2HYGD

The structure of apo-mntr from bacillus subtilis, native form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 40
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
D PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hygD01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hygD02
3V4GA 3TQNA 4M74A 3KP4A 4IRIA 3GF2A 1USSA 5A2QK 2XVCA 3FMSA 1DUXC 4XSZF 1ZG1A 1FP1D 3FXUA 3LA7A 4WK8F 3IKTA 1S7AA 3N97A 3E6MA 3GFMA 4EM0B 4HW0A 4PGGA 2LF8A 3HTSB 3HRSA 1J59A 4RGSA 4GGGA 4IPAA 1OR7A 3QPHA 4I0BA 2IW5A 3P7NA 3WTUC 3DQVC 2K86A 5E8GA 4OINF 1BI2A 2QQ9A 2R7FA 5LGNA 2LKPA 1NHAA 4MQVA 1G4DA 3HTUA 1I6XA 1F9NA 2E7WA 5CVUA 3T8TA 3L7WA 4KIGA 1ON2A 1IN4A 3C1DA 2H27A 5J6XA 5HDKA 4RGRA 1PP7U 4TV7A 2A68F 4U7BA 1WSUA 1S6LA 4I02A 2IPQX 2WTEA 3V7CA 1O3TA 2O6GE 4A6DA 5KK1A 3I59B 2FMLA 4BAYA 4AWXB 1R58A 3DPLC 4UVAA 1GXQA 2IVMA 2HS5A 1EH8A 2O8XA 1E2XA 1USTA 4ENKA 1GVJA 4HZFA 4N9HA 4A0ZA 3F8MA 5BQTA 1MDMB 4R79A 2ISZA 4RGUA 1MZBA 3KP2A 2Z3YA 4BH9A 1TW3A 4G6DA 1BI0A 4HDVA 3IKVA 2KIUA 3MQ0A 3ZMTA 1KA8A 4CDGA 2P6SA 4IJAA 3WU1B 4Q4ZF 1U5TC 5HS9A 3HYIA 1O7LA 1FBUA 3E5QA 4OMZA 4CZZA 5LHHA 3RKYA 4P9UA 5K1YA 4E70A 1ZRCA 3FWEA 1YW9A 2MLGA 2VC0A 4AIHA 1SD5A 4BNCA 4IF4A 2VBXA 2Z33A 1KQ8A 3KZZA 2Y0MA 2F5FA 2FEZA 4ENMA 5D4RA 1WQ2A 5ILVA 1FYMA 5FGMA 5E8IA 5CVJA 5L3CA 1ZRFA 3IWFA 4HQEA 2HYGD 4QLCU 1FBQA 2DW4A 3I64A 3ROUA 4ZZDA 5LEJA 3VFZA 3RPUA 1H0MA 2C6YA 2O03A 1FNNA 5AONA 4N0BA 1BC8C 3U2RA 4B09A 3P9KA 3KEQA 2IT0A 1Z6RA 1LEAA 3R60A 1PP8F 1P92A 4YFXF 3J81K 2FQ3A 1ZLJA 5E1XA 2D1HA 4XSXF 3BJAA 3ZN0A 2ZMEB 3JSPA 4BXUA 3CO7C 4Q48A 2EFNA 2NAZA 2NS0A 5ICCA 4KIFA 2ESNA 4KN7X 2HKXA 1IZ1A 3KP6A 1FOKA 4JBAA 5FD6A 2O3FA 3I0TA 1BOAA 2VONA 1MJAA 2XASA 2D45A 3G73A 1CF7A 3GFIA 5CVVA 5D5WB 1R1TA 1PUEE 3GFLA 2DLLA 4GYIA 4O3MA 3HHGA 5FLXK 1MJBA 2YX7A 1SMYF 2XAFA 2QLZA 1DPRA 1HQCA 4A0YA 3F72A 5DUKA 4YFNF 3WTZA 5ICEA 3MWMA 3HHHA 4MHGA 2DK8A 2QWWA 3F23A 2FA5A 2MLKA 3COAC 2OBPA 2CWEA 1BBYA 1XMKA 1QQIA 1LDKB 4G6QA 2LNBA 1BJAA 4HX7A 1LQ1A 2PLYA 2EA4A 4P5OA 1RI7A 4BQAA 1FPQA 2QBYA 4WCGA 3BOQA 2KIFA 2MH9A 2QM3A 3C3WA 4G94A 1HSJA 2DTRA 4MTEA 4KNYA 4LG0B 3WTYC 3O3KA 1TLHB 3MEXA 2FXAA 1LJ9A 3ISPA 4HYEA 2W25A 4ZYEA 2EFPA 1Z91A 3R4KA 4RB3C 3HRMA 2HQNA 2ZMEA 1FC3A 1A04A 4FT8A 1HW1A 3EETA 2J5PA 3WODF 3RYRA 3DV8A 2ZKZA 4I7HA 3F21A 1QGPA 1FSEA 3RYPA 1EH7A 3CTAA 2DU9A 2RC4A 1REPC 4M73A 1TTYA 3SFZA 2Q8KA 3E6CC 2MD5A 1R00A 1RZ4A 2ZFWA 4PGHA 3W6KB 1XCVA 3V8LA 2ZO4A 2BEOA 1STZA 4Y13A 3E5UA 1R22A 4NQWA 3M7GA 4UXNA 4BHBA 1DP7P 1T2KA 2DPDA 2K7LA 4MTDA 1U5TA 3RTRA 4AIJA 4BYYA 1G3WA 3DFGA 1OYYA 3W6JB 2NNNA 2VBYA 2NYXA 1ZRDA 1LEBA 1LVAA 3GFJA 4DNCA 3ULQB 3M1EA 1ULYA 2ELHA 3F22A 1FSHA 3WTVC 3QP6A 4HX8A 3HSRA 1UHWA 2CGPA 3PQKA 3MZHA 3MFKA 2FNPA 3ZMUA 2XUBA 2HYFA 2L02A 5D4SA 1F4KA 3T8RA 4OMYA 5LGUA 1B59A 2M45A 3L2CA 1FYLA 1D5VA 2D2WA 1HSTA 4KDPA 3IHUA 4ETSA 1BI3A 5LEKA 2XRNA 2BGCA 3G3ZA 2ZXJA 3LAPA 1K7AA 3H92A 4NHJA 3WGGA 4YG2F 2PMHA 2RNJA 2BV6A 4Q47A 2Y48A 2DO7A 1IW7F 1KQ0A 2EWNA 4I2OA 3GUDA 2FSWA 5LLQA 1XDSA 5HDNA 3B73A 3OV8A 1OPCA 4K2EA 3S2WA 2FRHA 1ZAOA 3K0LA 2VE9A 2OQGA 4XRFA 1LDDA 5TRDA 1IN6A 2OU2A 1Q1HA 2PQ8A 1QBJA 2XHKA 1L3LA 1ZLKA 2H6BA 3I53A 5FD5A 1KGSA 2QBYB 3HSEA 3DEUA 3TKYA 3DKWA 5ICGA 4G7HF 1S7OA 4HLYA 1LB2A 1U78A 4IVNA 2HZTA 3KCCA 3SXYA 1CGPA 5TJJA 3BJOA 1U3EM 1O3QA 4KT5C 2YU3A 2GWRA 2A6HF 4M71A 2GA2A 2L01A 5BPIA 3R6SA 4HF0A 2DQLA 4PCQA 1K6OA 4O5VA 1O7FA 3M9AA 3BJ6A 3CUQB 3ZMSA 2HWVA 3E6BA 5BPDA 5L3DA 3FZVA 2W57A 5DYMA 2DPUA 4EVIA 5HLHA 4G7ZF 5K5OA 4HV5A 3N4MA 1B9MA 1UHMA 4M6YA 1WKMA 4KFCA 4Q5SF 3WGIA 5A2QZ 2MA3A 1ONVA 1TNSA 4M9ZA 3Q9SA 1FX7A 4ZH4F 4IRGA 3O2PE 2EFWA 2K4BA 5F1RA 2MC3A 2YR2A 4HDUA 1KU2A 1UFMA 5ED4A 2P7VB 2XAHA 3MZYA 4BHCA 4JQFA 4ASNA 4A5MA 4RB2C 2OZUA 5DCMA 4HF1A 2IA0A 3NRVA 2LDUA 1ODDA 1FP2A 1R7JA 2FNAA 1ZREA 4RAYA 2QUFA 4ZZLA 2K27A 3Q5FA 4OIPF 4YIIA 2PFBA 4HBLA 1ZGAA 4ZYHA 4A12A 1E17A 5IT9K 5CYVA 4EM2A 2VT2A 1ZHFA 4ESBA 2CW0F 2DFIA 2P4WA 4LLNA 3QOPA 1VTNC 2M1BA 1KYZA 3E6DA 4Y17A 5BS6A 1V4RA 2QQAA 2HEOA 3FF5A 4PZJA 2VBZA 5L3BA 2E1CA 2A3SA 2MBFA 2LF7A 1XGNA 2J5OA 1YQAA 2G7UA 3BDDA 4LMYA 3J80K 3IRRA 1JHFA 6PAXA 1L0OC 2WV0A 2YX4A 3FMRA 3CUQA 2XAGA 1R1UA 2HDCA 1B1BA 2M5WA 4P96A 4M6XA 4WXDA 3KEOA 1ZN2A 2GA1A 3FX3A 1FYKA 3F8FA 2P8TA 5E17F 2RN7A 1JXSA 3GVAA 1R23A 3V7SA 4LJZF 3IWZA 4A5NA 4D0PA 2NRAC 2M30A 3FM3A 2RDPA 2PI0A 2OQRA 2P6TA 1DPUA 2FF4A 4R1HA 4IHSA 5ERIA 1OYIA 4OOIA 3CUQC 4KMFA 2DAOA 1TNTA 4U0WA 1P4XA 1Z05A 4S04A 1ZG5A 2W84A 4HF2A 2XROA 3LQRA 5LRRA 2STTA 1FZPB 4EJUA 1YLFA 2XIGA 3H3UA 4RB0A 1YYVA 4Z2YA 1SAXA 3GXOA 2P7CB 2OAZA 4FX4A 2XAQA 4HA8A 4XLPF 1T98A 3CJNA 1BIAA 1D3YA 3SHFA 1MDMA 4HX4A 5E18F 1RNLA 5E1WA 1YS7A 3RI4A 2RV8A 3QP5A 3EYYA 4L9JA 1J0RA 2XAJA 2HTJA 4U0VA 3JW4A 3BPVA 3T5XA 2HTSA 1TBXA 1G3YA 3LA3A 3LAJA 4ON0A 1YW7A 1HKSA 1MD0A 4LK0F 2PG4A 3E3VA 2EK5A 4NB5A 2V9VA 4EQQA 3ML6A 4ZYGA 1JGSA 1GHCA 3WGHA 5L3EA 5FLXZ 5D8KB 2L4MA 2CYYA 2VXZA 3JTHA 1J75A 3H3ZA 1Z9CA 3CLOA 3WU0A 2WC2A 1HW2A 4LLLA 3TOAA 4M9SA 1HKTA 2Z5UA 2E7XA 5D8LB 3ABTA 3LQQA 3L09A 4OIQF 2GXBA 4G9YA 3JTGA 1WRJA 1WWXA 2FBIA 4WX9A 1U5TB 1F1ZA 2KRFA 1UCRA 1HW5A 1ZARA 2COMA 5ILUA 2PMUA 4IRHA 1B4AA 2M8EA 3E5XA 4AVPA 4L5JA 1SFUA 2ISYA 1J7KA 3Q9VA 1B6AA 4UV9A 2OD5A 4DQ2A 3I59A 4CICA 2JRTA 3HUGA 4EJWA 2M87A 3QRFF 4UNOA 1P4AA 3CO6C 1QPMA 1BM9A 3RKWA 2R7DA 2Y75A 5CJ9A 2HFHA 2Z99A 3TO9A 1AWCA 1TQIA 2DQRA 4CO8A 1V3FA 2F5EA 3HOTA 1JE8A 3HIFA 3RJPA 1S3JA 1RIOH 2X4HA 3ECOA 5FO5A 5EEHA 1W5TA 3LSTA 4YFKF 4OIOF 2JSCA 1YS6A 3KP5A 2A61A 3GX4X 1XMAA 3F8BA 4RGXA 4M72A 3J7AO 2ESHA 4F7ZA 4I01A 3JAMZ 2KIMA 2JPCA 4LLGF 2JZYA 4EJOA 2EFOA 3F6VA 2D1VA 4MQ9F 1W7PB 3D0SA 4LGWA 1YO5C 5FFXA 1XSDA 2DI3A 4EMSA 3R61A 3J81Z 2GAUA 4MEXF 3SQNA 1OYWA 4H0EA 1P2FA 3ZMVA 5LHGA 3I58A 1IXRC 1U2WA 3JSOA 2V1DA 4Y15A 1HXDA 1W5SA 1O57A 4L9TA 5BMZA 2PBIA 2W85A 4AD9A 2KJBA 1ZYRF 5HLIA 5H6QA 1SFXA 3IRQA 5D6FA 1S29A 3NQOA 2UXNA 1I27A 1SD6A 3JAMK 4EV0A 4U0YA 2O61A 1IXCA 2PJPA 1D8KA 5HOOA 2ETHA 2EA2A 1EH6A 1QZZA 1BIBA 1YIOA 2FE3A 4LK1F 5DD8A 5JFRA 5LGTA 2W24A 1DDNA 1X3UA 2F5DA 5LBQA 3LA2A 2EJRA 4O6JA 1LDJA 3GLXA 4WWCA 3KETA 4EM1A 1CF7B 3BY6A 2P5KA 3FXQA 3ABUA 3GWZA 4I0AA 5DD4A 1J5YA 2PN6A 2A69F 2QYOA 1IN5A 3MCZA 4ESFA 3C18A 3RPQA 2EFQA 3RIRA 5E1ZB 2DBBA 1XD7A 3C7JA 5F6FA 3ECHA 5HDGA 2FU4A 4XBFA 3TGNA 2XGXA 1YFHA 3AAFA 3FM5A 3I54A 3F8NA 4KN4X 5HLGA 3IC7A 4CHUA 3TO6A 2HOEA 2A5YB 4KIBA 1QO0D 2ZCWA 2DT5A 3WG9A 1IRGA 1I1GA 2KKOA 3KLOA 1O3SA 2JPBA 3ELKA 2QZ8A 3WTXC 2STWA 5LRSA 4ENJA 1FY7A 1IUYA 1J2XA 3F3XA 2CSOA 1O3RA 4UUVA 1U8RA 2EV5A 2XKOA 3EQLF 2IJLA 3ZN1A 3L9FA 1XCBA 2ZNZA 1ZH5A 2H94A 2V1UA 2ZNYA 1SD7A 1IN7A 4KYWA 1OMIA 3K1PA 2HQRA 4CXFA 2GQQA 3DXJF 3TOBA 2NNYA 4EGZA 1T38A 2GZWA 3V7RA 2CO5A 3QAHA 4HOBA 4I98B 5L3FA 5K5QA 2V79A 4MEYF 2CFXA 2BBYA 1SMTA 1QNTA 1XN7A 1RUOA 3REOA 4HLXA 1R1VA 4GO1A 4R8HA 3OOPA 3DF8A 1B9NA 1FBSA 1KYWA 1I5ZA 2Z9OA 2VE8A 2FBKA 3J80Z 3EDPA 3BPXA 3GEZA 1R5GA 1SD4A 1HKQA 1QZYA 5HS8A 3VOEA 3WE3A 1T6SA 3HRTA 1FT9A 3NEUA 5JVTA 2B0LA 2V6CA 4G8XA 4A2UA 1C0WA 3B02A 4ENNA 2BYVE 3IL2A 5ICFA 2V1XA 3VB2A 4XLNF 2R3SA 2ZBKA 5FB2A 5H20A 2QENA 3TO7A 1KU7A 4WF2A 4FHTA 4RS8A 1YTYA 4N9IA 4RAZA 3WE2A 3I71A 3I5UA 1G3SA 4P55A 1K78A 4LFUA 3FHZA 1YG2A 2RKHA 4KICA 3BZ6A 3U9GA 2GIVA 4LD5A 3KLNA 3RDIA 5DEQA 2P5LC 2E1NA 3KP3A 3TDZC 2PEXA 3R0AA 1WI9A 2ADUA 2WWYA 3VODA 5CVRA 3GZ5A 5HVQC 1R5HA 4L0ZB 5DCFA 4MGRA 1XGSA 4L9NA 1J9IA 2RQPA 3I4PA 4L9VA 2QVOA 5E20A 1I1SA 3GYHX 3GZ6A 4I09A 2LSOA 2HGCA 4A6EA 1MKMA 1Z1DA 1R36A 2OZ6A 4L0YB 3P9IA 1P6RA 3F6OA 2L3DA 3QU6A 2A07F 3PQJA 1GXPA 2CG4A 1IRFA 5F64A 2TDXA 1MJ9A 1XSXA 3ZP5A 5D6EA 2F2EA 1XGOA 4BHPA 3M8FA 4LG0A 1KU9A 3CUOA 4EJVA 1BN5A 4GYGA 1S8NA 2EV0A 2EV6A 4L18B 1H9GA 2KJCA 2VODA 5CVIA 2FBHA 2XV4S 4LB6B 2GXGA 3ZQ7A 4ESJA 5HS7A 2P5VA 3K69A 2VN2A 4RB1A 3KFWX 5EEGA 2UZKA 3RKXA 3DP7A 2Q2EA 3QU3A 3EUHA 1IN8A 4FX0A 4UVBA 1UB9A 3O6BB 1IAWA 2UXXA 4IXAA 1W7PA 2RGVA 4CYDA 3KZYA 4QWQA 4G7OF 2A6EF 1XSVA 1Z7UA 1JHHA 3LWFA 2K02A 1K78B 3BP8A 4EGYA 3QPTA 4P9FA 2UWMA 2YPRA 3PFIA 4KUMA 2QQBA 1HBXG 1EV7A 2IA2A 4UV8A 5JR3A 2DK5A 3HOSA 2MH2A 5CLSA 5D5UB 5D5XB 1P4WA 2K4JA 5JHUA 3FXRA 5H6RA 3MAJA 5IT3A 1KQ9A 1Z6TA 3P9CA 5L3GA 4S05A 4GXOA 1U6GA 1MGTA 2X0LA 1F5TA 3KE2A 2AXLA 1FLIA 3M8EA 2Q0OA 1G6NA 5D5VB 4B8XA 2L4AA 4OU0A 5AIQA 3WTSC 3E97A 3ZPLA 1W4MA 3F8CA 4GCVA 1OKRA 4UVCA 5DUIA 1ON1A 3V8JA 2VBWA 4WXHA 3VEPA 1H9TA 3CDHA 4LB5A 2RVCA 2IA1A 1Y0UA 3HSFA 3R0JA 1RUNA 5LHIA 1W7PD 2EB7A 3HRUA 1XB4A 4MNUA 2AS5F 2VOOA 1TQPA 2CQKA 4OIRF 3K1NA 5JI6A 2HR3A 3FMQA 4UHTA 5BOXA 5J8CA 1T39A 3L00A 2XKPA 4PDKA 1IF1A 1T0FA 3LFKA 1XDUA 2VT3A 3TDUC 3GO5A 1YW8A 2ACJA 3K2ZA 2IRFG 1XGMA 3T0YA 1TW2A 2O0YA 3T1BA 2ZJ2A 2VOPA 3K9TA 4HQMA 5K5RA 5IT9Z 5ILSA 3K1MA 1BI1A 2G9WA 1BC7C 4KMUX 3ZMDA 4U7DA 1LNWA 3BWGA 1KU3A 3SZPA 3ERED 2BE5F 4CGZA 2FMYA 2H09A 3BROA 3U1DA 1ZG3A 2OA4A 4IHTA 3GW2A 4A0XA 1IXSB 4JK1X 1G3TA 5DDGA 4KA4A 2L54A 3SZTA 2VC1A 4WXCA 4EJTA 4ZYDA 1TQMA 5DCMB 3D5LA 2H6CA 3WTWC 5DV5A 4HAMA 1K79A 4L5IA 5FFZA 3EYIA 1D8JA 2G7HA 1PDNC 5KVRA 2JT1A 2IP2A 3DPTA 3ZMZA 2JTVA 1ZGJA 4M9XA 1SFEA 2FOKA 3WTTC 4HV6A 1AOYA 3V8KA 5J8FA 2HKOA 5AIPA 2YSRA 1FWZA 4YIFA 4AIKA 3KP7A 2F5CA 4U88A
chains in the Genus database with same CATH superfamily
3V4GA 5KAIC 4XOPA 3TQNA 4M74A 3KP4A 3HC7A 1KZHA 4IRIA 3DEEA 1F36A 3GF2A 1USSA 1MW7A 5A2QK 1ERDA 2JN6A 3M1CA 2XVCA 3FMSA 3TP3A 1DUXC 4XSZF 1ZG1A 1FP1D 2XRLA 4CCNA 4QPQA 3J81R 4UB6C 3FXUA 5JLWA 2AO9A 2QKLB 3ONQA 4YIRX 4RBOA 4C3IJ 3LA7A 4WK8F 2DCEA 3IKTA 1S7AA 4JYKA 3OYMA 3N97A 1W0TA 3E6MA 3GFMA 4EM0B 1TWFJ 4HW0A 4PGGA 5HODA 4RLFA 4NUBA 2LF8A 3HTSB 3HRSA 2QSHX 1J59A 4BDZA 3BZCA 4C9YA 5IYDJ 1FIAA 4RGSA 4Y33A 1A5JA 4GGGA 4IPAA 1OR7A 1FOYA 3QPHA 4I0BA 4DYCA 2BY2A 2IW5A 3P7NA 3KYCB 1YRNB 1DQUA 3BR6A 3WTUC 3HPHA 2EZLA 2IAIA 2MABA 2K86A 3DQVC 5E8GA 4OINF 1BI2A 2QQ9A 2L7ZA 3DLAA 2R7FA 1OJLA 1Y6IA 5LGNA 2LKPA 4F3QA 2XB0X 3BQYA 2EIMH 1NHAA 3BTJA 4MQVA 1G4DA 3HTUA 2LOOA 1I3QJ 1I6XA 1ETKA 1F9NA 2E7WA 5CVUA 2IGKA 3L7WA 3T8TA 3CC7I 2ZFUA 2JMWA 1JI8A 4KIGA 3W3CA 1ON2A 4KITB 1IN4A 3C1DA 1WGXA 2UV1A 2H27A 4EATA 5J6XA 5HDKA 4RGRA 5IT9R 1PP7U 1MMNA 4TV7A 4HG2A 2CW7A 2A68F 1T33A 4U7BA 5HNHA 3GZNB 1WSUA 1S6LA 2KIQA 4I02A 2IPQX 2WTEA 2L9NA 3V7CA 4AIDA 2BXZA 1SANA 1O3TA 2O6GE 4A6DA 1HF0A 3EUHC 5KK1A 3HDDA 1UZCA 3I59B 1Z67A 4IO9F 2FMLA 1JGGA 2KLOA 4BAYA 3CC4I 4AWXB 1R58A 3DPLC 4UVAA 1GXQA 2IVMA 4E7IA 2HS5A 1EH8A 2O8XA 3K4JA 1E2XA 1USTA 3LMMA 4ENKA 1GVJA 2DDAA 3G6EI 3D5SC 4HZFA 4N9HA 3GTGJ 4A0ZA 4LITA 2XAUA 3F8MA 5BQTA 1MDMB 4ABZA 4QIWN 1IGNA 1HDDC 2ME6A 2ZXWH 4R79A 2ISZA 2OCEA 4RGUA 2H8RA 1MZBA 3KP2A 2Z3YA 3ZCOA 3RZDJ 4BH9A 2BY1A 1TW3A 1X3WB 4G6DA 1BI0A 4YRVA 1A6QA 4HDVA 3IKVA 4A3MJ 2KIUA 3MQ0A 3ZMTA 4BE0A 4BQNA 1KA8A 4CDGA 3CCEI 2M35A 1SVLA 4H4KC 3MZ8A 3D1NI 2P6SA 3K4LA 1RKTA 2ECCA 2I5UA 4IJAA 3WU1B 3LSIA 2ZJRF 1W0UA 4Q4ZF 1U5TC 5HS9A 2L2OA 5IP9J 2NOGA 3HYIA 1O7LA 5KHDA 4UUSB 1FBUA 3TW7A 3E5QA 3M07A 4OMZA 4CZZA 5LHHA 2R7ZJ 4W97A 3RKYA 1LVKA 4D1QA 5B3SH 3WHCA 4P9UA 3DTEA 1OCCH 5K1YA 4E70A 4FETA 1TT0A 4NDLA 3LSKA 1ZRCA 1WCMJ 3A4CA 3FWEA 1YW9A 2BY3A 3O8HA 4U88A 2MLGA 2VC0A 2L0KA 4AIHA 1SD5A 1RKWA 4BNCA 2R5ZA 4IF4A 2VBXA 2Z33A 1Q1VA 3KZZA 1KQ8A 2E19A 2Y0MA 2F5FA 2FEZA 5FROA 1ETWA 3LSGA 1P7JA 1XS9A 4W1UA 4FCYA 4ENMA 3C2HA 3V42A 5D4RA 1WQ2A 5ILVA 2LD5A 1FYMA 1D0ZA 5FGMA 3ZXSA 3H9JA 4FISA 5E8IA 5CVJA 5L3CA 1ZRFA 4AU7A 3VSLA 4BS9A 3K4MA 3IWFA 4HQEA 2HYGD 4QLCU 1QA6A 1FBQA 2M8GX 2DW4A 3BC8A 2LREA 3I64A 3ROUA 1YJWI 4ZZDA 5LEJA 3VFZA 3RPUA 2W7NA 1H0MA 2C6YA 1NTCA 4FASD 2O03A 1FNNA 5AONA 4N0BA 1BC8C 3I56I 4BY1J 1TT5B 3U2RA 4B09A 3J7AY 3P9KA 