2HYGD

The structure of apo-mntr from bacillus subtilis, native form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
total genus 40
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
D PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hygD01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hygD02
2Z3YA 1XCVA 1ZLKA 4IHSA 2OU2A 4HLXA 2FBKA 2PJPA 1DDNA 3TGNA 3QU3A 2ZCWA 4CO8A 5BPDA 1I6XA 2M30A 5LHGA 4OMYA 5HS9A 5LGNA 4MEXF 4E70A 3GLXA 2GIVA 3ZMUA 1OPCA 1LJ9A 1S7AA 1ZYRF 4G6QA 3ZQ7A 3MZHA 5FFXA 2V1XA 3GVAA 2E7WA 1MKMA 1IRGA 4HF1A 1HSTA 1WRJA 1FBQA 3QAHA 4XSXF 1U5TB 1ONVA 2XAGA 3GO5A 5E8IA 1LB2A 2DK5A 1JHFA 2CWEA 3QPTA 3DQVC 3V8LA 4HV6A 3ISPA 1TBXA 4A5NA 2HWVA 2M87A 5DUKA 4EGZA 2KKOA 1L3LA 2GZWA 1USSA 5LHIA 2JPCA 4GO1A 1ZHFA 1OYIA 4RS8A 3HUGA 2RQPA 4AD9A 2RC4A 2OBPA 3MQ0A 2EV6A 4Y17A 4HDUA 3ZMZA 1R58A 3NQOA 5ICFA 3K9TA 3REOA 1AWCA 3VOEA 2HR3A 1GXPA 1FSHA 1F9NA 4ETSA 4LK1F 2O0YA 5CVVA 1KYZA 3JTGA 1BIAA 4MQ9F 1BJAA 2D1HA 1SFXA 5D4SA 3BOQA 1U5TC 4BAYA 2HS5A 5DCMB 2FMLA 1QZYA 3AAFA 4LG0B 4ZYEA 1YW7A 3WTTC 4DQ2A 1R5GA 3IRRA 3O3KA 4O5VA 5TJJA 3FWEA 1YQAA 5E1XA 2P5LC 2NNNA 5E8GA 3F8CA 4KIBA 1WKMA 1C0WA 2DFIA 5E17F 1LEAA 2QVOA 3KZYA 3B02A 3BWGA 2P7CB 1MGTA 4LLLA 2PI0A 2WV0A 4N9IA 5ILVA 1PUEE 3SHFA 2H6BA 2HTJA 4A5MA 3ERED 3T5XA 2X0LA 2VODA 1YIOA 4MTEA 3CJNA 2GQQA 1FNNA 2GA2A 1FWZA 1X3UA 2IT0A 1SFUA 2W85A 1S29A 2OZ6A 1DPRA 2DPDA 3F3XA 3R60A 3KLOA 3KP2A 5IT9Z 2MA3A 5DD8A 2Z9OA 3F8MA 3LSTA 1OMIA 4EQQA 5LGTA 1R5HA 1ZRDA 2O3FA 3WU1B 5HS8A 2DAOA 3ROUA 1FYLA 4GGGA 3I5UA 1O3QA 2VBWA 3N4MA 3GW2A 2BBYA 3CTAA 4U0VA 2QQAA 3G73A 2QQBA 5EEHA 3DV8A 1ZG3A 1YO5C 2QQ9A 1KU2A 2ZNYA 1XSXA 5A2QK 1FT9A 4BH9A 2EV0A 2OAZA 3HOSA 1FP1D 1P6RA 2PBIA 2HDCA 1SD4A 2K4BA 3ZN1A 1Z7UA 2LDUA 3TO9A 4OINF 4HOBA 5BPIA 1R7JA 2IPQX 3GF2A 4YIIA 4A0YA 3T0YA 4K2EA 2HOEA 2VBZA 4H0EA 2ZJ2A 4IHTA 2STTA 3V7SA 3H3UA 3DF8A 1RIOH 2ZO4A 5D8LB 1T38A 5KK1A 2HQRA 2YX7A 1ZN2A 4PDKA 2E1NA 4EJTA 4P5OA 5ICCA 4KUMA 2LSOA 4EJOA 2LNBA 2V9VA 2JRTA 3K2ZA 3R0AA 4XBFA 4IJAA 5L3DA 3JSOA 5FO5A 1R1VA 1FLIA 4L9JA 3ABUA 2H6CA 3FMSA 4RAYA 5DUIA 1ZLJA 3V4GA 1ZREA 1P4XA 1Z6TA 1DUXC 1KQ0A 3KCCA 2XUBA 2ZMEA 1WSUA 4KFCA 3BROA 4RB0A 4ENNA 3FX3A 1MDMB 2Q2EA 1UB9A 5BQTA 3RIRA 3V7CA 3BJOA 3WTYC 3ZPLA 3LQQA 4G7OF 6PAXA 4UXNA 1BM9A 3GZ5A 2VE9A 2EFWA 4B09A 1HQCA 3QRFF 3EDPA 2QWWA 3DEUA 5JHUA 4UV8A 2QBYA 1ZG1A 1L0OC 1FP2A 3LA3A 3HHGA 5E1ZB 2XV4S 2O6GE 2IRFG 3I0TA 3QOPA 4I02A 3TO7A 1KQ9A 2P5KA 4OIPF 3E5UA 4L9NA 4O6JA 5E1WA 1K6OA 5LGUA 1S8NA 1LDDA 2DO7A 3U9GA 1D8JA 4GYIA 2PMUA 3WTVC 1AOYA 2O03A 5JR3A 1HKSA 4M9SA 1K7AA 3TDUC 3P7NA 1B4AA 2XAJA 4L9VA 1IXSB 1W7PD 3F8FA 4U7DA 1TNTA 3KE2A 3TOBA 1K78B 2L4MA 2E1CA 3FXUA 4UVBA 2YX4A 1KU9A 2H09A 1XSVA 2Y48A 3QP6A 3CUQB 2XKPA 3IKTA 3ZMSA 1ON2A 3FM3A 3O6BB 4DNCA 1U6GA 3P9CA 4RGUA 2A6EF 3HSFA 2RGVA 4NQWA 2VN2A 1TQPA 3D5LA 2D2WA 4EMSA 5DV5A 4HBLA 2K02A 1O7LA 2P6TA 5FB2A 2UXXA 4OIQF 2VOPA 1JGSA 3K1MA 5FD6A 2YU3A 1TQMA 1QBJA 5CVUA 1IRFA 2F5DA 5L3GA 1GXQA 2RV8A 4NB5A 1E2XA 4TV7A 4N9HA 3FZVA 3IL2A 2P7VB 2FU4A 5HVQC 4WXCA 2UXNA 4R1HA 1TQIA 2FXAA 2O61A 2BV6A 1TW2A 2IJLA 1B9MA 1OYWA 4HQEA 1WI9A 2NYXA 3WGIA 4LGWA 1I1GA 1B59A 3HSEA 4HAMA 1QQIA 3GUDA 5J8FA 1YLFA 4JQFA 4YFNF 2HZTA 2LF7A 2QUFA 1W7PB 2XGXA 4RAZA 3CUQC 2VC1A 2UZKA 1MZBA 4OIOF 4KMUX 4A6EA 2BE5F 3T1BA 3L9FA 1FSEA 3BJ6A 3PQKA 2RVCA 5D8KB 1Q1HA 2E7XA 1STZA 1G3YA 4G6DA 3CO7C 4WWCA 4ESBA 5LEJA 3KFWX 4ZYDA 2R7DA 3PQJA 4AIKA 4BNCA 1YFHA 1ZRFA 3HIFA 4HW0A 1IF1A 2JTVA 2GAUA 2P4WA 3GFJA 3KEQA 3M8FA 3OV8A 4P9UA 1BIBA 2HGCA 3HSRA 3E6BA 4KN4X 4YFXF 4MGRA 3JW4A 3ZMDA 5FLXK 3COAC 2FQ3A 4KNYA 4R79A 1YW9A 1FZPB 3TKYA 3C3WA 2W57A 4LB6B 3DPTA 1ZGJA 1LDJA 4L0YB 3G3ZA 2XRNA 4PGHA 2W24A 4QWQA 4AIHA 1J0RA 2XVCA 4XLPF 4NHJA 4A2UA 1VTNC 3CLOA 1BI1A 3MWMA 5FLXZ 3F8BA 2OQRA 1I27A 4KIFA 3WTSC 2FRHA 1BOAA 1IN5A 1EV7A 2HKOA 3GYHX 1ZRCA 3EYIA 5F1RA 2A69F 4Y13A 3E6DA 3M9AA 2VT3A 4EJUA 1T0FA 2KRFA 5KVRA 4PZJA 2H94A 1MJAA 4LK0F 1HXDA 5ERIA 1HKQA 2MC3A 5DYMA 2OZUA 3V8KA 4EV0A 2XAHA 4KIGA 1JE8A 1IUYA 3LA7A 5HDGA 3C7JA 1U5TA 2IA1A 2Z99A 1HBXG 4G94A 2G7UA 3RDIA 5ED4A 4RGRA 3I4PA 3MZYA 4ESFA 2FNPA 2MH9A 3VEPA 4Q48A 5H20A 1SD6A 3ZN0A 3VODA 2DBBA 2PMHA 1NHAA 3B73A 4PCQA 5JVTA 1FC3A 3R6SA 5CJ9A 5AONA 1F1ZA 3WU0A 3VFZA 2JPBA 1Z91A 1QNTA 3TO6A 1QPMA 2L4AA 5IT9K 3GWZA 2Y0MA 2O8XA 2STWA 1YYVA 1KU7A 2PG4A 3IWZA 4HDVA 2CQKA 3ML6A 2IW5A 1HW2A 1O7FA 3RPQA 1B6AA 2KIUA 4M73A 1IN4A 2GXGA 5K1YA 2VOOA 4XLNF 1U8RA 4EGYA 2IA2A 2ZFWA 3F8NA 4U0YA 3WTUC 4O3MA 3H3ZA 3CDHA 3LAPA 3I54A 4D0PA 3IC7A 3HHHA 3BY6A 2DU9A 3KETA 5DCMA 5LBQA 4LG0A 4IPAA 3F22A 1RZ4A 3EETA 2RNJA 3W6JB 1R36A 5J8CA 5ILSA 1ZGAA 4IRIA 4Q4ZF 4A0ZA 1FYKA 5K5OA 4LJZF 1R1UA 3KP6A 1YG2A 1BI0A 3E5QA 1OR7A 3JSPA 3I59B 1P4WA 4ZZDA 2FMYA 4YFKF 1RUOA 1SMYF 1UCRA 5CLSA 1HW1A 2QM3A 3W6KB 2Z33A 2PQ8A 2EV5A 3QPHA 4BQAA 1FYMA 5LRSA 1T6SA 1JXSA 1P92A 4I7HA 2DW4A 2ISZA 1FY7A 4GXOA 3Q9SA 2QYOA 1R00A 3NEUA 1EH7A 2GWRA 3MCZA 3F6OA 2OQGA 2EFPA 4P9FA 2VONA 4HZFA 2ADUA 2VBYA 3F72A 3P9IA 1K79A 3WTXC 3N97A 2VE8A 3LWFA 5L3EA 5FGMA 4LB5A 3KLNA 5F64A 2XIGA 5L3FA 3L00A 2NS0A 2L3DA 4BHPA 1ON1A 4UV9A 4CICA 4WK8F 3FM5A 3BDDA 2BEOA 2OD5A 4FT8A 2ZBKA 2NRAC 1LEBA 1CF7B 1QGPA 3RJPA 3F23A 3SFZA 4G7HF 1ZG5A 4HX4A 3Q9VA 1H9TA 1B1BA 2XAFA 1FOKA 3HRTA 2JZYA 3MAJA 1U2WA 1G6NA 1B9NA 1GVJA 4BYYA 3K1PA 3T8TA 2MLKA 1A04A 4KA4A 2EA2A 1YTYA 3J81Z 1REPC 1XDSA 1BN5A 5ICGA 1G4DA 4FX0A 2ZKZA 4ENKA 2AXLA 5CVRA 4WXDA 1PP7U 4F7ZA 3RTRA 3ABTA 3R4KA 2B0LA 5E20A 3RYRA 3T8RA 1G3SA 4U0WA 2CSOA 5D6FA 3WE2A 2YSRA 3FHZA 1WWXA 3E6MA 4ENJA 1TNSA 2X4HA 2EFNA 3HTUA 2M45A 4PGGA 1HKTA 2IP2A 3ZMTA 5BMZA 1IW7F 2Y75A 5HLIA 2FNAA 3DFGA 3R0JA 4OIRF 1IXRC 4OU0A 2EJRA 2KJCA 4ZZLA 1O57A 4AWXB 4OMZA 1BC7C 3J80Z 1E17A 1ULYA 4UVAA 2GA1A 2ACJA 2FE3A 4HV5A 4L5IA 5CVJA 1MDMA 4M6XA 2A3SA 2FF4A 1HSJA 2IVMA 2DI3A 1J59A 3JTHA 3KEOA 3OOPA 4I0AA 2PFBA 2HYGD 1XMKA 1D8KA 2C6YA 4HA8A 4RGXA 4QLCU 5K5QA 1BBYA 2M8EA 4EJVA 2J5PA 4U7BA 2EA4A 4RB1A 5IT3A 1R22A 2NNYA 1J9IA 1IN6A 3U2RA 3WGHA 2KIMA 1FBSA 4KDPA 3EUHA 4N0BA 3QP5A 4MQVA 3WG9A 5BS6A 1OKRA 1XN7A 4CGZA 3E97A 4YG2F 1IN8A 2XROA 1QZZA 5LHHA 3KZZA 4YIFA 4EJWA 3DPLC 5D4RA 4UNOA 2XAQA 3RKXA 3IKVA 3ECOA 3BPVA 1K78A 3TDZC 4B8XA 3MFKA 4WX9A 4CXFA 3GFLA 4Q5SF 3CUQA 3R61A 2PEXA 2ESNA 4I98B 4WXHA 4CDGA 1J5YA 5JI6A 3WE3A 2BGCA 3FXRA 2MLGA 5DDGA 4OOIA 1IZ1A 1IXCA 4ASNA 1HW5A 3WODF 1ZAOA 4HF2A 4U88A 4AVPA 3I71A 4L18B 2EFOA 1Z05A 2L01A 1G3TA 2ZXJA 4WCGA 1J7KA 1I1SA 3RYPA 5D5WB 4HYEA 1F5TA 4A12A 3BJAA 2DPUA 4GYGA 2WWYA 1V3FA 2FEZA 2G9WA 3LA2A 2HFHA 1D5VA 1XDUA 2M1BA 3WTWC 3E5XA 4UUVA 3SQNA 4EVIA 1S6LA 2P8TA 3VB2A 2XKOA 2CFXA 2VC0A 1KQ8A 2M5WA 5AIPA 1S3JA 2XHKA 4KYWA 4A6DA 2V1DA 3I64A 1BI3A 2CYYA 4KT5C 5CYVA 2UWMA 2JSCA 3HTSB 3FF5A 4G7ZF 3LAJA 1W7PA 3V8JA 3ELKA 3ECHA 4HF0A 5LLQA 3ZP5A 2JT1A 1U78A 1Z6RA 2MD5A 5BOXA 4MNUA 4UHTA 1UHMA 3K1NA 5ILUA 4HLYA 5HOOA 2A61A 1LVAA 2DLLA 1LQ1A 2V79A 2DT5A 4XSZF 5HLHA 4ZYGA 2BYVE 1KA8A 4ON0A 1TW3A 5E18F 1P2FA 1G3WA 2KIFA 4RB3C 3KP7A 3E3VA 2YPRA 1XGSA 3F21A 1PDNC 2DQRA 1SD5A 3HYIA 2ETHA 1EH8A 3MEXA 1SAXA 5FFZA 1UHWA 5HS7A 4EM1A 1SD7A 2VT2A 1O3TA 1I5ZA 3O2PE 2DK8A 1OYYA 2A07F 1JHHA 2L54A 4UVCA 4I01A 3M8EA 2F5EA 2FSWA 2EB7A 2H27A 3L7WA 1P4AA 1XB4A 3GX4X 4HX7A 2VXZA 4ZYHA 3H92A 1S7OA 2HKXA 4LFUA 2QLZA 3P9KA 4FHTA 4M9ZA 3D0SA 3IHUA 1O3SA 3ZMVA 3HRMA 4A0XA 3M7GA 3FMRA 2Q0OA 4S05A 1WQ2A 2GXBA 3F6VA 1T39A 2XASA 3GXOA 2LKPA 4FX4A 2W25A 4IRHA 1LNWA 1W4MA 2EWNA 2FBHA 4M6YA 4HX8A 4ENMA 4MTDA 5D5UB 5H6QA 2A68F 2IA0A 1ZH5A 1YS6A 3J7AO 5HDKA 1H0MA 2TDXA 2F5FA 4S04A 2A5YB 2D1VA 5D5VB 3BP8A 3K69A 4L0ZB 4IRGA 4AIJA 2Z5UA 1Z1DA 1J2XA 1LDKB 2MH2A 2ISYA 2W84A 4KICA 5J6XA 1O3RA 1KGSA 2DTRA 3PFIA 5HLGA 3BPXA 4JK1X 2ZNZA 1DP7P 3K0LA 3V7RA 4EM0B 2RN7A 2Q8KA 1FX7A 3TOAA 2CG4A 5LEKA 2A6HF 2WC2A 4BHBA 2R3SA 2ZMEB 5D5XB 2F5CA 3E6CC 1R23A 3GFMA 1U3EM 4IVNA 4MHGA 4LLNA 4P96A 2RDPA 3SXYA 2LF8A 4L9TA 2WTEA 3IWFA 3L2CA 2QENA 5K5RA 3HRSA 2YR2A 2FOKA 5EEGA 3FXQA 3GFIA 3KP4A 3SZTA 3LQRA 3WGGA 2HTSA 4I2OA 3HRUA 1RUNA 4CHUA 1EH6A 3CO6C 3LFKA 2D45A 2PN6A 3TQNA 4LD5A 2EFQA 4Y15A 4G9YA 5FD5A 4I0BA 5A2QZ 4KMFA 1T98A 5F6FA 3JAMK 2QBYB 2NAZA 1W5SA 1SMTA 3M1EA 1MJ9A 5AIQA 3C18A 4MEYF 1F4KA 2R7FA 4EM2A 4ZH4F 3QU6A 2K27A 4Z2YA 4M74A 3RKWA 3J81K 5JFRA 2HQNA 3GZ6A 2PLYA 2CO5A 3WTZA 3JAMZ 3I59A 1ZARA 1BC8C 4I09A 4JBAA 3ULQB 5HDNA 3RKYA 3EYYA 5CVIA 3U1DA 1YS7A 2G7HA 2P5VA 2FBIA 3IRQA 4RGSA 2K86A 4LMYA 5L3CA 3RI4A 5LRRA 2K7LA 1T2KA 4GCVA 1W5TA 5DCFA 4Q47A 2HEOA 5H6RA 1XSDA 1BI2A 5L3BA 3J80K 3C1DA 1RNLA 1Z9CA 1KU3A 1R1TA 4KN7X 4XRFA 3CUOA 4M72A 2MBFA 1H9GA 2CW0F 1MJBA 3L09A 1USTA 3HOTA 1GHCA 3BZ6A 5ICEA 4BXUA 2HYFA 2ESHA 1Y0UA 1V4RA 1CF7A 4M71A 1YW8A 2DQLA 2OA4A 4L5JA 4CYDA 2CGPA 1CGPA 1KYWA 4LLGF 1SFEA 3Q5FA 3RPUA 2K4JA 1QO0D 4P55A 3DXJF 4R8HA 4WF2A 4RB2C 2KJBA 1FPQA 3I58A 1UFMA 1MD0A 3SZPA 1IN7A 1FBUA 1TTYA 2VBXA 4CZZA 2J5OA 4HQMA 1PP8F 1ODDA 2L02A 5DD4A 1D3YA 1XMAA 5DEQA 2F2EA 3EQLF 1XD7A 2V6CA 1DPUA 3S2WA 1XCBA 3DKWA 2V1UA 1IAWA 1XGMA 3DP7A 2COMA 4BHCA 4IXAA 4IF4A 1RI7A 3GEZA 3KP5A 1J75A 1XGNA 4G8XA 4M9XA 2QZ8A 3I53A 3NRVA 1XGOA 2EK5A 2P6SA 2ELHA 3FMQA 1TLHB 2RKHA 5D6EA 3KP3A 2FA5A 5TRDA 2AS5F 4ESJA
chains in the Genus database with same CATH superfamily
4F91B 3CMYA 2LRDA 2Z3YA 5EYRA 3JRBA 5HNHA 1JKOC 3OL4A 2VQHA 1XCVA 1TZLA 2K9LA 2K85A 3BR2A 4D5CA 1ZLKA 3H35A 1JTXA 1QPIA 1BR2A 1X3ZB 4IHSA 2ZJQF 1YJ9I 2OU2A 2GIZA 4HLXA 1PUFB 2FBKA 2M8GX 2WBMA 3B6CA 2PJPA 3SEZA 1DDNA 1Y6IA 3TGNA 4BJ6C 3QU3A 2ZCWA 2DYRH 3RSNA 2WB1N 4V19K 4CO8A 3B6AA 5BPDA 2FJ1A 3CJRB 1I6XA 2M30A 3VPRA 4J01A 5LHGA 1XPXA 1VQ6I 2IS4A 1JJ8C 4AYBN 3SDGA 5EZGA 3JRGA 4OMYA 1V55H 3CESA 3CQZJ 3BG7A 3DBLB 1G2HA 5HS9A 5GAGJ 3OIPA 5LGNA 4MEXF 1VNDA 2LBFB 4E70A 3GLXA 1R4NB 2GIVA 5B1AH 3ZMUA 1OPCA 5F27A 3GCMA 1BR1A 1LJ9A 3LSKA 1S7AA 1ZYRF 4G6QA 3K4LA 3ZQ7A 2Y0SA 3MZHA 3G4SI 3S3OA 3S1RJ 5FFXA 2V1XA 3GTJJ 3GVAA 1O4XA 1MMSA 2E7WA 1BA5A 1MKMA 1VQLI 1IRGA 4NC7A 4HF1A 3I4MJ 1HSTA 3H1CA 2CW7A 1WRJA 1FBQA 3QAHA 4XSXF 1WJ5A 1U5TB 4KISA 1ONVA 2XAGA 4RM3A 3OMYA 3GO5A 1DU0A 2F5VA 4BEHA 1A5JA 5E8IA 1LB2A 3HOYJ 1WGXA 2DK5A 1JHFA 3IV5A 5CPRB 4YIRX 2ID3A 4LOCA 2LFBA 4XOTA 2CWEA 4XICA 3QPTA 4XNFA 1Z3XA 1JT6A 3DQVC 3V8LA 3FHNA 4M3GA 3BTJA 4HV6A 3ISPA 1TBXA 2KPMA 2XB5A 3S3NA 1Z67A 1YX3A 2E36A 4A5NA 2HWVA 2M87A 3PJRA 1MH4A 5DUKA 3H36A 4EGZA 2KKOA 1L3LA 2GZWA 5KCMA 1USSA 2EZIA 5LHIA 1T56A 4C3JJ 4ZDLA 2JPCA 1F36A 3HB9A 1SVMA 4GO1A 3OYDA 1ZHFA 1OYIA 5FKMA 4RS8A 3HUGA 4QSHA 3W3CA 2RQPA 1VQ9I 4AD9A 2RC4A 2OBPA 5GTHC 1BOBA 5CQGA 3MQ0A 5FRMA 1MBEA 3AG1H 1UG0A 2EV6A 4Y17A 4HDUA 1GLNA 3NAUA 3ZMZA 4PFPA 1R58A 3S1QJ 1W5CC 3H9QA 4F52A 3NQOA 3L2VA 5ICFA 3K4NA 3K9TA 4QPQA 2DT6A 2GOMA 4AUXA 2QQ8A 3REOA 1AWCA 3LFUA 3VOEA 1JT0A 4D7MA 2HR3A 2WAFA 4CSWA 3GTQJ 1Q1VA 3HOWJ 1GXPA 3G1OA 5KAFC 2PMZA 1FSHA 1F9NA 4ETSA 4PSXA 1QVTA 4LK1F 1KZHA 2HOAA 2O0YA 2HXIA 4CUGA 5CVVA 4I6ZA 1WJBA 1KYZA 2XPWA 4JX6A 1BIAA 2HDWA 3JTGA 1MMGA 1G59A 4MQ9F 3A02A 2ZXWH 4PJJA 1BJAA 2D1HA 4ZYAA 3FXOA 1SFXA 3S8PA 5D4SA 5J1UA 3BOQA 1U5TC 4BAYA 1EKEA 2KL4A 4A3IJ 4M3DA 2HS5A 2E19A 2FMLA 2LKSA 5DCMB 1QZYA 3AAFA 4LG0B 4ZYEA 4AC0A 1YW7A 3N05A 2EPFA 3LSRA 3WTTC 3G6EI 3S14J 4DQ2A 1R5GA 3IRRA 3O3KA 4O5VA 5TJJA 3CCSI 3FWEA 1YOVB 1YQAA 5E1XA 2P5LC 4D7NA 2NNNA 1AKHB 3U21A 4B47A 3MKYB 2FD5A 2K40A 5E8GA 3H5AA 4GRIA 4CCJA 3J7AW 5J4VA 2JA7J 1BJZA 3F8CA 2X98A 2L9VA 4KIBA 1WKMA 1C0WA 2DFIA 5E17F 3M07A 2FOWA 1WPKA 1LEAA 2QVOA 2NOGA 4X1EA 5DTDA 5F04A 3RZOJ 3MZ8A 3K4BA 3KZYA 2IS1A 3B02A 1P7JA 2KT0A 1K61A 2H1KA 3S3MA 3BWGA 2P7CB 3KYLA 1MGTA 1SANA 4LLLA 2R7OA 4FISA 1K4TA 2PI0A 2WV0A 