2HYGD

The structure of apo-mntr from bacillus subtilis, native form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
molecule tags Transcription
total genus 40
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
D PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hygD01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hygD02
4HYEA 3DQVC 4MEXF 5FB2A 2EV0A 4Y17A 2FU4A 2V1DA 3KZZA 4EGZA 2HTJA 4KIGA 1T2KA 2OZ6A 2V9VA 2K4JA 1SAXA 5BS6A 5HOOA 1BI3A 2RV8A 1JXSA 3NRVA 2VE9A 3CDHA 1JHHA 1T38A 3MCZA 4BHCA 2YSRA 2YU3A 3KETA 1K78A 3QPHA 5D4RA 5K1YA 1J0RA 4BH9A 1X3UA 4OIOF 1XDUA 4JK1X 1ZG5A 1TW3A 3WTXC 4RB0A 2YX4A 1EH7A 5DEQA 2RGVA 4ZYDA 1HXDA 3K9TA 3GYHX 3LA2A 3GFMA 1BOAA 1LDDA 3E6BA 4CHUA 2ZO4A 3KEQA 2COMA 3FM5A 3S2WA 1OYYA 1FPQA 3QAHA 4P9UA 2FF4A 1XD7A 3I59A 5E8IA 3FF5A 3COAC 5BOXA 4ZZLA 4IF4A 2DK5A 2CFXA 3ZQ7A 1MDMA 1KYZA 4LLNA 3F8NA 3RKWA 3H92A 3K0LA 1Z7UA 4MTEA 3FMQA 2MD5A 4XBFA 4A6DA 3V7CA 2V6CA 2O61A 3K1NA 3V8LA 1P92A 3RKYA 3PQJA 2Z3YA 3WTZA 2STTA 3F6OA 3T8RA 1TQMA 4N9HA 1J9IA 3RJPA 2WV0A 1MD0A 4M9ZA 5E17F 3BJ6A 1O3TA 2PMUA 5HDNA 3GZ6A 1FP2A 2HTSA 1IZ1A 4Z2YA 2RN7A 4YIIA 5IT3A 2VT3A 4IHTA 3O6BB 1NHAA 1LDJA 1YO5C 1IN4A 4KN7X 4UUVA 2LDUA 3F8MA 3I71A 3VFZA 3FMRA 1FP1D 2IRFG 1E2XA 1Z05A 3L00A 4KUMA 1W7PD 1FY7A 4HF0A 1HSJA 4AWXB 2VOPA 3R4KA 3HTUA 3RKXA 3T5XA 2UZKA 1F5TA 3QP6A 4ESBA 2ZBKA 1SMYF 4OMZA 3M8FA 3P9IA 5DCMA 4A6EA 3MEXA 2LSOA 5LRRA 5BPDA 2KRFA 4A0XA 1KU3A 3BY6A 4G7HF 4LFUA 2L01A 3WTWC 2VODA 2TDXA 5H6RA 1SMTA 4KDPA 4B09A 3KLOA 5TJJA 1IUYA 4L5JA 2CGPA 1R58A 2DPUA 2DQLA 5E8GA 4M6YA 2OBPA 2P5LC 1YS7A 4P55A 5K5OA 1TLHB 1KQ8A 4WXCA 2HS5A 2M45A 3KP3A 2EFWA 2V1XA 2STWA 4R79A 2FXAA 2F5DA 2VOOA 1HKSA 2DK8A 2FQ3A 2O8XA 1PP8F 2V79A 4N0BA 4AIHA 4HAMA 2JPCA 4GYIA 4HX8A 3MZYA 2ETHA 4BQAA 2MC3A 1CF7B 1G3TA 1XSDA 4ZYHA 3M1EA 2V1UA 3HYIA 1BI1A 1WSUA 4M9SA 4IRHA 3LFKA 4LG0A 4LD5A 1ON2A 3I53A 3WTTC 3ERED 2GA2A 4OINF 3TO9A 4RAZA 4XSXF 5IT9Z 1H9TA 5F6FA 5H6QA 2IA0A 4ZYEA 4UVBA 5J8FA 5HLGA 3I0TA 1MJAA 1KYWA 1D8JA 1BN5A 1CGPA 3CJNA 3I4PA 2XHKA 3FHZA 4O3MA 3BPVA 2GA1A 2DLLA 3EQLF 3V8JA 3NQOA 1BI0A 1S6LA 3E5UA 4M74A 5AONA 4HOBA 3HOSA 4HLXA 2IA2A 5JR3A 2A3SA 4U88A 1R23A 1HW1A 4ENMA 3TKYA 4GGGA 2ZXJA 1RI7A 4NQWA 2GZWA 3KP4A 1W5TA 1B59A 2FBIA 2ZNZA 1P4XA 3D5LA 4G6QA 3SQNA 3CTAA 2OA4A 4ETSA 1TBXA 2UXNA 4LB6B 3QU3A 1L3LA 4UNOA 4EGYA 1LEBA 2OQRA 4EV0A 2QVOA 2GAUA 1O3QA 4KFCA 2K86A 3BROA 3RDIA 1YLFA 5JHUA 1O3SA 2HR3A 1IXCA 2KJCA 2QZ8A 4HV5A 3DF8A 3J80K 4MQ9F 5ICEA 2NRAC 3BDDA 3WGGA 1QNTA 4LK1F 1FYLA 3HRTA 4HZFA 3HSEA 3F8FA 3V7SA 1O7LA 3DKWA 2A6EF 3L9FA 3F22A 4WXDA 3TDZC 2FE3A 2RVCA 3N97A 2O03A 3I59B 3DXJF 3E5QA 3REOA 2QENA 1MDMB 1S7OA 1R00A 1SFUA 1UCRA 5A2QK 2M1BA 3TQNA 5DYMA 2F5CA 4O6JA 2XKPA 4ON0A 4FX0A 4M9XA 1YW8A 1W5SA 4RGSA 1T39A 1ZLJA 3GZ5A 5HLIA 2L4MA 3F8BA 5CYVA 2OU2A 2LF7A 5LEKA 4AVPA 5BMZA 4HF1A 2E7XA 1MZBA 3W6KB 3E5XA 2IPQX 1R1UA 3FXUA 1H9GA 3KP6A 4LLGF 2YR2A 2F2EA 1KU9A 3FZVA 2EK5A 2DBBA 4L0ZB 2QYOA 2ZJ2A 4WK8F 2XRNA 3CUOA 2X0LA 3ZN1A 4LGWA 2A68F 2HQRA 2K7LA 2P5KA 5ERIA 2BE5F 4I0AA 2X4HA 3LSTA 3HRMA 3OOPA 2XAFA 2CYYA 4PDKA 4GXOA 2H6BA 2Z5UA 5DCMB 2M87A 3MAJA 3FWEA 4EM0B 2H09A 2PBIA 5CVVA 2XAGA 3NEUA 4G7OF 3GWZA 3ZMDA 1O7FA 4M6XA 5D6FA 5FFZA 2DQRA 3Q9SA 2ZCWA 2VE8A 2W85A 2EV6A 4H0EA 3ZN0A 2H6CA 3FM3A 5J8CA 2OZUA 4IJAA 2EB7A 4CICA 3EDPA 5DCFA 2DFIA 1HQCA 2EA2A 5K5QA 3V7RA 4A0YA 2OD5A 5D4SA 1HKTA 5L3BA 2L02A 3MFKA 2HWVA 2P6TA 1LB2A 4MNUA 2CQKA 1SD4A 2RDPA 5L3EA 3VODA 4UVCA 4XLPF 3VB2A 3L2CA 4P9FA 1K6OA 1IN6A 2CW0F 3WTVC 3J7AO 4HX7A 3LA7A 1L0OC 1RNLA 3GFIA 2BBYA 2D45A 3TO6A 1LQ1A 3K1MA 2IW5A 3U2RA 4WWCA 2PLYA 1Z91A 5ICFA 4MGRA 2KIUA 5TRDA 2DPDA 4L9JA 4LG0B 2KKOA 2VBZA 3MWMA 3PFIA 3SZTA 3F21A 2HOEA 1R5GA 2CSOA 2NNYA 2QQBA 4JQFA 2XASA 4RGRA 3F3XA 4WCGA 4KMUX 5LHIA 4EJTA 1BC8C 1D8KA 3M8EA 2HZTA 3TDUC 1YIOA 1U5TA 2IP2A 1G3WA 4YFNF 4CO8A 2HDCA 1ZN2A 3HTSB 1FYMA 1U2WA 2LKPA 2F5FA 1PDNC 4UV9A 2Y48A 3J81K 3WG9A 2VXZA 1OYWA 1S3JA 4I0BA 4BXUA 1OPCA 5EEHA 1UHMA 1IXSB 5AIPA 2DO7A 5H20A 3WE3A 1DP7P 1LDKB 1BI2A 1B6AA 2R7DA 2DI3A 4HQEA 1R22A 2J5PA 2VBXA 5D5XB 1VTNC 3BZ6A 3MQ0A 1SD5A 2Y75A 4KNYA 5HVQC 2VONA 2VBWA 5HS8A 1RIOH 3JW4A 3R0JA 1TW2A 2OAZA 5DD4A 4ESJA 1U5TC 3F8CA 3DPTA 2IT0A 1ZREA 5FGMA 3QP5A 1U8RA 4M73A 4U7BA 1UHWA 1ULYA 5D5UB 1ZGJA 3ECHA 1V3FA 1RUNA 4U0WA 3HSFA 5ICGA 1SD7A 3JAMK 3IRRA 4MHGA 1K79A 2ISYA 5HDGA 2H27A 1Z9CA 2NAZA 2PJPA 1I1GA 3R61A 1QPMA 3P9CA 3HUGA 4CXFA 2J5OA 3GVAA 1ZRFA 1HKQA 4IRIA 3O3KA 4EJUA 1AWCA 1LEAA 1XGOA 4Y15A 2WWYA 3SFZA 1IF1A 2P7CB 1USSA 4BAYA 1FWZA 4ESFA 1D3YA 4XSZF 2FA5A 3E6CC 4RS8A 4HQMA 1DPRA 3W6JB 3P9KA 3RI4A 3WU0A 1AOYA 4OIPF 1RUOA 4UV8A 1BC7C 3V8KA 5D8LB 4IXAA 5BPIA 5EEGA 1OKRA 1DUXC 1FT9A 2P7VB 1ZG1A 5ICCA 3ECOA 2ZMEA 4K2EA 1MJBA 4NHJA 1TQPA 4LB5A 3IRQA 4HLYA 2YPRA 2A61A 3KLNA 2JRTA 1ZLKA 4I01A 3E97A 1YS6A 3T0YA 3O2PE 4R1HA 3ZMSA 1J7KA 2Q2EA 4U0YA 2ESHA 5D5VB 2HFHA 4BNCA 3LAJA 2PMHA 4YFKF 2ESNA 5E1XA 1ZAOA 4IHSA 1GXQA 2MH9A 3I64A 4KIFA 2PFBA 5DUIA 5LLQA 3KE2A 1JHFA 2DT5A 2QBYA 4BHPA 2BV6A 2Z33A 2FBHA 1ZRCA 3HRUA 1B9MA 2QWWA 3LQRA 2FMYA 3C1DA 4BYYA 3GEZA 2NS0A 4U7DA 1F9NA 4G9YA 4PZJA 5FO5A 1F4KA 2PN6A 3JTGA 2L54A 3EUHA 3CUQC 1ZARA 1TNTA 1R5HA 3K69A 3P7NA 1J5YA 4L5IA 5LHGA 1KQ0A 2VBYA 4IPAA 4ZZDA 1ONVA 2QQAA 1QQIA 4YIFA 3BPXA 3B73A 2G7UA 4A12A 3KCCA 2Q0OA 4IVNA 5A2QZ 4F7ZA 4S05A 3IKTA 1JGSA 1R7JA 4OMYA 3LAPA 1V4RA 1U78A 4GCVA 3D0SA 4GYGA 3FXQA 2XIGA 4E70A 5FLXZ 5L3DA 1ZG3A 5ILVA 2A07F 3R60A 1ON1A 1XGSA 3KP5A 2W24A 4L9NA 2P5VA 3SXYA 1YQAA 1U5TB 3HRSA 1W4MA 1BIBA 3Q9VA 2PG4A 1LVAA 2P6SA 2G7HA 1B4AA 3EYYA 1J2XA 2PI0A 2XAHA 1FSEA 1IN8A 2RNJA 4KMFA 1GHCA 3AAFA 2EFOA 1QGPA 2HEOA 2Z9OA 1UB9A 4A5MA 2FBKA 5CVIA 4XLNF 1LJ9A 2UXXA 2Z99A 4EMSA 1OYIA 2ZNYA 2HYGD 2HKXA 2C6YA 1DPUA 1IRFA 3G73A 1HW2A 3I58A 3TO7A 2EFQA 4RGUA 4G94A 1G3SA 3QRFF 2JT1A 2R3SA 3HIFA 4PCQA 4YG2F 5BQTA 2JPBA 1JE8A 1P6RA 4ASNA 3CO6C 4OOIA 1RZ4A 4HDVA 1IW7F 1XGMA 2D1VA 4ENKA 1XSXA 4MTDA 2WC2A 4Q5SF 3HSRA 1YW9A 4KT5C 1ZH5A 3DEUA 1W7PA 1XDSA 2B0LA 1IRGA 1U6GA 2KIFA 1IN5A 1Q1HA 3ZMTA 3RPQA 1UFMA 3E6MA 5J6XA 1TNSA 1HBXG 3GFJA 4HBLA 4OIRF 5K5RA 2DU9A 2R7FA 3WODF 4IRGA 3U1DA 5JVTA 3OV8A 1I6XA 2AS5F 5CLSA 2HGCA 5HS7A 4WF2A 3F23A 2OQGA 4EM2A 1XMAA 3FX3A 3GFLA 1I1SA 4N9IA 1B1BA 6PAXA 5F1RA 2WTEA 1FOKA 1FSHA 5L3GA 2ZMEB 1YW7A 2IVMA 1WWXA 3KFWX 3DPLC 4UHTA 2FOKA 3DP7A 5D5WB 3KP2A 2ADUA 2VC1A 3VEPA 2E7WA 1IAWA 3BP8A 5DD8A 3TOBA 3KZYA 2HYFA 3J81Z 1PP7U 3CUQB 3GUDA 3WGIA 4CDGA 3FXRA 4EM1A 1BJAA 3IWFA 1REPC 3JTHA 4ENNA 2A69F 5DDGA 2XV4S 2QLZA 5E18F 3RYPA 4EJVA 2XGXA 3LWFA 3ZP5A 2ELHA 3QOPA 4AD9A 4I7HA 2XVCA 3EETA 1G3YA 3LA3A 3IL2A 1XCVA 3PQKA 5HS9A 2F5EA 4R8HA 5CVJA 5FFXA 3SZPA 1ZHFA 3M7GA 1FLIA 5ILUA 1QZYA 3L7WA 2QBYB 3LQQA 3WGHA 1XGNA 3ZMUA 5LGNA 4KIBA 1F1ZA 3HOTA 3IKVA 1BM9A 4NB5A 1YFHA 4HA8A 4P5OA 2VN2A 3JSPA 3JAMZ 1MJ9A 2M8EA 3WTUC 1O3RA 1GXPA 1G4DA 4Q4ZF 1Z6RA 2NYXA 2JZYA 2W84A 2A5YB 3T8TA 4EJWA 3Q5FA 1ZGAA 1KU7A 3GX4X 3MZHA 5JI6A 3WE2A 2MA3A 3IC7A 3N4MA 1S8NA 1FYKA 1STZA 2K27A 4GO1A 3HHGA 3WU1B 1ZYRF 2BGCA 1P2FA 3IHUA 4HV6A 3R6SA 1BBYA 1XCBA 4RB1A 3E3VA 2MH2A 3C7JA 1HSTA 4S04A 2PEXA 4I2OA 2E1NA 1SD6A 4I02A 1FBUA 5LRSA 3ULQB 4HDUA 1KU2A 1PUEE 2DAOA 2W57A 2KJBA 1T0FA 1I5ZA 2MLGA 4A2UA 2KIMA 4G7ZF 3SHFA 5KK1A 3B02A 1G6NA 3L09A 3BJAA 1OMIA 2XAQA 1S7AA 3C3WA 3IWZA 2GXBA 4MQVA 2W25A 3EYIA 2CWEA 4LMYA 1ODDA 4P96A 2EV5A 1BIAA 4U0VA 1USTA 4LJZF 1YTYA 3VOEA 1XB4A 2D2WA 5CVUA 2ZKZA 3WTYC 1R36A 2P4WA 2EFPA 2EWNA 2E1CA 5LBQA 3QU6A 4PGGA 1FX7A 1ZRDA 3TOAA 4XRFA 2GXGA 1WRJA 4LLLA 3ELKA 2O6GE 3KP7A 1U3EM 2H94A 3F72A 2O0YA 1GVJA 1B9NA 1MGTA 3ABTA 4EJOA 3H3ZA 4JBAA 5LHHA 1J75A 1KGSA 5E1ZB 1R1TA 5F64A 4ZYGA 1TQIA 2HKOA 1YG2A 1O57A 2ACJA 4RGXA 4DQ2A 5KVRA 1W7PB 4CZZA 1WQ2A 3CUQA 5JFRA 3CLOA 3I54A 2EJRA 1R1VA 2AXLA 3TGNA 1QBJA 3RYRA 3KEOA 3HHHA 2L4AA 3DFGA 3ML6A 2CO5A 1Y0UA 4OU0A 1SFXA 2Y0MA 4LK0F 2P8TA 4CYDA 3ROUA 5AIQA 1XMKA 2IA1A 3GF2A 4AIKA 2LNBA 4ENJA 3J80Z 3K2ZA 1P4AA 1P4WA 2HQNA 5E1WA 4QLCU 4G8XA 3GW2A 5LEJA 4KA4A 2M5WA 4MEYF 2ISZA 1QZZA 4OIQF 4FX4A 1MKMA 2VC0A 5ED4A 3GXOA 3ZMVA 5E20A 4QWQA 1Z1DA 4I09A 4EQQA 3RIRA 3ABUA 2XROA 4M71A 1XSVA 3WTSC 4M72A 5L3FA 5CJ9A 5IT9K 4BHBA 1DDNA 4Q48A 1K78B 3R0AA 2PQ8A 2QM3A 3G3ZA 2CG4A 1QO0D 2BEOA 4O5VA 1SFEA 4FT8A 3DV8A 4L9VA 3CO7C 2XUBA 3C18A 2L3DA 2FSWA 1Z6TA 3T1BA 2XAJA 1TTYA 2UWMA 4FHTA 2O3FA 2RKHA 4ZH4F 4RB3C 3GLXA 4TV7A 4AIJA 4WXHA 4Q47A 3H3UA 1IN7A 2DTRA 1T6SA 4A0ZA 4WX9A 3BWGA 4HX4A 1FBQA 1KQ9A 2RQPA 3RPUA 4B8XA 1K7AA 4A5NA 4L0YB 2M30A 2NNNA 1XN7A 4HW0A 2EFNA 2MBFA 4YFXF 1S29A 1FBSA 2GQQA 4KYWA 1EV7A 5LGTA 3ISPA 5FD6A 2ZFWA 2FEZA 2FNPA 2JSCA 1D5VA 1LNWA 2FNAA 5D6EA 4RB2C 4HF2A 1I27A 1A04A 2G9WA 4CGZA 5FLXK 3K1PA 2QUFA 3BOQA 5LGUA 5CVRA 3V4GA 4L9TA 1T98A 1WKMA 2FRHA 1FC3A 4RAYA 1OR7A 3M9AA 1C0WA 3U9GA 1EH6A 3GO5A 1FZPB 2VT2A 1IXRC 1HW5A 2Q8KA 5ILSA 2EA4A 4Y13A 4L18B 4I98B 4UVAA 5HDKA 2LF8A 3RTRA 4PGHA 1FNNA 4KICA 2D1HA 2JTVA 2YX7A 2DW4A 2K02A 1H0MA 2BYVE 1CF7A 5DUKA 5L3CA 4UXNA 4DNCA 1YYVA 2MLKA 2RC4A 2A6HF 3E6DA 5DV5A 1KA8A 2K4BA 2XKOA 3I5UA 3JSOA 3ZMZA 5HLHA 5FD5A 1WI9A 2FMLA 2GIVA 3BJOA 2GWRA 2IJLA 5D8KB 3QPTA 1J59A 3ZPLA 4G6DA 3FMSA 4D0PA 4KN4X 1EH8A 4EVIA 1E17A 2QQ9A 3F6VA
chains in the Genus database with same CATH superfamily
4HYEA 3DQVC 4E7JA 2E1MB 1U8BA 4IHVA 4MEXF 5FB2A 2EV0A 3F9KA 4Y17A 1M1EB 3K2AA 2FU4A 2V1DA 2E71A 4XN3A 3AG3H 4IEJA 1I50J 3KZZA 4EGZA 2HTJA 3OYNA 4KIGA 1N25A 1T2KA 4IHXA 2OZ6A 1V55H 4IQJA 1MBJA 1ITYA 2V9VA 3BT9A 3G6EI 2K4JA 3U1KA 1SAXA 1SVMA 5BS6A 2JWTA 5HOOA 4YEJA 2BY3A 1BI3A 2RV8A 2Y0SN 1JXSA 1TWFJ 4IX7A 3NRVA 1NG7A 1YOVB 2W48A 3ABKH 3OYGA 2VE9A 2R7SA 3HM5A 3CDHA 2Y9ZA 1JHHA 3S32A 1G2HA 1T38A 3MCZA 1TWGJ 4BHCA 3J7YJ 2YSRA 3OYAA 2YU3A 2JVGA 2F4OB 1X3ZB 3KETA 2ZSIB 2EBIA 3QPHA 5D4RA 1K78A 2B9SA 2BY0A 5K1YA 1J0RA 4BH9A 1X3UA 1X2NA 2YU9J 4OIOF 2NVUB 2WAFA 1XDUA 4JK1X 4BBSJ 1ZG5A 1IDZA 4KT6A 4C3HJ 1SFOJ 1VZ0A 4D5CA 1TW3A 3WTXC 3OIOA 5M5XJ 3LSJA 3CCVI 1MNEA 2I10A 4RB0A 2YX4A 5GP9A 3VYRB 1RPWA 3VYSB 4HSRA 4A3MJ 2CUJA 1EH7A 3TP0A 5DEQA 2RGVA 3OYBA 1KONA 4ZYDA 4RAFA 2HPIA 2ZB9A 3DU5A 2KFDA 1PVEA 2XB5A 1HXDA 2H1KA 3K9TA 4Y7NJ 3JRGA 3GYHX 3FKIJ 2EIJH 3LA2A 2OTJI 3GFMA 2CJJA 1BOAA 1P9QC 4B43A 4XRMA 3SJMA 2PJRB 2F6CA 1LDDA 3E6BA 1VQKI 3RZDJ 3CJQB 4CHUA 4E7LA 2ZO4A 2JA5J 3KEQA 2COMA 2YS9A 3VSLA 3FM5A 3S2WA 1OYYA 1Z7LA 1FPQA 1JUPA 3QAHA 2NVYJ 4RLQA 4P9UA 1SFKA 2QKMB 3UR3C 4NC7A 1YJ9I 1ZELA 3CCQI 1Z67A 2XPVA 2FF4A 1I6HJ 1XD7A 3PM1A 1WH7A 2Z2SB 1DU0A 3I59A 5E8IA 1HCRA 3FF5A 4FASD 3COAC 3MKLA 5BOXA 4ZZLA 4IF4A 3ABLH 2DK5A 2CFXA 3ZQ7A 1MDMA 1KYZA 1PUFB 1X4OA 1WI3A 3F8NA 4FE7A 4LLNA 3RKWA 2X1DA 3H92A 3M8JA 3K0LA 3L2RA 3DTIA 2DA1A 2O7OA 1Z7UA 4MTEA 3FMQA 2M9HA 1EJ9A 2G0EA 2MD5A 4XBFA 3K70C 4A6DA 3V7CA 5EZGA 2V6CA 3HKZA 3CCMI 3TMOA 2O61A 3K1NA 3V8LA 3DBHB 1P92A 1MNDA 2JUCA 3RKYA 3PQJA 2Z3YA 1W36C 2XF6A 3WTZA 3G4SI 2STTA 3F6OA 3T8RA 1TQMA 4UY8I 2E2JJ 3RZOJ 4DBRA 4N9HA 1MMDA 1J9IA 3RJPA 2WV0A 1MD0A 2XAUA 3W2WA 3D1NI 2HDDA 4M9ZA 5E17F 2L5QA 3BJ6A 1K4SA 1O3TA 1FIAA 1JUSA 2PMUA 2WAEA 5HDNA 3GZ6A 1FP2A 2HTSA 5BNGA 3BR3A 1IZ1A 3FDYA 4Z2YA 2K9SA 2RN7A 3FXMA 4YIIA 2BHYA 2MABA 5IT3A 5JVGF 2VT3A 4IHTA 1E3HA 3MVPA 3HXLA 3O6BB 1NHAA 1LDJA 2O9LA 5DM7F 1YO5C 2QSGX 1IN4A 3RQIA 5EDNA 4KN7X 4UUVA 2LDUA 3F8MA 4DW6A 3I71A 3VFZA 2R93J 3FMRA 1FP1D 4DIQA 2IRFG 4CYCB 1E2XA 2HQ5A 1Z05A 2VJ5A 1R49A 3L00A 4KUMA 3OS2A 1W7PD 1VI0A 4XOPA 1FY7A 5IY5H 4HF0A 1HSJA 1V5EA 4AWXB 2VOPA 1D5YA 3R4KA 3HTUA 2LBFB 3RKXA 4A3BJ 1HLVA 1B8IB 3T5XA 2UZKA 1F5TA 3QP6A 4ESBA 2ZBKA 5KAIC 1ETWA 1SMYF 2DFHA 4OMZA 3M8FA 5F04A 3P9IA 5DCMA 1YI2I 