4HV6A

Structure of mntr h77a mutant in apo- and mn-bound forms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
133
structure length
133
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRAELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 49
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv6A02
3V8LA 1ZLJA 3K1NA 2CO5A 2V6CA 2EV6A 2L54A 5D4SA 1FBSA 3GFJA 2OD5A 1OMIA 3KP6A 3GXOA 4YFKF 4UNOA 1ZG3A 5BS6A 3F22A 1YW9A 2L02A 3LAJA 3KCCA 1IN4A 2HWVA 4I02A 1EV7A 5CYVA 4RB2C 4HQEA 3F6VA 1CF7B 4Z2YA 1FYKA 4UVCA 3L09A 4ZZDA 3R60A 2MH9A 4U0YA 4KT5C 4AVPA 3RI4A 2EWNA 3K0LA 1Y0UA 2K7LA 3WTXC 2ELHA 1O7LA 5HVQC 1ZH5A 5ERIA 1R1VA 4U7BA 4LFUA 3LA3A 4EGYA 4Q5SF 2VBWA 3I54A 1SFUA 3RKYA 1HKSA 1R1UA 4P55A 3HSRA 5LHGA 1OYYA 5EEHA 2RKHA 5LGUA 1XGNA 3J80K 1GXPA 1U5TB 5LEJA 1LNWA 2A07F 3ECHA 3JTHA 3Q9VA 3HHGA 4RAYA 3N97A 1J7KA 2JTVA 1MJ9A 2WWYA 2IA1A 1FSHA 3LSTA 4Y13A 2GA1A 4MEYF 4QLCU 2XKOA 4UHTA 3ABTA 3C3WA 2YX7A 5D4RA 2ZO4A 1PP8F 2XAJA 3FXRA 2VT2A 2H6CA 4CO8A 4M74A 2AS5F 4M71A 1HKTA 1YS7A 1EH8A 1FC3A 1ZRFA 2EFQA 3ZMSA 2K86A 4Y17A 3FXUA 1KA8A 1P6RA 4GGGA 3DXJF 1O3TA 4HV6A 4L5IA 5AONA 1J2XA 1A04A 1OPCA 2QYOA 2EFPA 2RQPA 1XD7A 2FE3A 2WC2A 5DCMA 1R1TA 4JBAA 4Q48A 2VC0A 3TGNA 3F8CA 1JHFA 4G6QA 1FLIA 1BC8C 3V4GA 4NQWA 5A2QZ 1J59A 4LG0A 4BQAA 3BDDA 1MGTA 5FD6A 2A61A 1TLHB 3M8FA 2QQAA 2L01A 3LQRA 4Q47A 1WSUA 3FMQA 4LK0F 2UWMA 1Z6RA 4GYIA 3FWEA 2L4AA 2GXBA 1IN6A 1ZGJA 3C7JA 1D8JA 2W84A 2DK8A 1ZN2A 4FT8A 2EA2A 3P9IA 1FY7A 6PAXA 1FBQA 3E6BA 3CLOA 2QM3A 4LK1F 1Z91A 4RGRA 2QQ9A 3I5UA 3WG9A 1XMAA 1ZARA 4HOBA 3ELKA 2LKPA 3EQLF 5A2QK 5AIQA 3BZ6A 4A5MA 3WU1B 2XROA 1L0OC 3J81Z 1X3UA 2YU3A 1BIBA 3RPUA 4WX9A 5HS8A 3P9CA 2P7CB 5FO5A 5DCFA 4ASNA 4WF2A 3DP7A 3WTWC 2P7VB 4ESBA 1RUOA 3COAC 5HLGA 2JPCA 3HHHA 1O7FA 5H6QA 2P6TA 4I7HA 4MNUA 1JGSA 5KVRA 3T1BA 3B02A 3J81K 2HQNA 2DT5A 4EV0A 1KQ0A 4ENNA 4QWQA 1OYIA 1GHCA 3QPHA 1DPRA 4YIFA 1HW1A 2HKXA 1TW3A 1ZLKA 2VOPA 4G8XA 5BPDA 3CUQB 3R6SA 5LGTA 1QNTA 2GWRA 3U9GA 4HQMA 2FRHA 3GFIA 5K5QA 3WGHA 5E17F 3PQJA 3JSOA 2O6GE 1IW7F 4HAMA 5J8CA 2ZNZA 1CGPA 2H6BA 1L3LA 4YFXF 2BGCA 3V8JA 2RC4A 2MC3A 5D5UB 1K79A 2NNNA 4UV8A 1QPMA 5FGMA 2DW4A 4OIQF 2VE8A 4BHPA 3KEOA 2QQBA 4L9VA 3DKWA 3U1DA 2IVMA 4U0VA 4AD9A 2TDXA 4A0ZA 4O5VA 1LJ9A 1HW2A 5D5XB 2QBYB 3R0JA 4FX0A 5DUIA 1G3SA 1R22A 5D6FA 1B9MA 5LHIA 2OA4A 3IL2A 2BYVE 2EK5A 5DUKA 3WTSC 3HYIA 1PP7U 2F5EA 4LMYA 5IT3A 1SD4A 3CDHA 1LEAA 4WXCA 1S7AA 4AIKA 5LGNA 1XMKA 3GLXA 2IT0A 1DPUA 3C1DA 5LEKA 1LEBA 5H6RA 2STTA 2P5LC 4ESJA 2KJCA 2EV0A 1XDSA 2A5YB 3R4KA 3FF5A 2RV8A 4HX4A 3F72A 4MGRA 2ETHA 2XV4S 1XCBA 4GYGA 1WQ2A 2OU2A 4GO1A 5E1WA 4EJOA 3REOA 2X4HA 2W24A 3I59B 1G4DA 4GXOA 4MQ9F 1QGPA 2ZBKA 2HZTA 4HX7A 1G6NA 1TQIA 2O03A 1YLFA 2RN7A 3ERED 1MDMA 5CLSA 3DPTA 2XKPA 3H3ZA 2XHKA 2PBIA 3B73A 2EA4A 3FMSA 1FWZA 4LLLA 4RS8A 3V7SA 3E5UA 3S2WA 1QBJA 2DBBA 2FMYA 2VBYA 2G7HA 1EH7A 4G7ZF 1TTYA 3Q5FA 3EUHA 1YFHA 2Y0MA 2HTSA 1Z6TA 3F23A 1ODDA 4KN4X 3VEPA 3VB2A 1WKMA 4A0XA 2CSOA 1J75A 4IXAA 1UFMA 2FF4A 4I09A 4I0BA 4M73A 2ACJA 2AXLA 3CO7C 5L3GA 2QUFA 3F8BA 2VXZA 2Y75A 5K5RA 1G3TA 5DCMB 4DNCA 1S3JA 4I0AA 1VTNC 3PQKA 2NYXA 3TO9A 2OZUA 2CQKA 2PLYA 1BM9A 3WTZA 4AWXB 4GCVA 5LHHA 1R5GA 3ZPLA 1KGSA 1T6SA 3RPQA 3RYPA 3VODA 1STZA 1FNNA 3GW2A 1SMYF 5LLQA 4UVBA 2EJRA 2PJPA 1JXSA 3KLNA 4Q4ZF 3VOEA 5IT9Z 3PFIA 2YX4A 3M7GA 4OIRF 2DFIA 1W4MA 1XB4A 4M9ZA 4HA8A 3JW4A 4G9YA 4B8XA 1UB9A 2X0LA 4ZYEA 3QU6A 3P7NA 4HYEA 4LB5A 1FBUA 4BNCA 4JK1X 4EM0B 1BI1A 2DI3A 3KLOA 2O3FA 2QVOA 3O6BB 3MEXA 4M72A 2XIGA 1Z7UA 2W57A 1BI0A 3HRMA 4JQFA 2F5DA 1IN7A 5IT9K 2Z33A 1KYZA 4MTDA 5E18F 3LWFA 1KQ8A 1XDUA 5LBQA 4PCQA 5E1XA 4ETSA 3IKVA 3WTYC 4TV7A 5DYMA 1DUXC 4G94A 1BN5A 4KIGA 1DP7P 2K4JA 3HTSB 3T0YA 2OAZA 1JE8A 1QQIA 3M8EA 4CGZA 2ZKZA 3E6DA 3GF2A 2HOEA 2M87A 4OIOF 4IVNA 3GFMA 3IKTA 5LRSA 3Q9SA 5FD5A 2Q8KA 5JR3A 4CZZA 2V79A 4N0BA 2D1VA 3G3ZA 2GXGA 3CO6C 5FFXA 2UXXA 3QPTA 1IRFA 4LGWA 4EMSA 1D5VA 4G7OF 2WV0A 5CVRA 5E1ZB 1IRGA 4LB6B 3CTAA 3M1EA 5L3EA 2A6HF 3W6KB 3GWZA 3L00A 2CYYA 4U88A 5H20A 1LDKB 2D1HA 4WWCA 1S7OA 4I98B 2HFHA 2GQQA 2FXAA 1REPC 3O3KA 4I2OA 1FT9A 3ZMVA 3KP3A 2DLLA 1W7PD 1UHMA 2Y48A 4RB3C 1XGSA 5HDKA 3HUGA 5D8LB 1OYWA 3I4PA 1R00A 2FBKA 4HBLA 1B9NA 2ZXJA 1H0MA 3D5LA 3WTUC 2FNAA 3GX4X 2ZFWA 4CICA 3NRVA 4OOIA 2VOOA 3ZMDA 4OMYA 4HV5A 1RIOH 4KYWA 2J5PA 3T8RA 1K78A 1AOYA 3BPXA 1GVJA 3TO6A 1T0FA 1HQCA 2W25A 3NQOA 1FZPB 4CHUA 1QZZA 2ESNA 1XSVA 2E7WA 4NHJA 2M1BA 2HTJA 3ML6A 3WODF 4HDVA 2FA5A 2JT1A 3MAJA 3M9AA 3RDIA 2DQRA 1CF7A 4S04A 4EJUA 1JHHA 3IRRA 5L3CA 3WGIA 2JRTA 4PDKA 2HDCA 4XSXF 1USTA 5L3BA 2P5KA 2XASA 3C18A 2JZYA 4MHGA 1ZRDA 3WTTC 2Z5UA 1UCRA 1HBXG 3W6JB 3V7CA 3H92A 2NS0A 1IF1A 3IHUA 3L7WA 3LFKA 1U5TA 4HW0A 4I01A 2UZKA 5AIPA 4OINF 3IWFA 3I71A 3N4MA 1HXDA 2MH2A 4OMZA 1YO5C 2KIUA 5ICGA 3DV8A 2ZCWA 3ISPA 1Z9CA 2EB7A 5F64A 1FYMA 2F2EA 4Y15A 1XSDA 1IUYA 2PG4A 5JVTA 3IC7A 2GA2A 1SFXA 3R61A 2PMUA 5ICEA 1RZ4A 5JFRA 4CYDA 4KFCA 3E5XA 3BWGA 5ICFA 1J9IA 1IAWA 2KIMA 5DEQA 4XLPF 3K1PA 1SAXA 2HKOA 2DQLA 2HYGD 1BBYA 2K4BA 2V1XA 4IF4A 2RGVA 3K2ZA 4BAYA 3DFGA 3DQVC 2JPBA 3I58A 5BMZA 4MEXF 1FX7A 2IA2A 1IXSB 3BY6A 2FSWA 2PMHA 4A5NA 2XUBA 3LAPA 2A69F 4L0ZB 3JTGA 4O3MA 4EQQA 5F6FA 3O2PE 4LLGF 5HDGA 1OR7A 5ILUA 3T8TA 2YR2A 3TQNA 5HS7A 3KP2A 3WE3A 2DK5A 1R7JA 2HEOA 3ZMUA 2MLKA 4K2EA 5J6XA 2A68F 4PGGA 3F21A 2K27A 1R58A 2J5OA 2H09A 4L5JA 5CVVA 1SMTA 3LA2A 4IRHA 5ILSA 2CFXA 1S29A 2Z9OA 4AIJA 5EEGA 1BI3A 1WI9A 1SD5A 2CGPA 3HSFA 5FLXZ 2YSRA 2PFBA 5L3FA 2BE5F 1P4WA 5BPIA 2R7FA 1G3WA 2IRFG 4CDGA 2Q2EA 4RGSA 5ICCA 1IXCA 4B09A 3I53A 3MZHA 2PI0A 4RB0A 4L9TA 5D8KB 2IPQX 1ZG5A 3JAMZ 1R5HA 4ZYDA 4M6XA 3QAHA 3KP5A 4FHTA 1ZRCA 2DAOA 1FYLA 2DO7A 3MQ0A 2R3SA 5FLXK 4KIFA 2BBYA 3E6CC 1MD0A 4KMFA 4A0YA 1H9TA 1RI7A 4IRIA 3RTRA 1I5ZA 3ZN0A 1PDNC 5D5WB 1MZBA 2RDPA 1KU2A 1F5TA 2V1DA 5LRRA 2FBIA 1YW8A 5HDNA 3JAMK 3P9KA 1ULYA 2R7DA 1ONVA 4KA4A 1RNLA 1NHAA 1USSA 3RKXA 2CG4A 4LLNA 3CUQA 2HGCA 5TRDA 4IHSA 4D0PA 5E20A 4UUVA 2CW0F 3CUOA 1J5YA 3CJNA 1TNTA 2PQ8A 3TO7A 2XVCA 3K9TA 1IN8A 2G7UA 1ZAOA 5HOOA 4XSZF 4H0EA 3E97A 1EH6A 4LG0B 3TOBA 1R23A 4FX4A 1TQPA 3FXQA 2VC1A 4KUMA 2QLZA 3EETA 3QP6A 1T2KA 4UXNA 1C0WA 4G6DA 3IWZA 4KN7X 3TOAA 3K69A 2ESHA 4L18B 1P92A 1E17A 1K78B 1YS6A 4R8HA 3HOSA 2HS5A 4HLYA 5K5OA 3L2CA 2VN2A 2PEXA 4IRGA 4EJVA 2QBYA 1ZREA 2FEZA 2BV6A 2ZNYA 1I6XA 4AIHA 2LDUA 4IHTA 3K1MA 4N9HA 3J80Z 5CJ9A 3GO5A 1MKMA 1HSTA 1PUEE 3TDUC 2FU4A 4R79A 3R0AA 1FOKA 3SXYA 3J7AO 4HF2A 3QRFF 1MJBA 4HLXA 1ON1A 1BJAA 1SD7A 4P9UA 3KETA 4KMUX 3ZN1A 5HLHA 4P96A 3F8MA 4LD5A 3SZPA 4PGHA 2G9WA 4M9XA 1IZ1A 3I59A 4WXDA 1TNSA 2VONA 3BJOA 3KFWX 4A6DA 3KE2A 2E7XA 2P8TA 3FM5A 3QU3A 3KP4A 2K02A 5BOXA 3SQNA 4PZJA 4EVIA 4P9FA 1T38A 4ZZLA 3IRQA 4MTEA 5ED4A 1LQ1A 5DV5A 3T5XA 4BYYA 5BQTA 1P2FA 3D0SA 1U6GA 3MCZA 4G7HF 4R1HA 4M6YA 2OBPA 3WU0A 2MLGA 2P5VA 5F1RA 3GZ5A 2ZMEA 3HSEA 5CVUA 2IJLA 2OZ6A 3EYYA 4KNYA 1IXRC 1YQAA 3V8KA 1XN7A 2Z99A 1HSJA 3OV8A 1B4AA 1BI2A 3MZYA 1KU9A 4RGUA 2EFWA 2CWEA 1FP1D 3WTVC 3E5QA 1LDJA 1LVAA 5FFZA 3WGGA 2QENA 4HDUA 2JSCA 3KP7A 2XAFA 2H94A 2DPDA 4EJWA 2EV5A 1W7PA 4L9JA 2IP2A 4O6JA 2D2WA 1XSXA 1F4KA 3GVAA 3EDPA 1XGMA 4BHCA 1QZYA 3SZTA 2DTRA 4RB1A 2E1CA 2YPRA 2Q0OA 2O8XA 2FMLA 1H9GA 1K7AA 3QP5A 2EFOA 2UXNA 3HOTA 4CXFA 2V1UA 1TQMA 2XAQA 2O61A 1T98A 2F5CA 1P4AA 1KU3A 4KIBA 5K1YA 2B0LA 3RKWA 4NB5A 3LQQA 3ZQ7A 3MFKA 1ON2A 3F3XA 3LA7A 4OU0A 4LJZF 5JI6A 4ENMA 3KEQA 2HR3A 3HIFA 3QOPA 4ENJA 2FQ3A 3BOQA 1FSEA 3HTUA 3GEZA 2M30A 4HZFA 2P4WA 3BPVA 4EJTA 3ROUA 1O57A 4KICA 2GIVA 4OIPF 1O3SA 5D6EA 4HX8A 2D45A 3JSPA 4ON0A 3FMRA 2XAHA 1YG2A 4XBFA 3E6MA 3NEUA 2KJBA 2QZ8A 1LB2A 1O3RA 2KIFA 1MDMB 3MWMA 1SFEA 2RNJA 3KZZA 4BH9A 1BC7C 2ADUA 2C6YA 1Z1DA 3FZVA 1U78A 4UV9A 5L3DA 1I27A 1U2WA 4WK8F 5JHUA 2KRFA 3TDZC 2LSOA 3RYRA 1U3EM 2FOKA 2A3SA 2W85A 3DEUA 1Z05A 2XGXA 5KK1A 1ZG1A 4P5OA 2GAUA 1F9NA 3AAFA 2HQRA 3RIRA 3FHZA 1S8NA 1O3QA 1OKRA 2ISZA 4ZYHA 2VE9A 1U5TC 2IW5A 1RUNA 3I0TA 2FBHA 2PN6A 1U8RA 4F7ZA 1W5SA 1D8KA 4RAZA 1D3YA 5FB2A 3F8FA 5DD4A 1K6OA 2DU9A 2L3DA 3SFZA 5TJJA 4KDPA 3BP8A 2LNBA 2VBZA 2XAGA 2A6EF 1TW2A 1F1ZA 2VBXA 2V9VA 3FM3A 2RVCA 2F5FA 5E8GA 4BXUA 2H27A 1V4RA 3ZMZA 1B6AA 1ZYRF 3F8NA 4ENKA 3FX3A 2QWWA 3GFLA 5E8IA 4XRFA 2XRNA 2VT3A 2M45A 1E2XA 4HF1A 4EGZA 4IJAA 1KU7A 1B1BA 1Q1HA 1V3FA 5ILVA 3GZ6A 1XGOA 1I1GA 4EM1A 1KQ9A 3F6OA 4MQVA 4M9SA 3BJ6A 2IA0A 2ISYA 3E3VA 4YIIA 3GUDA 1XCVA 1ZGAA 2FNPA 3GYHX 3BJAA 4A2UA 5D5VB 1YW7A 4WXHA 2NNYA 2M8EA 4ZYGA 1ZHFA 2OQGA 1DDNA 4WCGA 4RGXA 3SHFA 4IPAA 1HKQA 2MA3A 2DPUA 3WE2A 1WRJA 4ESFA 2E1NA 1J0RA 4L9NA 1HW5A 4YFNF 5DDGA 1AWCA 1I1SA 1T39A 3V7RA 2NAZA 2OQRA 3U2RA 3OOPA 3ABUA 3EYIA 2NRAC 1B59A 2STWA 3BROA 3TKYA 1SD6A 5CVIA 4U7DA 5DD8A 3HRUA 2L4MA 1KYWA 1G3YA 5J8FA 2LF7A 1FPQA 3HRSA 3VFZA 2M5WA 4HF0A 4A6EA 1YTYA 2MD5A 3RJPA 2MBFA 3ECOA 1TBXA 1UHWA 2WTEA 4N9IA 5HS9A 2Z3YA 1YYVA 5HLIA 1WWXA 2ZMEB 2KKOA 2HYFA 1LDDA 4YG2F 5CVJA 3ZP5A 4U0WA 1BIAA 4A12A 2P6SA 4UVAA 1BOAA 1FP2A 3I64A 4XLNF 1MJAA 4EM2A 3HRTA 2COMA 1YIOA 4ZH4F 2VODA 4S05A 1W5TA 2ZJ2A 3ULQB 3DPLC 3DF8A 1S6LA 2O0YA 1R36A 3G73A 2GZWA 3L9FA 1QO0D 4E70A 2LF8A 2BEOA 1W7PB 3ZMTA 3KZYA 1GXQA 1IN5A 2EFNA 1P4XA 4BHBA 4DQ2A 3H3UA 3CUQC 4L0YB
chains in the Genus database with same CATH superfamily
3V8LA 3K4CA 1ZLJA 3TP0A 2VI6A 3Q3SA 3K1NA 2CO5A 4CCJA 2V6CA 2EV6A 3OYIA 4XL9A 1PUFA 2L54A 2X1DA 4MIMA 1E3PA 5D4SA 4YELA 1ETOA 1FBSA 3GFJA 2LG4A 2OD5A 1OMIA 2E35A 2ZXHA 3KP6A 3GXOA 4YFKF 2DYRH 4UNOA 2BHZA 1G8XA 1ZG3A 2VJJA 5BS6A 2AQEA 3DPUA 3F22A 1YW9A 2L02A 3BR3A 3LAJA 2ZJQF 2K85A 2TRTA 3W2AA 3KCCA 1IN4A 4IQJA 2HWVA 4I02A 3DLAA 1FTZA 1EV7A 2L7MP 5CYVA 1B8IA 4RB2C 3I56I 4HQEA 2DYSH 3F6VA 2CH0A 1CF7B 4Z2YA 3HDDA 1FYKA 3L2VA 4UVCA 4ZYAA 3L09A 4FTHA 4ZZDA 5IP7J 3PUFA 3R60A 2MH9A 4U0YA 4KT5C 3MKYB 4AVPA 1IG7A 1VQ4I 1VQ9I 3RI4A 1XX5A 2EWNA 3K0LA 1Y0UA 2K7LA 5J1UA 3WTXC 1YE9A 1O7LA 2ELHA 2X85A 5HVQC 3CCUI 1ZH5A 3J7ZI 5ERIA 1R1VA 4XN0A 4B48A 4U7BA 4B4CA 4LFUA 3LA3A 4EGYA 1VNDA 4Q5SF 2VBWA 4EEFG 3I54A 4IX7A 4IEJA 2O5RA 1SFUA 4D9JA 1LUJB 3RKYA 1HKSA 1R1UA 2ID6A 4P55A 2DA6A 2CV0A 3HSRA 5LHGA 3JR9A 2M4KA 1OYYA 1MMSA 1JJ8C 3MN2A 5EEHA 2RKHA 1TZLA 5LGUA 1XGNA 1W5CC 2EIMH 3J80K 1GXPA 1U5TB 5LEJA 1LNWA 2A07F 3QWLA 1BOBA 5CKTA 4AM3A 3TMOA 1QPIA 3ECHA 2VKHA 3F0CA 2BHYA 3JTHA 3Q9VA 2TCTA 2KISA 3HHGA 4MLOA 1UHSA 4RAYA 4FE4A 3ZQIA 2F4OB 3N97A 1P9QC 1A5JA 1J7KA 3OYDA 1OISA 4PSXA 4Y4RA 4BE2A 1WVRA 4II3A 5JVGF 4I76A 2JTVA 2GIZA 1MJ9A 2WAFA 4OAYA 2WWYA 3PIPF 2IA1A 1V5FA 1FSHA 2R92J 3DLLF 3JRBA 3LSTA 4BQNA 1K6YA 2H1LA 2GA1A 2XGCA 4Y13A 4X0GA 4C3JJ 4MEYF 2X1CA 3CJQB 3SFIA 3W2WA 4QLCU 1MNDA 2XKOA 5JLXA 2KZVA 1N25A 2MUNA 2PMZA 1XPXA 4UHTA 2NS7A 5M5YJ 3ABTA 3C3WA 3PL8A 4W97A 3JREA 3CCVI 2YX7A 4JOMA 5GTIC 3DWLE 5D4RA 2ZO4A 2BY1A 1PP8F 1VQKI 2XAJA 2KLOA 3FXRA 3U21A 2VT2A 2H6CA 4CO8A 4M74A 2AS5F 4M71A 1HKTA 1YS7A 4NC7A 2DJNA 1EH8A 1X1DA 1FC3A 1ZRFA 1R5ID 5IP6A 2JMWA 2EFQA 2E36A 1OCOH 3ZMSA 4PFOA 1ORKA 2KT0A 2HQAA 2K86A 4Y17A 5J47A 1VFCA 3FXUA 3HKZA 5H2FC 1KA8A 1P6RA 4GGGA 4NC6A 3DXJF 3JRHA 1O3TA 2XSDC 1SEUA 2E34A 4LIVA 4HV6A 4L5IA 4DBQA 5AONA 3VDXA 2LP0A 1J2XA 1A04A 1OPCA 4HPQA 1SAUA 3A01B 2QYOA 4XICA 2EFPA 2BY3A 1QVTA 2RQPA 2EILH 1XD7A 2KFDA 4NUBA 3S8PA 4PUSA 2FE3A 4ZTFA 3S3NA 2WC2A 2V4JC 2DMNA 3ZQCA 1IJWC 1IC8A 1OCCH 5DCMA 1R1TA 2X1EA 4JBAA 1YITI 4Q48A 3PO2J 1FMVA 2VC0A 2W82A 3TGNA 1TL8A 3F8CA 3PSFA 2MZ4A 2Y0SA 5TGTA 2DA5A 1JHFA 4G6QA 1FLIA 1BC8C 4E4HA 3V4GA 3A2KA 3KYDB 1MSFC 1SVOA 3BLYA 4NQWA 5A2QZ 1J59A 4LG0A 2ZMEC 4BQAA 4M3DA 2YU9J 3BDDA 1ZR2A 1MGTA 1V5EA 5FD6A 3CCQI 1RPWA 2A61A 1TLHB 3M8FA 2HDDA 2QQAA 2L01A 3OYGA 3OYHA 