3VSKA 4N9IA 5ILVA 1PUEE 5IP9J 3SHFA 2H6BA 3DWLE 2HTJA 1WJEA 2BXYA 1RETA 4DGWB 1VI0A 3RZDJ 2HDDA 4A5MA 3ERED 4CCKA 3CCQI 3VWBA 3T5XA 2X0LA 2VODA 2OCEA 1YIOA 5EG0B 5KNLA 4MTEA 1HDPA 3CJNA 3DBRB 2GQQA 5GPCA 1FNNA 2GA2A 1BW6A 1FWZA 4BE2A 1X3UA 2IGNA 2IT0A 1V5FA 1SFUA 2W85A 1S29A 2OZ6A 1DPRA 3A2KA 2DPDA 3F3XA 3R60A 1MBJA 1SFKA 2LOOA 3KLOA 3KP2A 5IT9Z 2QEXI 2MA3A 1HF0A 3KYCB 2VKHA 5DD8A 2Z9OA 3F8MA 3LSTA 1OMIA 1ETWA 4AVZA 4EQQA 5LGTA 1WVRA 1SVLA 5TGTA 1R5HA 1ZRDA 2LR8A 2HPIA 2O3FA 2MYSA 2COBA 3GZNB 3M8JA 4XQFA 3WU1B 1FTTA 5HS8A 3OYBA 3DCFA 2DAOA 3AG2H 3ROUA 4UUSA 4BY7J 1FYLA 4GGGA 3I5UA 5F1JA 1Y8QB 2DA4A 3CMMA 3ESWB 1LFBA 3DU5A 1O3QA 2VBWA 4II3A 3RPUD 3N4MA 4P1WA 5IYCJ 2KIQA 3GW2A 2BBYA 3CTAA 4BBSJ 1MBFA 2DT7B 4U0VA 4G12A 3OYLA 3HM5A 4DZPA 2QQAA 3G73A 1X1AA 3H0DA 1IO2A 2QQBA 5EEHA 3IH3A 3DV8A 1ZG3A 1YO5C 1WI3A 2QQ9A 3BZKA 1QA6A 1X4PA 1WFXA 1KU2A 4CH7A 2E34A 1XSXA 2ZNYA 3HXLA 5A2QK 1FT9A 2EZLA 1WH5A 2EV0A 4BH9A 2HQ5A 2OAZA 5TISC 3HOSA 1FP1D 1P6RA 2MFZA 1U9NA 2PBIA 1VQ5I 2HDCA 1SD4A 1YX5A 1LFPA 2K4BA 2W48A 1TP4A 3ZN1A 1Z7UA 2LDUA 3TO9A 4OINF 4HOBA 5BPIA 1R7JA 2IPQX 3GF2A 4YIIA 4E7IA 3S93A 3BQZA 4A0YA 3LSGA 1LFUP 3RKQA 3T0YA 1JUMA 2KMUA 2JUCA 3DTEA 4K2EA 3OYHA 2HOEA 2VBZA 4H0EA 1ITYA 2ZJ2A 3TMOA 4IHTA 3FBIB 1EJ9A 1YI2I 3A0HC 2STTA 3K4CA 4XKVA 3V7SA 2WB1A 5M5YJ 3H3UA 1OJLA 3DF8A 3AL0B 1Y56A 2K9QA 1RIOH 2ZO4A 4AM3A 1N78A 4NNJA 5D8LB 1T38A 1I6HJ 5KK1A 2HQRA 3TW6A 1F43A 4V2GA 2YX7A 1ZN2A 4PDKA 2E1NA 3H5RA 4A3FJ 5K7ZA 2RNGA 4EJTA 5FKNA 4P5OA 1Y0NA 2LSOA 4KUMA 4EJOA 5ICCA 2VQCA 3W2WA 2LNBA 2K3FA 2V9VA 2JRTA 3K2ZA 3R0AA 4XBFA 2HNHA 4IJAA 4NUBA 5GP9A 3S15J 3O8GA 5L3DA 2KZGA 3JSOA 2P81A 3UKGA 5FO5A 1R1VA 2DJNA 1FLIA 2BY1A 5C4XJ 4L9JA 1LKXA 3ABUA 2H6CA 3FMSA 4RAYA 5DUIA 1ZLJA 1W0UA 3V4GA 1ZREA 1A6QA 1P4XA 3K70C 1Z6TA 1I50J 1DUXC 5EF6A 1KQ0A 3KCCA 1P9QC 2XUBA 2ZMEA 2DYSH 1WSUA 4KFCA 3BROA 4RB0A 3AG4H 4ENNA 2ZMEC 2EBIA 3ABKH 3CLQA 3CCLI 3FX3A 2BOLA 3S17J 4CYCA 5M3FJ 2DOEA 4PUSA 4Y4RA 1MDMB 3J7ZI 2Q2EA 1XTAA 4AU7A 1UB9A 5BQTA 1N77A 1IV6A 3RIRA 1LPQA 2LY1A 3P5JA 3BCAA 2BW3B 3V7CA 3BJOA 1VQKI 4XLCA 3OSGA 2M35A 3WTYC 1RKWA 3HEFA 1FEXA 3KIOA 3ZPLA 3LQQA 5KAIC 4XLHA 1RR8C 2JVGA 3HG9A 4G7OF 1Z77A 6PAXA 4UXNA 1BM9A 5EGOA 3GZ5A 2VE9A 2EFWA 1FMWA 4XLFA 4XM3A 1TWAJ 4B09A 1OLTA 2DTZA 2E1OA 1HQCA 2DDAA 3QRFF 3EDPA 2QWWA 2VXDA 4F55A 4F93B 3DEUA 5JHUA 4UV8A 2QBYA 3D5SC 1KONA 3KPHA 3QODA 1ZG1A 1L0OC 3PIPF 3PFYA 4ITVA 1FP2A 3IAM2 2E1MC 3LA3A 3HHGA 5E1ZB 2XV4S 2O6GE 2VASA 2IRFG 1T95A 3I0TA 3A01B 3LOCA 3QOPA 4I02A 3TO7A 1KQ9A 1NK3P 2P5KA 4OIPF 3HOUJ 2OUMA 3HOZJ 1WZ2A 1JJ6C 5IPAA 4F92B 3E5UA 2AQEA 5F0FA 4L9NA 4CCLA 4O6JA 1VQMI 5E1WA 4BUPA 1K6OA 5LGUA 3M3YJ 2CQ7A 4E6KG 1S8NA 1AHDP 1LDDA 2DO7A 3BT9A 3SFIA 3U9GA 1DGRM 1D8JA 2CUJA 2DFFA 4GYIA 2OPTA 2F48A 4MLOA 3VDXA 5E3OA 2PMUA 3WTVC 1OCPA 1AOYA 3DEWA 2O03A 5JR3A 1HKSA 4M9SA 2JQ7A 9ANTA 2LTPA 2JRMA 3JAMR 1K7AA 3TDUC 3P7NA 1B4AA 2XAJA 3IP4B 2XGDA 2R7TA 4L9VA 3UR3C 4D5FA 1IXSB 1Z7LA 1W7PD 3F8FA 4U7DA 1TNTA 3KE2A 3PO2J 2MUNA 3DTIA 3BTIA 2VIXA 3TOBA 1K78B 2L4MA 3E7LA 2E1CA 1XX5A 2HZDA 3FXUA 1M1EB 1I3QJ 2YX4A 4RM2A 4UVBA 3J81R 1KU9A 2H09A 4PSWA 4XORA 3ZCOA 1XSVA 2Y48A 3QP6A 3CUQB 4XONA 2AQFA 2XKPA 3IKTA 2VKDA 3ZMSA 2BY3A 1ON2A 3FM3A 2NS8A 3O6BB 4DNCA 1U6GA 3P9CA 4FE7A 4E7SA 5J1YA 4RGUA 1HA8A 2A6EF 1FOYA 2WADA 3HSFA 2VJ4A 2XGCA 2JJ7A 2RGVA 5GPAA 2HVSA 2BHYA 4NQWA 2VN2A 3S2DJ 1WJAA 1PJRA 2KP6A 2WA0A 1T08B 2R5ZA 1TQPA 2R0QC 3D5LA 2D2WA 4PJLA 4XKWA 4EMSA 5DV5A 2VUMJ 4HBLA 5B5EC 2DODA 2K02A 2ME6A 1TWHJ 1O7LA 2P6TA 5FB2A 2UXXA 4OIQF 2VOPA 1GDTA 1JGSA 1QZEA 3K1MA 1Y39A 5FD6A 2YU3A 1TQMA 1QBJA 2BXZA 4HPQA 3A03A 2IEKA 4I99C 5KHDA 5CVUA 4C2TA 1IRFA 2EZHA 2F5DA 3MD2A 5L3GA 2Z1DA 3CCYA 2L2OA 5IOZA 1GXQA 2RV8A 2DA5A 2DFEA 1PVEA 4NB5A 1E2XA 4TV7A 2VKVA 4N9HA 1GV5A 3FZVA 1K6YA 3IL2A 2P7VB 2FU4A 5HVQC 3J80R 2R7ZJ 2WY8Q 4WXCA 2UXNA 2RREA 4R1HA 1TQIA 2FXAA 3MKZA 1NK2P 1IRZA 2O61A 2BV6A 1TW2A 2IJLA 2LYCA 1T33A 2L9RA 1B9MA 1OYWA 4HNVA 4IHVA 4HQEA 2IXSA 2NVYJ 2PX9A 4XLEA 1BL0A 2GBYA 3MKWB 1WI9A 2NYXA 3WGIA 2R7VA 3ZQHA 4LGWA 1I1GA 3AKZA 2XC7A 1NTCA 1B59A 2Q1ZB 3QPLA 3IH2A 3ZQIA 1V54H 5J47A 1QRYA 2DA3A 2WAQN 3HSEA 3NWTA 5IOYA 4HAMA 4FTHA 2ZB9A 1QQIA 3GUDA 5J8FA 1YLFA 2ZFUA 4JQFA 4YFNF 2HZTA 2LF7A 5B66C 2QUFA 2W7NA 2DOAA 1W7PB 3S1MJ 2XGXA 4BJ5C 4RAZA 2M0MA 3CUQC 3C2BA 2P0TA 1S72I 2VC1A 3QQAA 1JI8A 2UZKA 1MZBA 3W2AA 3TBIA 4KMUX 4OIOF 4A6EA 3JRCA 2BE5F 3T1BA 3L9FA 1FSEA 3OS0A 2CQQA 3BJ6A 3PQKA 1MMDA 3KX2A 2RVCA 5D8KB 1Q1HA 2CS3A 2E7XA 1UJ8A 1STZA 1G3YA 4G6DA 3H0GJ 4LG3A 3UNGC 3CO7C 4WWCA 5J40A 4ESBA 5LEJA 2Z16A 1ZTRA 2OV7A 3ZXSA 3KFWX 3EUAA 4ZYDA 4RDUA 2R7DA 1X58A 2M7BA 3PQJA 4AIKA 4BNCA 1YFHA 1ZRFA 3GLLA 3HIFA 4HW0A 1IF1A 2JTVA 3Q0WA 1IG7A 2GAUA 2P4WA 3GFJA 3KEQA 3M8FA 3OV8A 3SZGA 1ZR4A 1SFOJ 5IYDJ 4P9UA 3HOVJ 2KISA 2XGEA 4BE0A 1BIBA 1WJCA 2HGCA 5FJ8J 1U8BA 2HYJA 3HSRA 3E6BA 4NBQA 4KN4X 4Y33A 1RC9A 1YRNA 4YFXF 1SVOA 3CCUI 1Z3YA 4MGRA 3EUKL 3OYIA 4IOAF 2W82A 3JW4A 1N25A 2CUEA 3ZMDA 5FLXK 1ETKA 3FXKA 3COAC 2FQ3A 4KNYA 4R79A 2JMWA 1YW9A 2K9MA 1FZPB 3TKYA 3C3WA 2W57A 2ZXIA 3FDYA 4LB6B 2IS2A 3OYAA 2XRLA 4XN0A 3DPTA 1WJFA 1ZGJA 1LDJA 4M3BA 2KZVA 4L0YB 3G3ZA 2XRNA 3HPGA 5JLXA 2Y2ZA 4PGHA 2W24A 3ABMH 4QWQA 1RESA 4AIHA 1PUFA 1J0RA 2QA4I 1ERDA 2XVCA 4BS9A 4XLPF 4NHJA 4A2UA 5F0CA 2CQXA 1VTNC 3CLOA 1BI1A 3MWMA 3JRAA 5FLXZ 4BXFA 3F8BA 2P0WA 2F4MB 3DKXA 3J7YJ 1OCRH 2OQRA 1I27A 2M7AA 3MVPA 1X1CA 4KIFA 3WTSC 2FRHA 1CQTA 1BOAA 5DM7F 1IN5A 1EV7A 3V42A 2HKOA 2LY9A 3DKYA 4YRVA 1TL8A 5M5XJ 2Y9ZA 1SAUA 3GYHX 3K4JA 1ZRCA 3EYIA 3FKJA 5F1RA 2A69F 4Y13A 2R7SA 1DU6A 2LBFA 3ZQCA 1HOMA 3E6DA 3HGYA 3M9AA 1OISA 2JUGA 2VT3A 2AHQA 4EJUA 2M4KA 4YEJA 1T0FA 3D5RC 2KRFA 1UELB 5KVRA 4PZJA 1X3WB 3WG7H 1T0FC 2H94A 1MJAA 1MNEA 2DMNA 4LK0F 2M2EA 1HXDA 4LITA 3VYRB 5ERIA 1HKQA 2MC3A 5DYMA 1POGA 2CV1A 2OZUA 2MG4A 3V8KA 4EV0A 3OYJA 2XAHA 1MMNA 4KIGA 1JE8A 3LA7A 1IUYA 5HDGA 2Y69H 1IV8A 4XN3A 3C7JA 1TWGJ 1U5TA 4FCYA 4E7JA 1RRJA 3DEEA 2IA1A 1ETQA 2Z99A 1BW5A 1HBXG 4G94A 1TWCJ 2G7UA 3RDIA 1W36C 5ED4A 5HLTA 4RGRA 3I4PA 3MZYA 4W1UA 2R7UA 5H2FC 2CFOA 4ESFA 1A31A 5IP7J 4FE4A 2FNPA 1VQ4I 2MH9A 3VEPA 2EIJH 2V7FA 4Q48A 3ZOBA 3A1YA 3HKZN 2R5YB 3MN2A 5H20A 1SD6A 3ZN0A 5FLVA 4XOPA 3VODA 2DBBA 3H5NA 5J3LA 2PMHA 1NHAA 3B73A 3K6GA 4PCQA 3RQIA 5JVTA 4IHXA 3IAS2 1FC3A 3R6SA 2MD0A 4UUTA 4CCMA 3BC8A 2V4JC 5CJ9A 5M3MJ 5AONA 3CCMI 1F1ZA 3X2QH 3WU0A 2KDZA 3GTOJ 3VFZA 2JPBA 1Z91A 1QNTA 2VB6A 1FMVA 3TO6A 1QPMA 2L4AA 1E3HA 1MBKA 5IT9K 1ETYA 1X1PA 3HJEA 5IY5H 1MSFC 1D5YA 1FIAA 4DYRA 3GWZA 1D1CA 2DA7A 2Y0MA 2O8XA 2STWA 1YYVA 1JTYA 1KU7A 3LSJA 2E71A 2PG4A 3IWZA 4HDVA 2M4GA 4J00A 2CQKA 3ML6A 2IW5A 3BLYA 3OSFA 1HW2A 3G1MA 2ZSHB 1O7FA 3RPQA 2KQRA 3CDIA 5FRNA 4GFBA 1N75A 1XS9A 2E35A 1TWFJ 1B6AA 2KIUA 4M73A 1IN4A 4IQJA 2GXGA 2L7KA 5K1YA 2VOOA 4XLNF 2DA2A 2VJJA 3C2GA 3ZQLA 1U8RA 2MVTA 4EGYA 2IA2A 2ZFWA 3F8NA 4U0YA 3WTUC 4DW6A 2I10A 5B3SH 2WY7Q 4O3MA 3H3ZA 3K10A 4J19A 3CDHA 2L7ZA 3OY9A 3OYMA 3CMAI 1UAAA 3LAPA 2VQLA 3I54A 4D0PA 3IC7A 1QHGA 2XSDC 3HHHA 3BY6A 2DU9A 3KZIC 5DCMA 3KETA 5LBQA 4HSTA 4B48A 4LG0A 4IPAA 3H3VK 3F22A 1RZ4A 4AIDA 2ZC2A 3EETA 4HG2A 2RNJA 3W6JB 5J4YA 1R36A 5J8CA 5ILSA 1A36A 1ZGAA 4IRIA 4Q4ZF 4A0ZA 4RAGA 2A5WA 1AKHA 1Y8RB 2XF7A 1FYKA 1MMAA 4DZJA 5K5OA 1B72B 5F08A 2V26A 4LJZF 1R1UA 3KP6A 1YG2A 3FIWA 3L2WA 1BI0A 2B7EA 1SC7A 2MSYA 3E5QA 4PJ0C 4JX4A 1OR7A 3JSPA 3I59B 1AA7A 1HCRA 1P4WA 4ZZDA 1R71A 1ZGWA 2FMYA 1OR7C 4YFKF 1RUOA 2O9LA 2CMPA 2MC4A 1MH3A 2DA6A 3QYEA 2ID6A 4BU2A 1SMYF 1UCRA 5CLSA 1HW1A 2JVHA 2QM3A 2JA5J 3W6KB 4XRSG 3OYGA 2PQ8A 2EV5A 3QPHA 2Z33A 1NH3A 4HNTA 2V6EA 4BJTA 2ZXHA 4BQAA 3E1SA 1FYMA 2E2IJ 5LRSA 1T6SA 3OYKA 3ZRGA 5EG0A 4XIDA 1JXSA 1MW7A 2WAQA 2XAUA 1U9OA 3FXMA 5FKKA 1P92A 4I7HA 4A3BJ 2WV1A 2OTJI 1QVUA 2DMTA 1DQUA 1WCMJ 5DS9A 3A52A 1Z21A 2A05A 1X2MA 2DW4A 1B8IB 2ISZA 1FY7A 4GXOA 3VYUB 2Y0SN 1XG1A 3CDLA 3Q9SA 2M34A 2QYOA 2QKLB 4XR6A 4AYBA 1R00A 2ICWG 4V2FA 3NEUA 3HPHA 3RQ4A 1EH7A 2GWRA 3C2HA 3MCZA 4DJAA 3F6OA 2LH9A 2OQGA 2EFPA 1R5ID 2R7QA 3QYFA 4ZTFA 2G0EA 4P9FA 2VONA 4HZFA 4ZC3A 3H9JA 2ADUA 2VBYA 3F72A 2M9HA 3P9IA 1HLVA 3WTXC 3BTLA 1K79A 4NDLA 2ELKA 3N97A 1OCCH 2VE8A 3PNVA 3LWFA 4PJMA 5L3EA 5C3EJ 5FGMA 4BQNA 2Y30A 4LB5A 3KLNA 5F64A 2XIGA 5L3FA 3L00A 3CMEI 4A3GJ 2NS0A 4MFEA 2L3DA 1DGWY 4E7KA 3OR1C 4BHPA 1ON1A 1D0XA 4UV9A 4CICA 4WK8F 3SJMA 4IHWA 4IO9F 2KHMA 2HOSA 3FM5A 2GLOA 3OYCA 3BDDA 2BEOA 2OD5A 4FT8A 2ZBKA 2NRAC 1LEBA 3DU6A 1FIPA 1CF7B 1QGPA 3RJPA 1X2NA 3F23A 1WJDA 3SFZA 4G7HF 1ZG5A 2VJ5A 3Q9VA 1NG7A 4HX4A 1H9TA 3CCEI 1D1BA 2X6YA 2NVUB 1B1BA 2XAFA 2R92J 1FOKA 3HRTA 3I9V2 2JZYA 3MAJA 1U2WA 1BR4A 1G6NA 3TW7A 3HGGA 1B9NA 3K2AA 2JWTA 1GVJA 4BYYA 3K1PA 3T8TA 2MLKA 3DLAA 2CV0A 1A04A 4KA4A 4M3FA 4IL6C 5CQEA 1LE8B 2EA2A 1K4SA 1YTYA 2NVXJ 4C2MJ 3J81Z 1MBGA 1REPC 4QIWN 2R7WA 3GTMJ 1XDSA 1BN5A 2QGUA 4QPOA 5ICGA 1G4DA 4FX0A 2ZKZA 4DBRA 2KFDA 1JUSA 4ENKA 2AXLA 5CVRA 4WXDA 2O8KA 2PJRB 2VI6A 1PP7U 1GV2A 3WHCA 5F0HA 2CRGA 4F7ZA 4ZJZA 3RTRA 3ABTA 3R4KA 3TP3A 2B0LA 5E20A 2VLAA 3RYRA 2VKEA 3AFHA 2KRCA 1ETVA 5GAHJ 3AL0C 3T8RA 1G3SA 3H9GA 4U0WA 2CSOA 2ZJPF 5D6FA 3WE2A 2HU9A 2YSRA 3FHZA 1DP3A 2PMZN 3BZCA 1QHHD 3OYFA 1WWXA 3E6MA 1X1BA 5A2QR 4ENJA 1TNSA 2X4HA 2EFNA 3HTUA 2M45A 4PGGA 2DMPA 1K83J 5JLWA 5GADJ 1HKTA 1V5GA 4FASD 2IP2A 3KEYA 3TEDA 3ZMTA 5FROA 5BMZA 1IW7F 2EINH 2IGKA 2LLKA 2Y75A 5HLIA 3CC4I 2FNAA 5BNGA 3CC7I 3S2HJ 3DFGA 2W4SA 3NWSA 3R0JA 4OIRF 2CJJA 3GTLJ 4L5EA 1IXRC 4OU0A 2EJRA 2KJCA 3QPSA 4ZZLA 1OCOH 1O57A 1IRXA 4AWXB 2Y9YA 4OMZA 1BC7C 3J80Z 1E17A 2NS7A 4OAZA 1IDYA 3OOUA 1Z0XA 1ULYA 3Q3SA 2GA1A 4KT6A 4UVAA 2ACJA 2FE3A 3CC2I 4PJNA 4PK4A 3HL2A 2RQQA 1WHUA 3ASNH 4B43A 4JX5A 4HV5A 5J1RA 1Y1VJ 1H8AC 1RQ6A 4L5IA 5CVJA 2K5CA 1MDMA 4M6XA 2A3SA 2FF4A 4HNUA 4B3AA 2XF6A 2BW3A 1HSJA 2F6CA 4XRMA 2IVMA 2DI3A 1J59A 2B9SA 3WHBA 3JTHA 1UZCA 3ONQA 4IQ4A 4E7LA 3KEOA 3OOPA 4I0AA 2PFBA 3BR0A 2HYGD 2K9SA 4RAFA 3U1KA 1XMKA 1D8KA 3FK6A 2VQGA 4XRSA 2C6YA 1GT0C 3K7AJ 4HA8A 4RGXA 4QLCU 3OS1A 5K5QA 1BBYA 1SEUA 2M8EA 4C30A 3LNQA 2OCCH 3CCJI 2EIMH 1IUFA 5HNFA 3NARA 1OCZH 1EF4A 4EJVA 4DYQA 2J5PA 1JKPC 1ZKGA 4RA2A 4U7BA 2EA4A 4RB1A 5IT3A 3CCRI 1R22A 3A01A 2NNYA 1J9IA 1AU7A 1IN6A 3U2RA 3WGHA 2KIMA 1FBSA 4YELA 2QKMB 2X51A 3LMMA 1YIJI 3CF5F 1H89C 4LIUA 3ASOH 4KDPA 2BY0A 3EUHA 3BR1A 4W97A 2DA1A 1W36D 4N0BA 3QP5A 3EUHC 2H8RA 4MQVA 3WG9A 4ANJA 5BS6A 5E3MA 4BKXA 4XKBA 4BGDA 1ZK8A 1OKRA 3OR2C 3W6VA 1XN7A 4CGZA 3E97A 2X85A 4S0HB 4YG2F 1IN8A 2XROA 1QZZA 5LHHA 1R6RA 3KZZA 1U0JA 4YIFA 4EJWA 3DPLC 5D4RA 1WH7A 2JA8J 4UNOA 2CW8A 2XAQA 3PUBA 3S32A 4BEHB 3RKXA 3IKVA 3ECOA 4HRIA 3BPVA 1K78A 3L1PA 1APLC 1UHSA 2XF5A 1E3PA 4UB6C 3TDZC 4B8XA 3MFKA 2M3AA 4CA0A 4PFOA 4WX9A 4CXFA 3GFLA 4Q5SF 2CU7A 3CUQA 5K7FA 3R61A 3PIOF 1D0ZA 2YS9A 3L2RA 2PEXA 2ESNA 4N4NB 1NG6A 4I98B 4WXHA 4CDGA 2LREA 4BBRJ 1J5YA 3WE3A 2BGCA 5JI6A 3FXRA 2MLGA 3LSPA 5DDGA 4OOIA 1XC5A 1IZ1A 2BZTA 2CUZA 1IXCA 2JA2A 4ASNA 1HW5A 4XKCA 3WODF 1ZAOA 4HF2A 3JRHA 4U88A 1IDZA 2AO9A 3HUGB 4AVPA 3I71A 2NOJB 4L18B 2EFOA 4B1RA 1Z05A 2L01A 2MW8A 3F9KA 1G3TA 2ZXJA 4WCGA 1J7KA 3PSFA 4LIVA 1I1SA 2FX0A 1D0YA 4C3IJ 3RYPA 4ZDOA 2XDVA 4JP0A 4C3HJ 5D5WB 4NC6A 4HYEA 3ZQQA 1F5TA 4A12A 3BJAA 3G1LA 1X4OA 4GYGA 2WWYA 2DPUA 1V3FA 2FEZA 2G9WA 3LA2A 2HFHA 2QSHX 1ENHA 2MABA 1D5VA 1XDUA 2UUZA 1RKTA 2QSFX 1FOXA 2M1BA 4FETA 3WTWC 4Y3OA 3E0JB 3E5XA 4UUVA 3SQNA 4EVIA 1S6LA 2P8TA 3VB2A 3HBLA 3ZR8X 4BXXJ 2XKOA 2CFXA 2VC0A 3HDDA 3VYSB 3TP0A 1KQ8A 1PYVA 1A6IA 2M5WA 5AIPA 2EQRA 1S3JA 3I55I 2XHKA 3MKLA 4KYWA 2JSPA 4A6DA 2L7FP 2V1DA 3I64A 2DMUA 2LP0A 1BI3A 4FQGA 3OS2A 2CYYA 3I4NJ 1J09A 4KT5C 5CYVA 