4HV6A

Structure of mntr h77a mutant in apo- and mn-bound forms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
133
structure length
133
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRAELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 49
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv6A02
1BIBA 2BGCA 4ZYEA 4E70A 2QLZA 3F8CA 1MJBA 4XLNF 2MC3A 1OR7A 5DD8A 3K69A 4IRHA 4I09A 1LDDA 5FGMA 5CVIA 1ZARA 2EK5A 1FBSA 4F7ZA 5A2QK 1Z6TA 3MFKA 3TOAA 1DP7P 2YU3A 2K02A 3BOQA 4GYGA 5HS9A 3ZMZA 2R7FA 4BH9A 4KMFA 5LHIA 1J7KA 2HKXA 1PP8F 4ETSA 2FE3A 3J80Z 2HEOA 3KP7A 1BI1A 2VXZA 3FWEA 4MTEA 1IN8A 1T2KA 2FNAA 3WTUC 2KJBA 1OKRA 2A5YB 3F22A 3VEPA 4IRIA 3M1EA 1T0FA 2LKPA 3QU3A 1STZA 2ACJA 4M9ZA 3N4MA 2FEZA 4HQMA 5LGTA 2DBBA 1O3TA 3VB2A 2WWYA 3SXYA 1ZRDA 3GZ6A 3DFGA 3H3ZA 1ZG3A 1E2XA 3DF8A 1IAWA 1H9GA 5DCMA 3OOPA 2OA4A 3TO9A 3EDPA 1Z6RA 2DQLA 2IA1A 3F6OA 1TBXA 5DDGA 3FZVA 2IRFG 3VFZA 3GW2A 2WC2A 1YS7A 1SMYF 4RB2C 1LDJA 3WU0A 2M8EA 4UVBA 4B09A 1G3TA 1S3JA 4U88A 4CGZA 4RGXA 2ISZA 1QQIA 3LFKA 1LDKB 3LA7A 4WXHA 4A2UA 3E97A 5EEHA 2VBWA 2GA1A 1K78B 3MWMA 3IC7A 2MBFA 1FWZA 1IRGA 1TNSA 3WE2A 3LA3A 1WKMA 4HDUA 3JAMK 1Z7UA 2CG4A 1E17A 5F64A 4OIQF 1G6NA 2JZYA 1GXPA 3IRQA 3M8FA 2VODA 3F6VA 5DV5A 1FOKA 3L09A 2JT1A 3TDZC 4HF0A 2G7UA 1PDNC 1MD0A 3NEUA 3WTTC 2GWRA 4L9NA 5DEQA 3KP3A 4HF1A 4UXNA 4L9VA 1BI3A 4Q4ZF 4S05A 1HKSA 4EJTA 1ZAOA 3P9CA 1KQ9A 5D4RA 3SHFA 1L0OC 2RC4A 3TGNA 1IW7F 4BXUA 3RI4A 4HDVA 2OZUA 2VT3A 2DLLA 1FPQA 3CUQC 1XSDA 2PN6A 4KIBA 4IF4A 5L3FA 1XB4A 3K1MA 3QP6A 3HTUA 1QPMA 1XSXA 3IHUA 1S8NA 5D8LB 2F5FA 2VE8A 2M87A 5ILVA 2JPBA 1JGSA 3H92A 1SFUA 2XV4S 3BJ6A 1F1ZA 3QRFF 2CWEA 1B1BA 1I1GA 1F4KA 2KRFA 5IT3A 4G7OF 2YSRA 4HYEA 1XGSA 5LGNA 3U1DA 1XD7A 3L2CA 1O3RA 3R61A 2RNJA 4AIKA 4P55A 1J9IA 2D1HA 4EJUA 2LNBA 2GA2A 2XUBA 4BNCA 4HBLA 5E1ZB 1I5ZA 2EWNA 2H94A 4N9HA 3P9KA 2DO7A 3V8JA 1O57A 3O3KA 2Z33A 2Z9OA 3J81K 3ROUA 1TW2A 2VBZA 4GCVA 4IHSA 2O0YA 4RS8A 3ABTA 4EM0B 3JTGA 5HS8A 2K4BA 4GYIA 2JSCA 1ZREA 4I01A 1Z9CA 2QBYA 3C7JA 1D8KA 5KK1A 3F3XA 1YTYA 4MEXF 1Q1HA 2GXBA 3W6JB 2XAFA 3ZMVA 3IL2A 1K7AA 2B0LA 2OBPA 1FLIA 1USSA 1FZPB 3BDDA 2ZMEA 4PCQA 2R7DA 4PGHA 4OIOF 4ZZLA 4XLPF 1OYYA 5ERIA 1UCRA 2PEXA 4HZFA 2A6HF 2L3DA 2QENA 2Z5UA 2FA5A 2XGXA 2E7XA 2LF7A 4OOIA 2HGCA 1EV7A 1R1VA 2A3SA 4RGUA 3V8KA 3ECOA 5HDGA 1WI9A 3T1BA 4Y15A 1HW2A 5E18F 2HYFA 4H0EA 4ESJA 4PZJA 4ZYGA 3RPQA 1I6XA 3H3UA 4QWQA 2QUFA 4NQWA 5FFXA 1SAXA 5AIPA 2XASA 3KCCA 4O6JA 4LLLA 4DQ2A 5HOOA 1LJ9A 3DXJF 4N0BA 2D1VA 2L54A 1XCVA 5HLIA 1LQ1A 2OQRA 1H0MA 3CTAA 3HOSA 2ZJ2A 2DK8A 1FSEA 4KT5C 6PAXA 4UNOA 4LK1F 4IVNA 3WTSC 2VC0A 1JHHA 3CUOA 2Y75A 2HDCA 4EJWA 3E6DA 2UXXA 1LEBA 4OMZA 2XKPA 4WK8F 2HYGD 1FY7A 1YW9A 2BYVE 2X4HA 4ASNA 2PG4A 2P6SA 1SFEA 3F23A 1O7LA 3KETA 3P9IA 1MGTA 2ESHA 4UV9A 5BOXA 1KU3A 3GXOA 2V6CA 4G94A 1IRFA 2VBXA 2UXNA 3BJAA 4DNCA 4R8HA 3I58A 5DCMB 1BC8C 4MEYF 4ENMA 4HX8A 2DU9A 1H9TA 3RJPA 1S7AA 2ZFWA 3QAHA 2OZ6A 1ZLKA 3NQOA 4N9IA 4G7ZF 5D4SA 3FMQA 3M9AA 5J6XA 4U7BA 1SD6A 3CJNA 2YX7A 1FX7A 2QYOA 3IWZA 3FM5A 3AAFA 1ZG1A 3R0JA 5CJ9A 3HHGA 4MTDA 3D5LA 1R22A 1ODDA 3L00A 4QLCU 4LFUA 1DDNA 2P8TA 1F5TA 5LRSA 3FMSA 3GZ5A 3KLNA 1R5HA 4U0YA 4LG0A 2XROA 3REOA 2K7LA 1W7PA 4Y17A 3HIFA 4L18B 4CZZA 3BWGA 2J5PA 1FNNA 4BHPA 1Z1DA 3DPTA 1W4MA 3MZHA 5E17F 2WV0A 1J0RA 1REPC 2J5OA 3IKVA 4EV0A 2W57A 4BHCA 3FHZA 2XVCA 4ZYHA 5IT9Z 4YFNF 1YQAA 2QWWA 4I02A 2BEOA 4TV7A 3WGGA 2O6GE 5LLQA 1FT9A 4CO8A 3BY6A 5K5OA 1O7FA 3O6BB 1U3EM 2FXAA 1XSVA 3V4GA 2D2WA 2E1NA 3KP5A 3ML6A 2QQBA 2YR2A 3BROA 2PMHA 1B9NA 5HDKA 1U6GA 5JVTA 5L3EA 4P96A 4P9UA 1SD5A 2ZBKA 3QOPA 1G3YA 4HV5A 5TJJA 4UV8A 3K2ZA 4OU0A 2RKHA 5CVUA 3EUHA 3RYPA 5IT9K 1XGOA 3TOBA 3BPXA 1OYIA 3RDIA 3I54A 2HKOA 4HW0A 3GFLA 4R79A 2HQNA 2ESNA 3J80K 2Q2EA 5H20A 1HSTA 3E5UA 1J5YA 3TO6A 3ZN0A 3EQLF 3CO7C 1RUNA 4MHGA 3CUQB 3FXRA 2O3FA 2Y0MA 5HVQC 4KICA 3HRTA 4AWXB 5LEJA 1IUYA 2QBYB 5F6FA 4HX4A 4M73A 2H6CA 1FBUA 1R00A 2ELHA 3C1DA 5D5VB 2W85A 1FBQA 5J8CA 2NS0A 3KP2A 1YS6A 5ICFA 2ZMEB 1ZRFA 1G3WA 4NB5A 2HOEA 2CO5A 5AONA 3ZP5A 3DPLC 4KN7X 1BBYA 3T5XA 1XMKA 1TTYA 2Y48A 3T8RA 5K5RA 1S29A 1ZN2A 2KIMA 2C6YA 1XN7A 3KP6A 3KP4A 3F21A 1SFXA 1U5TC 1CF7A 3ZMTA 4EM1A 3C3WA 3GFJA 2A07F 1YYVA 3RKYA 5FD6A 4OIRF 2F2EA 2V1XA 4LLGF 1TQMA 2RQPA 2RDPA 5BS6A 3KLOA 3P7NA 3I5UA 2PI0A 2PMUA 2E7WA 1FYLA 1XGNA 2HS5A 2QQAA 3C18A 2O61A 3QP5A 1TLHB 1UHWA 2RV8A 1C0WA 4ESBA 2FQ3A 3LAJA 2ZO4A 1IXSB 5J8FA 2H09A 5JR3A 1KA8A 3KZZA 5ED4A 3V7SA 5FFZA 5L3GA 4Z2YA 1B4AA 1QGPA 3B73A 3V7RA 4BYYA 4I0AA 4MQVA 3R60A 2NYXA 2P5VA 5DUKA 3ERED 1ZRCA 1FYMA 1T6SA 3ELKA 4EJOA 2OQGA 3K9TA 5E20A 5FD5A 1YW7A 1ONVA 2R3SA 2LSOA 2NRAC 4IPAA 1ON1A 2K27A 4CICA 3MCZA 5D6FA 2GXGA 3VOEA 1RUOA 2M5WA 1ZH5A 2HR3A 4FX4A 1D5VA 1J75A 1EH8A 3U2RA 3PQJA 4L0ZB 3DEUA 3LAPA 3HSFA 1V3FA 3K0LA 1T38A 1CGPA 3CUQA 2IW5A 4OINF 3SFZA 3HOTA 4LB6B 4YFKF 4O3MA 4MQ9F 1R36A 4KA4A 2XKOA 3I71A 4ZH4F 1S7OA 4MNUA 4RAYA 1AOYA 2VBYA 4KN4X 2ZNZA 2VT2A 3KFWX 2AS5F 3SZTA 1ZG5A 1U2WA 3ZQ7A 3NRVA 1OYWA 4U0VA 2KIFA 4AIHA 5LBQA 3WTYC 4FT8A 1QZZA 4PGGA 3E5XA 4WWCA 2EFPA 5LHHA 5CYVA 3GYHX 4XSXF 4EGYA 1V4RA 5CVVA 1KU2A 5L3CA 3MZYA 5F1RA 1IZ1A 2FMYA 2HWVA 4LG0B 3HSEA 2CGPA 1W7PB 4Q47A 2FU4A 3R0AA 4A0XA 1BIAA 3DQVC 2XHKA 2L02A 2V1UA 2CW0F 2VONA 1Z91A 2COMA 4A12A 2DQRA 3V7CA 2MH2A 4KFCA 1I27A 3N97A 4M9XA 2LF8A 4EQQA 4G6DA 2XAHA 1YG2A 2CYYA 2DFIA 3RTRA 1JE8A 1ZGJA 2ZKZA 2EV6A 1KYWA 3EYYA 1TW3A 2EA2A 3E5QA 3DKWA 3ZMDA 3E3VA 2XRNA 5FO5A 2L4AA 2L4MA 5DCFA 5BPIA 4A5NA 2FF4A 3F8NA 3I53A 4AVPA 4RB1A 3E6MA 3FMRA 4YFXF 1VTNC 3T8TA 4L5IA 2PQ8A 1YO5C 3RYRA 3HUGA 1DPUA 3QPTA 1YW8A 3WTWC 3E6CC 3TO7A 4OIPF 3FF5A 2K86A 4LLNA 2JPCA 3KEQA 1GVJA 3KEOA 4WXCA 1TQPA 1IN5A 4M6XA 2EB7A 1TNTA 1UFMA 3WTVC 5ICEA 3S2WA 2DPUA 1X3UA 4ESFA 3MEXA 1HKTA 4HLYA 2ZNYA 3ZN1A 2OU2A 1MJAA 3GEZA 2MLKA 3ZMUA 2W24A 3O2PE 2QVOA 2CSOA 3GO5A 4XSZF 5HLGA 3Q9VA 4S04A 3ZPLA 3JSOA 1NHAA 5K5QA 3HRUA 3JTHA 4G6QA 3COAC 4AIJA 3HYIA 5CVRA 3EYIA 1R23A 2DTRA 3Q9SA 3KE2A 5BQTA 1EH6A 1HW5A 3GLXA 1GXQA 4UUVA 3L7WA 2FBHA 2RN7A 2A6EF 2FNPA 2NAZA 3E6BA 4G8XA 4ENJA 4Q5SF 1P4WA 3V8LA 4HOBA 2FRHA 1B9MA 1CF7B 4RGRA 4CXFA 3KZYA 5K1YA 2F5CA 1MKMA 5LGUA 4XBFA 2ZCWA 2GZWA 3I0TA 3WG9A 5LEKA 1B59A 2H6BA 3BJOA 3LWFA 1I1SA 1K6OA 1HXDA 2KKOA 1P4AA 2XIGA 1MZBA 2LDUA 3GX4X 1MDMA 4L0YB 1SD7A 4YIIA 3IKTA 4WX9A 4EM2A 2FBIA 1PUEE 1BI0A 4HA8A 4G7HF 2HQRA 2Q0OA 4LD5A 1BN5A 3K1PA 5FLXZ 2QZ8A 3GFMA 3F8BA 3K1NA 3JW4A 2GIVA 5HLHA 3F8MA 4HF2A 4IHTA 4KUMA 2JRTA 2MA3A 2P5LC 5JHUA 4ZZDA 1ZLJA 3TKYA 3HTSB 3WE3A 4A0ZA 3FXUA 3J7AO 2P7CB 2D45A 3RPUA 5ILSA 5H6RA 4IRGA 4RB0A 1ULYA 1U78A 2CQKA 4IXAA 3MQ0A 3GWZA 1IF1A 1U5TB 5E8IA 3JAMZ 4P9FA 4L5JA 5CVJA 1QO0D 3IWFA 4RGSA 3W6KB 1FP1D 2P5KA 2GQQA 2FBKA 2DW4A 3WTZA 2HZTA 1AWCA 2ISYA 4KYWA 4A0YA 2A61A 2OAZA 2DPDA 2G9WA 4WF2A 4OMYA 4KNYA 2FSWA 4G9YA 4MGRA 1T39A 2Q8KA 1LB2A 5DUIA 5FLXK 1WWXA 5D8KB 4AD9A 3WU1B 1KU9A 3GF2A 2G7HA 1BM9A 2VE9A 4U0WA 2XAJA 1B6AA 2HTSA 1R5GA 2M45A 5D5XB 1HQCA 4HX7A 4M6YA 3GUDA 2DK5A 2BBYA 1BC7C 4A6DA 4EVIA 2K4JA 5AIQA 1R1UA 1JHFA 4P5OA 4WCGA 2PJPA 5FB2A 3BZ6A 1PP7U 2VN2A 2MLGA 5H6QA 1FP2A 4KMUX 1EH7A 3PQKA 2EJRA 3GFIA 1WSUA 2ADUA 3HHHA 4ON0A 5L3DA 3PFIA 1ON2A 4EJVA 2ZXJA 3F72A 4R1HA 5ILUA 1Z05A 4PDKA 4IJAA 5BPDA 2O8XA 3QPHA 1HBXG 4HV6A 4HLXA 4BAYA 2NNYA 1P6RA 4UHTA 3SZPA 3DP7A 1DPRA 5DYMA 4BHBA 5D5WB 1BI2A 5JFRA 2BV6A 4FHTA 2XAGA 5CLSA 3QU6A 2ETHA 1QZYA 4I7HA 4LGWA 3J81Z 4EGZA 4M9SA 2EV5A 3LQQA 2W84A 2H27A 2M30A 2PFBA 4D0PA 2V9VA 2IT0A 5TRDA 2DT5A 3G73A 3LA2A 4JBAA 2WTEA 3ISPA 1YIOA 3RKXA 1IN7A 3R4KA 1J59A 2VC1A 1OPCA 5D5UB 3RKWA 1BOAA 1ZHFA 3Q5FA 1U5TA 2EFNA 3I4PA 1FC3A 3FX3A 4LMYA 1WQ2A 3HSRA 4Q48A 3LQRA 2E1CA 1R58A 1RNLA 4ENNA 2HFHA 5JI6A 2QM3A 2RVCA 1BJAA 4GO1A 4KIFA 1WRJA 1GHCA 1G3SA 1R7JA 2FMLA 4I0BA 2W25A 5E8GA 2UWMA 1LNWA 4XRFA 3BPVA 2EFWA 3ABUA 2YPRA 5KVRA 2STWA 2PBIA 3HRSA 1W5SA 4UVAA 4ENKA 2IJLA 4FX0A 3CDHA 3R6SA 2IVMA 1K78A 3M8EA 2NNNA 3MAJA 3ZMSA 2KIUA 3GVAA 1RIOH 2JTVA 1U8RA 4I2OA 2BE5F 3SQNA 1HSJA 4EMSA 3F8FA 2IA2A 3ECHA 1IN4A 4M72A 4UVCA 1SD4A 4Y13A 2RGVA 1IXRC 1HKQA 3B02A 2O03A 3DV8A 2PLYA 2IA0A 1O3SA 1KU7A 2Z3YA 2DAOA 1IXCA 2EV0A 2FOKA 4CYDA 2P4WA 3I64A 1SMTA 1F9NA 4NHJA 5E1XA 1YFHA 2P6TA 1KQ0A 4HAMA 3WTXC 2AXLA 5ICGA 1J2XA 2EFOA 2V1DA 5BMZA 4JQFA 2MH9A 4KIGA 1UB9A 1YLFA 1P92A 1JXSA 2L01A 2DI3A 4JK1X 4YIFA 1T98A 3I59B 4L9JA 1D3YA 5LHGA 3WODF 4CHUA 1XDSA 1HW1A 1TQIA 2TDXA 1MJ9A 2IP2A 1W7PD 3EETA 2M1BA 1RI7A 1QNTA 4M71A 1K79A 4ZYDA 2YX4A 2MD5A 1OMIA 1MDMB 3TQNA 1R1TA 2XAQA 4K2EA 5LRRA 2A69F 1A04A 2VOOA 1ZGAA 3M7GA 3ULQB 5HDNA 1LVAA 1XMAA 1USTA 2F5DA 4LJZF 5L3BA 3HRMA 1FYKA 2OD5A 4KDPA 3IRRA 2P7VB 3JSPA 1ZYRF 1IN6A 4HQEA 5ICCA 1L3LA 5HS7A 4RAZA 5D6EA 1UHMA 3VODA 3OV8A 4GGGA 1KQ8A 3L9FA 3CLOA 2HTJA 4RB3C 4LB5A 1LEAA 2VOPA 3LSTA 3D0SA 3FXQA 2F5EA 4WXDA 2EFQA 3WGHA 4A5MA 2STTA 4M74A 3FM3A 3G3ZA 4CDGA 2Z99A 1QBJA 1G4DA 2X0LA 1P2FA 5E1WA 1W5TA 5A2QZ 4B8XA 4BQAA 3U9GA 2KJCA 4LK0F 1S6LA 4GXOA 2QQ9A 1FSHA 1XCBA 4L9TA 3T0YA 2A68F 1XGMA 1DUXC 2UZKA 4O5VA 3TDUC 3RIRA 1KGSA 1Y0UA 4A6EA 4U7DA 1D8JA 1P4XA 4YG2F 2IPQX 1KYZA 3WGIA 3CO6C 2CFXA 1XDUA 5DD4A 5EEGA 2EA4A 3I59A 2V79A 3BP8A 1RZ4A 2GAUA 1O3QA 4I98B
chains in the Genus database with same CATH superfamily
1BIBA 3CJRB 2BGCA 2DFEA 4E70A 2QLZA 4ZYEA 3F8CA 1MJBA 3M1CA 4XLNF 1X1PA 5EYRA 3EUHC 2MC3A 1OR7A 5DD8A 3K69A 3CC7I 4BQNA 3KYLA 4IRHA 3BTCA 1R49A 1BW5A 4I09A 3I56I 1LDDA 5FGMA 5CVIA 1ZARA 4UUSB 2EK5A 1OFCX 1FBSA 2MVTA 1QU3A 4F7ZA 5A2QK 1Z6TA 2CU7A 2VJIA 3MFKA 2LY9A 3BG5A 1MH4A 3TOAA 1DP7P 2MG4A 2YU3A 2JA6J 3BLYA 2K02A 3BOQA 3CC2I 4GYGA 1VQ4I 5HS9A 5F1JA 2R93J 3ZMZA 1ZKGA 2R7FA 1VQPI 1S5LC 4BH9A 4KMFA 3CZ6A 4UY8I 1YITI 2VUMJ 5LHIA 4I6ZA 1J7KA 2HKXA 5F0HA 1PP8F 3E0JB 3BC8A 4ETSA 5IYBJ 2FE3A 3J80Z 1JI8A 2HEOA 3KP7A 2XGEA 1BI1A 1M1EB 1YOVB 2VXZA 3FWEA 4MTEA 2AQEA 1IN8A 1T2KA 3HOWJ 2FNAA 3WTUC 2KJBA 2M0CA 2HVRA 1OKRA 4PJNA 2A5YB 2XGCA 1YJWI 3F22A 2CRGA 3VEPA 4IRIA 3M1EA 1T0FA 2R7QA 4CCMA 2LKPA 3QU3A 3QPLA 1STZA 2ACJA 4M9ZA 4B3XA 2H8RA 2Y30A 2FEZA 4HQMA 3H9QA 4XRSA 3N4MA 5LGTA 2H8WA 4NC7A 5JLWA 3GTPJ 2DBBA 1O3TA 5K7FA 1EJ9A 1ETYA 3VB2A 4LOCA 3S14J 2WWYA 4D9JA 3SXYA 5JLXA 1ZRDA 3C2GA 3GZ6A 4M3BA 5C3EJ 3DFGA 3H3ZA 1ZG3A 1E2XA 3DF8A 4J00A 1A35A 2F4IA 2KMUA 5IY5H 1SAUA 3IUOA 4DZJA 1IAWA 1H9GA 2MGQA 4Y33A 5DCMA 3OYGA 3OOPA 2OA4A 3FXJA 3TO9A 3L2WA 3EDPA 1G2HA 3OY9A 1Z6RA 2DQLA 3ABKH 2IA1A 3F6OA 4M6VA 2ELJA 1TBXA 4ZTFA 5DDGA 3J81R 3FZVA 5FKMA 4DOZA 2IRFG 3VFZA 3GW2A 1WCMJ 3QQAA 3BCAA 4G6TB 2WC2A 2IBDA 1YS7A 2N8GA 1SMYF 2XRLA 4RB2C 3LSIA 1OISA 1LDJA 1IDYA 3WU0A 3VYSB 4QPOA 1G8XA 3RCOA 2M8EA 3CCVI 3ZQHA 1RQ6A 2XB5A 4UVBA 4BJTA 4B09A 1MMGA 2Y2ZA 1G3TA 1XTAA 1S3JA 2KIQA 3NWSA 3MKWB 1BJZA 2E2IJ 4I76A 2CQQA 2UUZA 4U88A 3H5RA 4CGZA 4RGXA 1JGGA 3CCJI 2ISZA 1QQIA 3LFKA 1LDKB 3LA7A 2DMNA 4WXHA 1OQYA 4A2UA 3OR2C 3E97A 5EEHA 2VBWA 3HXLA 2GA1A 1K78B 2Y9YA 1RKWA 4OAYA 1BW6A 3MWMA 1YIJI 5F27A 1VFCA 3IC7A 2MBFA 1FWZA 1IRGA 1TNSA 3WE2A 3LA3A 2WB1A 4AYBA 1WKMA 2HI3A 2V9PA 2B9SA 4HDUA 1Z3XA 1Z7UA 3JAMK 4L5EA 2CG4A 1E17A 2JA2A 2PX9A 5F64A 2ZSHB 4OIQF 1G6NA 4C2TA 2L9SA 2JZYA 2Z1DA 1TT0A 2JVHA 1GXPA 4BS9A 4BY1J 3OL3A 3IRQA 3LL7A 2VLAA 3M8FA 2VODA 1TC3C 3VSKA 1IDZA 1X1DA 3F6VA 2WY7Q 5DV5A 1FOKA 3L09A 2JT1A 3JRFA 3TDZC 4HF0A 2HDDA 1X58A 2G7UA 1PDNC 1MD0A 2ID3A 3NEUA 3WTTC 2GWRA 4L9NA 5DEQA 4QTRA 3KP3A 5E3MA 2WV1A 2RAEA 4OAZA 4HF1A 4UXNA 3BTLA 4UUSA 4L9VA 3RZOJ 1BI3A 5J1UA 4Q4ZF 4S05A 4FQGA 1HKSA 3MD2A 1TL8A 4EJTA 1ZAOA 2ZJQF 3P9CA 1KQ9A 3KPHA 5D4RA 3SHFA 1L0OC 2RC4A 4C9YA 3TGNA 4YIRX 2L7FP 3AL0B 3A0BC 1IW7F 2VJJA 2Y0SA 1MBFA 2CQXA 