3LQRA 4Q47A 1WSUA 1HDDC 3FMQA 4LK0F 4IZZA 3LFUA 1JGGA 2UWMA 1Z6RA 4GYIA 1N75A 3FWEA 4DZPA 2L4AA 2GXBA 2GBYA 1IN6A 1ZGJA 2WAQA 1YRNB 2IGKA 2CQ7A 3TL4X 3C7JA 2HDWA 1D8JA 2W84A 3ESWB 2DK8A 4B3XA 1ZN2A 4FT8A 5B5EC 2EA2A 3P9IA 2BXZA 1FY7A 3FDYA 6PAXA 1FBQA 3E6BA 3K4JA 3CLOA 2QM3A 4LK1F 1Z91A 4RGRA 2QQ9A 3I5UA 3WG9A 1XMAA 1ZARA 4HOBA 2VKDA 2DDBA 1RR7A 3ELKA 2LKPA 3EQLF 5A2QK 3HOYJ 2Q2EB 2DFFA 2XF5A 2VPLA 5AIQA 3BZ6A 3BZKA 4A5MA 3WU1B 2XROA 1L0OC 3HXLA 3J81Z 3J7AY 1X3UA 2YU3A 4OAZA 1BIBA 2CUZA 3RPUA 2MW8A 2K3FA 3QYEA 4Y7NJ 2CQQA 2R0QC 2UV1A 3SJMA 2VUMJ 4WX9A 5HS8A 3P9CA 2KP6A 5J3LA 2P7CB 1WFXA 2DDAA 5FO5A 2R7WA 3BCBA 5DCFA 4ASNA 4BBSJ 4WF2A 3ABMH 3DTEA 3B6CA 3DP7A 3WTWC 2A05A 2P7VB 4ESBA 1RUOA 2K9NA 3COAC 3LSHA 5HLGA 2LYCA 2ZFUA 3CESA 3G4SI 2JPCA 3OYAA 3WU2C 3HHHA 1O7FA 5EG0B 4PJMA 5H6QA 1JTYA 2P6TA 1HLVA 4HSTA 4I7HA 2GLOA 1OCZH 3NAUA 3S17J 4MNUA 1JGSA 2Q1ZB 5KVRA 3T1BA 4L5EA 3B02A 3IAS2 3CLQA 2CS3A 1TP4A 3J81K 2HQNA 1GV5A 2DT5A 4EV0A 3OY9A 3RKQA 1TT0A 3OS1A 4FQGA 1KQ0A 4ENNA 3NWTA 2BW3A 5EGOA 3PFYA 2CV2A 4QWQA 2L5QA 1OYIA 1JKPC 4C9YA 4E7IA 1GHCA 1XMXA 3QPHA 3DEEA 1DPRA 4YIFA 1HW1A 2HKXA 1TW3A 2HOSA 3C2BA 1ZLKA 1U9NA 4G8XA 2VOPA 1DGWY 4JX4A 5BPDA 5GPCA 3LL7A 5A2QR 3SZGA 3CUQB 3R6SA 5LGTA 3LSPA 4XKWA 1QNTA 2GWRA 2HNHA 3U9GA 2DMPA 4HQMA 2FRHA 2HYJA 2JUGA 1FOXA 2JQ7A 5C4XJ 3GFIA 3PO3J 2W48A 5K5QA 3FK7A 3VSLA 3WGHA 3RQIA 4E7KA 1OFCX 1FMWA 5E17F 3PQJA 3FBIB 3JSOA 1ETVA 2LKXA 2K5CA 3H1CA 1MW7A 2O6GE 1TWGJ 1IW7F 3WHBA 2E2IJ 4HAMA 5J8CA 2ZNZA 3BT9A 2LY9A 1A36A 1V55H 1OQYA 2H6BA 2KL4A 1CGPA 2L9RA 1L3LA 4YFXF 2BGCA 3V8JA 2RC4A 2K3PA 2DA3A 5JHFA 3S1MJ 1I39A 2MC3A 5D5UB 1K79A 2E1MC 3CP2A 2NNNA 4UV8A 1WI3A 1QPMA 5FGMA 2DW4A 2ECBA 4BEHA 4OIQF 2VE8A 4F92B 2K9SA 4BHPA 1P7IA 3HJEA 3DU5A 3KEOA 2VQLA 2QQBA 4L9VA 4CYCB 1AKHB 4A3DJ 4XKVA 3I9V2 1IRZA 1WH7A 5C4JJ 3J81R 3DKWA 4FASD 3U1DA 2IVMA 3L2WA 3RZDJ 4U0VA 2QEXI 3FBNB 4C3HJ 1WPKA 4AD9A 2TDXA 1PUFB 1HCRA 2IBDA 4A0ZA 4O5VA 4AUXA 3RSNA 3JRFA 4E7HA 2WADA 2E5NA 1PVEA 2O8KA 1IDYA 2ID3A 1LJ9A 2ELKA 4Z6YA 1WH5A 2X6WA 3VYTB 1HW2A 2KRCA 5D5XB 2QBYB 5EJCA 1ACIA 3R0JA 1SVLA 4FX0A 5DUIA 1G3SA 1R22A 5D6FA 1B9MA 3LSJA 4AU7A 5LHIA 2OA4A 4QPOA 3K70D 1FIPA 5CPRB 2LRDA 1B8IB 2QCOA 4FISA 3ZGKA 2EIJH 3IL2A 2BYVE 1EJ9A 2EK5A 2NVYJ 5DUKA 3WTSC 1UELB 3HYIA 2QSFX 2F5EA 1PP7U 2WV1A 4XMYA 4XLHA 4LMYA 5IT3A 1SD4A 3CDHA 1LEAA 4WXCA 1S7AA 4AIKA 5LGNA 1XMKA 3GLXA 4B47A 2R7QA 2RNGA 2IT0A 2BXYA 1DPUA 3J7AW 3C1DA 5LEKA 1RQ6A 1LEBA 5H6RA 2STTA 2I10A 2P5LC 4ESJA 3H0GJ 2GOMA 2KJCA 3GZNB 1WZ2A 2EV0A 5E3NA 2OTLI 4C3IJ 1XDSA 2A5YB 3R4KA 2JRMA 3IAM2 3FF5A 2RV8A 3S93A 4HX4A 4BJTA 3F72A 3IUOA 3S3OA 4CCNA 4MGRA 1D5YA 2ETHA 2XV4S 2QGUA 1XCBA 2NVQJ 4GYGA 1WQ2A 3G1MA 2ZC2A 4U87A 2OU2A 4GO1A 5E1WA 3FIWA 4EJOA 3REOA 2X4HA 2W24A 3I59B 1G4DA 2M3AA 4GXOA 4MQ9F 1QGPA 2ZBKA 2HZTA 3FISA 4HX7A 3S32A 1G6NA 1TQIA 2O03A 2ZB9A 3EPZA 4BL0B 1YLFA 2RN7A 3ERED 2LY1A 3HOVJ 1MDMA 5CLSA 3M3YJ 3DPTA 4CCLA 2XKPA 3H3ZA 2XHKA 2PBIA 3B73A 2EA4A 3FMSA 2OJED 1FWZA 4LLLA 4RS8A 1I6HJ 3V7SA 3E5UA 1NK3P 3S2WA 2MVTA 3IH4A 2DBBA 1T56A 2FMYA 3K7AJ 1QBJA 2M35A 2VBYA 3H35A 3FXOA 4BDZA 1D0YA 2G7HA 2MABA 1EH7A 2E60A 4G7ZF 4XR6A 3ZQHA 1TTYA 3Q5FA 3EUHA 1VQLI 2OCEA 5GP9A 2K40A 2L7ZA 1YFHA 4I6ZA 2Y0MA 5LD2C 2CU7A 2HTSA 4BXFA 1Z6TA 5EYRA 3F23A 2XPUA 1ODDA 4KN4X 1H89C 3VEPA 3VB2A 3S1NJ 1D0XA 3ABKH 1WKMA 4A0XA 2CSOA 1E3HA 4PK4A 1J75A 3C2GA 4IXAA 1UFMA 2R5ZB 3CJTB 2FF4A 4NC8A 2OTJI 4I09A 4XK4A 3OIPA 3PNVA 4I0BA 4M73A 4D1QA 2VJIA 3ASOH 2ACJA 5FKKA 2AXLA 5EZGA 1Z7LA 3CO7C 3LMMA 2ZSHB 2LK2A 2BVMA 5L3GA 2G0EA 4QIWN 2QUFA 3F8BA 1A6IA 3K2AA 5F1JA 2VXZA 1PYVA 5IYCJ 2Y75A 2HVQA 5K5RA 4BE0A 2R7ZJ 1G3TA 3ONQA 5DCMB 4DNCA 1GT0C 3CC7I 2KQRA 1S3JA 2QKMB 4I0AA 1VTNC 3PQKA 3TEDA 2NYXA 3TO9A 2OZUA 1OCPA 2CQKA 2PLYA 1BM9A 2L0KA 3WTZA 1UMQA 2HVRA 4AWXB 4EATA 1Z3XA 4GCVA 2M7BA 2JA5J 1ZR4A 5LHHA 2VKVA 4B1RA 2AQFA 2R5YA 1R5GA 4D5FA 3ZPLA 1HDPA 1KGSA 1JTXA 1T6SA 3B6AA 3RPQA 3RYPA 3SYTA 3VODA 3BTJA 1STZA 1FNNA 5K7FA 3GW2A 1SMYF 5LLQA 2E71A 4UVBA 1I3AA 5J1RA 3PNYA 2EJRA 3G1OA 4D7MA 2PJPA 1XG1A 1JXSA 5B1AH 3UR3C 3KLNA 4Q4ZF 3VOEA 5IT9Z 3PNTA 3PFIA 2YX4A 5HNFA 4D5CA 5FJ8J 1D1BA 3M7GA 4OIRF 2DFIA 1W4MA 1XB4A 4M9ZA 4HA8A 3JW4A 4G9YA 4B8XA 1UB9A 3ZCOA 2X0LA 4ZYEA 3EUAA 4S0HB 3QU6A 3P7NA 5F08A 2XRLA 4HYEA 4LB5A 5FKLA 1FBUA 2LY2A 4BNCA 4JK1X 4EM0B 3BCAA 1Y56A 4XRMA 1GVDA 1ZTRA 2MSYA 4V19K 2V26A 1BI1A 2DI3A 3KLOA 2L2OA 4AC0A 2O3FA 2AO9A 4OWRB 5IYBJ 4DYRA 2QVOA 3O6BB 3HOXJ 3H9JA 2BVLA 2XIGA 3MEXA 4M72A 4UY8I 1Z7UA 2W57A 5E79C 1BI0A 3HRMA 4JQFA 1D1AA 2F5DA 3S14J 2ECCA 3I4MJ 2NOGA 1KONA 1IN7A 2EZKA 5EDNA 1Y6IA 5IT9K 2Z33A 2FX0A 1KYZA 4MTDA 5E18F 1MBHA 3LWFA 1N77A 3LSGA 1KQ8A 1MBGA 1XDUA 2DOEA 5LBQA 4PCQA 5E1XA 4ETSA 5FLVA 3IKVA 1OJLA 2LBFB 4F3QA 4NBQA 3WTYC 1Y39A 1RR8C 1VZ0A 4TV7A 5DYMA 1DUXC 4G94A 1X1AA 1BN5A 4KIGA 1DP7P 3QPSA 2K4JA 3HTSB 1QHGA 2MC4A 3T0YA 3OL4A 2GXAA 4BACA 2OAZA 2DCEA 3DTIA 4A3LJ 1JJ6C 2B9SA 2VQHA 5EGOB 2R7XA 1JE8A 1QQIA 4RMNA 3L2UA 2RAEA 3M8EA 4CGZA 2ZKZA 3E6DA 5FRMA 3GF2A 3OIOA 2K9QA 1MBEA 4ZC3A 2E1MB 2HOEA 4IHYA 3FXLA 2M87A 3D5SC 5FKMA 4E7SA 2X51A 2R7TA 4OIOF 4IVNA 3GFMA 4A3BJ 1MBKA 2CMPA 2VIXA 3IKTA 3G2BA 5LRSA 3F9KA 1MBFA 3GTPJ 2OF7A 3Q9SA 5FD5A 2Q8KA 4A69C 5JR3A 1Y8QB 3BR5A 4CZZA 2V79A 4N0BA 2D1VA 1N78A 4F91B 3G3ZA 2GXGA 3I3LA 3CO6C 1VQNI 5FFXA 2UXXA 3QPTA 5FKNA 1IRFA 4RAGA 2Y2ZA 4LGWA 4EMSA 2DA7A 1D5VA 2LVSA 4G7OF 5IP9J 2XB5A 1FOYA 2WV0A 5CVRA 2AHQA 5E1ZB 1IRGA 1HOMA 4LB6B 3WHCA 3CTAA 3HZJA 3LSMA 1LFBA 2COBA 2BOLA 3ZR8X 5IT9R 1X19A 3IH3A 3OR2C 3M1EA 4PJNA 5L3EA 2LR8A 2A6HF 5DS9A 3W6KB 3GWZA 2XPWA 4HSRA 4XM3A 3L00A 2CYYA 2IAIA 4U88A 5H20A 4PSWA 4V2GA 5DTDA 1P7JA 3CCJI 1LDKB 1K61A 3PSIA 2D1HA 4WWCA 1ENHA 4BEHB 4A3JJ 1W0TA 5J4VA 2OCCH 1S7OA 4I98B 2JA7J 2HFHA 2GQQA 1LFUP 1MMNA 2Y9ZA 3PIOF 3JRCA 4MFDA 4GDFA 2FXAA 1REPC 2L9SA 3O3KA 2LOOA 4I2OA 3CDIA 1FT9A 3ZMVA 3H5AA 1ETWA 2JVGA 3KP3A 2A5WA 2DLLA 1W7PD 1UHMA 2Y48A 2V1NA 1QHHD 3ZOBA 4RB3C 1XGSA 5HDKA 2F48A 2WA0A 2X6OA 3HUGA 5D8LB 3OYCA 1TWHJ 4UUSA 1OYWA 4RLFA 2A6TA 3I4PA 1WJEA 5F27A 2ME6A 3BTCA 4F55A 2IGMA 1R00A 2FBKA 2VLAA 4HBLA 3OYJA 4PFPA 1OLTA 1B9NA 2XB0X 2ZXJA 1H0MA 3D5LA 1UJ8A 3WTUC 2FNAA 3GX4X 5FRNA 1SFOJ 2F4MB 2IS2A 3BG7A 3OS0A 2ZFWA 3KPHA 2CRGA 4CICA 3NRVA 4OOIA 2VOOA 2VJ4A 3ZMDA 3QQAA 1Y0NA 4HV5A 4BDYA 4OMYA 1I50J 1RIOH 1AHDP 4N4OB 4RLQA 2HOAA 2JJ7A 4KYWA 3EUKL 2J5PA 3K4KA 3T8RA 1K78A 3LSIA 2O9LA 1AOYA 3BPXA 1GVJA 3TO6A 1T0FA 1X58A 1HQCA 5J4YA 3BR6A 3OYFA 3DKYA 3HG9A 2W25A 3NQOA 4CCKA 1ETKA 1FZPB 4CHUA 1QZZA 1GDTA 2LKSA 1WGXA 2ESNA 1XSVA 2XDVA 2JA8J 3TW6A 2E7WA 1NG7A 2EIKH 4NHJA 2ZJRF 2LLKA 2M1BA 2HTJA 3ML6A 3WODF 4FETA 2FA5A 4LITA 4HDVA 1T33A 2JT1A 3MAJA 3M9AA 3OSFA 3RDIA 2DQRA 4PJJA 1YI2I 1VI0A 4DW6A 1CF7A 2VKEA 4S04A 2V7FA 4EJUA 4RDUA 1Z21A 1SFKA 4CZCA 5E3LA 4CCMA 1JHHA 3IRRA 5L3CA 1HF0A 3WGIA 2JRTA 4PDKA 2HDCA 4XSXF 1USTA 4UB8C 2PJRA 3AL0B 3QYBA 3CQZJ 5L3BA 5IYDJ 2H1KA 1JKOC 2P5KA 1ZQ3P 4X6AJ 4BY1J 2XASA 3A03A 2PMZN 3U1KA 3FK6A 4XKBA 4DJAA 1WJCA 5GAEJ 1O4XA 1MIJA 3C18A 4GRIA 2JZYA 4MHGA 1ZRDA 5F04A 3FKJA 1IGNA 4XLFA 3WTTC 4KT6A 2Z5UA 1UCRA 1HBXG 1DGRM 2NVTJ 3W6JB 2XGDA 3V7CA 3H92A 2NS0A 1IF1A 3IHUA 2DN0A 1MBJA 2VXDA 3DTKA 2XPVA 1RESA 3HPGA 3L7WA 1U5TA 3LFKA 4XLAA 3L1PA 4HW0A 4I01A 2JA2A 4C30A 2UZKA 4XLCA 3MKLA 5AIPA 4OINF 3IWFA 3I71A 3HKZN 3N4MA 1HXDA 2MH2A 4OMZA 1YO5C 2KIUA 5ICGA 1E0EA 1LFPA 3DV8A 2ZCWA 3AKZA 3ISPA 1Z9CA 2EB7A 2R7UA 5F64A 3OYMA 2FJ1A 1LE8B 4DZJA 1FYMA 3BG3A 2D5VA 2F2EA 4Y15A 3JRIA 3H9GA 2X6YA 2GOXB 1XSDA 2DA2A 5J1YA 1OCTC 2DT7B 1IUYA 2PG4A 5JVTA 3IC7A 3G71I 3CC2I 3PUBA 1YJWI 2GA2A 3HGGA 1A6QA 3VSKA 1B72B 1SFXA 3R61A 2PMUA 1JUPA 5ICEA 1RZ4A 3ERMA 1EF4A 5JFRA 4CYDA 3D5RC 2EZHA 2Y0SN 2GM4A 2HXOA 4KFCA 4XQFA 3E5XA 3AG3H 3BWGA 3G6EI 5ICFA 1J9IA 3LNQA 1IAWA 2KIMA 5KCMA 3AG4H 2FD5A 5DEQA 4XLPF 1A35A 3K1PA 1SAXA 1POGA 1NG6A 2LD5A 2YUSA 2HKOA 2DQLA 2HYGD 1BBYA 2K4BA 2CW8A 2H8WA 2JUCA 2V1XA 2RGVA 4IF4A 3K2ZA 4BAYA 2L7KA 3GTQJ 3DFGA 3DQVC 3I55I 2JPBA 3MMYB 5IOYA 1U9OA 1WCMJ 2XSJC 3I58A 5BMZA 4MEXF 1FX7A 2IA2A 2WAQN 1YJ9I 1IXSB 3BY6A 2FSWA 2PMHA 3A02A 4BE1A 4A5NA 2XUBA 3H5RA 2A69F 3LAPA 3JTGA 2ZJPF 4L0ZB 3CCRI 2EZIA 4O3MA 2JSPA 3HBLA 4EQQA 5F6FA 3O2PE 1IV8A 4LLGF 4FE7A 5HDGA 1OR7A 5ILUA 3T8TA 3SDBA 3TW7A 2YR2A 1UG0A 3TQNA 4HRIA 4XOPA 3W3CA 4J01A 5HS7A 3KP2A 3WE3A 2DK5A 3HGYA 4CSWA 1R7JA 2HEOA 3ZMUA 4PJLA 2MLKA 4K2EA 1X4PA 5J6XA 2A68F 4PGGA 3F21A 2K27A 1R58A 2J5OA 2H09A 1SC7A 4L5JA 2WAEA 1S9HA 2DT6A 3CMMA 5CVVA 1SMTA 1EKEA 2M8GX 4ZJZA 3LA2A 4IRHA 3RZOJ 5ILSA 2L9VA 2CFXA 1V54H 3BC8A 4J19A 1S29A 2Z9OA 4AIJA 5EEGA 1BI3A 1WI9A 3CD6I 2DJIA 3RCOA 2P81A 4B44A 1SD5A 3OWTA 2CGPA 4IKFA 4DOZA 3HSFA 1FEXA 2W7NA 5FLXZ 2M34A 2YSRA 2PFBA 5L3FA 2BE5F 2VQGA 1P4WA 4BJ5C 1QVUA 5BPIA 4JP0A 1X1CA 2WB1N 2DMQA 3BR0A 5M5WJ 2R7FA 3V42A 3HOUJ 1G3WA 2IRFG 4CDGA 2Q2EA 1H8AC 3KYLA 2CUFA 3GBGA 4H4KC 4RGSA 5ICCA 1WJDA 3OOUA 2VPRA 3A0BC 1IXCA 4B09A 3I53A 1NTCA 3MZHA 4ABZA 3G1LA 2JWTA 2PI0A 4RB0A 4L9TA 5D8KB 2IPQX 1AU7A 2R7VA 5GPAA 1ZG5A 2OUMA 2XF6A 3JAMZ 1R5HA 4Y3OA 1RKTA 4M3FA 4XLEA 3OYNA 3Q0WA 4M6XA 3QAHA 4ZYDA 5GAHJ 2VASA 3KP5A 4FHTA 1ZRCA 3L2QA 5HNHA 2LFBA 2DAOA 1FYLA 1FTTA 2DO7A 1TWAJ 3MQ0A 3Q0UA 2R3SA 5FLXK 3A1YA 4KIFA 1IO2A 1A31A 4IHWA 2BBYA 3E6CC 1MD0A 4KMFA 4A0YA 1YX3A 4KITB 1J09A 1H9TA 1RI7A 2Y31A 4IRIA 3RTRA 1I5ZA 3M1CA 3CCSI 3ZN0A 1PDNC 5D5WB 1MZBA 2RDPA 1KU2A 1UAAA 1D0ZA 1BA5A 1F5TA 2V1DA 4IOCF 3H9QA 5LRRA 2FBIA 1GLNA 2ELJA 1YW8A 4BUPA 5EZHA 5HDNA 3JAMK 2KRHA 1NH3A 1MSEC 5BNGA 2AXTC 4NDLA 3AL0C 4BBRJ 3P9KA 4ZDPA 5K7HA 1ULYA 4Y33A 3ZXSA 1Z3YA 2R7DA 1ONVA 3HM5A 4KA4A 1RNLA 2O7OA 5LFAA 2X6XA 4P1WA 1YJNI 1ZELA 1NHAA 1USSA 1IV6A 3RKXA 3CCEI 2CG4A 4LLNA 5FLMJ 1BR2A 3CUQA 1VQMI 3S1RJ 2HGCA 1WJ5A 5TRDA 2UUZA 4DGWB 4IHSA 4CCOA 4D0PA 4IOAF 5E20A 4UUVA 2CW0F 1OCRH 3CUOA 5TISC 1X2MA 1F36A 4M6VA 1J5YA 4E7JA 2HPMA 3CJNA 1TNTA 2WY7Q 2PQ8A 2RREA 4NNJA 2L9NA 3TO7A 2XVCA 2OC6A 3K9TA 5JLWA 1IN8A 4XRSA 1T8IA 2G7UA 1ZAOA 3CMAI 5HOOA 3CC4I 4XSZF 3EUHC 4HG2A 4H0EA 4NQWB 3E97A 1K83J 1EH6A 2E5ZA 2IEKA 4ITVA 4XONA 2E2JJ 4LG0B 5FLXR 3TOBA 1YOVB 3QOEA 4RBOA 3MKZA 4XNFA 4B3AA 2QSGX 1R23A 4ANJA 5EEAA 3SEQA 4UUSB 3BQZA 1E3OC 4FX4A 1TQPA 3PM1A 3FXQA 2M0MA 4PJ0C 2HPIA 2IS1A 4DBRA 2VC1A 3KYCB 4KUMA 2IGNA 2QLZA 3EETA 3QP6A 1UG2A 1T2KA 4QPQA 1IRXA 4RA2A 4UXNA 1C0WA 4G6DA 4C2UA 5M3MJ 1DU6A 3IWZA 1EA3A 3OSGA 4A3KJ 3S2HJ 4CYCA 4KN7X 3TOAA 3JAMR 3K69A 1W36C 3VWBA 2ESHA 2KMUA 4L18B 1P92A 1E17A 4BQOA 1K78B 3HPHA 3MD2A 2CQNA 1YS6A 4KISA 4R8HA 3HOSA 3BG6A 2HS5A 4HLYA 5K5OA 3L2CA 2VN2A 1Q1VA 2PEXA 4IRGA 1XS9A 4EJVA 3KEYA 3PJRA 2NVXJ 1ZREA 2QBYA 1JI8A 1R4MB 2FEZA 3UNGC 2BV6A 1H88C 1ETYA 2K9LA 4L0YB 2ZNYA 3CCYA 1I6XA 3BG5A 2HZDA 4AIHA 2LDUA 4IHTA 3HB9A 3K1MA 4N9HA 4C2MJ 4A3FJ 2Y9YA 3J80Z 3CCLI 5CJ9A 3GO5A 3NARA 3CF5F 3FKIJ 1MKMA 1HSTA 1TWCJ 1MNEA 1PUEE 1ERDA 1DU0A 3TDUC 2FU4A 4R79A 3R0AA 3M07A 3DBLB 5B1BH 1FOKA 2IXSA 2PJRB 3SXYA 2OPTA 3J7AO 4HF2A 1GUUA 4X1EA 3QRFF 1MJBA 4HEA2 4HLXA 2W4SA 1ON1A 3GLLA 2JN6A 1SVMA 3BTLA 4IO9F 1BJAA 5KHDA 3HOZJ 4BQQA 3DEWA 1XTAA 1SD7A 4P9UA 3KETA 4QSHA 2K9MA 1SANA 4KMUX 3X2QH 4F52A 3ZN1A 5HLHA 4P96A 3F8MA 4LD5A 3SZPA 3JRAA 4BU2A 2ICWG 4PGHA 2EH3A 2HOTA 4UB6C 2X48A 3P5JA 3W6VA 1QU3A 3H5NA 2BW3B 2V9PA 1MNMC 1VQ6I 2I5UA 2G9WA 4V2FA 1ETQA 4M9XA 1YX5A 1IZ1A 3VPRA 3L2RA 3O8GA 2Y30A 2IGOA 3BR1A 3I59A 4WXDA 1TNSA 1BJZA 3O8HA 2VONA 3BJOA 3KFWX 4A6DA 3A0HC 3KE2A 1ZK8A 3HOWJ 3IP4B 2DOAA 2E7XA 4AYBN 2P8TA 1VF9A 3FM5A 3QU3A 3KP4A 2K02A 3GTKJ 4QTRA 5BOXA 1S7EA 2DOFA 3SQNA 4PZJA 4A3EJ 4EVIA 4P9FA 2V6EA 2VB6A 2M4GA 1T38A 4ZZLA 3IRQA 4MTEA 4CH7A 