4HV6A

Structure of mntr h77a mutant in apo- and mn-bound forms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
133
structure length
133
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRAELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
total genus 49
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv6A02
4BNCA 3HSFA 1P4XA 2EFQA 3ZMDA 5BS6A 5EEGA 2VT3A 4WXCA 2PFBA 3IWFA 5E8GA 1Z1DA 1FWZA 4UV9A 4HA8A 4ZYEA 3J81K 3GFLA 4ON0A 5BPDA 2VONA 1KGSA 3C18A 3NRVA 4ENNA 1TQMA 1R1VA 2CQKA 3I58A 2EWNA 3KEQA 4LFUA 2HKXA 3RDIA 3KP2A 1ZLJA 3EQLF 5ICFA 4OIPF 4L0YB 2EV6A 4Y17A 4PGGA 2RC4A 2VODA 3WU0A 1KU7A 5LGTA 3GUDA 2M30A 2LF8A 1OMIA 1LDJA 2NAZA 5CYVA 3ROUA 1W7PA 4IRIA 3QRFF 5HS7A 1J7KA 3I64A 4G7OF 1V3FA 2FBHA 1OR7A 5D8KB 2BGCA 3IWZA 2Z99A 1IAWA 2W84A 4MQVA 1CF7A 1O3RA 3VFZA 4P96A 3BOQA 2JZYA 4CICA 5L3CA 2XASA 1F9NA 2V1DA 3LA2A 2OA4A 1P92A 3V7RA 2RQPA 2LF7A 2BV6A 1GVJA 5D5WB 3CUQB 4M6YA 1I6XA 5FD6A 2OZ6A 4M9SA 4L0ZB 3JSPA 2L02A 2NRAC 4YFNF 4ZYDA 3FHZA 3C7JA 1MJBA 2GXBA 5D6FA 2DLLA 4XRFA 5J8FA 1U8RA 3GX4X 3D5LA 1MD0A 1UHWA 5TJJA 3GWZA 2CWEA 2RGVA 4UV8A 4HF1A 2YX7A 1O3SA 4Q48A 2EFNA 1R58A 2XAFA 4M9XA 2KIUA 5FB2A 1T0FA 3PFIA 1J0RA 3V7CA 1XMAA 4LLNA 2A6HF 3VODA 5H20A 1KU3A 2DTRA 4ENKA 2IA0A 5LGUA 1HSTA 2V1UA 1S3JA 1KU9A 1XSDA 2IT0A 4ZZLA 4HV5A 2K02A 2JT1A 1ZARA 2QQBA 1BI2A 1USTA 4U0VA 2CG4A 4RB3C 4R8HA 2VE8A 1MJAA 3BP8A 2EFOA 2Y48A 3ML6A 1SFXA 1YLFA 3QPTA 5H6RA 1UFMA 5D4RA 3KETA 3IL2A 5E17F 5IT3A 2FSWA 4OIRF 1R5GA 2L4AA 5HLIA 3R0AA 1U2WA 2O3FA 1LJ9A 4BAYA 1XN7A 2G7HA 2G7UA 2G9WA 1R7JA 5L3GA 1U5TC 4WF2A 3VB2A 1P2FA 5HDNA 4HF2A 4ZZDA 5BPIA 2Z5UA 5TRDA 3DFGA 3BJOA 3JAMK 2M5WA 4MNUA 1SFEA 2QQ9A 2BE5F 4EV0A 1U78A 1GXQA 3J80K 4L9TA 4KUMA 2XGXA 4BH9A 3I53A 1I5ZA 3U1DA 4RGXA 2XV4S 2CW0F 2WC2A 3M9AA 4IVNA 4RGRA 3ZQ7A 2FNAA 3ZN0A 2XAGA 3R0JA 2DQRA 2K7LA 1U6GA 1MZBA 5E20A 5LBQA 2EV5A 1MDMB 4OIQF 3KLNA 2E1NA 1ZN2A 3ZMVA 1FP2A 4GYGA 2IA1A 1TW2A 1KQ8A 1YO5C 2KIFA 3KP7A 2XIGA 5HS8A 3ELKA 2AXLA 1BC8C 1I1SA 5CVIA 3LAPA 3J80Z 3FM5A 3K69A 3TQNA 1B9NA 4KN4X 1B9MA 1SAXA 3C1DA 3B73A 2TDXA 4L9NA 3JAMZ 3FMRA 1FY7A 3C3WA 1Z6TA 4AIJA 3BROA 3F22A 2MH2A 1P4AA 2VC0A 3GW2A 4MEXF 2HTJA 4LLLA 4RGSA 3SQNA 2IA2A 2D1HA 4IF4A 2KJBA 2DO7A 4BHBA 2P8TA 2YX4A 2F5FA 3RTRA 2RDPA 2XKOA 2ADUA 3LQQA 3HRUA 2FMYA 1J75A 3IC7A 4LB5A 1ZRDA 2EA2A 3Q5FA 2MBFA 5K5OA 5AIQA 3R61A 2NYXA 4CO8A 2JSCA 3QU3A 4JQFA 3QPHA 4UNOA 1QZYA 2HS5A 2OAZA 3KZYA 1T98A 1H9GA 3ZPLA 4R79A 1TNTA 4M71A 2JPBA 1DDNA 1Z91A 5BMZA 4G8XA 1WRJA 3B02A 4I2OA 1PP8F 1JHFA 3P9KA 4G7ZF 1O7LA 3L09A 4P5OA 1S7AA 2DI3A 1XSVA 5LGNA 3HRSA 1S6LA 2P7VB 1E17A 3ZMTA 3Q9SA 2MLGA 3N97A 1XGMA 4BXUA 1STZA 1FYKA 3FZVA 4NHJA 1HW2A 5AIPA 2HYFA 2PG4A 2PEXA 3E6DA 2ZJ2A 3M8FA 3T1BA 1I27A 3HTUA 3RPQA 4L5JA 1I1GA 2QUFA 2PLYA 1Y0UA 3CJNA 3O6BB 3ECOA 1RIOH 4UXNA 4S04A 1SMTA 3IHUA 1FBQA 1O7FA 2PMHA 1Z9CA 4A0ZA 2RV8A 4CXFA 1ZH5A 4FX0A 2F5DA 1SD6A 2MC3A 1XGOA 1IXCA 1FC3A 5L3BA 3JW4A 3QOPA 3EUHA 2OU2A 3WGIA 3V7SA 3DPTA 2FBKA 5BOXA 4NQWA 3DQVC 3F8MA 3DV8A 2O03A 1HKTA 4O6JA 2XAQA 5F6FA 5ILVA 1ONVA 3FXQA 3TOBA 3T5XA 3OV8A 3DKWA 2W85A 2BBYA 2DU9A 4HZFA 1HW5A 2Z3YA 4HBLA 1RZ4A 1DUXC 4I7HA 1ULYA 2DK8A 2STWA 1K79A 1FNNA 2Y0MA 1IN4A 1TQPA 5DV5A 3KFWX 5DD8A 3J7AO 1CF7B 1MDMA 5HOOA 1FBSA 3IRQA 2GA1A 2WWYA 2ACJA 2OBPA 3F6VA 3HIFA 1GXPA 2FOKA 4IRHA 1BC7C 4G94A 1XCBA 4U7DA 4HX7A 3CTAA 1OPCA 2A68F 3WTSC 6PAXA 4KIGA 3F8FA 1DPRA 1P6RA 5CVVA 4EQQA 2ZXJA 3GFJA 4I98B 1XD7A 1MGTA 2HOEA 1P4WA 3V8LA 1E2XA 3GLXA 2UXNA 4KN7X 1QBJA 3ZMUA 3CUQC 1WKMA 1FSEA 2PMUA 2HDCA 3SZPA 5E8IA 1RUNA 4ESFA 3GVAA 1XB4A 5J8CA 1F4KA 3I5UA 4A0YA 1NHAA 3LFKA 1WWXA 2PJPA 3E6BA 3RJPA 2M87A 4UUVA 2QZ8A 3V4GA 2QQAA 3W6KB 3DEUA 3GXOA 4K2EA 2R3SA 2HQNA 4ESJA 4GGGA 4MTDA 4O3MA 3GO5A 4QLCU 2O61A 4DQ2A 2A5YB 5HDKA 1QO0D 1D8JA 4Y13A 5E1WA 5LRRA 1AOYA 3I71A 2COMA 3EETA 3RI4A 4U0YA 2LDUA 4HX8A 1G4DA 2WTEA 3HOSA 1VTNC 1IXSB 2CYYA 2P5VA 1SD7A 2ESHA 1FOKA 3TO9A 2QM3A 1CGPA 5JHUA 2Z33A 2H09A 2VOPA 1BIAA 2RN7A 2R7FA 5LHGA 4EGYA 4WCGA 3F8NA 4HQMA 4HOBA 4L9JA 3SXYA 2A3SA 1IRGA 2E7WA 3WTTC 2GIVA 5HS9A 2HWVA 1UHMA 3P7NA 1BBYA 4A5NA 2NS0A 3K0LA 1ODDA 3RPUA 5E18F 1FZPB 4U0WA 2GQQA 2Y75A 4KT5C 3E97A 1TQIA 2Z9OA 1B6AA 3O3KA 3MEXA 1YFHA 4P9UA 4LK0F 1FSHA 4AVPA 2O6GE 4HYEA 5FLXZ 3MQ0A 2CGPA 4G7HF 4AWXB 1H9TA 3R4KA 1IZ1A 1BM9A 1F5TA 1U5TA 1WI9A 4QWQA 2LKPA 2V1XA 3HRTA 2ZMEA 2LSOA 4EJVA 4EJWA 1ZG3A 2ZBKA 2HGCA 2FE3A 1BI3A 3ULQB 4XLPF 3MAJA 2Q2EA 3RIRA 1YQAA 1FPQA 2VOOA 2OQRA 3KCCA 2QBYB 3NEUA 4ENMA 3KLOA 1LEBA 4KIFA 4B8XA 1G3WA 1O3TA 4UHTA 5EEHA 2IRFG 3NQOA 1Z7UA 1IN7A 3GEZA 2L54A 1EV7A 5K5QA 4HF0A 5D5VB 2P4WA 3WG9A 3TOAA 2PBIA 2QBYA 3BDDA 2DPDA 1KYZA 2GA2A 3K1MA 4ETSA 4WWCA 1LB2A 4KICA 1QZZA 1LDDA 1F1ZA 2EFPA 4JBAA 1KYWA 3VOEA 1HSJA 5BQTA 4DNCA 2ZNYA 3E5UA 4M72A 3BJAA 4WXDA 1Z6RA 4HV6A 4PCQA 2YSRA 4XSXF 3N4MA 2AS5F 1LEAA 2P5KA 5ICGA 3JTHA 1FYLA 4UVCA 1SD5A 1K78B 2CSOA 1LDKB 2C6YA 4MEYF 4L5IA 3V8JA 2Q8KA 1OYIA 1D3YA 2A6EF 3F21A 4Q5SF 2F2EA 2QENA 4KMUX 3V8KA 1K78A 4M6XA 1YTYA 4UVAA 3T8RA 4GO1A 4M9ZA 3MZYA 3ERED 3S2WA 3AAFA 3FMSA 3FXUA 1EH6A 5D5XB 1MJ9A 5E1ZB 1JHHA 2RVCA 3M7GA 1DP7P 3KP6A 1C0WA 2A07F 4A2UA 4BQAA 1SD4A 1K7AA 1EH7A 4IHSA 3QP6A 1D5VA 2DPUA 4N9IA 4I09A 1QPMA 2QWWA 4U7BA 5LRSA 4I02A 1ZRFA 5FO5A 3WE2A 3ZN1A 5DUIA 3QU6A 2QLZA 4R1HA 4HLYA 1DPUA 3GFMA 4RAZA 1XGNA 2VT2A 2GWRA 3QAHA 3DPLC 4CDGA 2GAUA 4YFKF 3KP3A 2A61A 3CO7C 1QQIA 3F72A 4G6DA 2HZTA 2ZMEB 5CVJA 2LNBA 2L3DA 2VXZA 4KMFA 2J5OA 3EYIA 4AIKA 3FWEA 3DF8A 3CO6C 3IKTA 2OQGA 3WU1B 3TO6A 4E70A 2QVOA 2F5CA 2FF4A 2PN6A 3CUOA 3TO7A 3EYYA 3E3VA 3TKYA 2DBBA 1TW3A 3T0YA 3BPXA 1PDNC 4AIHA 3IKVA 3W6JB 4GYIA 2UXXA 5ICEA 2IW5A 2JRTA 1B1BA 1R1UA 2DK5A 2ZO4A 3JSOA 1GHCA 4FT8A 4A0XA 2KJCA 3BY6A 5DYMA 2XHKA 1W5SA 5E1XA 2HYGD 2V79A 3HSRA 5DCFA 1SMYF 1FLIA 2WV0A 5CVRA 5LHHA 1KA8A 1ZRCA 3MZHA 1XGSA 4EJOA 1IW7F 1ZREA 1YS6A 1ON1A 4IHTA 1A04A 2STTA 1XSXA 1JGSA 5HLHA 4EM2A 2FXAA 2ZCWA 4S05A 3GFIA 1H0MA 2ELHA 1W5TA 4YIFA 1HBXG 1G3TA 5KVRA 4KNYA 5AONA 4OU0A 1XDUA 2VBWA 3I59A 4XBFA 1IUYA 1R22A 1RNLA 4PZJA 1W7PB 2VE9A 2MLKA 3H92A 3CLOA 2ISZA 1S7OA 5F64A 1BI1A 1OKRA 2FU4A 1T6SA 3MCZA 4HQEA 4A6DA 1XCVA 1IF1A 4HLXA 1O3QA 2FA5A 4KIBA 4CYDA 1BI0A 2IJLA 5IT9K 4CHUA 1TTYA 2P7CB 3COAC 1HKQA 3RYPA 2A69F 3CUQA 4L18B 4KYWA 1LVAA 5FFXA 2L01A 4U88A 2UWMA 3K9TA 4PGHA 2HQRA 3R60A 2O8XA 1G3YA 5LEJA 3FMQA 3RYRA 3HHHA 4KA4A 2OD5A 4XLNF 1FT9A 4Y15A 3F6OA 3ABUA 2H6BA 1ZG1A 2W24A 4LG0A 4A5MA 4HX4A 3LA3A 1JXSA 3FXRA 1OYWA 3L9FA 3KZZA 3RKYA 5KK1A 4BHCA 1R23A 1T38A 2EV0A 5H6QA 2F5EA 1K6OA 2P5LC 3GZ6A 5DUKA 2DFIA 2HKOA 4FHTA 3H3ZA 1JE8A 4CZZA 2XUBA 2ETHA 3BWGA 2DT5A 4EM0B 1S8NA 1UB9A 2FBIA 2YR2A 3RKXA 1ON2A 2VN2A 3TGNA 4LJZF 3FF5A 2RNJA 1S29A 5K5RA 4Q4ZF 2BYVE 1TBXA 2M8EA 4MQ9F 5FGMA 2K4BA 2M1BA 3LWFA 1R5HA 3U2RA 2EA4A 4N9HA 1LNWA 3T8TA 4LG0B 4MHGA 3WTWC 2MD5A 1YW7A 1ZLKA 1PUEE 3I59B 4A12A 3WTYC 4RB1A 1YS7A 5LLQA 1R1TA 5F1RA 5CLSA 5DEQA 2JPCA 1QNTA 2XAJA 5JVTA 1R36A 1U5TB 3HUGA 3FM3A 2FEZA 1YG2A 4EVIA 5FLXK 1L0OC 2KRFA 5LHIA 1YIOA 3KP5A 3WGGA 4HDVA 2ZKZA 3HYIA 5DCMA 4ASNA 2KIMA 2K4JA 3ISPA 5FD5A 1IXRC 4MTEA 4ESBA 3JTGA 1BJAA 4EMSA 4L9VA 1HQCA 2P6TA 2XROA 5L3EA 5HLGA 3WGHA 3PQJA 4YFXF 2FNPA 4ZYGA 4M74A 4N0BA 3TDUC 2PQ8A 4LD5A 4P9FA 4RAYA 5D4SA 3L2CA 3WE3A 4GCVA 1WSUA 3I54A 3QP5A 4H0EA 4D0PA 5DDGA 1IN6A 3WODF 3K1PA 1TLHB 3KP4A 2DAOA 1ZGJA 2FMLA 3LQRA 2X0LA 2YU3A 3SZTA 1RI7A 4WK8F 1HW1A 2VBXA 2D2WA 2JTVA 3R6SA 1G3SA 2X4HA 4EJTA 3REOA 4EGZA 1Z05A 2CO5A 4I01A 2V9VA 4YG2F 3E6CC 1YYVA 5ILUA 1KU2A 3H3UA 2GZWA 4KFCA 5D5UB 2PI0A 3K1NA 5D6EA 2EB7A 1G6NA 1J2XA 4OMYA 1IRFA 3E5QA 1J59A 2MH9A 2GXGA 2IVMA 4OOIA 4Z2YA 1TNSA 1O57A 3ABTA 4IXAA 4P55A 2D1VA 3FX3A 3TDZC 3GYHX 3L00A 1U3EM 3LA7A 1USSA 2KKOA 3P9IA 3HHGA 3SHFA 1IN5A 2OZUA 3F8CA 1BOAA 3VEPA 2QYOA 5A2QK 2DW4A 3HOTA 1SFUA 4YIIA 4EM1A 4UVBA 2EFWA 4JK1X 4G6QA 2E7XA 1FBUA 5LEKA 4M73A 5CJ9A 2XKPA 4BHPA 1T2KA 3K2ZA 2XRNA 3DXJF 3GZ5A 2J5PA 3RKWA 4O5VA 3G3ZA 3L7WA 5DD4A 1RUOA 5L3DA 1FX7A 4LK1F 4OMZA 4WXHA 4XSZF 4FX4A 3LAJA 5JFRA 5HDGA 3D0SA 1ZG5A 3F3XA 5A2QZ 2YPRA 1UCRA 2BEOA 5L3FA 1W4MA 2Q0OA 2DQLA 5CVUA 1V4RA 2NNNA 2ZFWA 2RKHA 4Q47A 4GXOA 3EDPA 2K27A 1ZGAA 3BPVA 1B4AA 3E5XA 3ZMSA 5K1YA 4RGUA 4RB2C 1MKMA 1X3UA 2XVCA 1D8KA 1HXDA 4ZYHA 3J81Z 5ICCA 1QGPA 2HEOA 3DP7A 3P9CA 3CDHA 4G9YA 2P6SA 3O2PE 3BZ6A 4I0BA 4IJAA 3I4PA 1Q1HA 4F7ZA 2EK5A 4B09A 1KQ9A 1ZYRF 2NNYA 4LLGF 3HTSB 1BN5A 1L3LA 3F23A 2L4MA 1XDSA 3WTZA 2HTSA 3KE2A 4HW0A 2H6CA 3KEOA 3PQKA 4BYYA 2UZKA 5IT9Z 3ECHA 3MFKA 2MA3A 1YW9A 4IPAA 2R7DA 1REPC 3BJ6A 4LB6B 2ZNZA 4ENJA 3ZP5A 4I0AA 4LGWA 1LQ1A 2H27A 1HKSA 1OYYA 3U9GA 1ZAOA 1ZHFA 4RB0A 2HFHA 4ZH4F 2CFXA 5ILSA 4WX9A 4A6EA 2IPQX 2HR3A 2W25A 5JR3A 2E1CA 3OOPA 4LMYA 4RS8A 1EH8A 4OIOF 3F8BA 4NB5A 1PP7U 3GF2A 5JI6A 1AWCA 3HSEA 3SFZA 2VBZA 2H94A 2EJRA 4TV7A 2VC1A 2D45A 2O0YA 3HRMA 4HDUA 1XMKA 3G73A 5HVQC 1B59A 2M45A 3MWMA 2FRHA 4MGRA 1WQ2A 1YW8A 1IN8A 4HAMA 4IRGA 3E6MA 2ESNA 4AD9A 5J6XA 2V6CA 5ED4A 3ZMZA 4OINF 3LSTA 1BIBA 4PDKA 5FFZA 1T39A 3I0TA 1R00A 4CGZA 4EJUA 2XAHA 3WTUC 2ISYA 2IP2A 5D8LB 3WTXC 1FYMA 2FQ3A 5DCMB 3WTVC 2K86A 1W7PD 2W57A 3M1EA 5ERIA 3IRRA 2B0LA 4KDPA 2VBYA 1KQ0A 3M8EA 3Q9VA 1J5YA 1J9IA 1FP1D
chains in the Genus database with same CATH superfamily
4BNCA 3D5SC 4B48A 3ONQA 5CQGA 3OYHA 3BG6A 3HSFA 2E2JJ 1P4XA 4F3QA 3G1OA 5J3LA 3TEDA 2EFQA 3ZMDA 2GBYA 2JJ7A 5FKMA 5BS6A 5EEGA 2VT3A 2HDDA 4WXCA 4A3DJ 5EGOA 2PFBA 3IWFA 5E8GA 1Z1DA 3BG7A 1FWZA 4UV9A 3OOUA 4HA8A 3LSHA 3KIOA 2E36A 4ZYEA 5H2FC 4B1RA 3TP3A 3BCBA 3ZQIA 3J81K 1NTCA 3GFLA 4ON0A 4CCJA 5BPDA 2VONA 3FXKA 3H1CA 1KGSA 3C18A 1S9HA 3OYGA 4LIVA 3NRVA 1TC3C 4ENNA 1TQMA 1Z7LA 1DP3A 1R1VA 1MMDA 3AG1H 4PJ0C 1BR1A 3SDBA 2CQKA 3EUKL 1OCZH 3I58A 2DT7B 2FD5A 2LKSA 2EWNA 3LSGA 1G59A 4BY1J 1BW6A 4A3BJ 1LUJB 3KEQA 4S0HB 1ENHA 4LFUA 1PUFA 2HKXA 3RDIA 3KP2A 4IHVA 2F48A 1ZLJA 3EQLF 5ICFA 3HG9A 1SANA 2AXTC 4OIPF 5E3LA 3M07A 3OYAA 4L0YB 2EV6A 1TL8A 5E79C 3BTLA 2K3PA 5IP6A 4Y17A 4PGGA 2JN6A 4CSWA 2RC4A 2VODA 2CV2A 5HNFA 4IL6C 3WU0A 1KU7A 1YRNB 1FEXA 5LGTA 2HOAA 3GUDA 4J01A 2M30A 4HSRA 4QPOA 1IJWC 2LF8A 4U87A 1X2MA 1OMIA 1LDJA 2O5RA 2NAZA 2Q1ZB 4IEJA 4IQJA 5J47A 5CYVA 2ME6A 3ROUA 3MKZA 1W7PA 3CLQA 4YELA 1SC7A 2R0QC 4IRIA 3S2HJ 3QRFF 5HS7A 1J7KA 3I64A 4G7OF 2GOMA 1V3FA 2FBHA 1VZ0A 1OR7A 2DMNA 2L9VA 1TWGJ 5D8KB 1MSFC 2BGCA 3CJQB 3RPUD 2XGDA 1WVRA 3IWZA 2Z99A 1IAWA 1K61A 2W84A 4MQVA 2ECCA 1CF7A 5EG0B 1ZR4A 1O3RA 3VFZA 1K83J 1MMGA 4ZC3A 4P96A 3BOQA 2B7EA 2JZYA 2V1NA 4CICA 3BT9A 1IC8A 5L3CA 1QVTA 1S5LC 2XASA 1V55H 2QSHX 4DZPA 1F9NA 2V1DA 2F6CA 3LA2A 1JKPC 2OA4A 2KZVA 1P92A 3V7RA 2RQPA 4NBQA 4E7SA 1VQLI 1RPWA 2LY9A 3VYRB 2LF7A 5EZHA 2BZTA 4XKWA 1EF4A 1V5EA 2BV6A 4E6KG 3S93A 1M1EB 2X1DA 1GVJA 2R92J 5D5WB 1FJLA 3CUQB 4M6YA 1I6XA 1FIPA 5FD6A 3CF2A 1E3PA 2OZ6A 2M3AA 2L5QA 4QTRA 3LL7A 4M9SA 3JSPA 4L0ZB 2L02A 2Y69H 3BR0A 2NRAC 4YFNF 4ZYDA 3FHZA 3C7JA 2KQRA 5TGTA 3EUHC 2ELJA 2W82A 1MJBA 2ZMEC 2JRMA 2ZXHA 2MSYA 2GXBA 4XOPA 1K4SA 5D6FA 2DLLA 4V19K 3OYJA 2DDBA 4XRFA 2K40A 1TWHJ 3PUBA 5J8FA 2WAQN 4PSXA 4IHWA 4MIMA 2W7NA 1U8RA 3ZOBA 3GX4X 3D5LA 4PJNA 1MD0A 1UHWA 1I3QJ 1Y0NA 4XICA 5TJJA 3GWZA 3DU5A 1MBEA 1SVMA 2CWEA 1HA8A 2RGVA 4UV8A 1X3ZB 2M2EA 4HF1A 2YX7A 1MNMC 1O3SA 4Q48A 2EFNA 1R58A 2XAFA 3BTIA 2IGMA 3MVPA 4M9XA 4B3AA 2KIUA 5FB2A 1T0FA 2R93J 3PFIA 3K70D 5GP9A 1J0RA 3V7CA 2AQEA 2N8GA 4PUSA 1XMAA 1T56A 4LLNA 2A6HF 4PFPA 3VODA 2DA5A 2VL8A 3EPZA 5H20A 1KU3A 2OTJI 2DTRA 2HPIA 4DYQA 2R7XA 2E5NA 2NVUB 4ENKA 2IA0A 5LGUA 4CYCB 1HSTA 3MD2A 3DLLF 2V1UA 4BE0A 4UUSA 3BZKA 1S3JA 5K7ZA 1KU9A 2P0WA 1VQ8I 3NARA 3GTKJ 2FX0A 4XR6A 