4BXUA 3RI4A 1K61A 4HDVA 2OZUA 2VT3A 2DLLA 2F6CA 1FPQA 3HPHA 3CUQC 5F0FA 1XSDA 2PN6A 4KIBA 4IF4A 5L3FA 1VQLI 1XB4A 2E5NA 3K1MA 3QP6A 3HTUA 2X6XA 3OYIA 3BG6A 1QPMA 1XSXA 2BVLA 3ABMH 3IHUA 1RKTA 2ICWG 1S8NA 2IGMA 3PUFA 2F5FA 2IGKA 2VE8A 5D8LB 2ZC2A 2M87A 2VASA 5ILVA 2JPBA 3EUAA 1JGSA 3CF2A 1Z77A 2HZDA 3H92A 1SFUA 1VQ7I 3G1LA 3GLLA 4RAGA 2MUNA 2XV4S 3BJ6A 1F1ZA 4E7SA 2X51A 3AG4H 3BR2A 4P1WA 3QRFF 2CWEA 1ZELA 1B1BA 3PNVA 4XLAA 4A3BJ 1ZTRA 1I1GA 2BW3A 1F4KA 1MSEC 2KRFA 4RA2A 2LR8A 5IT3A 4G7OF 2YSRA 3ASOH 5K7HA 4HYEA 1XGSA 5LGNA 3U1DA 1V5EA 2O5RA 1XD7A 2P81A 3L2CA 2LG4A 1O3RA 3R61A 2RNJA 4AIKA 4Y52J 4P55A 1GT0C 1TZLA 2D1HA 2X9DA 1J9IA 2DA4A 5FROA 4EJUA 2LNBA 2GA2A 2XUBA 4CUGA 4BNCA 5FRMA 4HBLA 5E1ZB 1I5ZA 2EWNA 2H94A 4N9HA 1RC9A 1SFKA 3P9KA 2IEKA 2DO7A 2EZIA 2V4JC 2V7FA 3V8JA 4MFDA 1O57A 3LSRA 2E2JJ 3O3KA 1WPKA 3OYHA 3DBLB 4XIDA 2Z33A 3AKZA 2Z9OA 3J81K 3ROUA 3HGGA 1TW2A 1LVKA 2VBZA 4GCVA 3I4NJ 3H0DA 2H1KA 4IHSA 4JOMA 3JREA 4A3JJ 2O0YA 4RS8A 2FD5A 3AG3H 3ABTA 1X1BA 2KHMA 3CCSI 2WBMA 4EM0B 4X1EA 1H8AC 2QCOA 3E7LA 5HS8A 4X0GA 3JTGA 3CCUI 2K4BA 4XLCA 4GYIA 2JSCA 1XX5A 5CQEA 2R92J 1ZREA 4I01A 4UB8C 2LBFB 1Z9CA 3C7JA 2QBYA 1D8KA 5KK1A 3F3XA 1JKRC 1YTYA 1Y56A 4MEXF 1GUUA 1Q1HA 2GXBA 2JQ7A 3W6JB 2E2HJ 2LRDA 2XAFA 3K4BA 2KZGA 4BUPA 4E6KG 5CQGA 1JJ8C 3ZMVA 3IL2A 2QSFX 3ZRGA 1K7AA 2B0LA 4BQQA 3MKYB 2OBPA 1FLIA 3IV5A 1USSA 3DKXA 2VKHA 1FZPB 3BDDA 2ZMEA 4J19A 4PCQA 2TRTA 1UZCA 3P5JA 1T33A 2R7DA 4PGHA 4OIOF 4FE4A 1ETVA 4ZZLA 2VQLA 2CQNA 2BZTA 4XLPF 1OYYA 5ERIA 3GTMJ 1MNMC 1UCRA 4I99C 5IP6A 3O8HA 4C30A 5GAEJ 2L9VA 2PEXA 4HZFA 2A6HF 2QEXI 2L3DA 3DWLE 1X2NA 2QENA 2Z5UA 3CCMI 2FA5A 2ZSIB 5JVGF 2WAQA 2XGXA 3PL8A 3S15J 2E7XA 2LF7A 4OOIA 2HGCA 2XPVA 4BJ5C 1EV7A 1R1VA 2AQFA 2BXYA 3GCMA 2A3SA 4IQ4A 3S16J 2CMPA 4B47A 5IYDJ 3HZJA 3K4MA 4RGUA 5FLMJ 3V8KA 2DA2A 3DLLF 3ECOA 5HDGA 2CS3A 1WI9A 4MIMA 3B6AA 4Y15A 3T1BA 1HW2A 2DMUA 5E18F 2RQQA 2HYFA 2CW8A 5FKNA 4H0EA 5A2QR 4ESJA 4PZJA 5IP7J 4M3FA 4ZYGA 1QVTA 5EZGA 4E7JA 3RPQA 1I6XA 2ZFUA 3H3UA 4QWQA 2IS4A 4BY7J 1X3WB 2QUFA 4NQWA 5FFXA 2F4MB 1SAXA 5AIPA 2DN0A 2XASA 4FASD 1DU0A 3KCCA 4O6JA 4LLLA 4DQ2A 1Z67A 1Y0NA 2CUZA 5HOOA 3SFIA 4A69C 1LJ9A 3DXJF 4N0BA 2D1VA 2DJNA 2L54A 3ZQGA 3DPUA 2I8DA 1ZGWA 1XCVA 2V26A 2VL8A 5FLVA 3HOXJ 2B63J 1ACIA 5HLIA 1LQ1A 2OQRA 1MIJA 1H0MA 5EG0B 3CTAA 3BCBA 3HOSA 2ZJ2A 3QYBA 4S0HB 1AKHB 2DK8A 1FSEA 4KT5C 4BE2A 6PAXA 3Q0VA 5GP9A 2HVSA 4LK1F 4IVNA 4UNOA 3WTSC 2VC0A 1ERDA 3AG2H 4YELA 1YHQI 1JHHA 1WI3A 3CUOA 2Y75A 2WAEA 2HDCA 4A3LJ 4EJWA 3E6DA 2UXXA 1LEBA 2ZXIA 3OR1C 2VIXA 4OMZA 2XKPA 4WK8F 1ETWA 2HYGD 1FY7A 1UELB 2OCEA 2CV0A 2XF6A 1TWHJ 1YW9A 2BYVE 2X4HA 2XAUA 3ABLH 4XOPA 4ASNA 2WY8Q 3F0CA 3TW6A 2PG4A 2P6SA 1SFEA 3K4CA 5KNLA 3F23A 1O7LA 3FK7A 3KETA 3P9IA 2L9RA 2M7AA 1B8IB 1A5JA 1MGTA 1G59A 2ESHA 4UV9A 3IP4B 3VDXA 4XRMA 5BOXA 2MC4A 2CW7A 1KU3A 3GXOA 2V6CA 4G94A 1WJCA 3BZKA 3TW7A 1ETQA 1IRFA 2VBXA 4XQFA 1IO2A 3BZCA 3A01A 2UXNA 3VYUB 3BJAA 4DNCA 4R8HA 3JRDA 3I58A 5DCMB 3HBLA 4JX4A 1BC8C 4A3GJ 2M3AA 4MEYF 4ENMA 4HX8A 2DU9A 2B7EA 2XB0X 4DYQA 2NOGA 2BY1A 3DBRB 4BXFA 4DZPA 3J80R 4BBRJ 1H9TA 2JUCA 2Q1ZB 3RJPA 3RPUD 1YX3A 1S7AA 2FOWA 3OYMA 3S32A 2ZFWA 1HDDC 5C4JJ 3QAHA 2OZ6A 4M3EA 1ZLKA 3ASNH 3NQOA 4N9IA 1XC5A 1VQ9I 1BA5A 4XRSG 4G7ZF 5D4SA 3PUBA 2KPMA 3OYJA 3FMQA 3M9AA 5J6XA 4U7BA 1O4XA 3DU6A 1YI2I 3L2RA 1SD6A 3CJNA 1D1AA 2YX7A 3Q0UA 4CCNA 1FX7A 2QYOA 4LIVA 2UV1A 3CDLA 2L2OA 3IWZA 3FM5A 3AAFA 3VWBA 1ZG1A 3R0JA 5CJ9A 3HHGA 3JAMR 4MTDA 2X1EA 3D5LA 1N25A 3J7AW 1R22A 1D0ZA 4PJ0C 1ODDA 2TCTA 3L00A 4QLCU 3OYDA 4LFUA 1FIPA 3DTKA 2DA7A 3CMYA 1DDNA 3PSFA 2R7UA 2P8TA 3UR3C 1F5TA 4ZJZA 2EINH 4A3IJ 2LVSA 5LRSA 3FMSA 3GZ5A 3HM5A 3KLNA 2E60A 1R5HA 4U0YA 4LG0A 2XROA 1K4TA 3REOA 4IX7A 1IUFA 1P7IA 1W7PA 2K7LA 4Y17A 2XC7A 2IS2A 3HIFA 4BE1A 2VPRA 4L18B 4CA0A 4CZZA 5HLTA 3M07A 3BWGA 5K7ZA 3J7AY 1MMNA 2J5PA 1H88C 1ETXA 1FNNA 2EIJH 4BHPA 1Z1DA 3DPTA 1W4MA 2H1LA 2HNHA 4DBRA 2HOTA 3DTIA 3MZHA 3BQZA 1DQUA 3FXLA 1UMQA 5E17F 2WV0A 1YJNI 3FDYA 4EEFG 1J0RA 4A93J 1REPC 2JRMA 1IRZA 2DT7B 3M3YJ 2J5OA 3HOUJ 2ELKA 2LTPA 2KDOA 3G71I 1GV5A 4JYKA 1OJLA 3IKVA 2W57A 4BHCA 4EV0A 3FHZA 1IG7A 2XVCA 1MNDA 2I10A 2KP6A 4ZYHA 2Y69H 5IT9Z 2L9NA 2LOOA 2K3PA 4YFNF 1YQAA 2VB6A 2QWWA 1SVMA 3RQ4A 5EG0A 2OJED 4I02A 2BEOA 1WJBA 4TV7A 1AKHA 3LOCA 3WGGA 1OCTC 3MKLA 1K4SA 1VQ5I 2O6GE 2R7RA 5LLQA 5B1BH 1JTYA 1FT9A 4CO8A 3BY6A 5K5OA 1O7FA 1DGRM 2E19A 2K85A 1R9TJ 3O6BB 1U3EM 1N75A 2FXAA 1MW7A 1W5CC 5FKKA 1XSVA 4D7MA 3V4GA 1X3ZB 2K9QA 2D2WA 2GLOA 2E1NA 3KP5A 3ML6A 2QQBA 5IPAA 4F91B 4AU7A 1EF4A 3F9KA 3GTQJ 1RETA 2YR2A 3BROA 4E7KA 2HQAA 2PMHA 3DCFA 2GOMA 1B8IA 1B9NA 3DLAA 5HDKA 1FOXA 3D5SC 2BW3B 2OC6A 1U6GA 2IAIA 5JVTA 1OCRH 2CH0A 2P0WA 3KEYA 3TP0A 1I3AA 2V9KA 4P96A 5L3EA 5H2FC 2PMZA 4ITVA 4P9UA 2KFDA 1SD5A 2ZBKA 3QOPA 2QSHX 4BGDA 1TP4A 4GRIA 3CC4I 1G3YA 1NH3A 4JX6A 4HV5A 5EGOB 4XKVA 2R5ZB 5TJJA 4UV8A 4AVZA 4AM3A 3K2ZA 3QOEA 2MSYA 3S2HJ 4OU0A 2RKHA 5CVUA 2JN6A 1BR1A 2ECCA 2EZHA 3EUHA 1VQOI 4DGWB 3LFUA 4QSHA 4A3DJ 1VQ6I 3RYPA 2HXOA 2NS7A 2HU9A 5IT9K 1XGOA 3TOBA 3BPXA 1OYIA 2A5WA 3OIQA 1S72I 3W6VA 3RDIA 4CSWA 3I54A 2HKOA 2YUSA 4HW0A 3GFLA 4R79A 1POGA 2HQNA 2ESNA 3GTOJ 4XN3A 3J80K 2DMPA 2Q2EA 2R7ZJ 4NDLA 1WJFA 2BVMA 5H20A 1HSTA 3E5UA 1J5YA 3TO6A 3ZN0A 3HDDA 1Y6IA 2MW8A 1AA7A 3EQLF 2ZJRF 3CO7C 1RUNA 3L2QA 4MHGA 2JA8J 2DA1A 3CUQB 2ZXHA 3FXRA 3GZNB 2DYRH 1PJRA 2O3FA 2Y0MA 2VQGA 4KICA 3HRTA 5HVQC 1RR8C 4AWXB 5LEJA 2IS6A 1IUYA 2QBYB 5F6FA 4HX4A 4M73A 2X48A 1MBHA 2H6CA 2KZVA 1WZ2A 3K4JA 1FBUA 2WB1N 4AYBN 2JA5J 4FTHA 1R00A 2ELHA 3C1DA 5D5VB 3KZIC 2M2EA 2W85A 3K7AJ 1FBQA 5J8CA 2HXIA 4GDFA 2NS0A 3KP2A 1YS6A 2ZXWH 5ICFA 2ZMEB 5KCMA 3JRAA 2LP0A 1ZRFA 1G3WA 2DJIA 4NB5A 2HOEA 2CO5A 4C3JJ 4Z6YA 3G6EI 1QVUA 5AONA 3ZP5A 3DPLC 4KN7X 1BBYA 3T5XA 1XMKA 1TTYA 1U9NA 2Y48A 1ETOA 3T8RA 2K9MA 4IHYA 5K5RA 5J1RA 1S29A 1ZN2A 3OYEA 1IGNA 3OOUA 2KIMA 2C6YA 1XN7A 3KP6A 3KP4A 4DJAA 4BEHB 1R4MB 4CH7A 2HDWA 3F21A 9ANTA 1SFXA 5IOZA 4RAFA 1U5TC 4UB6C 1W36D 1CF7A 3ZMTA 3H1CA 1BL0A 4IO9F 4EM1A 1GDTA 3C3WA 3GFJA 4ABZA 2A07F 1YYVA 2YS9A 3RKYA 5M3MJ 5FD6A 3BQYA 3KIOA 4OIRF 2Y0SN 2F2EA 2M34A 2V1XA 4D7NA 4YEJA 4LLGF 2MZ4A 4LIUA 1X1CA 2CV2A 1TQMA 4AIDA 2RQPA 2RDPA 3GTKJ 5BS6A 3S1NJ 1X1AA 2Z16A 3KLOA 4FETA 1D1BA 3OYNA 1Q1VA 4B3AA 1JKOC 3P7NA 1W0UA 3I5UA 3FXMA 2OUMA 2PMUA 2PI0A 2E7WA 1FYLA 2IGOA 3CP8A 1XGNA 1MMDA 2HS5A 1VZ0A 2QQAA 3C18A 2O61A 1TWAJ 2DMTA 3H35A 3QP5A 4NQWB 1TLHB 3CDIA 3FISA 4M3GA 3VYRB 3HOVJ 1UHWA 3PO3J 2X98A 2RV8A 1DGWY 1C0WA 2PJRB 4ESBA 2FQ3A 1JUPA 2JUGA 5GAHJ 3CCRI 1HC8A 3LAJA 2ZO4A 2HOSA 1YX5A 1IXSB 1GVDA 1R5ID 2H09A 5J8FA 1H89C 5JR3A 3HOZJ 1KA8A 3KZZA 5ED4A 3V7SA 5FFZA 4ZDPA 1OCOH 5L3GA 4NUBA 2MYSA 4Z2YA 1FOWA 1B4AA 3ZQIA 2AO9A 1QGPA 5E79C 3B73A 3V7RA 4J01A 1QHHD 3I4MJ 2LYCA 1VQMI 4BYYA 4I0AA 4MQVA 1WGXA 1V54H 5J47A 3R60A 4B48A 2NYXA 1W36C 2XF7A 2P5VA 5DUKA 2DCEA 3ERED 1ZRCA 1FYMA 1T6SA 3ELKA 3CMAI 2JK3A 4EJOA 5B3SH 1UAAA 1S9HA 1ZR4A 5EGOA 1U0JA 2R5ZA 4XOTA 2OQGA 1D1CA 3BR1A 3K9TA 5E20A 2E34A 5FD5A 1YW7A 1ONVA 4U87A 5F04A 2R3SA 2LSOA 2OV7A 3JR9A 4E7IA 2NRAC 2WADA 4IPAA 4PUSA 1VQ8I 1ON1A 2K27A 4CICA 3MCZA 5D6FA 2GXGA 3VOEA 2P0TA 1WJEA 5TGTA 5J1YA 4RBOA 1MBGA 2M5WA 1RUOA 1ZH5A 2HR3A 3BG7A 4FX4A 1D5VA 3WHBA 1J75A 1EH8A 3CJQB 1JT0A 3U2RA 3PQJA 1TT5B 5EDNA 3A01B 4L0ZB 3DEUA 3LAPA 3HSFA 3OMYA 4XONA 1V3FA 3K0LA 2LKSA 4CCLA 2DA5A 1T38A 1CGPA 3CUQA 2F5VA 2KT0A 1U8BA 2IW5A 4OINF 3SFZA 2FQ4A 3HOTA 4LB6B 4A3FJ 4YFKF 4IQJA 4O3MA 2ZB9A 5LFAA 4ZTJA 4MQ9F 1R36A 3PSIA 4KA4A 2XKOA 3I71A 5FKOA 4ZH4F 1S7OA 1E3HA 4MNUA 4RAYA 3DEWA 1LUJB 4XKBA 2LK2A 1AOYA 2VBYA 4KN4X 2ZNZA 3BR3A 3PFYA 1X19A 4G12A 2L7ZA 2VT2A 3KFWX 2AS5F 2F48A 3SZTA 1ZG5A 1U2WA 3ZQ7A 3NRVA 1OYWA 4XL9A 4U0VA 2KIFA 4HPQA 4F92B 4XNFA 4AIHA 3DU5A 4ZC3A 5LBQA 3WTYC 4NNJA 4FT8A 3OYKA 1QZZA 3DBHB 4PGGA 3E5XA 4WWCA 2EFPA 3AG1H 2MD0A 5LHHA 5CYVA 4BEHA 3A03A 4B43A 2FJ1A 3A02A 3GYHX 2WAQN 1KONA 4XSXF 4EGYA 3CP2A 1V4RA 2LKXA 2M0MA 3ZCOA 2AXTC 1JUSA 5DM7F 3BR5A 2X85A 2A6TA 5CVVA 3H0GJ 4BL0B 1KU2A 1JTXA 5L3CA 3MZYA 4D5FA 3FXKA 5F1RA 1IZ1A 2FMYA 3PM1A 2HWVA 1RR7A 2W4SA 4LG0B 3TL4X 3HSEA 2E1MB 2CGPA 1W7PB 4Q47A 2FU4A 1T56A 1LE8A 3R0AA 4A0XA 3QPSA 1BIAA 3DQVC 4MO7A 1R6RA 4NC8A 1ITYA 3OYCA 2DFHA 1MBKA 2XHKA 3ERMA 2L02A 2EBIA 3CJTB 2V1UA 2CW0F 2R5YA 2VPLA 2M7BA 2PJRA 2VONA 1Z91A 3MN2A 2COMA 4A12A 3PNTA 2DQRA 3K10A 5IOYA 3V7CA 2MH2A 4KFCA 1I27A 2RNGA 1BOBA 3N97A 1LFUP 5FJ8J 1B72A 3IH2A 2X1DA 4M9XA 2BHZA 2LF8A 3HB9A 3S3OA 1ORKA 4EQQA 4G6DA 3RQIA 2XAHA 1YG2A 2IS1A 2CYYA 2DFIA 3RTRA 4PSWA 1JE8A 3PNYA 1ZGJA 2ZKZA 1SEUA 3PJRA 4IEJA 2EV6A 1KYWA 3J7ZI 2BY0A 3EYYA 2COBA 3BTIA 1TW3A 2EA2A 3E5QA 3KYCB 2XSDC 4XLHA 3DKWA 4HG2A 5BNGA 3ZMDA 2DA6A 3E3VA 3CCQI 2XRNA 1A31A 5FO5A 2EIKH 1P9QC 3VPRA 2L4AA 1XS9A 2L4MA 5DCFA 5BPIA 5GTIC 4A5NA 1NK2P 2VQCA 2FF4A 2G0EA 4N4OB 3F8NA 3I53A 4AVPA 4RB1A 4QPQA 1MNEA 2CV1A 3E6MA 4CCOA 3FMRA 4YFXF 2M35A 3B6CA 1VTNC 2XF5A 3T8TA 4L5IA 2V6EA 2F4OB 2PQ8A 4E7ZA 1YO5C 3RYRA 3TMOA 4XLEA 3HUGA 3AFHA 1DPUA 3FHNA 1WFXA 3QPTA 3FKJA 1YW8A 3WTWC 1UG2A 3E6CC 3TO7A 1YE9A 3L2UA 1D0YA 4OIPF 3H3VK 4Y7NJ 3FF5A 2K86A 4LLNA 2JPCA 3KEQA 2JMWA 2EQRA 1GVJA 3KEOA 5IT9R 4WXCA 1TQPA 1IN5A 4M6XA 2DOAA 1Y1WJ 4DIQA 2EB7A 1TNTA 2VKVA 4C3IJ 1AHDP 4PSXA 3BG3A 1UFMA 3G2BA 3WTVC 5J4VA 5ICEA 3S2WA 2DPUA 1X3UA 3IAS2 4ESFA 5CPRB 4IKFA 3MEXA 3JRHA 5GTHC 2EPFA 1N77A 1HKTA 4HLYA 2ZNYA 3IH3A 5TISC 3ZN1A 1SVLA 2OU2A 1U9OA 1NG7A 1MJAA 3GEZA 4HNVA 4CYCB 3S3NA 2CJJA 4NBQA 2MLKA 4PK4A 3ZMUA 2XGDA 2LC2A 2Q2EB 4NC6A 2W24A 1D5YA 3JRGA 3O2PE 2QVOA 2QA4I 5M5YJ 2A05A 2CSOA 3GO5A 3EPZA 2R7OA 4XSZF 3FKIJ 3W3CA 5HLGA 4II2A 3Q9VA 3ZOBA 4S04A 1V55H 2Y9ZA 3ZPLA 2KQRA 4RM3A 1TWGJ 3JSOA 1NHAA 5K5QA 3MVPA 3Q3SA 3HJEA 3HRUA 4ZDOA 3JTHA 4G6QA 4XM3A 3D1NI 3COAC 1I39A 2M9HA 2VKEA 3GBGA 4AIJA 3S3MA 2EIMH 3HYIA 5CVRA 4AC0A 3EYIA 1R23A 4F52A 5IP9J 2DTRA 1WJ5A 3Q9SA 1FOYA 3KE2A 5BQTA 1EH6A 4A3EJ 1HW5A 2DOEA 4RLQA 3U21A 2QSGX 3GLXA 3QYFA 1GXQA 5EJCA 3GTGJ 4UUVA 3L7WA 3S17J 3CCEI 1VI0A 3ZQFA 3V42A 4PJJA 2FBHA 2RN7A 2O7OA 2A6EF 2FNPA 3HC7A 1WVRA 3SEZA 5C44J 1HF0A 2NAZA 1S7EA 3E6BA 4G8XA 3JRIA 1FMVA 1F36A 3HOYJ 4ENJA 4Q5SF 3S8PA 1P4WA 4W97A 3OYAA 1RPWA 3V8LA 4HOBA 5C4XJ 2FRHA 5E3LA 1B9MA 1CF7B 4RGRA 2EH3A 5J3LA 3KZYA 2W00A 4CXFA 5K1YA 1MSFC 2F5CA 4HRIA 3CCYA 3HL2A 2O8KA 1MKMA 5LGUA 2BXZA 4JP0A 4IHXA 3OIPA 4XBFA 1TWCJ 2IXSA 1HOMA 2ZCWA 3N05A 2GZWA 3I0TA 3WG9A 2VI6A 2DYSH 5LEKA 1B59A 3PO2J 2NOJB 3I3LA 2H6BA 3BJOA 5GPCA 3LWFA 1QA6A 4B1RA 2W48A 4YRVA 1K6OA 3FBIB 1HXDA 1I1SA 2KKOA 1MMAA 1YRNB 1A6QA 1P4AA 4IOAF 1OCZH 2XIGA 2JA7J 1A36A 2OPTA 1MZBA 3C2HA 3FBNB 2LDUA 4H4KC 2KLOA 3GX4X 1MDMA 4L0YB 1SD7A 2OTJI 4YIIA 5HNFA 2AHQA 3IKTA 5HODA 2W7NA 4WX9A 4EM2A 2FBIA 1PUEE 1BI0A 2KL4A 2LD5A 2NXNB 4HA8A 2LREA 2DDAA 2HQRA 2Q0OA 4LD5A 1BN5A 3K1PA 4D5CA 4G7HF 2R7TA 4RDUA 3CCLI 3O8GA 5FLXZ 3MKZA 2K9LA 2QZ8A 4RLFA 3GFMA 3F8BA 3K1NA 3JW4A 2GIVA 5HLHA 3F8MA 2HYJA 3G1MA 1D0XA 2E35A 3S93A 4HF2A 4IHTA 4KUMA 2EILH 2DT6A 2JRTA 2MA3A 2PMZN 2HPMA 2P5LC 5JHUA 1R71A 4XKWA 4ZZDA 1I6HJ 1ZLJA 3TKYA 3HTSB 2BHYA 1LKXA 1Z21A 4BKXA 3WE3A 2ZJPF 5EZHA 4Y3OA 4A0ZA 1MMSA 2DA3A 3WG7H 3OIOA 1FMWA 3FXUA 3J7AO 2P7CB 2HVQA 5B1AH 2D45A 4D1QA 4XMYA 3RPUA 3ZR8X 5ILSA 4HNUA 5KAFC 3SZGA 5H6RA 4IRGA 4RB0A 1ULYA 1U78A 2CQKA 3UKGA 4IXAA 3MQ0A 3GWZA 1IF1A 3OYFA 1VQNI 1U5TB 2NVYJ 5E8IA 2CUJA 4PJLA 4A3KJ 3JAMZ 1LPQA 4P9FA 4L5JA 1Z7LA 4ANJA 1WH7A 5CVJA 1QO0D 3IWFA 4RGSA 2OCCH 3W6KB 1FP1D 4BXXJ 4ZYAA 2P5KA 2R7SA 2GQQA 3G4SI 4CYCA 2FBKA 2VXDA 3K4NA 1QHGA 2DW4A 2HZTA 4V2GA 2WA0A 2ISYA 5FKLA 4II3A 3WTZA 5B5EC 1AWCA 1LFPA 4KYWA 4A0YA 2A61A 