4HV6A

Structure of mntr h77a mutant in apo- and mn-bound forms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
133
structure length
133
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRAELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
total genus 49
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv6A02
1ZGAA 2Y75A 3WTVC 2WWYA 5L3BA 1KQ8A 1Z91A 1R00A 4EJTA 3E6CC 5JR3A 1FX7A 5E8IA 4MQ9F 3IRRA 2PMUA 4MTDA 4HQEA 1OYYA 1PDNC 4G94A 1DDNA 4UNOA 4ZYDA 5IT3A 3T8TA 2HKXA 4YFKF 4XSZF 3MEXA 2PLYA 2CYYA 4Q4ZF 3MCZA 1O3TA 2EV6A 4L18B 2VT3A 3RYPA 3IWFA 1BIBA 1Z1DA 4ASNA 3QRFF 3LQQA 2ZMEA 1I1SA 4U7BA 5DD4A 3IHUA 3WGGA 1U3EM 3WTTC 3IWZA 3HHHA 2MBFA 3M8EA 4HF2A 2KIUA 3P9KA 3U9GA 2HGCA 3T0YA 5L3CA 1T98A 2F5FA 3BOQA 5BS6A 2H6CA 2FF4A 1B4AA 3BJAA 2ZKZA 3TDZC 1Z7UA 2H27A 4UV9A 4M9ZA 4M72A 2UXXA 2Z5UA 1RI7A 2AXLA 3BY6A 3JW4A 2ZBKA 3L2CA 5FFXA 5A2QZ 4EQQA 5ILVA 5L3DA 2A6HF 2RDPA 1FNNA 1J59A 4MEYF 3M8FA 1BI1A 1MD0A 2OA4A 1KQ0A 4K2EA 3P7NA 4M74A 1T6SA 3S2WA 4GYGA 4GXOA 3HTSB 3GWZA 3TO6A 2DTRA 3M9AA 5FFZA 2STTA 3BDDA 3H92A 4HV6A 2ISYA 1AOYA 1SD7A 4S04A 4EV0A 1NHAA 1QZZA 4I7HA 2NNNA 5IT9K 4OINF 3T1BA 4EGZA 4KFCA 4KIBA 2P4WA 4RS8A 4Q47A 4HAMA 5BPDA 3MFKA 5F64A 3EYIA 4HQMA 1FC3A 1K78A 1WI9A 2M5WA 3GX4X 1D8JA 3ZMZA 5FD6A 3IKTA 3BP8A 3F3XA 5ICGA 3VEPA 1ZGJA 2A68F 3SFZA 2R3SA 1G4DA 4IVNA 3JAMK 5LHGA 2D45A 2P6SA 4P5OA 3M7GA 4ETSA 2BGCA 4QWQA 5HDNA 5DDGA 4OIQF 2JSCA 1T38A 4HF0A 3PFIA 1XDUA 3LA7A 4IF4A 1KYZA 4MGRA 1S29A 5KK1A 2F2EA 2XKOA 1IAWA 2O03A 2COMA 2VOOA 1LNWA 2RV8A 1XGSA 3FMSA 4A2UA 5H20A 4CHUA 4G9YA 2CFXA 4N9IA 1XSVA 4IRHA 1ON2A 4L5IA 1TQPA 2IVMA 5ICEA 4G6QA 1P4WA 2IPQX 4KICA 1J75A 3WE2A 4QLCU 3IKVA 3LQRA 3WU1B 2DW4A 5IT9Z 1R58A 1J9IA 2XUBA 4HYEA 1HSTA 1KQ9A 2M1BA 5LHHA 2ZMEB 1TTYA 2OD5A 2LF7A 4D0PA 1CF7B 2ZNZA 1BN5A 4Y17A 3TKYA 5ICFA 2Q2EA 2L54A 3KETA 2K27A 5CVJA 5JI6A 1XN7A 1B1BA 3RPQA 2NNYA 4G7HF 1S6LA 4I2OA 1ONVA 3EQLF 5DV5A 3HHGA 1ON1A 3GF2A 4CZZA 4HA8A 4ON0A 3ABUA 4P55A 2VBWA 1IN8A 2XAHA 1FWZA 2RQPA 1LDDA 2EV0A 3O6BB 2ISZA 1SD6A 3GFJA 4EJVA 2XV4S 1ZG3A 3K1MA 1L0OC 2VT2A 4A5MA 5L3GA 4RB0A 1P6RA 3FXRA 1RUNA 1U78A 4DQ2A 1JXSA 4A6EA 3CJNA 3I4PA 1IXSB 4LG0B 4LGWA 4LK1F 4PGGA 4HDUA 2B0LA 3COAC 4L0ZB 1LEAA 4KDPA 2O3FA 3HOSA 5K5OA 4A6DA 2KIMA 4PDKA 3WTWC 3KP4A 2DQRA 4ZYEA 5F6FA 1EH6A 2ESHA 2Z33A 1BI3A 4R79A 2P5LC 2D2WA 1T2KA 5LGNA 4HZFA 3E5QA 3LSTA 3GFLA 2ZXJA 2V9VA 3J81Z 4LD5A 4NQWA 4U7DA 2R7DA 2KKOA 3PQKA 1K7AA 2IA1A 1F4KA 3V8JA 3U2RA 5HVQC 3FM5A 1LB2A 1SMTA 3HRMA 4OMYA 1MKMA 3VFZA 3GUDA 1TLHB 1CGPA 3AAFA 2GQQA 3FMRA 3P9IA 2RN7A 4WXHA 1XSXA 2MLGA 3QPTA 2HWVA 3K1PA 3E5XA 1MJAA 5DD8A 3V8KA 2YSRA 2PFBA 5E1XA 1WWXA 1LDKB 3I53A 2HQRA 3CLOA 3GFMA 3L00A 1IRGA 2GA2A 2XAFA 5LEKA 1TW3A 5BMZA 4AWXB 2L4MA 2H6BA 4ENKA 3IRQA 2XAGA 3KP3A 4WWCA 5L3EA 2YX4A 2ZO4A 1B6AA 5CVIA 3KLNA 3ABTA 3JSOA 1R1UA 5DUKA 4ENJA 1H0MA 5FGMA 2JPBA 2V1DA 2G7HA 4AIJA 3KP2A 1QZYA 3C7JA 2BE5F 4L5JA 3ECHA 5LGTA 2ELHA 1HW5A 5DUIA 3C1DA 5DEQA 4EVIA 4RB2C 4BNCA 1JHFA 2E7WA 1BC7C 3L09A 2K02A 5D4RA 1RZ4A 5TJJA 3HRUA 2MLKA 2IRFG 2OQRA 2OZUA 5J6XA 4BAYA 3SXYA 5D8KB 3HSFA 1KU7A 1PP8F 2M8EA 3B02A 3WTYC 3BROA 4YIFA 2HYFA 3E97A 4ZH4F 2HTSA 3ZMUA 1BM9A 4IPAA 2XASA 5D4SA 1K78B 4L9JA 4OIRF 1HXDA 4BXUA 2HR3A 1U5TC 1YG2A 2HTJA 2RVCA 2HZTA 1U8RA 3ZMTA 3E6DA 4M6XA 4UUVA 3KEOA 2F5EA 2VONA 1XGNA 1IN4A 4I09A 1I1GA 3G3ZA 2A3SA 2QM3A 5ILSA 4HW0A 1T39A 3HIFA 1DPUA 2BV6A 1XDSA 1FPQA 4OIPF 1ZG1A 2EWNA 2FRHA 2RKHA 5LRRA 3ZN1A 3OV8A 1IXRC 4TV7A 2BEOA 2OU2A 5D5XB 2Z3YA 1HW1A 3IC7A 5HDKA 1IN6A 1EH7A 3QPHA 2FNAA 3CDHA 1WQ2A 3QAHA 1ZRFA 3SHFA 4HLYA 1H9GA 2V1XA 4A0YA 2Z9OA 5LEJA 2IA2A 3LAJA 1W5SA 1ZARA 2GZWA 4RAZA 1DUXC 3ZMSA 2V79A 5JHUA 1O7LA 3IL2A 2AS5F 1R36A 5HDGA 2GWRA 3I59A 3JTHA 5D5VB 4PGHA 4WXCA 3LWFA 1KU3A 4HBLA 1GXPA 2FEZA 2FXAA 1XB4A 4L0YB 3LFKA 3GLXA 4M9SA 1YTYA 4U0YA 3CUQB 3RYRA 2ADUA 3LA3A 3H3ZA 4GO1A 3O3KA 1QGPA 5KVRA 1FZPB 2QBYB 4FHTA 2QUFA 2QENA 3NEUA 3F21A 3J81K 5H6QA 1C0WA 1QPMA 2W24A 1MGTA 4HOBA 1YO5C 4I0BA 1BBYA 5ILUA 4UHTA 3DFGA 2KJCA 1A04A 3BWGA 2FE3A 1USTA 4JBAA 2EK5A 2P7VB 1ZLKA 3WTUC 1HQCA 2ZCWA 4GGGA 1FT9A 1ZRCA 1OYWA 5DCMA 1IXCA 1FYKA 5HS8A 4DNCA 3FX3A 1OYIA 2VC0A 2QZ8A 3DQVC 1UHMA 3WU0A 1E17A 2TDXA 2PN6A 2O6GE 2A69F 5LLQA 2VBYA 1BC8C 1KU2A 3GEZA 2PEXA 2FMLA 1IN5A 1EV7A 1IRFA 3N97A 5HLIA 4NHJA 1XCVA 4F7ZA 4JK1X 3T8RA 2G7UA 3MZHA 4A0ZA 4I0AA 5TRDA 2V6CA 2DLLA 5ERIA 2Z99A 1XD7A 1UCRA 3F8CA 5D5UB 4I02A 3TQNA 2CGPA 5FLXZ 2PBIA 3FXUA 2BYVE 3R0AA 3KZZA 2A5YB 5E1WA 1MDMA 3KP6A 1BJAA 3ML6A 4RGUA 2OAZA 1YQAA 3R0JA 3I0TA 3RIRA 3TO7A 3MZYA 1SAXA 4I01A 2OZ6A 3P9CA 2JPCA 1J5YA 2D1HA 2Y0MA 2YPRA 2IT0A 2FU4A 5D5WB 2MD5A 2WC2A 3ECOA 3R4KA 2M87A 4ENNA 1R22A 2J5OA 3GW2A 5ED4A 4XLPF 2FNPA 1SFEA 2M30A 3F6VA 4BHBA 3L9FA 2PG4A 1TNSA 4PCQA 5E8GA 4OOIA 5E1ZB 3RTRA 2H94A 5J8CA 1HBXG 3GFIA 3J80Z 5F1RA 4S05A 4UVBA 2VBZA 3TGNA 3DF8A 2FBHA 3Q5FA 3FF5A 3EYYA 4G7ZF 4LMYA 2LKPA 2HDCA 1T0FA 1Z05A 4Q5SF 1FLIA 4CGZA 3O2PE 2JZYA 1QO0D 3RI4A 4LLGF 1YW8A 4EM0B 4RGRA 5E20A 3HYIA 2HFHA 3BPXA 4B8XA 2DK8A 3Q9VA 3V8LA 2RC4A 3HRSA 2ETHA 1SFXA 2OQGA 1J2XA 1OR7A 2KIFA 1W5TA 2QYOA 4P9FA 1K6OA 2MA3A 5JVTA 2HYGD 2WV0A 1FBUA 3ZN0A 2FBKA 5HS7A 2K86A 1R7JA 3SQNA 2P7CB 4B09A 3V7RA 3ZP5A 3ZMVA 3F8NA 1O7FA 3ZMDA 2VN2A 1YW7A 2MH2A 5HLHA 2PMHA 1W7PA 3KLOA 1FYMA 2Y48A 5FO5A 3HRTA 5LBQA 3R60A 1D8KA 4LB6B 1YFHA 2NAZA 5CYVA 2VC1A 5EEGA 2A07F 1ODDA 2YR2A 3CO6C 2DPUA 5BPIA 4KA4A 3BJ6A 1FOKA 1U5TA 2O8XA 3MAJA 2XAQA 1XCBA 5AIPA 2ZNYA 2HOEA 1GXQA 4EMSA 4EM1A 1YIOA 5JFRA 2GA1A 4ESFA 4RB1A 4O3MA 3EETA 2CSOA 4NB5A 1P4XA 2FQ3A 1ZG5A 1J7KA 1S3JA 1FBQA 1LEBA 1JHHA 1BIAA 1MJ9A 2PQ8A 3BZ6A 1S8NA 5J8FA 3I59B 3I64A 4U0VA 4KIFA 4LFUA 4EM2A 3JSPA 2LNBA 1GVJA 2KJBA 4BQAA 3BJOA 5DYMA 2DK5A 3GZ5A 3H3UA 1B9NA 2CQKA 4HX8A 4MQVA 3QP5A 2JT1A 3ROUA 4Q48A 5L3FA 4EGYA 4WX9A 2VE9A 1TQMA 5D6EA 1FYLA 4YFXF 1STZA 1MZBA 3HOTA 2A61A 1XMAA 2DO7A 4H0EA 1O57A 2PI0A 4P9UA 1REPC 3VOEA 3VB2A 3W6JB 4BHCA 2D1VA 1W7PB 4BHPA 3KP5A 2W84A 3V7CA 4PZJA 1MDMB 4M71A 1PUEE 2RGVA 1FP2A 3HSRA 2MC3A 1W4MA 4EJUA 4KIGA 2V1UA 1B9MA 3CUQC 5K1YA 2EV5A 4KUMA 2O61A 1KGSA 1HKTA 1U2WA 2C6YA 1JGSA 2LDUA 4OU0A 3F6OA 3DV8A 3CTAA 2IA0A 3B73A 1IZ1A 3NRVA 4WF2A 2ACJA 2FA5A 2FMYA 2Q8KA 5BOXA 2EJRA 3WG9A 4AIKA 3HTUA 2ESNA 2XVCA 3DPTA 5D8LB 3OOPA 3K69A 1F5TA 1TW2A 3WODF 3T5XA 1G6NA 4JQFA 5FB2A 3W6KB 1FY7A 3J80K 1I6XA 4AIHA 4IXAA 4UXNA 1O3QA 2O0YA 3Q9SA 1UFMA 2G9WA 1ZREA 1ZAOA 2IJLA 2XKPA 2UWMA 2J5PA 1IW7F 2EFNA 2CO5A 1RIOH 1OPCA 4EJWA 2VE8A 2DI3A 4KN4X 2W57A 4N9HA 1ZHFA 4CYDA 1SD5A 3WGIA 1V4RA 2BBYA 3F22A 5D6FA 2STWA 1OKRA 4A5NA 3SZTA 1XMKA 3TOBA 1BI2A 1TNTA 4AVPA 5K5RA 1QNTA 2HEOA 4UVAA 2A6EF 3GO5A 4BYYA 1YW9A 2FBIA 1I27A 1AWCA 1SMYF 3FXQA 3C18A 3D5LA 3JAMZ 1GHCA 4M73A 1BI0A 3MQ0A 4EJOA 2ZJ2A 4WXDA 5CVRA 2OBPA 6PAXA 2XROA 2X0LA 3DXJF 2NYXA 2GXBA 3NQOA 3RKXA 1FSEA 1QQIA 2ZFWA 4HLXA 4XBFA 2HKOA 3TO9A 4ENMA 1VTNC 3F8BA 4KT5C 2QQAA 4Z2YA 3F8MA 4RAYA 3QU3A 3PQJA 2QVOA 1FSHA 4XRFA 1G3WA 1KYWA 3DPLC 1LVAA 1USSA 2CWEA 1XGMA 5H6RA 2W85A 1WSUA 3U1DA 4ZYGA 1BOAA 3GYHX 1Z6TA 4O5VA 2P8TA 3RKYA 1KU9A 3WGHA 3J7AO 2F5DA 4IRGA 2L3DA 3KP7A 4GCVA 1P92A 1R5HA 2E7XA 4R1HA 3I5UA 3QU6A 1P4AA 2MH9A 3DP7A 3V4GA 3K1NA 3F8FA 4YIIA 4LK0F 4HV5A 3E3VA 5CVUA 1YYVA 4ZZLA 3F23A 3LA2A 2DT5A 3FHZA 3GZ6A 1YS7A 1SD4A 4LJZF 3ELKA 5AONA 2CW0F 2EFOA 3EDPA 2YX7A 3FMQA 2UZKA 1DP7P 1WRJA 2M45A 4ESBA 2EFWA 4KN7X 4G7OF 2QBYA 4O6JA 4G6DA 2FOKA 2EA2A 4L9NA 2JTVA 4KYWA 4BH9A 3RJPA 5E18F 2H09A 2DFIA 1R1VA 3QP6A 5LHIA 2FSWA 4FX0A 2NRAC 2L01A 3ZPLA 2PJPA 1XSDA 3WTXC 3KCCA 2GAUA 1YS6A 3I71A 5CJ9A 4MTEA 4FX4A 3E6BA 4OIOF 2VOPA 3N4MA 1ULYA 4XSXF 4ZZDA 2WTEA 2XAJA 5E17F 1FBSA 3D0SA 3M1EA 1D5VA 1W7PD 1MJBA 2L4AA 2P6TA 2UXNA 1ZH5A 1D3YA 1B59A 2DQLA 3ULQB 2P5VA 4WK8F 1ZLJA 4MHGA 2XIGA 3RPUA 2QQBA 2DBBA 2EFPA 3K0LA 1LQ1A 4Y15A 1ZRDA 3KZYA 3GVAA 4MNUA 2IP2A 1OMIA 3DKWA 4OMZA 1FP1D 4XLNF 4RGXA 5K5QA 1Z6RA 3SZPA 1WKMA 5HOOA 5CLSA 4M6YA 1Q1HA 2VODA 2QLZA 1U5TB 2GXGA 4HX7A 1UB9A 5HS9A 4L9TA 1HW2A 4IHTA 3KE2A 5DCFA 3EUHA 1O3RA 4G8XA 3K2ZA 1ZN2A 3F72A 4HX4A 4IJAA 2EA4A 5LGUA 4YFNF 3KFWX 1E2XA 1SFUA 2LSOA 1I5ZA 1X3UA 2EB7A 3CUQA 3R61A 5ICCA 1R23A 1R5GA 2GIVA 5CVVA 1XGOA 4WCGA 2W25A 2DU9A 2Q0OA 4IRIA 2CG4A 1RUOA 2P5KA 4N0BA 4M9XA 4P96A 3VODA 1ZYRF 3QOPA 2X4HA 3I54A 4U88A 4KMUX 4GYIA 3CUOA 1Z9CA 5EEHA 3HUGA 5FD5A 4CO8A 2K4BA 3L7WA 1TBXA 2HQNA 1RNLA 1HSJA 2QWWA 2QQ9A 5FLXK 4RGSA 5DCMB 1HKSA 3JTGA 3HSEA 1TQIA 2L02A 1F9NA 2K4JA 2NS0A 4CDGA 4ESJA 3FZVA 1G3TA 3GXOA 1S7OA 1F1ZA 4A12A 1IF1A 3DEUA 1L3LA 2EFQA 1U6GA 3TDUC 4LB5A 5LRSA 2JRTA 3C3WA 3BPVA 4YG2F 1G3YA 2XHKA 4Y13A 2IW5A 1EH8A 4KMFA 4ZYHA 3I58A 2E1CA 3R6SA 4E70A 1J0RA 2XGXA 4UV8A 3RDIA 3WE3A 3KEQA 3E6MA 2R7FA 1V3FA 4LLLA 2VXZA 3TOAA 2YU3A 3RKWA 4CXFA 3MWMA 5HLGA 1R1TA 1LJ9A 2K7LA 3G73A 1CF7A 4A0XA 3FWEA 5AIQA 1K79A 1IN7A 2KRFA 1KA8A 3FM3A 3ERED 2XRNA 3K9TA 4MEXF 3V7SA 4UVCA 5BQTA 1PP7U 3LAPA 2VBXA 2LF8A 1JE8A 2E1NA 4LLNA 2F5CA 1G3SA 4KNYA 1IUYA 3WTSC 1YLFA 3E5UA 4AD9A 1S7AA 3WTZA 2RNJA 4L9VA 2DPDA 4U0WA 4FT8A 1QBJA 4CICA 3REOA 4HDVA 1LDJA 1HKQA 4R8HA 3ZQ7A 2DAOA 4LG0A 3CO7C 1UHWA 4IHSA 5A2QK 1O3SA 1H9TA 2HS5A 3ISPA 4HF1A 1Y0UA 1P2FA 4RB3C 4I98B 1DPRA
chains in the Genus database with same CATH superfamily
1ZGAA 2Y75A 3WTVC 2WWYA 5L3BA 5EF6A 4A93J 1KQ8A 1Z91A 1VZ0A 1R00A 4EJTA 4FE4A 3E6CC 4XLCA 2LG4A 2GBYA 3VDXA 2L2OA 1FX7A 5JR3A 4I76A 3G2BA 2IAIA 5E8IA 1XS9A 2CV0A 3HKZA 4YIRX 4MQ9F 3LSMA 3IRRA 3SZGA 4LOCA 3BR5A 2PMUA 3HB9A 1D5YA 3CP2A 5EJCA 4MTDA 1YX5A 4HQEA 4M3DA 1XTAA 1OYYA 1D1BA 4YRVA 3JCUC 1PDNC 4G94A 1DDNA 4UNOA 4ZYDA 3MKZA 2DA5A 3T8TA 5IT3A 4CYCA 2HKXA 2H1KA 4YFKF 3CCMI 4XSZF 2XB5A 3MEXA 4E7IA 2CYYA 2PLYA 3HGGA 4Y52J 4CH7A 4Q4ZF 3HDDA 3MCZA 1O3TA 1VQMI 2EV6A 4L18B 2VT3A 3Q3SA 2MG4A 3RYPA 4BY7J 1SVOA 3IWFA 1BIBA 1MBHA 2BW3B 2HOTA 3SDBA 1S72I 1Z1DA 1GLNA 1PVEA 2CUZA 2QGUA 3FKIJ 4ASNA 3QRFF 1OCCH 3OYLA 3LQQA 2ZMEA 1I1SA 3CF2A 4FE7A 2K9MA 1FIPA 2XF7A 4U7BA 5DD4A 3IHUA 3WGGA 4ZTFA 2NVXJ 1U3EM 3WTTC 3IWZA 3HHHA 2LRDA 2MBFA 3IAS2 3M8EA 3ZXSA 4HF2A 2KIUA 3P9KA 3K4NA 1M1EB 3U9GA 2HGCA 3T0YA 5L3CA 4KISA 1T98A 1R71A 2F5FA 3BOQA 2M9HA 1MH3A 4IEJA 5BS6A 2H6CA 1WJFA 2FF4A 1W0TA 1B4AA 3BJAA 1TZLA 2M3AA 3DLLF 2KT0A 2ZKZA 3TDZC 4HSTA 1Z7UA 2H27A 4GFBA 1SFKA 2DFFA 4UV9A 4XR6A 3PJRA 2KPMA 2JA8J 4M9ZA 2XF5A 4M72A 3S3MA 3DBRB 2UXXA 2Z5UA 4N4NB 3KIOA 1RI7A 1OLTA 2AXLA 4ZYAA 3BY6A 3JW4A 2ME6A 2HPIA 2WA0A 2ZBKA 3L2CA 2MZ4A 3MVPA 1UAAA 5FFXA 2WB1N 5A2QZ 2X6YA 4EQQA 5ILVA 5L3DA 2A6HF 5F0HA 2RDPA 1FNNA 1XC5A 4MEYF 1J59A 3M8FA 1BI1A 2LC2A 1MD0A 4LIVA 3AKZA 1R4MB 1KQ0A 2OA4A 3KYCB 1RKTA 4K2EA 3P7NA 4M74A 5FKMA 1T6SA 3OSGA 2QKMB 3S2WA 4GYGA 4GXOA 3HTSB 2VIXA 3GWZA 5K7ZA 3H0DA 3TO6A 4F3QA 1KZHA 2W82A 2DTRA 2F48A 3M9AA 1GV5A 5FFZA 5LFAA 1XG1A 3G1LA 2BY0A 1WJEA 2STTA 3BDDA 4E7ZA 3H92A 4HV6A 2ISYA 1AOYA 3CMAI 1SD7A 3K70D 3HPGA 4S04A 1PUFA 4CCOA 4EV0A 3DTIA 1NHAA 1QZZA 4S0HB 3EUHC 4I7HA 2DOEA 4XNFA 2NNNA 5IT9K 4OINF 3SDGA 4A3DJ 3T1BA 4EGZA 1WGXA 4KFCA 2X6XA 4KIBA 2P4WA 4RS8A 4Q47A 4HAMA 4M3FA 1YE9A 4NUBA 5BPDA 3CCYA 3DCFA 3MFKA 5F64A 2LP0A 3EYIA 3N05A 2OTLI 4HQMA 3I9V2 1FC3A 1K78A 3OY9A 4IHWA 2KISA 1WI9A 2M5WA 3A03A 4AVZA 2PJRA 3GX4X 1LKXA 1D8JA 3ZMZA 5FD6A 3IKTA 4QTRA 3BP8A 3F3XA 5ICGA 2X9DA 3DU6A 2Y69H 3K70C 3VEPA 1ZGJA 2A68F 3SFZA 2EZLA 2R3SA 1G4DA 4IVNA 3JAMK 5LHGA 2D45A 2P6SA 4P5OA 3CF5F 3M7GA 4ETSA 3H5AA 1IG7A 3PFYA 2BGCA 3FXMA 1PYVA 2DXIA 4FETA 4QWQA 5HDNA 2EZIA 5DDGA 2KP6A 2X85A 3FBIB 4OIQF 2JSCA 1T38A 2R7VA 1FIAA 4HF0A 3PFIA 3E0JB 1XDUA 3LA7A 1ORKA 4IF4A 1KYZA 4MGRA 1S29A 5KK1A 2F2EA 1A5JA 3J7AW 2XKOA 