4HV6A

Structure of mntr h77a mutant in apo- and mn-bound forms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
133
structure length
133
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRAELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C sites in the manganese-specific activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
total genus 49
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hv6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hv6A02
3EDPA 2O61A 2LSOA 3U2RA 4ZYEA 2ACJA 5HS8A 3F8CA 1BIBA 3IKTA 5FLXZ 1D3YA 2DK8A 3HUGA 3KEOA 1BC8C 1GVJA 3GZ6A 2JRTA 3TOAA 5ILUA 3VODA 2EWNA 1O3SA 1IAWA 4HAMA 2XGXA 2HDCA 5DUKA 3T8TA 2XASA 1R00A 2UXXA 1W5SA 1O3TA 4MQVA 2QZ8A 4P9FA 1BN5A 1KQ9A 2GZWA 4ZZLA 1YLFA 2EFPA 2VOPA 1I27A 1AOYA 2FMYA 1SD4A 5K1YA 5ICCA 5E8IA 3BDDA 4WX9A 2GA2A 3HTUA 1ZRCA 4IRHA 2HR3A 2KIUA 2A69F 2V9VA 3MZHA 5BS6A 5HS7A 2NAZA 3LA3A 2RNJA 3FXRA 2P8TA 2R7DA 3HSFA 3V7CA 4I0BA 3BJAA 4O5VA 1KU2A 2HGCA 3QU3A 3K9TA 3EQLF 2R3SA 1T39A 3FF5A 3K69A 2IP2A 3ECOA 1PP8F 5L3EA 4I7HA 4KMFA 3V8LA 4N0BA 4UV9A 4YIIA 3GFJA 3BPXA 2IPQX 4ON0A 3Q9VA 4OMYA 5H6QA 1P4WA 3GFMA 3CTAA 2L3DA 1J2XA 1QZZA 1SD6A 3WODF 3HSRA 3F8MA 3M1EA 1EV7A 2MLKA 4HQEA 5CYVA 3JAMK 1ZG1A 2L54A 5LBQA 1XCBA 1JXSA 2QLZA 5J8CA 4L9NA 1TNTA 4BXUA 3ZMDA 2DU9A 2FU4A 1Z91A 5EEGA 3HSEA 4MEXF 1B1BA 2NRAC 3WTYC 1YYVA 2O03A 5HDKA 3ERED 1D8JA 1XMKA 2HTSA 3C1DA 4HX7A 1YW8A 4A5MA 4I09A 2UWMA 1I1SA 2YSRA 2GXBA 2M1BA 1SFEA 2DW4A 1ZLJA 5A2QZ 1BM9A 1V3FA 5E18F 2V6CA 1U5TC 5DYMA 4UHTA 1UB9A 3TO7A 3R6SA 1P92A 2DQRA 4LLNA 3FX3A 5ILSA 5E1ZB 1G3TA 1WRJA 4KICA 5AIPA 5D8KB 1YQAA 3T8RA 4Q4ZF 4LK0F 3F6OA 3V8JA 1WSUA 1ULYA 3CLOA 3P9KA 1QQIA 2CSOA 1Z6TA 1YG2A 3LQRA 4M9XA 4ZYDA 1K79A 3HHGA 2LNBA 2OD5A 3HHHA 4FX0A 4ENKA 4U0VA 4B8XA 2VE8A 3KZZA 1LJ9A 3I58A 3GEZA 1HW1A 1QO0D 5F6FA 4CO8A 4BHCA 2R7FA 4A12A 3EUHA 5DUIA 4OINF 1QZYA 3K1NA 2CO5A 1YW9A 3H3ZA 1GXPA 1PUEE 4GGGA 4A0XA 2JTVA 5L3BA 1KQ8A 4A2UA 2GWRA 3KEQA 3C7JA 4OIQF 5BPIA 2JSCA 3R0AA 3MZYA 2KKOA 4N9HA 4IXAA 1R1TA 2QQBA 1J75A 5FO5A 1ZLKA 3VOEA 4OIRF 3DPTA 3J80Z 2GQQA 1S29A 2K4BA 1USTA 2EFOA 2ZKZA 1J9IA 1USSA 5TJJA 5CVIA 3Q9SA 3ZN0A 1LEAA 2UXNA 3MAJA 4HF1A 5E20A 2BBYA 3F8NA 1WQ2A 4G9YA 3RIRA 1KYWA 2A07F 1JGSA 1FBUA 4L0ZB 1K78A 5DDGA 4L5JA 2VODA 3WE2A 4KYWA 4FT8A 1FSEA 3F8BA 3KLOA 2EFQA 3ZMZA 1U5TB 2QUFA 2QYOA 1RIOH 3QOPA 2GXGA 5E8GA 5HOOA 2PQ8A 4RGSA 1XSVA 1SD7A 3GYHX 3HRTA 3BWGA 3N97A 3CDHA 4IVNA 2IJLA 5E1XA 3M9AA 4AIJA 2VT3A 4LD5A 4ENNA 3DF8A 1SFUA 3RYPA 1TTYA 1E17A 1IN6A 1LDDA 3M8EA 4A6DA 1XGSA 4G8XA 3GF2A 1KQ0A 4IPAA 1IXCA 2ZCWA 1MZBA 4YG2F 1R5HA 1ZGAA 3G73A 3MQ0A 3CO6C 3MWMA 1IN7A 3AAFA 4EGYA 2HTJA 2DO7A 4UNOA 3EYYA 3KP6A 4L0YB 3ELKA 2NS0A 1XMAA 5CVRA 4UV8A 4M71A 4PGHA 2CFXA 2O8XA 3KLNA 5CVJA 3TDZC 1ZAOA 4E70A 3G3ZA 2QENA 1T98A 4M6YA 3JSPA 5H20A 4A6EA 1GXQA 1IRGA 1IN8A 1FP1D 4M9ZA 1G3YA 3PQKA 4EJWA 2D1VA 1KA8A 2DT5A 3QPHA 3JSOA 3KP7A 2HQRA 2F5EA 4ESFA 3HOTA 4YFXF 4WXCA 2Z33A 1B59A 3CUQA 1XGOA 5KK1A 5JFRA 1W7PA 3I54A 1SFXA 1B9NA 3FXUA 3K1PA 2VBYA 2MC3A 4ESJA 3K1MA 4GXOA 3GO5A 3GFLA 2H27A 1V4RA 2PLYA 2J5OA 3FMSA 4M74A 2FMLA 1HW5A 3HOSA 1TLHB 1DPRA 2P7VB 4LLGF 1TQMA 2ETHA 3QAHA 3ABTA 1RNLA 3RDIA 1REPC 3WGGA 4ENJA 4JQFA 2E1CA 2XVCA 3JW4A 4EVIA 3EETA 1JHHA 3F6VA 3ZMUA 4M9SA 4HZFA 5IT9K 1YS6A 4HA8A 4KDPA 1OYWA 5HDGA 2B0LA 4Q5SF 2QM3A 5K5OA 2HKOA 1FOKA 2ZBKA 3F23A 1Z6RA 1J0RA 5DD8A 1IXRC 2XAFA 2PN6A 1ZRDA 4HLXA 1EH7A 4A5NA 1SAXA 5ICFA 1Z7UA 3TGNA 1B9MA 1ZG5A 3V4GA 3C18A 2YX4A 1B4AA 1ZRFA 2QBYB 2WC2A 5BMZA 4LB5A 1QBJA 1MJAA 2D2WA 4KT5C 4NB5A 5HVQC 3ZMVA 3KCCA 4U7BA 3IL2A 4N9IA 4Q48A 3Q5FA 1XSDA 1MD0A 3HIFA 3LFKA 2TDXA 4GYIA 1IW7F 3GLXA 1YFHA 1IUYA 3FZVA 4S04A 1ONVA 2M87A 2E7WA 2CGPA 1R5GA 2M45A 2HYGD 4IRGA 2PJPA 3IC7A 2EV0A 4IJAA 1R23A 2EK5A 3VB2A 1UCRA 4ESBA 3N4MA 2EV5A 5D4RA 3BROA 4KNYA 3FHZA 1K78B 2KJCA 3LSTA 2JT1A 3ZPLA 5ILVA 1A04A 2XKOA 3LA2A 4CXFA 3BPVA 2P7CB 3DEUA 5CJ9A 1U6GA 3FM3A 4OOIA 1LEBA 1BJAA 5ICGA 2XAGA 4KIBA 2FE3A 5IT9Z 2Z3YA 2FF4A 3U9GA 4BHPA 4XBFA 5D5UB 3IWZA 2C6YA 1P4AA 3GXOA 3T5XA 2DBBA 4EJVA 1G4DA 3QU6A 1R36A 3E5QA 4RGRA 2PEXA 1KU9A 1LNWA 4ZH4F 4L9VA 4PCQA 1J7KA 4L5IA 2A3SA 4F7ZA 5F1RA 2FEZA 2L02A 4JBAA 3WTZA 1WWXA 1LDJA 2J5PA 2VE9A 1BI2A 4R1HA 3WTWC 1BI0A 2K27A 2XAJA 5LHIA 3O2PE 1TNSA 3CUQB 4L9JA 2MBFA 1OYIA 3J80K 3ZN1A 4MHGA 1JE8A 1DPUA 1F1ZA 3KE2A 4R79A 1L3LA 4WWCA 1XB4A 2ZNZA 4EGZA 3BZ6A 3IHUA 1BOAA 2PG4A 3CUOA 2RV8A 4BH9A 5TRDA 1MDMA 5LRSA 1QNTA 5DD4A 4Q47A 2EJRA 2OAZA 5HS9A 3ZQ7A 1P6RA 4KUMA 1SMTA 3WTSC 2KJBA 3PFIA 1D8KA 2YX7A 1J59A 5JVTA 1HKTA 2VBWA 1ZGJA 3JTGA 4RB1A 4IF4A 4YFNF 4HLYA 4HYEA 3W6JB 2DI3A 2V79A 1T38A 1XDSA 2O6GE 1FT9A 2W24A 1T2KA 2X4HA 4A0YA 4G7HF 2RN7A 4ZZDA 5F64A 1HBXG 2HS5A 2FBKA 1STZA 3FM5A 1BIAA 2E1NA 1FYLA 4MGRA 3HRMA 2DLLA 3COAC 5D5VB 3SXYA 2O0YA 5J8FA 5L3GA 3P9CA 3BOQA 5DV5A 2VC0A 1PDNC 2VC1A 4EV0A 2P6TA 4PGGA 5IT3A 2EA2A 4HDUA 2HOEA 2XV4S 2FRHA 3IKVA 4H0EA 3L2CA 4GYGA 4LK1F 2XIGA 1UFMA 4CICA 1ZYRF 4I01A 3TO9A 2WWYA 2FA5A 2F2EA 3EYIA 3KP2A 1RUNA 3RPQA 2MA3A 2H94A 2CYYA 2ISZA 4TV7A 4Y17A 1K7AA 5ERIA 2FBHA 2PMUA 5ICEA 2PMHA 1RI7A 4LJZF 3HTSB 3V7SA 1CF7B 3KZYA 3WE3A 3SFZA 1ZARA 1NHAA 1LB2A 3E97A 4XSZF 4LGWA 4WF2A 4LG0A 1O3QA 2DAOA 4U0WA 3WTTC 1FLIA 3QP5A 2ZO4A 5AONA 3JAMZ 3NQOA 2W84A 4GCVA 2QBYA 5E1WA 2W25A 1Y0UA 2P5VA 2YR2A 1FYKA 2AS5F 1K6OA 1FYMA 2OZ6A 5LRRA 1HKQA 3H3UA 5FD6A 4KN7X 3D5LA 3RKXA 5LGUA 2M5WA 1TW2A 2DQLA 5FGMA 4EJUA 4WK8F 5AIQA 2ZMEB 4RAYA 4MEYF 1F5TA 4M6XA 5FLXK 2RQPA 4O6JA 3WTVC 2O3FA 3BJOA 4I0AA 4NHJA 2PBIA 2IA1A 2MH9A 4P55A 1FC3A 2ZJ2A 2JZYA 3IWFA 3RTRA 1XD7A 1S6LA 4UVBA 2PFBA 5CVVA 2LF7A 2LKPA 2YPRA 3R61A 1BBYA 4HW0A 4UXNA 1SD5A 1U2WA 4EJOA 4IHSA 1UHWA 4KMUX 2KRFA 1HW2A 3GX4X 2YU3A 2EFNA 2DPUA 3OOPA 1RZ4A 5E17F 3M8FA 3DFGA 4RB3C 3FXQA 3SZTA 2Y0MA 4EJTA 4AVPA 3FWEA 2ZXJA 2L01A 5DCFA 3T1BA 1CGPA 2STWA 3O3KA 5H6RA 1G3SA 3DXJF 2H6BA 2RDPA 2RKHA 2Q8KA 3BP8A 3SQNA 1F9NA 4OMZA 4Y15A 4PDKA 1YS7A 1S7AA 1FZPB 2CQKA 1P2FA 4P5OA 3E3VA 3TQNA 2ZNYA 1DDNA 4HX4A 5HLHA 2ISYA 1ON2A 2V1UA 3M7GA 1H9GA 1XDUA 4M72A 2IA2A 2JPCA 3GW2A 1IF1A 3DV8A 3K2ZA 1MDMB 1R58A 5HDNA 1SMYF 2G7HA 1TBXA 2XUBA 1XN7A 2VOOA 2F5FA 2WTEA 4DQ2A 3L00A 1BC7C 1MGTA 3FMQA 1TQIA 5CVUA 3IRRA 3J81Z 5LGNA 1OYYA 2H6CA 5BQTA 5LGTA 1YIOA 3LA7A 1HSJA 2PI0A 2EA4A 2XRNA 4QWQA 2KIFA 3RKYA 3PQJA 1W7PD 4BHBA 1FBSA 1G3WA 1OMIA 2G7UA 5FB2A 3KETA 3FMRA 2VN2A 1YO5C 2EV6A 2H09A 1ZH5A 1LDKB 4PZJA 2CW0F 3WU1B 4A0ZA 4HF0A 3NRVA 3KP3A 2VXZA 4NQWA 3VEPA 1I5ZA 2QQ9A 3E5XA 5LHHA 2ESHA 1LVAA 2M8EA 5JI6A 1BI1A 3WU0A 1HSTA 3C3WA 2L4MA 2Q0OA 4M73A 2HFHA 1J5YA 1O57A 3GFIA 4BAYA 1KU7A 1E2XA 1FNNA 3P7NA 2ELHA 2ZFWA 4I2OA 4FHTA 4P9UA 5D6EA 3MFKA 3TOBA 1R1UA 2P4WA 3DP7A 2VBXA 4LLLA 1T6SA 3E6BA 3U1DA 1AWCA 2FXAA 2K02A 4EM0B 2V1XA 2L4AA 4Y13A 1IN4A 4IHTA 2GIVA 4L9TA 2XKPA 1HQCA 3F3XA 4XSXF 2IT0A 4CDGA 5CLSA 3GVAA 4HQMA 2OU2A 4HX8A 4CHUA 2KIMA 4O3MA 3LQQA 2DTRA 3IRQA 2X0LA 4AIKA 1Q1HA 5D5XB 4CGZA 4XLPF 4G7ZF 2P5KA 3W6KB 5ED4A 3J81K 2K4JA 2Z5UA 3J7AO 3R60A 4KA4A 1LQ1A 2MLGA 4DNCA 1FSHA 2FNAA 2BE5F 3ULQB 2CWEA 4JK1X 5D8LB 1FPQA 5D4SA 4RGUA 4OU0A 2MH2A 4LMYA 4CYDA 2HEOA 3WTUC 2D1HA 3WGHA 1XGMA 2NNNA 2IA0A 2LF8A 3RYRA 1R7JA 3GZ5A 3DKWA 1DP7P 1XSXA 2Q2EA 1OR7A 4S05A 1KGSA 3NEUA 4HBLA 4RGXA 2QVOA 3I71A 2Z9OA 2A61A 1GHCA 1U78A 4RB2C 1FBQA 4HOBA 4HF2A 2FNPA 3I59A 2BEOA 1ZN2A 1KU3A 2CG4A 4K2EA 2STTA 3GUDA 1F4KA 1HXDA 3I5UA 5EEHA 4EQQA 2M30A 3QPTA 4Z2YA 3KP4A 5LEKA 3E5UA 1IXSB 2FOKA 2EB7A 4CZZA 3RKWA 3KFWX 2ESNA 3T0YA 2RVCA 3BY6A 3ZMSA 2HQNA 3MEXA 5HLIA 2LDUA 4EM2A 2V1DA 1H0MA 2XHKA 1ZHFA 3I4PA 4WCGA 3B73A 1ZREA 5K5RA 5BOXA 2HWVA 1P4XA 4EM1A 3E6CC 2EFWA 4ASNA 3F21A 4BNCA 4IRIA 4YIFA 2NNYA 4I02A 1VTNC 2BV6A 1G6NA 1U3EM 1QPMA 2OBPA 1R22A 2FBIA 1XCVA 2E7XA 3V7RA 4ENMA 3LAJA 3I53A 1S3JA 2ADUA 3V8KA 1XGNA 1Z1DA 1C0WA 2D45A 2OQGA 5DEQA 3LWFA 2XAHA 4UVAA 5L3CA 3E6MA 2UZKA 1L0OC 3R4KA 4KIFA 5J6XA 2DPDA 2HYFA 2A6EF 3LAPA 3RPUA 4D0PA 2IRFG 1UHMA 1FY7A 4WXDA 5HLGA 1ZG3A 3I59B 4LB6B 3ZMTA 4AWXB 1B6AA 1YW7A 1W5TA 3WGIA 1FWZA 5FFXA 1ON1A 1WKMA 4BQAA 4AIHA 1EH8A 1S7OA 2DK5A 2G9WA 1IRFA 3CUQC 3WTXC 3DPLC 4G6QA 1QGPA 5FD5A 2ZMEA 1S8NA 3I64A 3RJPA 4G6DA 1FX7A 5A2QK 6PAXA 1FP2A 3K0LA 3HRSA 2A68F 5L3FA 3F22A 3GWZA 4ZYHA 1CF7A 2GAUA 5DCMA 3ROUA 3CJNA 4EMSA 1D5VA 3SZPA 5LLQA 3ISPA 2VONA 4P96A 3F72A 5JHUA 3F8FA 2BYVE 4L18B 1YTYA 2RGVA 1BI3A 1KYZA 4LG0B 4XLNF 1MJ9A 4UUVA 1HKSA 5DCMB 3B02A 2W85A 4ETSA 3CO7C 3SHFA 1Z9CA 3HRUA 3TKYA 4YFKF 2VT2A 2WV0A 1O7LA 3QRFF 4MQ9F 1EH6A 2OZUA 4KFCA 4HV5A 5D5WB 4B09A 2JPBA 4GO1A 2IVMA 4MNUA 3ZP5A 1TQPA 4UVCA 1TW3A 1DUXC 2COMA 3RI4A 1O7FA 1W7PB 3O6BB 2A5YB 1U8RA 3H92A 2K86A 1H9TA 2FQ3A 5BPDA 4AD9A 4BYYA 1X3UA 1JHFA 3D0SA 1U5TA 2IW5A 4U7DA 5JR3A 4OIOF 1R1VA 2K7LA 3TDUC 5LEJA 4ZYGA 4RAZA 1ODDA 2Y48A 4G94A 2BGCA 3DQVC 5LHGA 5D6FA 3L09A 1T0FA 1PP7U 1O3RA 2OQRA 2QQAA 3OV8A 2Z99A 3MCZA 4FX4A 4HDVA 4U0YA 2A6HF 5K5QA 1IN5A 2QWWA 4KIGA 1W4MA 1Z05A 3R0JA 3ECHA 1MJBA 3WG9A 3L7WA 1I1GA 3JTHA 4XRFA 1WI9A 2RC4A 4G7OF 4RB0A 5FFZA 2F5CA 2NYXA 1I6XA 2VBZA 5L3DA 2MD5A 3QP6A 4LFUA 1MKMA 3I0TA 4MTEA 3REOA 1RUOA 3ML6A 4I98B 3E6DA 2AXLA 2OA4A 5KVRA 3BJ6A 3TO6A 2XAQA 4U88A 2P6SA 4MTDA 2HZTA 2F5DA 2XROA 2P5LC 2W57A 2DFIA 3ABUA 4KN4X 3KP5A 1IZ1A 4R8HA 4HV6A 2Y75A 3L9FA 4WXHA 3HYIA 3S2WA 2HKXA 3VFZA 2FSWA 1OPCA 4OIPF 1OKRA 4RS8A 3P9IA 4QLCU 2GA1A
chains in the Genus database with same CATH superfamily
2BY1A 2QKLB 3EDPA 4YEJA 2O61A 2LSOA 3CCQI 1WPKA 3U2RA 4AYBA 2XC7A 1RQ6A 4ZYEA 3W3CA 2ACJA 5J4YA 4C30A 5HS8A 3F8CA 1BIBA 3IKTA 5FLXZ 4X0GA 1D3YA 1YOVB 2DK8A 2CJJA 3HUGA 3Q0UA 3KEOA 1BC8C 1GVJA 2GM4A 2P0TA 2DN0A 2F5VA 5C4JJ 3GZ6A 1GVDA 2JRTA 3TOAA 1LFBA 1IV8A 1OQYA 3K4LA 5ILUA 3VODA 2EWNA 2XRLA 1O3SA 1WJEA 1IAWA 5IOYA 2E71A 3AL0C 2CH0A 4HAMA 2V7FA 2XGXA 5EG0A 2JA8J 2HDCA 5DUKA 3T8TA 2XASA 2JUCA 4LG3A 2NVTJ 1R00A 4C2TA 2UXXA 1W5SA 3G2BA 1O3TA 2O9LA 4MQVA 2QZ8A 4P9FA 1BN5A 1KQ9A 2GZWA 3DKYA 4ZZLA 1YLFA 3DU5A 2EFPA 2VOPA 1I27A 1AOYA 4BKXA 4DYRA 3HOVJ 1ZQ3P 4HNVA 1QPIA 2FMYA 1SD4A 3BR5A 3HJEA 5K1YA 2PJRB 3VPRA 5ICCA 3QOEA 5E8IA 4PJNA 3VYTB 2LOOA 3BDDA 4WX9A 2GA2A 4NNJA 3HTUA 1SAUA 2BXYA 2BY0A 2LD5A 1ZRCA 4IRHA 2DJNA 1VQPI 2HR3A 2KIUA 2A69F 2DTZA 2V9VA 3MZHA 2IBDA 5BS6A 5HS7A 1VQ9I 3PO2J 2NAZA 3LA3A 2RNJA 3FXRA 2P8TA 2K5CA 2R7DA 3HSFA 4I0BA 3BJAA 4O5VA 3V7CA 4FE7A 2QSGX 3DTKA 1KU2A 2RNGA 4ZC3A 3DBLB 2HGCA 2XGDA 1FIAA 3QU3A 4BDZA 3K9TA 2EZKA 3IP4B 5E3OA 3EQLF 1TC3C 4CCJA 1VQOI 2R3SA 3HOZJ 1T39A 3FF5A 5JHFA 3K69A 2IP2A 2QSFX 3ECOA 1PP8F 1JJ8C 5L3EA 4I7HA 4KMFA 3V8LA 4BE0A 3OYGA 2E60A 3OR2C 4N0BA 3BQZA 2VL8A 1I3QJ 1POGA 2M9HA 4UV9A 1Y39A 4YIIA 3GFJA 3OIPA 2OV7A 3BPXA 4IKFA 1LUJB 3TL4X 2WV1A 2VKVA 2IPQX 3JRGA 1I50J 4ON0A 4BJ6C 1WHUA 3Q9VA 4OMYA 5H6QA 3J81R 1P4WA 4DIQA 3ZQLA 3GFMA 3CTAA 2L3DA 3BR6A 2DCEA 1J2XA 4EATA 1QZZA 2V6EA 4J19A 2Z16A 5J40A 2WY8Q 3SEZA 4FQGA 1OR7C 1SD6A 3AKZA 3WODF 2E2IJ 4N4OB 3HSRA 3QWLA 3F8MA 2Y2ZA 1MMSA 3M1EA 1F43A 1EV7A 2P0WA 2MLKA 2VKHA 4HQEA 2XGCA 5CYVA 5DM7F 3JAMK 1ZG1A 1JKOC 2EQRA 2L54A 1B8IA 3TP3A 5TGTA 5LBQA 1XCBA 1JXSA 2QLZA 2HDDA 5J8CA 4L9NA 3SZGA 1TNTA 2X85A 4BXUA 3ZMDA 2XDVA 2NVUB 2DU9A 2FU4A 3A03A 2CUFA 1D1CA 4IQJA 3VWBA 1Z91A 5EEGA 3H5RA 3HSEA 4MEXF 2M35A 1B1BA 2NRAC 3WTYC 3PIPF 1YYVA 2O03A 5HDKA 3ERED 1D8JA 1XMKA 4CYCA 5F27A 1PUFA 2HTSA 3C1DA 2K9QA 3S32A 4HX7A 1LE8B 1YW8A 4A5MA 1VQNI 4M3EA 3WHCA 1ETXA 2IGNA 4I09A 1K61A 3GTOJ 2UWMA 1D5YA 1I1SA 2YSRA 3K4CA 2OCEA 2GXBA 1OISA 2M1BA 1SFEA 2DA5A 2DW4A 2GOMA 1DGRM 1HCRA 2LBFB 3M8JA 1ZLJA 2B9SA 5A2QZ 1BM9A 1V3FA 5E18F 3LSRA 3VSKA 2HOTA 2V6CA 3VYSB 2IEKA 2KFDA 1BW6A 3K7AJ 1U5TC 3ZQIA 