2TDXA

Diphtheria tox repressor (c102d mutant) complexed with nickel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
molecule keywords DIPHTHERIA TOX REPRESSOR
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2tdxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2tdxA02
4EM0B 4GGGA 3T0YA 2IW5A 4CICA 3IWZA 3L7WA 1V4RA 3DPLC 4AVPA 4ZYDA 2ZKZA 2A68F 1B6AA 3BP8A 3GW2A 2OQRA 1O57A 4EM1A 1VTNC 3K0LA 1KGSA 3ECOA 1W5SA 3GFIA 4HBLA 4P55A 4OINF 5F1RA 1BOAA 2V1UA 2YPRA 4L9JA 2M1BA 3GFLA 4I09A 3SZTA 1W4MA 3LWFA 3K9TA 5HDKA 1MD0A 5DUIA 4U0VA 1MDMB 3F8CA 2O03A 1R58A 2CG4A 2QZ8A 4KIGA 2Z99A 4A5MA 4QLCU 1I27A 1FP1D 2F5DA 1TNSA 1T38A 2FBKA 2XGXA 3CUOA 4M6YA 2OZUA 2VOOA 4EGYA 3WODF 1OYYA 1WRJA 2Q0OA 4U0YA 1O3QA 3I54A 1GVJA 4L9VA 4BXUA 4A6EA 2IA1A 3EYIA 1OKRA 3RYPA 1IN7A 1MZBA 4E70A 5AONA 3N97A 1IW7F 4R8HA 1HW2A 1G3SA 1IN4A 1HKQA 3WTWC 4BAYA 4Q5SF 3TQNA 2MH2A 4RS8A 3ZQ7A 3M9AA 2BE5F 2FA5A 1R7JA 2DLLA 4KIFA 4ASNA 2ZCWA 4IJAA 3TO6A 3DFGA 5E8IA 1U3EM 1PP8F 1IN6A 1Y0UA 4RGUA 3COAC 2VT2A 3PQJA 2H09A 3OOPA 3TGNA 1EH7A 3HOTA 4OIPF 4HX4A 4ETSA 3ABUA 3HRTA 2QBYA 1HSTA 2A6EF 2CWEA 3IRQA 4OIQF 2XRNA 3RJPA 2W25A 5L3FA 1LDKB 1SMYF 2LF7A 2WC2A 1T98A 2KKOA 5CVRA 4FX4A 1O3TA 2V79A 3V7RA 4ENNA 1R1VA 2VC1A 2VOPA 2FMYA 1DDNA 5LGUA 1I5ZA 2G9WA 3T5XA 4ZYGA 2VE9A 4H0EA 4JBAA 1K78B 5LHGA 2F5CA 1IXCA 2XV4S 4XSZF 3D5LA 1ODDA 5JI6A 2F5FA 1K78A 1RI7A 3O2PE 5ED4A 3FHZA 2NNNA 1J2XA 1S29A 1Z6RA 1ZGJA 4CXFA 1D5VA 2NAZA 1P2FA 2IRFG 4PGHA 2P5LC 2WV0A 2R3SA 3KP5A 1O3SA 3HYIA 5LGNA 1J9IA 2NYXA 2XUBA 5DDGA 3R4KA 3VODA 3WTTC 2JPBA 1KU9A 2O8XA 3E5UA 5JVTA 3IC7A 4I98B 4ON0A 1OR7A 2QWWA 4L0YB 2FMLA 3CLOA 1XSXA 3GYHX 2NRAC 4HDVA 1LVAA 3W6JB 4HV6A 1FSHA 5DUKA 1FBQA 2W57A 2UZKA 4GYGA 1FBSA 1LEBA 1YS6A 4N9IA 2QVOA 4HYEA 4HF2A 3LQQA 2QENA 1BI2A 4HW0A 4AWXB 5FLXZ 4UUVA 1BI1A 2ZJ2A 5BOXA 2HZTA 1ZRDA 4I0AA 5EEHA 2STTA 1W7PA 1LB2A 3BWGA 4BHPA 1IRGA 1U78A 2ZBKA 3DKWA 1Z05A 3HSFA 4U7DA 1BI0A 4YIIA 1SD4A 5F6FA 4Y13A 2FE3A 2GQQA 2JT1A 1TQIA 4UNOA 3GFJA 1PUEE 4GO1A 2IVMA 4P9FA 4IXAA 2YR2A 3RKXA 1FOKA 2BEOA 1BN5A 2V1XA 2XAFA 3IKTA 2A61A 3LA3A 4EJOA 3QP5A 3KEOA 1Z6TA 5HS8A 5FFXA 3L2CA 1PP7U 3E6BA 3GF2A 1TQPA 4CHUA 2ACJA 1P4WA 4LLLA 3IKVA 4HLXA 1XGMA 2KJBA 3KP7A 3C18A 3ML6A 3IWFA 2P8TA 2HTJA 1RIOH 1YW9A 2ZO4A 5H6RA 2P4WA 2HKXA 2R7FA 4UVBA 4CO8A 5DCMB 1R23A 1ZH5A 3FZVA 2JTVA 3GX4X 4Z2YA 2JRTA 2ZFWA 3CUQB 3C1DA 1Z7UA 1XGSA 5LRRA 3KLOA 2BV6A 2PEXA 4HDUA 2ZNYA 2UXNA 1ZRFA 1YIOA 1YYVA 4OMYA 2VN2A 3E6CC 2CSOA 2OAZA 1O7FA 4B09A 4MQVA 4NQWA 4MQ9F 2AXLA 1DUXC 4EV0A 1YO5C 2J5PA 3FMSA 2EV5A 5D8KB 5BS6A 2KRFA 3MZYA 1GXPA 6PAXA 1BJAA 3FMQA 3TO9A 4LJZF 2MBFA 4CZZA 2QQAA 2PQ8A 4JK1X 3C3WA 4WXHA 4I0BA 3LA7A 2B0LA 4RB2C 2GZWA 2BBYA 4ESBA 5CVUA 2FSWA 5AIPA 3V8KA 4LFUA 4M9ZA 4EMSA 3ROUA 1IF1A 5IT9Z 2HR3A 2CGPA 4MHGA 3GXOA 5J8FA 4XSXF 3L9FA 2A3SA 1W7PD 3DXJF 5HVQC 4Q4ZF 1J5YA 4L5IA 4A2UA 1U5TC 1D8JA 3Q9SA 3F22A 1XD7A 1O7LA 2X0LA 1UHMA 5CLSA 2PLYA 5CJ9A 1YW7A 3Q9VA 3MZHA 5D5UB 4GYIA 3QAHA 4AIJA 1XDUA 2H27A 1TTYA 4G7ZF 2XAHA 3T8RA 4G6QA 1SAXA 1REPC 4OMZA 3ISPA 1D8KA 2GXBA 5DV5A 1ZARA 4LLGF 1CF7B 3ECHA 1WI9A 3WTVC 3KP4A 1HQCA 1MJAA 3C7JA 4O6JA 4YFNF 1BM9A 3HRSA 5E8GA 1XMKA 1ZGAA 2XKOA 4KMUX 3ZMZA 4ZZLA 3HHGA 2D45A 5K5RA 1S8NA 4IHTA 5TRDA 3F8MA 2BYVE 1S7OA 3GWZA 2AS5F 2DQLA 4KMFA 4EJVA 1WWXA 2O3FA 4BNCA 3R0JA 4HQMA 4FHTA 4ZYHA 4LK1F 3TOBA 4HOBA 4A5NA 2VXZA 1JXSA 3O6BB 3HIFA 2LNBA 2DPDA 3I59B 3U2RA 3TKYA 4U88A 3JTGA 1XGOA 5IT3A 4UVAA 1ZN2A 2DFIA 1UCRA 3M8EA 4RGSA 3PQKA 5CVIA 2CFXA 2VBWA 2FNPA 1SMTA 3VFZA 1XDSA 3G3ZA 4MEYF 3CO6C 4RB3C 4LK0F 3WG9A 3QP6A 4M9XA 2PBIA 1HBXG 4ESJA 4Y17A 2L02A 4TV7A 4AIKA 3WTZA 3DPTA 1P4XA 3P7NA 2K02A 2E7XA 3HTSB 3CJNA 1H0MA 2HOEA 4PCQA 1SD6A 3EETA 4UV9A 3IRRA 1ZRCA 2X4HA 4BH9A 1G6NA 3ZMDA 2H94A 1KQ9A 5D6FA 5K5QA 1USTA 3WU0A 1QQIA 4LGWA 1RNLA 1ON1A 2RKHA 1JHFA 3FXUA 2XKPA 4KYWA 1B4AA 4QWQA 4ENKA 1BC7C 1F1ZA 4K2EA 5LRSA 5FLXK 3KETA 3IL2A 4LD5A 2DQRA 5E20A 4WXCA 3FM5A 1SFUA 3J7AO 2VT3A 1D3YA 2O6GE 5KK1A 1ZREA 3PFIA 3REOA 2EJRA 4KNYA 2MH9A 1P92A 4G94A 1T0FA 1MJBA 2M30A 3H3UA 3RPQA 1G3TA 3BJ6A 1LNWA 5A2QZ 2Y0MA 2VE8A 1EH6A 2LKPA 1AOYA 2GXGA 3R6SA 1V3FA 1ZYRF 2HWVA 5BPDA 5HS9A 2MLKA 4I2OA 1F5TA 1QPMA 4YIFA 1W7PB 3HSEA 3VB2A 2ZMEB 1BBYA 3G73A 1EV7A 1HW5A 1OPCA 3T1BA 2UWMA 3I64A 3MCZA 4O5VA 3BJAA 1F9NA 4DQ2A 2HQRA 2W85A 4M72A 2KIMA 2LF8A 3SFZA 3MWMA 3CUQA 1WQ2A 2IPQX 5CVJA 1FSEA 2MLGA 4ENJA 4HV5A 1EH8A 1E17A 3M1EA 2OZ6A 3I58A 3B73A 3B02A 3M8FA 2D2WA 2M45A 4PDKA 2DK8A 3NEUA 2QM3A 4KN7X 2HKOA 2FBHA 2DW4A 2FBIA 1LEAA 5HS7A 2JSCA 1XSDA 4IVNA 2L3DA 4M74A 5E1XA 5BQTA 3TDZC 5LEKA 1Z1DA 2L01A 4U0WA 2PN6A 2MA3A 4DNCA 4OU0A 2M8EA 1E2XA 2COMA 2EFNA 4WCGA 3Q5FA 3ZPLA 3V7CA 1WKMA 1JGSA 4EGZA 4BQAA 2XAGA 4R79A 3ZN1A 3WTUC 1IXRC 1S6LA 4RB0A 5FGMA 4OIRF 1ZG1A 5K1YA 2Q2EA 2EFQA 1DPRA 2XVCA 3WTXC 5DEQA 2HTSA 1FZPB 3F8NA 2KIUA 1FPQA 4LMYA 5F64A 2ZXJA 2KJCA 3E6MA 2ZNZA 3JW4A 4A12A 5L3CA 5L3EA 3HRMA 4FX0A 4P5OA 5ERIA 1ON2A 4Q48A 1KA8A 2EFWA 2G7HA 3DF8A 1I1GA 2QLZA 1BC8C 5D8LB 5J8CA 4EVIA 4MNUA 4EJTA 4IPAA 3GZ5A 3M7GA 2V9VA 2H6CA 3HUGA 4Q47A 3TO7A 3I53A 1FY7A 1SFXA 3BDDA 4KDPA 2EV0A 3EUHA 3RTRA 3V7SA 2FQ3A 3K1PA 2CO5A 4HF0A 1U2WA 4A0XA 1XCBA 5CYVA 2FOKA 3KE2A 3T8TA 1MGTA 5ICCA 4Y15A 2M5WA 1HXDA 3P9IA 2DPUA 2OBPA 2A6HF 3FMRA 2EA4A 3WGGA 5D4RA 4D0PA 1OYWA 5HLHA 3RI4A 1PDNC 4KFCA 1YFHA 3I0TA 4BYYA 4PZJA 1QZZA 1F4KA 3ERED 1K7AA 4I7HA 3GLXA 4N9HA 5KVRA 3F8FA 3JSPA 4A6DA 4UVCA 2DK5A 2EK5A 2V6CA 3FF5A 2RNJA 3FWEA 5FFZA 4M6XA 3J81Z 1B1BA 1XCVA 2K86A 2RVCA 3GZ6A 3WE2A 4IRIA 2G7UA 1C0WA 3VOEA 2E7WA 1UHWA 1TNTA 3U9GA 3FX3A 1IUYA 4IF4A 2HYFA 1H9GA 3BOQA 1QO0D 5LGTA 1ULYA 2V1DA 1L3LA 1WSUA 1Q1HA 5E1ZB 1P4AA 3R61A 4EJUA 1YW8A 5HLGA 1MKMA 1J75A 1RZ4A 4A0ZA 3JAMZ 5ILUA 3L00A 3WGHA 2STWA 2L4MA 4M71A 4RB1A 2WWYA 3H92A 3BJOA 3ZMVA 2OQGA 3TOAA 5FD5A 1T6SA 3TDUC 2PI0A 5J6XA 1FWZA 5D4SA 3DP7A 3P9KA 2LDUA 4LB5A 3HRUA 3F23A 4MTEA 3KZZA 2YU3A 2YX4A 4LG0A 3F72A 2GWRA 5TJJA 1K6OA 5FB2A 4YG2F 4YFXF 4ENMA 2ISZA 3E97A 3JTHA 4FT8A 1YG2A 1TBXA 2GA2A 1FYLA 2OD5A 2GIVA 2D1HA 1FP2A 1IAWA 4KIBA 3NRVA 4RGXA 3ZMUA 2HFHA 2XHKA 5E1WA 3QRFF 4BHBA 4EJWA 3O3KA 1LQ1A 3OV8A 1IN5A 3SXYA 2EA2A 3LAPA 1FNNA 2OA4A 1RUOA 2IJLA 3JAMK 1R22A 5FD6A 3LQRA 2QYOA 2W84A 4KUMA 2A5YB 4WWCA 2CYYA 1XB4A 3KP6A 3IHUA 4RAYA 3NQOA 4HF1A 5DCFA 3S2WA 5A2QK 1FC3A 2P5VA 3ZN0A 2F2EA 5E17F 2ETHA 5HDGA 3GEZA 1CGPA 1ZLKA 2Z33A 5K5OA 3WTSC 3E5XA 1G3YA 1MDMA 1TW2A 3N4MA 4A0YA 3QPHA 5JFRA 2XIGA 1ZG5A 4O3MA 2DO7A 1KYZA 3W6KB 4LB6B 2A07F 4RAZA 4LG0B 4HX8A 5BPIA 4P96A 3GFMA 5CVVA 4F7ZA 2EFOA 2DI3A 2ELHA 3WGIA 4NHJA 1GHCA 5E18F 3I4PA 4NB5A 3EYYA 4KICA 3LSTA 2MC3A 2RV8A 2PJPA 3WE3A 3ZP5A 3F21A 1XMAA 2EB7A 2OU2A 2EWNA 4G7OF 2P6SA 2H6BA 2VONA 1KQ8A 3SHFA 1DPUA 1UB9A 5D5WB 4G8XA 5ILVA 1B9MA 3MAJA 4ZH4F 1ZLJA 1FT9A 4PGGA 2GAUA 4HA8A 3F3XA 3SQNA 1AWCA 1FLIA 4S05A 3RDIA 3DQVC 2GA1A 2D1VA 4L5JA 2RDPA 1B59A 4L0ZB 2QBYB 1HW1A 2R7DA 2F5EA 3F8BA 5L3GA 3DEUA 1I1SA 2YSRA 4M73A 5ICGA 1LDDA 3R60A 3ZMTA 3FM3A 3SZPA 1YTYA 1XSVA 3HSRA 3K1MA 3L09A 3CO7C 1HSJA 3K69A 2FU4A 1O3RA 1R1UA 5DD8A 3HHHA 4ZZDA 1KU2A 4KA4A 5ICEA 3K2ZA 3EQLF 4G9YA 1R00A 2VODA 1SD7A 2ISYA 1DP7P 1BI3A 2BGCA 3BY6A 1G4DA 3QU6A 2PFBA 1OMIA 1U5TB 3LFKA 4ZYEA 2ZMEA 3F6VA 4HZFA 2Q8KA 4RGRA 1UFMA 4L9TA 2IT0A 2IA0A 4BHCA 1X3UA 4WXDA 1IRFA 4CYDA 1Z91A 3VEPA 2IA2A 3JSOA 2LSOA 3D0SA 5ILSA 3ZMSA 4M9SA 5DCMA 3K1NA 2HEOA 2XAQA 1J7KA 3MQ0A 2MD5A 5DD4A 2O61A 4EQQA 3EDPA 2XASA 1LDJA 4MTDA 1S3JA 4JQFA 3WU1B 2QQ9A 3FXQA 5BMZA 1KYWA 1U8RA 1OYIA 2RC4A 1XN7A 5LEJA 5HOOA 4MEXF 4OOIA 5AIQA 4IRHA 2XAJA 3J81K 1KU3A 2DT5A 4EM2A 2IP2A 4CDGA 2Z9OA 4UV8A 1I6XA 2Z5UA 3CUQC 2L4AA 4R1HA 4AIHA 1TW3A 1XGNA 4I01A 5JHUA 3BROA 1BIBA 3I71A 2DBBA 2P7CB 2FRHA 3E5QA 3KP3A 2XROA 1LJ9A 1KQ0A 3R0AA 4G7HF 2FXAA 3ABTA 2Y75A 2K7LA 2QUFA 3V8LA 1IN8A 4GCVA 2VBXA 2HS5A 2E1NA 5LBQA 2C6YA 1RUNA 3KFWX 3E6DA 4WK8F 2RQPA 2QQBA 5D5XB 1FX7A 3RKWA 1ZAOA 1FYMA 2TDXA 3FXRA 3DV8A 2JPCA 3KCCA 1HKSA 2FEZA 1R5HA 4U7BA 2PMUA 1A04A 3V4GA 2P7VB 5LLQA 4IRGA 1SFEA 3RKYA 3LA2A 1SD5A 3AAFA 1USSA 3QPTA 3CDHA 2W24A 3ULQB 1ZHFA 2PG4A 3I59A 2K27A 2K4JA 4WX9A 3P9CA 3H3ZA 3J80K 1TQMA 2KIFA 4I02A 3BPXA 2HYGD 5ICFA 1G3WA 1T39A 1H9TA 4XLNF 4G6DA 1YQAA 1Z9CA 1QNTA 2YX7A 2ADUA 4MGRA 1P6RA 3KP2A 3J80Z 2WTEA 1YLFA 2VC0A 2P6TA 4HX7A 2HDCA 2O0YA 1FBUA 1R36A 4XLPF 4UXNA 2L54A 2JZYA 1QZYA 5LHHA 1ZG3A 4KT5C 2RGVA 3QU3A 3KZYA 4LLNA 3I5UA 4KN4X 2UXXA 3CTAA 1L0OC 4XBFA 1J0RA 1GXQA 4ESFA 3GVAA 1K79A 1HKTA 1ONVA 1KU7A 3HOSA 2A69F 4IHSA 1NHAA 2VBYA 4HQEA 1YS7A 2FF4A 2P5KA 2DAOA 5LHIA 1CF7A 3KLNA 4CGZA 3E3VA 2RN7A 3MFKA 1MJ9A 4HLYA 4YFKF 2EV6A 3BZ6A 2FNAA 1JHHA 3RIRA 1S7AA 1FYKA 5L3BA 5HDNA 3RYRA 2E1CA 4UHTA 4L18B 2ESHA 4P9UA 4GXOA 1R1TA 2Y48A 2CW0F 3RPUA 1IXSB 2VBZA 5FO5A 2HQNA 2M87A 2DTRA 4N0BA 4B8XA 1QGPA 3LAJA 1B9NA 1T2KA 3GO5A 1U5TA 3GUDA 4XRFA 4AD9A 5IT9K 1STZA 5D6EA 2EFPA 2ESNA 4L9NA 3HTUA 3BPVA 1QBJA 3ELKA 5JR3A 1IZ1A 1BIAA 5H6QA 4S04A 2DU9A 2K4BA 1TLHB 5DYMA 1W5TA 5L3DA 2CQKA 5EEGA 3KEQA 3WTYC 4OIOF 2PMHA 1U6GA 3MEXA 5H20A 2NS0A 2HGCA 2Z3YA 1R5GA 3QOPA 5D5VB 2J5OA 3V8JA 3F6OA 3U1DA 2NNYA 1J59A 1JE8A 4HAMA 4WF2A 5HLIA
chains in the Genus database with same CATH superfamily
4XOPA 4EM0B 4GGGA 3T0YA 2IW5A 4CICA 1A6QA 3IWZA 4PFPA 3L7WA 1V4RA 2MGQA 4E4HA 4EATA 4DBQA 1FJLA 3DPLC 4AVPA 2M4GA 1JJ8C 2XF7A 4ZYDA 2ZKZA 2K9QA 1MIJA 2Y30A 3PJRA 2A68F 1B6AA 2CH0A 3OYAA 3BP8A 1DGWY 2OQRA 3GW2A 2F4OB 1O57A 4BXXJ 1MW7A 4EM1A 1VTNC 2CUEA 5IY5H 2DFHA 1Y56A 5E79C 2KL4A 5KNLA 3S1MJ 3K0LA 1KGSA 2K9MA 2ID3A 3ECOA 1W5SA 3GFIA 4HBLA 2E19A 4P55A 4OINF 5F1RA 3DBRB 2R0QC 1QHHD 2LY2A 1BOAA 2V1UA 1ETYA 2JWTA 2HVQA 2K85A 4RMNA 2YPRA 4L9JA 2M1BA 2WB1N 3GFLA 3M8JA 4I09A 3SZTA 1W4MA 3LWFA 3K9TA 5HDKA 4N4OB 1MD0A 5DUIA 4U0VA 1MDMB 4A3CJ 3ZOBA 2R7OA 3F8CA 2O03A 1JI8A 1R58A 2CG4A 1VFCA 1OCOH 3K4LA 2QZ8A 4KIGA 4HNTA 2Z99A 4A5MA 1LFBA 4QLCU 1I27A 1FP1D 3H1CA 4RA2A 5E3OA 2F5DA 1TNSA 2K9LA 1GV5A 4F92B 1T38A 1A36A 2FBKA 2XGXA 3CUOA 4M6YA 2OZUA 5J4YA 2VOOA 5C44J 3K70C 4EGYA 3K4CA 4Y3OA 3WODF 1K4SA 1FEXA 1OYYA 4GFBA 1WRJA 2Q0OA 4U0YA 1O3QA 3I54A 1ETOA 3GTPJ 3ABMH 1J09A 1GVJA 3KIOA 4L9VA 4F91B 4BXUA 4A6EA 2IA1A 1K83J 1HCRA 2EZLA 2ZXWH 3CP8A 3EYIA 4BEHA 1OKRA 3RYPA 2ELJA 1XC5A 2HDWA 1IN7A 1MZBA 3H9QA 1FOYA 2DT6A 5AONA 4E70A 1VQPI 2Z16A 2EZIA 3N97A 3O8GA 3QPSA 1IW7F 4R8HA 1HW2A 2XGCA 3BG6A 2R5YB 1G3SA 1IN4A 1HKQA 3G2BA 4AYBA 3WTWC 4BAYA 2IGOA 3F0CA 2L9RA 4Q5SF 4CSWA 3TQNA 4RLQA 2MH2A 3HGGA 4RS8A 5FRNA 3FISA 3ZQ7A 3M9AA 2Q1ZB 2BE5F 2FA5A 4UB8C 4ZDPA 3BQZA 2R7SA 1DGRM 2EH3A 1R7JA 2DLLA 2M2EA 2M7AA 4KIFA 1A31A 4ASNA 2ZCWA 4IJAA 3TO6A 3DFGA 5E8IA 1U3EM 1PP8F 1IN6A 1Y0UA 4RGUA 2CQXA 3COAC 2X1CA 3FIWA 2VT2A 5LD2C 3PQJA 2H09A 1ZR2A 2MD0A 4V2GA 3H5NA 1ZR4A 3OOPA 3G1LA 3TGNA 1EH7A 2H1KA 3HOTA 4OIPF 4A3IJ 3PM1A 4HX4A 3OYIA 3LSIA 3LNQA 5EG0B 3LFUA 2QSFX 4ETSA 4D5FA 1HDDC 4D1QA 3ABUA 4PUSA 3HRTA 2QBYA 3BQYA 2VQLA 1HSTA 2A6EF 1OCCH 2KISA 2CWEA 3DTIA 3IRQA 1I3QJ 1T33A 4OIQF 4W97A 4F3QA 3JCUC 2XC7A 2XRNA 3RJPA 2W25A 3RKQA 5L3FA 1LDKB 4LIVA 1PVEA 1SMYF 1OCRH 2LF7A 4IX7A 2WC2A 1T98A 2IXSA 3AG3H 1R5ID 2HQ5A 2XF5A 4H4KC 4DZJA 2E36A 2JA6J 2KKOA 5CVRA 4FX4A 1O3TA 2V79A 3V7RA 4ENNA 1R1VA 2VC1A 3CD6I 4CYCB 3DCFA 2VOPA 2FMYA 3ZQHA 1DDNA 2K3FA 2VASA 4QTRA 5LGUA 1BL0A 1JUPA 3WHCA 1I5ZA 2CQ7A 2ZXHA 2G9WA 3T5XA 4ZYGA 2VE9A 4H0EA 3CP2A 4JBAA 5JVGF 3C2HA 2PMZA 5IYDJ 3CCQI 4CYCA 4D7MA 2WBMA 1ETKA 1PUFA 5FKLA 3SDBA 1K78B 5LHGA 1MNDA 2QA4I 2F5CA 1NG6A 5J3LA 3DBLB 1IXCA 2HOAA 3WU2C 1SAUA 2XV4S 1U8BA 4XSZF 3D5LA 1ODDA 5JI6A 5JLXA 2F5FA 4BDYA 2LBFA 3VPRA 1K78A 1RI7A 