3KEQA 4UY8I 1T56A 2Y2ZA 2IT0A 4AM3A 2LBFA 1Z6RA 1LKXA 3VWBA 1JJ8C 3RCOA 1D1CA 1LEAA 3R60A 1PP8F 1FIPA 2Z1DA 4J00A 2KPMA 2PJRA 3ZQQA 1P92A 2QSFX 3A01B 1VQ4I 2X6XA 3BT9A 3ZQCA 4YFXF 4CA0A 3J81K 2FQ3A 4C2UA 1ZLJA 5E1XA 1Z77A 3CCYA 2G0EA 1WFXA 2KZGA 4RDUA 3OYBA 3GTOJ 1MNDA 3OSFA 1VQ9I 4AYBN 2IS6A 2XSJC 4DYQA 2D1HA 4XSXF 3BJAA 3ZN0A 2ZMEB 5FJ8J 3VYUB 2LH9A 3OMYA 3JSPA 4BXUA 3CO7C 4Q48A 1GDTA 2X1CA 2EFNA 2NAZA 2NS0A 5ICCA 2HDWA 4KIFA 5E3OA 1H8AC 2ESNA 2I8DA 2HKXA 4KN7X 1IZ1A 3M3YJ 3KP6A 3CCRI 1FOKA 2Q1ZB 4JBAA 2E2JJ 3PO2J 3OR2C 5FD6A 2KRHA 2O3FA 3I0TA 1BOAA 2K9SA 5GADJ 2VONA 3PJRA 2DODA 3IH3A 2EZHA 1MJAA 2XASA 1WVRA 3CP2A 2CV2A 2D45A 1B8IB 3H9QA 3G73A 1CF7A 3GFIA 5CVVA 4X0GA 2KFDA 5D5WB 1R1TA 3K4KA 3PIPF 2K40A 1PUEE 1ETOA 3U21A 3GFLA 2DLLA 4GYIA 1K4SA 4O3MA 3HHGA 2CV0A 5FLXK 1X1PA 1MJBA 2L7MP 2YX7A 3CD6I 1S9HA 5B66C 2P0TA 2DYRH 3SDGA 1ETVA 1X2NA 1SMYF 2XAFA 3HZJA 4BE2A 2QLZA 1GUUA 4ZTJA 1DPRA 1HQCA 4CCOA 2E60A 4A0YA 1IRZA 4KT6A 3F72A 3QPLA 3IAS2 5DUKA 2R7VA 4YFNF 1UHSA 1WZ2A 3WTZA 1GV5A 4XONA 5ICEA 3MWMA 3HHHA 2E35A 1APLC 4MHGA 3PUBA 2DK8A 2QWWA 2M9HA 5EG0A 3F23A 4A93J 2FA5A 2E5ZA 2MLKA 3COAC 2OBPA 2CWEA 4B3AA 1BBYA 2ZXHA 1XMKA 4BXXJ 2V26A 4PJLA 5C44J 1QQIA 1PUFA 1WHUA 4II3A 1MMDA 1LDKB 2X85A 1T08B 1SVMA 4G6QA 1WJCA 5IOZA 2LNBA 1BJAA 4HX7A 1LQ1A 2PLYA 2EA4A 3IUOA 4P5OA 3O8GA 4HNTA 1QRYA 2HQAA 1RI7A 1G59A 4BQAA 2X6WA 1FPQA 2VASA 1JUMA 2QBYA 1S5LC 3HB9A 5F0HA 4WCGA 4HPQA 4P1WA 2VXDA 4ZYAA 1JKRC 3BOQA 2KIFA 2MH9A 2QM3A 1YIJI 2RQQA 3C3WA 2F48A 4G94A 1HSJA 2DTRA 3FKJA 4MTEA 4KNYA 3OS2A 1MSEC 4M3EA 3O3KA 3WTYC 4LG0B 1TLHB 1BR1A 3MEXA 2FXAA 1MBFA 1LJ9A 4IHXA 2K3FA 2DA7A 3ISPA 3TBIA 3A01A 4XIDA 1AKHA 5JLXA 2LY9A 9ANTA 3IH2A 3HBLA 4HYEA 4JP0A 2BHYA 2W25A 1H88C 3OS0A 2UUZA 4ZYEA 1F43A 2EFPA 2DN0A 3ZQLA 1LPQA 1X4OA 1Z91A 2CUZA 3R4KA 4RB3C 1RR8C 3ABKH 3HRMA 1D5YA 1IJWC 1WJFA 3ESWB 2HQNA 2ZMEA 2O9LA 1FC3A 2ID6A 1A04A 4FT8A 1Y0NA 2WAQN 3ABMH 1HW1A 2XPUA 3EETA 3SYTA 5FLXR 3IAM2 3J7YJ 2J5PA 3WODF 3RYRA 3DV8A 2K3PA 2ZKZA 3SZGA 2XGCA 4I7HA 5C4JJ 3F21A 1QGPA 4BJ5C 1FSEA 1I3AA 4LOCA 2QGUA 3QYBA 3RYPA 4I99C 2DMNA 1TWAJ 1EH7A 3CTAA 2DU9A 2RC4A 2MG4A 1REPC 4M73A 3OL3A 1TTYA 3SFZA 2Q8KA 2MD5A 2ZFWA 1R00A 1RZ4A 4PGHA 3W6KB 3E6CC 2XC7A 1MBEA 1MBHA 3I9V2 3KEYA 1XCVA 3V8LA 2ZO4A 5IOYA 2BEOA 2LC2A 1STZA 4Y13A 1MBKA 2PMZA 3E5UA 4CCLA 2BHZA 2ZMEC 1R22A 4NQWA 3M7GA 5GAHJ 4UXNA 4BHBA 3GTKJ 1DP7P 3SJMA 2DOFA 2W82A 1T2KA 2MGQA 1R6RA 1ZELA 3HUGB 2DPDA 3K4NA 2K7LA 1OFCX 4MTDA 1K4TA 1U5TA 3RTRA 3S1QJ 4AIJA 3PNVA 4BYYA 1G3WA 3DFGA 2X48A 5A2QR 3J7AW 1K6YA 1OYYA 3W6JB 1R71A 3FXLA 2NNNA 2VBYA 4J19A 2NYXA 3QYFA 2RNGA 1ZRDA 1LEBA 2Y31A 1LVAA 3GFJA 1Z7LA 3TW6A 3NWSA 3BTLA 4M6VA 1D1AA 4DNCA 3GTLJ 4M3BA 3ULQB 3M1EA 1SEUA 3HOYJ 4XN3A 1ULYA 2ELHA 1RETA 3F22A 1FSHA 3FISA 3WTVC 3KYLA 3HOZJ 3QP6A 4Z6YA 4HX8A 3HSRA 2JA5J 4DYRA 3DU6A 2PMZN 1QPIA 3L2QA 2ELKA 2CUFA 5J40A 3BQZA 4F93B 1UHWA 2CGPA 3PQKA 2N8GA 3MFKA 3MZHA 2MFZA 3MD2A 3H5NA 2FNPA 3ZMUA 2XUBA 3E7LA 2HYFA 2L02A 3U1KA 5D4SA 4HNVA 1F4KA 4I76A 2HVRA 1E3PA 5HNFA 2W48A 4KJZA 1O4XA 3T8RA 4OMYA 5LGUA 1B59A 2M45A 3CMMA 3QWLA 3L2CA 1FYLA 1D5VA 2D2WA 1HSTA 4MLOA 4KDPA 3IHUA 4C3HJ 4U87A 4ETSA 1YX3A 1BI3A 5LEKA 2E1OA 5M3FJ 1XC5A 2XRNA 2CQ7A 2KDZA 2BGCA 3G3ZA 3L2VA 2ZXJA 5FLVA 3LAPA 2L9VA 1K7AA 3H92A 4NHJA 3OYCA 3WGGA 4YG2F 1HC8A 2PMHA 5J4VA 1GT0C 2HOTA 3KZIC 2X6OA 3CLQA 1TZLA 3H1CA 2RNJA 2M34A 4MO7A 2FUG2 1XPXA 2ZC2A 2BV6A 4UUSA 4HNUA 4Q47A 2Y48A 1IW7F 2DO7A 1KQ0A 3GTPJ 2EWNA 1LFPA 4PJ0C 4I2OA 2LVSA 3GUDA 1MH3A 2FSWA 4NBQA 5LLQA 1XDSA 4XK4A 5HDNA 3B73A 1B72B 3OV8A 1OPCA 2LRDA 3CF2A 1QHHD 3OY9A 1Y8RB 4K2EA 3S2WA 2FRHA 1ZAOA 3K0LA 3OYNA 3A03A 2OQGA 2VE9A 4XRFA 1LDDA 5TRDA 1IN6A 4BBSJ 2Y0SN 2OU2A 1Q1HA 3HOVJ 2PQ8A 4CZCA 2X6YA 3DLLF 1QBJA 3ZQFA 3IP4B 2XHKA 3H35A 3K7AJ 3PL8A 1L3LA 2JVHA 1ZLKA 2H6BA 1HLVA 3I53A 2KP6A 3CF5F 3JRHA 1IUFA 5FD5A 4NC8A 1KGSA 2QBYB 3HSEA 3DEUA 3TKYA 3DKWA 3OIQA 4M3GA 4B43A 5ICGA 4G7HF 1S7OA 4HLYA 2VIXA 1LB2A 1U78A 4IVNA 1WI3A 2HZTA 3KCCA 3SXYA 2GOXB 1CGPA 5EEAA 1FJLA 5TJJA 2EPFA 3BJOA 1U3EM 2KHMA 1O3QA 4KT5C 2YU3A 4CUGA 2GWRA 2A6HF 4V2GA 1TWCJ 4M71A 2GA2A 2L01A 5BPIA 3R6SA 1VQMI 3PO3J 4HF0A 3CQZJ 3ZQIA 2DQLA 4FTHA 2M4GA 4PCQA 3ZOBA 5DM6F 2VKEA 2WAEA 4PSXA 4IEJA 1K6OA 4O5VA 2LY2A 1O7FA 3OYAA 5B1BH 3M9AA 3BJ6A 3CUQB 3ZMSA 2Q2EB 2HWVA 2P0WA 3E6BA 4XM3A 4BXFA 2JK3A 5BPDA 5L3DA 3FZVA 3H5AA 1BL0A 4GFBA 2W57A 5DYMA 2DPUA 1E17A 2OC6A 2JWTA 2B9SA 3CZ6A 4EVIA 1MIJA 5HLHA 4G7ZF 5K5OA 2IGMA 4HV5A 1VF9A 3N4MA 3S16J 1B9MA 1UHMA 3FXMA 4M6YA 3CCMI 5EDNA 5J1YA 1WKMA 1Z3XA 5LFAA 2R7TA 4HRIA 4KFCA 4Q5SF 1XX5A 3WGIA 5A2QZ 4A3DJ 1RR7A 2MA3A 1ONVA 1TNSA 4M9ZA 3Q9SA 1FX7A 4QPOA 4ZH4F 4IRGA 3O2PE 2EFWA 2K4BA 5M5YJ 2MC3A 5F1RA 2A6TA 3JRIA 1P9QC 2YR2A 2M7BA 4HDUA 1KU2A 1UFMA 2XGEA 2VL8A 2P7VB 3EUAA 5ED4A 2XAHA 3MZYA 4BHCA 3CCQI 2X98A 2HU9A 2HPMA 1DU6A 4BUPA 2EIKH 4IHYA 1WJDA 4JQFA 4ASNA 1YRNA 4A5MA 4XKCA 4RB2C 2OZUA 5DCMA 4HF1A 1WJAA 2IA0A 3NRVA 2LDUA 1ODDA 2V1NA 1FP2A 4B1RA 2ID3A 4CCJA 1R7JA 1Z0XA 2FNAA 2JUCA 3BLYA 1ZREA 4RAYA 1N75A 5M5WJ 2LYCA 1VQLI 2QUFA 4ZZLA 2K27A 5FKKA 4AYBA 3C2BA 3CMEI 2IGNA 3Q5FA 4OIPF 4YIIA 2PFBA 4HBLA 2EH3A 1A35A 1ZGAA 4ZYHA 4A12A 1SFOJ 2M7AA 4IQJA 2NVTJ 2XGDA 2R92J 3S14J 5IT9K 2WY8Q 3NARA 2BOLA 4XOTA 5CYVA 3A2KA 4EM2A 2VT2A 4V19K 1ZHFA 1U9NA 4ESBA 3S93A 5K7ZA 2CW0F 2DFIA 2P4WA 2V6EA 3QOPA 4LLNA 5C4XJ 1VTNC 2QCOA 2VLAA 4RMNA 2M1BA 1KYZA 3SEQA 2AQFA 1JJ6C 4IQ4A 5EGOA 3E6DA 1N78A 1Y1VJ 2K9LA 4Y17A 1RPWA 5BS6A 1FOWA 1ACIA 1V4RA 3VYRB 2QQAA 2DTZA 4LG3A 2NVUB 5FKLA 2HEOA 3FF5A 2EQRA 2L7KA 4PZJA 3NAUA 2VBZA 4PFOA 1ORKA 5L3BA 2E1CA 3AG4H 2A3SA 2MBFA 2LF7A 1AKHB 1XGNA 4D5FA 1BR2A 2J5OA 1YQAA 4ZJZA 2G7UA 3BDDA 4LMYA 3GTQJ 1V55H 5F08A 3J80K 3IRRA 2VPRA 1UELB 5BNGA 1JHFA 6PAXA 4AC0A 1L0OC 1MBGA 2WV0A 1YI2I 2YX4A 3FMRA 4Y7NJ 3CUQA 3OS1A 2XAGA 4L5EA 1R1UA 3L2UA 2HDCA 1B1BA 1JKPC 4FQGA 2M5WA 4P96A 1VQKI 3BTCA 3HJEA 4M6XA 4WXDA 3KEOA 1ZN2A 2GA1A 3FX3A 2VPLA 4V2FA 1FYKA 3F8FA 2P8TA 5E17F 5E79C 1DP3A 2RN7A 2WB1A 1HCRA 1JXSA 3GVAA 1R23A 3V7SA 4LJZF 3WHBA 3IWZA 1IG7A 2EZIA 2DOAA 4A5NA 2KQRA 1SFKA 3K6GA 4D0PA 2NRAC 4IHVA 2M30A 1X19A 3OOUA 3FM3A 2RDPA 2PI0A 2OQRA 2DMUA 1MMGA 1BA5A 2P6TA 3BZKA 4XMYA 1DPUA 3S15J 4CSWA 2FF4A 4DOZA 4R1HA 4BACA 4IHSA 5ERIA 3AKZA 1JT6A 1OYIA 3DKXA 4OOIA 3OYHA 3RQ4A 3A02A 2CW8A 3CUQC 3J80R 4HEA2 3GTMJ 4KMFA 1X2MA 2DAOA 3BR2A 2VUMJ 2CQQA 1TNTA 2R5ZB 4U0WA 5F04A 1FEXA 3MN2A 1P4XA 1Z05A 4S04A 1KONA 1WJ5A 2W84A 1ZG5A 1SAUA 4HF2A 2IS1A 3JREA 2XROA 3LQRA 5LRRA 3H3VK 3OIPA 5J1RA 3SEZA 3CJRB 2STTA 1FZPB 3S2HJ 3AFHA 4EJUA 1YLFA 2XIGA 3C2GA 2AXTC 5JVGF 2NVXJ 3H3UA 1IO2A 4RB0A 2R5YB 1YYVA 4Z2YA 2BXYA 1SAXA 3GXOA 2P7CB 2OAZA 3OL4A 4FX4A 2XAQA 2HVSA 4HSTA 4HA8A 1A36A 5E3LA 3W2WA 4XLPF 1T98A 2XPWA 3CJNA 1IV6A 1X1CA 3Q0VA 1MMSA 1BIAA 2F4IA 1D3YA 4DZJA 2M3AA 3SHFA 5IYCJ 2JRMA 1YJNI 1MDMA 4HX4A 2HZDA 2R7OA 2Y69H 5E18F 2VJJA 2MYSA 1RNLA 4IKFA 5E1WA 1YS7A 2LLKA 2EBIA 2RV8A 3QP5A 3RI4A 3EYYA 2Y9YA 3VPRA 1ZKGA 4L9JA 1MBJA 2L7FP 2LTPA 4OAYA 3ASOH 1J0RA 5J3LA 3AL0B 2QKMB 2XAJA 4XLHA 2CQNA 2HTJA 4U0VA 3JW4A 4F92B 3BPVA 3QPSA 3T5XA 2R7WA 3H36A 2HTSA 1TBXA 1LE8A 2MVTA 1G3YA 3S32A 3LA3A 3Q0UA 3LAJA 3FXJA 4ON0A 1IDZA 1YW7A 1Z21A 3ABLH 2LKSA 1I6HJ 1YHQI 1HKSA 1QVUA 3DBRB 1ZK8A 1MD0A 1V5EA 4MFEA 2IS2A 2DYSH 2WADA 4LK0F 5EZGA 2ICWG 2PG4A 3E3VA 2Y9ZA 2EK5A 3OR1C 4NB5A 2V9VA 4EQQA 3ML6A 4ZYGA 1JGSA 1GHCA 4X1EA 4ITVA 3WGHA 5L3EA 2HYJA 1NG7A 5FLXZ 3UNGC 5D8KB 2L4MA 2CYYA 2VKHA 4E7LA 2VKDA 3SDBA 2VXZA 3JTHA 5F0FA 1J75A 4A3LJ 1WJBA 3H3ZA 3CLOA 1Z9CA 3B6AA 1ETXA 3WU0A 1IC8A 2WC2A 1HW2A 4LLLA 2LMDA 4E7HA 3TOAA 1WH5A 2EILH 3S3NA 4M9SA 1HKTA 2Z5UA 2E7XA 5D8LB 4PUSA 3ABTA 3LQQA 3JRFA 3L09A 1CQTA 4A3EJ 4OIQF 2GXBA 1P7IA 4BQOA 4G9YA 4Y3OA 4DZPA 3JTGA 4XICA 1WRJA 1WWXA 2FBIA 2I10A 4WX9A 1U5TB 2M2EA 1F1ZA 1U0JA 1VQOI 3G4SI 2KRFA 2E2HJ 4KISA 1UCRA 3BR1A 1VI0A 2GOMA 3QQAA 1HW5A 3HEFA 3CDIA 3CCLI 1ZARA 1AA7A 2COMA 5ILUA 2PMUA 4E7JA 2HOAA 4IRHA 3GTJJ 5KAFC 4II2A 1B4AA 1EJ9A 2M8EA 2RAEA 3CP8A 3E5XA 2DA2A 4L5JA 4AVPA 1SFUA 2ISYA 1VQ6I 1QU3A 2BW3A 4B48A 1J7KA 3Q9VA 4RLQA 5GPAA 3K4CA 1N25A 1B6AA 2QF7A 1PYVA 5GAGJ 5J4YA 1LUJB 1YX5A 4UV9A 1MNMC 5FRMA 2OD5A 3DEWA 4DQ2A 4C2TA 3I59A 3VYSB 1K61A 1OCPA 5CKTA 4A3IJ 4JX5A 4CICA 1MNEA 3JR9A 2M0CA 2HDDA 2WV1A 2JRTA 3HUGA 4E7KA 4EJWA 2M87A 3QRFF 4UNOA 5IPAA 1P4AA 3CO6C 1QPMA 4A3FJ 1BM9A 4FE4A 3RKWA 2R7DA 3ZQHA 3DKYA 3GCMA 2Y75A 1YJ9I 5CJ9A 2HFHA 4RM2A 2Z99A 3TO9A 1AWCA 3EUKL 1TQIA 1J09A 2DQRA 3OYEA 4CO8A 1V3FA 3L2RA 2F5EA 3HOTA 1JE8A 3HIFA 2VQGA 3QODA 4NNJA 3RJPA 2OTLI 2A5WA 1S3JA 4F52A 3DTIA 5EJCA 1MH4A 2DJNA 1RIOH 2X4HA 3ECOA 5FO5A 5EEHA 1W5TA 3LSTA 3MKLA 4YFKF 4B44A 1M1EB 2DFHA 2JSCA 4OIOF 1BR4A 1YS6A 3KP5A 2A61A 3GX4X 5GTHC 1XMAA 3F8BA 4RGXA 4XKVA 2HI3A 1RESA 4UB8C 5DTDA 4XRSA 4M72A 3CCVI 3J7AO 1X1BA 2ESHA 4F7ZA 4I01A 3LSPA 3JAMZ 2JJ7A 1ITYA 3HXLA 3FXKA 2KIMA 2JPCA 2XSDC 3CMAI 1PUFB 4LLGF 2JZYA 4EJOA 2EFOA 1VQ7I 3W2VA 3F6VA 1WPKA 2D1VA 2KT0A 3I3LA 4MQ9F 1OLTA 4IOCF 3DBHB 3ASNH 3RPUD 1ZR4A 1W7PB 2NS7A 2MUNA 3TEDA 3D0SA 4BGDA 4LGWA 2L5QA 3L1PA 1YO5C 5FFXA 1GV2A 3FXOA 4GRIA 3UR3C 1XSDA 2DI3A 4EMSA 3R61A 3J81Z 2LFBA 2GAUA 5J47A 5F27A 4DIQA 4MEXF 3SQNA 1OYWA 4XR6A 2KDOA 3HOUJ 3CJTB 1X58A 4H0EA 1P2FA 4BY7J 4LIVA 3ZMVA 2FQ4A 5LHGA 3I58A 1IXRC 1U2WA 2LY1A 4M3FA 3OYKA 3JSOA 2V1DA 4Y15A 1HXDA 3JCUC 1W5SA 1O57A 4L9TA 5J1UA 3J7ZI 2PBIA 2W85A 5BMZA 4CH7A 4AD9A 2KJBA 1T8IA 1ZYRF 2LG4A 1JUSA 5HLIA 1AU7A 5H6QA 1SFXA 2O8KA 3IRQA 5D6FA 3BCBA 2FD5A 3PUFA 1S29A 3NQOA 2R7RA 2UXNA 4BEHA 1I27A 1SD6A 1E0EA 4DJAA 3JAMK 1ETQA 1VZ0A 4DGWB 4EV0A 4U0YA 4ZTFA 2O61A 1IXCA 1R5ID 4IZZA 2PJPA 1D8KA 3FBNB 4BJ6C 2ZJPF 1TL8A 5HOOA 2ETHA 2EA2A 2V4JC 1EH6A 1QZZA 3TMOA 2COBA 2AQEA 3HPGA 1BIBA 2LP0A 2F4MB 1YIOA 3VYTB 5KNLA 2B63J 4DBRA 4C30A 3OYFA 2FE3A 3K4BA 5B1AH 1EF4A 3S8PA 3W2AA 4LK1F 1OCRH 5DD8A 3SFIA 5JFRA 2VJIA 5LGTA 1JKOC 5IP7J 1W1WE 2W24A 1DDNA 1X3UA 4A3JJ 3CCSI 2F5DA 2Z16A 5LBQA 1R4MB 3LA2A 3JRAA 2EJRA 1UG2A 4O6JA 1LDJA 3GLXA 2TCTA 1UG0A 2CMPA 5CQEA 3RKQA 3BCAA 1ZQ3P 4WWCA 3KETA 2KZVA 2CUJA 2JUGA 4EM1A 1RRJA 1CF7B 3BY6A 1ENHA 2R4GA 3FXQA 2P5KA 3AG3H 3ABUA 3GWZA 4I0AA 5DD4A 1J5YA 2PN6A 2A69F 2QYOA 4QSHA 5B5EC 1S72I 1IN5A 2VB6A 1SC7A 3MCZA 3L2WA 1JKQC 1UAAA 1BJZA 4ESFA 1FOXA 3AL0C 3C18A 2VI6A 1AHDP 3K2AA 3RPQA 2EFQA 3RIRA 4BKXA 5E1ZB 4XQFA 3HOXJ 2DBBA 3Q3SA 1XD7A 1JT0A 3C7JA 5F6FA 3ECHA 5HDGA 2FU4A 4XLAA 4XN0A 2F4OB 1VQ8I 2Y30A 4XBFA 3TGNA 2XGXA 1YFHA 2JA7J 3AAFA 2DT7B 3FM5A 2OCCH 4DW6A 2EZKA 2JA2A 2OF7A 3I54A 3F8NA 4KN4X 3NWTA 5HLGA 3IC7A 2WAQA 1TP4A 3DU5A 4CHUA 2CQXA 2K9NA 3TO6A 1X1DA 2HOEA 2A5YB 4KIBA 1QO0D 5H2FC 2ZSHB 4OAZA 5JHFA 3A0BC 4C2MJ 5DM7F 4I6ZA 2L9SA 2ZCWA 2DT5A 3WG9A 2HPIA 1IRGA 4J01A 1I1GA 2KKOA 1TWGJ 3KLOA 1O3SA 2JPBA 3ELKA 2NVQJ 1FMVA 2QZ8A 2LR8A 3WTXC 1ZGWA 4PJJA 2STWA 5LRSA 4ENJA 1X1AA 2WBMA 2DMPA 1FY7A 2VQCA 3M4OJ 3BG7A 1IUYA 1QHGA 3DBLB 1J2XA 2WY7Q 3F3XA 2CSOA 2HOSA 3FK6A 1O3RA 1MSFC 2K9MA 4UUVA 2DA4A 4XLCA 4RAGA 2JVGA 2MC4A 3DPUA 4NQWB 1U8RA 4XNFA 4D7NA 1ETYA 3ERMA 1V5GA 2A05A 3PM1A 4BBRJ 1POGA 1D1BA 2EV5A 1ZTRA 2XKOA 3GBGA 3EQLF 3WG7H 4PJMA 2IJLA 3ZN1A 4N4OB 3L9FA 1XCBA 5HLTA 2O5RA 2XDVA 1OISA 2ZNZA 4BDYA 3QOEA 3FHNA 1ZH5A 2H94A 2DA6A 2V1UA 4AVZA 2ZNYA 3UKGA 1R9TJ 1SD7A 4AUXA 2BZTA 1IN7A 4KYWA 3S3MA 1OMIA 3K1PA 1EA3A 1XG1A 2HQRA 3K70D 2DFEA 4CXFA 2GQQA 3DXJF 3TOBA 3MKWB 3E0JB 2NNYA 4EGZA 1T38A 1W36D 3S1NJ 1U8BA 2KMUA 2R7UA 2F6CA 2GZWA 3V7RA 2CO5A 3QAHA 4D5CA 2LK2A 4HOBA 2B7EA 4I98B 2V79A 4MEYF 4BQQA 3FIWA 5L3FA 5K5QA 3G1OA 5EGOB 2QA4I 2EINH 2BY0A 2X1EA 2CFXA 2DOEA 2BBYA 3VDXA 5K7HA 4MFDA 