4HX7A

Structure of mntr e11k mutant complexed with cd2+
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
133
structure length
128
Chain Sequence
PSMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 53
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx7A02
2KJBA 4XSXF 1SD6A 1IN5A 1K78A 5CVRA 5D8KB 3I54A 1OR7A 3ECOA 2P8TA 5DV5A 4XBFA 2HTSA 1RNLA 1KQ0A 5LEKA 3PFIA 3P9CA 3WTWC 3FF5A 4RB1A 2IA1A 1XDSA 2F2EA 3FM3A 2ADUA 2K4JA 4M74A 1ZGJA 1IRGA 4CZZA 4KUMA 2QBYA 2OZUA 3W6JB 3WGGA 3FX3A 1ZRCA 5E8IA 1G4DA 5A2QK 2XROA 3ZMZA 1ZH5A 2QQBA 3Q5FA 4M9ZA 2JPCA 2MBFA 1LDKB 1LNWA 1MJAA 4CICA 3IC7A 4MNUA 4S05A 1MDMA 4GO1A 4XSZF 2GZWA 2RDPA 2L4AA 3K0LA 3MEXA 2VC0A 3E6MA 2ZNZA 2BV6A 5HDGA 1T38A 2IPQX 3QP6A 3FHZA 5JVTA 4R8HA 1IN8A 1YTYA 1WQ2A 4BXUA 5CVUA 2E7WA 3KP5A 5E8GA 4M9SA 4U88A 4Q47A 1O7FA 2QYOA 1ZLKA 1USTA 2W25A 5CJ9A 3U1DA 4EJVA 1GVJA 4U7DA 4U0YA 2M45A 2BEOA 2LF8A 3JAMK 3GFJA 2FQ3A 1W7PA 2PMHA 4HF2A 5H6QA 4A0XA 1WSUA 4EGYA 4Q48A 1USSA 1OYIA 3M1EA 1U8RA 3KCCA 1R1TA 3BJAA 2F5FA 5FO5A 2FF4A 4UVCA 1XB4A 1MD0A 4WWCA 2COMA 2O61A 4BQAA 4OIQF 1LJ9A 4Q5SF 1F1ZA 3K9TA 4RGUA 1UB9A 1STZA 3V8LA 5L3BA 3IHUA 2VE8A 4RGXA 5J8FA 2ZJ2A 3DPLC 2ISZA 3WTSC 3ZMVA 3B02A 2PQ8A 2CW0F 2WC2A 2ACJA 3WTUC 2MD5A 4RAYA 3L00A 3TQNA 5ICGA 4M9XA 3HRSA 2V1UA 3HUGA 5HLHA 2G7HA 4G9YA 2GIVA 3ROUA 5HS8A 1R5HA 4DQ2A 3BWGA 2HR3A 1ON1A 3F6VA 4HOBA 2EV5A 2OQRA 3C3WA 2DLLA 2Z5UA 3BY6A 3J81K 4KIGA 3BP8A 1SMYF 2XVCA 2XGXA 3EDPA 5LLQA 2F5CA 4I02A 1YW9A 3KP7A 3I53A 2CFXA 4BNCA 2BBYA 4N9IA 5BPIA 2VC1A 2P5LC 3VODA 1H9GA 1IZ1A 3WG9A 2VODA 3KLNA 5LEJA 2AS5F 3DEUA 4GYGA 4WXDA 1FWZA 3C7JA 1RI7A 4ENNA 5K5RA 1DUXC 2VT3A 5FFXA 3HOTA 5HDNA 1ODDA 3MFKA 1BJAA 3EETA 5KK1A 3HRUA 1XD7A 2LF7A 3MCZA 5LRRA 5JI6A 2UWMA 3BPXA 5FLXK 3HIFA 1T0FA 1B9NA 4KYWA 3WGIA 5IT3A 1PP7U 1LEAA 5LBQA 2EB7A 4F7ZA 2QQAA 3IRQA 5D4RA 1ZARA 2Q2EA 3DXJF 2R7FA 4HYEA 5LGNA 1IXSB 4HDUA 4IPAA 1I27A 4A6DA 4YFNF 4G6DA 1GXQA 4EM2A 2AXLA 2KIFA 2HYGD 1S7OA 1HSJA 3GFMA 4IVNA 4N9HA 5J8CA 3KFWX 3COAC 2P4WA 1YG2A 4EM1A 5H20A 3WTZA 4YG2F 3KEOA 2PBIA 4UV8A 2B0LA 5LGTA 1BM9A 4P9UA 2EA4A 3R0JA 2IRFG 1KU2A 4BHBA 5E1WA 2MLKA 1S7AA 3L09A 2A6EF 1XSDA 1IW7F 5CVVA 5A2QZ 4A0ZA 3E6CC 1UHWA 2YSRA 1O3RA 3VB2A 3KE2A 2KKOA 3LWFA 2RQPA 3F8MA 2H09A 3TOBA 1QPMA 4NB5A 1JHFA 1T39A 4MQ9F 2P5KA 3GFLA 1P92A 3DV8A 5K5QA 4L0YB 2A6HF 1G3YA 4OOIA 2HZTA 4OMYA 3GF2A 2V79A 4KA4A 2VBYA 3MZHA 2C6YA 2D45A 1PP8F 5DCMB 3VFZA 3F8BA 5K1YA 3RKXA 5AONA 2KRFA 1UFMA 4ZZDA 1U5TA 3I58A 4IRGA 3JAMZ 4EGZA 4WK8F 3GLXA 3S2WA 5HLGA 4B8XA 3BJOA 4HV6A 3CJNA 2IVMA 4JQFA 1R58A 2EFOA 4I0AA 1D3YA 2V1DA 3BPVA 5D4SA 3V7CA 2K7LA 3HTUA 4HLXA 2XRNA 2WV0A 2HFHA 4OINF 5LHIA 1YS6A 1J5YA 4A6EA 4UXNA 4A12A 1KYZA 1VTNC 4LG0B 3V4GA 1FSHA 1BIBA 3L7WA 3MAJA 4HDVA 1EV7A 2HOEA 2M1BA 1G3SA 1L3LA 2ZO4A 1WRJA 2XV4S 3EYIA 1ZGAA 3TO9A 5HS7A 3GO5A 3P7NA 1KYWA 4RGSA 3CLOA 4WXHA 4K2EA 4P5OA 4G6QA 1HW1A 4P9FA 1GHCA 2HQNA 5ED4A 4HZFA 1BBYA 2ZFWA 1K79A 1H9TA 2NNNA 2IT0A 3CUQA 2J5PA 1W5TA 5E1XA 2PMUA 2YPRA 2YR2A 3C18A 5D5UB 3PQJA 4ENMA 1TW2A 3HHGA 1C0WA 3E5QA 3GVAA 3D0SA 4M6XA 4DNCA 3RTRA 3RYRA 1EH6A 3HOSA 1P6RA 1IAWA 3QRFF 2P6SA 4U0WA 2DAOA 2DW4A 2XKPA 2NYXA 1Q1HA 4KT5C 4A0YA 4I2OA 6PAXA 4IJAA 3DF8A 2FA5A 2L3DA 4MQVA 4ZH4F 4LB5A 2RN7A 3OV8A 2BYVE 1G3WA 5ILVA 3ABUA 1DPUA 1SMTA 1R36A 1T6SA 2QM3A 1MZBA 1TW3A 1FBQA 4IXAA 3KLOA 4L18B 1XCVA 3EUHA 5FLXZ 2O03A 1LDJA 2ZMEB 4JK1X 2NRAC 3WGHA 1FBUA 2K02A 2FU4A 3KZYA 1SFEA 3KP2A 3I59A 5L3EA 4P96A 4M71A 4I0BA 1I1SA 2DPDA 3REOA 2VOOA 2JPBA 5BPDA 2CYYA 3V7SA 4S04A 2M5WA 3SQNA 1ZYRF 2V1XA 1P2FA 3NRVA 3E6DA 3R6SA 2FNPA 3JSOA 4M73A 4Y15A 5F64A 3EQLF 2MC3A 2D1VA 4EMSA 2QQ9A 1XMAA 3ISPA 3CDHA 4KICA 5LHGA 1FYLA 2VE9A 2HEOA 2F5DA 4HQMA 3B73A 2XKOA 2MA3A 2RVCA 3R4KA 4IHTA 3RYPA 1BIAA 4ETSA 1HXDA 1YLFA 1ZG1A 1IXRC 2FMYA 3O3KA 3QPTA 1QQIA 1ZRFA 3H92A 1FPQA 4PGGA 3F22A 2L02A 2Y0MA 3L9FA 2NS0A 2ELHA 2KIUA 4MHGA 4XLNF 2LNBA 3LSTA 5FB2A 2DK8A 5DCFA 4Q4ZF 2K27A 3LA3A 1K6OA 1ZN2A 4EVIA 1FYKA 1PUEE 1F4KA 5E20A 2QENA 4ON0A 4UV9A 2J5OA 5E17F 3GFIA 2CG4A 2M30A 1LQ1A 4LB6B 4IF4A 2VBWA 1P4AA 3RI4A 1G6NA 3HRTA 2XAFA 1U78A 2VN2A 1QO0D 2PJPA 1J75A 1FLIA 4HF0A 1KU9A 2XASA 3LQQA 5F6FA 3QAHA 3W6KB 4CGZA 3VOEA 2X4HA 1OMIA 3FXUA 4O5VA 3F72A 3WTTC 4YFXF 4HX4A 2OAZA 5FD6A 1B6AA 3LAJA 3QPHA 4KN7X 2GXGA 3HTSB 1S3JA 1K78B 2IW5A 1KQ9A 2CGPA 1FY7A 3F3XA 1Z05A 3BDDA 1BC8C 2H27A 4OU0A 4L9TA 3IL2A 2G9WA 1B1BA 3HRMA 2Z3YA 2HGCA 2EFNA 2K4BA 3PQKA 2FBHA 4OMZA 5E1ZB 4HW0A 4G7OF 1R5GA 2XAQA 4MEYF 1BOAA 1I5ZA 3M9AA 4HA8A 3ZQ7A 2QBYB 2PFBA 3TO7A 1E2XA 5CVJA 3E5XA 2GWRA 3TDUC 3KP4A 4KMUX 5D6FA 5HLIA 1RIOH 2ESHA 4RAZA 1J59A 4XLPF 5D5XB 1TTYA 1R7JA 3WTYC 2O3FA 5BQTA 4KN4X 3GWZA 4MTEA 3AAFA 5JR3A 1FSEA 4GXOA 1XMKA 1DDNA 3BROA 3N4MA 1YFHA 1CF7A 1MDMB 1BI2A 2EV6A 1Z6TA 3GZ6A 1JXSA 1DP7P 2Y75A 1MGTA 2EFQA 1LEBA 4KIFA 4R1HA 3F8CA 4I01A 2L4MA 4LD5A 2K86A 1HSTA 1XCBA 1ULYA 4RS8A 1UHMA 2LDUA 3TGNA 3CO7C 5D5VB 1JGSA 2HTJA 3U2RA 4I98B 4U0VA 2CSOA 2PN6A 3NQOA 4AVPA 2DBBA 5J6XA 1TLHB 4A2UA 2YU3A 4HV5A 1GXPA 4IRIA 2M87A 2A61A 4H0EA 2EV0A 1T98A 1KA8A 2VBZA 1EH8A 2D1HA 3J7AO 1OYWA 3SXYA 5K5OA 3I71A 5HS9A 1LVAA 3E97A 4HLYA 3RKWA 2XAJA 2MH2A 4N0BA 5HOOA 1L0OC 2FRHA 1O57A 2P7VB 4RB0A 1ON2A 3RDIA 2LKPA 3LFKA 4ZYEA 2E7XA 1OKRA 4UUVA 2FEZA 1SAXA 3JTGA 1XGOA 1Z9CA 2WWYA 3EYYA 2DQRA 4LLGF 3H3UA 3M7GA 1F9NA 2PLYA 2TDXA 4B09A 3RJPA 2L01A 3T8RA 4UHTA 1W7PD 4CO8A 4EQQA 3R0AA 2E1CA 4KMFA 2NNYA 3KZZA 4PGHA 2GAUA 2XAGA 2DFIA 2PEXA 1P4WA 1O3SA 2QUFA 4LFUA 4UNOA 3J80K 3FXRA 1YO5C 4G8XA 3HSEA 5ILUA 4HBLA 1QZZA 4QWQA 2A69F 3D5LA 1B9MA 3OOPA 5JHUA 2O6GE 3SZPA 4Y13A 2RKHA 3V8JA 1SFUA 1OPCA 5F1RA 1S29A 3HSRA 1FZPB 4EJOA 1FOKA 3R61A 3ZMTA 1KU3A 1O7LA 3TO6A 2HYFA 4UVBA 3IRRA 4LK1F 2L54A 1CGPA 1G3TA 2QZ8A 2Z99A 4WF2A 2FE3A 1UCRA 2ZXJA 1B59A 1R00A 3C1DA 2E1NA 3K69A 1P4XA 3CUOA 2W24A 3O2PE 4ENKA 3RIRA 1A04A 4O6JA 3K2ZA 2STTA 3O6BB 2UZKA 3V7RA 4MGRA 3P9IA 4LGWA 4IRHA 4ZYGA 1U6GA 2HQRA 4MEXF 2MLGA 3ZMSA 5DUIA 3F21A 1RUOA 3FWEA 5D8LB 4R79A 2D2WA 3BZ6A 1J2XA 1O3QA 1LB2A 4CXFA 2A68F 2PI0A 1ZLJA 1K7AA 4ESBA 1F5TA 5IT9K 1R1VA 2XAHA 1B4AA 3HSFA 2RGVA 4AD9A 3ERED 1IRFA 1S6LA 1TNTA 3ZMUA 2R3SA 3SHFA 1ZREA 4QLCU 2CWEA 2V6CA 4HQEA 4LK0F 4AWXB 5FGMA 4KDPA 1AOYA 3QU3A 3F8NA 2ETHA 3K1MA 2X0LA 1MKMA 4HF1A 5LGUA 2OD5A 4EM0B 2F5EA 3T1BA 2OZ6A 1IXCA 5DD4A 2CQKA 4LLNA 3DP7A 3G3ZA 2FBKA 1SD7A 3LA2A 3MZYA 5ILSA 5BOXA 2VOPA 4L9VA 4CYDA 3ELKA 1U5TB 3GX4X 1Z1DA 1NHAA 1J9IA 3DPTA 5D5WB 2OA4A 2YX4A 3DKWA 4KNYA 1WWXA 5EEGA 2O8XA 1Y0UA 3R60A 5DDGA 4G7HF 3CTAA 1W5SA 2W85A 5KVRA 4OIOF 1HW5A 5DD8A 3KP6A 3WTXC 4OIPF 2FSWA 5BMZA 1S8NA 1FYMA 3E3VA 3K1PA 1YW7A 2Y48A 4ENJA 5DYMA 3BOQA 3CO6C 3NEUA 3F6OA 4BAYA 5DUKA 4AIHA 3GXOA 2IP2A 1HKTA 2Q0OA 4Z2YA 4L5JA 5BS6A 3LA7A 3JSPA 2ZBKA 1D8KA 1JE8A 3JW4A 1IN7A 4M72A 4HX7A 4XRFA 4MTDA 2BE5F 2A07F 1ZG3A 1R1UA 4G94A 5DEQA 4OIRF 5HVQC 4L0ZB 2P6TA 3F8FA 1FBSA 4WCGA 1ZG5A 2NAZA 1XN7A 1XSVA 2KIMA 2EFPA 2XUBA 3K1NA 1PDNC 1TQPA 2OU2A 4ESFA 2LSOA 3CUQB 2UXNA 4GGGA 1D5VA 2ZNYA 1I6XA 1YIOA 4GCVA 1ZAOA 2PG4A 4E70A 1FX7A 3RPUA 1X3UA 3VEPA 2BGCA 3ZP5A 2A3SA 4BHCA 1RUNA 1BI3A 3J80Z 2DQLA 5E18F 4HX8A 3HHHA 3WU1B 1RZ4A 2ISYA 3IKVA 3ULQB 4Y17A 3DFGA 1R23A 1SD5A 1QZYA 2DTRA 1D8JA 5ERIA 3QU6A 5FFZA 1QGPA 1EH7A 3IWFA 1JHHA 1AWCA 2JTVA 4PDKA 5DCMA 4EJWA 2ZKZA 2O0YA 1V4RA 3TOAA 4CDGA 2FMLA 3L2CA 2KJCA 4WXCA 2OQGA 2P7CB 3BJ6A 3I59B 3FMSA 2Z33A 3G73A 2H6BA 1TNSA 1MJ9A 3KP3A 3M8FA 3Q9SA 1FP2A 1Z6RA 2XHKA 5EEHA 2QLZA 2HWVA 3ZN1A 2JT1A 4U7BA 2RNJA 4EJUA 2DT5A 4GYIA 5ICEA 1MJBA 4KFCA 3FMQA 4ZYHA 1IUYA 2VXZA 1HQCA 3IKTA 1IN4A 5FD5A 4A5NA 1E17A 4RB3C 1IF1A 5TJJA 5IT9Z 1T2KA 4WX9A 4LG0A 1TQMA 2RV8A 1ZRDA 1KQ8A 3GYHX 5CYVA 3FMRA 3TKYA 4L9NA 2GA2A 3I64A 4D0PA 1XGNA 1BN5A 4AIJA 3H3ZA 3IWZA 3FZVA 4EV0A 3FM5A 3WE2A 3T0YA 2QVOA 3DQVC 5LHHA 2P5VA 1REPC 2YX7A 4CHUA 1W7PB 1LDDA 4FHTA 2V9VA 1H0MA 3MWMA 2GA1A 2DI3A 1J0RA 1YQAA 3GUDA 5LRSA 1QNTA 3GEZA 2IJLA 3HYIA 1XGMA 5AIQA 4NQWA 1DPRA 5TRDA 2EA2A 3F23A 1Z91A 3QOPA 1WI9A 3I5UA 2W57A 1HKQA 2R7DA 2FXAA 3V8KA 3SFZA 2HDCA 2H94A 2FBIA 2H6CA 1U5TC 4RB2C 2Z9OA 5L3GA 5ICFA 2OBPA 3ZPLA 1XDUA 3ML6A 3WE3A 1FC3A 1U3EM 2W84A 1O3TA 4KIBA 2DK5A 4YIFA 3RPQA 2VT2A 3Q9VA 4TV7A 4FX4A 2ZMEA 4A5MA 1V3FA 2UXXA 1ZHFA 2VONA 1SFXA 1YYVA 4ESJA 1BI1A 2DPUA 1FNNA 2XIGA 4HAMA 2G7UA 2Q8KA 3I0TA 2FNAA 1HKSA 1R22A 3RKYA 3M8EA 1HW2A 3LAPA 4LMYA 4I09A 2GQQA 2HS5A 1TQIA 2ESNA 4YFKF 3KETA 2EFWA 3WODF 3E5UA 3ZN0A 4P55A 2ZCWA 2WTEA 4BH9A 4RGRA 2DO7A 4AIKA 4L9JA 2QWWA 3LQRA 3QP5A 1XGSA 1QBJA 3N97A 3MQ0A 4I7HA 3CUQC 4PCQA 4FX0A 1CF7B 1Z7UA 3JTHA 4JBAA 4ZZLA 2FOKA 4G7ZF 1YS7A 1TBXA 3KEQA 4NHJA 3WU0A 2EJRA 3SZTA 1WKMA 4IHSA 2JSCA 4PZJA 5D6EA 4ASNA 3GZ5A 4YIIA 2EK5A 2IA2A 4BHPA 3U9GA 1HBXG 1I1GA 4LLLA 3T5XA 2CO5A 1ONVA 5L3CA 5HDKA 3T8TA 1FT9A 2RC4A 3ZMDA 4LJZF 2VBXA 4O3MA 2EWNA 5AIPA 1OYYA 3ECHA 1BI0A 5L3DA 2HKXA 1YW8A 3GW2A 2MH9A 1KU7A 3TDZC 3P9KA 2M8EA 3J81Z 1U2WA 1SD4A 1BC7C 5CLSA 5H6RA 4ZYDA 1FP1D 1KGSA 4FT8A 3E6BA 4M6YA 2JRTA 2DU9A 3WTVC 3I4PA 2GXBA 5ICCA 5JFRA 1W4MA 1J7KA 3ABTA 4L5IA 1XSXA 1IN6A 3FXQA 4EJTA 2JZYA 4BYYA 2HKOA 4UVAA 2IA0A 2A5YB 5CVIA 5L3FA 2STWA
chains in the Genus database with same CATH superfamily
2IXSA 2KJBA 4XSXF 1SD6A 4C2MJ 1ETWA 4FQGA 1X4OA 1IN5A 2X6OA 3HC7A 1K78A 3H9GA 5CVRA 5D8KB 2NOGA 1UZCA 1AA7A 3IH3A 3I54A 1OR7A 1A6QA 1VNDA 4PJMA 3ZQGA 3ECOA 2P8TA 2IAIA 4M3GA 3FKIJ 5DV5A 4XBFA 2HTSA 1YJ9I 1RNLA 1KQ0A 2TRTA 5LEKA 3PFIA 1MMAA 3P9CA 5B3SH 4RBOA 2PJRB 4M6VA 3WTWC 3FF5A 4RB1A 2I10A 3ESWB 3OYCA 2FJ1A 2IA1A 3S15J 2XPVA 4BBRJ 4AU7A 2R7SA 3DU6A 4C30A 1XDSA 2F2EA 3FM3A 4XMYA 4J01A 2ADUA 2K4JA 1VQNI 4M74A 2MG4A 1ZGJA 1IRGA 1K61A 3J7YJ 4CZZA 4KUMA 2QBYA 3UR3C 2R7WA 4CYCA 2OZUA 2W48A 3W6JB 3LL7A 3WGGA 3FX3A 4EEFG 1ZRCA 5E8IA 3CDLA 4IKFA 3KYCB 3H5AA 1RPWA 1G4DA 5A2QK 2XROA 3G1MA 1YIJI 2NOJB 1JUSA 3ZMZA 3A01A 1ORKA 4F92B 1D1BA 1ZH5A 4Y7NJ 2QQBA 3Q5FA 3S1NJ 4M9ZA 4A93J 4DBRA 2JPCA 2MBFA 5B66C 1YI2I 3MZ8A 2LY9A 1IDZA 1LDKB 2LR8A 1LNWA 3CD6I 3ABMH 2ZJRF 5FLMJ 1MJAA 3BZCA 2DA5A 2F6CA 4CICA 4DGWB 3IC7A 4A3JJ 4KISA 1K4TA 4MNUA 3M3YJ 4S05A 2DMNA 2XF6A 1AHDP 2AHQA 1MDMA 4GO1A 4XSZF 3HGYA 2GZWA 2RDPA 2L4AA 4YELA 4PFPA 3PSIA 3K0LA 2XSDC 3S2HJ 3MEXA 2VC0A 1Y39A 3E6MA 2ZNZA 5CQEA 2BV6A 5HDGA 1T38A 4XRMA 2IPQX 4AC0A 3QP6A 3FHZA 1TWAJ 1YJWI 1BL0A 5JVTA 4R8HA 1IN8A 3BG6A 3G1OA 4H4KC 3S3OA 1WQ2A 1YTYA 4BXUA 1FOWA 1X1DA 2E7WA 2KRCA 3KP5A 5CVUA 5E8GA 1ZR4A 4M9SA 3MVPA 3OSFA 4U88A 2NS7A 4Q47A 1O7FA 2QYOA 1TT5B 2E60A 3WG7H 2CQQA 1ZLKA 2P81A 1USTA 4QPOA 2W25A 1V54H 3MKLA 3L2RA 4HSTA 5CJ9A 5B5EC 3U1DA 3P5JA 1XS9A 4EJVA 2E35A 1GVJA 4U7DA 4U0YA 2M45A 2BEOA 2LF8A 3JAMK 2H1LA 3GFJA 2ZSIB 4IX7A 3HBLA 2FQ3A 1W7PA 1I39A 2PMHA 2X98A 3RQIA 4HF2A 2IBDA 5H6QA 2O8KA 1MH4A 2QKLB 4A0XA 1W36C 1WSUA 4EGYA 4Q48A 1USSA 5B1AH 1MIJA 1OYIA 2CV1A 3M1EA 5K7FA 5C44J 1U8RA 2D5VA 3KCCA 1R1TA 2M3AA 3BJAA 1FOYA 2F5FA 5M5YJ 1MBGA 4LITA 1JT0A 2EPFA 5FO5A 2X1EA 2FF4A 3CCUI 4UVCA 3BLYA 2DT7B 1XB4A 5IP9J 1MD0A 4WWCA 2COMA 2O61A 5TGTA 2X1CA 1P7IA 4BQAA 4OIQF 1LJ9A 3RSNA 4Q5SF 1F1ZA 2IEKA 2V7FA 5H2FC 4JYKA 5HNHA 3K9TA 4RGUA 3I3LA 1UB9A 1STZA 3V8LA 5L3BA 3GTOJ 4XNFA 3IHUA 2VE8A 2IGKA 4RGXA 5J8FA 2ZJ2A 4XK4A 1GVDA 3DPLC 3SJMA 2ISZA 2LC2A 4UUSA 3PUBA 1MBFA 4BQOA 3E0JB 2GOXB 2VKVA 1Z0XA 3VSKA 2HVRA 3WTSC 3ZMVA 3B02A 2PQ8A 1O4XA 1JT6A 1B72B 2CW0F 3W6VA 3TW7A 4JOMA 2WC2A 2L9RA 5J1YA 5B1BH 2ACJA 3WTUC 2M7AA 2MD5A 4RAYA 3L00A 3TQNA 2F4IA 5ICGA 4M9XA 3HRSA 3OWTA 3KYLA 2LTPA 2V1UA 3CF2A 4IL6C 3HUGA 5HLHA 2G7HA 2F5VA 2VASA 4G9YA 2L9NA 2GIVA 3ROUA 5HS8A 1R5HA 4OAZA 4DQ2A 2LFBA 1FIAA 3BWGA 2HR3A 