4A6EA 4CCNA 3AFHA 3MEXA 2LSOA 3AG1H 4XKWA 2HPMA 5LRRA 5BPDA 4MIMA 2KRFA 4A0XA 2AQFA 1KU3A 5F27A 3BY6A 1X4PA 4IOAF 4G7HF 4Y3OA 4DZPA 2XB0X 4LFUA 4N4OB 2L01A 4XLFA 1POGA 3WTWC 2VODA 2TDXA 2E36A 2OCCH 3DKYA 5H6RA 1SMTA 4KDPA 4B09A 5KNLA 3KLOA 2WB1N 5TJJA 5FRNA 2VIXA 4FTHA 3L2VA 1IUYA 2DMPA 4RM3A 4L5JA 2CGPA 1R58A 4I76A 5J3LA 1FTZA 5GAHJ 2V6EA 4B4CA 5LD2C 2M4GA 2DPUA 2DQLA 1IRXA 4H4KC 1YITI 5E8GA 5FJ8J 4M6YA 2OBPA 2P5LC 3S1NJ 3IP4B 1YS7A 4P55A 5K5OA 1TLHB 1KQ8A 4WXCA 2HS5A 2M45A 3KP3A 3ZXSA 1VQ5I 2PMZN 2EFWA 2V1XA 3P5JA 1MBFA 2I5UA 2STWA 2DMNA 3HKZN 4RMNA 4R79A 2FXAA 4J00A 2F5DA 5K7ZA 1JKRC 4B44A 1BA5A 2VOOA 1K61A 1HKSA 2E19A 3CZ6A 3Q0WA 2DK8A 3TP3A 2FQ3A 2O8XA 1PP8F 2V79A 4N0BA 4AIHA 4HAMA 2JPCA 3IH3A 4GYIA 4HX8A 3MZYA 2ETHA 3ONQA 2XSJC 4BQAA 3HG9A 2MC3A 1CF7B 1G3TA 1XSDA 4ZYHA 4ZTJA 1WZ2A 2MFZA 3M1EA 1IGNA 5M3MJ 2V1UA 2AHQA 3HYIA 1UZCA 1BI1A 4PJLA 1WSUA 4M9SA 3GTPJ 1TWHJ 2BY2A 2ZJQF 2ZXIA 3ASOH 2DOFA 4IRHA 3LFKA 3Q0VA 4LG0A 1LE8B 3K7AJ 4LD5A 1AU7A 1ON2A 2LMDA 3I53A 3WTTC 2L7MP 3ERED 2GA2A 4OINF 3TO9A 2R7UA 4RAZA 4XSXF 5IT9Z 1H9TA 5F6FA 5H6QA 2IA0A 4ZYEA 4UVBA 5J8FA 5HLGA 2WY7Q 3I0TA 4BL0B 1MJAA 5IPAA 3BCAA 1KYWA 1D8JA 1BN5A 1MNMC 1CGPA 1RR8C 3G71I 3V42A 3FK7A 3CJNA 3I4PA 1FMWA 2VKDA 2GOXB 1U9NA 2Y31A 3CMAI 3AL0C 2XHKA 3ZQGA 3FHZA 4O3MA 3BPVA 2GA1A 2DLLA 3EQLF 2M7BA 3V8JA 3NQOA 2BHZA 4DYRA 5FROA 1BI0A 1R71A 1S6LA 3ZQIA 1JI8A 1VQLI 3CJTB 3E5UA 1T56A 4M74A 5AONA 3LSPA 4HOBA 3HOSA 4HLXA 3KX2A 2IA2A 5JR3A 2A3SA 2ZMEC 4U88A 4XKBA 1R23A 1HW1A 1BOBA 4ENMA 3TKYA 2BVLA 4GGGA 3TL4X 3K4NA 2ZXJA 1A35A 1BW6A 1RI7A 4NQWA 5TISC 3FXOA 1MW7A 4B1RA 1TT5B 2F48A 1MMSA 3OYHA 3W3CA 4XICA 2GZWA 3RQ4A 3KP4A 1W5TA 1B59A 2FBIA 2ZNZA 3HOVJ 4J01A 1P4XA 3JRIA 3D5LA 4G6QA 3BTJA 3SQNA 4YRVA 3CTAA 2OA4A 1T8IA 3TBIA 4ETSA 3HDDA 2V9KA 1TBXA 4CUGA 2UXNA 3BTLA 4LB6B 3QU3A 2FUG2 1L3LA 1FJLA 4EGYA 4UNOA 1LEBA 2OQRA 4XM3A 4MFEA 4EV0A 2QVOA 2GAUA 1O3QA 4KFCA 2K86A 3BR5A 4I99C 2X51A 4M3FA 3BROA 3MKYB 3X2QH 1GV2A 2KMUA 3RDIA 1WJEA 1YLFA 5JHUA 2ECCA 1O3SA 2HR3A 1IXCA 2KISA 4RLFA 5IOZA 3K6GA 2KJCA 3GTMJ 1A31A 1WJ5A 2ECBA 2QZ8A 4HV5A 3DF8A 3J80K 5E3LA 4MQ9F 3W2VA 5ICEA 2NRAC 2R92J 3BDDA 3WGGA 1QNTA 3I4MJ 4LK1F 1FYLA 3MN2A 4D9JA 2LD5A 1PYVA 4E4HA 1LKXA 3HRTA 4HZFA 4A3CJ 3HSEA 3F8FA 3V7SA 1O7LA 5E3NA 1GUUA 3EUHC 3H9JA 3RKQA 4LIUA 3DKWA 2A6EF 3L9FA 3F22A 3HPGA 4WXDA 3TDZC 2FE3A 3G1LA 2RVCA 3JRDA 3N97A 2O03A 3I59B 3DXJF 3E5QA 2N8GA 2DJIA 3REOA 2V7FA 2QENA 1MDMB 4KISA 4F92B 4X6AJ 1S7OA 1R00A 1U9OA 2EINH 3I55I 2EZHA 1SFUA 1UCRA 5A2QK 2M1BA 3TQNA 5DYMA 2F5CA 2OF7A 2A05A 2JRMA 4O6JA 1D1CA 2XKPA 3LSGA 4ON0A 2RNGA 4CCKA 4FX0A 4M9XA 1YW8A 4NUBA 1W5SA 4RGSA 1MBHA 2RAEA 1ZLJA 1OCPA 1T39A 2O8KA 3GZ5A 5HLIA 4D7MA 2L4MA 2LREA 3F8BA 5CYVA 2OU2A 5M5YJ 2LF7A 5LEKA 5EG0B 1IRZA 2HDWA 2M0CA 4AVPA 4YIRX 5BMZA 3W6VA 4HF1A 2NOJB 5CQGA 1VQ6I 2NS8A 2E7XA 4FISA 3GTOJ 3CDLA 1MZBA 3W6KB 2LVSA 3E5XA 1XPXA 2IPQX 1OJLA 2CQNA 3PFYA 1R1UA 1RR7A 5A2QR 3FXUA 1H9GA 3KP6A 4LLGF 2P81A 2YR2A 2F2EA 1KU9A 4P1WA 2BY1A 3FZVA 4ZJZA 2GXAA 2EK5A 1QHHD 2DBBA 3FXLA 4L0ZB 1Z77A 2QYOA 2ZJ2A 3A0HC 2XC7A 4WK8F 2EILH 4BE0A 2DOAA 2FJ1A 3BG9A 5FKOA 4AM3A 5FLXR 2XRNA 1GVDA 3FK6A 3L1PA 1HF0A 3CUOA 2X0LA 3ZN1A 4LGWA 3BG7A 1S9HA 1TT0A 2A68F 2HQRA 2K7LA 2P5KA 5ERIA 5C44J 2BE5F 2DYSH 2LFBA 3BG3A 1SC7A 1RESA 5E79C 4I0AA 2X4HA 3LSTA 3HRMA 3OOPA 2Z1DA 3QYBA 1MSFC 2XAFA 2CYYA 4MFDA 1R6RA 4CZCA 4PDKA 4GXOA 2H6BA 2Z5UA 4DGWB 5DCMB 2M87A 3MAJA 3ZCOA 1VQ4I 3FWEA 4EM0B 2DFFA 2H09A 2PBIA 5CVVA 1Y1VJ 2XAGA 2LOOA 3NEUA 4G7OF 3GWZA 5F08A 5TGTA 1O7FA 4M6XA 3ZMDA 5D6FA 5FFZA 3CCUI 3HOZJ 1OLTA 3QPLA 2DQRA 2UV1A 2VJJA 1VQ9I 3Q9SA 2ZCWA 2X6YA 2VE8A 2F4MB 2EV6A 2JK3A 2W85A 3ZN0A 2CU7A 4H0EA 1LE8A 2A6TA 2H6CA 2VL8A 3FM3A 5J8CA 1FTTA 1ORKA 2OZUA 4IJAA 1D1AA 2EB7A 2CS3A 3C2GA 4JYKA 3HBLA 3I56I 4CICA 4E7IA 4BE1A 1RKTA 2VASA 3EDPA 5DCFA 2R5ZA 2DFIA 1HQCA 1K4TA 2EA2A 2DXIA 5K5QA 3V7RA 4A0YA 2ME6A 2ICWG 2OD5A 1D0ZA 5D4SA 1HKTA 4HRIA 3BR2A 2XF5A 3OSGA 5L3BA 1YJWI 2L02A 2AO9A 3MFKA 2HXOA 2HWVA 1MBGA 2P6TA 4RBOA 1LB2A 1UG2A 4MNUA 2R0QC 2CQKA 5DTDA 1ETQA 4UUTA 1SD4A 2CFOA 2RDPA 3AL0B 3BQYA 3CF5F 5L3EA 2DA6A 1R4NB 3VODA 1ETOA 4UVCA 4XLPF 1XMXA 3VB2A 4BUPA 3L2CA 3CCYA 3NWTA 2IEKA 4P9FA 2KZGA 1K6OA 2P0TA 5M3FJ 1IN6A 2CW0F 3WTVC 1AHDP 3J7AO 4HX7A 3LA7A 1L0OC 2R7OA 2M8GX 3S1QJ 1RNLA 3GFIA 3GTKJ 2HOAA 2OC6A 2BBYA 2D45A 3TO6A 1LQ1A 2OTLI 1OCOH 2WAQA 3K1MA 1VQNI 2IW5A 4ZC3A 3U2RA 4WWCA 1RQ6A 3BR6A 2PLYA 2QSFX 2K9NA 3DTEA 1YIJI 1Z91A 1U0JA 4BQNA 4PSWA 5ICFA 4MGRA 5GAEJ 2KIUA 4XRSA 2EZLA 2M3AA 3VDXA 3DPUA 2HOTA 5TRDA 2E5ZA 2DPDA 4L9JA 4LG0B 5GTIC 4PSXA 2KKOA 2VBZA 1YE9A 3MWMA 4FETA 4U87A 3CESA 3PFIA 3SZTA 2LRDA 2Q2EB 3F21A 2HOEA 3BR1A 1NG6A 2KLOA 3JRBA 1R5GA 3OMYA 2R7VA 1DQUA 2CSOA 2JMWA 2NNYA 2QQBA 4JQFA 4C2TA 2DMTA 1S72I 2XASA 4RGRA 3F3XA 1ZTRA 2WBMA 3ASNH 4BJTA 4WCGA 3TEDA 4XK4A 2HNHA 4KMUX 2XPWA 5LHIA 4EJTA 5B1BH 1BC8C 2LLKA 1D8KA 4RAGA 2M35A 1X1BA 2HZTA 2CW7A 3M8EA 2XGCA 4M3GA 4GDFA 3TDUC 1YIOA 3DTKA 1U5TA 2IP2A 3DEWA 1G3WA 2ELJA 1MIJA 3J7AY 2ZJRF 4A3DJ 4YFNF 1DP3A 4XKVA 1X1AA 2COBA 4CO8A 3M1CA 2FX0A 2HU9A 2HDCA 1ZN2A 1IO2A 3HTSB 1FYMA 2DDBA 3OR1C 1U2WA 4NQWB 2LKPA 1H8AC 2DT7B 2ZFUA 2F5FA 3RPUD 1PDNC 3O8GA 4UV9A 2Y48A 3J81K 3WG9A 3QYEA 4XORA 2VXZA 1OYWA 1S3JA 4I0BA 4BXUA 4C2MJ 1OPCA 3IH4A 4GRIA 5EEHA 1UHMA 1IXSB 5AIPA 3S1MJ 2DO7A 1N77A 2DMUA 1SAUA 3OYJA 3JRHA 5H20A 5J40A 2MUNA 1WPKA 3WE3A 2WA0A 3EPZA 1DP7P 1LDKB 1BI2A 1B6AA 1PJRA 2R7DA 3FXKA 2DI3A 4F55A 4HQEA 1R22A 1RETA 2J5PA 1BW5A 2VBXA 5D5XB 4Z6YA 1VTNC 3BZ6A 5EG0A 3MQ0A 3UNGC 2IBDA 1SD5A 3J81R 2Y75A 3FBNB 4KNYA 5HVQC 2VONA 3H5AA 4F93B 1EA3A 2VBWA 2M7AA 1IV8A 5HS8A 1IDYA 2WAQN 1RIOH 2NVTJ 2XRLA 3JW4A 1TW2A 2OAZA 3R0JA 5DD4A 2CW8A 4ESJA 1U5TC 2HXIA 3F8CA 3DPTA 2IT0A 3OIPA 3ZQCA 1ZREA 4LG3A 3G1OA 1VNDA 2HQAA 1OQYA 5KAFC 5FGMA 2GIZA 3GMEA 3QP5A 4BXFA 4EATA 5KHDA 1U8RA 3DEEA 4M73A 4U7BA 1UHWA 2V1NA 1ULYA 4JP0A 5D5UB 1JTYA 1ZGJA 3AKZA 3ECHA 1V3FA 4D1QA 1RUNA 4U0WA 3HSFA 1MBEA 4M3EA 4KJZA 2NVXJ 3O8HA 5ICGA 3HL2A 3PO3J 1SD7A 3JAMK 3IRRA 4MHGA 4BE2A 5GADJ 3I3LA 3ESWB 2VQGA 4CSWA 1V5GA 1K79A 5H2FC 2CUEA 2ISYA 2IAIA 5HDGA 2H27A 4ZTFA 1Z9CA 2NAZA 2PJPA 3IAM2 1I1GA 1AKHA 2F5VA 3R61A 3H5NA 1QPMA 9ANTA 1YHQI 2CRGA 2L9RA 3P9CA 3HUGA 1TWAJ 5FKNA 4CXFA 2J5OA 3GVAA 1ZRFA 1DGRM 1HKQA 1QU3A 4IRIA 3OS1A 3O3KA 2R7ZJ 3JAMR 1N75A 1ETXA 3BG6A 1S5LC 3PNTA 4EJUA 1AWCA 1LEAA 1XGOA 4F3QA 4Y15A 1E3OC 2WWYA 3SFZA 1IF1A 2P7CB 3SEQA 3OIQA 1USSA 4XMYA 3OYIA 2O5RA 1R4MB 2AXTC 2VLAA 5CKTA 1ZGWA 4BAYA 1FWZA 4ESFA 3OL4A 1D3YA 4XSZF 1D0YA 1RC9A 5IYCJ 2FA5A 3E6CC 4BQQA 4RS8A 5J4VA 4HQMA 1T0FC 1DPRA 3W6JB 3P9KA 3K4JA 4RM2A 3RI4A 3WU0A 1AOYA 2ID6A 2CV2A 3SDBA 3SEZA 4OIPF 1RUOA 4UV8A 1XS9A 1BC7C 3V8KA 5D8LB 4HG2A 1GV5A 4IXAA 1VF9A 2KHMA 2IS1A 3TW6A 5B66C 5BPIA 4AVZA 3S2DJ 5EEGA 2V9PA 1OISA 1OKRA 1A36A 1DUXC 1FT9A 2P7VB 1ZG1A 5ICCA 4ZDOA 3ECOA 3LSIA 2ZMEA 4K2EA 3K10A 1MJBA 4NHJA 3DKXA 1TQPA 2IGMA 3A1YA 4LB5A 4XLAA 1VQPI 1W1WE 1X58A 3IRQA 3BQZA 1J09A 2H1LA 4HLYA 3CMEI 2KL4A 2YPRA 2A61A 1WJCA 3KLNA 2JRTA 1ZLKA 4G6TB 3BR0A 2XPUA 2Y9YA 3A02A 3LMMA 4I01A 3E97A 1YS6A 3T0YA 3ABMH 3O2PE 4R1HA 4YELA 4Y4RA 4UB8C 3ZMSA 1APLC 3QQAA 4DBQA 1J7KA 2DMQA 4C9YA 4D5FA 1NK2P 2Q2EA 2QCOA 4U0YA 3JCUC 2K5CA 2R5ZB 2DA2A 2ESHA 1TP4A 2DT6A 5D5VB 2VKEA 1VQ7I 3CMMA 2HFHA 5J1RA 4BNCA 3LAJA 4F91B 3K70D 3L2QA 1MMGA 2PMHA 4YFKF 2ESNA 5E1XA 1ZAOA 1H88C 4IHSA 1GXQA 2MH9A 5DM6F 3H5RA 5C4JJ 4A3EJ 3I64A 2F4IA 2X98A 4KIFA 1XC5A 2PFBA 5DUIA 3OY9A 5IYDJ 5LLQA 3KE2A 1JKOC 1I3AA 4A3KJ 1JHFA 2DT5A 3ZOBA 2E2HJ 3NARA 2VKVA 2QBYA 1QRYA 3OYCA 4BHPA 2E1MC 2NOGA 3HB9A 2BV6A 2Z33A 4HEA2 2FBHA 1ZRCA 3HRUA 1B9MA 3GBGA 2QWWA 3LQRA 1MH4A 2FMYA 3C1DA 4A93J 3MMYB 2DCEA 4BYYA 4GFBA 3GEZA 2NS0A 3GTLJ 4DYQA 4U7DA 1F9NA 1NH3A 3VWBA 4G9YA 4PZJA 4B3XA 5FO5A 1F36A 4L5EA 4E7SA 1F4KA 1ZK8A 2PN6A 3JTGA 2L54A 3PJRA 2K3FA 3CUQC 3EUHA 1ZARA 5CPRB 1VQ8I 1TNTA 5FLMJ 1R5HA 1VQMI 2DYRH 3K69A 3P7NA 1J5YA 4L5IA 5LHGA 1KQ0A 1X1CA 2Q1ZB 2VBYA 4IPAA 4ZZDA 3S3NA 1ONVA 2QQAA 1QQIA 4YIFA 3BPXA 1ENHA 2H8WA 1MSEC 4C2UA 3B73A 2G7UA 3LL7A 4A12A 3BCBA 3KCCA 2R7QA 2Q0OA 5B3SH 5CQEA 2ME0A 2L7ZA 4BY1J 2W4SA 1Y8RB 2L7FP 2W00A 4IVNA 4F7ZA 4S05A 1JGSA 5A2QZ 3IKTA 1W0UA 1TC3C 4HSTA 1R7JA 4N4NB 3GCMA 5B1AH 4OMYA 4MO7A 3LAPA 1V4RA 1U78A 1ETVA 1DGWY 4GCVA 3D0SA 4GYGA 1EKEA 2VXDA 3FXQA 4IOCF 2CMPA 2XIGA 2XSDC 4E70A 5FLXZ 4OWRB 5L3DA 4NC8A 3GTQJ 1ZG3A 5ILVA 2KP6A 3M3YJ 2A07F 2LKSA 3W2AA 3R60A 1ON1A 2RQQA 1OCRH 3H0GJ 1XGSA 4IQ4A 3KP5A 2W24A 3BTCA 4L9NA 3ZR8X 1BR1A 5FRMA 3QPSA 2P5VA 3SXYA 3BTIA 1YQAA 4BDZA 1U5TB 2JA6J 4QPQA 3JR9A 2A5WA 3HRSA 2KQRA 1W4MA 3ZQLA 2L9SA 1UAAA 2DDAA 1BIBA 3WHBA 3Q9VA 2PG4A 4IHYA 2KPMA 2DN0A 1LVAA 2P6SA 2G7HA 4AIDA 1B4AA 3EYYA 1B72A 2LR8A 3PIOF 2OJED 2MZ4A 1J2XA 4QSHA 1JGGA 3SDGA 2DA3A 3ERMA 5LFAA 3HEFA 1NK3P 3HOXJ 2PI0A 2XAHA 1FSEA 1IN8A 2RNJA 3KPHA 3S1RJ 4KMFA 1GHCA 3AAFA 2EFOA 1QGPA 2HEOA 2Z9OA 1T95A 3J80R 2WY8Q 2LTPA 3N05A 1UB9A 2LYCA 4A5MA 2FBKA 5CVIA 1IC8A 5FKLA 3CCJI 4XLNF 1LJ9A 2UXXA 2Z99A 2KIQA 5EGOA 4QIWN 4EMSA 2V26A 3IH2A 1CQTA 1OYIA 5K7FA 2ZNYA 2HYGD 4QTRA 2HKXA 5F0HA 2C6YA 5K7HA 4ZDLA 3ZQHA 1E3PA 2B63J 1JT0A 1DPUA 3DWLE 3ZGKA 1IRFA 5IYBJ 3G73A 4CCOA 2L9VA 3NWSA 3PSIA 1HW2A 3A01A 3I58A 3TO7A 4ABZA 2EFQA 4RGUA 3CF2A 4G94A 3K4CA 1G3SA 4A3JJ 1Y39A 1WJAA 3BLYA 3HJEA 1ZQ3P 3PO2J 3LOCA 3CLQA 2JQ7A 3QRFF 4DZJA 1I3QJ 3S3MA 1V5FA 2JT1A 2VQLA 2R3SA 2H8RA 3HIFA 2Y0SA 4PJMA 4PCQA 1OCZH 4LITA 4YG2F 3GTJJ 5BQTA 1WJDA 2JPBA 3EUAA 4BJ5C 4RDUA 1P6RA 1JE8A 2ZC2A 4ASNA 2IXSA 3CO6C 4OOIA 4ZDPA 1JJ6C 5JHFA 3JRAA 1RZ4A 3LFUA 4CH7A 4HDVA 1IW7F 4G12A 1XGMA 1X1DA 2D1VA 2LP0A 4ENKA 2BZTA 3CCLI 1XSXA 2CQQA 3A2KA 2M2EA 2BW3A 2BVMA 4MTDA 2WC2A 1AKHB 3H0DA 4Q5SF 3HSRA 1YW9A 2E60A 2K9QA 4BS9A 4KT5C 4II3A 2W7NA 3DEUA 1W7PA 3HUGB 1XDSA 1ZH5A 2B0LA 1IRGA 4OAZA 1U6GA 4BGDA 2KIFA 3VYUB 1IN5A 3ZRGA 3CCRI 2EIMH 1Z0XA 1Q1HA 1Y8QB 4AU7A 3ZMTA 4UUSA 2JN6A 3RPQA 1UFMA 1UMQA 3E6MA 5IP7J 1X1PA 2QA4I 1N78A 5J6XA 1TNSA 1HBXG 2VB6A 1YJNI 3GFJA 4HBLA 4OIRF 5HNFA 2M34A 5K5RA 2DU9A 2R7FA 4XL9A 3H35A 3WODF 2QSHX 4IRGA 3U1DA 5JVTA 1JKPC 1XX5A 1RKWA 3QYFA 4BQOA 4V19K 1JUMA 2K3PA 3OV8A 5GPCA 1I6XA 1EF4A 4PFOA 3A0BC 2AS5F 4XIDA 1FOYA 3GZNB 1QVUA 5CLSA 2HGCA 5HS7A 4WF2A 1RRJA 3F23A 2OQGA 4EM2A 1K83J 1XMAA 1R9TJ 3FX3A 3OYLA 1WCMJ 1WVRA 4M3DA 3GFLA 1AA7A 1I1SA 2TCTA 4PJ0C 4N9IA 1B1BA 2B7EA 6PAXA 2X6OA 5F1RA 2E35A 5HODA 3S8PA 2WTEA 1FOKA 1FSHA 1FEXA 1ETYA 5L3GA 2ZMEB 1YW7A 2IVMA 3EUKL 1WWXA 3DLAA 3KFWX 4F52A 3WHCA 3DPLC 4UHTA 3PIPF 2IS2A 2FOKA 3MZ8A 3DP7A 5D5WB 2X1EA 3KP2A 3M07A 2ADUA 4W1UA 2MGQA 2VC1A 3VEPA 2E7WA 1IAWA 2GM4A 3BP8A 5DD8A 3TOBA 1Y0NA 3KZYA 5C4XJ 3OOUA 4II2A 3UKGA 2HYFA 2QKLB 3C2BA 3J81Z 1PP7U 4AC0A 3CUQB 4EEFG 3GUDA 3WGIA 1WFXA 4CDGA 4CCJA 3FXRA 3DU6A 4EM1A 1ZKGA 1R5ID 1BJAA 3LNQA 3IWFA 1REPC 2VKHA 3JTHA 2W82A 4V2GA 1W5CC 4AYBA 4ENNA 3S16J 4BXXJ 2KT0A 4NC6A 2A69F 3KYDB 3HC7A 2L0KA 5F0FA 5DDGA 4JOMA 1QZEA 4BY7J 3CCEI 2X48A 2X85A 2D5VA 2XV4S 2QLZA 3RYPA 4AUXA 4EJVA 2XGXA 5E18F 3LWFA 3ZP5A 1O4XA 2ELHA 3QOPA 4PK4A 5FKKA 1Z3XA 4AD9A 4I7HA 2GBYA 2L9NA 2XVCA 1A5JA 2GLOA 4QPOA 3EETA 1G3YA 3LA3A 3IL2A 1XCVA 4BKXA 3PQKA 1OFCX 5HS9A 2F5EA 4R8HA 4XLHA 2VJIA 5CVJA 5B5EC 1SEUA 5J47A 5FFXA 3SZPA 1ZHFA 2FQ4A 3KEYA 3M7GA 1FLIA 5ILUA 1QZYA 3L7WA 4E7HA 2QBYB 3LQQA 3WGHA 1XGNA 2MSYA 3SYTA 4JX4A 3F0CA 3ZMUA 5LGNA 4KIBA 1F1ZA 3HOTA 3IKVA 3PSFA 1BM9A 3B6AA 4NB5A 1MMNA 1S7EA 4LOCA 2X6XA 1HC8A 2R5YA 1YFHA 4HA8A 2VPRA 4P5OA 1UG0A 1SVLA 3HOUJ 2VN2A 5EEAA 3JSPA 3JAMZ 5E3MA 4XONA 3Q0UA 3D5SC 1MJ9A 2M8EA 3WTUC 1O3RA 1GXPA 1G4DA 3NAUA 4M6VA 4Q4ZF 1XG1A 