1XSDA 2IT0A 4ZZLA 1TP4A 2WY7Q 4HV5A 1X1PA 5C4JJ 2YU9J 2K02A 3ZR8X 5M5XJ 3SJMA 1SFKA 3K4BA 4C30A 1G2HA 2CS3A 3CCSI 2JT1A 2Z2SB 3HOZJ 1ZARA 2MC4A 2XGEA 2QQBA 1BI2A 2CUZA 1JKOC 3LOCA 4P1WA 1USTA 4U0VA 4RLFA 2CG4A 2P0TA 4I6ZA 2HQ5A 2K85A 2MVTA 3ZQLA 4RB3C 4R8HA 2VE8A 3TP0A 3CCUI 1MJAA 3BP8A 4B44A 2EFOA 2Y48A 4NNJA 2KRCA 3ML6A 3S32A 1SFXA 1YLFA 1H8AC 3QPTA 5H6RA 1UFMA 2KLOA 3PM1A 3CP2A 1WJFA 5D4RA 3K6GA 3Q3SA 3OWTA 2X6YA 3PIPF 3KETA 3BZCA 2M7BA 3IL2A 5E17F 5IT3A 5EF6A 1MBFA 3HDDA 1WI3A 2FSWA 2HYJA 4OIRF 3H9QA 1R5GA 1QU3A 2L4AA 1FTTA 3G71I 5CKTA 1ZK8A 4XN3A 3JRCA 3O8HA 1I3AA 5HLIA 4M3BA 2DTZA 3R0AA 1U2WA 3PFYA 2O3FA 5JVGF 1D1CA 3K70C 1LJ9A 4M6VA 4BAYA 5HODA 1UG0A 3L2WA 2Y9ZA 4JYKA 4GFBA 5K7FA 2HNHA 2QKLB 4W1UA 1XN7A 2G7HA 2XPWA 2G7UA 3OMYA 2G9WA 1OCTC 3KYLA 1R7JA 4CA0A 5FRMA 1Y56A 3A0HC 1U5TC 3KYCB 5L3GA 4WF2A 3GTPJ 1IV8A 3DTEA 3VB2A 1P2FA 4D5CA 3A4CA 1FOXA 5HDNA 4HF2A 4ZZDA 5BPIA 1JUMA 2Z5UA 5IOYA 3DFGA 3BJOA 3JAMK 3L2QA 5TRDA 2M5WA 4XOTA 4XN0A 2VIXA 3GCMA 4BU2A 2UUZA 5TISC 4C3JJ 4MNUA 3BTCA 5CPRB 5IPAA 3HB9A 4A3CJ 3JAMR 3HEFA 1RKWA 3GZNB 1SFEA 2QQ9A 2BE5F 4ZYAA 4EV0A 1U78A 3HGYA 1GXQA 2QA4I 1MSEC 3J80K 4L9TA 1TT0A 1AHDP 4KUMA 1P9QC 2DDAA 2XGXA 5KNLA 1N77A 2R5YB 4BH9A 4D1QA 2DA3A 1D0YA 2GLOA 3I53A 1I5ZA 3U1DA 4BJ5C 4RGXA 2QEXI 2XV4S 4XNFA 2CW0F 2WC2A 1Z3YA 1V54H 2OC6A 3M9AA 1ZR2A 1DGRM 4IVNA 3H5NA 5M3FJ 4RGRA 1U0JA 3ZQ7A 2FNAA 4KT6A 5J1UA 3ZN0A 1Y1VJ 4RM2A 2XAGA 2GIZA 3R0JA 2DQRA 2K7LA 3DKXA 3PUFA 2WV1A 3L2VA 2JA7J 1U6GA 2DFFA 1MZBA 5E20A 3CCRI 4RMNA 5LBQA 2NVTJ 2EV5A 2KRHA 4I99C 3BG5A 1QRYA 3H9GA 1MDMB 3KX2A 4OIQF 2HZDA 2HI3A 2NVXJ 1XX5A 3KLNA 2E1NA 4N4OB 2CU7A 2VJ4A 1A5JA 4C9YA 1ZN2A 3ZMVA 1FP2A 4GYGA 5M3MJ 2IA1A 3CJTB 2X98A 1TW2A 5LD2C 4MLOA 1KQ8A 3W2VA 3MKLA 1YO5C 2KIFA 3KP7A 2XIGA 5HS8A 3ELKA 2AXLA 1BC8C 1I1SA 4PSWA 5CVIA 3LAPA 3J80Z 1WH7A 3FM5A 3K69A 3TQNA 3LSKA 3OS1A 1B9NA 3JREA 4KN4X 4BE1A 1B9MA 1SAXA 4HNVA 3C1DA 3B73A 2TDXA 4L9NA 2PX9A 3SEQA 4XONA 2H8WA 2R7SA 3JAMZ 5E3OA 1BL0A 3FMRA 2DODA 1U8BA 2MD0A 1FY7A 1UZCA 2DA4A 3H0DA 3C3WA 1SEUA 1WJEA 1Z6TA 4AIJA 3BROA 5FKLA 1DQUA 4QSHA 2W4SA 2MH2A 2VC0A 1P4AA 3F22A 3GW2A 3HZJA 4MEXF 2HTJA 2LOOA 4E7ZA 2I5UA 5F1JA 3GTOJ 1S7EA 4LLLA 1EJ9A 2CUFA 2ZJRF 2CQXA 4RGSA 5DS9A 3SQNA 4BACA 4DBRA 1U9OA 2IA2A 2D1HA 4IF4A 4HRIA 3CMEI 2KJBA 2MFZA 3CCYA 2DO7A 4BHBA 2IBDA 3FKIJ 2P8TA 2YX4A 2F5FA 3RTRA 4LIUA 2RDPA 2XKOA 1YI2I 2ADUA 3JRIA 3LQQA 5GTIC 3HRUA 1WCMJ 2FMYA 1J75A 3IC7A 4LB5A 1ZRDA 1FIAA 1MH4A 2CUEA 2EA2A 5FLXR 4ABZA 1JUSA 1ZQ3P 1GDTA 4A93J 1UAAA 3Q5FA 1R4NB 2MBFA 5K5OA 5AIQA 3R61A 2I8DA 2NYXA 4CO8A 2JSCA 3QU3A 4JQFA 1NG6A 3QPHA 4UNOA 1QZYA 4ZDOA 2V4JC 2DA7A 4E7HA 2HS5A 4FE4A 2OAZA 3KZYA 1T98A 1H9GA 3OYFA 3ZPLA 3HPGA 4R79A 1TNTA 4M71A 1LFBA 3OYDA 2LR8A 1WPKA 2JPBA 1DDNA 3GLLA 1Z91A 3FXOA 1BA5A 2L7MP 5BMZA 1R5ID 2CRGA 4G8XA 1WRJA 3B02A 4I2OA 5IYCJ 1X1AA 3OIQA 1PP8F 4GDFA 1JHFA 5B5EC 3P9KA 4DZJA 4G7ZF 1QPIA 1Y39A 3ZQHA 1O7LA 3L09A 4P5OA 2O9LA 1S7AA 2DI3A 1XSVA 5KAFC 3HRSA 5LGNA 2XF6A 1S6LA 2P7VB 3OYLA 4BJ6C 3ZMTA 3Q9SA 1K4TA 2MLGA 1E17A 3N97A 3IP4B 1XGMA 4BXUA 4AYBN 1STZA 2R5ZB 1FYKA 3RQ4A 3FZVA 2R7ZJ 4NHJA 1HW2A 5AIPA 3CP8A 5FKNA 2NS7A 2HYFA 3DEEA 2PG4A 4BQOA 3DPUA 3N05A 4KJZA 2PEXA 4F52A 3E6DA 3CF5F 2ZJ2A 3M8FA 2WY8Q 3T1BA 1I27A 3HTUA 3RPQA 4L5JA 1I1GA 2QUFA 3A03A 2PLYA 2XPUA 1A31A 1Y0UA 3CJNA 3OL4A 3O6BB 1NK2P 1VQPI 3ECOA 4IO9F 1RIOH 5JLWA 4UXNA 4S04A 3MN2A 1SMTA 4M3EA 3QPSA 2F5VA 4BKXA 3IHUA 1F43A 4NC8A 1FBQA 1O7FA 2ZC2A 3BR3A 2PMHA 1SFOJ 3ERMA 1Z9CA 2R7OA 4IKFA 2WAQA 3AG3H 4A0ZA 2E1MB 2RV8A 3SFIA 1JGGA 2DMTA 4CXFA 1ZH5A 4FX0A 1D1AA 2F5DA 1APLC 1SD6A 2MC3A 4RLQA 3A2KA 5IT9R 2M7AA 1XGOA 3S15J 1IXCA 1FC3A 5L3BA 3JW4A 2IS6A 2XF5A 3QOPA 3EUHA 1LFPA 2OU2A 2R5ZA 3WGIA 2Y31A 3V7SA 4IHYA 4J19A 1Y8RB 3DPTA 2FBKA 4BGDA 5BOXA 4NQWA 3DQVC 3F8MA 3K4JA 3FK6A 2P81A 3DV8A 2O03A 1ETQA 1HKTA 4O6JA 4E7KA 2XAQA 3JCUC 4E4HA 2FQ4A 3A0BC 3S17J 2MG4A 5F6FA 5ILVA 1YRNA 1ONVA 3FXQA 3TOBA 3T5XA 3MKWB 1WH5A 2CV1A 3VYTB 2ZXWH 2Y0SN 3OV8A 3DKWA 2W85A 2BBYA 2DU9A 3CDIA 1VFCA 4HZFA 3WHBA 4D5FA 1HW5A 2Z3YA 4HBLA 2PJRB 1RZ4A 1DUXC 1UG2A 4I7HA 2WAFA 1ULYA 2DK8A 2STWA 3CCEI 1K79A 1JUPA 1FNNA 1BR2A 2Y0MA 1IN4A 5B1AH 1TQPA 2L9SA 2E35A 1OLTA 5DTDA 5DV5A 4A3KJ 3KFWX 2X1CA 5DD8A 3J7AO 1CF7B 1MDMA 5HOOA 1FBSA 4LOCA 2L7FP 3K4KA 3S16J 3IRQA 3CDLA 2GA1A 2DMQA 2WWYA 3CCQI 2ACJA 2OBPA 2VKDA 3F6VA 3HIFA 3JRAA 1GXPA 1MNEA 2FOKA 3H35A 4IRHA 3IAM2 1BC7C 2EILH 4PFOA 3ZRGA 1ORKA 4G94A 3OIOA 1XCBA 4NC6A 4U7DA 4HX7A 3CTAA 2DJIA 1OPCA 4AM3A 2A68F 3HJEA 4JP0A 3WTSC 6PAXA 5FLVA 4KIGA 3F8FA 2W00A 1DPRA 2K9QA 1P6RA 4FISA 4AIDA 3BR6A 5CVVA 4EQQA 2ZXJA 5C3EJ 3GFJA 4I98B 2LTPA 3OR1C 1FOWA 1XD7A 4XMYA 1MGTA 2HOEA 1P4WA 3V8LA 1E2XA 3IH3A 2MZ4A 3GLXA 1FTZA 2UXNA 4KN7X 1QBJA 3ZMUA 4XM3A 4IOCF 3CUQC 1OQYA 3BC8A 3H5RA 1WKMA 1FSEA 2PMUA 2VPRA 2HDCA 1ETYA 3SZPA 1YJ9I 2BVMA 2HVRA 5E8IA 4UUSB 1VQ9I 2KT0A 3J81R 3BR5A 1RUNA 4ANJA 3IV5A 2L0KA 4ESFA 2TRTA 3GVAA 2YUSA 1XB4A 5J8CA 1F4KA 3I5UA 4A0YA 3OYCA 1NHAA 3IAS2 3LFKA 1WWXA 5E3NA 2PJPA 3E6BA 3RJPA 2M87A 4UUVA 4HSTA 4ZTJA 3C2GA 2KP6A 2QZ8A 3V4GA 3PL8A 2X6XA 2W48A 1EKEA 2IGOA 2LMDA 2QQAA 4A3MJ 2LYCA 3W6KB 2LC2A 2COBA 3DEUA 2FOWA 2ID6A 3GXOA 3B6CA 4K2EA 2R3SA 2OCCH 2HQNA 4Z6YA 2BY2A 4ESJA 4GGGA 2DMPA 4MTDA 2VKEA 3CC7I 3HXLA 2HOSA 4O3MA 3GO5A 3OYNA 1B8IB 1CQTA 4QLCU 3E0JB 2O61A 4DQ2A 2JA8J 2H1KA 2A5YB 2VQGA 5HDKA 1QO0D 5KCMA 5B66C 2IAIA 1D8JA 4Y13A 3OS2A 2G0EA 5E1WA 1AA7A 4M3DA 3A52A 2LREA 5LRRA 1AOYA 1GV2A 2Y30A 2COMA 3I71A 3ZQCA 4RAGA 3EETA 3RI4A 4U0YA 1T33A 3S14J 4JOMA 3X2QH 2LDUA 2X9DA 4HX8A 1G4DA 2VKHA 2TCTA 2WTEA 2Y9YA 3HOSA 1VTNC 1IXSB 2CYYA 2P5VA 1JTYA 1SD7A 2ESHA 3TO9A 2JK3A 1FOKA 2QM3A 5EDNA 1CGPA 2OPTA 5JHUA 1XMXA 1ZGWA 1A6QA 2Z33A 2H09A 5HLTA 1BIAA 1OR7C 2VOPA 1HDDC 2RN7A 2R7FA 5LHGA 4EGYA 4WCGA 3CCVI 3RSNA 2JQ7A 3F8NA 1A35A 4HQMA 2ZJQF 2GM4A 4HOBA 1ZKGA 4L9JA 2EZKA 3SXYA 2A3SA 1IRGA 2E7WA 3WTTC 2VPLA 2GIVA 4CZCA 5HS9A 4ZJZA 1FMWA 1X1DA 2HWVA 1UHMA 3QPLA 4C3IJ 3KYDB 3P7NA 2DA1A 2DYSH 1R4MB 1BBYA 4A5NA 3GBGA 2NS0A 5CQEA 1IDZA 3LSIA 1LVKA 3K0LA 1ODDA 3RPUA 3SDGA 5E18F 4BQQA 1FZPB 4W97A 2XRLA 2LBFA 4U0WA 2GQQA 4C2TA 2Y75A 4KT5C 1T95A 3E97A 2R7RA 1A36A 3OY9A 1TQIA 2HVQA 4LITA 2Z9OA 4XIDA 1B6AA 3O3KA 3BQZA 3MEXA 4KITB 4P9UA 4LK0F 1YFHA 1FSHA 2NOJB 3AFHA 4AVPA 2O6GE 9ANTA 4HYEA 5FLXZ 2ME0A 4RAFA 4PJLA 3MQ0A 2CGPA 4G7HF 2NVYJ 4AWXB 1H9TA 2OTLI 3R4KA 1IZ1A 3U21A 1F36A 1BM9A 1F5TA 1U5TA 2YS9A 2GOXB 2VQHA 1GUUA 3MMYB 1VQNI 1WI9A 3MKYB 4QWQA 2LKPA 3FIWA 2E19A 2CQ7A 2XSDC 2FUG2 2V1XA 3HRTA 2ZMEA 2LSOA 4EJVA 4EJWA 3DBRB 1ZG3A 1OCRH 1ZTRA 2ZBKA 2HGCA 1WZ2A 2FE3A 4DYCA 1BI3A 3ULQB 2X48A 4XLPF 4DOZA 3LFUA 3HL2A 1VQ6I 5F08A 3MAJA 1VF9A 3C2BA 5E3MA 2L2OA 2Q2EA 3RIRA 1YQAA 1FPQA 3HM5A 5JHFA 2VOOA 3PNYA 2OQRA 5FKKA 1D1BA 2Z16A 3KCCA 4L5EA 2QBYB 3NEUA 1DU6A 1KONA 4ENMA 2VUMJ 3DU6A 4M3GA 3KLOA 1MMSA 2DYRH 4HG2A 2ICWG 3H0GJ 3Q0VA 1LEBA 4KIFA 3CMMA 1G3WA 4B8XA 1O3TA 4UHTA 3DTKA 3H36A 5EEHA 2IRFG 3NQOA 1Z7UA 2F4OB 3GEZA 1IN7A 3H5AA 2E5ZA 1EV7A 2L54A 5K5QA 1D0ZA 4HF0A 1PUFB 3S1RJ 5D5VB 4AYBA 3AL0C 2P4WA 3WG9A 3TOAA 3ZQFA 1B72B 2PBIA 2JA5J 3WHCA 2QBYA 2L9RA 2A05A 2MABA 3J7YJ 3SYTA 4BXFA 3BDDA 2DPDA 1KYZA 3BR1A 3OYBA 2GA2A 3JRBA 3K1MA 4ETSA 3GTLJ 2HXOA 1UHSA 4E7LA 5IYBJ 4WWCA 3IH4A 1LB2A 4KICA 3TL4X 1QZZA 1LDDA 1F1ZA 2EFPA 4JBAA 1VQ4I 1KYWA 4QPQA 2QKMB 3VOEA 3JRHA 1HSJA 5BQTA 2MW8A 1EA3A 4DNCA 2ZNYA 3E5UA 1PVEA 3BJAA 4M72A 4WXDA 3CESA 1Z6RA 2M4KA 3PSIA 2AHQA 2FJ1A 1JJ8C 4HV6A 4PCQA 1I50J 2BY3A 2NS8A 3I4NJ 2KZGA 4GRIA 2YSRA 4XSXF 1OCOH 3N4MA 3W2WA 3ZQQA 2AS5F 1LEAA 4XKVA 2HVSA 2P5KA 5ICGA 3JTHA 1FYLA 4UVCA 4OWRB 3D1NI 1SD5A 1K78B 3JRGA 3HKZN 2CSOA 3PNVA 1LDKB 2C6YA 1OJLA 1RR7A 4MEYF 2OJED 4V2GA 4L5IA 4LG3A 3V8JA 2LRDA 2Q8KA 1OYIA 1D3YA 5J40A 1Y1WJ 2K9MA 2V26A 3L1PA 3S1MJ 2A6EF 1XS9A 3F21A 4Q5SF 2F2EA 1QHHD 4G12A 1J09A 2QENA 4KMUX 3V8KA 1I6HJ 3CJRB 2NVQJ 1K78A 4M6XA 1YTYA 4UVAA 3T8RA 1GV5A 3CZ6A 1VQKI 4GO1A 3GTMJ 4M9ZA 1MH3A 3MZYA 1VI0A 3ERED 3S2WA 3ZXSA 2DCEA 3AAFA 3FMSA 3FXUA 1EH6A 2OCEA 4XL9A 4DW6A 5D5XB 3FKJA 1RC9A 1MJ9A 2EZHA 3K10A 3WG7H 5E1ZB 3I56I 2LK2A 1LKXA 3BR2A 4MFDA 1JHHA 2RVCA 3M7GA 3BG3A 5KAIC 1DP7P 4DBQA 1WJDA 3KP6A 2JWTA 3BTJA 1C0WA 3RCOA 2A07F 4A2UA 1WHUA 4BQAA 1SD4A 4XLHA 1K7AA 1EH7A 4IHSA 3QP6A 1D5VA 2EIKH 2DPUA 4N9IA 2CQQA 4I09A 4I76A 4OAZA 4D9JA 1QPMA 2MUNA 2QWWA 4U7BA 5LRSA 5FRNA 4XLCA 3H3VK 4BBRJ 4H4KC 1TZLA 4I02A 1T8IA 1ZRFA 5FO5A 3WE2A 3S8PA 2R7WA 4CCMA 2EQRA 3QQAA 2PMZA 3KZIC 1YJNI 3ZN1A 2WBMA 1ERDA 1X58A 4XKCA 1LE8B 3S1QJ 3FXMA 5DUIA 3QU6A 2QLZA 5F0CA 3VYUB 4R1HA 1X2NA 4CUGA 4HLYA 1RQ6A 1YX5A 1DPUA 5M5WJ 3GFMA 4RAZA 2R5YA 1XGNA 2BHYA 2VT2A 2CW7A 2GWRA 2LLKA 3QAHA 3RQIA 3DPLC 2XAUA 4CDGA 2VJJA 2DXIA 1TWAJ 4A3IJ 2KL4A 2GAUA 3OSFA 2QQ8A 2Z1DA 4YFKF 3KP3A 2A61A 3CO7C 4PK4A 1QQIA 3FBNB 1IV6A 3S3MA 3F72A 4G6DA 2HZTA 2ZMEB 5CVJA 4Y7NJ 3ABKH 2LNBA 2L3DA 1W1WE 1NK3P 3OL3A 4AU7A 5IP9J 5DM6F 1GLNA 2VXZA 4KMFA 3ESWB 2J5OA 5F0HA 1OCCH 3EYIA 4AIKA 2DMUA 4NDLA 2NXNB 3FWEA 3DF8A 3CO6C 4RBOA 1W36C 3IKTA 3QODA 2OQGA 3Q0UA 3WU1B 1XC5A 1DGWY 3TO6A 4B47A 4E70A 3FXJA 1K6YA 2QVOA 1E3HA 2F5CA 2FF4A 2PN6A 2AO9A 3PJRA 1JT0A 3FK7A 1Y8QB 1S72I 1X4OA 5HNHA 3CUOA 3TO7A 3EYYA 3M3YJ 4F55A 3E3VA 3TKYA 2DBBA 4BDYA 1TW3A 3T0YA 1VQ5I 5A2QR 3BPXA 1PDNC 4AIHA 1IUFA 1H89C 3IKVA 3VWBA 3W6JB 3AKZA 2DA6A 4GYIA 2UXXA 5ICEA 2IW5A 2JRTA 3RZDJ 1B1BA 1R1UA 2DK5A 2W1OA 2QSGX 2PJRA 2DJNA 2ZO4A 3JSOA 3HUGB 1GHCA 2WADA 5GAGJ 4FT8A 4A0XA 2KJCA 4X0GA 3CC2I 1V5FA 2VASA 4J00A 1N75A 3BY6A 5DYMA 2XHKA 1W5SA 5E1XA 2HYGD 2V79A 3HSRA 1YHQI 3OYKA 5DCFA 2VQLA 1SMYF 3GTGJ 1UMQA 2BHZA 1FLIA 2LP0A 2WV0A 5CVRA 5LHHA 2K5CA 1KA8A 1ZRCA 2KPMA 3MZHA 1XGSA 1X1BA 4EJOA 1IW7F 1ZREA 5J1YA 1YS6A 1ON1A 4IHTA 1W0TA 1A04A 4D7MA 2STTA 1XSXA 3ZCOA 1JGSA 3ABMH 5HLHA 2VJ5A 4EM2A 2FXAA 3QYFA 2E1OA 4C2MJ 2ZCWA 5F04A 1G8XA 4S05A 2BY0A 3GFIA 1IGNA 2IXSA 3EUAA 1RRJA 1H0MA 2ELHA 2IGNA 4NUBA 1W5TA 1UJ8A 5J4VA 4BXXJ 4YIFA 2VB6A 1HBXG 1G3TA 5KVRA 1WJCA 2R7VA 4KNYA 2RNGA 2L7KA 3CCMI 3CD6I 5AONA 2DFEA 4OU0A 1ACIA 2KDZA 1XDUA 2VBWA 3I59A 4XBFA 3J7ZI 1IUYA 1R22A 4E7JA 1RNLA 1GVDA 3OYEA 4HEA2 4PZJA 1W7PB 2LY1A 1QVUA 2OF7A 2VE9A 2MLKA 3H92A 1X4PA 3IUOA 3CLOA 2V9PA 2ISZA 3S3NA 1S7OA 3D5RC 5F64A 5GADJ 3CMAI 1BI1A 1OKRA 2FU4A 2HOTA 1T6SA 5IOZA 3MCZA 3DWLE 1P7JA 3OYMA 4HQEA 4A6DA 2X6WA 1XCVA 4ZTFA 1IF1A 4HLXA 2ELKA 1OFCX 3L2RA 1O3QA 1MBHA 2FA5A 3J7AY 2K9NA 4CCOA 2XDVA 4A69C 2XSJC 2HDWA 3K4CA 4KIBA 2E2IJ 4CYDA 5M5YJ 1BI0A 2LVSA 2IJLA 1QA6A 5IT9K 2LH9A 1TTYA 2P7CB 2ZJPF 4DYRA 4CHUA 1R6RA 3HOWJ 1IDYA 1RKTA 3COAC 1BW5A 4AUXA 1HKQA 3RYPA 3W6VA 2A69F 3UR3C 3CUQA 5FKOA 4L18B 4HPQA 3P5JA 4F91B 1LVAA 4KYWA 5FFXA 2CQNA 1QZEA 3HOXJ 1B8IA 2JUCA 2L01A 4U88A 3GTJJ 2UWMA 3K9TA 4PGHA 4RDUA 2HQRA 3R60A 2O8XA 5IP7J 1G3YA 3DTIA 3E7LA 3TMOA 5LEJA 2KISA 3FXLA 3FMQA 3RYRA 2ID3A 3GMEA 2QCOA 4EATA 1FOYA 3HHHA 4KA4A 5IYDJ 2OD5A 1VQOI 2A5WA 4XLNF 1FT9A 4Y15A 3F6OA 3Q0WA 1MIJA 4UUTA 1HC8A 3ABUA 2H6BA 1ZG1A 2W24A 1W5CC 2JVHA 3NAUA 4LG0A 4A5MA 4HX4A 2E34A 3LA3A 1JXSA 3FXRA 2XC7A 1OYWA 4QIWN 4IX7A 2R7TA 3OIPA 3L9FA 3KZZA 2Y2ZA 4KISA 3RKYA 3LSPA 1UELB 1MBKA 2HU9A 5KK1A 1NH3A 4BHCA 1R23A 1T38A 2EV0A 2BW3B 5H6QA 5EZGA 3FISA 2F5EA 5B1BH 3V42A 4XRSG 4FTHA 1NG7A 1K6OA 5K7HA 2P5LC 3GZ6A 1AKHB 1HDPA 2CUJA 5DUKA 2DFIA 2F4IA 2HKOA 4FHTA 3SEZA 3BQYA 5GAHJ 2JMWA 4A3EJ 3H3ZA 1JE8A 4CZZA 3L2UA 3W2AA 1X3WB 2XUBA 2ETHA 3BWGA 4Y52J 2DT5A 3ZQGA 4EM0B 1S8NA 4BEHB 1UB9A 2FBIA 2YR2A 3RKXA 1ON2A 2VN2A 3TGNA 4LJZF 3FF5A 1PYVA 2LD5A 3HPHA 2RNJA 3JRDA 5IY5H 1S29A 2CH0A 5K5RA 4Q4ZF 2ZSIB 4G6TB 2BYVE 1TBXA 3KPHA 2M8EA 4MQ9F 