2UWMA 4IKFA 4ZDPA 2JSCA 3HTSB 3FF5A 2FQ4A 4G7ZF 3LAJA 3BG9A 1W7PA 4BACA 3V8JA 4B3XA 3ELKA 2LK2A 3ABLH 3ECHA 4HF0A 4E7HA 3O8HA 5LLQA 5FKOA 3ZP5A 2JT1A 3BTCA 3I3LA 1U78A 1Z6RA 2MD5A 3DLLF 5BOXA 3I56I 4MNUA 4UHTA 1UHMA 3K1NA 5ILUA 2XPUA 4HLYA 1D1AA 2V9KA 5HOOA 2A61A 1LVAA 2DLLA 4GDFA 1LQ1A 3S1NJ 2V79A 2DT5A 4OAYA 2OTLI 2FUG2 4XSZF 4HSRA 5HLHA 4ZYGA 4CCOA 5GTIC 1R4MB 2BYVE 2MGQA 2DCEA 1KA8A 4ON0A 2O7OA 1TW3A 5E18F 1P2FA 1G3WA 2KIFA 3ZQGA 5HODA 4RB3C 3KP7A 4CCNA 2X1DA 3E3VA 2YPRA 5FKLA 3BG6A 1XGSA 4A3CJ 4BDZA 3F21A 1PDNC 2DQRA 3BR5A 3S16J 1SD5A 3HYIA 3WU2C 4A93J 2ETHA 1EH8A 3MEXA 2K3PA 1EA3A 3LSHA 1W0TA 1YHQI 1SAXA 3CD6I 4A3DJ 5M5WJ 2X6XA 5FFZA 1UHWA 4B44A 4JYKA 5HS7A 4EM1A 1MBHA 3K70D 1SD7A 2L9NA 2VT2A 2D5VA 1O3TA 1I5ZA 3OL3A 3M1CA 3O2PE 4I76A 2DK8A 1OYYA 3BR3A 2A07F 1HDDC 3HC7A 2VPLA 1JHHA 2L54A 5EZHA 4UVCA 4I01A 3M8EA 2F5EA 3BCBA 1HC8A 1GVDA 4BQOA 2FSWA 2EB7A 4UUSB 4UY8I 2E2HJ 2H27A 3L7WA 1P4AA 1XB4A 2N8GA 3FKIJ 4X6AJ 1VFCA 3GX4X 4HX7A 3HOXJ 2VXZA 4E4HA 4BE1A 4ZYHA 3H92A 1VQOI 1S7OA 2HKXA 2GXAA 4LFUA 4DIQA 2QLZA 3P9KA 4FHTA 1YITI 2YU9J 4M9ZA 2IAIA 1ZR2A 3D0SA 3PSIA 3IHUA 1O3SA 4MIMA 4A3LJ 3ZMVA 1UG2A 4D1QA 3HRMA 4NC8A 1YJNI 4A0XA 3M7GA 3FMRA 2Q0OA 2NVTJ 5CKTA 5FLXR 1VZ0A 4S05A 1WQ2A 2GXBA 3F6VA 1T39A 3JREA 3FXLA 2CV2A 2XASA 3GXOA 4IEJA 2ECCA 2LKPA 2Z2SB 2EZKA 2XPVA 1G8XA 4FX4A 2W25A 4IRHA 1LNWA 4BDYA 1W4MA 3JCUC 3OWTA 3HZJA 2EWNA 2FBHA 4M6YA 4HX8A 2E5NA 1YE9A 4ENMA 4MTDA 2EH3A 5D5UB 2LD5A 5H6QA 3JRDA 2A68F 3SYTA 3SDBA 1MNMC 2IA0A 1ZH5A 1YS6A 2XSJC 1Y1WJ 3J7AO 4DYCA 3JRIA 5HDKA 1H0MA 2I5UA 1GUUA 2TDXA 2F5FA 2HXOA 2A5YB 4MO7A 4S04A 2AXTC 2D1VA 3PL8A 5D5VB 3BP8A 5IYBJ 1VQ7I 3K69A 4L0ZB 4IRGA 3D1NI 1VQNI 4AIJA 2R5YA 2W00A 2F4IA 5K7HA 2Z5UA 2L9SA 1Z1DA 2O5RA 2MZ4A 4ABZA 1J2XA 1LDKB 2MH2A 2ISYA 2NXNB 2W84A 4KICA 3PNTA 5J6XA 3K4KA 1O3RA 1KGSA 2DTRA 5FLMJ 1W1WE 3PFIA 5HLGA 1MSEC 4BY1J 3BPXA 4KJZA 3CP8A 3OYEA 3GBGA 4JK1X 1IC8A 2ZNZA 2DJIA 2R7XA 3FXJA 2TCTA 3L2UA 3K0LA 1DP7P 3V7RA 2BHZA 1QU3A 4EM0B 2RN7A 4IX7A 5LFAA 2Q8KA 1R49A 3GTPJ 1FX7A 3TOAA 2E60A 2CG4A 5E3LA 3BG5A 5LEKA 3G71I 2A6HF 2F4OB 2WC2A 1ORKA 4BHBA 2R3SA 2ZMEB 2BY2A 5D5XB 3DTKA 5EJCA 2F5CA 3E6CC 1R23A 3GFMA 1U3EM 4IVNA 1I39A 2DMQA 4XMYA 2V9PA 2X6WA 4P96A 4MHGA 5C4JJ 4LLNA 2JA6J 2W1OA 2RDPA 4CYCB 2L7MP 2K9NA 3IUOA 3SXYA 2LF8A 2Q2EB 4L9TA 2E2JJ 1T8IA 2WTEA 2X1CA 3IWFA 4QTRA 3L2CA 2YUSA 1I3AA 2QENA 5K5RA 1VQPI 4XL9A 2KDOA 3DBHB 2LKXA 3HRSA 2YR2A 2FOKA 1LUJB 5EEGA 3FXQA 3GFIA 3KP4A 3SZTA 3LQRA 3WGGA 2HTSA 4I2OA 3HRUA 1RUNA 1ACIA 2ZSIB 3QOEA 4CHUA 2ZJRF 4E7ZA 1EH6A 3CO6C 1FTZA 4RBOA 4ZTJA 3LFKA 1XMXA 2D45A 5EGOB 2PN6A 1MIJA 3TQNA 2LMDA 1ETXA 4LD5A 2EFQA 2VPRA 2X9DA 4Y15A 4G9YA 5FD5A 4I0BA 5A2QZ 2X1EA 4KMFA 1T98A 1RPWA 5IP6A 5F6FA 3JAMK 2LC2A 2QBYB 2NAZA 4H4KC 1W5SA 1SMTA 5IT9R 3M1EA 2CH0A 1UMQA 2E1MB 1MJ9A 3BQYA 2R7RA 4IOCF 5AIQA 1ETOA 3C18A 4MEYF 2HQAA 2R4GA 4UB8C 1H88C 3DPUA 2R7FA 1F4KA 3Q0VA 2ME0A 3GMEA 4EM2A 4ZH4F 3QU6A 4KITB 2X6OA 1S9HA 2K27A 4XK4A 4Z2YA 2ELJA 4M74A 3RKWA 3J81K 4Z6YA 5JFRA 4RLQA 3CF2A 2HQNA 1B72A 2X48A 1S5LC 3GZ6A 2PLYA 1TT5B 4A3KJ 2CO5A 3WTZA 2HVQA 4M3EA 2KLOA 2UV1A 3CZ6A 3JAMZ 2CUFA 3I59A 2R93J 1ZARA 4BQQA 4C9YA 2L5QA 3PM1A 1BC8C 4I09A 2DOFA 4JBAA 3ULQB 4MFDA 2IS6A 5HDNA 3RKYA 1LVKA 3EYYA 5CVIA 3JR9A 3U1DA 5C44J 2CQNA 1FJLA 4X0GA 1YS7A 2G7HA 2P5VA 2FBIA 1E0EA 3IRQA 3PNYA 3LSMA 2V1NA 3ERMA 1V5EA 3CCVI 4RGSA 2K86A 4LMYA 4A3EJ 3M4OJ 4N4OB 5L3CA 3RI4A 2QF7A 5LRRA 3TL4X 5GAEJ 1IJWC 2NVQJ 2K7LA 1T2KA 1IGNA 4GCVA 1W5TA 5DCFA 3A0BC 4Q47A 1R9TJ 2HEOA 1JKQC 5H6RA 1XSDA 1BI2A 1B8IA 4IHYA 3FISA 2VL8A 2IBDA 1TT0A 1YJWI 2BVLA 5L3BA 1VF9A 2GOXB 3AG3H 1JGGA 2LVSA 3ZGKA 2GM4A 1E3OC 1VQ8I 3J80K 4DOZA 3C1DA 4C2UA 1RNLA 1X1DA 2LY2A 3A4CA 1Z9CA 4EEFG 2OF7A 1KU3A 1R1TA 4KN7X 4XRFA 5DM6F 3CUOA 3QWLA 4M72A 2MBFA 1H9GA 3FBNB 4NQWB 2CW0F 3JRFA 2R5ZB 1MJBA 3L09A 1USTA 3HOTA 3G2BA 1ZELA 3VYTB 3PUFA 2HOTA 1GHCA 4OWRB 1TC3C 3BZ6A 5ICEA 3F0CA 4BXUA 3KYDB 3CJTB 2HYFA 3FK7A 2ESHA 1JUPA 3ZQFA 1Y0UA 1V4RA 3VSLA 1CF7A 4M71A 1YW8A 2A6TA 2DQLA 2OA4A 3BG3A 4L5JA 2KRHA 4CYDA 2ECBA 2CGPA 1CGPA 1OFCX 3SEQA 1KYWA 4LLGF 1SFEA 3Q5FA 4HEA2 4XLAA 2I8DA 2JN6A 3RPUA 2K4JA 3HKZA 3LL7A 1QO0D 4G6TB 4P55A 3CP2A 4CZCA 3L2QA 1A35A 3DXJF 4EATA 1MNDA 4R8HA 1LE8A 4WF2A 2WAEA 4RB2C 2KJBA 1P7IA 3Q0UA 2HI3A 4A3JJ 1FPQA 3I58A 3RCOA 4F3QA 1UFMA 4A69C 1MD0A 4RMNA 4II2A 2EIKH 3SZPA 1IN7A 1FBUA 2L0KA 5LD2C 2RAEA 1TTYA 2PJRA 2VBXA 2H8WA 5E79C 4CZZA 2J5OA 5EEAA 2IGMA 4HQMA 1PP8F 1OCTC 2JK3A 3OIOA 2HVRA 3GTKJ 1ODDA 2L02A 5DD4A 1ZQ3P 1D3YA 1S7EA 1XMAA 2B63J 4Y7NJ 5DEQA 2BVMA 2F2EA 3EQLF 2HPMA 1XD7A 2Y31A 2V6CA 3EPZA 4M6VA 2DXIA 3S2WA 4DBQA 1DPUA 1XCBA 3DKWA 4A3MJ 1IAWA 1XGMA 2V1UA 3DP7A 2COMA 2EILH 4Y52J 4BHCA 4IXAA 3GTGJ 4IF4A 3W2VA 3CJQB 1RR7A 1RI7A 2QSGX 4RLFA 3MMYB 3GEZA 3OYNA 3PO3J 3J7AY 1OQYA 4U87A 2LG4A 3BR6A 3KP5A 1J75A 4D9JA 1XGNA 4G8XA 4M9XA 5JHFA 2QZ8A 3QYBA 3I53A 4IZZA 2TRTA 2VJIA 4JOMA 2DDBA 2DN0A 3NRVA 1FOWA 1XGOA 5B1BH 2QCOA 2EK5A 4B4CA 5EDNA 2P6SA 3K4MA 3LSIA 2H1LA 2IGOA 1JKRC 2DFHA 2OJED 2ELHA 2M0CA 3FMQA 3IH4A 1TLHB 2RKHA 5D6EA 2XB0X 3KP3A 2OC6A 2FA5A 5JVGF 1YRNB 4BL0B 5E3NA 5TRDA 1X19A 2AS5F 3OIQA 2E5ZA 4ESJA
chains in the Genus database with same CATH topology
2Z3YA 1XCVA 1ZLKA 4IHSA 2OU2A 4HLXA 2FBKA 2PJPA 1DDNA 3TGNA 3QU3A 2ZCWA 4CO8A 5BPDA 1I6XA 2M30A 5LHGA 4OMYA 5HS9A 5LGNA 4MEXF 4E70A 3GLXA 2GIVA 3ZMUA 1OPCA 1LJ9A 1S7AA 1ZYRF 4G6QA 3ZQ7A 3MZHA 5FFXA 2V1XA 3GVAA 2E7WA 1MKMA 1IRGA 4HF1A 1HSTA 1WRJA 1FBQA 3QAHA 4XSXF 1U5TB 1ONVA 2XAGA 3GO5A 5E8IA 1LB2A 2DK5A 1JHFA 2CWEA 3QPTA 3DQVC 3V8LA 4HV6A 3ISPA 1TBXA 4A5NA 2HWVA 2M87A 5DUKA 4EGZA 2KKOA 1L3LA 2GZWA 1USSA 5LHIA 2JPCA 4GO1A 1ZHFA 1OYIA 4RS8A 3HUGA 2RQPA 4AD9A 2RC4A 2OBPA 3MQ0A 2EV6A 4Y17A 4HDUA 3ZMZA 1R58A 3NQOA 5ICFA 3K9TA 3REOA 1AWCA 3VOEA 2HR3A 1GXPA 1FSHA 1F9NA 4ETSA 4LK1F 2O0YA 5CVVA 1KYZA 3JTGA 1BIAA 4MQ9F 1BJAA 2D1HA 1SFXA 5D4SA 3BOQA 1U5TC 4BAYA 2HS5A 5DCMB 2FMLA 1QZYA 3AAFA 4LG0B 4ZYEA 1YW7A 3WTTC 4DQ2A 1R5GA 3IRRA 3O3KA 4O5VA 5TJJA 3FWEA 1YQAA 5E1XA 2P5LC 2NNNA 5E8GA 3F8CA 4KIBA 1WKMA 1C0WA 2DFIA 5E17F 1LEAA 2QVOA 3KZYA 3B02A 3BWGA 2P7CB 1MGTA 4LLLA 2PI0A 2WV0A 4N9IA 5ILVA 1PUEE 3SHFA 2H6BA 2HTJA 4A5MA 3ERED 3T5XA 2X0LA 2VODA 1YIOA 4MTEA 3CJNA 2GQQA 1FNNA 2GA2A 1FWZA 1X3UA 2IT0A 1SFUA 2W85A 1S29A 2OZ6A 1DPRA 2DPDA 3F3XA 3R60A 3KLOA 3KP2A 5IT9Z 2MA3A 5DD8A 2Z9OA 3F8MA 3LSTA 1OMIA 4EQQA 5LGTA 1R5HA 1ZRDA 2O3FA 3WU1B 5HS8A 2DAOA 3ROUA 1FYLA 4GGGA 3I5UA 1O3QA 2VBWA 3N4MA 3GW2A 2BBYA 3CTAA 4U0VA 2QQAA 3G73A 2QQBA 5EEHA 3DV8A 1ZG3A 1YO5C 2QQ9A 1KU2A 2ZNYA 1XSXA 5A2QK 1FT9A 4BH9A 2EV0A 2OAZA 3HOSA 1FP1D 1P6RA 2PBIA 2HDCA 1SD4A 2K4BA 3ZN1A 1Z7UA 2LDUA 3TO9A 4OINF 4HOBA 5BPIA 1R7JA 2IPQX 3GF2A 4YIIA 4A0YA 3T0YA 4K2EA 2HOEA 2VBZA 4H0EA 2ZJ2A 4IHTA 2STTA 3V7SA 3H3UA 3DF8A 1RIOH 2ZO4A 5D8LB 1T38A 5KK1A 2HQRA 2YX7A 1ZN2A 4PDKA 2E1NA 4EJTA 4P5OA 5ICCA 4KUMA 2LSOA 4EJOA 2LNBA 2V9VA 2JRTA 3K2ZA 3R0AA 4XBFA 4IJAA 5L3DA 3JSOA 5FO5A 1R1VA 1FLIA 4L9JA 3ABUA 2H6CA 3FMSA 4RAYA 5DUIA 1ZLJA 3V4GA 1ZREA 1P4XA 1Z6TA 1DUXC 1KQ0A 3KCCA 2XUBA 2ZMEA 1WSUA 4KFCA 3BROA 4RB0A 4ENNA 3FX3A 1MDMB 2Q2EA 1UB9A 5BQTA 3RIRA 3V7CA 3BJOA 3WTYC 3ZPLA 3LQQA 4G7OF 6PAXA 4UXNA 1BM9A 3GZ5A 2VE9A 2EFWA 4B09A 1HQCA 3QRFF 3EDPA 2QWWA 3DEUA 5JHUA 4UV8A 2QBYA 1ZG1A 1L0OC 1FP2A 3LA3A 3HHGA 5E1ZB 2XV4S 2O6GE 2IRFG 3I0TA 3QOPA 4I02A 3TO7A 1KQ9A 2P5KA 4OIPF 3E5UA 4L9NA 4O6JA 5E1WA 1K6OA 5LGUA 1S8NA 1LDDA 2DO7A 3U9GA 1D8JA 4GYIA 2PMUA 3WTVC 1AOYA 2O03A 5JR3A 1HKSA 4M9SA 1K7AA 3TDUC 3P7NA 1B4AA 2XAJA 4L9VA 1IXSB 1W7PD 3F8FA 4U7DA 1TNTA 3KE2A 3TOBA 1K78B 2L4MA 2E1CA 3FXUA 4UVBA 2YX4A 1KU9A 2H09A 1XSVA 2Y48A 3QP6A 3CUQB 2XKPA 3IKTA 3ZMSA 1ON2A 3FM3A 3O6BB 4DNCA 1U6GA 3P9CA 4RGUA 2A6EF 3HSFA 2RGVA 4NQWA 2VN2A 1TQPA 3D5LA 2D2WA 4EMSA 5DV5A 4HBLA 2K02A 1O7LA 2P6TA 5FB2A 2UXXA 4OIQF 2VOPA 1JGSA 3K1MA 5FD6A 2YU3A 1TQMA 1QBJA 5CVUA 1IRFA 2F5DA 5L3GA 1GXQA 2RV8A 4NB5A 1E2XA 4TV7A 4N9HA 3FZVA 3IL2A 2P7VB 2FU4A 5HVQC 4WXCA 2UXNA 4R1HA 1TQIA 2FXAA 2O61A 2BV6A 1TW2A 2IJLA 1B9MA 1OYWA 4HQEA 1WI9A 2NYXA 3WGIA 4LGWA 1I1GA 1B59A 3HSEA 4HAMA 1QQIA 3GUDA 5J8FA 1YLFA 4JQFA 4YFNF 2HZTA 2LF7A 2QUFA 1W7PB 2XGXA 4RAZA 3CUQC 2VC1A 2UZKA 1MZBA 4OIOF 4KMUX 4A6EA 2BE5F 3T1BA 3L9FA 1FSEA 3BJ6A 3PQKA 2RVCA 5D8KB 1Q1HA 2E7XA 1STZA 1G3YA 4G6DA 3CO7C 4WWCA 4ESBA 5LEJA 3KFWX 4ZYDA 2R7DA 3PQJA 4AIKA 4BNCA 1YFHA 1ZRFA 3HIFA 4HW0A 1IF1A 2JTVA 2GAUA 2P4WA 3GFJA 3KEQA 3M8FA 3OV8A 4P9UA 1BIBA 2HGCA 3HSRA 3E6BA 4KN4X 4YFXF 4MGRA 3JW4A 3ZMDA 5FLXK 3COAC 2FQ3A 4KNYA 4R79A 1YW9A 1FZPB 3TKYA 3C3WA 2W57A 4LB6B 3DPTA 1ZGJA 1LDJA 4L0YB 3G3ZA 2XRNA 4PGHA 2W24A 4QWQA 4AIHA 1J0RA 2XVCA 4XLPF 4NHJA 4A2UA 1VTNC 3CLOA 1BI1A 3MWMA 5FLXZ 3F8BA 2OQRA 1I27A 4KIFA 3WTSC 2FRHA 1BOAA 1IN5A 1EV7A 2HKOA 3GYHX 1ZRCA 3EYIA 5F1RA 2A69F 4Y13A 3E6DA 3M9AA 2VT3A 4EJUA 1T0FA 2KRFA 5KVRA 4PZJA 2H94A 1MJAA 4LK0F 1HXDA 5ERIA 1HKQA 2MC3A 5DYMA 2OZUA 3V8KA 4EV0A 2XAHA 4KIGA 1JE8A 1IUYA 3LA7A 5HDGA 3C7JA 1U5TA 2IA1A 2Z99A 1HBXG 4G94A 2G7UA 3RDIA 5ED4A 4RGRA 3I4PA 3MZYA 4ESFA 2FNPA 2MH9A 3VEPA 4Q48A 5H20A 1SD6A 3ZN0A 3VODA 2DBBA 2PMHA 1NHAA 3B73A 4PCQA 5JVTA 1FC3A 3R6SA 5CJ9A 5AONA 1F1ZA 3WU0A 3VFZA 2JPBA 1Z91A 1QNTA 3TO6A 1QPMA 2L4AA 5IT9K 3GWZA 2Y0MA 2O8XA 2STWA 1YYVA 1KU7A 2PG4A 3IWZA 4HDVA 2CQKA 3ML6A 2IW5A 1HW2A 1O7FA 3RPQA 1B6AA 2KIUA 4M73A 1IN4A 2GXGA 5K1YA 2VOOA 4XLNF 1U8RA 4EGYA 2IA2A 2ZFWA 3F8NA 4U0YA 3WTUC 4O3MA 3H3ZA 3CDHA 3LAPA 3I54A 4D0PA 3IC7A 3HHHA 3BY6A 2DU9A 3KETA 5DCMA 5LBQA 4LG0A 4IPAA 3F22A 1RZ4A 3EETA 2RNJA 3W6JB 1R36A 5J8CA 5ILSA 1ZGAA 4IRIA 4Q4ZF 4A0ZA 1FYKA 5K5OA 4LJZF 1R1UA 3KP6A 1YG2A 1BI0A 3E5QA 1OR7A 3JSPA 3I59B 1P4WA 4ZZDA 2FMYA 4YFKF 1RUOA 1SMYF 1UCRA 5CLSA 1HW1A 2QM3A 3W6KB 2Z33A 2PQ8A 2EV5A 3QPHA 4BQAA 1FYMA 5LRSA 1T6SA 1JXSA 1P92A 4I7HA 2DW4A 2ISZA 1FY7A 4GXOA 3Q9SA 2QYOA 1R00A 3NEUA 1EH7A 2GWRA 3MCZA 3F6OA 2OQGA 2EFPA 4P9FA 2VONA 4HZFA 2ADUA 2VBYA 3F72A 3P9IA 1K79A 3WTXC 3N97A 2VE8A 3LWFA 5L3EA 5FGMA 4LB5A 3KLNA 5F64A 2XIGA 5L3FA 3L00A 2NS0A 2L3DA 4BHPA 1ON1A 4UV9A 4CICA 4WK8F 3FM5A 3BDDA 2BEOA 2OD5A 4FT8A 2ZBKA 2NRAC 1LEBA 1CF7B 1QGPA 3RJPA 3F23A 3SFZA 4G7HF 1ZG5A 4HX4A 3Q9VA 1H9TA 1B1BA 2XAFA 1FOKA 3HRTA 2JZYA 3MAJA 1U2WA 1G6NA 1B9NA 1GVJA 4BYYA 3K1PA 3T8TA 2MLKA 1A04A 4KA4A 2EA2A 1YTYA 3J81Z 1REPC 1XDSA 1BN5A 5ICGA 1G4DA 4FX0A 2ZKZA 4ENKA 2AXLA 5CVRA 4WXDA 1PP7U 4F7ZA 3RTRA 3ABTA 3R4KA 2B0LA 5E20A 3RYRA 3T8RA 1G3SA 4U0WA 2CSOA 5D6FA 3WE2A 2YSRA 3FHZA 1WWXA 3E6MA 4ENJA 1TNSA 2X4HA 2EFNA 3HTUA 2M45A 4PGGA 1HKTA 2IP2A 3ZMTA 5BMZA 1IW7F 2Y75A 5HLIA 2FNAA 3DFGA 3R0JA 4OIRF 1IXRC 4OU0A 2EJRA 2KJCA 4ZZLA 1O57A 4AWXB 4OMZA 1BC7C 3J80Z 1E17A 1ULYA 4UVAA 2GA1A 2ACJA 2FE3A 4HV5A 4L5IA 5CVJA 1MDMA 4M6XA 2A3SA 2FF4A 1HSJA 2IVMA 2DI3A 1J59A 3JTHA 3KEOA 3OOPA 4I0AA 2PFBA 2HYGD 1XMKA 1D8KA 2C6YA 4HA8A 4RGXA 4QLCU 5K5QA 1BBYA 2M8EA 4EJVA 2J5PA 4U7BA 2EA4A 4RB1A 5IT3A 1R22A 2NNYA 1J9IA 1IN6A 3U2RA 3WGHA 2KIMA 1FBSA 4KDPA 3EUHA 4N0BA 3QP5A 4MQVA 3WG9A 5BS6A 1OKRA 1XN7A 4CGZA 3E97A 4YG2F 1IN8A 2XROA 1QZZA 5LHHA 3KZZA 4YIFA 4EJWA 3DPLC 5D4RA 4UNOA 2XAQA 3RKXA 3IKVA 3ECOA 3BPVA 1K78A 3TDZC 4B8XA 3MFKA 4WX9A 4CXFA 3GFLA 4Q5SF 3CUQA 3R61A 2PEXA 2ESNA 4I98B 4WXHA 4CDGA 1J5YA 5JI6A 3WE3A 2BGCA 3FXRA 2MLGA 5DDGA 4OOIA 1IZ1A 1IXCA 4ASNA 1HW5A 3WODF 1ZAOA 4HF2A 4U88A 4AVPA 3I71A 4L18B 2EFOA 1Z05A 2L01A 1G3TA 2ZXJA 4WCGA 1J7KA 1I1SA 3RYPA 5D5WB 4HYEA 1F5TA 4A12A 3BJAA 2DPUA 4GYGA 2WWYA 1V3FA 2FEZA 2G9WA 3LA2A 2HFHA 1D5VA 1XDUA 2M1BA 3WTWC 3E5XA 4UUVA 3SQNA 4EVIA 1S6LA 2P8TA 3VB2A 2XKOA 2CFXA 2VC0A 1KQ8A 2M5WA 5AIPA 1S3JA 2XHKA 