3R60A

Structure of the mntr fe2+ complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
b'PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 51
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r60A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3r60A02
2L02A 3K9TA 3FXQA 1TW3A 3F21A 5E20A 3V7RA 4CXFA 3GFJA 1O7FA 3LFKA 1U2WA 4U7DA 5JR3A 2DU9A 1BJAA 3HTUA 3DKWA 4ZYDA 3H92A 3IKTA 2P5KA 3HUGA 3O2PE 4LK1F 4A0ZA 4S04A 2FBHA 5DDGA 2YU3A 5L3EA 2K02A 2D2WA 3U9GA 2R7FA 4O3MA 1KQ9A 2TDXA 4L0YB 1KU7A 3NQOA 1P92A 1XDSA 4G7HF 1ZREA 3E3VA 3ZPLA 1ZYRF 1BC8C 1HQCA 4MEXF 4MTDA 5LEKA 1TBXA 1U5TB 2XAHA 4EV0A 4ZZLA 3G3ZA 3QU3A 3IRRA 1NHAA 2CWEA 1JXSA 2M87A 3FXRA 3V7CA 2OQGA 3QAHA 1G3SA 1XSXA 1HKSA 1Z91A 3EQLF 2X4HA 1XGSA 4FX4A 2KIUA 2OZUA 4LB5A 2VBWA 2LF7A 1O7LA 5JFRA 3LSTA 5EEGA 4EM1A 2FBKA 5IT9Z 4BHBA 2VOPA 2J5OA 5ICEA 3L7WA 3VODA 3VFZA 2E7WA 3R61A 2W84A 1H9GA 1Y0UA 2NAZA 3RIRA 4BH9A 2ESHA 5LRRA 2PFBA 2DTRA 5EEHA 3CTAA 1BI0A 1K78A 5ILUA 3ML6A 4MGRA 2VE9A 3P9KA 2EFPA 5CVJA 3REOA 3L00A 3KP3A 2NS0A 2XAFA 1BM9A 2Q8KA 3ZMSA 2FMYA 1Z05A 4ON0A 1WWXA 2ELHA 4PDKA 3MWMA 1KYWA 3LWFA 4KUMA 3I59B 4IVNA 2UZKA 5ICCA 2GXGA 2V9VA 3C1DA 5BQTA 3WODF 1O3QA 4CICA 3RI4A 2QBYB 2W24A 1H9TA 5TRDA 1G4DA 4ZZDA 2VT3A 2Z9OA 2Z3YA 4G9YA 5JHUA 4KIBA 3F8FA 3JTGA 3RPUA 4ENKA 1LDDA 2GA2A 3L2CA 3R4KA 1JHFA 3CDHA 1YFHA 1OYYA 4UVAA 4IXAA 3W6KB 4ENJA 1IF1A 4KNYA 2HEOA 3TO6A 2PBIA 1T2KA 4L5JA 1RIOH 3EYYA 3RTRA 2PJPA 3K1MA 2A3SA 3E6MA 4FX0A 4ETSA 2HYFA 5D5UB 3BPVA 4L18B 1MJAA 1B9NA 4BQAA 4I02A 1TNSA 4Y15A 5CVRA 3GXOA 4EJOA 3R0AA 4HF2A 4RGRA 2VXZA 2RV8A 5L3CA 4RGSA 1I6XA 5LRSA 1DPRA 4EVIA 1Z7UA 1PUEE 1SMYF 3F8NA 1EH7A 2EV5A 3PQKA 3F8BA 4HA8A 2Y48A 1J0RA 5K1YA 4BHPA 1FC3A 5LGTA 4RGXA 5IT3A 1HXDA 1ZG5A 5JVTA 3T8TA 1IN8A 3FX3A 3ABUA 1KA8A 1RZ4A 2Q2EA 2FBIA 1ZG3A 2DT5A 3TQNA 2YR2A 3D5LA 3HRTA 2WTEA 2VN2A 4ZYHA 3MCZA 1XGNA 4QWQA 1I1SA 2D45A 2L4AA 2KRFA 1FBQA 3R6SA 2HKOA 2O3FA 3JAMZ 1EH8A 4QLCU 2QUFA 2A68F 5DD4A 2P5LC 2EFNA 4EM2A 2L54A 2ZNYA 4RB1A 1FNNA 1KQ8A 2QVOA 4XSXF 4NHJA 2CYYA 3IRQA 3S2WA 3AAFA 1K79A 5HOOA 4P5OA 2K4JA 1ZLJA 4M71A 3N97A 5D4RA 2BE5F 2MLGA 5HS8A 4OIQF 2B0LA 3LAJA 1IW7F 1J9IA 1YQAA 4YFNF 4M9XA 4LD5A 4YFXF 2IJLA 3KE2A 3O3KA 4JBAA 4IHTA 3L09A 1ZAOA 1S29A 4XSZF 2CG4A 3SZPA 3DPTA 3HHGA 5ILSA 3V8KA 5FD6A 1W4MA 1XCVA 5E8IA 4HQEA 5KVRA 3F8MA 4BXUA 4A2UA 2BYVE 1B9MA 1HKQA 2A07F 3OOPA 4MQVA 3WE3A 5K5QA 3B73A 1TQIA 3KEOA 4Q5SF 1J7KA 1BI3A 2F5FA 4YIIA 3ZMVA 3B02A 2DPDA 2Y75A 1OYWA 2FE3A 4HZFA 4HW0A 4B09A 3BROA 4R8HA 2IRFG 5FO5A 2FA5A 1L0OC 1SMTA 3KP2A 3KP6A 3IWZA 1XMAA 4L9VA 2D1HA 2PN6A 3C7JA 2EV6A 4EGYA 1LNWA 4HLYA 1QO0D 3P7NA 3I71A 1YW7A 1ZRFA 4EJUA 2M8EA 5DCMA 1DDNA 1I27A 5LEJA 1TNTA 1Q1HA 4BAYA 3GEZA 2IT0A 4KYWA 3TOAA 2P4WA 1RI7A 1W7PD 3EETA 2M1BA 1E2XA 1ZGAA 3VOEA 2PLYA 4ZH4F 1W5SA 3HTSB 1XSDA 1R23A 2O8XA 4JK1X 3BZ6A 2XIGA 1EH6A 2XHKA 1W7PA 2VBXA 1QQIA 3R0JA 4HX8A 4HYEA 3WTTC 4EJWA 1VTNC 3ZMTA 2J5PA 4EM0B 1QZZA 2VC0A 1R58A 1FPQA 2ZNZA 1K78B 1R22A 2STTA 2QYOA 3C18A 1FWZA 3HYIA 3GZ5A 2E1CA 1QNTA 2FXAA 2L4MA 2FRHA 3SQNA 1T0FA 3CJNA 3VEPA 4LG0A 2LDUA 2A5YB 5FD5A 3EDPA 1UB9A 4NB5A 2HWVA 3V8JA 4AVPA 3M9AA 4BYYA 2G9WA 4UVBA 1ZLKA 2R7DA 2DK8A 2FNPA 3FZVA 2LF8A 4HV6A 3ULQB 3SZTA 2CW0F 2MBFA 4A12A 3BJ6A 4A5MA 4UUVA 4ASNA 5D5VB 2QZ8A 5D8LB 5LGUA 5DUIA 3KFWX 3Q9VA 2EWNA 3DQVC 5E1ZB 2XAQA 2HQNA 4FT8A 3ERED 1JE8A 1REPC 4HX7A 4XRFA 4D0PA 1IN6A 1T39A 5FGMA 5D4SA 1IXCA 1R1TA 4G6DA 2FQ3A 3DFGA 3MEXA 2XASA 5DV5A 4G94A 5LHGA 4G6QA 2CQKA 2V1DA 2STWA 3RKWA 1SFXA 4L5IA 4WXHA 4MQ9F 4E70A 2K4BA 1IXSB 2JPBA 3CUQC 4N9IA 5ILVA 4XBFA 1FT9A 4MNUA 3I5UA 1R1VA 2HYGD 4WK8F 3JSOA 1LB2A 2QLZA 5J8CA 1P4XA 2PMUA 3FWEA 4R79A 1RNLA 1GXQA 3M7GA 1IN7A 3WTSC 3E5QA 1P4AA 1D3YA 3IKVA 2P6SA 3T5XA 2QM3A 5DUKA 2HTJA 3BDDA 2LNBA 3H3ZA 3JAMK 2W25A 5BOXA 2VOOA 3HSRA 4YG2F 4KA4A 1MJBA 2O0YA 3W6JB 1FSEA 3TO9A 3ZN0A 2ETHA 4U0VA 1SFUA 2LKPA 2MLKA 2RN7A 2QWWA 5DCFA 3BJAA 2IPQX 4BNCA 3FMSA 3WG9A 2RKHA 2QQAA 1U3EM 3FHZA 1O3RA 4KFCA 4UVCA 5H6RA 4L0ZB 1I5ZA 3GFIA 2YPRA 4LMYA 1W5TA 1J2XA 2K7LA 2NNYA 1RUOA 4B8XA 1S8NA 1ZHFA 1UFMA 1HBXG 3I53A 4M74A 3K1NA 3WTZA 3I64A 1HW5A 4WXDA 1MDMA 2MA3A 1WI9A 3GWZA 4RB0A 4AIHA 1U6GA 3E6BA 3SFZA 1J75A 2ZXJA 3J80K 1XGMA 1B4AA 1OR7A 2XV4S 4M9SA 3HHHA 5FFZA 1MJ9A 1D5VA 2HGCA 5D6FA 3T1BA 4IRGA 4NQWA 5K5RA 3U2RA 3ZQ7A 4U7BA 1ON1A 3ECHA 1ZH5A 1F1ZA 2YSRA 4F7ZA 3TGNA 2BV6A 1QGPA 3ELKA 3CUQA 2ZCWA 1AWCA 4P55A 2OU2A 4I09A 4I0BA 2CFXA 3HSEA 4LGWA 5DCMB 4A0YA 4I98B 3DF8A 2HS5A 1O57A 4ZYGA 2BGCA 3E6CC 3TOBA 5ED4A 1SD6A 3KZZA 4KN4X 3F22A 3FXUA 5CVUA 4YFKF 1G3YA 1IN5A 3F6OA 3WTWC 2KIMA 3WGHA 4CYDA 3RDIA 4I2OA 3R60A 4M6YA 1W7PB 2MC3A 4HF0A 3F23A 4EJTA 2RGVA 1USSA 2EFQA 2XUBA 5HLIA 3CO6C 5J8FA 2RC4A 1A04A 4GXOA 3QRFF 5AIQA 4WF2A 1KGSA 3KP7A 2HQRA 3K2ZA 4G8XA 5ERIA 2WC2A 3Q9SA 1DP7P 4UXNA 2ZMEA 4LFUA 3M8EA 3GW2A 4UHTA 4EQQA 2MH2A 4OU0A 4LG0B 4G7ZF 2AS5F 1ZARA 4HBLA 3WTUC 1FBUA 1LVAA 4AWXB 2G7UA 4L9TA 2A6EF 3BPXA 1P2FA 4HOBA 2H6CA 1R5GA 2Q0OA 1YS7A 5D6EA 3I4PA 1T38A 1IAWA 3MZHA 4M73A 3M1EA 1FBSA 1KYZA 3NRVA 1BC7C 4HAMA 4IRIA 4Q48A 4OINF 4KICA 1SD7A 2P5VA 1OMIA 3HRMA 2P8TA 3HOTA 2Z5UA 3SHFA 3KP5A 2X0LA 2FU4A 2KIFA 2OBPA 2EA4A 4MEYF 4YIFA 2RVCA 1FYKA 3WU0A 3LA3A 2KKOA 2EFWA 3ROUA 4CHUA 4IPAA 1QBJA 5FFXA 4UNOA 2E7XA 3GYHX 5E17F 1R7JA 3TDUC 5H6QA 2PMHA 2M45A 3J80Z 3QP5A 3U1DA 1I1GA 3EUHA 5BMZA 2RQPA 1R00A 4IF4A 4JQFA 5CVIA 3TDZC 3GO5A 1X3UA 3G73A 2F5CA 2NNNA 1Z6TA 1HW1A 1O3TA 1P6RA 3I0TA 3ZN1A 1DUXC 2HR3A 1BIBA 4AIKA 2L01A 2HTSA 1YTYA 1SAXA 2GXBA 2O03A 4BHCA 4P9UA 2F5DA 1FP2A 4AIJA 3OV8A 3E6DA 2G7HA 2WWYA 5DD8A 3BOQA 5F6FA 3V7SA 3GVAA 3J81K 5E1WA 4S05A 4WWCA 3I58A 2OAZA 3KCCA 3HRUA 1ONVA 2YX4A 1S7AA 3BY6A 1R5HA 2QQBA 2CO5A 1PP8F 3DXJF 5AONA 2DI3A 1DPUA 1LEAA 4O5VA 1HW2A 3WGIA 2C6YA 4A0XA 4OMYA 3JSPA 2Y0MA 1CF7A 1TW2A 2UWMA 2MH9A 4RS8A 2V79A 2H6BA 1TQMA 3O6BB 2GWRA 2A69F 5CYVA 1OKRA 2NRAC 4ZYEA 2VBYA 1ZRCA 2EFOA 4TV7A 4O6JA 1KU9A 4UV9A 3RJPA 5FLXZ 1LDJA 4I0AA 5L3FA 1GVJA 4ENNA 1STZA 5E18F 2DK5A 3GLXA 1UHWA 2JTVA 1MDMB 3PFIA 4KIFA 2DPUA 1F4KA 2H09A 2FNAA 2E1NA 2ISZA 2FF4A 5A2QK 2A61A 3ABTA 4OIRF 2JPCA 1WQ2A 1B6AA 4GGGA 4L9NA 4ENMA 2Z33A 3V8LA 5FB2A 3M8FA 5HDGA 4ESJA 5DEQA 2DQLA 1J59A 1EV7A 5L3BA 1J5YA 4H0EA 1QPMA 4GO1A 1TTYA 5HS7A 5BPDA 3BWGA 3CUQB 2ACJA 1Z1DA 1RUNA 2XVCA 2W85A 4MTEA 3DPLC 2K86A 2FSWA 1FZPB 3JW4A 4U0WA 1S6LA 1WRJA 5F1RA 2PG4A 2BBYA 1S7OA 1FOKA 5HLGA 2JT1A 1F9NA 1BIAA 2O6GE 3E5UA 1B59A 4OOIA 4MHGA 3F8CA 1SD5A 1KQ0A 3ISPA 4HV5A 2DO7A 2QQ9A 4N9HA 4OMZA 1UCRA 2FEZA 1G6NA 4LLLA 1IRFA 2XKPA 1Z6RA 2HFHA 2EV0A 3COAC 3CO7C 4L9JA 2OZ6A 1MGTA 3J81Z 1IUYA 5TJJA 3GZ6A 2ZMEB 2JSCA 2D1VA 1HSTA 4Q4ZF 1R1UA 2IW5A 2RNJA 4OIOF 3WTVC 3F72A 2H94A 1YS6A 5D5XB 1FX7A 1Z9CA 2EB7A 3Q5FA 2HKXA 1AOYA 5HDKA 4PZJA 2JZYA 1BI2A 2P7CB 3QP6A 2VC1A 4N0BA 2IA2A 2IA0A 1FSHA 1V4RA 4LLGF 2XKOA 2UXNA 1IN4A 4HLXA 1D8KA 3N4MA 4I01A 5J6XA 1U5TC 4M9ZA 2VODA 1D8JA 1LDKB 2ZBKA 2F5EA 5LGNA 3RKYA 1XN7A 5LLQA 3CLOA 2GA1A 3HOSA 1CGPA 3LA2A 3P9CA 3WE2A 1XGOA 2XAJA 2DQRA 3ZMUA 4WXCA 5A2QZ 3D0SA 4KDPA 1ON2A 4A6DA 4PCQA 3T8RA 1KU2A 1R36A 2HOEA 4GYIA 4KT5C 1MZBA 3NEUA 1SD4A 1LQ1A 2BEOA 3RPQA 3FMQA 1LEBA 4K2EA 1IRGA 3LQQA 3DV8A 1MKMA 1OPCA 2OD5A 1E17A 4P9FA 3K1PA 4R1HA 3KP4A 4Z2YA 1QZYA 3RYRA 3WU1B 2R3SA 1H0MA 3PQJA 4Y17A 2F2EA 2CGPA 4LB6B 4ESBA 1K6OA 5D5WB 2GIVA 2VBZA 1XSVA 2ISYA 4RB2C 2GZWA 2EA2A 3MAJA 1XDUA 1K7AA 3WGGA 1ZG1A 1YG2A 2DBBA 2L3DA 1MD0A 3VB2A 2HDCA 5AIPA 4U0YA 1UHMA 3LA7A 2IA1A 4PGHA 1XB4A 2K27A 3KLOA 3MQ0A 1U8RA 4A5NA 3RYPA 2IP2A 1PDNC 3QU6A 5HLHA 1CF7B 4WCGA 5K5OA 3FF5A 5HS9A 4IRHA 1U78A 3E5XA 3IWFA 3LQRA 3J7AO 3IC7A 4RB3C 1HSJA 4KN7X 4LK0F 3P9IA 1IXRC 5FLXK 4OIPF 3V4GA 3K0LA 4U88A 3GFMA 3JTHA 4KMFA 1U5TA 3SXYA 1YYVA 1V3FA 3ZMZA 4HF1A 4PGGA 5L3GA 4CO8A 1BN5A 1T98A 3H3UA 2W57A 2ZJ2A 2PI0A 3I54A 3KZYA 4KMUX 3F6VA 2EJRA 4EGZA 4A6EA 3HRSA 5H20A 2XGXA 1TQPA 4DQ2A 1ZGJA 5LHIA 1O3SA 3E97A 1GXPA 3DEUA 4P96A 3ZP5A 2ZKZA 2ADUA 3ZMDA 4ESFA 1L3LA 4M6XA 1USTA 2ZFWA 1XMKA 2LSOA 3QPHA 2OA4A 2Z99A 3GFLA 1FY7A 1T6SA 2YX7A 3KETA 2COMA 2DW4A 5E8GA 2HZTA 2M5WA 1G3WA 4Y13A 3EYIA 4G7OF 3WTXC 3F3XA 1C0WA 5ICFA 4CDGA 1PP7U 4HDVA 4IJAA 4UV8A 5F64A 2VE8A 3I59A 4RGUA 1WKMA 1ODDA 5BPIA 1OYIA 2JRTA 4HQMA 5JI6A 3WTYC 4LLNA 2CSOA 2QBYA 1YLFA 4HDUA 3MFKA 2V6CA 1XCBA 3CUOA 2O61A 1ULYA 3KEQA 1HKTA 2QENA 4WX9A 4KIGA 4GCVA 4Q47A 3BP8A 3FM3A 4GYGA 2WV0A 3L9FA 1ZRDA 2H27A 5LBQA 4RAYA 4RAZA 1XD7A 3T0YA 2FMLA 2AXLA 3DP7A 5BS6A 2PQ8A 1FLIA 2XROA 2M30A 5HVQC 5KK1A 1BBYA 3TO7A 5D8KB 4HX4A 2XRNA 2DLLA 1LJ9A 3BJOA 2ESNA 3RKXA 3C3WA 3GX4X 3ECOA 2XAGA 5HDNA 1YIOA 1S3JA 2DAOA 6PAXA 4EJVA 2V1XA 2FOKA 4LJZF 2UXXA 2V1UA 3MZYA 1FYMA 5IT9K 1GHCA 2VONA 4IHSA 1B1BA 2IVMA 1P4WA 2RDPA 3HSFA 4CZZA 2EK5A 3FM5A 3GF2A 3IL2A 3TKYA 2MD5A 2P6TA 4XLPF 2GAUA 3LAPA 4XLNF 2OQRA 2GQQA 4EMSA 1YW8A 5CVVA 3QPTA 4I7HA 4FHTA 3GUDA 1IZ1A 2PEXA 1G3TA 1SFEA 3K69A 3HIFA 4CGZA 5L3DA 3KLNA 1FP1D 2VT2A 3FMRA 5DYMA 1BOAA 2DFIA 5CJ9A 1KU3A 1BI1A 2KJBA 4DNCA 1WSUA 2KJCA 4AD9A 4M72A 2NYXA 3QOPA 5E1XA 2A6HF 1TLHB 5LHHA 1JHHA 1YW9A 2P7VB 1YO5C 5CLSA 3IHUA 1JGSA 1FYLA 1ZN2A 2ZO4A 5ICGA 1F5TA
chains in the Genus database with same CATH superfamily
2L02A 3K9TA 3FXQA 4X6AJ 1TW3A 3B6AA 4OAYA 2D5VA 5IT9R 2RQQA 4BKXA 2DFHA 3ZQQA 3F21A 4B44A 5E20A 3V7RA 4MIMA 1ETVA 5EZGA 2FD5A 4CXFA 3GFJA 1O7FA 4ABZA 3LFKA 1U2WA 1SFOJ 2HU9A 4U7DA 1SVOA 5JR3A 4PSWA 2DU9A 2BOLA 2E2HJ 2CQNA 2KRCA 2VB6A 2LC2A 3KPHA 1BJAA 3HTUA 3DKWA 4OWRB 4ZYDA 3S15J 3H92A 3IKTA 2P5KA 3HUGA 3O2PE 4LK1F 3NARA 4A0ZA 4S04A 3HOVJ 1D0ZA 4F91B 3H0DA 2FBHA 5DDGA 1K6YA 2YU3A 2LK2A 3K10A 4BL0B 5L3EA 2K02A 2D2WA 2MGQA 3U9GA 2R7FA 4O3MA 1KQ9A 3RSNA 2TDXA 4L0YB 1KU7A 5J1UA 3NQOA 1MMNA 3SDBA 1P92A 1XDSA 3LSJA 4G7HF 1ZREA 1PYVA 3E3VA 2NOJB 3ZPLA 1ZYRF 1BC8C 2X51A 3WG7H 1HQCA 4MEXF 3BG6A 3OYJA 4MTDA 3VYTB 5LEKA 1TBXA 1WJBA 5M3MJ 2ZSIB 4S0HB 2ID6A 3FK7A 3BT9A 3L2QA 1U5TB 4F55A 2XAHA 4EV0A 2WAEA 1AA7A 3JR9A 4ZZLA 3G3ZA 3HEFA 2HVQA 3QODA 1UELB 3QU3A 3IRRA 4IHVA 3Q0VA 1HC8A 4ITVA 4CH7A 1JKPC 1NHAA 2CWEA 2DA2A 1JXSA 1OCTC 2CW7A 2DOEA 4HEA2 2M87A 3FXRA 3K7AJ 3WHCA 3V7CA 2OQGA 3QAHA 1G3SA 1JUPA 1XSXA 4XM3A 1HKSA 1Z91A 2WB1A 2X4HA 3ABLH 3EQLF 1XGSA 4FX4A 2KIUA 2OZUA 2H1LA 1R4MB 4LB5A 5J47A 2JA6J 2R7UA 4CCMA 5GTHC 2VBWA 2LF7A 1I6HJ 2F6CA 1WCMJ 1O7LA 1R9TJ 2V6EA 5JFRA 3LSTA 5EEGA 2E1MC 4EM1A 2FBKA 2ELKA 5IT9Z 3HPGA 3S3MA 4BHBA 2VOPA 2OTJI 2J5OA 5ICEA 3L7WA 1W0UA 3I9V2 3OS2A 3VODA 2VPLA 3VFZA 2E7WA 2IAIA 4D7MA 3R61A 2W84A 1H9GA 5EZHA 4BEHA 1Y0UA 2NAZA 3RIRA 4BH9A 2KISA 2DODA 3I4MJ 2ESHA 1BW5A 3BR1A 3DBLB 5LRRA 2DFEA 2PFBA 2DTRA 2L7MP 4GRIA 5EEHA 3CTAA 2NS7A 3F0CA 1BI0A 2FQ4A 1K78A 5ILUA 3ML6A 3DTKA 3M3YJ 4BS9A 3ZRGA 4MGRA 1MNDA 3OL4A 3P9KA 3OYNA 2VE9A 2EFPA 5CVJA 3W2WA 3O8GA 1RETA 1M1EB 3REOA 3L00A 3KP3A 2NS0A 1TWHJ 2XAFA 3JREA 1BM9A 2Q8KA 3QQAA 2BXZA 3ZMSA 2FMYA 2XF6A 4LITA 1YJ9I 2YU9J 1VQ6I 1Z05A 3SFIA 3CC7I 1AHDP 3BG3A 3BTCA 4ON0A 5LD2C 1WWXA 2ELHA 4A3GJ 4PDKA 3MWMA 4HSRA 1KYWA 2OJED 3ZGKA 3LWFA 2R7OA 4KUMA 2Z2SB 4XN0A 3I59B 4IVNA 2UZKA 2Y0SA 5ICCA 2GXGA 2V9VA 3C1DA 3WODF 5BQTA 1O3QA 2DXIA 4CICA 2LREA 3RI4A 3G71I 4B3AA 2CUFA 4RM2A 2QBYB 3MVPA 3HB9A 2W24A 3PNTA 2WV1A 1H9TA 5TRDA 1WJ5A 1G4DA 4ZZDA 2VT3A 2Z9OA 2E19A 2Z3YA 2KPMA 5C4JJ 4G9YA 2EZKA 5JHUA 4KIBA 2LTPA 3F8FA 3JTGA 3RPUA 4ENKA 1LDDA 4E7HA 4M6VA 4YRVA 3L1PA 2UV1A 4PK4A 1S5LC 2GA2A 3L2CA 3R4KA 1JHFA 3AL0B 3CDHA 1VFCA 4QPQA 1YFHA 1OYYA 4UVAA 4IXAA 2JA7J 3W6KB 4ENJA 2A6TA 1T8IA 1IF1A 4XORA 4KNYA 3GTOJ 2HEOA 4IOCF 3TO6A 3PO2J 4JP0A 5E3NA 2PBIA 1T2KA 4L5JA 2K9QA 4XN3A 1RIOH 2L5QA 3S1MJ 