1SMTA 1QNTA 3HGGA 1XN7A 2K85A 3BR0A 1RUOA 3G1MA 3REOA 4HLXA 1R1VA 4GO1A 4JX4A 4R8HA 3OOPA 3DF8A 2E36A 1B9NA 2NOJB 1FBSA 5C3EJ 1KYWA 4ZDLA 3I4NJ 1I5ZA 3JRDA 4N4NB 2Z9OA 2VE8A 4C3JJ 2FBKA 2GXAA 3HL2A 3J80Z 3EDPA 3LSMA 3BPXA 3GEZA 4B47A 1R5GA 3AG2H 1SD4A 2VQHA 1HKQA 1QZYA 3PFYA 2JQ7A 5HS8A 3JRBA 3DTKA 3VOEA 5M5XJ 3WE3A 2W1OA 1V54H 1T6SA 5GPCA 2V9KA 1FT9A 3HRTA 3NEUA 2HQ5A 5JVTA 2B0LA 3AG1H 2V6CA 4G8XA 4A2UA 3OYIA 1C0WA 1SVOA 3B02A 2V9PA 4ENNA 2BYVE 2DA5A 3IL2A 5GTIC 2HNHA 5EG0B 3LL7A 5ICFA 1RC9A 2V1XA 2MZ4A 3H5RA 1GLNA 3LOCA 2MSYA 3VB2A 4XKBA 2X1DA 4XLNF 3HM5A 1D0YA 2R3SA 2ZBKA 3E1SA 5FB2A 2CU7A 3CDLA 3CJQB 5H20A 2QENA 2XF5A 3TO7A 1KU7A 4WF2A 1W5CC 3IH4A 4FHTA 4RS8A 1YTYA 4N9IA 4RAZA 3WE2A 3I71A 4XL9A 2HVQA 3I5UA 4XRSG 1Y1WJ 3MKZA 1G3SA 4P55A 1K78A 4LFUA 3FHZA 1G2HA 5EF6A 1YG2A 2E5NA 2RKHA 4KICA 3BZ6A 2GM4A 5FKMA 2E1MC 3OSGA 3U9GA 3PNTA 2JA8J 2GIVA 4LD5A 2Y0SA 3KLNA 3RDIA 4ZDOA 2DMQA 5DEQA 2P5LC 1BW6A 1IV8A 2E1NA 3X2QH 3KP3A 3TDZC 2PEXA 3LSHA 3R0AA 1N77A 1WI9A 4IOAF 2ELJA 2ADUA 1PVEA 3FK7A 3MVPA 2WWYA 3VODA 2K5CA 3LSRA 5CVRA 3OYJA 3GZ5A 3BG6A 2ZSIB 4PK4A 5HVQC 3S17J 1R5HA 3FKIJ 1WH7A 4XORA 4L0ZB 5DCFA 4MGRA 1UJ8A 1XGSA 4L9NA 1J9IA 1D0XA 4B4CA 2RQPA 2ZXIA 3OWTA 3I4PA 4L9VA 2IXSA 2QVOA 5E20A 1I1SA 3GYHX 3GZ6A 4I09A 4UUTA 2LSOA 2HGCA 4A6EA 2ZB9A 1MKMA 1Z1DA 1R36A 1YITI 2XF6A 2D5VA 2OZ6A 3F9KA 5K7FA 2WB1N 3MMYB 4L0YB 3P9IA 1P6RA 3F6OA 2L3DA 4F91B 3QU6A 2XB5A 2A07F 4IX7A 3G71I 2FOWA 2FJ1A 3PQJA 2OJED 1GXPA 1LE8B 3TP0A 1E3HA 3K10A 4PFPA 3PSIA 2CG4A 1XMXA 3A1YA 2VKVA 1IRFA 2CH0A 2W00A 3KX2A 1Y39A 2RREA 5F64A 2TDXA 5CQGA 1MJ9A 1XSXA 3ZP5A 5D6EA 2TRTA 2F2EA 1NH3A 3BG5A 1XGOA 3W6VA 2DFFA 4OWRB 2OPTA 3EPZA 4BHPA 1LFUP 3BR3A 3S1RJ 1QVTA 4S0HB 2CV1A 1DGWY 3Q0WA 3M8FA 4LG0A 1KU9A 3CUOA 4EJVA 1BN5A 4GYGA 1S8NA 1YOVB 2EV0A 2EV6A 4L18B 1H9GA 2KJCA 1T95A 3TL4X 3CCUI 2DA1A 2VODA 2V7FA 5CVIA 4A3CJ 5M3MJ 1UMQA 2M0MA 2FBHA 1Y8QB 2XV4S 4LB6B 1X3ZB 5FKOA 2GXGA 4ZC3A 3ZR8X 3ZQ7A 4ESJA 2GBYA 1Z3YA 2FX0A 5HS7A 1IRXA 5KCMA 3JAMR 4PJNA 2P5VA 3GMEA 3K69A 4BU2A 4CYCB 2VN2A 4RB1A 4IHWA 5FRNA 2P81A 3KFWX 1QZEA 4EEFG 5EEGA 2NS8A 1JTXA 1PJRA 2UZKA 3RKXA 1V5FA 3DP7A 2DA3A 2IBDA 2NXNB 2Q2EA 3QU3A 3OYGA 4PSWA 3H0GJ 2M4KA 3EUHA 1IN8A 1FTTA 4FX0A 2VQLA 2Z2SB 2KL4A 4M3DA 4UVBA 1UB9A 2CFOA 1G8XA 3O6BB 5GP9A 5TISC 1IAWA 2R7SA 3RZOJ 2UXXA 4IXAA 2OUMA 1W7PA 2RGVA 4YEJA 4CYDA 3G1LA 3KZYA 4QWQA 4G7OF 1T0FC 3H9GA 4RAFA 2A6EF 1XSVA 1Z7UA 1JHHA 3LWFA 2K02A 1K78B 3S3OA 3BP8A 1NK3P 2CUEA 4FE7A 3GLLA 4LIUA 3QPTA 4EGYA 2VJ4A 1LFBA 4P9FA 5EYRA 2DT6A 2YPRA 4F55A 1I50J 2UWMA 2X51A 4G6TB 3PFIA 5CPRB 4KUMA 2QQBA 1HBXG 1EV7A 2HXOA 2IA2A 3BR5A 2O7OA 2EIJH 4UV8A 5JR3A 2DK5A 3HOSA 1XTAA 2MH2A 1A31A 3I4MJ 5CLSA 4ANJA 5D5UB 1ZR2A 3FBIB 1P4WA 2DDBA 5D5XB 4JOMA 3MKYB 4CCKA 2K4JA 5JHUA 1VFCA 4E7SA 1X4PA 3FXRA 1A6IA 5H6RA 3KYDB 3MAJA 3A0HC 2L9RA 5IT3A 3HG9A 1KQ9A 1Z6TA 2YS9A 3P9CA 5L3GA 3PSFA 4GXOA 4S05A 1U6GA 1MGTA 1VNDA 2X0LA 1BOBA 1F5TA 3KE2A 2ME0A 2AXLA 1W36C 2JA6J 2MD0A 1FLIA 4D7MA 3M8EA 2Q0OA 3HGYA 2OV7A 3G2BA 4CCMA 1RQ6A 4A69C 4GDFA 2GIZA 3N05A 2KRCA 1G6NA 1JTYA 1WJEA 2R5YA 2ECBA 3K70C 5D5VB 4B8XA 2L4AA 2NVYJ 2VJ5A 1HA8A 2F5VA 2E2IJ 3FDYA 3DWLE 4OU0A 5AIQA 3E97A 3WTSC 3ZPLA 1W4MA 3CC2I 3PIOF 2GLOA 2YU9J 3F8CA 4NC6A 4GCVA 4E4HA 1OKRA 4UVCA 3ZRGA 5DUIA 1ON1A 3V8JA 1FMWA 4XLFA 2R93J 2OTJI 2IS4A 2HXIA 2VBWA 4WXHA 4DBQA 3VEPA 1H9TA 3CDHA 3CCJI 4LB5A 3CMYA 2RVCA 2IA1A 3HKZA 1Y0UA 2LKXA 1DU0A 3HSFA 4Y52J 3RSNA 4BE1A 3R0JA 1RUNA 2PX9A 2E1MB 5LHIA 1W7PD 5F0CA 2EB7A 2BW3B 3HRUA 2DMTA 1XB4A 3P5JA 4MNUA 4BEHB 2AS5F 2VOOA 3LNQA 1TQPA 2BVMA 4MIMA 2CQKA 4OIRF 2QQ8A 3K1NA 5IP6A 5JI6A 2HR3A 4A3BJ 3FMQA 4UHTA 1OQYA 5BOXA 5J8CA 1T39A 3KIOA 2K9QA 1R49A 1TC3C 3L00A 4E6KG 2XKPA 3S2DJ 3A52A 4PDKA 1U9OA 1IF1A 1T0FA 2DXIA 3RQIA 3LFKA 4QTRA 1XDUA 4A3KJ 2W4SA 4HSRA 1JUPA 2VT3A 3TDUC 3GO5A 5LD2C 1YW8A 5IYBJ 2IEKA 5DS9A 2ACJA 3K2ZA 3H0DA 1XGMA 2IRFG 2BVLA 4IL6C 4BJTA 3I55I 3T0YA 5GAEJ 3JRCA 4XKWA 1TW2A 2O0YA 3OYDA 3T1BA 2ZJ2A 2VOPA 3K9TA 4HQMA 5K5RA 1E3OC 4ZDPA 1HOMA 5IT9Z 5ILSA 1B8IA 3K1MA 1VQNI 4D9JA 3CESA 1BI1A 2G9WA 4YELA 2R7XA 1MMAA 1BC7C 3PNYA 4E7ZA 2AHQA 2CS3A 4KMUX 3ZMDA 1H89C 4A3GJ 4U7DA 1LNWA 2MW8A 3HOWJ 3M8JA 2R7QA 5E3NA 3BWGA 3LSJA 2R0QC 1KU3A 2QEXI 3SZPA 5F1JA 3ERED 4BL0B 4XRMA 2BE5F 4CGZA 1OR7C 1NG6A 1YE9A 5EZHA 3QYEA 2DJIA 2FMYA 3D5RC 2YUSA 2H09A 1DGRM 3BROA 1K83J 3S1MJ 1OCZH 3U1DA 2WA0A 1ZG3A 5E3MA 2OA4A 1B72A 3DCFA 4IHTA 2WAFA 3GW2A 4JX6A 1IDYA 1OCOH 2CJJA 3BG9A 3HKZN 2X9DA 4A0XA 1IXSB 2IGOA 2XF7A 4JK1X 2H1LA 4B3XA 5DDGA 3ZGKA 2XPVA 1EKEA 2L54A 4G12A 4KA4A 3KPHA 4XLEA 3SZTA 2VC1A 4RA2A 1FTZA 1HDPA 2QSGX 4WXCA 4EJTA 4ZYDA 2H8WA 1TQMA 5DCMB 5FKNA 3D5LA 2H6CA 3WTWC 5DV5A 4HAMA 1K79A 4NC7A 4X6AJ 4L5IA 5FFZA 1BW5A 1S7EA 1R4NB 5FLMJ 1I39A 2JSPA 3EYIA 1Y56A 1D8JA 5IY5H 3F0CA 2KISA 2G7HA 4CYCA 2ZJQF 4Y4RA 3OYLA 1TWHJ 5KVRA 1PDNC 2JT1A 2H1KA 3IV5A 3ZQGA 2IP2A 2E34A 1NK2P 3DPTA 1OCTC 3WU2C 2JTVA 3ZMZA 1ZGJA 3JRGA 4M9XA 1VQPI 2E71A 1SFEA 2FOKA 3WTTC 3VSKA 1GVDA 4RM3A 3OIOA 1VQ5I 4HV6A 1AOYA 3B6CA 3BTIA 2PJRB 3V8KA 5J8FA 2HKOA 3LFUA 5AIPA 5TGTA 2YSRA 1FWZA 4YIFA 4AIKA 2LBFB 3KP7A 2CRGA 2F5CA 1G3TA 3BG3A
chains in the Genus database with same CATH topology
3V4GA 3TQNA 4M74A 3KP4A 4IRIA 3GF2A 1USSA 5A2QK 2XVCA 3FMSA 1DUXC 4XSZF 1ZG1A 1FP1D 3FXUA 3LA7A 4WK8F 3IKTA 1S7AA 3N97A 3E6MA 3GFMA 4EM0B 4HW0A 4PGGA 2LF8A 3HTSB 3HRSA 1J59A 4RGSA 4GGGA 4IPAA 1OR7A 3QPHA 4I0BA 2IW5A 3P7NA 3WTUC 3DQVC 2K86A 5E8GA 4OINF 1BI2A 2QQ9A 2R7FA 5LGNA 2LKPA 1NHAA 4MQVA 1G4DA 3HTUA 1I6XA 1F9NA 2E7WA 5CVUA 3T8TA 3L7WA 4KIGA 1ON2A 1IN4A 3C1DA 2H27A 5J6XA 5HDKA 4RGRA 1PP7U 4TV7A 2A68F 4U7BA 1WSUA 1S6LA 4I02A 2IPQX 2WTEA 3V7CA 1O3TA 2O6GE 4A6DA 5KK1A 3I59B 2FMLA 4BAYA 4AWXB 1R58A 3DPLC 4UVAA 1GXQA 2IVMA 2HS5A 1EH8A 2O8XA 1E2XA 1USTA 4ENKA 1GVJA 4HZFA 4N9HA 4A0ZA 3F8MA 5BQTA 1MDMB 4R79A 2ISZA 4RGUA 1MZBA 3KP2A 2Z3YA 4BH9A 1TW3A 4G6DA 1BI0A 4HDVA 3IKVA 2KIUA 3MQ0A 3ZMTA 1KA8A 4CDGA 2P6SA 4IJAA 3WU1B 4Q4ZF 1U5TC 5HS9A 3HYIA 1O7LA 1FBUA 3E5QA 4OMZA 4CZZA 5LHHA 3RKYA 4P9UA 5K1YA 4E70A 1ZRCA 3FWEA 1YW9A 2MLGA 2VC0A 4AIHA 1SD5A 4BNCA 4IF4A 2VBXA 2Z33A 1KQ8A 3KZZA 2Y0MA 2F5FA 2FEZA 4ENMA 5D4RA 1WQ2A 5ILVA 1FYMA 5FGMA 5E8IA 5CVJA 5L3CA 1ZRFA 3IWFA 4HQEA 2HYGD 4QLCU 1FBQA 2DW4A 3I64A 3ROUA 4ZZDA 5LEJA 3VFZA 3RPUA 1H0MA 2C6YA 2O03A 1FNNA 5AONA 4N0BA 1BC8C 3U2RA 4B09A 3P9KA 3KEQA 2IT0A 1Z6RA 1LEAA 3R60A 1PP8F 1P92A 4YFXF 3J81K 2FQ3A 1ZLJA 5E1XA 2D1HA 4XSXF 3BJAA 3ZN0A 2ZMEB 3JSPA 4BXUA 3CO7C 4Q48A 2EFNA 2NAZA 2NS0A 5ICCA 4KIFA 2ESNA 4KN7X 2HKXA 1IZ1A 3KP6A 1FOKA 4JBAA 5FD6A 2O3FA 3I0TA 1BOAA 2VONA 1MJAA 2XASA 2D45A 3G73A 1CF7A 3GFIA 5CVVA 5D5WB 1R1TA 1PUEE 3GFLA 2DLLA 4GYIA 4O3MA 3HHGA 5FLXK 1MJBA 2YX7A 1SMYF 2XAFA 2QLZA 1DPRA 1HQCA 4A0YA 3F72A 5DUKA 4YFNF 3WTZA 5ICEA 3MWMA 3HHHA 4MHGA 2DK8A 2QWWA 3F23A 2FA5A 2MLKA 3COAC 2OBPA 2CWEA 1BBYA 1XMKA 1QQIA 1LDKB 4G6QA 2LNBA 1BJAA 4HX7A 1LQ1A 2PLYA 2EA4A 4P5OA 1RI7A 4BQAA 1FPQA 2QBYA 4WCGA 3BOQA 2KIFA 2MH9A 2QM3A 3C3WA 4G94A 1HSJA 2DTRA 4MTEA 4KNYA 4LG0B 3WTYC 3O3KA 1TLHB 3MEXA 2FXAA 1LJ9A 3ISPA 4HYEA 2W25A 4ZYEA 2EFPA 1Z91A 3R4KA 4RB3C 3HRMA 2HQNA 2ZMEA 1FC3A 1A04A 4FT8A 1HW1A 3EETA 2J5PA 3WODF 3RYRA 3DV8A 2ZKZA 4I7HA 3F21A 1QGPA 1FSEA 3RYPA 1EH7A 3CTAA 2DU9A 2RC4A 1REPC 4M73A 1TTYA 3SFZA 2Q8KA 3E6CC 2MD5A 1R00A 1RZ4A 2ZFWA 4PGHA 3W6KB 1XCVA 3V8LA 2ZO4A 2BEOA 1STZA 4Y13A 3E5UA 1R22A 4NQWA 3M7GA 4UXNA 4BHBA 1DP7P 1T2KA 2DPDA 2K7LA 4MTDA 1U5TA 3RTRA 4AIJA 4BYYA 1G3WA 3DFGA 1OYYA 3W6JB 2NNNA 2VBYA 2NYXA 1ZRDA 1LEBA 1LVAA 3GFJA 4DNCA 3ULQB 3M1EA 1ULYA 2ELHA 3F22A 1FSHA 3WTVC 3QP6A 4HX8A 3HSRA 1UHWA 2CGPA 3PQKA 3MZHA 3MFKA 2FNPA 3ZMUA 2XUBA 2HYFA 2L02A 5D4SA 1F4KA 3T8RA 4OMYA 5LGUA 1B59A 2M45A 3L2CA 1FYLA 1D5VA 2D2WA 1HSTA 4KDPA 3IHUA 4ETSA 1BI3A 5LEKA 2XRNA 2BGCA 3G3ZA 2ZXJA 3LAPA 1K7AA 3H92A 4NHJA 3WGGA 4YG2F 2PMHA 2RNJA 2BV6A 4Q47A 2Y48A 2DO7A 1IW7F 1KQ0A 2EWNA 4I2OA 3GUDA 2FSWA 5LLQA 1XDSA 5HDNA 3B73A 3OV8A 1OPCA 4K2EA 3S2WA 2FRHA 1ZAOA 3K0LA 2VE9A 2OQGA 4XRFA 1LDDA 5TRDA 1IN6A 2OU2A 1Q1HA 2PQ8A 1QBJA 2XHKA 1L3LA 1ZLKA 2H6BA 3I53A 5FD5A 1KGSA 2QBYB 3HSEA 3DEUA 3TKYA 3DKWA 5ICGA 4G7HF 1S7OA 4HLYA 1LB2A 1U78A 4IVNA 2HZTA 3KCCA 3SXYA 1CGPA 5TJJA 3BJOA 1U3EM 1O3QA 4KT5C 2YU3A 2GWRA 2A6HF 4M71A 2GA2A 2L01A 5BPIA 3R6SA 4HF0A 2DQLA 4PCQA 1K6OA 4O5VA 1O7FA 3M9AA 3BJ6A 3CUQB 3ZMSA 2HWVA 3E6BA 5BPDA 5L3DA 3FZVA 2W57A 5DYMA 2DPUA 4EVIA 5HLHA 4G7ZF 5K5OA 4HV5A 3N4MA 1B9MA 1UHMA 4M6YA 1WKMA 4KFCA 4Q5SF 3WGIA 5A2QZ 2MA3A 1ONVA 1TNSA 4M9ZA 3Q9SA 1FX7A 4ZH4F 4IRGA 3O2PE 2EFWA 2K4BA 5F1RA 2MC3A 2YR2A 4HDUA 1KU2A 1UFMA 5ED4A 2P7VB 2XAHA 3MZYA 4BHCA 4JQFA 4ASNA 4A5MA 4RB2C 2OZUA 5DCMA 4HF1A 2IA0A 3NRVA 2LDUA 1ODDA 1FP2A 1R7JA 2FNAA 1ZREA 4RAYA 2QUFA 4ZZLA 2K27A 3Q5FA 4OIPF 4YIIA 2PFBA 4HBLA 1ZGAA 4ZYHA 4A12A 1E17A 5IT9K 5CYVA 4EM2A 2VT2A 1ZHFA 4ESBA 2CW0F 2DFIA 2P4WA 4LLNA 3QOPA 1VTNC 2M1BA 1KYZA 3E6DA 4Y17A 5BS6A 1V4RA 2QQAA 2HEOA 3FF5A 4PZJA 2VBZA 5L3BA 2E1CA 2A3SA 2MBFA 2LF7A 1XGNA 2J5OA 1YQAA 2G7UA 3BDDA 4LMYA 3J80K 3IRRA 1JHFA 6PAXA 1L0OC 2WV0A 2YX4A 3FMRA 3CUQA 2XAGA 1R1UA 2HDCA 1B1BA 2M5WA 4P96A 4M6XA 4WXDA 3KEOA 1ZN2A 2GA1A 3FX3A 1FYKA 3F8FA 2P8TA 5E17F 2RN7A 1JXSA 3GVAA 1R23A 3V7SA 4LJZF 3IWZA 4A5NA 4D0PA 2NRAC 2M30A 3FM3A 2RDPA 2PI0A 2OQRA 2P6TA 1DPUA 2FF4A 4R1HA 4IHSA 5ERIA 1OYIA 4OOIA 3CUQC 4KMFA 2DAOA 1TNTA 4U0WA 1P4XA 1Z05A 4S04A 1ZG5A 2W84A 4HF2A 2XROA 3LQRA 5LRRA 2STTA 1FZPB 4EJUA 1YLFA 2XIGA 3H3UA 4RB0A 1YYVA 4Z2YA 1SAXA 3GXOA 2P7CB 2OAZA 4FX4A 2XAQA 4HA8A 4XLPF 1T98A 3CJNA 1BIAA 1D3YA 3SHFA 1MDMA 4HX4A 5E18F 1RNLA 5E1WA 1YS7A 3RI4A 2RV8A 3QP5A 3EYYA 4L9JA 1J0RA 2XAJA 2HTJA 4U0VA 3JW4A 3BPVA 3T5XA 2HTSA 1TBXA 1G3YA 3LA3A 3LAJA 4ON0A 1YW7A 1HKSA 1MD0A 4LK0F 2PG4A 3E3VA 2EK5A 4NB5A 2V9VA 4EQQA 3ML6A 4ZYGA 1JGSA 1GHCA 3WGHA 5L3EA 5FLXZ 5D8KB 2L4MA 2CYYA 2VXZA 3JTHA 1J75A 3H3ZA 1Z9CA 3CLOA 3WU0A 2WC2A 1HW2A 4LLLA 3TOAA 4M9SA 1HKTA 2Z5UA 2E7XA 5D8LB 3ABTA 3LQQA 3L09A 4OIQF 2GXBA 4G9YA 3JTGA 1WRJA 1WWXA 2FBIA 4WX9A 1U5TB 1F1ZA 2KRFA 1UCRA 1HW5A 1ZARA 2COMA 5ILUA 2PMUA 4IRHA 1B4AA 2M8EA 3E5XA 4AVPA 4L5JA 1SFUA 2ISYA 1J7KA 3Q9VA 1B6AA 4UV9A 2OD5A 4DQ2A 3I59A 4CICA 2JRTA 3HUGA 4EJWA 2M87A 3QRFF 4UNOA 1P4AA 3CO6C 1QPMA 1BM9A 3RKWA 2R7DA 2Y75A 5CJ9A 2HFHA 2Z99A 3TO9A 1AWCA 1TQIA 2DQRA 4CO8A 1V3FA 2F5EA 3HOTA 1JE8A 3HIFA 3RJPA 1S3JA 1RIOH 2X4HA 3ECOA 5FO5A 5EEHA 1W5TA 3LSTA 4YFKF 4OIOF 2JSCA 1YS6A 3KP5A 2A61A 3GX4X 1XMAA 3F8BA 4RGXA 4M72A 3J7AO 2ESHA 4F7ZA 4I01A 3JAMZ 2KIMA 2JPCA 4LLGF 2JZYA 4EJOA 2EFOA 3F6VA 2D1VA 4MQ9F 1W7PB 3D0SA 4LGWA 1YO5C 5FFXA 1XSDA 2DI3A 4EMSA 3R61A 3J81Z 2GAUA 4MEXF 3SQNA 1OYWA 4H0EA 1P2FA 3ZMVA 5LHGA 3I58A 1IXRC 1U2WA 3JSOA 2V1DA 4Y15A 1HXDA 1W5SA 1O57A 4L9TA 5BMZA 2PBIA 2W85A 4AD9A 2KJBA 1ZYRF 5HLIA 5H6QA 1SFXA 3IRQA 5D6FA 1S29A 3NQOA 2UXNA 1I27A 1SD6A 3JAMK 4EV0A 4U0YA 2O61A 1IXCA 2PJPA 1D8KA 5HOOA 2ETHA 2EA2A 1EH6A 1QZZA 1BIBA 1YIOA 2FE3A 4LK1F 5DD8A 5JFRA 5LGTA 2W24A 1DDNA 1X3UA 2F5DA 5LBQA 3LA2A 2EJRA 4O6JA 1LDJA 3GLXA 4WWCA 3KETA 4EM1A 1CF7B 3BY6A 2P5KA 3FXQA 3ABUA 3GWZA 4I0AA 5DD4A 1J5YA 2PN6A 2A69F 2QYOA 1IN5A 3MCZA 4ESFA 3C18A 3RPQA 2EFQA 3RIRA 5E1ZB 2DBBA 1XD7A 3C7JA 5F6FA 3ECHA 5HDGA 2FU4A 4XBFA 3TGNA 2XGXA 1YFHA 3AAFA 3FM5A 3I54A 3F8NA 4KN4X 5HLGA 3IC7A 4CHUA 3TO6A 2HOEA 2A5YB 4KIBA 1QO0D 2ZCWA 2DT5A 3WG9A 1IRGA 1I1GA 2KKOA 3KLOA 1O3SA 2JPBA 3ELKA 2QZ8A 3WTXC 2STWA 5LRSA 4ENJA 1FY7A 1IUYA 1J2XA 3F3XA 2CSOA 1O3RA 4UUVA 1U8RA 2EV5A 2XKOA 3EQLF 2IJLA 3ZN1A 3L9FA 1XCBA 2ZNZA 1ZH5A 2H94A 2V1UA 2ZNYA 1SD7A 1IN7A 4KYWA 1OMIA 3K1PA 2HQRA 4CXFA 2GQQA 