1GLNA 3OL3A 1ON1A 3F6VA 2LG4A 3K70C 3W3CA 4HOBA 2EV5A 2OQRA 2OCEA 2XSJC 2DLLA 3C3WA 2R7QA 2Z5UA 1POGA 2OF7A 2COBA 3DBHB 5GP9A 3BY6A 5EDNA 3G1LA 3J81K 4KIGA 1RQ6A 3BP8A 4RAGA 1SMYF 2HXOA 4B3XA 2YU9J 2WV1A 3LSIA 4GRIA 2E1MB 2XVCA 2XGXA 2FX0A 2W4SA 3EDPA 3BTCA 4CZCA 3BG7A 5LLQA 1X58A 2UV1A 2F5CA 1A36A 4I02A 5BNGA 4C3HJ 2XC7A 1YW9A 3H9QA 4AYBA 3KP7A 3CMAI 3IH4A 3I53A 2Y9YA 2CFXA 3CC4I 4BNCA 2FD5A 1WGXA 2BBYA 4N9IA 5BPIA 2VC1A 1Y0NA 1JUPA 3GTJJ 2P5LC 3VODA 2R93J 2VXDA 1H9GA 1LKXA 3PNYA 3IAM2 1IZ1A 3WG9A 4A3FJ 3KLNA 2VODA 5LEJA 1W1WE 2AS5F 3ABLH 3DEUA 4GYGA 4WXDA 1FWZA 3C7JA 1RI7A 5E3OA 1T95A 4ENNA 5K5RA 1DUXC 2VT3A 5FFXA 3S1QJ 3HOTA 1IV8A 5JHFA 2FUG2 3DBLB 5HDNA 1ODDA 4Z6YA 4BXXJ 3MFKA 2BY1A 2WAQN 2KRHA 1BJAA 2RNGA 3EETA 1W0TA 5KK1A 3HRUA 1XD7A 2LF7A 3MCZA 5LRRA 5JI6A 2R5ZA 2KIQA 1UG0A 1WJAA 3QQAA 3PL8A 2UWMA 3BPXA 2ME6A 5FKNA 1BW5A 5FLXK 3HIFA 2MVTA 1T0FA 1B9NA 3BR0A 4KYWA 3A2KA 3WGIA 4E7ZA 5IT3A 1PP7U 1LEAA 4NNJA 5LBQA 2EB7A 4F7ZA 2QQAA 1K6YA 4MFEA 1MBJA 2OC6A 3IRQA 5D4RA 1ZARA 2Q2EA 3DXJF 3KYDB 2OPTA 2R7FA 4HYEA 4E7HA 5IOYA 3WHBA 5LGNA 1IUFA 1IXSB 4HDUA 1R49A 4IPAA 4HSRA 1JUMA 1VQ5I 1I27A 2MC4A 4A6DA 4YFNF 4G6DA 3ZGKA 2LVSA 1GXQA 4EM2A 2AXLA 3SEQA 4XKCA 2KIFA 2HYGD 1S7OA 3CCEI 1HSJA 5EZGA 3J7AY 2EQRA 3LSPA 3GFMA 3A03A 4IVNA 1ETXA 4N9HA 5J8CA 3KFWX 3OL4A 3COAC 2P4WA 1WH7A 3VYRB 3OYDA 1YG2A 3JRFA 1ZTRA 1TWFJ 4EM1A 3QPSA 2KT0A 1WJFA 5H20A 3S17J 3WTZA 2DMQA 4YG2F 3KEOA 2PBIA 4C3JJ 1WFXA 4UV8A 2B0LA 5DTDA 2VJ5A 4BKXA 5LGTA 1BM9A 1ZR2A 4P9UA 2EA4A 2WAFA 3R0JA 2PMZA 2IRFG 3H5NA 4ITVA 1KU2A 2L7KA 4BHBA 5E1WA 4ZDLA 2MLKA 4Y52J 1S7AA 3BTIA 1TP4A 3VYUB 3CDIA 2HPMA 3L09A 2A6EF 3BZKA 1XSDA 1IW7F 5CVVA 5A2QZ 4A0ZA 3E6CC 2E5ZA 1UHWA 1M1EB 2EIMH 1S72I 3PSFA 2YSRA 3K10A 1O3RA 1V5FA 3VB2A 2HZDA 3KE2A 3HOZJ 2HOAA 3TL4X 4E7IA 2DMUA 2KKOA 2V6EA 3LWFA 2RQPA 3F8MA 2H09A 3TOBA 1QPMA 4NB5A 1JHFA 2MUNA 1T39A 1LPQA 4MQ9F 2CUEA 2P5KA 5FROA 3GFLA 1P92A 3DV8A 4PJLA 2L9SA 5K5QA 4L0YB 1V55H 2HXIA 2A6HF 4CCNA 1G3YA 3JRDA 4OOIA 2HZTA 4RLQA 4OMYA 3BTLA 4MO7A 3GF2A 2V79A 2Y30A 4KA4A 1V5GA 2VBYA 1XMXA 3MZHA 2LREA 2R7TA 1CQTA 3L2UA 4NC6A 9ANTA 2C6YA 2D45A 5HNFA 2L5QA 3DLAA 5FRMA 4Y3OA 1PP8F 5DCMB 3OOUA 3CZ6A 3VFZA 4B3AA 4NC8A 3F8BA 5K1YA 2K9QA 3VDXA 4CCLA 4PJNA 2HI3A 3RKXA 1YRNB 5AONA 2KRFA 3SFIA 1UFMA 2DFFA 1MSEC 5J47A 1ETVA 4BUPA 4ZZDA 3BG3A 1U5TA 4I99C 3OYLA 3RCOA 4N4OB 1N25A 4XR6A 2KHMA 3I58A 4IRGA 4XM3A 5F08A 3JAMZ 5M5XJ 4EGZA 3RPUD 2YUSA 4WK8F 3GLXA 1JKOC 3LSHA 4W97A 3S2WA 5F0HA 5HLGA 3HZJA 2ZJQF 2M0CA 4JX4A 2ZXHA 2AXTC 2H1KA 4B8XA 1NTCA 2DA7A 3BJOA 4HV6A 2DFEA 3CJNA 1X2MA 2IVMA 4JQFA 1R58A 1ITYA 3ZQCA 2EFOA 4A3IJ 2LLKA 3CJQB 4OWRB 4I0AA 1D3YA 2V1DA 2DN0A 3BPVA 5D4SA 3V7CA 1FOXA 2G0EA 2K7LA 3HTUA 4HLXA 2XRNA 2WV0A 2HFHA 4OINF 4F55A 4F93B 2HNHA 4LOCA 1W0UA 5LHIA 1YS6A 3B6CA 1J5YA 4A6EA 2L9VA 4UXNA 3L1PA 4A12A 2CH0A 4CH7A 1KYZA 1VTNC 3SYTA 4LG0B 3V4GA 1FSHA 1Y1WJ 2WA0A 1BIBA 3FBNB 2VJIA 4D7MA 1DGWY 2VQGA 1MNMC 5TISC 1WCMJ 3L7WA 3MAJA 4HDVA 1EV7A 2HOEA 2M1BA 1G3SA 3LSKA 1L3LA 1X1PA 2QKMB 2K5CA 4B4CA 2HOSA 2VUMJ 2ZO4A 1WRJA 3ZQFA 2XV4S 3G2BA 3C2BA 3EYIA 1ZGAA 2M2EA 3TO9A 5HS7A 3GO5A 3P7NA 1KYWA 1RR7A 2JUCA 3CLOA 4IEJA 4RGSA 4JX5A 4WXHA 4K2EA 4P5OA 4G6QA 1HW1A 4P9FA 4F91B 3GTLJ 1GHCA 1YE9A 2HQNA 5ED4A 4HZFA 1LFUP 4XLAA 5CPRB 3EUKL 3LFUA 1BBYA 2ZFWA 5M3MJ 1K79A 2WB1N 1H9TA 2QGUA 2NNNA 2IT0A 3CUQA 4B1RA 3TMOA 5M3FJ 1HCRA 4FCYA 2J5PA 1W5TA 5E1XA 3E1SA 2LBFA 2PMUA 3CCVI 4CUGA 2YPRA 2YR2A 3C18A 5D5UB 3PQJA 4ENMA 3PNTA 3G71I 1TW2A 4BJTA 3TW6A 2DTZA 3HHGA 5C4JJ 1AKHB 4U87A 1C0WA 3E5QA 2QEXI 3GVAA 2R5YA 3D0SA 3FIWA 1K83J 4M6XA 1UELB 4G6TB 3IV5A 1P9QC 1FTZA 4DNCA 3TP3A 2ZFUA 2X51A 3RTRA 3RYRA 3W2AA 1VZ0A 1EH6A 3HOSA 1P6RA 1IAWA 2QF7A 2I5UA 4FASD 3QRFF 2P6SA 2O5RA 5IYBJ 4RA2A 4U0WA 2XF7A 2DAOA 2DW4A 2MSYA 2X9DA 2NYXA 2XKPA 1Q1HA 4KT5C 4A0YA 4I2OA 3D1NI 4AUXA 2ZJPF 6PAXA 4BEHB 3Q3SA 4IJAA 3DF8A 4DZPA 2FA5A 2L3DA 1GV5A 4MQVA 4ZH4F 4LB5A 1QVUA 5CQGA 2RN7A 3CQZJ 3OV8A 3CCRI 2BYVE 1EF4A 1G3WA 5ILVA 2VQLA 3ABUA 1DPUA 1SMTA 5HLTA 1R36A 4XLFA 2UUZA 3MKYB 1T6SA 3BG5A 2QM3A 3E7LA 3IAS2 2OTLI 2W1OA 1MZBA 1TW3A 3DWLE 2WAEA 2V9PA 1FBQA 4D7NA 4IXAA 3ABKH 2JSPA 4M3FA 5FRNA 3KLOA 4L18B 1XCVA 3EUHA 5FLXZ 2O03A 1LDJA 1U9OA 2ZMEB 2BZTA 4JK1X 2NRAC 2CW7A 3QPLA 2JQ7A 2DA3A 2XGEA 3WGHA 1FBUA 2K02A 2FU4A 3KZYA 2VJ4A 3HPHA 1SFEA 1X1CA 3KP2A 4N4NB 1Y1VJ 2DFHA 3I59A 5L3EA 4P96A 2JUGA 4M71A 4ZDPA 1A6IA 4I0BA 1I1SA 3BCBA 2DPDA 2Y0SA 4A3DJ 3REOA 2VOOA 2JPBA 5BPDA 2CYYA 1MBKA 3V7SA 4E4HA 4S04A 3CCQI 3JRIA 3ZQLA 2M5WA 3SQNA 4BQNA 1EJ9A 1WH5A 3SZGA 3KEYA 2Y69H 1ZYRF 3HJEA 2V1XA 5GPCA 1RC9A 1P2FA 2BOLA 3NRVA 3FDYA 1NG7A 3E6DA 3R6SA 4GDFA 2X1DA 3J80R 2FNPA 1ZELA 2K3FA 2LKXA 3JSOA 4IOAF 4M73A 4Y15A 2RAEA 5F64A 1ZK8A 4HNUA 2E71A 2F48A 3EQLF 2MC3A 1R4MB 1YOVB 2D1VA 2KQRA 4EMSA 3OY9A 2QQ9A 1XX5A 1XMAA 3ISPA 3PO2J 3CDHA 1LE8B 1OLTA 1V5EA 4LIUA 1OCOH 4KICA 5LHGA 4E7KA 1S5LC 1FYLA 2VE9A 1BW6A 2HEOA 2F5DA 4HQMA 4B44A 5IOZA 3FXLA 4MLOA 3B73A 4FE4A 2XKOA 2O9LA 2MA3A 4XOPA 2RVCA 3R4KA 1FTTA 3HEFA 1MBHA 4IHTA 3RYPA 1BIAA 4ETSA 1HXDA 1YLFA 1ZG1A 2MGQA 1IXRC 4NBQA 1R9TJ 1VQ9I 2FMYA 3O3KA 3QYEA 2XB5A 3H35A 3QPTA 1QQIA 1ZRFA 1ZGWA 4A3BJ 2VQCA 3H92A 2IS4A 1FPQA 4PGGA 1BOBA 1BA5A 2XAUA 2VPRA 3F22A 3U1KA 2L02A 2Y0MA 3ZOBA 2VLAA 1T08B 1OCRH 3L9FA 2NS0A 2X6YA 2ZC2A 2ELHA 2LKSA 1X2NA 4PK4A 2KIUA 3OYAA 4MHGA 3BTJA 4XLNF 3Q0WA 2LNBA 2EZIA 4BY7J 2PX9A 3LSTA 5J1RA 5FB2A 2DK8A 2WY8Q 3BR6A 2P0WA 5DCFA 4Q4ZF 3M4OJ 4BBSJ 2K27A 3LA3A 3U21A 5CKTA 1K6OA 1PVEA 1X1BA 4BJ6C 1ZN2A 5E3LA 4EVIA 1IRZA 5DM6F 2IGOA 2B9SA 1FYKA 4KJZA 1PUEE 1F4KA 1R71A 5EJCA 1HDDC 4HG2A 4X0GA 2JA5J 5E20A 2QENA 2MYSA 4NC7A 4UV9A 4ON0A 1U8BA 2J5OA 1KZHA 5E17F 3M8JA 4B48A 3GFIA 1QRYA 2BW3B 5FKLA 1T8IA 2CG4A 4V2GA 2M30A 1LQ1A 4LB6B 3CCYA 2VBWA 4IF4A 4IQ4A 1P4AA 3RI4A 4F3QA 2DOEA 2KDZA 1G6NA 2K40A 3HRTA 2GLOA 1R5ID 1RKWA 5C4XJ 2XAFA 2B7EA 4HRIA 1U78A 2ME0A 2VN2A 2QSGX 1QO0D 2PJPA 4RAFA 1LFBA 1J75A 1FLIA 3WU2C 2W7NA 3OYFA 4HF0A 2WADA 1ETYA 1KU9A 3FHNA 2XASA 3OYKA 3LQQA 5IT9R 5F6FA 3QAHA 2DXIA 3W6KB 3A0HC 2Z2SB 4FTHA 4CGZA 1FMVA 3VSLA 3VOEA 2X4HA 1OMIA 4KITB 3W2WA 3FXUA 4O5VA 1VFCA 3F72A 3WTTC 4YFXF 5FKOA 1XC5A 1D0ZA 4HX4A 2OAZA 3DTKA 3H9JA 3GTMJ 4AVZA 5FD6A 3JRAA 1B6AA 3LAJA 3QPHA 4KN7X 2GXGA 3HTSB 1S3JA 1K78B 2IW5A 4E7JA 1KQ9A 2K85A 1N75A 2CGPA 2DDAA 1FY7A 2M7BA 3ZXSA 3F3XA 1Z05A 3BDDA 1BC8C 2H27A 4OU0A 2V4JC 2KISA 1IDYA 2NVYJ 4L9TA 3IL2A 2G9WA 1B1BA 3HRMA 2Z3YA 4G12A 2HGCA 1YX3A 2EFNA 1FMWA 2K4BA 1D0XA 3PQKA 1IG7A 1Z3YA 1ZKGA 2FBHA 4OMZA 5E1ZB 4HW0A 4G7OF 1R5GA 1ENHA 1NK3P 2XAQA 4XRSA 4MEYF 4A3EJ 1BOAA 1I5ZA 2EIJH 3M9AA 2L2OA 2M4GA 4QPQA 2NXNB 2HPIA 4HA8A 3ZQ7A 2QBYB 3N05A 2PFBA 2CV0A 3TO7A 4CYCB 3GTKJ 4L5EA 3K4NA 3K4LA 3X2QH 1IV6A 1E2XA 3B6AA 5CVJA 1EKEA 2NS8A 3CJTB 3A1YA 3E5XA 2GWRA 4XLCA 5EYRA 5GAHJ 2QSFX 3A01B 3TDUC 3HOUJ 3SEZA 3KP4A 4KMUX 1N78A 5D6FA 5HLIA 4HNVA 1RIOH 2ESHA 3CMYA 4RAZA 1J59A 4XLPF 5KAIC 5D5XB 1TTYA 1R7JA 2NVTJ 3WTYC 2O3FA 5BQTA 1Z3XA 4KN4X 3GWZA 4II3A 3ZCOA 4MTEA 3AAFA 5JR3A 2FQ4A 1FSEA 1B8IA 2BXYA 2EZHA 4GXOA 3RZDJ 2CV2A 3ZR8X 1XMKA 1DDNA 1MMDA 1DGRM 3BROA 3N4MA 1YFHA 1CF7A 3UNGC 1MDMB 1BI2A 3Q0VA 1XG1A 3G6EI 2NVQJ 2EV6A 5J1UA 1Z6TA 3GZ6A 2JJ7A 1JXSA 3BC8A 1JJ8C 3OS0A 1UJ8A 4UY8I 1DP7P 4XKBA 1OCCH 2Y75A 1MGTA 2TCTA 2EFQA 1LEBA 4KIFA 4R1HA 2DOAA 3F8CA 4I01A 1TT0A 2ECBA 1FJLA 2DA1A 2L4MA 5J4YA 1A35A 4LD5A 1WJEA 1ERDA 1HA8A 2VL8A 3AG4H 2K86A 3OYGA 4AYBN 1HSTA 3DTEA 1XCBA 1ULYA 1Y8RB 4RS8A 2IGMA 1MSFC 3K7AJ 1UHMA 2DJNA 2W82A 3GTPJ 2LDUA 1WJDA 3TGNA 3CO7C 2CUFA 5D5VB 4J00A 1YITI 1JGSA 2HTJA 3U2RA 3QWLA 4I98B 1QPIA 4U0VA 4UB6C 4RLFA 3HOWJ 2CSOA 2PN6A 3NQOA 2HU9A 5F04A 3DBRB 2VI6A 1ETOA 5J3LA 4AVPA 2LYCA 1HLVA 1D1CA 2DBBA 5J6XA 1TLHB 4A2UA 2YU3A 4XLEA 4HV5A 4QTRA 1GXPA 4IRIA 2M87A 2R7UA 3CJRB 1OJLA 2A61A 3BR1A 4H0EA 1VQMI 1JTXA 2M4KA 1D0YA 2EV0A 2F4MB 3OS2A 1T98A 1KA8A 2VBZA 1EH8A 2XRLA 3CMMA 1PYVA 3HG9A 2JRMA 2D1HA 2Q1ZB 3J7AO 1H89C 1OYWA 3SXYA 2ZMEC 5K5OA 3I71A 5HS9A 1LVAA 3OSGA 3E97A 3DKXA 4HLYA 3RKWA 3SDBA 2XAJA 2MH2A 4N0BA 5HOOA 3V42A 2CW8A 2JA7J 1L0OC 2FRHA 1O57A 1ETQA 2P7VB 4RB0A 3OYEA 1ON2A 3RDIA 1MNEA 2LKPA 1Z77A 3LFKA 4ZYEA 3RZOJ 1WI3A 2E7XA 3OR2C 4D1QA 1OKRA 4UUVA 4ANJA 1SVLA 2FEZA 3BR5A 1SAXA 3JTGA 3DEEA 3GMEA 1X1AA 1VQKI 5DM7F 1XGOA 4YRVA 1MH3A 3HKZA 1Z9CA 1HDPA 3QODA 1QA6A 1U9NA 3KZIC 2WWYA 1WZ2A 1Z67A 3LMMA 3HUGB 4XONA 1DU0A 3EYYA 2K9MA 4HEA2 2DQRA 4LLGF 2LD5A 3H3UA 2JVGA 2GIZA 2KL4A 3M7GA 1F9NA 2PLYA 2TDXA 4B09A 3RJPA 2PJRA 2PMZN 4BDYA 3FXMA 2CU7A 1JTYA 2L01A 4M3DA 3FISA 3T8RA 4UHTA 1W7PD 4CO8A 4FISA 3BT9A 4EQQA 3TEDA 1IJWC 1X19A 3R0AA 2E1CA 4KMFA 4RM3A 2CFOA 2MFZA 2LP0A 3K4KA 3H1CA 5FKKA 2NNYA 5FLVA 3KZZA 3ASNH 4PGHA 2KMUA 3ZQHA 3I4MJ 2GAUA 2XAGA 2DFIA 2PEXA 2K9SA 2HQAA 1P4WA 1O3SA 2QUFA 4LFUA 2QSHX 4UNOA 3J80K 3FXRA 1YO5C 2HDDA 2FOWA 2QCOA 4G8XA 3HSEA 3VWBA 1YX5A 4I6ZA 5ILUA 4HBLA 1QZZA 4BXFA 2KLOA 4QWQA 2A69F 4Y33A 1XPXA 3D5LA 1B9MA 4HPQA 3FK7A 3OOPA 5JHUA 2O6GE 3CLQA 3SZPA 4Y13A 2RKHA 3AG1H 3V8JA 2AQEA 2K9LA 1SFUA 1OPCA 3H5RA 5F1RA 2BXZA 3D5RC 1HC8A 1S29A 2XGDA 3OYIA 5KNLA 4IQJA 2XF5A 1ZQ3P 5JVGF 3I9V2 1TWCJ 3HSRA 3ASOH 1FZPB 4EJOA 1FOKA 3R61A 3ZMTA 1KU3A 1O7LA 3A4CA 3W2VA 4BE2A 1JKPC 3TO6A 1LE8A 2HYFA 2K9NA 4UVBA 3IRRA 3G4SI 4LK1F 3NAUA 1TC3C 4B43A 5KHDA 1VQ8I 2R5ZB 2L54A 4JP0A 2X48A 1CGPA 1G3TA 2QZ8A 2Z99A 3MD2A 5GAEJ 4WF2A 3PNVA 2FE3A 1UCRA 3ONQA 1DP3A 1ETKA 3ZQQA 2ZXJA 1B59A 4X6AJ 1R00A 1RESA 3C1DA 2DCEA 4PJ0C 2E1NA 3K69A 4A3MJ 1P4XA 3CUOA 2IS1A 4MFDA 2Q2EB 2W24A 2CUZA 3O2PE 3RIRA 4ENKA 2E34A 1A04A 4KT6A 4O6JA 2JA2A 3K2ZA 2BY3A 2F4OB 3PO3J 2BY2A 2STTA 4XOTA 2L7ZA 3O6BB 1J09A 2UZKA 3V7RA 1XTAA 2LOOA 3CCMI 4MGRA 3P9IA 4V19K 3HOXJ 4XRSG 4LGWA 3OYMA 4IRHA 2ELKA 4BL0B 2IS6A 3F9KA 2GBYA 4ZYGA 1U6GA 4BDZA 1PUFB 1RR8C 5F0CA 2HQRA 4E7SA 4CCMA 3K6GA 2M34A 1IO2A 1UG2A 2MLGA 3HPGA 3ZMSA 3CF5F 4MEXF 5DUIA 2ZXIA 1X3ZB 2EZKA 3F21A 1QU3A 1NK2P 1RUOA 3FWEA 3S8PA 5D8LB 4R79A 2D2WA 2JK3A 3BZ6A 3FXKA 4NQWB 5M5WJ 4PJJA 1J2XA 1O3QA 1N77A 1OR7C 1LB2A 2JN6A 4F52A 2VPLA 3QYBA 4CXFA 4BE1A 1GUUA 1LVKA 2A68F 1S9HA 2PI0A 2VIXA 1ZLJA 1K7AA 4ESBA 3JRHA 3ZQIA 2DMPA 1R6RA 3EUHC 4C9YA 1F5TA 2A05A 1VQLI 5IT9K 3OYJA 3D5SC 3F0CA 3JREA 1VQ6I 2P0TA 4XORA 1R1VA 2XAHA 1B4AA 3HSFA 2Z16A 1OCPA 2BVMA 4M3BA 2RGVA 3EUAA 4PSXA 4IHXA 4AD9A 3ERED 1IRFA 1S6LA 1TNTA 2OJED 3ZMUA 2R3SA 3SHFA 1ZREA 4QLCU 2CWEA 1B72A 3HL2A 2V6CA 1JKQC 4HQEA 4LK0F 4YEJA 4AWXB 1MMGA 4BGDA 2JMWA 5FGMA 2E2HJ 4KDPA 1AOYA 3QU3A 3F8NA 3CP2A 2Y31A 2DA4A 2ETHA 1RKTA 2B63J 3HXLA 2BHYA 3K1MA 2ID3A 1F36A 3LSJA 4BY1J 2X0LA 2KPMA 5KAFC 3GCMA 3BQZA 1MKMA 4HF1A 5LGUA 1E3HA 2OD5A 4EM0B 2F5EA 3T1BA 3IUOA 5EF6A 1VQOI 2JA6J 2OZ6A 2BVLA 3OS1A 1IXCA 5IP7J 3PIOF 3O8HA 5DD4A 2CQKA 4LLNA 1WJCA 3DP7A 3TBIA 2E5NA 5IY5H 5F27A 3IP4B 2DMTA 2X85A 3G3ZA 2FBKA 1SD7A 3MKWB 5LFAA 3ZRGA 2HOTA 3LA2A 3MZYA 5GTIC 2R0QC 5ILSA 5BOXA 2VOPA 3CC2I 4L9VA 1MBEA 4CYDA 3OIOA 4MIMA 3ELKA 1U5TB 2QQ8A 3GX4X 1Z1DA 3NWTA 3L2WA 1NHAA 1J9IA 3DPTA 3PUFA 5D5WB 3BCAA 1Z7LA 2V9KA 3MKZA 2OA4A 4IHYA 4ZTFA 3L2VA 3GLLA 3NARA 3S1RJ 4QSHA 3UKGA 2HDWA 2YX4A 3S1MJ 2OCCH 3A52A 3DKWA 4KNYA 1WWXA 1VF9A 5EEGA 2O8XA 1Y0UA 3R60A 5DDGA 1SVOA 4DYCA 1IRXA 3DU5A 4G7HF 1T56A 3C2HA 3CTAA 1RRJA 1W5SA 2W85A 5KVRA 4OIOF 4Y4RA 1HW5A 5DD8A 4IZZA 4XL9A 2LMDA 3KP6A 3WTXC 4OIPF 2FSWA 5BMZA 2GOMA 5GADJ 1S8NA 1FYMA 2R7VA 3E3VA 3K1PA 2DDBA 3AG3H 1SFKA 1YW7A 4C2TA 2Y48A 4IHVA 4ENJA 5DYMA 3BOQA 1I3AA 3CO6C 1LFPA 3NEUA 5EEAA 2R92J 3SDGA 3F6OA 4BAYA 4PFOA 5DUKA 3AG2H 2ICWG 3AL0C 3K4MA 2CUJA 4AIHA 2Y0SN 3GXOA 1P7JA 2IP2A 4FETA 1HKTA 1ACIA 2Q0OA 4Z2YA 