3R60A

Structure of the mntr fe2+ complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator mntR
total genus 51
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r60A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3r60A02
1FBUA 1G3SA 2C6YA 4I7HA 2HGCA 3QP6A 4I01A 1QGPA 5IT3A 1P92A 2IA1A 4LB5A 2ADUA 2B0LA 3BZ6A 1HW5A 2L4MA 4I02A 1HSJA 3LQQA 3WGGA 1TW2A 1B6AA 4I98B 2CWEA 2RN7A 5FD6A 5DCMB 2ISYA 2PQ8A 2ISZA 4KN4X 4HOBA 5H6QA 3FMRA 5F1RA 5DD8A 3QPTA 5BPDA 4A6DA 3NQOA 2FNPA 2L3DA 4OOIA 1PP7U 4HQMA 4M74A 2ZO4A 1B4AA 4RAZA 1FP2A 5A2QK 5L3GA 1CF7B 2JSCA 4DNCA 4HF2A 5J8CA 5FD5A 3PQKA 2RC4A 1H9GA 1FOKA 2AS5F 1EH6A 2R7FA 2VC1A 4MTEA 1SFXA 2VT3A 3W6JB 1HW2A 2LKPA 4I0BA 4RS8A 4ESJA 2QQ9A 4M72A 4RB1A 2VOOA 3BDDA 3LFKA 3RIRA 3WGHA 2P8TA 4O5VA 1S7OA 4P55A 2DQLA 2Y0MA 1KYWA 2EA2A 2CYYA 3D5LA 5HDGA 2P4WA 1SMTA 4LLNA 2FNAA 5DEQA 2Z3YA 4AWXB 1SD5A 3QAHA 5AONA 2XAFA 5D6FA 4BAYA 4CXFA 1U5TA 3BJAA 1I6XA 1IN4A 4LFUA 4ON0A 3KE2A 4NB5A 4A0XA 4G6DA 3HRTA 2VODA 4MQ9F 2EA4A 3MZHA 4OU0A 4BNCA 3NRVA 1KQ0A 4IRGA 2PMHA 3BJOA 1Z9CA 3LA3A 3V7CA 2KJCA 3WTYC 1ON2A 2K7LA 3TOAA 4U0WA 4ESFA 3MZYA 2PMUA 3GXOA 1IRFA 2HKOA 5BMZA 4R1HA 1G3TA 4LJZF 2NYXA 1BI0A 2EFQA 1U5TC 4N9IA 5HS8A 3JW4A 3FHZA 2ZJ2A 1DPUA 5DYMA 5F64A 2K27A 2LNBA 3E3VA 3I71A 5FLXZ 1O3QA 1WRJA 1OR7A 5D5WB 1RUNA 2JPCA 4Q47A 1T38A 5LHIA 1OMIA 2IVMA 2XHKA 4EVIA 1FX7A 2F5FA 4AVPA 3Q9SA 1STZA 5DUKA 3V4GA 1BC7C 4RAYA 1HXDA 4LK0F 5AIQA 4CGZA 5DV5A 5BQTA 2ZCWA 1YS6A 4ZYEA 3K1PA 3M1EA 1P2FA 1ZRFA 3K2ZA 1ZGAA 1FYMA 1IN7A 2K4BA 1CF7A 2PG4A 4ETSA 4M9ZA 2GWRA 1S29A 1ZLJA 1J59A 4MGRA 1IUYA 3T0YA 1USSA 2M5WA 2CO5A 1FPQA 2FU4A 1ONVA 3I0TA 1WWXA 3R6SA 5H20A 5TJJA 5L3DA 3HSRA 2FQ3A 3H3UA 1F9NA 1R22A 2UZKA 2QENA 1P4XA 3TO9A 2XROA 2R7DA 1S3JA 1J5YA 2X4HA 2OZ6A 2PBIA 4ENKA 3CJNA 2XASA 1F4KA 1LDJA 2OBPA 5ICEA 1V3FA 4KT5C 1XN7A 1J7KA 3WTUC 2FXAA 2KIFA 4EJVA 4TV7A 2HS5A 2YPRA 3VEPA 2MH2A 1LEAA 2DO7A 1MDMB 3IHUA 1MZBA 3ZPLA 5IT9Z 3EYIA 1BN5A 5F6FA 1DPRA 2LSOA 1T39A 2HFHA 2KJBA 2XKPA 1QPMA 2DAOA 3RPUA 1TBXA 3IL2A 2H6CA 3NEUA 4KYWA 4MTDA 5CVVA 1QZZA 4HV5A 5ICCA 2GQQA 2MLKA 3OOPA 3HOSA 1RUOA 2EJRA 1LNWA 3I54A 3GW2A 3LSTA 2H27A 4HLYA 1A04A 2O03A 3W6KB 2VBZA 4HF0A 2DBBA 3BPXA 4HX8A 1IZ1A 5CLSA 2BE5F 2BV6A 4KIFA 5L3EA 3L9FA 3Q9VA 4G6QA 2PLYA 2ZKZA 2A68F 5D5UB 4ESBA 1BBYA 4KIBA 2LDUA 3GO5A 1RNLA 3ISPA 2MBFA 1SMYF 1ZG5A 2JTVA 5L3BA 2F5CA 5KK1A 2HDCA 4K2EA 1UHWA 2QUFA 3R0JA 4M6XA 3CO6C 3E6CC 1DDNA 2KIUA 3H92A 2YR2A 1XD7A 4GCVA 4XLPF 1YFHA 4IRHA 1U2WA 2Q2EA 1PDNC 1UFMA 4MHGA 2MD5A 3ULQB 2DTRA 3FWEA 4EMSA 3RKYA 1LB2A 3FM5A 4HDVA 1RZ4A 2PN6A 4LG0B 4WXCA 1XMAA 2EFNA 2QQBA 3SHFA 5BS6A 4ZYDA 2P5VA 2PJPA 3IWFA 3S2WA 4RGXA 4O6JA 1XSXA 4YIIA 3I59A 5FLXK 2PEXA 4EGZA 5HS9A 4KDPA 1T6SA 5J8FA 1KU7A 2VBXA 3RYPA 4DQ2A 3GYHX 4MQVA 4U88A 4WXDA 4H0EA 2IA2A 4B8XA 3CO7C 1J75A 1R5HA 1GVJA 3DEUA 2STTA 4RGUA 4OIQF 3GFMA 3I64A 3F21A 3V8JA 3WODF 3ECOA 3GX4X 1CGPA 3M9AA 1W4MA 4KMUX 2BBYA 4GYIA 3K9TA 4UXNA 3SQNA 2DI3A 2A07F 1R00A 3J80K 1B59A 2BEOA 4FX4A 5BOXA 5ERIA 1IF1A 5L3FA 3F6OA 1OYWA 2K86A 2EFOA 2PI0A 4KNYA 2COMA 1FYKA 2G7UA 3JSOA 4HF1A 1XSVA 3LA2A 2R3SA 2X0LA 5ICGA 3E5QA 2WTEA 1S6LA 3FXUA 1JXSA 3BJ6A 3JAMK 3MAJA 2W57A 1YTYA 4ZZLA 3KCCA 4BHCA 2V6CA 2L01A 1FZPB 2YU3A 3P9CA 3KP2A 2W25A 5L3CA 3CLOA 1Z91A 5HDNA 2Z9OA 2NRAC 2ESHA 3ABTA 1IXSB 4A12A 1ZLKA 4G94A 1O3RA 2DK5A 1EH8A 2OAZA 4L9TA 1G6NA 1XGSA 3CUOA 3JTHA 3WTTC 5LBQA 3HTSB 2P6SA 2VONA 1TTYA 3PFIA 2ESNA 4ENJA 1FBSA 2BYVE 4HYEA 2TDXA 4QWQA 4BXUA 2FRHA 1W7PB 4MEXF 3ZP5A 5LGTA 2DW4A 1IN5A 2A6EF 1BJAA 4IHSA 3D0SA 1FNNA 3GFIA 3BPVA 2QVOA 3HRUA 3HTUA 2OA4A 2W24A 3HHGA 2OD5A 3HSFA 1TNTA 1IXCA 3M8FA 4BH9A 3C1DA 5LHGA 1GHCA 1YS7A 1D3YA 3CUQB 2G9WA 4L9NA 4XBFA 2GA2A 3N4MA 3EYYA 1T98A 1V4RA 4XSXF 4M6YA 4I09A 3HYIA 2Y75A 3GFJA 2ZBKA 5FFXA 1UHMA 2BGCA 3C3WA 1LJ9A 5HLHA 2F5EA 2IP2A 5ICFA 1VTNC 3WTXC 1W5TA 2EFWA 4PGHA 4U7BA 3F22A 4HAMA 2GAUA 4EJOA 4KN7X 5E1WA 5CJ9A 1ON1A 2NNYA 4HX4A 4Q4ZF 1YLFA 2W84A 5JHUA 2VE8A 4HZFA 4M71A 5DDGA 1JHHA 4EV0A 4BHBA 2IJLA 2FSWA 2P5KA 4A0YA 3MQ0A 1IRGA 3L2CA 1T0FA 1SD7A 1B1BA 2M1BA 4WXHA 2RQPA 5DD4A 1K79A 4ZZDA 5HDKA 1R5GA 5LGUA 1FBQA 3CTAA 3HSEA 1YIOA 2QQAA 4L9VA 5HLIA 1LVAA 3BP8A 4GYGA 4L5JA 4L0ZB 4N0BA 5ED4A 4MNUA 2MA3A 1ZG1A 2STWA 1PUEE 3V8KA 4UV8A 3R0AA 1ULYA 2P7VB 3R60A 3QOPA 4Y17A 1ZARA 1O57A 3J80Z 2QLZA 2L4AA 1MD0A 2O8XA 2O6GE 2OZUA 3RPQA 3ROUA 1L0OC 1YW7A 4WK8F 2V1XA 4ZH4F 1IW7F 2EV0A 1SFUA 4R79A 3F6VA 4XRFA 4WF2A 3MCZA 1U5TB 1REPC 4BYYA 3ZMTA 3ZMZA 3FMSA 2VT2A 3KEQA 2MH9A 3TKYA 4XLNF 1R23A 5DCFA 3K0LA 3GZ5A 3FXRA 5KVRA 1U3EM 3O6BB 1TLHB 4GGGA 2ZXJA 1W7PA 3F8NA 3EETA 4FX0A 3FX3A 3I5UA 3ZMUA 2CFXA 1HKSA 5ILVA 1L3LA 3DV8A 1QZYA 1HBXG 5E18F 3LAPA 3LAJA 1EH7A 3HRMA 3BWGA 3IRRA 2VE9A 3MFKA 1Z1DA 2CGPA 4HW0A 4YFKF 3C18A 4L5IA 4LLGF 5TRDA 4A2UA 1IN6A 2IPQX 3R61A 3DP7A 4R8HA 3DKWA 3U1DA 3KP4A 2IA0A 2QBYB 5EEGA 3ELKA 3M8EA 4LD5A 3BOQA 3SXYA 1NHAA 1IAWA 2XAGA 3WTVC 1XGNA 3TQNA 3IKTA 4OIRF 3F8MA 5E8IA 3BY6A 1Q1HA 3ZMDA 2MC3A 2EV5A 5HLGA 1W7PD 1SFEA 3WTWC 3J7AO 1R58A 1XDSA 2HWVA 1BC8C 1ZG3A 5ILUA 1O3SA 5CYVA 2XRNA 5FO5A 3TDUC 3KFWX 1JHFA 1TNSA 1KGSA 1HW1A 4AIHA 1I1SA 4G7HF 1C0WA 4WX9A 2FE3A 4CZZA 4OMZA 4KICA 1WI9A 4M9SA 2IW5A 3WE3A 1QQIA 1ZREA 5CVUA 3ML6A 3COAC 4KA4A 3L09A 5DUIA 4L9JA 1I5ZA 3CDHA 3GF2A 1Z6TA 1YG2A 5HVQC 3DF8A 1U78A 1XDUA 3RKWA 3Q5FA 1IN8A 1DP7P 4IRIA 1K78B 1MGTA 4ENMA 4RGRA 3IRQA 1BI2A 2RVCA 3WE2A 2W85A 1R1UA 5LEJA 3I59B 2NAZA 2IRFG 2HOEA 2M8EA 5IT9K 2FMLA 5CVRA 1X3UA 3KEOA 4G8XA 3REOA 1K78A 5FGMA 3N97A 4BHPA 3B73A 4HV6A 5LEKA 4CYDA 1B9MA 1SD6A 1XCVA 1QO0D 2CG4A 2NS0A 5BPIA 4A5NA 3O3KA 3F23A 3PQJA 2DK8A 1B9NA 1JE8A 5D8LB 4EM2A 4QLCU 2Z33A 3LWFA 3T8RA 1PP8F 3EQLF 3I53A 2Q0OA 2CQKA 1I27A 3HOTA 3RI4A 1EV7A 1XMKA 2VBYA 2ACJA 1ODDA 4EM1A 2RV8A 2VXZA 3KLOA 1XB4A 3U9GA 3KP6A 2G7HA 1G3YA 1FY7A 2M45A 4FT8A 3T1BA 4HLXA 2EFPA 3SZTA 2L02A 1LQ1A 1O7LA 2FBHA 2F2EA 3ZN1A 3RTRA 1Z05A 3WGIA 2WWYA 3VB2A 2D1HA 3G3ZA 5HS7A 2J5PA 1GXPA 1BIAA 3ABUA 2XIGA 2O0YA 3HUGA 2Z99A 3FM3A 3QPHA 3E6DA 4NQWA 4IF4A 3CUQA 2V79A 3T8TA 4OINF 3VOEA 5D5VB 2GA1A 3KP3A 3I4PA 1OKRA 5EEHA 1ZYRF 2KIMA 3GZ6A 5ILSA 2EK5A 2OQGA 4ZYHA 4HQEA 3QU3A 3KLNA 1S8NA 4S05A 3KP5A 1TQPA 5K5OA 1BIBA 2FOKA 2XAHA 4UVCA 3TGNA 4JK1X 3IKVA 3ZN0A 1P6RA 4CHUA 3J81Z 5E17F 4EJWA 1YW8A 1K6OA 4Q5SF 3E97A 2YSRA 1OYIA 1TQMA 1UCRA 1OYYA 3HRSA 2ZMEA 4D0PA 4WCGA 2LF8A 1RI7A 3GEZA 2P6TA 3TO6A 5H6RA 2WV0A 2HTJA 2XAQA 3RYRA 3DQVC 2DLLA 2HZTA 3WU1B 2XKOA 4EM0B 1D5VA 3I58A 4U7DA 4UVAA 5FFZA 4UNOA 4Z2YA 4CDGA 2V1DA 4Y15A 4O3MA 2RGVA 4S04A 4EQQA 1YW9A 1S7AA 3ZMVA 3ZQ7A 1JGSA 3MEXA 1BI3A 2OU2A 3F3XA 4YIFA 1XGOA 2DQRA 1BI1A 2GIVA 1TW3A 1FWZA 2JZYA 4UHTA 4A0ZA 1MJAA 3C7JA 4BQAA 6PAXA 5FB2A 5LRRA 2JPBA 1FP1D 3KZZA 2RKHA 3ERED 1Z6RA 4CO8A 4E70A 3V7SA 2K4JA 1LDDA 3F8CA 3F72A 4IPAA 2GZWA 1P4AA 2DPUA 4KIGA 2DU9A 4AD9A 4CICA 5D4RA 4IVNA 3TO7A 3T5XA 3DFGA 1W5SA 1UB9A 4U0YA 1F5TA 3JSPA 2VC0A 2EWNA 2ETHA 2H6BA 2ZNZA 3J81K 4IXAA 2A5YB 1YO5C 3L7WA 2VBWA 3V7RA 2HQNA 3DPTA 3RDIA 3K69A 1KQ9A 1TQIA 3OV8A 4RB2C 2FBIA 5K1YA 1KA8A 1IXRC 4LLLA 1BM9A 1QNTA 1FSEA 3HHHA 3WG9A 3E5UA 2CW0F 4OIPF 3DXJF 2AXLA 3M7GA 1E2XA 2Y48A 2JRTA 2E1CA 1FT9A 3GFLA 4P9UA 1LDKB 4P9FA 2FA5A 2XVCA 3B02A 3F8FA 4KUMA 4AIJA 2RNJA 1ZGJA 4Y13A 2NNNA 1Z7UA 4WWCA 3FF5A 2ZNYA 2ZFWA 3EUHA 4F7ZA 1H9TA 1D8KA 2EB7A 1HQCA 5K5QA 2VOPA 3E6BA 2P5LC 3WTZA 3GLXA 4RGSA 2HR3A 1G3WA 2UXNA 4KMFA 5LRSA 4I0AA 4UUVA 1KU2A 4PGGA 3WU0A 2HYGD 3K1MA 4G7OF 2H94A 4JQFA 1G4DA 4KFCA 1SAXA 2EV6A 2A69F 4GO1A 3FZVA 2UXXA 1R1TA 1U6GA 3LA7A 3QRFF 4EJUA 1R1VA 2Q8KA 3TOBA 2IT0A 1FLIA 3SZPA 4HX7A 2MLGA 3KZYA 2HKXA 1WQ2A 2L54A 4ZYGA 4U0VA 4IHTA 4OMYA 4YFXF 3DPLC 4YG2F 4I2OA 1FSHA 3ZMSA 2K02A 1R36A 2LF7A 2WC2A 5LLQA 1RIOH 1ZAOA 4PDKA 2OQRA 4MEYF 2XUBA 3AAFA 4HDUA 1WSUA 4LK1F 2JT1A 4P5OA 1D8JA 2HTSA 4ENNA 2YX7A 2YX4A 1KQ8A 3P7NA 1I1GA 4RB3C 4PZJA 1ZRCA 4M9XA 2GXBA 4LB6B 1HSTA 2FBKA 2QYOA 4M73A 4N9HA 2HQRA 3FMQA 3GUDA 4HA8A 4AIKA 2DT5A 2Z5UA 5E1XA 1F1ZA 5JR3A 3BROA 3VFZA 3JTGA 2HEOA 1AWCA 3QP5A 4XSZF 2DFIA 1K7AA 2QBYA 2J5OA 4Q48A 1HKQA 3V8LA 5AIPA 4OIOF 4B09A 2A6HF 4L0YB 3KETA 4ASNA 1H0MA 2E7XA 4EJTA 5HOOA 3HIFA 2XAJA 4UVBA 4RB0A 2F5DA 1R7JA 2CSOA 2FEZA 1J0RA 5CVJA 4A6EA 3GWZA 2P7CB 2FMYA 5CVIA 2ELHA 1HKTA 1ZH5A 1AOYA 3IWZA 4EGYA 1XCBA 1WKMA 1USTA 1QBJA 5E20A 2KRFA 3E5XA 4GXOA 2D2WA 2ZMEB 4LMYA 2GXGA 2QM3A 1O7FA 2O3FA 1YYVA 4PCQA 2D45A 4LG0A 1MJBA 3CUQC 5K5RA 3RJPA 1XSDA 1YQAA 1KU3A 3K1NA 1ZHFA 4JBAA 1MDMA 3G73A 2H09A 2D1VA 3R4KA 3LQRA 3VODA 5JVTA 3P9KA 5LGNA 1U8RA 1KYZA 2QZ8A 1KU9A 1P4WA 2E1NA 3IC7A 2XV4S 3P9IA 2UWMA 2QWWA 3TDZC 2XGXA 4P96A 3F8BA 5JFRA 5LHHA 4YFNF 5D4SA 3JAMZ 2M87A 1ZRDA 1GXQA 4HBLA 2KKOA 3EDPA 3L00A 3O2PE 2FF4A 4LGWA 2A61A 1XGMA 1DUXC 3KP7A 2V1UA 4G9YA 5E1ZB 2PFBA 3FXQA 5A2QZ 1T2KA 3U2RA 2V9VA 2RDPA 1FC3A 1OPCA 1J2XA 1SD4A 3GVAA 4A5MA 1MKMA 5D5XB 2A3SA 1O3TA 4G7ZF 3QU6A 1LEBA 5E8GA 2E7WA 1MJ9A 4UV9A 5J6XA 2VN2A 1J9IA 3E6MA 5D8KB 5DCMA 2O61A 4IJAA 2HYFA 1ZN2A 3MWMA 3RKXA 1FYLA 4L18B 2DPDA 2M30A 4NHJA 3WTSC 1E17A 3H3ZA 4FHTA 5JI6A 5D6EA 3ECHA 3SFZA 1Y0UA 1BOAA
chains in the Genus database with same CATH superfamily
1FBUA 2NOJB 1ETWA 1G3SA 1SANA 4B3XA 2C6YA 2LYCA 4I7HA 2R7UA 3A03A 2YUSA 3FBIB 2ELJA 2HGCA 1OCCH 5M5XJ 3QP6A 4CA0A 4I01A 3TW6A 2CQNA 1QGPA 5IT3A 4M3FA 1P92A 3OMYA 3CCUI 2IA1A 1YX5A 3K6GA 4LB5A 2ADUA 1WJBA 5IOZA 3HC7A 5GAGJ 2B0LA 2ID6A 3BZ6A 5EGOA 4BGDA 3OS1A 1VQKI 2KRHA 1ETYA 1HF0A 1HW5A 2V4JC 3JRDA 2L4MA 4C2UA 4I02A 1HSJA 3LQQA 1V54H 2CMPA 3QWLA 2OV7A 1TW2A 2X9DA 3WGGA 1W0UA 4CCKA 2R92J 4DIQA 1R49A 1B6AA 4I98B 2CWEA 3VSLA 1MBGA 2RN7A 2VB6A 2XF6A 1VQOI 5FD6A 2CFOA 3OYAA 2LKSA 5DCMB 3V42A 2ISYA 3OYMA 4IHWA 3BG7A 3RQIA 2PQ8A 2KZGA 2Z16A 2ISZA 2VKVA 3BQYA 4Y33A 4IX7A 4KN4X 1ORKA 1O4XA 1OCTC 4HOBA 5H6QA 1S7EA 3FMRA 1LFUP 5F1RA 1RKWA 2X6OA 4UB6C 2VQGA 3QPTA 5DD8A 5BPDA 1G59A 2Q1ZB 2W82A 2LP0A 3NAUA 4A6DA 3NQOA 2FNPA 2L3DA 4XKCA 4CCNA 4OOIA 2H8WA 4MIMA 1PP7U 1VNDA 4HQMA 4M74A 3ZCOA 2OCCH 2JA8J 1SVOA 2ZO4A 1B4AA 3RQ4A 5HLTA 4RAZA 2IS2A 1FP2A 5A2QK 5L3GA 1CF7B 2JSCA 4NC6A 4DNCA 4MFEA 4PSWA 4HF2A 5J8CA 5FD5A 1P7JA 5CQGA 2DDBA 2BXYA 3S16J 3PQKA 2K3FA 3BQZA 2RC4A 1H9GA 1ETQA 1UMQA 2JUCA 1FOKA 2AS5F 1EH6A 1R5ID 2MYSA 3HOVJ 1SVLA 3PM1A 2R7FA 2PMZA 2VC1A 5E3MA 4MTEA 1SFXA 2VT3A 3W6JB 1HW2A 2W7NA 1MMNA 2A05A 2LKPA 2QKMB 4I0BA 4RS8A 4ESJA 2QQ9A 3LSIA 3MKWB 4M72A 4RB1A 2O7OA 3BDDA 2VOOA 4XRMA 3SJMA 2JMWA 3LFKA 1MMDA 4Y3OA 1WJDA 2F5VA 3BTIA 4B48A 3ONQA 3RIRA 3WGHA 1DU6A 1W36C 4F52A 2P8TA 4O5VA 1S7OA 4QPOA 3AG4H 5FKLA 4P55A 1QRYA 3BZCA 2DQLA 3AKZA 2Y0MA 3HB9A 1KYWA 2EA2A 3B6CA 2CYYA 3D5LA 5HDGA 5IYCJ 2P4WA 1SMTA 4LLNA 4CCOA 5J47A 4IEJA 2FNAA 2VJ4A 1OCRH 1JT0A 3DWLE 5DEQA 3TEDA 2B9SA 2Z3YA 4OWRB 3FKJA 1NK2P 3KYLA 2WADA 3RKQA 4AWXB 3CMMA 1SD5A 3QAHA 4M3GA 5AONA 3CC2I 2XAFA 3ZGKA 2K5CA 3UNGC 4AC0A 1IUFA 5D6FA 5EG0B 4BAYA 5B66C 4CXFA 1I6HJ 1U5TA 3BJAA 1U8BA 4FASD 4HSRA 3VYTB 3SFIA 1FTZA 1I6XA 1IN4A 4LFUA 2R5YB 2CUEA 4ON0A 3K70D 4DOZA 1A6IA 3KE2A 4NB5A 4A0XA 4YIRX 3CMEI 2ZJQF 2AXTC 4G6DA 4DYQA 3HRTA 3JRFA 2NVYJ 3OYCA 3HL2A 2VODA 3HBLA 2EA4A 3QODA 4MQ9F 4BQNA 3MZHA 3M3YJ 2HPMA 1I39A 4OU0A 4C2MJ 4Y7NJ 3NRVA 4BNCA 1KQ0A 4IRGA 2PMHA 3BJOA 1Z9CA 3LA3A 3RPUD 3V7CA 2VASA 3X2QH 1ZR2A 1VQNI 2KJCA 3WTYC 3FKIJ 2DMQA 5JLWA 2LOOA 4A3GJ 1ON2A 1JI8A 2K7LA 3TOAA 5FLVA 4U87A 4U0WA 4ESFA 3OYNA 3MZYA 2KP6A 3ZQFA 3H36A 2PMUA 3GXOA 2MUNA 1IRFA 2HKOA 1IC8A 4J01A 2TRTA 5BMZA 2XAUA 4ZYAA 4R1HA 1VQ6I 1G3TA 4LJZF 4IZZA 2P81A 2NYXA 1BI0A 2VQCA 2K9NA 1ZK8A 2EFQA 1U5TC 4N9IA 5HS8A 3CZ6A 3GTGJ 2KZVA 3E1SA 3JW4A 