4HX7A

Structure of mntr e11k mutant complexed with cd2+
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
133
structure length
128
Chain Sequence
PSMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 53
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx7A02
5KVRA 3ML6A 3CUQA 1K7AA 2DAOA 4RGSA 2DW4A 2FEZA 2Z33A 1T38A 2L4MA 4KUMA 2O61A 2FMYA 4KFCA 3K2ZA 3RPUA 3LSTA 1LJ9A 2VODA 2QZ8A 3KEQA 4LJZF 1TQMA 3ULQB 2XAJA 5BMZA 2OQRA 2ISZA 1TW2A 5J6XA 2ZXJA 4HX8A 3JTHA 2K4BA 4AIKA 1TNSA 4H0EA 2KIFA 3FZVA 4CZZA 5F64A 1MDMA 4S05A 3DP7A 3T0YA 2YU3A 3GLXA 1YLFA 1D8JA 4I2OA 1LQ1A 4KIBA 3KZYA 2GXGA 1FSEA 1X3UA 3J80Z 4MNUA 2PI0A 3ELKA 1BN5A 3R4KA 4K2EA 3C18A 5ILSA 2RC4A 3KP6A 5CYVA 2CSOA 2X0LA 2GA2A 2DBBA 2LSOA 2M5WA 3GYHX 1KU2A 2EV5A 3HRTA 3ZMVA 2LNBA 1EH8A 3M8FA 4HF0A 3WTZA 3GWZA 4OIRF 2RVCA 4P9UA 1FBQA 1O57A 5K1YA 3BY6A 3L00A 3HRSA 4RS8A 2HZTA 2EFNA 4DQ2A 3IRRA 2FBHA 2QWWA 1GHCA 3BJOA 3MAJA 4Q5SF 1Z05A 1I6XA 1VTNC 1AOYA 4HDUA 4AVPA 3O3KA 4Q47A 2J5PA 2ZJ2A 4M9XA 1B1BA 1UHWA 2XAFA 3R6SA 1P4XA 1MJBA 4LLGF 4WXCA 2OD5A 4IRIA 5HS7A 2F5CA 3L9FA 4YFXF 2J5OA 1C0WA 3TO9A 1W7PA 1ZRFA 2D45A 3ERED 4OIPF 3TO7A 5HOOA 2M45A 2DFIA 4PDKA 2O8XA 1GXPA 4KIGA 1S6LA 3WTYC 3TO6A 2EWNA 1P6RA 4HBLA 2XIGA 4RB1A 1RIOH 1IF1A 3VOEA 4EJWA 4G94A 2ZNYA 2H6BA 1JE8A 2XGXA 1W5TA 3D5LA 2DPUA 2XAHA 4YG2F 1T39A 3DEUA 2W84A 1JHFA 1IRFA 3D0SA 5BOXA 4P9FA 2HTJA 1KU9A 1O7LA 2XAGA 1CF7B 5JI6A 2HKOA 1DUXC 3WTXC 4MEYF 1J5YA 3GO5A 1I5ZA 4KA4A 4QWQA 1USTA 3E6MA 4LG0B 2Z9OA 2YX7A 2KKOA 2BGCA 2JTVA 4HQMA 4EM1A 1DP7P 3ABTA 2W25A 3IKTA 4MEXF 3F8FA 3J7AO 2HS5A 2MC3A 2XVCA 2RQPA 5LGTA 4M74A 1OYYA 2H6CA 3K1MA 2NNNA 3EQLF 1U78A 2L4AA 3IWFA 3V7RA 2M8EA 1K78B 1B6AA 4JQFA 5D8LB 2EFQA 2F5EA 2M1BA 5ICFA 5JHUA 3LQRA 1O3SA 2P7CB 5E1WA 5JVTA 4B09A 4WX9A 1ULYA 4RB0A 1BI3A 5L3DA 4YFNF 4BQAA 2DU9A 5FLXZ 4UVBA 1XGSA 4G8XA 4N9HA 2AS5F 3M7GA 3BDDA 4ENJA 4EMSA 4LB5A 1W7PD 3SXYA 3PFIA 4CDGA 4M9SA 2D1VA 3HSFA 2HYGD 1JHHA 2R7FA 1REPC 2XROA 2JRTA 3TDZC 3ZQ7A 4WXDA 5E1XA 4O5VA 3RPQA 2TDXA 4HLYA 4I98B 2PEXA 3M9AA 3BJAA 4ZYGA 1Z6TA 4ETSA 2QBYA 3F21A 2K4JA 4RGRA 5BS6A 4HV6A 1UCRA 1Z9CA 1XDUA 5DD8A 2DK8A 3F22A 4ZZDA 4HV5A 3V4GA 5LBQA 2LDUA 5K5OA 2Z5UA 3RDIA 1EH6A 3V8LA 5LGNA 2DK5A 4L9TA 3HOTA 4FT8A 4YFKF 5DCMA 1KU3A 1T0FA 3Q9VA 5BQTA 4GYGA 1HSJA 1ZG5A 4UVAA 3F8BA 2OZUA 1RUOA 2UZKA 4Y15A 1ZRDA 3T8RA 4BHPA 3GFLA 2IT0A 1P4AA 1ON1A 3R0JA 5FD6A 3EYIA 2OZ6A 4I0BA 2D2WA 3GZ5A 2UWMA 4LB6B 3I54A 5FD5A 1FYMA 4Q4ZF 1IN6A 5CJ9A 5DUKA 3RKYA 5LRSA 4A2UA 3SQNA 4I7HA 3DQVC 2HGCA 2QQAA 2JZYA 3MZYA 1XSXA 3IHUA 4KN7X 4HF1A 1R1VA 1J9IA 4BNCA 2MA3A 4L5IA 5D5XB 5D8KB 2ETHA 2M87A 3PQJA 4M6YA 2FBKA 1FLIA 3ZMTA 3BPVA 1QNTA 4XBFA 1F9NA 2NYXA 1IN8A 2VT3A 3P7NA 4A0XA 4A12A 5J8FA 3MFKA 3IL2A 3H3UA 2QQ9A 2COMA 3NRVA 2L01A 1BBYA 1ZREA 1ZARA 4G6QA 1ZYRF 4HQEA 1LNWA 2Z99A 5IT9Z 3WGHA 3HHGA 3B73A 4EJTA 3ZN1A 2QYOA 3BOQA 1BIBA 4CO8A 3C1DA 1STZA 1WRJA 3N4MA 3HOSA 3WG9A 4LGWA 2FA5A 4MGRA 4AWXB 2VOPA 2MH9A 2H09A 2FNPA 1LDDA 2HOEA 3QP6A 3KLNA 3LQQA 4GYIA 1TW3A 4LFUA 5E20A 2DTRA 2CQKA 1XD7A 3R0AA 4M72A 5ICEA 2XHKA 2ZMEB 2K7LA 2VE9A 4U0YA 1ZRCA 2D1HA 1KGSA 4RAYA 3RIRA 2HKXA 1IW7F 2DLLA 4M6XA 2GIVA 1FP1D 1U5TB 4JBAA 4B8XA 2MBFA 5HDNA 3EYYA 2VXZA 1HW5A 3RKXA 4A6DA 5IT3A 2UXXA 2ELHA 1BI2A 4EQQA 1AWCA 2EV6A 5LEJA 3F8CA 4ZZLA 2A07F 4BAYA 1B9MA 3I59A 3ECHA 2RV8A 3F6OA 3FXUA 2E7XA 4P96A 1RNLA 1ODDA 3BROA 1S8NA 3DPTA 2V9VA 4L5JA 3E5UA 2GAUA 3IRQA 2A3SA 1B4AA 4FX0A 1YO5C 1KA8A 1RZ4A 3KLOA 2IRFG 4O3MA 2EK5A 1D8KA 1L3LA 3I4PA 2G9WA 1MJ9A 3K9TA 4P5OA 1A04A 5LRRA 2CG4A 5CVIA 2LF8A 1MZBA 3GW2A 4U0WA 2QENA 3CUQC 3HHHA 4WK8F 2CWEA 1UFMA 5K5RA 1SD6A 5LLQA 4AIJA 5L3GA 2Z3YA 2QQBA 2CW0F 5JFRA 3IWZA 3E6BA 4RGUA 1SD7A 2E7WA 3TDUC 2A61A 3V8KA 1Z91A 2DQRA 3JAMZ 5A2QK 2V1XA 2OQGA 1FNNA 2NS0A 1KQ9A 1MKMA 1TQIA 3ABUA 3GZ6A 1P4WA 2EFOA 1J7KA 1GXQA 1TLHB 1K79A 2L54A 1MD0A 1O3TA 2KJCA 1R1TA 2RGVA 3NEUA 1FY7A 1ONVA 1RUNA 3WODF 2HQNA 1HKTA 5E17F 1PUEE 2X4HA 3F23A 2WWYA 1I27A 3V7CA 3ECOA 1LEBA 1WI9A 2PLYA 3JSOA 1IRGA 2KJBA 2QM3A 2EA4A 1DPUA 2P8TA 3KZZA 5BPIA 3FM3A 5CVJA 1I1SA 2CFXA 1YW7A 5L3EA 1OMIA 1LEAA 3RKWA 3B02A 1ZG1A 2BV6A 3CUQB 2C6YA 2K27A 4A0YA 2STTA 1NHAA 4EV0A 5LGUA 1TBXA 3FMSA 3I59B 4LLNA 1PP8F 4HDVA 1ZGAA 3BWGA 2NNYA 3N97A 4CHUA 2HEOA 3O6BB 5K5QA 3I71A 1S3JA 1XSVA 3HTSB 4L0YB 5D5UB 1XMKA 5DV5A 2ACJA 2DPDA 2IPQX 2V1DA 2FMLA 2BEOA 1MDMB 1U2WA 3QOPA 1CGPA 5ED4A 1ON2A 2JT1A 4ASNA 3LA2A 1OYIA 5LEKA 2YPRA 2GZWA 3G3ZA 4L9VA 3CO6C 1IN4A 1YQAA 3SHFA 3GFMA 2E1CA 1OKRA 2WTEA 3BP8A 4KMUX 4GO1A 3FM5A 3CJNA 3U2RA 4L0ZB 2LKPA 1I1GA 2ISYA 4IRGA 4U7DA 3HRUA 5F6FA 3HUGA 1KQ0A 3HRMA 1G3SA 3VODA 3TOAA 1T98A 4ESBA 3S2WA 2F2EA 3KFWX 3BJ6A 1YW8A 2DO7A 4JK1X 1ZLKA 1J75A 2CYYA 1SD4A 1WSUA 4XSXF 1XGNA 1W7PB 4YIFA 5DDGA 3HTUA 3W6KB 3DF8A 3IC7A 4UV9A 2VOOA 1IXRC 1UB9A 3L09A 3MQ0A 4G9YA 2MLGA 1G3YA 2FE3A 2KRFA 1HQCA 1QZYA 3FXQA 1QZZA 1LDKB 2FU4A 5H6RA 1IN5A 4HAMA 1FWZA 1IAWA 4OMZA 3V7SA 3IKVA 3F6VA 2XAQA 1OPCA 1T2KA 2EV0A 1YS7A 1TTYA 2DI3A 2PQ8A 2DQLA 3HSEA 2M30A 3ZMSA 4A0ZA 5HS8A 3U9GA 3CUOA 1FBUA 2F5FA 3FMRA 3QPTA 4E70A 4UHTA 2VN2A 4CXFA 3GXOA 3DPLC 3J81K 4OOIA 1LDJA 4PGHA 2H27A 4XSZF 5KK1A 4CYDA 2DT5A 2FNAA 4KICA 2CGPA 4S04A 3TGNA 2FSWA 5D5WB 4O6JA 1K6OA 2OU2A 5ICGA 1ZLJA 3FWEA 2VBXA 3KP5A 1BIAA 1BOAA 1V3FA 4GXOA 1E2XA 3E5XA 4I02A 2CO5A 4XLPF 4FHTA 5J8CA 2PMHA 1FYKA 2STWA 2VBWA 3QP5A 2ADUA 3FMQA 3KCCA 1R36A 4TV7A 5AONA 2HWVA 3BZ6A 4ON0A 1R00A 3WU1B 5ILUA 1XDSA 2A6EF 2PG4A 4KN4X 2EFPA 2ZBKA 2FF4A 4BHBA 1YYVA 4UUVA 2KIUA 2W57A 1S29A 2Y0MA 3FF5A 1Z6RA 2AXLA 2R7DA 3QU6A 4EJUA 1YIOA 2XKOA 3KETA 1FZPB 4UXNA 1U3EM 2IA2A 3HIFA 3J80K 4A5MA 1YW9A 1HBXG 4GCVA 3RYRA 1FYLA 2QBYB 3HSRA 2VE8A 1SAXA 4MTEA 5D4RA 4D0PA 3LFKA 1SFEA 1G4DA 3M8EA 2L02A 2B0LA 3P9KA 3I58A 1BC8C 1HW1A 5E1ZB 1IN7A 4BYYA 3TKYA 2A69F 3H92A 4NHJA 3I64A 3CLOA 5DCMB 1BJAA 1WQ2A 1FSHA 4IPAA 1J59A 1XB4A 2VBYA 5ERIA 3K1NA 1FP2A 5FGMA 2IP2A 5HLHA 3RYPA 5E18F 1SFXA 2NRAC 4WXHA 1CF7A 3HYIA 4EJVA 1R5GA 4BXUA 2BYVE 1T6SA 1BI1A 4LG0A 2HQRA 2JSCA 2IJLA 3AAFA 3NQOA 1EV7A 2JPBA 2G7HA 3V8JA 4KIFA 2V6CA 2FXAA 1KYZA 2L3DA 4A6EA 4MHGA 2A5YB 5BPDA 2VC1A 3KP3A 1QO0D 1SMYF 2A68F 3MEXA 1B9NA 4G6DA 4ESFA 1S7AA 2WV0A 4LMYA 3I53A 4HOBA 1K78A 1MJAA 3GFJA 1O7FA 3DV8A 1L0OC 4UVCA 1ZG3A 2ZO4A 2O0YA 2W85A 4OINF 1DPRA 2Y75A 4N9IA 3T1BA 1LB2A 3T8TA 4ZH4F 5HVQC 5ICCA 2BE5F 3H3ZA 2GXBA 2NAZA 3WTUC 1P2FA 3P9IA 4OIQF 3OOPA 2O3FA 1QGPA 3ZMZA 1F4KA 4L9NA 5L3BA 3EUHA 3G73A 2MD5A 3GX4X 4KNYA 2O6GE 2ESNA 3K69A 1ZHFA 2FOKA 3LA3A 2RKHA 3KEOA 3K1PA 3U1DA 4G7OF 4N0BA 4AIHA 4LK0F 1YFHA 3C3WA 4KDPA 1R22A 2XUBA 3F3XA 4R8HA 5D6EA 4U88A 4EJOA 2RN7A 2GQQA 2QVOA 1FT9A 3WTSC 5EEHA 2VONA 1QPMA 1J0RA 3WTVC 2Q2EA 4RGXA 1EH7A 5DCFA 3ZP5A 1TQPA 2P6SA 4LD5A 2V1UA 3FXRA 2RNJA 4Q48A 2P5LC 3KP7A 1XSDA 5FO5A 5LHHA 4HX7A 2WC2A 1IUYA 1RI7A 5FLXK 1LVAA 3MZHA 3LA7A 3SZPA 1R23A 4NB5A 1HKQA 2W24A 3CTAA 3QRFF 3QAHA 4ESJA 1E17A 1SMTA 4GGGA 2FBIA 3E5QA 1D5VA 3W6JB 3F8MA 3F8NA 1JXSA 1OYWA 2HR3A 3RJPA 4HX4A 4CGZA 2O03A 4CICA 3K0LA 2HDCA 2VT2A 1MGTA 3BPXA 4IXAA 3MCZA 1D3YA 3REOA 3LAJA 1HKSA 2EB7A 3L7WA 2ESHA 3O2PE 3WTWC 2V79A 4ZYHA 5CVRA 5L3CA 2F5DA 1OR7A 2ZCWA 3E97A 4IJAA 3MWMA 1H9GA 4KT5C 2K02A 4KYWA 2Q0OA 1KQ8A 3JW4A 3Q9SA 3DKWA 5FFZA 2PMUA 4NQWA 5FB2A 4IHTA 4WF2A 5A2QZ 4Z2YA 1F5TA 2Q8KA 1R5HA 5CLSA 4HLXA 4ZYEA 4RB2C 3I0TA 3M1EA 2R3SA 1TNTA 1HW2A 2GWRA 4L9JA 1FOKA 5LHGA 1BC7C 2IVMA 4MQVA 2XKPA 3KP4A 1YTYA 5DEQA 1P92A 3EETA 4ENKA 1FPQA 5L3FA 4RB3C 5FFXA 1IXSB 2K86A 2ZFWA 4R1HA 5CVVA 4HZFA 2VBZA 1PDNC 2FRHA 1WWXA 3GF2A 2MH2A 2OA4A 2XASA 2RDPA 5JR3A 4BHCA 3JTGA 1Z7UA 2P5KA 2YR2A 1V4RA 4A5NA 4HF2A 5H20A 3WU0A 3ZPLA 5D6FA 4M9ZA 1R7JA 4ENNA 4PZJA 1W5SA 2IA1A 1G3WA 3DXJF 5HDGA 2ZMEA 2IA0A 4KMFA 1Z1DA 2P7VB 3ROUA 1ZH5A 2G7UA 2GA1A 1IZ1A 4HW0A 4IRHA 3WGGA 4G7ZF 1QBJA 4L18B 1UHMA 1U5TA 3ISPA 3ZMUA 1DDNA 1SFUA 4AD9A 4I0AA 3QU3A 2JPCA 1WKMA 1SD5A 5D4SA 5IT9K 4U0VA 5AIQA 2QUFA 2FQ3A 1G3TA 4M71A 4ZYDA 3E6DA 2E1NA 4BH9A 2XRNA 2Y48A 4MTDA 4XLNF 1J2XA 3F72A 2OAZA 3WE2A 3L2CA 3QPHA 3KE2A 3VB2A 6PAXA 4UNOA 3P9CA 3T5XA 3WGIA 2PJPA 3KP2A 2EA2A 4WCGA 2P6TA 1YG2A 3R61A 2UXNA 5TJJA 5D5VB 1FBSA 3GVAA 5HS9A 3FX3A 2YX4A 2PFBA 3CO7C 4XRFA 3OV8A 4YIIA 1GVJA 1W4MA 3I5UA 4QLCU 3RTRA 1U5TC 3E6CC 1U8RA 4OU0A 3TOBA 3TQNA 4I01A 4I09A 4Y13A 4ENMA 1U6GA 1ZGJA 1BI0A 4UV8A 2P4WA 1H0MA 2HFHA 3GEZA 3LAPA 4G7HF 3GUDA 1XCBA 5EEGA 2H94A 4IVNA 4P55A 2ZNZA 4PGGA 3VEPA 1G6NA 1JGSA 4LLLA 4MQ9F 3WTTC 2HTSA 3VFZA 4U7BA 4PCQA 5E8GA 5DYMA 2IW5A 1FC3A 5TRDA 3Q5FA 4RAZA 3ZN0A 4LK1F 2VC0A 3CDHA 1B59A 2PN6A 3SFZA 4EVIA 5HDKA 5HLGA 1H9TA 4OMYA 3WE3A 1HSTA 1KU7A 5CVUA 4EM2A 2P5VA 4DNCA 2LF7A 1ZN2A 4OIOF 3SZTA 4HA8A 4EGYA 2A6HF 1QQIA 3JSPA 4IF4A 5HLIA 4HYEA 4IHSA 5DUIA 3COAC 1HXDA 3EDPA 1F1ZA 2OBPA 1S7OA 5E8IA 1XGMA 5LHIA 3E3VA 1YS6A 3ZMDA 1XMAA 2ZKZA 1Q1HA 1PP7U 1XCVA 3LWFA 2KIMA 3R60A 1BM9A 2EJRA 3FHZA 1O3RA 1IXCA 5AIPA 2QLZA 1R58A 3DFGA 3JAMK 4FX4A 1ZAOA 1Y0UA 2YSRA 2EFWA 3C7JA 1O3QA 3J81Z 2XV4S 1USSA 1XN7A 4R79A 1R1UA 5ILVA 3RI4A 5DD4A 4WWCA 4Y17A 1KYWA 1XGOA 4EM0B 5H6QA 2HYFA 2PBIA 4EGZA 5F1RA 3GFIA 4F7ZA 1FX7A 2MLKA 3PQKA 2BBYA 4M73A
chains in the Genus database with same CATH superfamily
1J09A 5KVRA 3H5AA 3ML6A 2RAEA 3DBRB 4DW6A 3CUQA 1K7AA 2QKMB 2DAOA 4RGSA 2DW4A 2FEZA 5CPRB 2Z33A 1T38A 2L4MA 4KUMA 1HOMA 2O61A 3HXLA 1MMDA 2FMYA 4KFCA 3CCYA 2XAUA 2KQRA 3K2ZA 2IS4A 2DMNA 3RPUA 4F52A 3LSTA 2DA1A 2R7ZJ 1LJ9A 1MIJA 2YU9J 2VODA 3K70D 3LSMA 2QZ8A 3KEQA 4BJ6C 4LJZF 1TQMA 3ULQB 3HJEA 2L7FP 1R4NB 2L0KA 2XAJA 3CCUI 5BMZA 3JRAA 2YS9A 2OV7A 2VQHA 2OQRA 2HVQA 1P9QC 2ISZA 2M7BA 3FISA 1TW2A 3U1KA 5M3FJ 3CC7I 2ME6A 5J6XA 2ZXJA 4HX8A 3JTHA 1VNDA 4Y7NJ 2K4BA 4AIKA 1IUFA 1TNSA 1YJNI 2VKDA 3ASOH 4H0EA 1WHUA 2KIFA 3FZVA 4CZZA 5F64A 1HA8A 1ETVA 2JUCA 1MDMA 4S05A 3DP7A 3C2HA 3T0YA 2YU3A 1EF4A 3GLXA 3J7AY 4KT6A 4DZPA 1YLFA 1D8JA 4I2OA 1BR2A 2NVUB 2CRGA 1LQ1A 4J19A 4PJ0C 4KIBA 1H88C 3KZYA 2ZJRF 1DGWY 2GXGA 1FSEA 1X3UA 3J80Z 4MNUA 3NWTA 2V9PA 2PI0A 1OISA 3ELKA 3I9V2 4AM3A 1BN5A 3R4KA 4K2EA 2VIXA 3C18A 5ILSA 2RC4A 2CUEA 3QPLA 3KP6A 5CYVA 2E1MB 2CSOA 2X0LA 2GA2A 2DBBA 2LSOA 5HODA 2M5WA 3GTMJ 2EIKH 4XN3A 5J1YA 1ENHA 3GYHX 1KU2A 2P81A 1DU0A 2EV5A 4F92B 4HRIA 4U87A 3HRTA 3ZMVA 2R7SA 2LNBA 1EH8A 3M8FA 4HF0A 3WTZA 3O8HA 3GWZA 3OIOA 4OIRF 4B48A 3OYLA 3MKYB 3J7AW 2RVCA 4P9UA 1FBQA 1O57A 2ICWG 5K1YA 4FQGA 3BY6A 1E3OC 2VPLA 3L00A 2LMDA 1A31A 3HRSA 1YRNB 4RS8A 2HZTA 1Y6IA 2EFNA 4DQ2A 3IRRA 2WAQA 3CCVI 2FBHA 2LFBA 2QWWA 2LY1A 2F5VA 3H0GJ 1GHCA 3BJOA 3MAJA 2KLOA 2LKXA 4Q5SF 1Z05A 1K6YA 4IEJA 2DFEA 1I6XA 3LSRA 2E60A 2XDVA 1VTNC 4HDUA 1B8IB 3CC2I 1AOYA 3IH3A 1I3AA 3CESA 1TP4A 4AVPA 3O3KA 3A2KA 4Q47A 2J5PA 2ZJ2A 4M9XA 3CQZJ 1B1BA 1WFXA 5IYBJ 1UHWA 3HKZN 1RC9A 2Z16A 4BBRJ 2XAFA 4ZTJA 3R6SA 3M1CA 1P4XA 1MJBA 4LLGF 3A01B 2XSDC 4CH7A 4WXCA 2OD5A 1LUJB 4IRIA 2DYRH 5HS7A 4UY8I 1X1DA 2R5YA 2F5CA 1I3QJ 1MMNA 3L9FA 1I50J 4YFXF 5J47A 2J5OA 1C0WA 2E36A 3TO9A 1FOXA 2E19A 2K5CA 1W7PA 1ZRFA 3OIPA 2D45A 3ERED 4OIPF 2ZXWH 3DBLB 3TO7A 5HOOA 5FLMJ 2R7RA 3TP0A 3IH2A 2M45A 1Z3YA 4BE2A 2BVMA 4UUTA 3HOVJ 2DFIA 4PDKA 3L2VA 2O8XA 1GXPA 4XL9A 3RPUD 4KIGA 3SYTA 1VQ6I 1S6LA 1E3PA 3WTYC 3TO6A 2EWNA 1GV5A 1P6RA 5F27A 3FK6A 4BE0A 1T8IA 4HBLA 2XIGA 4RB1A 1RIOH 1A36A 2MC4A 9ANTA 1IF1A 3VOEA 3BG6A 3BG7A 5M5YJ 4EJWA 4G94A 2DA3A 4UUSB 1BR4A 2ZNYA 2H6BA 3CCQI 2Q1ZB 4GFBA 3A0HC 4PFPA 3MKWB 1JE8A 2XGXA 3S1NJ 1W5TA 3D5LA 4HG2A 2OPTA 2DPUA 4DYCA 1B72B 2XAHA 4YG2F 2R7QA 4CCNA 1T39A 3DEUA 2RNGA 1JHFA 1IRFA 2M2EA 2MFZA 2W84A 3D0SA 4P9FA 5BOXA 2JMWA 2RQQA 2HTJA 3H36A 3K2AA 1KU9A 1O7LA 2XAGA 2R5ZA 