1I6HJ 2X6XA 4L5JA 5BS6A 3LA7A 3JSPA 2ZBKA 1D8KA 1JE8A 3JW4A 1IN7A 4M72A 2JWTA 4HX7A 4XRFA 5E79C 2IS2A 4MTDA 1G8XA 2BE5F 2E1OA 1NH3A 5HODA 2A07F 3FKJA 2DODA 1OFCX 2Y2ZA 4DYQA 2CRGA 1ZG3A 1R1UA 4G94A 5DEQA 4OIRF 4YIRX 5HVQC 4L0ZB 1IC8A 1APLC 1IGNA 2DA2A 2P6TA 5DS9A 3F8FA 1FBSA 4WCGA 1ZG5A 1MW7A 2NAZA 1XN7A 2RQQA 4ZC3A 1XSVA 2KIMA 2EFPA 2XUBA 3K1NA 1PDNC 1TQPA 3K4CA 2EBIA 2OU2A 4ESFA 1WPKA 2LSOA 2UXNA 3CUQB 4GGGA 2ZNYA 1D5VA 1I6XA 3KIOA 1YIOA 5EZHA 3H36A 4DW6A 1ZAOA 4GCVA 2PG4A 2JA8J 2JVHA 3OYHA 2LBFB 4E70A 1G2HA 1FX7A 3RPUA 3S16J 3C2GA 3QYFA 1X3UA 3VEPA 1YJNI 2BGCA 2N8GA 1PJRA 2A3SA 3ZP5A 4RM2A 4BHCA 1RUNA 4NUBA 1BI3A 3J80Z 1TL8A 2DQLA 5EGOB 2R5YB 3NWSA 5E18F 1TWHJ 1VQ4I 4HX8A 3JR9A 5KCMA 3HHHA 3WU1B 2M35A 1RZ4A 1WVRA 3I55I 2ISYA 2LY2A 3IKVA 3LSRA 1A31A 3S2DJ 3K4JA 3ULQB 4Y17A 2KZGA 3DFGA 4XKWA 3PJRA 5EG0B 1R23A 2AO9A 1SD5A 2EZLA 1QZYA 1E3OC 4NDLA 4W1UA 2DTRA 2L7MP 1D8JA 5ERIA 5K7HA 3QU6A 5FFZA 1QGPA 1EH7A 3IWFA 1JHHA 3HM5A 3OYBA 3AKZA 1AWCA 2JTVA 3VYTB 3S93A 1OQYA 2OTJI 3PFYA 3GZNB 4A3LJ 4PDKA 2DA6A 2KFDA 5DCMA 4EJWA 3HOVJ 2ZKZA 1GT0C 4FE7A 2O0YA 2Y9ZA 2WAQA 3A0BC 4GFBA 4EATA 1V4RA 3TOAA 4CDGA 2E19A 3L2QA 3KX2A 2FMLA 1YRNA 2MW8A 3L2CA 1W5CC 2KJCA 4WXCA 2OQGA 2P7CB 3BJ6A 4E6KG 3CP8A 3I59B 1G59A 1MMNA 3FMSA 5IYDJ 2Z33A 1U0JA 3G73A 4II2A 4V2FA 3H0GJ 2H6BA 1T0FC 1TNSA 1MJ9A 3KP3A 3M8FA 3Q9SA 2XPWA 1FP2A 1Z6RA 2EINH 2XHKA 5EEHA 4XLHA 1JI8A 2E36A 4CA0A 2QLZA 2XGCA 3OYNA 2HWVA 5J40A 1E0EA 3LSGA 3DPUA 3ZN1A 3PIPF 2JT1A 4U7BA 3FK6A 2R7RA 2RNJA 4EJUA 1SAUA 2DT5A 4GYIA 2KDOA 2VKDA 2NVUB 5ICEA 1MJBA 5A2QR 2ZB9A 4KFCA 3AFHA 4BACA 4LIVA 3FMQA 3O8GA 4ZYHA 3VYSB 1A5JA 1JKRC 4XQFA 2MD0A 3K2AA 5JLWA 1IUYA 2VXZA 3OIQA 1HQCA 2M9HA 1AU7A 3IKTA 1IN4A 3CESA 3BQYA 2QA4I 5FD5A 4A5NA 1E17A 2GM4A 3S32A 4DZJA 3K4BA 4RB3C 3S3MA 1IF1A 5TJJA 4IO9F 1SVMA 5IT9Z 1T2KA 4WX9A 2HVSA 4LG0A 2O7OA 1TQMA 2RV8A 1D5YA 1ZRDA 4IOCF 1BR2A 4M3EA 1KQ8A 3J7ZI 3GYHX 2BY0A 5CYVA 3FMRA 3TKYA 4CCKA 2AQFA 4L9NA 4BS9A 2GA2A 3I64A 4D0PA 4ZTJA 1VQ7I 1XGNA 1BN5A 4AIJA 3HOYJ 3H3ZA 3IWZA 3FZVA 3HB9A 4EV0A 3FM5A 2CJJA 2H8WA 3WE2A 1VQPI 4LG3A 2E2JJ 3QOEA 1WJBA 1QZEA 3T0YA 2QVOA 1DU6A 4CCOA 1Y6IA 4RMNA 3DQVC 5LHHA 2P5VA 5IPAA 1REPC 2YX7A 1I3QJ 2CMPA 2VB6A 4CHUA 1W7PB 1LDDA 2LRDA 4FHTA 4UUTA 3EPZA 3M07A 5GAGJ 1T33A 2L0KA 1GV2A 2M8GX 2V9VA 1H8AC 4BU2A 1H0MA 1HOMA 3RKQA 3MWMA 2GA1A 1X3WB 3JAMR 2DI3A 1J0RA 5C3EJ 3CCJI 1PUFA 1YQAA 1SFOJ 1S7EA 3GUDA 5E3NA 5LRSA 3AL0B 4PSWA 1QNTA 3M1CA 1DQUA 3H3VK 2XDVA 3GEZA 4CSWA 2HQ5A 4E7LA 1F43A 2IJLA 1OCZH 3ERMA 4XKVA 3HYIA 1XGMA 4BE0A 5GPAA 5AIQA 4XN0A 1BR1A 4NQWA 1AKHA 2EIKH 3FXJA 5IYCJ 1DPRA 5TRDA 2EA2A 2XB0X 3F23A 1Z91A 3QOPA 1WI9A 4HNTA 3JRBA 2STWA 1QHHD 1QHGA 3I5UA 2OV7A 2W57A 2EILH 2V1NA 4DIQA 1HKQA 2R7DA 2FXAA 3V8KA 3SFZA 2ID6A 4A69C 2HDCA 2WY7Q 1MNDA 2H94A 2K3PA 1SANA 4UUSB 2IGNA 2FBIA 3DEWA 4D5FA 4XN3A 2H6CA 4DYRA 1U5TC 4BEHA 3S3NA 1OISA 4RB2C 2Z9OA 5L3GA 1Q1VA 4ZDOA 4B47A 5ICFA 4C2UA 2OBPA 4XIDA 3ZPLA 1XDUA 3BG9A 2KP6A 3FXOA 3ML6A 3WE3A 1FC3A 1U3EM 2W84A 4DJAA 1O3TA 1JJ6C 4P1WA 3CC7I 3I56I 2A6TA 4KIBA 2DK5A 4CCJA 4YIFA 3RPQA 2EH3A 2VT2A 3Q9VA 1SEUA 1NG6A 3JRGA 4TV7A 2L7FP 4FX4A 2ZMEA 4A5MA 1V3FA 2VKHA 2UXXA 3GBGA 1ZHFA 3LSMA 3CMEI 2CQXA 1D1AA 1OCTC 4AM3A 2VONA 1EA3A 4QIWN 1SFXA 1YYVA 1SC7A 4ESJA 1BI1A 2LK2A 2DPUA 5F0FA 3J81R 1VI0A 3BR3A 4DBQA 1FNNA 2ECCA 2XIGA 3HGGA 4HAMA 2G7UA 2Q8KA 3I0TA 5GTHC 2FNAA 3CCLI 3S14J 1X4PA 1HKSA 5J4VA 1R22A 3RKYA 3HKZN 2ZSHB 3M8EA 3KPHA 1HW2A 3CCSI 3LAPA 4LMYA 4I09A 1YHQI 1Y8QB 2VJJA 3FBIB 2GQQA 2HS5A 3OR1C 1TQIA 2ESNA 4I76A 4YFKF 3KETA 2EFWA 3WODF 2DYRH 4C3IJ 3IH2A 3E5UA 1K4SA 2CS3A 2RREA 2I8DA 3A02A 3OIPA 3ZN0A 4P55A 2ZCWA 2WTEA 1WJ5A 4BH9A 2HYJA 4RGRA 2DO7A 4S0HB 4AIKA 4L9JA 2LH9A 2QWWA 1BJZA 3LQRA 3QP5A 1RETA 2WB1A 1XGSA 1QBJA 3N97A 2KZVA 3MQ0A 1LUJB 4I7HA 1HF0A 1B8IB 1UHSA 3WHCA 3LOCA 1Y56A 2NVXJ 2BHZA 1WHUA 3CUQC 4PCQA 1W36D 4FX0A 2DJIA 1CF7B 5FJ8J 2DT6A 1Z21A 3JCUC 1JGGA 2H8RA 1Z7UA 2XPUA 3JTHA 4AIDA 2M0MA 4JBAA 4ZZLA 2GXAA 1KONA 2FOKA 2MABA 2R7ZJ 2WBMA 2R4GA 3DKYA 4RDUA 2VQHA 3PM1A 4G7ZF 1YS7A 1H88C 1MMSA 5FLXR 1TBXA 3KEQA 5K7ZA 2EJRA 3WU0A 3SZTA 1WKMA 4IHSA 4NHJA 2JSCA 2YS9A 4PZJA 4PUSA 5D6EA 5JLXA 4ASNA 3GZ5A 4YIIA 3DLLF 2EK5A 2IA2A 4BHPA 4BJ5C 5LD2C 4D9JA 4J19A 3U9GA 4ZYAA 1HBXG 1I1GA 4OAYA 3VPRA 4LLLA 3T5XA 2OUMA 2CO5A 2W00A 1ONVA 2DOFA 4A3CJ 5L3CA 1FEXA 2A5WA 5HDKA 3TP0A 2V26A 2DYSH 5FKMA 3T8TA 1FT9A 2VKEA 3LNQA 3GTQJ 2CQNA 2RC4A 3ZMDA 4LJZF 2VBXA 2ELJA 1BR4A 1TZLA 3HDDA 3MN2A 3OMYA 4O3MA 2EWNA 5AIPA 1OYYA 3RQ4A 3ECHA 1BI0A 1FIPA 2BW3A 5L3DA 2HKXA 3Q0UA 2E2IJ 3J7AW 1YW8A 3DCFA 3JRCA 3GW2A 2MH9A 2MZ4A 2CQ7A 1KU7A 1QVTA 3P9KA 3TDZC 2M8EA 4X1EA 3J81Z 2R7OA 4D5CA 1U2WA 2X6WA 1SD4A 1BC7C 5CLSA 5H6RA 4ZYDA 5E3MA 5F1JA 2HVQA 3K70D 1FP1D 4ZJZA 1KGSA 4FT8A 3GTGJ 1UMQA 3E6BA 4A3GJ 4M6YA 4JX6A 3BR2A 5EGOA 2JRTA 2ZXWH 2DU9A 4IHWA 2Z1DA 3H0DA 3MMYB 3WTVC 3I4PA 2GXBA 1I50J 2LY1A 5ICCA 5JFRA 1W4MA 1UAAA 4UB8C 1J7KA 3ABTA 4L5IA 1XSXA 4ABZA 2E1MC 1IN6A 1GDTA 3FXQA 1R4NB 3DTIA 4XICA 3I4NJ 4BQQA 4EJTA 1TWGJ 1E3PA 4DOZA 5IP6A 2JZYA 4BYYA 2HKOA 5EG0A 4UVAA 2IA0A 2A5YB 2R7XA 5CVIA 5L3FA 4A3KJ
chains in the Genus database with same CATH topology
2KJBA 4XSXF 1SD6A 1IN5A 1K78A 5CVRA 5D8KB 3I54A 1OR7A 3ECOA 2P8TA 5DV5A 4XBFA 2HTSA 1RNLA 1KQ0A 5LEKA 3PFIA 3P9CA 3WTWC 3FF5A 4RB1A 2IA1A 1XDSA 2F2EA 3FM3A 2ADUA 2K4JA 4M74A 1ZGJA 1IRGA 4CZZA 4KUMA 2QBYA 2OZUA 3W6JB 3WGGA 3FX3A 1ZRCA 5E8IA 1G4DA 5A2QK 2XROA 3ZMZA 1ZH5A 2QQBA 3Q5FA 4M9ZA 2JPCA 2MBFA 1LDKB 1LNWA 1MJAA 4CICA 3IC7A 4MNUA 4S05A 1MDMA 4GO1A 4XSZF 2GZWA 2RDPA 2L4AA 3K0LA 3MEXA 2VC0A 3E6MA 2ZNZA 2BV6A 5HDGA 1T38A 2IPQX 3QP6A 3FHZA 5JVTA 4R8HA 1IN8A 1YTYA 1WQ2A 4BXUA 5CVUA 2E7WA 3KP5A 5E8GA 4M9SA 4U88A 4Q47A 1O7FA 2QYOA 1ZLKA 1USTA 2W25A 5CJ9A 3U1DA 4EJVA 1GVJA 4U7DA 4U0YA 2M45A 2BEOA 2LF8A 3JAMK 3GFJA 2FQ3A 1W7PA 2PMHA 4HF2A 5H6QA 4A0XA 1WSUA 4EGYA 4Q48A 1USSA 1OYIA 3M1EA 1U8RA 3KCCA 1R1TA 3BJAA 2F5FA 5FO5A 2FF4A 4UVCA 1XB4A 1MD0A 4WWCA 2COMA 2O61A 4BQAA 4OIQF 1LJ9A 4Q5SF 1F1ZA 3K9TA 4RGUA 1UB9A 1STZA 3V8LA 5L3BA 3IHUA 2VE8A 4RGXA 5J8FA 2ZJ2A 3DPLC 2ISZA 3WTSC 3ZMVA 3B02A 2PQ8A 2CW0F 2WC2A 2ACJA 3WTUC 2MD5A 4RAYA 3L00A 3TQNA 5ICGA 4M9XA 3HRSA 2V1UA 3HUGA 5HLHA 2G7HA 4G9YA 2GIVA 3ROUA 5HS8A 1R5HA 4DQ2A 3BWGA 2HR3A 1ON1A 3F6VA 4HOBA 2EV5A 2OQRA 3C3WA 2DLLA 2Z5UA 3BY6A 3J81K 4KIGA 3BP8A 1SMYF 2XVCA 2XGXA 3EDPA 5LLQA 2F5CA 4I02A 1YW9A 3KP7A 3I53A 2CFXA 4BNCA 2BBYA 4N9IA 5BPIA 2VC1A 2P5LC 3VODA 1H9GA 1IZ1A 3WG9A 2VODA 3KLNA 5LEJA 2AS5F 3DEUA 4GYGA 4WXDA 1FWZA 3C7JA 1RI7A 4ENNA 5K5RA 1DUXC 2VT3A 5FFXA 3HOTA 5HDNA 1ODDA 3MFKA 1BJAA 3EETA 5KK1A 3HRUA 1XD7A 2LF7A 3MCZA 5LRRA 5JI6A 2UWMA 3BPXA 5FLXK 3HIFA 1T0FA 1B9NA 4KYWA 3WGIA 5IT3A 1PP7U 1LEAA 5LBQA 2EB7A 4F7ZA 2QQAA 3IRQA 5D4RA 1ZARA 2Q2EA 3DXJF 2R7FA 4HYEA 5LGNA 1IXSB 4HDUA 4IPAA 1I27A 4A6DA 4YFNF 4G6DA 1GXQA 4EM2A 2AXLA 2KIFA 2HYGD 1S7OA 1HSJA 3GFMA 4IVNA 4N9HA 5J8CA 3KFWX 3COAC 2P4WA 1YG2A 4EM1A 5H20A 3WTZA 4YG2F 3KEOA 2PBIA 4UV8A 2B0LA 5LGTA 1BM9A 4P9UA 2EA4A 3R0JA 2IRFG 1KU2A 4BHBA 5E1WA 2MLKA 1S7AA 3L09A 2A6EF 1XSDA 1IW7F 5CVVA 5A2QZ 4A0ZA 3E6CC 1UHWA 2YSRA 1O3RA 3VB2A 3KE2A 2KKOA 3LWFA 2RQPA 3F8MA 2H09A 3TOBA 1QPMA 4NB5A 1JHFA 1T39A 4MQ9F 2P5KA 3GFLA 1P92A 3DV8A 5K5QA 4L0YB 2A6HF 1G3YA 4OOIA 2HZTA 4OMYA 3GF2A 2V79A 4KA4A 2VBYA 3MZHA 2C6YA 2D45A 1PP8F 5DCMB 3VFZA 3F8BA 5K1YA 3RKXA 5AONA 2KRFA 1UFMA 4ZZDA 1U5TA 3I58A 4IRGA 3JAMZ 4EGZA 4WK8F 3GLXA 3S2WA 5HLGA 4B8XA 3BJOA 4HV6A 3CJNA 2IVMA 4JQFA 1R58A 2EFOA 4I0AA 1D3YA 2V1DA 3BPVA 5D4SA 3V7CA 2K7LA 3HTUA 4HLXA 2XRNA 2WV0A 2HFHA 4OINF 5LHIA 1YS6A 1J5YA 4A6EA 4UXNA 4A12A 1KYZA 1VTNC 4LG0B 3V4GA 1FSHA 1BIBA 3L7WA 3MAJA 4HDVA 1EV7A 2HOEA 2M1BA 1G3SA 1L3LA 2ZO4A 1WRJA 2XV4S 3EYIA 1ZGAA 3TO9A 5HS7A 3GO5A 3P7NA 1KYWA 4RGSA 3CLOA 4WXHA 4K2EA 4P5OA 4G6QA 1HW1A 4P9FA 1GHCA 2HQNA 5ED4A 4HZFA 1BBYA 2ZFWA 1K79A 1H9TA 2NNNA 2IT0A 3CUQA 2J5PA 1W5TA 5E1XA 2PMUA 2YPRA 2YR2A 3C18A 5D5UB 3PQJA 4ENMA 1TW2A 3HHGA 1C0WA 3E5QA 3GVAA 3D0SA 4M6XA 4DNCA 3RTRA 3RYRA 1EH6A 3HOSA 1P6RA 1IAWA 3QRFF 2P6SA 4U0WA 2DAOA 2DW4A 2XKPA 2NYXA 1Q1HA 4KT5C 4A0YA 4I2OA 6PAXA 4IJAA 3DF8A 2FA5A 2L3DA 4MQVA 4ZH4F 4LB5A 2RN7A 3OV8A 2BYVE 1G3WA 5ILVA 3ABUA 1DPUA 1SMTA 1R36A 1T6SA 2QM3A 1MZBA 1TW3A 1FBQA 4IXAA 3KLOA 4L18B 1XCVA 3EUHA 5FLXZ 2O03A 1LDJA 2ZMEB 4JK1X 2NRAC 3WGHA 1FBUA 2K02A 2FU4A 3KZYA 1SFEA 3KP2A 3I59A 5L3EA 4P96A 4M71A 4I0BA 1I1SA 2DPDA 3REOA 2VOOA 2JPBA 5BPDA 2CYYA 3V7SA 4S04A 2M5WA 3SQNA 1ZYRF 2V1XA 1P2FA 3NRVA 3E6DA 3R6SA 2FNPA 3JSOA 4M73A 4Y15A 5F64A 3EQLF 2MC3A 2D1VA 4EMSA 2QQ9A 1XMAA 3ISPA 3CDHA 4KICA 5LHGA 1FYLA 2VE9A 2HEOA 2F5DA 4HQMA 3B73A 2XKOA 2MA3A 2RVCA 3R4KA 4IHTA 3RYPA 1BIAA 4ETSA 1HXDA 1YLFA 1ZG1A 1IXRC 2FMYA 3O3KA 3QPTA 1QQIA 1ZRFA 3H92A 1FPQA 4PGGA 3F22A 2L02A 2Y0MA 3L9FA 2NS0A 2ELHA 2KIUA 4MHGA 4XLNF 2LNBA 3LSTA 5FB2A 2DK8A 5DCFA 4Q4ZF 2K27A 3LA3A 1K6OA 1ZN2A 4EVIA 1FYKA 1PUEE 1F4KA 5E20A 2QENA 4ON0A 4UV9A 2J5OA 5E17F 3GFIA 2CG4A 2M30A 1LQ1A 4LB6B 4IF4A 2VBWA 1P4AA 3RI4A 1G6NA 3HRTA 2XAFA 1U78A 2VN2A 1QO0D 2PJPA 1J75A 1FLIA 4HF0A 1KU9A 2XASA 3LQQA 5F6FA 3QAHA 3W6KB 4CGZA 3VOEA 2X4HA 1OMIA 3FXUA 4O5VA 3F72A 3WTTC 4YFXF 4HX4A 2OAZA 5FD6A 1B6AA 3LAJA 3QPHA 4KN7X 2GXGA 3HTSB 1S3JA 1K78B 2IW5A 1KQ9A 2CGPA 1FY7A 3F3XA 1Z05A 3BDDA 1BC8C 2H27A 4OU0A 4L9TA 3IL2A 2G9WA 1B1BA 3HRMA 2Z3YA 2HGCA 2EFNA 2K4BA 3PQKA 2FBHA 4OMZA 5E1ZB 4HW0A 4G7OF 1R5GA 2XAQA 4MEYF 1BOAA 1I5ZA 3M9AA 4HA8A 3ZQ7A 2QBYB 2PFBA 3TO7A 1E2XA 5CVJA 3E5XA 2GWRA 3TDUC 3KP4A 4KMUX 5D6FA 5HLIA 1RIOH 2ESHA 4RAZA 1J59A 4XLPF 5D5XB 1TTYA 1R7JA 3WTYC 2O3FA 5BQTA 4KN4X 3GWZA 4MTEA 3AAFA 5JR3A 1FSEA 4GXOA 1XMKA 1DDNA 3BROA 3N4MA 1YFHA 1CF7A 1MDMB 1BI2A 2EV6A 1Z6TA 3GZ6A 1JXSA 1DP7P 2Y75A 1MGTA 2EFQA 1LEBA 4KIFA 4R1HA 3F8CA 4I01A 2L4MA 4LD5A 2K86A 1HSTA 1XCBA 1ULYA 4RS8A 1UHMA 2LDUA 3TGNA 3CO7C 5D5VB 1JGSA 2HTJA 3U2RA 4I98B 4U0VA 2CSOA 2PN6A 3NQOA 4AVPA 2DBBA 5J6XA 1TLHB 4A2UA 2YU3A 4HV5A 1GXPA 4IRIA 2M87A 2A61A 4H0EA 2EV0A 1T98A 1KA8A 2VBZA 1EH8A 2D1HA 3J7AO 1OYWA 3SXYA 5K5OA 3I71A 5HS9A 1LVAA 3E97A 4HLYA 3RKWA 2XAJA 2MH2A 4N0BA 5HOOA 1L0OC 2FRHA 1O57A 2P7VB 4RB0A 1ON2A 3RDIA 2LKPA 3LFKA 4ZYEA 2E7XA 1OKRA 4UUVA 2FEZA 1SAXA 3JTGA 1XGOA 1Z9CA 2WWYA 3EYYA 2DQRA 4LLGF 3H3UA 3M7GA 1F9NA 2PLYA 2TDXA 4B09A 3RJPA 2L01A 3T8RA 4UHTA 1W7PD 4CO8A 4EQQA 3R0AA 2E1CA 4KMFA 2NNYA 3KZZA 4PGHA 2GAUA 2XAGA 2DFIA 2PEXA 1P4WA 1O3SA 2QUFA 4LFUA 4UNOA 3J80K 3FXRA 1YO5C 4G8XA 3HSEA 5ILUA 4HBLA 1QZZA 4QWQA 2A69F 3D5LA 1B9MA 3OOPA 5JHUA 2O6GE 3SZPA 4Y13A 2RKHA 3V8JA 1SFUA 1OPCA 5F1RA 1S29A 3HSRA 1FZPB 4EJOA 1FOKA 3R61A 3ZMTA 1KU3A 1O7LA 3TO6A 2HYFA 4UVBA 3IRRA 4LK1F 2L54A 1CGPA 1G3TA 2QZ8A 2Z99A 4WF2A 2FE3A 1UCRA 2ZXJA 1B59A 1R00A 3C1DA 2E1NA 3K69A 1P4XA 3CUOA 2W24A 3O2PE 4ENKA 3RIRA 1A04A 4O6JA 3K2ZA 2STTA 3O6BB 2UZKA 3V7RA 4MGRA 3P9IA 4LGWA 4IRHA 4ZYGA 1U6GA 2HQRA 4MEXF 2MLGA 3ZMSA 5DUIA 3F21A 1RUOA 3FWEA 5D8LB 4R79A 2D2WA 3BZ6A 1J2XA 1O3QA 1LB2A 4CXFA 2A68F 2PI0A 1ZLJA 1K7AA 4ESBA 1F5TA 5IT9K 1R1VA 2XAHA 1B4AA 3HSFA 2RGVA 4AD9A 3ERED 1IRFA 1S6LA 1TNTA 3ZMUA 2R3SA 3SHFA 1ZREA 4QLCU 2CWEA 2V6CA 4HQEA 4LK0F 4AWXB 5FGMA 4KDPA 1AOYA 3QU3A 3F8NA 2ETHA 3K1MA 2X0LA 1MKMA 4HF1A 5LGUA 2OD5A 4EM0B 2F5EA 3T1BA 2OZ6A 1IXCA 5DD4A 2CQKA 4LLNA 3DP7A 3G3ZA 2FBKA 1SD7A 3LA2A 3MZYA 5ILSA 5BOXA 2VOPA 4L9VA 4CYDA 3ELKA 1U5TB 3GX4X 1Z1DA 1NHAA 1J9IA 3DPTA 5D5WB 2OA4A 2YX4A 3DKWA 4KNYA 1WWXA 5EEGA 2O8XA 1Y0UA 3R60A 5DDGA 4G7HF 3CTAA 1W5SA 2W85A 5KVRA 4OIOF 1HW5A 5DD8A 3KP6A 3WTXC 4OIPF 2FSWA 5BMZA 1S8NA 1FYMA 3E3VA 3K1PA 1YW7A 2Y48A 4ENJA 5DYMA 