1Z6RA 2WB1A 3JRCA 2NYXA 2JZYA 2W84A 1IG7A 4B47A 2A5YB 2ELKA 2DJNA 4NBQA 3T8TA 4EJWA 4HNVA 2FOWA 3Q5FA 1ZGAA 1KU7A 3GX4X 3MZHA 5JI6A 3LSKA 3WE2A 2MA3A 5J1YA 1FOXA 3IC7A 4C3IJ 3WG7H 3DBRB 4ZYAA 5J4YA 3N4MA 1S8NA 1FYKA 4CCMA 1STZA 2K27A 4GO1A 3CP2A 2FD5A 3HHGA 3WU1B 2KDZA 3CD6I 1ZYRF 2BGCA 3E0JB 1P2FA 3IHUA 2K9LA 4BDYA 1BJZA 2PMZA 4HV6A 3R6SA 1BBYA 4CCLA 2ID3A 5JLXA 1XCBA 4RB1A 3CQZJ 3MKWB 3E3VA 3G2BA 2MH2A 3C7JA 1HSTA 3FIWA 1LUJB 2KZVA 3U21A 4S04A 2PEXA 4PJNA 3OYKA 2VI6A 1X3WB 1IV6A 4I2OA 2E1NA 2Y69H 3ZQQA 4PJJA 1SD6A 4I02A 2LY1A 1FBUA 5LRSA 1TZLA 2Y30A 3ULQB 4HDUA 1KU2A 3PNVA 2DAOA 1PUEE 1YRNA 2W57A 3FHNA 2KJBA 2BXZA 4AYBN 3OS0A 1Y1WJ 1T0FA 4FE4A 1I5ZA 2MLGA 5FKMA 4IO9F 3FBIB 1B72B 3OWTA 4XLCA 4A2UA 2KIMA 1Q1VA 1E0EA 3AG4H 1JTXA 2DODA 3A52A 4G7ZF 3OL3A 4OAYA 3SHFA 5KK1A 3GTGJ 3CC4I 3B02A 4DJAA 1G6NA 3L09A 2QF7A 3BJAA 4E6KG 1OMIA 2XAQA 4E7KA 1JKQC 1S7AA 3C3WA 1MMAA 1OCCH 4A69C 3IWZA 1NTCA 2GXBA 4CA0A 2TRTA 3LSMA 1ZR4A 3K4LA 4A3GJ 2IGOA 2MC4A 4MQVA 2W25A 3EYIA 2LK2A 3C2HA 1SANA 2CWEA 2AQEA 1P7JA 3HPHA 4LMYA 5EGOB 4A3LJ 1GLNA 4IZZA 1ODDA 1WJBA 3FKJA 3Q3SA 2QGUA 4P96A 4DYCA 1T33A 2EV5A 3J7AW 2JSPA 3CCSI 2DOEA 1BIAA 4U0VA 1USTA 2EZIA 2OV7A 3BC8A 3VSKA 2IS4A 3S17J 1YX3A 1TWCJ 4LJZF 2CQ7A 1YTYA 4XN0A 2CUFA 3VOEA 2L7KA 1SVOA 1A6IA 3OR2C 2HVSA 1XB4A 5FLVA 2VQHA 2R7RA 4S0HB 1ACIA 5KCMA 2D2WA 5CVUA 2ZKZA 4XQFA 3WTYC 1R36A 2DA4A 2P4WA 2EFPA 2OUMA 2EWNA 3A01B 2E1CA 3BG5A 2HI3A 5LBQA 1T08B 3QU6A 4PGGA 2VPLA 2M0MA 1FX7A 1LFBA 3CDIA 1ZRDA 3TOAA 4XRFA 1D1BA 2WV1A 2GXGA 1QVTA 5GPAA 1LFUP 1WRJA 2CH0A 4LLLA 3ELKA 2O6GE 3KP7A 1U3EM 2H94A 3F72A 2E2IJ 2O0YA 1GVJA 1P7IA 1B9NA 2VQCA 4BEHB 1MGTA 4PFPA 4IHWA 4B3AA 4XLEA 3ABTA 2R7XA 4EJOA 1MBKA 4KITB 2DFEA 3H3ZA 4JBAA 5LHHA 3OYMA 4V2FA 1J75A 1KGSA 4JX5A 1HDDC 4M3BA 2XGDA 5E1ZB 2P0WA 1R1TA 5F64A 4ZYGA 1TQIA 2LY9A 1X19A 3H9GA 1A6QA 1UELB 2BW3B 2NS7A 3FISA 2HKOA 1YG2A 1O57A 5IOYA 2JA2A 3HZJA 2ACJA 1LFPA 4RGXA 4DQ2A 1VFCA 1V54H 5KVRA 1LPQA 1W7PB 2K85A 2JVHA 3IAS2 4FCYA 1G59A 4CZZA 1WQ2A 3CUQA 5JFRA 4PUSA 3K4BA 2CV0A 4UUSB 3PUFA 3CLOA 1UHSA 1GDTA 3BZCA 2HVRA 3I54A 2VJ4A 2I8DA 4XR6A 5EJCA 2EJRA 1R1VA 3CP8A 2AXLA 1QHGA 4RA2A 3SZGA 2X9DA 2OCEA 3TGNA 3E7LA 2XGEA 3S14J 1QBJA 3RYRA 3DCFA 3KEOA 3QODA 2LKXA 3HHHA 4ITVA 1Y56A 5JLWA 2L4AA 3L2WA 3DFGA 3ML6A 2CV1A 1G8XA 2CO5A 2E1OA 1Y0UA 4OU0A 1SFXA 4BBRJ 4HPQA 2Y0MA 3PNYA 4LK0F 1W36D 2P8TA 4CYDA 2XDVA 3RSNA 2LY2A 1H89C 3ROUA 4NNJA 5AIQA 3S93A 5E3OA 3SFIA 1XMKA 1JJ8C 2JA8J 2IA1A 3CJRB 3GF2A 4AIKA 2E34A 4ANJA 2LNBA 2NVQJ 2RREA 4ENJA 5M5WJ 3K2ZA 3J80Z 1P4AA 1P4WA 2HQNA 5E1WA 4QLCU 4G8XA 5HNHA 1FOWA 3A03A 1GT0C 4E7ZA 3GW2A 5LEJA 4KA4A 2W1OA 2M5WA 4MEYF 4A3FJ 3QOEA 1BR4A 2PJRA 2ISZA 2X1CA 1ERDA 5F1JA 1QZZA 4OIQF 2EIKH 4FX4A 4B48A 1MKMA 2BOLA 2VC0A 5ED4A 3GXOA 3DLLF 2QQ8A 1K6YA 5DS9A 3ZMVA 1IJWC 2HVQA 3GLLA 3L2UA 5E20A 4QWQA 1Z1DA 4I09A 3FXJA 3OYEA 4EQQA 3WU2C 3RIRA 2IGKA 3ABUA 2XROA 1JT6A 4M71A 2JA7J 3H9QA 2JJ7A 1XSVA 3WTSC 4X0GA 4MLOA 4M72A 3IUOA 4Y52J 5L3FA 2K9MA 3B6CA 1PUFA 5CJ9A 2EZKA 5IT9K 4BHBA 1DDNA 4Q48A 1K78B 1QA6A 2Y2ZA 3R0AA 4DOZA 2V4JC 1IUFA 3H1CA 3E1SA 2HOSA 2PQ8A 2QM3A 4D7NA 3G1MA 3G3ZA 2CG4A 1QO0D 1VQOI 1UJ8A 3CC7I 2BEOA 2HZDA 4O5VA 2QEXI 1SFEA 4FT8A 3DV8A 4L9VA 3CO7C 2XUBA 3C18A 4X1EA 3D5RC 2L3DA 2FSWA 2GOMA 2R4GA 4NDLA 1Z6TA 3T1BA 2ZJPF 2LG4A 1TTYA 2XAJA 4FHTA 2UWMA 3OSFA 1HDPA 2MYSA 2O3FA 2RKHA 1ETKA 4ZH4F 5IT9R 4RB3C 3GLXA 3CMYA 2M4KA 5GAGJ 1LVKA 2DA7A 4HNUA 4TV7A 1BL0A 5IP9J 4AIJA 2YUSA 4WXHA 4Q47A 4UB6C 3H3UA 2R5YB 2EPFA 1IN7A 2DTRA 3J7ZI 2HYJA 3I4NJ 4XKCA 3ZQFA 4LIVA 1T6SA 4W97A 4A0ZA 1WHUA 4WX9A 3BWGA 1KZHA 3IV5A 4HX4A 1FBQA 4CYCA 4JX6A 3PUBA 4C30A 1KQ9A 4IL6C 2LC2A 2RQPA 3KYCB 3RPUA 4B8XA 1D0XA 1K7AA 4A5NA 4XNFA 1OCTC 4L0YB 4BJ6C 3JRFA 2LBFA 3RCOA 2M30A 2LH9A 1Y6IA 1WGXA 4C3JJ 1B8IA 2NNNA 1XN7A 4HW0A 2EFNA 2MBFA 3MKZA 4YFXF 1S29A 4J19A 2DA5A 3HOWJ 1FBSA 2GQQA 4KYWA 1EV7A 3DBLB 1HOMA 5LGTA 3PL8A 4FQGA 3ISPA 5FD6A 2ZFWA 2FEZA 2MD0A 2K40A 2EQRA 2ZXHA 2FNPA 2JSCA 1I39A 5IP6A 4Y33A 3H36A 1D5VA 1BR2A 1WJFA 1LNWA 2FNAA 1W0TA 1TL8A 5D6EA 4RB2C 3K4KA 3OYDA 2XF7A 2EH3A 4XRSG 4HF2A 3OYFA 1I27A 1A04A 2G9WA 4CGZA 5FLXK 3K1PA 1DU6A 2QUFA 3A4CA 3BOQA 1WH5A 3MD2A 5LGUA 3I9V2 2KRCA 5CVRA 3V4GA 3HOYJ 2MVTA 1YRNB 4L9TA 1T98A 4BEHA 2L2OA 1WKMA 2FRHA 1FC3A 2CUZA 4RAYA 3QWLA 1OR7A 3M4OJ 2E5NA 3M9AA 2UUZA 2Z16A 1C0WA 3KIOA 3U9GA 1EH6A 3GO5A 1FZPB 3K4MA 2VT2A 2KDOA 3VPRA 1IXRC 2VUMJ 1HW5A 1ZR2A 2Q8KA 2X6WA 4A3IJ 1Z21A 2EA4A 5ILSA 2OPTA 1Z3YA 4Y13A 4L18B 5GTHC 4I98B 4UVAA 2WADA 2R7WA 5HDKA 2LF8A 3RTRA 1YX5A 1HA8A 2IGNA 2DTZA 4PGHA 3TW7A 1FNNA 2NXNB 1F43A 4KICA 2D1HA 2JTVA 3HGYA 2ZSHB 2YX7A 4XOTA 2MG4A 3HGGA 4BACA 2DW4A 2K02A 1H0MA 1XTAA 2BYVE 1CF7A 5DUKA 5L3CA 4UXNA 3LSHA 2CQXA 2JUGA 5J1UA 4DNCA 3KYLA 3AG2H 3BZKA 2PX9A 1YYVA 3S15J 4HNTA 2MLKA 3JREA 1FIPA 2RC4A 3S3OA 1FMVA 3LSRA 2A6HF 3E6DA 5DV5A 1KA8A 2IS6A 5EYRA 2K4BA 2XKOA 3I5UA 2MW8A 3VYTB 3ZMZA 5HLHA 3JSOA 5FD5A 1MH3A 1WI9A 2FMLA 2GIVA 3BJOA 2ZXWH 1OR7C 2GWRA 2IJLA 5D8KB 3QPTA 3H3VK 1J59A 3S2HJ 5C3EJ 2R7TA 4I6ZA 3KZIC 1QPIA 3ZPLA 5EF6A 4BU2A 4G6DA 5HLTA 3FMSA 4D0PA 2BXYA 1EH8A 4KN4X 3CC2I 4EVIA 1E17A 1X2MA 2QQ9A 5EZHA 4IKFA 5F0CA 3F6VA 2KRHA
chains in the Genus database with same CATH topology
4HYEA 3DQVC 4MEXF 5FB2A 2EV0A 4Y17A 2FU4A 2V1DA 3KZZA 4EGZA 2HTJA 4KIGA 1T2KA 2OZ6A 2V9VA 2K4JA 1SAXA 5BS6A 5HOOA 1BI3A 2RV8A 1JXSA 3NRVA 2VE9A 3CDHA 1JHHA 1T38A 3MCZA 4BHCA 2YSRA 2YU3A 3KETA 1K78A 3QPHA 5D4RA 5K1YA 1J0RA 4BH9A 1X3UA 4OIOF 1XDUA 4JK1X 1ZG5A 1TW3A 3WTXC 4RB0A 2YX4A 1EH7A 5DEQA 2RGVA 4ZYDA 1HXDA 3K9TA 3GYHX 3LA2A 3GFMA 1BOAA 1LDDA 3E6BA 4CHUA 2ZO4A 3KEQA 2COMA 3FM5A 3S2WA 1OYYA 1FPQA 3QAHA 4P9UA 2FF4A 1XD7A 3I59A 5E8IA 3FF5A 3COAC 5BOXA 4ZZLA 4IF4A 2DK5A 2CFXA 3ZQ7A 1MDMA 1KYZA 4LLNA 3F8NA 3RKWA 3H92A 3K0LA 1Z7UA 4MTEA 3FMQA 2MD5A 4XBFA 4A6DA 3V7CA 2V6CA 2O61A 3K1NA 3V8LA 1P92A 3RKYA 3PQJA 2Z3YA 3WTZA 2STTA 3F6OA 3T8RA 1TQMA 4N9HA 1J9IA 3RJPA 2WV0A 1MD0A 4M9ZA 5E17F 3BJ6A 1O3TA 2PMUA 5HDNA 3GZ6A 1FP2A 2HTSA 1IZ1A 4Z2YA 2RN7A 4YIIA 5IT3A 2VT3A 4IHTA 3O6BB 1NHAA 1LDJA 1YO5C 1IN4A 4KN7X 4UUVA 2LDUA 3F8MA 3I71A 3VFZA 3FMRA 1FP1D 2IRFG 1E2XA 1Z05A 3L00A 4KUMA 1W7PD 1FY7A 4HF0A 1HSJA 4AWXB 2VOPA 3R4KA 3HTUA 3RKXA 3T5XA 2UZKA 1F5TA 3QP6A 4ESBA 2ZBKA 1SMYF 4OMZA 3M8FA 3P9IA 5DCMA 4A6EA 3MEXA 2LSOA 5LRRA 5BPDA 2KRFA 4A0XA 1KU3A 3BY6A 4G7HF 4LFUA 2L01A 3WTWC 2VODA 2TDXA 5H6RA 1SMTA 4KDPA 4B09A 3KLOA 5TJJA 1IUYA 4L5JA 2CGPA 1R58A 2DPUA 2DQLA 5E8GA 4M6YA 2OBPA 2P5LC 1YS7A 4P55A 5K5OA 1TLHB 1KQ8A 4WXCA 2HS5A 2M45A 3KP3A 2EFWA 2V1XA 2STWA 4R79A 2FXAA 2F5DA 2VOOA 1HKSA 2DK8A 2FQ3A 2O8XA 1PP8F 2V79A 4N0BA 4AIHA 4HAMA 2JPCA 4GYIA 4HX8A 3MZYA 2ETHA 4BQAA 2MC3A 1CF7B 1G3TA 1XSDA 4ZYHA 3M1EA 2V1UA 3HYIA 1BI1A 1WSUA 4M9SA 4IRHA 3LFKA 4LG0A 4LD5A 1ON2A 3I53A 3WTTC 3ERED 2GA2A 4OINF 3TO9A 4RAZA 4XSXF 5IT9Z 1H9TA 5F6FA 5H6QA 2IA0A 4ZYEA 4UVBA 5J8FA 5HLGA 3I0TA 1MJAA 1KYWA 1D8JA 1BN5A 1CGPA 3CJNA 3I4PA 2XHKA 3FHZA 4O3MA 3BPVA 2GA1A 2DLLA 3EQLF 3V8JA 3NQOA 1BI0A 1S6LA 3E5UA 4M74A 5AONA 4HOBA 3HOSA 4HLXA 2IA2A 5JR3A 2A3SA 4U88A 1R23A 1HW1A 4ENMA 3TKYA 4GGGA 2ZXJA 1RI7A 4NQWA 2GZWA 3KP4A 1W5TA 1B59A 2FBIA 2ZNZA 1P4XA 3D5LA 4G6QA 3SQNA 3CTAA 2OA4A 4ETSA 1TBXA 2UXNA 4LB6B 3QU3A 1L3LA 4UNOA 4EGYA 1LEBA 2OQRA 4EV0A 2QVOA 2GAUA 1O3QA 4KFCA 2K86A 3BROA 3RDIA 1YLFA 5JHUA 1O3SA 2HR3A 1IXCA 2KJCA 2QZ8A 4HV5A 3DF8A 3J80K 4MQ9F 5ICEA 2NRAC 3BDDA 3WGGA 1QNTA 4LK1F 1FYLA 3HRTA 4HZFA 3HSEA 3F8FA 3V7SA 1O7LA 3DKWA 2A6EF 3L9FA 3F22A 4WXDA 3TDZC 2FE3A 2RVCA 3N97A 2O03A 3I59B 3DXJF 3E5QA 3REOA 2QENA 1MDMB 1S7OA 1R00A 1SFUA 1UCRA 5A2QK 2M1BA 3TQNA 5DYMA 2F5CA 4O6JA 2XKPA 4ON0A 4FX0A 4M9XA 1YW8A 1W5SA 4RGSA 1T39A 1ZLJA 3GZ5A 5HLIA 2L4MA 3F8BA 5CYVA 2OU2A 2LF7A 5LEKA 4AVPA 5BMZA 4HF1A 2E7XA 1MZBA 3W6KB 3E5XA 2IPQX 1R1UA 3FXUA 1H9GA 3KP6A 4LLGF 2YR2A 2F2EA 1KU9A 3FZVA 2EK5A 2DBBA 4L0ZB 2QYOA 2ZJ2A 4WK8F 2XRNA 3CUOA 2X0LA 3ZN1A 4LGWA 2A68F 2HQRA 2K7LA 2P5KA 5ERIA 2BE5F 4I0AA 2X4HA 3LSTA 3HRMA 3OOPA 2XAFA 2CYYA 4PDKA 4GXOA 2H6BA 2Z5UA 5DCMB 2M87A 3MAJA 3FWEA 4EM0B 2H09A 2PBIA 5CVVA 2XAGA 3NEUA 4G7OF 3GWZA 3ZMDA 1O7FA 4M6XA 5D6FA 5FFZA 2DQRA 3Q9SA 2ZCWA 2VE8A 2W85A 2EV6A 4H0EA 3ZN0A 2H6CA 3FM3A 5J8CA 2OZUA 4IJAA 2EB7A 4CICA 3EDPA 5DCFA 2DFIA 1HQCA 2EA2A 5K5QA 3V7RA 4A0YA 2OD5A 5D4SA 1HKTA 5L3BA 2L02A 3MFKA 2HWVA 2P6TA 1LB2A 4MNUA 2CQKA 1SD4A 2RDPA 5L3EA 3VODA 4UVCA 4XLPF 3VB2A 3L2CA 4P9FA 1K6OA 1IN6A 2CW0F 3WTVC 3J7AO 4HX7A 3LA7A 1L0OC 1RNLA 3GFIA 2BBYA 2D45A 3TO6A 1LQ1A 3K1MA 2IW5A 3U2RA 4WWCA 2PLYA 1Z91A 5ICFA 4MGRA 2KIUA 5TRDA 2DPDA 4L9JA 4LG0B 2KKOA 2VBZA 3MWMA 3PFIA 3SZTA 3F21A 2HOEA 1R5GA 2CSOA 2NNYA 2QQBA 4JQFA 2XASA 4RGRA 3F3XA 4WCGA 4KMUX 5LHIA 4EJTA 1BC8C 1D8KA 3M8EA 2HZTA 3TDUC 1YIOA 1U5TA 2IP2A 1G3WA 4YFNF 4CO8A 2HDCA 1ZN2A 3HTSB 1FYMA 1U2WA 2LKPA 2F5FA 1PDNC 4UV9A 2Y48A 3J81K 3WG9A 2VXZA 1OYWA 1S3JA 4I0BA 4BXUA 1OPCA 5EEHA 1UHMA 1IXSB 5AIPA 2DO7A 5H20A 3WE3A 1DP7P 1LDKB 1BI2A 1B6AA 2R7DA 2DI3A 4HQEA 1R22A 2J5PA 2VBXA 5D5XB 1VTNC 3BZ6A 3MQ0A 1SD5A 2Y75A 4KNYA 5HVQC 2VONA 2VBWA 5HS8A 1RIOH 3JW4A 3R0JA 1TW2A 2OAZA 5DD4A 4ESJA 1U5TC 3F8CA 3DPTA 2IT0A 1ZREA 5FGMA 3QP5A 1U8RA 4M73A 4U7BA 1UHWA 1ULYA 5D5UB 1ZGJA 3ECHA 1V3FA 1RUNA 4U0WA 3HSFA 5ICGA 1SD7A 3JAMK 3IRRA 4MHGA 1K79A 2ISYA 5HDGA 2H27A 1Z9CA 2NAZA 2PJPA 1I1GA 3R61A 1QPMA 3P9CA 3HUGA 4CXFA 2J5OA 3GVAA 1ZRFA 1HKQA 4IRIA 3O3KA 4EJUA 1AWCA 1LEAA 1XGOA 4Y15A 2WWYA 3SFZA 1IF1A 2P7CB 1USSA 4BAYA 1FWZA 4ESFA 1D3YA 4XSZF 2FA5A 3E6CC 4RS8A 4HQMA 1DPRA 3W6JB 3P9KA 3RI4A 3WU0A 1AOYA 4OIPF 1RUOA 4UV8A 1BC7C 3V8KA 5D8LB 4IXAA 5BPIA 5EEGA 1OKRA 1DUXC 1FT9A 2P7VB 1ZG1A 5ICCA 3ECOA 2ZMEA 4K2EA 1MJBA 4NHJA 1TQPA 4LB5A 3IRQA 4HLYA 2YPRA 2A61A 3KLNA 2JRTA 1ZLKA 4I01A 3E97A 1YS6A 3T0YA 3O2PE 4R1HA 3ZMSA 1J7KA 2Q2EA 4U0YA 2ESHA 5D5VB 2HFHA 4BNCA 3LAJA 2PMHA 4YFKF 2ESNA 5E1XA 1ZAOA 4IHSA 1GXQA 2MH9A 3I64A 4KIFA 2PFBA 5DUIA 5LLQA 3KE2A 1JHFA 2DT5A 2QBYA 4BHPA 2BV6A 2Z33A 2FBHA 1ZRCA 3HRUA 1B9MA 2QWWA 3LQRA 2FMYA 3C1DA 4BYYA 3GEZA 2NS0A 4U7DA 1F9NA 4G9YA 4PZJA 5FO5A 1F4KA 2PN6A 3JTGA 2L54A 3EUHA 3CUQC 1ZARA 1TNTA 1R5HA 3K69A 3P7NA 1J5YA 4L5IA 5LHGA 1KQ0A 2VBYA 4IPAA 4ZZDA 1ONVA 2QQAA 1QQIA 4YIFA 3BPXA 3B73A 2G7UA 4A12A 3KCCA 2Q0OA 4IVNA 5A2QZ 4F7ZA 4S05A 3IKTA 1JGSA 1R7JA 4OMYA 3LAPA 1V4RA 1U78A 4GCVA 3D0SA 4GYGA 3FXQA 2XIGA 4E70A 5FLXZ 5L3DA 1ZG3A 5ILVA 2A07F 3R60A 1ON1A 1XGSA 3KP5A 2W24A 4L9NA 2P5VA 3SXYA 1YQAA 1U5TB 3HRSA 1W4MA 1BIBA 3Q9VA 2PG4A 1LVAA 2P6SA 2G7HA 1B4AA 3EYYA 1J2XA 2PI0A 2XAHA 1FSEA 1IN8A 2RNJA 4KMFA 1GHCA 3AAFA 2EFOA 1QGPA 2HEOA 2Z9OA 1UB9A 4A5MA 2FBKA 5CVIA 4XLNF 1LJ9A 2UXXA 2Z99A 4EMSA 1OYIA 2ZNYA 2HYGD 2HKXA 2C6YA 1DPUA 1IRFA 3G73A 1HW2A 3I58A 3TO7A 2EFQA 4RGUA 4G94A 1G3SA 3QRFF 2JT1A 2R3SA 3HIFA 4PCQA 4YG2F 5BQTA 2JPBA 1JE8A 1P6RA 4ASNA 3CO6C 4OOIA 1RZ4A 4HDVA 1IW7F 1XGMA 2D1VA 4ENKA 1XSXA 4MTDA 2WC2A 4Q5SF 3HSRA 1YW9A 4KT5C 1ZH5A 3DEUA 1W7PA 1XDSA 2B0LA 1IRGA 1U6GA 2KIFA 1IN5A 1Q1HA 3ZMTA 3RPQA 1UFMA 3E6MA 5J6XA 1TNSA 1HBXG 3GFJA 4HBLA 4OIRF 5K5RA 2DU9A 2R7FA 3WODF 4IRGA 3U1DA 5JVTA 3OV8A 1I6XA 2AS5F 5CLSA 2HGCA 5HS7A 4WF2A 3F23A 2OQGA 4EM2A 1XMAA 3FX3A 3GFLA 1I1SA 4N9IA 1B1BA 6PAXA 5F1RA 2WTEA 1FOKA 1FSHA 5L3GA 2ZMEB 1YW7A 2IVMA 1WWXA 3KFWX 3DPLC 4UHTA 2FOKA 3DP7A 5D5WB 3KP2A 2ADUA 2VC1A 3VEPA 2E7WA 1IAWA 3BP8A 5DD8A 3TOBA 3KZYA 2HYFA 3J81Z 1PP7U 3CUQB 3GUDA 3WGIA 4CDGA 3FXRA 4EM1A 1BJAA 3IWFA 1REPC 3JTHA 4ENNA 2A69F 5DDGA 2XV4S 2QLZA 5E18F 3RYPA 4EJVA 2XGXA 3LWFA 3ZP5A 2ELHA 3QOPA 4AD9A 4I7HA 2XVCA 3EETA 1G3YA 3LA3A 3IL2A 1XCVA 3PQKA 5HS9A 2F5EA 4R8HA 5CVJA 5FFXA 