5GPAA 1Z3YA 2OAZA 4FCYA 2DPDA 2G9WA 4IZZA 1Y1VJ 4WF2A 4OMYA 4KNYA 2FSWA 4G9YA 1SC7A 4MGRA 2Z2SB 1APLC 1T39A 4IHVA 2Q8KA 1LB2A 2K9SA 5DUIA 2QQ8A 1WWXA 3A0HC 5FLXK 2FX0A 5D8KB 4AD9A 3WU1B 4HSRA 3LSGA 1KU9A 3GF2A 5IYCJ 4OWRB 3TEDA 3FXOA 2G7HA 1BM9A 2VE9A 4U0WA 2XAJA 1B6AA 2HTSA 1V5FA 3QYEA 2JWTA 1R5GA 2M45A 3S2DJ 1PUFA 2GOXB 1ZK8A 5D5XB 1J09A 1HQCA 3W2WA 4HX7A 4M6YA 3S1MJ 3GUDA 3ZQCA 1IRXA 2DK5A 2CQ7A 4BE0A 2BBYA 1VNDA 3L2VA 1BC7C 4XR6A 4A6DA 5GADJ 3U1KA 4EVIA 3W2AA 2K4JA 2XSJC 3D5RC 4BDZA 5AIQA 1R1UA 1JHFA 1XG1A 3ONQA 1GV2A 2DODA 2QF7A 4P5OA 3RSNA 3DEEA 4WCGA 4E7HA 3CD6I 2PJPA 2R0QC 5FB2A 3BZ6A 3JRCA 1PP7U 4BBSJ 2VN2A 3W2VA 2MLGA 5H6QA 1FP2A 4KMUX 1EH7A 1UJ8A 2BOLA 3PQKA 2EJRA 3GFIA 1WSUA 2ADUA 3HHHA 4BU2A 4ON0A 1FJLA 5L3DA 3PFIA 1N78A 2RREA 1ON2A 3I55I 2VKDA 4EJVA 3X2QH 3H9GA 1MBEA 2GBYA 3DKYA 2M8GX 2JVGA 2ZXJA 3F72A 4PFPA 4R1HA 3TP3A 5ILUA 3H5NA 1Z05A 3ZXSA 1X4PA 3JCUC 4PDKA 1FEXA 4IJAA 5BPDA 2O8XA 5E3NA 5M3FJ 3RZDJ 1CQTA 1LE8B 1YRNA 3QPHA 4BJ6C 3DTEA 4KT6A 3LSPA 1HBXG 1W0TA 2CUFA 4HV6A 4V19K 4HLXA 4BAYA 2NNYA 1P6RA 4UHTA 4F3QA 2X6YA 1SANA 2R5YB 3SZPA 3DP7A 1DPRA 2KRHA 3ESWB 4XKCA 5DYMA 4BHBA 3NARA 3OSFA 5D5WB 1BI2A 5JFRA 2VJ5A 1T08B 2BV6A 4FHTA 4UUTA 1B72B 2XAGA 3SEQA 2EZLA 3CMMA 5CLSA 4DW6A 2ME6A 1MBJA 3QU6A 2ETHA 2K3FA 1QZYA 4I7HA 4LGWA 3J81Z 4EGZA 1T8IA 4M9SA 3CMEI 2EV5A 3LQQA 2KISA 2KDZA 2W84A 3H9JA 2H27A 2NS8A 4ZDLA 2M30A 2ID6A 2PFBA 4M3DA 4D0PA 2K5CA 5B66C 2V9VA 2IT0A 4Y4RA 2HPIA 5TRDA 3IAM2 3OWTA 1WJAA 1WH5A 2DT5A 4QIWN 3G73A 1OCCH 3BT9A 3LA2A 4JBAA 2WTEA 2NVXJ 3ISPA 2ZMEC 1X4OA 1YIOA 1KZHA 1QPIA 3RKXA 4BDYA 1IN7A 1HDPA 5M5WJ 3R4KA 1J59A 2VC1A 1OPCA 5D5UB 2DDBA 3RKWA 1BOAA 4FISA 1ZHFA 3Q5FA 2JSPA 1OCPA 3L1PA 1FIAA 4KISA 3GTLJ 1U5TA 2EFNA 3I4PA 3LNQA 3PIPF 1ZQ3P 3HUGB 1HCRA 1FC3A 3FX3A 1FTZA 2X6WA 1BR2A 1WQ2A 3HSRA 4LMYA 3LQRA 4Q48A 2E1CA 1R58A 1RNLA 1XMXA 4ENNA 2HFHA 5JI6A 2QM3A 2RVCA 1BJAA 4GO1A 1V5GA 4KIFA 1WRJA 1GHCA 5KAIC 1G3SA 5KHDA 1R7JA 2FMLA 1DU6A 4PJMA 4I0BA 2L5QA 2O9LA 3AL0C 3K4LA 2W25A 1Y8RB 5E8GA 2UWMA 1LNWA 4XRFA 3OL4A 2QKLB 3A52A 1XPXA 3BPVA 3QODA 2EFWA 3ABUA 2E71A 4XK4A 2R4GA 4KITB 4RMNA 4C2MJ 4CCKA 3OS2A 3K2AA 2YPRA 1GLNA 4DYCA 2CUEA 2GXAA 2M4GA 4BACA 5KVRA 2STWA 2PBIA 3HRSA 1QRYA 3MZ8A 1AU7A 1W5SA 1VQKI 2L7KA 4UVAA 4X6AJ 4ENKA 5FRNA 3BR6A 2QGUA 4CCJA 2IJLA 4FX0A 3CDHA 3H5AA 2IVMA 3R6SA 3CF5F 1K78A 3M8EA 3FK6A 2NNNA 4F93B 3MMYB 3S1RJ 3MAJA 3ZMSA 2KIUA 3GVAA 1RIOH 4LG3A 2JTVA 1U8RA 2LLKA 4I2OA 2BE5F 3CESA 2K40A 3SQNA 4E7LA 1HSJA 1E3PA 3E1SA 4EMSA 3PIOF 3H36A 3A2KA 3F8FA 2IA2A 3ECHA 1NTCA 4XORA 3TBIA 1IN4A 3BTJA 4M72A 4UVCA 1SD4A 4Y13A 2L0KA 2RGVA 5DS9A 1IXRC 2K9NA 1HKQA 3B02A 2O03A 2BY3A 4C2UA 3DV8A 3NAUA 3OSGA 2PLYA 5F0CA 2E1OA 1UHSA 2IA0A 3SDBA 1O3SA 2Z3YA 1KU7A 2GM4A 3A1YA 2DAOA 1IXCA 2EV0A 2FOKA 4CYDA 4A3CJ 2P4WA 3SJMA 3I64A 1SMTA 1F9NA 2DFFA 3KYDB 5E1XA 3SYTA 1T95A 1YFHA 2P6TA 1IJWC 4NHJA 2NVQJ 2KRCA 1KQ0A 3GMEA 4HAMA 1BR4A 3WTXC 2AXLA 3NWTA 2YU9J 5ICGA 1PYVA 2GIZA 1J2XA 1Y8QB 2EFOA 2V1DA 5BMZA 3J7YJ 3CLQA 4JQFA 3OYBA 1VF9A 1ETKA 2MH9A 1UB9A 4KIGA 1YLFA 3M8JA 1P92A 4PFOA 1JXSA 2L01A 1EKEA 2DI3A 1NG6A 4JK1X 4YIFA 4DBQA 3HPGA 2HOAA 4DYRA 4LITA 1T98A 3I59B 3HKZN 5E3OA 3S1QJ 3OS1A 1ENHA 4L9JA 3HEFA 4IHWA 1D3YA 3BR0A 2W1OA 5LHGA 3HKZA 3WODF 3G1OA 3HG9A 1SVOA 4CHUA 4IOCF 1XDSA 1HW1A 1TQIA 1WJDA 1MJ9A 2TDXA 5DTDA 5DM6F 2ME0A 2L7MP 2IP2A 1W7PD 3EETA 2M1BA 1RI7A 1QNTA 4M71A 1K79A 1TWFJ 4ZYDA 2YX4A 2MD5A 1IV8A 1OLTA 3JRBA 1OMIA 5F08A 2CFOA 4XLFA 3LMMA 2E36A 1MDMB 2M4KA 2MABA 3TQNA 1IV6A 1DP3A 1R1TA 1SFOJ 2XAQA 3ZGKA 2NVTJ 4K2EA 4HNTA 5LRRA 2A69F 1A04A 1EA3A 4AUXA 2VOOA 2XPUA 1ZGAA 1W1WE 4A3MJ 3K6GA 3M7GA 3ZQLA 3ULQB 2R7XA 3UNGC 5HDNA 4BQOA 2JJ7A 3VYTB 3EUKL 1LVAA 1XMAA 1USTA 1JUMA 1I50J 2F5DA 4LJZF 5L3BA 4B4CA 4IL6C 4EATA 3LSKA 1NK3P 3ZQQA 3HRMA 5EEAA 1FYKA 2E5ZA 2OD5A 2R7WA 4KDPA 3IRRA 2FUG2 2P7VB 3JSPA 1RESA 1ZYRF 2DTZA 1JKQC 3VSLA 1IN6A 5HNHA 4HQEA 5ICCA 1RRJA 2I5UA 3CQZJ 3K70D 1L3LA 4B44A 5HS7A 3LSMA 4RAZA 3SDGA 3LSJA 5D6EA 2E1MC 1UHMA 3GTJJ 2V1NA 4E4HA 1PVEA 1E3OC 2Y31A 5CKTA 3VODA 2VQHA 1YJ9I 3FIWA 3OV8A 4W1UA 5EF6A 1Z0XA 4GGGA 5LD2C 4V2FA 1KQ8A 2HQ5A 1I3QJ 2LMDA 2W82A 2XDVA 1OR7C 3L9FA 3CLOA 2HTJA 2XPWA 4RB3C 4LB5A 1LEAA 2VOPA 5FLXR 3K4KA 4C3HJ 1FTTA 2LBFA 3LSTA 3D0SA 2D5VA 2LY2A 3FXQA 2MFZA 2F5EA 2WAFA 1JT6A 4WXDA 2QKMB 3KX2A 3M4OJ 2EFQA 3WGHA 4A5MA 3RKQA 2STTA 4M74A 2LH9A 3FM3A 1F43A 3G3ZA 2BY2A 2VJ4A 4CDGA 1X2MA 4KJZA 5J4YA 2Z99A 4MLOA 1QBJA 1ZR2A 1G4DA 2R7VA 2X0LA 1MH3A 1P2FA 5E1WA 3OS0A 1W5TA 5A2QZ 2IGNA 3HGYA 4B8XA 1K6YA 4RM2A 4BQAA 2DXIA 4N4NB 2X6OA 4XN0A 3U9GA 4CZCA 2X1CA 3QWLA 5JHFA 2KJCA 1LFBA 4LK0F 1S6LA 4GXOA 1PUFB 2QQ9A 2NVUB 5J40A 3OYLA 1FSHA 3BG9A 1HLVA 3C2BA 1XCBA 3LSHA 4HEA2 3K70C 4MFEA 4L9TA 3T0YA 4GFBA 2A68F 1XGMA 1DUXC 1IC8A 1HA8A 2UZKA 4O5VA 3TDUC 1WHUA 2LFBA 3RIRA 1JKPC 1KGSA 1Y0UA 3WU2C 4A6EA 4U7DA 1D8JA 1T0FC 3Q0WA 2DOFA 3I9V2 3IH4A 5GAGJ 2LY1A 1K83J 4XICA 1P4XA 1UG0A 4YG2F 2IPQX 1P7JA 1R4NB 1E0EA 3A4CA 1KYZA 3WGIA 3CO6C 2CFXA 1Y39A 1XDUA 1QZEA 5M5XJ 5DD4A 3WHCA 5EEGA 2ECBA 2EZKA 2OF7A 4HSTA 2EA4A 1A6IA 2OTLI 2DMQA 3I59A 4F55A 2V79A 3BP8A 4FE7A 1RZ4A 2GAUA 1O3QA 1JJ6C 4JX5A 4I98B
chains in the Genus database with same CATH topology
1BIBA 2BGCA 4ZYEA 4E70A 2QLZA 3F8CA 1MJBA 4XLNF 2MC3A 1OR7A 5DD8A 3K69A 4IRHA 4I09A 1LDDA 5FGMA 5CVIA 1ZARA 2EK5A 1FBSA 4F7ZA 5A2QK 1Z6TA 3MFKA 3TOAA 1DP7P 2YU3A 2K02A 3BOQA 4GYGA 5HS9A 3ZMZA 2R7FA 4BH9A 4KMFA 5LHIA 1J7KA 2HKXA 1PP8F 4ETSA 2FE3A 3J80Z 2HEOA 3KP7A 1BI1A 2VXZA 3FWEA 4MTEA 1IN8A 1T2KA 2FNAA 3WTUC 2KJBA 1OKRA 2A5YB 3F22A 3VEPA 4IRIA 3M1EA 1T0FA 2LKPA 3QU3A 1STZA 2ACJA 4M9ZA 3N4MA 2FEZA 4HQMA 5LGTA 2DBBA 1O3TA 3VB2A 2WWYA 3SXYA 1ZRDA 3GZ6A 3DFGA 3H3ZA 1ZG3A 1E2XA 3DF8A 1IAWA 1H9GA 5DCMA 3OOPA 2OA4A 3TO9A 3EDPA 1Z6RA 2DQLA 2IA1A 3F6OA 1TBXA 5DDGA 3FZVA 2IRFG 3VFZA 3GW2A 2WC2A 1YS7A 1SMYF 4RB2C 1LDJA 3WU0A 2M8EA 4UVBA 4B09A 1G3TA 1S3JA 4U88A 4CGZA 4RGXA 2ISZA 1QQIA 3LFKA 1LDKB 3LA7A 4WXHA 4A2UA 3E97A 5EEHA 2VBWA 2GA1A 1K78B 3MWMA 3IC7A 2MBFA 1FWZA 1IRGA 1TNSA 3WE2A 3LA3A 1WKMA 4HDUA 3JAMK 1Z7UA 2CG4A 1E17A 5F64A 4OIQF 1G6NA 2JZYA 1GXPA 3IRQA 3M8FA 2VODA 3F6VA 5DV5A 1FOKA 3L09A 2JT1A 3TDZC 4HF0A 2G7UA 1PDNC 1MD0A 3NEUA 3WTTC 2GWRA 4L9NA 5DEQA 3KP3A 4HF1A 4UXNA 4L9VA 1BI3A 4Q4ZF 4S05A 1HKSA 4EJTA 1ZAOA 3P9CA 1KQ9A 5D4RA 3SHFA 1L0OC 2RC4A 3TGNA 1IW7F 4BXUA 3RI4A 4HDVA 2OZUA 2VT3A 2DLLA 1FPQA 3CUQC 1XSDA 2PN6A 4KIBA 4IF4A 5L3FA 1XB4A 3K1MA 3QP6A 3HTUA 1QPMA 1XSXA 3IHUA 1S8NA 5D8LB 2F5FA 2VE8A 2M87A 5ILVA 2JPBA 1JGSA 3H92A 1SFUA 2XV4S 3BJ6A 1F1ZA 3QRFF 2CWEA 1B1BA 1I1GA 1F4KA 2KRFA 5IT3A 4G7OF 2YSRA 4HYEA 1XGSA 5LGNA 3U1DA 1XD7A 3L2CA 1O3RA 3R61A 2RNJA 4AIKA 4P55A 1J9IA 2D1HA 4EJUA 2LNBA 2GA2A 2XUBA 4BNCA 4HBLA 5E1ZB 1I5ZA 2EWNA 2H94A 4N9HA 3P9KA 2DO7A 3V8JA 1O57A 3O3KA 2Z33A 2Z9OA 3J81K 3ROUA 1TW2A 2VBZA 4GCVA 4IHSA 2O0YA 4RS8A 3ABTA 4EM0B 3JTGA 5HS8A 2K4BA 4GYIA 2JSCA 1ZREA 4I01A 1Z9CA 2QBYA 3C7JA 1D8KA 5KK1A 3F3XA 1YTYA 4MEXF 1Q1HA 2GXBA 3W6JB 2XAFA 3ZMVA 3IL2A 1K7AA 2B0LA 2OBPA 1FLIA 1USSA 1FZPB 3BDDA 2ZMEA 4PCQA 2R7DA 4PGHA 4OIOF 4ZZLA 4XLPF 1OYYA 5ERIA 1UCRA 2PEXA 4HZFA 2A6HF 2L3DA 2QENA 2Z5UA 2FA5A 2XGXA 2E7XA 2LF7A 4OOIA 2HGCA 1EV7A 1R1VA 2A3SA 4RGUA 3V8KA 3ECOA 5HDGA 1WI9A 3T1BA 4Y15A 1HW2A 5E18F 2HYFA 4H0EA 4ESJA 4PZJA 4ZYGA 3RPQA 1I6XA 3H3UA 4QWQA 2QUFA 4NQWA 5FFXA 1SAXA 5AIPA 2XASA 3KCCA 4O6JA 4LLLA 4DQ2A 5HOOA 1LJ9A 3DXJF 4N0BA 2D1VA 2L54A 1XCVA 5HLIA 1LQ1A 2OQRA 1H0MA 3CTAA 3HOSA 2ZJ2A 2DK8A 1FSEA 4KT5C 6PAXA 4UNOA 4LK1F 4IVNA 3WTSC 2VC0A 1JHHA 3CUOA 2Y75A 2HDCA 4EJWA 3E6DA 2UXXA 1LEBA 4OMZA 2XKPA 4WK8F 2HYGD 1FY7A 1YW9A 2BYVE 2X4HA 4ASNA 2PG4A 2P6SA 1SFEA 3F23A 1O7LA 3KETA 3P9IA 1MGTA 2ESHA 4UV9A 5BOXA 1KU3A 3GXOA 2V6CA 4G94A 1IRFA 2VBXA 2UXNA 3BJAA 4DNCA 4R8HA 3I58A 5DCMB 1BC8C 4MEYF 4ENMA 4HX8A 2DU9A 1H9TA 3RJPA 1S7AA 2ZFWA 3QAHA 2OZ6A 1ZLKA 3NQOA 4N9IA 4G7ZF 5D4SA 3FMQA 3M9AA 5J6XA 4U7BA 1SD6A 3CJNA 2YX7A 1FX7A 2QYOA 3IWZA 3FM5A 3AAFA 1ZG1A 3R0JA 5CJ9A 3HHGA 4MTDA 3D5LA 1R22A 1ODDA 3L00A 4QLCU 4LFUA 1DDNA 2P8TA 1F5TA 5LRSA 3FMSA 3GZ5A 3KLNA 1R5HA 4U0YA 4LG0A 2XROA 3REOA 2K7LA 1W7PA 4Y17A 3HIFA 4L18B 4CZZA 3BWGA 2J5PA 1FNNA 4BHPA 1Z1DA 3DPTA 1W4MA 3MZHA 5E17F 2WV0A 1J0RA 1REPC 2J5OA 3IKVA 4EV0A 2W57A 4BHCA 3FHZA 2XVCA 4ZYHA 5IT9Z 4YFNF 1YQAA 2QWWA 4I02A 2BEOA 4TV7A 3WGGA 2O6GE 5LLQA 1FT9A 4CO8A 3BY6A 5K5OA 1O7FA 3O6BB 1U3EM 2FXAA 1XSVA 3V4GA 2D2WA 2E1NA 3KP5A 3ML6A 2QQBA 2YR2A 3BROA 2PMHA 1B9NA 5HDKA 1U6GA 5JVTA 5L3EA 4P96A 4P9UA 1SD5A 2ZBKA 3QOPA 1G3YA 4HV5A 5TJJA 4UV8A 3K2ZA 4OU0A 2RKHA 5CVUA 3EUHA 3RYPA 5IT9K 1XGOA 3TOBA 3BPXA 1OYIA 3RDIA 3I54A 2HKOA 4HW0A 3GFLA 4R79A 2HQNA 2ESNA 3J80K 2Q2EA 5H20A 1HSTA 3E5UA 1J5YA 3TO6A 3ZN0A 3EQLF 3CO7C 1RUNA 4MHGA 3CUQB 3FXRA 2O3FA 2Y0MA 5HVQC 4KICA 3HRTA 4AWXB 5LEJA 1IUYA 2QBYB 5F6FA 4HX4A 4M73A 2H6CA 1FBUA 1R00A 2ELHA 3C1DA 5D5VB 2W85A 1FBQA 5J8CA 2NS0A 3KP2A 1YS6A 5ICFA 2ZMEB 1ZRFA 1G3WA 4NB5A 2HOEA 2CO5A 5AONA 3ZP5A 3DPLC 4KN7X 1BBYA 3T5XA 1XMKA 1TTYA 2Y48A 3T8RA 5K5RA 1S29A 1ZN2A 2KIMA 2C6YA 1XN7A 3KP6A 3KP4A 3F21A 1SFXA 1U5TC 1CF7A 3ZMTA 4EM1A 3C3WA 3GFJA 2A07F 1YYVA 3RKYA 5FD6A 4OIRF 2F2EA 2V1XA 4LLGF 1TQMA 2RQPA 2RDPA 5BS6A 3KLOA 3P7NA 3I5UA 2PI0A 2PMUA 2E7WA 1FYLA 1XGNA 2HS5A 2QQAA 3C18A 2O61A 3QP5A 1TLHB 1UHWA 2RV8A 1C0WA 4ESBA 2FQ3A 3LAJA 2ZO4A 1IXSB 5J8FA 2H09A 5JR3A 1KA8A 3KZZA 5ED4A 3V7SA 5FFZA 5L3GA 4Z2YA 1B4AA 1QGPA 3B73A 3V7RA 4BYYA 4I0AA 4MQVA 3R60A 2NYXA 2P5VA 5DUKA 3ERED 1ZRCA 1FYMA 1T6SA 3ELKA 4EJOA 2OQGA 3K9TA 5E20A 5FD5A 1YW7A 1ONVA 2R3SA 2LSOA 2NRAC 4IPAA 1ON1A 2K27A 4CICA 3MCZA 5D6FA 2GXGA 3VOEA 1RUOA 2M5WA 1ZH5A 2HR3A 4FX4A 1D5VA 1J75A 1EH8A 3U2RA 3PQJA 4L0ZB 3DEUA 3LAPA 3HSFA 1V3FA 3K0LA 1T38A 1CGPA 3CUQA 2IW5A 4OINF 3SFZA 3HOTA 4LB6B 4YFKF 4O3MA 4MQ9F 1R36A 4KA4A 2XKOA 3I71A 4ZH4F 1S7OA 4MNUA 4RAYA 1AOYA 2VBYA 4KN4X 2ZNZA 2VT2A 3KFWX 2AS5F 3SZTA 1ZG5A 1U2WA 3ZQ7A 3NRVA 1OYWA 4U0VA 2KIFA 4AIHA 5LBQA 3WTYC 4FT8A 1QZZA 4PGGA 3E5XA 4WWCA 2EFPA 5LHHA 5CYVA 3GYHX 4XSXF 4EGYA 1V4RA 5CVVA 1KU2A 5L3CA 3MZYA 5F1RA 1IZ1A 2FMYA 2HWVA 4LG0B 3HSEA 2CGPA 1W7PB 4Q47A 2FU4A 3R0AA 4A0XA 1BIAA 3DQVC 2XHKA 2L02A 2V1UA 2CW0F 2VONA 1Z91A 2COMA 4A12A 2DQRA 3V7CA 2MH2A 4KFCA 1I27A 3N97A 4M9XA 2LF8A 4EQQA 4G6DA 2XAHA 1YG2A 2CYYA 2DFIA 3RTRA 1JE8A 1ZGJA 2ZKZA 2EV6A 1KYWA 3EYYA 1TW3A 2EA2A 3E5QA 3DKWA 3ZMDA 3E3VA 2XRNA 5FO5A 2L4AA 2L4MA 5DCFA 5BPIA 4A5NA 2FF4A 3F8NA 3I53A 4AVPA 4RB1A 3E6MA 3FMRA 4YFXF 1VTNC 3T8TA 4L5IA 2PQ8A 1YO5C 3RYRA 3HUGA 1DPUA 3QPTA 1YW8A 3WTWC 3E6CC 3TO7A 4OIPF 3FF5A 2K86A 4LLNA 2JPCA 3KEQA 1GVJA 3KEOA 4WXCA 1TQPA 1IN5A 4M6XA 2EB7A 1TNTA 1UFMA 3WTVC 5ICEA 3S2WA 2DPUA 1X3UA 4ESFA 3MEXA 1HKTA 4HLYA 2ZNYA 3ZN1A 2OU2A 1MJAA 3GEZA 2MLKA 3ZMUA 2W24A 3O2PE 2QVOA 2CSOA 3GO5A 4XSZF 5HLGA 3Q9VA 4S04A 3ZPLA 3JSOA 1NHAA 5K5QA 3HRUA 3JTHA 4G6QA 3COAC 4AIJA 3HYIA 5CVRA 3EYIA 1R23A 2DTRA 3Q9SA 3KE2A 5BQTA 1EH6A 1HW5A 3GLXA 1GXQA 4UUVA 3L7WA 2FBHA 2RN7A 2A6EF 2FNPA 2NAZA 3E6BA 4G8XA 4ENJA 4Q5SF 1P4WA 3V8LA 4HOBA 2FRHA 1B9MA 1CF7B 4RGRA 4CXFA 3KZYA 5K1YA 2F5CA 1MKMA 5LGUA 4XBFA 2ZCWA 2GZWA 3I0TA 3WG9A 5LEKA 1B59A 2H6BA 3BJOA 3LWFA 1I1SA 1K6OA 1HXDA 2KKOA 1P4AA 2XIGA 1MZBA 2LDUA 3GX4X 1MDMA 4L0YB 1SD7A 4YIIA 3IKTA 4WX9A 4EM2A 2FBIA 1PUEE 1BI0A 4HA8A 4G7HF 2HQRA 2Q0OA 4LD5A 1BN5A 3K1PA 5FLXZ 2QZ8A 3GFMA 3F8BA 3K1NA 3JW4A 2GIVA 5HLHA 3F8MA 4HF2A 4IHTA 4KUMA 2JRTA 2MA3A 2P5LC 5JHUA 4ZZDA 1ZLJA 3TKYA 3HTSB 3WE3A 4A0ZA 3FXUA 3J7AO 2P7CB 2D45A 3RPUA 5ILSA 5H6RA 4IRGA 4RB0A 1ULYA 1U78A 2CQKA 4IXAA 3MQ0A 3GWZA 1IF1A 1U5TB 5E8IA 3JAMZ 4P9FA 4L5JA 5CVJA 