3EYYA 3CMMA 3RTRA 2X9DA 2CMPA 3HZJA 2PJPA 3ASOH 3K1MA 1QVUA 2A3SA 3E6MA 3NWTA 2E34A 4FX0A 3H35A 1IV6A 4ETSA 2HYFA 5D5UB 3IP4B 3BPVA 4L18B 1MJAA 1VQLI 4XLEA 3K2AA 1B9NA 4BQAA 4I02A 2JA8J 3CJTB 1TNSA 2VQGA 4MO7A 4Y15A 5CVRA 4IQJA 3GXOA 4EJOA 2QEXI 2O5RA 1MMDA 2A05A 3R0AA 4MLOA 3ZCOA 4HF2A 1VQMI 5HNHA 4RGRA 2VXZA 4A3LJ 5B66C 2R7RA 2P0WA 2RV8A 5F0FA 4A3KJ 3AL0C 5L3CA 3S1QJ 4RAGA 3OYMA 1S9HA 4RGSA 1I6XA 5LRSA 2E5NA 1DPRA 4HRIA 4EVIA 1Z7UA 2R7QA 1PUEE 2IS4A 2OUMA 1SMYF 3F8NA 1EH7A 2VUMJ 2EV5A 4HG2A 3PQKA 3F8BA 2XC7A 1S7EA 4HA8A 3GTGJ 4AUXA 2Y48A 4IX7A 1J0RA 5K1YA 2LY9A 4BHPA 3DEWA 1FC3A 2DYSH 5LGTA 4RGXA 2IGOA 2ZJQF 1N78A 4CCNA 4ANJA 2M4GA 5IT3A 4D1QA 1HXDA 1ZG5A 1RR8C 2P0TA 1OJLA 5JVTA 1TT5B 3A52A 3T8TA 3QYEA 3OYFA 2MG4A 2Z16A 5CQEA 1IN8A 3BR3A 2ZJPF 3G1OA 4BACA 3FX3A 3ABUA 1A31A 1KA8A 1RZ4A 2Q2EA 2FBIA 1ZG3A 2DT5A 3CP2A 3TQNA 2WY7Q 2YR2A 3D5LA 3HRTA 2X48A 4CCOA 2WTEA 4E7SA 2VN2A 1NK2P 4ZYHA 1MBKA 3MCZA 4L5EA 1XGNA 1H89C 2AHQA 1FOXA 4XKVA 1G2HA 4QWQA 4F93B 1I1SA 2D45A 2L4AA 4AM3A 2KRFA 1OCRH 4BE1A 1FBQA 3R6SA 2HKOA 2O3FA 3JAMZ 2GOXB 1VQ8I 1EH8A 4QLCU 4E7ZA 2QUFA 1OCOH 2A68F 5DD4A 4C2TA 1WHUA 1AKHB 2X6YA 2MUNA 2EZLA 2P5LC 2EFNA 2KQRA 2DN0A 4EM2A 2L54A 1G59A 2ZNYA 4RB1A 2KRHA 4ZDLA 1FNNA 1KQ8A 3A2KA 2DT6A 2QVOA 4XSXF 4NHJA 3DBRB 2CYYA 3IRQA 3S2WA 5JHFA 3AAFA 1K79A 5HOOA 4W97A 2CV2A 4BQOA 3FKIJ 4P5OA 2L2OA 4Z6YA 2K4JA 1ZLJA 3GTJJ 2OCCH 4M71A 2DJIA 3N97A 1Y1WJ 1HLVA 1R71A 3DWLE 1W1WE 5D4RA 2BE5F 2LFBA 2MLGA 1X4OA 5HS8A 4OIQF 4B47A 2B0LA 2QCOA 3LAJA 1IW7F 3CMYA 1J9IA 3FXOA 1YQAA 3IAS2 2MD0A 4YFNF 4XICA 1T0FC 4M9XA 1MBGA 1FOWA 1V54H 2L7FP 4LD5A 1A6QA 4PFOA 4YFXF 2IJLA 3KE2A 5C4XJ 1A6IA 2I8DA 2DA5A 3O3KA 4JBAA 1WFXA 2QF7A 4IHTA 2M35A 3L09A 1VZ0A 1ZAOA 2R7VA 1S29A 3E1SA 1X1PA 2CRGA 1XPXA 2KLOA 1U9OA 4XSZF 5J3LA 3JRHA 2CG4A 2ID3A 1IDYA 2WAQA 3BTLA 5DTDA 3SZPA 2IEKA 3DPTA 3HHGA 4FE4A 5ILSA 3V8KA 5FD6A 4PUSA 1W4MA 3CCRI 4J19A 1XCVA 2ZXHA 2EBIA 3S8PA 5E8IA 4HQEA 3HUGB 3MKYB 5KVRA 3FISA 2PMZN 4A3BJ 3F8MA 4BXUA 3VYUB 2LY1A 4A2UA 4XR6A 4CYCA 1D1BA 3PNYA 2BYVE 1B9MA 1HKQA 4UY8I 2MZ4A 1MMGA 1QU3A 3J7YJ 2A07F 2M34A 3RQ4A 1VQOI 3OOPA 4MQVA 5HNFA 3WE3A 5K5QA 3B73A 3CCQI 1TQIA 2LMDA 2XPVA 3KEOA 4Q5SF 1J7KA 1BI3A 2F5FA 2EPFA 2V9PA 2JWTA 4YIIA 4BQNA 3ZMVA 3B02A 2DPDA 2Y75A 1OYWA 3IH3A 3DKXA 2FE3A 4HZFA 2K9NA 4HW0A 4KJZA 4B09A 3GBGA 3BROA 4IHWA 4MFEA 2BY3A 4A69C 4I76A 4R8HA 4AC0A 2IRFG 5FO5A 2FA5A 1L0OC 3AFHA 1SMTA 3KP2A 1QZEA 3K70C 2JVHA 4BQQA 3KP6A 3IWZA 1E3HA 3CCEI 1XMAA 4L9VA 2D1HA 2PN6A 5B5EC 1IUFA 3OSGA 2BHZA 3C7JA 1PJRA 2EV6A 4EGYA 1O4XA 1LNWA 3TW7A 4HLYA 1NK3P 2B9SA 4XNFA 1QO0D 2BY2A 2W7NA 3RCOA 1RRJA 3P7NA 3I71A 1YW7A 4NBQA 1ZRFA 4EJUA 2M8EA 5DCMA 3GTLJ 1DDNA 1I27A 2QSGX 5LEJA 1TNTA 3S16J 3OIPA 1Q1HA 4BAYA 3GEZA 2IT0A 3RKQA 4KYWA 4LG3A 3TOAA 1FJLA 2P4WA 5TGTA 3K4NA 1ZQ3P 1RI7A 2HVSA 1W7PD 3EETA 3LSIA 2M1BA 3NWSA 1E2XA 1ZGAA 3VOEA 2PLYA 2V1NA 4ZH4F 1W5SA 4HNVA 2XRLA 2LLKA 3CJRB 3CQZJ 3HTSB 1XSDA 1R23A 3H9QA 3AG2H 2O8XA 4JK1X 5EDNA 1D5YA 3BZ6A 2XIGA 1EH6A 3H3VK 2XHKA 5DM7F 1W7PA 2VBXA 3CF2A 4BEHB 1X1BA 2DA6A 5FJ8J 1QQIA 3R0JA 4HX8A 4HYEA 1RR7A 4XK4A 4EJWA 2IGNA 3WTTC 3A03A 3PSIA 1VTNC 3ZMTA 4A3IJ 1ETXA 2GIZA 1JJ6C 2J5PA 2JSPA 3NAUA 3G4SI 4EM0B 1SAUA 1QZZA 2VC0A 3TP3A 1R58A 1FPQA 3K6GA 2ZNZA 1OFCX 3A0HC 4F3QA 1BR1A 1K78B 1R22A 4V2FA 2STTA 1LFUP 2QYOA 3C18A 4HNTA 2K3FA 1FWZA 3HYIA 4IO9F 3GZ5A 3P5JA 4A3FJ 2BY1A 2E1CA 1QNTA 2VQLA 2XPUA 1Z0XA 5F08A 2FXAA 2L4MA 2FRHA 3SQNA 3H0GJ 1ETQA 2HDWA 3QYBA 1T0FA 4XL9A 2H8RA 3CJNA 1WJCA 1X1CA 4DBRA 3VEPA 4LG0A 2LDUA 4CA0A 2L0KA 2A5YB 5FD5A 3EDPA 2I5UA 1JJ8C 1UB9A 4NNJA 4NB5A 4AYBA 2HWVA 3V8JA 4B48A 1S72I 3Q0WA 4AVPA 1GVDA 3M9AA 4BGDA 1B72A 2XSJC 4BYYA 2G9WA 4UVBA 3PUFA 2MVTA 1ZLKA 2R7DA 2HZDA 2IS2A 2DK8A 2FNPA 4A3EJ 3JRFA 3FZVA 2Y30A 3WU2C 3CMEI 3I4NJ 1OCCH 2LF8A 4HV6A 3ULQB 3I55I 3SZTA 2F4OB 2CW0F 3HC7A 2MBFA 3TBIA 4A12A 1QRYA 3BJ6A 1QHHD 4A5MA 4UUVA 4ASNA 1ORKA 3B6CA 5D5VB 2QZ8A 1I50J 5D8LB 3UKGA 5LGUA 5DUIA 1GUUA 3RZOJ 3K70D 1A35A 1YIJI 1D1AA 3KFWX 3Q9VA 2R7ZJ 3LSPA 4KITB 2EWNA 3SYTA 3DQVC 4ZDOA 2L9SA 5E1ZB 2XAQA 2HQNA 4FT8A 3ERED 5HLTA 1JE8A 4X0GA 3ZXSA 4DYRA 3KEYA 1REPC 1E0EA 4HX7A 4XRFA 2XF7A 4N4OB 4D0PA 1IN6A 3D1NI 1T39A 3Q0UA 1WJEA 2DTZA 5FGMA 4JX5A 3FIWA 1WH5A 5D4SA 4XIDA 3JRCA 1IXCA 1R1TA 3JRBA 2EZIA 1EJ9A 3IUOA 1P9QC 3SEZA 1GV5A 4B4CA 4E7KA 3S1RJ 1F43A 4G6DA 1UHSA 4A93J 5DM6F 2FQ3A 3DFGA 3MEXA 2XASA 5DV5A 4G94A 5LHGA 1JT0A 4G6QA 1R5ID 2CQKA 2V1DA 1X3WB 2V9KA 2STWA 1T33A 3RKWA 1XC5A 1EA3A 4HNUA 3IAM2 1ETWA 2LKXA 2DFFA 3F9KA 1SFXA 4IZZA 3DLLF 3J7AW 3KIOA 3BZKA 4L5IA 1DQUA 4WXHA 2CV1A 2XB5A 4MQ9F 3TMOA 4E70A 2K4BA 1IXSB 2JPBA 4LIUA 3CUQC 4FE7A 4N9IA 2E60A 5ILVA 4XBFA 2KP6A 5B1BH 1FT9A 2VJ4A 1RESA 4MNUA 2DJNA 2V4JC 2E1MB 3I5UA 3CCYA 2H1KA 1R1VA 2VKHA 5FRNA 4DGWB 4KT6A 2QKLB 4PJLA 2HYGD 4WK8F 4PJMA 4QPOA 3DEEA 2JN6A 3JSOA 1LB2A 2HVRA 2QLZA 5J8CA 2NVTJ 5E3MA 2Q2EB 1JTYA 2NXNB 3FBNB 3CESA 1P4XA 2PMUA 3FWEA 4R79A 4C3JJ 1RNLA 1GXQA 1UMQA 3HOYJ 3M8JA 3M7GA 2X1DA 1TWAJ 1IN7A 4XRSA 3WTSC 3E5QA 1P4AA 1D3YA 3IKVA 2OV7A 2P6SA 4LOCA 5M5WJ 3T5XA 1RQ6A 1U9NA 4M3BA 2QM3A 2LRDA 5DUKA 1HA8A 2HTJA 3BDDA 2LNBA 2W4SA 3H3ZA 3JAMK 2W25A 1Z67A 4W1UA 5BOXA 5IYBJ 2VOOA 3HSRA 4YG2F 2CJJA 4KA4A 1MJBA 2O0YA 3HOXJ 3W6JB 3MKZA 5EGOA 4UUTA 4BJ5C 4M3DA 1FSEA 3TO9A 3ZN0A 2ETHA 3L2RA 4U0VA 2Y2ZA 4PJNA 2LKPA 2MLKA 2RN7A 1SFUA 1ACIA 5M5XJ 2QWWA 1Y39A 3CDLA 1JKQC 5DCFA 3BJAA 1X2MA 4IL6C 4E4HA 3I3LA 3OIQA 2ICWG 2HI3A 2K3PA 4J01A 4BE2A 2CV0A 2IPQX 2ZMEC 4PSXA 4BNCA 3LSGA 3FMSA 3PNVA 4IKFA 2XSDC 2KDZA 3WG9A 1K4SA 2RKHA 2QQAA 1U3EM 2XDVA 3FHZA 1O3RA 4KFCA 2I10A 4UVCA 5H6RA 1BJZA 4L0ZB 1I5ZA 3AKZA 1X19A 4J00A 3OYAA 3GFIA 2YPRA 3OIOA 1W5TA 1J2XA 4LMYA 5K7HA 1ZR4A 1K61A 2K7LA 4EEFG 2NNYA 1P7JA 1RUOA 2CW8A 4B8XA 5EF6A 1S8NA 1ZHFA 1UFMA 3VSLA 1HBXG 3I53A 5E3OA 1J09A 2MSYA 1ETKA 5FKMA 4M74A 3K1NA 3WTZA 3I64A 5IOYA 1R49A 1NG6A 2NVQJ 4QTRA 3ABMH 1HW5A 5IPAA 2M2EA 4WXDA 5JLWA 1MDMA 1VQ9I 4NDLA 2MA3A 1VF9A 1WI9A 3GWZA 4RB0A 4AIHA 3C2HA 2QGUA 4XQFA 1U6GA 1ENHA 3E6BA 2M9HA 1HCRA 2JMWA 5K7FA 2HXIA 3RPUD 4P1WA 4CYCB 2R5ZA 3SFZA 1J75A 4FETA 2HOTA 1KZHA 2ZXJA 5IP9J 1ZKGA 1YOVB 3J80K 1XGMA 1ERDA 1LE8A 1B4AA 1OR7A 2XV4S 4OAZA 3WHBA 4M9SA 4NC7A 3LNQA 3HHHA 1HOMA 5FFZA 3VPRA 1MSFC 1MJ9A 1D5VA 1Z77A 4D9JA 2HGCA 3SEQA 5D6FA 3T1BA 1AU7A 2XAUA 2HPIA 4EATA 4IRGA 4NQWA 5K5RA 3JAMR 3CLQA 3U2RA 3ZQ7A 1OCPA 2E36A 4U7BA 1MBJA 1ON1A 2LOOA 3ECHA 5E3LA 1MW7A 3SZGA 1ZH5A 1F1ZA 4NC6A 2LKSA 3QYFA 2YSRA 1MIJA 2AO9A 1A5JA 4F7ZA 2P81A 3TGNA 2F48A 2EIKH 2BV6A 1QGPA 3ELKA 3CUQA 3FDYA 2DT7B 1LPQA 3HOZJ 4B3XA 2ZCWA 1AWCA 4P55A 2KDOA 3OOUA 2OU2A 1Y0NA 1Z3YA 4I09A 1SC7A 2CQQA 4I0BA 5FKLA 1JUSA 4YIRX 5CQGA 2CFXA 2RNGA 2LYCA 3A1YA 2Y9YA 3HSEA 3OR1C 3HM5A 4LGWA 5DCMB 2OF7A 1VQ5I 4A0YA 4A3CJ 5KAIC 4BDYA 4I98B 3CC2I 2VXDA 3DF8A 2HS5A 1O57A 4ZYGA 1N75A 2BGCA 3TOBA 3E6CC 2LD5A 2VJ5A 1GV2A 3JCUC 2OPTA 5GADJ 3RZDJ 2HQ5A 1FMVA 1V5GA 5ED4A 1SD6A 3KZZA 3PUBA 4KN4X 1T95A 3F22A 1UAAA 3FXUA 5CVUA 2CQ7A 2JJ7A 4YFKF 1G3YA 1IN5A 3F6OA 4Y3OA 3UR3C 3WTWC 2KIMA 3WGHA 1FEXA 2G0EA 4CYDA 5GP9A 3RDIA 1XTAA 4I2OA 3R60A 4M6YA 2X6WA 1W7PB 1ITYA 2MC3A 2CQXA 1MBFA 2NVYJ 4HF0A 5B1AH 4NC8A 3F23A 4EJTA 2RGVA 1USSA 2EFQA 2XUBA 2ECCA 5HLIA 3CO6C 5J8FA 3FKJA 2RC4A 4ZTJA 1A04A 4GXOA 3QRFF 3K4CA 4RDUA 2JRMA 5AIQA 3J80R 4G12A 4WF2A 1KGSA 3KP7A 2HQRA 9ANTA 3K2ZA 4G8XA 2K85A 1IGNA 2M8GX 2K5CA 5ERIA 1W0TA 3PFYA 2WC2A 3CJQB 3Q9SA 4CSWA 2NVXJ 1DP7P 4UXNA 2ZMEA 4LFUA 2W48A 1Y56A 2OTLI 2DA4A 3M8EA 2QSHX 3GW2A 1XX5A 2NOGA 4BJTA 2Y69H 1Z7LA 4UHTA 4EQQA 3BCBA 2MH2A 1ETYA 2F4MB 4OU0A 1XMXA 4LG0B 3G1LA 1V5EA 2QSFX 4G7ZF 2AS5F 1ZARA 4HBLA 3WTUC 1FBUA 1LVAA 4I99C 4XRSG 3PIPF 4AWXB 5C44J 2G7UA 4L9TA 2A6EF 3BPXA 1P2FA 1BL0A 1D0XA 4HOBA 2H6CA 3ZQFA 1B72B 1R5GA 2Q0OA 1YS7A 2VASA 5D6EA 1SANA 3I4PA 4QSHA 3OSFA 1T38A 4LIVA 3VSKA 1IAWA 2M0CA 3MZHA 4RA2A 3HGYA 4FCYA 4M73A 3M1EA 4XRMA 1FBSA 1SVLA 2WY8Q 1KYZA 2R5YA 3NRVA 1BC7C 4HAMA 3HKZN 4IRIA 4Q48A 4OINF 4KICA 1E3OC 2V26A 1SD7A 3DU6A 4PJ0C 2P5VA 1OMIA 3HRMA 4BJ6C 2R93J 1UG0A 2P8TA 1VQ4I 3HOTA 2Z5UA 3SHFA 3K4KA 3KP5A 2X0LA 2FU4A 2KIFA 2OBPA 1X1AA 2EA4A 2MABA 1NTCA 1VQ7I 2YUSA 1MNEA 4MEYF 4YIFA 1PUFA 2RVCA 2X6XA 4NUBA 1FYKA 1DP3A 3OL3A 3WU0A 4V19K 1F36A 1LUJB 3GCMA 3CF5F 3LA3A 2KKOA 2EFWA 3M4OJ 1VQPI 3ROUA 4CHUA 1ETOA 1MMAA 3PJRA 4IPAA 2NVUB 1QBJA 4B43A 2Q1ZB 2HDDA 2ZFUA 5FFXA 4UNOA 2E7XA 3GYHX 5E17F 1R7JA 3FK6A 3TDUC 5H6QA 2PMHA 2M45A 4MFDA 1G8XA 3J80Z 2R7WA 3QP5A 3U1DA 4XKWA 2DMPA 1I1GA 4F92B 3EUHA 5BMZA 5JLXA 2KHMA 3QPSA 2RQPA 1MH4A 1UJ8A 1R00A 4IF4A 4JQFA 5CVIA 3TP0A 2L7ZA 3CC4I 3BTJA 3TDZC 3GO5A 1X3UA 3QWLA 3G73A 2F5CA 2NNNA 1Z6TA 2QQ8A 3JRIA 1HW1A 4Y33A 2EIJH 1O3TA 1CQTA 2ZB9A 4G6TB 4IQ4A 1P6RA 4XOTA 3JRAA 2HOSA 1FTZA 2EIMH 4B1RA 3I0TA 3ZN1A 1HDDC 1DUXC 4GFBA 2XPWA 2HR3A 4DOZA 3HGGA 4DIQA 1BIBA 3BCAA 4AIKA 4XONA 2CUZA 2L01A 5FKNA 2HTSA 4C3IJ 3M07A 1YTYA 1SAXA 2R0QC 2GXBA 2O03A 4BHCA 3CCLI 4P9UA 2X6OA 2F5DA 2VL8A 5M3FJ 5BNGA 1WPKA 4JX4A 2CUJA 1FP2A 2KL4A 1TC3C 4AIJA 3G6EI 3OV8A 3E6DA 2G7HA 2WWYA 1IG7A 5DD8A 3BOQA 3ZQCA 4D5FA 5F6FA 4XKBA 3V7SA 3GVAA 3J81K 5E1WA 5EEAA 4S05A 4WWCA 2L9RA 1NG7A 3S17J 2E5ZA 2OAZA 2MFZA 3I58A 2ZXWH 2W82A 3HXLA 3KCCA 1DGWY 3HRUA 1ONVA 3OWTA 2IGKA 2YX4A 2EILH 1S7AA 3BY6A 3OMYA 5GAEJ 1IRXA 1R5HA 2QQBA 1DU6A 2CO5A 3ESWB 1PP8F 3DXJF 5AONA 4Y7NJ 2WB1N 2DI3A 3G2BA 2BVLA 5EGOB 1WVRA 1DPUA 1LEAA 1ZELA 2MW8A 5GPAA 2VIXA 3EUAA 4O5VA 4ZJZA 2X98A 3H9GA 3E7LA 1WJDA 3DU5A 1HW2A 3WGIA 3D5RC 3DCFA 2C6YA 4CCKA 4IHYA 4A0XA 3G1MA 4OMYA 3PL8A 2PJRA 2ELJA 1TP4A 2Y0MA 3JSPA 1CF7A 1TW2A 2UWMA 2MH9A 4RS8A 2AQEA 2H6BA 2V79A 1MSEC 3CMAI 1TQMA 3O6BB 2GWRA 2A69F 3N05A 5CYVA 3IH4A 1OKRA 2VI6A 1Q1VA 5C3EJ 2NRAC 4BY1J 4ZYEA 4C3HJ 2KZGA 2VBYA 1ZRCA 2EFOA 4TV7A 4O6JA 5FKKA 3H1CA 2YS9A 2O8KA 2NS8A 1I3AA 1KU9A 4IOAF 4UV9A 3RJPA 1IV8A 5FLXZ 3OYGA 1LDJA 5F27A 1DGRM 4I0AA 4AVZA 5L3FA 1GVJA 5GPCA 1LFBA 1YITI 5IYCJ 3BQZA 4ENNA 2AXTC 1STZA 3TEDA 2E2IJ 5E18F 2DK5A 3GLXA 1UHWA 5KCMA 3CDIA 3CCMI 2JTVA 1MDMB 1YJNI 3PFIA 4KIFA 5EYRA 2LBFA 1FIAA 2DPUA 4RM3A 1F4KA 3D5SC 2H09A 2GLOA 2R5ZB 1OISA 2WA0A 2FNAA 2E1NA 2FJ1A 1BA5A 3CCSI 2ISZA 2FF4A 3FHNA 4JYKA 4JX6A 3MKLA 5A2QK 3FXKA 1LE8B 2Y0SN 3LSKA 3L2WA 3J81R 2A61A 1QPIA 3ABTA 4OIRF 3EPZA 2JPCA 1WGXA 5KNLA 1FOYA 4IHXA 1WQ2A 3DKYA 1B6AA 4CCJA 4GGGA 3K4JA 4L9NA 4Y4RA 2IXSA 2K40A 2Z33A 4ENMA 3V8LA 5FB2A 3M8FA 4RMNA 4NQWB 3FXLA 5HDGA 4ESJA 4ZYAA 5DEQA 2L7KA 2DQLA 2MC4A 1J59A 3S3NA 1EV7A 5L3BA 1J5YA 4H0EA 2V7FA 2VPRA 4YEJA 4UUSB 4RAFA 1V55H 2M7AA 1LKXA 4BU2A 3HL2A 1B8IA 2GBYA 2O9LA 3OR2C 2PX9A 1QPMA 3BG9A 4GO1A 2DMQA 1R6RA 1TTYA 5HS7A 2ME6A 3UNGC 5BPDA 4CCLA 3BWGA 3CUQB 4BXFA 4DW6A 2ACJA 5E79C 1BOBA 5F04A 1Z1DA 1RUNA 4AIDA 2XVCA 2W85A 4MTEA 3AG3H 4M3EA 2DDAA 2LP0A 1OR7C 3DPLC 1YJWI 2K86A 1JKRC 2FSWA 2M0MA 1FZPB 2DCEA 1TWCJ 3JW4A 4U0WA 2EZHA 1S6LA 1WRJA 2B7EA 3VDXA 5F1RA 3GMEA 4E7JA 1IRZA 2R7XA 2EINH 2HNHA 2PG4A 1UZCA 1ZGWA 2X1CA 4Y52J 1X58A 2BBYA 2DMNA 1S7OA 1OQYA 3HDDA 2PMZA 1IC8A 1FOKA 3A0BC 3L2VA 1Y8RB 5HLGA 2JT1A 1F9NA 1BIAA 3HJEA 5EG0A 2O6GE 2XF5A 3LSHA 3E5UA 3SDGA 3KYCB 1B59A 2JUCA 4OOIA 4MHGA 3F8CA 2RREA 1HDPA 1SD5A 3TW6A 2DA1A 3OYHA 1KQ0A 3ISPA 4HV5A 2JA5J 1WJFA 1XS9A 2COBA 3HOWJ 2DO7A 3LMMA 2QQ9A 4N9HA 4OMZA 4UB6C 2DMTA 4FISA 1UCRA 3BR2A 5A2QR 3BG5A 2FEZA 1JTXA 1G6NA 4LLLA 3MN2A 4C2MJ 3FBIB 1IRFA 2IBDA 2XKPA 1Z6RA 2HFHA 2EV0A 3COAC 1YX3A 3CO7C 1GT0C 4L9JA 2OZ6A 1MGTA 3J81Z 1IUYA 5TJJA 3GZ6A 2ZMEB 2JSCA 1TT0A 2D1VA 1HSTA 1TWGJ 4PJJA 4Q4ZF 1R1UA 2IW5A 2RNJA 3FXMA 4OIOF 3WTVC 4JOMA 3CCUI 1X2NA 3JRDA 2GXAA 2ZSHB 3F72A 2H94A 3K4BA 