1AA7A 1MMSA 3FHZA 2ZJ2A 2RQQA 4OAYA 3CC7I 1DQUA 1DPUA 5DYMA 3PUBA 1BR2A 4F3QA 5EDNA 5F64A 3HM5A 2K27A 2LNBA 3E3VA 3I71A 3ZXSA 5FLXZ 3J7YJ 1O3QA 4Z6YA 2R7VA 2ECCA 3ZQGA 1WRJA 5FRMA 1OR7A 1OCZH 5D5WB 3LSKA 1RUNA 2JPCA 4Q47A 1T38A 5LHIA 1OMIA 2IVMA 2BY1A 2XHKA 4EVIA 9ANTA 5C44J 4RBOA 1FX7A 4CYCA 1JUSA 2F5FA 4AVPA 3Q9SA 1STZA 5DUKA 1J09A 3V4GA 2EQRA 1BC7C 4RAYA 2XB5A 4NC7A 1S72I 4I76A 1HXDA 4LK0F 2K85A 5AIQA 5LFAA 4CGZA 1WVRA 5DV5A 5BQTA 1BW5A 2ZCWA 2VKHA 1YS6A 4ZYEA 3K1PA 1JKRC 3M1EA 1P2FA 3Q3SA 4E4HA 1ZRFA 3K2ZA 2CH0A 4W97A 1ZGAA 1FYMA 4IHYA 3FBNB 1TWFJ 1Z0XA 1IN7A 1N25A 2LY9A 2M3AA 4J19A 2K4BA 1CF7A 2PG4A 4RAGA 4ETSA 3PL8A 4M9ZA 2GWRA 2M8GX 1S29A 1ZLJA 1YOVB 5F0CA 5DM7F 1Y39A 2DODA 1J59A 1LE8B 1X4PA 4LITA 1U9OA 4MGRA 1XC5A 5M5YJ 4BJ6C 1IUYA 3T0YA 1USSA 1ZTRA 2CO5A 2M5WA 3TP3A 5JHFA 1FPQA 2FU4A 1ONVA 3I0TA 1WWXA 1MBJA 3R6SA 5H20A 3OR2C 5TJJA 2DJIA 2W1OA 5L3DA 3AG3H 3HSRA 1YHQI 2FQ3A 3HPHA 4AIDA 2I10A 2VUMJ 3H3UA 3CMYA 2DMPA 1F9NA 3PIOF 1R22A 1T33A 2UZKA 3M1CA 2QENA 1P4XA 2F4MB 2DMTA 3K4MA 3TO9A 2XROA 3F9KA 3BCBA 2R7DA 1S3JA 1J5YA 2O5RA 2LTPA 2R7SA 2X4HA 1K4TA 3MN2A 4HEA2 1MNMC 1VQ7I 3GTOJ 2OZ6A 2RNGA 3UR3C 2P0TA 2PBIA 5HNFA 4ENKA 3CJNA 2XASA 1F4KA 1ZKGA 1LDJA 2OBPA 3S1QJ 5ICEA 1V3FA 2DA2A 4KT5C 2QQ8A 1XN7A 1J7KA 3WTUC 1WH5A 4BBSJ 2FXAA 2KIFA 4EJVA 4TV7A 2JRMA 2HS5A 2YPRA 3VEPA 2MH2A 1LEAA 2DO7A 2R4GA 3K4JA 4BEHB 1MDMB 2BVLA 3IHUA 1MZBA 5EZGA 2FUG2 2LG4A 2WB1A 3ZPLA 5IT9Z 3EYIA 3Q0WA 1K61A 1BN5A 5F6FA 1DPRA 2LSOA 1T39A 2E2JJ 2HFHA 2KJBA 2MD0A 2KMUA 2XKPA 3LSPA 1QPMA 2DAOA 2XRLA 1VI0A 3OYHA 3RPUA 1TBXA 3IL2A 2H6CA 1R4MB 4AYBN 4EEFG 3NEUA 4KYWA 4MTDA 2R7TA 5CVVA 1QZZA 4HV5A 1JKQC 5ICCA 5HNHA 2GQQA 3OIOA 3HDDA 2L9SA 2HXOA 2L7KA 3OYGA 2Y69H 2MLKA 3I55I 4FTHA 3OOPA 3I4MJ 1MW7A 1TZLA 3HOSA 1RUOA 2EJRA 2ZSIB 4PJ0C 3HPGA 1LNWA 1VQ5I 1WJFA 4JYKA 3I54A 3ZQHA 3GW2A 3CESA 2DA5A 3W2VA 3LSTA 5BNGA 1NH3A 1NG6A 2H27A 2EINH 1W36D 4J00A 2X98A 5FLMJ 4HLYA 1A04A 2O03A 2PX9A 2VBZA 4HF0A 2DBBA 3W6KB 3BPXA 3HOYJ 2M0CA 4HX8A 3VSKA 1IZ1A 5CLSA 2BE5F 4BUPA 1XTAA 3P5JA 3ZRGA 2DA7A 2OC6A 3MKLA 2BV6A 4KIFA 5L3EA 4FCYA 1VQ4I 4HPQA 3L9FA 1OCPA 4PJJA 3Q9VA 4DYRA 3OY9A 2PJRA 4G6QA 2K9SA 5JVGF 2LY1A 3AL0B 1WJEA 1Y56A 5B3SH 2PLYA 2ZKZA 2A68F 5D5UB 4ESBA 1BBYA 1DGRM 4KIBA 1JUMA 2LDUA 3OOUA 3J7ZI 5F27A 3GO5A 1RNLA 2A6TA 1YITI 4P1WA 1B72A 2I5UA 3ISPA 1G2HA 2MABA 3A0BC 2MBFA 1SMYF 3G1MA 3CF5F 2EZKA 3H9GA 1ZG5A 1LFPA 2JTVA 1BW6A 3GTQJ 3OYFA 1PUFA 2Y30A 3FXLA 5L3BA 2F5CA 5IYDJ 3MZ8A 5KK1A 4K2EA 2HDCA 2R7WA 1UHWA 2DYRH 2QUFA 2CU7A 5IP7J 5E79C 2IGOA 3R0JA 4M6XA 3CO6C 1CQTA 3E6CC 2XC7A 3S3OA 1YRNB 5C4JJ 3K4KA 1D1AA 1DDNA 1GLNA 2KDZA 4BJ5C 2KIUA 2ZXWH 5E3OA 1BR1A 3H92A 2YR2A 1XD7A 4GCVA 4XLPF 2V6EA 1YFHA 4IRHA 4W1UA 1U2WA 2Q2EA 4IOAF 1PDNC 2E2IJ 1UFMA 1PUFB 4IQJA 3BTLA 2EZHA 1R4NB 4HNVA 3OS0A 4MHGA 1ETVA 2KISA 3AL0C 1N78A 2MD5A 3ULQB 2YS9A 3WHCA 3K4NA 1Y1VJ 2DTRA 3FWEA 3Q0VA 4EMSA 3RKYA 3S14J 3JREA 4BXFA 4JP0A 1LB2A 3LSMA 3BR1A 2ZC2A 4DGWB 3FM5A 1E3PA 2K9MA 4HDVA 1RZ4A 2PN6A 3GZNB 4LG0B 4WXCA 2KIQA 1XMAA 2EFNA 2QQBA 2M0MA 3SHFA 2EZLA 2CS3A 1A36A 5F0FA 2JK3A 2WB1N 3H5RA 3JAMR 5BS6A 2OTLI 2Z1DA 2DMUA 4RM2A 4CZCA 4ZYDA 1YJNI 2P5VA 2F6CA 2PJPA 3GTKJ 3K7AJ 3VYSB 3PIPF 2VPLA 3IWFA 3S2WA 4RGXA 4O6JA 1XSXA 1JT6A 4YIIA 3I59A 5FLXK 1HC8A 2PEXA 4EGZA 4KJZA 5HS9A 4KDPA 1T6SA 5J8FA 1KU7A 3GTMJ 1GUUA 1GV2A 2L7ZA 2VBXA 2BHYA 2Y9YA 3K2AA 2WY7Q 3RYPA 2LC2A 4DQ2A 3GYHX 4E7IA 4MQVA 2CQXA 4NBQA 2XGEA 4U88A 3L2WA 3JR9A 4WXDA 4H0EA 3S8PA 4C3JJ 2IA2A 4JX5A 2MSYA 4B8XA 2HVQA 4A3EJ 3CO7C 1J75A 1R5HA 2W4SA 1X19A 4XKVA 3NWTA 1GVJA 3IH4A 1JTXA 3FXJA 1ETOA 3DEUA 4V2GA 1POGA 1RPWA 2XPUA 4RGUA 2STTA 2ZJRF 4OIQF 3GFMA 3VDXA 3I64A 3ABLH 3F21A 3V8JA 3WODF 3VWBA 3ECOA 3GX4X 4XR6A 1CGPA 3J81R 3M9AA 1W4MA 2X1CA 2KHMA 1XG1A 3SDBA 1OQYA 4KMUX 3HGGA 2BBYA 4GYIA 3K9TA 5M3FJ 5K7FA 4UXNA 3SQNA 4QPQA 2DI3A 2A07F 1R00A 3J80K 4CSWA 1B59A 2BEOA 2VI6A 4FX4A 5BOXA 1UAAA 5ERIA 2MVTA 3PO3J 2WBMA 4RLQA 1IF1A 5L3FA 1M1EB 1S5LC 3F6OA 4BL0B 1OYWA 2K86A 1TWHJ 2EFOA 3BR3A 3HJEA 1ZELA 2PI0A 4KNYA 2COMA 4QSHA 3L2UA 1FYKA 1MBFA 2G7UA 3JSOA 1V55H 1XSVA 1IG7A 1EJ9A 4HF1A 4IHXA 3LA2A 3H35A 2R3SA 2X0LA 5ICGA 3E5QA 3O8GA 2WTEA 1MH4A 2X1EA 1S6LA 1MMGA 1X2NA 3FXUA 1JXSA 3BJ6A 3JAMK 3MAJA 2X51A 2W57A 1YTYA 3JRCA 4ZZLA 3KCCA 4BHCA 2V6CA 2L01A 4BDYA 1FZPB 2YU3A 3P9CA 2JA5J 3RZDJ 1IRXA 1IDYA 3KP2A 2W25A 5L3CA 4E7SA 4PK4A 3CLOA 1Z91A 5HDNA 1AU7A 2JSPA 3H5NA 2Z9OA 2NRAC 2K40A 2JN6A 2MW8A 2M4KA 2IGMA 3O8HA 2ESHA 2M2EA 2M7AA 1IXSB 3ABTA 2Y9ZA 4A12A 2ZSHB 1ZLKA 4G94A 1O3RA 2DK5A 3UKGA 1EH8A 3S32A 2OAZA 4L9TA 2E5ZA 1G6NA 2HYJA 1XGSA 3CUOA 3JTHA 3WTTC 4HNTA 5LBQA 1OR7C 3HTSB 1A6QA 2P6SA 1ZGWA 3C2GA 3S2HJ 2H8RA 4BE2A 2VONA 1TTYA 3PFIA 3GTPJ 1BA5A 2ESNA 4RLFA 4ENJA 4V19K 1JJ8C 1WJ5A 1JKOC 1FBSA 2UV1A 2VQHA 2BYVE 4HYEA 2TDXA 2XF7A 1ERDA 2JVGA 2E1MB 4QWQA 4BXUA 2FRHA 2BW3B 1W7PB 3HUGB 3HEFA 1MH3A 4MEXF 1I3QJ 3ZP5A 5LGTA 2OCEA 4M3DA 2DW4A 2V26A 2EIJH 3DLAA 3CP2A 4QIWN 1IN5A 2A5WA 2A6EF 1BJAA 4IHSA 3D0SA 1WI3A 4XRSG 1FNNA 4KISA 3GFIA 1IRZA 3CCQI 3BPVA 3KX2A 2WA0A 2QVOA 3HRUA 3ZR8X 2D5VA 3MVPA 3BR6A 3HTUA 2ZMEC 1Q1VA 3BR5A 2OA4A 2IAIA 2W24A 3HHGA 4ABZA 2OD5A 3HSFA 1TNTA 1IXCA 2IS4A 3M8FA 1UG0A 4BH9A 2DCEA 3C1DA 1NTCA 5LHGA 5FRNA 1GHCA 3JRGA 3DBLB 2AQEA 5GAEJ 3KEYA 3NARA 1YS7A 2KFDA 1D3YA 1EF4A 5KNLA 4B47A 2QSHX 3E0JB 3CUQB 4E7HA 3ASNH 4F91B 1JGGA 2G9WA 1VQLI 1Z77A 2HDDA 4L9NA 4XBFA 2AO9A 1JUPA 2GA2A 2ZJPF 3N4MA 3EYYA 1T98A 1TP4A 2V9PA 1V4RA 4AVZA 1WH7A 4XSXF 4M6YA 4I09A 3HYIA 3F0CA 1AHDP 2Y75A 2DFFA 3GFJA 2ZBKA 1YE9A 5FFXA 3W6VA 5IT9R 1U0JA 4UY8I 3H3VK 1UHMA 3SDGA 2MGQA 3HKZN 2BGCA 3C3WA 1LJ9A 1B8IB 5HLHA 3VYRB 4KITB 2F5EA 2IP2A 4ANJA 2QEXI 5ICFA 3RZOJ 4UUSA 5B5EC 1HDPA 4II2A 2Z2SB 1VTNC 3WTXC 3FHNA 1D1BA 1W5TA 4FETA 3J7AY 4XRSA 2EFWA 4PGHA 2CUZA 2JJ7A 4U7BA 3JRHA 3F22A 4HNUA 3W2AA 4HAMA 2IBDA 2GAUA 4EJOA 4KN7X 2XB0X 5E1WA 5CJ9A 1ON1A 3FIWA 2EIKH 2NNYA 4AM3A 4HX4A 3HOZJ 4BU2A 4Q4ZF 1YLFA 3G1OA 2FX0A 4E7JA 2W84A 1OISA 5JHUA 1T8IA 2VE8A 1K4SA 4HZFA 4M71A 2P0WA 3H9JA 3TMOA 5GTHC 2LRDA 2QKLB 5DDGA 2KLOA 1JHHA 4EV0A 4BHBA 2IJLA 2M34A 2FSWA 2DT6A 2P5KA 4A0YA 3MQ0A 1MNDA 1IRGA 3L2CA 1VQ9I 1T0FA 1SD7A 5K7ZA 1B1BA 2M1BA 2DTZA 4WXHA 2RQPA 5DD4A 1Y0NA 4AU7A 5IPAA 1K79A 4ZZDA 1GDTA 1TWCJ 5HDKA 1R5GA 3PNTA 3DLLF 4NC8A 5LGUA 1FBQA 3CTAA 5H2FC 3GTLJ 4DJAA 3LSJA 3I3LA 3HSEA 1FMWA 1YIOA 2QQAA 2H1LA 4X0GA 4L9VA 5HLIA 4S0HB 2CW7A 1LVAA 3BP8A 3A01B 4GYGA 2KQRA 4L5JA 4N0BA 4L0ZB 1G8XA 5ED4A 4MNUA 2MA3A 1ZG1A 2STWA 1PUEE 3V8KA 4UV8A 3R0AA 1PYVA 3M4OJ 1ULYA 2P7VB 3FDYA 3R60A 4XIDA 2CW8A 3QOPA 4Y17A 3KIOA 5F0HA 4EATA 1ZARA 2R5ZA 1HLVA 1O57A 3J80Z 3OS2A 2QLZA 2L4AA 1MD0A 2O8XA 4RMNA 2O6GE 2OZUA 3RPQA 3ROUA 1L0OC 1RC9A 1YW7A 2ID3A 2MC4A 1FMVA 2V1XA 4ZH4F 4WK8F 3FXOA 1IW7F 2EV0A 1SFUA 5CPRB 3F6VA 3CJTB 4XRFA 2DA1A 2KPMA 4XM3A 4R79A 4WF2A 4RDUA 3MCZA 1U5TB 1VQPI 4BYYA 1REPC 1TL8A 3ZMTA 2EH3A 3ZMZA 1RESA 3FMSA 3CCSI 1BR4A 2O9LA 2VT2A 3KEQA 2MH9A 3TKYA 4XLNF 2KDOA 1R23A 1FIPA 5DCFA 3K0LA 2DYSH 3LL7A 2EILH 3GZ5A 3FXRA 5KVRA 1U3EM 3G1LA 3O6BB 1TLHB 1GVDA 4GGGA 2ZXJA 1W7PA 3F8NA 3EETA 4FX0A 3FX3A 4Y4RA 3LSGA 1AKHA 3I5UA 3ZMUA 4DZPA 2CFXA 1HKSA 2ICWG 4B44A 5ILVA 4IO9F 1OJLA 3A02A 1W5CC 1L3LA 3A01A 2RAEA 3DV8A 4MLOA 3FK7A 2M9HA 1QZYA 3LSRA 1HBXG 5E18F 5IY5H 1Z3YA 4CYCB 2HVRA 2XPWA 3LAPA 1HOMA 2F4OB 2ZFUA 1D1CA 1SEUA 2NS7A 3LAJA 1EH7A 3HRMA 3BWGA 3IRRA 2WY8Q 2BXZA 4BXXJ 2VE9A 1VZ0A 3MFKA 1Z1DA 1TWAJ 2CGPA 4HW0A 4YFKF 3C18A 1EA3A 4L5IA 3C2HA 4LLGF 5TRDA 3S3MA 5EZHA 4A2UA 1IN6A 2IPQX 3R61A 4YRVA 3DP7A 4R8HA 1UHSA 1QHGA 3DKWA 2DFHA 3DTIA 3U1DA 1QU3A 3KP4A 3DBHB 4C3IJ 2IA0A 3OR1C 1WJCA 2QBYB 5E3NA 4GDFA 5EEGA 3MD2A 1Z21A 2CUJA 3ELKA 3M8EA 4LD5A 2B7EA 4LG3A 5M3MJ 3BOQA 3K4CA 3SXYA 1NHAA 4D5CA 1ACIA 3IP4B 1IAWA 1X4OA 2XAGA 3HGYA 3IAS2 2PJRB 1V5EA 2ME0A 3AFHA 3WTVC 1T08B 1XGNA 2LBFA 4ZDLA 3TQNA 3IKTA 4OIRF 3F8MA 5E8IA 5LD2C 1R71A 1ZQ3P 3BY6A 1Q1HA 5F1JA 2Y31A 4E6KG 3ZMDA 2MC3A 1UJ8A 3OYKA 2EV5A 4C30A 1PVEA 3CP8A 1X1DA 2HQAA 3S15J 5HLGA 1W7PD 1SFEA 2Q2EB 3WTWC 3J7AO 2HZDA 3LOCA 1R58A 4F55A 4ZJZA 4HSTA 2LFBA 2HVSA 1WGXA 1XDSA 2HWVA 1ZG3A 5ILUA 1BC8C 1RQ6A 4XONA 1O3SA 3OYJA 5CYVA 2XRNA 5FO5A 4A3FJ 2E2HJ 2VLAA 3TDUC 4DBQA 3K4LA 3KFWX 1LE8A 1JHFA 1TNSA 1T95A 4AUXA 4A3KJ 1KGSA 1HW1A 4AIHA 1I1SA 4G7HF 5DTDA 1C0WA 3U1KA 3DBRB 4WX9A 2FE3A 4JX4A 5GP9A 3ZOBA 4CZZA 1FTTA 3BT9A 1XMXA 4OMZA 5EEAA 4KICA 1WI9A 4M9SA 4XICA 2IW5A 3WE3A 1QQIA 4LIVA 1ZREA 5CVUA 3ML6A 3COAC 4C9YA 3E7LA 3L09A 5DUIA 4KA4A 4BE1A 3DKXA 3DCFA 4L9JA 4PSXA 1I5ZA 1JJ6C 3CDHA 2QSGX 3GF2A 4BKXA 1Z6TA 3H0GJ 3K10A 1YG2A 1UG2A 2I8DA 1X1PA 5HVQC 3DF8A 4BY7J 1U78A 1XDUA 3RKWA 3Q5FA 1IN8A 1DP7P 4IRIA 1K78B 1MGTA 4ENMA 3I4NJ 1LUJB 4RGRA 3CDIA 2DA6A 2F48A 3IRQA 2LK2A 1BI2A 4A93J 2RVCA 4A3BJ 3WE2A 2W85A 3S1RJ 5GADJ 1R1UA 2E34A 3DEEA 2ZXHA 5GPCA 3QOEA 5LEJA 3I59B 1IO2A 3BCAA 2NAZA 2IRFG 3DPUA 2HOEA 2M8EA 3JRIA 5IT9K 3HZJA 2FMLA 5CVRA 1X3UA 3KEOA 3K4BA 4G8XA 3REOA 5FGMA 4M3EA 5IP9J 3W2WA 1K78A 2FQ4A 3H5AA 1X3WB 3GLLA 3N97A 5IYBJ 4BHPA 2L7MP 3B73A 3RSNA 4HV6A 2QSFX 3IAM2 5LEKA 4CYDA 1B9MA 4FE4A 1SD6A 5IP6A 1XCVA 3FXMA 1QO0D 2CG4A 2NS0A 1WCMJ 5BPIA 2DT7B 2W48A 4A5NA 1VF9A 3O3KA 4D7MA 4PUSA 1I3AA 3F23A 3PQJA 2DK8A 1IV6A 2V9KA 1B9NA 3L1PA 3JRAA 1E3HA 1T0FC 5DS9A 4HG2A 2FD5A 3L2RA 1JE8A 1VQ8I 1YJ9I 2UUZA 5D8LB 1FOWA 4LIUA 4EM2A 3FISA 4QLCU 2Z33A 3D5SC 3LWFA 3T8RA 2OPTA 1PP8F 4XQFA 3EQLF 1W0TA 2LMDA 3I53A 5EJCA 2Q0OA 1VFCA 2X1DA 1BL0A 3OIQA 2CQKA 5KHDA 1I27A 4XKBA 3HOTA 1LPQA 5EGOB 3RI4A 1AKHB 1EV7A 2XSJC 2L9VA 2BOLA 3GMEA 2M4GA 3ZQLA 1MSFC 1XMKA 2PMZN 2VBYA 2ACJA 3N05A 4L5EA 1ODDA 1IJWC 2IS6A 4EM1A 2NOGA 2EIMH 2RV8A 4G12A 4D7NA 2VXZA 2EBIA 3KLOA 1MIJA 3M07A 3CLQA 4XLEA 2CRGA 1RKTA 1XB4A 1MMAA 3FK6A 3KP6A 4ITVA 3U9GA 2G7HA 1G3YA 1FY7A 2M45A 3BG6A 3A2KA 3DEWA 4IQ4A 4UB8C 3HOUJ 4FT8A 3QPLA 3T1BA 4HLXA 2EFPA 3PJRA 2L0KA 3SZTA 5K7HA 2DMNA 4NUBA 2L02A 4CCLA 2CV2A 1LQ1A 1O7LA 3I56I 2NVTJ 2FBHA 4XMYA 2F2EA 3ZN1A 1P9QC 3RTRA 1Z05A 3WGIA 2WWYA 3VB2A 3OYEA 3G6EI 2COBA 1QVTA 2BZTA 3CC4I 1MBHA 2D1HA 2R0QC 3G3ZA 3KPHA 3BR0A 5HS7A 2L5QA 2J5PA 3KZIC 3PNYA 1GXPA 1BIAA 3ABUA 1WFXA 3U21A 3PSFA 2GBYA 2EPFA 2XIGA 1LVKA 2L9RA 4DYCA 2O0YA 4OAZA 4UUTA 4E7LA 2CQQA 3GBGA 3ZQQA 5J1RA 4XOPA 3HUGA 2JVHA 2K3PA 2Z99A 5C4XJ 3FM3A 2JWTA 3QPHA 2BVMA 1F36A 1QHHD 4CCMA 3E6DA 4NQWA 1YIJI 2LBFB 2WAEA 4IF4A 3CUQA 1Y8RB 2V79A 3T8TA 2Y0SA 1WPKA 1IDZA 4OINF 3VOEA 4IKFA 5D5VB 2GA1A 3KP3A 3I4PA 4XN0A 1OKRA 5EEHA 3S1MJ 5EF6A 1ZYRF 5A2QR 2KIMA 2F4IA 4N4OB 2ME6A 3GZ6A 3J80R 3OYLA 5ILSA 2EK5A 2OQGA 3BZKA 3L2VA 4ZYHA 4HQEA 3QU3A 3A1YA 5J1UA 3KLNA 4ZTFA 2HXIA 3QYFA 1S8NA 1JTYA 4S05A 3VYUB 4G6TB 3KP5A 1TQPA 5K5OA 1B8IA 5FJ8J 1BIBA 2FOKA 2XAHA 3HOWJ 3QYBA 4UVCA 3TGNA 4JK1X 2DN0A 4X1EA 3IKVA 3I9V2 2V7FA 3ZN0A 1P6RA 4CHUA 3A4CA 3CCJI 3J81Z 5E17F 2JQ7A 5GPAA 3TL4X 2X6WA 4EJWA 1YW8A 1K6OA 4Q5SF 3E97A 1RR8C 2LH9A 3K70C 5B1AH 2YSRA 4XLHA 1OYIA 3BLYA 1TQMA 1UCRA 3LFUA 1I50J 1OYYA 1T56A 5TISC 3HRSA 3G4SI 4XLCA 2ZMEA 4D0PA 4WCGA 2LF8A 1RI7A 4A3JJ 4NQWB 2M7BA 1DP3A 3GEZA 3DU5A 4A69C 4E7KA 2P6TA 2IGNA 3TO6A 5H6RA 2QCOA 2WV0A 2HTJA 2XAQA 3PNVA 3CCRI 3RYRA 2OJED 3DQVC 1Y8QB 2ELKA 2VIXA 2DXIA 2DLLA 2HZTA 3WU1B 1HCRA 1BJZA 4B43A 2XKOA 4EM0B 1D5VA 3I58A 4BACA 3H1CA 4U7DA 4UVAA 5FFZA 1FOYA 4XL9A 1SAUA 4UNOA 4Z2YA 3A0HC 4CDGA 2V1DA 4Y15A 1Y6IA 4O3MA 4II3A 2RGVA 1H8AC 4S04A 2LR8A 4AYBA 5IOYA 5F04A 4EQQA 1X1CA 1YW9A 3HXLA 2BY2A 1S7AA 3ZMVA 2X6XA 3ZQ7A 2KRCA 3BG3A 3DTKA 1JGSA 1FOXA 3MEXA 1MSEC 5GAHJ 1BI3A 2OU2A 4XORA 1E0EA 3F3XA 3TW7A 5CQEA 4YIFA 1D0XA 1XGOA 2EZIA 2DQRA 3BG5A 2ZB9A 