2R7OA 1M1EB 1ETXA 1Y1WJ 3S1QJ 2Z2SB 5ED4A 1G2HA 2VJ5A 2R93J 1LQ1A 1MH4A 5DV5A 3T5XA 4BYYA 5BQTA 2DFEA 1P2FA 3D0SA 1U6GA 3MCZA 4G7HF 3TBIA 4II2A 2W1OA 3KX2A 2N8GA 4R1HA 3BZCA 3J7YJ 2X9DA 4M6YA 3KIOA 1KZHA 3GTGJ 2OBPA 3CJRB 1VQ7I 3WU0A 2MLGA 2P5VA 3GZ5A 5F1RA 4A3IJ 2ZMEA 3HSEA 5CVUA 1FJLA 1X4OA 2IJLA 2OZ6A 2V9KA 3EYYA 2WBMA 3ZQGA 4KNYA 5IY5H 4LIUA 1IXRC 1YQAA 3V8KA 3GCMA 1XN7A 2Z99A 4Y52J 1HSJA 3OV8A 1B4AA 1BI2A 2R5ZA 3MZYA 1KU9A 1ZGWA 1U8BA 2CFOA 2DA1A 4RGUA 2EFWA 4IHXA 1IUFA 2CWEA 4BY7J 1FP1D 3HEFA 3BG9A 2L7FP 3SEZA 3WTVC 1I3QJ 1YHQI 3J80R 3E5QA 1LDJA 1LVAA 3CZ6A 2R7SA 5FFZA 3WGGA 3K4BA 5KNLA 1HA8A 2QF7A 4XIDA 2QENA 4RAFA 2JK3A 4YRVA 1S5LC 4W1UA 4DIQA 4HDUA 2JSCA 2P0TA 3KP7A 3DBHB 2XAFA 2H94A 2DPDA 3CP8A 2E19A 4EJWA 3FXJA 3K4NA 2EV5A 1Z77A 1W7PA 2YS9A 4L9JA 3GTMJ 2IP2A 4G12A 4BKXA 4MFEA 4O6JA 2D2WA 1XSXA 1F4KA 3GVAA 3EDPA 2MYSA 1XGMA 4BHCA 2DMTA 1QZYA 3SZTA 2DTRA 5EF6A 4RB1A 2E1CA 2YPRA 2Q0OA 2FQ4A 3CMEI 2O8XA 2CQXA 1H9GA 2FMLA 4B43A 1Y8RB 1K7AA 1X3WB 3QP5A 2EFOA 2JA6J 2Y69H 1ITYA 2UXNA 1PJRA 3HOTA 2KHMA 4CXFA 2V1UA 1TQMA 2DMUA 1TWFJ 2XAQA 2B63J 3GTOJ 2O61A 1T98A 2F5CA 3C2HA 2KPMA 3M4OJ 1P4AA 1KU3A 4KIBA 3M8JA 5K1YA 2B0LA 3RKWA 4NB5A 2BY2A 3LQQA 3ZQ7A 1DQUA 3MFKA 1ON2A 3F3XA 3LA7A 4OU0A 4LJZF 1RETA 4BS9A 5JI6A 2HQ5A 4ENMA 3KEQA 2QQ8A 1R71A 3Q0VA 2HR3A 3HIFA 3QOPA 4FCYA 4ENJA 1XC5A 2FQ3A 3BOQA 1FSEA 3HTUA 3GEZA 2DFHA 2M30A 3RPUD 4HZFA 2P4WA 3BPVA 4EJTA 3ROUA 1LVKA 1O57A 2CV1A 4KICA 2GIVA 3OYBA 4ZDLA 4JX5A 1O3SA 5D6EA 1G59A 1X1PA 4OIPF 4JX6A 1WJFA 4N4NB 4HX8A 2D45A 3JSPA 4ON0A 3CF2A 2RQQA 3FMRA 1FOWA 2XAHA 5M5XJ 2EINH 1YG2A 4XBFA 5F0CA 3E6MA 2NXNB 3NEUA 4A3MJ 2KJBA 2QZ8A 1LB2A 2ZXWH 5DM7F 1T0FC 2EQRA 3ZQLA 1O3RA 2WY8Q 3JRDA 4UUTA 4E7ZA 3I4NJ 2KIFA 1MDMB 3E7LA 3MWMA 3A4CA 3ZQFA 4XORA 5K7ZA 1RRJA 1SFEA 2RNJA 5C44J 3KZZA 2R4GA 4BH9A 1BC7C 2ADUA 2C6YA 2EZLA 1Z1DA 3FZVA 3ASNH 3FXMA 2LBFA 1U78A 4D7NA 2ME0A 2PX9A 4UV9A 3OMYA 5L3DA 1I27A 1U2WA 2ZXIA 4WK8F 2XAUA 5JHUA 4IL6C 2BZTA 4I99C 2KRFA 3TDZC 2WB1A 3TP3A 2LSOA 3RYRA 2HU9A 4BGDA 4C2TA 1U3EM 3AFHA 2FOKA 2A3SA 2MD0A 3LSKA 2W00A 2W85A 4DYQA 5M3FJ 3KZIC 3DEUA 3QODA 1Z05A 2XGXA 1QZEA 2F4IA 5KK1A 1F43A 1ZG1A 2HXIA 5F0HA 4P5OA 5HODA 3OS2A 4AVZA 4HNTA 3DU6A 1Z0XA 3DKXA 3LOCA 4RM2A 1BL0A 2IS4A 1X3ZB 2GAUA 2I8DA 1F9NA 5E3OA 4YEJA 2CUJA 2KDOA 5HLTA 4RM3A 3N05A 3QYFA 3AAFA 2HQRA 3RIRA 3FHZA 3S15J 3DBRB 1S8NA 1O3QA 1OKRA 4IHVA 3K6GA 2ISZA 4ZYHA 4G6TB 2DTZA 2VE9A 1RC9A 1U5TC 1CQTA 2IW5A 1RUNA 3I0TA 1DP3A 1AA7A 2FBHA 3UKGA 2PN6A 4J00A 3OYEA 1U8RA 3E0JB 4E7LA 3K4LA 2F6CA 4MO7A 1VQ8I 4F7ZA 1W5SA 3IH2A 5GAGJ 3ABLH 3FXKA 3BTIA 3NWSA 1S72I 3DCFA 1MH3A 4F93B 2IS6A 1D8KA 4RAZA 1D3YA 1WJBA 5FB2A 2KIQA 3S16J 2XF7A 1WJAA 3F8FA 5DD4A 3IV5A 1K6OA 9ANTA 2KDZA 2DU9A 2R5YB 2L3DA 3A01A 3SFZA 4E6KG 3VYSB 1RKWA 5TJJA 3BP8A 4KDPA 4KJZA 3OYLA 2LNBA 2VBZA 2XAGA 5GADJ 1NK2P 1ZKGA 1BR1A 2A6EF 1TW2A 3AG2H 4XRSG 4A3GJ 1F1ZA 2VBXA 2V9VA 1HC8A 3FM3A 2RVCA 2F5FA 5E8GA 5F0FA 4BXUA 2H27A 4BXXJ 1V4RA 1W1WE 3QPLA 3ZMZA 1VQPI 3JRGA 1B6AA 1ZYRF 2MG4A 3F8NA 2H8RA 1IDZA 5E3MA 4ENKA 3FX3A 2QWWA 3GFLA 5FROA 5E8IA 3BQYA 1D1CA 4XRFA 2XRNA 1R49A 4XN3A 2FOWA 2F5VA 2VT3A 2M45A 1E2XA 4HF1A 5CQGA 4EGZA 2E1OA 4IJAA 5CQEA 1KU7A 1JKQC 1JT6A 1YIJI 1B1BA 4IQ4A 1MMDA 1Q1HA 1V3FA 5ILVA 3GZ6A 1QRYA 3GMEA 1XGOA 5IOZA 1YRNA 1I1GA 2DODA 3FHNA 4EM1A 1KQ9A 3F6OA 4XKCA 2MFZA 4M3BA 4M9SA 4MQVA 3BJ6A 5C3EJ 2IA0A 3GTJJ 1R4NB 2ISYA 2VQCA 4A3CJ 3OYKA 1WHUA 3E3VA 4YIIA 2FUG2 3S3MA 4CUGA 3GUDA 1OR7C 1XCVA 3MZ8A 1UZCA 3H0DA 1ZGAA 1BW5A 2FNPA 1LPQA 3GYHX 3OL3A 3SDGA 3BJAA 1R9TJ 2M2EA 1W0UA 4A2UA 1JT0A 3RQ4A 2EBIA 2CJJA 5D5VB 1R6RA 1YW7A 4ZTJA 4WXHA 2NNYA 2LTPA 5GTHC 2EPFA 4LG3A 2M8EA 3D1NI 3ZQQA 2QA4I 4ZYGA 5FKOA 1ZHFA 2Z1DA 3W2VA 2OQGA 3K10A 3K70C 1DDNA 3LSRA 4WCGA 4RGXA 3SHFA 4IPAA 2CW7A 1HKQA 2MA3A 2DPUA 3WE2A 3WG7H 1VQ5I 1WRJA 4ESFA 1K4SA 2CUEA 2R7RA 3OR1C 1X2NA 3VYUB 2E1NA 1J0RA 4L9NA 1HW5A 4YFNF 5B66C 5DDGA 1FIAA 1AWCA 1I1SA 1T39A 3V7RA 2NAZA 1Y1VJ 2M0CA 3JCUC 2OQRA 3U2RA 1T08B 3MKWB 5EG0A 3OOPA 3ABUA 1TC3C 3EYIA 2NRAC 1B59A 2STWA 3CDLA 3BROA 3TKYA 1SD6A 5CVIA 4U7DA 1QA6A 2LC2A 1U0JA 5DD8A 1V5GA 5KAIC 2HVSA 1TT5B 3HRUA 2L4MA 1KYWA 1G3YA 4BJ6C 4JYKA 5J8FA 2DXIA 2LF7A 2ZSIB 4ZDOA 3H3VK 5B3SH 2LH9A 1FPQA 1MMAA 2QKLB 3HRSA 2DA4A 2M9HA 3HC7A 3VFZA 5DM6F 2M5WA 3MVPA 2QSHX 1JUSA 3ZRGA 3CMYA 5IPAA 3E1SA 4HF0A 4A6EA 1YTYA 2MD5A 3RJPA 3HL2A 2LMDA 2MBFA 2VL8A 3ECOA 1TBXA 1UHWA 2WTEA 2XGEA 3H36A 4N9IA 5HS9A 1APLC 2Z3YA 3GTLJ 1YYVA 5HLIA 1GV2A 1WWXA 2ZMEB 1LE8A 2Z16A 2KKOA 2HYFA 1T95A 2NS8A 1LDDA 2HI3A 1VQOI 3OIQA 3VYRB 2XC7A 4YG2F 5CVJA 3ZP5A 4M3GA 4XOTA 2NVUB 1W36D 4U0WA 1BR4A 2MGQA 1BIAA 4A12A 2P6SA 3A52A 1JUMA 1Z67A 3AG1H 1BOAA 4UVAA 2BY0A 4HNUA 1B72A 1MMGA 2X98A 1FP2A 2P0WA 3I64A 4AYBA 4DYCA 4A93J 1BW6A 1X1BA 4XLNF 1MJAA 4EM2A 4LOCA 3HRTA 2COMA 1YIOA 5J40A 4AIDA 4ZH4F 2VODA 4S05A 1W5TA 2LREA 4M3EA 2ZJ2A 3ULQB 3DPLC 2KZGA 3DF8A 1S6LA 3HUGB 1LKXA 1R36A 2O0YA 4HNVA 5KAFC 4YIRX 3G73A 1K4TA 2GZWA 3L9FA 1QO0D 4GFBA 4E70A 2LF8A 2BEOA 1W7PB 3ZMTA 1JKRC 2JVHA 4CA0A 2NOJB 2E2HJ 2M7AA 2OV7A 3KZYA 3S2DJ 2B7EA 1GXQA 1IN5A 2EFNA 3K4MA 1P4XA 4BHBA 4DQ2A 3H3UA 3CUQC 3BR2A 1AKHA 3CCMI
chains in the Genus database with same CATH topology
3V8LA 1ZLJA 3K1NA 2CO5A 2V6CA 2EV6A 2L54A 5D4SA 1FBSA 3GFJA 2OD5A 1OMIA 3KP6A 3GXOA 4YFKF 4UNOA 1ZG3A 5BS6A 3F22A 1YW9A 2L02A 3LAJA 3KCCA 1IN4A 2HWVA 4I02A 1EV7A 5CYVA 4RB2C 4HQEA 3F6VA 1CF7B 4Z2YA 1FYKA 4UVCA 3L09A 4ZZDA 3R60A 2MH9A 4U0YA 4KT5C 4AVPA 3RI4A 2EWNA 3K0LA 1Y0UA 2K7LA 3WTXC 2ELHA 1O7LA 5HVQC 1ZH5A 5ERIA 1R1VA 4U7BA 4LFUA 3LA3A 4EGYA 4Q5SF 2VBWA 3I54A 1SFUA 3RKYA 1HKSA 1R1UA 4P55A 3HSRA 5LHGA 1OYYA 5EEHA 2RKHA 5LGUA 1XGNA 3J80K 1GXPA 1U5TB 5LEJA 1LNWA 2A07F 3ECHA 3JTHA 3Q9VA 3HHGA 4RAYA 3N97A 1J7KA 2JTVA 1MJ9A 2WWYA 2IA1A 1FSHA 3LSTA 4Y13A 2GA1A 4MEYF 4QLCU 2XKOA 4UHTA 3ABTA 3C3WA 2YX7A 5D4RA 2ZO4A 1PP8F 2XAJA 3FXRA 2VT2A 2H6CA 4CO8A 4M74A 2AS5F 4M71A 1HKTA 1YS7A 1EH8A 1FC3A 1ZRFA 2EFQA 3ZMSA 2K86A 4Y17A 3FXUA 1KA8A 1P6RA 4GGGA 3DXJF 1O3TA 4HV6A 4L5IA 5AONA 1J2XA 1A04A 1OPCA 2QYOA 2EFPA 2RQPA 1XD7A 2FE3A 2WC2A 5DCMA 1R1TA 4JBAA 4Q48A 2VC0A 3TGNA 3F8CA 1JHFA 4G6QA 1FLIA 1BC8C 3V4GA 4NQWA 5A2QZ 1J59A 4LG0A 4BQAA 3BDDA 1MGTA 5FD6A 2A61A 1TLHB 3M8FA 2QQAA 2L01A 3LQRA 4Q47A 1WSUA 3FMQA 4LK0F 2UWMA 1Z6RA 4GYIA 3FWEA 2L4AA 2GXBA 1IN6A 1ZGJA 3C7JA 1D8JA 2W84A 2DK8A 1ZN2A 4FT8A 2EA2A 3P9IA 1FY7A 6PAXA 1FBQA 3E6BA 3CLOA 2QM3A 4LK1F 1Z91A 4RGRA 2QQ9A 3I5UA 3WG9A 1XMAA 1ZARA 4HOBA 3ELKA 2LKPA 3EQLF 5A2QK 5AIQA 3BZ6A 4A5MA 3WU1B 2XROA 1L0OC 3J81Z 1X3UA 2YU3A 1BIBA 3RPUA 4WX9A 5HS8A 3P9CA 2P7CB 5FO5A 5DCFA 4ASNA 4WF2A 3DP7A 3WTWC 2P7VB 4ESBA 1RUOA 3COAC 5HLGA 2JPCA 3HHHA 1O7FA 5H6QA 2P6TA 4I7HA 4MNUA 1JGSA 5KVRA 3T1BA 3B02A 3J81K 2HQNA 2DT5A 4EV0A 1KQ0A 4ENNA 4QWQA 1OYIA 1GHCA 3QPHA 1DPRA 4YIFA 1HW1A 2HKXA 1TW3A 1ZLKA 2VOPA 4G8XA 5BPDA 3CUQB 3R6SA 5LGTA 1QNTA 2GWRA 3U9GA 4HQMA 2FRHA 3GFIA 5K5QA 3WGHA 5E17F 3PQJA 3JSOA 2O6GE 1IW7F 4HAMA 5J8CA 2ZNZA 1CGPA 2H6BA 1L3LA 4YFXF 2BGCA 3V8JA 2RC4A 2MC3A 5D5UB 1K79A 2NNNA 4UV8A 1QPMA 5FGMA 2DW4A 4OIQF 2VE8A 4BHPA 3KEOA 2QQBA 4L9VA 3DKWA 3U1DA 2IVMA 4U0VA 4AD9A 2TDXA 4A0ZA 4O5VA 1LJ9A 1HW2A 5D5XB 2QBYB 3R0JA 4FX0A 5DUIA 1G3SA 1R22A 5D6FA 1B9MA 5LHIA 2OA4A 3IL2A 2BYVE 2EK5A 5DUKA 3WTSC 3HYIA 1PP7U 2F5EA 4LMYA 5IT3A 1SD4A 3CDHA 1LEAA 4WXCA 1S7AA 4AIKA 5LGNA 1XMKA 3GLXA 2IT0A 1DPUA 3C1DA 5LEKA 1LEBA 5H6RA 2STTA 2P5LC 4ESJA 2KJCA 2EV0A 1XDSA 2A5YB 3R4KA 3FF5A 2RV8A 4HX4A 3F72A 4MGRA 2ETHA 2XV4S 1XCBA 4GYGA 1WQ2A 2OU2A 4GO1A 5E1WA 4EJOA 3REOA 2X4HA 2W24A 3I59B 1G4DA 4GXOA 4MQ9F 1QGPA 2ZBKA 2HZTA 4HX7A 1G6NA 1TQIA 2O03A 1YLFA 2RN7A 3ERED 1MDMA 5CLSA 3DPTA 2XKPA 3H3ZA 2XHKA 2PBIA 3B73A 2EA4A 3FMSA 1FWZA 4LLLA 4RS8A 3V7SA 3E5UA 3S2WA 1QBJA 2DBBA 2FMYA 2VBYA 2G7HA 1EH7A 4G7ZF 1TTYA 3Q5FA 3EUHA 1YFHA 2Y0MA 2HTSA 1Z6TA 3F23A 1ODDA 4KN4X 3VEPA 3VB2A 1WKMA 4A0XA 2CSOA 1J75A 4IXAA 1UFMA 2FF4A 4I09A 4I0BA 4M73A 2ACJA 2AXLA 3CO7C 5L3GA 2QUFA 3F8BA 2VXZA 2Y75A 5K5RA 1G3TA 5DCMB 4DNCA 1S3JA 4I0AA 1VTNC 3PQKA 2NYXA 3TO9A 2OZUA 2CQKA 2PLYA 1BM9A 3WTZA 4AWXB 4GCVA 5LHHA 1R5GA 3ZPLA 1KGSA 1T6SA 3RPQA 3RYPA 3VODA 1STZA 1FNNA 3GW2A 1SMYF 5LLQA 4UVBA 2EJRA 2PJPA 1JXSA 3KLNA 4Q4ZF 3VOEA 5IT9Z 3PFIA 2YX4A 3M7GA 4OIRF 2DFIA 1W4MA 1XB4A 4M9ZA 4HA8A 3JW4A 4G9YA 4B8XA 1UB9A 2X0LA 4ZYEA 3QU6A 3P7NA 4HYEA 4LB5A 1FBUA 4BNCA 4JK1X 4EM0B 1BI1A 2DI3A 3KLOA 2O3FA 2QVOA 3O6BB 3MEXA 4M72A 2XIGA 1Z7UA 2W57A 1BI0A 3HRMA 4JQFA 2F5DA 1IN7A 5IT9K 2Z33A 1KYZA 4MTDA 5E18F 3LWFA 1KQ8A 1XDUA 5LBQA 4PCQA 5E1XA 4ETSA 3IKVA 3WTYC 4TV7A 5DYMA 1DUXC 4G94A 1BN5A 4KIGA 1DP7P 2K4JA 3HTSB 3T0YA 2OAZA 1JE8A 1QQIA 3M8EA 4CGZA 2ZKZA 3E6DA 3GF2A 2HOEA 2M87A 4OIOF 4IVNA 3GFMA 3IKTA 5LRSA 3Q9SA 5FD5A 2Q8KA 5JR3A 4CZZA 2V79A 4N0BA 2D1VA 3G3ZA 2GXGA 3CO6C 5FFXA 2UXXA 3QPTA 1IRFA 4LGWA 4EMSA 1D5VA 4G7OF 2WV0A 5CVRA 5E1ZB 1IRGA 4LB6B 3CTAA 3M1EA 5L3EA 2A6HF 3W6KB 3GWZA 3L00A 2CYYA 4U88A 5H20A 1LDKB 2D1HA 4WWCA 1S7OA 4I98B 2HFHA 2GQQA 2FXAA 1REPC 3O3KA 4I2OA 1FT9A 3ZMVA 3KP3A 2DLLA 1W7PD 1UHMA 2Y48A 4RB3C 1XGSA 5HDKA 3HUGA 5D8LB 1OYWA 3I4PA 1R00A 2FBKA 4HBLA 1B9NA 2ZXJA 1H0MA 3D5LA 3WTUC 2FNAA 3GX4X 2ZFWA 4CICA 3NRVA 4OOIA 2VOOA 3ZMDA 4OMYA 4HV5A 1RIOH 4KYWA 2J5PA 3T8RA 1K78A 1AOYA 3BPXA 1GVJA 3TO6A 1T0FA 1HQCA 2W25A 3NQOA 1FZPB 4CHUA 1QZZA 2ESNA 1XSVA 2E7WA 4NHJA 2M1BA 2HTJA 3ML6A 3WODF 4HDVA 2FA5A 2JT1A 3MAJA 3M9AA 3RDIA 2DQRA 1CF7A 4S04A 4EJUA 1JHHA 3IRRA 5L3CA 3WGIA 2JRTA 4PDKA 2HDCA 4XSXF 1USTA 5L3BA 2P5KA 2XASA 3C18A 2JZYA 4MHGA 1ZRDA 3WTTC 2Z5UA 1UCRA 1HBXG 3W6JB 3V7CA 3H92A 2NS0A 1IF1A 3IHUA 3L7WA 3LFKA 1U5TA 4HW0A 4I01A 2UZKA 5AIPA 4OINF 3IWFA 3I71A 3N4MA 1HXDA 2MH2A 4OMZA 1YO5C 2KIUA 5ICGA 3DV8A 2ZCWA 3ISPA 1Z9CA 2EB7A 5F64A 1FYMA 2F2EA 4Y15A 1XSDA 1IUYA 2PG4A 5JVTA 3IC7A 2GA2A 1SFXA 3R61A 2PMUA 5ICEA 1RZ4A 5JFRA 4CYDA 4KFCA 3E5XA 3BWGA 5ICFA 1J9IA 1IAWA 2KIMA 5DEQA 4XLPF 3K1PA 1SAXA 2HKOA 2DQLA 2HYGD 1BBYA 2K4BA 2V1XA 4IF4A 2RGVA 3K2ZA 4BAYA 3DFGA 3DQVC 2JPBA 3I58A 5BMZA 4MEXF 1FX7A 2IA2A 1IXSB 3BY6A 2FSWA 2PMHA 4A5NA 2XUBA 3LAPA 2A69F 4L0ZB 3JTGA 4O3MA 4EQQA 5F6FA 3O2PE 4LLGF 5HDGA 1OR7A 5ILUA 3T8TA 2YR2A 3TQNA 5HS7A 3KP2A 3WE3A 2DK5A 1R7JA 2HEOA 3ZMUA 2MLKA 4K2EA 5J6XA 2A68F 4PGGA 3F21A 2K27A 1R58A 2J5OA 2H09A 4L5JA 5CVVA 1SMTA 3LA2A 4IRHA 5ILSA 2CFXA 1S29A 2Z9OA 4AIJA 5EEGA 1BI3A 1WI9A 1SD5A 2CGPA 3HSFA 5FLXZ 2YSRA 2PFBA 5L3FA 2BE5F 1P4WA 5BPIA 2R7FA 1G3WA 2IRFG 4CDGA 2Q2EA 4RGSA 5ICCA 1IXCA 4B09A 3I53A 3MZHA 2PI0A 4RB0A 4L9TA 5D8KB 2IPQX 1ZG5A 3JAMZ 1R5HA 4ZYDA 4M6XA 3QAHA 3KP5A 4FHTA 1ZRCA 2DAOA 1FYLA 2DO7A 3MQ0A 2R3SA 5FLXK 4KIFA 2BBYA 3E6CC 1MD0A 4KMFA 4A0YA 1H9TA 1RI7A 4IRIA 3RTRA 1I5ZA 3ZN0A 1PDNC 5D5WB 1MZBA 2RDPA 1KU2A 1F5TA 2V1DA 5LRRA 2FBIA 1YW8A 5HDNA 3JAMK 3P9KA 1ULYA 2R7DA 1ONVA 4KA4A 1RNLA 1NHAA 1USSA 3RKXA 2CG4A 4LLNA 3CUQA 2HGCA 5TRDA 4IHSA 4D0PA 5E20A 4UUVA 2CW0F 3CUOA 1J5YA 3CJNA 1TNTA 2PQ8A 3TO7A 2XVCA 3K9TA 1IN8A 2G7UA 1ZAOA 5HOOA 4XSZF 4H0EA 3E97A 1EH6A 4LG0B 3TOBA 1R23A 4FX4A 1TQPA 3FXQA 2VC1A 4KUMA 2QLZA 3EETA 3QP6A 1T2KA 4UXNA 1C0WA 4G6DA 3IWZA 4KN7X 3TOAA 3K69A 2ESHA 4L18B 1P92A 1E17A 1K78B 1YS6A 4R8HA 3HOSA 2HS5A 4HLYA 5K5OA 3L2CA 2VN2A 2PEXA 4IRGA 4EJVA 2QBYA 1ZREA 2FEZA 2BV6A 2ZNYA 1I6XA 4AIHA 2LDUA 4IHTA 3K1MA 4N9HA 3J80Z 5CJ9A 3GO5A 1MKMA 1HSTA 1PUEE 3TDUC 2FU4A 4R79A 3R0AA 1FOKA 3SXYA 3J7AO 4HF2A 3QRFF 1MJBA 4HLXA 1ON1A 1BJAA 1SD7A 4P9UA 3KETA 4KMUX 3ZN1A 5HLHA 4P96A 3F8MA 4LD5A 3SZPA 4PGHA 2G9WA 4M9XA 1IZ1A 3I59A 4WXDA 1TNSA 2VONA 3BJOA 3KFWX 4A6DA 3KE2A 2E7XA 2P8TA 3FM5A 3QU3A 3KP4A 2K02A 5BOXA 