1QO0D 3IWFA 4RGSA 3W6KB 1FP1D 2P5KA 2GQQA 2FBKA 2DW4A 3WTZA 2HZTA 1AWCA 2ISYA 4KYWA 4A0YA 2A61A 2OAZA 2DPDA 2G9WA 4WF2A 4OMYA 4KNYA 2FSWA 4G9YA 4MGRA 1T39A 2Q8KA 1LB2A 5DUIA 5FLXK 1WWXA 5D8KB 4AD9A 3WU1B 1KU9A 3GF2A 2G7HA 1BM9A 2VE9A 4U0WA 2XAJA 1B6AA 2HTSA 1R5GA 2M45A 5D5XB 1HQCA 4HX7A 4M6YA 3GUDA 2DK5A 2BBYA 1BC7C 4A6DA 4EVIA 2K4JA 5AIQA 1R1UA 1JHFA 4P5OA 4WCGA 2PJPA 5FB2A 3BZ6A 1PP7U 2VN2A 2MLGA 5H6QA 1FP2A 4KMUX 1EH7A 3PQKA 2EJRA 3GFIA 1WSUA 2ADUA 3HHHA 4ON0A 5L3DA 3PFIA 1ON2A 4EJVA 2ZXJA 3F72A 4R1HA 5ILUA 1Z05A 4PDKA 4IJAA 5BPDA 2O8XA 3QPHA 1HBXG 4HV6A 4HLXA 4BAYA 2NNYA 1P6RA 4UHTA 3SZPA 3DP7A 1DPRA 5DYMA 4BHBA 5D5WB 1BI2A 5JFRA 2BV6A 4FHTA 2XAGA 5CLSA 3QU6A 2ETHA 1QZYA 4I7HA 4LGWA 3J81Z 4EGZA 4M9SA 2EV5A 3LQQA 2W84A 2H27A 2M30A 2PFBA 4D0PA 2V9VA 2IT0A 5TRDA 2DT5A 3G73A 3LA2A 4JBAA 2WTEA 3ISPA 1YIOA 3RKXA 1IN7A 3R4KA 1J59A 2VC1A 1OPCA 5D5UB 3RKWA 1BOAA 1ZHFA 3Q5FA 1U5TA 2EFNA 3I4PA 1FC3A 3FX3A 4LMYA 1WQ2A 3HSRA 4Q48A 3LQRA 2E1CA 1R58A 1RNLA 4ENNA 2HFHA 5JI6A 2QM3A 2RVCA 1BJAA 4GO1A 4KIFA 1WRJA 1GHCA 1G3SA 1R7JA 2FMLA 4I0BA 2W25A 5E8GA 2UWMA 1LNWA 4XRFA 3BPVA 2EFWA 3ABUA 2YPRA 5KVRA 2STWA 2PBIA 3HRSA 1W5SA 4UVAA 4ENKA 2IJLA 4FX0A 3CDHA 3R6SA 2IVMA 1K78A 3M8EA 2NNNA 3MAJA 3ZMSA 2KIUA 3GVAA 1RIOH 2JTVA 1U8RA 4I2OA 2BE5F 3SQNA 1HSJA 4EMSA 3F8FA 2IA2A 3ECHA 1IN4A 4M72A 4UVCA 1SD4A 4Y13A 2RGVA 1IXRC 1HKQA 3B02A 2O03A 3DV8A 2PLYA 2IA0A 1O3SA 1KU7A 2Z3YA 2DAOA 1IXCA 2EV0A 2FOKA 4CYDA 2P4WA 3I64A 1SMTA 1F9NA 4NHJA 5E1XA 1YFHA 2P6TA 1KQ0A 4HAMA 3WTXC 2AXLA 5ICGA 1J2XA 2EFOA 2V1DA 5BMZA 4JQFA 2MH9A 4KIGA 1UB9A 1YLFA 1P92A 1JXSA 2L01A 2DI3A 4JK1X 4YIFA 1T98A 3I59B 4L9JA 1D3YA 5LHGA 3WODF 4CHUA 1XDSA 1HW1A 1TQIA 2TDXA 1MJ9A 2IP2A 1W7PD 3EETA 2M1BA 1RI7A 1QNTA 4M71A 1K79A 4ZYDA 2YX4A 2MD5A 1OMIA 1MDMB 3TQNA 1R1TA 2XAQA 4K2EA 5LRRA 2A69F 1A04A 2VOOA 1ZGAA 3M7GA 3ULQB 5HDNA 1LVAA 1XMAA 1USTA 2F5DA 4LJZF 5L3BA 3HRMA 1FYKA 2OD5A 4KDPA 3IRRA 2P7VB 3JSPA 1ZYRF 1IN6A 4HQEA 5ICCA 1L3LA 5HS7A 4RAZA 5D6EA 1UHMA 3VODA 3OV8A 4GGGA 1KQ8A 3L9FA 3CLOA 2HTJA 4RB3C 4LB5A 1LEAA 2VOPA 3LSTA 3D0SA 3FXQA 2F5EA 4WXDA 2EFQA 3WGHA 4A5MA 2STTA 4M74A 3FM3A 3G3ZA 4CDGA 2Z99A 1QBJA 1G4DA 2X0LA 1P2FA 5E1WA 1W5TA 5A2QZ 4B8XA 4BQAA 3U9GA 2KJCA 4LK0F 1S6LA 4GXOA 2QQ9A 1FSHA 1XCBA 4L9TA 3T0YA 2A68F 1XGMA 1DUXC 2UZKA 4O5VA 3TDUC 3RIRA 1KGSA 1Y0UA 4A6EA 4U7DA 1D8JA 1P4XA 4YG2F 2IPQX 1KYZA 3WGIA 3CO6C 2CFXA 1XDUA 5DD4A 5EEGA 2EA4A 3I59A 2V79A 3BP8A 1RZ4A 2GAUA 1O3QA 4I98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  2BGC A;  4ZYE A;  4E70 A;  2QLZ A;  3F8C A;  1MJB A;  4XLN F;  2MC3 A;  1OR7 A;  5DD8 A;  3K69 A;  4IRH A;  4I09 A;  1LDD A;  5FGM A;  5CVI A;  1ZAR A;  2EK5 A;  1FBS A;  4F7Z A;  5A2Q K;  1Z6T A;  3MFK A;  3TOA A;  1DP7 P;  2YU3 A;  2K02 A;  3BOQ A;  4GYG A;  5HS9 A;  3ZMZ A;  2R7F A;  4BH9 A;  4KMF A;  5LHI A;  1J7K A;  2HKX A;  1PP8 F;  4ETS A;  2FE3 A;  3J80 Z;  2HEO A;  3KP7 A;  1BI1 A;  2VXZ A;  3FWE A;  4MTE A;  1IN8 A;  1T2K A;  2FNA A;  3WTU C;  2KJB A;  1OKR A;  2A5Y B;  3F22 A;  3VEP A;  4IRI A;  3M1E A;  1T0F A;  2LKP A;  3QU3 A;  1STZ A;  2ACJ A;  4M9Z A;  3N4M A;  2FEZ A;  4HQM A;  5LGT A;  2DBB A;  1O3T A;  3VB2 A;  2WWY A;  3SXY A;  1ZRD A;  3GZ6 A;  3DFG A;  3H3Z A;  1ZG3 A;  1E2X A;  3DF8 A;  1IAW A;  1H9G A;  5DCM A;  3OOP A;  2OA4 A;  3TO9 A;  3EDP A;  1Z6R A;  2DQL A;  2IA1 A;  3F6O A;  1TBX A;  5DDG A;  3FZV A;  2IRF G;  3VFZ A;  3GW2 A;  2WC2 A;  1YS7 A;  1SMY F;  4RB2 C;  1LDJ A;  3WU0 A;  2M8E A;  4UVB A;  4B09 A;  1G3T A;  1S3J A;  4U88 A;  4CGZ A;  4RGX A;  2ISZ A;  1QQI A;  3LFK A;  1LDK B;  3LA7 A;  4WXH A;  4A2U A;  3E97 A;  5EEH A;  2VBW A;  2GA1 A;  1K78 B;  3MWM A;  3IC7 A;  2MBF A;  1FWZ A;  1IRG A;  1TNS A;  3WE2 A;  3LA3 A;  1WKM A;  4HDU A;  3JAM K;  1Z7U A;  2CG4 A;  1E17 A;  5F64 A;  4OIQ F;  1G6N A;  2JZY A;  1GXP A;  3IRQ A;  3M8F A;  2VOD A;  3F6V A;  5DV5 A;  1FOK A;  3L09 A;  2JT1 A;  3TDZ C;  4HF0 A;  2G7U A;  1PDN C;  1MD0 A;  3NEU A;  3WTT C;  2GWR A;  4L9N A;  5DEQ A;  3KP3 A;  4HF1 A;  4UXN A;  4L9V A;  1BI3 A;  4Q4Z F;  4S05 A;  1HKS A;  4EJT A;  1ZAO A;  3P9C A;  1KQ9 A;  5D4R A;  3SHF A;  1L0O C;  2RC4 A;  3TGN A;  1IW7 F;  4BXU A;  3RI4 A;  4HDV A;  2OZU A;  2VT3 A;  2DLL A;  1FPQ A;  3CUQ C;  1XSD A;  2PN6 A;  4KIB A;  4IF4 A;  5L3F A;  1XB4 A;  3K1M A;  3QP6 A;  3HTU A;  1QPM A;  1XSX A;  3IHU A;  1S8N A;  5D8L B;  2F5F A;  2VE8 A;  2M87 A;  5ILV A;  2JPB A;  1JGS A;  3H92 A;  1SFU A;  2XV4 S;  3BJ6 A;  1F1Z A;  3QRF F;  2CWE A;  1B1B A;  1I1G A;  1F4K A;  2KRF A;  5IT3 A;  4G7O F;  2YSR A;  4HYE A;  1XGS A;  5LGN A;  3U1D A;  1XD7 A;  3L2C A;  1O3R A;  3R61 A;  2RNJ A;  4AIK A;  4P55 A;  1J9I A;  2D1H A;  4EJU A;  2LNB A;  2GA2 A;  2XUB A;  4BNC A;  4HBL A;  5E1Z B;  1I5Z A;  2EWN A;  2H94 A;  4N9H A;  3P9K A;  2DO7 A;  3V8J A;  1O57 A;  3O3K A;  2Z33 A;  2Z9O A;  3J81 K;  3ROU A;  1TW2 A;  2VBZ A;  4GCV A;  4IHS A;  2O0Y A;  4RS8 A;  3ABT A;  4EM0 B;  3JTG A;  5HS8 A;  2K4B A;  4GYI A;  2JSC A;  1ZRE A;  4I01 A;  1Z9C A;  2QBY A;  3C7J A;  1D8K A;  5KK1 A;  3F3X A;  1YTY A;  4MEX F;  1Q1H A;  2GXB A;  3W6J B;  2XAF A;  3ZMV A;  3IL2 A;  1K7A A;  2B0L A;  2OBP A;  1FLI A;  1USS A;  1FZP B;  3BDD A;  2ZME A;  4PCQ A;  2R7D A;  4PGH A;  4OIO F;  4ZZL A;  4XLP F;  1OYY A;  5ERI A;  1UCR A;  2PEX A;  4HZF A;  2A6H F;  2L3D A;  2QEN A;  2Z5U A;  2FA5 A;  2XGX A;  2E7X A;  2LF7 A;  4OOI A;  2HGC A;  1EV7 A;  1R1V A;  2A3S A;  4RGU A;  3V8K A;  3ECO A;  5HDG A;  1WI9 A;  3T1B A;  4Y15 A;  1HW2 A;  5E18 F;  2HYF A;  4H0E A;  4ESJ A;  4PZJ A;  4ZYG A;  3RPQ A;  1I6X A;  3H3U A;  4QWQ A;  2QUF A;  4NQW A;  5FFX A;  1SAX A;  5AIP A;  2XAS A;  3KCC A;  4O6J A;  4LLL A;  4DQ2 A;  5HOO A;  1LJ9 A;  3DXJ F;  4N0B A;  2D1V A;  2L54 A;  1XCV A;  5HLI A;  1LQ1 A;  2OQR A;  1H0M A;  3CTA A;  3HOS A;  2ZJ2 A;  2DK8 A;  1FSE A;  4KT5 C;  6PAX A;  4UNO A;  4LK1 F;  4IVN A;  3WTS C;  2VC0 A;  1JHH A;  3CUO A;  2Y75 A;  2HDC A;  4EJW A;  3E6D A;  2UXX A;  1LEB A;  4OMZ A;  2XKP A;  4WK8 F;  2HYG D;  1FY7 A;  1YW9 A;  2BYV E;  2X4H A;  4ASN A;  2PG4 A;  2P6S A;  1SFE A;  3F23 A;  1O7L A;  3KET A;  3P9I A;  1MGT A;  2ESH A;  4UV9 A;  5BOX A;  1KU3 A;  3GXO A;  2V6C A;  4G94 A;  1IRF A;  2VBX A;  2UXN A;  3BJA A;  4DNC A;  4R8H A;  3I58 A;  5DCM B;  1BC8 C;  4MEY F;  4ENM A;  4HX8 A;  2DU9 A;  1H9T A;  3RJP A;  1S7A A;  2ZFW A;  3QAH A;  2OZ6 A;  1ZLK A;  3NQO A;  4N9I A;  4G7Z F;  5D4S A;  3FMQ A;  3M9A A;  5J6X A;  4U7B A;  1SD6 A;  3CJN A;  2YX7 A;  1FX7 A;  2QYO A;  3IWZ A;  3FM5 A;  3AAF A;  1ZG1 A;  3R0J A;  5CJ9 A;  3HHG A;  4MTD A;  3D5L A;  1R22 A;  1ODD A;  3L00 A;  4QLC U;  4LFU A;  1DDN A;  2P8T A;  1F5T A;  5LRS A;  3FMS A;  3GZ5 A;  3KLN A;  1R5H A;  4U0Y A;  4LG0 A;  2XRO A;  3REO A;  2K7L A;  1W7P A;  4Y17 A;  3HIF A;  4L18 B;  4CZZ A;  3BWG A;  2J5P A;  1FNN A;  4BHP A;  1Z1D A;  3DPT A;  1W4M A;  3MZH A;  5E17 F;  2WV0 A;  1J0R A;  1REP C;  2J5O A;  3IKV A;  4EV0 A;  2W57 A;  4BHC A;  3FHZ A;  2XVC A;  4ZYH A;  5IT9 Z;  4YFN F;  1YQA A;  2QWW A;  4I02 A;  2BEO A;  4TV7 A;  3WGG A;  2O6G E;  5LLQ A;  1FT9 A;  4CO8 A;  3BY6 A;  5K5O A;  1O7F A;  3O6B B;  1U3E M;  2FXA A;  1XSV A;  3V4G A;  2D2W A;  2E1N A;  3KP5 A;  3ML6 A;  2QQB A;  2YR2 A;  3BRO A;  2PMH A;  1B9N A;  5HDK A;  1U6G A;  5JVT A;  5L3E A;  4P96 A;  4P9U A;  1SD5 A;  2ZBK A;  3QOP A;  1G3Y A;  4HV5 A;  5TJJ A;  4UV8 A;  3K2Z A;  4OU0 A;  2RKH A;  5CVU A;  3EUH A;  3RYP A;  5IT9 K;  1XGO A;  3TOB A;  3BPX A;  1OYI A;  3RDI A;  3I54 A;  2HKO A;  4HW0 A;  3GFL A;  4R79 A;  2HQN A;  2ESN A;  3J80 K;  2Q2E A;  5H20 A;  1HST A;  3E5U A;  1J5Y A;  3TO6 A;  3ZN0 A;  3EQL F;  3CO7 C;  1RUN A;  4MHG A;  3CUQ B;  3FXR A;  2O3F A;  2Y0M A;  5HVQ C;  4KIC A;  3HRT A;  4AWX B;  5LEJ A;  1IUY A;  2QBY B;  5F6F A;  4HX4 A;  4M73 A;  2H6C A;  1FBU A;  1R00 A;  2ELH A;  3C1D A;  5D5V B;  2W85 A;  1FBQ A;  5J8C A;  2NS0 A;  3KP2 A;  1YS6 A;  5ICF A;  2ZME B;  1ZRF A;  1G3W A;  4NB5 A;  2HOE A;  2CO5 A;  5AON A;  3ZP5 A;  3DPL C;  4KN7 X;  1BBY A;  3T5X A;  1XMK A;  1TTY A;  2Y48 A;  3T8R A;  5K5R A;  1S29 A;  1ZN2 A;  2KIM A;  2C6Y A;  1XN7 A;  3KP6 A;  3KP4 A;  3F21 A;  1SFX A;  1U5T C;  1CF7 A;  3ZMT A;  4EM1 A;  3C3W A;  3GFJ A;  2A07 F;  1YYV A;  3RKY A;  5FD6 A;  4OIR F;  2F2E A;  2V1X A;  4LLG F;  1TQM A;  2RQP A;  2RDP A;  5BS6 A;  3KLO A;  3P7N A;  3I5U A;  2PI0 A;  2PMU A;  2E7W A;  1FYL A;  1XGN A;  2HS5 A;  2QQA A;  3C18 A;  2O61 A;  3QP5 A;  1TLH B;  1UHW A;  2RV8 A;  1C0W A;  4ESB A;  2FQ3 A;  3LAJ A;  2ZO4 A;  1IXS B;  5J8F A;  2H09 A;  5JR3 A;  1KA8 A;  3KZZ A;  5ED4 A;  3V7S A;  5FFZ A;  5L3G A;  4Z2Y A;  1B4A A;  1QGP A;  3B73 A;  3V7R A;  4BYY A;  4I0A A;  4MQV A;  3R60 A;  2NYX A;  2P5V A;  5DUK A;  3ERE D;  1ZRC A;  1FYM A;  1T6S A;  3ELK A;  4EJO A;  2OQG A;  3K9T A;  5E20 A;  5FD5 A;  1YW7 A;  1ONV A;  2R3S A;  2LSO A;  2NRA C;  4IPA A;  1ON1 A;  2K27 A;  4CIC A;  3MCZ A;  5D6F A;  2GXG A;  3VOE A;  1RUO A;  2M5W A;  1ZH5 A;  2HR3 A;  4FX4 A;  1D5V A;  1J75 A;  1EH8 A;  3U2R A;  3PQJ A;  4L0Z B;  3DEU A;  3LAP A;  3HSF A;  1V3F A;  3K0L A;  1T38 A;  1CGP A;  3CUQ A;  2IW5 A;  4OIN F;  3SFZ A;  3HOT A;  4LB6 B;  4YFK F;  4O3M A;  4MQ9 F;  1R36 A;  4KA4 A;  2XKO A;  3I71 A;  4ZH4 F;  1S7O A;  4MNU A;  4RAY A;  1AOY A;  2VBY A;  4KN4 X;  2ZNZ A;  2VT2 A;  3KFW X;  2AS5 F;  3SZT A;  1ZG5 A;  1U2W A;  3ZQ7 A;  3NRV A;  1OYW A;  4U0V A;  2KIF A;  4AIH A;  5LBQ A;  3WTY C;  4FT8 A;  1QZZ A;  4PGG A;  3E5X A;  4WWC A;  2EFP A;  5LHH A;  5CYV A;  3GYH X;  4XSX F;  4EGY A;  1V4R A;  5CVV A;  1KU2 A;  5L3C A;  3MZY A;  5F1R A;  1IZ1 A;  2FMY A;  2HWV A;  4LG0 B;  3HSE A;  2CGP A;  1W7P B;  4Q47 A;  2FU4 A;  3R0A A;  4A0X A;  1BIA A;  3DQV C;  2XHK A;  2L02 A;  2V1U A;  2CW0 F;  2VON A;  1Z91 A;  2COM A;  4A12 A;  2DQR A;  3V7C A;  2MH2 A;  4KFC A;  1I27 A;  3N97 A;  4M9X A;  2LF8 A;  4EQQ A;  4G6D A;  2XAH A;  1YG2 A;  2CYY A;  2DFI A;  3RTR A;  1JE8 A;  1ZGJ A;  2ZKZ A;  2EV6 A;  1KYW A;  3EYY A;  1TW3 A;  2EA2 A;  3E5Q A;  3DKW A;  3ZMD A;  3E3V A;  2XRN A;  5FO5 A;  2L4A A;  2L4M A;  5DCF A;  5BPI A;  4A5N A;  2FF4 A;  3F8N A;  3I53 A;  4AVP A;  4RB1 A;  3E6M A;  3FMR A;  4YFX F;  1VTN C;  3T8T A;  4L5I A;  2PQ8 A;  1YO5 C;  3RYR A;  3HUG A;  1DPU A;  3QPT A;  1YW8 A;  3WTW C;  3E6C C;  3TO7 A;  4OIP F;  3FF5 A;  2K86 A;  4LLN A;  2JPC A;  3KEQ A;  1GVJ A;  3KEO A;  4WXC A;  1TQP A;  1IN5 A;  4M6X A;  2EB7 A;  1TNT A;  1UFM A;  3WTV C;  5ICE A;  3S2W A;  2DPU A;  1X3U A;  4ESF A;  3MEX A;  1HKT A;  4HLY A;  2ZNY A;  3ZN1 A;  2OU2 A;  1MJA A;  3GEZ A;  2MLK A;  3ZMU A;  2W24 A;  3O2P E;  2QVO A;  2CSO A;  3GO5 A;  4XSZ F;  5HLG A;  3Q9V A;  4S04 A;  3ZPL A;  3JSO A;  1NHA A;  5K5Q A;  3HRU A;  3JTH A;  4G6Q A;  3COA C;  4AIJ A;  3HYI A;  5CVR A;  3EYI A;  1R23 A;  2DTR A;  3Q9S A;  3KE2 A;  5BQT A;  1EH6 A;  1HW5 A;  3GLX A;  1GXQ A;  4UUV A;  3L7W A;  2FBH A;  2RN7 A;  2A6E F;  2FNP A;  2NAZ A;  3E6B A;  4G8X A;  4ENJ A;  4Q5S F;  1P4W A;  3V8L A;  4HOB A;  2FRH A;  1B9M A;  1CF7 B;  4RGR A;  4CXF A;  3KZY A;  5K1Y A;  2F5C A;  1MKM A;  5LGU A;  4XBF A;  2ZCW A;  2GZW A;  3I0T A;  3WG9 A;  5LEK A;  1B59 A;  2H6B A;  3BJO A;  3LWF A;  1I1S A;  1K6O A;  1HXD A;  2KKO A;  1P4A A;  2XIG A;  1MZB A;  2LDU A;  3GX4 X;  1MDM A;  4L0Y B;  1SD7 A;  4YII A;  3IKT A;  4WX9 A;  4EM2 A;  2FBI A;  1PUE E;  1BI0 A;  