2VJJA 2M35A 2X85A 4ZTJA 1Z67A 2MZ4A 1BI1A 2GIVA 2O8KA 1TW3A 3ABKH 3OIPA 1FWZA 2E1OA 2JZYA 3EPZA 4UHTA 4A0ZA 3QPSA 1MJAA 3C7JA 4BQAA 6PAXA 5FB2A 5LRRA 2GOXB 1QPIA 2JA2A 2DOEA 1N77A 2GLOA 2JPBA 1JKPC 1FP1D 5EYRA 3KZZA 4D1QA 2QA4I 2RKHA 2VXDA 3ERED 4I99C 1Z6RA 4CO8A 2K9LA 4E70A 3V7SA 2K4JA 4C3HJ 2VKDA 1LDDA 3F8CA 3F72A 4IPAA 2GZWA 2HOTA 1P4AA 2DPUA 4Y52J 3M8JA 4KIGA 4BQQA 2HNHA 2DU9A 4AD9A 4CICA 2BW3A 5FROA 4I6ZA 5D4RA 2NVUB 4IVNA 3TO7A 2QF7A 1YX3A 3ZQIA 1QA6A 3L2QA 3T5XA 4XLAA 1X58A 3ESWB 1NK3P 4PFPA 4A3MJ 4GFBA 3LMMA 3DFGA 5FKOA 1TT0A 1W5SA 2Y2ZA 1UB9A 4U0YA 1F5TA 1IGNA 3JSPA 2VC0A 2EWNA 2ETHA 4N4NB 5FKMA 2H6BA 5E3LA 1F43A 2ZNZA 3J81K 1MBEA 2ZXIA 2A5YB 4IXAA 3AG2H 1YO5C 3L7WA 2VBWA 4E7ZA 2R7ZJ 3CCLI 3V7RA 1A35A 2HQNA 3DPTA 1XS9A 3RDIA 3K69A 3CMAI 1KQ9A 1TQIA 3OV8A 1R9TJ 3BTJA 3BR2A 4RB2C 2FBIA 4BDZA 1D0YA 2LKXA 4F93B 5K1YA 1SFKA 5EG0A 1KA8A 1EKEA 3EUKL 2JUGA 2L2OA 4XN3A 3OL3A 1IXRC 4PFOA 1BM9A 4LLLA 1QNTA 1WZ2A 1FSEA 4YELA 3D1NI 3HHHA 3WG9A 3E5UA 2DOAA 4JOMA 4MO7A 3PFYA 2CW0F 3Q0UA 2R5YA 4BQOA 2XF5A 4UUSB 4OIPF 3BC8A 3DXJF 2AXLA 2YU9J 3M7GA 2OTJI 1MBKA 1E2XA 4A3IJ 3JCUC 1HA8A 2Y48A 2JRTA 2E1CA 1FT9A 3GFLA 4P9UA 1LDKB 4P9FA 2FA5A 2XVCA 4MFDA 3B6AA 4XOTA 1UELB 3B02A 1MNEA 3F8FA 4KUMA 2AHQA 3H0DA 4AIJA 2RNJA 1ZGJA 2OUMA 2MFZA 3S93A 4Y13A 2BY3A 2NNNA 1Z7UA 4WWCA 2LLKA 2DA3A 3FXKA 3FF5A 2ZNYA 2ZFWA 3EUHA 4F7ZA 2HPIA 1H9TA 2HU9A 1D8KA 2EB7A 1HQCA 2X6YA 5K5QA 2VOPA 2WAQN 2BHZA 4D9JA 3MKZA 2NS8A 4BJTA 3E6BA 2P5LC 3WTZA 3GLXA 4RGSA 1FJLA 2HR3A 1G3WA 2UXNA 1SC7A 4KMFA 1R6RA 4B4CA 5LRSA 4I0AA 4UUVA 3QYEA 2NVQJ 2JA6J 1KU2A 4PGGA 1H89C 3OYDA 3WU0A 2HYGD 2R5ZB 3K1MA 4DW6A 2XSDC 2H94A 4JQFA 1G4DA 4KFCA 4G7OF 3OL4A 1SAXA 2EV6A 4ZDOA 1X2MA 5KCMA 4B3AA 2A69F 4GO1A 3FZVA 4RAFA 2UXXA 1R1TA 5GTIC 2LD5A 1U6GA 5C3EJ 3LA7A 3QRFF 2VPRA 1TC3C 4EJUA 1R1VA 5J4VA 2XGDA 2Q8KA 3TOBA 2DA4A 2IT0A 3PO2J 3IH2A 1APLC 2AQFA 3J7AW 2VJ5A 1FLIA 1V5GA 3SZPA 1H88C 4HX7A 2MLGA 3SZGA 3KZYA 2CUFA 2HKXA 1WQ2A 2L54A 3HG9A 3MMYB 3CCMI 4ZYGA 4U0VA 3KYCB 4IHTA 4YFXF 3DPLC 4YG2F 4OMYA 4I2OA 4DBRA 3ZMSA 1FSHA 2K02A 3KYDB 1R36A 2MG4A 2WC2A 2LF7A 5JLXA 4DZJA 5LLQA 1RIOH 1ZAOA 2HQ5A 4PDKA 1WHUA 2OQRA 4MEYF 5J1YA 2XUBA 3AAFA 3MKYB 4M6VA 4HDUA 1X3ZB 1WSUA 4LK1F 3DTEA 2XDVA 2JT1A 4P5OA 1D8JA 2HDWA 1Y1WJ 2HTSA 4ENNA 2YX7A 1SFOJ 3BTCA 1KONA 2YX4A 1KQ8A 3EUHC 2DOFA 3P7NA 4XLFA 1Z7LA 2IGKA 1I1GA 4RB3C 4PZJA 1ZRCA 1GV5A 4M9XA 5TGTA 1N75A 2GXBA 4LB6B 1HSTA 2FBKA 2QYOA 4M73A 2LREA 2GIZA 4N9HA 1OLTA 3CD6I 2HQRA 3FMQA 3GUDA 2E35A 4HA8A 4AIKA 3OSGA 1YRNA 1PJRA 3OYIA 2DT5A 5J3LA 2Z5UA 1X1AA 3CJQB 5E1XA 1F1ZA 5J40A 3WG7H 3SEQA 3BROA 3VFZA 5JR3A 3JTGA 3SYTA 5M5WJ 3QP5A 5KAIC 1AWCA 2HEOA 1OFCX 3OYBA 2VKEA 4XSZF 2DFIA 2IS1A 3LSHA 4ZC3A 1K7AA 2QBYA 4C2TA 2LVSA 2J5OA 4Q48A 4B1RA 1HDDC 4A3LJ 1HKQA 3D5RC 2QGUA 5AIPA 3V8LA 3LNQA 3G2BA 4OIOF 2BY0A 2XGCA 2A6HF 4B09A 1ZR4A 4L0YB 1ETKA 3KETA 4ASNA 4BS9A 3HKZA 2E5NA 3JRBA 1V5FA 4F92B 1H0MA 1NG7A 2VQLA 2R7RA 2B63J 1D5YA 2E7XA 3EUAA 1IV8A 4EJTA 5HOOA 3HIFA 2XAJA 2E36A 4UVBA 1SVMA 3WU2C 3S17J 2HI3A 4RB0A 2F5DA 4IOCF 2GXAA 1R7JA 4NDLA 2CSOA 2FEZA 3DU6A 3C2BA 2R93J 5KAFC 1J0RA 2IXSA 5CVJA 1GT0C 4BEHA 3PSIA 1WJAA 3GWZA 4A6EA 1ETXA 1XPXA 2P7CB 2VJIA 2FMYA 2WAQA 5CVIA 2ELHA 3RCOA 1HKTA 1ZH5A 2Y0SN 1AOYA 3IWZA 4A3DJ 2X48A 2DDAA 4FISA 4XNFA 4EGYA 5J4YA 4YEJA 1XCBA 1WKMA 1ENHA 2L7FP 4V2FA 5F08A 1USTA 1QBJA 3ZQCA 5E20A 1ITYA 2KRFA 1A31A 2RREA 3E5XA 4GXOA 4FQGA 2ZMEB 2D2WA 4LMYA 2GXGA 2QM3A 1O7FA 2HOAA 2O3FA 1YJWI 1XX5A 1YYVA 1K6YA 5HODA 4PCQA 2D45A 4XKWA 4LG0A 4CH7A 4LOCA 4H4KC 1MJBA 1QVUA 3CUQC 5K5RA 3RJPA 3VPRA 4D5FA 4BY1J 1DGWY 2G0EA 1XSDA 1DU0A 1YQAA 4CCJA 2R7XA 1KU3A 3K1NA 3SEZA 1ZHFA 3CJRB 4JBAA 1U9NA 1MDMA 3G73A 2NVXJ 2H09A 2D1VA 3TBIA 2R7OA 3R4KA 3LQRA 5FKNA 1TWGJ 3VODA 5JVTA 1LKXA 3P9KA 1OCOH 2W00A 4KT6A 4M3BA 5LGNA 2HOSA 4FE7A 1KZHA 1U8RA 2KL4A 1KYZA 1S9HA 3H9QA 3CDLA 3HOXJ 2QZ8A 2CV1A 3S2DJ 1KU9A 1RR7A 1P4WA 2WV1A 1VQMI 2E1NA 4BBRJ 4PJMA 3IC7A 2XV4S 3P9IA 1FIAA 2UWMA 2QWWA 2DJNA 2FOWA 5FLXR 3AG1H 3TDZC 2XGXA 4P96A 2VL8A 3F8BA 5JFRA 5LHHA 4YFNF 5D4SA 2E71A 5B1BH 3JAMZ 3OWTA 3CCVI 3PUFA 5CKTA 2M87A 1ZRDA 5FKKA 1GXQA 4HBLA 2KKOA 3EDPA 3L00A 1B72B 3O2PE 4PJNA 2FF4A 4LGWA 2A61A 2L9NA 1XGMA 3IUOA 1DUXC 4RA2A 3IH3A 3KP7A 3TP0A 2V1UA 4G9YA 5E1ZB 3G71I 4CUGA 2PFBA 2WAFA 3FXQA 5A2QZ 1T2KA 3U2RA 3S1NJ 2NXNB 3QQAA 1RRJA 2V9VA 2RDPA 2K9QA 1FC3A 1RETA 1OPCA 4ZDPA 2E19A 1J2XA 2GOMA 1SD4A 1W1WE 3GVAA 1E3OC 3CQZJ 1YI2I 3DKYA 2N8GA 2GM4A 4A5MA 1D0ZA 2E60A 5DM6F 2H1KA 4GRIA 3GCMA 4JX6A 1MKMA 5D5XB 2A3SA 2XPVA 1TT5B 4HRIA 1O3TA 2E1MC 1A5JA 2R7QA 2FJ1A 4G7ZF 3S3NA 2TCTA 2LY2A 2CJJA 2CQ7A 3QU6A 1LEBA 4X6AJ 2ECBA 3ASOH 5E8GA 4IL6C 2E7WA 4NNJA 3W3CA 1MJ9A 4UV9A 5J6XA 2VN2A 1J9IA 3BG9A 2KT0A 3E6MA 1LFBA 2IEKA 1BOBA 2OF7A 4A3CJ 3OSFA 5D8KB 5DCMA 3CCEI 2DFEA 2O61A 4IJAA 3NWSA 3CF2A 1X1BA 4RM3A 2HYFA 4QTRA 1ZN2A 3MWMA 3RKXA 1Z3XA 1K83J 1FYLA 4L18B 2DPDA 2M30A 3CCYA 1QZEA 1FEXA 4XK4A 4NHJA 3WTSC 1E17A 4PJLA 1UZCA 3H3ZA 4FHTA 2V1NA 4BE0A 5JI6A 5D6EA 3ERMA 3A52A 3GTJJ 4IHVA 2JA7J 3ECHA 2CV0A 3SFZA 1P7IA 3IV5A 3WHBA 1Y0UA 1BOAA 3ABMH
chains in the Genus database with same CATH topology
1FBUA 1G3SA 2C6YA 4I7HA 2HGCA 3QP6A 4I01A 1QGPA 5IT3A 1P92A 2IA1A 4LB5A 2ADUA 2B0LA 3BZ6A 1HW5A 2L4MA 4I02A 1HSJA 3LQQA 3WGGA 1TW2A 1B6AA 4I98B 2CWEA 2RN7A 5FD6A 5DCMB 2ISYA 2PQ8A 2ISZA 4KN4X 4HOBA 5H6QA 3FMRA 5F1RA 5DD8A 3QPTA 5BPDA 4A6DA 3NQOA 2FNPA 2L3DA 4OOIA 1PP7U 4HQMA 4M74A 2ZO4A 1B4AA 4RAZA 1FP2A 5A2QK 5L3GA 1CF7B 2JSCA 4DNCA 4HF2A 5J8CA 5FD5A 3PQKA 2RC4A 1H9GA 1FOKA 2AS5F 1EH6A 2R7FA 2VC1A 4MTEA 1SFXA 2VT3A 3W6JB 1HW2A 2LKPA 4I0BA 4RS8A 4ESJA 2QQ9A 4M72A 4RB1A 2VOOA 3BDDA 3LFKA 3RIRA 3WGHA 2P8TA 4O5VA 1S7OA 4P55A 2DQLA 2Y0MA 1KYWA 2EA2A 2CYYA 3D5LA 5HDGA 2P4WA 1SMTA 4LLNA 2FNAA 5DEQA 2Z3YA 4AWXB 1SD5A 3QAHA 5AONA 2XAFA 5D6FA 4BAYA 4CXFA 1U5TA 3BJAA 1I6XA 1IN4A 4LFUA 4ON0A 3KE2A 4NB5A 4A0XA 4G6DA 3HRTA 2VODA 4MQ9F 2EA4A 3MZHA 4OU0A 4BNCA 3NRVA 1KQ0A 4IRGA 2PMHA 3BJOA 1Z9CA 3LA3A 3V7CA 2KJCA 3WTYC 1ON2A 2K7LA 3TOAA 4U0WA 4ESFA 3MZYA 2PMUA 3GXOA 1IRFA 2HKOA 5BMZA 4R1HA 1G3TA 4LJZF 2NYXA 1BI0A 2EFQA 1U5TC 4N9IA 5HS8A 3JW4A 3FHZA 2ZJ2A 1DPUA 5DYMA 5F64A 2K27A 2LNBA 3E3VA 3I71A 5FLXZ 1O3QA 1WRJA 1OR7A 5D5WB 1RUNA 2JPCA 4Q47A 1T38A 5LHIA 1OMIA 2IVMA 2XHKA 4EVIA 1FX7A 2F5FA 4AVPA 3Q9SA 1STZA 5DUKA 3V4GA 1BC7C 4RAYA 1HXDA 4LK0F 5AIQA 4CGZA 5DV5A 5BQTA 2ZCWA 1YS6A 4ZYEA 3K1PA 3M1EA 1P2FA 1ZRFA 3K2ZA 1ZGAA 1FYMA 1IN7A 2K4BA 1CF7A 2PG4A 4ETSA 4M9ZA 2GWRA 1S29A 1ZLJA 1J59A 4MGRA 1IUYA 3T0YA 1USSA 2M5WA 2CO5A 1FPQA 2FU4A 1ONVA 3I0TA 1WWXA 3R6SA 5H20A 5TJJA 5L3DA 3HSRA 2FQ3A 3H3UA 1F9NA 1R22A 2UZKA 2QENA 1P4XA 3TO9A 2XROA 2R7DA 1S3JA 1J5YA 2X4HA 2OZ6A 2PBIA 4ENKA 3CJNA 2XASA 1F4KA 1LDJA 2OBPA 5ICEA 1V3FA 4KT5C 1XN7A 1J7KA 3WTUC 2FXAA 2KIFA 4EJVA 4TV7A 2HS5A 2YPRA 3VEPA 2MH2A 1LEAA 2DO7A 1MDMB 3IHUA 1MZBA 3ZPLA 5IT9Z 3EYIA 1BN5A 5F6FA 1DPRA 2LSOA 1T39A 2HFHA 2KJBA 2XKPA 1QPMA 2DAOA 3RPUA 1TBXA 3IL2A 2H6CA 3NEUA 4KYWA 4MTDA 5CVVA 1QZZA 4HV5A 5ICCA 2GQQA 2MLKA 3OOPA 3HOSA 1RUOA 2EJRA 1LNWA 3I54A 3GW2A 3LSTA 2H27A 4HLYA 1A04A 2O03A 3W6KB 2VBZA 4HF0A 2DBBA 3BPXA 4HX8A 1IZ1A 5CLSA 2BE5F 2BV6A 4KIFA 5L3EA 3L9FA 3Q9VA 4G6QA 2PLYA 2ZKZA 2A68F 5D5UB 4ESBA 1BBYA 4KIBA 2LDUA 3GO5A 1RNLA 3ISPA 2MBFA 1SMYF 1ZG5A 2JTVA 5L3BA 2F5CA 5KK1A 2HDCA 4K2EA 1UHWA 2QUFA 3R0JA 4M6XA 3CO6C 3E6CC 1DDNA 2KIUA 3H92A 2YR2A 1XD7A 4GCVA 4XLPF 1YFHA 4IRHA 1U2WA 2Q2EA 1PDNC 1UFMA 4MHGA 2MD5A 3ULQB 2DTRA 3FWEA 4EMSA 3RKYA 1LB2A 3FM5A 4HDVA 1RZ4A 2PN6A 4LG0B 4WXCA 1XMAA 2EFNA 2QQBA 3SHFA 5BS6A 4ZYDA 2P5VA 2PJPA 3IWFA 3S2WA 4RGXA 4O6JA 1XSXA 4YIIA 3I59A 5FLXK 2PEXA 4EGZA 5HS9A 4KDPA 1T6SA 5J8FA 1KU7A 2VBXA 3RYPA 4DQ2A 3GYHX 4MQVA 4U88A 4WXDA 4H0EA 2IA2A 4B8XA 3CO7C 1J75A 1R5HA 1GVJA 3DEUA 2STTA 4RGUA 4OIQF 3GFMA 3I64A 3F21A 3V8JA 3WODF 3ECOA 3GX4X 1CGPA 3M9AA 1W4MA 4KMUX 2BBYA 4GYIA 3K9TA 4UXNA 3SQNA 2DI3A 2A07F 1R00A 3J80K 1B59A 2BEOA 4FX4A 5BOXA 5ERIA 1IF1A 5L3FA 3F6OA 1OYWA 2K86A 2EFOA 2PI0A 4KNYA 2COMA 1FYKA 2G7UA 3JSOA 4HF1A 1XSVA 3LA2A 2R3SA 2X0LA 5ICGA 3E5QA 2WTEA 1S6LA 3FXUA 1JXSA 3BJ6A 3JAMK 3MAJA 2W57A 1YTYA 4ZZLA 3KCCA 4BHCA 2V6CA 2L01A 1FZPB 2YU3A 3P9CA 3KP2A 2W25A 5L3CA 3CLOA 1Z91A 5HDNA 2Z9OA 2NRAC 2ESHA 3ABTA 1IXSB 4A12A 1ZLKA 4G94A 1O3RA 2DK5A 1EH8A 2OAZA 4L9TA 1G6NA 1XGSA 3CUOA 3JTHA 3WTTC 5LBQA 3HTSB 2P6SA 2VONA 1TTYA 3PFIA 2ESNA 4ENJA 1FBSA 2BYVE 4HYEA 2TDXA 4QWQA 4BXUA 2FRHA 1W7PB 4MEXF 3ZP5A 5LGTA 2DW4A 1IN5A 2A6EF 1BJAA 4IHSA 3D0SA 1FNNA 3GFIA 3BPVA 2QVOA 3HRUA 3HTUA 2OA4A 2W24A 3HHGA 2OD5A 3HSFA 1TNTA 1IXCA 3M8FA 4BH9A 3C1DA 5LHGA 1GHCA 1YS7A 1D3YA 3CUQB 2G9WA 4L9NA 4XBFA 2GA2A 3N4MA 3EYYA 1T98A 1V4RA 4XSXF 4M6YA 4I09A 3HYIA 2Y75A 3GFJA 2ZBKA 5FFXA 1UHMA 2BGCA 3C3WA 1LJ9A 5HLHA 2F5EA 2IP2A 5ICFA 1VTNC 3WTXC 1W5TA 2EFWA 4PGHA 4U7BA 3F22A 4HAMA 2GAUA 4EJOA 4KN7X 5E1WA 5CJ9A 1ON1A 2NNYA 4HX4A 4Q4ZF 1YLFA 2W84A 5JHUA 2VE8A 4HZFA 4M71A 5DDGA 1JHHA 4EV0A 4BHBA 2IJLA 2FSWA 2P5KA 4A0YA 3MQ0A 1IRGA 3L2CA 1T0FA 1SD7A 1B1BA 2M1BA 4WXHA 2RQPA 5DD4A 1K79A 4ZZDA 5HDKA 1R5GA 5LGUA 1FBQA 3CTAA 3HSEA 1YIOA 2QQAA 4L9VA 5HLIA 1LVAA 3BP8A 4GYGA 4L5JA 4L0ZB 4N0BA 5ED4A 4MNUA 2MA3A 1ZG1A 2STWA 1PUEE 3V8KA 4UV8A 3R0AA 1ULYA 2P7VB 3R60A 3QOPA 4Y17A 1ZARA 1O57A 3J80Z 2QLZA 2L4AA 1MD0A 2O8XA 2O6GE 2OZUA 3RPQA 3ROUA 1L0OC 1YW7A 4WK8F 2V1XA 4ZH4F 1IW7F 2EV0A 1SFUA 4R79A 3F6VA 4XRFA 4WF2A 3MCZA 1U5TB 1REPC 4BYYA 3ZMTA 3ZMZA 3FMSA 2VT2A 3KEQA 2MH9A 3TKYA 4XLNF 1R23A 5DCFA 3K0LA 3GZ5A 3FXRA 5KVRA 1U3EM 3O6BB 1TLHB 4GGGA 2ZXJA 1W7PA 3F8NA 3EETA 4FX0A 3FX3A 3I5UA 3ZMUA 2CFXA 1HKSA 5ILVA 1L3LA 3DV8A 1QZYA 1HBXG 5E18F 3LAPA 3LAJA 1EH7A 3HRMA 3BWGA 3IRRA 2VE9A 3MFKA 1Z1DA 2CGPA 4HW0A 4YFKF 3C18A 4L5IA 4LLGF 5TRDA 4A2UA 1IN6A 2IPQX 3R61A 3DP7A 4R8HA 3DKWA 3U1DA 3KP4A 2IA0A 2QBYB 5EEGA 3ELKA 3M8EA 4LD5A 3BOQA 3SXYA 1NHAA 1IAWA 2XAGA 3WTVC 1XGNA 3TQNA 3IKTA 4OIRF 3F8MA 5E8IA 3BY6A 1Q1HA 3ZMDA 2MC3A 2EV5A 5HLGA 1W7PD 1SFEA 3WTWC 3J7AO 1R58A 1XDSA 2HWVA 1BC8C 1ZG3A 5ILUA 1O3SA 5CYVA 2XRNA 5FO5A 3TDUC 3KFWX 1JHFA 1TNSA 1KGSA 1HW1A 4AIHA 1I1SA 4G7HF 1C0WA 4WX9A 2FE3A 4CZZA 4OMZA 4KICA 1WI9A 4M9SA 2IW5A 3WE3A 1QQIA 1ZREA 5CVUA 3ML6A 3COAC 4KA4A 3L09A 5DUIA 4L9JA 1I5ZA 3CDHA 3GF2A 1Z6TA 1YG2A 5HVQC 3DF8A 1U78A 1XDUA 3RKWA 3Q5FA 1IN8A 1DP7P 4IRIA 1K78B 1MGTA 4ENMA 4RGRA 3IRQA 1BI2A 2RVCA 3WE2A 2W85A 1R1UA 5LEJA 3I59B 2NAZA 2IRFG 2HOEA 2M8EA 5IT9K 2FMLA 5CVRA 1X3UA 3KEOA 4G8XA 3REOA 1K78A 5FGMA 3N97A 4BHPA 3B73A 4HV6A 5LEKA 4CYDA 1B9MA 1SD6A 1XCVA 1QO0D 2CG4A 2NS0A 5BPIA 4A5NA 3O3KA 3F23A 3PQJA 2DK8A 1B9NA 1JE8A 5D8LB 4EM2A 4QLCU 2Z33A 3LWFA 3T8RA 1PP8F 3EQLF 3I53A 2Q0OA 2CQKA 1I27A 3HOTA 3RI4A 1EV7A 1XMKA 2VBYA 2ACJA 1ODDA 4EM1A 2RV8A 2VXZA 3KLOA 1XB4A 3U9GA 3KP6A 2G7HA 1G3YA 1FY7A 2M45A 4FT8A 3T1BA 4HLXA 2EFPA 3SZTA 2L02A 1LQ1A 1O7LA 2FBHA 2F2EA 3ZN1A 3RTRA 1Z05A 3WGIA 2WWYA 3VB2A 2D1HA 3G3ZA 5HS7A 2J5PA 1GXPA 1BIAA 3ABUA 2XIGA 2O0YA 3HUGA 2Z99A 3FM3A 3QPHA 3E6DA 4NQWA 4IF4A 3CUQA 2V79A 3T8TA 4OINF 3VOEA 5D5VB 2GA1A 3KP3A 3I4PA 1OKRA 5EEHA 1ZYRF 2KIMA 3GZ6A 5ILSA 2EK5A 2OQGA 4ZYHA 4HQEA 3QU3A 3KLNA 1S8NA 4S05A 3KP5A 1TQPA 5K5OA 1BIBA 2FOKA 2XAHA 4UVCA 3TGNA 4JK1X 3IKVA 3ZN0A 1P6RA 4CHUA 3J81Z 5E17F 4EJWA 1YW8A 1K6OA 4Q5SF 3E97A 2YSRA 1OYIA 1TQMA 1UCRA 1OYYA 3HRSA 2ZMEA 4D0PA 4WCGA 2LF8A 1RI7A 3GEZA 2P6TA 3TO6A 5H6RA 2WV0A 2HTJA 2XAQA 3RYRA 3DQVC 2DLLA 2HZTA 3WU1B 2XKOA 4EM0B 1D5VA 3I58A 4U7DA 4UVAA 5FFZA 4UNOA 4Z2YA 4CDGA 2V1DA 4Y15A 4O3MA 2RGVA 4S04A 4EQQA 1YW9A 1S7AA 3ZMVA 3ZQ7A 1JGSA 3MEXA 1BI3A 2OU2A 3F3XA 4YIFA 1XGOA 