3HPHA 3I56I 1YS6A 5D5XB 4BUPA 3IV5A 4II2A 4V2GA 4C30A 3ZR8X 2XB0X 1FX7A 1Z9CA 3U21A 2FUG2 3S2HJ 2W1OA 3OYCA 5FLVA 2EB7A 5FLMJ 5J1YA 3Q5FA 2AQFA 1EKEA 1MBHA 4BBSJ 2HKXA 4KISA 2BZTA 2KIQA 1MMSA 5HDKA 1AOYA 4PZJA 2JZYA 2BW3A 1BI2A 2P7CB 3QP6A 1JT6A 2VC1A 4N0BA 2IA2A 3QOEA 2IA0A 1FSHA 2IS1A 1V4RA 4LLGF 2XKOA 2UXNA 1IN4A 1N25A 5K7ZA 3TL4X 3HG9A 2F4IA 5GAGJ 2R5YB 4HLXA 1D8KA 3N4MA 4I01A 2VQCA 2ZC2A 1ZTRA 2FX0A 4FQGA 3BZCA 5J6XA 5FKOA 1FTTA 1U5TC 4M9ZA 1ZR2A 3C2BA 5GTIC 2VODA 3S2DJ 1D8JA 1LDKB 2ZBKA 1YE9A 1NH3A 2F5EA 1SFKA 5LGNA 3RKYA 1PUFB 1XN7A 4DYQA 1T08B 3LSMA 2F5VA 5LLQA 1TWFJ 3CLOA 2GA1A 2RAEA 2XGCA 3HOSA 1CGPA 3LA2A 2KT0A 5J4YA 4II3A 3P9CA 3WE2A 1XGOA 4DBQA 2XAJA 2E1OA 2DQRA 1HF0A 3ZMUA 1OLTA 4FTHA 4WXCA 1WH7A 2M4KA 1GLNA 2WAQN 3AG1H 5A2QZ 3D0SA 3OYBA 4KDPA 1ON2A 4A6DA 1U8BA 2CS3A 1IDZA 4PCQA 4C2UA 3T8RA 3GTMJ 1KU2A 4BBRJ 1R36A 2HOEA 1X3ZB 3MD2A 2WADA 4GYIA 4KT5C 1MZBA 3NEUA 3DLAA 1SD4A 1LQ1A 4RLFA 3BQYA 2BEOA 3RPQA 3FMQA 3KZIC 1LEBA 2MYSA 3S3OA 2JVGA 4K2EA 1U0JA 3S1NJ 1LVKA 1TZLA 2IGMA 3BG7A 2QKMB 1IRGA 3LQQA 1YRNA 3DV8A 1MKMA 1OPCA 2DA3A 3JRGA 4DZJA 1WZ2A 2CUEA 3H36A 2OD5A 4UUSA 1E17A 2BVMA 4P9FA 3K1PA 4R1HA 3KP4A 3ZOBA 4XLHA 3A01A 4Z2YA 1QZYA 3RYRA 2H8WA 1W36C 3WU1B 2R3SA 1H0MA 3J7ZI 3PQJA 4Y17A 2F2EA 5H2FC 2CGPA 4LB6B 5FROA 1T56A 4ESBA 4GDFA 1K6OA 5D5WB 3EUHC 2GIVA 1K4TA 2VBZA 1XSVA 2ISYA 3BR5A 5IYDJ 1W5CC 3A4CA 4RB2C 2GZWA 1P7IA 2EA2A 2L9NA 3ONQA 3MAJA 1XDUA 2BY0A 1LFPA 3K4MA 3KYDB 4ZC3A 5GAHJ 2A5WA 3VYRB 1K7AA 1I3QJ 3WGGA 1ZG1A 1YG2A 2DBBA 4ZDPA 4D7NA 2L3DA 3Q3SA 1MD0A 3VB2A 3GTKJ 2UUZA 2HDCA 5AIPA 4U0YA 1UHMA 3LA7A 2IA1A 2DDBA 4PGHA 2Z1DA 4X1EA 3PM1A 3ASNH 2R7TA 1XB4A 3C2GA 1JI8A 2FOWA 2K27A 5JVGF 1YI2I 2EH3A 3H5NA 3S93A 3KLOA 3MQ0A 2X1EA 4N4NB 3X2QH 1U8RA 4A5NA 3RYPA 2IP2A 2PJRB 2HOAA 4A3MJ 1PDNC 3QU6A 1WJAA 5HLHA 1R4NB 1CF7B 2EQRA 1I39A 4H4KC 4M3FA 4WCGA 3OYLA 4BE0A 5K5OA 3FF5A 1H88C 5F1JA 5HS9A 3M1CA 4IRHA 1FIPA 2KFDA 3E5XA 1U78A 3S32A 3IWFA 2WBMA 3LQRA 4U87A 1BR2A 3J7AO 4AU7A 1Z21A 3IC7A 4RB3C 1HSJA 1MNMC 4E7IA 4KN7X 4LK0F 3P9IA 1IXRC 5FLXK 2KZVA 4DZPA 2ECBA 4OIPF 3V4GA 3K0LA 2K9LA 2E2JJ 4U88A 4I6ZA 3GFMA 2BXYA 3OYIA 2X85A 3JTHA 3LSRA 4KMFA 1U5TA 2VKEA 3A02A 2M3AA 3SXYA 1YYVA 1V3FA 3MMYB 3ZMZA 2ME0A 4QIWN 4HF1A 4PGGA 5L3GA 2GOMA 4CO8A 2JQ7A 2JUGA 2LBFB 3V42A 1BN5A 1VNDA 2Y31A 4ZTFA 4HPQA 2ZXIA 1T98A 4UB8C 3H3UA 2W57A 4XOPA 1QA6A 2ZJ2A 5CKTA 2TCTA 2PI0A 2E71A 4XKCA 3I54A 2JK3A 3BLYA 3KZYA 2W00A 2L9VA 4KMUX 4M3GA 3F6VA 2EJRA 4EGZA 4A6EA 4AYBN 3DPUA 1IO2A 3KX2A 3HRSA 5KAFC 5H20A 2XGXA 2OCEA 4BY7J 3RQIA 1TQPA 4DQ2A 1RC9A 2VKVA 1ZGJA 5LHIA 1O3SA 1Y1VJ 3E97A 1GDTA 5IP7J 3DEUA 1GXPA 2O7OA 4HSTA 4P96A 3ZP5A 4XMYA 2K9SA 1B8IB 1W36D 2B63J 3OYKA 2ZKZA 2ADUA 2LG4A 5IP6A 1ZK8A 3ZMDA 4ESFA 3CD6I 3KYLA 2VKDA 1L3LA 4M6XA 1USTA 3DTIA 2ZFWA 1XMKA 2LH9A 4FASD 3VWBA 4C9YA 2LSOA 2VJIA 3QPHA 2OA4A 3LFUA 1MH3A 3QPLA 2VQHA 2Z99A 3GFLA 1BR4A 1FY7A 3L2UA 1T6SA 2YX7A 3KETA 2COMA 2DW4A 5E8GA 2HZTA 2M5WA 1G3WA 2HPMA 3MZ8A 4Y13A 3H5AA 3W3CA 3EYIA 4G7OF 3J7AY 3WTXC 3F3XA 4D5CA 4XLAA 1C0WA 5ICFA 3ZQLA 4CDGA 5TISC 2DYRH 5FLXR 2R92J 1PP7U 1YX5A 4IJAA 4UV8A 5F64A 4HDVA 2R7SA 3OS0A 2VE8A 3I59A 3BTIA 4RGUA 4XLCA 5EG0B 3PSFA 1VI0A 1SEUA 1WKMA 1KONA 1ODDA 5BPIA 3LL7A 1OYIA 2JRTA 4HQMA 5JI6A 2LY2A 3WTYC 4BDZA 4DYCA 3LOCA 3W2VA 2N8GA 2XGEA 4LLNA 2CSOA 1N77A 2KMUA 2QBYA 1YLFA 4HDUA 3MFKA 3ERMA 3OYDA 5DS9A 2DOAA 2V6CA 1JUMA 1XCBA 3IH2A 3CUOA 2O61A 1ULYA 3KEQA 1HKTA 2QENA 3VYSB 4WX9A 4KIGA 1Z3XA 1EF4A 3W6VA 4GCVA 3SJMA 2DOFA 3GLLA 5J4VA 3GTPJ 3DBHB 4Q47A 1V5FA 3BP8A 3FM3A 1FMWA 2XGDA 3HBLA 5J40A 4GYGA 4XLFA 2TRTA 2WV0A 3L9FA 1ZRDA 2IS6A 1TL8A 1JGGA 3DTEA 1XG1A 2H27A 5LBQA 4RAYA 3FXJA 4RAZA 1XD7A 3T0YA 2BHYA 2FMLA 2AXLA 3DP7A 5BS6A 4F52A 2VLAA 2PQ8A 1FLIA 5EJCA 1RKWA 2XROA 2M30A 5HVQC 4PFPA 1VQKI 4BXXJ 5KK1A 3BR0A 1BBYA 3TO7A 5D8KB 4HX4A 2XRNA 2DLLA 1JKOC 1LJ9A 3BJOA 5LFAA 1WI3A 2ESNA 3RKXA 3CZ6A 2DMUA 4A3JJ 3O8HA 4DJAA 1D0YA 1OCZH 4CZCA 2CU7A 3E0JB 2BW3B 3C3WA 5B3SH 3BC8A 2CH0A 1Y8QB 3GX4X 3ECOA 3K4LA 2XAGA 5HDNA 1UG2A 1YIOA 1S3JA 2JA2A 2E35A 2DAOA 6PAXA 4EJVA 2HQAA 2V1XA 2FOKA 4LJZF 2UXXA 2V1UA 1RKTA 3MZYA 1FYMA 4IEJA 5IT9K 1DU0A 2R4GA 1D1CA 3H9JA 2LR8A 1GHCA 5CPRB 5F0HA 2VONA 4IHSA 1BW6A 2DA7A 4YELA 1B1BA 2WAFA 1POGA 5IOZA 2IVMA 1APLC 3U1KA 2ZJRF 2CFOA 1P4WA 3OS1A 1SVMA 2RDPA 3OY9A 3ZQGA 1PVEA 3HSFA 3PIOF 4CZZA 2EK5A 3ABKH 3FM5A 3BR6A 3GF2A 3IL2A 4A3DJ 3TKYA 2MD5A 5M5YJ 2P6TA 4XLPF 2K9MA 2GAUA 4CUGA 4RBOA 3LAPA 1MBEA 4XLNF 2OQRA 2GQQA 4EMSA 1YW8A 1H8AC 5CVVA 3QPTA 4I7HA 3CCVI 4FHTA 3GUDA 3S14J 1IZ1A 1QHGA 1Y6IA 5F0CA 1QVTA 2PEXA 1X4PA 1G3TA 1SFEA 3K69A 3HIFA 1YHQI 1IJWC 1E3PA 3ZQIA 4CGZA 3EUKL 5L3DA 3KLNA 5KHDA 5J1RA 1FP1D 3PO3J 2VT2A 1A36A 5IY5H 3H5RA 3FMRA 5DYMA 3GZNB 1BOAA 2DFIA 5CJ9A 1KU3A 1BI1A 1K83J 2KJBA 4DNCA 1WSUA 1AKHA 3CCJI 3AG4H 4RLQA 2KJCA 1VQNI 4AD9A 3CP8A 4E7LA 2GM4A 1YRNB 2QA4I 2Y9ZA 4M72A 4E6KG 1X1DA 2NYXA 5FRMA 3QOPA 5E1XA 2A6HF 3HKZA 2HYJA 2VJJA 1TLHB 5LHHA 3A01B 1JHHA 1YW9A 2P7VB 1YO5C 3MKWB 5CLSA 3IHUA 2HXOA 1JGSA 3OYEA 5HODA 3GTQJ 3W2AA 2OC6A 2LVSA 1RPWA 2M7BA 1FYLA 1ZN2A 2ZO4A 5ICGA 3HOUJ 1F5TA 3ZQHA
chains in the Genus database with same CATH topology
2L02A 3K9TA 3FXQA 1TW3A 3F21A 5E20A 3V7RA 4CXFA 3GFJA 1O7FA 3LFKA 1U2WA 4U7DA 5JR3A 2DU9A 1BJAA 3HTUA 3DKWA 4ZYDA 3H92A 3IKTA 2P5KA 3HUGA 3O2PE 4LK1F 4A0ZA 4S04A 2FBHA 5DDGA 2YU3A 5L3EA 2K02A 2D2WA 3U9GA 2R7FA 4O3MA 1KQ9A 2TDXA 4L0YB 1KU7A 3NQOA 1P92A 1XDSA 4G7HF 1ZREA 3E3VA 3ZPLA 1ZYRF 1BC8C 1HQCA 4MEXF 4MTDA 5LEKA 1TBXA 1U5TB 2XAHA 4EV0A 4ZZLA 3G3ZA 3QU3A 3IRRA 1NHAA 2CWEA 1JXSA 2M87A 3FXRA 3V7CA 2OQGA 3QAHA 1G3SA 1XSXA 1HKSA 1Z91A 3EQLF 2X4HA 1XGSA 4FX4A 2KIUA 2OZUA 4LB5A 2VBWA 2LF7A 1O7LA 5JFRA 3LSTA 5EEGA 4EM1A 2FBKA 5IT9Z 4BHBA 2VOPA 2J5OA 5ICEA 3L7WA 3VODA 3VFZA 2E7WA 3R61A 2W84A 1H9GA 1Y0UA 2NAZA 3RIRA 4BH9A 2ESHA 5LRRA 2PFBA 2DTRA 5EEHA 3CTAA 1BI0A 1K78A 5ILUA 3ML6A 4MGRA 2VE9A 3P9KA 2EFPA 5CVJA 3REOA 3L00A 3KP3A 2NS0A 2XAFA 1BM9A 2Q8KA 3ZMSA 2FMYA 1Z05A 4ON0A 1WWXA 2ELHA 4PDKA 3MWMA 1KYWA 3LWFA 4KUMA 3I59B 4IVNA 2UZKA 5ICCA 2GXGA 2V9VA 3C1DA 5BQTA 3WODF 1O3QA 4CICA 3RI4A 2QBYB 2W24A 1H9TA 5TRDA 1G4DA 4ZZDA 2VT3A 2Z9OA 2Z3YA 4G9YA 5JHUA 4KIBA 3F8FA 3JTGA 3RPUA 4ENKA 1LDDA 2GA2A 3L2CA 3R4KA 1JHFA 3CDHA 1YFHA 1OYYA 4UVAA 4IXAA 3W6KB 4ENJA 1IF1A 4KNYA 2HEOA 3TO6A 2PBIA 1T2KA 4L5JA 1RIOH 3EYYA 3RTRA 2PJPA 3K1MA 2A3SA 3E6MA 4FX0A 4ETSA 2HYFA 5D5UB 3BPVA 4L18B 1MJAA 1B9NA 4BQAA 4I02A 1TNSA 4Y15A 5CVRA 3GXOA 4EJOA 3R0AA 4HF2A 4RGRA 2VXZA 2RV8A 5L3CA 4RGSA 1I6XA 5LRSA 1DPRA 4EVIA 1Z7UA 1PUEE 1SMYF 3F8NA 1EH7A 2EV5A 3PQKA 3F8BA 4HA8A 2Y48A 1J0RA 5K1YA 4BHPA 1FC3A 5LGTA 4RGXA 5IT3A 1HXDA 1ZG5A 5JVTA 3T8TA 1IN8A 3FX3A 3ABUA 1KA8A 1RZ4A 2Q2EA 2FBIA 1ZG3A 2DT5A 3TQNA 2YR2A 3D5LA 3HRTA 2WTEA 2VN2A 4ZYHA 3MCZA 1XGNA 4QWQA 1I1SA 2D45A 2L4AA 2KRFA 1FBQA 3R6SA 2HKOA 2O3FA 3JAMZ 1EH8A 4QLCU 2QUFA 2A68F 5DD4A 2P5LC 2EFNA 4EM2A 2L54A 2ZNYA 4RB1A 1FNNA 1KQ8A 2QVOA 4XSXF 4NHJA 2CYYA 3IRQA 3S2WA 3AAFA 1K79A 5HOOA 4P5OA 2K4JA 1ZLJA 4M71A 3N97A 5D4RA 2BE5F 2MLGA 5HS8A 4OIQF 2B0LA 3LAJA 1IW7F 1J9IA 1YQAA 4YFNF 4M9XA 4LD5A 4YFXF 2IJLA 3KE2A 3O3KA 4JBAA 4IHTA 3L09A 1ZAOA 1S29A 4XSZF 2CG4A 3SZPA 3DPTA 3HHGA 5ILSA 3V8KA 5FD6A 1W4MA 1XCVA 5E8IA 4HQEA 5KVRA 3F8MA 4BXUA 4A2UA 2BYVE 1B9MA 1HKQA 2A07F 3OOPA 4MQVA 3WE3A 5K5QA 3B73A 1TQIA 3KEOA 4Q5SF 1J7KA 1BI3A 2F5FA 4YIIA 3ZMVA 3B02A 2DPDA 2Y75A 1OYWA 2FE3A 4HZFA 4HW0A 4B09A 3BROA 4R8HA 2IRFG 5FO5A 2FA5A 1L0OC 1SMTA 3KP2A 3KP6A 3IWZA 1XMAA 4L9VA 2D1HA 2PN6A 3C7JA 2EV6A 4EGYA 1LNWA 4HLYA 1QO0D 3P7NA 3I71A 1YW7A 1ZRFA 4EJUA 2M8EA 5DCMA 1DDNA 1I27A 5LEJA 1TNTA 1Q1HA 4BAYA 3GEZA 2IT0A 4KYWA 3TOAA 2P4WA 1RI7A 1W7PD 3EETA 2M1BA 1E2XA 1ZGAA 3VOEA 2PLYA 4ZH4F 1W5SA 3HTSB 1XSDA 1R23A 2O8XA 4JK1X 3BZ6A 2XIGA 1EH6A 2XHKA 1W7PA 2VBXA 1QQIA 3R0JA 4HX8A 4HYEA 3WTTC 4EJWA 1VTNC 3ZMTA 2J5PA 4EM0B 1QZZA 2VC0A 1R58A 1FPQA 2ZNZA 1K78B 1R22A 2STTA 2QYOA 3C18A 1FWZA 3HYIA 3GZ5A 2E1CA 1QNTA 2FXAA 2L4MA 2FRHA 3SQNA 1T0FA 3CJNA 3VEPA 4LG0A 2LDUA 2A5YB 5FD5A 3EDPA 1UB9A 4NB5A 2HWVA 3V8JA 4AVPA 3M9AA 4BYYA 2G9WA 4UVBA 1ZLKA 2R7DA 2DK8A 2FNPA 3FZVA 2LF8A 4HV6A 3ULQB 3SZTA 2CW0F 2MBFA 4A12A 3BJ6A 4A5MA 4UUVA 4ASNA 5D5VB 2QZ8A 5D8LB 5LGUA 5DUIA 3KFWX 3Q9VA 2EWNA 3DQVC 5E1ZB 2XAQA 2HQNA 4FT8A 3ERED 1JE8A 1REPC 4HX7A 4XRFA 4D0PA 1IN6A 1T39A 5FGMA 5D4SA 1IXCA 1R1TA 4G6DA 2FQ3A 3DFGA 3MEXA 2XASA 5DV5A 4G94A 5LHGA 4G6QA 2CQKA 2V1DA 2STWA 3RKWA 1SFXA 4L5IA 4WXHA 4MQ9F 4E70A 2K4BA 1IXSB 2JPBA 3CUQC 4N9IA 5ILVA 4XBFA 1FT9A 4MNUA 3I5UA 1R1VA 2HYGD 4WK8F 3JSOA 1LB2A 2QLZA 5J8CA 1P4XA 2PMUA 3FWEA 4R79A 1RNLA 1GXQA 3M7GA 1IN7A 3WTSC 3E5QA 1P4AA 1D3YA 3IKVA 2P6SA 3T5XA 2QM3A 5DUKA 2HTJA 3BDDA 2LNBA 3H3ZA 3JAMK 2W25A 5BOXA 2VOOA 3HSRA 4YG2F 4KA4A 1MJBA 2O0YA 3W6JB 1FSEA 3TO9A 3ZN0A 2ETHA 4U0VA 1SFUA 2LKPA 2MLKA 2RN7A 2QWWA 5DCFA 3BJAA 2IPQX 4BNCA 3FMSA 3WG9A 2RKHA 2QQAA 1U3EM 3FHZA 1O3RA 4KFCA 4UVCA 5H6RA 4L0ZB 1I5ZA 3GFIA 2YPRA 4LMYA 1W5TA 1J2XA 2K7LA 2NNYA 1RUOA 4B8XA 1S8NA 1ZHFA 1UFMA 1HBXG 3I53A 4M74A 3K1NA 3WTZA 3I64A 1HW5A 4WXDA 1MDMA 2MA3A 1WI9A 3GWZA 4RB0A 4AIHA 1U6GA 3E6BA 3SFZA 1J75A 2ZXJA 3J80K 1XGMA 1B4AA 1OR7A 2XV4S 4M9SA 3HHHA 5FFZA 1MJ9A 1D5VA 2HGCA 5D6FA 3T1BA 4IRGA 4NQWA 5K5RA 3U2RA 3ZQ7A 4U7BA 1ON1A 3ECHA 1ZH5A 1F1ZA 2YSRA 4F7ZA 3TGNA 2BV6A 1QGPA 3ELKA 3CUQA 2ZCWA 1AWCA 4P55A 2OU2A 4I09A 4I0BA 2CFXA 3HSEA 4LGWA 5DCMB 4A0YA 4I98B 3DF8A 2HS5A 1O57A 4ZYGA 2BGCA 3E6CC 3TOBA 5ED4A 1SD6A 3KZZA 4KN4X 3F22A 3FXUA 5CVUA 4YFKF 1G3YA 1IN5A 3F6OA 3WTWC 2KIMA 3WGHA 4CYDA 3RDIA 4I2OA 3R60A 4M6YA 1W7PB 2MC3A 4HF0A 3F23A 4EJTA 2RGVA 1USSA 2EFQA 2XUBA 5HLIA 3CO6C 5J8FA 2RC4A 1A04A 4GXOA 3QRFF 5AIQA 4WF2A 1KGSA 3KP7A 2HQRA 3K2ZA 4G8XA 5ERIA 2WC2A 3Q9SA 1DP7P 4UXNA 2ZMEA 4LFUA 3M8EA 3GW2A 4UHTA 4EQQA 2MH2A 4OU0A 4LG0B 4G7ZF 2AS5F 1ZARA 4HBLA 3WTUC 1FBUA 1LVAA 4AWXB 2G7UA 4L9TA 2A6EF 3BPXA 1P2FA 4HOBA 2H6CA 1R5GA 2Q0OA 1YS7A 5D6EA 3I4PA 1T38A 1IAWA 3MZHA 4M73A 3M1EA 1FBSA 1KYZA 3NRVA 1BC7C 4HAMA 4IRIA 4Q48A 4OINF 4KICA 1SD7A 2P5VA 1OMIA 3HRMA 2P8TA 3HOTA 2Z5UA 3SHFA 3KP5A 2X0LA 2FU4A 2KIFA 2OBPA 2EA4A 4MEYF 4YIFA 2RVCA 1FYKA 3WU0A 3LA3A 2KKOA 2EFWA 3ROUA 4CHUA 4IPAA 1QBJA 5FFXA 4UNOA 2E7XA 3GYHX 5E17F 1R7JA 3TDUC 5H6QA 2PMHA 2M45A 3J80Z 3QP5A 3U1DA 1I1GA 3EUHA 5BMZA 2RQPA 1R00A 4IF4A 4JQFA 5CVIA 3TDZC 3GO5A 1X3UA 3G73A 2F5CA 2NNNA 1Z6TA 1HW1A 1O3TA 1P6RA 3I0TA 3ZN1A 1DUXC 2HR3A 1BIBA 4AIKA 2L01A 2HTSA 1YTYA 1SAXA 2GXBA 2O03A 4BHCA 4P9UA 2F5DA 1FP2A 4AIJA 3OV8A 3E6DA 2G7HA 2WWYA 5DD8A 3BOQA 5F6FA 3V7SA 3GVAA 3J81K 5E1WA 4S05A 4WWCA 3I58A 2OAZA 3KCCA 3HRUA 1ONVA 2YX4A 1S7AA 3BY6A 1R5HA 2QQBA 2CO5A 1PP8F 3DXJF 5AONA 2DI3A 1DPUA 1LEAA 4O5VA 1HW2A 3WGIA 2C6YA 4A0XA 4OMYA 3JSPA 2Y0MA 1CF7A 1TW2A 2UWMA 2MH9A 4RS8A 2V79A 2H6BA 1TQMA 3O6BB 2GWRA 2A69F 5CYVA 1OKRA 2NRAC 4ZYEA 2VBYA 1ZRCA 2EFOA 4TV7A 4O6JA 1KU9A 4UV9A 3RJPA 5FLXZ 1LDJA 4I0AA 5L3FA 1GVJA 4ENNA 1STZA 5E18F 2DK5A 3GLXA 1UHWA 2JTVA 1MDMB 3PFIA 4KIFA 2DPUA 1F4KA 2H09A 2FNAA 2E1NA 2ISZA 2FF4A 5A2QK 2A61A 3ABTA 4OIRF 2JPCA 1WQ2A 1B6AA 4GGGA 4L9NA 4ENMA 2Z33A 3V8LA 5FB2A 3M8FA 5HDGA 4ESJA 5DEQA 2DQLA 1J59A 1EV7A 5L3BA 1J5YA 4H0EA 1QPMA 4GO1A 1TTYA 5HS7A 5BPDA 3BWGA 3CUQB 2ACJA 1Z1DA 1RUNA 2XVCA 2W85A 4MTEA 3DPLC 2K86A 2FSWA 1FZPB 3JW4A 4U0WA 1S6LA 1WRJA 5F1RA 2PG4A 2BBYA 1S7OA 1FOKA 5HLGA 2JT1A 1F9NA 1BIAA 2O6GE 3E5UA 1B59A 4OOIA 4MHGA 3F8CA 1SD5A 1KQ0A 3ISPA 4HV5A 2DO7A 2QQ9A 4N9HA 4OMZA 1UCRA 2FEZA 1G6NA 4LLLA 1IRFA 2XKPA 1Z6RA 2HFHA 2EV0A 3COAC 3CO7C 4L9JA 2OZ6A 1MGTA 3J81Z 1IUYA 5TJJA 3GZ6A 2ZMEB 2JSCA 2D1VA 