5EGOB 1CF7B 5JI6A 4NUBA 2HKOA 1DUXC 3WTXC 3OSGA 3WG7H 3H9JA 4MEYF 1J5YA 1QPIA 3GO5A 1F36A 4XMYA 1I5ZA 3BG5A 3FIWA 1WCMJ 4KA4A 4QWQA 1USTA 2V4JC 3E6MA 4LG0B 2Z9OA 2YX7A 2H8RA 2LTPA 2KKOA 2BGCA 2JTVA 4HQMA 4D9JA 3RQ4A 3S1RJ 4EM1A 2PJRB 1DP7P 1X58A 3ABTA 3CCRI 3GBGA 2CQXA 2OCCH 2W25A 3IKTA 4MEXF 3CD6I 1Z21A 3VYRB 3F8FA 4B44A 2MUNA 4W1UA 3J7AO 2HS5A 2BW3A 2MC3A 4ABZA 2XVCA 2MYSA 2RQPA 5LGTA 3HDDA 4M74A 4V2FA 1OYYA 5IOZA 2H6CA 3D1NI 3K1MA 5FKOA 3DEWA 3DWLE 2R7UA 2NNNA 3HOWJ 1UG2A 3EQLF 3OIQA 2L4AA 1U78A 3IWFA 3V7RA 5FKKA 4A3DJ 3A02A 1IG7A 2M8EA 1K78B 2KZVA 1B6AA 3ERMA 1K61A 4JQFA 5D8LB 1ZR4A 2X98A 2EFQA 2F5EA 2M1BA 1OR7C 5ICFA 5JHUA 3LQRA 3ZQHA 2UUZA 3P5JA 3MKZA 1I6HJ 4ZDPA 1O3SA 3I4NJ 1LVKA 2P7CB 5E1WA 5JVTA 1MBEA 4PJJA 4B09A 3OYGA 5J4VA 4WX9A 1VQ8I 1ULYA 2W00A 1G59A 4RB0A 1WH5A 1BI3A 3HG9A 3OYIA 5L3DA 1UHSA 2IGKA 3F9KA 1SFKA 4D7MA 4YFNF 4C3HJ 4BQAA 2DU9A 3VSLA 3VPRA 1WJ5A 5FLXZ 4UVBA 1XGSA 2DYSH 4G8XA 1FOYA 1MNDA 1NG7A 4N9HA 5E79C 3UKGA 2AS5F 2DOFA 3M7GA 3BDDA 4ENJA 4EMSA 4LB5A 1IRXA 1W7PD 3TMOA 2JA2A 3SXYA 2E2JJ 1E3HA 3PFIA 2VQGA 4CDGA 3HKZA 4M9SA 3W2AA 2D1VA 2L7MP 3HSFA 1A6IA 2HYGD 3FXLA 3LNQA 4HNVA 1JHHA 2M0CA 2R7FA 1REPC 2XROA 2JRTA 4RLFA 3TDZC 3ZQ7A 4E4HA 4E7IA 4WXDA 2X1EA 3SDBA 3KPHA 4O5VA 5E1XA 3RPQA 2G0EA 3MVPA 3CMYA 5LD2C 2TDXA 4HLYA 4I98B 2Y2ZA 1K83J 2PEXA 3M9AA 3BJAA 4ZYGA 1Z6TA 3KEYA 4ETSA 1T95A 1WJDA 4QPQA 2QBYA 3F21A 1WJCA 2K4JA 4RGRA 5BS6A 4HV6A 5GTHC 1IC8A 1SC7A 1UCRA 3VDXA 1NG6A 2Q2EB 1TZLA 2CS3A 1Z9CA 2KRCA 1XDUA 5DD8A 2DK8A 2QF7A 3F22A 4ZZDA 4HV5A 3V4GA 5FRMA 5LBQA 2LVSA 4BQOA 2LDUA 4IHYA 5K5OA 2Z5UA 3KYCB 3RDIA 3QWLA 1EH6A 3V8LA 5LGNA 2DK5A 3H1CA 2LYCA 4L9TA 4CZCA 3HOTA 5HNHA 3K6GA 4FT8A 4XKWA 4BACA 1W36C 1WVRA 2KFDA 4YFKF 5DCMA 1KU3A 1T0FA 3GZNB 5IOYA 3Q9VA 1GVDA 4N4OB 4DIQA 4GYGA 5BQTA 1VQ7I 1HSJA 2M0MA 1ZG5A 2QA4I 4UVAA 3F8BA 2JSPA 2LC2A 2X51A 2CJJA 4F55A 2OZUA 3DU5A 4D7NA 1X2MA 1MBJA 1APLC 4D1QA 1RUOA 2UZKA 4Y15A 1ZRDA 3BQZA 3T8RA 2EH3A 1MSFC 3GMEA 2WADA 3BCAA 1V5EA 3QYFA 1VQ4I 4A3CJ 3K4CA 3QOEA 2Z1DA 4BHPA 3GFLA 2ZMEC 5J1RA 2IT0A 2ZJQF 1P4AA 4YIRX 2FUG2 1ON1A 3L2RA 3R0JA 1FTTA 5FD6A 5IP9J 3EYIA 1YI2I 4DJAA 2OZ6A 2R92J 2MD0A 3OYAA 4I0BA 1D1BA 2D2WA 3GZ5A 2L7ZA 2LY2A 2P0WA 3V42A 2UWMA 1WI3A 4LB6B 3I54A 5FD5A 1FYMA 1QZEA 2B63J 4Q4ZF 1IN6A 1Z77A 4M3EA 5CJ9A 3JRHA 3M4OJ 5DUKA 3RKYA 5LRSA 2L5QA 4A2UA 3SQNA 1MW7A 4I7HA 3DQVC 1N78A 1S9HA 2M34A 2HGCA 4FASD 2QQAA 5FRNA 2NVQJ 2JZYA 3MZYA 2DOEA 1XSXA 3IHUA 2JN6A 4KN7X 2QSHX 4HF1A 4RDUA 1W36D 2HDDA 4AUXA 2BHYA 1R1VA 1J9IA 4BNCA 2MA3A 3ZR8X 4V19K 1YX3A 2EZIA 2IGMA 4A3MJ 4L5IA 3BCBA 5D5XB 5D8KB 2VLAA 2ETHA 2M87A 4XM3A 3PQJA 3IAS2 2NS8A 4C3IJ 3MZ8A 4M6YA 1MBGA 2XF6A 1P7IA 2FBKA 5BNGA 3ZMTA 1RRJA 4E7KA 1FLIA 3BPVA 1QNTA 4BE1A 4XBFA 1V54H 4XLAA 3S17J 4XKCA 1F9NA 1KONA 1NK3P 1ZKGA 2NYXA 2CUFA 4ZDLA 1IN8A 2F6CA 2VT3A 2LD5A 3P7NA 4A0XA 2K85A 5FKLA 4A12A 5J8FA 3MFKA 2EIMH 3IL2A 3H5RA 3H3UA 2QQ9A 4XOTA 2XRLA 2COMA 2W48A 3NRVA 2VJJA 5JLXA 2L01A 1BBYA 1BW6A 3FXMA 3TW7A 4E7SA 1ZARA 1ZREA 4G6QA 1TWGJ 1ZYRF 4HQEA 4B43A 2CUJA 2HPIA 2Y31A 1LNWA 2Z99A 3DU6A 5IT9Z 4I99C 3HHGA 3WGHA 1Y56A 3B73A 4EJTA 5J3LA 3H9QA 4YEJA 3LFUA 3ZN1A 2QYOA 1YITI 2NOGA 1BIBA 3BOQA 4CO8A 3C1DA 1STZA 2LKSA 3CDIA 1WRJA 3N4MA 3AL0C 3FHNA 3HOSA 3WG9A 1LPQA 4LGWA 2FA5A 3OYDA 3BR0A 2KRHA 4MGRA 4E7ZA 5GADJ 3S2DJ 4AWXB 2VOPA 2MH9A 2H09A 1GDTA 2FNPA 1LDDA 3GTOJ 3OYJA 2HOEA 3QP6A 3KLNA 2HDWA 3BR2A 3LQQA 4KITB 3PIPF 3L2WA 4IQJA 3BLYA 3AG2H 4GYIA 5J1UA 4HNTA 3BR3A 1TW3A 2IBDA 3W2VA 5LFAA 4A3KJ 4LFUA 1DU6A 3CP8A 5E20A 2DTRA 2CQKA 1XD7A 3R0AA 4M72A 5ICEA 4ZJZA 2XHKA 3L1PA 1JT0A 3AG3H 1POGA 2ZMEB 2K7LA 2VE9A 2LG4A 4U0YA 3OR2C 4CCMA 1ZRCA 2D1HA 1KGSA 2EQRA 4RAYA 3RIRA 2K3PA 2HKXA 3OOUA 1IW7F 1MH3A 5GTIC 2DLLA 4M6XA 2HNHA 4CCLA 4IO9F 3S93A 3HM5A 2GIVA 1FP1D 1U5TB 1PVEA 1VQ9I 1HC8A 3LSGA 4JBAA 4B8XA 1XTAA 4FE7A 2MBFA 5EF6A 2HQAA 5HDNA 1WJEA 3EYYA 2VXZA 3KYDB 2Y30A 1ZELA 1HW5A 4AU7A 3RKXA 4A6DA 5IT3A 3OYMA 5TGTA 4XIDA 4HSTA 2M7AA 2UXXA 1T33A 2DMQA 2ELJA 3DCFA 2ELHA 3CZ6A 1BI2A 4EQQA 1AWCA 2EV6A 3D5RC 2DDAA 3JCUC 5LEJA 3F8CA 4ZZLA 2NS7A 1AKHB 2A07F 2CMPA 4AYBA 2VI6A 4Y4RA 4BAYA 4QTRA 4H4KC 1H89C 3H35A 1B9MA 3I59A 3LSIA 1R4MB 3ECHA 2RV8A 3F6OA 1FMWA 3FXUA 2E7XA 3VYTB 2EBIA 1T56A 2DXIA 5IT9R 4P96A 1RNLA 1ODDA 3BROA 1S8NA 2VQLA 3DPTA 1XS9A 3G6EI 2V9VA 3BR1A 1JKPC 4L5JA 2HZDA 3E5UA 4E7JA 4BUPA 5F0HA 3ZQCA 3IV5A 2GAUA 2BOLA 3IRQA 2A3SA 1B4AA 4FX0A 1YO5C 1KA8A 3BTLA 1RZ4A 3KLOA 2IRFG 4MLOA 2M3AA 5B1AH 3DKYA 4O3MA 3TP3A 2EK5A 1XG1A 1D8KA 1L3LA 3I4PA 2G9WA 4AC0A 1MJ9A 3K9TA 4HPQA 1WPKA 4P5OA 1A04A 5LRRA 2CV0A 1X3ZB 2CG4A 2A6TA 5CVIA 2LOOA 2W1OA 3OS0A 1D5YA 2LF8A 4X6AJ 1MZBA 3TL4X 3GW2A 4U0WA 2QENA 3CUQC 3HHHA 4WK8F 2CWEA 1UFMA 5K5RA 4XLFA 1SD6A 2CQ7A 5B5EC 2ZB9A 2BZTA 3S1QJ 5LLQA 4AIJA 3J81R 5L3GA 2XF7A 2Z3YA 5FKNA 3S2HJ 5KNLA 3OY9A 1UJ8A 2QQBA 2WV1A 1JT6A 4RM3A 3AL0B 3BT9A 4RAFA 2CW0F 5JFRA 3IWZA 3HOXJ 2E34A 3E6BA 2BY3A 2V9KA 4RGUA 2HYJA 1XPXA 1AHDP 4I76A 1SD7A 2E7WA 1YHQI 3TDUC 1SEUA 1QHGA 3LOCA 2A61A 3V8KA 1Z91A 2PX9A 1OCOH 2DQRA 3JAMZ 5A2QK 1V5GA 2V1XA 1GLNA 2OQGA 3OL3A 2HVSA 1FNNA 2NS0A 2BXZA 1KQ9A 1MKMA 1TQIA 3ABUA 3SFIA 1N77A 3GZ6A 3ONQA 2VQCA 1P4WA 1ETWA 2EFOA 1LKXA 4XRSG 3GTPJ 1J7KA 1GXQA 1TLHB 1K79A 2L54A 1MD0A 1N25A 2JA7J 4EATA 1O3TA 2KJCA 3K4JA 3ABMH 1R1TA 2RGVA 3NEUA 1FY7A 1ETQA 4LIUA 1GT0C 1ONVA 4CA0A 1RUNA 3WODF 2HQNA 4IOAF 2KZGA 2W82A 1HKTA 5E17F 2LLKA 3TBIA 1PUEE 2X4HA 2QKLB 3AKZA 2MSYA 3BC8A 1S5LC 1OLTA 3GTKJ 2KL4A 1SVOA 4A3EJ 2OC6A 5C3EJ 3F23A 1FTZA 2WWYA 2DN0A 1I27A 1MMAA 2VXDA 2LBFA 3V7CA 2Y0SN 3J80R 3ECOA 3SZGA 4IOCF 4MIMA 1JKQC 1FIAA 2K40A 1LEBA 1QVUA 1S72I 1WI9A 3MKLA 2PLYA 3JSOA 3CCLI 2FD5A 1IRGA 2M35A 2KJBA 2BY1A 1LE8A 2QM3A 2VASA 2MZ4A 2X6OA 2BY2A 2EA4A 5K7FA 2FJ1A 2DFHA 1DPUA 2P8TA 3KZZA 2VUMJ 4HNUA 5BPIA 2CQNA 2JA6J 3FM3A 4B47A 5CVJA 1I1SA 2CFXA 2R7VA 1FIPA 1TWCJ 2EZLA 1YW7A 3F0CA 5TISC 4XN0A 4XLHA 3OMYA 2E1OA 3G4SI 4B1RA 5L3EA 1E0EA 1OMIA 5EG0B 1LEAA 2O8KA 3RKWA 3B02A 3OYCA 1ZG1A 3PNYA 2BV6A 3CUQB 2E2HJ 2C6YA 1RKTA 2ECCA 3ABLH 3K4MA 1X1AA 1TWFJ 2K27A 4A0YA 1W0UA 4E7HA 2R0QC 2STTA 1NHAA 4EV0A 4XKVA 1TBXA 5LGUA 1SANA 3FMSA 3I59B 3BR6A 4LLNA 1BL0A 1X4OA 1PP8F 2VKHA 3K10A 1XC5A 4HDVA 1ZGAA 3BWGA 3BR5A 3HPGA 1JGGA 5EJCA 2NNYA 3ZQQA 3HZJA 2L9VA 3N97A 4CHUA 2HEOA 2K3FA 3DKXA 3O6BB 1JJ8C 5K5QA 3KX2A 3I71A 5KCMA 3OS2A 1S3JA 1XSVA 3HTSB 4L0YB 4A3LJ 2OUMA 5D5UB 2JK3A 2VKVA 5IYDJ 3BG3A 2E71A 1XMKA 5DV5A 3OYNA 3CJTB 2ACJA 4S0HB 3E0JB 2DPDA 2MG4A 3EUAA 3M07A 1BJZA 3ZGKA 2IPQX 2V1DA 2FMLA 2BEOA 1MDMB 4IX7A 1U2WA 3QOPA 3S8PA 2Y69H 2BVLA 1CGPA 3RSNA 5ED4A 3QYBA 1ON2A 2JT1A 4J00A 4ASNA 3LA2A 1OYIA 2DA5A 3Q3SA 4DGWB 5LEKA 2YPRA 1TL8A 2GZWA 2ZSIB 3UNGC 3G3ZA 4A3JJ 4L9VA 5B3SH 1WJFA 3HB9A 1ZTRA 4OAZA 4CUGA 5KAIC 4A3IJ 2VJ4A 3CO6C 4XICA 3CMAI 2LRDA 2W4SA 1IN4A 2X9DA 4BXFA 1M1EB 1YQAA 3SHFA 5E3NA 2DT7B 5CKTA 3GFMA 2X1CA 3PNVA 1QHHD 2E1CA 1OKRA 2WTEA 2Y9ZA 4NDLA 3BP8A 2JJ7A 1R49A 1SAUA 4KMUX 1KZHA 1D0YA 3AG4H 4LIVA 4GO1A 3FM5A 3PL8A 3CF2A 4FCYA 1FEXA 4BKXA 1X1CA 4JX4A 3CJNA 3U2RA 4L0ZB 2LKPA 3GTGJ 5HNFA 1I1GA 1JKOC 3SEZA 2ISYA 4IRGA 4NC6A 2R7XA 2XPWA 4U7DA 2DOAA 4UB8C 1TC3C 3HRUA 5F6FA 2VJ5A 3I3LA 3HUGA 1KQ0A 4BDYA 3DPUA 3HRMA 2V26A 2FOWA 2MVTA 2X6YA 2JWTA 1G3SA 3HPHA 2HU9A 2XB5A 3VODA 4F93B 3VWBA 3TOAA 1T98A 2XGEA 4ESBA 3S2WA 2F2EA 3KFWX 3BJ6A 5IYCJ 2D5VA 3N05A 1YW8A 2DO7A 2A05A 4JK1X 1ZLKA 3BTJA 2Y0SA 3L2QA 1J75A 5F1JA 2CYYA 1SD4A 1VF9A 3WHBA 3ZQLA 4M6VA 2R5YB 1WSUA 3DTEA 5B1BH 4CCJA 2HXOA 2NOJB 4XSXF 5IP6A 1XGNA 1F43A 2HOAA 1IDZA 1W7PB 4YIFA 5DDGA 3HTUA 3W6KB 2W7NA 2JA8J 3DF8A 3IC7A 4UV9A 2IEKA 4XR6A 3PUFA 1HDDC 2VOOA 1IXRC 4DBRA 4XOPA 1UB9A 3BZKA 3L09A 2X85A 3K4BA 2GOMA 3MQ0A 4G9YA 3OYHA 2MLGA 1NH3A 1G3YA 2FE3A 2KRFA 1VQNI 1HQCA 2LBFB 1QZYA 3FXQA 1QZZA 1PUFA 3OS1A 5FLXR 1LDKB 2FU4A 5H6RA 3DLAA 1IN5A 2DA2A 4HAMA 1FWZA 1IAWA 4OMZA 3V7SA 3GCMA 2X48A 3Q0UA 3CCJI 3ESWB 1PJRA 5EDNA 3IKVA 1LE8B 3F6VA 5JHFA 4NBQA 3M8JA 2XAQA 1OPCA 1T2KA 2EV0A 1YS7A 1TTYA 2DI3A 2PQ8A 2DQLA 2KDOA 4BY1J 3HSEA 1RESA 4AYBN 2IAIA 2M30A 4YELA 5M5WJ 4F91B 3NWSA 3ZMSA 4M3GA 2ME0A 4A0ZA 5HS8A 3LSJA 3U9GA 3S15J 2R5ZB 2AQFA 3CUOA 4X1EA 4BL0B 1FBUA 2F5FA 3FMRA 2DFFA 3QPTA 4E70A 4UHTA 2K9QA 5DS9A 1VQPI 5GAHJ 5E3MA 2VN2A 1T0FC 4CXFA 2HVRA 3GXOA 3DPLC 4JX6A 3J81K 4OOIA 1LDJA 4PGHA 1BW5A 3JRDA 3ASNH 3G1MA 2H27A 2IS2A 1GV2A 3FXOA 4XSZF 3LSHA 2CW7A 5KK1A 4CYDA 2QSGX 2DT5A 1NTCA 4ZDOA 2K9MA 3PM1A 4IHXA 2FNAA 4KICA 2CGPA 4S04A 3TGNA 1Y0NA 3TW6A 2F4OB 2BW3B 2FSWA 3ZQGA 2KDZA 5D5WB 2EILH 4O6JA 3BQYA 1K6OA 2OU2A 5ICGA 3KYLA 1ZLJA 3FWEA 1DGRM 3S16J 3HBLA 5DM6F 2VBXA 3KP5A 1BIAA 3CCEI 1BOAA 1V3FA 5F0CA 4GXOA 1E2XA 3E5XA 4I02A 3JRBA 2CO5A 2JA5J 2FX0A 2DA7A 5C4JJ 4XLPF 1X1BA 1R71A 3E1SA 5J4YA 1O4XA 2HXIA 3OL4A 4FHTA 2ECBA 5J8CA 2CV2A 2BHZA 2PMZN 4DBQA 5M3MJ 2PMHA 1FYKA 3G1OA 2K9NA 3PUBA 2GXAA 5J40A 2STWA 2VBWA 3IAM2 4E6KG 3ZQIA 3QP5A 2ADUA 3FMQA 3FK7A 3J7YJ 3KZIC 3VYSB 3KCCA 3PSIA 2LH9A 1R36A 1TWAJ 4MO7A 4TV7A 4B3AA 5AONA 2HWVA 2E2IJ 3BZ6A 4LITA 1YRNA 2ZXIA 2DTZA 2DJNA 4ON0A 1R00A 1BOBA 3WU1B 5ILUA 3I55I 1XDSA 4KJZA 3H3VK 3QYEA 2A6EF 2PG4A 2OTJI 4KN4X 3HOUJ 2EFPA 2ZBKA 4B3XA 2FF4A 1B8IA 2CH0A 5FROA 3IH4A 5C4XJ 1QRYA 4RA2A 4BHBA 1YYVA 4UUVA 2KIUA 2W57A 1S29A 2Y0MA 3FF5A 4JOMA 1Z6RA 2AXLA 2R7DA 3QU6A 4ZTFA 4EJUA 1D1CA 1YIOA 3A01A 3VSKA 3Q0VA 4AIDA 2WB1A 2XKOA 3KETA 1FZPB 3LMMA 1IJWC 3CDLA 4UXNA 1U3EM 2IA2A 3HIFA 3JREA 1NK2P 3J80K 1W5CC 2ZSHB 4A5MA 1YW9A 2JVGA 3W6VA 1HBXG 3DTKA 4BS9A 4GCVA 1MMGA 3ZCOA 2XPUA 4NNJA 3RYRA 1LFBA 1FYLA 2QBYB 2HQ5A 3HSRA 2DMTA 1OFCX 2VE8A 1SAXA 1VZ0A 4MTEA 5D4RA 1UZCA 4D0PA 1AU7A 4IZZA 1JTXA 3LFKA 1SFEA 4C30A 1G4DA 4N4NB 4PUSA 2GM4A 3FBNB 4PK4A 2CU7A 3FXKA 5B66C 3M8EA 1IO2A 2L02A 4C9YA 5EYRA 2B0LA 3GTQJ 1MSEC 3P9KA 1T08B 4CCOA 3I58A 5E3OA 1BC8C 1HW1A 5E1ZB 4F3QA 1IN7A 2H1LA 4BYYA 3NARA 3TKYA 2A69F 2GOXB 3H92A 4YRVA 4NHJA 4UUSA 3I64A 4BQNA 3CLOA 5DM7F 5DCMB 1BJAA 1WQ2A 2GLOA 3AFHA 1FSHA 4IPAA 2M9HA 3ZQFA 1J59A 1XB4A 2VBYA 2JVHA 3S3OA 1UG0A 5ERIA 1B72A 3K1NA 1FP2A 1JUSA 5FGMA 3CJQB 2IP2A 5HLHA 3RYPA 5E18F 3PJRA 2MW8A 1SFXA 3FDYA 4NC8A 2NRAC 2NVYJ 3C2GA 1WGXA 4WXHA 5EGOA 2KP6A 2WBMA 2KISA 3NAUA 5DTDA 5CQEA 4M3BA 1CF7A 4KISA 3HYIA 1Z3XA 1X2NA 1R5GA 4EJVA 3HEFA 3X2QH 4BXUA 2BYVE 1T6SA 1BI1A 4PFOA 4LG0A 2HQRA 2JSCA 2DMUA 2IJLA 3AAFA 3NQOA 1EV7A 3RCOA 3U21A 2PJRA 1OJLA 2G7HA 2JPBA 4LOCA 1YIJI 3V8JA 2LREA 4CCKA 1HDPA 1OCPA 2ZJPF 1ZR2A 1D1AA 4KIFA 5KAFC 2V6CA 2FXAA 1KYZA 2E5NA 2L3DA 1MNMC 4A6EA 4MHGA 2A5YB 5BPDA 2VC1A 4FISA 3KP3A 2R7TA 1U0JA 1QO0D 2LK2A 1SMYF 2A68F 3MEXA 1XMXA 2R7OA 1B9NA 4G6DA 1MNEA 4ESFA 2EZKA 1S7AA 2WV0A 4D5CA 1V5FA 4LMYA 2A5WA 2NXNB 3I53A 4HOBA 4A69C 1K78A 1A5JA 3CLQA 1MJAA 4BQQA 2PMZA 3GFJA 2DA6A 4D5FA 4DZJA 1O7FA 3DV8A 1EKEA 1SFOJ 1L0OC 4UVCA 2I5UA 4FETA 4IHVA 1ZG3A 1K4TA 3EPZA 4MFEA 2ZO4A 2O0YA 2W85A 3B6CA 3CP2A 4OINF 4XRMA 2JRMA 1DPRA 2Y75A 4N9IA 3T1BA 3K4NA 1LB2A 4P1WA 3T8TA 4ZH4F 5HVQC 3HGGA 2P0TA 5ICCA 4II3A 5FLVA 2BE5F 3H3ZA 2GXBA 2NAZA 1TWHJ 3WTUC 1P2FA 1TT5B 3E7LA 4OWRB 3J7ZI 1VQLI 1UAAA 2O5RA 4FTHA 3P9IA 4OIQF 1JTYA 1MH4A 2O3FA 3IP4B 3OOPA 4C3JJ 5IP7J 4BEHA 1QGPA 3ZMZA 2ZFUA 1F4KA 4L9NA 5L3BA 3EUHA 3BTIA 3G73A 1YJWI 4JYKA 2MD5A 3GX4X 1IV6A 1HLVA 2IGNA 4KNYA 2IXSA 2O6GE 2ESNA 2LR8A 3K69A 1ZHFA 2FOKA 2FQ4A 3G2BA 2WY7Q 3LA3A 2L9RA 2NVXJ 2RKHA 1IDYA 3KEOA 3K1PA 3U1DA 1JJ6C 4Z6YA 4G7OF 4FE4A 1A35A 4N0BA 1QVTA 4AIHA 4X0GA 4QSHA 1I39A 4LK0F 1YFHA 2XB0X 3C3WA 4KDPA 1R22A 2XUBA 3F3XA 4R8HA 2L2OA 5D6EA 4U88A 4EJOA 2RN7A 1ITYA 2GQQA 3H5NA 3L2UA 2QVOA 1FT9A 3S1MJ 2ELKA 3ZRGA 1P7JA 4QIWN 3I56I 2OJED 