5DYMA 2MD0A 4UHTA 4I6ZA 2L7ZA 1UB9A 3HG9A 5HLTA 3TO7A 1X4OA 3R6SA 1P92A 2QCOA 4B1RA 2DQRA 4LLNA 3FX3A 5ILSA 2P81A 5E1ZB 1G3TA 1R4MB 3N05A 1QRYA 1WRJA 3Q0VA 1JT6A 4KICA 5AIPA 5D8KB 1TWHJ 1YQAA 3T8RA 2KISA 4Q4ZF 3OYEA 4LK0F 2WA0A 3F6OA 3V8JA 1WSUA 2R0QC 1MH4A 1ULYA 3CCUI 4ZTFA 3CLOA 3P9KA 1QQIA 2CSOA 1Z6TA 3GTPJ 2DMNA 1S5LC 1YG2A 3LQRA 4M9XA 4ZYDA 4DZPA 1K79A 3HHGA 2LNBA 2OD5A 2V9PA 3HHHA 4FX0A 3UNGC 4U0VA 3TW6A 1HDPA 4J00A 4ENKA 4B8XA 2IGOA 2KRCA 2Y9YA 2WADA 3BG6A 4Y33A 1WI3A 4JX5A 2VE8A 3KZZA 3GMEA 4ZDPA 1LJ9A 3I58A 3GEZA 1HW1A 2ZC2A 1QO0D 3HGGA 4XRSG 5F6FA 4CO8A 4BHCA 2CUZA 4QTRA 1GT0C 2Y30A 2R7FA 4A3MJ 3OSGA 4A12A 4A69C 3EUHA 5DUIA 4OINF 5CPRB 2Y0SN 4E7ZA 1QZYA 3K1NA 2CO5A 2UV1A 4A3CJ 2DOEA 2QA4I 1YW9A 5J1YA 1ETQA 2HYJA 2ZSIB 2R7WA 3K4BA 3H3ZA 1ACIA 1RETA 1GXPA 1PUEE 2NXNB 4GGGA 4A0XA 2JTVA 3RKQA 2DFEA 5L3BA 2LY2A 1ETWA 2QQ8A 1KQ8A 2BXZA 4A2UA 3PSIA 1MIJA 2GWRA 3E0JB 3HPHA 2R92J 3KEQA 3C7JA 2LC2A 4OIQF 5KNLA 3CMMA 5BPIA 2R7QA 3FBNB 3RPUD 2JSCA 3R0AA 3MZYA 2XGEA 2KKOA 3I4NJ 4CCKA 3OYFA 4N9HA 4JOMA 4XLEA 3OYBA 2YU9J 1JUPA 4IXAA 1R1TA 3QYFA 3W2AA 1LFUP 3S1QJ 2VPLA 2DA7A 2QQBA 3BZCA 1JTYA 5FO5A 1J75A 2LTPA 2VIXA 1YRNA 2ZFUA 1E3PA 1ZLKA 2XB0X 3GTGJ 2NS8A 3VOEA 1AHDP 1MNEA 4OIRF 2WB1A 2JK3A 3DPTA 3J80Z 2RQQA 3IH4A 2DODA 4D7NA 2LKSA 2GQQA 1S29A 2K4BA 2DJIA 1USTA 2EFOA 3NAUA 4PJJA 2CS3A 3DWLE 2ZKZA 2CV0A 5A2QR 4XRSA 2NVXJ 3A52A 1J9IA 2HPIA 1BJZA 2VQCA 1USSA 1MH3A 1B72B 3OS0A 5TJJA 3TW7A 1I6HJ 5CVIA 3Q9SA 3ZN0A 1LEAA 2UXNA 3MAJA 3D5RC 4HF1A 5E20A 1IJWC 2BBYA 3F8NA 3HKZN 4B48A 1WQ2A 4G9YA 3RIRA 1KYWA 2A07F 1JGSA 1FBUA 4L0ZB 5IP9J 1MMDA 2F4IA 4XMYA 2PMZA 1K78A 3PM1A 3S15J 1V5EA 3DEEA 3OYNA 4NC6A 5DDGA 4L5JA 2VODA 2OTJI 5GADJ 2LVSA 1UMQA 3WE2A 3JAMR 4PFPA 4FT8A 4KYWA 3NWTA 5E3MA 3FXKA 2Q1ZB 4IZZA 1FSEA 3F8BA 3KLOA 2EFQA 3ZMZA 1U5TB 2QUFA 5F0FA 2QYOA 2V1NA 1ZR4A 3J7YJ 1RIOH 1U0JA 4LIVA 2GOXB 3QOPA 2GXGA 5E8GA 2R7VA 5HOOA 2PQ8A 2VI6A 4RGSA 1IG7A 1QZEA 1SD7A 1XSVA 1CQTA 2I8DA 3OIQA 3GYHX 3HRTA 4XQFA 3BWGA 3N97A 1WJ5A 3CDHA 4IVNA 1LFPA 2IJLA 5E1XA 3D5SC 2O8KA 4CA0A 3M9AA 4AIJA 2VT3A 4LD5A 1ZTRA 4ENNA 3DF8A 3CDLA 1SFUA 3RYPA 1TTYA 3UKGA 3BQYA 3G1LA 1E17A 1IN6A 5GTIC 1LDDA 1S7EA 3M8EA 1ETYA 5TISC 3KIOA 4BY7J 3BTIA 4A6DA 1XC5A 3W6VA 1Q1VA 2PJRA 1XGSA 3LSPA 2VASA 3BG9A 5J4VA 1WH5A 2M0CA 4G8XA 4ABZA 1W0UA 5B1BH 3S8PA 2L9VA 1KQ0A 3GF2A 4IPAA 4V2GA 1IXCA 4CZCA 2ZCWA 1MZBA 1TP4A 3OMYA 4H4KC 5H2FC 4YG2F 1R5HA 1ZGAA 3G73A 3MQ0A 1RKTA 2E36A 4XRMA 3CO6C 3MWMA 1IN7A 4XNFA 3AAFA 1HC8A 5B3SH 4EGYA 3S3MA 2HTJA 2DO7A 4UNOA 2ELJA 3EYYA 3KP6A 4L0YB 3PJRA 4BDYA 3ELKA 4ZYAA 1NG6A 1T0FC 3E1SA 3O8HA 2NS0A 1XMAA 2WAFA 1P9QC 4UUTA 4UV8A 5CVRA 4M71A 3ZQGA 4PGHA 2CFXA 2O8XA 1GV2A 3KLNA 5CVJA 3TDZC 1KZHA 1ZAOA 4E70A 3G3ZA 2ZJQF 2VKEA 2QENA 2COBA 1W36C 4C2MJ 3OR1C 1T98A 2I5UA 4GDFA 3H0GJ 4M6YA 4DJAA 3JSPA 1MNDA 5H20A 4A6EA 2XF5A 5M3FJ 1GXQA 1IRGA 1IN8A 1MSFC 3K70D 1FP1D 3L2UA 4E7HA 4M9ZA 5LD2C 1R9TJ 1G3YA 3CCLI 3KZIC 4QPOA 2X6OA 4BACA 4BGDA 3HC7A 3PQKA 2GLOA 4EJWA 3GBGA 2D1VA 1IV6A 3TP0A 1KA8A 1E3HA 2DT5A 3QPHA 3JSOA 4PK4A 3KP7A 2HQRA 2HXIA 2M7AA 2RREA 4IHYA 2CQQA 3BCAA 2F5EA 4ESFA 3HOTA 4YFXF 4WXCA 2Z33A 2X48A 2QGUA 1B59A 2H8RA 1GLNA 3CUQA 4M3BA 2R5ZA 2BVLA 3DU6A 1XGOA 1JUSA 4F3QA 2KQRA 1TT0A 2BHYA 2KP6A 1W7PA 2W1OA 5KK1A 5JFRA 3I54A 3HL2A 1SFXA 3I9V2 1B9NA 3OYMA 3FXUA 2IS1A 3TBIA 2H1KA 2A5WA 3OL4A 3K1PA 3KPHA 2VBYA 2ZB9A 2MC3A 4ESJA 3K1MA 4GXOA 1YITI 3GO5A 4G6TB 1TWGJ 2DYRH 3GFLA 2H27A 5M5WJ 3FIWA 1V4RA 4DW6A 3VYRB 2E5NA 3CCYA 2PLYA 2J5OA 3FMSA 2FUG2 4XOTA 4M74A 4E7JA 2FMLA 1HW5A 1S9HA 3HOSA 1TLHB 1DPRA 2P7VB 2HVRA 3VYUB 5M5XJ 4LLGF 5GP9A 1TQMA 3CDIA 2ETHA 1UG0A 3C2GA 3QAHA 4Y52J 3ABTA 1RNLA 4NUBA 3FXOA 3RDIA 1REPC 2LY9A 3WGGA 4IOCF 4ENJA 4JQFA 2LP0A 3J7ZI 4A3EJ 2E1CA 2NVQJ 2XVCA 3HBLA 3JW4A 3LSKA 4EVIA 3BTJA 3EETA 1JHHA 1XTAA 1VQ7I 3F6VA 3ZMUA 2EIKH 1QHGA 4M9SA 2R7RA 4HZFA 5IT9K 2L9SA 3G71I 1YS6A 4HA8A 4IX7A 4ZDOA 3CCJI 4Y4RA 2CV1A 3HOUJ 4YELA 1HOMA 3UR3C 4KDPA 1OYWA 2JA6J 5HDGA 2B0LA 3OOUA 5B1AH 4Q5SF 2QM3A 5K5OA 3KX2A 2HKOA 1X19A 1FOKA 1Z77A 1VQKI 2ZBKA 5FJ8J 3F23A 2MW8A 2GBYA 2BW3A 2PX9A 1W5CC 1Z6RA 1VQMI 1J0RA 5DD8A 1IXRC 2XAFA 4B44A 1YX5A 2PN6A 1FJLA 1ZRDA 3CQZJ 2L9RA 4HLXA 4XONA 4J01A 1EH7A 2DDBA 4A5NA 2VJ4A 1SAXA 5ICFA 1Z7UA 3TGNA 1B9MA 1ZG5A 1VQ5I 3ONQA 3V4GA 2EH3A 2VJJA 3X2QH 3C18A 2YX4A 1B4AA 3WHBA 1ZRFA 2QBYB 4XORA 2WC2A 5BMZA 4LB5A 3BG5A 1QBJA 1MJAA 2D2WA 4XICA 4KT5C 4NB5A 2DA3A 1G59A 5HVQC 3ZMVA 1ZELA 3KCCA 4U7BA 3IL2A 1WJDA 4N9IA 3HDDA 4HPQA 4Q48A 2V26A 5EZGA 3Q5FA 4RM3A 5M5YJ 1XSDA 1QHHD 3H5AA 5JVGF 1MD0A 3HIFA 3AG4H 3LFKA 4IOAF 2TDXA 4GYIA 2FOWA 1IW7F 3GLXA 2CUJA 3LFUA 3V42A 3IH2A 4FCYA 1YFHA 1IUYA 3FZVA 4S04A 3ZQQA 1SANA 2M3AA 1ONVA 1SC7A 4F55A 2M87A 2E7WA 2CGPA 1R5GA 2M45A 4MLOA 2HYGD 4IRGA 2PJPA 3IC7A 2EV0A 2TCTA 2F4MB 2XSDC 4IJAA 1R23A 2EK5A 3SYTA 3VB2A 1UCRA 4ESBA 3N4MA 2EV5A 5D4RA 4OAZA 3BROA 4IO9F 3BR2A 4KNYA 3H3VK 3FHZA 2E19A 2GIZA 1K78B 4AUXA 2KJCA 2OF7A 1XX5A 4BJ5C 3LSTA 1Y1VJ 1ZR2A 1Z7LA 1ETOA 5EDNA 2JT1A 3K2AA 3ZPLA 5ILVA 1A04A 2XKOA 3LA2A 1ZKGA 1K6YA 4CXFA 1EF4A 3BCBA 3S3OA 2V4JC 3JRFA 1FOXA 3BPVA 2Y9ZA 2P7CB 3DEUA 5B66C 4DGWB 1BL0A 2I10A 2RAEA 5CJ9A 1U6GA 4A3JJ 3CD6I 3FM3A 4OOIA 3MKZA 3L2VA 1LEBA 1BJAA 3ABLH 4A3LJ 5ICGA 2XAGA 1AKHB 4JP0A 4KIBA 2FE3A 5IT9Z 2Z3YA 3RSNA 2FF4A 3U9GA 4BHPA 2HVSA 4XBFA 1HA8A 5D5UB 4CH7A 3H35A 3IWZA 2C6YA 2WY7Q 2HQAA 3ZR8X 1DU0A 2JVGA 1P4AA 1UJ8A 3GXOA 3BTCA 3JRDA 3MMYB 3T5XA 2DBBA 4EJVA 1G4DA 3QU6A 3ZCOA 2VLAA 1R36A 3E5QA 1EKEA 1M1EB 4RGRA 4CCNA 4XR6A 3C2BA 1BR1A 2DYSH 1RRJA 3PSFA 2PEXA 1KU9A 1Y6IA 5KHDA 4D5FA 1LNWA 2BVMA 4ZH4F 1JI8A 4L9VA 3ZOBA 4PCQA 1J7KA 5DTDA 1JGGA 4L5IA 2A3SA 1Z3YA 4F7ZA 5F1RA 3SDBA 3PO3J 2FEZA 2L02A 1WJAA 2ME0A 4JBAA 3WTZA 5EJCA 1WWXA 3FXJA 1LDJA 5GAEJ 2J5PA 2VE9A 4CSWA 3OYIA 1X3ZB 1BI2A 3LSIA 3O8GA 5HODA 2EZLA 4R1HA 4V19K 2EZIA 4DOZA 4UY8I 3HKZA 3WTWC 1YIJI 1OCRH 1BI0A 1X58A 2K27A 2XAJA 5LHIA 3O2PE 1TNSA 3CUQB 4FISA 2O5RA 4L9JA 3K4NA 2NOJB 2MBFA 3FBIB 5DM6F 1XS9A 3SDGA 1X3WB 3W2WA 1OYIA 4C2UA 3HOYJ 3D1NI 2X9DA 3OL3A 3J80K 3ZN1A 4MHGA 1ZGWA 1JE8A 1DPUA 3KYCB 1F1ZA 3KE2A 5CQGA 3QYBA 1I39A 4R79A 2X98A 1LPQA 4NDLA 1DP3A 1L3LA 4WWCA 4FETA 1XB4A 2ZNZA 1IUFA 4LIUA 4EGZA 1NK3P 3BZ6A 2ZJPF 4PFOA 3IHUA 1BOAA 2PG4A 4C3HJ 2HXOA 1FTTA 3CUOA 4RAFA 5GAHJ 2RV8A 2AQEA 3NARA 5GPAA 4BH9A 4BQQA 5TRDA 1MDMA 5LRSA 1QNTA 2DA6A 3FK6A 5DD4A 4Q47A 1MMAA 3A4CA 2EJRA 2OAZA 3SJMA 5HS9A 2VQGA 3ZQ7A 1P6RA 4KUMA 5KAFC 3J7AW 1SMTA 3WTSC 2KJBA 3PFIA 5JLXA 4D1QA 1D8KA 2YX7A 1ERDA 1YE9A 2X1EA 5JVTA 4BUPA 1J59A 1HKTA 2VBWA 1ZGJA 5FKLA 4RB1A 1KONA 3JTGA 5EF6A 4IF4A 2K3FA 4YFNF 4HLYA 4HYEA 3W6JB 3CC4I 2DI3A 2V79A 1T38A 4BEHA 1X4PA 2R7SA 1XDSA 2O6GE 1FT9A 2W24A 1A6IA 3S2DJ 3BT9A 1SFKA 2X4HA 2DOFA 4A0YA 2QEXI 2RN7A 3L2RA 4G7HF 1T2KA 4ZZDA 5F64A 3JRAA 2DFHA 2ZXWH 3I56I 3HXLA 2LLKA 3U21A 3S16J 5FLVA 2K9MA 4CCOA 2HPMA 4I76A 4U87A 4G12A 1HBXG 2HS5A 5IOZA 3MVPA 3FK7A 2BOLA 2FBKA 5FLMJ 1X1DA 1B72A 3PNTA 1STZA 3FM5A 1BIAA 2E1NA 2E35A 2MC4A 3K4JA 1FYLA 1MW7A 2ID3A 3MKWB 1FTZA 4MGRA 3HRMA 2DLLA 3JRCA 3COAC 5D5VB 5GAGJ 3SXYA 2AHQA 2O0YA 5J8FA 5FRNA 5L3GA 3P9CA 5FLXR 3BOQA 3NWSA 5DV5A 4RAGA 2ICWG 4XKWA 2VC0A 3BR0A 4OAYA 1PDNC 2VC1A 3B6CA 4EV0A 1E0EA 2P6TA 4PGGA 2K3PA 4B43A 5IT3A 2EA2A 2ZXIA 2HOEA 3CCEI 4PJLA 3DBRB 3WG7H 4EEFG 3C2HA 4HDUA 4A3BJ 2XV4S 1YX3A 4LOCA 4AVZA 4DYQA 1T95A 4KITB 2FRHA 4AIDA 3IKVA 2VKDA 4D7MA 4M3FA 2M2EA 4H0EA 3L2CA 4GYGA 3ASOH 2M8GX 2DMQA 1OCCH 3SEQA 4LK1F 2XIGA 1VQ6I 1UFMA 5F08A 2WBMA 4CICA 1ZYRF 3JRHA 4I01A 3TO9A 2WWYA 2HQ5A 4XLFA 5IYBJ 2FA5A 3JCUC 2AO9A 2IGKA 2BY3A 3J7AY 2F2EA 2QF7A 4RM2A 3EYIA 2MABA 3KP2A 3QQAA 1RUNA 2NOGA 4XKBA 2MA3A 3DTEA 3RPQA 5IY5H 2H94A 1YHQI 3BG7A 2CYYA 1Y8RB 5IYCJ 4BE2A 2ISZA 4TV7A 4Y17A 1K7AA 5ERIA 2ME6A 3CCSI 2FBHA 2PMUA 5ICEA 4E7KA 2PMHA 1RI7A 4LJZF 4B3XA 5EEAA 2AXTC 5LFAA 1J09A 5JLWA 3HTSB 3V7SA 1APLC 1YI2I 1CF7B 1N75A 2BHZA 2JMWA 2L2OA 1MSEC 3KZYA 4BJTA 4KT6A 3WE3A 4AC0A 9ANTA 3SFZA 2M4GA 1ZARA 1NHAA 3E97A 1MBEA 3EUAA 1NTCA 4XSZF 1LB2A 1IRZA 2E1MC 2MYSA 4NC7A 4LGWA 1IGNA 1QVUA 5GPCA 3G1OA 1H89C 4WF2A 1VNDA 4XLCA 1WJFA 3AG1H 2LK2A 4LG0A 2R7ZJ 1O3QA 4CUGA 1RR8C 2EIMH 4C3IJ 1EA3A 2CUEA 2X6WA 2DAOA 2LKXA 4U0WA 3WTTC 2XB5A 3QP5A 1FLIA 5FKKA 1GV5A 2JRMA 2ZO4A 5AONA 3BC8A 3JAMZ 3NQOA 1XG1A 1R71A 2EILH 2W84A 3CF5F 4GCVA 1OCOH 1UZCA 2QBYA 1SEUA 5E1WA 3HOWJ 3B6AA 1N78A 2W25A 2Z2SB 3M07A 4IHXA 2JA7J 2OUMA 4RLQA 5F0CA 2E34A 1Y56A 3PNVA 3LMMA 2LH9A 3OYJA 1SFOJ 1Y0UA 2R7XA 2P5VA 3IH3A 2YR2A 1FYKA 2AS5F 1K6OA 4IHWA 1FYMA 2OZ6A 5LRRA 3TEDA 3PIOF 1HKQA 1UG2A 3H3UA 1S72I 5FD6A 4KN7X 1OLTA 3FDYA 3D5LA 1WFXA 3RKXA 5LGUA 4NC8A 2M5WA 1TW2A 2DQLA 3VDXA 1FEXA 5FGMA 2FX0A 4EJUA 2MG4A 4WK8F 3W2VA 3MD2A 5AIQA 1RKWA 2N8GA 2ZMEB 1D0ZA 3TMOA 2IGMA 2MUNA 4QSHA 2Y0SA 4MEYF 4RAYA 3HOXJ 1F5TA 2KRHA 4M6XA 4M6VA 1X1PA 2DMTA 2KDOA 5FLXK 2RQPA 4O6JA 3WTVC 3GTLJ 2O3FA 5IPAA 2K9SA 4W97A 3BJOA 4I0AA 3GTKJ 4NHJA 2L7KA 1JTXA 4CYCB 2PBIA 2IA1A 3SFIA 4D5CA 2VPRA 2MH9A 4P55A 4JX6A 1FC3A 1SVOA 2O7OA 1MBKA 2ZJ2A 2JZYA 4A3DJ 2OCCH 4I99C 3IWFA 1N77A 3RTRA 2HVQA 3VSLA 1XD7A 1S6LA 4UVBA 2PFBA 5CVVA 2LF7A 2LKPA 1R6RA 2YPRA 3R61A 3A01B 3F0CA 1BBYA 4HW0A 4UXNA 1SD5A 1U2WA 4EJOA 3JRIA 4IHSA 1UHWA 4KMUX 2KRFA 2LRDA 2WAQN 3S14J 1HW2A 3MN2A 2FD5A 3GX4X 3LL7A 1A35A 2YU3A 2EFNA 1T08B 1Y0NA 2D5VA 3DLLF 2DPUA 3RCOA 3ABKH 1WVRA 2HDWA 3OOPA 1RC9A 1RZ4A 1Z21A 1LVKA 1H88C 5E17F 3M8FA 2WAQA 5B5EC 3DFGA 3ERMA 1DQUA 1X1BA 2R4GA 4PJ0C 4RB3C 3G6EI 3OYAA 3Q3SA 3FXQA 3SZTA 1TL8A 2R5ZB 2Y0MA 4BY1J 3U1KA 4EJTA 4AVPA 3FWEA 2ZXJA 2L01A 1SVLA 5DCFA 3T1BA 1T33A 4FTHA 1CGPA 2WAEA 2JA2A 2STWA 3O3KA 4II2A 5H6RA 4E7SA 3BTLA 1G3SA 3DXJF 2BZTA 2H6BA 2RDPA 2RKHA 4HSRA 2KZGA 3BP8A 2Q8KA 4DZJA 3CCVI 3SQNA 4F52A 1WZ2A 1F9NA 4OMZA 4Y15A 1B8IB 4PDKA 1YS7A 2X1CA 1XMXA 1S7AA 1FZPB 1ZK8A 2CQKA 1P2FA 3DPUA 2JQ7A 4P5OA 3E3VA 3TQNA 2LR8A 2ZNYA 1DDNA 4HX4A 1QA6A 5HLHA 4UUSB 4XOPA 2CQ7A 2ISYA 1ON2A 2AQFA 3ZQFA 2V1UA 3M7GA 2R7UA 3FISA 3OYCA 1BA5A 1H9GA 1XDUA 2LREA 4M72A 2IA2A 2CRGA 2MSYA 2JPCA 4IQ4A 3GW2A 4UB6C 1IF1A 2X51A 3DV8A 3K2ZA 1MDMB 3GLLA 1R58A 1BR2A 1OCZH 5HDNA 1V55H 2HU9A 1MMNA 1SMYF 2G7HA 1TBXA 2XUBA 1XN7A 3OY9A 2F5FA 2WTEA 2VOOA 4DQ2A 2DXIA 4W1UA 3L00A 3KYLA 1BC7C 2DA2A 1MGTA 2Q2EB 3FMQA 1Z3XA 1R49A 4E4HA 1TQIA 5CVUA 3IRRA 3J81Z 3QPLA 1OYYA 2G0EA 5LGNA 2H6CA 4ZJZA 5BQTA 2HZDA 4AM3A 2ID6A 5LGTA 1VI0A 1RPWA 1YIOA 3LA7A 1HSJA 4BXFA 5J47A 3K4KA 3PFYA 4BXXJ 2PI0A 3K10A 2ECBA 2EA4A 3CMYA 2XRNA 2CW7A 4CCMA 1AKHA 4QWQA 2KIFA 3AG2H 3RKYA 3PQJA 1W7PD 4BHBA 1FBSA 1G3WA 4ANJA 5E3NA 4JYKA 1OMIA 2G7UA 5FB2A 3KETA 3FMRA 2VN2A 1IO2A 1TZLA 1YO5C 2EV6A 2H09A 3EPZA 1ZH5A 1LDKB 2Z1DA 4PZJA 4BQOA 4F91B 2CW0F 1PYVA 3L1PA 3S3NA 3WU1B 4A0ZA 1BOBA 1T56A 4KJZA 4HF0A 4Y7NJ 2V9KA 3NRVA 4RLFA 3KP3A 2VXZA 4NQWA 3WU2C 2W4SA 3VEPA 1I5ZA 5K7FA 5EGOB 2QQ9A 3P5JA 3S2HJ 3E5XA 1A6QA 3GCMA 5LHHA 2ESHA 2CFOA 3HB9A 1LVAA 2M8EA 5JI6A 3OYHA 1BI1A 3WU0A 4FASD 5IP7J 1HSTA 2X6XA 3C3WA 2VQHA 2L4MA 4BBSJ 2CW8A 2Q0OA 2UUZA 5J1RA 4M73A 2H8WA 2HFHA 2R7OA 1JUMA 4QPQA 2W7NA 1J5YA 4XN3A 1O57A 5J3LA 2L0KA 3F9KA 3GFIA 1K83J 4BAYA 5C44J 1KU7A 1HDDC 1E2XA 3M4OJ 2VJ5A 2OJED 1FNNA 3P7NA 2ELHA 2ZFWA 2B7EA 1TWCJ 2HI3A 1JKPC 3S93A 4N4NB 4I2OA 4FHTA 4P9UA 5D6EA 3MFKA 2MGQA 2ZSHB 3TOBA 4HSTA 5F1JA 1R1UA 3CP8A 4FE4A 2P4WA 3DP7A 5M3MJ 2VBXA 4LLLA 1Z67A 1HF0A 1T6SA 3E6BA 5E3LA 1WH7A 3U1DA 1AWCA 2FXAA 2K02A 4EM0B 2V1XA 2L4AA 4Y13A 1IN4A 4B3AA 4IHTA 2GIVA 4AYBN 4L9TA 4E6KG 1Z0XA 4X6AJ 4MIMA 2XKPA 4B47A 1R5ID 1WJCA 1HQCA 4XN0A 3CMAI 4XKCA 5EG0B 3F3XA 4XSXF 5EZHA 2IT0A 4CDGA 5CLSA 4IHVA 2LBFA 3CP2A 1X2NA 3GVAA 4HQMA 