2TDXA

Diphtheria tox repressor (c102d mutant) complexed with nickel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2tdxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2tdxA02
4BH9A 2LNBA 2ZCWA 5L3DA 2EV5A 5K1YA 2VBYA 2DPUA 1ZHFA 1IN5A 2E7WA 4M71A 4PGGA 3IWZA 4IVNA 4CHUA 3ECHA 1OYIA 3IRRA 4UV9A 4FX0A 4Q4ZF 5D8LB 5BQTA 2VODA 2QQBA 2LF7A 2FNPA 1FT9A 5FGMA 3KP7A 1V4RA 5LHGA 3VFZA 3ZN0A 3ZPLA 1O57A 1DPRA 5LGUA 3K0LA 4N9HA 4ZYHA 1TQPA 4ENMA 4UVAA 1TNSA 2P5LC 2FEZA 2FU4A 3VODA 3WGIA 1OYYA 2K86A 1RUOA 3G73A 2P8TA 1K6OA 2LKPA 2J5OA 3GW2A 4ENNA 3CLOA 1P2FA 3LA3A 3CDHA 3LQRA 2VONA 4B8XA 4I0BA 1ZAOA 2EV6A 5K5OA 1HW1A 5HOOA 1FP2A 2M5WA 1R36A 1IF1A 2O6GE 1KQ9A 3GXOA 4G9YA 4OINF 3WTSC 1JGSA 4KA4A 2OBPA 1ZLJA 5D5XB 2X4HA 4PGHA 4F7ZA 2IT0A 2P5KA 4WXDA 4KFCA 4LG0B 1WSUA 2CFXA 4KNYA 1IXCA 1AWCA 3IKTA 4MNUA 1IN6A 2DK5A 5CVUA 3K2ZA 2A6HF 2VOPA 2V1DA 4O3MA 2VOOA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1B6AA 2XHKA 3BWGA 2XAFA 3REOA 1XGNA 2OA4A 1O3TA 2DAOA 5A2QZ 2HTSA 3PQKA 2DI3A 1LEBA 1O3SA 3E5UA 4Y17A 4PDKA 2W84A 3ABTA 3TOAA 4NHJA 4NB5A 2ZJ2A 2O61A 3FXQA 4M9ZA 2STWA 1FYLA 1CF7A 4RGXA 3J7AO 4YG2F 5AIQA 1FSHA 2MLKA 3CO6C 1B9MA 3I58A 4XRFA 4RGSA 2FRHA 3BROA 3EQLF 3Q9VA 1DP7P 1P4XA 2RDPA 2PQ8A 1G3SA 4RB2C 2OAZA 1YG2A 5HLIA 2STTA 2V1XA 5HS9A 4IRIA 4LK0F 5HDGA 1S7OA 1BIAA 2Y0MA 2PN6A 4AIHA 2VXZA 4IJAA 1ONVA 4RAZA 1P4AA 1KA8A 2EA2A 2PMUA 1S6LA 2QQAA 4HBLA 1IXSB 3CUQC 4UHTA 4IF4A 2OZ6A 4EM1A 1MJ9A 1MGTA 2IA1A 2IW5A 1YS6A 1G3WA 2OD5A 1MJAA 1NHAA 2E7XA 2G9WA 5HS8A 1R1UA 2ZNZA 4IHSA 4G7ZF 5E20A 3HHGA 4L9TA 4ZYDA 2F5FA 4U88A 2EK5A 2LF8A 3DXJF 2EB7A 1P92A 2HQNA 4I0AA 3WTTC 2RQPA 5LHIA 1USSA 4HF2A 4ASNA 3RPUA 2PLYA 1TQIA 2E1NA 2VT2A 2PI0A 4MHGA 4P9UA 4WX9A 3V8KA 2WWYA 1QQIA 5DD8A 3HSFA 3E6DA 2RNJA 1XCVA 2DU9A 3T1BA 5BOXA 2ZBKA 4Q5SF 3M9AA 1K7AA 1HSTA 2PG4A 3MCZA 1J0RA 5LLQA 3FMQA 3E3VA 4JK1X 3KP2A 5E1WA 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 1W5TA 1YW7A 5TRDA 4Y15A 4UVCA 3WTWC 1O7LA 1ZN2A 3WE2A 5AIPA 5DCMB 2NAZA 2HTJA 2FXAA 3I59A 4MTDA 1RZ4A 5DUKA 1K79A 3HTSB 1H9TA 3BJ6A 4O6JA 1WKMA 2OQRA 1ZREA 2BBYA 4R1HA 3U1DA 3BY6A 2FNAA 2DT5A 3ZMDA 5F64A 5BPDA 2K7LA 2QZ8A 3NEUA 2L4AA 3L7WA 4A0YA 1OMIA 3GX4X 1C0WA 4L0ZB 4RGRA 3K9TA 1RI7A 3V7RA 2EA4A 4I98B 3E6CC 1B9NA 3K1PA 2JZYA 2MC3A 3VEPA 4A12A 3KFWX 3R4KA 1G3YA 2D1VA 5ICCA 1WRJA 2HR3A 3TKYA 2XAHA 1SAXA 3I5UA 1USTA 2LDUA 3F8FA 3MZYA 3F3XA 4HX4A 3ABUA 2ISZA 2YU3A 3Q5FA 2FMLA 5CVRA 5H20A 3JSPA 3SFZA 2EFNA 2XIGA 2BGCA 2CGPA 1T6SA 5AONA 3KP4A 1TBXA 4IPAA 3ROUA 1FYMA 1ON2A 3SZPA 4YFNF 2NYXA 3C18A 2EWNA 3LAJA 1FWZA 2VE8A 2HZTA 3P7NA 3KZZA 2DLLA 2DQRA 4LG0A 5HLGA 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 2XROA 1BI3A 2BYVE 2BV6A 3E5XA 1D8JA 2H6CA 4BYYA 1YIOA 5ICGA 2P6TA 3EYIA 1ZGJA 3P9CA 3T8RA 5FLXK 2O03A 4QLCU 1HW2A 2OQGA 1K78B 1KU7A 4KMUX 4HV5A 1XGSA 2L02A 2DPDA 4QWQA 3NQOA 2A68F 3GYHX 3IC7A 3WGHA 1ZGAA 1LEAA 2GWRA 3SHFA 1ZRCA 1Z05A 2ZKZA 1Y0UA 2QENA 4L5JA 1J9IA 4A6DA 1V3FA 5H6QA 4RB0A 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 4ENJA 1LQ1A 1EH6A 4EVIA 3N4MA 1D3YA 4UV8A 1OPCA 1BC7C 4YIFA 4MEXF 2GZWA 4R8HA 4HQEA 1X3UA 5D8KB 1FP1D 2RGVA 1R1VA 2VC0A 1LNWA 2M45A 2PJPA 3HRMA 3AAFA 3MEXA 3MQ0A 3ZMSA 1LDKB 2Y75A 4ESBA 2IPQX 2OU2A 1R58A 3V7CA 4LB5A 3ULQB 1TW3A 1KU2A 1SMTA 3CJNA 2Z5UA 4HAMA 3VOEA 1PDNC 4G6DA 1YS7A 1FBSA 1U8RA 1R22A 5K5QA 1CGPA 1SD7A 3ZP5A 1XCBA 1XMAA 5KK1A 1EH7A 2KIMA 3GF2A 5E18F 2XUBA 3O6BB 1G6NA 4MTEA 2A3SA 3NRVA 2DQLA 1ZG5A 1HQCA 1XDSA 1GXPA 2M1BA 3D0SA 4AD9A 5F6FA 1MJBA 2CG4A 4U0WA 1Z91A 2GA1A 3BPXA 1FY7A 1TLHB 4Q48A 1RIOH 3DPTA 3TO7A 3ECOA 1QO0D 3F22A 3FMSA 1ZG1A 5BPIA 1MKMA 1QZZA 3H92A 5HDKA 2FOKA 1FC3A 3VB2A 1F9NA 3HSRA 3FWEA 3I71A 5DV5A 5E17F 4YIIA 2KRFA 1REPC 5ICEA 1UHWA 3K1NA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 3F8CA 3J81K 4HF1A 1T38A 2ISYA 4NQWA 4KDPA 1YYVA 5LHHA 4MQVA 1YQAA 5DCMA 3T5XA 5CLSA 3WU1B 3ZN1A 3TGNA 2UXXA 4I09A 2H94A 3HSEA 4RB1A 3F72A 3QOPA 4Y13A 3GFLA 3EDPA 3IWFA 4KUMA 3JAMK 5BMZA 2QBYB 1B59A 1R7JA 5HS7A 1SD6A 1P4WA 4I01A 3B73A 3LA7A 1QBJA 3ZMVA 3R0AA 2HS5A 2Z3YA 3F8BA 4OU0A 1TNTA 2PFBA 4MQ9F 3TOBA 5CVIA 2YX7A 2GQQA 2XAQA 1R5GA 2D45A 2GAUA 3KE2A 2BE5F 4AWXB 3FXRA 4UUVA 3DQVC 1PUEE 3T8TA 1HBXG 1XSDA 4OIPF 3V8LA 4EM2A 3RI4A 2EFPA 5DUIA 3WTUC 4K2EA 1HW5A 4KIGA 1YLFA 3QRFF 3RYPA 2FSWA 3V8JA 1XMKA 5LBQA 5JR3A 1AOYA 4CXFA 1J2XA 4I2OA 5E8GA 5D5VB 1QZYA 4BXUA 4GYIA 3F8NA 3C3WA 1KQ8A 2HGCA 4LLNA 2XGXA 3IHUA 2KIFA 2Q0OA 2QYOA 3RPQA 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 2KIUA 2RKHA 3R6SA 4B09A 2MH9A 3E6MA 3KZYA 3QAHA 4PZJA 4CICA 3MAJA 1O7FA 2YR2A 5J8FA 4L5IA 4M73A 4U7DA 1IN8A 2OZUA 3O3KA 2XASA 4CYDA 2WC2A 1G4DA 5FFXA 2CWEA 3FF5A 2GIVA 3FXUA 1YTYA 3QU6A 1Z6RA 2PMHA 1KYZA 2XAGA 2R3SA 3GFIA 2AXLA 2KJBA 3HOSA 5HLHA 4N0BA 4L9NA 4S05A 1BIBA 1K78A 1MD0A 3FZVA 4G7HF 4KYWA 1SD4A 2CYYA 5L3EA 3WTXC 2YPRA 1SD5A 4HA8A 4P9FA 3HRUA 1G3TA 2EFQA 1W7PB 3I53A 5JFRA 3N97A 1KGSA 3R60A 4ON0A 2P4WA 4U7BA 3KETA 3TO6A 4A2UA 2NNNA 3MFKA 2P7CB 1GXQA 4LD5A 3FM3A 3WU0A 4HDVA 1S7AA 2HDCA 1XGMA 3LAPA 4HX7A 2D1HA 2HYFA 4GCVA 5FD6A 3MZHA 3MWMA 2TDXA 2KKOA 2F5CA 1UHMA 1H9GA 2YSRA 5FLXZ 1HKSA 2CQKA 4ZZDA 3TQNA 2VT3A 4TV7A 2FBIA 2ACJA 1FZPB 4BHBA 2L4MA 4ENKA 1F1ZA 4KMFA 4ZYEA 4HF0A 4HYEA 3G3ZA 2HQRA 5KVRA 2P7VB 2V79A 4FX4A 2G7UA 1JHFA 3KP3A 4RGUA 2Z99A 3R61A 4G8XA 2VBXA 1R1TA 4CZZA 1U2WA 1VTNC 3GZ6A 1L3LA 1I6XA 3WG9A 2D2WA 3GUDA 4YFKF 2DTRA 5DD4A 1RUNA 4WF2A 1J7KA 4EM0B 5ED4A 3HIFA 3K1MA 1FYKA 1I5ZA 1JXSA 2L01A 4RB3C 1XN7A 4BNCA 2R7DA 4FT8A 2UZKA 4IHTA 2W25A 1U5TB 4IRGA 2RVCA 4A6EA 1U3EM 2L3DA 5LRSA 3QPTA 4EV0A 3J80K 2JPCA 3M8EA 3LA2A 5FO5A 2ETHA 4KT5C 4WXHA 1XB4A 5DYMA 3BJOA 2GXGA 1BOAA 1MDMB 2G7HA 1WQ2A 1I1GA 3BDDA 4A0ZA 4OIQF 3M8FA 1FNNA 4EJUA 1T0FA 2F5DA 3BOQA 1DDNA 4OMYA 2Z9OA 1LJ9A 4EGZA 4P5OA 2PBIA 1SFEA 3BP8A 2L54A 3HYIA 3KLOA 1LDJA 2A07F 2QBYA 3GWZA 3CO7C 2VC1A 1Z7UA 3M1EA 4XBFA 4M72A 3ZMTA 5K5RA 1QPMA 5LGTA 2M30A 5LEKA 2MBFA 3PQJA 5L3FA 4L0YB 3DPLC 2ELHA 3C7JA 3OOPA 4HQMA 3K69A 3I0TA 1R00A 1SFXA 3J81Z 2HWVA 2QQ9A 4RS8A 3GVAA 2HKOA 1XD7A 1ZG3A 3EETA 4MGRA 2VBWA 1UB9A 4LMYA 5FD5A 4PCQA 1D8KA 4YFXF 1IN7A 2A5YB 2F2EA 3V4GA 3PFIA 4I7HA 3QPHA 3V7SA 1TQMA 1GVJA 1FX7A 2MH2A 4OMZA 3JAMZ 4IXAA 2Q8KA 1ON1A 3F21A 3RIRA 1BI1A 2RV8A 3HOTA 2FBKA 2A69F 5IT9K 2FE3A 1IN4A 1J75A 2A6EF 4OOIA 2CO5A 4BAYA 3ML6A 2NNYA 5D5WB 4Q47A 3GEZA 1IRGA 1D5VA 5H6RA 4KN4X 4M9XA 4KICA 1DPUA 3I59B 2QM3A 2MD5A 5J8CA 3O2PE 4L9VA 4LJZF 3ERED 2GA2A 1E17A 3WTZA 4D0PA 1R5HA 2RC4A 2JRTA 4EJWA 5L3GA 4HLYA 2IA0A 2P6SA 3HHHA 1IW7F 1LVAA 1OR7A 1SMYF 5FB2A 3OV8A 1ZRDA 3EYYA 2FMYA 2K27A 2HOEA 1Z9CA 5ERIA 3ELKA 1J59A 2V1UA 1TTYA 2Z33A 3JTHA 4WWCA 5DCFA 3WTYC 2ESNA 4M6XA 4P55A 4AIJA 1W7PA 4XSZF 2AS5F 3BZ6A 2O8XA 5TJJA 1I27A 4WXCA 2EJRA 3WGGA 2BEOA 2DO7A 3KEOA 2EFWA 2IRFG 3HUGA 2EFOA 3FX3A 5F1RA 5JHUA 3Q9SA 4R79A 3HRTA 1OYWA 4GXOA 1B1BA 2QWWA 2RN7A 4U0YA 3COAC 1KYWA 3LWFA 3KCCA 4GO1A 1T98A 3CUQB 4M6YA 3L2CA 2M8EA 1KQ0A 2K02A 1FBQA 1RNLA 1B4AA 2ZFWA 3GLXA 2FF4A 3DEUA 4XLPF 3RJPA 1IUYA 2W24A 4S04A 4EJVA 5ILVA 2HKXA 3E97A 4CDGA 5CVVA 1QGPA 5DDGA 4CO8A 4HX8A 4GYGA 1BJAA 2J5PA 5HDNA 4G94A 2H27A 1WWXA 3F6OA 2XV4S 1ZLKA 1HKTA 1YW9A 1KU3A 4XSXF 1ZYRF 5LGNA 2UWMA 4UVBA 2JSCA 2UXNA 2O3FA 1BI2A 2HFHA 2ZMEB 1FSEA 4HOBA 3KP6A 2QLZA 5L3CA 2VBZA 2MLGA 1U5TA 4A5NA 1UFMA 4EMSA 4LLGF 5JVTA 1FBUA 3LFKA 1O3QA 3L9FA 1U78A 2W85A 3LQQA 1MDMA 3IKVA 4H0EA 5ICFA 5D4SA 1IAWA 1ULYA 2F5EA 1P6RA 1S3JA 3B02A 4Z2YA 5ILUA 2CSOA 1Z1DA 4HDUA 3RKYA 1WI9A 2ESHA 2XKPA 2C6YA 1ODDA 3KP5A 5CVJA 1TW2A 4U0VA 3SZTA 1W4MA 2FBHA 4CGZA 4M74A 2ZNYA 2FA5A 3C1DA 4HZFA 2EV0A 2W57A 1Q1HA 1IRFA 4G7OF 4KIBA 6PAXA 2LSOA 5E1ZB 4EGYA 4BHPA 4KN7X 4WCGA 1XSVA 2WTEA 5EEHA 3J80Z 4LGWA 1F4KA 4MEYF 4O5VA 4JBAA 2K4BA 5A2QK 2P5VA 4DNCA 3WODF 3WTVC 5E1XA 1YO5C 5DEQA 1A04A 2DW4A 3E6BA 1ZH5A 3HRSA 2PEXA 4G6QA 3DP7A 3E5QA 3L00A 2V9VA 2A61A 1MZBA 5CJ9A 3GFJA 2E1CA 3R0JA 3TO9A 2JT1A 5L3BA 3DV8A 3T0YA 2DK8A 5BS6A 4WK8F 2Y48A 3L09A 1PP8F 1S8NA 1JHHA 4FHTA 1T39A 2XRNA 1YW8A 4EJOA 4XLNF 1O3RA 1QNTA 2IP2A 4RAYA 5D5UB 2XVCA 4LLLA 3DF8A 3F23A 1IZ1A 1FOKA 1J5YA 2QUFA 2M87A 4HLXA 3GZ5A 1U6GA 5FFZA 3ZMUA 2B0LA 2JTVA 1UCRA 4BQAA 2O0YA 1H0MA 4IRHA 3RYRA 3I4PA 1SFUA 1XDUA 4I02A 3F8MA 5CYVA 1ZRFA 1HXDA 3FMRA 3RDIA 5J6XA 3JTGA 4OIOF 5JI6A 2IA2A 1BN5A 1S29A 2NRAC 3ZQ7A 1GHCA 5IT9Z 1ZARA 1XGOA 2HEOA 3EUHA 4A0XA 1CF7B 2ADUA 3CTAA 5LEJA 4L18B 3GO5A 1L0OC 5IT3A 2NS0A 1F5TA 4M9SA 2Q2EA 5D6EA 3RTRA 4A5MA 4JQFA 4P96A 3SQNA 1EV7A 5EEGA 2KJCA 3IL2A 2HYGD 1BI0A 2ZXJA 3QP5A 5ILSA 2H09A 4BHCA 2V6CA 2ZO4A 3M7GA 3W6JB 2FQ3A 4EJTA 3RKWA 2R7FA 3GFMA 2K4JA 1IXRC 3HTUA 1BM9A 5LRRA 4E70A 3BPVA 4EQQA 3CUQA 4L9JA 3IRQA 2MA3A 4AIKA 3JSOA 2YX4A 3KEQA 4ETSA 3U9GA 4KIFA 3U2RA 3LSTA 1HSJA 1E2XA 3QU3A 1PP7U 2H6BA 4LB6B 1LB2A 4ZH4F 3H3UA 3JW4A 1HKQA 4LK1F 1I1SA 2CW0F 1JE8A 4HW0A 1FLIA 2COMA 2XKOA 1LDDA 2IJLA 4OIRF 5E8IA 3I54A 3P9KA 4HV6A 1BC8C 4ESFA 2GXBA 1EH8A 3DKWA 2DBBA 3DFGA 3I64A 3F6VA 2ZMEA 2IVMA 1BBYA 3S2WA 3H3ZA 1STZA 2DFIA 5HVQC 2WV0A 5D6FA 2JPBA 4DQ2A 1U5TC 5D4RA 1T2KA 4ESJA 1KU9A 3CUOA 1R23A 1XSXA 1FPQA 3BJAA 3P9IA 4ZYGA