3SZPA 1ZHFA 3M7GA 1FLIA 5ILUA 1QZYA 3L7WA 2QBYB 3LQQA 3WGHA 1XGNA 3ZMUA 5LGNA 4KIBA 1F1ZA 3HOTA 3IKVA 1BM9A 4NB5A 1YFHA 4HA8A 4P5OA 2VN2A 3JSPA 3JAMZ 1MJ9A 2M8EA 3WTUC 1O3RA 1GXPA 1G4DA 4Q4ZF 1Z6RA 2NYXA 2JZYA 2W84A 2A5YB 3T8TA 4EJWA 3Q5FA 1ZGAA 1KU7A 3GX4X 3MZHA 5JI6A 3WE2A 2MA3A 3IC7A 3N4MA 1S8NA 1FYKA 1STZA 2K27A 4GO1A 3HHGA 3WU1B 1ZYRF 2BGCA 1P2FA 3IHUA 4HV6A 3R6SA 1BBYA 1XCBA 4RB1A 3E3VA 2MH2A 3C7JA 1HSTA 4S04A 2PEXA 4I2OA 2E1NA 1SD6A 4I02A 1FBUA 5LRSA 3ULQB 4HDUA 1KU2A 1PUEE 2DAOA 2W57A 2KJBA 1T0FA 1I5ZA 2MLGA 4A2UA 2KIMA 4G7ZF 3SHFA 5KK1A 3B02A 1G6NA 3L09A 3BJAA 1OMIA 2XAQA 1S7AA 3C3WA 3IWZA 2GXBA 4MQVA 2W25A 3EYIA 2CWEA 4LMYA 1ODDA 4P96A 2EV5A 1BIAA 4U0VA 1USTA 4LJZF 1YTYA 3VOEA 1XB4A 2D2WA 5CVUA 2ZKZA 3WTYC 1R36A 2P4WA 2EFPA 2EWNA 2E1CA 5LBQA 3QU6A 4PGGA 1FX7A 1ZRDA 3TOAA 4XRFA 2GXGA 1WRJA 4LLLA 3ELKA 2O6GE 3KP7A 1U3EM 2H94A 3F72A 2O0YA 1GVJA 1B9NA 1MGTA 3ABTA 4EJOA 3H3ZA 4JBAA 5LHHA 1J75A 1KGSA 5E1ZB 1R1TA 5F64A 4ZYGA 1TQIA 2HKOA 1YG2A 1O57A 2ACJA 4RGXA 4DQ2A 5KVRA 1W7PB 4CZZA 1WQ2A 3CUQA 5JFRA 3CLOA 3I54A 2EJRA 1R1VA 2AXLA 3TGNA 1QBJA 3RYRA 3KEOA 3HHHA 2L4AA 3DFGA 3ML6A 2CO5A 1Y0UA 4OU0A 1SFXA 2Y0MA 4LK0F 2P8TA 4CYDA 3ROUA 5AIQA 1XMKA 2IA1A 3GF2A 4AIKA 2LNBA 4ENJA 3J80Z 3K2ZA 1P4AA 1P4WA 2HQNA 5E1WA 4QLCU 4G8XA 3GW2A 5LEJA 4KA4A 2M5WA 4MEYF 2ISZA 1QZZA 4OIQF 4FX4A 1MKMA 2VC0A 5ED4A 3GXOA 3ZMVA 5E20A 4QWQA 1Z1DA 4I09A 4EQQA 3RIRA 3ABUA 2XROA 4M71A 1XSVA 3WTSC 4M72A 5L3FA 5CJ9A 5IT9K 4BHBA 1DDNA 4Q48A 1K78B 3R0AA 2PQ8A 2QM3A 3G3ZA 2CG4A 1QO0D 2BEOA 4O5VA 1SFEA 4FT8A 3DV8A 4L9VA 3CO7C 2XUBA 3C18A 2L3DA 2FSWA 1Z6TA 3T1BA 2XAJA 1TTYA 2UWMA 4FHTA 2O3FA 2RKHA 4ZH4F 4RB3C 3GLXA 4TV7A 4AIJA 4WXHA 4Q47A 3H3UA 1IN7A 2DTRA 1T6SA 4A0ZA 4WX9A 3BWGA 4HX4A 1FBQA 1KQ9A 2RQPA 3RPUA 4B8XA 1K7AA 4A5NA 4L0YB 2M30A 2NNNA 1XN7A 4HW0A 2EFNA 2MBFA 4YFXF 1S29A 1FBSA 2GQQA 4KYWA 1EV7A 5LGTA 3ISPA 5FD6A 2ZFWA 2FEZA 2FNPA 2JSCA 1D5VA 1LNWA 2FNAA 5D6EA 4RB2C 4HF2A 1I27A 1A04A 2G9WA 4CGZA 5FLXK 3K1PA 2QUFA 3BOQA 5LGUA 5CVRA 3V4GA 4L9TA 1T98A 1WKMA 2FRHA 1FC3A 4RAYA 1OR7A 3M9AA 1C0WA 3U9GA 1EH6A 3GO5A 1FZPB 2VT2A 1IXRC 1HW5A 2Q8KA 5ILSA 2EA4A 4Y13A 4L18B 4I98B 4UVAA 5HDKA 2LF8A 3RTRA 4PGHA 1FNNA 4KICA 2D1HA 2JTVA 2YX7A 2DW4A 2K02A 1H0MA 2BYVE 1CF7A 5DUKA 5L3CA 4UXNA 4DNCA 1YYVA 2MLKA 2RC4A 2A6HF 3E6DA 5DV5A 1KA8A 2K4BA 2XKOA 3I5UA 3JSOA 3ZMZA 5HLHA 5FD5A 1WI9A 2FMLA 2GIVA 3BJOA 2GWRA 2IJLA 5D8KB 3QPTA 1J59A 3ZPLA 4G6DA 3FMSA 4D0PA 4KN4X 1EH8A 4EVIA 1E17A 2QQ9A 3F6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYE A;  3DQV C;  4MEX F;  5FB2 A;  2EV0 A;  4Y17 A;  2FU4 A;  2V1D A;  3KZZ A;  4EGZ A;  2HTJ A;  4KIG A;  1T2K A;  2OZ6 A;  2V9V A;  2K4J A;  1SAX A;  5BS6 A;  5HOO A;  1BI3 A;  2RV8 A;  1JXS A;  3NRV A;  2VE9 A;  3CDH A;  1JHH A;  1T38 A;  3MCZ A;  4BHC A;  2YSR A;  2YU3 A;  3KET A;  1K78 A;  3QPH A;  5D4R A;  5K1Y A;  1J0R A;  4BH9 A;  1X3U A;  4OIO F;  1XDU A;  4JK1 X;  1ZG5 A;  1TW3 A;  3WTX C;  4RB0 A;  2YX4 A;  1EH7 A;  5DEQ A;  2RGV A;  4ZYD A;  1HXD A;  3K9T A;  3GYH X;  3LA2 A;  3GFM A;  1BOA A;  1LDD A;  3E6B A;  4CHU A;  2ZO4 A;  3KEQ A;  2COM A;  3FM5 A;  3S2W A;  1OYY A;  1FPQ A;  3QAH A;  4P9U A;  2FF4 A;  1XD7 A;  3I59 A;  5E8I A;  3FF5 A;  3COA C;  5BOX A;  4ZZL A;  4IF4 A;  2DK5 A;  2CFX A;  3ZQ7 A;  1MDM A;  1KYZ A;  4LLN A;  3F8N A;  3RKW A;  3H92 A;  3K0L A;  1Z7U A;  4MTE A;  3FMQ A;  2MD5 A;  4XBF A;  4A6D A;  3V7C A;  2V6C A;  2O61 A;  3K1N A;  3V8L A;  1P92 A;  3RKY A;  3PQJ A;  2Z3Y A;  3WTZ A;  2STT A;  3F6O A;  3T8R A;  1TQM A;  4N9H A;  1J9I A;  3RJP A;  2WV0 A;  1MD0 A;  4M9Z A;  5E17 F;  3BJ6 A;  1O3T A;  2PMU A;  5HDN A;  3GZ6 A;  1FP2 A;  2HTS A;  1IZ1 A;  4Z2Y A;  2RN7 A;  4YII A;  5IT3 A;  2VT3 A;  4IHT A;  3O6B B;  1NHA A;  1LDJ A;  1YO5 C;  1IN4 A;  4KN7 X;  4UUV A;  2LDU A;  3F8M A;  3I71 A;  3VFZ A;  3FMR A;  1FP1 D;  2IRF G;  1E2X A;  1Z05 A;  3L00 A;  4KUM A;  1W7P D;  1FY7 A;  4HF0 A;  1HSJ A;  4AWX B;  2VOP A;  3R4K A;  3HTU A;  3RKX A;  3T5X A;  2UZK A;  1F5T A;  3QP6 A;  4ESB A;  2ZBK A;  1SMY F;  4OMZ A;  3M8F A;  3P9I A;  5DCM A;  4A6E A;  3MEX A;  2LSO A;  5LRR A;  5BPD A;  2KRF A;  4A0X A;  1KU3 A;  3BY6 A;  4G7H F;  4LFU A;  2L01 A;  3WTW C;  2VOD A;  2TDX A;  5H6R A;  1SMT A;  4KDP A;  4B09 A;  3KLO A;  5TJJ A;  1IUY A;  4L5J A;  2CGP A;  1R58 A;  2DPU A;  2DQL A;  5E8G A;  4M6Y A;  2OBP A;  2P5L C;  1YS7 A;  4P55 A;  5K5O A;  1TLH B;  1KQ8 A;  4WXC A;  2HS5 A;  2M45 A;  3KP3 A;  2EFW A;  2V1X A;  2STW A;  4R79 A;  2FXA A;  2F5D A;  2VOO A;  1HKS A;  2DK8 A;  2FQ3 A;  2O8X A;  1PP8 F;  2V79 A;  4N0B A;  4AIH A;  4HAM A;  2JPC A;  4GYI A;  4HX8 A;  3MZY A;  2ETH A;  4BQA A;  2MC3 A;  1CF7 B;  1G3T A;  1XSD A;  4ZYH A;  3M1E A;  2V1U A;  3HYI A;  1BI1 A;  1WSU A;  4M9S A;  4IRH A;  3LFK A;  4LG0 A;  4LD5 A;  1ON2 A;  3I53 A;  3WTT C;  3ERE D;  2GA2 A;  4OIN F;  3TO9 A;  4RAZ A;  4XSX F;  5IT9 Z;  1H9T A;  5F6F A;  5H6Q A;  2IA0 A;  4ZYE A;  4UVB A;  5J8F A;  5HLG A;  3I0T A;  1MJA A;  1KYW A;  1D8J A;  1BN5 A;  1CGP A;  3CJN A;  3I4P A;  2XHK A;  3FHZ A;  4O3M A;  3BPV A;  2GA1 A;  2DLL A;  3EQL F;  3V8J A;  3NQO A;  1BI0 A;  1S6L A;  3E5U A;  4M74 A;  5AON A;  4HOB A;  3HOS A;  4HLX A;  2IA2 A;  5JR3 A;  2A3S A;  4U88 A;  1R23 A;  1HW1 A;  4ENM A;  3TKY A;  4GGG A;  2ZXJ A;  1RI7 A;  4NQW A;  2GZW A;  3KP4 A;  1W5T A;  1B59 A;  2FBI A;  2ZNZ A;  1P4X A;  3D5L A;  4G6Q A;  3SQN A;  3CTA A;  2OA4 A;  4ETS A;  1TBX A;  2UXN A;  4LB6 B;  3QU3 A;  1L3L A;  4UNO A;  4EGY A;  1LEB A;  2OQR A;  4EV0 A;  2QVO A;  2GAU A;  1O3Q A;  4KFC A;  2K86 A;  3BRO A;  3RDI A;  1YLF A;  5JHU A;  1O3S A;  2HR3 A;  1IXC A;  2KJC A;  2QZ8 A;  4HV5 A;  3DF8 A;  3J80 K;  4MQ9 F;  5ICE A;  2NRA C;  3BDD A;  3WGG A;  1QNT A;  4LK1 F;  1FYL A;  3HRT A;  4HZF A;  3HSE A;  3F8F A;  3V7S A;  1O7L A;  3DKW A;  2A6E F;  3L9F A;  3F22 A;  4WXD A;  3TDZ C;  2FE3 A;  2RVC A;  3N97 A;  2O03 A;  3I59 B;  3DXJ F;  3E5Q A;  3REO A;  2QEN A;  1MDM B;  1S7O A;  1R00 A;  1SFU A;  1UCR A;  5A2Q K;  2M1B A;  3TQN A;  5DYM A;  2F5C A;  4O6J A;  2XKP A;  4ON0 A;  4FX0 A;  4M9X A;  1YW8 A;  1W5S A;  4RGS A;  1T39 A;  1ZLJ A;  3GZ5 A;  5HLI A;  2L4M A;  3F8B A;  5CYV A;  2OU2 A;  2LF7 A;  5LEK A;  4AVP A;  5BMZ A;  4HF1 A;  2E7X A;  1MZB A;  3W6K B;  3E5X A;  2IPQ X;  1R1U A;  3FXU A;  1H9G A;  3KP6 A;  4LLG F;  2YR2 A;  2F2E A;  1KU9 A;  3FZV A;  2EK5 A;  2DBB A;  4L0Z B;  2QYO A;  2ZJ2 A;  4WK8 F;  2XRN A;  3CUO A;  2X0L A;  3ZN1 A;  4LGW A;  2A68 F;  2HQR A;  2K7L A;  2P5K A;  5ERI A;  2BE5 F;  4I0A A;  2X4H A;  3LST A;  3HRM A;  3OOP A;  2XAF A;  2CYY A;  4PDK A;  4GXO A;  2H6B A;  2Z5U A;  5DCM B;  2M87 A;  3MAJ A;  3FWE A;  4EM0 B;  2H09 A;  2PBI A;  5CVV A;  2XAG A;  3NEU A;  4G7O F;  3GWZ A;  3ZMD A;  1O7F A;  4M6X A;  5D6F A;  5FFZ A;  2DQR A;  3Q9S A;  2ZCW A;  2VE8 A;  2W85 A;  2EV6 A;  4H0E A;  3ZN0 A;  2H6C A;  3FM3 A;  5J8C A;  2OZU A;  4IJA A;  2EB7 A;  4CIC A;  3EDP A;  5DCF A;  2DFI A;  1HQC A;  2EA2 A;  5K5Q A;  3V7R A;  4A0Y A;  2OD5 A;  5D4S A;  1HKT A;  5L3B A;  2L02 A;  3MFK A;  2HWV A;  2P6T A;  1LB2 A;  4MNU A;  2CQK A;  1SD4 A;  2RDP A;  5L3E A;  3VOD A;  4UVC A;  4XLP F;  3VB2 A;  3L2C A;  4P9F A;  1K6O A;  1IN6 A;  2CW0 F;  3WTV C;  3J7A O;  4HX7 A;  3LA7 A;  1L0O C;  1RNL A;  3GFI A;  2BBY A;  2D45 A;  3TO6 A;  1LQ1 A;  3K1M A;  2IW5 A;  3U2R A;  4WWC A;  2PLY A;  1Z91 A;  5ICF A;  4MGR A;  2KIU A;  5TRD A;  2DPD A;  4L9J A;  4LG0 B;  2KKO A;  2VBZ A;  3MWM A;  3PFI A;  3SZT A;  3F21 A;  2HOE A;  1R5G A;  2CSO A;  2NNY A;  2QQB A;  4JQF A;  2XAS A;  4RGR A;  3F3X A;  4WCG A;  4KMU X;  5LHI A;  4EJT A;  1BC8 C;  1D8K A;  3M8E A;  2HZT A;  3TDU C;  1YIO A;  1U5T A;  2IP2 A;  1G3W A;  4YFN F;  4CO8 A;  2HDC A;  1ZN2 A;  3HTS B;  1FYM A;  1U2W A;  2LKP A;  2F5F A;  1PDN C;  4UV9 A;  2Y48 A;  3J81 K;  3WG9 A;  2VXZ A;  1OYW A;  1S3J A;  4I0B A;  4BXU A;  1OPC A;  5EEH A;  1UHM A;  1IXS B;  5AIP A;  2DO7 A;  5H20 A;  3WE3 A;  1DP7 P;  1LDK B;  1BI2 A;  1B6A A;  2R7D A;  2DI3 A;  4HQE A;  1R22 A;  2J5P A;  2VBX A;  5D5X B;  1VTN C;  3BZ6 A;  3MQ0 A;  1SD5 A;  2Y75 A;  4KNY A;  5HVQ C;  2VON A;  2VBW A;  5HS8 A;  1RIO H;  3JW4 A;  3R0J A;  1TW2 A;  2OAZ A;  5DD4 A;  4ESJ A;  1U5T C;  3F8C A;  3DPT A;  2IT0 A;  1ZRE A;  5FGM A;  3QP5 A;  1U8R A;  4M73 A;  4U7B A;  1UHW A;  1ULY A;  5D5U B;  1ZGJ A;  3ECH A;  1V3F A;  1RUN A;  4U0W A;  3HSF A;  5ICG A;  1SD7 A;  3JAM K;  3IRR A;  4MHG A;  1K79 A;  2ISY A;  5HDG A;  2H27 A;  1Z9C A;  2NAZ A;  2PJP A;  1I1G A;  3R61 A;  1QPM A;  3P9C A;  3HUG A;  4CXF A;  2J5O A;  3GVA A;  1ZRF A;  1HKQ A;  4IRI A;  3O3K A;  4EJU A;  1AWC A;  1LEA A;  1XGO A;  4Y15 A;  2WWY A;  3SFZ A;  1IF1 A;  2P7C B;  1USS A;  4BAY A;  1FWZ A;  4ESF A;  1D3Y A;  4XSZ F;  2FA5 A;  3E6C C;  4RS8 A;  4HQM A;  1DPR A;  3W6J B;  3P9K A;  3RI4 A;  3WU0 A;  1AOY A;  4OIP F;  1RUO A;  4UV8 A;  1BC7 C;  3V8K A;  5D8L B;  4IXA A;  5BPI A;  5EEG A;  1OKR A;  1DUX C;  1FT9 A;  2P7V B;  1ZG1 A;  5ICC A;  3ECO A;  2ZME A;  4K2E A;  1MJB A;  4NHJ A;  1TQP A;  4LB5 A;  3IRQ A;  4HLY A;  2YPR A;  2A61 A;  3KLN A;  2JRT A;  1ZLK A;  4I01 A;  3E97 A;  1YS6 A;  3T0Y A;  3O2P E;  4R1H A;  3ZMS A;  1J7K A;  2Q2E A;  4U0Y A;  2ESH A;  5D5V B;  2HFH A;  4BNC A;  3LAJ A;  2PMH A;  4YFK F;  2ESN A;  5E1X A;  1ZAO A;  4IHS A;  1GXQ A;  2MH9 A;  3I64 A;  4KIF A;  2PFB A;  5DUI A;  5LLQ A;  3KE2 A;  1JHF A;  2DT5 A;  2QBY A;  4BHP A;  2BV6 A;  2Z33 A;  2FBH A;  1ZRC A;  3HRU A;  1B9M A;  2QWW A;  3LQR A;  2FMY A;  3C1D A;  4BYY A;  3GEZ A;  2NS0 A;  4U7D A;  1F9N A;  4G9Y A;  4PZJ A;  5FO5 A;  1F4K A;  2PN6 A;  3JTG A;  2L54 A;  3EUH A;  3CUQ C;  1ZAR A;  1TNT A;  1R5H A;  3K69 A;  3P7N A;  1J5Y A;  4L5I A;  5LHG A;  1KQ0 A;  2VBY A;  4IPA A;  4ZZD A;  1ONV A;  2QQA A;  1QQI A;  4YIF A;  3BPX A;  3B73 A;  2G7U A;  4A12 A;  3KCC A;  2Q0O A;  4IVN A;  5A2Q Z;  4F7Z A;  4S05 A;  3IKT A;  1JGS A;  1R7J A;  4OMY A;  3LAP A;  1V4R A;  1U78 A;  4GCV A;  3D0S A;  4GYG A;  3FXQ A;  2XIG A;  4E70 A;  5FLX Z;  5L3D A;  1ZG3 A;  5ILV A;  2A07 F;  3R60 A;  1ON1 A;  1XGS A;  3KP5 A;  2W24 A;  4L9N A;  2P5V A;  3SXY A;  1YQA A;  1U5T B;  3HRS A;  1W4M A;  1BIB A;  3Q9V A;  2PG4 A;  1LVA A;  2P6S A;  2G7H A;  1B4A A;  3EYY A;  1J2X A;  2PI0 A;  2XAH A;  1FSE A;  1IN8 A;  2RNJ A;  4KMF A;  1GHC A;  3AAF A;  2EFO A;  1QGP A;  2HEO A;  2Z9O A;  1UB9 A;  4A5M A;  2FBK A;  5CVI A;  4XLN F;  1LJ9 A;  2UXX A;  2Z99 A;  4EMS A;  1OYI A;  2ZNY A;  2HYG D;  2HKX A;  2C6Y A;  1DPU A;  1IRF A;  3G73 A;  1HW2 A;  3I58 A;  3TO7 A;  2EFQ A;  4RGU A;  4G94 A;  1G3S A;  3QRF F;  2JT1 A;  2R3S A;  3HIF A;  4PCQ A;  4YG2 F;  5BQT A;  2JPB A;  1JE8 A;  1P6R A;  4ASN A;  3CO6 C;  4OOI A;  1RZ4 A;  4HDV A;  1IW7 F;  1XGM A;  2D1V A;  4ENK A;  1XSX A;  4MTD A;  2WC2 A;  4Q5S F;  3HSR A;  1YW9 A;  4KT5 C;  1ZH5 A;  3DEU A;  1W7P A;  1XDS A;  2B0L A;  1IRG A;  1U6G A;  2KIF A;  1IN5 A;  1Q1H A;  3ZMT A;  3RPQ A;  1UFM A;  3E6M A;  5J6X A;  1TNS A;  1HBX G;  3GFJ A;  4HBL A;  4OIR F;  5K5R A;  2DU9 A;  2R7F A;  3WOD F;  4IRG A;  3U1D A;  5JVT A;  3OV8 A;  1I6X A;  2AS5 F;  5CLS A;  2HGC A;  5HS7 A;  4WF2 A;  3F23 A;  2OQG A;  4EM2 A;  1XMA A;  3FX3 A;  3GFL A;  1I1S A;  4N9I A;  1B1B A;  6PAX A;  5F1R A;  2WTE A;  1FOK A;  1FSH A;  5L3G A;  2ZME B;  1YW7 A;  2IVM A;  1WWX A;  3KFW X;  3DPL C;  4UHT A;  2FOK A;  3DP7 A;  5D5W B;  3KP2 