3SQNA 4PZJA 4EVIA 4P9FA 1T38A 4ZZLA 3IRQA 4MTEA 5ED4A 1LQ1A 5DV5A 3T5XA 4BYYA 5BQTA 1P2FA 3D0SA 1U6GA 3MCZA 4G7HF 4R1HA 4M6YA 2OBPA 3WU0A 2MLGA 2P5VA 5F1RA 3GZ5A 2ZMEA 3HSEA 5CVUA 2IJLA 2OZ6A 3EYYA 4KNYA 1IXRC 1YQAA 3V8KA 1XN7A 2Z99A 1HSJA 3OV8A 1B4AA 1BI2A 3MZYA 1KU9A 4RGUA 2EFWA 2CWEA 1FP1D 3WTVC 3E5QA 1LDJA 1LVAA 5FFZA 3WGGA 2QENA 4HDUA 2JSCA 3KP7A 2XAFA 2H94A 2DPDA 4EJWA 2EV5A 1W7PA 4L9JA 2IP2A 4O6JA 2D2WA 1XSXA 1F4KA 3GVAA 3EDPA 1XGMA 4BHCA 1QZYA 3SZTA 2DTRA 4RB1A 2E1CA 2YPRA 2Q0OA 2O8XA 2FMLA 1H9GA 1K7AA 3QP5A 2EFOA 2UXNA 3HOTA 4CXFA 2V1UA 1TQMA 2XAQA 2O61A 1T98A 2F5CA 1P4AA 1KU3A 4KIBA 5K1YA 2B0LA 3RKWA 4NB5A 3LQQA 3ZQ7A 3MFKA 1ON2A 3F3XA 3LA7A 4OU0A 4LJZF 5JI6A 4ENMA 3KEQA 2HR3A 3HIFA 3QOPA 4ENJA 2FQ3A 3BOQA 1FSEA 3HTUA 3GEZA 2M30A 4HZFA 2P4WA 3BPVA 4EJTA 3ROUA 1O57A 4KICA 2GIVA 4OIPF 1O3SA 5D6EA 4HX8A 2D45A 3JSPA 4ON0A 3FMRA 2XAHA 1YG2A 4XBFA 3E6MA 3NEUA 2KJBA 2QZ8A 1LB2A 1O3RA 2KIFA 1MDMB 3MWMA 1SFEA 2RNJA 3KZZA 4BH9A 1BC7C 2ADUA 2C6YA 1Z1DA 3FZVA 1U78A 4UV9A 5L3DA 1I27A 1U2WA 4WK8F 5JHUA 2KRFA 3TDZC 2LSOA 3RYRA 1U3EM 2FOKA 2A3SA 2W85A 3DEUA 1Z05A 2XGXA 5KK1A 1ZG1A 4P5OA 2GAUA 1F9NA 3AAFA 2HQRA 3RIRA 3FHZA 1S8NA 1O3QA 1OKRA 2ISZA 4ZYHA 2VE9A 1U5TC 2IW5A 1RUNA 3I0TA 2FBHA 2PN6A 1U8RA 4F7ZA 1W5SA 1D8KA 4RAZA 1D3YA 5FB2A 3F8FA 5DD4A 1K6OA 2DU9A 2L3DA 3SFZA 5TJJA 4KDPA 3BP8A 2LNBA 2VBZA 2XAGA 2A6EF 1TW2A 1F1ZA 2VBXA 2V9VA 3FM3A 2RVCA 2F5FA 5E8GA 4BXUA 2H27A 1V4RA 3ZMZA 1B6AA 1ZYRF 3F8NA 4ENKA 3FX3A 2QWWA 3GFLA 5E8IA 4XRFA 2XRNA 2VT3A 2M45A 1E2XA 4HF1A 4EGZA 4IJAA 1KU7A 1B1BA 1Q1HA 1V3FA 5ILVA 3GZ6A 1XGOA 1I1GA 4EM1A 1KQ9A 3F6OA 4MQVA 4M9SA 3BJ6A 2IA0A 2ISYA 3E3VA 4YIIA 3GUDA 1XCVA 1ZGAA 2FNPA 3GYHX 3BJAA 4A2UA 5D5VB 1YW7A 4WXHA 2NNYA 2M8EA 4ZYGA 1ZHFA 2OQGA 1DDNA 4WCGA 4RGXA 3SHFA 4IPAA 1HKQA 2MA3A 2DPUA 3WE2A 1WRJA 4ESFA 2E1NA 1J0RA 4L9NA 1HW5A 4YFNF 5DDGA 1AWCA 1I1SA 1T39A 3V7RA 2NAZA 2OQRA 3U2RA 3OOPA 3ABUA 3EYIA 2NRAC 1B59A 2STWA 3BROA 3TKYA 1SD6A 5CVIA 4U7DA 5DD8A 3HRUA 2L4MA 1KYWA 1G3YA 5J8FA 2LF7A 1FPQA 3HRSA 3VFZA 2M5WA 4HF0A 4A6EA 1YTYA 2MD5A 3RJPA 2MBFA 3ECOA 1TBXA 1UHWA 2WTEA 4N9IA 5HS9A 2Z3YA 1YYVA 5HLIA 1WWXA 2ZMEB 2KKOA 2HYFA 1LDDA 4YG2F 5CVJA 3ZP5A 4U0WA 1BIAA 4A12A 2P6SA 4UVAA 1BOAA 1FP2A 3I64A 4XLNF 1MJAA 4EM2A 3HRTA 2COMA 1YIOA 4ZH4F 2VODA 4S05A 1W5TA 2ZJ2A 3ULQB 3DPLC 3DF8A 1S6LA 2O0YA 1R36A 3G73A 2GZWA 3L9FA 1QO0D 4E70A 2LF8A 2BEOA 1W7PB 3ZMTA 3KZYA 1GXQA 1IN5A 2EFNA 1P4XA 4BHBA 4DQ2A 3H3UA 3CUQC 4L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8L A;  1ZLJ A;  3K1N A;  2CO5 A;  2V6C A;  2EV6 A;  2L54 A;  5D4S A;  1FBS A;  3GFJ A;  2OD5 A;  1OMI A;  3KP6 A;  3GXO A;  4YFK F;  4UNO A;  1ZG3 A;  5BS6 A;  3F22 A;  1YW9 A;  2L02 A;  3LAJ A;  3KCC A;  1IN4 A;  2HWV A;  4I02 A;  1EV7 A;  5CYV A;  4RB2 C;  4HQE A;  3F6V A;  1CF7 B;  4Z2Y A;  1FYK A;  4UVC A;  3L09 A;  4ZZD A;  3R60 A;  2MH9 A;  4U0Y A;  4KT5 C;  4AVP A;  3RI4 A;  2EWN A;  3K0L A;  1Y0U A;  2K7L A;  3WTX C;  2ELH A;  1O7L A;  5HVQ C;  1ZH5 A;  5ERI A;  1R1V A;  4U7B A;  4LFU A;  3LA3 A;  4EGY A;  4Q5S F;  2VBW A;  3I54 A;  1SFU A;  3RKY A;  1HKS A;  1R1U A;  4P55 A;  3HSR A;  5LHG A;  1OYY A;  5EEH A;  2RKH A;  5LGU A;  1XGN A;  3J80 K;  1GXP A;  1U5T B;  5LEJ A;  1LNW A;  2A07 F;  3ECH A;  3JTH A;  3Q9V A;  3HHG A;  4RAY A;  3N97 A;  1J7K A;  2JTV A;  1MJ9 A;  2WWY A;  2IA1 A;  1FSH A;  3LST A;  4Y13 A;  2GA1 A;  4MEY F;  4QLC U;  2XKO A;  4UHT A;  3ABT A;  3C3W A;  2YX7 A;  5D4R A;  2ZO4 A;  1PP8 F;  2XAJ A;  3FXR A;  2VT2 A;  2H6C A;  4CO8 A;  4M74 A;  2AS5 F;  4M71 A;  1HKT A;  1YS7 A;  1EH8 A;  1FC3 A;  1ZRF A;  2EFQ A;  3ZMS A;  2K86 A;  4Y17 A;  3FXU A;  1KA8 A;  1P6R A;  4GGG A;  3DXJ F;  1O3T A;  4HV6 A;  4L5I A;  5AON A;  1J2X A;  1A04 A;  1OPC A;  2QYO A;  2EFP A;  2RQP A;  1XD7 A;  2FE3 A;  2WC2 A;  5DCM A;  1R1T A;  4JBA A;  4Q48 A;  2VC0 A;  3TGN A;  3F8C A;  1JHF A;  4G6Q A;  1FLI A;  1BC8 C;  3V4G A;  4NQW A;  5A2Q Z;  1J59 A;  4LG0 A;  4BQA A;  3BDD A;  1MGT A;  5FD6 A;  2A61 A;  1TLH B;  3M8F A;  2QQA A;  2L01 A;  3LQR A;  4Q47 A;  1WSU A;  3FMQ A;  4LK0 F;  2UWM A;  1Z6R A;  4GYI A;  3FWE A;  2L4A A;  2GXB A;  1IN6 A;  1ZGJ A;  3C7J A;  1D8J A;  2W84 A;  2DK8 A;  1ZN2 A;  4FT8 A;  2EA2 A;  3P9I A;  1FY7 A;  6PAX A;  1FBQ A;  3E6B A;  3CLO A;  2QM3 A;  4LK1 F;  1Z91 A;  4RGR A;  2QQ9 A;  3I5U A;  3WG9 A;  1XMA A;  1ZAR A;  4HOB A;  3ELK A;  2LKP A;  3EQL F;  5A2Q K;  5AIQ A;  3BZ6 A;  4A5M A;  3WU1 B;  2XRO A;  1L0O C;  3J81 Z;  1X3U A;  2YU3 A;  1BIB A;  3RPU A;  4WX9 A;  5HS8 A;  3P9C A;  2P7C B;  5FO5 A;  5DCF A;  4ASN A;  4WF2 A;  3DP7 A;  3WTW C;  2P7V B;  4ESB A;  1RUO A;  3COA C;  5HLG A;  2JPC A;  3HHH A;  1O7F A;  5H6Q A;  2P6T A;  4I7H A;  4MNU A;  1JGS A;  5KVR A;  3T1B A;  3B02 A;  3J81 K;  2HQN A;  2DT5 A;  4EV0 A;  1KQ0 A;  4ENN A;  4QWQ A;  1OYI A;  1GHC A;  3QPH A;  1DPR A;  4YIF A;  1HW1 A;  2HKX A;  1TW3 A;  1ZLK A;  2VOP A;  4G8X A;  5BPD A;  3CUQ B;  3R6S A;  5LGT A;  1QNT A;  2GWR A;  3U9G A;  4HQM A;  2FRH A;  3GFI A;  5K5Q A;  3WGH A;  5E17 F;  3PQJ A;  3JSO A;  2O6G E;  1IW7 F;  4HAM A;  5J8C A;  2ZNZ A;  1CGP A;  2H6B A;  1L3L A;  4YFX F;  2BGC A;  3V8J A;  2RC4 A;  2MC3 A;  5D5U B;  1K79 A;  2NNN A;  4UV8 A;  1QPM A;  5FGM A;  2DW4 A;  4OIQ F;  2VE8 A;  4BHP A;  3KEO A;  2QQB A;  4L9V A;  3DKW A;  3U1D A;  2IVM A;  4U0V A;  4AD9 A;  2TDX A;  4A0Z A;  4O5V A;  1LJ9 A;  1HW2 A;  5D5X B;  2QBY B;  3R0J A;  4FX0 A;  5DUI A;  1G3S A;  1R22 A;  5D6F A;  1B9M A;  5LHI A;  2OA4 A;  3IL2 A;  2BYV E;  2EK5 A;  5DUK A;  3WTS C;  3HYI A;  1PP7 U;  2F5E A;  4LMY A;  5IT3 A;  1SD4 A;  3CDH A;  1LEA A;  4WXC A;  1S7A A;  4AIK A;  5LGN A;  1XMK A;  3GLX A;  2IT0 A;  1DPU A;  3C1D A;  5LEK A;  1LEB A;  5H6R A;  2STT A;  2P5L C;  4ESJ A;  2KJC A;  2EV0 A;  1XDS A;  2A5Y B;  3R4K A;  3FF5 A;  2RV8 A;  4HX4 A;  3F72 A;  4MGR A;  2ETH A;  2XV4 S;  1XCB A;  4GYG A;  1WQ2 A;  2OU2 A;  4GO1 A;  5E1W A;  4EJO A;  3REO A;  2X4H A;  2W24 A;  3I59 B;  1G4D A;  4GXO A;  4MQ9 F;  1QGP A;  2ZBK A;  2HZT A;  4HX7 A;  1G6N A;  1TQI A;  2O03 A;  1YLF A;  2RN7 A;  3ERE D;  1MDM A;  5CLS A;  3DPT A;  2XKP A;  3H3Z A;  2XHK A;  2PBI A;  3B73 A;  2EA4 A;  3FMS A;  1FWZ A;  4LLL A;  4RS8 A;  3V7S A;  3E5U A;  3S2W A;  1QBJ A;  2DBB A;  2FMY A;  2VBY A;  2G7H A;  1EH7 A;  4G7Z F;  1TTY A;  3Q5F A;  3EUH A;  1YFH A;  2Y0M A;  2HTS A;  1Z6T A;  3F23 A;  1ODD A;  4KN4 X;  3VEP A;  3VB2 A;  1WKM A;  4A0X A;  2CSO A;  1J75 A;  4IXA A;  1UFM A;  2FF4 A;  4I09 A;  4I0B A;  4M73 A;  2ACJ A;  2AXL A;  3CO7 C;  5L3G A;  2QUF A;  3F8B A;  2VXZ A;  2Y75 A;  5K5R A;  1G3T A;  5DCM B;  4DNC A;  1S3J A;  4I0A A;  1VTN C;  3PQK A;  2NYX A;  3TO9 A;  2OZU A;  2CQK A;  2PLY A;  1BM9 A;  3WTZ A;  4AWX B;  4GCV A;  5LHH A;  1R5G A;  3ZPL A;  1KGS A;  1T6S A;  3RPQ A;  3RYP A;  3VOD A;  1STZ A;  1FNN A;  3GW2 A;  1SMY F;  5LLQ A;  4UVB A;  2EJR A;  2PJP A;  1JXS A;  3KLN A;  4Q4Z F;  3VOE A;  5IT9 Z;  3PFI A;  2YX4 A;  3M7G A;  4OIR F;  2DFI A;  1W4M A;  1XB4 A;  4M9Z A;  4HA8 A;  3JW4 A;  4G9Y A;  4B8X A;  1UB9 A;  2X0L A;  4ZYE A;  3QU6 A;  3P7N A;  4HYE A;  4LB5 A;  1FBU A;  4BNC A;  4JK1 X;  4EM0 B;  1BI1 A;  2DI3 A;  3KLO A;  2O3F A;  2QVO A;  3O6B B;  3MEX A;  4M72 A;  2XIG A;  1Z7U A;  2W57 A;  1BI0 A;  3HRM A;  4JQF A;  2F5D A;  1IN7 A;  5IT9 K;  2Z33 A;  1KYZ A;  4MTD A;  5E18 F;  3LWF A;  1KQ8 A;  1XDU A;  5LBQ A;  4PCQ A;  5E1X A;  4ETS A;  3IKV A;  3WTY C;  4TV7 A;  5DYM A;  1DUX C;  4G94 A;  1BN5 A;  4KIG A;  1DP7 P;  2K4J A;  3HTS B;  3T0Y A;  2OAZ A;  1JE8 A;  1QQI A;  3M8E A;  4CGZ A;  2ZKZ A;  3E6D A;  3GF2 A;  2HOE A;  2M87 A;  4OIO F;  4IVN A;  3GFM A;  3IKT A;  5LRS A;  3Q9S A;  5FD5 A;  2Q8K A;  5JR3 A;  4CZZ A;  2V79 A;  4N0B A;  2D1V A;  3G3Z A;  2GXG A;  3CO6 C;  5FFX A;  2UXX A;  3QPT A;  1IRF A;  4LGW A;  4EMS A;  1D5V A;  4G7O F;  2WV0 A;  5CVR A;  5E1Z B;  1IRG A;  4LB6 B;  3CTA A;  3M1E A;  5L3E A;  2A6H F;  3W6K B;  3GWZ A;  3L00 A;  2CYY A;  4U88 A;  5H20 A;  1LDK B;  2D1H A;  4WWC A;  1S7O A;  4I98 B;  2HFH A;  2GQQ A;  2FXA A;  1REP C;  3O3K A;  4I2O A;  1FT9 A;  3ZMV A;  3KP3 A;  2DLL A;  1W7P D;  1UHM A;  2Y48 A;  4RB3 C;  1XGS A;  5HDK A;  3HUG A;  5D8L B;  1OYW A;  3I4P A;  1R00 A;  2FBK A;  4HBL A;  1B9N A;  2ZXJ A;  1H0M A;  3D5L A;  3WTU C;  2FNA A;  3GX4 X;  2ZFW A;  4CIC A;  3NRV A;  4OOI A;  2VOO A;  3ZMD A;  4OMY A;  4HV5 A;  1RIO H;  4KYW A;  2J5P A;  3T8R A;  1K78 A;  1AOY A;  3BPX A;  1GVJ A;  3TO6 A;  1T0F A;  1HQC A;  2W25 A;  3NQO A;  1FZP B;  4CHU A;  1QZZ A;  2ESN A;  1XSV A;  2E7W A;  4NHJ A;  2M1B A;  2HTJ A;  3ML6 A;  3WOD F;  4HDV A;  2FA5 A;  2JT1 A;  3MAJ A;  3M9A A;  3RDI A;  2DQR A;  1CF7 A;  4S04 A;  4EJU A;  1JHH A;  3IRR A;  5L3C A;  3WGI A;  2JRT A;  4PDK A;  2HDC A;  4XSX F;  1UST A;  5L3B A;  2P5K A;  2XAS A;  3C18 A;  2JZY A;  4MHG A;  1ZRD A;  3WTT C;  2Z5U A;  1UCR A;  1HBX G;  3W6J B;  3V7C A;  3H92 A;  2NS0 A;  1IF1 A;  3IHU A;  3L7W A;  3LFK A;  1U5T A;  4HW0 A;  4I01 A;  2UZK A;  5AIP A;  4OIN F;  3IWF A;  3I71 A;  3N4M A;  1HXD A;  2MH2 A;  4OMZ A;  1YO5 C;  2KIU A;  5ICG A;  3DV8 A;  2ZCW A;  3ISP A;  1Z9C A;  2EB7 A;  5F64 A;  1FYM A;  2F2E A;  4Y15 A;  1XSD A;  1IUY A;  2PG4 A;  5JVT A;  3IC7 A;  2GA2 A;  1SFX A;  3R61 A;  2PMU A;  5ICE A;  1RZ4 A;  5JFR A;  4CYD A;  4KFC A;  3E5X A;  3BWG A;  5ICF A;  1J9I A;  1IAW A;  2KIM A;  5DEQ A;  4XLP F;  3K1P A;  1SAX A;  2HKO A;  2DQL A;  2HYG D;  1BBY A;  2K4B A;  2V1X A;  4IF4 A;  2RGV A;  3K2Z A;  4BAY A;  3DFG A;  3DQV C;  2JPB A;  3I58 A;  5BMZ A;  4MEX F;  1FX7 A;  2IA2 A;  1IXS B;  3BY6 A;  2FSW A;  2PMH A;  4A5N A;  2XUB A;  3LAP A;  2A69 F;  4L0Z B;  3JTG A;  4O3M A;  4EQQ A;  5F6F A;  3O2P E;  4LLG F;  5HDG A;  1OR7 A;  5ILU A;  3T8T A;  2YR2 A;  3TQN A;  5HS7 A;  3KP2 A;  3WE3 A;  2DK5 A;  1R7J A;  2HEO A;  3ZMU A;  2MLK A;  4K2E A;  5J6X A;  2A68 F;  4PGG A;  3F21 A;  2K27 A;  1R58 A;  2J5O A;  2H09 A;  4L5J A;  5CVV A;  1SMT A;  3LA2 A;  4IRH A;  5ILS A;  2CFX A;  1S29 A;  2Z9O A;  4AIJ A;  5EEG A;  1BI3 A;  1WI9 A;  1SD5 A;  2CGP A;  3HSF A;  5FLX Z;  2YSR A;  2PFB A;  5L3F A;  2BE5 F;  1P4W A;  5BPI A;  2R7F A;  1G3W A;  2IRF G;  4CDG A;  2Q2E A;  4RGS A;  5ICC A;  1IXC A;  4B09 A;  3I53 A;  3MZH A;  2PI0 A;  4RB0 A;  4L9T A;  5D8K B;  2IPQ X;  1ZG5 A;  3JAM Z;  1R5H A;  4ZYD A;  4M6X A;  3QAH A;  3KP5 A;  4FHT A;  1ZRC A;  2DAO A;  1FYL A;  2DO7 A;  3MQ0 A;  2R3S A;  5FLX K;  4KIF A;  2BBY A;  3E6C C;  1MD0 A;  4KMF A;  4A0Y A;  1H9T A;  1RI7 A;  4IRI A;  3RTR A;  1I5Z A;  3ZN0 A;  1PDN C;  5D5W B;  1MZB A;  2RDP A;  1KU2 A;  1F5T A;  2V1D A;  5LRR A;  2FBI A;  1YW8 A;  5HDN A;  3JAM K;  3P9K A;  1ULY A;  2R7D A;  1ONV A;  4KA4 A;  1RNL A;  1NHA A;  1USS A;  3RKX A;  2CG4 A;  4LLN A;  3CUQ A;  2HGC A;  5TRD A;  4IHS A;  4D0P A;  5E20 A;  4UUV A;  2CW0 F;  3CUO A;  1J5Y A;  3CJN A;  1TNT A;  2PQ8 A;  3TO7 A;  2XVC A;  3K9T A;  1IN8 A;  2G7U A;  1ZAO A;  5HOO A;  4XSZ F;  4H0E A;  3E97 A;  1EH6 A;  4LG0 B;  3TOB A;  1R23 A;  4FX4 A;  1TQP A;  3FXQ A;  2VC1 A;  4KUM A;  2QLZ A;  3EET A;  3QP6 A;  1T2K A;  4UXN A;  1C0W A;  4G6D A;  3IWZ A;  4KN7 X;  3TOA A;  3K69 A;  2ESH A;  4L18 B;  1P92 A;  1E17 A;  1K78 B;  1YS6 A;  4R8H A;  3HOS A;  2HS5 A;  4HLY A;  5K5O A;  3L2C A;  2VN2 A;  2PEX A;  4IRG A;  4EJV A;  2QBY A;  1ZRE A;  2FEZ A;  2BV6 A;  2ZNY A;  1I6X A;  4AIH A;  2LDU A;  