3R60A

Structure of the mntr fe2+ complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 51
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r60A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3r60A02
2G7HA 2O61A 1QNTA 4MGRA 1KQ0A 3FM3A 5DV5A 1QPMA 3HTUA 3GWZA 5J8FA 3GFLA 1K79A 3KFWX 1XGOA 1XGMA 2IA2A 4M6XA 2FA5A 2OAZA 4PGHA 3QOPA 5FFZA 1XMAA 2MD5A 3WTWC 4KIFA 1T2KA 3RPUA 1I6XA 3SZTA 2Z3YA 4XSZF 2Z9OA 2HGCA 1HKTA 2IPQX 3RTRA 2ZKZA 1RI7A 2XV4S 4LGWA 2NYXA 3QRFF 1FP1D 2UXNA 2ZMEA 4A6EA 2XROA 2W57A 5EEGA 1DUXC 2QM3A 3ULQB 1V3FA 2UWMA 2V6CA 1ODDA 3E5UA 4U0VA 2H27A 3LQQA 4GCVA 2YX4A 1DDNA 2KIMA 4CDGA 1IXRC 3T1BA 2V1DA 1U8RA 2PJPA 4LLGF 4IF4A 3WTYC 1ON2A 1R1TA 4L9VA 3HIFA 3WGIA 2IA1A 5L3GA 1T6SA 2XASA 1JHFA 5LEKA 2V79A 2DU9A 3K0LA 2HFHA 2DK8A 2FOKA 3TOAA 4A5MA 3WU0A 5HDGA 2EA2A 1LQ1A 1O7LA 4HQMA 2LSOA 4E70A 2XAHA 4EJVA 2EV0A 4O5VA 1U5TB 3ZN1A 5FLXZ 2P5LC 3I5UA 1R22A 4Y15A 3DKWA 4NQWA 5FLXK 1XB4A 2DFIA 1TTYA 3L2CA 3CTAA 2XAQA 2DI3A 4KICA 1ZRFA 4JQFA 2MBFA 3TGNA 5L3FA 1T98A 2VXZA 4TV7A 2NRAC 1YFHA 4AIKA 1HQCA 2FMLA 2ZO4A 1O7FA 3OOPA 1MDMB 1W7PA 3TKYA 3JSPA 2O03A 4L5JA 3TOBA 3H3ZA 3IWZA 5JFRA 3COAC 2LDUA 3BPVA 5EEHA 3QPTA 3L09A 2QQBA 3RKWA 1UB9A 3GEZA 4IRGA 4ENMA 4LD5A 5DD8A 3QU3A 1Z91A 4LMYA 1I1GA 3F8NA 1W4MA 2HDCA 1U78A 1REPC 2VT2A 1J9IA 2J5OA 5DUIA 2WV0A 2A69F 4IRHA 1EH7A 2H94A 5LGUA 1IAWA 2HKOA 1FSHA 3R6SA 4RB0A 2CFXA 3E6BA 5F1RA 1GHCA 5CVIA 4GYIA 2D1VA 3IRRA 4PGGA 3E5QA 2FBIA 3GZ6A 1B9NA 3GFJA 4MEXF 1Z6RA 1Z6TA 3E97A 1KYWA 1B1BA 1YO5C 5IT3A 2Z33A 1R5HA 3G73A 4YFKF 5E1WA 3LAPA 2P7CB 4LLLA 2LNBA 1SAXA 1F5TA 4ZZLA 1IN7A 1YG2A 2W24A 2K4BA 3FM5A 2MLKA 1ON1A 2KIFA 4HA8A 1HSTA 4OIPF 2DT5A 2EFWA 1OMIA 2Y48A 1W5TA 1Y0UA 5K5OA 2XAJA 2ELHA 2YR2A 5BQTA 1YTYA 4ZZDA 3F6VA 2A6HF 4HX4A 2ADUA 1I5ZA 5FFXA 4LJZF 1TW3A 2W25A 4WX9A 2A6EF 1HW5A 4MNUA 1G3SA 1BI0A 3HRMA 4KN4X 3IL2A 1AWCA 3ZPLA 5D4RA 2QYOA 5FB2A 4RAYA 1O3QA 5JR3A 4Q47A 3DF8A 1SD5A 1HW2A 4FX4A 2K02A 2QQAA 3K1MA 5FD5A 3BY6A 4XLNF 5IT9Z 5CYVA 4KNYA 2ZXJA 2MC3A 1FC3A 2P7VB 5AONA 4KFCA 4M9ZA 2VODA 1Z7UA 2ZMEB 3EUHA 4I7HA 3OV8A 2B0LA 4U0WA 1SD6A 3M9AA 1TQMA 3KEQA 3Q9SA 1TW2A 2IJLA 5K1YA 1G4DA 2EFPA 2IT0A 5E8GA 1OYYA 3GUDA 2G7UA 1QZYA 3B73A 4U7BA 5CLSA 1FYKA 1LNWA 4RB1A 4NHJA 3DFGA 4HLYA 1IXSB 1BM9A 2ESHA 3LA7A 4RB2C 1MJBA 1XSXA 3CO6C 4G7OF 3V7CA 1Z1DA 4MQ9F 3BZ6A 1TNTA 4I2OA 2HKXA 2CW0F 4WK8F 1ONVA 3I4PA 1FY7A 4ZYDA 5FGMA 1R23A 3FWEA 4RGXA 3JAMK 3L7WA 4KN7X 2VBXA 1SFEA 3K2ZA 3WODF 4ESBA 4KYWA 2ZNZA 5D8LB 4QLCU 3SXYA 4IRIA 1J59A 5ILSA 5D5XB 4GGGA 1PP8F 3IKTA 3WTTC 1TQIA 1KQ8A 4HV6A 2XAFA 1KGSA 2DPDA 5BS6A 3I59B 2GQQA 2FQ3A 2CWEA 1O3TA 3RJPA 1P2FA 1ZARA 4R79A 2GA1A 3RI4A 3H3UA 3V7RA 4HX8A 1YW9A 1YS7A 5LBQA 3FX3A 4HDVA 5J6XA 2E7WA 1TQPA 2LF8A 2QLZA 2ESNA 3KZZA 1XCVA 3TO7A 4IJAA 2FBKA 3KETA 3DPTA 1SD4A 2EFNA 1S7AA 1SMTA 3ZMZA 4UVCA 3I0TA 5JHUA 1F9NA 4AWXB 5F64A 4JK1X 1R5GA 2KJCA 3BWGA 4BYYA 3P7NA 2V1XA 4HW0A 4RGUA 4QWQA 5HOOA 1O3RA 4UUVA 3LQRA 4ZYGA 1EV7A 3V4GA 4S04A 1B4AA 3GFMA 1UHWA 4MTEA 3W6KB 2WWYA 4HDUA 3MZYA 1LDKB 1USSA 4AD9A 5FD6A 3DV8A 5BPIA 4EGYA 2ISYA 1YW8A 3CUQC 4H0EA 3PFIA 1S7OA 3DQVC 1FSEA 1ZREA 3GLXA 4UXNA 1QBJA 1KYZA 1P4AA 2L4AA 2KKOA 2H6BA 1T38A 2EB7A 2D1HA 1E17A 4UNOA 2IW5A 1DP7P 3F8BA 2JZYA 2YPRA 3FMRA 1RUNA 1P6RA 5D6EA 4Q48A 4YIFA 4L0YB 3HYIA 4A5NA 1FBSA 3DXJF 3FXQA 1T39A 3N4MA 4A12A 1IN4A 2WTEA 4IHSA 3W6JB 3G3ZA 3F8FA 2M45A 4G94A 3VB2A 5LGTA 3R0AA 1B6AA 2QQ9A 4G9YA 2FNPA 1BC8C 2FSWA 3KLOA 4YIIA 2L54A 1XDUA 2EV6A 2CO5A 3MWMA 5ICFA 5ICEA 3J80Z 4L9NA 5HLIA 4G7ZF 3CUQA 3ZMDA 1WI9A 3J80K 3I53A 1KU9A 3GW2A 4HF0A 2STTA 5HLHA 2DPUA 2CGPA 3MQ0A 2X4HA 4M6YA 3SQNA 4XLPF 1SFXA 2GXBA 2VC0A 2DQRA 4P96A 4RGSA 3N97A 5D5WB 1NHAA 2HOEA 4LG0B 4BQAA 3E6DA 2W85A 5HDNA 4RS8A 2OQGA 4KIBA 4F7ZA 2DBBA 2VBZA 1XCBA 2MLGA 3GYHX 4I02A 2Q0OA 3L9FA 1IXCA 4OIQF 3WGGA 3E3VA 5LGNA 1J0RA 5DCMB 2HYGD 3E5XA 4ZYEA 1PDNC 5D8KB 2P4WA 2RDPA 4I98B 3VOEA 1ZYRF 1L3LA 1CF7B 3J81Z 2NNNA 4G8XA 4BHPA 2Q2EA 4PDKA 4XRFA 3J81K 1K78B 2GXGA 4IPAA 5E20A 2STWA 3ERED 2RN7A 2QENA 1U3EM 4M71A 1BN5A 4EM2A 1BC7C 5CVRA 4IXAA 2DQLA 3F23A 1J5YA 1IF1A 4P9UA 3TDUC 2IA0A 1HBXG 1RNLA 3C7JA 3FMSA 2LKPA 5LRRA 3K9TA 2P5VA 3IKVA 1FT9A 4K2EA 1QZZA 1R1VA 5D4SA 5JVTA 2H6CA 3ZMVA 2XGXA 5DCFA 5E8IA 2RQPA 4ENKA 1ZLJA 2JPBA 2F5CA 3P9KA 3IWFA 1MGTA 2XRNA 4CGZA 2QBYA 2CSOA 3HSRA 4ETSA 2GWRA 3R61A 2FEZA 3K1NA 3ABTA 1G6NA 2K7LA 3ML6A 4B09A 3WTUC 2E7XA 1FLIA 3CJNA 5AIQA 3VEPA 2M5WA 3C18A 3BJ6A 1XN7A 3MEXA 4OIOF 1BJAA 1CGPA 4ZYHA 1R7JA 2EK5A 5DYMA 4LLNA 2PMUA 3U1DA 2FU4A 2MH9A 4G6DA 1K7AA 2YSRA 2IP2A 2RKHA 3GZ5A 4KIGA 2ACJA 4HOBA 2XUBA 2OQRA 4KMUX 4D0PA 2P6SA 1TNSA 1R00A 3KP5A 2HZTA 5ICCA 2CG4A 3MAJA 1UCRA 2A5YB 4B8XA 4A0ZA 2XIGA 3JTHA 5LRSA 5KK1A 5DEQA 5TJJA 3RDIA 3WE3A 4OOIA 1KU2A 2VBWA 2OZ6A 1FZPB 2NAZA 2XKOA 1IW7F 2M1BA 4N9IA 2M30A 1XMKA 2R3SA 3Q5FA 1JHHA 4KT5C 5H6RA 1P4XA 3I64A 2BE5F 1QGPA 5E17F 2ZFWA 3IC7A 5ED4A 1SFUA 1BI3A 2Q8KA 2F2EA 3F21A 4KA4A 3SFZA 1F4KA 2FMYA 1C0WA 1A04A 2DW4A 2A68F 2OA4A 2BGCA 4UV9A 3M8EA 3GVAA 1F1ZA 3FHZA 4BHCA 3LFKA 4A0XA 4BNCA 1U5TA 4LK1F 2EA4A 3QAHA 5LHHA 3SZPA 1S8NA 5HLGA 2PBIA 4HLXA 3WU1B 2D2WA 4RB3C 3TO6A 2EFOA 1IN6A 1Q1HA 3WGHA 2HS5A 2QWWA 5E1XA 4ESFA 2AXLA 3JAMZ 3JSOA 2V1UA 3R60A 4OMYA 3F8CA 1JGSA 3RYRA 1FNNA 4WXCA 2PQ8A 1MDMA 3M7GA 1H0MA 3R4KA 4DQ2A 1B9MA 1TBXA 2ZNYA 4G6QA 5D5UB 1OYIA 2PEXA 4O6JA 3F3XA 3M1EA 4ENNA 1BI2A 4AIHA 5LHIA 3NRVA 5LEJA 1P92A 3QP5A 3CDHA 3IHUA 3BJAA 3ISPA 3RKXA 1UFMA 5E1ZB 1I27A 1MD0A 5DDGA 1K6OA 3ABUA 2A07F 4HF1A 2FNAA 3C1DA 4PCQA 1W7PB 2HYFA 4AVPA 2Z99A 1S6LA 1T0FA 4FHTA 1G3YA 2KJBA 2JTVA 3WTVC 3MFKA 2HEOA 1ZRDA 1B59A 3QP6A 5ICGA 5LLQA 3HRTA 5DD4A 2BEOA 4CXFA 3B02A 4BXUA 2H09A 4CHUA 1D5VA 3DPLC 3MZHA 5BMZA 1OPCA 4GXOA 3KP3A 3V8JA 3O3KA 2TDXA 3RIRA 3HHGA 2VN2A 1HKQA 4EJUA 1S29A 2C6YA 1HW1A 4G7HF 4EQQA 2QVOA 5E18F 3GO5A 2OZUA 3GXOA 3DP7A 4BAYA 1IRGA 4GO1A 1LB2A 3K69A 4EJOA 2CQKA 2PG4A 5ERIA 1FPQA 2K27A 1ZGAA 2QBYB 2D45A 2VT3A 3FZVA 3LSTA 2HTSA 3F72A 1MZBA 2VBYA 1FBUA 2HWVA 1U2WA 1I1SA 4ENJA 3HSEA 1W7PD 3HHHA 4OIRF 3BP8A 3P9CA 2PI0A 2EJRA 4N0BA 4O3MA 3FF5A 5L3EA 4KUMA 1YYVA 2R7FA 1KU7A 1D8JA 6PAXA 1KA8A 4ESJA 3ELKA 5ILUA 2COMA 1TLHB 3BJOA 4A0YA 4EV0A 4Q5SF 1FWZA 5LHGA 1IUYA 1WKMA 1MJAA 3RKYA 4L0ZB 2PN6A 4AIJA 3Q9VA 1H9GA 1OKRA 4XSXF 3L00A 1S3JA 3T5XA 1LDDA 2FF4A 3KZYA 3RPQA 5H20A 2GA2A 5ILVA 2O3FA 5L3BA 2HR3A 4DNCA 4YFNF 2DO7A 1PUEE 4LB5A 3DEUA 4CYDA 2F5FA 4N9HA 1BI1A 4FT8A 3ECOA 4ZH4F 2CYYA 4UV8A 2PMHA 2JT1A 3F6OA 4EM1A 1H9TA 5CVVA 3CO7C 3HRUA 1YQAA 1X3UA 4EJWA 1ULYA 2VONA 4LB6B 1E2XA 5DUKA 1OR7A 2BBYA 3F22A 2DLLA 2OBPA 3HTSB 3KP2A 1KU3A 3LA3A 3I54A 4CO8A 4OINF 2FXAA 4I0AA 1QQIA 1D8KA 1ZRCA 4BH9A 2X0LA 3ZMUA 1IZ1A 3P9IA 4EMSA 4WCGA 3NEUA 2OD5A 5H6QA 5BOXA 2FRHA 3F8MA 1EH8A 2DTRA 2P8TA 4NB5A 1YIOA 1OYWA 2M87A 1QO0D 4U7DA 1LJ9A 2Y0MA 2HQRA 4UVBA 1WWXA 3TDZC 4WXHA 3I59A 4WF2A 4MHGA 4MTDA 4RGRA 3D0SA 1L0OC 4Z2YA 4U88A 1SD7A 4CICA 1MKMA 4MQVA 4R8HA 2L3DA 4L18B 4PZJA 1JE8A 4HX7A 4EGZA 2K86A 1YS6A 2XVCA 2QZ8A 3BDDA 3LAJA 2ZCWA 2L02A 3E6MA 5F6FA 2RV8A 3O2PE 4YG2F 2P6TA 2GZWA 1IN8A 1V4RA 3KP7A 1R36A 1XSVA 4HF2A 2BV6A 3KE2A 3ZQ7A 3CUOA 3BPXA 3FXRA 1RUOA 1DPRA 1LEBA 4M9XA 2EWNA 4S05A 2NNYA 1G3TA 4BHBA 1P4WA 1LEAA 2G9WA 3HSFA 3V7SA 5JI6A 1HKSA 2V9VA 3LWFA 4HYEA 4HQEA 4UHTA 5AIPA 1ZLKA 3QPHA 3WTSC 1R1UA 5HS8A 4XBFA 5CVJA 2ETHA 2VOOA 4I01A 1Z05A 5D6FA 2KIUA 2KRFA 3FMQA 2ZJ2A 1FYLA 4GYGA 1LDJA 2EV5A 3PQJA 5FO5A 3ROUA 1J75A 2E1NA 1D3YA 2YU3A 2QUFA 1Z9CA 2K4JA 2XKPA 1FYMA 1BIAA 3VODA 1RZ4A 2HQNA 4KDPA 2R7DA 2LF7A 2A61A 2RC4A 3BROA 1ZHFA 1U5TC 4HBLA 3T8TA 3CLOA 2FBHA 3NQOA 1R58A 5K5QA 2O6GE 5HS7A 1XSDA 2O8XA 1HXDA 2GIVA 4M9SA 5J8CA 4A2UA 4A6DA 1ZG5A 2EFQA 4CZZA 5K5RA 2VE9A 2AS5F 1JXSA 1ZH5A 3MCZA 3HOSA 2DK5A 4I0BA 3BOQA 1XD7A 1ZAOA 2RNJA 1GXPA 1ZGJA 3WTXC 3KP4A 1O3SA 2MA3A 4LK0F 4HZFA 3T0YA 2NS0A 4WWCA 3SHFA 4P55A 1BBYA 3EETA 2A3SA 1WRJA 3FXUA 1IRFA 3J7AO 1RIOH 2P5KA 5IT9K 4WXDA 3I58A 4P9FA 2JSCA 3KP6A 2DAOA 2F5EA 4KMFA 4LG0A 3ECHA 3C3WA 1O57A 3ZMSA 3ZP5A 3GFIA 2L01A 2ZBKA 4Q4ZF 3U9GA 1PP7U 4R1HA 5D5VB 2RGVA 4IVNA 3HUGA 1YLFA 4LFUA 2BYVE 1YW7A 2L4MA 1GXQA 5KVRA 2HTJA 2W84A 4L9JA 4HAMA 3T8RA 3CUQB 2XHKA 2OU2A 5DCMA 3JTGA 3KCCA 1XGSA 1HSJA 3HOTA 1AOYA 2JPCA 4EJTA 5CJ9A 1WSUA 5HS9A 3GF2A 3H92A 1CF7A 1LVAA 3WG9A 4OU0A 3KEOA 1BIBA 3ZMTA 4Y17A 5HDKA 1ZG1A 5A2QZ 1K78A 1BOAA 3TQNA 5A2QK 2PLYA 4I09A 3LA2A 5L3CA 2UXXA 1XDSA 3EDPA 1ZG3A 4Y13A 1W5SA 1XGNA 2UZKA 3V8KA 3TO9A 4EM0B 1MJ9A 1J7KA 1GVJA 5HVQC 1ZN2A 2Z5UA 3EYYA 4ASNA 4M73A 3WTZA 3EYIA 1FX7A 2O0YA 3O6BB 2VE8A 1DPUA 3VFZA 2RVCA 3QU6A 2VC1A 4U0YA 4YFXF 4FX0A 1KQ9A 3I71A 3GX4X 3ZN0A 4UVAA 2YX7A 3M8FA 1FP2A 3WE2A 1USTA 5L3DA 2IVMA 1FBQA 2IRFG 3V8LA 3E6CC 4MEYF 1J2XA 4L5IA 3REOA 1UHMA 2XAGA 3U2RA 3KLNA 3R0JA 3JW4A 4M74A 1EH6A 4M72A 4HV5A 4P5OA 3EQLF 1IN5A 3RYPA 2F5DA 5TRDA 2MH2A 2E1CA 3D5LA 2GAUA 3IRQA 4ON0A 3HRSA 1WQ2A 1G3WA 2FE3A 2ISZA 1VTNC 4L9TA 3S2WA 4OMZA 3K1PA 5BPDA 4RAZA 1FOKA 2PFBA 2JRTA 3PQKA 4EVIA 3AAFA 4JBAA 1STZA 4IHTA 2J5PA 5CVUA 2VOPA 2M8EA 2Y75A 1U6GA 1SMYF 2WC2A
chains in the Genus database with same CATH superfamily
3IUOA 4XRMA 1MNDA 2CUZA 4UUSB 4DYRA 2G7HA 4E7LA 2M4GA 2O61A 1QNTA 1TWCJ 3X2QH 4MGRA 3OYCA 3GTMJ 1KQ0A 5C4JJ 3FM3A 5DV5A 1CF7A 2DDAA 2OPTA 3K4MA 2EINH 1QPMA 3HTUA 4XN0A 2R0QC 2HI3A 1BJZA 3GWZA 3A02A 1B8IB 5J8FA 3CCEI 1MH4A 3PSIA 3GFLA 1K79A 1BOBA 2XPWA 3KFWX 1XGOA 1JJ6C 1XGMA 1JKPC 2IA2A 4M6XA 2QSHX 2FA5A 2OAZA 4PGHA 4A3FJ 3QOPA 3ZQCA 3J7AY 5FFZA 1XMAA 3CP2A 2MD5A 3BR1A 3WTWC 4XL9A 3GTJJ 4KIFA 2DTZA 1T2KA 3RPUA 1I6XA 2M0MA 3SZTA 1NTCA 2HQ5A 2KP6A 2Z3YA 2OUMA 1OJLA 4XSZF 2Z9OA 2CV2A 2HGCA 2JA8J 2X1DA 1HKTA 2IPQX 3RTRA 2ZKZA 1RI7A 2EQRA 4A3BJ 2CFOA 2XV4S 3DPUA 4LGWA 2NYXA 5HNFA 2ZXIA 2FD5A 3QRFF 2V26A 5GADJ 5IP9J 5J40A 1FP1D 2UXNA 2ZMEA 5FLXR 4A6EA 2DA1A 4CSWA 2HQAA 2OTJI 2XROA 2W57A 3LSKA 5EEGA 1DUXC 3PNYA 2QM3A 4M6VA 4AC0A 3ULQB 1V3FA 2UWMA 3K4NA 2L7KA 1MIJA 2K3FA 2V6CA 2MGQA 1ODDA 3E5UA 4U0VA 2FJ1A 2H27A 1G8XA 3LQQA 2L9RA 5K7HA 1TT0A 1PVEA 3LFUA 1TZLA 4GCVA 2YX4A 3G1LA 3ASOH 3NWTA 1NK2P 1DDNA 2KIMA 4CDGA 1NK3P 1IXRC 3T1BA 4BUPA 2BHZA 2V1DA 3CMAI 1U8RA 5B1BH 2PJPA 4LLGF 2K9QA 4IF4A 3WTYC 5B5EC 2IS2A 4I6ZA 1ON2A 3JREA 1R1TA 4L9VA 3HIFA 2H1KA 4XM3A 3WGIA 4BACA 1LFUP 1OCCH 2IA1A 3S8PA 5M5YJ 3OYFA 5L3GA 2V6EA 2VL8A 1T6SA 2XASA 3CJQB 3IH2A 2LD5A 2K3PA 1JHFA 3AG3H 3HOYJ 1BW5A 3O8GA 2RAEA 5LEKA 2GOXB 2V79A 2E5ZA 2H8WA 2DU9A 3K0LA 2HFHA 2DK8A 3KYCB 3VWBA 2AXTC 2FOKA 3OR1C 3OYAA 4S0HB 1AHDP 3TOAA 4A3DJ 4A5MA 3WU0A 5HDGA 2KFDA 2EA2A 4DYCA 2VQLA 1LQ1A 3VYUB 4NUBA 1O7LA 4X0GA 4YEJA 4HQMA 2LSOA 4E70A 4RMNA 2XAHA 3DLLF 1FOXA 4RLQA 5M5WJ 4EJVA 2EV0A 4O5VA 1U5TB 3ZN1A 5FLXZ 2NVQJ 2P5LC 3I5UA 1MBHA 2V1NA 2L7MP 2M8GX 1R22A 4Y15A 3DKWA 4NQWA 1Y8RB 5FLXK 1XB4A 2KT0A 1DGRM 5BNGA 1ZELA 2DFIA 1XTAA 1TTYA 3L2CA 3CTAA 1RR7A 1B72A 3MKWB 2XAQA 3HPHA 2DI3A 4LG3A 3S16J 2B7EA 2VKEA 4KICA 5KAIC 3G2BA 2M2EA 1ZRFA 4JQFA 2KQRA 2MBFA 2E19A 3TGNA 2JN6A 5L3FA 1T98A 2VXZA 4TV7A 2NRAC 3H9GA 3HJEA 4XRSG 1YFHA 2HOAA 5IOYA 2F48A 4AIKA 1HQCA 4JX5A 2FMLA 2ELJA 3OYGA 3LSPA 2DXIA 2LYCA 3L2QA 2ZO4A 1O7FA 3OOPA 1MDMB 1UJ8A 1W7PA 3TKYA 4IQJA 3JSPA 2O03A 4L5JA 1UZCA 3TOBA 3CMYA 3H3ZA 3IWZA 5JFRA 2IAIA 1W36D 4RAGA 2ZC2A 3COAC 2CQQA 1YIJI 1R4NB 2LDUA 4B48A 3CESA 3BPVA 4QIWN 5EEHA 3QPTA 1A31A 3KPHA 4BL0B 1MMDA 2HXIA 3L09A 1LKXA 2QQBA 2R7ZJ 3RKWA 3JRGA 1UB9A 2DYRH 3GEZA 4IRGA 4CCNA 4ENMA 4LD5A 2E1MB 5DD8A 2JQ7A 2QSFX 3LSHA 4BY1J 3QU3A 1Z91A 4LMYA 1IC8A 2MZ4A 1I50J 3MMYB 1I1GA 3F8NA 3KYLA 1W4MA 1YRNA 4LITA 2HDCA 3CCJI 9ANTA 1Z3YA 