5FGMA 2K4BA 3G1LA 3DLAA 2M1BA 3LWFA 1R5HA 2EA4A 4N9HA 3U2RA 1LNWA 3T8TA 4LG0B 3VSKA 5J4YA 4BY7J 4C2UA 2E1MC 3MZ8A 4MHGA 3WTWC 2MD5A 1YW7A 3I55I 1ZLKA 1PUEE 2K9SA 4BQNA 3I59B 4ZDLA 4A12A 1Z3XA 4XLFA 3WTYC 4RB1A 1YS7A 5LLQA 1R1TA 5F1RA 5CLSA 3JRFA 2LFBA 1BOBA 1Z67A 5DEQA 2JPCA 1JJ6C 1QNTA 2XAJA 5JVTA 1R36A 1U5TB 4F92B 3IH2A 3HUGA 4MFEA 4YEJA 3FM3A 4II3A 4UB6C 4DGWB 2FEZA 2WB1A 1YG2A 4EVIA 5FLXK 3SZGA 1L0OC 2KRFA 1YITI 4AC0A 4Y33A 5LHIA 3BLYA 4YRVA 1YIOA 1ETWA 3KP5A 2XGCA 4DJAA 3WGGA 4HDVA 1LPQA 4B3XA 2ZKZA 3HYIA 3K7AJ 3I9V2 5DCMA 4AVZA 3BG9A 4ASNA 5DM7F 5EGOB 2L7ZA 3J7AW 5FLMJ 2JA6J 2KIMA 2K4JA 3BCAA 3LSJA 2D5VA 3ISPA 5FD5A 1IXRC 1Z77A 4MTEA 1HF0A 4M3FA 3S2DJ 4ESBA 3JTGA 1BJAA 2E71A 5FJ8J 4EMSA 4L9VA 4Y4RA 1HQCA 2P6TA 1P7IA 2XROA 5L3EA 5HLGA 2LY2A 3WGHA 5J1RA 3F9KA 1JI8A 3PQJA 1R71A 3OR2C 4YFXF 2FNPA 4JX5A 4ZYGA 4M74A 4N0BA 1TWFJ 3TW6A 3TDUC 2PQ8A 2F4MB 4LD5A 4N4NB 3G6EI 4P9FA 2LBFB 1POGA 4RAYA 1OCPA 2JSPA 5D4SA 3WE3A 3L2CA 2QF7A 1X19A 4GCVA 2M35A 1WSUA 2DA2A 2EZLA 3I54A 1VQMI 2M9HA 3QP5A 3OYIA 1ETVA 2E2HJ 1E0EA 2L9NA 4H0EA 3CMYA 2VKVA 2ZXIA 4D0PA 2O7OA 5DDGA 4XKBA 2M34A 1IN6A 3WODF 4DIQA 3AG4H 3K1PA 1TLHB 3KP4A 5F0FA 3M4OJ 2DAOA 1ZGJA 2FMLA 2HQAA 3LQRA 2X0LA 3G2BA 2YU3A 3SZTA 1RI7A 4WK8F 1HW1A 4XK4A 3QWLA 2VBXA 2D2WA 2JTVA 3R6SA 3F0CA 4XQFA 3CCLI 3AL0B 3S1NJ 4BBSJ 1VNDA 3U1KA 1G3SA 2VI6A 2X4HA 4EJTA 4XLEA 3REOA 2EZIA 4IOAF 2IGKA 4EGZA 1Z05A 3QOEA 2VXDA 2CO5A 3LMMA 4I01A 2V9VA 4UY8I 4YG2F 2XPVA 3E6CC 3HGGA 1YYVA 1GT0C 5ILUA 1KU2A 4FASD 3H3UA 1MBJA 2GZWA 1I39A 2LKXA 4KFCA 1ZELA 5D5UB 2PI0A 3K1NA 5D6EA 1WJAA 3ABLH 3G4SI 2EB7A 1IO2A 2I10A 2DOFA 3O8GA 1G6NA 1H88C 1ITYA 2CJJA 4V2FA 1J2XA 4FCYA 4OMYA 1IRFA 3E5QA 4MO7A 1J59A 3KEYA 2MH9A 2GXGA 1Z0XA 2JUGA 3HOUJ 2IVMA 4OOIA 2KIQA 5GPCA 4IHXA 1YX3A 3PO3J 3I4MJ 4Z2YA 4PJJA 1TNSA 4FE7A 1O57A 3ABTA 4NQWB 4IXAA 5EEAA 4P55A 2D1VA 3FX3A 2IEKA 3TDZC 3GYHX 3HC7A 3L00A 1FMVA 1U3EM 3LA7A 1W36D 3M1CA 1USSA 2KKOA 3P9IA 1WFXA 3TW7A 3HHGA 3SHFA 1IN5A 2OZUA 4XRSA 2BXZA 3F8CA 2B9SA 1BOAA 3B6AA 3VEPA 2QYOA 5A2QK 4E7IA 4ITVA 2CV0A 2H8RA 2DW4A 3HOTA 1SFUA 2OUMA 3K4LA 4JX4A 3A1YA 2MGQA 5LFAA 4YIIA 1XPXA 2X6OA 2BW3A 2JA2A 2XF7A 4EM1A 4UVBA 2EFWA 4JK1X 4G6QA 1U9NA 1FBUA 2E7XA 4XLAA 5LEKA 2RREA 4M73A 2QSFX 5CJ9A 2XKPA 4BHPA 1T2KA 3K2ZA 1IRXA 2XRNA 3DXJF 4B4CA 3GZ5A 2J5PA 3RKWA 4EEFG 4IZZA 4A3JJ 4O5VA 3G3ZA 3L7WA 3PIOF 4F93B 5DD4A 2VQCA 1RUOA 3LSRA 2VLAA 5L3DA 1RR8C 3LSMA 2EBIA 4A3LJ 1HOMA 1FX7A 4LK1F 2X85A 1ETOA 2DOEA 4OMZA 4WXHA 3HBLA 4XSZF 3GTQJ 2VJIA 3J80R 2E60A 4FX4A 3LAJA 2V6EA 1XTAA 5EJCA 2KHMA 2K3FA 4X6AJ 1T08B 5JFRA 5HDGA 3ASOH 1ETXA 1SVOA 3D0SA 1ZG5A 2EPFA 1D5YA 2EIMH 1N25A 3F3XA 2YPRA 5A2QZ 1Y6IA 4CH7A 1UCRA 2BEOA 2KFDA 1IG7A 5L3FA 1W4MA 2Q0OA 2M0MA 1MMAA 5C4XJ 3A01A 2IS1A 1WGXA 2DQLA 5CVUA 2LG4A 3DKYA 1MMNA 1V4RA 2NNNA 3WU2C 2ZFWA 2RKHA 4OAYA 4X1EA 4XORA 1YE9A 4Q47A 3DBHB 3EDPA 4GXOA 3K2AA 4HNUA 2UV1A 1SAUA 2K27A 5JLXA 1ZGAA 2ZFUA 3BPVA 3FHNA 3OS0A 1B4AA 3E5XA 2OV7A 4B43A 3ZMSA 5K1YA 3ZGKA 3OSGA 3HKZA 1HLVA 2XB5A 2WB1N 2A6TA 4RGUA 4RB2C 1MKMA 1X3UA 2PMZN 3HOVJ 2XVCA 1D8KA 1BR4A 1HXDA 1QHGA 4ZYHA 2BVLA 3H9JA 2CFOA 3J81Z 5ICCA 1QGPA 2V9KA 3NWSA 2DT6A 5EG0A 3PNTA 2HEOA 3DP7A 3P9CA 3CDHA 2ECBA 2XB0X 4G9YA 2P6SA 3O2PE 3BZ6A 1MNDA 4I0BA 4IJAA 3I4PA 1Q1HA 3DBLB 4F7ZA 2EK5A 4B09A 4CCLA 1YIJI 1YOVB 1JKRC 2ZB9A 1KQ9A 2O8KA 1ZYRF 2NNYA 2X1EA 4LLGF 3HTSB 1BN5A 1L3LA 3F23A 2L4MA 1XDSA 3WTZA 1B72A 2HTSA 3KE2A 4HW0A 3ASNH 4ZDPA 5BNGA 2H6CA 3KEOA 3PQKA 1V5GA 3K4NA 4BYYA 2RQQA 3VSLA 2UZKA 3C2HA 3I3LA 5IT9Z 1RESA 3ECHA 3MFKA 2MA3A 2DN0A 1D0XA 3JR9A 2EH3A 1YW9A 4FETA 2CMPA 4IPAA 3VYSB 2R7DA 1A6IA 2WAEA 2DOAA 1REPC 4II2A 5EYRA 5B3SH 3BJ6A 4HNTA 3K4MA 4LB6B 2ZNZA 5KHDA 4ENJA 3UNGC 3ZP5A 4I0AA 4LGWA 1LQ1A 2H27A 2NOGA 1JTXA 2BXYA 4NC7A 4BJTA 2KDOA 2B63J 1N78A 1HKSA 1OYYA 1R49A 3U9GA 3RKQA 3M8JA 1ZAOA 1ZHFA 1ETKA 1WJ5A 2QGUA 3CCJI 1JKQC 4RB0A 2HFHA 4ZH4F 1IRZA 2CFXA 5ILSA 4WX9A 1AKHA 4A6EA 2IPQX 3TBIA 3UKGA 1E3OC 2HR3A 2W25A 5JR3A 2V7FA 4YIRX 1HCRA 2E1CA 3QYBA 1YJWI 2BOLA 1TWCJ 3OOPA 2HPMA 4FQGA 4RM3A 3VDXA 4LMYA 1AU7A 3DEWA 4RS8A 4A3GJ 2AQFA 1TT5B 3FDYA 4UB8C 2HXIA 1EH8A 3HOYJ 4BL0B 4OIOF 2MYSA 3F8BA 3S3OA 2K9LA 3AG2H 5GAEJ 4NB5A 1PP7U 3GF2A 2X51A 1SVLA 5JI6A 1AWCA 2BY1A 4BUPA 3HSEA 3SFZA 2R7QA 4BS9A 1PJRA 2VBZA 2H94A 2EJRA 4TV7A 1O4XA 2IS2A 2VC1A 4A3FJ 2D45A 1WJBA 2O0YA 4CCKA 2M4GA 3HRMA 4HDUA 1XMKA 3CC4I 1Z21A 3G73A 5HVQC 3QYEA 1B59A 2M45A 2KMUA 3MWMA 2FRHA 2WA0A 3E1SA 3PO2J 1T0FC 4MGRA 1WQ2A 5FROA 1YW8A 4D7NA 1BJZA 1IN8A 2IS4A 4XRMA 4HAMA 4IRGA 1MBGA 1LE8A 4PJMA 2M0CA 2M8GX 3E6MA 4BDZA 2ESNA 4AD9A 3G1MA 5J6XA 3RZOJ 2V6CA 2RAEA 1W0UA 3FBIB 2Y0SA 5ED4A 3LNQA 5F27A 3DCFA 3ZMZA 4OINF 3LSTA 5C44J 1BIBA 4PDKA 5FFZA 1T39A 3I0TA 2Q2EB 1MW7A 5GTHC 1R00A 1VQ7I 4CGZA 3A02A 3VPRA 2GXAA 4EJUA 2XAHA 3WTUC 2ISYA 1XG1A 2IP2A 4Y3OA 5D8LB 2H1LA 2R4GA 1R9TJ 2R7UA 3CQZJ 1X1CA 3WTXC 2FQ3A 1FYMA 2JVGA 1DU0A 3PSFA 4CYCA 1Q1VA 1OISA 4JX6A 2ZSHB 5DCMB 3WTVC 2EINH 4CCNA 2K86A 1W7PD 4BE2A 1JT6A 2W57A 2DFHA 3M1EA 3NWTA 1LFUP 5ERIA 2EIJH 4IQ4A 3IRRA 4RA2A 2B0LA 2VBYA 4KDPA 1KQ0A 4BEHA 1KZHA 4C3HJ 1RETA 3W3CA 3A01B 3M8EA 3Q9VA 1J5YA 2CW8A 1J9IA 1FP1D 5GPAA
chains in the Genus database with same CATH topology
4BNCA 3HSFA 1P4XA 2EFQA 3ZMDA 5BS6A 5EEGA 2VT3A 4WXCA 2PFBA 3IWFA 5E8GA 1Z1DA 1FWZA 4UV9A 4HA8A 4ZYEA 3J81K 3GFLA 4ON0A 5BPDA 2VONA 1KGSA 3C18A 3NRVA 4ENNA 1TQMA 1R1VA 2CQKA 3I58A 2EWNA 3KEQA 4LFUA 2HKXA 3RDIA 3KP2A 1ZLJA 3EQLF 5ICFA 4OIPF 4L0YB 2EV6A 4Y17A 4PGGA 2RC4A 2VODA 3WU0A 1KU7A 5LGTA 3GUDA 2M30A 2LF8A 1OMIA 1LDJA 2NAZA 5CYVA 3ROUA 1W7PA 4IRIA 3QRFF 5HS7A 1J7KA 3I64A 4G7OF 1V3FA 2FBHA 1OR7A 5D8KB 2BGCA 3IWZA 2Z99A 1IAWA 2W84A 4MQVA 1CF7A 1O3RA 3VFZA 4P96A 3BOQA 2JZYA 4CICA 5L3CA 2XASA 1F9NA 2V1DA 3LA2A 2OA4A 1P92A 3V7RA 2RQPA 2LF7A 2BV6A 1GVJA 5D5WB 3CUQB 4M6YA 1I6XA 5FD6A 2OZ6A 4M9SA 4L0ZB 3JSPA 2L02A 2NRAC 4YFNF 4ZYDA 3FHZA 3C7JA 1MJBA 2GXBA 5D6FA 2DLLA 4XRFA 5J8FA 1U8RA 3GX4X 3D5LA 1MD0A 1UHWA 5TJJA 3GWZA 2CWEA 2RGVA 4UV8A 4HF1A 2YX7A 1O3SA 4Q48A 2EFNA 1R58A 2XAFA 4M9XA 2KIUA 5FB2A 1T0FA 3PFIA 1J0RA 3V7CA 1XMAA 4LLNA 2A6HF 3VODA 5H20A 1KU3A 2DTRA 4ENKA 2IA0A 5LGUA 1HSTA 2V1UA 1S3JA 1KU9A 1XSDA 2IT0A 4ZZLA 4HV5A 2K02A 2JT1A 1ZARA 2QQBA 1BI2A 1USTA 4U0VA 2CG4A 4RB3C 4R8HA 2VE8A 1MJAA 3BP8A 2EFOA 2Y48A 3ML6A 1SFXA 1YLFA 3QPTA 5H6RA 1UFMA 5D4RA 3KETA 3IL2A 5E17F 5IT3A 2FSWA 4OIRF 1R5GA 2L4AA 5HLIA 3R0AA 1U2WA 2O3FA 1LJ9A 4BAYA 1XN7A 2G7HA 2G7UA 2G9WA 1R7JA 5L3GA 1U5TC 4WF2A 3VB2A 1P2FA 5HDNA 4HF2A 4ZZDA 5BPIA 2Z5UA 5TRDA 3DFGA 3BJOA 3JAMK 2M5WA 4MNUA 1SFEA 2QQ9A 2BE5F 4EV0A 1U78A 1GXQA 3J80K 4L9TA 4KUMA 2XGXA 4BH9A 3I53A 1I5ZA 3U1DA 4RGXA 2XV4S 2CW0F 2WC2A 3M9AA 4IVNA 4RGRA 3ZQ7A 2FNAA 3ZN0A 2XAGA 3R0JA 2DQRA 2K7LA 1U6GA 1MZBA 5E20A 5LBQA 2EV5A 1MDMB 4OIQF 3KLNA 2E1NA 1ZN2A 3ZMVA 1FP2A 4GYGA 2IA1A 1TW2A 1KQ8A 1YO5C 2KIFA 3KP7A 2XIGA 5HS8A 3ELKA 2AXLA 1BC8C 1I1SA 5CVIA 3LAPA 3J80Z 3FM5A 3K69A 3TQNA 1B9NA 4KN4X 1B9MA 1SAXA 3C1DA 3B73A 2TDXA 4L9NA 3JAMZ 3FMRA 1FY7A 3C3WA 1Z6TA 4AIJA 3BROA 3F22A 2MH2A 1P4AA 2VC0A 3GW2A 4MEXF 2HTJA 4LLLA 4RGSA 3SQNA 2IA2A 2D1HA 4IF4A 2KJBA 2DO7A 4BHBA 2P8TA 2YX4A 2F5FA 3RTRA 2RDPA 2XKOA 2ADUA 3LQQA 3HRUA 2FMYA 1J75A 3IC7A 4LB5A 1ZRDA 2EA2A 3Q5FA 2MBFA 5K5OA 5AIQA 3R61A 2NYXA 4CO8A 2JSCA 3QU3A 4JQFA 3QPHA 4UNOA 1QZYA 2HS5A 2OAZA 3KZYA 1T98A 1H9GA 3ZPLA 4R79A 1TNTA 4M71A 2JPBA 1DDNA 1Z91A 5BMZA 4G8XA 1WRJA 3B02A 4I2OA 1PP8F 1JHFA 3P9KA 4G7ZF 1O7LA 3L09A 4P5OA 1S7AA 2DI3A 1XSVA 5LGNA 3HRSA 1S6LA 2P7VB 1E17A 3ZMTA 3Q9SA 2MLGA 3N97A 1XGMA 4BXUA 1STZA 1FYKA 3FZVA 4NHJA 1HW2A 5AIPA 2HYFA 2PG4A 2PEXA 3E6DA 2ZJ2A 3M8FA 3T1BA 1I27A 3HTUA 3RPQA 4L5JA 1I1GA 2QUFA 2PLYA 1Y0UA 3CJNA 3O6BB 3ECOA 1RIOH 4UXNA 4S04A 1SMTA 3IHUA 1FBQA 1O7FA 2PMHA 1Z9CA 4A0ZA 2RV8A 4CXFA 1ZH5A 4FX0A 2F5DA 1SD6A 2MC3A 1XGOA 1IXCA 1FC3A 5L3BA 3JW4A 3QOPA 3EUHA 2OU2A 3WGIA 3V7SA 3DPTA 2FBKA 5BOXA 4NQWA 3DQVC 3F8MA 3DV8A 2O03A 1HKTA 4O6JA 2XAQA 5F6FA 5ILVA 1ONVA 3FXQA 3TOBA 3T5XA 3OV8A 3DKWA 2W85A 2BBYA 2DU9A 4HZFA 1HW5A 2Z3YA 4HBLA 1RZ4A 1DUXC 4I7HA 1ULYA 2DK8A 2STWA 1K79A 1FNNA 2Y0MA 1IN4A 1TQPA 5DV5A 3KFWX 5DD8A 3J7AO 1CF7B 1MDMA 5HOOA 1FBSA 3IRQA 2GA1A 2WWYA 2ACJA 2OBPA 3F6VA 3HIFA 1GXPA 2FOKA 4IRHA 1BC7C 4G94A 1XCBA 4U7DA 4HX7A 3CTAA 1OPCA 2A68F 3WTSC 6PAXA 4KIGA 3F8FA 1DPRA 1P6RA 5CVVA 4EQQA 2ZXJA 3GFJA 4I98B 1XD7A 1MGTA 2HOEA 1P4WA 3V8LA 1E2XA 3GLXA 2UXNA 4KN7X 1QBJA 3ZMUA 3CUQC 1WKMA 1FSEA 2PMUA 2HDCA 3SZPA 5E8IA 1RUNA 4ESFA 3GVAA 1XB4A 5J8CA 1F4KA 3I5UA 4A0YA 1NHAA 3LFKA 1WWXA 2PJPA 3E6BA 3RJPA 2M87A 4UUVA 2QZ8A 3V4GA 2QQAA 3W6KB 3DEUA 3GXOA 4K2EA 2R3SA 2HQNA 4ESJA 4GGGA 4MTDA 4O3MA 3GO5A 4QLCU 2O61A 4DQ2A 2A5YB 5HDKA 1QO0D 1D8JA 4Y13A 5E1WA 5LRRA 1AOYA 3I71A 2COMA 3EETA 3RI4A 4U0YA 2LDUA 4HX8A 1G4DA 2WTEA 3HOSA 1VTNC 1IXSB 2CYYA 2P5VA 1SD7A 2ESHA 1FOKA 3TO9A 2QM3A 1CGPA 5JHUA 2Z33A 2H09A 2VOPA 1BIAA 2RN7A 2R7FA 5LHGA 4EGYA 4WCGA 3F8NA 4HQMA 4HOBA 4L9JA 3SXYA 2A3SA 1IRGA 2E7WA 3WTTC 2GIVA 5HS9A 2HWVA 1UHMA 3P7NA 1BBYA 4A5NA 2NS0A 3K0LA 1ODDA 3RPUA 5E18F 1FZPB 4U0WA 2GQQA 2Y75A 4KT5C 3E97A 1TQIA 2Z9OA 1B6AA 3O3KA 3MEXA 1YFHA 4P9UA 4LK0F 1FSHA 4AVPA 2O6GE 4HYEA 5FLXZ 3MQ0A 2CGPA 4G7HF 4AWXB 1H9TA 3R4KA 1IZ1A 1BM9A 1F5TA 1U5TA 1WI9A 4QWQA 2LKPA 2V1XA 3HRTA 2ZMEA 2LSOA 4EJVA 4EJWA 1ZG3A 2ZBKA 2HGCA 2FE3A 1BI3A 3ULQB 4XLPF 3MAJA 2Q2EA 3RIRA 1YQAA 1FPQA 2VOOA 2OQRA 3KCCA 2QBYB 3NEUA 4ENMA 3KLOA 1LEBA 4KIFA 4B8XA 1G3WA 1O3TA 4UHTA 5EEHA 2IRFG 3NQOA 1Z7UA 1IN7A 3GEZA 2L54A 1EV7A 5K5QA 4HF0A 5D5VB 2P4WA 3WG9A 3TOAA 2PBIA 2QBYA 3BDDA 2DPDA 1KYZA 2GA2A 3K1MA 4ETSA 4WWCA 1LB2A 4KICA 1QZZA 1LDDA 1F1ZA 2EFPA 4JBAA 1KYWA 3VOEA 1HSJA 5BQTA 4DNCA 2ZNYA 3E5UA 4M72A 3BJAA 4WXDA 1Z6RA 4HV6A 4PCQA 2YSRA 4XSXF 3N4MA 2AS5F 1LEAA 2P5KA 5ICGA 3JTHA 1FYLA 4UVCA 1SD5A 1K78B 2CSOA 1LDKB 2C6YA 4MEYF 4L5IA 3V8JA 2Q8KA 1OYIA 1D3YA 2A6EF 3F21A 4Q5SF 2F2EA 2QENA 4KMUX 3V8KA 1K78A 4M6XA 1YTYA 4UVAA 3T8RA 4GO1A 4M9ZA 3MZYA 3ERED 3S2WA 3AAFA 3FMSA 3FXUA 1EH6A 5D5XB 1MJ9A 5E1ZB 1JHHA 2RVCA 3M7GA 1DP7P 3KP6A 1C0WA 2A07F 4A2UA 4BQAA 1SD4A 1K7AA 1EH7A 4IHSA 3QP6A 1D5VA 2DPUA 4N9IA 4I09A 1QPMA 2QWWA 4U7BA 5LRSA 4I02A 1ZRFA 5FO5A 3WE2A 3ZN1A 5DUIA 3QU6A 2QLZA 4R1HA 4HLYA 1DPUA 3GFMA 4RAZA 1XGNA 2VT2A 2GWRA 3QAHA 3DPLC 4CDGA 2GAUA 4YFKF 3KP3A 2A61A 3CO7C 1QQIA 3F72A 4G6DA 2HZTA 2ZMEB 5CVJA 2LNBA 2L3DA 2VXZA 4KMFA 2J5OA 3EYIA 4AIKA 3FWEA 3DF8A 3CO6C 3IKTA 2OQGA 3WU1B 3TO6A 4E70A 2QVOA 2F5CA 2FF4A 2PN6A 3CUOA 3TO7A 3EYYA 3E3VA 3TKYA 2DBBA 1TW3A 3T0YA 3BPXA 1PDNC 4AIHA 3IKVA 3W6JB 4GYIA 2UXXA 5ICEA 2IW5A 2JRTA 1B1BA 1R1UA 2DK5A 2ZO4A 3JSOA 1GHCA 4FT8A 4A0XA 2KJCA 3BY6A 5DYMA 2XHKA 1W5SA 5E1XA 2HYGD 2V79A 3HSRA 5DCFA 1SMYF 1FLIA 2WV0A 5CVRA 5LHHA 1KA8A 1ZRCA 3MZHA 1XGSA 4EJOA 1IW7F 1ZREA 1YS6A 1ON1A 4IHTA 1A04A 2STTA 1XSXA 1JGSA 5HLHA 4EM2A 2FXAA 2ZCWA 4S05A 3GFIA 1H0MA 2ELHA 1W5TA 4YIFA 1HBXG 1G3TA 5KVRA 4KNYA 5AONA 4OU0A 1XDUA 2VBWA 3I59A 4XBFA 1IUYA 1R22A 1RNLA 4PZJA 1W7PB 2VE9A 2MLKA 3H92A 3CLOA 2ISZA 1S7OA 5F64A 1BI1A 1OKRA 2FU4A 1T6SA 3MCZA 4HQEA 4A6DA 1XCVA 1IF1A 4HLXA 1O3QA 2FA5A 4KIBA 4CYDA 1BI0A 2IJLA 5IT9K 4CHUA 1TTYA 2P7CB 3COAC 1HKQA 3RYPA 2A69F 3CUQA 4L18B 4KYWA 1LVAA 5FFXA 2L01A 4U88A 2UWMA 3K9TA 4PGHA 2HQRA 3R60A 2O8XA 1G3YA 5LEJA 3FMQA 3RYRA 3HHHA 4KA4A 2OD5A 4XLNF 1FT9A 4Y15A 3F6OA 3ABUA 2H6BA 1ZG1A 2W24A 4LG0A 4A5MA 4HX4A 3LA3A 1JXSA 3FXRA 1OYWA 3L9FA 3KZZA 3RKYA 5KK1A 4BHCA 1R23A 1T38A 2EV0A 5H6QA 2F5EA 1K6OA 2P5LC 3GZ6A 5DUKA 2DFIA 2HKOA 4FHTA 3H3ZA 1JE8A 4CZZA 2XUBA 2ETHA 3BWGA 2DT5A 4EM0B 1S8NA 1UB9A 2FBIA 2YR2A 3RKXA 1ON2A 