3WTSC 1BR1A 2QGUA 2AO9A 3DEEA 5EEHA 2F48A 2VONA 1QPMA 4XNFA 1J0RA 3WTVC 3CMEI 3W3CA 2Q2EA 4RGXA 4XONA 1G2HA 1EH7A 3RQIA 5DCFA 1K4SA 4DOZA 1Y8QB 1TQPA 2P6SA 3ZP5A 4LD5A 2V1UA 2KHMA 3WU2C 3FXRA 2RNJA 4Q48A 1LFUP 2P5LC 2V1NA 3KP7A 1XSDA 5FO5A 5LHHA 4HX7A 1GUUA 2WC2A 1ORKA 1IUYA 1JUPA 3H0DA 1RI7A 2Y9YA 5FLXK 1LVAA 2QSFX 2BXYA 3MZHA 3LA7A 2XGDA 3SZPA 1R23A 4NB5A 4C2UA 1HKQA 2KT0A 3EUHC 2W24A 3CTAA 4ANJA 3QRFF 5C44J 3QAHA 3PO2J 4ESJA 2DMPA 2RREA 1E17A 1SMTA 4GGGA 1FJLA 2FBIA 2JUGA 3E5QA 1D5VA 3W6JB 3PO3J 3HOZJ 3F8MA 3F8NA 1JXSA 1OYWA 4ZC3A 2HR3A 3RJPA 4HX4A 3H9GA 4GDFA 1YX5A 2COBA 2O03A 5KHDA 4CGZA 2IS1A 4BU2A 1ETYA 4XORA 3B6AA 1A6QA 2EZHA 4CICA 3K0LA 2HDCA 2KIQA 3S14J 4BBSJ 3BG9A 2VT2A 2CFOA 1MGTA 3BPXA 4IXAA 2WY8Q 2K9LA 3MCZA 3JAMR 4Y33A 1D3YA 3REOA 4IL6C 2X6WA 3LAJA 3M3YJ 1HKSA 2EB7A 3L7WA 1S7EA 4IQ4A 2ESHA 3O2PE 1RPWA 2DJIA 3WTWC 2V79A 4ZYHA 5CVRA 5L3CA 1OQYA 1VQMI 2F5DA 4B4CA 4XLEA 1OR7A 3FXJA 2ZCWA 3ABKH 3CCSI 3E97A 1IRZA 2QCOA 4NC7A 4CSWA 4XK4A 2B9SA 5EEAA 4IJAA 3MWMA 1H9GA 4KT5C 2K02A 1ETXA 3BTCA 4RLQA 4KYWA 2Q0OA 1KQ8A 3JW4A 3Q9SA 2HOTA 3K4LA 3DKWA 1X1PA 1SVLA 5FFZA 2PMUA 3MN2A 1QA6A 1VQKI 4NQWA 5FB2A 1IGNA 4HSRA 1BA5A 1IV8A 3EUKL 4IHTA 4M3FA 4WF2A 5A2QZ 4Z2YA 1W1WE 1F5TA 3CC4I 2Q8KA 1FOWA 1R5HA 1X19A 1Y39A 2DT6A 4G6TB 5GAGJ 5K7HA 1UELB 4HLXA 5CLSA 1DP3A 2AXTC 1YOVB 2VJIA 4J01A 4ZYEA 4RB2C 2K9SA 3I0TA 4PSWA 4A3BJ 3G1LA 2R3SA 3M1EA 2DCEA 4BXXJ 3DBHB 1TNTA 3HGYA 1HW2A 2GWRA 4RMNA 2Z2SB 4L9JA 2CQQA 1FOKA 3I4MJ 2OCEA 4L5EA 3CMMA 5LHGA 2XPVA 3RZDJ 1BC7C 3C2BA 2L9NA 2IVMA 3Q0WA 4MQVA 1Y1WJ 1RR8C 1WH7A 2XKPA 3KP4A 1YTYA 5DEQA 1P92A 3LSPA 2KMUA 3DTIA 3EETA 4ENKA 1FPQA 2M4GA 5GAEJ 2GBYA 4V2GA 3SJMA 5L3FA 1XX5A 4I6ZA 4RB3C 3OWTA 5FFXA 2H8WA 3PSFA 1IXSB 3OR1C 2XC7A 2K86A 4A3GJ 3SEQA 2ZFWA 4R1HA 5HLTA 3RKQA 5CVVA 4IKFA 4HZFA 2VBZA 3GTLJ 3HC7A 1VFCA 3W2WA 1PDNC 2FRHA 1WWXA 4BEHB 5GPCA 3GF2A 2MH2A 4XKBA 1TT0A 3FKIJ 2OA4A 2XASA 2RDPA 3SDGA 5JR3A 4BHCA 1Z0XA 3JTGA 3JRCA 1X4PA 1Z7UA 2P5KA 2YR2A 1V4RA 3FBIB 4A5NA 2IS6A 2MGQA 1R9TJ 4HF2A 1UMQA 4QPOA 5H20A 4ITVA 3WU0A 4HEA2 3ZPLA 5D6FA 1N75A 3HL2A 5F04A 4M9ZA 1R7JA 4ENNA 2WB1N 2YUSA 1JKRC 4PZJA 1W5SA 2IA1A 1G3WA 3G71I 3KIOA 1Z67A 2H1KA 5A2QR 1VQ5I 1MMSA 5JVGF 4II2A 2E5ZA 3DXJF 5HDGA 2ZMEA 2IA0A 4KMFA 1Z1DA 2JQ7A 2UV1A 1AA7A 3LSKA 2P7VB 2AHQA 3ROUA 1WJBA 1ZH5A 1ETOA 2G7UA 4A93J 2GA1A 1IZ1A 4HW0A 4IRHA 3WGGA 4G7ZF 1QBJA 2N8GA 4CYCA 4L18B 1FMVA 1OCZH 1UHMA 1U5TA 3ISPA 3ZMUA 1YJ9I 1DDNA 1SFUA 2XF5A 4AD9A 4I0AA 3QU3A 2JPCA 1WKMA 1SD5A 5D4SA 4EEFG 5IT9K 4U0VA 2OTLI 5AIQA 2QUFA 5EZHA 2FQ3A 1ZGWA 1G3TA 2VB6A 3A4CA 4M71A 3ZXSA 4C2MJ 3K7AJ 3QODA 4ZYDA 2TRTA 3E6DA 2E1NA 4PJLA 2XRNA 4BH9A 5JLWA 3JRGA 2Y48A 4MTDA 4XLNF 2VKEA 1J2XA 3F72A 1AKHA 2OAZA 3WE2A 3L2CA 1EJ9A 3QPSA 3QPHA 3KE2A 2KPMA 3VB2A 6PAXA 4UNOA 5M5XJ 3P9CA 3T5XA 3WGIA 2PJPA 3BZCA 2WAFA 3PIOF 2ZC2A 3KP2A 1WJAA 4IHWA 3PNTA 1RR7A 4DYRA 2EA2A 4WCGA 1VI0A 4PJNA 1G8XA 3QQAA 2P6TA 1YG2A 2EINH 3R61A 2UXNA 3MMYB 1OCTC 3HOYJ 3PFYA 1MBHA 1Y1VJ 5TJJA 4JX5A 5D5VB 1FBSA 3OYBA 2R93J 3GVAA 1ETKA 5HS9A 1RKWA 3FX3A 2YX4A 5CQGA 1CQTA 2VPRA 2PFBA 3CO7C 3OYKA 4XRFA 1R6RA 2F4IA 1JI8A 2TCTA 3OV8A 2EIJH 4YIIA 1GVJA 1W4MA 3I5UA 4QLCU 1WZ2A 3RTRA 1U5TC 3E6CC 1U8RA 4OU0A 3TOBA 2B7EA 4MFDA 2R4GA 3TQNA 1Q1VA 4I01A 4I09A 2XGCA 4Y13A 4G12A 4ENMA 1HF0A 1U6GA 3JRIA 2L7KA 3ZOBA 3O8GA 1ZGJA 1RETA 1ZQ3P 1BI0A 3FKJA 4Y52J 4JP0A 1MBFA 4NQWB 1JUMA 2WAEA 4PJMA 4UV8A 1MBKA 5F0FA 4A3FJ 2CV1A 2P4WA 1H0MA 2HFHA 3A03A 3GEZA 1OCCH 3LAPA 2I10A 4XRSA 2NVTJ 1EA3A 4G7HF 3GUDA 1XCBA 2I8DA 5EEGA 3S32A 2LP0A 5FJ8J 5K7ZA 2M4KA 2H94A 2DODA 1W0TA 2GIZA 3D5SC 3DLLF 4IVNA 1U8BA 5IY5H 4P55A 2X1DA 5H2FC 2ZNZA 3CF5F 3A0BC 4PGGA 4BY7J 4W97A 4XLCA 2CW8A 3VEPA 1G6NA 3OSFA 1ZK8A 5GPAA 1JGSA 3MD2A 2O7OA 4LLLA 4RAGA 4MQ9F 3WTTC 2DA4A 2HTSA 2LY9A 3AG1H 5EZGA 3VFZA 4BJTA 4U7BA 4PCQA 2HPMA 3S3MA 1YE9A 5F08A 2HI3A 4BJ5C 5E8GA 1VQOI 1H8AC 5DYMA 2IW5A 2M8GX 1FC3A 3IUOA 5TRDA 3Q5FA 4RAZA 3ZN0A 2ZXHA 4LK1F 2VC0A 3CDHA 4BDZA 3LL7A 3RZOJ 1ACIA 1B59A 2PN6A 3SFZA 4PSXA 4EVIA 5HDKA 5HLGA 3UR3C 1PYVA 1H9TA 3WHCA 4XQFA 4OMYA 3WE3A 3TEDA 2VL8A 1RQ6A 1HSTA 4UB6C 1KU7A 4ZYAA 4C2TA 5CVUA 2XSJC 2ID6A 4EM2A 2L9SA 1ERDA 2WA0A 1SVMA 2P5VA 4DNCA 1Y8RB 2LF7A 1ZN2A 5FKMA 4OIOF 2CUZA 3SZTA 4GRIA 4HA8A 2ID3A 2WAQN 5GP9A 4E7LA 5E3LA 2F4MB 4EGYA 2A6HF 1QQIA 1X3WB 4IF4A 3JSPA 5HLIA 4HYEA 4IHSA 5DUIA 3COAC 2E1MC 1HXDA 3S3NA 3A52A 3EDPA 1F1ZA 1DQUA 2OBPA 2DDBA 1S7OA 3GTJJ 5E8IA 3K70C 3HUGB 1XGMA 1OCRH 5LHIA 2HOSA 3E3VA 3GLLA 2V6EA 3OYEA 1YS6A 3ZMDA 1XMAA 2ZKZA 4AVZA 1Q1HA 2OF7A 1PP7U 1XCVA 3OYFA 3LWFA 2E35A 2KIMA 3R60A 4RM2A 4BGDA 1BM9A 3CJRB 1HCRA 2EJRA 1V55H 1U9OA 3FHZA 1O3RA 1IXCA 5AIPA 3VYUB 3JRFA 2QLZA 1R58A 3DFGA 3JAMK 2MABA 1D0ZA 5IPAA 4FX4A 3A1YA 1ZAOA 1Y0UA 2O9LA 2EPFA 2YSRA 2QEXI 2EFWA 4Y3OA 3C7JA 1QU3A 2V7FA 2R7WA 4M3DA 1O3QA 3J81Z 2XV4S 2QQ8A 1R5ID 1USSA 1XN7A 1LFPA 4OAYA 4R79A 1R1UA 5ILVA 2IGOA 3RI4A 1D0XA 4CYCB 2BY0A 4RBOA 5DD4A 4WWCA 4Y17A 1KYWA 1XGOA 2AQEA 4EM0B 3K4KA 5H6QA 2HYFA 2PBIA 4EGZA 5F1RA 2X6XA 1U9NA 4LG3A 4F7ZA 1FX7A 2MLKA 3PQKA 4DYQA 3GFIA 2BBYA 5EG0A 3JR9A 4M73A 1Z7LA 3CCMI 1PUFB
chains in the Genus database with same CATH topology
5KVRA 3ML6A 3CUQA 1K7AA 2DAOA 4RGSA 2DW4A 2FEZA 2Z33A 1T38A 2L4MA 4KUMA 2O61A 2FMYA 4KFCA 3K2ZA 3RPUA 3LSTA 1LJ9A 2VODA 2QZ8A 3KEQA 4LJZF 1TQMA 3ULQB 2XAJA 5BMZA 2OQRA 2ISZA 1TW2A 5J6XA 2ZXJA 4HX8A 3JTHA 2K4BA 4AIKA 1TNSA 4H0EA 2KIFA 3FZVA 4CZZA 5F64A 1MDMA 4S05A 3DP7A 3T0YA 2YU3A 3GLXA 1YLFA 1D8JA 4I2OA 1LQ1A 4KIBA 3KZYA 2GXGA 1FSEA 1X3UA 3J80Z 4MNUA 2PI0A 3ELKA 1BN5A 3R4KA 4K2EA 3C18A 5ILSA 2RC4A 3KP6A 5CYVA 2CSOA 2X0LA 2GA2A 2DBBA 2LSOA 2M5WA 3GYHX 1KU2A 2EV5A 3HRTA 3ZMVA 2LNBA 1EH8A 3M8FA 4HF0A 3WTZA 3GWZA 4OIRF 2RVCA 4P9UA 1FBQA 1O57A 5K1YA 3BY6A 3L00A 3HRSA 4RS8A 2HZTA 2EFNA 4DQ2A 3IRRA 2FBHA 2QWWA 1GHCA 3BJOA 3MAJA 4Q5SF 1Z05A 1I6XA 1VTNC 1AOYA 4HDUA 4AVPA 3O3KA 4Q47A 2J5PA 2ZJ2A 4M9XA 1B1BA 1UHWA 2XAFA 3R6SA 1P4XA 1MJBA 4LLGF 4WXCA 2OD5A 4IRIA 5HS7A 2F5CA 3L9FA 4YFXF 2J5OA 1C0WA 3TO9A 1W7PA 1ZRFA 2D45A 3ERED 4OIPF 3TO7A 5HOOA 2M45A 2DFIA 4PDKA 2O8XA 1GXPA 4KIGA 1S6LA 3WTYC 3TO6A 2EWNA 1P6RA 4HBLA 2XIGA 4RB1A 1RIOH 1IF1A 3VOEA 4EJWA 4G94A 2ZNYA 2H6BA 1JE8A 2XGXA 1W5TA 3D5LA 2DPUA 2XAHA 4YG2F 1T39A 3DEUA 2W84A 1JHFA 1IRFA 3D0SA 5BOXA 4P9FA 2HTJA 1KU9A 1O7LA 2XAGA 1CF7B 5JI6A 2HKOA 1DUXC 3WTXC 4MEYF 1J5YA 3GO5A 1I5ZA 4KA4A 4QWQA 1USTA 3E6MA 4LG0B 2Z9OA 2YX7A 2KKOA 2BGCA 2JTVA 4HQMA 4EM1A 1DP7P 3ABTA 2W25A 3IKTA 4MEXF 3F8FA 3J7AO 2HS5A 2MC3A 2XVCA 2RQPA 5LGTA 4M74A 1OYYA 2H6CA 3K1MA 2NNNA 3EQLF 1U78A 2L4AA 3IWFA 3V7RA 2M8EA 1K78B 1B6AA 4JQFA 5D8LB 2EFQA 2F5EA 2M1BA 5ICFA 5JHUA 3LQRA 1O3SA 2P7CB 5E1WA 5JVTA 4B09A 4WX9A 1ULYA 4RB0A 1BI3A 5L3DA 4YFNF 4BQAA 2DU9A 5FLXZ 4UVBA 1XGSA 4G8XA 4N9HA 2AS5F 3M7GA 3BDDA 4ENJA 4EMSA 4LB5A 1W7PD 3SXYA 3PFIA 4CDGA 4M9SA 2D1VA 3HSFA 2HYGD 1JHHA 2R7FA 1REPC 2XROA 2JRTA 3TDZC 3ZQ7A 4WXDA 5E1XA 4O5VA 3RPQA 2TDXA 4HLYA 4I98B 2PEXA 3M9AA 3BJAA 4ZYGA 1Z6TA 4ETSA 2QBYA 3F21A 2K4JA 4RGRA 5BS6A 4HV6A 1UCRA 1Z9CA 1XDUA 5DD8A 2DK8A 3F22A 4ZZDA 4HV5A 3V4GA 5LBQA 2LDUA 5K5OA 2Z5UA 3RDIA 1EH6A 3V8LA 5LGNA 2DK5A 4L9TA 3HOTA 4FT8A 4YFKF 5DCMA 1KU3A 1T0FA 3Q9VA 5BQTA 4GYGA 1HSJA 1ZG5A 4UVAA 3F8BA 2OZUA 1RUOA 2UZKA 4Y15A 1ZRDA 3T8RA 4BHPA 3GFLA 2IT0A 1P4AA 1ON1A 3R0JA 5FD6A 3EYIA 2OZ6A 4I0BA 2D2WA 3GZ5A 2UWMA 4LB6B 3I54A 5FD5A 1FYMA 4Q4ZF 1IN6A 5CJ9A 5DUKA 3RKYA 5LRSA 4A2UA 3SQNA 4I7HA 3DQVC 2HGCA 2QQAA 2JZYA 3MZYA 1XSXA 3IHUA 4KN7X 4HF1A 1R1VA 1J9IA 4BNCA 2MA3A 4L5IA 5D5XB 5D8KB 2ETHA 2M87A 3PQJA 4M6YA 2FBKA 1FLIA 3ZMTA 3BPVA 1QNTA 4XBFA 1F9NA 2NYXA 1IN8A 2VT3A 3P7NA 4A0XA 4A12A 5J8FA 3MFKA 3IL2A 3H3UA 2QQ9A 2COMA 3NRVA 2L01A 1BBYA 1ZREA 1ZARA 4G6QA 1ZYRF 4HQEA 1LNWA 2Z99A 5IT9Z 3WGHA 3HHGA 3B73A 4EJTA 3ZN1A 2QYOA 3BOQA 1BIBA 4CO8A 3C1DA 1STZA 1WRJA 3N4MA 3HOSA 3WG9A 4LGWA 2FA5A 4MGRA 4AWXB 2VOPA 2MH9A 2H09A 2FNPA 1LDDA 2HOEA 3QP6A 3KLNA 3LQQA 4GYIA 1TW3A 4LFUA 5E20A 2DTRA 2CQKA 1XD7A 3R0AA 4M72A 5ICEA 2XHKA 2ZMEB 2K7LA 2VE9A 4U0YA 1ZRCA 2D1HA 1KGSA 4RAYA 3RIRA 2HKXA 1IW7F 2DLLA 4M6XA 2GIVA 1FP1D 1U5TB 4JBAA 4B8XA 2MBFA 5HDNA 3EYYA 2VXZA 1HW5A 3RKXA 4A6DA 5IT3A 2UXXA 2ELHA 1BI2A 4EQQA 1AWCA 2EV6A 5LEJA 3F8CA 4ZZLA 2A07F 4BAYA 1B9MA 3I59A 3ECHA 2RV8A 3F6OA 3FXUA 2E7XA 4P96A 1RNLA 1ODDA 3BROA 1S8NA 3DPTA 2V9VA 4L5JA 3E5UA 2GAUA 3IRQA 2A3SA 1B4AA 4FX0A 1YO5C 1KA8A 1RZ4A 3KLOA 2IRFG 4O3MA 2EK5A 1D8KA 1L3LA 3I4PA 2G9WA 1MJ9A 3K9TA 4P5OA 1A04A 5LRRA 2CG4A 5CVIA 2LF8A 1MZBA 3GW2A 4U0WA 2QENA 3CUQC 3HHHA 4WK8F 2CWEA 1UFMA 5K5RA 1SD6A 5LLQA 4AIJA 5L3GA 2Z3YA 2QQBA 2CW0F 5JFRA 3IWZA 3E6BA 4RGUA 1SD7A 2E7WA 3TDUC 2A61A 3V8KA 1Z91A 2DQRA 3JAMZ 5A2QK 2V1XA 2OQGA 1FNNA 2NS0A 1KQ9A 1MKMA 1TQIA 3ABUA 3GZ6A 1P4WA 2EFOA 1J7KA 1GXQA 1TLHB 1K79A 2L54A 1MD0A 1O3TA 2KJCA 1R1TA 2RGVA 3NEUA 1FY7A 1ONVA 1RUNA 3WODF 2HQNA 1HKTA 5E17F 1PUEE 2X4HA 3F23A 2WWYA 1I27A 3V7CA 3ECOA 1LEBA 1WI9A 2PLYA 3JSOA 1IRGA 2KJBA 2QM3A 2EA4A 1DPUA 2P8TA 3KZZA 5BPIA 3FM3A 5CVJA 1I1SA 2CFXA 1YW7A 5L3EA 1OMIA 1LEAA 3RKWA 3B02A 1ZG1A 2BV6A 3CUQB 2C6YA 2K27A 4A0YA 2STTA 1NHAA 4EV0A 5LGUA 1TBXA 3FMSA 3I59B 4LLNA 1PP8F 4HDVA 1ZGAA 3BWGA 2NNYA 3N97A 4CHUA 2HEOA 3O6BB 5K5QA 3I71A 1S3JA 1XSVA 3HTSB 4L0YB 5D5UB 1XMKA 5DV5A 2ACJA 2DPDA 2IPQX 2V1DA 2FMLA 2BEOA 1MDMB 1U2WA 3QOPA 1CGPA 5ED4A 1ON2A 2JT1A 4ASNA 3LA2A 1OYIA 5LEKA 2YPRA 2GZWA 3G3ZA 4L9VA 3CO6C 1IN4A 1YQAA 3SHFA 3GFMA 2E1CA 1OKRA 2WTEA 3BP8A 4KMUX 4GO1A 3FM5A 3CJNA 3U2RA 4L0ZB 2LKPA 1I1GA 2ISYA 4IRGA 4U7DA 3HRUA 5F6FA 3HUGA 1KQ0A 3HRMA 1G3SA 3VODA 3TOAA 1T98A 4ESBA 3S2WA 2F2EA 3KFWX 3BJ6A 1YW8A 2DO7A 4JK1X 1ZLKA 1J75A 2CYYA 1SD4A 1WSUA 4XSXF 1XGNA 1W7PB 4YIFA 5DDGA 3HTUA 3W6KB 3DF8A 3IC7A 4UV9A 2VOOA 1IXRC 1UB9A 3L09A 3MQ0A 4G9YA 2MLGA 1G3YA 2FE3A 2KRFA 1HQCA 1QZYA 3FXQA 1QZZA 1LDKB 2FU4A 5H6RA 1IN5A 4HAMA 1FWZA 1IAWA 4OMZA 3V7SA 3IKVA 3F6VA 2XAQA 1OPCA 1T2KA 2EV0A 1YS7A 1TTYA 2DI3A 2PQ8A 2DQLA 3HSEA 2M30A 3ZMSA 4A0ZA 5HS8A 3U9GA 3CUOA 1FBUA 2F5FA 3FMRA 3QPTA 4E70A 4UHTA 2VN2A 4CXFA 3GXOA 3DPLC 3J81K 4OOIA 1LDJA 4PGHA 2H27A 4XSZF 5KK1A 4CYDA 2DT5A 2FNAA 4KICA 2CGPA 4S04A 3TGNA 2FSWA 5D5WB 4O6JA 1K6OA 2OU2A 5ICGA 1ZLJA 3FWEA 2VBXA 3KP5A 1BIAA 1BOAA 1V3FA 4GXOA 1E2XA 3E5XA 4I02A 2CO5A 4XLPF 4FHTA 5J8CA 2PMHA 1FYKA 2STWA 2VBWA 3QP5A 2ADUA 3FMQA 3KCCA 1R36A 4TV7A 5AONA 2HWVA 3BZ6A 4ON0A 1R00A 3WU1B 5ILUA 1XDSA 2A6EF 2PG4A 4KN4X 2EFPA 2ZBKA 2FF4A 4BHBA 1YYVA 4UUVA 2KIUA 2W57A 1S29A 2Y0MA 3FF5A 1Z6RA 2AXLA 2R7DA 3QU6A 4EJUA 1YIOA 2XKOA 3KETA 1FZPB 4UXNA 1U3EM 2IA2A 3HIFA 3J80K 4A5MA 1YW9A 1HBXG 4GCVA 3RYRA 1FYLA 2QBYB 3HSRA 2VE8A 1SAXA 4MTEA 5D4RA 4D0PA 3LFKA 1SFEA 1G4DA 3M8EA 2L02A 2B0LA 3P9KA 3I58A 1BC8C 1HW1A 5E1ZB 1IN7A 4BYYA 3TKYA 2A69F 3H92A 4NHJA 3I64A 3CLOA 5DCMB 1BJAA 1WQ2A 1FSHA 4IPAA 1J59A 1XB4A 2VBYA 5ERIA 3K1NA 1FP2A 5FGMA 2IP2A 5HLHA 3RYPA 5E18F 1SFXA 2NRAC 4WXHA 1CF7A 3HYIA 4EJVA 1R5GA 4BXUA 2BYVE 1T6SA 1BI1A 4LG0A 2HQRA 2JSCA 2IJLA 3AAFA 3NQOA 1EV7A 2JPBA 2G7HA 3V8JA 4KIFA 2V6CA 2FXAA 1KYZA 2L3DA 4A6EA 4MHGA 2A5YB 5BPDA 2VC1A 3KP3A 1QO0D 1SMYF 2A68F 3MEXA 1B9NA 4G6DA 4ESFA 1S7AA 2WV0A 4LMYA 3I53A 4HOBA 1K78A 1MJAA 3GFJA 1O7FA 3DV8A 1L0OC 4UVCA 1ZG3A 2ZO4A 2O0YA 2W85A 4OINF 1DPRA 2Y75A 4N9IA 3T1BA 1LB2A 3T8TA 4ZH4F 5HVQC 5ICCA 2BE5F 3H3ZA 2GXBA 2NAZA 3WTUC 1P2FA 3P9IA 4OIQF 3OOPA 2O3FA 1QGPA 3ZMZA 1F4KA 4L9NA 5L3BA 3EUHA 3G73A 2MD5A 3GX4X 4KNYA 2O6GE 2ESNA 3K69A 1ZHFA 2FOKA 3LA3A 2RKHA 3KEOA 3K1PA 3U1DA 4G7OF 4N0BA 4AIHA 4LK0F 1YFHA 3C3WA 4KDPA 1R22A 2XUBA 3F3XA 4R8HA 5D6EA 4U88A 4EJOA 2RN7A 2GQQA 2QVOA 1FT9A 