2GOMA 1T08B 3GTLJ 1U78A 1REPC 4XLEA 3VYRB 1FMVA 2VT2A 1J9IA 2J5OA 1YE9A 5DUIA 2HPIA 2WV0A 2A69F 2KRCA 4V2GA 1PJRA 1EH7A 2H94A 2V9KA 4G6TB 4IRHA 5LGUA 1IAWA 5E3MA 3CCRI 2HKOA 1FSHA 4BKXA 3R6SA 4RB0A 1JUMA 2CFXA 3E6BA 3K4KA 2X1CA 5F1RA 3WHBA 1GHCA 2F4OB 5CVIA 4ZDPA 4GYIA 2D1VA 3IRRA 3OOUA 4PGGA 1WVRA 2VJ4A 3E5QA 2FBIA 1D1CA 3GZ6A 1B9NA 3AFHA 3GFJA 4MEXF 3G4SI 1Z6RA 4BDZA 1Z6TA 2ZSHB 3E97A 2VKVA 3I4MJ 1KYWA 1HA8A 1B1BA 2BZTA 2M3AA 5IT3A 1YO5C 3W2WA 2Z33A 1VQOI 2JUCA 5M5XJ 4C30A 1PUFA 3IAM2 1R5HA 2W4SA 2HOTA 3G73A 5EEAA 2VB6A 4YFKF 3DEWA 4IX7A 5E1WA 3LAPA 1EJ9A 5IT9R 2P7CB 4LLLA 2LNBA 5GPAA 1SAXA 1F5TA 4ZZLA 1IN7A 3DEEA 3DCFA 1WPKA 4C3JJ 2KL4A 1YG2A 2W24A 3H0DA 2K4BA 2OTLI 3CCSI 3EUHC 4PJLA 3FM5A 2DA5A 3TMOA 2MLKA 4BXXJ 1ON1A 2KIFA 5H2FC 4F93B 2DCEA 4HA8A 1HSTA 3I9V2 4OIPF 2DT5A 2EFWA 1OMIA 2IGMA 2E1OA 3QYBA 3ZXSA 2Y48A 4A3JJ 1W5TA 2LY9A 1Y0UA 5K5OA 2XAJA 2PJRA 5CQEA 2ELHA 1IUFA 2YR2A 5BQTA 2DT6A 3IV5A 4A3IJ 3CC4I 1FEXA 1DU0A 5FRNA 3S2HJ 1YX3A 3OL3A 1UMQA 1YTYA 2EIMH 3RQIA 3G1MA 4ZZDA 3F6VA 2A6HF 4HX4A 2ADUA 2LG4A 1YJNI 1I5ZA 5FFXA 5GAGJ 4LJZF 2DODA 1TW3A 2Y2ZA 2E71A 1HC8A 2W25A 4WX9A 2F4MB 1N78A 3I56I 2JRMA 2A6EF 4B3AA 4JP0A 1HW5A 1MH3A 4MLOA 4MNUA 1G3SA 1BI0A 3HRMA 1K4TA 3H35A 4KN4X 1ZTRA 2W82A 3IL2A 1AWCA 3ZPLA 5D4RA 2QYOA 5FB2A 2E36A 4RAYA 4F91B 2XGEA 4RAFA 1O3QA 5JR3A 4XKVA 4Q47A 2MFZA 3DF8A 1SD5A 1HW2A 4FX4A 2ECBA 2K02A 1FOWA 2BW3A 1OISA 2QQAA 3K1MA 2NXNB 5FD5A 4F55A 3BY6A 1WZ2A 3WHCA 2AQFA 4XLNF 5IT9Z 1A5JA 5CYVA 4KNYA 2XDVA 2ZXJA 2IS6A 2QEXI 2MC3A 3B6CA 1FC3A 4XMYA 2P7VB 4E7SA 3BG6A 3FXOA 4C9YA 1MNEA 5DTDA 4NC8A 5AONA 4KFCA 4M9ZA 2VODA 3CJRB 1Z7UA 2ZMEB 3EUHA 3K4BA 3S1RJ 4I7HA 2DOFA 3OV8A 4L5EA 2B0LA 2CS3A 4U0WA 2XB5A 4IKFA 1SD6A 1QRYA 1WHUA 2BXYA 3M9AA 4RM3A 1TQMA 3KEQA 3Q9SA 3Q0WA 4EEFG 2MW8A 5TISC 1TW2A 3CCQI 2IJLA 5K1YA 2VQHA 2EFPA 1G4DA 2IGOA 2IT0A 5E8GA 1OYYA 3GUDA 2WAQN 2G7UA 1QZYA 3B73A 4U7BA 3FKJA 3J7ZI 5CLSA 1FYKA 1LNWA 4RB1A 3QYFA 3ZCOA 1SAUA 4NHJA 3DFGA 4HLYA 3L1PA 5EGOB 1IXSB 2R5YA 1ERDA 2XPUA 1BM9A 2ESHA 3LA7A 2K9SA 3OYBA 4RB2C 2LKXA 4BS9A 1K6YA 5GPCA 1MJBA 1XSXA 3I55I 3CO6C 4G7OF 3V7CA 2Y9ZA 1Z1DA 3L2UA 1V55H 3RKQA 4I99C 4BDYA 3OYLA 4D5FA 1XS9A 4MQ9F 1BL0A 3BZ6A 3ZQLA 4BQNA 1TNTA 3HPGA 4I2OA 2HKXA 3CCUI 1Y0NA 2CW0F 4PFPA 1JI8A 2Y9YA 4WK8F 1JKRC 1ONVA 3BCBA 5F04A 1RR8C 3I4PA 2JWTA 1AU7A 1FY7A 2HVSA 4OWRB 4ZYDA 2JUGA 5FGMA 1R23A 1Z67A 2Q1ZB 1RPWA 2EZKA 3ERMA 3FWEA 4PK4A 4RGXA 1RRJA 3JAMK 3L7WA 4KN7X 3RPUD 1IRZA 1LPQA 5KNLA 3VPRA 2VBXA 1SFEA 3K2ZA 3WODF 2A6TA 4ESBA 1DGWY 2JJ7A 2PMZN 2ZNZA 5D8LB 3AG1H 4QLCU 3SXYA 4KYWA 3PO2J 2CU7A 2GBYA 4IRIA 2VKDA 3ZQHA 2IS4A 3AL0B 4BJ6C 3D5RC 1J59A 1W0UA 1SVMA 5ILSA 2X1EA 5D5XB 4GGGA 1PP8F 4X6AJ 3CDIA 3IKTA 3S93A 3WTTC 1D1BA 1E0EA 3BTLA 1TQIA 1KQ8A 4HV6A 2XAFA 1KGSA 2DPDA 2IXSA 1GUUA 3RZDJ 5BS6A 2XGDA 3BG3A 3I59B 2GQQA 3SYTA 1V54H 4J00A 2FQ3A 2CWEA 3H0GJ 1ACIA 1O3TA 3RJPA 1P2FA 1ZARA 4R79A 1U0JA 2R7SA 2GA1A 3S14J 3FBNB 2OCEA 3FIWA 3RI4A 2M9HA 3SDBA 1MBEA 1H8AC 5E3LA 4ITVA 3H3UA 3MZ8A 4IQ4A 3V7RA 2TRTA 1FJLA 4HX8A 2BHYA 2VJJA 1YW9A 1YS7A 5LBQA 5IPAA 3FX3A 5J1RA 2ZJRF 4HDVA 4DYQA 1XC5A 5J6XA 2E7WA 5EDNA 1X58A 1TQPA 3CQZJ 1TWGJ 4YIRX 2LF8A 2MVTA 2QLZA 3NWSA 3ZRGA 2ESNA 3KZZA 3OS1A 3PSFA 1XCVA 1E3PA 3TO7A 4IJAA 1RKTA 2FBKA 3KETA 3DPTA 1SD4A 4PSXA 2EFNA 1S7AA 1VQKI 1SMTA 4IOCF 2NOGA 3ZMZA 4RA2A 4XKBA 5EF6A 4UVCA 3I0TA 5JHUA 4V19K 4NDLA 2XRLA 3BT9A 2F4IA 4F52A 4FCYA 1F9NA 2WADA 4AWXB 5JLWA 1W0TA 3G1OA 5IY5H 5F64A 4JK1X 1R5GA 3MD2A 2KJCA 1VQ7I 1Z0XA 3BWGA 4BYYA 5J1UA 1MMSA 1GV5A 1V5FA 3P7NA 2V1XA 4HW0A 1HDDC 1I3QJ 4RGUA 1SFOJ 4QWQA 4QPOA 5HOOA 4BQQA 1O3RA 2LR8A 4UUVA 1WJEA 3LQRA 3QPLA 1R49A 1QPIA 2FX0A 1AKHB 4ZYGA 1EV7A 3V4GA 4OAZA 5F1JA 4S04A 2AO9A 1TWHJ 1B4AA 1YOVB 3GFMA 2KISA 1UHWA 3HGGA 3KZIC 3IAS2 4MTEA 4DBQA 3W6KB 3E0JB 4W97A 2WWYA 4HDUA 3QOEA 3FHNA 3MZYA 3HKZN 3LMMA 1LDKB 2Z2SB 1USSA 4ANJA 4II2A 2DMQA 4AM3A 4A3GJ 4AD9A 5FD6A 2VI6A 3DV8A 5BPIA 1SVOA 3WG7H 4D7NA 1SC7A 1BR4A 4E7JA 4EGYA 1SFKA 2W48A 3D1NI 4PUSA 4AUXA 4YRVA 2ISYA 4KITB 2AQEA 4B47A 3VSLA 3J80R 2DOAA 2FOWA 2YUSA 1YW8A 3CUQC 2HOSA 4H0EA 3PFIA 3HXLA 1S7OA 3H9QA 5IYCJ 1D0YA 2DFFA 1IGNA 1D0ZA 2DMTA 3K7AJ 3OWTA 3DQVC 1VFCA 3B6AA 1FSEA 2JK3A 1ZREA 2JSPA 5C4XJ 1A6QA 4M3EA 3GLXA 4UXNA 4ZTFA 1QBJA 1KYZA 2KRHA 2VXDA 1P4AA 1R71A 4BJ5C 4JX6A 1TWFJ 2L4AA 2KKOA 4Z6YA 2Y30A 2H6BA 3AG4H 1TL8A 5FJ8J 3FBIB 4XKWA 2EB7A 1T38A 2D1HA 3C2GA 4XLCA 4CYCB 2K9MA 1E17A 1OCPA 3NARA 4UNOA 2IW5A 1DP7P 3BC8A 3F8BA 2JZYA 2YPRA 1ETKA 3FMRA 1RUNA 3H5AA 3IH3A 4CCMA 4HNVA 4XOTA 1P6RA 5D6EA 3HG9A 4Q48A 2DMUA 4YIFA 4L0YB 3RCOA 3HYIA 4A5NA 1FBSA 3DXJF 3FXQA 4D9JA 1T39A 3N4MA 2XAUA 4A12A 5FKOA 3EPZA 1IN4A 2KPMA 2E5NA 2WTEA 5DM6F 4IHSA 3W6JB 3G3ZA 3F8FA 2M45A 4MIMA 4G94A 3VB2A 1JTXA 4CCKA 5LGTA 4LOCA 1K4SA 3R0AA 1B6AA 2QQ9A 4G9YA 4W1UA 2XGCA 4A3EJ 3C2HA 2FNPA 1BC8C 1VQ6I 2FSWA 4V2FA 3KLOA 1GLNA 4YIIA 1I3AA 5CPRB 2WAFA 4KT6A 2M0CA 4DZJA 4J19A 2L54A 1XDUA 3DBLB 2EV6A 4B1RA 2DMPA 2M35A 3J81R 4RDUA 2CO5A 1YJ9I 3MWMA 2P0TA 5ICFA 5ICEA 2I5UA 1JUSA 3BTIA 3UNGC 3J80Z 3SFIA 4L9NA 2EPFA 5HLIA 4G7ZF 3CUQA 1ETYA 3ZMDA 1WI9A 3J80K 3I53A 3ASNH 2I10A 4PJJA 1KU9A 3ESWB 3GW2A 4HF0A 3GTGJ 2STTA 5HLHA 2DPUA 2CGPA 1QHGA 3MQ0A 1ETOA 2X4HA 4M6YA 3SQNA 4XLPF 3C2BA 1X1DA 3F0CA 2W7NA 1SFXA 2GXBA 2VC0A 1OCOH 2DQRA 2W00A 4P96A 1HF0A 2JA2A 2DT7B 4XNFA 4RGSA 3CF2A 3N97A 5D5WB 3GCMA 3OYJA 1NHAA 2HOEA 3BQYA 4LG0B 1Y39A 4BQAA 4M3BA 1XPXA 3E6DA 2W85A 2NVTJ 3CCLI 5J3LA 5HDNA 1HCRA 4RS8A 2OQGA 1MBJA 2L9VA 4I76A 4KIBA 5EJCA 3E7LA 3RQ4A 2QCOA 4F7ZA 2DBBA 2VBZA 2Y69H 2GM4A 1XCBA 2MLGA 3HUGB 3GYHX 4I02A 2Q0OA 1Z21A 3L9FA 2DFEA 3HL2A 1MNMC 2VUMJ 4IO9F 4IZZA 1VQPI 3MN2A 4ZDOA 1IXCA 4OIQF 4II3A 3WGGA 3E3VA 5LGNA 1J0RA 1XMXA 2YS9A 5DCMB 3W6VA 2HYGD 5KAFC 3E5XA 5CQGA 3LSGA 4E7KA 3HOWJ 1QU3A 5JHFA 4MO7A 4DJAA 4ZYEA 3KX2A 1PDNC 1E3HA 5D8KB 2P4WA 1JTYA 2RDPA 4I98B 3VOEA 3FISA 1ZYRF 1L3LA 1CF7B 2R92J 3J81Z 2NNNA 4G8XA 4BHPA 1QVUA 2Q2EA 4PDKA 3JRAA 2K9LA 3S32A 4XRFA 3J81K 3OSFA 2ZJQF 1LUJB 1K78B 2GXGA 4IPAA 5E20A 2RQQA 2STWA 3ERED 2RN7A 2WY7Q 3OS2A 3JRCA 1IJWC 4XR6A 2QENA 5FRMA 3JRFA 5IP7J 1OQYA 1T33A 1U3EM 1P9QC 4M71A 3K6GA 4IHXA 1BN5A 4EM2A 1BC7C 1ETWA 5CVRA 4IXAA 1OLTA 2DQLA 2ELKA 3F23A 1J5YA 2LRDA 1TC3C 1IF1A 2FUG2 4P9UA 3TDUC 3A01A 2IA0A 2DOEA 1HBXG 1RNLA 1UAAA 3C7JA 3FMSA 3SEZA 1O4XA 4DBRA 2LKPA 3A03A 5B1AH 5LRRA 4E7ZA 3H9JA 3K9TA 1G2HA 2P5VA 3BR2A 1RC9A 2MC4A 3IKVA 4XQFA 4XIDA 4JX4A 3OMYA 1AA7A 4FASD 3HBLA 1FT9A 2Z16A 2JA6J 4K2EA 1QZZA 1R1VA 3EUKL 1OCTC 5D4SA 2XF6A 5JVTA 2H6CA 4DIQA 3ZMVA 2XGXA 5DCFA 1RQ6A 5E8IA 2RQPA 2F5VA 2F6CA 3Q0UA 2OCCH 4ENKA 3LSIA 3FXMA 1ZLJA 2JPBA 5K7ZA 2GLOA 2F5CA 3P9KA 2ECCA 3IWFA 1X1BA 1MGTA 2XRNA 4CGZA 3VDXA 2QBYA 2CSOA 2CQ7A 3L2RA 5GAHJ 1MBFA 2AHQA 3HSRA 4RM2A 2HYJA 4ETSA 4FE4A 1VQ4I 2GWRA 3R61A 2N8GA 2M7BA 4UUSA 2CMPA 2FEZA 3J7AW 3K1NA 3ABTA 2VPLA 2LBFB 1BA5A 1G6NA 2K7LA 3ML6A 2MSYA 4B09A 4M3GA 2DA2A 3WTUC 2E7XA 1FLIA 3CJNA 5AIQA 3VEPA 4D7MA 4HEA2 1B8IA 1S5LC 2R7RA 1FTZA 2DFHA 2KDOA 3OY9A 3OL4A 1VQLI 2M5WA 3C18A 3BJ6A 3IP4B 1D5YA 1XN7A 3MEXA 4F3QA 3QQAA 1WJDA 5FKKA 5TGTA 5EG0A 4OIOF 2M4KA 1BJAA 1CGPA 4ZYHA 1R7JA 1WGXA 2R7XA 4YELA 2QSGX 2EK5A 5DYMA 4AYBA 3K10A 4LLNA 2PMUA 2HU9A 3U1DA 2FU4A 2MH9A 1I39A 4G6DA 1K7AA 2YSRA 1T95A 2IP2A 2RKHA 1RETA 2L7FP 3GZ5A 4KIGA 2HNHA 4HOBA 2ACJA 2XUBA 3ABMH 2OQRA 4KMUX 4D0PA 2P6SA 1FMWA 4A69C 2R5ZB 1TNSA 2CH0A 2QKLB 1R00A 3KP5A 2HZTA 3PM1A 5ICCA 3BZCA 2Y0SA 2LREA 3DBHB 3N05A 4QTRA 2CG4A 2H8RA 4CCJA 3OSGA 4M3DA 3HOXJ 3MAJA 1QA6A 3A2KA 1YJWI 1UCRA 2A5YB 3OR2C 3HOZJ 4B8XA 3DLAA 4XK4A 4A0ZA 2QF7A 2XIGA 2LC2A 1VI0A 3JTHA 5LRSA 4IHWA 5KK1A 1BR1A 5DEQA 2WA0A 5TJJA 2HXOA 1WJAA 1RESA 3L2VA 3PL8A 2GXAA 4XRSA 2M7AA 3RDIA 3WE3A 4OOIA 4XICA 4XOPA 1KU2A 4M3FA 1FOYA 4C2UA 2VBWA 2OZ6A 1FZPB 2NAZA 3I4NJ 2XKOA 1IW7F 2M1BA 3JAMR 4N9IA 4QSHA 2P0WA 2M30A 1XMKA 2O7OA 4HNTA 1S72I 2R3SA 4BQOA 3BZKA 3Q5FA 1JHHA 2JVHA 3BQZA 4KT5C 2DJIA 5H6RA 3TW6A 5J1YA 1P4XA 3TBIA 3I64A 2BE5F 1K83J 1ZK8A 4LIUA 1WJ5A 3IH4A 1QGPA 5E17F 2ZFWA 1BW6A 3IC7A 5ED4A 1SFUA 3WU2C 3CC2I 2GIZA 1BI3A 1QHHD 2Q8KA 2CUJA 3G71I 2F2EA 2V4JC 3F21A 2CW7A 4N4NB 4KA4A 3GZNB 3SFZA 1F4KA 2FMYA 1H88C 1GDTA 1C0WA 1A04A 2DW4A 2A68F 2OA4A 2JA7J 2BGCA 4CH7A 4UV9A 4KJZA 1G59A 3M8EA 3S1MJ 3GVAA 2NVUB 1F1ZA 2VPRA 1MBGA 3FHZA 4BHCA 3LFKA 4A0XA 3S2DJ 1ZR4A 1A36A 4BNCA 1U5TA 1X19A 4F92B 1HOMA 4LK1F 1ETVA 2R7VA 4MFDA 2EA4A 3QAHA 2KIQA 3CDLA 5B66C 5LHHA 3SZPA 1XX5A 1S8NA 2M34A 5HLGA 2PBIA 4HLXA 4ZC3A 2WAEA 2EIJH 3WU1B 2EZIA 2D2WA 2LOOA 2KLOA 1K61A 4RB3C 3TO6A 3LNQA 1WH5A 2R7QA 2EFOA 1T0FC 3H5NA 1IN6A 5FKMA 1Q1HA 3OS0A 3WGHA 1S7EA 2EZLA 2HS5A 4CCOA 2QWWA 5E1XA 3QPSA 4ESFA 2L2OA 2AXLA 3MKLA 3JAMZ 4ZJZA 3JSOA 2V1UA 5GTHC 2XC7A 1EA3A 3R60A 4ABZA 4OMYA 4A3LJ 1LFBA 5J47A 3F8CA 1ITYA 1JGSA 4FISA 3RYRA 4C2TA 1FNNA 4OAYA 4WXCA 2HPMA 2CV1A 4PJNA 2LP0A 2PQ8A 1MDMA 2QGUA 3K70C 3M7GA 4XLFA 1H0MA 3KIOA 3R4KA 4DQ2A 1B9MA 1TBXA 2ZNYA 4G6QA 5D5UB 1FTTA 2X6YA 4IL6C 3PJRA 4NQWB 2Y31A 5KHDA 3KEYA 2JVGA 1OYIA 2PEXA 4O6JA 1JKQC 3DU6A 3F3XA 3M1EA 3LSRA 5FROA 3VSKA 2L9NA 4ENNA 1B72B 1BI2A 4AIHA 5LHIA 3NRVA 2RREA 5LEJA 3H3VK 4B44A 3HB9A 4D1QA 1P92A 3JRBA 4BEHA 3M4OJ 1P7JA 2VQCA 3QP5A 3CDHA 2NVYJ 2O5RA 3IHUA 1N75A 3ONQA 1LFPA 4E7HA 3BJAA 3E1SA 3ISPA 1Y56A 3RKXA 4Y7NJ 3CCVI 2I8DA 2ME6A 3FK6A 1UFMA 2VIXA 1HLVA 4PJMA 2KHMA 5E1ZB 1I27A 1MD0A 1NG7A 5DDGA 3ABUA 1K6OA 2A07F 4HF1A 2FNAA 2R4GA 1APLC 3C1DA 2FQ4A 4XLAA 3GTPJ 2LY1A 4PCQA 1W7PB 3ZR8X 2A5WA 2Q2EB 3Q3SA 4B43A 1UG2A 1Y1VJ 2HYFA 3Q0VA 2WB1A 4AVPA 2Z99A 1R9TJ 5JLXA 1S6LA 1T0FA 1VQMI 4FHTA 5HNHA 1G3YA 3OYDA 2V9PA 2KJBA 2XSJC 4AYBN 2JTVA 1NG6A 4N4OB 3CMEI 3WTVC 3UR3C 3MFKA 1P7IA 2HEOA 1ZRDA 4GDFA 4HSTA 1B59A 3BR3A 2BY2A 3S15J 3QP6A 5ICGA 1VNDA 5LLQA 3HRTA 5DD4A 2BEOA 4BXFA 4CXFA 3B02A 3U1KA 4BXUA 2H09A 4CHUA 1D5VA 1YRNB 3JRHA 3DPLC 3PNVA 2H1LA 2LLKA 3MZHA 5BMZA 2BY1A 1IDZA 1OPCA 1VF9A 4GXOA 4AU7A 3KP3A 3V8JA 1D0XA 3O3KA 3PO3J 3DU5A 1EF4A 2L0KA 2TDXA 3RIRA 3KYDB 3HHGA 2VN2A 1HKQA 4EJUA 1S29A 2C6YA 2NS8A 1HW1A 2XF7A 4EQQA 1W5CC 4G7HF 4HNUA 2QVOA 5E18F 3GO5A 2OZUA 3GXOA 3DP7A 3CZ6A 2VQGA 4BAYA 4A3MJ 1VZ0A 1IRGA 5F0HA 4CA0A 4GO1A 2PX9A 4BE2A 2IGNA 3HC7A 2ZSIB 3ZGKA 1F43A 2A05A 3K69A 1LB2A 4EJOA 2CQKA 2QA4I 1E3OC 1V5GA 2PG4A 3LOCA 5ERIA 4BY7J 1FPQA 2K27A 5KCMA 1ZGAA 2QBYB 5F27A 2D45A 2VT3A 3OYIA 3FZVA 1MMNA 5EZHA 4GRIA 2BVMA 2HTSA 3LSTA 3F72A 3OIPA 1MZBA 3M8JA 4B3XA 2ZB9A 4DW6A 2VBYA 1FBUA 2HWVA 4KISA 1U2WA 1OCRH 3BG9A 1PUFB 3HOVJ 1I1SA 1SANA 1T56A 4ENJA 1Y6IA 1QZEA 2CW8A 3HSEA 1W7PD 1ENHA 2DA3A 2MABA 3CLQA 3BP8A 3HHHA 3P9CA 4OIRF 5IYBJ 2MUNA 1VQ5I 2PI0A 2EJRA 4N0BA 4O3MA 3BTCA 4Y52J 3FF5A 2X48A 5L3EA 4KUMA 2OJED 1OR7C 5EG0B 1YYVA 2R7FA 1KU7A 1D1AA 1D8JA 3PIPF 6PAXA 1KA8A 3FXLA 4ESJA 1IV6A 4G12A 3ELKA 3S17J 3FXJA 4IHYA 5ILUA 2DYSH 2COMA 3RSNA 1LE8A 4LIVA 3DKXA 2CQXA 1FIPA 1TLHB 3ZQQA 3BJOA 4A0YA 1TP4A 4EV0A 3BTJA 4Q5SF 2PJRB 4BU2A 1R4MB 4PFOA 2DA7A 3F9KA 1FWZA 2LKSA 3CCYA 1HDPA 4AVZA 5LHGA 1IUYA 3AL0C 5C3EJ 1KONA 1WKMA 3V42A 4HRIA 1MJAA 3RKYA 4L0ZB 3DTKA 2PN6A 4AIJA 3Q9VA 4XN3A 1H9GA 5E79C 1JJ8C 1OKRA 1MMGA 3EUAA 4XSXF 3L00A 2V7FA 1M1EB 1S3JA 3OYNA 3T5XA 1LDDA 2FF4A 2MG4A 3FK7A 3KZYA 2X6WA 4DGWB 1X3ZB 3U21A 3BG5A 3RPQA 5H20A 2E34A 2L5QA 4BJTA 3TL4X 2GA2A 2KZVA 5ILVA 2O3FA 5F08A 5L3BA 1JKOC 4XONA 2HR3A 4DNCA 2KDZA 3BR5A 4YFNF 2DO7A 1PUEE 4LB5A 3H5RA 3DEUA 2F5FA 4CYDA 5EGOA 4N9HA 1BI1A 3AG2H 3W2VA 4FT8A 2BW3B 3ECOA 4ZH4F 2VLAA 3A52A 3PUBA 2CYYA 4UV8A 2D5VA 1NH3A 2PMHA 2JT1A 3DBRB 2WBMA 3F6OA 3TP0A 4CZCA 4EM1A 4EATA 3UKGA 1Z77A 1H9TA 5CVVA 1OFCX 2MYSA 