3OYJA 3O2PE 1HLVA 5ED4A 3FHZA 3MKWB 2NNNA 1J2XA 1S29A 1Z6RA 1ZGJA 1YHQI 3H3VK 4CXFA 1D5VA 2NAZA 2X1EA 4MFEA 1VQ4I 3DKXA 1P2FA 2IRFG 1DQUA 2GIZA 4PGHA 2P5LC 2WV0A 2R3SA 1TWCJ 3KP5A 1O3SA 1GDTA 3CMAI 3HYIA 3H9GA 5LGNA 3SFIA 5J47A 4HNUA 2O5RA 4GRIA 1J9IA 2F5VA 1TWHJ 2V9PA 2WB1A 2NYXA 2XUBA 2VL8A 5DDGA 3R4KA 5GP9A 3VODA 3WTTC 2JPBA 1KU9A 2O8XA 3E5UA 5F0FA 1DP3A 2F4MB 4I76A 5JVTA 3IC7A 1FOWA 4I98B 3GTLJ 1SC7A 3OS1A 4ON0A 1OR7A 2QWWA 3FDYA 1N77A 2FMLA 4L0YB 2V4JC 1NK3P 3CLOA 1XSXA 3GYHX 3A52A 5F0HA 2E5NA 2NRAC 4HDVA 4UY8I 1LVAA 3CLQA 3W6JB 4HV6A 1FSHA 3FXKA 5DUKA 1FBQA 3HZJA 2W57A 1R9TJ 2UZKA 4GYGA 4LOCA 2M0CA 1WJ5A 2KQRA 1PYVA 1FBSA 1LEBA 4XKCA 1YS6A 4N9IA 2QVOA 4HYEA 4HF2A 2QF7A 5TGTA 4XLAA 3PIPF 3LQQA 2HNHA 2QENA 1BI2A 2DA5A 3FXMA 4HW0A 4AWXB 5FLXZ 4A93J 1P7JA 5C3EJ 5HNFA 2LG4A 4UUVA 2DCEA 1BI1A 2R93J 2ZJ2A 3VSKA 4U87A 5BOXA 5BNGA 2HZTA 1ZRDA 3BR6A 4I0AA 1U0JA 3H35A 5EEHA 2STTA 1Y6IA 4LIUA 2VUMJ 1W7PA 1LB2A 2XB5A 2AQEA 3BWGA 4BHPA 1IRGA 1U78A 5EZHA 2ZBKA 2BY0A 3DKWA 1Z05A 1VQMI 3HSFA 2E2HJ 1WJFA 4U7DA 2W7NA 1BI0A 2KMUA 1X2MA 2LH9A 1SD4A 4YIIA 2EILH 5F6FA 2FE3A 2XDVA 1E3HA 2GQQA 2JT1A 4BBRJ 4Y13A 3HOXJ 2I10A 1TQIA 5JHFA 2KP6A 1MBKA 3QPLA 1N75A 1X1CA 1WCMJ 4UNOA 1SVLA 3GFJA 2DYSH 1Z3XA 2BHZA 2IEKA 1PUEE 2ID6A 4GO1A 4OWRB 5CQEA 4BKXA 3KEYA 3PL8A 2IVMA 4P9FA 2CJJA 3GTGJ 2FD5A 4IXAA 2YR2A 3X2QH 4A3LJ 1WFXA 4FQGA 3H5RA 2QGUA 3RKXA 1FOKA 2BEOA 2LK2A 2OCEA 1Y39A 1BN5A 2IBDA 2V1XA 4ZJZA 2JQ7A 2XAFA 3IKTA 2A61A 3LA3A 4EJOA 2XB0X 4AC0A 3QP5A 3KEOA 3CCVI 1Z6TA 5HS8A 5FFXA 3BTIA 4XKBA 1IV6A 2N8GA 4MIMA 3L2CA 1PP7U 1D1CA 1WHUA 1XMXA 2VQHA 3CDLA 3E6BA 3GF2A 1ZKGA 4BJTA 1MMNA 1TQPA 2VJ5A 1GT0C 4CHUA 2ACJA 2FJ1A 3ONQA 3SEQA 2VIXA 1NH3A 1P4WA 2OPTA 4LLLA 4ZYAA 3IKVA 4HLXA 1XGMA 2KJBA 2ICWG 3KP7A 4IQ4A 3C18A 3ML6A 3IWFA 2P8TA 2CW8A 2HTJA 1RIOH 2HDDA 1YW9A 4RAFA 2ZO4A 5IP6A 5H6RA 5A2QR 2P4WA 2HKXA 2R7FA 4UVBA 4CO8A 5DCMB 1R23A 1ZH5A 1G8XA 4PFOA 5CPRB 3TP3A 3FZVA 2JTVA 4Z2YA 2JRTA 3GX4X 2NVXJ 2ZFWA 2MVTA 3CUQB 3C1DA 1X1PA 4CCNA 5M5XJ 3KZIC 1Z7UA 1N25A 1XGSA 1JKPC 4NNJA 5LRRA 3KLOA 2BV6A 2PEXA 4HDUA 2ZNYA 2HYJA 2UXNA 3TMOA 1VQ5I 1ZRFA 4YELA 1YIOA 4Z6YA 1YYVA 4OMYA 4BY1J 2VN2A 3E6CC 2CSOA 4S0HB 1JUSA 2OAZA 1O7FA 1MBJA 4B09A 2QKMB 2AHQA 3NWTA 4MQVA 4NQWA 4DW6A 4MQ9F 2AXLA 3CQZJ 2DFEA 1DUXC 4EV0A 3GMEA 3H5AA 1VQOI 2LREA 4BEHB 5F1JA 4XRMA 1YO5C 2J5PA 1HF0A 3FMSA 2EV5A 5D8KB 5BS6A 2KRFA 3MZYA 1RPWA 3KYDB 1IV8A 1GXPA 6PAXA 1BJAA 3FMQA 1LUJB 3UKGA 2E2IJ 2HZDA 4ZTFA 2R7WA 2DMUA 2NVUB 3S3OA 3TO9A 4LJZF 2MBFA 5GADJ 4CZZA 2QQAA 2PQ8A 1YE9A 4JK1X 2ELKA 3C3WA 1JTXA 4WXHA 1JT0A 4I0BA 3H9JA 2B0LA 3LA7A 1VQ8I 4RB2C 2GZWA 2BBYA 4ESBA 5CVUA 4LITA 5EGOA 3W2WA 2FSWA 5AIPA 3V8KA 4LFUA 1AKHA 4M9ZA 3CCUI 4EMSA 3ROUA 1IF1A 3VWBA 5IT9Z 3IAS2 2HR3A 4BQNA 1LFUP 2CGPA 2Y0SA 4MHGA 2VQCA 5B5EC 2A6TA 2AQFA 4ABZA 3GXOA 4JX4A 5J8FA 4OAYA 4XSXF 5GAGJ 3L9FA 2A3SA 1BR4A 1W7PD 1LE8B 3DXJF 5HVQC 4Q4ZF 3FXOA 5J4VA 2IS4A 1J5YA 3DLLF 3CC4I 4IO9F 2M0MA 4L5IA 4A2UA 1U5TC 1D8JA 4XORA 1QZEA 1YX5A 3Q9SA 3ZGKA 3F22A 1XD7A 5FKKA 4FISA 1O7LA 3SEZA 2X0LA 5EJCA 1DU6A 4KITB 1UHMA 4DYCA 2BXYA 5CLSA 2PLYA 5CJ9A 1YW7A 3Q9VA 3MZHA 5D5UB 4GYIA 3QAHA 4AIJA 4A3BJ 1XDUA 3OYLA 2H27A 3W3CA 1TTYA 2L9SA 4G7ZF 2XAHA 3T8RA 1P7IA 4G6QA 1UMQA 3C2GA 1S5LC 1SAXA 1REPC 2RAEA 2ECCA 3ISPA 4OMZA 1D8KA 3D5SC 2GXBA 5DV5A 3LSKA 4FE4A 4BQOA 1ZARA 1DU0A 4LLGF 2LYCA 4X6AJ 1CF7B 3ECHA 1WI9A 3WTVC 3KP4A 3S3NA 3OYBA 1HQCA 1MJAA 2L9VA 3C7JA 3CZ6A 4O6JA 4YFNF 1BM9A 1MH4A 2CUZA 3HRSA 5E8GA 1SFOJ 1BA5A 1XMKA 1ZGAA 2XKOA 3K2AA 1R6RA 4KMUX 3ZMZA 5B3SH 4ZZLA 1E3OC 3HHGA 2D45A 1TWAJ 5K5RA 3HG9A 1S8NA 4IHTA 2FX0A 1SANA 4CZCA 1MMAA 2JJ7A 5TRDA 3F8MA 2BYVE 3DEEA 1S7OA 3GWZA 2AS5F 2NXNB 2DQLA 1APLC 4KMFA 4EJVA 1WWXA 4CH7A 2O3FA 2NVQJ 3FHNA 2KLOA 1S9HA 4BNCA 3R0JA 1WI3A 4HQMA 2E1MC 2H8RA 2L7FP 4FHTA 4ZYHA 4LK1F 3TOBA 3LSJA 4HOBA 4XLHA 2PJRB 4A5NA 2ZB9A 4IEJA 2XPUA 3O8HA 1OFCX 2VXZA 1JXSA 3HEFA 4Y7NJ 2FOWA 3EUAA 4M3EA 3O6BB 1MBHA 3HIFA 1WH7A 2LNBA 2DPDA 3I59B 3U2RA 2V6EA 3TKYA 2YS9A 3H0GJ 1VQ7I 3K6GA 4U88A 1FMWA 4IHWA 1B8IA 3JTGA 1XGOA 3VYSB 4QSHA 4A3MJ 5IT3A 5F04A 3I4MJ 2VKDA 2R4GA 2X51A 4UVAA 3ZR8X 1QU3A 1ZN2A 2DFIA 1UCRA 2E1MB 3DWLE 3M8EA 4KISA 1FIAA 1WJBA 4RGSA 2KHMA 2Y2ZA 3J7YJ 3JRIA 3PQKA 5K7HA 2VJIA 5CVIA 2IS6A 2CFXA 4ZTJA 1XTAA 4NDLA 2VBWA 2FNPA 4NC6A 4D7NA 1TC3C 1SMTA 3VFZA 3RQ4A 1XDSA 3ZQCA 1EA3A 2X6OA 3G3ZA 2KRHA 1X58A 4MEYF 5E3LA 3CO6C 3OSGA 3RPUD 4RB3C 4LK0F 2CV2A 3WG9A 3QP6A 4M9XA 2PBIA 1HBXG 4ESJA 4Y17A 4V2FA 2L02A 1MMGA 4TV7A 2DOEA 2P0TA 4IHYA 3OSFA 2V7FA 1JTYA 4AIKA 4J01A 3WTZA 3DPTA 1P4XA 1V5GA 3P7NA 4A3EJ 2K02A 2L2OA 1LFPA 2E7XA 3HTSB 2VPRA 3NWSA 3CJNA 1H0MA 2M35A 2HOEA 4PCQA 1LKXA 1SD6A 4E7IA 3EETA 3MVPA 3H0DA 1LPQA 1MNEA 1WPKA 1QRYA 4IOCF 4UV9A 5HNHA 1OLTA 4FE7A 4XLCA 1POGA 3ZXSA 3ZQFA 3IRRA 3JRBA 1ZRCA 2X4HA 5C4JJ 4AUXA 4BH9A 1G6NA 3ZMDA 2H94A 1KQ9A 5D6FA 5K5QA 1A6IA 1USTA 2EZKA 3WU0A 4DYQA 1QQIA 3CCEI 3BR2A 1RNLA 1ON1A 2RKHA 1JHFA 3BR0A 4LGWA 2QSGX 2BXZA 3FXUA 1JJ6C 2XKPA 4KYWA 1B4AA 4QWQA 2MW8A 5DM7F 4ENKA 1BC7C 1F1ZA 4K2EA 4C3HJ 3W6VA 5LRSA 2LP0A 5FLXK 3KETA 3IL2A 4LD5A 2D5VA 1I50J 3S15J 1W36C 2GXAA 2DQRA 1F43A 5E20A 2DDAA 4WXCA 1B72A 3FM5A 3HOZJ 2R7TA 1SFUA 2CV1A 3J7AO 2VT3A 1D3YA 1S72I 4RM3A 5FROA 2O6GE 3L1PA 5EYRA 5KK1A 1ZREA 3PFIA 3REOA 3S3MA 2LMDA 5J1YA 3Q0UA 4RAGA 3OL4A 5IYBJ 2MC4A 2EJRA 4KNYA 2MH9A 4ZC3A 5GAHJ 4E7ZA 1P92A 4G94A 1T0FA 2WAEA 2NS8A 3LSPA 5B1BH 5TISC 2CU7A 3MN2A 5H2FC 1MJBA 2M30A 3H3UA 3RPQA 1G3TA 1KZHA 3BJ6A 1LNWA 5A2QZ 1WVRA 3S1RJ 1YRNB 1RC9A 2Y0MA 2R7UA 2VE8A 1EH6A 3GTOJ 2CW7A 3OYCA 1W0TA 2G0EA 2X6XA 2LKPA 2LVSA 2L5QA 3PNTA 1AOYA 2XPVA 2GXGA 3OOUA 3R6SA 1I39A 2OCCH 1V3FA 1ZYRF 2Z2SB 2HWVA 5BPDA 2XGEA 4DZPA 4E7LA 5M5WJ 5HS9A 1TWGJ 2MLKA 3P5JA 4I2OA 1F5TA 4X1EA 1T95A 1QPMA 3BG5A 3DTEA 3RQIA 4YIFA 4HRIA 1W7PB 3HSEA 3CDIA 1BR1A 3VB2A 4NBQA 1HC8A 2HXIA 2ZMEB 4JX6A 1BBYA 3G73A 1EV7A 2Z1DA 1HW5A 4ZDLA 1OPCA 1T8IA 5F0CA 3T1BA 5FKNA 1QPIA 2UWMA 3I64A 3MCZA 2V26A 3BTJA 3CC7I 4O5VA 5J1UA 4CCLA 3BJAA 3EPZA 1F9NA 4DQ2A 2M8GX 1X4OA 2HQRA 2P0WA 1K4TA 1WJDA 5F08A 2W85A 4M72A 3PUBA 1YJWI 2KIMA 1Z21A 2DFFA 4PSXA 4ZDOA 2LF8A 4BE1A 4C2MJ 1H8AC 3AL0C 1ENHA 3VDXA 3SFZA 3MWMA 3CUQA 3W2VA 2BY2A 2DMQA 3S1NJ 2M4KA 4PJJA 1Z77A 1WQ2A 2IPQX 5CVJA 4JOMA 1FSEA 3ZQLA 2MLGA 4ENJA 4P1WA 4HV5A 2VKEA 1EH8A 2DMNA 1E17A 3M1EA 5EF6A 2OZ6A 4C30A 3I58A 3B73A 5JLWA 2K5CA 4XQFA 3B02A 3M8FA 2D2WA 2M45A 4PDKA 2DK8A 3HGYA 5IOYA 3NEUA 2DA7A 1Y8RB 2IGNA 3BT9A 2QM3A 4KN7X 2HKOA 3K4JA 2FBHA 4PK4A 1MBFA 3HDDA 1UG2A 2DW4A 2COBA 2FBIA 3RZOJ 1VI0A 1LEAA 3IAM2 5HS7A 2JSCA 3JRDA 1XSDA 3CCLI 5GPAA 1SVMA 4IVNA 4CCKA 2DOFA 2L3DA 4M74A 3PIOF 5E1XA 5BQTA 2KFDA 3TDZC 1RKTA 3U1KA 5LEKA 1Z1DA 2L01A 4U0WA 2PN6A 1K61A 2MA3A 1W5CC 4DNCA 1SFKA 2DA4A 4OU0A 2EIKH 2HOTA 2RREA 2M8EA 1E2XA 2COMA 4A3DJ 2EFNA 3ZRGA 4F55A 1RRJA 4NUBA 4WCGA 5DM6F 3Q5FA 3V7CA 1WKMA 1JGSA 3ZPLA 4XLFA 4EGZA 3DBHB 4BQAA 2R7ZJ 3ZQIA 4XIDA 2XAGA 3HKZN 4R79A 1GV2A 3ZN1A 4RB0A 1IXRC 1S6LA 1X1BA 3WTUC 2R7QA 2X9DA 2VKHA 5FGMA 4OIRF 4AM3A 1VQ9I 3CJRB 5M3MJ 2XSDC 2TRTA 4XL9A 2W1OA 3CCSI 1JUMA 2AXTC 2VPLA 1ZG1A 3WG7H 3PSIA 2Q2EA 3WHBA 5K1YA 1JKOC 2MUNA 2EFQA 1G59A 3L2RA 4QPOA 1DPRA 3D5RC 3BLYA 3CF2A 3OL3A 2XVCA 2Y9YA 3WTXC 1FTTA 5DEQA 4E7SA 1IG7A 2HTSA 2DA1A 1FZPB 3F8NA 1P9QC 3W2AA 2QKLB 1LE8A 2VLAA 2KIUA 2LRDA 2VI6A 5B66C 1FPQA 4LMYA 5F64A 2ZXJA 1IO2A 3S2DJ 3GTJJ 2KJCA 2BY3A 2ZNZA 3E6MA 2E35A 3JW4A 4A12A 2WADA 5L3CA 5L3EA 3HRMA 4FX0A 4P5OA 4C3IJ 2JA7J 4M3FA 4B43A 1VF9A 2WA0A 1T08B 2XGDA 2A05A 5ERIA 1ON2A 4Q48A 3A02A 1KA8A 2EFWA 2G7HA 4E7KA 4II3A 3M1CA 3DF8A 1I1GA 2QLZA 1BC8C 3BTCA 3J7AY 5D8LB 5J8CA 4EVIA 4XNFA 4MNUA 4EJTA 4IPAA 3GZ5A 2LTPA 1E0EA 3M7GA 4BXFA 2V9VA 2H6CA 3HUGA 3OIPA 4Q47A 2DMTA 2EINH 3I53A 3TO7A 1BR2A 4KT6A 4IKFA 2JVHA 1IRXA 1FY7A 4B3XA 3RZDJ 1SFXA 3M4OJ 2PX9A 2WAQN 3BDDA 2YU9J 2VXDA 5IT9R 4KDPA 2EV0A 3EUHA 3RTRA 3DU5A 3V7SA 3S8PA 4C2TA 2FQ3A 3CJQB 1ZELA 2JA2A 3K1PA 2CO5A 4HF0A 2DTZA 3UNGC 1U2WA 4A0XA 1XCBA 2UUZA 2WAQA 5CYVA 2FOKA 3KE2A 3T8TA 1MGTA 4UB6C 5ICCA 5CKTA 4Y15A 4DYRA 2M5WA 1HXDA 2VJJA 3P9IA 1QHGA 2DPUA 2OBPA 2A6HF 3FMRA 2EA4A 3WGGA 2IGKA 2MYSA 1E3PA 5D4RA 2CUJA 4D0PA 1OYWA 4ANJA 1OJLA 1G2HA 5HLHA 5E3MA 3BG9A 3RI4A 1PDNC 1Q1VA 1QVUA 3OYGA 4KFCA 1YFHA 3FXJA 2DA2A 3I0TA 4BGDA 4FCYA 2QSHX 4BYYA 4PZJA 1QZZA 4J19A 1F4KA 3ERED 1K7AA 4I7HA 2MFZA 3AG1H 2EBIA 1V5FA 1Z3YA 3GLXA 4N9HA 5KVRA 3SJMA 3F8FA 3VYTB 2KIQA 3JSPA 3CF5F 4A6DA 4UVCA 3OWTA 1K6YA 4HSRA 4CCOA 3ASNH 2DK5A 2BVMA 2EK5A 2V6CA 2JVGA 1RR8C 2FQ4A 3FF5A 2HVRA 2RNJA 3FWEA 3GTKJ 2BZTA 5FFZA 2VKVA 3BC8A 2PJRA 3ZCOA 3QYEA 4M6XA 3CMEI 3J81Z 1B1BA 1XCVA 2CRGA 2K86A 3HPHA 2RVCA 1O4XA 1NG7A 3E1SA 3GZ6A 2BY1A 3WE2A 4IRIA 2G7UA 2IS1A 3G1MA 1C0WA 1YRNA 3VOEA 2E7WA 1UHWA 2LKXA 1TNTA 3BCAA 3U9GA 3FX3A 2GLOA 2CQNA 1IUYA 2JSPA 4IF4A 2HYFA 3CESA 5HODA 4DBRA 2F48A 1OR7C 1H9GA 3BOQA 1QO0D 2EZHA 3PNYA 3A01A 5LGTA 1ULYA 2V1DA 1L3LA 1WSUA 1GUUA 1Q1HA 3K4BA 1MBEA 4C2UA 2JA5J 5E1ZB 2GOXB 3HOYJ 2M3AA 1P4AA 3R61A 4EJUA 1X19A 3OYMA 1YW8A 5HLGA 3JAMR 1MSEC 2Q2EB 1MKMA 4A3FJ 1YOVB 1RZ4A 4XN3A 4A0ZA 1J75A 3JAMZ 5ILUA 2ZXIA 3L00A 3WGHA 2STWA 2L4MA 4M3BA 2Y31A 4M71A 2OTLI 2ZJRF 1D0XA 3SZGA 4BE0A 2IAIA 4RB1A 4I6ZA 2OJED 5KAIC 2WWYA 3H92A 3BJOA 4A3GJ 1WJCA 4UUTA 1YJ9I 3LSGA 2LY9A 3ZMVA 2OQGA 2NVTJ 3IUOA 5KAFC 4XKWA 3TOAA 4V19K 3ESWB 3EUKL 5FD5A 2ZJQF 1T6SA 3TDUC 2PI0A 2KZVA 5J6XA 1WJEA 1FWZA 1FIPA 1IRZA 5D4SA 3DP7A 1VQLI 1T56A 3P9KA 2LDUA 4LB5A 3ABKH 3HRUA 3F23A 4MTEA 3KZZA 2YU3A 2YX4A 3MMYB 3JRHA 4LG0A 5C4XJ 3F72A 2GWRA 3V42A 4XKVA 3SDGA 5FKOA 4LG3A 3GTQJ 2B63J 5TJJA 1YI2I 1IJWC 1K6OA 5FB2A 4HG2A 4YG2F 5EG0A 4E7HA 2F6CA 4IL6C 4XOTA 4C9YA 3LSMA 2R92J 4YFXF 3PUFA 2EIMH 4ENMA 2ISZA 4B47A 3E97A 3JTHA 4FT8A 4IHXA 1YG2A 1TBXA 2GA2A 1H89C 1FYLA 2OD5A 2GIVA 3OYDA 2X6YA 1ETVA 4BBSJ 3Q0WA 2D1HA 1FP2A 5FLVA 1IAWA 4IHVA 2E5ZA 2L7MP 3IH3A 3C2BA 4KIBA 4AU7A 3HJEA 5IYCJ 2QEXI 2XF6A 3NRVA 1UZCA 4HSTA 2HFHA 2XHKA 4RGXA 3ZMUA 5E1WA 3QRFF 4BHBA 3B6AA 4EJWA 2F4IA 3TEDA 2ME6A 3O3KA 1LQ1A 3L2VA 3HC7A 3OV8A 1IN5A 3SXYA 2OUMA 3L2UA 5DS9A 2EA2A 1UG0A 3LAPA 1W36D 1OCTC 4X0GA 1FNNA 2OA4A 3GTMJ 1RUOA 2RNGA 2LLKA 3BR1A 4Y33A 3ZQQA 2IJLA 3B6CA 1ETWA 3IV5A 5EGOB 2E71A 1S7EA 1MH3A 3DKYA 2HPIA 3NARA 3JAMK 1A35A 1R22A 4B44A 3HPGA 1TL8A 5FD6A 3LQRA 2QYOA 4FASD 2ZFUA 2W84A 4KUMA 4A3JJ 1YIJI 2A5YB 4RLFA 2GBYA 2CYYA 4WWCA 1XB4A 2AO9A 3TW6A 3HM5A 2MABA 3LMMA 1TWFJ 2JMWA 5EZGA 4AYBN 4E7JA 3KP6A 3IHUA 4PJ0C 4RAYA 1QA6A 3NQOA 3E7LA 1XPXA 4HF1A 5DCFA 5CQGA 3S2WA 5A2QK 1FC3A 2P5VA 2IGMA 2R7RA 1D0YA 2F2EA 2K9NA 3AG2H 3ZN0A 5E17F 3CCRI 2ETHA 5HDGA 3GEZA 1CGPA 3JR9A 1WH5A 1IUFA 4AVZA 1ZLKA 3S32A 2JK3A 2DN0A 2Z33A 5K5OA 3WTSC 2Y9ZA 2VB6A 3E5XA 4NQWB 2Y0SN 2X85A 2HXOA 3PFYA 1BOBA 3I55I 1G3YA 1MDMA 1TW2A 4MFDA 1ACIA 2XSJC 4A3KJ 3N4MA 4A0YA 3ERMA 3QPHA 5JFRA 5GPCA 2XIGA 1ZG5A 3CCYA 3Q0VA 2DO7A 4PSWA 4RM2A 4O3MA 3HUGB 1KYZA 2W4SA 3W6KB 1MNMC 2P81A 4LB6B 4BY7J 3S2HJ 3BR3A 2A07F 2LR8A 4RAZA 3OIQA 1YJNI 4LG0B 5M5YJ 1HOMA 3TL4X 4HX8A 5BPIA 1Y1WJ 3JRCA 4RDUA 1WGXA 1F36A 4P96A 3GFMA 3FXLA 5CVVA 1JGGA 1W1WE 2M7BA 4F7ZA 2ECBA 1PUFB 2WAFA 3A4CA 2EFOA 4CCMA 3SYTA 1U9NA 2O8KA 2DI3A 2ELHA 2HOSA 3WGIA 3MZ8A 4NHJA 1GHCA 1GLNA 5E18F 5F27A 3I4PA 4NB5A 2ZMEC 3EYYA 4KICA 3LSTA 2W82A 2MC3A 2RV8A 1X1AA 3DEWA 5GTIC 4JYKA 3AFHA 4HNVA 4DGWB 2NVYJ 2PJPA 3WE3A 3ZP5A 1GVDA 3G6EI 3F21A 1XMAA 3CCMI 2EB7A 5E3NA 2GOMA 2OU2A 2CFOA 1B72B 4A69C 2EWNA 2FUG2 4YRVA 3G71I 4G7OF 3DPUA 4D9JA 2P6SA 3S16J 2H6BA 2VONA 1KQ8A 2NOJB 3SHFA 1DPUA 1UB9A 1AA7A 4G8XA 5ILVA 5D5WB 1B9MA 3MAJA 1I3AA 1MMSA 4ZH4F 2UV1A 