A;  2ADU A;  2VC1 A;  3VEP A;  2E7W A;  1IAW A;  3BP8 A;  5DD8 A;  3TOB A;  3KZY A;  2HYF A;  3J81 Z;  1PP7 U;  3CUQ B;  3GUD A;  3WGI A;  4CDG A;  3FXR A;  4EM1 A;  1BJA A;  3IWF A;  1REP C;  3JTH A;  4ENN A;  2A69 F;  5DDG A;  2XV4 S;  2QLZ A;  5E18 F;  3RYP A;  4EJV A;  2XGX A;  3LWF A;  3ZP5 A;  2ELH A;  3QOP A;  4AD9 A;  4I7H A;  2XVC A;  3EET A;  1G3Y A;  3LA3 A;  3IL2 A;  1XCV A;  3PQK A;  5HS9 A;  2F5E A;  4R8H A;  5CVJ A;  5FFX A;  3SZP A;  1ZHF A;  3M7G A;  1FLI A;  5ILU A;  1QZY A;  3L7W A;  2QBY B;  3LQQ A;  3WGH A;  1XGN A;  3ZMU A;  5LGN A;  4KIB A;  1F1Z A;  3HOT A;  3IKV A;  1BM9 A;  4NB5 A;  1YFH A;  4HA8 A;  4P5O A;  2VN2 A;  3JSP A;  3JAM Z;  1MJ9 A;  2M8E A;  3WTU C;  1O3R A;  1GXP A;  1G4D A;  4Q4Z F;  1Z6R A;  2NYX A;  2JZY A;  2W84 A;  2A5Y B;  3T8T A;  4EJW A;  3Q5F A;  1ZGA A;  1KU7 A;  3GX4 X;  3MZH A;  5JI6 A;  3WE2 A;  2MA3 A;  3IC7 A;  3N4M A;  1S8N A;  1FYK A;  1STZ A;  2K27 A;  4GO1 A;  3HHG A;  3WU1 B;  1ZYR F;  2BGC A;  1P2F A;  3IHU A;  4HV6 A;  3R6S A;  1BBY A;  1XCB A;  4RB1 A;  3E3V A;  2MH2 A;  3C7J A;  1HST A;  4S04 A;  2PEX A;  4I2O A;  2E1N A;  1SD6 A;  4I02 A;  1FBU A;  5LRS A;  3ULQ B;  4HDU A;  1KU2 A;  1PUE E;  2DAO A;  2W57 A;  2KJB A;  1T0F A;  1I5Z A;  2MLG A;  4A2U A;  2KIM A;  4G7Z F;  3SHF A;  5KK1 A;  3B02 A;  1G6N A;  3L09 A;  3BJA A;  1OMI A;  2XAQ A;  1S7A A;  3C3W A;  3IWZ A;  2GXB A;  4MQV A;  2W25 A;  3EYI A;  2CWE A;  4LMY A;  1ODD A;  4P96 A;  2EV5 A;  1BIA A;  4U0V A;  1UST A;  4LJZ F;  1YTY A;  3VOE A;  1XB4 A;  2D2W A;  5CVU A;  2ZKZ A;  3WTY C;  1R36 A;  2P4W A;  2EFP A;  2EWN A;  2E1C A;  5LBQ A;  3QU6 A;  4PGG A;  1FX7 A;  1ZRD A;  3TOA A;  4XRF A;  2GXG A;  1WRJ A;  4LLL A;  3ELK A;  2O6G E;  3KP7 A;  1U3E M;  2H94 A;  3F72 A;  2O0Y A;  1GVJ A;  1B9N A;  1MGT A;  3ABT A;  4EJO A;  3H3Z A;  4JBA A;  5LHH A;  1J75 A;  1KGS A;  5E1Z B;  1R1T A;  5F64 A;  4ZYG A;  1TQI A;  2HKO A;  1YG2 A;  1O57 A;  2ACJ A;  4RGX A;  4DQ2 A;  5KVR A;  1W7P B;  4CZZ A;  1WQ2 A;  3CUQ A;  5JFR A;  3CLO A;  3I54 A;  2EJR A;  1R1V A;  2AXL A;  3TGN A;  1QBJ A;  3RYR A;  3KEO A;  3HHH A;  2L4A A;  3DFG A;  3ML6 A;  2CO5 A;  1Y0U A;  4OU0 A;  1SFX A;  2Y0M A;  4LK0 F;  2P8T A;  4CYD A;  3ROU A;  5AIQ A;  1XMK A;  2IA1 A;  3GF2 A;  4AIK A;  2LNB A;  4ENJ A;  3J80 Z;  3K2Z A;  1P4A A;  1P4W A;  2HQN A;  5E1W A;  4QLC U;  4G8X A;  3GW2 A;  5LEJ A;  4KA4 A;  2M5W A;  4MEY F;  2ISZ A;  1QZZ A;  4OIQ F;  4FX4 A;  1MKM A;  2VC0 A;  5ED4 A;  3GXO A;  3ZMV A;  5E20 A;  4QWQ A;  1Z1D A;  4I09 A;  4EQQ A;  3RIR A;  3ABU A;  2XRO A;  4M71 A;  1XSV A;  3WTS C;  4M72 A;  5L3F A;  5CJ9 A;  5IT9 K;  4BHB A;  1DDN A;  4Q48 A;  1K78 B;  3R0A A;  2PQ8 A;  2QM3 A;  3G3Z A;  2CG4 A;  1QO0 D;  2BEO A;  4O5V A;  1SFE A;  4FT8 A;  3DV8 A;  4L9V A;  3CO7 C;  2XUB A;  3C18 A;  2L3D A;  2FSW A;  1Z6T A;  3T1B A;  2XAJ A;  1TTY A;  2UWM A;  4FHT A;  2O3F A;  2RKH A;  4ZH4 F;  4RB3 C;  3GLX A;  4TV7 A;  4AIJ A;  4WXH A;  4Q47 A;  3H3U A;  1IN7 A;  2DTR A;  1T6S A;  4A0Z A;  4WX9 A;  3BWG A;  4HX4 A;  1FBQ A;  1KQ9 A;  2RQP A;  3RPU A;  4B8X A;  1K7A A;  4A5N A;  4L0Y B;  2M30 A;  2NNN A;  1XN7 A;  4HW0 A;  2EFN A;  2MBF A;  4YFX F;  1S29 A;  1FBS A;  2GQQ A;  4KYW A;  1EV7 A;  5LGT A;  3ISP A;  5FD6 A;  2ZFW A;  2FEZ A;  2FNP A;  2JSC A;  1D5V A;  1LNW A;  2FNA A;  5D6E A;  4RB2 C;  4HF2 A;  1I27 A;  1A04 A;  2G9W A;  4CGZ A;  5FLX K;  3K1P A;  2QUF A;  3BOQ A;  5LGU A;  5CVR A;  3V4G A;  4L9T A;  1T98 A;  1WKM A;  2FRH A;  1FC3 A;  4RAY A;  1OR7 A;  3M9A A;  1C0W A;  3U9G A;  1EH6 A;  3GO5 A;  1FZP B;  2VT2 A;  1IXR C;  1HW5 A;  2Q8K A;  5ILS A;  2EA4 A;  4Y13 A;  4L18 B;  4I98 B;  4UVA A;  5HDK A;  2LF8 A;  3RTR A;  4PGH A;  1FNN A;  4KIC A;  2D1H A;  2JTV A;  2YX7 A;  2DW4 A;  2K02 A;  1H0M A;  2BYV E;  1CF7 A;  5DUK A;  5L3C A;  4UXN A;  4DNC A;  1YYV A;  2MLK A;  2RC4 A;  2A6H F;  3E6D A;  5DV5 A;  1KA8 A;  2K4B A;  2XKO A;  3I5U A;  3JSO A;  3ZMZ A;  5HLH A;  5FD5 A;  1WI9 A;  2FML A;  2GIV A;  3BJO A;  2GWR A;  2IJL A;  5D8K B;  3QPT A;  1J59 A;  3ZPL A;  4G6D A;  3FMS A;  4D0P A;  4KN4 X;  1EH8 A;  4EVI A;  1E17 A;  2QQ9 A;  3F6V A; 
#chains in the Genus database with same CATH topology
 4HYE A;  3DQV C;  4E7J A;  2E1M B;  1U8B A;  4IHV A;  4MEX F;  5FB2 A;  2EV0 A;  3F9K A;  4Y17 A;  1M1E B;  3K2A A;  2FU4 A;  2V1D A;  2E71 A;  4XN3 A;  3AG3 H;  4IEJ A;  1I50 J;  3KZZ A;  4EGZ A;  2HTJ A;  3OYN A;  4KIG A;  1N25 A;  1T2K A;  4IHX A;  2OZ6 A;  1V55 H;  4IQJ A;  1MBJ A;  1ITY A;  2V9V A;  3BT9 A;  3G6E I;  2K4J A;  3U1K A;  1SAX A;  1SVM A;  5BS6 A;  2JWT A;  5HOO A;  4YEJ A;  2BY3 A;  1BI3 A;  2RV8 A;  2Y0S N;  1JXS A;  1TWF J;  4IX7 A;  3NRV A;  1NG7 A;  1YOV B;  2W48 A;  3ABK H;  3OYG A;  2VE9 A;  2R7S A;  3HM5 A;  3CDH A;  2Y9Z A;  1JHH A;  3S32 A;  1G2H A;  1T38 A;  3MCZ A;  1TWG J;  4BHC A;  3J7Y J;  2YSR A;  3OYA A;  2YU3 A;  2JVG A;  2F4O B;  1X3Z B;  3KET A;  2ZSI B;  2EBI A;  3QPH A;  5D4R A;  1K78 A;  2B9S A;  2BY0 A;  5K1Y A;  1J0R A;  4BH9 A;  1X3U A;  1X2N A;  2YU9 J;  4OIO F;  2NVU B;  2WAF A;  1XDU A;  4JK1 X;  4BBS J;  1ZG5 A;  1IDZ A;  4KT6 A;  4C3H J;  1SFO J;  1VZ0 A;  4D5C A;  1TW3 A;  3WTX C;  3OIO A;  5M5X J;  3LSJ A;  3CCV I;  1MNE A;  2I10 A;  4RB0 A;  2YX4 A;  5GP9 A;  3VYR B;  1RPW A;  3VYS B;  4HSR A;  4A3M J;  2CUJ A;  1EH7 A;  3TP0 A;  5DEQ A;  2RGV A;  3OYB A;  1KON A;  4ZYD A;  4RAF A;  2HPI A;  2ZB9 A;  3DU5 A;  2KFD A;  1PVE A;  2XB5 A;  1HXD A;  2H1K A;  3K9T A;  4Y7N J;  3JRG A;  3GYH X;  3FKI J;  2EIJ H;  3LA2 A;  2OTJ I;  3GFM A;  2CJJ A;  1BOA A;  1P9Q C;  4B43 A;  4XRM A;  3SJM A;  2PJR B;  2F6C A;  1LDD A;  3E6B A;  1VQK I;  3RZD J;  3CJQ B;  4CHU A;  4E7L A;  2ZO4 A;  2JA5 J;  3KEQ A;  2COM A;  2YS9 A;  3VSL A;  3FM5 A;  3S2W A;  1OYY A;  1Z7L A;  1FPQ A;  1JUP A;  3QAH A;  2NVY J;  4RLQ A;  4P9U A;  1SFK A;  2QKM B;  3UR3 C;  4NC7 A;  1YJ9 I;  1ZEL A;  3CCQ I;  1Z67 A;  2XPV A;  2FF4 A;  1I6H J;  1XD7 A;  3PM1 A;  1WH7 A;  2Z2S B;  1DU0 A;  3I59 A;  5E8I A;  1HCR A;  3FF5 A;  4FAS D;  3COA C;  3MKL A;  5BOX A;  4ZZL A;  4IF4 A;  3ABL H;  2DK5 A;  2CFX A;  3ZQ7 A;  1MDM A;  1KYZ A;  1PUF B;  1X4O A;  1WI3 A;  3F8N A;  4FE7 A;  4LLN A;  3RKW A;  2X1D A;  3H92 A;  3M8J A;  3K0L A;  3L2R A;  3DTI A;  2DA1 A;  2O7O A;  1Z7U A;  4MTE A;  3FMQ A;  2M9H A;  1EJ9 A;  2G0E A;  2MD5 A;  4XBF A;  3K70 C;  4A6D A;  3V7C A;  5EZG A;  2V6C A;  3HKZ A;  3CCM I;  3TMO A;  2O61 A;  3K1N A;  3V8L A;  3DBH B;  1P92 A;  1MND A;  2JUC A;  3RKY A;  3PQJ A;  2Z3Y A;  1W36 C;  2XF6 A;  3WTZ A;  3G4S I;  2STT A;  3F6O A;  3T8R A;  1TQM A;  4UY8 I;  2E2J J;  3RZO J;  4DBR A;  4N9H A;  1MMD A;  1J9I A;  3RJP A;  2WV0 A;  1MD0 A;  2XAU A;  3W2W A;  3D1N I;  2HDD A;  4M9Z A;  5E17 F;  2L5Q A;  3BJ6 A;  1K4S A;  1O3T A;  1FIA A;  1JUS A;  2PMU A;  2WAE A;  5HDN A;  3GZ6 A;  1FP2 A;  2HTS A;  5BNG A;  3BR3 A;  1IZ1 A;  3FDY A;  4Z2Y A;  2K9S A;  2RN7 A;  3FXM A;  4YII A;  2BHY A;  2MAB A;  5IT3 A;  5JVG F;  2VT3 A;  4IHT A;  1E3H A;  3MVP A;  3HXL A;  3O6B B;  1NHA A;  1LDJ A;  2O9L A;  5DM7 F;  1YO5 C;  2QSG X;  1IN4 A;  3RQI A;  5EDN A;  4KN7 X;  4UUV A;  2LDU A;  3F8M A;  4DW6 A;  3I71 A;  3VFZ A;  2R93 J;  3FMR A;  1FP1 D;  4DIQ A;  2IRF G;  4CYC B;  1E2X A;  2HQ5 A;  1Z05 A;  2VJ5 A;  1R49 A;  3L00 A;  4KUM A;  3OS2 A;  1W7P D;  1VI0 A;  4XOP A;  1FY7 A;  5IY5 H;  4HF0 A;  1HSJ A;  1V5E A;  4AWX B;  2VOP A;  1D5Y A;  3R4K A;  3HTU A;  2LBF B;  3RKX A;  4A3B J;  1HLV A;  1B8I B;  3T5X A;  2UZK A;  1F5T A;  3QP6 A;  4ESB A;  2ZBK A;  5KAI C;  1ETW A;  1SMY F;  2DFH A;  4OMZ A;  3M8F A;  5F04 A;  3P9I A;  5DCM A;  1YI2 I;  4A6E A;  4CCN A;  3AFH A;  3MEX A;  2LSO A;  3AG1 H;  4XKW A;  2HPM A;  5LRR A;  5BPD A;  4MIM A;  2KRF A;  4A0X A;  2AQF A;  1KU3 A;  5F27 A;  3BY6 A;  1X4P A;  4IOA F;  4G7H F;  4Y3O A;  4DZP A;  2XB0 X;  4LFU A;  4N4O B;  2L01 A;  4XLF A;  1POG A;  3WTW C;  2VOD A;  2TDX A;  2E36 A;  2OCC H;  3DKY A;  5H6R A;  1SMT A;  4KDP A;  4B09 A;  5KNL A;  3KLO A;  2WB1 N;  5TJJ A;  5FRN A;  2VIX A;  4FTH A;  3L2V A;  1IUY A;  2DMP A;  4RM3 A;  4L5J A;  2CGP A;  1R58 A;  4I76 A;  5J3L A;  1FTZ A;  5GAH J;  2V6E A;  4B4C A;  5LD2 C;  2M4G A;  2DPU A;  2DQL A;  1IRX A;  4H4K C;  1YIT I;  5E8G A;  5FJ8 J;  4M6Y A;  2OBP A;  2P5L C;  3S1N J;  3IP4 B;  1YS7 A;  4P55 A;  5K5O A;  1TLH B;  1KQ8 A;  4WXC A;  2HS5 A;  2M45 A;  3KP3 A;  3ZXS A;  1VQ5 I;  2PMZ N;  2EFW A;  2V1X A;  3P5J A;  1MBF A;  2I5U A;  2STW A;  2DMN A;  3HKZ N;  4RMN A;  4R79 A;  2FXA A;  4J00 A;  2F5D A;  5K7Z A;  1JKR C;  4B44 A;  1BA5 A;  2VOO A;  1K61 A;  1HKS A;  2E19 A;  3CZ6 A;  3Q0W A;  2DK8 A;  3TP3 A;  2FQ3 A;  2O8X A;  1PP8 F;  2V79 A;  4N0B A;  4AIH A;  4HAM A;  2JPC A;  3IH3 A;  4GYI A;  4HX8 A;  3MZY A;  2ETH A;  3ONQ A;  2XSJ C;  4BQA A;  3HG9 A;  2MC3 A;  1CF7 B;  1G3T A;  1XSD A;  4ZYH A;  4ZTJ A;  1WZ2 A;  2MFZ A;  3M1E A;  1IGN A;  5M3M J;  2V1U A;  2AHQ A;  3HYI A;  1UZC A;  1BI1 A;  4PJL A;  1WSU A;  4M9S A;  3GTP J;  1TWH J;  2BY2 A;  2ZJQ F;  2ZXI A;  3ASO H;  2DOF A;  4IRH A;  3LFK A;  3Q0V A;  4LG0 A;  1LE8 B;  3K7A J;  4LD5 A;  1AU7 A;  1ON2 A;  2LMD A;  3I53 A;  3WTT C;  2L7M P;  3ERE D;  2GA2 A;  4OIN F;  3TO9 A;  2R7U A;  4RAZ A;  4XSX F;  5IT9 Z;  1H9T A;  5F6F A;  5H6Q A;  2IA0 A;  4ZYE A;  4UVB A;  5J8F A;  5HLG A;  2WY7 Q;  3I0T A;  4BL0 B;  1MJA A;  5IPA A;  3BCA A;  1KYW A;  1D8J A;  1BN5 A;  1MNM C;  1CGP A;  1RR8 C;  3G71 I;  3V42 A;  3FK7 A;  3CJN A;  3I4P A;  1FMW A;  2VKD A;  2GOX B;  1U9N A;  2Y31 A;  3CMA I;  3AL0 C;  2XHK A;  3ZQG A;  3FHZ A;  4O3M A;  3BPV A;  2GA1 A;  2DLL A;  3EQL F;  2M7B A;  3V8J A;  3NQO A;  2BHZ A;  4DYR A;  5FRO A;  1BI0 A;  1R71 A;  1S6L A;  3ZQI A;  1JI8 A;  1VQL I;  3CJT B;  3E5U A;  1T56 A;  4M74 A;  5AON A;  3LSP A;  4HOB A;  3HOS A;  4HLX A;  3KX2 A;  2IA2 A;  5JR3 A;  2A3S A;  2ZME C;  4U88 A;  4XKB A;  1R23 A;  1HW1 A;  1BOB A;  4ENM A;  3TKY A;  2BVL A;  4GGG A;  3TL4 X;  3K4N A;  2ZXJ A;  1A35 A;  1BW6 A;  1RI7 A;  4NQW A;  5TIS C;  3FXO A;  1MW7 A;  4B1R A;  1TT5 B;  2F48 A;  1MMS A;  3OYH A;  3W3C A;  4XIC A;  2GZW A;  3RQ4 A;  3KP4 A;  1W5T A;  1B59 A;  2FBI A;  2ZNZ A;  3HOV J;  4J01 A;  1P4X A;  3JRI A;  3D5L A;  4G6Q A;  3BTJ A;  3SQN A;  4YRV A;  3CTA A;  2OA4 A;  1T8I A;  3TBI A;  4ETS A;  3HDD A;  2V9K A;  1TBX A;  4CUG A;  2UXN A;  3BTL A;  4LB6 B;  3QU3 A;  2FUG 2;  1L3L A;  1FJL A;  4EGY A;  4UNO A;  1LEB A;  2OQR A;  4XM3 A;  4MFE A;  4EV0 A;  2QVO A;  2GAU A;  1O3Q A;  4KFC A;  2K86 A;  3BR5 A;  4I99 C;  2X51 A;  4M3F A;  3BRO A;  3MKY B;  3X2Q H;  1GV2 A;  2KMU A;  3RDI A;  1WJE A;  1YLF A;  5JHU A;  2ECC A;  1O3S A;  2HR3 A;  1IXC A;  2KIS A;  4RLF A;  5IOZ A;  3K6G A;  2KJC A;  3GTM J;  1A31 A;  1WJ5 A;  2ECB A;  2QZ8 A;  4HV5 A;  3DF8 A;  3J80 K;  5E3L A;  4MQ9 F;  3W2V A;  5ICE A;  2NRA C;  2R92 J;  3BDD A;  3WGG A;  1QNT A;  3I4M J;  4LK1 F;  1FYL A;  3MN2 A;  4D9J A;  2LD5 A;  1PYV A;  4E4H A;  1LKX A;  3HRT A;  4HZF A;  4A3C J;  3HSE A;  3F8F A;  3V7S A;  1O7L A;  5E3N A;  1GUU A;  3EUH C;  3H9J A;  3RKQ A;  4LIU A;  3DKW A;  2A6E F;  3L9F A;  3F22 A;  3HPG A;  4WXD A;  3TDZ C;  2FE3 A;  3G1L A;  2RVC A;  3JRD A;  3N97 A;  2O03 A;  3I59 B;  3DXJ F;  3E5Q A;  2N8G A;  2DJI A;  3REO A;  2V7F A;  2QEN A;  1MDM B;  4KIS A;  4F92 B;  4X6A J;  1S7O A;  1R00 A;  1U9O A;  2EIN H;  3I55 I;  2EZH