2VN2A 3TGNA 4LJZF 3FF5A 2RNJA 1S29A 5K5RA 4Q4ZF 2BYVE 1TBXA 2M8EA 4MQ9F 5FGMA 2K4BA 2M1BA 3LWFA 1R5HA 3U2RA 2EA4A 4N9HA 1LNWA 3T8TA 4LG0B 4MHGA 3WTWC 2MD5A 1YW7A 1ZLKA 1PUEE 3I59B 4A12A 3WTYC 4RB1A 1YS7A 5LLQA 1R1TA 5F1RA 5CLSA 5DEQA 2JPCA 1QNTA 2XAJA 5JVTA 1R36A 1U5TB 3HUGA 3FM3A 2FEZA 1YG2A 4EVIA 5FLXK 1L0OC 2KRFA 5LHIA 1YIOA 3KP5A 3WGGA 4HDVA 2ZKZA 3HYIA 5DCMA 4ASNA 2KIMA 2K4JA 3ISPA 5FD5A 1IXRC 4MTEA 4ESBA 3JTGA 1BJAA 4EMSA 4L9VA 1HQCA 2P6TA 2XROA 5L3EA 5HLGA 3WGHA 3PQJA 4YFXF 2FNPA 4ZYGA 4M74A 4N0BA 3TDUC 2PQ8A 4LD5A 4P9FA 4RAYA 5D4SA 3L2CA 3WE3A 4GCVA 1WSUA 3I54A 3QP5A 4H0EA 4D0PA 5DDGA 1IN6A 3WODF 3K1PA 1TLHB 3KP4A 2DAOA 1ZGJA 2FMLA 3LQRA 2X0LA 2YU3A 3SZTA 1RI7A 4WK8F 1HW1A 2VBXA 2D2WA 2JTVA 3R6SA 1G3SA 2X4HA 4EJTA 3REOA 4EGZA 1Z05A 2CO5A 4I01A 2V9VA 4YG2F 3E6CC 1YYVA 5ILUA 1KU2A 3H3UA 2GZWA 4KFCA 5D5UB 2PI0A 3K1NA 5D6EA 2EB7A 1G6NA 1J2XA 4OMYA 1IRFA 3E5QA 1J59A 2MH9A 2GXGA 2IVMA 4OOIA 4Z2YA 1TNSA 1O57A 3ABTA 4IXAA 4P55A 2D1VA 3FX3A 3TDZC 3GYHX 3L00A 1U3EM 3LA7A 1USSA 2KKOA 3P9IA 3HHGA 3SHFA 1IN5A 2OZUA 3F8CA 1BOAA 3VEPA 2QYOA 5A2QK 2DW4A 3HOTA 1SFUA 4YIIA 4EM1A 4UVBA 2EFWA 4JK1X 4G6QA 2E7XA 1FBUA 5LEKA 4M73A 5CJ9A 2XKPA 4BHPA 1T2KA 3K2ZA 2XRNA 3DXJF 3GZ5A 2J5PA 3RKWA 4O5VA 3G3ZA 3L7WA 5DD4A 1RUOA 5L3DA 1FX7A 4LK1F 4OMZA 4WXHA 4XSZF 4FX4A 3LAJA 5JFRA 5HDGA 3D0SA 1ZG5A 3F3XA 5A2QZ 2YPRA 1UCRA 2BEOA 5L3FA 1W4MA 2Q0OA 2DQLA 5CVUA 1V4RA 2NNNA 2ZFWA 2RKHA 4Q47A 4GXOA 3EDPA 2K27A 1ZGAA 3BPVA 1B4AA 3E5XA 3ZMSA 5K1YA 4RGUA 4RB2C 1MKMA 1X3UA 2XVCA 1D8KA 1HXDA 4ZYHA 3J81Z 5ICCA 1QGPA 2HEOA 3DP7A 3P9CA 3CDHA 4G9YA 2P6SA 3O2PE 3BZ6A 4I0BA 4IJAA 3I4PA 1Q1HA 4F7ZA 2EK5A 4B09A 1KQ9A 1ZYRF 2NNYA 4LLGF 3HTSB 1BN5A 1L3LA 3F23A 2L4MA 1XDSA 3WTZA 2HTSA 3KE2A 4HW0A 2H6CA 3KEOA 3PQKA 4BYYA 2UZKA 5IT9Z 3ECHA 3MFKA 2MA3A 1YW9A 4IPAA 2R7DA 1REPC 3BJ6A 4LB6B 2ZNZA 4ENJA 3ZP5A 4I0AA 4LGWA 1LQ1A 2H27A 1HKSA 1OYYA 3U9GA 1ZAOA 1ZHFA 4RB0A 2HFHA 4ZH4F 2CFXA 5ILSA 4WX9A 4A6EA 2IPQX 2HR3A 2W25A 5JR3A 2E1CA 3OOPA 4LMYA 4RS8A 1EH8A 4OIOF 3F8BA 4NB5A 1PP7U 3GF2A 5JI6A 1AWCA 3HSEA 3SFZA 2VBZA 2H94A 2EJRA 4TV7A 2VC1A 2D45A 2O0YA 3HRMA 4HDUA 1XMKA 3G73A 5HVQC 1B59A 2M45A 3MWMA 2FRHA 4MGRA 1WQ2A 1YW8A 1IN8A 4HAMA 4IRGA 3E6MA 2ESNA 4AD9A 5J6XA 2V6CA 5ED4A 3ZMZA 4OINF 3LSTA 1BIBA 4PDKA 5FFZA 1T39A 3I0TA 1R00A 4CGZA 4EJUA 2XAHA 3WTUC 2ISYA 2IP2A 5D8LB 3WTXC 1FYMA 2FQ3A 5DCMB 3WTVC 2K86A 1W7PD 2W57A 3M1EA 5ERIA 3IRRA 2B0LA 4KDPA 2VBYA 1KQ0A 3M8EA 3Q9VA 1J5YA 1J9IA 1FP1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BNC A;  3HSF A;  1P4X A;  2EFQ A;  3ZMD A;  5BS6 A;  5EEG A;  2VT3 A;  4WXC A;  2PFB A;  3IWF A;  5E8G A;  1Z1D A;  1FWZ A;  4UV9 A;  4HA8 A;  4ZYE A;  3J81 K;  3GFL A;  4ON0 A;  5BPD A;  2VON A;  1KGS A;  3C18 A;  3NRV A;  4ENN A;  1TQM A;  1R1V A;  2CQK A;  3I58 A;  2EWN A;  3KEQ A;  4LFU A;  2HKX A;  3RDI A;  3KP2 A;  1ZLJ A;  3EQL F;  5ICF A;  4OIP F;  4L0Y B;  2EV6 A;  4Y17 A;  4PGG A;  2RC4 A;  2VOD A;  3WU0 A;  1KU7 A;  5LGT A;  3GUD A;  2M30 A;  2LF8 A;  1OMI A;  1LDJ A;  2NAZ A;  5CYV A;  3ROU A;  1W7P A;  4IRI A;  3QRF F;  5HS7 A;  1J7K A;  3I64 A;  4G7O F;  1V3F A;  2FBH A;  1OR7 A;  5D8K B;  2BGC A;  3IWZ A;  2Z99 A;  1IAW A;  2W84 A;  4MQV A;  1CF7 A;  1O3R A;  3VFZ A;  4P96 A;  3BOQ A;  2JZY A;  4CIC A;  5L3C A;  2XAS A;  1F9N A;  2V1D A;  3LA2 A;  2OA4 A;  1P92 A;  3V7R A;  2RQP A;  2LF7 A;  2BV6 A;  1GVJ A;  5D5W B;  3CUQ B;  4M6Y A;  1I6X A;  5FD6 A;  2OZ6 A;  4M9S A;  4L0Z B;  3JSP A;  2L02 A;  2NRA C;  4YFN F;  4ZYD A;  3FHZ A;  3C7J A;  1MJB A;  2GXB A;  5D6F A;  2DLL A;  4XRF A;  5J8F A;  1U8R A;  3GX4 X;  3D5L A;  1MD0 A;  1UHW A;  5TJJ A;  3GWZ A;  2CWE A;  2RGV A;  4UV8 A;  4HF1 A;  2YX7 A;  1O3S A;  4Q48 A;  2EFN A;  1R58 A;  2XAF A;  4M9X A;  2KIU A;  5FB2 A;  1T0F A;  3PFI A;  1J0R A;  3V7C A;  1XMA A;  4LLN A;  2A6H F;  3VOD A;  5H20 A;  1KU3 A;  2DTR A;  4ENK A;  2IA0 A;  5LGU A;  1HST A;  2V1U A;  1S3J A;  1KU9 A;  1XSD A;  2IT0 A;  4ZZL A;  4HV5 A;  2K02 A;  2JT1 A;  1ZAR A;  2QQB A;  1BI2 A;  1UST A;  4U0V A;  2CG4 A;  4RB3 C;  4R8H A;  2VE8 A;  1MJA A;  3BP8 A;  2EFO A;  2Y48 A;  3ML6 A;  1SFX A;  1YLF A;  3QPT A;  5H6R A;  1UFM A;  5D4R A;  3KET A;  3IL2 A;  5E17 F;  5IT3 A;  2FSW A;  4OIR F;  1R5G A;  2L4A A;  5HLI A;  3R0A A;  1U2W A;  2O3F A;  1LJ9 A;  4BAY A;  1XN7 A;  2G7H A;  2G7U A;  2G9W A;  1R7J A;  5L3G A;  1U5T C;  4WF2 A;  3VB2 A;  1P2F A;  5HDN A;  4HF2 A;  4ZZD A;  5BPI A;  2Z5U A;  5TRD A;  3DFG A;  3BJO A;  3JAM K;  2M5W A;  4MNU A;  1SFE A;  2QQ9 A;  2BE5 F;  4EV0 A;  1U78 A;  1GXQ A;  3J80 K;  4L9T A;  4KUM A;  2XGX A;  4BH9 A;  3I53 A;  1I5Z A;  3U1D A;  4RGX A;  2XV4 S;  2CW0 F;  2WC2 A;  3M9A A;  4IVN A;  4RGR A;  3ZQ7 A;  2FNA A;  3ZN0 A;  2XAG A;  3R0J A;  2DQR A;  2K7L A;  1U6G A;  1MZB A;  5E20 A;  5LBQ A;  2EV5 A;  1MDM B;  4OIQ F;  3KLN A;  2E1N A;  1ZN2 A;  3ZMV A;  1FP2 A;  4GYG A;  2IA1 A;  1TW2 A;  1KQ8 A;  1YO5 C;  2KIF A;  3KP7 A;  2XIG A;  5HS8 A;  3ELK A;  2AXL A;  1BC8 C;  1I1S A;  5CVI A;  3LAP A;  3J80 Z;  3FM5 A;  3K69 A;  3TQN A;  1B9N A;  4KN4 X;  1B9M A;  1SAX A;  3C1D A;  3B73 A;  2TDX A;  4L9N A;  3JAM Z;  3FMR A;  1FY7 A;  3C3W A;  1Z6T A;  4AIJ A;  3BRO A;  3F22 A;  2MH2 A;  1P4A A;  2VC0 A;  3GW2 A;  4MEX F;  2HTJ A;  4LLL A;  4RGS A;  3SQN A;  2IA2 A;  2D1H A;  4IF4 A;  2KJB A;  2DO7 A;  4BHB A;  2P8T A;  2YX4 A;  2F5F A;  3RTR A;  2RDP A;  2XKO A;  2ADU A;  3LQQ A;  3HRU A;  2FMY A;  1J75 A;  3IC7 A;  4LB5 A;  1ZRD A;  2EA2 A;  3Q5F A;  2MBF A;  5K5O A;  5AIQ A;  3R61 A;  2NYX A;  4CO8 A;  2JSC A;  3QU3 A;  4JQF A;  3QPH A;  4UNO A;  1QZY A;  2HS5 A;  2OAZ A;  3KZY A;  1T98 A;  1H9G A;  3ZPL A;  4R79 A;  1TNT A;  4M71 A;  2JPB A;  1DDN A;  1Z91 A;  5BMZ A;  4G8X A;  1WRJ A;  3B02 A;  4I2O A;  1PP8 F;  1JHF A;  3P9K A;  4G7Z F;  1O7L A;  3L09 A;  4P5O A;  1S7A A;  2DI3 A;  1XSV A;  5LGN A;  3HRS A;  1S6L A;  2P7V B;  1E17 A;  3ZMT A;  3Q9S A;  2MLG A;  3N97 A;  1XGM A;  4BXU A;  1STZ A;  1FYK A;  3FZV A;  4NHJ A;  1HW2 A;  5AIP A;  2HYF A;  2PG4 A;  2PEX A;  3E6D A;  2ZJ2 A;  3M8F A;  3T1B A;  1I27 A;  3HTU A;  3RPQ A;  4L5J A;  1I1G A;  2QUF A;  2PLY A;  1Y0U A;  3CJN A;  3O6B B;  3ECO A;  1RIO H;  4UXN A;  4S04 A;  1SMT A;  3IHU A;  1FBQ A;  1O7F A;  2PMH A;  1Z9C A;  4A0Z A;  2RV8 A;  4CXF A;  1ZH5 A;  4FX0 A;  2F5D A;  1SD6 A;  2MC3 A;  1XGO A;  1IXC A;  1FC3 A;  5L3B A;  3JW4 A;  3QOP A;  3EUH A;  2OU2 A;  3WGI A;  3V7S A;  3DPT A;  2FBK A;  5BOX A;  4NQW A;  3DQV C;  3F8M A;  3DV8 A;  2O03 A;  1HKT A;  4O6J A;  2XAQ A;  5F6F A;  5ILV A;  1ONV A;  3FXQ A;  3TOB A;  3T5X A;  3OV8 A;  3DKW A;  2W85 A;  2BBY A;  2DU9 A;  4HZF A;  1HW5 A;  2Z3Y A;  4HBL A;  1RZ4 A;  1DUX C;  4I7H A;  1ULY A;  2DK8 A;  2STW A;  1K79 A;  1FNN A;  2Y0M A;  1IN4 A;  1TQP A;  5DV5 A;  3KFW X;  5DD8 A;  3J7A O;  1CF7 B;  1MDM A;  5HOO A;  1FBS A;  3IRQ A;  2GA1 A;  2WWY A;  2ACJ A;  2OBP A;  3F6V A;  3HIF A;  1GXP A;  2FOK A;  4IRH A;  1BC7 C;  4G94 A;  1XCB A;  4U7D A;  4HX7 A;  3CTA A;  1OPC A;  2A68 F;  3WTS C;  6PAX A;  4KIG A;  3F8F A;  1DPR A;  1P6R A;  5CVV A;  4EQQ A;  2ZXJ A;  3GFJ A;  4I98 B;  1XD7 A;  1MGT A;  2HOE A;  1P4W A;  3V8L A;  1E2X A;  3GLX A;  2UXN A;  4KN7 X;  1QBJ A;  3ZMU A;  3CUQ C;  1WKM A;  1FSE A;  2PMU A;  2HDC A;  3SZP A;  5E8I A;  1RUN A;  4ESF A;  3GVA A;  1XB4 A;  5J8C A;  1F4K A;  3I5U A;  4A0Y A;  1NHA A;  3LFK A;  1WWX A;  2PJP A;  3E6B A;  3RJP A;  2M87 A;  4UUV A;  2QZ8 A;  3V4G A;  2QQA A;  3W6K B;  3DEU A;  3GXO A;  4K2E A;  2R3S A;  2HQN A;  4ESJ A;  4GGG A;  4MTD A;  4O3M A;  3GO5 A;  4QLC U;  2O61 A;  4DQ2 A;  2A5Y B;  5HDK A;  1QO0 D;  1D8J A;  4Y13 A;  5E1W A;  5LRR A;  1AOY A;  3I71 A;  2COM A;  3EET A;  3RI4 A;  4U0Y A;  2LDU A;  4HX8 A;  1G4D A;  2WTE A;  3HOS A;  1VTN C;  1IXS B;  2CYY A;  2P5V A;  1SD7 A;  2ESH A;  1FOK A;  3TO9 A;  2QM3 A;  1CGP A;  5JHU A;  2Z33 A;  2H09 A;  2VOP A;  1BIA A;  2RN7 A;  2R7F A;  5LHG A;  4EGY A;  4WCG A;  3F8N A;  4HQM A;  4HOB A;  4L9J A;  3SXY A;  2A3S A;  1IRG A;  2E7W A;  3WTT C;  2GIV A;  5HS9 A;  2HWV A;  1UHM A;  3P7N A;  1BBY A;  4A5N A;  2NS0 A;  3K0L A;  1ODD A;  3RPU A;  5E18 F;  1FZP B;  4U0W A;  2GQQ A;  2Y75 A;  4KT5 C;  3E97 A;  1TQI A;  2Z9O A;  1B6A A;  3O3K A;  3MEX A;  1YFH A;  4P9U A;  4LK0 F;  1FSH A;  4AVP A;  2O6G E;  4HYE A;  5FLX Z;  3MQ0 A;  2CGP A;  4G7H F;  4AWX B;  1H9T A;  3R4K A;  1IZ1 A;  1BM9 A;  1F5T A;  1U5T A;  1WI9 A;  4QWQ A;  2LKP A;  2V1X A;  3HRT A;  2ZME A;  2LSO A;  4EJV A;  4EJW A;  1ZG3 A;  2ZBK A;  2HGC A;  2FE3 A;  1BI3 A;  3ULQ B;  4XLP F;  3MAJ A;  2Q2E A;  3RIR A;  1YQA A;  1FPQ A;  2VOO A;  2OQR A;  3KCC A;  2QBY B;  3NEU A;  4ENM A;  3KLO A;  1LEB A;  4KIF A;  4B8X A;  1G3W A;  1O3T A;  4UHT A;  5EEH A;  2IRF G;  3NQO A;  1Z7U A;  1IN7 A;  3GEZ A;  2L54 A;  1EV7 A;  5K5Q A;  4HF0 A;  5D5V B;  2P4W A;  3WG9 A;  3TOA A;  2PBI A;  2QBY A;  3BDD A;  2DPD A;  1KYZ A;  2GA2 A;  3K1M A;  4ETS A;  4WWC A;  1LB2 A;  4KIC A;  1QZZ A;  1LDD A;  1F1Z A;  2EFP A;  4JBA A;  1KYW A;  3VOE A;  1HSJ A;  5BQT A;  4DNC A;  2ZNY A;  3E5U A;  4M72 A;  3BJA A;  4WXD A;  1Z6R A;  4HV6 A;  4PCQ A;  2YSR A;  4XSX F;  3N4M A;  2AS5 F;  1LEA A;  2P5K A;  5ICG A;  3JTH A;  1FYL A;  4UVC A;  1SD5 A;  1K78 B;  2CSO A;  1LDK B;  2C6Y A;  4MEY F;  4L5I A;  3V8J A;  2Q8K A;  1OYI A;  1D3Y A;  2A6E F;  3F21 A;  4Q5S F;  2F2E A;  2QEN A;  4KMU X;  3V8K A;  1K78 A;  4M6X A;  1YTY A;  4UVA A;  3T8R A;  4GO1 A;  4M9Z A;  3MZY A;  3ERE D;  3S2W A;  3AAF A;  3FMS A;  3FXU A;  1EH6 A;  5D5X B;  1MJ9 A;  5E1Z B;  1JHH A;  2RVC A;  3M7G A;  1DP7 P;  3KP6 A;  1C0W A;  2A07 F;  4A2U A;  4BQA A;  1SD4 A;  1K7A A;  1EH7 A;  4IHS A;  3QP6 A;  1D5V A;  2DPU A;  4N9I A;  4I09 A;  1QPM A;  2QWW A;  4U7B A;  5LRS A;  4I02 A;  1ZRF A;  5FO5 A;  3WE2 A;  3ZN1 A;  5DUI A;  3QU6 A;  2QLZ A;  4R1H A;  4HLY A;  1DPU A;  3GFM A;  4RAZ A;  1XGN A;  2VT2 A;  2GWR A;  3QAH A;  3DPL C;  4CDG A;  2GAU A;  4YFK F;  3KP3 A;  2A61 A;  3CO7 C;  1QQI A;  3F72 A;  4G6D A;  2HZT A;  2ZME B;  5CVJ A;  2LNB A;  2L3D A;  2VXZ A;  4KMF A;  2J5O A;  3EYI A;  4AIK A;  3FWE A;  3DF8 A;  3CO6 C;  3IKT A;  2OQG A;  3WU1 B;  3TO6 A;  4E70 A;  2QVO A;  2F5C A;  2FF4 A;  2PN6 A;  3CUO A;  3TO7 A;  3EYY A;  3E3V A;  3TKY A;  2DBB A;  1TW3 A;  3T0Y A;  3BPX A;  1PDN C;  4AIH A;  3IKV A;  3W6J B;  4GYI A;  2UXX A;  5ICE A;  2IW5 A;  2JRT A;  1B1B A;  1R1U A;  2DK5 A;  2ZO4 A;  3JSO A;  1GHC A;  4FT8 A;  4A0X A;  2KJC A;  3BY6 A;  5DYM A;  2XHK A;  1W5S A;  5E1X A;  2HYG D;  2V79 A;  3HSR A;  5DCF A;  1SMY F;  1FLI A;  2WV0 A;  5CVR A;  5LHH A;  1KA8 A;  1ZRC A;  3MZH A;  1XGS A;  4EJO A;  1IW7 F;  1ZRE A;  1YS6 A;  1ON1 A;  4IHT A;  1A04 A;  2STT A;  1XSX A;  1JGS A;  5HLH A;  4EM2 A;  2FXA A;  2ZCW A;  4S05 A;  3GFI A;  1H0M A;  2ELH A;  1W5T A;  4YIF A;  1HBX G;  1G3T A;  5KVR A;  4KNY A;  5AON A;  4OU0 A;  1XDU A;  2VBW A;  3I59 A;  4XBF A;  1IUY A;  1R22 A;  1RNL A;  4PZJ A;  1W7P B;  2VE9 A;  2MLK A;  3H92 A;  3CLO A;  2ISZ A;  1S7O A;  5F64 A;  1BI1 A;  1OKR A;  2FU4 A;  1T6S A;  3MCZ A;  4HQE A;  4A6D A;  1XCV A;  1IF1 A;  4HLX A;  1O3Q A;  2FA5 A;  4KIB A;  4CYD A;  1BI0 A;  2IJL A;  5IT9 K;  4CHU A;  1TTY A;  2P7C B;  3COA C;  1HKQ A;  3RYP A;  2A69 F;  3CUQ A;  4L18 B;  4KYW A;  1LVA A;  5FFX A;  2L01 A;  4U88 A;  2UWM A;  3K9T A;  4PGH A;  2HQR A;  3R60 A;  2O8X A;  1G3Y A;  5LEJ A;  