4KYWA 4A6DA 2V1DA 3I64A 1BI3A 2CYYA 4KT5C 5CYVA 2UWMA 2JSCA 3HTSB 3FF5A 4G7ZF 3LAJA 1W7PA 3V8JA 3ELKA 3ECHA 4HF0A 5LLQA 3ZP5A 2JT1A 1U78A 1Z6RA 2MD5A 5BOXA 4MNUA 4UHTA 1UHMA 3K1NA 5ILUA 4HLYA 5HOOA 2A61A 1LVAA 2DLLA 1LQ1A 2V79A 2DT5A 4XSZF 5HLHA 4ZYGA 2BYVE 1KA8A 4ON0A 1TW3A 5E18F 1P2FA 1G3WA 2KIFA 4RB3C 3KP7A 3E3VA 2YPRA 1XGSA 3F21A 1PDNC 2DQRA 1SD5A 3HYIA 2ETHA 1EH8A 3MEXA 1SAXA 5FFZA 1UHWA 5HS7A 4EM1A 1SD7A 2VT2A 1O3TA 1I5ZA 3O2PE 2DK8A 1OYYA 2A07F 1JHHA 2L54A 4UVCA 4I01A 3M8EA 2F5EA 2FSWA 2EB7A 2H27A 3L7WA 1P4AA 1XB4A 3GX4X 4HX7A 2VXZA 4ZYHA 3H92A 1S7OA 2HKXA 4LFUA 2QLZA 3P9KA 4FHTA 4M9ZA 3D0SA 3IHUA 1O3SA 3ZMVA 3HRMA 4A0XA 3M7GA 3FMRA 2Q0OA 4S05A 1WQ2A 2GXBA 3F6VA 1T39A 2XASA 3GXOA 2LKPA 4FX4A 2W25A 4IRHA 1LNWA 1W4MA 2EWNA 2FBHA 4M6YA 4HX8A 4ENMA 4MTDA 5D5UB 5H6QA 2A68F 2IA0A 1ZH5A 1YS6A 3J7AO 5HDKA 1H0MA 2TDXA 2F5FA 4S04A 2A5YB 2D1VA 5D5VB 3BP8A 3K69A 4L0ZB 4IRGA 4AIJA 2Z5UA 1Z1DA 1J2XA 1LDKB 2MH2A 2ISYA 2W84A 4KICA 5J6XA 1O3RA 1KGSA 2DTRA 3PFIA 5HLGA 3BPXA 4JK1X 2ZNZA 1DP7P 3K0LA 3V7RA 4EM0B 2RN7A 2Q8KA 1FX7A 3TOAA 2CG4A 5LEKA 2A6HF 2WC2A 4BHBA 2R3SA 2ZMEB 5D5XB 2F5CA 3E6CC 1R23A 3GFMA 1U3EM 4IVNA 4MHGA 4LLNA 4P96A 2RDPA 3SXYA 2LF8A 4L9TA 2WTEA 3IWFA 3L2CA 2QENA 5K5RA 3HRSA 2YR2A 2FOKA 5EEGA 3FXQA 3GFIA 3KP4A 3SZTA 3LQRA 3WGGA 2HTSA 4I2OA 3HRUA 1RUNA 4CHUA 1EH6A 3CO6C 3LFKA 2D45A 2PN6A 3TQNA 4LD5A 2EFQA 4Y15A 4G9YA 5FD5A 4I0BA 5A2QZ 4KMFA 1T98A 5F6FA 3JAMK 2QBYB 2NAZA 1W5SA 1SMTA 3M1EA 1MJ9A 5AIQA 3C18A 4MEYF 1F4KA 2R7FA 4EM2A 4ZH4F 3QU6A 2K27A 4Z2YA 4M74A 3RKWA 3J81K 5JFRA 2HQNA 3GZ6A 2PLYA 2CO5A 3WTZA 3JAMZ 3I59A 1ZARA 1BC8C 4I09A 4JBAA 3ULQB 5HDNA 3RKYA 3EYYA 5CVIA 3U1DA 1YS7A 2G7HA 2P5VA 2FBIA 3IRQA 4RGSA 2K86A 4LMYA 5L3CA 3RI4A 5LRRA 2K7LA 1T2KA 4GCVA 1W5TA 5DCFA 4Q47A 2HEOA 5H6RA 1XSDA 1BI2A 5L3BA 3J80K 3C1DA 1RNLA 1Z9CA 1KU3A 1R1TA 4KN7X 4XRFA 3CUOA 4M72A 2MBFA 1H9GA 2CW0F 1MJBA 3L09A 1USTA 3HOTA 1GHCA 3BZ6A 5ICEA 4BXUA 2HYFA 2ESHA 1Y0UA 1V4RA 1CF7A 4M71A 1YW8A 2DQLA 2OA4A 4L5JA 4CYDA 2CGPA 1CGPA 1KYWA 4LLGF 1SFEA 3Q5FA 3RPUA 2K4JA 1QO0D 4P55A 3DXJF 4R8HA 4WF2A 4RB2C 2KJBA 1FPQA 3I58A 1UFMA 1MD0A 3SZPA 1IN7A 1FBUA 1TTYA 2VBXA 4CZZA 2J5OA 4HQMA 1PP8F 1ODDA 2L02A 5DD4A 1D3YA 1XMAA 5DEQA 2F2EA 3EQLF 1XD7A 2V6CA 1DPUA 3S2WA 1XCBA 3DKWA 2V1UA 1IAWA 1XGMA 3DP7A 2COMA 4BHCA 4IXAA 4IF4A 1RI7A 3GEZA 3KP5A 1J75A 1XGNA 4G8XA 4M9XA 2QZ8A 3I53A 3NRVA 1XGOA 2EK5A 2P6SA 2ELHA 3FMQA 1TLHB 2RKHA 5D6EA 3KP3A 2FA5A 5TRDA 2AS5F 4ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3Y A;  1XCV A;  1ZLK A;  4IHS A;  2OU2 A;  4HLX A;  2FBK A;  2PJP A;  1DDN A;  3TGN A;  3QU3 A;  2ZCW A;  4CO8 A;  5BPD A;  1I6X A;  2M30 A;  5LHG A;  4OMY A;  5HS9 A;  5LGN A;  4MEX F;  4E70 A;  3GLX A;  2GIV A;  3ZMU A;  1OPC A;  1LJ9 A;  1S7A A;  1ZYR F;  4G6Q A;  3ZQ7 A;  3MZH A;  5FFX A;  2V1X A;  3GVA A;  2E7W A;  1MKM A;  1IRG A;  4HF1 A;  1HST A;  1WRJ A;  1FBQ A;  3QAH A;  4XSX F;  1U5T B;  1ONV A;  2XAG A;  3GO5 A;  5E8I A;  1LB2 A;  2DK5 A;  1JHF A;  2CWE A;  3QPT A;  3DQV C;  3V8L A;  4HV6 A;  3ISP A;  1TBX A;  4A5N A;  2HWV A;  2M87 A;  5DUK A;  4EGZ A;  2KKO A;  1L3L A;  2GZW A;  1USS A;  5LHI A;  2JPC A;  4GO1 A;  1ZHF A;  1OYI A;  4RS8 A;  3HUG A;  2RQP A;  4AD9 A;  2RC4 A;  2OBP A;  3MQ0 A;  2EV6 A;  4Y17 A;  4HDU A;  3ZMZ A;  1R58 A;  3NQO A;  5ICF A;  3K9T A;  3REO A;  1AWC A;  3VOE A;  2HR3 A;  1GXP A;  1FSH A;  1F9N A;  4ETS A;  4LK1 F;  2O0Y A;  5CVV A;  1KYZ A;  3JTG A;  1BIA A;  4MQ9 F;  1BJA A;  2D1H A;  1SFX A;  5D4S A;  3BOQ A;  1U5T C;  4BAY A;  2HS5 A;  5DCM B;  2FML A;  1QZY A;  3AAF A;  4LG0 B;  4ZYE A;  1YW7 A;  3WTT C;  4DQ2 A;  1R5G A;  3IRR A;  3O3K A;  4O5V A;  5TJJ A;  3FWE A;  1YQA A;  5E1X A;  2P5L C;  2NNN A;  5E8G A;  3F8C A;  4KIB A;  1WKM A;  1C0W A;  2DFI A;  5E17 F;  1LEA A;  2QVO A;  3KZY A;  3B02 A;  3BWG A;  2P7C B;  1MGT A;  4LLL A;  2PI0 A;  2WV0 A;  4N9I A;  5ILV A;  1PUE E;  3SHF A;  2H6B A;  2HTJ A;  4A5M A;  3ERE D;  3T5X A;  2X0L A;  2VOD A;  1YIO A;  4MTE A;  3CJN A;  2GQQ A;  1FNN A;  2GA2 A;  1FWZ A;  1X3U A;  2IT0 A;  1SFU A;  2W85 A;  1S29 A;  2OZ6 A;  1DPR A;  2DPD A;  3F3X A;  3R60 A;  3KLO A;  3KP2 A;  5IT9 Z;  2MA3 A;  5DD8 A;  2Z9O A;  3F8M A;  3LST A;  1OMI A;  4EQQ A;  5LGT A;  1R5H A;  1ZRD A;  2O3F A;  3WU1 B;  5HS8 A;  2DAO A;  3ROU A;  1FYL A;  4GGG A;  3I5U A;  1O3Q A;  2VBW A;  3N4M A;  3GW2 A;  2BBY A;  3CTA A;  4U0V A;  2QQA A;  3G73 A;  2QQB A;  5EEH A;  3DV8 A;  1ZG3 A;  1YO5 C;  2QQ9 A;  1KU2 A;  2ZNY A;  1XSX A;  5A2Q K;  1FT9 A;  4BH9 A;  2EV0 A;  2OAZ A;  3HOS A;  1FP1 D;  1P6R A;  2PBI A;  2HDC A;  1SD4 A;  2K4B A;  3ZN1 A;  1Z7U A;  2LDU A;  3TO9 A;  4OIN F;  4HOB A;  5BPI A;  1R7J A;  2IPQ X;  3GF2 A;  4YII A;  4A0Y A;  3T0Y A;  4K2E A;  2HOE A;  2VBZ A;  4H0E A;  2ZJ2 A;  4IHT A;  2STT A;  3V7S A;  3H3U A;  3DF8 A;  1RIO H;  2ZO4 A;  5D8L B;  1T38 A;  5KK1 A;  2HQR A;  2YX7 A;  1ZN2 A;  4PDK A;  2E1N A;  4EJT A;  4P5O A;  5ICC A;  4KUM A;  2LSO A;  4EJO A;  2LNB A;  2V9V A;  2JRT A;  3K2Z A;  3R0A A;  4XBF A;  4IJA A;  5L3D A;  3JSO A;  5FO5 A;  1R1V A;  1FLI A;  4L9J A;  3ABU A;  2H6C A;  3FMS A;  4RAY A;  5DUI A;  1ZLJ A;  3V4G A;  1ZRE A;  1P4X A;  1Z6T A;  1DUX C;  1KQ0 A;  3KCC A;  2XUB A;  2ZME A;  1WSU A;  4KFC A;  3BRO A;  4RB0 A;  4ENN A;  3FX3 A;  1MDM B;  2Q2E A;  1UB9 A;  5BQT A;  3RIR A;  3V7C A;  3BJO A;  3WTY C;  3ZPL A;  3LQQ A;  4G7O F;  6PAX A;  4UXN A;  1BM9 A;  3GZ5 A;  2VE9 A;  2EFW A;  4B09 A;  1HQC A;  3QRF F;  3EDP A;  2QWW A;  3DEU A;  5JHU A;  4UV8 A;  2QBY A;  1ZG1 A;  1L0O C;  1FP2 A;  3LA3 A;  3HHG A;  5E1Z B;  2XV4 S;  2O6G E;  2IRF G;  3I0T A;  3QOP A;  4I02 A;  3TO7 A;  1KQ9 A;  2P5K A;  4OIP F;  3E5U A;  4L9N A;  4O6J A;  5E1W A;  1K6O A;  5LGU A;  1S8N A;  1LDD A;  2DO7 A;  3U9G A;  1D8J A;  4GYI A;  2PMU A;  3WTV C;  1AOY A;  2O03 A;  5JR3 A;  1HKS A;  4M9S A;  1K7A A;  3TDU C;  3P7N A;  1B4A A;  2XAJ A;  4L9V A;  1IXS B;  1W7P D;  3F8F A;  4U7D A;  1TNT A;  3KE2 A;  3TOB A;  1K78 B;  2L4M A;  2E1C A;  3FXU A;  4UVB A;  2YX4 A;  1KU9 A;  2H09 A;  1XSV A;  2Y48 A;  3QP6 A;  3CUQ B;  2XKP A;  3IKT A;  3ZMS A;  1ON2 A;  3FM3 A;  3O6B B;  4DNC A;  1U6G A;  3P9C A;  4RGU A;  2A6E F;  3HSF A;  2RGV A;  4NQW A;  2VN2 A;  1TQP A;  3D5L A;  2D2W A;  4EMS A;  5DV5 A;  4HBL A;  2K02 A;  1O7L A;  2P6T A;  5FB2 A;  2UXX A;  4OIQ F;  2VOP A;  1JGS A;  3K1M A;  5FD6 A;  2YU3 A;  1TQM A;  1QBJ A;  5CVU A;  1IRF A;  2F5D A;  5L3G A;  1GXQ A;  2RV8 A;  4NB5 A;  1E2X A;  4TV7 A;  4N9H A;  3FZV A;  3IL2 A;  2P7V B;  2FU4 A;  5HVQ C;  4WXC A;  2UXN A;  4R1H A;  1TQI A;  2FXA A;  2O61 A;  2BV6 A;  1TW2 A;  2IJL A;  1B9M A;  1OYW A;  4HQE A;  1WI9 A;  2NYX A;  3WGI A;  4LGW A;  1I1G A;  1B59 A;  3HSE A;  4HAM A;  1QQI A;  3GUD A;  5J8F A;  1YLF A;  4JQF A;  4YFN F;  2HZT A;  2LF7 A;  2QUF A;  1W7P B;  2XGX A;  4RAZ A;  3CUQ C;  2VC1 A;  2UZK A;  1MZB A;  4OIO F;  4KMU X;  4A6E A;  2BE5 F;  3T1B A;  3L9F A;  1FSE A;  3BJ6 A;  3PQK A;  2RVC A;  5D8K B;  1Q1H A;  2E7X A;  1STZ A;  1G3Y A;  4G6D A;  3CO7 C;  4WWC A;  4ESB A;  5LEJ A;  3KFW X;  4ZYD A;  2R7D A;  3PQJ A;  4AIK A;  4BNC A;  1YFH A;  1ZRF A;  3HIF A;  4HW0 A;  1IF1 A;  2JTV A;  2GAU A;  2P4W A;  3GFJ A;  3KEQ A;  3M8F A;  3OV8 A;  4P9U A;  1BIB A;  2HGC A;  3HSR A;  3E6B A;  4KN4 X;  4YFX F;  4MGR A;  3JW4 A;  3ZMD A;  5FLX K;  3COA C;  2FQ3 A;  4KNY A;  4R79 A;  1YW9 A;  1FZP B;  3TKY A;  3C3W A;  2W57 A;  4LB6 B;  3DPT A;  1ZGJ A;  1LDJ A;  4L0Y B;  3G3Z A;  2XRN A;  4PGH A;  2W24 A;  4QWQ A;  4AIH A;  1J0R A;  2XVC A;  4XLP F;  4NHJ A;  4A2U A;  1VTN C;  3CLO A;  1BI1 A;  3MWM A;  5FLX Z;  3F8B A;  2OQR A;  1I27 A;  4KIF A;  3WTS C;  2FRH A;  1BOA A;  1IN5 A;  1EV7 A;  2HKO A;  3GYH X;  1ZRC A;  3EYI A;  5F1R A;  2A69 F;  4Y13 A;  3E6D A;  3M9A A;  2VT3 A;  4EJU A;  1T0F A;  2KRF A;  5KVR A;  4PZJ A;  2H94 A;  1MJA A;  4LK0 F;  1HXD A;  5ERI A;  1HKQ A;  2MC3 A;  5DYM A;  2OZU A;  3V8K A;  4EV0 A;  2XAH A;  4KIG A;  1JE8 A;  1IUY A;  3LA7 A;  5HDG A;  3C7J A;  1U5T A;  2IA1 A;  2Z99 A;  1HBX G;  4G94 A;  2G7U A;  3RDI A;  5ED4 A;  4RGR A;  3I4P A;  3MZY A;  4ESF A;  2FNP A;  2MH9 A;  3VEP A;  4Q48 A;  5H20 A;  1SD6 A;  3ZN0 A;  3VOD A;  2DBB A;  2PMH A;  1NHA A;  3B73 A;  4PCQ A;  5JVT A;  1FC3 A;  3R6S A;  5CJ9 A;  5AON A;  1F1Z A;  3WU0 A;  3VFZ A;  2JPB A;  1Z91 A;  1QNT A;  3TO6 A;  1QPM A;  2L4A A;  5IT9 K;  3GWZ A;  2Y0M A;  2O8X A;  2STW A;  1YYV A;  1KU7 A;  2PG4 A;  3IWZ A;  4HDV A;  2CQK A;  3ML6 A;  2IW5 A;  1HW2 A;  1O7F A;  3RPQ A;  1B6A A;  2KIU A;  4M73 A;  1IN4 A;  2GXG A;  5K1Y A;  2VOO A;  4XLN F;  1U8R A;  4EGY A;  2IA2 A;  2ZFW A;  3F8N A;  4U0Y A;  3WTU C;  4O3M A;  3H3Z A;  3CDH A;  3LAP A;  3I54 A;  4D0P A;  3IC7 A;  3HHH A;  3BY6 A;  2DU9 A;  3KET A;  5DCM A;  5LBQ A;  4LG0 A;  4IPA A;  3F22 A;  1RZ4 A;  3EET A;  2RNJ A;  3W6J B;  1R36 A;  5J8C A;  5ILS A;  1ZGA A;  4IRI A;  4Q4Z F;  4A0Z A;  1FYK A;  5K5O A;  4LJZ F;  1R1U A;  3KP6 A;  1YG2 A;  1BI0 A;  3E5Q A;  1OR7 A;  3JSP A;  3I59 B;  1P4W A;  4ZZD A;  2FMY A;  4YFK F;  1RUO A;  1SMY F;  1UCR A;  5CLS A;  1HW1 A;  2QM3 A;  3W6K B;  2Z33 A;  2PQ8 A;  2EV5 A;  3QPH A;  4BQA A;  1FYM A;  5LRS A;  1T6S A;  1JXS A;  1P92 A;  4I7H A;  2DW4 A;  2ISZ A;  1FY7 A;  4GXO A;  3Q9S A;  2QYO A;  1R00 A;  3NEU A;  1EH7 A;  2GWR A;  3MCZ A;  3F6O A;  2OQG A;  2EFP A;  4P9F A;  2VON A;  4HZF A;  2ADU A;  2VBY A;  3F72 A;  3P9I A;  1K79 A;  3WTX C;  3N97 A;  2VE8 A;  3LWF A;  5L3E A;  5FGM A;  4LB5 A;  3KLN A;  5F64 A;  2XIG A;  5L3F A;  3L00 A;  2NS0 A;  2L3D A;  4BHP A;  1ON1 A;  4UV9 A;  4CIC A;  4WK8 F;  3FM5 A;  3BDD A;  2BEO A;  2OD5 A;  4FT8 A;  2ZBK A;  2NRA C;  1LEB A;  1CF7 B;  1QGP A;  3RJP A;  3F23 A;  3SFZ A;  4G7H F;  1ZG5 A;  4HX4 A;  3Q9V A;  1H9T A;  1B1B A;  2XAF A;  1FOK A;  3HRT A;  2JZY A;  3MAJ A;  1U2W A;  1G6N A;  1B9N A;  1GVJ A;  4BYY A;  3K1P A;  3T8T A;  2MLK A;  1A04 A;  4KA4 A;  2EA2 A;  1YTY A;  3J81 Z;  1REP C;  1XDS A;  1BN5 A;  5ICG A;  1G4D A;  4FX0 A;  2ZKZ A;  4ENK A;  2AXL A;  5CVR A;  4WXD A;  1PP7 U;  4F7Z A;  3RTR A;  3ABT A;  3R4K A;  2B0L A;  5E20 A;  3RYR A;  3T8R A;  1G3S A;  4U0W A;  2CSO A;  5D6F A;  3WE2 A;  2YSR A;  3FHZ A;  1WWX A;  3E6M A;  4ENJ A;  1TNS A;  2X4H A;  2EFN A;  3HTU A;  2M45 A;  4PGG A;  1HKT A;  2IP2 A;  3ZMT A;  5BMZ A;  1IW7 F;  2Y75 A;  5HLI A;  2FNA A;  3DFG A;  3R0J A;  4OIR F;  1IXR C;  4OU0 A;  2EJR A;  2KJC A;  4ZZL A;  1O57 A;  4AWX B;  4OMZ A;  1BC7 C;  3J80 Z;  1E17 A;  1ULY A;  4UVA A;  2GA1 A;  2ACJ A;  2FE3 A;  4HV5 A;  4L5I A;  5CVJ A;  1MDM A;  4M6X A;  2A3S A;  2FF4 A;  1HSJ A;  2IVM A;  2DI3 A;  1J59 A;  3JTH A;  3KEO A;  3OOP A;  4I0A A;  2PFB A;  2HYG D;  1XMK A;  1D8K A;  2C6Y A;  4HA8 A;  4RGX A;  4QLC U;  5K5Q A;  1BBY A;  2M8E A;  4EJV A;  2J5P A;  4U7B A;  2EA4 A;  4RB1 A;  5IT3 A;  1R22 A;  2NNY A;  1J9I A;  1IN6 A;  3U2R A;  3WGH A;  2KIM A;  1FBS A;  4KDP A;  3EUH A;  4N0B A;  3QP5 A;  4MQV A;  3WG9 A;  5BS6 A;  1OKR A;  1XN7 A;  4CGZ A;  3E97 A;  4YG2 F;  1IN8 A;  2XRO A;  1QZZ A;  5LHH A;  3KZZ A;  4YIF A;  4EJW A;  3DPL C;  5D4R A;  4UNO A;  2XAQ A;  3RKX A;  3IKV A;  3ECO A;  3BPV A;  1K78 A;  3TDZ C;  4B8X A;  3MFK A;  4WX9 A;  4CXF A;  3GFL A;  4Q5S F;  3CUQ A;  3R61 A;  2PEX A;  2ESN A;  4I98 B;  4WXH A;  4CDG A;  1J5Y A;  5JI6 A;  3WE3 A;  2BGC A;  3FXR A;  2MLG A;  5DDG A;  4OOI A;  1IZ1 A;  