4IHT A;  3K1M A;  4N9H A;  3J80 Z;  5CJ9 A;  3GO5 A;  1MKM A;  1HST A;  1PUE E;  3TDU C;  2FU4 A;  4R79 A;  3R0A A;  1FOK A;  3SXY A;  3J7A O;  4HF2 A;  3QRF F;  1MJB A;  4HLX A;  1ON1 A;  1BJA A;  1SD7 A;  4P9U A;  3KET A;  4KMU X;  3ZN1 A;  5HLH A;  4P96 A;  3F8M A;  4LD5 A;  3SZP A;  4PGH A;  2G9W A;  4M9X A;  1IZ1 A;  3I59 A;  4WXD A;  1TNS A;  2VON A;  3BJO A;  3KFW X;  4A6D A;  3KE2 A;  2E7X A;  2P8T A;  3FM5 A;  3QU3 A;  3KP4 A;  2K02 A;  5BOX A;  3SQN A;  4PZJ A;  4EVI A;  4P9F A;  1T38 A;  4ZZL A;  3IRQ A;  4MTE A;  5ED4 A;  1LQ1 A;  5DV5 A;  3T5X A;  4BYY A;  5BQT A;  1P2F A;  3D0S A;  1U6G A;  3MCZ A;  4G7H F;  4R1H A;  4M6Y A;  2OBP A;  3WU0 A;  2MLG A;  2P5V A;  5F1R A;  3GZ5 A;  2ZME A;  3HSE A;  5CVU A;  2IJL A;  2OZ6 A;  3EYY A;  4KNY A;  1IXR C;  1YQA A;  3V8K A;  1XN7 A;  2Z99 A;  1HSJ A;  3OV8 A;  1B4A A;  1BI2 A;  3MZY A;  1KU9 A;  4RGU A;  2EFW A;  2CWE A;  1FP1 D;  3WTV C;  3E5Q A;  1LDJ A;  1LVA A;  5FFZ A;  3WGG A;  2QEN A;  4HDU A;  2JSC A;  3KP7 A;  2XAF A;  2H94 A;  2DPD A;  4EJW A;  2EV5 A;  1W7P A;  4L9J A;  2IP2 A;  4O6J A;  2D2W A;  1XSX A;  1F4K A;  3GVA A;  3EDP A;  1XGM A;  4BHC A;  1QZY A;  3SZT A;  2DTR A;  4RB1 A;  2E1C A;  2YPR A;  2Q0O A;  2O8X A;  2FML A;  1H9G A;  1K7A A;  3QP5 A;  2EFO A;  2UXN A;  3HOT A;  4CXF A;  2V1U A;  1TQM A;  2XAQ A;  2O61 A;  1T98 A;  2F5C A;  1P4A A;  1KU3 A;  4KIB A;  5K1Y A;  2B0L A;  3RKW A;  4NB5 A;  3LQQ A;  3ZQ7 A;  3MFK A;  1ON2 A;  3F3X A;  3LA7 A;  4OU0 A;  4LJZ F;  5JI6 A;  4ENM A;  3KEQ A;  2HR3 A;  3HIF A;  3QOP A;  4ENJ A;  2FQ3 A;  3BOQ A;  1FSE A;  3HTU A;  3GEZ A;  2M30 A;  4HZF A;  2P4W A;  3BPV A;  4EJT A;  3ROU A;  1O57 A;  4KIC A;  2GIV A;  4OIP F;  1O3S A;  5D6E A;  4HX8 A;  2D45 A;  3JSP A;  4ON0 A;  3FMR A;  2XAH A;  1YG2 A;  4XBF A;  3E6M A;  3NEU A;  2KJB A;  2QZ8 A;  1LB2 A;  1O3R A;  2KIF A;  1MDM B;  3MWM A;  1SFE A;  2RNJ A;  3KZZ A;  4BH9 A;  1BC7 C;  2ADU A;  2C6Y A;  1Z1D A;  3FZV A;  1U78 A;  4UV9 A;  5L3D A;  1I27 A;  1U2W A;  4WK8 F;  5JHU A;  2KRF A;  3TDZ C;  2LSO A;  3RYR A;  1U3E M;  2FOK A;  2A3S A;  2W85 A;  3DEU A;  1Z05 A;  2XGX A;  5KK1 A;  1ZG1 A;  4P5O A;  2GAU A;  1F9N A;  3AAF A;  2HQR A;  3RIR A;  3FHZ A;  1S8N A;  1O3Q A;  1OKR A;  2ISZ A;  4ZYH A;  2VE9 A;  1U5T C;  2IW5 A;  1RUN A;  3I0T A;  2FBH A;  2PN6 A;  1U8R A;  4F7Z A;  1W5S A;  1D8K A;  4RAZ A;  1D3Y A;  5FB2 A;  3F8F A;  5DD4 A;  1K6O A;  2DU9 A;  2L3D A;  3SFZ A;  5TJJ A;  4KDP A;  3BP8 A;  2LNB A;  2VBZ A;  2XAG A;  2A6E F;  1TW2 A;  1F1Z A;  2VBX A;  2V9V A;  3FM3 A;  2RVC A;  2F5F A;  5E8G A;  4BXU A;  2H27 A;  1V4R A;  3ZMZ A;  1B6A A;  1ZYR F;  3F8N A;  4ENK A;  3FX3 A;  2QWW A;  3GFL A;  5E8I A;  4XRF A;  2XRN A;  2VT3 A;  2M45 A;  1E2X A;  4HF1 A;  4EGZ A;  4IJA A;  1KU7 A;  1B1B A;  1Q1H A;  1V3F A;  5ILV A;  3GZ6 A;  1XGO A;  1I1G A;  4EM1 A;  1KQ9 A;  3F6O A;  4MQV A;  4M9S A;  3BJ6 A;  2IA0 A;  2ISY A;  3E3V A;  4YII A;  3GUD A;  1XCV A;  1ZGA A;  2FNP A;  3GYH X;  3BJA A;  4A2U A;  5D5V B;  1YW7 A;  4WXH A;  2NNY A;  2M8E A;  4ZYG A;  1ZHF A;  2OQG A;  1DDN A;  4WCG A;  4RGX A;  3SHF A;  4IPA A;  1HKQ A;  2MA3 A;  2DPU A;  3WE2 A;  1WRJ A;  4ESF A;  2E1N A;  1J0R A;  4L9N A;  1HW5 A;  4YFN F;  5DDG A;  1AWC A;  1I1S A;  1T39 A;  3V7R A;  2NAZ A;  2OQR A;  3U2R A;  3OOP A;  3ABU A;  3EYI A;  2NRA C;  1B59 A;  2STW A;  3BRO A;  3TKY A;  1SD6 A;  5CVI A;  4U7D A;  5DD8 A;  3HRU A;  2L4M A;  1KYW A;  1G3Y A;  5J8F A;  2LF7 A;  1FPQ A;  3HRS A;  3VFZ A;  2M5W A;  4HF0 A;  4A6E A;  1YTY A;  2MD5 A;  3RJP A;  2MBF A;  3ECO A;  1TBX A;  1UHW A;  2WTE A;  4N9I A;  5HS9 A;  2Z3Y A;  1YYV A;  5HLI A;  1WWX A;  2ZME B;  2KKO A;  2HYF A;  1LDD A;  4YG2 F;  5CVJ A;  3ZP5 A;  4U0W A;  1BIA A;  4A12 A;  2P6S A;  4UVA A;  1BOA A;  1FP2 A;  3I64 A;  4XLN F;  1MJA A;  4EM2 A;  3HRT A;  2COM A;  1YIO A;  4ZH4 F;  2VOD A;  4S05 A;  1W5T A;  2ZJ2 A;  3ULQ B;  3DPL C;  3DF8 A;  1S6L A;  2O0Y A;  1R36 A;  3G73 A;  2GZW A;  3L9F A;  1QO0 D;  4E70 A;  2LF8 A;  2BEO A;  1W7P B;  3ZMT A;  3KZY A;  1GXQ A;  1IN5 A;  2EFN A;  1P4X A;  4BHB A;  4DQ2 A;  3H3U A;  3CUQ C;  4L0Y B; 
#chains in the Genus database with same CATH topology
 3V8L A;  3K4C A;  1ZLJ A;  3TP0 A;  2VI6 A;  3Q3S A;  3K1N A;  2CO5 A;  4CCJ A;  2V6C A;  2EV6 A;  3OYI A;  4XL9 A;  1PUF A;  2L54 A;  2X1D A;  4MIM A;  1E3P A;  5D4S A;  4YEL A;  1ETO A;  1FBS A;  3GFJ A;  2LG4 A;  2OD5 A;  1OMI A;  2E35 A;  2ZXH A;  3KP6 A;  3GXO A;  4YFK F;  2DYR H;  4UNO A;  2BHZ A;  1G8X A;  1ZG3 A;  2VJJ A;  5BS6 A;  2AQE A;  3DPU A;  3F22 A;  1YW9 A;  2L02 A;  3BR3 A;  3LAJ A;  2ZJQ F;  2K85 A;  2TRT A;  3W2A A;  3KCC A;  1IN4 A;  4IQJ A;  2HWV A;  4I02 A;  3DLA A;  1FTZ A;  1EV7 A;  2L7M P;  5CYV A;  1B8I A;  4RB2 C;  3I56 I;  4HQE A;  2DYS H;  3F6V A;  2CH0 A;  1CF7 B;  4Z2Y A;  3HDD A;  1FYK A;  3L2V A;  4UVC A;  4ZYA A;  3L09 A;  4FTH A;  4ZZD A;  5IP7 J;  3PUF A;  3R60 A;  2MH9 A;  4U0Y A;  4KT5 C;  3MKY B;  4AVP A;  1IG7 A;  1VQ4 I;  1VQ9 I;  3RI4 A;  1XX5 A;  2EWN A;  3K0L A;  1Y0U A;  2K7L A;  5J1U A;  3WTX C;  1YE9 A;  1O7L A;  2ELH A;  2X85 A;  5HVQ C;  3CCU I;  1ZH5 A;  3J7Z I;  5ERI A;  1R1V A;  4XN0 A;  4B48 A;  4U7B A;  4B4C A;  4LFU A;  3LA3 A;  4EGY A;  1VND A;  4Q5S F;  2VBW A;  4EEF G;  3I54 A;  4IX7 A;  4IEJ A;  2O5R A;  1SFU A;  4D9J A;  1LUJ B;  3RKY A;  1HKS A;  1R1U A;  2ID6 A;  4P55 A;  2DA6 A;  2CV0 A;  3HSR A;  5LHG A;  3JR9 A;  2M4K A;  1OYY A;  1MMS A;  1JJ8 C;  3MN2 A;  5EEH A;  2RKH A;  1TZL A;  5LGU A;  1XGN A;  1W5C C;  2EIM H;  3J80 K;  1GXP A;  1U5T B;  5LEJ A;  1LNW A;  2A07 F;  3QWL A;  1BOB A;  5CKT A;  4AM3 A;  3TMO A;  1QPI A;  3ECH A;  2VKH A;  3F0C A;  2BHY A;  3JTH A;  3Q9V A;  2TCT A;  2KIS A;  3HHG A;  4MLO A;  1UHS A;  4RAY A;  4FE4 A;  3ZQI A;  2F4O B;  3N97 A;  1P9Q C;  1A5J A;  1J7K A;  3OYD A;  1OIS A;  4PSX A;  4Y4R A;  4BE2 A;  1WVR A;  4II3 A;  5JVG F;  4I76 A;  2JTV A;  2GIZ A;  1MJ9 A;  2WAF A;  4OAY A;  2WWY A;  3PIP F;  2IA1 A;  1V5F A;  1FSH A;  2R92 J;  3DLL F;  3JRB A;  3LST A;  4BQN A;  1K6Y A;  2H1L A;  2GA1 A;  2XGC A;  4Y13 A;  4X0G A;  4C3J J;  4MEY F;  2X1C A;  3CJQ B;  3SFI A;  3W2W A;  4QLC U;  1MND A;  2XKO A;  5JLX A;  2KZV A;  1N25 A;  2MUN A;  2PMZ A;  1XPX A;  4UHT A;  2NS7 A;  5M5Y J;  3ABT A;  3C3W A;  3PL8 A;  4W97 A;  3JRE A;  3CCV I;  2YX7 A;  4JOM A;  5GTI C;  3DWL E;  5D4R A;  2ZO4 A;  2BY1 A;  1PP8 F;  1VQK I;  2XAJ A;  2KLO A;  3FXR A;  3U21 A;  2VT2 A;  2H6C A;  4CO8 A;  4M74 A;  2AS5 F;  4M71 A;  1HKT A;  1YS7 A;  4NC7 A;  2DJN A;  1EH8 A;  1X1D A;  1FC3 A;  1ZRF A;  1R5I D;  5IP6 A;  2JMW A;  2EFQ A;  2E36 A;  1OCO H;  3ZMS A;  4PFO A;  1ORK A;  2KT0 A;  2HQA A;  2K86 A;  4Y17 A;  5J47 A;  1VFC A;  3FXU A;  3HKZ A;  5H2F C;  1KA8 A;  1P6R A;  4GGG A;  4NC6 A;  3DXJ F;  3JRH A;  1O3T A;  2XSD C;  1SEU A;  2E34 A;  4LIV A;  4HV6 A;  4L5I A;  4DBQ A;  5AON A;  3VDX A;  2LP0 A;  1J2X A;  1A04 A;  1OPC A;  4HPQ A;  1SAU A;  3A01 B;  2QYO A;  4XIC A;  2EFP A;  2BY3 A;  1QVT A;  2RQP A;  2EIL H;  1XD7 A;  2KFD A;  4NUB A;  3S8P A;  4PUS A;  2FE3 A;  4ZTF A;  3S3N A;  2WC2 A;  2V4J C;  2DMN A;  3ZQC A;  1IJW C;  1IC8 A;  1OCC H;  5DCM A;  1R1T A;  2X1E A;  4JBA A;  1YIT I;  4Q48 A;  3PO2 J;  1FMV A;  2VC0 A;  2W82 A;  3TGN A;  1TL8 A;  3F8C A;  3PSF A;  2MZ4 A;  2Y0S A;  5TGT A;  2DA5 A;  1JHF A;  4G6Q A;  1FLI A;  1BC8 C;  4E4H A;  3V4G A;  3A2K A;  3KYD B;  1MSF C;  1SVO A;  3BLY A;  4NQW A;  5A2Q Z;  1J59 A;  4LG0 A;  2ZME C;  4BQA A;  4M3D A;  2YU9 J;  3BDD A;  1ZR2 A;  1MGT A;  1V5E A;  5FD6 A;  3CCQ I;  1RPW A;  2A61 A;  1TLH B;  3M8F A;  2HDD A;  2QQA A;  2L01 A;  3OYG A;  3OYH A;  3LQR A;  4Q47 A;  1WSU A;  1HDD C;  3FMQ A;  4LK0 F;  4IZZ A;  3LFU A;  1JGG A;  2UWM A;  1Z6R A;  4GYI A;  1N75 A;  3FWE A;  4DZP A;  2L4A A;  2GXB A;  2GBY A;  1IN6 A;  1ZGJ A;  2WAQ A;  1YRN B;  2IGK A;  2CQ7 A;  3TL4 X;  3C7J A;  2HDW A;  1D8J A;  2W84 A;  3ESW B;  2DK8 A;  4B3X A;  1ZN2 A;  4FT8 A;  5B5E C;  2EA2 A;  3P9I A;  2BXZ A;  1FY7 A;  3FDY A;  6PAX A;  1FBQ A;  3E6B A;  3K4J A;  3CLO A;  2QM3 A;  4LK1 F;  1Z91 A;  4RGR A;  2QQ9 A;  3I5U A;  3WG9 A;  1XMA A;  1ZAR A;  4HOB A;  2VKD A;  2DDB A;  1RR7 A;  3ELK A;  2LKP A;  3EQL F;  5A2Q K;  3HOY J;  2Q2E B;  2DFF A;  2XF5 A;  2VPL A;  5AIQ A;  3BZ6 A;  3BZK A;  4A5M A;  3WU1 B;  2XRO A;  1L0O C;  3HXL A;  3J81 Z;  3J7A Y;  1X3U A;  2YU3 A;  4OAZ A;  1BIB A;  2CUZ A;  3RPU A;  2MW8 A;  2K3F A;  3QYE A;  4Y7N J;  2CQQ A;  2R0Q C;  2UV1 A;  3SJM A;  2VUM J;  4WX9 A;  5HS8 A;  3P9C A;  2KP6 A;  5J3L A;  2P7C B;  1WFX A;  2DDA A;  5FO5 A;  2R7W A;  3BCB A;  5DCF A;  4ASN A;  4BBS J;  4WF2 A;  3ABM H;  3DTE A;  3B6C A;  3DP7 A;  3WTW C;  2A05 A;  2P7V B;  4ESB A;  1RUO A;  2K9N A;  3COA C;  3LSH A;  5HLG A;  2LYC A;  2ZFU A;  3CES A;  3G4S I;  2JPC A;  3OYA A;  3WU2 C;  3HHH A;  1O7F A;  5EG0 B;  4PJM A;  5H6Q A;  1JTY A;  2P6T A;  1HLV A;  4HST A;  4I7H A;  2GLO A;  1OCZ H;  3NAU A;  3S17 J;  4MNU A;  1JGS A;  2Q1Z B;  5KVR A;  3T1B A;  4L5E A;  3B02 A;  3IAS 2;  3CLQ A;  2CS3 A;  1TP4 A;  3J81 K;  2HQN A;  1GV5 A;  2DT5 A;  4EV0 A;  3OY9 A;  3RKQ A;  1TT0 A;  3OS1 A;  4FQG A;  1KQ0 A;  4ENN A;  3NWT A;  2BW3 A;  5EGO A;  3PFY A;  2CV2 A;  4QWQ A;  2L5Q A;  1OYI A;  1JKP C;  4C9Y A;  4E7I A;  1GHC A;  1XMX A;  3QPH A;  3DEE A;  1DPR A;  4YIF A;  1HW1 A;  2HKX A;  1TW3 A;  2HOS A;  3C2B A;  1ZLK A;  1U9N A;  4G8X A;  2VOP A;  1DGW Y;  4JX4 A;  5BPD A;  5GPC A;  3LL7 A;  5A2Q R;  3SZG A;  3CUQ B;  3R6S A;  5LGT A;  3LSP A;  4XKW A;  1QNT A;  2GWR A;  2HNH A;  3U9G A;  2DMP A;  4HQM A;  2FRH A;  2HYJ A;  2JUG A;  1FOX A;  2JQ7 A;  5C4X J;  3GFI A;  3PO3 J;  2W48 A;  5K5Q A;  3FK7 A;  3VSL A;  3WGH A;  3RQI A;  4E7K A;  1OFC X;  1FMW A;  5E17 F;  3PQJ A;  3FBI B;  3JSO A;  1ETV A;  2LKX A;  2K5C A;  3H1C A;  1MW7 A;  2O6G E;  1TWG J;  1IW7 F;  3WHB A;  2E2I J;  4HAM A;  5J8C A;  2ZNZ A;  3BT9 A;  2LY9 A;  1A36 A;  1V55 H;  1OQY A;  2H6B A;  2KL4 A;  1CGP A;  2L9R A;  1L3L A;  4YFX F;  2BGC A;  3V8J A;  2RC4 A;  2K3P A;  2DA3 A;  5JHF A;  3S1M J;  1I39 A;  2MC3 A;  5D5U B;  1K79 A;  2E1M C;  3CP2 A;  2NNN A;  4UV8 A;  1WI3 A;  1QPM A;  5FGM A;  2DW4 A;  2ECB A;  4BEH A;  4OIQ F;  2VE8 A;  4F92 B;  2K9S A;  4BHP A;  1P7I A;  3HJE A;  3DU5 A;  3KEO A;  2VQL A;  2QQB A;  4L9V A;  4CYC B;  1AKH B;  4A3D J;  4XKV A;  3I9V 2;  1IRZ A;  1WH7 A;  5C4J J;  3J81 R;  3DKW A;  4FAS D;  3U1D A;  2IVM A;  3L2W A;  3RZD J;  4U0V A;  2QEX I;  3FBN B;  4C3H J;  1WPK A;  4AD9 A;  2TDX A;  1PUF B;  1HCR A;  2IBD A;  4A0Z A;  4O5V A;  4AUX A;  3RSN A;  3JRF A;  4E7H A;  2WAD A;  2E5N A;  1PVE A;  2O8K A;  1IDY A;  2ID3 A;  1LJ9 A;  2ELK A;  4Z6Y A;  1WH5 A;  2X6W A;  3VYT B;  1HW2 A;  2KRC A;  5D5X B;  2QBY B;  5EJC A;  1ACI A;  3R0J A;  1SVL A;  4FX0 A;  5DUI A;  1G3S A;  1R22 A;  5D6F A;  1B9M A;  3LSJ A;  4AU7 A;  5LHI A;  2OA4 A;  4QPO A;  3K70 D;  1FIP A;  5CPR B;  2LRD A;  1B8I B;  2QCO A;  4FIS A;  3ZGK A;  2EIJ H;  3IL2 A;  2BYV E;  1EJ9 A;  2EK5 A;  2NVY J;  5DUK A;  3WTS C;  1UEL B;  3HYI A;  2QSF X;  2F5E A;  1PP7 U;  2WV1 A;  4XMY A;  4XLH A;  4LMY A;  5IT3 A;  1SD4 A;  3CDH A;  1LEA A;  4WXC A;  1S7A A;  4AIK A;  5LGN A;  1XMK A;  3GLX A;  4B47 A;  2R7Q A;  2RNG A;  2IT0 A;  2BXY A;  1DPU A;  3J7A W;  3C1D A;  5LEK A;  1RQ6 A;  1LEB A;  5H6R A;  2STT A;  2I10 A;  2P5L