1IAWA 4BE2A 3JRBA 2O03A 3LOCA 4XLAA 2COMA 2VPRA 2DDBA 2L5QA 2VOOA 3BCAA 1LNWA 2RV8A 3CCVI 4P1WA 1XGSA 4HNVA 3B6AA 2VQGA 2R7SA 3FMSA 2KRHA 4A2UA 5H20A 4CHUA 2DYSH 3VYSB 2IGKA 2QA4I 2VJIA 2OUMA 4G9YA 5J4YA 1MMAA 2CFXA 2E60A 1V5EA 4N9IA 1XSVA 2EILH 2Y9ZA 4IRHA 1HDPA 1ON2A 3HJEA 5TGTA 4A3EJ 4L5IA 1TQPA 2IVMA 4XM3A 5ICEA 4G6QA 1P4WA 2IPQX 1T08B 4KICA 3PNVA 1J75A 3WE2A 4QLCU 1FTZA 4B47A 3IKVA 3LQRA 3WU1B 2DW4A 3I55I 5IT9Z 1R58A 1J9IA 1TWAJ 2XUBA 4HYEA 1HSTA 1KQ9A 4B4CA 5DM6F 2M1BA 5LHHA 2JSPA 2ZMEB 1TTYA 4LG3A 4Z6YA 2P0WA 2KDOA 2M0MA 2R0QC 4BBRJ 2OD5A 4XIDA 2LF7A 4D0PA 4JYKA 2VI6A 1CF7B 2CRGA 1YIJI 2ZNZA 3I4NJ 1Y56A 1BN5A 4Y17A 1LE8B 3TKYA 4JX5A 5ICFA 2Q2EA 2V9KA 1X19A 2L54A 3KETA 2K27A 3BCBA 5CVJA 5JI6A 3HOWJ 2UUZA 2VKEA 1XN7A 1B1BA 2KQRA 3RPQA 2X1EA 2NNYA 3K4KA 5J3LA 4M3GA 4G7HF 1S6LA 4ZTJA 2LFBA 3LSRA 4I2OA 1GVDA 1ONVA 1R5ID 3EQLF 5DV5A 3BZKA 1VQOI 3HOYJ 3HHGA 1ON1A 3GF2A 4CZZA 4HA8A 4ON0A 3ABUA 2E35A 1NTCA 4P55A 2BHYA 2VBWA 1IN8A 2N8GA 2XAHA 1FWZA 2HQ5A 2RQPA 1LDDA 2EV0A 3CCJI 3O6BB 2ISZA 5FROA 1SD6A 4D9JA 4B48A 2Y0SN 3ZQGA 4BEHA 3GFJA 5TISC 2M2EA 2FX0A 5GTIC 3D5SC 4EJVA 2XV4S 4G6TB 1RR7A 1ZG3A 5C3EJ 3EPZA 3GLLA 3K1MA 1L0OC 4XLEA 2VT2A 3AG3H 5FLMJ 4A5MA 5L3GA 1IJWC 1CQTA 4RB0A 1P6RA 3FXRA 1RUNA 1U78A 2CW7A 1W0UA 4DQ2A 3GZNB 5E79C 2F5VA 2AQFA 2B7EA 2YS9A 4A6EA 1JXSA 3P5JA 3OL4A 2K5CA 3CJNA 3I4PA 4XK4A 1IXSB 4LG0B 4LGWA 3GTQJ 4LK1F 2O9LA 2L9NA 4PGGA 3JRFA 2DN0A 2X98A 4BUPA 1B8IA 2B0LA 3COAC 1MW7A 3A0HC 4HDUA 1LEAA 4L0ZB 1JTYA 2IGMA 3CJQB 4KDPA 1T8IA 2O3FA 3HOSA 5K5OA 1Z7LA 4A6DA 1J09A 2CFOA 2KIMA 3HC7A 4NBQA 4PDKA 3G71I 1NK2P 1JUSA 3WTWC 3KP4A 1WI3A 2DQRA 3CC7I 2NVQJ 5DTDA 1VQNI 1Y6IA 4ZYEA 3J7AY 4FTHA 5F6FA 1YITI 1EH6A 2ESHA 2DA3A 2Z33A 1BI3A 4OWRB 2V6EA 4R79A 4D7MA 4FISA 5C4JJ 2P5LC 2D2WA 1ZK8A 1T2KA 4A3MJ 4C3IJ 3K10A 4XN0A 2HOAA 3E5QA 2CH0A 3LSTA 3OR2C 4HZFA 4PJMA 5LGNA 2P81A 3GFLA 2ZXJA 2ECCA 2V9VA 3ZQHA 3OIOA 4J19A 5C4XJ 3J81Z 4LD5A 2LOOA 2DMUA 4NQWA 4U7DA 4CCLA 3PSFA 2R7DA 2XC7A 2KKOA 3PQKA 1K7AA 2IA1A 4XMYA 3FXKA 4ZDPA 1F4KA 3BG5A 3V8JA 3CP8A 3U2RA 1ETYA 3GTJJ 5HVQC 1TT0A 5DM7F 2MD0A 1JJ8C 2VQCA 3FM5A 1LB2A 1SMTA 3HRMA 4V2FA 3QODA 4OMYA 1MKMA 3VFZA 3GUDA 4XLHA 1TLHB 3SEQA 1LE8A 1CGPA 3AAFA 2K9SA 2GQQA 2L7FP 4LIUA 1LFUP 3FMRA 3P9IA 2K40A 2RN7A 4X0GA 4AM3A 4WXHA 2Y2ZA 1XSXA 2MLGA 3DKXA 3QPTA 3TMOA 2QEXI 2HWVA 3K1PA 3GTOJ 1DQUA 3E5XA 1MJAA 3BG6A 5DD8A 2Y9YA 3V8KA 2YSRA 1QU3A 2PFBA 4UUSB 4IO9F 1Z77A 5E1XA 1WWXA 2F6CA 1LDKB 3S1QJ 1V5FA 3I53A 2HQRA 2VKDA 3CLOA 3ZGKA 4DBRA 3CC2I 5FLVA 3GFMA 3L00A 2R93J 4ANJA 4N4OB 1IRGA 2DA7A 2GA2A 4V2GA 4IX7A 2XAFA 3K7AJ 5LEKA 1TW3A 5BMZA 1VQ9I 2FOWA 3LSJA 2MFZA 4AWXB 2L4MA 2XGEA 3HL2A 3ASNH 2H6BA 2XSJC 4ENKA 3IRQA 1TT5B 2JMWA 2XAGA 3KP3A 1MNMC 4WWCA 1MBFA 5L3EA 2YX4A 2ZO4A 2KDZA 1Z3XA 1B6AA 5CVIA 1B72B 3KLNA 3ABTA 2TCTA 3JSOA 1R1UA 5DUKA 4ENJA 1H0MA 5FGMA 2JPBA 2V1DA 2AXTC 2G7HA 4AIJA 1MNDA 3KP2A 1QA6A 1QZYA 3S16J 4XKWA 3KEYA 3C7JA 2BE5F 4L5JA 4PJ0C 3ECHA 5LGTA 1YJWI 2ELHA 1HW5A 4HRIA 4B1RA 2BY3A 5DUIA 3C1DA 1DU0A 4BU2A 4BL0B 5DEQA 4EVIA 2IGOA 4RB2C 4BNCA 1JHFA 2E7WA 1BC7C 5FRNA 3L09A 2K02A 5D4RA 2EH3A 5KNLA 1RZ4A 3OYNA 5TJJA 3HRUA 3UKGA 3V42A 1EJ9A 3H1CA 2MLKA 2IRFG 2OQRA 2OZUA 5J6XA 2X6WA 5M3MJ 3QPSA 4BAYA 3SXYA 5D8KB 1PUFB 3HSFA 1KU7A 2DMPA 1PP8F 2M8EA 3B02A 5B5EC 3WTYC 1UZCA 3BROA 1H88C 4YIFA 4ZDOA 3CCUI 1SEUA 1WJAA 2L7ZA 2NVYJ 1MBGA 2JJ7A 2HYFA 4E7HA 3E97A 1N77A 4ZH4F 3LNQA 2JA2A 3ZQFA 3G6EI 1T0FC 1H8AC 2HTSA 3RQ4A 5F0FA 3CMEI 2Y0SA 3ZMUA 1BM9A 2V9PA 4CSWA 4IPAA 4IOCF 2XASA 5D4SA 3Q0WA 1K78B 4L9JA 1NH3A 4OIRF 3MMYB 1MNEA 4EEFG 3A2KA 1HXDA 4BXUA 1JGGA 4XRMA 1A6IA 2HR3A 1LVKA 1ERDA 4AC0A 3FBNB 2B63J 1U5TC 4LITA 1YG2A 3TEDA 2HTJA 2RVCA 2HZTA 1U8RA 3C2BA 3ZMTA 3E6DA 1BOBA 4M6XA 4UUVA 3KEOA 2F5EA 2VONA 2L7MP 1ETQA 1XGNA 1IN4A 2DYRH 1W1WE 4UUSA 4I09A 1I1GA 2Z2SB 3G3ZA 4OAYA 2A3SA 2QM3A 5J4VA 1I50J 4XICA 3L2WA 5ILSA 3SJMA 4HW0A 3BR0A 1T39A 3HIFA 2VQHA 1DPUA 2BV6A 3HKZN 2OCEA 1XDSA 1FPQA 1YI2I 4II3A 4II2A 4GRIA 4OIPF 1ZG1A 1VNDA 2EWNA 2FRHA 2BW3A 2WAFA 2RKHA 2ID3A 5LRRA 1Y0NA 3S1MJ 4DYQA 3ZN1A 4A3KJ 2LH9A 1JKPC 2IXSA 3C2GA 3OV8A 5IOZA 1YRNA 1IXRC 4TV7A 1IRZA 4NC7A 2BEOA 2OU2A 3NAUA 4NC8A 5D5XB 2Z3YA 1U8BA 2LMDA 1HW1A 3IC7A 5HDKA 1IN6A 1V5GA 3L2RA 1EH7A 1Q1VA 3QPHA 1DU6A 2FNAA 3CDHA 5LD2C 5J1UA 3RZDJ 2LBFA 1WQ2A 3IH4A 1JT6A 2A05A 3QAHA 1ZRFA 3SHFA 1WPKA 4DYRA 1D1AA 4F93B 2JN6A 5FRMA 3PUFA 3DEWA 1BW5A 4HLYA 1JI8A 1H9GA 1ETXA 2W1OA 3GTPJ 2V1XA 4A0YA 2Z9OA 4A3CJ 2QSFX 5LEJA 2IA2A 3LAJA 1W5SA 1EKEA 3M3YJ 2L9SA 3PSIA 3OS2A 1U9NA 1ZARA 4G12A 2GZWA 4RAZA 1DUXC 3CD6I 2M7BA 3ZMSA 2V79A 4A3LJ 5JHUA 1IV8A 2WADA 1O7LA 2BHZA 4NC6A 3IL2A 2AS5F 1R36A 1D0YA 3KX2A 5HDGA 3ZR8X 4AIDA 3PL8A 3K4CA 2GWRA 5K7FA 3I59A 3JTHA 5D5VB 5IT9R 4PGHA 1BR4A 1VQLI 5HLTA 1D0XA 1T33A 3PUBA 1X2MA 4WXCA 3LWFA 4DZJA 1KU3A 1JTXA 4HBLA 2B9SA 1MSFC 1GXPA 1JKRC 3ZQQA 2FEZA 2FXAA 3WG7H 1XB4A 4L0YB 2HXIA 3LFKA 3GLXA 2W7NA 4M9SA 1YTYA 5GP9A 1YJ9I 4XORA 4U0YA 2XPVA 3CUQB 4CZCA 1FEXA 3RYRA 1RETA 2ADUA 3LA3A 1MMSA 2OJED 3H3ZA 4GO1A 3AFHA 1BJZA 3O3KA 4HG2A 1QGPA 1UJ8A 3PNTA 5KVRA 2ZJQF 1FZPB 2QBYB 4FHTA 4W1UA 2QUFA 2QENA 3NEUA 3F21A 3J81K 5H6QA 1C0WA 1QPMA 2JRMA 4B3XA 2W24A 5EDNA 1MGTA 4HOBA 2JA7J 2TRTA 1YO5C 1K4TA 1APLC 4I0BA 1FMVA 3OYAA 1BBYA 1SFOJ 5ILUA 1BL0A 4UHTA 3J80R 3K4JA 3DFGA 2KJCA 3CC4I 1A04A 2E1MB 1IV6A 2CUEA 5EG0B 2W4SA 2EINH 3BWGA 2FE3A 2H8WA 1USTA 3CZ6A 3HZJA 4HPQA 4PJLA 4JBAA 2EK5A 2OPTA 5IPAA 2P7VB 1ZLKA 2VPLA 3WTUC 3M07A 2ME0A 2L7KA 1YJNI 4BACA 1HQCA 2ICWG 2ZCWA 3H9JA 3MZ8A 4GGGA 1FT9A 4PJNA 4AYBN 4DJAA 4BQOA 4NDLA 4Y3OA 1ZRCA 2EIKH 3BTCA 1GDTA 1OYWA 5DCMA 3S32A 1IXCA 2V26A 3PIPF 1FYKA 2HYJA 2IBDA 5HS8A 4DNCA 3FX3A 1R49A 4JOMA 3AG2H 1W36C 1OYIA 2VC0A 2XDVA 2QZ8A 2KMUA 3DQVC 4DW6A 2LBFB 1UHMA 3WU0A 1XPXA 1E17A 2TDXA 2XF6A 2CQNA 2PN6A 2O6GE 2A69F 2CV1A 5LLQA 5E3NA 3IH3A 3H36A 2VBYA 1MBEA 1QPIA 1BC8C 1KU2A 3GEZA 1X1BA 2PEXA 3FK7A 1H89C 2FMLA 1IN5A 1GV2A 2DDAA 1EV7A 3OOUA 3U21A 3Q0VA 1IRFA 1HOMA 1ETVA 3N97A 5HLIA 4NHJA 3BR6A 2ZSIB 3B6CA 3IH2A 1XCVA 5FJ8J 4F7ZA 4JK1X 3L1PA 3T8RA 3BG9A 1JJ6C 2G7UA 4BKXA 3MZHA 4A0ZA 2DA6A 2HVSA 4I0AA 2LY2A 5TRDA 3MKLA 4JP0A 3WHBA 2V6CA 2WAQA 1MMDA 4M3EA 5EEAA 3F9KA 4A3FJ 4IOAF 5GPCA 3JRHA 2DLLA 5ERIA 2LKXA 1P7JA 2Z99A 3BQZA 1IDZA 3A52A 1X2NA 2R7XA 4EATA 9ANTA 3G1OA 3JRDA 1XD7A 4XKCA 1UCRA 3F8CA 3S15J 2JUCA 5D5UB 4I02A 4XN3A 4PFOA 2VB6A 2DA1A 2HQAA 3TQNA 2XGDA 2CGPA 5FLXZ 2PBIA 3FXUA 2XAUA 2E36A 4JX4A 3FIWA 4J00A 2BYVE 3R0AA 4C2MJ 3KZZA 2A5YB 1ZR4A 2HZDA 5E1WA 5F0CA 3GMEA 3KP6A 1MDMA 1BJAA 3ML6A 4JX6A 4RGUA 2OAZA 1YQAA 2DMTA 5FKNA 3R0JA 2X1DA 3I0TA 3RIRA 3RZOJ 3TO7A 1HDDC 2E19A 3MZYA 3L2VA 1SAXA 4I01A 4MFEA 2L0KA 2OZ6A 2PMZN 2F4IA 3K4MA 3P9CA 2VUMJ 2JPCA 1J5YA 2ID6A 2HNHA 2D1HA 2GIZA 2EIMH 1X1AA 2Y0MA 2YPRA 2IT0A 1ZQ3P 5E3OA 1OCZH 2FU4A 5D5WB 4DIQA 2NOGA 2MYSA 2MD5A 3DTEA 2WC2A 3ECOA 3BQYA 3R4KA 2Y30A 1I3AA 2V7FA 3G4SI 2M87A 4ENNA 1R22A 2M8GX 3NWTA 1FMWA 1P7IA 3VSLA 2ZXHA 2J5OA 2KRCA 1F36A 3BR1A 3GW2A 5ED4A 3ONQA 4XLPF 3HM5A 2FNPA 1SFEA 2M30A 2KLOA 3F6VA 4ITVA 4BHBA 2IS2A 3L9FA 3Q0UA 2NVUB 3S1NJ 2UV1A 2PG4A 2CQQA 1TNSA 1ETOA 5K7HA 4PCQA 3J7ZI 5E8GA 4OOIA 1SC7A 5E1ZB 3RTRA 2H94A 5J8CA 2EIJH 1HBXG 2LREA 2Z16A 3GFIA 3FDYA 3J80Z 2Z1DA 3ZQIA 2KFDA 5F1RA 4S05A 2WV1A 5H2FC 2VBZA 4UVBA 4XKBA 3TGNA 3AL0B 3HUGB 3K2AA 3DF8A 4UB6C 1WJBA 4PUSA 4L5EA 2FBHA 2ZXWH 2MC4A 1X1PA 1T95A 3Q5FA 3FF5A 4HNTA 2GOXB 3ERMA 2R7TA 3EYYA 3QYEA 4G7ZF 4IHYA 4LMYA 1AHDP 2LKPA 2HDCA 1HCRA 5GTHC 2AHQA 1B8IB 1T0FA 3VPRA 1Z05A 2DOFA 4Q5SF 1FLIA 4CGZA 3O2PE 2JZYA 3CCLI 1QO0D 3RI4A 2MSYA 4LLGF 1YW8A 4EM0B 1RQ6A 4RGRA 1MIJA 3K6GA 3HYIA 5E20A 2HFHA 3BPXA 1RPWA 4B8XA 3O8HA 3CESA 5HODA 4CCJA 2DK8A 3Q9VA 3V8LA 2RC4A 3HRSA 2ETHA 1SFXA 2OQGA 3S14J 1J2XA 3A1YA 1OR7A 3OIPA 2KIFA 3CJTB 1W5TA 3BC8A 2QYOA 4P9FA 1K6OA 2MA3A 5JVTA 2HYGD 2WV0A 3M8JA 1IUFA 2CW8A 4NQWB 1O4XA 3S2HJ 2Y31A 2R7ZJ 1FBUA 3ZN0A 3IUOA 2FBKA 5HS7A 2K86A 3X2QH 3UR3C 3MN2A 1HLVA 2IS1A 1R7JA 5F27A 3SQNA 2P7CB 4B09A 1WH5A 2HVQA 3V7RA 3ZP5A 1IC8A 3AL0C 3ZMVA 3F8NA 5GAEJ 1O7FA 3GBGA 3ZMDA 3K4BA 1K83J 2VN2A 1YW7A 2AO9A 2MH2A 5HLHA 2PMHA 1W7PA 3KLOA 3L2UA 1TWHJ 1FYMA 2Y48A 5FO5A 3HRTA 5LBQA 3R60A 1D8KA 2F4MB 4LB6B 2A6TA 2KHMA 4ZDLA 1YFHA 2E2IJ 1JKOC 1UMQA 3W2WA 3RSNA 2ZMEC 1NK3P 3M4OJ 2NAZA 5CYVA 2VC1A 4XRSG 5EEGA 2A07F 2H8RA 3A0BC 3F0CA 3OYHA 3CCSI 5J1RA 1ACIA 1ODDA 2YR2A 3CO6C 2DPUA 5BPIA 4KA4A 4X6AJ 3BJ6A 5GAGJ 1FOKA 1U5TA 3DBLB 2O8XA 4D5FA 3MAJA 3OS1A 2XAQA 1XCBA 3O8GA 5CQGA 5AIPA 2XRLA 2ZNYA 2HOEA 2R5YB 1GXQA 1VFCA 4EMSA 4EM1A 1YIOA 5JFRA 3CCEI 2GA1A 1YHQI 3VYRB 4ESFA 2K85A 5IYDJ 4RB1A 3HXLA 3OS0A 4O3MA 3EETA 2CSOA 4NB5A 2VLAA 3A02A 3HGYA 1P4XA 2FQ3A 4BXXJ 3OYDA 1G2HA 1ZG5A 1J7KA 1S3JA 1FBQA 1LEBA 1JHHA 2Q2EB 2R7UA 1BIAA 4M6VA 1MJ9A 2PQ8A 4DYCA 3BZ6A 1S8NA 2FJ1A 5B1BH 4C3HJ 1QHHD 5J8FA 2HOSA 1G59A 2E71A 5IOYA 3QPLA 1QRYA 2G0EA 2MW8A 3I59B 4B43A 2CU7A 3PO3J 3I64A 2XPWA 4U0VA 5JLXA 3FXOA 3E1SA 1RRJA 1TC3C 4KT6A 4KIFA 1VQKI 1Z3YA 4LFUA 4EM2A 2ZFUA 3JSPA 2LNBA 1GVJA 1U9OA 2KJBA 4BQAA 3BJOA 5DYMA 4D5CA 3LMMA 2E5NA 2DK5A 2R5ZA 3GZ5A 3H3UA 3SYTA 4A3GJ 1B9NA 2CQKA 2PMZA 4A3JJ 4HX8A 3I56I 1WJDA 4MQVA 3PO2J 1ZELA 3QP5A 5IYCJ 2JT1A 4X1EA 5J47A 3ROUA 4Q48A 5IP6A 5L3FA 4EGYA 2O7OA 3D1NI 4YEJA 2ECBA 3DBHB 4WX9A 2VE9A 1TQMA 5D6EA 2FD5A 5FKLA 4E7SA 1FYLA 4YFXF 1STZA 2KL4A 1MZBA 5EYRA 1WJ5A 2EQRA 2PJRB 5KAFC 3TP3A 2GOMA 3H9GA 2ZJPF 3HOTA 2A61A 5EG0A 4F91B 5JHFA 1XMAA 2DO7A 1OCOH 4H0EA 3OSFA 1O57A 3EUAA 5M3FJ 2DJIA 4P9UA 2PI0A 2X51A 1JKQC 1T56A 4AUXA 5KCMA 4KITB 1REPC 3IP4B 3VOEA 2FQ4A 2O5RA 2DT7B 3VB2A 3W6JB 4BHCA 2D1VA 1RC9A 2QF7A 3JRAA 2D5VA 2BXYA 2E1OA 3BG7A 1W7PB 5JLWA 1LUJB 2VKHA 4QPQA 2I10A 4BHPA 3A4CA 3KP5A 1ENHA 5IYBJ 2W84A 3V7CA 4PZJA 2LKSA 1MDMB 3QWLA 4M71A 5F1JA 2DODA 1PUEE 2EZKA 2RGVA 1FP2A 3HSRA 1E3PA 2MC3A 3QOEA 1VQ4I 3W6VA 1W4MA 2JVGA 4UUTA 4EJUA 2BOLA 2ZC2A 1LPQA 2JVHA 2WY8Q 4KIGA 2MGQA 2V1UA 1B9MA 3CUQC 4PJJA 2CV2A 4MIMA 5K1YA 1U0JA 2EV5A 1VF9A 2BVMA 2M4KA 3LL7A 2VASA 3OYEA 2JA6J 1Y1WJ 5F04A 1A35A 4KUMA 2O61A 4BJTA 2V4JC 5GADJ 4IQ4A 1KGSA 1HKTA 1U2WA 2C6YA 4BDZA 1JGSA 2LDUA 4OU0A 3TW6A 3F6OA 1Y39A 3L2QA 3DV8A 3JR9A 1A6QA 2PX9A 3CTAA 2QSHX 2IA0A 3B73A 1IZ1A 3NRVA 4AYBA 3IV5A 4E4HA 4WF2A 2ACJA 2FA5A 3OL3A 1AKHB 1S9HA 3BZCA 2V1NA 2LR8A 1QHGA 2FMYA 2Q8KA 5BOXA 4W97A 2EJRA 3WG9A 1V54H 2HI3A 3S93A 1WHUA 2I8DA 2WY7Q 4AIKA 3HTUA 4CUGA 2M7AA 3HBLA 4BS9A 2ESNA 2R5ZB 3W2VA 2XVCA 2DMQA 3DPTA 4CCKA 3S2DJ 5D8LB 3OOPA 5KHDA 3K69A 1F5TA 1TW2A 1EF4A 1MMGA 4XOTA 5EZHA 3WODF 4C2UA 3T5XA 1G6NA 4H4KC 4JQFA 5FB2A 3W6KB 1FY7A 1OQYA 1RKWA 2K3FA 3OWTA 2FUG2 3J80K 4ABZA 3BTJA 1I6XA 3QYFA 1QVTA 3ZQCA 4AIHA 5EGOA 3CDLA 4IXAA 2HDDA 3A01A 4UXNA 1O3QA 1Z0XA 2O0YA 4RAFA 3Q9SA 1UFMA 4J01A 2G9WA 1KONA 1ZREA 4RBOA 1ZAOA 4IL6C 2IJLA 5BNGA 4DGWB 4RMNA 3JRGA 2HDWA 5GPAA 4XRSA 4A3BJ 1ETKA 2XKPA 2UWMA 2J5PA 1IW7F 1WVRA 2EFNA 1N78A 2CO5A 1VQ8I 1RIOH 4XKVA 1OPCA 1MBJA 4EJWA 2VE8A 2BY1A 1POGA 2DI3A 2LY9A 2DJNA 1QVUA 4KN4X 2W57A 1Z21A 1S5LC 2XSDC 3KPHA 3W2AA 1W36D 4XLFA 4N9HA 3E7LA 4F52A 1ZHFA 5DS9A 4CYDA 3ABLH 3GTGJ 2M4GA 3DPUA 3TBIA 2NOJB 1SD5A 3WGIA 1OISA 2XPUA 4BGDA 1V4RA 2OC6A 2BBYA 3S1RJ 1OCPA 3F22A 5D6FA 4ZC3A 2STWA 1OKRA 3WHCA 1WFXA 4DOZA 1A31A 4A5NA 2GXAA 2QSGX 1D1CA 3SZTA 1XMKA 3ASOH 3TOBA 1BI2A 1TNTA 4HNUA 4AVPA 5K5RA 1QNTA 2HEOA 4UVAA 4BBSJ 2VJ5A 2A6EF 3GO5A 3J7YJ 4BYYA 1YW9A 3GTKJ 2FBIA 2EZHA 1I27A 2X48A 1YX3A 1AWCA 1SMYF 3FXQA 1DGWY 3C18A 3WU2C 3D5LA 4HSRA 3JAMZ 4M73A 1GHCA 1WJCA 2HU9A 1BI0A 3MQ0A 4EJOA 2ZJ2A 4WXDA 5CVRA 4CCMA 2OBPA 6PAXA 3BTIA 2XROA 2X0LA 3DXJF 5GAHJ 3CMMA 3J81R 