1ORKA 2OU2A 3OWTA 4HX8A 5EGOA 4A3FJ 1OCPA 2KIMA 3LQQA 5DS9A 4CHUA 4O3MA 2DTRA 3IRQA 2X0LA 3HPGA 4AIKA 3S1RJ 4UB8C 1Q1HA 5D5XB 4CGZA 4XLPF 4G7ZF 2P5KA 3HGYA 3W6KB 5ED4A 3J81K 2LMDA 5HNHA 1JKQC 3M1CA 2K4JA 2Z5UA 3J7AO 3R60A 4KA4A 1LQ1A 2MLGA 2OPTA 2F6CA 4DNCA 4XIDA 3DLAA 1IRXA 2BE5F 2FNAA 4DBRA 1FSHA 4ITVA 4UUSA 3I55I 4PSXA 2CWEA 3ULQB 4JK1X 2ZMEC 5D8LB 1FPQA 1NH3A 5D4SA 4RGUA 4OU0A 3H1CA 4RBOA 2ZXHA 2MH2A 1F36A 4LMYA 4CYDA 4CCLA 2HEOA 3JREA 1LKXA 3WTUC 2D1HA 3M3YJ 3WGHA 1XGMA 2NNNA 2XPWA 2IA0A 2LF8A 3RYRA 2LG4A 1R7JA 3GZ5A 2A05A 2KPMA 1VZ0A 3AG3H 3DKWA 4OWRB 1DP7P 1OCTC 1XSXA 2Q2EA 1P7IA 1OR7A 2EIJH 2KIQA 2L7FP 4HNTA 3PNYA 4S05A 1KGSA 3H0DA 5IP6A 3NEUA 2CU7A 4HBLA 4RDUA 2VUMJ 2CQNA 3HZJA 4BE1A 3G1MA 1D0YA 1D1BA 5F04A 4RGXA 2QVOA 5K7ZA 2MVTA 2E2HJ 3I71A 3LSGA 4MFDA 1GUUA 2Z9OA 2X1DA 1UHSA 1W1WE 1NG7A 4M3DA 2A61A 4GRIA 3OYDA 1WCMJ 3K4MA 1IDYA 4AU7A 1GHCA 1U78A 4RB2C 1FBQA 1OFCX 4HOBA 5BNGA 2CQXA 1RESA 3S17J 2OC6A 4HF2A 1VQ8I 2E1MB 2FNPA 3ESWB 3LNQA 3I59A 2BEOA 1ZN2A 1KU3A 2CG4A 4Z6YA 1GDTA 4K2EA 1U9OA 3GUDA 2STTA 4DYCA 1F4KA 1HXDA 3I5UA 2XAUA 5EEHA 2K9LA 5IYDJ 4EQQA 4D9JA 2M30A 3MKYB 3QPTA 4Z2YA 2JUGA 3KP4A 1X1CA 5LEKA 3E5UA 2VXDA 1IXSB 4M3GA 2FOKA 3MZ8A 3RQIA 2EB7A 4CZZA 4DBQA 4C9YA 3RKWA 1MBHA 3KFWX 2ESNA 3QODA 3PUBA 3T0YA 1ITYA 2RVCA 3BY6A 3ZMSA 3L2QA 2QSHX 2MFZA 3BR1A 3OS2A 2HQNA 3MEXA 5HLIA 2LDUA 5C3EJ 4HEA2 2CV2A 4EM2A 2V1DA 3CJQB 3GZNB 3DEWA 1H0MA 3ZQHA 1O4XA 2M0MA 1MBJA 1X1AA 2XHKA 1ZHFA 3I4PA 4WCGA 3JR9A 3A2KA 2HOAA 4LITA 3B73A 1ZREA 5K5RA 3KEYA 5BOXA 3GTQJ 2L7MP 4XM3A 2HWVA 1K4SA 1P4XA 4BBRJ 4EM1A 4YRVA 3E6CC 3EUKL 4ASNA 2EFWA 3F21A 4BNCA 4IRIA 1ENHA 4YIFA 3KYDB 1DU6A 3JRBA 4BQNA 2NNYA 3H5NA 4I02A 1VTNC 2EZHA 3LSMA 2BV6A 1W36D 2DDAA 1VQ4I 1G6NA 4BL0B 1MBFA 1U3EM 2VJIA 2ECCA 4C3JJ 4HG2A 1QPMA 2OBPA 4NQWB 2MZ4A 1R22A 2FBIA 1WGXA 4ZDLA 3OS1A 2DFFA 1OJLA 4V2FA 4IEJA 1HLVA 1XCVA 2E7XA 3V7RA 5CQEA 4PJMA 4ENMA 2JN6A 4PSWA 2KT0A 1MNMC 3LAJA 3I53A 1S3JA 2OTLI 2BY2A 3CLQA 2IS2A 2ADUA 2JVHA 3V8KA 2E5ZA 5K7HA 1XGNA 2L9NA 1Z1DA 1C0WA 1ETKA 2D45A 1PVEA 2OQGA 5DEQA 3LWFA 3EUHC 2XSJC 4F93B 2XAHA 2R7TA 3FKIJ 1VQLI 4Y3OA 4UVAA 2LYCA 5L3CA 3E6MA 1YRNB 2X6YA 3K70C 1U9NA 3PUFA 1L0OC 4P1WA 3R4KA 2UZKA 4KIFA 1PJRA 2R93J 5J6XA 2DPDA 2HYFA 3FXMA 2TRTA 2A6EF 3LAPA 3RPUA 1V54H 2ZJRF 4D0PA 2IRFG 1QVTA 1D0XA 3CJRB 3FHNA 3FXLA 1UHMA 1FY7A 4WXDA 4X1EA 2YUSA 5HLGA 5E79C 3ZXSA 3IV5A 1ZG3A 2L5QA 3I59B 4LB6B 3ZMTA 4AWXB 1B6AA 1YW7A 1W5TA 1N25A 3WGIA 3LOCA 1FWZA 2DT7B 2W48A 1FOWA 4E7IA 5FFXA 2DA1A 5C4XJ 3MKLA 1ON1A 1WKMA 4BQAA 2R5YB 4HNUA 4AIHA 1TWAJ 1EH8A 1LE8A 2QKMB 5KCMA 1S7OA 3H36A 2DK5A 4S0HB 2G9WA 1T8IA 1A5JA 2DA4A 1IRFA 2XF7A 3CUQC 3WTXC 4RA2A 4RMNA 3DPLC 4A3GJ 1XPXA 2JA5J 2EINH 3I4MJ 3J80R 1U8BA 1G2HA 4G6QA 1QGPA 1JT0A 4BU2A 1K4TA 2M4KA 3Q0WA 2ZMEA 2KHMA 5FD5A 5FROA 1S8NA 3AFHA 1FMVA 3CCMI 3I64A 3OYLA 2XPVA 3RJPA 2KDZA 4G6DA 2DT6A 4BEHB 1FX7A 5A2QK 2JWTA 1FP2A 6PAXA 3K0LA 1ETVA 3HRSA 4MO7A 3S1NJ 2A68F 5L3FA 3F22A 1X2MA 5J1UA 2XF6A 2A6TA 3GWZA 4ZYHA 1CF7A 4F92B 2GAUA 5DCMA 2NS7A 3ROUA 1YJNI 2YS9A 3CJNA 4EMSA 1R4NB 1D5VA 3BLYA 3SZPA 5LLQA 3ISPA 1YJWI 2DMUA 2ELKA 3ZGKA 2VONA 1E3OC 4KISA 3BZKA 2K85A 1I3AA 2PMZN 4XL9A 1SVMA 2FJ1A 4P96A 1YJ9I 2EBIA 4A3KJ 3F72A 3ZRGA 4II3A 4A93J 1G8XA 3G4SI 2M7BA 3DCFA 2B63J 3OSFA 2FQ4A 5JHUA 3F8FA 2BYVE 1FOYA 4L18B 1YTYA 2RGVA 3A1YA 1BI3A 3RZDJ 3CC2I 2HNHA 1KYZA 3GTJJ 4LG0B 2KLOA 4XLNF 1UAAA 4IL6C 1MJ9A 1BW5A 4UUVA 1V5GA 3DTIA 4ZTJA 1HKSA 1IC8A 2K9NA 3CC7I 3QPSA 5DCMB 3B02A 2E2JJ 2W85A 2HOSA 4ETSA 3PL8A 3LSHA 3CO7C 3A01A 2KMUA 5EYRA 3SHFA 1Z9CA 2W82A 3HRUA 3TKYA 2GXAA 4YFKF 3A0BC 2VT2A 2LFBA 2WV0A 1O7LA 3CMEI 3OIOA 4XLAA 1P7JA 3QRFF 3CESA 2CMPA 4MQ9F 1EH6A 2K40A 2NVYJ 1Y1WJ 2OZUA 4KFCA 4HV5A 5D5WB 4B09A 2JPBA 4GO1A 2IVMA 4MNUA 3AL0B 3DBHB 1JJ6C 3ZP5A 2VQLA 1TQPA 4UVCA 1TW3A 2KZVA 1IDZA 2JJ7A 3DKXA 1DUXC 3A0HC 2COMA 3RI4A 1O7FA 1W7PB 5CKTA 3O6BB 2A5YB 1U8RA 1JKRC 3H92A 2K86A 1UELB 5HNFA 2EPFA 2FQ3A 5BPDA 1H9TA 4AD9A 4BYYA 3S1MJ 1TWFJ 1X3UA 1JHFA 3H9JA 3D0SA 1U5TA 2E1OA 4XLHA 2IW5A 2W00A 3BG3A 4U7DA 5JR3A 4NBQA 4OIOF 5KAIC 4YIRX 1R1VA 2K7LA 3TDUC 4BS9A 3H9QA 1BR4A 5LEJA 4ZYGA 4RAZA 5FKMA 1ODDA 2Y48A 4G94A 1EJ9A 3HUGB 2BGCA 3DQVC 5LHGA 5D6FA 3L09A 2JSPA 5FKOA 1T0FA 1PP7U 1O3RA 2OQRA 2QQAA 3OV8A 4XK4A 3CCRI 5FRMA 2Z99A 3MCZA 1AU7A 4FX4A 1NK2P 4HDVA 3HM5A 4U0YA 4QIWN 5F0HA 4XKVA 1FIPA 1PUFB 2A6HF 5K5QA 1IN5A 2R5YA 2QWWA 3H9GA 1WJBA 4A3IJ 3CZ6A 3OYKA 4KIGA 3K6GA 1W4MA 1RR7A 1VF9A 1Z05A 5FKNA 3R0JA 3ECHA 1MJBA 3ZQCA 3RQ4A 3WG9A 1W0TA 3L7WA 1I1GA 3JTHA 1MMGA 4MFEA 3FKJA 4XRFA 1WI9A 2RC4A 3E7LA 3ABMH 4G7OF 4RB0A 5FFZA 2F5CA 2KL4A 1I6XA 2NYXA 2VBZA 1H8AC 5L3DA 2MD5A 3I3LA 3GTMJ 3LSJA 1MBGA 3QP6A 4LFUA 1MKMA 3I0TA 1DGWY 4MTEA 3REOA 1RUOA 3ML6A 4I98B 3E6DA 5IT9R 1FMWA 2AXLA 2IS4A 1VFCA 3CF2A 1A31A 2OA4A 4JX4A 2VB6A 4L5EA 5KVRA 3BJ6A 3RZOJ 3TO6A 2XAQA 4U88A 2M34A 2P6SA 5GTHC 4PUSA 4MTDA 3IAM2 2Y69H 2HZTA 2F5DA 1V5FA 2XROA 2DOAA 2P5LC 2W57A 1AA7A 2DFIA 3A02A 3ABUA 4KN4X 2IS6A 3IAS2 3KP5A 2WB1N 4GFBA 3IUOA 1IZ1A 4R8HA 2IXSA 4HV6A 2DMPA 3L2WA 2H1LA 2Y75A 3BR3A 1A36A 2F48A 4B4CA 3QYEA 3L9FA 4WXHA 2IAIA 3HYIA 4E7LA 2LY1A 4HRIA 3ASNH 3S2WA 3CJTB 2HKXA 3VFZA 1TT5B 1D1AA 2Y31A 2FSWA 3HEFA 1OPCA 4OIPF 2BW3B 1QU3A 1OKRA 4RS8A 2XPUA 2F4OB 3P9IA 4QLCU 2GA1A 1Y8QB
chains in the Genus database with same CATH topology
3EDPA 2O61A 2LSOA 3U2RA 4ZYEA 2ACJA 5HS8A 3F8CA 1BIBA 3IKTA 5FLXZ 1D3YA 2DK8A 3HUGA 3KEOA 1BC8C 1GVJA 3GZ6A 2JRTA 3TOAA 5ILUA 3VODA 2EWNA 1O3SA 1IAWA 4HAMA 2XGXA 2HDCA 5DUKA 3T8TA 2XASA 1R00A 2UXXA 1W5SA 1O3TA 4MQVA 2QZ8A 4P9FA 1BN5A 1KQ9A 2GZWA 4ZZLA 1YLFA 2EFPA 2VOPA 1I27A 1AOYA 2FMYA 1SD4A 5K1YA 5ICCA 5E8IA 3BDDA 4WX9A 2GA2A 3HTUA 1ZRCA 4IRHA 2HR3A 2KIUA 2A69F 2V9VA 3MZHA 5BS6A 5HS7A 2NAZA 3LA3A 2RNJA 3FXRA 2P8TA 2R7DA 3HSFA 3V7CA 4I0BA 3BJAA 4O5VA 1KU2A 2HGCA 3QU3A 3K9TA 3EQLF 2R3SA 1T39A 3FF5A 3K69A 2IP2A 3ECOA 1PP8F 5L3EA 4I7HA 4KMFA 3V8LA 4N0BA 4UV9A 4YIIA 3GFJA 3BPXA 2IPQX 4ON0A 3Q9VA 4OMYA 5H6QA 1P4WA 3GFMA 3CTAA 2L3DA 1J2XA 1QZZA 1SD6A 3WODF 3HSRA 3F8MA 3M1EA 1EV7A 2MLKA 4HQEA 5CYVA 3JAMK 1ZG1A 2L54A 5LBQA 1XCBA 1JXSA 2QLZA 5J8CA 4L9NA 1TNTA 4BXUA 3ZMDA 2DU9A 2FU4A 1Z91A 5EEGA 3HSEA 4MEXF 1B1BA 2NRAC 3WTYC 1YYVA 2O03A 5HDKA 3ERED 1D8JA 1XMKA 2HTSA 3C1DA 4HX7A 1YW8A 4A5MA 4I09A 2UWMA 1I1SA 2YSRA 2GXBA 2M1BA 1SFEA 2DW4A 1ZLJA 5A2QZ 1BM9A 1V3FA 5E18F 2V6CA 1U5TC 5DYMA 4UHTA 1UB9A 3TO7A 3R6SA 1P92A 2DQRA 4LLNA 3FX3A 5ILSA 5E1ZB 1G3TA 1WRJA 4KICA 5AIPA 5D8KB 1YQAA 3T8RA 4Q4ZF 4LK0F 3F6OA 3V8JA 1WSUA 1ULYA 3CLOA 3P9KA 1QQIA 2CSOA 1Z6TA 1YG2A 3LQRA 4M9XA 4ZYDA 1K79A 3HHGA 2LNBA 2OD5A 3HHHA 4FX0A 4ENKA 4U0VA 4B8XA 2VE8A 3KZZA 1LJ9A 3I58A 3GEZA 1HW1A 1QO0D 5F6FA 4CO8A 4BHCA 2R7FA 4A12A 3EUHA 5DUIA 4OINF 1QZYA 3K1NA 2CO5A 1YW9A 3H3ZA 1GXPA 1PUEE 4GGGA 4A0XA 2JTVA 5L3BA 1KQ8A 4A2UA 2GWRA 3KEQA 3C7JA 4OIQF 5BPIA 2JSCA 3R0AA 3MZYA 2KKOA 4N9HA 4IXAA 1R1TA 2QQBA 1J75A 5FO5A 1ZLKA 3VOEA 4OIRF 3DPTA 3J80Z 2GQQA 1S29A 2K4BA 1USTA 2EFOA 2ZKZA 1J9IA 1USSA 5TJJA 5CVIA 3Q9SA 3ZN0A 1LEAA 2UXNA 3MAJA 4HF1A 5E20A 2BBYA 3F8NA 1WQ2A 4G9YA 3RIRA 1KYWA 2A07F 1JGSA 1FBUA 4L0ZB 1K78A 5DDGA 4L5JA 2VODA 3WE2A 4KYWA 4FT8A 1FSEA 3F8BA 3KLOA 2EFQA 3ZMZA 1U5TB 2QUFA 2QYOA 1RIOH 3QOPA 2GXGA 5E8GA 5HOOA 2PQ8A 4RGSA 1XSVA 1SD7A 3GYHX 3HRTA 3BWGA 3N97A 3CDHA 4IVNA 2IJLA 5E1XA 3M9AA 4AIJA 2VT3A 4LD5A 4ENNA 3DF8A 1SFUA 3RYPA 1TTYA 1E17A 1IN6A 1LDDA 3M8EA 4A6DA 1XGSA 4G8XA 3GF2A 1KQ0A 4IPAA 1IXCA 2ZCWA 1MZBA 4YG2F 1R5HA 1ZGAA 3G73A 3MQ0A 3CO6C 3MWMA 1IN7A 3AAFA 4EGYA 2HTJA 2DO7A 4UNOA 3EYYA 3KP6A 4L0YB 3ELKA 2NS0A 1XMAA 5CVRA 4UV8A 4M71A 4PGHA 2CFXA 2O8XA 3KLNA 5CVJA 3TDZC 1ZAOA 4E70A 3G3ZA 2QENA 1T98A 4M6YA 3JSPA 5H20A 4A6EA 1GXQA 1IRGA 1IN8A 1FP1D 4M9ZA 1G3YA 3PQKA 4EJWA 2D1VA 1KA8A 2DT5A 3QPHA 3JSOA 3KP7A 2HQRA 2F5EA 4ESFA 3HOTA 4YFXF 4WXCA 2Z33A 1B59A 3CUQA 1XGOA 5KK1A 5JFRA 1W7PA 3I54A 1SFXA 1B9NA 3FXUA 3K1PA 2VBYA 2MC3A 4ESJA 3K1MA 4GXOA 3GO5A 3GFLA 2H27A 1V4RA 2PLYA 2J5OA 3FMSA 4M74A 2FMLA 1HW5A 3HOSA 1TLHB 1DPRA 2P7VB 4LLGF 1TQMA 2ETHA 3QAHA 3ABTA 1RNLA 3RDIA 1REPC 3WGGA 4ENJA 4JQFA 2E1CA 2XVCA 3JW4A 4EVIA 3EETA 1JHHA 3F6VA 3ZMUA 4M9SA 4HZFA 5IT9K 1YS6A 4HA8A 4KDPA 1OYWA 5HDGA 2B0LA 4Q5SF 2QM3A 5K5OA 2HKOA 1FOKA 2ZBKA 3F23A 1Z6RA 1J0RA 5DD8A 1IXRC 2XAFA 2PN6A 1ZRDA 4HLXA 1EH7A 4A5NA 1SAXA 5ICFA 1Z7UA 3TGNA 1B9MA 1ZG5A 3V4GA 3C18A 2YX4A 1B4AA 1ZRFA 2QBYB 2WC2A 5BMZA 4LB5A 1QBJA 1MJAA 2D2WA 4KT5C 4NB5A 5HVQC 3ZMVA 3KCCA 4U7BA 3IL2A 4N9IA 4Q48A 3Q5FA 1XSDA 1MD0A 3HIFA 3LFKA 2TDXA 4GYIA 1IW7F 3GLXA 1YFHA 1IUYA 3FZVA 4S04A 1ONVA 2M87A 2E7WA 2CGPA 1R5GA 2M45A 2HYGD 4IRGA 2PJPA 3IC7A 2EV0A 4IJAA 1R23A 2EK5A 3VB2A 1UCRA 4ESBA 3N4MA 2EV5A 5D4RA 3BROA 4KNYA 3FHZA 1K78B 2KJCA 3LSTA 2JT1A 3ZPLA 5ILVA 1A04A 2XKOA 3LA2A 4CXFA 3BPVA 2P7CB 3DEUA 5CJ9A 1U6GA 3FM3A 4OOIA 1LEBA 1BJAA 5ICGA 2XAGA 4KIBA 2FE3A 5IT9Z 2Z3YA 2FF4A 3U9GA 4BHPA 4XBFA 5D5UB 3IWZA 2C6YA 1P4AA 3GXOA 3T5XA 2DBBA 4EJVA 1G4DA 3QU6A 1R36A 3E5QA 4RGRA 2PEXA 1KU9A 1LNWA 4ZH4F 4L9VA 4PCQA 1J7KA 4L5IA 2A3SA 4F7ZA 5F1RA 2FEZA 2L02A 4JBAA 3WTZA 1WWXA 1LDJA 2J5PA 2VE9A 1BI2A 4R1HA 3WTWC 1BI0A 2K27A 2XAJA 5LHIA 3O2PE 1TNSA 3CUQB 4L9JA 2MBFA 1OYIA 3J80K 3ZN1A 4MHGA 1JE8A 1DPUA 1F1ZA 3KE2A 4R79A 1L3LA 4WWCA 1XB4A 2ZNZA 4EGZA 3BZ6A 3IHUA 1BOAA 2PG4A 3CUOA 2RV8A 4BH9A 5TRDA 1MDMA 5LRSA 1QNTA 5DD4A 4Q47A 2EJRA 2OAZA 5HS9A 3ZQ7A 1P6RA 4KUMA 1SMTA 3WTSC 2KJBA 3PFIA 1D8KA 2YX7A 1J59A 5JVTA 1HKTA 2VBWA 1ZGJA 3JTGA 4RB1A 4IF4A 4YFNF 4HLYA 4HYEA 3W6JB 2DI3A 2V79A 1T38A 1XDSA 2O6GE 1FT9A 2W24A 1T2KA 2X4HA 4A0YA 4G7HF 2RN7A 4ZZDA 5F64A 1HBXG 2HS5A 2FBKA 1STZA 3FM5A 1BIAA 2E1NA 1FYLA 4MGRA 3HRMA 2DLLA 3COAC 5D5VB 3SXYA 2O0YA 5J8FA 5L3GA 3P9CA 3BOQA 5DV5A 2VC0A 1PDNC 2VC1A 4EV0A 2P6TA 4PGGA 5IT3A 2EA2A 4HDUA 2HOEA 2XV4S 2FRHA 3IKVA 4H0EA 3L2CA 4GYGA 4LK1F 2XIGA 1UFMA 4CICA 1ZYRF 4I01A 3TO9A 2WWYA 2FA5A 2F2EA 3EYIA 3KP2A 1RUNA 3RPQA 2MA3A 2H94A 2CYYA 2ISZA 4TV7A 4Y17A 1K7AA 5ERIA 2FBHA 2PMUA 5ICEA 2PMHA 1RI7A 4LJZF 3HTSB 3V7SA 1CF7B 3KZYA 3WE3A 3SFZA 1ZARA 1NHAA 1LB2A 3E97A 4XSZF 4LGWA 4WF2A 4LG0A 1O3QA 2DAOA 4U0WA 3WTTC 1FLIA 3QP5A 2ZO4A 5AONA 3JAMZ 3NQOA 2W84A 4GCVA 2QBYA 5E1WA 2W25A 1Y0UA 2P5VA 2YR2A 1FYKA 2AS5F 1K6OA 1FYMA 2OZ6A 5LRRA 1HKQA 3H3UA 5FD6A 4KN7X 3D5LA 3RKXA 5LGUA 2M5WA 1TW2A 2DQLA 5FGMA 4EJUA 4WK8F 5AIQA 2ZMEB 4RAYA 4MEYF 1F5TA 4M6XA 5FLXK 2RQPA 4O6JA 3WTVC 2O3FA 3BJOA 4I0AA 4NHJA 2PBIA 2IA1A 2MH9A 4P55A 1FC3A 2ZJ2A 2JZYA 3IWFA 3RTRA 1XD7A 1S6LA 4UVBA 2PFBA 5CVVA 2LF7A 2LKPA 2YPRA 3R61A 1BBYA 4HW0A 4UXNA 1SD5A 1U2WA 4EJOA 4IHSA 1UHWA 4KMUX 2KRFA 1HW2A 3GX4X 2YU3A 2EFNA 2DPUA 3OOPA 1RZ4A 5E17F 3M8FA 3DFGA 4RB3C 3FXQA 3SZTA 2Y0MA 4EJTA 4AVPA 3FWEA 2ZXJA 2L01A 5DCFA 3T1BA 1CGPA 2STWA 3O3KA 5H6RA 1G3SA 3DXJF 2H6BA 2RDPA 2RKHA 2Q8KA 3BP8A 3SQNA 1F9NA 4OMZA 4Y15A 4PDKA 1YS7A 1S7AA 1FZPB 2CQKA 1P2FA 4P5OA 3E3VA 3TQNA 2ZNYA 1DDNA 4HX4A 5HLHA 2ISYA 1ON2A 2V1UA 3M7GA 1H9GA 1XDUA 4M72A 2IA2A 2JPCA 3GW2A 1IF1A 3DV8A 3K2ZA 1MDMB 1R58A 5HDNA 1SMYF 2G7HA 1TBXA 2XUBA 1XN7A 2VOOA 2F5FA 2WTEA 4DQ2A 3L00A 1BC7C 1MGTA 3FMQA 1TQIA 5CVUA 3IRRA 3J81Z 5LGNA 1OYYA 2H6CA 5BQTA 5LGTA 1YIOA 3LA7A 1HSJA 2PI0A 2EA4A 2XRNA 4QWQA 2KIFA 3RKYA 3PQJA 1W7PD 4BHBA 1FBSA 1G3WA 1OMIA 2G7UA 5FB2A 3KETA 3FMRA 2VN2A 1YO5C 2EV6A 2H09A 1ZH5A 1LDKB 4PZJA 2CW0F 3WU1B 4A0ZA 4HF0A 3NRVA 3KP3A 2VXZA 4NQWA 3VEPA 1I5ZA 2QQ9A 3E5XA 5LHHA 2ESHA 1LVAA 2M8EA 5JI6A 1BI1A 3WU0A 1HSTA 3C3WA 2L4MA 2Q0OA 4M73A 2HFHA 1J5YA 1O57A 3GFIA 4BAYA 1KU7A 1E2XA 1FNNA 3P7NA 2ELHA 2ZFWA 4I2OA 4FHTA 4P9UA 5D6EA 3MFKA 3TOBA 1R1UA 2P4WA 3DP7A 2VBXA 4LLLA 1T6SA 