chains in the Genus database with same CATH superfamily
2JUGA 4BH9A 2BHZA 2LNBA 2ZCWA 3V42A 2LMDA 2KIQA 4U87A 3LSJA 5L3DA 4BS9A 2EV5A 3IP4B 2VBYA 5K1YA 3GTPJ 2EPFA 2Y9ZA 4D9JA 2DPUA 4ZDPA 1ZHFA 1IN5A 3MD2A 2E7WA 2M7AA 2COBA 1A6IA 4M71A 4PGGA 3IWZA 4IVNA 9ANTA 1JI8A 2M2EA 4CHUA 1D1AA 5JVGF 3PNYA 1YRNA 3FXKA 3ECHA 1OYIA 3IRRA 4UV9A 1F43A 3ZCOA 3OYEA 4FX0A 4Q4ZF 5M5YJ 1QHGA 4ANJA 5D8LB 5BQTA 2M8GX 2VODA 2QQBA 3VPRA 2LF7A 2FNPA 1BW5A 1FT9A 5FGMA 3KP7A 1Z3YA 4BQQA 1W0UA 1V4RA 5LHGA 3VFZA 3ZN0A 4HPQA 4AU7A 3ZPLA 1O57A 1DPRA 3GLLA 5LGUA 3PL8A 3K0LA 1PVEA 4N9HA 4XICA 4ZYHA 1TQPA 3OS2A 1O4XA 1SAUA 2VQGA 4XRSG 2EZKA 4ENMA 2EQRA 4UVAA 4QPOA 1B8IB 4N4NB 5FLMJ 1TNSA 2YUSA 2P5LC 2FEZA 2MW8A 2XSJC 1ZGWA 2FU4A 3VODA 3BR6A 3WGIA 3J7ZI 2R5YA 5J1RA 1OYYA 2K86A 1VQ8I 1RUOA 3G73A 2E2HJ 2CRGA 1F36A 2P8TA 2WAEA 4KITB 2LKPA 1K6OA 3FKIJ 2M4GA 2J5OA 3GW2A 1GLNA 4ENNA 2ZB9A 3CLOA 1VFCA 1IDZA 1P2FA 3CCRI 3LA3A 3CDHA 4CA0A 3LQRA 2VONA 3PO2J 3U21A 4B8XA 3LSRA 3W2AA 2LLKA 2M7BA 5EZHA 1MSFC 4I0BA 4X6AJ 1G2HA 2CQNA 1ZAOA 2EV6A 3JR9A 4PK4A 5K5OA 4PUSA 1X1PA 2IEKA 1HW1A 5E3LA 3CMMA 4DYQA 5HOOA 3CC4I 2WBMA 1FP2A 3CLQA 4A3MJ 1XS9A 1GT0C 2Z2SB 2M5WA 1R36A 1IF1A 3PIPF 2O6GE 1KQ9A 2BW3A 3DTEA 4A3LJ 3M07A 3GXOA 4G9YA 3S1QJ 4OINF 1EA3A 2XPWA 3WTSC 1JGSA 4KA4A 1SFKA 3BR1A 2OBPA 1ORKA 1ZLJA 3HBLA 5D5XB 2X4HA 3RQ4A 3MKZA 3CF5F 4PGHA 5DS9A 2K3FA 4F7ZA 2IT0A 2R92J 2P5KA 4D5CA 2FQ4A 4WXDA 4KFCA 4LG0B 3L2WA 1WSUA 2CFXA 3L2VA 3UKGA 3OYHA 4KNYA 1QVUA 1IXCA 1AWCA 2VKDA 3S8PA 3IKTA 4MNUA 2VB6A 1IN6A 2DK5A 3BT9A 2X48A 4E7LA 1X1CA 5CVUA 3K2ZA 2A6HF 2VOPA 2V1DA 2WY8Q 2MUNA 3OR1C 4O3MA 2VOOA 1OLTA 4RDUA 4ITVA 2Z1DA 1NK3P 4A3CJ 3HKZN 3K6GA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1E0EA 4NBQA 1B6AA 2XHKA 3BWGA 2LD5A 2XF6A 1Z3XA 2XAFA 3REOA 3G71I 1XGNA 2DOEA 2OA4A 2HNHA 1P7JA 1O3TA 2DAOA 5A2QZ 2VKVA 2HTSA 2QF7A 4NC6A 4C3HJ 5EJCA 3PQKA 1GDTA 2VUMJ 2DI3A 2KLOA 2MVTA 3CF2A 2F6CA 1LEBA 1O3SA 3E5UA 2FJ1A 5KCMA 1JTXA 4Y17A 5LFAA 3D5RC 1IUFA 4IL6C 3FK6A 3ZQCA 3G2BA 4PDKA 2OTLI 2W84A 3DLAA 5E3MA 1BA5A 5DM7F 4BJTA 1MMDA 3ABTA 3CZ6A 3GTJJ 3Q0UA 3TOAA 1B72B 2NVUB 2FD5A 4NHJA 4NB5A 2ZJ2A 4XKWA 3FXQA 2O61A 5F08A 4BXXJ 3FIWA 4M9ZA 3QOEA 2STWA 1JKPC 2DMTA 1XX5A 3K2AA 1FYLA 2V9PA 4RGXA 1CF7A 4YG2F 3AFHA 3ZRGA 3J7AO 2QEXI 5AIQA 4XONA 1I50J 3BCAA 1FSHA 5KNLA 2MLKA 3CO6C 1B9MA 1WGXA 3OYAA 3I58A 4UB8C 4XRFA 4RGSA 4XKVA 2FRHA 3BROA 1AA7A 3EQLF 3Q9VA 4BQOA 3MZ8A 1DP7P 1X58A 1HC8A 1P4XA 2RDPA 2O5RA 2PQ8A 4B1RA 1G3SA 4RB2C 4D7MA 3F0CA 2JUCA 2OAZA 3KEYA 3LSIA 1I3AA 1YG2A 5HLIA 2STTA 2V1XA 5HS9A 4IRIA 1FIPA 5J1YA 2JA2A 4LK0F 2XAUA 5HDGA 4Y4RA 4LOCA 5C4XJ 1S7OA 1BIAA 4C9YA 2Y0MA 2PN6A 2QCOA 4AIHA 3DU5A 1OJLA 5EYRA 2VXZA 5J4YA 2A05A 4IJAA 3PNTA 1FOYA 2IS2A 1ONVA 1TWHJ 4RAZA 1P4AA 3SYTA 2EH3A 1AKHA 3W6VA 1KA8A 2EZIA 2P0WA 1WFXA 3GTKJ 3J7AY 3DKXA 4HSTA 3DBHB 2X85A 2EA2A 2PMUA 3TW7A 2PMZN 1S6LA 4C2TA 2HYJA 4XR6A 2QQAA 4HBLA 1IXSB 3CUQC 4UHTA 3S1NJ 1WVRA 4IF4A 4C2MJ 2OZ6A 4EM1A 1ETOA 3OIOA 1MJ9A 1MGTA 3CCEI 2IA1A 5LD2C 2IW5A 1YS6A 1GVDA 1G3WA 2OD5A 3W3CA 1MJAA 1UJ8A 1NHAA 2DMPA 2E7XA 4QIWN 4XIDA 4XN3A 5GPAA 2G9WA 5EGOA 5HS8A 1R1UA 1I3QJ 2ZNZA 4IHSA 4G7ZF 5E20A 1BOBA 3HEFA 3HHGA 4L9TA 4ZYDA 4X0GA 2F5FA 4U88A 2HVQA 1D1BA 3A03A 3ZQQA 1HOMA 4PSXA 2EK5A 2LF8A 2KRCA 3A02A 3PIOF 1R4MB 2L9NA 3DXJF 3S32A 2EB7A 5IP7J 4XK4A 1P92A 2HQNA 4I0AA 3WTTC 1Z77A 2RQPA 5LHIA 3BQYA 1USSA 4GRIA 3X2QH 4HF2A 1R4NB 3BG5A 4ASNA 3RPUA 2PLYA 2JWTA 2WAQN 4KT6A 1TQIA 2E1NA 2IGMA 2VT2A 3CCJI 2PI0A 1N25A 4MHGA 3H9GA 2W1OA 4P9UA 1W0TA 4WX9A 2F5VA 3C2BA 3V8KA 2WWYA 4D7NA 1QQIA 5DD8A 3HSFA 3E6DA 3HOYJ 3K4JA 2RNJA 4C3IJ 1WHUA 1XCVA 3BG9A 2DU9A 1PYVA 3H9JA 3OMYA 3T1BA 5BNGA 2L7MP 5BOXA 2ZBKA 3L1PA 5GAEJ 2JK3A 5IYBJ 2DJIA 2F4MB 3EUKL 3VYUB 5HNHA 4Q5SF 3M9AA 1K7AA 4IHVA 1HSTA 2PG4A 3MCZA 1AHDP 1ZR2A 4A3IJ 1J0RA 5LLQA 3MN2A 4B43A 3FMQA 3E3VA 4Y3OA 4JK1X 3GTOJ 3KP2A 5E1WA 2CW8A 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 3S1RJ 4HEA2 1W5TA 1YW7A 3OYNA 1N77A 5TRDA 4NQWB 3M8JA 4Y15A 1QRYA 2HOTA 5FRMA 3A2KA 4UVCA 4BDYA 3DEEA 3WTWC 1O7LA 1ZN2A 4RM2A 3WE2A 5AIPA 5DCMB 2NAZA 2VQHA 2Z16A 2HTJA 2FXAA 3I59A 4MTDA 1RZ4A 2P81A 5DUKA 1K79A 1ZKGA 3HTSB 1H9TA 3BJ6A 4YELA 2YU9J 4IO9F 3HXLA 4PJMA 2F48A 1D0ZA 2F4IA 3OOUA 3RSNA 2LY9A 1WKMA 4O6JA 2OQRA 1ZREA 5IYDJ 2BBYA 2RQQA 4JOMA 2WADA 1H88C 4R1HA 4G6TB 3U1DA 3BY6A 4W1UA 3H1CA 2BY2A 2FNAA 2DT5A 1TT5B 3ZMDA 5F64A 2K9MA 5BPDA 4BDZA 2VJ5A 3BG3A 2K7LA 2QZ8A 4BY7J 3NEUA 1SEUA 1K6YA 4YRVA 2L4AA 3L7WA 4A0YA 1OMIA 1MBEA 1OISA 3K10A 1S72I 3NAUA 4PSWA 3GX4X 1UMQA 1C0WA 4L0ZB 3LL7A 4RGRA 3K9TA 1RI7A 5M3FJ 3V7RA 2EA4A 2EINH 2PMZA 1VI0A 4HRIA 1X1AA 4I98B 3E6CC 1B9NA 3K1PA 2JZYA 2MC3A 3VEPA 4A12A 1KZHA 3KFWX 1Y39A 2HDDA 3BG6A 3R4KA 1B8IA 3CDLA 1G3YA 1XTAA 2LBFB 4LITA 2D1VA 2DT7B 3AG1H 4Z6YA 5ICCA 3PSFA 1ITYA 2CU7A 2CV2A 1WRJA 4X1EA 2HR3A 3TKYA 1Q1VA 2XAHA 2GBYA 1MBHA 1SAXA 3I5UA 1USTA 2LDUA 1D0YA 3F8FA 3MZYA 2AQEA 3F3XA 4HX4A 2R7QA 2IS1A 3ABUA 4II2A 3GBGA 4M3GA 2X6XA 2ISZA 4RA2A 2YU3A 3Q5FA 2FMLA 5CVRA 1OFCX 5H20A 2O9LA 4ZTFA 4MLOA 3JSPA 3SFZA 2EFNA 2XIGA 3EPZA 2WAQA 1HLVA 2ME6A 2L5QA 2E71A 3S3MA 1H89C 3TBIA 1VF9A 2BGCA 1VQ9I 2CGPA 1T6SA 3G4SI 1LKXA 2VIXA 1TWAJ 5AONA 3KP4A 1TBXA 4IPAA 3ROUA 2RREA 1FYMA 3I4MJ 1ON2A 1OCPA 3SZPA 4YFNF 1U0JA 3TL4X 3M3YJ 3L2RA 2V4JC 3KX2A 2NYXA 1JJ8C 4IZZA 1R6RA 2W7NA 4CH7A 2QKMB 3C18A 2HXIA 1X1BA 2EWNA 3VYTB 3LAJA 1FWZA 2N8GA 2VE8A 2HZTA 1JJ6C 3P7NA 3KZZA 1HF0A 2VKEA 3B6AA 2DLLA 2DQRA 4LG0A 2E5NA 5HLGA 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 1DQUA 1BI3A 2DA7A 2XROA 1JKOC 2BYVE 4FTHA 2BV6A 3E5XA 4BBSJ 1D8JA 2H6CA 4BYYA 1YIOA 1JUPA 5ICGA 1A31A 3J7YJ 2P6TA 3EYIA 1ZGJA 2R7RA 3P9CA 3T8RA 3JRCA 5FLXK 2O03A 1Z21A 1W36D 4QLCU 1HW2A 1LFPA 2OQGA 2B9SA 1ZTRA 1K78B 1KU7A 4KMUX 1I6HJ 2DMNA 4HV5A 5K7ZA 1XGSA 2L02A 2DPDA 3MKWB 4QWQA 3ZQFA 3NQOA 2A68F 4MO7A 2BHYA 3GYHX 5F04A 1LFUP 3IC7A 2B63J 2KP6A 3WGHA 2CQ7A 1ZGAA 4A93J 1LEAA 3FBIB 2L7KA 2GWRA 3SHFA 1ZRCA 2V6EA 1OCRH 1Z05A 2K5CA 3VYRB 3MKYB 1T95A 1IJWC 2ZKZA 1Y0UA 4XKCA 2QENA 4L5JA 5J1UA 1J9IA 1B72A 3QQAA 2H8WA 5TISC 4A6DA 4D1QA 2BOLA 1DU6A 1V3FA 1WPKA 5H6QA 3CCLI 4RB0A 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 4ENJA 2O7OA 1LQ1A 1EH6A 2XPVA 1MIJA 4EVIA 3ESWB 1YITI 2LK2A 5EG0B 3CESA 3FBNB 2OUMA 3D1NI 3N4MA 1D3YA 4UV8A 5M5XJ 1OPCA 1BC7C 3QODA 3ZR8X 1GV2A 4YIFA 4MEXF 2GZWA 4R8HA 4HQEA 1UZCA 1X3UA 4RM3A 2DYRH 2OC6A 2KZVA 5D8KB 1FP1D 1HCRA 1FEXA 2RGVA 1M1EB 1R1VA 2VC0A 5IY5H 2KHMA 1LNWA 2I5UA 2M45A 2XRLA 3OYLA 2PJPA 3HRMA 3AAFA 1RRJA 3MEXA 2BVLA 3MQ0A 1UELB 3ZMSA 1LDKB 2Y75A 3VSKA 4ESBA 2NS8A 3CCSI 2IPQX 2OU2A 2EIMH 1R58A 3V7CA 4CCLA 3BZKA 3HOUJ 2IAIA 4A3EJ 4LB5A 3ULQB 1TW3A 1KU2A 1SMTA 3K4LA 4RAFA 3CCUI 3CJNA 2Z5UA 4HAMA 3DPUA 2R5ZA 5GAGJ 3VOEA 2NVXJ 1PDNC 1TWFJ 4G6DA 2M35A 1YS7A 1D0XA 1FBSA 3K4CA 4DOZA 1U8RA 1R22A 5K5QA 1CGPA 1SD7A 3ZP5A 2CUJA 4I99C 1XCBA 1X4PA 3Q3SA 5M5WJ 1V54H 1GUUA 4E7SA 1XMAA 2WB1N 5KK1A 2HQAA 2ZFUA 4CUGA 2H1KA 1EH7A 1XG1A 2KIMA 3W2VA 2KPMA 3GF2A 2XUBA 5E18F 2IXSA 3O6BB 2V26A 4ZC3A 3OY9A 1G6NA 4MTEA 2A3SA 1DP3A 3NRVA 2DQLA 5EF6A 1ZG5A 2NS7A 1HQCA 4B48A 1XDSA 2HDWA 1GXPA 4Y33A 2M1BA 3D0SA 4AD9A 5F6FA 5FLXR 2JQ7A 1MJBA 3RKQA 4B3AA 3TP3A 2CG4A 2FOWA 2LFBA 4U0WA 4W97A 1Z91A 2GA1A 3BPXA 1FY7A 1TLHB 4Q48A 3WHCA 5C4JJ 1RIOH 2JA7J 3DPTA 3TO7A 2XGDA 2UV1A 1V55H 3ECOA 1QO0D 2MFZA 3F22A 4QTRA 2X6YA 3FMSA 3E7LA 4AYBN 1R49A 2Y0SN 2AO9A 1ZG1A 4C2UA 1IRZA 4IEJA 5BPIA 1MKMA 1QZZA 3QPSA 5J47A 1VZ0A 3H92A 2V7FA 2HOSA 4HNUA 5HDKA 2FOKA 3I56I 3OYBA 1FC3A 3VB2A 1F9NA 3HSRA 1YIJI 3FWEA 3I71A 5DV5A 4XORA 5E17F 1YX5A 2DCEA 3CJRB 1HDDC 4YIIA 2KRFA 1REPC 1UHWA 3K1NA 5ICEA 2LTPA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 3F8CA 3CCYA 3J81K 4HF1A 3OSFA 1T38A 5FLVA 1WI3A 2XDVA 2ISYA 3ZGKA 3RZOJ 4NQWA 1VQOI 4KDPA 1YYVA 4XOPA 1LE8B 2Y31A 5LHHA 1GV5A 4MQVA 1YQAA 2W48A 4J19A 3E1SA 5DCMA 2K9SA 3T5XA 3GTQJ 2DDAA 5CLSA 3WU1B 2M9HA 3ZN1A 3TP0A 2K9QA 3HG9A 1OCZH 3TGNA 2UXXA 4I09A 2H94A 3HSEA 3F9KA 4RB1A 3OYGA 3F72A 5B66C 2CV1A 2VJIA 3QOPA 4AIDA 4Y13A 1X2MA 3GFLA 3EDPA 4DGWB 3IWFA 4KUMA 3DU6A 2X6OA 3JAMK 4FQGA 5BMZA 2K40A 2R7WA 2QBYB 1IG7A 4CCNA 2W00A 3JRFA 2DTZA 4M3DA 5J4VA 2PJRB 1B59A 1R7JA 1U8BA 5HS7A 5E3OA 2YS9A 1SD6A 1TZLA 1QZEA 1P4WA 1YX3A 4I01A 4XOTA 3B73A 3K7AJ 3LA7A 1QBJA 1XPXA 3ZMVA 3R0AA 2HS5A 3CCMI 4XNFA 3DBRB 2Z3YA 4XLFA 3F8BA 1IV6A 1BJZA 4OU0A 3QYEA 1TNTA 2PFBA 1RR7A 3GCMA 4MQ9F 3TOBA 5CVIA 2YX7A 2GQQA 2XAQA 1R5GA 3BR2A 3HPGA 2D45A 2ID6A 4BEHB 1EF4A 2GAUA 4ZYAA 4FASD 3KE2A 2BE5F 4AWXB 3FXRA 5DM6F 4UUVA 3DQVC 4XLAA 1LPQA 3T8TA 4AUXA 1PUEE 1HBXG 1XSDA 