2JMWA 3CO7C 2XSDC 2NOJB 3HRUA 1YQAA 1X3UA 1U9NA 2LTPA 4EJWA 5E3NA 1ULYA 2VONA 4LB6B 1E2XA 2NS7A 3ZOBA 5F0CA 2E2IJ 2DJNA 5DUKA 1OR7A 2BBYA 4C3HJ 3F22A 3TEDA 2HVRA 1VQ8I 2DLLA 3W2AA 2OBPA 3HTSB 3KP2A 3LSJA 1KU3A 3LA3A 2EH3A 3I54A 4CO8A 3A4CA 3PUFA 3PNTA 3FXKA 2WY8Q 5HODA 2LMDA 1X4OA 4OINF 2FXAA 1JGGA 4GFBA 3CP8A 2HDWA 4I0AA 4IEJA 1QQIA 1D8KA 1ZRCA 2TCTA 1X3WB 4BH9A 2X0LA 3QYEA 3ZMUA 1IZ1A 3P9IA 4EMSA 4WCGA 3H36A 3NEUA 2OD5A 2ID6A 5H6QA 5BOXA 2FRHA 5EYRA 5GTIC 3F8MA 2R5YB 1EH8A 2VASA 4UB8C 2DTRA 1IDYA 2P8TA 2VJIA 4NB5A 1YIOA 3BCAA 3W3CA 5HLTA 1OYWA 2M87A 1QO0D 4PJ0C 4U7DA 1LJ9A 2Y0MA 4BE0A 2WB1N 1VQ9I 2HQRA 4UVBA 1YI2I 1WWXA 2EILH 3TDZC 2RNGA 2BXZA 4WXHA 3I59A 4WF2A 1X1CA 3HOUJ 2L9SA 3DTEA 3GMEA 4MHGA 4MTDA 1H89C 1DQUA 4RGRA 3D0SA 1U9OA 4RLFA 1I6HJ 1L0OC 2W1OA 4Z2YA 4U88A 3OYMA 1SD7A 4CICA 4XORA 4D5CA 1MKMA 1Y8QB 2DA6A 4MQVA 1UHSA 3GTQJ 1YX5A 2WAQA 4R8HA 2L3DA 4L18B 1V5EA 3HZJA 4PZJA 3LSMA 4E7IA 1JE8A 5IP6A 3SZGA 4HX7A 4EGZA 2K86A 3SJMA 1YS6A 4HSRA 2R7OA 3CJTB 2XVCA 2QZ8A 3BDDA 4FQGA 4HPQA 3LAJA 1BR2A 2DMNA 2ZCWA 2L02A 3E6MA 5F6FA 3ZQIA 4UB6C 2RV8A 2IGKA 3O2PE 1IV8A 4YG2F 2P6TA 2GZWA 3I3LA 1IN8A 1R6RA 1V4RA 3KP7A 1R36A 1XSVA 1F36A 1CQTA 4HF2A 2BV6A 3KE2A 4Y4RA 3ZQ7A 1A35A 1YITI 2HDDA 3CUOA 3BPXA 2WV1A 1WJCA 3FXRA 1RUOA 1DPRA 3S1NJ 2BOLA 1LEBA 2X85A 4M9XA 1PYVA 2EWNA 2K40A 1EKEA 4S05A 2QKMB 4BEHB 2NNYA 1G3TA 4BHBA 1P4WA 1LEAA 2G9WA 3DTIA 3HSFA 2LK2A 3V7SA 3LL7A 2ID3A 5JI6A 2K9NA 2PMZA 1AKHA 1HKSA 2YU9J 2V9VA 1SEUA 3LWFA 4HYEA 4HQEA 1WJBA 3BLYA 3JCUC 4UHTA 5AIPA 1ZLKA 3QPHA 3WTSC 1R1UA 5HS8A 3QWLA 1X2MA 3MVPA 4XBFA 3MKZA 1JUPA 3HM5A 5CVJA 2ETHA 2X98A 4NNJA 1QVTA 2R7WA 1TWAJ 2MD0A 3P5JA 2VOOA 4I01A 1Z05A 3G6EI 5D6FA 3JR9A 1X2NA 3M07A 1W36C 2KIUA 2KRFA 3FMQA 2E2HJ 2ZJ2A 5JVGF 2XPVA 4QPQA 3H1CA 1FYLA 3MKYB 5J4VA 4GYGA 1LDJA 2EV5A 3PQJA 5FKLA 2X6OA 5FO5A 1Q1VA 3ROUA 1J75A 4PSWA 2E1NA 4BGDA 3OYKA 1D3YA 2ZFUA 2YU3A 2LY2A 1R5ID 2QUFA 1Z9CA 1FIAA 1WFXA 2ZXHA 2K4JA 4E6KG 2HZDA 1JT6A 2XKPA 1FYMA 4UUTA 1BIAA 1OCZH 4Y33A 3VODA 2L7ZA 4IHVA 1RZ4A 2HQNA 2R93J 1N25A 4KDPA 2R7DA 2LF7A 3M1CA 4A93J 2A61A 3FDYA 3AKZA 2RC4A 3BROA 1ZHFA 1U5TC 1KZHA 4HBLA 4Y3OA 4CYCA 4BE1A 1GT0C 3T8TA 3CLOA 4B4CA 2FBHA 5E3OA 2O9LA 3NQOA 4UY8I 5K7FA 2ICWG 2ZXWH 3QODA 1R58A 5K5QA 2O6GE 1X1PA 1IO2A 1SVLA 5HS7A 1XSDA 3PIOF 2CRGA 2O8XA 1J09A 2X51A 3HGYA 1HXDA 5LFAA 2GIVA 3DWLE 4M9SA 5J8CA 1U8BA 4A2UA 2EIKH 3JRIA 4A6DA 2LFBA 3ZQFA 5FLMJ 2DDBA 2CQNA 2EFQA 1ZG5A 1X1AA 4CZZA 2OV7A 3L2WA 5K5RA 2VE9A 2AS5F 5GP9A 1IG7A 1ZH5A 2E35A 1JXSA 3K4CA 1WH7A 3K4LA 3MCZA 3HOSA 3NAUA 2DK5A 2R7TA 4HG2A 3A0BC 3BOQA 3HEFA 4I0BA 2IS1A 2LVSA 1XD7A 1ZAOA 2RNJA 4AIDA 1GXPA 1ZGJA 4C3IJ 3WTXC 3OYEA 1MSEC 4H4KC 3KP4A 1O3SA 2DA4A 2MA3A 3HKZA 4LK0F 4HZFA 4X1EA 3CC7I 1WI3A 3T0YA 3CD6I 5A2QR 2NS0A 2O8KA 3A1YA 2CV0A 3PFYA 1IRXA 2ZJPF 4WWCA 3SHFA 1LE8B 3M3YJ 5IYDJ 4P55A 1BBYA 3EETA 2A3SA 1UELB 4DZPA 5J4YA 2B9SA 1WRJA 2E1MC 3FXUA 3RZOJ 1WCMJ 3K70D 1IRFA 2LH9A 4CUGA 3CF5F 3J7AO 1RIOH 4C2MJ 3D5SC 2P5KA 4ZTJA 5IT9K 2G0EA 4WXDA 3I58A 4P9FA 4XLHA 1Z7LA 4A3KJ 2JSCA 5CKTA 2EBIA 3A0HC 2DAOA 3KP6A 2EZHA 2F5EA 3TW7A 3GTOJ 3S1QJ 1S9HA 4KMFA 4LG0A 3ECHA 3C3WA 1O57A 1ORKA 3ZMSA 1W1WE 3ZP5A 3ABLH 3GFIA 5FKNA 2L01A 2ZBKA 2CJJA 2UV1A 4Q4ZF 3U9GA 1PP7U 4IOAF 2IEKA 4R1HA 2DN0A 5D5VB 2RGVA 4IVNA 1GVDA 3HUGA 1YLFA 2Z1DA 4LFUA 2BYVE 1YW7A 2L4MA 1GXQA 3K4JA 5KVRA 2OF7A 4MFEA 2HTJA 2W84A 4L9JA 2R7UA 4HAMA 3T8RA 3CUQB 1JT0A 2XHKA 2OU2A 5DCMA 2KZGA 3JTGA 3S3MA 3KCCA 1XGSA 1HSJA 3HOTA 1AOYA 2JPCA 2P81A 4EJTA 5CJ9A 1WSUA 1VQNI 5HS9A 3GF2A 1DP3A 3H92A 5EZGA 4NC6A 1LVAA 4ZYAA 3WG9A 4FE7A 3KEOA 4OU0A 3SEQA 4BBRJ 1BIBA 1ZKGA 3S3OA 3ZMTA 3HDDA 4Y17A 2E60A 5HDKA 2E2JJ 4FTHA 1ZG1A 5A2QZ 1N77A 1K78A 3JRDA 1POGA 2JA5J 2B63J 1MW7A 5F0FA 2CUEA 1BOAA 4CCLA 2QQ8A 3TQNA 5A2QK 1ETXA 2PLYA 1Z3XA 4U87A 4I09A 3LA2A 5L3CA 5M3MJ 2UXXA 3BG7A 1XDSA 3EDPA 2XB0X 1YHQI 3VYTB 3VYSB 1ZG3A 4Y13A 1W5SA 1XGNA 2UZKA 2BY0A 3V8KA 3TO9A 1ZGWA 4EM0B 1MJ9A 4E4HA 1J7KA 1GVJA 1WJFA 4NBQA 2COBA 5HVQC 1TT5B 1ZN2A 2Z5UA 3ABKH 3EYYA 4ASNA 4M73A 5IOZA 3WTZA 3EYIA 1FX7A 2O0YA 3GLLA 3O6BB 5M3FJ 2VE8A 1DPUA 3VFZA 2K85A 2RVCA 3QU6A 3CCMI 2VC1A 5GAEJ 1ZQ3P 4NC7A 5LD2C 4ZDLA 4U0YA 4YFXF 3O8HA 3TP3A 4FX0A 1UG0A 4RBOA 1KQ9A 3I71A 3GX4X 3ZN0A 4UVAA 2YX7A 3M8FA 1FP2A 2X9DA 2NVXJ 1RKWA 1MBKA 2X6XA 5B3SH 3WE2A 3OYHA 1USTA 5L3DA 2IVMA 1FBQA 2IRFG 3BR0A 1T8IA 3GBGA 1X4PA 3V8LA 3E6CC 2CUFA 2HVQA 4MEYF 1J2XA 3OIQA 4L5IA 3REOA 1UHMA 1ZR2A 2XAGA 3OIOA 3U2RA 5DS9A 3CMMA 3KLNA 3R0JA 3BR6A 2VKHA 3JW4A 4M74A 2K5CA 3J7YJ 1EH6A 1A6IA 2ME0A 3A01B 2LBFA 2BVLA 3GTKJ 3FKIJ 1GV2A 4HV5A 4M72A 4P5OA 2KMUA 3EQLF 4P1WA 4A3CJ 1IN5A 3RYPA 4DOZA 2Y0SN 2F5DA 1MMAA 5TRDA 2MH2A 2E1CA 2BY3A 5DM7F 2VJ5A 4FETA 3D5LA 2GAUA 2XF5A 1LVKA 3S3NA 3IRQA 4ON0A 3HRSA 1WQ2A 2OC6A 2ZMEC 4J01A 1Y1WJ 4BBSJ 1MSFC 5C44J 1G3WA 3DKYA 2FE3A 4JYKA 2ISZA 1DU6A 1VTNC 4L9TA 3S2WA 4OMZA 3SDGA 3K1PA 5BPDA 1ETQA 3K2AA 4RAZA 3ZQGA 5FLVA 2IBDA 1FOKA 2PFBA 4JOMA 2UUZA 2JRTA 1XG1A 3PQKA 4EVIA 3AAFA 4JBAA 2R5ZA 4XKCA 1STZA 4IHTA 2J5PA 5CVUA 2VOPA 2M8EA 2Y75A 1U6GA 1SMYF 2WC2A
chains in the Genus database with same CATH topology
2G7HA 2O61A 1QNTA 4MGRA 1KQ0A 3FM3A 5DV5A 1QPMA 3HTUA 3GWZA 5J8FA 3GFLA 1K79A 3KFWX 1XGOA 1XGMA 2IA2A 4M6XA 2FA5A 2OAZA 4PGHA 3QOPA 5FFZA 1XMAA 2MD5A 3WTWC 4KIFA 1T2KA 3RPUA 1I6XA 3SZTA 2Z3YA 4XSZF 2Z9OA 2HGCA 1HKTA 2IPQX 3RTRA 2ZKZA 1RI7A 2XV4S 4LGWA 2NYXA 3QRFF 1FP1D 2UXNA 2ZMEA 4A6EA 2XROA 2W57A 5EEGA 1DUXC 2QM3A 3ULQB 1V3FA 2UWMA 2V6CA 1ODDA 3E5UA 4U0VA 2H27A 3LQQA 4GCVA 2YX4A 1DDNA 2KIMA 4CDGA 1IXRC 3T1BA 2V1DA 1U8RA 2PJPA 4LLGF 4IF4A 3WTYC 1ON2A 1R1TA 4L9VA 3HIFA 3WGIA 2IA1A 5L3GA 1T6SA 2XASA 1JHFA 5LEKA 2V79A 2DU9A 3K0LA 2HFHA 2DK8A 2FOKA 3TOAA 4A5MA 3WU0A 5HDGA 2EA2A 1LQ1A 1O7LA 4HQMA 2LSOA 4E70A 2XAHA 4EJVA 2EV0A 4O5VA 1U5TB 3ZN1A 5FLXZ 2P5LC 3I5UA 1R22A 4Y15A 3DKWA 4NQWA 5FLXK 1XB4A 2DFIA 1TTYA 3L2CA 3CTAA 2XAQA 2DI3A 4KICA 1ZRFA 4JQFA 2MBFA 3TGNA 5L3FA 1T98A 2VXZA 4TV7A 2NRAC 1YFHA 4AIKA 1HQCA 2FMLA 2ZO4A 1O7FA 3OOPA 1MDMB 1W7PA 3TKYA 3JSPA 2O03A 4L5JA 3TOBA 3H3ZA 3IWZA 5JFRA 3COAC 2LDUA 3BPVA 5EEHA 3QPTA 3L09A 2QQBA 3RKWA 1UB9A 3GEZA 4IRGA 4ENMA 4LD5A 5DD8A 3QU3A 1Z91A 4LMYA 1I1GA 3F8NA 1W4MA 2HDCA 1U78A 1REPC 2VT2A 1J9IA 2J5OA 5DUIA 2WV0A 2A69F 4IRHA 1EH7A 2H94A 5LGUA 1IAWA 2HKOA 1FSHA 3R6SA 4RB0A 2CFXA 3E6BA 5F1RA 1GHCA 5CVIA 4GYIA 2D1VA 3IRRA 4PGGA 3E5QA 2FBIA 3GZ6A 1B9NA 3GFJA 4MEXF 1Z6RA 1Z6TA 3E97A 1KYWA 1B1BA 1YO5C 5IT3A 2Z33A 1R5HA 3G73A 4YFKF 5E1WA 3LAPA 2P7CB 4LLLA 2LNBA 1SAXA 1F5TA 4ZZLA 1IN7A 1YG2A 2W24A 2K4BA 3FM5A 2MLKA 1ON1A 2KIFA 4HA8A 1HSTA 4OIPF 2DT5A 2EFWA 1OMIA 2Y48A 1W5TA 1Y0UA 5K5OA 2XAJA 2ELHA 2YR2A 5BQTA 1YTYA 4ZZDA 3F6VA 2A6HF 4HX4A 2ADUA 1I5ZA 5FFXA 4LJZF 1TW3A 2W25A 4WX9A 2A6EF 1HW5A 4MNUA 1G3SA 1BI0A 3HRMA 4KN4X 3IL2A 1AWCA 3ZPLA 5D4RA 2QYOA 5FB2A 4RAYA 1O3QA 5JR3A 4Q47A 3DF8A 1SD5A 1HW2A 4FX4A 2K02A 2QQAA 3K1MA 5FD5A 3BY6A 4XLNF 5IT9Z 5CYVA 4KNYA 2ZXJA 2MC3A 1FC3A 2P7VB 5AONA 4KFCA 4M9ZA 2VODA 1Z7UA 2ZMEB 3EUHA 4I7HA 3OV8A 2B0LA 4U0WA 1SD6A 3M9AA 1TQMA 3KEQA 3Q9SA 1TW2A 2IJLA 5K1YA 1G4DA 2EFPA 2IT0A 5E8GA 1OYYA 3GUDA 2G7UA 1QZYA 3B73A 4U7BA 5CLSA 1FYKA 1LNWA 4RB1A 4NHJA 3DFGA 4HLYA 1IXSB 1BM9A 2ESHA 3LA7A 4RB2C 1MJBA 1XSXA 3CO6C 4G7OF 3V7CA 1Z1DA 4MQ9F 3BZ6A 1TNTA 4I2OA 2HKXA 2CW0F 4WK8F 1ONVA 3I4PA 1FY7A 4ZYDA 5FGMA 1R23A 3FWEA 4RGXA 3JAMK 3L7WA 4KN7X 2VBXA 1SFEA 3K2ZA 3WODF 4ESBA 4KYWA 2ZNZA 5D8LB 4QLCU 3SXYA 4IRIA 1J59A 5ILSA 5D5XB 4GGGA 1PP8F 3IKTA 3WTTC 1TQIA 1KQ8A 4HV6A 2XAFA 1KGSA 2DPDA 5BS6A 3I59B 2GQQA 2FQ3A 2CWEA 1O3TA 3RJPA 1P2FA 1ZARA 4R79A 2GA1A 3RI4A 3H3UA 3V7RA 4HX8A 1YW9A 1YS7A 5LBQA 3FX3A 4HDVA 5J6XA 2E7WA 1TQPA 2LF8A 2QLZA 2ESNA 3KZZA 1XCVA 3TO7A 4IJAA 2FBKA 3KETA 3DPTA 1SD4A 2EFNA 1S7AA 1SMTA 3ZMZA 4UVCA 3I0TA 5JHUA 1F9NA 4AWXB 5F64A 4JK1X 1R5GA 2KJCA 3BWGA 4BYYA 3P7NA 2V1XA 4HW0A 4RGUA 4QWQA 5HOOA 1O3RA 4UUVA 3LQRA 4ZYGA 1EV7A 3V4GA 4S04A 1B4AA 3GFMA 1UHWA 4MTEA 3W6KB 2WWYA 4HDUA 3MZYA 1LDKB 1USSA 4AD9A 5FD6A 3DV8A 5BPIA 4EGYA 2ISYA 1YW8A 3CUQC 4H0EA 3PFIA 1S7OA 3DQVC 1FSEA 1ZREA 3GLXA 4UXNA 1QBJA 1KYZA 1P4AA 2L4AA 2KKOA 2H6BA 1T38A 2EB7A 2D1HA 1E17A 4UNOA 2IW5A 1DP7P 3F8BA 2JZYA 2YPRA 3FMRA 1RUNA 1P6RA 5D6EA 4Q48A 4YIFA 4L0YB 3HYIA 4A5NA 1FBSA 3DXJF 3FXQA 1T39A 3N4MA 4A12A 1IN4A 2WTEA 4IHSA 3W6JB 3G3ZA 3F8FA 2M45A 4G94A 3VB2A 5LGTA 3R0AA 1B6AA 2QQ9A 4G9YA 2FNPA 1BC8C 2FSWA 3KLOA 4YIIA 2L54A 1XDUA 2EV6A 2CO5A 3MWMA 5ICFA 5ICEA 3J80Z 4L9NA 5HLIA 4G7ZF 3CUQA 3ZMDA 1WI9A 3J80K 3I53A 1KU9A 3GW2A 4HF0A 2STTA 5HLHA 2DPUA 2CGPA 3MQ0A 2X4HA 4M6YA 3SQNA 4XLPF 1SFXA 2GXBA 2VC0A 2DQRA 4P96A 4RGSA 3N97A 5D5WB 1NHAA 2HOEA 4LG0B 4BQAA 3E6DA 2W85A 5HDNA 4RS8A 2OQGA 4KIBA 4F7ZA 2DBBA 2VBZA 1XCBA 2MLGA 3GYHX 4I02A 2Q0OA 3L9FA 1IXCA 4OIQF 3WGGA 3E3VA 5LGNA 1J0RA 5DCMB 2HYGD 3E5XA 4ZYEA 1PDNC 5D8KB 2P4WA 2RDPA 4I98B 3VOEA 1ZYRF 1L3LA 1CF7B 3J81Z 2NNNA 4G8XA 4BHPA 2Q2EA 4PDKA 4XRFA 3J81K 1K78B 2GXGA 4IPAA 5E20A 2STWA 3ERED 2RN7A 2QENA 1U3EM 4M71A 1BN5A 4EM2A 1BC7C 5CVRA 4IXAA 2DQLA 3F23A 1J5YA 1IF1A 4P9UA 3TDUC 2IA0A 1HBXG 1RNLA 3C7JA 3FMSA 2LKPA 5LRRA 3K9TA 2P5VA 3IKVA 1FT9A 4K2EA 1QZZA 1R1VA 5D4SA 5JVTA 2H6CA 3ZMVA 2XGXA 5DCFA 5E8IA 2RQPA 4ENKA 1ZLJA 2JPBA 2F5CA 3P9KA 3IWFA 1MGTA 2XRNA 4CGZA 2QBYA 2CSOA 3HSRA 4ETSA 2GWRA 3R61A 2FEZA 3K1NA 3ABTA 1G6NA 2K7LA 3ML6A 4B09A 3WTUC 2E7XA 1FLIA 3CJNA 5AIQA 3VEPA 2M5WA 3C18A 3BJ6A 1XN7A 3MEXA 4OIOF 1BJAA 1CGPA 4ZYHA 1R7JA 2EK5A 5DYMA 4LLNA 2PMUA 3U1DA 2FU4A 2MH9A 4G6DA 1K7AA 2YSRA 2IP2A 2RKHA 3GZ5A 4KIGA 2ACJA 4HOBA 2XUBA 2OQRA 4KMUX 4D0PA 2P6SA 1TNSA 1R00A 3KP5A 2HZTA 5ICCA 2CG4A 3MAJA 1UCRA 2A5YB 4B8XA 4A0ZA 2XIGA 3JTHA 5LRSA 5KK1A 5DEQA 5TJJA 3RDIA 3WE3A 4OOIA 1KU2A 2VBWA 2OZ6A 1FZPB 2NAZA 2XKOA 1IW7F 2M1BA 4N9IA 2M30A 1XMKA 2R3SA 3Q5FA 1JHHA 4KT5C 5H6RA 1P4XA 3I64A 2BE5F 1QGPA 5E17F 2ZFWA 3IC7A 5ED4A 1SFUA 1BI3A 2Q8KA 2F2EA 3F21A 4KA4A 3SFZA 1F4KA 2FMYA 1C0WA 1A04A 2DW4A 2A68F 2OA4A 2BGCA 4UV9A 3M8EA 3GVAA 1F1ZA 3FHZA 4BHCA 3LFKA 4A0XA 4BNCA 1U5TA 4LK1F 2EA4A 3QAHA 5LHHA 3SZPA 1S8NA 5HLGA 2PBIA 4HLXA 3WU1B 2D2WA 4RB3C 3TO6A 2EFOA 1IN6A 1Q1HA 3WGHA 2HS5A 2QWWA 5E1XA 4ESFA 2AXLA 3JAMZ 3JSOA 2V1UA 3R60A 4OMYA 3F8CA 1JGSA 3RYRA 1FNNA 4WXCA 2PQ8A 1MDMA 3M7GA 1H0MA 3R4KA 4DQ2A 1B9MA 1TBXA 2ZNYA 4G6QA 5D5UB 1OYIA 2PEXA 4O6JA 3F3XA 3M1EA 4ENNA 1BI2A 4AIHA 5LHIA 3NRVA 5LEJA 1P92A 3QP5A 3CDHA 3IHUA 3BJAA 3ISPA 3RKXA 1UFMA 5E1ZB 1I27A 1MD0A 5DDGA 1K6OA 3ABUA 2A07F 4HF1A 2FNAA 3C1DA 4PCQA 1W7PB 2HYFA 4AVPA 2Z99A 1S6LA 1T0FA 4FHTA 1G3YA 2KJBA 2JTVA 3WTVC 3MFKA 2HEOA 1ZRDA 1B59A 3QP6A 5ICGA 5LLQA 3HRTA 5DD4A 2BEOA 4CXFA 3B02A 4BXUA 2H09A 4CHUA 1D5VA 3DPLC 3MZHA 5BMZA 1OPCA 4GXOA 3KP3A 3V8JA 3O3KA 2TDXA 3RIRA 3HHGA 2VN2A 1HKQA 4EJUA 1S29A 2C6YA 1HW1A 4G7HF 4EQQA 2QVOA 5E18F 3GO5A 2OZUA 3GXOA 3DP7A 4BAYA 1IRGA 4GO1A 1LB2A 3K69A 4EJOA 2CQKA 2PG4A 5ERIA 1FPQA 2K27A 1ZGAA 2QBYB 2D45A 2VT3A 3FZVA 3LSTA 2HTSA 3F72A 1MZBA 2VBYA 1FBUA 2HWVA 1U2WA 1I1SA 4ENJA 3HSEA 1W7PD 3HHHA 4OIRF 3BP8A 3P9CA 2PI0A 2EJRA 4N0BA 4O3MA 3FF5A 5L3EA 4KUMA 1YYVA 2R7FA 1KU7A 1D8JA 6PAXA 1KA8A 4ESJA 3ELKA 5ILUA 2COMA 1TLHB 3BJOA 4A0YA 4EV0A 4Q5SF 1FWZA 5LHGA 1IUYA 1WKMA 1MJAA 3RKYA 4L0ZB 2PN6A 4AIJA 3Q9VA 1H9GA 1OKRA 4XSXF 3L00A 1S3JA 3T5XA 1LDDA 2FF4A 3KZYA 3RPQA 5H20A 2GA2A 5ILVA 2O3FA 5L3BA 2HR3A 4DNCA 4YFNF 2DO7A 1PUEE 4LB5A 3DEUA 4CYDA 2F5FA 4N9HA 1BI1A 4FT8A 3ECOA 4ZH4F 2CYYA 4UV8A 2PMHA 2JT1A 3F6OA 4EM1A 1H9TA 5CVVA 3CO7C 3HRUA 1YQAA 1X3UA 4EJWA 1ULYA 2VONA 4LB6B 1E2XA 5DUKA 1OR7A 2BBYA 3F22A 2DLLA 2OBPA 3HTSB 3KP2A 1KU3A 