3E6BA 3U1DA 1AWCA 2FXAA 2K02A 4EM0B 2V1XA 2L4AA 4Y13A 1IN4A 4IHTA 2GIVA 4L9TA 2XKPA 1HQCA 3F3XA 4XSXF 2IT0A 4CDGA 5CLSA 3GVAA 4HQMA 2OU2A 4HX8A 4CHUA 2KIMA 4O3MA 3LQQA 2DTRA 3IRQA 2X0LA 4AIKA 1Q1HA 5D5XB 4CGZA 4XLPF 4G7ZF 2P5KA 3W6KB 5ED4A 3J81K 2K4JA 2Z5UA 3J7AO 3R60A 4KA4A 1LQ1A 2MLGA 4DNCA 1FSHA 2FNAA 2BE5F 3ULQB 2CWEA 4JK1X 5D8LB 1FPQA 5D4SA 4RGUA 4OU0A 2MH2A 4LMYA 4CYDA 2HEOA 3WTUC 2D1HA 3WGHA 1XGMA 2NNNA 2IA0A 2LF8A 3RYRA 1R7JA 3GZ5A 3DKWA 1DP7P 1XSXA 2Q2EA 1OR7A 4S05A 1KGSA 3NEUA 4HBLA 4RGXA 2QVOA 3I71A 2Z9OA 2A61A 1GHCA 1U78A 4RB2C 1FBQA 4HOBA 4HF2A 2FNPA 3I59A 2BEOA 1ZN2A 1KU3A 2CG4A 4K2EA 2STTA 3GUDA 1F4KA 1HXDA 3I5UA 5EEHA 4EQQA 2M30A 3QPTA 4Z2YA 3KP4A 5LEKA 3E5UA 1IXSB 2FOKA 2EB7A 4CZZA 3RKWA 3KFWX 2ESNA 3T0YA 2RVCA 3BY6A 3ZMSA 2HQNA 3MEXA 5HLIA 2LDUA 4EM2A 2V1DA 1H0MA 2XHKA 1ZHFA 3I4PA 4WCGA 3B73A 1ZREA 5K5RA 5BOXA 2HWVA 1P4XA 4EM1A 3E6CC 2EFWA 4ASNA 3F21A 4BNCA 4IRIA 4YIFA 2NNYA 4I02A 1VTNC 2BV6A 1G6NA 1U3EM 1QPMA 2OBPA 1R22A 2FBIA 1XCVA 2E7XA 3V7RA 4ENMA 3LAJA 3I53A 1S3JA 2ADUA 3V8KA 1XGNA 1Z1DA 1C0WA 2D45A 2OQGA 5DEQA 3LWFA 2XAHA 4UVAA 5L3CA 3E6MA 2UZKA 1L0OC 3R4KA 4KIFA 5J6XA 2DPDA 2HYFA 2A6EF 3LAPA 3RPUA 4D0PA 2IRFG 1UHMA 1FY7A 4WXDA 5HLGA 1ZG3A 3I59B 4LB6B 3ZMTA 4AWXB 1B6AA 1YW7A 1W5TA 3WGIA 1FWZA 5FFXA 1ON1A 1WKMA 4BQAA 4AIHA 1EH8A 1S7OA 2DK5A 2G9WA 1IRFA 3CUQC 3WTXC 3DPLC 4G6QA 1QGPA 5FD5A 2ZMEA 1S8NA 3I64A 3RJPA 4G6DA 1FX7A 5A2QK 6PAXA 1FP2A 3K0LA 3HRSA 2A68F 5L3FA 3F22A 3GWZA 4ZYHA 1CF7A 2GAUA 5DCMA 3ROUA 3CJNA 4EMSA 1D5VA 3SZPA 5LLQA 3ISPA 2VONA 4P96A 3F72A 5JHUA 3F8FA 2BYVE 4L18B 1YTYA 2RGVA 1BI3A 1KYZA 4LG0B 4XLNF 1MJ9A 4UUVA 1HKSA 5DCMB 3B02A 2W85A 4ETSA 3CO7C 3SHFA 1Z9CA 3HRUA 3TKYA 4YFKF 2VT2A 2WV0A 1O7LA 3QRFF 4MQ9F 1EH6A 2OZUA 4KFCA 4HV5A 5D5WB 4B09A 2JPBA 4GO1A 2IVMA 4MNUA 3ZP5A 1TQPA 4UVCA 1TW3A 1DUXC 2COMA 3RI4A 1O7FA 1W7PB 3O6BB 2A5YB 1U8RA 3H92A 2K86A 1H9TA 2FQ3A 5BPDA 4AD9A 4BYYA 1X3UA 1JHFA 3D0SA 1U5TA 2IW5A 4U7DA 5JR3A 4OIOF 1R1VA 2K7LA 3TDUC 5LEJA 4ZYGA 4RAZA 1ODDA 2Y48A 4G94A 2BGCA 3DQVC 5LHGA 5D6FA 3L09A 1T0FA 1PP7U 1O3RA 2OQRA 2QQAA 3OV8A 2Z99A 3MCZA 4FX4A 4HDVA 4U0YA 2A6HF 5K5QA 1IN5A 2QWWA 4KIGA 1W4MA 1Z05A 3R0JA 3ECHA 1MJBA 3WG9A 3L7WA 1I1GA 3JTHA 4XRFA 1WI9A 2RC4A 4G7OF 4RB0A 5FFZA 2F5CA 2NYXA 1I6XA 2VBZA 5L3DA 2MD5A 3QP6A 4LFUA 1MKMA 3I0TA 4MTEA 3REOA 1RUOA 3ML6A 4I98B 3E6DA 2AXLA 2OA4A 5KVRA 3BJ6A 3TO6A 2XAQA 4U88A 2P6SA 4MTDA 2HZTA 2F5DA 2XROA 2P5LC 2W57A 2DFIA 3ABUA 4KN4X 3KP5A 1IZ1A 4R8HA 4HV6A 2Y75A 3L9FA 4WXHA 3HYIA 3S2WA 2HKXA 3VFZA 2FSWA 1OPCA 4OIPF 1OKRA 4RS8A 3P9IA 4QLCU 2GA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDP A;  2O61 A;  2LSO A;  3U2R A;  4ZYE A;  2ACJ A;  5HS8 A;  3F8C A;  1BIB A;  3IKT A;  5FLX Z;  1D3Y A;  2DK8 A;  3HUG A;  3KEO A;  1BC8 C;  1GVJ A;  3GZ6 A;  2JRT A;  3TOA A;  5ILU A;  3VOD A;  2EWN A;  1O3S A;  1IAW A;  4HAM A;  2XGX A;  2HDC A;  5DUK A;  3T8T A;  2XAS A;  1R00 A;  2UXX A;  1W5S A;  1O3T A;  4MQV A;  2QZ8 A;  4P9F A;  1BN5 A;  1KQ9 A;  2GZW A;  4ZZL A;  1YLF A;  2EFP A;  2VOP A;  1I27 A;  1AOY A;  2FMY A;  1SD4 A;  5K1Y A;  5ICC A;  5E8I A;  3BDD A;  4WX9 A;  2GA2 A;  3HTU A;  1ZRC A;  4IRH A;  2HR3 A;  2KIU A;  2A69 F;  2V9V A;  3MZH A;  5BS6 A;  5HS7 A;  2NAZ A;  3LA3 A;  2RNJ A;  3FXR A;  2P8T A;  2R7D A;  3HSF A;  3V7C A;  4I0B A;  3BJA A;  4O5V A;  1KU2 A;  2HGC A;  3QU3 A;  3K9T A;  3EQL F;  2R3S A;  1T39 A;  3FF5 A;  3K69 A;  2IP2 A;  3ECO A;  1PP8 F;  5L3E A;  4I7H A;  4KMF A;  3V8L A;  4N0B A;  4UV9 A;  4YII A;  3GFJ A;  3BPX A;  2IPQ X;  4ON0 A;  3Q9V A;  4OMY A;  5H6Q A;  1P4W A;  3GFM A;  3CTA A;  2L3D A;  1J2X A;  1QZZ A;  1SD6 A;  3WOD F;  3HSR A;  3F8M A;  3M1E A;  1EV7 A;  2MLK A;  4HQE A;  5CYV A;  3JAM K;  1ZG1 A;  2L54 A;  5LBQ A;  1XCB A;  1JXS A;  2QLZ A;  5J8C A;  4L9N A;  1TNT A;  4BXU A;  3ZMD A;  2DU9 A;  2FU4 A;  1Z91 A;  5EEG A;  3HSE A;  4MEX F;  1B1B A;  2NRA C;  3WTY C;  1YYV A;  2O03 A;  5HDK A;  3ERE D;  1D8J A;  1XMK A;  2HTS A;  3C1D A;  4HX7 A;  1YW8 A;  4A5M A;  4I09 A;  2UWM A;  1I1S A;  2YSR A;  2GXB A;  2M1B A;  1SFE A;  2DW4 A;  1ZLJ A;  5A2Q Z;  1BM9 A;  1V3F A;  5E18 F;  2V6C A;  1U5T C;  5DYM A;  4UHT A;  1UB9 A;  3TO7 A;  3R6S A;  1P92 A;  2DQR A;  4LLN A;  3FX3 A;  5ILS A;  5E1Z B;  1G3T A;  1WRJ A;  4KIC A;  5AIP A;  5D8K B;  1YQA A;  3T8R A;  4Q4Z F;  4LK0 F;  3F6O A;  3V8J A;  1WSU A;  1ULY A;  3CLO A;  3P9K A;  1QQI A;  2CSO A;  1Z6T A;  1YG2 A;  3LQR A;  4M9X A;  4ZYD A;  1K79 A;  3HHG A;  2LNB A;  2OD5 A;  3HHH A;  4FX0 A;  4ENK A;  4U0V A;  4B8X A;  2VE8 A;  3KZZ A;  1LJ9 A;  3I58 A;  3GEZ A;  1HW1 A;  1QO0 D;  5F6F A;  4CO8 A;  4BHC A;  2R7F A;  4A12 A;  3EUH A;  5DUI A;  4OIN F;  1QZY A;  3K1N A;  2CO5 A;  1YW9 A;  3H3Z A;  1GXP A;  1PUE E;  4GGG A;  4A0X A;  2JTV A;  5L3B A;  1KQ8 A;  4A2U A;  2GWR A;  3KEQ A;  3C7J A;  4OIQ F;  5BPI A;  2JSC A;  3R0A A;  3MZY A;  2KKO A;  4N9H A;  4IXA A;  1R1T A;  2QQB A;  1J75 A;  5FO5 A;  1ZLK A;  3VOE A;  4OIR F;  3DPT A;  3J80 Z;  2GQQ A;  1S29 A;  2K4B A;  1UST A;  2EFO A;  2ZKZ A;  1J9I A;  1USS A;  5TJJ A;  5CVI A;  3Q9S A;  3ZN0 A;  1LEA A;  2UXN A;  3MAJ A;  4HF1 A;  5E20 A;  2BBY A;  3F8N A;  1WQ2 A;  4G9Y A;  3RIR A;  1KYW A;  2A07 F;  1JGS A;  1FBU A;  4L0Z B;  1K78 A;  5DDG A;  4L5J A;  2VOD A;  3WE2 A;  4KYW A;  4FT8 A;  1FSE A;  3F8B A;  3KLO A;  2EFQ A;  3ZMZ A;  1U5T B;  2QUF A;  2QYO A;  1RIO H;  3QOP A;  2GXG A;  5E8G A;  5HOO A;  2PQ8 A;  4RGS A;  1XSV A;  1SD7 A;  3GYH X;  3HRT A;  3BWG A;  3N97 A;  3CDH A;  4IVN A;  2IJL A;  5E1X A;  3M9A A;  4AIJ A;  2VT3 A;  4LD5 A;  4ENN A;  3DF8 A;  1SFU A;  3RYP A;  1TTY A;  1E17 A;  1IN6 A;  1LDD A;  3M8E A;  4A6D A;  1XGS A;  4G8X A;  3GF2 A;  1KQ0 A;  4IPA A;  1IXC A;  2ZCW A;  1MZB A;  4YG2 F;  1R5H A;  1ZGA A;  3G73 A;  3MQ0 A;  3CO6 C;  3MWM A;  1IN7 A;  3AAF A;  4EGY A;  2HTJ A;  2DO7 A;  4UNO A;  3EYY A;  3KP6 A;  4L0Y B;  3ELK A;  2NS0 A;  1XMA A;  5CVR A;  4UV8 A;  4M71 A;  4PGH A;  2CFX A;  2O8X A;  3KLN A;  5CVJ A;  3TDZ C;  1ZAO A;  4E70 A;  3G3Z A;  2QEN A;  1T98 A;  4M6Y A;  3JSP A;  5H20 A;  4A6E A;  1GXQ A;  1IRG A;  1IN8 A;  1FP1 D;  4M9Z A;  1G3Y A;  3PQK A;  4EJW A;  2D1V A;  1KA8 A;  2DT5 A;  3QPH A;  3JSO A;  3KP7 A;  2HQR A;  2F5E A;  4ESF A;  3HOT A;  4YFX F;  4WXC A;  2Z33 A;  1B59 A;  3CUQ A;  1XGO A;  5KK1 A;  5JFR A;  1W7P A;  3I54 A;  1SFX A;  1B9N A;  3FXU A;  3K1P A;  2VBY A;  2MC3 A;  4ESJ A;  3K1M A;  4GXO A;  3GO5 A;  3GFL A;  2H27 A;  1V4R A;  2PLY A;  2J5O A;  3FMS A;  4M74 A;  2FML A;  1HW5 A;  3HOS A;  1TLH B;  1DPR A;  2P7V B;  4LLG F;  1TQM A;  2ETH A;  3QAH A;  3ABT A;  1RNL A;  3RDI A;  1REP C;  3WGG A;  4ENJ A;  4JQF A;  2E1C A;  2XVC A;  3JW4 A;  4EVI A;  3EET A;  1JHH A;  3F6V A;  3ZMU A;  4M9S A;  4HZF A;  5IT9 K;  1YS6 A;  4HA8 A;  4KDP A;  1OYW A;  5HDG A;  2B0L A;  4Q5S F;  2QM3 A;  5K5O A;  2HKO A;  1FOK A;  2ZBK A;  3F23 A;  1Z6R A;  1J0R A;  5DD8 A;  1IXR C;  2XAF A;  2PN6 A;  1ZRD A;  4HLX A;  1EH7 A;  4A5N A;  1SAX A;  5ICF A;  1Z7U A;  3TGN A;  1B9M A;  1ZG5 A;  3V4G A;  3C18 A;  2YX4 A;  1B4A A;  1ZRF A;  2QBY B;  2WC2 A;  5BMZ A;  4LB5 A;  1QBJ A;  1MJA A;  2D2W A;  4KT5 C;  4NB5 A;  5HVQ C;  3ZMV A;  3KCC A;  4U7B A;  3IL2 A;  4N9I A;  4Q48 A;  3Q5F A;  1XSD A;  1MD0 A;  3HIF A;  3LFK A;  2TDX A;  4GYI A;  1IW7 F;  3GLX A;  1YFH A;  1IUY A;  3FZV A;  4S04 A;  1ONV A;  2M87 A;  2E7W A;  2CGP A;  1R5G A;  2M45 A;  2HYG D;  4IRG A;  2PJP A;  3IC7 A;  2EV0 A;  4IJA A;  1R23 A;  2EK5 A;  3VB2 A;  1UCR A;  4ESB A;  3N4M A;  2EV5 A;  5D4R A;  3BRO A;  4KNY A;  3FHZ A;  1K78 B;  2KJC A;  3LST A;  2JT1 A;  3ZPL A;  5ILV A;  1A04 A;  2XKO A;  3LA2 A;  4CXF A;  3BPV A;  2P7C B;  3DEU A;  5CJ9 A;  1U6G A;  3FM3 A;  4OOI A;  1LEB A;  1BJA A;  5ICG A;  2XAG A;  4KIB A;  2FE3 A;  5IT9 Z;  2Z3Y A;  2FF4 A;  3U9G A;  4BHP A;  4XBF A;  5D5U B;  3IWZ A;  2C6Y A;  1P4A A;  3GXO A;  3T5X A;  2DBB A;  4EJV A;  1G4D A;  3QU6 A;  1R36 A;  3E5Q A;  4RGR A;  2PEX A;  1KU9 A;  1LNW A;  4ZH4 F;  4L9V A;  4PCQ A;  1J7K A;  4L5I A;  2A3S A;  4F7Z A;  5F1R A;  2FEZ A;  2L02 A;  4JBA A;  3WTZ A;  1WWX A;  1LDJ A;  2J5P A;  2VE9 A;  1BI2 A;  4R1H A;  3WTW C;  1BI0 A;  2K27 A;  2XAJ A;  5LHI A;  3O2P E;  1TNS A;  3CUQ B;  4L9J A;  2MBF A;  1OYI A;  3J80 K;  3ZN1 A;  4MHG A;  1JE8 A;  1DPU A;  1F1Z A;  3KE2 A;  4R79 A;  1L3L A;  4WWC A;  1XB4 A;  2ZNZ A;  4EGZ A;  3BZ6 A;  3IHU A;  1BOA A;  2PG4 A;  3CUO A;  2RV8 A;  4BH9 A;  5TRD A;  1MDM A;  5LRS A;  1QNT A;  5DD4 A;  4Q47 A;  2EJR A;  2OAZ A;  5HS9 A;  3ZQ7 A;  1P6R A;  4KUM A;  1SMT A;  3WTS C;  2KJB A;  3PFI A;  1D8K A;  2YX7 A;  1J59 A;  5JVT A;  1HKT A;  2VBW A;  1ZGJ A;  3JTG A;  4RB1 A;  4IF4 A;  4YFN F;  4HLY A;  4HYE A;  3W6J B;  2DI3 A;  2V79 A;  1T38 A;  1XDS A;  2O6G E;  1FT9 A;  2W24 A;  1T2K A;  2X4H A;  4A0Y A;  4G7H F;  2RN7 A;  4ZZD A;  5F64 A;  1HBX G;  2HS5 A;  2FBK A;  1STZ A;  3FM5 A;  1BIA A;  2E1N A;  1FYL A;  4MGR A;  3HRM A;  2DLL A;  3COA C;  5D5V B;  3SXY A;  2O0Y A;  5J8F A;  5L3G A;  3P9C A;  3BOQ A;  5DV5 A;  2VC0 A;  1PDN C;  2VC1 A;  4EV0 A;  2P6T A;  4PGG A;  5IT3 A;  2EA2 A;  4HDU A;  2HOE A;  2XV4 S;  2FRH A;  3IKV A;  4H0E A;  3L2C A;  4GYG A;  4LK1 F;  2XIG A;  1UFM A;  4CIC A;  1ZYR F;  4I01 A;  3TO9 A;  2WWY A;  2FA5 A;  2F2E A;  3EYI A;  3KP2 A;  1RUN A;  3RPQ A;  2MA3 A;  2H94 A;  2CYY A;  2ISZ A;  4TV7 A;  4Y17 A;  1K7A A;  5ERI A;  2FBH A;  2PMU A;  5ICE A;  2PMH A;  1RI7 A;  4LJZ F;  3HTS B;  3V7S A;  1CF7 B;  3KZY A;  3WE3 A;  3SFZ A;  1ZAR A;  1NHA A;  1LB2 A;  3E97 A;  4XSZ F;  4LGW A;  4WF2 A;  4LG0 A;  1O3Q A;  2DAO A;  4U0W A;  3WTT C;  1FLI A;  3QP5 A;  2ZO4 A;  5AON A;  3JAM Z;  3NQO A;  2W84 A;  4GCV A;  2QBY A;  5E1W A;  2W25 A;  1Y0U A;  2P5V A;  2YR2 A;  1FYK A;  2AS5 F;  1K6O A;  1FYM A;  2OZ6 A;  5LRR A;  1HKQ A;  3H3U A;  5FD6 A;  4KN7 X;  3D5L A;  3RKX A;  5LGU A;  2M5W A;  1TW2 A;  2DQL A;  5FGM A;  4EJU A;  4WK8 F;  5AIQ A;  2ZME B;  4RAY A;  4MEY F;  1F5T A;  4M6X A;  5FLX K;  2RQP A;  4O6J A;  3WTV C;  2O3F A;  3BJO A;  4I0A A;  4NHJ A;  2PBI A;  2IA1 A;  2MH9 A;  4P55 A;  1FC3 A;  2ZJ2 A;  2JZY A;  3IWF A;  3RTR A;  1XD7 A;  1S6L A;  4UVB A;  2PFB A;  5CVV A;  2LF7 A;  2LKP A;  2YPR A;  3R61 A;  1BBY A;  4HW0 A;  4UXN A;  1SD5 A;  1U2W A;  4EJO A;  4IHS A;  1UHW A;  4KMU X;  2KRF A;  1HW2 A;  3GX4 X;  2YU3 A;  2EFN A;  2DPU A;  3OOP A;  1RZ4 A;  5E17 F;  3M8F A;  3DFG A;  4RB3 C;  3FXQ A;  3SZT A;  2Y0M A;  4EJT A;  4AVP A;  3FWE A;  2ZXJ A;  2L01 A;  5DCF A;  3T1B A;  1CGP A;  2STW A;  3O3K A;  5H6R A;  1G3S A;  3DXJ F;  2H6B A;  2RDP A;  2RKH A;  2Q8K A;  3BP8 A;  3SQN A;  1F9N A;  4OMZ A;  4Y15 A;  4PDK A;  1YS7 A;  1S7A A;  1FZP B;  2CQK A;  1P2F A;  4P5O A;  3E3V A;  3TQN A;  2ZNY A;  1DDN A;  4HX4 A;  5HLH A;  2ISY A;  1ON2 A;  2V1U A;  3M7G A;  1H9G A;  1XDU A;  4M72 A;  2IA2 A;  2JPC A;  3GW2 A;  1IF1 A;  3DV8 A;  3K2Z A;  1MDM B;  1R58 A;  5HDN A;  1SMY F;  2G7H A;  1TBX A;  2XUB A;  1XN7 A;  2VOO A;  2F5F A;  2WTE A;  4DQ2 A;  3L00 A;  1BC7 C;  1MGT A;  3FMQ A;  1TQI A;  5CVU A;  3IRR A;  3J81 Z;  5LGN A;  1OYY A;  2H6C A;  5BQT A;  5LGT A;  1YIO A;  3LA7 A;  1HSJ A;  2PI0 A;  2EA4 A;  2XRN A;  4QWQ A;  2KIF A;  3RKY A;  3PQJ A;  1W7P D;  4BHB A;  1FBS A;  1G3W A;  1OMI A;  2G7U A;  5FB2 A;  3KET A;  3FMR A;  2VN2 A;  1YO5 C;  2EV6 A;  2H09 A;  1ZH5 A;  1LDK B;  4PZJ A;  2CW0 F;  3WU1 B;  4A0Z A;  4HF0 A;  3NRV