2DQRA 1BI1A 2GIVA 1TW3A 1FWZA 2JZYA 4UHTA 4A0ZA 1MJAA 3C7JA 4BQAA 6PAXA 5FB2A 5LRRA 2JPBA 1FP1D 3KZZA 2RKHA 3ERED 1Z6RA 4CO8A 4E70A 3V7SA 2K4JA 1LDDA 3F8CA 3F72A 4IPAA 2GZWA 1P4AA 2DPUA 4KIGA 2DU9A 4AD9A 4CICA 5D4RA 4IVNA 3TO7A 3T5XA 3DFGA 1W5SA 1UB9A 4U0YA 1F5TA 3JSPA 2VC0A 2EWNA 2ETHA 2H6BA 2ZNZA 3J81K 4IXAA 2A5YB 1YO5C 3L7WA 2VBWA 3V7RA 2HQNA 3DPTA 3RDIA 3K69A 1KQ9A 1TQIA 3OV8A 4RB2C 2FBIA 5K1YA 1KA8A 1IXRC 4LLLA 1BM9A 1QNTA 1FSEA 3HHHA 3WG9A 3E5UA 2CW0F 4OIPF 3DXJF 2AXLA 3M7GA 1E2XA 2Y48A 2JRTA 2E1CA 1FT9A 3GFLA 4P9UA 1LDKB 4P9FA 2FA5A 2XVCA 3B02A 3F8FA 4KUMA 4AIJA 2RNJA 1ZGJA 4Y13A 2NNNA 1Z7UA 4WWCA 3FF5A 2ZNYA 2ZFWA 3EUHA 4F7ZA 1H9TA 1D8KA 2EB7A 1HQCA 5K5QA 2VOPA 3E6BA 2P5LC 3WTZA 3GLXA 4RGSA 2HR3A 1G3WA 2UXNA 4KMFA 5LRSA 4I0AA 4UUVA 1KU2A 4PGGA 3WU0A 2HYGD 3K1MA 4G7OF 2H94A 4JQFA 1G4DA 4KFCA 1SAXA 2EV6A 2A69F 4GO1A 3FZVA 2UXXA 1R1TA 1U6GA 3LA7A 3QRFF 4EJUA 1R1VA 2Q8KA 3TOBA 2IT0A 1FLIA 3SZPA 4HX7A 2MLGA 3KZYA 2HKXA 1WQ2A 2L54A 4ZYGA 4U0VA 4IHTA 4OMYA 4YFXF 3DPLC 4YG2F 4I2OA 1FSHA 3ZMSA 2K02A 1R36A 2LF7A 2WC2A 5LLQA 1RIOH 1ZAOA 4PDKA 2OQRA 4MEYF 2XUBA 3AAFA 4HDUA 1WSUA 4LK1F 2JT1A 4P5OA 1D8JA 2HTSA 4ENNA 2YX7A 2YX4A 1KQ8A 3P7NA 1I1GA 4RB3C 4PZJA 1ZRCA 4M9XA 2GXBA 4LB6B 1HSTA 2FBKA 2QYOA 4M73A 4N9HA 2HQRA 3FMQA 3GUDA 4HA8A 4AIKA 2DT5A 2Z5UA 5E1XA 1F1ZA 5JR3A 3BROA 3VFZA 3JTGA 2HEOA 1AWCA 3QP5A 4XSZF 2DFIA 1K7AA 2QBYA 2J5OA 4Q48A 1HKQA 3V8LA 5AIPA 4OIOF 4B09A 2A6HF 4L0YB 3KETA 4ASNA 1H0MA 2E7XA 4EJTA 5HOOA 3HIFA 2XAJA 4UVBA 4RB0A 2F5DA 1R7JA 2CSOA 2FEZA 1J0RA 5CVJA 4A6EA 3GWZA 2P7CB 2FMYA 5CVIA 2ELHA 1HKTA 1ZH5A 1AOYA 3IWZA 4EGYA 1XCBA 1WKMA 1USTA 1QBJA 5E20A 2KRFA 3E5XA 4GXOA 2D2WA 2ZMEB 4LMYA 2GXGA 2QM3A 1O7FA 2O3FA 1YYVA 4PCQA 2D45A 4LG0A 1MJBA 3CUQC 5K5RA 3RJPA 1XSDA 1YQAA 1KU3A 3K1NA 1ZHFA 4JBAA 1MDMA 3G73A 2H09A 2D1VA 3R4KA 3LQRA 3VODA 5JVTA 3P9KA 5LGNA 1U8RA 1KYZA 2QZ8A 1KU9A 1P4WA 2E1NA 3IC7A 2XV4S 3P9IA 2UWMA 2QWWA 3TDZC 2XGXA 4P96A 3F8BA 5JFRA 5LHHA 4YFNF 5D4SA 3JAMZ 2M87A 1ZRDA 1GXQA 4HBLA 2KKOA 3EDPA 3L00A 3O2PE 2FF4A 4LGWA 2A61A 1XGMA 1DUXC 3KP7A 2V1UA 4G9YA 5E1ZB 2PFBA 3FXQA 5A2QZ 1T2KA 3U2RA 2V9VA 2RDPA 1FC3A 1OPCA 1J2XA 1SD4A 3GVAA 4A5MA 1MKMA 5D5XB 2A3SA 1O3TA 4G7ZF 3QU6A 1LEBA 5E8GA 2E7WA 1MJ9A 4UV9A 5J6XA 2VN2A 1J9IA 3E6MA 5D8KB 5DCMA 2O61A 4IJAA 2HYFA 1ZN2A 3MWMA 3RKXA 1FYLA 4L18B 2DPDA 2M30A 4NHJA 3WTSC 1E17A 3H3ZA 4FHTA 5JI6A 5D6EA 3ECHA 3SFZA 1Y0UA 1BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBU A;  1G3S A;  2C6Y A;  4I7H A;  2HGC A;  3QP6 A;  4I01 A;  1QGP A;  5IT3 A;  1P92 A;  2IA1 A;  4LB5 A;  2ADU A;  2B0L A;  3BZ6 A;  1HW5 A;  2L4M A;  4I02 A;  1HSJ A;  3LQQ A;  3WGG A;  1TW2 A;  1B6A A;  4I98 B;  2CWE A;  2RN7 A;  5FD6 A;  5DCM B;  2ISY A;  2PQ8 A;  2ISZ A;  4KN4 X;  4HOB A;  5H6Q A;  3FMR A;  5F1R A;  5DD8 A;  3QPT A;  5BPD A;  4A6D A;  3NQO A;  2FNP A;  2L3D A;  4OOI A;  1PP7 U;  4HQM A;  4M74 A;  2ZO4 A;  1B4A A;  4RAZ A;  1FP2 A;  5A2Q K;  5L3G A;  1CF7 B;  2JSC A;  4DNC A;  4HF2 A;  5J8C A;  5FD5 A;  3PQK A;  2RC4 A;  1H9G A;  1FOK A;  2AS5 F;  1EH6 A;  2R7F A;  2VC1 A;  4MTE A;  1SFX A;  2VT3 A;  3W6J B;  1HW2 A;  2LKP A;  4I0B A;  4RS8 A;  4ESJ A;  2QQ9 A;  4M72 A;  4RB1 A;  2VOO A;  3BDD A;  3LFK A;  3RIR A;  3WGH A;  2P8T A;  4O5V A;  1S7O A;  4P55 A;  2DQL A;  2Y0M A;  1KYW A;  2EA2 A;  2CYY A;  3D5L A;  5HDG A;  2P4W A;  1SMT A;  4LLN A;  2FNA A;  5DEQ A;  2Z3Y A;  4AWX B;  1SD5 A;  3QAH A;  5AON A;  2XAF A;  5D6F A;  4BAY A;  4CXF A;  1U5T A;  3BJA A;  1I6X A;  1IN4 A;  4LFU A;  4ON0 A;  3KE2 A;  4NB5 A;  4A0X A;  4G6D A;  3HRT A;  2VOD A;  4MQ9 F;  2EA4 A;  3MZH A;  4OU0 A;  4BNC A;  3NRV A;  1KQ0 A;  4IRG A;  2PMH A;  3BJO A;  1Z9C A;  3LA3 A;  3V7C A;  2KJC A;  3WTY C;  1ON2 A;  2K7L A;  3TOA A;  4U0W A;  4ESF A;  3MZY A;  2PMU A;  3GXO A;  1IRF A;  2HKO A;  5BMZ A;  4R1H A;  1G3T A;  4LJZ F;  2NYX A;  1BI0 A;  2EFQ A;  1U5T C;  4N9I A;  5HS8 A;  3JW4 A;  3FHZ A;  2ZJ2 A;  1DPU A;  5DYM A;  5F64 A;  2K27 A;  2LNB A;  3E3V A;  3I71 A;  5FLX Z;  1O3Q A;  1WRJ A;  1OR7 A;  5D5W B;  1RUN A;  2JPC A;  4Q47 A;  1T38 A;  5LHI A;  1OMI A;  2IVM A;  2XHK A;  4EVI A;  1FX7 A;  2F5F A;  4AVP A;  3Q9S A;  1STZ A;  5DUK A;  3V4G A;  1BC7 C;  4RAY A;  1HXD A;  4LK0 F;  5AIQ A;  4CGZ A;  5DV5 A;  5BQT A;  2ZCW A;  1YS6 A;  4ZYE A;  3K1P A;  3M1E A;  1P2F A;  1ZRF A;  3K2Z A;  1ZGA A;  1FYM A;  1IN7 A;  2K4B A;  1CF7 A;  2PG4 A;  4ETS A;  4M9Z A;  2GWR A;  1S29 A;  1ZLJ A;  1J59 A;  4MGR A;  1IUY A;  3T0Y A;  1USS A;  2M5W A;  2CO5 A;  1FPQ A;  2FU4 A;  1ONV A;  3I0T A;  1WWX A;  3R6S A;  5H20 A;  5TJJ A;  5L3D A;  3HSR A;  2FQ3 A;  3H3U A;  1F9N A;  1R22 A;  2UZK A;  2QEN A;  1P4X A;  3TO9 A;  2XRO A;  2R7D A;  1S3J A;  1J5Y A;  2X4H A;  2OZ6 A;  2PBI A;  4ENK A;  3CJN A;  2XAS A;  1F4K A;  1LDJ A;  2OBP A;  5ICE A;  1V3F A;  4KT5 C;  1XN7 A;  1J7K A;  3WTU C;  2FXA A;  2KIF A;  4EJV A;  4TV7 A;  2HS5 A;  2YPR A;  3VEP A;  2MH2 A;  1LEA A;  2DO7 A;  1MDM B;  3IHU A;  1MZB A;  3ZPL A;  5IT9 Z;  3EYI A;  1BN5 A;  5F6F A;  1DPR A;  2LSO A;  1T39 A;  2HFH A;  2KJB A;  2XKP A;  1QPM A;  2DAO A;  3RPU A;  1TBX A;  3IL2 A;  2H6C A;  3NEU A;  4KYW A;  4MTD A;  5CVV A;  1QZZ A;  4HV5 A;  5ICC A;  2GQQ A;  2MLK A;  3OOP A;  3HOS A;  1RUO A;  2EJR A;  1LNW A;  3I54 A;  3GW2 A;  3LST A;  2H27 A;  4HLY A;  1A04 A;  2O03 A;  3W6K B;  2VBZ A;  4HF0 A;  2DBB A;  3BPX A;  4HX8 A;  1IZ1 A;  5CLS A;  2BE5 F;  2BV6 A;  4KIF A;  5L3E A;  3L9F A;  3Q9V A;  4G6Q A;  2PLY A;  2ZKZ A;  2A68 F;  5D5U B;  4ESB A;  1BBY A;  4KIB A;  2LDU A;  3GO5 A;  1RNL A;  3ISP A;  2MBF A;  1SMY F;  1ZG5 A;  2JTV A;  5L3B A;  2F5C A;  5KK1 A;  2HDC A;  4K2E A;  1UHW A;  2QUF A;  3R0J A;  4M6X A;  3CO6 C;  3E6C C;  1DDN A;  2KIU A;  3H92 A;  2YR2 A;  1XD7 A;  4GCV A;  4XLP F;  1YFH A;  4IRH A;  1U2W A;  2Q2E A;  1PDN C;  1UFM A;  4MHG A;  2MD5 A;  3ULQ B;  2DTR A;  3FWE A;  4EMS A;  3RKY A;  1LB2 A;  3FM5 A;  4HDV A;  1RZ4 A;  2PN6 A;  4LG0 B;  4WXC A;  1XMA A;  2EFN A;  2QQB A;  3SHF A;  5BS6 A;  4ZYD A;  2P5V A;  2PJP A;  3IWF A;  3S2W A;  4RGX A;  4O6J A;  1XSX A;  4YII A;  3I59 A;  5FLX K;  2PEX A;  4EGZ A;  5HS9 A;  4KDP A;  1T6S A;  5J8F A;  1KU7 A;  2VBX A;  3RYP A;  4DQ2 A;  3GYH X;  4MQV A;  4U88 A;  4WXD A;  4H0E A;  2IA2 A;  4B8X A;  3CO7 C;  1J75 A;  1R5H A;  1GVJ A;  3DEU A;  2STT A;  4RGU A;  4OIQ F;  3GFM A;  3I64 A;  3F21 A;  3V8J A;  3WOD F;  3ECO A;  3GX4 X;  1CGP A;  3M9A A;  1W4M A;  4KMU X;  2BBY A;  4GYI A;  3K9T A;  4UXN A;  3SQN A;  2DI3 A;  2A07 F;  1R00 A;  3J80 K;  1B59 A;  2BEO A;  4FX4 A;  5BOX A;  5ERI A;  1IF1 A;  5L3F A;  3F6O A;  1OYW A;  2K86 A;  2EFO A;  2PI0 A;  4KNY A;  2COM A;  1FYK A;  2G7U A;  3JSO A;  4HF1 A;  1XSV A;  3LA2 A;  2R3S A;  2X0L A;  5ICG A;  3E5Q A;  2WTE A;  1S6L A;  3FXU A;  1JXS A;  3BJ6 A;  3JAM K;  3MAJ A;  2W57 A;  1YTY A;  4ZZL A;  3KCC A;  4BHC A;  2V6C A;  2L01 A;  1FZP B;  2YU3 A;  3P9C A;  3KP2 A;  2W25 A;  5L3C A;  3CLO A;  1Z91 A;  5HDN A;  2Z9O A;  2NRA C;  2ESH A;  3ABT A;  1IXS B;  4A12 A;  1ZLK A;  4G94 A;  1O3R A;  2DK5 A;  1EH8 A;  2OAZ A;  4L9T A;  1G6N A;  1XGS A;  3CUO A;  3JTH A;  3WTT C;  5LBQ A;  3HTS B;  2P6S A;  2VON A;  1TTY A;  3PFI A;  2ESN A;  4ENJ A;  1FBS A;  2BYV E;  4HYE A;  2TDX A;  4QWQ A;  4BXU A;  2FRH A;  1W7P B;  4MEX F;  3ZP5 A;  5LGT A;  2DW4 A;  1IN5 A;  2A6E F;  1BJA A;  4IHS A;  3D0S A;  1FNN A;  3GFI A;  3BPV A;  2QVO A;  3HRU A;  3HTU A;  2OA4 A;  2W24 A;  3HHG A;  2OD5 A;  3HSF A;  1TNT A;  1IXC A;  3M8F A;  4BH9 A;  3C1D A;  5LHG A;  1GHC A;  1YS7 A;  1D3Y A;  3CUQ B;  2G9W A;  4L9N A;  4XBF A;  2GA2 A;  3N4M A;  3EYY A;  1T98 A;  1V4R A;  4XSX F;  4M6Y A;  4I09 A;  3HYI A;  2Y75 A;  3GFJ A;  2ZBK A;  5FFX A;  1UHM A;  2BGC A;  3C3W A;  1LJ9 A;  5HLH A;  2F5E A;  2IP2 A;  5ICF A;  1VTN C;  3WTX C;  1W5T A;  2EFW A;  4PGH A;  4U7B A;  3F22 A;  4HAM A;  2GAU A;  4EJO A;  4KN7 X;  5E1W A;  5CJ9 A;  1ON1 A;  2NNY A;  4HX4 A;  4Q4Z F;  1YLF A;  2W84 A;  5JHU A;  2VE8 A;  4HZF A;  4M71 A;  5DDG A;  1JHH A;  4EV0 A;  4BHB A;  2IJL A;  2FSW A;  2P5K A;  4A0Y A;  3MQ0 A;  1IRG A;  3L2C A;  1T0F A;  1SD7 A;  1B1B A;  2M1B A;  4WXH A;  2RQP A;  5DD4 A;  1K79 A;  4ZZD A;  5HDK A;  1R5G A;  5LGU A;  1FBQ A;  3CTA A;  3HSE A;  1YIO A;  2QQA A;  4L9V A;  5HLI A;  1LVA A;  3BP8 A;  4GYG A;  4L5J A;  4L0Z B;  4N0B A;  5ED4 A;  4MNU A;  2MA3 A;  1ZG1 A;  2STW A;  1PUE E;  3V8K A;  4UV8 A;  3R0A A;  1ULY A;  2P7V B;  3R60 A;  3QOP A;  4Y17 A;  1ZAR A;  1O57 A;  3J80 Z;  2QLZ A;  2L4A A;  1MD0 A;  2O8X A;  2O6G E;  2OZU A;  3RPQ A;  3ROU A;  1L0O C;  1YW7 A;  4WK8 F;  2V1X A;  4ZH4 F;  1IW7 F;  2EV0 A;  1SFU A;  4R79 A;  3F6V A;  4XRF A;  4WF2 A;  3MCZ A;  1U5T B;  1REP C;  4BYY A;  3ZMT A;  3ZMZ A;  3FMS A;  2VT2 A;  3KEQ A;  2MH9 A;  3TKY A;  4XLN F;  1R23 A;  5DCF A;  3K0L A;  3GZ5 A;  3FXR A;  5KVR A;  1U3E M;  3O6B B;  1TLH B;  4GGG A;  2ZXJ A;  1W7P A;  3F8N A;  3EET A;  4FX0 A;  3FX3 A;  3I5U A;  3ZMU A;  2CFX A;  1HKS A;  5ILV A;  1L3L A;  3DV8 A;  1QZY A;  1HBX G;  5E18 F;  3LAP A;  3LAJ A;  1EH7 A;  3HRM A;  3BWG A;  3IRR A;  2VE9 A;  3MFK A;  1Z1D A;  2CGP A;  4HW0 A;  4YFK F;  3C18 A;  4L5I A;  4LLG F;  5TRD A;  4A2U A;  1IN6 A;  2IPQ X;  3R61 A;  3DP7 A;  4R8H A;  3DKW A;  3U1D A;  3KP4 A;  2IA0 A;  2QBY B;  5EEG A;  3ELK A;  3M8E A;  4LD5 A;  3BOQ A;  3SXY A;  1NHA A;  1IAW A;  2XAG A;  3WTV C;  1XGN A;  3TQN A;  3IKT A;  4OIR F;  3F8M A;  5E8I A;  3BY6 A;  1Q1H A;  3ZMD A;  2MC3 A;  2EV5 A;  5HLG A;  1W7P D;  1SFE A;  3WTW C;  3J7A O;  1R58 A;  1XDS A;  2HWV A;  1BC8 C;  1ZG3 A;  5ILU A;  1O3S A;  5CYV A;  2XRN A;  5FO5 A;  3TDU C;  3KFW X;  1JHF A;  1TNS A;  1KGS A;  1HW1 A;  4AIH A;  1I1S A;  4G7H F;  1C0W A;  4WX9 A;  2FE3 A;  4CZZ A;  4OMZ A;  4KIC A;  1WI9 A;  4M9S A;  2IW5 A;  3WE3 A;  1QQI A;  1ZRE A;  5CVU A;  3ML6 A;  3COA C;  4KA4 A;  3L09 A;  5DUI A;  4L9J A;  1I5Z A;  3CDH A;  3GF2 A;  1Z6T A;  1YG2 A;  5HVQ C;  3DF8 A;  1U78 A;  1XDU A;  3RKW A;  3Q5F A;  1IN8 A;  1DP7 P;  4IRI A;  1K78 B;  1MGT A;  4ENM A;  4RGR A;  3IRQ A;  1BI2 A;  2RVC A;  3WE2 A;  2W85 A;  1R1U A;  5LEJ A;  3I59 B;  2NAZ A;  2IRF G;  2HOE A;  2M8E A;  5IT9 K;  2FML A;  5CVR A;  1X3U A;  3KEO A;  4G8X A;  3REO A;  1K78 A;  5FGM A;  3N97 A;  4BHP A;  3B73 A;  4HV6 A;  5LEK A;  4CYD A;  1B9M A;  1SD6 A;  1XCV A;  1QO0 D;  2CG4 A;  2NS0 A;  5BPI A;  4A5N A;  3O3K A;  3F23 A;  3PQJ A;  2DK8 A;  1B9N A;  1JE8 A;  5D8L B;  4EM2 A;  4QLC U;  2Z33 A;  3LWF A;  3T8R A;  1PP8 F;  3EQL F;  3I53 A;  2Q0O A;  2CQK A;  1I27 A;  3HOT A;  3RI4 A;  1EV7 A;  1XMK A;  2VBY A;  2ACJ A;  1ODD A;  4EM1 A;  2RV8 A;  2VXZ A;  3KLO A;  1XB4 A;  3U9G A;  3KP6 A;  2G7H A;  1G3Y A;  1FY7 A;  2M45 A;  4FT8 A;  3T1B A;  4HLX A;  2EFP A;  3SZT A;  2L02 A;  1LQ1 A;  1O7L A;  2FBH A;  2F2E A;  3ZN1 A;  3RTR A;  1Z05 A;  3WGI A;  2WWY A;  3VB2 A;  2D1H A;  3G3Z A;  5HS7 A;  2J5P A;  1GXP A;  1BIA A;  3ABU A;  2XIG A;  2O0Y A;  3HUG A;  2Z99 A;  3FM3 A;  3QPH A;  3E6D A;  4NQW A;  4IF4 A;  3CUQ A;  2V79 A;  3T8T A;  4OIN F;  3VOE A;  5D5V B;  2GA1 A;  3KP3 A;  3I4P A;  1OKR A;  5EEH A;  1ZYR F;  2KIM A;  3GZ6 A;  5ILS A;  2EK5 A;  2OQG A;  4ZYH A;  4HQE A;  3QU3 A;  3KLN A;  1S8N A;  4S05 A;  3KP5 A;  1TQP A;  5K5O A;  1BIB A;  2FOK A;  2XAH A;  4UVC A;  3TGN A;  4JK1 X;  3IKV A;  3ZN0 A;  1P6R A;  4CHU A;  3J81 Z;  5E17 F;  4EJW