1ZLJA 1FT9A 3AL0B 4PGGA 3JRFA 2GAUA 4UUSA 5K7FA 4HA8A 2HU9A 3BG7A 2X1DA 4BACA 2CV0A 3F3XA 3SQNA 1AWCA 1FLIA 2KDOA 1ITYA 4S05A 2DJIA 2O7OA 2L9NA 3GZNB 3BCBA 3RDIA 2X98A 2B7EA 3DQVC 3HOVJ 2WV1A 2GA1A 1FMVA 4BDZA 5HLTA 2D1VA 4L5JA 2RDPA 1B59A 2QBYB 4L0ZB 1HW1A 2R7DA 3FBIB 2F5EA 3F8BA 5EDNA 3CCJI 4BUPA 1ERDA 5L3GA 3UR3C 3E0JB 3DEUA 4BL0B 1I1SA 2YSRA 1VZ0A 4N4NB 4M73A 3ZQGA 1Y8QB 5ICGA 3BR5A 1LDDA 2OF7A 1EF4A 3R60A 3ZMTA 3FM3A 3SZPA 4QPQA 1YTYA 1XSVA 1HA8A 2CQQA 4Y52J 3HSRA 3A03A 3K10A 4XONA 3J81R 3K1MA 2E1OA 1QVTA 3L09A 3CO7C 1HSJA 3K69A 2DXIA 5FRMA 4RBOA 3IH2A 2FU4A 2CS3A 4F52A 4B3AA 4BQQA 1R49A 1O3RA 1R1UA 5DD8A 1I6HJ 1BW6A 1R71A 3N05A 4M6VA 3HHHA 4DOZA 4ZZDA 2KRCA 1KU2A 4KA4A 3RSNA 3QQAA 3S14J 5ICEA 4JP0A 4PJLA 3K2ZA 3EQLF 1UJ8A 1TZLA 1SEUA 2O9LA 1VQNI 4G9YA 1R00A 1A5JA 2JUGA 3L2QA 1SD7A 2ISYA 2NS7A 2VODA 1DP7P 1BJZA 1BI3A 2BGCA 3L2WA 2R5YA 3I4NJ 3PO2J 4CA0A 4IOAF 3BY6A 1G4DA 3QU6A 2PFBA 3HOWJ 1RQ6A 1OMIA 1U5TB 1Z7LA 3AKZA 1AHDP 3G1OA 3LFKA 4ZYEA 2ZMEA 5IOZA 3OR2C 1B8IB 3F6VA 4HZFA 1ORKA 2Q8KA 1MMDA 4RGRA 1UFMA 3CMYA 4L9TA 2JRMA 2IT0A 2IA0A 3I3LA 4BHCA 1X3UA 4WXDA 1IRFA 4CYDA 1Z91A 3VEPA 2LC2A 2GM4A 1RETA 2IA2A 3JSOA 2LSOA 3D0SA 5ILSA 3ZMSA 3LOCA 4M9SA 1R4NB 5DCMA 3K1NA 1D0ZA 1W0UA 2HEOA 5IP7J 4FETA 2XAQA 1J7KA 3TBIA 3MQ0A 2V1NA 2MD5A 2DYRH 5DD4A 2A5WA 2LD5A 3NAUA 2O61A 3J7AW 4UUSB 2W00A 2KPMA 2WY7Q 4EQQA 1AU7A 3BZCA 1UELB 3EDPA 2XASA 3D1NI 1LDJA 4MTDA 1S3JA 4JQFA 2CUFA 3WU1B 3QODA 3HXLA 2QQ9A 3FXQA 5BMZA 1KYWA 1U8RA 1OYIA 2RC4A 1PJRA 1XN7A 1X3ZB 2EIJH 3VYUB 5LEJA 2E2JJ 5HOOA 1BW5A 4MEXF 1RR7A 1OCPA 1Z67A 1ETQA 4OOIA 5AIQA 3K70D 4NC7A 4CUGA 2HPMA 4IRHA 3A2KA 5GTHC 2ZC2A 2XAJA 3J81K 2WY8Q 1KU3A 4BJ6C 2DT5A 4AIDA 1RKWA 3J80R 4EM2A 4XRSG 2IP2A 4CDGA 2Z9OA 2V9KA 4UV8A 3HL2A 1I6XA 2Z5UA 3CUQC 2L4AA 4R1HA 4AIHA 4CCJA 1TW3A 1XGNA 4I01A 3QYBA 5JHUA 3K4NA 1VQ6I 2KT0A 3BROA 3OR1C 2DODA 1CQTA 1MSFC 1BIBA 2H8WA 3FKIJ 3I71A 1ETXA 1Z0XA 2XAUA 1FOXA 1IDYA 3GCMA 2DBBA 2ZSIB 2P7CB 2FRHA 3OS0A 4W1UA 3E5QA 4G12A 1JKQC 4KJZA 1EJ9A 1D1AA 3KP3A 2DDBA 2XROA 1LJ9A 1KQ0A 3I56I 2M34A 1D5YA 3R0AA 4G7HF 3LSRA 3Q3SA 2FXAA 3ABTA 2Y75A 4Y4RA 2K7LA 4XN0A 1ZTRA 3JRGA 3CMMA 1FTZA 2QUFA 3V8LA 1ZGWA 1IN8A 3VSLA 4GCVA 3GBGA 4JX5A 3MD2A 3CC2I 2VBXA 2HS5A 2E1NA 4XR6A 5LBQA 2C6YA 1RUNA 5GAEJ 3CJTB 2L0KA 3KFWX 2I5UA 1YITI 1OISA 3E6DA 2DMPA 3HB9A 4WK8F 2RQPA 4B4CA 2QQBA 3KX2A 1FX7A 3RCOA 5D5XB 4GDFA 3A0HC 3M3YJ 3RKWA 3JRAA 1UHSA 2JA8J 1ZAOA 4XM3A 5FKMA 3OYFA 4IZZA 1FYMA 3U21A 2TDXA 1UAAA 2B9SA 4PJNA 2DA3A 3EUHC 3FXRA 3OYEA 3DV8A 1XG1A 2JPCA 3HOUJ 4II2A 2Y69H 3KCCA 2BOLA 1HKSA 2FEZA 5EEAA 5KHDA 4BE2A 1R5HA 4U7BA 1Y1VJ 2PMUA 1JKRC 1A04A 3V4GA 2P7VB 4XMYA 5LLQA 4IRGA 1SFEA 3RKYA 3LA2A 3ASOH 2LFBA 1SD5A 3AAFA 1USSA 3QPTA 3CDHA 2W24A 3ULQB 1ZHFA 2OV7A 2PMZN 2ZJPF 2PG4A 3JREA 2R7XA 3I59A 3TP0A 2K27A 1U9OA 3AG4H 2K4JA 3DTKA 4WX9A 3P9CA 3H3ZA 4EEFG 3J80K 3OMYA 2XRLA 2R5ZA 4D5CA 1TQMA 5K7ZA 2KIFA 1LVKA 4L5EA 4BU2A 4B48A 3OYHA 1TP4A 3KYCB 4DJAA 2I8DA 2BVLA 2DT7B 4I02A 3BPXA 4YEJA 2HYGD 5ICFA 1G3WA 1T39A 4XLEA 1H9TA 4XLNF 3DLAA 4G6DA 4NC8A 1YQAA 2LKSA 1WJAA 1Z9CA 1R4MB 1TT5B 1QNTA 2K9SA 2E34A 2HI3A 2E60A 4PJMA 5LFAA 5B1AH 3IP4B 2YX7A 4YIRX 5IP9J 4FTHA 2ADUA 4MGRA 2OC6A 1P6RA 3KP2A 2YUSA 2MG4A 3J80Z 1TT0A 2WTEA 4BJ5C 1N78A 1YLFA 2VC0A 3FKJA 2P6TA 4HX7A 1H88C 2OTJI 2HDCA 5M3FJ 1EKEA 2R7VA 4DIQA 2O0YA 4J00A 3OYKA 3FK7A 2HVSA 1FBUA 1R36A 4XLPF 4UXNA 2L54A 3S17J 2JZYA 1QZYA 3S93A 2IS2A 5LHHA 1IGNA 1ZG3A 2MSYA 4KT5C 2QCOA 3FK6A 4QIWN 2RGVA 3QOEA 4G6TB 4XK4A 4HEA2 3QU3A 3ABLH 3KZYA 4LLNA 3I5UA 4KN4X 3MKYB 2UXXA 2M9HA 3CTAA 1L0OC 4XBFA 1M1EB 4HPQA 1J0RA 1GXQA 4E6KG 3A01B 4ESFA 3GVAA 1K79A 1HKTA 1ONVA 3PNVA 2CMPA 3OS2A 2EQRA 2LBFB 1KU7A 3HOSA 2A69F 1WZ2A 1X4PA 1NHAA 2VBYA 3KPHA 4IHSA 2MZ4A 4HQEA 1IC8A 1ZQ3P 1YS7A 2DA6A 2LOOA 2FF4A 3QWLA 1AKHB 2P5KA 2DAOA 5LHIA 3IH4A 3GLLA 1CF7A 3M07A 3KLNA 2EPFA 2H1LA 4CGZA 3E3VA 3LSHA 2RN7A 2DOAA 4B1RA 3MFKA 5FJ8J 2KDZA 1MJ9A 3OY9A 2JUCA 4HLYA 2QQ8A 2K40A 2LY1A 3HBLA 4YFKF 3PO3J 3LL7A 3BG3A 2RQQA 3OYNA 2EV6A 2KZGA 3BZ6A 3PSFA 2FNAA 1JHHA 4OAZA 3RIRA 2X6WA 2L7KA 3FBNB 1S7AA 1FYKA 1KONA 5L3BA 1HDPA 1NTCA 5HDNA 5DTDA 3RYRA 2E1CA 2NOGA 1MBGA 1VNDA 4ITVA 2ESHA 4UHTA 4L18B 1X1DA 4M3DA 2VJ4A 9ANTA 2BW3B 2K3PA 5KCMA 3QYFA 2BHYA 1OQYA 4P9UA 4GXOA 1D1BA 2R5ZB 1R1TA 4BS9A 2JN6A 4MO7A 1IDZA 2Y48A 2CW0F 5IPAA 3RPUA 1IXSB 2VBZA 2VQGA 5FO5A 2HQNA 2L7ZA 2M87A 2DTRA 3MKZA 1Y0NA 4N0BA 4B8XA 1QGPA 2TCTA 2BW3A 4IQJA 4XICA 3S1QJ 3LAJA 4I99C 4XRSA 5FLXR 1B9NA 4C3JJ 1T2KA 4F93B 3GO5A 1U5TA 3MKLA 3GUDA 4XRFA 4AD9A 3OIOA 2ZSHB 1V54H 1XS9A 5IT9K 1STZA 5D6EA 2EFPA 3TW7A 3VYRB 2ESNA 2ME0A 4L9NA 1RESA 3DU6A 3A1YA 2HQAA 3HTUA 3BPVA 5FLMJ 1QBJA 3ELKA 1V5EA 5JR3A 1IZ1A 1BIAA 5H6QA 4S04A 2DU9A 2K4BA 2DJNA 1TLHB 3F9KA 1W5TA 5DYMA 5L3DA 2CQKA 1X2NA 1OCZH 3K7AJ 1T0FC 3BZKA 5EEGA 3G4SI 1NK2P 4M3GA 3J7ZI 3BTLA 3KEQA 3WTYC 3I9V2 4OIOF 4MLOA 1VQKI 2PMHA 2W48A 1ZK8A 1V55H 3HKZA 1U6GA 3H36A 3MEXA 3K4MA 5H20A 2NS0A 5J1RA 1X3WB 2HGCA 2Z3YA 1R5GA 1SVOA 3QOPA 2J5OA 5D5VB 1JT6A 2X48A 3V8JA 3F6OA 3U1DA 3A0BC 2NNYA 3KYLA 2XPWA 1J59A 5J40A 1JE8A 1YX3A 4HAMA 4WF2A 1XX5A 3K4KA 5HLIA
chains in the Genus database with same CATH topology
4EM0B 4GGGA 3T0YA 2IW5A 4CICA 3IWZA 3L7WA 1V4RA 3DPLC 4AVPA 4ZYDA 2ZKZA 2A68F 1B6AA 3BP8A 3GW2A 2OQRA 1O57A 4EM1A 1VTNC 3K0LA 1KGSA 3ECOA 1W5SA 3GFIA 4HBLA 4P55A 4OINF 5F1RA 1BOAA 2V1UA 2YPRA 4L9JA 2M1BA 3GFLA 4I09A 3SZTA 1W4MA 3LWFA 3K9TA 5HDKA 1MD0A 5DUIA 4U0VA 1MDMB 3F8CA 2O03A 1R58A 2CG4A 2QZ8A 4KIGA 2Z99A 4A5MA 4QLCU 1I27A 1FP1D 2F5DA 1TNSA 1T38A 2FBKA 2XGXA 3CUOA 4M6YA 2OZUA 2VOOA 4EGYA 3WODF 1OYYA 1WRJA 2Q0OA 4U0YA 1O3QA 3I54A 1GVJA 4L9VA 4BXUA 4A6EA 2IA1A 3EYIA 1OKRA 3RYPA 1IN7A 1MZBA 4E70A 5AONA 3N97A 1IW7F 4R8HA 1HW2A 1G3SA 1IN4A 1HKQA 3WTWC 4BAYA 4Q5SF 3TQNA 2MH2A 4RS8A 3ZQ7A 3M9AA 2BE5F 2FA5A 1R7JA 2DLLA 4KIFA 4ASNA 2ZCWA 4IJAA 3TO6A 3DFGA 5E8IA 1U3EM 1PP8F 1IN6A 1Y0UA 4RGUA 3COAC 2VT2A 3PQJA 2H09A 3OOPA 3TGNA 1EH7A 3HOTA 4OIPF 4HX4A 4ETSA 3ABUA 3HRTA 2QBYA 1HSTA 2A6EF 2CWEA 3IRQA 4OIQF 2XRNA 3RJPA 2W25A 5L3FA 1LDKB 1SMYF 2LF7A 2WC2A 1T98A 2KKOA 5CVRA 4FX4A 1O3TA 2V79A 3V7RA 4ENNA 1R1VA 2VC1A 2VOPA 2FMYA 1DDNA 5LGUA 1I5ZA 2G9WA 3T5XA 4ZYGA 2VE9A 4H0EA 4JBAA 1K78B 5LHGA 2F5CA 1IXCA 2XV4S 4XSZF 3D5LA 1ODDA 5JI6A 2F5FA 1K78A 1RI7A 3O2PE 5ED4A 3FHZA 2NNNA 1J2XA 1S29A 1Z6RA 1ZGJA 4CXFA 1D5VA 2NAZA 1P2FA 2IRFG 4PGHA 2P5LC 2WV0A 2R3SA 3KP5A 1O3SA 3HYIA 5LGNA 1J9IA 2NYXA 2XUBA 5DDGA 3R4KA 3VODA 3WTTC 2JPBA 1KU9A 2O8XA 3E5UA 5JVTA 3IC7A 4I98B 4ON0A 1OR7A 2QWWA 4L0YB 2FMLA 3CLOA 1XSXA 3GYHX 2NRAC 4HDVA 1LVAA 3W6JB 4HV6A 1FSHA 5DUKA 1FBQA 2W57A 2UZKA 4GYGA 1FBSA 1LEBA 1YS6A 4N9IA 2QVOA 4HYEA 4HF2A 3LQQA 2QENA 1BI2A 4HW0A 4AWXB 5FLXZ 4UUVA 1BI1A 2ZJ2A 5BOXA 2HZTA 1ZRDA 4I0AA 5EEHA 2STTA 1W7PA 1LB2A 3BWGA 4BHPA 1IRGA 1U78A 2ZBKA 3DKWA 1Z05A 3HSFA 4U7DA 1BI0A 4YIIA 1SD4A 5F6FA 4Y13A 2FE3A 2GQQA 2JT1A 1TQIA 4UNOA 3GFJA 1PUEE 4GO1A 2IVMA 4P9FA 4IXAA 2YR2A 3RKXA 1FOKA 2BEOA 1BN5A 2V1XA 2XAFA 3IKTA 2A61A 3LA3A 4EJOA 3QP5A 3KEOA 1Z6TA 5HS8A 5FFXA 3L2CA 1PP7U 3E6BA 3GF2A 1TQPA 4CHUA 2ACJA 1P4WA 4LLLA 3IKVA 4HLXA 1XGMA 2KJBA 3KP7A 3C18A 3ML6A 3IWFA 2P8TA 2HTJA 1RIOH 1YW9A 2ZO4A 5H6RA 2P4WA 2HKXA 2R7FA 4UVBA 4CO8A 5DCMB 1R23A 1ZH5A 3FZVA 2JTVA 3GX4X 4Z2YA 2JRTA 2ZFWA 3CUQB 3C1DA 1Z7UA 1XGSA 5LRRA 3KLOA 2BV6A 2PEXA 4HDUA 2ZNYA 2UXNA 1ZRFA 1YIOA 1YYVA 4OMYA 2VN2A 3E6CC 2CSOA 2OAZA 1O7FA 4B09A 4MQVA 4NQWA 4MQ9F 2AXLA 1DUXC 4EV0A 1YO5C 2J5PA 3FMSA 2EV5A 5D8KB 5BS6A 2KRFA 3MZYA 1GXPA 6PAXA 1BJAA 3FMQA 3TO9A 4LJZF 2MBFA 4CZZA 2QQAA 2PQ8A 4JK1X 3C3WA 4WXHA 4I0BA 3LA7A 2B0LA 4RB2C 2GZWA 2BBYA 4ESBA 5CVUA 2FSWA 5AIPA 3V8KA 4LFUA 4M9ZA 4EMSA 3ROUA 1IF1A 5IT9Z 2HR3A 2CGPA 4MHGA 3GXOA 5J8FA 4XSXF 3L9FA 2A3SA 1W7PD 3DXJF 5HVQC 4Q4ZF 1J5YA 4L5IA 4A2UA 1U5TC 1D8JA 3Q9SA 3F22A 1XD7A 1O7LA 2X0LA 1UHMA 5CLSA 2PLYA 5CJ9A 1YW7A 3Q9VA 3MZHA 5D5UB 4GYIA 3QAHA 4AIJA 1XDUA 2H27A 1TTYA 4G7ZF 2XAHA 3T8RA 4G6QA 1SAXA 1REPC 4OMZA 3ISPA 1D8KA 2GXBA 5DV5A 1ZARA 4LLGF 1CF7B 3ECHA 1WI9A 3WTVC 3KP4A 1HQCA 1MJAA 3C7JA 4O6JA 4YFNF 1BM9A 3HRSA 5E8GA 1XMKA 1ZGAA 2XKOA 4KMUX 3ZMZA 4ZZLA 3HHGA 2D45A 5K5RA 1S8NA 4IHTA 5TRDA 3F8MA 2BYVE 1S7OA 3GWZA 2AS5F 2DQLA 4KMFA 4EJVA 1WWXA 2O3FA 4BNCA 3R0JA 4HQMA 4FHTA 4ZYHA 4LK1F 3TOBA 4HOBA 4A5NA 2VXZA 1JXSA 3O6BB 3HIFA 2LNBA 2DPDA 3I59B 3U2RA 3TKYA 4U88A 3JTGA 1XGOA 5IT3A 4UVAA 1ZN2A 2DFIA 1UCRA 3M8EA 4RGSA 3PQKA 5CVIA 2CFXA 2VBWA 2FNPA 1SMTA 3VFZA 1XDSA 3G3ZA 4MEYF 3CO6C 4RB3C 4LK0F 3WG9A 3QP6A 4M9XA 2PBIA 1HBXG 4ESJA 4Y17A 2L02A 4TV7A 4AIKA 3WTZA 3DPTA 1P4XA 3P7NA 2K02A 2E7XA 3HTSB 3CJNA 1H0MA 2HOEA 4PCQA 1SD6A 3EETA 4UV9A 3IRRA 1ZRCA 2X4HA 4BH9A 1G6NA 3ZMDA 2H94A 1KQ9A 5D6FA 5K5QA 1USTA 3WU0A 1QQIA 4LGWA 1RNLA 1ON1A 2RKHA 1JHFA 3FXUA 2XKPA 4KYWA 1B4AA 4QWQA 4ENKA 1BC7C 1F1ZA 4K2EA 5LRSA 5FLXK 3KETA 3IL2A 4LD5A 2DQRA 5E20A 4WXCA 3FM5A 1SFUA 3J7AO 2VT3A 1D3YA 2O6GE 5KK1A 1ZREA 3PFIA 3REOA 2EJRA 4KNYA 2MH9A 1P92A 4G94A 1T0FA 1MJBA 2M30A 3H3UA 3RPQA 1G3TA 3BJ6A 1LNWA 5A2QZ 2Y0MA 2VE8A 1EH6A 2LKPA 1AOYA 2GXGA 3R6SA 1V3FA 1ZYRF 2HWVA 5BPDA 5HS9A 2MLKA 4I2OA 1F5TA 1QPMA 4YIFA 1W7PB 3HSEA 3VB2A 2ZMEB 1BBYA 3G73A 1EV7A 1HW5A 1OPCA 3T1BA 2UWMA 3I64A 3MCZA 4O5VA 3BJAA 1F9NA 4DQ2A 2HQRA 2W85A 4M72A 2KIMA 2LF8A 3SFZA 3MWMA 3CUQA 1WQ2A 2IPQX 5CVJA 1FSEA 2MLGA 4ENJA 4HV5A 1EH8A 1E17A 3M1EA 2OZ6A 3I58A 3B73A 3B02A 3M8FA 2D2WA 2M45A 4PDKA 2DK8A 3NEUA 2QM3A 4KN7X 2HKOA 2FBHA 2DW4A 2FBIA 1LEAA 5HS7A 2JSCA 1XSDA 4IVNA 2L3DA 4M74A 5E1XA 5BQTA 3TDZC 5LEKA 1Z1DA 2L01A 4U0WA 2PN6A 2MA3A 4DNCA 4OU0A 2M8EA 1E2XA 2COMA 2EFNA 4WCGA 3Q5FA 3ZPLA 3V7CA 1WKMA 1JGSA 4EGZA 4BQAA 2XAGA 4R79A 3ZN1A 3WTUC 1IXRC 1S6LA 4RB0A 5FGMA 4OIRF 1ZG1A 5K1YA 2Q2EA 2EFQA 1DPRA 2XVCA 3WTXC 5DEQA 2HTSA 1FZPB 3F8NA 2KIUA 1FPQA 4LMYA 5F64A 2ZXJA 2KJCA 3E6MA 2ZNZA 3JW4A 4A12A 5L3CA 5L3EA 3HRMA 4FX0A 4P5OA 5ERIA 1ON2A 4Q48A 1KA8A 2EFWA 2G7HA 3DF8A 1I1GA 2QLZA 1BC8C 5D8LB 5J8CA 4EVIA 4MNUA 4EJTA 4IPAA 3GZ5A 3M7GA 2V9VA 2H6CA 3HUGA 4Q47A 3TO7A 3I53A 1FY7A 1SFXA 3BDDA 4KDPA 2EV0A 3EUHA 3RTRA 3V7SA 2FQ3A 3K1PA 2CO5A 4HF0A 1U2WA 4A0XA 1XCBA 5CYVA 2FOKA 3KE2A 3T8TA 1MGTA 5ICCA 4Y15A 2M5WA 1HXDA 3P9IA 2DPUA 2OBPA 2A6HF 3FMRA 2EA4A 3WGGA 5D4RA 4D0PA 1OYWA 5HLHA 3RI4A 1PDNC 4KFCA 1YFHA 3I0TA 4BYYA 4PZJA 1QZZA 1F4KA 3ERED 1K7AA 4I7HA 3GLXA 4N9HA 5KVRA 3F8FA 3JSPA 4A6DA 4UVCA 2DK5A 2EK5A 2V6CA 3FF5A 2RNJA 3FWEA 5FFZA 4M6XA 3J81Z 1B1BA 1XCVA 2K86A 2RVCA 3GZ6A 3WE2A 4IRIA 2G7UA 1C0WA 3VOEA 2E7WA 1UHWA 1TNTA 3U9GA 3FX3A 1IUYA 4IF4A 2HYFA 1H9GA 3BOQA 1QO0D 5LGTA 1ULYA 2V1DA 1L3LA 1WSUA 1Q1HA 5E1ZB 1P4AA 3R61A 4EJUA 1YW8A 5HLGA 1MKMA 1J75A 1RZ4A 4A0ZA 3JAMZ 5ILUA 3L00A 3WGHA 2STWA 2L4MA 4M71A 4RB1A 2WWYA 3H92A 3BJOA 3ZMVA 2OQGA 3TOAA 5FD5A 1T6SA 3TDUC 2PI0A 5J6XA 1FWZA 5D4SA 3DP7A 3P9KA 2LDUA 4LB5A 3HRUA 3F23A 4MTEA 3KZZA 2YU3A 2YX4A 4LG0A 3F72A 2GWRA 5TJJA 1K6OA 5FB2A 4YG2F 4YFXF 4ENMA 2ISZA 3E97A 3JTHA 4FT8A 1YG2A 1TBXA 2GA2A 1FYLA 2OD5A 2GIVA 2D1HA 1FP2A 1IAWA 4KIBA 3NRVA 4RGXA 3ZMUA 2HFHA 2XHKA 5E1WA 3QRFF 4BHBA 4EJWA 3O3KA 1LQ1A 3OV8A 1IN5A 3SXYA 2EA2A 3LAPA 1FNNA 2OA4A 1RUOA 2IJLA 3JAMK 1R22A 5FD6A 3LQRA 2QYOA 2W84A 4KUMA 2A5YB 4WWCA 2CYYA 1XB4A 3KP6A 3IHUA 4RAYA 3NQOA 4HF1A 5DCFA 3S2WA 5A2QK 1FC3A 2P5VA 3ZN0A 2F2EA 5E17F 2ETHA 5HDGA 3GEZA 1CGPA 1ZLKA 2Z33A 5K5OA 3WTSC 3E5XA 1G3YA 1MDMA 1TW2A 3N4MA 4A0YA 3QPHA 5JFRA 2XIGA 1ZG5A 4O3MA 2DO7A 1KYZA 3W6KB 4LB6B 2A07F 4RAZA 4LG0B 4HX8A 5BPIA 4P96A 3GFMA 5CVVA 4F7ZA 2EFOA 2DI3A 2ELHA 3WGIA 4NHJA 1GHCA 5E18F 3I4PA 4NB5A 3EYYA 4KICA 3LSTA 2MC3A 2RV8A 2PJPA 