A;  3KP3 A;  2VXZ A;  4NQW A;  3VEP A;  1I5Z A;  2QQ9 A;  3E5X A;  5LHH A;  2ESH A;  1LVA A;  2M8E A;  5JI6 A;  1BI1 A;  3WU0 A;  1HST A;  3C3W A;  2L4M A;  2Q0O A;  4M73 A;  2HFH A;  1J5Y A;  1O57 A;  3GFI A;  4BAY A;  1KU7 A;  1E2X A;  1FNN A;  3P7N A;  2ELH A;  2ZFW A;  4I2O A;  4FHT A;  4P9U A;  5D6E A;  3MFK A;  3TOB A;  1R1U A;  2P4W A;  3DP7 A;  2VBX A;  4LLL A;  1T6S A;  3E6B A;  3U1D A;  1AWC A;  2FXA A;  2K02 A;  4EM0 B;  2V1X A;  2L4A A;  4Y13 A;  1IN4 A;  4IHT A;  2GIV A;  4L9T A;  2XKP A;  1HQC A;  3F3X A;  4XSX F;  2IT0 A;  4CDG A;  5CLS A;  3GVA A;  4HQM A;  2OU2 A;  4HX8 A;  4CHU A;  2KIM A;  4O3M A;  3LQQ A;  2DTR A;  3IRQ A;  2X0L A;  4AIK A;  1Q1H A;  5D5X B;  4CGZ A;  4XLP F;  4G7Z F;  2P5K A;  3W6K B;  5ED4 A;  3J81 K;  2K4J A;  2Z5U A;  3J7A O;  3R60 A;  4KA4 A;  1LQ1 A;  2MLG A;  4DNC A;  1FSH A;  2FNA A;  2BE5 F;  3ULQ B;  2CWE A;  4JK1 X;  5D8L B;  1FPQ A;  5D4S A;  4RGU A;  4OU0 A;  2MH2 A;  4LMY A;  4CYD A;  2HEO A;  3WTU C;  2D1H A;  3WGH A;  1XGM A;  2NNN A;  2IA0 A;  2LF8 A;  3RYR A;  1R7J A;  3GZ5 A;  3DKW A;  1DP7 P;  1XSX A;  2Q2E A;  1OR7 A;  4S05 A;  1KGS A;  3NEU A;  4HBL A;  4RGX A;  2QVO A;  3I71 A;  2Z9O A;  2A61 A;  1GHC A;  1U78 A;  4RB2 C;  1FBQ A;  4HOB A;  4HF2 A;  2FNP A;  3I59 A;  2BEO A;  1ZN2 A;  1KU3 A;  2CG4 A;  4K2E A;  2STT A;  3GUD A;  1F4K A;  1HXD A;  3I5U A;  5EEH A;  4EQQ A;  2M30 A;  3QPT A;  4Z2Y A;  3KP4 A;  5LEK A;  3E5U A;  1IXS B;  2FOK A;  2EB7 A;  4CZZ A;  3RKW A;  3KFW X;  2ESN A;  3T0Y A;  2RVC A;  3BY6 A;  3ZMS A;  2HQN A;  3MEX A;  5HLI A;  2LDU A;  4EM2 A;  2V1D A;  1H0M A;  2XHK A;  1ZHF A;  3I4P A;  4WCG A;  3B73 A;  1ZRE A;  5K5R A;  5BOX A;  2HWV A;  1P4X A;  4EM1 A;  3E6C C;  2EFW A;  4ASN A;  3F21 A;  4BNC A;  4IRI A;  4YIF A;  2NNY A;  4I02 A;  1VTN C;  2BV6 A;  1G6N A;  1U3E M;  1QPM A;  2OBP A;  1R22 A;  2FBI A;  1XCV A;  2E7X A;  3V7R A;  4ENM A;  3LAJ A;  3I53 A;  1S3J A;  2ADU A;  3V8K A;  1XGN A;  1Z1D A;  1C0W A;  2D45 A;  2OQG A;  5DEQ A;  3LWF A;  2XAH A;  4UVA A;  5L3C A;  3E6M A;  2UZK A;  1L0O C;  3R4K A;  4KIF A;  5J6X A;  2DPD A;  2HYF A;  2A6E F;  3LAP A;  3RPU A;  4D0P A;  2IRF G;  1UHM A;  1FY7 A;  4WXD A;  5HLG A;  1ZG3 A;  3I59 B;  4LB6 B;  3ZMT A;  4AWX B;  1B6A A;  1YW7 A;  1W5T A;  3WGI A;  1FWZ A;  5FFX A;  1ON1 A;  1WKM A;  4BQA A;  4AIH A;  1EH8 A;  1S7O A;  2DK5 A;  2G9W A;  1IRF A;  3CUQ C;  3WTX C;  3DPL C;  4G6Q A;  1QGP A;  5FD5 A;  2ZME A;  1S8N A;  3I64 A;  3RJP A;  4G6D A;  1FX7 A;  5A2Q K;  6PAX A;  1FP2 A;  3K0L A;  3HRS A;  2A68 F;  5L3F A;  3F22 A;  3GWZ A;  4ZYH A;  1CF7 A;  2GAU A;  5DCM A;  3ROU A;  3CJN A;  4EMS A;  1D5V A;  3SZP A;  5LLQ A;  3ISP A;  2VON A;  4P96 A;  3F72 A;  5JHU A;  3F8F A;  2BYV E;  4L18 B;  1YTY A;  2RGV A;  1BI3 A;  1KYZ A;  4LG0 B;  4XLN F;  1MJ9 A;  4UUV A;  1HKS A;  5DCM B;  3B02 A;  2W85 A;  4ETS A;  3CO7 C;  3SHF A;  1Z9C A;  3HRU A;  3TKY A;  4YFK F;  2VT2 A;  2WV0 A;  1O7L A;  3QRF F;  4MQ9 F;  1EH6 A;  2OZU A;  4KFC A;  4HV5 A;  5D5W B;  4B09 A;  2JPB A;  4GO1 A;  2IVM A;  4MNU A;  3ZP5 A;  1TQP A;  4UVC A;  1TW3 A;  1DUX C;  2COM A;  3RI4 A;  1O7F A;  1W7P B;  3O6B B;  2A5Y B;  1U8R A;  3H92 A;  2K86 A;  1H9T A;  2FQ3 A;  5BPD A;  4AD9 A;  4BYY A;  1X3U A;  1JHF A;  3D0S A;  1U5T A;  2IW5 A;  4U7D A;  5JR3 A;  4OIO F;  1R1V A;  2K7L A;  3TDU C;  5LEJ A;  4ZYG A;  4RAZ A;  1ODD A;  2Y48 A;  4G94 A;  2BGC A;  3DQV C;  5LHG A;  5D6F A;  3L09 A;  1T0F A;  1PP7 U;  1O3R A;  2OQR A;  2QQA A;  3OV8 A;  2Z99 A;  3MCZ A;  4FX4 A;  4HDV A;  4U0Y A;  2A6H F;  5K5Q A;  1IN5 A;  2QWW A;  4KIG A;  1W4M A;  1Z05 A;  3R0J A;  3ECH A;  1MJB A;  3WG9 A;  3L7W A;  1I1G A;  3JTH A;  4XRF A;  1WI9 A;  2RC4 A;  4G7O F;  4RB0 A;  5FFZ A;  2F5C A;  2NYX A;  1I6X A;  2VBZ A;  5L3D A;  2MD5 A;  3QP6 A;  4LFU A;  1MKM A;  3I0T A;  4MTE A;  3REO A;  1RUO A;  3ML6 A;  4I98 B;  3E6D A;  2AXL A;  2OA4 A;  5KVR A;  3BJ6 A;  3TO6 A;  2XAQ A;  4U88 A;  2P6S A;  4MTD A;  2HZT A;  2F5D A;  2XRO A;  2P5L C;  2W57 A;  2DFI A;  3ABU A;  4KN4 X;  3KP5 A;  1IZ1 A;  4R8H A;  4HV6 A;  2Y75 A;  3L9F A;  4WXH A;  3HYI A;  3S2W A;  2HKX A;  3VFZ A;  2FSW A;  1OPC A;  4OIP F;  1OKR A;  4RS8 A;  3P9I A;  4QLC U;  2GA1 A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  2QKL B;  3EDP A;  4YEJ A;  2O61 A;  2LSO A;  3CCQ I;  1WPK A;  3U2R A;  4AYB A;  2XC7 A;  1RQ6 A;  4ZYE A;  3W3C A;  2ACJ A;  5J4Y A;  4C30 A;  5HS8 A;  3F8C A;  1BIB A;  3IKT A;  5FLX Z;  4X0G A;  1D3Y A;  1YOV B;  2DK8 A;  2CJJ A;  3HUG A;  3Q0U A;  3KEO A;  1BC8 C;  1GVJ A;  2GM4 A;  2P0T A;  2DN0 A;  2F5V A;  5C4J J;  3GZ6 A;  1GVD A;  2JRT A;  3TOA A;  1LFB A;  1IV8 A;  1OQY A;  3K4L A;  5ILU A;  3VOD A;  2EWN A;  2XRL A;  1O3S A;  1WJE A;  1IAW A;  5IOY A;  2E71 A;  3AL0 C;  2CH0 A;  4HAM A;  2V7F A;  2XGX A;  5EG0 A;  2JA8 J;  2HDC A;  5DUK A;  3T8T A;  2XAS A;  2JUC A;  4LG3 A;  2NVT J;  1R00 A;  4C2T A;  2UXX A;  1W5S A;  3G2B A;  1O3T A;  2O9L A;  4MQV A;  2QZ8 A;  4P9F A;  1BN5 A;  1KQ9 A;  2GZW A;  3DKY A;  4ZZL A;  1YLF A;  3DU5 A;  2EFP A;  2VOP A;  1I27 A;  1AOY A;  4BKX A;  4DYR A;  3HOV J;  1ZQ3 P;  4HNV A;  1QPI A;  2FMY A;  1SD4 A;  3BR5 A;  3HJE A;  5K1Y A;  2PJR B;  3VPR A;  5ICC A;  3QOE A;  5E8I A;  4PJN A;  3VYT B;  2LOO A;  3BDD A;  4WX9 A;  2GA2 A;  4NNJ A;  3HTU A;  1SAU A;  2BXY A;  2BY0 A;  2LD5 A;  1ZRC A;  4IRH A;  2DJN A;  1VQP I;  2HR3 A;  2KIU A;  2A69 F;  2DTZ A;  2V9V A;  3MZH A;  2IBD A;  5BS6 A;  5HS7 A;  1VQ9 I;  3PO2 J;  2NAZ A;  3LA3 A;  2RNJ A;  3FXR A;  2P8T A;  2K5C A;  2R7D A;  3HSF A;  4I0B A;  3BJA A;  4O5V A;  3V7C A;  4FE7 A;  2QSG X;  3DTK A;  1KU2 A;  2RNG A;  4ZC3 A;  3DBL B;  2HGC A;  2XGD A;  1FIA A;  3QU3 A;  4BDZ A;  3K9T A;  2EZK A;  3IP4 B;  5E3O A;  3EQL F;  1TC3 C;  4CCJ A;  1VQO I;  2R3S A;  3HOZ J;  1T39 A;  3FF5 A;  5JHF A;  3K69 A;  2IP2 A;  2QSF X;  3ECO A;  1PP8 F;  1JJ8 C;  5L3E A;  4I7H A;  4KMF A;  3V8L A;  4BE0 A;  3OYG A;  2E60 A;  3OR2 C;  4N0B A;  3BQZ A;  2VL8 A;  1I3Q J;  1POG A;  2M9H A;  4UV9 A;  1Y39 A;  4YII A;  3GFJ A;  3OIP A;  2OV7 A;  3BPX A;  4IKF A;  1LUJ B;  3TL4 X;  2WV1 A;  2VKV A;  2IPQ X;  3JRG A;  1I50 J;  4ON0 A;  4BJ6 C;  1WHU A;  3Q9V A;  4OMY A;  5H6Q A;  3J81 R;  1P4W A;  4DIQ A;  3ZQL A;  3GFM A;  3CTA A;  2L3D A;  3BR6 A;  2DCE A;  1J2X A;  4EAT A;  1QZZ A;  2V6E A;  4J19 A;  2Z16 A;  5J40 A;  2WY8 Q;  3SEZ A;  4FQG A;  1OR7 C;  1SD6 A;  3AKZ A;  3WOD F;  2E2I J;  4N4O B;  3HSR A;  3QWL A;  3F8M A;  2Y2Z A;  1MMS A;  3M1E A;  1F43 A;  1EV7 A;  2P0W A;  2MLK A;  2VKH A;  4HQE A;  2XGC A;  5CYV A;  5DM7 F;  3JAM K;  1ZG1 A;  1JKO C;  2EQR A;  2L54 A;  1B8I A;  3TP3 A;  5TGT A;  5LBQ A;  1XCB A;  1JXS A;  2QLZ A;  2HDD A;  5J8C A;  4L9N A;  3SZG A;  1TNT A;  2X85 A;  4BXU A;  3ZMD A;  2XDV A;  2NVU B;  2DU9 A;  2FU4 A;  3A03 A;  2CUF A;  1D1C A;  4IQJ A;  3VWB A;  1Z91 A;  5EEG A;  3H5R A;  3HSE A;  4MEX F;  2M35 A;  1B1B A;  2NRA C;  3WTY C;  3PIP F;  1YYV A;  2O03 A;  5HDK A;  3ERE D;  1D8J A;  1XMK A;  4CYC A;  5F27 A;  1PUF A;  2HTS A;  3C1D A;  2K9Q A;  3S32 A;  4HX7 A;  1LE8 B;  1YW8 A;  4A5M A;  1VQN I;  4M3E A;  3WHC A;  1ETX A;  2IGN A;  4I09 A;  1K61 A;  3GTO J;  2UWM A;  1D5Y A;  1I1S A;  2YSR A;  3K4C A;  2OCE A;  2GXB A;  1OIS A;  2M1B A;  1SFE A;  2DA5 A;  2DW4 A;  2GOM A;  1DGR M;  1HCR A;  2LBF B;  3M8J A;  1ZLJ A;  2B9S A;  5A2Q Z;  1BM9 A;  1V3F A;  5E18 F;  3LSR A;  3VSK A;  2HOT A;  2V6C A;  3VYS B;  2IEK A;  2KFD A;  1BW6 A;  3K7A J;  1U5T C;  3ZQI A;  5DYM A;  2MD0 A;  4UHT A;  4I6Z A;  2L7Z A;  1UB9 A;  3HG9 A;  5HLT A;  3TO7 A;  1X4O A;  3R6S A;  1P92 A;  2QCO A;  4B1R A;  2DQR A;  4LLN A;  3FX3 A;  5ILS A;  2P81 A;  5E1Z B;  1G3T A;  1R4M B;  3N05 A;  1QRY A;  1WRJ A;  3Q0V A;  1JT6 A;  4KIC A;  5AIP A;  5D8K B;  1TWH J;  1YQA A;  3T8R A;  2KIS A;  4Q4Z F;  3OYE A;  4LK0 F;  2WA0 A;  3F6O A;  3V8J A;  1WSU A;  2R0Q C;  1MH4 A;  1ULY A;  3CCU I;  4ZTF A;  3CLO A;  3P9K A;  1QQI A;  2CSO A;  1Z6T A;  3GTP J;  2DMN A;  1S5L C;  1YG2 A;  3LQR A;  4M9X A;  4ZYD A;  4DZP A;  1K79 A;  3HHG A;  2LNB A;  2OD5 A;  2V9P A;  3HHH A;  4FX0 A;  3UNG C;  4U0V A;  3TW6 A;  1HDP A;  4J00 A;  4ENK A;  4B8X A;  2IGO A;  2KRC A;  2Y9Y A;  2WAD A;  3BG6 A;  4Y33 A;  1WI3 A;  4JX5 A;  2VE8 A;  3KZZ A;  3GME A;  4ZDP A;  1LJ9 A;  3I58 A;  3GEZ A;  1HW1 A;  2ZC2 A;  1QO0 D;  3HGG A;  4XRS G;  5F6F A;  4CO8 A;  4BHC A;  2CUZ A;  4QTR A;  1GT0 C;  2Y30 A;  2R7F A;  4A3M J;  3OSG A;  4A12 A;  4A69 C;  3EUH A;  5DUI A;  4OIN F;  5CPR B;  2Y0S N;  4E7Z A;  1QZY A;  3K1N A;  2CO5 A;  2UV1 A;  4A3C J;  2DOE A;  2QA4 I;  1YW9 A;  5J1Y A;  1ETQ A;  2HYJ A;  2ZSI B;  2R7W A;  3K4B A;  3H3Z A;  1ACI A;  1RET A;  1GXP A;  1PUE E;  2NXN B;  4GGG A;  4A0X A;  2JTV A;  3RKQ A;  2DFE A;  5L3B A;  2LY2 A;  1ETW A;  2QQ8 A;  1KQ8 A;  2BXZ A;  4A2U A;  3PSI A;  1MIJ A;  2GWR A;  3E0J B;  3HPH A;  2R92 J;  3KEQ A;  3C7J A;  2LC2 A;  4OIQ F;  5KNL A;  3CMM A;  5BPI A;  2R7Q A;  3FBN B;  3RPU D;  2JSC A;  3R0A A;  3MZY A;  2XGE A;  2KKO A;  3I4N J;  4CCK A;  3OYF A;  4N9H A;  4JOM A;  4XLE A;  3OYB A;  2YU9 J;  1JUP A;  4IXA A;  1R1T A;  3QYF A;  3W2A A;  1LFU P;  3S1Q J;  2VPL A;  2DA7 A;  2QQB A;  3BZC A;  1JTY A;  5FO5 A;  1J75 A;  2LTP A;  2VIX A;  1YRN A;  2ZFU A;  1E3P A;  1ZLK A;  2XB0 X;  3GTG J;  2NS8 A;  3VOE A;  1AHD P;  1MNE A;  4OIR F;  2WB1 A;  2JK3 A;  3DPT A;  3J80 Z;  2RQQ A;  3IH4 A;  2DOD A;  4D7N A;  2LKS A;  2GQQ A;  1S29 A;  2K4B A;  2DJI A;  1UST A;  2EFO A;  3NAU A;  4PJJ A;  2CS3 A;  3DWL E;  2ZKZ A;  2CV0 A;  5A2Q R;  4XRS A;  2NVX J;  3A52 A;  1J9I A;  2HPI A;  1BJZ A;  2VQC A;  1USS A;  1MH3 A;  1B72 B;  3OS0 A;  5TJJ A;  3TW7 A;  1I6H J;  5CVI A;  3Q9S A;  3ZN0 A;  1LEA A;  2UXN A;  3MAJ A;  3D5R C;  4HF1 A;  5E20 A;  1IJW C;  2BBY A;  3F8N A;  3HKZ N;  4B48 A;  1WQ2 A;  4G9Y A;  3RIR A;  1KYW A;  2A07 F;  1JGS A;  1FBU A;  4L0Z B;  5IP9 J;  1MMD A;  2F4I A;  4XMY A;  2PMZ A;  1K78 A;  3PM1 A;  3S15 J;  1V5E A;  3DEE A;  3OYN A;  4NC6 A;  5DDG A;  4L5J A;  2VOD A;  2OTJ I;  5GAD J;  2LVS A;  1UMQ A;  3WE2 A;  3JAM R;  4PFP A;  4FT8 A;  4KYW A;  3NWT A;  5E3M A;  3FXK A;  2Q1Z B;  4IZZ A;  1FSE A;  3F8B A;  3KLO A;  2EFQ A;  3ZMZ A;  1U5T B;  2QUF A;  5F0F A;  2QYO A;  2V1N A;  1ZR4 A;  3J7Y J;  1RIO H;  1U0J A;  4LIV A;  2GOX B;  3QOP A;  2GXG A;  5E8G A;  2R7V A;  5HOO A;  2PQ8 A;  2VI6 A;  4RGS A;  1IG7 A;  1QZE A;  1SD7 A;  1XSV A;  1CQT A;  2I8D A;  3OIQ A;  3GYH X;  3HRT A;  4XQF A;  3BWG A;  3N97 A;  1WJ5 A;  3CDH A;  4IVN A;  1LFP A;  2IJL A;  5E1X A;  3D5S C;  2O8K A;  4CA0 A;  3M9A A;  4AIJ A;  2VT3 A;  4LD5 A;  1ZTR A;  4ENN A;  3DF8 A;  3CDL A;  1SFU A;  3RYP A;  1TTY A;  3UKG A;  3BQY A;  3G1L A;  1E17 A;  1IN6 A;  5GTI C;  1LDD A;  1S7E A;  3M8E A;  1ETY A;  5TIS C;  3KIO A;  4BY7 J;  3BTI A;  4A6D A;  1XC5 A;  3W6V A;  1Q1V A;  2PJR A;  1XGS A;  3LSP A;  2VAS A;  3BG9 A;  5J4V A;  1WH5 A;  2M0C A;  4G8X A;  4ABZ A;  1W0U A;  5B1B H;  3S8P A;  2L9V A;  1KQ0 A;  3GF2 A;  4IPA A;  4V2G A;  1IXC A;  4CZC A;  2ZCW A;  1MZB A;  1TP4 A;  3OMY A;  4H4K C;  5H2F C;  4YG2 F;  1R5H A;  1ZGA A;  3G73 A;  3MQ0 A;  1RKT A;  2E36 A;  4XRM A;  3CO6 C;  3MWM A;  1IN7 A;  4XNF A;  3AAF A;  1HC8 A;  5B3S H;  4EGY A;  3S3M A;  2HTJ A;  2DO7 A;  4UNO A;  2ELJ A;  3EYY A;  3KP6 A;  4L0Y B;  3PJR A;  4BDY A;  3ELK A;  4ZYA A;  1NG6 A;  1T0F