3BOQA 3CO6C 3NEUA 3F6OA 4BAYA 5DUKA 4AIHA 3GXOA 2IP2A 1HKTA 2Q0OA 4Z2YA 4L5JA 5BS6A 3LA7A 3JSPA 2ZBKA 1D8KA 1JE8A 3JW4A 1IN7A 4M72A 4HX7A 4XRFA 4MTDA 2BE5F 2A07F 1ZG3A 1R1UA 4G94A 5DEQA 4OIRF 5HVQC 4L0ZB 2P6TA 3F8FA 1FBSA 4WCGA 1ZG5A 2NAZA 1XN7A 1XSVA 2KIMA 2EFPA 2XUBA 3K1NA 1PDNC 1TQPA 2OU2A 4ESFA 2LSOA 3CUQB 2UXNA 4GGGA 1D5VA 2ZNYA 1I6XA 1YIOA 4GCVA 1ZAOA 2PG4A 4E70A 1FX7A 3RPUA 1X3UA 3VEPA 2BGCA 3ZP5A 2A3SA 4BHCA 1RUNA 1BI3A 3J80Z 2DQLA 5E18F 4HX8A 3HHHA 3WU1B 1RZ4A 2ISYA 3IKVA 3ULQB 4Y17A 3DFGA 1R23A 1SD5A 1QZYA 2DTRA 1D8JA 5ERIA 3QU6A 5FFZA 1QGPA 1EH7A 3IWFA 1JHHA 1AWCA 2JTVA 4PDKA 5DCMA 4EJWA 2ZKZA 2O0YA 1V4RA 3TOAA 4CDGA 2FMLA 3L2CA 2KJCA 4WXCA 2OQGA 2P7CB 3BJ6A 3I59B 3FMSA 2Z33A 3G73A 2H6BA 1TNSA 1MJ9A 3KP3A 3M8FA 3Q9SA 1FP2A 1Z6RA 2XHKA 5EEHA 2QLZA 2HWVA 3ZN1A 2JT1A 4U7BA 2RNJA 4EJUA 2DT5A 4GYIA 5ICEA 1MJBA 4KFCA 3FMQA 4ZYHA 1IUYA 2VXZA 1HQCA 3IKTA 1IN4A 5FD5A 4A5NA 1E17A 4RB3C 1IF1A 5TJJA 5IT9Z 1T2KA 4WX9A 4LG0A 1TQMA 2RV8A 1ZRDA 1KQ8A 3GYHX 5CYVA 3FMRA 3TKYA 4L9NA 2GA2A 3I64A 4D0PA 1XGNA 1BN5A 4AIJA 3H3ZA 3IWZA 3FZVA 4EV0A 3FM5A 3WE2A 3T0YA 2QVOA 3DQVC 5LHHA 2P5VA 1REPC 2YX7A 4CHUA 1W7PB 1LDDA 4FHTA 2V9VA 1H0MA 3MWMA 2GA1A 2DI3A 1J0RA 1YQAA 3GUDA 5LRSA 1QNTA 3GEZA 2IJLA 3HYIA 1XGMA 5AIQA 4NQWA 1DPRA 5TRDA 2EA2A 3F23A 1Z91A 3QOPA 1WI9A 3I5UA 2W57A 1HKQA 2R7DA 2FXAA 3V8KA 3SFZA 2HDCA 2H94A 2FBIA 2H6CA 1U5TC 4RB2C 2Z9OA 5L3GA 5ICFA 2OBPA 3ZPLA 1XDUA 3ML6A 3WE3A 1FC3A 1U3EM 2W84A 1O3TA 4KIBA 2DK5A 4YIFA 3RPQA 2VT2A 3Q9VA 4TV7A 4FX4A 2ZMEA 4A5MA 1V3FA 2UXXA 1ZHFA 2VONA 1SFXA 1YYVA 4ESJA 1BI1A 2DPUA 1FNNA 2XIGA 4HAMA 2G7UA 2Q8KA 3I0TA 2FNAA 1HKSA 1R22A 3RKYA 3M8EA 1HW2A 3LAPA 4LMYA 4I09A 2GQQA 2HS5A 1TQIA 2ESNA 4YFKF 3KETA 2EFWA 3WODF 3E5UA 3ZN0A 4P55A 2ZCWA 2WTEA 4BH9A 4RGRA 2DO7A 4AIKA 4L9JA 2QWWA 3LQRA 3QP5A 1XGSA 1QBJA 3N97A 3MQ0A 4I7HA 3CUQC 4PCQA 4FX0A 1CF7B 1Z7UA 3JTHA 4JBAA 4ZZLA 2FOKA 4G7ZF 1YS7A 1TBXA 3KEQA 4NHJA 3WU0A 2EJRA 3SZTA 1WKMA 4IHSA 2JSCA 4PZJA 5D6EA 4ASNA 3GZ5A 4YIIA 2EK5A 2IA2A 4BHPA 3U9GA 1HBXG 1I1GA 4LLLA 3T5XA 2CO5A 1ONVA 5L3CA 5HDKA 3T8TA 1FT9A 2RC4A 3ZMDA 4LJZF 2VBXA 4O3MA 2EWNA 5AIPA 1OYYA 3ECHA 1BI0A 5L3DA 2HKXA 1YW8A 3GW2A 2MH9A 1KU7A 3TDZC 3P9KA 2M8EA 3J81Z 1U2WA 1SD4A 1BC7C 5CLSA 5H6RA 4ZYDA 1FP1D 1KGSA 4FT8A 3E6BA 4M6YA 2JRTA 2DU9A 3WTVC 3I4PA 2GXBA 5ICCA 5JFRA 1W4MA 1J7KA 3ABTA 4L5IA 1XSXA 1IN6A 3FXQA 4EJTA 2JZYA 4BYYA 2HKOA 4UVAA 2IA0A 2A5YB 5CVIA 5L3FA 2STWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJB A;  4XSX F;  1SD6 A;  1IN5 A;  1K78 A;  5CVR A;  5D8K B;  3I54 A;  1OR7 A;  3ECO A;  2P8T A;  5DV5 A;  4XBF A;  2HTS A;  1RNL A;  1KQ0 A;  5LEK A;  3PFI A;  3P9C A;  3WTW C;  3FF5 A;  4RB1 A;  2IA1 A;  1XDS A;  2F2E A;  3FM3 A;  2ADU A;  2K4J A;  4M74 A;  1ZGJ A;  1IRG A;  4CZZ A;  4KUM A;  2QBY A;  2OZU A;  3W6J B;  3WGG A;  3FX3 A;  1ZRC A;  5E8I A;  1G4D A;  5A2Q K;  2XRO A;  3ZMZ A;  1ZH5 A;  2QQB A;  3Q5F A;  4M9Z A;  2JPC A;  2MBF A;  1LDK B;  1LNW A;  1MJA A;  4CIC A;  3IC7 A;  4MNU A;  4S05 A;  1MDM A;  4GO1 A;  4XSZ F;  2GZW A;  2RDP A;  2L4A A;  3K0L A;  3MEX A;  2VC0 A;  3E6M A;  2ZNZ A;  2BV6 A;  5HDG A;  1T38 A;  2IPQ X;  3QP6 A;  3FHZ A;  5JVT A;  4R8H A;  1IN8 A;  1YTY A;  1WQ2 A;  4BXU A;  5CVU A;  2E7W A;  3KP5 A;  5E8G A;  4M9S A;  4U88 A;  4Q47 A;  1O7F A;  2QYO A;  1ZLK A;  1UST A;  2W25 A;  5CJ9 A;  3U1D A;  4EJV A;  1GVJ A;  4U7D A;  4U0Y A;  2M45 A;  2BEO A;  2LF8 A;  3JAM K;  3GFJ A;  2FQ3 A;  1W7P A;  2PMH A;  4HF2 A;  5H6Q A;  4A0X A;  1WSU A;  4EGY A;  4Q48 A;  1USS A;  1OYI A;  3M1E A;  1U8R A;  3KCC A;  1R1T A;  3BJA A;  2F5F A;  5FO5 A;  2FF4 A;  4UVC A;  1XB4 A;  1MD0 A;  4WWC A;  2COM A;  2O61 A;  4BQA A;  4OIQ F;  1LJ9 A;  4Q5S F;  1F1Z A;  3K9T A;  4RGU A;  1UB9 A;  1STZ A;  3V8L A;  5L3B A;  3IHU A;  2VE8 A;  4RGX A;  5J8F A;  2ZJ2 A;  3DPL C;  2ISZ A;  3WTS C;  3ZMV A;  3B02 A;  2PQ8 A;  2CW0 F;  2WC2 A;  2ACJ A;  3WTU C;  2MD5 A;  4RAY A;  3L00 A;  3TQN A;  5ICG A;  4M9X A;  3HRS A;  2V1U A;  3HUG A;  5HLH A;  2G7H A;  4G9Y A;  2GIV A;  3ROU A;  5HS8 A;  1R5H A;  4DQ2 A;  3BWG A;  2HR3 A;  1ON1 A;  3F6V A;  4HOB A;  2EV5 A;  2OQR A;  3C3W A;  2DLL A;  2Z5U A;  3BY6 A;  3J81 K;  4KIG A;  3BP8 A;  1SMY F;  2XVC A;  2XGX A;  3EDP A;  5LLQ A;  2F5C A;  4I02 A;  1YW9 A;  3KP7 A;  3I53 A;  2CFX A;  4BNC A;  2BBY A;  4N9I A;  5BPI A;  2VC1 A;  2P5L C;  3VOD A;  1H9G A;  1IZ1 A;  3WG9 A;  2VOD A;  3KLN A;  5LEJ A;  2AS5 F;  3DEU A;  4GYG A;  4WXD A;  1FWZ A;  3C7J A;  1RI7 A;  4ENN A;  5K5R A;  1DUX C;  2VT3 A;  5FFX A;  3HOT A;  5HDN A;  1ODD A;  3MFK A;  1BJA A;  3EET A;  5KK1 A;  3HRU A;  1XD7 A;  2LF7 A;  3MCZ A;  5LRR A;  5JI6 A;  2UWM A;  3BPX A;  5FLX K;  3HIF A;  1T0F A;  1B9N A;  4KYW A;  3WGI A;  5IT3 A;  1PP7 U;  1LEA A;  5LBQ A;  2EB7 A;  4F7Z A;  2QQA A;  3IRQ A;  5D4R A;  1ZAR A;  2Q2E A;  3DXJ F;  2R7F A;  4HYE A;  5LGN A;  1IXS B;  4HDU A;  4IPA A;  1I27 A;  4A6D A;  4YFN F;  4G6D A;  1GXQ A;  4EM2 A;  2AXL A;  2KIF A;  2HYG D;  1S7O A;  1HSJ A;  3GFM A;  4IVN A;  4N9H A;  5J8C A;  3KFW X;  3COA C;  2P4W A;  1YG2 A;  4EM1 A;  5H20 A;  3WTZ A;  4YG2 F;  3KEO A;  2PBI A;  4UV8 A;  2B0L A;  5LGT A;  1BM9 A;  4P9U A;  2EA4 A;  3R0J A;  2IRF G;  1KU2 A;  4BHB A;  5E1W A;  2MLK A;  1S7A A;  3L09 A;  2A6E F;  1XSD A;  1IW7 F;  5CVV A;  5A2Q Z;  4A0Z A;  3E6C C;  1UHW A;  2YSR A;  1O3R A;  3VB2 A;  3KE2 A;  2KKO A;  3LWF A;  2RQP A;  3F8M A;  2H09 A;  3TOB A;  1QPM A;  4NB5 A;  1JHF A;  1T39 A;  4MQ9 F;  2P5K A;  3GFL A;  1P92 A;  3DV8 A;  5K5Q A;  4L0Y B;  2A6H F;  1G3Y A;  4OOI A;  2HZT A;  4OMY A;  3GF2 A;  2V79 A;  4KA4 A;  2VBY A;  3MZH A;  2C6Y A;  2D45 A;  1PP8 F;  5DCM B;  3VFZ A;  3F8B A;  5K1Y A;  3RKX A;  5AON A;  2KRF A;  1UFM A;  4ZZD A;  1U5T A;  3I58 A;  4IRG A;  3JAM Z;  4EGZ A;  4WK8 F;  3GLX A;  3S2W A;  5HLG A;  4B8X A;  3BJO A;  4HV6 A;  3CJN A;  2IVM A;  4JQF A;  1R58 A;  2EFO A;  4I0A A;  1D3Y A;  2V1D A;  3BPV A;  5D4S A;  3V7C A;  2K7L A;  3HTU A;  4HLX A;  2XRN A;  2WV0 A;  2HFH A;  4OIN F;  5LHI A;  1YS6 A;  1J5Y A;  4A6E A;  4UXN A;  4A12 A;  1KYZ A;  1VTN C;  4LG0 B;  3V4G A;  1FSH A;  1BIB A;  3L7W A;  3MAJ A;  4HDV A;  1EV7 A;  2HOE A;  2M1B A;  1G3S A;  1L3L A;  2ZO4 A;  1WRJ A;  2XV4 S;  3EYI A;  1ZGA A;  3TO9 A;  5HS7 A;  3GO5 A;  3P7N A;  1KYW A;  4RGS A;  3CLO A;  4WXH A;  4K2E A;  4P5O A;  4G6Q A;  1HW1 A;  4P9F A;  1GHC A;  2HQN A;  5ED4 A;  4HZF A;  1BBY A;  2ZFW A;  1K79 A;  1H9T A;  2NNN A;  2IT0 A;  3CUQ A;  2J5P A;  1W5T A;  5E1X A;  2PMU A;  2YPR A;  2YR2 A;  3C18 A;  5D5U B;  3PQJ A;  4ENM A;  1TW2 A;  3HHG A;  1C0W A;  3E5Q A;  3GVA A;  3D0S A;  4M6X A;  4DNC A;  3RTR A;  3RYR A;  1EH6 A;  3HOS A;  1P6R A;  1IAW A;  3QRF F;  2P6S A;  4U0W A;  2DAO A;  2DW4 A;  2XKP A;  2NYX A;  1Q1H A;  4KT5 C;  4A0Y A;  4I2O A;  6PAX A;  4IJA A;  3DF8 A;  2FA5 A;  2L3D A;  4MQV A;  4ZH4 F;  4LB5 A;  2RN7 A;  3OV8 A;  2BYV E;  1G3W A;  5ILV A;  3ABU A;  1DPU A;  1SMT A;  1R36 A;  1T6S A;  2QM3 A;  1MZB A;  1TW3 A;  1FBQ A;  4IXA A;  3KLO A;  4L18 B;  1XCV A;  3EUH A;  5FLX Z;  2O03 A;  1LDJ A;  2ZME B;  4JK1 X;  2NRA C;  3WGH A;  1FBU A;  2K02 A;  2FU4 A;  3KZY A;  1SFE A;  3KP2 A;  3I59 A;  5L3E A;  4P96 A;  4M71 A;  4I0B A;  1I1S A;  2DPD A;  3REO A;  2VOO A;  2JPB A;  5BPD A;  2CYY A;  3V7S A;  4S04 A;  2M5W A;  3SQN A;  1ZYR F;  2V1X A;  1P2F A;  3NRV A;  3E6D A;  3R6S A;  2FNP A;  3JSO A;  4M73 A;  4Y15 A;  5F64 A;  3EQL F;  2MC3 A;  2D1V A;  4EMS A;  2QQ9 A;  1XMA A;  3ISP A;  3CDH A;  4KIC A;  5LHG A;  1FYL A;  2VE9 A;  2HEO A;  2F5D A;  4HQM A;  3B73 A;  2XKO A;  2MA3 A;  2RVC A;  3R4K A;  4IHT A;  3RYP A;  1BIA A;  4ETS A;  1HXD A;  1YLF A;  1ZG1 A;  1IXR C;  2FMY A;  3O3K A;  3QPT A;  1QQI A;  1ZRF A;  3H92 A;  1FPQ A;  4PGG A;  3F22 A;  2L02 A;  2Y0M A;  3L9F A;  2NS0 A;  2ELH A;  2KIU A;  4MHG A;  4XLN F;  2LNB A;  3LST A;  5FB2 A;  2DK8 A;  5DCF A;  4Q4Z F;  2K27 A;  3LA3 A;  1K6O A;  1ZN2 A;  4EVI A;  1FYK A;  1PUE E;  1F4K A;  5E20 A;  2QEN A;  4ON0 A;  4UV9 A;  2J5O A;  5E17 F;  3GFI A;  2CG4 A;  2M30 A;  1LQ1 A;  4LB6 B;  4IF4 A;  2VBW A;  1P4A A;  3RI4 A;  1G6N A;  3HRT A;  2XAF A;  1U78 A;  2VN2 A;  1QO0 D;  2PJP A;  1J75 A;  1FLI A;  4HF0 A;  1KU9 A;  2XAS A;  3LQQ A;  5F6F A;  3QAH A;  3W6K B;  4CGZ A;  3VOE A;  2X4H A;  1OMI A;  3FXU A;  4O5V A;  3F72 A;  3WTT C;  4YFX F;  4HX4 A;  2OAZ A;  5FD6 A;  1B6A A;  3LAJ A;  3QPH A;  4KN7 X;  2GXG A;  3HTS B;  1S3J A;  1K78 B;  2IW5 A;  1KQ9 A;  2CGP A;  1FY7 A;  3F3X A;  1Z05 A;  3BDD A;  1BC8 C;  2H27 A;  4OU0 A;  4L9T A;  3IL2 A;  2G9W A;  1B1B A;  3HRM A;  2Z3Y A;  2HGC A;  2EFN A;  2K4B A;  3PQK A;  2FBH A;  4OMZ A;  5E1Z B;  4HW0 A;  4G7O F;  1R5G A;  2XAQ A;  4MEY F;  1BOA A;  1I5Z A;  3M9A A;  4HA8 A;  3ZQ7 A;  2QBY B;  2PFB A;  3TO7 A;  1E2X A;  5CVJ A;  3E5X A;  2GWR A;  3TDU C;  3KP4 A;  4KMU X;  5D6F A;  5HLI A;  1RIO H;  2ESH A;  4RAZ A;  1J59 A;  4XLP F;  5D5X B;  1TTY A;  1R7J A;  3WTY C;  2O3F A;  5BQT A;  4KN4 X;  3GWZ A;  4MTE A;  3AAF A;  5JR3 A;  1FSE A;  4GXO A;  1XMK A;  1DDN A;  3BRO A;  3N4M A;  1YFH A;  1CF7 A;  1MDM B;  1BI2 A;  2EV6 A;  1Z6T A;  3GZ6 A;  1JXS A;  1DP7 P;  2Y75 A;  1MGT A;  2EFQ A;  1LEB A;  4KIF A;  4R1H A;  3F8C A;  4I01 A;  2L4M A;  4LD5 A;  2K86 A;  1HST A;  1XCB A;  1ULY A;  4RS8 A;  1UHM A;  2LDU A;  3TGN A;  3CO7 C;  5D5V B;  1JGS A;  2HTJ A;  3U2R A;  4I98 B;  4U0V A;  2CSO A;  2PN6 A;  3NQO A;  4AVP A;  2DBB A;  5J6X A;  1TLH B;  4A2U A;  2YU3 A;  4HV5 A;  1GXP A;  4IRI A;  2M87 A;  2A61 A;  4H0E A;  2EV0 A;  1T98 A;  1KA8 A;  2VBZ A;  1EH8 A;  2D1H A;  3J7A O;  1OYW A;  3SXY A;  5K5O A;  3I71 A;  5HS9 A;  1LVA A;  3E97 A;  4HLY A;  3RKW A;  2XAJ A;  2MH2 A;  4N0B A;  5HOO A;  1L0O C;  2FRH A;  1O57 A;  2P7V B;  4RB0 A;  1ON2 A;  3RDI A;  2LKP A;  3LFK A;  4ZYE A;  2E7X A;  1OKR A;  4UUV A;  2FEZ A;  1SAX A;  3JTG A;  1XGO A;  1Z9C A;  2WWY A;  3EYY A;  2DQR A;  4LLG F;  3H3U A;  3M7G A;  1F9N A;  2PLY A;  2TDX A;  4B09 A;  3RJP A;  2L01 A;  3T8R A;  4UHT A;  1W7P D;  4CO8 A;  4EQQ A;  3R0A A;  2E1C A;  4KMF A;  2NNY A;  3KZZ A;  4PGH A;  2GAU A;  2XAG A;  2DFI A;  2PEX A;  1P4W A;  1O3S A;  2QUF A;  4LFU A;  4UNO A;  3J80 K;  3FXR A;  1YO5 C;  4G8X A;  3HSE A;  5ILU A;  4HBL A;  1QZZ A;  4QWQ A;  2A69 F;  3D5L A;  1B9M A;  3OOP A;  5JHU A;  2O6G E;  3SZP A;  4Y13 A;  2RKH A;  3V8J A;  1SFU A;  1OPC A;  5F1R A;  1S29 A;  3HSR A;  1FZP B;  4EJO A;  1FOK A;  3R61 A;  3ZMT A;  1KU3 A;  1O7L A;  3TO6 A;  2HYF A;  4UVB A;  3IRR A;  4LK1 F;  2L54 A;  1CGP A;  1G3T A;  2QZ8 A;  2Z99 A;  4WF2 A;  2FE3 A;  1UCR A;  2ZXJ A;  1B59 A;  1R00 A;  3C1D A;  2E1N A;  3K69 A;  1P4X A;  3CUO A;  2W24 A;  3O2P E;  4ENK A;  3RIR A;  1A04 A;  4O6J A;  3K2Z A;  2STT A;  3O6B B;  2UZK A;  3V7R A;  4MGR A;  3P9I A;  4LGW A;  4IRH A;  4ZYG A;  1U6G A;  2HQR A;  4MEX F;  2MLG A;  3ZMS A;  5DUI A;  3F21 A;  1RUO A;  3FWE A;  5D8L B;  4R79 A;  2D2W A;  3BZ6 A;  1J2X A;  1O3Q A;  1LB2 A;  4CXF A;  2A68 F;  2PI0 A;  1ZLJ A;  1K7A A;  4ESB A;  1F5T A;  5IT9 K;  1R1V A;  2XAH A;  1B4A A;  3HSF A;  2RGV A;  4AD9 A;  3ERE D;  1IRF A;  1S6L A;  1TNT A;  3ZMU A;  2R3S A;  3SHF A;  1ZRE A;  4QLC U;  2CWE A;  2V6C A;  4HQE A;  4LK0 F;  4AWX B;  5FGM A;  4KDP A;  1AOY A;  3QU3 A;  3F8N A;  2ETH A;  3K1M A;  2X0L A;  1MKM A;  4HF1 A;  5LGU A;  2OD5 A;  4EM0 B;  2F5E A;  3T1B A;  2OZ6 A;  1IXC