C;  4ESJ A;  3H0G J;  2GOM A;  2KJC A;  3GZN B;  1WZ2 A;  2EV0 A;  5E3N A;  2OTL I;  4C3I J;  1XDS A;  2A5Y B;  3R4K A;  2JRM A;  3IAM 2;  3FF5 A;  2RV8 A;  3S93 A;  4HX4 A;  4BJT A;  3F72 A;  3IUO A;  3S3O A;  4CCN A;  4MGR A;  1D5Y A;  2ETH A;  2XV4 S;  2QGU A;  1XCB A;  2NVQ J;  4GYG A;  1WQ2 A;  3G1M A;  2ZC2 A;  4U87 A;  2OU2 A;  4GO1 A;  5E1W A;  3FIW A;  4EJO A;  3REO A;  2X4H A;  2W24 A;  3I59 B;  1G4D A;  2M3A A;  4GXO A;  4MQ9 F;  1QGP A;  2ZBK A;  2HZT A;  3FIS A;  4HX7 A;  3S32 A;  1G6N A;  1TQI A;  2O03 A;  2ZB9 A;  3EPZ A;  4BL0 B;  1YLF A;  2RN7 A;  3ERE D;  2LY1 A;  3HOV J;  1MDM A;  5CLS A;  3M3Y J;  3DPT A;  4CCL A;  2XKP A;  3H3Z A;  2XHK A;  2PBI A;  3B73 A;  2EA4 A;  3FMS A;  2OJE D;  1FWZ A;  4LLL A;  4RS8 A;  1I6H J;  3V7S A;  3E5U A;  1NK3 P;  3S2W A;  2MVT A;  3IH4 A;  2DBB A;  1T56 A;  2FMY A;  3K7A J;  1QBJ A;  2M35 A;  2VBY A;  3H35 A;  3FXO A;  4BDZ A;  1D0Y A;  2G7H A;  2MAB A;  1EH7 A;  2E60 A;  4G7Z F;  4XR6 A;  3ZQH A;  1TTY A;  3Q5F A;  3EUH A;  1VQL I;  2OCE A;  5GP9 A;  2K40 A;  2L7Z A;  1YFH A;  4I6Z A;  2Y0M A;  5LD2 C;  2CU7 A;  2HTS A;  4BXF A;  1Z6T A;  5EYR A;  3F23 A;  2XPU A;  1ODD A;  4KN4 X;  1H89 C;  3VEP A;  3VB2 A;  3S1N J;  1D0X A;  3ABK H;  1WKM A;  4A0X A;  2CSO A;  1E3H A;  4PK4 A;  1J75 A;  3C2G A;  4IXA A;  1UFM A;  2R5Z B;  3CJT B;  2FF4 A;  4NC8 A;  2OTJ I;  4I09 A;  4XK4 A;  3OIP A;  3PNV A;  4I0B A;  4M73 A;  4D1Q A;  2VJI A;  3ASO H;  2ACJ A;  5FKK A;  2AXL A;  5EZG A;  1Z7L A;  3CO7 C;  3LMM A;  2ZSH B;  2LK2 A;  2BVM A;  5L3G A;  2G0E A;  4QIW N;  2QUF A;  3F8B A;  1A6I A;  3K2A A;  5F1J A;  2VXZ A;  1PYV A;  5IYC J;  2Y75 A;  2HVQ A;  5K5R A;  4BE0 A;  2R7Z J;  1G3T A;  3ONQ A;  5DCM B;  4DNC A;  1GT0 C;  3CC7 I;  2KQR A;  1S3J A;  2QKM B;  4I0A A;  1VTN C;  3PQK A;  3TED A;  2NYX A;  3TO9 A;  2OZU A;  1OCP A;  2CQK A;  2PLY A;  1BM9 A;  2L0K A;  3WTZ A;  1UMQ A;  2HVR A;  4AWX B;  4EAT A;  1Z3X A;  4GCV A;  2M7B A;  2JA5 J;  1ZR4 A;  5LHH A;  2VKV A;  4B1R A;  2AQF A;  2R5Y A;  1R5G A;  4D5F A;  3ZPL A;  1HDP A;  1KGS A;  1JTX A;  1T6S A;  3B6A A;  3RPQ A;  3RYP A;  3SYT A;  3VOD A;  3BTJ A;  1STZ A;  1FNN A;  5K7F A;  3GW2 A;  1SMY F;  5LLQ A;  2E71 A;  4UVB A;  1I3A A;  5J1R A;  3PNY A;  2EJR A;  3G1O A;  4D7M A;  2PJP A;  1XG1 A;  1JXS A;  5B1A H;  3UR3 C;  3KLN A;  4Q4Z F;  3VOE A;  5IT9 Z;  3PNT A;  3PFI A;  2YX4 A;  5HNF A;  4D5C A;  5FJ8 J;  1D1B A;  3M7G A;  4OIR F;  2DFI A;  1W4M A;  1XB4 A;  4M9Z A;  4HA8 A;  3JW4 A;  4G9Y A;  4B8X A;  1UB9 A;  3ZCO A;  2X0L A;  4ZYE A;  3EUA A;  4S0H B;  3QU6 A;  3P7N A;  5F08 A;  2XRL A;  4HYE A;  4LB5 A;  5FKL A;  1FBU A;  2LY2 A;  4BNC A;  4JK1 X;  4EM0 B;  3BCA A;  1Y56 A;  4XRM A;  1GVD A;  1ZTR A;  2MSY A;  4V19 K;  2V26 A;  1BI1 A;  2DI3 A;  3KLO A;  2L2O A;  4AC0 A;  2O3F A;  2AO9 A;  4OWR B;  5IYB J;  4DYR A;  2QVO A;  3O6B B;  3HOX J;  3H9J A;  2BVL A;  2XIG A;  3MEX A;  4M72 A;  4UY8 I;  1Z7U A;  2W57 A;  5E79 C;  1BI0 A;  3HRM A;  4JQF A;  1D1A A;  2F5D A;  3S14 J;  2ECC A;  3I4M J;  2NOG A;  1KON A;  1IN7 A;  2EZK A;  5EDN A;  1Y6I A;  5IT9 K;  2Z33 A;  2FX0 A;  1KYZ A;  4MTD A;  5E18 F;  1MBH A;  3LWF A;  1N77 A;  3LSG A;  1KQ8 A;  1MBG A;  1XDU A;  2DOE A;  5LBQ A;  4PCQ A;  5E1X A;  4ETS A;  5FLV A;  3IKV A;  1OJL A;  2LBF B;  4F3Q A;  4NBQ A;  3WTY C;  1Y39 A;  1RR8 C;  1VZ0 A;  4TV7 A;  5DYM A;  1DUX C;  4G94 A;  1X1A A;  1BN5 A;  4KIG A;  1DP7 P;  3QPS A;  2K4J A;  3HTS B;  1QHG A;  2MC4 A;  3T0Y A;  3OL4 A;  2GXA A;  4BAC A;  2OAZ A;  2DCE A;  3DTI A;  4A3L J;  1JJ6 C;  2B9S A;  2VQH A;  5EGO B;  2R7X A;  1JE8 A;  1QQI A;  4RMN A;  3L2U A;  2RAE A;  3M8E A;  4CGZ A;  2ZKZ A;  3E6D A;  5FRM A;  3GF2 A;  3OIO A;  2K9Q A;  1MBE A;  4ZC3 A;  2E1M B;  2HOE A;  4IHY A;  3FXL A;  2M87 A;  3D5S C;  5FKM A;  4E7S A;  2X51 A;  2R7T A;  4OIO F;  4IVN A;  3GFM A;  4A3B J;  1MBK A;  2CMP A;  2VIX A;  3IKT A;  3G2B A;  5LRS A;  3F9K A;  1MBF A;  3GTP J;  2OF7 A;  3Q9S A;  5FD5 A;  2Q8K A;  4A69 C;  5JR3 A;  1Y8Q B;  3BR5 A;  4CZZ A;  2V79 A;  4N0B A;  2D1V A;  1N78 A;  4F91 B;  3G3Z A;  2GXG A;  3I3L A;  3CO6 C;  1VQN I;  5FFX A;  2UXX A;  3QPT A;  5FKN A;  1IRF A;  4RAG A;  2Y2Z A;  4LGW A;  4EMS A;  2DA7 A;  1D5V A;  2LVS A;  4G7O F;  5IP9 J;  2XB5 A;  1FOY A;  2WV0 A;  5CVR A;  2AHQ A;  5E1Z B;  1IRG A;  1HOM A;  4LB6 B;  3WHC A;  3CTA A;  3HZJ A;  3LSM A;  1LFB A;  2COB A;  2BOL A;  3ZR8 X;  5IT9 R;  1X19 A;  3IH3 A;  3OR2 C;  3M1E A;  4PJN A;  5L3E A;  2LR8 A;  2A6H F;  5DS9 A;  3W6K B;  3GWZ A;  2XPW A;  4HSR A;  4XM3 A;  3L00 A;  2CYY A;  2IAI A;  4U88 A;  5H20 A;  4PSW A;  4V2G A;  5DTD A;  1P7J A;  3CCJ I;  1LDK B;  1K61 A;  3PSI A;  2D1H A;  4WWC A;  1ENH A;  4BEH B;  4A3J J;  1W0T A;  5J4V A;  2OCC H;  1S7O A;  4I98 B;  2JA7 J;  2HFH A;  2GQQ A;  1LFU P;  1MMN A;  2Y9Z A;  3PIO F;  3JRC A;  4MFD A;  4GDF A;  2FXA A;  1REP C;  2L9S A;  3O3K A;  2LOO A;  4I2O A;  3CDI A;  1FT9 A;  3ZMV A;  3H5A A;  1ETW A;  2JVG A;  3KP3 A;  2A5W A;  2DLL A;  1W7P D;  1UHM A;  2Y48 A;  2V1N A;  1QHH D;  3ZOB A;  4RB3 C;  1XGS A;  5HDK A;  2F48 A;  2WA0 A;  2X6O A;  3HUG A;  5D8L B;  3OYC A;  1TWH J;  4UUS A;  1OYW A;  4RLF A;  2A6T A;  3I4P A;  1WJE A;  5F27 A;  2ME6 A;  3BTC A;  4F55 A;  2IGM A;  1R00 A;  2FBK A;  2VLA A;  4HBL A;  3OYJ A;  4PFP A;  1OLT A;  1B9N A;  2XB0 X;  2ZXJ A;  1H0M A;  3D5L A;  1UJ8 A;  3WTU C;  2FNA A;  3GX4 X;  5FRN A;  1SFO J;  2F4M B;  2IS2 A;  3BG7 A;  3OS0 A;  2ZFW A;  3KPH A;  2CRG A;  4CIC A;  3NRV A;  4OOI A;  2VOO A;  2VJ4 A;  3ZMD A;  3QQA A;  1Y0N A;  4HV5 A;  4BDY A;  4OMY A;  1I50 J;  1RIO H;  1AHD P;  4N4O B;  4RLQ A;  2HOA A;  2JJ7 A;  4KYW A;  3EUK L;  2J5P A;  3K4K A;  3T8R A;  1K78 A;  3LSI A;  2O9L A;  1AOY A;  3BPX A;  1GVJ A;  3TO6 A;  1T0F A;  1X58 A;  1HQC A;  5J4Y A;  3BR6 A;  3OYF A;  3DKY A;  3HG9 A;  2W25 A;  3NQO A;  4CCK A;  1ETK A;  1FZP B;  4CHU A;  1QZZ A;  1GDT A;  2LKS A;  1WGX A;  2ESN A;  1XSV A;  2XDV A;  2JA8 J;  3TW6 A;  2E7W A;  1NG7 A;  2EIK H;  4NHJ A;  2ZJR F;  2LLK A;  2M1B A;  2HTJ A;  3ML6 A;  3WOD F;  4FET A;  2FA5 A;  4LIT A;  4HDV A;  1T33 A;  2JT1 A;  3MAJ A;  3M9A A;  3OSF A;  3RDI A;  2DQR A;  4PJJ A;  1YI2 I;  1VI0 A;  4DW6 A;  1CF7 A;  2VKE A;  4S04 A;  2V7F A;  4EJU A;  4RDU A;  1Z21 A;  1SFK A;  4CZC A;  5E3L A;  4CCM A;  1JHH A;  3IRR A;  5L3C A;  1HF0 A;  3WGI A;  2JRT A;  4PDK A;  2HDC A;  4XSX F;  1UST A;  4UB8 C;  2PJR A;  3AL0 B;  3QYB A;  3CQZ J;  5L3B A;  5IYD J;  2H1K A;  1JKO C;  2P5K A;  1ZQ3 P;  4X6A J;  4BY1 J;  2XAS A;  3A03 A;  2PMZ N;  3U1K A;  3FK6 A;  4XKB A;  4DJA A;  1WJC A;  5GAE J;  1O4X A;  1MIJ A;  3C18 A;  4GRI A;  2JZY A;  4MHG A;  1ZRD A;  5F04 A;  3FKJ A;  1IGN A;  4XLF A;  3WTT C;  4KT6 A;  2Z5U A;  1UCR A;  1HBX G;  1DGR M;  2NVT J;  3W6J B;  2XGD A;  3V7C A;  3H92 A;  2NS0 A;  1IF1 A;  3IHU A;  2DN0 A;  1MBJ A;  2VXD A;  3DTK A;  2XPV A;  1RES A;  3HPG A;  3L7W A;  1U5T A;  3LFK A;  4XLA A;  3L1P A;  4HW0 A;  4I01 A;  2JA2 A;  4C30 A;  2UZK A;  4XLC A;  3MKL A;  5AIP A;  4OIN F;  3IWF A;  3I71 A;  3HKZ N;  3N4M A;  1HXD A;  2MH2 A;  4OMZ A;  1YO5 C;  2KIU A;  5ICG A;  1E0E A;  1LFP A;  3DV8 A;  2ZCW A;  3AKZ A;  3ISP A;  1Z9C A;  2EB7 A;  2R7U A;  5F64 A;  3OYM A;  2FJ1 A;  1LE8 B;  4DZJ A;  1FYM A;  3BG3 A;  2D5V A;  2F2E A;  4Y15 A;  3JRI A;  3H9G A;  2X6Y A;  2GOX B;  1XSD A;  2DA2 A;  5J1Y A;  1OCT C;  2DT7 B;  1IUY A;  2PG4 A;  5JVT A;  3IC7 A;  3G71 I;  3CC2 I;  3PUB A;  1YJW I;  2GA2 A;  3HGG A;  1A6Q A;  3VSK A;  1B72 B;  1SFX A;  3R61 A;  2PMU A;  1JUP A;  5ICE A;  1RZ4 A;  3ERM A;  1EF4 A;  5JFR A;  4CYD A;  3D5R C;  2EZH A;  2Y0S N;  2GM4 A;  2HXO A;  4KFC A;  4XQF A;  3E5X A;  3AG3 H;  3BWG A;  3G6E I;  5ICF A;  1J9I A;  3LNQ A;  1IAW A;  2KIM A;  5KCM A;  3AG4 H;  2FD5 A;  5DEQ A;  4XLP F;  1A35 A;  3K1P A;  1SAX A;  1POG A;  1NG6 A;  2LD5 A;  2YUS A;  2HKO A;  2DQL A;  2HYG D;  1BBY A;  2K4B A;  2CW8 A;  2H8W A;  2JUC A;  2V1X A;  2RGV A;  4IF4 A;  3K2Z A;  4BAY A;  2L7K A;  3GTQ J;  3DFG A;  3DQV C;  3I55 I;  2JPB A;  3MMY B;  5IOY A;  1U9O A;  1WCM J;  2XSJ C;  3I58 A;  5BMZ A;  4MEX F;  1FX7 A;  2IA2 A;  2WAQ N;  1YJ9 I;  1IXS B;  3BY6 A;  2FSW A;  2PMH A;  3A02 A;  4BE1 A;  4A5N A;  2XUB A;  3H5R A;  2A69 F;  3LAP A;  3JTG A;  2ZJP F;  4L0Z B;  3CCR I;  2EZI A;  4O3M A;  2JSP A;  3HBL A;  4EQQ A;  5F6F A;  3O2P E;  1IV8 A;  4LLG F;  4FE7 A;  5HDG A;  1OR7 A;  5ILU A;  3T8T A;  3SDB A;  3TW7 A;  2YR2 A;  1UG0 A;  3TQN A;  4HRI A;  4XOP A;  3W3C A;  4J01 A;  5HS7 A;  3KP2 A;  3WE3 A;  2DK5 A;  3HGY A;  4CSW A;  1R7J A;  2HEO A;  3ZMU A;  4PJL A;  2MLK A;  4K2E A;  1X4P A;  5J6X A;  2A68 F;  4PGG A;  3F21 A;  2K27 A;  1R58 A;  2J5O A;  2H09 A;  1SC7 A;  4L5J A;  2WAE A;  1S9H A;  2DT6 A;  3CMM A;  5CVV A;  1SMT A;  1EKE A;  2M8G X;  4ZJZ A;  3LA2 A;  4IRH A;  3RZO J;  5ILS A;  2L9V A;  2CFX A;  1V54 H;  3BC8 A;  4J19 A;  1S29 A;  2Z9O A;  4AIJ A;  5EEG A;  1BI3 A;  1WI9 A;  3CD6 I;  2DJI A;  3RCO A;  2P81 A;  4B44 A;  1SD5 A;  3OWT A;  2CGP A;  4IKF A;  4DOZ A;  3HSF A;  1FEX A;  2W7N A;  5FLX Z;  2M34 A;  2YSR A;  2PFB A;  5L3F A;  2BE5 F;  2VQG A;  1P4W A;  4BJ5 C;  1QVU A;  5BPI A;  4JP0 A;  1X1C A;  2WB1 N;  2DMQ A;  3BR0 A;  5M5W J;  2R7F A;  3V42 A;  3HOU J;  1G3W A;  2IRF G;  4CDG A;  2Q2E A;  1H8A C;  3KYL A;  2CUF A;  3GBG A;  4H4K C;  4RGS A;  5ICC A;  1WJD A;  3OOU A;  2VPR A;  3A0B C;  1IXC A;  4B09 A;  3I53 A;  1NTC A;  3MZH A;  4ABZ A;  3G1L A;  2JWT A;  2PI0 A;  4RB0 A;  4L9T A;  5D8K B;  2IPQ X;  1AU7 A;  2R7V A;  5GPA A;  1ZG5 A;  2OUM A;  2XF6 A;  3JAM Z;  1R5H A;  4Y3O A;  1RKT A;  4M3F A;  4XLE A;  3OYN A;  3Q0W A;  4M6X A;  3QAH A;  4ZYD A;  5GAH J;  2VAS A;  3KP5 A;  4FHT A;  1ZRC A;  3L2Q A;  5HNH A;  2LFB A;  2DAO A;  1FYL A;  1FTT A;  2DO7 A;  1TWA J;  3MQ0 A;  3Q0U A;  2R3S A;  5FLX K;  3A1Y A;  4KIF A;  1IO2 A;  1A31 A;  4IHW A;  2BBY A;  3E6C C;  1MD0 A;  4KMF A;  4A0Y A;  1YX3 A;  4KIT B;  1J09 A;  1H9T A;  1RI7 A;  2Y31 A;  4IRI A;  3RTR A;  1I5Z A;  3M1C A;  3CCS I;  3ZN0 A;  1PDN C;  5D5W B;  1MZB A;  2RDP A;  1KU2 A;  1UAA A;  1D0Z A;  1BA5 A;  1F5T A;  2V1D A;  4IOC F;  3H9Q A;  5LRR A;  2FBI A;  1GLN A;  2ELJ A;  1YW8 A;  4BUP A;  5EZH A;  5HDN A;  3JAM K;  2KRH A;  1NH3 A;  1MSE C;  5BNG A;  2AXT C;  4NDL A;  3AL0 C;  4BBR J;  3P9K A;  4ZDP A;  5K7H A;  1ULY A;  4Y33 A;  3ZXS A;  1Z3Y A;  2R7D A;  1ONV A;  3HM5 A;  4KA4 A;  1RNL A;  2O7O A;  5LFA A;  2X6X A;  4P1W A;  1YJN I;  1ZEL A;  1NHA A;  1USS A;  1IV6 A;  3RKX A;  3CCE I;  2CG4 A;  4LLN A;  5FLM J;  1BR2 A;  3CUQ A;  1VQM I;  3S1R J;  2HGC A;  1WJ5 A;  5TRD A;  2UUZ A;  4DGW B;  4IHS A;  4CCO A;  4D0P A;  4IOA F;  5E20 A;  4UUV A;  2CW0 F;  1OCR H;  3CUO A;  5TIS C;  1X2M A;  1F36 A;  4M6V A;  1J5Y A;  4E7J A;  2HPM A;  3CJN A;  1TNT A;  2WY7 Q;  2PQ8 A;  2RRE A;  4NNJ A;  2L9N A;  3TO7 A;  2XVC A;  2OC6 A;  3K9T A;  5JLW A;  1IN8 A;  4XRS A;  1T8I A;  2G7U A;  1ZAO A;  3CMA I;  5HOO A;  3CC4 I;  4XSZ F;  3EUH C;  4HG2 A;  4H0E A;  4NQW B;  3E97 A;  1K83 J;  1EH6 A;  2E5Z A;  2IEK A;  4ITV A;  4XON A;  2E2J J;  4LG0 B;  5FLX R;  3TOB A;  1YOV B;  3QOE A;  4RBO A;  3MKZ A;  4XNF A;  4B3A A;  2QSG X;  1R23 A;  4ANJ A;  5EEA A;  3SEQ A;  4UUS B;  3BQZ A;  1E3O C;  4FX4 A;  1TQP A;  3PM1 A;  3FXQ A;  2M0M A;  4PJ0 C;  2HPI A;  2IS1 A;  4DBR A;  2VC1 A;  3KYC B;  