3LA3A 3I54A 4CO8A 4OINF 2FXAA 4I0AA 1QQIA 1D8KA 1ZRCA 4BH9A 2X0LA 3ZMUA 1IZ1A 3P9IA 4EMSA 4WCGA 3NEUA 2OD5A 5H6QA 5BOXA 2FRHA 3F8MA 1EH8A 2DTRA 2P8TA 4NB5A 1YIOA 1OYWA 2M87A 1QO0D 4U7DA 1LJ9A 2Y0MA 2HQRA 4UVBA 1WWXA 3TDZC 4WXHA 3I59A 4WF2A 4MHGA 4MTDA 4RGRA 3D0SA 1L0OC 4Z2YA 4U88A 1SD7A 4CICA 1MKMA 4MQVA 4R8HA 2L3DA 4L18B 4PZJA 1JE8A 4HX7A 4EGZA 2K86A 1YS6A 2XVCA 2QZ8A 3BDDA 3LAJA 2ZCWA 2L02A 3E6MA 5F6FA 2RV8A 3O2PE 4YG2F 2P6TA 2GZWA 1IN8A 1V4RA 3KP7A 1R36A 1XSVA 4HF2A 2BV6A 3KE2A 3ZQ7A 3CUOA 3BPXA 3FXRA 1RUOA 1DPRA 1LEBA 4M9XA 2EWNA 4S05A 2NNYA 1G3TA 4BHBA 1P4WA 1LEAA 2G9WA 3HSFA 3V7SA 5JI6A 1HKSA 2V9VA 3LWFA 4HYEA 4HQEA 4UHTA 5AIPA 1ZLKA 3QPHA 3WTSC 1R1UA 5HS8A 4XBFA 5CVJA 2ETHA 2VOOA 4I01A 1Z05A 5D6FA 2KIUA 2KRFA 3FMQA 2ZJ2A 1FYLA 4GYGA 1LDJA 2EV5A 3PQJA 5FO5A 3ROUA 1J75A 2E1NA 1D3YA 2YU3A 2QUFA 1Z9CA 2K4JA 2XKPA 1FYMA 1BIAA 3VODA 1RZ4A 2HQNA 4KDPA 2R7DA 2LF7A 2A61A 2RC4A 3BROA 1ZHFA 1U5TC 4HBLA 3T8TA 3CLOA 2FBHA 3NQOA 1R58A 5K5QA 2O6GE 5HS7A 1XSDA 2O8XA 1HXDA 2GIVA 4M9SA 5J8CA 4A2UA 4A6DA 1ZG5A 2EFQA 4CZZA 5K5RA 2VE9A 2AS5F 1JXSA 1ZH5A 3MCZA 3HOSA 2DK5A 4I0BA 3BOQA 1XD7A 1ZAOA 2RNJA 1GXPA 1ZGJA 3WTXC 3KP4A 1O3SA 2MA3A 4LK0F 4HZFA 3T0YA 2NS0A 4WWCA 3SHFA 4P55A 1BBYA 3EETA 2A3SA 1WRJA 3FXUA 1IRFA 3J7AO 1RIOH 2P5KA 5IT9K 4WXDA 3I58A 4P9FA 2JSCA 3KP6A 2DAOA 2F5EA 4KMFA 4LG0A 3ECHA 3C3WA 1O57A 3ZMSA 3ZP5A 3GFIA 2L01A 2ZBKA 4Q4ZF 3U9GA 1PP7U 4R1HA 5D5VB 2RGVA 4IVNA 3HUGA 1YLFA 4LFUA 2BYVE 1YW7A 2L4MA 1GXQA 5KVRA 2HTJA 2W84A 4L9JA 4HAMA 3T8RA 3CUQB 2XHKA 2OU2A 5DCMA 3JTGA 3KCCA 1XGSA 1HSJA 3HOTA 1AOYA 2JPCA 4EJTA 5CJ9A 1WSUA 5HS9A 3GF2A 3H92A 1CF7A 1LVAA 3WG9A 4OU0A 3KEOA 1BIBA 3ZMTA 4Y17A 5HDKA 1ZG1A 5A2QZ 1K78A 1BOAA 3TQNA 5A2QK 2PLYA 4I09A 3LA2A 5L3CA 2UXXA 1XDSA 3EDPA 1ZG3A 4Y13A 1W5SA 1XGNA 2UZKA 3V8KA 3TO9A 4EM0B 1MJ9A 1J7KA 1GVJA 5HVQC 1ZN2A 2Z5UA 3EYYA 4ASNA 4M73A 3WTZA 3EYIA 1FX7A 2O0YA 3O6BB 2VE8A 1DPUA 3VFZA 2RVCA 3QU6A 2VC1A 4U0YA 4YFXF 4FX0A 1KQ9A 3I71A 3GX4X 3ZN0A 4UVAA 2YX7A 3M8FA 1FP2A 3WE2A 1USTA 5L3DA 2IVMA 1FBQA 2IRFG 3V8LA 3E6CC 4MEYF 1J2XA 4L5IA 3REOA 1UHMA 2XAGA 3U2RA 3KLNA 3R0JA 3JW4A 4M74A 1EH6A 4M72A 4HV5A 4P5OA 3EQLF 1IN5A 3RYPA 2F5DA 5TRDA 2MH2A 2E1CA 3D5LA 2GAUA 3IRQA 4ON0A 3HRSA 1WQ2A 1G3WA 2FE3A 2ISZA 1VTNC 4L9TA 3S2WA 4OMZA 3K1PA 5BPDA 4RAZA 1FOKA 2PFBA 2JRTA 3PQKA 4EVIA 3AAFA 4JBAA 1STZA 4IHTA 2J5PA 5CVUA 2VOPA 2M8EA 2Y75A 1U6GA 1SMYF 2WC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7H A;  2O61 A;  1QNT A;  4MGR A;  1KQ0 A;  3FM3 A;  5DV5 A;  1QPM A;  3HTU A;  3GWZ A;  5J8F A;  3GFL A;  1K79 A;  3KFW X;  1XGO A;  1XGM A;  2IA2 A;  4M6X A;  2FA5 A;  2OAZ A;  4PGH A;  3QOP A;  5FFZ A;  1XMA A;  2MD5 A;  3WTW C;  4KIF A;  1T2K A;  3RPU A;  1I6X A;  3SZT A;  2Z3Y A;  4XSZ F;  2Z9O A;  2HGC A;  1HKT A;  2IPQ X;  3RTR A;  2ZKZ A;  1RI7 A;  2XV4 S;  4LGW A;  2NYX A;  3QRF F;  1FP1 D;  2UXN A;  2ZME A;  4A6E A;  2XRO A;  2W57 A;  5EEG A;  1DUX C;  2QM3 A;  3ULQ B;  1V3F A;  2UWM A;  2V6C A;  1ODD A;  3E5U A;  4U0V A;  2H27 A;  3LQQ A;  4GCV A;  2YX4 A;  1DDN A;  2KIM A;  4CDG A;  1IXR C;  3T1B A;  2V1D A;  1U8R A;  2PJP A;  4LLG F;  4IF4 A;  3WTY C;  1ON2 A;  1R1T A;  4L9V A;  3HIF A;  3WGI A;  2IA1 A;  5L3G A;  1T6S A;  2XAS A;  1JHF A;  5LEK A;  2V79 A;  2DU9 A;  3K0L A;  2HFH A;  2DK8 A;  2FOK A;  3TOA A;  4A5M A;  3WU0 A;  5HDG A;  2EA2 A;  1LQ1 A;  1O7L A;  4HQM A;  2LSO A;  4E70 A;  2XAH A;  4EJV A;  2EV0 A;  4O5V A;  1U5T B;  3ZN1 A;  5FLX Z;  2P5L C;  3I5U A;  1R22 A;  4Y15 A;  3DKW A;  4NQW A;  5FLX K;  1XB4 A;  2DFI A;  1TTY A;  3L2C A;  3CTA A;  2XAQ A;  2DI3 A;  4KIC A;  1ZRF A;  4JQF A;  2MBF A;  3TGN A;  5L3F A;  1T98 A;  2VXZ A;  4TV7 A;  2NRA C;  1YFH A;  4AIK A;  1HQC A;  2FML A;  2ZO4 A;  1O7F A;  3OOP A;  1MDM B;  1W7P A;  3TKY A;  3JSP A;  2O03 A;  4L5J A;  3TOB A;  3H3Z A;  3IWZ A;  5JFR A;  3COA C;  2LDU A;  3BPV A;  5EEH A;  3QPT A;  3L09 A;  2QQB A;  3RKW A;  1UB9 A;  3GEZ A;  4IRG A;  4ENM A;  4LD5 A;  5DD8 A;  3QU3 A;  1Z91 A;  4LMY A;  1I1G A;  3F8N A;  1W4M A;  2HDC A;  1U78 A;  1REP C;  2VT2 A;  1J9I A;  2J5O A;  5DUI A;  2WV0 A;  2A69 F;  4IRH A;  1EH7 A;  2H94 A;  5LGU A;  1IAW A;  2HKO A;  1FSH A;  3R6S A;  4RB0 A;  2CFX A;  3E6B A;  5F1R A;  1GHC A;  5CVI A;  4GYI A;  2D1V A;  3IRR A;  4PGG A;  3E5Q A;  2FBI A;  3GZ6 A;  1B9N A;  3GFJ A;  4MEX F;  1Z6R A;  1Z6T A;  3E97 A;  1KYW A;  1B1B A;  1YO5 C;  5IT3 A;  2Z33 A;  1R5H A;  3G73 A;  4YFK F;  5E1W A;  3LAP A;  2P7C B;  4LLL A;  2LNB A;  1SAX A;  1F5T A;  4ZZL A;  1IN7 A;  1YG2 A;  2W24 A;  2K4B A;  3FM5 A;  2MLK A;  1ON1 A;  2KIF A;  4HA8 A;  1HST A;  4OIP F;  2DT5 A;  2EFW A;  1OMI A;  2Y48 A;  1W5T A;  1Y0U A;  5K5O A;  2XAJ A;  2ELH A;  2YR2 A;  5BQT A;  1YTY A;  4ZZD A;  3F6V A;  2A6H F;  4HX4 A;  2ADU A;  1I5Z A;  5FFX A;  4LJZ F;  1TW3 A;  2W25 A;  4WX9 A;  2A6E F;  1HW5 A;  4MNU A;  1G3S A;  1BI0 A;  3HRM A;  4KN4 X;  3IL2 A;  1AWC A;  3ZPL A;  5D4R A;  2QYO A;  5FB2 A;  4RAY A;  1O3Q A;  5JR3 A;  4Q47 A;  3DF8 A;  1SD5 A;  1HW2 A;  4FX4 A;  2K02 A;  2QQA A;  3K1M A;  5FD5 A;  3BY6 A;  4XLN F;  5IT9 Z;  5CYV A;  4KNY A;  2ZXJ A;  2MC3 A;  1FC3 A;  2P7V B;  5AON A;  4KFC A;  4M9Z A;  2VOD A;  1Z7U A;  2ZME B;  3EUH A;  4I7H A;  3OV8 A;  2B0L A;  4U0W A;  1SD6 A;  3M9A A;  1TQM A;  3KEQ A;  3Q9S A;  1TW2 A;  2IJL A;  5K1Y A;  1G4D A;  2EFP A;  2IT0 A;  5E8G A;  1OYY A;  3GUD A;  2G7U A;  1QZY A;  3B73 A;  4U7B A;  5CLS A;  1FYK A;  1LNW A;  4RB1 A;  4NHJ A;  3DFG A;  4HLY A;  1IXS B;  1BM9 A;  2ESH A;  3LA7 A;  4RB2 C;  1MJB A;  1XSX A;  3CO6 C;  4G7O F;  3V7C A;  1Z1D A;  4MQ9 F;  3BZ6 A;  1TNT A;  4I2O A;  2HKX A;  2CW0 F;  4WK8 F;  1ONV A;  3I4P A;  1FY7 A;  4ZYD A;  5FGM A;  1R23 A;  3FWE A;  4RGX A;  3JAM K;  3L7W A;  4KN7 X;  2VBX A;  1SFE A;  3K2Z A;  3WOD F;  4ESB A;  4KYW A;  2ZNZ A;  5D8L B;  4QLC U;  3SXY A;  4IRI A;  1J59 A;  5ILS A;  5D5X B;  4GGG A;  1PP8 F;  3IKT A;  3WTT C;  1TQI A;  1KQ8 A;  4HV6 A;  2XAF A;  1KGS A;  2DPD A;  5BS6 A;  3I59 B;  2GQQ A;  2FQ3 A;  2CWE A;  1O3T A;  3RJP A;  1P2F A;  1ZAR A;  4R79 A;  2GA1 A;  3RI4 A;  3H3U A;  3V7R A;  4HX8 A;  1YW9 A;  1YS7 A;  5LBQ A;  3FX3 A;  4HDV A;  5J6X A;  2E7W A;  1TQP A;  2LF8 A;  2QLZ A;  2ESN A;  3KZZ A;  1XCV A;  3TO7 A;  4IJA A;  2FBK A;  3KET A;  3DPT A;  1SD4 A;  2EFN A;  1S7A A;  1SMT A;  3ZMZ A;  4UVC A;  3I0T A;  5JHU A;  1F9N A;  4AWX B;  5F64 A;  4JK1 X;  1R5G A;  2KJC A;  3BWG A;  4BYY A;  3P7N A;  2V1X A;  4HW0 A;  4RGU A;  4QWQ A;  5HOO A;  1O3R A;  4UUV A;  3LQR A;  4ZYG A;  1EV7 A;  3V4G A;  4S04 A;  1B4A A;  3GFM A;  1UHW A;  4MTE A;  3W6K B;  2WWY A;  4HDU A;  3MZY A;  1LDK B;  1USS A;  4AD9 A;  5FD6 A;  3DV8 A;  5BPI A;  4EGY A;  2ISY A;  1YW8 A;  3CUQ C;  4H0E A;  3PFI A;  1S7O A;  3DQV C;  1FSE A;  1ZRE A;  3GLX A;  4UXN A;  1QBJ A;  1KYZ A;  1P4A A;  2L4A A;  2KKO A;  2H6B A;  1T38 A;  2EB7 A;  2D1H A;  1E17 A;  4UNO A;  2IW5 A;  1DP7 P;  3F8B A;  2JZY A;  2YPR A;  3FMR A;  1RUN A;  1P6R A;  5D6E A;  4Q48 A;  4YIF A;  4L0Y B;  3HYI A;  4A5N A;  1FBS A;  3DXJ F;  3FXQ A;  1T39 A;  3N4M A;  4A12 A;  1IN4 A;  2WTE A;  4IHS A;  3W6J B;  3G3Z A;  3F8F A;  2M45 A;  4G94 A;  3VB2 A;  5LGT A;  3R0A A;  1B6A A;  2QQ9 A;  4G9Y A;  2FNP A;  1BC8 C;  2FSW A;  3KLO A;  4YII A;  2L54 A;  1XDU A;  2EV6 A;  2CO5 A;  3MWM A;  5ICF A;  5ICE A;  3J80 Z;  4L9N A;  5HLI A;  4G7Z F;  3CUQ A;  3ZMD A;  1WI9 A;  3J80 K;  3I53 A;  1KU9 A;  3GW2 A;  4HF0 A;  2STT A;  5HLH A;  2DPU A;  2CGP A;  3MQ0 A;  2X4H A;  4M6Y A;  3SQN A;  4XLP F;  1SFX A;  2GXB A;  2VC0 A;  2DQR A;  4P96 A;  4RGS A;  3N97 A;  5D5W B;  1NHA A;  2HOE A;  4LG0 B;  4BQA A;  3E6D A;  2W85 A;  5HDN A;  4RS8 A;  2OQG A;  4KIB A;  4F7Z A;  2DBB A;  2VBZ A;  1XCB A;  2MLG A;  3GYH X;  4I02 A;  2Q0O A;  3L9F A;  1IXC A;  4OIQ F;  3WGG A;  3E3V A;  5LGN A;  1J0R A;  5DCM B;  2HYG D;  3E5X A;  4ZYE A;  1PDN C;  5D8K B;  2P4W A;  2RDP A;  4I98 B;  3VOE A;  1ZYR F;  1L3L A;  1CF7 B;  3J81 Z;  2NNN A;  4G8X A;  4BHP A;  2Q2E A;  4PDK A;  4XRF A;  3J81 K;  1K78 B;  2GXG A;  4IPA A;  5E20 A;  2STW A;  3ERE D;  2RN7 A;  2QEN A;  1U3E M;  4M71 A;  1BN5 A;  4EM2 A;  1BC7 C;  5CVR A;  4IXA A;  2DQL A;  3F23 A;  1J5Y A;  1IF1 A;  4P9U A;  3TDU C;  2IA0 A;  1HBX G;  1RNL A;  3C7J A;  3FMS A;  2LKP A;  5LRR A;  3K9T A;  2P5V A;  3IKV A;  1FT9 A;  4K2E A;  1QZZ A;  1R1V A;  5D4S A;  5JVT A;  2H6C A;  3ZMV A;  2XGX A;  5DCF A;  5E8I A;  2RQP A;  4ENK A;  1ZLJ A;  2JPB A;  2F5C A;  3P9K A;  3IWF A;  1MGT A;  2XRN A;  4CGZ A;  2QBY A;  2CSO A;  3HSR A;  4ETS A;  2GWR A;  3R61 A;  2FEZ A;  3K1N A;  3ABT A;  1G6N A;  2K7L A;  3ML6 A;  4B09 A;  3WTU C;  2E7X A;  1FLI A;  3CJN A;  5AIQ A;  3VEP A;  2M5W A;  3C18 A;  3BJ6 A;  1XN7 A;  3MEX A;  4OIO F;  1BJA A;  1CGP A;  4ZYH A;  1R7J A;  2EK5 A;  5DYM A;  4LLN A;  2PMU A;  3U1D A;  2FU4 A;  2MH9 A;  4G6D A;  1K7A A;  2YSR A;  2IP2 A;  2RKH A;  3GZ5 A;  4KIG A;  2ACJ A;  4HOB A;  2XUB A;  2OQR A;  4KMU X;  4D0P A;  2P6S A;  1TNS A;  1R00 A;  3KP5 A;  2HZT A;  5ICC A;  2CG4 A;  3MAJ A;  1UCR A;  2A5Y B;  4B8X A;  4A0Z A;  2XIG A;  3JTH A;  5LRS A;  5KK1 A;  5DEQ A;  5TJJ A;  3RDI A;  3WE3 A;  4OOI A;  1KU2 A;  2VBW A;  2OZ6 A;  1FZP B;  2NAZ A;  2XKO A;  1IW7 F;  2M1B A;  4N9I A;  2M30 A;  1XMK A;  2R3S A;  3Q5F A;  1JHH A;  4KT5 C;  5H6R A;  1P4X A;  3I64 A;  2BE5 F;  1QGP A;  5E17 F;  2ZFW A;  3IC7 A;  5ED4 A;  1SFU A;  1BI3 A;  2Q8K A;  2F2E A;  3F21 A;  4KA4 A;  3SFZ A;  1F4K A;  2FMY A;  1C0W A;  1A04 A;  2DW4 A;  2A68 F;  2OA4 A;  2BGC A;  4UV9 A;  3M8E A;  3GVA A;  1F1Z A;  3FHZ A;  4BHC A;  3LFK A;  4A0X A;  4BNC A;  1U5T A;  4LK1 F;  2EA4 A;  3QAH A;  5LHH A;  3SZP A;  1S8N A;  5HLG A;  2PBI A;  4HLX A;  3WU1 B;  2D2W A;  4RB3 C;  3TO6 A;  2EFO A;  1IN6 A;  1Q1H A;  3WGH A;  2HS5 A;  2QWW A;  5E1X A;  4ESF A;  2AXL A;  3JAM Z;  3JSO A;  2V1U A;  3R60 A;  4OMY A;  3F8C A;  1JGS A;  3RYR A;  1FNN A;  4WXC A;  2PQ8 A;  1MDM A;  3M7G A;  1H0M A;  3R4K A;  4DQ2 A;  1B9M A;  1TBX A;  2ZNY A;  4G6Q A;  5D5U B;  1OYI A;  2PEX A;  4O6J A;  3F3X A;  3M1E A;  4ENN A;  1BI2 A;  4AIH A;  5LHI A;  3NRV A;  5LEJ A;  1P92 A;  3QP5 A;  3CDH A;  3IHU A;  3BJA A;  3ISP A;  3RKX A;  1UFM A;  5E1Z B;  1I27 A;  1MD0 A;  5DDG A;  1K6O A;  3ABU A;  2A07 F;  4HF1 A;  2FNA A;  3C1D A;  4PCQ A;  1W7P B;  2HYF A;  4AVP A;  2Z99 A;  1S6L A;  1T0F A;  4FHT A;  1G3Y A;  2KJB A;  2JTV A;  3WTV C;  3MFK A;  2HEO A;  1ZRD A;  1B59 A;  3QP6 A;  5ICG A;  5LLQ A;  3HRT A;  5DD4 A;  2BEO A;  4CXF A;  3B02 A;  4BXU A;  2H09 A;  4CHU A;  1D5V A;  3DPL C;  3MZH A;  5BMZ A;  1OPC A;  4GXO A;  3KP3 A;  3V8J A;  3O3K A;  2TDX A;  3RIR A;  3HHG A;  2VN2 A;  1HKQ A;  4EJU A;  1S29 A;  2C6Y A;  1HW1 A;  4G7H F;  4EQQ A;  2QVO A;  5E18 F;  3GO5 A;  2OZU A;  3GXO A;  3DP7 A;  4BAY A;  1IRG A;  4GO1 A;  1LB2 A;  3K69 A;  4EJO A;  2CQK A;  2PG4 A;  5ERI A;  1FPQ A;  2K27 A;  1ZGA A;  2QBY B;  2D45 A;  2VT3 A;  3FZV A;  3LST A;  2HTS A;  3F72 A;  1MZB A;  2VBY A;  1FBU A;  2HWV A;  1U2W A;  1I1S A;  4ENJ A;  3HSE A;  1W7P D;  3HHH A;  4OIR F;  3BP8 A;  3P9C A;  2PI0 A;  2EJR A;  4N0B A;  4O3M A;  3FF5 A;  5L3E A;  4KUM A;  1YYV A;  2R7F A;  1KU7 A;  1D8J A;  6PAX A;  1KA8 A;  4ESJ A;  3ELK A;  5ILU A;  2COM A;  1TLH B;  3BJO A;  4A0Y A;  4EV0 A;  4Q5S F;  1FWZ A;  5LHG A;  1IUY A;  1WKM A;  1MJA A;  3RKY A;  4L0Z B;  2PN6 A;  4AIJ A;  3Q9V