A;  5DD4 A;  2CQK A;  4LLN A;  3DP7 A;  3G3Z A;  2FBK A;  1SD7 A;  3LA2 A;  3MZY A;  5ILS A;  5BOX A;  2VOP A;  4L9V A;  4CYD A;  3ELK A;  1U5T B;  3GX4 X;  1Z1D A;  1NHA A;  1J9I A;  3DPT A;  5D5W B;  2OA4 A;  2YX4 A;  3DKW A;  4KNY A;  1WWX A;  5EEG A;  2O8X A;  1Y0U A;  3R60 A;  5DDG A;  4G7H F;  3CTA A;  1W5S A;  2W85 A;  5KVR A;  4OIO F;  1HW5 A;  5DD8 A;  3KP6 A;  3WTX C;  4OIP F;  2FSW A;  5BMZ A;  1S8N A;  1FYM A;  3E3V A;  3K1P A;  1YW7 A;  2Y48 A;  4ENJ A;  5DYM A;  3BOQ A;  3CO6 C;  3NEU A;  3F6O A;  4BAY A;  5DUK A;  4AIH A;  3GXO A;  2IP2 A;  1HKT A;  2Q0O A;  4Z2Y A;  4L5J A;  5BS6 A;  3LA7 A;  3JSP A;  2ZBK A;  1D8K A;  1JE8 A;  3JW4 A;  1IN7 A;  4M72 A;  4HX7 A;  4XRF A;  4MTD A;  2BE5 F;  2A07 F;  1ZG3 A;  1R1U A;  4G94 A;  5DEQ A;  4OIR F;  5HVQ C;  4L0Z B;  2P6T A;  3F8F A;  1FBS A;  4WCG A;  1ZG5 A;  2NAZ A;  1XN7 A;  1XSV A;  2KIM A;  2EFP A;  2XUB A;  3K1N A;  1PDN C;  1TQP A;  2OU2 A;  4ESF A;  2LSO A;  3CUQ B;  2UXN A;  4GGG A;  1D5V A;  2ZNY A;  1I6X A;  1YIO A;  4GCV A;  1ZAO A;  2PG4 A;  4E70 A;  1FX7 A;  3RPU A;  1X3U A;  3VEP A;  2BGC A;  3ZP5 A;  2A3S A;  4BHC A;  1RUN A;  1BI3 A;  3J80 Z;  2DQL A;  5E18 F;  4HX8 A;  3HHH A;  3WU1 B;  1RZ4 A;  2ISY A;  3IKV A;  3ULQ B;  4Y17 A;  3DFG A;  1R23 A;  1SD5 A;  1QZY A;  2DTR A;  1D8J A;  5ERI A;  3QU6 A;  5FFZ A;  1QGP A;  1EH7 A;  3IWF A;  1JHH A;  1AWC A;  2JTV A;  4PDK A;  5DCM A;  4EJW A;  2ZKZ A;  2O0Y A;  1V4R A;  3TOA A;  4CDG A;  2FML A;  3L2C A;  2KJC A;  4WXC A;  2OQG A;  2P7C B;  3BJ6 A;  3I59 B;  3FMS A;  2Z33 A;  3G73 A;  2H6B A;  1TNS A;  1MJ9 A;  3KP3 A;  3M8F A;  3Q9S A;  1FP2 A;  1Z6R A;  2XHK A;  5EEH A;  2QLZ A;  2HWV A;  3ZN1 A;  2JT1 A;  4U7B A;  2RNJ A;  4EJU A;  2DT5 A;  4GYI A;  5ICE A;  1MJB A;  4KFC A;  3FMQ A;  4ZYH A;  1IUY A;  2VXZ A;  1HQC A;  3IKT A;  1IN4 A;  5FD5 A;  4A5N A;  1E17 A;  4RB3 C;  1IF1 A;  5TJJ A;  5IT9 Z;  1T2K A;  4WX9 A;  4LG0 A;  1TQM A;  2RV8 A;  1ZRD A;  1KQ8 A;  3GYH X;  5CYV A;  3FMR A;  3TKY A;  4L9N A;  2GA2 A;  3I64 A;  4D0P A;  1XGN A;  1BN5 A;  4AIJ A;  3H3Z A;  3IWZ A;  3FZV A;  4EV0 A;  3FM5 A;  3WE2 A;  3T0Y A;  2QVO A;  3DQV C;  5LHH A;  2P5V A;  1REP C;  2YX7 A;  4CHU A;  1W7P B;  1LDD A;  4FHT A;  2V9V A;  1H0M A;  3MWM A;  2GA1 A;  2DI3 A;  1J0R A;  1YQA A;  3GUD A;  5LRS A;  1QNT A;  3GEZ A;  2IJL A;  3HYI A;  1XGM A;  5AIQ A;  4NQW A;  1DPR A;  5TRD A;  2EA2 A;  3F23 A;  1Z91 A;  3QOP A;  1WI9 A;  3I5U A;  2W57 A;  1HKQ A;  2R7D A;  2FXA A;  3V8K A;  3SFZ A;  2HDC A;  2H94 A;  2FBI A;  2H6C A;  1U5T C;  4RB2 C;  2Z9O A;  5L3G A;  5ICF A;  2OBP A;  3ZPL A;  1XDU A;  3ML6 A;  3WE3 A;  1FC3 A;  1U3E M;  2W84 A;  1O3T A;  4KIB A;  2DK5 A;  4YIF A;  3RPQ A;  2VT2 A;  3Q9V A;  4TV7 A;  4FX4 A;  2ZME A;  4A5M A;  1V3F A;  2UXX A;  1ZHF A;  2VON A;  1SFX A;  1YYV A;  4ESJ A;  1BI1 A;  2DPU A;  1FNN A;  2XIG A;  4HAM A;  2G7U A;  2Q8K A;  3I0T A;  2FNA A;  1HKS A;  1R22 A;  3RKY A;  3M8E A;  1HW2 A;  3LAP A;  4LMY A;  4I09 A;  2GQQ A;  2HS5 A;  1TQI A;  2ESN A;  4YFK F;  3KET A;  2EFW A;  3WOD F;  3E5U A;  3ZN0 A;  4P55 A;  2ZCW A;  2WTE A;  4BH9 A;  4RGR A;  2DO7 A;  4AIK A;  4L9J A;  2QWW A;  3LQR A;  3QP5 A;  1XGS A;  1QBJ A;  3N97 A;  3MQ0 A;  4I7H A;  3CUQ C;  4PCQ A;  4FX0 A;  1CF7 B;  1Z7U A;  3JTH A;  4JBA A;  4ZZL A;  2FOK A;  4G7Z F;  1YS7 A;  1TBX A;  3KEQ A;  4NHJ A;  3WU0 A;  2EJR A;  3SZT A;  1WKM A;  4IHS A;  2JSC A;  4PZJ A;  5D6E A;  4ASN A;  3GZ5 A;  4YII A;  2EK5 A;  2IA2 A;  4BHP A;  3U9G A;  1HBX G;  1I1G A;  4LLL A;  3T5X A;  2CO5 A;  1ONV A;  5L3C A;  5HDK A;  3T8T A;  1FT9 A;  2RC4 A;  3ZMD A;  4LJZ F;  2VBX A;  4O3M A;  2EWN A;  5AIP A;  1OYY A;  3ECH A;  1BI0 A;  5L3D A;  2HKX A;  1YW8 A;  3GW2 A;  2MH9 A;  1KU7 A;  3TDZ C;  3P9K A;  2M8E A;  3J81 Z;  1U2W A;  1SD4 A;  1BC7 C;  5CLS A;  5H6R A;  4ZYD A;  1FP1 D;  1KGS A;  4FT8 A;  3E6B A;  4M6Y A;  2JRT A;  2DU9 A;  3WTV C;  3I4P A;  2GXB A;  5ICC A;  5JFR A;  1W4M A;  1J7K A;  3ABT A;  4L5I A;  1XSX A;  1IN6 A;  3FXQ A;  4EJT A;  2JZY A;  4BYY A;  2HKO A;  4UVA A;  2IA0 A;  2A5Y B;  5CVI A;  5L3F A;  2STW A; 
#chains in the Genus database with same CATH topology
 2IXS A;  2KJB A;  4XSX F;  1SD6 A;  4C2M J;  1ETW A;  4FQG A;  1X4O A;  1IN5 A;  2X6O A;  3HC7 A;  1K78 A;  3H9G A;  5CVR A;  5D8K B;  2NOG A;  1UZC A;  1AA7 A;  3IH3 A;  3I54 A;  1OR7 A;  1A6Q A;  1VND A;  4PJM A;  3ZQG A;  3ECO A;  2P8T A;  2IAI A;  4M3G A;  3FKI J;  5DV5 A;  4XBF A;  2HTS A;  1YJ9 I;  1RNL A;  1KQ0 A;  2TRT A;  5LEK A;  3PFI A;  1MMA A;  3P9C A;  5B3S H;  4RBO A;  2PJR B;  4M6V A;  3WTW C;  3FF5 A;  4RB1 A;  2I10 A;  3ESW B;  3OYC A;  2FJ1 A;  2IA1 A;  3S15 J;  2XPV A;  4BBR J;  4AU7 A;  2R7S A;  3DU6 A;  4C30 A;  1XDS A;  2F2E A;  3FM3 A;  4XMY A;  4J01 A;  2ADU A;  2K4J A;  1VQN I;  4M74 A;  2MG4 A;  1ZGJ A;  1IRG A;  1K61 A;  3J7Y J;  4CZZ A;  4KUM A;  2QBY A;  3UR3 C;  2R7W A;  4CYC A;  2OZU A;  2W48 A;  3W6J B;  3LL7 A;  3WGG A;  3FX3 A;  4EEF G;  1ZRC A;  5E8I A;  3CDL A;  4IKF A;  3KYC B;  3H5A A;  1RPW A;  1G4D A;  5A2Q K;  2XRO A;  3G1M A;  1YIJ I;  2NOJ B;  1JUS A;  3ZMZ A;  3A01 A;  1ORK A;  4F92 B;  1D1B A;  1ZH5 A;  4Y7N J;  2QQB A;  3Q5F A;  3S1N J;  4M9Z A;  4A93 J;  4DBR A;  2JPC A;  2MBF A;  5B66 C;  1YI2 I;  3MZ8 A;  2LY9 A;  1IDZ A;  1LDK B;  2LR8 A;  1LNW A;  3CD6 I;  3ABM H;  2ZJR F;  5FLM J;  1MJA A;  3BZC A;  2DA5 A;  2F6C A;  4CIC A;  4DGW B;  3IC7 A;  4A3J J;  4KIS A;  1K4T A;  4MNU A;  3M3Y J;  4S05 A;  2DMN A;  2XF6 A;  1AHD P;  2AHQ A;  1MDM A;  4GO1 A;  4XSZ F;  3HGY A;  2GZW A;  2RDP A;  2L4A A;  4YEL A;  4PFP A;  3PSI A;  3K0L A;  2XSD C;  3S2H J;  3MEX A;  2VC0 A;  1Y39 A;  3E6M A;  2ZNZ A;  5CQE A;  2BV6 A;  5HDG A;  1T38 A;  4XRM A;  2IPQ X;  4AC0 A;  3QP6 A;  3FHZ A;  1TWA J;  1YJW I;  1BL0 A;  5JVT A;  4R8H A;  1IN8 A;  3BG6 A;  3G1O A;  4H4K C;  3S3O A;  1WQ2 A;  1YTY A;  4BXU A;  1FOW A;  1X1D A;  2E7W A;  2KRC A;  3KP5 A;  5CVU A;  5E8G A;  1ZR4 A;  4M9S A;  3MVP A;  3OSF A;  4U88 A;  2NS7 A;  4Q47 A;  1O7F A;  2QYO A;  1TT5 B;  2E60 A;  3WG7 H;  2CQQ A;  1ZLK A;  2P81 A;  1UST A;  4QPO A;  2W25 A;  1V54 H;  3MKL A;  3L2R A;  4HST A;  5CJ9 A;  5B5E C;  3U1D A;  3P5J A;  1XS9 A;  4EJV A;  2E35 A;  1GVJ A;  4U7D A;  4U0Y A;  2M45 A;  2BEO A;  2LF8 A;  3JAM K;  2H1L A;  3GFJ A;  2ZSI B;  4IX7 A;  3HBL A;  2FQ3 A;  1W7P A;  1I39 A;  2PMH A;  2X98 A;  3RQI A;  4HF2 A;  2IBD A;  5H6Q A;  2O8K A;  1MH4 A;  2QKL B;  4A0X A;  1W36 C;  1WSU A;  4EGY A;  4Q48 A;  1USS A;  5B1A H;  1MIJ A;  1OYI A;  2CV1 A;  3M1E A;  5K7F A;  5C44 J;  1U8R A;  2D5V A;  3KCC A;  1R1T A;  2M3A A;  3BJA A;  1FOY A;  2F5F A;  5M5Y J;  1MBG A;  4LIT A;  1JT0 A;  2EPF A;  5FO5 A;  2X1E A;  2FF4 A;  3CCU I;  4UVC A;  3BLY A;  2DT7 B;  1XB4 A;  5IP9 J;  1MD0 A;  4WWC A;  2COM A;  2O61 A;  5TGT A;  2X1C A;  1P7I A;  4BQA A;  4OIQ F;  1LJ9 A;  3RSN A;  4Q5S F;  1F1Z A;  2IEK A;  2V7F A;  5H2F C;  4JYK A;  5HNH A;  3K9T A;  4RGU A;  3I3L A;  1UB9 A;  1STZ A;  3V8L A;  5L3B A;  3GTO J;  4XNF A;  3IHU A;  2VE8 A;  2IGK A;  4RGX A;  5J8F A;  2ZJ2 A;  4XK4 A;  1GVD A;  3DPL C;  3SJM A;  2ISZ A;  2LC2 A;  4UUS A;  3PUB A;  1MBF A;  4BQO A;  3E0J B;  2GOX B;  2VKV A;  1Z0X A;  3VSK A;  2HVR A;  3WTS C;  3ZMV A;  3B02 A;  2PQ8 A;  1O4X A;  1JT6 A;  1B72 B;  2CW0 F;  3W6V A;  3TW7 A;  4JOM A;  2WC2 A;  2L9R A;  5J1Y A;  5B1B H;  2ACJ A;  3WTU C;  2M7A A;  2MD5 A;  4RAY A;  3L00 A;  3TQN A;  2F4I A;  5ICG A;  4M9X A;  3HRS A;  3OWT A;  3KYL A;  2LTP A;  2V1U A;  3CF2 A;  4IL6 C;  3HUG A;  5HLH A;  2G7H A;  2F5V A;  2VAS A;  4G9Y A;  2L9N A;  2GIV A;  3ROU A;  5HS8 A;  1R5H A;  4OAZ A;  4DQ2 A;  2LFB A;  1FIA A;  3BWG A;  2HR3 A;  1GLN A;  3OL3 A;  1ON1 A;  3F6V A;  2LG4 A;  3K70 C;  3W3C A;  4HOB A;  2EV5 A;  2OQR A;  2OCE A;  2XSJ C;  2DLL A;  3C3W A;  2R7Q A;  2Z5U A;  1POG A;  2OF7 A;  2COB A;  3DBH B;  5GP9 A;  3BY6 A;  5EDN A;  3G1L A;  3J81 K;  4KIG A;  1RQ6 A;  3BP8 A;  4RAG A;  1SMY F;  2HXO A;  4B3X A;  2YU9 J;  2WV1 A;  3LSI A;  4GRI A;  2E1M B;  2XVC A;  2XGX A;  2FX0 A;  2W4S A;  3EDP A;  3BTC A;  4CZC A;  3BG7 A;  5LLQ A;  1X58 A;  2UV1 A;  2F5C A;  1A36 A;  4I02 A;  5BNG A;  4C3H J;  2XC7 A;  1YW9 A;  3H9Q A;  4AYB A;  3KP7 A;  3CMA I;  3IH4 A;  3I53 A;  2Y9Y A;  2CFX A;  3CC4 I;  4BNC A;  2FD5 A;  1WGX A;  2BBY A;  4N9I A;  5BPI A;  2VC1 A;  1Y0N A;  1JUP A;  3GTJ J;  2P5L C;  3VOD A;  2R93 J;  2VXD A;  1H9G A;  1LKX A;  3PNY A;  3IAM 2;  1IZ1 A;  3WG9 A;  4A3F J;  3KLN A;  2VOD A;  5LEJ A;  1W1W E;  2AS5 F;  3ABL H;  3DEU A;  4GYG A;  4WXD A;  1FWZ A;  3C7J A;  1RI7 A;  5E3O A;  1T95 A;  4ENN A;  5K5R A;  1DUX C;  2VT3 A;  5FFX A;  3S1Q J;  3HOT A;  1IV8 A;  5JHF A;  2FUG 2;  3DBL B;  5HDN A;  1ODD A;  4Z6Y A;  4BXX J;  3MFK A;  2BY1 A;  2WAQ N;  2KRH A;  1BJA A;  2RNG A;  3EET A;  1W0T A;  5KK1 A;  3HRU A;  1XD7 A;  2LF7 A;  3MCZ A;  5LRR A;  5JI6 A;  2R5Z A;  2KIQ A;  1UG0 A;  1WJA A;  3QQA A;  3PL8 A;  2UWM A;  3BPX A;  2ME6 A;  5FKN A;  1BW5 A;  5FLX K;  3HIF A;  2MVT A;  1T0F A;  1B9N A;  3BR0 A;  4KYW A;  3A2K A;  3WGI A;  4E7Z A;  5IT3 A;  1PP7 U;  1LEA A;  4NNJ A;  5LBQ A;  2EB7 A;  4F7Z A;  2QQA A;  1K6Y A;  4MFE A;  1MBJ A;  2OC6 A;  3IRQ A;  5D4R A;  1ZAR A;  2Q2E A;  3DXJ F;  3KYD B;  2OPT A;  2R7F A;  4HYE A;  4E7H A;  5IOY A;  3WHB A;  5LGN A;  1IUF A;  1IXS B;  4HDU A;  1R49 A;  4IPA A;  4HSR A;  1JUM A;  1VQ5 I;  1I27 A;  2MC4 A;  4A6D A;  4YFN F;  4G6D A;  3ZGK A;  2LVS A;  1GXQ A;  4EM2 A;  2AXL A;  3SEQ A;  4XKC A;  2KIF A;  2HYG D;  1S7O A;  3CCE I;  1HSJ A;  5EZG A;  3J7A Y;  2EQR A;  3LSP A;  3GFM A;  3A03 A;  4IVN A;  1ETX A;  4N9H A;  5J8C A;  3KFW X;  3OL4 A;  3COA C;  2P4W A;  1WH7 A;  3VYR B;  3OYD A;  1YG2 A;  3JRF A;  1ZTR A;  1TWF J;  4EM1 A;  3QPS A;  2KT0 A;  1WJF A;  5H20 A;  3S17 J;  3WTZ A;  2DMQ A;  4YG2 F;  3KEO A;  2PBI A;  4C3J J;  1WFX A;  4UV8 A;  2B0L A;  5DTD A;  2VJ5 A;  4BKX A;  5LGT A;  1BM9 A;  1ZR2 A;  4P9U A;  2EA4 A;  2WAF A;  3R0J A;  2PMZ A;  2IRF G;  3H5N A;  4ITV A;  1KU2 A;  2L7K A;  4BHB A;  5E1W A;  4ZDL A;  2MLK A;  4Y52 J;  1S7A A;  3BTI A;  1TP4 A;  3VYU B;  3CDI A;  2HPM A;  3L09 A;  2A6E F;  3BZK A;  1XSD A;  1IW7 F;  5CVV A;  5A2Q Z;  4A0Z A;  3E6C C;  2E5Z A;  1UHW A;  1M1E B;  2EIM H;  1S72 I;  3PSF A;  2YSR A;  3K10 A;  1O3R A;  1V5F A;  3VB2 A;  2HZD A;  3KE2 A;  3HOZ J;  2HOA A;  3TL4 X;  4E7I A;  2DMU A;  2KKO A;  2V6E A;  3LWF A;  2RQP A;  3F8M A;  2H09 A;  3TOB A;  1QPM A;  4NB5 A;  1JHF A;  2MUN A;  1T39 A;  1LPQ A;  4MQ9 F;  2CUE A;  2P5K A;  5FRO A;  3GFL A;  1P92 A;  3DV8 A;  4PJL A;  2L9S A;  5K5Q A;  4L0Y B;  1V55 H;  2HXI A;  2A6H F;  4CCN A;  1G3Y A;  3JRD A;  4OOI A;  2HZT A;  4RLQ A;  4OMY A;  3BTL A;  4MO7 A;  3GF2 A;  2V79 A;  2Y30 A;  4KA4 A;  1V5G A;  2VBY A;  1XMX A;  3MZH A;  2LRE A;  2R7T A;  1CQT A;  3L2U A;  4NC6 A;  9ANT A;  2C6Y A;  2D45 A;  5HNF A;  2L5Q A;  3DLA A;  5FRM A;  4Y3O A;  1PP8 F;  5DCM B;  3OOU A;  3CZ6 A;  3VFZ A;  4B3A A;  4NC8 A;  3F8B A;  5K1Y A;  2K9Q A;  3VDX A;  4CCL A;  4PJN A;  2HI3 A;  3RKX A;  1YRN B;  5AON A;  2KRF A;  3SFI A;  1UFM A;  2DFF A;  1MSE C;  5J47 A;  1ETV A;  4BUP A;  4ZZD A;  3BG3 A;  1U5T A;  4I99 C;  3OYL A;  3RCO A;  4N4O B;  1N25 A;  4XR6 A;  2KHM A;  3I58 A;  4IRG A;  4XM3 A;  5F08 A;  3JAM Z;  5M5X J;  4EGZ A;  3RPU D;  2YUS A;  4WK8 F;  3GLX A;  1JKO