3DXJF 3TOBA 2NNYA 4EGZA 1T38A 2GZWA 3V7RA 2CO5A 3QAHA 4HOBA 4I98B 5L3FA 5K5QA 2V79A 4MEYF 2CFXA 2BBYA 1SMTA 1QNTA 1XN7A 1RUOA 3REOA 4HLXA 1R1VA 4GO1A 4R8HA 3OOPA 3DF8A 1B9NA 1FBSA 1KYWA 1I5ZA 2Z9OA 2VE8A 2FBKA 3J80Z 3EDPA 3BPXA 3GEZA 1R5GA 1SD4A 1HKQA 1QZYA 5HS8A 3VOEA 3WE3A 1T6SA 3HRTA 1FT9A 3NEUA 5JVTA 2B0LA 2V6CA 4G8XA 4A2UA 1C0WA 3B02A 4ENNA 2BYVE 3IL2A 5ICFA 2V1XA 3VB2A 4XLNF 2R3SA 2ZBKA 5FB2A 5H20A 2QENA 3TO7A 1KU7A 4WF2A 4FHTA 4RS8A 1YTYA 4N9IA 4RAZA 3WE2A 3I71A 3I5UA 1G3SA 4P55A 1K78A 4LFUA 3FHZA 1YG2A 2RKHA 4KICA 3BZ6A 3U9GA 2GIVA 4LD5A 3KLNA 3RDIA 5DEQA 2P5LC 2E1NA 3KP3A 3TDZC 2PEXA 3R0AA 1WI9A 2ADUA 2WWYA 3VODA 5CVRA 3GZ5A 5HVQC 1R5HA 4L0ZB 5DCFA 4MGRA 1XGSA 4L9NA 1J9IA 2RQPA 3I4PA 4L9VA 2QVOA 5E20A 1I1SA 3GYHX 3GZ6A 4I09A 2LSOA 2HGCA 4A6EA 1MKMA 1Z1DA 1R36A 2OZ6A 4L0YB 3P9IA 1P6RA 3F6OA 2L3DA 3QU6A 2A07F 3PQJA 1GXPA 2CG4A 1IRFA 5F64A 2TDXA 1MJ9A 1XSXA 3ZP5A 5D6EA 2F2EA 1XGOA 4BHPA 3M8FA 4LG0A 1KU9A 3CUOA 4EJVA 1BN5A 4GYGA 1S8NA 2EV0A 2EV6A 4L18B 1H9GA 2KJCA 2VODA 5CVIA 2FBHA 2XV4S 4LB6B 2GXGA 3ZQ7A 4ESJA 5HS7A 2P5VA 3K69A 2VN2A 4RB1A 3KFWX 5EEGA 2UZKA 3RKXA 3DP7A 2Q2EA 3QU3A 3EUHA 1IN8A 4FX0A 4UVBA 1UB9A 3O6BB 1IAWA 2UXXA 4IXAA 1W7PA 2RGVA 4CYDA 3KZYA 4QWQA 4G7OF 2A6EF 1XSVA 1Z7UA 1JHHA 3LWFA 2K02A 1K78B 3BP8A 4EGYA 3QPTA 4P9FA 2UWMA 2YPRA 3PFIA 4KUMA 2QQBA 1HBXG 1EV7A 2IA2A 4UV8A 5JR3A 2DK5A 3HOSA 2MH2A 5CLSA 5D5UB 5D5XB 1P4WA 2K4JA 5JHUA 3FXRA 5H6RA 3MAJA 5IT3A 1KQ9A 1Z6TA 3P9CA 5L3GA 4S05A 4GXOA 1U6GA 1MGTA 2X0LA 1F5TA 3KE2A 2AXLA 1FLIA 3M8EA 2Q0OA 1G6NA 5D5VB 4B8XA 2L4AA 4OU0A 5AIQA 3WTSC 3E97A 3ZPLA 1W4MA 3F8CA 4GCVA 1OKRA 4UVCA 5DUIA 1ON1A 3V8JA 2VBWA 4WXHA 3VEPA 1H9TA 3CDHA 4LB5A 2RVCA 2IA1A 1Y0UA 3HSFA 3R0JA 1RUNA 5LHIA 1W7PD 2EB7A 3HRUA 1XB4A 4MNUA 2AS5F 2VOOA 1TQPA 2CQKA 4OIRF 3K1NA 5JI6A 2HR3A 3FMQA 4UHTA 5BOXA 5J8CA 1T39A 3L00A 2XKPA 4PDKA 1IF1A 1T0FA 3LFKA 1XDUA 2VT3A 3TDUC 3GO5A 1YW8A 2ACJA 3K2ZA 2IRFG 1XGMA 3T0YA 1TW2A 2O0YA 3T1BA 2ZJ2A 2VOPA 3K9TA 4HQMA 5K5RA 5IT9Z 5ILSA 3K1MA 1BI1A 2G9WA 1BC7C 4KMUX 3ZMDA 4U7DA 1LNWA 3BWGA 1KU3A 3SZPA 3ERED 2BE5F 4CGZA 2FMYA 2H09A 3BROA 3U1DA 1ZG3A 2OA4A 4IHTA 3GW2A 4A0XA 1IXSB 4JK1X 1G3TA 5DDGA 4KA4A 2L54A 3SZTA 2VC1A 4WXCA 4EJTA 4ZYDA 1TQMA 5DCMB 3D5LA 2H6CA 3WTWC 5DV5A 4HAMA 1K79A 4L5IA 5FFZA 3EYIA 1D8JA 2G7HA 1PDNC 5KVRA 2JT1A 2IP2A 3DPTA 3ZMZA 2JTVA 1ZGJA 4M9XA 1SFEA 2FOKA 3WTTC 4HV6A 1AOYA 3V8KA 5J8FA 2HKOA 5AIPA 2YSRA 1FWZA 4YIFA 4AIKA 3KP7A 2F5CA 4U88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  3TQN A;  4M74 A;  3KP4 A;  4IRI A;  3GF2 A;  1USS A;  5A2Q K;  2XVC A;  3FMS A;  1DUX C;  4XSZ F;  1ZG1 A;  1FP1 D;  3FXU A;  3LA7 A;  4WK8 F;  3IKT A;  1S7A A;  3N97 A;  3E6M A;  3GFM A;  4EM0 B;  4HW0 A;  4PGG A;  2LF8 A;  3HTS B;  3HRS A;  1J59 A;  4RGS A;  4GGG A;  4IPA A;  1OR7 A;  3QPH A;  4I0B A;  2IW5 A;  3P7N A;  3WTU C;  3DQV C;  2K86 A;  5E8G A;  4OIN F;  1BI2 A;  2QQ9 A;  2R7F A;  5LGN A;  2LKP A;  1NHA A;  4MQV A;  1G4D A;  3HTU A;  1I6X A;  1F9N A;  2E7W A;  5CVU A;  3T8T A;  3L7W A;  4KIG A;  1ON2 A;  1IN4 A;  3C1D A;  2H27 A;  5J6X A;  5HDK A;  4RGR A;  1PP7 U;  4TV7 A;  2A68 F;  4U7B A;  1WSU A;  1S6L A;  4I02 A;  2IPQ X;  2WTE A;  3V7C A;  1O3T A;  2O6G E;  4A6D A;  5KK1 A;  3I59 B;  2FML A;  4BAY A;  4AWX B;  1R58 A;  3DPL C;  4UVA A;  1GXQ A;  2IVM A;  2HS5 A;  1EH8 A;  2O8X A;  1E2X A;  1UST A;  4ENK A;  1GVJ A;  4HZF A;  4N9H A;  4A0Z A;  3F8M A;  5BQT A;  1MDM B;  4R79 A;  2ISZ A;  4RGU A;  1MZB A;  3KP2 A;  2Z3Y A;  4BH9 A;  1TW3 A;  4G6D A;  1BI0 A;  4HDV A;  3IKV A;  2KIU A;  3MQ0 A;  3ZMT A;  1KA8 A;  4CDG A;  2P6S A;  4IJA A;  3WU1 B;  4Q4Z F;  1U5T C;  5HS9 A;  3HYI A;  1O7L A;  1FBU A;  3E5Q A;  4OMZ A;  4CZZ A;  5LHH A;  3RKY A;  4P9U A;  5K1Y A;  4E70 A;  1ZRC A;  3FWE A;  1YW9 A;  2MLG A;  2VC0 A;  4AIH A;  1SD5 A;  4BNC A;  4IF4 A;  2VBX A;  2Z33 A;  1KQ8 A;  3KZZ A;  2Y0M A;  2F5F A;  2FEZ A;  4ENM A;  5D4R A;  1WQ2 A;  5ILV A;  1FYM A;  5FGM A;  5E8I A;  5CVJ A;  5L3C A;  1ZRF A;  3IWF A;  4HQE A;  2HYG D;  4QLC U;  1FBQ A;  2DW4 A;  3I64 A;  3ROU A;  4ZZD A;  5LEJ A;  3VFZ A;  3RPU A;  1H0M A;  2C6Y A;  2O03 A;  1FNN A;  5AON A;  4N0B A;  1BC8 C;  3U2R A;  4B09 A;  3P9K A;  3KEQ A;  2IT0 A;  1Z6R A;  1LEA A;  3R60 A;  1PP8 F;  1P92 A;  4YFX F;  3J81 K;  2FQ3 A;  1ZLJ A;  5E1X A;  2D1H A;  4XSX F;  3BJA A;  3ZN0 A;  2ZME B;  3JSP A;  4BXU A;  3CO7 C;  4Q48 A;  2EFN A;  2NAZ A;  2NS0 A;  5ICC A;  4KIF A;  2ESN A;  4KN7 X;  2HKX A;  1IZ1 A;  3KP6 A;  1FOK A;  4JBA A;  5FD6 A;  2O3F A;  3I0T A;  1BOA A;  2VON A;  1MJA A;  2XAS A;  2D45 A;  3G73 A;  1CF7 A;  3GFI A;  5CVV A;  5D5W B;  1R1T A;  1PUE E;  3GFL A;  2DLL A;  4GYI A;  4O3M A;  3HHG A;  5FLX K;  1MJB A;  2YX7 A;  1SMY F;  2XAF A;  2QLZ A;  1DPR A;  1HQC A;  4A0Y A;  3F72 A;  5DUK A;  4YFN F;  3WTZ A;  5ICE A;  3MWM A;  3HHH A;  4MHG A;  2DK8 A;  2QWW A;  3F23 A;  2FA5 A;  2MLK A;  3COA C;  2OBP A;  2CWE A;  1BBY A;  1XMK A;  1QQI A;  1LDK B;  4G6Q A;  2LNB A;  1BJA A;  4HX7 A;  1LQ1 A;  2PLY A;  2EA4 A;  4P5O A;  1RI7 A;  4BQA A;  1FPQ A;  2QBY A;  4WCG A;  3BOQ A;  2KIF A;  2MH9 A;  2QM3 A;  3C3W A;  4G94 A;  1HSJ A;  2DTR A;  4MTE A;  4KNY A;  4LG0 B;  3WTY C;  3O3K A;  1TLH B;  3MEX A;  2FXA A;  1LJ9 A;  3ISP A;  4HYE A;  2W25 A;  4ZYE A;  2EFP A;  1Z91 A;  3R4K A;  4RB3 C;  3HRM A;  2HQN A;  2ZME A;  1FC3 A;  1A04 A;  4FT8 A;  1HW1 A;  3EET A;  2J5P A;  3WOD F;  3RYR A;  3DV8 A;  2ZKZ A;  4I7H A;  3F21 A;  1QGP A;  1FSE A;  3RYP A;  1EH7 A;  3CTA A;  2DU9 A;  2RC4 A;  1REP C;  4M73 A;  1TTY A;  3SFZ A;  2Q8K A;  3E6C C;  2MD5 A;  1R00 A;  1RZ4 A;  2ZFW A;  4PGH A;  3W6K B;  1XCV A;  3V8L A;  2ZO4 A;  2BEO A;  1STZ A;  4Y13 A;  3E5U A;  1R22 A;  4NQW A;  3M7G A;  4UXN A;  4BHB A;  1DP7 P;  1T2K A;  2DPD A;  2K7L A;  4MTD A;  1U5T A;  3RTR A;  4AIJ A;  4BYY A;  1G3W A;  3DFG A;  1OYY A;  3W6J B;  2NNN A;  2VBY A;  2NYX A;  1ZRD A;  1LEB A;  1LVA A;  3GFJ A;  4DNC A;  3ULQ B;  3M1E A;  1ULY A;  2ELH A;  3F22 A;  1FSH A;  3WTV C;  3QP6 A;  4HX8 A;  3HSR A;  1UHW A;  2CGP A;  3PQK A;  3MZH A;  3MFK A;  2FNP A;  3ZMU A;  2XUB A;  2HYF A;  2L02 A;  5D4S A;  1F4K A;  3T8R A;  4OMY A;  5LGU A;  1B59 A;  2M45 A;  3L2C A;  1FYL A;  1D5V A;  2D2W A;  1HST A;  4KDP A;  3IHU A;  4ETS A;  1BI3 A;  5LEK A;  2XRN A;  2BGC A;  3G3Z A;  2ZXJ A;  3LAP A;  1K7A A;  3H92 A;  4NHJ A;  3WGG A;  4YG2 F;  2PMH A;  2RNJ A;  2BV6 A;  4Q47 A;  2Y48 A;  2DO7 A;  1IW7 F;  1KQ0 A;  2EWN A;  4I2O A;  3GUD A;  2FSW A;  5LLQ A;  1XDS A;  5HDN A;  3B73 A;  3OV8 A;  1OPC A;  4K2E A;  3S2W A;  2FRH A;  1ZAO A;  3K0L A;  2VE9 A;  2OQG A;  4XRF A;  1LDD A;  5TRD A;  1IN6 A;  2OU2 A;  1Q1H A;  2PQ8 A;  1QBJ A;  2XHK A;  1L3L A;  1ZLK A;  2H6B A;  3I53 A;  5FD5 A;  1KGS A;  2QBY B;  3HSE A;  3DEU A;  3TKY A;  3DKW A;  5ICG A;  4G7H F;  1S7O A;  4HLY A;  1LB2 A;  1U78 A;  4IVN A;  2HZT A;  3KCC A;  3SXY A;  1CGP A;  5TJJ A;  3BJO A;  1U3E M;  1O3Q A;  4KT5 C;  2YU3 A;  2GWR A;  2A6H F;  4M71 A;  2GA2 A;  2L01 A;  5BPI A;  3R6S A;  4HF0 A;  2DQL A;  4PCQ A;  1K6O A;  4O5V A;  1O7F A;  3M9A A;  3BJ6 A;  3CUQ B;  3ZMS A;  2HWV A;  3E6B A;  5BPD A;  5L3D A;  3FZV A;  2W57 A;  5DYM A;  2DPU A;  4EVI A;  5HLH A;  4G7Z F;  5K5O A;  4HV5 A;  3N4M A;  1B9M A;  1UHM A;  4M6Y A;  1WKM A;  4KFC A;  4Q5S F;  3WGI A;  5A2Q Z;  2MA3 A;  1ONV A;  1TNS A;  4M9Z A;  3Q9S A;  1FX7 A;  4ZH4 F;  4IRG A;  3O2P E;  2EFW A;  2K4B A;  5F1R A;  2MC3 A;  2YR2 A;  4HDU A;  1KU2 A;  1UFM A;  5ED4 A;  2P7V B;  2XAH A;  3MZY A;  4BHC A;  4JQF A;  4ASN A;  4A5M A;  4RB2 C;  2OZU A;  5DCM A;  4HF1 A;  2IA0 A;  3NRV A;  2LDU A;  1ODD A;  1FP2 A;  1R7J A;  2FNA A;  1ZRE A;  4RAY A;  2QUF A;  4ZZL A;  2K27 A;  3Q5F A;  4OIP F;  4YII A;  2PFB A;  4HBL A;  1ZGA A;  4ZYH A;  4A12 A;  1E17 A;  5IT9 K;  5CYV A;  4EM2 A;  2VT2 A;  1ZHF A;  4ESB A;  2CW0 F;  2DFI A;  2P4W A;  4LLN A;  3QOP A;  1VTN C;  2M1B A;  1KYZ A;  3E6D A;  4Y17 A;  5BS6 A;  1V4R A;  2QQA A;  2HEO A;  3FF5 A;  4PZJ A;  2VBZ A;  5L3B A;  2E1C A;  2A3S A;  2MBF A;  2LF7 A;  1XGN A;  2J5O A;  1YQA A;  2G7U A;  3BDD A;  4LMY A;  3J80 K;  3IRR A;  1JHF A;  6PAX A;  1L0O C;  2WV0 A;  2YX4 A;  3FMR A;  3CUQ A;  2XAG A;  1R1U A;  2HDC A;  1B1B A;  2M5W A;  4P96 A;  4M6X A;  4WXD A;  3KEO A;  1ZN2 A;  2GA1 A;  3FX3 A;  1FYK A;  3F8F A;  2P8T A;  5E17 F;  2RN7 A;  1JXS A;  3GVA A;  1R23 A;  3V7S A;  4LJZ F;  3IWZ A;  4A5N A;  4D0P A;  2NRA C;  2M30 A;  3FM3 A;  2RDP A;  2PI0 A;  2OQR A;  2P6T A;  1DPU A;  2FF4 A;  4R1H A;  4IHS A;  5ERI A;  1OYI A;  4OOI A;  3CUQ C;  4KMF A;  2DAO A;  1TNT A;  4U0W A;  1P4X A;  1Z05 A;  4S04 A;  1ZG5 A;  2W84 A;  4HF2 A;  2XRO A;  3LQR A;  5LRR A;  2STT A;  1FZP B;  4EJU A;  1YLF A;  2XIG A;  3H3U A;  4RB0 A;  1YYV A;  4Z2Y A;  1SAX A;  3GXO A;  2P7C B;  2OAZ A;  4FX4 A;  2XAQ A;  4HA8 A;  4XLP F;  1T98 A;  3CJN A;  1BIA A;  1D3Y A;  3SHF A;  1MDM A;  4HX4 A;  5E18 F;  1RNL A;  5E1W A;  1YS7 A;  3RI4 A;  2RV8 A;  3QP5 A;  3EYY A;  4L9J A;  1J0R A;  2XAJ A;  2HTJ A;  4U0V A;  3JW4 A;  3BPV A;  3T5X A;  2HTS A;  1TBX A;  1G3Y A;  3LA3 A;  3LAJ A;  4ON0 A;  1YW7 A;  1HKS A;  1MD0 A;  4LK0 F;  2PG4 A;  3E3V A;  2EK5 A;  4NB5 A;  2V9V A;  4EQQ A;  3ML6 A;  4ZYG A;  1JGS A;  1GHC A;  3WGH A;  5L3E A;  5FLX Z;  5D8K B;  2L4M A;  2CYY A;  2VXZ A;  3JTH A;  1J75 A;  3H3Z A;  1Z9C A;  3CLO A;  3WU0 A;  2WC2 A;  1HW2 A;  4LLL A;  3TOA A;  4M9S A;  1HKT A;  2Z5U A;  2E7X A;  5D8L B;  3ABT A;  3LQQ A;  3L09 A;  4OIQ F;  2GXB A;  4G9Y A;  3JTG A;  1WRJ A;  1WWX A;  2FBI A;  4WX9 A;  1U5T B;  1F1Z A;  2KRF A;  1UCR A;  1HW5 A;  1ZAR A;  2COM A;  5ILU A;  2PMU A;  4IRH A;  1B4A A;  2M8E A;  3E5X A;  4AVP A;  4L5J A;  1SFU A;  2ISY A;  1J7K A;  3Q9V A;  1B6A A;  4UV9 A;  2OD5 A;  4DQ2 A;  3I59 A;  4CIC A;  2JRT A;  3HUG A;  4EJW A;  2M87 A;  3QRF F;  4UNO A;  1P4A A;  3CO6 C;  1QPM A;  1BM9 A;  3RKW A;  2R7D A;  2Y75 A;  5CJ9 A;  2HFH A;  2Z99 A;  3TO9 A;  1AWC A;  1TQI A;  2DQR A;  4CO8 A;  1V3F A;  2F5E A;  3HOT A;  1JE8 A;  3HIF A;  3RJP A;  1S3J A;  1RIO H;  2X4H A;  3ECO A;  5FO5 A;  5EEH A;  1W5T A;  3LST A;  4YFK F;  4OIO F;  2JSC A;  1YS6 A;  3KP5 A;  2A61 A;  3GX4 X;  1XMA A;  3F8B A;  4RGX A;  4M72 A;  3J7A O;  2ESH A;  4F7Z A;  4I01 A;  3JAM Z;  2KIM A;  2JPC A;  4LLG F;  2JZY A;  4EJO A;  2EFO A;  3F6V A;  2D1V A;  4MQ9 F;  1W7P B;  3D0S A;  4LGW A;  1YO5 C;  5FFX A;  1XSD A;  2DI3 A;  4EMS A;  3R61 A;  3J81 Z;  2GAU A;  4MEX F;  3SQN A;  1OYW A;  4H0E A;  1P2F A;  3ZMV A;  5LHG A;  3I58 A;  1IXR C;  1U2W A;  3JSO A;  2V1D A;  4Y15 A;  1HXD A;  1W5S A;  1O57 A;  4L9T A;  5BMZ A;  2PBI A;  2W85 A;  4AD9 A;  2KJB A;  1ZYR F;  5HLI A;  5H6Q A;  1SFX A;  3IRQ A;  5D6F A;  1S29 A;  3NQO A;  2UXN A;  1I27 A;  1SD6 A;  3JAM K;  4EV0 A;  4U0Y A;  2O61 A;  1IXC A;  2PJP A;  1D8K A;  5HOO A;  2ETH A;  2EA2 A;  1EH6 A;  1QZZ A;  1BIB A;  1YIO A;  2FE3 A;  4LK1 F;  5DD8 A;  5JFR A;  5LGT A;  2W24 A;  1DDN A;  1X3U A;  2F5D A;  5LBQ A;  3LA2 A;  2EJR A;  4O6J A;  1LDJ A;  3GLX A;  4WWC A;  3KET A;  4EM1 A;  1CF7 B;  3BY6 A;  2P5K A;  3FXQ A;  3ABU A;  3GWZ A;  4I0A A;  5DD4 A;  1J5Y A;  2PN6 A;  2A69 F;  2QYO A;  1IN5 A;  3MCZ A;  4ESF A;  3C18 A;  3RPQ A;  2EFQ A;  3RIR A;  5E1Z B;  2DBB A;  1XD7 A;  3C7J A;  5F6F A;  3ECH A;  5HDG A;  2FU4 A;  4XBF A;  3TGN A;  2XGX A;  1YFH A;  3AAF A;  3FM5 A;  3I54 A;  3F8N A;  4KN4 X;  