4S0HB 3ZQLA 2QGUA 2LBFA 1Z7LA 4OIPF 3V8LA 4EM2A 3RI4A 1BL0A 2NXNB 2EFPA 4JP0A 5DUIA 1RKWA 2IS4A 3DTKA 3BG7A 2ZJRF 3HGGA 3WTUC 4K2EA 1VQ4I 4JX5A 1HW5A 3MKLA 4KIGA 2TRTA 1YLFA 2HQ5A 1DGRM 3QRFF 1X19A 3RYPA 2VL8A 2FSWA 3V8JA 5B3SH 4OAZA 3LSGA 1XMKA 5LBQA 5JR3A 1AOYA 1RPWA 4CXFA 1J2XA 3S16J 4I2OA 2CS3A 5E8GA 1G8XA 3C2GA 5D5VB 1QZYA 4BXUA 1Y1WJ 2E35A 2CMPA 4GYIA 3F8NA 3C3WA 3DWLE 2DOAA 3H35A 1KQ8A 2HGCA 3K4BA 4LLNA 2XGXA 3ASOH 3IHUA 1ETXA 3OL3A 4KJZA 2KIFA 2Q0OA 2QYOA 3K4KA 3RPQA 3I3LA 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 1MMAA 2Y0SA 2DDBA 2KIUA 2RKHA 1TWCJ 3R6SA 4B09A 2M0MA 4HNTA 2MH9A 1K61A 3E6MA 3KZYA 3QAHA 4PZJA 3A1YA 4CICA 3MAJA 1O7FA 2M0CA 2YR2A 2M3AA 5J8FA 4L5IA 4M73A 4U7DA 4YEJA 1IN8A 2OZUA 4NNJA 2ECCA 4RLQA 3O3KA 1TP4A 2XASA 4LG3A 2WC2A 4CYDA 3CD6I 1VQ5I 3ONQA 5FFXA 1G4DA 3G1LA 4A3DJ 2CWEA 3FF5A 3MMYB 3J81R 1FOXA 2GIVA 3NARA 3FXUA 1YTYA 1VQ7I 1K83J 3QU6A 1Z6RA 1D1CA 2PMHA 1YRNB 5IYCJ 2DFEA 1KYZA 1WJ5A 2XAGA 2R3SA 3GFIA 2AXLA 2KJBA 3HOSA 1ERDA 5HLHA 4N0BA 1MNDA 1N75A 5F1JA 4L9NA 4S05A 5B5EC 1BIBA 1K78A 3TMOA 4IHXA 1MD0A 2E34A 2GOMA 4M3BA 2MSYA 3FZVA 4G7HF 3JAMR 4KYWA 1VQNI 1SD4A 1ENHA 2CYYA 2ECBA 5L3EA 1OCTC 3OYIA 3HKZA 2LP0A 3WTXC 3BR0A 2YPRA 1SD5A 4HA8A 4JYKA 4P9FA 2VLAA 1JT0A 2MD0A 5M3MJ 2DA2A 3HRUA 1G3TA 2EFQA 2VKHA 1W7PB 3I53A 5JFRA 1MH3A 5KAIC 3N97A 3QYBA 1KGSA 2IGNA 4OWRB 3JREA 1T56A 3R60A 5DTDA 4ON0A 3OYKA 5J40A 4H4KC 2P4WA 4EATA 4U7BA 3KETA 3B6CA 4DYCA 4F52A 3TO6A 3NWSA 5FKNA 2VPLA 3KPHA 2ID3A 4A2UA 2NNNA 3MFKA 2KDOA 2P7CB 1GXQA 4LD5A 3HPHA 3DEWA 3GZNB 3FM3A 3SDBA 3WU0A 1S7AA 5EG0A 4HDVA 2ZSIB 2HDCA 1XGMA 5E79C 3LAPA 3DBLB 4MIMA 4HX7A 2D1HA 2HYFA 2OF7A 2X98A 4GCVA 3HUGB 5FD6A 2HI3A 3MZHA 3I4NJ 1FMWA 3MWMA 2TDXA 1N78A 2DODA 3CCQI 2KKOA 3BCBA 2F5CA 3GTLJ 3LFUA 1JT6A 2LREA 1H9GA 1UHMA 2YSRA 3J7AW 5FLXZ 1E3PA 3LSKA 1MSEC 1WJBA 5J3LA 1HKSA 2CQKA 2A6TA 3BZCA 4ZZDA 4RBOA 4BY1J 4V2FA 3TQNA 2UUZA 3JRBA 2VT3A 4TV7A 2FBIA 2E60A 2ZXWH 5K7FA 2ACJA 1FZPB 3BR5A 4BHBA 2L7ZA 2L4MA 4ENKA 3ZQGA 3S93A 3M4OJ 1F1ZA 3FDYA 2KT0A 3AG4H 2V9KA 1MH4A 4KMFA 4ZYEA 1H8AC 4HF0A 4IHWA 1TWGJ 4HYEA 3G3ZA 1SFOJ 2HQRA 5KVRA 2P7VB 2V79A 1WJFA 4A3KJ 1RETA 4FX4A 2DOFA 3N05A 2G7UA 4XN0A 2KDZA 1JHFA 2EZHA 2BY3A 1RKTA 1MMSA 3KP3A 4RGUA 2Z99A 4IOAF 2W4SA 3R61A 4G8XA 3JRDA 2VBXA 1R1TA 3VDXA 2DMQA 4CZZA 1U2WA 1VTNC 2XF5A 3OL4A 3GZ6A 2OCCH 1L3LA 2MZ4A 2EBIA 4M3FA 2R7ZJ 3CCVI 2BVMA 1I6XA 2E36A 4E7HA 1J09A 3WG9A 4BE0A 2DXIA 2D2WA 5EDNA 4CYCB 3HL2A 3GUDA 2OJED 4YFKF 3ABLH 2DTRA 2E1MB 5DD4A 1RUNA 4HG2A 1OR7C 4WF2A 1J7KA 1A35A 1WZ2A 4EM0B 5ED4A 3HIFA 4XRSA 3K1MA 1FYKA 1I5ZA 3ZQIA 3HOZJ 1JXSA 4PFOA 2L01A 2HU9A 1P9QC 4RB3C 1Y6IA 2NOGA 1VQKI 2CH0A 3PJRA 1XN7A 4BNCA 2R7DA 5CQEA 1IRXA 4FT8A 2UZKA 2K9NA 1RESA 4IHTA 3MVPA 2ZC2A 4F55A 2W25A 5JLWA 1K4SA 5IPAA 1APLC 1U5TB 2A5WA 3OYDA 4IRGA 3I55I 1UAAA 1ZR4A 2LG4A 2X9DA 2RVCA 4A6EA 2M4KA 2MGQA 4RMNA 3L2QA 3BLYA 1U3EM 4CCOA 2L7FP 2L3DA 1NG6A 5LRSA 5FRNA 3QPTA 5GP9A 1MBGA 4EV0A 3J80K 1SVMA 1MBKA 2JPCA 3M8EA 1FOWA 1MW7A 2CJJA 1VNDA 3LA2A 5FO5A 5IOZA 2ETHA 1ETWA 4KT5C 4WXHA 4XLEA 1XB4A 5DYMA 2QSGX 3BJOA 4C30A 5B1AH 2GXGA 1YI2I 2DFFA 1BOAA 2VJ4A 2G7HA 1MDMB 1WQ2A 1I1GA 2EILH 3BDDA 5A2QR 1RC9A 4MFDA 4A0ZA 4OIQF 2L0KA 3M8FA 1FNNA 2R7TA 4EJUA 1T0FA 4CZCA 1LVKA 1LE8A 3RCOA 1V5GA 2F5DA 3WHBA 3BOQA 3HB9A 1AU7A 1DDNA 4OMYA 2Z9OA 1WJDA 4FE7A 4QPQA 2L9RA 1LJ9A 4XRMA 2F4OB 1JUSA 4EGZA 4P5OA 3OS0A 3SEQA 3K70C 1PUFB 2X51A 2PBIA 1SFEA 3BP8A 3RZDJ 2L54A 3PFYA 3HYIA 3KLOA 4J01A 3OYFA 1LDJA 1JUMA 2A07F 3S2DJ 2QBYA 4LIVA 2BXZA 1TL8A 3GWZA 3CO7C 2PJRA 2VC1A 4C3JJ 4ZDOA 4PFPA 3JRAA 2HVRA 3OS1A 3CMAI 3CP2A 3HGYA 3IH2A 1Z7UA 5HNFA 3PSIA 4M6VA 1R9TJ 1X3ZB 3M1EA 1QU3A 4XBFA 3CC2I 3H5RA 2X1CA 4M72A 4XKBA 5CKTA 3ZMTA 5K5RA 1QPMA 3IAS2 3K4MA 5LGTA 1D5YA 2M30A 2R7OA 5LEKA 2MBFA 3PQJA 4RAGA 5IP6A 2CQQA 2HPMA 1WJEA 3H0GJ 5L3FA 4L0YB 3W2WA 3DPLC 3S17J 2ELHA 3C7JA 2ELKA 4BEHA 3I9V2 2G0EA 3OIQA 2DA5A 2R7XA 3AKZA 2P0TA 3OOPA 4HQMA 3K69A 1ACIA 3I0TA 2WAFA 1R5ID 1R00A 1SFXA 4CCMA 1IGNA 1HA8A 1BR1A 2TCTA 2W82A 3PM1A 3J81Z 3A01B 3OSGA 2HWVA 2QQ9A 1YJ9I 4KISA 4RS8A 1JKRC 2NVQJ 3GVAA 1Y0NA 2HKOA 1X1DA 1ZK8A 1XD7A 1YE9A 4B3XA 1ZG3A 3EETA 4MGRA 2VBWA 3ZQHA 2WA0A 1UB9A 3A0HC 4LMYA 2H1LA 2X1EA 2LOOA 4PCQA 5FD5A 1X2NA 3ZXSA 4B44A 2QSHX 1D8KA 3S3OA 4YFXF 1IN7A 2A5YB 2F2EA 3PFIA 4I7HA 3V4GA 2JRMA 3QPHA 2DYSH 3V7SA 1OCOH 1TQMA 1Z0XA 1GVJA 3S2HJ 1FX7A 2MH2A 4OMZA 4XLHA 3JAMZ 4BJ6C 4IXAA 3SEZA 2Q8KA 1ON1A 4DBRA 1VQ6I 2IBDA 3F21A 2OTJI 2IGOA 3RIRA 1BI1A 2WY7Q 2RV8A 3HOTA 3SJMA 2FBKA 2A69F 2VPRA 1R71A 5IT9K 2FE3A 1IN4A 1J75A 2A6EF 4IHYA 4OOIA 2CO5A 3H5AA 4DZJA 3LSHA 2ZJQF 3G1OA 4F91B 1QVTA 2VASA 3ABKH 3ASNH 3ML6A 4BAYA 2NNYA 5D5WB 2QSFX 3LNQA 2PX9A 4Q47A 2XB0X 3GEZA 1IRGA 4B4CA 2XF7A 1D5VA 5H6RA 4KN4X 1V5EA 4M9XA 2K3PA 5GTHC 4KICA 1DPUA 3I59B 3J80R 2QM3A 2MD5A 5GAHJ 5J8CA 4II3A 5JHFA 1EKEA 3O2PE 2Y9YA 2OPTA 4L9VA 4LJZF 4DW6A 3ERED 2GA2A 1E17A 2E5ZA 2JA5J 3WTZA 2CUFA 1VQLI 3GMEA 3L2UA 4D0PA 2LR8A 3S15J 1R5HA 5E3NA 5JLXA 3ABMH 3P5JA 1SC7A 2RC4A 2LKSA 2JA6J 2JRTA 5F0CA 4EJWA 1QPIA 5L3GA 3LOCA 3FKJA 4HLYA 2IA0A 2P6SA 1WCMJ 3HHHA 2Q1ZB 1KONA 1IW7F 1LUJB 1LVAA 1ETKA 1OR7A 1SMYF 3IAM2 5FB2A 3JRHA 3OV8A 3BQZA 1ZRDA 3H5NA 3EYYA 1POGA 3CQZJ 2FMYA 2K27A 1W1WE 2CW7A 2HOEA 4MFEA 4BE1A 3U1KA 1Z9CA 3IV5A 5ERIA 4UY8I 3ELKA 1J59A 2ME0A 2V1UA 1TTYA 2Z33A 3JTHA 4AVZA 4F92B 4WWCA 5EZGA 5DCFA 3WTYC 2ESNA 2DN0A 3LMMA 4M6XA 3QYFA 4P55A 4AIJA 2RAEA 1W7PA 2CFOA 4XSZF 4BKXA 2JA8J 4BGDA 2AS5F 1DGWY 4LIUA 3HZJA 3BZ6A 2O8XA 2MG4A 3PNVA 5TJJA 4D5FA 3HM5A 1NG7A 2MYSA 3TW6A 2Q2EB 4EEFG 1I27A 4WXCA 2EJRA 2Y69H 5K7HA 3WGGA 2BEOA 2DO7A 3KEOA 4M3EA 2EFWA 2KZGA 4JX4A 2IRFG 3EUAA 3HUGA 2I8DA 3VWBA 2EFOA 3FX3A 5F1RA 2LY2A 5JHUA 4ABZA 3Q9SA 4R79A 3HRTA 5B1BH 1NK2P 1OYWA 2AXTC 2HXOA 1IV8A 1JGGA 4RLFA 4GXOA 2L9SA 1B1BA 1FTZA 2QWWA 4Y52J 2KISA 2DT6A 4ZTJA 2RN7A 4U0YA 3COAC 3ERMA 3H36A 1U9OA 1KYWA 2DFHA 2KRHA 3LWFA 4BU2A 3KCCA 4GO1A 3RPUD 3A0BC 1ZQ3P 1T98A 3S1MJ 3CUQB 4M6YA 3L2CA 4A3FJ 2M8EA 2LY1A 2HVSA 1KQ0A 4DYRA 4DIQA 2K02A 1FBQA 1RNLA 2DJNA 2GXAA 4A3GJ 1B4AA 5IT9R 2ZFWA 3GTMJ 3DLLF 2FF4A 1NTCA 3GLXA 4BE2A 2LRDA 3JCUC 3DEUA 4BUPA 4XLPF 4IX7A 3RJPA 4QSHA 1IUYA 2W24A 3E0JB 3WU2C 4XLCA 3RQIA 4S04A 1XC5A 4EJVA 5ILVA 3H9QA 1IC8A 2HKXA 3E97A 2LVSA 5HODA 2LH9A 4CDGA 5KAFC 5CVVA 1FJLA 1QGPA 1PJRA 2AQFA 5DDGA 1U9NA 4CO8A 4HX8A 4GYGA 1MNMC 3FXLA 1BW6A 1BJAA 5GADJ 1Y8RB 2GOXB 2J5PA 3QWLA 1T8IA 4A3BJ 3M1CA 3BTJA 4G94A 5HDNA 1WWXA 4E7KA 3F6OA 2KL4A 2H27A 4NDLA 5CQGA 2XV4S 4CYCA 2JN6A 3FISA 4DJAA 1QHHD 2WB1A 1DU0A 1VQPI 1ZLKA 1HKTA 1YW9A 2ZXHA 1KU3A 4XSXF 1ZYRF 1MBJA 5LGNA 3CJTB 4UVBA 2UWMA 1CQTA 2JSCA 4BQNA 2UXNA 2O3FA 2FX0A 1BI2A 1VQMI 2HFHA 3DKYA 2L2OA 3PO3J 2ZMEB 1OQYA 3G6EI 1FSEA 3A4CA 4UUSB 4HOBA 3KP6A 2EIJH 2QLZA 5L3CA 2VBZA 2XSDC 2JVGA 2MLGA 3LSMA 1U5TA 3EUHC 4FCYA 4A5NA 3CMYA 1UFMA 4XL9A 3VSLA 4EMSA 2L9VA 2BZTA 1UG2A 4JX6A 4Y7NJ 5GPCA 4LLGF 5JVTA 1FBUA 3LFKA 4L5EA 5C44J 1O3QA 2HZDA 5FJ8J 1IO2A 2XC7A 4AYBA 2NVYJ 3FK7A 3L9FA 4BXFA 2ZSHB 2LC2A 2KFDA 2Y2ZA 1U78A 5FKOA 2W85A 3QPLA 4BL0B 3LQQA 4IOCF 4HNVA 1MDMA 3IKVA 3OYMA 1FTTA 2K85A 4H0EA 2AHQA 5ICFA 5D4SA 1IAWA 1ULYA 1A6QA 1WH7A 4AC0A 2F5EA 1P6RA 1WH5A 1S3JA 3B02A 3IH4A 1Y1VJ 1TC3C 2Y30A 4Z2YA 2ZJPF 3AG3H 5ILUA 1T0FC 1XMXA 3S14J 3HDDA 2CSOA 3HJEA 2OCEA 1PUFA 1Z1DA 2BY0A 4HDUA 1Y56A 2R5ZB 1W5CC 1BR2A 3RKYA 4I6ZA 1YJNI 1WI9A 2ESHA 2XKPA 4FE4A 5CPRB 4A69C 1ODDA 1IDYA 2C6YA 3KP5A 4G12A 5CVJA 2R7SA 2QKLB 1TW2A 2QA4I 3KYLA 1G59A 3D5SC 4U0VA 2QQ8A 4AM3A 3FHNA 1RR8C 3SZTA 1W4MA 1RQ6A 2FBHA 4CGZA 4M74A 2ZNYA 2FA5A 3C1DA 4HZFA 4CCKA 1T08B 4IQ4A 2EV0A 2KMUA 2KQRA 2W57A 1Q1HA 1IRFA 4G7OF 4KIBA 2K9LA 6PAXA 5H2FC 2LSOA 5E1ZB 4EGYA 4BHPA 4KN7X 4WCGA 1XSVA 2DA4A 2WTEA 5EEHA 3BTLA 3J80Z 4LGWA 2R5YB 1F4KA 4E6KG 4MEYF 4XQFA 1A5JA 2BY1A 3A01A 4O5VA 4JBAA 3AL0B 3CP8A 2K4BA 2MC4A 5A2QK 1ZELA 2P5VA 4DNCA 2GM4A 2JMWA 3WODF 3HOVJ 1X3WB 3H3VK 3WTVC 3O8HA 5E1XA 1YO5C 5DEQA 2ICWG 1A04A 3OYJA 2DW4A 3E6BA 4F3QA 1ZH5A 3GTGJ 2GIZA 3HRSA 1MMGA 2PEXA 2X1DA 5FKLA 4G6QA 2ZMEC 3DP7A 3KZIC 3E5QA 3L00A 2V9VA 4NC7A 2A61A 1LFBA 1MZBA 1T33A 2BW3B 3OIPA 5CJ9A 5HLTA 2E2IJ 1OCCH 3GFJA 3HOXJ 4UB6C 2E1CA 2ZXIA 3BTCA 3R0JA 3TO9A 1A36A 2JT1A 5L3BA 3DV8A 3T0YA 3UNGC 4V19K 2CUZA 4PJLA 3SDGA 2DMUA 2OV7A 2IS6A 2DK8A 5BS6A 3BTIA 4WK8F 2Y48A 5FKMA 1TT0A 3L09A 1PP8F 1S8NA 1JHHA 1I39A 3DCFA 4FHTA 3CC7I 4CSWA 1T39A 2JVHA 1YHQI 2XRNA 3BC8A 1YW8A 1JTYA 3BR3A 4EJOA 4XLNF 1O3RA 1QNTA 3FXJA 4OAYA 2IP2A 4RAYA 2E1OA 5IOYA 5D5UB 4NC8A 2CV0A 2XVCA 4LLLA 3DF8A 1MMNA 3F23A 1IZ1A 3FXMA 2V1NA 1J5YA 1FOKA 2QUFA 2M87A 2VI6A 3VYSB 4HLXA 3GZ5A 3JRGA 2GLOA 3HOWJ 1U6GA 5FFZA 3ZMUA 2B0LA 2JTVA 1FIAA 1UCRA 3K4NA 4BQAA 1QA6A 2O0YA 1H0MA 4IRHA 3SFIA 3RYRA 2DA3A 3I4PA 1SFUA 1XDUA 2X6WA 4E7JA 4XM3A 4I02A 3F8MA 5CYVA 1ZRFA 1WJAA 2DA1A 3OWTA 2H8RA 2R7VA 2R4GA 2JJ7A 5F27A 1HXDA 4YIRX 3FMRA 3RDIA 5J6XA 3JTGA 5F0FA 4OIOF 3DTIA 