C;  3LSH A;  4W97 A;  3S2W A;  5F0H A;  5HLG A;  3HZJ A;  2ZJQ F;  2M0C A;  4JX4 A;  2ZXH A;  2AXT C;  2H1K A;  4B8X A;  1NTC A;  2DA7 A;  3BJO A;  4HV6 A;  2DFE A;  3CJN A;  1X2M A;  2IVM A;  4JQF A;  1R58 A;  1ITY A;  3ZQC A;  2EFO A;  4A3I J;  2LLK A;  3CJQ B;  4OWR B;  4I0A A;  1D3Y A;  2V1D A;  2DN0 A;  3BPV A;  5D4S A;  3V7C A;  1FOX A;  2G0E A;  2K7L A;  3HTU A;  4HLX A;  2XRN A;  2WV0 A;  2HFH A;  4OIN F;  4F55 A;  4F93 B;  2HNH A;  4LOC A;  1W0U A;  5LHI A;  1YS6 A;  3B6C A;  1J5Y A;  4A6E A;  2L9V A;  4UXN A;  3L1P A;  4A12 A;  2CH0 A;  4CH7 A;  1KYZ A;  1VTN C;  3SYT A;  4LG0 B;  3V4G A;  1FSH A;  1Y1W J;  2WA0 A;  1BIB A;  3FBN B;  2VJI A;  4D7M A;  1DGW Y;  2VQG A;  1MNM C;  5TIS C;  1WCM J;  3L7W A;  3MAJ A;  4HDV A;  1EV7 A;  2HOE A;  2M1B A;  1G3S A;  3LSK A;  1L3L A;  1X1P A;  2QKM B;  2K5C A;  4B4C A;  2HOS A;  2VUM J;  2ZO4 A;  1WRJ A;  3ZQF A;  2XV4 S;  3G2B A;  3C2B A;  3EYI A;  1ZGA A;  2M2E A;  3TO9 A;  5HS7 A;  3GO5 A;  3P7N A;  1KYW A;  1RR7 A;  2JUC A;  3CLO A;  4IEJ A;  4RGS A;  4JX5 A;  4WXH A;  4K2E A;  4P5O A;  4G6Q A;  1HW1 A;  4P9F A;  4F91 B;  3GTL J;  1GHC A;  1YE9 A;  2HQN A;  5ED4 A;  4HZF A;  1LFU P;  4XLA A;  5CPR B;  3EUK L;  3LFU A;  1BBY A;  2ZFW A;  5M3M J;  1K79 A;  2WB1 N;  1H9T A;  2QGU A;  2NNN A;  2IT0 A;  3CUQ A;  4B1R A;  3TMO A;  5M3F J;  1HCR A;  4FCY A;  2J5P A;  1W5T A;  5E1X A;  3E1S A;  2LBF A;  2PMU A;  3CCV I;  4CUG A;  2YPR A;  2YR2 A;  3C18 A;  5D5U B;  3PQJ A;  4ENM A;  3PNT A;  3G71 I;  1TW2 A;  4BJT A;  3TW6 A;  2DTZ A;  3HHG A;  5C4J J;  1AKH B;  4U87 A;  1C0W A;  3E5Q A;  2QEX I;  3GVA A;  2R5Y A;  3D0S A;  3FIW A;  1K83 J;  4M6X A;  1UEL B;  4G6T B;  3IV5 A;  1P9Q C;  1FTZ A;  4DNC A;  3TP3 A;  2ZFU A;  2X51 A;  3RTR A;  3RYR A;  3W2A A;  1VZ0 A;  1EH6 A;  3HOS A;  1P6R A;  1IAW A;  2QF7 A;  2I5U A;  4FAS D;  3QRF F;  2P6S A;  2O5R A;  5IYB J;  4RA2 A;  4U0W A;  2XF7 A;  2DAO A;  2DW4 A;  2MSY A;  2X9D A;  2NYX A;  2XKP A;  1Q1H A;  4KT5 C;  4A0Y A;  4I2O A;  3D1N I;  4AUX A;  2ZJP F;  6PAX A;  4BEH B;  3Q3S A;  4IJA A;  3DF8 A;  4DZP A;  2FA5 A;  2L3D A;  1GV5 A;  4MQV A;  4ZH4 F;  4LB5 A;  1QVU A;  5CQG A;  2RN7 A;  3CQZ J;  3OV8 A;  3CCR I;  2BYV E;  1EF4 A;  1G3W A;  5ILV A;  2VQL A;  3ABU A;  1DPU A;  1SMT A;  5HLT A;  1R36 A;  4XLF A;  2UUZ A;  3MKY B;  1T6S A;  3BG5 A;  2QM3 A;  3E7L A;  3IAS 2;  2OTL I;  2W1O A;  1MZB A;  1TW3 A;  3DWL E;  2WAE A;  2V9P A;  1FBQ A;  4D7N A;  4IXA A;  3ABK H;  2JSP A;  4M3F A;  5FRN A;  3KLO A;  4L18 B;  1XCV A;  3EUH A;  5FLX Z;  2O03 A;  1LDJ A;  1U9O A;  2ZME B;  2BZT A;  4JK1 X;  2NRA C;  2CW7 A;  3QPL A;  2JQ7 A;  2DA3 A;  2XGE A;  3WGH A;  1FBU A;  2K02 A;  2FU4 A;  3KZY A;  2VJ4 A;  3HPH A;  1SFE A;  1X1C A;  3KP2 A;  4N4N B;  1Y1V J;  2DFH A;  3I59 A;  5L3E A;  4P96 A;  2JUG A;  4M71 A;  4ZDP A;  1A6I A;  4I0B A;  1I1S A;  3BCB A;  2DPD A;  2Y0S A;  4A3D J;  3REO A;  2VOO A;  2JPB A;  5BPD A;  2CYY A;  1MBK A;  3V7S A;  4E4H A;  4S04 A;  3CCQ I;  3JRI A;  3ZQL A;  2M5W A;  3SQN A;  4BQN A;  1EJ9 A;  1WH5 A;  3SZG A;  3KEY A;  2Y69 H;  1ZYR F;  3HJE A;  2V1X A;  5GPC A;  1RC9 A;  1P2F A;  2BOL A;  3NRV A;  3FDY A;  1NG7 A;  3E6D A;  3R6S A;  4GDF A;  2X1D A;  3J80 R;  2FNP A;  1ZEL A;  2K3F A;  2LKX A;  3JSO A;  4IOA F;  4M73 A;  4Y15 A;  2RAE A;  5F64 A;  1ZK8 A;  4HNU A;  2E71 A;  2F48 A;  3EQL F;  2MC3 A;  1R4M B;  1YOV B;  2D1V A;  2KQR A;  4EMS A;  3OY9 A;  2QQ9 A;  1XX5 A;  1XMA A;  3ISP A;  3PO2 J;  3CDH A;  1LE8 B;  1OLT A;  1V5E A;  4LIU A;  1OCO H;  4KIC A;  5LHG A;  4E7K A;  1S5L C;  1FYL A;  2VE9 A;  1BW6 A;  2HEO A;  2F5D A;  4HQM A;  4B44 A;  5IOZ A;  3FXL A;  4MLO A;  3B73 A;  4FE4 A;  2XKO A;  2O9L A;  2MA3 A;  4XOP A;  2RVC A;  3R4K A;  1FTT A;  3HEF A;  1MBH A;  4IHT A;  3RYP A;  1BIA A;  4ETS A;  1HXD A;  1YLF A;  1ZG1 A;  2MGQ A;  1IXR C;  4NBQ A;  1R9T J;  1VQ9 I;  2FMY A;  3O3K A;  3QYE A;  2XB5 A;  3H35 A;  3QPT A;  1QQI A;  1ZRF A;  1ZGW A;  4A3B J;  2VQC A;  3H92 A;  2IS4 A;  1FPQ A;  4PGG A;  1BOB A;  1BA5 A;  2XAU A;  2VPR A;  3F22 A;  3U1K A;  2L02 A;  2Y0M A;  3ZOB A;  2VLA A;  1T08 B;  1OCR H;  3L9F A;  2NS0 A;  2X6Y A;  2ZC2 A;  2ELH A;  2LKS A;  1X2N A;  4PK4 A;  2KIU A;  3OYA A;  4MHG A;  3BTJ A;  4XLN F;  3Q0W A;  2LNB A;  2EZI A;  4BY7 J;  2PX9 A;  3LST A;  5J1R A;  5FB2 A;  2DK8 A;  2WY8 Q;  3BR6 A;  2P0W A;  5DCF A;  4Q4Z F;  3M4O J;  4BBS J;  2K27 A;  3LA3 A;  3U21 A;  5CKT A;  1K6O A;  1PVE A;  1X1B A;  4BJ6 C;  1ZN2 A;  5E3L A;  4EVI A;  1IRZ A;  5DM6 F;  2IGO A;  2B9S A;  1FYK A;  4KJZ A;  1PUE E;  1F4K A;  1R71 A;  5EJC A;  1HDD C;  4HG2 A;  4X0G A;  2JA5 J;  5E20 A;  2QEN A;  2MYS A;  4NC7 A;  4UV9 A;  4ON0 A;  1U8B A;  2J5O A;  1KZH A;  5E17 F;  3M8J A;  4B48 A;  3GFI A;  1QRY A;  2BW3 B;  5FKL A;  1T8I A;  2CG4 A;  4V2G A;  2M30 A;  1LQ1 A;  4LB6 B;  3CCY A;  2VBW A;  4IF4 A;  4IQ4 A;  1P4A A;  3RI4 A;  4F3Q A;  2DOE A;  2KDZ A;  1G6N A;  2K40 A;  3HRT A;  2GLO A;  1R5I D;  1RKW A;  5C4X J;  2XAF A;  2B7E A;  4HRI A;  1U78 A;  2ME0 A;  2VN2 A;  2QSG X;  1QO0 D;  2PJP A;  4RAF A;  1LFB A;  1J75 A;  1FLI A;  3WU2 C;  2W7N A;  3OYF A;  4HF0 A;  2WAD A;  1ETY A;  1KU9 A;  3FHN A;  2XAS A;  3OYK A;  3LQQ A;  5IT9 R;  5F6F A;  3QAH A;  2DXI A;  3W6K B;  3A0H C;  2Z2S B;  4FTH A;  4CGZ A;  1FMV A;  3VSL A;  3VOE A;  2X4H A;  1OMI A;  4KIT B;  3W2W A;  3FXU A;  4O5V A;  1VFC A;  3F72 A;  3WTT C;  4YFX F;  5FKO A;  1XC5 A;  1D0Z A;  4HX4 A;  2OAZ A;  3DTK A;  3H9J A;  3GTM J;  4AVZ A;  5FD6 A;  3JRA A;  1B6A A;  3LAJ A;  3QPH A;  4KN7 X;  2GXG A;  3HTS B;  1S3J A;  1K78 B;  2IW5 A;  4E7J A;  1KQ9 A;  2K85 A;  1N75 A;  2CGP A;  2DDA A;  1FY7 A;  2M7B A;  3ZXS A;  3F3X A;  1Z05 A;  3BDD A;  1BC8 C;  2H27 A;  4OU0 A;  2V4J C;  2KIS A;  1IDY A;  2NVY J;  4L9T A;  3IL2 A;  2G9W A;  1B1B A;  3HRM A;  2Z3Y A;  4G12 A;  2HGC A;  1YX3 A;  2EFN A;  1FMW A;  2K4B A;  1D0X A;  3PQK A;  1IG7 A;  1Z3Y A;  1ZKG A;  2FBH A;  4OMZ A;  5E1Z B;  4HW0 A;  4G7O F;  1R5G A;  1ENH A;  1NK3 P;  2XAQ A;  4XRS A;  4MEY F;  4A3E J;  1BOA A;  1I5Z A;  2EIJ H;  3M9A A;  2L2O A;  2M4G A;  4QPQ A;  2NXN B;  2HPI A;  4HA8 A;  3ZQ7 A;  2QBY B;  3N05 A;  2PFB A;  2CV0 A;  3TO7 A;  4CYC B;  3GTK J;  4L5E A;  3K4N A;  3K4L A;  3X2Q H;  1IV6 A;  1E2X A;  3B6A A;  5CVJ A;  1EKE A;  2NS8 A;  3CJT B;  3A1Y A;  3E5X A;  2GWR A;  4XLC A;  5EYR A;  5GAH J;  2QSF X;  3A01 B;  3TDU C;  3HOU J;  3SEZ A;  3KP4 A;  4KMU X;  1N78 A;  5D6F A;  5HLI A;  4HNV A;  1RIO H;  2ESH A;  3CMY A;  4RAZ A;  1J59 A;  4XLP F;  5KAI C;  5D5X B;  1TTY A;  1R7J A;  2NVT J;  3WTY C;  2O3F A;  5BQT A;  1Z3X A;  4KN4 X;  3GWZ A;  4II3 A;  3ZCO A;  4MTE A;  3AAF A;  5JR3 A;  2FQ4 A;  1FSE A;  1B8I A;  2BXY A;  2EZH A;  4GXO A;  3RZD J;  2CV2 A;  3ZR8 X;  1XMK A;  1DDN A;  1MMD A;  1DGR M;  3BRO A;  3N4M A;  1YFH A;  1CF7 A;  3UNG C;  1MDM B;  1BI2 A;  3Q0V A;  1XG1 A;  3G6E I;  2NVQ J;  2EV6 A;  5J1U A;  1Z6T A;  3GZ6 A;  2JJ7 A;  1JXS A;  3BC8 A;  1JJ8 C;  3OS0 A;  1UJ8 A;  4UY8 I;  1DP7 P;  4XKB A;  1OCC H;  2Y75 A;  1MGT A;  2TCT A;  2EFQ A;  1LEB A;  4KIF A;  4R1H A;  2DOA A;  3F8C A;  4I01 A;  1TT0 A;  2ECB A;  1FJL A;  2DA1 A;  2L4M A;  5J4Y A;  1A35 A;  4LD5 A;  1WJE A;  1ERD A;  1HA8 A;  2VL8 A;  3AG4 H;  2K86 A;  3OYG A;  4AYB N;  1HST A;  3DTE A;  1XCB A;  1ULY A;  1Y8R B;  4RS8 A;  2IGM A;  1MSF C;  3K7A J;  1UHM A;  2DJN A;  2W82 A;  3GTP J;  2LDU A;  1WJD A;  3TGN A;  3CO7 C;  2CUF A;  5D5V B;  4J00 A;  1YIT I;  1JGS A;  2HTJ A;  3U2R A;  3QWL A;  4I98 B;  1QPI A;  4U0V A;  4UB6 C;  4RLF A;  3HOW J;  2CSO A;  2PN6 A;  3NQO A;  2HU9 A;  5F04 A;  3DBR B;  2VI6 A;  1ETO A;  5J3L A;  4AVP A;  2LYC A;  1HLV A;  1D1C A;  2DBB A;  5J6X A;  1TLH B;  4A2U A;  2YU3 A;  4XLE A;  4HV5 A;  4QTR A;  1GXP A;  4IRI A;  2M87 A;  2R7U A;  3CJR B;  1OJL A;  2A61 A;  3BR1 A;  4H0E A;  1VQM I;  1JTX A;  2M4K A;  1D0Y A;  2EV0 A;  2F4M B;  3OS2 A;  1T98 A;  1KA8 A;  2VBZ A;  1EH8 A;  2XRL A;  3CMM A;  1PYV A;  3HG9 A;  2JRM A;  2D1H A;  2Q1Z B;  3J7A O;  1H89 C;  1OYW A;  3SXY A;  2ZME C;  5K5O A;  3I71 A;  5HS9 A;  1LVA A;  3OSG A;  3E97 A;  3DKX A;  4HLY A;  3RKW A;  3SDB A;  2XAJ A;  2MH2 A;  4N0B A;  5HOO A;  3V42 A;  2CW8 A;  2JA7 J;  1L0O C;  2FRH A;  1O57 A;  1ETQ A;  2P7V B;  4RB0 A;  3OYE A;  1ON2 A;  3RDI A;  1MNE A;  2LKP A;  1Z77 A;  3LFK A;  4ZYE A;  3RZO J;  1WI3 A;  2E7X A;  3OR2 C;  4D1Q A;  1OKR A;  4UUV A;  4ANJ A;  1SVL A;  2FEZ A;  3BR5 A;  1SAX A;  3JTG A;  3DEE A;  3GME A;  1X1A A;  1VQK I;  5DM7 F;  1XGO A;  4YRV A;  1MH3 A;  3HKZ A;  1Z9C A;  1HDP A;  3QOD A;  1QA6 A;  1U9N A;  3KZI C;  2WWY A;  1WZ2 A;  1Z67 A;  3LMM A;  3HUG B;  4XON A;  1DU0 A;  3EYY A;  2K9M A;  4HEA 2;  2DQR A;  4LLG F;  2LD5 A;  3H3U A;  2JVG A;  2GIZ A;  2KL4 A;  3M7G A;  1F9N A;  2PLY A;  2TDX A;  4B09 A;  3RJP A;  2PJR A;  2PMZ N;  4BDY A;  3FXM A;  2CU7 A;  1JTY A;  2L01 A;  4M3D A;  3FIS A;  3T8R A;  4UHT A;  1W7P D;  4CO8 A;  4FIS A;  3BT9 A;  4EQQ A;  3TED A;  1IJW C;  1X19 A;  3R0A A;  2E1C A;  4KMF A;  4RM3 A;  2CFO A;  2MFZ A;  2LP0 A;  3K4K A;  3H1C A;  5FKK A;  2NNY A;  5FLV A;  3KZZ A;  3ASN H;  4PGH A;  2KMU A;  3ZQH A;  3I4M J;  2GAU A;  2XAG A;  2DFI A;  2PEX A;  2K9S A;  2HQA A;  1P4W A;  1O3S A;  2QUF A;  4LFU A;  2QSH X;  4UNO A;  3J80 K;  3FXR A;  1YO5 C;  2HDD A;  2FOW A;  2QCO A;  4G8X A;  3HSE A;  3VWB A;  1YX5 A;  4I6Z A;  5ILU A;  4HBL A;  1QZZ A;  4BXF A;  2KLO A;  4QWQ A;  2A69 F;  4Y33 A;  1XPX A;  3D5L A;  1B9M A;  4HPQ A;  3FK7 A;  3OOP A;  5JHU A;  2O6G E;  3CLQ A;  3SZP A;  4Y13 A;  2RKH A;  3AG1 H;  3V8J A;  2AQE A;  2K9L A;  1SFU A;  1OPC A;  3H5R A;  5F1R A;  2BXZ A;  3D5R C;  1HC8 A;  1S29 A;  2XGD A;  3OYI A;  5KNL A;  4IQJ A;  2XF5 A;  1ZQ3 P;  5JVG F;  3I9V 2;  1TWC J;  3HSR A;  3ASO H;  1FZP B;  4EJO A;  1FOK A;  3R61 A;  3ZMT A;  1KU3 A;  1O7L A;  3A4C A;  3W2V A;  4BE2 A;  1JKP C;  3TO6 A;  1LE8 A;  2HYF A;  2K9N A;  4UVB A;  3IRR A;  3G4S I;  4LK1 F;  3NAU A;  1TC3 C;  4B43 A;  5KHD A;  1VQ8 I;  2R5Z B;  2L54 A;  4JP0 A;  2X48 A;  1CGP A;  1G3T A;  2QZ8 A;  2Z99 A;  3MD2 A;  5GAE J;  4WF2 A;  3PNV A;  2FE3 A;  1UCR A;  3ONQ A;  1DP3 A;  1ETK A;  3ZQQ A;  2ZXJ A;  1B59 A;  4X6A J;  1R00 A;  1RES A;  3C1D A;  2DCE A;  4PJ0 C;  2E1N A;  3K69 A;  4A3M J;  1P4X A;  3CUO A;  2IS1 A;  4MFD A;  2Q2E B;  2W24 A;  2CUZ A;  3O2P E;  3RIR A;  4ENK A;  2E34 A;  1A04 A;  4KT6 A;  4O6J A;  2JA2 A;  3K2Z A;  2BY3 A;  2F4O B;  3PO3 J;  2BY2 A;  2STT A;  4XOT A;  2L7Z A;  3O6B B;  1J09 A;  2UZK A;  3V7R A;  1XTA A;  2LOO A;  3CCM I;  4MGR A;  3P9I A;  4V19 K;  3HOX J;  4XRS G;  4LGW A;  3OYM A;  4IRH A;  2ELK A;  4BL0 B;  2IS6 A;  3F9K A;  2GBY A;  4ZYG A;  1U6G A;  4BDZ A;  1PUF B;  1RR8 C;  5F0C A;  2HQR A;  4E7S A;  4CCM A;  3K6G A;  2M34 A;  1IO2 A;  1UG2 A;  2MLG A;  3HPG A;  3ZMS A;  3CF5 F;  4MEX F;  5DUI A;  2ZXI A;  1X3Z B;  2EZK A;  3F21 A;  1QU3 A;  1NK2 P;  1RUO A;  3FWE A;  3S8P A;  5D8L B;  4R79 A;  2D2W A;  2JK3 A;  3BZ6 A;  3FXK A;  4NQW B;  5M5W J;  4PJJ A;  1J2X A;  1O3Q A;  1N77 A;  1OR7 C;  1LB2 A;  2JN6 A;  4F52 A;  2VPL A;  3QYB A;  4CXF A;  4BE1 A;  1GUU A;  1LVK A;  2A68 F;  1S9H A;  2PI0 A;  2VIX A;  1ZLJ A;  1K7A A;  4ESB A;  3JRH A;  3ZQI A;  2DMP A;  1R6R A;  3EUH C;  4C9Y A;  1F5T A;  2A05 A;  1VQL I;  5IT9 K;  3OYJ A;  3D5S C;  3F0C A;  3JRE A;  1VQ6 I;  2P0T