1HSTA 4Q4ZF 1R1UA 2IW5A 2RNJA 4OIOF 3WTVC 3F72A 2H94A 1YS6A 5D5XB 1FX7A 1Z9CA 2EB7A 3Q5FA 2HKXA 1AOYA 5HDKA 4PZJA 2JZYA 1BI2A 2P7CB 3QP6A 2VC1A 4N0BA 2IA2A 2IA0A 1FSHA 1V4RA 4LLGF 2XKOA 2UXNA 1IN4A 4HLXA 1D8KA 3N4MA 4I01A 5J6XA 1U5TC 4M9ZA 2VODA 1D8JA 1LDKB 2ZBKA 2F5EA 5LGNA 3RKYA 1XN7A 5LLQA 3CLOA 2GA1A 3HOSA 1CGPA 3LA2A 3P9CA 3WE2A 1XGOA 2XAJA 2DQRA 3ZMUA 4WXCA 5A2QZ 3D0SA 4KDPA 1ON2A 4A6DA 4PCQA 3T8RA 1KU2A 1R36A 2HOEA 4GYIA 4KT5C 1MZBA 3NEUA 1SD4A 1LQ1A 2BEOA 3RPQA 3FMQA 1LEBA 4K2EA 1IRGA 3LQQA 3DV8A 1MKMA 1OPCA 2OD5A 1E17A 4P9FA 3K1PA 4R1HA 3KP4A 4Z2YA 1QZYA 3RYRA 3WU1B 2R3SA 1H0MA 3PQJA 4Y17A 2F2EA 2CGPA 4LB6B 4ESBA 1K6OA 5D5WB 2GIVA 2VBZA 1XSVA 2ISYA 4RB2C 2GZWA 2EA2A 3MAJA 1XDUA 1K7AA 3WGGA 1ZG1A 1YG2A 2DBBA 2L3DA 1MD0A 3VB2A 2HDCA 5AIPA 4U0YA 1UHMA 3LA7A 2IA1A 4PGHA 1XB4A 2K27A 3KLOA 3MQ0A 1U8RA 4A5NA 3RYPA 2IP2A 1PDNC 3QU6A 5HLHA 1CF7B 4WCGA 5K5OA 3FF5A 5HS9A 4IRHA 1U78A 3E5XA 3IWFA 3LQRA 3J7AO 3IC7A 4RB3C 1HSJA 4KN7X 4LK0F 3P9IA 1IXRC 5FLXK 4OIPF 3V4GA 3K0LA 4U88A 3GFMA 3JTHA 4KMFA 1U5TA 3SXYA 1YYVA 1V3FA 3ZMZA 4HF1A 4PGGA 5L3GA 4CO8A 1BN5A 1T98A 3H3UA 2W57A 2ZJ2A 2PI0A 3I54A 3KZYA 4KMUX 3F6VA 2EJRA 4EGZA 4A6EA 3HRSA 5H20A 2XGXA 1TQPA 4DQ2A 1ZGJA 5LHIA 1O3SA 3E97A 1GXPA 3DEUA 4P96A 3ZP5A 2ZKZA 2ADUA 3ZMDA 4ESFA 1L3LA 4M6XA 1USTA 2ZFWA 1XMKA 2LSOA 3QPHA 2OA4A 2Z99A 3GFLA 1FY7A 1T6SA 2YX7A 3KETA 2COMA 2DW4A 5E8GA 2HZTA 2M5WA 1G3WA 4Y13A 3EYIA 4G7OF 3WTXC 3F3XA 1C0WA 5ICFA 4CDGA 1PP7U 4HDVA 4IJAA 4UV8A 5F64A 2VE8A 3I59A 4RGUA 1WKMA 1ODDA 5BPIA 1OYIA 2JRTA 4HQMA 5JI6A 3WTYC 4LLNA 2CSOA 2QBYA 1YLFA 4HDUA 3MFKA 2V6CA 1XCBA 3CUOA 2O61A 1ULYA 3KEQA 1HKTA 2QENA 4WX9A 4KIGA 4GCVA 4Q47A 3BP8A 3FM3A 4GYGA 2WV0A 3L9FA 1ZRDA 2H27A 5LBQA 4RAYA 4RAZA 1XD7A 3T0YA 2FMLA 2AXLA 3DP7A 5BS6A 2PQ8A 1FLIA 2XROA 2M30A 5HVQC 5KK1A 1BBYA 3TO7A 5D8KB 4HX4A 2XRNA 2DLLA 1LJ9A 3BJOA 2ESNA 3RKXA 3C3WA 3GX4X 3ECOA 2XAGA 5HDNA 1YIOA 1S3JA 2DAOA 6PAXA 4EJVA 2V1XA 2FOKA 4LJZF 2UXXA 2V1UA 3MZYA 1FYMA 5IT9K 1GHCA 2VONA 4IHSA 1B1BA 2IVMA 1P4WA 2RDPA 3HSFA 4CZZA 2EK5A 3FM5A 3GF2A 3IL2A 3TKYA 2MD5A 2P6TA 4XLPF 2GAUA 3LAPA 4XLNF 2OQRA 2GQQA 4EMSA 1YW8A 5CVVA 3QPTA 4I7HA 4FHTA 3GUDA 1IZ1A 2PEXA 1G3TA 1SFEA 3K69A 3HIFA 4CGZA 5L3DA 3KLNA 1FP1D 2VT2A 3FMRA 5DYMA 1BOAA 2DFIA 5CJ9A 1KU3A 1BI1A 2KJBA 4DNCA 1WSUA 2KJCA 4AD9A 4M72A 2NYXA 3QOPA 5E1XA 2A6HF 1TLHB 5LHHA 1JHHA 1YW9A 2P7VB 1YO5C 5CLSA 3IHUA 1JGSA 1FYLA 1ZN2A 2ZO4A 5ICGA 1F5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L02 A;  3K9T A;  3FXQ A;  1TW3 A;  3F21 A;  5E20 A;  3V7R A;  4CXF A;  3GFJ A;  1O7F A;  3LFK A;  1U2W A;  4U7D A;  5JR3 A;  2DU9 A;  1BJA A;  3HTU A;  3DKW A;  4ZYD A;  3H92 A;  3IKT A;  2P5K A;  3HUG A;  3O2P E;  4LK1 F;  4A0Z A;  4S04 A;  2FBH A;  5DDG A;  2YU3 A;  5L3E A;  2K02 A;  2D2W A;  3U9G A;  2R7F A;  4O3M A;  1KQ9 A;  2TDX A;  4L0Y B;  1KU7 A;  3NQO A;  1P92 A;  1XDS A;  4G7H F;  1ZRE A;  3E3V A;  3ZPL A;  1ZYR F;  1BC8 C;  1HQC A;  4MEX F;  4MTD A;  5LEK A;  1TBX A;  1U5T B;  2XAH A;  4EV0 A;  4ZZL A;  3G3Z A;  3QU3 A;  3IRR A;  1NHA A;  2CWE A;  1JXS A;  2M87 A;  3FXR A;  3V7C A;  2OQG A;  3QAH A;  1G3S A;  1XSX A;  1HKS A;  1Z91 A;  3EQL F;  2X4H A;  1XGS A;  4FX4 A;  2KIU A;  2OZU A;  4LB5 A;  2VBW A;  2LF7 A;  1O7L A;  5JFR A;  3LST A;  5EEG A;  4EM1 A;  2FBK A;  5IT9 Z;  4BHB A;  2VOP A;  2J5O A;  5ICE A;  3L7W A;  3VOD A;  3VFZ A;  2E7W A;  3R61 A;  2W84 A;  1H9G A;  1Y0U A;  2NAZ A;  3RIR A;  4BH9 A;  2ESH A;  5LRR A;  2PFB A;  2DTR A;  5EEH A;  3CTA A;  1BI0 A;  1K78 A;  5ILU A;  3ML6 A;  4MGR A;  2VE9 A;  3P9K A;  2EFP A;  5CVJ A;  3REO A;  3L00 A;  3KP3 A;  2NS0 A;  2XAF A;  1BM9 A;  2Q8K A;  3ZMS A;  2FMY A;  1Z05 A;  4ON0 A;  1WWX A;  2ELH A;  4PDK A;  3MWM A;  1KYW A;  3LWF A;  4KUM A;  3I59 B;  4IVN A;  2UZK A;  5ICC A;  2GXG A;  2V9V A;  3C1D A;  5BQT A;  3WOD F;  1O3Q A;  4CIC A;  3RI4 A;  2QBY B;  2W24 A;  1H9T A;  5TRD A;  1G4D A;  4ZZD A;  2VT3 A;  2Z9O A;  2Z3Y A;  4G9Y A;  5JHU A;  4KIB A;  3F8F A;  3JTG A;  3RPU A;  4ENK A;  1LDD A;  2GA2 A;  3L2C A;  3R4K A;  1JHF A;  3CDH A;  1YFH A;  1OYY A;  4UVA A;  4IXA A;  3W6K B;  4ENJ A;  1IF1 A;  4KNY A;  2HEO A;  3TO6 A;  2PBI A;  1T2K A;  4L5J A;  1RIO H;  3EYY A;  3RTR A;  2PJP A;  3K1M A;  2A3S A;  3E6M A;  4FX0 A;  4ETS A;  2HYF A;  5D5U B;  3BPV A;  4L18 B;  1MJA A;  1B9N A;  4BQA A;  4I02 A;  1TNS A;  4Y15 A;  5CVR A;  3GXO A;  4EJO A;  3R0A A;  4HF2 A;  4RGR A;  2VXZ A;  2RV8 A;  5L3C A;  4RGS A;  1I6X A;  5LRS A;  1DPR A;  4EVI A;  1Z7U A;  1PUE E;  1SMY F;  3F8N A;  1EH7 A;  2EV5 A;  3PQK A;  3F8B A;  4HA8 A;  2Y48 A;  1J0R A;  5K1Y A;  4BHP A;  1FC3 A;  5LGT A;  4RGX A;  5IT3 A;  1HXD A;  1ZG5 A;  5JVT A;  3T8T A;  1IN8 A;  3FX3 A;  3ABU A;  1KA8 A;  1RZ4 A;  2Q2E A;  2FBI A;  1ZG3 A;  2DT5 A;  3TQN A;  2YR2 A;  3D5L A;  3HRT A;  2WTE A;  2VN2 A;  4ZYH A;  3MCZ A;  1XGN A;  4QWQ A;  1I1S A;  2D45 A;  2L4A A;  2KRF A;  1FBQ A;  3R6S A;  2HKO A;  2O3F A;  3JAM Z;  1EH8 A;  4QLC U;  2QUF A;  2A68 F;  5DD4 A;  2P5L C;  2EFN A;  4EM2 A;  2L54 A;  2ZNY A;  4RB1 A;  1FNN A;  1KQ8 A;  2QVO A;  4XSX F;  4NHJ A;  2CYY A;  3IRQ A;  3S2W A;  3AAF A;  1K79 A;  5HOO A;  4P5O A;  2K4J A;  1ZLJ A;  4M71 A;  3N97 A;  5D4R A;  2BE5 F;  2MLG A;  5HS8 A;  4OIQ F;  2B0L A;  3LAJ A;  1IW7 F;  1J9I A;  1YQA A;  4YFN F;  4M9X A;  4LD5 A;  4YFX F;  2IJL A;  3KE2 A;  3O3K A;  4JBA A;  4IHT A;  3L09 A;  1ZAO A;  1S29 A;  4XSZ F;  2CG4 A;  3SZP A;  3DPT A;  3HHG A;  5ILS A;  3V8K A;  5FD6 A;  1W4M A;  1XCV A;  5E8I A;  4HQE A;  5KVR A;  3F8M A;  4BXU A;  4A2U A;  2BYV E;  1B9M A;  1HKQ A;  2A07 F;  3OOP A;  4MQV A;  3WE3 A;  5K5Q A;  3B73 A;  1TQI A;  3KEO A;  4Q5S F;  1J7K A;  1BI3 A;  2F5F A;  4YII A;  3ZMV A;  3B02 A;  2DPD A;  2Y75 A;  1OYW A;  2FE3 A;  4HZF A;  4HW0 A;  4B09 A;  3BRO A;  4R8H A;  2IRF G;  5FO5 A;  2FA5 A;  1L0O C;  1SMT A;  3KP2 A;  3KP6 A;  3IWZ A;  1XMA A;  4L9V A;  2D1H A;  2PN6 A;  3C7J A;  2EV6 A;  4EGY A;  1LNW A;  4HLY A;  1QO0 D;  3P7N A;  3I71 A;  1YW7 A;  1ZRF A;  4EJU A;  2M8E A;  5DCM A;  1DDN A;  1I27 A;  5LEJ A;  1TNT A;  1Q1H A;  4BAY A;  3GEZ A;  2IT0 A;  4KYW A;  3TOA A;  2P4W A;  1RI7 A;  1W7P D;  3EET A;  2M1B A;  1E2X A;  1ZGA A;  3VOE A;  2PLY A;  4ZH4 F;  1W5S A;  3HTS B;  1XSD A;  1R23 A;  2O8X A;  4JK1 X;  3BZ6 A;  2XIG A;  1EH6 A;  2XHK A;  1W7P A;  2VBX A;  1QQI A;  3R0J A;  4HX8 A;  4HYE A;  3WTT C;  4EJW A;  1VTN C;  3ZMT A;  2J5P A;  4EM0 B;  1QZZ A;  2VC0 A;  1R58 A;  1FPQ A;  2ZNZ A;  1K78 B;  1R22 A;  2STT A;  2QYO A;  3C18 A;  1FWZ A;  3HYI A;  3GZ5 A;  2E1C A;  1QNT A;  2FXA A;  2L4M A;  2FRH A;  3SQN A;  1T0F A;  3CJN A;  3VEP A;  4LG0 A;  2LDU A;  2A5Y B;  5FD5 A;  3EDP A;  1UB9 A;  4NB5 A;  2HWV A;  3V8J A;  4AVP A;  3M9A A;  4BYY A;  2G9W A;  4UVB A;  1ZLK A;  2R7D A;  2DK8 A;  2FNP A;  3FZV A;  2LF8 A;  4HV6 A;  3ULQ B;  3SZT A;  2CW0 F;  2MBF A;  4A12 A;  3BJ6 A;  4A5M A;  4UUV A;  4ASN A;  5D5V B;  2QZ8 A;  5D8L B;  5LGU A;  5DUI A;  3KFW X;  3Q9V A;  2EWN A;  3DQV C;  5E1Z B;  2XAQ A;  2HQN A;  4FT8 A;  3ERE D;  1JE8 A;  1REP C;  4HX7 A;  4XRF A;  4D0P A;  1IN6 A;  1T39 A;  5FGM A;  5D4S A;  1IXC A;  1R1T A;  4G6D A;  2FQ3 A;  3DFG A;  3MEX A;  2XAS A;  5DV5 A;  4G94 A;  5LHG A;  4G6Q A;  2CQK A;  2V1D A;  2STW A;  3RKW A;  1SFX A;  4L5I A;  4WXH A;  4MQ9 F;  4E70 A;  2K4B A;  1IXS B;  2JPB A;  3CUQ C;  4N9I A;  5ILV A;  4XBF A;  1FT9 A;  4MNU A;  3I5U A;  1R1V A;  2HYG D;  4WK8 F;  3JSO A;  1LB2 A;  2QLZ A;  5J8C A;  1P4X A;  2PMU A;  3FWE A;  4R79 A;  1RNL A;  1GXQ A;  3M7G A;  1IN7 A;  3WTS C;  3E5Q A;  1P4A A;  1D3Y A;  3IKV A;  2P6S A;  3T5X A;  2QM3 A;  5DUK A;  2HTJ A;  3BDD A;  2LNB A;  3H3Z A;  3JAM K;  2W25 A;  5BOX A;  2VOO A;  3HSR A;  4YG2 F;  4KA4 A;  1MJB A;  2O0Y A;  3W6J B;  1FSE A;  3TO9 A;  3ZN0 A;  2ETH A;  4U0V A;  1SFU A;  2LKP A;  2MLK A;  2RN7 A;  2QWW A;  5DCF A;  3BJA A;  2IPQ X;  4BNC A;  3FMS A;  3WG9 A;  2RKH A;  2QQA A;  1U3E M;  3FHZ A;  1O3R A;  4KFC A;  4UVC A;  5H6R A;  4L0Z B;  1I5Z A;  3GFI A;  2YPR A;  4LMY A;  1W5T A;  1J2X A;  2K7L A;  2NNY A;  1RUO A;  4B8X A;  1S8N A;  1ZHF A;  1UFM A;  1HBX G;  3I53 A;  4M74 A;  3K1N A;  3WTZ A;  3I64 A;  1HW5 A;  4WXD A;  1MDM A;  2MA3 A;  1WI9 A;  3GWZ A;  4RB0 A;  4AIH A;  1U6G A;  3E6B A;  3SFZ A;  1J75 A;  2ZXJ A;  3J80 K;  1XGM A;  1B4A A;  1OR7 A;  2XV4 S;  4M9S A;  3HHH A;  5FFZ A;  1MJ9 A;  1D5V A;  2HGC A;  5D6F A;  3T1B A;  4IRG A;  4NQW A;  5K5R A;  3U2R A;  3ZQ7 A;  4U7B A;  1ON1 A;  3ECH A;  1ZH5 A;  1F1Z A;  2YSR A;  4F7Z A;  3TGN A;  2BV6 A;  1QGP A;  3ELK A;  3CUQ A;  2ZCW A;  1AWC A;  4P55 A;  2OU2 A;  4I09 A;  4I0B A;  2CFX A;  3HSE A;  4LGW A;  5DCM B;  4A0Y A;  4I98 B;  3DF8 A;  2HS5 A;  1O57 A;  4ZYG A;  2BGC A;  3E6C C;  3TOB A;  5ED4 A;  1SD6 A;  3KZZ A;  4KN4 X;  3F22 A;  3FXU A;  5CVU A;  4YFK F;  1G3Y A;  1IN5 A;  3F6O A;  3WTW C;  2KIM A;  3WGH A;  4CYD A;  3RDI A;  4I2O A;  3R60 A;  4M6Y A;  1W7P B;  2MC3 A;  4HF0 A;  3F23 A;  4EJT A;  2RGV A;  1USS A;  2EFQ A;  2XUB A;  5HLI A;  3CO6 C;  5J8F A;  2RC4 A;  1A04 A;  4GXO A;  3QRF F;  5AIQ A;  4WF2 A;  1KGS A;  3KP7 A;  2HQR A;  3K2Z A;  4G8X A;  5ERI A;  2WC2 A;  3Q9S A;  1DP7 P;  4UXN A;  2ZME A;  4LFU A;  3M8E A;  3GW2 A;  4UHT A;  4EQQ A;  2MH2 A;  4OU0 A;  4LG0 B;  4G7Z F;  2AS5 F;  1ZAR A;  4HBL A;  3WTU C;  1FBU A;  1LVA A;  4AWX B;  2G7U A;  4L9T A;  2A6E F;  3BPX A;  1P2F A;  4HOB A;  2H6C A;  1R5G A;  2Q0O A;  1YS7 A;  5D6E A;  3I4P A;  1T38 A;  1IAW A;  3MZH A;  4M73 A;  3M1E A;  1FBS A;  1KYZ A;  3NRV A;  1BC7 C;  4HAM A;  4IRI A;  4Q48 A;  4OIN F;  4KIC A;  1SD7 A;  2P5V A;  1OMI A;  3HRM A;  2P8T A;  3HOT A;  2Z5U A;  3SHF A;  3KP5 A;  2X0L A;  2FU4 A;  2KIF A;  2OBP A;  2EA4 A;  4MEY F;  4YIF A;  2RVC A;  1FYK A;  3WU0 A;  3LA3 A;  2KKO A;  2EFW A;  3ROU A;  4CHU A;  4IPA A;  1QBJ A;  5FFX A;  4UNO A;  2E7X A;  3GYH X;  5E17 F;  1R7J A;  3TDU C;  5H6Q A;  2PMH A;  2M45 A;  3J80 Z;  3QP5 A;  3U1D A;  1I1G A;  3EUH A;  5BMZ A;  2RQP A;  1R00 A;  4IF4 A;  4JQF A;  5CVI A;  3TDZ C;  3GO5 A;  1X3U A;  3G73 A;  2F5C A;  2NNN A;  1Z6T A;  1HW1 A;  1O3T A;  1P6R A;  3I0T A;  3ZN1 A;  1DUX C;  2HR3 A;  1BIB A;  4AIK A;  2L01 A;  2HTS A;  1YTY A;  1SAX A;  2GXB A;  2O03 A;  4BHC A;  4P9U A;  2F5D A;  1FP2 A;  4AIJ A;  3OV8 A;  3E6D A;  2G7H A;  2WWY A;  5DD8 A;  3BOQ A;  5F6F A;  3V7S A;  3GVA A;  3J81 K;  5E1W A;  4S05 A;  4WWC A;  3I58 A;  2OAZ A;  3KCC A;  3HRU A;  1ONV A;  2YX4 A;  1S7A A;  3BY6 A;  1R5H A;  2QQB A;  2CO5 A;  1PP8 F;  3DXJ F;  5AON A;  2DI3 A;  1DPU A;  1LEA A;  4O5V A;  1HW2 A;  3WGI A;  2C6Y A;  4A0X A;  4OMY A;  3JSP A;  2Y0M A;  1CF7 A;  1TW2 A;  2UWM A;  2MH9 A;  4RS8 A;  2V79 A;  2H6B A;  1TQM A;  3O6B B;  2GWR A;  2A69 F;  5CYV A;  1OKR A;  2NRA C;  4ZYE A;  2VBY A;  1ZRC A;  2EFO A;  4TV7 A;  4O6J A;  1KU9 A;  4UV9 A;  3RJP A;  5FLX Z;  1LDJ A;  4I0A A;  5L3F A;  1GVJ A;  4ENN A;  1STZ A;  5E18 F;  2DK5 A;  3GLX A;  1UHW A;  2JTV A;  1MDM B;  3PFI A;  4KIF A;  2DPU A;  1F4K A;  2H09 A;  2FNA A;  2E1N A;  2ISZ A;  2FF4 A;  5A2Q K;  2A61 A;  3ABT A;  4OIR F;  2JPC A;  1WQ2 A;  1B6A A;  4GGG A;  4L9N A;  4ENM A;  2Z33 A;  3V8L A;  5FB2 A;  3M8F A;  5HDG A;  4ESJ A;  5DEQ A;  2DQL A;  1J59 A;  1EV7 A;  5L3B A;  1J5Y A;  4H0E A;  1QPM A;  4GO1 A;  1TTY A;  5HS7 A;  5BPD A;  3BWG A;  3CUQ B;  2ACJ A;  1Z1D A;  1RUN A;  2XVC A;  2W85 