4P1WA 5JI6A 1NH3A 2IA2A 1S29A 1BN5A 1S9HA 2WV1A 2NRAC 2NVTJ 3ZQ7A 1GHCA 5IT9Z 1ZARA 3SZGA 1XGOA 2HEOA 4DBQA 3EUHA 2R93J 4A0XA 1CF7B 2ADUA 3CTAA 5LEJA 4J00A 4L18B 3GO5A 2M34A 3NWTA 5C3EJ 4IKFA 1L0OC 5IT3A 2NS0A 2EIKH 4E4HA 1F5TA 4M9SA 2Q2EA 4UUTA 5D6EA 3RTRA 4A5MA 2HOAA 1Z67A 4JQFA 2JSPA 4P96A 3AL0C 3SQNA 1WJCA 1EV7A 3KYDB 1BR4A 4BBRJ 1W36C 1ETQA 2KJCA 5EEGA 3IL2A 2VQCA 4BJ5C 1E3HA 4BACA 1UG0A 4ZJZA 2HYGD 1BI0A 2ZXJA 3UR3C 5KHDA 3LSPA 3QP5A 4E7ZA 5ILSA 1JKQC 2H09A 4BHCA 1YJWI 1UHSA 2V6CA 3CJQB 2ZO4A 2B7EA 4I76A 3M7GA 4PJNA 3KYCB 3W6JB 4PJ0C 5FROA 3H0DA 2FQ3A 2LKXA 4EJTA 1E3OC 3RKWA 2R7FA 2IGKA 3GFMA 2K4JA 4IQJA 1K4TA 3S3NA 1IXRC 2O8KA 3HTUA 1AKHB 1BM9A 2I10A 3IH3A 2FUG2 2XPUA 5LRRA 4E70A 3BPVA 4EQQA 3CUQA 2XB5A 3FXOA 4L9JA 3IRQA 2VQLA 2MA3A 4AIKA 3JSOA 2YX4A 4ZDLA 3KEQA 4ETSA 1HDPA 3U9GA 4KIFA 3HC7A 3U2RA 4F93B 3LSTA 4CCJA 1HSJA 1E2XA 3QU3A 4FETA 5GTIC 3JRIA 2E2JJ 2LYCA 4GDFA 1PP7U 3WG7H 2H6BA 2NOJB 3Q0VA 4LB6B 1LB2A 4FISA 3IUOA 4ZH4F 1MBFA 2BXYA 3H3UA 3JW4A 2XGEA 1HKQA 5EEAA 4LK1F 1I1SA 2CW0F 4B47A 5EGOB 3O8GA 1EJ9A 1ETVA 3OR2C 1SVOA 1JE8A 4HW0A 2R7UA 3G1MA 1FLIA 4XMYA 4DZPA 1V5FA 2COMA 3CDIA 2XKOA 1LDDA 2IJLA 4OIRF 4GFBA 2E19A 5E8IA 5F0HA 2CQXA 3I54A 3P9KA 4HV6A 2VJJA 1BC8C 4ESFA 2R0QC 2GXBA 1S5LC 1EH8A 1P7IA 2DA6A 2MABA 3TEDA 3K70D 4V2GA 3C2HA 3DKWA 1FMVA 2DBBA 2E1MC 3DFGA 3I64A 2EZLA 3F6VA 2XGCA 1ETYA 3CMEI 5IP9J 2HPIA 1SVLA 2ZMEA 3PUFA 4UUSA 2IVMA 4E7IA 3KIOA 1BBYA 1Y8QB 3S2WA 3ZOBA 4A3JJ 3H3ZA 4HSRA 1STZA 2DFIA 5HVQC 1YOVB 5FKKA 2ELJA 4N4OB 2CUEA 2WV0A 1SANA 3Q0WA 4NUBA 4PJJA 5D6FA 3A52A 2JPBA 4DQ2A 1U5TC 5D4RA 1T2KA 2RNGA 4ESJA 1KU9A 3CUOA 5TGTA 1R23A 3OYCA 1S7EA 2VXDA 3PUBA 1MNEA 1XSXA 1FPQA 3BJAA 3P9IA 2D5VA 4ZYGA 3AG2H 1X4OA
chains in the Genus database with same CATH topology
4BH9A 2LNBA 2ZCWA 5L3DA 2EV5A 5K1YA 2VBYA 2DPUA 1ZHFA 1IN5A 2E7WA 4M71A 4PGGA 3IWZA 4IVNA 4CHUA 3ECHA 1OYIA 3IRRA 4UV9A 4FX0A 4Q4ZF 5D8LB 5BQTA 2VODA 2QQBA 2LF7A 2FNPA 1FT9A 5FGMA 3KP7A 1V4RA 5LHGA 3VFZA 3ZN0A 3ZPLA 1O57A 1DPRA 5LGUA 3K0LA 4N9HA 4ZYHA 1TQPA 4ENMA 4UVAA 1TNSA 2P5LC 2FEZA 2FU4A 3VODA 3WGIA 1OYYA 2K86A 1RUOA 3G73A 2P8TA 1K6OA 2LKPA 2J5OA 3GW2A 4ENNA 3CLOA 1P2FA 3LA3A 3CDHA 3LQRA 2VONA 4B8XA 4I0BA 1ZAOA 2EV6A 5K5OA 1HW1A 5HOOA 1FP2A 2M5WA 1R36A 1IF1A 2O6GE 1KQ9A 3GXOA 4G9YA 4OINF 3WTSC 1JGSA 4KA4A 2OBPA 1ZLJA 5D5XB 2X4HA 4PGHA 4F7ZA 2IT0A 2P5KA 4WXDA 4KFCA 4LG0B 1WSUA 2CFXA 4KNYA 1IXCA 1AWCA 3IKTA 4MNUA 1IN6A 2DK5A 5CVUA 3K2ZA 2A6HF 2VOPA 2V1DA 4O3MA 2VOOA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1B6AA 2XHKA 3BWGA 2XAFA 3REOA 1XGNA 2OA4A 1O3TA 2DAOA 5A2QZ 2HTSA 3PQKA 2DI3A 1LEBA 1O3SA 3E5UA 4Y17A 4PDKA 2W84A 3ABTA 3TOAA 4NHJA 4NB5A 2ZJ2A 2O61A 3FXQA 4M9ZA 2STWA 1FYLA 1CF7A 4RGXA 3J7AO 4YG2F 5AIQA 1FSHA 2MLKA 3CO6C 1B9MA 3I58A 4XRFA 4RGSA 2FRHA 3BROA 3EQLF 3Q9VA 1DP7P 1P4XA 2RDPA 2PQ8A 1G3SA 4RB2C 2OAZA 1YG2A 5HLIA 2STTA 2V1XA 5HS9A 4IRIA 4LK0F 5HDGA 1S7OA 1BIAA 2Y0MA 2PN6A 4AIHA 2VXZA 4IJAA 1ONVA 4RAZA 1P4AA 1KA8A 2EA2A 2PMUA 1S6LA 2QQAA 4HBLA 1IXSB 3CUQC 4UHTA 4IF4A 2OZ6A 4EM1A 1MJ9A 1MGTA 2IA1A 2IW5A 1YS6A 1G3WA 2OD5A 1MJAA 1NHAA 2E7XA 2G9WA 5HS8A 1R1UA 2ZNZA 4IHSA 4G7ZF 5E20A 3HHGA 4L9TA 4ZYDA 2F5FA 4U88A 2EK5A 2LF8A 3DXJF 2EB7A 1P92A 2HQNA 4I0AA 3WTTC 2RQPA 5LHIA 1USSA 4HF2A 4ASNA 3RPUA 2PLYA 1TQIA 2E1NA 2VT2A 2PI0A 4MHGA 4P9UA 4WX9A 3V8KA 2WWYA 1QQIA 5DD8A 3HSFA 3E6DA 2RNJA 1XCVA 2DU9A 3T1BA 5BOXA 2ZBKA 4Q5SF 3M9AA 1K7AA 1HSTA 2PG4A 3MCZA 1J0RA 5LLQA 3FMQA 3E3VA 4JK1X 3KP2A 5E1WA 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 1W5TA 1YW7A 5TRDA 4Y15A 4UVCA 3WTWC 1O7LA 1ZN2A 3WE2A 5AIPA 5DCMB 2NAZA 2HTJA 2FXAA 3I59A 4MTDA 1RZ4A 5DUKA 1K79A 3HTSB 1H9TA 3BJ6A 4O6JA 1WKMA 2OQRA 1ZREA 2BBYA 4R1HA 3U1DA 3BY6A 2FNAA 2DT5A 3ZMDA 5F64A 5BPDA 2K7LA 2QZ8A 3NEUA 2L4AA 3L7WA 4A0YA 1OMIA 3GX4X 1C0WA 4L0ZB 4RGRA 3K9TA 1RI7A 3V7RA 2EA4A 4I98B 3E6CC 1B9NA 3K1PA 2JZYA 2MC3A 3VEPA 4A12A 3KFWX 3R4KA 1G3YA 2D1VA 5ICCA 1WRJA 2HR3A 3TKYA 2XAHA 1SAXA 3I5UA 1USTA 2LDUA 3F8FA 3MZYA 3F3XA 4HX4A 3ABUA 2ISZA 2YU3A 3Q5FA 2FMLA 5CVRA 5H20A 3JSPA 3SFZA 2EFNA 2XIGA 2BGCA 2CGPA 1T6SA 5AONA 3KP4A 1TBXA 4IPAA 3ROUA 1FYMA 1ON2A 3SZPA 4YFNF 2NYXA 3C18A 2EWNA 3LAJA 1FWZA 2VE8A 2HZTA 3P7NA 3KZZA 2DLLA 2DQRA 4LG0A 5HLGA 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 2XROA 1BI3A 2BYVE 2BV6A 3E5XA 1D8JA 2H6CA 4BYYA 1YIOA 5ICGA 2P6TA 3EYIA 1ZGJA 3P9CA 3T8RA 5FLXK 2O03A 4QLCU 1HW2A 2OQGA 1K78B 1KU7A 4KMUX 4HV5A 1XGSA 2L02A 2DPDA 4QWQA 3NQOA 2A68F 3GYHX 3IC7A 3WGHA 1ZGAA 1LEAA 2GWRA 3SHFA 1ZRCA 1Z05A 2ZKZA 1Y0UA 2QENA 4L5JA 1J9IA 4A6DA 1V3FA 5H6QA 4RB0A 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 4ENJA 1LQ1A 1EH6A 4EVIA 3N4MA 1D3YA 4UV8A 1OPCA 1BC7C 4YIFA 4MEXF 2GZWA 4R8HA 4HQEA 1X3UA 5D8KB 1FP1D 2RGVA 1R1VA 2VC0A 1LNWA 2M45A 2PJPA 3HRMA 3AAFA 3MEXA 3MQ0A 3ZMSA 1LDKB 2Y75A 4ESBA 2IPQX 2OU2A 1R58A 3V7CA 4LB5A 3ULQB 1TW3A 1KU2A 1SMTA 3CJNA 2Z5UA 4HAMA 3VOEA 1PDNC 4G6DA 1YS7A 1FBSA 1U8RA 1R22A 5K5QA 1CGPA 1SD7A 3ZP5A 1XCBA 1XMAA 5KK1A 1EH7A 2KIMA 3GF2A 5E18F 2XUBA 3O6BB 1G6NA 4MTEA 2A3SA 3NRVA 2DQLA 1ZG5A 1HQCA 1XDSA 1GXPA 2M1BA 3D0SA 4AD9A 5F6FA 1MJBA 2CG4A 4U0WA 1Z91A 2GA1A 3BPXA 1FY7A 1TLHB 4Q48A 1RIOH 3DPTA 3TO7A 3ECOA 1QO0D 3F22A 3FMSA 1ZG1A 5BPIA 1MKMA 1QZZA 3H92A 5HDKA 2FOKA 1FC3A 3VB2A 1F9NA 3HSRA 3FWEA 3I71A 5DV5A 5E17F 4YIIA 2KRFA 1REPC 5ICEA 1UHWA 3K1NA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 3F8CA 3J81K 4HF1A 1T38A 2ISYA 4NQWA 4KDPA 1YYVA 5LHHA 4MQVA 1YQAA 5DCMA 3T5XA 5CLSA 3WU1B 3ZN1A 3TGNA 2UXXA 4I09A 2H94A 3HSEA 4RB1A 3F72A 3QOPA 4Y13A 3GFLA 3EDPA 3IWFA 4KUMA 3JAMK 5BMZA 2QBYB 1B59A 1R7JA 5HS7A 1SD6A 1P4WA 4I01A 3B73A 3LA7A 1QBJA 3ZMVA 3R0AA 2HS5A 2Z3YA 3F8BA 4OU0A 1TNTA 2PFBA 4MQ9F 3TOBA 5CVIA 2YX7A 2GQQA 2XAQA 1R5GA 2D45A 2GAUA 3KE2A 2BE5F 4AWXB 3FXRA 4UUVA 3DQVC 1PUEE 3T8TA 1HBXG 1XSDA 4OIPF 3V8LA 4EM2A 3RI4A 2EFPA 5DUIA 3WTUC 4K2EA 1HW5A 4KIGA 1YLFA 3QRFF 3RYPA 2FSWA 3V8JA 1XMKA 5LBQA 5JR3A 1AOYA 4CXFA 1J2XA 4I2OA 5E8GA 5D5VB 1QZYA 4BXUA 4GYIA 3F8NA 3C3WA 1KQ8A 2HGCA 4LLNA 2XGXA 3IHUA 2KIFA 2Q0OA 2QYOA 3RPQA 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 2KIUA 2RKHA 3R6SA 4B09A 2MH9A 3E6MA 3KZYA 3QAHA 4PZJA 4CICA 3MAJA 1O7FA 2YR2A 5J8FA 4L5IA 4M73A 4U7DA 1IN8A 2OZUA 3O3KA 2XASA 4CYDA 2WC2A 1G4DA 5FFXA 2CWEA 3FF5A 2GIVA 3FXUA 1YTYA 3QU6A 1Z6RA 2PMHA 1KYZA 2XAGA 2R3SA 3GFIA 2AXLA 2KJBA 3HOSA 5HLHA 4N0BA 4L9NA 4S05A 1BIBA 1K78A 1MD0A 3FZVA 4G7HF 4KYWA 1SD4A 2CYYA 5L3EA 3WTXC 2YPRA 1SD5A 4HA8A 4P9FA 3HRUA 1G3TA 2EFQA 1W7PB 3I53A 5JFRA 3N97A 1KGSA 3R60A 4ON0A 2P4WA 4U7BA 3KETA 3TO6A 4A2UA 2NNNA 3MFKA 2P7CB 1GXQA 4LD5A 3FM3A 3WU0A 4HDVA 1S7AA 2HDCA 1XGMA 3LAPA 4HX7A 2D1HA 2HYFA 4GCVA 5FD6A 3MZHA 3MWMA 2TDXA 2KKOA 2F5CA 1UHMA 1H9GA 2YSRA 5FLXZ 1HKSA 2CQKA 4ZZDA 3TQNA 2VT3A 4TV7A 2FBIA 2ACJA 1FZPB 4BHBA 2L4MA 4ENKA 1F1ZA 4KMFA 4ZYEA 4HF0A 4HYEA 3G3ZA 2HQRA 5KVRA 2P7VB 2V79A 4FX4A 2G7UA 1JHFA 3KP3A 4RGUA 2Z99A 3R61A 4G8XA 2VBXA 1R1TA 4CZZA 1U2WA 1VTNC 3GZ6A 1L3LA 1I6XA 3WG9A 2D2WA 3GUDA 4YFKF 2DTRA 5DD4A 1RUNA 4WF2A 1J7KA 4EM0B 5ED4A 3HIFA 3K1MA 1FYKA 1I5ZA 1JXSA 2L01A 4RB3C 1XN7A 4BNCA 2R7DA 4FT8A 2UZKA 4IHTA 2W25A 1U5TB 4IRGA 2RVCA 4A6EA 1U3EM 2L3DA 5LRSA 3QPTA 4EV0A 3J80K 2JPCA 3M8EA 3LA2A 5FO5A 2ETHA 4KT5C 4WXHA 1XB4A 5DYMA 3BJOA 2GXGA 1BOAA 1MDMB 2G7HA 1WQ2A 1I1GA 3BDDA 4A0ZA 4OIQF 3M8FA 1FNNA 4EJUA 1T0FA 2F5DA 3BOQA 1DDNA 4OMYA 2Z9OA 1LJ9A 4EGZA 4P5OA 2PBIA 1SFEA 3BP8A 2L54A 3HYIA 3KLOA 1LDJA 2A07F 2QBYA 3GWZA 3CO7C 2VC1A 1Z7UA 3M1EA 4XBFA 4M72A 3ZMTA 5K5RA 1QPMA 5LGTA 2M30A 5LEKA 2MBFA 3PQJA 5L3FA 4L0YB 3DPLC 2ELHA 3C7JA 3OOPA 4HQMA 3K69A 3I0TA 1R00A 1SFXA 3J81Z 2HWVA 2QQ9A 4RS8A 3GVAA 2HKOA 1XD7A 1ZG3A 3EETA 4MGRA 2VBWA 1UB9A 4LMYA 5FD5A 4PCQA 1D8KA 4YFXF 1IN7A 2A5YB 2F2EA 3V4GA 3PFIA 4I7HA 3QPHA 3V7SA 1TQMA 1GVJA 1FX7A 2MH2A 4OMZA 3JAMZ 4IXAA 2Q8KA 1ON1A 3F21A 3RIRA 1BI1A 2RV8A 3HOTA 2FBKA 2A69F 5IT9K 2FE3A 1IN4A 1J75A 2A6EF 4OOIA 2CO5A 4BAYA 3ML6A 2NNYA 5D5WB 4Q47A 3GEZA 1IRGA 1D5VA 5H6RA 4KN4X 4M9XA 4KICA 1DPUA 3I59B 2QM3A 2MD5A 5J8CA 3O2PE 4L9VA 4LJZF 3ERED 2GA2A 1E17A 3WTZA 4D0PA 1R5HA 2RC4A 2JRTA 4EJWA 5L3GA 4HLYA 2IA0A 2P6SA 3HHHA 1IW7F 1LVAA 1OR7A 1SMYF 5FB2A 3OV8A 1ZRDA 3EYYA 2FMYA 2K27A 2HOEA 1Z9CA 5ERIA 3ELKA 1J59A 2V1UA 1TTYA 2Z33A 3JTHA 4WWCA 5DCFA 3WTYC 2ESNA 4M6XA 4P55A 4AIJA 1W7PA 4XSZF 2AS5F 3BZ6A 2O8XA 5TJJA 1I27A 4WXCA 2EJRA 3WGGA 2BEOA 2DO7A 3KEOA 2EFWA 2IRFG 3HUGA 2EFOA 3FX3A 5F1RA 5JHUA 3Q9SA 4R79A 3HRTA 1OYWA 4GXOA 1B1BA 2QWWA 2RN7A 4U0YA 3COAC 1KYWA 3LWFA 3KCCA 4GO1A 1T98A 3CUQB 4M6YA 3L2CA 2M8EA 1KQ0A 2K02A 1FBQA 1RNLA 1B4AA 2ZFWA 3GLXA 2FF4A 3DEUA 4XLPF 3RJPA 1IUYA 2W24A 4S04A 4EJVA 5ILVA 2HKXA 3E97A 4CDGA 5CVVA 1QGPA 5DDGA 4CO8A 4HX8A 4GYGA 1BJAA 2J5PA 5HDNA 4G94A 2H27A 1WWXA 3F6OA 2XV4S 1ZLKA 1HKTA 1YW9A 1KU3A 4XSXF 1ZYRF 5LGNA 2UWMA 4UVBA 2JSCA 2UXNA 