A;  1YW8 A;  1K6O A;  4Q5S F;  3E97 A;  2YSR A;  1OYI A;  1TQM A;  1UCR A;  1OYY A;  3HRS A;  2ZME A;  4D0P A;  4WCG A;  2LF8 A;  1RI7 A;  3GEZ A;  2P6T A;  3TO6 A;  5H6R A;  2WV0 A;  2HTJ A;  2XAQ A;  3RYR A;  3DQV C;  2DLL A;  2HZT A;  3WU1 B;  2XKO A;  4EM0 B;  1D5V A;  3I58 A;  4U7D A;  4UVA A;  5FFZ A;  4UNO A;  4Z2Y A;  4CDG A;  2V1D A;  4Y15 A;  4O3M A;  2RGV A;  4S04 A;  4EQQ A;  1YW9 A;  1S7A A;  3ZMV A;  3ZQ7 A;  1JGS A;  3MEX A;  1BI3 A;  2OU2 A;  3F3X A;  4YIF A;  1XGO A;  2DQR A;  1BI1 A;  2GIV A;  1TW3 A;  1FWZ A;  2JZY A;  4UHT A;  4A0Z A;  1MJA A;  3C7J A;  4BQA A;  6PAX A;  5FB2 A;  5LRR A;  2JPB A;  1FP1 D;  3KZZ A;  2RKH A;  3ERE D;  1Z6R A;  4CO8 A;  4E70 A;  3V7S A;  2K4J A;  1LDD A;  3F8C A;  3F72 A;  4IPA A;  2GZW A;  1P4A A;  2DPU A;  4KIG A;  2DU9 A;  4AD9 A;  4CIC A;  5D4R A;  4IVN A;  3TO7 A;  3T5X A;  3DFG A;  1W5S A;  1UB9 A;  4U0Y A;  1F5T A;  3JSP A;  2VC0 A;  2EWN A;  2ETH A;  2H6B A;  2ZNZ A;  3J81 K;  4IXA A;  2A5Y B;  1YO5 C;  3L7W A;  2VBW A;  3V7R A;  2HQN A;  3DPT A;  3RDI A;  3K69 A;  1KQ9 A;  1TQI A;  3OV8 A;  4RB2 C;  2FBI A;  5K1Y A;  1KA8 A;  1IXR C;  4LLL A;  1BM9 A;  1QNT A;  1FSE A;  3HHH A;  3WG9 A;  3E5U A;  2CW0 F;  4OIP F;  3DXJ F;  2AXL A;  3M7G A;  1E2X A;  2Y48 A;  2JRT A;  2E1C A;  1FT9 A;  3GFL A;  4P9U A;  1LDK B;  4P9F A;  2FA5 A;  2XVC A;  3B02 A;  3F8F A;  4KUM A;  4AIJ A;  2RNJ A;  1ZGJ A;  4Y13 A;  2NNN A;  1Z7U A;  4WWC A;  3FF5 A;  2ZNY A;  2ZFW A;  3EUH A;  4F7Z A;  1H9T A;  1D8K A;  2EB7 A;  1HQC A;  5K5Q A;  2VOP A;  3E6B A;  2P5L C;  3WTZ A;  3GLX A;  4RGS A;  2HR3 A;  1G3W A;  2UXN A;  4KMF A;  5LRS A;  4I0A A;  4UUV A;  1KU2 A;  4PGG A;  3WU0 A;  2HYG D;  3K1M A;  4G7O F;  2H94 A;  4JQF A;  1G4D A;  4KFC A;  1SAX A;  2EV6 A;  2A69 F;  4GO1 A;  3FZV A;  2UXX A;  1R1T A;  1U6G A;  3LA7 A;  3QRF F;  4EJU A;  1R1V A;  2Q8K A;  3TOB A;  2IT0 A;  1FLI A;  3SZP A;  4HX7 A;  2MLG A;  3KZY A;  2HKX A;  1WQ2 A;  2L54 A;  4ZYG A;  4U0V A;  4IHT A;  4OMY A;  4YFX F;  3DPL C;  4YG2 F;  4I2O A;  1FSH A;  3ZMS A;  2K02 A;  1R36 A;  2LF7 A;  2WC2 A;  5LLQ A;  1RIO H;  1ZAO A;  4PDK A;  2OQR A;  4MEY F;  2XUB A;  3AAF A;  4HDU A;  1WSU A;  4LK1 F;  2JT1 A;  4P5O A;  1D8J A;  2HTS A;  4ENN A;  2YX7 A;  2YX4 A;  1KQ8 A;  3P7N A;  1I1G A;  4RB3 C;  4PZJ A;  1ZRC A;  4M9X A;  2GXB A;  4LB6 B;  1HST A;  2FBK A;  2QYO A;  4M73 A;  4N9H A;  2HQR A;  3FMQ A;  3GUD A;  4HA8 A;  4AIK A;  2DT5 A;  2Z5U A;  5E1X A;  1F1Z A;  5JR3 A;  3BRO A;  3VFZ A;  3JTG A;  2HEO A;  1AWC A;  3QP5 A;  4XSZ F;  2DFI A;  1K7A A;  2QBY A;  2J5O A;  4Q48 A;  1HKQ A;  3V8L A;  5AIP A;  4OIO F;  4B09 A;  2A6H F;  4L0Y B;  3KET A;  4ASN A;  1H0M A;  2E7X A;  4EJT A;  5HOO A;  3HIF A;  2XAJ A;  4UVB A;  4RB0 A;  2F5D A;  1R7J A;  2CSO A;  2FEZ A;  1J0R A;  5CVJ A;  4A6E A;  3GWZ A;  2P7C B;  2FMY A;  5CVI A;  2ELH A;  1HKT A;  1ZH5 A;  1AOY A;  3IWZ A;  4EGY A;  1XCB A;  1WKM A;  1UST A;  1QBJ A;  5E20 A;  2KRF A;  3E5X A;  4GXO A;  2D2W A;  2ZME B;  4LMY A;  2GXG A;  2QM3 A;  1O7F A;  2O3F A;  1YYV A;  4PCQ A;  2D45 A;  4LG0 A;  1MJB A;  3CUQ C;  5K5R A;  3RJP A;  1XSD A;  1YQA A;  1KU3 A;  3K1N A;  1ZHF A;  4JBA A;  1MDM A;  3G73 A;  2H09 A;  2D1V A;  3R4K A;  3LQR A;  3VOD A;  5JVT A;  3P9K A;  5LGN A;  1U8R A;  1KYZ A;  2QZ8 A;  1KU9 A;  1P4W A;  2E1N A;  3IC7 A;  2XV4 S;  3P9I A;  2UWM A;  2QWW A;  3TDZ C;  2XGX A;  4P96 A;  3F8B A;  5JFR A;  5LHH A;  4YFN F;  5D4S A;  3JAM Z;  2M87 A;  1ZRD A;  1GXQ A;  4HBL A;  2KKO A;  3EDP A;  3L00 A;  3O2P E;  2FF4 A;  4LGW A;  2A61 A;  1XGM A;  1DUX C;  3KP7 A;  2V1U A;  4G9Y A;  5E1Z B;  2PFB A;  3FXQ A;  5A2Q Z;  1T2K A;  3U2R A;  2V9V A;  2RDP A;  1FC3 A;  1OPC A;  1J2X A;  1SD4 A;  3GVA A;  4A5M A;  1MKM A;  5D5X B;  2A3S A;  1O3T A;  4G7Z F;  3QU6 A;  1LEB A;  5E8G A;  2E7W A;  1MJ9 A;  4UV9 A;  5J6X A;  2VN2 A;  1J9I A;  3E6M A;  5D8K B;  5DCM A;  2O61 A;  4IJA A;  2HYF A;  1ZN2 A;  3MWM A;  3RKX A;  1FYL A;  4L18 B;  2DPD A;  2M30 A;  4NHJ A;  3WTS C;  1E17 A;  3H3Z A;  4FHT A;  5JI6 A;  5D6E A;  3ECH A;  3SFZ A;  1Y0U A;  1BOA A; 
#chains in the Genus database with same CATH topology
 1FBU A;  2NOJ B;  1ETW A;  1G3S A;  1SAN A;  4B3X A;  2C6Y A;  2LYC A;  4I7H A;  2R7U A;  3A03 A;  2YUS A;  3FBI B;  2ELJ A;  2HGC A;  1OCC H;  5M5X J;  3QP6 A;  4CA0 A;  4I01 A;  3TW6 A;  2CQN A;  1QGP A;  5IT3 A;  4M3F A;  1P92 A;  3OMY A;  3CCU I;  2IA1 A;  1YX5 A;  3K6G A;  4LB5 A;  2ADU A;  1WJB A;  5IOZ A;  3HC7 A;  5GAG J;  2B0L A;  2ID6 A;  3BZ6 A;  5EGO A;  4BGD A;  3OS1 A;  1VQK I;  2KRH A;  1ETY A;  1HF0 A;  1HW5 A;  2V4J C;  3JRD A;  2L4M A;  4C2U A;  4I02 A;  1HSJ A;  3LQQ A;  1V54 H;  2CMP A;  3QWL A;  2OV7 A;  1TW2 A;  2X9D A;  3WGG A;  1W0U A;  4CCK A;  2R92 J;  4DIQ A;  1R49 A;  1B6A A;  4I98 B;  2CWE A;  3VSL A;  1MBG A;  2RN7 A;  2VB6 A;  2XF6 A;  1VQO I;  5FD6 A;  2CFO A;  3OYA A;  2LKS A;  5DCM B;  3V42 A;  2ISY A;  3OYM A;  4IHW A;  3BG7 A;  3RQI A;  2PQ8 A;  2KZG A;  2Z16 A;  2ISZ A;  2VKV A;  3BQY A;  4Y33 A;  4IX7 A;  4KN4 X;  1ORK A;  1O4X A;  1OCT C;  4HOB A;  5H6Q A;  1S7E A;  3FMR A;  1LFU P;  5F1R A;  1RKW A;  2X6O A;  4UB6 C;  2VQG A;  3QPT A;  5DD8 A;  5BPD A;  1G59 A;  2Q1Z B;  2W82 A;  2LP0 A;  3NAU A;  4A6D A;  3NQO A;  2FNP A;  2L3D A;  4XKC A;  4CCN A;  4OOI A;  2H8W A;  4MIM A;  1PP7 U;  1VND A;  4HQM A;  4M74 A;  3ZCO A;  2OCC H;  2JA8 J;  1SVO A;  2ZO4 A;  1B4A A;  3RQ4 A;  5HLT A;  4RAZ A;  2IS2 A;  1FP2 A;  5A2Q K;  5L3G A;  1CF7 B;  2JSC A;  4NC6 A;  4DNC A;  4MFE A;  4PSW A;  4HF2 A;  5J8C A;  5FD5 A;  1P7J A;  5CQG A;  2DDB A;  2BXY A;  3S16 J;  3PQK A;  2K3F A;  3BQZ A;  2RC4 A;  1H9G A;  1ETQ A;  1UMQ A;  2JUC A;  1FOK A;  2AS5 F;  1EH6 A;  1R5I D;  2MYS A;  3HOV J;  1SVL A;  3PM1 A;  2R7F A;  2PMZ A;  2VC1 A;  5E3M A;  4MTE A;  1SFX A;  2VT3 A;  3W6J B;  1HW2 A;  2W7N A;  1MMN A;  2A05 A;  2LKP A;  2QKM B;  4I0B A;  4RS8 A;  4ESJ A;  2QQ9 A;  3LSI A;  3MKW B;  4M72 A;  4RB1 A;  2O7O A;  3BDD A;  2VOO A;  4XRM A;  3SJM A;  2JMW A;  3LFK A;  1MMD A;  4Y3O A;  1WJD A;  2F5V A;  3BTI A;  4B48 A;  3ONQ A;  3RIR A;  3WGH A;  1DU6 A;  1W36 C;  4F52 A;  2P8T A;  4O5V A;  1S7O A;  4QPO A;  3AG4 H;  5FKL A;  4P55 A;  1QRY A;  3BZC A;  2DQL A;  3AKZ A;  2Y0M A;  3HB9 A;  1KYW A;  2EA2 A;  3B6C A;  2CYY A;  3D5L A;  5HDG A;  5IYC J;  2P4W A;  1SMT A;  4LLN A;  4CCO A;  5J47 A;  4IEJ A;  2FNA A;  2VJ4 A;  1OCR H;  1JT0 A;  3DWL E;  5DEQ A;  3TED A;  2B9S A;  2Z3Y A;  4OWR B;  3FKJ A;  1NK2 P;  3KYL A;  2WAD A;  3RKQ A;  4AWX B;  3CMM A;  1SD5 A;  3QAH A;  4M3G A;  5AON A;  3CC2 I;  2XAF A;  3ZGK A;  2K5C A;  3UNG C;  4AC0 A;  1IUF A;  5D6F A;  5EG0 B;  4BAY A;  5B66 C;  4CXF A;  1I6H J;  1U5T A;  3BJA A;  1U8B A;  4FAS D;  4HSR A;  3VYT B;  3SFI A;  1FTZ A;  1I6X A;  1IN4 A;  4LFU A;  2R5Y B;  2CUE A;  4ON0 A;  3K70 D;  4DOZ A;  1A6I A;  3KE2 A;  4NB5 A;  4A0X A;  4YIR X;  3CME I;  2ZJQ F;  2AXT C;  4G6D A;  4DYQ A;  3HRT A;  3JRF A;  2NVY J;  3OYC A;  3HL2 A;  2VOD A;  3HBL A;  2EA4 A;  3QOD A;  4MQ9 F;  4BQN A;  3MZH A;  3M3Y J;  2HPM A;  1I39 A;  4OU0 A;  4C2M J;  4Y7N J;  3NRV A;  4BNC A;  1KQ0 A;  4IRG A;  2PMH A;  3BJO A;  1Z9C A;  3LA3 A;  3RPU D;  3V7C A;  2VAS A;  3X2Q H;  1ZR2 A;  1VQN I;  2KJC A;  3WTY C;  3FKI J;  2DMQ A;  5JLW A;  2LOO A;  4A3G J;  1ON2 A;  1JI8 A;  2K7L A;  3TOA A;  5FLV A;  4U87 A;  4U0W A;  4ESF A;  3OYN A;  3MZY A;  2KP6 A;  3ZQF A;  3H36 A;  2PMU A;  3GXO A;  2MUN A;  1IRF A;  2HKO A;  1IC8 A;  4J01 A;  2TRT A;  5BMZ A;  2XAU A;  4ZYA A;  4R1H A;  1VQ6 I;  1G3T A;  4LJZ F;  4IZZ A;  2P81 A;  2NYX A;  1BI0 A;  2VQC A;  2K9N A;  1ZK8 A;  2EFQ A;  1U5T C;  4N9I A;  5HS8 A;  3CZ6 A;  3GTG J;  2KZV A;  3E1S A;  3JW4 A;  1AA7 A;  1MMS A;  3FHZ A;  2ZJ2 A;  2RQQ A;  4OAY A;  3CC7 I;  1DQU A;  1DPU A;  5DYM A;  3PUB A;  1BR2 A;  4F3Q A;  5EDN A;  5F64 A;  3HM5 A;  2K27 A;  2LNB A;  3E3V A;  3I71 A;  3ZXS A;  5FLX Z;  3J7Y J;  1O3Q A;  4Z6Y A;  2R7V A;  2ECC A;  3ZQG A;  1WRJ A;  5FRM A;  1OR7 A;  1OCZ H;  5D5W B;  3LSK A;  1RUN A;  2JPC A;  4Q47 A;  1T38 A;  5LHI A;  1OMI A;  2IVM A;  2BY1 A;  2XHK A;  4EVI A;  9ANT A;  5C44 J;  4RBO A;  1FX7 A;  4CYC A;  1JUS A;  2F5F A;  4AVP A;  3Q9S A;  1STZ A;  5DUK A;  1J09 A;  3V4G A;  2EQR A;  1BC7 C;  4RAY A;  2XB5 A;  4NC7 A;  1S72 I;  4I76 A;  1HXD A;  4LK0 F;  2K85 A;  5AIQ A;  5LFA A;  4CGZ A;  1WVR A;  5DV5 A;  5BQT A;  1BW5 A;  2ZCW A;  2VKH A;  1YS6 A;  4ZYE A;  3K1P A;  1JKR C;  3M1E A;  1P2F A;  3Q3S A;  4E4H A;  1ZRF A;  3K2Z A;  2CH0 A;  4W97 A;  1ZGA A;  1FYM A;  4IHY A;  3FBN B;  1TWF J;  1Z0X A;  1IN7 A;  1N25 A;  2LY9 A;  2M3A A;  4J19 A;  2K4B A;  1CF7 A;  2PG4 A;  4RAG A;  4ETS A;  3PL8 A;  4M9Z A;  2GWR A;  2M8G X;  1S29 A;  1ZLJ A;  1YOV B;  5F0C A;  5DM7 F;  1Y39 A;  2DOD A;  1J59 A;  1LE8 B;  1X4P A;  4LIT A;  1U9O A;  4MGR A;  1XC5 A;  5M5Y J;  4BJ6 C;  1IUY A;  3T0Y A;  1USS A;  1ZTR A;  2CO5 A;  2M5W A;  3TP3 A;  5JHF A;  1FPQ A;  2FU4 A;  1ONV A;  3I0T A;  1WWX A;  1MBJ A;  3R6S A;  5H20 A;  3OR2 C;  5TJJ A;  2DJI A;  2W1O A;  5L3D A;  3AG3 H;  3HSR A;  1YHQ I;  2FQ3 A;  3HPH A;  4AID A;  2I10 A;  2VUM J;  3H3U A;  3CMY A;  2DMP A;  1F9N A;  3PIO F;  1R22 A;  1T33 A;  2UZK A;  3M1C A;  2QEN A;  1P4X A;  2F4M B;  2DMT A;  3K4M A;  3TO9 A;  2XRO A;  3F9K A;  3BCB A;  2R7D A;  1S3J A;  1J5Y A;  2O5R A;  2LTP A;  2R7S A;  2X4H A;  1K4T A;  3MN2 A;  4HEA 2;  1MNM C;  1VQ7 I;  3GTO J;  2OZ6 A;  2RNG A;  3UR3 C;  2P0T A;  2PBI A;  5HNF A;  4ENK A;  3CJN A;  2XAS A;  1F4K A;  1ZKG A;  1LDJ A;  2OBP A;  3S1Q J;  5ICE A;  1V3F A;  2DA2 A;  4KT5 C;  2QQ8 A;  1XN7 A;  1J7K A;  3WTU C;  1WH5 A;  4BBS J;  2FXA A;  2KIF A;  4EJV A;  4TV7 A;  2JRM A;  2HS5 A;  2YPR A;  3VEP A;  2MH2 A;  1LEA A;  2DO7 A;  2R4G A;  3K4J A;  4BEH B;  1MDM B;  2BVL A;  3IHU A;  1MZB A;  5EZG A;  2FUG 2;  2LG4 A;  2WB1 A;  3ZPL A;  5IT9 Z;  3EYI A;  3Q0W A;  1K61 A;  1BN5 A;  5F6F A;  1DPR A;  2LSO A;  1T39 A;  2E2J J;  2HFH A;  2KJB A;  2MD0 A;  2KMU A;  2XKP A;  3LSP A;  1QPM A;  2DAO A;  2XRL A;  1VI0 A;  3OYH A;  3RPU A;  1TBX A;  3IL2 A;  2H6C A;  1R4M B;  4AYB N;  4EEF G;  3NEU A;  4KYW A;  4MTD A;  2R7T A;  5CVV A;  1QZZ A;  4HV5 A;  1JKQ C;  5ICC A;  5HNH A;  2GQQ A;  3OIO A;  3HDD A;  2L9S A;  2HXO A;  2L7K A;  3OYG A;  2Y69 H;  2MLK A;  3I55 I;  4FTH A;  3OOP A;  3I4M J;  1MW7 A;  1TZL A;  3HOS A;  1RUO A;  2EJR A;  2ZSI B;  4PJ0 C;  3HPG A;  1LNW A;  1VQ5 I;  1WJF A;  4JYK A;  3I54 A;  3ZQH A;  3GW2 A;  3CES A;  2DA5 A;  3W2V A;  3LST A;  5BNG A;  1NH3 A;  1NG6 A;  2H27 A;  2EIN H;  1W36 D;  4J00 A;  2X98 A;  5FLM J;  4HLY A;  1A04 A;  2O03 A;  2PX9 A;  2VBZ A;  4HF0 A;  2DBB A;  3W6K B;  3BPX A;  3HOY J;  2M0C A;  4HX8 A;  3VSK A;  1IZ1 A;  5CLS A;  2BE5 F;  4BUP A;  1XTA A;  3P5J A;  3ZRG A;  2DA7 A;  2OC6 A;  3MKL A;  2BV6 A;  4KIF A;  5L3E A;  4FCY A;  1VQ4 I;  4HPQ A;  3L9F A;  1OCP A;  4PJJ A;  3Q9V A;  4DYR A;  3OY9 A;  2PJR A;  4G6Q A;  2K9S A;  5JVG F;  2LY1 A;  3AL0 B;  1WJE A;  1Y56 A;  5B3S H;  2PLY A;  2ZKZ A;  2A68 F;  5D5U B;  4ESB A;  1BBY A;  1DGR M;  4KIB A;  1JUM A;  2LDU A;  3OOU A;  3J7Z I;  5F27 A;  3GO5 A;  1RNL A;  2A6T A;  1YIT I;  4P1W A;  1B72 A;  2I5U A;  3ISP A;  1G2H A;  2MAB A;  3A0B C;  2MBF A;  1SMY F;  3G1M A;  3CF5 F;  2EZK A;  3H9G A;  1ZG5 A;  1LFP A;  2JTV A;  1BW6 A;  3GTQ J;  3OYF A;  