C;  3E1S A;  3O8H A;  2NS0 A;  1XMA A;  2WAF A;  1P9Q C;  4UUT A;  4UV8 A;  5CVR A;  4M71 A;  3ZQG A;  4PGH A;  2CFX A;  2O8X A;  1GV2 A;  3KLN A;  5CVJ A;  3TDZ C;  1KZH A;  1ZAO A;  4E70 A;  3G3Z A;  2ZJQ F;  2VKE A;  2QEN A;  2COB A;  1W36 C;  4C2M J;  3OR1 C;  1T98 A;  2I5U A;  4GDF A;  3H0G J;  4M6Y A;  4DJA A;  3JSP A;  1MND A;  5H20 A;  4A6E A;  2XF5 A;  5M3F J;  1GXQ A;  1IRG A;  1IN8 A;  1MSF C;  3K70 D;  1FP1 D;  3L2U A;  4E7H A;  4M9Z A;  5LD2 C;  1R9T J;  1G3Y A;  3CCL I;  3KZI C;  4QPO A;  2X6O A;  4BAC A;  4BGD A;  3HC7 A;  3PQK A;  2GLO A;  4EJW A;  3GBG A;  2D1V A;  1IV6 A;  3TP0 A;  1KA8 A;  1E3H A;  2DT5 A;  3QPH A;  3JSO A;  4PK4 A;  3KP7 A;  2HQR A;  2HXI A;  2M7A A;  2RRE A;  4IHY A;  2CQQ A;  3BCA A;  2F5E A;  4ESF A;  3HOT A;  4YFX F;  4WXC A;  2Z33 A;  2X48 A;  2QGU A;  1B59 A;  2H8R A;  1GLN A;  3CUQ A;  4M3B A;  2R5Z A;  2BVL A;  3DU6 A;  1XGO A;  1JUS A;  4F3Q A;  2KQR A;  1TT0 A;  2BHY A;  2KP6 A;  1W7P A;  2W1O A;  5KK1 A;  5JFR A;  3I54 A;  3HL2 A;  1SFX A;  3I9V 2;  1B9N A;  3OYM A;  3FXU A;  2IS1 A;  3TBI A;  2H1K A;  2A5W A;  3OL4 A;  3K1P A;  3KPH A;  2VBY A;  2ZB9 A;  2MC3 A;  4ESJ A;  3K1M A;  4GXO A;  1YIT I;  3GO5 A;  4G6T B;  1TWG J;  2DYR H;  3GFL A;  2H27 A;  5M5W J;  3FIW A;  1V4R A;  4DW6 A;  3VYR B;  2E5N A;  3CCY A;  2PLY A;  2J5O A;  3FMS A;  2FUG 2;  4XOT A;  4M74 A;  4E7J A;  2FML A;  1HW5 A;  1S9H A;  3HOS A;  1TLH B;  1DPR A;  2P7V B;  2HVR A;  3VYU B;  5M5X J;  4LLG F;  5GP9 A;  1TQM A;  3CDI A;  2ETH A;  1UG0 A;  3C2G A;  3QAH A;  4Y52 J;  3ABT A;  1RNL A;  4NUB A;  3FXO A;  3RDI A;  1REP C;  2LY9 A;  3WGG A;  4IOC F;  4ENJ A;  4JQF A;  2LP0 A;  3J7Z I;  4A3E J;  2E1C A;  2NVQ J;  2XVC A;  3HBL A;  3JW4 A;  3LSK A;  4EVI A;  3BTJ A;  3EET A;  1JHH A;  1XTA A;  1VQ7 I;  3F6V A;  3ZMU A;  2EIK H;  1QHG A;  4M9S A;  2R7R A;  4HZF A;  5IT9 K;  2L9S A;  3G71 I;  1YS6 A;  4HA8 A;  4IX7 A;  4ZDO A;  3CCJ I;  4Y4R A;  2CV1 A;  3HOU J;  4YEL A;  1HOM A;  3UR3 C;  4KDP A;  1OYW A;  2JA6 J;  5HDG A;  2B0L A;  3OOU A;  5B1A H;  4Q5S F;  2QM3 A;  5K5O A;  3KX2 A;  2HKO A;  1X19 A;  1FOK A;  1Z77 A;  1VQK I;  2ZBK A;  5FJ8 J;  3F23 A;  2MW8 A;  2GBY A;  2BW3 A;  2PX9 A;  1W5C C;  1Z6R A;  1VQM I;  1J0R A;  5DD8 A;  1IXR C;  2XAF A;  4B44 A;  1YX5 A;  2PN6 A;  1FJL A;  1ZRD A;  3CQZ J;  2L9R A;  4HLX A;  4XON A;  4J01 A;  1EH7 A;  2DDB A;  4A5N A;  2VJ4 A;  1SAX A;  5ICF A;  1Z7U A;  3TGN A;  1B9M A;  1ZG5 A;  1VQ5 I;  3ONQ A;  3V4G A;  2EH3 A;  2VJJ A;  3X2Q H;  3C18 A;  2YX4 A;  1B4A A;  3WHB A;  1ZRF A;  2QBY B;  4XOR A;  2WC2 A;  5BMZ A;  4LB5 A;  3BG5 A;  1QBJ A;  1MJA A;  2D2W A;  4XIC A;  4KT5 C;  4NB5 A;  2DA3 A;  1G59 A;  5HVQ C;  3ZMV A;  1ZEL A;  3KCC A;  4U7B A;  3IL2 A;  1WJD A;  4N9I A;  3HDD A;  4HPQ A;  4Q48 A;  2V26 A;  5EZG A;  3Q5F A;  4RM3 A;  5M5Y J;  1XSD A;  1QHH D;  3H5A A;  5JVG F;  1MD0 A;  3HIF A;  3AG4 H;  3LFK A;  4IOA F;  2TDX A;  4GYI A;  2FOW A;  1IW7 F;  3GLX A;  2CUJ A;  3LFU A;  3V42 A;  3IH2 A;  4FCY A;  1YFH A;  1IUY A;  3FZV A;  4S04 A;  3ZQQ A;  1SAN A;  2M3A A;  1ONV A;  1SC7 A;  4F55 A;  2M87 A;  2E7W A;  2CGP A;  1R5G A;  2M45 A;  4MLO A;  2HYG D;  4IRG A;  2PJP A;  3IC7 A;  2EV0 A;  2TCT A;  2F4M B;  2XSD C;  4IJA A;  1R23 A;  2EK5 A;  3SYT A;  3VB2 A;  1UCR A;  4ESB A;  3N4M A;  2EV5 A;  5D4R A;  4OAZ A;  3BRO A;  4IO9 F;  3BR2 A;  4KNY A;  3H3V K;  3FHZ A;  2E19 A;  2GIZ A;  1K78 B;  4AUX A;  2KJC A;  2OF7 A;  1XX5 A;  4BJ5 C;  3LST A;  1Y1V J;  1ZR2 A;  1Z7L A;  1ETO A;  5EDN A;  2JT1 A;  3K2A A;  3ZPL A;  5ILV A;  1A04 A;  2XKO A;  3LA2 A;  1ZKG A;  1K6Y A;  4CXF A;  1EF4 A;  3BCB A;  3S3O A;  2V4J C;  3JRF A;  1FOX A;  3BPV A;  2Y9Z A;  2P7C B;  3DEU A;  5B66 C;  4DGW B;  1BL0 A;  2I10 A;  2RAE A;  5CJ9 A;  1U6G A;  4A3J J;  3CD6 I;  3FM3 A;  4OOI A;  3MKZ A;  3L2V A;  1LEB A;  1BJA A;  3ABL H;  4A3L J;  5ICG A;  2XAG A;  1AKH B;  4JP0 A;  4KIB A;  2FE3 A;  5IT9 Z;  2Z3Y A;  3RSN A;  2FF4 A;  3U9G A;  4BHP A;  2HVS A;  4XBF A;  1HA8 A;  5D5U B;  4CH7 A;  3H35 A;  3IWZ A;  2C6Y A;  2WY7 Q;  2HQA A;  3ZR8 X;  1DU0 A;  2JVG A;  1P4A A;  1UJ8 A;  3GXO A;  3BTC A;  3JRD A;  3MMY B;  3T5X A;  2DBB A;  4EJV A;  1G4D A;  3QU6 A;  3ZCO A;  2VLA A;  1R36 A;  3E5Q A;  1EKE A;  1M1E B;  4RGR A;  4CCN A;  4XR6 A;  3C2B A;  1BR1 A;  2DYS H;  1RRJ A;  3PSF A;  2PEX A;  1KU9 A;  1Y6I A;  5KHD A;  4D5F A;  1LNW A;  2BVM A;  4ZH4 F;  1JI8 A;  4L9V A;  3ZOB A;  4PCQ A;  1J7K A;  5DTD A;  1JGG A;  4L5I A;  2A3S A;  1Z3Y A;  4F7Z A;  5F1R A;  3SDB A;  3PO3 J;  2FEZ A;  2L02 A;  1WJA A;  2ME0 A;  4JBA A;  3WTZ A;  5EJC A;  1WWX A;  3FXJ A;  1LDJ A;  5GAE J;  2J5P A;  2VE9 A;  4CSW A;  3OYI A;  1X3Z B;  1BI2 A;  3LSI A;  3O8G A;  5HOD A;  2EZL A;  4R1H A;  4V19 K;  2EZI A;  4DOZ A;  4UY8 I;  3HKZ A;  3WTW C;  1YIJ I;  1OCR H;  1BI0 A;  1X58 A;  2K27 A;  2XAJ A;  5LHI A;  3O2P E;  1TNS A;  3CUQ B;  4FIS A;  2O5R A;  4L9J A;  3K4N A;  2NOJ B;  2MBF A;  3FBI B;  5DM6 F;  1XS9 A;  3SDG A;  1X3W B;  3W2W A;  1OYI A;  4C2U A;  3HOY J;  3D1N I;  2X9D A;  3OL3 A;  3J80 K;  3ZN1 A;  4MHG A;  1ZGW A;  1JE8 A;  1DPU A;  3KYC B;  1F1Z A;  3KE2 A;  5CQG A;  3QYB A;  1I39 A;  4R79 A;  2X98 A;  1LPQ A;  4NDL A;  1DP3 A;  1L3L A;  4WWC A;  4FET A;  1XB4 A;  2ZNZ A;  1IUF A;  4LIU A;  4EGZ A;  1NK3 P;  3BZ6 A;  2ZJP F;  4PFO A;  3IHU A;  1BOA A;  2PG4 A;  4C3H J;  2HXO A;  1FTT A;  3CUO A;  4RAF A;  5GAH J;  2RV8 A;  2AQE A;  3NAR A;  5GPA A;  4BH9 A;  4BQQ A;  5TRD A;  1MDM A;  5LRS A;  1QNT A;  2DA6 A;  3FK6 A;  5DD4 A;  4Q47 A;  1MMA A;  3A4C A;  2EJR A;  2OAZ A;  3SJM A;  5HS9 A;  2VQG A;  3ZQ7 A;  1P6R A;  4KUM A;  5KAF C;  3J7A W;  1SMT A;  3WTS C;  2KJB A;  3PFI A;  5JLX A;  4D1Q A;  1D8K A;  2YX7 A;  1ERD A;  1YE9 A;  2X1E A;  5JVT A;  4BUP A;  1J59 A;  1HKT A;  2VBW A;  1ZGJ A;  5FKL A;  4RB1 A;  1KON A;  3JTG A;  5EF6 A;  4IF4 A;  2K3F A;  4YFN F;  4HLY A;  4HYE A;  3W6J B;  3CC4 I;  2DI3 A;  2V79 A;  1T38 A;  4BEH A;  1X4P A;  2R7S A;  1XDS A;  2O6G E;  1FT9 A;  2W24 A;  1A6I A;  3S2D J;  3BT9 A;  1SFK A;  2X4H A;  2DOF A;  4A0Y A;  2QEX I;  2RN7 A;  3L2R A;  4G7H F;  1T2K A;  4ZZD A;  5F64 A;  3JRA A;  2DFH A;  2ZXW H;  3I56 I;  3HXL A;  2LLK A;  3U21 A;  3S16 J;  5FLV A;  2K9M A;  4CCO A;  2HPM A;  4I76 A;  4U87 A;  4G12 A;  1HBX G;  2HS5 A;  5IOZ A;  3MVP A;  3FK7 A;  2BOL A;  2FBK A;  5FLM J;  1X1D A;  1B72 A;  3PNT A;  1STZ A;  3FM5 A;  1BIA A;  2E1N A;  2E35 A;  2MC4 A;  3K4J A;  1FYL A;  1MW7 A;  2ID3 A;  3MKW B;  1FTZ A;  4MGR A;  3HRM A;  2DLL A;  3JRC A;  3COA C;  5D5V B;  5GAG J;  3SXY A;  2AHQ A;  2O0Y A;  5J8F A;  5FRN A;  5L3G A;  3P9C A;  5FLX R;  3BOQ A;  3NWS A;  5DV5 A;  4RAG A;  2ICW G;  4XKW A;  2VC0 A;  3BR0 A;  4OAY A;  1PDN C;  2VC1 A;  3B6C A;  4EV0 A;  1E0E A;  2P6T A;  4PGG A;  2K3P A;  4B43 A;  5IT3 A;  2EA2 A;  2ZXI A;  2HOE A;  3CCE I;  4PJL A;  3DBR B;  3WG7 H;  4EEF G;  3C2H A;  4HDU A;  4A3B J;  2XV4 S;  1YX3 A;  4LOC A;  4AVZ A;  4DYQ A;  1T95 A;  4KIT B;  2FRH A;  4AID A;  3IKV A;  2VKD A;  4D7M A;  4M3F A;  2M2E A;  4H0E A;  3L2C A;  4GYG A;  3ASO H;  2M8G X;  2DMQ A;  1OCC H;  3SEQ A;  4LK1 F;  2XIG A;  1VQ6 I;  1UFM A;  5F08 A;  2WBM A;  4CIC A;  1ZYR F;  3JRH A;  4I01 A;  3TO9 A;  2WWY A;  2HQ5 A;  4XLF A;  5IYB J;  2FA5 A;  3JCU C;  2AO9 A;  2IGK A;  2BY3 A;  3J7A Y;  2F2E A;  2QF7 A;  4RM2 A;  3EYI A;  2MAB A;  3KP2 A;  3QQA A;  1RUN A;  2NOG A;  4XKB A;  2MA3 A;  3DTE A;  3RPQ A;  5IY5 H;  2H94 A;  1YHQ I;  3BG7 A;  2CYY A;  1Y8R B;  5IYC J;  4BE2 A;  2ISZ A;  4TV7 A;  4Y17 A;  1K7A A;  5ERI A;  2ME6 A;  3CCS I;  2FBH A;  2PMU A;  5ICE A;  4E7K A;  2PMH A;  1RI7 A;  4LJZ F;  4B3X A;  5EEA A;  2AXT C;  5LFA A;  1J09 A;  5JLW A;  3HTS B;  3V7S A;  1APL C;  1YI2 I;  1CF7 B;  1N75 A;  2BHZ A;  2JMW A;  2L2O A;  1MSE C;  3KZY A;  4BJT A;  4KT6 A;  3WE3 A;  4AC0 A;  9ANT A;  3SFZ A;  2M4G A;  1ZAR A;  1NHA A;  3E97 A;  1MBE A;  3EUA A;  1NTC A;  4XSZ F;  1LB2 A;  1IRZ A;  2E1M C;  2MYS A;  4NC7 A;  4LGW A;  1IGN A;  1QVU A;  5GPC A;  3G1O A;  1H89 C;  4WF2 A;  1VND A;  4XLC A;  1WJF A;  3AG1 H;  2LK2 A;  4LG0 A;  2R7Z J;  1O3Q A;  4CUG A;  1RR8 C;  2EIM H;  4C3I J;  1EA3 A;  2CUE A;  2X6W A;  2DAO A;  2LKX A;  4U0W A;  3WTT C;  2XB5 A;  3QP5 A;  1FLI A;  5FKK A;  1GV5 A;  2JRM A;  2ZO4 A;  5AON A;  3BC8 A;  3JAM Z;  3NQO A;  1XG1 A;  1R71 A;  2EIL H;  2W84 A;  3CF5 F;  4GCV A;  1OCO H;  1UZC A;  2QBY A;  1SEU A;  5E1W A;  3HOW J;  3B6A A;  1N78 A;  2W25 A;  2Z2S B;  3M07 A;  4IHX A;  2JA7 J;  2OUM A;  4RLQ A;  5F0C A;  2E34 A;  1Y56 A;  3PNV A;  3LMM A;  2LH9 A;  3OYJ A;  1SFO J;  1Y0U A;  2R7X A;  2P5V A;  3IH3 A;  2YR2 A;  1FYK A;  2AS5 F;  1K6O A;  4IHW A;  1FYM A;  2OZ6 A;  5LRR A;  3TED A;  3PIO F;  1HKQ A;  1UG2 A;  3H3U A;  1S72 I;  5FD6 A;  4KN7 X;  1OLT A;  3FDY A;  3D5L A;  1WFX A;  3RKX A;  5LGU A;  4NC8 A;  2M5W A;  1TW2 A;  2DQL A;  3VDX A;  1FEX A;  5FGM A;  2FX0 A;  4EJU A;  2MG4 A;  4WK8 F;  3W2V A;  3MD2 A;  5AIQ A;  1RKW A;  2N8G A;  2ZME B;  1D0Z A;  3TMO A;  2IGM A;  2MUN A;  4QSH A;  2Y0S A;  4MEY F;  4RAY A;  3HOX J;  1F5T A;  2KRH A;  4M6X A;  4M6V A;  1X1P A;  2DMT A;  2KDO A;  5FLX K;  2RQP A;  4O6J A;  3WTV C;  3GTL J;  2O3F A;  5IPA A;  2K9S A;  4W97 A;  3BJO A;  4I0A A;  3GTK J;  4NHJ A;  2L7K A;  1JTX A;  4CYC B;  2PBI A;  2IA1 A;  3SFI A;  4D5C A;  2VPR A;  2MH9 A;  4P55 A;  4JX6 A;  1FC3 A;  1SVO A;  2O7O A;  1MBK A;  2ZJ2 A;  2JZY A;  4A3D J;  2OCC H;  4I99 C;  3IWF A;  1N77 A;  3RTR A;  2HVQ A;  3VSL A;  1XD7 A;  1S6L A;  4UVB A;  2PFB A;  5CVV A;  2LF7 A;  2LKP A;  1R6R A;  2YPR A;  3R61 A;  3A01 B;  3F0C A;  1BBY A;  4HW0 A;  4UXN A;  1SD5 A;  1U2W A;  4EJO A;  3JRI A;  4IHS A;  1UHW A;  4KMU X;  2KRF A;  2LRD A;  2WAQ N;  3S14 J;  1HW2 A;  3MN2 A;  2FD5 A;  3GX4 X;  3LL7 A;  1A35 A;  2YU3 A;  2EFN A;  1T08 B;  1Y0N A;  2D5V A;  3DLL F;  2DPU A;  3RCO A;  3ABK H;  1WVR A;  2HDW A;  3OOP A;  1RC9 A;  1RZ4 A;  1Z21 A;  1LVK A;  1H88 C;  5E17 F;  3M8F A;  2WAQ A;  5B5E C;  3DFG A;  3ERM A;  1DQU A;  1X1B A;  2R4G A;  4PJ0 C;  4RB3 C;  3G6E I;  3OYA A;  3Q3S A;  3FXQ A;  3SZT A;  1TL8 A;  2R5Z B;  2Y0M A;  4BY1 J;  3U1K A;  4EJT A;  4AVP A;  3FWE A;  2ZXJ A;  2L01 A;  1SVL A;  5DCF A;  3T1B A;  1T33 A;  4FTH A;  1CGP A;  2WAE A;  2JA2 A;  2STW A;  3O3K A;  4II2 A;  5H6R A;  4E7S A;  3BTL A;  1G3S A;  3DXJ F;  2BZT A;  2H6B A;  2RDP A;  2RKH A;  4HSR A;  2KZG A;  3BP8 A;  2Q8K A;  4DZJ A;  3CCV I;  3SQN A;  4F52 A;  1WZ2 A;  1F9N A;  4OMZ A;  4Y15 A;  1B8I B;  4PDK A;  1YS7 A;  2X1C A;  1XMX A;  1S7A A;  1FZP B;  1ZK8 A;  2CQK A;  1P2F A;  3DPU A;  2JQ7 A;  4P5O A;  3E3V A;  3TQN A;  2LR8 A;  2ZNY A;  1DDN A;  4HX4 A;  1QA6 A;  5HLH A;  4UUS B;  4XOP A;  2CQ7 A;  2ISY A;  1ON2 A;  2AQF A;  3ZQF A;  2V1U A;  3M7G A;  2R7U A;  3FIS A;  3OYC A;  1BA5 A;  1H9G A;  1XDU A;  2LRE A;  4M72 A;  2IA2 A;  2CRG A;  2MSY A;  2JPC A;  4IQ4 A;  3GW2 A;  4UB6 C;  1IF1 A;  2X51 A;  3DV8 A;  3K2Z A;  1MDM B;  3GLL A;  1R58 A;  1BR2 A;  1OCZ H;  5HDN A;  1V55 H;  2HU9 A;  1MMN A;  1SMY F;  2G7H A;  1TBX A;  2XUB A;  1XN7 A;  3OY9 A;  2F5F A;  2WTE A;  2VOO A;  4DQ2 A;  2DXI A;  4W1U A;  3L00 A;  3KYL A;  1BC7 C;  2DA2 A;  1MGT A;  2Q2E B;  3FMQ A;  1Z3X A;  1R49 A;  4E4H A;  1TQI A;  5CVU A;  3IRR A;  3J81 Z;  3QPL A;  1OYY A;  2G0E A;  5LGN A;  2H6C A;  4ZJZ A;  5BQT A;  2HZD A;  4AM3 A;  2ID6 A;  