2O3FA 1BI2A 2HFHA 2ZMEB 1FSEA 4HOBA 3KP6A 2QLZA 5L3CA 2VBZA 2MLGA 1U5TA 4A5NA 1UFMA 4EMSA 4LLGF 5JVTA 1FBUA 3LFKA 1O3QA 3L9FA 1U78A 2W85A 3LQQA 1MDMA 3IKVA 4H0EA 5ICFA 5D4SA 1IAWA 1ULYA 2F5EA 1P6RA 1S3JA 3B02A 4Z2YA 5ILUA 2CSOA 1Z1DA 4HDUA 3RKYA 1WI9A 2ESHA 2XKPA 2C6YA 1ODDA 3KP5A 5CVJA 1TW2A 4U0VA 3SZTA 1W4MA 2FBHA 4CGZA 4M74A 2ZNYA 2FA5A 3C1DA 4HZFA 2EV0A 2W57A 1Q1HA 1IRFA 4G7OF 4KIBA 6PAXA 2LSOA 5E1ZB 4EGYA 4BHPA 4KN7X 4WCGA 1XSVA 2WTEA 5EEHA 3J80Z 4LGWA 1F4KA 4MEYF 4O5VA 4JBAA 2K4BA 5A2QK 2P5VA 4DNCA 3WODF 3WTVC 5E1XA 1YO5C 5DEQA 1A04A 2DW4A 3E6BA 1ZH5A 3HRSA 2PEXA 4G6QA 3DP7A 3E5QA 3L00A 2V9VA 2A61A 1MZBA 5CJ9A 3GFJA 2E1CA 3R0JA 3TO9A 2JT1A 5L3BA 3DV8A 3T0YA 2DK8A 5BS6A 4WK8F 2Y48A 3L09A 1PP8F 1S8NA 1JHHA 4FHTA 1T39A 2XRNA 1YW8A 4EJOA 4XLNF 1O3RA 1QNTA 2IP2A 4RAYA 5D5UB 2XVCA 4LLLA 3DF8A 3F23A 1IZ1A 1FOKA 1J5YA 2QUFA 2M87A 4HLXA 3GZ5A 1U6GA 5FFZA 3ZMUA 2B0LA 2JTVA 1UCRA 4BQAA 2O0YA 1H0MA 4IRHA 3RYRA 3I4PA 1SFUA 1XDUA 4I02A 3F8MA 5CYVA 1ZRFA 1HXDA 3FMRA 3RDIA 5J6XA 3JTGA 4OIOF 5JI6A 2IA2A 1BN5A 1S29A 2NRAC 3ZQ7A 1GHCA 5IT9Z 1ZARA 1XGOA 2HEOA 3EUHA 4A0XA 1CF7B 2ADUA 3CTAA 5LEJA 4L18B 3GO5A 1L0OC 5IT3A 2NS0A 1F5TA 4M9SA 2Q2EA 5D6EA 3RTRA 4A5MA 4JQFA 4P96A 3SQNA 1EV7A 5EEGA 2KJCA 3IL2A 2HYGD 1BI0A 2ZXJA 3QP5A 5ILSA 2H09A 4BHCA 2V6CA 2ZO4A 3M7GA 3W6JB 2FQ3A 4EJTA 3RKWA 2R7FA 3GFMA 2K4JA 1IXRC 3HTUA 1BM9A 5LRRA 4E70A 3BPVA 4EQQA 3CUQA 4L9JA 3IRQA 2MA3A 4AIKA 3JSOA 2YX4A 3KEQA 4ETSA 3U9GA 4KIFA 3U2RA 3LSTA 1HSJA 1E2XA 3QU3A 1PP7U 2H6BA 4LB6B 1LB2A 4ZH4F 3H3UA 3JW4A 1HKQA 4LK1F 1I1SA 2CW0F 1JE8A 4HW0A 1FLIA 2COMA 2XKOA 1LDDA 2IJLA 4OIRF 5E8IA 3I54A 3P9KA 4HV6A 1BC8C 4ESFA 2GXBA 1EH8A 3DKWA 2DBBA 3DFGA 3I64A 3F6VA 2ZMEA 2IVMA 1BBYA 3S2WA 3H3ZA 1STZA 2DFIA 5HVQC 2WV0A 5D6FA 2JPBA 4DQ2A 1U5TC 5D4RA 1T2KA 4ESJA 1KU9A 3CUOA 1R23A 1XSXA 1FPQA 3BJAA 3P9IA 4ZYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BH9 A;  2LNB A;  2ZCW A;  5L3D A;  2EV5 A;  5K1Y A;  2VBY A;  2DPU A;  1ZHF A;  1IN5 A;  2E7W A;  4M71 A;  4PGG A;  3IWZ A;  4IVN A;  4CHU A;  3ECH A;  1OYI A;  3IRR A;  4UV9 A;  4FX0 A;  4Q4Z F;  5D8L B;  5BQT A;  2VOD A;  2QQB A;  2LF7 A;  2FNP A;  1FT9 A;  5FGM A;  3KP7 A;  1V4R A;  5LHG A;  3VFZ A;  3ZN0 A;  3ZPL A;  1O57 A;  1DPR A;  5LGU A;  3K0L A;  4N9H A;  4ZYH A;  1TQP A;  4ENM A;  4UVA A;  1TNS A;  2P5L C;  2FEZ A;  2FU4 A;  3VOD A;  3WGI A;  1OYY A;  2K86 A;  1RUO A;  3G73 A;  2P8T A;  1K6O A;  2LKP A;  2J5O A;  3GW2 A;  4ENN A;  3CLO A;  1P2F A;  3LA3 A;  3CDH A;  3LQR A;  2VON A;  4B8X A;  4I0B A;  1ZAO A;  2EV6 A;  5K5O A;  1HW1 A;  5HOO A;  1FP2 A;  2M5W A;  1R36 A;  1IF1 A;  2O6G E;  1KQ9 A;  3GXO A;  4G9Y A;  4OIN F;  3WTS C;  1JGS A;  4KA4 A;  2OBP A;  1ZLJ A;  5D5X B;  2X4H A;  4PGH A;  4F7Z A;  2IT0 A;  2P5K A;  4WXD A;  4KFC A;  4LG0 B;  1WSU A;  2CFX A;  4KNY A;  1IXC A;  1AWC A;  3IKT A;  4MNU A;  1IN6 A;  2DK5 A;  5CVU A;  3K2Z A;  2A6H F;  2VOP A;  2V1D A;  4O3M A;  2VOO A;  2X0L A;  3D5L A;  1Z6T A;  4GGG A;  3TDZ C;  4UNO A;  1B6A A;  2XHK A;  3BWG A;  2XAF A;  3REO A;  1XGN A;  2OA4 A;  1O3T A;  2DAO A;  5A2Q Z;  2HTS A;  3PQK A;  2DI3 A;  1LEB A;  1O3S A;  3E5U A;  4Y17 A;  4PDK A;  2W84 A;  3ABT A;  3TOA A;  4NHJ A;  4NB5 A;  2ZJ2 A;  2O61 A;  3FXQ A;  4M9Z A;  2STW A;  1FYL A;  1CF7 A;  4RGX A;  3J7A O;  4YG2 F;  5AIQ A;  1FSH A;  2MLK A;  3CO6 C;  1B9M A;  3I58 A;  4XRF A;  4RGS A;  2FRH A;  3BRO A;  3EQL F;  3Q9V A;  1DP7 P;  1P4X A;  2RDP A;  2PQ8 A;  1G3S A;  4RB2 C;  2OAZ A;  1YG2 A;  5HLI A;  2STT A;  2V1X A;  5HS9 A;  4IRI A;  4LK0 F;  5HDG A;  1S7O A;  1BIA A;  2Y0M A;  2PN6 A;  4AIH A;  2VXZ A;  4IJA A;  1ONV A;  4RAZ A;  1P4A A;  1KA8 A;  2EA2 A;  2PMU A;  1S6L A;  2QQA A;  4HBL A;  1IXS B;  3CUQ C;  4UHT A;  4IF4 A;  2OZ6 A;  4EM1 A;  1MJ9 A;  1MGT A;  2IA1 A;  2IW5 A;  1YS6 A;  1G3W A;  2OD5 A;  1MJA A;  1NHA A;  2E7X A;  2G9W A;  5HS8 A;  1R1U A;  2ZNZ A;  4IHS A;  4G7Z F;  5E20 A;  3HHG A;  4L9T A;  4ZYD A;  2F5F A;  4U88 A;  2EK5 A;  2LF8 A;  3DXJ F;  2EB7 A;  1P92 A;  2HQN A;  4I0A A;  3WTT C;  2RQP A;  5LHI A;  1USS A;  4HF2 A;  4ASN A;  3RPU A;  2PLY A;  1TQI A;  2E1N A;  2VT2 A;  2PI0 A;  4MHG A;  4P9U A;  4WX9 A;  3V8K A;  2WWY A;  1QQI A;  5DD8 A;  3HSF A;  3E6D A;  2RNJ A;  1XCV A;  2DU9 A;  3T1B A;  5BOX A;  2ZBK A;  4Q5S F;  3M9A A;  1K7A A;  1HST A;  2PG4 A;  3MCZ A;  1J0R A;  5LLQ A;  3FMQ A;  3E3V A;  4JK1 X;  3KP2 A;  5E1W A;  1DUX C;  3SXY A;  4AVP A;  2XAJ A;  3FHZ A;  1W5T A;  1YW7 A;  5TRD A;  4Y15 A;  4UVC A;  3WTW C;  1O7L A;  1ZN2 A;  3WE2 A;  5AIP A;  5DCM B;  2NAZ A;  2HTJ A;  2FXA A;  3I59 A;  4MTD A;  1RZ4 A;  5DUK A;  1K79 A;  3HTS B;  1H9T A;  3BJ6 A;  4O6J A;  1WKM A;  2OQR A;  1ZRE A;  2BBY A;  4R1H A;  3U1D A;  3BY6 A;  2FNA A;  2DT5 A;  3ZMD A;  5F64 A;  5BPD A;  2K7L A;  2QZ8 A;  3NEU A;  2L4A A;  3L7W A;  4A0Y A;  1OMI A;  3GX4 X;  1C0W A;  4L0Z B;  4RGR A;  3K9T A;  1RI7 A;  3V7R A;  2EA4 A;  4I98 B;  3E6C C;  1B9N A;  3K1P A;  2JZY A;  2MC3 A;  3VEP A;  4A12 A;  3KFW X;  3R4K A;  1G3Y A;  2D1V A;  5ICC A;  1WRJ A;  2HR3 A;  3TKY A;  2XAH A;  1SAX A;  3I5U A;  1UST A;  2LDU A;  3F8F A;  3MZY A;  3F3X A;  4HX4 A;  3ABU A;  2ISZ A;  2YU3 A;  3Q5F A;  2FML A;  5CVR A;  5H20 A;  3JSP A;  3SFZ A;  2EFN A;  2XIG A;  2BGC A;  2CGP A;  1T6S A;  5AON A;  3KP4 A;  1TBX A;  4IPA A;  3ROU A;  1FYM A;  1ON2 A;  3SZP A;  4YFN F;  2NYX A;  3C18 A;  2EWN A;  3LAJ A;  1FWZ A;  2VE8 A;  2HZT A;  3P7N A;  3KZZ A;  2DLL A;  2DQR A;  4LG0 A;  5HLG A;  1W5S A;  1W7P D;  2QVO A;  2VE9 A;  3WE3 A;  2XRO A;  1BI3 A;  2BYV E;  2BV6 A;  3E5X A;  1D8J A;  2H6C A;  4BYY A;  1YIO A;  5ICG A;  2P6T A;  3EYI A;  1ZGJ A;  3P9C A;  3T8R A;  5FLX K;  2O03 A;  4QLC U;  1HW2 A;  2OQG A;  1K78 B;  1KU7 A;  4KMU X;  4HV5 A;  1XGS A;  2L02 A;  2DPD A;  4QWQ A;  3NQO A;  2A68 F;  3GYH X;  3IC7 A;  3WGH A;  1ZGA A;  1LEA A;  2GWR A;  3SHF A;  1ZRC A;  1Z05 A;  2ZKZ A;  1Y0U A;  2QEN A;  4L5J A;  1J9I A;  4A6D A;  1V3F A;  5H6Q A;  4RB0 A;  4N9I A;  3FM5 A;  3ISP A;  4LFU A;  1OKR A;  4ENJ A;  1LQ1 A;  1EH6 A;  4EVI A;  3N4M A;  1D3Y A;  4UV8 A;  1OPC A;  1BC7 C;  4YIF A;  4MEX F;  2GZW A;  4R8H A;  4HQE A;  1X3U A;  5D8K B;  1FP1 D;  2RGV A;  1R1V A;  2VC0 A;  1LNW A;  2M45 A;  2PJP A;  3HRM A;  3AAF A;  3MEX A;  3MQ0 A;  3ZMS A;  1LDK B;  2Y75 A;  4ESB A;  2IPQ X;  2OU2 A;  1R58 A;  3V7C A;  4LB5 A;  3ULQ B;  1TW3 A;  1KU2 A;  1SMT A;  3CJN A;  2Z5U A;  4HAM A;  3VOE A;  1PDN C;  4G6D A;  1YS7 A;  1FBS A;  1U8R A;  1R22 A;  5K5Q A;  1CGP A;  1SD7 A;  3ZP5 A;  1XCB A;  1XMA A;  5KK1 A;  1EH7 A;  2KIM A;  3GF2 A;  5E18 F;  2XUB A;  3O6B B;  1G6N A;  4MTE A;  2A3S A;  3NRV A;  2DQL A;  1ZG5 A;  1HQC A;  1XDS A;  1GXP A;  2M1B A;  3D0S A;  4AD9 A;  5F6F A;  1MJB A;  2CG4 A;  4U0W A;  1Z91 A;  2GA1 A;  3BPX A;  1FY7 A;  1TLH B;  4Q48 A;  1RIO H;  3DPT A;  3TO7 A;  3ECO A;  1QO0 D;  3F22 A;  3FMS A;  1ZG1 A;  5BPI A;  1MKM A;  1QZZ A;  3H92 A;  5HDK A;  2FOK A;  1FC3 A;  3VB2 A;  1F9N A;  3HSR A;  3FWE A;  3I71 A;  5DV5 A;  5E17 F;  4YII A;  2KRF A;  1REP C;  5ICE A;  1UHW A;  3K1N A;  3QP6 A;  2VN2 A;  3W6K B;  1YFH A;  3KLN A;  3F8C A;  3J81 K;  4HF1 A;  1T38 A;  2ISY A;  4NQW A;  4KDP A;  1YYV A;  5LHH A;  4MQV A;  1YQA A;  5DCM A;  3T5X A;  5CLS A;  3WU1 B;  3ZN1 A;  3TGN A;  2UXX A;  4I09 A;  2H94 A;  3HSE A;  4RB1 A;  3F72 A;  3QOP A;  4Y13 A;  3GFL A;  3EDP A;  3IWF A;  4KUM A;  3JAM K;  5BMZ A;  2QBY B;  1B59 A;  1R7J A;  5HS7 A;  1SD6 A;  1P4W A;  4I01 A;  3B73 A;  3LA7 A;  1QBJ A;  3ZMV A;  3R0A A;  2HS5 A;  2Z3Y A;  3F8B A;  4OU0 A;  1TNT A;  2PFB A;  4MQ9 F;  3TOB A;  5CVI A;  2YX7 A;  2GQQ A;  2XAQ A;  1R5G A;  2D45 A;  2GAU A;  3KE2 A;  2BE5 F;  4AWX B;  3FXR A;  4UUV A;  3DQV C;  1PUE E;  3T8T A;  1HBX G;  1XSD A;  4OIP F;  3V8L A;  4EM2 A;  3RI4 A;  2EFP A;  5DUI A;  3WTU C;  4K2E A;  1HW5 A;  4KIG A;  1YLF A;  3QRF F;  3RYP A;  2FSW A;  3V8J A;  1XMK A;  5LBQ A;  5JR3 A;  1AOY A;  4CXF A;  1J2X A;  4I2O A;  5E8G A;  5D5V B;  1QZY A;  4BXU A;  4GYI A;  3F8N A;  3C3W A;  1KQ8 A;  2HGC A;  4LLN A;  2XGX A;  3IHU A;  2KIF A;  2Q0O A;  2QYO A;  3RPQ A;  4ZZL A;  3RKX A;  3TDU C;  4UXN A;  3ZMZ A;  2KIU A;  2RKH A;  3R6S A;  4B09 A;  2MH9 A;  3E6M A;  3KZY A;  3QAH A;  4PZJ A;  4CIC A;  3MAJ A;  1O7F A;  2YR2 A;  5J8F A;  4L5I A;  4M73 A;  4U7D A;  1IN8 A;  2OZU A;  3O3K A;  2XAS A;  4CYD A;  2WC2 A;  1G4D A;  5FFX A;  2CWE A;  3FF5 A;  2GIV A;  3FXU A;  1YTY A;  3QU6 A;  1Z6R A;  2PMH A;  1KYZ A;  2XAG A;  2R3S A;  3GFI A;  2AXL A;  2KJB A;  3HOS A;  5HLH A;  4N0B A;  4L9N A;  4S05 A;  1BIB A;  1K78 A;  1MD0 A;  3FZV A;  4G7H F;  4KYW A;  1SD4 A;  2CYY A;  5L3E A;  3WTX C;  2YPR A;  1SD5 A;  4HA8 A;  4P9F A;  3HRU A;  1G3T A;  2EFQ A;  1W7P B;  3I53 A;  5JFR