1IXC A;  4ASN A;  1HW5 A;  3WOD F;  1ZAO A;  4HF2 A;  4U88 A;  4AVP A;  3I71 A;  4L18 B;  2EFO A;  1Z05 A;  2L01 A;  1G3T A;  2ZXJ A;  4WCG A;  1J7K A;  1I1S A;  3RYP A;  5D5W B;  4HYE A;  1F5T A;  4A12 A;  3BJA A;  2DPU A;  4GYG A;  2WWY A;  1V3F A;  2FEZ A;  2G9W A;  3LA2 A;  2HFH A;  1D5V A;  1XDU A;  2M1B A;  3WTW C;  3E5X A;  4UUV A;  3SQN A;  4EVI A;  1S6L A;  2P8T A;  3VB2 A;  2XKO A;  2CFX A;  2VC0 A;  1KQ8 A;  2M5W A;  5AIP A;  1S3J A;  2XHK A;  4KYW A;  4A6D A;  2V1D A;  3I64 A;  1BI3 A;  2CYY A;  4KT5 C;  5CYV A;  2UWM A;  2JSC A;  3HTS B;  3FF5 A;  4G7Z F;  3LAJ A;  1W7P A;  3V8J A;  3ELK A;  3ECH A;  4HF0 A;  5LLQ A;  3ZP5 A;  2JT1 A;  1U78 A;  1Z6R A;  2MD5 A;  5BOX A;  4MNU A;  4UHT A;  1UHM A;  3K1N A;  5ILU A;  4HLY A;  5HOO A;  2A61 A;  1LVA A;  2DLL A;  1LQ1 A;  2V79 A;  2DT5 A;  4XSZ F;  5HLH A;  4ZYG A;  2BYV E;  1KA8 A;  4ON0 A;  1TW3 A;  5E18 F;  1P2F A;  1G3W A;  2KIF A;  4RB3 C;  3KP7 A;  3E3V A;  2YPR A;  1XGS A;  3F21 A;  1PDN C;  2DQR A;  1SD5 A;  3HYI A;  2ETH A;  1EH8 A;  3MEX A;  1SAX A;  5FFZ A;  1UHW A;  5HS7 A;  4EM1 A;  1SD7 A;  2VT2 A;  1O3T A;  1I5Z A;  3O2P E;  2DK8 A;  1OYY A;  2A07 F;  1JHH A;  2L54 A;  4UVC A;  4I01 A;  3M8E A;  2F5E A;  2FSW A;  2EB7 A;  2H27 A;  3L7W A;  1P4A A;  1XB4 A;  3GX4 X;  4HX7 A;  2VXZ A;  4ZYH A;  3H92 A;  1S7O A;  2HKX A;  4LFU A;  2QLZ A;  3P9K A;  4FHT A;  4M9Z A;  3D0S A;  3IHU A;  1O3S A;  3ZMV A;  3HRM A;  4A0X A;  3M7G A;  3FMR A;  2Q0O A;  4S05 A;  1WQ2 A;  2GXB A;  3F6V A;  1T39 A;  2XAS A;  3GXO A;  2LKP A;  4FX4 A;  2W25 A;  4IRH A;  1LNW A;  1W4M A;  2EWN A;  2FBH A;  4M6Y A;  4HX8 A;  4ENM A;  4MTD A;  5D5U B;  5H6Q A;  2A68 F;  2IA0 A;  1ZH5 A;  1YS6 A;  3J7A O;  5HDK A;  1H0M A;  2TDX A;  2F5F A;  4S04 A;  2A5Y B;  2D1V A;  5D5V B;  3BP8 A;  3K69 A;  4L0Z B;  4IRG A;  4AIJ A;  2Z5U A;  1Z1D A;  1J2X A;  1LDK B;  2MH2 A;  2ISY A;  2W84 A;  4KIC A;  5J6X A;  1O3R A;  1KGS A;  2DTR A;  3PFI A;  5HLG A;  3BPX A;  4JK1 X;  2ZNZ A;  1DP7 P;  3K0L A;  3V7R A;  4EM0 B;  2RN7 A;  2Q8K A;  1FX7 A;  3TOA A;  2CG4 A;  5LEK A;  2A6H F;  2WC2 A;  4BHB A;  2R3S A;  2ZME B;  5D5X B;  2F5C A;  3E6C C;  1R23 A;  3GFM A;  1U3E M;  4IVN A;  4MHG A;  4LLN A;  4P96 A;  2RDP A;  3SXY A;  2LF8 A;  4L9T A;  2WTE A;  3IWF A;  3L2C A;  2QEN A;  5K5R A;  3HRS A;  2YR2 A;  2FOK A;  5EEG A;  3FXQ A;  3GFI A;  3KP4 A;  3SZT A;  3LQR A;  3WGG A;  2HTS A;  4I2O A;  3HRU A;  1RUN A;  4CHU A;  1EH6 A;  3CO6 C;  3LFK A;  2D45 A;  2PN6 A;  3TQN A;  4LD5 A;  2EFQ A;  4Y15 A;  4G9Y A;  5FD5 A;  4I0B A;  5A2Q Z;  4KMF A;  1T98 A;  5F6F A;  3JAM K;  2QBY B;  2NAZ A;  1W5S A;  1SMT A;  3M1E A;  1MJ9 A;  5AIQ A;  3C18 A;  4MEY F;  1F4K A;  2R7F A;  4EM2 A;  4ZH4 F;  3QU6 A;  2K27 A;  4Z2Y A;  4M74 A;  3RKW A;  3J81 K;  5JFR A;  2HQN A;  3GZ6 A;  2PLY A;  2CO5 A;  3WTZ A;  3JAM Z;  3I59 A;  1ZAR A;  1BC8 C;  4I09 A;  4JBA A;  3ULQ B;  5HDN A;  3RKY A;  3EYY A;  5CVI A;  3U1D A;  1YS7 A;  2G7H A;  2P5V A;  2FBI A;  3IRQ A;  4RGS A;  2K86 A;  4LMY A;  5L3C A;  3RI4 A;  5LRR A;  2K7L A;  1T2K A;  4GCV A;  1W5T A;  5DCF A;  4Q47 A;  2HEO A;  5H6R A;  1XSD A;  1BI2 A;  5L3B A;  3J80 K;  3C1D A;  1RNL A;  1Z9C A;  1KU3 A;  1R1T A;  4KN7 X;  4XRF A;  3CUO A;  4M72 A;  2MBF A;  1H9G A;  2CW0 F;  1MJB A;  3L09 A;  1UST A;  3HOT A;  1GHC A;  3BZ6 A;  5ICE A;  4BXU A;  2HYF A;  2ESH A;  1Y0U A;  1V4R A;  1CF7 A;  4M71 A;  1YW8 A;  2DQL A;  2OA4 A;  4L5J A;  4CYD A;  2CGP A;  1CGP A;  1KYW A;  4LLG F;  1SFE A;  3Q5F A;  3RPU A;  2K4J A;  1QO0 D;  4P55 A;  3DXJ F;  4R8H A;  4WF2 A;  4RB2 C;  2KJB A;  1FPQ A;  3I58 A;  1UFM A;  1MD0 A;  3SZP A;  1IN7 A;  1FBU A;  1TTY A;  2VBX A;  4CZZ A;  2J5O A;  4HQM A;  1PP8 F;  1ODD A;  2L02 A;  5DD4 A;  1D3Y A;  1XMA A;  5DEQ A;  2F2E A;  3EQL F;  1XD7 A;  2V6C A;  1DPU A;  3S2W A;  1XCB A;  3DKW A;  2V1U A;  1IAW A;  1XGM A;  3DP7 A;  2COM A;  4BHC A;  4IXA A;  4IF4 A;  1RI7 A;  3GEZ A;  3KP5 A;  1J75 A;  1XGN A;  4G8X A;  4M9X A;  2QZ8 A;  3I53 A;  3NRV A;  1XGO A;  2EK5 A;  2P6S A;  2ELH A;  3FMQ A;  1TLH B;  2RKH A;  5D6E A;  3KP3 A;  2FA5 A;  5TRD A;  2AS5 F;  4ESJ A; 
#chains in the Genus database with same CATH topology
 4F91 B;  3CMY A;  2LRD A;  2Z3Y A;  5EYR A;  3JRB A;  5HNH A;  1JKO C;  3OL4 A;  2VQH A;  1XCV A;  1TZL A;  2K9L A;  2K85 A;  3BR2 A;  4D5C A;  1ZLK A;  3H35 A;  1JTX A;  1QPI A;  1BR2 A;  1X3Z B;  4IHS A;  2ZJQ F;  1YJ9 I;  2OU2 A;  2GIZ A;  4HLX A;  1PUF B;  2FBK A;  2M8G X;  2WBM A;  3B6C A;  2PJP A;  3SEZ A;  1DDN A;  1Y6I A;  3TGN A;  4BJ6 C;  3QU3 A;  2ZCW A;  2DYR H;  3RSN A;  2WB1 N;  4V19 K;  4CO8 A;  3B6A A;  5BPD A;  2FJ1 A;  3CJR B;  1I6X A;  2M30 A;  3VPR A;  4J01 A;  5LHG A;  1XPX A;  1VQ6 I;  2IS4 A;  1JJ8 C;  4AYB N;  3SDG A;  5EZG A;  3JRG A;  4OMY A;  1V55 H;  3CES A;  3CQZ J;  3BG7 A;  3DBL B;  1G2H A;  5HS9 A;  5GAG J;  3OIP A;  5LGN A;  4MEX F;  1VND A;  2LBF B;  4E70 A;  3GLX A;  1R4N B;  2GIV A;  5B1A H;  3ZMU A;  1OPC A;  5F27 A;  3GCM A;  1BR1 A;  1LJ9 A;  3LSK A;  1S7A A;  1ZYR F;  4G6Q A;  3K4L A;  3ZQ7 A;  2Y0S A;  3MZH A;  3G4S I;  3S3O A;  3S1R J;  5FFX A;  2V1X A;  3GTJ J;  3GVA A;  1O4X A;  1MMS A;  2E7W A;  1BA5 A;  1MKM A;  1VQL I;  1IRG A;  4NC7 A;  4HF1 A;  3I4M J;  1HST A;  3H1C A;  2CW7 A;  1WRJ A;  1FBQ A;  3QAH A;  4XSX F;  1WJ5 A;  1U5T B;  4KIS A;  1ONV A;  2XAG A;  4RM3 A;  3OMY A;  3GO5 A;  1DU0 A;  2F5V A;  4BEH A;  1A5J A;  5E8I A;  1LB2 A;  3HOY J;  1WGX A;  2DK5 A;  1JHF A;  3IV5 A;  5CPR B;  4YIR X;  2ID3 A;  4LOC A;  2LFB A;  4XOT A;  2CWE A;  4XIC A;  3QPT A;  4XNF A;  1Z3X A;  1JT6 A;  3DQV C;  3V8L A;  3FHN A;  4M3G A;  3BTJ A;  4HV6 A;  3ISP A;  1TBX A;  2KPM A;  2XB5 A;  3S3N A;  1Z67 A;  1YX3 A;  2E36 A;  4A5N A;  2HWV A;  2M87 A;  3PJR A;  1MH4 A;  5DUK A;  3H36 A;  4EGZ A;  2KKO A;  1L3L A;  2GZW A;  5KCM A;  1USS A;  2EZI A;  5LHI A;  1T56 A;  4C3J J;  4ZDL A;  2JPC A;  1F36 A;  3HB9 A;  1SVM A;  4GO1 A;  3OYD A;  1ZHF A;  1OYI A;  5FKM A;  4RS8 A;  3HUG A;  4QSH A;  3W3C A;  2RQP A;  1VQ9 I;  4AD9 A;  2RC4 A;  2OBP A;  5GTH C;  1BOB A;  5CQG A;  3MQ0 A;  5FRM A;  1MBE A;  3AG1 H;  1UG0 A;  2EV6 A;  4Y17 A;  4HDU A;  1GLN A;  3NAU A;  3ZMZ A;  4PFP A;  1R58 A;  3S1Q J;  1W5C C;  3H9Q A;  4F52 A;  3NQO A;  3L2V A;  5ICF A;  3K4N A;  3K9T A;  4QPQ A;  2DT6 A;  2GOM A;  4AUX A;  2QQ8 A;  3REO A;  1AWC A;  3LFU A;  3VOE A;  1JT0 A;  4D7M A;  2HR3 A;  2WAF A;  4CSW A;  3GTQ J;  1Q1V A;  3HOW J;  1GXP A;  3G1O A;  5KAF C;  2PMZ A;  1FSH A;  1F9N A;  4ETS A;  4PSX A;  1QVT A;  4LK1 F;  1KZH A;  2HOA A;  2O0Y A;  2HXI A;  4CUG A;  5CVV A;  4I6Z A;  1WJB A;  1KYZ A;  2XPW A;  4JX6 A;  1BIA A;  2HDW A;  3JTG A;  1MMG A;  1G59 A;  4MQ9 F;  3A02 A;  2ZXW H;  4PJJ A;  1BJA A;  2D1H A;  4ZYA A;  3FXO A;  1SFX A;  3S8P A;  5D4S A;  5J1U A;  3BOQ A;  1U5T C;  4BAY A;  1EKE A;  2KL4 A;  4A3I J;  4M3D A;  2HS5 A;  2E19 A;  2FML A;  2LKS A;  5DCM B;  1QZY A;  3AAF A;  4LG0 B;  4ZYE A;  4AC0 A;  1YW7 A;  3N05 A;  2EPF A;  3LSR A;  3WTT C;  3G6E I;  3S14 J;  4DQ2 A;  1R5G A;  3IRR A;  3O3K A;  4O5V A;  5TJJ A;  3CCS I;  3FWE A;  1YOV B;  1YQA A;  5E1X A;  2P5L C;  4D7N A;  2NNN A;  1AKH B;  3U21 A;  4B47 A;  3MKY B;  2FD5 A;  2K40 A;  5E8G A;  3H5A A;  4GRI A;  4CCJ A;  3J7A W;  5J4V A;  2JA7 J;  1BJZ A;  3F8C A;  2X98 A;  2L9V A;  4KIB A;  1WKM A;  1C0W A;  2DFI A;  5E17 F;  3M07 A;  2FOW A;  1WPK A;  1LEA A;  2QVO A;  2NOG A;  4X1E A;  5DTD A;  5F04 A;  3RZO J;  3MZ8 A;  3K4B A;  3KZY A;  2IS1 A;  3B02 A;  1P7J A;  2KT0 A;  1K61 A;  2H1K A;  3S3M A;  3BWG A;  2P7C B;  3KYL A;  1MGT A;  1SAN A;  4LLL A;  2R7O A;  4FIS A;  1K4T A;  2PI0 A;  2WV0 A;  3VSK A;  4N9I A;  5ILV A;  1PUE E;  5IP9 J;  3SHF A;  2H6B A;  3DWL E;  2HTJ A;  1WJE A;  2BXY A;  1RET A;  4DGW B;  1VI0 A;  3RZD J;  2HDD A;  4A5M A;  3ERE D;  4CCK A;  3CCQ I;  3VWB A;  3T5X A;  2X0L A;  2VOD A;  2OCE A;  1YIO A;  5EG0 B;  5KNL A;  4MTE A;  1HDP A;  3CJN A;  3DBR B;  2GQQ A;  5GPC A;  1FNN A;  2GA2 A;  1BW6 A;  1FWZ A;  4BE2 A;  1X3U A;  2IGN A;  2IT0 A;  1V5F A;  1SFU A;  2W85 A;  1S29 A;  2OZ6 A;  1DPR A;  3A2K A;  2DPD A;  3F3X A;  3R60 A;  1MBJ A;  1SFK A;  2LOO A;  3KLO A;  3KP2 A;  5IT9 Z;  2QEX I;  2MA3 A;  1HF0 A;  3KYC B;  2VKH A;  5DD8 A;  2Z9O A;  3F8M A;  3LST A;  1OMI A;  1ETW A;  4AVZ A;  4EQQ A;  5LGT A;  1WVR A;  1SVL A;  5TGT A;  1R5H A;  1ZRD A;  2LR8 A;  2HPI A;  2O3F A;  2MYS A;  2COB A;  3GZN B;  3M8J A;  4XQF A;  3WU1 B;  1FTT A;  5HS8 A;  3OYB A;  3DCF A;  2DAO A;  3AG2 H;  3ROU A;  4UUS A;  4BY7 J;  1FYL A;  4GGG A;  3I5U A;  5F1J A;  1Y8Q B;  2DA4 A;  3CMM A;  3ESW B;  1LFB A;  3DU5 A;  1O3Q A;  2VBW A;  4II3 A;  3RPU D;  3N4M A;  4P1W A;  5IYC J;  2KIQ A;  3GW2 A;  2BBY A;  3CTA A;  4BBS J;  1MBF A;  2DT7 B;  4U0V A;  4G12 A;  3OYL A;  3HM5 A;  4DZP A;  2QQA A;  3G73 A;  1X1A A;  3H0D A;  1IO2 A;  2QQB A;  5EEH A;  3IH3 A;  3DV8 A;  1ZG3 A;  1YO5 C;  1WI3 A;  2QQ9 A;  3BZK A;  1QA6 A;  1X4P A;  1WFX A;  1KU2 A;  4CH7 A;  2E34 A;  1XSX A;  2ZNY A;  3HXL A;  5A2Q K;  1FT9 A;  2EZL A;  1WH5 A;  2EV0 A;  4BH9 A;  2HQ5 A;  2OAZ A;  5TIS C;  3HOS A;  1FP1 D;  1P6R A;  2MFZ A;  1U9N A;  2PBI A;  1VQ5 I;  2HDC A;  1SD4 A;  1YX5 A;  1LFP A;  2K4B A;  2W48 A;  1TP4 A;  3ZN1 A;  1Z7U A;  2LDU A;  3TO9 A;  4OIN F;  4HOB A;  5BPI A;  1R7J A;  2IPQ X;  3GF2 A;  4YII A;  4E7I A;  3S93 A;  3BQZ A;  4A0Y A;  3LSG A;  1LFU P;  3RKQ A;  3T0Y A;  1JUM A;  2KMU A;  2JUC A;  3DTE A;  4K2E A;  3OYH A;  2HOE A;  2VBZ A;  4H0E A;  1ITY A;  2ZJ2 A;  3TMO A;  4IHT A;  3FBI B;  1EJ9 A;  1YI2 I;  3A0H C;  2STT A;  3K4C A;  4XKV A;  3V7S A;  2WB1 A;  5M5Y J;  3H3U A;  1OJL A;  3DF8 A;  3AL0 B;  1Y56 A;  2K9Q A;  1RIO H;  2ZO4 A;  4AM3 A;  1N78 A;  4NNJ A;  5D8L B;  1T38 A;  1I6H J;  5KK1 A;  2HQR A;  3TW6 A;  1F43 A;  4V2G A;  2YX7 A;  1ZN2 A;  4PDK A;  2E1N A;  3H5R A;  4A3F J;  5K7Z A;  2RNG A;  4EJT A;  5FKN A;  4P5O A;  1Y0N A;  2LSO A;  4KUM A;  4EJO A;  5ICC A;  2VQC A;  3W2W A;  2LNB A;  2K3F A;  2V9V A;  2JRT A;  3K2Z A;  3R0A A;  4XBF A;  2HNH A;  4IJA A;  4NUB A;  5GP9 A;  3S15 J;  3O8G A;  5L3D A;  2KZG A;  3JSO A;  2P81 A;  3UKG A;  5FO5 A;  1R1V A;  2DJN A;  1FLI A;  2BY1 A;  5C4X J;  4L9J A;  1LKX A;  3ABU A;  2H6C A;  3FMS A;  4RAY A;  5DUI A;  1ZLJ A;  1W0U A;  3V4G A;  1ZRE A;  1A6Q A;  1P4X A;  3K70 C;  1Z6T A;  1I50 J;  1DUX C;  5EF6 A;  1KQ0 A;  3KCC A;  1P9Q C;  2XUB A;  2ZME A;  2DYS H;  1WSU A;  4KFC A;  3BRO A;  4RB0 A;  3AG4 H;  4ENN A;  2ZME C;  2EBI A;  3ABK H;  3CLQ A;  3CCL I;  3FX3 A;  2BOL A;  3S17 J;  4CYC A;  5M3F J;  2DOE A;  4PUS A;  4Y4R A;  1MDM B;  3J7Z I;  2Q2E A;  1XTA A;  4AU7 A;  1UB9 A;  5BQT A;  1N77 A;  1IV6 A;  3RIR A;  1LPQ A;  2LY1 A;  3P5J A;  3BCA A;  2BW3 B;  3V7C A;  3BJO A;  1VQK I;  4XLC A;  3OSG A;  2M35 A;  3WTY C;  1RKW A;  3HEF A;  1FEX A;  3KIO A;  3ZPL A;  3LQQ A;  5KAI C;  4XLH A;  1RR8 C;  2JVG A;  3HG9 A;  4G7O F;  1Z77 A;  6PAX A;  4UXN A;  1BM9 A;  5EGO A;  3GZ5 A;  2VE9 A;  2EFW A;  1FMW A;  4XLF A;  4XM3 A;  1TWA J;  4B09 A;  1OLT A;  2DTZ A;  2E1O A;  1HQC A;  2DDA A;  3QRF F;  3EDP A;  2QWW A;  2VXD A;  4F55 A;  4F93 B;  3DEU A;  5JHU A;  4UV8 A;  2QBY A;  3D5S C;  1KON A;  3KPH A;  3QOD A;  1ZG1 A;  1L0O C;  3PIP F;  3PFY A;  4ITV A;  1FP2 A;  3IAM 2;  2E1M C;  3LA3 A;  3HHG A;  5E1Z B;  2XV4 S;  2O6G E;  2VAS A;  2IRF G;  1T95 