A;  1H9G A;  1OKR A;  4XSX F;  3L00 A;  1S3J A;  3T5X A;  1LDD A;  2FF4 A;  3KZY A;  3RPQ A;  5H20 A;  2GA2 A;  5ILV A;  2O3F A;  5L3B A;  2HR3 A;  4DNC A;  4YFN F;  2DO7 A;  1PUE E;  4LB5 A;  3DEU A;  4CYD A;  2F5F A;  4N9H A;  1BI1 A;  4FT8 A;  3ECO A;  4ZH4 F;  2CYY A;  4UV8 A;  2PMH A;  2JT1 A;  3F6O A;  4EM1 A;  1H9T A;  5CVV A;  3CO7 C;  3HRU A;  1YQA A;  1X3U A;  4EJW A;  1ULY A;  2VON A;  4LB6 B;  1E2X A;  5DUK A;  1OR7 A;  2BBY A;  3F22 A;  2DLL A;  2OBP A;  3HTS B;  3KP2 A;  1KU3 A;  3LA3 A;  3I54 A;  4CO8 A;  4OIN F;  2FXA A;  4I0A A;  1QQI A;  1D8K A;  1ZRC A;  4BH9 A;  2X0L A;  3ZMU A;  1IZ1 A;  3P9I A;  4EMS A;  4WCG A;  3NEU A;  2OD5 A;  5H6Q A;  5BOX A;  2FRH A;  3F8M A;  1EH8 A;  2DTR A;  2P8T A;  4NB5 A;  1YIO A;  1OYW A;  2M87 A;  1QO0 D;  4U7D A;  1LJ9 A;  2Y0M A;  2HQR A;  4UVB A;  1WWX A;  3TDZ C;  4WXH A;  3I59 A;  4WF2 A;  4MHG A;  4MTD A;  4RGR A;  3D0S A;  1L0O C;  4Z2Y A;  4U88 A;  1SD7 A;  4CIC A;  1MKM A;  4MQV A;  4R8H A;  2L3D A;  4L18 B;  4PZJ A;  1JE8 A;  4HX7 A;  4EGZ A;  2K86 A;  1YS6 A;  2XVC A;  2QZ8 A;  3BDD A;  3LAJ A;  2ZCW A;  2L02 A;  3E6M A;  5F6F A;  2RV8 A;  3O2P E;  4YG2 F;  2P6T A;  2GZW A;  1IN8 A;  1V4R A;  3KP7 A;  1R36 A;  1XSV A;  4HF2 A;  2BV6 A;  3KE2 A;  3ZQ7 A;  3CUO A;  3BPX A;  3FXR A;  1RUO A;  1DPR A;  1LEB A;  4M9X A;  2EWN A;  4S05 A;  2NNY A;  1G3T A;  4BHB A;  1P4W A;  1LEA A;  2G9W A;  3HSF A;  3V7S A;  5JI6 A;  1HKS A;  2V9V A;  3LWF A;  4HYE A;  4HQE A;  4UHT A;  5AIP A;  1ZLK A;  3QPH A;  3WTS C;  1R1U A;  5HS8 A;  4XBF A;  5CVJ A;  2ETH A;  2VOO A;  4I01 A;  1Z05 A;  5D6F A;  2KIU A;  2KRF A;  3FMQ A;  2ZJ2 A;  1FYL A;  4GYG A;  1LDJ A;  2EV5 A;  3PQJ A;  5FO5 A;  3ROU A;  1J75 A;  2E1N A;  1D3Y A;  2YU3 A;  2QUF A;  1Z9C A;  2K4J A;  2XKP A;  1FYM A;  1BIA A;  3VOD A;  1RZ4 A;  2HQN A;  4KDP A;  2R7D A;  2LF7 A;  2A61 A;  2RC4 A;  3BRO A;  1ZHF A;  1U5T C;  4HBL A;  3T8T A;  3CLO A;  2FBH A;  3NQO A;  1R58 A;  5K5Q A;  2O6G E;  5HS7 A;  1XSD A;  2O8X A;  1HXD A;  2GIV A;  4M9S A;  5J8C A;  4A2U A;  4A6D A;  1ZG5 A;  2EFQ A;  4CZZ A;  5K5R A;  2VE9 A;  2AS5 F;  1JXS A;  1ZH5 A;  3MCZ A;  3HOS A;  2DK5 A;  4I0B A;  3BOQ A;  1XD7 A;  1ZAO A;  2RNJ A;  1GXP A;  1ZGJ A;  3WTX C;  3KP4 A;  1O3S A;  2MA3 A;  4LK0 F;  4HZF A;  3T0Y A;  2NS0 A;  4WWC A;  3SHF A;  4P55 A;  1BBY A;  3EET A;  2A3S A;  1WRJ A;  3FXU A;  1IRF A;  3J7A O;  1RIO H;  2P5K A;  5IT9 K;  4WXD A;  3I58 A;  4P9F A;  2JSC A;  3KP6 A;  2DAO A;  2F5E A;  4KMF A;  4LG0 A;  3ECH A;  3C3W A;  1O57 A;  3ZMS A;  3ZP5 A;  3GFI A;  2L01 A;  2ZBK A;  4Q4Z F;  3U9G A;  1PP7 U;  4R1H A;  5D5V B;  2RGV A;  4IVN A;  3HUG A;  1YLF A;  4LFU A;  2BYV E;  1YW7 A;  2L4M A;  1GXQ A;  5KVR A;  2HTJ A;  2W84 A;  4L9J A;  4HAM A;  3T8R A;  3CUQ B;  2XHK A;  2OU2 A;  5DCM A;  3JTG A;  3KCC A;  1XGS A;  1HSJ A;  3HOT A;  1AOY A;  2JPC A;  4EJT A;  5CJ9 A;  1WSU A;  5HS9 A;  3GF2 A;  3H92 A;  1CF7 A;  1LVA A;  3WG9 A;  4OU0 A;  3KEO A;  1BIB A;  3ZMT A;  4Y17 A;  5HDK A;  1ZG1 A;  5A2Q Z;  1K78 A;  1BOA A;  3TQN A;  5A2Q K;  2PLY A;  4I09 A;  3LA2 A;  5L3C A;  2UXX A;  1XDS A;  3EDP A;  1ZG3 A;  4Y13 A;  1W5S A;  1XGN A;  2UZK A;  3V8K A;  3TO9 A;  4EM0 B;  1MJ9 A;  1J7K A;  1GVJ A;  5HVQ C;  1ZN2 A;  2Z5U A;  3EYY A;  4ASN A;  4M73 A;  3WTZ A;  3EYI A;  1FX7 A;  2O0Y A;  3O6B B;  2VE8 A;  1DPU A;  3VFZ A;  2RVC A;  3QU6 A;  2VC1 A;  4U0Y A;  4YFX F;  4FX0 A;  1KQ9 A;  3I71 A;  3GX4 X;  3ZN0 A;  4UVA A;  2YX7 A;  3M8F A;  1FP2 A;  3WE2 A;  1UST A;  5L3D A;  2IVM A;  1FBQ A;  2IRF G;  3V8L A;  3E6C C;  4MEY F;  1J2X A;  4L5I A;  3REO A;  1UHM A;  2XAG A;  3U2R A;  3KLN A;  3R0J A;  3JW4 A;  4M74 A;  1EH6 A;  4M72 A;  4HV5 A;  4P5O A;  3EQL F;  1IN5 A;  3RYP A;  2F5D A;  5TRD A;  2MH2 A;  2E1C A;  3D5L A;  2GAU A;  3IRQ A;  4ON0 A;  3HRS A;  1WQ2 A;  1G3W A;  2FE3 A;  2ISZ A;  1VTN C;  4L9T A;  3S2W A;  4OMZ A;  3K1P A;  5BPD A;  4RAZ A;  1FOK A;  2PFB A;  2JRT A;  3PQK A;  4EVI A;  3AAF A;  4JBA A;  1STZ A;  4IHT A;  2J5P A;  5CVU A;  2VOP A;  2M8E A;  2Y75 A;  1U6G A;  1SMY F;  2WC2 A; 
#chains in the Genus database with same CATH topology
 3IUO A;  4XRM A;  1MND A;  2CUZ A;  4UUS B;  4DYR A;  2G7H A;  4E7L A;  2M4G A;  2O61 A;  1QNT A;  1TWC J;  3X2Q H;  4MGR A;  3OYC A;  3GTM J;  1KQ0 A;  5C4J J;  3FM3 A;  5DV5 A;  1CF7 A;  2DDA A;  2OPT A;  3K4M A;  2EIN H;  1QPM A;  3HTU A;  4XN0 A;  2R0Q C;  2HI3 A;  1BJZ A;  3GWZ A;  3A02 A;  1B8I B;  5J8F A;  3CCE I;  1MH4 A;  3PSI A;  3GFL A;  1K79 A;  1BOB A;  2XPW A;  3KFW X;  1XGO A;  1JJ6 C;  1XGM A;  1JKP C;  2IA2 A;  4M6X A;  2QSH X;  2FA5 A;  2OAZ A;  4PGH A;  4A3F J;  3QOP A;  3ZQC A;  3J7A Y;  5FFZ A;  1XMA A;  3CP2 A;  2MD5 A;  3BR1 A;  3WTW C;  4XL9 A;  3GTJ J;  4KIF A;  2DTZ A;  1T2K A;  3RPU A;  1I6X A;  2M0M A;  3SZT A;  1NTC A;  2HQ5 A;  2KP6 A;  2Z3Y A;  2OUM A;  1OJL A;  4XSZ F;  2Z9O A;  2CV2 A;  2HGC A;  2JA8 J;  2X1D A;  1HKT A;  2IPQ X;  3RTR A;  2ZKZ A;  1RI7 A;  2EQR A;  4A3B J;  2CFO A;  2XV4 S;  3DPU A;  4LGW A;  2NYX A;  5HNF A;  2ZXI A;  2FD5 A;  3QRF F;  2V26 A;  5GAD J;  5IP9 J;  5J40 A;  1FP1 D;  2UXN A;  2ZME A;  5FLX R;  4A6E A;  2DA1 A;  4CSW A;  2HQA A;  2OTJ I;  2XRO A;  2W57 A;  3LSK A;  5EEG A;  1DUX C;  3PNY A;  2QM3 A;  4M6V A;  4AC0 A;  3ULQ B;  1V3F A;  2UWM A;  3K4N A;  2L7K A;  1MIJ A;  2K3F A;  2V6C A;  2MGQ A;  1ODD A;  3E5U A;  4U0V A;  2FJ1 A;  2H27 A;  1G8X A;  3LQQ A;  2L9R A;  5K7H A;  1TT0 A;  1PVE A;  3LFU A;  1TZL A;  4GCV A;  2YX4 A;  3G1L A;  3ASO H;  3NWT A;  1NK2 P;  1DDN A;  2KIM A;  4CDG A;  1NK3 P;  1IXR C;  3T1B A;  4BUP A;  2BHZ A;  2V1D A;  3CMA I;  1U8R A;  5B1B H;  2PJP A;  4LLG F;  2K9Q A;  4IF4 A;  3WTY C;  5B5E C;  2IS2 A;  4I6Z A;  1ON2 A;  3JRE A;  1R1T A;  4L9V A;  3HIF A;  2H1K A;  4XM3 A;  3WGI A;  4BAC A;  1LFU P;  1OCC H;  2IA1 A;  3S8P A;  5M5Y J;  3OYF A;  5L3G A;  2V6E A;  2VL8 A;  1T6S A;  2XAS A;  3CJQ B;  3IH2 A;  2LD5 A;  2K3P A;  1JHF A;  3AG3 H;  3HOY J;  1BW5 A;  3O8G A;  2RAE A;  5LEK A;  2GOX B;  2V79 A;  2E5Z A;  2H8W A;  2DU9 A;  3K0L A;  2HFH A;  2DK8 A;  3KYC B;  3VWB A;  2AXT C;  2FOK A;  3OR1 C;  3OYA A;  4S0H B;  1AHD P;  3TOA A;  4A3D J;  4A5M A;  3WU0 A;  5HDG A;  2KFD A;  2EA2 A;  4DYC A;  2VQL A;  1LQ1 A;  3VYU B;  4NUB A;  1O7L A;  4X0G A;  4YEJ A;  4HQM A;  2LSO A;  4E70 A;  4RMN A;  2XAH A;  3DLL F;  1FOX A;  4RLQ A;  5M5W J;  4EJV A;  2EV0 A;  4O5V A;  1U5T B;  3ZN1 A;  5FLX Z;  2NVQ J;  2P5L C;  3I5U A;  1MBH A;  2V1N A;  2L7M P;  2M8G X;  1R22 A;  4Y15 A;  3DKW A;  4NQW A;  1Y8R B;  5FLX K;  1XB4 A;  2KT0 A;  1DGR M;  5BNG A;  1ZEL A;  2DFI A;  1XTA A;  1TTY A;  3L2C A;  3CTA A;  1RR7 A;  1B72 A;  3MKW B;  2XAQ A;  3HPH A;  2DI3 A;  4LG3 A;  3S16 J;  2B7E A;  2VKE A;  4KIC A;  5KAI C;  3G2B A;  2M2E A;  1ZRF A;  4JQF A;  2KQR A;  2MBF A;  2E19 A;  3TGN A;  2JN6 A;  5L3F A;  1T98 A;  2VXZ A;  4TV7 A;  2NRA C;  3H9G A;  3HJE A;  4XRS G;  1YFH A;  2HOA A;  5IOY A;  2F48 A;  4AIK A;  1HQC A;  4JX5 A;  2FML A;  2ELJ A;  3OYG A;  3LSP A;  2DXI A;  2LYC A;  3L2Q A;  2ZO4 A;  1O7F A;  3OOP A;  1MDM B;  1UJ8 A;  1W7P A;  3TKY A;  4IQJ A;  3JSP A;  2O03 A;  4L5J A;  1UZC A;  3TOB A;  3CMY A;  3H3Z A;  3IWZ A;  5JFR A;  2IAI A;  1W36 D;  4RAG A;  2ZC2 A;  3COA C;  2CQQ A;  1YIJ I;  1R4N B;  2LDU A;  4B48 A;  3CES A;  3BPV A;  4QIW N;  5EEH A;  3QPT A;  1A31 A;  3KPH A;  4BL0 B;  1MMD A;  2HXI A;  3L09 A;  1LKX A;  2QQB A;  2R7Z J;  3RKW A;  3JRG A;  1UB9 A;  2DYR H;  3GEZ A;  4IRG A;  4CCN A;  4ENM A;  4LD5 A;  2E1M B;  5DD8 A;  2JQ7 A;  2QSF X;  3LSH A;  4BY1 J;  3QU3 A;  1Z91 A;  4LMY A;  1IC8 A;  2MZ4 A;  1I50 J;  3MMY B;  1I1G A;  3F8N A;  3KYL A;  1W4M A;  1YRN A;  4LIT A;  2HDC A;  3CCJ I;  9ANT A;  1Z3Y A;  2GOM A;  1T08 B;  3GTL J;  1U78 A;  1REP C;  4XLE A;  3VYR B;  1FMV A;  2VT2 A;  1J9I A;  2J5O A;  1YE9 A;  5DUI A;  2HPI A;  2WV0 A;  2A69 F;  2KRC A;  4V2G A;  1PJR A;  1EH7 A;  2H94 A;  2V9K A;  4G6T B;  4IRH A;  5LGU A;  1IAW A;  5E3M A;  3CCR I;  2HKO A;  1FSH A;  4BKX A;  3R6S A;  4RB0 A;  1JUM A;  2CFX A;  3E6B A;  3K4K A;  2X1C A;  5F1R A;  3WHB A;  1GHC A;  2F4O B;  5CVI A;  4ZDP A;  4GYI A;  2D1V A;  3IRR A;  3OOU A;  4PGG A;  1WVR A;  2VJ4 A;  3E5Q A;  2FBI A;  1D1C A;  3GZ6 A;  1B9N A;  3AFH A;  3GFJ A;  4MEX F;  3G4S I;  1Z6R A;  4BDZ A;  1Z6T A;  2ZSH B;  3E97 A;  2VKV A;  3I4M J;  1KYW A;  1HA8 A;  1B1B A;  2BZT A;  2M3A A;  5IT3 A;  1YO5 C;  3W2W A;  2Z33 A;  1VQO I;  2JUC A;  5M5X J;  4C30 A;  1PUF A;  3IAM 2;  1R5H A;  2W4S A;  2HOT A;  3G73 A;  5EEA A;  2VB6 A;  4YFK F;  3DEW A;  4IX7 A;  5E1W A;  3LAP A;  1EJ9 A;  5IT9 R;  2P7C B;  4LLL A;  2LNB A;  5GPA A;  1SAX A;  1F5T A;  4ZZL A;  1IN7 A;  3DEE A;  3DCF A;  1WPK A;  4C3J J;  2KL4 A;  1YG2 A;  2W24 A;  3H0D A;  2K4B A;  2OTL I;  3CCS I;  3EUH C;  4PJL A;  3FM5 A;  2DA5 A;  3TMO A;  2MLK A;  4BXX J;  1ON1 A;  2KIF A;  5H2F C;  4F93 B;  2DCE A;  4HA8 A;  1HST A;  3I9V 2;  4OIP F;  2DT5 A;  2EFW A;  1OMI A;  2IGM A;  2E1O A;  3QYB A;  3ZXS A;  2Y48 A;  4A3J J;  1W5T A;  2LY9 A;  1Y0U A;  5K5O A;  2XAJ A;  2PJR A;  5CQE A;  2ELH A;  1IUF A;  2YR2 A;  5BQT A;  2DT6 A;  3IV5 A;  4A3I J;  3CC4 I;  1FEX A;  1DU0 A;  5FRN A;  3S2H J;  1YX3 A;  3OL3 A;  1UMQ A;  1YTY A;  2EIM H;  3RQI A;  3G1M A;  4ZZD A;  3F6V A;  2A6H F;  4HX4 A;  2ADU A;  2LG4 A;  1YJN I;  1I5Z A;  5FFX A;  5GAG J;  4LJZ F;  2DOD A;  1TW3 A;  2Y2Z A;  2E71 A;  1HC8 A;  2W25 A;  4WX9 A;  2F4M B;  1N78 A;  3I56 I;  2JRM A;  2A6E F;  4B3A A;  4JP0 A;  1HW5 A;  1MH3 A;  4MLO A;  4MNU A;  1G3S A;  1BI0 A;  3HRM A;  1K4T A;  3H35 A;  4KN4 X;  1ZTR A;  2W82 A;  3IL2 A;  1AWC A;  3ZPL A;  5D4R A;  2QYO A;  5FB2 A;  2E36 A;  4RAY A;  4F91 B;  2XGE A;  4RAF A;  1O3Q A;  5JR3 A;  4XKV A;  4Q47 A;  2MFZ A;  3DF8 A;  1SD5 A;  1HW2 A;  4FX4 A;  2ECB A;  2K02 A;  1FOW A;  2BW3 A;  1OIS A;  2QQA A;  3K1M A;  2NXN B;  5FD5 A;  4F55 A;  3BY6 A;  1WZ2 A;  3WHC A;  2AQF A;  4XLN F;  5IT9 Z;  1A5J A;  5CYV A;  4KNY A;  2XDV A;  2ZXJ A;  2IS6 A;  2QEX I;  2MC3 A;  3B6C A;  1FC3 A;  4XMY A;  2P7V B;  4E7S A;  3BG6 A;  3FXO A;  4C9Y A;  1MNE A;  5DTD A;  4NC8 A;  5AON A;  4KFC A;  4M9Z A;  2VOD A;  3CJR B;  1Z7U A;  2ZME B;  3EUH A;  3K4B A;  3S1R J;  4I7H A;  2DOF A;  3OV8 A;  4L5E A;  2B0L A;  2CS3 A;  4U0W A;  2XB5 A;  4IKF A;  1SD6 A;  1QRY A;  1WHU A;  2BXY A;  3M9A A;  4RM3 A;  1TQM A;  3KEQ A;  3Q9S A;  3Q0W A;  4EEF G;  2MW8 A;  5TIS C;  1TW2 A;  3CCQ I;  2IJL A;  5K1Y A;  2VQH A;  2EFP A;  1G4D A;  2IGO A;  2IT0 A;  5E8G A;  1OYY A;  3GUD A;  2WAQ N;  2G7U A;  1QZY A;  3B73 A;  4U7B A;  3FKJ A;  3J7Z I;  5CLS A;  1FYK A;  1LNW A;  4RB1 A;  3QYF A;  3ZCO A;  1SAU A;  4NHJ A;  3DFG A;  4HLY A;  3L1P A;  5EGO B;  1IXS B;  2R5Y A;  1ERD A;  2XPU A;  1BM9 A;  2ESH A;  3LA7 A;  2K9S A;  3OYB A;  4RB2 C;  2LKX A;  4BS9 A;  1K6Y A;  5GPC A;  1MJB A;  1XSX A;  3I55 I;  3CO6 C;  4G7O F;  3V7C A;  2Y9Z A;  1Z1D A;  3L2U A;  1V55 H;  3RKQ A;  4I99 C;  4BDY A;  3OYL A;  4D5F A;  1XS9 A;  4MQ9 F;  1BL0 A;  3BZ6 A;  3ZQL A;  4BQN A;  1TNT A;  3HPG A;  4I2O A;  2HKX A;  3CCU I;  1Y0N A;  2CW0 F;  4PFP A;  1JI8 A;  2Y9Y A;  4WK8 F;  1JKR C;  1ONV A;  3BCB A;  5F04 A;  1RR8 C;  3I4P A;  2JWT A;  1AU7 A;  1FY7 A;  2HVS A;  4OWR B;  4ZYD A;  2JUG A;  5FGM A;  1R23 A;  1Z67 A;  2Q1Z B;  1RPW A;  2EZK A;  3ERM A;  3FWE A;  4PK4 A;  