5HLG A;  3IC7 A;  4CHU A;  3TO6 A;  2HOE A;  2A5Y B;  4KIB A;  1QO0 D;  2ZCW A;  2DT5 A;  3WG9 A;  1IRG A;  1I1G A;  2KKO A;  3KLO A;  1O3S A;  2JPB A;  3ELK A;  2QZ8 A;  3WTX C;  2STW A;  5LRS A;  4ENJ A;  1FY7 A;  1IUY A;  1J2X A;  3F3X A;  2CSO A;  1O3R A;  4UUV A;  1U8R A;  2EV5 A;  2XKO A;  3EQL F;  2IJL A;  3ZN1 A;  3L9F A;  1XCB A;  2ZNZ A;  1ZH5 A;  2H94 A;  2V1U A;  2ZNY A;  1SD7 A;  1IN7 A;  4KYW A;  1OMI A;  3K1P A;  2HQR A;  4CXF A;  2GQQ A;  3DXJ F;  3TOB A;  2NNY A;  4EGZ A;  1T38 A;  2GZW A;  3V7R A;  2CO5 A;  3QAH A;  4HOB A;  4I98 B;  5L3F A;  5K5Q A;  2V79 A;  4MEY F;  2CFX A;  2BBY A;  1SMT A;  1QNT A;  1XN7 A;  1RUO A;  3REO A;  4HLX A;  1R1V A;  4GO1 A;  4R8H A;  3OOP A;  3DF8 A;  1B9N A;  1FBS A;  1KYW A;  1I5Z A;  2Z9O A;  2VE8 A;  2FBK A;  3J80 Z;  3EDP A;  3BPX A;  3GEZ A;  1R5G A;  1SD4 A;  1HKQ A;  1QZY A;  5HS8 A;  3VOE A;  3WE3 A;  1T6S A;  3HRT A;  1FT9 A;  3NEU A;  5JVT A;  2B0L A;  2V6C A;  4G8X A;  4A2U A;  1C0W A;  3B02 A;  4ENN A;  2BYV E;  3IL2 A;  5ICF A;  2V1X A;  3VB2 A;  4XLN F;  2R3S A;  2ZBK A;  5FB2 A;  5H20 A;  2QEN A;  3TO7 A;  1KU7 A;  4WF2 A;  4FHT A;  4RS8 A;  1YTY A;  4N9I A;  4RAZ A;  3WE2 A;  3I71 A;  3I5U A;  1G3S A;  4P55 A;  1K78 A;  4LFU A;  3FHZ A;  1YG2 A;  2RKH A;  4KIC A;  3BZ6 A;  3U9G A;  2GIV A;  4LD5 A;  3KLN A;  3RDI A;  5DEQ A;  2P5L C;  2E1N A;  3KP3 A;  3TDZ C;  2PEX A;  3R0A A;  1WI9 A;  2ADU A;  2WWY A;  3VOD A;  5CVR A;  3GZ5 A;  5HVQ C;  1R5H A;  4L0Z B;  5DCF A;  4MGR A;  1XGS A;  4L9N A;  1J9I A;  2RQP A;  3I4P A;  4L9V A;  2QVO A;  5E20 A;  1I1S A;  3GYH X;  3GZ6 A;  4I09 A;  2LSO A;  2HGC A;  4A6E A;  1MKM A;  1Z1D A;  1R36 A;  2OZ6 A;  4L0Y B;  3P9I A;  1P6R A;  3F6O A;  2L3D A;  3QU6 A;  2A07 F;  3PQJ A;  1GXP A;  2CG4 A;  1IRF A;  5F64 A;  2TDX A;  1MJ9 A;  1XSX A;  3ZP5 A;  5D6E A;  2F2E A;  1XGO A;  4BHP A;  3M8F A;  4LG0 A;  1KU9 A;  3CUO A;  4EJV A;  1BN5 A;  4GYG A;  1S8N A;  2EV0 A;  2EV6 A;  4L18 B;  1H9G A;  2KJC A;  2VOD A;  5CVI A;  2FBH A;  2XV4 S;  4LB6 B;  2GXG A;  3ZQ7 A;  4ESJ A;  5HS7 A;  2P5V A;  3K69 A;  2VN2 A;  4RB1 A;  3KFW X;  5EEG A;  2UZK A;  3RKX A;  3DP7 A;  2Q2E A;  3QU3 A;  3EUH A;  1IN8 A;  4FX0 A;  4UVB A;  1UB9 A;  3O6B B;  1IAW A;  2UXX A;  4IXA A;  1W7P A;  2RGV A;  4CYD A;  3KZY A;  4QWQ A;  4G7O F;  2A6E F;  1XSV A;  1Z7U A;  1JHH A;  3LWF A;  2K02 A;  1K78 B;  3BP8 A;  4EGY A;  3QPT A;  4P9F A;  2UWM A;  2YPR A;  3PFI A;  4KUM A;  2QQB A;  1HBX G;  1EV7 A;  2IA2 A;  4UV8 A;  5JR3 A;  2DK5 A;  3HOS A;  2MH2 A;  5CLS A;  5D5U B;  5D5X B;  1P4W A;  2K4J A;  5JHU A;  3FXR A;  5H6R A;  3MAJ A;  5IT3 A;  1KQ9 A;  1Z6T A;  3P9C A;  5L3G A;  4S05 A;  4GXO A;  1U6G A;  1MGT A;  2X0L A;  1F5T A;  3KE2 A;  2AXL A;  1FLI A;  3M8E A;  2Q0O A;  1G6N A;  5D5V B;  4B8X A;  2L4A A;  4OU0 A;  5AIQ A;  3WTS C;  3E97 A;  3ZPL A;  1W4M A;  3F8C A;  4GCV A;  1OKR A;  4UVC A;  5DUI A;  1ON1 A;  3V8J A;  2VBW A;  4WXH A;  3VEP A;  1H9T A;  3CDH A;  4LB5 A;  2RVC A;  2IA1 A;  1Y0U A;  3HSF A;  3R0J A;  1RUN A;  5LHI A;  1W7P D;  2EB7 A;  3HRU A;  1XB4 A;  4MNU A;  2AS5 F;  2VOO A;  1TQP A;  2CQK A;  4OIR F;  3K1N A;  5JI6 A;  2HR3 A;  3FMQ A;  4UHT A;  5BOX A;  5J8C A;  1T39 A;  3L00 A;  2XKP A;  4PDK A;  1IF1 A;  1T0F A;  3LFK A;  1XDU A;  2VT3 A;  3TDU C;  3GO5 A;  1YW8 A;  2ACJ A;  3K2Z A;  2IRF G;  1XGM A;  3T0Y A;  1TW2 A;  2O0Y A;  3T1B A;  2ZJ2 A;  2VOP A;  3K9T A;  4HQM A;  5K5R A;  5IT9 Z;  5ILS A;  3K1M A;  1BI1 A;  2G9W A;  1BC7 C;  4KMU X;  3ZMD A;  4U7D A;  1LNW A;  3BWG A;  1KU3 A;  3SZP A;  3ERE D;  2BE5 F;  4CGZ A;  2FMY A;  2H09 A;  3BRO A;  3U1D A;  1ZG3 A;  2OA4 A;  4IHT A;  3GW2 A;  4A0X A;  1IXS B;  4JK1 X;  1G3T A;  5DDG A;  4KA4 A;  2L54 A;  3SZT A;  2VC1 A;  4WXC A;  4EJT A;  4ZYD A;  1TQM A;  5DCM B;  3D5L A;  2H6C A;  3WTW C;  5DV5 A;  4HAM A;  1K79 A;  4L5I A;  5FFZ A;  3EYI A;  1D8J A;  2G7H A;  1PDN C;  5KVR A;  2JT1 A;  2IP2 A;  3DPT A;  3ZMZ A;  2JTV A;  1ZGJ A;  4M9X A;  1SFE A;  2FOK A;  3WTT C;  4HV6 A;  1AOY A;  3V8K A;  5J8F A;  2HKO A;  5AIP A;  2YSR A;  1FWZ A;  4YIF A;  4AIK A;  3KP7 A;  2F5C A;  4U88 A; 
#chains in the Genus database with same CATH topology
 3V4G A;  5KAI C;  4XOP A;  3TQN A;  4M74 A;  3KP4 A;  3HC7 A;  1KZH A;  4IRI A;  3DEE A;  1F36 A;  3GF2 A;  1USS A;  1MW7 A;  5A2Q K;  1ERD A;  2JN6 A;  3M1C A;  2XVC A;  3FMS A;  3TP3 A;  1DUX C;  4XSZ F;  1ZG1 A;  1FP1 D;  2XRL A;  4CCN A;  4QPQ A;  3J81 R;  4UB6 C;  3FXU A;  5JLW A;  2AO9 A;  2QKL B;  3ONQ A;  4YIR X;  4RBO A;  4C3I J;  3LA7 A;  4WK8 F;  2DCE A;  3IKT A;  1S7A A;  4JYK A;  3OYM A;  3N97 A;  1W0T A;  3E6M A;  3GFM A;  4EM0 B;  1TWF J;  4HW0 A;  4PGG A;  5HOD A;  4RLF A;  4NUB A;  2LF8 A;  3HTS B;  3HRS A;  2QSH X;  1J59 A;  4BDZ A;  3BZC A;  4C9Y A;  5IYD J;  1FIA A;  4RGS A;  4Y33 A;  1A5J A;  4GGG A;  4IPA A;  1OR7 A;  1FOY A;  3QPH A;  4I0B A;  4DYC A;  2BY2 A;  2IW5 A;  3P7N A;  3KYC B;  1YRN B;  1DQU A;  3BR6 A;  3WTU C;  3HPH A;  2EZL A;  2IAI A;  2MAB A;  2K86 A;  3DQV C;  5E8G A;  4OIN F;  1BI2 A;  2QQ9 A;  2L7Z A;  3DLA A;  2R7F A;  1OJL A;  1Y6I A;  5LGN A;  2LKP A;  4F3Q A;  2XB0 X;  3BQY A;  2EIM H;  1NHA A;  3BTJ A;  4MQV A;  1G4D A;  3HTU A;  2LOO A;  1I3Q J;  1I6X A;  1ETK A;  1F9N A;  2E7W A;  5CVU A;  2IGK A;  3L7W A;  3T8T A;  3CC7 I;  2ZFU A;  2JMW A;  1JI8 A;  4KIG A;  3W3C A;  1ON2 A;  4KIT B;  1IN4 A;  3C1D A;  1WGX A;  2UV1 A;  2H27 A;  4EAT A;  5J6X A;  5HDK A;  4RGR A;  5IT9 R;  1PP7 U;  1MMN A;  4TV7 A;  4HG2 A;  2CW7 A;  2A68 F;  1T33 A;  4U7B A;  5HNH A;  3GZN B;  1WSU A;  1S6L A;  2KIQ A;  4I02 A;  2IPQ X;  2WTE A;  2L9N A;  3V7C A;  4AID A;  2BXZ A;  1SAN A;  1O3T A;  2O6G E;  4A6D A;  1HF0 A;  3EUH C;  5KK1 A;  3HDD A;  1UZC A;  3I59 B;  1Z67 A;  4IO9 F;  2FML A;  1JGG A;  2KLO A;  4BAY A;  3CC4 I;  4AWX B;  1R58 A;  3DPL C;  4UVA A;  1GXQ A;  2IVM A;  4E7I A;  2HS5 A;  1EH8 A;  2O8X A;  3K4J A;  1E2X A;  1UST A;  3LMM A;  4ENK A;  1GVJ A;  2DDA A;  3G6E I;  3D5S C;  4HZF A;  4N9H A;  3GTG J;  4A0Z A;  4LIT A;  2XAU A;  3F8M A;  5BQT A;  1MDM B;  4ABZ A;  4QIW N;  1IGN A;  1HDD C;  2ME6 A;  2ZXW H;  4R79 A;  2ISZ A;  2OCE A;  4RGU A;  2H8R A;  1MZB A;  3KP2 A;  2Z3Y A;  3ZCO A;  3RZD J;  4BH9 A;  2BY1 A;  1TW3 A;  1X3W B;  4G6D A;  1BI0 A;  4YRV A;  1A6Q A;  4HDV A;  3IKV A;  4A3M J;  2KIU A;  3MQ0 A;  3ZMT A;  4BE0 A;  4BQN A;  1KA8 A;  4CDG A;  3CCE I;  2M35 A;  1SVL A;  4H4K C;  3MZ8 A;  3D1N I;  2P6S A;  3K4L A;  1RKT A;  2ECC A;  2I5U A;  4IJA A;  3WU1 B;  3LSI A;  2ZJR F;  1W0U A;  4Q4Z F;  1U5T C;  5HS9 A;  2L2O A;  5IP9 J;  2NOG A;  3HYI A;  1O7L A;  5KHD A;  4UUS B;  1FBU A;  3TW7 A;  3E5Q A;  3M07 A;  4OMZ A;  4CZZ A;  5LHH A;  2R7Z J;  4W97 A;  3RKY A;  1LVK A;  4D1Q A;  5B3S H;  3WHC A;  4P9U A;  3DTE A;  1OCC H;  5K1Y A;  4E70 A;  4FET A;  1TT0 A;  4NDL A;  3LSK A;  1ZRC A;  1WCM J;  3A4C A;  3FWE A;  1YW9 A;  2BY3 A;  3O8H A;  4U88 A;  2MLG A;  2VC0 A;  2L0K A;  4AIH A;  1SD5 A;  1RKW A;  4BNC A;  2R5Z A;  4IF4 A;  2VBX A;  2Z33 A;  1Q1V A;  3KZZ A;  1KQ8 A;  2E19 A;  2Y0M A;  2F5F A;  2FEZ A;  5FRO A;  1ETW A;  3LSG A;  1P7J A;  1XS9 A;  4W1U A;  4FCY A;  4ENM A;  3C2H A;  3V42 A;  5D4R A;  1WQ2 A;  5ILV A;  2LD5 A;  1FYM A;  1D0Z A;  5FGM A;  3ZXS A;  3H9J A;  4FIS A;  5E8I A;  5CVJ A;  5L3C A;  1ZRF A;  4AU7 A;  3VSL A;  4BS9 A;  3K4M A;  3IWF A;  4HQE A;  2HYG D;  4QLC U;  1QA6 A;  1FBQ A;  2M8G X;  2DW4 A;  3BC8 A;  2LRE A;  3I64 A;  3ROU A;  1YJW I;  4ZZD A;  5LEJ A;  3VFZ A;  3RPU A;  2W7N A;  1H0M A;  2C6Y A;  1NTC A;  4FAS D;  2O03 A;  1FNN A;  5AON A;  4N0B A;  1BC8 C;  3I56 I;  4BY1 J;  1TT5 B;  3U2R A;  4B09 A;  3J7A Y;  3P9K A;  3KEQ A;  4UY8 I;  1T56 A;  2Y2Z A;  2IT0 A;  4AM3 A;  2LBF A;  1Z6R A;  1LKX A;  3VWB A;  1JJ8 C;  3RCO A;  1D1C A;  1LEA A;  3R60 A;  1PP8 F;  1FIP A;  2Z1D A;  4J00 A;  2KPM A;  2PJR A;  3ZQQ A;  1P92 A;  2QSF X;  3A01 B;  1VQ4 I;  2X6X A;  3BT9 A;  3ZQC A;  4YFX F;  4CA0 A;  3J81 K;  2FQ3 A;  4C2U A;  1ZLJ A;  5E1X A;  1Z77 A;  3CCY A;  2G0E A;  1WFX A;  2KZG A;  4RDU A;  3OYB A;  3GTO J;  1MND A;  3OSF A;  1VQ9 I;  4AYB N;  2IS6 A;  2XSJ C;  4DYQ A;  2D1H A;  4XSX F;  3BJA A;  3ZN0 A;  2ZME B;  5FJ8 J;  3VYU B;  2LH9 A;  3OMY A;  3JSP A;  4BXU A;  3CO7 C;  4Q48 A;  1GDT A;  2X1C A;  2EFN A;  2NAZ A;  2NS0 A;  5ICC A;  2HDW A;  4KIF A;  5E3O A;  1H8A C;  2ESN A;  2I8D A;  2HKX A;  4KN7 X;  1IZ1 A;  3M3Y J;  3KP6 A;  3CCR I;  1FOK A;  2Q1Z B;  4JBA A;  2E2J J;  3PO2 J;  3OR2 C;  5FD6 A;  2KRH A;  2O3F A;  3I0T A;  1BOA A;  2K9S A;  5GAD J;  2VON A;  3PJR A;  2DOD A;  3IH3 A;  2EZH A;  1MJA A;  2XAS A;  1WVR A;  3CP2 A;  2CV2 A;  2D45 A;  1B8I B;  3H9Q A;  3G73 A;  1CF7 A;  3GFI A;  5CVV A;  4X0G A;  2KFD A;  5D5W B;  1R1T A;  3K4K A;  3PIP F;  2K40 A;  1PUE E;  1ETO A;  3U21 A;  3GFL A;  2DLL A;  4GYI A;  1K4S A;  4O3M A;  3HHG A;  2CV0 A;  5FLX K;  1X1P A;  1MJB A;  2L7M P;  2YX7 A;  3CD6 I;  1S9H A;  5B66 C;  2P0T A;  2DYR H;  3SDG A;  1ETV A;  1X2N A;  1SMY F;  2XAF A;  3HZJ A;  4BE2 A;  2QLZ A;  1GUU A;  4ZTJ A;  1DPR A;  1HQC A;  4CCO A;  2E60 A;  4A0Y A;  1IRZ A;  4KT6 A;  3F72 A;  3QPL A;  3IAS 2;  5DUK A;  2R7V A;  4YFN F;  1UHS A;  1WZ2 A;  3WTZ A;  1GV5 A;  4XON A;  5ICE A;  3MWM A;  3HHH A;  2E35 A;  1APL C;  4MHG A;  3PUB A;  2DK8 A;  2QWW A;  2M9H A;  5EG0 A;  3F23 A;  4A93 J;  2FA5 A;  2E5Z A;  2MLK A;  3COA C;  2OBP A;  2CWE A;  4B3A A;  1BBY A;  2ZXH A;  1XMK A;  4BXX J;  2V26 A;  4PJL A;  5C44 J;  1QQI A;  1PUF A;  1WHU A;  4II3 A;  1MMD A;  1LDK B;  2X85 A;  1T08 B;  1SVM A;  4G6Q A;  1WJC A;  5IOZ A;  2LNB A;  1BJA A;  4HX7 A;  1LQ1 A;  2PLY A;  2EA4 A;  3IUO A;  4P5O A;  3O8G A;  4HNT A;  1QRY A;  2HQA A;  1RI7 A;  1G59 A;  4BQA A;  2X6W A;  1FPQ A;  2VAS A;  1JUM A;  2QBY A;  1S5L C;  3HB9 A;  5F0H A;  4WCG A;  4HPQ A;  4P1W A;  2VXD A;  4ZYA A;  1JKR C;  3BOQ A;  2KIF A;  2MH9 A;  2QM3 A;  1YIJ I;  2RQQ A;  3C3W A;  2F48 A;  4G94 A;  1HSJ A;  2DTR A;  3FKJ A;  4MTE A;  4KNY A;  3OS2 A;  1MSE C;  4M3E A;  3O3K A;  3WTY C;  4LG0 B;  1TLH B;  1BR1 A;  3MEX A;  2FXA A;  1MBF A;  1LJ9 A;  4IHX A;  2K3F A;  2DA7 A;  3ISP A;  3TBI A;  3A01 A;  4XID A;  1AKH A;  5JLX A;  2LY9 A;  9ANT A;  3IH2 A;  3HBL A;  4HYE A;  4JP0 A;  2BHY A;  2W25 A;  1H88 C;  3OS0 A;  2UUZ A;  4ZYE A;  1F43 A;  2EFP A;  2DN0 A;  3ZQL A;  1LPQ A;  1X4O A;  1Z91 A;  2CUZ A;  3R4K A;  4RB3 C;  1RR8 C;  3ABK H;  3HRM A;  1D5Y A;  1IJW C;  1WJF A;  3ESW B;  2HQN A;  2ZME A;  2O9L A;  1FC3 A;  2ID6 A;  1A04 A;  4FT8 A;  1Y0N A;  2WAQ N;  3ABM H;  1HW1 A;  2XPU A;  3EET A;  3SYT A;  5FLX R;  3IAM 2;  3J7Y J;  2J5P A;  3WOD F;  3RYR A;  3DV8 A;  2K3P A;  2ZKZ A;  3SZG A;  2XGC A;  4I7H A;  5C4J J;  3F21 A;  1QGP A;  4BJ5 C;  1FSE A;  1I3A A;  4LOC A;  2QGU A;  3QYB A;  3RYP A;  4I99 C;  2DMN A;  1TWA J;  1EH7 A;  3CTA A;  2DU9 A;  2RC4 A;  2MG4 A;  1REP C;  4M73 A;  3OL3 A;  1TTY A;  3SFZ A;  2Q8K A;  2MD5 A;  2ZFW A;  1R00 A;  1RZ4 A;  4PGH A;  3W6K B;  3E6C C;  2XC7 A;  1MBE A;  1MBH A;  3I9V 2;  3KEY A;  1XCV A;  3V8L A;  2ZO4 A;  5IOY A;  2BEO A;  2LC2 A;  1STZ A;  4Y13 A;  1MBK A;  2PMZ A;  3E5U A;  4CCL A;  2BHZ A;  2ZME C;  1R22 A;  4NQW A;  3M7G A;  5GAH J;  4UXN A;  4BHB A;  3GTK J;  1DP7 P;  3SJM A;  2DOF A;  2W82 A;  1T2K A;  2MGQ A;  1R6R A;  1ZEL A;  3HUG B;  2DPD A;  3K4N A;  2K7L A;  1OFC X;  4MTD A;  1K4T