A;  3N97 A;  1KGS A;  3R60 A;  4ON0 A;  2P4W A;  4U7B A;  3KET A;  3TO6 A;  4A2U A;  2NNN A;  3MFK A;  2P7C B;  1GXQ A;  4LD5 A;  3FM3 A;  3WU0 A;  4HDV A;  1S7A A;  2HDC A;  1XGM A;  3LAP A;  4HX7 A;  2D1H A;  2HYF A;  4GCV A;  5FD6 A;  3MZH A;  3MWM A;  2TDX A;  2KKO A;  2F5C A;  1UHM A;  1H9G A;  2YSR A;  5FLX Z;  1HKS A;  2CQK A;  4ZZD A;  3TQN A;  2VT3 A;  4TV7 A;  2FBI A;  2ACJ A;  1FZP B;  4BHB A;  2L4M A;  4ENK A;  1F1Z A;  4KMF A;  4ZYE A;  4HF0 A;  4HYE A;  3G3Z A;  2HQR A;  5KVR A;  2P7V B;  2V79 A;  4FX4 A;  2G7U A;  1JHF A;  3KP3 A;  4RGU A;  2Z99 A;  3R61 A;  4G8X A;  2VBX A;  1R1T A;  4CZZ A;  1U2W A;  1VTN C;  3GZ6 A;  1L3L A;  1I6X A;  3WG9 A;  2D2W A;  3GUD A;  4YFK F;  2DTR A;  5DD4 A;  1RUN A;  4WF2 A;  1J7K A;  4EM0 B;  5ED4 A;  3HIF A;  3K1M A;  1FYK A;  1I5Z A;  1JXS A;  2L01 A;  4RB3 C;  1XN7 A;  4BNC A;  2R7D A;  4FT8 A;  2UZK A;  4IHT A;  2W25 A;  1U5T B;  4IRG A;  2RVC A;  4A6E A;  1U3E M;  2L3D A;  5LRS A;  3QPT A;  4EV0 A;  3J80 K;  2JPC A;  3M8E A;  3LA2 A;  5FO5 A;  2ETH A;  4KT5 C;  4WXH A;  1XB4 A;  5DYM A;  3BJO A;  2GXG A;  1BOA A;  1MDM B;  2G7H A;  1WQ2 A;  1I1G A;  3BDD A;  4A0Z A;  4OIQ F;  3M8F A;  1FNN A;  4EJU A;  1T0F A;  2F5D A;  3BOQ A;  1DDN A;  4OMY A;  2Z9O A;  1LJ9 A;  4EGZ A;  4P5O A;  2PBI A;  1SFE A;  3BP8 A;  2L54 A;  3HYI A;  3KLO A;  1LDJ A;  2A07 F;  2QBY A;  3GWZ A;  3CO7 C;  2VC1 A;  1Z7U A;  3M1E A;  4XBF A;  4M72 A;  3ZMT A;  5K5R A;  1QPM A;  5LGT A;  2M30 A;  5LEK A;  2MBF A;  3PQJ A;  5L3F A;  4L0Y B;  3DPL C;  2ELH A;  3C7J A;  3OOP A;  4HQM A;  3K69 A;  3I0T A;  1R00 A;  1SFX A;  3J81 Z;  2HWV A;  2QQ9 A;  4RS8 A;  3GVA A;  2HKO A;  1XD7 A;  1ZG3 A;  3EET A;  4MGR A;  2VBW A;  1UB9 A;  4LMY A;  5FD5 A;  4PCQ A;  1D8K A;  4YFX F;  1IN7 A;  2A5Y B;  2F2E A;  3V4G A;  3PFI A;  4I7H A;  3QPH A;  3V7S A;  1TQM A;  1GVJ A;  1FX7 A;  2MH2 A;  4OMZ A;  3JAM Z;  4IXA A;  2Q8K A;  1ON1 A;  3F21 A;  3RIR A;  1BI1 A;  2RV8 A;  3HOT A;  2FBK A;  2A69 F;  5IT9 K;  2FE3 A;  1IN4 A;  1J75 A;  2A6E F;  4OOI A;  2CO5 A;  4BAY A;  3ML6 A;  2NNY A;  5D5W B;  4Q47 A;  3GEZ A;  1IRG A;  1D5V A;  5H6R A;  4KN4 X;  4M9X A;  4KIC A;  1DPU A;  3I59 B;  2QM3 A;  2MD5 A;  5J8C A;  3O2P E;  4L9V A;  4LJZ F;  3ERE D;  2GA2 A;  1E17 A;  3WTZ A;  4D0P A;  1R5H A;  2RC4 A;  2JRT A;  4EJW A;  5L3G A;  4HLY A;  2IA0 A;  2P6S A;  3HHH A;  1IW7 F;  1LVA A;  1OR7 A;  1SMY F;  5FB2 A;  3OV8 A;  1ZRD A;  3EYY A;  2FMY A;  2K27 A;  2HOE A;  1Z9C A;  5ERI A;  3ELK A;  1J59 A;  2V1U A;  1TTY A;  2Z33 A;  3JTH A;  4WWC A;  5DCF A;  3WTY C;  2ESN A;  4M6X A;  4P55 A;  4AIJ A;  1W7P A;  4XSZ F;  2AS5 F;  3BZ6 A;  2O8X A;  5TJJ A;  1I27 A;  4WXC A;  2EJR A;  3WGG A;  2BEO A;  2DO7 A;  3KEO A;  2EFW A;  2IRF G;  3HUG A;  2EFO A;  3FX3 A;  5F1R A;  5JHU A;  3Q9S A;  4R79 A;  3HRT A;  1OYW A;  4GXO A;  1B1B A;  2QWW A;  2RN7 A;  4U0Y A;  3COA C;  1KYW A;  3LWF A;  3KCC A;  4GO1 A;  1T98 A;  3CUQ B;  4M6Y A;  3L2C A;  2M8E A;  1KQ0 A;  2K02 A;  1FBQ A;  1RNL A;  1B4A A;  2ZFW A;  3GLX A;  2FF4 A;  3DEU A;  4XLP F;  3RJP A;  1IUY A;  2W24 A;  4S04 A;  4EJV A;  5ILV A;  2HKX A;  3E97 A;  4CDG A;  5CVV A;  1QGP A;  5DDG A;  4CO8 A;  4HX8 A;  4GYG A;  1BJA A;  2J5P A;  5HDN A;  4G94 A;  2H27 A;  1WWX A;  3F6O A;  2XV4 S;  1ZLK A;  1HKT A;  1YW9 A;  1KU3 A;  4XSX F;  1ZYR F;  5LGN A;  2UWM A;  4UVB A;  2JSC A;  2UXN A;  2O3F A;  1BI2 A;  2HFH A;  2ZME B;  1FSE A;  4HOB A;  3KP6 A;  2QLZ A;  5L3C A;  2VBZ A;  2MLG A;  1U5T A;  4A5N A;  1UFM A;  4EMS A;  4LLG F;  5JVT A;  1FBU A;  3LFK A;  1O3Q A;  3L9F A;  1U78 A;  2W85 A;  3LQQ A;  1MDM A;  3IKV A;  4H0E A;  5ICF A;  5D4S A;  1IAW A;  1ULY A;  2F5E A;  1P6R A;  1S3J A;  3B02 A;  4Z2Y A;  5ILU A;  2CSO A;  1Z1D A;  4HDU A;  3RKY A;  1WI9 A;  2ESH A;  2XKP A;  2C6Y A;  1ODD A;  3KP5 A;  5CVJ A;  1TW2 A;  4U0V A;  3SZT A;  1W4M A;  2FBH A;  4CGZ A;  4M74 A;  2ZNY A;  2FA5 A;  3C1D A;  4HZF A;  2EV0 A;  2W57 A;  1Q1H A;  1IRF A;  4G7O F;  4KIB A;  6PAX A;  2LSO A;  5E1Z B;  4EGY A;  4BHP A;  4KN7 X;  4WCG A;  1XSV A;  2WTE A;  5EEH A;  3J80 Z;  4LGW A;  1F4K A;  4MEY F;  4O5V A;  4JBA A;  2K4B A;  5A2Q K;  2P5V A;  4DNC A;  3WOD F;  3WTV C;  5E1X A;  1YO5 C;  5DEQ A;  1A04 A;  2DW4 A;  3E6B A;  1ZH5 A;  3HRS A;  2PEX A;  4G6Q A;  3DP7 A;  3E5Q A;  3L00 A;  2V9V A;  2A61 A;  1MZB A;  5CJ9 A;  3GFJ A;  2E1C A;  3R0J A;  3TO9 A;  2JT1 A;  5L3B A;  3DV8 A;  3T0Y A;  2DK8 A;  5BS6 A;  4WK8 F;  2Y48 A;  3L09 A;  1PP8 F;  1S8N A;  1JHH A;  4FHT A;  1T39 A;  2XRN A;  1YW8 A;  4EJO A;  4XLN F;  1O3R A;  1QNT A;  2IP2 A;  4RAY A;  5D5U B;  2XVC A;  4LLL A;  3DF8 A;  3F23 A;  1IZ1 A;  1FOK A;  1J5Y A;  2QUF A;  2M87 A;  4HLX A;  3GZ5 A;  1U6G A;  5FFZ A;  3ZMU A;  2B0L A;  2JTV A;  1UCR A;  4BQA A;  2O0Y A;  1H0M A;  4IRH A;  3RYR A;  3I4P A;  1SFU A;  1XDU A;  4I02 A;  3F8M A;  5CYV A;  1ZRF A;  1HXD A;  3FMR A;  3RDI A;  5J6X A;  3JTG A;  4OIO F;  5JI6 A;  2IA2 A;  1BN5 A;  1S29 A;  2NRA C;  3ZQ7 A;  1GHC A;  5IT9 Z;  1ZAR A;  1XGO A;  2HEO A;  3EUH A;  4A0X A;  1CF7 B;  2ADU A;  3CTA A;  5LEJ A;  4L18 B;  3GO5 A;  1L0O C;  5IT3 A;  2NS0 A;  1F5T A;  4M9S A;  2Q2E A;  5D6E A;  3RTR A;  4A5M A;  4JQF A;  4P96 A;  3SQN A;  1EV7 A;  5EEG A;  2KJC A;  3IL2 A;  2HYG D;  1BI0 A;  2ZXJ A;  3QP5 A;  5ILS A;  2H09 A;  4BHC A;  2V6C A;  2ZO4 A;  3M7G A;  3W6J B;  2FQ3 A;  4EJT A;  3RKW A;  2R7F A;  3GFM A;  2K4J A;  1IXR C;  3HTU A;  1BM9 A;  5LRR A;  4E70 A;  3BPV A;  4EQQ A;  3CUQ A;  4L9J A;  3IRQ A;  2MA3 A;  4AIK A;  3JSO A;  2YX4 A;  3KEQ A;  4ETS A;  3U9G A;  4KIF A;  3U2R A;  3LST A;  1HSJ A;  1E2X A;  3QU3 A;  1PP7 U;  2H6B A;  4LB6 B;  1LB2 A;  4ZH4 F;  3H3U A;  3JW4 A;  1HKQ A;  4LK1 F;  1I1S A;  2CW0 F;  1JE8 A;  4HW0 A;  1FLI A;  2COM A;  2XKO A;  1LDD A;  2IJL A;  4OIR F;  5E8I A;  3I54 A;  3P9K A;  4HV6 A;  1BC8 C;  4ESF A;  2GXB A;  1EH8 A;  3DKW A;  2DBB A;  3DFG A;  3I64 A;  3F6V A;  2ZME A;  2IVM A;  1BBY A;  3S2W A;  3H3Z A;  1STZ A;  2DFI A;  5HVQ C;  2WV0 A;  5D6F A;  2JPB A;  4DQ2 A;  1U5T C;  5D4R A;  1T2K A;  4ESJ A;  1KU9 A;  3CUO A;  1R23 A;  1XSX A;  1FPQ A;  3BJA A;  3P9I A;  4ZYG A; 
#chains in the Genus database with same CATH topology
 2JUG A;  4BH9 A;  2BHZ A;  2LNB A;  2ZCW A;  3V42 A;  2LMD A;  2KIQ A;  4U87 A;  3LSJ A;  5L3D A;  4BS9 A;  2EV5 A;  3IP4 B;  2VBY A;  5K1Y A;  3GTP J;  2EPF A;  2Y9Z A;  4D9J A;  2DPU A;  4ZDP A;  1ZHF A;  1IN5 A;  3MD2 A;  2E7W A;  2M7A A;  2COB A;  1A6I A;  4M71 A;  4PGG A;  3IWZ A;  4IVN A;  9ANT A;  1JI8 A;  2M2E A;  4CHU A;  1D1A A;  5JVG F;  3PNY A;  1YRN A;  3FXK A;  3ECH A;  1OYI A;  3IRR A;  4UV9 A;  1F43 A;  3ZCO A;  3OYE A;  4FX0 A;  4Q4Z F;  5M5Y J;  1QHG A;  4ANJ A;  5D8L B;  5BQT A;  2M8G X;  2VOD A;  2QQB A;  3VPR A;  2LF7 A;  2FNP A;  1BW5 A;  1FT9 A;  5FGM A;  3KP7 A;  1Z3Y A;  4BQQ A;  1W0U A;  1V4R A;  5LHG A;  3VFZ A;  3ZN0 A;  4HPQ A;  4AU7 A;  3ZPL A;  1O57 A;  1DPR A;  3GLL A;  5LGU A;  3PL8 A;  3K0L A;  1PVE A;  4N9H A;  4XIC A;  4ZYH A;  1TQP A;  3OS2 A;  1O4X A;  1SAU A;  2VQG A;  4XRS G;  2EZK A;  4ENM A;  2EQR A;  4UVA A;  4QPO A;  1B8I B;  4N4N B;  5FLM J;  1TNS A;  2YUS A;  2P5L C;  2FEZ A;  2MW8 A;  2XSJ C;  1ZGW A;  2FU4 A;  3VOD A;  3BR6 A;  3WGI A;  3J7Z I;  2R5Y A;  5J1R A;  1OYY A;  2K86 A;  1VQ8 I;  1RUO A;  3G73 A;  2E2H J;  2CRG A;  1F36 A;  2P8T A;  2WAE A;  4KIT B;  2LKP A;  1K6O A;  3FKI J;  2M4G A;  2J5O A;  3GW2 A;  1GLN A;  4ENN A;  2ZB9 A;  3CLO A;  1VFC A;  1IDZ A;  1P2F A;  3CCR I;  3LA3 A;  3CDH A;  4CA0 A;  3LQR A;  2VON A;  3PO2 J;  3U21 A;  4B8X A;  3LSR A;  3W2A A;  2LLK A;  2M7B A;  5EZH A;  1MSF C;  4I0B A;  4X6A J;  1G2H A;  2CQN A;  1ZAO A;  2EV6 A;  3JR9 A;  4PK4 A;  5K5O A;  4PUS A;  1X1P A;  2IEK A;  1HW1 A;  5E3L A;  3CMM A;  4DYQ A;  5HOO A;  3CC4 I;  2WBM A;  1FP2 A;  3CLQ A;  4A3M J;  1XS9 A;  1GT0 C;  2Z2S B;  2M5W A;  1R36 A;  1IF1 A;  3PIP F;  2O6G E;  1KQ9 A;  2BW3 A;  3DTE A;  4A3L J;  3M07 A;  3GXO A;  4G9Y A;  3S1Q J;  4OIN F;  1EA3 A;  2XPW A;  3WTS C;  1JGS A;  4KA4 A;  1SFK A;  3BR1 A;  2OBP A;  1ORK A;  1ZLJ A;  3HBL A;  5D5X B;  2X4H A;  3RQ4 A;  3MKZ A;  3CF5 F;  4PGH A;  5DS9 A;  2K3F A;  4F7Z A;  2IT0 A;  2R92 J;  2P5K A;  4D5C A;  2FQ4 A;  4WXD A;  4KFC A;  4LG0 B;  3L2W A;  1WSU A;  2CFX A;  3L2V A;  3UKG A;  3OYH A;  4KNY A;  1QVU A;  1IXC A;  1AWC A;  2VKD A;  3S8P A;  3IKT A;  4MNU A;  2VB6 A;  1IN6 A;  2DK5 A;  3BT9 A;  2X48 A;  4E7L A;  1X1C A;  5CVU A;  3K2Z A;  2A6H F;  2VOP A;  2V1D A;  2WY8 Q;  2MUN A;  3OR1 C;  4O3M A;  2VOO A;  1OLT A;  4RDU A;  4ITV A;  2Z1D A;  1NK3 P;  4A3C J;  3HKZ N;  3K6G A;  2X0L A;  3D5L A;  1Z6T A;  4GGG A;  3TDZ C;  4UNO A;  1E0E A;  4NBQ A;  1B6A A;  2XHK A;  3BWG A;  2LD5 A;  2XF6 A;  