3FMQ A;  3RYR A;  3HHH A;  4KA4 A;  2OD5 A;  4XLN F;  1FT9 A;  4Y15 A;  3F6O A;  3ABU A;  2H6B A;  1ZG1 A;  2W24 A;  4LG0 A;  4A5M A;  4HX4 A;  3LA3 A;  1JXS A;  3FXR A;  1OYW A;  3L9F A;  3KZZ A;  3RKY A;  5KK1 A;  4BHC A;  1R23 A;  1T38 A;  2EV0 A;  5H6Q A;  2F5E A;  1K6O A;  2P5L C;  3GZ6 A;  5DUK A;  2DFI A;  2HKO A;  4FHT A;  3H3Z A;  1JE8 A;  4CZZ A;  2XUB A;  2ETH A;  3BWG A;  2DT5 A;  4EM0 B;  1S8N A;  1UB9 A;  2FBI A;  2YR2 A;  3RKX A;  1ON2 A;  2VN2 A;  3TGN A;  4LJZ F;  3FF5 A;  2RNJ A;  1S29 A;  5K5R A;  4Q4Z F;  2BYV E;  1TBX A;  2M8E A;  4MQ9 F;  5FGM A;  2K4B A;  2M1B A;  3LWF A;  1R5H A;  3U2R A;  2EA4 A;  4N9H A;  1LNW A;  3T8T A;  4LG0 B;  4MHG A;  3WTW C;  2MD5 A;  1YW7 A;  1ZLK A;  1PUE E;  3I59 B;  4A12 A;  3WTY C;  4RB1 A;  1YS7 A;  5LLQ A;  1R1T A;  5F1R A;  5CLS A;  5DEQ A;  2JPC A;  1QNT A;  2XAJ A;  5JVT A;  1R36 A;  1U5T B;  3HUG A;  3FM3 A;  2FEZ A;  1YG2 A;  4EVI A;  5FLX K;  1L0O C;  2KRF A;  5LHI A;  1YIO A;  3KP5 A;  3WGG A;  4HDV A;  2ZKZ A;  3HYI A;  5DCM A;  4ASN A;  2KIM A;  2K4J A;  3ISP A;  5FD5 A;  1IXR C;  4MTE A;  4ESB A;  3JTG A;  1BJA A;  4EMS A;  4L9V A;  1HQC A;  2P6T A;  2XRO A;  5L3E A;  5HLG A;  3WGH A;  3PQJ A;  4YFX F;  2FNP A;  4ZYG A;  4M74 A;  4N0B A;  3TDU C;  2PQ8 A;  4LD5 A;  4P9F A;  4RAY A;  5D4S A;  3L2C A;  3WE3 A;  4GCV A;  1WSU A;  3I54 A;  3QP5 A;  4H0E A;  4D0P A;  5DDG A;  1IN6 A;  3WOD F;  3K1P A;  1TLH B;  3KP4 A;  2DAO A;  1ZGJ A;  2FML A;  3LQR A;  2X0L A;  2YU3 A;  3SZT A;  1RI7 A;  4WK8 F;  1HW1 A;  2VBX A;  2D2W A;  2JTV A;  3R6S A;  1G3S A;  2X4H A;  4EJT A;  3REO A;  4EGZ A;  1Z05 A;  2CO5 A;  4I01 A;  2V9V A;  4YG2 F;  3E6C C;  1YYV A;  5ILU A;  1KU2 A;  3H3U A;  2GZW A;  4KFC A;  5D5U B;  2PI0 A;  3K1N A;  5D6E A;  2EB7 A;  1G6N A;  1J2X A;  4OMY A;  1IRF A;  3E5Q A;  1J59 A;  2MH9 A;  2GXG A;  2IVM A;  4OOI A;  4Z2Y A;  1TNS A;  1O57 A;  3ABT A;  4IXA A;  4P55 A;  2D1V A;  3FX3 A;  3TDZ C;  3GYH X;  3L00 A;  1U3E M;  3LA7 A;  1USS A;  2KKO A;  3P9I A;  3HHG A;  3SHF A;  1IN5 A;  2OZU A;  3F8C A;  1BOA A;  3VEP A;  2QYO A;  5A2Q K;  2DW4 A;  3HOT A;  1SFU A;  4YII A;  4EM1 A;  4UVB A;  2EFW A;  4JK1 X;  4G6Q A;  2E7X A;  1FBU A;  5LEK A;  4M73 A;  5CJ9 A;  2XKP A;  4BHP A;  1T2K A;  3K2Z A;  2XRN A;  3DXJ F;  3GZ5 A;  2J5P A;  3RKW A;  4O5V A;  3G3Z A;  3L7W A;  5DD4 A;  1RUO A;  5L3D A;  1FX7 A;  4LK1 F;  4OMZ A;  4WXH A;  4XSZ F;  4FX4 A;  3LAJ A;  5JFR A;  5HDG A;  3D0S A;  1ZG5 A;  3F3X A;  5A2Q Z;  2YPR A;  1UCR A;  2BEO A;  5L3F A;  1W4M A;  2Q0O A;  2DQL A;  5CVU A;  1V4R A;  2NNN A;  2ZFW A;  2RKH A;  4Q47 A;  4GXO A;  3EDP A;  2K27 A;  1ZGA A;  3BPV A;  1B4A A;  3E5X A;  3ZMS A;  5K1Y A;  4RGU A;  4RB2 C;  1MKM A;  1X3U A;  2XVC A;  1D8K A;  1HXD A;  4ZYH A;  3J81 Z;  5ICC A;  1QGP A;  2HEO A;  3DP7 A;  3P9C A;  3CDH A;  4G9Y A;  2P6S A;  3O2P E;  3BZ6 A;  4I0B A;  4IJA A;  3I4P A;  1Q1H A;  4F7Z A;  2EK5 A;  4B09 A;  1KQ9 A;  1ZYR F;  2NNY A;  4LLG F;  3HTS B;  1BN5 A;  1L3L A;  3F23 A;  2L4M A;  1XDS A;  3WTZ A;  2HTS A;  3KE2 A;  4HW0 A;  2H6C A;  3KEO A;  3PQK A;  4BYY A;  2UZK A;  5IT9 Z;  3ECH A;  3MFK A;  2MA3 A;  1YW9 A;  4IPA A;  2R7D A;  1REP C;  3BJ6 A;  4LB6 B;  2ZNZ A;  4ENJ A;  3ZP5 A;  4I0A A;  4LGW A;  1LQ1 A;  2H27 A;  1HKS A;  1OYY A;  3U9G A;  1ZAO A;  1ZHF A;  4RB0 A;  2HFH A;  4ZH4 F;  2CFX A;  5ILS A;  4WX9 A;  4A6E A;  2IPQ X;  2HR3 A;  2W25 A;  5JR3 A;  2E1C A;  3OOP A;  4LMY A;  4RS8 A;  1EH8 A;  4OIO F;  3F8B A;  4NB5 A;  1PP7 U;  3GF2 A;  5JI6 A;  1AWC A;  3HSE A;  3SFZ A;  2VBZ A;  2H94 A;  2EJR A;  4TV7 A;  2VC1 A;  2D45 A;  2O0Y A;  3HRM A;  4HDU A;  1XMK A;  3G73 A;  5HVQ C;  1B59 A;  2M45 A;  3MWM A;  2FRH A;  4MGR A;  1WQ2 A;  1YW8 A;  1IN8 A;  4HAM A;  4IRG A;  3E6M A;  2ESN A;  4AD9 A;  5J6X A;  2V6C A;  5ED4 A;  3ZMZ A;  4OIN F;  3LST A;  1BIB A;  4PDK A;  5FFZ A;  1T39 A;  3I0T A;  1R00 A;  4CGZ A;  4EJU A;  2XAH A;  3WTU C;  2ISY A;  2IP2 A;  5D8L B;  3WTX C;  1FYM A;  2FQ3 A;  5DCM B;  3WTV C;  2K86 A;  1W7P D;  2W57 A;  3M1E A;  5ERI A;  3IRR A;  2B0L A;  4KDP A;  2VBY A;  1KQ0 A;  3M8E A;  3Q9V A;  1J5Y A;  1J9I A;  1FP1 D; 
#chains in the Genus database with same CATH topology
 4BNC A;  3D5S C;  4B48 A;  3ONQ A;  5CQG A;  3OYH A;  3BG6 A;  3HSF A;  2E2J J;  1P4X A;  4F3Q A;  3G1O A;  5J3L A;  3TED A;  2EFQ A;  3ZMD A;  2GBY A;  2JJ7 A;  5FKM A;  5BS6 A;  5EEG A;  2VT3 A;  2HDD A;  4WXC A;  4A3D J;  5EGO A;  2PFB A;  3IWF A;  5E8G A;  1Z1D A;  3BG7 A;  1FWZ A;  4UV9 A;  3OOU A;  4HA8 A;  3LSH A;  3KIO A;  2E36 A;  4ZYE A;  5H2F C;  4B1R A;  3TP3 A;  3BCB A;  3ZQI A;  3J81 K;  1NTC A;  3GFL A;  4ON0 A;  4CCJ A;  5BPD A;  2VON A;  3FXK A;  3H1C A;  1KGS A;  3C18 A;  1S9H A;  3OYG A;  4LIV A;  3NRV A;  1TC3 C;  4ENN A;  1TQM A;  1Z7L A;  1DP3 A;  1R1V A;  1MMD A;  3AG1 H;  4PJ0 C;  1BR1 A;  3SDB A;  2CQK A;  3EUK L;  1OCZ H;  3I58 A;  2DT7 B;  2FD5 A;  2LKS A;  2EWN A;  3LSG A;  1G59 A;  4BY1 J;  1BW6 A;  4A3B J;  1LUJ B;  3KEQ A;  4S0H B;  1ENH A;  4LFU A;  1PUF A;  2HKX A;  3RDI A;  3KP2 A;  4IHV A;  2F48 A;  1ZLJ A;  3EQL F;  5ICF A;  3HG9 A;  1SAN A;  2AXT C;  4OIP F;  5E3L A;  3M07 A;  3OYA A;  4L0Y B;  2EV6 A;  1TL8 A;  5E79 C;  3BTL A;  2K3P A;  5IP6 A;  4Y17 A;  4PGG A;  2JN6 A;  4CSW A;  2RC4 A;  2VOD A;  2CV2 A;  5HNF A;  4IL6 C;  3WU0 A;  1KU7 A;  1YRN B;  1FEX A;  5LGT A;  2HOA A;  3GUD A;  4J01 A;  2M30 A;  4HSR A;  4QPO A;  1IJW C;  2LF8 A;  4U87 A;  1X2M A;  1OMI A;  1LDJ A;  2O5R A;  2NAZ A;  2Q1Z B;  4IEJ A;  4IQJ A;  5J47 A;  5CYV A;  2ME6 A;  3ROU A;  3MKZ A;  1W7P A;  3CLQ A;  4YEL A;  1SC7 A;  2R0Q C;  4IRI A;  3S2H J;  3QRF F;  5HS7 A;  1J7K A;  3I64 A;  4G7O F;  2GOM A;  1V3F A;  2FBH A;  1VZ0 A;  1OR7 A;  2DMN A;  2L9V A;  1TWG J;  5D8K B;  1MSF C;  2BGC A;  3CJQ B;  3RPU D;  2XGD A;  1WVR A;  3IWZ A;  2Z99 A;  1IAW A;  1K61 A;  2W84 A;  4MQV A;  2ECC A;  1CF7 A;  5EG0 B;  1ZR4 A;  1O3R A;  3VFZ A;  1K83 J;  1MMG A;  4ZC3 A;  4P96 A;  3BOQ A;  2B7E A;  2JZY A;  2V1N A;  4CIC A;  3BT9 A;  1IC8 A;  5L3C A;  1QVT A;  1S5L C;  2XAS A;  1V55 H;  2QSH X;  4DZP A;  1F9N A;  2V1D A;  2F6C A;  3LA2 A;  1JKP C;  2OA4 A;  2KZV A;  1P92 A;  3V7R A;  2RQP A;  4NBQ A;  4E7S A;  1VQL I;  1RPW A;  2LY9 A;  3VYR B;  2LF7 A;  5EZH A;  2BZT A;  4XKW A;  1EF4 A;  1V5E A;  2BV6 A;  4E6K G;  3S93 A;  1M1E B;  2X1D A;  1GVJ A;  2R92 J;  5D5W B;  1FJL A;  3CUQ B;  4M6Y A;  1I6X A;  1FIP A;  5FD6 A;  3CF2 A;  1E3P A;  2OZ6 A;  2M3A A;  2L5Q A;  4QTR A;  3LL7 A;  4M9S A;  3JSP A;  4L0Z B;  2L02 A;  2Y69 H;  3BR0 A;  2NRA C;  4YFN F;  4ZYD A;  3FHZ A;  3C7J A;  2KQR A;  5TGT A;  3EUH C;  2ELJ A;  2W82 A;  1MJB A;  2ZME C;  2JRM A;  2ZXH A;  2MSY A;  2GXB A;  4XOP A;  1K4S A;  5D6F A;  2DLL A;  4V19 K;  3OYJ A;  2DDB A;  4XRF A;  2K40 A;  1TWH J;  3PUB A;  5J8F A;  2WAQ N;  4PSX A;  4IHW A;  4MIM A;  2W7N A;  1U8R A;  3ZOB A;  3GX4 X;  3D5L A;  4PJN A;  1MD0 A;  1UHW A;  1I3Q J;  1Y0N A;  4XIC A;  5TJJ A;  3GWZ A;  3DU5 A;  1MBE A;  1SVM A;  2CWE A;  1HA8 A;  2RGV A;  4UV8 A;  1X3Z B;  2M2E A;  4HF1 A;  2YX7 A;  1MNM C;  1O3S A;  4Q48 A;  2EFN A;  1R58 A;  2XAF A;  3BTI A;  2IGM A;  3MVP A;  4M9X A;  4B3A A;  2KIU A;  5FB2 A;  1T0F A;  2R93 J;  3PFI A;  3K70 D;  5GP9 A;  1J0R A;  3V7C A;  2AQE A;  2N8G A;  4PUS A;  1XMA A;  1T56 A;  4LLN A;  2A6H F;  4PFP A;  3VOD A;  2DA5 A;  2VL8 A;  3EPZ A;  5H20 A;  1KU3 A;  2OTJ I;  2DTR A;  2HPI A;  4DYQ A;  2R7X A;  2E5N A;  2NVU B;  4ENK A;  2IA0 A;  5LGU A;  4CYC B;  1HST A;  3MD2 A;  3DLL F;  2V1U A;  4BE0 A;  4UUS A;  3BZK A;  1S3J A;  5K7Z A;  1KU9 A;  2P0W A;  1VQ8 I;  3NAR A;  3GTK J;  2FX0 A;  4XR6 A;  1XSD A;  2IT0 A;  4ZZL A;  1TP4 A;  2WY7 Q;  4HV5 A;  1X1P A;  5C4J J;  2YU9 J;  2K02 A;  3ZR8 X;  5M5X J;  3SJM A;  1SFK A;  3K4B A;  4C30 A;  1G2H A;  2CS3 A;  3CCS I;  2JT1 A;  2Z2S B;  3HOZ J;  1ZAR A;  2MC4 A;  2XGE A;  2QQB A;  1BI2 A;  2CUZ A;  1JKO C;  3LOC A;  4P1W A;  1UST A;  4U0V A;  4RLF A;  2CG4 A;  2P0T A;  4I6Z A;  2HQ5 A;  2K85 A;  2MVT A;  3ZQL A;  4RB3 C;  4R8H A;  2VE8 A;  3TP0 A;  3CCU I;  1MJA A;  3BP8 A;  4B44 A;  2EFO A;  2Y48 A;  4NNJ A;  2KRC A;  3ML6 A;  3S32 A;  1SFX A;  1YLF A;  1H8A C;  3QPT A;  5H6R A;  1UFM A;  2KLO A;  3PM1 A;  3CP2 A;  1WJF A;  5D4R A;  3K6G A;  3Q3S A;  3OWT A;  2X6Y A;  3PIP F;  3KET A;  3BZC A;  2M7B A;  3IL2 A;  5E17 F;  5IT3 A;  5EF6 A;  1MBF A;  3HDD A;  1WI3 A;  2FSW A;  2HYJ A;  4OIR F;  3H9Q A;  1R5G A;  1QU3 A;  2L4A A;  1FTT A;  3G71 I;  5CKT A;  1ZK8 A;  4XN3 A;  3JRC A;  3O8H A;  1I3A A;  5HLI A;  4M3B A;  2DTZ A;  3R0A A;  1U2W A;  3PFY A;  2O3F A;  5JVG F;  1D1C A;  3K70 C;  1LJ9 A;  4M6V A;  4BAY A;  5HOD A;  1UG0 A;  3L2W A;  2Y9Z A;  4JYK A;  4GFB A;  5K7F A;  2HNH A;  2QKL B;  4W1U A;  1XN7 A;  2G7H A;  2XPW A;  2G7U A;  3OMY A;  2G9W A;  1OCT C;  3KYL A;  1R7J A;  4CA0 A;  5FRM A;  1Y56 A;  3A0H C;  1U5T C;  3KYC B;  5L3G A;  4WF2 A;  3GTP J;  1IV8 A;  3DTE A;  3VB2 A;  1P2F A;  4D5C A;  3A4C A;  1FOX A;  5HDN A;  4HF2 A;  4ZZD A;  5BPI A;  1JUM A;  2Z5U A;  5IOY A;  3DFG A;  3BJO A;  3JAM K;  3L2Q A;  5TRD A;  2M5W A;  4XOT A;  4XN0 A;  2VIX A;  3GCM A;  4BU2 A;  2UUZ A;  5TIS C;  4C3J J;  4MNU A;  3BTC A;  5CPR B;  5IPA A;  3HB9 A;  4A3C J;  3JAM R;  3HEF A;  1RKW A;  3GZN B;  1SFE A;  2QQ9 A;  2BE5 F;  4ZYA A;  4EV0 A;  1U78 A;  3HGY A;  1GXQ A;  2QA4 I;  1MSE C;  3J80 K;  4L9T A;  1TT0 A;  1AHD P;  4KUM A;  1P9Q C;  2DDA A;  2XGX A;  5KNL A;  1N77 A;  2R5Y B;  4BH9 A;  4D1Q A;  2DA3 A;  1D0Y A;  2GLO A;  3I53 A;  1I5Z A;  3U1D A;  4BJ5 C;  4RGX A;  2QEX I;  2XV4 S;  4XNF A;  2CW0 F;  2WC2 A;  1Z3Y A;  1V54 H;  2OC6 A;  3M9A A;  1ZR2 A;  1DGR M;  4IVN A;  3H5N A;  5M3F J;  4RGR A;  1U0J A;  3ZQ7 A;  2FNA A;  4KT6 A;  5J1U A;  3ZN0 A;  1Y1V J;  4RM2 A;  2XAG A;  2GIZ A;  3R0J A;  2DQR A;  2K7L A;  3DKX A;  3PUF A;  2WV1 A;  3L2V A;  2JA7 J;  1U6G A;  2DFF A;  1MZB A;  5E20 A;  3CCR I;  4RMN A;  5LBQ A;  2NVT J;  2EV5 A;  2KRH A;  4I99 C;  3BG5 A;  1QRY A;  3H9G A;  1MDM B;  3KX2 A;  4OIQ F;  2HZD A;  2HI3 A;  2NVX J;  1XX5 A;  3KLN A;  2E1N A;  4N4O B;  2CU7 A;  2VJ4 A;  1A5J A;  4C9Y A;  1ZN2 A;  3ZMV A;  1FP2 A;  4GYG A;  5M3M J;  2IA1 A;  3CJT B;  2X98 A;  1TW2 A;  5LD2 C;  4MLO A;  1KQ8 A;  3W2V A;  3MKL A;  1YO5 C;  2KIF A;  3KP7 A;  2XIG A;  5HS8 A;  3ELK A;  2AXL A;  1BC8 C;  1I1S A;  4PSW A;  5CVI A;  3LAP A;  3J80 Z;  1WH7 A;  3FM5 A;  3K69 A;  3TQN A;  3LSK A;  3OS1 A;  1B9N A;  3JRE A;  4KN4 X;  4BE1 A;  1B9M A;  1SAX A;  4HNV A;  3C1D A;  3B73 A;  2TDX A;  4L9N A;  2PX9 A;  3SEQ A;  4XON A;  2H8W A;  2R7S A;  3JAM Z;  5E3O A;  1BL0 A;  3FMR A;  2DOD A;  1U8B A;  2MD0 A;  1FY7 A;  1UZC A;  2DA4 A;  3H0D A;  3C3W A;  1SEU A;  1WJE A;  1Z6T A;  4AIJ A;  3BRO A;  5FKL A;  1DQU A;  4QSH A;  2W4S A;  2MH2 A;  2VC0 A;  1P4A A;  3F22 A;  3GW2 A;  3HZJ A;  4MEX F;  2HTJ A;  2LOO A;  4E7Z A;  2I5U A;  5F1J A;  3GTO J;  1S7E A;  4LLL A;  1EJ9 A;  2CUF A;  2ZJR F;  2CQX A;  4RGS A;  5DS9 A;  3SQN A;  4BAC A;  4DBR A;  1U9O A;  2IA2 A;  2D1H A;  4IF4 A;  4HRI A;  3CME I;  2KJB A;  2MFZ A;  3CCY A;  2DO7 A;  4BHB A;  2IBD A;  3FKI J;  2P8T A;  2YX4 A;  2F5F A;  3RTR A;  4LIU A;  2RDP A;  2XKO A;  1YI2 I;  2ADU A;  3JRI A;  3LQQ A;  5GTI C;  3HRU A;  1WCM J;  2FMY A;  1J75 A;  3IC7 A;  4LB5 A;  1ZRD A;  1FIA A;  1MH4 A;  2CUE A;  2EA2 A;  5FLX R;  4ABZ A;  