4RGX A;  1RRJ A;  3JAM K;  3L7W A;  4KN7 X;  3RPU D;  1IRZ A;  1LPQ A;  5KNL A;  3VPR A;  2VBX A;  1SFE A;  3K2Z A;  3WOD F;  2A6T A;  4ESB A;  1DGW Y;  2JJ7 A;  2PMZ N;  2ZNZ A;  5D8L B;  3AG1 H;  4QLC U;  3SXY A;  4KYW A;  3PO2 J;  2CU7 A;  2GBY A;  4IRI A;  2VKD A;  3ZQH A;  2IS4 A;  3AL0 B;  4BJ6 C;  3D5R C;  1J59 A;  1W0U A;  1SVM A;  5ILS A;  2X1E A;  5D5X B;  4GGG A;  1PP8 F;  4X6A J;  3CDI A;  3IKT A;  3S93 A;  3WTT C;  1D1B A;  1E0E A;  3BTL A;  1TQI A;  1KQ8 A;  4HV6 A;  2XAF A;  1KGS A;  2DPD A;  2IXS A;  1GUU A;  3RZD J;  5BS6 A;  2XGD A;  3BG3 A;  3I59 B;  2GQQ A;  3SYT A;  1V54 H;  4J00 A;  2FQ3 A;  2CWE A;  3H0G J;  1ACI A;  1O3T A;  3RJP A;  1P2F A;  1ZAR A;  4R79 A;  1U0J A;  2R7S A;  2GA1 A;  3S14 J;  3FBN B;  2OCE A;  3FIW A;  3RI4 A;  2M9H A;  3SDB A;  1MBE A;  1H8A C;  5E3L A;  4ITV A;  3H3U A;  3MZ8 A;  4IQ4 A;  3V7R A;  2TRT A;  1FJL A;  4HX8 A;  2BHY A;  2VJJ A;  1YW9 A;  1YS7 A;  5LBQ A;  5IPA A;  3FX3 A;  5J1R A;  2ZJR F;  4HDV A;  4DYQ A;  1XC5 A;  5J6X A;  2E7W A;  5EDN A;  1X58 A;  1TQP A;  3CQZ J;  1TWG J;  4YIR X;  2LF8 A;  2MVT A;  2QLZ A;  3NWS A;  3ZRG A;  2ESN A;  3KZZ A;  3OS1 A;  3PSF A;  1XCV A;  1E3P A;  3TO7 A;  4IJA A;  1RKT A;  2FBK A;  3KET A;  3DPT A;  1SD4 A;  4PSX A;  2EFN A;  1S7A A;  1VQK I;  1SMT A;  4IOC F;  2NOG A;  3ZMZ A;  4RA2 A;  4XKB A;  5EF6 A;  4UVC A;  3I0T A;  5JHU A;  4V19 K;  4NDL A;  2XRL A;  3BT9 A;  2F4I A;  4F52 A;  4FCY A;  1F9N A;  2WAD A;  4AWX B;  5JLW A;  1W0T A;  3G1O A;  5IY5 H;  5F64 A;  4JK1 X;  1R5G A;  3MD2 A;  2KJC A;  1VQ7 I;  1Z0X A;  3BWG A;  4BYY A;  5J1U A;  1MMS A;  1GV5 A;  1V5F A;  3P7N A;  2V1X A;  4HW0 A;  1HDD C;  1I3Q J;  4RGU A;  1SFO J;  4QWQ A;  4QPO A;  5HOO A;  4BQQ A;  1O3R A;  2LR8 A;  4UUV A;  1WJE A;  3LQR A;  3QPL A;  1R49 A;  1QPI A;  2FX0 A;  1AKH B;  4ZYG A;  1EV7 A;  3V4G A;  4OAZ A;  5F1J A;  4S04 A;  2AO9 A;  1TWH J;  1B4A A;  1YOV B;  3GFM A;  2KIS A;  1UHW A;  3HGG A;  3KZI C;  3IAS 2;  4MTE A;  4DBQ A;  3W6K B;  3E0J B;  4W97 A;  2WWY A;  4HDU A;  3QOE A;  3FHN A;  3MZY A;  3HKZ N;  3LMM A;  1LDK B;  2Z2S B;  1USS A;  4ANJ A;  4II2 A;  2DMQ A;  4AM3 A;  4A3G J;  4AD9 A;  5FD6 A;  2VI6 A;  3DV8 A;  5BPI A;  1SVO A;  3WG7 H;  4D7N A;  1SC7 A;  1BR4 A;  4E7J A;  4EGY A;  1SFK A;  2W48 A;  3D1N I;  4PUS A;  4AUX A;  4YRV A;  2ISY A;  4KIT B;  2AQE A;  4B47 A;  3VSL A;  3J80 R;  2DOA A;  2FOW A;  2YUS A;  1YW8 A;  3CUQ C;  2HOS A;  4H0E A;  3PFI A;  3HXL A;  1S7O A;  3H9Q A;  5IYC J;  1D0Y A;  2DFF A;  1IGN A;  1D0Z A;  2DMT A;  3K7A J;  3OWT A;  3DQV C;  1VFC A;  3B6A A;  1FSE A;  2JK3 A;  1ZRE A;  2JSP A;  5C4X J;  1A6Q A;  4M3E A;  3GLX A;  4UXN A;  4ZTF A;  1QBJ A;  1KYZ A;  2KRH A;  2VXD A;  1P4A A;  1R71 A;  4BJ5 C;  4JX6 A;  1TWF J;  2L4A A;  2KKO A;  4Z6Y A;  2Y30 A;  2H6B A;  3AG4 H;  1TL8 A;  5FJ8 J;  3FBI B;  4XKW A;  2EB7 A;  1T38 A;  2D1H A;  3C2G A;  4XLC A;  4CYC B;  2K9M A;  1E17 A;  1OCP A;  3NAR A;  4UNO A;  2IW5 A;  1DP7 P;  3BC8 A;  3F8B A;  2JZY A;  2YPR A;  1ETK A;  3FMR A;  1RUN A;  3H5A A;  3IH3 A;  4CCM A;  4HNV A;  4XOT A;  1P6R A;  5D6E A;  3HG9 A;  4Q48 A;  2DMU A;  4YIF A;  4L0Y B;  3RCO A;  3HYI A;  4A5N A;  1FBS A;  3DXJ F;  3FXQ A;  4D9J A;  1T39 A;  3N4M A;  2XAU A;  4A12 A;  5FKO A;  3EPZ A;  1IN4 A;  2KPM A;  2E5N A;  2WTE A;  5DM6 F;  4IHS A;  3W6J B;  3G3Z A;  3F8F A;  2M45 A;  4MIM A;  4G94 A;  3VB2 A;  1JTX A;  4CCK A;  5LGT A;  4LOC A;  1K4S A;  3R0A A;  1B6A A;  2QQ9 A;  4G9Y A;  4W1U A;  2XGC A;  4A3E J;  3C2H A;  2FNP A;  1BC8 C;  1VQ6 I;  2FSW A;  4V2F A;  3KLO A;  1GLN A;  4YII A;  1I3A A;  5CPR B;  2WAF A;  4KT6 A;  2M0C A;  4DZJ A;  4J19 A;  2L54 A;  1XDU A;  3DBL B;  2EV6 A;  4B1R A;  2DMP A;  2M35 A;  3J81 R;  4RDU A;  2CO5 A;  1YJ9 I;  3MWM A;  2P0T A;  5ICF A;  5ICE A;  2I5U A;  1JUS A;  3BTI A;  3UNG C;  3J80 Z;  3SFI A;  4L9N A;  2EPF A;  5HLI A;  4G7Z F;  3CUQ A;  1ETY A;  3ZMD A;  1WI9 A;  3J80 K;  3I53 A;  3ASN H;  2I10 A;  4PJJ A;  1KU9 A;  3ESW B;  3GW2 A;  4HF0 A;  3GTG J;  2STT A;  5HLH A;  2DPU A;  2CGP A;  1QHG A;  3MQ0 A;  1ETO A;  2X4H A;  4M6Y A;  3SQN A;  4XLP F;  3C2B A;  1X1D A;  3F0C A;  2W7N A;  1SFX A;  2GXB A;  2VC0 A;  1OCO H;  2DQR A;  2W00 A;  4P96 A;  1HF0 A;  2JA2 A;  2DT7 B;  4XNF A;  4RGS A;  3CF2 A;  3N97 A;  5D5W B;  3GCM A;  3OYJ A;  1NHA A;  2HOE A;  3BQY A;  4LG0 B;  1Y39 A;  4BQA A;  4M3B A;  1XPX A;  3E6D A;  2W85 A;  2NVT J;  3CCL I;  5J3L A;  5HDN A;  1HCR A;  4RS8 A;  2OQG A;  1MBJ A;  2L9V A;  4I76 A;  4KIB A;  5EJC A;  3E7L A;  3RQ4 A;  2QCO A;  4F7Z A;  2DBB A;  2VBZ A;  2Y69 H;  2GM4 A;  1XCB A;  2MLG A;  3HUG B;  3GYH X;  4I02 A;  2Q0O A;  1Z21 A;  3L9F A;  2DFE A;  3HL2 A;  1MNM C;  2VUM J;  4IO9 F;  4IZZ A;  1VQP I;  3MN2 A;  4ZDO A;  1IXC A;  4OIQ F;  4II3 A;  3WGG A;  3E3V A;  5LGN A;  1J0R A;  1XMX A;  2YS9 A;  5DCM B;  3W6V A;  2HYG D;  5KAF C;  3E5X A;  5CQG A;  3LSG A;  4E7K A;  3HOW J;  1QU3 A;  5JHF A;  4MO7 A;  4DJA A;  4ZYE A;  3KX2 A;  1PDN C;  1E3H A;  5D8K B;  2P4W A;  1JTY A;  2RDP A;  4I98 B;  3VOE A;  3FIS A;  1ZYR F;  1L3L A;  1CF7 B;  2R92 J;  3J81 Z;  2NNN A;  4G8X A;  4BHP A;  1QVU A;  2Q2E A;  4PDK A;  3JRA A;  2K9L A;  3S32 A;  4XRF A;  3J81 K;  3OSF A;  2ZJQ F;  1LUJ B;  1K78 B;  2GXG A;  4IPA A;  5E20 A;  2RQQ A;  2STW A;  3ERE D;  2RN7 A;  2WY7 Q;  3OS2 A;  3JRC A;  1IJW C;  4XR6 A;  2QEN A;  5FRM A;  3JRF A;  5IP7 J;  1OQY A;  1T33 A;  1U3E M;  1P9Q C;  4M71 A;  3K6G A;  4IHX A;  1BN5 A;  4EM2 A;  1BC7 C;  1ETW A;  5CVR A;  4IXA A;  1OLT A;  2DQL A;  2ELK A;  3F23 A;  1J5Y A;  2LRD A;  1TC3 C;  1IF1 A;  2FUG 2;  4P9U A;  3TDU C;  3A01 A;  2IA0 A;  2DOE A;  1HBX G;  1RNL A;  1UAA A;  3C7J A;  3FMS A;  3SEZ A;  1O4X A;  4DBR A;  2LKP A;  3A03 A;  5B1A H;  5LRR A;  4E7Z A;  3H9J A;  3K9T A;  1G2H A;  2P5V A;  3BR2 A;  1RC9 A;  2MC4 A;  3IKV A;  4XQF A;  4XID A;  4JX4 A;  3OMY A;  1AA7 A;  4FAS D;  3HBL A;  1FT9 A;  2Z16 A;  2JA6 J;  4K2E A;  1QZZ A;  1R1V A;  3EUK L;  1OCT C;  5D4S A;  2XF6 A;  5JVT A;  2H6C A;  4DIQ A;  3ZMV A;  2XGX A;  5DCF A;  1RQ6 A;  5E8I A;  2RQP A;  2F5V A;  2F6C A;  3Q0U A;  2OCC H;  4ENK A;  3LSI A;  3FXM A;  1ZLJ A;  2JPB A;  5K7Z A;  2GLO A;  2F5C A;  3P9K A;  2ECC A;  3IWF A;  1X1B A;  1MGT A;  2XRN A;  4CGZ A;  3VDX A;  2QBY A;  2CSO A;  2CQ7 A;  3L2R A;  5GAH J;  1MBF A;  2AHQ A;  3HSR A;  4RM2 A;  2HYJ A;  4ETS A;  4FE4 A;  1VQ4 I;  2GWR A;  3R61 A;  2N8G A;  2M7B A;  4UUS A;  2CMP A;  2FEZ A;  3J7A W;  3K1N A;  3ABT A;  2VPL A;  2LBF B;  1BA5 A;  1G6N A;  2K7L A;  3ML6 A;  2MSY A;  4B09 A;  4M3G A;  2DA2 A;  3WTU C;  2E7X A;  1FLI A;  3CJN A;  5AIQ A;  3VEP A;  4D7M A;  4HEA 2;  1B8I A;  1S5L C;  2R7R A;  1FTZ A;  2DFH A;  2KDO A;  3OY9 A;  3OL4 A;  1VQL I;  2M5W A;  3C18 A;  3BJ6 A;  3IP4 B;  1D5Y A;  1XN7 A;  3MEX A;  4F3Q A;  3QQA A;  1WJD A;  5FKK A;  5TGT A;  5EG0 A;  4OIO F;  2M4K A;  1BJA A;  1CGP A;  4ZYH A;  1R7J A;  1WGX A;  2R7X A;  4YEL A;  2QSG X;  2EK5 A;  5DYM A;  4AYB A;  3K10 A;  4LLN A;  2PMU A;  2HU9 A;  3U1D A;  2FU4 A;  2MH9 A;  1I39 A;  4G6D A;  1K7A A;  2YSR A;  1T95 A;  2IP2 A;  2RKH A;  1RET A;  2L7F P;  3GZ5 A;  4KIG A;  2HNH A;  4HOB A;  2ACJ A;  2XUB A;  3ABM H;  2OQR A;  4KMU X;  4D0P A;  2P6S A;  1FMW A;  4A69 C;  2R5Z B;  1TNS A;  2CH0 A;  2QKL B;  1R00 A;  3KP5 A;  2HZT A;  3PM1 A;  5ICC A;  3BZC A;  2Y0S A;  2LRE A;  3DBH B;  3N05 A;  4QTR A;  2CG4 A;  2H8R A;  4CCJ A;  3OSG A;  4M3D A;  3HOX J;  3MAJ A;  1QA6 A;  3A2K A;  1YJW I;  1UCR A;  2A5Y B;  3OR2 C;  3HOZ J;  4B8X A;  3DLA A;  4XK4 A;  4A0Z A;  2QF7 A;  2XIG A;  2LC2 A;  1VI0 A;  3JTH A;  5LRS A;  4IHW A;  5KK1 A;  1BR1 A;  5DEQ A;  2WA0 A;  5TJJ A;  2HXO A;  1WJA A;  1RES A;  3L2V A;  3PL8 A;  2GXA A;  4XRS A;  2M7A A;  3RDI A;  3WE3 A;  4OOI A;  4XIC A;  4XOP A;  1KU2 A;  4M3F A;  1FOY A;  4C2U A;  2VBW A;  2OZ6 A;  1FZP B;  2NAZ A;  3I4N J;  2XKO A;  1IW7 F;  2M1B A;  3JAM R;  4N9I A;  4QSH A;  2P0W A;  2M30 A;  1XMK A;  2O7O A;  4HNT A;  1S72 I;  2R3S A;  4BQO A;  3BZK A;  3Q5F A;  1JHH A;  2JVH A;  3BQZ A;  4KT5 C;  2DJI A;  5H6R A;  3TW6 A;  5J1Y A;  1P4X A;  3TBI A;  3I64 A;  2BE5 F;  1K83 J;  1ZK8 A;  4LIU A;  1WJ5 A;  3IH4 A;  1QGP A;  5E17 F;  2ZFW A;  1BW6 A;  3IC7 A;  5ED4 A;  1SFU A;  3WU2 C;  3CC2 I;  2GIZ A;  1BI3 A;  1QHH D;  2Q8K A;  2CUJ A;  3G71 I;  2F2E A;  2V4J C;  3F21 A;  2CW7 A;  4N4N B;  4KA4 A;  3GZN B;  3SFZ A;  1F4K A;  2FMY A;  1H88 C;  1GDT A;  1C0W A;  1A04 A;  2DW4 A;  2A68 F;  2OA4 A;  2JA7 J;  2BGC A;  4CH7 A;  4UV9 A;  4KJZ A;  1G59 A;  3M8E A;  3S1M J;  3GVA A;  2NVU B;  1F1Z A;  2VPR A;  1MBG A;  3FHZ A;  4BHC A;  3LFK A;  4A0X A;  3S2D J;  1ZR4 A;  1A36 A;  4BNC A;  1U5T A;  1X19 A;  4F92 B;  1HOM A;  4LK1 F;  1ETV A;  2R7V A;  4MFD A;  2EA4 A;  3QAH A;  2KIQ A;  3CDL A;  5B66 C;  5LHH A;  3SZP A;  1XX5 A;  1S8N A;  2M34 A;  5HLG A;  2PBI A;  4HLX A;  4ZC3 A;  2WAE A;  2EIJ H;  3WU1 B;  2EZI A;  2D2W A;  2LOO A;  2KLO A;  1K61 A;  4RB3 C;  3TO6 A;  3LNQ A;  1WH5 A;  2R7Q A;  2EFO A;  1T0F C;  3H5N A;  1IN6 A;  5FKM A;  1Q1H A;  3OS0 A;  3WGH A;  1S7E A;  2EZL A;  2HS5 A;  4CCO A;  2QWW A;  5E1X A;  3QPS A;  4ESF A;  2L2O A;  2AXL A;  3MKL A;  3JAM Z;  4ZJZ A;  3JSO A;  2V1U A;  5GTH C;  2XC7 A;  1EA3 A;  3R60 A;  4ABZ A;  4OMY A;  4A3L J;  1LFB A;  5J47 A;  3F8C A;  1ITY A;  1JGS A;  4FIS A;  3RYR A;  4C2T A;  1FNN A;  4OAY A;  4WXC A;  2HPM A;  2CV1 A;  4PJN A;  2LP0 A;  2PQ8 A;  1MDM A;  2QGU A;  3K70 C;  3M7G A;  4XLF A;  1H0M A;  3KIO A;  3R4K A;  4DQ2 A;  1B9M A;  1TBX A;  2ZNY A;  4G6Q A;  5D5U B;  1FTT A;  2X6Y A;  4IL6 C;  3PJR A;  4NQW B;  2Y31 A;  5KHD A;  3KEY A;  2JVG A;  1OYI A;  2PEX A;  4O6J A;  1JKQ C;  3DU6 A;  3F3X A;  3M1E A;  3LSR A;  5FRO A;  3VSK A;  2L9N A;  4ENN A;  1B72 B;  1BI2 A;  4AIH A;  5LHI A;  3NRV A;  2RRE A;  5LEJ A;  3H3V K;  4B44 A;  3HB9 A;  4D1Q A;  1P92 A;  3JRB A;  4BEH A;  3M4O J;  1P7J A;  2VQC A;  3QP5 A;  3CDH A;  2NVY J;  2O5R A;  3IHU A;  1N75 A;  3ONQ A;  1LFP A;  4E7H A;  3BJA A;  3E1S A;  3ISP A;  1Y56 A;  3RKX A;  4Y7N J;  3CCV I;  2I8D A;  2ME6 A;  3FK6 A;  1UFM A;  2VIX A;  1HLV A;  4PJM A;  2KHM A;  5E1Z B;  1I27 A;  1MD0 A;  1NG7 A;  5DDG A;  3ABU A;  1K6O A;  2A07 F;  4HF1 A;  2FNA A;  2R4G A;  1APL C;  3C1D A;  2FQ4 A;  4XLA A;  3GTP J;  2LY1 A;  4PCQ A;  1W7P B;  3ZR8 X;  2A5W A;  2Q2E B;  3Q3S A;  4B43 A;  1UG2 A;  1Y1V J;  2HYF A;  3Q0V A;  2WB1 A;  4AVP A;  2Z99 A;  1R9T J;  5JLX A;  1S6L A;  1T0F A;  1VQM I;  4FHT A;  5HNH A;  1G3Y A;  3OYD A;  2V9P A;  2KJB A;  2XSJ C;  4AYB N;  2JTV A;  1NG6 A;  4N4O B;  3CME I;  3WTV C;  3UR3 C;  3MFK A;  1P7I A;  2HEO A;  1ZRD A;  4GDF A;  4HST A;  1B59 A;  3BR3 A;  2BY2 A;  3S15 J;  3QP6 A;  5ICG A;  1VND A;  5LLQ A;  3HRT A;  5DD4 A;  2BEO A;  4BXF A;  4CXF A;  3B02 A;  3U1K A;  4BXU A;  2H09 A;  4CHU A;  1D5V A;  1YRN B;  3JRH A;  3DPL C;  3PNV A;  2H1L A;  2LLK A;  3MZH A;  5BMZ A;  2BY1 A;  1IDZ A;  1OPC A;  1VF9 A;  4GXO A;  4AU7 A;  3KP3 A;  3V8J A;  1D0X A;  3O3K A;  3PO3 J;  3DU5 A;  1EF4 A;  2L0K A;  2TDX A;  3RIR A;  3KYD B;  3HHG A;  2VN2 A;  1HKQ A;  4EJU A;  1S29 A;  2C6Y A;  2NS8 A;  1HW1 A;  2XF7 A;  4EQQ A;  1W5C C;  4G7H F;  4HNU A;  2QVO A;  5E18 F;  3GO5 A;  2OZU A;  3GXO A;  3DP7 A;  3CZ6 A;  2VQG A;  4BAY A;  4A3M J;  1VZ0 A;  1IRG A;  5F0H A;  4CA0 A;  4GO1 A;  2PX9 A;  