A;  1SFU A;  1UCR A;  5A2Q K;  2M1B A;  3TQN A;  5DYM A;  2F5C A;  2OF7 A;  2A05 A;  2JRM A;  4O6J A;  1D1C A;  2XKP A;  3LSG A;  4ON0 A;  2RNG A;  4CCK A;  4FX0 A;  4M9X A;  1YW8 A;  4NUB A;  1W5S A;  4RGS A;  1MBH A;  2RAE A;  1ZLJ A;  1OCP A;  1T39 A;  2O8K A;  3GZ5 A;  5HLI A;  4D7M A;  2L4M A;  2LRE A;  3F8B A;  5CYV A;  2OU2 A;  5M5Y J;  2LF7 A;  5LEK A;  5EG0 B;  1IRZ A;  2HDW A;  2M0C A;  4AVP A;  4YIR X;  5BMZ A;  3W6V A;  4HF1 A;  2NOJ B;  5CQG A;  1VQ6 I;  2NS8 A;  2E7X A;  4FIS A;  3GTO J;  3CDL A;  1MZB A;  3W6K B;  2LVS A;  3E5X A;  1XPX A;  2IPQ X;  1OJL A;  2CQN A;  3PFY A;  1R1U A;  1RR7 A;  5A2Q R;  3FXU A;  1H9G A;  3KP6 A;  4LLG F;  2P81 A;  2YR2 A;  2F2E A;  1KU9 A;  4P1W A;  2BY1 A;  3FZV A;  4ZJZ A;  2GXA A;  2EK5 A;  1QHH D;  2DBB A;  3FXL A;  4L0Z B;  1Z77 A;  2QYO A;  2ZJ2 A;  3A0H C;  2XC7 A;  4WK8 F;  2EIL H;  4BE0 A;  2DOA A;  2FJ1 A;  3BG9 A;  5FKO A;  4AM3 A;  5FLX R;  2XRN A;  1GVD A;  3FK6 A;  3L1P A;  1HF0 A;  3CUO A;  2X0L A;  3ZN1 A;  4LGW A;  3BG7 A;  1S9H A;  1TT0 A;  2A68 F;  2HQR A;  2K7L A;  2P5K A;  5ERI A;  5C44 J;  2BE5 F;  2DYS H;  2LFB A;  3BG3 A;  1SC7 A;  1RES A;  5E79 C;  4I0A A;  2X4H A;  3LST A;  3HRM A;  3OOP A;  2Z1D A;  3QYB A;  1MSF C;  2XAF A;  2CYY A;  4MFD A;  1R6R A;  4CZC A;  4PDK A;  4GXO A;  2H6B A;  2Z5U A;  4DGW B;  5DCM B;  2M87 A;  3MAJ A;  3ZCO A;  1VQ4 I;  3FWE A;  4EM0 B;  2DFF A;  2H09 A;  2PBI A;  5CVV A;  1Y1V J;  2XAG A;  2LOO A;  3NEU A;  4G7O F;  3GWZ A;  5F08 A;  5TGT A;  1O7F A;  4M6X A;  3ZMD A;  5D6F A;  5FFZ A;  3CCU I;  3HOZ J;  1OLT A;  3QPL A;  2DQR A;  2UV1 A;  2VJJ A;  1VQ9 I;  3Q9S A;  2ZCW A;  2X6Y A;  2VE8 A;  2F4M B;  2EV6 A;  2JK3 A;  2W85 A;  3ZN0 A;  2CU7 A;  4H0E A;  1LE8 A;  2A6T A;  2H6C A;  2VL8 A;  3FM3 A;  5J8C A;  1FTT A;  1ORK A;  2OZU A;  4IJA A;  1D1A A;  2EB7 A;  2CS3 A;  3C2G A;  4JYK A;  3HBL A;  3I56 I;  4CIC A;  4E7I A;  4BE1 A;  1RKT A;  2VAS A;  3EDP A;  5DCF A;  2R5Z A;  2DFI A;  1HQC A;  1K4T A;  2EA2 A;  2DXI A;  5K5Q A;  3V7R A;  4A0Y A;  2ME6 A;  2ICW G;  2OD5 A;  1D0Z A;  5D4S A;  1HKT A;  4HRI A;  3BR2 A;  2XF5 A;  3OSG A;  5L3B A;  1YJW I;  2L02 A;  2AO9 A;  3MFK A;  2HXO A;  2HWV A;  1MBG A;  2P6T A;  4RBO A;  1LB2 A;  1UG2 A;  4MNU A;  2R0Q C;  2CQK A;  5DTD A;  1ETQ A;  4UUT A;  1SD4 A;  2CFO A;  2RDP A;  3AL0 B;  3BQY A;  3CF5 F;  5L3E A;  2DA6 A;  1R4N B;  3VOD A;  1ETO A;  4UVC A;  4XLP F;  1XMX A;  3VB2 A;  4BUP A;  3L2C A;  3CCY A;  3NWT A;  2IEK A;  4P9F A;  2KZG A;  1K6O A;  2P0T A;  5M3F J;  1IN6 A;  2CW0 F;  3WTV C;  1AHD P;  3J7A O;  4HX7 A;  3LA7 A;  1L0O C;  2R7O A;  2M8G X;  3S1Q J;  1RNL A;  3GFI A;  3GTK J;  2HOA A;  2OC6 A;  2BBY A;  2D45 A;  3TO6 A;  1LQ1 A;  2OTL I;  1OCO H;  2WAQ A;  3K1M A;  1VQN I;  2IW5 A;  4ZC3 A;  3U2R A;  4WWC A;  1RQ6 A;  3BR6 A;  2PLY A;  2QSF X;  2K9N A;  3DTE A;  1YIJ I;  1Z91 A;  1U0J A;  4BQN A;  4PSW A;  5ICF A;  4MGR A;  5GAE J;  2KIU A;  4XRS A;  2EZL A;  2M3A A;  3VDX A;  3DPU A;  2HOT A;  5TRD A;  2E5Z A;  2DPD A;  4L9J A;  4LG0 B;  5GTI C;  4PSX A;  2KKO A;  2VBZ A;  1YE9 A;  3MWM A;  4FET A;  4U87 A;  3CES A;  3PFI A;  3SZT A;  2LRD A;  2Q2E B;  3F21 A;  2HOE A;  3BR1 A;  1NG6 A;  2KLO A;  3JRB A;  1R5G A;  3OMY A;  2R7V A;  1DQU A;  2CSO A;  2JMW A;  2NNY A;  2QQB A;  4JQF A;  4C2T A;  2DMT A;  1S72 I;  2XAS A;  4RGR A;  3F3X A;  1ZTR A;  2WBM A;  3ASN H;  4BJT A;  4WCG A;  3TED A;  4XK4 A;  2HNH A;  4KMU X;  2XPW A;  5LHI A;  4EJT A;  5B1B H;  1BC8 C;  2LLK A;  1D8K A;  4RAG A;  2M35 A;  1X1B A;  2HZT A;  2CW7 A;  3M8E A;  2XGC A;  4M3G A;  4GDF A;  3TDU C;  1YIO A;  3DTK A;  1U5T A;  2IP2 A;  3DEW A;  1G3W A;  2ELJ A;  1MIJ A;  3J7A Y;  2ZJR F;  4A3D J;  4YFN F;  1DP3 A;  4XKV A;  1X1A A;  2COB A;  4CO8 A;  3M1C A;  2FX0 A;  2HU9 A;  2HDC A;  1ZN2 A;  1IO2 A;  3HTS B;  1FYM A;  2DDB A;  3OR1 C;  1U2W A;  4NQW B;  2LKP A;  1H8A C;  2DT7 B;  2ZFU A;  2F5F A;  3RPU D;  1PDN C;  3O8G A;  4UV9 A;  2Y48 A;  3J81 K;  3WG9 A;  3QYE A;  4XOR A;  2VXZ A;  1OYW A;  1S3J A;  4I0B A;  4BXU A;  4C2M J;  1OPC A;  3IH4 A;  4GRI A;  5EEH A;  1UHM A;  1IXS B;  5AIP A;  3S1M J;  2DO7 A;  1N77 A;  2DMU A;  1SAU A;  3OYJ A;  3JRH A;  5H20 A;  5J40 A;  2MUN A;  1WPK A;  3WE3 A;  2WA0 A;  3EPZ A;  1DP7 P;  1LDK B;  1BI2 A;  1B6A A;  1PJR A;  2R7D A;  3FXK A;  2DI3 A;  4F55 A;  4HQE A;  1R22 A;  1RET A;  2J5P A;  1BW5 A;  2VBX A;  5D5X B;  4Z6Y A;  1VTN C;  3BZ6 A;  5EG0 A;  3MQ0 A;  3UNG C;  2IBD A;  1SD5 A;  3J81 R;  2Y75 A;  3FBN B;  4KNY A;  5HVQ C;  2VON A;  3H5A A;  4F93 B;  1EA3 A;  2VBW A;  2M7A A;  1IV8 A;  5HS8 A;  1IDY A;  2WAQ N;  1RIO H;  2NVT J;  2XRL A;  3JW4 A;  1TW2 A;  2OAZ A;  3R0J A;  5DD4 A;  2CW8 A;  4ESJ A;  1U5T C;  2HXI A;  3F8C A;  3DPT A;  2IT0 A;  3OIP A;  3ZQC A;  1ZRE A;  4LG3 A;  3G1O A;  1VND A;  2HQA A;  1OQY A;  5KAF C;  5FGM A;  2GIZ A;  3GME A;  3QP5 A;  4BXF A;  4EAT A;  5KHD A;  1U8R A;  3DEE A;  4M73 A;  4U7B A;  1UHW A;  2V1N A;  1ULY A;  4JP0 A;  5D5U B;  1JTY A;  1ZGJ A;  3AKZ A;  3ECH A;  1V3F A;  4D1Q A;  1RUN A;  4U0W A;  3HSF A;  1MBE A;  4M3E A;  4KJZ A;  2NVX J;  3O8H A;  5ICG A;  3HL2 A;  3PO3 J;  1SD7 A;  3JAM K;  3IRR A;  4MHG A;  4BE2 A;  5GAD J;  3I3L A;  3ESW B;  2VQG A;  4CSW A;  1V5G A;  1K79 A;  5H2F C;  2CUE A;  2ISY A;  2IAI A;  5HDG A;  2H27 A;  4ZTF A;  1Z9C A;  2NAZ A;  2PJP A;  3IAM 2;  1I1G A;  1AKH A;  2F5V A;  3R61 A;  3H5N A;  1QPM A;  9ANT A;  1YHQ I;  2CRG A;  2L9R A;  3P9C A;  3HUG A;  1TWA J;  5FKN A;  4CXF A;  2J5O A;  3GVA A;  1ZRF A;  1DGR M;  1HKQ A;  1QU3 A;  4IRI A;  3OS1 A;  3O3K A;  2R7Z J;  3JAM R;  1N75 A;  1ETX A;  3BG6 A;  1S5L C;  3PNT A;  4EJU A;  1AWC A;  1LEA A;  1XGO A;  4F3Q A;  4Y15 A;  1E3O C;  2WWY A;  3SFZ A;  1IF1 A;  2P7C B;  3SEQ A;  3OIQ A;  1USS A;  4XMY A;  3OYI A;  2O5R A;  1R4M B;  2AXT C;  2VLA A;  5CKT A;  1ZGW A;  4BAY A;  1FWZ A;  4ESF A;  3OL4 A;  1D3Y A;  4XSZ F;  1D0Y A;  1RC9 A;  5IYC J;  2FA5 A;  3E6C C;  4BQQ A;  4RS8 A;  5J4V A;  4HQM A;  1T0F C;  1DPR A;  3W6J B;  3P9K A;  3K4J A;  4RM2 A;  3RI4 A;  3WU0 A;  1AOY A;  2ID6 A;  2CV2 A;  3SDB A;  3SEZ A;  4OIP F;  1RUO A;  4UV8 A;  1XS9 A;  1BC7 C;  3V8K A;  5D8L B;  4HG2 A;  1GV5 A;  4IXA A;  1VF9 A;  2KHM A;  2IS1 A;  3TW6 A;  5B66 C;  5BPI A;  4AVZ A;  3S2D J;  5EEG A;  2V9P A;  1OIS A;  1OKR A;  1A36 A;  1DUX C;  1FT9 A;  2P7V B;  1ZG1 A;  5ICC A;  4ZDO A;  3ECO A;  3LSI A;  2ZME A;  4K2E A;  3K10 A;  1MJB A;  4NHJ A;  3DKX A;  1TQP A;  2IGM A;  3A1Y A;  4LB5 A;  4XLA A;  1VQP I;  1W1W E;  1X58 A;  3IRQ A;  3BQZ A;  1J09 A;  2H1L A;  4HLY A;  3CME I;  2KL4 A;  2YPR A;  2A61 A;  1WJC A;  3KLN A;  2JRT A;  1ZLK A;  4G6T B;  3BR0 A;  2XPU A;  2Y9Y A;  3A02 A;  3LMM A;  4I01 A;  3E97 A;  1YS6 A;  3T0Y A;  3ABM H;  3O2P E;  4R1H A;  4YEL A;  4Y4R A;  4UB8 C;  3ZMS A;  1APL C;  3QQA A;  4DBQ A;  1J7K A;  2DMQ A;  4C9Y A;  4D5F A;  1NK2 P;  2Q2E A;  2QCO A;  4U0Y A;  3JCU C;  2K5C A;  2R5Z B;  2DA2 A;  2ESH A;  1TP4 A;  2DT6 A;  5D5V B;  2VKE A;  1VQ7 I;  3CMM A;  2HFH A;  5J1R A;  4BNC A;  3LAJ A;  4F91 B;  3K70 D;  3L2Q A;  1MMG A;  2PMH A;  4YFK F;  2ESN A;  5E1X A;  1ZAO A;  1H88 C;  4IHS A;  1GXQ A;  2MH9 A;  5DM6 F;  3H5R A;  5C4J J;  4A3E J;  3I64 A;  2F4I A;  2X98 A;  4KIF A;  1XC5 A;  2PFB A;  5DUI A;  3OY9 A;  5IYD J;  5LLQ A;  3KE2 A;  1JKO C;  1I3A A;  4A3K J;  1JHF A;  2DT5 A;  3ZOB A;  2E2H J;  3NAR A;  2VKV A;  2QBY A;  1QRY A;  3OYC A;  4BHP A;  2E1M C;  2NOG A;  3HB9 A;  2BV6 A;  2Z33 A;  4HEA 2;  2FBH A;  1ZRC A;  3HRU A;  1B9M A;  3GBG A;  2QWW A;  3LQR A;  1MH4 A;  2FMY A;  3C1D A;  4A93 J;  3MMY B;  2DCE A;  4BYY A;  4GFB A;  3GEZ A;  2NS0 A;  3GTL J;  4DYQ A;  4U7D A;  1F9N A;  1NH3 A;  3VWB A;  4G9Y A;  4PZJ A;  4B3X A;  5FO5 A;  1F36 A;  4L5E A;  4E7S A;  1F4K A;  1ZK8 A;  2PN6 A;  3JTG A;  2L54 A;  3PJR A;  2K3F A;  3CUQ C;  3EUH A;  1ZAR A;  5CPR B;  1VQ8 I;  1TNT A;  5FLM J;  1R5H A;  1VQM I;  2DYR H;  3K69 A;  3P7N A;  1J5Y A;  4L5I A;  5LHG A;  1KQ0 A;  1X1C A;  2Q1Z B;  2VBY A;  4IPA A;  4ZZD A;  3S3N A;  1ONV A;  2QQA A;  1QQI A;  4YIF A;  3BPX A;  1ENH A;  2H8W A;  1MSE C;  4C2U A;  3B73 A;  2G7U A;  3LL7 A;  4A12 A;  3BCB A;  3KCC A;  2R7Q A;  2Q0O A;  5B3S H;  5CQE A;  2ME0 A;  2L7Z A;  4BY1 J;  2W4S A;  1Y8R B;  2L7F P;  2W00 A;  4IVN A;  4F7Z A;  4S05 A;  1JGS A;  5A2Q Z;  3IKT A;  1W0U A;  1TC3 C;  4HST A;  1R7J A;  4N4N B;  3GCM A;  5B1A H;  4OMY A;  4MO7 A;  3LAP A;  1V4R A;  1U78 A;  1ETV A;  1DGW Y;  4GCV A;  3D0S A;  4GYG A;  1EKE A;  2VXD A;  3FXQ A;  4IOC F;  2CMP A;  2XIG A;  2XSD C;  4E70 A;  5FLX Z;  4OWR B;  5L3D A;  4NC8 A;  3GTQ J;  1ZG3 A;  5ILV A;  2KP6 A;  3M3Y J;  2A07 F;  2LKS A;  3W2A A;  3R60 A;  1ON1 A;  2RQQ A;  1OCR H;  3H0G J;  1XGS A;  4IQ4 A;  3KP5 A;  2W24 A;  3BTC A;  4L9N A;  3ZR8 X;  1BR1 A;  5FRM A;  3QPS A;  2P5V A;  3SXY A;  3BTI A;  1YQA A;  4BDZ A;  1U5T B;  2JA6 J;  4QPQ A;  3JR9 A;  2A5W A;  3HRS A;  2KQR A;  1W4M A;  3ZQL A;  2L9S A;  1UAA A;  2DDA A;  1BIB A;  3WHB A;  3Q9V A;  2PG4 A;  4IHY A;  2KPM A;  2DN0 A;  1LVA A;  2P6S A;  2G7H A;  4AID A;  1B4A A;  3EYY A;  1B72 A;  2LR8 A;  3PIO F;  2OJE D;  2MZ4 A;  1J2X A;  4QSH A;  1JGG A;  3SDG A;  2DA3 A;  3ERM A;  5LFA A;  3HEF A;  1NK3 P;  3HOX J;  2PI0 A;  2XAH A;  1FSE A;  1IN8 A;  2RNJ A;  3KPH A;  3S1R J;  4KMF A;  1GHC A;  3AAF A;  2EFO A;  1QGP A;  2HEO A;  2Z9O A;  1T95 A;  3J80 R;  2WY8 Q;  2LTP A;  3N05 A;  1UB9 A;  2LYC A;  4A5M A;  2FBK A;  5CVI A;  1IC8 A;  5FKL A;  3CCJ I;  4XLN F;  1LJ9 A;  2UXX A;  2Z99 A;  2KIQ A;  5EGO A;  4QIW N;  4EMS A;  2V26 A;  3IH2 A;  1CQT A;  1OYI A;  5K7F A;  2ZNY A;  2HYG D;  4QTR A;  2HKX A;  5F0H A;  2C6Y A;  5K7H A;  4ZDL A;  3ZQH A;  1E3P A;  2B63 J;  1JT0 A;  1DPU A;  3DWL E;  3ZGK A;  1IRF A;  5IYB J;  3G73 A;  4CCO A;  2L9V A;  3NWS A;  3PSI A;  1HW2 A;  3A01 A;  3I58 A;  3TO7 A;  4ABZ A;  2EFQ A;  4RGU A;  3CF2 A;  4G94 A;  3K4C A;  1G3S A;  4A3J J;  1Y39 A;  1WJA A;  3BLY A;  3HJE A;  1ZQ3 P;  3PO2 J;  3LOC A;  3CLQ A;  2JQ7 A;  3QRF F;  4DZJ A;  1I3Q J;  3S3M A;  1V5F A;  2JT1 A;  2VQL A;  2R3S A;  2H8R A;  3HIF A;  2Y0S A;  4PJM A;  4PCQ A;  1OCZ H;  4LIT A;  4YG2 F;  3GTJ J;  5BQT A;  1WJD A;  2JPB A;  3EUA A;  4BJ5 C;  4RDU A;  1P6R A;  1JE8 A;  2ZC2 A;  4ASN A;  2IXS A;  3CO6 C;  4OOI A;  4ZDP A;  1JJ6 C;  5JHF A;  3JRA A;  1RZ4 A;  3LFU A;  4CH7 A;  4HDV A;  1IW7 F;  4G12 A;  1XGM A;  1X1D A;  2D1V A;  2LP0 A;  4ENK A;  2BZT A;  3CCL I;  1XSX A;  2CQQ A;  3A2K A;  2M2E A;  2BW3 A;  2BVM A;  4MTD A;  2WC2 A;  1AKH B;  3H0D A;  4Q5S F;  3HSR A;  1YW9 A;  2E60 A;  2K9Q A;  4BS9 A;  4KT5 C;  4II3 A;  2W7N A;  3DEU A;  1W7P A;  3HUG B;  1XDS A;  1ZH5 A;  2B0L A;  1IRG A;  4OAZ A;  1U6G A;  4BGD A;  2KIF A;  3VYU B;  1IN5 A;  3ZRG A;  3CCR I;  2EIM H;  1Z0X A;  1Q1H A;  1Y8Q B;  4AU7 A;  3ZMT A;  4UUS A;  2JN6 A;  3RPQ A;  1UFM A;  1UMQ A;  3E6M A;  5IP7 J;  1X1P A;  2QA4 I;  1N78 A;  5J6X A;  1TNS A;  1HBX G;  2VB6 A;  1YJN I;  3GFJ A;  4HBL A;  4OIR F;  5HNF A;  2M34 A;  5K5R A;  2DU9 A;  2R7F A;  4XL9 A;  3H35 A;  3WOD F;  2QSH X;  4IRG A;  3U1D A;  5JVT A;  1JKP C;  1XX5 A;  1RKW A;  3QYF A;  4BQO A;  4V19 K;  1JUM A;  2K3P A;  3OV8 A;  5GPC A;  1I6X A;  1EF4 A;  4PFO A;  3A0B C;  2AS5 F;  4XID A;  1FOY A;  3GZN B;  1QVU A;  5CLS A;  2HGC A;  5HS7 A;  4WF2 A;  1RRJ A;  3F23 A;  2OQG A;  4EM2 A;  1K83 