1Z3X A;  2XAF A;  3REO A;  3G71 I;  1XGN A;  2DOE A;  2OA4 A;  2HNH A;  1P7J A;  1O3T A;  2DAO A;  5A2Q Z;  2VKV A;  2HTS A;  2QF7 A;  4NC6 A;  4C3H J;  5EJC A;  3PQK A;  1GDT A;  2VUM J;  2DI3 A;  2KLO A;  2MVT A;  3CF2 A;  2F6C A;  1LEB A;  1O3S A;  3E5U A;  2FJ1 A;  5KCM A;  1JTX A;  4Y17 A;  5LFA A;  3D5R C;  1IUF A;  4IL6 C;  3FK6 A;  3ZQC A;  3G2B A;  4PDK A;  2OTL I;  2W84 A;  3DLA A;  5E3M A;  1BA5 A;  5DM7 F;  4BJT A;  1MMD A;  3ABT A;  3CZ6 A;  3GTJ J;  3Q0U A;  3TOA A;  1B72 B;  2NVU B;  2FD5 A;  4NHJ A;  4NB5 A;  2ZJ2 A;  4XKW A;  3FXQ A;  2O61 A;  5F08 A;  4BXX J;  3FIW A;  4M9Z A;  3QOE A;  2STW A;  1JKP C;  2DMT A;  1XX5 A;  3K2A A;  1FYL A;  2V9P A;  4RGX A;  1CF7 A;  4YG2 F;  3AFH A;  3ZRG A;  3J7A O;  2QEX I;  5AIQ A;  4XON A;  1I50 J;  3BCA A;  1FSH A;  5KNL A;  2MLK A;  3CO6 C;  1B9M A;  1WGX A;  3OYA A;  3I58 A;  4UB8 C;  4XRF A;  4RGS A;  4XKV A;  2FRH A;  3BRO A;  1AA7 A;  3EQL F;  3Q9V A;  4BQO A;  3MZ8 A;  1DP7 P;  1X58 A;  1HC8 A;  1P4X A;  2RDP A;  2O5R A;  2PQ8 A;  4B1R A;  1G3S A;  4RB2 C;  4D7M A;  3F0C A;  2JUC A;  2OAZ A;  3KEY A;  3LSI A;  1I3A A;  1YG2 A;  5HLI A;  2STT A;  2V1X A;  5HS9 A;  4IRI A;  1FIP A;  5J1Y A;  2JA2 A;  4LK0 F;  2XAU A;  5HDG A;  4Y4R A;  4LOC A;  5C4X J;  1S7O A;  1BIA A;  4C9Y A;  2Y0M A;  2PN6 A;  2QCO A;  4AIH A;  3DU5 A;  1OJL A;  5EYR A;  2VXZ A;  5J4Y A;  2A05 A;  4IJA A;  3PNT A;  1FOY A;  2IS2 A;  1ONV A;  1TWH J;  4RAZ A;  1P4A A;  3SYT A;  2EH3 A;  1AKH A;  3W6V A;  1KA8 A;  2EZI A;  2P0W A;  1WFX A;  3GTK J;  3J7A Y;  3DKX A;  4HST A;  3DBH B;  2X85 A;  2EA2 A;  2PMU A;  3TW7 A;  2PMZ N;  1S6L A;  4C2T A;  2HYJ A;  4XR6 A;  2QQA A;  4HBL A;  1IXS B;  3CUQ C;  4UHT A;  3S1N J;  1WVR A;  4IF4 A;  4C2M J;  2OZ6 A;  4EM1 A;  1ETO A;  3OIO A;  1MJ9 A;  1MGT A;  3CCE I;  2IA1 A;  5LD2 C;  2IW5 A;  1YS6 A;  1GVD A;  1G3W A;  2OD5 A;  3W3C A;  1MJA A;  1UJ8 A;  1NHA A;  2DMP A;  2E7X A;  4QIW N;  4XID A;  4XN3 A;  5GPA A;  2G9W A;  5EGO A;  5HS8 A;  1R1U A;  1I3Q J;  2ZNZ A;  4IHS A;  4G7Z F;  5E20 A;  1BOB A;  3HEF A;  3HHG A;  4L9T A;  4ZYD A;  4X0G A;  2F5F A;  4U88 A;  2HVQ A;  1D1B A;  3A03 A;  3ZQQ A;  1HOM A;  4PSX A;  2EK5 A;  2LF8 A;  2KRC A;  3A02 A;  3PIO F;  1R4M B;  2L9N A;  3DXJ F;  3S32 A;  2EB7 A;  5IP7 J;  4XK4 A;  1P92 A;  2HQN A;  4I0A A;  3WTT C;  1Z77 A;  2RQP A;  5LHI A;  3BQY A;  1USS A;  4GRI A;  3X2Q H;  4HF2 A;  1R4N B;  3BG5 A;  4ASN A;  3RPU A;  2PLY A;  2JWT A;  2WAQ N;  4KT6 A;  1TQI A;  2E1N A;  2IGM A;  2VT2 A;  3CCJ I;  2PI0 A;  1N25 A;  4MHG A;  3H9G A;  2W1O A;  4P9U A;  1W0T A;  4WX9 A;  2F5V A;  3C2B A;  3V8K A;  2WWY A;  4D7N A;  1QQI A;  5DD8 A;  3HSF A;  3E6D A;  3HOY J;  3K4J A;  2RNJ A;  4C3I J;  1WHU A;  1XCV A;  3BG9 A;  2DU9 A;  1PYV A;  3H9J A;  3OMY A;  3T1B A;  5BNG A;  2L7M P;  5BOX A;  2ZBK A;  3L1P A;  5GAE J;  2JK3 A;  5IYB J;  2DJI A;  2F4M B;  3EUK L;  3VYU B;  5HNH A;  4Q5S F;  3M9A A;  1K7A A;  4IHV A;  1HST A;  2PG4 A;  3MCZ A;  1AHD P;  1ZR2 A;  4A3I J;  1J0R A;  5LLQ A;  3MN2 A;  4B43 A;  3FMQ A;  3E3V A;  4Y3O A;  4JK1 X;  3GTO J;  3KP2 A;  5E1W A;  2CW8 A;  1DUX C;  3SXY A;  4AVP A;  2XAJ A;  3FHZ A;  3S1R J;  4HEA 2;  1W5T A;  1YW7 A;  3OYN A;  1N77 A;  5TRD A;  4NQW B;  3M8J A;  4Y15 A;  1QRY A;  2HOT A;  5FRM A;  3A2K A;  4UVC A;  4BDY A;  3DEE A;  3WTW C;  1O7L A;  1ZN2 A;  4RM2 A;  3WE2 A;  5AIP A;  5DCM B;  2NAZ A;  2VQH A;  2Z16 A;  2HTJ A;  2FXA A;  3I59 A;  4MTD A;  1RZ4 A;  2P81 A;  5DUK A;  1K79 A;  1ZKG A;  3HTS B;  1H9T A;  3BJ6 A;  4YEL A;  2YU9 J;  4IO9 F;  3HXL A;  4PJM A;  2F48 A;  1D0Z A;  2F4I A;  3OOU A;  3RSN A;  2LY9 A;  1WKM A;  4O6J A;  2OQR A;  1ZRE A;  5IYD J;  2BBY A;  2RQQ A;  4JOM A;  2WAD A;  1H88 C;  4R1H A;  4G6T B;  3U1D A;  3BY6 A;  4W1U A;  3H1C A;  2BY2 A;  2FNA A;  2DT5 A;  1TT5 B;  3ZMD A;  5F64 A;  2K9M A;  5BPD A;  4BDZ A;  2VJ5 A;  3BG3 A;  2K7L A;  2QZ8 A;  4BY7 J;  3NEU A;  1SEU A;  1K6Y A;  4YRV A;  2L4A A;  3L7W A;  4A0Y A;  1OMI A;  1MBE A;  1OIS A;  3K10 A;  1S72 I;  3NAU A;  4PSW A;  3GX4 X;  1UMQ A;  1C0W A;  4L0Z B;  3LL7 A;  4RGR A;  3K9T A;  1RI7 A;  5M3F J;  3V7R A;  2EA4 A;  2EIN H;  2PMZ A;  1VI0 A;  4HRI A;  1X1A A;  4I98 B;  3E6C C;  1B9N A;  3K1P A;  2JZY A;  2MC3 A;  3VEP A;  4A12 A;  1KZH A;  3KFW X;  1Y39 A;  2HDD A;  3BG6 A;  3R4K A;  1B8I A;  3CDL A;  1G3Y A;  1XTA A;  2LBF B;  4LIT A;  2D1V A;  2DT7 B;  3AG1 H;  4Z6Y A;  5ICC A;  3PSF A;  1ITY A;  2CU7 A;  2CV2 A;  1WRJ A;  4X1E A;  2HR3 A;  3TKY A;  1Q1V A;  2XAH A;  2GBY A;  1MBH A;  1SAX A;  3I5U A;  1UST A;  2LDU A;  1D0Y A;  3F8F A;  3MZY A;  2AQE A;  3F3X A;  4HX4 A;  2R7Q A;  2IS1 A;  3ABU A;  4II2 A;  3GBG A;  4M3G A;  2X6X A;  2ISZ A;  4RA2 A;  2YU3 A;  3Q5F A;  2FML A;  5CVR A;  1OFC X;  5H20 A;  2O9L A;  4ZTF A;  4MLO A;  3JSP A;  3SFZ A;  2EFN A;  2XIG A;  3EPZ A;  2WAQ A;  1HLV A;  2ME6 A;  2L5Q A;  2E71 A;  3S3M A;  1H89 C;  3TBI A;  1VF9 A;  2BGC A;  1VQ9 I;  2CGP A;  1T6S A;  3G4S I;  1LKX A;  2VIX A;  1TWA J;  5AON A;  3KP4 A;  1TBX A;  4IPA A;  3ROU A;  2RRE A;  1FYM A;  3I4M J;  1ON2 A;  1OCP A;  3SZP A;  4YFN F;  1U0J A;  3TL4 X;  3M3Y J;  3L2R A;  2V4J C;  3KX2 A;  2NYX A;  1JJ8 C;  4IZZ A;  1R6R A;  2W7N A;  4CH7 A;  2QKM B;  3C18 A;  2HXI A;  1X1B A;  2EWN A;  3VYT B;  3LAJ A;  1FWZ A;  2N8G A;  2VE8 A;  2HZT A;  1JJ6 C;  3P7N A;  3KZZ A;  1HF0 A;  2VKE A;  3B6A A;  2DLL A;  2DQR A;  4LG0 A;  2E5N A;  5HLG A;  1W5S A;  1W7P D;  2QVO A;  2VE9 A;  3WE3 A;  1DQU A;  1BI3 A;  2DA7 A;  2XRO A;  1JKO C;  2BYV E;  4FTH A;  2BV6 A;  3E5X A;  4BBS J;  1D8J A;  2H6C A;  4BYY A;  1YIO A;  1JUP A;  5ICG A;  1A31 A;  3J7Y J;  2P6T A;  3EYI A;  1ZGJ A;  2R7R A;  3P9C A;  3T8R A;  3JRC A;  5FLX K;  2O03 A;  1Z21 A;  1W36 D;  4QLC U;  1HW2 A;  1LFP A;  2OQG A;  2B9S A;  1ZTR A;  1K78 B;  1KU7 A;  4KMU X;  1I6H J;  2DMN A;  4HV5 A;  5K7Z A;  1XGS A;  2L02 A;  2DPD A;  3MKW B;  4QWQ A;  3ZQF A;  3NQO A;  2A68 F;  4MO7 A;  2BHY A;  3GYH X;  5F04 A;  1LFU P;  3IC7 A;  2B63 J;  2KP6 A;  3WGH A;  2CQ7 A;  1ZGA A;  4A93 J;  1LEA A;  3FBI B;  2L7K A;  2GWR A;  3SHF A;  1ZRC A;  2V6E A;  1OCR H;  1Z05 A;  2K5C A;  3VYR B;  3MKY B;  1T95 A;  1IJW C;  2ZKZ A;  1Y0U A;  4XKC A;  2QEN A;  4L5J A;  5J1U A;  1J9I A;  1B72 A;  3QQA A;  2H8W A;  5TIS C;  4A6D A;  4D1Q A;  2BOL A;  1DU6 A;  1V3F A;  1WPK A;  5H6Q A;  3CCL I;  4RB0 A;  4N9I A;  3FM5 A;  3ISP A;  4LFU A;  1OKR A;  4ENJ A;  2O7O A;  1LQ1 A;  1EH6 A;  2XPV A;  1MIJ A;  4EVI A;  3ESW B;  1YIT I;  2LK2 A;  5EG0 B;  3CES A;  3FBN B;  2OUM A;  3D1N I;  3N4M A;  1D3Y A;  4UV8 A;  5M5X J;  1OPC A;  1BC7 C;  3QOD A;  3ZR8 X;  1GV2 A;  4YIF A;  4MEX F;  2GZW A;  4R8H A;  4HQE A;  1UZC A;  1X3U A;  4RM3 A;  2DYR H;  2OC6 A;  2KZV A;  5D8K B;  1FP1 D;  1HCR A;  1FEX A;  2RGV A;  1M1E B;  1R1V A;  2VC0 A;  5IY5 H;  2KHM A;  1LNW A;  2I5U A;  2M45 A;  2XRL A;  3OYL A;  2PJP A;  3HRM A;  3AAF A;  1RRJ A;  3MEX A;  2BVL A;  3MQ0 A;  1UEL B;  3ZMS A;  1LDK B;  2Y75 A;  3VSK A;  4ESB A;  2NS8 A;  3CCS I;  2IPQ X;  2OU2 A;  2EIM H;  1R58 A;  3V7C A;  4CCL A;  3BZK A;  3HOU J;  2IAI A;  4A3E J;  4LB5 A;  3ULQ B;  1TW3 A;  1KU2 A;  1SMT A;  3K4L A;  4RAF A;  3CCU I;  3CJN A;  2Z5U A;  4HAM A;  3DPU A;  2R5Z A;  5GAG J;  3VOE A;  2NVX J;  1PDN C;  1TWF J;  4G6D A;  2M35 A;  1YS7 A;  1D0X A;  1FBS A;  3K4C A;  4DOZ A;  1U8R A;  1R22 A;  5K5Q A;  1CGP A;  1SD7 A;  3ZP5 A;  2CUJ A;  4I99 C;  1XCB A;  1X4P A;  3Q3S A;  5M5W J;  1V54 H;  1GUU A;  4E7S A;  1XMA A;  2WB1 N;  5KK1 A;  2HQA A;  2ZFU A;  4CUG A;  2H1K A;  1EH7 A;  1XG1 A;  2KIM A;  3W2V A;  2KPM A;  3GF2 A;  2XUB A;  5E18 F;  2IXS A;  3O6B B;  2V26 A;  4ZC3 A;  3OY9 A;  1G6N A;  4MTE A;  2A3S A;  1DP3 A;  3NRV A;  2DQL A;  5EF6 A;  1ZG5 A;  2NS7 A;  1HQC A;  4B48 A;  1XDS A;  2HDW A;  1GXP A;  4Y33 A;  2M1B A;  3D0S A;  4AD9 A;  5F6F A;  5FLX R;  2JQ7 A;  1MJB A;  3RKQ A;  4B3A A;  3TP3 A;  2CG4 A;  2FOW A;  2LFB A;  4U0W A;  4W97 A;  1Z91 A;  2GA1 A;  3BPX A;  1FY7 A;  1TLH B;  4Q48 A;  3WHC A;  5C4J J;  1RIO H;  2JA7 J;  3DPT A;  3TO7 A;  2XGD A;  2UV1 A;  1V55 H;  3ECO A;  1QO0 D;  2MFZ A;  3F22 A;  4QTR A;  2X6Y A;  3FMS A;  3E7L A;  4AYB N;  1R49 A;  2Y0S N;  2AO9 A;  1ZG1 A;  4C2U A;  1IRZ A;  4IEJ A;  5BPI A;  1MKM A;  1QZZ A;  3QPS A;  5J47 A;  1VZ0 A;  3H92 A;  2V7F A;  2HOS A;  4HNU A;  5HDK A;  2FOK A;  3I56 I;  3OYB A;  1FC3 A;  3VB2 A;  1F9N A;  3HSR A;  1YIJ I;  3FWE A;  3I71 A;  5DV5 A;  4XOR A;  5E17 F;  1YX5 A;  2DCE A;  3CJR B;  1HDD C;  4YII A;  2KRF A;  1REP C;  1UHW A;  3K1N A;  5ICE A;  2LTP A;  3QP6 A;  2VN2 A;  3W6K B;  1YFH A;  3KLN A;  3F8C A;  3CCY A;  3J81 K;  4HF1 A;  3OSF A;  1T38 A;  5FLV A;  1WI3 A;  2XDV A;  2ISY A;  3ZGK A;  3RZO J;  4NQW A;  