3WE3A 3ZP5A 3F21A 1XMAA 2EB7A 2OU2A 2EWNA 4G7OF 2P6SA 2H6BA 2VONA 1KQ8A 3SHFA 1DPUA 1UB9A 5D5WB 4G8XA 5ILVA 1B9MA 3MAJA 4ZH4F 1ZLJA 1FT9A 4PGGA 2GAUA 4HA8A 3F3XA 3SQNA 1AWCA 1FLIA 4S05A 3RDIA 3DQVC 2GA1A 2D1VA 4L5JA 2RDPA 1B59A 4L0ZB 2QBYB 1HW1A 2R7DA 2F5EA 3F8BA 5L3GA 3DEUA 1I1SA 2YSRA 4M73A 5ICGA 1LDDA 3R60A 3ZMTA 3FM3A 3SZPA 1YTYA 1XSVA 3HSRA 3K1MA 3L09A 3CO7C 1HSJA 3K69A 2FU4A 1O3RA 1R1UA 5DD8A 3HHHA 4ZZDA 1KU2A 4KA4A 5ICEA 3K2ZA 3EQLF 4G9YA 1R00A 2VODA 1SD7A 2ISYA 1DP7P 1BI3A 2BGCA 3BY6A 1G4DA 3QU6A 2PFBA 1OMIA 1U5TB 3LFKA 4ZYEA 2ZMEA 3F6VA 4HZFA 2Q8KA 4RGRA 1UFMA 4L9TA 2IT0A 2IA0A 4BHCA 1X3UA 4WXDA 1IRFA 4CYDA 1Z91A 3VEPA 2IA2A 3JSOA 2LSOA 3D0SA 5ILSA 3ZMSA 4M9SA 5DCMA 3K1NA 2HEOA 2XAQA 1J7KA 3MQ0A 2MD5A 5DD4A 2O61A 4EQQA 3EDPA 2XASA 1LDJA 4MTDA 1S3JA 4JQFA 3WU1B 2QQ9A 3FXQA 5BMZA 1KYWA 1U8RA 1OYIA 2RC4A 1XN7A 5LEJA 5HOOA 4MEXF 4OOIA 5AIQA 4IRHA 2XAJA 3J81K 1KU3A 2DT5A 4EM2A 2IP2A 4CDGA 2Z9OA 4UV8A 1I6XA 2Z5UA 3CUQC 2L4AA 4R1HA 4AIHA 1TW3A 1XGNA 4I01A 5JHUA 3BROA 1BIBA 3I71A 2DBBA 2P7CB 2FRHA 3E5QA 3KP3A 2XROA 1LJ9A 1KQ0A 3R0AA 4G7HF 2FXAA 3ABTA 2Y75A 2K7LA 2QUFA 3V8LA 1IN8A 4GCVA 2VBXA 2HS5A 2E1NA 5LBQA 2C6YA 1RUNA 3KFWX 3E6DA 4WK8F 2RQPA 2QQBA 5D5XB 1FX7A 3RKWA 1ZAOA 1FYMA 2TDXA 3FXRA 3DV8A 2JPCA 3KCCA 1HKSA 2FEZA 1R5HA 4U7BA 2PMUA 1A04A 3V4GA 2P7VB 5LLQA 4IRGA 1SFEA 3RKYA 3LA2A 1SD5A 3AAFA 1USSA 3QPTA 3CDHA 2W24A 3ULQB 1ZHFA 2PG4A 3I59A 2K27A 2K4JA 4WX9A 3P9CA 3H3ZA 3J80K 1TQMA 2KIFA 4I02A 3BPXA 2HYGD 5ICFA 1G3WA 1T39A 1H9TA 4XLNF 4G6DA 1YQAA 1Z9CA 1QNTA 2YX7A 2ADUA 4MGRA 1P6RA 3KP2A 3J80Z 2WTEA 1YLFA 2VC0A 2P6TA 4HX7A 2HDCA 2O0YA 1FBUA 1R36A 4XLPF 4UXNA 2L54A 2JZYA 1QZYA 5LHHA 1ZG3A 4KT5C 2RGVA 3QU3A 3KZYA 4LLNA 3I5UA 4KN4X 2UXXA 3CTAA 1L0OC 4XBFA 1J0RA 1GXQA 4ESFA 3GVAA 1K79A 1HKTA 1ONVA 1KU7A 3HOSA 2A69F 4IHSA 1NHAA 2VBYA 4HQEA 1YS7A 2FF4A 2P5KA 2DAOA 5LHIA 1CF7A 3KLNA 4CGZA 3E3VA 2RN7A 3MFKA 1MJ9A 4HLYA 4YFKF 2EV6A 3BZ6A 2FNAA 1JHHA 3RIRA 1S7AA 1FYKA 5L3BA 5HDNA 3RYRA 2E1CA 4UHTA 4L18B 2ESHA 4P9UA 4GXOA 1R1TA 2Y48A 2CW0F 3RPUA 1IXSB 2VBZA 5FO5A 2HQNA 2M87A 2DTRA 4N0BA 4B8XA 1QGPA 3LAJA 1B9NA 1T2KA 3GO5A 1U5TA 3GUDA 4XRFA 4AD9A 5IT9K 1STZA 5D6EA 2EFPA 2ESNA 4L9NA 3HTUA 3BPVA 1QBJA 3ELKA 5JR3A 1IZ1A 1BIAA 5H6QA 4S04A 2DU9A 2K4BA 1TLHB 5DYMA 1W5TA 5L3DA 2CQKA 5EEGA 3KEQA 3WTYC 4OIOF 2PMHA 1U6GA 3MEXA 5H20A 2NS0A 2HGCA 2Z3YA 1R5GA 3QOPA 5D5VB 2J5OA 3V8JA 3F6OA 3U1DA 2NNYA 1J59A 1JE8A 4HAMA 4WF2A 5HLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM0 B;  4GGG A;  3T0Y A;  2IW5 A;  4CIC A;  3IWZ A;  3L7W A;  1V4R A;  3DPL C;  4AVP A;  4ZYD A;  2ZKZ A;  2A68 F;  1B6A A;  3BP8 A;  3GW2 A;  2OQR A;  1O57 A;  4EM1 A;  1VTN C;  3K0L A;  1KGS A;  3ECO A;  1W5S A;  3GFI A;  4HBL A;  4P55 A;  4OIN F;  5F1R A;  1BOA A;  2V1U A;  2YPR A;  4L9J A;  2M1B A;  3GFL A;  4I09 A;  3SZT A;  1W4M A;  3LWF A;  3K9T A;  5HDK A;  1MD0 A;  5DUI A;  4U0V A;  1MDM B;  3F8C A;  2O03 A;  1R58 A;  2CG4 A;  2QZ8 A;  4KIG A;  2Z99 A;  4A5M A;  4QLC U;  1I27 A;  1FP1 D;  2F5D A;  1TNS A;  1T38 A;  2FBK A;  2XGX A;  3CUO A;  4M6Y A;  2OZU A;  2VOO A;  4EGY A;  3WOD F;  1OYY A;  1WRJ A;  2Q0O A;  4U0Y A;  1O3Q A;  3I54 A;  1GVJ A;  4L9V A;  4BXU A;  4A6E A;  2IA1 A;  3EYI A;  1OKR A;  3RYP A;  1IN7 A;  1MZB A;  4E70 A;  5AON A;  3N97 A;  1IW7 F;  4R8H A;  1HW2 A;  1G3S A;  1IN4 A;  1HKQ A;  3WTW C;  4BAY A;  4Q5S F;  3TQN A;  2MH2 A;  4RS8 A;  3ZQ7 A;  3M9A A;  2BE5 F;  2FA5 A;  1R7J A;  2DLL A;  4KIF A;  4ASN A;  2ZCW A;  4IJA A;  3TO6 A;  3DFG A;  5E8I A;  1U3E M;  1PP8 F;  1IN6 A;  1Y0U A;  4RGU A;  3COA C;  2VT2 A;  3PQJ A;  2H09 A;  3OOP A;  3TGN A;  1EH7 A;  3HOT A;  4OIP F;  4HX4 A;  4ETS A;  3ABU A;  3HRT A;  2QBY A;  1HST A;  2A6E F;  2CWE A;  3IRQ A;  4OIQ F;  2XRN A;  3RJP A;  2W25 A;  5L3F A;  1LDK B;  1SMY F;  2LF7 A;  2WC2 A;  1T98 A;  2KKO A;  5CVR A;  4FX4 A;  1O3T A;  2V79 A;  3V7R A;  4ENN A;  1R1V A;  2VC1 A;  2VOP A;  2FMY A;  1DDN A;  5LGU A;  1I5Z A;  2G9W A;  3T5X A;  4ZYG A;  2VE9 A;  4H0E A;  4JBA A;  1K78 B;  5LHG A;  2F5C A;  1IXC A;  2XV4 S;  4XSZ F;  3D5L A;  1ODD A;  5JI6 A;  2F5F A;  1K78 A;  1RI7 A;  3O2P E;  5ED4 A;  3FHZ A;  2NNN A;  1J2X A;  1S29 A;  1Z6R A;  1ZGJ A;  4CXF A;  1D5V A;  2NAZ A;  1P2F A;  2IRF G;  4PGH A;  2P5L C;  2WV0 A;  2R3S A;  3KP5 A;  1O3S A;  3HYI A;  5LGN A;  1J9I A;  2NYX A;  2XUB A;  5DDG A;  3R4K A;  3VOD A;  3WTT C;  2JPB A;  1KU9 A;  2O8X A;  3E5U A;  5JVT A;  3IC7 A;  4I98 B;  4ON0 A;  1OR7 A;  2QWW A;  4L0Y B;  2FML A;  3CLO A;  1XSX A;  3GYH X;  2NRA C;  4HDV A;  1LVA A;  3W6J B;  4HV6 A;  1FSH A;  5DUK A;  1FBQ A;  2W57 A;  2UZK A;  4GYG A;  1FBS A;  1LEB A;  1YS6 A;  4N9I A;  2QVO A;  4HYE A;  4HF2 A;  3LQQ A;  2QEN A;  1BI2 A;  4HW0 A;  4AWX B;  5FLX Z;  4UUV A;  1BI1 A;  2ZJ2 A;  5BOX A;  2HZT A;  1ZRD A;  4I0A A;  5EEH A;  2STT A;  1W7P A;  1LB2 A;  3BWG A;  4BHP A;  1IRG A;  1U78 A;  2ZBK A;  3DKW A;  1Z05 A;  3HSF A;  4U7D A;  1BI0 A;  4YII A;  1SD4 A;  5F6F A;  4Y13 A;  2FE3 A;  2GQQ A;  2JT1 A;  1TQI A;  4UNO A;  3GFJ A;  1PUE E;  4GO1 A;  2IVM A;  4P9F A;  4IXA A;  2YR2 A;  3RKX A;  1FOK A;  2BEO A;  1BN5 A;  2V1X A;  2XAF A;  3IKT A;  2A61 A;  3LA3 A;  4EJO A;  3QP5 A;  3KEO A;  1Z6T A;  5HS8 A;  5FFX A;  3L2C A;  1PP7 U;  3E6B A;  3GF2 A;  1TQP A;  4CHU A;  2ACJ A;  1P4W A;  4LLL A;  3IKV A;  4HLX A;  1XGM A;  2KJB A;  3KP7 A;  3C18 A;  3ML6 A;  3IWF A;  2P8T A;  2HTJ A;  1RIO H;  1YW9 A;  2ZO4 A;  5H6R A;  2P4W A;  2HKX A;  2R7F A;  4UVB A;  4CO8 A;  5DCM B;  1R23 A;  1ZH5 A;  3FZV A;  2JTV A;  3GX4 X;  4Z2Y A;  2JRT A;  2ZFW A;  3CUQ B;  3C1D A;  1Z7U A;  1XGS A;  5LRR A;  3KLO A;  2BV6 A;  2PEX A;  4HDU A;  2ZNY A;  2UXN A;  1ZRF A;  1YIO A;  1YYV A;  4OMY A;  2VN2 A;  3E6C C;  2CSO A;  2OAZ A;  1O7F A;  4B09 A;  4MQV A;  4NQW A;  4MQ9 F;  2AXL A;  1DUX C;  4EV0 A;  1YO5 C;  2J5P A;  3FMS A;  2EV5 A;  5D8K B;  5BS6 A;  2KRF A;  3MZY A;  1GXP A;  6PAX A;  1BJA A;  3FMQ A;  3TO9 A;  4LJZ F;  2MBF A;  4CZZ A;  2QQA A;  2PQ8 A;  4JK1 X;  3C3W A;  4WXH A;  4I0B A;  3LA7 A;  2B0L A;  4RB2 C;  2GZW A;  2BBY A;  4ESB A;  5CVU A;  2FSW A;  5AIP A;  3V8K A;  4LFU A;  4M9Z A;  4EMS A;  3ROU A;  1IF1 A;  5IT9 Z;  2HR3 A;  2CGP A;  4MHG A;  3GXO A;  5J8F A;  4XSX F;  3L9F A;  2A3S A;  1W7P D;  3DXJ F;  5HVQ C;  4Q4Z F;  1J5Y A;  4L5I A;  4A2U A;  1U5T C;  1D8J A;  3Q9S A;  3F22 A;  1XD7 A;  1O7L A;  2X0L A;  1UHM A;  5CLS A;  2PLY A;  5CJ9 A;  1YW7 A;  3Q9V A;  3MZH A;  5D5U B;  4GYI A;  3QAH A;  4AIJ A;  1XDU A;  2H27 A;  1TTY A;  4G7Z F;  2XAH A;  3T8R A;  4G6Q A;  1SAX A;  1REP C;  4OMZ A;  3ISP A;  1D8K A;  2GXB A;  5DV5 A;  1ZAR A;  4LLG F;  1CF7 B;  3ECH A;  1WI9 A;  3WTV C;  3KP4 A;  1HQC A;  1MJA A;  3C7J A;  4O6J A;  4YFN F;  1BM9 A;  3HRS A;  5E8G A;  1XMK A;  1ZGA A;  2XKO A;  4KMU X;  3ZMZ A;  4ZZL A;  3HHG A;  2D45 A;  5K5R A;  1S8N A;  4IHT A;  5TRD A;  3F8M A;  2BYV E;  1S7O A;  3GWZ A;  2AS5 F;  2DQL A;  4KMF A;  4EJV A;  1WWX A;  2O3F A;  4BNC A;  3R0J A;  4HQM A;  4FHT A;  4ZYH A;  4LK1 F;  3TOB A;  4HOB A;  4A5N A;  2VXZ A;  1JXS A;  3O6B B;  3HIF A;  2LNB A;  2DPD A;  3I59 B;  3U2R A;  3TKY A;  4U88 A;  3JTG A;  1XGO A;  5IT3 A;  4UVA A;  1ZN2 A;  2DFI A;  1UCR A;  3M8E A;  4RGS A;  3PQK A;  5CVI A;  2CFX A;  2VBW A;  2FNP A;  1SMT A;  3VFZ A;  1XDS A;  3G3Z A;  4MEY F;  3CO6 C;  4RB3 C;  4LK0 F;  3WG9 A;  3QP6 A;  4M9X A;  2PBI A;  1HBX G;  4ESJ A;  4Y17 A;  2L02 A;  4TV7 A;  4AIK A;  3WTZ A;  3DPT A;  1P4X A;  3P7N A;  2K02 A;  2E7X A;  3HTS B;  3CJN A;  1H0M A;  2HOE A;  4PCQ A;  1SD6 A;  3EET A;  4UV9 A;  3IRR A;  1ZRC A;  2X4H A;  4BH9 A;  1G6N A;  3ZMD A;  2H94 A;  1KQ9 A;  5D6F A;  5K5Q A;  1UST A;  3WU0 A;  1QQI A;  4LGW A;  1RNL A;  1ON1 A;  2RKH A;  1JHF A;  3FXU A;  2XKP A;  4KYW A;  1B4A A;  4QWQ A;  4ENK A;  1BC7 C;  1F1Z A;  4K2E A;  5LRS A;  5FLX K;  3KET A;  3IL2 A;  4LD5 A;  2DQR A;  5E20 A;  4WXC A;  3FM5 A;  1SFU A;  3J7A O;  2VT3 A;  1D3Y A;  2O6G E;  5KK1 A;  1ZRE A;  3PFI A;  3REO A;  2EJR A;  4KNY A;  2MH9 A;  1P92 A;  4G94 A;  1T0F A;  1MJB A;  2M30 A;  3H3U A;  3RPQ A;  1G3T A;  3BJ6 A;  1LNW A;  5A2Q Z;  2Y0M A;  2VE8 A;  1EH6 A;  2LKP A;  1AOY A;  2GXG A;  3R6S A;  1V3F A;  1ZYR F;  2HWV A;  5BPD A;  5HS9 A;  2MLK A;  4I2O A;  1F5T A;  1QPM A;  4YIF A;  1W7P B;  3HSE A;  3VB2 A;  2ZME B;  1BBY A;  3G73 A;  1EV7 A;  1HW5 A;  1OPC A;  3T1B A;  2UWM A;  3I64 A;  3MCZ A;  4O5V A;  3BJA A;  1F9N A;  4DQ2 A;  2HQR A;  2W85 A;  4M72 A;  2KIM A;  2LF8 A;  3SFZ A;  3MWM A;  3CUQ A;  1WQ2 A;  2IPQ X;  5CVJ A;  1FSE A;  2MLG A;  4ENJ A;  4HV5 A;  1EH8 A;  1E17 A;  3M1E A;  2OZ6 A;  3I58 A;  3B73 A;  3B02 A;  3M8F A;  2D2W A;  2M45 A;  4PDK A;  2DK8 A;  3NEU A;  2QM3 A;  4KN7 X;  2HKO A;  2FBH A;  2DW4 A;  2FBI A;  1LEA A;  5HS7 A;  2JSC A;  1XSD A;  4IVN A;  2L3D A;  4M74 A;  5E1X A;  5BQT A;  3TDZ C;  5LEK A;  1Z1D A;  2L01 A;  4U0W A;  2PN6 A;  2MA3 A;  4DNC A;  4OU0 A;  2M8E A;  1E2X A;  2COM A;  2EFN A;  4WCG A;  3Q5F A;  3ZPL A;  3V7C A;  1WKM A;  1JGS A;  4EGZ A;  4BQA A;  2XAG A;  4R79 A;  3ZN1 A;  3WTU C;  1IXR C;  1S6L A;  4RB0 A;  5FGM A;  4OIR F;  1ZG1 A;  5K1Y A;  2Q2E A;  2EFQ A;  1DPR A;  2XVC A;  3WTX C;  5DEQ A;  2HTS A;  1FZP B;  3F8N A;  2KIU A;  1FPQ A;  4LMY A;  5F64 A;  2ZXJ A;  2KJC A;  3E6M A;  2ZNZ A;  3JW4 A;  4A12 A;  5L3C A;  5L3E A;  3HRM A;  4FX0 A;  4P5O A;  5ERI A;  1ON2 A;  4Q48 A;  1KA8 A;  2EFW A;  2G7H A;  3DF8 A;  1I1G A;  2QLZ A;  1BC8 C;  5D8L B;  5J8C A;  4EVI A;  4MNU A;  4EJT A;  4IPA A;  3GZ5 A;  3M7G A;  2V9V A;  2H6C A;  3HUG A;  4Q47 A;  3TO7 A;  3I53 A;  1FY7 A;  1SFX A;  3BDD A;  4KDP A;  2EV0 A;  3EUH A;  3RTR A;  3V7S A;  2FQ3 A;  3K1P A;  2CO5 A;  4HF0 A;  1U2W A;  4A0X A;  1XCB A;  5CYV A;  2FOK A;  3KE2 A;  3T8T A;  1MGT A;  5ICC A;  4Y15 A;  2M5W A;  1HXD A;  3P9I A;  2DPU A;  2OBP A;  2A6H F;  3FMR A;  2EA4 A;  3WGG A;  5D4R A;  4D0P A;  1OYW A;  5HLH A;  3RI4 A;  1PDN C;  4KFC A;  1YFH A;  3I0T A;  4BYY A;  4PZJ A;  1QZZ A;  1F4K A;  3ERE D;  1K7A A;  4I7H A;  3GLX A;  4N9H A;  5KVR A;  3F8F A;  3JSP A;  4A6D A;  4UVC A;  2DK5 A;  2EK5 A;  2V6C A;  3FF5 A;  2RNJ A;  3FWE A;  5FFZ A;  4M6X A;  3J81 Z;  1B1B A;  1XCV A;  2K86 A;  2RVC A;  3GZ6 A;  3WE2 A;  4IRI A;  2G7U A;  1C0W A;  3VOE A;  2E7W A;  1UHW A;  1TNT A;  3U9G A;  3FX3 A;  1IUY A;  4IF4 A;  2HYF A;  1H9G A;  3BOQ A;  1QO0 D;  5LGT A;  1ULY A;  2V1D A;  1L3L A;  1WSU A;  1Q1H A;  5E1Z B;  1P4A A;  3R61 A;  4EJU A;  1YW8 A;  5HLG A;  1MKM A;  1J75 A;  1RZ4 A;  4A0Z A;  3JAM Z;  5ILU A;  3L00 A;  3WGH A;  2STW A;  2L4M A;  4M71 A;  4RB1 A;  2WWY A;  3H92 A;  3BJO A;  3ZMV A;  2OQG A;  3TOA A;  5FD5 A;  1T6S A;  3TDU C;  2PI0 A;  5J6X A;  1FWZ A;  5D4S A;  3DP7 A;  3P9K A;  2LDU A;  4LB5 A;  3HRU A;  3F23 A;  4MTE A;  3KZZ A;  2YU3 A;  2YX4 A;  4LG0 A;  3F72 A;  2GWR A;  5TJJ A;  1K6O A;  5FB2 A;  4YG2 F;  4YFX F;  4ENM A;  2ISZ A;  3E97 A;  3JTH A;  4FT8 A;  1YG2 A;  1TBX A;  2GA2 A;  1FYL A;  2OD5 A;  2GIV A;  2D1H A;  1FP2 A;  1IAW A;  4KIB A;  3NRV A;  4RGX A;  3ZMU A;  2HFH A;  2XHK A;  5E1W A;  3QRF F;  4BHB A;  4EJW A;  3O3K A;  1LQ1 A;  3OV8 A;  1IN5 A;  3SXY A;  2EA2 A;  3LAP A;  1FNN A;  2OA4 A;  1RUO A;  2IJL A;  3JAM K;  1R22 A;  5FD6 A;  3LQR A;  2QYO A;  2W84 A;  4KUM A;  2A5Y B;  4WWC A;  2CYY A;  1XB4 A;  3KP6 A;  3IHU A;  4RAY A;  3NQO A;  4HF1 A;  5DCF A;  3S2W A;  5A2Q