3WTSC 5EEHA 2VONA 1QPMA 1J0RA 3WTVC 2Q2EA 4RGXA 1EH7A 5DCFA 3ZP5A 1TQPA 2P6SA 4LD5A 2V1UA 3FXRA 2RNJA 4Q48A 2P5LC 3KP7A 1XSDA 5FO5A 5LHHA 4HX7A 2WC2A 1IUYA 1RI7A 5FLXK 1LVAA 3MZHA 3LA7A 3SZPA 1R23A 4NB5A 1HKQA 2W24A 3CTAA 3QRFF 3QAHA 4ESJA 1E17A 1SMTA 4GGGA 2FBIA 3E5QA 1D5VA 3W6JB 3F8MA 3F8NA 1JXSA 1OYWA 2HR3A 3RJPA 4HX4A 4CGZA 2O03A 4CICA 3K0LA 2HDCA 2VT2A 1MGTA 3BPXA 4IXAA 3MCZA 1D3YA 3REOA 3LAJA 1HKSA 2EB7A 3L7WA 2ESHA 3O2PE 3WTWC 2V79A 4ZYHA 5CVRA 5L3CA 2F5DA 1OR7A 2ZCWA 3E97A 4IJAA 3MWMA 1H9GA 4KT5C 2K02A 4KYWA 2Q0OA 1KQ8A 3JW4A 3Q9SA 3DKWA 5FFZA 2PMUA 4NQWA 5FB2A 4IHTA 4WF2A 5A2QZ 4Z2YA 1F5TA 2Q8KA 1R5HA 5CLSA 4HLXA 4ZYEA 4RB2C 3I0TA 3M1EA 2R3SA 1TNTA 1HW2A 2GWRA 4L9JA 1FOKA 5LHGA 1BC7C 2IVMA 4MQVA 2XKPA 3KP4A 1YTYA 5DEQA 1P92A 3EETA 4ENKA 1FPQA 5L3FA 4RB3C 5FFXA 1IXSB 2K86A 2ZFWA 4R1HA 5CVVA 4HZFA 2VBZA 1PDNC 2FRHA 1WWXA 3GF2A 2MH2A 2OA4A 2XASA 2RDPA 5JR3A 4BHCA 3JTGA 1Z7UA 2P5KA 2YR2A 1V4RA 4A5NA 4HF2A 5H20A 3WU0A 3ZPLA 5D6FA 4M9ZA 1R7JA 4ENNA 4PZJA 1W5SA 2IA1A 1G3WA 3DXJF 5HDGA 2ZMEA 2IA0A 4KMFA 1Z1DA 2P7VB 3ROUA 1ZH5A 2G7UA 2GA1A 1IZ1A 4HW0A 4IRHA 3WGGA 4G7ZF 1QBJA 4L18B 1UHMA 1U5TA 3ISPA 3ZMUA 1DDNA 1SFUA 4AD9A 4I0AA 3QU3A 2JPCA 1WKMA 1SD5A 5D4SA 5IT9K 4U0VA 5AIQA 2QUFA 2FQ3A 1G3TA 4M71A 4ZYDA 3E6DA 2E1NA 4BH9A 2XRNA 2Y48A 4MTDA 4XLNF 1J2XA 3F72A 2OAZA 3WE2A 3L2CA 3QPHA 3KE2A 3VB2A 6PAXA 4UNOA 3P9CA 3T5XA 3WGIA 2PJPA 3KP2A 2EA2A 4WCGA 2P6TA 1YG2A 3R61A 2UXNA 5TJJA 5D5VB 1FBSA 3GVAA 5HS9A 3FX3A 2YX4A 2PFBA 3CO7C 4XRFA 3OV8A 4YIIA 1GVJA 1W4MA 3I5UA 4QLCU 3RTRA 1U5TC 3E6CC 1U8RA 4OU0A 3TOBA 3TQNA 4I01A 4I09A 4Y13A 4ENMA 1U6GA 1ZGJA 1BI0A 4UV8A 2P4WA 1H0MA 2HFHA 3GEZA 3LAPA 4G7HF 3GUDA 1XCBA 5EEGA 2H94A 4IVNA 4P55A 2ZNZA 4PGGA 3VEPA 1G6NA 1JGSA 4LLLA 4MQ9F 3WTTC 2HTSA 3VFZA 4U7BA 4PCQA 5E8GA 5DYMA 2IW5A 1FC3A 5TRDA 3Q5FA 4RAZA 3ZN0A 4LK1F 2VC0A 3CDHA 1B59A 2PN6A 3SFZA 4EVIA 5HDKA 5HLGA 1H9TA 4OMYA 3WE3A 1HSTA 1KU7A 5CVUA 4EM2A 2P5VA 4DNCA 2LF7A 1ZN2A 4OIOF 3SZTA 4HA8A 4EGYA 2A6HF 1QQIA 3JSPA 4IF4A 5HLIA 4HYEA 4IHSA 5DUIA 3COAC 1HXDA 3EDPA 1F1ZA 2OBPA 1S7OA 5E8IA 1XGMA 5LHIA 3E3VA 1YS6A 3ZMDA 1XMAA 2ZKZA 1Q1HA 1PP7U 1XCVA 3LWFA 2KIMA 3R60A 1BM9A 2EJRA 3FHZA 1O3RA 1IXCA 5AIPA 2QLZA 1R58A 3DFGA 3JAMK 4FX4A 1ZAOA 1Y0UA 2YSRA 2EFWA 3C7JA 1O3QA 3J81Z 2XV4S 1USSA 1XN7A 4R79A 1R1UA 5ILVA 3RI4A 5DD4A 4WWCA 4Y17A 1KYWA 1XGOA 4EM0B 5H6QA 2HYFA 2PBIA 4EGZA 5F1RA 3GFIA 4F7ZA 1FX7A 2MLKA 3PQKA 2BBYA 4M73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KVR A;  3ML6 A;  3CUQ A;  1K7A A;  2DAO A;  4RGS A;  2DW4 A;  2FEZ A;  2Z33 A;  1T38 A;  2L4M A;  4KUM A;  2O61 A;  2FMY A;  4KFC A;  3K2Z A;  3RPU A;  3LST A;  1LJ9 A;  2VOD A;  2QZ8 A;  3KEQ A;  4LJZ F;  1TQM A;  3ULQ B;  2XAJ A;  5BMZ A;  2OQR A;  2ISZ A;  1TW2 A;  5J6X A;  2ZXJ A;  4HX8 A;  3JTH A;  2K4B A;  4AIK A;  1TNS A;  4H0E A;  2KIF A;  3FZV A;  4CZZ A;  5F64 A;  1MDM A;  4S05 A;  3DP7 A;  3T0Y A;  2YU3 A;  3GLX A;  1YLF A;  1D8J A;  4I2O A;  1LQ1 A;  4KIB A;  3KZY A;  2GXG A;  1FSE A;  1X3U A;  3J80 Z;  4MNU A;  2PI0 A;  3ELK A;  1BN5 A;  3R4K A;  4K2E A;  3C18 A;  5ILS A;  2RC4 A;  3KP6 A;  5CYV A;  2CSO A;  2X0L A;  2GA2 A;  2DBB A;  2LSO A;  2M5W A;  3GYH X;  1KU2 A;  2EV5 A;  3HRT A;  3ZMV A;  2LNB A;  1EH8 A;  3M8F A;  4HF0 A;  3WTZ A;  3GWZ A;  4OIR F;  2RVC A;  4P9U A;  1FBQ A;  1O57 A;  5K1Y A;  3BY6 A;  3L00 A;  3HRS A;  4RS8 A;  2HZT A;  2EFN A;  4DQ2 A;  3IRR A;  2FBH A;  2QWW A;  1GHC A;  3BJO A;  3MAJ A;  4Q5S F;  1Z05 A;  1I6X A;  1VTN C;  1AOY A;  4HDU A;  4AVP A;  3O3K A;  4Q47 A;  2J5P A;  2ZJ2 A;  4M9X A;  1B1B A;  1UHW A;  2XAF A;  3R6S A;  1P4X A;  1MJB A;  4LLG F;  4WXC A;  2OD5 A;  4IRI A;  5HS7 A;  2F5C A;  3L9F A;  4YFX F;  2J5O A;  1C0W A;  3TO9 A;  1W7P A;  1ZRF A;  2D45 A;  3ERE D;  4OIP F;  3TO7 A;  5HOO A;  2M45 A;  2DFI A;  4PDK A;  2O8X A;  1GXP A;  4KIG A;  1S6L A;  3WTY C;  3TO6 A;  2EWN A;  1P6R A;  4HBL A;  2XIG A;  4RB1 A;  1RIO H;  1IF1 A;  3VOE A;  4EJW A;  4G94 A;  2ZNY A;  2H6B A;  1JE8 A;  2XGX A;  1W5T A;  3D5L A;  2DPU A;  2XAH A;  4YG2 F;  1T39 A;  3DEU A;  2W84 A;  1JHF A;  1IRF A;  3D0S A;  5BOX A;  4P9F A;  2HTJ A;  1KU9 A;  1O7L A;  2XAG A;  1CF7 B;  5JI6 A;  2HKO A;  1DUX C;  3WTX C;  4MEY F;  1J5Y A;  3GO5 A;  1I5Z A;  4KA4 A;  4QWQ A;  1UST A;  3E6M A;  4LG0 B;  2Z9O A;  2YX7 A;  2KKO A;  2BGC A;  2JTV A;  4HQM A;  4EM1 A;  1DP7 P;  3ABT A;  2W25 A;  3IKT A;  4MEX F;  3F8F A;  3J7A O;  2HS5 A;  2MC3 A;  2XVC A;  2RQP A;  5LGT A;  4M74 A;  1OYY A;  2H6C A;  3K1M A;  2NNN A;  3EQL F;  1U78 A;  2L4A A;  3IWF A;  3V7R A;  2M8E A;  1K78 B;  1B6A A;  4JQF A;  5D8L B;  2EFQ A;  2F5E A;  2M1B A;  5ICF A;  5JHU A;  3LQR A;  1O3S A;  2P7C B;  5E1W A;  5JVT A;  4B09 A;  4WX9 A;  1ULY A;  4RB0 A;  1BI3 A;  5L3D A;  4YFN F;  4BQA A;  2DU9 A;  5FLX Z;  4UVB A;  1XGS A;  4G8X A;  4N9H A;  2AS5 F;  3M7G A;  3BDD A;  4ENJ A;  4EMS A;  4LB5 A;  1W7P D;  3SXY A;  3PFI A;  4CDG A;  4M9S A;  2D1V A;  3HSF A;  2HYG D;  1JHH A;  2R7F A;  1REP C;  2XRO A;  2JRT A;  3TDZ C;  3ZQ7 A;  4WXD A;  5E1X A;  4O5V A;  3RPQ A;  2TDX A;  4HLY A;  4I98 B;  2PEX A;  3M9A A;  3BJA A;  4ZYG A;  1Z6T A;  4ETS A;  2QBY A;  3F21 A;  2K4J A;  4RGR A;  5BS6 A;  4HV6 A;  1UCR A;  1Z9C A;  1XDU A;  5DD8 A;  2DK8 A;  3F22 A;  4ZZD A;  4HV5 A;  3V4G A;  5LBQ A;  2LDU A;  5K5O A;  2Z5U A;  3RDI A;  1EH6 A;  3V8L A;  5LGN A;  2DK5 A;  4L9T A;  3HOT A;  4FT8 A;  4YFK F;  5DCM A;  1KU3 A;  1T0F A;  3Q9V A;  5BQT A;  4GYG A;  1HSJ A;  1ZG5 A;  4UVA A;  3F8B A;  2OZU A;  1RUO A;  2UZK A;  4Y15 A;  1ZRD A;  3T8R A;  4BHP A;  3GFL A;  2IT0 A;  1P4A A;  1ON1 A;  3R0J A;  5FD6 A;  3EYI A;  2OZ6 A;  4I0B A;  2D2W A;  3GZ5 A;  2UWM A;  4LB6 B;  3I54 A;  5FD5 A;  1FYM A;  4Q4Z F;  1IN6 A;  5CJ9 A;  5DUK A;  3RKY A;  5LRS A;  4A2U A;  3SQN A;  4I7H A;  3DQV C;  2HGC A;  2QQA A;  2JZY A;  3MZY A;  1XSX A;  3IHU A;  4KN7 X;  4HF1 A;  1R1V A;  1J9I A;  4BNC A;  2MA3 A;  4L5I A;  5D5X B;  5D8K B;  2ETH A;  2M87 A;  3PQJ A;  4M6Y A;  2FBK A;  1FLI A;  3ZMT A;  3BPV A;  1QNT A;  4XBF A;  1F9N A;  2NYX A;  1IN8 A;  2VT3 A;  3P7N A;  4A0X A;  4A12 A;  5J8F A;  3MFK A;  3IL2 A;  3H3U A;  2QQ9 A;  2COM A;  3NRV A;  2L01 A;  1BBY A;  1ZRE A;  1ZAR A;  4G6Q A;  1ZYR F;  4HQE A;  1LNW A;  2Z99 A;  5IT9 Z;  3WGH A;  3HHG A;  3B73 A;  4EJT A;  3ZN1 A;  2QYO A;  3BOQ A;  1BIB A;  4CO8 A;  3C1D A;  1STZ A;  1WRJ A;  3N4M A;  3HOS A;  3WG9 A;  4LGW A;  2FA5 A;  4MGR A;  4AWX B;  2VOP A;  2MH9 A;  2H09 A;  2FNP A;  1LDD A;  2HOE A;  3QP6 A;  3KLN A;  3LQQ A;  4GYI A;  1TW3 A;  4LFU A;  5E20 A;  2DTR A;  2CQK A;  1XD7 A;  3R0A A;  4M72 A;  5ICE A;  2XHK A;  2ZME B;  2K7L A;  2VE9 A;  4U0Y A;  1ZRC A;  2D1H A;  1KGS A;  4RAY A;  3RIR A;  2HKX A;  1IW7 F;  2DLL A;  4M6X A;  2GIV A;  1FP1 D;  1U5T B;  4JBA A;  4B8X A;  2MBF A;  5HDN A;  3EYY A;  2VXZ A;  1HW5 A;  3RKX A;  4A6D A;  5IT3 A;  2UXX A;  2ELH A;  1BI2 A;  4EQQ A;  1AWC A;  2EV6 A;  5LEJ A;  3F8C A;  4ZZL A;  2A07 F;  4BAY A;  1B9M A;  3I59 A;  3ECH A;  2RV8 A;  3F6O A;  3FXU A;  2E7X A;  4P96 A;  1RNL A;  1ODD A;  3BRO A;  1S8N A;  3DPT A;  2V9V A;  4L5J A;  3E5U A;  2GAU A;  3IRQ A;  2A3S A;  1B4A A;  4FX0 A;  1YO5 C;  1KA8 A;  1RZ4 A;  3KLO A;  2IRF G;  4O3M A;  2EK5 A;  1D8K A;  1L3L A;  3I4P A;  2G9W A;  1MJ9 A;  3K9T A;  4P5O A;  1A04 A;  5LRR A;  2CG4 A;  5CVI A;  2LF8 A;  1MZB A;  3GW2 A;  4U0W A;  2QEN A;  3CUQ C;  3HHH A;  4WK8 F;  2CWE A;  1UFM A;  5K5R A;  1SD6 A;  5LLQ A;  4AIJ A;  5L3G A;  2Z3Y A;  2QQB A;  2CW0 F;  5JFR A;  3IWZ A;  3E6B A;  4RGU A;  1SD7 A;  2E7W A;  3TDU C;  2A61 A;  3V8K A;  1Z91 A;  2DQR A;  3JAM Z;  5A2Q K;  2V1X A;  2OQG A;  1FNN A;  2NS0 A;  1KQ9 A;  1MKM A;  1TQI A;  3ABU A;  3GZ6 A;  1P4W A;  2EFO A;  1J7K A;  1GXQ A;  1TLH B;  1K79 A;  2L54 A;  1MD0 A;  1O3T A;  2KJC A;  1R1T A;  2RGV A;  3NEU A;  1FY7 A;  1ONV A;  1RUN A;  3WOD F;  2HQN A;  1HKT A;  5E17 F;  1PUE E;  2X4H A;  3F23 A;  2WWY A;  1I27 A;  3V7C A;  3ECO A;  1LEB A;  1WI9 A;  2PLY A;  3JSO A;  1IRG A;  2KJB A;  2QM3 A;  2EA4 A;  1DPU A;  2P8T A;  3KZZ A;  5BPI A;  3FM3 A;  5CVJ A;  1I1S A;  2CFX A;  1YW7 A;  5L3E A;  1OMI A;  1LEA A;  3RKW A;  3B02 A;  1ZG1 A;  2BV6 A;  3CUQ B;  2C6Y A;  2K27 A;  4A0Y A;  2STT A;  1NHA A;  4EV0 A;  5LGU A;  1TBX A;  3FMS A;  3I59 B;  4LLN A;  1PP8 F;  4HDV A;  1ZGA A;  3BWG A;  2NNY A;  3N97 A;  4CHU A;  2HEO A;  3O6B B;  5K5Q A;  3I71 A;  1S3J A;  1XSV A;  3HTS B;  4L0Y B;  5D5U B;  1XMK A;  5DV5 A;  2ACJ A;  2DPD A;  2IPQ X;  2V1D A;  2FML A;  2BEO A;  1MDM B;  1U2W A;  3QOP A;  1CGP A;  5ED4 A;  1ON2 A;  2JT1 A;  4ASN A;  3LA2 A;  1OYI A;  5LEK A;  2YPR A;  2GZW A;  3G3Z A;  4L9V A;  3CO6 C;  1IN4 A;  1YQA A;  3SHF A;  3GFM A;  2E1C A;  1OKR A;  2WTE A;  3BP8 A;  4KMU X;  4GO1 A;  3FM5 A;  3CJN A;  3U2R A;  4L0Z B;  2LKP A;  1I1G A;  2ISY A;  4IRG A;  4U7D A;  3HRU A;  5F6F A;  3HUG A;  1KQ0 A;  3HRM A;  1G3S A;  3VOD A;  3TOA A;  1T98 A;  4ESB A;  3S2W A;  2F2E A;  3KFW X;  3BJ6 A;  1YW8 A;  2DO7 A;  4JK1 X;  1ZLK A;  1J75 A;  2CYY A;  1SD4 A;  1WSU A;  4XSX F;  1XGN A;  1W7P B;  4YIF A;  5DDG A;  3HTU A;  3W6K B;  3DF8 A;  3IC7 A;  4UV9 A;  2VOO A;  1IXR C;  1UB9 A;  3L09 A;  3MQ0 A;  4G9Y A;  2MLG A;  1G3Y A;  2FE3 A;  2KRF A;  1HQC A;  1QZY A;  3FXQ A;  1QZZ A;  1LDK B;  2FU4 A;  5H6R A;  1IN5 A;  4HAM A;  1FWZ A;  1IAW A;  4OMZ A;  3V7S A;  3IKV A;  3F6V A;  2XAQ A;  1OPC A;  1T2K A;  2EV0 A;  1YS7 A;  1TTY A;  2DI3 A;  2PQ8 A;  2DQL A;  3HSE A;  2M30 A;  3ZMS A;  4A0Z A;  5HS8 A;  3U9G A;  3CUO A;  1FBU A;  2F5F A;  3FMR A;  3QPT A;  4E70 A;  4UHT A;  2VN2 A;  4CXF A;  3GXO A;  3DPL C;  3J81 K;  4OOI A;  1LDJ A;  4PGH A;  2H27 A;  4XSZ F;  5KK1 A;  4CYD A;  2DT5 A;  2FNA A;  4KIC A;  2CGP A;  4S04 A;  3TGN A;  2FSW A;  5D5W B;  4O6J A;  1K6O A;  2OU2 A;  5ICG A;  1ZLJ A;  3FWE A;  2VBX A;  3KP5 A;  1BIA A;  1BOA A;  1V3F A;  4GXO A;  1E2X A;  3E5X A;  4I02 A;  2CO5 A;  4XLP F;  4FHT A;  5J8C A;  2PMH A;  1FYK A;  2STW A;  2VBW A;  3QP5 A;  2ADU A;  3FMQ A;  3KCC A;  1R36 A;  4TV7 A;  5AON A;  2HWV A;  3BZ6 A;  4ON0 A;  1R00 A;  3WU1 B;  5ILU A;  1XDS A;  2A6E F;  2PG4 A;  4KN4 X;  2EFP A;  2ZBK A;  2FF4 A;  4BHB A;  1YYV A;  4UUV A;  2KIU A;  2W57 A;  1S29 A;  2Y0M A;  3FF5 A;  1Z6R A;  2AXL A;  2R7D A;  3QU6 A;  4EJU A;  1YIO A;  2XKO A;  3KET A;  1FZP B;  4UXN A;  1U3E M;  2IA2 A;  3HIF A;  3J80 K;  4A5M A;  1YW9 A;  1HBX G;  4GCV A;  3RYR A;  1FYL A;  2QBY B;  3HSR A;  2VE8 A;  1SAX A;  4MTE A;  5D4R A;  4D0P A;  3LFK A;  1SFE A;  1G4D A;  3M8E A;  2L02 A;  2B0L A;  3P9K A;  3I58 A;  1BC8 C;  1HW1 A;  5E1Z B;  1IN7 A;  4BYY A;  3TKY A;  2A69 F;  3H92 A;  4NHJ A;  3I64 A;  3CLO A;  5DCM B;  1BJA A;  1WQ2 A;  1FSH A;  4IPA A;  1J59 A;  1XB4 A;  2VBY A;  5ERI A;  3K1N A;  1FP2 A;  5FGM A;  2IP2 A;  5HLH A;  3RYP A;  5E18 F;  1SFX A;  2NRA C;  4WXH A;  1CF7 A;  3HYI A;  4EJV A;  1R5G A;  4BXU A;  2BYV E;  1T6S A;  1BI1 A;  4LG0 A;  2HQR A;  2JSC A;  2IJL A;  3AAF A;  3NQO A;  1EV7 A;  2JPB A;  2G7H A;  3V8J A;  4KIF A;  2V6C A;  2FXA A;  1KYZ A;  2L3D A;  4A6E A;  4MHG A;  2A5Y B;  5BPD A;  2VC1 A;  3KP3 A;  1QO0 D;  1SMY F;  2A68 F;  3MEX A;  1B9N A;  4G6D A;  4ESF A;  1S7A A;  2WV0 A;  4LMY A;  3I53 A;  4HOB A;  1K78 A;  1MJA A;  3GFJ A;  1O7F A;  3DV8 A;  1L0O C;  4UVC A;  1ZG3 A;  2ZO4 A;  2O0Y A;  2W85 A;  4OIN F;  1DPR A;  2Y75 A;  4N9I A;  3T1B