1JUS A;  1ZQ3 P;  1GDT A;  4A93 J;  1UAA A;  3Q5F A;  1R4N B;  2MBF A;  5K5O A;  5AIQ A;  3R61 A;  2I8D A;  2NYX A;  4CO8 A;  2JSC A;  3QU3 A;  4JQF A;  1NG6 A;  3QPH A;  4UNO A;  1QZY A;  4ZDO A;  2V4J C;  2DA7 A;  4E7H A;  2HS5 A;  4FE4 A;  2OAZ A;  3KZY A;  1T98 A;  1H9G A;  3OYF A;  3ZPL A;  3HPG A;  4R79 A;  1TNT A;  4M71 A;  1LFB A;  3OYD A;  2LR8 A;  1WPK A;  2JPB A;  1DDN A;  3GLL A;  1Z91 A;  3FXO A;  1BA5 A;  2L7M P;  5BMZ A;  1R5I D;  2CRG A;  4G8X A;  1WRJ A;  3B02 A;  4I2O A;  5IYC J;  1X1A A;  3OIQ A;  1PP8 F;  4GDF A;  1JHF A;  5B5E C;  3P9K A;  4DZJ A;  4G7Z F;  1QPI A;  1Y39 A;  3ZQH A;  1O7L A;  3L09 A;  4P5O A;  2O9L A;  1S7A A;  2DI3 A;  1XSV A;  5KAF C;  3HRS A;  5LGN A;  2XF6 A;  1S6L A;  2P7V B;  3OYL A;  4BJ6 C;  3ZMT A;  3Q9S A;  1K4T A;  2MLG A;  1E17 A;  3N97 A;  3IP4 B;  1XGM A;  4BXU A;  4AYB N;  1STZ A;  2R5Z B;  1FYK A;  3RQ4 A;  3FZV A;  2R7Z J;  4NHJ A;  1HW2 A;  5AIP A;  3CP8 A;  5FKN A;  2NS7 A;  2HYF A;  3DEE A;  2PG4 A;  4BQO A;  3DPU A;  3N05 A;  4KJZ A;  2PEX A;  4F52 A;  3E6D A;  3CF5 F;  2ZJ2 A;  3M8F A;  2WY8 Q;  3T1B A;  1I27 A;  3HTU A;  3RPQ A;  4L5J A;  1I1G A;  2QUF A;  3A03 A;  2PLY A;  2XPU A;  1A31 A;  1Y0U A;  3CJN A;  3OL4 A;  3O6B B;  1NK2 P;  1VQP I;  3ECO A;  4IO9 F;  1RIO H;  5JLW A;  4UXN A;  4S04 A;  3MN2 A;  1SMT A;  4M3E A;  3QPS A;  2F5V A;  4BKX A;  3IHU A;  1F43 A;  4NC8 A;  1FBQ A;  1O7F A;  2ZC2 A;  3BR3 A;  2PMH A;  1SFO J;  3ERM A;  1Z9C A;  2R7O A;  4IKF A;  2WAQ A;  3AG3 H;  4A0Z A;  2E1M B;  2RV8 A;  3SFI A;  1JGG A;  2DMT A;  4CXF A;  1ZH5 A;  4FX0 A;  1D1A A;  2F5D A;  1APL C;  1SD6 A;  2MC3 A;  4RLQ A;  3A2K A;  5IT9 R;  2M7A A;  1XGO A;  3S15 J;  1IXC A;  1FC3 A;  5L3B A;  3JW4 A;  2IS6 A;  2XF5 A;  3QOP A;  3EUH A;  1LFP A;  2OU2 A;  2R5Z A;  3WGI A;  2Y31 A;  3V7S A;  4IHY A;  4J19 A;  1Y8R B;  3DPT A;  2FBK A;  4BGD A;  5BOX A;  4NQW A;  3DQV C;  3F8M A;  3K4J A;  3FK6 A;  2P81 A;  3DV8 A;  2O03 A;  1ETQ A;  1HKT A;  4O6J A;  4E7K A;  2XAQ A;  3JCU C;  4E4H A;  2FQ4 A;  3A0B C;  3S17 J;  2MG4 A;  5F6F A;  5ILV A;  1YRN A;  1ONV A;  3FXQ A;  3TOB A;  3T5X A;  3MKW B;  1WH5 A;  2CV1 A;  3VYT B;  2ZXW H;  2Y0S N;  3OV8 A;  3DKW A;  2W85 A;  2BBY A;  2DU9 A;  3CDI A;  1VFC A;  4HZF A;  3WHB A;  4D5F A;  1HW5 A;  2Z3Y A;  4HBL A;  2PJR B;  1RZ4 A;  1DUX C;  1UG2 A;  4I7H A;  2WAF A;  1ULY A;  2DK8 A;  2STW A;  3CCE I;  1K79 A;  1JUP A;  1FNN A;  1BR2 A;  2Y0M A;  1IN4 A;  5B1A H;  1TQP A;  2L9S A;  2E35 A;  1OLT A;  5DTD A;  5DV5 A;  4A3K J;  3KFW X;  2X1C A;  5DD8 A;  3J7A O;  1CF7 B;  1MDM A;  5HOO A;  1FBS A;  4LOC A;  2L7F P;  3K4K A;  3S16 J;  3IRQ A;  3CDL A;  2GA1 A;  2DMQ A;  2WWY A;  3CCQ I;  2ACJ A;  2OBP A;  2VKD A;  3F6V A;  3HIF A;  3JRA A;  1GXP A;  1MNE A;  2FOK A;  3H35 A;  4IRH A;  3IAM 2;  1BC7 C;  2EIL H;  4PFO A;  3ZRG A;  1ORK A;  4G94 A;  3OIO A;  1XCB A;  4NC6 A;  4U7D A;  4HX7 A;  3CTA A;  2DJI A;  1OPC A;  4AM3 A;  2A68 F;  3HJE A;  4JP0 A;  3WTS C;  6PAX A;  5FLV A;  4KIG A;  3F8F A;  2W00 A;  1DPR A;  2K9Q A;  1P6R A;  4FIS A;  4AID A;  3BR6 A;  5CVV A;  4EQQ A;  2ZXJ A;  5C3E J;  3GFJ A;  4I98 B;  2LTP A;  3OR1 C;  1FOW A;  1XD7 A;  4XMY A;  1MGT A;  2HOE A;  1P4W A;  3V8L A;  1E2X A;  3IH3 A;  2MZ4 A;  3GLX A;  1FTZ A;  2UXN A;  4KN7 X;  1QBJ A;  3ZMU A;  4XM3 A;  4IOC F;  3CUQ C;  1OQY A;  3BC8 A;  3H5R A;  1WKM A;  1FSE A;  2PMU A;  2VPR A;  2HDC A;  1ETY A;  3SZP A;  1YJ9 I;  2BVM A;  2HVR A;  5E8I A;  4UUS B;  1VQ9 I;  2KT0 A;  3J81 R;  3BR5 A;  1RUN A;  4ANJ A;  3IV5 A;  2L0K A;  4ESF A;  2TRT A;  3GVA A;  2YUS A;  1XB4 A;  5J8C A;  1F4K A;  3I5U A;  4A0Y A;  3OYC A;  1NHA A;  3IAS 2;  3LFK A;  1WWX A;  5E3N A;  2PJP A;  3E6B A;  3RJP A;  2M87 A;  4UUV A;  4HST A;  4ZTJ A;  3C2G A;  2KP6 A;  2QZ8 A;  3V4G A;  3PL8 A;  2X6X A;  2W48 A;  1EKE A;  2IGO A;  2LMD A;  2QQA A;  4A3M J;  2LYC A;  3W6K B;  2LC2 A;  2COB A;  3DEU A;  2FOW A;  2ID6 A;  3GXO A;  3B6C A;  4K2E A;  2R3S A;  2OCC H;  2HQN A;  4Z6Y A;  2BY2 A;  4ESJ A;  4GGG A;  2DMP A;  4MTD A;  2VKE A;  3CC7 I;  3HXL A;  2HOS A;  4O3M A;  3GO5 A;  3OYN A;  1B8I B;  1CQT A;  4QLC U;  3E0J B;  2O61 A;  4DQ2 A;  2JA8 J;  2H1K A;  2A5Y B;  2VQG A;  5HDK A;  1QO0 D;  5KCM A;  5B66 C;  2IAI A;  1D8J A;  4Y13 A;  3OS2 A;  2G0E A;  5E1W A;  1AA7 A;  4M3D A;  3A52 A;  2LRE A;  5LRR A;  1AOY A;  1GV2 A;  2Y30 A;  2COM A;  3I71 A;  3ZQC A;  4RAG A;  3EET A;  3RI4 A;  4U0Y A;  1T33 A;  3S14 J;  4JOM A;  3X2Q H;  2LDU A;  2X9D A;  4HX8 A;  1G4D A;  2VKH A;  2TCT A;  2WTE A;  2Y9Y A;  3HOS A;  1VTN C;  1IXS B;  2CYY A;  2P5V A;  1JTY A;  1SD7 A;  2ESH A;  3TO9 A;  2JK3 A;  1FOK A;  2QM3 A;  5EDN A;  1CGP A;  2OPT A;  5JHU A;  1XMX A;  1ZGW A;  1A6Q A;  2Z33 A;  2H09 A;  5HLT A;  1BIA A;  1OR7 C;  2VOP A;  1HDD C;  2RN7 A;  2R7F A;  5LHG A;  4EGY A;  4WCG A;  3CCV I;  3RSN A;  2JQ7 A;  3F8N A;  1A35 A;  4HQM A;  2ZJQ F;  2GM4 A;  4HOB A;  1ZKG A;  4L9J A;  2EZK A;  3SXY A;  2A3S A;  1IRG A;  2E7W A;  3WTT C;  2VPL A;  2GIV A;  4CZC A;  5HS9 A;  4ZJZ A;  1FMW A;  1X1D A;  2HWV A;  1UHM A;  3QPL A;  4C3I J;  3KYD B;  3P7N A;  2DA1 A;  2DYS H;  1R4M B;  1BBY A;  4A5N A;  3GBG A;  2NS0 A;  5CQE A;  1IDZ A;  3LSI A;  1LVK A;  3K0L A;  1ODD A;  3RPU A;  3SDG A;  5E18 F;  4BQQ A;  1FZP B;  4W97 A;  2XRL A;  2LBF A;  4U0W A;  2GQQ A;  4C2T A;  2Y75 A;  4KT5 C;  1T95 A;  3E97 A;  2R7R A;  1A36 A;  3OY9 A;  1TQI A;  2HVQ A;  4LIT A;  2Z9O A;  4XID A;  1B6A A;  3O3K A;  3BQZ A;  3MEX A;  4KIT B;  4P9U A;  4LK0 F;  1YFH A;  1FSH A;  2NOJ B;  3AFH A;  4AVP A;  2O6G E;  9ANT A;  4HYE A;  5FLX Z;  2ME0 A;  4RAF A;  4PJL A;  3MQ0 A;  2CGP A;  4G7H F;  2NVY J;  4AWX B;  1H9T A;  2OTL I;  3R4K A;  1IZ1 A;  3U21 A;  1F36 A;  1BM9 A;  1F5T A;  1U5T A;  2YS9 A;  2GOX B;  2VQH A;  1GUU A;  3MMY B;  1VQN I;  1WI9 A;  3MKY B;  4QWQ A;  2LKP A;  3FIW A;  2E19 A;  2CQ7 A;  2XSD C;  2FUG 2;  2V1X A;  3HRT A;  2ZME A;  2LSO A;  4EJV A;  4EJW A;  3DBR B;  1ZG3 A;  1OCR H;  1ZTR A;  2ZBK A;  2HGC A;  1WZ2 A;  2FE3 A;  4DYC A;  1BI3 A;  3ULQ B;  2X48 A;  4XLP F;  4DOZ A;  3LFU A;  3HL2 A;  1VQ6 I;  5F08 A;  3MAJ A;  1VF9 A;  3C2B A;  5E3M A;  2L2O A;  2Q2E A;  3RIR A;  1YQA A;  1FPQ A;  3HM5 A;  5JHF A;  2VOO A;  3PNY A;  2OQR A;  5FKK A;  1D1B A;  2Z16 A;  3KCC A;  4L5E A;  2QBY B;  3NEU A;  1DU6 A;  1KON A;  4ENM A;  2VUM J;  3DU6 A;  4M3G A;  3KLO A;  1MMS A;  2DYR H;  4HG2 A;  2ICW G;  3H0G J;  3Q0V A;  1LEB A;  4KIF A;  3CMM A;  1G3W A;  4B8X A;  1O3T A;  4UHT A;  3DTK A;  3H36 A;  5EEH A;  2IRF G;  3NQO A;  1Z7U A;  2F4O B;  3GEZ A;  1IN7 A;  3H5A A;  2E5Z A;  1EV7 A;  2L54 A;  5K5Q A;  1D0Z A;  4HF0 A;  1PUF B;  3S1R J;  5D5V B;  4AYB A;  3AL0 C;  2P4W A;  3WG9 A;  3TOA A;  3ZQF A;  1B72 B;  2PBI A;  2JA5 J;  3WHC A;  2QBY A;  2L9R A;  2A05 A;  2MAB A;  3J7Y J;  3SYT A;  4BXF A;  3BDD A;  2DPD A;  1KYZ A;  3BR1 A;  3OYB A;  2GA2 A;  3JRB A;  3K1M A;  4ETS A;  3GTL J;  2HXO A;  1UHS A;  4E7L A;  5IYB J;  4WWC A;  3IH4 A;  1LB2 A;  4KIC A;  3TL4 X;  1QZZ A;  1LDD A;  1F1Z A;  2EFP A;  4JBA A;  1VQ4 I;  1KYW A;  4QPQ A;  2QKM B;  3VOE A;  3JRH A;  1HSJ A;  5BQT A;  2MW8 A;  1EA3 A;  4DNC A;  2ZNY A;  3E5U A;  1PVE A;  3BJA A;  4M72 A;  4WXD A;  3CES A;  1Z6R A;  2M4K A;  3PSI A;  2AHQ A;  2FJ1 A;  1JJ8 C;  4HV6 A;  4PCQ A;  1I50 J;  2BY3 A;  2NS8 A;  3I4N J;  2KZG A;  4GRI A;  2YSR A;  4XSX F;  1OCO H;  3N4M A;  3W2W A;  3ZQQ A;  2AS5 F;  1LEA A;  4XKV A;  2HVS A;  2P5K A;  5ICG A;  3JTH A;  1FYL A;  4UVC A;  4OWR B;  3D1N I;  1SD5 A;  1K78 B;  3JRG A;  3HKZ N;  2CSO A;  3PNV A;  1LDK B;  2C6Y A;  1OJL A;  1RR7 A;  4MEY F;  2OJE D;  4V2G A;  4L5I A;  4LG3 A;  3V8J A;  2LRD A;  2Q8K A;  1OYI A;  1D3Y A;  5J40 A;  1Y1W J;  2K9M A;  2V26 A;  3L1P A;  3S1M J;  2A6E F;  1XS9 A;  3F21 A;  4Q5S F;  2F2E A;  1QHH D;  4G12 A;  1J09 A;  2QEN A;  4KMU X;  3V8K A;  1I6H J;  3CJR B;  2NVQ J;  1K78 A;  4M6X A;  1YTY A;  4UVA A;  3T8R A;  1GV5 A;  3CZ6 A;  1VQK I;  4GO1 A;  3GTM J;  4M9Z A;  1MH3 A;  3MZY A;  1VI0 A;  3ERE D;  3S2W A;  3ZXS A;  2DCE A;  3AAF A;  3FMS A;  3FXU A;  1EH6 A;  2OCE A;  4XL9 A;  4DW6 A;  5D5X B;  3FKJ A;  1RC9 A;  1MJ9 A;  2EZH A;  3K10 A;  3WG7 H;  5E1Z B;  3I56 I;  2LK2 A;  1LKX A;  3BR2 A;  4MFD A;  1JHH A;  2RVC A;  3M7G A;  3BG3 A;  5KAI C;  1DP7 P;  4DBQ A;  1WJD A;  3KP6 A;  2JWT A;  3BTJ A;  1C0W A;  3RCO A;  2A07 F;  4A2U A;  1WHU A;  4BQA A;  1SD4 A;  4XLH A;  1K7A A;  1EH7 A;  4IHS A;  3QP6 A;  1D5V A;  2EIK H;  2DPU A;  4N9I A;  2CQQ A;  4I09 A;  4I76 A;  4OAZ A;  4D9J A;  1QPM A;  2MUN A;  2QWW A;  4U7B A;  5LRS A;  5FRN A;  4XLC A;  3H3V K;  4BBR J;  4H4K C;  1TZL A;  4I02 A;  1T8I A;  1ZRF A;  5FO5 A;  3WE2 A;  3S8P A;  2R7W A;  4CCM A;  2EQR A;  3QQA A;  2PMZ A;  3KZI C;  1YJN I;  3ZN1 A;  2WBM A;  1ERD A;  1X58 A;  4XKC A;  1LE8 B;  3S1Q J;  3FXM A;  5DUI A;  3QU6 A;  2QLZ A;  5F0C A;  3VYU B;  4R1H A;  1X2N A;  4CUG A;  4HLY A;  1RQ6 A;  1YX5 A;  1DPU A;  5M5W J;  3GFM A;  4RAZ A;  2R5Y A;  1XGN A;  2BHY A;  2VT2 A;  2CW7 A;  2GWR A;  2LLK A;  3QAH A;  3RQI A;  3DPL C;  2XAU A;  4CDG A;  2VJJ A;  2DXI A;  1TWA J;  4A3I J;  2KL4 A;  2GAU A;  3OSF A;  2QQ8 A;  2Z1D A;  4YFK F;  3KP3 A;  2A61 A;  3CO7 C;  4PK4 A;  1QQI A;  3FBN B;  1IV6 A;  3S3M A;  3F72 A;  4G6D A;  2HZT A;  2ZME B;  5CVJ A;  4Y7N J;  3ABK H;  2LNB A;  2L3D A;  1W1W E;  1NK3 P;  3OL3 A;  4AU7 A;  5IP9 J;  5DM6 F;  1GLN A;  2VXZ A;  4KMF A;  3ESW B;  2J5O A;  5F0H A;  1OCC H;  3EYI A;  4AIK A;  2DMU A;  4NDL A;  2NXN B;  3FWE A;  3DF8 A;  3CO6 C;  4RBO A;  1W36 C;  3IKT A;  3QOD A;  2OQG A;  3Q0U A;  3WU1 B;  1XC5 A;  1DGW Y;  3TO6 A;  4B47 A;  4E70 A;  3FXJ A;  1K6Y A;  2QVO A;  1E3H A;  2F5C A;  2FF4 A;  2PN6 A;  2AO9 A;  3PJR A;  1JT0 A;  3FK7 A;  1Y8Q B;  1S72 I;  1X4O A;  5HNH A;  3CUO A;  3TO7 A;  3EYY A;  3M3Y J;  4F55 A;  3E3V A;  3TKY A;  2DBB A;  4BDY A;  1TW3 A;  3T0Y A;  1VQ5 I;  5A2Q R;  3BPX A;  1PDN C;  4AIH A;  1IUF A;  1H89 C;  3IKV A;  3VWB A;  3W6J B;  3AKZ A;  2DA6 A;  4GYI A;  2UXX A;  5ICE A;  2IW5 A;  2JRT A;  3RZD J;  1B1B A;  1R1U A;  2DK5 A;  2W1O A;  2QSG X;  2PJR A;  2DJN A;  2ZO4 A;  3JSO A;  3HUG B;  1GHC A;  2WAD A;  5GAG J;  4FT8 A;  4A0X A;  2KJC A;  4X0G A;  3CC2 I;  1V5F A;  2VAS A;  4J00 A;  1N75 A;  3BY6 A;  5DYM A;  2XHK A;  1W5S A;  5E1X A;  2HYG D;  2V79 A;  3HSR A;  1YHQ I;  3OYK A;  5DCF A;  2VQL A;  1SMY F;  3GTG J;  1UMQ A;  2BHZ A;  1FLI A;  2LP0 A;  2WV0 A;  5CVR A;  5LHH A;  2K5C A;  1KA8 A;  1ZRC A;  2KPM A;  3MZH A;  1XGS A;  1X1B A;  4EJO A;  1IW7 F;  1ZRE A;  5J1Y A;  1YS6 A;  1ON1 A;  4IHT A;  1W0T A;  1A04 A;  4D7M A;  2STT A;  1XSX A;  3ZCO A;  1JGS A;  3ABM H;  5HLH A;  2VJ5 A;  4EM2 A;  2FXA A;  3QYF A;  2E1O A;  4C2M J;  2ZCW A;  5F04 A;  1G8X A;  4S05 A;  2BY0 A;  3GFI A;  1IGN A;  2IXS A;  3EUA A;  1RRJ A;  1H0M A;  2ELH A;  2IGN A;  4NUB A;  1W5T A;  1UJ8 A;  5J4V A;  4BXX J;  4YIF A;  2VB6 A;  1HBX G;  1G3T A;  5KVR A;  1WJC A;  2R7V A;  4KNY A;  2RNG A;  2L7K A;  3CCM I;  3CD6 I;  5AON A;  2DFE A;  4OU0 A;  1ACI A;  2KDZ A;  1XDU A;  2VBW A;  3I59 A;  4XBF A;  3J7Z I;  1IUY A;  1R22 A;  4E7J A;  1RNL A;  1GVD A;  3OYE A;  4HEA 2;  4PZJ A;  1W7P B;  2LY1 A;  1QVU A;  2OF7 A;  2VE9 A;  2MLK A;  3H92 A;  1X4P A;  3IUO A;  3CLO A;  2V9P A;  2ISZ A;  3S3N A;  1S7O A;  3D5R C;  5F64 A;  5GAD J;  3CMA I;  1BI1 A;  1OKR A;  