A;  4XOR A;  1R1V A;  2XAH A;  1B4A A;  3HSF A;  2Z16 A;  1OCP A;  2BVM A;  4M3B A;  2RGV A;  3EUA A;  4PSX A;  4IHX A;  4AD9 A;  3ERE D;  1IRF A;  1S6L A;  1TNT A;  2OJE D;  3ZMU A;  2R3S A;  3SHF A;  1ZRE A;  4QLC U;  2CWE A;  1B72 A;  3HL2 A;  2V6C A;  1JKQ C;  4HQE A;  4LK0 F;  4YEJ A;  4AWX B;  1MMG A;  4BGD A;  2JMW A;  5FGM A;  2E2H J;  4KDP A;  1AOY A;  3QU3 A;  3F8N A;  3CP2 A;  2Y31 A;  2DA4 A;  2ETH A;  1RKT A;  2B63 J;  3HXL A;  2BHY A;  3K1M A;  2ID3 A;  1F36 A;  3LSJ A;  4BY1 J;  2X0L A;  2KPM A;  5KAF C;  3GCM A;  3BQZ A;  1MKM A;  4HF1 A;  5LGU A;  1E3H A;  2OD5 A;  4EM0 B;  2F5E A;  3T1B A;  3IUO A;  5EF6 A;  1VQO I;  2JA6 J;  2OZ6 A;  2BVL A;  3OS1 A;  1IXC A;  5IP7 J;  3PIO F;  3O8H A;  5DD4 A;  2CQK A;  4LLN A;  1WJC A;  3DP7 A;  3TBI A;  2E5N A;  5IY5 H;  5F27 A;  3IP4 B;  2DMT A;  2X85 A;  3G3Z A;  2FBK A;  1SD7 A;  3MKW B;  5LFA A;  3ZRG A;  2HOT A;  3LA2 A;  3MZY A;  5GTI C;  2R0Q C;  5ILS A;  5BOX A;  2VOP A;  3CC2 I;  4L9V A;  1MBE A;  4CYD A;  3OIO A;  4MIM A;  3ELK A;  1U5T B;  2QQ8 A;  3GX4 X;  1Z1D A;  3NWT A;  3L2W A;  1NHA A;  1J9I A;  3DPT A;  3PUF A;  5D5W B;  3BCA A;  1Z7L A;  2V9K A;  3MKZ A;  2OA4 A;  4IHY A;  4ZTF A;  3L2V A;  3GLL A;  3NAR A;  3S1R J;  4QSH A;  3UKG A;  2HDW A;  2YX4 A;  3S1M J;  2OCC H;  3A52 A;  3DKW A;  4KNY A;  1WWX A;  1VF9 A;  5EEG A;  2O8X A;  1Y0U A;  3R60 A;  5DDG A;  1SVO A;  4DYC A;  1IRX A;  3DU5 A;  4G7H F;  1T56 A;  3C2H A;  3CTA A;  1RRJ A;  1W5S A;  2W85 A;  5KVR A;  4OIO F;  4Y4R A;  1HW5 A;  5DD8 A;  4IZZ A;  4XL9 A;  2LMD A;  3KP6 A;  3WTX C;  4OIP F;  2FSW A;  5BMZ A;  2GOM A;  5GAD J;  1S8N A;  1FYM A;  2R7V A;  3E3V A;  3K1P A;  2DDB A;  3AG3 H;  1SFK A;  1YW7 A;  4C2T A;  2Y48 A;  4IHV A;  4ENJ A;  5DYM A;  3BOQ A;  1I3A A;  3CO6 C;  1LFP A;  3NEU A;  5EEA A;  2R92 J;  3SDG A;  3F6O A;  4BAY A;  4PFO A;  5DUK A;  3AG2 H;  2ICW G;  3AL0 C;  3K4M A;  2CUJ A;  4AIH A;  2Y0S N;  3GXO A;  1P7J A;  2IP2 A;  4FET A;  1HKT A;  1ACI A;  2Q0O A;  4Z2Y A;  1I6H J;  2X6X A;  4L5J A;  5BS6 A;  3LA7 A;  3JSP A;  2ZBK A;  1D8K A;  1JE8 A;  3JW4 A;  1IN7 A;  4M72 A;  2JWT A;  4HX7 A;  4XRF A;  5E79 C;  2IS2 A;  4MTD A;  1G8X A;  2BE5 F;  2E1O A;  1NH3 A;  5HOD A;  2A07 F;  3FKJ A;  2DOD A;  1OFC X;  2Y2Z A;  4DYQ A;  2CRG A;  1ZG3 A;  1R1U A;  4G94 A;  5DEQ A;  4OIR F;  4YIR X;  5HVQ C;  4L0Z B;  1IC8 A;  1APL C;  1IGN A;  2DA2 A;  2P6T A;  5DS9 A;  3F8F A;  1FBS A;  4WCG A;  1ZG5 A;  1MW7 A;  2NAZ A;  1XN7 A;  2RQQ A;  4ZC3 A;  1XSV A;  2KIM A;  2EFP A;  2XUB A;  3K1N A;  1PDN C;  1TQP A;  3K4C A;  2EBI A;  2OU2 A;  4ESF A;  1WPK A;  2LSO A;  2UXN A;  3CUQ B;  4GGG A;  2ZNY A;  1D5V A;  1I6X A;  3KIO A;  1YIO A;  5EZH A;  3H36 A;  4DW6 A;  1ZAO A;  4GCV A;  2PG4 A;  2JA8 J;  2JVH A;  3OYH A;  2LBF B;  4E70 A;  1G2H A;  1FX7 A;  3RPU A;  3S16 J;  3C2G A;  3QYF A;  1X3U A;  3VEP A;  1YJN I;  2BGC A;  2N8G A;  1PJR A;  2A3S A;  3ZP5 A;  4RM2 A;  4BHC A;  1RUN A;  4NUB A;  1BI3 A;  3J80 Z;  1TL8 A;  2DQL A;  5EGO B;  2R5Y B;  3NWS A;  5E18 F;  1TWH J;  1VQ4 I;  4HX8 A;  3JR9 A;  5KCM A;  3HHH A;  3WU1 B;  2M35 A;  1RZ4 A;  1WVR A;  3I55 I;  2ISY A;  2LY2 A;  3IKV A;  3LSR A;  1A31 A;  3S2D J;  3K4J A;  3ULQ B;  4Y17 A;  2KZG A;  3DFG A;  4XKW A;  3PJR A;  5EG0 B;  1R23 A;  2AO9 A;  1SD5 A;  2EZL A;  1QZY A;  1E3O C;  4NDL A;  4W1U A;  2DTR A;  2L7M P;  1D8J A;  5ERI A;  5K7H A;  3QU6 A;  5FFZ A;  1QGP A;  1EH7 A;  3IWF A;  1JHH A;  3HM5 A;  3OYB A;  3AKZ A;  1AWC A;  2JTV A;  3VYT B;  3S93 A;  1OQY A;  2OTJ I;  3PFY A;  3GZN B;  4A3L J;  4PDK A;  2DA6 A;  2KFD A;  5DCM A;  4EJW A;  3HOV J;  2ZKZ A;  1GT0 C;  4FE7 A;  2O0Y A;  2Y9Z A;  2WAQ A;  3A0B C;  4GFB A;  4EAT A;  1V4R A;  3TOA A;  4CDG A;  2E19 A;  3L2Q A;  3KX2 A;  2FML A;  1YRN A;  2MW8 A;  3L2C A;  1W5C C;  2KJC A;  4WXC A;  2OQG A;  2P7C B;  3BJ6 A;  4E6K G;  3CP8 A;  3I59 B;  1G59 A;  1MMN A;  3FMS A;  5IYD J;  2Z33 A;  1U0J A;  3G73 A;  4II2 A;  4V2F A;  3H0G J;  2H6B A;  1T0F C;  1TNS A;  1MJ9 A;  3KP3 A;  3M8F A;  3Q9S A;  2XPW A;  1FP2 A;  1Z6R A;  2EIN H;  2XHK A;  5EEH A;  4XLH A;  1JI8 A;  2E36 A;  4CA0 A;  2QLZ A;  2XGC A;  3OYN A;  2HWV A;  5J40 A;  1E0E A;  3LSG A;  3DPU A;  3ZN1 A;  3PIP F;  2JT1 A;  4U7B A;  3FK6 A;  2R7R A;  2RNJ A;  4EJU A;  1SAU A;  2DT5 A;  4GYI A;  2KDO A;  2VKD A;  2NVU B;  5ICE A;  1MJB A;  5A2Q R;  2ZB9 A;  4KFC A;  3AFH A;  4BAC A;  4LIV A;  3FMQ A;  3O8G A;  4ZYH A;  3VYS B;  1A5J A;  1JKR C;  4XQF A;  2MD0 A;  3K2A A;  5JLW A;  1IUY A;  2VXZ A;  3OIQ A;  1HQC A;  2M9H A;  1AU7 A;  3IKT A;  1IN4 A;  3CES A;  3BQY A;  2QA4 I;  5FD5 A;  4A5N A;  1E17 A;  2GM4 A;  3S32 A;  4DZJ A;  3K4B A;  4RB3 C;  3S3M A;  1IF1 A;  5TJJ A;  4IO9 F;  1SVM A;  5IT9 Z;  1T2K A;  4WX9 A;  2HVS A;  4LG0 A;  2O7O A;  1TQM A;  2RV8 A;  1D5Y A;  1ZRD A;  4IOC F;  1BR2 A;  4M3E A;  1KQ8 A;  3J7Z I;  3GYH X;  2BY0 A;  5CYV A;  3FMR A;  3TKY A;  4CCK A;  2AQF A;  4L9N A;  4BS9 A;  2GA2 A;  3I64 A;  4D0P A;  4ZTJ A;  1VQ7 I;  1XGN A;  1BN5 A;  4AIJ A;  3HOY J;  3H3Z A;  3IWZ A;  3FZV A;  3HB9 A;  4EV0 A;  3FM5 A;  2CJJ A;  2H8W A;  3WE2 A;  1VQP I;  4LG3 A;  2E2J J;  3QOE A;  1WJB A;  1QZE A;  3T0Y A;  2QVO A;  1DU6 A;  4CCO A;  1Y6I A;  4RMN A;  3DQV C;  5LHH A;  2P5V A;  5IPA A;  1REP C;  2YX7 A;  1I3Q J;  2CMP A;  2VB6 A;  4CHU A;  1W7P B;  1LDD A;  2LRD A;  4FHT A;  4UUT A;  3EPZ A;  3M07 A;  5GAG J;  1T33 A;  2L0K A;  1GV2 A;  2M8G X;  2V9V A;  1H8A C;  4BU2 A;  1H0M A;  1HOM A;  3RKQ A;  3MWM A;  2GA1 A;  1X3W B;  3JAM R;  2DI3 A;  1J0R A;  5C3E J;  3CCJ I;  1PUF A;  1YQA A;  1SFO J;  1S7E A;  3GUD A;  5E3N A;  5LRS A;  3AL0 B;  4PSW A;  1QNT A;  3M1C A;  1DQU A;  3H3V K;  2XDV A;  3GEZ A;  4CSW A;  2HQ5 A;  4E7L A;  1F43 A;  2IJL A;  1OCZ H;  3ERM A;  4XKV A;  3HYI A;  1XGM A;  4BE0 A;  5GPA A;  5AIQ A;  4XN0 A;  1BR1 A;  4NQW A;  1AKH A;  2EIK H;  3FXJ A;  5IYC J;  1DPR A;  5TRD A;  2EA2 A;  2XB0 X;  3F23 A;  1Z91 A;  3QOP A;  1WI9 A;  4HNT A;  3JRB A;  2STW A;  1QHH D;  1QHG A;  3I5U A;  2OV7 A;  2W57 A;  2EIL H;  2V1N A;  4DIQ A;  1HKQ A;  2R7D A;  2FXA A;  3V8K A;  3SFZ A;  2ID6 A;  4A69 C;  2HDC A;  2WY7 Q;  1MND A;  2H94 A;  2K3P A;  1SAN A;  4UUS B;  2IGN A;  2FBI A;  3DEW A;  4D5F A;  4XN3 A;  2H6C A;  4DYR A;  1U5T C;  4BEH A;  3S3N A;  1OIS A;  4RB2 C;  2Z9O A;  5L3G A;  1Q1V A;  4ZDO A;  4B47 A;  5ICF A;  4C2U A;  2OBP A;  4XID A;  3ZPL A;  1XDU A;  3BG9 A;  2KP6 A;  3FXO A;  3ML6 A;  3WE3 A;  1FC3 A;  1U3E M;  2W84 A;  4DJA A;  1O3T A;  1JJ6 C;  4P1W A;  3CC7 I;  3I56 I;  2A6T A;  4KIB A;  2DK5 A;  4CCJ A;  4YIF A;  3RPQ A;  2EH3 A;  2VT2 A;  3Q9V A;  1SEU A;  1NG6 A;  3JRG A;  4TV7 A;  2L7F P;  4FX4 A;  2ZME A;  4A5M A;  1V3F A;  2VKH A;  2UXX A;  3GBG A;  1ZHF A;  3LSM A;  3CME I;  2CQX A;  1D1A A;  1OCT C;  4AM3 A;  2VON A;  1EA3 A;  4QIW N;  1SFX A;  1YYV A;  1SC7 A;  4ESJ A;  1BI1 A;  2LK2 A;  2DPU A;  5F0F A;  3J81 R;  1VI0 A;  3BR3 A;  4DBQ A;  1FNN A;  2ECC A;  2XIG A;  3HGG A;  4HAM A;  2G7U A;  2Q8K A;  3I0T A;  5GTH C;  2FNA A;  3CCL I;  3S14 J;  1X4P A;  1HKS A;  5J4V A;  1R22 A;  3RKY A;  3HKZ N;  2ZSH B;  3M8E A;  3KPH A;  1HW2 A;  3CCS I;  3LAP A;  4LMY A;  4I09 A;  1YHQ I;  1Y8Q B;  2VJJ A;  3FBI B;  2GQQ A;  2HS5 A;  3OR1 C;  1TQI A;  2ESN A;  4I76 A;  4YFK F;  3KET A;  2EFW A;  3WOD F;  2DYR H;  4C3I J;  3IH2 A;  3E5U A;  1K4S A;  2CS3 A;  2RRE A;  2I8D A;  3A02 A;  3OIP A;  3ZN0 A;  4P55 A;  2ZCW A;  2WTE A;  1WJ5 A;  4BH9 A;  2HYJ A;  4RGR A;  2DO7 A;  4S0H B;  4AIK A;  4L9J A;  2LH9 A;  2QWW A;  1BJZ A;  3LQR A;  3QP5 A;  1RET A;  2WB1 A;  1XGS A;  1QBJ A;  3N97 A;  2KZV A;  3MQ0 A;  1LUJ B;  4I7H A;  1HF0 A;  1B8I B;  1UHS A;  3WHC A;  3LOC A;  1Y56 A;  2NVX J;  2BHZ A;  1WHU A;  3CUQ C;  4PCQ A;  1W36 D;  4FX0 A;  2DJI A;  1CF7 B;  5FJ8 J;  2DT6 A;  1Z21 A;  3JCU C;  1JGG A;  2H8R A;  1Z7U A;  2XPU A;  3JTH A;  4AID A;  2M0M A;  4JBA A;  4ZZL A;  2GXA A;  1KON A;  2FOK A;  2MAB A;  2R7Z J;  2WBM A;  2R4G A;  3DKY A;  4RDU A;  2VQH A;  3PM1 A;  4G7Z F;  1YS7 A;  1H88 C;  1MMS A;  5FLX R;  1TBX A;  3KEQ A;  5K7Z A;  2EJR A;  3WU0 A;  3SZT A;  1WKM A;  4IHS A;  4NHJ A;  2JSC A;  2YS9 A;  4PZJ A;  4PUS A;  5D6E A;  5JLX A;  4ASN A;  3GZ5 A;  4YII A;  3DLL F;  2EK5 A;  2IA2 A;  4BHP A;  4BJ5 C;  5LD2 C;  4D9J A;  4J19 A;  3U9G A;  4ZYA A;  1HBX G;  1I1G A;  4OAY A;  3VPR A;  4LLL A;  3T5X A;  2OUM A;  2CO5 A;  2W00 A;  1ONV A;  2DOF A;  4A3C J;  5L3C A;  1FEX A;  2A5W A;  5HDK A;  3TP0 A;  2V26 A;  2DYS H;  5FKM A;  3T8T A;  1FT9 A;  2VKE A;  3LNQ A;  3GTQ J;  2CQN A;  2RC4 A;  3ZMD A;  4LJZ F;  2VBX A;  2ELJ A;  1BR4 A;  1TZL A;  3HDD A;  3MN2 A;  3OMY A;  4O3M A;  2EWN A;  5AIP A;  1OYY A;  3RQ4 A;  3ECH A;  1BI0 A;  1FIP A;  2BW3 A;  5L3D A;  2HKX A;  3Q0U A;  2E2I J;  3J7A W;  1YW8 A;  3DCF A;  3JRC A;  3GW2 A;  2MH9 A;  2MZ4 A;  2CQ7 A;  1KU7 A;  1QVT A;  3P9K A;  3TDZ C;  2M8E A;  4X1E A;  3J81 Z;  2R7O A;  4D5C A;  1U2W A;  2X6W A;  1SD4 A;  1BC7 C;  5CLS A;  5H6R A;  4ZYD A;  5E3M A;  5F1J A;  2HVQ A;  3K70 D;  1FP1 D;  4ZJZ A;  1KGS A;  4FT8 A;  3GTG J;  1UMQ A;  3E6B A;  4A3G J;  4M6Y A;  4JX6 A;  3BR2 A;  5EGO A;  2JRT A;  2ZXW H;  2DU9 A;  4IHW A;  2Z1D A;  3H0D A;  3MMY B;  3WTV C;  3I4P A;  2GXB A;  1I50 J;  2LY1 A;  5ICC A;  5JFR A;  1W4M A;  1UAA A;  4UB8 C;  1J7K A;  3ABT A;  4L5I A;  1XSX A;  4ABZ A;  2E1M C;  1IN6 A;  1GDT A;  3FXQ A;  1R4N B;  3DTI A;  4XIC A;  3I4N J;  4BQQ A;  4EJT A;  1TWG J;  1E3P A;  4DOZ A;  5IP6 A;  2JZY A;  4BYY A;  2HKO A;  5EG0 A;  4UVA A;  2IA0 A;  2A5Y B;  2R7X A;  5CVI A;  5L3F A;  4A3K J; 
#chains in the Genus database with same CATH homology
 2KJB A;  4XSX F;  1SD6 A;  1IN5 A;  1K78 A;  5CVR A;  5D8K B;  3I54 A;  1OR7 A;  3ECO A;  2P8T A;  5DV5 A;  4XBF A;  2HTS A;  1RNL A;  1KQ0 A;  5LEK A;  3PFI A;  3P9C A;  3WTW C;  3FF5 A;  4RB1 A;  2IA1 A;  1XDS A;  2F2E A;  3FM3 A;  2ADU A;  2K4J A;  4M74 A;  1ZGJ A;  1IRG A;  4CZZ A;  4KUM A;  2QBY A;  2OZU A;  3W6J B;  3WGG A;  3FX3 A;  1ZRC A;  5E8I A;  1G4D A;  5A2Q K;  2XRO A;  3ZMZ A;  1ZH5 A;  2QQB A;  3Q5F A;  4M9Z A;  2JPC A;  2MBF A;  1LDK B;  1LNW A;  1MJA A;  4CIC A;  3IC7 A;  4MNU A;  4S05 A;  1MDM A;  4GO1 A;  4XSZ F;  2GZW A;  2RDP A;  2L4A A;  3K0L A;  3MEX A;  2VC0 A;  3E6M A;  2ZNZ A;  2BV6 A;  5HDG A;  1T38 A;  2IPQ X;  3QP6 A;  3FHZ A;  5JVT A;  4R8H A;  1IN8 A;  1YTY A;  1WQ2 A;  4BXU A;  5CVU A;  2E7W A;  3KP5 A;  5E8G A;  4M9S A;  4U88 A;  4Q47 A;  1O7F A;  2QYO A;  1ZLK A;  1UST A;  2W25 A;  5CJ9 A;  3U1D A;  4EJV A;  1GVJ A;  4U7D A;  4U0Y A;  2M45 A;  2BEO A;  2LF8 A;  3JAM K;  3GFJ A;  2FQ3 A;  1W7P A;  2PMH A;  4HF2 A;  5H6Q A;  4A0X A;  1WSU A;  4EGY A;  4Q48 A;  1USS A;  1OYI A;  3M1E A;  1U8R A;  3KCC A;  1R1T A;  3BJA A;  2F5F A;  5FO5 A;  2FF4 A;  4UVC A;  1XB4 A;  1MD0 A;  4WWC A;  2COM A;  2O61 A;  4BQA A;  4OIQ F;  1LJ9 A;  4Q5S F;  1F1Z A;  3K9T A;  4RGU A;  1UB9 A;  1STZ A;  3V8L A;  5L3B A;  3IHU A;  2VE8 A;  4RGX A;  5J8F A;  2ZJ2 A;  3DPL C;  2ISZ A;  3WTS C;  3ZMV A;  3B02 A;  2PQ8 A;  2CW0 F;  2WC2 A;  2ACJ A;  3WTU C;  2MD5 A;  4RAY A;  3L00 A;  3TQN A;  5ICG A;  4M9X A;  3HRS A;  2V1U A;  3HUG A;  5HLH A;  2G7H A;  4G9Y A;  2GIV A;  3ROU A;  5HS8 A;  1R5H A;  4DQ2 A;  3BWG A;  2HR3 A;  1ON1 A;  3F6V A;  4HOB A;  2EV5 A;  2OQR A;  3C3W A;  2DLL A;  2Z5U A;  3BY6 A;  3J81 K;  4KIG