4MLOA 2NYXA 1JT0A 2CMPA 2GXBA 3JRCA 1N25A 3S3OA 3CLQA 4NNJA 3NQOA 3RKXA 1FSEA 1QQIA 2WAEA 2ZFWA 1UHSA 4HLXA 1VQPI 1X3WB 4XBFA 2GM4A 2HKOA 4AU7A 4RLQA 3TO9A 4ENMA 1VTNC 2YU9J 4XONA 3NARA 1TWGJ 3F8BA 4KT5C 3RCOA 2QQAA 4Z2YA 3F8MA 4RAYA 4D1QA 3QU3A 3FKJA 3PQJA 2QVOA 1FSHA 4XRFA 3H5RA 1Z67A 1G3WA 2CQXA 1TWFJ 2OTJI 1KYWA 2R92J 1W5CC 4BXFA 1ZTRA 1BW6A 3DPLC 1SVMA 3BTLA 2QQ8A 2QKLB 3TW7A 3OR1C 1DP3A 1LVAA 1USSA 2CWEA 3OYMA 1XGMA 5H6RA 2W85A 1WCMJ 4IZZA 1FOXA 3ZQLA 2BXZA 1WSUA 3U1DA 4ZYGA 1BOAA 3GYHX 3AG1H 1X58A 4IQJA 2I5UA 1Z6TA 2CJJA 4O5VA 1V55H 2P8TA 3LSHA 3RKYA 1KU9A 1TWCJ 2BY2A 3WGHA 3J7AO 2F5DA 3LSKA 5B1AH 4IRGA 2L3DA 2E2HJ 3HOVJ 5EZGA 3PIOF 4BQNA 3KP7A 2KZVA 4GCVA 2M35A 3K4LA 1P92A 1R5HA 2VL8A 2E2JJ 1WH7A 4PSWA 2E7XA 4R1HA 2GLOA 3I5UA 3QU6A 1OCTC 1P4AA 2R7OA 2CUFA 2MH9A 3W3CA 2NS8A 3DP7A 2DCEA 3I3LA 3V4GA 3K1NA 3F8FA 3CJRB 4YIIA 1AA7A 4LK0F 1MH4A 3DLAA 2HPMA 4HV5A 5JVGF 1BR2A 3E3VA 1AKHA 5CVUA 1YYVA 4ZZLA 4BEHB 3OYCA 3F23A 4BQQA 3LA2A 2DT5A 1GT0C 4RA2A 3FHZA 3RPUD 2R5YA 4C2TA 1X4PA 4FASD 4V19K 3GZ6A 2X1CA 1BA5A 1YS7A 1SD4A 4LJZF 1Y8RB 4E7KA 4CCNA 3ELKA 3G1MA 5AONA 1VI0A 2CW0F 2EFOA 3EDPA 2YX7A 3FMQA 2LD5A 4E6KG 2UZKA 1A36A 3UNGC 2DOAA 4HEA2 3CCRI 1E3OC 2ZJRF 1DP7P 1WRJA 3H9QA 2M45A 4ESBA 2EFWA 3CMYA 2IEKA 4KN7X 3OMYA 3KYLA 4G7OF 1MBKA 2QBYA 4O6JA 4G6DA 3ZOBA 2FOKA 3KZIC 5EGOB 2EA2A 4L9NA 2JTVA 4KYWA 4BH9A 4B44A 2DTZA 3RJPA 1HC8A 5E18F 2H09A 5C44J 3OYGA 2DFIA 1FJLA 5B3SH 4CYCB 1R1VA 3QP6A 2RQQA 5IP7J 5IP9J 5LHIA 5IY5H 4UY8I 2FSWA 2NS7A 1UG2A 2AQEA 2DA2A 2LK2A 2VJ4A 3QQAA 1X4OA 2DT6A 2CS3A 4FX0A 5E3LA 2NRAC 2L01A 3HG9A 2KZGA 2VQLA 2EBIA 2ZXIA 4B3AA 3ZPLA 4UB8C 1X1DA 2PJPA 3SEZA 1XSDA 3OYJA 2XGCA 3WTXC 3KCCA 2R7WA 2R4GA 3LSIA 2GAUA 1YS6A 5F08A 3I71A 1ZGWA 2VJJA 5CJ9A 4MTEA 1N75A 4FX4A 3E6BA 3EUKL 3BG3A 2K3PA 1E0EA 2RNGA 4OIOF 2VOPA 2DFHA 2DFEA 3N4MA 1MMNA 1ULYA 4XSXF 4ZZDA 2QCOA 1QZEA 2WTEA 2HVRA 2XAJA 4BJ6C 3OYIA 2H1LA 5E17F 1FBSA 3D0SA 3M1EA 5M5YJ 1IRXA 1D5VA 3BLYA 2IS4A 1EA3A 1W7PD 1FOYA 4D7NA 1MJBA 2L4AA 2P6TA 4BE0A 2K9NA 2UXNA 1ZH5A 1D3YA 1RESA 1B59A 2ZSHB 4RLFA 2DQLA 3ULQB 1WZ2A 2P5VA 3OYKA 1YRNB 4WK8F 1ZLJA 4PFPA 2XIGA 4MHGA 1OJLA 1ZR2A 3RPUA 2QQBA 3GCMA 4C9YA 3HEFA 2DBBA 2CUJA 2EFPA 3I4MJ 3K0LA 1LQ1A 2DA4A 4Y15A 1ZRDA 3KZYA 3GVAA 4MO7A 4MNUA 2IP2A 4IKFA 5CQEA 1BR1A 2HXOA 2RREA 1OMIA 3DKWA 4OMZA 1ZKGA 2X6OA 1FP1D 3S3NA 4XLNF 2W48A 4RGXA 3HOXJ 2K9QA 5K5QA 3HOZJ 2L9RA 2NXNB 1Z6RA 3SZPA 1WKMA 5HOOA 1TP4A 1B72A 5CLSA 4M6YA 1Q1HA 2R7QA 1R9TJ 2LLKA 2LY1A 3FHNA 4C30A 2VODA 2QLZA 1U5TB 4QIWN 4BE1A 2GXGA 3TL4X 4HX7A 1UB9A 1XX5A 5M5WJ 3D5RC 5HS9A 3ABKH 4L9TA 4A3IJ 1HW2A 4IHTA 3KE2A 2YUSA 5DCFA 3EUHA 3RQIA 1FOWA 1O3RA 3FISA 4G8XA 3K2ZA 1ZN2A 2Q1ZB 3F72A 4FCYA 1XMXA 2LTPA 3M1CA 5CPRB 4HX4A 4IJAA 2EA4A 5LGUA 1NG6A 2JWTA 5A2QR 1TL8A 5HNHA 4YFNF 3DTKA 1HA8A 4XL9A 3KFWX 2IS6A 1E2XA 1SFUA 5M5XJ 2LSOA 2OF7A 1I5ZA 1X3UA 2VXDA 2EB7A 1R4NB 3CUQA 3OYFA 3DKYA 2COBA 1PJRA 3FXLA 3VSKA 1X1CA 4DBQA 3R61A 3JRIA 5ICCA 2DMNA 2BZTA 4Y7NJ 3BR3A 3PM1A 1R23A 3HOUJ 1R5GA 2WAQN 4A69C 2GIVA 5CVVA 1XGOA 1S7EA 4WCGA 2O8KA 3SFIA 4BJ5C 2W25A 2DU9A 2Q0OA 4IRIA 2CG4A 1RUOA 4RDUA 1YOVB 3PNYA 2P5KA 3ZRGA 4N0BA 1Y1VJ 4BDYA 5CKTA 4RAGA 1Y8QB 4PSXA 3ABMH 4M9XA 3OYBA 4P96A 2KIQA 3VODA 2ELJA 2IGNA 1ZYRF 1OFCX 3QOPA 3AG4H 1VQ7I 2X4HA 2ZB9A 3I54A 4U88A 3FXJA 2E5ZA 1K61A 4KMUX 4GYIA 4F55A 3GTLJ 3CUOA 1Z9CA 5EEHA 1IDYA 3HUGA 1E3HA 5FD5A 4CO8A 2K4BA 4RM2A 1K4SA 1F43A 3L7WA 1TBXA 2HQNA 1RNLA 1HSJA 2QWWA 4QSHA 3FK6A 1UG0A 2QQ9A 2LVSA 3MKWB 5FLXK 4RGSA 5DCMB 1HKSA 3JTGA 3LFUA 2M0CA 1VQ5I 3GTMJ 5FLXR 3CCQI 1NG7A 3HSEA 1D0ZA 1TQIA 4I6ZA 2L02A 1F9NA 2K4JA 2NS0A 3KYDB 4CDGA 3TP0A 4ESJA 3BT9A 3FZVA 2OCCH 1G3TA 3GXOA 1FTTA 1S7OA 1I39A 1F1ZA 4A12A 1IF1A 4IHXA 4CA0A 2MVTA 3DEUA 2NVTJ 1JUMA 3JREA 1P9QC 2M34A 1X3ZB 4FQGA 2EFQA 1U6GA 2OV7A 3TDUC 1L3LA 3S8PA 4C3JJ 4LB5A 5LRSA 2XB0X 2JRTA 3C3WA 4F92B 1HF0A 3BPVA 2RAEA 2EPFA 4YG2F 1G3YA 2MABA 2XHKA 4Y13A 1ETWA 4MFDA 2IW5A 1IO2A 1EH8A 4KMFA 4ZYHA 3I58A 2E1CA 3BR2A 4U87A 4I99C 3R6SA 4E70A 1J0RA 2XGXA 4UV8A 3RDIA 1UELB 1SAUA 3OIQA 3WE3A 1I6HJ 3KEQA 1SANA 4Y4RA 3E6MA 2JQ7A 3U1KA 2R7FA 3H3VK 1V3FA 1RR8C 4OAZA 5KAIC 4LLLA 4QPOA 2VXZA 3H5NA 3HPHA 3TOAA 1IGNA 2YU3A 4PK4A 3RKWA 4DZPA 4CXFA 3MWMA 5HLGA 1R1TA 1LJ9A 2K7LA 2WBMA 3G73A 1ITYA 3LSPA 1SVLA 1LFBA 2K9LA 3DU5A 1CF7A 4A0XA 2W00A 3FWEA 5AIQA 1AU7A 1K79A 5J1YA 3VWBA 4XOPA 1IN7A 2KRFA 1KA8A 3FM3A 3ERED 1OCRH 1JUPA 2XRNA 3K9TA 3H35A 4MEXF 4BY1J 3V7SA 4UVCA 5FKOA 3LSGA 1K6YA 3VYTB 5BQTA 3RKQA 1OR7C 1PP7U 3MKYB 5FKKA 3LAPA 4YELA 2VBXA 2LF8A 4E7LA 1GUUA 3CQZJ 4KJZA 1JE8A 2L9VA 3QYBA 2JA5J 2E1NA 4GDFA 4LLNA 2F5CA 2E1MC 1G3SA 1VQ6I 2P0TA 2ELKA 1LFPA 4KNYA 2JK3A 1IUYA 3JAMR 3WTSC 1YLFA 3E5UA 4AD9A 4Y33A 1G8XA 5B66C 5J40A 1S7AA 3WTZA 5E3MA 1MSEC 2RNJA 1R6RA 4M3BA 4L9VA 2DPDA 4XQFA 5HNFA 2MUNA 2A5WA 3H0GJ 3C2HA 4U0WA 3ESWB 4FT8A 3MD2A 1QBJA 2CQ7A 1I3QJ 4ZJZA 3A01B 3ZCOA 4CICA 3REOA 2F4OB 4HDVA 1LDJA 2R7RA 4IHVA 2VKVA 3DEEA 1DGRM 1HKQA 3IAM2 4R8HA 4E7JA 3S17J 3ZQ7A 2DAOA 3DWLE 4LG0A 2BVLA 3CDIA 3CO7C 1UHWA 2LYCA 4IHSA 2E34A 3VYUB 5A2QK 1O3SA 1H9TA 2HS5A 3ISPA 3NWSA 4HF1A 4RM3A 1Y0UA 2WB1A 1P2FA 4RB3C 4I98B 2JUGA 1DPRA
chains in the Genus database with same CATH topology
1ZGAA 2Y75A 3WTVC 2WWYA 5L3BA 1KQ8A 1Z91A 1R00A 4EJTA 3E6CC 5JR3A 1FX7A 5E8IA 4MQ9F 3IRRA 2PMUA 4MTDA 4HQEA 1OYYA 1PDNC 4G94A 1DDNA 4UNOA 4ZYDA 5IT3A 3T8TA 2HKXA 4YFKF 4XSZF 3MEXA 2PLYA 2CYYA 4Q4ZF 3MCZA 1O3TA 2EV6A 4L18B 2VT3A 3RYPA 3IWFA 1BIBA 1Z1DA 4ASNA 3QRFF 3LQQA 2ZMEA 1I1SA 4U7BA 5DD4A 3IHUA 3WGGA 1U3EM 3WTTC 3IWZA 3HHHA 2MBFA 3M8EA 4HF2A 2KIUA 3P9KA 3U9GA 2HGCA 3T0YA 5L3CA 1T98A 2F5FA 3BOQA 5BS6A 2H6CA 2FF4A 1B4AA 3BJAA 2ZKZA 3TDZC 1Z7UA 2H27A 4UV9A 4M9ZA 4M72A 2UXXA 2Z5UA 1RI7A 2AXLA 3BY6A 3JW4A 2ZBKA 3L2CA 5FFXA 5A2QZ 4EQQA 5ILVA 5L3DA 2A6HF 2RDPA 1FNNA 1J59A 4MEYF 3M8FA 1BI1A 1MD0A 2OA4A 1KQ0A 4K2EA 3P7NA 4M74A 1T6SA 3S2WA 4GYGA 4GXOA 3HTSB 3GWZA 3TO6A 2DTRA 3M9AA 5FFZA 2STTA 3BDDA 3H92A 4HV6A 2ISYA 1AOYA 1SD7A 4S04A 4EV0A 1NHAA 1QZZA 4I7HA 2NNNA 5IT9K 4OINF 3T1BA 4EGZA 4KFCA 4KIBA 2P4WA 4RS8A 4Q47A 4HAMA 5BPDA 3MFKA 5F64A 3EYIA 4HQMA 1FC3A 1K78A 1WI9A 2M5WA 3GX4X 1D8JA 3ZMZA 5FD6A 3IKTA 3BP8A 3F3XA 5ICGA 3VEPA 1ZGJA 2A68F 3SFZA 2R3SA 1G4DA 4IVNA 3JAMK 5LHGA 2D45A 2P6SA 4P5OA 3M7GA 4ETSA 2BGCA 4QWQA 5HDNA 5DDGA 4OIQF 2JSCA 1T38A 4HF0A 3PFIA 1XDUA 3LA7A 4IF4A 1KYZA 4MGRA 1S29A 5KK1A 2F2EA 2XKOA 1IAWA 2O03A 2COMA 2VOOA 1LNWA 2RV8A 1XGSA 3FMSA 4A2UA 5H20A 4CHUA 4G9YA 2CFXA 4N9IA 1XSVA 4IRHA 1ON2A 4L5IA 1TQPA 2IVMA 5ICEA 4G6QA 1P4WA 2IPQX 4KICA 1J75A 3WE2A 4QLCU 3IKVA 3LQRA 3WU1B 2DW4A 5IT9Z 1R58A 1J9IA 2XUBA 4HYEA 1HSTA 1KQ9A 2M1BA 5LHHA 2ZMEB 1TTYA 2OD5A 2LF7A 4D0PA 1CF7B 2ZNZA 1BN5A 4Y17A 3TKYA 5ICFA 2Q2EA 2L54A 3KETA 2K27A 5CVJA 5JI6A 1XN7A 1B1BA 3RPQA 2NNYA 4G7HF 1S6LA 4I2OA 1ONVA 3EQLF 5DV5A 3HHGA 1ON1A 3GF2A 4CZZA 4HA8A 4ON0A 3ABUA 4P55A 2VBWA 1IN8A 2XAHA 1FWZA 2RQPA 1LDDA 2EV0A 3O6BB 2ISZA 1SD6A 3GFJA 4EJVA 2XV4S 1ZG3A 3K1MA 1L0OC 2VT2A 4A5MA 5L3GA 4RB0A 1P6RA 3FXRA 1RUNA 1U78A 4DQ2A 1JXSA 4A6EA 3CJNA 3I4PA 1IXSB 4LG0B 4LGWA 4LK1F 4PGGA 4HDUA 2B0LA 3COAC 4L0ZB 1LEAA 4KDPA 2O3FA 3HOSA 5K5OA 4A6DA 2KIMA 4PDKA 3WTWC 3KP4A 2DQRA 4ZYEA 5F6FA 1EH6A 2ESHA 2Z33A 1BI3A 4R79A 2P5LC 2D2WA 1T2KA 5LGNA 4HZFA 3E5QA 3LSTA 3GFLA 2ZXJA 2V9VA 3J81Z 4LD5A 4NQWA 4U7DA 2R7DA 2KKOA 3PQKA 1K7AA 2IA1A 1F4KA 3V8JA 3U2RA 5HVQC 3FM5A 1LB2A 1SMTA 3HRMA 4OMYA 1MKMA 3VFZA 3GUDA 1TLHB 1CGPA 3AAFA 2GQQA 3FMRA 3P9IA 2RN7A 4WXHA 1XSXA 2MLGA 3QPTA 2HWVA 3K1PA 3E5XA 1MJAA 5DD8A 3V8KA 2YSRA 2PFBA 5E1XA 1WWXA 1LDKB 3I53A 2HQRA 3CLOA 3GFMA 3L00A 1IRGA 2GA2A 2XAFA 5LEKA 1TW3A 5BMZA 4AWXB 2L4MA 2H6BA 4ENKA 3IRQA 2XAGA 3KP3A 4WWCA 5L3EA 2YX4A 2ZO4A 1B6AA 5CVIA 3KLNA 3ABTA 3JSOA 1R1UA 5DUKA 4ENJA 1H0MA 5FGMA 2JPBA 2V1DA 2G7HA 4AIJA 3KP2A 1QZYA 3C7JA 2BE5F 4L5JA 3ECHA 5LGTA 2ELHA 1HW5A 5DUIA 3C1DA 5DEQA 4EVIA 4RB2C 4BNCA 1JHFA 2E7WA 1BC7C 3L09A 2K02A 5D4RA 1RZ4A 5TJJA 3HRUA 2MLKA 2IRFG 2OQRA 2OZUA 5J6XA 4BAYA 3SXYA 5D8KB 3HSFA 1KU7A 1PP8F 2M8EA 3B02A 3WTYC 3BROA 4YIFA 2HYFA 3E97A 4ZH4F 2HTSA 3ZMUA 1BM9A 4IPAA 2XASA 5D4SA 1K78B 4L9JA 4OIRF 1HXDA 4BXUA 2HR3A 1U5TC 1YG2A 2HTJA 2RVCA 2HZTA 1U8RA 3ZMTA 3E6DA 4M6XA 4UUVA 3KEOA 2F5EA 2VONA 1XGNA 1IN4A 4I09A 1I1GA 3G3ZA 2A3SA 2QM3A 5ILSA 4HW0A 1T39A 3HIFA 1DPUA 2BV6A 1XDSA 1FPQA 4OIPF 1ZG1A 2EWNA 2FRHA 2RKHA 5LRRA 3ZN1A 3OV8A 1IXRC 4TV7A 2BEOA 2OU2A 5D5XB 2Z3YA 1HW1A 3IC7A 5HDKA 1IN6A 1EH7A 3QPHA 2FNAA 3CDHA 1WQ2A 3QAHA 1ZRFA 3SHFA 4HLYA 1H9GA 2V1XA 4A0YA 2Z9OA 5LEJA 2IA2A 3LAJA 1W5SA 1ZARA 2GZWA 4RAZA 1DUXC 3ZMSA 2V79A 5JHUA 1O7LA 3IL2A 2AS5F 1R36A 5HDGA 2GWRA 3I59A 3JTHA 5D5VB 4PGHA 4WXCA 3LWFA 1KU3A 4HBLA 1GXPA 2FEZA 2FXAA 1XB4A 4L0YB 3LFKA 3GLXA 4M9SA 1YTYA 4U0YA 3CUQB 3RYRA 2ADUA 3LA3A 3H3ZA 4GO1A 3O3KA 1QGPA 5KVRA 1FZPB 2QBYB 4FHTA 2QUFA 2QENA 3NEUA 3F21A 3J81K 5H6QA 1C0WA 1QPMA 2W24A 1MGTA 4HOBA 1YO5C 4I0BA 1BBYA 5ILUA 4UHTA 3DFGA 2KJCA 1A04A 3BWGA 2FE3A 1USTA 4JBAA 2EK5A 2P7VB 1ZLKA 3WTUC 1HQCA 2ZCWA 4GGGA 1FT9A 1ZRCA 1OYWA 5DCMA 1IXCA 1FYKA 5HS8A 4DNCA 3FX3A 1OYIA 2VC0A 2QZ8A 3DQVC 1UHMA 3WU0A 1E17A 2TDXA 2PN6A 2O6GE 2A69F 5LLQA 2VBYA 1BC8C 1KU2A 3GEZA 2PEXA 2FMLA 1IN5A 1EV7A 1IRFA 3N97A 5HLIA 4NHJA 1XCVA 4F7ZA 4JK1X 3T8RA 2G7UA 3MZHA 4A0ZA 4I0AA 5TRDA 2V6CA 2DLLA 5ERIA 2Z99A 1XD7A 1UCRA 3F8CA 5D5UB 4I02A 3TQNA 2CGPA 5FLXZ 2PBIA 3FXUA 2BYVE 3R0AA 3KZZA 2A5YB 5E1WA 1MDMA 3KP6A 1BJAA 3ML6A 4RGUA 2OAZA 1YQAA 3R0JA 3I0TA 3RIRA 3TO7A 3MZYA 1SAXA 4I01A 2OZ6A 3P9CA 2JPCA 1J5YA 2D1HA 2Y0MA 2YPRA 2IT0A 2FU4A 5D5WB 2MD5A 2WC2A 3ECOA 3R4KA 2M87A 4ENNA 1R22A 2J5OA 3GW2A 5ED4A 4XLPF 2FNPA 1SFEA 2M30A 3F6VA 4BHBA 3L9FA 2PG4A 1TNSA 4PCQA 5E8GA 4OOIA 5E1ZB 3RTRA 2H94A 5J8CA 1HBXG 3GFIA 3J80Z 5F1RA 4S05A 4UVBA 2VBZA 3TGNA 3DF8A 2FBHA 3Q5FA 3FF5A 3EYYA 4G7ZF 4LMYA 2LKPA 2HDCA 1T0FA 1Z05A 4Q5SF 1FLIA 4CGZA 3O2PE 2JZYA 1QO0D 3RI4A 4LLGF 1YW8A 4EM0B 4RGRA 5E20A 3HYIA 2HFHA 3BPXA 4B8XA 2DK8A 3Q9VA 3V8LA 2RC4A 3HRSA 2ETHA 1SFXA 2OQGA 1J2XA 1OR7A 2KIFA 1W5TA 2QYOA 4P9FA 1K6OA 2MA3A 5JVTA 2HYGD 2WV0A 1FBUA 3ZN0A 2FBKA 5HS7A 2K86A 1R7JA 3SQNA 2P7CB 4B09A 3V7RA 3ZP5A 3ZMVA 3F8NA 1O7FA 3ZMDA 2VN2A 1YW7A 2MH2A 5HLHA 2PMHA 1W7PA 3KLOA 1FYMA 2Y48A 5FO5A 3HRTA 5LBQA 3R60A 1D8KA 4LB6B 1YFHA 2NAZA 5CYVA 2VC1A 5EEGA 2A07F 1ODDA 2YR2A 3CO6C 2DPUA 5BPIA 4KA4A 3BJ6A 1FOKA 1U5TA 2O8XA 3MAJA 2XAQA 1XCBA 5AIPA 2ZNYA 2HOEA 1GXQA 4EMSA 4EM1A 1YIOA 5JFRA 2GA1A 4ESFA 4RB1A 4O3MA 3EETA 2CSOA 4NB5A 1P4XA 2FQ3A 1ZG5A 1J7KA 1S3JA 1FBQA 1LEBA 1JHHA 1BIAA 1MJ9A 2PQ8A 3BZ6A 1S8NA 5J8FA 3I59B 3I64A 4U0VA 4KIFA 4LFUA 4EM2A 3JSPA 2LNBA 1GVJA 2KJBA 4BQAA 3BJOA 5DYMA 2DK5A 3GZ5A 3H3UA 1B9NA 2CQKA 4HX8A 4MQVA 3QP5A 2JT1A 3ROUA 4Q48A 5L3FA 4EGYA 4WX9A 2VE9A 1TQMA 5D6EA 1FYLA 4YFXF 1STZA 1MZBA 3HOTA 2A61A 1XMAA 2DO7A 4H0EA 1O57A 2PI0A 4P9UA 1REPC 3VOEA 3VB2A 3W6JB 4BHCA 2D1VA 1W7PB 4BHPA 3KP5A 2W84A 3V7CA 4PZJA 1MDMB 4M71A 1PUEE 2RGVA 1FP2A 3HSRA 2MC3A 1W4MA 4EJUA 4KIGA 2V1UA 1B9MA 3CUQC 5K1YA 2EV5A 4KUMA 2O61A 1KGSA 1HKTA 1U2WA 2C6YA 1JGSA 2LDUA 4OU0A 3F6OA 3DV8A 3CTAA 2IA0A 3B73A 1IZ1A 3NRVA 4WF2A 2ACJA 2FA5A 2FMYA 2Q8KA 5BOXA 2EJRA 3WG9A 4AIKA 3HTUA 2ESNA 2XVCA 3DPTA 5D8LB 3OOPA 3K69A 1F5TA 1TW2A 3WODF 3T5XA 1G6NA 4JQFA 5FB2A 3W6KB 1FY7A 3J80K 1I6XA 4AIHA 4IXAA 4UXNA 1O3QA 2O0YA 3Q9SA 1UFMA 2G9WA 1ZREA 1ZAOA 2IJLA 2XKPA 2UWMA 2J5PA 1IW7F 2EFNA 2CO5A 1RIOH 1OPCA 4EJWA 2VE8A 2DI3A 4KN4X 2W57A 4N9HA 1ZHFA 4CYDA 1SD5A 3WGIA 1V4RA 2BBYA 3F22A 5D6FA 2STWA 1OKRA 4A5NA 3SZTA 1XMKA 3TOBA 1BI2A 1TNTA 4AVPA 5K5RA 1QNTA 2HEOA 4UVAA 2A6EF 3GO5A 4BYYA 