4BE2 A;  2IGN A;  3HC7 A;  2ZSI B;  3ZGK A;  1F43 A;  2A05 A;  3K69 A;  1LB2 A;  4EJO A;  2CQK A;  2QA4 I;  1E3O C;  1V5G A;  2PG4 A;  3LOC A;  5ERI A;  4BY7 J;  1FPQ A;  2K27 A;  5KCM A;  1ZGA A;  2QBY B;  5F27 A;  2D45 A;  2VT3 A;  3OYI A;  3FZV A;  1MMN A;  5EZH A;  4GRI A;  2BVM A;  2HTS A;  3LST A;  3F72 A;  3OIP A;  1MZB A;  3M8J A;  4B3X A;  2ZB9 A;  4DW6 A;  2VBY A;  1FBU A;  2HWV A;  4KIS A;  1U2W A;  1OCR H;  3BG9 A;  1PUF B;  3HOV J;  1I1S A;  1SAN A;  1T56 A;  4ENJ A;  1Y6I A;  1QZE A;  2CW8 A;  3HSE A;  1W7P D;  1ENH A;  2DA3 A;  2MAB A;  3CLQ A;  3BP8 A;  3HHH A;  3P9C A;  4OIR F;  5IYB J;  2MUN A;  1VQ5 I;  2PI0 A;  2EJR A;  4N0B A;  4O3M A;  3BTC A;  4Y52 J;  3FF5 A;  2X48 A;  5L3E A;  4KUM A;  2OJE D;  1OR7 C;  5EG0 B;  1YYV A;  2R7F A;  1KU7 A;  1D1A A;  1D8J A;  3PIP F;  6PAX A;  1KA8 A;  3FXL A;  4ESJ A;  1IV6 A;  4G12 A;  3ELK A;  3S17 J;  3FXJ A;  4IHY A;  5ILU A;  2DYS H;  2COM A;  3RSN A;  1LE8 A;  4LIV A;  3DKX A;  2CQX A;  1FIP A;  1TLH B;  3ZQQ A;  3BJO A;  4A0Y A;  1TP4 A;  4EV0 A;  3BTJ A;  4Q5S F;  2PJR B;  4BU2 A;  1R4M B;  4PFO A;  2DA7 A;  3F9K A;  1FWZ A;  2LKS A;  3CCY A;  1HDP A;  4AVZ A;  5LHG A;  1IUY A;  3AL0 C;  5C3E J;  1KON A;  1WKM A;  3V42 A;  4HRI A;  1MJA A;  3RKY A;  4L0Z B;  3DTK A;  2PN6 A;  4AIJ A;  3Q9V A;  4XN3 A;  1H9G A;  5E79 C;  1JJ8 C;  1OKR A;  1MMG A;  3EUA A;  4XSX F;  3L00 A;  2V7F A;  1M1E B;  1S3J A;  3OYN A;  3T5X A;  1LDD A;  2FF4 A;  2MG4 A;  3FK7 A;  3KZY A;  2X6W A;  4DGW B;  1X3Z B;  3U21 A;  3BG5 A;  3RPQ A;  5H20 A;  2E34 A;  2L5Q A;  4BJT A;  3TL4 X;  2GA2 A;  2KZV A;  5ILV A;  2O3F A;  5F08 A;  5L3B A;  1JKO C;  4XON A;  2HR3 A;  4DNC A;  2KDZ A;  3BR5 A;  4YFN F;  2DO7 A;  1PUE E;  4LB5 A;  3H5R A;  3DEU A;  2F5F A;  4CYD A;  5EGO A;  4N9H A;  1BI1 A;  3AG2 H;  3W2V A;  4FT8 A;  2BW3 B;  3ECO A;  4ZH4 F;  2VLA A;  3A52 A;  3PUB A;  2CYY A;  4UV8 A;  2D5V A;  1NH3 A;  2PMH A;  2JT1 A;  3DBR B;  2WBM A;  3F6O A;  3TP0 A;  4CZC A;  4EM1 A;  4EAT A;  3UKG A;  1Z77 A;  1H9T A;  5CVV A;  1OFC X;  2MYS A;  2JMW A;  3CO7 C;  2XSD C;  2NOJ B;  3HRU A;  1YQA A;  1X3U A;  1U9N A;  2LTP A;  4EJW A;  5E3N A;  1ULY A;  2VON A;  4LB6 B;  1E2X A;  2NS7 A;  3ZOB A;  5F0C A;  2E2I J;  2DJN A;  5DUK A;  1OR7 A;  2BBY A;  4C3H J;  3F22 A;  3TED A;  2HVR A;  1VQ8 I;  2DLL A;  3W2A A;  2OBP A;  3HTS B;  3KP2 A;  3LSJ A;  1KU3 A;  3LA3 A;  2EH3 A;  3I54 A;  4CO8 A;  3A4C A;  3PUF A;  3PNT A;  3FXK A;  2WY8 Q;  5HOD A;  2LMD A;  1X4O A;  4OIN F;  2FXA A;  1JGG A;  4GFB A;  3CP8 A;  2HDW A;  4I0A A;  4IEJ A;  1QQI A;  1D8K A;  1ZRC A;  2TCT A;  1X3W B;  4BH9 A;  2X0L A;  3QYE A;  3ZMU A;  1IZ1 A;  3P9I A;  4EMS A;  4WCG A;  3H36 A;  3NEU A;  2OD5 A;  2ID6 A;  5H6Q A;  5BOX A;  2FRH A;  5EYR A;  5GTI C;  3F8M A;  2R5Y B;  1EH8 A;  2VAS A;  4UB8 C;  2DTR A;  1IDY A;  2P8T A;  2VJI A;  4NB5 A;  1YIO A;  3BCA A;  3W3C A;  5HLT A;  1OYW A;  2M87 A;  1QO0 D;  4PJ0 C;  4U7D A;  1LJ9 A;  2Y0M A;  4BE0 A;  2WB1 N;  1VQ9 I;  2HQR A;  4UVB A;  1YI2 I;  1WWX A;  2EIL H;  3TDZ C;  2RNG A;  2BXZ A;  4WXH A;  3I59 A;  4WF2 A;  1X1C A;  3HOU J;  2L9S A;  3DTE A;  3GME A;  4MHG A;  4MTD A;  1H89 C;  1DQU A;  4RGR A;  3D0S A;  1U9O A;  4RLF A;  1I6H J;  1L0O C;  2W1O A;  4Z2Y A;  4U88 A;  3OYM A;  1SD7 A;  4CIC A;  4XOR A;  4D5C A;  1MKM A;  1Y8Q B;  2DA6 A;  4MQV A;  1UHS A;  3GTQ J;  1YX5 A;  2WAQ A;  4R8H A;  2L3D A;  4L18 B;  1V5E A;  3HZJ A;  4PZJ A;  3LSM A;  4E7I A;  1JE8 A;  5IP6 A;  3SZG A;  4HX7 A;  4EGZ A;  2K86 A;  3SJM A;  1YS6 A;  4HSR A;  2R7O A;  3CJT B;  2XVC A;  2QZ8 A;  3BDD A;  4FQG A;  4HPQ A;  3LAJ A;  1BR2 A;  2DMN A;  2ZCW A;  2L02 A;  3E6M A;  5F6F A;  3ZQI A;  4UB6 C;  2RV8 A;  2IGK A;  3O2P E;  1IV8 A;  4YG2 F;  2P6T A;  2GZW A;  3I3L A;  1IN8 A;  1R6R A;  1V4R A;  3KP7 A;  1R36 A;  1XSV A;  1F36 A;  1CQT A;  4HF2 A;  2BV6 A;  3KE2 A;  4Y4R A;  3ZQ7 A;  1A35 A;  1YIT I;  2HDD A;  3CUO A;  3BPX A;  2WV1 A;  1WJC A;  3FXR A;  1RUO A;  1DPR A;  3S1N J;  2BOL A;  1LEB A;  2X85 A;  4M9X A;  1PYV A;  2EWN A;  2K40 A;  1EKE A;  4S05 A;  2QKM B;  4BEH B;  2NNY A;  1G3T A;  4BHB A;  1P4W A;  1LEA A;  2G9W A;  3DTI A;  3HSF A;  2LK2 A;  3V7S A;  3LL7 A;  2ID3 A;  5JI6 A;  2K9N A;  2PMZ A;  1AKH A;  1HKS A;  2YU9 J;  2V9V A;  1SEU A;  3LWF A;  4HYE A;  4HQE A;  1WJB A;  3BLY A;  3JCU C;  4UHT A;  5AIP A;  1ZLK A;  3QPH A;  3WTS C;  1R1U A;  5HS8 A;  3QWL A;  1X2M A;  3MVP A;  4XBF A;  3MKZ A;  1JUP A;  3HM5 A;  5CVJ A;  2ETH A;  2X98 A;  4NNJ A;  1QVT A;  2R7W A;  1TWA J;  2MD0 A;  3P5J A;  2VOO A;  4I01 A;  1Z05 A;  3G6E I;  5D6F A;  3JR9 A;  1X2N A;  3M07 A;  1W36 C;  2KIU A;  2KRF A;  3FMQ A;  2E2H J;  2ZJ2 A;  5JVG F;  2XPV A;  4QPQ A;  3H1C A;  1FYL A;  3MKY B;  5J4V A;  4GYG A;  1LDJ A;  2EV5 A;  3PQJ A;  5FKL A;  2X6O A;  5FO5 A;  1Q1V A;  3ROU A;  1J75 A;  4PSW A;  2E1N A;  4BGD A;  3OYK A;  1D3Y A;  2ZFU A;  2YU3 A;  2LY2 A;  1R5I D;  2QUF A;  1Z9C A;  1FIA A;  1WFX A;  2ZXH A;  2K4J A;  4E6K G;  2HZD A;  1JT6 A;  2XKP A;  1FYM A;  4UUT A;  1BIA A;  1OCZ H;  4Y33 A;  3VOD A;  2L7Z A;  4IHV A;  1RZ4 A;  2HQN A;  2R93 J;  1N25 A;  4KDP A;  2R7D A;  2LF7 A;  3M1C A;  4A93 J;  2A61 A;  3FDY A;  3AKZ A;  2RC4 A;  3BRO A;  1ZHF A;  1U5T C;  1KZH A;  4HBL A;  4Y3O A;  4CYC A;  4BE1 A;  1GT0 C;  3T8T A;  3CLO A;  4B4C A;  2FBH A;  5E3O A;  2O9L A;  3NQO A;  4UY8 I;  5K7F A;  2ICW G;  2ZXW H;  3QOD A;  1R58 A;  5K5Q A;  2O6G E;  1X1P A;  1IO2 A;  1SVL A;  5HS7 A;  1XSD A;  3PIO F;  2CRG A;  2O8X A;  1J09 A;  2X51 A;  3HGY A;  1HXD A;  5LFA A;  2GIV A;  3DWL E;  4M9S A;  5J8C A;  1U8B A;  4A2U A;  2EIK H;  3JRI A;  4A6D A;  2LFB A;  3ZQF A;  5FLM J;  2DDB A;  2CQN A;  2EFQ A;  1ZG5 A;  1X1A A;  4CZZ A;  2OV7 A;  3L2W A;  5K5R A;  2VE9 A;  2AS5 F;  5GP9 A;  1IG7 A;  1ZH5 A;  2E35 A;  1JXS A;  3K4C A;  1WH7 A;  3K4L A;  3MCZ A;  3HOS A;  3NAU A;  2DK5 A;  2R7T A;  4HG2 A;  3A0B C;  3BOQ A;  3HEF A;  4I0B A;  2IS1 A;  2LVS A;  1XD7 A;  1ZAO A;  2RNJ A;  4AID A;  1GXP A;  1ZGJ A;  4C3I J;  3WTX C;  3OYE A;  1MSE C;  4H4K C;  3KP4 A;  1O3S A;  2DA4 A;  2MA3 A;  3HKZ A;  4LK0 F;  4HZF A;  4X1E A;  3CC7 I;  1WI3 A;  3T0Y A;  3CD6 I;  5A2Q R;  2NS0 A;  2O8K A;  3A1Y A;  2CV0 A;  3PFY A;  1IRX A;  2ZJP F;  4WWC A;  3SHF A;  1LE8 B;  3M3Y J;  5IYD J;  4P55 A;  1BBY A;  3EET A;  2A3S A;  1UEL B;  4DZP A;  5J4Y A;  2B9S A;  1WRJ A;  2E1M C;  3FXU A;  3RZO J;  1WCM J;  3K70 D;  1IRF A;  2LH9 A;  4CUG A;  3CF5 F;  3J7A O;  1RIO H;  4C2M J;  3D5S C;  2P5K A;  4ZTJ A;  5IT9 K;  2G0E A;  4WXD A;  3I58 A;  4P9F A;  4XLH A;  1Z7L A;  4A3K J;  2JSC A;  5CKT A;  2EBI A;  3A0H C;  2DAO A;  3KP6 A;  2EZH A;  2F5E A;  3TW7 A;  3GTO J;  3S1Q J;  1S9H A;  4KMF A;  4LG0 A;  3ECH A;  3C3W A;  1O57 A;  1ORK A;  3ZMS A;  1W1W E;  3ZP5 A;  3ABL H;  3GFI A;  5FKN A;  2L01 A;  2ZBK A;  2CJJ A;  2UV1 A;  4Q4Z F;  3U9G A;  1PP7 U;  4IOA F;  2IEK A;  4R1H A;  2DN0 A;  5D5V B;  2RGV A;  4IVN A;  1GVD A;  3HUG A;  1YLF A;  2Z1D A;  4LFU A;  2BYV E;  1YW7 A;  2L4M A;  1GXQ A;  3K4J A;  5KVR A;  2OF7 A;  4MFE A;  2HTJ A;  2W84 A;  4L9J A;  2R7U A;  4HAM A;  3T8R A;  3CUQ B;  1JT0 A;  2XHK A;  2OU2 A;  5DCM A;  2KZG A;  3JTG A;  3S3M A;  3KCC A;  1XGS A;  1HSJ A;  3HOT A;  1AOY A;  2JPC A;  2P81 A;  4EJT A;  5CJ9 A;  1WSU A;  1VQN I;  5HS9 A;  3GF2 A;  1DP3 A;  3H92 A;  5EZG A;  4NC6 A;  1LVA A;  4ZYA A;  3WG9 A;  4FE7 A;  3KEO A;  4OU0 A;  3SEQ A;  4BBR J;  1BIB A;  1ZKG A;  3S3O A;  3ZMT A;  3HDD A;  4Y17 A;  2E60 A;  5HDK A;  2E2J J;  4FTH A;  1ZG1 A;  5A2Q Z;  1N77 A;  1K78 A;  3JRD A;  1POG A;  2JA5 J;  2B63 J;  1MW7 A;  5F0F A;  2CUE A;  1BOA A;  4CCL A;  2QQ8 A;  3TQN A;  5A2Q K;  1ETX A;  2PLY A;  1Z3X A;  4U87 A;  4I09 A;  3LA2 A;  5L3C A;  5M3M J;  2UXX A;  3BG7 A;  1XDS A;  3EDP A;  2XB0 X;  1YHQ I;  3VYT B;  3VYS B;  1ZG3 A;  4Y13 A;  1W5S A;  1XGN A;  2UZK A;  2BY0 A;  3V8K A;  3TO9 A;  1ZGW A;  4EM0 B;  1MJ9 A;  4E4H A;  1J7K A;  1GVJ A;  1WJF A;  4NBQ A;  2COB A;  5HVQ C;  1TT5 B;  1ZN2 A;  2Z5U A;  3ABK H;  3EYY A;  4ASN A;  4M73 A;  5IOZ A;  3WTZ A;  3EYI A;  1FX7 A;  2O0Y A;  3GLL A;  3O6B B;  5M3F J;  2VE8 A;  1DPU A;  3VFZ A;  2K85 A;  2RVC A;  3QU6 A;  3CCM I;  2VC1 A;  5GAE J;  1ZQ3 P;  4NC7 A;  5LD2 C;  4ZDL A;  4U0Y A;  4YFX F;  3O8H A;  3TP3 A;  4FX0 A;  1UG0 A;  4RBO A;  1KQ9 A;  3I71 A;  3GX4 X;  3ZN0 A;  4UVA A;  2YX7 A;  3M8F A;  1FP2 A;  2X9D A;  2NVX J;  1RKW A;  1MBK A;  2X6X A;  5B3S H;  3WE2 A;  3OYH A;  1UST A;  5L3D A;  2IVM A;  1FBQ A;  2IRF G;  3BR0 A;  1T8I A;  3GBG A;  1X4P A;  3V8L A;  3E6C C;  2CUF A;  2HVQ A;  4MEY F;  1J2X A;  3OIQ A;  4L5I A;  3REO A;  1UHM A;  1ZR2 A;  2XAG A;  3OIO A;  3U2R A;  5DS9 A;  3CMM A;  3KLN A;  3R0J A;  3BR6 A;  2VKH A;  3JW4 A;  4M74 A;  2K5C A;  3J7Y J;  1EH6 A;  1A6I A;  2ME0 A;  3A01 B;  2LBF A;  2BVL A;  3GTK J;  3FKI J;  1GV2 A;  4HV5 A;  4M72 A;  4P5O A;  2KMU A;  3EQL F;  4P1W A;  4A3C J;  1IN5 A;  3RYP A;  4DOZ A;  2Y0S N;  2F5D A;  1MMA A;  5TRD A;  2MH2 A;  2E1C A;  2BY3 A;  5DM7 F;  2VJ5 A;  4FET A;  3D5L A;  2GAU A;  2XF5 A;  1LVK A;  3S3N A;  3IRQ A;  4ON0 A;  3HRS A;  1WQ2 A;  2OC6 A;  2ZME C;  4J01 A;  1Y1W J;  4BBS J;  1MSF C;  5C44 J;  1G3W A;  3DKY A;  2FE3 A;  4JYK A;  2ISZ A;  1DU6 A;  1VTN C;  4L9T A;  3S2W A;  4OMZ A;  3SDG A;  3K1P A;  5BPD A;  1ETQ A;  3K2A A;  4RAZ A;  3ZQG A;  5FLV A;  2IBD A;  1FOK A;  2PFB A;  4JOM A;  2UUZ A;  2JRT A;  1XG1 A;  3PQK A;  4EVI A;  3AAF A;  4JBA A;  2R5Z A;  4XKC A;  1STZ A;  4IHT A;  2J5P A;  5CVU A;  2VOP A;  2M8E A;  2Y75 A;  1U6G A;  1SMY F;  2WC2 A; 
#chains in the Genus database with same CATH homology
 2G7H A;  2O61 A;  1QNT A;  4MGR A;  1KQ0 A;  3FM3 A;  5DV5 A;  1QPM A;  3HTU A;  3GWZ A;  5J8F A;  3GFL A;  1K79 A;  3KFW X;  1XGO A;  1XGM A;  2IA2 A;  4M6X A;  2FA5 A;  2OAZ A;  4PGH A;  3QOP A;  5FFZ A;  1XMA A;  2MD5 A;  3WTW C;  4KIF A;  1T2K A;  3RPU A;  1I6X A;  3SZT A;  2Z3Y A;  4XSZ F;  2Z9O A;  2HGC A;  1HKT A;  2IPQ X;  3RTR A;  2ZKZ A;  1RI7 A;  2XV4 S;  4LGW A;  2NYX A;  3QRF F;  1FP1 D;  2UXN A;  2ZME A;  4A6E A;  2XRO A;  2W57 A;  5EEG A;  1DUX C;  2QM3 A;  3ULQ B;  1V3F A;  2UWM A;  2V6C A;  1ODD A;  3E5U A;  4U0V A;  2H27 A;  3LQQ A;  4GCV A;  2YX4 A;  1DDN A;  2KIM A;  4CDG A;  1IXR C;  3T1B A;  2V1D A;  1U8R A;  2PJP A;  4LLG F;  4IF4 A;  3WTY C;  1ON2 A;  1R1T A;  4L9V A;  3HIF A;  3WGI A;  2IA1 A;  5L3G A;  1T6S A;  2XAS A;  1JHF A;  5LEK A;  2V79 A;  2DU9 A;  3K0L A;  2HFH A;  2DK8 A;  2FOK A;  3TOA A;  4A5M A;  3WU0 A;  5HDG A;  2EA2 A;  1LQ1 A;  1O7L A;  4HQM A;  2LSO A;  4E70 A;  2XAH A;  4EJV A;  2EV0 A;  4O5V A;  1U5T B;  3ZN1 A;  5FLX Z;  2P5L C;  3I5U A;  1R22 A;  4Y15 A;  3DKW A;  4NQW A;  5FLX K;  1XB4 A;  2DFI A;  1TTY A;  3L2C A;  3CTA A;  2XAQ A;  2DI3 A;  4KIC A;  1ZRF A;  4JQF A;  2MBF A;  3TGN A;  5L3F A;  1T98 A;  2VXZ A;  4TV7 A;  2NRA C;  1YFH A;  4AIK A;  1HQC A;  2FML A;  2ZO4 A;  1O7F A;  3OOP A;  1MDM B;  1W7P A;  3TKY A;  3JSP A;  2O03 A;  4L5J A;  3TOB A;  3H3Z A;  3IWZ A;  5JFR A;  3COA C;  2LDU A;  3BPV A;  5EEH A;  3QPT A;  3L09 A;  2QQB A;  3RKW A;  1UB9 A;  3GEZ A;  4IRG A;  4ENM A;  4LD5 A;  5DD8 A;  3QU3 A;  1Z91 A;  4LMY A;  1I1G A;  3F8N A;  1W4M A;  2HDC A;  1U78 A;  1REP C;  2VT2 A;  1J9I A;  2J5O A;  5DUI A;  2WV0 A;  2A69 F;  4IRH A;  1EH7 A;  2H94 A;  5LGU A;  1IAW A;  