A;  3I0T A;  3A01 B;  3LOC A;  3QOP A;  4I02 A;  3TO7 A;  1KQ9 A;  1NK3 P;  2P5K A;  4OIP F;  3HOU J;  2OUM A;  3HOZ J;  1WZ2 A;  1JJ6 C;  5IPA A;  4F92 B;  3E5U A;  2AQE A;  5F0F A;  4L9N A;  4CCL A;  4O6J A;  1VQM I;  5E1W A;  4BUP A;  1K6O A;  5LGU A;  3M3Y J;  2CQ7 A;  4E6K G;  1S8N A;  1AHD P;  1LDD A;  2DO7 A;  3BT9 A;  3SFI A;  3U9G A;  1DGR M;  1D8J A;  2CUJ A;  2DFF A;  4GYI A;  2OPT A;  2F48 A;  4MLO A;  3VDX A;  5E3O A;  2PMU A;  3WTV C;  1OCP A;  1AOY A;  3DEW A;  2O03 A;  5JR3 A;  1HKS A;  4M9S A;  2JQ7 A;  9ANT A;  2LTP A;  2JRM A;  3JAM R;  1K7A A;  3TDU C;  3P7N A;  1B4A A;  2XAJ A;  3IP4 B;  2XGD A;  2R7T A;  4L9V A;  3UR3 C;  4D5F A;  1IXS B;  1Z7L A;  1W7P D;  3F8F A;  4U7D A;  1TNT A;  3KE2 A;  3PO2 J;  2MUN A;  3DTI A;  3BTI A;  2VIX A;  3TOB A;  1K78 B;  2L4M A;  3E7L A;  2E1C A;  1XX5 A;  2HZD A;  3FXU A;  1M1E B;  1I3Q J;  2YX4 A;  4RM2 A;  4UVB A;  3J81 R;  1KU9 A;  2H09 A;  4PSW A;  4XOR A;  3ZCO A;  1XSV A;  2Y48 A;  3QP6 A;  3CUQ B;  4XON A;  2AQF A;  2XKP A;  3IKT A;  2VKD A;  3ZMS A;  2BY3 A;  1ON2 A;  3FM3 A;  2NS8 A;  3O6B B;  4DNC A;  1U6G A;  3P9C A;  4FE7 A;  4E7S A;  5J1Y A;  4RGU A;  1HA8 A;  2A6E F;  1FOY A;  2WAD A;  3HSF A;  2VJ4 A;  2XGC A;  2JJ7 A;  2RGV A;  5GPA A;  2HVS A;  2BHY A;  4NQW A;  2VN2 A;  3S2D J;  1WJA A;  1PJR A;  2KP6 A;  2WA0 A;  1T08 B;  2R5Z A;  1TQP A;  2R0Q C;  3D5L A;  2D2W A;  4PJL A;  4XKW A;  4EMS A;  5DV5 A;  2VUM J;  4HBL A;  5B5E C;  2DOD A;  2K02 A;  2ME6 A;  1TWH J;  1O7L A;  2P6T A;  5FB2 A;  2UXX A;  4OIQ F;  2VOP A;  1GDT A;  1JGS A;  1QZE A;  3K1M A;  1Y39 A;  5FD6 A;  2YU3 A;  1TQM A;  1QBJ A;  2BXZ A;  4HPQ A;  3A03 A;  2IEK A;  4I99 C;  5KHD A;  5CVU A;  4C2T A;  1IRF A;  2EZH A;  2F5D A;  3MD2 A;  5L3G A;  2Z1D A;  3CCY A;  2L2O A;  5IOZ A;  1GXQ A;  2RV8 A;  2DA5 A;  2DFE A;  1PVE A;  4NB5 A;  1E2X A;  4TV7 A;  2VKV A;  4N9H A;  1GV5 A;  3FZV A;  1K6Y A;  3IL2 A;  2P7V B;  2FU4 A;  5HVQ C;  3J80 R;  2R7Z J;  2WY8 Q;  4WXC A;  2UXN A;  2RRE A;  4R1H A;  1TQI A;  2FXA A;  3MKZ A;  1NK2 P;  1IRZ A;  2O61 A;  2BV6 A;  1TW2 A;  2IJL A;  2LYC A;  1T33 A;  2L9R A;  1B9M A;  1OYW A;  4HNV A;  4IHV A;  4HQE A;  2IXS A;  2NVY J;  2PX9 A;  4XLE A;  1BL0 A;  2GBY A;  3MKW B;  1WI9 A;  2NYX A;  3WGI A;  2R7V A;  3ZQH A;  4LGW A;  1I1G A;  3AKZ A;  2XC7 A;  1NTC A;  1B59 A;  2Q1Z B;  3QPL A;  3IH2 A;  3ZQI A;  1V54 H;  5J47 A;  1QRY A;  2DA3 A;  2WAQ N;  3HSE A;  3NWT A;  5IOY A;  4HAM A;  4FTH A;  2ZB9 A;  1QQI A;  3GUD A;  5J8F A;  1YLF A;  2ZFU A;  4JQF A;  4YFN F;  2HZT A;  2LF7 A;  5B66 C;  2QUF A;  2W7N A;  2DOA A;  1W7P B;  3S1M J;  2XGX A;  4BJ5 C;  4RAZ A;  2M0M A;  3CUQ C;  3C2B A;  2P0T A;  1S72 I;  2VC1 A;  3QQA A;  1JI8 A;  2UZK A;  1MZB A;  3W2A A;  3TBI A;  4KMU X;  4OIO F;  4A6E A;  3JRC A;  2BE5 F;  3T1B A;  3L9F A;  1FSE A;  3OS0 A;  2CQQ A;  3BJ6 A;  3PQK A;  1MMD A;  3KX2 A;  2RVC A;  5D8K B;  1Q1H A;  2CS3 A;  2E7X A;  1UJ8 A;  1STZ A;  1G3Y A;  4G6D A;  3H0G J;  4LG3 A;  3UNG C;  3CO7 C;  4WWC A;  5J40 A;  4ESB A;  5LEJ A;  2Z16 A;  1ZTR A;  2OV7 A;  3ZXS A;  3KFW X;  3EUA A;  4ZYD A;  4RDU A;  2R7D A;  1X58 A;  2M7B A;  3PQJ A;  4AIK A;  4BNC A;  1YFH A;  1ZRF A;  3GLL A;  3HIF A;  4HW0 A;  1IF1 A;  2JTV A;  3Q0W A;  1IG7 A;  2GAU A;  2P4W A;  3GFJ A;  3KEQ A;  3M8F A;  3OV8 A;  3SZG A;  1ZR4 A;  1SFO J;  5IYD J;  4P9U A;  3HOV J;  2KIS A;  2XGE A;  4BE0 A;  1BIB A;  1WJC A;  2HGC A;  5FJ8 J;  1U8B A;  2HYJ A;  3HSR A;  3E6B A;  4NBQ A;  4KN4 X;  4Y33 A;  1RC9 A;  1YRN A;  4YFX F;  1SVO A;  3CCU I;  1Z3Y A;  4MGR A;  3EUK L;  3OYI A;  4IOA F;  2W82 A;  3JW4 A;  1N25 A;  2CUE A;  3ZMD A;  5FLX K;  1ETK A;  3FXK A;  3COA C;  2FQ3 A;  4KNY A;  4R79 A;  2JMW A;  1YW9 A;  2K9M A;  1FZP B;  3TKY A;  3C3W A;  2W57 A;  2ZXI A;  3FDY A;  4LB6 B;  2IS2 A;  3OYA A;  2XRL A;  4XN0 A;  3DPT A;  1WJF A;  1ZGJ A;  1LDJ A;  4M3B A;  2KZV A;  4L0Y B;  3G3Z A;  2XRN A;  3HPG A;  5JLX A;  2Y2Z A;  4PGH A;  2W24 A;  3ABM H;  4QWQ A;  1RES A;  4AIH A;  1PUF A;  1J0R A;  2QA4 I;  1ERD A;  2XVC A;  4BS9 A;  4XLP F;  4NHJ A;  4A2U A;  5F0C A;  2CQX A;  1VTN C;  3CLO A;  1BI1 A;  3MWM A;  3JRA A;  5FLX Z;  4BXF A;  3F8B A;  2P0W A;  2F4M B;  3DKX A;  3J7Y J;  1OCR H;  2OQR A;  1I27 A;  2M7A A;  3MVP A;  1X1C A;  4KIF A;  3WTS C;  2FRH A;  1CQT A;  1BOA A;  5DM7 F;  1IN5 A;  1EV7 A;  3V42 A;  2HKO A;  2LY9 A;  3DKY A;  4YRV A;  1TL8 A;  5M5X J;  2Y9Z A;  1SAU A;  3GYH X;  3K4J A;  1ZRC A;  3EYI A;  3FKJ A;  5F1R A;  2A69 F;  4Y13 A;  2R7S A;  1DU6 A;  2LBF A;  3ZQC A;  1HOM A;  3E6D A;  3HGY A;  3M9A A;  1OIS A;  2JUG A;  2VT3 A;  2AHQ A;  4EJU A;  2M4K A;  4YEJ A;  1T0F A;  3D5R C;  2KRF A;  1UEL B;  5KVR A;  4PZJ A;  1X3W B;  3WG7 H;  1T0F C;  2H94 A;  1MJA A;  1MNE A;  2DMN A;  4LK0 F;  2M2E A;  1HXD A;  4LIT A;  3VYR B;  5ERI A;  1HKQ A;  2MC3 A;  5DYM A;  1POG A;  2CV1 A;  2OZU A;  2MG4 A;  3V8K A;  4EV0 A;  3OYJ A;  2XAH A;  1MMN A;  4KIG A;  1JE8 A;  3LA7 A;  1IUY A;  5HDG A;  2Y69 H;  1IV8 A;  4XN3 A;  3C7J A;  1TWG J;  1U5T A;  4FCY A;  4E7J A;  1RRJ A;  3DEE A;  2IA1 A;  1ETQ A;  2Z99 A;  1BW5 A;  1HBX G;  4G94 A;  1TWC J;  2G7U A;  3RDI A;  1W36 C;  5ED4 A;  5HLT A;  4RGR A;  3I4P A;  3MZY A;  4W1U A;  2R7U A;  5H2F C;  2CFO A;  4ESF A;  1A31 A;  5IP7 J;  4FE4 A;  2FNP A;  1VQ4 I;  2MH9 A;  3VEP A;  2EIJ H;  2V7F A;  4Q48 A;  3ZOB A;  3A1Y A;  3HKZ N;  2R5Y B;  3MN2 A;  5H20 A;  1SD6 A;  3ZN0 A;  5FLV A;  4XOP A;  3VOD A;  2DBB A;  3H5N A;  5J3L A;  2PMH A;  1NHA A;  3B73 A;  3K6G A;  4PCQ A;  3RQI A;  5JVT A;  4IHX A;  3IAS 2;  1FC3 A;  3R6S A;  2MD0 A;  4UUT A;  4CCM A;  3BC8 A;  2V4J C;  5CJ9 A;  5M3M J;  5AON A;  3CCM I;  1F1Z A;  3X2Q H;  3WU0 A;  2KDZ A;  3GTO J;  3VFZ A;  2JPB A;  1Z91 A;  1QNT A;  2VB6 A;  1FMV A;  3TO6 A;  1QPM A;  2L4A A;  1E3H A;  1MBK A;  5IT9 K;  1ETY A;  1X1P A;  3HJE A;  5IY5 H;  1MSF C;  1D5Y A;  1FIA A;  4DYR A;  3GWZ A;  1D1C A;  2DA7 A;  2Y0M A;  2O8X A;  2STW A;  1YYV A;  1JTY A;  1KU7 A;  3LSJ A;  2E71 A;  2PG4 A;  3IWZ A;  4HDV A;  2M4G A;  4J00 A;  2CQK A;  3ML6 A;  2IW5 A;  3BLY A;  3OSF A;  1HW2 A;  3G1M A;  2ZSH B;  1O7F A;  3RPQ A;  2KQR A;  3CDI A;  5FRN A;  4GFB A;  1N75 A;  1XS9 A;  2E35 A;  1TWF J;  1B6A A;  2KIU A;  4M73 A;  1IN4 A;  4IQJ A;  2GXG A;  2L7K A;  5K1Y A;  2VOO A;  4XLN F;  2DA2 A;  2VJJ A;  3C2G A;  3ZQL A;  1U8R A;  2MVT A;  4EGY A;  2IA2 A;  2ZFW A;  3F8N A;  4U0Y A;  3WTU C;  4DW6 A;  2I10 A;  5B3S H;  2WY7 Q;  4O3M A;  3H3Z A;  3K10 A;  4J19 A;  3CDH A;  2L7Z A;  3OY9 A;  3OYM A;  3CMA I;  1UAA A;  3LAP A;  2VQL A;  3I54 A;  4D0P A;  3IC7 A;  1QHG A;  2XSD C;  3HHH A;  3BY6 A;  2DU9 A;  3KZI C;  5DCM A;  3KET A;  5LBQ A;  4HST A;  4B48 A;  4LG0 A;  4IPA A;  3H3V K;  3F22 A;  1RZ4 A;  4AID A;  2ZC2 A;  3EET A;  4HG2 A;  2RNJ A;  3W6J B;  5J4Y A;  1R36 A;  5J8C A;  5ILS A;  1A36 A;  1ZGA A;  4IRI A;  4Q4Z F;  4A0Z A;  4RAG A;  2A5W A;  1AKH A;  1Y8R B;  2XF7 A;  1FYK A;  1MMA A;  4DZJ A;  5K5O A;  1B72 B;  5F08 A;  2V26 A;  4LJZ F;  1R1U A;  3KP6 A;  1YG2 A;  3FIW A;  3L2W A;  1BI0 A;  2B7E A;  1SC7 A;  2MSY A;  3E5Q A;  4PJ0 C;  4JX4 A;  1OR7 A;  3JSP A;  3I59 B;  1AA7 A;  1HCR A;  1P4W A;  4ZZD A;  1R71 A;  1ZGW A;  2FMY A;  1OR7 C;  4YFK F;  1RUO A;  2O9L A;  2CMP A;  2MC4 A;  1MH3 A;  2DA6 A;  3QYE A;  2ID6 A;  4BU2 A;  1SMY F;  1UCR A;  5CLS A;  1HW1 A;  2JVH A;  2QM3 A;  2JA5 J;  3W6K B;  4XRS G;  3OYG A;  2PQ8 A;  2EV5 A;  3QPH A;  2Z33 A;  1NH3 A;  4HNT A;  2V6E A;  4BJT A;  2ZXH A;  4BQA A;  3E1S A;  1FYM A;  2E2I J;  5LRS A;  1T6S A;  3OYK A;  3ZRG A;  5EG0 A;  4XID A;  1JXS A;  1MW7 A;  2WAQ A;  2XAU A;  1U9O A;  3FXM A;  5FKK A;  1P92 A;  4I7H A;  4A3B J;  2WV1 A;  2OTJ I;  1QVU A;  2DMT A;  1DQU A;  1WCM J;  5DS9 A;  3A52 A;  1Z21 A;  2A05 A;  1X2M A;  2DW4 A;  1B8I B;  2ISZ A;  1FY7 A;  4GXO A;  3VYU B;  2Y0S N;  1XG1 A;  3CDL A;  3Q9S A;  2M34 A;  2QYO A;  2QKL B;  4XR6 A;  4AYB A;  1R00 A;  2ICW G;  4V2F A;  3NEU A;  3HPH A;  3RQ4 A;  1EH7 A;  2GWR A;  3C2H A;  3MCZ A;  4DJA A;  3F6O A;  2LH9 A;  2OQG A;  2EFP A;  1R5I D;  2R7Q A;  3QYF A;  4ZTF A;  2G0E A;  4P9F A;  2VON A;  4HZF A;  4ZC3 A;  3H9J A;  2ADU A;  2VBY A;  3F72 A;  2M9H A;  3P9I A;  1HLV A;  3WTX C;  3BTL A;  1K79 A;  4NDL A;  2ELK A;  3N97 A;  1OCC H;  2VE8 A;  3PNV A;  3LWF A;  4PJM A;  5L3E A;  5C3E J;  5FGM A;  4BQN A;  2Y30 A;  4LB5 A;  3KLN A;  5F64 A;  2XIG A;  5L3F A;  3L00 A;  3CME I;  4A3G J;  2NS0 A;  4MFE A;  2L3D A;  1DGW Y;  4E7K A;  3OR1 C;  4BHP A;  1ON1 A;  1D0X A;  4UV9 A;  4CIC A;  4WK8 F;  3SJM A;  4IHW A;  4IO9 F;  2KHM A;  2HOS A;  3FM5 A;  2GLO A;  3OYC A;  3BDD A;  2BEO A;  2OD5 A;  4FT8 A;  2ZBK A;  2NRA C;  1LEB A;  3DU6 A;  1FIP A;  1CF7 B;  1QGP A;  3RJP A;  1X2N A;  3F23 A;  1WJD A;  3SFZ A;  4G7H F;  1ZG5 A;  2VJ5 A;  3Q9V A;  1NG7 A;  4HX4 A;  1H9T A;  3CCE I;  1D1B A;  2X6Y A;  2NVU B;  1B1B A;  2XAF A;  2R92 J;  1FOK A;  3HRT A;  3I9V 2;  2JZY A;  3MAJ A;  1U2W A;  1BR4 A;  1G6N A;  3TW7 A;  3HGG A;  1B9N A;  3K2A A;  2JWT A;  1GVJ A;  4BYY A;  3K1P A;  3T8T A;  2MLK A;  3DLA A;  2CV0 A;  1A04 A;  4KA4 A;  4M3F A;  4IL6 C;  5CQE A;  1LE8 B;  2EA2 A;  1K4S A;  1YTY A;  2NVX J;  4C2M J;  3J81 Z;  1MBG A;  1REP C;  4QIW N;  2R7W A;  3GTM J;  1XDS A;  1BN5 A;  2QGU A;  4QPO A;  5ICG A;  1G4D A;  4FX0 A;  2ZKZ A;  4DBR A;  2KFD A;  1JUS A;  4ENK A;  2AXL A;  5CVR A;  4WXD A;  2O8K A;  2PJR B;  2VI6 A;  1PP7 U;  1GV2 A;  3WHC A;  5F0H A;  2CRG A;  4F7Z A;  4ZJZ A;  3RTR A;  3ABT A;  3R4K A;  3TP3 A;  2B0L A;  5E20 A;  2VLA A;  3RYR A;  2VKE A;  3AFH A;  2KRC A;  1ETV A;  5GAH J;  3AL0 C;  3T8R A;  1G3S A;  3H9G A;  4U0W A;  2CSO A;  2ZJP F;  5D6F A;  3WE2 A;  2HU9 A;  2YSR A;  3FHZ A;  1DP3 A;  2PMZ N;  3BZC A;  1QHH D;  3OYF A;  1WWX A;  3E6M A;  1X1B A;  5A2Q R;  4ENJ A;  1TNS A;  2X4H A;  2EFN A;  3HTU A;  2M45 A;  4PGG A;  2DMP A;  1K83 J;  5JLW A;  5GAD J;  1HKT A;  1V5G A;  4FAS D;  2IP2 A;  3KEY A;  3TED A;  3ZMT A;  5FRO A;  5BMZ A;  1IW7 F;  2EIN H;  2IGK A;  2LLK A;  2Y75 A;  5HLI A;  3CC4 I;  2FNA A;  5BNG A;  3CC7 I;  3S2H J;  3DFG A;  2W4S A;  3NWS A;  3R0J A;  4OIR F;  2CJJ A;  3GTL J;  4L5E A;  1IXR C;  4OU0 A;  2EJR A;  2KJC A;  3QPS A;  4ZZL A;  1OCO H;  1O57 A;  1IRX A;  4AWX B;  2Y9Y A;  4OMZ A;  1BC7 C;  3J80 Z;  1E17 A;  2NS7 A;  4OAZ A;  1IDY A;  3OOU A;  1Z0X A;  1ULY A;  3Q3S A;  2GA1 A;  4KT6 A;  4UVA A;  2ACJ A;  2FE3 A;  3CC2 I;  4PJN A;  4PK4 A;  3HL2 A;  2RQQ A;  1WHU A;  3ASN H;  4B43 A;  4JX5 A;  4HV5 A;  5J1R A;  1Y1V J;  1H8A C;  1RQ6 A;  4L5I A;  5CVJ A;  2K5C A;  1MDM A;  4M6X A;  2A3S A;  2FF4 A;  4HNU A;  4B3A A;  2XF6 A;  2BW3 A;  1HSJ A;  2F6C A;  4XRM A;  2IVM A;  2DI3 A;  1J59 A;  2B9S A;  3WHB A;  3JTH A;  1UZC A;  3ONQ A;  4IQ4 A;  4E7L A;  3KEO A;  3OOP A;  4I0A A;  2PFB A;  3BR0 A;  2HYG D;  2K9S A;  4RAF A;  3U1K A;  1XMK A;  1D8K A;  3FK6 A;  2VQG A;  4XRS A;  2C6Y A;  1GT0 C;  3K7A J;  4HA8 A;  4RGX A;  4QLC U;  3OS1 A;  5K5Q A;  1BBY A;  1SEU A;  2M8E A;  4C30 A;  3LNQ A;  2OCC H;  3CCJ I;  2EIM H;  1IUF A;  5HNF A;  3NAR A;  1OCZ H;  1EF4 A;  4EJV A;  4DYQ A;  2J5P A;  1JKP C;  1ZKG A;  4RA2 A;  4U7B A;  2EA4 A;  4RB1 A;  5IT3 A;  3CCR I;  1R22 A;  3A01 A;  2NNY A;  1J9I A;  1AU7 A;  1IN6 A;  3U2R A;  3WGH A;  2KIM A;  1FBS A;  4YEL A;  2QKM B;  2X51 A;  3LMM A;  1YIJ I;  3CF5 F;  1H89 C;  