A;  4MTE A;  3DPL C;  2K86 A;  2FSW A;  1FZP B;  3JW4 A;  4U0W A;  1S6L A;  1WRJ A;  5F1R A;  2PG4 A;  2BBY A;  1S7O A;  1FOK A;  5HLG A;  2JT1 A;  1F9N A;  1BIA A;  2O6G E;  3E5U A;  1B59 A;  4OOI A;  4MHG A;  3F8C A;  1SD5 A;  1KQ0 A;  3ISP A;  4HV5 A;  2DO7 A;  2QQ9 A;  4N9H A;  4OMZ A;  1UCR A;  2FEZ A;  1G6N A;  4LLL A;  1IRF A;  2XKP A;  1Z6R A;  2HFH A;  2EV0 A;  3COA C;  3CO7 C;  4L9J A;  2OZ6 A;  1MGT A;  3J81 Z;  1IUY A;  5TJJ A;  3GZ6 A;  2ZME B;  2JSC A;  2D1V A;  1HST A;  4Q4Z F;  1R1U A;  2IW5 A;  2RNJ A;  4OIO F;  3WTV C;  3F72 A;  2H94 A;  1YS6 A;  5D5X B;  1FX7 A;  1Z9C A;  2EB7 A;  3Q5F A;  2HKX A;  1AOY A;  5HDK A;  4PZJ A;  2JZY A;  1BI2 A;  2P7C B;  3QP6 A;  2VC1 A;  4N0B A;  2IA2 A;  2IA0 A;  1FSH A;  1V4R A;  4LLG F;  2XKO A;  2UXN A;  1IN4 A;  4HLX A;  1D8K A;  3N4M A;  4I01 A;  5J6X A;  1U5T C;  4M9Z A;  2VOD A;  1D8J A;  1LDK B;  2ZBK A;  2F5E A;  5LGN A;  3RKY A;  1XN7 A;  5LLQ A;  3CLO A;  2GA1 A;  3HOS A;  1CGP A;  3LA2 A;  3P9C A;  3WE2 A;  1XGO A;  2XAJ A;  2DQR A;  3ZMU A;  4WXC A;  5A2Q Z;  3D0S A;  4KDP A;  1ON2 A;  4A6D A;  4PCQ A;  3T8R A;  1KU2 A;  1R36 A;  2HOE A;  4GYI A;  4KT5 C;  1MZB A;  3NEU A;  1SD4 A;  1LQ1 A;  2BEO A;  3RPQ A;  3FMQ A;  1LEB A;  4K2E A;  1IRG A;  3LQQ A;  3DV8 A;  1MKM A;  1OPC A;  2OD5 A;  1E17 A;  4P9F A;  3K1P A;  4R1H A;  3KP4 A;  4Z2Y A;  1QZY A;  3RYR A;  3WU1 B;  2R3S A;  1H0M A;  3PQJ A;  4Y17 A;  2F2E A;  2CGP A;  4LB6 B;  4ESB A;  1K6O A;  5D5W B;  2GIV A;  2VBZ A;  1XSV A;  2ISY A;  4RB2 C;  2GZW A;  2EA2 A;  3MAJ A;  1XDU A;  1K7A A;  3WGG A;  1ZG1 A;  1YG2 A;  2DBB A;  2L3D A;  1MD0 A;  3VB2 A;  2HDC A;  5AIP A;  4U0Y A;  1UHM A;  3LA7 A;  2IA1 A;  4PGH A;  1XB4 A;  2K27 A;  3KLO A;  3MQ0 A;  1U8R A;  4A5N A;  3RYP A;  2IP2 A;  1PDN C;  3QU6 A;  5HLH A;  1CF7 B;  4WCG A;  5K5O A;  3FF5 A;  5HS9 A;  4IRH A;  1U78 A;  3E5X A;  3IWF A;  3LQR A;  3J7A O;  3IC7 A;  4RB3 C;  1HSJ A;  4KN7 X;  4LK0 F;  3P9I A;  1IXR C;  5FLX K;  4OIP F;  3V4G A;  3K0L A;  4U88 A;  3GFM A;  3JTH A;  4KMF A;  1U5T A;  3SXY A;  1YYV A;  1V3F A;  3ZMZ A;  4HF1 A;  4PGG A;  5L3G A;  4CO8 A;  1BN5 A;  1T98 A;  3H3U A;  2W57 A;  2ZJ2 A;  2PI0 A;  3I54 A;  3KZY A;  4KMU X;  3F6V A;  2EJR A;  4EGZ A;  4A6E A;  3HRS A;  5H20 A;  2XGX A;  1TQP A;  4DQ2 A;  1ZGJ A;  5LHI A;  1O3S A;  3E97 A;  1GXP A;  3DEU A;  4P96 A;  3ZP5 A;  2ZKZ A;  2ADU A;  3ZMD A;  4ESF A;  1L3L A;  4M6X A;  1UST A;  2ZFW A;  1XMK A;  2LSO A;  3QPH A;  2OA4 A;  2Z99 A;  3GFL A;  1FY7 A;  1T6S A;  2YX7 A;  3KET A;  2COM A;  2DW4 A;  5E8G A;  2HZT A;  2M5W A;  1G3W A;  4Y13 A;  3EYI A;  4G7O F;  3WTX C;  3F3X A;  1C0W A;  5ICF A;  4CDG A;  1PP7 U;  4HDV A;  4IJA A;  4UV8 A;  5F64 A;  2VE8 A;  3I59 A;  4RGU A;  1WKM A;  1ODD A;  5BPI A;  1OYI A;  2JRT A;  4HQM A;  5JI6 A;  3WTY C;  4LLN A;  2CSO A;  2QBY A;  1YLF A;  4HDU A;  3MFK A;  2V6C A;  1XCB A;  3CUO A;  2O61 A;  1ULY A;  3KEQ A;  1HKT A;  2QEN A;  4WX9 A;  4KIG A;  4GCV A;  4Q47 A;  3BP8 A;  3FM3 A;  4GYG A;  2WV0 A;  3L9F A;  1ZRD A;  2H27 A;  5LBQ A;  4RAY A;  4RAZ A;  1XD7 A;  3T0Y A;  2FML A;  2AXL A;  3DP7 A;  5BS6 A;  2PQ8 A;  1FLI A;  2XRO A;  2M30 A;  5HVQ C;  5KK1 A;  1BBY A;  3TO7 A;  5D8K B;  4HX4 A;  2XRN A;  2DLL A;  1LJ9 A;  3BJO A;  2ESN A;  3RKX A;  3C3W A;  3GX4 X;  3ECO A;  2XAG A;  5HDN A;  1YIO A;  1S3J A;  2DAO A;  6PAX A;  4EJV A;  2V1X A;  2FOK A;  4LJZ F;  2UXX A;  2V1U A;  3MZY A;  1FYM A;  5IT9 K;  1GHC A;  2VON A;  4IHS A;  1B1B A;  2IVM A;  1P4W A;  2RDP A;  3HSF A;  4CZZ A;  2EK5 A;  3FM5 A;  3GF2 A;  3IL2 A;  3TKY A;  2MD5 A;  2P6T A;  4XLP F;  2GAU A;  3LAP A;  4XLN F;  2OQR A;  2GQQ A;  4EMS A;  1YW8 A;  5CVV A;  3QPT A;  4I7H A;  4FHT A;  3GUD A;  1IZ1 A;  2PEX A;  1G3T A;  1SFE A;  3K69 A;  3HIF A;  4CGZ A;  5L3D A;  3KLN A;  1FP1 D;  2VT2 A;  3FMR A;  5DYM A;  1BOA A;  2DFI A;  5CJ9 A;  1KU3 A;  1BI1 A;  2KJB A;  4DNC A;  1WSU A;  2KJC A;  4AD9 A;  4M72 A;  2NYX A;  3QOP A;  5E1X A;  2A6H F;  1TLH B;  5LHH A;  1JHH A;  1YW9 A;  2P7V B;  1YO5 C;  5CLS A;  3IHU A;  1JGS A;  1FYL A;  1ZN2 A;  2ZO4 A;  5ICG A;  1F5T A; 
#chains in the Genus database with same CATH topology
 2L02 A;  3K9T A;  3FXQ A;  4X6A J;  1TW3 A;  3B6A A;  4OAY A;  2D5V A;  5IT9 R;  2RQQ A;  4BKX A;  2DFH A;  3ZQQ A;  3F21 A;  4B44 A;  5E20 A;  3V7R A;  4MIM A;  1ETV A;  5EZG A;  2FD5 A;  4CXF A;  3GFJ A;  1O7F A;  4ABZ A;  3LFK A;  1U2W A;  1SFO J;  2HU9 A;  4U7D A;  1SVO A;  5JR3 A;  4PSW A;  2DU9 A;  2BOL A;  2E2H J;  2CQN A;  2KRC A;  2VB6 A;  2LC2 A;  3KPH A;  1BJA A;  3HTU A;  3DKW A;  4OWR B;  4ZYD A;  3S15 J;  3H92 A;  3IKT A;  2P5K A;  3HUG A;  3O2P E;  4LK1 F;  3NAR A;  4A0Z A;  4S04 A;  3HOV J;  1D0Z A;  4F91 B;  3H0D A;  2FBH A;  5DDG A;  1K6Y A;  2YU3 A;  2LK2 A;  3K10 A;  4BL0 B;  5L3E A;  2K02 A;  2D2W A;  2MGQ A;  3U9G A;  2R7F A;  4O3M A;  1KQ9 A;  3RSN A;  2TDX A;  4L0Y B;  1KU7 A;  5J1U A;  3NQO A;  1MMN A;  3SDB A;  1P92 A;  1XDS A;  3LSJ A;  4G7H F;  1ZRE A;  1PYV A;  3E3V A;  2NOJ B;  3ZPL A;  1ZYR F;  1BC8 C;  2X51 A;  3WG7 H;  1HQC A;  4MEX F;  3BG6 A;  3OYJ A;  4MTD A;  3VYT B;  5LEK A;  1TBX A;  1WJB A;  5M3M J;  2ZSI B;  4S0H B;  2ID6 A;  3FK7 A;  3BT9 A;  3L2Q A;  1U5T B;  4F55 A;  2XAH A;  4EV0 A;  2WAE A;  1AA7 A;  3JR9 A;  4ZZL A;  3G3Z A;  3HEF A;  2HVQ A;  3QOD A;  1UEL B;  3QU3 A;  3IRR A;  4IHV A;  3Q0V A;  1HC8 A;  4ITV A;  4CH7 A;  1JKP C;  1NHA A;  2CWE A;  2DA2 A;  1JXS A;  1OCT C;  2CW7 A;  2DOE A;  4HEA 2;  2M87 A;  3FXR A;  3K7A J;  3WHC A;  3V7C A;  2OQG A;  3QAH A;  1G3S A;  1JUP A;  1XSX A;  4XM3 A;  1HKS A;  1Z91 A;  2WB1 A;  2X4H A;  3ABL H;  3EQL F;  1XGS A;  4FX4 A;  2KIU A;  2OZU A;  2H1L A;  1R4M B;  4LB5 A;  5J47 A;  2JA6 J;  2R7U A;  4CCM A;  5GTH C;  2VBW A;  2LF7 A;  1I6H J;  2F6C A;  1WCM J;  1O7L A;  1R9T J;  2V6E A;  5JFR A;  3LST A;  5EEG A;  2E1M C;  4EM1 A;  2FBK A;  2ELK A;  5IT9 Z;  3HPG A;  3S3M A;  4BHB A;  2VOP A;  2OTJ I;  2J5O A;  5ICE A;  3L7W A;  1W0U A;  3I9V 2;  3OS2 A;  3VOD A;  2VPL A;  3VFZ A;  2E7W A;  2IAI A;  4D7M A;  3R61 A;  2W84 A;  1H9G A;  5EZH A;  4BEH A;  1Y0U A;  2NAZ A;  3RIR A;  4BH9 A;  2KIS A;  2DOD A;  3I4M J;  2ESH A;  1BW5 A;  3BR1 A;  3DBL B;  5LRR A;  2DFE A;  2PFB A;  2DTR A;  2L7M P;  4GRI A;  5EEH A;  3CTA A;  2NS7 A;  3F0C A;  1BI0 A;  2FQ4 A;  1K78 A;  5ILU A;  3ML6 A;  3DTK A;  3M3Y J;  4BS9 A;  3ZRG A;  4MGR A;  1MND A;  3OL4 A;  3P9K A;  3OYN A;  2VE9 A;  2EFP A;  5CVJ A;  3W2W A;  3O8G A;  1RET A;  1M1E B;  3REO A;  3L00 A;  3KP3 A;  2NS0 A;  1TWH J;  2XAF A;  3JRE A;  1BM9 A;  2Q8K A;  3QQA A;  2BXZ A;  3ZMS A;  2FMY A;  2XF6 A;  4LIT A;  1YJ9 I;  2YU9 J;  1VQ6 I;  1Z05 A;  3SFI A;  3CC7 I;  1AHD P;  3BG3 A;  3BTC A;  4ON0 A;  5LD2 C;  1WWX A;  2ELH A;  4A3G J;  4PDK A;  3MWM A;  4HSR A;  1KYW A;  2OJE D;  3ZGK A;  3LWF A;  2R7O A;  4KUM A;  2Z2S B;  4XN0 A;  3I59 B;  4IVN A;  2UZK A;  2Y0S A;  5ICC A;  2GXG A;  2V9V A;  3C1D A;  3WOD F;  5BQT A;  1O3Q A;  2DXI A;  4CIC A;  2LRE A;  3RI4 A;  3G71 I;  4B3A A;  2CUF A;  4RM2 A;  2QBY B;  3MVP A;  3HB9 A;  2W24 A;  3PNT A;  2WV1 A;  1H9T A;  5TRD A;  1WJ5 A;  1G4D A;  4ZZD A;  2VT3 A;  2Z9O A;  2E19 A;  2Z3Y A;  2KPM A;  5C4J J;  4G9Y A;  2EZK A;  5JHU A;  4KIB A;  2LTP A;  3F8F A;  3JTG A;  3RPU A;  4ENK A;  1LDD A;  4E7H A;  4M6V A;  4YRV A;  3L1P A;  2UV1 A;  4PK4 A;  1S5L C;  2GA2 A;  3L2C A;  3R4K A;  1JHF A;  3AL0 B;  3CDH A;  1VFC A;  4QPQ A;  1YFH A;  1OYY A;  4UVA A;  4IXA A;  2JA7 J;  3W6K B;  4ENJ A;  2A6T A;  1T8I A;  1IF1 A;  4XOR A;  4KNY A;  3GTO J;  2HEO A;  4IOC F;  3TO6 A;  3PO2 J;  4JP0 A;  5E3N A;  2PBI A;  1T2K A;  4L5J A;  2K9Q A;  4XN3 A;  1RIO H;  2L5Q A;  3S1M J;  3EYY A;  3CMM A;  3RTR A;  2X9D A;  2CMP A;  3HZJ A;  2PJP A;  3ASO H;  3K1M A;  1QVU A;  2A3S A;  3E6M A;  3NWT A;  2E34 A;  4FX0 A;  3H35 A;  1IV6 A;  4ETS A;  2HYF A;  5D5U B;  3IP4 B;  3BPV A;  4L18 B;  1MJA A;  1VQL I;  4XLE A;  3K2A A;  1B9N A;  4BQA A;  4I02 A;  2JA8 J;  3CJT B;  1TNS A;  2VQG A;  4MO7 A;  4Y15 A;  5CVR A;  4IQJ A;  3GXO A;  4EJO A;  2QEX I;  2O5R A;  1MMD A;  2A05 A;  3R0A A;  4MLO A;  3ZCO A;  4HF2 A;  1VQM I;  5HNH A;  4RGR A;  2VXZ A;  4A3L J;  5B66 C;  2R7R A;  2P0W A;  2RV8 A;  5F0F A;  4A3K J;  3AL0 C;  5L3C A;  3S1Q J;  4RAG A;  3OYM A;  1S9H A;  4RGS A;  1I6X A;  5LRS A;  2E5N A;  1DPR A;  4HRI A;  4EVI A;  1Z7U A;  2R7Q A;  1PUE E;  2IS4 A;  2OUM A;  1SMY F;  3F8N A;  1EH7 A;  2VUM J;  2EV5 A;  4HG2 A;  3PQK A;  3F8B A;  2XC7 A;  1S7E A;  4HA8 A;  3GTG J;  4AUX A;  2Y48 A;  4IX7 A;  1J0R A;  5K1Y A;  2LY9 A;  4BHP A;  3DEW A;  1FC3 A;  2DYS H;  5LGT A;  4RGX A;  2IGO A;  2ZJQ F;  1N78 A;  4CCN A;  4ANJ A;  2M4G A;  5IT3 A;  4D1Q A;  1HXD A;  1ZG5 A;  1RR8 C;  2P0T A;  1OJL A;  5JVT A;  1TT5 B;  3A52 A;  3T8T A;  3QYE A;  3OYF A;  2MG4 A;  2Z16 A;  5CQE A;  1IN8 A;  3BR3 A;  2ZJP F;  3G1O A;  4BAC A;  3FX3 A;  3ABU A;  1A31 A;  1KA8 A;  1RZ4 A;  2Q2E A;  2FBI A;  1ZG3 A;  2DT5 A;  3CP2 A;  3TQN A;  2WY7 Q;  2YR2 A;  3D5L A;  3HRT A;  2X48 A;  4CCO A;  2WTE A;  4E7S A;  2VN2 A;  1NK2 P;  4ZYH A;  1MBK A;  3MCZ A;  4L5E A;  1XGN A;  1H89 C;  2AHQ A;  1FOX A;  4XKV A;  1G2H A;  4QWQ A;  4F93 B;  1I1S A;  2D45 A;  2L4A A;  4AM3 A;  2KRF A;  1OCR H;  4BE1 A;  1FBQ A;  3R6S A;  2HKO A;  2O3F A;  3JAM Z;  2GOX B;  1VQ8 I;  1EH8 A;  4QLC U;  4E7Z A;  2QUF A;  1OCO H;  2A68 F;  5DD4 A;  4C2T A;  1WHU A;  1AKH B;  2X6Y A;  2MUN A;  2EZL A;  2P5L C;  2EFN A;  2KQR A;  2DN0 A;  4EM2 A;  2L54 A;  1G59 A;  2ZNY A;  4RB1 A;  2KRH A;  4ZDL A;  1FNN A;  1KQ8 A;  3A2K A;  2DT6 A;  2QVO A;  4XSX F;  4NHJ A;  3DBR B;  2CYY A;  3IRQ A;  3S2W A;  5JHF A;  3AAF A;  1K79 A;  5HOO A;  4W97 A;  2CV2 A;  4BQO A;  3FKI J;  4P5O A;  2L2O A;  4Z6Y A;  2K4J A;  1ZLJ A;  3GTJ J;  2OCC H;  4M71 A;  2DJI A;  3N97 A;  1Y1W J;  1HLV A;  1R71 A;  3DWL E;  1W1W E;  5D4R A;  2BE5 F;  2LFB A;  2MLG A;  1X4O A;  5HS8 A;  4OIQ F;  4B47 A;  2B0L A;  2QCO A;  3LAJ A;  1IW7 F;  3CMY A;  1J9I A;  3FXO A;  1YQA A;  3IAS 2;  2MD0 A;  4YFN F;  4XIC A;  1T0F C;  4M9X A;  1MBG A;  1FOW A;  1V54 H;  2L7F P;  4LD5 A;  1A6Q A;  4PFO A;  4YFX F;  2IJL A;  3KE2 A;  5C4X J;  1A6I A;  2I8D A;  2DA5 A;  3O3K A;  4JBA A;  1WFX A;  2QF7 A;  4IHT A;  2M35 A;  3L09 A;  1VZ0 A;  1ZAO A;  2R7V A;  1S29 A;  3E1S A;  1X1P A;  2CRG A;  1XPX A;  2KLO A;  1U9O A;  4XSZ F;  5J3L A;  3JRH A;  2CG4 A;  2ID3 A;  1IDY A;  2WAQ A;  3BTL A;  5DTD A;  3SZP A;  2IEK A;  3DPT A;  3HHG A;  4FE4 A;  5ILS A;  3V8K A;  5FD6 A;  4PUS A;  1W4M A;  3CCR I;  4J19 A;  1XCV A;  2ZXH A;  2EBI A;  3S8P A;  5E8I A;  4HQE A;  3HUG B;  3MKY B;  5KVR A;  3FIS A;  2PMZ N;  4A3B J;  3F8M A;  4BXU A;  3VYU B;  2LY1 A;  4A2U A;  4XR6 A;  4CYC A;  1D1B A;  3PNY A;  2BYV E;  1B9M A;  1HKQ A;  4UY8 I;  2MZ4 A;  1MMG A;  1QU3 A;  3J7Y J;  2A07 F;  2M34 A;  3RQ4 A;  1VQO I;  3OOP A;  4MQV A;  5HNF A;  3WE3 A;  5K5Q A;  3B73 A;  3CCQ I;  1TQI A;  2LMD A;  2XPV A;  3KEO A;  4Q5S F;  1J7K A;  1BI3 A;  2F5F A;  2EPF A;  2V9P A;  2JWT A;  4YII A;  4BQN A;  3ZMV A;  3B02 A;  2DPD A;  2Y75 A;  1OYW A;  3IH3 A;  3DKX A;  2FE3 A;  4HZF A;  2K9N A;  4HW0 A;  4KJZ A;  4B09 A;  3GBG A;  3BRO A;  4IHW A;  4MFE A;  2BY3 A;  4A69 C;  4I76 A;  4R8H A;  4AC0 A;  2IRF G;  5FO5 A;  2FA5 A;  1L0O C;  3AFH A;  1SMT A;  3KP2 A;  1QZE A;  3K70 C;  2JVH A;  4BQQ A;  3KP6 