A;  1LB2 A;  3T8T A;  4ZH4 F;  5HVQ C;  5ICC A;  2BE5 F;  3H3Z A;  2GXB A;  2NAZ A;  3WTU C;  1P2F A;  3P9I A;  4OIQ F;  3OOP A;  2O3F A;  1QGP A;  3ZMZ A;  1F4K A;  4L9N A;  5L3B A;  3EUH A;  3G73 A;  2MD5 A;  3GX4 X;  4KNY A;  2O6G E;  2ESN A;  3K69 A;  1ZHF A;  2FOK A;  3LA3 A;  2RKH A;  3KEO A;  3K1P A;  3U1D A;  4G7O F;  4N0B A;  4AIH A;  4LK0 F;  1YFH A;  3C3W A;  4KDP A;  1R22 A;  2XUB A;  3F3X A;  4R8H A;  5D6E A;  4U88 A;  4EJO A;  2RN7 A;  2GQQ A;  2QVO A;  1FT9 A;  3WTS C;  5EEH A;  2VON A;  1QPM A;  1J0R A;  3WTV C;  2Q2E A;  4RGX A;  1EH7 A;  5DCF A;  3ZP5 A;  1TQP A;  2P6S A;  4LD5 A;  2V1U A;  3FXR A;  2RNJ A;  4Q48 A;  2P5L C;  3KP7 A;  1XSD A;  5FO5 A;  5LHH A;  4HX7 A;  2WC2 A;  1IUY A;  1RI7 A;  5FLX K;  1LVA A;  3MZH A;  3LA7 A;  3SZP A;  1R23 A;  4NB5 A;  1HKQ A;  2W24 A;  3CTA A;  3QRF F;  3QAH A;  4ESJ A;  1E17 A;  1SMT A;  4GGG A;  2FBI A;  3E5Q A;  1D5V A;  3W6J B;  3F8M A;  3F8N A;  1JXS A;  1OYW A;  2HR3 A;  3RJP A;  4HX4 A;  4CGZ A;  2O03 A;  4CIC A;  3K0L A;  2HDC A;  2VT2 A;  1MGT A;  3BPX A;  4IXA A;  3MCZ A;  1D3Y A;  3REO A;  3LAJ A;  1HKS A;  2EB7 A;  3L7W A;  2ESH A;  3O2P E;  3WTW C;  2V79 A;  4ZYH A;  5CVR A;  5L3C A;  2F5D A;  1OR7 A;  2ZCW A;  3E97 A;  4IJA A;  3MWM A;  1H9G A;  4KT5 C;  2K02 A;  4KYW A;  2Q0O A;  1KQ8 A;  3JW4 A;  3Q9S A;  3DKW A;  5FFZ A;  2PMU A;  4NQW A;  5FB2 A;  4IHT A;  4WF2 A;  5A2Q Z;  4Z2Y A;  1F5T A;  2Q8K A;  1R5H A;  5CLS A;  4HLX A;  4ZYE A;  4RB2 C;  3I0T A;  3M1E A;  2R3S A;  1TNT A;  1HW2 A;  2GWR A;  4L9J A;  1FOK A;  5LHG A;  1BC7 C;  2IVM A;  4MQV A;  2XKP A;  3KP4 A;  1YTY A;  5DEQ A;  1P92 A;  3EET A;  4ENK A;  1FPQ A;  5L3F A;  4RB3 C;  5FFX A;  1IXS B;  2K86 A;  2ZFW A;  4R1H A;  5CVV A;  4HZF A;  2VBZ A;  1PDN C;  2FRH A;  1WWX A;  3GF2 A;  2MH2 A;  2OA4 A;  2XAS A;  2RDP A;  5JR3 A;  4BHC A;  3JTG A;  1Z7U A;  2P5K A;  2YR2 A;  1V4R A;  4A5N A;  4HF2 A;  5H20 A;  3WU0 A;  3ZPL A;  5D6F A;  4M9Z A;  1R7J A;  4ENN A;  4PZJ A;  1W5S A;  2IA1 A;  1G3W A;  3DXJ F;  5HDG A;  2ZME A;  2IA0 A;  4KMF A;  1Z1D A;  2P7V B;  3ROU A;  1ZH5 A;  2G7U A;  2GA1 A;  1IZ1 A;  4HW0 A;  4IRH A;  3WGG A;  4G7Z F;  1QBJ A;  4L18 B;  1UHM A;  1U5T A;  3ISP A;  3ZMU A;  1DDN A;  1SFU A;  4AD9 A;  4I0A A;  3QU3 A;  2JPC A;  1WKM A;  1SD5 A;  5D4S A;  5IT9 K;  4U0V A;  5AIQ A;  2QUF A;  2FQ3 A;  1G3T A;  4M71 A;  4ZYD A;  3E6D A;  2E1N A;  4BH9 A;  2XRN A;  2Y48 A;  4MTD A;  4XLN F;  1J2X A;  3F72 A;  2OAZ A;  3WE2 A;  3L2C A;  3QPH A;  3KE2 A;  3VB2 A;  6PAX A;  4UNO A;  3P9C A;  3T5X A;  3WGI A;  2PJP A;  3KP2 A;  2EA2 A;  4WCG A;  2P6T A;  1YG2 A;  3R61 A;  2UXN A;  5TJJ A;  5D5V B;  1FBS A;  3GVA A;  5HS9 A;  3FX3 A;  2YX4 A;  2PFB A;  3CO7 C;  4XRF A;  3OV8 A;  4YII A;  1GVJ A;  1W4M A;  3I5U A;  4QLC U;  3RTR A;  1U5T C;  3E6C C;  1U8R A;  4OU0 A;  3TOB A;  3TQN A;  4I01 A;  4I09 A;  4Y13 A;  4ENM A;  1U6G A;  1ZGJ A;  1BI0 A;  4UV8 A;  2P4W A;  1H0M A;  2HFH A;  3GEZ A;  3LAP A;  4G7H F;  3GUD A;  1XCB A;  5EEG A;  2H94 A;  4IVN A;  4P55 A;  2ZNZ A;  4PGG A;  3VEP A;  1G6N A;  1JGS A;  4LLL A;  4MQ9 F;  3WTT C;  2HTS A;  3VFZ A;  4U7B A;  4PCQ A;  5E8G A;  5DYM A;  2IW5 A;  1FC3 A;  5TRD A;  3Q5F A;  4RAZ A;  3ZN0 A;  4LK1 F;  2VC0 A;  3CDH A;  1B59 A;  2PN6 A;  3SFZ A;  4EVI A;  5HDK A;  5HLG A;  1H9T A;  4OMY A;  3WE3 A;  1HST A;  1KU7 A;  5CVU A;  4EM2 A;  2P5V A;  4DNC A;  2LF7 A;  1ZN2 A;  4OIO F;  3SZT A;  4HA8 A;  4EGY A;  2A6H F;  1QQI A;  3JSP A;  4IF4 A;  5HLI A;  4HYE A;  4IHS A;  5DUI A;  3COA C;  1HXD A;  3EDP A;  1F1Z A;  2OBP A;  1S7O A;  5E8I A;  1XGM A;  5LHI A;  3E3V A;  1YS6 A;  3ZMD A;  1XMA A;  2ZKZ A;  1Q1H A;  1PP7 U;  1XCV A;  3LWF A;  2KIM A;  3R60 A;  1BM9 A;  2EJR A;  3FHZ A;  1O3R A;  1IXC A;  5AIP A;  2QLZ A;  1R58 A;  3DFG A;  3JAM K;  4FX4 A;  1ZAO A;  1Y0U A;  2YSR A;  2EFW A;  3C7J A;  1O3Q A;  3J81 Z;  2XV4 S;  1USS A;  1XN7 A;  4R79 A;  1R1U A;  5ILV A;  3RI4 A;  5DD4 A;  4WWC A;  4Y17 A;  1KYW A;  1XGO A;  4EM0 B;  5H6Q A;  2HYF A;  2PBI A;  4EGZ A;  5F1R A;  3GFI A;  4F7Z A;  1FX7 A;  2MLK A;  3PQK A;  2BBY A;  4M73 A; 
#chains in the Genus database with same CATH topology
 1J09 A;  5KVR A;  3H5A A;  3ML6 A;  2RAE A;  3DBR B;  4DW6 A;  3CUQ A;  1K7A A;  2QKM B;  2DAO A;  4RGS A;  2DW4 A;  2FEZ A;  5CPR B;  2Z33 A;  1T38 A;  2L4M A;  4KUM A;  1HOM A;  2O61 A;  3HXL A;  1MMD A;  2FMY A;  4KFC A;  3CCY A;  2XAU A;  2KQR A;  3K2Z A;  2IS4 A;  2DMN A;  3RPU A;  4F52 A;  3LST A;  2DA1 A;  2R7Z J;  1LJ9 A;  1MIJ A;  2YU9 J;  2VOD A;  3K70 D;  3LSM A;  2QZ8 A;  3KEQ A;  4BJ6 C;  4LJZ F;  1TQM A;  3ULQ B;  3HJE A;  2L7F P;  1R4N B;  2L0K A;  2XAJ A;  3CCU I;  5BMZ A;  3JRA A;  2YS9 A;  2OV7 A;  2VQH A;  2OQR A;  2HVQ A;  1P9Q C;  2ISZ A;  2M7B A;  3FIS A;  1TW2 A;  3U1K A;  5M3F J;  3CC7 I;  2ME6 A;  5J6X A;  2ZXJ A;  4HX8 A;  3JTH A;  1VND A;  4Y7N J;  2K4B A;  4AIK A;  1IUF A;  1TNS A;  1YJN I;  2VKD A;  3ASO H;  4H0E A;  1WHU A;  2KIF A;  3FZV A;  4CZZ A;  5F64 A;  1HA8 A;  1ETV A;  2JUC A;  1MDM A;  4S05 A;  3DP7 A;  3C2H A;  3T0Y A;  2YU3 A;  1EF4 A;  3GLX A;  3J7A Y;  4KT6 A;  4DZP A;  1YLF A;  1D8J A;  4I2O A;  1BR2 A;  2NVU B;  2CRG A;  1LQ1 A;  4J19 A;  4PJ0 C;  4KIB A;  1H88 C;  3KZY A;  2ZJR F;  1DGW Y;  2GXG A;  1FSE A;  1X3U A;  3J80 Z;  4MNU A;  3NWT A;  2V9P A;  2PI0 A;  1OIS A;  3ELK A;  3I9V 2;  4AM3 A;  1BN5 A;  3R4K A;  4K2E A;  2VIX A;  3C18 A;  5ILS A;  2RC4 A;  2CUE A;  3QPL A;  3KP6 A;  5CYV A;  2E1M B;  2CSO A;  2X0L A;  2GA2 A;  2DBB A;  2LSO A;  5HOD A;  2M5W A;  3GTM J;  2EIK H;  4XN3 A;  5J1Y A;  1ENH A;  3GYH X;  1KU2 A;  2P81 A;  1DU0 A;  2EV5 A;  4F92 B;  4HRI A;  4U87 A;  3HRT A;  3ZMV A;  2R7S A;  2LNB A;  1EH8 A;  3M8F A;  4HF0 A;  3WTZ A;  3O8H A;  3GWZ A;  3OIO A;  4OIR F;  4B48 A;  3OYL A;  3MKY B;  3J7A W;  2RVC A;  4P9U A;  1FBQ A;  1O57 A;  2ICW G;  5K1Y A;  4FQG A;  3BY6 A;  1E3O C;  2VPL A;  3L00 A;  2LMD A;  1A31 A;  3HRS A;  1YRN B;  4RS8 A;  2HZT A;  1Y6I A;  2EFN A;  4DQ2 A;  3IRR A;  2WAQ A;  3CCV I;  2FBH A;  2LFB A;  2QWW A;  2LY1 A;  2F5V A;  3H0G J;  1GHC A;  3BJO A;  3MAJ A;  2KLO A;  2LKX A;  4Q5S F;  1Z05 A;  1K6Y A;  4IEJ A;  2DFE A;  1I6X A;  3LSR A;  2E60 A;  2XDV A;  1VTN C;  4HDU A;  1B8I B;  3CC2 I;  1AOY A;  3IH3 A;  1I3A A;  3CES A;  1TP4 A;  4AVP A;  3O3K A;  3A2K A;  4Q47 A;  2J5P A;  2ZJ2 A;  4M9X A;  3CQZ J;  1B1B A;  1WFX A;  5IYB J;  1UHW A;  3HKZ N;  1RC9 A;  2Z16 A;  4BBR J;  2XAF A;  4ZTJ A;  3R6S A;  3M1C A;  1P4X A;  1MJB A;  4LLG F;  3A01 B;  2XSD C;  4CH7 A;  4WXC A;  2OD5 A;  1LUJ B;  4IRI A;  2DYR H;  5HS7 A;  4UY8 I;  1X1D A;  2R5Y A;  2F5C A;  1I3Q J;  1MMN A;  3L9F A;  1I50 J;  4YFX F;  5J47 A;  2J5O A;  1C0W A;  2E36 A;  3TO9 A;  1FOX A;  2E19 A;  2K5C A;  1W7P A;  1ZRF A;  3OIP A;  2D45 A;  3ERE D;  4OIP F;  2ZXW H;  3DBL B;  3TO7 A;  5HOO A;  5FLM J;  2R7R A;  3TP0 A;  3IH2 A;  2M45 A;  1Z3Y A;  4BE2 A;  2BVM A;  4UUT A;  3HOV J;  2DFI A;  4PDK A;  3L2V A;  2O8X A;  1GXP A;  4XL9 A;  3RPU D;  4KIG A;  3SYT A;  1VQ6 I;  1S6L A;  1E3P A;  3WTY C;  3TO6 A;  2EWN A;  1GV5 A;  1P6R A;  5F27 A;  3FK6 A;  4BE0 A;  1T8I A;  4HBL A;  2XIG A;  4RB1 A;  1RIO H;  1A36 A;  2MC4 A;  9ANT A;  1IF1 A;  3VOE A;  3BG6 A;  3BG7 A;  5M5Y J;  4EJW A;  4G94 A;  2DA3 A;  4UUS B;  1BR4 A;  2ZNY A;  2H6B A;  3CCQ I;  2Q1Z B;  4GFB A;  3A0H C;  4PFP A;  3MKW B;  1JE8 A;  2XGX A;  3S1N J;  1W5T A;  3D5L A;  4HG2 A;  2OPT A;  2DPU A;  4DYC A;  1B72 B;  2XAH A;  4YG2 F;  2R7Q A;  4CCN A;  1T39 A;  3DEU A;  2RNG A;  1JHF A;  1IRF A;  2M2E A;  2MFZ A;  2W84 A;  3D0S A;  4P9F A;  5BOX A;  2JMW A;  2RQQ A;  2HTJ A;  3H36 A;  3K2A A;  1KU9 A;  1O7L A;  2XAG A;  2R5Z A;  5EGO B;  1CF7 B;  5JI6 A;  4NUB A;  2HKO A;  1DUX C;  3WTX C;  3OSG A;  3WG7 H;  3H9J A;  4MEY F;  1J5Y A;  1QPI A;  3GO5 A;  1F36 A;  4XMY A;  1I5Z A;  3BG5 A;  3FIW A;  1WCM J;  4KA4 A;  4QWQ A;  1UST A;  2V4J C;  3E6M A;  4LG0 B;  2Z9O A;  2YX7 A;  2H8R A;  2LTP A;  2KKO A;  2BGC A;  2JTV A;  4HQM A;  4D9J A;  3RQ4 A;  3S1R J;  4EM1 A;  2PJR B;  1DP7 P;  1X58 A;  3ABT A;  3CCR I;  3GBG A;  2CQX A;  2OCC H;  2W25 A;  3IKT A;  4MEX F;  3CD6 I;  1Z21 A;  3VYR B;  3F8F A;  4B44 A;  2MUN A;  4W1U A;  3J7A O;  2HS5 A;  2BW3 A;  2MC3 A;  4ABZ A;  2XVC A;  2MYS A;  2RQP A;  5LGT A;  3HDD A;  4M74 A;  4V2F A;  1OYY A;  5IOZ A;  2H6C A;  3D1N I;  3K1M A;  5FKO A;  3DEW A;  3DWL E;  2R7U A;  2NNN A;  3HOW J;  1UG2 A;  3EQL F;  3OIQ A;  2L4A A;  1U78 A;  3IWF A;  3V7R A;  5FKK A;  4A3D J;  3A02 A;  1IG7 A;  2M8E A;  1K78 B;  2KZV A;  1B6A A;  3ERM A;  1K61 A;  4JQF A;  5D8L B;  1ZR4 A;  2X98 A;  2EFQ A;  2F5E A;  2M1B A;  1OR7 C;  5ICF A;  5JHU A;  3LQR A;  3ZQH A;  2UUZ A;  3P5J A;  3MKZ A;  1I6H J;  4ZDP A;  1O3S A;  3I4N J;  1LVK A;  2P7C B;  5E1W A;  5JVT A;  1MBE A;  4PJJ A;  4B09 A;  3OYG A;  5J4V A;  4WX9 A;  1VQ8 I;  1ULY A;  2W00 A;  1G59 A;  4RB0 A;  1WH5 A;  1BI3 A;  3HG9 A;  3OYI A;  5L3D A;  1UHS A;  2IGK A;  3F9K A;  1SFK A;  4D7M A;  4YFN F;  4C3H J;  4BQA A;  2DU9 A;  3VSL A;  3VPR A;  1WJ5 A;  5FLX Z;  4UVB A;  1XGS A;  2DYS H;  4G8X A;  1FOY A;  1MND A;  1NG7 A;  4N9H A;  5E79 C;  3UKG A;  2AS5 F;  2DOF A;  3M7G A;  3BDD A;  4ENJ A;  4EMS A;  4LB5 A;  1IRX A;  1W7P D;  3TMO A;  2JA2 A;  3SXY A;  2E2J J;  1E3H A;  3PFI A;  2VQG A;  4CDG A;  3HKZ A;  4M9S A;  3W2A A;  2D1V A;  2L7M P;  3HSF A;  1A6I A;  2HYG D;  3FXL A;  3LNQ A;  4HNV A;  1JHH A;  2M0C A;  2R7F A;  1REP C;  2XRO A;  2JRT A;  4RLF A;  3TDZ C;  3ZQ7 A;  4E4H A;  4E7I A;  4WXD A;  2X1E A;  3SDB A;  3KPH A;  4O5V A;  5E1X A;  3RPQ A;  2G0E A;  3MVP A;  3CMY A;  5LD2 C;  2TDX A;  4HLY A;  4I98 B;  2Y2Z A;  1K83 J;  2PEX A;  3M9A A;  3BJA A;  4ZYG A;  1Z6T A;  3KEY A;  4ETS A;  1T95 A;  1WJD A;  4QPQ A;  2QBY A;  3F21 A;  1WJC A;  2K4J A;  4RGR A;  5BS6 A;  4HV6 A;  5GTH C;  1IC8 A;  1SC7 A;  1UCR A;  3VDX A;  1NG6 A;  2Q2E B;  1TZL A;  2CS3 A;  1Z9C A;  2KRC A;  1XDU A;  5DD8 A;  2DK8 A;  2QF7 A;  3F22 A;  4ZZD A;  4HV5 A;  3V4G A;  5FRM A;  5LBQ A;  2LVS A;  4BQO A;  2LDU A;  4IHY A;  5K5O A;  2Z5U A;  3KYC B;  3RDI A;  3QWL A;  1EH6 A;  3V8L A;  5LGN A;  2DK5 A;  3H1C A;  2LYC A;  4L9T A;  4CZC A;  3HOT A;  5HNH A;  3K6G A;  4FT8 A;  4XKW A;  4BAC A;  1W36 C;  1WVR A;  2KFD A;  4YFK F;  5DCM A;  1KU3 A;  1T0F A;  3GZN B;  5IOY A;  3Q9V A;  1GVD A;  4N4O B;  4DIQ A;  4GYG A;  5BQT A;  1VQ7 I;  1HSJ A;  2M0M A;  1ZG5 A;  2QA4 I;  4UVA A;  3F8B A;  2JSP A;  2LC2 A;  2X51 A;  2CJJ A;  4F55 A;  2OZU A;  3DU5 A;  4D7N A;  1X2M A;  1MBJ A;  1APL C;  4D1Q A;  1RUO A;  2UZK A;  4Y15 A;  1ZRD A;  3BQZ A;  3T8R A;  2EH3 A;  1MSF C;  3GME A;  2WAD A;  3BCA A;  1V5E A;  3QYF A;  1VQ4 I;  4A3C J;  3K4C A;  3QOE A;  2Z1D A;  4BHP A;  3GFL A;  2ZME C;  5J1R A;  2IT0 A;  2ZJQ F;  1P4A A;  4YIR X;  2FUG 2;  1ON1 A;  3L2R A;  3R0J A;  1FTT A;  5FD6 A;  5IP9 J;  3EYI A;  1YI2 I;  4DJA A;  2OZ6 A;  2R92 J;  2MD0 A;  3OYA A;  4I0B A;  1D1B A;  2D2W A;  3GZ5 A;  2L7Z A;  2LY2 A;  2P0W A;  3V42 A;  2UWM A;  1WI3 A;  4LB6 B;  3I54 A;  5FD5 A;  1FYM A;  1QZE A;  2B63 J;  4Q4Z F;  1IN6 A;  1Z77 A;  4M3E A;  5CJ9 A;  3JRH A;  3M4O J;  5DUK A;  3RKY A;  5LRS A;  2L5Q A;  4A2U A;  3SQN A;  1MW7 A;  4I7H A;  3DQV C;  1N78 A;  1S9H A;  2M34 A;  2HGC A;  4FAS D;  2QQA A;  5FRN A;  2NVQ J;  2JZY A;  3MZY A;  2DOE A;  1XSX A;  3IHU A;  2JN6 