1YW9A 2FBIA 1I27A 1AWCA 1SMYF 3FXQA 3C18A 3D5LA 3JAMZ 1GHCA 4M73A 1BI0A 3MQ0A 4EJOA 2ZJ2A 4WXDA 5CVRA 2OBPA 6PAXA 2XROA 2X0LA 3DXJF 2NYXA 2GXBA 3NQOA 3RKXA 1FSEA 1QQIA 2ZFWA 4HLXA 4XBFA 2HKOA 3TO9A 4ENMA 1VTNC 3F8BA 4KT5C 2QQAA 4Z2YA 3F8MA 4RAYA 3QU3A 3PQJA 2QVOA 1FSHA 4XRFA 1G3WA 1KYWA 3DPLC 1LVAA 1USSA 2CWEA 1XGMA 5H6RA 2W85A 1WSUA 3U1DA 4ZYGA 1BOAA 3GYHX 1Z6TA 4O5VA 2P8TA 3RKYA 1KU9A 3WGHA 3J7AO 2F5DA 4IRGA 2L3DA 3KP7A 4GCVA 1P92A 1R5HA 2E7XA 4R1HA 3I5UA 3QU6A 1P4AA 2MH9A 3DP7A 3V4GA 3K1NA 3F8FA 4YIIA 4LK0F 4HV5A 3E3VA 5CVUA 1YYVA 4ZZLA 3F23A 3LA2A 2DT5A 3FHZA 3GZ6A 1YS7A 1SD4A 4LJZF 3ELKA 5AONA 2CW0F 2EFOA 3EDPA 2YX7A 3FMQA 2UZKA 1DP7P 1WRJA 2M45A 4ESBA 2EFWA 4KN7X 4G7OF 2QBYA 4O6JA 4G6DA 2FOKA 2EA2A 4L9NA 2JTVA 4KYWA 4BH9A 3RJPA 5E18F 2H09A 2DFIA 1R1VA 3QP6A 5LHIA 2FSWA 4FX0A 2NRAC 2L01A 3ZPLA 2PJPA 1XSDA 3WTXC 3KCCA 2GAUA 1YS6A 3I71A 5CJ9A 4MTEA 4FX4A 3E6BA 4OIOF 2VOPA 3N4MA 1ULYA 4XSXF 4ZZDA 2WTEA 2XAJA 5E17F 1FBSA 3D0SA 3M1EA 1D5VA 1W7PD 1MJBA 2L4AA 2P6TA 2UXNA 1ZH5A 1D3YA 1B59A 2DQLA 3ULQB 2P5VA 4WK8F 1ZLJA 4MHGA 2XIGA 3RPUA 2QQBA 2DBBA 2EFPA 3K0LA 1LQ1A 4Y15A 1ZRDA 3KZYA 3GVAA 4MNUA 2IP2A 1OMIA 3DKWA 4OMZA 1FP1D 4XLNF 4RGXA 5K5QA 1Z6RA 3SZPA 1WKMA 5HOOA 5CLSA 4M6YA 1Q1HA 2VODA 2QLZA 1U5TB 2GXGA 4HX7A 1UB9A 5HS9A 4L9TA 1HW2A 4IHTA 3KE2A 5DCFA 3EUHA 1O3RA 4G8XA 3K2ZA 1ZN2A 3F72A 4HX4A 4IJAA 2EA4A 5LGUA 4YFNF 3KFWX 1E2XA 1SFUA 2LSOA 1I5ZA 1X3UA 2EB7A 3CUQA 3R61A 5ICCA 1R23A 1R5GA 2GIVA 5CVVA 1XGOA 4WCGA 2W25A 2DU9A 2Q0OA 4IRIA 2CG4A 1RUOA 2P5KA 4N0BA 4M9XA 4P96A 3VODA 1ZYRF 3QOPA 2X4HA 3I54A 4U88A 4KMUX 4GYIA 3CUOA 1Z9CA 5EEHA 3HUGA 5FD5A 4CO8A 2K4BA 3L7WA 1TBXA 2HQNA 1RNLA 1HSJA 2QWWA 2QQ9A 5FLXK 4RGSA 5DCMB 1HKSA 3JTGA 3HSEA 1TQIA 2L02A 1F9NA 2K4JA 2NS0A 4CDGA 4ESJA 3FZVA 1G3TA 3GXOA 1S7OA 1F1ZA 4A12A 1IF1A 3DEUA 1L3LA 2EFQA 1U6GA 3TDUC 4LB5A 5LRSA 2JRTA 3C3WA 3BPVA 4YG2F 1G3YA 2XHKA 4Y13A 2IW5A 1EH8A 4KMFA 4ZYHA 3I58A 2E1CA 3R6SA 4E70A 1J0RA 2XGXA 4UV8A 3RDIA 3WE3A 3KEQA 3E6MA 2R7FA 1V3FA 4LLLA 2VXZA 3TOAA 2YU3A 3RKWA 4CXFA 3MWMA 5HLGA 1R1TA 1LJ9A 2K7LA 3G73A 1CF7A 4A0XA 3FWEA 5AIQA 1K79A 1IN7A 2KRFA 1KA8A 3FM3A 3ERED 2XRNA 3K9TA 4MEXF 3V7SA 4UVCA 5BQTA 1PP7U 3LAPA 2VBXA 2LF8A 1JE8A 2E1NA 4LLNA 2F5CA 1G3SA 4KNYA 1IUYA 3WTSC 1YLFA 3E5UA 4AD9A 1S7AA 3WTZA 2RNJA 4L9VA 2DPDA 4U0WA 4FT8A 1QBJA 4CICA 3REOA 4HDVA 1LDJA 1HKQA 4R8HA 3ZQ7A 2DAOA 4LG0A 3CO7C 1UHWA 4IHSA 5A2QK 1O3SA 1H9TA 2HS5A 3ISPA 4HF1A 1Y0UA 1P2FA 4RB3C 4I98B 1DPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGA A;  2Y75 A;  3WTV C;  2WWY A;  5L3B A;  1KQ8 A;  1Z91 A;  1R00 A;  4EJT A;  3E6C C;  5JR3 A;  1FX7 A;  5E8I A;  4MQ9 F;  3IRR A;  2PMU A;  4MTD A;  4HQE A;  1OYY A;  1PDN C;  4G94 A;  1DDN A;  4UNO A;  4ZYD A;  5IT3 A;  3T8T A;  2HKX A;  4YFK F;  4XSZ F;  3MEX A;  2PLY A;  2CYY A;  4Q4Z F;  3MCZ A;  1O3T A;  2EV6 A;  4L18 B;  2VT3 A;  3RYP A;  3IWF A;  1BIB A;  1Z1D A;  4ASN A;  3QRF F;  3LQQ A;  2ZME A;  1I1S A;  4U7B A;  5DD4 A;  3IHU A;  3WGG A;  1U3E M;  3WTT C;  3IWZ A;  3HHH A;  2MBF A;  3M8E A;  4HF2 A;  2KIU A;  3P9K A;  3U9G A;  2HGC A;  3T0Y A;  5L3C A;  1T98 A;  2F5F A;  3BOQ A;  5BS6 A;  2H6C A;  2FF4 A;  1B4A A;  3BJA A;  2ZKZ A;  3TDZ C;  1Z7U A;  2H27 A;  4UV9 A;  4M9Z A;  4M72 A;  2UXX A;  2Z5U A;  1RI7 A;  2AXL A;  3BY6 A;  3JW4 A;  2ZBK A;  3L2C A;  5FFX A;  5A2Q Z;  4EQQ A;  5ILV A;  5L3D A;  2A6H F;  2RDP A;  1FNN A;  1J59 A;  4MEY F;  3M8F A;  1BI1 A;  1MD0 A;  2OA4 A;  1KQ0 A;  4K2E A;  3P7N A;  4M74 A;  1T6S A;  3S2W A;  4GYG A;  4GXO A;  3HTS B;  3GWZ A;  3TO6 A;  2DTR A;  3M9A A;  5FFZ A;  2STT A;  3BDD A;  3H92 A;  4HV6 A;  2ISY A;  1AOY A;  1SD7 A;  4S04 A;  4EV0 A;  1NHA A;  1QZZ A;  4I7H A;  2NNN A;  5IT9 K;  4OIN F;  3T1B A;  4EGZ A;  4KFC A;  4KIB A;  2P4W A;  4RS8 A;  4Q47 A;  4HAM A;  5BPD A;  3MFK A;  5F64 A;  3EYI A;  4HQM A;  1FC3 A;  1K78 A;  1WI9 A;  2M5W A;  3GX4 X;  1D8J A;  3ZMZ A;  5FD6 A;  3IKT A;  3BP8 A;  3F3X A;  5ICG A;  3VEP A;  1ZGJ A;  2A68 F;  3SFZ A;  2R3S A;  1G4D A;  4IVN A;  3JAM K;  5LHG A;  2D45 A;  2P6S A;  4P5O A;  3M7G A;  4ETS A;  2BGC A;  4QWQ A;  5HDN A;  5DDG A;  4OIQ F;  2JSC A;  1T38 A;  4HF0 A;  3PFI A;  1XDU A;  3LA7 A;  4IF4 A;  1KYZ A;  4MGR A;  1S29 A;  5KK1 A;  2F2E A;  2XKO A;  1IAW A;  2O03 A;  2COM A;  2VOO A;  1LNW A;  2RV8 A;  1XGS A;  3FMS A;  4A2U A;  5H20 A;  4CHU A;  4G9Y A;  2CFX A;  4N9I A;  1XSV A;  4IRH A;  1ON2 A;  4L5I A;  1TQP A;  2IVM A;  5ICE A;  4G6Q A;  1P4W A;  2IPQ X;  4KIC A;  1J75 A;  3WE2 A;  4QLC U;  3IKV A;  3LQR A;  3WU1 B;  2DW4 A;  5IT9 Z;  1R58 A;  1J9I A;  2XUB A;  4HYE A;  1HST A;  1KQ9 A;  2M1B A;  5LHH A;  2ZME B;  1TTY A;  2OD5 A;  2LF7 A;  4D0P A;  1CF7 B;  2ZNZ A;  1BN5 A;  4Y17 A;  3TKY A;  5ICF A;  2Q2E A;  2L54 A;  3KET A;  2K27 A;  5CVJ A;  5JI6 A;  1XN7 A;  1B1B A;  3RPQ A;  2NNY A;  4G7H F;  1S6L A;  4I2O A;  1ONV A;  3EQL F;  5DV5 A;  3HHG A;  1ON1 A;  3GF2 A;  4CZZ A;  4HA8 A;  4ON0 A;  3ABU A;  4P55 A;  2VBW A;  1IN8 A;  2XAH A;  1FWZ A;  2RQP A;  1LDD A;  2EV0 A;  3O6B B;  2ISZ A;  1SD6 A;  3GFJ A;  4EJV A;  2XV4 S;  1ZG3 A;  3K1M A;  1L0O C;  2VT2 A;  4A5M A;  5L3G A;  4RB0 A;  1P6R A;  3FXR A;  1RUN A;  1U78 A;  4DQ2 A;  1JXS A;  4A6E A;  3CJN A;  3I4P A;  1IXS B;  4LG0 B;  4LGW A;  4LK1 F;  4PGG A;  4HDU A;  2B0L A;  3COA C;  4L0Z B;  1LEA A;  4KDP A;  2O3F A;  3HOS A;  5K5O A;  4A6D A;  2KIM A;  4PDK A;  3WTW C;  3KP4 A;  2DQR A;  4ZYE A;  5F6F A;  1EH6 A;  2ESH A;  2Z33 A;  1BI3 A;  4R79 A;  2P5L C;  2D2W A;  1T2K A;  5LGN A;  4HZF A;  3E5Q A;  3LST A;  3GFL A;  2ZXJ A;  2V9V A;  3J81 Z;  4LD5 A;  4NQW A;  4U7D A;  2R7D A;  2KKO A;  3PQK A;  1K7A A;  2IA1 A;  1F4K A;  3V8J A;  3U2R A;  5HVQ C;  3FM5 A;  1LB2 A;  1SMT A;  3HRM A;  4OMY A;  1MKM A;  3VFZ A;  3GUD A;  1TLH B;  1CGP A;  3AAF A;  2GQQ A;  3FMR A;  3P9I A;  2RN7 A;  4WXH A;  1XSX A;  2MLG A;  3QPT A;  2HWV A;  3K1P A;  3E5X A;  1MJA A;  5DD8 A;  3V8K A;  2YSR A;  2PFB A;  5E1X A;  1WWX A;  1LDK B;  3I53 A;  2HQR A;  3CLO A;  3GFM A;  3L00 A;  1IRG A;  2GA2 A;  2XAF A;  5LEK A;  1TW3 A;  5BMZ A;  4AWX B;  2L4M A;  2H6B A;  4ENK A;  3IRQ A;  2XAG A;  3KP3 A;  4WWC A;  5L3E A;  2YX4 A;  2ZO4 A;  1B6A A;  5CVI A;  3KLN A;  3ABT A;  3JSO A;  1R1U A;  5DUK A;  4ENJ A;  1H0M A;  5FGM A;  2JPB A;  2V1D A;  2G7H A;  4AIJ A;  3KP2 A;  1QZY A;  3C7J A;  2BE5 F;  4L5J A;  3ECH A;  5LGT A;  2ELH A;  1HW5 A;  5DUI A;  3C1D A;  5DEQ A;  4EVI A;  4RB2 C;  4BNC A;  1JHF A;  2E7W A;  1BC7 C;  3L09 A;  2K02 A;  5D4R A;  1RZ4 A;  5TJJ A;  3HRU A;  2MLK A;  2IRF G;  2OQR A;  2OZU A;  5J6X A;  4BAY A;  3SXY A;  5D8K B;  3HSF A;  1KU7 A;  1PP8 F;  2M8E A;  3B02 A;  3WTY C;  3BRO A;  4YIF A;  2HYF A;  3E97 A;  4ZH4 F;  2HTS A;  3ZMU A;  1BM9 A;  4IPA A;  2XAS A;  5D4S A;  1K78 B;  4L9J A;  4OIR F;  1HXD A;  4BXU A;  2HR3 A;  1U5T C;  1YG2 A;  2HTJ A;  2RVC A;  2HZT A;  1U8R A;  3ZMT A;  3E6D A;  4M6X A;  4UUV A;  3KEO A;  2F5E A;  2VON A;  1XGN A;  1IN4 A;  4I09 A;  1I1G A;  3G3Z A;  2A3S A;  2QM3 A;  5ILS A;  4HW0 A;  1T39 A;  3HIF A;  1DPU A;  2BV6 A;  1XDS A;  1FPQ A;  4OIP F;  1ZG1 A;  2EWN A;  2FRH A;  2RKH A;  5LRR A;  3ZN1 A;  3OV8 A;  1IXR C;  4TV7 A;  2BEO A;  2OU2 A;  5D5X B;  2Z3Y A;  1HW1 A;  3IC7 A;  5HDK A;  1IN6 A;  1EH7 A;  3QPH A;  2FNA A;  3CDH A;  1WQ2 A;  3QAH A;  1ZRF A;  3SHF A;  4HLY A;  1H9G A;  2V1X A;  4A0Y A;  2Z9O A;  5LEJ A;  2IA2 A;  3LAJ A;  1W5S A;  1ZAR A;  2GZW A;  4RAZ A;  1DUX C;  3ZMS A;  2V79 A;  5JHU A;  1O7L A;  3IL2 A;  2AS5 F;  1R36 A;  5HDG A;  2GWR A;  3I59 A;  3JTH A;  5D5V B;  4PGH A;  4WXC A;  3LWF A;  1KU3 A;  4HBL A;  1GXP A;  2FEZ A;  2FXA A;  1XB4 A;  4L0Y B;  3LFK A;  3GLX A;  4M9S A;  1YTY A;  4U0Y A;  3CUQ B;  3RYR A;  2ADU A;  3LA3 A;  3H3Z A;  4GO1 A;  3O3K A;  1QGP A;  5KVR A;  1FZP B;  2QBY B;  4FHT A;  2QUF A;  2QEN A;  3NEU A;  3F21 A;  3J81 K;  5H6Q A;  1C0W A;  1QPM A;  2W24 A;  1MGT A;  4HOB A;  1YO5 C;  4I0B A;  1BBY A;  5ILU A;  4UHT A;  3DFG A;  2KJC A;  1A04 A;  3BWG A;  2FE3 A;  1UST A;  4JBA A;  2EK5 A;  2P7V B;  1ZLK A;  3WTU C;  1HQC A;  2ZCW A;  4GGG A;  1FT9 A;  1ZRC A;  1OYW A;  5DCM A;  1IXC A;  1FYK A;  5HS8 A;  4DNC A;  3FX3 A;  1OYI A;  2VC0 A;  2QZ8 A;  3DQV C;  1UHM A;  3WU0 A;  1E17 A;  2TDX A;  2PN6 A;  2O6G E;  2A69 F;  5LLQ A;  2VBY A;  1BC8 C;  1KU2 A;  3GEZ A;  2PEX A;  2FML A;  1IN5 A;  1EV7 A;  1IRF A;  3N97 A;  5HLI A;  4NHJ A;  1XCV A;  4F7Z A;  4JK1 X;  3T8R A;  2G7U A;  3MZH A;  4A0Z A;  4I0A A;  5TRD A;  2V6C A;  2DLL A;  5ERI A;  2Z99 A;  1XD7 A;  1UCR A;  3F8C A;  5D5U B;  4I02 A;  3TQN A;  2CGP A;  5FLX Z;  2PBI A;  3FXU A;  2BYV E;  3R0A A;  3KZZ A;  2A5Y B;  5E1W A;  1MDM A;  3KP6 A;  1BJA A;  3ML6 A;  4RGU A;  2OAZ A;  1YQA A;  3R0J A;  3I0T A;  3RIR A;  3TO7 A;  3MZY A;  1SAX A;  4I01 A;  2OZ6 A;  3P9C A;  2JPC A;  1J5Y A;  2D1H A;  2Y0M A;  2YPR A;  2IT0 A;  2FU4 A;  5D5W B;  2MD5 A;  2WC2 A;  3ECO A;  3R4K A;  2M87 A;  4ENN A;  1R22 A;  2J5O A;  3GW2 A;  5ED4 A;  4XLP F;  2FNP A;  1SFE A;  2M30 A;  3F6V A;  4BHB A;  3L9F A;  2PG4 A;  1TNS A;  4PCQ A;  5E8G A;  4OOI A;  5E1Z B;  3RTR A;  2H94 A;  5J8C A;  1HBX G;  3GFI A;  3J80 Z;  5F1R A;  4S05 A;  4UVB A;  2VBZ A;  3TGN A;  3DF8 A;  2FBH A;  3Q5F A;  3FF5 A;  3EYY A;  4G7Z F;  4LMY A;  2LKP A;  2HDC A;  1T0F A;  1Z05 A;  4Q5S F;  1FLI A;  4CGZ A;  3O2P E;  2JZY A;  1QO0 D;  3RI4 A;  4LLG F;  1YW8 A;  4EM0 B;  4RGR A;  5E20 A;  3HYI A;  2HFH A;  3BPX A;  4B8X A;  2DK8 A;  3Q9V A;  3V8L A;  2RC4 A;  3HRS A;  2ETH A;  1SFX A;  2OQG A;  1J2X A;  1OR7 A;  2KIF A;  1W5T A;  2QYO A;  4P9F A;  1K6O A;  2MA3 A;  5JVT A;  2HYG D;  2WV0 A;  1FBU A;  3ZN0 A;  2FBK A;  5HS7 A;  2K86 A;  1R7J A;  3SQN A;  2P7C B;  4B09 A;  3V7R A;  3ZP5 A;  3ZMV A;  3F8N A;  1O7F A;  3ZMD A;  2VN2 A;  1YW7 A;  2MH2 A;  5HLH A;  2PMH A;  1W7P A;  3KLO A;  1FYM A;  2Y48 A;  5FO5 A;  3HRT A;  5LBQ A;  3R60 A;  1D8K A;  4LB6 B;  1YFH A;  2NAZ A;  5CYV A;  2VC1 A;  5EEG A;  2A07 F;  1ODD A;  2YR2 A;  3CO6 C;  2DPU A;  5BPI A;  4KA4 A;  3BJ6 A;  1FOK A;  1U5T A;  2O8X A;  3MAJ A;  2XAQ A;  1XCB A;  5AIP A;  2ZNY A;  2HOE A;  1GXQ A;  4EMS A;  4EM1 A;  1YIO A;  5JFR A;  2GA1 A;  4ESF A;  4RB1 A;  4O3M A;  3EET A;  2CSO A;  4NB5 A;  1P4X A;  2FQ3 A;  1ZG5 A;  1J7K A;  1S3J A;  1FBQ A;  1LEB A;  1JHH A;  1BIA A;  1MJ9 A;  2PQ8 A;  3BZ6 A;  1S8N A;  5J8F A;  3I59 B;  3I64 A;  4U0V A;  4KIF A;  4LFU A;  4EM2 A;  3JSP A;  2LNB A;  1GVJ A;  2KJB A;  4BQA A;  3BJO A;  5DYM A;  2DK5 A;  3GZ5 A;  3H3U A;  1B9N A;  2CQK A;  4HX8 A;  4MQV A;  3QP5 A;  2JT1 A;  3ROU A;  4Q48 A;  5L3F A;  4EGY A;  4WX9 A;  2VE9 A;  1TQM A;  5D6E A;  1FYL A;  4YFX F;  1STZ A;  1MZB A;  3HOT A;  2A61 A;  1XMA A;  2DO7 A;  4H0E A;  1O57 A;  2PI0 A;  4P9U A;  1REP C;  3VOE A;  3VB2 A;  3W6J B;  4BHC A;  2D1V A;  1W7P B;  4BHP A;  3KP5 A;  2W84 A;  3V7C A;  4PZJ A;  1MDM B;  4M71 A;  1PUE E;  2RGV A;  1FP2 A;  3HSR A;  2MC3 A;  1W4M A;  4EJU A;  4KIG A;  2V1U A;  1B9M A;  3CUQ C;  5K1Y A;  2EV5 A;  4KUM A;  2O61 A;  1KGS A;  1HKT A;  1U2W A;  2C6Y A;  1JGS A;  2LDU A;  4OU0 A;  3F6O A;  3DV8 A;  3CTA A;  2IA0 A;  3B73 A;  1IZ1 A;  3NRV A;  4WF2 A;  2ACJ A;  2FA5 A;  2FMY A;  2Q8K A;  5BOX A;  2EJR A;  3WG9 A;  4AIK A;  3HTU A;  2ESN A;  2XVC A;  3DPT A;  5D8L B;  3OOP A;  3K69 A;  1F5T A;  1TW2 A;  3WOD F;  3T5X A;  1G6N A;  4JQF A;  5FB2 A;  3W6K B;  1FY7 A;  3J80 