A;  3IWZ A;  1E3H A;  3CCE I;  1XMA A;  4L9V A;  2D1H A;  2PN6 A;  5B5E C;  1IUF A;  3OSG A;  2BHZ A;  3C7J A;  1PJR A;  2EV6 A;  4EGY A;  1O4X A;  1LNW A;  3TW7 A;  4HLY A;  1NK3 P;  2B9S A;  4XNF A;  1QO0 D;  2BY2 A;  2W7N A;  3RCO A;  1RRJ A;  3P7N A;  3I71 A;  1YW7 A;  4NBQ A;  1ZRF A;  4EJU A;  2M8E A;  5DCM A;  3GTL J;  1DDN A;  1I27 A;  2QSG X;  5LEJ A;  1TNT A;  3S16 J;  3OIP A;  1Q1H A;  4BAY A;  3GEZ A;  2IT0 A;  3RKQ A;  4KYW A;  4LG3 A;  3TOA A;  1FJL A;  2P4W A;  5TGT A;  3K4N A;  1ZQ3 P;  1RI7 A;  2HVS A;  1W7P D;  3EET A;  3LSI A;  2M1B A;  3NWS A;  1E2X A;  1ZGA A;  3VOE A;  2PLY A;  2V1N A;  4ZH4 F;  1W5S A;  4HNV A;  2XRL A;  2LLK A;  3CJR B;  3CQZ J;  3HTS B;  1XSD A;  1R23 A;  3H9Q A;  3AG2 H;  2O8X A;  4JK1 X;  5EDN A;  1D5Y A;  3BZ6 A;  2XIG A;  1EH6 A;  3H3V K;  2XHK A;  5DM7 F;  1W7P A;  2VBX A;  3CF2 A;  4BEH B;  1X1B A;  2DA6 A;  5FJ8 J;  1QQI A;  3R0J A;  4HX8 A;  4HYE A;  1RR7 A;  4XK4 A;  4EJW A;  2IGN A;  3WTT C;  3A03 A;  3PSI A;  1VTN C;  3ZMT A;  4A3I J;  1ETX A;  2GIZ A;  1JJ6 C;  2J5P A;  2JSP A;  3NAU A;  3G4S I;  4EM0 B;  1SAU A;  1QZZ A;  2VC0 A;  3TP3 A;  1R58 A;  1FPQ A;  3K6G A;  2ZNZ A;  1OFC X;  3A0H C;  4F3Q A;  1BR1 A;  1K78 B;  1R22 A;  4V2F A;  2STT A;  1LFU P;  2QYO A;  3C18 A;  4HNT A;  2K3F A;  1FWZ A;  3HYI A;  4IO9 F;  3GZ5 A;  3P5J A;  4A3F J;  2BY1 A;  2E1C A;  1QNT A;  2VQL A;  2XPU A;  1Z0X A;  5F08 A;  2FXA A;  2L4M A;  2FRH A;  3SQN A;  3H0G J;  1ETQ A;  2HDW A;  3QYB A;  1T0F A;  4XL9 A;  2H8R A;  3CJN A;  1WJC A;  1X1C A;  4DBR A;  3VEP A;  4LG0 A;  2LDU A;  4CA0 A;  2L0K A;  2A5Y B;  5FD5 A;  3EDP A;  2I5U A;  1JJ8 C;  1UB9 A;  4NNJ A;  4NB5 A;  4AYB A;  2HWV A;  3V8J A;  4B48 A;  1S72 I;  3Q0W A;  4AVP A;  1GVD A;  3M9A A;  4BGD A;  1B72 A;  2XSJ C;  4BYY A;  2G9W A;  4UVB A;  3PUF A;  2MVT A;  1ZLK A;  2R7D A;  2HZD A;  2IS2 A;  2DK8 A;  2FNP A;  4A3E J;  3JRF A;  3FZV A;  2Y30 A;  3WU2 C;  3CME I;  3I4N J;  1OCC H;  2LF8 A;  4HV6 A;  3ULQ B;  3I55 I;  3SZT A;  2F4O B;  2CW0 F;  3HC7 A;  2MBF A;  3TBI A;  4A12 A;  1QRY A;  3BJ6 A;  1QHH D;  4A5M A;  4UUV A;  4ASN A;  1ORK A;  3B6C A;  5D5V B;  2QZ8 A;  1I50 J;  5D8L B;  3UKG A;  5LGU A;  5DUI A;  1GUU A;  3RZO J;  3K70 D;  1A35 A;  1YIJ I;  1D1A A;  3KFW X;  3Q9V A;  2R7Z J;  3LSP A;  4KIT B;  2EWN A;  3SYT A;  3DQV C;  4ZDO A;  2L9S A;  5E1Z B;  2XAQ A;  2HQN A;  4FT8 A;  3ERE D;  5HLT A;  1JE8 A;  4X0G A;  3ZXS A;  4DYR A;  3KEY A;  1REP C;  1E0E A;  4HX7 A;  4XRF A;  2XF7 A;  4N4O B;  4D0P A;  1IN6 A;  3D1N I;  1T39 A;  3Q0U A;  1WJE A;  2DTZ A;  5FGM A;  4JX5 A;  3FIW A;  1WH5 A;  5D4S A;  4XID A;  3JRC A;  1IXC A;  1R1T A;  3JRB A;  2EZI A;  1EJ9 A;  3IUO A;  1P9Q C;  3SEZ A;  1GV5 A;  4B4C A;  4E7K A;  3S1R J;  1F43 A;  4G6D A;  1UHS A;  4A93 J;  5DM6 F;  2FQ3 A;  3DFG A;  3MEX A;  2XAS A;  5DV5 A;  4G94 A;  5LHG A;  1JT0 A;  4G6Q A;  1R5I D;  2CQK A;  2V1D A;  1X3W B;  2V9K A;  2STW A;  1T33 A;  3RKW A;  1XC5 A;  1EA3 A;  4HNU A;  3IAM 2;  1ETW A;  2LKX A;  2DFF A;  3F9K A;  1SFX A;  4IZZ A;  3DLL F;  3J7A W;  3KIO A;  3BZK A;  4L5I A;  1DQU A;  4WXH A;  2CV1 A;  2XB5 A;  4MQ9 F;  3TMO A;  4E70 A;  2K4B A;  1IXS B;  2JPB A;  4LIU A;  3CUQ C;  4FE7 A;  4N9I A;  2E60 A;  5ILV A;  4XBF A;  2KP6 A;  5B1B H;  1FT9 A;  2VJ4 A;  1RES A;  4MNU A;  2DJN A;  2V4J C;  2E1M B;  3I5U A;  3CCY A;  2H1K A;  1R1V A;  2VKH A;  5FRN A;  4DGW B;  4KT6 A;  2QKL B;  4PJL A;  2HYG D;  4WK8 F;  4PJM A;  4QPO A;  3DEE A;  2JN6 A;  3JSO A;  1LB2 A;  2HVR A;  2QLZ A;  5J8C A;  2NVT J;  5E3M A;  2Q2E B;  1JTY A;  2NXN B;  3FBN B;  3CES A;  1P4X A;  2PMU A;  3FWE A;  4R79 A;  4C3J J;  1RNL A;  1GXQ A;  1UMQ A;  3HOY J;  3M8J A;  3M7G A;  2X1D A;  1TWA J;  1IN7 A;  4XRS A;  3WTS C;  3E5Q A;  1P4A A;  1D3Y A;  3IKV A;  2OV7 A;  2P6S A;  4LOC A;  5M5W J;  3T5X A;  1RQ6 A;  1U9N A;  4M3B A;  2QM3 A;  2LRD A;  5DUK A;  1HA8 A;  2HTJ A;  3BDD A;  2LNB A;  2W4S A;  3H3Z A;  3JAM K;  2W25 A;  1Z67 A;  4W1U A;  5BOX A;  5IYB J;  2VOO A;  3HSR A;  4YG2 F;  2CJJ A;  4KA4 A;  1MJB A;  2O0Y A;  3HOX J;  3W6J B;  3MKZ A;  5EGO A;  4UUT A;  4BJ5 C;  4M3D A;  1FSE A;  3TO9 A;  3ZN0 A;  2ETH A;  3L2R A;  4U0V A;  2Y2Z A;  4PJN A;  2LKP A;  2MLK A;  2RN7 A;  1SFU A;  1ACI A;  5M5X J;  2QWW A;  1Y39 A;  3CDL A;  1JKQ C;  5DCF A;  3BJA A;  1X2M A;  4IL6 C;  4E4H A;  3I3L A;  3OIQ A;  2ICW G;  2HI3 A;  2K3P A;  4J01 A;  4BE2 A;  2CV0 A;  2IPQ X;  2ZME C;  4PSX A;  4BNC A;  3LSG A;  3FMS A;  3PNV A;  4IKF A;  2XSD C;  2KDZ A;  3WG9 A;  1K4S A;  2RKH A;  2QQA A;  1U3E M;  2XDV A;  3FHZ A;  1O3R A;  4KFC A;  2I10 A;  4UVC A;  5H6R A;  1BJZ A;  4L0Z B;  1I5Z A;  3AKZ A;  1X19 A;  4J00 A;  3OYA A;  3GFI A;  2YPR A;  3OIO A;  1W5T A;  1J2X A;  4LMY A;  5K7H A;  1ZR4 A;  1K61 A;  2K7L A;  4EEF G;  2NNY A;  1P7J A;  1RUO A;  2CW8 A;  4B8X A;  5EF6 A;  1S8N A;  1ZHF A;  1UFM A;  3VSL A;  1HBX G;  3I53 A;  5E3O A;  1J09 A;  2MSY A;  1ETK A;  5FKM A;  4M74 A;  3K1N A;  3WTZ A;  3I64 A;  5IOY A;  1R49 A;  1NG6 A;  2NVQ J;  4QTR A;  3ABM H;  1HW5 A;  5IPA A;  2M2E A;  4WXD A;  5JLW A;  1MDM A;  1VQ9 I;  4NDL A;  2MA3 A;  1VF9 A;  1WI9 A;  3GWZ A;  4RB0 A;  4AIH A;  3C2H A;  2QGU A;  4XQF A;  1U6G A;  1ENH A;  3E6B A;  2M9H A;  1HCR A;  2JMW A;  5K7F A;  2HXI A;  3RPU D;  4P1W A;  4CYC B;  2R5Z A;  3SFZ A;  1J75 A;  4FET A;  2HOT A;  1KZH A;  2ZXJ A;  5IP9 J;  1ZKG A;  1YOV B;  3J80 K;  1XGM A;  1ERD A;  1LE8 A;  1B4A A;  1OR7 A;  2XV4 S;  4OAZ A;  3WHB A;  4M9S A;  4NC7 A;  3LNQ A;  3HHH A;  1HOM A;  5FFZ A;  3VPR A;  1MSF C;  1MJ9 A;  1D5V A;  1Z77 A;  4D9J A;  2HGC A;  3SEQ A;  5D6F A;  3T1B A;  1AU7 A;  2XAU A;  2HPI A;  4EAT A;  4IRG A;  4NQW A;  5K5R A;  3JAM R;  3CLQ A;  3U2R A;  3ZQ7 A;  1OCP A;  2E36 A;  4U7B A;  1MBJ A;  1ON1 A;  2LOO A;  3ECH A;  5E3L A;  1MW7 A;  3SZG A;  1ZH5 A;  1F1Z A;  4NC6 A;  2LKS A;  3QYF A;  2YSR A;  1MIJ A;  2AO9 A;  1A5J A;  4F7Z A;  2P81 A;  3TGN A;  2F48 A;  2EIK H;  2BV6 A;  1QGP A;  3ELK A;  3CUQ A;  3FDY A;  2DT7 B;  1LPQ A;  3HOZ J;  4B3X A;  2ZCW A;  1AWC A;  4P55 A;  2KDO A;  3OOU A;  2OU2 A;  1Y0N A;  1Z3Y A;  4I09 A;  1SC7 A;  2CQQ A;  4I0B A;  5FKL A;  1JUS A;  4YIR X;  5CQG A;  2CFX A;  2RNG A;  2LYC A;  3A1Y A;  2Y9Y A;  3HSE A;  3OR1 C;  3HM5 A;  4LGW A;  5DCM B;  2OF7 A;  1VQ5 I;  4A0Y A;  4A3C J;  5KAI C;  4BDY A;  4I98 B;  3CC2 I;  2VXD A;  3DF8 A;  2HS5 A;  1O57 A;  4ZYG A;  1N75 A;  2BGC A;  3TOB A;  3E6C C;  2LD5 A;  2VJ5 A;  1GV2 A;  3JCU C;  2OPT A;  5GAD J;  3RZD J;  2HQ5 A;  1FMV A;  1V5G A;  5ED4 A;  1SD6 A;  3KZZ A;  3PUB A;  4KN4 X;  1T95 A;  3F22 A;  1UAA A;  3FXU A;  5CVU A;  2CQ7 A;  2JJ7 A;  4YFK F;  1G3Y A;  1IN5 A;  3F6O A;  4Y3O A;  3UR3 C;  3WTW C;  2KIM A;  3WGH A;  1FEX A;  2G0E A;  4CYD A;  5GP9 A;  3RDI A;  1XTA A;  4I2O A;  3R60 A;  4M6Y A;  2X6W A;  1W7P B;  1ITY A;  2MC3 A;  2CQX A;  1MBF A;  2NVY J;  4HF0 A;  5B1A H;  4NC8 A;  3F23 A;  4EJT A;  2RGV A;  1USS A;  2EFQ A;  2XUB A;  2ECC A;  5HLI A;  3CO6 C;  5J8F A;  3FKJ A;  2RC4 A;  4ZTJ A;  1A04 A;  4GXO A;  3QRF F;  3K4C A;  4RDU A;  2JRM A;  5AIQ A;  3J80 R;  4G12 A;  4WF2 A;  1KGS A;  3KP7 A;  2HQR A;  9ANT A;  3K2Z A;  4G8X A;  2K85 A;  1IGN A;  2M8G X;  2K5C A;  5ERI A;  1W0T A;  3PFY A;  2WC2 A;  3CJQ B;  3Q9S A;  4CSW A;  2NVX J;  1DP7 P;  4UXN A;  2ZME A;  4LFU A;  2W48 A;  1Y56 A;  2OTL I;  2DA4 A;  3M8E A;  2QSH X;  3GW2 A;  1XX5 A;  2NOG A;  4BJT A;  2Y69 H;  1Z7L A;  4UHT A;  4EQQ A;  3BCB A;  2MH2 A;  1ETY A;  2F4M B;  4OU0 A;  1XMX A;  4LG0 B;  3G1L A;  1V5E A;  2QSF X;  4G7Z F;  2AS5 F;  1ZAR A;  4HBL A;  3WTU C;  1FBU A;  1LVA A;  4I99 C;  4XRS G;  3PIP F;  4AWX B;  5C44 J;  2G7U A;  4L9T A;  2A6E F;  3BPX A;  1P2F A;  1BL0 A;  1D0X A;  4HOB A;  2H6C A;  3ZQF A;  1B72 B;  1R5G A;  2Q0O A;  1YS7 A;  2VAS A;  5D6E A;  1SAN A;  3I4P A;  4QSH A;  3OSF A;  1T38 A;  4LIV A;  3VSK A;  1IAW A;  2M0C A;  3MZH A;  4RA2 A;  3HGY A;  4FCY A;  4M73 A;  3M1E A;  4XRM A;  1FBS A;  1SVL A;  2WY8 Q;  1KYZ A;  2R5Y A;  3NRV A;  1BC7 C;  4HAM A;  3HKZ N;  4IRI A;  4Q48 A;  4OIN F;  4KIC A;  1E3O C;  2V26 A;  1SD7 A;  3DU6 A;  4PJ0 C;  2P5V A;  1OMI A;  3HRM A;  4BJ6 C;  2R93 J;  1UG0 A;  2P8T A;  1VQ4 I;  3HOT A;  2Z5U A;  3SHF A;  3K4K A;  3KP5 A;  2X0L A;  2FU4 A;  2KIF A;  2OBP A;  1X1A A;  2EA4 A;  2MAB A;  1NTC A;  1VQ7 I;  2YUS A;  1MNE A;  4MEY F;  4YIF A;  1PUF A;  2RVC A;  2X6X A;  4NUB A;  1FYK A;  1DP3 A;  3OL3 A;  3WU0 A;  4V19 K;  1F36 A;  1LUJ B;  3GCM A;  3CF5 F;  3LA3 A;  2KKO A;  2EFW A;  3M4O J;  1VQP I;  3ROU A;  4CHU A;  1ETO A;  1MMA A;  3PJR A;  4IPA A;  2NVU B;  1QBJ A;  4B43 A;  2Q1Z B;  2HDD A;  2ZFU A;  5FFX A;  4UNO A;  2E7X A;  3GYH X;  5E17 F;  1R7J A;  3FK6 A;  3TDU C;  5H6Q A;  2PMH A;  2M45 A;  4MFD A;  1G8X A;  3J80 Z;  2R7W A;  3QP5 A;  3U1D A;  4XKW A;  2DMP A;  1I1G A;  4F92 B;  3EUH A;  5BMZ A;  5JLX A;  2KHM A;  3QPS A;  2RQP A;  1MH4 A;  1UJ8 A;  1R00 A;  4IF4 A;  4JQF A;  5CVI A;  3TP0 A;  2L7Z A;  3CC4 I;  3BTJ A;  3TDZ C;  3GO5 A;  1X3U A;  3QWL A;  3G73 A;  2F5C A;  2NNN A;  1Z6T A;  2QQ8 A;  3JRI A;  1HW1 A;  4Y33 A;  2EIJ H;  1O3T A;  1CQT A;  2ZB9 A;  4G6T B;  4IQ4 A;  1P6R A;  4XOT A;  3JRA A;  2HOS A;  1FTZ A;  2EIM H;  4B1R A;  3I0T A;  3ZN1 A;  1HDD C;  1DUX C;  4GFB A;  2XPW A;  2HR3 A;  4DOZ A;  3HGG A;  4DIQ A;  1BIB A;  3BCA A;  4AIK A;  4XON A;  2CUZ A;  2L01 A;  5FKN A;  2HTS A;  4C3I J;  3M07 A;  1YTY A;  1SAX A;  2R0Q C;  2GXB A;  2O03 A;  4BHC A;  3CCL I;  4P9U A;  2X6O A;  2F5D A;  2VL8 A;  5M3F J;  5BNG A;  1WPK A;  4JX4 A;  2CUJ A;  1FP2 A;  2KL4 A;  1TC3 C;  4AIJ A;  3G6E I;  3OV8 A;  3E6D A;  2G7H A;  2WWY A;  1IG7 A;  5DD8 A;  3BOQ A;  3ZQC A;  4D5F A;  5F6F A;  4XKB A;  3V7S A;  3GVA A;  3J81 K;  5E1W A;  5EEA A;  4S05 A;  4WWC A;  2L9R A;  1NG7 A;  3S17 J;  2E5Z A;  2OAZ A;  2MFZ A;  3I58 A;  2ZXW H;  2W82 A;  3HXL A;  3KCC A;  1DGW Y;  3HRU A;  1ONV A;  3OWT A;  2IGK A;  2YX4 A;  2EIL H;  1S7A A;  3BY6 A;  3OMY A;  5GAE J;  1IRX A;  1R5H A;  2QQB A;  1DU6 A;  2CO5 A;  3ESW B;  1PP8 F;  3DXJ F;  5AON A;  4Y7N J;  2WB1 N;  2DI3 A;  3G2B A;  2BVL A;  5EGO B;  1WVR A;  1DPU A;  1LEA A;  1ZEL A;  2MW8 A;  5GPA A;  2VIX A;  3EUA A;  4O5V A;  4ZJZ A;  2X98 A;  3H9G A;  3E7L A;  1WJD A;  3DU5 A;  1HW2 A;  3WGI A;  3D5R C;  3DCF A;  2C6Y A;  4CCK A;  4IHY A;  4A0X A;  3G1M A;  4OMY A;  3PL8 A;  2PJR A;  2ELJ A;  1TP4 A;  2Y0M A;  3JSP A;  1CF7 A;  1TW2 A;  2UWM A;  2MH9 A;  4RS8 A;  2AQE A;  2H6B A;  2V79 A;  1MSE C;  3CMA I;  1TQM A;  3O6B B;  2GWR A;  2A69 F;  3N05 A;  5CYV A;  3IH4 A;  1OKR A;  2VI6 A;  1Q1V A;  5C3E J;  2NRA C;  4BY1 J;  4ZYE A;  4C3H J;  2KZG A;  2VBY A;  1ZRC A;  2EFO A;  4TV7 A;  4O6J A;  5FKK A;  3H1C A;  2YS9 A;  2O8K A;  2NS8 A;  1I3A A;  1KU9 A;  4IOA F;  4UV9 A;  3RJP A;  1IV8 A;  5FLX Z;  3OYG A;  1LDJ A;  5F27 A;  1DGR M;  4I0A A;  4AVZ A;  5L3F A;  1GVJ A;  5GPC A;  1LFB A;  1YIT I;  5IYC J;  3BQZ A;  4ENN A;  2AXT C;  1STZ A;  3TED A;  2E2I J;  5E18 F;  2DK5 A;  3GLX A;  1UHW A;  5KCM A;  3CDI A;  3CCM I;  2JTV A;  1MDM B;  1YJN I;  3PFI A;  4KIF A;  5EYR A;  2LBF A;  1FIA A;  2DPU A;  4RM3 A;  1F4K A;  3D5S C;  2H09 A;  2GLO A;  2R5Z B;  1OIS A;  2WA0 A;  2FNA A;  2E1N A;  2FJ1 A;  1BA5 A;  3CCS I;  2ISZ A;  2FF4 A;  3FHN A;  4JYK A;  4JX6 A;  3MKL A;  5A2Q K;  3FXK A;  1LE8 B;  2Y0S N;  3LSK A;  3L2W