5LGT A;  1VI0 A;  1RPW A;  1YIO A;  3LA7 A;  1HSJ A;  4BXF A;  5J47 A;  3K4K A;  3PFY A;  4BXX J;  2PI0 A;  3K10 A;  2ECB A;  2EA4 A;  3CMY A;  2XRN A;  2CW7 A;  4CCM A;  1AKH A;  4QWQ A;  2KIF A;  3AG2 H;  3RKY A;  3PQJ A;  1W7P D;  4BHB A;  1FBS A;  1G3W A;  4ANJ A;  5E3N A;  4JYK A;  1OMI A;  2G7U A;  5FB2 A;  3KET A;  3FMR A;  2VN2 A;  1IO2 A;  1TZL A;  1YO5 C;  2EV6 A;  2H09 A;  3EPZ A;  1ZH5 A;  1LDK B;  2Z1D A;  4PZJ A;  4BQO A;  4F91 B;  2CW0 F;  1PYV A;  3L1P A;  3S3N A;  3WU1 B;  4A0Z A;  1BOB A;  1T56 A;  4KJZ A;  4HF0 A;  4Y7N J;  2V9K A;  3NRV A;  4RLF A;  3KP3 A;  2VXZ A;  4NQW A;  3WU2 C;  2W4S A;  3VEP A;  1I5Z A;  5K7F A;  5EGO B;  2QQ9 A;  3P5J A;  3S2H J;  3E5X A;  1A6Q A;  3GCM A;  5LHH A;  2ESH A;  2CFO A;  3HB9 A;  1LVA A;  2M8E A;  5JI6 A;  3OYH A;  1BI1 A;  3WU0 A;  4FAS D;  5IP7 J;  1HST A;  2X6X A;  3C3W A;  2VQH A;  2L4M A;  4BBS J;  2CW8 A;  2Q0O A;  2UUZ A;  5J1R A;  4M73 A;  2H8W A;  2HFH A;  2R7O A;  1JUM A;  4QPQ A;  2W7N A;  1J5Y A;  4XN3 A;  1O57 A;  5J3L A;  2L0K A;  3F9K A;  3GFI A;  1K83 J;  4BAY A;  5C44 J;  1KU7 A;  1HDD C;  1E2X A;  3M4O J;  2VJ5 A;  2OJE D;  1FNN A;  3P7N A;  2ELH A;  2ZFW A;  2B7E A;  1TWC J;  2HI3 A;  1JKP C;  3S93 A;  4N4N B;  4I2O A;  4FHT A;  4P9U A;  5D6E A;  3MFK A;  2MGQ A;  2ZSH B;  3TOB A;  4HST A;  5F1J A;  1R1U A;  3CP8 A;  4FE4 A;  2P4W A;  3DP7 A;  5M3M J;  2VBX A;  4LLL A;  1Z67 A;  1HF0 A;  1T6S A;  3E6B A;  5E3L A;  1WH7 A;  3U1D A;  1AWC A;  2FXA A;  2K02 A;  4EM0 B;  2V1X A;  2L4A A;  4Y13 A;  1IN4 A;  4B3A A;  4IHT A;  2GIV A;  4AYB N;  4L9T A;  4E6K G;  1Z0X A;  4X6A J;  4MIM A;  2XKP A;  4B47 A;  1R5I D;  1WJC A;  1HQC A;  4XN0 A;  3CMA I;  4XKC A;  5EG0 B;  3F3X A;  4XSX F;  5EZH A;  2IT0 A;  4CDG A;  5CLS A;  4IHV A;  2LBF A;  3CP2 A;  1X2N A;  3GVA A;  4HQM A;  1ORK A;  2OU2 A;  3OWT A;  4HX8 A;  5EGO A;  4A3F J;  1OCP A;  2KIM A;  3LQQ A;  5DS9 A;  4CHU A;  4O3M A;  2DTR A;  3IRQ A;  2X0L A;  3HPG A;  4AIK A;  3S1R J;  4UB8 C;  1Q1H A;  5D5X B;  4CGZ A;  4XLP F;  4G7Z F;  2P5K A;  3HGY A;  3W6K B;  5ED4 A;  3J81 K;  2LMD A;  5HNH A;  1JKQ C;  3M1C A;  2K4J A;  2Z5U A;  3J7A O;  3R60 A;  4KA4 A;  1LQ1 A;  2MLG A;  2OPT A;  2F6C A;  4DNC A;  4XID A;  3DLA A;  1IRX A;  2BE5 F;  2FNA A;  4DBR A;  1FSH A;  4ITV A;  4UUS A;  3I55 I;  4PSX A;  2CWE A;  3ULQ B;  4JK1 X;  2ZME C;  5D8L B;  1FPQ A;  1NH3 A;  5D4S A;  4RGU A;  4OU0 A;  3H1C A;  4RBO A;  2ZXH A;  2MH2 A;  1F36 A;  4LMY A;  4CYD A;  4CCL A;  2HEO A;  3JRE A;  1LKX A;  3WTU C;  2D1H A;  3M3Y J;  3WGH A;  1XGM A;  2NNN A;  2XPW A;  2IA0 A;  2LF8 A;  3RYR A;  2LG4 A;  1R7J A;  3GZ5 A;  2A05 A;  2KPM A;  1VZ0 A;  3AG3 H;  3DKW A;  4OWR B;  1DP7 P;  1OCT C;  1XSX A;  2Q2E A;  1P7I A;  1OR7 A;  2EIJ H;  2KIQ A;  2L7F P;  4HNT A;  3PNY A;  4S05 A;  1KGS A;  3H0D A;  5IP6 A;  3NEU A;  2CU7 A;  4HBL A;  4RDU A;  2VUM J;  2CQN A;  3HZJ A;  4BE1 A;  3G1M A;  1D0Y A;  1D1B A;  5F04 A;  4RGX A;  2QVO A;  5K7Z A;  2MVT A;  2E2H J;  3I71 A;  3LSG A;  4MFD A;  1GUU A;  2Z9O A;  2X1D A;  1UHS A;  1W1W E;  1NG7 A;  4M3D A;  2A61 A;  4GRI A;  3OYD A;  1WCM J;  3K4M A;  1IDY A;  4AU7 A;  1GHC A;  1U78 A;  4RB2 C;  1FBQ A;  1OFC X;  4HOB A;  5BNG A;  2CQX A;  1RES A;  3S17 J;  2OC6 A;  4HF2 A;  1VQ8 I;  2E1M B;  2FNP A;  3ESW B;  3LNQ A;  3I59 A;  2BEO A;  1ZN2 A;  1KU3 A;  2CG4 A;  4Z6Y A;  1GDT A;  4K2E A;  1U9O A;  3GUD A;  2STT A;  4DYC A;  1F4K A;  1HXD A;  3I5U A;  2XAU A;  5EEH A;  2K9L A;  5IYD J;  4EQQ A;  4D9J A;  2M30 A;  3MKY B;  3QPT A;  4Z2Y A;  2JUG A;  3KP4 A;  1X1C A;  5LEK A;  3E5U A;  2VXD A;  1IXS B;  4M3G A;  2FOK A;  3MZ8 A;  3RQI A;  2EB7 A;  4CZZ A;  4DBQ A;  4C9Y A;  3RKW A;  1MBH A;  3KFW X;  2ESN A;  3QOD A;  3PUB A;  3T0Y A;  1ITY A;  2RVC A;  3BY6 A;  3ZMS A;  3L2Q A;  2QSH X;  2MFZ A;  3BR1 A;  3OS2 A;  2HQN A;  3MEX A;  5HLI A;  2LDU A;  5C3E J;  4HEA 2;  2CV2 A;  4EM2 A;  2V1D A;  3CJQ B;  3GZN B;  3DEW A;  1H0M A;  3ZQH A;  1O4X A;  2M0M A;  1MBJ A;  1X1A A;  2XHK A;  1ZHF A;  3I4P A;  4WCG A;  3JR9 A;  3A2K A;  2HOA A;  4LIT A;  3B73 A;  1ZRE A;  5K5R A;  3KEY A;  5BOX A;  3GTQ J;  2L7M P;  4XM3 A;  2HWV A;  1K4S A;  1P4X A;  4BBR J;  4EM1 A;  4YRV A;  3E6C C;  3EUK L;  4ASN A;  2EFW A;  3F21 A;  4BNC A;  4IRI A;  1ENH A;  4YIF A;  3KYD B;  1DU6 A;  3JRB A;  4BQN A;  2NNY A;  3H5N A;  4I02 A;  1VTN C;  2EZH A;  3LSM A;  2BV6 A;  1W36 D;  2DDA A;  1VQ4 I;  1G6N A;  4BL0 B;  1MBF A;  1U3E M;  2VJI A;  2ECC A;  4C3J J;  4HG2 A;  1QPM A;  2OBP A;  4NQW B;  2MZ4 A;  1R22 A;  2FBI A;  1WGX A;  4ZDL A;  3OS1 A;  2DFF A;  1OJL A;  4V2F A;  4IEJ A;  1HLV A;  1XCV A;  2E7X A;  3V7R A;  5CQE A;  4PJM A;  4ENM A;  2JN6 A;  4PSW A;  2KT0 A;  1MNM C;  3LAJ A;  3I53 A;  1S3J A;  2OTL I;  2BY2 A;  3CLQ A;  2IS2 A;  2ADU A;  2JVH A;  3V8K A;  2E5Z A;  5K7H A;  1XGN A;  2L9N A;  1Z1D A;  1C0W A;  1ETK A;  2D45 A;  1PVE A;  2OQG A;  5DEQ A;  3LWF A;  3EUH C;  2XSJ C;  4F93 B;  2XAH A;  2R7T A;  3FKI J;  1VQL I;  4Y3O A;  4UVA A;  2LYC A;  5L3C A;  3E6M A;  1YRN B;  2X6Y A;  3K70 C;  1U9N A;  3PUF A;  1L0O C;  4P1W A;  3R4K A;  2UZK A;  4KIF A;  1PJR A;  2R93 J;  5J6X A;  2DPD A;  2HYF A;  3FXM A;  2TRT A;  2A6E F;  3LAP A;  3RPU A;  1V54 H;  2ZJR F;  4D0P A;  2IRF G;  1QVT A;  1D0X A;  3CJR B;  3FHN A;  3FXL A;  1UHM A;  1FY7 A;  4WXD A;  4X1E A;  2YUS A;  5HLG A;  5E79 C;  3ZXS A;  3IV5 A;  1ZG3 A;  2L5Q A;  3I59 B;  4LB6 B;  3ZMT A;  4AWX B;  1B6A A;  1YW7 A;  1W5T A;  1N25 A;  3WGI A;  3LOC A;  1FWZ A;  2DT7 B;  2W48 A;  1FOW A;  4E7I A;  5FFX A;  2DA1 A;  5C4X J;  3MKL A;  1ON1 A;  1WKM A;  4BQA A;  2R5Y B;  4HNU A;  4AIH A;  1TWA J;  1EH8 A;  1LE8 A;  2QKM B;  5KCM A;  1S7O A;  3H36 A;  2DK5 A;  4S0H B;  2G9W A;  1T8I A;  1A5J A;  2DA4 A;  1IRF A;  2XF7 A;  3CUQ C;  3WTX C;  4RA2 A;  4RMN A;  3DPL C;  4A3G J;  1XPX A;  2JA5 J;  2EIN H;  3I4M J;  3J80 R;  1U8B A;  1G2H A;  4G6Q A;  1QGP A;  1JT0 A;  4BU2 A;  1K4T A;  2M4K A;  3Q0W A;  2ZME A;  2KHM A;  5FD5 A;  5FRO A;  1S8N A;  3AFH A;  1FMV A;  3CCM I;  3I64 A;  3OYL A;  2XPV A;  3RJP A;  2KDZ A;  4G6D A;  2DT6 A;  4BEH B;  1FX7 A;  5A2Q K;  2JWT A;  1FP2 A;  6PAX A;  3K0L A;  1ETV A;  3HRS A;  4MO7 A;  3S1N J;  2A68 F;  5L3F A;  3F22 A;  1X2M A;  5J1U A;  2XF6 A;  2A6T A;  3GWZ A;  4ZYH A;  1CF7 A;  4F92 B;  2GAU A;  5DCM A;  2NS7 A;  3ROU A;  1YJN I;  2YS9 A;  3CJN A;  4EMS A;  1R4N B;  1D5V A;  3BLY A;  3SZP A;  5LLQ A;  3ISP A;  1YJW I;  2DMU A;  2ELK A;  3ZGK A;  2VON A;  1E3O C;  4KIS A;  3BZK A;  2K85 A;  1I3A A;  2PMZ N;  4XL9 A;  1SVM A;  2FJ1 A;  4P96 A;  1YJ9 I;  2EBI A;  4A3K J;  3F72 A;  3ZRG A;  4II3 A;  4A93 J;  1G8X A;  3G4S I;  2M7B A;  3DCF A;  2B63 J;  3OSF A;  2FQ4 A;  5JHU A;  3F8F A;  2BYV E;  1FOY A;  4L18 B;  1YTY A;  2RGV A;  3A1Y A;  1BI3 A;  3RZD J;  3CC2 I;  2HNH A;  1KYZ A;  3GTJ J;  4LG0 B;  2KLO A;  4XLN F;  1UAA A;  4IL6 C;  1MJ9 A;  1BW5 A;  4UUV A;  1V5G A;  3DTI A;  4ZTJ A;  1HKS A;  1IC8 A;  2K9N A;  3CC7 I;  3QPS A;  5DCM B;  3B02 A;  2E2J J;  2W85 A;  2HOS A;  4ETS A;  3PL8 A;  3LSH A;  3CO7 C;  3A01 A;  2KMU A;  5EYR A;  3SHF A;  1Z9C A;  2W82 A;  3HRU A;  3TKY A;  2GXA A;  4YFK F;  3A0B C;  2VT2 A;  2LFB A;  2WV0 A;  1O7L A;  3CME I;  3OIO A;  4XLA A;  1P7J A;  3QRF F;  3CES A;  2CMP A;  4MQ9 F;  1EH6 A;  2K40 A;  2NVY J;  1Y1W J;  2OZU A;  4KFC A;  4HV5 A;  5D5W B;  4B09 A;  2JPB A;  4GO1 A;  2IVM A;  4MNU A;  3AL0 B;  3DBH B;  1JJ6 C;  3ZP5 A;  2VQL A;  1TQP A;  4UVC A;  1TW3 A;  2KZV A;  1IDZ A;  2JJ7 A;  3DKX A;  1DUX C;  3A0H C;  2COM A;  3RI4 A;  1O7F A;  1W7P B;  5CKT A;  3O6B B;  2A5Y B;  1U8R A;  1JKR C;  3H92 A;  2K86 A;  1UEL B;  5HNF A;  2EPF A;  2FQ3 A;  5BPD A;  1H9T A;  4AD9 A;  4BYY A;  3S1M J;  1TWF J;  1X3U A;  1JHF A;  3H9J A;  3D0S A;  1U5T A;  2E1O A;  4XLH A;  2IW5 A;  2W00 A;  3BG3 A;  4U7D A;  5JR3 A;  4NBQ A;  4OIO F;  5KAI C;  4YIR X;  1R1V A;  2K7L A;  3TDU C;  4BS9 A;  3H9Q A;  1BR4 A;  5LEJ A;  4ZYG A;  4RAZ A;  5FKM A;  1ODD A;  2Y48 A;  4G94 A;  1EJ9 A;  3HUG B;  2BGC A;  3DQV C;  5LHG A;  5D6F A;  3L09 A;  2JSP A;  5FKO A;  1T0F A;  1PP7 U;  1O3R A;  2OQR A;  2QQA A;  3OV8 A;  4XK4 A;  3CCR I;  5FRM A;  2Z99 A;  3MCZ A;  1AU7 A;  4FX4 A;  1NK2 P;  4HDV A;  3HM5 A;  4U0Y A;  4QIW N;  5F0H A;  4XKV A;  1FIP A;  1PUF B;  2A6H F;  5K5Q A;  1IN5 A;  2R5Y A;  2QWW A;  3H9G A;  1WJB A;  4A3I J;  3CZ6 A;  3OYK A;  4KIG A;  3K6G A;  1W4M A;  1RR7 A;  1VF9 A;  1Z05 A;  5FKN A;  3R0J A;  3ECH A;  1MJB A;  3ZQC A;  3RQ4 A;  3WG9 A;  1W0T A;  3L7W A;  1I1G A;  3JTH A;  1MMG A;  4MFE A;  3FKJ A;  4XRF A;  1WI9 A;  2RC4 A;  3E7L A;  3ABM H;  4G7O F;  4RB0 A;  5FFZ A;  2F5C A;  2KL4 A;  1I6X A;  2NYX A;  2VBZ A;  1H8A C;  5L3D A;  2MD5 A;  3I3L A;  3GTM J;  3LSJ A;  1MBG A;  3QP6 A;  4LFU A;  1MKM A;  3I0T A;  1DGW Y;  4MTE A;  3REO A;  1RUO A;  3ML6 A;  4I98 B;  3E6D A;  5IT9 R;  1FMW A;  2AXL A;  2IS4 A;  1VFC A;  3CF2 A;  1A31 A;  2OA4 A;  4JX4 A;  2VB6 A;  4L5E A;  5KVR A;  3BJ6 A;  3RZO J;  3TO6 A;  2XAQ A;  4U88 A;  2M34 A;  2P6S A;  5GTH C;  4PUS A;  4MTD A;  3IAM 2;  2Y69 H;  2HZT A;  2F5D A;  1V5F A;  2XRO A;  2DOA A;  2P5L C;  2W57 A;  1AA7 A;  2DFI A;  3A02 A;  3ABU A;  4KN4 X;  2IS6 A;  3IAS 2;  3KP5 A;  2WB1 N;  4GFB A;  3IUO A;  1IZ1 A;  4R8H A;  2IXS A;  4HV6 A;  2DMP A;  3L2W A;  2H1L A;  2Y75 A;  3BR3 A;  1A36 A;  2F48 A;  4B4C A;  3QYE A;  3L9F A;  4WXH A;  2IAI A;  3HYI A;  4E7L A;  2LY1 A;  4HRI A;  3ASN H;  3S2W A;  3CJT B;  2HKX A;  3VFZ A;  1TT5 B;  1D1A A;  2Y31 A;  2FSW A;  3HEF A;  1OPC A;  4OIP F;  2BW3 B;  1QU3 A;  1OKR A;  4RS8 A;  2XPU A;  2F4O B;  3P9I A;  4QLC U;  2GA1 A;  1Y8Q B; 
#chains in the Genus database with same CATH homology