4HA8 A;  4G7H F;  2HQR A;  2Q0O A;  4LD5 A;  1BN5 A;  3K1P A;  5FLX Z;  2QZ8 A;  3GFM A;  3F8B A;  3K1N A;  3JW4 A;  2GIV A;  5HLH A;  3F8M A;  4HF2 A;  4IHT A;  4KUM A;  2JRT A;  2MA3 A;  2P5L C;  5JHU A;  4ZZD A;  1ZLJ A;  3TKY A;  3HTS B;  3WE3 A;  4A0Z A;  3FXU A;  3J7A O;  2P7C B;  2D45 A;  3RPU A;  5ILS A;  5H6R A;  4IRG A;  4RB0 A;  1ULY A;  1U78 A;  2CQK A;  4IXA A;  3MQ0 A;  3GWZ A;  1IF1 A;  1U5T B;  5E8I A;  3JAM Z;  4P9F A;  4L5J A;  5CVJ A;  1QO0 D;  3IWF A;  4RGS A;  3W6K B;  1FP1 D;  2P5K A;  2GQQ A;  2FBK A;  2DW4 A;  3WTZ A;  2HZT A;  1AWC A;  2ISY A;  4KYW A;  4A0Y A;  2A61 A;  2OAZ A;  2DPD A;  2G9W A;  4WF2 A;  4OMY A;  4KNY A;  2FSW A;  4G9Y A;  4MGR A;  1T39 A;  2Q8K A;  1LB2 A;  5DUI A;  5FLX K;  1WWX A;  5D8K B;  4AD9 A;  3WU1 B;  1KU9 A;  3GF2 A;  2G7H A;  1BM9 A;  2VE9 A;  4U0W A;  2XAJ A;  1B6A A;  2HTS A;  1R5G A;  2M45 A;  5D5X B;  1HQC A;  4HX7 A;  4M6Y A;  3GUD A;  2DK5 A;  2BBY A;  1BC7 C;  4A6D A;  4EVI A;  2K4J A;  5AIQ A;  1R1U A;  1JHF A;  4P5O A;  4WCG A;  2PJP A;  5FB2 A;  3BZ6 A;  1PP7 U;  2VN2 A;  2MLG A;  5H6Q A;  1FP2 A;  4KMU X;  1EH7 A;  3PQK A;  2EJR A;  3GFI A;  1WSU A;  2ADU A;  3HHH A;  4ON0 A;  5L3D A;  3PFI A;  1ON2 A;  4EJV A;  2ZXJ A;  3F72 A;  4R1H A;  5ILU A;  1Z05 A;  4PDK A;  4IJA A;  5BPD A;  2O8X A;  3QPH A;  1HBX G;  4HV6 A;  4HLX A;  4BAY A;  2NNY A;  1P6R A;  4UHT A;  3SZP A;  3DP7 A;  1DPR A;  5DYM A;  4BHB A;  5D5W B;  1BI2 A;  5JFR A;  2BV6 A;  4FHT A;  2XAG A;  5CLS A;  3QU6 A;  2ETH A;  1QZY A;  4I7H A;  4LGW A;  3J81 Z;  4EGZ A;  4M9S A;  2EV5 A;  3LQQ A;  2W84 A;  2H27 A;  2M30 A;  2PFB A;  4D0P A;  2V9V A;  2IT0 A;  5TRD A;  2DT5 A;  3G73 A;  3LA2 A;  4JBA A;  2WTE A;  3ISP A;  1YIO A;  3RKX A;  1IN7 A;  3R4K A;  1J59 A;  2VC1 A;  1OPC A;  5D5U B;  3RKW A;  1BOA A;  1ZHF A;  3Q5F A;  1U5T A;  2EFN A;  3I4P A;  1FC3 A;  3FX3 A;  4LMY A;  1WQ2 A;  3HSR A;  4Q48 A;  3LQR A;  2E1C A;  1R58 A;  1RNL A;  4ENN A;  2HFH A;  5JI6 A;  2QM3 A;  2RVC A;  1BJA A;  4GO1 A;  4KIF A;  1WRJ A;  1GHC A;  1G3S A;  1R7J A;  2FML A;  4I0B A;  2W25 A;  5E8G A;  2UWM A;  1LNW A;  4XRF A;  3BPV A;  2EFW A;  3ABU A;  2YPR A;  5KVR A;  2STW A;  2PBI A;  3HRS A;  1W5S A;  4UVA A;  4ENK A;  2IJL A;  4FX0 A;  3CDH A;  3R6S A;  2IVM A;  1K78 A;  3M8E A;  2NNN A;  3MAJ A;  3ZMS A;  2KIU A;  3GVA A;  1RIO H;  2JTV A;  1U8R A;  4I2O A;  2BE5 F;  3SQN A;  1HSJ A;  4EMS A;  3F8F A;  2IA2 A;  3ECH A;  1IN4 A;  4M72 A;  4UVC A;  1SD4 A;  4Y13 A;  2RGV A;  1IXR C;  1HKQ A;  3B02 A;  2O03 A;  3DV8 A;  2PLY A;  2IA0 A;  1O3S A;  1KU7 A;  2Z3Y A;  2DAO A;  1IXC A;  2EV0 A;  2FOK A;  4CYD A;  2P4W A;  3I64 A;  1SMT A;  1F9N A;  4NHJ A;  5E1X A;  1YFH A;  2P6T A;  1KQ0 A;  4HAM A;  3WTX C;  2AXL A;  5ICG A;  1J2X A;  2EFO A;  2V1D A;  5BMZ A;  4JQF A;  2MH9 A;  4KIG A;  1UB9 A;  1YLF A;  1P92 A;  1JXS A;  2L01 A;  2DI3 A;  4JK1 X;  4YIF A;  1T98 A;  3I59 B;  4L9J A;  1D3Y A;  5LHG A;  3WOD F;  4CHU A;  1XDS A;  1HW1 A;  1TQI A;  2TDX A;  1MJ9 A;  2IP2 A;  1W7P D;  3EET A;  2M1B A;  1RI7 A;  1QNT A;  4M71 A;  1K79 A;  4ZYD A;  2YX4 A;  2MD5 A;  1OMI A;  1MDM B;  3TQN A;  1R1T A;  2XAQ A;  4K2E A;  5LRR A;  2A69 F;  1A04 A;  2VOO A;  1ZGA A;  3M7G A;  3ULQ B;  5HDN A;  1LVA A;  1XMA A;  1UST A;  2F5D A;  4LJZ F;  5L3B A;  3HRM A;  1FYK A;  2OD5 A;  4KDP A;  3IRR A;  2P7V B;  3JSP A;  1ZYR F;  1IN6 A;  4HQE A;  5ICC A;  1L3L A;  5HS7 A;  4RAZ A;  5D6E A;  1UHM A;  3VOD A;  3OV8 A;  4GGG A;  1KQ8 A;  3L9F A;  3CLO A;  2HTJ A;  4RB3 C;  4LB5 A;  1LEA A;  2VOP A;  3LST A;  3D0S A;  3FXQ A;  2F5E A;  4WXD A;  2EFQ A;  3WGH A;  4A5M A;  2STT A;  4M74 A;  3FM3 A;  3G3Z A;  4CDG A;  2Z99 A;  1QBJ A;  1G4D A;  2X0L A;  1P2F A;  5E1W A;  1W5T A;  5A2Q Z;  4B8X A;  4BQA A;  3U9G A;  2KJC A;  4LK0 F;  1S6L A;  4GXO A;  2QQ9 A;  1FSH A;  1XCB A;  4L9T A;  3T0Y A;  2A68 F;  1XGM A;  1DUX C;  2UZK A;  4O5V A;  3TDU C;  3RIR A;  1KGS A;  1Y0U A;  4A6E A;  4U7D A;  1D8J A;  1P4X A;  4YG2 F;  2IPQ X;  1KYZ A;  3WGI A;  3CO6 C;  2CFX A;  1XDU A;  5DD4 A;  5EEG A;  2EA4 A;  3I59 A;  2V79 A;  3BP8 A;  1RZ4 A;  2GAU A;  1O3Q A;  4I98 B; 
#chains in the Genus database with same CATH topology
 1BIB A;  3CJR B;  2BGC A;  2DFE A;  4E70 A;  2QLZ A;  4ZYE A;  3F8C A;  1MJB A;  3M1C A;  4XLN F;  1X1P A;  5EYR A;  3EUH C;  2MC3 A;  1OR7 A;  5DD8 A;  3K69 A;  3CC7 I;  4BQN A;  3KYL A;  4IRH A;  3BTC A;  1R49 A;  1BW5 A;  4I09 A;  3I56 I;  1LDD A;  5FGM A;  5CVI A;  1ZAR A;  4UUS B;  2EK5 A;  1OFC X;  1FBS A;  2MVT A;  1QU3 A;  4F7Z A;  5A2Q K;  1Z6T A;  2CU7 A;  2VJI A;  3MFK A;  2LY9 A;  3BG5 A;  1MH4 A;  3TOA A;  1DP7 P;  2MG4 A;  2YU3 A;  2JA6 J;  3BLY A;  2K02 A;  3BOQ A;  3CC2 I;  4GYG A;  1VQ4 I;  5HS9 A;  5F1J A;  2R93 J;  3ZMZ A;  1ZKG A;  2R7F A;  1VQP I;  1S5L C;  4BH9 A;  4KMF A;  3CZ6 A;  4UY8 I;  1YIT I;  2VUM J;  5LHI A;  4I6Z A;  1J7K A;  2HKX A;  5F0H A;  1PP8 F;  3E0J B;  3BC8 A;  4ETS A;  5IYB J;  2FE3 A;  3J80 Z;  1JI8 A;  2HEO A;  3KP7 A;  2XGE A;  1BI1 A;  1M1E B;  1YOV B;  2VXZ A;  3FWE A;  4MTE A;  2AQE A;  1IN8 A;  1T2K A;  3HOW J;  2FNA A;  3WTU C;  2KJB A;  2M0C A;  2HVR A;  1OKR A;  4PJN A;  2A5Y B;  2XGC A;  1YJW I;  3F22 A;  2CRG A;  3VEP A;  4IRI A;  3M1E A;  1T0F A;  2R7Q A;  4CCM A;  2LKP A;  3QU3 A;  3QPL A;  1STZ A;  2ACJ A;  4M9Z A;  4B3X A;  2H8R A;  2Y30 A;  2FEZ A;  4HQM A;  3H9Q A;  4XRS A;  3N4M A;  5LGT A;  2H8W A;  4NC7 A;  5JLW A;  3GTP J;  2DBB A;  1O3T A;  5K7F A;  1EJ9 A;  1ETY A;  3VB2 A;  4LOC A;  3S14 J;  2WWY A;  4D9J A;  3SXY A;  5JLX A;  1ZRD A;  3C2G A;  3GZ6 A;  4M3B A;  5C3E J;  3DFG A;  3H3Z A;  1ZG3 A;  1E2X A;  3DF8 A;  4J00 A;  1A35 A;  2F4I A;  2KMU A;  5IY5 H;  1SAU A;  3IUO A;  4DZJ A;  1IAW A;  1H9G A;  2MGQ A;  4Y33 A;  5DCM A;  3OYG A;  3OOP A;  2OA4 A;  3FXJ A;  3TO9 A;  3L2W A;  3EDP A;  1G2H A;  3OY9 A;  1Z6R A;  2DQL A;  3ABK H;  2IA1 A;  3F6O A;  4M6V A;  2ELJ A;  1TBX A;  4ZTF A;  5DDG A;  3J81 R;  3FZV A;  5FKM A;  4DOZ A;  2IRF G;  3VFZ A;  3GW2 A;  1WCM J;  3QQA A;  3BCA A;  4G6T B;  2WC2 A;  2IBD A;  1YS7 A;  2N8G A;  1SMY F;  2XRL A;  4RB2 C;  3LSI A;  1OIS A;  1LDJ A;  1IDY A;  3WU0 A;  3VYS B;  4QPO A;  1G8X A;  3RCO A;  2M8E A;  3CCV I;  3ZQH A;  1RQ6 A;  2XB5 A;  4UVB A;  4BJT A;  4B09 A;  1MMG A;  2Y2Z A;  1G3T A;  1XTA A;  1S3J A;  2KIQ A;  3NWS A;  3MKW B;  1BJZ A;  2E2I J;  4I76 A;  2CQQ A;  2UUZ A;  4U88 A;  3H5R A;  4CGZ A;  4RGX A;  1JGG A;  3CCJ I;  2ISZ A;  1QQI A;  3LFK A;  1LDK B;  3LA7 A;  2DMN A;  4WXH A;  1OQY A;  4A2U A;  3OR2 C;  3E97 A;  5EEH A;  2VBW A;  3HXL A;  2GA1 A;  1K78 B;  2Y9Y A;  1RKW A;  4OAY A;  1BW6 A;  3MWM A;  1YIJ I;  5F27 A;  1VFC A;  3IC7 A;  2MBF A;  1FWZ A;  1IRG A;  1TNS A;  3WE2 A;  3LA3 A;  2WB1 A;  4AYB A;  1WKM A;  2HI3 A;  2V9P A;  2B9S A;  4HDU A;  1Z3X A;  1Z7U A;  3JAM K;  4L5E A;  2CG4 A;  1E17 A;  2JA2 A;  2PX9 A;  5F64 A;  2ZSH B;  4OIQ F;  1G6N A;  4C2T A;  2L9S A;  2JZY A;  2Z1D A;  1TT0 A;  2JVH A;  1GXP A;  4BS9 A;  4BY1 J;  3OL3 A;  3IRQ A;  3LL7 A;  2VLA A;  3M8F A;  2VOD A;  1TC3 C;  3VSK A;  1IDZ A;  1X1D A;  3F6V A;  2WY7 Q;  5DV5 A;  1FOK A;  3L09 A;  2JT1 A;  3JRF A;  3TDZ C;  4HF0 A;  2HDD A;  1X58 A;  2G7U A;  1PDN C;  1MD0 A;  2ID3 A;  3NEU A;  3WTT C;  2GWR A;  4L9N A;  5DEQ A;  4QTR A;  3KP3 A;  5E3M A;  2WV1 A;  2RAE A;  4OAZ A;  4HF1 A;  4UXN A;  3BTL A;  4UUS A;  4L9V A;  3RZO J;  1BI3 A;  5J1U A;  4Q4Z F;  4S05 A;  4FQG A;  1HKS A;  3MD2 A;  1TL8 A;  4EJT A;  1ZAO A;  2ZJQ F;  3P9C A;  1KQ9 A;  3KPH A;  5D4R A;  3SHF A;  1L0O C;  2RC4 A;  4C9Y A;  3TGN A;  4YIR X;  2L7F P;  3AL0 B;  3A0B C;  1IW7 F;  2VJJ A;  2Y0S A;  1MBF A;  2CQX A;  4BXU A;  3RI4 A;  1K61 A;  4HDV A;  2OZU A;  2VT3 A;  2DLL A;  2F6C A;  1FPQ A;  3HPH A;  3CUQ C;  5F0F A;  1XSD A;  2PN6 A;  4KIB A;  4IF4 A;  5L3F A;  1VQL I;  1XB4 A;  2E5N A;  3K1M A;  3QP6 A;  3HTU A;  2X6X A;  3OYI A;  3BG6 A;  1QPM A;  1XSX A;  2BVL A;  3ABM H;  3IHU A;  1RKT A;  2ICW G;  1S8N A;  2IGM A;  3PUF A;  2F5F A;  2IGK A;  2VE8 A;  5D8L B;  2ZC2 A;  2M87 A;  2VAS A;  5ILV A;  2JPB A;  3EUA A;  1JGS A;  3CF2 A;  1Z77 A;  2HZD A;  3H92 A;  1SFU A;  1VQ7 I;  3G1L A;  3GLL A;  4RAG A;  2MUN A;  2XV4 S;  3BJ6 A;  1F1Z A;  4E7S A;  2X51 A;  3AG4 H;  3BR2 A;  4P1W A;  3QRF F;  2CWE A;  1ZEL A;  1B1B A;  3PNV A;  4XLA A;  4A3B J;  1ZTR A;  1I1G A;  2BW3 A;  1F4K A;  1MSE C;  2KRF A;  4RA2 A;  2LR8 A;  5IT3 A;  4G7O F;  2YSR A;  3ASO H;  5K7H A;  4HYE A;  1XGS A;  5LGN A;  3U1D A;  1V5E A;  2O5R A;  1XD7 A;  2P81 A;  3L2C A;  2LG4 A;  1O3R A;  3R61 A;  2RNJ A;  4AIK A;  4Y52 J;  4P55 A;  1GT0 C;  1TZL A;  2D1H A;  2X9D A;  1J9I A;  2DA4 A;  5FRO A;  4EJU A;  2LNB A;  2GA2 A;  2XUB A;  4CUG A;  4BNC A;  5FRM A;  4HBL A;  5E1Z B;  1I5Z A;  2EWN A;  2H94 A;  4N9H A;  1RC9 A;  1SFK A;  3P9K A;  2IEK A;  2DO7 A;  2EZI A;  2V4J C;  2V7F A;  3V8J A;  4MFD A;  1O57 A;  3LSR A;  2E2J J;  3O3K A;  1WPK A;  3OYH A;  3DBL B;  4XID A;  2Z33 A;  3AKZ A;  2Z9O A;  3J81 K;  3ROU A;  3HGG A;  1TW2 A;  1LVK A;  2VBZ A;  4GCV A;  3I4N J;  3H0D A;  2H1K A;  4IHS A;  4JOM A;  3JRE A;  4A3J J;  2O0Y A;  4RS8 A;  2FD5 A;  3AG3 H;  3ABT A;  1X1B A;  2KHM A;  3CCS I;  2WBM A;  4EM0 B;  4X1E A;  1H8A C;  2QCO A;  3E7L A;  5HS8 A;  4X0G A;  3JTG A;  3CCU I;  2K4B A;  4XLC A;  4GYI A;  2JSC A;  1XX5 A;  5CQE A;  2R92 J;  1ZRE A;  4I01 A;  4UB8 C;  2LBF B;  1Z9C A;  3C7J A;  2QBY A;  1D8K A;  5KK1 A;  3F3X A;  1JKR C;  1YTY A;  1Y56 A;  4MEX F;  1GUU A;  1Q1H A;  2GXB A;  2JQ7 A;  3W6J B;  2E2H J;  2LRD A;  2XAF A;  3K4B A;  2KZG A;  4BUP A;  4E6K G;  5CQG A;  1JJ8 C;  3ZMV A;  3IL2 A;  2QSF X;  3ZRG A;  1K7A A;  2B0L A;  4BQQ A;  3MKY B;  2OBP A;  1FLI A;  3IV5 A;  1USS A;  3DKX A;  2VKH A;  1FZP B;  3BDD A;  2ZME A;  4J19 A;  4PCQ A;  2TRT A;  1UZC A;  3P5J A;  1T33 A;  2R7D A;  4PGH A;  4OIO F;  4FE4 A;  1ETV A;  4ZZL A;  2VQL A;  2CQN A;  2BZT A;  4XLP F;  1OYY A;  5ERI A;  3GTM J;  1MNM C;  1UCR A;  4I99 C;  5IP6 A;  3O8H A;  4C30 A;  5GAE J;  2L9V A;  2PEX A;  4HZF A;  2A6H F;  2QEX I;  2L3D A;  3DWL E;  1X2N A;  2QEN A;  2Z5U A;  3CCM I;  2FA5 A;  2ZSI B;  5JVG F;  2WAQ A;  2XGX A;  3PL8 A;  3S15 J;  2E7X A;  2LF7 A;  4OOI A;  2HGC A;  2XPV A;  4BJ5 C;  1EV7 A;  1R1V A;  2AQF A;  2BXY A;  3GCM A;  2A3S A;  4IQ4 A;  3S16 J;  2CMP A;  4B47 A;  5IYD J;  3HZJ A;  3K4M A;  4RGU A;  5FLM J;  3V8K A;  2DA2 A;  3DLL F;  3ECO A;  5HDG A;  2CS3 A;  1WI9 A;  4MIM A;  3B6A A;  4Y15 A;  3T1B A;  1HW2 A;  2DMU A;  5E18 F;  2RQQ A;  2HYF A;  2CW8 A;  5FKN A;  4H0E A;  5A2Q R;  4ESJ A;  4PZJ A;  5IP7 J;  4M3F A;  4ZYG A;  1QVT A;  5EZG A;  4E7J A;  3RPQ A;  1I6X A;  2ZFU A;  3H3U A;  4QWQ A;  2IS4 A;  4BY7 J;  1X3W B;  2QUF A;  4NQW A;  5FFX A;  2F4M B;  1SAX A;  5AIP A;  2DN0 A;  2XAS A;  4FAS D;  1DU0 A;  3KCC A;  4O6J A;  4LLL A;  4DQ2 A;  1Z67 A;  1Y0N A;  2CUZ A;  5HOO A;  3SFI A;  4A69 C;  1LJ9 A;  3DXJ F;  4N0B A;  2D1V A;  2DJN A;  2L54 A;  3ZQG A;  3DPU A;  2I8D A;  1ZGW A;  1XCV A;  2V26 A;  2VL8 A;  5FLV A;  3HOX J;  2B63 J;  1ACI A;  5HLI A;  1LQ1 A;  2OQR A;  1MIJ A;  1H0M A;  5EG0 B;  3CTA A;  3BCB A;  3HOS A;  2ZJ2 A;  3QYB A;  4S0H B;  1AKH B;  2DK8 A;  1FSE A;  4KT5 C;  4BE2 A;  6PAX A;  3Q0V A;  5GP9 A;  2HVS A;  4LK1 F;  4IVN A;  4UNO A;  3WTS C;  2VC0 A;  1ERD A;  3AG2 H;  4YEL A;  1YHQ I;  1JHH A;  1WI3 A;  3CUO A;  2Y75 A;  