4KUM A;  2IGN A;  2QLZ A;  3EET A;  3QP6 A;  1UG2 A;  1T2K A;  4QPQ A;  1IRX A;  4RA2 A;  4UXN A;  1C0W A;  4G6D A;  4C2U A;  5M3M J;  1DU6 A;  3IWZ A;  1EA3 A;  3OSG A;  4A3K J;  3S2H J;  4CYC A;  4KN7 X;  3TOA A;  3JAM R;  3K69 A;  1W36 C;  3VWB A;  2ESH A;  2KMU A;  4L18 B;  1P92 A;  1E17 A;  4BQO A;  1K78 B;  3HPH A;  3MD2 A;  2CQN A;  1YS6 A;  4KIS A;  4R8H A;  3HOS A;  3BG6 A;  2HS5 A;  4HLY A;  5K5O A;  3L2C A;  2VN2 A;  1Q1V A;  2PEX A;  4IRG A;  1XS9 A;  4EJV A;  3KEY A;  3PJR A;  2NVX J;  1ZRE A;  2QBY A;  1JI8 A;  1R4M B;  2FEZ A;  3UNG C;  2BV6 A;  1H88 C;  1ETY A;  2K9L A;  4L0Y B;  2ZNY A;  3CCY A;  1I6X A;  3BG5 A;  2HZD A;  4AIH A;  2LDU A;  4IHT A;  3HB9 A;  3K1M A;  4N9H A;  4C2M J;  4A3F J;  2Y9Y A;  3J80 Z;  3CCL I;  5CJ9 A;  3GO5 A;  3NAR A;  3CF5 F;  3FKI J;  1MKM A;  1HST A;  1TWC J;  1MNE A;  1PUE E;  1ERD A;  1DU0 A;  3TDU C;  2FU4 A;  4R79 A;  3R0A A;  3M07 A;  3DBL B;  5B1B H;  1FOK A;  2IXS A;  2PJR B;  3SXY A;  2OPT A;  3J7A O;  4HF2 A;  1GUU A;  4X1E A;  3QRF F;  1MJB A;  4HEA 2;  4HLX A;  2W4S A;  1ON1 A;  3GLL A;  2JN6 A;  1SVM A;  3BTL A;  4IO9 F;  1BJA A;  5KHD A;  3HOZ J;  4BQQ A;  3DEW A;  1XTA A;  1SD7 A;  4P9U A;  3KET A;  4QSH A;  2K9M A;  1SAN A;  4KMU X;  3X2Q H;  4F52 A;  3ZN1 A;  5HLH A;  4P96 A;  3F8M A;  4LD5 A;  3SZP A;  3JRA A;  4BU2 A;  2ICW G;  4PGH A;  2EH3 A;  2HOT A;  4UB6 C;  2X48 A;  3P5J A;  3W6V A;  1QU3 A;  3H5N A;  2BW3 B;  2V9P A;  1MNM C;  1VQ6 I;  2I5U A;  2G9W A;  4V2F A;  1ETQ A;  4M9X A;  1YX5 A;  1IZ1 A;  3VPR A;  3L2R A;  3O8G A;  2Y30 A;  2IGO A;  3BR1 A;  3I59 A;  4WXD A;  1TNS A;  1BJZ A;  3O8H A;  2VON A;  3BJO A;  3KFW X;  4A6D A;  3A0H C;  3KE2 A;  1ZK8 A;  3HOW J;  3IP4 B;  2DOA A;  2E7X A;  4AYB N;  2P8T A;  1VF9 A;  3FM5 A;  3QU3 A;  3KP4 A;  2K02 A;  3GTK J;  4QTR A;  5BOX A;  1S7E A;  2DOF A;  3SQN A;  4PZJ A;  4A3E J;  4EVI A;  4P9F A;  2V6E A;  2VB6 A;  2M4G A;  1T38 A;  4ZZL A;  3IRQ A;  4MTE A;  4CH7 A;  2R7O A;  1M1E B;  1ETX A;  1Y1W J;  3S1Q J;  2Z2S B;  5ED4 A;  1G2H A;  2VJ5 A;  2R93 J;  1LQ1 A;  1MH4 A;  5DV5 A;  3T5X A;  4BYY A;  5BQT A;  2DFE A;  1P2F A;  3D0S A;  1U6G A;  3MCZ A;  4G7H F;  3TBI A;  4II2 A;  2W1O A;  3KX2 A;  2N8G A;  4R1H A;  3BZC A;  3J7Y J;  2X9D A;  4M6Y A;  3KIO A;  1KZH A;  3GTG J;  2OBP A;  3CJR B;  1VQ7 I;  3WU0 A;  2MLG A;  2P5V A;  3GZ5 A;  5F1R A;  4A3I J;  2ZME A;  3HSE A;  5CVU A;  1FJL A;  1X4O A;  2IJL A;  2OZ6 A;  2V9K A;  3EYY A;  2WBM A;  3ZQG A;  4KNY A;  5IY5 H;  4LIU A;  1IXR C;  1YQA A;  3V8K A;  3GCM A;  1XN7 A;  2Z99 A;  4Y52 J;  1HSJ A;  3OV8 A;  1B4A A;  1BI2 A;  2R5Z A;  3MZY A;  1KU9 A;  1ZGW A;  1U8B A;  2CFO A;  2DA1 A;  4RGU A;  2EFW A;  4IHX A;  1IUF A;  2CWE A;  4BY7 J;  1FP1 D;  3HEF A;  3BG9 A;  2L7F P;  3SEZ A;  3WTV C;  1I3Q J;  1YHQ I;  3J80 R;  3E5Q A;  1LDJ A;  1LVA A;  3CZ6 A;  2R7S A;  5FFZ A;  3WGG A;  3K4B A;  5KNL A;  1HA8 A;  2QF7 A;  4XID A;  2QEN A;  4RAF A;  2JK3 A;  4YRV A;  1S5L C;  4W1U A;  4DIQ A;  4HDU A;  2JSC A;  2P0T A;  3KP7 A;  3DBH B;  2XAF A;  2H94 A;  2DPD A;  3CP8 A;  2E19 A;  4EJW A;  3FXJ A;  3K4N A;  2EV5 A;  1Z77 A;  1W7P A;  2YS9 A;  4L9J A;  3GTM J;  2IP2 A;  4G12 A;  4BKX A;  4MFE A;  4O6J A;  2D2W A;  1XSX A;  1F4K A;  3GVA A;  3EDP A;  2MYS A;  1XGM A;  4BHC A;  2DMT A;  1QZY A;  3SZT A;  2DTR A;  5EF6 A;  4RB1 A;  2E1C A;  2YPR A;  2Q0O A;  2FQ4 A;  3CME I;  2O8X A;  2CQX A;  1H9G A;  2FML A;  4B43 A;  1Y8R B;  1K7A A;  1X3W B;  3QP5 A;  2EFO A;  2JA6 J;  2Y69 H;  1ITY A;  2UXN A;  1PJR A;  3HOT A;  2KHM A;  4CXF A;  2V1U A;  1TQM A;  2DMU A;  1TWF J;  2XAQ A;  2B63 J;  3GTO J;  2O61 A;  1T98 A;  2F5C A;  3C2H A;  2KPM A;  3M4O J;  1P4A A;  1KU3 A;  4KIB A;  3M8J A;  5K1Y A;  2B0L A;  3RKW A;  4NB5 A;  2BY2 A;  3LQQ A;  3ZQ7 A;  1DQU A;  3MFK A;  1ON2 A;  3F3X A;  3LA7 A;  4OU0 A;  4LJZ F;  1RET A;  4BS9 A;  5JI6 A;  2HQ5 A;  4ENM A;  3KEQ A;  2QQ8 A;  1R71 A;  3Q0V A;  2HR3 A;  3HIF A;  3QOP A;  4FCY A;  4ENJ A;  1XC5 A;  2FQ3 A;  3BOQ A;  1FSE A;  3HTU A;  3GEZ A;  2DFH A;  2M30 A;  3RPU D;  4HZF A;  2P4W A;  3BPV A;  4EJT A;  3ROU A;  1LVK A;  1O57 A;  2CV1 A;  4KIC A;  2GIV A;  3OYB A;  4ZDL A;  4JX5 A;  1O3S A;  5D6E A;  1G59 A;  1X1P A;  4OIP F;  4JX6 A;  1WJF A;  4N4N B;  4HX8 A;  2D45 A;  3JSP A;  4ON0 A;  3CF2 A;  2RQQ A;  3FMR A;  1FOW A;  2XAH A;  5M5X J;  2EIN H;  1YG2 A;  4XBF A;  5F0C A;  3E6M A;  2NXN B;  3NEU A;  4A3M J;  2KJB A;  2QZ8 A;  1LB2 A;  2ZXW H;  5DM7 F;  1T0F C;  2EQR A;  3ZQL A;  1O3R A;  2WY8 Q;  3JRD A;  4UUT A;  4E7Z A;  3I4N J;  2KIF A;  1MDM B;  3E7L A;  3MWM A;  3A4C A;  3ZQF A;  4XOR A;  5K7Z A;  1RRJ A;  1SFE A;  2RNJ A;  5C44 J;  3KZZ A;  2R4G A;  4BH9 A;  1BC7 C;  2ADU A;  2C6Y A;  2EZL A;  1Z1D A;  3FZV A;  3ASN H;  3FXM A;  2LBF A;  1U78 A;  4D7N A;  2ME0 A;  2PX9 A;  4UV9 A;  3OMY A;  5L3D A;  1I27 A;  1U2W A;  2ZXI A;  4WK8 F;  2XAU A;  5JHU A;  4IL6 C;  2BZT A;  4I99 C;  2KRF A;  3TDZ C;  2WB1 A;  3TP3 A;  2LSO A;  3RYR A;  2HU9 A;  4BGD A;  4C2T A;  1U3E M;  3AFH A;  2FOK A;  2A3S A;  2MD0 A;  3LSK A;  2W00 A;  2W85 A;  4DYQ A;  5M3F J;  3KZI C;  3DEU A;  3QOD A;  1Z05 A;  2XGX A;  1QZE A;  2F4I A;  5KK1 A;  1F43 A;  1ZG1 A;  2HXI A;  5F0H A;  4P5O A;  5HOD A;  3OS2 A;  4AVZ A;  4HNT A;  3DU6 A;  1Z0X A;  3DKX A;  3LOC A;  4RM2 A;  1BL0 A;  2IS4 A;  1X3Z B;  2GAU A;  2I8D A;  1F9N A;  5E3O A;  4YEJ A;  2CUJ A;  2KDO A;  5HLT A;  4RM3 A;  3N05 A;  3QYF A;  3AAF A;  2HQR A;  3RIR A;  3FHZ A;  3S15 J;  3DBR B;  1S8N A;  1O3Q A;  1OKR A;  4IHV A;  3K6G A;  2ISZ A;  4ZYH A;  4G6T B;  2DTZ A;  2VE9 A;  1RC9 A;  1U5T C;  1CQT A;  2IW5 A;  1RUN A;  3I0T A;  1DP3 A;  1AA7 A;  2FBH A;  3UKG A;  2PN6 A;  4J00 A;  3OYE A;  1U8R A;  3E0J B;  4E7L A;  3K4L A;  2F6C A;  4MO7 A;  1VQ8 I;  4F7Z A;  1W5S A;  3IH2 A;  5GAG J;  3ABL H;  3FXK A;  3BTI A;  3NWS A;  1S72 I;  3DCF A;  1MH3 A;  4F93 B;  2IS6 A;  1D8K A;  4RAZ A;  1D3Y A;  1WJB A;  5FB2 A;  2KIQ A;  3S16 J;  2XF7 A;  1WJA A;  3F8F A;  5DD4 A;  3IV5 A;  1K6O A;  9ANT A;  2KDZ A;  2DU9 A;  2R5Y B;  2L3D A;  3A01 A;  3SFZ A;  4E6K G;  3VYS B;  1RKW A;  5TJJ A;  3BP8 A;  4KDP A;  4KJZ A;  3OYL A;  2LNB A;  2VBZ A;  2XAG A;  5GAD J;  1NK2 P;  1ZKG A;  1BR1 A;  2A6E F;  1TW2 A;  3AG2 H;  4XRS G;  4A3G J;  1F1Z A;  2VBX A;  2V9V A;  1HC8 A;  3FM3 A;  2RVC A;  2F5F A;  5E8G A;  5F0F A;  4BXU A;  2H27 A;  4BXX J;  1V4R A;  1W1W E;  3QPL A;  3ZMZ A;  1VQP I;  3JRG A;  1B6A A;  1ZYR F;  2MG4 A;  3F8N A;  2H8R A;  1IDZ A;  5E3M A;  4ENK A;  3FX3 A;  2QWW A;  3GFL A;  5FRO A;  5E8I A;  3BQY A;  1D1C A;  4XRF A;  2XRN A;  1R49 A;  4XN3 A;  2FOW A;  2F5V A;  2VT3 A;  2M45 A;  1E2X A;  4HF1 A;  5CQG A;  4EGZ A;  2E1O A;  4IJA A;  5CQE A;  1KU7 A;  1JKQ C;  1JT6 A;  1YIJ I;  1B1B A;  4IQ4 A;  1MMD A;  1Q1H A;  1V3F A;  5ILV A;  3GZ6 A;  1QRY A;  3GME A;  1XGO A;  5IOZ A;  1YRN A;  1I1G A;  2DOD A;  3FHN A;  4EM1 A;  1KQ9 A;  3F6O A;  4XKC A;  2MFZ A;  4M3B A;  4M9S A;  4MQV A;  3BJ6 A;  5C3E J;  2IA0 A;  3GTJ J;  1R4N B;  2ISY A;  2VQC A;  4A3C J;  3OYK A;  1WHU A;  3E3V A;  4YII A;  2FUG 2;  3S3M A;  4CUG A;  3GUD A;  1OR7 C;  1XCV A;  3MZ8 A;  1UZC A;  3H0D A;  1ZGA A;  1BW5 A;  2FNP A;  1LPQ A;  3GYH X;  3OL3 A;  3SDG A;  3BJA A;  1R9T J;  2M2E A;  1W0U A;  4A2U A;  1JT0 A;  3RQ4 A;  2EBI A;  2CJJ A;  5D5V B;  1R6R A;  1YW7 A;  4ZTJ A;  4WXH A;  2NNY A;  2LTP A;  5GTH C;  2EPF A;  4LG3 A;  2M8E A;  3D1N I;  3ZQQ A;  2QA4 I;  4ZYG A;  5FKO A;  1ZHF A;  2Z1D A;  3W2V A;  2OQG A;  3K10 A;  3K70 C;  1DDN A;  3LSR A;  4WCG A;  4RGX A;  3SHF A;  4IPA A;  2CW7 A;  1HKQ A;  2MA3 A;  2DPU A;  3WE2 A;  3WG7 H;  1VQ5 I;  1WRJ A;  4ESF A;  1K4S A;  2CUE A;  2R7R A;  3OR1 C;  1X2N A;  3VYU B;  2E1N A;  1J0R A;  4L9N A;  1HW5 A;  4YFN F;  5B66 C;  5DDG A;  1FIA A;  1AWC A;  1I1S A;  1T39 A;  3V7R A;  2NAZ A;  1Y1V J;  2M0C A;  3JCU C;  2OQR A;  3U2R A;  1T08 B;  3MKW B;  5EG0 A;  3OOP A;  3ABU A;  1TC3 C;  3EYI A;  2NRA C;  1B59 A;  2STW A;  3CDL A;  3BRO A;  3TKY A;  1SD6 A;  5CVI A;  4U7D A;  1QA6 A;  2LC2 A;  1U0J A;  5DD8 A;  1V5G A;  5KAI C;  2HVS A;  1TT5 B;  3HRU A;  2L4M A;  1KYW A;  1G3Y A;  4BJ6 C;  4JYK A;  5J8F A;  2DXI A;  2LF7 A;  2ZSI B;  4ZDO A;  3H3V K;  5B3S H;  2LH9 A;  1FPQ A;  1MMA A;  2QKL B;  3HRS A;  2DA4 A;  2M9H A;  3HC7 A;  3VFZ A;  5DM6 F;  2M5W A;  3MVP A;  2QSH X;  1JUS A;  3ZRG A;  3CMY A;  5IPA A;  3E1S A;  4HF0 A;  4A6E A;  1YTY A;  2MD5 A;  3RJP A;  3HL2 A;  2LMD A;  2MBF A;  2VL8 A;  3ECO A;  1TBX A;  1UHW A;  2WTE A;  2XGE A;  3H36 A;  4N9I A;  5HS9 A;  1APL C;  2Z3Y A;  3GTL J;  1YYV A;  5HLI A;  1GV2 A;  1WWX A;  2ZME B;  1LE8 A;  2Z16 A;  2KKO A;  2HYF A;  1T95 A;  2NS8 A;  1LDD A;  2HI3 A;  1VQO I;  3OIQ A;  3VYR B;  2XC7 A;  4YG2 F;  5CVJ A;  3ZP5 A;  4M3G A;  4XOT A;  2NVU B;  1W36 D;  4U0W A;  1BR4 A;  2MGQ A;  1BIA A;  4A12 A;  2P6S A;  3A52 A;  1JUM A;  1Z67 A;  3AG1 H;  1BOA A;  4UVA A;  2BY0 A;  4HNU A;  1B72 A;  1MMG A;  2X98 A;  1FP2 A;  2P0W A;  3I64 A;  4AYB A;  4DYC A;  4A93 J;  1BW6 A;  1X1B A;  4XLN F;  1MJA A;  4EM2 A;  4LOC A;  3HRT A;  2COM A;  1YIO A;  5J40 A;  4AID A;  4ZH4 F;  2VOD A;  4S05 A;  1W5T A;  2LRE A;  4M3E A;  2ZJ2 A;  3ULQ B;  3DPL C;  2KZG A;  3DF8 A;  1S6L A;  3HUG B;  1LKX A;  1R36 A;  2O0Y A;  4HNV A;  5KAF C;  4YIR X;  3G73 A;  1K4T A;  2GZW A;  3L9F A;  1QO0 D;  4GFB A;  4E70 A;  2LF8 A;  2BEO A;  1W7P B;  3ZMT A;  1JKR C;  2JVH A;  4CA0 A;  2NOJ B;  2E2H J;  2M7A A;  2OV7 A;  3KZY A;  3S2D J;  2B7E A;  1GXQ A;  1IN5 A;  2EFN A;  3K4M A;  1P4X A;  4BHB A;  4DQ2 A;  3H3U A;  3CUQ C;  3BR2 A;  1AKH A;  3CCM I; 
#chains in the Genus database with same CATH homology