K;  1I6X A;  4AIH A;  4IXA A;  4UXN A;  1O3Q A;  2O0Y A;  3Q9S A;  1UFM A;  2G9W A;  1ZRE A;  1ZAO A;  2IJL A;  2XKP A;  2UWM A;  2J5P A;  1IW7 F;  2EFN A;  2CO5 A;  1RIO H;  1OPC A;  4EJW A;  2VE8 A;  2DI3 A;  4KN4 X;  2W57 A;  4N9H A;  1ZHF A;  4CYD A;  1SD5 A;  3WGI A;  1V4R A;  2BBY A;  3F22 A;  5D6F A;  2STW A;  1OKR A;  4A5N A;  3SZT A;  1XMK A;  3TOB A;  1BI2 A;  1TNT A;  4AVP A;  5K5R A;  1QNT A;  2HEO A;  4UVA A;  2A6E F;  3GO5 A;  4BYY A;  1YW9 A;  2FBI A;  1I27 A;  1AWC A;  1SMY F;  3FXQ A;  3C18 A;  3D5L A;  3JAM Z;  1GHC A;  4M73 A;  1BI0 A;  3MQ0 A;  4EJO A;  2ZJ2 A;  4WXD A;  5CVR A;  2OBP A;  6PAX A;  2XRO A;  2X0L A;  3DXJ F;  2NYX A;  2GXB A;  3NQO A;  3RKX A;  1FSE A;  1QQI A;  2ZFW A;  4HLX A;  4XBF A;  2HKO A;  3TO9 A;  4ENM A;  1VTN C;  3F8B A;  4KT5 C;  2QQA A;  4Z2Y A;  3F8M A;  4RAY A;  3QU3 A;  3PQJ A;  2QVO A;  1FSH A;  4XRF A;  1G3W A;  1KYW A;  3DPL C;  1LVA A;  1USS A;  2CWE A;  1XGM A;  5H6R A;  2W85 A;  1WSU A;  3U1D A;  4ZYG A;  1BOA A;  3GYH X;  1Z6T A;  4O5V A;  2P8T A;  3RKY A;  1KU9 A;  3WGH A;  3J7A O;  2F5D A;  4IRG A;  2L3D A;  3KP7 A;  4GCV A;  1P92 A;  1R5H A;  2E7X A;  4R1H A;  3I5U A;  3QU6 A;  1P4A A;  2MH9 A;  3DP7 A;  3V4G A;  3K1N A;  3F8F A;  4YII A;  4LK0 F;  4HV5 A;  3E3V A;  5CVU A;  1YYV A;  4ZZL A;  3F23 A;  3LA2 A;  2DT5 A;  3FHZ A;  3GZ6 A;  1YS7 A;  1SD4 A;  4LJZ F;  3ELK A;  5AON A;  2CW0 F;  2EFO A;  3EDP A;  2YX7 A;  3FMQ A;  2UZK A;  1DP7 P;  1WRJ A;  2M45 A;  4ESB A;  2EFW A;  4KN7 X;  4G7O F;  2QBY A;  4O6J A;  4G6D A;  2FOK A;  2EA2 A;  4L9N A;  2JTV A;  4KYW A;  4BH9 A;  3RJP A;  5E18 F;  2H09 A;  2DFI A;  1R1V A;  3QP6 A;  5LHI A;  2FSW A;  4FX0 A;  2NRA C;  2L01 A;  3ZPL A;  2PJP A;  1XSD A;  3WTX C;  3KCC A;  2GAU A;  1YS6 A;  3I71 A;  5CJ9 A;  4MTE A;  4FX4 A;  3E6B A;  4OIO F;  2VOP A;  3N4M A;  1ULY A;  4XSX F;  4ZZD A;  2WTE A;  2XAJ A;  5E17 F;  1FBS A;  3D0S A;  3M1E A;  1D5V A;  1W7P D;  1MJB A;  2L4A A;  2P6T A;  2UXN A;  1ZH5 A;  1D3Y A;  1B59 A;  2DQL A;  3ULQ B;  2P5V A;  4WK8 F;  1ZLJ A;  4MHG A;  2XIG A;  3RPU A;  2QQB A;  2DBB A;  2EFP A;  3K0L A;  1LQ1 A;  4Y15 A;  1ZRD A;  3KZY A;  3GVA A;  4MNU A;  2IP2 A;  1OMI A;  3DKW A;  4OMZ A;  1FP1 D;  4XLN F;  4RGX A;  5K5Q A;  1Z6R A;  3SZP A;  1WKM A;  5HOO A;  5CLS A;  4M6Y A;  1Q1H A;  2VOD A;  2QLZ A;  1U5T B;  2GXG A;  4HX7 A;  1UB9 A;  5HS9 A;  4L9T A;  1HW2 A;  4IHT A;  3KE2 A;  5DCF A;  3EUH A;  1O3R A;  4G8X A;  3K2Z A;  1ZN2 A;  3F72 A;  4HX4 A;  4IJA A;  2EA4 A;  5LGU A;  4YFN F;  3KFW X;  1E2X A;  1SFU A;  2LSO A;  1I5Z A;  1X3U A;  2EB7 A;  3CUQ A;  3R61 A;  5ICC A;  1R23 A;  1R5G A;  2GIV A;  5CVV A;  1XGO A;  4WCG A;  2W25 A;  2DU9 A;  2Q0O A;  4IRI A;  2CG4 A;  1RUO A;  2P5K A;  4N0B A;  4M9X A;  4P96 A;  3VOD A;  1ZYR F;  3QOP A;  2X4H A;  3I54 A;  4U88 A;  4KMU X;  4GYI A;  3CUO A;  1Z9C A;  5EEH A;  3HUG A;  5FD5 A;  4CO8 A;  2K4B A;  3L7W A;  1TBX A;  2HQN A;  1RNL A;  1HSJ A;  2QWW A;  2QQ9 A;  5FLX K;  4RGS A;  5DCM B;  1HKS A;  3JTG A;  3HSE A;  1TQI A;  2L02 A;  1F9N A;  2K4J A;  2NS0 A;  4CDG A;  4ESJ A;  3FZV A;  1G3T A;  3GXO A;  1S7O A;  1F1Z A;  4A12 A;  1IF1 A;  3DEU A;  1L3L A;  2EFQ A;  1U6G A;  3TDU C;  4LB5 A;  5LRS A;  2JRT A;  3C3W A;  3BPV A;  4YG2 F;  1G3Y A;  2XHK A;  4Y13 A;  2IW5 A;  1EH8 A;  4KMF A;  4ZYH A;  3I58 A;  2E1C A;  3R6S A;  4E70 A;  1J0R A;  2XGX A;  4UV8 A;  3RDI A;  3WE3 A;  3KEQ A;  3E6M A;  2R7F A;  1V3F A;  4LLL A;  2VXZ A;  3TOA A;  2YU3 A;  3RKW A;  4CXF A;  3MWM A;  5HLG A;  1R1T A;  1LJ9 A;  2K7L A;  3G73 A;  1CF7 A;  4A0X A;  3FWE A;  5AIQ A;  1K79 A;  1IN7 A;  2KRF A;  1KA8 A;  3FM3 A;  3ERE D;  2XRN A;  3K9T A;  4MEX F;  3V7S A;  4UVC A;  5BQT A;  1PP7 U;  3LAP A;  2VBX A;  2LF8 A;  1JE8 A;  2E1N A;  4LLN A;  2F5C A;  1G3S A;  4KNY A;  1IUY A;  3WTS C;  1YLF A;  3E5U A;  4AD9 A;  1S7A A;  3WTZ A;  2RNJ A;  4L9V A;  2DPD A;  4U0W A;  4FT8 A;  1QBJ A;  4CIC A;  3REO A;  4HDV A;  1LDJ A;  1HKQ A;  4R8H A;  3ZQ7 A;  2DAO A;  4LG0 A;  3CO7 C;  1UHW A;  4IHS A;  5A2Q K;  1O3S A;  1H9T A;  2HS5 A;  3ISP A;  4HF1 A;  1Y0U A;  1P2F A;  4RB3 C;  4I98 B;  1DPR A; 
#chains in the Genus database with same CATH topology
 1ZGA A;  2Y75 A;  3WTV C;  2WWY A;  5L3B A;  5EF6 A;  4A93 J;  1KQ8 A;  1Z91 A;  1VZ0 A;  1R00 A;  4EJT A;  4FE4 A;  3E6C C;  4XLC A;  2LG4 A;  2GBY A;  3VDX A;  2L2O A;  1FX7 A;  5JR3 A;  4I76 A;  3G2B A;  2IAI A;  5E8I A;  1XS9 A;  2CV0 A;  3HKZ A;  4YIR X;  4MQ9 F;  3LSM A;  3IRR A;  3SZG A;  4LOC A;  3BR5 A;  2PMU A;  3HB9 A;  1D5Y A;  3CP2 A;  5EJC A;  4MTD A;  1YX5 A;  4HQE A;  4M3D A;  1XTA A;  1OYY A;  1D1B A;  4YRV A;  3JCU C;  1PDN C;  4G94 A;  1DDN A;  4UNO A;  4ZYD A;  3MKZ A;  2DA5 A;  3T8T A;  5IT3 A;  4CYC A;  2HKX A;  2H1K A;  4YFK F;  3CCM I;  4XSZ F;  2XB5 A;  3MEX A;  4E7I A;  2CYY A;  2PLY A;  3HGG A;  4Y52 J;  4CH7 A;  4Q4Z F;  3HDD A;  3MCZ A;  1O3T A;  1VQM I;  2EV6 A;  4L18 B;  2VT3 A;  3Q3S A;  2MG4 A;  3RYP A;  4BY7 J;  1SVO A;  3IWF A;  1BIB A;  1MBH A;  2BW3 B;  2HOT A;  3SDB A;  1S72 I;  1Z1D A;  1GLN A;  1PVE A;  2CUZ A;  2QGU A;  3FKI J;  4ASN A;  3QRF F;  1OCC H;  3OYL A;  3LQQ A;  2ZME A;  1I1S A;  3CF2 A;  4FE7 A;  2K9M A;  1FIP A;  2XF7 A;  4U7B A;  5DD4 A;  3IHU A;  3WGG A;  4ZTF A;  2NVX J;  1U3E M;  3WTT C;  3IWZ A;  3HHH A;  2LRD A;  2MBF A;  3IAS 2;  3M8E A;  3ZXS A;  4HF2 A;  2KIU A;  3P9K A;  3K4N A;  1M1E B;  3U9G A;  2HGC A;  3T0Y A;  5L3C A;  4KIS A;  1T98 A;  1R71 A;  2F5F A;  3BOQ A;  2M9H A;  1MH3 A;  4IEJ A;  5BS6 A;  2H6C A;  1WJF A;  2FF4 A;  1W0T A;  1B4A A;  3BJA A;  1TZL A;  2M3A A;  3DLL F;  2KT0 A;  2ZKZ A;  3TDZ C;  4HST A;  1Z7U A;  2H27 A;  4GFB A;  1SFK A;  2DFF A;  4UV9 A;  4XR6 A;  3PJR A;  2KPM A;  2JA8 J;  4M9Z A;  2XF5 A;  4M72 A;  3S3M A;  3DBR B;  2UXX A;  2Z5U A;  4N4N B;  3KIO A;  1RI7 A;  1OLT A;  2AXL A;  4ZYA A;  3BY6 A;  3JW4 A;  2ME6 A;  2HPI A;  2WA0 A;  2ZBK A;  3L2C A;  2MZ4 A;  3MVP A;  1UAA A;  5FFX A;  2WB1 N;  5A2Q Z;  2X6Y A;  4EQQ A;  5ILV A;  5L3D A;  2A6H F;  5F0H A;  2RDP A;  1FNN A;  1XC5 A;  4MEY F;  1J59 A;  3M8F A;  1BI1 A;  2LC2 A;  1MD0 A;  4LIV A;  3AKZ A;  1R4M B;  1KQ0 A;  2OA4 A;  3KYC B;  1RKT A;  4K2E A;  3P7N A;  4M74 A;  5FKM A;  1T6S A;  3OSG A;  2QKM B;  3S2W A;  4GYG A;  4GXO A;  3HTS B;  2VIX A;  3GWZ A;  5K7Z A;  3H0D A;  3TO6 A;  4F3Q A;  1KZH A;  2W82 A;  2DTR A;  2F48 A;  3M9A A;  1GV5 A;  5FFZ A;  5LFA A;  1XG1 A;  3G1L A;  2BY0 A;  1WJE A;  2STT A;  3BDD A;  4E7Z A;  3H92 A;  4HV6 A;  2ISY A;  1AOY A;  3CMA I;  1SD7 A;  3K70 D;  3HPG A;  4S04 A;  1PUF A;  4CCO A;  4EV0 A;  3DTI A;  1NHA A;  1QZZ A;  4S0H B;  3EUH C;  4I7H A;  2DOE A;  4XNF A;  2NNN A;  5IT9 K;  4OIN F;  3SDG A;  4A3D J;  3T1B A;  4EGZ A;  1WGX A;  4KFC A;  2X6X A;  4KIB A;  2P4W A;  4RS8 A;  4Q47 A;  4HAM A;  4M3F A;  1YE9 A;  4NUB A;  5BPD A;  3CCY A;  3DCF A;  3MFK A;  5F64 A;  2LP0 A;  3EYI A;  3N05 A;  2OTL I;  4HQM A;  3I9V 2;  1FC3 A;  1K78 A;  3OY9 A;  4IHW A;  2KIS A;  1WI9 A;  2M5W A;  3A03 A;  4AVZ A;  2PJR A;  3GX4 X;  1LKX A;  1D8J A;  3ZMZ A;  5FD6 A;  3IKT A;  4QTR A;  3BP8 A;  3F3X A;  5ICG A;  2X9D A;  3DU6 A;  2Y69 H;  3K70 C;  3VEP A;  1ZGJ A;  2A68 F;  3SFZ A;  2EZL A;  2R3S A;  1G4D A;  4IVN A;  3JAM K;  5LHG A;  2D45 A;  2P6S A;  4P5O A;  3CF5 F;  3M7G A;  4ETS A;  3H5A A;  1IG7 A;  3PFY A;  2BGC A;  3FXM A;  1PYV A;  2DXI A;  4FET A;  4QWQ A;  5HDN A;  2EZI A;  5DDG A;  2KP6 A;  2X85 A;  3FBI B;  4OIQ F;  2JSC A;  1T38 A;  2R7V A;  1FIA A;  4HF0 A;  3PFI A;  3E0J B;  1XDU A;  3LA7 A;  1ORK A;  4IF4 A;  1KYZ A;  4MGR A;  1S29 A;  5KK1 A;  2F2E A;  1A5J A;  3J7A W;  2XKO A;  1IAW A;  4BE2 A;  3JRB A;  2O03 A;  3LOC A;  4XLA A;  2COM A;  2VPR A;  2DDB A;  2L5Q A;  2VOO A;  3BCA A;  1LNW A;  2RV8 A;  3CCV I;  4P1W A;  1XGS A;  4HNV A;  3B6A A;  2VQG A;  2R7S A;  3FMS A;  2KRH A;  4A2U A;  5H20 A;  4CHU A;  2DYS H;  3VYS B;  2IGK A;  2QA4 I;  2VJI A;  2OUM A;  4G9Y A;  5J4Y A;  1MMA A;  2CFX A;  2E60 A;  1V5E A;  4N9I A;  1XSV A;  2EIL H;  2Y9Z A;  4IRH A;  1HDP A;  1ON2 A;  3HJE A;  5TGT A;  4A3E J;  4L5I A;  1TQP A;  2IVM A;  4XM3 A;  5ICE A;  4G6Q A;  1P4W A;  2IPQ X;  1T08 B;  4KIC A;  3PNV A;  1J75 A;  3WE2 A;  4QLC U;  1FTZ A;  4B47 A;  3IKV A;  3LQR A;  3WU1 B;  2DW4 A;  3I55 I;  5IT9 Z;  1R58 A;  1J9I A;  1TWA J;  2XUB A;  4HYE A;  1HST A;  1KQ9 A;  4B4C A;  5DM6 F;  2M1B A;  5LHH A;  2JSP A;  2ZME B;  1TTY A;  4LG3 A;  4Z6Y A;  2P0W A;  2KDO A;  2M0M A;  2R0Q C;  4BBR J;  2OD5 A;  4XID A;  2LF7 A;  4D0P A;  4JYK A;  2VI6 A;  1CF7 B;  2CRG A;  1YIJ I;  2ZNZ A;  3I4N J;  1Y56 A;  1BN5 A;  4Y17 A;  1LE8 B;  3TKY A;  4JX5 A;  5ICF A;  2Q2E A;  2V9K A;  1X19 A;  2L54 A;  3KET A;  2K27 A;  3BCB A;  5CVJ A;  5JI6 A;  3HOW J;  2UUZ A;  2VKE A;  1XN7 A;  1B1B A;  2KQR A;  3RPQ A;  2X1E A;  2NNY A;  3K4K A;  5J3L A;  4M3G A;  4G7H F;  1S6L A;  4ZTJ A;  2LFB A;  3LSR A;  4I2O A;  1GVD A;  1ONV A;  1R5I D;  3EQL F;  5DV5 A;  3BZK A;  1VQO I;  3HOY J;  3HHG A;  1ON1 A;  3GF2 A;  4CZZ A;  4HA8 A;  4ON0 A;  3ABU A;  2E35 A;  1NTC A;  4P55 A;  2BHY A;  2VBW A;  1IN8 A;  2N8G A;  2XAH A;  1FWZ A;  2HQ5 A;  2RQP A;  1LDD A;  2EV0 A;  3CCJ I;  3O6B B;  2ISZ A;  5FRO A;  1SD6 A;  4D9J A;  4B48 A;  2Y0S N;  3ZQG A;  4BEH A;  3GFJ A;  5TIS C;  2M2E A;  2FX0 A;  5GTI C;  3D5S C;  4EJV A;  2XV4 S;  4G6T B;  1RR7 A;  1ZG3 A;  5C3E J;  3EPZ A;  3GLL A;  3K1M A;  1L0O C;  4XLE A;  2VT2 A;  3AG3 H;  5FLM J;  4A5M A;  5L3G A;  1IJW C;  1CQT A;  4RB0 A;  1P6R A;  3FXR A;  1RUN A;  1U78 A;  2CW7 A;  1W0U A;  4DQ2 A;  3GZN B;  5E79 C;  2F5V A;  2AQF A;  2B7E A;  2YS9 A;  4A6E A;  1JXS A;  3P5J A;  3OL4 A;  2K5C A;  3CJN A;  3I4P A;  4XK4 A;  1IXS B;  4LG0 B;  4LGW A;  3GTQ J;  4LK1 F;  2O9L A;  2L9N A;  4PGG A;  3JRF A;  2DN0 A;  2X98 A;  4BUP A;  1B8I A;  2B0L A;  3COA C;  1MW7 A;  3A0H C;  4HDU A;  1LEA A;  4L0Z B;  1JTY A;  2IGM A;  3CJQ B;  4KDP A;  1T8I A;  2O3F A;  3HOS A;  5K5O A;  1Z7L A;  4A6D A;  1J09 A;  2CFO A;  2KIM A;  3HC7 A;  4NBQ A;  4PDK A;  3G71 I;  1NK2 P;  1JUS A;  3WTW C;  3KP4 A;  1WI3 A;  2DQR A;  3CC7 I;  2NVQ J;  5DTD A;  1VQN I;  1Y6I A;  4ZYE A;  3J7A Y;  4FTH A;  5F6F A;  1YIT I;  1EH6 A;  2ESH A;  2DA3 A;  2Z33 A;  1BI3 A;  4OWR B;  2V6E A;  4R79 A;  4D7M A;  4FIS A;  5C4J J;  2P5L C;  2D2W A;  1ZK8 A;  1T2K A;  4A3M J;  4C3I J;  3K10 A;  4XN0 A;  2HOA A;  3E5Q A;  2CH0 A;  3LST A;  3OR2 C;  4HZF A;  4PJM A;  5LGN A;  2P81 A;  3GFL A;  2ZXJ A;  2ECC A;  2V9V A;  3ZQH A;  3OIO A;  4J19 A;  5C4X J;  3J81 Z;  4LD5 A;  2LOO A;  2DMU A;  4NQW A;  4U7D A;  4CCL A;  3PSF A;  2R7D A;  2XC7 A;  2KKO A;  3PQK A;  1K7A A;  2IA1 A;  4XMY A;  3FXK A;  4ZDP A;  1F4K A;  3BG5 A;  3V8J A;  3CP8 A;  3U2R A;  1ETY A;  3GTJ J;  5HVQ C;  1TT0 A;  5DM7 F;  2MD0 A;  1JJ8 C;  2VQC A;  3FM5 A;  1LB2 A;  1SMT A;  3HRM A;  4V2F A;  3QOD A;  4OMY A;  1MKM A;  3VFZ A;  3GUD A;  4XLH A;  1TLH B;  3SEQ A;  1LE8 A;  1CGP A;  3AAF A;  2K9S A;  2GQQ A;  2L7F P;  4LIU A;  1LFU P;  3FMR A;  3P9I A;  2K40 A;  2RN7 A;  4X0G A;  4AM3 A;  4WXH A;  2Y2Z A;  1XSX A;  2MLG A;  3DKX A;  3QPT A;  3TMO A;  2QEX I;  2HWV A;  3K1P A;  3GTO J;  1DQU A;  3E5X A;  1MJA A;  3BG6 A;  5DD8 A;  2Y9Y A;  3V8K A;  2YSR A;  1QU3 A;  2PFB A;  4UUS B;  4IO9 F;  1Z77 A;  5E1X A;  1WWX A;  2F6C A;  1LDK B;  3S1Q J;  1V5F A;  3I53 A;  2HQR A;  2VKD A;  