1PUF A;  2Y30 A;  3FXL A;  5L3B A;  2F5C A;  5IYD J;  3MZ8 A;  5KK1 A;  4K2E A;  2HDC A;  2R7W A;  1UHW A;  2DYR H;  2QUF A;  2CU7 A;  5IP7 J;  5E79 C;  2IGO A;  3R0J A;  4M6X A;  3CO6 C;  1CQT A;  3E6C C;  2XC7 A;  3S3O A;  1YRN B;  5C4J J;  3K4K A;  1D1A A;  1DDN A;  1GLN A;  2KDZ A;  4BJ5 C;  2KIU A;  2ZXW H;  5E3O A;  1BR1 A;  3H92 A;  2YR2 A;  1XD7 A;  4GCV A;  4XLP F;  2V6E A;  1YFH A;  4IRH A;  4W1U A;  1U2W A;  2Q2E A;  4IOA F;  1PDN C;  2E2I J;  1UFM A;  1PUF B;  4IQJ A;  3BTL A;  2EZH A;  1R4N B;  4HNV A;  3OS0 A;  4MHG A;  1ETV A;  2KIS A;  3AL0 C;  1N78 A;  2MD5 A;  3ULQ B;  2YS9 A;  3WHC A;  3K4N A;  1Y1V J;  2DTR A;  3FWE A;  3Q0V A;  4EMS A;  3RKY A;  3S14 J;  3JRE A;  4BXF A;  4JP0 A;  1LB2 A;  3LSM A;  3BR1 A;  2ZC2 A;  4DGW B;  3FM5 A;  1E3P A;  2K9M A;  4HDV A;  1RZ4 A;  2PN6 A;  3GZN B;  4LG0 B;  4WXC A;  2KIQ A;  1XMA A;  2EFN A;  2QQB A;  2M0M A;  3SHF A;  2EZL A;  2CS3 A;  1A36 A;  5F0F A;  2JK3 A;  2WB1 N;  3H5R A;  3JAM R;  5BS6 A;  2OTL I;  2Z1D A;  2DMU A;  4RM2 A;  4CZC A;  4ZYD A;  1YJN I;  2P5V A;  2F6C A;  2PJP A;  3GTK J;  3K7A J;  3VYS B;  3PIP F;  2VPL A;  3IWF A;  3S2W A;  4RGX A;  4O6J A;  1XSX A;  1JT6 A;  4YII A;  3I59 A;  5FLX K;  1HC8 A;  2PEX A;  4EGZ A;  4KJZ A;  5HS9 A;  4KDP A;  1T6S A;  5J8F A;  1KU7 A;  3GTM J;  1GUU A;  1GV2 A;  2L7Z A;  2VBX A;  2BHY A;  2Y9Y A;  3K2A A;  2WY7 Q;  3RYP A;  2LC2 A;  4DQ2 A;  3GYH X;  4E7I A;  4MQV A;  2CQX A;  4NBQ A;  2XGE A;  4U88 A;  3L2W A;  3JR9 A;  4WXD A;  4H0E A;  3S8P A;  4C3J J;  2IA2 A;  4JX5 A;  2MSY A;  4B8X A;  2HVQ A;  4A3E J;  3CO7 C;  1J75 A;  1R5H A;  2W4S A;  1X19 A;  4XKV A;  3NWT A;  1GVJ A;  3IH4 A;  1JTX A;  3FXJ A;  1ETO A;  3DEU A;  4V2G A;  1POG A;  1RPW A;  2XPU A;  4RGU A;  2STT A;  2ZJR F;  4OIQ F;  3GFM A;  3VDX A;  3I64 A;  3ABL H;  3F21 A;  3V8J A;  3WOD F;  3VWB A;  3ECO A;  3GX4 X;  4XR6 A;  1CGP A;  3J81 R;  3M9A A;  1W4M A;  2X1C A;  2KHM A;  1XG1 A;  3SDB A;  1OQY A;  4KMU X;  3HGG A;  2BBY A;  4GYI A;  3K9T A;  5M3F J;  5K7F A;  4UXN A;  3SQN A;  4QPQ A;  2DI3 A;  2A07 F;  1R00 A;  3J80 K;  4CSW A;  1B59 A;  2BEO A;  2VI6 A;  4FX4 A;  5BOX A;  1UAA A;  5ERI A;  2MVT A;  3PO3 J;  2WBM A;  4RLQ A;  1IF1 A;  5L3F A;  1M1E B;  1S5L C;  3F6O A;  4BL0 B;  1OYW A;  2K86 A;  1TWH J;  2EFO A;  3BR3 A;  3HJE A;  1ZEL A;  2PI0 A;  4KNY A;  2COM A;  4QSH A;  3L2U A;  1FYK A;  1MBF A;  2G7U A;  3JSO A;  1V55 H;  1XSV A;  1IG7 A;  1EJ9 A;  4HF1 A;  4IHX A;  3LA2 A;  3H35 A;  2R3S A;  2X0L A;  5ICG A;  3E5Q A;  3O8G A;  2WTE A;  1MH4 A;  2X1E A;  1S6L A;  1MMG A;  1X2N A;  3FXU A;  1JXS A;  3BJ6 A;  3JAM K;  3MAJ A;  2X51 A;  2W57 A;  1YTY A;  3JRC A;  4ZZL A;  3KCC A;  4BHC A;  2V6C A;  2L01 A;  4BDY A;  1FZP B;  2YU3 A;  3P9C A;  2JA5 J;  3RZD J;  1IRX A;  1IDY A;  3KP2 A;  2W25 A;  5L3C A;  4E7S A;  4PK4 A;  3CLO A;  1Z91 A;  5HDN A;  1AU7 A;  2JSP A;  3H5N A;  2Z9O A;  2NRA C;  2K40 A;  2JN6 A;  2MW8 A;  2M4K A;  2IGM A;  3O8H A;  2ESH A;  2M2E A;  2M7A A;  1IXS B;  3ABT A;  2Y9Z A;  4A12 A;  2ZSH B;  1ZLK A;  4G94 A;  1O3R A;  2DK5 A;  3UKG A;  1EH8 A;  3S32 A;  2OAZ A;  4L9T A;  2E5Z A;  1G6N A;  2HYJ A;  1XGS A;  3CUO A;  3JTH A;  3WTT C;  4HNT A;  5LBQ A;  1OR7 C;  3HTS B;  1A6Q A;  2P6S A;  1ZGW A;  3C2G A;  3S2H J;  2H8R A;  4BE2 A;  2VON A;  1TTY A;  3PFI A;  3GTP J;  1BA5 A;  2ESN A;  4RLF A;  4ENJ A;  4V19 K;  1JJ8 C;  1WJ5 A;  1JKO C;  1FBS A;  2UV1 A;  2VQH A;  2BYV E;  4HYE A;  2TDX A;  2XF7 A;  1ERD A;  2JVG A;  2E1M B;  4QWQ A;  4BXU A;  2FRH A;  2BW3 B;  1W7P B;  3HUG B;  3HEF A;  1MH3 A;  4MEX F;  1I3Q J;  3ZP5 A;  5LGT A;  2OCE A;  4M3D A;  2DW4 A;  2V26 A;  2EIJ H;  3DLA A;  3CP2 A;  4QIW N;  1IN5 A;  2A5W A;  2A6E F;  1BJA A;  4IHS A;  3D0S A;  1WI3 A;  4XRS G;  1FNN A;  4KIS A;  3GFI A;  1IRZ A;  3CCQ I;  3BPV A;  3KX2 A;  2WA0 A;  2QVO A;  3HRU A;  3ZR8 X;  2D5V A;  3MVP A;  3BR6 A;  3HTU A;  2ZME C;  1Q1V A;  3BR5 A;  2OA4 A;  2IAI A;  2W24 A;  3HHG A;  4ABZ A;  2OD5 A;  3HSF A;  1TNT A;  1IXC A;  2IS4 A;  3M8F A;  1UG0 A;  4BH9 A;  2DCE A;  3C1D A;  1NTC A;  5LHG A;  5FRN A;  1GHC A;  3JRG A;  3DBL B;  2AQE A;  5GAE J;  3KEY A;  3NAR A;  1YS7 A;  2KFD A;  1D3Y A;  1EF4 A;  5KNL A;  4B47 A;  2QSH X;  3E0J B;  3CUQ B;  4E7H A;  3ASN H;  4F91 B;  1JGG A;  2G9W A;  1VQL I;  1Z77 A;  2HDD A;  4L9N A;  4XBF A;  2AO9 A;  1JUP A;  2GA2 A;  2ZJP F;  3N4M A;  3EYY A;  1T98 A;  1TP4 A;  2V9P A;  1V4R A;  4AVZ A;  1WH7 A;  4XSX F;  4M6Y A;  4I09 A;  3HYI A;  3F0C A;  1AHD P;  2Y75 A;  2DFF A;  3GFJ A;  2ZBK A;  1YE9 A;  5FFX A;  3W6V A;  5IT9 R;  1U0J A;  4UY8 I;  3H3V K;  1UHM A;  3SDG A;  2MGQ A;  3HKZ N;  2BGC A;  3C3W A;  1LJ9 A;  1B8I B;  5HLH A;  3VYR B;  4KIT B;  2F5E A;  2IP2 A;  4ANJ A;  2QEX I;  5ICF A;  3RZO J;  4UUS A;  5B5E C;  1HDP A;  4II2 A;  2Z2S B;  1VTN C;  3WTX C;  3FHN A;  1D1B A;  1W5T A;  4FET A;  3J7A Y;  4XRS A;  2EFW A;  4PGH A;  2CUZ A;  2JJ7 A;  4U7B A;  3JRH A;  3F22 A;  4HNU A;  3W2A A;  4HAM A;  2IBD A;  2GAU A;  4EJO A;  4KN7 X;  2XB0 X;  5E1W A;  5CJ9 A;  1ON1 A;  3FIW A;  2EIK H;  2NNY A;  4AM3 A;  4HX4 A;  3HOZ J;  4BU2 A;  4Q4Z F;  1YLF A;  3G1O A;  2FX0 A;  4E7J A;  2W84 A;  1OIS A;  5JHU A;  1T8I A;  2VE8 A;  1K4S A;  4HZF A;  4M71 A;  2P0W A;  3H9J A;  3TMO A;  5GTH C;  2LRD A;  2QKL B;  5DDG A;  2KLO A;  1JHH A;  4EV0 A;  4BHB A;  2IJL A;  2M34 A;  2FSW A;  2DT6 A;  2P5K A;  4A0Y A;  3MQ0 A;  1MND A;  1IRG A;  3L2C A;  1VQ9 I;  1T0F A;  1SD7 A;  5K7Z A;  1B1B A;  2M1B A;  2DTZ A;  4WXH A;  2RQP A;  5DD4 A;  1Y0N A;  4AU7 A;  5IPA A;  1K79 A;  4ZZD A;  1GDT A;  1TWC J;  5HDK A;  1R5G A;  3PNT A;  3DLL F;  4NC8 A;  5LGU A;  1FBQ A;  3CTA A;  5H2F C;  3GTL J;  4DJA A;  3LSJ A;  3I3L A;  3HSE A;  1FMW A;  1YIO A;  2QQA A;  2H1L A;  4X0G A;  4L9V A;  5HLI A;  4S0H B;  2CW7 A;  1LVA A;  3BP8 A;  3A01 B;  4GYG A;  2KQR A;  4L5J A;  4N0B A;  4L0Z B;  1G8X A;  5ED4 A;  4MNU A;  2MA3 A;  1ZG1 A;  2STW A;  1PUE E;  3V8K A;  4UV8 A;  3R0A A;  1PYV A;  3M4O J;  1ULY A;  2P7V B;  3FDY A;  3R60 A;  4XID A;  2CW8 A;  3QOP A;  4Y17 A;  3KIO A;  5F0H A;  4EAT A;  1ZAR A;  2R5Z A;  1HLV A;  1O57 A;  3J80 Z;  3OS2 A;  2QLZ A;  2L4A A;  1MD0 A;  2O8X A;  4RMN A;  2O6G E;  2OZU A;  3RPQ A;  3ROU A;  1L0O C;  1RC9 A;  1YW7 A;  2ID3 A;  2MC4 A;  1FMV A;  2V1X A;  4ZH4 F;  4WK8 F;  3FXO A;  1IW7 F;  2EV0 A;  1SFU A;  5CPR B;  3F6V A;  3CJT B;  4XRF A;  2DA1 A;  2KPM A;  4XM3 A;  4R79 A;  4WF2 A;  4RDU A;  3MCZ A;  1U5T B;  1VQP I;  4BYY A;  1REP C;  1TL8 A;  3ZMT A;  2EH3 A;  3ZMZ A;  1RES A;  3FMS A;  3CCS I;  1BR4 A;  2O9L A;  2VT2 A;  3KEQ A;  2MH9 A;  3TKY A;  4XLN F;  2KDO A;  1R23 A;  1FIP A;  5DCF A;  3K0L A;  2DYS H;  3LL7 A;  2EIL H;  3GZ5 A;  3FXR A;  5KVR A;  1U3E M;  3G1L A;  3O6B B;  1TLH B;  1GVD A;  4GGG A;  2ZXJ A;  1W7P A;  3F8N A;  3EET A;  4FX0 A;  3FX3 A;  4Y4R A;  3LSG A;  1AKH A;  3I5U A;  3ZMU A;  4DZP A;  2CFX A;  1HKS A;  2ICW G;  4B44 A;  5ILV A;  4IO9 F;  1OJL A;  3A02 A;  1W5C C;  1L3L A;  3A01 A;  2RAE A;  3DV8 A;  4MLO A;  3FK7 A;  2M9H A;  1QZY A;  3LSR A;  1HBX G;  5E18 F;  5IY5 H;  1Z3Y A;  4CYC B;  2HVR A;  2XPW A;  3LAP A;  1HOM A;  2F4O B;  2ZFU A;  1D1C A;  1SEU A;  2NS7 A;  3LAJ A;  1EH7 A;  3HRM A;  3BWG A;  3IRR A;  2WY8 Q;  2BXZ A;  4BXX J;  2VE9 A;  1VZ0 A;  3MFK A;  1Z1D A;  1TWA J;  2CGP A;  4HW0 A;  4YFK F;  3C18 A;  1EA3 A;  4L5I A;  3C2H A;  4LLG F;  5TRD A;  3S3M A;  5EZH A;  4A2U A;  1IN6 A;  2IPQ X;  3R61 A;  4YRV A;  3DP7 A;  4R8H A;  1UHS A;  1QHG A;  3DKW A;  2DFH A;  3DTI A;  3U1D A;  1QU3 A;  3KP4 A;  3DBH B;  4C3I J;  2IA0 A;  3OR1 C;  1WJC A;  2QBY B;  5E3N A;  4GDF A;  5EEG A;  3MD2 A;  1Z21 A;  2CUJ A;  3ELK A;  3M8E A;  4LD5 A;  2B7E A;  4LG3 A;  5M3M J;  3BOQ A;  3K4C A;  3SXY A;  1NHA A;  4D5C A;  1ACI A;  3IP4 B;  1IAW A;  1X4O A;  2XAG A;  3HGY A;  3IAS 2;  2PJR B;  1V5E A;  2ME0 A;  3AFH A;  3WTV C;  1T08 B;  1XGN A;  2LBF A;  4ZDL A;  3TQN A;  3IKT A;  4OIR F;  3F8M A;  5E8I A;  5LD2 C;  1R71 A;  1ZQ3 P;  3BY6 A;  1Q1H A;  5F1J A;  2Y31 A;  4E6K G;  3ZMD A;  2MC3 A;  1UJ8 A;  3OYK A;  2EV5 A;  4C30 A;  1PVE A;  3CP8 A;  1X1D A;  2HQA A;  3S15 J;  5HLG A;  1W7P D;  1SFE A;  2Q2E B;  3WTW C;  3J7A O;  2HZD A;  3LOC A;  1R58 A;  4F55 A;  4ZJZ A;  4HST A;  2LFB A;  2HVS A;  1WGX A;  1XDS A;  2HWV A;  1ZG3 A;  5ILU A;  1BC8 C;  1RQ6 A;  4XON A;  1O3S A;  3OYJ A;  5CYV A;  2XRN A;  5FO5 A;  4A3F J;  2E2H J;  2VLA A;  3TDU C;  4DBQ A;  3K4L A;  3KFW X;  1LE8 A;  1JHF A;  1TNS A;  1T95 A;  4AUX A;  4A3K J;  1KGS A;  1HW1 A;  4AIH A;  1I1S A;  4G7H F;  5DTD A;  1C0W A;  3U1K A;  3DBR B;  4WX9 A;  2FE3 A;  4JX4 A;  5GP9 A;  3ZOB A;  4CZZ A;  1FTT A;  3BT9 A;  1XMX A;  4OMZ A;  5EEA A;  4KIC A;  1WI9 A;  4M9S A;  4XIC A;  2IW5 A;  3WE3 A;  1QQI A;  4LIV A;  1ZRE A;  5CVU A;  3ML6 A;  3COA C;  4C9Y A;  3E7L A;  3L09 A;  5DUI A;  4KA4 A;  4BE1 A;  3DKX A;  3DCF A;  4L9J A;  4PSX A;  1I5Z A;  1JJ6 C;  3CDH A;  2QSG X;  3GF2 A;  4BKX A;  1Z6T A;  3H0G J;  3K10 A;  1YG2 A;  1UG2 A;  2I8D A;  1X1P A;  5HVQ C;  3DF8 A;  4BY7 J;  1U78 A;  1XDU A;  3RKW A;  3Q5F A;  1IN8 A;  1DP7 P;  4IRI A;  1K78 B;  1MGT A;  4ENM A;  3I4N J;  1LUJ B;  4RGR A;  3CDI A;  2DA6 A;  2F48 A;  3IRQ A;  2LK2 A;  1BI2 A;  4A93 J;  2RVC A;  4A3B J;  3WE2 A;  2W85 A;  3S1R J;  5GAD J;  1R1U A;  2E34 A;  3DEE A;  2ZXH A;  5GPC A;  3QOE A;  5LEJ A;  3I59 B;  1IO2 A;  3BCA A;  2NAZ A;  2IRF G;  3DPU A;  2HOE A;  2M8E A;  3JRI A;  5IT9 K;  3HZJ A;  2FML A;  5CVR A;  1X3U A;  3KEO A;  3K4B A;  4G8X A;  3REO A;  5FGM A;  4M3E A;  5IP9 J;  3W2W A;  1K78 A;  2FQ4 A;  3H5A A;  1X3W B;  3GLL A;  3N97 A;  5IYB J;  4BHP A;  2L7M P;  3B73 A;  3RSN A;  4HV6 A;  2QSF X;  3IAM 2;  5LEK A;  4CYD A;  1B9M A;  4FE4 A;  1SD6 A;  5IP6 A;  1XCV A;  3FXM A;  1QO0 D;  2CG4 A;  2NS0 A;  1WCM J;  5BPI A;  2DT7 B;  2W48 A;  4A5N A;  1VF9 A;  3O3K A;  4D7M A;  4PUS A;  1I3A A;  3F23 A;  3PQJ A;  2DK8 A;  1IV6 A;  2V9K A;  1B9N A;  3L1P A;  3JRA A;  1E3H A;  1T0F C;  5DS9 A;  4HG2 A;  2FD5 A;  3L2R A;  1JE8 A;  1VQ8 I;  1YJ9 I;  2UUZ A;  5D8L B;  1FOW A;  4LIU A;  4EM2 A;  3FIS A;  4QLC U;  2Z33 A;  3D5S C;  3LWF A;  3T8R A;  2OPT A;  1PP8 F;  4XQF A;  3EQL F;  1W0T A;  2LMD A;  3I53 A;  5EJC A;  2Q0O A;  1VFC A;  2X1D A;  1BL0 A;  3OIQ A;  2CQK A;  5KHD A;  1I27 A;  4XKB A;  3HOT A;  1LPQ A;  5EGO B;  3RI4 A;  1AKH B;  1EV7 A;  2XSJ C;  2L9V A;  2BOL A;  3GME A;  2M4G A;  3ZQL A;  1MSF C;  1XMK A;  2PMZ N;  2VBY A;  2ACJ A;  3N05 A;  4L5E A;  1ODD A;  1IJW C;  2IS6 A;  4EM1 A;  2NOG A;  2EIM H;  2RV8 A;  4G12 A;  4D7N A;  2VXZ A;  2EBI A;  3KLO A;  1MIJ A;  3M07 A;  3CLQ A;  4XLE A;  2CRG A;  1RKT A;  1XB4 A;  1MMA A;  3FK6 A;  3KP6 A;  4ITV A;  3U9G A;  2G7H A;  1G3Y A;  1FY7 A;  2M45 A;  3BG6 A;  3A2K A;  3DEW A;  4IQ4 A;  4UB8 C;  3HOU J;  4FT8 A;  3QPL A;  3T1B A;  4HLX A;  2EFP A;  3PJR A;  2L0K A;  3SZT A;  5K7H A;  2DMN A;  4NUB A;  2L02 A;  4CCL A;  2CV2 A;  1LQ1 A;  1O7L A;  3I56 I;  2NVT J;  2FBH A;  4XMY A;  2F2E A;  3ZN1 A;  1P9Q C;  3RTR A;  1Z05 A;  3WGI A;  2WWY A;  3VB2 A;  3OYE A;  3G6E I;  2COB A;  1QVT A;  2BZT A;  3CC4 I;  1MBH A;  2D1H A;  2R0Q C;  3G3Z A;  3KPH A;  3BR0 A;  5HS7 A;  2L5Q A;  2J5P A;  3KZI C;  3PNY A;  1GXP A;  1BIA A;  3ABU A;  1WFX A;  3U21 A;  3PSF A;  2GBY A;  2EPF A;  2XIG A;  1LVK A;  2L9R A;  4DYC A;  2O0Y