4LIU A;  3ASO H;  4KDP A;  2BY0 A;  3EUH A;  3BR1 A;  4W97 A;  2DA1 A;  1W36 D;  4N0B A;  3QP5 A;  3EUH C;  2H8R A;  4MQV A;  3WG9 A;  4ANJ A;  5BS6 A;  5E3M A;  4BKX A;  4XKB A;  4BGD A;  1ZK8 A;  1OKR A;  3OR2 C;  3W6V A;  1XN7 A;  4CGZ A;  3E97 A;  2X85 A;  4S0H B;  4YG2 F;  1IN8 A;  2XRO A;  1QZZ A;  5LHH A;  1R6R A;  3KZZ A;  1U0J A;  4YIF A;  4EJW A;  3DPL C;  5D4R A;  1WH7 A;  2JA8 J;  4UNO A;  2CW8 A;  2XAQ A;  3PUB A;  3S32 A;  4BEH B;  3RKX A;  3IKV A;  3ECO A;  4HRI A;  3BPV A;  1K78 A;  3L1P A;  1APL C;  1UHS A;  2XF5 A;  1E3P A;  4UB6 C;  3TDZ C;  4B8X A;  3MFK A;  2M3A A;  4CA0 A;  4PFO A;  4WX9 A;  4CXF A;  3GFL A;  4Q5S F;  2CU7 A;  3CUQ A;  5K7F A;  3R61 A;  3PIO F;  1D0Z A;  2YS9 A;  3L2R A;  2PEX A;  2ESN A;  4N4N B;  1NG6 A;  4I98 B;  4WXH A;  4CDG A;  2LRE A;  4BBR J;  1J5Y A;  3WE3 A;  2BGC A;  5JI6 A;  3FXR A;  2MLG A;  3LSP A;  5DDG A;  4OOI A;  1XC5 A;  1IZ1 A;  2BZT A;  2CUZ A;  1IXC A;  2JA2 A;  4ASN A;  1HW5 A;  4XKC A;  3WOD F;  1ZAO A;  4HF2 A;  3JRH A;  4U88 A;  1IDZ A;  2AO9 A;  3HUG B;  4AVP A;  3I71 A;  2NOJ B;  4L18 B;  2EFO A;  4B1R A;  1Z05 A;  2L01 A;  2MW8 A;  3F9K A;  1G3T A;  2ZXJ A;  4WCG A;  1J7K A;  3PSF A;  4LIV A;  1I1S A;  2FX0 A;  1D0Y A;  4C3I J;  3RYP A;  4ZDO A;  2XDV A;  4JP0 A;  4C3H J;  5D5W B;  4NC6 A;  4HYE A;  3ZQQ A;  1F5T A;  4A12 A;  3BJA A;  3G1L A;  1X4O A;  4GYG A;  2WWY A;  2DPU A;  1V3F A;  2FEZ A;  2G9W A;  3LA2 A;  2HFH A;  2QSH X;  1ENH A;  2MAB A;  1D5V A;  1XDU A;  2UUZ A;  1RKT A;  2QSF X;  1FOX A;  2M1B A;  4FET A;  3WTW C;  4Y3O A;  3E0J B;  3E5X A;  4UUV A;  3SQN A;  4EVI A;  1S6L A;  2P8T A;  3VB2 A;  3HBL A;  3ZR8 X;  4BXX J;  2XKO A;  2CFX A;  2VC0 A;  3HDD A;  3VYS B;  3TP0 A;  1KQ8 A;  1PYV A;  1A6I A;  2M5W A;  5AIP A;  2EQR A;  1S3J A;  3I55 I;  2XHK A;  3MKL A;  4KYW A;  2JSP A;  4A6D A;  2L7F P;  2V1D A;  3I64 A;  2DMU A;  2LP0 A;  1BI3 A;  4FQG A;  3OS2 A;  2CYY A;  3I4N J;  1J09 A;  4KT5 C;  5CYV A;  2UWM A;  4IKF A;  4ZDP A;  2JSC A;  3HTS B;  3FF5 A;  2FQ4 A;  4G7Z F;  3LAJ A;  3BG9 A;  1W7P A;  4BAC A;  3V8J A;  4B3X A;  3ELK A;  2LK2 A;  3ABL H;  3ECH A;  4HF0 A;  4E7H A;  3O8H A;  5LLQ A;  5FKO A;  3ZP5 A;  2JT1 A;  3BTC A;  3I3L A;  1U78 A;  1Z6R A;  2MD5 A;  3DLL F;  5BOX A;  3I56 I;  4MNU A;  4UHT A;  1UHM A;  3K1N A;  5ILU A;  2XPU A;  4HLY A;  1D1A A;  2V9K A;  5HOO A;  2A61 A;  1LVA A;  2DLL A;  4GDF A;  1LQ1 A;  3S1N J;  2V79 A;  2DT5 A;  4OAY A;  2OTL I;  2FUG 2;  4XSZ F;  4HSR A;  5HLH A;  4ZYG A;  4CCO A;  5GTI C;  1R4M B;  2BYV E;  2MGQ A;  2DCE A;  1KA8 A;  4ON0 A;  2O7O A;  1TW3 A;  5E18 F;  1P2F A;  1G3W A;  2KIF A;  3ZQG A;  5HOD A;  4RB3 C;  3KP7 A;  4CCN A;  2X1D A;  3E3V A;  2YPR A;  5FKL A;  3BG6 A;  1XGS A;  4A3C J;  4BDZ A;  3F21 A;  1PDN C;  2DQR A;  3BR5 A;  3S16 J;  1SD5 A;  3HYI A;  3WU2 C;  4A93 J;  2ETH A;  1EH8 A;  3MEX A;  2K3P A;  1EA3 A;  3LSH A;  1W0T A;  1YHQ I;  1SAX A;  3CD6 I;  4A3D J;  5M5W J;  2X6X A;  5FFZ A;  1UHW A;  4B44 A;  4JYK A;  5HS7 A;  4EM1 A;  1MBH A;  3K70 D;  1SD7 A;  2L9N A;  2VT2 A;  2D5V A;  1O3T A;  1I5Z A;  3OL3 A;  3M1C A;  3O2P E;  4I76 A;  2DK8 A;  1OYY A;  3BR3 A;  2A07 F;  1HDD C;  3HC7 A;  2VPL A;  1JHH A;  2L54 A;  5EZH A;  4UVC A;  4I01 A;  3M8E A;  2F5E A;  3BCB A;  1HC8 A;  1GVD A;  4BQO A;  2FSW A;  2EB7 A;  4UUS B;  4UY8 I;  2E2H J;  2H27 A;  3L7W A;  1P4A A;  1XB4 A;  2N8G A;  3FKI J;  4X6A J;  1VFC A;  3GX4 X;  4HX7 A;  3HOX J;  2VXZ A;  4E4H A;  4BE1 A;  4ZYH A;  3H92 A;  1VQO I;  1S7O A;  2HKX A;  2GXA A;  4LFU A;  4DIQ A;  2QLZ A;  3P9K A;  4FHT A;  1YIT I;  2YU9 J;  4M9Z A;  2IAI A;  1ZR2 A;  3D0S A;  3PSI A;  3IHU A;  1O3S A;  4MIM A;  4A3L J;  3ZMV A;  1UG2 A;  4D1Q A;  3HRM A;  4NC8 A;  1YJN I;  4A0X A;  3M7G A;  3FMR A;  2Q0O A;  2NVT J;  5CKT A;  5FLX R;  1VZ0 A;  4S05 A;  1WQ2 A;  2GXB A;  3F6V A;  1T39 A;  3JRE A;  3FXL A;  2CV2 A;  2XAS A;  3GXO A;  4IEJ A;  2ECC A;  2LKP A;  2Z2S B;  2EZK A;  2XPV A;  1G8X A;  4FX4 A;  2W25 A;  4IRH A;  1LNW A;  4BDY A;  1W4M A;  3JCU C;  3OWT A;  3HZJ A;  2EWN A;  2FBH A;  4M6Y A;  4HX8 A;  2E5N A;  1YE9 A;  4ENM A;  4MTD A;  2EH3 A;  5D5U B;  2LD5 A;  5H6Q A;  3JRD A;  2A68 F;  3SYT A;  3SDB A;  1MNM C;  2IA0 A;  1ZH5 A;  1YS6 A;  2XSJ C;  1Y1W J;  3J7A O;  4DYC A;  3JRI A;  5HDK A;  1H0M A;  2I5U A;  1GUU A;  2TDX A;  2F5F A;  2HXO A;  2A5Y B;  4MO7 A;  4S04 A;  2AXT C;  2D1V A;  3PL8 A;  5D5V B;  3BP8 A;  5IYB J;  1VQ7 I;  3K69 A;  4L0Z B;  4IRG A;  3D1N I;  1VQN I;  4AIJ A;  2R5Y A;  2W00 A;  2F4I A;  5K7H A;  2Z5U A;  2L9S A;  1Z1D A;  2O5R A;  2MZ4 A;  4ABZ A;  1J2X A;  1LDK B;  2MH2 A;  2ISY A;  2NXN B;  2W84 A;  4KIC A;  3PNT A;  5J6X A;  3K4K A;  1O3R A;  1KGS A;  2DTR A;  5FLM J;  1W1W E;  3PFI A;  5HLG A;  1MSE C;  4BY1 J;  3BPX A;  4KJZ A;  3CP8 A;  3OYE A;  3GBG A;  4JK1 X;  1IC8 A;  2ZNZ A;  2DJI A;  2R7X A;  3FXJ A;  2TCT A;  3L2U A;  3K0L A;  1DP7 P;  3V7R A;  2BHZ A;  1QU3 A;  4EM0 B;  2RN7 A;  4IX7 A;  5LFA A;  2Q8K A;  1R49 A;  3GTP J;  1FX7 A;  3TOA A;  2E60 A;  2CG4 A;  5E3L A;  3BG5 A;  5LEK A;  3G71 I;  2A6H F;  2F4O B;  2WC2 A;  1ORK A;  4BHB A;  2R3S A;  2ZME B;  2BY2 A;  5D5X B;  3DTK A;  5EJC A;  2F5C A;  3E6C C;  1R23 A;  3GFM A;  1U3E M;  4IVN A;  1I39 A;  2DMQ A;  4XMY A;  2V9P A;  2X6W A;  4P96 A;  4MHG A;  5C4J J;  4LLN A;  2JA6 J;  2W1O A;  2RDP A;  4CYC B;  2L7M P;  2K9N A;  3IUO A;  3SXY A;  2LF8 A;  2Q2E B;  4L9T A;  2E2J J;  1T8I A;  2WTE A;  2X1C A;  3IWF A;  4QTR A;  3L2C A;  2YUS A;  1I3A A;  2QEN A;  5K5R A;  1VQP I;  4XL9 A;  2KDO A;  3DBH B;  2LKX A;  3HRS A;  2YR2 A;  2FOK A;  1LUJ B;  5EEG A;  3FXQ A;  3GFI A;  3KP4 A;  3SZT A;  3LQR A;  3WGG A;  2HTS A;  4I2O A;  3HRU A;  1RUN A;  1ACI A;  2ZSI B;  3QOE A;  4CHU A;  2ZJR F;  4E7Z A;  1EH6 A;  3CO6 C;  1FTZ A;  4RBO A;  4ZTJ A;  3LFK A;  1XMX A;  2D45 A;  5EGO B;  2PN6 A;  1MIJ A;  3TQN A;  2LMD A;  1ETX A;  4LD5 A;  2EFQ A;  2VPR A;  2X9D A;  4Y15 A;  4G9Y A;  5FD5 A;  4I0B A;  5A2Q Z;  2X1E A;  4KMF A;  1T98 A;  1RPW A;  5IP6 A;  5F6F A;  3JAM K;  2LC2 A;  2QBY B;  2NAZ A;  4H4K C;  1W5S A;  1SMT A;  5IT9 R;  3M1E A;  2CH0 A;  1UMQ A;  2E1M B;  1MJ9 A;  3BQY A;  2R7R A;  4IOC F;  5AIQ A;  1ETO A;  3C18 A;  4MEY F;  2HQA A;  2R4G A;  4UB8 C;  1H88 C;  3DPU A;  2R7F A;  1F4K A;  3Q0V A;  2ME0 A;  3GME A;  4EM2 A;  4ZH4 F;  3QU6 A;  4KIT B;  2X6O A;  1S9H A;  2K27 A;  4XK4 A;  4Z2Y A;  2ELJ A;  4M74 A;  3RKW A;  3J81 K;  4Z6Y A;  5JFR A;  4RLQ A;  3CF2 A;  2HQN A;  1B72 A;  2X48 A;  1S5L C;  3GZ6 A;  2PLY A;  1TT5 B;  4A3K J;  2CO5 A;  3WTZ A;  2HVQ A;  4M3E A;  2KLO A;  2UV1 A;  3CZ6 A;  3JAM Z;  2CUF A;  3I59 A;  2R93 J;  1ZAR A;  4BQQ A;  4C9Y A;  2L5Q A;  3PM1 A;  1BC8 C;  4I09 A;  2DOF A;  4JBA A;  3ULQ B;  4MFD A;  2IS6 A;  5HDN A;  3RKY A;  1LVK A;  3EYY A;  5CVI A;  3JR9 A;  3U1D A;  5C44 J;  2CQN A;  1FJL A;  4X0G A;  1YS7 A;  2G7H A;  2P5V A;  2FBI A;  1E0E A;  3IRQ A;  3PNY A;  3LSM A;  2V1N A;  3ERM A;  1V5E A;  3CCV I;  4RGS A;  2K86 A;  4LMY A;  4A3E J;  3M4O J;  4N4O B;  5L3C A;  3RI4 A;  2QF7 A;  5LRR A;  3TL4 X;  5GAE J;  1IJW C;  2NVQ J;  2K7L A;  1T2K A;  1IGN A;  4GCV A;  1W5T A;  5DCF A;  3A0B C;  4Q47 A;  1R9T J;  2HEO A;  1JKQ C;  5H6R A;  1XSD A;  1BI2 A;  1B8I A;  4IHY A;  3FIS A;  2VL8 A;  2IBD A;  1TT0 A;  1YJW I;  2BVL A;  5L3B A;  1VF9 A;  2GOX B;  3AG3 H;  1JGG A;  2LVS A;  3ZGK A;  2GM4 A;  1E3O C;  1VQ8 I;  3J80 K;  4DOZ A;  3C1D A;  4C2U A;  1RNL A;  1X1D A;  2LY2 A;  3A4C A;  1Z9C A;  4EEF G;  2OF7 A;  1KU3 A;  1R1T A;  4KN7 X;  4XRF A;  5DM6 F;  3CUO A;  3QWL A;  4M72 A;  2MBF A;  1H9G A;  3FBN B;  4NQW B;  2CW0 F;  3JRF A;  2R5Z B;  1MJB A;  3L09 A;  1UST A;  3HOT A;  3G2B A;  1ZEL A;  3VYT B;  3PUF A;  2HOT A;  1GHC A;  4OWR B;  1TC3 C;  3BZ6 A;  5ICE A;  3F0C A;  4BXU A;  3KYD B;  3CJT B;  2HYF A;  3FK7 A;  2ESH A;  1JUP A;  3ZQF A;  1Y0U A;  1V4R A;  3VSL A;  1CF7 A;  4M71 A;  1YW8 A;  2A6T A;  2DQL A;  2OA4 A;  3BG3 A;  4L5J A;  2KRH A;  4CYD A;  2ECB A;  2CGP A;  1CGP A;  1OFC X;  3SEQ A;  1KYW A;  4LLG F;  1SFE A;  3Q5F A;  4HEA 2;  4XLA A;  2I8D A;  2JN6 A;  3RPU A;  2K4J A;  3HKZ A;  3LL7 A;  1QO0 D;  4G6T B;  4P55 A;  3CP2 A;  4CZC A;  3L2Q A;  1A35 A;  3DXJ F;  4EAT A;  1MND A;  4R8H A;  1LE8 A;  4WF2 A;  2WAE A;  4RB2 C;  2KJB A;  1P7I A;  3Q0U A;  2HI3 A;  4A3J J;  1FPQ A;  3I58 A;  3RCO A;  4F3Q A;  1UFM A;  4A69 C;  1MD0 A;  4RMN A;  4II2 A;  2EIK H;  3SZP A;  1IN7 A;  1FBU A;  2L0K A;  5LD2 C;  2RAE A;  1TTY A;  2PJR A;  2VBX A;  2H8W A;  5E79 C;  4CZZ A;  2J5O A;  5EEA A;  2IGM A;  4HQM A;  1PP8 F;  1OCT C;  2JK3 A;  3OIO A;  2HVR A;  3GTK J;  1ODD A;  2L02 A;  5DD4 A;  1ZQ3 P;  1D3Y A;  1S7E A;  1XMA A;  2B63 J;  4Y7N J;  5DEQ A;  2BVM A;  2F2E A;  3EQL F;  2HPM A;  1XD7 A;  2Y31 A;  2V6C A;  3EPZ A;  4M6V A;  2DXI A;  3S2W A;  4DBQ A;  1DPU A;  1XCB A;  3DKW A;  4A3M J;  1IAW A;  1XGM A;  2V1U A;  3DP7 A;  2COM A;  2EIL H;  4Y52 J;  4BHC A;  4IXA A;  3GTG J;  4IF4 A;  3W2V A;  3CJQ B;  1RR7 A;  1RI7 A;  2QSG X;  4RLF A;  3MMY B;  3GEZ A;  3OYN A;  3PO3 J;  3J7A Y;  1OQY A;  4U87 A;  2LG4 A;  3BR6 A;  3KP5 A;  1J75 A;  4D9J A;  1XGN A;  4G8X A;  4M9X A;  5JHF A;  2QZ8 A;  3QYB A;  3I53 A;  4IZZ A;  2TRT A;  2VJI A;  4JOM A;  2DDB A;  2DN0 A;  3NRV A;  1FOW A;  1XGO A;  5B1B H;  2QCO A;  2EK5 A;  4B4C A;  5EDN A;  2P6S A;  3K4M A;  3LSI A;  2H1L A;  2IGO A;  1JKR C;  2DFH A;  2OJE D;  2ELH A;  2M0C A;  3FMQ A;  3IH4 A;  1TLH B;  2RKH A;  5D6E A;  2XB0 X;  3KP3 A;  2OC6 A;  2FA5 A;  5JVG F;  1YRN B;  4BL0 B;  5E3N A;  5TRD A;  1X19 A;  2AS5 F;  3OIQ A;  2E5Z A;  4ESJ A; 
#chains in the Genus database with same CATH homology