A;  3BP8 A;  1SMY F;  2XVC A;  2XGX A;  3EDP A;  5LLQ A;  2F5C A;  4I02 A;  1YW9 A;  3KP7 A;  3I53 A;  2CFX A;  4BNC A;  2BBY A;  4N9I A;  5BPI A;  2VC1 A;  2P5L C;  3VOD A;  1H9G A;  1IZ1 A;  3WG9 A;  2VOD A;  3KLN A;  5LEJ A;  2AS5 F;  3DEU A;  4GYG A;  4WXD A;  1FWZ A;  3C7J A;  1RI7 A;  4ENN A;  5K5R A;  1DUX C;  2VT3 A;  5FFX A;  3HOT A;  5HDN A;  1ODD A;  3MFK A;  1BJA A;  3EET A;  5KK1 A;  3HRU A;  1XD7 A;  2LF7 A;  3MCZ A;  5LRR A;  5JI6 A;  2UWM A;  3BPX A;  5FLX K;  3HIF A;  1T0F A;  1B9N A;  4KYW A;  3WGI A;  5IT3 A;  1PP7 U;  1LEA A;  5LBQ A;  2EB7 A;  4F7Z A;  2QQA A;  3IRQ A;  5D4R A;  1ZAR A;  2Q2E A;  3DXJ F;  2R7F A;  4HYE A;  5LGN A;  1IXS B;  4HDU A;  4IPA A;  1I27 A;  4A6D A;  4YFN F;  4G6D A;  1GXQ A;  4EM2 A;  2AXL A;  2KIF A;  2HYG D;  1S7O A;  1HSJ A;  3GFM A;  4IVN A;  4N9H A;  5J8C A;  3KFW X;  3COA C;  2P4W A;  1YG2 A;  4EM1 A;  5H20 A;  3WTZ A;  4YG2 F;  3KEO A;  2PBI A;  4UV8 A;  2B0L A;  5LGT A;  1BM9 A;  4P9U A;  2EA4 A;  3R0J A;  2IRF G;  1KU2 A;  4BHB A;  5E1W A;  2MLK A;  1S7A A;  3L09 A;  2A6E F;  1XSD A;  1IW7 F;  5CVV A;  5A2Q Z;  4A0Z A;  3E6C C;  1UHW A;  2YSR A;  1O3R A;  3VB2 A;  3KE2 A;  2KKO A;  3LWF A;  2RQP A;  3F8M A;  2H09 A;  3TOB A;  1QPM A;  4NB5 A;  1JHF A;  1T39 A;  4MQ9 F;  2P5K A;  3GFL A;  1P92 A;  3DV8 A;  5K5Q A;  4L0Y B;  2A6H F;  1G3Y A;  4OOI A;  2HZT A;  4OMY A;  3GF2 A;  2V79 A;  4KA4 A;  2VBY A;  3MZH A;  2C6Y A;  2D45 A;  1PP8 F;  5DCM B;  3VFZ A;  3F8B A;  5K1Y A;  3RKX A;  5AON A;  2KRF A;  1UFM A;  4ZZD A;  1U5T A;  3I58 A;  4IRG A;  3JAM Z;  4EGZ A;  4WK8 F;  3GLX A;  3S2W A;  5HLG A;  4B8X A;  3BJO A;  4HV6 A;  3CJN A;  2IVM A;  4JQF A;  1R58 A;  2EFO A;  4I0A A;  1D3Y A;  2V1D A;  3BPV A;  5D4S A;  3V7C A;  2K7L A;  3HTU A;  4HLX A;  2XRN A;  2WV0 A;  2HFH A;  4OIN F;  5LHI A;  1YS6 A;  1J5Y A;  4A6E A;  4UXN A;  4A12 A;  1KYZ A;  1VTN C;  4LG0 B;  3V4G A;  1FSH A;  1BIB A;  3L7W A;  3MAJ A;  4HDV A;  1EV7 A;  2HOE A;  2M1B A;  1G3S A;  1L3L A;  2ZO4 A;  1WRJ A;  2XV4 S;  3EYI A;  1ZGA A;  3TO9 A;  5HS7 A;  3GO5 A;  3P7N A;  1KYW A;  4RGS A;  3CLO A;  4WXH A;  4K2E A;  4P5O A;  4G6Q A;  1HW1 A;  4P9F A;  1GHC A;  2HQN A;  5ED4 A;  4HZF A;  1BBY A;  2ZFW A;  1K79 A;  1H9T A;  2NNN A;  2IT0 A;  3CUQ A;  2J5P A;  1W5T A;  5E1X A;  2PMU A;  2YPR A;  2YR2 A;  3C18 A;  5D5U B;  3PQJ A;  4ENM A;  1TW2 A;  3HHG A;  1C0W A;  3E5Q A;  3GVA A;  3D0S A;  4M6X A;  4DNC A;  3RTR A;  3RYR A;  1EH6 A;  3HOS A;  1P6R A;  1IAW A;  3QRF F;  2P6S A;  4U0W A;  2DAO A;  2DW4 A;  2XKP A;  2NYX A;  1Q1H A;  4KT5 C;  4A0Y A;  4I2O A;  6PAX A;  4IJA A;  3DF8 A;  2FA5 A;  2L3D A;  4MQV A;  4ZH4 F;  4LB5 A;  2RN7 A;  3OV8 A;  2BYV E;  1G3W A;  5ILV A;  3ABU A;  1DPU A;  1SMT A;  1R36 A;  1T6S A;  2QM3 A;  1MZB A;  1TW3 A;  1FBQ A;  4IXA A;  3KLO A;  4L18 B;  1XCV A;  3EUH A;  5FLX Z;  2O03 A;  1LDJ A;  2ZME B;  4JK1 X;  2NRA C;  3WGH A;  1FBU A;  2K02 A;  2FU4 A;  3KZY A;  1SFE A;  3KP2 A;  3I59 A;  5L3E A;  4P96 A;  4M71 A;  4I0B A;  1I1S A;  2DPD A;  3REO A;  2VOO A;  2JPB A;  5BPD A;  2CYY A;  3V7S A;  4S04 A;  2M5W A;  3SQN A;  1ZYR F;  2V1X A;  1P2F A;  3NRV A;  3E6D A;  3R6S A;  2FNP A;  3JSO A;  4M73 A;  4Y15 A;  5F64 A;  3EQL F;  2MC3 A;  2D1V A;  4EMS A;  2QQ9 A;  1XMA A;  3ISP A;  3CDH A;  4KIC A;  5LHG A;  1FYL A;  2VE9 A;  2HEO A;  2F5D A;  4HQM A;  3B73 A;  2XKO A;  2MA3 A;  2RVC A;  3R4K A;  4IHT A;  3RYP A;  1BIA A;  4ETS A;  1HXD A;  1YLF A;  1ZG1 A;  1IXR C;  2FMY A;  3O3K A;  3QPT A;  1QQI A;  1ZRF A;  3H92 A;  1FPQ A;  4PGG A;  3F22 A;  2L02 A;  2Y0M A;  3L9F A;  2NS0 A;  2ELH A;  2KIU A;  4MHG A;  4XLN F;  2LNB A;  3LST A;  5FB2 A;  2DK8 A;  5DCF A;  4Q4Z F;  2K27 A;  3LA3 A;  1K6O A;  1ZN2 A;  4EVI A;  1FYK A;  1PUE E;  1F4K A;  5E20 A;  2QEN A;  4ON0 A;  4UV9 A;  2J5O A;  5E17 F;  3GFI A;  2CG4 A;  2M30 A;  1LQ1 A;  4LB6 B;  4IF4 A;  2VBW A;  1P4A A;  3RI4 A;  1G6N A;  3HRT A;  2XAF A;  1U78 A;  2VN2 A;  1QO0 D;  2PJP A;  1J75 A;  1FLI A;  4HF0 A;  1KU9 A;  2XAS A;  3LQQ A;  5F6F A;  3QAH A;  3W6K B;  4CGZ A;  3VOE A;  2X4H A;  1OMI A;  3FXU A;  4O5V A;  3F72 A;  3WTT C;  4YFX F;  4HX4 A;  2OAZ A;  5FD6 A;  1B6A A;  3LAJ A;  3QPH A;  4KN7 X;  2GXG A;  3HTS B;  1S3J A;  1K78 B;  2IW5 A;  1KQ9 A;  2CGP A;  1FY7 A;  3F3X A;  1Z05 A;  3BDD A;  1BC8 C;  2H27 A;  4OU0 A;  4L9T A;  3IL2 A;  2G9W A;  1B1B A;  3HRM A;  2Z3Y A;  2HGC A;  2EFN A;  2K4B A;  3PQK A;  2FBH A;  4OMZ A;  5E1Z B;  4HW0 A;  4G7O F;  1R5G A;  2XAQ A;  4MEY F;  1BOA A;  1I5Z A;  3M9A A;  4HA8 A;  3ZQ7 A;  2QBY B;  2PFB A;  3TO7 A;  1E2X A;  5CVJ A;  3E5X A;  2GWR A;  3TDU C;  3KP4 A;  4KMU X;  5D6F A;  5HLI A;  1RIO H;  2ESH A;  4RAZ A;  1J59 A;  4XLP F;  5D5X B;  1TTY A;  1R7J A;  3WTY C;  2O3F A;  5BQT A;  4KN4 X;  3GWZ A;  4MTE A;  3AAF A;  5JR3 A;  1FSE A;  4GXO A;  1XMK A;  1DDN A;  3BRO A;  3N4M A;  1YFH A;  1CF7 A;  1MDM B;  1BI2 A;  2EV6 A;  1Z6T A;  3GZ6 A;  1JXS A;  1DP7 P;  2Y75 A;  1MGT A;  2EFQ A;  1LEB A;  4KIF A;  4R1H A;  3F8C A;  4I01 A;  2L4M A;  4LD5 A;  2K86 A;  1HST A;  1XCB A;  1ULY A;  4RS8 A;  1UHM A;  2LDU A;  3TGN A;  3CO7 C;  5D5V B;  1JGS A;  2HTJ A;  3U2R A;  4I98 B;  4U0V A;  2CSO A;  2PN6 A;  3NQO A;  4AVP A;  2DBB A;  5J6X A;  1TLH B;  4A2U A;  2YU3 A;  4HV5 A;  1GXP A;  4IRI A;  2M87 A;  2A61 A;  4H0E A;  2EV0 A;  1T98 A;  1KA8 A;  2VBZ A;  1EH8 A;  2D1H A;  3J7A O;  1OYW A;  3SXY A;  5K5O A;  3I71 A;  5HS9 A;  1LVA A;  3E97 A;  4HLY A;  3RKW A;  2XAJ A;  2MH2 A;  4N0B A;  5HOO A;  1L0O C;  2FRH A;  1O57 A;  2P7V B;  4RB0 A;  1ON2 A;  3RDI A;  2LKP A;  3LFK A;  4ZYE A;  2E7X A;  1OKR A;  4UUV A;  2FEZ A;  1SAX A;  3JTG A;  1XGO A;  1Z9C A;  2WWY A;  3EYY A;  2DQR A;  4LLG F;  3H3U A;  3M7G A;  1F9N A;  2PLY A;  2TDX A;  4B09 A;  3RJP A;  2L01 A;  3T8R A;  4UHT A;  1W7P D;  4CO8 A;  4EQQ A;  3R0A A;  2E1C A;  4KMF A;  2NNY A;  3KZZ A;  4PGH A;  2GAU A;  2XAG A;  2DFI A;  2PEX A;  1P4W A;  1O3S A;  2QUF A;  4LFU A;  4UNO A;  3J80 K;  3FXR A;  1YO5 C;  4G8X A;  3HSE A;  5ILU A;  4HBL A;  1QZZ A;  4QWQ A;  2A69 F;  3D5L A;  1B9M A;  3OOP A;  5JHU A;  2O6G E;  3SZP A;  4Y13 A;  2RKH A;  3V8J A;  1SFU A;  1OPC A;  5F1R A;  1S29 A;  3HSR A;  1FZP B;  4EJO A;  1FOK A;  3R61 A;  3ZMT A;  1KU3 A;  1O7L A;  3TO6 A;  2HYF A;  4UVB A;  3IRR A;  4LK1 F;  2L54 A;  1CGP A;  1G3T A;  2QZ8 A;  2Z99 A;  4WF2 A;  2FE3 A;  1UCR A;  2ZXJ A;  1B59 A;  1R00 A;  3C1D A;  2E1N A;  3K69 A;  1P4X A;  3CUO A;  2W24 A;  3O2P E;  4ENK A;  3RIR A;  1A04 A;  4O6J A;  3K2Z A;  2STT A;  3O6B B;  2UZK A;  3V7R A;  4MGR A;  3P9I A;  4LGW A;  4IRH A;  4ZYG A;  1U6G A;  2HQR A;  4MEX F;  2MLG A;  3ZMS A;  5DUI A;  3F21 A;  1RUO A;  3FWE A;  5D8L B;  4R79 A;  2D2W A;  3BZ6 A;  1J2X A;  1O3Q A;  1LB2 A;  4CXF A;  2A68 F;  2PI0 A;  1ZLJ A;  1K7A A;  4ESB A;  1F5T A;  5IT9 K;  1R1V A;  2XAH A;  1B4A A;  3HSF A;  2RGV A;  4AD9 A;  3ERE D;  1IRF A;  1S6L A;  1TNT A;  3ZMU A;  2R3S A;  3SHF A;  1ZRE A;  4QLC U;  2CWE A;  2V6C A;  4HQE A;  4LK0 F;  4AWX B;  5FGM A;  4KDP A;  1AOY A;  3QU3 A;  3F8N A;  2ETH A;  3K1M A;  2X0L A;  1MKM A;  4HF1 A;  5LGU A;  2OD5 A;  4EM0 B;  2F5E A;  3T1B A;  2OZ6 A;  1IXC A;  5DD4 A;  2CQK A;  4LLN A;  3DP7 A;  3G3Z A;  2FBK A;  1SD7 A;  3LA2 A;  3MZY A;  5ILS A;  5BOX A;  2VOP A;  4L9V A;  4CYD A;  3ELK A;  1U5T B;  3GX4 X;  1Z1D A;  1NHA A;  1J9I A;  3DPT A;  5D5W B;  2OA4 A;  2YX4 A;  3DKW A;  4KNY A;  1WWX A;  5EEG A;  2O8X A;  1Y0U A;  3R60 A;  5DDG A;  4G7H F;  3CTA A;  1W5S A;  2W85 A;  5KVR A;  4OIO F;  1HW5 A;  5DD8 A;  3KP6 A;  3WTX C;  4OIP F;  2FSW A;  5BMZ A;  1S8N A;  1FYM A;  3E3V A;  3K1P A;  1YW7 A;  2Y48 A;  4ENJ A;  5DYM A;  3BOQ A;  3CO6 C;  3NEU A;  3F6O A;  4BAY A;  5DUK A;  4AIH A;  3GXO A;  2IP2 A;  1HKT A;  2Q0O A;  4Z2Y A;  4L5J A;  5BS6 A;  3LA7 A;  3JSP A;  2ZBK A;  1D8K A;  1JE8 A;  3JW4 A;  1IN7 A;  4M72 A;  4HX7 A;  4XRF A;  4MTD A;  2BE5 F;  2A07 F;  1ZG3 A;  1R1U A;  4G94 A;  5DEQ A;  4OIR F;  5HVQ C;  4L0Z B;  2P6T A;  3F8F A;  1FBS A;  4WCG A;  1ZG5 A;  2NAZ A;  1XN7 A;  1XSV A;  2KIM A;  2EFP A;  2XUB A;  3K1N A;  1PDN C;  1TQP A;  2OU2 A;  4ESF A;  2LSO A;  3CUQ B;  2UXN A;  4GGG A;  1D5V A;  2ZNY A;  1I6X A;  1YIO A;  4GCV A;  1ZAO A;  2PG4 A;  4E70 A;  1FX7 A;  3RPU A;  1X3U A;  3VEP A;  2BGC A;  3ZP5 A;  2A3S A;  4BHC A;  1RUN A;  1BI3 A;  3J80 Z;  2DQL A;  5E18 F;  4HX8 A;  3HHH A;  3WU1 B;  1RZ4 A;  2ISY A;  3IKV A;  3ULQ B;  4Y17 A;  3DFG A;  1R23 A;  1SD5 A;  1QZY A;  2DTR A;  1D8J A;  5ERI A;  3QU6 A;  5FFZ A;  1QGP A;  1EH7 A;  3IWF A;  1JHH A;  1AWC A;  2JTV A;  4PDK A;  5DCM A;  4EJW A;  2ZKZ A;  2O0Y A;  1V4R A;  3TOA A;  4CDG A;  2FML A;  3L2C A;  2KJC A;  4WXC A;  2OQG A;  2P7C B;  3BJ6 A;  3I59 B;  3FMS A;  2Z33 A;  3G73 A;  2H6B A;  1TNS A;  1MJ9 A;  3KP3 A;  3M8F A;  3Q9S A;  1FP2 A;  1Z6R A;  2XHK A;  5EEH A;  2QLZ A;  2HWV A;  3ZN1 A;  2JT1 A;  4U7B A;  2RNJ A;  4EJU A;  2DT5 A;  4GYI A;  5ICE A;  1MJB A;  4KFC A;  3FMQ A;  4ZYH A;  1IUY A;  2VXZ A;  1HQC A;  3IKT A;  1IN4 A;  5FD5 A;  4A5N A;  1E17 A;  4RB3 C;  1IF1 A;  5TJJ A;  5IT9 Z;  1T2K A;  4WX9 A;  4LG0 A;  1TQM A;  2RV8 A;  1ZRD A;  1KQ8 A;  3GYH X;  5CYV A;  3FMR A;  3TKY A;  4L9N A;  2GA2 A;  3I64 A;  4D0P A;  1XGN A;  1BN5 A;  4AIJ A;  3H3Z A;  3IWZ A;  3FZV A;  4EV0 A;  3FM5 A;  3WE2 A;  3T0Y A;  2QVO A;  3DQV C;  5LHH A;  2P5V A;  1REP C;  2YX7 A;  4CHU A;  1W7P B;  1LDD A;  4FHT A;  2V9V A;  1H0M A;  3MWM A;  2GA1 A;  2DI3 A;  1J0R A;  1YQA A;  3GUD A;  5LRS A;  1QNT A;  3GEZ A;  2IJL A;  3HYI A;  1XGM A;  5AIQ A;  4NQW A;  1DPR A;  5TRD A;  2EA2 A;  3F23 A;  1Z91 A;  3QOP A;  1WI9 A;  3I5U A;  2W57 A;  1HKQ A;  2R7D A;  2FXA A;  3V8K A;  3SFZ A;  2HDC A;  2H94 A;  2FBI A;  2H6C A;  1U5T C;  4RB2 C;  2Z9O A;  5L3G A;  5ICF A;  2OBP A;  3ZPL A;  1XDU A;  3ML6 A;  3WE3 A;  1FC3 A;  1U3E M;  2W84 A;  1O3T A;  4KIB A;  2DK5 A;  4YIF A;  3RPQ A;  2VT2 A;  3Q9V A;  4TV7 A;  4FX4 A;  2ZME A;  4A5M A;  1V3F A;  2UXX A;  1ZHF A;  2VON A;  1SFX A;  1YYV A;  4ESJ A;  1BI1 A;  2DPU A;  1FNN A;  2XIG A;  4HAM A;  2G7U A;  2Q8K A;  3I0T A;  2FNA A;  1HKS A;  1R22 A;  3RKY A;  3M8E A;  1HW2 A;  3LAP A;  4LMY A;  4I09 A;  2GQQ A;  2HS5 A;  1TQI A;  2ESN A;  4YFK F;  3KET A;  2EFW A;  3WOD F;  3E5U A;  3ZN0 A;  4P55 A;  2ZCW A;  2WTE A;  4BH9 A;  4RGR A;  2DO7 A;  4AIK A;  4L9J A;  2QWW A;  3LQR A;  3QP5 A;  1XGS A;  1QBJ A;  3N97 A;  3MQ0 A;  4I7H A;  3CUQ C;  4PCQ A;  4FX0 A;  1CF7 B;  1Z7U A;  3JTH A;  4JBA A;  4ZZL A;  2FOK A;  4G7Z F;  1YS7 A;  1TBX A;  3KEQ A;  4NHJ A;  3WU0 A;  2EJR A;  3SZT A;  1WKM A;  4IHS A;  2JSC A;  4PZJ A;  5D6E A;  4ASN A;  3GZ5 A;  4YII A;  2EK5 A;  2IA2 A;  4BHP A;  3U9G A;  1HBX G;  1I1G A;  4LLL A;  3T5X A;  2CO5 A;  1ONV A;  5L3C A;  5HDK A;  3T8T A;  1FT9 A;  2RC4 A;  3ZMD A;  4LJZ F;  2VBX A;  4O3M A;  2EWN A;  5AIP A;  1OYY A;  3ECH A;  1BI0 A;  5L3D A;  2HKX A;  1YW8 A;  3GW2 A;  2MH9 A;  1KU7 A;  3TDZ C;  3P9K A;  2M8E A;  3J81 Z;  1U2W A;  1SD4 A;  1BC7 C;  5CLS A;  5H6R A;  4ZYD A;  1FP1 D;  1KGS A;  4FT8 A;  3E6B A;  4M6Y A;  2JRT A;  2DU9 A;  3WTV C;  3I4P A;  2GXB A;  5ICC A;  5JFR A;  1W4M A;  1J7K A;  3ABT A;  4L5I A;  1XSX A;  1IN6 A;  3FXQ A;  4EJT A;  2JZY A;  4BYY A;  2HKO A;  4UVA A;  2IA0 A;  2A5Y B;  5CVI A;  5L3F A;  2STW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...