A;  3J81 R;  2A61 A;  1QPI A;  3ABT A;  4OIR F;  3EPZ A;  2JPC A;  1WGX A;  5KNL A;  1FOY A;  4IHX A;  1WQ2 A;  3DKY A;  1B6A A;  4CCJ A;  4GGG A;  3K4J A;  4L9N A;  4Y4R A;  2IXS A;  2K40 A;  2Z33 A;  4ENM A;  3V8L A;  5FB2 A;  3M8F A;  4RMN A;  4NQW B;  3FXL A;  5HDG A;  4ESJ A;  4ZYA A;  5DEQ A;  2L7K A;  2DQL A;  2MC4 A;  1J59 A;  3S3N A;  1EV7 A;  5L3B A;  1J5Y A;  4H0E A;  2V7F A;  2VPR A;  4YEJ A;  4UUS B;  4RAF A;  1V55 H;  2M7A A;  1LKX A;  4BU2 A;  3HL2 A;  1B8I A;  2GBY A;  2O9L A;  3OR2 C;  2PX9 A;  1QPM A;  3BG9 A;  4GO1 A;  2DMQ A;  1R6R A;  1TTY A;  5HS7 A;  2ME6 A;  3UNG C;  5BPD A;  4CCL A;  3BWG A;  3CUQ B;  4BXF A;  4DW6 A;  2ACJ A;  5E79 C;  1BOB A;  5F04 A;  1Z1D A;  1RUN A;  4AID A;  2XVC A;  2W85 A;  4MTE A;  3AG3 H;  4M3E A;  2DDA A;  2LP0 A;  1OR7 C;  3DPL C;  1YJW I;  2K86 A;  1JKR C;  2FSW A;  2M0M A;  1FZP B;  2DCE A;  1TWC J;  3JW4 A;  4U0W A;  2EZH A;  1S6L A;  1WRJ A;  2B7E A;  3VDX A;  5F1R A;  3GME A;  4E7J A;  1IRZ A;  2R7X A;  2EIN H;  2HNH A;  2PG4 A;  1UZC A;  1ZGW A;  2X1C A;  4Y52 J;  1X58 A;  2BBY A;  2DMN A;  1S7O A;  1OQY A;  3HDD A;  2PMZ A;  1IC8 A;  1FOK A;  3A0B C;  3L2V A;  1Y8R B;  5HLG A;  2JT1 A;  1F9N A;  1BIA A;  3HJE A;  5EG0 A;  2O6G E;  2XF5 A;  3LSH A;  3E5U A;  3SDG A;  3KYC B;  1B59 A;  2JUC A;  4OOI A;  4MHG A;  3F8C A;  2RRE A;  1HDP A;  1SD5 A;  3TW6 A;  2DA1 A;  3OYH A;  1KQ0 A;  3ISP A;  4HV5 A;  2JA5 J;  1WJF A;  1XS9 A;  2COB A;  3HOW J;  2DO7 A;  3LMM A;  2QQ9 A;  4N9H A;  4OMZ A;  4UB6 C;  2DMT A;  4FIS A;  1UCR A;  3BR2 A;  5A2Q R;  3BG5 A;  2FEZ A;  1JTX A;  1G6N A;  4LLL A;  3MN2 A;  4C2M J;  3FBI B;  1IRF A;  2IBD A;  2XKP A;  1Z6R A;  2HFH A;  2EV0 A;  3COA C;  1YX3 A;  3CO7 C;  1GT0 C;  4L9J A;  2OZ6 A;  1MGT A;  3J81 Z;  1IUY A;  5TJJ A;  3GZ6 A;  2ZME B;  2JSC A;  1TT0 A;  2D1V A;  1HST A;  1TWG J;  4PJJ A;  4Q4Z F;  1R1U A;  2IW5 A;  2RNJ A;  3FXM A;  4OIO F;  3WTV C;  4JOM A;  3CCU I;  1X2N A;  3JRD A;  2GXA A;  2ZSH B;  3F72 A;  2H94 A;  3K4B A;  3HPH A;  3I56 I;  1YS6 A;  5D5X B;  4BUP A;  3IV5 A;  4II2 A;  4V2G A;  4C30 A;  3ZR8 X;  2XB0 X;  1FX7 A;  1Z9C A;  3U21 A;  2FUG 2;  3S2H J;  2W1O A;  3OYC A;  5FLV A;  2EB7 A;  5FLM J;  5J1Y A;  3Q5F A;  2AQF A;  1EKE A;  1MBH A;  4BBS J;  2HKX A;  4KIS A;  2BZT A;  2KIQ A;  1MMS A;  5HDK A;  1AOY A;  4PZJ A;  2JZY A;  2BW3 A;  1BI2 A;  2P7C B;  3QP6 A;  1JT6 A;  2VC1 A;  4N0B A;  2IA2 A;  3QOE A;  2IA0 A;  1FSH A;  2IS1 A;  1V4R A;  4LLG F;  2XKO A;  2UXN A;  1IN4 A;  1N25 A;  5K7Z A;  3TL4 X;  3HG9 A;  2F4I A;  5GAG J;  2R5Y B;  4HLX A;  1D8K A;  3N4M A;  4I01 A;  2VQC A;  2ZC2 A;  1ZTR A;  2FX0 A;  4FQG A;  3BZC A;  5J6X A;  5FKO A;  1FTT A;  1U5T C;  4M9Z A;  1ZR2 A;  3C2B A;  5GTI C;  2VOD A;  3S2D J;  1D8J A;  1LDK B;  2ZBK A;  1YE9 A;  1NH3 A;  2F5E A;  1SFK A;  5LGN A;  3RKY A;  1PUF B;  1XN7 A;  4DYQ A;  1T08 B;  3LSM A;  2F5V A;  5LLQ A;  1TWF J;  3CLO A;  2GA1 A;  2RAE A;  2XGC A;  3HOS A;  1CGP A;  3LA2 A;  2KT0 A;  5J4Y A;  4II3 A;  3P9C A;  3WE2 A;  1XGO A;  4DBQ A;  2XAJ A;  2E1O A;  2DQR A;  1HF0 A;  3ZMU A;  1OLT A;  4FTH A;  4WXC A;  1WH7 A;  2M4K A;  1GLN A;  2WAQ N;  3AG1 H;  5A2Q Z;  3D0S A;  3OYB A;  4KDP A;  1ON2 A;  4A6D A;  1U8B A;  2CS3 A;  1IDZ A;  4PCQ A;  4C2U A;  3T8R A;  3GTM J;  1KU2 A;  4BBR J;  1R36 A;  2HOE A;  1X3Z B;  3MD2 A;  2WAD A;  4GYI A;  4KT5 C;  1MZB A;  3NEU A;  3DLA A;  1SD4 A;  1LQ1 A;  4RLF A;  3BQY A;  2BEO A;  3RPQ A;  3FMQ A;  3KZI C;  1LEB A;  2MYS A;  3S3O A;  2JVG A;  4K2E A;  1U0J A;  3S1N J;  1LVK A;  1TZL A;  2IGM A;  3BG7 A;  2QKM B;  1IRG A;  3LQQ A;  1YRN A;  3DV8 A;  1MKM A;  1OPC A;  2DA3 A;  3JRG A;  4DZJ A;  1WZ2 A;  2CUE A;  3H36 A;  2OD5 A;  4UUS A;  1E17 A;  2BVM A;  4P9F A;  3K1P A;  4R1H A;  3KP4 A;  3ZOB A;  4XLH A;  3A01 A;  4Z2Y A;  1QZY A;  3RYR A;  2H8W A;  1W36 C;  3WU1 B;  2R3S A;  1H0M A;  3J7Z I;  3PQJ A;  4Y17 A;  2F2E A;  5H2F C;  2CGP A;  4LB6 B;  5FRO A;  1T56 A;  4ESB A;  4GDF A;  1K6O A;  5D5W B;  3EUH C;  2GIV A;  1K4T A;  2VBZ A;  1XSV A;  2ISY A;  3BR5 A;  5IYD J;  1W5C C;  3A4C A;  4RB2 C;  2GZW A;  1P7I A;  2EA2 A;  2L9N A;  3ONQ A;  3MAJ A;  1XDU A;  2BY0 A;  1LFP A;  3K4M A;  3KYD B;  4ZC3 A;  5GAH J;  2A5W A;  3VYR B;  1K7A A;  1I3Q J;  3WGG A;  1ZG1 A;  1YG2 A;  2DBB A;  4ZDP A;  4D7N A;  2L3D A;  3Q3S A;  1MD0 A;  3VB2 A;  3GTK J;  2UUZ A;  2HDC A;  5AIP A;  4U0Y A;  1UHM A;  3LA7 A;  2IA1 A;  2DDB A;  4PGH A;  2Z1D A;  4X1E A;  3PM1 A;  3ASN H;  2R7T A;  1XB4 A;  3C2G A;  1JI8 A;  2FOW A;  2K27 A;  5JVG F;  1YI2 I;  2EH3 A;  3H5N A;  3S93 A;  3KLO A;  3MQ0 A;  2X1E A;  4N4N B;  3X2Q H;  1U8R A;  4A5N A;  3RYP A;  2IP2 A;  2PJR B;  2HOA A;  4A3M J;  1PDN C;  3QU6 A;  1WJA A;  5HLH A;  1R4N B;  1CF7 B;  2EQR A;  1I39 A;  4H4K C;  4M3F A;  4WCG A;  3OYL A;  4BE0 A;  5K5O A;  3FF5 A;  1H88 C;  5F1J A;  5HS9 A;  3M1C A;  4IRH A;  1FIP A;  2KFD A;  3E5X A;  1U78 A;  3S32 A;  3IWF A;  2WBM A;  3LQR A;  4U87 A;  1BR2 A;  3J7A O;  4AU7 A;  1Z21 A;  3IC7 A;  4RB3 C;  1HSJ A;  1MNM C;  4E7I A;  4KN7 X;  4LK0 F;  3P9I A;  1IXR C;  5FLX K;  2KZV A;  4DZP A;  2ECB A;  4OIP F;  3V4G A;  3K0L A;  2K9L A;  2E2J J;  4U88 A;  4I6Z A;  3GFM A;  2BXY A;  3OYI A;  2X85 A;  3JTH A;  3LSR A;  4KMF A;  1U5T A;  2VKE A;  3A02 A;  2M3A A;  3SXY A;  1YYV A;  1V3F A;  3MMY B;  3ZMZ A;  2ME0 A;  4QIW N;  4HF1 A;  4PGG A;  5L3G A;  2GOM A;  4CO8 A;  2JQ7 A;  2JUG A;  2LBF B;  3V42 A;  1BN5 A;  1VND A;  2Y31 A;  4ZTF A;  4HPQ A;  2ZXI A;  1T98 A;  4UB8 C;  3H3U A;  2W57 A;  4XOP A;  1QA6 A;  2ZJ2 A;  5CKT A;  2TCT A;  2PI0 A;  2E71 A;  4XKC A;  3I54 A;  2JK3 A;  3BLY A;  3KZY A;  2W00 A;  2L9V A;  4KMU X;  4M3G A;  3F6V A;  2EJR A;  4EGZ A;  4A6E A;  4AYB N;  3DPU A;  1IO2 A;  3KX2 A;  3HRS A;  5KAF C;  5H20 A;  2XGX A;  2OCE A;  4BY7 J;  3RQI A;  1TQP A;  4DQ2 A;  1RC9 A;  2VKV A;  1ZGJ A;  5LHI A;  1O3S A;  1Y1V J;  3E97 A;  1GDT A;  5IP7 J;  3DEU A;  1GXP A;  2O7O A;  4HST A;  4P96 A;  3ZP5 A;  4XMY A;  2K9S A;  1B8I B;  1W36 D;  2B63 J;  3OYK A;  2ZKZ A;  2ADU A;  2LG4 A;  5IP6 A;  1ZK8 A;  3ZMD A;  4ESF A;  3CD6 I;  3KYL A;  2VKD A;  1L3L A;  4M6X A;  1UST A;  3DTI A;  2ZFW A;  1XMK A;  2LH9 A;  4FAS D;  3VWB A;  4C9Y A;  2LSO A;  2VJI A;  3QPH A;  2OA4 A;  3LFU A;  1MH3 A;  3QPL A;  2VQH A;  2Z99 A;  3GFL A;  1BR4 A;  1FY7 A;  3L2U A;  1T6S A;  2YX7 A;  3KET A;  2COM A;  2DW4 A;  5E8G A;  2HZT A;  2M5W A;  1G3W A;  2HPM A;  3MZ8 A;  4Y13 A;  3H5A A;  3W3C A;  3EYI A;  4G7O F;  3J7A Y;  3WTX C;  3F3X A;  4D5C A;  4XLA A;  1C0W A;  5ICF A;  3ZQL A;  4CDG A;  5TIS C;  2DYR H;  5FLX R;  2R92 J;  1PP7 U;  1YX5 A;  4IJA A;  4UV8 A;  5F64 A;  4HDV A;  2R7S A;  3OS0 A;  2VE8 A;  3I59 A;  3BTI A;  4RGU A;  4XLC A;  5EG0 B;  3PSF A;  1VI0 A;  1SEU A;  1WKM A;  1KON A;  1ODD A;  5BPI A;  3LL7 A;  1OYI A;  2JRT A;  4HQM A;  5JI6 A;  2LY2 A;  3WTY C;  4BDZ A;  4DYC A;  3LOC A;  3W2V A;  2N8G A;  2XGE A;  4LLN A;  2CSO A;  1N77 A;  2KMU A;  2QBY A;  1YLF A;  4HDU A;  3MFK A;  3ERM A;  3OYD A;  5DS9 A;  2DOA A;  2V6C A;  1JUM A;  1XCB A;  3IH2 A;  3CUO A;  2O61 A;  1ULY A;  3KEQ A;  1HKT A;  2QEN A;  3VYS B;  4WX9 A;  4KIG A;  1Z3X A;  1EF4 A;  3W6V A;  4GCV A;  3SJM A;  2DOF A;  3GLL A;  5J4V A;  3GTP J;  3DBH B;  4Q47 A;  1V5F A;  3BP8 A;  3FM3 A;  1FMW A;  2XGD A;  3HBL A;  5J40 A;  4GYG A;  4XLF A;  2TRT A;  2WV0 A;  3L9F A;  1ZRD A;  2IS6 A;  1TL8 A;  1JGG A;  3DTE A;  1XG1 A;  2H27 A;  5LBQ A;  4RAY A;  3FXJ A;  4RAZ A;  1XD7 A;  3T0Y A;  2BHY A;  2FML A;  2AXL A;  3DP7 A;  5BS6 A;  4F52 A;  2VLA A;  2PQ8 A;  1FLI A;  5EJC A;  1RKW A;  2XRO A;  2M30 A;  5HVQ C;  4PFP A;  1VQK I;  4BXX J;  5KK1 A;  3BR0 A;  1BBY A;  3TO7 A;  5D8K B;  4HX4 A;  2XRN A;  2DLL A;  1JKO C;  1LJ9 A;  3BJO A;  5LFA A;  1WI3 A;  2ESN A;  3RKX A;  3CZ6 A;  2DMU A;  4A3J J;  3O8H A;  4DJA A;  1D0Y A;  1OCZ H;  4CZC A;  2CU7 A;  3E0J B;  2BW3 B;  3C3W A;  5B3S H;  3BC8 A;  2CH0 A;  1Y8Q B;  3GX4 X;  3ECO A;  3K4L A;  2XAG A;  5HDN A;  1UG2 A;  1YIO A;  1S3J A;  2JA2 A;  2E35 A;  2DAO A;  6PAX A;  4EJV A;  2HQA A;  2V1X A;  2FOK A;  4LJZ F;  2UXX A;  2V1U A;  1RKT A;  3MZY A;  1FYM A;  4IEJ A;  5IT9 K;  1DU0 A;  2R4G A;  1D1C A;  3H9J A;  2LR8 A;  1GHC A;  5CPR B;  5F0H A;  2VON A;  4IHS A;  1BW6 A;  2DA7 A;  4YEL A;  1B1B A;  2WAF A;  1POG A;  5IOZ A;  2IVM A;  1APL C;  3U1K A;  2ZJR F;  2CFO A;  1P4W A;  3OS1 A;  1SVM A;  2RDP A;  3OY9 A;  3ZQG A;  1PVE A;  3HSF A;  3PIO F;  4CZZ A;  2EK5 A;  3ABK H;  3FM5 A;  3BR6 A;  3GF2 A;  3IL2 A;  4A3D J;  3TKY A;  2MD5 A;  5M5Y J;  2P6T A;  4XLP F;  2K9M A;  2GAU A;  4CUG A;  4RBO A;  3LAP A;  1MBE A;  4XLN F;  2OQR A;  2GQQ A;  4EMS A;  1YW8 A;  1H8A C;  5CVV A;  3QPT A;  4I7H A;  3CCV I;  4FHT A;  3GUD A;  3S14 J;  1IZ1 A;  1QHG A;  1Y6I A;  5F0C A;  1QVT A;  2PEX A;  1X4P A;  1G3T A;  1SFE A;  3K69 A;  3HIF A;  1YHQ I;  1IJW C;  1E3P A;  3ZQI A;  4CGZ A;  3EUK L;  5L3D A;  3KLN A;  5KHD A;  5J1R A;  1FP1 D;  3PO3 J;  2VT2 A;  1A36 A;  5IY5 H;  3H5R A;  3FMR A;  5DYM A;  3GZN B;  1BOA A;  2DFI A;  5CJ9 A;  1KU3 A;  1BI1 A;  1K83 J;  2KJB A;  4DNC A;  1WSU A;  1AKH A;  3CCJ I;  3AG4 H;  4RLQ A;  2KJC A;  1VQN I;  4AD9 A;  3CP8 A;  4E7L A;  2GM4 A;  1YRN B;  2QA4 I;  2Y9Z A;  4M72 A;  4E6K G;  1X1D A;  2NYX A;  5FRM A;  3QOP A;  5E1X A;  2A6H F;  3HKZ A;  2HYJ A;  2VJJ A;  1TLH B;  5LHH A;  3A01 B;  1JHH A;  1YW9 A;  2P7V B;  1YO5 C;  3MKW B;  5CLS A;  3IHU A;  2HXO A;  1JGS A;  3OYE A;  5HOD A;  3GTQ J;  3W2A A;  2OC6 A;  2LVS A;  1RPW A;  2M7B A;  1FYL A;  1ZN2 A;  2ZO4 A;  5ICG A;  3HOU J;  1F5T A;  3ZQH A; 
#chains in the Genus database with same CATH homology
 2L02 A;  3K9T A;  3FXQ A;  1TW3 A;  3F21 A;  5E20 A;  3V7R A;  4CXF A;  3GFJ A;  1O7F A;  3LFK A;  1U2W A;  4U7D A;  5JR3 A;  2DU9 A;  1BJA A;  3HTU A;  3DKW A;  4ZYD A;  3H92 A;  3IKT A;  2P5K A;  3HUG A;  3O2P E;  4LK1 F;  4A0Z A;  4S04 A;  2FBH A;  5DDG A;  2YU3 A;  5L3E A;  2K02 A;  2D2W A;  3U9G A;  2R7F A;  4O3M A;  1KQ9 A;  2TDX A;  4L0Y B;  1KU7 A;  3NQO A;  1P92 A;  1XDS A;  4G7H F;  1ZRE A;  3E3V A;  3ZPL A;  1ZYR F;  1BC8 C;  1HQC A;  4MEX F;  4MTD A;  5LEK A;  1TBX A;  1U5T B;  2XAH A;  4EV0 A;  4ZZL A;  3G3Z A;  3QU3 A;  3IRR A;  1NHA A;  2CWE A;  1JXS A;  2M87 A;  3FXR A;  3V7C A;  2OQG A;  3QAH A;  1G3S A;  1XSX A;  1HKS A;  1Z91 A;  3EQL F;  2X4H A;  1XGS A;  4FX4 A;  2KIU A;  2OZU A;  4LB5 A;  2VBW A;  2LF7 A;  1O7L A;  5JFR A;  3LST A;  5EEG A;  4EM1 A;  2FBK A;  5IT9 Z;  4BHB A;  2VOP A;  2J5O A;  5ICE A;  3L7W A;  3VOD A;  3VFZ A;  2E7W A;  3R61 A;  2W84 A;  1H9G A;  1Y0U A;  2NAZ A;  3RIR A;  4BH9 A;  2ESH A;  5LRR A;  2PFB A;  2DTR A;  5EEH A;  3CTA A;  1BI0 A;  1K78 A;  5ILU A;  3ML6 A;  4MGR A;  2VE9 A;  3P9K A;  2EFP A;  5CVJ A;  3REO A;  3L00 A;  3KP3 A;  2NS0 A;  2XAF A;  1BM9 A;  2Q8K A;  3ZMS A;  2FMY A;  1Z05 A;  4ON0 A;  1WWX A;  2ELH A;  4PDK A;  3MWM A;  1KYW A;  3LWF A;  4KUM A;  3I59 B;  4IVN A;  2UZK A;  5ICC A;  2GXG A;  2V9V A;  3C1D A;  5BQT A;  3WOD F;  1O3Q A;  4CIC A;  3RI4 A;  2QBY B;  2W24 A;  1H9T A;  5TRD A;  1G4D A;  4ZZD A;  2VT3 A;  2Z9O A;  2Z3Y A;  4G9Y A;  5JHU A;  4KIB A;  3F8F A;  3JTG A;  3RPU A;  4ENK A;  1LDD A;  2GA2 A;  3L2C A;  3R4K A;  1JHF A;  3CDH A;  1YFH A;  1OYY A;  4UVA A;  4IXA A;  3W6K B;  4ENJ A;  1IF1 A;  4KNY A;  2HEO A;  3TO6 A;  2PBI A;  1T2K A;  4L5J