J;  1XMA A;  1R9T J;  3FX3 A;  3OYL A;  1WCM J;  1WVR A;  4M3D A;  3GFL A;  1AA7 A;  1I1S A;  2TCT A;  4PJ0 C;  4N9I A;  1B1B A;  2B7E A;  6PAX A;  2X6O A;  5F1R A;  2E35 A;  5HOD A;  3S8P A;  2WTE A;  1FOK A;  1FSH A;  1FEX A;  1ETY A;  5L3G A;  2ZME B;  1YW7 A;  2IVM A;  3EUK L;  1WWX A;  3DLA A;  3KFW X;  4F52 A;  3WHC A;  3DPL C;  4UHT A;  3PIP F;  2IS2 A;  2FOK A;  3MZ8 A;  3DP7 A;  5D5W B;  2X1E A;  3KP2 A;  3M07 A;  2ADU A;  4W1U A;  2MGQ A;  2VC1 A;  3VEP A;  2E7W A;  1IAW A;  2GM4 A;  3BP8 A;  5DD8 A;  3TOB A;  1Y0N A;  3KZY A;  5C4X J;  3OOU A;  4II2 A;  3UKG A;  2HYF A;  2QKL B;  3C2B A;  3J81 Z;  1PP7 U;  4AC0 A;  3CUQ B;  4EEF G;  3GUD A;  3WGI A;  1WFX A;  4CDG A;  4CCJ A;  3FXR A;  3DU6 A;  4EM1 A;  1ZKG A;  1R5I D;  1BJA A;  3LNQ A;  3IWF A;  1REP C;  2VKH A;  3JTH A;  2W82 A;  4V2G A;  1W5C C;  4AYB A;  4ENN A;  3S16 J;  4BXX J;  2KT0 A;  4NC6 A;  2A69 F;  3KYD B;  3HC7 A;  2L0K A;  5F0F A;  5DDG A;  4JOM A;  1QZE A;  4BY7 J;  3CCE I;  2X48 A;  2X85 A;  2D5V A;  2XV4 S;  2QLZ A;  3RYP A;  4AUX A;  4EJV A;  2XGX A;  5E18 F;  3LWF A;  3ZP5 A;  1O4X A;  2ELH A;  3QOP A;  4PK4 A;  5FKK A;  1Z3X A;  4AD9 A;  4I7H A;  2GBY A;  2L9N A;  2XVC A;  1A5J A;  2GLO A;  4QPO A;  3EET A;  1G3Y A;  3LA3 A;  3IL2 A;  1XCV A;  4BKX A;  3PQK A;  1OFC X;  5HS9 A;  2F5E A;  4R8H A;  4XLH A;  2VJI A;  5CVJ A;  5B5E C;  1SEU A;  5J47 A;  5FFX A;  3SZP A;  1ZHF A;  2FQ4 A;  3KEY A;  3M7G A;  1FLI A;  5ILU A;  1QZY A;  3L7W A;  4E7H A;  2QBY B;  3LQQ A;  3WGH A;  1XGN A;  2MSY A;  3SYT A;  4JX4 A;  3F0C A;  3ZMU A;  5LGN A;  4KIB A;  1F1Z A;  3HOT A;  3IKV A;  3PSF A;  1BM9 A;  3B6A A;  4NB5 A;  1MMN A;  1S7E A;  4LOC A;  2X6X A;  1HC8 A;  2R5Y A;  1YFH A;  4HA8 A;  2VPR A;  4P5O A;  1UG0 A;  1SVL A;  3HOU J;  2VN2 A;  5EEA A;  3JSP A;  3JAM Z;  5E3M A;  4XON A;  3Q0U A;  3D5S C;  1MJ9 A;  2M8E A;  3WTU C;  1O3R A;  1GXP A;  1G4D A;  3NAU A;  4M6V A;  4Q4Z F;  1XG1 A;  1Z6R A;  2WB1 A;  3JRC A;  2NYX A;  2JZY A;  2W84 A;  1IG7 A;  4B47 A;  2A5Y B;  2ELK A;  2DJN A;  4NBQ A;  3T8T A;  4EJW A;  4HNV A;  2FOW A;  3Q5F A;  1ZGA A;  1KU7 A;  3GX4 X;  3MZH A;  5JI6 A;  3LSK A;  3WE2 A;  2MA3 A;  5J1Y A;  1FOX A;  3IC7 A;  4C3I J;  3WG7 H;  3DBR B;  4ZYA A;  5J4Y A;  3N4M A;  1S8N A;  1FYK A;  4CCM A;  1STZ A;  2K27 A;  4GO1 A;  3CP2 A;  2FD5 A;  3HHG A;  3WU1 B;  2KDZ A;  3CD6 I;  1ZYR F;  2BGC A;  3E0J B;  1P2F A;  3IHU A;  2K9L A;  4BDY A;  1BJZ A;  2PMZ A;  4HV6 A;  3R6S A;  1BBY A;  4CCL A;  2ID3 A;  5JLX A;  1XCB A;  4RB1 A;  3CQZ J;  3MKW B;  3E3V A;  3G2B A;  2MH2 A;  3C7J A;  1HST A;  3FIW A;  1LUJ B;  2KZV A;  3U21 A;  4S04 A;  2PEX A;  4PJN A;  3OYK A;  2VI6 A;  1X3W B;  1IV6 A;  4I2O A;  2E1N A;  2Y69 H;  3ZQQ A;  4PJJ A;  1SD6 A;  4I02 A;  2LY1 A;  1FBU A;  5LRS A;  1TZL A;  2Y30 A;  3ULQ B;  4HDU A;  1KU2 A;  3PNV A;  2DAO A;  1PUE E;  1YRN A;  2W57 A;  3FHN A;  2KJB A;  2BXZ A;  4AYB N;  3OS0 A;  1Y1W J;  1T0F A;  4FE4 A;  1I5Z A;  2MLG A;  5FKM A;  4IO9 F;  3FBI B;  1B72 B;  3OWT A;  4XLC A;  4A2U A;  2KIM A;  1Q1V A;  1E0E A;  3AG4 H;  1JTX A;  2DOD A;  3A52 A;  4G7Z F;  3OL3 A;  4OAY A;  3SHF A;  5KK1 A;  3GTG J;  3CC4 I;  3B02 A;  4DJA A;  1G6N A;  3L09 A;  2QF7 A;  3BJA A;  4E6K G;  1OMI A;  2XAQ A;  4E7K A;  1JKQ C;  1S7A A;  3C3W A;  1MMA A;  1OCC H;  4A69 C;  3IWZ A;  1NTC A;  2GXB A;  4CA0 A;  2TRT A;  3LSM A;  1ZR4 A;  3K4L A;  4A3G J;  2IGO A;  2MC4 A;  4MQV A;  2W25 A;  3EYI A;  2LK2 A;  3C2H A;  1SAN A;  2CWE A;  2AQE A;  1P7J A;  3HPH A;  4LMY A;  5EGO B;  4A3L J;  1GLN A;  4IZZ A;  1ODD A;  1WJB A;  3FKJ A;  3Q3S A;  2QGU A;  4P96 A;  4DYC A;  1T33 A;  2EV5 A;  3J7A W;  2JSP A;  3CCS I;  2DOE A;  1BIA A;  4U0V A;  1UST A;  2EZI A;  2OV7 A;  3BC8 A;  3VSK A;  2IS4 A;  3S17 J;  1YX3 A;  1TWC J;  4LJZ F;  2CQ7 A;  1YTY A;  4XN0 A;  2CUF A;  3VOE A;  2L7K A;  1SVO A;  1A6I A;  3OR2 C;  2HVS A;  1XB4 A;  5FLV A;  2VQH A;  2R7R A;  4S0H B;  1ACI A;  5KCM A;  2D2W A;  5CVU A;  2ZKZ A;  4XQF A;  3WTY C;  1R36 A;  2DA4 A;  2P4W A;  2EFP A;  2OUM A;  2EWN A;  3A01 B;  2E1C A;  3BG5 A;  2HI3 A;  5LBQ A;  1T08 B;  3QU6 A;  4PGG A;  2VPL A;  2M0M A;  1FX7 A;  1LFB A;  3CDI A;  1ZRD A;  3TOA A;  4XRF A;  1D1B A;  2WV1 A;  2GXG A;  1QVT A;  5GPA A;  1LFU P;  1WRJ A;  2CH0 A;  4LLL A;  3ELK A;  2O6G E;  3KP7 A;  1U3E M;  2H94 A;  3F72 A;  2E2I J;  2O0Y A;  1GVJ A;  1P7I A;  1B9N A;  2VQC A;  4BEH B;  1MGT A;  4PFP A;  4IHW A;  4B3A A;  4XLE A;  3ABT A;  2R7X A;  4EJO A;  1MBK A;  4KIT B;  2DFE A;  3H3Z A;  4JBA A;  5LHH A;  3OYM A;  4V2F A;  1J75 A;  1KGS A;  4JX5 A;  1HDD C;  4M3B A;  2XGD A;  5E1Z B;  2P0W A;  1R1T A;  5F64 A;  4ZYG A;  1TQI A;  2LY9 A;  1X19 A;  3H9G A;  1A6Q A;  1UEL B;  2BW3 B;  2NS7 A;  3FIS A;  2HKO A;  1YG2 A;  1O57 A;  5IOY A;  2JA2 A;  3HZJ A;  2ACJ A;  1LFP A;  4RGX A;  4DQ2 A;  1VFC A;  1V54 H;  5KVR A;  1LPQ A;  1W7P B;  2K85 A;  2JVH A;  3IAS 2;  4FCY A;  1G59 A;  4CZZ A;  1WQ2 A;  3CUQ A;  5JFR A;  4PUS A;  3K4B A;  2CV0 A;  4UUS B;  3PUF A;  3CLO A;  1UHS A;  1GDT A;  3BZC A;  2HVR A;  3I54 A;  2VJ4 A;  2I8D A;  4XR6 A;  5EJC A;  2EJR A;  1R1V A;  3CP8 A;  2AXL A;  1QHG A;  4RA2 A;  3SZG A;  2X9D A;  2OCE A;  3TGN A;  3E7L A;  2XGE A;  3S14 J;  1QBJ A;  3RYR A;  3DCF A;  3KEO A;  3QOD A;  2LKX A;  3HHH A;  4ITV A;  1Y56 A;  5JLW A;  2L4A A;  3L2W A;  3DFG A;  3ML6 A;  2CV1 A;  1G8X A;  2CO5 A;  2E1O A;  1Y0U A;  4OU0 A;  1SFX A;  4BBR J;  4HPQ A;  2Y0M A;  3PNY A;  4LK0 F;  1W36 D;  2P8T A;  4CYD A;  2XDV A;  3RSN A;  2LY2 A;  1H89 C;  3ROU A;  4NNJ A;  5AIQ A;  3S93 A;  5E3O A;  3SFI A;  1XMK A;  1JJ8 C;  2JA8 J;  2IA1 A;  3CJR B;  3GF2 A;  4AIK A;  2E34 A;  4ANJ A;  2LNB A;  2NVQ J;  2RRE A;  4ENJ A;  5M5W J;  3K2Z A;  3J80 Z;  1P4A A;  1P4W A;  2HQN A;  5E1W A;  4QLC U;  4G8X A;  5HNH A;  1FOW A;  3A03 A;  1GT0 C;  4E7Z A;  3GW2 A;  5LEJ A;  4KA4 A;  2W1O A;  2M5W A;  4MEY F;  4A3F J;  3QOE A;  1BR4 A;  2PJR A;  2ISZ A;  2X1C A;  1ERD A;  5F1J A;  1QZZ A;  4OIQ F;  2EIK H;  4FX4 A;  4B48 A;  1MKM A;  2BOL A;  2VC0 A;  5ED4 A;  3GXO A;  3DLL F;  2QQ8 A;  1K6Y A;  5DS9 A;  3ZMV A;  1IJW C;  2HVQ A;  3GLL A;  3L2U A;  5E20 A;  4QWQ A;  1Z1D A;  4I09 A;  3FXJ A;  3OYE A;  4EQQ A;  3WU2 C;  3RIR A;  2IGK A;  3ABU A;  2XRO A;  1JT6 A;  4M71 A;  2JA7 J;  3H9Q A;  2JJ7 A;  1XSV A;  3WTS C;  4X0G A;  4MLO A;  4M72 A;  3IUO A;  4Y52 J;  5L3F A;  2K9M A;  3B6C A;  1PUF A;  5CJ9 A;  2EZK A;  5IT9 K;  4BHB A;  1DDN A;  4Q48 A;  1K78 B;  1QA6 A;  2Y2Z A;  3R0A A;  4DOZ A;  2V4J C;  1IUF A;  3H1C A;  3E1S A;  2HOS A;  2PQ8 A;  2QM3 A;  4D7N A;  3G1M A;  3G3Z A;  2CG4 A;  1QO0 D;  1VQO I;  1UJ8 A;  3CC7 I;  2BEO A;  2HZD A;  4O5V A;  2QEX I;  1SFE A;  4FT8 A;  3DV8 A;  4L9V A;  3CO7 C;  2XUB A;  3C18 A;  4X1E A;  3D5R C;  2L3D A;  2FSW A;  2GOM A;  2R4G A;  4NDL A;  1Z6T A;  3T1B A;  2ZJP F;  2LG4 A;  1TTY A;  2XAJ A;  4FHT A;  2UWM A;  3OSF A;  1HDP A;  2MYS A;  2O3F A;  2RKH A;  1ETK A;  4ZH4 F;  5IT9 R;  4RB3 C;  3GLX A;  3CMY A;  2M4K A;  5GAG J;  1LVK A;  2DA7 A;  4HNU A;  4TV7 A;  1BL0 A;  5IP9 J;  4AIJ A;  2YUS A;  4WXH A;  4Q47 A;  4UB6 C;  3H3U A;  2R5Y B;  2EPF A;  1IN7 A;  2DTR A;  3J7Z I;  2HYJ A;  3I4N J;  4XKC A;  3ZQF A;  4LIV A;  1T6S A;  4W97 A;  4A0Z A;  1WHU A;  4WX9 A;  3BWG A;  1KZH A;  3IV5 A;  4HX4 A;  1FBQ A;  4CYC A;  4JX6 A;  3PUB A;  4C30 A;  1KQ9 A;  4IL6 C;  2LC2 A;  2RQP A;  3KYC B;  3RPU A;  4B8X A;  1D0X A;  1K7A A;  4A5N A;  4XNF A;  1OCT C;  4L0Y B;  4BJ6 C;  3JRF A;  2LBF A;  3RCO A;  2M30 A;  2LH9 A;  1Y6I A;  1WGX A;  4C3J J;  1B8I A;  2NNN A;  1XN7 A;  4HW0 A;  2EFN A;  2MBF A;  3MKZ A;  4YFX F;  1S29 A;  4J19 A;  2DA5 A;  3HOW J;  1FBS A;  2GQQ A;  4KYW A;  1EV7 A;  3DBL B;  1HOM A;  5LGT A;  3PL8 A;  4FQG A;  3ISP A;  5FD6 A;  2ZFW A;  2FEZ A;  2MD0 A;  2K40 A;  2EQR A;  2ZXH A;  2FNP A;  2JSC A;  1I39 A;  5IP6 A;  4Y33 A;  3H36 A;  1D5V A;  1BR2 A;  1WJF A;  1LNW A;  2FNA A;  1W0T A;  1TL8 A;  5D6E A;  4RB2 C;  3K4K A;  3OYD A;  2XF7 A;  2EH3 A;  4XRS G;  4HF2 A;  3OYF A;  1I27 A;  1A04 A;  2G9W A;  4CGZ A;  5FLX K;  3K1P A;  1DU6 A;  2QUF A;  3A4C A;  3BOQ A;  1WH5 A;  3MD2 A;  5LGU A;  3I9V 2;  2KRC A;  5CVR A;  3V4G A;  3HOY J;  2MVT A;  1YRN B;  4L9T A;  1T98 A;  4BEH A;  2L2O A;  1WKM A;  2FRH A;  1FC3 A;  2CUZ A;  4RAY A;  3QWL A;  1OR7 A;  3M4O J;  2E5N A;  3M9A A;  2UUZ A;  2Z16 A;  1C0W A;  3KIO A;  3U9G A;  1EH6 A;  3GO5 A;  1FZP B;  3K4M A;  2VT2 A;  2KDO A;  3VPR A;  1IXR C;  2VUM J;  1HW5 A;  1ZR2 A;  2Q8K A;  2X6W A;  4A3I J;  1Z21 A;  2EA4 A;  5ILS A;  2OPT A;  1Z3Y A;  4Y13 A;  4L18 B;  5GTH C;  4I98 B;  4UVA A;  2WAD A;  2R7W A;  5HDK A;  2LF8 A;  3RTR A;  1YX5 A;  1HA8 A;  2IGN A;  2DTZ A;  4PGH A;  3TW7 A;  1FNN A;  2NXN B;  1F43 A;  4KIC A;  2D1H A;  2JTV A;  3HGY A;  2ZSH B;  2YX7 A;  4XOT A;  2MG4 A;  3HGG A;  4BAC A;  2DW4 A;  2K02 A;  1H0M A;  1XTA A;  2BYV E;  1CF7 A;  5DUK A;  5L3C A;  4UXN A;  3LSH A;  2CQX A;  2JUG A;  5J1U A;  4DNC A;  3KYL A;  3AG2 H;  3BZK A;  2PX9 A;  1YYV A;  3S15 J;  4HNT A;  2MLK A;  3JRE A;  1FIP A;  2RC4 A;  3S3O A;  1FMV A;  3LSR A;  2A6H F;  3E6D A;  5DV5 A;  1KA8 A;  2IS6 A;  5EYR A;  2K4B A;  2XKO A;  3I5U A;  2MW8 A;  3VYT B;  3ZMZ A;  5HLH A;  3JSO A;  5FD5 A;  1MH3 A;  1WI9 A;  2FML A;  2GIV A;  3BJO A;  2ZXW H;  1OR7 C;  2GWR A;  2IJL A;  5D8K B;  3QPT A;  3H3V K;  1J59 A;  3S2H J;  5C3E J;  2R7T A;  4I6Z A;  3KZI C;  1QPI A;  3ZPL A;  5EF6 A;  4BU2 A;  4G6D A;  5HLT A;  3FMS A;  4D0P A;  2BXY A;  1EH8 A;  4KN4 X;  3CC2 I;  4EVI A;  1E17 A;  1X2M A;  2QQ9 A;  5EZH A;  4IKF A;  5F0C A;  3F6V A;  2KRH A; 
#chains in the Genus database with same CATH homology