K;  1FC3 A;  2P5V A;  3ZN0 A;  2F2E A;  5E17 F;  2ETH A;  5HDG A;  3GEZ A;  1CGP A;  1ZLK A;  2Z33 A;  5K5O A;  3WTS C;  3E5X A;  1G3Y A;  1MDM A;  1TW2 A;  3N4M A;  4A0Y A;  3QPH A;  5JFR A;  2XIG A;  1ZG5 A;  4O3M A;  2DO7 A;  1KYZ A;  3W6K B;  4LB6 B;  2A07 F;  4RAZ A;  4LG0 B;  4HX8 A;  5BPI A;  4P96 A;  3GFM A;  5CVV A;  4F7Z A;  2EFO A;  2DI3 A;  2ELH A;  3WGI A;  4NHJ A;  1GHC A;  5E18 F;  3I4P A;  4NB5 A;  3EYY A;  4KIC A;  3LST A;  2MC3 A;  2RV8 A;  2PJP A;  3WE3 A;  3ZP5 A;  3F21 A;  1XMA A;  2EB7 A;  2OU2 A;  2EWN A;  4G7O F;  2P6S A;  2H6B A;  2VON A;  1KQ8 A;  3SHF A;  1DPU A;  1UB9 A;  5D5W B;  4G8X A;  5ILV A;  1B9M A;  3MAJ A;  4ZH4 F;  1ZLJ A;  1FT9 A;  4PGG A;  2GAU A;  4HA8 A;  3F3X A;  3SQN A;  1AWC A;  1FLI A;  4S05 A;  3RDI A;  3DQV C;  2GA1 A;  2D1V A;  4L5J A;  2RDP A;  1B59 A;  4L0Z B;  2QBY B;  1HW1 A;  2R7D A;  2F5E A;  3F8B A;  5L3G A;  3DEU A;  1I1S A;  2YSR A;  4M73 A;  5ICG A;  1LDD A;  3R60 A;  3ZMT A;  3FM3 A;  3SZP A;  1YTY A;  1XSV A;  3HSR A;  3K1M A;  3L09 A;  3CO7 C;  1HSJ A;  3K69 A;  2FU4 A;  1O3R A;  1R1U A;  5DD8 A;  3HHH A;  4ZZD A;  1KU2 A;  4KA4 A;  5ICE A;  3K2Z A;  3EQL F;  4G9Y A;  1R00 A;  2VOD A;  1SD7 A;  2ISY A;  1DP7 P;  1BI3 A;  2BGC A;  3BY6 A;  1G4D A;  3QU6 A;  2PFB A;  1OMI A;  1U5T B;  3LFK A;  4ZYE A;  2ZME A;  3F6V A;  4HZF A;  2Q8K A;  4RGR A;  1UFM A;  4L9T A;  2IT0 A;  2IA0 A;  4BHC A;  1X3U A;  4WXD A;  1IRF A;  4CYD A;  1Z91 A;  3VEP A;  2IA2 A;  3JSO A;  2LSO A;  3D0S A;  5ILS A;  3ZMS A;  4M9S A;  5DCM A;  3K1N A;  2HEO A;  2XAQ A;  1J7K A;  3MQ0 A;  2MD5 A;  5DD4 A;  2O61 A;  4EQQ A;  3EDP A;  2XAS A;  1LDJ A;  4MTD A;  1S3J A;  4JQF A;  3WU1 B;  2QQ9 A;  3FXQ A;  5BMZ A;  1KYW A;  1U8R A;  1OYI A;  2RC4 A;  1XN7 A;  5LEJ A;  5HOO A;  4MEX F;  4OOI A;  5AIQ A;  4IRH A;  2XAJ A;  3J81 K;  1KU3 A;  2DT5 A;  4EM2 A;  2IP2 A;  4CDG A;  2Z9O A;  4UV8 A;  1I6X A;  2Z5U A;  3CUQ C;  2L4A A;  4R1H A;  4AIH A;  1TW3 A;  1XGN A;  4I01 A;  5JHU A;  3BRO A;  1BIB A;  3I71 A;  2DBB A;  2P7C B;  2FRH A;  3E5Q A;  3KP3 A;  2XRO A;  1LJ9 A;  1KQ0 A;  3R0A A;  4G7H F;  2FXA A;  3ABT A;  2Y75 A;  2K7L A;  2QUF A;  3V8L A;  1IN8 A;  4GCV A;  2VBX A;  2HS5 A;  2E1N A;  5LBQ A;  2C6Y A;  1RUN A;  3KFW X;  3E6D A;  4WK8 F;  2RQP A;  2QQB A;  5D5X B;  1FX7 A;  3RKW A;  1ZAO A;  1FYM A;  2TDX A;  3FXR A;  3DV8 A;  2JPC A;  3KCC A;  1HKS A;  2FEZ A;  1R5H A;  4U7B A;  2PMU A;  1A04 A;  3V4G A;  2P7V B;  5LLQ A;  4IRG A;  1SFE A;  3RKY A;  3LA2 A;  1SD5 A;  3AAF A;  1USS A;  3QPT A;  3CDH A;  2W24 A;  3ULQ B;  1ZHF A;  2PG4 A;  3I59 A;  2K27 A;  2K4J A;  4WX9 A;  3P9C A;  3H3Z A;  3J80 K;  1TQM A;  2KIF A;  4I02 A;  3BPX A;  2HYG D;  5ICF A;  1G3W A;  1T39 A;  1H9T A;  4XLN F;  4G6D A;  1YQA A;  1Z9C A;  1QNT A;  2YX7 A;  2ADU A;  4MGR A;  1P6R A;  3KP2 A;  3J80 Z;  2WTE A;  1YLF A;  2VC0 A;  2P6T A;  4HX7 A;  2HDC A;  2O0Y A;  1FBU A;  1R36 A;  4XLP F;  4UXN A;  2L54 A;  2JZY A;  1QZY A;  5LHH A;  1ZG3 A;  4KT5 C;  2RGV A;  3QU3 A;  3KZY A;  4LLN A;  3I5U A;  4KN4 X;  2UXX A;  3CTA A;  1L0O C;  4XBF A;  1J0R A;  1GXQ A;  4ESF A;  3GVA A;  1K79 A;  1HKT A;  1ONV A;  1KU7 A;  3HOS A;  2A69 F;  4IHS A;  1NHA A;  2VBY A;  4HQE A;  1YS7 A;  2FF4 A;  2P5K A;  2DAO A;  5LHI A;  1CF7 A;  3KLN A;  4CGZ A;  3E3V A;  2RN7 A;  3MFK A;  1MJ9 A;  4HLY A;  4YFK F;  2EV6 A;  3BZ6 A;  2FNA A;  1JHH A;  3RIR A;  1S7A A;  1FYK A;  5L3B A;  5HDN A;  3RYR A;  2E1C A;  4UHT A;  4L18 B;  2ESH A;  4P9U A;  4GXO A;  1R1T A;  2Y48 A;  2CW0 F;  3RPU A;  1IXS B;  2VBZ A;  5FO5 A;  2HQN A;  2M87 A;  2DTR A;  4N0B A;  4B8X A;  1QGP A;  3LAJ A;  1B9N A;  1T2K A;  3GO5 A;  1U5T A;  3GUD A;  4XRF A;  4AD9 A;  5IT9 K;  1STZ A;  5D6E A;  2EFP A;  2ESN A;  4L9N A;  3HTU A;  3BPV A;  1QBJ A;  3ELK A;  5JR3 A;  1IZ1 A;  1BIA A;  5H6Q A;  4S04 A;  2DU9 A;  2K4B A;  1TLH B;  5DYM A;  1W5T A;  5L3D A;  2CQK A;  5EEG A;  3KEQ A;  3WTY C;  4OIO F;  2PMH A;  1U6G A;  3MEX A;  5H20 A;  2NS0 A;  2HGC A;  2Z3Y A;  1R5G A;  3QOP A;  5D5V B;  2J5O A;  3V8J A;  3F6O A;  3U1D A;  2NNY A;  1J59 A;  1JE8 A;  4HAM A;  4WF2 A;  5HLI A; 
#chains in the Genus database with same CATH topology
 4XOP A;  4EM0 B;  4GGG A;  3T0Y A;  2IW5 A;  4CIC A;  1A6Q A;  3IWZ A;  4PFP A;  3L7W A;  1V4R A;  2MGQ A;  4E4H A;  4EAT A;  4DBQ A;  1FJL A;  3DPL C;  4AVP A;  2M4G A;  1JJ8 C;  2XF7 A;  4ZYD A;  2ZKZ A;  2K9Q A;  1MIJ A;  2Y30 A;  3PJR A;  2A68 F;  1B6A A;  2CH0 A;  3OYA A;  3BP8 A;  1DGW Y;  2OQR A;  3GW2 A;  2F4O B;  1O57 A;  4BXX J;  1MW7 A;  4EM1 A;  1VTN C;  2CUE A;  5IY5 H;  2DFH A;  1Y56 A;  5E79 C;  2KL4 A;  5KNL A;  3S1M J;  3K0L A;  1KGS A;  2K9M A;  2ID3 A;  3ECO A;  1W5S A;  3GFI A;  4HBL A;  2E19 A;  4P55 A;  4OIN F;  5F1R A;  3DBR B;  2R0Q C;  1QHH D;  2LY2 A;  1BOA A;  2V1U A;  1ETY A;  2JWT A;  2HVQ A;  2K85 A;  4RMN A;  2YPR A;  4L9J A;  2M1B A;  2WB1 N;  3GFL A;  3M8J A;  4I09 A;  3SZT A;  1W4M A;  3LWF A;  3K9T A;  5HDK A;  4N4O B;  1MD0 A;  5DUI A;  4U0V A;  1MDM B;  4A3C J;  3ZOB A;  2R7O A;  3F8C A;  2O03 A;  1JI8 A;  1R58 A;  2CG4 A;  1VFC A;  1OCO H;  3K4L A;  2QZ8 A;  4KIG A;  4HNT A;  2Z99 A;  4A5M A;  1LFB A;  4QLC U;  1I27 A;  1FP1 D;  3H1C A;  4RA2 A;  5E3O A;  2F5D A;  1TNS A;  2K9L A;  1GV5 A;  4F92 B;  1T38 A;  1A36 A;  2FBK A;  2XGX A;  3CUO A;  4M6Y A;  2OZU A;  5J4Y A;  2VOO A;  5C44 J;  3K70 C;  4EGY A;  3K4C A;  4Y3O A;  3WOD F;  1K4S A;  1FEX A;  1OYY A;  4GFB A;  1WRJ A;  2Q0O A;  4U0Y A;  1O3Q A;  3I54 A;  1ETO A;  3GTP J;  3ABM H;  1J09 A;  1GVJ A;  3KIO A;  4L9V A;  4F91 B;  4BXU A;  4A6E A;  2IA1 A;  1K83 J;  1HCR A;  2EZL A;  2ZXW H;  3CP8 A;  3EYI A;  4BEH A;  1OKR A;  3RYP A;  2ELJ A;  1XC5 A;  2HDW A;  1IN7 A;  1MZB A;  3H9Q A;  1FOY A;  2DT6 A;  5AON A;  4E70 A;  1VQP I;  2Z16 A;  2EZI A;  3N97 A;  3O8G A;  3QPS A;  1IW7 F;  4R8H A;  1HW2 A;  2XGC A;  3BG6 A;  2R5Y B;  1G3S A;  1IN4 A;  1HKQ A;  3G2B A;  4AYB A;  3WTW C;  4BAY A;  2IGO A;  3F0C A;  2L9R A;  4Q5S F;  4CSW A;  3TQN A;  4RLQ A;  2MH2 A;  3HGG A;  4RS8 A;  5FRN A;  3FIS A;  3ZQ7 A;  3M9A A;  2Q1Z B;  2BE5 F;  2FA5 A;  4UB8 C;  4ZDP A;  3BQZ A;  2R7S A;  1DGR M;  2EH3 A;  1R7J A;  2DLL A;  2M2E A;  2M7A A;  4KIF A;  1A31 A;  4ASN A;  2ZCW A;  4IJA A;  3TO6 A;  3DFG A;  5E8I A;  1U3E M;  1PP8 F;  1IN6 A;  1Y0U A;  4RGU A;  2CQX A;  3COA C;  2X1C A;  3FIW A;  2VT2 A;  5LD2 C;  3PQJ A;  2H09 A;  1ZR2 A;  2MD0 A;  4V2G A;  3H5N A;  1ZR4 A;  3OOP A;  3G1L A;  3TGN A;  1EH7 A;  2H1K A;  3HOT A;  4OIP F;  4A3I J;  3PM1 A;  4HX4 A;  3OYI A;  3LSI A;  3LNQ A;  5EG0 B;  3LFU A;  2QSF X;  4ETS A;  4D5F A;  1HDD C;  4D1Q A;  3ABU A;  4PUS A;  3HRT A;  2QBY A;  3BQY A;  2VQL A;  1HST A;  2A6E F;  1OCC H;  2KIS A;  2CWE A;  3DTI A;  3IRQ A;  1I3Q J;  1T33 A;  4OIQ F;  4W97 A;  4F3Q A;  3JCU C;  2XC7 A;  2XRN A;  3RJP A;  2W25 A;  3RKQ A;  5L3F A;  1LDK B;  4LIV A;  1PVE A;  1SMY F;  1OCR H;  2LF7 A;  4IX7 A;  2WC2 A;  1T98 A;  2IXS A;  3AG3 H;  1R5I D;  2HQ5 A;  2XF5 A;  4H4K C;  4DZJ A;  2E36 A;  2JA6 J;  2KKO A;  5CVR A;  4FX4 A;  1O3T A;  2V79 A;  3V7R A;  4ENN A;  1R1V A;  2VC1 A;  3CD6 I;  4CYC B;  3DCF A;  2VOP A;  2FMY A;  3ZQH A;  1DDN A;  2K3F A;  2VAS A;  4QTR A;  5LGU A;  1BL0 A;  1JUP A;  3WHC A;  1I5Z A;  2CQ7 A;  2ZXH A;  2G9W A;  3T5X A;  4ZYG A;  2VE9 A;  4H0E A;  3CP2 A;  4JBA A;  5JVG F;  3C2H A;  2PMZ A;  5IYD J;  3CCQ I;  4CYC A;  4D7M A;  2WBM A;  1ETK A;  1PUF A;  5FKL A;  3SDB A;  1K78 B;  5LHG A;  1MND A;  2QA4 I;  2F5C A;  1NG6 A;  5J3L A;  3DBL B;  1IXC A;  2HOA A;  3WU2 C;  1SAU A;  2XV4 S;  1U8B A;  4XSZ F;  3D5L A;  1ODD A;  5JI6 A;  5JLX A;  2F5F A;  4BDY A;  2LBF A;  3VPR A;  1K78 A;  1RI7 A;  3OYJ A;  3O2P E;  1HLV A;  5ED4 A;  3FHZ A;  3MKW B;  2NNN A;  1J2X A;  1S29 A;  1Z6R A;  1ZGJ A;  1YHQ I;  3H3V K;  4CXF A;  1D5V A;  2NAZ A;  2X1E A;  4MFE A;  1VQ4 I;  3DKX A;  1P2F A;  2IRF G;  1DQU A;  2GIZ A;  4PGH A;  2P5L C;  2WV0 A;  2R3S A;  1TWC J;  3KP5 A;  1O3S A;  1GDT A;  3CMA I;  3HYI A;  3H9G A;  5LGN A;  3SFI A;  5J47 A;  4HNU A;  2O5R A;  4GRI A;  1J9I A;  2F5V A;  1TWH J;  2V9P A;  2WB1 A;  2NYX A;  2XUB A;  2VL8 A;  5DDG A;  3R4K A;  5GP9 A;  3VOD A;  3WTT C;  2JPB A;  1KU9 A;  2O8X A;  3E5U A;  5F0F A;  1DP3 A;  2F4M B;  4I76 A;  5JVT A;  3IC7 A;  1FOW A;  4I98 B;  3GTL J;  1SC7 A;  3OS1 A;  4ON0 A;  1OR7 A;  2QWW A;  3FDY A;  1N77 A;  2FML A;  4L0Y B;  2V4J C;  1NK3 P;  3CLO A;  1XSX A;  3GYH X;  3A52 A;  5F0H A;  2E5N A;  2NRA C;  4HDV A;  4UY8 I;  1LVA A;  3CLQ A;  3W6J B;  4HV6 A;  1FSH A;  3FXK A;  5DUK A;  1FBQ A;  3HZJ A;  2W57 A;  1R9T J;  2UZK A;  4GYG A;  4LOC A;  2M0C A;  1WJ5 A;  2KQR A;  1PYV A;  1FBS A;  1LEB A;  4XKC A;  1YS6 A;  4N9I A;  2QVO A;  4HYE A;  4HF2 A;  2QF7 A;  5TGT A;  4XLA A;  3PIP F;  3LQQ A;  2HNH A;  2QEN A;  1BI2 A;  2DA5 A;  3FXM A;  4HW0 A;  4AWX B;  5FLX Z;  4A93 J;  1P7J A;  5C3E J;  5HNF A;  2LG4 A;  4UUV A;  2DCE A;  1BI1 A;  2R93 J;  2ZJ2 A;  3VSK A;  4U87 A;  5BOX A;  5BNG A;  2HZT A;  1ZRD A;  3BR6 A;  4I0A A;  1U0J A;  3H35 A;  5EEH A;  2STT A;  1Y6I A;  4LIU A;  2VUM J;  1W7P A;  1LB2 A;  2XB5 A;  2AQE A;  3BWG A;  4BHP A;  1IRG A;  1U78 A;  5EZH A;  2ZBK A;  2BY0 A;  3DKW A;  1Z05 A;  1VQM I;  3HSF A;  2E2H J;  1WJF A;  4U7D A;  2W7N A;  1BI0 A;  2KMU A;  1X2M A;  2LH9 A;  1SD4 A;  4YII A;  2EIL H;  5F6F A;  2FE3 A;  2XDV A;  1E3H A;  2GQQ A;  2JT1 A;  4BBR J;  4Y13 A;  3HOX J;  2I10 A;  1TQI A;  5JHF A;  2KP6 A;  1MBK A;  3QPL A;  1N75 A;  1X1C A;  1WCM J;  4UNO A;  1SVL A;  3GFJ A;  2DYS H;  1Z3X A;  2BHZ A;  2IEK A;  1PUE E;  2ID6 A;  4GO1 A;  4OWR B;  5CQE A;  4BKX A;  3KEY A;  3PL8 A;  2IVM A;  4P9F A;  2CJJ A;  3GTG J;  2FD5 A;  4IXA A;  2YR2 A;  3X2Q H;  4A3L J;  1WFX A;  4FQG A;  3H5R A;  2QGU A;  3RKX A;  1FOK A;  2BEO A;  2LK2 A;  2OCE A;  1Y39 A;  1BN5 A;  2IBD A;  2V1X A;  4ZJZ A;  2JQ7 A;  2XAF A;  3IKT A;  2A61 A;  3LA3 A;  4EJO A;  2XB0 X;  4AC0 A;  3QP5 A;  3KEO A;  3CCV I;  1Z6T A;  5HS8 A;  5FFX A;  3BTI A;  4XKB A;  1IV6 A;  2N8G A;  4MIM A;  3L2C A;  1PP7 U;  1D1C A;  1WHU A;  1XMX A;  2VQH A;  3CDL A;  3E6B A;  3GF2 A;  1ZKG A;  4BJT A;  1MMN A;  1TQP A;  2VJ5 A;  1GT0 C;  4CHU A;  2ACJ A;  2FJ1 A;  3ONQ A;  3SEQ A;  2VIX A;  1NH3 A;  1P4W A;  2OPT A;  4LLL A;  4ZYA A;  3IKV A;  4HLX A;  1XGM A;  2KJB A;  2ICW G;  3KP7 A;  4IQ4 A;  3C18 A;  3ML6 A;  3IWF A;  2P8T A;  2CW8 A;  2HTJ A;  1RIO H;  2HDD A;  1YW9 A;  4RAF A;  2ZO4 A;  5IP6 A;  5H6R A;  5A2Q R;  2P4W A;  2HKX A;  2R7F A;  4UVB A;  4CO8 A;  5DCM B;  1R23 A;  1ZH5 A;  1G8X A;  4PFO A;  5CPR B;  3TP3 A;  3FZV A;  2JTV A;  4Z2Y A;  2JRT A;  3GX4 X;  2NVX J;  2ZFW A;  2MVT A;  3CUQ B;  3C1D A;  1X1P A;  4CCN A;  5M5X J;  3KZI C;  1Z7U A;  1N25 A;  1XGS A;  1JKP C;  4NNJ A;  5LRR A;  3KLO A;  2BV6 A;  2PEX A;  4HDU A;  2ZNY A;  2HYJ A;  2UXN A;  3TMO A;  1VQ5 I;  1ZRF A;  4YEL A;  1YIO A;  4Z6Y A;  1YYV A;  4OMY A;  4BY1 J;  2VN2 A;  3E6C C;  2CSO A;  4S0H B;  1JUS A;  2OAZ A;  1O7F A;  1MBJ A;  4B09 A;  2QKM B;  2AHQ A;  3NWT A;  4MQV A;  4NQW A;  4DW6 A;  4MQ9 F;  2AXL A;  3CQZ J;  2DFE A;  1DUX C;  4EV0 A;  3GME A;  3H5A A;  1VQO I;  2LRE A;  4BEH B;  5F1J A;  4XRM A;  1YO5 C;  2J5P A;  1HF0 A;  3FMS A;  2EV5 A;  5D8K B;  5BS6 A;  2KRF A;  3MZY A;  1RPW A;  3KYD B;  1IV8 A;  1GXP A;  6PAX A;  1BJA A;  3FMQ A;  1LUJ B;  3UKG A;  2E2I J;  2HZD A;  