A;  4KN7 X;  2QSH X;  4HF1 A;  4RDU A;  1W36 D;  2HDD A;  4AUX A;  2BHY A;  1R1V A;  1J9I A;  4BNC A;  2MA3 A;  3ZR8 X;  4V19 K;  1YX3 A;  2EZI A;  2IGM A;  4A3M J;  4L5I A;  3BCB A;  5D5X B;  5D8K B;  2VLA A;  2ETH A;  2M87 A;  4XM3 A;  3PQJ A;  3IAS 2;  2NS8 A;  4C3I J;  3MZ8 A;  4M6Y A;  1MBG A;  2XF6 A;  1P7I A;  2FBK A;  5BNG A;  3ZMT A;  1RRJ A;  4E7K A;  1FLI A;  3BPV A;  1QNT A;  4BE1 A;  4XBF A;  1V54 H;  4XLA A;  3S17 J;  4XKC A;  1F9N A;  1KON A;  1NK3 P;  1ZKG A;  2NYX A;  2CUF A;  4ZDL A;  1IN8 A;  2F6C A;  2VT3 A;  2LD5 A;  3P7N A;  4A0X A;  2K85 A;  5FKL A;  4A12 A;  5J8F A;  3MFK A;  2EIM H;  3IL2 A;  3H5R A;  3H3U A;  2QQ9 A;  4XOT A;  2XRL A;  2COM A;  2W48 A;  3NRV A;  2VJJ A;  5JLX A;  2L01 A;  1BBY A;  1BW6 A;  3FXM A;  3TW7 A;  4E7S A;  1ZAR A;  1ZRE A;  4G6Q A;  1TWG J;  1ZYR F;  4HQE A;  4B43 A;  2CUJ A;  2HPI A;  2Y31 A;  1LNW A;  2Z99 A;  3DU6 A;  5IT9 Z;  4I99 C;  3HHG A;  3WGH A;  1Y56 A;  3B73 A;  4EJT A;  5J3L A;  3H9Q A;  4YEJ A;  3LFU A;  3ZN1 A;  2QYO A;  1YIT I;  2NOG A;  1BIB A;  3BOQ A;  4CO8 A;  3C1D A;  1STZ A;  2LKS A;  3CDI A;  1WRJ A;  3N4M A;  3AL0 C;  3FHN A;  3HOS A;  3WG9 A;  1LPQ A;  4LGW A;  2FA5 A;  3OYD A;  3BR0 A;  2KRH A;  4MGR A;  4E7Z A;  5GAD J;  3S2D J;  4AWX B;  2VOP A;  2MH9 A;  2H09 A;  1GDT A;  2FNP A;  1LDD A;  3GTO J;  3OYJ A;  2HOE A;  3QP6 A;  3KLN A;  2HDW A;  3BR2 A;  3LQQ A;  4KIT B;  3PIP F;  3L2W A;  4IQJ A;  3BLY A;  3AG2 H;  4GYI A;  5J1U A;  4HNT A;  3BR3 A;  1TW3 A;  2IBD A;  3W2V A;  5LFA A;  4A3K J;  4LFU A;  1DU6 A;  3CP8 A;  5E20 A;  2DTR A;  2CQK A;  1XD7 A;  3R0A A;  4M72 A;  5ICE A;  4ZJZ A;  2XHK A;  3L1P A;  1JT0 A;  3AG3 H;  1POG A;  2ZME B;  2K7L A;  2VE9 A;  2LG4 A;  4U0Y A;  3OR2 C;  4CCM A;  1ZRC A;  2D1H A;  1KGS A;  2EQR A;  4RAY A;  3RIR A;  2K3P A;  2HKX A;  3OOU A;  1IW7 F;  1MH3 A;  5GTI C;  2DLL A;  4M6X A;  2HNH A;  4CCL A;  4IO9 F;  3S93 A;  3HM5 A;  2GIV A;  1FP1 D;  1U5T B;  1PVE A;  1VQ9 I;  1HC8 A;  3LSG A;  4JBA A;  4B8X A;  1XTA A;  4FE7 A;  2MBF A;  5EF6 A;  2HQA A;  5HDN A;  1WJE A;  3EYY A;  2VXZ A;  3KYD B;  2Y30 A;  1ZEL A;  1HW5 A;  4AU7 A;  3RKX A;  4A6D A;  5IT3 A;  3OYM A;  5TGT A;  4XID A;  4HST A;  2M7A A;  2UXX A;  1T33 A;  2DMQ A;  2ELJ A;  3DCF A;  2ELH A;  3CZ6 A;  1BI2 A;  4EQQ A;  1AWC A;  2EV6 A;  3D5R C;  2DDA A;  3JCU C;  5LEJ A;  3F8C A;  4ZZL A;  2NS7 A;  1AKH B;  2A07 F;  2CMP A;  4AYB A;  2VI6 A;  4Y4R A;  4BAY A;  4QTR A;  4H4K C;  1H89 C;  3H35 A;  1B9M A;  3I59 A;  3LSI A;  1R4M B;  3ECH A;  2RV8 A;  3F6O A;  1FMW A;  3FXU A;  2E7X A;  3VYT B;  2EBI A;  1T56 A;  2DXI A;  5IT9 R;  4P96 A;  1RNL A;  1ODD A;  3BRO A;  1S8N A;  2VQL A;  3DPT A;  1XS9 A;  3G6E I;  2V9V A;  3BR1 A;  1JKP C;  4L5J A;  2HZD A;  3E5U A;  4E7J A;  4BUP A;  5F0H A;  3ZQC A;  3IV5 A;  2GAU A;  2BOL A;  3IRQ A;  2A3S A;  1B4A A;  4FX0 A;  1YO5 C;  1KA8 A;  3BTL A;  1RZ4 A;  3KLO A;  2IRF G;  4MLO A;  2M3A A;  5B1A H;  3DKY A;  4O3M A;  3TP3 A;  2EK5 A;  1XG1 A;  1D8K A;  1L3L A;  3I4P A;  2G9W A;  4AC0 A;  1MJ9 A;  3K9T A;  4HPQ A;  1WPK A;  4P5O A;  1A04 A;  5LRR A;  2CV0 A;  1X3Z B;  2CG4 A;  2A6T A;  5CVI A;  2LOO A;  2W1O A;  3OS0 A;  1D5Y A;  2LF8 A;  4X6A J;  1MZB A;  3TL4 X;  3GW2 A;  4U0W A;  2QEN A;  3CUQ C;  3HHH A;  4WK8 F;  2CWE A;  1UFM A;  5K5R A;  4XLF A;  1SD6 A;  2CQ7 A;  5B5E C;  2ZB9 A;  2BZT A;  3S1Q J;  5LLQ A;  4AIJ A;  3J81 R;  5L3G A;  2XF7 A;  2Z3Y A;  5FKN A;  3S2H J;  5KNL A;  3OY9 A;  1UJ8 A;  2QQB A;  2WV1 A;  1JT6 A;  4RM3 A;  3AL0 B;  3BT9 A;  4RAF A;  2CW0 F;  5JFR A;  3IWZ A;  3HOX J;  2E34 A;  3E6B A;  2BY3 A;  2V9K A;  4RGU A;  2HYJ A;  1XPX A;  1AHD P;  4I76 A;  1SD7 A;  2E7W A;  1YHQ I;  3TDU C;  1SEU A;  1QHG A;  3LOC A;  2A61 A;  3V8K A;  1Z91 A;  2PX9 A;  1OCO H;  2DQR A;  3JAM Z;  5A2Q K;  1V5G A;  2V1X A;  1GLN A;  2OQG A;  3OL3 A;  2HVS A;  1FNN A;  2NS0 A;  2BXZ A;  1KQ9 A;  1MKM A;  1TQI A;  3ABU A;  3SFI A;  1N77 A;  3GZ6 A;  3ONQ A;  2VQC A;  1P4W A;  1ETW A;  2EFO A;  1LKX A;  4XRS G;  3GTP J;  1J7K A;  1GXQ A;  1TLH B;  1K79 A;  2L54 A;  1MD0 A;  1N25 A;  2JA7 J;  4EAT A;  1O3T A;  2KJC A;  3K4J A;  3ABM H;  1R1T A;  2RGV A;  3NEU A;  1FY7 A;  1ETQ A;  4LIU A;  1GT0 C;  1ONV A;  4CA0 A;  1RUN A;  3WOD F;  2HQN A;  4IOA F;  2KZG A;  2W82 A;  1HKT A;  5E17 F;  2LLK A;  3TBI A;  1PUE E;  2X4H A;  2QKL B;  3AKZ A;  2MSY A;  3BC8 A;  1S5L C;  1OLT A;  3GTK J;  2KL4 A;  1SVO A;  4A3E J;  2OC6 A;  5C3E J;  3F23 A;  1FTZ A;  2WWY A;  2DN0 A;  1I27 A;  1MMA A;  2VXD A;  2LBF A;  3V7C A;  2Y0S N;  3J80 R;  3ECO A;  3SZG A;  4IOC F;  4MIM A;  1JKQ C;  1FIA A;  2K40 A;  1LEB A;  1QVU A;  1S72 I;  1WI9 A;  3MKL A;  2PLY A;  3JSO A;  3CCL I;  2FD5 A;  1IRG A;  2M35 A;  2KJB A;  2BY1 A;  1LE8 A;  2QM3 A;  2VAS A;  2MZ4 A;  2X6O A;  2BY2 A;  2EA4 A;  5K7F A;  2FJ1 A;  2DFH A;  1DPU A;  2P8T A;  3KZZ A;  2VUM J;  4HNU A;  5BPI A;  2CQN A;  2JA6 J;  3FM3 A;  4B47 A;  5CVJ A;  1I1S A;  2CFX A;  2R7V A;  1FIP A;  1TWC J;  2EZL A;  1YW7 A;  3F0C A;  5TIS C;  4XN0 A;  4XLH A;  3OMY A;  2E1O A;  3G4S I;  4B1R A;  5L3E A;  1E0E A;  1OMI A;  5EG0 B;  1LEA A;  2O8K A;  3RKW A;  3B02 A;  3OYC A;  1ZG1 A;  3PNY A;  2BV6 A;  3CUQ B;  2E2H J;  2C6Y A;  1RKT A;  2ECC A;  3ABL H;  3K4M A;  1X1A A;  1TWF J;  2K27 A;  4A0Y A;  1W0U A;  4E7H A;  2R0Q C;  2STT A;  1NHA A;  4EV0 A;  4XKV A;  1TBX A;  5LGU A;  1SAN A;  3FMS A;  3I59 B;  3BR6 A;  4LLN A;  1BL0 A;  1X4O A;  1PP8 F;  2VKH A;  3K10 A;  1XC5 A;  4HDV A;  1ZGA A;  3BWG A;  3BR5 A;  3HPG A;  1JGG A;  5EJC A;  2NNY A;  3ZQQ A;  3HZJ A;  2L9V A;  3N97 A;  4CHU A;  2HEO A;  2K3F A;  3DKX A;  3O6B B;  1JJ8 C;  5K5Q A;  3KX2 A;  3I71 A;  5KCM A;  3OS2 A;  1S3J A;  1XSV A;  3HTS B;  4L0Y B;  4A3L J;  2OUM A;  5D5U B;  2JK3 A;  2VKV A;  5IYD J;  3BG3 A;  2E71 A;  1XMK A;  5DV5 A;  3OYN A;  3CJT B;  2ACJ A;  4S0H B;  3E0J B;  2DPD A;  2MG4 A;  3EUA A;  3M07 A;  1BJZ A;  3ZGK A;  2IPQ X;  2V1D A;  2FML A;  2BEO A;  1MDM B;  4IX7 A;  1U2W A;  3QOP A;  3S8P A;  2Y69 H;  2BVL A;  1CGP A;  3RSN A;  5ED4 A;  3QYB A;  1ON2 A;  2JT1 A;  4J00 A;  4ASN A;  3LA2 A;  1OYI A;  2DA5 A;  3Q3S A;  4DGW B;  5LEK A;  2YPR A;  1TL8 A;  2GZW A;  2ZSI B;  3UNG C;  3G3Z A;  4A3J J;  4L9V A;  5B3S H;  1WJF A;  3HB9 A;  1ZTR A;  4OAZ A;  4CUG A;  5KAI C;  4A3I J;  2VJ4 A;  3CO6 C;  4XIC A;  3CMA I;  2LRD A;  2W4S A;  1IN4 A;  2X9D A;  4BXF A;  1M1E B;  1YQA A;  3SHF A;  5E3N A;  2DT7 B;  5CKT A;  3GFM A;  2X1C A;  3PNV A;  1QHH D;  2E1C A;  1OKR A;  2WTE A;  2Y9Z A;  4NDL A;  3BP8 A;  2JJ7 A;  1R49 A;  1SAU A;  4KMU X;  1KZH A;  1D0Y A;  3AG4 H;  4LIV A;  4GO1 A;  3FM5 A;  3PL8 A;  3CF2 A;  4FCY A;  1FEX A;  4BKX A;  1X1C A;  4JX4 A;  3CJN A;  3U2R A;  4L0Z B;  2LKP A;  3GTG J;  5HNF A;  1I1G A;  1JKO C;  3SEZ A;  2ISY A;  4IRG A;  4NC6 A;  2R7X A;  2XPW A;  4U7D A;  2DOA A;  4UB8 C;  1TC3 C;  3HRU A;  5F6F A;  2VJ5 A;  3I3L A;  3HUG A;  1KQ0 A;  4BDY A;  3DPU A;  3HRM A;  2V26 A;  2FOW A;  2MVT A;  2X6Y A;  2JWT A;  1G3S A;  3HPH A;  2HU9 A;  2XB5 A;  3VOD A;  4F93 B;  3VWB A;  3TOA A;  1T98 A;  2XGE A;  4ESB A;  3S2W A;  2F2E A;  3KFW X;  3BJ6 A;  5IYC J;  2D5V A;  3N05 A;  1YW8 A;  2DO7 A;  2A05 A;  4JK1 X;  1ZLK A;  3BTJ A;  2Y0S A;  3L2Q A;  1J75 A;  5F1J A;  2CYY A;  1SD4 A;  1VF9 A;  3WHB A;  3ZQL A;  4M6V A;  2R5Y B;  1WSU A;  3DTE A;  5B1B H;  4CCJ A;  2HXO A;  2NOJ B;  4XSX F;  5IP6 A;  1XGN A;  1F43 A;  2HOA A;  1IDZ A;  1W7P B;  4YIF A;  5DDG A;  3HTU A;  3W6K B;  2W7N A;  2JA8 J;  3DF8 A;  3IC7 A;  4UV9 A;  2IEK A;  4XR6 A;  3PUF A;  1HDD C;  2VOO A;  1IXR C;  4DBR A;  4XOP A;  1UB9 A;  3BZK A;  3L09 A;  2X85 A;  3K4B A;  2GOM A;  3MQ0 A;  4G9Y A;  3OYH A;  2MLG A;  1NH3 A;  1G3Y A;  2FE3 A;  2KRF A;  1VQN I;  1HQC A;  2LBF B;  1QZY A;  3FXQ A;  1QZZ A;  1PUF A;  3OS1 A;  5FLX R;  1LDK B;  2FU4 A;  5H6R A;  3DLA A;  1IN5 A;  2DA2 A;  4HAM A;  1FWZ A;  1IAW A;  4OMZ A;  3V7S A;  3GCM A;  2X48 A;  3Q0U A;  3CCJ I;  3ESW B;  1PJR A;  5EDN A;  3IKV A;  1LE8 B;  3F6V A;  5JHF A;  4NBQ A;  3M8J A;  2XAQ A;  1OPC A;  1T2K A;  2EV0 A;  1YS7 A;  1TTY A;  2DI3 A;  2PQ8 A;  2DQL A;  2KDO A;  4BY1 J;  3HSE A;  1RES A;  4AYB N;  2IAI A;  2M30 A;  4YEL A;  5M5W J;  4F91 B;  3NWS A;  3ZMS A;  4M3G A;  2ME0 A;  4A0Z A;  5HS8 A;  3LSJ A;  3U9G A;  3S15 J;  2R5Z B;  2AQF A;  3CUO A;  4X1E A;  4BL0 B;  1FBU A;  2F5F A;  3FMR A;  2DFF A;  3QPT A;  4E70 A;  4UHT A;  2K9Q A;  5DS9 A;  1VQP I;  5GAH J;  5E3M A;  2VN2 A;  1T0F C;  4CXF A;  2HVR A;  3GXO A;  3DPL C;  4JX6 A;  3J81 K;  4OOI A;  1LDJ A;  4PGH A;  1BW5 A;  3JRD A;  3ASN H;  3G1M A;  2H27 A;  2IS2 A;  1GV2 A;  3FXO A;  4XSZ F;  3LSH A;  2CW7 A;  5KK1 A;  4CYD A;  2QSG X;  2DT5 A;  1NTC A;  4ZDO A;  2K9M A;  3PM1 A;  4IHX A;  2FNA A;  4KIC A;  2CGP A;  4S04 A;  3TGN A;  1Y0N A;  3TW6 A;  2F4O B;  2BW3 B;  2FSW A;  3ZQG A;  2KDZ A;  5D5W B;  2EIL H;  4O6J A;  3BQY A;  1K6O A;  2OU2 A;  5ICG A;  3KYL A;  1ZLJ A;  3FWE A;  1DGR M;  3S16 J;  3HBL A;  5DM6 F;  2VBX A;  3KP5 A;  1BIA A;  3CCE I;  1BOA A;  1V3F A;  5F0C A;  4GXO A;  1E2X A;  3E5X A;  4I02 A;  3JRB A;  2CO5 A;  2JA5 J;  2FX0 A;  2DA7 A;  5C4J J;  4XLP F;  1X1B A;  1R71 A;  3E1S A;  5J4Y A;  1O4X A;  2HXI A;  3OL4 A;  4FHT A;  2ECB A;  5J8C A;  2CV2 A;  2BHZ A;  2PMZ N;  4DBQ A;  5M3M J;  2PMH A;  1FYK A;  3G1O A;  2K9N A;  3PUB A;  2GXA A;  5J40 A;  2STW A;  2VBW A;  3IAM 2;  4E6K G;  3ZQI A;  3QP5 A;  2ADU A;  3FMQ A;  3FK7 A;  3J7Y J;  3KZI C;  3VYS B;  3KCC A;  3PSI A;  2LH9 A;  1R36 A;  1TWA J;  4MO7 A;  4TV7 A;  4B3A A;  5AON A;  2HWV A;  2E2I J;  3BZ6 A;  4LIT A;  1YRN A;  2ZXI A;  2DTZ A;  2DJN A;  4ON0 A;  1R00 A;  1BOB A;  3WU1 B;  5ILU A;  3I55 I;  1XDS A;  4KJZ A;  3H3V K;  3QYE A;  2A6E F;  2PG4 A;  2OTJ I;  4KN4 X;  3HOU J;  2EFP A;  2ZBK A;  4B3X A;  2FF4 A;  1B8I A;  2CH0 A;  5FRO A;  3IH4 A;  5C4X J;  1QRY A;  4RA2 A;  4BHB A;  1YYV A;  4UUV A;  2KIU A;  2W57 A;  1S29 A;  2Y0M A;  3FF5 A;  4JOM A;  1Z6R A;  2AXL A;  2R7D A;  3QU6 A;  4ZTF A;  4EJU A;  1D1C A;  1YIO A;  3A01 A;  3VSK A;  3Q0V A;  4AID A;  2WB1 A;  2XKO A;  3KET A;  1FZP B;  3LMM A;  1IJW C;  3CDL A;  4UXN A;  1U3E M;  2IA2 A;  3HIF A;  3JRE A;  1NK2 P;  3J80 K;  1W5C C;  2ZSH B;  4A5M A;  1YW9 A;  2JVG A;  3W6V A;  1HBX G;  3DTK A;  4BS9 A;  4GCV A;  1MMG A;  3ZCO A;  2XPU A;  4NNJ A;  3RYR A;  1LFB A;  1FYL A;  2QBY B;  2HQ5 A;  3HSR A;  2DMT A;  1OFC X;  2VE8 A;  1SAX A;  1VZ0 A;  4MTE A;  5D4R A;  1UZC A;  4D0P A;  1AU7 A;  4IZZ A;  1JTX A;  3LFK A;  1SFE A;  4C30 A;  1G4D A;  4N4N B;  4PUS A;  2GM4 A;  3FBN B;  4PK4 A;  2CU7 A;  3FXK A;  5B66 C;  3M8E A;  1IO2 A;  2L02 A;  4C9Y A;  5EYR A;  2B0L A;  3GTQ J;  1MSE C;  3P9K A;  1T08 B;  4CCO A;  3I58 A;  5E3O A;  1BC8 C;  1HW1 A;  5E1Z B;  4F3Q A;  1IN7 A;  2H1L A;  4BYY A;  3NAR A;  3TKY A;  2A69 F;  2GOX B;  3H92 A;  4YRV A;  4NHJ A;  4UUS A;  3I64 A;  4BQN A;  3CLO A;  5DM7 F;  5DCM B;  1BJA A;  1WQ2 A;  2GLO A;  3AFH A;  1FSH A;  4IPA A;  2M9H A;  3ZQF A;  1J59 A;  1XB4 A;  2VBY A;  2JVH A;  3S3O A;  1UG0 A;  5ERI A;  1B72 A;  3K1N A;  1FP2 A;  1JUS A;  5FGM A;  3CJQ B;  2IP2 A;  5HLH A;  3RYP A;  5E18 F;  3PJR A;  2MW8 A;  1SFX A;  3FDY A;  4NC8 A;  2NRA C;  2NVY J;  3C2G A;  1WGX A;  4WXH A;  5EGO A;  2KP6 A;  2WBM A;  2KIS A;  3NAU A;  5DTD A;  5CQE A;  4M3B A;  1CF7 A;  4KIS A;  3HYI A;  1Z3X A;  1X2N A;  1R5G A;  4EJV A;  3HEF A;  3X2Q H;  4BXU A;  2BYV E;  1T6S A;  1BI1 A;  4PFO A;  4LG0 A;  2HQR A;  2JSC A;  2DMU A;  2IJL A;  3AAF A;  3NQO A;  1EV7 A;  3RCO A;  3U21 A;  2PJR A;  1OJL A;  2G7H A;  2JPB A;  4LOC A;  1YIJ I;  3V8J A;  2LRE A;  4CCK A;  1HDP A;  1OCP A;  2ZJP F;  1ZR2 A;  1D1A A;  4KIF A;  5KAF C;  2V6C A;  2FXA A;  1KYZ A;  2E5N A;  2L3D A;  1MNM C;  4A6E A;  4MHG A;  2A5Y B;  5BPD A;  2VC1 A;  4FIS A;  3KP3 A;  2R7T A;  1U0J A;  1QO0 D;  2LK2 A;  1SMY F;  2A68 F;  3MEX A;  1XMX A;  2R7O A;  1B9N A;  4G6D A;  1MNE A;  4ESF A;  2EZK A;  1S7A A;  2WV0 A;  4D5C A;  1V5F A;  4LMY A;  2A5W A;  2NXN B;  3I53 A;  4HOB A;  4A69 C;  1K78 A;  1A5J A;  3CLQ A;  1MJA A;  4BQQ A;  2PMZ A;  3GFJ A;  2DA6 A;  4D5F A;  4DZJ A;  1O7F A;  3DV8 A;  1EKE A;  1SFO J;  1L0O C;  4UVC A;  2I5U A;  4FET A;  4IHV A;  1ZG3 A;  1K4T A;  3EPZ A;  4MFE A;  2ZO4 A;  2O0Y A;  2W85 A;  3B6C A;  3CP2 A;  4OIN F;  4XRM A;  2JRM A;  1DPR A;  2Y75 A;  4N9I A;  3T1B A;  3K4N A;  1LB2 A;  4P1W A;  3T8T A;  4ZH4 F;  5HVQ C;  3HGG A;  2P0T A;  5ICC A;  4II3 A;  5FLV A;  2BE5 F;  3H3Z A;  2GXB A;  2NAZ A;  1TWH J;  3WTU C;  1P2F A;  1TT5 B;  3E7L A;  4OWR B;  3J7Z I;  1VQL I;  1UAA A;  2O5R A;  4FTH A;  3P9I A;  4OIQ F;  1JTY A;  1MH4 A;  2O3F A;  3IP4 B;  3OOP A;  4C3J J;  5IP7 J;  4BEH A;  1QGP A;  3ZMZ A;  2ZFU A;  1F4K A;  4L9N A;  5L3B A;  3EUH A;  3BTI A;  3G73 A;  1YJW I;  4JYK A;  2MD5 A;  3GX4 X;  1IV6 A;  1HLV A;  2IGN A;  4KNY A;  2IXS A;  2O6G E;  2ESN A;  2LR8 A;  3K69 A;  1ZHF A;  2FOK A;  2FQ4 A;  3G2B A;  2WY7 Q;  3LA3 A;  2L9R A;  2NVX J;  2RKH A;  1IDY A;  3KEO A;  3K1P A;  3U1D A;  1JJ6 C;  4Z6Y A;  4G7O F;  4FE4 A;  1A35 A;  4N0B A;  1QVT A;  4AIH A;  4X0G A;  4QSH A;  1I39 A;  4LK0 F;  1YFH A;  2XB0 X;  3C3W A;  4KDP A;  1R22 A;  2XUB A;  3F3X A;  4R8H A;  2L2O A;  5D6E A;  4U88 A;  4EJO A;  2RN7 A;  1ITY A;  2GQQ A;  3H5N A;  3L2U A;  2QVO A;  1FT9 A;  3S1M J;  2ELK A;  3ZRG A;  1P7J A;  4QIW N;  3I56 I;  2OJE D;  3WTS C;  1BR1 A;  2QGU A;  2AO9 A;  3DEE A;  5EEH A;  2F48 A;  2VON A;  1QPM A;  4XNF A;  1J0R A;  3WTV C;  3CME I;  3W3C A;  2Q2E A;  4RGX A;  4XON A;  1G2H A;  1EH7 A;  3RQI A;  5DCF A;  1K4S A;  4DOZ A;  1Y8Q B;  1TQP A;  2P6S A;  3ZP5 A;  4LD5 A;  2V1U A;  2KHM A;  3WU2 C;  3FXR A;  2RNJ A;  4Q48 A;  1LFU P;  2P5L C;  2V1N A;  3KP7 A;  1XSD A;  5FO5 A;  5LHH A;  4HX7 A;  1GUU A;  2WC2 A;  1ORK A;  1IUY A;  1JUP A;  3H0D A;  1RI7 A;  2Y9Y A;  5FLX K;  1LVA A;  2QSF X;  2BXY A;  3MZH A;  3LA7 A;  2XGD A;  3SZP A;  1R23 A;  4NB5 A;  4C2U A;  1HKQ A;  2KT0 A;  3EUH C;  2W24 A;  3CTA A;  4ANJ A;  3QRF F;  5C44 J;  3QAH A;  3PO2 J;  4ESJ A;  2DMP A;  2RRE A;  1E17 A;  1SMT A;  4GGG A;  1FJL A;  2FBI A;  2JUG A;  3E5Q A;  1D5V A;  3W6J B;  3PO3 J;  3HOZ J;  3F8M A;  3F8N A;  1JXS A;  1OYW A;  4ZC3 A;  2HR3 A;  3RJP A;  4HX4 A;  3H9G A;  4GDF A;  1YX5 A;  2COB A;  2O03 A;  5KHD A;  4CGZ A;  2IS1 A;  4BU2 A;  1ETY A;  4XOR A;  3B6A A;  1A6Q A;  2EZH A;  4CIC A;  3K0L A;  2HDC A;  2KIQ A;  3S14 J;  4BBS J;  3BG9 A;  2VT2 A;  2CFO A;  1MGT A;  3BPX A;  4IXA A;  2WY8 Q;  2K9L A;  3MCZ A;  3JAM R;  4Y33 A;  1D3Y A;  3REO A;  4IL6 C;  2X6W A;  3LAJ A;  3M3Y J;  1HKS A;  2EB7 A;  3L7W A;  1S7E A;  4IQ4 A;  2ESH A;  3O2P E;  1RPW A;  2DJI A;  3WTW C;  2V79 A;  4ZYH A;  5CVR A;  5L3C A;  1OQY A;  1VQM I;  2F5D A;  4B4C A;  4XLE A;  1OR7 A;  3FXJ A;  2ZCW A;  3ABK H;  3CCS I;  3E97 A;  1IRZ A;  2QCO A;  4NC7 A;  4CSW A;  4XK4 A;  2B9S A;  5EEA A;  4IJA A;  3MWM A;  1H9G A;  4KT5 C;  2K02 A;  1ETX A;  3BTC A;  4RLQ A;  4KYW A;  2Q0O A;  1KQ8 A;  3JW4 A;  3Q9S A;  2HOT A;  3K4L A;  3DKW A;  1X1P A;  1SVL A;  5FFZ A;  2PMU A;  3MN2 A;  1QA6 A;  1VQK I;  4NQW A;  5FB2 A;  1IGN A;  4HSR A;  1BA5 A;  1IV8 A;  3EUK L;  4IHT A;  4M3F A;  4WF2 A;  5A2Q Z;  4Z2Y A;  1W1W E;  1F5T A;  3CC4 I;  2Q8K A;  1FOW A;  1R5H A;  1X19 A;  1Y39 A;  2DT6 A;  4G6T B;  5GAG J;  5K7H A;  1UEL B;  4HLX A;  5CLS A;  1DP3 A;  2AXT C;  1YOV B;  2VJI A;  4J01 A;  4ZYE A;  4RB2 C;  2K9S A;  3I0T A;  4PSW A;  4A3B J;  3G1L A;  2R3S A;  3M1E A;  2DCE A;  4BXX J;  3DBH B;  1TNT A;  3HGY A;  1HW2 A;  2GWR A;  4RMN A;  2Z2S B;  4L9J A;  2CQQ A;  1FOK A;  3I4M J;  2OCE A;  4L5E A;  3CMM A;  5LHG A;  2XPV A;  3RZD J;  1BC7 C;  3C2B A;  2L9N A;  2IVM A;  3Q0W A;  4MQV A;  1Y1W J;  1RR8 C;  1WH7 A;  2XKP A;  3KP4 A;  1YTY A;  5DEQ A;  1P92 A;  3LSP A;  2KMU A;  3DTI A;  3EET A;  4ENK A;  1FPQ A;  2M4G A;  5GAE J;  2GBY A;  4V2G A;  3SJM A;  5L3F A;  1XX5 A;  4I6Z A;  4RB3 C;  3OWT A;  5FFX A;  2H8W A;  3PSF A;  1IXS B;  3OR1 C;  2XC7 A;  2K86 A;  4A3G J;  3SEQ A;  2ZFW A;  4R1H A;  5HLT A;  3RKQ A;  5CVV A;  4IKF A;  4HZF A;  2VBZ A;  3GTL J;  3HC7 A;  1VFC A;  3W2W A;  1PDN C;  2FRH A;  1WWX A;  4BEH B;  5GPC A;  3GF2 A;  2MH2 A;  4XKB A;  1TT0 A;  3FKI J;  2OA4 A;  2XAS A;  2RDP A;  3SDG A;  5JR3 A;  4BHC A;  1Z0X A;  3JTG A;  3JRC A;  1X4P A;  1Z7U A;  2P5K A;  2YR2 A;  1V4R A;  3FBI B;  4A5N A;  2IS6 A;  2MGQ A;  1R9T J;  4HF2 A;  1UMQ A;  4QPO A;  5H20 A;  4ITV A;  3WU0 A;  4HEA 2;  3ZPL A;  5D6F A;  1N75 A;  3HL2 A;  5F04 A;  4M9Z A;  1R7J A;  4ENN A;  2WB1 N;  2YUS A;  1JKR C;  4PZJ A;  1W5S A;  2IA1 A;  1G3W A;  3G71 I;  3KIO A;  1Z67 A;  2H1K A;  5A2Q R;  1VQ5 I;  1MMS A;  5JVG F;  4II2 A;  2E5Z A;  3DXJ F;  5HDG A;  2ZME A;  2IA0 A;  4KMF A;  1Z1D A;  2JQ7 A;  2UV1 A;  1AA7 A;  3LSK A;  2P7V B;  2AHQ A;  3ROU A;  1WJB A;  1ZH5 A;  1ETO A;  2G7U A;  4A93 J;  2GA1 A;  1IZ1 A;  4HW0 A;  4IRH A;  3WGG A;  4G7Z F;  1QBJ A;  2N8G A;  4CYC A;  4L18 B;  1FMV A;  1OCZ H;  1UHM A;  1U5T A;  3ISP A;  3ZMU A;  1YJ9 I;  1DDN A;  1SFU A;  2XF5 A;  4AD9 A;  4I0A A;  3QU3 A;  2JPC A;  1WKM A;  1SD5 A;  5D4S A;  4EEF G;  5IT9 K;  4U0V A;  2OTL I;  5AIQ A;  2QUF A;  5EZH A;  2FQ3 A;  1ZGW A;  1G3T A;  2VB6 A;  3A4C A;  4M71 A;  3ZXS A;  4C2M J;  3K7A J;  3QOD A;  4ZYD A;  2TRT A;  3E6D A;  2E1N A;  4PJL A;  2XRN A;  4BH9 A;  5JLW A;  3JRG A;  2Y48 A;  4MTD A;  4XLN F;  2VKE A;  1J2X A;  3F72 A;  1AKH A;  2OAZ A;  3WE2 A;  3L2C A;  1EJ9 A;  3QPS A;  3QPH A;  3KE2 A;  2KPM A;  3VB2 A;  6PAX A;  4UNO A;  5M5X J;  3P9C A;  3T5X A;  3WGI A;  2PJP A;  3BZC A;  2WAF A;  3PIO F;  2ZC2 A;  3KP2 A;  1WJA A;  4IHW A;  3PNT A;  1RR7 A;  4DYR A;  2EA2 A;  4WCG A;  1VI0 A;  4PJN A;  1G8X A;  3QQA A;  2P6T A;  1YG2 A;  2EIN H;  3R61 A;  2UXN A;  3MMY B;  1OCT C;  3HOY J;  3PFY A;  1MBH A;  1Y1V J;  5TJJ A;  4JX5 A;  5D5V B;  1FBS A;  3OYB A;  2R93 J;  3GVA A;  1ETK A;  5HS9 A;  1RKW A;  3FX3 A;  2YX4 A;  5CQG A;  1CQT A;  2VPR A;  2PFB A;  3CO7 C;  3OYK A;  4XRF A;  1R6R A;  2F4I A;  1JI8 A;  2TCT A;  3OV8 A;  2EIJ H;  4YII A;  1GVJ A;  1W4M A;  3I5U A;  4QLC U;  1WZ2 A;  3RTR A;  1U5T C;  3E6C C;  1U8R A;  4OU0 A;  3TOB A;  2B7E A;  4MFD A;  2R4G A;  3TQN A;  1Q1V A;  4I01 A;  4I09 A;  2XGC A;  4Y13 A;  4G12 A;  4ENM A;  1HF0 A;  1U6G A;  3JRI A;  2L7K A;  3ZOB A;  3O8G A;  1ZGJ A;  1RET A;  1ZQ3 P;  1BI0 A;  3FKJ A;  4Y52 J;  4JP0 A;  1MBF A;  4NQW B;  1JUM A;  2WAE A;  4PJM A;  4UV8 A;  1MBK A;  5F0F A;  4A3F J;  2CV1 A;  2P4W A;  1H0M A;  2HFH A;  3A03 A;  3GEZ A;  1OCC H;  3LAP A;  2I10 A;  4XRS A;  2NVT J;  1EA3 A;  4G7H F;  3GUD A;  1XCB A;  2I8D A;  5EEG A;  3S32 A;  2LP0 A;  5FJ8 J;  5K7Z A;  2M4K A;  2H94 A;  2DOD A;  1W0T A;  2GIZ A;  3D5S C;  3DLL F;  4IVN A;  1U8B A;  5IY5 H;  4P55 A;  2X1D A;  5H2F C;  2ZNZ A;  3CF5 F;  3A0B C;  4PGG A;  4BY7 J;  4W97 A;  4XLC A;  2CW8 A;  3VEP A;  1G6N A;  3OSF A;  1ZK8 A;  5GPA A;  1JGS A;  3MD2 A;  2O7O A;  4LLL A;  4RAG A;  4MQ9 F;  3WTT C;  2DA4 A;  2HTS A;  2LY9 A;  3AG1 H;  5EZG A;  3VFZ A;  4BJT A;  4U7B A;  4PCQ A;  2HPM A;  3S3M A;  1YE9 A;  5F08 A;  2HI3 A;  4BJ5 C;  5E8G A;  1VQO I;  1H8A C;  5DYM A;  2IW5 A;  2M8G X;  1FC3 A;  3IUO A;  5TRD A;  3Q5F A;  4RAZ A;  3ZN0 A;  2ZXH A;  4LK1 F;  2VC0 A;  3CDH A;  4BDZ A;  3LL7 A;  3RZO J;  1ACI A;  1B59 A;  2PN6 A;  3SFZ A;  4PSX A;  4EVI A;  5HDK A;  5HLG A;  3UR3 C;  1PYV A;  1H9T A;  3WHC A;  4XQF A;  4OMY A;  3WE3 A;  3TED A;  2VL8 A;  1RQ6 A;  1HST A;  4UB6 C;  1KU7 A;  4ZYA A;  4C2T A;  5CVU A;  2XSJ C;  2ID6 A;  4EM2 A;  2L9S A;  1ERD A;  2WA0 A;  1SVM A;  2P5V A;  4DNC A;  1Y8R B;  2LF7 A;  1ZN2 A;  5FKM A;  4OIO F;  2CUZ A;  3SZT A;  4GRI A;  4HA8 A;  2ID3 A;  2WAQ N;  5GP9 A;  4E7L A;  5E3L A;  2F4M B;  4EGY A;  2A6H F;  1QQI A;  1X3W B;  4IF4 A;  3JSP A;  5HLI A;  4HYE A;  4IHS A;  5DUI A;  3COA C;  2E1M C;  1HXD A;  3S3N A;  3A52 A;  3EDP A;  1F1Z A;  1DQU A;  2OBP A;  2DDB A;  1S7O A;  3GTJ J;  5E8I A;  3K70 C;  3HUG B;  1XGM A;  1OCR H;  5LHI A;  2HOS A;  3E3V A;  3GLL A;  2V6E A;  3OYE A;  1YS6 A;  3ZMD A;  1XMA A;  2ZKZ A;  4AVZ A;  1Q1H A;  2OF7 A;  1PP7 U;  1XCV A;  3OYF A;  3LWF A;  2E35 A;  2KIM A;  3R60 A;  4RM2 A;  4BGD A;  1BM9 A;  3CJR B;  1HCR A;  2EJR A;  1V55 H;  1U9O A;  3FHZ A;  1O3R A;  1IXC A;  5AIP A;  3VYU B;  3JRF A;  2QLZ A;  1R58 A;  3DFG A;  3JAM K;  2MAB A;  1D0Z A;  5IPA A;  4FX4 A;  3A1Y A;  1ZAO A;  1Y0U A;  2O9L A;  2EPF A;  2YSR A;  2QEX I;  2EFW A;  4Y3O A;  3C7J A;  1QU3 A;  2V7F A;  2R7W A;  4M3D A;  1O3Q A;  3J81 Z;  2XV4 S;  2QQ8 A;  1R5I D;  1USS A;  1XN7 A;  1LFP A;  4OAY A;  4R79 A;  1R1U A;  5ILV A;  2IGO A;  3RI4 A;  1D0X A;  4CYC B;  2BY0 A;  4RBO A;  5DD4 A;  4WWC A;  4Y17 A;  1KYW A;  1XGO A;  2AQE A;  4EM0 B;  3K4K A;  5H6Q A;  2HYF A;  2PBI A;  4EGZ A;  5F1R A;  2X6X A;  1U9N A;  4LG3 A;  4F7Z A;  1FX7 A;  2MLK A;  3PQK A;  4DYQ A;  3GFI A;  2BBY A;  5EG0 A;  3JR9 A;  4M73 A;  1Z7L A;  3CCM I;  1PUF B; 
#chains in the Genus database with same CATH homology
 5KVR A;  3ML6 A;  3CUQ A;  1K7A A;  2DAO A;  4RGS A;  2DW4 A;  2FEZ A;  2Z33 A;  1T38 A;  2L4M A;  4KUM A;  2O61 A;  2FMY A;  4KFC A;  3K2Z A;  3RPU A;  3LST A;  1LJ9 A;  2VOD A;  2QZ8 A;  3KEQ A;  4LJZ F;  1TQM A;  3ULQ B;  2XAJ A;  5BMZ A;  2OQR A;  2ISZ A;  1TW2 A;  5J6X A;  2ZXJ A;  4HX8 A;  3JTH A;  2K4B A;  4AIK A;  1TNS A;  4H0E A;  2KIF A;  3FZV A;  4CZZ A;  5F64 A;  1MDM A;  4S05 A;  3DP7 A;  3T0Y A;  2YU3 A;  3GLX A;  1YLF A;  1D8J A;  4I2O A;  1LQ1 A;  4KIB A;  3KZY A;  2GXG A;  1FSE A;  1X3U A;  3J80 Z;  4MNU A;  2PI0 A;  3ELK A;  1BN5 A;  3R4K A;  4K2E A;  3C18 A;  5ILS A;  2RC4 A;  3KP6 A;  5CYV A;  2CSO A;  2X0L A;  2GA2 A;  2DBB A;  2LSO A;  2M5W A;  3GYH X;  1KU2 A;  2EV5 A;  3HRT A;  3ZMV A;  2LNB A;  1EH8 A;  3M8F A;  4HF0 A;  3WTZ A;  3GWZ A;  4OIR F;  2RVC A;  4P9U A;  1FBQ A;  1O57 A;  5K1Y A;  3BY6 A;  3L00 A;  3HRS A;  4RS8 A;  2HZT A;  2EFN A;  4DQ2 A;  3IRR A;  2FBH A;  2QWW A;  1GHC A;  3BJO A;  3MAJ A;  4Q5S F;  1Z05 A;  1I6X A;  1VTN C;  1AOY A;  4HDU A;  4AVP A;  3O3K A;  4Q47 A;  2J5P A;  2ZJ2 A;  4M9X A;  1B1B A;  1UHW A;  2XAF A;  3R6S A;  1P4X A;  1MJB A;  4LLG F;  4WXC A;  2OD5 A;  4IRI A;  5HS7 A;  2F5C A;  3L9F A;  4YFX F;  2J5O A;  1C0W A;  3TO9 A;  1W7P A;  1ZRF A;  2D45 A;  3ERE D;  4OIP F;  3TO7 A;  5HOO A;  2M45 A;  2DFI A;  4PDK A;  2O8X A;  1GXP A;  4KIG A;  1S6L A;  3WTY C;  3TO6 A;  2EWN A;  1P6R A;  4HBL A;  2XIG A;  4RB1 A;  1RIO H;  1IF1 A;  3VOE A;  4EJW A;  4G94 A;  2ZNY A;  2H6B A;  1JE8 A;  2XGX A;  1W5T A;  3D5L A;  2DPU A;  2XAH A;  4YG2 F;  1T39 A;  3DEU A;  2W84 A;  1JHF A;  1IRF A;  3D0S A;  5BOX A;  4P9F A;  2HTJ A;  1KU9 A;  1O7L A;  2XAG A;  1CF7 B;  5JI6 A;  2HKO