 4HYE A;  3DQV C;  4MEX F;  5FB2 A;  2EV0 A;  4Y17 A;  2FU4 A;  2V1D A;  3KZZ A;  4EGZ A;  2HTJ A;  4KIG A;  1T2K A;  2OZ6 A;  2V9V A;  2K4J A;  1SAX A;  5BS6 A;  5HOO A;  1BI3 A;  2RV8 A;  1JXS A;  3NRV A;  2VE9 A;  3CDH A;  1JHH A;  1T38 A;  3MCZ A;  4BHC A;  2YSR A;  2YU3 A;  3KET A;  1K78 A;  3QPH A;  5D4R A;  5K1Y A;  1J0R A;  4BH9 A;  1X3U A;  4OIO F;  1XDU A;  4JK1 X;  1ZG5 A;  1TW3 A;  3WTX C;  4RB0 A;  2YX4 A;  1EH7 A;  5DEQ A;  2RGV A;  4ZYD A;  1HXD A;  3K9T A;  3GYH X;  3LA2 A;  3GFM A;  1BOA A;  1LDD A;  3E6B A;  4CHU A;  2ZO4 A;  3KEQ A;  2COM A;  3FM5 A;  3S2W A;  1OYY A;  1FPQ A;  3QAH A;  4P9U A;  2FF4 A;  1XD7 A;  3I59 A;  5E8I A;  3FF5 A;  3COA C;  5BOX A;  4ZZL A;  4IF4 A;  2DK5 A;  2CFX A;  3ZQ7 A;  1MDM A;  1KYZ A;  4LLN A;  3F8N A;  3RKW A;  3H92 A;  3K0L A;  1Z7U A;  4MTE A;  3FMQ A;  2MD5 A;  4XBF A;  4A6D A;  3V7C A;  2V6C A;  2O61 A;  3K1N A;  3V8L A;  1P92 A;  3RKY A;  3PQJ A;  2Z3Y A;  3WTZ A;  2STT A;  3F6O A;  3T8R A;  1TQM A;  4N9H A;  1J9I A;  3RJP A;  2WV0 A;  1MD0 A;  4M9Z A;  5E17 F;  3BJ6 A;  1O3T A;  2PMU A;  5HDN A;  3GZ6 A;  1FP2 A;  2HTS A;  1IZ1 A;  4Z2Y A;  2RN7 A;  4YII A;  5IT3 A;  2VT3 A;  4IHT A;  3O6B B;  1NHA A;  1LDJ A;  1YO5 C;  1IN4 A;  4KN7 X;  4UUV A;  2LDU A;  3F8M A;  3I71 A;  3VFZ A;  3FMR A;  1FP1 D;  2IRF G;  1E2X A;  1Z05 A;  3L00 A;  4KUM A;  1W7P D;  1FY7 A;  4HF0 A;  1HSJ A;  4AWX B;  2VOP A;  3R4K A;  3HTU A;  3RKX A;  3T5X A;  2UZK A;  1F5T A;  3QP6 A;  4ESB A;  2ZBK A;  1SMY F;  4OMZ A;  3M8F A;  3P9I A;  5DCM A;  4A6E A;  3MEX A;  2LSO A;  5LRR A;  5BPD A;  2KRF A;  4A0X A;  1KU3 A;  3BY6 A;  4G7H F;  4LFU A;  2L01 A;  3WTW C;  2VOD A;  2TDX A;  5H6R A;  1SMT A;  4KDP A;  4B09 A;  3KLO A;  5TJJ A;  1IUY A;  4L5J A;  2CGP A;  1R58 A;  2DPU A;  2DQL A;  5E8G A;  4M6Y A;  2OBP A;  2P5L C;  1YS7 A;  4P55 A;  5K5O A;  1TLH B;  1KQ8 A;  4WXC A;  2HS5 A;  2M45 A;  3KP3 A;  2EFW A;  2V1X A;  2STW A;  4R79 A;  2FXA A;  2F5D A;  2VOO A;  1HKS A;  2DK8 A;  2FQ3 A;  2O8X A;  1PP8 F;  2V79 A;  4N0B A;  4AIH A;  4HAM A;  2JPC A;  4GYI A;  4HX8 A;  3MZY A;  2ETH A;  4BQA A;  2MC3 A;  1CF7 B;  1G3T A;  1XSD A;  4ZYH A;  3M1E A;  2V1U A;  3HYI A;  1BI1 A;  1WSU A;  4M9S A;  4IRH A;  3LFK A;  4LG0 A;  4LD5 A;  1ON2 A;  3I53 A;  3WTT C;  3ERE D;  2GA2 A;  4OIN F;  3TO9 A;  4RAZ A;  4XSX F;  5IT9 Z;  1H9T A;  5F6F A;  5H6Q A;  2IA0 A;  4ZYE A;  4UVB A;  5J8F A;  5HLG A;  3I0T A;  1MJA A;  1KYW A;  1D8J A;  1BN5 A;  1CGP A;  3CJN A;  3I4P A;  2XHK A;  3FHZ A;  4O3M A;  3BPV A;  2GA1 A;  2DLL A;  3EQL F;  3V8J A;  3NQO A;  1BI0 A;  1S6L A;  3E5U A;  4M74 A;  5AON A;  4HOB A;  3HOS A;  4HLX A;  2IA2 A;  5JR3 A;  2A3S A;  4U88 A;  1R23 A;  1HW1 A;  4ENM A;  3TKY A;  4GGG A;  2ZXJ A;  1RI7 A;  4NQW A;  2GZW A;  3KP4 A;  1W5T A;  1B59 A;  2FBI A;  2ZNZ A;  1P4X A;  3D5L A;  4G6Q A;  3SQN A;  3CTA A;  2OA4 A;  4ETS A;  1TBX A;  2UXN A;  4LB6 B;  3QU3 A;  1L3L A;  4UNO A;  4EGY A;  1LEB A;  2OQR A;  4EV0 A;  2QVO A;  2GAU A;  1O3Q A;  4KFC A;  2K86 A;  3BRO A;  3RDI A;  1YLF A;  5JHU A;  1O3S A;  2HR3 A;  1IXC A;  2KJC A;  2QZ8 A;  4HV5 A;  3DF8 A;  3J80 K;  4MQ9 F;  5ICE A;  2NRA C;  3BDD A;  3WGG A;  1QNT A;  4LK1 F;  1FYL A;  3HRT A;  4HZF A;  3HSE A;  3F8F A;  3V7S A;  1O7L A;  3DKW A;  2A6E F;  3L9F A;  3F22 A;  4WXD A;  3TDZ C;  2FE3 A;  2RVC A;  3N97 A;  2O03 A;  3I59 B;  3DXJ F;  3E5Q A;  3REO A;  2QEN A;  1MDM B;  1S7O A;  1R00 A;  1SFU A;  1UCR A;  5A2Q K;  2M1B A;  3TQN A;  5DYM A;  2F5C A;  4O6J A;  2XKP A;  4ON0 A;  4FX0 A;  4M9X A;  1YW8 A;  1W5S A;  4RGS A;  1T39 A;  1ZLJ A;  3GZ5 A;  5HLI A;  2L4M A;  3F8B A;  5CYV A;  2OU2 A;  2LF7 A;  5LEK A;  4AVP A;  5BMZ A;  4HF1 A;  2E7X A;  1MZB A;  3W6K B;  3E5X A;  2IPQ X;  1R1U A;  3FXU A;  1H9G A;  3KP6 A;  4LLG F;  2YR2 A;  2F2E A;  1KU9 A;  3FZV A;  2EK5 A;  2DBB A;  4L0Z B;  2QYO A;  2ZJ2 A;  4WK8 F;  2XRN A;  3CUO A;  2X0L A;  3ZN1 A;  4LGW A;  2A68 F;  2HQR A;  2K7L A;  2P5K A;  5ERI A;  2BE5 F;  4I0A A;  2X4H A;  3LST A;  3HRM A;  3OOP A;  2XAF A;  2CYY A;  4PDK A;  4GXO A;  2H6B A;  2Z5U A;  5DCM B;  2M87 A;  3MAJ A;  3FWE A;  4EM0 B;  2H09 A;  2PBI A;  5CVV A;  2XAG A;  3NEU A;  4G7O F;  3GWZ A;  3ZMD A;  1O7F A;  4M6X A;  5D6F A;  5FFZ A;  2DQR A;  3Q9S A;  2ZCW A;  2VE8 A;  2W85 A;  2EV6 A;  4H0E A;  3ZN0 A;  2H6C A;  3FM3 A;  5J8C A;  2OZU A;  4IJA A;  2EB7 A;  4CIC A;  3EDP A;  5DCF A;  2DFI A;  1HQC A;  2EA2 A;  5K5Q A;  3V7R A;  4A0Y A;  2OD5 A;  5D4S A;  1HKT A;  5L3B A;  2L02 A;  3MFK A;  2HWV A;  2P6T A;  1LB2 A;  4MNU A;  2CQK A;  1SD4 A;  2RDP A;  5L3E A;  3VOD A;  4UVC A;  4XLP F;  3VB2 A;  3L2C A;  4P9F A;  1K6O A;  1IN6 A;  2CW0 F;  3WTV C;  3J7A O;  4HX7 A;  3LA7 A;  1L0O C;  1RNL A;  3GFI A;  2BBY A;  2D45 A;  3TO6 A;  1LQ1 A;  3K1M A;  2IW5 A;  3U2R A;  4WWC A;  2PLY A;  1Z91 A;  5ICF A;  4MGR A;  2KIU A;  5TRD A;  2DPD A;  4L9J A;  4LG0 B;  2KKO A;  2VBZ A;  3MWM A;  3PFI A;  3SZT A;  3F21 A;  2HOE A;  1R5G A;  2CSO A;  2NNY A;  2QQB A;  4JQF A;  2XAS A;  4RGR A;  3F3X A;  4WCG A;  4KMU X;  5LHI A;  4EJT A;  1BC8 C;  1D8K A;  3M8E A;  2HZT A;  3TDU C;  1YIO A;  1U5T A;  2IP2 A;  1G3W A;  4YFN F;  4CO8 A;  2HDC A;  1ZN2 A;  3HTS B;  1FYM A;  1U2W A;  2LKP A;  2F5F A;  1PDN C;  4UV9 A;  2Y48 A;  3J81 K;  3WG9 A;  2VXZ A;  1OYW A;  1S3J A;  4I0B A;  4BXU A;  1OPC A;  5EEH A;  1UHM A;  1IXS B;  5AIP A;  2DO7 A;  5H20 A;  3WE3 A;  1DP7 P;  1LDK B;  1BI2 A;  1B6A A;  2R7D A;  2DI3 A;  4HQE A;  1R22 A;  2J5P A;  2VBX A;  5D5X B;  1VTN C;  3BZ6 A;  3MQ0 A;  1SD5 A;  2Y75 A;  4KNY A;  5HVQ C;  2VON A;  2VBW A;  5HS8 A;  1RIO H;  3JW4 A;  3R0J A;  1TW2 A;  2OAZ A;  5DD4 A;  4ESJ A;  1U5T C;  3F8C A;  3DPT A;  2IT0 A;  1ZRE A;  5FGM A;  3QP5 A;  1U8R A;  4M73 A;  4U7B A;  1UHW A;  1ULY A;  5D5U B;  1ZGJ A;  3ECH A;  1V3F A;  1RUN A;  4U0W A;  3HSF A;  5ICG A;  1SD7 A;  3JAM K;  3IRR A;  4MHG A;  1K79 A;  2ISY A;  5HDG A;  2H27 A;  1Z9C A;  2NAZ A;  2PJP A;  1I1G A;  3R61 A;  1QPM A;  3P9C A;  3HUG A;  4CXF A;  2J5O A;  3GVA A;  1ZRF A;  1HKQ A;  4IRI A;  3O3K A;  4EJU A;  1AWC A;  1LEA A;  1XGO A;  4Y15 A;  2WWY A;  3SFZ A;  1IF1 A;  2P7C B;  1USS A;  4BAY A;  1FWZ A;  4ESF A;  1D3Y A;  4XSZ F;  2FA5 A;  3E6C C;  4RS8 A;  4HQM A;  1DPR A;  3W6J B;  3P9K A;  3RI4 A;  3WU0 A;  1AOY A;  4OIP F;  1RUO A;  4UV8 A;  1BC7 C;  3V8K A;  5D8L B;  4IXA A;  5BPI A;  5EEG A;  1OKR A;  1DUX C;  1FT9 A;  2P7V B;  1ZG1 A;  5ICC A;  3ECO A;  2ZME A;  4K2E A;  1MJB A;  4NHJ A;  1TQP A;  4LB5 A;  3IRQ A;  4HLY A;  2YPR A;  2A61 A;  3KLN A;  2JRT A;  1ZLK A;  4I01 A;  3E97 A;  1YS6 A;  3T0Y A;  3O2P E;  4R1H A;  3ZMS A;  1J7K A;  2Q2E A;  4U0Y A;  2ESH A;  5D5V B;  2HFH A;  4BNC A;  3LAJ A;  2PMH A;  4YFK F;  2ESN A;  5E1X A;  1ZAO A;  4IHS A;  1GXQ A;  2MH9 A;  3I64 A;  4KIF A;  2PFB A;  5DUI A;  5LLQ A;  3KE2 A;  1JHF A;  2DT5 A;  2QBY A;  4BHP A;  2BV6 A;  2Z33 A;  2FBH A;  1ZRC A;  3HRU A;  1B9M A;  2QWW A;  3LQR A;  2FMY A;  3C1D A;  4BYY A;  3GEZ A;  2NS0 A;  4U7D A;  1F9N A;  4G9Y A;  4PZJ A;  5FO5 A;  1F4K A;  2PN6 A;  3JTG A;  2L54 A;  3EUH A;  3CUQ C;  1ZAR A;  1TNT A;  1R5H A;  3K69 A;  3P7N A;  1J5Y A;  4L5I A;  5LHG A;  1KQ0 A;  2VBY A;  4IPA A;  4ZZD A;  1ONV A;  2QQA A;  1QQI A;  4YIF A;  3BPX A;  3B73 A;  2G7U A;  4A12 A;  3KCC A;  2Q0O A;  4IVN A;  5A2Q Z;  4F7Z A;  4S05 A;  3IKT A;  1JGS A;  1R7J A;  4OMY A;  3LAP A;  1V4R A;  1U78 A;  4GCV A;  3D0S A;  4GYG A;  3FXQ A;  2XIG A;  4E70 A;  5FLX Z;  5L3D A;  1ZG3 A;  5ILV A;  2A07 F;  3R60 A;  1ON1 A;  1XGS A;  3KP5 A;  2W24 A;  4L9N A;  2P5V A;  3SXY A;  1YQA A;  1U5T B;  3HRS A;  1W4M A;  1BIB A;  3Q9V A;  2PG4 A;  1LVA A;  2P6S A;  2G7H A;  1B4A A;  3EYY A;  1J2X A;  2PI0 A;  2XAH A;  1FSE A;  1IN8 A;  2RNJ A;  4KMF A;  1GHC A;  3AAF A;  2EFO A;  1QGP A;  2HEO A;  2Z9O A;  1UB9 A;  4A5M A;  2FBK A;  5CVI A;  4XLN F;  1LJ9 A;  2UXX A;  2Z99 A;  4EMS A;  1OYI A;  2ZNY A;  2HYG D;  2HKX A;  2C6Y A;  1DPU A;  1IRF A;  3G73 A;  1HW2 A;  3I58 A;  3TO7 A;  2EFQ A;  4RGU A;  4G94 A;  1G3S A;  3QRF F;  2JT1 A;  2R3S A;  3HIF A;  4PCQ A;  4YG2 F;  5BQT A;  2JPB A;  1JE8 A;  1P6R A;  4ASN A;  3CO6 C;  4OOI A;  1RZ4 A;  4HDV A;  1IW7 F;  1XGM A;  2D1V A;  4ENK A;  1XSX A;  4MTD A;  2WC2 A;  4Q5S F;  3HSR A;  1YW9 A;  4KT5 C;  1ZH5 A;  3DEU A;  1W7P A;  1XDS A;  2B0L A;  1IRG A;  1U6G A;  2KIF A;  1IN5 A;  1Q1H A;  3ZMT A;  3RPQ A;  1UFM A;  3E6M A;  5J6X A;  1TNS A;  1HBX G;  3GFJ A;  4HBL A;  4OIR F;  5K5R A;  2DU9 A;  2R7F A;  3WOD F;  4IRG A;  3U1D A;  5JVT A;  3OV8 A;  1I6X A;  2AS5 F;  5CLS A;  2HGC A;  5HS7 A;  4WF2 A;  3F23 A;  2OQG A;  4EM2 A;  1XMA A;  3FX3 A;  3GFL A;  1I1S A;  4N9I A;  1B1B A;  6PAX A;  5F1R A;  2WTE A;  1FOK A;  1FSH A;  5L3G A;  2ZME B;  1YW7 A;  2IVM A;  1WWX A;  3KFW X;  3DPL C;  4UHT A;  2FOK A;  3DP7 A;  5D5W B;  3KP2 A;  2ADU A;  2VC1 A;  3VEP A;  2E7W A;  1IAW A;  3BP8 A;  5DD8 A;  3TOB A;  3KZY A;  2HYF A;  3J81 Z;  1PP7 U;  3CUQ B;  3GUD A;  3WGI A;  4CDG A;  3FXR A;  4EM1 A;  1BJA A;  3IWF A;  1REP C;  3JTH A;  4ENN A;  2A69 F;  5DDG A;  2XV4 S;  2QLZ A;  5E18 F;  3RYP A;  4EJV A;  2XGX A;  3LWF A;  3ZP5 A;  2ELH A;  3QOP A;  4AD9 A;  4I7H A;  2XVC A;  3EET A;  1G3Y A;  3LA3 A;  3IL2 A;  1XCV A;  3PQK A;  5HS9 A;  2F5E A;  4R8H A;  5CVJ A;  5FFX A;  3SZP A;  1ZHF A;  3M7G A;  1FLI A;  5ILU A;  1QZY A;  3L7W A;  2QBY B;  3LQQ A;  3WGH A;  1XGN A;  3ZMU A;  5LGN A;  4KIB A;  1F1Z A;  3HOT A;  3IKV A;  1BM9 A;  4NB5 A;  1YFH A;  4HA8 A;  4P5O A;  2VN2 A;  3JSP A;  3JAM Z;  1MJ9 A;  2M8E A;  3WTU C;  1O3R A;  1GXP A;  1G4D A;  4Q4Z F;  1Z6R A;  2NYX A;  2JZY A;  2W84 A;  2A5Y B;  3T8T A;  4EJW A;  3Q5F A;  1ZGA A;  1KU7 A;  3GX4 X;  3MZH A;  5JI6 A;  3WE2 A;  2MA3 A;  3IC7 A;  3N4M A;  1S8N A;  1FYK A;  1STZ A;  2K27 A;  4GO1 A;  3HHG A;  3WU1 B;  1ZYR F;  2BGC A;  1P2F A;  3IHU A;  4HV6 A;  3R6S A;  1BBY A;  1XCB A;  4RB1 A;  3E3V A;  2MH2 A;  3C7J A;  1HST A;  4S04 A;  2PEX A;  4I2O A;  2E1N A;  1SD6 A;  4I02 A;  1FBU A;  5LRS A;  3ULQ B;  4HDU A;  1KU2 A;  1PUE E;  2DAO A;  2W57 A;  2KJB A;  1T0F A;  1I5Z A;  2MLG A;  4A2U A;  2KIM A;  4G7Z F;  3SHF A;  5KK1 A;  3B02 A;  1G6N A;  3L09 A;  3BJA A;  1OMI A;  2XAQ A;  1S7A A;  3C3W A;  3IWZ A;  2GXB A;  4MQV A;  2W25 A;  3EYI A;  2CWE A;  4LMY A;  1ODD A;  4P96 A;  2EV5 A;  1BIA A;  4U0V A;  1UST A;  4LJZ F;  1YTY A;  3VOE A;  1XB4 A;  2D2W A;  5CVU A;  2ZKZ A;  3WTY C;  1R36 A;  2P4W A;  2EFP A;  2EWN A;  2E1C A;  5LBQ A;  3QU6 A;  4PGG A;  1FX7 A;  1ZRD A;  3TOA A;  4XRF A;  2GXG A;  1WRJ A;  4LLL A;  3ELK A;  2O6G E;  3KP7 A;  1U3E M;  2H94 A;  3F72 A;  2O0Y A;  1GVJ A;  1B9N A;  1MGT A;  3ABT A;  4EJO A;  3H3Z A;  4JBA A;  5LHH A;  1J75 A;  1KGS A;  5E1Z B;  1R1T A;  5F64 A;  4ZYG A;  1TQI A;  2HKO A;  1YG2 A;  1O57 A;  2ACJ A;  4RGX A;  4DQ2 A;  5KVR A;  1W7P B;  4CZZ A;  1WQ2 A;  3CUQ A;  5JFR A;  3CLO A;  3I54 A;  2EJR A;  1R1V A;  2AXL A;  3TGN A;  1QBJ A;  3RYR A;  3KEO A;  3HHH A;  2L4A A;  3DFG A;  3ML6 A;  2CO5 A;  1Y0U A;  4OU0 A;  1SFX A;  2Y0M A;  4LK0 F;  2P8T A;  4CYD A;  3ROU A;  5AIQ A;  1XMK A;  2IA1 A;  3GF2 A;  4AIK A;  2LNB A;  4ENJ A;  3J80 Z;  3K2Z A;  1P4A A;  1P4W A;  2HQN A;  5E1W A;  4QLC U;  4G8X A;  3GW2 A;  5LEJ A;  4KA4 A;  2M5W A;  4MEY F;  2ISZ A;  1QZZ A;  4OIQ F;  4FX4 A;  1MKM A;  2VC0 A;  5ED4 A;  3GXO A;  3ZMV A;  5E20 A;  4QWQ A;  1Z1D A;  4I09 A;  4EQQ A;  3RIR A;  3ABU A;  2XRO A;  4M71 A;  1XSV A;  3WTS C;  4M72 A;  5L3F A;  5CJ9 A;  5IT9 K;  4BHB A;  1DDN A;  4Q48 A;  1K78 B;  3R0A A;  2PQ8 A;  2QM3 A;  3G3Z A;  2CG4 A;  1QO0 D;  2BEO A;  4O5V A;  1SFE A;  4FT8 A;  3DV8 A;  4L9V A;  3CO7 C;  2XUB A;  3C18 A;  2L3D A;  2FSW A;  1Z6T A;  3T1B A;  2XAJ A;  1TTY A;  2UWM A;  4FHT A;  2O3F A;  2RKH A;  4ZH4 F;  4RB3 C;  3GLX A;  4TV7 A;  4AIJ A;  4WXH A;  4Q47 A;  3H3U A;  1IN7 A;  2DTR A;  1T6S A;  4A0Z A;  4WX9 A;  3BWG A;  4HX4 A;  1FBQ A;  1KQ9 A;  2RQP A;  3RPU A;  4B8X A;  1K7A A;  4A5N A;  4L0Y B;  2M30 A;  2NNN A;  1XN7 A;  4HW0 A;  2EFN A;  2MBF A;  4YFX F;  1S29 A;  1FBS A;  2GQQ A;  4KYW A;  1EV7 A;  5LGT A;  3ISP A;  5FD6 A;  2ZFW A;  2FEZ A;  2FNP A;  2JSC A;  1D5V A;  1LNW A;  2FNA A;  5D6E A;  4RB2 C;  4HF2 A;  1I27 A;  1A04 A;  2G9W A;  4CGZ A;  5FLX K;  3K1P A;  2QUF A;  3BOQ A;  5LGU A;  5CVR A;  3V4G A;  4L9T A;  1T98 A;  1WKM A;  2FRH A;  1FC3 A;  4RAY A;  1OR7 A;  3M9A A;  1C0W A;  3U9G A;  1EH6 A;  3GO5 A;  1FZP B;  2VT2 A;  1IXR C;  1HW5 A;  2Q8K A;  5ILS A;  2EA4 A;  4Y13 A;  4L18 B;  4I98 B;  4UVA A;  5HDK A;  2LF8 A;  3RTR A;  4PGH A;  1FNN A;  4KIC A;  2D1H A;  2JTV A;  2YX7 A;  2DW4 A;  2K02 A;  1H0M A;  2BYV E;  1CF7 A;  5DUK A;  5L3C A;  4UXN A;  4DNC A;  1YYV A;  2MLK A;  2RC4 A;  2A6H F;  3E6D A;  5DV5 A;  1KA8 A;  2K4B A;  2XKO A;  3I5U A;  3JSO A;  3ZMZ A;  5HLH A;  5FD5 A;  1WI9 A;  2FML A;  2GIV A;  3BJO A;  2GWR A;  2IJL A;  5D8K B;  3QPT A;  1J59 A;  3ZPL A;  4G6D A;  3FMS A;  4D0P A;  4KN4 X;  1EH8 A;  4EVI A;  1E17 A;  2QQ9 A;  3F6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...