A;  1RIO H;  3EYY A;  3RTR A;  2PJP A;  3K1M A;  2A3S A;  3E6M A;  4FX0 A;  4ETS A;  2HYF A;  5D5U B;  3BPV A;  4L18 B;  1MJA A;  1B9N A;  4BQA A;  4I02 A;  1TNS A;  4Y15 A;  5CVR A;  3GXO A;  4EJO A;  3R0A A;  4HF2 A;  4RGR A;  2VXZ A;  2RV8 A;  5L3C A;  4RGS A;  1I6X A;  5LRS A;  1DPR A;  4EVI A;  1Z7U A;  1PUE E;  1SMY F;  3F8N A;  1EH7 A;  2EV5 A;  3PQK A;  3F8B A;  4HA8 A;  2Y48 A;  1J0R A;  5K1Y A;  4BHP A;  1FC3 A;  5LGT A;  4RGX A;  5IT3 A;  1HXD A;  1ZG5 A;  5JVT A;  3T8T A;  1IN8 A;  3FX3 A;  3ABU A;  1KA8 A;  1RZ4 A;  2Q2E A;  2FBI A;  1ZG3 A;  2DT5 A;  3TQN A;  2YR2 A;  3D5L A;  3HRT A;  2WTE A;  2VN2 A;  4ZYH A;  3MCZ A;  1XGN A;  4QWQ A;  1I1S A;  2D45 A;  2L4A A;  2KRF A;  1FBQ A;  3R6S A;  2HKO A;  2O3F A;  3JAM Z;  1EH8 A;  4QLC U;  2QUF A;  2A68 F;  5DD4 A;  2P5L C;  2EFN A;  4EM2 A;  2L54 A;  2ZNY A;  4RB1 A;  1FNN A;  1KQ8 A;  2QVO A;  4XSX F;  4NHJ A;  2CYY A;  3IRQ A;  3S2W A;  3AAF A;  1K79 A;  5HOO A;  4P5O A;  2K4J A;  1ZLJ A;  4M71 A;  3N97 A;  5D4R A;  2BE5 F;  2MLG A;  5HS8 A;  4OIQ F;  2B0L A;  3LAJ A;  1IW7 F;  1J9I A;  1YQA A;  4YFN F;  4M9X A;  4LD5 A;  4YFX F;  2IJL A;  3KE2 A;  3O3K A;  4JBA A;  4IHT A;  3L09 A;  1ZAO A;  1S29 A;  4XSZ F;  2CG4 A;  3SZP A;  3DPT A;  3HHG A;  5ILS A;  3V8K A;  5FD6 A;  1W4M A;  1XCV A;  5E8I A;  4HQE A;  5KVR A;  3F8M A;  4BXU A;  4A2U A;  2BYV E;  1B9M A;  1HKQ A;  2A07 F;  3OOP A;  4MQV A;  3WE3 A;  5K5Q A;  3B73 A;  1TQI A;  3KEO A;  4Q5S F;  1J7K A;  1BI3 A;  2F5F A;  4YII A;  3ZMV A;  3B02 A;  2DPD A;  2Y75 A;  1OYW A;  2FE3 A;  4HZF A;  4HW0 A;  4B09 A;  3BRO A;  4R8H A;  2IRF G;  5FO5 A;  2FA5 A;  1L0O C;  1SMT A;  3KP2 A;  3KP6 A;  3IWZ A;  1XMA A;  4L9V A;  2D1H A;  2PN6 A;  3C7J A;  2EV6 A;  4EGY A;  1LNW A;  4HLY A;  1QO0 D;  3P7N A;  3I71 A;  1YW7 A;  1ZRF A;  4EJU A;  2M8E A;  5DCM A;  1DDN A;  1I27 A;  5LEJ A;  1TNT A;  1Q1H A;  4BAY A;  3GEZ A;  2IT0 A;  4KYW A;  3TOA A;  2P4W A;  1RI7 A;  1W7P D;  3EET A;  2M1B A;  1E2X A;  1ZGA A;  3VOE A;  2PLY A;  4ZH4 F;  1W5S A;  3HTS B;  1XSD A;  1R23 A;  2O8X A;  4JK1 X;  3BZ6 A;  2XIG A;  1EH6 A;  2XHK A;  1W7P A;  2VBX A;  1QQI A;  3R0J A;  4HX8 A;  4HYE A;  3WTT C;  4EJW A;  1VTN C;  3ZMT A;  2J5P A;  4EM0 B;  1QZZ A;  2VC0 A;  1R58 A;  1FPQ A;  2ZNZ A;  1K78 B;  1R22 A;  2STT A;  2QYO A;  3C18 A;  1FWZ A;  3HYI A;  3GZ5 A;  2E1C A;  1QNT A;  2FXA A;  2L4M A;  2FRH A;  3SQN A;  1T0F A;  3CJN A;  3VEP A;  4LG0 A;  2LDU A;  2A5Y B;  5FD5 A;  3EDP A;  1UB9 A;  4NB5 A;  2HWV A;  3V8J A;  4AVP A;  3M9A A;  4BYY A;  2G9W A;  4UVB A;  1ZLK A;  2R7D A;  2DK8 A;  2FNP A;  3FZV A;  2LF8 A;  4HV6 A;  3ULQ B;  3SZT A;  2CW0 F;  2MBF A;  4A12 A;  3BJ6 A;  4A5M A;  4UUV A;  4ASN A;  5D5V B;  2QZ8 A;  5D8L B;  5LGU A;  5DUI A;  3KFW X;  3Q9V A;  2EWN A;  3DQV C;  5E1Z B;  2XAQ A;  2HQN A;  4FT8 A;  3ERE D;  1JE8 A;  1REP C;  4HX7 A;  4XRF A;  4D0P A;  1IN6 A;  1T39 A;  5FGM A;  5D4S A;  1IXC A;  1R1T A;  4G6D A;  2FQ3 A;  3DFG A;  3MEX A;  2XAS A;  5DV5 A;  4G94 A;  5LHG A;  4G6Q A;  2CQK A;  2V1D A;  2STW A;  3RKW A;  1SFX A;  4L5I A;  4WXH A;  4MQ9 F;  4E70 A;  2K4B A;  1IXS B;  2JPB A;  3CUQ C;  4N9I A;  5ILV A;  4XBF A;  1FT9 A;  4MNU A;  3I5U A;  1R1V A;  2HYG D;  4WK8 F;  3JSO A;  1LB2 A;  2QLZ A;  5J8C A;  1P4X A;  2PMU A;  3FWE A;  4R79 A;  1RNL A;  1GXQ A;  3M7G A;  1IN7 A;  3WTS C;  3E5Q A;  1P4A A;  1D3Y A;  3IKV A;  2P6S A;  3T5X A;  2QM3 A;  5DUK A;  2HTJ A;  3BDD A;  2LNB A;  3H3Z A;  3JAM K;  2W25 A;  5BOX A;  2VOO A;  3HSR A;  4YG2 F;  4KA4 A;  1MJB A;  2O0Y A;  3W6J B;  1FSE A;  3TO9 A;  3ZN0 A;  2ETH A;  4U0V A;  1SFU A;  2LKP A;  2MLK A;  2RN7 A;  2QWW A;  5DCF A;  3BJA A;  2IPQ X;  4BNC A;  3FMS A;  3WG9 A;  2RKH A;  2QQA A;  1U3E M;  3FHZ A;  1O3R A;  4KFC A;  4UVC A;  5H6R A;  4L0Z B;  1I5Z A;  3GFI A;  2YPR A;  4LMY A;  1W5T A;  1J2X A;  2K7L A;  2NNY A;  1RUO A;  4B8X A;  1S8N A;  1ZHF A;  1UFM A;  1HBX G;  3I53 A;  4M74 A;  3K1N A;  3WTZ A;  3I64 A;  1HW5 A;  4WXD A;  1MDM A;  2MA3 A;  1WI9 A;  3GWZ A;  4RB0 A;  4AIH A;  1U6G A;  3E6B A;  3SFZ A;  1J75 A;  2ZXJ A;  3J80 K;  1XGM A;  1B4A A;  1OR7 A;  2XV4 S;  4M9S A;  3HHH A;  5FFZ A;  1MJ9 A;  1D5V A;  2HGC A;  5D6F A;  3T1B A;  4IRG A;  4NQW A;  5K5R A;  3U2R A;  3ZQ7 A;  4U7B A;  1ON1 A;  3ECH A;  1ZH5 A;  1F1Z A;  2YSR A;  4F7Z A;  3TGN A;  2BV6 A;  1QGP A;  3ELK A;  3CUQ A;  2ZCW A;  1AWC A;  4P55 A;  2OU2 A;  4I09 A;  4I0B A;  2CFX A;  3HSE A;  4LGW A;  5DCM B;  4A0Y A;  4I98 B;  3DF8 A;  2HS5 A;  1O57 A;  4ZYG A;  2BGC A;  3E6C C;  3TOB A;  5ED4 A;  1SD6 A;  3KZZ A;  4KN4 X;  3F22 A;  3FXU A;  5CVU A;  4YFK F;  1G3Y A;  1IN5 A;  3F6O A;  3WTW C;  2KIM A;  3WGH A;  4CYD A;  3RDI A;  4I2O A;  3R60 A;  4M6Y A;  1W7P B;  2MC3 A;  4HF0 A;  3F23 A;  4EJT A;  2RGV A;  1USS A;  2EFQ A;  2XUB A;  5HLI A;  3CO6 C;  5J8F A;  2RC4 A;  1A04 A;  4GXO A;  3QRF F;  5AIQ A;  4WF2 A;  1KGS A;  3KP7 A;  2HQR A;  3K2Z A;  4G8X A;  5ERI A;  2WC2 A;  3Q9S A;  1DP7 P;  4UXN A;  2ZME A;  4LFU A;  3M8E A;  3GW2 A;  4UHT A;  4EQQ A;  2MH2 A;  4OU0 A;  4LG0 B;  4G7Z F;  2AS5 F;  1ZAR A;  4HBL A;  3WTU C;  1FBU A;  1LVA A;  4AWX B;  2G7U A;  4L9T A;  2A6E F;  3BPX A;  1P2F A;  4HOB A;  2H6C A;  1R5G A;  2Q0O A;  1YS7 A;  5D6E A;  3I4P A;  1T38 A;  1IAW A;  3MZH A;  4M73 A;  3M1E A;  1FBS A;  1KYZ A;  3NRV A;  1BC7 C;  4HAM A;  4IRI A;  4Q48 A;  4OIN F;  4KIC A;  1SD7 A;  2P5V A;  1OMI A;  3HRM A;  2P8T A;  3HOT A;  2Z5U A;  3SHF A;  3KP5 A;  2X0L A;  2FU4 A;  2KIF A;  2OBP A;  2EA4 A;  4MEY F;  4YIF A;  2RVC A;  1FYK A;  3WU0 A;  3LA3 A;  2KKO A;  2EFW A;  3ROU A;  4CHU A;  4IPA A;  1QBJ A;  5FFX A;  4UNO A;  2E7X A;  3GYH X;  5E17 F;  1R7J A;  3TDU C;  5H6Q A;  2PMH A;  2M45 A;  3J80 Z;  3QP5 A;  3U1D A;  1I1G A;  3EUH A;  5BMZ A;  2RQP A;  1R00 A;  4IF4 A;  4JQF A;  5CVI A;  3TDZ C;  3GO5 A;  1X3U A;  3G73 A;  2F5C A;  2NNN A;  1Z6T A;  1HW1 A;  1O3T A;  1P6R A;  3I0T A;  3ZN1 A;  1DUX C;  2HR3 A;  1BIB A;  4AIK A;  2L01 A;  2HTS A;  1YTY A;  1SAX A;  2GXB A;  2O03 A;  4BHC A;  4P9U A;  2F5D A;  1FP2 A;  4AIJ A;  3OV8 A;  3E6D A;  2G7H A;  2WWY A;  5DD8 A;  3BOQ A;  5F6F A;  3V7S A;  3GVA A;  3J81 K;  5E1W A;  4S05 A;  4WWC A;  3I58 A;  2OAZ A;  3KCC A;  3HRU A;  1ONV A;  2YX4 A;  1S7A A;  3BY6 A;  1R5H A;  2QQB A;  2CO5 A;  1PP8 F;  3DXJ F;  5AON A;  2DI3 A;  1DPU A;  1LEA A;  4O5V A;  1HW2 A;  3WGI A;  2C6Y A;  4A0X A;  4OMY A;  3JSP A;  2Y0M A;  1CF7 A;  1TW2 A;  2UWM A;  2MH9 A;  4RS8 A;  2V79 A;  2H6B A;  1TQM A;  3O6B B;  2GWR A;  2A69 F;  5CYV A;  1OKR A;  2NRA C;  4ZYE A;  2VBY A;  1ZRC A;  2EFO A;  4TV7 A;  4O6J A;  1KU9 A;  4UV9 A;  3RJP A;  5FLX Z;  1LDJ A;  4I0A A;  5L3F A;  1GVJ A;  4ENN A;  1STZ A;  5E18 F;  2DK5 A;  3GLX A;  1UHW A;  2JTV A;  1MDM B;  3PFI A;  4KIF A;  2DPU A;  1F4K A;  2H09 A;  2FNA A;  2E1N A;  2ISZ A;  2FF4 A;  5A2Q K;  2A61 A;  3ABT A;  4OIR F;  2JPC A;  1WQ2 A;  1B6A A;  4GGG A;  4L9N A;  4ENM A;  2Z33 A;  3V8L A;  5FB2 A;  3M8F A;  5HDG A;  4ESJ A;  5DEQ A;  2DQL A;  1J59 A;  1EV7 A;  5L3B A;  1J5Y A;  4H0E A;  1QPM A;  4GO1 A;  1TTY A;  5HS7 A;  5BPD A;  3BWG A;  3CUQ B;  2ACJ A;  1Z1D A;  1RUN A;  2XVC A;  2W85 A;  4MTE A;  3DPL C;  2K86 A;  2FSW A;  1FZP B;  3JW4 A;  4U0W A;  1S6L A;  1WRJ A;  5F1R A;  2PG4 A;  2BBY A;  1S7O A;  1FOK A;  5HLG A;  2JT1 A;  1F9N A;  1BIA A;  2O6G E;  3E5U A;  1B59 A;  4OOI A;  4MHG A;  3F8C A;  1SD5 A;  1KQ0 A;  3ISP A;  4HV5 A;  2DO7 A;  2QQ9 A;  4N9H A;  4OMZ A;  1UCR A;  2FEZ A;  1G6N A;  4LLL A;  1IRF A;  2XKP A;  1Z6R A;  2HFH A;  2EV0 A;  3COA C;  3CO7 C;  4L9J A;  2OZ6 A;  1MGT A;  3J81 Z;  1IUY A;  5TJJ A;  3GZ6 A;  2ZME B;  2JSC A;  2D1V A;  1HST A;  4Q4Z F;  1R1U A;  2IW5 A;  2RNJ A;  4OIO F;  3WTV C;  3F72 A;  2H94 A;  1YS6 A;  5D5X B;  1FX7 A;  1Z9C A;  2EB7 A;  3Q5F A;  2HKX A;  1AOY A;  5HDK A;  4PZJ A;  2JZY A;  1BI2 A;  2P7C B;  3QP6 A;  2VC1 A;  4N0B A;  2IA2 A;  2IA0 A;  1FSH A;  1V4R A;  4LLG F;  2XKO A;  2UXN A;  1IN4 A;  4HLX A;  1D8K A;  3N4M A;  4I01 A;  5J6X A;  1U5T C;  4M9Z A;  2VOD A;  1D8J A;  1LDK B;  2ZBK A;  2F5E A;  5LGN A;  3RKY A;  1XN7 A;  5LLQ A;  3CLO A;  2GA1 A;  3HOS A;  1CGP A;  3LA2 A;  3P9C A;  3WE2 A;  1XGO A;  2XAJ A;  2DQR A;  3ZMU A;  4WXC A;  5A2Q Z;  3D0S A;  4KDP A;  1ON2 A;  4A6D A;  4PCQ A;  3T8R A;  1KU2 A;  1R36 A;  2HOE A;  4GYI A;  4KT5 C;  1MZB A;  3NEU A;  1SD4 A;  1LQ1 A;  2BEO A;  3RPQ A;  3FMQ A;  1LEB A;  4K2E A;  1IRG A;  3LQQ A;  3DV8 A;  1MKM A;  1OPC A;  2OD5 A;  1E17 A;  4P9F A;  3K1P A;  4R1H A;  3KP4 A;  4Z2Y A;  1QZY A;  3RYR A;  3WU1 B;  2R3S A;  1H0M A;  3PQJ A;  4Y17 A;  2F2E A;  2CGP A;  4LB6 B;  4ESB A;  1K6O A;  5D5W B;  2GIV A;  2VBZ A;  1XSV A;  2ISY A;  4RB2 C;  2GZW A;  2EA2 A;  3MAJ A;  1XDU A;  1K7A A;  3WGG A;  1ZG1 A;  1YG2 A;  2DBB A;  2L3D A;  1MD0 A;  3VB2 A;  2HDC A;  5AIP A;  4U0Y A;  1UHM A;  3LA7 A;  2IA1 A;  4PGH A;  1XB4 A;  2K27 A;  3KLO A;  3MQ0 A;  1U8R A;  4A5N A;  3RYP A;  2IP2 A;  1PDN C;  3QU6 A;  5HLH A;  1CF7 B;  4WCG A;  5K5O A;  3FF5 A;  5HS9 A;  4IRH A;  1U78 A;  3E5X A;  3IWF A;  3LQR A;  3J7A O;  3IC7 A;  4RB3 C;  1HSJ A;  4KN7 X;  4LK0 F;  3P9I A;  1IXR C;  5FLX K;  4OIP F;  3V4G A;  3K0L A;  4U88 A;  3GFM A;  3JTH A;  4KMF A;  1U5T A;  3SXY A;  1YYV A;  1V3F A;  3ZMZ A;  4HF1 A;  4PGG A;  5L3G A;  4CO8 A;  1BN5 A;  1T98 A;  3H3U A;  2W57 A;  2ZJ2 A;  2PI0 A;  3I54 A;  3KZY A;  4KMU X;  3F6V A;  2EJR A;  4EGZ A;  4A6E A;  3HRS A;  5H20 A;  2XGX A;  1TQP A;  4DQ2 A;  1ZGJ A;  5LHI A;  1O3S A;  3E97 A;  1GXP A;  3DEU A;  4P96 A;  3ZP5 A;  2ZKZ A;  2ADU A;  3ZMD A;  4ESF A;  1L3L A;  4M6X A;  1UST A;  2ZFW A;  1XMK A;  2LSO A;  3QPH A;  2OA4 A;  2Z99 A;  3GFL A;  1FY7 A;  1T6S A;  2YX7 A;  3KET A;  2COM A;  2DW4 A;  5E8G A;  2HZT A;  2M5W A;  1G3W A;  4Y13 A;  3EYI A;  4G7O F;  3WTX C;  3F3X A;  1C0W A;  5ICF A;  4CDG A;  1PP7 U;  4HDV A;  4IJA A;  4UV8 A;  5F64 A;  2VE8 A;  3I59 A;  4RGU A;  1WKM A;  1ODD A;  5BPI A;  1OYI A;  2JRT A;  4HQM A;  5JI6 A;  3WTY C;  4LLN A;  2CSO A;  2QBY A;  1YLF A;  4HDU A;  3MFK A;  2V6C A;  1XCB A;  3CUO A;  2O61 A;  1ULY A;  3KEQ A;  1HKT A;  2QEN A;  4WX9 A;  4KIG A;  4GCV A;  4Q47 A;  3BP8 A;  3FM3 A;  4GYG A;  2WV0 A;  3L9F A;  1ZRD A;  2H27 A;  5LBQ A;  4RAY A;  4RAZ A;  1XD7 A;  3T0Y A;  2FML A;  2AXL A;  3DP7 A;  5BS6 A;  2PQ8 A;  1FLI A;  2XRO A;  2M30 A;  5HVQ C;  5KK1 A;  1BBY A;  3TO7 A;  5D8K B;  4HX4 A;  2XRN A;  2DLL A;  1LJ9 A;  3BJO A;  2ESN A;  3RKX A;  3C3W A;  3GX4 X;  3ECO A;  2XAG A;  5HDN A;  1YIO A;  1S3J A;  2DAO A;  6PAX A;  4EJV A;  2V1X A;  2FOK A;  4LJZ F;  2UXX A;  2V1U A;  3MZY A;  1FYM A;  5IT9 K;  1GHC A;  2VON A;  4IHS A;  1B1B A;  2IVM A;  1P4W A;  2RDP A;  3HSF A;  4CZZ A;  2EK5 A;  3FM5 A;  3GF2 A;  3IL2 A;  3TKY A;  2MD5 A;  2P6T A;  4XLP F;  2GAU A;  3LAP A;  4XLN F;  2OQR A;  2GQQ A;  4EMS A;  1YW8 A;  5CVV A;  3QPT A;  4I7H A;  4FHT A;  3GUD A;  1IZ1 A;  2PEX A;  1G3T A;  1SFE A;  3K69 A;  3HIF A;  4CGZ A;  5L3D A;  3KLN A;  1FP1 D;  2VT2 A;  3FMR A;  5DYM A;  1BOA A;  2DFI A;  5CJ9 A;  1KU3 A;  1BI1 A;  2KJB A;  4DNC A;  1WSU A;  2KJC A;  4AD9 A;  4M72 A;  2NYX A;  3QOP A;  5E1X A;  2A6H F;  1TLH B;  5LHH A;  1JHH A;  1YW9 A;  2P7V B;  1YO5 C;  5CLS A;  3IHU A;  1JGS A;  1FYL A;  1ZN2 A;  2ZO4 A;  5ICG A;  1F5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...