 3EDP A;  2O61 A;  2LSO A;  3U2R A;  4ZYE A;  2ACJ A;  5HS8 A;  3F8C A;  1BIB A;  3IKT A;  5FLX Z;  1D3Y A;  2DK8 A;  3HUG A;  3KEO A;  1BC8 C;  1GVJ A;  3GZ6 A;  2JRT A;  3TOA A;  5ILU A;  3VOD A;  2EWN A;  1O3S A;  1IAW A;  4HAM A;  2XGX A;  2HDC A;  5DUK A;  3T8T A;  2XAS A;  1R00 A;  2UXX A;  1W5S A;  1O3T A;  4MQV A;  2QZ8 A;  4P9F A;  1BN5 A;  1KQ9 A;  2GZW A;  4ZZL A;  1YLF A;  2EFP A;  2VOP A;  1I27 A;  1AOY A;  2FMY A;  1SD4 A;  5K1Y A;  5ICC A;  5E8I A;  3BDD A;  4WX9 A;  2GA2 A;  3HTU A;  1ZRC A;  4IRH A;  2HR3 A;  2KIU A;  2A69 F;  2V9V A;  3MZH A;  5BS6 A;  5HS7 A;  2NAZ A;  3LA3 A;  2RNJ A;  3FXR A;  2P8T A;  2R7D A;  3HSF A;  3V7C A;  4I0B A;  3BJA A;  4O5V A;  1KU2 A;  2HGC A;  3QU3 A;  3K9T A;  3EQL F;  2R3S A;  1T39 A;  3FF5 A;  3K69 A;  2IP2 A;  3ECO A;  1PP8 F;  5L3E A;  4I7H A;  4KMF A;  3V8L A;  4N0B A;  4UV9 A;  4YII A;  3GFJ A;  3BPX A;  2IPQ X;  4ON0 A;  3Q9V A;  4OMY A;  5H6Q A;  1P4W A;  3GFM A;  3CTA A;  2L3D A;  1J2X A;  1QZZ A;  1SD6 A;  3WOD F;  3HSR A;  3F8M A;  3M1E A;  1EV7 A;  2MLK A;  4HQE A;  5CYV A;  3JAM K;  1ZG1 A;  2L54 A;  5LBQ A;  1XCB A;  1JXS A;  2QLZ A;  5J8C A;  4L9N A;  1TNT A;  4BXU A;  3ZMD A;  2DU9 A;  2FU4 A;  1Z91 A;  5EEG A;  3HSE A;  4MEX F;  1B1B A;  2NRA C;  3WTY C;  1YYV A;  2O03 A;  5HDK A;  3ERE D;  1D8J A;  1XMK A;  2HTS A;  3C1D A;  4HX7 A;  1YW8 A;  4A5M A;  4I09 A;  2UWM A;  1I1S A;  2YSR A;  2GXB A;  2M1B A;  1SFE A;  2DW4 A;  1ZLJ A;  5A2Q Z;  1BM9 A;  1V3F A;  5E18 F;  2V6C A;  1U5T C;  5DYM A;  4UHT A;  1UB9 A;  3TO7 A;  3R6S A;  1P92 A;  2DQR A;  4LLN A;  3FX3 A;  5ILS A;  5E1Z B;  1G3T A;  1WRJ A;  4KIC A;  5AIP A;  5D8K B;  1YQA A;  3T8R A;  4Q4Z F;  4LK0 F;  3F6O A;  3V8J A;  1WSU A;  1ULY A;  3CLO A;  3P9K A;  1QQI A;  2CSO A;  1Z6T A;  1YG2 A;  3LQR A;  4M9X A;  4ZYD A;  1K79 A;  3HHG A;  2LNB A;  2OD5 A;  3HHH A;  4FX0 A;  4ENK A;  4U0V A;  4B8X A;  2VE8 A;  3KZZ A;  1LJ9 A;  3I58 A;  3GEZ A;  1HW1 A;  1QO0 D;  5F6F A;  4CO8 A;  4BHC A;  2R7F A;  4A12 A;  3EUH A;  5DUI A;  4OIN F;  1QZY A;  3K1N A;  2CO5 A;  1YW9 A;  3H3Z A;  1GXP A;  1PUE E;  4GGG A;  4A0X A;  2JTV A;  5L3B A;  1KQ8 A;  4A2U A;  2GWR A;  3KEQ A;  3C7J A;  4OIQ F;  5BPI A;  2JSC A;  3R0A A;  3MZY A;  2KKO A;  4N9H A;  4IXA A;  1R1T A;  2QQB A;  1J75 A;  5FO5 A;  1ZLK A;  3VOE A;  4OIR F;  3DPT A;  3J80 Z;  2GQQ A;  1S29 A;  2K4B A;  1UST A;  2EFO A;  2ZKZ A;  1J9I A;  1USS A;  5TJJ A;  5CVI A;  3Q9S A;  3ZN0 A;  1LEA A;  2UXN A;  3MAJ A;  4HF1 A;  5E20 A;  2BBY A;  3F8N A;  1WQ2 A;  4G9Y A;  3RIR A;  1KYW A;  2A07 F;  1JGS A;  1FBU A;  4L0Z B;  1K78 A;  5DDG A;  4L5J A;  2VOD A;  3WE2 A;  4KYW A;  4FT8 A;  1FSE A;  3F8B A;  3KLO A;  2EFQ A;  3ZMZ A;  1U5T B;  2QUF A;  2QYO A;  1RIO H;  3QOP A;  2GXG A;  5E8G A;  5HOO A;  2PQ8 A;  4RGS A;  1XSV A;  1SD7 A;  3GYH X;  3HRT A;  3BWG A;  3N97 A;  3CDH A;  4IVN A;  2IJL A;  5E1X A;  3M9A A;  4AIJ A;  2VT3 A;  4LD5 A;  4ENN A;  3DF8 A;  1SFU A;  3RYP A;  1TTY A;  1E17 A;  1IN6 A;  1LDD A;  3M8E A;  4A6D A;  1XGS A;  4G8X A;  3GF2 A;  1KQ0 A;  4IPA A;  1IXC A;  2ZCW A;  1MZB A;  4YG2 F;  1R5H A;  1ZGA A;  3G73 A;  3MQ0 A;  3CO6 C;  3MWM A;  1IN7 A;  3AAF A;  4EGY A;  2HTJ A;  2DO7 A;  4UNO A;  3EYY A;  3KP6 A;  4L0Y B;  3ELK A;  2NS0 A;  1XMA A;  5CVR A;  4UV8 A;  4M71 A;  4PGH A;  2CFX A;  2O8X A;  3KLN A;  5CVJ A;  3TDZ C;  1ZAO A;  4E70 A;  3G3Z A;  2QEN A;  1T98 A;  4M6Y A;  3JSP A;  5H20 A;  4A6E A;  1GXQ A;  1IRG A;  1IN8 A;  1FP1 D;  4M9Z A;  1G3Y A;  3PQK A;  4EJW A;  2D1V A;  1KA8 A;  2DT5 A;  3QPH A;  3JSO A;  3KP7 A;  2HQR A;  2F5E A;  4ESF A;  3HOT A;  4YFX F;  4WXC A;  2Z33 A;  1B59 A;  3CUQ A;  1XGO A;  5KK1 A;  5JFR A;  1W7P A;  3I54 A;  1SFX A;  1B9N A;  3FXU A;  3K1P A;  2VBY A;  2MC3 A;  4ESJ A;  3K1M A;  4GXO A;  3GO5 A;  3GFL A;  2H27 A;  1V4R A;  2PLY A;  2J5O A;  3FMS A;  4M74 A;  2FML A;  1HW5 A;  3HOS A;  1TLH B;  1DPR A;  2P7V B;  4LLG F;  1TQM A;  2ETH A;  3QAH A;  3ABT A;  1RNL A;  3RDI A;  1REP C;  3WGG A;  4ENJ A;  4JQF A;  2E1C A;  2XVC A;  3JW4 A;  4EVI A;  3EET A;  1JHH A;  3F6V A;  3ZMU A;  4M9S A;  4HZF A;  5IT9 K;  1YS6 A;  4HA8 A;  4KDP A;  1OYW A;  5HDG A;  2B0L A;  4Q5S F;  2QM3 A;  5K5O A;  2HKO A;  1FOK A;  2ZBK A;  3F23 A;  1Z6R A;  1J0R A;  5DD8 A;  1IXR C;  2XAF A;  2PN6 A;  1ZRD A;  4HLX A;  1EH7 A;  4A5N A;  1SAX A;  5ICF A;  1Z7U A;  3TGN A;  1B9M A;  1ZG5 A;  3V4G A;  3C18 A;  2YX4 A;  1B4A A;  1ZRF A;  2QBY B;  2WC2 A;  5BMZ A;  4LB5 A;  1QBJ A;  1MJA A;  2D2W A;  4KT5 C;  4NB5 A;  5HVQ C;  3ZMV A;  3KCC A;  4U7B A;  3IL2 A;  4N9I A;  4Q48 A;  3Q5F A;  1XSD A;  1MD0 A;  3HIF A;  3LFK A;  2TDX A;  4GYI A;  1IW7 F;  3GLX A;  1YFH A;  1IUY A;  3FZV A;  4S04 A;  1ONV A;  2M87 A;  2E7W A;  2CGP A;  1R5G A;  2M45 A;  2HYG D;  4IRG A;  2PJP A;  3IC7 A;  2EV0 A;  4IJA A;  1R23 A;  2EK5 A;  3VB2 A;  1UCR A;  4ESB A;  3N4M A;  2EV5 A;  5D4R A;  3BRO A;  4KNY A;  3FHZ A;  1K78 B;  2KJC A;  3LST A;  2JT1 A;  3ZPL A;  5ILV A;  1A04 A;  2XKO A;  3LA2 A;  4CXF A;  3BPV A;  2P7C B;  3DEU A;  5CJ9 A;  1U6G A;  3FM3 A;  4OOI A;  1LEB A;  1BJA A;  5ICG A;  2XAG A;  4KIB A;  2FE3 A;  5IT9 Z;  2Z3Y A;  2FF4 A;  3U9G A;  4BHP A;  4XBF A;  5D5U B;  3IWZ A;  2C6Y A;  1P4A A;  3GXO A;  3T5X A;  2DBB A;  4EJV A;  1G4D A;  3QU6 A;  1R36 A;  3E5Q A;  4RGR A;  2PEX A;  1KU9 A;  1LNW A;  4ZH4 F;  4L9V A;  4PCQ A;  1J7K A;  4L5I A;  2A3S A;  4F7Z A;  5F1R A;  2FEZ A;  2L02 A;  4JBA A;  3WTZ A;  1WWX A;  1LDJ A;  2J5P A;  2VE9 A;  1BI2 A;  4R1H A;  3WTW C;  1BI0 A;  2K27 A;  2XAJ A;  5LHI A;  3O2P E;  1TNS A;  3CUQ B;  4L9J A;  2MBF A;  1OYI A;  3J80 K;  3ZN1 A;  4MHG A;  1JE8 A;  1DPU A;  1F1Z A;  3KE2 A;  4R79 A;  1L3L A;  4WWC A;  1XB4 A;  2ZNZ A;  4EGZ A;  3BZ6 A;  3IHU A;  1BOA A;  2PG4 A;  3CUO A;  2RV8 A;  4BH9 A;  5TRD A;  1MDM A;  5LRS A;  1QNT A;  5DD4 A;  4Q47 A;  2EJR A;  2OAZ A;  5HS9 A;  3ZQ7 A;  1P6R A;  4KUM A;  1SMT A;  3WTS C;  2KJB A;  3PFI A;  1D8K A;  2YX7 A;  1J59 A;  5JVT A;  1HKT A;  2VBW A;  1ZGJ A;  3JTG A;  4RB1 A;  4IF4 A;  4YFN F;  4HLY A;  4HYE A;  3W6J B;  2DI3 A;  2V79 A;  1T38 A;  1XDS A;  2O6G E;  1FT9 A;  2W24 A;  1T2K A;  2X4H A;  4A0Y A;  4G7H F;  2RN7 A;  4ZZD A;  5F64 A;  1HBX G;  2HS5 A;  2FBK A;  1STZ A;  3FM5 A;  1BIA A;  2E1N A;  1FYL A;  4MGR A;  3HRM A;  2DLL A;  3COA C;  5D5V B;  3SXY A;  2O0Y A;  5J8F A;  5L3G A;  3P9C A;  3BOQ A;  5DV5 A;  2VC0 A;  1PDN C;  2VC1 A;  4EV0 A;  2P6T A;  4PGG A;  5IT3 A;  2EA2 A;  4HDU A;  2HOE A;  2XV4 S;  2FRH A;  3IKV A;  4H0E A;  3L2C A;  4GYG A;  4LK1 F;  2XIG A;  1UFM A;  4CIC A;  1ZYR F;  4I01 A;  3TO9 A;  2WWY A;  2FA5 A;  2F2E A;  3EYI A;  3KP2 A;  1RUN A;  3RPQ A;  2MA3 A;  2H94 A;  2CYY A;  2ISZ A;  4TV7 A;  4Y17 A;  1K7A A;  5ERI A;  2FBH A;  2PMU A;  5ICE A;  2PMH A;  1RI7 A;  4LJZ F;  3HTS B;  3V7S A;  1CF7 B;  3KZY A;  3WE3 A;  3SFZ A;  1ZAR A;  1NHA A;  1LB2 A;  3E97 A;  4XSZ F;  4LGW A;  4WF2 A;  4LG0 A;  1O3Q A;  2DAO A;  4U0W A;  3WTT C;  1FLI A;  3QP5 A;  2ZO4 A;  5AON A;  3JAM Z;  3NQO A;  2W84 A;  4GCV A;  2QBY A;  5E1W A;  2W25 A;  1Y0U A;  2P5V A;  2YR2 A;  1FYK A;  2AS5 F;  1K6O A;  1FYM A;  2OZ6 A;  5LRR A;  1HKQ A;  3H3U A;  5FD6 A;  4KN7 X;  3D5L A;  3RKX A;  5LGU A;  2M5W A;  1TW2 A;  2DQL A;  5FGM A;  4EJU A;  4WK8 F;  5AIQ A;  2ZME B;  4RAY A;  4MEY F;  1F5T A;  4M6X A;  5FLX K;  2RQP A;  4O6J A;  3WTV C;  2O3F A;  3BJO A;  4I0A A;  4NHJ A;  2PBI A;  2IA1 A;  2MH9 A;  4P55 A;  1FC3 A;  2ZJ2 A;  2JZY A;  3IWF A;  3RTR A;  1XD7 A;  1S6L A;  4UVB A;  2PFB A;  5CVV A;  2LF7 A;  2LKP A;  2YPR A;  3R61 A;  1BBY A;  4HW0 A;  4UXN A;  1SD5 A;  1U2W A;  4EJO A;  4IHS A;  1UHW A;  4KMU X;  2KRF A;  1HW2 A;  3GX4 X;  2YU3 A;  2EFN A;  2DPU A;  3OOP A;  1RZ4 A;  5E17 F;  3M8F A;  3DFG A;  4RB3 C;  3FXQ A;  3SZT A;  2Y0M A;  4EJT A;  4AVP A;  3FWE A;  2ZXJ A;  2L01 A;  5DCF A;  3T1B A;  1CGP A;  2STW A;  3O3K A;  5H6R A;  1G3S A;  3DXJ F;  2H6B A;  2RDP A;  2RKH A;  2Q8K A;  3BP8 A;  3SQN A;  1F9N A;  4OMZ A;  4Y15 A;  4PDK A;  1YS7 A;  1S7A A;  1FZP B;  2CQK A;  1P2F A;  4P5O A;  3E3V A;  3TQN A;  2ZNY A;  1DDN A;  4HX4 A;  5HLH A;  2ISY A;  1ON2 A;  2V1U A;  3M7G A;  1H9G A;  1XDU A;  4M72 A;  2IA2 A;  2JPC A;  3GW2 A;  1IF1 A;  3DV8 A;  3K2Z A;  1MDM B;  1R58 A;  5HDN A;  1SMY F;  2G7H A;  1TBX A;  2XUB A;  1XN7 A;  2VOO A;  2F5F A;  2WTE A;  4DQ2 A;  3L00 A;  1BC7 C;  1MGT A;  3FMQ A;  1TQI A;  5CVU A;  3IRR A;  3J81 Z;  5LGN A;  1OYY A;  2H6C A;  5BQT A;  5LGT A;  1YIO A;  3LA7 A;  1HSJ A;  2PI0 A;  2EA4 A;  2XRN A;  4QWQ A;  2KIF A;  3RKY A;  3PQJ A;  1W7P D;  4BHB A;  1FBS A;  1G3W A;  1OMI A;  2G7U A;  5FB2 A;  3KET A;  3FMR A;  2VN2 A;  1YO5 C;  2EV6 A;  2H09 A;  1ZH5 A;  1LDK B;  4PZJ A;  2CW0 F;  3WU1 B;  4A0Z A;  4HF0 A;  3NRV A;  3KP3 A;  2VXZ A;  4NQW A;  3VEP A;  1I5Z A;  2QQ9 A;  3E5X A;  5LHH A;  2ESH A;  1LVA A;  2M8E A;  5JI6 A;  1BI1 A;  3WU0 A;  1HST A;  3C3W A;  2L4M A;  2Q0O A;  4M73 A;  2HFH A;  1J5Y A;  1O57 A;  3GFI A;  4BAY A;  1KU7 A;  1E2X A;  1FNN A;  3P7N A;  2ELH A;  2ZFW A;  4I2O A;  4FHT A;  4P9U A;  5D6E A;  3MFK A;  3TOB A;  1R1U A;  2P4W A;  3DP7 A;  2VBX A;  4LLL A;  1T6S A;  3E6B A;  3U1D A;  1AWC A;  2FXA A;  2K02 A;  4EM0 B;  2V1X A;  2L4A A;  4Y13 A;  1IN4 A;  4IHT A;  2GIV A;  4L9T A;  2XKP A;  1HQC A;  3F3X A;  4XSX F;  2IT0 A;  4CDG A;  5CLS A;  3GVA A;  4HQM A;  2OU2 A;  4HX8 A;  4CHU A;  2KIM A;  4O3M A;  3LQQ A;  2DTR A;  3IRQ A;  2X0L A;  4AIK A;  1Q1H A;  5D5X B;  4CGZ A;  4XLP F;  4G7Z F;  2P5K A;  3W6K B;  5ED4 A;  3J81 K;  2K4J A;  2Z5U A;  3J7A O;  3R60 A;  4KA4 A;  1LQ1 A;  2MLG A;  4DNC A;  1FSH A;  2FNA A;  2BE5 F;  3ULQ B;  2CWE A;  4JK1 X;  5D8L B;  1FPQ A;  5D4S A;  4RGU A;  4OU0 A;  2MH2 A;  4LMY A;  4CYD A;  2HEO A;  3WTU C;  2D1H A;  3WGH A;  1XGM A;  2NNN A;  2IA0 A;  2LF8 A;  3RYR A;  1R7J A;  3GZ5 A;  3DKW A;  1DP7 P;  1XSX A;  2Q2E A;  1OR7 A;  4S05 A;  1KGS A;  3NEU A;  4HBL A;  4RGX A;  2QVO A;  3I71 A;  2Z9O A;  2A61 A;  1GHC A;  1U78 A;  4RB2 C;  1FBQ A;  4HOB A;  4HF2 A;  2FNP A;  3I59 A;  2BEO A;  1ZN2 A;  1KU3 A;  2CG4 A;  4K2E A;  2STT A;  3GUD A;  1F4K A;  1HXD A;  3I5U A;  5EEH A;  4EQQ A;  2M30 A;  3QPT A;  4Z2Y A;  3KP4 A;  5LEK A;  3E5U A;  1IXS B;  2FOK A;  2EB7 A;  4CZZ A;  3RKW A;  3KFW X;  2ESN A;  3T0Y A;  2RVC A;  3BY6 A;  3ZMS A;  2HQN A;  3MEX A;  5HLI A;  2LDU A;  4EM2 A;  2V1D A;  1H0M A;  2XHK A;  1ZHF A;  3I4P A;  4WCG A;  3B73 A;  1ZRE A;  5K5R A;  5BOX A;  2HWV A;  1P4X A;  4EM1 A;  3E6C C;  2EFW A;  4ASN A;  3F21 A;  4BNC A;  4IRI A;  4YIF A;  2NNY A;  4I02 A;  1VTN C;  2BV6 A;  1G6N A;  1U3E M;  1QPM A;  2OBP A;  1R22 A;  2FBI A;  1XCV A;  2E7X A;  3V7R A;  4ENM A;  3LAJ A;  3I53 A;  1S3J A;  2ADU A;  3V8K A;  1XGN A;  1Z1D A;  1C0W A;  2D45 A;  2OQG A;  5DEQ A;  3LWF A;  2XAH A;  4UVA A;  5L3C A;  3E6M A;  2UZK A;  1L0O C;  3R4K A;  4KIF A;  5J6X A;  2DPD A;  2HYF A;  2A6E F;  3LAP A;  3RPU A;  4D0P A;  2IRF G;  1UHM A;  1FY7 A;  4WXD A;  5HLG A;  1ZG3 A;  3I59 B;  4LB6 B;  3ZMT A;  4AWX B;  1B6A A;  1YW7 A;  1W5T A;  3WGI A;  1FWZ A;  5FFX A;  1ON1 A;  1WKM A;  4BQA A;  4AIH A;  1EH8 A;  1S7O A;  2DK5 A;  2G9W A;  1IRF A;  3CUQ C;  3WTX C;  3DPL C;  4G6Q A;  1QGP A;  5FD5 A;  2ZME A;  1S8N A;  3I64 A;  3RJP A;  4G6D A;  1FX7 A;  5A2Q K;  6PAX A;  1FP2 A;  3K0L A;  3HRS A;  2A68 F;  5L3F A;  3F22 A;  3GWZ A;  4ZYH A;  1CF7 A;  2GAU A;  5DCM A;  3ROU A;  3CJN A;  4EMS A;  1D5V A;  3SZP A;  5LLQ A;  3ISP A;  2VON A;  4P96 A;  3F72 A;  5JHU A;  3F8F A;  2BYV E;  4L18 B;  1YTY A;  2RGV A;  1BI3 A;  1KYZ A;  4LG0 B;  4XLN F;  1MJ9 A;  4UUV A;  1HKS A;  5DCM B;  3B02 A;  2W85 A;  4ETS A;  3CO7 C;  3SHF A;  1Z9C A;  3HRU A;  3TKY A;  4YFK F;  2VT2 A;  2WV0 A;  1O7L A;  3QRF F;  4MQ9 F;  1EH6 A;  2OZU A;  4KFC A;  4HV5 A;  5D5W B;  4B09 A;  2JPB A;  4GO1 A;  2IVM A;  4MNU A;  3ZP5 A;  1TQP A;  4UVC A;  1TW3 A;  1DUX C;  2COM A;  3RI4 A;  1O7F A;  1W7P B;  3O6B B;  2A5Y B;  1U8R A;  3H92 A;  2K86 A;  1H9T A;  2FQ3 A;  5BPD A;  4AD9 A;  4BYY A;  1X3U A;  1JHF A;  3D0S A;  1U5T A;  2IW5 A;  4U7D A;  5JR3 A;  4OIO F;  1R1V A;  2K7L A;  3TDU C;  5LEJ A;  4ZYG A;  4RAZ A;  1ODD A;  2Y48 A;  4G94 A;  2BGC A;  3DQV C;  5LHG A;  5D6F A;  3L09 A;  1T0F A;  1PP7 U;  1O3R A;  2OQR A;  2QQA A;  3OV8 A;  2Z99 A;  3MCZ A;  4FX4 A;  4HDV A;  4U0Y A;  2A6H F;  5K5Q A;  1IN5 A;  2QWW A;  4KIG A;  1W4M A;  1Z05 A;  3R0J A;  3ECH A;  1MJB A;  3WG9 A;  3L7W A;  1I1G A;  3JTH A;  4XRF A;  1WI9 A;  2RC4 A;  4G7O F;  4RB0 A;  5FFZ A;  2F5C A;  2NYX A;  1I6X A;  2VBZ A;  5L3D A;  2MD5 A;  3QP6 A;  4LFU A;  1MKM A;  3I0T A;  4MTE A;  3REO A;  1RUO A;  3ML6 A;  4I98 B;  3E6D A;  2AXL A;  2OA4 A;  5KVR A;  3BJ6 A;  3TO6 A;  2XAQ A;  4U88 A;  2P6S A;  4MTD A;  2HZT A;  2F5D A;  2XRO A;  2P5L C;  2W57 A;  2DFI A;  3ABU A;  4KN4 X;  3KP5 A;  1IZ1 A;  4R8H A;  4HV6 A;  2Y75 A;  3L9F A;  4WXH A;  3HYI A;  3S2W A;  2HKX A;  3VFZ A;  2FSW A;  1OPC A;  4OIP F;  1OKR A;  4RS8 A;  3P9I A;  4QLC U;  2GA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...