4ZTF A;  2R7W A;  2DMU A;  2NVU B;  3S3O A;  3TO9 A;  4LJZ F;  2MBF A;  5GAD J;  4CZZ A;  2QQA A;  2PQ8 A;  1YE9 A;  4JK1 X;  2ELK A;  3C3W A;  1JTX A;  4WXH A;  1JT0 A;  4I0B A;  3H9J A;  2B0L A;  3LA7 A;  1VQ8 I;  4RB2 C;  2GZW A;  2BBY A;  4ESB A;  5CVU A;  4LIT A;  5EGO A;  3W2W A;  2FSW A;  5AIP A;  3V8K A;  4LFU A;  1AKH A;  4M9Z A;  3CCU I;  4EMS A;  3ROU A;  1IF1 A;  3VWB A;  5IT9 Z;  3IAS 2;  2HR3 A;  4BQN A;  1LFU P;  2CGP A;  2Y0S A;  4MHG A;  2VQC A;  5B5E C;  2A6T A;  2AQF A;  4ABZ A;  3GXO A;  4JX4 A;  5J8F A;  4OAY A;  4XSX F;  5GAG J;  3L9F A;  2A3S A;  1BR4 A;  1W7P D;  1LE8 B;  3DXJ F;  5HVQ C;  4Q4Z F;  3FXO A;  5J4V A;  2IS4 A;  1J5Y A;  3DLL F;  3CC4 I;  4IO9 F;  2M0M A;  4L5I A;  4A2U A;  1U5T C;  1D8J A;  4XOR A;  1QZE A;  1YX5 A;  3Q9S A;  3ZGK A;  3F22 A;  1XD7 A;  5FKK A;  4FIS A;  1O7L A;  3SEZ A;  2X0L A;  5EJC A;  1DU6 A;  4KIT B;  1UHM A;  4DYC A;  2BXY A;  5CLS A;  2PLY A;  5CJ9 A;  1YW7 A;  3Q9V A;  3MZH A;  5D5U B;  4GYI A;  3QAH A;  4AIJ A;  4A3B J;  1XDU A;  3OYL A;  2H27 A;  3W3C A;  1TTY A;  2L9S A;  4G7Z F;  2XAH A;  3T8R A;  1P7I A;  4G6Q A;  1UMQ A;  3C2G A;  1S5L C;  1SAX A;  1REP C;  2RAE A;  2ECC A;  3ISP A;  4OMZ A;  1D8K A;  3D5S C;  2GXB A;  5DV5 A;  3LSK A;  4FE4 A;  4BQO A;  1ZAR A;  1DU0 A;  4LLG F;  2LYC A;  4X6A J;  1CF7 B;  3ECH A;  1WI9 A;  3WTV C;  3KP4 A;  3S3N A;  3OYB A;  1HQC A;  1MJA A;  2L9V A;  3C7J A;  3CZ6 A;  4O6J A;  4YFN F;  1BM9 A;  1MH4 A;  2CUZ A;  3HRS A;  5E8G A;  1SFO J;  1BA5 A;  1XMK A;  1ZGA A;  2XKO A;  3K2A A;  1R6R A;  4KMU X;  3ZMZ A;  5B3S H;  4ZZL A;  1E3O C;  3HHG A;  2D45 A;  1TWA J;  5K5R A;  3HG9 A;  1S8N A;  4IHT A;  2FX0 A;  1SAN A;  4CZC A;  1MMA A;  2JJ7 A;  5TRD A;  3F8M A;  2BYV E;  3DEE A;  1S7O A;  3GWZ A;  2AS5 F;  2NXN B;  2DQL A;  1APL C;  4KMF A;  4EJV A;  1WWX A;  4CH7 A;  2O3F A;  2NVQ J;  3FHN A;  2KLO A;  1S9H A;  4BNC A;  3R0J A;  1WI3 A;  4HQM A;  2E1M C;  2H8R A;  2L7F P;  4FHT A;  4ZYH A;  4LK1 F;  3TOB A;  3LSJ A;  4HOB A;  4XLH A;  2PJR B;  4A5N A;  2ZB9 A;  4IEJ A;  2XPU A;  3O8H A;  1OFC X;  2VXZ A;  1JXS A;  3HEF A;  4Y7N J;  2FOW A;  3EUA A;  4M3E A;  3O6B B;  1MBH A;  3HIF A;  1WH7 A;  2LNB A;  2DPD A;  3I59 B;  3U2R A;  2V6E A;  3TKY A;  2YS9 A;  3H0G J;  1VQ7 I;  3K6G A;  4U88 A;  1FMW A;  4IHW A;  1B8I A;  3JTG A;  1XGO A;  3VYS B;  4QSH A;  4A3M J;  5IT3 A;  5F04 A;  3I4M J;  2VKD A;  2R4G A;  2X51 A;  4UVA A;  3ZR8 X;  1QU3 A;  1ZN2 A;  2DFI A;  1UCR A;  2E1M B;  3DWL E;  3M8E A;  4KIS A;  1FIA A;  1WJB A;  4RGS A;  2KHM A;  2Y2Z A;  3J7Y J;  3JRI A;  3PQK A;  5K7H A;  2VJI A;  5CVI A;  2IS6 A;  2CFX A;  4ZTJ A;  1XTA A;  4NDL A;  2VBW A;  2FNP A;  4NC6 A;  4D7N A;  1TC3 C;  1SMT A;  3VFZ A;  3RQ4 A;  1XDS A;  3ZQC A;  1EA3 A;  2X6O A;  3G3Z A;  2KRH A;  1X58 A;  4MEY F;  5E3L A;  3CO6 C;  3OSG A;  3RPU D;  4RB3 C;  4LK0 F;  2CV2 A;  3WG9 A;  3QP6 A;  4M9X A;  2PBI A;  1HBX G;  4ESJ A;  4Y17 A;  4V2F A;  2L02 A;  1MMG A;  4TV7 A;  2DOE A;  2P0T A;  4IHY A;  3OSF A;  2V7F A;  1JTY A;  4AIK A;  4J01 A;  3WTZ A;  3DPT A;  1P4X A;  1V5G A;  3P7N A;  4A3E J;  2K02 A;  2L2O A;  1LFP A;  2E7X A;  3HTS B;  2VPR A;  3NWS A;  3CJN A;  1H0M A;  2M35 A;  2HOE A;  4PCQ A;  1LKX A;  1SD6 A;  4E7I A;  3EET A;  3MVP A;  3H0D A;  1LPQ A;  1MNE A;  1WPK A;  1QRY A;  4IOC F;  4UV9 A;  5HNH A;  1OLT A;  4FE7 A;  4XLC A;  1POG A;  3ZXS A;  3ZQF A;  3IRR A;  3JRB A;  1ZRC A;  2X4H A;  5C4J J;  4AUX A;  4BH9 A;  1G6N A;  3ZMD A;  2H94 A;  1KQ9 A;  5D6F A;  5K5Q A;  1A6I A;  1UST A;  2EZK A;  3WU0 A;  4DYQ A;  1QQI A;  3CCE I;  3BR2 A;  1RNL A;  1ON1 A;  2RKH A;  1JHF A;  3BR0 A;  4LGW A;  2QSG X;  2BXZ A;  3FXU A;  1JJ6 C;  2XKP A;  4KYW A;  1B4A A;  4QWQ A;  2MW8 A;  5DM7 F;  4ENK A;  1BC7 C;  1F1Z A;  4K2E A;  4C3H J;  3W6V A;  5LRS A;  2LP0 A;  5FLX K;  3KET A;  3IL2 A;  4LD5 A;  2D5V A;  1I50 J;  3S15 J;  1W36 C;  2GXA A;  2DQR A;  1F43 A;  5E20 A;  2DDA A;  4WXC A;  1B72 A;  3FM5 A;  3HOZ J;  2R7T A;  1SFU A;  2CV1 A;  3J7A O;  2VT3 A;  1D3Y A;  1S72 I;  4RM3 A;  5FRO A;  2O6G E;  3L1P A;  5EYR A;  5KK1 A;  1ZRE A;  3PFI A;  3REO A;  3S3M A;  2LMD A;  5J1Y A;  3Q0U A;  4RAG A;  3OL4 A;  5IYB J;  2MC4 A;  2EJR A;  4KNY A;  2MH9 A;  4ZC3 A;  5GAH J;  4E7Z A;  1P92 A;  4G94 A;  1T0F A;  2WAE A;  2NS8 A;  3LSP A;  5B1B H;  5TIS C;  2CU7 A;  3MN2 A;  5H2F C;  1MJB A;  2M30 A;  3H3U A;  3RPQ A;  1G3T A;  1KZH A;  3BJ6 A;  1LNW A;  5A2Q Z;  1WVR A;  3S1R J;  1YRN B;  1RC9 A;  2Y0M A;  2R7U A;  2VE8 A;  1EH6 A;  3GTO J;  2CW7 A;  3OYC A;  1W0T A;  2G0E A;  2X6X A;  2LKP A;  2LVS A;  2L5Q A;  3PNT A;  1AOY A;  2XPV A;  2GXG A;  3OOU A;  3R6S A;  1I39 A;  2OCC H;  1V3F A;  1ZYR F;  2Z2S B;  2HWV A;  5BPD A;  2XGE A;  4DZP A;  4E7L A;  5M5W J;  5HS9 A;  1TWG J;  2MLK A;  3P5J A;  4I2O A;  1F5T A;  4X1E A;  1T95 A;  1QPM A;  3BG5 A;  3DTE A;  3RQI A;  4YIF A;  4HRI A;  1W7P B;  3HSE A;  3CDI A;  1BR1 A;  3VB2 A;  4NBQ A;  1HC8 A;  2HXI A;  2ZME B;  4JX6 A;  1BBY A;  3G73 A;  1EV7 A;  2Z1D A;  1HW5 A;  4ZDL A;  1OPC A;  1T8I A;  5F0C A;  3T1B A;  5FKN A;  1QPI A;  2UWM A;  3I64 A;  3MCZ A;  2V26 A;  3BTJ A;  3CC7 I;  4O5V A;  5J1U A;  4CCL A;  3BJA A;  3EPZ A;  1F9N A;  4DQ2 A;  2M8G X;  1X4O A;  2HQR A;  2P0W A;  1K4T A;  1WJD A;  5F08 A;  2W85 A;  4M72 A;  3PUB A;  1YJW I;  2KIM A;  1Z21 A;  2DFF A;  4PSX A;  4ZDO A;  2LF8 A;  4BE1 A;  4C2M J;  1H8A C;  3AL0 C;  1ENH A;  3VDX A;  3SFZ A;  3MWM A;  3CUQ A;  3W2V A;  2BY2 A;  2DMQ A;  3S1N J;  2M4K A;  4PJJ A;  1Z77 A;  1WQ2 A;  2IPQ X;  5CVJ A;  4JOM A;  1FSE A;  3ZQL A;  2MLG A;  4ENJ A;  4P1W A;  4HV5 A;  2VKE A;  1EH8 A;  2DMN A;  1E17 A;  3M1E A;  5EF6 A;  2OZ6 A;  4C30 A;  3I58 A;  3B73 A;  5JLW A;  2K5C A;  4XQF A;  3B02 A;  3M8F A;  2D2W A;  2M45 A;  4PDK A;  2DK8 A;  3HGY A;  5IOY A;  3NEU A;  2DA7 A;  1Y8R B;  2IGN A;  3BT9 A;  2QM3 A;  4KN7 X;  2HKO A;  3K4J A;  2FBH A;  4PK4 A;  1MBF A;  3HDD A;  1UG2 A;  2DW4 A;  2COB A;  2FBI A;  3RZO J;  1VI0 A;  1LEA A;  3IAM 2;  5HS7 A;  2JSC A;  3JRD A;  1XSD A;  3CCL I;  5GPA A;  1SVM A;  4IVN A;  4CCK A;  2DOF A;  2L3D A;  4M74 A;  3PIO F;  5E1X A;  5BQT A;  2KFD A;  3TDZ C;  1RKT A;  3U1K A;  5LEK A;  1Z1D A;  2L01 A;  4U0W A;  2PN6 A;  1K61 A;  2MA3 A;  1W5C C;  4DNC A;  1SFK A;  2DA4 A;  4OU0 A;  2EIK H;  2HOT A;  2RRE A;  2M8E A;  1E2X A;  2COM A;  4A3D J;  2EFN A;  3ZRG A;  4F55 A;  1RRJ A;  4NUB A;  4WCG A;  5DM6 F;  3Q5F A;  3V7C A;  1WKM A;  1JGS A;  3ZPL A;  4XLF A;  4EGZ A;  3DBH B;  4BQA A;  2R7Z J;  3ZQI A;  4XID A;  2XAG A;  3HKZ N;  4R79 A;  1GV2 A;  3ZN1 A;  4RB0 A;  1IXR C;  1S6L A;  1X1B A;  3WTU C;  2R7Q A;  2X9D A;  2VKH A;  5FGM A;  4OIR F;  4AM3 A;  1VQ9 I;  3CJR B;  5M3M J;  2XSD C;  2TRT A;  4XL9 A;  2W1O A;  3CCS I;  1JUM A;  2AXT C;  2VPL A;  1ZG1 A;  3WG7 H;  3PSI A;  2Q2E A;  3WHB A;  5K1Y A;  1JKO C;  2MUN A;  2EFQ A;  1G59 A;  3L2R A;  4QPO A;  1DPR A;  3D5R C;  3BLY A;  3CF2 A;  3OL3 A;  2XVC A;  2Y9Y A;  3WTX C;  1FTT A;  5DEQ A;  4E7S A;  1IG7 A;  2HTS A;  2DA1 A;  1FZP B;  3F8N A;  1P9Q C;  3W2A A;  2QKL B;  1LE8 A;  2VLA A;  2KIU A;  2LRD A;  2VI6 A;  5B66 C;  1FPQ A;  4LMY A;  5F64 A;  2ZXJ A;  1IO2 A;  3S2D J;  3GTJ J;  2KJC A;  2BY3 A;  2ZNZ A;  3E6M A;  2E35 A;  3JW4 A;  4A12 A;  2WAD A;  5L3C A;  5L3E A;  3HRM A;  4FX0 A;  4P5O A;  4C3I J;  2JA7 J;  4M3F A;  4B43 A;  1VF9 A;  2WA0 A;  1T08 B;  2XGD A;  2A05 A;  5ERI A;  1ON2 A;  4Q48 A;  3A02 A;  1KA8 A;  2EFW A;  2G7H A;  4E7K A;  4II3 A;  3M1C A;  3DF8 A;  1I1G A;  2QLZ A;  1BC8 C;  3BTC A;  3J7A Y;  5D8L B;  5J8C A;  4EVI A;  4XNF A;  4MNU A;  4EJT A;  4IPA A;  3GZ5 A;  2LTP A;  1E0E A;  3M7G A;  4BXF A;  2V9V A;  2H6C A;  3HUG A;  3OIP A;  4Q47 A;  2DMT A;  2EIN H;  3I53 A;  3TO7 A;  1BR2 A;  4KT6 A;  4IKF A;  2JVH A;  1IRX A;  1FY7 A;  4B3X A;  3RZD J;  1SFX A;  3M4O J;  2PX9 A;  2WAQ N;  3BDD A;  2YU9 J;  2VXD A;  5IT9 R;  4KDP A;  2EV0 A;  3EUH A;  3RTR A;  3DU5 A;  3V7S A;  3S8P A;  4C2T A;  2FQ3 A;  3CJQ B;  1ZEL A;  2JA2 A;  3K1P A;  2CO5 A;  4HF0 A;  2DTZ A;  3UNG C;  1U2W A;  4A0X A;  1XCB A;  2UUZ A;  2WAQ A;  5CYV A;  2FOK A;  3KE2 A;  3T8T A;  1MGT A;  4UB6 C;  5ICC A;  5CKT A;  4Y15 A;  4DYR A;  2M5W A;  1HXD A;  2VJJ A;  3P9I A;  1QHG A;  2DPU A;  2OBP A;  2A6H F;  3FMR A;  2EA4 A;  3WGG A;  2IGK A;  2MYS A;  1E3P A;  5D4R A;  2CUJ A;  4D0P A;  1OYW A;  4ANJ A;  1OJL A;  1G2H A;  5HLH A;  5E3M A;  3BG9 A;  3RI4 A;  1PDN C;  1Q1V A;  1QVU A;  3OYG A;  4KFC A;  1YFH A;  3FXJ A;  2DA2 A;  3I0T A;  4BGD A;  4FCY A;  2QSH X;  4BYY A;  4PZJ A;  1QZZ A;  4J19 A;  1F4K A;  3ERE D;  1K7A A;  4I7H A;  2MFZ A;  3AG1 H;  2EBI A;  1V5F A;  1Z3Y A;  3GLX A;  4N9H A;  5KVR A;  3SJM A;  3F8F A;  3VYT B;  2KIQ A;  3JSP A;  3CF5 F;  4A6D A;  4UVC A;  3OWT A;  1K6Y A;  4HSR A;  4CCO A;  3ASN H;  2DK5 A;  2BVM A;  2EK5 A;  2V6C A;  2JVG A;  1RR8 C;  2FQ4 A;  3FF5 A;  2HVR A;  2RNJ A;  3FWE A;  3GTK J;  2BZT A;  5FFZ A;  2VKV A;  3BC8 A;  2PJR A;  3ZCO A;  3QYE A;  4M6X A;  3CME I;  3J81 Z;  1B1B A;  1XCV A;  2CRG A;  2K86 A;  3HPH A;  2RVC A;  1O4X A;  1NG7 A;  3E1S A;  3GZ6 A;  2BY1 A;  3WE2 A;  4IRI A;  2G7U A;  2IS1 A;  3G1M A;  1C0W A;  1YRN A;  3VOE A;  2E7W A;  1UHW A;  2LKX A;  1TNT A;  3BCA A;  3U9G A;  3FX3 A;  2GLO A;  2CQN A;  1IUY A;  2JSP A;  4IF4 A;  2HYF A;  3CES A;  5HOD A;  4DBR A;  2F48 A;  1OR7 C;  1H9G A;  3BOQ A;  1QO0 D;  2EZH A;  3PNY A;  3A01 A;  5LGT A;  1ULY A;  2V1D A;  1L3L A;  1WSU A;  1GUU A;  1Q1H A;  3K4B A;  1MBE A;  4C2U A;  2JA5 J;  5E1Z B;  2GOX B;  3HOY J;  2M3A A;  1P4A A;  3R61 A;  4EJU A;  1X19 A;  3OYM A;  1YW8 A;  5HLG A;  3JAM R;  1MSE C;  2Q2E B;  1MKM A;  4A3F J;  1YOV B;  1RZ4 A;  4XN3 A;  4A0Z A;  1J75 A;  3JAM Z;  5ILU A;  2ZXI A;  3L00 A;  3WGH A;  2STW A;  2L4M A;  4M3B A;  2Y31 A;  4M71 A;  2OTL I;  2ZJR F;  1D0X A;  3SZG A;  4BE0 A;  2IAI A;  4RB1 A;  4I6Z A;  2OJE D;  5KAI C;  2WWY A;  3H92 A;  3BJO A;  4A3G J;  1WJC A;  4UUT A;  1YJ9 I;  3LSG A;  2LY9 A;  3ZMV A;  2OQG A;  2NVT J;  3IUO A;  5KAF C;  4XKW A;  3TOA A;  4V19 K;  3ESW B;  3EUK L;  5FD5 A;  2ZJQ F;  1T6S A;  3TDU C;  2PI0 A;  2KZV A;  5J6X A;  1WJE A;  1FWZ A;  1FIP A;  1IRZ A;  5D4S A;  3DP7 A;  1VQL I;  1T56 A;  3P9K A;  2LDU A;  4LB5 A;  3ABK H;  3HRU A;  3F23 A;  4MTE A;  3KZZ A;  2YU3 A;  2YX4 A;  3MMY B;  3JRH A;  4LG0 A;  5C4X J;  3F72 A;  2GWR A;  3V42 A;  4XKV A;  3SDG A;  5FKO A;  4LG3 A;  3GTQ J;  2B63 J;  5TJJ A;  1YI2 I;  1IJW C;  1K6O A;  5FB2 A;  4HG2 A;  4YG2 F;  5EG0 A;  4E7H A;  2F6C A;  4IL6 C;  4XOT A;  4C9Y A;  3LSM A;  2R92 J;  4YFX F;  3PUF A;  2EIM H;  4ENM A;  2ISZ A;  4B47 A;  3E97 A;  3JTH A;  4FT8 A;  4IHX A;  1YG2 A;  1TBX A;  2GA2 A;  1H89 C;  1FYL A;  2OD5 A;  2GIV A;  3OYD A;  2X6Y A;  1ETV A;  4BBS J;  3Q0W A;  2D1H A;  1FP2 A;  5FLV A;  1IAW A;  4IHV A;  2E5Z A;  2L7M P;  3IH3 A;  3C2B A;  4KIB A;  4AU7 A;  3HJE A;  5IYC J;  2QEX I;  2XF6 A;  3NRV A;  1UZC A;  4HST A;  2HFH A;  2XHK A;  4RGX A;  3ZMU A;  5E1W A;  3QRF F;  4BHB A;  3B6A A;  4EJW A;  2F4I A;  3TED A;  2ME6 A;  3O3K A;  1LQ1 A;  3L2V A;  3HC7 A;  3OV8 A;  1IN5 A;  3SXY A;  2OUM A;  3L2U A;  5DS9 A;  2EA2 A;  1UG0 A;  3LAP A;  1W36 D;  1OCT C;  4X0G A;  1FNN A;  2OA4 A;  3GTM J;  1RUO A;  2RNG A;  2LLK A;  3BR1 A;  4Y33 A;  3ZQQ A;  2IJL A;  3B6C A;  1ETW A;  3IV5 A;  5EGO B;  2E71 A;  1S7E A;  