2WAE A;  2HDC A;  4A3L J;  4EJW A;  3E6D A;  2UXX A;  1LEB A;  2ZXI A;  3OR1 C;  2VIX A;  4OMZ A;  2XKP A;  4WK8 F;  1ETW A;  2HYG D;  1FY7 A;  1UEL B;  2OCE A;  2CV0 A;  2XF6 A;  1TWH J;  1YW9 A;  2BYV E;  2X4H A;  2XAU A;  3ABL H;  4XOP A;  4ASN A;  2WY8 Q;  3F0C A;  3TW6 A;  2PG4 A;  2P6S A;  1SFE A;  3K4C A;  5KNL A;  3F23 A;  1O7L A;  3FK7 A;  3KET A;  3P9I A;  2L9R A;  2M7A A;  1B8I B;  1A5J A;  1MGT A;  1G59 A;  2ESH A;  4UV9 A;  3IP4 B;  3VDX A;  4XRM A;  5BOX A;  2MC4 A;  2CW7 A;  1KU3 A;  3GXO A;  2V6C A;  4G94 A;  1WJC A;  3BZK A;  3TW7 A;  1ETQ A;  1IRF A;  2VBX A;  4XQF A;  1IO2 A;  3BZC A;  3A01 A;  2UXN A;  3VYU B;  3BJA A;  4DNC A;  4R8H A;  3JRD A;  3I58 A;  5DCM B;  3HBL A;  4JX4 A;  1BC8 C;  4A3G J;  2M3A A;  4MEY F;  4ENM A;  4HX8 A;  2DU9 A;  2B7E A;  2XB0 X;  4DYQ A;  2NOG A;  2BY1 A;  3DBR B;  4BXF A;  4DZP A;  3J80 R;  4BBR J;  1H9T A;  2JUC A;  2Q1Z B;  3RJP A;  3RPU D;  1YX3 A;  1S7A A;  2FOW A;  3OYM A;  3S32 A;  2ZFW A;  1HDD C;  5C4J J;  3QAH A;  2OZ6 A;  4M3E A;  1ZLK A;  3ASN H;  3NQO A;  4N9I A;  1XC5 A;  1VQ9 I;  1BA5 A;  4XRS G;  4G7Z F;  5D4S A;  3PUB A;  2KPM A;  3OYJ A;  3FMQ A;  3M9A A;  5J6X A;  4U7B A;  1O4X A;  3DU6 A;  1YI2 I;  3L2R A;  1SD6 A;  3CJN A;  1D1A A;  2YX7 A;  3Q0U A;  4CCN A;  1FX7 A;  2QYO A;  4LIV A;  2UV1 A;  3CDL A;  2L2O A;  3IWZ A;  3FM5 A;  3AAF A;  3VWB A;  1ZG1 A;  3R0J A;  5CJ9 A;  3HHG A;  3JAM R;  4MTD A;  2X1E A;  3D5L A;  1N25 A;  3J7A W;  1R22 A;  1D0Z A;  4PJ0 C;  1ODD A;  2TCT A;  3L00 A;  4QLC U;  3OYD A;  4LFU A;  1FIP A;  3DTK A;  2DA7 A;  3CMY A;  1DDN A;  3PSF A;  2R7U A;  2P8T A;  3UR3 C;  1F5T A;  4ZJZ A;  2EIN H;  4A3I J;  2LVS A;  5LRS A;  3FMS A;  3GZ5 A;  3HM5 A;  3KLN A;  2E60 A;  1R5H A;  4U0Y A;  4LG0 A;  2XRO A;  1K4T A;  3REO A;  4IX7 A;  1IUF A;  1P7I A;  1W7P A;  2K7L A;  4Y17 A;  2XC7 A;  2IS2 A;  3HIF A;  4BE1 A;  2VPR A;  4L18 B;  4CA0 A;  4CZZ A;  5HLT A;  3M07 A;  3BWG A;  5K7Z A;  3J7A Y;  1MMN A;  2J5P A;  1H88 C;  1ETX A;  1FNN A;  2EIJ H;  4BHP A;  1Z1D A;  3DPT A;  1W4M A;  2H1L A;  2HNH A;  4DBR A;  2HOT A;  3DTI A;  3MZH A;  3BQZ A;  1DQU A;  3FXL A;  1UMQ A;  5E17 F;  2WV0 A;  1YJN I;  3FDY A;  4EEF G;  1J0R A;  4A93 J;  1REP C;  2JRM A;  1IRZ A;  2DT7 B;  3M3Y J;  2J5O A;  3HOU J;  2ELK A;  2LTP A;  2KDO A;  3G71 I;  1GV5 A;  4JYK A;  1OJL A;  3IKV A;  2W57 A;  4BHC A;  4EV0 A;  3FHZ A;  1IG7 A;  2XVC A;  1MND A;  2I10 A;  2KP6 A;  4ZYH A;  2Y69 H;  5IT9 Z;  2L9N A;  2LOO A;  2K3P A;  4YFN F;  1YQA A;  2VB6 A;  2QWW A;  1SVM A;  3RQ4 A;  5EG0 A;  2OJE D;  4I02 A;  2BEO A;  1WJB A;  4TV7 A;  1AKH A;  3LOC A;  3WGG A;  1OCT C;  3MKL A;  1K4S A;  1VQ5 I;  2O6G E;  2R7R A;  5LLQ A;  5B1B H;  1JTY A;  1FT9 A;  4CO8 A;  3BY6 A;  5K5O A;  1O7F A;  1DGR M;  2E19 A;  2K85 A;  1R9T J;  3O6B B;  1U3E M;  1N75 A;  2FXA A;  1MW7 A;  1W5C C;  5FKK A;  1XSV A;  4D7M A;  3V4G A;  1X3Z B;  2K9Q A;  2D2W A;  2GLO A;  2E1N A;  3KP5 A;  3ML6 A;  2QQB A;  5IPA A;  4F91 B;  4AU7 A;  1EF4 A;  3F9K A;  3GTQ J;  1RET A;  2YR2 A;  3BRO A;  4E7K A;  2HQA A;  2PMH A;  3DCF A;  2GOM A;  1B8I A;  1B9N A;  3DLA A;  5HDK A;  1FOX A;  3D5S C;  2BW3 B;  2OC6 A;  1U6G A;  2IAI A;  5JVT A;  1OCR H;  2CH0 A;  2P0W A;  3KEY A;  3TP0 A;  1I3A A;  2V9K A;  4P96 A;  5L3E A;  5H2F C;  2PMZ A;  4ITV A;  4P9U A;  2KFD A;  1SD5 A;  2ZBK A;  3QOP A;  2QSH X;  4BGD A;  1TP4 A;  4GRI A;  3CC4 I;  1G3Y A;  1NH3 A;  4JX6 A;  4HV5 A;  5EGO B;  4XKV A;  2R5Z B;  5TJJ A;  4UV8 A;  4AVZ A;  4AM3 A;  3K2Z A;  3QOE A;  2MSY A;  3S2H J;  4OU0 A;  2RKH A;  5CVU A;  2JN6 A;  1BR1 A;  2ECC A;  2EZH A;  3EUH A;  1VQO I;  4DGW B;  3LFU A;  4QSH A;  4A3D J;  1VQ6 I;  3RYP A;  2HXO A;  2NS7 A;  2HU9 A;  5IT9 K;  1XGO A;  3TOB A;  3BPX A;  1OYI A;  2A5W A;  3OIQ A;  1S72 I;  3W6V A;  3RDI A;  4CSW A;  3I54 A;  2HKO A;  2YUS A;  4HW0 A;  3GFL A;  4R79 A;  1POG A;  2HQN A;  2ESN A;  3GTO J;  4XN3 A;  3J80 K;  2DMP A;  2Q2E A;  2R7Z J;  4NDL A;  1WJF A;  2BVM A;  5H20 A;  1HST A;  3E5U A;  1J5Y A;  3TO6 A;  3ZN0 A;  3HDD A;  1Y6I A;  2MW8 A;  1AA7 A;  3EQL F;  2ZJR F;  3CO7 C;  1RUN A;  3L2Q A;  4MHG A;  2JA8 J;  2DA1 A;  3CUQ B;  2ZXH A;  3FXR A;  3GZN B;  2DYR H;  1PJR A;  2O3F A;  2Y0M A;  2VQG A;  4KIC A;  3HRT A;  5HVQ C;  1RR8 C;  4AWX B;  5LEJ A;  2IS6 A;  1IUY A;  2QBY B;  5F6F A;  4HX4 A;  4M73 A;  2X48 A;  1MBH A;  2H6C A;  2KZV A;  1WZ2 A;  3K4J A;  1FBU A;  2WB1 N;  4AYB N;  2JA5 J;  4FTH A;  1R00 A;  2ELH A;  3C1D A;  5D5V B;  3KZI C;  2M2E A;  2W85 A;  3K7A J;  1FBQ A;  5J8C A;  2HXI A;  4GDF A;  2NS0 A;  3KP2 A;  1YS6 A;  2ZXW H;  5ICF A;  2ZME B;  5KCM A;  3JRA A;  2LP0 A;  1ZRF A;  1G3W A;  2DJI A;  4NB5 A;  2HOE A;  2CO5 A;  4C3J J;  4Z6Y A;  3G6E I;  1QVU A;  5AON A;  3ZP5 A;  3DPL C;  4KN7 X;  1BBY A;  3T5X A;  1XMK A;  1TTY A;  1U9N A;  2Y48 A;  1ETO A;  3T8R A;  2K9M A;  4IHY A;  5K5R A;  5J1R A;  1S29 A;  1ZN2 A;  3OYE A;  1IGN A;  3OOU A;  2KIM A;  2C6Y A;  1XN7 A;  3KP6 A;  3KP4 A;  4DJA A;  4BEH B;  1R4M B;  4CH7 A;  2HDW A;  3F21 A;  9ANT A;  1SFX A;  5IOZ A;  4RAF A;  1U5T C;  4UB6 C;  1W36 D;  1CF7 A;  3ZMT A;  3H1C A;  1BL0 A;  4IO9 F;  4EM1 A;  1GDT A;  3C3W A;  3GFJ A;  4ABZ A;  2A07 F;  1YYV A;  2YS9 A;  3RKY A;  5M3M J;  5FD6 A;  3BQY A;  3KIO A;  4OIR F;  2Y0S N;  2F2E A;  2M34 A;  2V1X A;  4D7N A;  4YEJ A;  4LLG F;  2MZ4 A;  4LIU A;  1X1C A;  2CV2 A;  1TQM A;  4AID A;  2RQP A;  2RDP A;  3GTK J;  5BS6 A;  3S1N J;  1X1A A;  2Z16 A;  3KLO A;  4FET A;  1D1B A;  3OYN A;  1Q1V A;  4B3A A;  1JKO C;  3P7N A;  1W0U A;  3I5U A;  3FXM A;  2OUM A;  2PMU A;  2PI0 A;  2E7W A;  1FYL A;  2IGO A;  3CP8 A;  1XGN A;  1MMD A;  2HS5 A;  1VZ0 A;  2QQA A;  3C18 A;  2O61 A;  1TWA J;  2DMT A;  3H35 A;  3QP5 A;  4NQW B;  1TLH B;  3CDI A;  3FIS A;  4M3G A;  3VYR B;  3HOV J;  1UHW A;  3PO3 J;  2X98 A;  2RV8 A;  1DGW Y;  1C0W A;  2PJR B;  4ESB A;  2FQ3 A;  1JUP A;  2JUG A;  5GAH J;  3CCR I;  1HC8 A;  3LAJ A;  2ZO4 A;  2HOS A;  1YX5 A;  1IXS B;  1GVD A;  1R5I D;  2H09 A;  5J8F A;  1H89 C;  5JR3 A;  3HOZ J;  1KA8 A;  3KZZ A;  5ED4 A;  3V7S A;  5FFZ A;  4ZDP A;  1OCO H;  5L3G A;  4NUB A;  2MYS A;  4Z2Y A;  1FOW A;  1B4A A;  3ZQI A;  2AO9 A;  1QGP A;  5E79 C;  3B73 A;  3V7R A;  4J01 A;  1QHH D;  3I4M J;  2LYC A;  1VQM I;  4BYY A;  4I0A A;  4MQV A;  1WGX A;  1V54 H;  5J47 A;  3R60 A;  4B48 A;  2NYX A;  1W36 C;  2XF7 A;  2P5V A;  5DUK A;  2DCE A;  3ERE D;  1ZRC A;  1FYM A;  1T6S A;  3ELK A;  3CMA I;  2JK3 A;  4EJO A;  5B3S H;  1UAA A;  1S9H A;  1ZR4 A;  5EGO A;  1U0J A;  2R5Z A;  4XOT A;  2OQG A;  1D1C A;  3BR1 A;  3K9T A;  5E20 A;  2E34 A;  5FD5 A;  1YW7 A;  1ONV A;  4U87 A;  5F04 A;  2R3S A;  2LSO A;  2OV7 A;  3JR9 A;  4E7I A;  2NRA C;  2WAD A;  4IPA A;  4PUS A;  1VQ8 I;  1ON1 A;  2K27 A;  4CIC A;  3MCZ A;  5D6F A;  2GXG A;  3VOE A;  2P0T A;  1WJE A;  5TGT A;  5J1Y A;  4RBO A;  1MBG A;  2M5W A;  1RUO A;  1ZH5 A;  2HR3 A;  3BG7 A;  4FX4 A;  1D5V A;  3WHB A;  1J75 A;  1EH8 A;  3CJQ B;  1JT0 A;  3U2R A;  3PQJ A;  1TT5 B;  5EDN A;  3A01 B;  4L0Z B;  3DEU A;  3LAP A;  3HSF A;  3OMY A;  4XON A;  1V3F A;  3K0L A;  2LKS A;  4CCL A;  2DA5 A;  1T38 A;  1CGP A;  3CUQ A;  2F5V A;  2KT0 A;  1U8B A;  2IW5 A;  4OIN F;  3SFZ A;  2FQ4 A;  3HOT A;  4LB6 B;  4A3F J;  4YFK F;  4IQJ A;  4O3M A;  2ZB9 A;  5LFA A;  4ZTJ A;  4MQ9 F;  1R36 A;  3PSI A;  4KA4 A;  2XKO A;  3I71 A;  5FKO A;  4ZH4 F;  1S7O A;  1E3H A;  4MNU A;  4RAY A;  3DEW A;  1LUJ B;  4XKB A;  2LK2 A;  1AOY A;  2VBY A;  4KN4 X;  2ZNZ A;  3BR3 A;  3PFY A;  1X19 A;  4G12 A;  2L7Z A;  2VT2 A;  3KFW X;  2AS5 F;  2F48 A;  3SZT A;  1ZG5 A;  1U2W A;  3ZQ7 A;  3NRV A;  1OYW A;  4XL9 A;  4U0V A;  2KIF A;  4HPQ A;  4F92 B;  4XNF A;  4AIH A;  3DU5 A;  4ZC3 A;  5LBQ A;  3WTY C;  4NNJ A;  4FT8 A;  3OYK A;  1QZZ A;  3DBH B;  4PGG A;  3E5X A;  4WWC A;  2EFP A;  3AG1 H;  2MD0 A;  5LHH A;  5CYV A;  4BEH A;  3A03 A;  4B43 A;  2FJ1 A;  3A02 A;  3GYH X;  2WAQ N;  1KON A;  4XSX F;  4EGY A;  3CP2 A;  1V4R A;  2LKX A;  2M0M A;  3ZCO A;  2AXT C;  1JUS A;  5DM7 F;  3BR5 A;  2X85 A;  2A6T A;  5CVV A;  3H0G J;  4BL0 B;  1KU2 A;  1JTX A;  5L3C A;  3MZY A;  4D5F A;  3FXK A;  5F1R A;  1IZ1 A;  2FMY A;  3PM1 A;  2HWV A;  1RR7 A;  2W4S A;  4LG0 B;  3TL4 X;  3HSE A;  2E1M B;  2CGP A;  1W7P B;  4Q47 A;  2FU4 A;  1T56 A;  1LE8 A;  3R0A A;  4A0X A;  3QPS A;  1BIA A;  3DQV C;  4MO7 A;  1R6R A;  4NC8 A;  1ITY A;  3OYC A;  2DFH A;  1MBK A;  2XHK A;  3ERM A;  2L02 A;  2EBI A;  3CJT B;  2V1U A;  2CW0 F;  2R5Y A;  2VPL A;  2M7B A;  2PJR A;  2VON A;  1Z91 A;  3MN2 A;  2COM A;  4A12 A;  3PNT A;  2DQR A;  3K10 A;  5IOY A;  3V7C A;  2MH2 A;  4KFC A;  1I27 A;  2RNG A;  1BOB A;  3N97 A;  1LFU P;  5FJ8 J;  1B72 A;  3IH2 A;  2X1D A;  4M9X A;  2BHZ A;  2LF8 A;  3HB9 A;  3S3O A;  1ORK A;  4EQQ A;  4G6D A;  3RQI A;  2XAH A;  1YG2 A;  2IS1 A;  2CYY A;  2DFI A;  3RTR A;  4PSW A;  1JE8 A;  3PNY A;  1ZGJ A;  2ZKZ A;  1SEU A;  3PJR A;  4IEJ A;  2EV6 A;  1KYW A;  3J7Z I;  2BY0 A;  3EYY A;  2COB A;  3BTI A;  1TW3 A;  2EA2 A;  3E5Q A;  3KYC B;  2XSD C;  4XLH A;  3DKW A;  4HG2 A;  5BNG A;  3ZMD A;  2DA6 A;  3E3V A;  3CCQ I;  2XRN A;  1A31 A;  5FO5 A;  2EIK H;  1P9Q C;  3VPR A;  2L4A A;  1XS9 A;  2L4M A;  5DCF A;  5BPI A;  5GTI C;  4A5N A;  1NK2 P;  2VQC A;  2FF4 A;  2G0E A;  4N4O B;  3F8N A;  3I53 A;  4AVP A;  4RB1 A;  4QPQ A;  1MNE A;  2CV1 A;  3E6M A;  4CCO A;  3FMR A;  4YFX F;  2M35 A;  3B6C A;  1VTN C;  2XF5 A;  3T8T A;  4L5I A;  2V6E A;  2F4O B;  2PQ8 A;  4E7Z A;  1YO5 C;  3RYR A;  3TMO A;  4XLE A;  3HUG A;  3AFH A;  1DPU A;  3FHN A;  1WFX A;  3QPT A;  3FKJ A;  1YW8 A;  3WTW C;  1UG2 A;  3E6C C;  3TO7 A;  1YE9 A;  3L2U A;  1D0Y A;  4OIP F;  3H3V K;  4Y7N J;  3FF5 A;  2K86 A;  4LLN A;  2JPC A;  3KEQ A;  2JMW A;  2EQR A;  1GVJ A;  3KEO A;  5IT9 R;  4WXC A;  1TQP A;  1IN5 A;  4M6X A;  2DOA A;  1Y1W J;  4DIQ A;  2EB7 A;  1TNT A;  2VKV A;  4C3I J;  1AHD P;  4PSX A;  3BG3 A;  1UFM A;  3G2B A;  3WTV C;  5J4V A;  5ICE A;  3S2W A;  2DPU A;  1X3U A;  3IAS 2;  4ESF A;  5CPR B;  4IKF A;  3MEX A;  3JRH A;  5GTH C;  2EPF A;  1N77 A;  1HKT A;  4HLY A;  2ZNY A;  3IH3 A;  5TIS C;  3ZN1 A;  1SVL A;  2OU2 A;  1U9O A;  1NG7 A;  1MJA A;  3GEZ A;  4HNV A;  4CYC B;  3S3N A;  2CJJ A;  4NBQ A;  2MLK A;  4PK4 A;  3ZMU A;  2XGD A;  2LC2 A;  2Q2E B;  4NC6 A;  2W24 A;  1D5Y A;  3JRG A;  3O2P E;  2QVO A;  2QA4 I;  5M5Y J;  2A05 A;  2CSO A;  3GO5 A;  3EPZ A;  2R7O A;  4XSZ F;  3FKI J;  3W3C A;  5HLG A;  4II2 A;  3Q9V A;  3ZOB A;  4S04 A;  1V55 H;  2Y9Z A;  3ZPL A;  2KQR A;  4RM3 A;  1TWG J;  3JSO A;  1NHA A;  5K5Q A;  3MVP A;  3Q3S A;  3HJE A;  3HRU A;  4ZDO A;  3JTH A;  4G6Q A;  4XM3 A;  3D1N I;  3COA C;  1I39 A;  2M9H A;  2VKE A;  3GBG A;  4AIJ A;  3S3M A;  2EIM H;  3HYI A;  5CVR A;  4AC0 A;  3EYI A;  1R23 A;  4F52 A;  5IP9 J;  2DTR A;  1WJ5 A;  3Q9S A;  1FOY A;  3KE2 A;  5BQT A;  1EH6 A;  4A3E J;  1HW5 A;  2DOE A;  4RLQ A;  3U21 A;  2QSG X;  3GLX A;  3QYF A;  1GXQ A;  5EJC A;  3GTG J;  4UUV A;  3L7W A;  3S17 J;  3CCE I;  1VI0 A;  3ZQF A;  3V42 A;  4PJJ A;  2FBH A;  2RN7 A;  2O7O A;  2A6E F;  2FNP A;  3HC7 A;  1WVR A;  3SEZ A;  5C44 J;  1HF0 A;  2NAZ A;  1S7E A;  3E6B A;  4G8X A;  3JRI A;  1FMV A;  1F36 A;  3HOY J;  4ENJ A;  4Q5S F;  3S8P A;  1P4W A;  4W97 A;  3OYA A;  1RPW A;  3V8L A;  4HOB A;  5C4X J;  2FRH A;  5E3L A;  1B9M A;  1CF7 B;  4RGR A;  2EH3 A;  5J3L A;  3KZY A;  2W00 A;  4CXF