2FU4 A;  2HOT A;  1T6S A;  5IOZ A;  3MCZ A;  3DWL E;  1P7J A;  3OYM A;  4HQE A;  4A6D A;  2X6W A;  1XCV A;  4ZTF A;  1IF1 A;  4HLX A;  2ELK A;  1OFC X;  3L2R A;  1O3Q A;  1MBH A;  2FA5 A;  3J7A Y;  2K9N A;  4CCO A;  2XDV A;  4A69 C;  2XSJ C;  2HDW A;  3K4C A;  4KIB A;  2E2I J;  4CYD A;  5M5Y J;  1BI0 A;  2LVS A;  2IJL A;  1QA6 A;  5IT9 K;  2LH9 A;  1TTY A;  2P7C B;  2ZJP F;  4DYR A;  4CHU A;  1R6R A;  3HOW J;  1IDY A;  1RKT A;  3COA C;  1BW5 A;  4AUX A;  1HKQ A;  3RYP A;  3W6V A;  2A69 F;  3UR3 C;  3CUQ A;  5FKO A;  4L18 B;  4HPQ A;  3P5J A;  4F91 B;  1LVA A;  4KYW A;  5FFX A;  2CQN A;  1QZE A;  3HOX J;  1B8I A;  2JUC A;  2L01 A;  4U88 A;  3GTJ J;  2UWM A;  3K9T A;  4PGH A;  4RDU A;  2HQR A;  3R60 A;  2O8X A;  5IP7 J;  1G3Y A;  3DTI A;  3E7L A;  3TMO A;  5LEJ A;  2KIS A;  3FXL A;  3FMQ A;  3RYR A;  2ID3 A;  3GME A;  2QCO A;  4EAT A;  1FOY A;  3HHH A;  4KA4 A;  5IYD J;  2OD5 A;  1VQO I;  2A5W A;  4XLN F;  1FT9 A;  4Y15 A;  3F6O A;  3Q0W A;  1MIJ A;  4UUT A;  1HC8 A;  3ABU A;  2H6B A;  1ZG1 A;  2W24 A;  1W5C C;  2JVH A;  3NAU A;  4LG0 A;  4A5M A;  4HX4 A;  2E34 A;  3LA3 A;  1JXS A;  3FXR A;  2XC7 A;  1OYW A;  4QIW N;  4IX7 A;  2R7T A;  3OIP A;  3L9F A;  3KZZ A;  2Y2Z A;  4KIS A;  3RKY A;  3LSP A;  1UEL B;  1MBK A;  2HU9 A;  5KK1 A;  1NH3 A;  4BHC A;  1R23 A;  1T38 A;  2EV0 A;  2BW3 B;  5H6Q A;  5EZG A;  3FIS A;  2F5E A;  5B1B H;  3V42 A;  4XRS G;  4FTH A;  1NG7 A;  1K6O A;  5K7H A;  2P5L C;  3GZ6 A;  1AKH B;  1HDP A;  2CUJ A;  5DUK A;  2DFI A;  2F4I A;  2HKO A;  4FHT A;  3SEZ A;  3BQY A;  5GAH J;  2JMW A;  4A3E J;  3H3Z A;  1JE8 A;  4CZZ A;  3L2U A;  3W2A A;  1X3W B;  2XUB A;  2ETH A;  3BWG A;  4Y52 J;  2DT5 A;  3ZQG A;  4EM0 B;  1S8N A;  4BEH B;  1UB9 A;  2FBI A;  2YR2 A;  3RKX A;  1ON2 A;  2VN2 A;  3TGN A;  4LJZ F;  3FF5 A;  1PYV A;  2LD5 A;  3HPH A;  2RNJ A;  3JRD A;  5IY5 H;  1S29 A;  2CH0 A;  5K5R A;  4Q4Z F;  2ZSI B;  4G6T B;  2BYV E;  1TBX A;  3KPH A;  2M8E A;  4MQ9 F;  5FGM A;  2K4B A;  3G1L A;  3DLA A;  2M1B A;  3LWF A;  1R5H A;  2EA4 A;  4N9H A;  3U2R A;  1LNW A;  3T8T A;  4LG0 B;  3VSK A;  5J4Y A;  4BY7 J;  4C2U A;  2E1M C;  3MZ8 A;  4MHG A;  3WTW C;  2MD5 A;  1YW7 A;  3I55 I;  1ZLK A;  1PUE E;  2K9S A;  4BQN A;  3I59 B;  4ZDL A;  4A12 A;  1Z3X A;  4XLF A;  3WTY C;  4RB1 A;  1YS7 A;  5LLQ A;  1R1T A;  5F1R A;  5CLS A;  3JRF A;  2LFB A;  1BOB A;  1Z67 A;  5DEQ A;  2JPC A;  1JJ6 C;  1QNT A;  2XAJ A;  5JVT A;  1R36 A;  1U5T B;  4F92 B;  3IH2 A;  3HUG A;  4MFE A;  4YEJ A;  3FM3 A;  4II3 A;  4UB6 C;  4DGW B;  2FEZ A;  2WB1 A;  1YG2 A;  4EVI A;  5FLX K;  3SZG A;  1L0O C;  2KRF A;  1YIT I;  4AC0 A;  4Y33 A;  5LHI A;  3BLY A;  4YRV A;  1YIO A;  1ETW A;  3KP5 A;  2XGC A;  4DJA A;  3WGG A;  4HDV A;  1LPQ A;  4B3X A;  2ZKZ A;  3HYI A;  3K7A J;  3I9V 2;  5DCM A;  4AVZ A;  3BG9 A;  4ASN A;  5DM7 F;  5EGO B;  2L7Z A;  3J7A W;  5FLM J;  2JA6 J;  2KIM A;  2K4J A;  3BCA A;  3LSJ A;  2D5V A;  3ISP A;  5FD5 A;  1IXR C;  1Z77 A;  4MTE A;  1HF0 A;  4M3F A;  3S2D J;  4ESB A;  3JTG A;  1BJA A;  2E71 A;  5FJ8 J;  4EMS A;  4L9V A;  4Y4R A;  1HQC A;  2P6T A;  1P7I A;  2XRO A;  5L3E A;  5HLG A;  2LY2 A;  3WGH A;  5J1R A;  3F9K A;  1JI8 A;  3PQJ A;  1R71 A;  3OR2 C;  4YFX F;  2FNP A;  4JX5 A;  4ZYG A;  4M74 A;  4N0B A;  1TWF J;  3TW6 A;  3TDU C;  2PQ8 A;  2F4M B;  4LD5 A;  4N4N B;  3G6E I;  4P9F A;  2LBF B;  1POG A;  4RAY A;  1OCP A;  2JSP A;  5D4S A;  3WE3 A;  3L2C A;  2QF7 A;  1X19 A;  4GCV A;  2M35 A;  1WSU A;  2DA2 A;  2EZL A;  3I54 A;  1VQM I;  2M9H A;  3QP5 A;  3OYI A;  1ETV A;  2E2H J;  1E0E A;  2L9N A;  4H0E A;  3CMY A;  2VKV A;  2ZXI A;  4D0P A;  2O7O A;  5DDG A;  4XKB A;  2M34 A;  1IN6 A;  3WOD F;  4DIQ A;  3AG4 H;  3K1P A;  1TLH B;  3KP4 A;  5F0F A;  3M4O J;  2DAO A;  1ZGJ A;  2FML A;  2HQA A;  3LQR A;  2X0L A;  3G2B A;  2YU3 A;  3SZT A;  1RI7 A;  4WK8 F;  1HW1 A;  4XK4 A;  3QWL A;  2VBX A;  2D2W A;  2JTV A;  3R6S A;  3F0C A;  4XQF A;  3CCL I;  3AL0 B;  3S1N J;  4BBS J;  1VND A;  3U1K A;  1G3S A;  2VI6 A;  2X4H A;  4EJT A;  4XLE A;  3REO A;  2EZI A;  4IOA F;  2IGK A;  4EGZ A;  1Z05 A;  3QOE A;  2VXD A;  2CO5 A;  3LMM A;  4I01 A;  2V9V A;  4UY8 I;  4YG2 F;  2XPV A;  3E6C C;  3HGG A;  1YYV A;  1GT0 C;  5ILU A;  1KU2 A;  4FAS D;  3H3U A;  1MBJ A;  2GZW A;  1I39 A;  2LKX A;  4KFC A;  1ZEL A;  5D5U B;  2PI0 A;  3K1N A;  5D6E A;  1WJA A;  3ABL H;  3G4S I;  2EB7 A;  1IO2 A;  2I10 A;  2DOF A;  3O8G A;  1G6N A;  1H88 C;  1ITY A;  2CJJ A;  4V2F A;  1J2X A;  4FCY A;  4OMY A;  1IRF A;  3E5Q A;  4MO7 A;  1J59 A;  3KEY A;  2MH9 A;  2GXG A;  1Z0X A;  2JUG A;  3HOU J;  2IVM A;  4OOI A;  2KIQ A;  5GPC A;  4IHX A;  1YX3 A;  3PO3 J;  3I4M J;  4Z2Y A;  4PJJ A;  1TNS A;  4FE7 A;  1O57 A;  3ABT A;  4NQW B;  4IXA A;  5EEA A;  4P55 A;  2D1V A;  3FX3 A;  2IEK A;  3TDZ C;  3GYH X;  3HC7 A;  3L00 A;  1FMV A;  1U3E M;  3LA7 A;  1W36 D;  3M1C A;  1USS A;  2KKO A;  3P9I A;  1WFX A;  3TW7 A;  3HHG A;  3SHF A;  1IN5 A;  2OZU A;  4XRS A;  2BXZ A;  3F8C A;  2B9S A;  1BOA A;  3B6A A;  3VEP A;  2QYO A;  5A2Q K;  4E7I A;  4ITV A;  2CV0 A;  2H8R A;  2DW4 A;  3HOT A;  1SFU A;  2OUM A;  3K4L A;  4JX4 A;  3A1Y A;  2MGQ A;  5LFA A;  4YII A;  1XPX A;  2X6O A;  2BW3 A;  2JA2 A;  2XF7 A;  4EM1 A;  4UVB A;  2EFW A;  4JK1 X;  4G6Q A;  1U9N A;  1FBU A;  2E7X A;  4XLA A;  5LEK A;  2RRE A;  4M73 A;  2QSF X;  5CJ9 A;  2XKP A;  4BHP A;  1T2K A;  3K2Z A;  1IRX A;  2XRN A;  3DXJ F;  4B4C A;  3GZ5 A;  2J5P A;  3RKW A;  4EEF G;  4IZZ A;  4A3J J;  4O5V A;  3G3Z A;  3L7W A;  3PIO F;  4F93 B;  5DD4 A;  2VQC A;  1RUO A;  3LSR A;  2VLA A;  5L3D A;  1RR8 C;  3LSM A;  2EBI A;  4A3L J;  1HOM A;  1FX7 A;  4LK1 F;  2X85 A;  1ETO A;  2DOE A;  4OMZ A;  4WXH A;  3HBL A;  4XSZ F;  3GTQ J;  2VJI A;  3J80 R;  2E60 A;  4FX4 A;  3LAJ A;  2V6E A;  1XTA A;  5EJC A;  2KHM A;  2K3F A;  4X6A J;  1T08 B;  5JFR A;  5HDG A;  3ASO H;  1ETX A;  1SVO A;  3D0S A;  1ZG5 A;  2EPF A;  1D5Y A;  2EIM H;  1N25 A;  3F3X A;  2YPR A;  5A2Q Z;  1Y6I A;  4CH7 A;  1UCR A;  2BEO A;  2KFD A;  1IG7 A;  5L3F A;  1W4M A;  2Q0O A;  2M0M A;  1MMA A;  5C4X J;  3A01 A;  2IS1 A;  1WGX A;  2DQL A;  5CVU A;  2LG4 A;  3DKY A;  1MMN A;  1V4R A;  2NNN A;  3WU2 C;  2ZFW A;  2RKH A;  4OAY A;  4X1E A;  4XOR A;  1YE9 A;  4Q47 A;  3DBH B;  3EDP A;  4GXO A;  3K2A A;  4HNU A;  2UV1 A;  1SAU A;  2K27 A;  5JLX A;  1ZGA A;  2ZFU A;  3BPV A;  3FHN A;  3OS0 A;  1B4A A;  3E5X A;  2OV7 A;  4B43 A;  3ZMS A;  5K1Y A;  3ZGK A;  3OSG A;  3HKZ A;  1HLV A;  2XB5 A;  2WB1 N;  2A6T A;  4RGU A;  4RB2 C;  1MKM A;  1X3U A;  2PMZ N;  3HOV J;  2XVC A;  1D8K A;  1BR4 A;  1HXD A;  1QHG A;  4ZYH A;  2BVL A;  3H9J A;  2CFO A;  3J81 Z;  5ICC A;  1QGP A;  2V9K A;  3NWS A;  2DT6 A;  5EG0 A;  3PNT A;  2HEO A;  3DP7 A;  3P9C A;  3CDH A;  2ECB A;  2XB0 X;  4G9Y A;  2P6S A;  3O2P E;  3BZ6 A;  1MND A;  4I0B A;  4IJA A;  3I4P A;  1Q1H A;  3DBL B;  4F7Z A;  2EK5 A;  4B09 A;  4CCL A;  1YIJ I;  1YOV B;  1JKR C;  2ZB9 A;  1KQ9 A;  2O8K A;  1ZYR F;  2NNY A;  2X1E A;  4LLG F;  3HTS B;  1BN5 A;  1L3L A;  3F23 A;  2L4M A;  1XDS A;  3WTZ A;  1B72 A;  2HTS A;  3KE2 A;  4HW0 A;  3ASN H;  4ZDP A;  5BNG A;  2H6C A;  3KEO A;  3PQK A;  1V5G A;  3K4N A;  4BYY A;  2RQQ A;  3VSL A;  2UZK A;  3C2H A;  3I3L A;  5IT9 Z;  1RES A;  3ECH A;  3MFK A;  2MA3 A;  2DN0 A;  1D0X A;  3JR9 A;  2EH3 A;  1YW9 A;  4FET A;  2CMP A;  4IPA A;  3VYS B;  2R7D A;  1A6I A;  2WAE A;  2DOA A;  1REP C;  4II2 A;  5EYR A;  5B3S H;  3BJ6 A;  4HNT A;  3K4M A;  4LB6 B;  2ZNZ A;  5KHD A;  4ENJ A;  3UNG C;  3ZP5 A;  4I0A A;  4LGW A;  1LQ1 A;  2H27 A;  2NOG A;  1JTX A;  2BXY A;  4NC7 A;  4BJT A;  2KDO A;  2B63 J;  1N78 A;  1HKS A;  1OYY A;  1R49 A;  3U9G A;  3RKQ A;  3M8J A;  1ZAO A;  1ZHF A;  1ETK A;  1WJ5 A;  2QGU A;  3CCJ I;  1JKQ C;  4RB0 A;  2HFH A;  4ZH4 F;  1IRZ A;  2CFX A;  5ILS A;  4WX9 A;  1AKH A;  4A6E A;  2IPQ X;  3TBI A;  3UKG A;  1E3O C;  2HR3 A;  2W25 A;  5JR3 A;  2V7F A;  4YIR X;  1HCR A;  2E1C A;  3QYB A;  1YJW I;  2BOL A;  1TWC J;  3OOP A;  2HPM A;  4FQG A;  4RM3 A;  3VDX A;  4LMY A;  1AU7 A;  3DEW A;  4RS8 A;  4A3G J;  2AQF A;  1TT5 B;  3FDY A;  4UB8 C;  2HXI A;  1EH8 A;  3HOY J;  4BL0 B;  4OIO F;  2MYS A;  3F8B A;  3S3O A;  2K9L A;  3AG2 H;  5GAE J;  4NB5 A;  1PP7 U;  3GF2 A;  2X51 A;  1SVL A;  5JI6 A;  1AWC A;  2BY1 A;  4BUP A;  3HSE A;  3SFZ A;  2R7Q A;  4BS9 A;  1PJR A;  2VBZ A;  2H94 A;  2EJR A;  4TV7 A;  1O4X A;  2IS2 A;  2VC1 A;  4A3F J;  2D45 A;  1WJB A;  2O0Y A;  4CCK A;  2M4G A;  3HRM A;  4HDU A;  1XMK A;  3CC4 I;  1Z21 A;  3G73 A;  5HVQ C;  3QYE A;  1B59 A;  2M45 A;  2KMU A;  3MWM A;  2FRH A;  2WA0 A;  3E1S A;  3PO2 J;  1T0F C;  4MGR A;  1WQ2 A;  5FRO A;  1YW8 A;  4D7N A;  1BJZ A;  1IN8 A;  2IS4 A;  4XRM A;  4HAM A;  4IRG A;  1MBG A;  1LE8 A;  4PJM A;  2M0C A;  2M8G X;  3E6M A;  4BDZ A;  2ESN A;  4AD9 A;  3G1M A;  5J6X A;  3RZO J;  2V6C A;  2RAE A;  1W0U A;  3FBI B;  2Y0S A;  5ED4 A;  3LNQ A;  5F27 A;  3DCF A;  3ZMZ A;  4OIN F;  3LST A;  5C44 J;  1BIB A;  4PDK A;  5FFZ A;  1T39 A;  3I0T A;  2Q2E B;  1MW7 A;  5GTH C;  1R00 A;  1VQ7 I;  4CGZ A;  3A02 A;  3VPR A;  2GXA A;  4EJU A;  2XAH A;  3WTU C;  2ISY A;  1XG1 A;  2IP2 A;  4Y3O A;  5D8L B;  2H1L A;  2R4G A;  1R9T J;  2R7U A;  3CQZ J;  1X1C A;  3WTX C;  2FQ3 A;  1FYM A;  2JVG A;  1DU0 A;  3PSF A;  4CYC A;  1Q1V A;  1OIS A;  4JX6 A;  2ZSH B;  5DCM B;  3WTV C;  2EIN H;  4CCN A;  2K86 A;  1W7P D;  4BE2 A;  1JT6 A;  2W57 A;  2DFH A;  3M1E A;  3NWT A;  1LFU P;  5ERI A;  2EIJ H;  4IQ4 A;  3IRR A;  4RA2 A;  2B0L A;  2VBY A;  4KDP A;  1KQ0 A;  4BEH A;  1KZH A;  4C3H J;  1RET A;  3W3C A;  3A01 B;  3M8E A;  3Q9V A;  1J5Y A;  2CW8 A;  1J9I A;  1FP1 D;  5GPA A; 
#chains in the Genus database with same CATH homology