 3V8L A;  1ZLJ A;  3K1N A;  2CO5 A;  2V6C A;  2EV6 A;  2L54 A;  5D4S A;  1FBS A;  3GFJ A;  2OD5 A;  1OMI A;  3KP6 A;  3GXO A;  4YFK F;  4UNO A;  1ZG3 A;  5BS6 A;  3F22 A;  1YW9 A;  2L02 A;  3LAJ A;  3KCC A;  1IN4 A;  2HWV A;  4I02 A;  1EV7 A;  5CYV A;  4RB2 C;  4HQE A;  3F6V A;  1CF7 B;  4Z2Y A;  1FYK A;  4UVC A;  3L09 A;  4ZZD A;  3R60 A;  2MH9 A;  4U0Y A;  4KT5 C;  4AVP A;  3RI4 A;  2EWN A;  3K0L A;  1Y0U A;  2K7L A;  3WTX C;  2ELH A;  1O7L A;  5HVQ C;  1ZH5 A;  5ERI A;  1R1V A;  4U7B A;  4LFU A;  3LA3 A;  4EGY A;  4Q5S F;  2VBW A;  3I54 A;  1SFU A;  3RKY A;  1HKS A;  1R1U A;  4P55 A;  3HSR A;  5LHG A;  1OYY A;  5EEH A;  2RKH A;  5LGU A;  1XGN A;  3J80 K;  1GXP A;  1U5T B;  5LEJ A;  1LNW A;  2A07 F;  3ECH A;  3JTH A;  3Q9V A;  3HHG A;  4RAY A;  3N97 A;  1J7K A;  2JTV A;  1MJ9 A;  2WWY A;  2IA1 A;  1FSH A;  3LST A;  4Y13 A;  2GA1 A;  4MEY F;  4QLC U;  2XKO A;  4UHT A;  3ABT A;  3C3W A;  2YX7 A;  5D4R A;  2ZO4 A;  1PP8 F;  2XAJ A;  3FXR A;  2VT2 A;  2H6C A;  4CO8 A;  4M74 A;  2AS5 F;  4M71 A;  1HKT A;  1YS7 A;  1EH8 A;  1FC3 A;  1ZRF A;  2EFQ A;  3ZMS A;  2K86 A;  4Y17 A;  3FXU A;  1KA8 A;  1P6R A;  4GGG A;  3DXJ F;  1O3T A;  4HV6 A;  4L5I A;  5AON A;  1J2X A;  1A04 A;  1OPC A;  2QYO A;  2EFP A;  2RQP A;  1XD7 A;  2FE3 A;  2WC2 A;  5DCM A;  1R1T A;  4JBA A;  4Q48 A;  2VC0 A;  3TGN A;  3F8C A;  1JHF A;  4G6Q A;  1FLI A;  1BC8 C;  3V4G A;  4NQW A;  5A2Q Z;  1J59 A;  4LG0 A;  4BQA A;  3BDD A;  1MGT A;  5FD6 A;  2A61 A;  1TLH B;  3M8F A;  2QQA A;  2L01 A;  3LQR A;  4Q47 A;  1WSU A;  3FMQ A;  4LK0 F;  2UWM A;  1Z6R A;  4GYI A;  3FWE A;  2L4A A;  2GXB A;  1IN6 A;  1ZGJ A;  3C7J A;  1D8J A;  2W84 A;  2DK8 A;  1ZN2 A;  4FT8 A;  2EA2 A;  3P9I A;  1FY7 A;  6PAX A;  1FBQ A;  3E6B A;  3CLO A;  2QM3 A;  4LK1 F;  1Z91 A;  4RGR A;  2QQ9 A;  3I5U A;  3WG9 A;  1XMA A;  1ZAR A;  4HOB A;  3ELK A;  2LKP A;  3EQL F;  5A2Q K;  5AIQ A;  3BZ6 A;  4A5M A;  3WU1 B;  2XRO A;  1L0O C;  3J81 Z;  1X3U A;  2YU3 A;  1BIB A;  3RPU A;  4WX9 A;  5HS8 A;  3P9C A;  2P7C B;  5FO5 A;  5DCF A;  4ASN A;  4WF2 A;  3DP7 A;  3WTW C;  2P7V B;  4ESB A;  1RUO A;  3COA C;  5HLG A;  2JPC A;  3HHH A;  1O7F A;  5H6Q A;  2P6T A;  4I7H A;  4MNU A;  1JGS A;  5KVR A;  3T1B A;  3B02 A;  3J81 K;  2HQN A;  2DT5 A;  4EV0 A;  1KQ0 A;  4ENN A;  4QWQ A;  1OYI A;  1GHC A;  3QPH A;  1DPR A;  4YIF A;  1HW1 A;  2HKX A;  1TW3 A;  1ZLK A;  2VOP A;  4G8X A;  5BPD A;  3CUQ B;  3R6S A;  5LGT A;  1QNT A;  2GWR A;  3U9G A;  4HQM A;  2FRH A;  3GFI A;  5K5Q A;  3WGH A;  5E17 F;  3PQJ A;  3JSO A;  2O6G E;  1IW7 F;  4HAM A;  5J8C A;  2ZNZ A;  1CGP A;  2H6B A;  1L3L A;  4YFX F;  2BGC A;  3V8J A;  2RC4 A;  2MC3 A;  5D5U B;  1K79 A;  2NNN A;  4UV8 A;  1QPM A;  5FGM A;  2DW4 A;  4OIQ F;  2VE8 A;  4BHP A;  3KEO A;  2QQB A;  4L9V A;  3DKW A;  3U1D A;  2IVM A;  4U0V A;  4AD9 A;  2TDX A;  4A0Z A;  4O5V A;  1LJ9 A;  1HW2 A;  5D5X B;  2QBY B;  3R0J A;  4FX0 A;  5DUI A;  1G3S A;  1R22 A;  5D6F A;  1B9M A;  5LHI A;  2OA4 A;  3IL2 A;  2BYV E;  2EK5 A;  5DUK A;  3WTS C;  3HYI A;  1PP7 U;  2F5E A;  4LMY A;  5IT3 A;  1SD4 A;  3CDH A;  1LEA A;  4WXC A;  1S7A A;  4AIK A;  5LGN A;  1XMK A;  3GLX A;  2IT0 A;  1DPU A;  3C1D A;  5LEK A;  1LEB A;  5H6R A;  2STT A;  2P5L C;  4ESJ A;  2KJC A;  2EV0 A;  1XDS A;  2A5Y B;  3R4K A;  3FF5 A;  2RV8 A;  4HX4 A;  3F72 A;  4MGR A;  2ETH A;  2XV4 S;  1XCB A;  4GYG A;  1WQ2 A;  2OU2 A;  4GO1 A;  5E1W A;  4EJO A;  3REO A;  2X4H A;  2W24 A;  3I59 B;  1G4D A;  4GXO A;  4MQ9 F;  1QGP A;  2ZBK A;  2HZT A;  4HX7 A;  1G6N A;  1TQI A;  2O03 A;  1YLF A;  2RN7 A;  3ERE D;  1MDM A;  5CLS A;  3DPT A;  2XKP A;  3H3Z A;  2XHK A;  2PBI A;  3B73 A;  2EA4 A;  3FMS A;  1FWZ A;  4LLL A;  4RS8 A;  3V7S A;  3E5U A;  3S2W A;  1QBJ A;  2DBB A;  2FMY A;  2VBY A;  2G7H A;  1EH7 A;  4G7Z F;  1TTY A;  3Q5F A;  3EUH A;  1YFH A;  2Y0M A;  2HTS A;  1Z6T A;  3F23 A;  1ODD A;  4KN4 X;  3VEP A;  3VB2 A;  1WKM A;  4A0X A;  2CSO A;  1J75 A;  4IXA A;  1UFM A;  2FF4 A;  4I09 A;  4I0B A;  4M73 A;  2ACJ A;  2AXL A;  3CO7 C;  5L3G A;  2QUF A;  3F8B A;  2VXZ A;  2Y75 A;  5K5R A;  1G3T A;  5DCM B;  4DNC A;  1S3J A;  4I0A A;  1VTN C;  3PQK A;  2NYX A;  3TO9 A;  2OZU A;  2CQK A;  2PLY A;  1BM9 A;  3WTZ A;  4AWX B;  4GCV A;  5LHH A;  1R5G A;  3ZPL A;  1KGS A;  1T6S A;  3RPQ A;  3RYP A;  3VOD A;  1STZ A;  1FNN A;  3GW2 A;  1SMY F;  5LLQ A;  4UVB A;  2EJR A;  2PJP A;  1JXS A;  3KLN A;  4Q4Z F;  3VOE A;  5IT9 Z;  3PFI A;  2YX4 A;  3M7G A;  4OIR F;  2DFI A;  1W4M A;  1XB4 A;  4M9Z A;  4HA8 A;  3JW4 A;  4G9Y A;  4B8X A;  1UB9 A;  2X0L A;  4ZYE A;  3QU6 A;  3P7N A;  4HYE A;  4LB5 A;  1FBU A;  4BNC A;  4JK1 X;  4EM0 B;  1BI1 A;  2DI3 A;  3KLO A;  2O3F A;  2QVO A;  3O6B B;  3MEX A;  4M72 A;  2XIG A;  1Z7U A;  2W57 A;  1BI0 A;  3HRM A;  4JQF A;  2F5D A;  1IN7 A;  5IT9 K;  2Z33 A;  1KYZ A;  4MTD A;  5E18 F;  3LWF A;  1KQ8 A;  1XDU A;  5LBQ A;  4PCQ A;  5E1X A;  4ETS A;  3IKV A;  3WTY C;  4TV7 A;  5DYM A;  1DUX C;  4G94 A;  1BN5 A;  4KIG A;  1DP7 P;  2K4J A;  3HTS B;  3T0Y A;  2OAZ A;  1JE8 A;  1QQI A;  3M8E A;  4CGZ A;  2ZKZ A;  3E6D A;  3GF2 A;  2HOE A;  2M87 A;  4OIO F;  4IVN A;  3GFM A;  3IKT A;  5LRS A;  3Q9S A;  5FD5 A;  2Q8K A;  5JR3 A;  4CZZ A;  2V79 A;  4N0B A;  2D1V A;  3G3Z A;  2GXG A;  3CO6 C;  5FFX A;  2UXX A;  3QPT A;  1IRF A;  4LGW A;  4EMS A;  1D5V A;  4G7O F;  2WV0 A;  5CVR A;  5E1Z B;  1IRG A;  4LB6 B;  3CTA A;  3M1E A;  5L3E A;  2A6H F;  3W6K B;  3GWZ A;  3L00 A;  2CYY A;  4U88 A;  5H20 A;  1LDK B;  2D1H A;  4WWC A;  1S7O A;  4I98 B;  2HFH A;  2GQQ A;  2FXA A;  1REP C;  3O3K A;  4I2O A;  1FT9 A;  3ZMV A;  3KP3 A;  2DLL A;  1W7P D;  1UHM A;  2Y48 A;  4RB3 C;  1XGS A;  5HDK A;  3HUG A;  5D8L B;  1OYW A;  3I4P A;  1R00 A;  2FBK A;  4HBL A;  1B9N A;  2ZXJ A;  1H0M A;  3D5L A;  3WTU C;  2FNA A;  3GX4 X;  2ZFW A;  4CIC A;  3NRV A;  4OOI A;  2VOO A;  3ZMD A;  4OMY A;  4HV5 A;  1RIO H;  4KYW A;  2J5P A;  3T8R A;  1K78 A;  1AOY A;  3BPX A;  1GVJ A;  3TO6 A;  1T0F A;  1HQC A;  2W25 A;  3NQO A;  1FZP B;  4CHU A;  1QZZ A;  2ESN A;  1XSV A;  2E7W A;  4NHJ A;  2M1B A;  2HTJ A;  3ML6 A;  3WOD F;  4HDV A;  2FA5 A;  2JT1 A;  3MAJ A;  3M9A A;  3RDI A;  2DQR A;  1CF7 A;  4S04 A;  4EJU A;  1JHH A;  3IRR A;  5L3C A;  3WGI A;  2JRT A;  4PDK A;  2HDC A;  4XSX F;  1UST A;  5L3B A;  2P5K A;  2XAS A;  3C18 A;  2JZY A;  4MHG A;  1ZRD A;  3WTT C;  2Z5U A;  1UCR A;  1HBX G;  3W6J B;  3V7C A;  3H92 A;  2NS0 A;  1IF1 A;  3IHU A;  3L7W A;  3LFK A;  1U5T A;  4HW0 A;  4I01 A;  2UZK A;  5AIP A;  4OIN F;  3IWF A;  3I71 A;  3N4M A;  1HXD A;  2MH2 A;  4OMZ A;  1YO5 C;  2KIU A;  5ICG A;  3DV8 A;  2ZCW A;  3ISP A;  1Z9C A;  2EB7 A;  5F64 A;  1FYM A;  2F2E A;  4Y15 A;  1XSD A;  1IUY A;  2PG4 A;  5JVT A;  3IC7 A;  2GA2 A;  1SFX A;  3R61 A;  2PMU A;  5ICE A;  1RZ4 A;  5JFR A;  4CYD A;  4KFC A;  3E5X A;  3BWG A;  5ICF A;  1J9I A;  1IAW A;  2KIM A;  5DEQ A;  4XLP F;  3K1P A;  1SAX A;  2HKO A;  2DQL A;  2HYG D;  1BBY A;  2K4B A;  2V1X A;  4IF4 A;  2RGV A;  3K2Z A;  4BAY A;  3DFG A;  3DQV C;  2JPB A;  3I58 A;  5BMZ A;  4MEX F;  1FX7 A;  2IA2 A;  1IXS B;  3BY6 A;  2FSW A;  2PMH A;  4A5N A;  2XUB A;  3LAP A;  2A69 F;  4L0Z B;  3JTG A;  4O3M A;  4EQQ A;  5F6F A;  3O2P E;  4LLG F;  5HDG A;  1OR7 A;  5ILU A;  3T8T A;  2YR2 A;  3TQN A;  5HS7 A;  3KP2 A;  3WE3 A;  2DK5 A;  1R7J A;  2HEO A;  3ZMU A;  2MLK A;  4K2E A;  5J6X A;  2A68 F;  4PGG A;  3F21 A;  2K27 A;  1R58 A;  2J5O A;  2H09 A;  4L5J A;  5CVV A;  1SMT A;  3LA2 A;  4IRH A;  5ILS A;  2CFX A;  1S29 A;  2Z9O A;  4AIJ A;  5EEG A;  1BI3 A;  1WI9 A;  1SD5 A;  2CGP A;  3HSF A;  5FLX Z;  2YSR A;  2PFB A;  5L3F A;  2BE5 F;  1P4W A;  5BPI A;  2R7F A;  1G3W A;  2IRF G;  4CDG A;  2Q2E A;  4RGS A;  5ICC A;  1IXC A;  4B09 A;  3I53 A;  3MZH A;  2PI0 A;  4RB0 A;  4L9T A;  5D8K B;  2IPQ X;  1ZG5 A;  3JAM Z;  1R5H A;  4ZYD A;  4M6X A;  3QAH A;  3KP5 A;  4FHT A;  1ZRC A;  2DAO A;  1FYL A;  2DO7 A;  3MQ0 A;  2R3S A;  5FLX K;  4KIF A;  2BBY A;  3E6C C;  1MD0 A;  4KMF A;  4A0Y A;  1H9T A;  1RI7 A;  4IRI A;  3RTR A;  1I5Z A;  3ZN0 A;  1PDN C;  5D5W B;  1MZB A;  2RDP A;  1KU2 A;  1F5T A;  2V1D A;  5LRR A;  2FBI A;  1YW8 A;  5HDN A;  3JAM K;  3P9K A;  1ULY A;  2R7D A;  1ONV A;  4KA4 A;  1RNL A;  1NHA A;  1USS A;  3RKX A;  2CG4 A;  4LLN A;  3CUQ A;  2HGC A;  5TRD A;  4IHS A;  4D0P A;  5E20 A;  4UUV A;  2CW0 F;  3CUO A;  1J5Y A;  3CJN A;  1TNT A;  2PQ8 A;  3TO7 A;  2XVC A;  3K9T A;  1IN8 A;  2G7U A;  1ZAO A;  5HOO A;  4XSZ F;  4H0E A;  3E97 A;  1EH6 A;  4LG0 B;  3TOB A;  1R23 A;  4FX4 A;  1TQP A;  3FXQ A;  2VC1 A;  4KUM A;  2QLZ A;  3EET A;  3QP6 A;  1T2K A;  4UXN A;  1C0W A;  4G6D A;  3IWZ A;  4KN7 X;  3TOA A;  3K69 A;  2ESH A;  4L18 B;  1P92 A;  1E17 A;  1K78 B;  1YS6 A;  4R8H A;  3HOS A;  2HS5 A;  4HLY A;  5K5O A;  3L2C A;  2VN2 A;  2PEX A;  4IRG A;  4EJV A;  2QBY A;  1ZRE A;  2FEZ A;  2BV6 A;  2ZNY A;  1I6X A;  4AIH A;  2LDU A;  4IHT A;  3K1M A;  4N9H A;  3J80 Z;  5CJ9 A;  3GO5 A;  1MKM A;  1HST A;  1PUE E;  3TDU C;  2FU4 A;  4R79 A;  3R0A A;  1FOK A;  3SXY A;  3J7A O;  4HF2 A;  3QRF F;  1MJB A;  4HLX A;  1ON1 A;  1BJA A;  1SD7 A;  4P9U A;  3KET A;  4KMU X;  3ZN1 A;  5HLH A;  4P96 A;  3F8M A;  4LD5 A;  3SZP A;  4PGH A;  2G9W A;  4M9X A;  1IZ1 A;  3I59 A;  4WXD A;  1TNS A;  2VON A;  3BJO A;  3KFW X;  4A6D A;  3KE2 A;  2E7X A;  2P8T A;  3FM5 A;  3QU3 A;  3KP4 A;  2K02 A;  5BOX A;  3SQN A;  4PZJ A;  4EVI A;  4P9F A;  1T38 A;  4ZZL A;  3IRQ A;  4MTE A;  5ED4 A;  1LQ1 A;  5DV5 A;  3T5X A;  4BYY A;  5BQT A;  1P2F A;  3D0S A;  1U6G A;  3MCZ A;  4G7H F;  4R1H A;  4M6Y A;  2OBP A;  3WU0 A;  2MLG A;  2P5V A;  5F1R A;  3GZ5 A;  2ZME A;  3HSE A;  5CVU A;  2IJL A;  2OZ6 A;  3EYY A;  4KNY A;  1IXR C;  1YQA A;  3V8K A;  1XN7 A;  2Z99 A;  1HSJ A;  3OV8 A;  1B4A A;  1BI2 A;  3MZY A;  1KU9 A;  4RGU A;  2EFW A;  2CWE A;  1FP1 D;  3WTV C;  3E5Q A;  1LDJ A;  1LVA A;  5FFZ A;  3WGG A;  2QEN A;  4HDU A;  2JSC A;  3KP7 A;  2XAF A;  2H94 A;  2DPD A;  4EJW A;  2EV5 A;  1W7P A;  4L9J A;  2IP2 A;  4O6J A;  2D2W A;  1XSX A;  1F4K A;  3GVA A;  3EDP A;  1XGM A;  4BHC A;  1QZY A;  3SZT A;  2DTR A;  4RB1 A;  2E1C A;  2YPR A;  2Q0O A;  2O8X A;  2FML A;  1H9G A;  1K7A A;  3QP5 A;  2EFO A;  2UXN A;  3HOT A;  4CXF A;  2V1U A;  1TQM A;  2XAQ A;  2O61 A;  1T98 A;  2F5C A;  1P4A A;  1KU3 A;  4KIB A;  5K1Y A;  2B0L A;  3RKW A;  4NB5 A;  3LQQ A;  3ZQ7 A;  3MFK A;  1ON2 A;  3F3X A;  3LA7 A;  4OU0 A;  4LJZ F;  5JI6 A;  4ENM A;  3KEQ A;  2HR3 A;  3HIF A;  3QOP A;  4ENJ A;  2FQ3 A;  3BOQ A;  1FSE A;  3HTU A;  3GEZ A;  2M30 A;  4HZF A;  2P4W A;  3BPV A;  4EJT A;  3ROU A;  1O57 A;  4KIC A;  2GIV A;  4OIP F;  1O3S A;  5D6E A;  4HX8 A;  2D45 A;  3JSP A;  4ON0 A;  3FMR A;  2XAH A;  1YG2 A;  4XBF A;  3E6M A;  3NEU A;  2KJB A;  2QZ8 A;  1LB2 A;  1O3R A;  2KIF A;  1MDM B;  3MWM A;  1SFE A;  2RNJ A;  3KZZ A;  4BH9 A;  1BC7 C;  2ADU A;  2C6Y A;  1Z1D A;  3FZV A;  1U78 A;  4UV9 A;  5L3D A;  1I27 A;  1U2W A;  4WK8 F;  5JHU A;  2KRF A;  3TDZ C;  2LSO A;  3RYR A;  1U3E M;  2FOK A;  2A3S A;  2W85 A;  3DEU A;  1Z05 A;  2XGX A;  5KK1 A;  1ZG1 A;  4P5O A;  2GAU A;  1F9N A;  3AAF A;  2HQR A;  3RIR A;  3FHZ A;  1S8N A;  1O3Q A;  1OKR A;  2ISZ A;  4ZYH A;  2VE9 A;  1U5T C;  2IW5 A;  1RUN A;  3I0T A;  2FBH A;  2PN6 A;  1U8R A;  4F7Z A;  1W5S A;  1D8K A;  4RAZ A;  1D3Y A;  5FB2 A;  3F8F A;  5DD4 A;  1K6O A;  2DU9 A;  2L3D A;  3SFZ A;  5TJJ A;  4KDP A;  3BP8 A;  2LNB A;  2VBZ A;  2XAG A;  2A6E F;  1TW2 A;  1F1Z A;  2VBX A;  2V9V A;  3FM3 A;  2RVC A;  2F5F A;  5E8G A;  4BXU A;  2H27 A;  1V4R A;  3ZMZ A;  1B6A A;  1ZYR F;  3F8N A;  4ENK A;  3FX3 A;  2QWW A;  3GFL A;  5E8I A;  4XRF A;  2XRN A;  2VT3 A;  2M45 A;  1E2X A;  4HF1 A;  4EGZ A;  4IJA A;  1KU7 A;  1B1B A;  1Q1H A;  1V3F A;  5ILV A;  3GZ6 A;  1XGO A;  1I1G A;  4EM1 A;  1KQ9 A;  3F6O A;  4MQV A;  4M9S A;  3BJ6 A;  2IA0 A;  2ISY A;  3E3V A;  4YII A;  3GUD A;  1XCV A;  1ZGA A;  2FNP A;  3GYH X;  3BJA A;  4A2U A;  5D5V B;  1YW7 A;  4WXH A;  2NNY A;  2M8E A;  4ZYG A;  1ZHF A;  2OQG A;  1DDN A;  4WCG A;  4RGX A;  3SHF A;  4IPA A;  1HKQ A;  2MA3 A;  2DPU A;  3WE2 A;  1WRJ A;  4ESF A;  2E1N A;  1J0R A;  4L9N A;  1HW5 A;  4YFN F;  5DDG A;  1AWC A;  1I1S A;  1T39 A;  3V7R A;  2NAZ A;  2OQR A;  3U2R A;  3OOP A;  3ABU A;  3EYI A;  2NRA C;  1B59 A;  2STW A;  3BRO A;  3TKY A;  1SD6 A;  5CVI A;  4U7D A;  5DD8 A;  3HRU A;  2L4M A;  1KYW A;  1G3Y A;  5J8F A;  2LF7 A;  1FPQ A;  3HRS A;  3VFZ A;  2M5W A;  4HF0 A;  4A6E A;  1YTY A;  2MD5 A;  3RJP A;  2MBF A;  3ECO A;  1TBX A;  1UHW A;  2WTE A;  4N9I A;  5HS9 A;  2Z3Y A;  1YYV A;  5HLI A;  1WWX A;  2ZME B;  2KKO A;  2HYF A;  1LDD A;  4YG2 F;  5CVJ A;  3ZP5 A;  4U0W A;  1BIA A;  4A12 A;  2P6S A;  4UVA A;  1BOA A;  1FP2 A;  3I64 A;  4XLN F;  1MJA A;  4EM2 A;  3HRT A;  2COM A;  1YIO A;  4ZH4 F;  2VOD A;  4S05 A;  1W5T A;  2ZJ2 A;  3ULQ B;  3DPL C;  3DF8 A;  1S6L A;  2O0Y A;  1R36 A;  3G73 A;  2GZW A;  3L9F A;  1QO0 D;  4E70 A;  2LF8 A;  2BEO A;  1W7P B;  3ZMT A;  3KZY A;  1GXQ A;  1IN5 A;  2EFN A;  1P4X A;  4BHB A;  4DQ2 A;  3H3U A;  3CUQ C;  4L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...