A;  5K1Y A;  1MSF C;  2F5C A;  4HRI A;  3CCY A;  3HL2 A;  2O8K A;  1MKM A;  5LGU A;  2BXZ A;  4JP0 A;  4IHX A;  3OIP A;  4XBF A;  1TWC J;  2IXS A;  1HOM A;  2ZCW A;  3N05 A;  2GZW A;  3I0T A;  3WG9 A;  2VI6 A;  2DYS H;  5LEK A;  1B59 A;  3PO2 J;  2NOJ B;  3I3L A;  2H6B A;  3BJO A;  5GPC A;  3LWF A;  1QA6 A;  4B1R A;  2W48 A;  4YRV A;  1K6O A;  3FBI B;  1HXD A;  1I1S A;  2KKO A;  1MMA A;  1YRN B;  1A6Q A;  1P4A A;  4IOA F;  1OCZ H;  2XIG A;  2JA7 J;  1A36 A;  2OPT A;  1MZB A;  3C2H A;  3FBN B;  2LDU A;  4H4K C;  2KLO A;  3GX4 X;  1MDM A;  4L0Y B;  1SD7 A;  2OTJ I;  4YII A;  5HNF A;  2AHQ A;  3IKT A;  5HOD A;  2W7N A;  4WX9 A;  4EM2 A;  2FBI A;  1PUE E;  1BI0 A;  2KL4 A;  2LD5 A;  2NXN B;  4HA8 A;  2LRE A;  2DDA A;  2HQR A;  2Q0O A;  4LD5 A;  1BN5 A;  3K1P A;  4D5C A;  4G7H F;  2R7T A;  4RDU A;  3CCL I;  3O8G A;  5FLX Z;  3MKZ A;  2K9L A;  2QZ8 A;  4RLF A;  3GFM A;  3F8B A;  3K1N A;  3JW4 A;  2GIV A;  5HLH A;  3F8M A;  2HYJ A;  3G1M A;  1D0X A;  2E35 A;  3S93 A;  4HF2 A;  4IHT A;  4KUM A;  2EIL H;  2DT6 A;  2JRT A;  2MA3 A;  2PMZ N;  2HPM A;  2P5L C;  5JHU A;  1R71 A;  4XKW A;  4ZZD A;  1I6H J;  1ZLJ A;  3TKY A;  3HTS B;  2BHY A;  1LKX A;  1Z21 A;  4BKX A;  3WE3 A;  2ZJP F;  5EZH A;  4Y3O A;  4A0Z A;  1MMS A;  2DA3 A;  3WG7 H;  3OIO A;  1FMW A;  3FXU A;  3J7A O;  2P7C B;  2HVQ A;  5B1A H;  2D45 A;  4D1Q A;  4XMY A;  3RPU A;  3ZR8 X;  5ILS A;  4HNU A;  5KAF C;  3SZG A;  5H6R A;  4IRG A;  4RB0 A;  1ULY A;  1U78 A;  2CQK A;  3UKG A;  4IXA A;  3MQ0 A;  3GWZ A;  1IF1 A;  3OYF A;  1VQN I;  1U5T B;  2NVY J;  5E8I A;  2CUJ A;  4PJL A;  4A3K J;  3JAM Z;  1LPQ A;  4P9F A;  4L5J A;  1Z7L A;  4ANJ A;  1WH7 A;  5CVJ A;  1QO0 D;  3IWF A;  4RGS A;  2OCC H;  3W6K B;  1FP1 D;  4BXX J;  4ZYA A;  2P5K A;  2R7S A;  2GQQ A;  3G4S I;  4CYC A;  2FBK A;  2VXD A;  3K4N A;  1QHG A;  2DW4 A;  2HZT A;  4V2G A;  2WA0 A;  2ISY A;  5FKL A;  4II3 A;  3WTZ A;  5B5E C;  1AWC A;  1LFP A;  4KYW A;  4A0Y A;  2A61 A;  5GPA A;  1Z3Y A;  2OAZ A;  4FCY A;  2DPD A;  2G9W A;  4IZZ A;  1Y1V J;  4WF2 A;  4OMY A;  4KNY A;  2FSW A;  4G9Y A;  1SC7 A;  4MGR A;  2Z2S B;  1APL C;  1T39 A;  4IHV A;  2Q8K A;  1LB2 A;  2K9S A;  5DUI A;  2QQ8 A;  1WWX A;  3A0H C;  5FLX K;  2FX0 A;  5D8K B;  4AD9 A;  3WU1 B;  4HSR A;  3LSG A;  1KU9 A;  3GF2 A;  5IYC J;  4OWR B;  3TED A;  3FXO A;  2G7H A;  1BM9 A;  2VE9 A;  4U0W A;  2XAJ A;  1B6A A;  2HTS A;  1V5F A;  3QYE A;  2JWT A;  1R5G A;  2M45 A;  3S2D J;  1PUF A;  2GOX B;  1ZK8 A;  5D5X B;  1J09 A;  1HQC A;  3W2W A;  4HX7 A;  4M6Y A;  3S1M J;  3GUD A;  3ZQC A;  1IRX A;  2DK5 A;  2CQ7 A;  4BE0 A;  2BBY A;  1VND A;  3L2V A;  1BC7 C;  4XR6 A;  4A6D A;  5GAD J;  3U1K A;  4EVI A;  3W2A A;  2K4J A;  2XSJ C;  3D5R C;  4BDZ A;  5AIQ A;  1R1U A;  1JHF A;  1XG1 A;  3ONQ A;  1GV2 A;  2DOD A;  2QF7 A;  4P5O A;  3RSN A;  3DEE A;  4WCG A;  4E7H A;  3CD6 I;  2PJP A;  2R0Q C;  5FB2 A;  3BZ6 A;  3JRC A;  1PP7 U;  4BBS J;  2VN2 A;  3W2V A;  2MLG A;  5H6Q A;  1FP2 A;  4KMU X;  1EH7 A;  1UJ8 A;  2BOL A;  3PQK A;  2EJR A;  3GFI A;  1WSU A;  2ADU A;  3HHH A;  4BU2 A;  4ON0 A;  1FJL A;  5L3D A;  3PFI A;  1N78 A;  2RRE A;  1ON2 A;  3I55 I;  2VKD A;  4EJV A;  3X2Q H;  3H9G A;  1MBE A;  2GBY A;  3DKY A;  2M8G X;  2JVG A;  2ZXJ A;  3F72 A;  4PFP A;  4R1H A;  3TP3 A;  5ILU A;  3H5N A;  1Z05 A;  3ZXS A;  1X4P A;  3JCU C;  4PDK A;  1FEX A;  4IJA A;  5BPD A;  2O8X A;  5E3N A;  5M3F J;  3RZD J;  1CQT A;  1LE8 B;  1YRN A;  3QPH A;  4BJ6 C;  3DTE A;  4KT6 A;  3LSP A;  1HBX G;  1W0T A;  2CUF A;  4HV6 A;  4V19 K;  4HLX A;  4BAY A;  2NNY A;  1P6R A;  4UHT A;  4F3Q A;  2X6Y A;  1SAN A;  2R5Y B;  3SZP A;  3DP7 A;  1DPR A;  2KRH A;  3ESW B;  4XKC A;  5DYM A;  4BHB A;  3NAR A;  3OSF A;  5D5W B;  1BI2 A;  5JFR A;  2VJ5 A;  1T08 B;  2BV6 A;  4FHT A;  4UUT A;  1B72 B;  2XAG A;  3SEQ A;  2EZL A;  3CMM A;  5CLS A;  4DW6 A;  2ME6 A;  1MBJ A;  3QU6 A;  2ETH A;  2K3F A;  1QZY A;  4I7H A;  4LGW A;  3J81 Z;  4EGZ A;  1T8I A;  4M9S A;  3CME I;  2EV5 A;  3LQQ A;  2KIS A;  2KDZ A;  2W84 A;  3H9J A;  2H27 A;  2NS8 A;  4ZDL A;  2M30 A;  2ID6 A;  2PFB A;  4M3D A;  4D0P A;  2K5C A;  5B66 C;  2V9V A;  2IT0 A;  4Y4R A;  2HPI A;  5TRD A;  3IAM 2;  3OWT A;  1WJA A;  1WH5 A;  2DT5 A;  4QIW N;  3G73 A;  1OCC H;  3BT9 A;  3LA2 A;  4JBA A;  2WTE A;  2NVX J;  3ISP A;  2ZME C;  1X4O A;  1YIO A;  1KZH A;  1QPI A;  3RKX A;  4BDY A;  1IN7 A;  1HDP A;  5M5W J;  3R4K A;  1J59 A;  2VC1 A;  1OPC A;  5D5U B;  2DDB A;  3RKW A;  1BOA A;  4FIS A;  1ZHF A;  3Q5F A;  2JSP A;  1OCP A;  3L1P A;  1FIA A;  4KIS A;  3GTL J;  1U5T A;  2EFN A;  3I4P A;  3LNQ A;  3PIP F;  1ZQ3 P;  3HUG B;  1HCR A;  1FC3 A;  3FX3 A;  1FTZ A;  2X6W A;  1BR2 A;  1WQ2 A;  3HSR A;  4LMY A;  3LQR A;  4Q48 A;  2E1C A;  1R58 A;  1RNL A;  1XMX A;  4ENN A;  2HFH A;  5JI6 A;  2QM3 A;  2RVC A;  1BJA A;  4GO1 A;  1V5G A;  4KIF A;  1WRJ A;  1GHC A;  5KAI C;  1G3S A;  5KHD A;  1R7J A;  2FML A;  1DU6 A;  4PJM A;  4I0B A;  2L5Q A;  2O9L A;  3AL0 C;  3K4L A;  2W25 A;  1Y8R B;  5E8G A;  2UWM A;  1LNW A;  4XRF A;  3OL4 A;  2QKL B;  3A52 A;  1XPX A;  3BPV A;  3QOD A;  2EFW A;  3ABU A;  2E71 A;  4XK4 A;  2R4G A;  4KIT B;  4RMN A;  4C2M J;  4CCK A;  3OS2 A;  3K2A A;  2YPR A;  1GLN A;  4DYC A;  2CUE A;  2GXA A;  2M4G A;  4BAC A;  5KVR A;  2STW A;  2PBI A;  3HRS A;  1QRY A;  3MZ8 A;  1AU7 A;  1W5S A;  1VQK I;  2L7K A;  4UVA A;  4X6A J;  4ENK A;  5FRN A;  3BR6 A;  2QGU A;  4CCJ A;  2IJL A;  4FX0 A;  3CDH A;  3H5A A;  2IVM A;  3R6S A;  3CF5 F;  1K78 A;  3M8E A;  3FK6 A;  2NNN A;  4F93 B;  3MMY B;  3S1R J;  3MAJ A;  3ZMS A;  2KIU A;  3GVA A;  1RIO H;  4LG3 A;  2JTV A;  1U8R A;  2LLK A;  4I2O A;  2BE5 F;  3CES A;  2K40 A;  3SQN A;  4E7L A;  1HSJ A;  1E3P A;  3E1S A;  4EMS A;  3PIO F;  3H36 A;  3A2K A;  3F8F A;  2IA2 A;  3ECH A;  1NTC A;  4XOR A;  3TBI A;  1IN4 A;  3BTJ A;  4M72 A;  4UVC A;  1SD4 A;  4Y13 A;  2L0K A;  2RGV A;  5DS9 A;  1IXR C;  2K9N A;  1HKQ A;  3B02 A;  2O03 A;  2BY3 A;  4C2U A;  3DV8 A;  3NAU A;  3OSG A;  2PLY A;  5F0C A;  2E1O A;  1UHS A;  2IA0 A;  3SDB A;  1O3S A;  2Z3Y A;  1KU7 A;  2GM4 A;  3A1Y A;  2DAO A;  1IXC A;  2EV0 A;  2FOK A;  4CYD A;  4A3C J;  2P4W A;  3SJM A;  3I64 A;  1SMT A;  1F9N A;  2DFF A;  3KYD B;  5E1X A;  3SYT A;  1T95 A;  1YFH A;  2P6T A;  1IJW C;  4NHJ A;  2NVQ J;  2KRC A;  1KQ0 A;  3GME A;  4HAM A;  1BR4 A;  3WTX C;  2AXL A;  3NWT A;  2YU9 J;  5ICG A;  1PYV A;  2GIZ A;  1J2X A;  1Y8Q B;  2EFO A;  2V1D A;  5BMZ A;  3J7Y J;  3CLQ A;  4JQF A;  3OYB A;  1VF9 A;  1ETK A;  2MH9 A;  1UB9 A;  4KIG A;  1YLF A;  3M8J A;  1P92 A;  4PFO A;  1JXS A;  2L01 A;  1EKE A;  2DI3 A;  1NG6 A;  4JK1 X;  4YIF A;  4DBQ A;  3HPG A;  2HOA A;  4DYR A;  4LIT A;  1T98 A;  3I59 B;  3HKZ N;  5E3O A;  3S1Q J;  3OS1 A;  1ENH A;  4L9J A;  3HEF A;  4IHW A;  1D3Y A;  3BR0 A;  2W1O A;  5LHG A;  3HKZ A;  3WOD F;  3G1O A;  3HG9 A;  1SVO A;  4CHU A;  4IOC F;  1XDS A;  1HW1 A;  1TQI A;  1WJD A;  1MJ9 A;  2TDX A;  5DTD A;  5DM6 F;  2ME0 A;  2L7M P;  2IP2 A;  1W7P D;  3EET A;  2M1B A;  1RI7 A;  1QNT A;  4M71 A;  1K79 A;  1TWF J;  4ZYD A;  2YX4 A;  2MD5 A;  1IV8 A;  1OLT A;  3JRB A;  1OMI A;  5F08 A;  2CFO A;  4XLF A;  3LMM A;  2E36 A;  1MDM B;  2M4K A;  2MAB A;  3TQN A;  1IV6 A;  1DP3 A;  1R1T A;  1SFO J;  2XAQ A;  3ZGK A;  2NVT J;  4K2E A;  4HNT A;  5LRR A;  2A69 F;  1A04 A;  1EA3 A;  4AUX A;  2VOO A;  2XPU A;  1ZGA A;  1W1W E;  4A3M J;  3K6G A;  3M7G A;  3ZQL A;  3ULQ B;  2R7X A;  3UNG C;  5HDN A;  4BQO A;  2JJ7 A;  3VYT B;  3EUK L;  1LVA A;  1XMA A;  1UST A;  1JUM A;  1I50 J;  2F5D A;  4LJZ F;  5L3B A;  4B4C A;  4IL6 C;  4EAT A;  3LSK A;  1NK3 P;  3ZQQ A;  3HRM A;  5EEA A;  1FYK A;  2E5Z A;  2OD5 A;  2R7W A;  4KDP A;  3IRR A;  2FUG 2;  2P7V B;  3JSP A;  1RES A;  1ZYR F;  2DTZ A;  1JKQ C;  3VSL A;  1IN6 A;  5HNH A;  4HQE A;  5ICC A;  1RRJ A;  2I5U A;  3CQZ J;  3K70 D;  1L3L A;  4B44 A;  5HS7 A;  3LSM A;  4RAZ A;  3SDG A;  3LSJ A;  5D6E A;  2E1M C;  1UHM A;  3GTJ J;  2V1N A;  4E4H A;  1PVE A;  1E3O C;  2Y31 A;  5CKT A;  3VOD A;  2VQH A;  1YJ9 I;  3FIW A;  3OV8 A;  4W1U A;  5EF6 A;  1Z0X A;  4GGG A;  5LD2 C;  4V2F A;  1KQ8 A;  2HQ5 A;  1I3Q J;  2LMD A;  2W82 A;  2XDV A;  1OR7 C;  3L9F A;  3CLO A;  2HTJ A;  2XPW A;  4RB3 C;  4LB5 A;  1LEA A;  2VOP A;  5FLX R;  3K4K A;  4C3H J;  1FTT A;  2LBF A;  3LST A;  3D0S A;  2D5V A;  2LY2 A;  3FXQ A;  2MFZ A;  2F5E A;  2WAF A;  1JT6 A;  4WXD A;  2QKM B;  3KX2 A;  3M4O J;  2EFQ A;  3WGH A;  4A5M A;  3RKQ A;  2STT A;  4M74 A;  2LH9 A;  3FM3 A;  1F43 A;  3G3Z A;  2BY2 A;  2VJ4 A;  4CDG A;  1X2M A;  4KJZ A;  5J4Y A;  2Z99 A;  4MLO A;  1QBJ A;  1ZR2 A;  1G4D A;  2R7V A;  2X0L A;  1MH3 A;  1P2F A;  5E1W A;  3OS0 A;  1W5T A;  5A2Q Z;  2IGN A;  3HGY A;  4B8X A;  1K6Y A;  4RM2 A;  4BQA A;  2DXI A;  4N4N B;  2X6O A;  4XN0 A;  3U9G A;  4CZC A;  2X1C A;  3QWL A;  5JHF A;  2KJC A;  1LFB A;  4LK0 F;  1S6L A;  4GXO A;  1PUF B;  2QQ9 A;  2NVU B;  5J40 A;  3OYL A;  1FSH A;  3BG9 A;  1HLV A;  3C2B A;  1XCB A;  3LSH A;  4HEA 2;  3K70 C;  4MFE A;  4L9T A;  3T0Y A;  4GFB A;  2A68 F;  1XGM A;  1DUX C;  1IC8 A;  1HA8 A;  2UZK A;  4O5V A;  3TDU C;  1WHU A;  2LFB A;  3RIR A;  1JKP C;  1KGS A;  1Y0U A;  3WU2 C;  4A6E A;  4U7D A;  1D8J A;  1T0F C;  3Q0W A;  2DOF A;  3I9V 2;  3IH4 A;  5GAG J;  2LY1 A;  1K83 J;  4XIC A;  1P4X A;  1UG0 A;  4YG2 F;  2IPQ X;  1P7J A;  1R4N B;  1E0E A;  3A4C A;  1KYZ A;  3WGI A;  3CO6 C;  2CFX A;  1Y39 A;  1XDU A;  1QZE A;  5M5X J;  5DD4 A;  3WHC A;  5EEG A;  2ECB A;  2EZK A;  2OF7 A;  4HST A;  2EA4 A;  1A6I A;  2OTL I;  2DMQ A;  3I59 A;  4F55 A;  2V79 A;  3BP8 A;  4FE7 A;  1RZ4 A;  2GAU A;  1O3Q A;  1JJ6 C;  4JX5 A;  4I98 B; 
#chains in the Genus database with same CATH homology