A;  1DUX C;  3WTX C;  4MEY F;  1J5Y A;  3GO5 A;  1I5Z A;  4KA4 A;  4QWQ A;  1UST A;  3E6M A;  4LG0 B;  2Z9O A;  2YX7 A;  2KKO A;  2BGC A;  2JTV A;  4HQM A;  4EM1 A;  1DP7 P;  3ABT A;  2W25 A;  3IKT A;  4MEX F;  3F8F A;  3J7A O;  2HS5 A;  2MC3 A;  2XVC A;  2RQP A;  5LGT A;  4M74 A;  1OYY A;  2H6C A;  3K1M A;  2NNN A;  3EQL F;  1U78 A;  2L4A A;  3IWF A;  3V7R A;  2M8E A;  1K78 B;  1B6A A;  4JQF A;  5D8L B;  2EFQ A;  2F5E A;  2M1B A;  5ICF A;  5JHU A;  3LQR A;  1O3S A;  2P7C B;  5E1W A;  5JVT A;  4B09 A;  4WX9 A;  1ULY A;  4RB0 A;  1BI3 A;  5L3D A;  4YFN F;  4BQA A;  2DU9 A;  5FLX Z;  4UVB A;  1XGS A;  4G8X A;  4N9H A;  2AS5 F;  3M7G A;  3BDD A;  4ENJ A;  4EMS A;  4LB5 A;  1W7P D;  3SXY A;  3PFI A;  4CDG A;  4M9S A;  2D1V A;  3HSF A;  2HYG D;  1JHH A;  2R7F A;  1REP C;  2XRO A;  2JRT A;  3TDZ C;  3ZQ7 A;  4WXD A;  5E1X A;  4O5V A;  3RPQ A;  2TDX A;  4HLY A;  4I98 B;  2PEX A;  3M9A A;  3BJA A;  4ZYG A;  1Z6T A;  4ETS A;  2QBY A;  3F21 A;  2K4J A;  4RGR A;  5BS6 A;  4HV6 A;  1UCR A;  1Z9C A;  1XDU A;  5DD8 A;  2DK8 A;  3F22 A;  4ZZD A;  4HV5 A;  3V4G A;  5LBQ A;  2LDU A;  5K5O A;  2Z5U A;  3RDI A;  1EH6 A;  3V8L A;  5LGN A;  2DK5 A;  4L9T A;  3HOT A;  4FT8 A;  4YFK F;  5DCM A;  1KU3 A;  1T0F A;  3Q9V A;  5BQT A;  4GYG A;  1HSJ A;  1ZG5 A;  4UVA A;  3F8B A;  2OZU A;  1RUO A;  2UZK A;  4Y15 A;  1ZRD A;  3T8R A;  4BHP A;  3GFL A;  2IT0 A;  1P4A A;  1ON1 A;  3R0J A;  5FD6 A;  3EYI A;  2OZ6 A;  4I0B A;  2D2W A;  3GZ5 A;  2UWM A;  4LB6 B;  3I54 A;  5FD5 A;  1FYM A;  4Q4Z F;  1IN6 A;  5CJ9 A;  5DUK A;  3RKY A;  5LRS A;  4A2U A;  3SQN A;  4I7H A;  3DQV C;  2HGC A;  2QQA A;  2JZY A;  3MZY A;  1XSX A;  3IHU A;  4KN7 X;  4HF1 A;  1R1V A;  1J9I A;  4BNC A;  2MA3 A;  4L5I A;  5D5X B;  5D8K B;  2ETH A;  2M87 A;  3PQJ A;  4M6Y A;  2FBK A;  1FLI A;  3ZMT A;  3BPV A;  1QNT A;  4XBF A;  1F9N A;  2NYX A;  1IN8 A;  2VT3 A;  3P7N A;  4A0X A;  4A12 A;  5J8F A;  3MFK A;  3IL2 A;  3H3U A;  2QQ9 A;  2COM A;  3NRV A;  2L01 A;  1BBY A;  1ZRE A;  1ZAR A;  4G6Q A;  1ZYR F;  4HQE A;  1LNW A;  2Z99 A;  5IT9 Z;  3WGH A;  3HHG A;  3B73 A;  4EJT A;  3ZN1 A;  2QYO A;  3BOQ A;  1BIB A;  4CO8 A;  3C1D A;  1STZ A;  1WRJ A;  3N4M A;  3HOS A;  3WG9 A;  4LGW A;  2FA5 A;  4MGR A;  4AWX B;  2VOP A;  2MH9 A;  2H09 A;  2FNP A;  1LDD A;  2HOE A;  3QP6 A;  3KLN A;  3LQQ A;  4GYI A;  1TW3 A;  4LFU A;  5E20 A;  2DTR A;  2CQK A;  1XD7 A;  3R0A A;  4M72 A;  5ICE A;  2XHK A;  2ZME B;  2K7L A;  2VE9 A;  4U0Y A;  1ZRC A;  2D1H A;  1KGS A;  4RAY A;  3RIR A;  2HKX A;  1IW7 F;  2DLL A;  4M6X A;  2GIV A;  1FP1 D;  1U5T B;  4JBA A;  4B8X A;  2MBF A;  5HDN A;  3EYY A;  2VXZ A;  1HW5 A;  3RKX A;  4A6D A;  5IT3 A;  2UXX A;  2ELH A;  1BI2 A;  4EQQ A;  1AWC A;  2EV6 A;  5LEJ A;  3F8C A;  4ZZL A;  2A07 F;  4BAY A;  1B9M A;  3I59 A;  3ECH A;  2RV8 A;  3F6O A;  3FXU A;  2E7X A;  4P96 A;  1RNL A;  1ODD A;  3BRO A;  1S8N A;  3DPT A;  2V9V A;  4L5J A;  3E5U A;  2GAU A;  3IRQ A;  2A3S A;  1B4A A;  4FX0 A;  1YO5 C;  1KA8 A;  1RZ4 A;  3KLO A;  2IRF G;  4O3M A;  2EK5 A;  1D8K A;  1L3L A;  3I4P A;  2G9W A;  1MJ9 A;  3K9T A;  4P5O A;  1A04 A;  5LRR A;  2CG4 A;  5CVI A;  2LF8 A;  1MZB A;  3GW2 A;  4U0W A;  2QEN A;  3CUQ C;  3HHH A;  4WK8 F;  2CWE A;  1UFM A;  5K5R A;  1SD6 A;  5LLQ A;  4AIJ A;  5L3G A;  2Z3Y A;  2QQB A;  2CW0 F;  5JFR A;  3IWZ A;  3E6B A;  4RGU A;  1SD7 A;  2E7W A;  3TDU C;  2A61 A;  3V8K A;  1Z91 A;  2DQR A;  3JAM Z;  5A2Q K;  2V1X A;  2OQG A;  1FNN A;  2NS0 A;  1KQ9 A;  1MKM A;  1TQI A;  3ABU A;  3GZ6 A;  1P4W A;  2EFO A;  1J7K A;  1GXQ A;  1TLH B;  1K79 A;  2L54 A;  1MD0 A;  1O3T A;  2KJC A;  1R1T A;  2RGV A;  3NEU A;  1FY7 A;  1ONV A;  1RUN A;  3WOD F;  2HQN A;  1HKT A;  5E17 F;  1PUE E;  2X4H A;  3F23 A;  2WWY A;  1I27 A;  3V7C A;  3ECO A;  1LEB A;  1WI9 A;  2PLY A;  3JSO A;  1IRG A;  2KJB A;  2QM3 A;  2EA4 A;  1DPU A;  2P8T A;  3KZZ A;  5BPI A;  3FM3 A;  5CVJ A;  1I1S A;  2CFX A;  1YW7 A;  5L3E A;  1OMI A;  1LEA A;  3RKW A;  3B02 A;  1ZG1 A;  2BV6 A;  3CUQ B;  2C6Y A;  2K27 A;  4A0Y A;  2STT A;  1NHA A;  4EV0 A;  5LGU A;  1TBX A;  3FMS A;  3I59 B;  4LLN A;  1PP8 F;  4HDV A;  1ZGA A;  3BWG A;  2NNY A;  3N97 A;  4CHU A;  2HEO A;  3O6B B;  5K5Q A;  3I71 A;  1S3J A;  1XSV A;  3HTS B;  4L0Y B;  5D5U B;  1XMK A;  5DV5 A;  2ACJ A;  2DPD A;  2IPQ X;  2V1D A;  2FML A;  2BEO A;  1MDM B;  1U2W A;  3QOP A;  1CGP A;  5ED4 A;  1ON2 A;  2JT1 A;  4ASN A;  3LA2 A;  1OYI A;  5LEK A;  2YPR A;  2GZW A;  3G3Z A;  4L9V A;  3CO6 C;  1IN4 A;  1YQA A;  3SHF A;  3GFM A;  2E1C A;  1OKR A;  2WTE A;  3BP8 A;  4KMU X;  4GO1 A;  3FM5 A;  3CJN A;  3U2R A;  4L0Z B;  2LKP A;  1I1G A;  2ISY A;  4IRG A;  4U7D A;  3HRU A;  5F6F A;  3HUG A;  1KQ0 A;  3HRM A;  1G3S A;  3VOD A;  3TOA A;  1T98 A;  4ESB A;  3S2W A;  2F2E A;  3KFW X;  3BJ6 A;  1YW8 A;  2DO7 A;  4JK1 X;  1ZLK A;  1J75 A;  2CYY A;  1SD4 A;  1WSU A;  4XSX F;  1XGN A;  1W7P B;  4YIF A;  5DDG A;  3HTU A;  3W6K B;  3DF8 A;  3IC7 A;  4UV9 A;  2VOO A;  1IXR C;  1UB9 A;  3L09 A;  3MQ0 A;  4G9Y A;  2MLG A;  1G3Y A;  2FE3 A;  2KRF A;  1HQC A;  1QZY A;  3FXQ A;  1QZZ A;  1LDK B;  2FU4 A;  5H6R A;  1IN5 A;  4HAM A;  1FWZ A;  1IAW A;  4OMZ A;  3V7S A;  3IKV A;  3F6V A;  2XAQ A;  1OPC A;  1T2K A;  2EV0 A;  1YS7 A;  1TTY A;  2DI3 A;  2PQ8 A;  2DQL A;  3HSE A;  2M30 A;  3ZMS A;  4A0Z A;  5HS8 A;  3U9G A;  3CUO A;  1FBU A;  2F5F A;  3FMR A;  3QPT A;  4E70 A;  4UHT A;  2VN2 A;  4CXF A;  3GXO A;  3DPL C;  3J81 K;  4OOI A;  1LDJ A;  4PGH A;  2H27 A;  4XSZ F;  5KK1 A;  4CYD A;  2DT5 A;  2FNA A;  4KIC A;  2CGP A;  4S04 A;  3TGN A;  2FSW A;  5D5W B;  4O6J A;  1K6O A;  2OU2 A;  5ICG A;  1ZLJ A;  3FWE A;  2VBX A;  3KP5 A;  1BIA A;  1BOA A;  1V3F A;  4GXO A;  1E2X A;  3E5X A;  4I02 A;  2CO5 A;  4XLP F;  4FHT A;  5J8C A;  2PMH A;  1FYK A;  2STW A;  2VBW A;  3QP5 A;  2ADU A;  3FMQ A;  3KCC A;  1R36 A;  4TV7 A;  5AON A;  2HWV A;  3BZ6 A;  4ON0 A;  1R00 A;  3WU1 B;  5ILU A;  1XDS A;  2A6E F;  2PG4 A;  4KN4 X;  2EFP A;  2ZBK A;  2FF4 A;  4BHB A;  1YYV A;  4UUV A;  2KIU A;  2W57 A;  1S29 A;  2Y0M A;  3FF5 A;  1Z6R A;  2AXL A;  2R7D A;  3QU6 A;  4EJU A;  1YIO A;  2XKO A;  3KET A;  1FZP B;  4UXN A;  1U3E M;  2IA2 A;  3HIF A;  3J80 K;  4A5M A;  1YW9 A;  1HBX G;  4GCV A;  3RYR A;  1FYL A;  2QBY B;  3HSR A;  2VE8 A;  1SAX A;  4MTE A;  5D4R A;  4D0P A;  3LFK A;  1SFE A;  1G4D A;  3M8E A;  2L02 A;  2B0L A;  3P9K A;  3I58 A;  1BC8 C;  1HW1 A;  5E1Z B;  1IN7 A;  4BYY A;  3TKY A;  2A69 F;  3H92 A;  4NHJ A;  3I64 A;  3CLO A;  5DCM B;  1BJA A;  1WQ2 A;  1FSH A;  4IPA A;  1J59 A;  1XB4 A;  2VBY A;  5ERI A;  3K1N A;  1FP2 A;  5FGM A;  2IP2 A;  5HLH A;  3RYP A;  5E18 F;  1SFX A;  2NRA C;  4WXH A;  1CF7 A;  3HYI A;  4EJV A;  1R5G A;  4BXU A;  2BYV E;  1T6S A;  1BI1 A;  4LG0 A;  2HQR A;  2JSC A;  2IJL A;  3AAF A;  3NQO A;  1EV7 A;  2JPB A;  2G7H A;  3V8J A;  4KIF A;  2V6C A;  2FXA A;  1KYZ A;  2L3D A;  4A6E A;  4MHG A;  2A5Y B;  5BPD A;  2VC1 A;  3KP3 A;  1QO0 D;  1SMY F;  2A68 F;  3MEX A;  1B9N A;  4G6D A;  4ESF A;  1S7A A;  2WV0 A;  4LMY A;  3I53 A;  4HOB A;  1K78 A;  1MJA A;  3GFJ A;  1O7F A;  3DV8 A;  1L0O C;  4UVC A;  1ZG3 A;  2ZO4 A;  2O0Y A;  2W85 A;  4OIN F;  1DPR A;  2Y75 A;  4N9I A;  3T1B A;  1LB2 A;  3T8T A;  4ZH4 F;  5HVQ C;  5ICC A;  2BE5 F;  3H3Z A;  2GXB A;  2NAZ A;  3WTU C;  1P2F A;  3P9I A;  4OIQ F;  3OOP A;  2O3F A;  1QGP A;  3ZMZ A;  1F4K A;  4L9N A;  5L3B A;  3EUH A;  3G73 A;  2MD5 A;  3GX4 X;  4KNY A;  2O6G E;  2ESN A;  3K69 A;  1ZHF A;  2FOK A;  3LA3 A;  2RKH A;  3KEO A;  3K1P A;  3U1D A;  4G7O F;  4N0B A;  4AIH A;  4LK0 F;  1YFH A;  3C3W A;  4KDP A;  1R22 A;  2XUB A;  3F3X A;  4R8H A;  5D6E A;  4U88 A;  4EJO A;  2RN7 A;  2GQQ A;  2QVO A;  1FT9 A;  3WTS C;  5EEH A;  2VON A;  1QPM A;  1J0R A;  3WTV C;  2Q2E A;  4RGX A;  1EH7 A;  5DCF A;  3ZP5 A;  1TQP A;  2P6S A;  4LD5 A;  2V1U A;  3FXR A;  2RNJ A;  4Q48 A;  2P5L C;  3KP7 A;  1XSD A;  5FO5 A;  5LHH A;  4HX7 A;  2WC2 A;  1IUY A;  1RI7 A;  5FLX K;  1LVA A;  3MZH A;  3LA7 A;  3SZP A;  1R23 A;  4NB5 A;  1HKQ A;  2W24 A;  3CTA A;  3QRF F;  3QAH A;  4ESJ A;  1E17 A;  1SMT A;  4GGG A;  2FBI A;  3E5Q A;  1D5V A;  3W6J B;  3F8M A;  3F8N A;  1JXS A;  1OYW A;  2HR3 A;  3RJP A;  4HX4 A;  4CGZ A;  2O03 A;  4CIC A;  3K0L A;  2HDC A;  2VT2 A;  1MGT A;  3BPX A;  4IXA A;  3MCZ A;  1D3Y A;  3REO A;  3LAJ A;  1HKS A;  2EB7 A;  3L7W A;  2ESH A;  3O2P E;  3WTW C;  2V79 A;  4ZYH A;  5CVR A;  5L3C A;  2F5D A;  1OR7 A;  2ZCW A;  3E97 A;  4IJA A;  3MWM A;  1H9G A;  4KT5 C;  2K02 A;  4KYW A;  2Q0O A;  1KQ8 A;  3JW4 A;  3Q9S A;  3DKW A;  5FFZ A;  2PMU A;  4NQW A;  5FB2 A;  4IHT A;  4WF2 A;  5A2Q Z;  4Z2Y A;  1F5T A;  2Q8K A;  1R5H A;  5CLS A;  4HLX A;  4ZYE A;  4RB2 C;  3I0T A;  3M1E A;  2R3S A;  1TNT A;  1HW2 A;  2GWR A;  4L9J A;  1FOK A;  5LHG A;  1BC7 C;  2IVM A;  4MQV A;  2XKP A;  3KP4 A;  1YTY A;  5DEQ A;  1P92 A;  3EET A;  4ENK A;  1FPQ A;  5L3F A;  4RB3 C;  5FFX A;  1IXS B;  2K86 A;  2ZFW A;  4R1H A;  5CVV A;  4HZF A;  2VBZ A;  1PDN C;  2FRH A;  1WWX A;  3GF2 A;  2MH2 A;  2OA4 A;  2XAS A;  2RDP A;  5JR3 A;  4BHC A;  3JTG A;  1Z7U A;  2P5K A;  2YR2 A;  1V4R A;  4A5N A;  4HF2 A;  5H20 A;  3WU0 A;  3ZPL A;  5D6F A;  4M9Z A;  1R7J A;  4ENN A;  4PZJ A;  1W5S A;  2IA1 A;  1G3W A;  3DXJ F;  5HDG A;  2ZME A;  2IA0 A;  4KMF A;  1Z1D A;  2P7V B;  3ROU A;  1ZH5 A;  2G7U A;  2GA1 A;  1IZ1 A;  4HW0 A;  4IRH A;  3WGG A;  4G7Z F;  1QBJ A;  4L18 B;  1UHM A;  1U5T A;  3ISP A;  3ZMU A;  1DDN A;  1SFU A;  4AD9 A;  4I0A A;  3QU3 A;  2JPC A;  1WKM A;  1SD5 A;  5D4S A;  5IT9 K;  4U0V A;  5AIQ A;  2QUF A;  2FQ3 A;  1G3T A;  4M71 A;  4ZYD A;  3E6D A;  2E1N A;  4BH9 A;  2XRN A;  2Y48 A;  4MTD A;  4XLN F;  1J2X A;  3F72 A;  2OAZ A;  3WE2 A;  3L2C A;  3QPH A;  3KE2 A;  3VB2 A;  6PAX A;  4UNO A;  3P9C A;  3T5X A;  3WGI A;  2PJP A;  3KP2 A;  2EA2 A;  4WCG A;  2P6T A;  1YG2 A;  3R61 A;  2UXN A;  5TJJ A;  5D5V B;  1FBS A;  3GVA A;  5HS9 A;  3FX3 A;  2YX4 A;  2PFB A;  3CO7 C;  4XRF A;  3OV8 A;  4YII A;  1GVJ A;  1W4M A;  3I5U A;  4QLC U;  3RTR A;  1U5T C;  3E6C C;  1U8R A;  4OU0 A;  3TOB A;  3TQN A;  4I01 A;  4I09 A;  4Y13 A;  4ENM A;  1U6G A;  1ZGJ A;  1BI0 A;  4UV8 A;  2P4W A;  1H0M A;  2HFH A;  3GEZ A;  3LAP A;  4G7H F;  3GUD A;  1XCB A;  5EEG A;  2H94 A;  4IVN A;  4P55 A;  2ZNZ A;  4PGG A;  3VEP A;  1G6N A;  1JGS A;  4LLL A;  4MQ9 F;  3WTT C;  2HTS A;  3VFZ A;  4U7B A;  4PCQ A;  5E8G A;  5DYM A;  2IW5 A;  1FC3 A;  5TRD A;  3Q5F A;  4RAZ A;  3ZN0 A;  4LK1 F;  2VC0 A;  3CDH A;  1B59 A;  2PN6 A;  3SFZ A;  4EVI A;  5HDK A;  5HLG A;  1H9T A;  4OMY A;  3WE3 A;  1HST A;  1KU7 A;  5CVU A;  4EM2 A;  2P5V A;  4DNC A;  2LF7 A;  1ZN2 A;  4OIO F;  3SZT A;  4HA8 A;  4EGY A;  2A6H F;  1QQI A;  3JSP A;  4IF4 A;  5HLI A;  4HYE A;  4IHS A;  5DUI A;  3COA C;  1HXD A;  3EDP A;  1F1Z A;  2OBP A;  1S7O A;  5E8I A;  1XGM A;  5LHI A;  3E3V A;  1YS6 A;  3ZMD A;  1XMA A;  2ZKZ A;  1Q1H A;  1PP7 U;  1XCV A;  3LWF A;  2KIM A;  3R60 A;  1BM9 A;  2EJR A;  3FHZ A;  1O3R A;  1IXC A;  5AIP A;  2QLZ A;  1R58 A;  3DFG A;  3JAM K;  4FX4 A;  1ZAO A;  1Y0U A;  2YSR A;  2EFW A;  3C7J A;  1O3Q A;  3J81 Z;  2XV4 S;  1USS A;  1XN7 A;  4R79 A;  1R1U A;  5ILV A;  3RI4 A;  5DD4 A;  4WWC A;  4Y17 A;  1KYW A;  1XGO A;  4EM0 B;  5H6Q A;  2HYF A;  2PBI A;  4EGZ A;  5F1R A;  3GFI A;  4F7Z A;  1FX7 A;  2MLK A;  3PQK A;  2BBY A;  4M73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...