3CLO A;  3ZGK A;  4DBR A;  3CC2 I;  5FLV A;  3GFM A;  3L00 A;  2R93 J;  4ANJ A;  4N4O B;  1IRG A;  2DA7 A;  2GA2 A;  4V2G A;  4IX7 A;  2XAF A;  3K7A J;  5LEK A;  1TW3 A;  5BMZ A;  1VQ9 I;  2FOW A;  3LSJ A;  2MFZ A;  4AWX B;  2L4M A;  2XGE A;  3HL2 A;  3ASN H;  2H6B A;  2XSJ C;  4ENK A;  3IRQ A;  1TT5 B;  2JMW A;  2XAG A;  3KP3 A;  1MNM C;  4WWC A;  1MBF A;  5L3E A;  2YX4 A;  2ZO4 A;  2KDZ A;  1Z3X A;  1B6A A;  5CVI A;  1B72 B;  3KLN A;  3ABT A;  2TCT A;  3JSO A;  1R1U A;  5DUK A;  4ENJ A;  1H0M A;  5FGM A;  2JPB A;  2V1D A;  2AXT C;  2G7H A;  4AIJ A;  1MND A;  3KP2 A;  1QA6 A;  1QZY A;  3S16 J;  4XKW A;  3KEY A;  3C7J A;  2BE5 F;  4L5J A;  4PJ0 C;  3ECH A;  5LGT A;  1YJW I;  2ELH A;  1HW5 A;  4HRI A;  4B1R A;  2BY3 A;  5DUI A;  3C1D A;  1DU0 A;  4BU2 A;  4BL0 B;  5DEQ A;  4EVI A;  2IGO A;  4RB2 C;  4BNC A;  1JHF A;  2E7W A;  1BC7 C;  5FRN A;  3L09 A;  2K02 A;  5D4R A;  2EH3 A;  5KNL A;  1RZ4 A;  3OYN A;  5TJJ A;  3HRU A;  3UKG A;  3V42 A;  1EJ9 A;  3H1C A;  2MLK A;  2IRF G;  2OQR A;  2OZU A;  5J6X A;  2X6W A;  5M3M J;  3QPS A;  4BAY A;  3SXY A;  5D8K B;  1PUF B;  3HSF A;  1KU7 A;  2DMP A;  1PP8 F;  2M8E A;  3B02 A;  5B5E C;  3WTY C;  1UZC A;  3BRO A;  1H88 C;  4YIF A;  4ZDO A;  3CCU I;  1SEU A;  1WJA A;  2L7Z A;  2NVY J;  1MBG A;  2JJ7 A;  2HYF A;  4E7H A;  3E97 A;  1N77 A;  4ZH4 F;  3LNQ A;  2JA2 A;  3ZQF A;  3G6E I;  1T0F C;  1H8A C;  2HTS A;  3RQ4 A;  5F0F A;  3CME I;  2Y0S A;  3ZMU A;  1BM9 A;  2V9P A;  4CSW A;  4IPA A;  4IOC F;  2XAS A;  5D4S A;  3Q0W A;  1K78 B;  4L9J A;  1NH3 A;  4OIR F;  3MMY B;  1MNE A;  4EEF G;  3A2K A;  1HXD A;  4BXU A;  1JGG A;  4XRM A;  1A6I A;  2HR3 A;  1LVK A;  1ERD A;  4AC0 A;  3FBN B;  2B63 J;  1U5T C;  4LIT A;  1YG2 A;  3TED A;  2HTJ A;  2RVC A;  2HZT A;  1U8R A;  3C2B A;  3ZMT A;  3E6D A;  1BOB A;  4M6X A;  4UUV A;  3KEO A;  2F5E A;  2VON A;  2L7M P;  1ETQ A;  1XGN A;  1IN4 A;  2DYR H;  1W1W E;  4UUS A;  4I09 A;  1I1G A;  2Z2S B;  3G3Z A;  4OAY A;  2A3S A;  2QM3 A;  5J4V A;  1I50 J;  4XIC A;  3L2W A;  5ILS A;  3SJM A;  4HW0 A;  3BR0 A;  1T39 A;  3HIF A;  2VQH A;  1DPU A;  2BV6 A;  3HKZ N;  2OCE A;  1XDS A;  1FPQ A;  1YI2 I;  4II3 A;  4II2 A;  4GRI A;  4OIP F;  1ZG1 A;  1VND A;  2EWN A;  2FRH A;  2BW3 A;  2WAF A;  2RKH A;  2ID3 A;  5LRR A;  1Y0N A;  3S1M J;  4DYQ A;  3ZN1 A;  4A3K J;  2LH9 A;  1JKP C;  2IXS A;  3C2G A;  3OV8 A;  5IOZ A;  1YRN A;  1IXR C;  4TV7 A;  1IRZ A;  4NC7 A;  2BEO A;  2OU2 A;  3NAU A;  4NC8 A;  5D5X B;  2Z3Y A;  1U8B A;  2LMD A;  1HW1 A;  3IC7 A;  5HDK A;  1IN6 A;  1V5G A;  3L2R A;  1EH7 A;  1Q1V A;  3QPH A;  1DU6 A;  2FNA A;  3CDH A;  5LD2 C;  5J1U A;  3RZD J;  2LBF A;  1WQ2 A;  3IH4 A;  1JT6 A;  2A05 A;  3QAH A;  1ZRF A;  3SHF A;  1WPK A;  4DYR A;  1D1A A;  4F93 B;  2JN6 A;  5FRM A;  3PUF A;  3DEW A;  1BW5 A;  4HLY A;  1JI8 A;  1H9G A;  1ETX A;  2W1O A;  3GTP J;  2V1X A;  4A0Y A;  2Z9O A;  4A3C J;  2QSF X;  5LEJ A;  2IA2 A;  3LAJ A;  1W5S A;  1EKE A;  3M3Y J;  2L9S A;  3PSI A;  3OS2 A;  1U9N A;  1ZAR A;  4G12 A;  2GZW A;  4RAZ A;  1DUX C;  3CD6 I;  2M7B A;  3ZMS A;  2V79 A;  4A3L J;  5JHU A;  1IV8 A;  2WAD A;  1O7L A;  2BHZ A;  4NC6 A;  3IL2 A;  2AS5 F;  1R36 A;  1D0Y A;  3KX2 A;  5HDG A;  3ZR8 X;  4AID A;  3PL8 A;  3K4C A;  2GWR A;  5K7F A;  3I59 A;  3JTH A;  5D5V B;  5IT9 R;  4PGH A;  1BR4 A;  1VQL I;  5HLT A;  1D0X A;  1T33 A;  3PUB A;  1X2M A;  4WXC A;  3LWF A;  4DZJ A;  1KU3 A;  1JTX A;  4HBL A;  2B9S A;  1MSF C;  1GXP A;  1JKR C;  3ZQQ A;  2FEZ A;  2FXA A;  3WG7 H;  1XB4 A;  4L0Y B;  2HXI A;  3LFK A;  3GLX A;  2W7N A;  4M9S A;  1YTY A;  5GP9 A;  1YJ9 I;  4XOR A;  4U0Y A;  2XPV A;  3CUQ B;  4CZC A;  1FEX A;  3RYR A;  1RET A;  2ADU A;  3LA3 A;  1MMS A;  2OJE D;  3H3Z A;  4GO1 A;  3AFH A;  1BJZ A;  3O3K A;  4HG2 A;  1QGP A;  1UJ8 A;  3PNT A;  5KVR A;  2ZJQ F;  1FZP B;  2QBY B;  4FHT A;  4W1U A;  2QUF A;  2QEN A;  3NEU A;  3F21 A;  3J81 K;  5H6Q A;  1C0W A;  1QPM A;  2JRM A;  4B3X A;  2W24 A;  5EDN A;  1MGT A;  4HOB A;  2JA7 J;  2TRT A;  1YO5 C;  1K4T A;  1APL C;  4I0B A;  1FMV A;  3OYA A;  1BBY A;  1SFO J;  5ILU A;  1BL0 A;  4UHT A;  3J80 R;  3K4J A;  3DFG A;  2KJC A;  3CC4 I;  1A04 A;  2E1M B;  1IV6 A;  2CUE A;  5EG0 B;  2W4S A;  2EIN H;  3BWG A;  2FE3 A;  2H8W A;  1UST A;  3CZ6 A;  3HZJ A;  4HPQ A;  4PJL A;  4JBA A;  2EK5 A;  2OPT A;  5IPA A;  2P7V B;  1ZLK A;  2VPL A;  3WTU C;  3M07 A;  2ME0 A;  2L7K A;  1YJN I;  4BAC A;  1HQC A;  2ICW G;  2ZCW A;  3H9J A;  3MZ8 A;  4GGG A;  1FT9 A;  4PJN A;  4AYB N;  4DJA A;  4BQO A;  4NDL A;  4Y3O A;  1ZRC A;  2EIK H;  3BTC A;  1GDT A;  1OYW A;  5DCM A;  3S32 A;  1IXC A;  2V26 A;  3PIP F;  1FYK A;  2HYJ A;  2IBD A;  5HS8 A;  4DNC A;  3FX3 A;  1R49 A;  4JOM A;  3AG2 H;  1W36 C;  1OYI A;  2VC0 A;  2XDV A;  2QZ8 A;  2KMU A;  3DQV C;  4DW6 A;  2LBF B;  1UHM A;  3WU0 A;  1XPX A;  1E17 A;  2TDX A;  2XF6 A;  2CQN A;  2PN6 A;  2O6G E;  2A69 F;  2CV1 A;  5LLQ A;  5E3N A;  3IH3 A;  3H36 A;  2VBY A;  1MBE A;  1QPI A;  1BC8 C;  1KU2 A;  3GEZ A;  1X1B A;  2PEX A;  3FK7 A;  1H89 C;  2FML A;  1IN5 A;  1GV2 A;  2DDA A;  1EV7 A;  3OOU A;  3U21 A;  3Q0V A;  1IRF A;  1HOM A;  1ETV A;  3N97 A;  5HLI A;  4NHJ A;  3BR6 A;  2ZSI B;  3B6C A;  3IH2 A;  1XCV A;  5FJ8 J;  4F7Z A;  4JK1 X;  3L1P A;  3T8R A;  3BG9 A;  1JJ6 C;  2G7U A;  4BKX A;  3MZH A;  4A0Z A;  2DA6 A;  2HVS A;  4I0A A;  2LY2 A;  5TRD A;  3MKL A;  4JP0 A;  3WHB A;  2V6C A;  2WAQ A;  1MMD A;  4M3E A;  5EEA A;  3F9K A;  4A3F J;  4IOA F;  5GPC A;  3JRH A;  2DLL A;  5ERI A;  2LKX A;  1P7J A;  2Z99 A;  3BQZ A;  1IDZ A;  3A52 A;  1X2N A;  2R7X A;  4EAT A;  9ANT A;  3G1O A;  3JRD A;  1XD7 A;  4XKC A;  1UCR A;  3F8C A;  3S15 J;  2JUC A;  5D5U B;  4I02 A;  4XN3 A;  4PFO A;  2VB6 A;  2DA1 A;  2HQA A;  3TQN A;  2XGD A;  2CGP A;  5FLX Z;  2PBI A;  3FXU A;  2XAU A;  2E36 A;  4JX4 A;  3FIW A;  4J00 A;  2BYV E;  3R0A A;  4C2M J;  3KZZ A;  2A5Y B;  1ZR4 A;  2HZD A;  5E1W A;  5F0C A;  3GME A;  3KP6 A;  1MDM A;  1BJA A;  3ML6 A;  4JX6 A;  4RGU A;  2OAZ A;  1YQA A;  2DMT A;  5FKN A;  3R0J A;  2X1D A;  3I0T A;  3RIR A;  3RZO J;  3TO7 A;  1HDD C;  2E19 A;  3MZY A;  3L2V A;  1SAX A;  4I01 A;  4MFE A;  2L0K A;  2OZ6 A;  2PMZ N;  2F4I A;  3K4M A;  3P9C A;  2VUM J;  2JPC A;  1J5Y A;  2ID6 A;  2HNH A;  2D1H A;  2GIZ A;  2EIM H;  1X1A A;  2Y0M A;  2YPR A;  2IT0 A;  1ZQ3 P;  5E3O A;  1OCZ H;  2FU4 A;  5D5W B;  4DIQ A;  2NOG A;  2MYS A;  2MD5 A;  3DTE A;  2WC2 A;  3ECO A;  3BQY A;  3R4K A;  2Y30 A;  1I3A A;  2V7F A;  3G4S I;  2M87 A;  4ENN A;  1R22 A;  2M8G X;  3NWT A;  1FMW A;  1P7I A;  3VSL A;  2ZXH A;  2J5O A;  2KRC A;  1F36 A;  3BR1 A;  3GW2 A;  5ED4 A;  3ONQ A;  4XLP F;  3HM5 A;  2FNP A;  1SFE A;  2M30 A;  2KLO A;  3F6V A;  4ITV A;  4BHB A;  2IS2 A;  3L9F A;  3Q0U A;  2NVU B;  3S1N J;  2UV1 A;  2PG4 A;  2CQQ A;  1TNS A;  1ETO A;  5K7H A;  4PCQ A;  3J7Z I;  5E8G A;  4OOI A;  1SC7 A;  5E1Z B;  3RTR A;  2H94 A;  5J8C A;  2EIJ H;  1HBX G;  2LRE A;  2Z16 A;  3GFI A;  3FDY A;  3J80 Z;  2Z1D A;  3ZQI A;  2KFD A;  5F1R A;  4S05 A;  2WV1 A;  5H2F C;  2VBZ A;  4UVB A;  4XKB A;  3TGN A;  3AL0 B;  3HUG B;  3K2A A;  3DF8 A;  4UB6 C;  1WJB A;  4PUS A;  4L5E A;  2FBH A;  2ZXW H;  2MC4 A;  1X1P A;  1T95 A;  3Q5F A;  3FF5 A;  4HNT A;  2GOX B;  3ERM A;  2R7T A;  3EYY A;  3QYE A;  4G7Z F;  4IHY A;  4LMY A;  1AHD P;  2LKP A;  2HDC A;  1HCR A;  5GTH C;  2AHQ A;  1B8I B;  1T0F A;  3VPR A;  1Z05 A;  2DOF A;  4Q5S F;  1FLI A;  4CGZ A;  3O2P E;  2JZY A;  3CCL I;  1QO0 D;  3RI4 A;  2MSY A;  4LLG F;  1YW8 A;  4EM0 B;  1RQ6 A;  4RGR A;  1MIJ A;  3K6G A;  3HYI A;  5E20 A;  2HFH A;  3BPX A;  1RPW A;  4B8X A;  3O8H A;  3CES A;  5HOD A;  4CCJ A;  2DK8 A;  3Q9V A;  3V8L A;  2RC4 A;  3HRS A;  2ETH A;  1SFX A;  2OQG A;  3S14 J;  1J2X A;  3A1Y A;  1OR7 A;  3OIP A;  2KIF A;  3CJT B;  1W5T A;  3BC8 A;  2QYO A;  4P9F A;  1K6O A;  2MA3 A;  5JVT A;  2HYG D;  2WV0 A;  3M8J A;  1IUF A;  2CW8 A;  4NQW B;  1O4X A;  3S2H J;  2Y31 A;  2R7Z J;  1FBU A;  3ZN0 A;  3IUO A;  2FBK A;  5HS7 A;  2K86 A;  3X2Q H;  3UR3 C;  3MN2 A;  1HLV A;  2IS1 A;  1R7J A;  5F27 A;  3SQN A;  2P7C B;  4B09 A;  1WH5 A;  2HVQ A;  3V7R A;  3ZP5 A;  1IC8 A;  3AL0 C;  3ZMV A;  3F8N A;  5GAE J;  1O7F A;  3GBG A;  3ZMD A;  3K4B A;  1K83 J;  2VN2 A;  1YW7 A;  2AO9 A;  2MH2 A;  5HLH A;  2PMH A;  1W7P A;  3KLO A;  3L2U A;  1TWH J;  1FYM A;  2Y48 A;  5FO5 A;  3HRT A;  5LBQ A;  3R60 A;  1D8K A;  2F4M B;  4LB6 B;  2A6T A;  2KHM A;  4ZDL A;  1YFH A;  2E2I J;  1JKO C;  1UMQ A;  3W2W A;  3RSN A;  2ZME C;  1NK3 P;  3M4O J;  2NAZ A;  5CYV A;  2VC1 A;  4XRS G;  5EEG A;  2A07 F;  2H8R A;  3A0B C;  3F0C A;  3OYH A;  3CCS I;  5J1R A;  1ACI A;  1ODD A;  2YR2 A;  3CO6 C;  2DPU A;  5BPI A;  4KA4 A;  4X6A J;  3BJ6 A;  5GAG J;  1FOK A;  1U5T A;  3DBL B;  2O8X A;  4D5F A;  3MAJ A;  3OS1 A;  2XAQ A;  1XCB A;  3O8G A;  5CQG A;  5AIP A;  2XRL A;  2ZNY A;  2HOE A;  2R5Y B;  1GXQ A;  1VFC A;  4EMS A;  4EM1 A;  1YIO A;  5JFR A;  3CCE I;  2GA1 A;  1YHQ I;  3VYR B;  4ESF A;  2K85 A;  5IYD J;  4RB1 A;  3HXL A;  3OS0 A;  4O3M A;  3EET A;  2CSO A;  4NB5 A;  2VLA A;  3A02 A;  3HGY A;  1P4X A;  2FQ3 A;  4BXX J;  3OYD A;  1G2H A;  1ZG5 A;  1J7K A;  1S3J A;  1FBQ A;  1LEB A;  1JHH A;  2Q2E B;  2R7U A;  1BIA A;  4M6V A;  1MJ9 A;  2PQ8 A;  4DYC A;  3BZ6 A;  1S8N A;  2FJ1 A;  5B1B H;  4C3H J;  1QHH D;  5J8F A;  2HOS A;  1G59 A;  2E71 A;  5IOY A;  3QPL A;  1QRY A;  2G0E A;  2MW8 A;  3I59 B;  4B43 A;  2CU7 A;  3PO3 J;  3I64 A;  2XPW A;  4U0V A;  5JLX A;  3FXO A;  3E1S A;  1RRJ A;  1TC3 C;  4KT6 A;  4KIF A;  1VQK I;  1Z3Y A;  4LFU A;  4EM2 A;  2ZFU A;  3JSP A;  2LNB A;  1GVJ A;  1U9O A;  2KJB A;  4BQA A;  3BJO A;  5DYM A;  4D5C A;  3LMM A;  2E5N A;  2DK5 A;  2R5Z A;  3GZ5 A;  3H3U A;  3SYT A;  4A3G J;  1B9N A;  2CQK A;  2PMZ A;  4A3J J;  4HX8 A;  3I56 I;  1WJD A;  4MQV A;  3PO2 J;  1ZEL A;  3QP5 A;  5IYC J;  2JT1 A;  4X1E A;  5J47 A;  3ROU A;  4Q48 A;  5IP6 A;  5L3F A;  4EGY A;  2O7O A;  3D1N I;  4YEJ A;  2ECB A;  3DBH B;  4WX9 A;  2VE9 A;  1TQM A;  5D6E A;  2FD5 A;  5FKL A;  4E7S A;  1FYL A;  4YFX F;  1STZ A;  2KL4 A;  1MZB A;  5EYR A;  1WJ5 A;  2EQR A;  2PJR B;  5KAF C;  3TP3 A;  2GOM A;  3H9G A;  2ZJP F;  3HOT A;  2A61 A;  5EG0 A;  4F91 B;  5JHF A;  1XMA A;  2DO7 A;  1OCO H;  4H0E A;  3OSF A;  1O57 A;  3EUA A;  5M3F J;  2DJI A;  4P9U A;  2PI0 A;  2X51 A;  1JKQ C;  1T56 A;  4AUX A;  5KCM A;  4KIT B;  1REP C;  3IP4 B;  3VOE A;  2FQ4 A;  2O5R A;  2DT7 B;  3VB2 A;  3W6J B;  4BHC A;  2D1V A;  1RC9 A;  2QF7 A;  3JRA A;  2D5V A;  2BXY A;  2E1O A;  3BG7 A;  1W7P B;  5JLW A;  1LUJ B;  2VKH A;  4QPQ A;  2I10 A;  4BHP A;  3A4C A;  3KP5 A;  1ENH A;  5IYB J;  2W84 A;  3V7C A;  4PZJ A;  2LKS A;  1MDM B;  3QWL A;  4M71 A;  5F1J A;  2DOD A;  1PUE E;  2EZK A;  2RGV A;  1FP2 A;  3HSR A;  1E3P A;  2MC3 A;  3QOE A;  1VQ4 I;  3W6V A;  1W4M A;  2JVG A;  4UUT A;  4EJU A;  2BOL A;  2ZC2 A;  1LPQ A;  2JVH A;  2WY8 Q;  4KIG A;  2MGQ A;  2V1U A;  1B9M A;  3CUQ C;  4PJJ A;  2CV2 A;  4MIM A;  5K1Y A;  1U0J A;  2EV5 A;  1VF9 A;  2BVM A;  2M4K A;  3LL7 A;  2VAS A;  3OYE A;  2JA6 J;  1Y1W J;  5F04 A;  1A35 A;  4KUM A;  2O61 A;  4BJT A;  2V4J C;  5GAD J;  4IQ4 A;  1KGS A;  1HKT A;  1U2W A;  2C6Y A;  4BDZ A;  1JGS A;  2LDU A;  4OU0 A;  3TW6 A;  3F6O A;  1Y39 A;  3L2Q A;  3DV8 A;  3JR9 A;  1A6Q A;  2PX9 A;  3CTA A;  2QSH X;  2IA0 A;  3B73 A;  1IZ1 A;  3NRV A;  4AYB A;  3IV5 A;  4E4H A;  4WF2 A;  2ACJ A;  2FA5 A;  3OL3 A;  