A;  1U5T A;  3RTR A;  3S1Q J;  4AIJ A;  3PNV A;  4BYY A;  1G3W A;  3DFG A;  2X48 A;  5A2Q R;  3J7A W;  1K6Y A;  1OYY A;  3W6J B;  1R71 A;  3FXL A;  2NNN A;  2VBY A;  4J19 A;  2NYX A;  3QYF A;  2RNG A;  1ZRD A;  1LEB A;  2Y31 A;  1LVA A;  3GFJ A;  1Z7L A;  3TW6 A;  3NWS A;  3BTL A;  4M6V A;  1D1A A;  4DNC A;  3GTL J;  4M3B A;  3ULQ B;  3M1E A;  1SEU A;  3HOY J;  4XN3 A;  1ULY A;  2ELH A;  1RET A;  3F22 A;  1FSH A;  3FIS A;  3WTV C;  3KYL A;  3HOZ J;  3QP6 A;  4Z6Y A;  4HX8 A;  3HSR A;  2JA5 J;  4DYR A;  3DU6 A;  2PMZ N;  1QPI A;  3L2Q A;  2ELK A;  2CUF A;  5J40 A;  3BQZ A;  4F93 B;  1UHW A;  2CGP A;  3PQK A;  2N8G A;  3MFK A;  3MZH A;  2MFZ A;  3MD2 A;  3H5N A;  2FNP A;  3ZMU A;  2XUB A;  3E7L A;  2HYF A;  2L02 A;  3U1K A;  5D4S A;  4HNV A;  1F4K A;  4I76 A;  2HVR A;  1E3P A;  5HNF A;  2W48 A;  4KJZ A;  1O4X A;  3T8R A;  4OMY A;  5LGU A;  1B59 A;  2M45 A;  3CMM A;  3QWL A;  3L2C A;  1FYL A;  1D5V A;  2D2W A;  1HST A;  4MLO A;  4KDP A;  3IHU A;  4C3H J;  4U87 A;  4ETS A;  1YX3 A;  1BI3 A;  5LEK A;  2E1O A;  5M3F J;  1XC5 A;  2XRN A;  2CQ7 A;  2KDZ A;  2BGC A;  3G3Z A;  3L2V A;  2ZXJ A;  5FLV A;  3LAP A;  2L9V A;  1K7A A;  3H92 A;  4NHJ A;  3OYC A;  3WGG A;  4YG2 F;  1HC8 A;  2PMH A;  5J4V A;  1GT0 C;  2HOT A;  3KZI C;  2X6O A;  3CLQ A;  1TZL A;  3H1C A;  2RNJ A;  2M34 A;  4MO7 A;  2FUG 2;  1XPX A;  2ZC2 A;  2BV6 A;  4UUS A;  4HNU A;  4Q47 A;  2Y48 A;  1IW7 F;  2DO7 A;  1KQ0 A;  3GTP J;  2EWN A;  1LFP A;  4PJ0 C;  4I2O A;  2LVS A;  3GUD A;  1MH3 A;  2FSW A;  4NBQ A;  5LLQ A;  1XDS A;  4XK4 A;  5HDN A;  3B73 A;  1B72 B;  3OV8 A;  1OPC A;  2LRD A;  3CF2 A;  1QHH D;  3OY9 A;  1Y8R B;  4K2E A;  3S2W A;  2FRH A;  1ZAO A;  3K0L A;  3OYN A;  3A03 A;  2OQG A;  2VE9 A;  4XRF A;  1LDD A;  5TRD A;  1IN6 A;  4BBS J;  2Y0S N;  2OU2 A;  1Q1H A;  3HOV J;  2PQ8 A;  4CZC A;  2X6Y A;  3DLL F;  1QBJ A;  3ZQF A;  3IP4 B;  2XHK A;  3H35 A;  3K7A J;  3PL8 A;  1L3L A;  2JVH A;  1ZLK A;  2H6B A;  1HLV A;  3I53 A;  2KP6 A;  3CF5 F;  3JRH A;  1IUF A;  5FD5 A;  4NC8 A;  1KGS A;  2QBY B;  3HSE A;  3DEU A;  3TKY A;  3DKW A;  3OIQ A;  4M3G A;  4B43 A;  5ICG A;  4G7H F;  1S7O A;  4HLY A;  2VIX A;  1LB2 A;  1U78 A;  4IVN A;  1WI3 A;  2HZT A;  3KCC A;  3SXY A;  2GOX B;  1CGP A;  5EEA A;  1FJL A;  5TJJ A;  2EPF A;  3BJO A;  1U3E M;  2KHM A;  1O3Q A;  4KT5 C;  2YU3 A;  4CUG A;  2GWR A;  2A6H F;  4V2G A;  1TWC J;  4M71 A;  2GA2 A;  2L01 A;  5BPI A;  3R6S A;  1VQM I;  3PO3 J;  4HF0 A;  3CQZ J;  3ZQI A;  2DQL A;  4FTH A;  2M4G A;  4PCQ A;  3ZOB A;  5DM6 F;  2VKE A;  2WAE A;  4PSX A;  4IEJ A;  1K6O A;  4O5V A;  2LY2 A;  1O7F A;  3OYA A;  5B1B H;  3M9A A;  3BJ6 A;  3CUQ B;  3ZMS A;  2Q2E B;  2HWV A;  2P0W A;  3E6B A;  4XM3 A;  4BXF A;  2JK3 A;  5BPD A;  5L3D A;  3FZV A;  3H5A A;  1BL0 A;  4GFB A;  2W57 A;  5DYM A;  2DPU A;  1E17 A;  2OC6 A;  2JWT A;  2B9S A;  3CZ6 A;  4EVI A;  1MIJ A;  5HLH A;  4G7Z F;  5K5O A;  2IGM A;  4HV5 A;  1VF9 A;  3N4M A;  3S16 J;  1B9M A;  1UHM A;  3FXM A;  4M6Y A;  3CCM I;  5EDN A;  5J1Y A;  1WKM A;  1Z3X A;  5LFA A;  2R7T A;  4HRI A;  4KFC A;  4Q5S F;  1XX5 A;  3WGI A;  5A2Q Z;  4A3D J;  1RR7 A;  2MA3 A;  1ONV A;  1TNS A;  4M9Z A;  3Q9S A;  1FX7 A;  4QPO A;  4ZH4 F;  4IRG A;  3O2P E;  2EFW A;  2K4B A;  5M5Y J;  2MC3 A;  5F1R A;  2A6T A;  3JRI A;  1P9Q C;  2YR2 A;  2M7B A;  4HDU A;  1KU2 A;  1UFM A;  2XGE A;  2VL8 A;  2P7V B;  3EUA A;  5ED4 A;  2XAH A;  3MZY A;  4BHC A;  3CCQ I;  2X98 A;  2HU9 A;  2HPM A;  1DU6 A;  4BUP A;  2EIK H;  4IHY A;  1WJD A;  4JQF A;  4ASN A;  1YRN A;  4A5M A;  4XKC A;  4RB2 C;  2OZU A;  5DCM A;  4HF1 A;  1WJA A;  2IA0 A;  3NRV A;  2LDU A;  1ODD A;  2V1N A;  1FP2 A;  4B1R A;  2ID3 A;  4CCJ A;  1R7J A;  1Z0X A;  2FNA A;  2JUC A;  3BLY A;  1ZRE A;  4RAY A;  1N75 A;  5M5W J;  2LYC A;  1VQL I;  2QUF A;  4ZZL A;  2K27 A;  5FKK A;  4AYB A;  3C2B A;  3CME I;  2IGN A;  3Q5F A;  4OIP F;  4YII A;  2PFB A;  4HBL A;  2EH3 A;  1A35 A;  1ZGA A;  4ZYH A;  4A12 A;  1SFO J;  2M7A A;  4IQJ A;  2NVT J;  2XGD A;  2R92 J;  3S14 J;  5IT9 K;  2WY8 Q;  3NAR A;  2BOL A;  4XOT A;  5CYV A;  3A2K A;  4EM2 A;  2VT2 A;  4V19 K;  1ZHF A;  1U9N A;  4ESB A;  3S93 A;  5K7Z A;  2CW0 F;  2DFI A;  2P4W A;  2V6E A;  3QOP A;  4LLN A;  5C4X J;  1VTN C;  2QCO A;  2VLA A;  4RMN A;  2M1B A;  1KYZ A;  3SEQ A;  2AQF A;  1JJ6 C;  4IQ4 A;  5EGO A;  3E6D A;  1N78 A;  1Y1V J;  2K9L A;  4Y17 A;  1RPW A;  5BS6 A;  1FOW A;  1ACI A;  1V4R A;  3VYR B;  2QQA A;  2DTZ A;  4LG3 A;  2NVU B;  5FKL A;  2HEO A;  3FF5 A;  2EQR A;  2L7K A;  4PZJ A;  3NAU A;  2VBZ A;  4PFO A;  1ORK A;  5L3B A;  2E1C A;  3AG4 H;  2A3S A;  2MBF A;  2LF7 A;  1AKH B;  1XGN A;  4D5F A;  1BR2 A;  2J5O A;  1YQA A;  4ZJZ A;  2G7U A;  3BDD A;  4LMY A;  3GTQ J;  1V55 H;  5F08 A;  3J80 K;  3IRR A;  2VPR A;  1UEL B;  5BNG A;  1JHF A;  6PAX A;  4AC0 A;  1L0O C;  1MBG A;  2WV0 A;  1YI2 I;  2YX4 A;  3FMR A;  4Y7N J;  3CUQ A;  3OS1 A;  2XAG A;  4L5E A;  1R1U A;  3L2U A;  2HDC A;  1B1B A;  1JKP C;  4FQG A;  2M5W A;  4P96 A;  1VQK I;  3BTC A;  3HJE A;  4M6X A;  4WXD A;  3KEO A;  1ZN2 A;  2GA1 A;  3FX3 A;  2VPL A;  4V2F A;  1FYK A;  3F8F A;  2P8T A;  5E17 F;  5E79 C;  1DP3 A;  2RN7 A;  2WB1 A;  1HCR A;  1JXS A;  3GVA A;  1R23 A;  3V7S A;  4LJZ F;  3WHB A;  3IWZ A;  1IG7 A;  2EZI A;  2DOA A;  4A5N A;  2KQR A;  1SFK A;  3K6G A;  4D0P A;  2NRA C;  4IHV A;  2M30 A;  1X19 A;  3OOU A;  3FM3 A;  2RDP A;  2PI0 A;  2OQR A;  2DMU A;  1MMG A;  1BA5 A;  2P6T A;  3BZK A;  4XMY A;  1DPU A;  3S15 J;  4CSW A;  2FF4 A;  4DOZ A;  4R1H A;  4BAC A;  4IHS A;  5ERI A;  3AKZ A;  1JT6 A;  1OYI A;  3DKX A;  4OOI A;  3OYH A;  3RQ4 A;  3A02 A;  2CW8 A;  3CUQ C;  3J80 R;  4HEA 2;  3GTM J;  4KMF A;  1X2M A;  2DAO A;  3BR2 A;  2VUM J;  2CQQ A;  1TNT A;  2R5Z B;  4U0W A;  5F04 A;  1FEX A;  3MN2 A;  1P4X A;  1Z05 A;  4S04 A;  1KON A;  1WJ5 A;  2W84 A;  1ZG5 A;  1SAU A;  4HF2 A;  2IS1 A;  3JRE A;  2XRO A;  3LQR A;  5LRR A;  3H3V K;  3OIP A;  5J1R A;  3SEZ A;  3CJR B;  2STT A;  1FZP B;  3S2H J;  3AFH A;  4EJU A;  1YLF A;  2XIG A;  3C2G A;  2AXT C;  5JVG F;  2NVX J;  3H3U A;  1IO2 A;  4RB0 A;  2R5Y B;  1YYV A;  4Z2Y A;  2BXY A;  1SAX A;  3GXO A;  2P7C B;  2OAZ A;  3OL4 A;  4FX4 A;  2XAQ A;  2HVS A;  4HST A;  4HA8 A;  1A36 A;  5E3L A;  3W2W A;  4XLP F;  1T98 A;  2XPW A;  3CJN A;  1IV6 A;  1X1C A;  3Q0V A;  1MMS A;  1BIA A;  2F4I A;  1D3Y A;  4DZJ A;  2M3A A;  3SHF A;  5IYC J;  2JRM A;  1YJN I;  1MDM A;  4HX4 A;  2HZD A;  2R7O A;  2Y69 H;  5E18 F;  2VJJ A;  2MYS A;  1RNL A;  4IKF A;  5E1W A;  1YS7 A;  2LLK A;  2EBI A;  2RV8 A;  3QP5 A;  3RI4 A;  3EYY A;  2Y9Y A;  3VPR A;  1ZKG A;  4L9J A;  1MBJ A;  2L7F P;  2LTP A;  4OAY A;  3ASO H;  1J0R A;  5J3L A;  3AL0 B;  2QKM B;  2XAJ A;  4XLH A;  2CQN A;  2HTJ A;  4U0V A;  3JW4 A;  4F92 B;  3BPV A;  3QPS A;  3T5X A;  2R7W A;  3H36 A;  2HTS A;  1TBX A;  1LE8 A;  2MVT A;  1G3Y A;  3S32 A;  3LA3 A;  3Q0U A;  3LAJ A;  3FXJ A;  4ON0 A;  1IDZ A;  1YW7 A;  1Z21 A;  3ABL H;  2LKS A;  1I6H J;  1YHQ I;  1HKS A;  1QVU A;  3DBR B;  1ZK8 A;  1MD0 A;  1V5E A;  4MFE A;  2IS2 A;  2DYS H;  2WAD A;  4LK0 F;  5EZG A;  2ICW G;  2PG4 A;  3E3V A;  2Y9Z A;  2EK5 A;  3OR1 C;  4NB5 A;  2V9V A;  4EQQ A;  3ML6 A;  4ZYG A;  1JGS A;  1GHC A;  4X1E A;  4ITV A;  3WGH A;  5L3E A;  2HYJ A;  1NG7 A;  5FLX Z;  3UNG C;  5D8K B;  2L4M A;  2CYY A;  2VKH A;  4E7L A;  2VKD A;  3SDB A;  2VXZ A;  3JTH A;  5F0F A;  1J75 A;  4A3L J;  1WJB A;  3H3Z A;  3CLO A;  1Z9C A;  3B6A A;  1ETX A;  3WU0 A;  1IC8 A;  2WC2 A;  1HW2 A;  4LLL A;  2LMD A;  4E7H A;  3TOA A;  1WH5 A;  2EIL H;  3S3N A;  4M9S A;  1HKT A;  2Z5U A;  2E7X A;  5D8L B;  4PUS A;  3ABT A;  3LQQ A;  3JRF A;  3L09 A;  1CQT A;  4A3E J;  4OIQ F;  2GXB A;  1P7I A;  4BQO A;  4G9Y A;  4Y3O A;  4DZP A;  3JTG A;  4XIC A;  1WRJ A;  1WWX A;  2FBI A;  2I10 A;  4WX9 A;  1U5T B;  2M2E A;  1F1Z A;  1U0J A;  1VQO I;  3G4S I;  2KRF A;  2E2H J;  4KIS A;  1UCR A;  3BR1 A;  1VI0 A;  2GOM A;  3QQA A;  1HW5 A;  3HEF A;  3CDI A;  3CCL I;  1ZAR A;  1AA7 A;  2COM A;  5ILU A;  2PMU A;  4E7J A;  2HOA A;  4IRH A;  3GTJ J;  5KAF C;  4II2 A;  1B4A A;  1EJ9 A;  2M8E A;  2RAE A;  3CP8 A;  3E5X A;  2DA2 A;  4L5J A;  4AVP A;  1SFU A;  2ISY A;  1VQ6 I;  1QU3 A;  2BW3 A;  4B48 A;  1J7K A;  3Q9V A;  4RLQ A;  5GPA A;  3K4C A;  1N25 A;  1B6A A;  2QF7 A;  1PYV A;  5GAG J;  5J4Y A;  1LUJ B;  1YX5 A;  4UV9 A;  1MNM C;  5FRM A;  2OD5 A;  3DEW A;  4DQ2 A;  4C2T A;  3I59 A;  3VYS B;  1K61 A;  1OCP A;  5CKT A;  4A3I J;  4JX5 A;  4CIC A;  1MNE A;  3JR9 A;  2M0C A;  2HDD A;  2WV1 A;  2JRT A;  3HUG A;  4E7K A;  4EJW A;  2M87 A;  3QRF F;  4UNO A;  5IPA A;  1P4A A;  3CO6 C;  1QPM A;  4A3F J;  1BM9 A;  4FE4 A;  3RKW A;  2R7D A;  3ZQH A;  3DKY A;  3GCM A;  2Y75 A;  1YJ9 I;  5CJ9 A;  2HFH A;  4RM2 A;  2Z99 A;  3TO9 A;  1AWC A;  3EUK L;  1TQI A;  1J09 A;  2DQR A;  3OYE A;  4CO8 A;  1V3F A;  3L2R A;  2F5E A;  3HOT A;  1JE8 A;  3HIF A;  2VQG A;  3QOD A;  4NNJ A;  3RJP A;  2OTL I;  2A5W A;  1S3J A;  4F52 A;  3DTI A;  5EJC A;  1MH4 A;  2DJN A;  1RIO H;  2X4H A;  3ECO A;  5FO5 A;  5EEH A;  1W5T A;  3LST A;  3MKL A;  4YFK F;  4B44 A;  1M1E B;  2DFH A;  2JSC A;  4OIO F;  1BR4 A;  1YS6 A;  3KP5 A;  2A61 A;  3GX4 X;  5GTH C;  1XMA A;  3F8B A;  4RGX A;  4XKV A;  2HI3 A;  1RES A;  4UB8 C;  5DTD A;  4XRS A;  4M72 A;  3CCV I;  3J7A O;  1X1B A;  2ESH A;  4F7Z A;  4I01 A;  3LSP A;  3JAM Z;  2JJ7 A;  1ITY A;  3HXL A;  3FXK A;  2KIM A;  2JPC A;  2XSD C;  3CMA I;  1PUF B;  4LLG F;  2JZY A;  4EJO A;  2EFO A;  1VQ7 I;  3W2V A;  3F6V A;  1WPK A;  2D1V A;  2KT0 A;  3I3L A;  4MQ9 F;  1OLT A;  4IOC F;  3DBH B;  3ASN H;  3RPU D;  1ZR4 A;  1W7P B;  2NS7 A;  2MUN A;  3TED A;  3D0S A;  4BGD A;  4LGW A;  2L5Q A;  3L1P A;  1YO5 C;  5FFX A;  1GV2 A;  3FXO A;  4GRI A;  3UR3 C;  1XSD A;  2DI3 A;  4EMS A;  3R61 A;  3J81 Z;  2LFB A;  2GAU A;  5J47 A;  5F27 A;  4DIQ A;  4MEX F;  3SQN A;  1OYW A;  4XR6 A;  2KDO A;  3HOU J;  3CJT B;  1X58 A;  4H0E A;  1P2F A;  4BY7 J;  4LIV A;  3ZMV A;  2FQ4 A;  5LHG A;  3I58 A;  1IXR C;  1U2W A;  2LY1 A;  4M3F A;  3OYK A;  3JSO A;  2V1D A;  4Y15 A;  1HXD A;  3JCU C;  1W5S A;  1O57 A;  4L9T A;  5J1U A;  3J7Z I;  2PBI A;  2W85 A;  5BMZ A;  4CH7 A;  4AD9 A;  2KJB A;  1T8I A;  1ZYR F;  2LG4 A;  1JUS A;  5HLI A;  1AU7 A;  5H6Q A;  1SFX A;  2O8K A;  3IRQ A;  5D6F A;  3BCB A;  2FD5 A;  3PUF A;  1S29 A;  3NQO A;  2R7R A;  2UXN A;  4BEH A;  1I27 A;  1SD6 A;  1E0E A;  4DJA A;  3JAM K;  1ETQ A;  1VZ0 A;  4DGW B;  4EV0 A;  4U0Y A;  4ZTF A;  2O61 A;  1IXC A;  1R5I D;  4IZZ A;  2PJP A;  1D8K A;  3FBN B;  4BJ6 C;  2ZJP F;  1TL8 A;  5HOO A;  2ETH A;  2EA2 A;  2V4J C;  1EH6 A;  1QZZ A;  3TMO A;  2COB A;  2AQE A;  3HPG A;  1BIB A;  2LP0 A;  2F4M B;  1YIO A;  3VYT B;  5KNL A;  2B63 J;  4DBR A;  4C30 A;  3OYF A;  2FE3 A;  3K4B A;  5B1A H;  1EF4 A;  3S8P A;  3W2A A;  4LK1 F;  1OCR H;  5DD8 A;  3SFI A;  5JFR A;  2VJI A;  5LGT A;  1JKO C;  5IP7 J;  1W1W E;  2W24 A;  1DDN A;  1X3U A;  4A3J J;  3CCS I;  2F5D A;  2Z16 A;  5LBQ A;  1R4M B;  3LA2 A;  3JRA A;  2EJR A;  1UG2 A;  4O6J A;  1LDJ A;  3GLX A;  2TCT A;  1UG0 A;  2CMP A;  5CQE A;  3RKQ A;  3BCA A;  1ZQ3 P;  4WWC A;  3KET A;  2KZV A;  2CUJ A;  2JUG A;  4EM1 A;  1RRJ A;  1CF7 B;  3BY6 A;  1ENH A;  2R4G A;  3FXQ A;  2P5K A;  3AG3 H;  3ABU A;  3GWZ A;  4I0A A;  5DD4 A;  1J5Y A;  2PN6 A;  2A69 F;  2QYO A;  4QSH A;  5B5E C;  1S72 I;  1IN5 A;  2VB6 A;  1SC7 A;  3MCZ A;  3L2W A;  1JKQ C;  