 1BIB A;  2BGC A;  4ZYE A;  4E70 A;  2QLZ A;  3F8C A;  1MJB A;  4XLN F;  2MC3 A;  1OR7 A;  5DD8 A;  3K69 A;  4IRH A;  4I09 A;  1LDD A;  5FGM A;  5CVI A;  1ZAR A;  2EK5 A;  1FBS A;  4F7Z A;  5A2Q K;  1Z6T A;  3MFK A;  3TOA A;  1DP7 P;  2YU3 A;  2K02 A;  3BOQ A;  4GYG A;  5HS9 A;  3ZMZ A;  2R7F A;  4BH9 A;  4KMF A;  5LHI A;  1J7K A;  2HKX A;  1PP8 F;  4ETS A;  2FE3 A;  3J80 Z;  2HEO A;  3KP7 A;  1BI1 A;  2VXZ A;  3FWE A;  4MTE A;  1IN8 A;  1T2K A;  2FNA A;  3WTU C;  2KJB A;  1OKR A;  2A5Y B;  3F22 A;  3VEP A;  4IRI A;  3M1E A;  1T0F A;  2LKP A;  3QU3 A;  1STZ A;  2ACJ A;  4M9Z A;  3N4M A;  2FEZ A;  4HQM A;  5LGT A;  2DBB A;  1O3T A;  3VB2 A;  2WWY A;  3SXY A;  1ZRD A;  3GZ6 A;  3DFG A;  3H3Z A;  1ZG3 A;  1E2X A;  3DF8 A;  1IAW A;  1H9G A;  5DCM A;  3OOP A;  2OA4 A;  3TO9 A;  3EDP A;  1Z6R A;  2DQL A;  2IA1 A;  3F6O A;  1TBX A;  5DDG A;  3FZV A;  2IRF G;  3VFZ A;  3GW2 A;  2WC2 A;  1YS7 A;  1SMY F;  4RB2 C;  1LDJ A;  3WU0 A;  2M8E A;  4UVB A;  4B09 A;  1G3T A;  1S3J A;  4U88 A;  4CGZ A;  4RGX A;  2ISZ A;  1QQI A;  3LFK A;  1LDK B;  3LA7 A;  4WXH A;  4A2U A;  3E97 A;  5EEH A;  2VBW A;  2GA1 A;  1K78 B;  3MWM A;  3IC7 A;  2MBF A;  1FWZ A;  1IRG A;  1TNS A;  3WE2 A;  3LA3 A;  1WKM A;  4HDU A;  3JAM K;  1Z7U A;  2CG4 A;  1E17 A;  5F64 A;  4OIQ F;  1G6N A;  2JZY A;  1GXP A;  3IRQ A;  3M8F A;  2VOD A;  3F6V A;  5DV5 A;  1FOK A;  3L09 A;  2JT1 A;  3TDZ C;  4HF0 A;  2G7U A;  1PDN C;  1MD0 A;  3NEU A;  3WTT C;  2GWR A;  4L9N A;  5DEQ A;  3KP3 A;  4HF1 A;  4UXN A;  4L9V A;  1BI3 A;  4Q4Z F;  4S05 A;  1HKS A;  4EJT A;  1ZAO A;  3P9C A;  1KQ9 A;  5D4R A;  3SHF A;  1L0O C;  2RC4 A;  3TGN A;  1IW7 F;  4BXU A;  3RI4 A;  4HDV A;  2OZU A;  2VT3 A;  2DLL A;  1FPQ A;  3CUQ C;  1XSD A;  2PN6 A;  4KIB A;  4IF4 A;  5L3F A;  1XB4 A;  3K1M A;  3QP6 A;  3HTU A;  1QPM A;  1XSX A;  3IHU A;  1S8N A;  5D8L B;  2F5F A;  2VE8 A;  2M87 A;  5ILV A;  2JPB A;  1JGS A;  3H92 A;  1SFU A;  2XV4 S;  3BJ6 A;  1F1Z A;  3QRF F;  2CWE A;  1B1B A;  1I1G A;  1F4K A;  2KRF A;  5IT3 A;  4G7O F;  2YSR A;  4HYE A;  1XGS A;  5LGN A;  3U1D A;  1XD7 A;  3L2C A;  1O3R A;  3R61 A;  2RNJ A;  4AIK A;  4P55 A;  1J9I A;  2D1H A;  4EJU A;  2LNB A;  2GA2 A;  2XUB A;  4BNC A;  4HBL A;  5E1Z B;  1I5Z A;  2EWN A;  2H94 A;  4N9H A;  3P9K A;  2DO7 A;  3V8J A;  1O57 A;  3O3K A;  2Z33 A;  2Z9O A;  3J81 K;  3ROU A;  1TW2 A;  2VBZ A;  4GCV A;  4IHS A;  2O0Y A;  4RS8 A;  3ABT A;  4EM0 B;  3JTG A;  5HS8 A;  2K4B A;  4GYI A;  2JSC A;  1ZRE A;  4I01 A;  1Z9C A;  2QBY A;  3C7J A;  1D8K A;  5KK1 A;  3F3X A;  1YTY A;  4MEX F;  1Q1H A;  2GXB A;  3W6J B;  2XAF A;  3ZMV A;  3IL2 A;  1K7A A;  2B0L A;  2OBP A;  1FLI A;  1USS A;  1FZP B;  3BDD A;  2ZME A;  4PCQ A;  2R7D A;  4PGH A;  4OIO F;  4ZZL A;  4XLP F;  1OYY A;  5ERI A;  1UCR A;  2PEX A;  4HZF A;  2A6H F;  2L3D A;  2QEN A;  2Z5U A;  2FA5 A;  2XGX A;  2E7X A;  2LF7 A;  4OOI A;  2HGC A;  1EV7 A;  1R1V A;  2A3S A;  4RGU A;  3V8K A;  3ECO A;  5HDG A;  1WI9 A;  3T1B A;  4Y15 A;  1HW2 A;  5E18 F;  2HYF A;  4H0E A;  4ESJ A;  4PZJ A;  4ZYG A;  3RPQ A;  1I6X A;  3H3U A;  4QWQ A;  2QUF A;  4NQW A;  5FFX A;  1SAX A;  5AIP A;  2XAS A;  3KCC A;  4O6J A;  4LLL A;  4DQ2 A;  5HOO A;  1LJ9 A;  3DXJ F;  4N0B A;  2D1V A;  2L54 A;  1XCV A;  5HLI A;  1LQ1 A;  2OQR A;  1H0M A;  3CTA A;  3HOS A;  2ZJ2 A;  2DK8 A;  1FSE A;  4KT5 C;  6PAX A;  4UNO A;  4LK1 F;  4IVN A;  3WTS C;  2VC0 A;  1JHH A;  3CUO A;  2Y75 A;  2HDC A;  4EJW A;  3E6D A;  2UXX A;  1LEB A;  4OMZ A;  2XKP A;  4WK8 F;  2HYG D;  1FY7 A;  1YW9 A;  2BYV E;  2X4H A;  4ASN A;  2PG4 A;  2P6S A;  1SFE A;  3F23 A;  1O7L A;  3KET A;  3P9I A;  1MGT A;  2ESH A;  4UV9 A;  5BOX A;  1KU3 A;  3GXO A;  2V6C A;  4G94 A;  1IRF A;  2VBX A;  2UXN A;  3BJA A;  4DNC A;  4R8H A;  3I58 A;  5DCM B;  1BC8 C;  4MEY F;  4ENM A;  4HX8 A;  2DU9 A;  1H9T A;  3RJP A;  1S7A A;  2ZFW A;  3QAH A;  2OZ6 A;  1ZLK A;  3NQO A;  4N9I A;  4G7Z F;  5D4S A;  3FMQ A;  3M9A A;  5J6X A;  4U7B A;  1SD6 A;  3CJN A;  2YX7 A;  1FX7 A;  2QYO A;  3IWZ A;  3FM5 A;  3AAF A;  1ZG1 A;  3R0J A;  5CJ9 A;  3HHG A;  4MTD A;  3D5L A;  1R22 A;  1ODD A;  3L00 A;  4QLC U;  4LFU A;  1DDN A;  2P8T A;  1F5T A;  5LRS A;  3FMS A;  3GZ5 A;  3KLN A;  1R5H A;  4U0Y A;  4LG0 A;  2XRO A;  3REO A;  2K7L A;  1W7P A;  4Y17 A;  3HIF A;  4L18 B;  4CZZ A;  3BWG A;  2J5P A;  1FNN A;  4BHP A;  1Z1D A;  3DPT A;  1W4M A;  3MZH A;  5E17 F;  2WV0 A;  1J0R A;  1REP C;  2J5O A;  3IKV A;  4EV0 A;  2W57 A;  4BHC A;  3FHZ A;  2XVC A;  4ZYH A;  5IT9 Z;  4YFN F;  1YQA A;  2QWW A;  4I02 A;  2BEO A;  4TV7 A;  3WGG A;  2O6G E;  5LLQ A;  1FT9 A;  4CO8 A;  3BY6 A;  5K5O A;  1O7F A;  3O6B B;  1U3E M;  2FXA A;  1XSV A;  3V4G A;  2D2W A;  2E1N A;  3KP5 A;  3ML6 A;  2QQB A;  2YR2 A;  3BRO A;  2PMH A;  1B9N A;  5HDK A;  1U6G A;  5JVT A;  5L3E A;  4P96 A;  4P9U A;  1SD5 A;  2ZBK A;  3QOP A;  1G3Y A;  4HV5 A;  5TJJ A;  4UV8 A;  3K2Z A;  4OU0 A;  2RKH A;  5CVU A;  3EUH A;  3RYP A;  5IT9 K;  1XGO A;  3TOB A;  3BPX A;  1OYI A;  3RDI A;  3I54 A;  2HKO A;  4HW0 A;  3GFL A;  4R79 A;  2HQN A;  2ESN A;  3J80 K;  2Q2E A;  5H20 A;  1HST A;  3E5U A;  1J5Y A;  3TO6 A;  3ZN0 A;  3EQL F;  3CO7 C;  1RUN A;  4MHG A;  3CUQ B;  3FXR A;  2O3F A;  2Y0M A;  5HVQ C;  4KIC A;  3HRT A;  4AWX B;  5LEJ A;  1IUY A;  2QBY B;  5F6F A;  4HX4 A;  4M73 A;  2H6C A;  1FBU A;  1R00 A;  2ELH A;  3C1D A;  5D5V B;  2W85 A;  1FBQ A;  5J8C A;  2NS0 A;  3KP2 A;  1YS6 A;  5ICF A;  2ZME B;  1ZRF A;  1G3W A;  4NB5 A;  2HOE A;  2CO5 A;  5AON A;  3ZP5 A;  3DPL C;  4KN7 X;  1BBY A;  3T5X A;  1XMK A;  1TTY A;  2Y48 A;  3T8R A;  5K5R A;  1S29 A;  1ZN2 A;  2KIM A;  2C6Y A;  1XN7 A;  3KP6 A;  3KP4 A;  3F21 A;  1SFX A;  1U5T C;  1CF7 A;  3ZMT A;  4EM1 A;  3C3W A;  3GFJ A;  2A07 F;  1YYV A;  3RKY A;  5FD6 A;  4OIR F;  2F2E A;  2V1X A;  4LLG F;  1TQM A;  2RQP A;  2RDP A;  5BS6 A;  3KLO A;  3P7N A;  3I5U A;  2PI0 A;  2PMU A;  2E7W A;  1FYL A;  1XGN A;  2HS5 A;  2QQA A;  3C18 A;  2O61 A;  3QP5 A;  1TLH B;  1UHW A;  2RV8 A;  1C0W A;  4ESB A;  2FQ3 A;  3LAJ A;  2ZO4 A;  1IXS B;  5J8F A;  2H09 A;  5JR3 A;  1KA8 A;  3KZZ A;  5ED4 A;  3V7S A;  5FFZ A;  5L3G A;  4Z2Y A;  1B4A A;  1QGP A;  3B73 A;  3V7R A;  4BYY A;  4I0A A;  4MQV A;  3R60 A;  2NYX A;  2P5V A;  5DUK A;  3ERE D;  1ZRC A;  1FYM A;  1T6S A;  3ELK A;  4EJO A;  2OQG A;  3K9T A;  5E20 A;  5FD5 A;  1YW7 A;  1ONV A;  2R3S A;  2LSO A;  2NRA C;  4IPA A;  1ON1 A;  2K27 A;  4CIC A;  3MCZ A;  5D6F A;  2GXG A;  3VOE A;  1RUO A;  2M5W A;  1ZH5 A;  2HR3 A;  4FX4 A;  1D5V A;  1J75 A;  1EH8 A;  3U2R A;  3PQJ A;  4L0Z B;  3DEU A;  3LAP A;  3HSF A;  1V3F A;  3K0L A;  1T38 A;  1CGP A;  3CUQ A;  2IW5 A;  4OIN F;  3SFZ A;  3HOT A;  4LB6 B;  4YFK F;  4O3M A;  4MQ9 F;  1R36 A;  4KA4 A;  2XKO A;  3I71 A;  4ZH4 F;  1S7O A;  4MNU A;  4RAY A;  1AOY A;  2VBY A;  4KN4 X;  2ZNZ A;  2VT2 A;  3KFW X;  2AS5 F;  3SZT A;  1ZG5 A;  1U2W A;  3ZQ7 A;  3NRV A;  1OYW A;  4U0V A;  2KIF A;  4AIH A;  5LBQ A;  3WTY C;  4FT8 A;  1QZZ A;  4PGG A;  3E5X A;  4WWC A;  2EFP A;  5LHH A;  5CYV A;  3GYH X;  4XSX F;  4EGY A;  1V4R A;  5CVV A;  1KU2 A;  5L3C A;  3MZY A;  5F1R A;  1IZ1 A;  2FMY A;  2HWV A;  4LG0 B;  3HSE A;  2CGP A;  1W7P B;  4Q47 A;  2FU4 A;  3R0A A;  4A0X A;  1BIA A;  3DQV C;  2XHK A;  2L02 A;  2V1U A;  2CW0 F;  2VON A;  1Z91 A;  2COM A;  4A12 A;  2DQR A;  3V7C A;  2MH2 A;  4KFC A;  1I27 A;  3N97 A;  4M9X A;  2LF8 A;  4EQQ A;  4G6D A;  2XAH A;  1YG2 A;  2CYY A;  2DFI A;  3RTR A;  1JE8 A;  1ZGJ A;  2ZKZ A;  2EV6 A;  1KYW A;  3EYY A;  1TW3 A;  2EA2 A;  3E5Q A;  3DKW A;  3ZMD A;  3E3V A;  2XRN A;  5FO5 A;  2L4A A;  2L4M A;  5DCF A;  5BPI A;  4A5N A;  2FF4 A;  3F8N A;  3I53 A;  4AVP A;  4RB1 A;  3E6M A;  3FMR A;  4YFX F;  1VTN C;  3T8T A;  4L5I A;  2PQ8 A;  1YO5 C;  3RYR A;  3HUG A;  1DPU A;  3QPT A;  1YW8 A;  3WTW C;  3E6C C;  3TO7 A;  4OIP F;  3FF5 A;  2K86 A;  4LLN A;  2JPC A;  3KEQ A;  1GVJ A;  3KEO A;  4WXC A;  1TQP A;  1IN5 A;  4M6X A;  2EB7 A;  1TNT A;  1UFM A;  3WTV C;  5ICE A;  3S2W A;  2DPU A;  1X3U A;  4ESF A;  3MEX A;  1HKT A;  4HLY A;  2ZNY A;  3ZN1 A;  2OU2 A;  1MJA A;  3GEZ A;  2MLK A;  3ZMU A;  2W24 A;  3O2P E;  2QVO A;  2CSO A;  3GO5 A;  4XSZ F;  5HLG A;  3Q9V A;  4S04 A;  3ZPL A;  3JSO A;  1NHA A;  5K5Q A;  3HRU A;  3JTH A;  4G6Q A;  3COA C;  4AIJ A;  3HYI A;  5CVR A;  3EYI A;  1R23 A;  2DTR A;  3Q9S A;  3KE2 A;  5BQT A;  1EH6 A;  1HW5 A;  3GLX A;  1GXQ A;  4UUV A;  3L7W A;  2FBH A;  2RN7 A;  2A6E F;  2FNP A;  2NAZ A;  3E6B A;  4G8X A;  4ENJ A;  4Q5S F;  1P4W A;  3V8L A;  4HOB A;  2FRH A;  1B9M A;  1CF7 B;  4RGR A;  4CXF A;  3KZY A;  5K1Y A;  2F5C A;  1MKM A;  5LGU A;  4XBF A;  2ZCW A;  2GZW A;  3I0T A;  3WG9 A;  5LEK A;  1B59 A;  2H6B A;  3BJO A;  3LWF A;  1I1S A;  1K6O A;  1HXD A;  2KKO A;  1P4A A;  2XIG A;  1MZB A;  2LDU A;  3GX4 X;  1MDM A;  4L0Y B;  1SD7 A;  4YII A;  3IKT A;  4WX9 A;  4EM2 A;  2FBI A;  1PUE E;  1BI0 A;  4HA8 A;  4G7H F;  2HQR A;  2Q0O A;  4LD5 A;  1BN5 A;  3K1P A;  5FLX Z;  2QZ8 A;  3GFM A;  3F8B A;  3K1N A;  3JW4 A;  2GIV A;  5HLH A;  3F8M A;  4HF2 A;  4IHT A;  4KUM A;  2JRT A;  2MA3 A;  2P5L C;  5JHU A;  4ZZD A;  1ZLJ A;  3TKY A;  3HTS B;  3WE3 A;  4A0Z A;  3FXU A;  3J7A O;  2P7C B;  2D45 A;  3RPU A;  5ILS A;  5H6R A;  4IRG A;  4RB0 A;  1ULY A;  1U78 A;  2CQK A;  4IXA A;  3MQ0 A;  3GWZ A;  1IF1 A;  1U5T B;  5E8I A;  3JAM Z;  4P9F A;  4L5J A;  5CVJ A;  1QO0 D;  3IWF A;  4RGS A;  3W6K B;  1FP1 D;  2P5K A;  2GQQ A;  2FBK A;  2DW4 A;  3WTZ A;  2HZT A;  1AWC A;  2ISY A;  4KYW A;  4A0Y A;  2A61 A;  2OAZ A;  2DPD A;  2G9W A;  4WF2 A;  4OMY A;  4KNY A;  2FSW A;  4G9Y A;  4MGR A;  1T39 A;  2Q8K A;  1LB2 A;  5DUI A;  5FLX K;  1WWX A;  5D8K B;  4AD9 A;  3WU1 B;  1KU9 A;  3GF2 A;  2G7H A;  1BM9 A;  2VE9 A;  4U0W A;  2XAJ A;  1B6A A;  2HTS A;  1R5G A;  2M45 A;  5D5X B;  1HQC A;  4HX7 A;  4M6Y A;  3GUD A;  2DK5 A;  2BBY A;  1BC7 C;  4A6D A;  4EVI A;  2K4J A;  5AIQ A;  1R1U A;  1JHF A;  4P5O A;  4WCG A;  2PJP A;  5FB2 A;  3BZ6 A;  1PP7 U;  2VN2 A;  2MLG A;  5H6Q A;  1FP2 A;  4KMU X;  1EH7 A;  3PQK A;  2EJR A;  3GFI A;  1WSU A;  2ADU A;  3HHH A;  4ON0 A;  5L3D A;  3PFI A;  1ON2 A;  4EJV A;  2ZXJ A;  3F72 A;  4R1H A;  5ILU A;  1Z05 A;  4PDK A;  4IJA A;  5BPD A;  2O8X A;  3QPH A;  1HBX G;  4HV6 A;  4HLX A;  4BAY A;  2NNY A;  1P6R A;  4UHT A;  3SZP A;  3DP7 A;  1DPR A;  5DYM A;  4BHB A;  5D5W B;  1BI2 A;  5JFR A;  2BV6 A;  4FHT A;  2XAG A;  5CLS A;  3QU6 A;  2ETH A;  1QZY A;  4I7H A;  4LGW A;  3J81 Z;  4EGZ A;  4M9S A;  2EV5 A;  3LQQ A;  2W84 A;  2H27 A;  2M30 A;  2PFB A;  4D0P A;  2V9V A;  2IT0 A;  5TRD A;  2DT5 A;  3G73 A;  3LA2 A;  4JBA A;  2WTE A;  3ISP A;  1YIO A;  3RKX A;  1IN7 A;  3R4K A;  1J59 A;  2VC1 A;  1OPC A;  5D5U B;  3RKW A;  1BOA A;  1ZHF A;  3Q5F A;  1U5T A;  2EFN A;  3I4P A;  1FC3 A;  3FX3 A;  4LMY A;  1WQ2 A;  3HSR A;  4Q48 A;  3LQR A;  2E1C A;  1R58 A;  1RNL A;  4ENN A;  2HFH A;  5JI6 A;  2QM3 A;  2RVC A;  1BJA A;  4GO1 A;  4KIF A;  1WRJ A;  1GHC A;  1G3S A;  1R7J A;  2FML A;  4I0B A;  2W25 A;  5E8G A;  2UWM A;  1LNW A;  4XRF A;  3BPV A;  2EFW A;  3ABU A;  2YPR A;  5KVR A;  2STW A;  2PBI A;  3HRS A;  1W5S A;  4UVA A;  4ENK A;  2IJL A;  4FX0 A;  3CDH A;  3R6S A;  2IVM A;  1K78 A;  3M8E A;  2NNN A;  3MAJ A;  3ZMS A;  2KIU A;  3GVA A;  1RIO H;  2JTV A;  1U8R A;  4I2O A;  2BE5 F;  3SQN A;  1HSJ A;  4EMS A;  3F8F A;  2IA2 A;  3ECH A;  1IN4 A;  4M72 A;  4UVC A;  1SD4 A;  4Y13 A;  2RGV A;  1IXR C;  1HKQ A;  3B02 A;  2O03 A;  3DV8 A;  2PLY A;  2IA0 A;  1O3S A;  1KU7 A;  2Z3Y A;  2DAO A;  1IXC A;  2EV0 A;  2FOK A;  4CYD A;  2P4W A;  3I64 A;  1SMT A;  1F9N A;  4NHJ A;  5E1X A;  1YFH A;  2P6T A;  1KQ0 A;  4HAM A;  3WTX C;  2AXL A;  5ICG A;  1J2X A;  2EFO A;  2V1D A;  5BMZ A;  4JQF A;  2MH9 A;  4KIG A;  1UB9 A;  1YLF A;  1P92 A;  1JXS A;  2L01 A;  2DI3 A;  4JK1 X;  4YIF A;  1T98 A;  3I59 B;  4L9J A;  1D3Y A;  5LHG A;  3WOD F;  4CHU A;  1XDS A;  1HW1 A;  1TQI A;  2TDX A;  1MJ9 A;  2IP2 A;  1W7P D;  3EET A;  2M1B A;  1RI7 A;  1QNT A;  4M71 A;  1K79 A;  4ZYD A;  2YX4 A;  2MD5 A;  1OMI A;  1MDM B;  3TQN A;  1R1T A;  2XAQ A;  4K2E A;  5LRR A;  2A69 F;  1A04 A;  2VOO A;  1ZGA A;  3M7G A;  3ULQ B;  5HDN A;  1LVA A;  1XMA A;  1UST A;  2F5D A;  4LJZ F;  5L3B A;  3HRM A;  1FYK A;  2OD5 A;  4KDP A;  3IRR A;  2P7V B;  3JSP A;  1ZYR F;  1IN6 A;  4HQE A;  5ICC A;  1L3L A;  5HS7 A;  4RAZ A;  5D6E A;  1UHM A;  3VOD A;  3OV8 A;  4GGG A;  1KQ8 A;  3L9F A;  3CLO A;  2HTJ A;  4RB3 C;  4LB5 A;  1LEA A;  2VOP A;  3LST A;  3D0S A;  3FXQ A;  2F5E A;  4WXD A;  2EFQ A;  3WGH A;  4A5M A;  2STT A;  4M74 A;  3FM3 A;  3G3Z A;  4CDG A;  2Z99 A;  1QBJ A;  1G4D A;  2X0L A;  1P2F A;  5E1W A;  1W5T A;  5A2Q Z;  4B8X A;  4BQA A;  3U9G A;  2KJC A;  4LK0 F;  1S6L A;  4GXO A;  2QQ9 A;  1FSH A;  1XCB A;  4L9T A;  3T0Y A;  2A68 F;  1XGM A;  1DUX C;  2UZK A;  4O5V A;  3TDU C;  3RIR A;  1KGS A;  1Y0U A;  4A6E A;  4U7D A;  1D8J A;  1P4X A;  4YG2 F;  2IPQ X;  1KYZ A;  3WGI A;  3CO6 C;  2CFX A;  1XDU A;  5DD4 A;  5EEG A;  2EA4 A;  3I59 A;  2V79 A;  3BP8 A;  1RZ4 A;  2GAU A;  1O3Q A;  4I98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...