1AKH B;  1S9H A;  3BZC A;  2V1N A;  2LR8 A;  1QHG A;  2FMY A;  2Q8K A;  5BOX A;  4W97 A;  2EJR A;  3WG9 A;  1V54 H;  2HI3 A;  3S93 A;  1WHU A;  2I8D A;  2WY7 Q;  4AIK A;  3HTU A;  4CUG A;  2M7A A;  3HBL A;  4BS9 A;  2ESN A;  2R5Z B;  3W2V A;  2XVC A;  2DMQ A;  3DPT A;  4CCK A;  3S2D J;  5D8L B;  3OOP A;  5KHD A;  3K69 A;  1F5T A;  1TW2 A;  1EF4 A;  1MMG A;  4XOT A;  5EZH A;  3WOD F;  4C2U A;  3T5X A;  1G6N A;  4H4K C;  4JQF A;  5FB2 A;  3W6K B;  1FY7 A;  1OQY A;  1RKW A;  2K3F A;  3OWT A;  2FUG 2;  3J80 K;  4ABZ A;  3BTJ A;  1I6X A;  3QYF A;  1QVT A;  3ZQC A;  4AIH A;  5EGO A;  3CDL A;  4IXA A;  2HDD A;  3A01 A;  4UXN A;  1O3Q A;  1Z0X A;  2O0Y A;  4RAF A;  3Q9S A;  1UFM A;  4J01 A;  2G9W A;  1KON A;  1ZRE A;  4RBO A;  1ZAO A;  4IL6 C;  2IJL A;  5BNG A;  4DGW B;  4RMN A;  3JRG A;  2HDW A;  5GPA A;  4XRS A;  4A3B J;  1ETK A;  2XKP A;  2UWM A;  2J5P A;  1IW7 F;  1WVR A;  2EFN A;  1N78 A;  2CO5 A;  1VQ8 I;  1RIO H;  4XKV A;  1OPC A;  1MBJ A;  4EJW A;  2VE8 A;  2BY1 A;  1POG A;  2DI3 A;  2LY9 A;  2DJN A;  1QVU A;  4KN4 X;  2W57 A;  1Z21 A;  1S5L C;  2XSD C;  3KPH A;  3W2A A;  1W36 D;  4XLF A;  4N9H A;  3E7L A;  4F52 A;  1ZHF A;  5DS9 A;  4CYD A;  3ABL H;  3GTG J;  2M4G A;  3DPU A;  3TBI A;  2NOJ B;  1SD5 A;  3WGI A;  1OIS A;  2XPU A;  4BGD A;  1V4R A;  2OC6 A;  2BBY A;  3S1R J;  1OCP A;  3F22 A;  5D6F A;  4ZC3 A;  2STW A;  1OKR A;  3WHC A;  1WFX A;  4DOZ A;  1A31 A;  4A5N A;  2GXA A;  2QSG X;  1D1C A;  3SZT A;  1XMK A;  3ASO H;  3TOB A;  1BI2 A;  1TNT A;  4HNU A;  4AVP A;  5K5R A;  1QNT A;  2HEO A;  4UVA A;  4BBS J;  2VJ5 A;  2A6E F;  3GO5 A;  3J7Y J;  4BYY A;  1YW9 A;  3GTK J;  2FBI A;  2EZH A;  1I27 A;  2X48 A;  1YX3 A;  1AWC A;  1SMY F;  3FXQ A;  1DGW Y;  3C18 A;  3WU2 C;  3D5L A;  4HSR A;  3JAM Z;  4M73 A;  1GHC A;  1WJC A;  2HU9 A;  1BI0 A;  3MQ0 A;  4EJO A;  2ZJ2 A;  4WXD A;  5CVR A;  4CCM A;  2OBP A;  6PAX A;  3BTI A;  2XRO A;  2X0L A;  3DXJ F;  5GAH J;  3CMM A;  3J81 R;  4MLO A;  2NYX A;  1JT0 A;  2CMP A;  2GXB A;  3JRC A;  1N25 A;  3S3O A;  3CLQ A;  4NNJ A;  3NQO A;  3RKX A;  1FSE A;  1QQI A;  2WAE A;  2ZFW A;  1UHS A;  4HLX A;  1VQP I;  1X3W B;  4XBF A;  2GM4 A;  2HKO A;  4AU7 A;  4RLQ A;  3TO9 A;  4ENM A;  1VTN C;  2YU9 J;  4XON A;  3NAR A;  1TWG J;  3F8B A;  4KT5 C;  3RCO A;  2QQA A;  4Z2Y A;  3F8M A;  4RAY A;  4D1Q A;  3QU3 A;  3FKJ A;  3PQJ A;  2QVO A;  1FSH A;  4XRF A;  3H5R A;  1Z67 A;  1G3W A;  2CQX A;  1TWF J;  2OTJ I;  1KYW A;  2R92 J;  1W5C C;  4BXF A;  1ZTR A;  1BW6 A;  3DPL C;  1SVM A;  3BTL A;  2QQ8 A;  2QKL B;  3TW7 A;  3OR1 C;  1DP3 A;  1LVA A;  1USS A;  2CWE A;  3OYM A;  1XGM A;  5H6R A;  2W85 A;  1WCM J;  4IZZ A;  1FOX A;  3ZQL A;  2BXZ A;  1WSU A;  3U1D A;  4ZYG A;  1BOA A;  3GYH X;  3AG1 H;  1X58 A;  4IQJ A;  2I5U A;  1Z6T A;  2CJJ A;  4O5V A;  1V55 H;  2P8T A;  3LSH A;  3RKY A;  1KU9 A;  1TWC J;  2BY2 A;  3WGH A;  3J7A O;  2F5D A;  3LSK A;  5B1A H;  4IRG A;  2L3D A;  2E2H J;  3HOV J;  5EZG A;  3PIO F;  4BQN A;  3KP7 A;  2KZV A;  4GCV A;  2M35 A;  3K4L A;  1P92 A;  1R5H A;  2VL8 A;  2E2J J;  1WH7 A;  4PSW A;  2E7X A;  4R1H A;  2GLO A;  3I5U A;  3QU6 A;  1OCT C;  1P4A A;  2R7O A;  2CUF A;  2MH9 A;  3W3C A;  2NS8 A;  3DP7 A;  2DCE A;  3I3L A;  3V4G A;  3K1N A;  3F8F A;  3CJR B;  4YII A;  1AA7 A;  4LK0 F;  1MH4 A;  3DLA A;  2HPM A;  4HV5 A;  5JVG F;  1BR2 A;  3E3V A;  1AKH A;  5CVU A;  1YYV A;  4ZZL A;  4BEH B;  3OYC A;  3F23 A;  4BQQ A;  3LA2 A;  2DT5 A;  1GT0 C;  4RA2 A;  3FHZ A;  3RPU D;  2R5Y A;  4C2T A;  1X4P A;  4FAS D;  4V19 K;  3GZ6 A;  2X1C A;  1BA5 A;  1YS7 A;  1SD4 A;  4LJZ F;  1Y8R B;  4E7K A;  4CCN A;  3ELK A;  3G1M A;  5AON A;  1VI0 A;  2CW0 F;  2EFO A;  3EDP A;  2YX7 A;  3FMQ A;  2LD5 A;  4E6K G;  2UZK A;  1A36 A;  3UNG C;  2DOA A;  4HEA 2;  3CCR I;  1E3O C;  2ZJR F;  1DP7 P;  1WRJ A;  3H9Q A;  2M45 A;  4ESB A;  2EFW A;  3CMY A;  2IEK A;  4KN7 X;  3OMY A;  3KYL A;  4G7O F;  1MBK A;  2QBY A;  4O6J A;  4G6D A;  3ZOB A;  2FOK A;  3KZI C;  5EGO B;  2EA2 A;  4L9N A;  2JTV A;  4KYW A;  4BH9 A;  4B44 A;  2DTZ A;  3RJP A;  1HC8 A;  5E18 F;  2H09 A;  5C44 J;  3OYG A;  2DFI A;  1FJL A;  5B3S H;  4CYC B;  1R1V A;  3QP6 A;  2RQQ A;  5IP7 J;  5IP9 J;  5LHI A;  5IY5 H;  4UY8 I;  2FSW A;  2NS7 A;  1UG2 A;  2AQE A;  2DA2 A;  2LK2 A;  2VJ4 A;  3QQA A;  1X4O A;  2DT6 A;  2CS3 A;  4FX0 A;  5E3L A;  2NRA C;  2L01 A;  3HG9 A;  2KZG A;  2VQL A;  2EBI A;  2ZXI A;  4B3A A;  3ZPL A;  4UB8 C;  1X1D A;  2PJP A;  3SEZ A;  1XSD A;  3OYJ A;  2XGC A;  3WTX C;  3KCC A;  2R7W A;  2R4G A;  3LSI A;  2GAU A;  1YS6 A;  5F08 A;  3I71 A;  1ZGW A;  2VJJ A;  5CJ9 A;  4MTE A;  1N75 A;  4FX4 A;  3E6B A;  3EUK L;  3BG3 A;  2K3P A;  1E0E A;  2RNG A;  4OIO F;  2VOP A;  2DFH A;  2DFE A;  3N4M A;  1MMN A;  1ULY A;  4XSX F;  4ZZD A;  2QCO A;  1QZE A;  2WTE A;  2HVR A;  2XAJ A;  4BJ6 C;  3OYI A;  2H1L A;  5E17 F;  1FBS A;  3D0S A;  3M1E A;  5M5Y J;  1IRX A;  1D5V A;  3BLY A;  2IS4 A;  1EA3 A;  1W7P D;  1FOY A;  4D7N A;  1MJB A;  2L4A A;  2P6T A;  4BE0 A;  2K9N A;  2UXN A;  1ZH5 A;  1D3Y A;  1RES A;  1B59 A;  2ZSH B;  4RLF A;  2DQL A;  3ULQ B;  1WZ2 A;  2P5V A;  3OYK A;  1YRN B;  4WK8 F;  1ZLJ A;  4PFP A;  2XIG A;  4MHG A;  1OJL A;  1ZR2 A;  3RPU A;  2QQB A;  3GCM A;  4C9Y A;  3HEF A;  2DBB A;  2CUJ A;  2EFP A;  3I4M J;  3K0L A;  1LQ1 A;  2DA4 A;  4Y15 A;  1ZRD A;  3KZY A;  3GVA A;  4MO7 A;  4MNU A;  2IP2 A;  4IKF A;  5CQE A;  1BR1 A;  2HXO A;  2RRE A;  1OMI A;  3DKW A;  4OMZ A;  1ZKG A;  2X6O A;  1FP1 D;  3S3N A;  4XLN F;  2W48 A;  4RGX A;  3HOX J;  2K9Q A;  5K5Q A;  3HOZ J;  2L9R A;  2NXN B;  1Z6R A;  3SZP A;  1WKM A;  5HOO A;  1TP4 A;  1B72 A;  5CLS A;  4M6Y A;  1Q1H A;  2R7Q A;  1R9T J;  2LLK A;  2LY1 A;  3FHN A;  4C30 A;  2VOD A;  2QLZ A;  1U5T B;  4QIW N;  4BE1 A;  2GXG A;  3TL4 X;  4HX7 A;  1UB9 A;  1XX5 A;  5M5W J;  3D5R C;  5HS9 A;  3ABK H;  4L9T A;  4A3I J;  1HW2 A;  4IHT A;  3KE2 A;  2YUS A;  5DCF A;  3EUH A;  3RQI A;  1FOW A;  1O3R A;  3FIS A;  4G8X A;  3K2Z A;  1ZN2 A;  2Q1Z B;  3F72 A;  4FCY A;  1XMX A;  2LTP A;  3M1C A;  5CPR B;  4HX4 A;  4IJA A;  2EA4 A;  5LGU A;  1NG6 A;  2JWT A;  5A2Q R;  1TL8 A;  5HNH A;  4YFN F;  3DTK A;  1HA8 A;  4XL9 A;  3KFW X;  2IS6 A;  1E2X A;  1SFU A;  5M5X J;  2LSO A;  2OF7 A;  1I5Z A;  1X3U A;  2VXD A;  2EB7 A;  1R4N B;  3CUQ A;  3OYF A;  3DKY A;  2COB A;  1PJR A;  3FXL A;  3VSK A;  1X1C A;  4DBQ A;  3R61 A;  3JRI A;  5ICC A;  2DMN A;  2BZT A;  4Y7N J;  3BR3 A;  3PM1 A;  1R23 A;  3HOU J;  1R5G A;  2WAQ N;  4A69 C;  2GIV A;  5CVV A;  1XGO A;  1S7E A;  4WCG A;  2O8K A;  3SFI A;  4BJ5 C;  2W25 A;  2DU9 A;  2Q0O A;  4IRI A;  2CG4 A;  1RUO A;  4RDU A;  1YOV B;  3PNY A;  2P5K A;  3ZRG A;  4N0B A;  1Y1V J;  4BDY A;  5CKT A;  4RAG A;  1Y8Q B;  4PSX A;  3ABM H;  4M9X A;  3OYB A;  4P96 A;  2KIQ A;  3VOD A;  2ELJ A;  2IGN A;  1ZYR F;  1OFC X;  3QOP A;  3AG4 H;  1VQ7 I;  2X4H A;  2ZB9 A;  3I54 A;  4U88 A;  3FXJ A;  2E5Z A;  1K61 A;  4KMU X;  4GYI A;  4F55 A;  3GTL J;  3CUO A;  1Z9C A;  5EEH A;  1IDY A;  3HUG A;  1E3H A;  5FD5 A;  4CO8 A;  2K4B A;  4RM2 A;  1K4S A;  1F43 A;  3L7W A;  1TBX A;  2HQN A;  1RNL A;  1HSJ A;  2QWW A;  4QSH A;  3FK6 A;  1UG0 A;  2QQ9 A;  2LVS A;  3MKW B;  5FLX K;  4RGS A;  5DCM B;  1HKS A;  3JTG A;  3LFU A;  2M0C A;  1VQ5 I;  3GTM J;  5FLX R;  3CCQ I;  1NG7 A;  3HSE A;  1D0Z A;  1TQI A;  4I6Z A;  2L02 A;  1F9N A;  2K4J A;  2NS0 A;  3KYD B;  4CDG A;  3TP0 A;  4ESJ A;  3BT9 A;  3FZV A;  2OCC H;  1G3T A;  3GXO A;  1FTT A;  1S7O A;  1I39 A;  1F1Z A;  4A12 A;  1IF1 A;  4IHX A;  4CA0 A;  2MVT A;  3DEU A;  2NVT J;  1JUM A;  3JRE A;  1P9Q C;  2M34 A;  1X3Z B;  4FQG A;  2EFQ A;  1U6G A;  2OV7 A;  3TDU C;  1L3L A;  3S8P A;  4C3J J;  4LB5 A;  5LRS A;  2XB0 X;  2JRT A;  3C3W A;  4F92 B;  1HF0 A;  3BPV A;  2RAE A;  2EPF A;  4YG2 F;  1G3Y A;  2MAB A;  2XHK A;  4Y13 A;  1ETW A;  4MFD A;  2IW5 A;  1IO2 A;  1EH8 A;  4KMF A;  4ZYH A;  3I58 A;  2E1C A;  3BR2 A;  4U87 A;  4I99 C;  3R6S A;  4E70 A;  1J0R A;  2XGX A;  4UV8 A;  3RDI A;  1UEL B;  1SAU A;  3OIQ A;  3WE3 A;  1I6H J;  3KEQ A;  1SAN A;  4Y4R A;  3E6M A;  2JQ7 A;  3U1K A;  2R7F A;  3H3V K;  1V3F A;  1RR8 C;  4OAZ A;  5KAI C;  4LLL A;  4QPO A;  2VXZ A;  3H5N A;  3HPH A;  3TOA A;  1IGN A;  2YU3 A;  4PK4 A;  3RKW A;  4DZP A;  4CXF A;  3MWM A;  5HLG A;  1R1T A;  1LJ9 A;  2K7L A;  2WBM A;  3G73 A;  1ITY A;  3LSP A;  1SVL A;  1LFB A;  2K9L A;  3DU5 A;  1CF7 A;  4A0X A;  2W00 A;  3FWE A;  5AIQ A;  1AU7 A;  1K79 A;  5J1Y A;  3VWB A;  4XOP A;  1IN7 A;  2KRF A;  1KA8 A;  3FM3 A;  3ERE D;  1OCR H;  1JUP A;  2XRN A;  3K9T A;  3H35 A;  4MEX F;  4BY1 J;  3V7S A;  4UVC A;  5FKO A;  3LSG A;  1K6Y A;  3VYT B;  5BQT A;  3RKQ A;  1OR7 C;  1PP7 U;  3MKY B;  5FKK A;  3LAP A;  4YEL A;  2VBX A;  2LF8 A;  4E7L A;  1GUU A;  3CQZ J;  4KJZ A;  1JE8 A;  2L9V A;  3QYB A;  2JA5 J;  2E1N A;  4GDF A;  4LLN A;  2F5C A;  2E1M C;  1G3S A;  1VQ6 I;  2P0T A;  2ELK A;  1LFP A;  4KNY A;  2JK3 A;  1IUY A;  3JAM R;  3WTS C;  1YLF A;  3E5U A;  4AD9 A;  4Y33 A;  1G8X A;  5B66 C;  5J40 A;  1S7A A;  3WTZ A;  5E3M A;  1MSE C;  2RNJ A;  1R6R A;  4M3B A;  4L9V A;  2DPD A;  4XQF A;  5HNF A;  2MUN A;  2A5W A;  3H0G J;  3C2H A;  4U0W A;  3ESW B;  4FT8 A;  3MD2 A;  1QBJ A;  2CQ7 A;  1I3Q J;  4ZJZ A;  3A01 B;  3ZCO A;  4CIC A;  3REO A;  2F4O B;  4HDV A;  1LDJ A;  2R7R A;  4IHV A;  2VKV A;  3DEE A;  1DGR M;  1HKQ A;  3IAM 2;  4R8H A;  4E7J A;  3S17 J;  3ZQ7 A;  2DAO A;  3DWL E;  4LG0 A;  2BVL A;  3CDI A;  3CO7 C;  1UHW A;  2LYC A;  4IHS A;  2E34 A;  3VYU B;  5A2Q K;  1O3S A;  1H9T A;  2HS5 A;  3ISP A;  3NWS A;  4HF1 A;  4RM3 A;  1Y0U A;  2WB1 A;  1P2F A;  4RB3 C;  4I98 B;  2JUG A;  1DPR A; 
#chains in the Genus database with same CATH homology