1UAA A;  1BJZ A;  4ESF A;  1FOX A;  3AL0 C;  3C18 A;  2VI6 A;  1AHD P;  3K2A A;  3RPQ A;  2EFQ A;  3RIR A;  4BKX A;  5E1Z B;  4XQF A;  3HOX J;  2DBB A;  3Q3S A;  1XD7 A;  1JT0 A;  3C7J A;  5F6F A;  3ECH A;  5HDG A;  2FU4 A;  4XLA A;  4XN0 A;  2F4O B;  1VQ8 I;  2Y30 A;  4XBF A;  3TGN A;  2XGX A;  1YFH A;  2JA7 J;  3AAF A;  2DT7 B;  3FM5 A;  2OCC H;  4DW6 A;  2EZK A;  2JA2 A;  2OF7 A;  3I54 A;  3F8N A;  4KN4 X;  3NWT A;  5HLG A;  3IC7 A;  2WAQ A;  1TP4 A;  3DU5 A;  4CHU A;  2CQX A;  2K9N A;  3TO6 A;  1X1D A;  2HOE A;  2A5Y B;  4KIB A;  1QO0 D;  5H2F C;  2ZSH B;  4OAZ A;  5JHF A;  3A0B C;  4C2M J;  5DM7 F;  4I6Z A;  2L9S A;  2ZCW A;  2DT5 A;  3WG9 A;  2HPI A;  1IRG A;  4J01 A;  1I1G A;  2KKO A;  1TWG J;  3KLO A;  1O3S A;  2JPB A;  3ELK A;  2NVQ J;  1FMV A;  2QZ8 A;  2LR8 A;  3WTX C;  1ZGW A;  4PJJ A;  2STW A;  5LRS A;  4ENJ A;  1X1A A;  2WBM A;  2DMP A;  1FY7 A;  2VQC A;  3M4O J;  3BG7 A;  1IUY A;  1QHG A;  3DBL B;  1J2X A;  2WY7 Q;  3F3X A;  2CSO A;  2HOS A;  3FK6 A;  1O3R A;  1MSF C;  2K9M A;  4UUV A;  2DA4 A;  4XLC A;  4RAG A;  2JVG A;  2MC4 A;  3DPU A;  4NQW B;  1U8R A;  4XNF A;  4D7N A;  1ETY A;  3ERM A;  1V5G A;  2A05 A;  3PM1 A;  4BBR J;  1POG A;  1D1B A;  2EV5 A;  1ZTR A;  2XKO A;  3GBG A;  3EQL F;  3WG7 H;  4PJM A;  2IJL A;  3ZN1 A;  4N4O B;  3L9F A;  1XCB A;  5HLT A;  2O5R A;  2XDV A;  1OIS A;  2ZNZ A;  4BDY A;  3QOE A;  3FHN A;  1ZH5 A;  2H94 A;  2DA6 A;  2V1U A;  4AVZ A;  2ZNY A;  3UKG A;  1R9T J;  1SD7 A;  4AUX A;  2BZT A;  1IN7 A;  4KYW A;  3S3M A;  1OMI A;  3K1P A;  1EA3 A;  1XG1 A;  2HQR A;  3K70 D;  2DFE A;  4CXF A;  2GQQ A;  3DXJ F;  3TOB A;  3MKW B;  3E0J B;  2NNY A;  4EGZ A;  1T38 A;  1W36 D;  3S1N J;  1U8B A;  2KMU A;  2R7U A;  2F6C A;  2GZW A;  3V7R A;  2CO5 A;  3QAH A;  4D5C A;  2LK2 A;  4HOB A;  2B7E A;  4I98 B;  2V79 A;  4MEY F;  4BQQ A;  3FIW A;  5L3F A;  5K5Q A;  3G1O A;  5EGO B;  2QA4 I;  2EIN H;  2BY0 A;  2X1E A;  2CFX A;  2DOE A;  2BBY A;  3VDX A;  5K7H A;  4MFD A;  1SMT A;  1QNT A;  3HGG A;  1XN7 A;  2K85 A;  3BR0 A;  1RUO A;  3G1M A;  3REO A;  4HLX A;  1R1V A;  4GO1 A;  4JX4 A;  4R8H A;  3OOP A;  3DF8 A;  2E36 A;  1B9N A;  2NOJ B;  1FBS A;  5C3E J;  1KYW A;  4ZDL A;  3I4N J;  1I5Z A;  3JRD A;  4N4N B;  2Z9O A;  2VE8 A;  4C3J J;  2FBK A;  2GXA A;  3HL2 A;  3J80 Z;  3EDP A;  3LSM A;  3BPX A;  3GEZ A;  4B47 A;  1R5G A;  3AG2 H;  1SD4 A;  2VQH A;  1HKQ A;  1QZY A;  3PFY A;  2JQ7 A;  5HS8 A;  3JRB A;  3DTK A;  3VOE A;  5M5X J;  3WE3 A;  2W1O A;  1V54 H;  1T6S A;  5GPC A;  2V9K A;  1FT9 A;  3HRT A;  3NEU A;  2HQ5 A;  5JVT A;  2B0L A;  3AG1 H;  2V6C A;  4G8X A;  4A2U A;  3OYI A;  1C0W A;  1SVO A;  3B02 A;  2V9P A;  4ENN A;  2BYV E;  2DA5 A;  3IL2 A;  5GTI C;  2HNH A;  5EG0 B;  3LL7 A;  5ICF A;  1RC9 A;  2V1X A;  2MZ4 A;  3H5R A;  1GLN A;  3LOC A;  2MSY A;  3VB2 A;  4XKB A;  2X1D A;  4XLN F;  3HM5 A;  1D0Y A;  2R3S A;  2ZBK A;  3E1S A;  5FB2 A;  2CU7 A;  3CDL A;  3CJQ B;  5H20 A;  2QEN A;  2XF5 A;  3TO7 A;  1KU7 A;  4WF2 A;  1W5C C;  3IH4 A;  4FHT A;  4RS8 A;  1YTY A;  4N9I A;  4RAZ A;  3WE2 A;  3I71 A;  4XL9 A;  2HVQ A;  3I5U A;  4XRS G;  1Y1W J;  3MKZ A;  1G3S A;  4P55 A;  1K78 A;  4LFU A;  3FHZ A;  1G2H A;  5EF6 A;  1YG2 A;  2E5N A;  2RKH A;  4KIC A;  3BZ6 A;  2GM4 A;  5FKM A;  2E1M C;  3OSG A;  3U9G A;  3PNT A;  2JA8 J;  2GIV A;  4LD5 A;  2Y0S A;  3KLN A;  3RDI A;  4ZDO A;  2DMQ A;  5DEQ A;  2P5L C;  1BW6 A;  1IV8 A;  2E1N A;  3X2Q H;  3KP3 A;  3TDZ C;  2PEX A;  3LSH A;  3R0A A;  1N77 A;  1WI9 A;  4IOA F;  2ELJ A;  2ADU A;  1PVE A;  3FK7 A;  3MVP A;  2WWY A;  3VOD A;  2K5C A;  3LSR A;  5CVR A;  3OYJ A;  3GZ5 A;  3BG6 A;  2ZSI B;  4PK4 A;  5HVQ C;  3S17 J;  1R5H A;  3FKI J;  1WH7 A;  4XOR A;  4L0Z B;  5DCF A;  4MGR A;  1UJ8 A;  1XGS A;  4L9N A;  1J9I A;  1D0X A;  4B4C A;  2RQP A;  2ZXI A;  3OWT A;  3I4P A;  4L9V A;  2IXS A;  2QVO A;  5E20 A;  1I1S A;  3GYH X;  3GZ6 A;  4I09 A;  4UUT A;  2LSO A;  2HGC A;  4A6E A;  2ZB9 A;  1MKM A;  1Z1D A;  1R36 A;  1YIT I;  2XF6 A;  2D5V A;  2OZ6 A;  3F9K A;  5K7F A;  2WB1 N;  3MMY B;  4L0Y B;  3P9I A;  1P6R A;  3F6O A;  2L3D A;  4F91 B;  3QU6 A;  2XB5 A;  2A07 F;  4IX7 A;  3G71 I;  2FOW A;  2FJ1 A;  3PQJ A;  2OJE D;  1GXP A;  1LE8 B;  3TP0 A;  1E3H A;  3K10 A;  4PFP A;  3PSI A;  2CG4 A;  1XMX A;  3A1Y A;  2VKV A;  1IRF A;  2CH0 A;  2W00 A;  3KX2 A;  1Y39 A;  2RRE A;  5F64 A;  2TDX A;  5CQG A;  1MJ9 A;  1XSX A;  3ZP5 A;  5D6E A;  2TRT A;  2F2E A;  1NH3 A;  3BG5 A;  1XGO A;  3W6V A;  2DFF A;  4OWR B;  2OPT A;  3EPZ A;  4BHP A;  1LFU P;  3BR3 A;  3S1R J;  1QVT A;  4S0H B;  2CV1 A;  1DGW Y;  3Q0W A;  3M8F A;  4LG0 A;  1KU9 A;  3CUO A;  4EJV A;  1BN5 A;  4GYG A;  1S8N A;  1YOV B;  2EV0 A;  2EV6 A;  4L18 B;  1H9G A;  2KJC A;  1T95 A;  3TL4 X;  3CCU I;  2DA1 A;  2VOD A;  2V7F A;  5CVI A;  4A3C J;  5M3M J;  1UMQ A;  2M0M A;  2FBH A;  1Y8Q B;  2XV4 S;  4LB6 B;  1X3Z B;  5FKO A;  2GXG A;  4ZC3 A;  3ZR8 X;  3ZQ7 A;  4ESJ A;  2GBY A;  1Z3Y A;  2FX0 A;  5HS7 A;  1IRX A;  5KCM A;  3JAM R;  4PJN A;  2P5V A;  3GME A;  3K69 A;  4BU2 A;  4CYC B;  2VN2 A;  4RB1 A;  4IHW A;  5FRN A;  2P81 A;  3KFW X;  1QZE A;  4EEF G;  5EEG A;  2NS8 A;  1JTX A;  1PJR A;  2UZK A;  3RKX A;  1V5F A;  3DP7 A;  2DA3 A;  2IBD A;  2NXN B;  2Q2E A;  3QU3 A;  3OYG A;  4PSW A;  3H0G J;  2M4K A;  3EUH A;  1IN8 A;  1FTT A;  4FX0 A;  2VQL A;  2Z2S B;  2KL4 A;  4M3D A;  4UVB A;  1UB9 A;  2CFO A;  1G8X A;  3O6B B;  5GP9 A;  5TIS C;  1IAW A;  2R7S A;  3RZO J;  2UXX A;  4IXA A;  2OUM A;  1W7P A;  2RGV A;  4YEJ A;  4CYD A;  3G1L A;  3KZY A;  4QWQ A;  4G7O F;  1T0F C;  3H9G A;  4RAF A;  2A6E F;  1XSV A;  1Z7U A;  1JHH A;  3LWF A;  2K02 A;  1K78 B;  3S3O A;  3BP8 A;  1NK3 P;  2CUE A;  4FE7 A;  3GLL A;  4LIU A;  3QPT A;  4EGY A;  2VJ4 A;  1LFB A;  4P9F A;  5EYR A;  2DT6 A;  2YPR A;  4F55 A;  1I50 J;  2UWM A;  2X51 A;  4G6T B;  3PFI A;  5CPR B;  4KUM A;  2QQB A;  1HBX G;  1EV7 A;  2HXO A;  2IA2 A;  3BR5 A;  2O7O A;  2EIJ H;  4UV8 A;  5JR3 A;  2DK5 A;  3HOS A;  1XTA A;  2MH2 A;  1A31 A;  3I4M J;  5CLS A;  4ANJ A;  5D5U B;  1ZR2 A;  3FBI B;  1P4W A;  2DDB A;  5D5X B;  4JOM A;  3MKY B;  4CCK A;  2K4J A;  5JHU A;  1VFC A;  4E7S A;  1X4P A;  3FXR A;  1A6I A;  5H6R A;  3KYD B;  3MAJ A;  3A0H C;  2L9R A;  5IT3 A;  3HG9 A;  1KQ9 A;  1Z6T A;  2YS9 A;  3P9C A;  5L3G A;  3PSF A;  4GXO A;  4S05 A;  1U6G A;  1MGT A;  1VND A;  2X0L A;  1BOB A;  1F5T A;  3KE2 A;  2ME0 A;  2AXL A;  1W36 C;  2JA6 J;  2MD0 A;  1FLI A;  4D7M A;  3M8E A;  2Q0O A;  3HGY A;  2OV7 A;  3G2B A;  4CCM A;  1RQ6 A;  4A69 C;  4GDF A;  2GIZ A;  3N05 A;  2KRC A;  1G6N A;  1JTY A;  1WJE A;  2R5Y A;  2ECB A;  3K70 C;  5D5V B;  4B8X A;  2L4A A;  2NVY J;  2VJ5 A;  1HA8 A;  2F5V A;  2E2I J;  3FDY A;  3DWL E;  4OU0 A;  5AIQ A;  3E97 A;  3WTS C;  3ZPL A;  1W4M A;  3CC2 I;  3PIO F;  2GLO A;  2YU9 J;  3F8C A;  4NC6 A;  4GCV A;  4E4H A;  1OKR A;  4UVC A;  3ZRG A;  5DUI A;  1ON1 A;  3V8J A;  1FMW A;  4XLF A;  2R93 J;  2OTJ I;  2IS4 A;  2HXI A;  2VBW A;  4WXH A;  4DBQ A;  3VEP A;  1H9T A;  3CDH A;  3CCJ I;  4LB5 A;  3CMY A;  2RVC A;  2IA1 A;  3HKZ A;  1Y0U A;  2LKX A;  1DU0 A;  3HSF A;  4Y52 J;  3RSN A;  4BE1 A;  3R0J A;  1RUN A;  2PX9 A;  2E1M B;  5LHI A;  1W7P D;  5F0C A;  2EB7 A;  2BW3 B;  3HRU A;  2DMT A;  1XB4 A;  3P5J A;  4MNU A;  4BEH B;  2AS5 F;  2VOO A;  3LNQ A;  1TQP A;  2BVM A;  4MIM A;  2CQK A;  4OIR F;  2QQ8 A;  3K1N A;  5IP6 A;  5JI6 A;  2HR3 A;  4A3B J;  3FMQ A;  4UHT A;  1OQY A;  5BOX A;  5J8C A;  1T39 A;  3KIO A;  2K9Q A;  1R49 A;  1TC3 C;  3L00 A;  4E6K G;  2XKP A;  3S2D J;  3A52 A;  4PDK A;  1U9O A;  1IF1 A;  1T0F A;  2DXI A;  3RQI A;  3LFK A;  4QTR A;  1XDU A;  4A3K J;  2W4S A;  4HSR A;  1JUP A;  2VT3 A;  3TDU C;  3GO5 A;  5LD2 C;  1YW8 A;  5IYB J;  2IEK A;  5DS9 A;  2ACJ A;  3K2Z A;  3H0D A;  1XGM A;  2IRF G;  2BVL A;  4IL6 C;  4BJT A;  3I55 I;  3T0Y A;  5GAE J;  3JRC A;  4XKW A;  1TW2 A;  2O0Y A;  3OYD A;  3T1B A;  2ZJ2 A;  2VOP A;  3K9T A;  4HQM A;  5K5R A;  1E3O C;  4ZDP A;  1HOM A;  5IT9 Z;  5ILS A;  1B8I A;  3K1M A;  1VQN I;  4D9J A;  3CES A;  1BI1 A;  2G9W A;  4YEL A;  2R7X A;  1MMA A;  1BC7 C;  3PNY A;  4E7Z A;  2AHQ A;  2CS3 A;  4KMU X;  3ZMD A;  1H89 C;  4A3G J;  4U7D A;  1LNW A;  2MW8 A;  3HOW J;  3M8J A;  2R7Q A;  5E3N A;  3BWG A;  3LSJ A;  2R0Q C;  1KU3 A;  2QEX I;  3SZP A;  5F1J A;  3ERE D;  4BL0 B;  4XRM A;  2BE5 F;  4CGZ A;  1OR7 C;  1NG6 A;  1YE9 A;  5EZH A;  3QYE A;  2DJI A;  2FMY A;  3D5R C;  2YUS A;  2H09 A;  1DGR M;  3BRO A;  1K83 J;  3S1M J;  1OCZ H;  3U1D A;  2WA0 A;  1ZG3 A;  5E3M A;  2OA4 A;  1B72 A;  3DCF A;  4IHT A;  2WAF A;  3GW2 A;  4JX6 A;  1IDY A;  1OCO H;  2CJJ A;  3BG9 A;  3HKZ N;  2X9D A;  4A0X A;  1IXS B;  2IGO A;  2XF7 A;  4JK1 X;  2H1L A;  4B3X A;  5DDG A;  3ZGK A;  2XPV A;  1EKE A;  2L54 A;  4G12 A;  4KA4 A;  3KPH A;  4XLE A;  3SZT A;  2VC1 A;  4RA2 A;  1FTZ A;  1HDP A;  2QSG X;  4WXC A;  4EJT A;  4ZYD A;  2H8W A;  1TQM A;  5DCM B;  5FKN A;  3D5L A;  2H6C A;  3WTW C;  5DV5 A;  4HAM A;  1K79 A;  4NC7 A;  4X6A J;  4L5I A;  5FFZ A;  1BW5 A;  1S7E A;  1R4N B;  5FLM J;  1I39 A;  2JSP A;  3EYI A;  1Y56 A;  1D8J A;  5IY5 H;  3F0C A;  2KIS A;  2G7H A;  4CYC A;  2ZJQ F;  4Y4R A;  3OYL A;  1TWH J;  5KVR A;  1PDN C;  2JT1 A;  2H1K A;  3IV5 A;  3ZQG A;  2IP2 A;  2E34 A;  1NK2 P;  3DPT A;  1OCT C;  3WU2 C;  2JTV A;  3ZMZ A;  1ZGJ A;  3JRG A;  4M9X A;  1VQP I;  2E71 A;  1SFE A;  2FOK A;  3WTT C;  3VSK A;  1GVD A;  4RM3 A;  3OIO A;  1VQ5 I;  4HV6 A;  1AOY A;  3B6C A;  3BTI A;  2PJR B;  3V8K A;  5J8F A;  2HKO A;  3LFU A;  5AIP A;  5TGT A;  2YSR A;  1FWZ A;  4YIF A;  4AIK A;  2LBF B;  3KP7 A;  2CRG A;  2F5C A;  1G3T A;  3BG3 A; 
#chains in the Genus database with same CATH homology
 3V4G A;  3TQN A;  4M74 A;  3KP4 A;  4IRI A;  3GF2 A;  1USS A;  5A2Q K;  2XVC A;  3FMS A;  1DUX C;  4XSZ F;  1ZG1 A;  1FP1 D;  3FXU A;  3LA7 A;  4WK8 F;  3IKT A;  1S7A A;  3N97 A;  3E6M A;  3GFM A;  4EM0 B;  4HW0 A;  4PGG A;  2LF8 A;  3HTS B;  3HRS A;  1J59 A;  4RGS A;  4GGG A;  4IPA A;  1OR7 A;  3QPH A;  4I0B A;  2IW5 A;  3P7N A;  3WTU C;  3DQV C;  2K86 A;  5E8G A;  4OIN F;  1BI2 A;  2QQ9 A;  2R7F A;  5LGN A;  2LKP A;  1NHA A;  4MQV A;  1G4D A;  3HTU A;  1I6X A;  1F9N A;  2E7W A;  5CVU A;  3T8T A;  3L7W A;  4KIG A;  1ON2 A;  1IN4 A;  3C1D A;  2H27 A;  5J6X A;  5HDK A;  4RGR A;  1PP7 U;  4TV7 A;  2A68 F;  4U7B A;  1WSU A;  1S6L A;  4I02 A;  2IPQ X;  2WTE A;  3V7C A;  1O3T A;  2O6G E;  4A6D A;  5KK1 A;  3I59 B;  2FML A;  4BAY A;  4AWX B;  1R58 A;  3DPL C;  4UVA A;  1GXQ A;  2IVM A;  2HS5 A;  1EH8 A;  2O8X A;  1E2X A;  1UST A;  4ENK A;  1GVJ A;  4HZF A;  4N9H A;  4A0Z A;  3F8M A;  5BQT A;  1MDM B;  4R79 A;  2ISZ A;  4RGU A;  1MZB A;  3KP2 A;  2Z3Y A;  4BH9 A;  1TW3 A;  4G6D A;  1BI0 A;  4HDV A;  3IKV A;  2KIU A;  3MQ0 A;  3ZMT A;  1KA8 A;  4CDG A;  2P6S A;  4IJA A;  3WU1 B;  4Q4Z F;  1U5T C;  5HS9 A;  3HYI A;  1O7L A;  1FBU A;  3E5Q A;  4OMZ A;  4CZZ A;  5LHH A;  3RKY A;  4P9U A;  5K1Y A;  4E70 A;  1ZRC A;  3FWE A;  1YW9 A;  2MLG A;  2VC0 A;  4AIH A;  1SD5 A;  4BNC A;  4IF4 A;  2VBX A;  2Z33 A;  1KQ8 A;  3KZZ A;  2Y0M A;  2F5F A;  2FEZ A;  4ENM A;  5D4R A;  1WQ2 A;  5ILV A;  1FYM A;  5FGM A;  5E8I A;  5CVJ A;  5L3C A;  1ZRF A;  3IWF A;  4HQE A;  2HYG D;  4QLC U;  1FBQ A;  2DW4 A;  3I64 A;  3ROU A;  4ZZD A;  5LEJ A;  3VFZ A;  3RPU A;  1H0M A;  2C6Y A;  2O03 A;  1FNN A;  5AON A;  4N0B A;  1BC8 C;  3U2R A;  4B09 A;  3P9K A;  