1MH3 A;  3DKY A;  2HPI A;  3NAR A;  3JAM K;  1A35 A;  1R22 A;  4B44 A;  3HPG A;  1TL8 A;  5FD6 A;  3LQR A;  2QYO A;  4FAS D;  2ZFU A;  2W84 A;  4KUM A;  4A3J J;  1YIJ I;  2A5Y B;  4RLF A;  2GBY A;  2CYY A;  4WWC A;  1XB4 A;  2AO9 A;  3TW6 A;  3HM5 A;  2MAB A;  3LMM A;  1TWF J;  2JMW A;  5EZG A;  4AYB N;  4E7J A;  3KP6 A;  3IHU A;  4PJ0 C;  4RAY A;  1QA6 A;  3NQO A;  3E7L A;  1XPX A;  4HF1 A;  5DCF A;  5CQG A;  3S2W A;  5A2Q K;  1FC3 A;  2P5V A;  2IGM A;  2R7R A;  1D0Y A;  2F2E A;  2K9N A;  3AG2 H;  3ZN0 A;  5E17 F;  3CCR I;  2ETH A;  5HDG A;  3GEZ A;  1CGP A;  3JR9 A;  1WH5 A;  1IUF A;  4AVZ A;  1ZLK A;  3S32 A;  2JK3 A;  2DN0 A;  2Z33 A;  5K5O A;  3WTS C;  2Y9Z A;  2VB6 A;  3E5X A;  4NQW B;  2Y0S N;  2X85 A;  2HXO A;  3PFY A;  1BOB A;  3I55 I;  1G3Y A;  1MDM A;  1TW2 A;  4MFD A;  1ACI A;  2XSJ C;  4A3K J;  3N4M A;  4A0Y A;  3ERM A;  3QPH A;  5JFR A;  5GPC A;  2XIG A;  1ZG5 A;  3CCY A;  3Q0V A;  2DO7 A;  4PSW A;  4RM2 A;  4O3M A;  3HUG B;  1KYZ A;  2W4S A;  3W6K B;  1MNM C;  2P81 A;  4LB6 B;  4BY7 J;  3S2H J;  3BR3 A;  2A07 F;  2LR8 A;  4RAZ A;  3OIQ A;  1YJN I;  4LG0 B;  5M5Y J;  1HOM A;  3TL4 X;  4HX8 A;  5BPI A;  1Y1W J;  3JRC A;  4RDU A;  1WGX A;  1F36 A;  4P96 A;  3GFM A;  3FXL A;  5CVV A;  1JGG A;  1W1W E;  2M7B A;  4F7Z A;  2ECB A;  1PUF B;  2WAF A;  3A4C A;  2EFO A;  4CCM A;  3SYT A;  1U9N A;  2O8K A;  2DI3 A;  2ELH A;  2HOS A;  3WGI A;  3MZ8 A;  4NHJ A;  1GHC A;  1GLN A;  5E18 F;  5F27 A;  3I4P A;  4NB5 A;  2ZME C;  3EYY A;  4KIC A;  3LST A;  2W82 A;  2MC3 A;  2RV8 A;  1X1A A;  3DEW A;  5GTI C;  4JYK A;  3AFH A;  4HNV A;  4DGW B;  2NVY J;  2PJP A;  3WE3 A;  3ZP5 A;  1GVD A;  3G6E I;  3F21 A;  1XMA A;  3CCM I;  2EB7 A;  5E3N A;  2GOM A;  2OU2 A;  2CFO A;  1B72 B;  4A69 C;  2EWN A;  2FUG 2;  4YRV A;  3G71 I;  4G7O F;  3DPU A;  4D9J A;  2P6S A;  3S16 J;  2H6B A;  2VON A;  1KQ8 A;  2NOJ B;  3SHF A;  1DPU A;  1UB9 A;  1AA7 A;  4G8X A;  5ILV A;  5D5W B;  1B9M A;  3MAJ A;  1I3A A;  1MMS A;  4ZH4 F;  2UV1 A;  1ZLJ A;  1FT9 A;  3AL0 B;  4PGG A;  3JRF A;  2GAU A;  4UUS A;  5K7F A;  4HA8 A;  2HU9 A;  3BG7 A;  2X1D A;  4BAC A;  2CV0 A;  3F3X A;  3SQN A;  1AWC A;  1FLI A;  2KDO A;  1ITY A;  4S05 A;  2DJI A;  2O7O A;  2L9N A;  3GZN B;  3BCB A;  3RDI A;  2X98 A;  2B7E A;  3DQV C;  3HOV J;  2WV1 A;  2GA1 A;  1FMV A;  4BDZ A;  5HLT A;  2D1V A;  4L5J A;  2RDP A;  1B59 A;  2QBY B;  4L0Z B;  1HW1 A;  2R7D A;  3FBI B;  2F5E A;  3F8B A;  5EDN A;  3CCJ I;  4BUP A;  1ERD A;  5L3G A;  3UR3 C;  3E0J B;  3DEU A;  4BL0 B;  1I1S A;  2YSR A;  1VZ0 A;  4N4N B;  4M73 A;  3ZQG A;  1Y8Q B;  5ICG A;  3BR5 A;  1LDD A;  2OF7 A;  1EF4 A;  3R60 A;  3ZMT A;  3FM3 A;  3SZP A;  4QPQ A;  1YTY A;  1XSV A;  1HA8 A;  2CQQ A;  4Y52 J;  3HSR A;  3A03 A;  3K10 A;  4XON A;  3J81 R;  3K1M A;  2E1O A;  1QVT A;  3L09 A;  3CO7 C;  1HSJ A;  3K69 A;  2DXI A;  5FRM A;  4RBO A;  3IH2 A;  2FU4 A;  2CS3 A;  4F52 A;  4B3A A;  4BQQ A;  1R49 A;  1O3R A;  1R1U A;  5DD8 A;  1I6H J;  1BW6 A;  1R71 A;  3N05 A;  4M6V A;  3HHH A;  4DOZ A;  4ZZD A;  2KRC A;  1KU2 A;  4KA4 A;  3RSN A;  3QQA A;  3S14 J;  5ICE A;  4JP0 A;  4PJL A;  3K2Z A;  3EQL F;  1UJ8 A;  1TZL A;  1SEU A;  2O9L A;  1VQN I;  4G9Y A;  1R00 A;  1A5J A;  2JUG A;  3L2Q A;  1SD7 A;  2ISY A;  2NS7 A;  2VOD A;  1DP7 P;  1BJZ A;  1BI3 A;  2BGC A;  3L2W A;  2R5Y A;  3I4N J;  3PO2 J;  4CA0 A;  4IOA F;  3BY6 A;  1G4D A;  3QU6 A;  2PFB A;  3HOW J;  1RQ6 A;  1OMI A;  1U5T B;  1Z7L A;  3AKZ A;  1AHD P;  3G1O A;  3LFK A;  4ZYE A;  2ZME A;  5IOZ A;  3OR2 C;  1B8I B;  3F6V A;  4HZF A;  1ORK A;  2Q8K A;  1MMD A;  4RGR A;  1UFM A;  3CMY A;  4L9T A;  2JRM A;  2IT0 A;  2IA0 A;  3I3L A;  4BHC A;  1X3U A;  4WXD A;  1IRF A;  4CYD A;  1Z91 A;  3VEP A;  2LC2 A;  2GM4 A;  1RET A;  2IA2 A;  3JSO A;  2LSO A;  3D0S A;  5ILS A;  3ZMS A;  3LOC A;  4M9S A;  1R4N B;  5DCM A;  3K1N A;  1D0Z A;  1W0U A;  2HEO A;  5IP7 J;  4FET A;  2XAQ A;  1J7K A;  3TBI A;  3MQ0 A;  2V1N A;  2MD5 A;  2DYR H;  5DD4 A;  2A5W A;  2LD5 A;  3NAU A;  2O61 A;  3J7A W;  4UUS B;  2W00 A;  2KPM A;  2WY7 Q;  4EQQ A;  1AU7 A;  3BZC A;  1UEL B;  3EDP A;  2XAS A;  3D1N I;  1LDJ A;  4MTD A;  1S3J A;  4JQF A;  2CUF A;  3WU1 B;  3QOD A;  3HXL A;  2QQ9 A;  3FXQ A;  5BMZ A;  1KYW A;  1U8R A;  1OYI A;  2RC4 A;  1PJR A;  1XN7 A;  1X3Z B;  2EIJ H;  3VYU B;  5LEJ A;  2E2J J;  5HOO A;  1BW5 A;  4MEX F;  1RR7 A;  1OCP A;  1Z67 A;  1ETQ A;  4OOI A;  5AIQ A;  3K70 D;  4NC7 A;  4CUG A;  2HPM A;  4IRH A;  3A2K A;  5GTH C;  2ZC2 A;  2XAJ A;  3J81 K;  2WY8 Q;  1KU3 A;  4BJ6 C;  2DT5 A;  4AID A;  1RKW A;  3J80 R;  4EM2 A;  4XRS G;  2IP2 A;  4CDG A;  2Z9O A;  2V9K A;  4UV8 A;  3HL2 A;  1I6X A;  2Z5U A;  3CUQ C;  2L4A A;  4R1H A;  4AIH A;  4CCJ A;  1TW3 A;  1XGN A;  4I01 A;  3QYB A;  5JHU A;  3K4N A;  1VQ6 I;  2KT0 A;  3BRO A;  3OR1 C;  2DOD A;  1CQT A;  1MSF C;  1BIB A;  2H8W A;  3FKI J;  3I71 A;  1ETX A;  1Z0X A;  2XAU A;  1FOX A;  1IDY A;  3GCM A;  2DBB A;  2ZSI B;  2P7C B;  2FRH A;  3OS0 A;  4W1U A;  3E5Q A;  4G12 A;  1JKQ C;  4KJZ A;  1EJ9 A;  1D1A A;  3KP3 A;  2DDB A;  2XRO A;  1LJ9 A;  1KQ0 A;  3I56 I;  2M34 A;  1D5Y A;  3R0A A;  4G7H F;  3LSR A;  3Q3S A;  2FXA A;  3ABT A;  2Y75 A;  4Y4R A;  2K7L A;  4XN0 A;  1ZTR A;  3JRG A;  3CMM A;  1FTZ A;  2QUF A;  3V8L A;  1ZGW A;  1IN8 A;  3VSL A;  4GCV A;  3GBG A;  4JX5 A;  3MD2 A;  3CC2 I;  2VBX A;  2HS5 A;  2E1N A;  4XR6 A;  5LBQ A;  2C6Y A;  1RUN A;  5GAE J;  3CJT B;  2L0K A;  3KFW X;  2I5U A;  1YIT I;  1OIS A;  3E6D A;  2DMP A;  3HB9 A;  4WK8 F;  2RQP A;  4B4C A;  2QQB A;  3KX2 A;  1FX7 A;  3RCO A;  5D5X B;  4GDF A;  3A0H C;  3M3Y J;  3RKW A;  3JRA A;  1UHS A;  2JA8 J;  1ZAO A;  4XM3 A;  5FKM A;  3OYF A;  4IZZ A;  1FYM A;  3U21 A;  2TDX A;  1UAA A;  2B9S A;  4PJN A;  2DA3 A;  3EUH C;  3FXR A;  3OYE A;  3DV8 A;  1XG1 A;  2JPC A;  3HOU J;  4II2 A;  2Y69 H;  3KCC A;  2BOL A;  1HKS A;  2FEZ A;  5EEA A;  5KHD A;  4BE2 A;  1R5H A;  4U7B A;  1Y1V J;  2PMU A;  1JKR C;  1A04 A;  3V4G A;  2P7V B;  4XMY A;  5LLQ A;  4IRG A;  1SFE A;  3RKY A;  3LA2 A;  3ASO H;  2LFB A;  1SD5 A;  3AAF A;  1USS A;  3QPT A;  3CDH A;  2W24 A;  3ULQ B;  1ZHF A;  2OV7 A;  2PMZ N;  2ZJP F;  2PG4 A;  3JRE A;  2R7X A;  3I59 A;  3TP0 A;  2K27 A;  1U9O A;  3AG4 H;  2K4J A;  3DTK A;  4WX9 A;  3P9C A;  3H3Z A;  4EEF G;  3J80 K;  3OMY A;  2XRL A;  2R5Z A;  4D5C A;  1TQM A;  5K7Z A;  2KIF A;  1LVK A;  4L5E A;  4BU2 A;  4B48 A;  3OYH A;  1TP4 A;  3KYC B;  4DJA A;  2I8D A;  2BVL A;  2DT7 B;  4I02 A;  3BPX A;  4YEJ A;  2HYG D;  5ICF A;  1G3W A;  1T39 A;  4XLE A;  1H9T A;  4XLN F;  3DLA A;  4G6D A;  4NC8 A;  1YQA A;  2LKS A;  1WJA A;  1Z9C A;  1R4M B;  1TT5 B;  1QNT A;  2K9S A;  2E34 A;  2HI3 A;  2E60 A;  4PJM A;  5LFA A;  5B1A H;  3IP4 B;  2YX7 A;  4YIR X;  5IP9 J;  4FTH A;  2ADU A;  4MGR A;  2OC6 A;  1P6R A;  3KP2 A;  2YUS A;  2MG4 A;  3J80 Z;  1TT0 A;  2WTE A;  4BJ5 C;  1N78 A;  1YLF A;  2VC0 A;  3FKJ A;  2P6T A;  4HX7 A;  1H88 C;  2OTJ I;  2HDC A;  5M3F J;  1EKE A;  2R7V A;  4DIQ A;  2O0Y A;  4J00 A;  3OYK A;  3FK7 A;  2HVS A;  1FBU A;  1R36 A;  4XLP F;  4UXN A;  2L54 A;  3S17 J;  2JZY A;  1QZY A;  3S93 A;  2IS2 A;  5LHH A;  1IGN A;  1ZG3 A;  2MSY A;  4KT5 C;  2QCO A;  3FK6 A;  4QIW N;  2RGV A;  3QOE A;  4G6T B;  4XK4 A;  4HEA 2;  3QU3 A;  3ABL H;  3KZY A;  4LLN A;  3I5U A;  4KN4 X;  3MKY B;  2UXX A;  2M9H A;  3CTA A;  1L0O C;  4XBF A;  1M1E B;  4HPQ A;  1J0R A;  1GXQ A;  4E6K G;  3A01 B;  4ESF A;  3GVA A;  1K79 A;  1HKT A;  1ONV A;  3PNV A;  2CMP A;  3OS2 A;  2EQR A;  2LBF B;  1KU7 A;  3HOS A;  2A69 F;  1WZ2 A;  1X4P A;  1NHA A;  2VBY A;  3KPH A;  4IHS A;  2MZ4 A;  4HQE A;  1IC8 A;  1ZQ3 P;  1YS7 A;  2DA6 A;  2LOO A;  2FF4 A;  3QWL A;  1AKH B;  2P5K A;  2DAO A;  5LHI A;  3IH4 A;  3GLL A;  1CF7 A;  3M07 A;  3KLN A;  2EPF A;  2H1L A;  4CGZ A;  3E3V A;  3LSH A;  2RN7 A;  2DOA A;  4B1R A;  3MFK A;  5FJ8 J;  2KDZ A;  1MJ9 A;  3OY9 A;  2JUC A;  4HLY A;  2QQ8 A;  2K40 A;  2LY1 A;  3HBL A;  4YFK F;  3PO3 J;  3LL7 A;  3BG3 A;  2RQQ A;  3OYN A;  2EV6 A;  2KZG A;  3BZ6 A;  3PSF A;  2FNA A;  1JHH A;  4OAZ A;  3RIR A;  2X6W A;  2L7K A;  3FBN B;  1S7A A;  1FYK A;  1KON A;  5L3B A;  1HDP A;  1NTC A;  5HDN A;  5DTD A;  3RYR A;  2E1C A;  2NOG A;  1MBG A;  1VND A;  4ITV A;  2ESH A;  4UHT A;  4L18 B;  1X1D A;  4M3D A;  2VJ4 A;  9ANT A;  2BW3 B;  2K3P A;  5KCM A;  3QYF A;  2BHY A;  1OQY A;  4P9U A;  4GXO A;  1D1B A;  2R5Z B;  1R1T A;  4BS9 A;  2JN6 A;  4MO7 A;  1IDZ A;  2Y48 A;  2CW0 F;  5IPA A;  3RPU A;  1IXS B;  2VBZ A;  2VQG A;  5FO5 A;  2HQN A;  2L7Z A;  2M87 A;  2DTR A;  3MKZ A;  1Y0N A;  4N0B A;  4B8X A;  1QGP A;  2TCT A;  2BW3 A;  4IQJ A;  4XIC A;  3S1Q J;  3LAJ A;  4I99 C;  4XRS A;  5FLX R;  1B9N A;  4C3J J;  1T2K A;  4F93 B;  3GO5 A;  1U5T A;  3MKL A;  3GUD A;  4XRF A;  4AD9 A;  3OIO A;  2ZSH B;  1V54 H;  1XS9 A;  5IT9 K;  1STZ A;  5D6E A;  2EFP A;  3TW7 A;  3VYR B;  2ESN A;  2ME0 A;  4L9N A;  1RES A;  3DU6 A;  3A1Y A;  2HQA A;  3HTU A;  3BPV A;  5FLM J;  1QBJ A;  3ELK A;  1V5E A;  5JR3 A;  1IZ1 A;  1BIA A;  5H6Q A;  4S04 A;  2DU9 A;  2K4B A;  2DJN A;  1TLH B;  3F9K A;  1W5T A;  5DYM A;  5L3D A;  2CQK A;  1X2N A;  1OCZ H;  3K7A J;  1T0F C;  3BZK A;  5EEG A;  3G4S I;  1NK2 P;  4M3G A;  3J7Z I;  3BTL A;  3KEQ A;  3WTY C;  3I9V 2;  4OIO F;  4MLO A;  1VQK I;  2PMH A;  2W48 A;  1ZK8 A;  1V55 H;  3HKZ A;  1U6G A;  3H36 A;  3MEX A;  3K4M A;  5H20 A;  2NS0 A;  5J1R A;  1X3W B;  2HGC A;  2Z3Y A;  1R5G A;  1SVO A;  3QOP A;  2J5O A;  5D5V B;  1JT6 A;  2X48 A;  3V8J A;  3F6O A;  3U1D A;  3A0B C;  2NNY A;  3KYL A;  2XPW A;  1J59 A;  5J40 A;  1JE8 A;  1YX3 A;  4HAM A;  4WF2 A;  1XX5 A;  3K4K A;  5HLI A; 
#chains in the Genus database with same CATH homology
 4EM0 B;  4GGG A;  3T0Y A;  2IW5 A;  4CIC A;  3IWZ A;  3L7W A;  1V4R A;  3DPL C;  4AVP A;  4ZYD A;  2ZKZ A;  2A68 F;  1B6A A;  3BP8 A;  3GW2 A;  2OQR A;  1O57 A;  4EM1 A;  1VTN C;  3K0L A;  1KGS A;  3ECO A;  1W5S A;  3GFI A;  4HBL A;  4P55 A;  4OIN F;  5F1R A;  1BOA A;  2V1U A;  2YPR A;  4L9J A;  2M1B A;  3GFL A;  4I09 A;  3SZT A;  1W4M A;  3LWF A;  3K9T A;  5HDK A;  1MD0 A;  5DUI A;  4U0V A;  1MDM B;  3F8C A;  2O03 A;  1R58 A;  2CG4 A;  2QZ8 A;  4KIG A;  2Z99 A;  4A5M A;  4QLC U;  1I27 A;  1FP1 D;  2F5D A;  1TNS A;  1T38 A;  2FBK A;  2XGX A;  3CUO A;  4M6Y A;  2OZU A;  2VOO A;  4EGY A;  3WOD F;  1OYY A;  1WRJ A;  2Q0O A;  4U0Y A;  1O3Q A;  3I54 A;  1GVJ A;  4L9V A;  4BXU A;  4A6E A;  2IA1 A;  3EYI A;  1OKR A;  3RYP A;  1IN7 A;  1MZB A;  4E70 A;  5AON A;  3N97 A;  1IW7 F;  4R8H A;  1HW2 A;  1G3S A;  1IN4 A;  1HKQ A;  3WTW C;  4BAY A;  4Q5S F;  3TQN A;  2MH2 A;  4RS8 A;  3ZQ7 A;  3M9A A;  2BE5 F;  2FA5 A;  1R7J A;  2DLL A;  4KIF A;  4ASN A;  2ZCW A;  4IJA A;  3TO6 A;  3DFG A;  5E8I A;  1U3E M;  1PP8 F;  1IN6 A;  1Y0U A;  4RGU A;  3COA C;  2VT2 A;  3PQJ A;  2H09 A;  3OOP A;  3TGN A;  1EH7 A;  3HOT A;  4OIP F;  4HX4 A;  4ETS A;  3ABU A;  3HRT A;  2QBY A;  1HST A;  2A6E F;  2CWE A;  3IRQ A;  4OIQ F;  2XRN A;  3RJP A;  2W25 A;  5L3F A;  1LDK B;  1SMY F;  2LF7 A;  2WC2 A;  1T98 A;  2KKO A;  5CVR A;  4FX4 A;  1O3T A;  2V79 A;  3V7R A;  4ENN A;  1R1V A;  2VC1 A;  2VOP A;  2FMY A;  1DDN A;  5LGU A;  1I5Z A;  2G9W A;  3T5X A;  4ZYG A;  2VE9 A;  4H0E A;  4JBA A;  1K78 B;  5LHG A;  2F5C A;  1IXC A;  2XV4 S;  4XSZ F;  3D5L A;  1ODD A;  5JI6 A;  2F5F A;  1K78 A;  1RI7 A;  3O2P E;  5ED4 A;  3FHZ A;  2NNN A;  1J2X A;  1S29 A;  1Z6R A;  1ZGJ A;  4CXF A;  1D5V A;  2NAZ A;  1P2F A;  2IRF G;  4PGH A;  2P5L C;  2WV0 A;  2R3S A;  3KP5 A;  1O3S A;  3HYI A;  5LGN A;  1J9I A;  2NYX A;  2XUB A;  5DDG A;  3R4K A;  3VOD A;  3WTT C;  2JPB A;  1KU9 A;  2O8X A;  3E5U A;  5JVT A;  3IC7 A;  4I98 B;  4ON0 A;  1OR7 A;  2QWW A;  4L0Y B;  2FML A;  3CLO A;  1XSX A;  3GYH X;  2NRA C;  4HDV A;  1LVA A;  3W6J B;  4HV6 A;  1FSH A;  5DUK A;  1FBQ A;  2W57 A;  2UZK A;  4GYG A;  1FBS A;  1LEB A;  1YS6 A;  4N9I A;  2QVO A;  4HYE A;  4HF2 A;  3LQQ A;  2QEN A;  1BI2 A;  4HW0 A;  4AWX B;  5FLX Z;  4UUV A;  1BI1 A;  2ZJ2 A;  5BOX A;  2HZT A;  1ZRD A;  4I0A A;  5EEH A;  2STT A;  1W7P A;  1LB2 A;  3BWG A;  4BHP A;  1IRG A;  1U78 A;  2ZBK A;  3DKW A;  1Z05 A;  3HSF A;  4U7D A;  1BI0 A;  4YII A;  1SD4 A;  5F6F A;  4Y13 A;  2FE3 A;  2GQQ A;  2JT1 A;  1TQI A;  4UNO A;  3GFJ A;  1PUE E;  4GO1 A;  2IVM A;  4P9F A;  4IXA A;  2YR2 A;  3RKX A;  1FOK A;  2BEO A;  1BN5 A;  2V1X A;  2XAF A;  3IKT A;  2A61 A;  3LA3 A;  4EJO A;  3QP5 A;  3KEO A;  1Z6T A;  5HS8 A;  5FFX A;  3L2C A;  1PP7 U;  3E6B A;  3GF2 A;  1TQP A;  4CHU A;  2ACJ A;  1P4W A;  4LLL A;  3IKV A;  4HLX A;  1XGM A;  2KJB A;  3KP7 A;  3C18 A;  3ML6 A;  3IWF A;  2P8T A;  2HTJ A;  1RIO H;  1YW9 A;  2ZO4 A;  5H6R A;  2P4W A;  2HKX A;  2R7F A;  4UVB A;  4CO8 A;  5DCM B;  1R23 A;  1ZH5 A;  3FZV A;  2JTV A;  3GX4 X;  4Z2Y A;  2JRT A;  2ZFW A;  3CUQ B;  3C1D A;  1Z7U A;  1XGS A;  5LRR A;  3KLO A;  2BV6 A;  2PEX A;  4HDU A;  2ZNY A;  2UXN A;  1ZRF A;  1YIO A;  1YYV A;  4OMY A;  2VN2 A;  3E6C C;  2CSO A;  2OAZ A;  1O7F A;  4B09 A;  4MQV A;  4NQW A;  4MQ9 F;  2AXL A;  1DUX C;  4EV0 A;  1YO5 C;  2J5P A;  3FMS A;  2EV5 A;  5D8K B;  5BS6 A;  2KRF A;  3MZY A;  1GXP A;  6PAX A;  1BJA A;  3FMQ A;  3TO9 A;  4LJZ F;  2MBF A;  4CZZ A;  2QQA A;  2PQ8 A;  4JK1 X;  3C3W A;  4WXH A;  4I0B A;  3LA7 A;  2B0L A;  4RB2 C;  2GZW A;  2BBY A;  4ESB A;  5CVU A;  2FSW A;  5AIP A;  3V8K A;  4LFU A;  4M9Z A;  4EMS A;  3ROU A;  1IF1 A;  5IT9 Z;  2HR3 A;  2CGP A;  4MHG A;  3GXO A;  5J8F A;  4XSX F;  3L9F A;  2A3S A;  1W7P D;  3DXJ F;  5HVQ C;  4Q4Z F;  1J5Y A;  4L5I A;  4A2U A;  1U5T C;  1D8J A;  3Q9S A;  3F22 A;  1XD7 A;  1O7L A;  2X0L A;  1UHM A;  5CLS A;  2PLY A;  5CJ9 A;  1YW7 A;  3Q9V A;  3MZH A;  5D5U B;  4GYI A;  3QAH A;  4AIJ A;  1XDU A;  2H27 A;  1TTY A;  4G7Z F;  2XAH A;  3T8R A;  4G6Q A;  1SAX A;  1REP C;  4OMZ A;  3ISP A;  1D8K A;  2GXB A;  5DV5 A;  1ZAR A;  4LLG F;  1CF7 B;  3ECH A;  1WI9 A;  3WTV C;  3KP4 A;  1HQC A;  1MJA A;  3C7J A;  4O6J A;  4YFN F;  1BM9 A;  3HRS A;  5E8G A;  1XMK A;  1ZGA A;  2XKO A;  4KMU X;  3ZMZ A;  4ZZL A;  3HHG A;  2D45 A;  5K5R A;  1S8N A;  4IHT A;  5TRD A;  3F8M A;  2BYV E;  1S7O A;  3GWZ A;  2AS5 F;  2DQL A;  4KMF A;  4EJV A;  1WWX A;  2O3F A;  4BNC A;  3R0J A;  4HQM A;  4FHT A;  4ZYH A;  4LK1 F;  3TOB A;  4HOB A;  4A5N A;  2VXZ A;  1JXS A;  3O6B B;  3HIF A;  2LNB A;  2DPD A;  3I59 B;  3U2R A;  3TKY A;  4U88 A;  3JTG A;  1XGO A;  5IT3 A;  4UVA A;  1ZN2 A;  2DFI A;  1UCR A;  3M8E A;  4RGS A;  3PQK A;  5CVI A;  2CFX A;  2VBW A;  2FNP A;  1SMT A;  3VFZ A;  1XDS A;  3G3Z A;  4MEY F;  3CO6 C;  4RB3 C;  4LK0 F;  3WG9 A;  3QP6 A;  4M9X A;  2PBI A;  1HBX G;  4ESJ A;  4Y17 A;  2L02 A;  4TV7 A;  4AIK A;  3WTZ A;  3DPT A;  1P4X A;  3P7N A;  2K02 A;  2E7X A;  3HTS B;  3CJN A;  1H0M A;  2HOE A;  4PCQ A;  1SD6 A;  3EET A;  4UV9 A;  3IRR A;  1ZRC A;  2X4H A;  4BH9 A;  1G6N A;  3ZMD A;  2H94 A;  1KQ9 A;  5D6F A;  5K5Q A;  1UST A;  3WU0 A;  1QQI A;  4LGW A;  1RNL A;  1ON1 A;  2RKH A;  1JHF A;  3FXU A;  2XKP A;  4KYW A;  1B4A A;  4QWQ A;  4ENK A;  1BC7 C;  1F1Z A;  4K2E A;  5LRS A;  5FLX K;  3KET A;  3IL2 A;  4LD5 A;  2DQR A;  5E20 A;  4WXC A;  3FM5 A;  1SFU A;  3J7A O;  2VT3 A;  1D3Y A;  2O6G E;  5KK1 A;  1ZRE A;  3PFI A;  3REO A;  2EJR A;  4KNY A;  2MH9 A;  1P92 A;  4G94 A;  1T0F A;  1MJB A;  2M30 A;  3H3U A;  3RPQ A;  1G3T A;  3BJ6 A;  1LNW A;  5A2Q Z;  2Y0M A;  2VE8 A;  1EH6 A;  2LKP A;  1AOY A;  2GXG A;  3R6S A;  1V3F A;  1ZYR F;  2HWV A;  5BPD A;  5HS9 A;  2MLK A;  4I2O A;  1F5T A;  1QPM A;  4YIF A;  1W7P B;  3HSE A;  3VB2 A;  2ZME B;  1BBY A;  3G73 A;  1EV7 A;  1HW5 A;  1OPC A;  3T1B A;  2UWM A;  3I64 A;  3MCZ A;  4O5V A;  3BJA A;  1F9N A;  4DQ2 A;  2HQR A;  2W85 A;  4M72 A;  2KIM A;  2LF8 A;  3SFZ A;  3MWM A;  3CUQ A;  1WQ2 A;  2IPQ X;  5CVJ A;  1FSE A;  2MLG A;  4ENJ A;  4HV5 A;  1EH8 A;  1E17 A;  3M1E A;  2OZ6 A;  3I58 A;  3B73 A;  3B02 A;  3M8F A;  2D2W A;  2M45 A;  4PDK A;  2DK8 A;  3NEU A;  2QM3 A;  4KN7 X;  2HKO A;  2FBH A;  2DW4 A;  2FBI A;  1LEA A;  5HS7 A;  2JSC A;  1XSD A;  4IVN A;  2L3D A;  4M74 A;  5E1X A;  5BQT A;  3TDZ C;  5LEK A;  1Z1D A;  2L01 A;  4U0W A;  2PN6 A;  2MA3 A;  4DNC A;  4OU0 A;  2M8E A;  1E2X A;  2COM A;  2EFN A;  4WCG A;  3Q5F A;  3ZPL A;  3V7C A;  1WKM A;  1JGS A;  4EGZ A;  4BQA A;  2XAG A;  4R79 A;  3ZN1 A;  3WTU C;  1IXR C;  1S6L A;  4RB0 A;  5FGM A;  4OIR F;  1ZG1 A;  5K1Y A;  2Q2E A;  2EFQ A;  1DPR A;  2XVC A;  3WTX C;  5DEQ A;  2HTS A;  1FZP B;  3F8N A;  2KIU A;  1FPQ A;  4LMY A;  5F64 A;  2ZXJ A;  2KJC A;  3E6M A;  2ZNZ A;  3JW4 A;  4A12 A;  5L3C A;  5L3E A;  3HRM A;  4FX0 A;  4P5O A;  5ERI A;  1ON2 A;  4Q48 A;  1KA8 A;  2EFW A;  2G7H A;  3DF8 A;  1I1G A;  2QLZ A;  1BC8 C;  5D8L B;  5J8C A;  4EVI A;  4MNU A;  4EJT A;  4IPA A;  3GZ5 A;  3M7G A;  2V9V A;  2H6C A;  3HUG A;  4Q47 A;  3TO7 A;  3I53 A;  1FY7 A;  1SFX A;  3BDD A;  4KDP A;  2EV0 A;  3EUH A;  3RTR A;  3V7S A;  2FQ3 A;  3K1P A;  2CO5 A;  4HF0 A;  1U2W A;  4A0X A;  1XCB A;  5CYV A;  2FOK A;  3KE2 A;  3T8T A;  1MGT A;  5ICC A;  4Y15 A;  2M5W A;  1HXD A;  3P9I A;  2DPU A;  2OBP A;  2A6H F;  3FMR A;  2EA4 A;  3WGG A;  5D4R A;  4D0P A;  1OYW A;  5HLH A;  3RI4 A;  1PDN C;  4KFC A;  1YFH A;  3I0T A;  4BYY A;  4PZJ A;  1QZZ A;  1F4K A;  3ERE D;  1K7A A;  4I7H A;  3GLX A;  4N9H A;  5KVR A;  3F8F A;  3JSP A;  4A6D A;  4UVC A;  2DK5 A;  2EK5 A;  2V6C A;  3FF5 A;  2RNJ A;  3FWE A;  5FFZ A;  4M6X A;  3J81 Z;  1B1B A;  1XCV A;  2K86 A;  2RVC A;  3GZ6 A;  3WE2 A;  4IRI A;  2G7U A;  1C0W A;  3VOE A;  2E7W A;  1UHW A;  1TNT A;  3U9G A;  3FX3 A;  1IUY A;  4IF4 A;  2HYF A;  1H9G A;  3BOQ A;  1QO0 D;  5LGT A;  1ULY A;  2V1D A;  1L3L A;  1WSU A;  1Q1H A;  5E1Z B;  1P4A A;  3R61 A;  4EJU A;  1YW8 A;  5HLG A;  1MKM A;  1J75 A;  1RZ4 A;  4A0Z A;  3JAM Z;  5ILU A;  3L00 A;  3WGH A;  2STW A;  2L4M A;  4M71 A;  4RB1 A;  2WWY A;  3H92 A;  3BJO A;  3ZMV A;  2OQG A;  3TOA A;  5FD5 A;  1T6S A;  3TDU C;  2PI0 A;  5J6X A;  1FWZ A;  5D4S A;  3DP7 A;  3P9K A;  2LDU A;  4LB5 A;  3HRU A;  3F23 A;  4MTE A;  3KZZ A;  2YU3 A;  2YX4 A;  4LG0 A;  3F72 A;  2GWR A;  5TJJ A;  1K6O A;  5FB2 A;  4YG2 F;  4YFX F;  4ENM A;  2ISZ A;  3E97 A;  3JTH A;  4FT8 A;  1YG2 A;  1TBX A;  2GA2 A;  1FYL A;  2OD5 A;  2GIV A;  2D1H A;  1FP2 A;  1IAW A;  4KIB A;  3NRV A;  4RGX A;  3ZMU A;  2HFH A;  2XHK A;  5E1W A;  3QRF F;  4BHB A;  4EJW A;  3O3K A;  1LQ1 A;  3OV8 A;  1IN5 A;  3SXY A;  2EA2 A;  3LAP A;  1FNN A;  2OA4 A;  1RUO A;  2IJL A;  3JAM K;  1R22 A;  5FD6 A;  3LQR A;  2QYO A;  2W84 A;  4KUM A;  2A5Y B;  4WWC A;  2CYY A;  1XB4 A;  3KP6 A;  3IHU A;  4RAY A;  3NQO A;  4HF1 A;  5DCF A;  3S2W A;  5A2Q K;  1FC3 A;  2P5V A;  3ZN0 A;  2F2E A;  5E17 F;  2ETH A;  5HDG A;  3GEZ A;  1CGP A;  1ZLK A;  2Z33 A;  5K5O A;  3WTS C;  3E5X A;  1G3Y A;  1MDM A;  1TW2 A;  3N4M A;  4A0Y A;  3QPH A;  5JFR A;  2XIG A;  1ZG5 A;  4O3M A;  2DO7 A;  1KYZ A;  3W6K B;  4LB6 B;  2A07 F;  4RAZ A;  4LG0 B;  4HX8 A;  5BPI A;  4P96 A;  3GFM A;  5CVV A;  4F7Z A;  2EFO A;  2DI3 A;  2ELH A;  3WGI A;  4NHJ A;  1GHC A;  5E18 F;  3I4P A;  4NB5 A;  3EYY A;  4KIC A;  3LST A;  2MC3 A;  2RV8 A;  2PJP A;  3WE3 A;  3ZP5 A;  3F21 A;  1XMA A;  2EB7 A;  2OU2 A;  2EWN A;  4G7O F;  2P6S A;  2H6B A;  2VON A;  1KQ8 A;  3SHF A;  1DPU A;  1UB9 A;  5D5W B;  4G8X A;  5ILV A;  1B9M A;  3MAJ A;  4ZH4 F;  1ZLJ A;  1FT9 A;  4PGG A;  2GAU A;  4HA8 A;  3F3X A;  3SQN A;  1AWC A;  1FLI A;  4S05 A;  3RDI A;  3DQV C;  2GA1 A;  2D1V A;  4L5J A;  2RDP A;  1B59 A;  4L0Z B;  2QBY B;  1HW1 A;  2R7D A;  2F5E A;  3F8B A;  5L3G A;  3DEU A;  1I1S A;  2YSR A;  4M73 A;  5ICG A;  1LDD A;  3R60 A;  3ZMT A;  3FM3 A;  3SZP A;  1YTY A;  1XSV A;  3HSR A;  3K1M A;  3L09 A;  3CO7 C;  1HSJ A;  3K69 A;  2FU4 A;  1O3R A;  1R1U A;  5DD8 A;  3HHH A;  4ZZD A;  1KU2 A;  4KA4 A;  5ICE A;  3K2Z A;  3EQL F;  4G9Y A;  1R00 A;  2VOD A;  1SD7 A;  2ISY A;  1DP7 P;  1BI3 A;  2BGC A;  3BY6 A;  1G4D A;  3QU6 A;  2PFB A;  1OMI A;  1U5T B;  3LFK A;  4ZYE A;  2ZME A;  3F6V A;  4HZF A;  2Q8K A;  4RGR A;  1UFM A;  4L9T A;  2IT0 A;  2IA0 A;  4BHC A;  1X3U A;  4WXD A;  1IRF A;  4CYD A;  1Z91 A;  3VEP A;  2IA2 A;  3JSO A;  2LSO A;  3D0S A;  5ILS A;  3ZMS A;  4M9S A;  5DCM A;  3K1N A;  2HEO A;  2XAQ A;  1J7K A;  3MQ0 A;  2MD5 A;  5DD4 A;  2O61 A;  4EQQ A;  3EDP A;  2XAS A;  1LDJ A;  4MTD A;  1S3J A;  4JQF A;  3WU1 B;  2QQ9 A;  3FXQ A;  5BMZ A;  1KYW A;  1U8R A;  1OYI A;  2RC4 A;  1XN7 A;  5LEJ A;  5HOO A;  4MEX F;  4OOI A;  5AIQ A;  4IRH A;  2XAJ A;  3J81 K;  1KU3 A;  2DT5 A;  4EM2 A;  2IP2 A;  4CDG A;  2Z9O A;  4UV8 A;  1I6X A;  2Z5U A;  3CUQ C;  2L4A A;  4R1H A;  4AIH A;  1TW3 A;  1XGN A;  4I01 A;  5JHU A;  3BRO A;  1BIB A;  3I71 A;  2DBB A;  2P7C B;  2FRH A;  3E5Q A;  3KP3 A;  2XRO A;  1LJ9 A;  1KQ0 A;  3R0A A;  4G7H F;  2FXA A;  3ABT A;  2Y75 A;  2K7L A;  2QUF A;  3V8L A;  1IN8 A;  4GCV A;  2VBX A;  2HS5 A;  2E1N A;  5LBQ A;  2C6Y A;  1RUN A;  3KFW X;  3E6D A;  4WK8 F;  2RQP A;  2QQB A;  5D5X B;  1FX7 A;  3RKW A;  1ZAO A;  1FYM A;  2TDX A;  3FXR A;  3DV8 A;  2JPC A;  3KCC A;  1HKS A;  2FEZ A;  1R5H A;  4U7B A;  2PMU A;  1A04 A;  3V4G A;  2P7V B;  5LLQ A;  4IRG A;  1SFE A;  3RKY A;  3LA2 A;  1SD5 A;  3AAF A;  1USS A;  3QPT A;  3CDH A;  2W24 A;  3ULQ B;  1ZHF A;  2PG4 A;  3I59 A;  2K27 A;  2K4J A;  4WX9 A;  3P9C A;  3H3Z A;  3J80 K;  1TQM A;  2KIF A;  4I02 A;  3BPX A;  2HYG D;  5ICF A;  1G3W A;  1T39 A;  1H9T A;  4XLN F;  4G6D A;  1YQA A;  1Z9C A;  1QNT A;  2YX7 A;  2ADU A;  4MGR A;  1P6R A;  3KP2 A;  3J80 Z;  2WTE A;  1YLF A;  2VC0 A;  2P6T A;  4HX7 A;  2HDC A;  2O0Y A;  1FBU A;  1R36 A;  4XLP F;  4UXN A;  2L54 A;  2JZY A;  1QZY A;  5LHH A;  1ZG3 A;  4KT5 C;  2RGV A;  3QU3 A;  3KZY A;  4LLN A;  3I5U A;  4KN4 X;  2UXX A;  3CTA A;  1L0O C;  4XBF A;  1J0R A;  1GXQ A;  4ESF A;  3GVA A;  1K79 A;  1HKT A;  1ONV A;  1KU7 A;  3HOS A;  2A69 F;  4IHS A;  1NHA A;  2VBY A;  4HQE A;  1YS7 A;  2FF4 A;  2P5K A;  2DAO A;  5LHI A;  1CF7 A;  3KLN A;  4CGZ A;  3E3V A;  2RN7 A;  3MFK A;  1MJ9 A;  4HLY A;  4YFK F;  2EV6 A;  3BZ6 A;  2FNA A;  1JHH A;  3RIR A;  1S7A A;  1FYK A;  5L3B A;  5HDN A;  3RYR A;  2E1C A;  4UHT A;  4L18 B;  2ESH A;  4P9U A;  4GXO A;  1R1T A;  2Y48 A;  2CW0 F;  3RPU A;  1IXS B;  2VBZ A;  5FO5 A;  2HQN A;  2M87 A;  2DTR A;  4N0B A;  4B8X A;  1QGP A;  3LAJ A;  1B9N A;  1T2K A;  3GO5 A;  1U5T A;  3GUD A;  4XRF A;  4AD9 A;  5IT9 K;  1STZ A;  5D6E A;  2EFP A;  2ESN A;  4L9N A;  3HTU A;  3BPV A;  1QBJ A;  3ELK A;  5JR3 A;  1IZ1 A;  1BIA A;  5H6Q A;  4S04 A;  2DU9 A;  2K4B A;  1TLH B;  5DYM A;  1W5T A;  5L3D A;  2CQK A;  5EEG A;  3KEQ A;  3WTY C;  4OIO F;  2PMH A;  1U6G A;  3MEX A;  5H20 A;  2NS0 A;  2HGC A;  2Z3Y A;  1R5G A;  3QOP A;  5D5V B;  2J5O A;  3V8J A;  3F6O A;  3U1D A;  2NNY A;  1J59 A;  1JE8 A;  4HAM A;  4WF2 A;  5HLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...