 1ZGA A;  2Y75 A;  3WTV C;  2WWY A;  5L3B A;  1KQ8 A;  1Z91 A;  1R00 A;  4EJT A;  3E6C C;  5JR3 A;  1FX7 A;  5E8I A;  4MQ9 F;  3IRR A;  2PMU A;  4MTD A;  4HQE A;  1OYY A;  1PDN C;  4G94 A;  1DDN A;  4UNO A;  4ZYD A;  5IT3 A;  3T8T A;  2HKX A;  4YFK F;  4XSZ F;  3MEX A;  2PLY A;  2CYY A;  4Q4Z F;  3MCZ A;  1O3T A;  2EV6 A;  4L18 B;  2VT3 A;  3RYP A;  3IWF A;  1BIB A;  1Z1D A;  4ASN A;  3QRF F;  3LQQ A;  2ZME A;  1I1S A;  4U7B A;  5DD4 A;  3IHU A;  3WGG A;  1U3E M;  3WTT C;  3IWZ A;  3HHH A;  2MBF A;  3M8E A;  4HF2 A;  2KIU A;  3P9K A;  3U9G A;  2HGC A;  3T0Y A;  5L3C A;  1T98 A;  2F5F A;  3BOQ A;  5BS6 A;  2H6C A;  2FF4 A;  1B4A A;  3BJA A;  2ZKZ A;  3TDZ C;  1Z7U A;  2H27 A;  4UV9 A;  4M9Z A;  4M72 A;  2UXX A;  2Z5U A;  1RI7 A;  2AXL A;  3BY6 A;  3JW4 A;  2ZBK A;  3L2C A;  5FFX A;  5A2Q Z;  4EQQ A;  5ILV A;  5L3D A;  2A6H F;  2RDP A;  1FNN A;  1J59 A;  4MEY F;  3M8F A;  1BI1 A;  1MD0 A;  2OA4 A;  1KQ0 A;  4K2E A;  3P7N A;  4M74 A;  1T6S A;  3S2W A;  4GYG A;  4GXO A;  3HTS B;  3GWZ A;  3TO6 A;  2DTR A;  3M9A A;  5FFZ A;  2STT A;  3BDD A;  3H92 A;  4HV6 A;  2ISY A;  1AOY A;  1SD7 A;  4S04 A;  4EV0 A;  1NHA A;  1QZZ A;  4I7H A;  2NNN A;  5IT9 K;  4OIN F;  3T1B A;  4EGZ A;  4KFC A;  4KIB A;  2P4W A;  4RS8 A;  4Q47 A;  4HAM A;  5BPD A;  3MFK A;  5F64 A;  3EYI A;  4HQM A;  1FC3 A;  1K78 A;  1WI9 A;  2M5W A;  3GX4 X;  1D8J A;  3ZMZ A;  5FD6 A;  3IKT A;  3BP8 A;  3F3X A;  5ICG A;  3VEP A;  1ZGJ A;  2A68 F;  3SFZ A;  2R3S A;  1G4D A;  4IVN A;  3JAM K;  5LHG A;  2D45 A;  2P6S A;  4P5O A;  3M7G A;  4ETS A;  2BGC A;  4QWQ A;  5HDN A;  5DDG A;  4OIQ F;  2JSC A;  1T38 A;  4HF0 A;  3PFI A;  1XDU A;  3LA7 A;  4IF4 A;  1KYZ A;  4MGR A;  1S29 A;  5KK1 A;  2F2E A;  2XKO A;  1IAW A;  2O03 A;  2COM A;  2VOO A;  1LNW A;  2RV8 A;  1XGS A;  3FMS A;  4A2U A;  5H20 A;  4CHU A;  4G9Y A;  2CFX A;  4N9I A;  1XSV A;  4IRH A;  1ON2 A;  4L5I A;  1TQP A;  2IVM A;  5ICE A;  4G6Q A;  1P4W A;  2IPQ X;  4KIC A;  1J75 A;  3WE2 A;  4QLC U;  3IKV A;  3LQR A;  3WU1 B;  2DW4 A;  5IT9 Z;  1R58 A;  1J9I A;  2XUB A;  4HYE A;  1HST A;  1KQ9 A;  2M1B A;  5LHH A;  2ZME B;  1TTY A;  2OD5 A;  2LF7 A;  4D0P A;  1CF7 B;  2ZNZ A;  1BN5 A;  4Y17 A;  3TKY A;  5ICF A;  2Q2E A;  2L54 A;  3KET A;  2K27 A;  5CVJ A;  5JI6 A;  1XN7 A;  1B1B A;  3RPQ A;  2NNY A;  4G7H F;  1S6L A;  4I2O A;  1ONV A;  3EQL F;  5DV5 A;  3HHG A;  1ON1 A;  3GF2 A;  4CZZ A;  4HA8 A;  4ON0 A;  3ABU A;  4P55 A;  2VBW A;  1IN8 A;  2XAH A;  1FWZ A;  2RQP A;  1LDD A;  2EV0 A;  3O6B B;  2ISZ A;  1SD6 A;  3GFJ A;  4EJV A;  2XV4 S;  1ZG3 A;  3K1M A;  1L0O C;  2VT2 A;  4A5M A;  5L3G A;  4RB0 A;  1P6R A;  3FXR A;  1RUN A;  1U78 A;  4DQ2 A;  1JXS A;  4A6E A;  3CJN A;  3I4P A;  1IXS B;  4LG0 B;  4LGW A;  4LK1 F;  4PGG A;  4HDU A;  2B0L A;  3COA C;  4L0Z B;  1LEA A;  4KDP A;  2O3F A;  3HOS A;  5K5O A;  4A6D A;  2KIM A;  4PDK A;  3WTW C;  3KP4 A;  2DQR A;  4ZYE A;  5F6F A;  1EH6 A;  2ESH A;  2Z33 A;  1BI3 A;  4R79 A;  2P5L C;  2D2W A;  1T2K A;  5LGN A;  4HZF A;  3E5Q A;  3LST A;  3GFL A;  2ZXJ A;  2V9V A;  3J81 Z;  4LD5 A;  4NQW A;  4U7D A;  2R7D A;  2KKO A;  3PQK A;  1K7A A;  2IA1 A;  1F4K A;  3V8J A;  3U2R A;  5HVQ C;  3FM5 A;  1LB2 A;  1SMT A;  3HRM A;  4OMY A;  1MKM A;  3VFZ A;  3GUD A;  1TLH B;  1CGP A;  3AAF A;  2GQQ A;  3FMR A;  3P9I A;  2RN7 A;  4WXH A;  1XSX A;  2MLG A;  3QPT A;  2HWV A;  3K1P A;  3E5X A;  1MJA A;  5DD8 A;  3V8K A;  2YSR A;  2PFB A;  5E1X A;  1WWX A;  1LDK B;  3I53 A;  2HQR A;  3CLO A;  3GFM A;  3L00 A;  1IRG A;  2GA2 A;  2XAF A;  5LEK A;  1TW3 A;  5BMZ A;  4AWX B;  2L4M A;  2H6B A;  4ENK A;  3IRQ A;  2XAG A;  3KP3 A;  4WWC A;  5L3E A;  2YX4 A;  2ZO4 A;  1B6A A;  5CVI A;  3KLN A;  3ABT A;  3JSO A;  1R1U A;  5DUK A;  4ENJ A;  1H0M A;  5FGM A;  2JPB A;  2V1D A;  2G7H A;  4AIJ A;  3KP2 A;  1QZY A;  3C7J A;  2BE5 F;  4L5J A;  3ECH A;  5LGT A;  2ELH A;  1HW5 A;  5DUI A;  3C1D A;  5DEQ A;  4EVI A;  4RB2 C;  4BNC A;  1JHF A;  2E7W A;  1BC7 C;  3L09 A;  2K02 A;  5D4R A;  1RZ4 A;  5TJJ A;  3HRU A;  2MLK A;  2IRF G;  2OQR A;  2OZU A;  5J6X A;  4BAY A;  3SXY A;  5D8K B;  3HSF A;  1KU7 A;  1PP8 F;  2M8E A;  3B02 A;  3WTY C;  3BRO A;  4YIF A;  2HYF A;  3E97 A;  4ZH4 F;  2HTS A;  3ZMU A;  1BM9 A;  4IPA A;  2XAS A;  5D4S A;  1K78 B;  4L9J A;  4OIR F;  1HXD A;  4BXU A;  2HR3 A;  1U5T C;  1YG2 A;  2HTJ A;  2RVC A;  2HZT A;  1U8R A;  3ZMT A;  3E6D A;  4M6X A;  4UUV A;  3KEO A;  2F5E A;  2VON A;  1XGN A;  1IN4 A;  4I09 A;  1I1G A;  3G3Z A;  2A3S A;  2QM3 A;  5ILS A;  4HW0 A;  1T39 A;  3HIF A;  1DPU A;  2BV6 A;  1XDS A;  1FPQ A;  4OIP F;  1ZG1 A;  2EWN A;  2FRH A;  2RKH A;  5LRR A;  3ZN1 A;  3OV8 A;  1IXR C;  4TV7 A;  2BEO A;  2OU2 A;  5D5X B;  2Z3Y A;  1HW1 A;  3IC7 A;  5HDK A;  1IN6 A;  1EH7 A;  3QPH A;  2FNA A;  3CDH A;  1WQ2 A;  3QAH A;  1ZRF A;  3SHF A;  4HLY A;  1H9G A;  2V1X A;  4A0Y A;  2Z9O A;  5LEJ A;  2IA2 A;  3LAJ A;  1W5S A;  1ZAR A;  2GZW A;  4RAZ A;  1DUX C;  3ZMS A;  2V79 A;  5JHU A;  1O7L A;  3IL2 A;  2AS5 F;  1R36 A;  5HDG A;  2GWR A;  3I59 A;  3JTH A;  5D5V B;  4PGH A;  4WXC A;  3LWF A;  1KU3 A;  4HBL A;  1GXP A;  2FEZ A;  2FXA A;  1XB4 A;  4L0Y B;  3LFK A;  3GLX A;  4M9S A;  1YTY A;  4U0Y A;  3CUQ B;  3RYR A;  2ADU A;  3LA3 A;  3H3Z A;  4GO1 A;  3O3K A;  1QGP A;  5KVR A;  1FZP B;  2QBY B;  4FHT A;  2QUF A;  2QEN A;  3NEU A;  3F21 A;  3J81 K;  5H6Q A;  1C0W A;  1QPM A;  2W24 A;  1MGT A;  4HOB A;  1YO5 C;  4I0B A;  1BBY A;  5ILU A;  4UHT A;  3DFG A;  2KJC A;  1A04 A;  3BWG A;  2FE3 A;  1UST A;  4JBA A;  2EK5 A;  2P7V B;  1ZLK A;  3WTU C;  1HQC A;  2ZCW A;  4GGG A;  1FT9 A;  1ZRC A;  1OYW A;  5DCM A;  1IXC A;  1FYK A;  5HS8 A;  4DNC A;  3FX3 A;  1OYI A;  2VC0 A;  2QZ8 A;  3DQV C;  1UHM A;  3WU0 A;  1E17 A;  2TDX A;  2PN6 A;  2O6G E;  2A69 F;  5LLQ A;  2VBY A;  1BC8 C;  1KU2 A;  3GEZ A;  2PEX A;  2FML A;  1IN5 A;  1EV7 A;  1IRF A;  3N97 A;  5HLI A;  4NHJ A;  1XCV A;  4F7Z A;  4JK1 X;  3T8R A;  2G7U A;  3MZH A;  4A0Z A;  4I0A A;  5TRD A;  2V6C A;  2DLL A;  5ERI A;  2Z99 A;  1XD7 A;  1UCR A;  3F8C A;  5D5U B;  4I02 A;  3TQN A;  2CGP A;  5FLX Z;  2PBI A;  3FXU A;  2BYV E;  3R0A A;  3KZZ A;  2A5Y B;  5E1W A;  1MDM A;  3KP6 A;  1BJA A;  3ML6 A;  4RGU A;  2OAZ A;  1YQA A;  3R0J A;  3I0T A;  3RIR A;  3TO7 A;  3MZY A;  1SAX A;  4I01 A;  2OZ6 A;  3P9C A;  2JPC A;  1J5Y A;  2D1H A;  2Y0M A;  2YPR A;  2IT0 A;  2FU4 A;  5D5W B;  2MD5 A;  2WC2 A;  3ECO A;  3R4K A;  2M87 A;  4ENN A;  1R22 A;  2J5O A;  3GW2 A;  5ED4 A;  4XLP F;  2FNP A;  1SFE A;  2M30 A;  3F6V A;  4BHB A;  3L9F A;  2PG4 A;  1TNS A;  4PCQ A;  5E8G A;  4OOI A;  5E1Z B;  3RTR A;  2H94 A;  5J8C A;  1HBX G;  3GFI A;  3J80 Z;  5F1R A;  4S05 A;  4UVB A;  2VBZ A;  3TGN A;  3DF8 A;  2FBH A;  3Q5F A;  3FF5 A;  3EYY A;  4G7Z F;  4LMY A;  2LKP A;  2HDC A;  1T0F A;  1Z05 A;  4Q5S F;  1FLI A;  4CGZ A;  3O2P E;  2JZY A;  1QO0 D;  3RI4 A;  4LLG F;  1YW8 A;  4EM0 B;  4RGR A;  5E20 A;  3HYI A;  2HFH A;  3BPX A;  4B8X A;  2DK8 A;  3Q9V A;  3V8L A;  2RC4 A;  3HRS A;  2ETH A;  1SFX A;  2OQG A;  1J2X A;  1OR7 A;  2KIF A;  1W5T A;  2QYO A;  4P9F A;  1K6O A;  2MA3 A;  5JVT A;  2HYG D;  2WV0 A;  1FBU A;  3ZN0 A;  2FBK A;  5HS7 A;  2K86 A;  1R7J A;  3SQN A;  2P7C B;  4B09 A;  3V7R A;  3ZP5 A;  3ZMV A;  3F8N A;  1O7F A;  3ZMD A;  2VN2 A;  1YW7 A;  2MH2 A;  5HLH A;  2PMH A;  1W7P A;  3KLO A;  1FYM A;  2Y48 A;  5FO5 A;  3HRT A;  5LBQ A;  3R60 A;  1D8K A;  4LB6 B;  1YFH A;  2NAZ A;  5CYV A;  2VC1 A;  5EEG A;  2A07 F;  1ODD A;  2YR2 A;  3CO6 C;  2DPU A;  5BPI A;  4KA4 A;  3BJ6 A;  1FOK A;  1U5T A;  2O8X A;  3MAJ A;  2XAQ A;  1XCB A;  5AIP A;  2ZNY A;  2HOE A;  1GXQ A;  4EMS A;  4EM1 A;  1YIO A;  5JFR A;  2GA1 A;  4ESF A;  4RB1 A;  4O3M A;  3EET A;  2CSO A;  4NB5 A;  1P4X A;  2FQ3 A;  1ZG5 A;  1J7K A;  1S3J A;  1FBQ A;  1LEB A;  1JHH A;  1BIA A;  1MJ9 A;  2PQ8 A;  3BZ6 A;  1S8N A;  5J8F A;  3I59 B;  3I64 A;  4U0V A;  4KIF A;  4LFU A;  4EM2 A;  3JSP A;  2LNB A;  1GVJ A;  2KJB A;  4BQA A;  3BJO A;  5DYM A;  2DK5 A;  3GZ5 A;  3H3U A;  1B9N A;  2CQK A;  4HX8 A;  4MQV A;  3QP5 A;  2JT1 A;  3ROU A;  4Q48 A;  5L3F A;  4EGY A;  4WX9 A;  2VE9 A;  1TQM A;  5D6E A;  1FYL A;  4YFX F;  1STZ A;  1MZB A;  3HOT A;  2A61 A;  1XMA A;  2DO7 A;  4H0E A;  1O57 A;  2PI0 A;  4P9U A;  1REP C;  3VOE A;  3VB2 A;  3W6J B;  4BHC A;  2D1V A;  1W7P B;  4BHP A;  3KP5 A;  2W84 A;  3V7C A;  4PZJ A;  1MDM B;  4M71 A;  1PUE E;  2RGV A;  1FP2 A;  3HSR A;  2MC3 A;  1W4M A;  4EJU A;  4KIG A;  2V1U A;  1B9M A;  3CUQ C;  5K1Y A;  2EV5 A;  4KUM A;  2O61 A;  1KGS A;  1HKT A;  1U2W A;  2C6Y A;  1JGS A;  2LDU A;  4OU0 A;  3F6O A;  3DV8 A;  3CTA A;  2IA0 A;  3B73 A;  1IZ1 A;  3NRV A;  4WF2 A;  2ACJ A;  2FA5 A;  2FMY A;  2Q8K A;  5BOX A;  2EJR A;  3WG9 A;  4AIK A;  3HTU A;  2ESN A;  2XVC A;  3DPT A;  5D8L B;  3OOP A;  3K69 A;  1F5T A;  1TW2 A;  3WOD F;  3T5X A;  1G6N A;  4JQF A;  5FB2 A;  3W6K B;  1FY7 A;  3J80 K;  1I6X A;  4AIH A;  4IXA A;  4UXN A;  1O3Q A;  2O0Y A;  3Q9S A;  1UFM A;  2G9W A;  1ZRE A;  1ZAO A;  2IJL A;  2XKP A;  2UWM A;  2J5P A;  1IW7 F;  2EFN A;  2CO5 A;  1RIO H;  1OPC A;  4EJW A;  2VE8 A;  2DI3 A;  4KN4 X;  2W57 A;  4N9H A;  1ZHF A;  4CYD A;  1SD5 A;  3WGI A;  1V4R A;  2BBY A;  3F22 A;  5D6F A;  2STW A;  1OKR A;  4A5N A;  3SZT A;  1XMK A;  3TOB A;  1BI2 A;  1TNT A;  4AVP A;  5K5R A;  1QNT A;  2HEO A;  4UVA A;  2A6E F;  3GO5 A;  4BYY A;  1YW9 A;  2FBI A;  1I27 A;  1AWC A;  1SMY F;  3FXQ A;  3C18 A;  3D5L A;  3JAM Z;  1GHC A;  4M73 A;  1BI0 A;  3MQ0 A;  4EJO A;  2ZJ2 A;  4WXD A;  5CVR A;  2OBP A;  6PAX A;  2XRO A;  2X0L A;  3DXJ F;  2NYX A;  2GXB A;  3NQO A;  3RKX A;  1FSE A;  1QQI A;  2ZFW A;  4HLX A;  4XBF A;  2HKO A;  3TO9 A;  4ENM A;  1VTN C;  3F8B A;  4KT5 C;  2QQA A;  4Z2Y A;  3F8M A;  4RAY A;  3QU3 A;  3PQJ A;  2QVO A;  1FSH A;  4XRF A;  1G3W A;  1KYW A;  3DPL C;  1LVA A;  1USS A;  2CWE A;  1XGM A;  5H6R A;  2W85 A;  1WSU A;  3U1D A;  4ZYG A;  1BOA A;  3GYH X;  1Z6T A;  4O5V A;  2P8T A;  3RKY A;  1KU9 A;  3WGH A;  3J7A O;  2F5D A;  4IRG A;  2L3D A;  3KP7 A;  4GCV A;  1P92 A;  1R5H A;  2E7X A;  4R1H A;  3I5U A;  3QU6 A;  1P4A A;  2MH9 A;  3DP7 A;  3V4G A;  3K1N A;  3F8F A;  4YII A;  4LK0 F;  4HV5 A;  3E3V A;  5CVU A;  1YYV A;  4ZZL A;  3F23 A;  3LA2 A;  2DT5 A;  3FHZ A;  3GZ6 A;  1YS7 A;  1SD4 A;  4LJZ F;  3ELK A;  5AON A;  2CW0 F;  2EFO A;  3EDP A;  2YX7 A;  3FMQ A;  2UZK A;  1DP7 P;  1WRJ A;  2M45 A;  4ESB A;  2EFW A;  4KN7 X;  4G7O F;  2QBY A;  4O6J A;  4G6D A;  2FOK A;  2EA2 A;  4L9N A;  2JTV A;  4KYW A;  4BH9 A;  3RJP A;  5E18 F;  2H09 A;  2DFI A;  1R1V A;  3QP6 A;  5LHI A;  2FSW A;  4FX0 A;  2NRA C;  2L01 A;  3ZPL A;  2PJP A;  1XSD A;  3WTX C;  3KCC A;  2GAU A;  1YS6 A;  3I71 A;  5CJ9 A;  4MTE A;  4FX4 A;  3E6B A;  4OIO F;  2VOP A;  3N4M A;  1ULY A;  4XSX F;  4ZZD A;  2WTE A;  2XAJ A;  5E17 F;  1FBS A;  3D0S A;  3M1E A;  1D5V A;  1W7P D;  1MJB A;  2L4A A;  2P6T A;  2UXN A;  1ZH5 A;  1D3Y A;  1B59 A;  2DQL A;  3ULQ B;  2P5V A;  4WK8 F;  1ZLJ A;  4MHG A;  2XIG A;  3RPU A;  2QQB A;  2DBB A;  2EFP A;  3K0L A;  1LQ1 A;  4Y15 A;  1ZRD A;  3KZY A;  3GVA A;  4MNU A;  2IP2 A;  1OMI A;  3DKW A;  4OMZ A;  1FP1 D;  4XLN F;  4RGX A;  5K5Q A;  1Z6R A;  3SZP A;  1WKM A;  5HOO A;  5CLS A;  4M6Y A;  1Q1H A;  2VOD A;  2QLZ A;  1U5T B;  2GXG A;  4HX7 A;  1UB9 A;  5HS9 A;  4L9T A;  1HW2 A;  4IHT A;  3KE2 A;  5DCF A;  3EUH A;  1O3R A;  4G8X A;  3K2Z A;  1ZN2 A;  3F72 A;  4HX4 A;  4IJA A;  2EA4 A;  5LGU A;  4YFN F;  3KFW X;  1E2X A;  1SFU A;  2LSO A;  1I5Z A;  1X3U A;  2EB7 A;  3CUQ A;  3R61 A;  5ICC A;  1R23 A;  1R5G A;  2GIV A;  5CVV A;  1XGO A;  4WCG A;  2W25 A;  2DU9 A;  2Q0O A;  4IRI A;  2CG4 A;  1RUO A;  2P5K A;  4N0B A;  4M9X A;  4P96 A;  3VOD A;  1ZYR F;  3QOP A;  2X4H A;  3I54 A;  4U88 A;  4KMU X;  4GYI A;  3CUO A;  1Z9C A;  5EEH A;  3HUG A;  5FD5 A;  4CO8 A;  2K4B A;  3L7W A;  1TBX A;  2HQN A;  1RNL A;  1HSJ A;  2QWW A;  2QQ9 A;  5FLX K;  4RGS A;  5DCM B;  1HKS A;  3JTG A;  3HSE A;  1TQI A;  2L02 A;  1F9N A;  2K4J A;  2NS0 A;  4CDG A;  4ESJ A;  3FZV A;  1G3T A;  3GXO A;  1S7O A;  1F1Z A;  4A12 A;  1IF1 A;  3DEU A;  1L3L A;  2EFQ A;  1U6G A;  3TDU C;  4LB5 A;  5LRS A;  2JRT A;  3C3W A;  3BPV A;  4YG2 F;  1G3Y A;  2XHK A;  4Y13 A;  2IW5 A;  1EH8 A;  4KMF A;  4ZYH A;  3I58 A;  2E1C A;  3R6S A;  4E70 A;  1J0R A;  2XGX A;  4UV8 A;  3RDI A;  3WE3 A;  3KEQ A;  3E6M A;  2R7F A;  1V3F A;  4LLL A;  2VXZ A;  3TOA A;  2YU3 A;  3RKW A;  4CXF A;  3MWM A;  5HLG A;  1R1T A;  1LJ9 A;  2K7L A;  3G73 A;  1CF7 A;  4A0X A;  3FWE A;  5AIQ A;  1K79 A;  1IN7 A;  2KRF A;  1KA8 A;  3FM3 A;  3ERE D;  2XRN A;  3K9T A;  4MEX F;  3V7S A;  4UVC A;  5BQT A;  1PP7 U;  3LAP A;  2VBX A;  2LF8 A;  1JE8 A;  2E1N A;  4LLN A;  2F5C A;  1G3S A;  4KNY A;  1IUY A;  3WTS C;  1YLF A;  3E5U A;  4AD9 A;  1S7A A;  3WTZ A;  2RNJ A;  4L9V A;  2DPD A;  4U0W A;  4FT8 A;  1QBJ A;  4CIC A;  3REO A;  4HDV A;  1LDJ A;  1HKQ A;  4R8H A;  3ZQ7 A;  2DAO A;  4LG0 A;  3CO7 C;  1UHW A;  4IHS A;  5A2Q K;  1O3S A;  1H9T A;  2HS5 A;  3ISP A;  4HF1 A;  1Y0U A;  1P2F A;  4RB3 C;  4I98 B;  1DPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...