3KEQ A;  2IT0 A;  1Z6R A;  1LEA A;  3R60 A;  1PP8 F;  1P92 A;  4YFX F;  3J81 K;  2FQ3 A;  1ZLJ A;  5E1X A;  2D1H A;  4XSX F;  3BJA A;  3ZN0 A;  2ZME B;  3JSP A;  4BXU A;  3CO7 C;  4Q48 A;  2EFN A;  2NAZ A;  2NS0 A;  5ICC A;  4KIF A;  2ESN A;  4KN7 X;  2HKX A;  1IZ1 A;  3KP6 A;  1FOK A;  4JBA A;  5FD6 A;  2O3F A;  3I0T A;  1BOA A;  2VON A;  1MJA A;  2XAS A;  2D45 A;  3G73 A;  1CF7 A;  3GFI A;  5CVV A;  5D5W B;  1R1T A;  1PUE E;  3GFL A;  2DLL A;  4GYI A;  4O3M A;  3HHG A;  5FLX K;  1MJB A;  2YX7 A;  1SMY F;  2XAF A;  2QLZ A;  1DPR A;  1HQC A;  4A0Y A;  3F72 A;  5DUK A;  4YFN F;  3WTZ A;  5ICE A;  3MWM A;  3HHH A;  4MHG A;  2DK8 A;  2QWW A;  3F23 A;  2FA5 A;  2MLK A;  3COA C;  2OBP A;  2CWE A;  1BBY A;  1XMK A;  1QQI A;  1LDK B;  4G6Q A;  2LNB A;  1BJA A;  4HX7 A;  1LQ1 A;  2PLY A;  2EA4 A;  4P5O A;  1RI7 A;  4BQA A;  1FPQ A;  2QBY A;  4WCG A;  3BOQ A;  2KIF A;  2MH9 A;  2QM3 A;  3C3W A;  4G94 A;  1HSJ A;  2DTR A;  4MTE A;  4KNY A;  4LG0 B;  3WTY C;  3O3K A;  1TLH B;  3MEX A;  2FXA A;  1LJ9 A;  3ISP A;  4HYE A;  2W25 A;  4ZYE A;  2EFP A;  1Z91 A;  3R4K A;  4RB3 C;  3HRM A;  2HQN A;  2ZME A;  1FC3 A;  1A04 A;  4FT8 A;  1HW1 A;  3EET A;  2J5P A;  3WOD F;  3RYR A;  3DV8 A;  2ZKZ A;  4I7H A;  3F21 A;  1QGP A;  1FSE A;  3RYP A;  1EH7 A;  3CTA A;  2DU9 A;  2RC4 A;  1REP C;  4M73 A;  1TTY A;  3SFZ A;  2Q8K A;  3E6C C;  2MD5 A;  1R00 A;  1RZ4 A;  2ZFW A;  4PGH A;  3W6K B;  1XCV A;  3V8L A;  2ZO4 A;  2BEO A;  1STZ A;  4Y13 A;  3E5U A;  1R22 A;  4NQW A;  3M7G A;  4UXN A;  4BHB A;  1DP7 P;  1T2K A;  2DPD A;  2K7L A;  4MTD A;  1U5T A;  3RTR A;  4AIJ A;  4BYY A;  1G3W A;  3DFG A;  1OYY A;  3W6J B;  2NNN A;  2VBY A;  2NYX A;  1ZRD A;  1LEB A;  1LVA A;  3GFJ A;  4DNC A;  3ULQ B;  3M1E A;  1ULY A;  2ELH A;  3F22 A;  1FSH A;  3WTV C;  3QP6 A;  4HX8 A;  3HSR A;  1UHW A;  2CGP A;  3PQK A;  3MZH A;  3MFK A;  2FNP A;  3ZMU A;  2XUB A;  2HYF A;  2L02 A;  5D4S A;  1F4K A;  3T8R A;  4OMY A;  5LGU A;  1B59 A;  2M45 A;  3L2C A;  1FYL A;  1D5V A;  2D2W A;  1HST A;  4KDP A;  3IHU A;  4ETS A;  1BI3 A;  5LEK A;  2XRN A;  2BGC A;  3G3Z A;  2ZXJ A;  3LAP A;  1K7A A;  3H92 A;  4NHJ A;  3WGG A;  4YG2 F;  2PMH A;  2RNJ A;  2BV6 A;  4Q47 A;  2Y48 A;  2DO7 A;  1IW7 F;  1KQ0 A;  2EWN A;  4I2O A;  3GUD A;  2FSW A;  5LLQ A;  1XDS A;  5HDN A;  3B73 A;  3OV8 A;  1OPC A;  4K2E A;  3S2W A;  2FRH A;  1ZAO A;  3K0L A;  2VE9 A;  2OQG A;  4XRF A;  1LDD A;  5TRD A;  1IN6 A;  2OU2 A;  1Q1H A;  2PQ8 A;  1QBJ A;  2XHK A;  1L3L A;  1ZLK A;  2H6B A;  3I53 A;  5FD5 A;  1KGS A;  2QBY B;  3HSE A;  3DEU A;  3TKY A;  3DKW A;  5ICG A;  4G7H F;  1S7O A;  4HLY A;  1LB2 A;  1U78 A;  4IVN A;  2HZT A;  3KCC A;  3SXY A;  1CGP A;  5TJJ A;  3BJO A;  1U3E M;  1O3Q A;  4KT5 C;  2YU3 A;  2GWR A;  2A6H F;  4M71 A;  2GA2 A;  2L01 A;  5BPI A;  3R6S A;  4HF0 A;  2DQL A;  4PCQ A;  1K6O A;  4O5V A;  1O7F A;  3M9A A;  3BJ6 A;  3CUQ B;  3ZMS A;  2HWV A;  3E6B A;  5BPD A;  5L3D A;  3FZV A;  2W57 A;  5DYM A;  2DPU A;  4EVI A;  5HLH A;  4G7Z F;  5K5O A;  4HV5 A;  3N4M A;  1B9M A;  1UHM A;  4M6Y A;  1WKM A;  4KFC A;  4Q5S F;  3WGI A;  5A2Q Z;  2MA3 A;  1ONV A;  1TNS A;  4M9Z A;  3Q9S A;  1FX7 A;  4ZH4 F;  4IRG A;  3O2P E;  2EFW A;  2K4B A;  5F1R A;  2MC3 A;  2YR2 A;  4HDU A;  1KU2 A;  1UFM A;  5ED4 A;  2P7V B;  2XAH A;  3MZY A;  4BHC A;  4JQF A;  4ASN A;  4A5M A;  4RB2 C;  2OZU A;  5DCM A;  4HF1 A;  2IA0 A;  3NRV A;  2LDU A;  1ODD A;  1FP2 A;  1R7J A;  2FNA A;  1ZRE A;  4RAY A;  2QUF A;  4ZZL A;  2K27 A;  3Q5F A;  4OIP F;  4YII A;  2PFB A;  4HBL A;  1ZGA A;  4ZYH A;  4A12 A;  1E17 A;  5IT9 K;  5CYV A;  4EM2 A;  2VT2 A;  1ZHF A;  4ESB A;  2CW0 F;  2DFI A;  2P4W A;  4LLN A;  3QOP A;  1VTN C;  2M1B A;  1KYZ A;  3E6D A;  4Y17 A;  5BS6 A;  1V4R A;  2QQA A;  2HEO A;  3FF5 A;  4PZJ A;  2VBZ A;  5L3B A;  2E1C A;  2A3S A;  2MBF A;  2LF7 A;  1XGN A;  2J5O A;  1YQA A;  2G7U A;  3BDD A;  4LMY A;  3J80 K;  3IRR A;  1JHF A;  6PAX A;  1L0O C;  2WV0 A;  2YX4 A;  3FMR A;  3CUQ A;  2XAG A;  1R1U A;  2HDC A;  1B1B A;  2M5W A;  4P96 A;  4M6X A;  4WXD A;  3KEO A;  1ZN2 A;  2GA1 A;  3FX3 A;  1FYK A;  3F8F A;  2P8T A;  5E17 F;  2RN7 A;  1JXS A;  3GVA A;  1R23 A;  3V7S A;  4LJZ F;  3IWZ A;  4A5N A;  4D0P A;  2NRA C;  2M30 A;  3FM3 A;  2RDP A;  2PI0 A;  2OQR A;  2P6T A;  1DPU A;  2FF4 A;  4R1H A;  4IHS A;  5ERI A;  1OYI A;  4OOI A;  3CUQ C;  4KMF A;  2DAO A;  1TNT A;  4U0W A;  1P4X A;  1Z05 A;  4S04 A;  1ZG5 A;  2W84 A;  4HF2 A;  2XRO A;  3LQR A;  5LRR A;  2STT A;  1FZP B;  4EJU A;  1YLF A;  2XIG A;  3H3U A;  4RB0 A;  1YYV A;  4Z2Y A;  1SAX A;  3GXO A;  2P7C B;  2OAZ A;  4FX4 A;  2XAQ A;  4HA8 A;  4XLP F;  1T98 A;  3CJN A;  1BIA A;  1D3Y A;  3SHF A;  1MDM A;  4HX4 A;  5E18 F;  1RNL A;  5E1W A;  1YS7 A;  3RI4 A;  2RV8 A;  3QP5 A;  3EYY A;  4L9J A;  1J0R A;  2XAJ A;  2HTJ A;  4U0V A;  3JW4 A;  3BPV A;  3T5X A;  2HTS A;  1TBX A;  1G3Y A;  3LA3 A;  3LAJ A;  4ON0 A;  1YW7 A;  1HKS A;  1MD0 A;  4LK0 F;  2PG4 A;  3E3V A;  2EK5 A;  4NB5 A;  2V9V A;  4EQQ A;  3ML6 A;  4ZYG A;  1JGS A;  1GHC A;  3WGH A;  5L3E A;  5FLX Z;  5D8K B;  2L4M A;  2CYY A;  2VXZ A;  3JTH A;  1J75 A;  3H3Z A;  1Z9C A;  3CLO A;  3WU0 A;  2WC2 A;  1HW2 A;  4LLL A;  3TOA A;  4M9S A;  1HKT A;  2Z5U A;  2E7X A;  5D8L B;  3ABT A;  3LQQ A;  3L09 A;  4OIQ F;  2GXB A;  4G9Y A;  3JTG A;  1WRJ A;  1WWX A;  2FBI A;  4WX9 A;  1U5T B;  1F1Z A;  2KRF A;  1UCR A;  1HW5 A;  1ZAR A;  2COM A;  5ILU A;  2PMU A;  4IRH A;  1B4A A;  2M8E A;  3E5X A;  4AVP A;  4L5J A;  1SFU A;  2ISY A;  1J7K A;  3Q9V A;  1B6A A;  4UV9 A;  2OD5 A;  4DQ2 A;  3I59 A;  4CIC A;  2JRT A;  3HUG A;  4EJW A;  2M87 A;  3QRF F;  4UNO A;  1P4A A;  3CO6 C;  1QPM A;  1BM9 A;  3RKW A;  2R7D A;  2Y75 A;  5CJ9 A;  2HFH A;  2Z99 A;  3TO9 A;  1AWC A;  1TQI A;  2DQR A;  4CO8 A;  1V3F A;  2F5E A;  3HOT A;  1JE8 A;  3HIF A;  3RJP A;  1S3J A;  1RIO H;  2X4H A;  3ECO A;  5FO5 A;  5EEH A;  1W5T A;  3LST A;  4YFK F;  4OIO F;  2JSC A;  1YS6 A;  3KP5 A;  2A61 A;  3GX4 X;  1XMA A;  3F8B A;  4RGX A;  4M72 A;  3J7A O;  2ESH A;  4F7Z A;  4I01 A;  3JAM Z;  2KIM A;  2JPC A;  4LLG F;  2JZY A;  4EJO A;  2EFO A;  3F6V A;  2D1V A;  4MQ9 F;  1W7P B;  3D0S A;  4LGW A;  1YO5 C;  5FFX A;  1XSD A;  2DI3 A;  4EMS A;  3R61 A;  3J81 Z;  2GAU A;  4MEX F;  3SQN A;  1OYW A;  4H0E A;  1P2F A;  3ZMV A;  5LHG A;  3I58 A;  1IXR C;  1U2W A;  3JSO A;  2V1D A;  4Y15 A;  1HXD A;  1W5S A;  1O57 A;  4L9T A;  5BMZ A;  2PBI A;  2W85 A;  4AD9 A;  2KJB A;  1ZYR F;  5HLI A;  5H6Q A;  1SFX A;  3IRQ A;  5D6F A;  1S29 A;  3NQO A;  2UXN A;  1I27 A;  1SD6 A;  3JAM K;  4EV0 A;  4U0Y A;  2O61 A;  1IXC A;  2PJP A;  1D8K A;  5HOO A;  2ETH A;  2EA2 A;  1EH6 A;  1QZZ A;  1BIB A;  1YIO A;  2FE3 A;  4LK1 F;  5DD8 A;  5JFR A;  5LGT A;  2W24 A;  1DDN A;  1X3U A;  2F5D A;  5LBQ A;  3LA2 A;  2EJR A;  4O6J A;  1LDJ A;  3GLX A;  4WWC A;  3KET A;  4EM1 A;  1CF7 B;  3BY6 A;  2P5K A;  3FXQ A;  3ABU A;  3GWZ A;  4I0A A;  5DD4 A;  1J5Y A;  2PN6 A;  2A69 F;  2QYO A;  1IN5 A;  3MCZ A;  4ESF A;  3C18 A;  3RPQ A;  2EFQ A;  3RIR A;  5E1Z B;  2DBB A;  1XD7 A;  3C7J A;  5F6F A;  3ECH A;  5HDG A;  2FU4 A;  4XBF A;  3TGN A;  2XGX A;  1YFH A;  3AAF A;  3FM5 A;  3I54 A;  3F8N A;  4KN4 X;  5HLG A;  3IC7 A;  4CHU A;  3TO6 A;  2HOE A;  2A5Y B;  4KIB A;  1QO0 D;  2ZCW A;  2DT5 A;  3WG9 A;  1IRG A;  1I1G A;  2KKO A;  3KLO A;  1O3S A;  2JPB A;  3ELK A;  2QZ8 A;  3WTX C;  2STW A;  5LRS A;  4ENJ A;  1FY7 A;  1IUY A;  1J2X A;  3F3X A;  2CSO A;  1O3R A;  4UUV A;  1U8R A;  2EV5 A;  2XKO A;  3EQL F;  2IJL A;  3ZN1 A;  3L9F A;  1XCB A;  2ZNZ A;  1ZH5 A;  2H94 A;  2V1U A;  2ZNY A;  1SD7 A;  1IN7 A;  4KYW A;  1OMI A;  3K1P A;  2HQR A;  4CXF A;  2GQQ A;  3DXJ F;  3TOB A;  2NNY A;  4EGZ A;  1T38 A;  2GZW A;  3V7R A;  2CO5 A;  3QAH A;  4HOB A;  4I98 B;  5L3F A;  5K5Q A;  2V79 A;  4MEY F;  2CFX A;  2BBY A;  1SMT A;  1QNT A;  1XN7 A;  1RUO A;  3REO A;  4HLX A;  1R1V A;  4GO1 A;  4R8H A;  3OOP A;  3DF8 A;  1B9N A;  1FBS A;  1KYW A;  1I5Z A;  2Z9O A;  2VE8 A;  2FBK A;  3J80 Z;  3EDP A;  3BPX A;  3GEZ A;  1R5G A;  1SD4 A;  1HKQ A;  1QZY A;  5HS8 A;  3VOE A;  3WE3 A;  1T6S A;  3HRT A;  1FT9 A;  3NEU A;  5JVT A;  2B0L A;  2V6C A;  4G8X A;  4A2U A;  1C0W A;  3B02 A;  4ENN A;  2BYV E;  3IL2 A;  5ICF A;  2V1X A;  3VB2 A;  4XLN F;  2R3S A;  2ZBK A;  5FB2 A;  5H20 A;  2QEN A;  3TO7 A;  1KU7 A;  4WF2 A;  4FHT A;  4RS8 A;  1YTY A;  4N9I A;  4RAZ A;  3WE2 A;  3I71 A;  3I5U A;  1G3S A;  4P55 A;  1K78 A;  4LFU A;  3FHZ A;  1YG2 A;  2RKH A;  4KIC A;  3BZ6 A;  3U9G A;  2GIV A;  4LD5 A;  3KLN A;  3RDI A;  5DEQ A;  2P5L C;  2E1N A;  3KP3 A;  3TDZ C;  2PEX A;  3R0A A;  1WI9 A;  2ADU A;  2WWY A;  3VOD A;  5CVR A;  3GZ5 A;  5HVQ C;  1R5H A;  4L0Z B;  5DCF A;  4MGR A;  1XGS A;  4L9N A;  1J9I A;  2RQP A;  3I4P A;  4L9V A;  2QVO A;  5E20 A;  1I1S A;  3GYH X;  3GZ6 A;  4I09 A;  2LSO A;  2HGC A;  4A6E A;  1MKM A;  1Z1D A;  1R36 A;  2OZ6 A;  4L0Y B;  3P9I A;  1P6R A;  3F6O A;  2L3D A;  3QU6 A;  2A07 F;  3PQJ A;  1GXP A;  2CG4 A;  1IRF A;  5F64 A;  2TDX A;  1MJ9 A;  1XSX A;  3ZP5 A;  5D6E A;  2F2E A;  1XGO A;  4BHP A;  3M8F A;  4LG0 A;  1KU9 A;  3CUO A;  4EJV A;  1BN5 A;  4GYG A;  1S8N A;  2EV0 A;  2EV6 A;  4L18 B;  1H9G A;  2KJC A;  2VOD A;  5CVI A;  2FBH A;  2XV4 S;  4LB6 B;  2GXG A;  3ZQ7 A;  4ESJ A;  5HS7 A;  2P5V A;  3K69 A;  2VN2 A;  4RB1 A;  3KFW X;  5EEG A;  2UZK A;  3RKX A;  3DP7 A;  2Q2E A;  3QU3 A;  3EUH A;  1IN8 A;  4FX0 A;  4UVB A;  1UB9 A;  3O6B B;  1IAW A;  2UXX A;  4IXA A;  1W7P A;  2RGV A;  4CYD A;  3KZY A;  4QWQ A;  4G7O F;  2A6E F;  1XSV A;  1Z7U A;  1JHH A;  3LWF A;  2K02 A;  1K78 B;  3BP8 A;  4EGY A;  3QPT A;  4P9F A;  2UWM A;  2YPR A;  3PFI A;  4KUM A;  2QQB A;  1HBX G;  1EV7 A;  2IA2 A;  4UV8 A;  5JR3 A;  2DK5 A;  3HOS A;  2MH2 A;  5CLS A;  5D5U B;  5D5X B;  1P4W A;  2K4J A;  5JHU A;  3FXR A;  5H6R A;  3MAJ A;  5IT3 A;  1KQ9 A;  1Z6T A;  3P9C A;  5L3G A;  4S05 A;  4GXO A;  1U6G A;  1MGT A;  2X0L A;  1F5T A;  3KE2 A;  2AXL A;  1FLI A;  3M8E A;  2Q0O A;  1G6N A;  5D5V B;  4B8X A;  2L4A A;  4OU0 A;  5AIQ A;  3WTS C;  3E97 A;  3ZPL A;  1W4M A;  3F8C A;  4GCV A;  1OKR A;  4UVC A;  5DUI A;  1ON1 A;  3V8J A;  2VBW A;  4WXH A;  3VEP A;  1H9T A;  3CDH A;  4LB5 A;  2RVC A;  2IA1 A;  1Y0U A;  3HSF A;  3R0J A;  1RUN A;  5LHI A;  1W7P D;  2EB7 A;  3HRU A;  1XB4 A;  4MNU A;  2AS5 F;  2VOO A;  1TQP A;  2CQK A;  4OIR F;  3K1N A;  5JI6 A;  2HR3 A;  3FMQ A;  4UHT A;  5BOX A;  5J8C A;  1T39 A;  3L00 A;  2XKP A;  4PDK A;  1IF1 A;  1T0F A;  3LFK A;  1XDU A;  2VT3 A;  3TDU C;  3GO5 A;  1YW8 A;  2ACJ A;  3K2Z A;  2IRF G;  1XGM A;  3T0Y A;  1TW2 A;  2O0Y A;  3T1B A;  2ZJ2 A;  2VOP A;  3K9T A;  4HQM A;  5K5R A;  5IT9 Z;  5ILS A;  3K1M A;  1BI1 A;  2G9W A;  1BC7 C;  4KMU X;  3ZMD A;  4U7D A;  1LNW A;  3BWG A;  1KU3 A;  3SZP A;  3ERE D;  2BE5 F;  4CGZ A;  2FMY A;  2H09 A;  3BRO A;  3U1D A;  1ZG3 A;  2OA4 A;  4IHT A;  3GW2 A;  4A0X A;  1IXS B;  4JK1 X;  1G3T A;  5DDG A;  4KA4 A;  2L54 A;  3SZT A;  2VC1 A;  4WXC A;  4EJT A;  4ZYD A;  1TQM A;  5DCM B;  3D5L A;  2H6C A;  3WTW C;  5DV5 A;  4HAM A;  1K79 A;  4L5I A;  5FFZ A;  3EYI A;  1D8J A;  2G7H A;  1PDN C;  5KVR A;  2JT1 A;  2IP2 A;  3DPT A;  3ZMZ A;  2JTV A;  1ZGJ A;  4M9X A;  1SFE A;  2FOK A;  3WTT C;  4HV6 A;  1AOY A;  3V8K A;  5J8F A;  2HKO A;  5AIP A;  2YSR A;  1FWZ A;  4YIF A;  4AIK A;  3KP7 A;  2F5C A;  4U88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...