 4BNC A;  3HSF A;  1P4X A;  2EFQ A;  3ZMD A;  5BS6 A;  5EEG A;  2VT3 A;  4WXC A;  2PFB A;  3IWF A;  5E8G A;  1Z1D A;  1FWZ A;  4UV9 A;  4HA8 A;  4ZYE A;  3J81 K;  3GFL A;  4ON0 A;  5BPD A;  2VON A;  1KGS A;  3C18 A;  3NRV A;  4ENN A;  1TQM A;  1R1V A;  2CQK A;  3I58 A;  2EWN A;  3KEQ A;  4LFU A;  2HKX A;  3RDI A;  3KP2 A;  1ZLJ A;  3EQL F;  5ICF A;  4OIP F;  4L0Y B;  2EV6 A;  4Y17 A;  4PGG A;  2RC4 A;  2VOD A;  3WU0 A;  1KU7 A;  5LGT A;  3GUD A;  2M30 A;  2LF8 A;  1OMI A;  1LDJ A;  2NAZ A;  5CYV A;  3ROU A;  1W7P A;  4IRI A;  3QRF F;  5HS7 A;  1J7K A;  3I64 A;  4G7O F;  1V3F A;  2FBH A;  1OR7 A;  5D8K B;  2BGC A;  3IWZ A;  2Z99 A;  1IAW A;  2W84 A;  4MQV A;  1CF7 A;  1O3R A;  3VFZ A;  4P96 A;  3BOQ A;  2JZY A;  4CIC A;  5L3C A;  2XAS A;  1F9N A;  2V1D A;  3LA2 A;  2OA4 A;  1P92 A;  3V7R A;  2RQP A;  2LF7 A;  2BV6 A;  1GVJ A;  5D5W B;  3CUQ B;  4M6Y A;  1I6X A;  5FD6 A;  2OZ6 A;  4M9S A;  4L0Z B;  3JSP A;  2L02 A;  2NRA C;  4YFN F;  4ZYD A;  3FHZ A;  3C7J A;  1MJB A;  2GXB A;  5D6F A;  2DLL A;  4XRF A;  5J8F A;  1U8R A;  3GX4 X;  3D5L A;  1MD0 A;  1UHW A;  5TJJ A;  3GWZ A;  2CWE A;  2RGV A;  4UV8 A;  4HF1 A;  2YX7 A;  1O3S A;  4Q48 A;  2EFN A;  1R58 A;  2XAF A;  4M9X A;  2KIU A;  5FB2 A;  1T0F A;  3PFI A;  1J0R A;  3V7C A;  1XMA A;  4LLN A;  2A6H F;  3VOD A;  5H20 A;  1KU3 A;  2DTR A;  4ENK A;  2IA0 A;  5LGU A;  1HST A;  2V1U A;  1S3J A;  1KU9 A;  1XSD A;  2IT0 A;  4ZZL A;  4HV5 A;  2K02 A;  2JT1 A;  1ZAR A;  2QQB A;  1BI2 A;  1UST A;  4U0V A;  2CG4 A;  4RB3 C;  4R8H A;  2VE8 A;  1MJA A;  3BP8 A;  2EFO A;  2Y48 A;  3ML6 A;  1SFX A;  1YLF A;  3QPT A;  5H6R A;  1UFM A;  5D4R A;  3KET A;  3IL2 A;  5E17 F;  5IT3 A;  2FSW A;  4OIR F;  1R5G A;  2L4A A;  5HLI A;  3R0A A;  1U2W A;  2O3F A;  1LJ9 A;  4BAY A;  1XN7 A;  2G7H A;  2G7U A;  2G9W A;  1R7J A;  5L3G A;  1U5T C;  4WF2 A;  3VB2 A;  1P2F A;  5HDN A;  4HF2 A;  4ZZD A;  5BPI A;  2Z5U A;  5TRD A;  3DFG A;  3BJO A;  3JAM K;  2M5W A;  4MNU A;  1SFE A;  2QQ9 A;  2BE5 F;  4EV0 A;  1U78 A;  1GXQ A;  3J80 K;  4L9T A;  4KUM A;  2XGX A;  4BH9 A;  3I53 A;  1I5Z A;  3U1D A;  4RGX A;  2XV4 S;  2CW0 F;  2WC2 A;  3M9A A;  4IVN A;  4RGR A;  3ZQ7 A;  2FNA A;  3ZN0 A;  2XAG A;  3R0J A;  2DQR A;  2K7L A;  1U6G A;  1MZB A;  5E20 A;  5LBQ A;  2EV5 A;  1MDM B;  4OIQ F;  3KLN A;  2E1N A;  1ZN2 A;  3ZMV A;  1FP2 A;  4GYG A;  2IA1 A;  1TW2 A;  1KQ8 A;  1YO5 C;  2KIF A;  3KP7 A;  2XIG A;  5HS8 A;  3ELK A;  2AXL A;  1BC8 C;  1I1S A;  5CVI A;  3LAP A;  3J80 Z;  3FM5 A;  3K69 A;  3TQN A;  1B9N A;  4KN4 X;  1B9M A;  1SAX A;  3C1D A;  3B73 A;  2TDX A;  4L9N A;  3JAM Z;  3FMR A;  1FY7 A;  3C3W A;  1Z6T A;  4AIJ A;  3BRO A;  3F22 A;  2MH2 A;  1P4A A;  2VC0 A;  3GW2 A;  4MEX F;  2HTJ A;  4LLL A;  4RGS A;  3SQN A;  2IA2 A;  2D1H A;  4IF4 A;  2KJB A;  2DO7 A;  4BHB A;  2P8T A;  2YX4 A;  2F5F A;  3RTR A;  2RDP A;  2XKO A;  2ADU A;  3LQQ A;  3HRU A;  2FMY A;  1J75 A;  3IC7 A;  4LB5 A;  1ZRD A;  2EA2 A;  3Q5F A;  2MBF A;  5K5O A;  5AIQ A;  3R61 A;  2NYX A;  4CO8 A;  2JSC A;  3QU3 A;  4JQF A;  3QPH A;  4UNO A;  1QZY A;  2HS5 A;  2OAZ A;  3KZY A;  1T98 A;  1H9G A;  3ZPL A;  4R79 A;  1TNT A;  4M71 A;  2JPB A;  1DDN A;  1Z91 A;  5BMZ A;  4G8X A;  1WRJ A;  3B02 A;  4I2O A;  1PP8 F;  1JHF A;  3P9K A;  4G7Z F;  1O7L A;  3L09 A;  4P5O A;  1S7A A;  2DI3 A;  1XSV A;  5LGN A;  3HRS A;  1S6L A;  2P7V B;  1E17 A;  3ZMT A;  3Q9S A;  2MLG A;  3N97 A;  1XGM A;  4BXU A;  1STZ A;  1FYK A;  3FZV A;  4NHJ A;  1HW2 A;  5AIP A;  2HYF A;  2PG4 A;  2PEX A;  3E6D A;  2ZJ2 A;  3M8F A;  3T1B A;  1I27 A;  3HTU A;  3RPQ A;  4L5J A;  1I1G A;  2QUF A;  2PLY A;  1Y0U A;  3CJN A;  3O6B B;  3ECO A;  1RIO H;  4UXN A;  4S04 A;  1SMT A;  3IHU A;  1FBQ A;  1O7F A;  2PMH A;  1Z9C A;  4A0Z A;  2RV8 A;  4CXF A;  1ZH5 A;  4FX0 A;  2F5D A;  1SD6 A;  2MC3 A;  1XGO A;  1IXC A;  1FC3 A;  5L3B A;  3JW4 A;  3QOP A;  3EUH A;  2OU2 A;  3WGI A;  3V7S A;  3DPT A;  2FBK A;  5BOX A;  4NQW A;  3DQV C;  3F8M A;  3DV8 A;  2O03 A;  1HKT A;  4O6J A;  2XAQ A;  5F6F A;  5ILV A;  1ONV A;  3FXQ A;  3TOB A;  3T5X A;  3OV8 A;  3DKW A;  2W85 A;  2BBY A;  2DU9 A;  4HZF A;  1HW5 A;  2Z3Y A;  4HBL A;  1RZ4 A;  1DUX C;  4I7H A;  1ULY A;  2DK8 A;  2STW A;  1K79 A;  1FNN A;  2Y0M A;  1IN4 A;  1TQP A;  5DV5 A;  3KFW X;  5DD8 A;  3J7A O;  1CF7 B;  1MDM A;  5HOO A;  1FBS A;  3IRQ A;  2GA1 A;  2WWY A;  2ACJ A;  2OBP A;  3F6V A;  3HIF A;  1GXP A;  2FOK A;  4IRH A;  1BC7 C;  4G94 A;  1XCB A;  4U7D A;  4HX7 A;  3CTA A;  1OPC A;  2A68 F;  3WTS C;  6PAX A;  4KIG A;  3F8F A;  1DPR A;  1P6R A;  5CVV A;  4EQQ A;  2ZXJ A;  3GFJ A;  4I98 B;  1XD7 A;  1MGT A;  2HOE A;  1P4W A;  3V8L A;  1E2X A;  3GLX A;  2UXN A;  4KN7 X;  1QBJ A;  3ZMU A;  3CUQ C;  1WKM A;  1FSE A;  2PMU A;  2HDC A;  3SZP A;  5E8I A;  1RUN A;  4ESF A;  3GVA A;  1XB4 A;  5J8C A;  1F4K A;  3I5U A;  4A0Y A;  1NHA A;  3LFK A;  1WWX A;  2PJP A;  3E6B A;  3RJP A;  2M87 A;  4UUV A;  2QZ8 A;  3V4G A;  2QQA A;  3W6K B;  3DEU A;  3GXO A;  4K2E A;  2R3S A;  2HQN A;  4ESJ A;  4GGG A;  4MTD A;  4O3M A;  3GO5 A;  4QLC U;  2O61 A;  4DQ2 A;  2A5Y B;  5HDK A;  1QO0 D;  1D8J A;  4Y13 A;  5E1W A;  5LRR A;  1AOY A;  3I71 A;  2COM A;  3EET A;  3RI4 A;  4U0Y A;  2LDU A;  4HX8 A;  1G4D A;  2WTE A;  3HOS A;  1VTN C;  1IXS B;  2CYY A;  2P5V A;  1SD7 A;  2ESH A;  1FOK A;  3TO9 A;  2QM3 A;  1CGP A;  5JHU A;  2Z33 A;  2H09 A;  2VOP A;  1BIA A;  2RN7 A;  2R7F A;  5LHG A;  4EGY A;  4WCG A;  3F8N A;  4HQM A;  4HOB A;  4L9J A;  3SXY A;  2A3S A;  1IRG A;  2E7W A;  3WTT C;  2GIV A;  5HS9 A;  2HWV A;  1UHM A;  3P7N A;  1BBY A;  4A5N A;  2NS0 A;  3K0L A;  1ODD A;  3RPU A;  5E18 F;  1FZP B;  4U0W A;  2GQQ A;  2Y75 A;  4KT5 C;  3E97 A;  1TQI A;  2Z9O A;  1B6A A;  3O3K A;  3MEX A;  1YFH A;  4P9U A;  4LK0 F;  1FSH A;  4AVP A;  2O6G E;  4HYE A;  5FLX Z;  3MQ0 A;  2CGP A;  4G7H F;  4AWX B;  1H9T A;  3R4K A;  1IZ1 A;  1BM9 A;  1F5T A;  1U5T A;  1WI9 A;  4QWQ A;  2LKP A;  2V1X A;  3HRT A;  2ZME A;  2LSO A;  4EJV A;  4EJW A;  1ZG3 A;  2ZBK A;  2HGC A;  2FE3 A;  1BI3 A;  3ULQ B;  4XLP F;  3MAJ A;  2Q2E A;  3RIR A;  1YQA A;  1FPQ A;  2VOO A;  2OQR A;  3KCC A;  2QBY B;  3NEU A;  4ENM A;  3KLO A;  1LEB A;  4KIF A;  4B8X A;  1G3W A;  1O3T A;  4UHT A;  5EEH A;  2IRF G;  3NQO A;  1Z7U A;  1IN7 A;  3GEZ A;  2L54 A;  1EV7 A;  5K5Q A;  4HF0 A;  5D5V B;  2P4W A;  3WG9 A;  3TOA A;  2PBI A;  2QBY A;  3BDD A;  2DPD A;  1KYZ A;  2GA2 A;  3K1M A;  4ETS A;  4WWC A;  1LB2 A;  4KIC A;  1QZZ A;  1LDD A;  1F1Z A;  2EFP A;  4JBA A;  1KYW A;  3VOE A;  1HSJ A;  5BQT A;  4DNC A;  2ZNY A;  3E5U A;  4M72 A;  3BJA A;  4WXD A;  1Z6R A;  4HV6 A;  4PCQ A;  2YSR A;  4XSX F;  3N4M A;  2AS5 F;  1LEA A;  2P5K A;  5ICG A;  3JTH A;  1FYL A;  4UVC A;  1SD5 A;  1K78 B;  2CSO A;  1LDK B;  2C6Y A;  4MEY F;  4L5I A;  3V8J A;  2Q8K A;  1OYI A;  1D3Y A;  2A6E F;  3F21 A;  4Q5S F;  2F2E A;  2QEN A;  4KMU X;  3V8K A;  1K78 A;  4M6X A;  1YTY A;  4UVA A;  3T8R A;  4GO1 A;  4M9Z A;  3MZY A;  3ERE D;  3S2W A;  3AAF A;  3FMS A;  3FXU A;  1EH6 A;  5D5X B;  1MJ9 A;  5E1Z B;  1JHH A;  2RVC A;  3M7G A;  1DP7 P;  3KP6 A;  1C0W A;  2A07 F;  4A2U A;  4BQA A;  1SD4 A;  1K7A A;  1EH7 A;  4IHS A;  3QP6 A;  1D5V A;  2DPU A;  4N9I A;  4I09 A;  1QPM A;  2QWW A;  4U7B A;  5LRS A;  4I02 A;  1ZRF A;  5FO5 A;  3WE2 A;  3ZN1 A;  5DUI A;  3QU6 A;  2QLZ A;  4R1H A;  4HLY A;  1DPU A;  3GFM A;  4RAZ A;  1XGN A;  2VT2 A;  2GWR A;  3QAH A;  3DPL C;  4CDG A;  2GAU A;  4YFK F;  3KP3 A;  2A61 A;  3CO7 C;  1QQI A;  3F72 A;  4G6D A;  2HZT A;  2ZME B;  5CVJ A;  2LNB A;  2L3D A;  2VXZ A;  4KMF A;  2J5O A;  3EYI A;  4AIK A;  3FWE A;  3DF8 A;  3CO6 C;  3IKT A;  2OQG A;  3WU1 B;  3TO6 A;  4E70 A;  2QVO A;  2F5C A;  2FF4 A;  2PN6 A;  3CUO A;  3TO7 A;  3EYY A;  3E3V A;  3TKY A;  2DBB A;  1TW3 A;  3T0Y A;  3BPX A;  1PDN C;  4AIH A;  3IKV A;  3W6J B;  4GYI A;  2UXX A;  5ICE A;  2IW5 A;  2JRT A;  1B1B A;  1R1U A;  2DK5 A;  2ZO4 A;  3JSO A;  1GHC A;  4FT8 A;  4A0X A;  2KJC A;  3BY6 A;  5DYM A;  2XHK A;  1W5S A;  5E1X A;  2HYG D;  2V79 A;  3HSR A;  5DCF A;  1SMY F;  1FLI A;  2WV0 A;  5CVR A;  5LHH A;  1KA8 A;  1ZRC A;  3MZH A;  1XGS A;  4EJO A;  1IW7 F;  1ZRE A;  1YS6 A;  1ON1 A;  4IHT A;  1A04 A;  2STT A;  1XSX A;  1JGS A;  5HLH A;  4EM2 A;  2FXA A;  2ZCW A;  4S05 A;  3GFI A;  1H0M A;  2ELH A;  1W5T A;  4YIF A;  1HBX G;  1G3T A;  5KVR A;  4KNY A;  5AON A;  4OU0 A;  1XDU A;  2VBW A;  3I59 A;  4XBF A;  1IUY A;  1R22 A;  1RNL A;  4PZJ A;  1W7P B;  2VE9 A;  2MLK A;  3H92 A;  3CLO A;  2ISZ A;  1S7O A;  5F64 A;  1BI1 A;  1OKR A;  2FU4 A;  1T6S A;  3MCZ A;  4HQE A;  4A6D A;  1XCV A;  1IF1 A;  4HLX A;  1O3Q A;  2FA5 A;  4KIB A;  4CYD A;  1BI0 A;  2IJL A;  5IT9 K;  4CHU A;  1TTY A;  2P7C B;  3COA C;  1HKQ A;  3RYP A;  2A69 F;  3CUQ A;  4L18 B;  4KYW A;  1LVA A;  5FFX A;  2L01 A;  4U88 A;  2UWM A;  3K9T A;  4PGH A;  2HQR A;  3R60 A;  2O8X A;  1G3Y A;  5LEJ A;  3FMQ A;  3RYR A;  3HHH A;  4KA4 A;  2OD5 A;  4XLN F;  1FT9 A;  4Y15 A;  3F6O A;  3ABU A;  2H6B A;  1ZG1 A;  2W24 A;  4LG0 A;  4A5M A;  4HX4 A;  3LA3 A;  1JXS A;  3FXR A;  1OYW A;  3L9F A;  3KZZ A;  3RKY A;  5KK1 A;  4BHC A;  1R23 A;  1T38 A;  2EV0 A;  5H6Q A;  2F5E A;  1K6O A;  2P5L C;  3GZ6 A;  5DUK A;  2DFI A;  2HKO A;  4FHT A;  3H3Z A;  1JE8 A;  4CZZ A;  2XUB A;  2ETH A;  3BWG A;  2DT5 A;  4EM0 B;  1S8N A;  1UB9 A;  2FBI A;  2YR2 A;  3RKX A;  1ON2 A;  2VN2 A;  3TGN A;  4LJZ F;  3FF5 A;  2RNJ A;  1S29 A;  5K5R A;  4Q4Z F;  2BYV E;  1TBX A;  2M8E A;  4MQ9 F;  5FGM A;  2K4B A;  2M1B A;  3LWF A;  1R5H A;  3U2R A;  2EA4 A;  4N9H A;  1LNW A;  3T8T A;  4LG0 B;  4MHG A;  3WTW C;  2MD5 A;  1YW7 A;  1ZLK A;  1PUE E;  3I59 B;  4A12 A;  3WTY C;  4RB1 A;  1YS7 A;  5LLQ A;  1R1T A;  5F1R A;  5CLS A;  5DEQ A;  2JPC A;  1QNT A;  2XAJ A;  5JVT A;  1R36 A;  1U5T B;  3HUG A;  3FM3 A;  2FEZ A;  1YG2 A;  4EVI A;  5FLX K;  1L0O C;  2KRF A;  5LHI A;  1YIO A;  3KP5 A;  3WGG A;  4HDV A;  2ZKZ A;  3HYI A;  5DCM A;  4ASN A;  2KIM A;  2K4J A;  3ISP A;  5FD5 A;  1IXR C;  4MTE A;  4ESB A;  3JTG A;  1BJA A;  4EMS A;  4L9V A;  1HQC A;  2P6T A;  2XRO A;  5L3E A;  5HLG A;  3WGH A;  3PQJ A;  4YFX F;  2FNP A;  4ZYG A;  4M74 A;  4N0B A;  3TDU C;  2PQ8 A;  4LD5 A;  4P9F A;  4RAY A;  5D4S A;  3L2C A;  3WE3 A;  4GCV A;  1WSU A;  3I54 A;  3QP5 A;  4H0E A;  4D0P A;  5DDG A;  1IN6 A;  3WOD F;  3K1P A;  1TLH B;  3KP4 A;  2DAO A;  1ZGJ A;  2FML A;  3LQR A;  2X0L A;  2YU3 A;  3SZT A;  1RI7 A;  4WK8 F;  1HW1 A;  2VBX A;  2D2W A;  2JTV A;  3R6S A;  1G3S A;  2X4H A;  4EJT A;  3REO A;  4EGZ A;  1Z05 A;  2CO5 A;  4I01 A;  2V9V A;  4YG2 F;  3E6C C;  1YYV A;  5ILU A;  1KU2 A;  3H3U A;  2GZW A;  4KFC A;  5D5U B;  2PI0 A;  3K1N A;  5D6E A;  2EB7 A;  1G6N A;  1J2X A;  4OMY A;  1IRF A;  3E5Q A;  1J59 A;  2MH9 A;  2GXG A;  2IVM A;  4OOI A;  4Z2Y A;  1TNS A;  1O57 A;  3ABT A;  4IXA A;  4P55 A;  2D1V A;  3FX3 A;  3TDZ C;  3GYH X;  3L00 A;  1U3E M;  3LA7 A;  1USS A;  2KKO A;  3P9I A;  3HHG A;  3SHF A;  1IN5 A;  2OZU A;  3F8C A;  1BOA A;  3VEP A;  2QYO A;  5A2Q K;  2DW4 A;  3HOT A;  1SFU A;  4YII A;  4EM1 A;  4UVB A;  2EFW A;  4JK1 X;  4G6Q A;  2E7X A;  1FBU A;  5LEK A;  4M73 A;  5CJ9 A;  2XKP A;  4BHP A;  1T2K A;  3K2Z A;  2XRN A;  3DXJ F;  3GZ5 A;  2J5P A;  3RKW A;  4O5V A;  3G3Z A;  3L7W A;  5DD4 A;  1RUO A;  5L3D A;  1FX7 A;  4LK1 F;  4OMZ A;  4WXH A;  4XSZ F;  4FX4 A;  3LAJ A;  5JFR A;  5HDG A;  3D0S A;  1ZG5 A;  3F3X A;  5A2Q Z;  2YPR A;  1UCR A;  2BEO A;  5L3F A;  1W4M A;  2Q0O A;  2DQL A;  5CVU A;  1V4R A;  2NNN A;  2ZFW A;  2RKH A;  4Q47 A;  4GXO A;  3EDP A;  2K27 A;  1ZGA A;  3BPV A;  1B4A A;  3E5X A;  3ZMS A;  5K1Y A;  4RGU A;  4RB2 C;  1MKM A;  1X3U A;  2XVC A;  1D8K A;  1HXD A;  4ZYH A;  3J81 Z;  5ICC A;  1QGP A;  2HEO A;  3DP7 A;  3P9C A;  3CDH A;  4G9Y A;  2P6S A;  3O2P E;  3BZ6 A;  4I0B A;  4IJA A;  3I4P A;  1Q1H A;  4F7Z A;  2EK5 A;  4B09 A;  1KQ9 A;  1ZYR F;  2NNY A;  4LLG F;  3HTS B;  1BN5 A;  1L3L A;  3F23 A;  2L4M A;  1XDS A;  3WTZ A;  2HTS A;  3KE2 A;  4HW0 A;  2H6C A;  3KEO A;  3PQK A;  4BYY A;  2UZK A;  5IT9 Z;  3ECH A;  3MFK A;  2MA3 A;  1YW9 A;  4IPA A;  2R7D A;  1REP C;  3BJ6 A;  4LB6 B;  2ZNZ A;  4ENJ A;  3ZP5 A;  4I0A A;  4LGW A;  1LQ1 A;  2H27 A;  1HKS A;  1OYY A;  3U9G A;  1ZAO A;  1ZHF A;  4RB0 A;  2HFH A;  4ZH4 F;  2CFX A;  5ILS A;  4WX9 A;  4A6E A;  2IPQ X;  2HR3 A;  2W25 A;  5JR3 A;  2E1C A;  3OOP A;  4LMY A;  4RS8 A;  1EH8 A;  4OIO F;  3F8B A;  4NB5 A;  1PP7 U;  3GF2 A;  5JI6 A;  1AWC A;  3HSE A;  3SFZ A;  2VBZ A;  2H94 A;  2EJR A;  4TV7 A;  2VC1 A;  2D45 A;  2O0Y A;  3HRM A;  4HDU A;  1XMK A;  3G73 A;  5HVQ C;  1B59 A;  2M45 A;  3MWM A;  2FRH A;  4MGR A;  1WQ2 A;  1YW8 A;  1IN8 A;  4HAM A;  4IRG A;  3E6M A;  2ESN A;  4AD9 A;  5J6X A;  2V6C A;  5ED4 A;  3ZMZ A;  4OIN F;  3LST A;  1BIB A;  4PDK A;  5FFZ A;  1T39 A;  3I0T A;  1R00 A;  4CGZ A;  4EJU A;  2XAH A;  3WTU C;  2ISY A;  2IP2 A;  5D8L B;  3WTX C;  1FYM A;  2FQ3 A;  5DCM B;  3WTV C;  2K86 A;  1W7P D;  2W57 A;  3M1E A;  5ERI A;  3IRR A;  2B0L A;  4KDP A;  2VBY A;  1KQ0 A;  3M8E A;  3Q9V A;  1J5Y A;  1J9I A;  1FP1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...