2HKO A;  1FSH A;  3R6S A;  4RB0 A;  2CFX A;  3E6B A;  5F1R A;  1GHC A;  5CVI A;  4GYI A;  2D1V A;  3IRR A;  4PGG A;  3E5Q A;  2FBI A;  3GZ6 A;  1B9N A;  3GFJ A;  4MEX F;  1Z6R A;  1Z6T A;  3E97 A;  1KYW A;  1B1B A;  1YO5 C;  5IT3 A;  2Z33 A;  1R5H A;  3G73 A;  4YFK F;  5E1W A;  3LAP A;  2P7C B;  4LLL A;  2LNB A;  1SAX A;  1F5T A;  4ZZL A;  1IN7 A;  1YG2 A;  2W24 A;  2K4B A;  3FM5 A;  2MLK A;  1ON1 A;  2KIF A;  4HA8 A;  1HST A;  4OIP F;  2DT5 A;  2EFW A;  1OMI A;  2Y48 A;  1W5T A;  1Y0U A;  5K5O A;  2XAJ A;  2ELH A;  2YR2 A;  5BQT A;  1YTY A;  4ZZD A;  3F6V A;  2A6H F;  4HX4 A;  2ADU A;  1I5Z A;  5FFX A;  4LJZ F;  1TW3 A;  2W25 A;  4WX9 A;  2A6E F;  1HW5 A;  4MNU A;  1G3S A;  1BI0 A;  3HRM A;  4KN4 X;  3IL2 A;  1AWC A;  3ZPL A;  5D4R A;  2QYO A;  5FB2 A;  4RAY A;  1O3Q A;  5JR3 A;  4Q47 A;  3DF8 A;  1SD5 A;  1HW2 A;  4FX4 A;  2K02 A;  2QQA A;  3K1M A;  5FD5 A;  3BY6 A;  4XLN F;  5IT9 Z;  5CYV A;  4KNY A;  2ZXJ A;  2MC3 A;  1FC3 A;  2P7V B;  5AON A;  4KFC A;  4M9Z A;  2VOD A;  1Z7U A;  2ZME B;  3EUH A;  4I7H A;  3OV8 A;  2B0L A;  4U0W A;  1SD6 A;  3M9A A;  1TQM A;  3KEQ A;  3Q9S A;  1TW2 A;  2IJL A;  5K1Y A;  1G4D A;  2EFP A;  2IT0 A;  5E8G A;  1OYY A;  3GUD A;  2G7U A;  1QZY A;  3B73 A;  4U7B A;  5CLS A;  1FYK A;  1LNW A;  4RB1 A;  4NHJ A;  3DFG A;  4HLY A;  1IXS B;  1BM9 A;  2ESH A;  3LA7 A;  4RB2 C;  1MJB A;  1XSX A;  3CO6 C;  4G7O F;  3V7C A;  1Z1D A;  4MQ9 F;  3BZ6 A;  1TNT A;  4I2O A;  2HKX A;  2CW0 F;  4WK8 F;  1ONV A;  3I4P A;  1FY7 A;  4ZYD A;  5FGM A;  1R23 A;  3FWE A;  4RGX A;  3JAM K;  3L7W A;  4KN7 X;  2VBX A;  1SFE A;  3K2Z A;  3WOD F;  4ESB A;  4KYW A;  2ZNZ A;  5D8L B;  4QLC U;  3SXY A;  4IRI A;  1J59 A;  5ILS A;  5D5X B;  4GGG A;  1PP8 F;  3IKT A;  3WTT C;  1TQI A;  1KQ8 A;  4HV6 A;  2XAF A;  1KGS A;  2DPD A;  5BS6 A;  3I59 B;  2GQQ A;  2FQ3 A;  2CWE A;  1O3T A;  3RJP A;  1P2F A;  1ZAR A;  4R79 A;  2GA1 A;  3RI4 A;  3H3U A;  3V7R A;  4HX8 A;  1YW9 A;  1YS7 A;  5LBQ A;  3FX3 A;  4HDV A;  5J6X A;  2E7W A;  1TQP A;  2LF8 A;  2QLZ A;  2ESN A;  3KZZ A;  1XCV A;  3TO7 A;  4IJA A;  2FBK A;  3KET A;  3DPT A;  1SD4 A;  2EFN A;  1S7A A;  1SMT A;  3ZMZ A;  4UVC A;  3I0T A;  5JHU A;  1F9N A;  4AWX B;  5F64 A;  4JK1 X;  1R5G A;  2KJC A;  3BWG A;  4BYY A;  3P7N A;  2V1X A;  4HW0 A;  4RGU A;  4QWQ A;  5HOO A;  1O3R A;  4UUV A;  3LQR A;  4ZYG A;  1EV7 A;  3V4G A;  4S04 A;  1B4A A;  3GFM A;  1UHW A;  4MTE A;  3W6K B;  2WWY A;  4HDU A;  3MZY A;  1LDK B;  1USS A;  4AD9 A;  5FD6 A;  3DV8 A;  5BPI A;  4EGY A;  2ISY A;  1YW8 A;  3CUQ C;  4H0E A;  3PFI A;  1S7O A;  3DQV C;  1FSE A;  1ZRE A;  3GLX A;  4UXN A;  1QBJ A;  1KYZ A;  1P4A A;  2L4A A;  2KKO A;  2H6B A;  1T38 A;  2EB7 A;  2D1H A;  1E17 A;  4UNO A;  2IW5 A;  1DP7 P;  3F8B A;  2JZY A;  2YPR A;  3FMR A;  1RUN A;  1P6R A;  5D6E A;  4Q48 A;  4YIF A;  4L0Y B;  3HYI A;  4A5N A;  1FBS A;  3DXJ F;  3FXQ A;  1T39 A;  3N4M A;  4A12 A;  1IN4 A;  2WTE A;  4IHS A;  3W6J B;  3G3Z A;  3F8F A;  2M45 A;  4G94 A;  3VB2 A;  5LGT A;  3R0A A;  1B6A A;  2QQ9 A;  4G9Y A;  2FNP A;  1BC8 C;  2FSW A;  3KLO A;  4YII A;  2L54 A;  1XDU A;  2EV6 A;  2CO5 A;  3MWM A;  5ICF A;  5ICE A;  3J80 Z;  4L9N A;  5HLI A;  4G7Z F;  3CUQ A;  3ZMD A;  1WI9 A;  3J80 K;  3I53 A;  1KU9 A;  3GW2 A;  4HF0 A;  2STT A;  5HLH A;  2DPU A;  2CGP A;  3MQ0 A;  2X4H A;  4M6Y A;  3SQN A;  4XLP F;  1SFX A;  2GXB A;  2VC0 A;  2DQR A;  4P96 A;  4RGS A;  3N97 A;  5D5W B;  1NHA A;  2HOE A;  4LG0 B;  4BQA A;  3E6D A;  2W85 A;  5HDN A;  4RS8 A;  2OQG A;  4KIB A;  4F7Z A;  2DBB A;  2VBZ A;  1XCB A;  2MLG A;  3GYH X;  4I02 A;  2Q0O A;  3L9F A;  1IXC A;  4OIQ F;  3WGG A;  3E3V A;  5LGN A;  1J0R A;  5DCM B;  2HYG D;  3E5X A;  4ZYE A;  1PDN C;  5D8K B;  2P4W A;  2RDP A;  4I98 B;  3VOE A;  1ZYR F;  1L3L A;  1CF7 B;  3J81 Z;  2NNN A;  4G8X A;  4BHP A;  2Q2E A;  4PDK A;  4XRF A;  3J81 K;  1K78 B;  2GXG A;  4IPA A;  5E20 A;  2STW A;  3ERE D;  2RN7 A;  2QEN A;  1U3E M;  4M71 A;  1BN5 A;  4EM2 A;  1BC7 C;  5CVR A;  4IXA A;  2DQL A;  3F23 A;  1J5Y A;  1IF1 A;  4P9U A;  3TDU C;  2IA0 A;  1HBX G;  1RNL A;  3C7J A;  3FMS A;  2LKP A;  5LRR A;  3K9T A;  2P5V A;  3IKV A;  1FT9 A;  4K2E A;  1QZZ A;  1R1V A;  5D4S A;  5JVT A;  2H6C A;  3ZMV A;  2XGX A;  5DCF A;  5E8I A;  2RQP A;  4ENK A;  1ZLJ A;  2JPB A;  2F5C A;  3P9K A;  3IWF A;  1MGT A;  2XRN A;  4CGZ A;  2QBY A;  2CSO A;  3HSR A;  4ETS A;  2GWR A;  3R61 A;  2FEZ A;  3K1N A;  3ABT A;  1G6N A;  2K7L A;  3ML6 A;  4B09 A;  3WTU C;  2E7X A;  1FLI A;  3CJN A;  5AIQ A;  3VEP A;  2M5W A;  3C18 A;  3BJ6 A;  1XN7 A;  3MEX A;  4OIO F;  1BJA A;  1CGP A;  4ZYH A;  1R7J A;  2EK5 A;  5DYM A;  4LLN A;  2PMU A;  3U1D A;  2FU4 A;  2MH9 A;  4G6D A;  1K7A A;  2YSR A;  2IP2 A;  2RKH A;  3GZ5 A;  4KIG A;  2ACJ A;  4HOB A;  2XUB A;  2OQR A;  4KMU X;  4D0P A;  2P6S A;  1TNS A;  1R00 A;  3KP5 A;  2HZT A;  5ICC A;  2CG4 A;  3MAJ A;  1UCR A;  2A5Y B;  4B8X A;  4A0Z A;  2XIG A;  3JTH A;  5LRS A;  5KK1 A;  5DEQ A;  5TJJ A;  3RDI A;  3WE3 A;  4OOI A;  1KU2 A;  2VBW A;  2OZ6 A;  1FZP B;  2NAZ A;  2XKO A;  1IW7 F;  2M1B A;  4N9I A;  2M30 A;  1XMK A;  2R3S A;  3Q5F A;  1JHH A;  4KT5 C;  5H6R A;  1P4X A;  3I64 A;  2BE5 F;  1QGP A;  5E17 F;  2ZFW A;  3IC7 A;  5ED4 A;  1SFU A;  1BI3 A;  2Q8K A;  2F2E A;  3F21 A;  4KA4 A;  3SFZ A;  1F4K A;  2FMY A;  1C0W A;  1A04 A;  2DW4 A;  2A68 F;  2OA4 A;  2BGC A;  4UV9 A;  3M8E A;  3GVA A;  1F1Z A;  3FHZ A;  4BHC A;  3LFK A;  4A0X A;  4BNC A;  1U5T A;  4LK1 F;  2EA4 A;  3QAH A;  5LHH A;  3SZP A;  1S8N A;  5HLG A;  2PBI A;  4HLX A;  3WU1 B;  2D2W A;  4RB3 C;  3TO6 A;  2EFO A;  1IN6 A;  1Q1H A;  3WGH A;  2HS5 A;  2QWW A;  5E1X A;  4ESF A;  2AXL A;  3JAM Z;  3JSO A;  2V1U A;  3R60 A;  4OMY A;  3F8C A;  1JGS A;  3RYR A;  1FNN A;  4WXC A;  2PQ8 A;  1MDM A;  3M7G A;  1H0M A;  3R4K A;  4DQ2 A;  1B9M A;  1TBX A;  2ZNY A;  4G6Q A;  5D5U B;  1OYI A;  2PEX A;  4O6J A;  3F3X A;  3M1E A;  4ENN A;  1BI2 A;  4AIH A;  5LHI A;  3NRV A;  5LEJ A;  1P92 A;  3QP5 A;  3CDH A;  3IHU A;  3BJA A;  3ISP A;  3RKX A;  1UFM A;  5E1Z B;  1I27 A;  1MD0 A;  5DDG A;  1K6O A;  3ABU A;  2A07 F;  4HF1 A;  2FNA A;  3C1D A;  4PCQ A;  1W7P B;  2HYF A;  4AVP A;  2Z99 A;  1S6L A;  1T0F A;  4FHT A;  1G3Y A;  2KJB A;  2JTV A;  3WTV C;  3MFK A;  2HEO A;  1ZRD A;  1B59 A;  3QP6 A;  5ICG A;  5LLQ A;  3HRT A;  5DD4 A;  2BEO A;  4CXF A;  3B02 A;  4BXU A;  2H09 A;  4CHU A;  1D5V A;  3DPL C;  3MZH A;  5BMZ A;  1OPC A;  4GXO A;  3KP3 A;  3V8J A;  3O3K A;  2TDX A;  3RIR A;  3HHG A;  2VN2 A;  1HKQ A;  4EJU A;  1S29 A;  2C6Y A;  1HW1 A;  4G7H F;  4EQQ A;  2QVO A;  5E18 F;  3GO5 A;  2OZU A;  3GXO A;  3DP7 A;  4BAY A;  1IRG A;  4GO1 A;  1LB2 A;  3K69 A;  4EJO A;  2CQK A;  2PG4 A;  5ERI A;  1FPQ A;  2K27 A;  1ZGA A;  2QBY B;  2D45 A;  2VT3 A;  3FZV A;  3LST A;  2HTS A;  3F72 A;  1MZB A;  2VBY A;  1FBU A;  2HWV A;  1U2W A;  1I1S A;  4ENJ A;  3HSE A;  1W7P D;  3HHH A;  4OIR F;  3BP8 A;  3P9C A;  2PI0 A;  2EJR A;  4N0B A;  4O3M A;  3FF5 A;  5L3E A;  4KUM A;  1YYV A;  2R7F A;  1KU7 A;  1D8J A;  6PAX A;  1KA8 A;  4ESJ A;  3ELK A;  5ILU A;  2COM A;  1TLH B;  3BJO A;  4A0Y A;  4EV0 A;  4Q5S F;  1FWZ A;  5LHG A;  1IUY A;  1WKM A;  1MJA A;  3RKY A;  4L0Z B;  2PN6 A;  4AIJ A;  3Q9V A;  1H9G A;  1OKR A;  4XSX F;  3L00 A;  1S3J A;  3T5X A;  1LDD A;  2FF4 A;  3KZY A;  3RPQ A;  5H20 A;  2GA2 A;  5ILV A;  2O3F A;  5L3B A;  2HR3 A;  4DNC A;  4YFN F;  2DO7 A;  1PUE E;  4LB5 A;  3DEU A;  4CYD A;  2F5F A;  4N9H A;  1BI1 A;  4FT8 A;  3ECO A;  4ZH4 F;  2CYY A;  4UV8 A;  2PMH A;  2JT1 A;  3F6O A;  4EM1 A;  1H9T A;  5CVV A;  3CO7 C;  3HRU A;  1YQA A;  1X3U A;  4EJW A;  1ULY A;  2VON A;  4LB6 B;  1E2X A;  5DUK A;  1OR7 A;  2BBY A;  3F22 A;  2DLL A;  2OBP A;  3HTS B;  3KP2 A;  1KU3 A;  3LA3 A;  3I54 A;  4CO8 A;  4OIN F;  2FXA A;  4I0A A;  1QQI A;  1D8K A;  1ZRC A;  4BH9 A;  2X0L A;  3ZMU A;  1IZ1 A;  3P9I A;  4EMS A;  4WCG A;  3NEU A;  2OD5 A;  5H6Q A;  5BOX A;  2FRH A;  3F8M A;  1EH8 A;  2DTR A;  2P8T A;  4NB5 A;  1YIO A;  1OYW A;  2M87 A;  1QO0 D;  4U7D A;  1LJ9 A;  2Y0M A;  2HQR A;  4UVB A;  1WWX A;  3TDZ C;  4WXH A;  3I59 A;  4WF2 A;  4MHG A;  4MTD A;  4RGR A;  3D0S A;  1L0O C;  4Z2Y A;  4U88 A;  1SD7 A;  4CIC A;  1MKM A;  4MQV A;  4R8H A;  2L3D A;  4L18 B;  4PZJ A;  1JE8 A;  4HX7 A;  4EGZ A;  2K86 A;  1YS6 A;  2XVC A;  2QZ8 A;  3BDD A;  3LAJ A;  2ZCW A;  2L02 A;  3E6M A;  5F6F A;  2RV8 A;  3O2P E;  4YG2 F;  2P6T A;  2GZW A;  1IN8 A;  1V4R A;  3KP7 A;  1R36 A;  1XSV A;  4HF2 A;  2BV6 A;  3KE2 A;  3ZQ7 A;  3CUO A;  3BPX A;  3FXR A;  1RUO A;  1DPR A;  1LEB A;  4M9X A;  2EWN A;  4S05 A;  2NNY A;  1G3T A;  4BHB A;  1P4W A;  1LEA A;  2G9W A;  3HSF A;  3V7S A;  5JI6 A;  1HKS A;  2V9V A;  3LWF A;  4HYE A;  4HQE A;  4UHT A;  5AIP A;  1ZLK A;  3QPH A;  3WTS C;  1R1U A;  5HS8 A;  4XBF A;  5CVJ A;  2ETH A;  2VOO A;  4I01 A;  1Z05 A;  5D6F A;  2KIU A;  2KRF A;  3FMQ A;  2ZJ2 A;  1FYL A;  4GYG A;  1LDJ A;  2EV5 A;  3PQJ A;  5FO5 A;  3ROU A;  1J75 A;  2E1N A;  1D3Y A;  2YU3 A;  2QUF A;  1Z9C A;  2K4J A;  2XKP A;  1FYM A;  1BIA A;  3VOD A;  1RZ4 A;  2HQN A;  4KDP A;  2R7D A;  2LF7 A;  2A61 A;  2RC4 A;  3BRO A;  1ZHF A;  1U5T C;  4HBL A;  3T8T A;  3CLO A;  2FBH A;  3NQO A;  1R58 A;  5K5Q A;  2O6G E;  5HS7 A;  1XSD A;  2O8X A;  1HXD A;  2GIV A;  4M9S A;  5J8C A;  4A2U A;  4A6D A;  1ZG5 A;  2EFQ A;  4CZZ A;  5K5R A;  2VE9 A;  2AS5 F;  1JXS A;  1ZH5 A;  3MCZ A;  3HOS A;  2DK5 A;  4I0B A;  3BOQ A;  1XD7 A;  1ZAO A;  2RNJ A;  1GXP A;  1ZGJ A;  3WTX C;  3KP4 A;  1O3S A;  2MA3 A;  4LK0 F;  4HZF A;  3T0Y A;  2NS0 A;  4WWC A;  3SHF A;  4P55 A;  1BBY A;  3EET A;  2A3S A;  1WRJ A;  3FXU A;  1IRF A;  3J7A O;  1RIO H;  2P5K A;  5IT9 K;  4WXD A;  3I58 A;  4P9F A;  2JSC A;  3KP6 A;  2DAO A;  2F5E A;  4KMF A;  4LG0 A;  3ECH A;  3C3W A;  1O57 A;  3ZMS A;  3ZP5 A;  3GFI A;  2L01 A;  2ZBK A;  4Q4Z F;  3U9G A;  1PP7 U;  4R1H A;  5D5V B;  2RGV A;  4IVN A;  3HUG A;  1YLF A;  4LFU A;  2BYV E;  1YW7 A;  2L4M A;  1GXQ A;  5KVR A;  2HTJ A;  2W84 A;  4L9J A;  4HAM A;  3T8R A;  3CUQ B;  2XHK A;  2OU2 A;  5DCM A;  3JTG A;  3KCC A;  1XGS A;  1HSJ A;  3HOT A;  1AOY A;  2JPC A;  4EJT A;  5CJ9 A;  1WSU A;  5HS9 A;  3GF2 A;  3H92 A;  1CF7 A;  1LVA A;  3WG9 A;  4OU0 A;  3KEO A;  1BIB A;  3ZMT A;  4Y17 A;  5HDK A;  1ZG1 A;  5A2Q Z;  1K78 A;  1BOA A;  3TQN A;  5A2Q K;  2PLY A;  4I09 A;  3LA2 A;  5L3C A;  2UXX A;  1XDS A;  3EDP A;  1ZG3 A;  4Y13 A;  1W5S A;  1XGN A;  2UZK A;  3V8K A;  3TO9 A;  4EM0 B;  1MJ9 A;  1J7K A;  1GVJ A;  5HVQ C;  1ZN2 A;  2Z5U A;  3EYY A;  4ASN A;  4M73 A;  3WTZ A;  3EYI A;  1FX7 A;  2O0Y A;  3O6B B;  2VE8 A;  1DPU A;  3VFZ A;  2RVC A;  3QU6 A;  2VC1 A;  4U0Y A;  4YFX F;  4FX0 A;  1KQ9 A;  3I71 A;  3GX4 X;  3ZN0 A;  4UVA A;  2YX7 A;  3M8F A;  1FP2 A;  3WE2 A;  1UST A;  5L3D A;  2IVM A;  1FBQ A;  2IRF G;  3V8L A;  3E6C C;  4MEY F;  1J2X A;  4L5I A;  3REO A;  1UHM A;  2XAG A;  3U2R A;  3KLN A;  3R0J A;  3JW4 A;  4M74 A;  1EH6 A;  4M72 A;  4HV5 A;  4P5O A;  3EQL F;  1IN5 A;  3RYP A;  2F5D A;  5TRD A;  2MH2 A;  2E1C A;  3D5L A;  2GAU A;  3IRQ A;  4ON0 A;  3HRS A;  1WQ2 A;  1G3W A;  2FE3 A;  2ISZ A;  1VTN C;  4L9T A;  3S2W A;  4OMZ A;  3K1P A;  5BPD A;  4RAZ A;  1FOK A;  2PFB A;  2JRT A;  3PQK A;  4EVI A;  3AAF A;  4JBA A;  1STZ A;  4IHT A;  2J5P A;  5CVU A;  2VOP A;  2M8E A;  2Y75 A;  1U6G A;  1SMY F;  2WC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...