A;  4OAZ A;  4UUT A;  4E7L A;  2CQQ A;  3GBG A;  3ZQQ A;  5J1R A;  4XOP A;  3HUG A;  2JVH A;  2K3P A;  2Z99 A;  5C4X J;  3FM3 A;  2JWT A;  3QPH A;  2BVM A;  1F36 A;  1QHH D;  4CCM A;  3E6D A;  4NQW A;  1YIJ I;  2LBF B;  2WAE A;  4IF4 A;  3CUQ A;  1Y8R B;  2V79 A;  3T8T A;  2Y0S A;  1WPK A;  1IDZ A;  4OIN F;  3VOE A;  4IKF A;  5D5V B;  2GA1 A;  3KP3 A;  3I4P A;  4XN0 A;  1OKR A;  5EEH A;  3S1M J;  5EF6 A;  1ZYR F;  5A2Q R;  2KIM A;  2F4I A;  4N4O B;  2ME6 A;  3GZ6 A;  3J80 R;  3OYL A;  5ILS A;  2EK5 A;  2OQG A;  3BZK A;  3L2V A;  4ZYH A;  4HQE A;  3QU3 A;  3A1Y A;  5J1U A;  3KLN A;  4ZTF A;  2HXI A;  3QYF A;  1S8N A;  1JTY A;  4S05 A;  3VYU B;  4G6T B;  3KP5 A;  1TQP A;  5K5O A;  1B8I A;  5FJ8 J;  1BIB A;  2FOK A;  2XAH A;  3HOW J;  3QYB A;  4UVC A;  3TGN A;  4JK1 X;  2DN0 A;  4X1E A;  3IKV A;  3I9V 2;  2V7F A;  3ZN0 A;  1P6R A;  4CHU A;  3A4C A;  3CCJ I;  3J81 Z;  5E17 F;  2JQ7 A;  5GPA A;  3TL4 X;  2X6W A;  4EJW A;  1YW8 A;  1K6O A;  4Q5S F;  3E97 A;  1RR8 C;  2LH9 A;  3K70 C;  5B1A H;  2YSR A;  4XLH A;  1OYI A;  3BLY A;  1TQM A;  1UCR A;  3LFU A;  1I50 J;  1OYY A;  1T56 A;  5TIS C;  3HRS A;  3G4S I;  4XLC A;  2ZME A;  4D0P A;  4WCG A;  2LF8 A;  1RI7 A;  4A3J J;  4NQW B;  2M7B A;  1DP3 A;  3GEZ A;  3DU5 A;  4A69 C;  4E7K A;  2P6T A;  2IGN A;  3TO6 A;  5H6R A;  2QCO A;  2WV0 A;  2HTJ A;  2XAQ A;  3PNV A;  3CCR I;  3RYR A;  2OJE D;  3DQV C;  1Y8Q B;  2ELK A;  2VIX A;  2DXI A;  2DLL A;  2HZT A;  3WU1 B;  1HCR A;  1BJZ A;  4B43 A;  2XKO A;  4EM0 B;  1D5V A;  3I58 A;  4BAC A;  3H1C A;  4U7D A;  4UVA A;  5FFZ A;  1FOY A;  4XL9 A;  1SAU A;  4UNO A;  4Z2Y A;  3A0H C;  4CDG A;  2V1D A;  4Y15 A;  1Y6I A;  4O3M A;  4II3 A;  2RGV A;  1H8A C;  4S04 A;  2LR8 A;  4AYB A;  5IOY A;  5F04 A;  4EQQ A;  1X1C A;  1YW9 A;  3HXL A;  2BY2 A;  1S7A A;  3ZMV A;  2X6X A;  3ZQ7 A;  2KRC A;  3BG3 A;  3DTK A;  1JGS A;  1FOX A;  3MEX A;  1MSE C;  5GAH J;  1BI3 A;  2OU2 A;  4XOR A;  1E0E A;  3F3X A;  3TW7 A;  5CQE A;  4YIF A;  1D0X A;  1XGO A;  2EZI A;  2DQR A;  3BG5 A;  2ZB9 A;  2VJJ A;  2M35 A;  2X85 A;  4ZTJ A;  1Z67 A;  2MZ4 A;  1BI1 A;  2GIV A;  2O8K A;  1TW3 A;  3ABK H;  3OIP A;  1FWZ A;  2E1O A;  2JZY A;  3EPZ A;  4UHT A;  4A0Z A;  3QPS A;  1MJA A;  3C7J A;  4BQA A;  6PAX A;  5FB2 A;  5LRR A;  2GOX B;  1QPI A;  2JA2 A;  2DOE A;  1N77 A;  2GLO A;  2JPB A;  1JKP C;  1FP1 D;  5EYR A;  3KZZ A;  4D1Q A;  2QA4 I;  2RKH A;  2VXD A;  3ERE D;  4I99 C;  1Z6R A;  4CO8 A;  2K9L A;  4E70 A;  3V7S A;  2K4J A;  4C3H J;  2VKD A;  1LDD A;  3F8C A;  3F72 A;  4IPA A;  2GZW A;  2HOT A;  1P4A A;  2DPU A;  4Y52 J;  3M8J A;  4KIG A;  4BQQ A;  2HNH A;  2DU9 A;  4AD9 A;  4CIC A;  2BW3 A;  5FRO A;  4I6Z A;  5D4R A;  2NVU B;  4IVN A;  3TO7 A;  2QF7 A;  1YX3 A;  3ZQI A;  1QA6 A;  3L2Q A;  3T5X A;  4XLA A;  1X58 A;  3ESW B;  1NK3 P;  4PFP A;  4A3M J;  4GFB A;  3LMM A;  3DFG A;  5FKO A;  1TT0 A;  1W5S A;  2Y2Z A;  1UB9 A;  4U0Y A;  1F5T A;  1IGN A;  3JSP A;  2VC0 A;  2EWN A;  2ETH A;  4N4N B;  5FKM A;  2H6B A;  5E3L A;  1F43 A;  2ZNZ A;  3J81 K;  1MBE A;  2ZXI A;  2A5Y B;  4IXA A;  3AG2 H;  1YO5 C;  3L7W A;  2VBW A;  4E7Z A;  2R7Z J;  3CCL I;  3V7R A;  1A35 A;  2HQN A;  3DPT A;  1XS9 A;  3RDI A;  3K69 A;  3CMA I;  1KQ9 A;  1TQI A;  3OV8 A;  1R9T J;  3BTJ A;  3BR2 A;  4RB2 C;  2FBI A;  4BDZ A;  1D0Y A;  2LKX A;  4F93 B;  5K1Y A;  1SFK A;  5EG0 A;  1KA8 A;  1EKE A;  3EUK L;  2JUG A;  2L2O A;  4XN3 A;  3OL3 A;  1IXR C;  4PFO A;  1BM9 A;  4LLL A;  1QNT A;  1WZ2 A;  1FSE A;  4YEL A;  3D1N I;  3HHH A;  3WG9 A;  3E5U A;  2DOA A;  4JOM A;  4MO7 A;  3PFY A;  2CW0 F;  3Q0U A;  2R5Y A;  4BQO A;  2XF5 A;  4UUS B;  4OIP F;  3BC8 A;  3DXJ F;  2AXL A;  2YU9 J;  3M7G A;  2OTJ I;  1MBK A;  1E2X A;  4A3I J;  3JCU C;  1HA8 A;  2Y48 A;  2JRT A;  2E1C A;  1FT9 A;  3GFL A;  4P9U A;  1LDK B;  4P9F A;  2FA5 A;  2XVC A;  4MFD A;  3B6A A;  4XOT A;  1UEL B;  3B02 A;  1MNE A;  3F8F A;  4KUM A;  2AHQ A;  3H0D A;  4AIJ A;  2RNJ A;  1ZGJ A;  2OUM A;  2MFZ A;  3S93 A;  4Y13 A;  2BY3 A;  2NNN A;  1Z7U A;  4WWC A;  2LLK A;  2DA3 A;  3FXK A;  3FF5 A;  2ZNY A;  2ZFW A;  3EUH A;  4F7Z A;  2HPI A;  1H9T A;  2HU9 A;  1D8K A;  2EB7 A;  1HQC A;  2X6Y A;  5K5Q A;  2VOP A;  2WAQ N;  2BHZ A;  4D9J A;  3MKZ A;  2NS8 A;  4BJT A;  3E6B A;  2P5L C;  3WTZ A;  3GLX A;  4RGS A;  1FJL A;  2HR3 A;  1G3W A;  2UXN A;  1SC7 A;  4KMF A;  1R6R A;  4B4C A;  5LRS A;  4I0A A;  4UUV A;  3QYE A;  2NVQ J;  2JA6 J;  1KU2 A;  4PGG A;  1H89 C;  3OYD A;  3WU0 A;  2HYG D;  2R5Z B;  3K1M A;  4DW6 A;  2XSD C;  2H94 A;  4JQF A;  1G4D A;  4KFC A;  4G7O F;  3OL4 A;  1SAX A;  2EV6 A;  4ZDO A;  1X2M A;  5KCM A;  4B3A A;  2A69 F;  4GO1 A;  3FZV A;  4RAF A;  2UXX A;  1R1T A;  5GTI C;  2LD5 A;  1U6G A;  5C3E J;  3LA7 A;  3QRF F;  2VPR A;  1TC3 C;  4EJU A;  1R1V A;  5J4V A;  2XGD A;  2Q8K A;  3TOB A;  2DA4 A;  2IT0 A;  3PO2 J;  3IH2 A;  1APL C;  2AQF A;  3J7A W;  2VJ5 A;  1FLI A;  1V5G A;  3SZP A;  1H88 C;  4HX7 A;  2MLG A;  3SZG A;  3KZY A;  2CUF A;  2HKX A;  1WQ2 A;  2L54 A;  3HG9 A;  3MMY B;  3CCM I;  4ZYG A;  4U0V A;  3KYC B;  4IHT A;  4YFX F;  3DPL C;  4YG2 F;  4OMY A;  4I2O A;  4DBR A;  3ZMS A;  1FSH A;  2K02 A;  3KYD B;  1R36 A;  2MG4 A;  2WC2 A;  2LF7 A;  5JLX A;  4DZJ A;  5LLQ A;  1RIO H;  1ZAO A;  2HQ5 A;  4PDK A;  1WHU A;  2OQR A;  4MEY F;  5J1Y A;  2XUB A;  3AAF A;  3MKY B;  4M6V A;  4HDU A;  1X3Z B;  1WSU A;  4LK1 F;  3DTE A;  2XDV A;  2JT1 A;  4P5O A;  1D8J A;  2HDW A;  1Y1W J;  2HTS A;  4ENN A;  2YX7 A;  1SFO J;  3BTC A;  1KON A;  2YX4 A;  1KQ8 A;  3EUH C;  2DOF A;  3P7N A;  4XLF A;  1Z7L A;  2IGK A;  1I1G A;  4RB3 C;  4PZJ A;  1ZRC A;  1GV5 A;  4M9X A;  5TGT A;  1N75 A;  2GXB A;  4LB6 B;  1HST A;  2FBK A;  2QYO A;  4M73 A;  2LRE A;  2GIZ A;  4N9H A;  1OLT A;  3CD6 I;  2HQR A;  3FMQ A;  3GUD A;  2E35 A;  4HA8 A;  4AIK A;  3OSG A;  1YRN A;  1PJR A;  3OYI A;  2DT5 A;  5J3L A;  2Z5U A;  1X1A A;  3CJQ B;  5E1X A;  1F1Z A;  5J40 A;  3WG7 H;  3SEQ A;  3BRO A;  3VFZ A;  5JR3 A;  3JTG A;  3SYT A;  5M5W J;  3QP5 A;  5KAI C;  1AWC A;  2HEO A;  1OFC X;  3OYB A;  2VKE A;  4XSZ F;  2DFI A;  2IS1 A;  3LSH A;  4ZC3 A;  1K7A A;  2QBY A;  4C2T A;  2LVS A;  2J5O A;  4Q48 A;  4B1R A;  1HDD C;  4A3L J;  1HKQ A;  3D5R C;  2QGU A;  5AIP A;  3V8L A;  3LNQ A;  3G2B A;  4OIO F;  2BY0 A;  2XGC A;  2A6H F;  4B09 A;  1ZR4 A;  4L0Y B;  1ETK A;  3KET A;  4ASN A;  4BS9 A;  3HKZ A;  2E5N A;  3JRB A;  1V5F A;  4F92 B;  1H0M A;  1NG7 A;  2VQL A;  2R7R A;  2B63 J;  1D5Y A;  2E7X A;  3EUA A;  1IV8 A;  4EJT A;  5HOO A;  3HIF A;  2XAJ A;  2E36 A;  4UVB A;  1SVM A;  3WU2 C;  3S17 J;  2HI3 A;  4RB0 A;  2F5D A;  4IOC F;  2GXA A;  1R7J A;  4NDL A;  2CSO A;  2FEZ A;  3DU6 A;  3C2B A;  2R93 J;  5KAF C;  1J0R A;  2IXS A;  5CVJ A;  1GT0 C;  4BEH A;  3PSI A;  1WJA A;  3GWZ A;  4A6E A;  1ETX A;  1XPX A;  2P7C B;  2VJI A;  2FMY A;  2WAQ A;  5CVI A;  2ELH A;  3RCO A;  1HKT A;  1ZH5 A;  2Y0S N;  1AOY A;  3IWZ A;  4A3D J;  2X48 A;  2DDA A;  4FIS A;  4XNF A;  4EGY A;  5J4Y A;  4YEJ A;  1XCB A;  1WKM A;  1ENH A;  2L7F P;  4V2F A;  5F08 A;  1UST A;  1QBJ A;  3ZQC A;  5E20 A;  1ITY A;  2KRF A;  1A31 A;  2RRE A;  3E5X A;  4GXO A;  4FQG A;  2ZME B;  2D2W A;  4LMY A;  2GXG A;  2QM3 A;  1O7F A;  2HOA A;  2O3F A;  1YJW I;  1XX5 A;  1YYV A;  1K6Y A;  5HOD A;  4PCQ A;  2D45 A;  4XKW A;  4LG0 A;  4CH7 A;  4LOC A;  4H4K C;  1MJB A;  1QVU A;  3CUQ C;  5K5R A;  3RJP A;  3VPR A;  4D5F A;  4BY1 J;  1DGW Y;  2G0E A;  1XSD A;  1DU0 A;  1YQA A;  4CCJ A;  2R7X A;  1KU3 A;  3K1N A;  3SEZ A;  1ZHF A;  3CJR B;  4JBA A;  1U9N A;  1MDM A;  3G73 A;  2NVX J;  2H09 A;  2D1V A;  3TBI A;  2R7O A;  3R4K A;  3LQR A;  5FKN A;  1TWG J;  3VOD A;  5JVT A;  1LKX A;  3P9K A;  1OCO H;  2W00 A;  4KT6 A;  4M3B A;  5LGN A;  2HOS A;  4FE7 A;  1KZH A;  1U8R A;  2KL4 A;  1KYZ A;  1S9H A;  3H9Q A;  3CDL A;  3HOX J;  2QZ8 A;  2CV1 A;  3S2D J;  1KU9 A;  1RR7 A;  1P4W A;  2WV1 A;  1VQM I;  2E1N A;  4BBR J;  4PJM A;  3IC7 A;  2XV4 S;  3P9I A;  1FIA A;  2UWM A;  2QWW A;  2DJN A;  2FOW A;  5FLX R;  3AG1 H;  3TDZ C;  2XGX A;  4P96 A;  2VL8 A;  3F8B A;  5JFR A;  5LHH A;  4YFN F;  5D4S A;  2E71 A;  5B1B H;  3JAM Z;  3OWT A;  3CCV I;  3PUF A;  5CKT A;  2M87 A;  1ZRD A;  5FKK A;  1GXQ A;  4HBL A;  2KKO A;  3EDP A;  3L00 A;  1B72 B;  3O2P E;  4PJN A;  2FF4 A;  4LGW A;  2A61 A;  2L9N A;  1XGM A;  3IUO A;  1DUX C;  4RA2 A;  3IH3 A;  3KP7 A;  3TP0 A;  2V1U A;  4G9Y A;  5E1Z B;  3G71 I;  4CUG A;  2PFB A;  2WAF A;  3FXQ A;  5A2Q Z;  1T2K A;  3U2R A;  3S1N J;  2NXN B;  3QQA A;  1RRJ A;  2V9V A;  2RDP A;  2K9Q A;  1FC3 A;  1RET A;  1OPC A;  4ZDP A;  2E19 A;  1J2X A;  2GOM A;  1SD4 A;  1W1W E;  3GVA A;  1E3O C;  3CQZ J;  1YI2 I;  3DKY A;  2N8G A;  2GM4 A;  4A5M A;  1D0Z A;  2E60 A;  5DM6 F;  2H1K A;  4GRI A;  3GCM A;  4JX6 A;  1MKM A;  5D5X B;  2A3S A;  2XPV A;  1TT5 B;  4HRI A;  1O3T A;  2E1M C;  1A5J A;  2R7Q A;  2FJ1 A;  4G7Z F;  3S3N A;  2TCT A;  2LY2 A;  2CJJ A;  2CQ7 A;  3QU6 A;  1LEB A;  4X6A J;  2ECB A;  3ASO H;  5E8G A;  4IL6 C;  2E7W A;  4NNJ A;  3W3C A;  1MJ9 A;  4UV9 A;  5J6X A;  2VN2 A;  1J9I A;  3BG9 A;  2KT0 A;  3E6M A;  1LFB A;  2IEK A;  1BOB A;  2OF7 A;  4A3C J;  3OSF A;  5D8K B;  5DCM A;  3CCE I;  2DFE A;  2O61 A;  4IJA A;  3NWS A;  3CF2 A;  1X1B A;  4RM3 A;  2HYF A;  4QTR A;  1ZN2 A;  3MWM A;  3RKX A;  1Z3X A;  1K83 J;  1FYL A;  4L18 B;  2DPD A;  2M30 A;  3CCY A;  1QZE A;  1FEX A;  4XK4 A;  4NHJ A;  3WTS C;  1E17 A;  4PJL A;  1UZC A;  3H3Z A;  4FHT A;  2V1N A;  4BE0 A;  5JI6 A;  5D6E A;  3ERM A;  3A52 A;  3GTJ J;  4IHV A;  2JA7 J;  3ECH A;  2CV0 A;  3SFZ A;  1P7I A;  3IV5 A;  3WHB A;  1Y0U A;  1BOA A;  3ABM H; 
#chains in the Genus database with same CATH homology
 1FBU A;  1G3S A;  2C6Y A;  4I7H A;  2HGC A;  3QP6 A;  4I01 A;  1QGP A;  5IT3 A;  1P92 A;  2IA1 A;  4LB5 A;  2ADU A;  2B0L A;  3BZ6 A;  1HW5 A;  2L4M A;  4I02 A;  1HSJ A;  3LQQ A;  3WGG A;  1TW2 A;  1B6A A;  4I98 B;  2CWE A;  2RN7 A;  5FD6 A;  5DCM B;  2ISY A;  2PQ8 A;  2ISZ A;  4KN4 X;  4HOB A;  5H6Q A;  3FMR A;  5F1R A;  5DD8 A;  3QPT A;  5BPD A;  4A6D A;  3NQO A;  2FNP A;  2L3D A;  4OOI A;  1PP7 U;  4HQM A;  4M74 A;  2ZO4 A;  1B4A A;  4RAZ A;  1FP2 A;  5A2Q K;  5L3G A;  1CF7 B;  2JSC A;  4DNC A;  4HF2 A;  5J8C A;  5FD5 A;  3PQK A;  2RC4 A;  1H9G A;  1FOK A;  2AS5 F;  1EH6 A;  2R7F A;  2VC1 A;  4MTE A;  1SFX A;  2VT3 A;  3W6J B;  1HW2 A;  2LKP A;  4I0B A;  4RS8 A;  4ESJ A;  2QQ9 A;  4M72 A;  4RB1 A;  2VOO A;  3BDD A;  3LFK A;  3RIR A;  3WGH A;  2P8T A;  4O5V A;  1S7O A;  4P55 A;  2DQL A;  2Y0M A;  1KYW A;  2EA2 A;  2CYY A;  3D5L A;  5HDG A;  2P4W A;  1SMT A;  4LLN A;  2FNA A;  5DEQ A;  2Z3Y A;  4AWX B;  1SD5 A;  3QAH A;  5AON A;  2XAF A;  5D6F A;  4BAY A;  4CXF A;  1U5T A;  3BJA A;  1I6X A;  1IN4 A;  4LFU A;  4ON0 A;  3KE2 A;  4NB5 A;  4A0X A;  4G6D A;  3HRT A;  2VOD A;  4MQ9 F;  2EA4 A;  3MZH A;  4OU0 A;  4BNC A;  3NRV A;  1KQ0 A;  4IRG A;  2PMH A;  3BJO A;  1Z9C A;  3LA3 A;  3V7C A;  2KJC A;  3WTY C;  1ON2 A;  2K7L A;  3TOA A;  4U0W A;  4ESF A;  3MZY A;  2PMU A;  3GXO A;  1IRF A;  2HKO A;  5BMZ A;  4R1H A;  1G3T A;  4LJZ F;  2NYX A;  1BI0 A;  2EFQ A;  1U5T C;  4N9I A;  5HS8 A;  3JW4 A;  3FHZ A;  2ZJ2 A;  1DPU A;  5DYM A;  5F64 A;  2K27 A;  2LNB A;  3E3V A;  3I71 A;  5FLX Z;  1O3Q A;  1WRJ A;  1OR7 A;  5D5W B;  1RUN A;  2JPC A;  4Q47 A;  1T38 A;  5LHI A;  1OMI A;  2IVM A;  2XHK A;  4EVI A;  1FX7 A;  2F5F A;  4AVP A;  3Q9S A;  