 2Z3Y A;  1XCV A;  1ZLK A;  4IHS A;  2OU2 A;  4HLX A;  2FBK A;  2PJP A;  1DDN A;  3TGN A;  3QU3 A;  2ZCW A;  4CO8 A;  5BPD A;  1I6X A;  2M30 A;  5LHG A;  4OMY A;  5HS9 A;  5LGN A;  4MEX F;  4E70 A;  3GLX A;  2GIV A;  3ZMU A;  1OPC A;  1LJ9 A;  1S7A A;  1ZYR F;  4G6Q A;  3ZQ7 A;  3MZH A;  5FFX A;  2V1X A;  3GVA A;  2E7W A;  1MKM A;  1IRG A;  4HF1 A;  1HST A;  1WRJ A;  1FBQ A;  3QAH A;  4XSX F;  1U5T B;  1ONV A;  2XAG A;  3GO5 A;  5E8I A;  1LB2 A;  2DK5 A;  1JHF A;  2CWE A;  3QPT A;  3DQV C;  3V8L A;  4HV6 A;  3ISP A;  1TBX A;  4A5N A;  2HWV A;  2M87 A;  5DUK A;  4EGZ A;  2KKO A;  1L3L A;  2GZW A;  1USS A;  5LHI A;  2JPC A;  4GO1 A;  1ZHF A;  1OYI A;  4RS8 A;  3HUG A;  2RQP A;  4AD9 A;  2RC4 A;  2OBP A;  3MQ0 A;  2EV6 A;  4Y17 A;  4HDU A;  3ZMZ A;  1R58 A;  3NQO A;  5ICF A;  3K9T A;  3REO A;  1AWC A;  3VOE A;  2HR3 A;  1GXP A;  1FSH A;  1F9N A;  4ETS A;  4LK1 F;  2O0Y A;  5CVV A;  1KYZ A;  3JTG A;  1BIA A;  4MQ9 F;  1BJA A;  2D1H A;  1SFX A;  5D4S A;  3BOQ A;  1U5T C;  4BAY A;  2HS5 A;  5DCM B;  2FML A;  1QZY A;  3AAF A;  4LG0 B;  4ZYE A;  1YW7 A;  3WTT C;  4DQ2 A;  1R5G A;  3IRR A;  3O3K A;  4O5V A;  5TJJ A;  3FWE A;  1YQA A;  5E1X A;  2P5L C;  2NNN A;  5E8G A;  3F8C A;  4KIB A;  1WKM A;  1C0W A;  2DFI A;  5E17 F;  1LEA A;  2QVO A;  3KZY A;  3B02 A;  3BWG A;  2P7C B;  1MGT A;  4LLL A;  2PI0 A;  2WV0 A;  4N9I A;  5ILV A;  1PUE E;  3SHF A;  2H6B A;  2HTJ A;  4A5M A;  3ERE D;  3T5X A;  2X0L A;  2VOD A;  1YIO A;  4MTE A;  3CJN A;  2GQQ A;  1FNN A;  2GA2 A;  1FWZ A;  1X3U A;  2IT0 A;  1SFU A;  2W85 A;  1S29 A;  2OZ6 A;  1DPR A;  2DPD A;  3F3X A;  3R60 A;  3KLO A;  3KP2 A;  5IT9 Z;  2MA3 A;  5DD8 A;  2Z9O A;  3F8M A;  3LST A;  1OMI A;  4EQQ A;  5LGT A;  1R5H A;  1ZRD A;  2O3F A;  3WU1 B;  5HS8 A;  2DAO A;  3ROU A;  1FYL A;  4GGG A;  3I5U A;  1O3Q A;  2VBW A;  3N4M A;  3GW2 A;  2BBY A;  3CTA A;  4U0V A;  2QQA A;  3G73 A;  2QQB A;  5EEH A;  3DV8 A;  1ZG3 A;  1YO5 C;  2QQ9 A;  1KU2 A;  2ZNY A;  1XSX A;  5A2Q K;  1FT9 A;  4BH9 A;  2EV0 A;  2OAZ A;  3HOS A;  1FP1 D;  1P6R A;  2PBI A;  2HDC A;  1SD4 A;  2K4B A;  3ZN1 A;  1Z7U A;  2LDU A;  3TO9 A;  4OIN F;  4HOB A;  5BPI A;  1R7J A;  2IPQ X;  3GF2 A;  4YII A;  4A0Y A;  3T0Y A;  4K2E A;  2HOE A;  2VBZ A;  4H0E A;  2ZJ2 A;  4IHT A;  2STT A;  3V7S A;  3H3U A;  3DF8 A;  1RIO H;  2ZO4 A;  5D8L B;  1T38 A;  5KK1 A;  2HQR A;  2YX7 A;  1ZN2 A;  4PDK A;  2E1N A;  4EJT A;  4P5O A;  5ICC A;  4KUM A;  2LSO A;  4EJO A;  2LNB A;  2V9V A;  2JRT A;  3K2Z A;  3R0A A;  4XBF A;  4IJA A;  5L3D A;  3JSO A;  5FO5 A;  1R1V A;  1FLI A;  4L9J A;  3ABU A;  2H6C A;  3FMS A;  4RAY A;  5DUI A;  1ZLJ A;  3V4G A;  1ZRE A;  1P4X A;  1Z6T A;  1DUX C;  1KQ0 A;  3KCC A;  2XUB A;  2ZME A;  1WSU A;  4KFC A;  3BRO A;  4RB0 A;  4ENN A;  3FX3 A;  1MDM B;  2Q2E A;  1UB9 A;  5BQT A;  3RIR A;  3V7C A;  3BJO A;  3WTY C;  3ZPL A;  3LQQ A;  4G7O F;  6PAX A;  4UXN A;  1BM9 A;  3GZ5 A;  2VE9 A;  2EFW A;  4B09 A;  1HQC A;  3QRF F;  3EDP A;  2QWW A;  3DEU A;  5JHU A;  4UV8 A;  2QBY A;  1ZG1 A;  1L0O C;  1FP2 A;  3LA3 A;  3HHG A;  5E1Z B;  2XV4 S;  2O6G E;  2IRF G;  3I0T A;  3QOP A;  4I02 A;  3TO7 A;  1KQ9 A;  2P5K A;  4OIP F;  3E5U A;  4L9N A;  4O6J A;  5E1W A;  1K6O A;  5LGU A;  1S8N A;  1LDD A;  2DO7 A;  3U9G A;  1D8J A;  4GYI A;  2PMU A;  3WTV C;  1AOY A;  2O03 A;  5JR3 A;  1HKS A;  4M9S A;  1K7A A;  3TDU C;  3P7N A;  1B4A A;  2XAJ A;  4L9V A;  1IXS B;  1W7P D;  3F8F A;  4U7D A;  1TNT A;  3KE2 A;  3TOB A;  1K78 B;  2L4M A;  2E1C A;  3FXU A;  4UVB A;  2YX4 A;  1KU9 A;  2H09 A;  1XSV A;  2Y48 A;  3QP6 A;  3CUQ B;  2XKP A;  3IKT A;  3ZMS A;  1ON2 A;  3FM3 A;  3O6B B;  4DNC A;  1U6G A;  3P9C A;  4RGU A;  2A6E F;  3HSF A;  2RGV A;  4NQW A;  2VN2 A;  1TQP A;  3D5L A;  2D2W A;  4EMS A;  5DV5 A;  4HBL A;  2K02 A;  1O7L A;  2P6T A;  5FB2 A;  2UXX A;  4OIQ F;  2VOP A;  1JGS A;  3K1M A;  5FD6 A;  2YU3 A;  1TQM A;  1QBJ A;  5CVU A;  1IRF A;  2F5D A;  5L3G A;  1GXQ A;  2RV8 A;  4NB5 A;  1E2X A;  4TV7 A;  4N9H A;  3FZV A;  3IL2 A;  2P7V B;  2FU4 A;  5HVQ C;  4WXC A;  2UXN A;  4R1H A;  1TQI A;  2FXA A;  2O61 A;  2BV6 A;  1TW2 A;  2IJL A;  1B9M A;  1OYW A;  4HQE A;  1WI9 A;  2NYX A;  3WGI A;  4LGW A;  1I1G A;  1B59 A;  3HSE A;  4HAM A;  1QQI A;  3GUD A;  5J8F A;  1YLF A;  4JQF A;  4YFN F;  2HZT A;  2LF7 A;  2QUF A;  1W7P B;  2XGX A;  4RAZ A;  3CUQ C;  2VC1 A;  2UZK A;  1MZB A;  4OIO F;  4KMU X;  4A6E A;  2BE5 F;  3T1B A;  3L9F A;  1FSE A;  3BJ6 A;  3PQK A;  2RVC A;  5D8K B;  1Q1H A;  2E7X A;  1STZ A;  1G3Y A;  4G6D A;  3CO7 C;  4WWC A;  4ESB A;  5LEJ A;  3KFW X;  4ZYD A;  2R7D A;  3PQJ A;  4AIK A;  4BNC A;  1YFH A;  1ZRF A;  3HIF A;  4HW0 A;  1IF1 A;  2JTV A;  2GAU A;  2P4W A;  3GFJ A;  3KEQ A;  3M8F A;  3OV8 A;  4P9U A;  1BIB A;  2HGC A;  3HSR A;  3E6B A;  4KN4 X;  4YFX F;  4MGR A;  3JW4 A;  3ZMD A;  5FLX K;  3COA C;  2FQ3 A;  4KNY A;  4R79 A;  1YW9 A;  1FZP B;  3TKY A;  3C3W A;  2W57 A;  4LB6 B;  3DPT A;  1ZGJ A;  1LDJ A;  4L0Y B;  3G3Z A;  2XRN A;  4PGH A;  2W24 A;  4QWQ A;  4AIH A;  1J0R A;  2XVC A;  4XLP F;  4NHJ A;  4A2U A;  1VTN C;  3CLO A;  1BI1 A;  3MWM A;  5FLX Z;  3F8B A;  2OQR A;  1I27 A;  4KIF A;  3WTS C;  2FRH A;  1BOA A;  1IN5 A;  1EV7 A;  2HKO A;  3GYH X;  1ZRC A;  3EYI A;  5F1R A;  2A69 F;  4Y13 A;  3E6D A;  3M9A A;  2VT3 A;  4EJU A;  1T0F A;  2KRF A;  5KVR A;  4PZJ A;  2H94 A;  1MJA A;  4LK0 F;  1HXD A;  5ERI A;  1HKQ A;  2MC3 A;  5DYM A;  2OZU A;  3V8K A;  4EV0 A;  2XAH A;  4KIG A;  1JE8 A;  1IUY A;  3LA7 A;  5HDG A;  3C7J A;  1U5T A;  2IA1 A;  2Z99 A;  1HBX G;  4G94 A;  2G7U A;  3RDI A;  5ED4 A;  4RGR A;  3I4P A;  3MZY A;  4ESF A;  2FNP A;  2MH9 A;  3VEP A;  4Q48 A;  5H20 A;  1SD6 A;  3ZN0 A;  3VOD A;  2DBB A;  2PMH A;  1NHA A;  3B73 A;  4PCQ A;  5JVT A;  1FC3 A;  3R6S A;  5CJ9 A;  5AON A;  1F1Z A;  3WU0 A;  3VFZ A;  2JPB A;  1Z91 A;  1QNT A;  3TO6 A;  1QPM A;  2L4A A;  5IT9 K;  3GWZ A;  2Y0M A;  2O8X A;  2STW A;  1YYV A;  1KU7 A;  2PG4 A;  3IWZ A;  4HDV A;  2CQK A;  3ML6 A;  2IW5 A;  1HW2 A;  1O7F A;  3RPQ A;  1B6A A;  2KIU A;  4M73 A;  1IN4 A;  2GXG A;  5K1Y A;  2VOO A;  4XLN F;  1U8R A;  4EGY A;  2IA2 A;  2ZFW A;  3F8N A;  4U0Y A;  3WTU C;  4O3M A;  3H3Z A;  3CDH A;  3LAP A;  3I54 A;  4D0P A;  3IC7 A;  3HHH A;  3BY6 A;  2DU9 A;  3KET A;  5DCM A;  5LBQ A;  4LG0 A;  4IPA A;  3F22 A;  1RZ4 A;  3EET A;  2RNJ A;  3W6J B;  1R36 A;  5J8C A;  5ILS A;  1ZGA A;  4IRI A;  4Q4Z F;  4A0Z A;  1FYK A;  5K5O A;  4LJZ F;  1R1U A;  3KP6 A;  1YG2 A;  1BI0 A;  3E5Q A;  1OR7 A;  3JSP A;  3I59 B;  1P4W A;  4ZZD A;  2FMY A;  4YFK F;  1RUO A;  1SMY F;  1UCR A;  5CLS A;  1HW1 A;  2QM3 A;  3W6K B;  2Z33 A;  2PQ8 A;  2EV5 A;  3QPH A;  4BQA A;  1FYM A;  5LRS A;  1T6S A;  1JXS A;  1P92 A;  4I7H A;  2DW4 A;  2ISZ A;  1FY7 A;  4GXO A;  3Q9S A;  2QYO A;  1R00 A;  3NEU A;  1EH7 A;  2GWR A;  3MCZ A;  3F6O A;  2OQG A;  2EFP A;  4P9F A;  2VON A;  4HZF A;  2ADU A;  2VBY A;  3F72 A;  3P9I A;  1K79 A;  3WTX C;  3N97 A;  2VE8 A;  3LWF A;  5L3E A;  5FGM A;  4LB5 A;  3KLN A;  5F64 A;  2XIG A;  5L3F A;  3L00 A;  2NS0 A;  2L3D A;  4BHP A;  1ON1 A;  4UV9 A;  4CIC A;  4WK8 F;  3FM5 A;  3BDD A;  2BEO A;  2OD5 A;  4FT8 A;  2ZBK A;  2NRA C;  1LEB A;  1CF7 B;  1QGP A;  3RJP A;  3F23 A;  3SFZ A;  4G7H F;  1ZG5 A;  4HX4 A;  3Q9V A;  1H9T A;  1B1B A;  2XAF A;  1FOK A;  3HRT A;  2JZY A;  3MAJ A;  1U2W A;  1G6N A;  1B9N A;  1GVJ A;  4BYY A;  3K1P A;  3T8T A;  2MLK A;  1A04 A;  4KA4 A;  2EA2 A;  1YTY A;  3J81 Z;  1REP C;  1XDS A;  1BN5 A;  5ICG A;  1G4D A;  4FX0 A;  2ZKZ A;  4ENK A;  2AXL A;  5CVR A;  4WXD A;  1PP7 U;  4F7Z A;  3RTR A;  3ABT A;  3R4K A;  2B0L A;  5E20 A;  3RYR A;  3T8R A;  1G3S A;  4U0W A;  2CSO A;  5D6F A;  3WE2 A;  2YSR A;  3FHZ A;  1WWX A;  3E6M A;  4ENJ A;  1TNS A;  2X4H A;  2EFN A;  3HTU A;  2M45 A;  4PGG A;  1HKT A;  2IP2 A;  3ZMT A;  5BMZ A;  1IW7 F;  2Y75 A;  5HLI A;  2FNA A;  3DFG A;  3R0J A;  4OIR F;  1IXR C;  4OU0 A;  2EJR A;  2KJC A;  4ZZL A;  1O57 A;  4AWX B;  4OMZ A;  1BC7 C;  3J80 Z;  1E17 A;  1ULY A;  4UVA A;  2GA1 A;  2ACJ A;  2FE3 A;  4HV5 A;  4L5I A;  5CVJ A;  1MDM A;  4M6X A;  2A3S A;  2FF4 A;  1HSJ A;  2IVM A;  2DI3 A;  1J59 A;  3JTH A;  3KEO A;  3OOP A;  4I0A A;  2PFB A;  2HYG D;  1XMK A;  1D8K A;  2C6Y A;  4HA8 A;  4RGX A;  4QLC U;  5K5Q A;  1BBY A;  2M8E A;  4EJV A;  2J5P A;  4U7B A;  2EA4 A;  4RB1 A;  5IT3 A;  1R22 A;  2NNY A;  1J9I A;  1IN6 A;  3U2R A;  3WGH A;  2KIM A;  1FBS A;  4KDP A;  3EUH A;  4N0B A;  3QP5 A;  4MQV A;  3WG9 A;  5BS6 A;  1OKR A;  1XN7 A;  4CGZ A;  3E97 A;  4YG2 F;  1IN8 A;  2XRO A;  1QZZ A;  5LHH A;  3KZZ A;  4YIF A;  4EJW A;  3DPL C;  5D4R A;  4UNO A;  2XAQ A;  3RKX A;  3IKV A;  3ECO A;  3BPV A;  1K78 A;  3TDZ C;  4B8X A;  3MFK A;  4WX9 A;  4CXF A;  3GFL A;  4Q5S F;  3CUQ A;  3R61 A;  2PEX A;  2ESN A;  4I98 B;  4WXH A;  4CDG A;  1J5Y A;  5JI6 A;  3WE3 A;  2BGC A;  3FXR A;  2MLG A;  5DDG A;  4OOI A;  1IZ1 A;  1IXC A;  4ASN A;  1HW5 A;  3WOD F;  1ZAO A;  4HF2 A;  4U88 A;  4AVP A;  3I71 A;  4L18 B;  2EFO A;  1Z05 A;  2L01 A;  1G3T A;  2ZXJ A;  4WCG A;  1J7K A;  1I1S A;  3RYP A;  5D5W B;  4HYE A;  1F5T A;  4A12 A;  3BJA A;  2DPU A;  4GYG A;  2WWY A;  1V3F A;  2FEZ A;  2G9W A;  3LA2 A;  2HFH A;  1D5V A;  1XDU A;  2M1B A;  3WTW C;  3E5X A;  4UUV A;  3SQN A;  4EVI A;  1S6L A;  2P8T A;  3VB2 A;  2XKO A;  2CFX A;  2VC0 A;  1KQ8 A;  2M5W A;  5AIP A;  1S3J A;  2XHK A;  4KYW A;  4A6D A;  2V1D A;  3I64 A;  1BI3 A;  2CYY A;  4KT5 C;  5CYV A;  2UWM A;  2JSC A;  3HTS B;  3FF5 A;  4G7Z F;  3LAJ A;  1W7P A;  3V8J A;  3ELK A;  3ECH A;  4HF0 A;  5LLQ A;  3ZP5 A;  2JT1 A;  1U78 A;  1Z6R A;  2MD5 A;  5BOX A;  4MNU A;  4UHT A;  1UHM A;  3K1N A;  5ILU A;  4HLY A;  5HOO A;  2A61 A;  1LVA A;  2DLL A;  1LQ1 A;  2V79 A;  2DT5 A;  4XSZ F;  5HLH A;  4ZYG A;  2BYV E;  1KA8 A;  4ON0 A;  1TW3 A;  5E18 F;  1P2F A;  1G3W A;  2KIF A;  4RB3 C;  3KP7 A;  3E3V A;  2YPR A;  1XGS A;  3F21 A;  1PDN C;  2DQR A;  1SD5 A;  3HYI A;  2ETH A;  1EH8 A;  3MEX A;  1SAX A;  5FFZ A;  1UHW A;  5HS7 A;  4EM1 A;  1SD7 A;  2VT2 A;  1O3T A;  1I5Z A;  3O2P E;  2DK8 A;  1OYY A;  2A07 F;  1JHH A;  2L54 A;  4UVC A;  4I01 A;  3M8E A;  2F5E A;  2FSW A;  2EB7 A;  2H27 A;  3L7W A;  1P4A A;  1XB4 A;  3GX4 X;  4HX7 A;  2VXZ A;  4ZYH A;  3H92 A;  1S7O A;  2HKX A;  4LFU A;  2QLZ A;  3P9K A;  4FHT A;  4M9Z A;  3D0S A;  3IHU A;  1O3S A;  3ZMV A;  3HRM A;  4A0X A;  3M7G A;  3FMR A;  2Q0O A;  4S05 A;  1WQ2 A;  2GXB A;  3F6V A;  1T39 A;  2XAS A;  3GXO A;  2LKP A;  4FX4 A;  2W25 A;  4IRH A;  1LNW A;  1W4M A;  2EWN A;  2FBH A;  4M6Y A;  4HX8 A;  4ENM A;  4MTD A;  5D5U B;  5H6Q A;  2A68 F;  2IA0 A;  1ZH5 A;  1YS6 A;  3J7A O;  5HDK A;  1H0M A;  2TDX A;  2F5F A;  4S04 A;  2A5Y B;  2D1V A;  5D5V B;  3BP8 A;  3K69 A;  4L0Z B;  4IRG A;  4AIJ A;  2Z5U A;  1Z1D A;  1J2X A;  1LDK B;  2MH2 A;  2ISY A;  2W84 A;  4KIC A;  5J6X A;  1O3R A;  1KGS A;  2DTR A;  3PFI A;  5HLG A;  3BPX A;  4JK1 X;  2ZNZ A;  1DP7 P;  3K0L A;  3V7R A;  4EM0 B;  2RN7 A;  2Q8K A;  1FX7 A;  3TOA A;  2CG4 A;  5LEK A;  2A6H F;  2WC2 A;  4BHB A;  2R3S A;  2ZME B;  5D5X B;  2F5C A;  3E6C C;  1R23 A;  3GFM A;  1U3E M;  4IVN A;  4MHG A;  4LLN A;  4P96 A;  2RDP A;  3SXY A;  2LF8 A;  4L9T A;  2WTE A;  3IWF A;  3L2C A;  2QEN A;  5K5R A;  3HRS A;  2YR2 A;  2FOK A;  5EEG A;  3FXQ A;  3GFI A;  3KP4 A;  3SZT A;  3LQR A;  3WGG A;  2HTS A;  4I2O A;  3HRU A;  1RUN A;  4CHU A;  1EH6 A;  3CO6 C;  3LFK A;  2D45 A;  2PN6 A;  3TQN A;  4LD5 A;  2EFQ A;  4Y15 A;  4G9Y A;  5FD5 A;  4I0B A;  5A2Q Z;  4KMF A;  1T98 A;  5F6F A;  3JAM K;  2QBY B;  2NAZ A;  1W5S A;  1SMT A;  3M1E A;  1MJ9 A;  5AIQ A;  3C18 A;  4MEY F;  1F4K A;  2R7F A;  4EM2 A;  4ZH4 F;  3QU6 A;  2K27 A;  4Z2Y A;  4M74 A;  3RKW A;  3J81 K;  5JFR A;  2HQN A;  3GZ6 A;  2PLY A;  2CO5 A;  3WTZ A;  3JAM Z;  3I59 A;  1ZAR A;  1BC8 C;  4I09 A;  4JBA A;  3ULQ B;  5HDN A;  3RKY A;  3EYY A;  5CVI A;  3U1D A;  1YS7 A;  2G7H A;  2P5V A;  2FBI A;  3IRQ A;  4RGS A;  2K86 A;  4LMY A;  5L3C A;  3RI4 A;  5LRR A;  2K7L A;  1T2K A;  4GCV A;  1W5T A;  5DCF A;  4Q47 A;  2HEO A;  5H6R A;  1XSD A;  1BI2 A;  5L3B A;  3J80 K;  3C1D A;  1RNL A;  1Z9C A;  1KU3 A;  1R1T A;  4KN7 X;  4XRF A;  3CUO A;  4M72 A;  2MBF A;  1H9G A;  2CW0 F;  1MJB A;  3L09 A;  1UST A;  3HOT A;  1GHC A;  3BZ6 A;  5ICE A;  4BXU A;  2HYF A;  2ESH A;  1Y0U A;  1V4R A;  1CF7 A;  4M71 A;  1YW8 A;  2DQL A;  2OA4 A;  4L5J A;  4CYD A;  2CGP A;  1CGP A;  1KYW A;  4LLG F;  1SFE A;  3Q5F A;  3RPU A;  2K4J A;  1QO0 D;  4P55 A;  3DXJ F;  4R8H A;  4WF2 A;  4RB2 C;  2KJB A;  1FPQ A;  3I58 A;  1UFM A;  1MD0 A;  3SZP A;  1IN7 A;  1FBU A;  1TTY A;  2VBX A;  4CZZ A;  2J5O A;  4HQM A;  1PP8 F;  1ODD A;  2L02 A;  5DD4 A;  1D3Y A;  1XMA A;  5DEQ A;  2F2E A;  3EQL F;  1XD7 A;  2V6C A;  1DPU A;  3S2W A;  1XCB A;  3DKW A;  2V1U A;  1IAW A;  1XGM A;  3DP7 A;  2COM A;  4BHC A;  4IXA A;  4IF4 A;  1RI7 A;  3GEZ A;  3KP5 A;  1J75 A;  1XGN A;  4G8X A;  4M9X A;  2QZ8 A;  3I53 A;  3NRV A;  1XGO A;  2EK5 A;  2P6S A;  2ELH A;  3FMQ A;  1TLH B;  2RKH A;  5D6E A;  3KP3 A;  2FA5 A;  5TRD A;  2AS5 F;  4ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...