1STZ A;  5DUK A;  3V4G A;  1BC7 C;  4RAY A;  1HXD A;  4LK0 F;  5AIQ A;  4CGZ A;  5DV5 A;  5BQT A;  2ZCW A;  1YS6 A;  4ZYE A;  3K1P A;  3M1E A;  1P2F A;  1ZRF A;  3K2Z A;  1ZGA A;  1FYM A;  1IN7 A;  2K4B A;  1CF7 A;  2PG4 A;  4ETS A;  4M9Z A;  2GWR A;  1S29 A;  1ZLJ A;  1J59 A;  4MGR A;  1IUY A;  3T0Y A;  1USS A;  2M5W A;  2CO5 A;  1FPQ A;  2FU4 A;  1ONV A;  3I0T A;  1WWX A;  3R6S A;  5H20 A;  5TJJ A;  5L3D A;  3HSR A;  2FQ3 A;  3H3U A;  1F9N A;  1R22 A;  2UZK A;  2QEN A;  1P4X A;  3TO9 A;  2XRO A;  2R7D A;  1S3J A;  1J5Y A;  2X4H A;  2OZ6 A;  2PBI A;  4ENK A;  3CJN A;  2XAS A;  1F4K A;  1LDJ A;  2OBP A;  5ICE A;  1V3F A;  4KT5 C;  1XN7 A;  1J7K A;  3WTU C;  2FXA A;  2KIF A;  4EJV A;  4TV7 A;  2HS5 A;  2YPR A;  3VEP A;  2MH2 A;  1LEA A;  2DO7 A;  1MDM B;  3IHU A;  1MZB A;  3ZPL A;  5IT9 Z;  3EYI A;  1BN5 A;  5F6F A;  1DPR A;  2LSO A;  1T39 A;  2HFH A;  2KJB A;  2XKP A;  1QPM A;  2DAO A;  3RPU A;  1TBX A;  3IL2 A;  2H6C A;  3NEU A;  4KYW A;  4MTD A;  5CVV A;  1QZZ A;  4HV5 A;  5ICC A;  2GQQ A;  2MLK A;  3OOP A;  3HOS A;  1RUO A;  2EJR A;  1LNW A;  3I54 A;  3GW2 A;  3LST A;  2H27 A;  4HLY A;  1A04 A;  2O03 A;  3W6K B;  2VBZ A;  4HF0 A;  2DBB A;  3BPX A;  4HX8 A;  1IZ1 A;  5CLS A;  2BE5 F;  2BV6 A;  4KIF A;  5L3E A;  3L9F A;  3Q9V A;  4G6Q A;  2PLY A;  2ZKZ A;  2A68 F;  5D5U B;  4ESB A;  1BBY A;  4KIB A;  2LDU A;  3GO5 A;  1RNL A;  3ISP A;  2MBF A;  1SMY F;  1ZG5 A;  2JTV A;  5L3B A;  2F5C A;  5KK1 A;  2HDC A;  4K2E A;  1UHW A;  2QUF A;  3R0J A;  4M6X A;  3CO6 C;  3E6C C;  1DDN A;  2KIU A;  3H92 A;  2YR2 A;  1XD7 A;  4GCV A;  4XLP F;  1YFH A;  4IRH A;  1U2W A;  2Q2E A;  1PDN C;  1UFM A;  4MHG A;  2MD5 A;  3ULQ B;  2DTR A;  3FWE A;  4EMS A;  3RKY A;  1LB2 A;  3FM5 A;  4HDV A;  1RZ4 A;  2PN6 A;  4LG0 B;  4WXC A;  1XMA A;  2EFN A;  2QQB A;  3SHF A;  5BS6 A;  4ZYD A;  2P5V A;  2PJP A;  3IWF A;  3S2W A;  4RGX A;  4O6J A;  1XSX A;  4YII A;  3I59 A;  5FLX K;  2PEX A;  4EGZ A;  5HS9 A;  4KDP A;  1T6S A;  5J8F A;  1KU7 A;  2VBX A;  3RYP A;  4DQ2 A;  3GYH X;  4MQV A;  4U88 A;  4WXD A;  4H0E A;  2IA2 A;  4B8X A;  3CO7 C;  1J75 A;  1R5H A;  1GVJ A;  3DEU A;  2STT A;  4RGU A;  4OIQ F;  3GFM A;  3I64 A;  3F21 A;  3V8J A;  3WOD F;  3ECO A;  3GX4 X;  1CGP A;  3M9A A;  1W4M A;  4KMU X;  2BBY A;  4GYI A;  3K9T A;  4UXN A;  3SQN A;  2DI3 A;  2A07 F;  1R00 A;  3J80 K;  1B59 A;  2BEO A;  4FX4 A;  5BOX A;  5ERI A;  1IF1 A;  5L3F A;  3F6O A;  1OYW A;  2K86 A;  2EFO A;  2PI0 A;  4KNY A;  2COM A;  1FYK A;  2G7U A;  3JSO A;  4HF1 A;  1XSV A;  3LA2 A;  2R3S A;  2X0L A;  5ICG A;  3E5Q A;  2WTE A;  1S6L A;  3FXU A;  1JXS A;  3BJ6 A;  3JAM K;  3MAJ A;  2W57 A;  1YTY A;  4ZZL A;  3KCC A;  4BHC A;  2V6C A;  2L01 A;  1FZP B;  2YU3 A;  3P9C A;  3KP2 A;  2W25 A;  5L3C A;  3CLO A;  1Z91 A;  5HDN A;  2Z9O A;  2NRA C;  2ESH A;  3ABT A;  1IXS B;  4A12 A;  1ZLK A;  4G94 A;  1O3R A;  2DK5 A;  1EH8 A;  2OAZ A;  4L9T A;  1G6N A;  1XGS A;  3CUO A;  3JTH A;  3WTT C;  5LBQ A;  3HTS B;  2P6S A;  2VON A;  1TTY A;  3PFI A;  2ESN A;  4ENJ A;  1FBS A;  2BYV E;  4HYE A;  2TDX A;  4QWQ A;  4BXU A;  2FRH A;  1W7P B;  4MEX F;  3ZP5 A;  5LGT A;  2DW4 A;  1IN5 A;  2A6E F;  1BJA A;  4IHS A;  3D0S A;  1FNN A;  3GFI A;  3BPV A;  2QVO A;  3HRU A;  3HTU A;  2OA4 A;  2W24 A;  3HHG A;  2OD5 A;  3HSF A;  1TNT A;  1IXC A;  3M8F A;  4BH9 A;  3C1D A;  5LHG A;  1GHC A;  1YS7 A;  1D3Y A;  3CUQ B;  2G9W A;  4L9N A;  4XBF A;  2GA2 A;  3N4M A;  3EYY A;  1T98 A;  1V4R A;  4XSX F;  4M6Y A;  4I09 A;  3HYI A;  2Y75 A;  3GFJ A;  2ZBK A;  5FFX A;  1UHM A;  2BGC A;  3C3W A;  1LJ9 A;  5HLH A;  2F5E A;  2IP2 A;  5ICF A;  1VTN C;  3WTX C;  1W5T A;  2EFW A;  4PGH A;  4U7B A;  3F22 A;  4HAM A;  2GAU A;  4EJO A;  4KN7 X;  5E1W A;  5CJ9 A;  1ON1 A;  2NNY A;  4HX4 A;  4Q4Z F;  1YLF A;  2W84 A;  5JHU A;  2VE8 A;  4HZF A;  4M71 A;  5DDG A;  1JHH A;  4EV0 A;  4BHB A;  2IJL A;  2FSW A;  2P5K A;  4A0Y A;  3MQ0 A;  1IRG A;  3L2C A;  1T0F A;  1SD7 A;  1B1B A;  2M1B A;  4WXH A;  2RQP A;  5DD4 A;  1K79 A;  4ZZD A;  5HDK A;  1R5G A;  5LGU A;  1FBQ A;  3CTA A;  3HSE A;  1YIO A;  2QQA A;  4L9V A;  5HLI A;  1LVA A;  3BP8 A;  4GYG A;  4L5J A;  4L0Z B;  4N0B A;  5ED4 A;  4MNU A;  2MA3 A;  1ZG1 A;  2STW A;  1PUE E;  3V8K A;  4UV8 A;  3R0A A;  1ULY A;  2P7V B;  3R60 A;  3QOP A;  4Y17 A;  1ZAR A;  1O57 A;  3J80 Z;  2QLZ A;  2L4A A;  1MD0 A;  2O8X A;  2O6G E;  2OZU A;  3RPQ A;  3ROU A;  1L0O C;  1YW7 A;  4WK8 F;  2V1X A;  4ZH4 F;  1IW7 F;  2EV0 A;  1SFU A;  4R79 A;  3F6V A;  4XRF A;  4WF2 A;  3MCZ A;  1U5T B;  1REP C;  4BYY A;  3ZMT A;  3ZMZ A;  3FMS A;  2VT2 A;  3KEQ A;  2MH9 A;  3TKY A;  4XLN F;  1R23 A;  5DCF A;  3K0L A;  3GZ5 A;  3FXR A;  5KVR A;  1U3E M;  3O6B B;  1TLH B;  4GGG A;  2ZXJ A;  1W7P A;  3F8N A;  3EET A;  4FX0 A;  3FX3 A;  3I5U A;  3ZMU A;  2CFX A;  1HKS A;  5ILV A;  1L3L A;  3DV8 A;  1QZY A;  1HBX G;  5E18 F;  3LAP A;  3LAJ A;  1EH7 A;  3HRM A;  3BWG A;  3IRR A;  2VE9 A;  3MFK A;  1Z1D A;  2CGP A;  4HW0 A;  4YFK F;  3C18 A;  4L5I A;  4LLG F;  5TRD A;  4A2U A;  1IN6 A;  2IPQ X;  3R61 A;  3DP7 A;  4R8H A;  3DKW A;  3U1D A;  3KP4 A;  2IA0 A;  2QBY B;  5EEG A;  3ELK A;  3M8E A;  4LD5 A;  3BOQ A;  3SXY A;  1NHA A;  1IAW A;  2XAG A;  3WTV C;  1XGN A;  3TQN A;  3IKT A;  4OIR F;  3F8M A;  5E8I A;  3BY6 A;  1Q1H A;  3ZMD A;  2MC3 A;  2EV5 A;  5HLG A;  1W7P D;  1SFE A;  3WTW C;  3J7A O;  1R58 A;  1XDS A;  2HWV A;  1BC8 C;  1ZG3 A;  5ILU A;  1O3S A;  5CYV A;  2XRN A;  5FO5 A;  3TDU C;  3KFW X;  1JHF A;  1TNS A;  1KGS A;  1HW1 A;  4AIH A;  1I1S A;  4G7H F;  1C0W A;  4WX9 A;  2FE3 A;  4CZZ A;  4OMZ A;  4KIC A;  1WI9 A;  4M9S A;  2IW5 A;  3WE3 A;  1QQI A;  1ZRE A;  5CVU A;  3ML6 A;  3COA C;  4KA4 A;  3L09 A;  5DUI A;  4L9J A;  1I5Z A;  3CDH A;  3GF2 A;  1Z6T A;  1YG2 A;  5HVQ C;  3DF8 A;  1U78 A;  1XDU A;  3RKW A;  3Q5F A;  1IN8 A;  1DP7 P;  4IRI A;  1K78 B;  1MGT A;  4ENM A;  4RGR A;  3IRQ A;  1BI2 A;  2RVC A;  3WE2 A;  2W85 A;  1R1U A;  5LEJ A;  3I59 B;  2NAZ A;  2IRF G;  2HOE A;  2M8E A;  5IT9 K;  2FML A;  5CVR A;  1X3U A;  3KEO A;  4G8X A;  3REO A;  1K78 A;  5FGM A;  3N97 A;  4BHP A;  3B73 A;  4HV6 A;  5LEK A;  4CYD A;  1B9M A;  1SD6 A;  1XCV A;  1QO0 D;  2CG4 A;  2NS0 A;  5BPI A;  4A5N A;  3O3K A;  3F23 A;  3PQJ A;  2DK8 A;  1B9N A;  1JE8 A;  5D8L B;  4EM2 A;  4QLC U;  2Z33 A;  3LWF A;  3T8R A;  1PP8 F;  3EQL F;  3I53 A;  2Q0O A;  2CQK A;  1I27 A;  3HOT A;  3RI4 A;  1EV7 A;  1XMK A;  2VBY A;  2ACJ A;  1ODD A;  4EM1 A;  2RV8 A;  2VXZ A;  3KLO A;  1XB4 A;  3U9G A;  3KP6 A;  2G7H A;  1G3Y A;  1FY7 A;  2M45 A;  4FT8 A;  3T1B A;  4HLX A;  2EFP A;  3SZT A;  2L02 A;  1LQ1 A;  1O7L A;  2FBH A;  2F2E A;  3ZN1 A;  3RTR A;  1Z05 A;  3WGI A;  2WWY A;  3VB2 A;  2D1H A;  3G3Z A;  5HS7 A;  2J5P A;  1GXP A;  1BIA A;  3ABU A;  2XIG A;  2O0Y A;  3HUG A;  2Z99 A;  3FM3 A;  3QPH A;  3E6D A;  4NQW A;  4IF4 A;  3CUQ A;  2V79 A;  3T8T A;  4OIN F;  3VOE A;  5D5V B;  2GA1 A;  3KP3 A;  3I4P A;  1OKR A;  5EEH A;  1ZYR F;  2KIM A;  3GZ6 A;  5ILS A;  2EK5 A;  2OQG A;  4ZYH A;  4HQE A;  3QU3 A;  3KLN A;  1S8N A;  4S05 A;  3KP5 A;  1TQP A;  5K5O A;  1BIB A;  2FOK A;  2XAH A;  4UVC A;  3TGN A;  4JK1 X;  3IKV A;  3ZN0 A;  1P6R A;  4CHU A;  3J81 Z;  5E17 F;  4EJW A;  1YW8 A;  1K6O A;  4Q5S F;  3E97 A;  2YSR A;  1OYI A;  1TQM A;  1UCR A;  1OYY A;  3HRS A;  2ZME A;  4D0P A;  4WCG A;  2LF8 A;  1RI7 A;  3GEZ A;  2P6T A;  3TO6 A;  5H6R A;  2WV0 A;  2HTJ A;  2XAQ A;  3RYR A;  3DQV C;  2DLL A;  2HZT A;  3WU1 B;  2XKO A;  4EM0 B;  1D5V A;  3I58 A;  4U7D A;  4UVA A;  5FFZ A;  4UNO A;  4Z2Y A;  4CDG A;  2V1D A;  4Y15 A;  4O3M A;  2RGV A;  4S04 A;  4EQQ A;  1YW9 A;  1S7A A;  3ZMV A;  3ZQ7 A;  1JGS A;  3MEX A;  1BI3 A;  2OU2 A;  3F3X A;  4YIF A;  1XGO A;  2DQR A;  1BI1 A;  2GIV A;  1TW3 A;  1FWZ A;  2JZY A;  4UHT A;  4A0Z A;  1MJA A;  3C7J A;  4BQA A;  6PAX A;  5FB2 A;  5LRR A;  2JPB A;  1FP1 D;  3KZZ A;  2RKH A;  3ERE D;  1Z6R A;  4CO8 A;  4E70 A;  3V7S A;  2K4J A;  1LDD A;  3F8C A;  3F72 A;  4IPA A;  2GZW A;  1P4A A;  2DPU A;  4KIG A;  2DU9 A;  4AD9 A;  4CIC A;  5D4R A;  4IVN A;  3TO7 A;  3T5X A;  3DFG A;  1W5S A;  1UB9 A;  4U0Y A;  1F5T A;  3JSP A;  2VC0 A;  2EWN A;  2ETH A;  2H6B A;  2ZNZ A;  3J81 K;  4IXA A;  2A5Y B;  1YO5 C;  3L7W A;  2VBW A;  3V7R A;  2HQN A;  3DPT A;  3RDI A;  3K69 A;  1KQ9 A;  1TQI A;  3OV8 A;  4RB2 C;  2FBI A;  5K1Y A;  1KA8 A;  1IXR C;  4LLL A;  1BM9 A;  1QNT A;  1FSE A;  3HHH A;  3WG9 A;  3E5U A;  2CW0 F;  4OIP F;  3DXJ F;  2AXL A;  3M7G A;  1E2X A;  2Y48 A;  2JRT A;  2E1C A;  1FT9 A;  3GFL A;  4P9U A;  1LDK B;  4P9F A;  2FA5 A;  2XVC A;  3B02 A;  3F8F A;  4KUM A;  4AIJ A;  2RNJ A;  1ZGJ A;  4Y13 A;  2NNN A;  1Z7U A;  4WWC A;  3FF5 A;  2ZNY A;  2ZFW A;  3EUH A;  4F7Z A;  1H9T A;  1D8K A;  2EB7 A;  1HQC A;  5K5Q A;  2VOP A;  3E6B A;  2P5L C;  3WTZ A;  3GLX A;  4RGS A;  2HR3 A;  1G3W A;  2UXN A;  4KMF A;  5LRS A;  4I0A A;  4UUV A;  1KU2 A;  4PGG A;  3WU0 A;  2HYG D;  3K1M A;  4G7O F;  2H94 A;  4JQF A;  1G4D A;  4KFC A;  1SAX A;  2EV6 A;  2A69 F;  4GO1 A;  3FZV A;  2UXX A;  1R1T A;  1U6G A;  3LA7 A;  3QRF F;  4EJU A;  1R1V A;  2Q8K A;  3TOB A;  2IT0 A;  1FLI A;  3SZP A;  4HX7 A;  2MLG A;  3KZY A;  2HKX A;  1WQ2 A;  2L54 A;  4ZYG A;  4U0V A;  4IHT A;  4OMY A;  4YFX F;  3DPL C;  4YG2 F;  4I2O A;  1FSH A;  3ZMS A;  2K02 A;  1R36 A;  2LF7 A;  2WC2 A;  5LLQ A;  1RIO H;  1ZAO A;  4PDK A;  2OQR A;  4MEY F;  2XUB A;  3AAF A;  4HDU A;  1WSU A;  4LK1 F;  2JT1 A;  4P5O A;  1D8J A;  2HTS A;  4ENN A;  2YX7 A;  2YX4 A;  1KQ8 A;  3P7N A;  1I1G A;  4RB3 C;  4PZJ A;  1ZRC A;  4M9X A;  2GXB A;  4LB6 B;  1HST A;  2FBK A;  2QYO A;  4M73 A;  4N9H A;  2HQR A;  3FMQ A;  3GUD A;  4HA8 A;  4AIK A;  2DT5 A;  2Z5U A;  5E1X A;  1F1Z A;  5JR3 A;  3BRO A;  3VFZ A;  3JTG A;  2HEO A;  1AWC A;  3QP5 A;  4XSZ F;  2DFI A;  1K7A A;  2QBY A;  2J5O A;  4Q48 A;  1HKQ A;  3V8L A;  5AIP A;  4OIO F;  4B09 A;  2A6H F;  4L0Y B;  3KET A;  4ASN A;  1H0M A;  2E7X A;  4EJT A;  5HOO A;  3HIF A;  2XAJ A;  4UVB A;  4RB0 A;  2F5D A;  1R7J A;  2CSO A;  2FEZ A;  1J0R A;  5CVJ A;  4A6E A;  3GWZ A;  2P7C B;  2FMY A;  5CVI A;  2ELH A;  1HKT A;  1ZH5 A;  1AOY A;  3IWZ A;  4EGY A;  1XCB A;  1WKM A;  1UST A;  1QBJ A;  5E20 A;  2KRF A;  3E5X A;  4GXO A;  2D2W A;  2ZME B;  4LMY A;  2GXG A;  2QM3 A;  1O7F A;  2O3F A;  1YYV A;  4PCQ A;  2D45 A;  4LG0 A;  1MJB A;  3CUQ C;  5K5R A;  3RJP A;  1XSD A;  1YQA A;  1KU3 A;  3K1N A;  1ZHF A;  4JBA A;  1MDM A;  3G73 A;  2H09 A;  2D1V A;  3R4K A;  3LQR A;  3VOD A;  5JVT A;  3P9K A;  5LGN A;  1U8R A;  1KYZ A;  2QZ8 A;  1KU9 A;  1P4W A;  2E1N A;  3IC7 A;  2XV4 S;  3P9I A;  2UWM A;  2QWW A;  3TDZ C;  2XGX A;  4P96 A;  3F8B A;  5JFR A;  5LHH A;  4YFN F;  5D4S A;  3JAM Z;  2M87 A;  1ZRD A;  1GXQ A;  4HBL A;  2KKO A;  3EDP A;  3L00 A;  3O2P E;  2FF4 A;  4LGW A;  2A61 A;  1XGM A;  1DUX C;  3KP7 A;  2V1U A;  4G9Y A;  5E1Z B;  2PFB A;  3FXQ A;  5A2Q Z;  1T2K A;  3U2R A;  2V9V A;  2RDP A;  1FC3 A;  1OPC A;  1J2X A;  1SD4 A;  3GVA A;  4A5M A;  1MKM A;  5D5X B;  2A3S A;  1O3T A;  4G7Z F;  3QU6 A;  1LEB A;  5E8G A;  2E7W A;  1MJ9 A;  4UV9 A;  5J6X A;  2VN2 A;  1J9I A;  3E6M A;  5D8K B;  5DCM A;  2O61 A;  4IJA A;  2HYF A;  1ZN2 A;  3MWM A;  3RKX A;  1FYL A;  4L18 B;  2DPD A;  2M30 A;  4NHJ A;  3WTS C;  1E17 A;  3H3Z A;  4FHT A;  5JI6 A;  5D6E A;  3ECH A;  3SFZ A;  1Y0U A;  1BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...