1VQO I;  4KDP A;  1YYV A;  4XOP A;  1LE8 B;  2Y31 A;  5LHH A;  1GV5 A;  4MQV A;  1YQA A;  2W48 A;  4J19 A;  3E1S A;  5DCM A;  2K9S A;  3T5X A;  3GTQ J;  2DDA A;  5CLS A;  3WU1 B;  2M9H A;  3ZN1 A;  3TP0 A;  2K9Q A;  3HG9 A;  1OCZ H;  3TGN A;  2UXX A;  4I09 A;  2H94 A;  3HSE A;  3F9K A;  4RB1 A;  3OYG A;  3F72 A;  5B66 C;  2CV1 A;  2VJI A;  3QOP A;  4AID A;  4Y13 A;  1X2M A;  3GFL A;  3EDP A;  4DGW B;  3IWF A;  4KUM A;  3DU6 A;  2X6O A;  3JAM K;  4FQG A;  5BMZ A;  2K40 A;  2R7W A;  2QBY B;  1IG7 A;  4CCN A;  2W00 A;  3JRF A;  2DTZ A;  4M3D A;  5J4V A;  2PJR B;  1B59 A;  1R7J A;  1U8B A;  5HS7 A;  5E3O A;  2YS9 A;  1SD6 A;  1TZL A;  1QZE A;  1P4W A;  1YX3 A;  4I01 A;  4XOT A;  3B73 A;  3K7A J;  3LA7 A;  1QBJ A;  1XPX A;  3ZMV A;  3R0A A;  2HS5 A;  3CCM I;  4XNF A;  3DBR B;  2Z3Y A;  4XLF A;  3F8B A;  1IV6 A;  1BJZ A;  4OU0 A;  3QYE A;  1TNT A;  2PFB A;  1RR7 A;  3GCM A;  4MQ9 F;  3TOB A;  5CVI A;  2YX7 A;  2GQQ A;  2XAQ A;  1R5G A;  3BR2 A;  3HPG A;  2D45 A;  2ID6 A;  4BEH B;  1EF4 A;  2GAU A;  4ZYA A;  4FAS D;  3KE2 A;  2BE5 F;  4AWX B;  3FXR A;  5DM6 F;  4UUV A;  3DQV C;  4XLA A;  1LPQ A;  3T8T A;  4AUX A;  1PUE E;  1HBX G;  1XSD A;  4S0H B;  3ZQL A;  2QGU A;  2LBF A;  1Z7L A;  4OIP F;  3V8L A;  4EM2 A;  3RI4 A;  1BL0 A;  2NXN B;  2EFP A;  4JP0 A;  5DUI A;  1RKW A;  2IS4 A;  3DTK A;  3BG7 A;  2ZJR F;  3HGG A;  3WTU C;  4K2E A;  1VQ4 I;  4JX5 A;  1HW5 A;  3MKL A;  4KIG A;  2TRT A;  1YLF A;  2HQ5 A;  1DGR M;  3QRF F;  1X19 A;  3RYP A;  2VL8 A;  2FSW A;  3V8J A;  5B3S H;  4OAZ A;  3LSG A;  1XMK A;  5LBQ A;  5JR3 A;  1AOY A;  1RPW A;  4CXF A;  1J2X A;  3S16 J;  4I2O A;  2CS3 A;  5E8G A;  1G8X A;  3C2G A;  5D5V B;  1QZY A;  4BXU A;  1Y1W J;  2E35 A;  2CMP A;  4GYI A;  3F8N A;  3C3W A;  3DWL E;  2DOA A;  3H35 A;  1KQ8 A;  2HGC A;  3K4B A;  4LLN A;  2XGX A;  3ASO H;  3IHU A;  1ETX A;  3OL3 A;  4KJZ A;  2KIF A;  2Q0O A;  2QYO A;  3K4K A;  3RPQ A;  3I3L A;  4ZZL A;  3RKX A;  3TDU C;  4UXN A;  3ZMZ A;  1MMA A;  2Y0S A;  2DDB A;  2KIU A;  2RKH A;  1TWC J;  3R6S A;  4B09 A;  2M0M A;  4HNT A;  2MH9 A;  1K61 A;  3E6M A;  3KZY A;  3QAH A;  4PZJ A;  3A1Y A;  4CIC A;  3MAJ A;  1O7F A;  2M0C A;  2YR2 A;  2M3A A;  5J8F A;  4L5I A;  4M73 A;  4U7D A;  4YEJ A;  1IN8 A;  2OZU A;  4NNJ A;  2ECC A;  4RLQ A;  3O3K A;  1TP4 A;  2XAS A;  4LG3 A;  2WC2 A;  4CYD A;  3CD6 I;  1VQ5 I;  3ONQ A;  5FFX A;  1G4D A;  3G1L A;  4A3D J;  2CWE A;  3FF5 A;  3MMY B;  3J81 R;  1FOX A;  2GIV A;  3NAR A;  3FXU A;  1YTY A;  1VQ7 I;  1K83 J;  3QU6 A;  1Z6R A;  1D1C A;  2PMH A;  1YRN B;  5IYC J;  2DFE A;  1KYZ A;  1WJ5 A;  2XAG A;  2R3S A;  3GFI A;  2AXL A;  2KJB A;  3HOS A;  1ERD A;  5HLH A;  4N0B A;  1MND A;  1N75 A;  5F1J A;  4L9N A;  4S05 A;  5B5E C;  1BIB A;  1K78 A;  3TMO A;  4IHX A;  1MD0 A;  2E34 A;  2GOM A;  4M3B A;  2MSY A;  3FZV A;  4G7H F;  3JAM R;  4KYW A;  1VQN I;  1SD4 A;  1ENH A;  2CYY A;  2ECB A;  5L3E A;  1OCT C;  3OYI A;  3HKZ A;  2LP0 A;  3WTX C;  3BR0 A;  2YPR A;  1SD5 A;  4HA8 A;  4JYK A;  4P9F A;  2VLA A;  1JT0 A;  2MD0 A;  5M3M J;  2DA2 A;  3HRU A;  1G3T A;  2EFQ A;  2VKH A;  1W7P B;  3I53 A;  5JFR A;  1MH3 A;  5KAI C;  3N97 A;  3QYB A;  1KGS A;  2IGN A;  4OWR B;  3JRE A;  1T56 A;  3R60 A;  5DTD A;  4ON0 A;  3OYK A;  5J40 A;  4H4K C;  2P4W A;  4EAT A;  4U7B A;  3KET A;  3B6C A;  4DYC A;  4F52 A;  3TO6 A;  3NWS A;  5FKN A;  2VPL A;  3KPH A;  2ID3 A;  4A2U A;  2NNN A;  3MFK A;  2KDO A;  2P7C B;  1GXQ A;  4LD5 A;  3HPH A;  3DEW A;  3GZN B;  3FM3 A;  3SDB A;  3WU0 A;  1S7A A;  5EG0 A;  4HDV A;  2ZSI B;  2HDC A;  1XGM A;  5E79 C;  3LAP A;  3DBL B;  4MIM A;  4HX7 A;  2D1H A;  2HYF A;  2OF7 A;  2X98 A;  4GCV A;  3HUG B;  5FD6 A;  2HI3 A;  3MZH A;  3I4N J;  1FMW A;  3MWM A;  2TDX A;  1N78 A;  2DOD A;  3CCQ I;  2KKO A;  3BCB A;  2F5C A;  3GTL J;  3LFU A;  1JT6 A;  2LRE A;  1H9G A;  1UHM A;  2YSR A;  3J7A W;  5FLX Z;  1E3P A;  3LSK A;  1MSE C;  1WJB A;  5J3L A;  1HKS A;  2CQK A;  2A6T A;  3BZC A;  4ZZD A;  4RBO A;  4BY1 J;  4V2F A;  3TQN A;  2UUZ A;  3JRB A;  2VT3 A;  4TV7 A;  2FBI A;  2E60 A;  2ZXW H;  5K7F A;  2ACJ A;  1FZP B;  3BR5 A;  4BHB A;  2L7Z A;  2L4M A;  4ENK A;  3ZQG A;  3S93 A;  3M4O J;  1F1Z A;  3FDY A;  2KT0 A;  3AG4 H;  2V9K A;  1MH4 A;  4KMF A;  4ZYE A;  1H8A C;  4HF0 A;  4IHW A;  1TWG J;  4HYE A;  3G3Z A;  1SFO J;  2HQR A;  5KVR A;  2P7V B;  2V79 A;  1WJF A;  4A3K J;  1RET A;  4FX4 A;  2DOF A;  3N05 A;  2G7U A;  4XN0 A;  2KDZ A;  1JHF A;  2EZH A;  2BY3 A;  1RKT A;  1MMS A;  3KP3 A;  4RGU A;  2Z99 A;  4IOA F;  2W4S A;  3R61 A;  4G8X A;  3JRD A;  2VBX A;  1R1T A;  3VDX A;  2DMQ A;  4CZZ A;  1U2W A;  1VTN C;  2XF5 A;  3OL4 A;  3GZ6 A;  2OCC H;  1L3L A;  2MZ4 A;  2EBI A;  4M3F A;  2R7Z J;  3CCV I;  2BVM A;  1I6X A;  2E36 A;  4E7H A;  1J09 A;  3WG9 A;  4BE0 A;  2DXI A;  2D2W A;  5EDN A;  4CYC B;  3HL2 A;  3GUD A;  2OJE D;  4YFK F;  3ABL H;  2DTR A;  2E1M B;  5DD4 A;  1RUN A;  4HG2 A;  1OR7 C;  4WF2 A;  1J7K A;  1A35 A;  1WZ2 A;  4EM0 B;  5ED4 A;  3HIF A;  4XRS A;  3K1M A;  1FYK A;  1I5Z A;  3ZQI A;  3HOZ J;  1JXS A;  4PFO A;  2L01 A;  2HU9 A;  1P9Q C;  4RB3 C;  1Y6I A;  2NOG A;  1VQK I;  2CH0 A;  3PJR A;  1XN7 A;  4BNC A;  2R7D A;  5CQE A;  1IRX A;  4FT8 A;  2UZK A;  2K9N A;  1RES A;  4IHT A;  3MVP A;  2ZC2 A;  4F55 A;  2W25 A;  5JLW A;  1K4S A;  5IPA A;  1APL C;  1U5T B;  2A5W A;  3OYD A;  4IRG A;  3I55 I;  1UAA A;  1ZR4 A;  2LG4 A;  2X9D A;  2RVC A;  4A6E A;  2M4K A;  2MGQ A;  4RMN A;  3L2Q A;  3BLY A;  1U3E M;  4CCO A;  2L7F P;  2L3D A;  1NG6 A;  5LRS A;  5FRN A;  3QPT A;  5GP9 A;  1MBG A;  4EV0 A;  3J80 K;  1SVM A;  1MBK A;  2JPC A;  3M8E A;  1FOW A;  1MW7 A;  2CJJ A;  1VND A;  3LA2 A;  5FO5 A;  5IOZ A;  2ETH A;  1ETW A;  4KT5 C;  4WXH A;  4XLE A;  1XB4 A;  5DYM A;  2QSG X;  3BJO A;  4C30 A;  5B1A H;  2GXG A;  1YI2 I;  2DFF A;  1BOA A;  2VJ4 A;  2G7H A;  1MDM B;  1WQ2 A;  1I1G A;  2EIL H;  3BDD A;  5A2Q R;  1RC9 A;  4MFD A;  4A0Z A;  4OIQ F;  2L0K A;  3M8F A;  1FNN A;  2R7T A;  4EJU A;  1T0F A;  4CZC A;  1LVK A;  1LE8 A;  3RCO A;  1V5G A;  2F5D A;  3WHB A;  3BOQ A;  3HB9 A;  1AU7 A;  1DDN A;  4OMY A;  2Z9O A;  1WJD A;  4FE7 A;  4QPQ A;  2L9R A;  1LJ9 A;  4XRM A;  2F4O B;  1JUS A;  4EGZ A;  4P5O A;  3OS0 A;  3SEQ A;  3K70 C;  1PUF B;  2X51 A;  2PBI A;  1SFE A;  3BP8 A;  3RZD J;  2L54 A;  3PFY A;  3HYI A;  3KLO A;  4J01 A;  3OYF A;  1LDJ A;  1JUM A;  2A07 F;  3S2D J;  2QBY A;  4LIV A;  2BXZ A;  1TL8 A;  3GWZ A;  3CO7 C;  2PJR A;  2VC1 A;  4C3J J;  4ZDO A;  4PFP A;  3JRA A;  2HVR A;  3OS1 A;  3CMA I;  3CP2 A;  3HGY A;  3IH2 A;  1Z7U A;  5HNF A;  3PSI A;  4M6V A;  1R9T J;  1X3Z B;  3M1E A;  1QU3 A;  4XBF A;  3CC2 I;  3H5R A;  2X1C A;  4M72 A;  4XKB A;  5CKT A;  3ZMT A;  5K5R A;  1QPM A;  3IAS 2;  3K4M A;  5LGT A;  1D5Y A;  2M30 A;  2R7O A;  5LEK A;  2MBF A;  3PQJ A;  4RAG A;  5IP6 A;  2CQQ A;  2HPM A;  1WJE A;  3H0G J;  5L3F A;  4L0Y B;  3W2W A;  3DPL C;  3S17 J;  2ELH A;  3C7J A;  2ELK A;  4BEH A;  3I9V 2;  2G0E A;  3OIQ A;  2DA5 A;  2R7X A;  3AKZ A;  2P0T A;  3OOP A;  4HQM A;  3K69 A;  1ACI A;  3I0T A;  2WAF A;  1R5I D;  1R00 A;  1SFX A;  4CCM A;  1IGN A;  1HA8 A;  1BR1 A;  2TCT A;  2W82 A;  3PM1 A;  3J81 Z;  3A01 B;  3OSG A;  2HWV A;  2QQ9 A;  1YJ9 I;  4KIS A;  4RS8 A;  1JKR C;  2NVQ J;  3GVA A;  1Y0N A;  2HKO A;  1X1D A;  1ZK8 A;  1XD7 A;  1YE9 A;  4B3X A;  1ZG3 A;  3EET A;  4MGR A;  2VBW A;  3ZQH A;  2WA0 A;  1UB9 A;  3A0H C;  4LMY A;  2H1L A;  2X1E A;  2LOO A;  4PCQ A;  5FD5 A;  1X2N A;  3ZXS A;  4B44 A;  2QSH X;  1D8K A;  3S3O A;  4YFX F;  1IN7 A;  2A5Y B;  2F2E A;  3PFI A;  4I7H A;  3V4G A;  2JRM A;  3QPH A;  2DYS H;  3V7S A;  1OCO H;  1TQM A;  1Z0X A;  1GVJ A;  3S2H J;  1FX7 A;  2MH2 A;  4OMZ A;  4XLH A;  3JAM Z;  4BJ6 C;  4IXA A;  3SEZ A;  2Q8K A;  1ON1 A;  4DBR A;  1VQ6 I;  2IBD A;  3F21 A;  2OTJ I;  2IGO A;  3RIR A;  1BI1 A;  2WY7 Q;  2RV8 A;  3HOT A;  3SJM A;  2FBK A;  2A69 F;  2VPR A;  1R71 A;  5IT9 K;  2FE3 A;  1IN4 A;  1J75 A;  2A6E F;  4IHY A;  4OOI A;  2CO5 A;  3H5A A;  4DZJ A;  3LSH A;  2ZJQ F;  3G1O A;  4F91 B;  1QVT A;  2VAS A;  3ABK H;  3ASN H;  3ML6 A;  4BAY A;  2NNY A;  5D5W B;  2QSF X;  3LNQ A;  2PX9 A;  4Q47 A;  2XB0 X;  3GEZ A;  1IRG A;  4B4C A;  2XF7 A;  1D5V A;  5H6R A;  4KN4 X;  1V5E A;  4M9X A;  2K3P A;  5GTH C;  4KIC A;  1DPU A;  3I59 B;  3J80 R;  2QM3 A;  2MD5 A;  5GAH J;  5J8C A;  4II3 A;  5JHF A;  1EKE A;  3O2P E;  2Y9Y A;  2OPT A;  4L9V A;  4LJZ F;  4DW6 A;  3ERE D;  2GA2 A;  1E17 A;  2E5Z A;  2JA5 J;  3WTZ A;  2CUF A;  1VQL I;  3GME A;  3L2U A;  4D0P A;  2LR8 A;  3S15 J;  1R5H A;  5E3N A;  5JLX A;  3ABM H;  3P5J A;  1SC7 A;  2RC4 A;  2LKS A;  2JA6 J;  2JRT A;  5F0C A;  4EJW A;  1QPI A;  5L3G A;  3LOC A;  3FKJ A;  4HLY A;  2IA0 A;  2P6S A;  1WCM J;  3HHH A;  2Q1Z B;  1KON A;  1IW7 F;  1LUJ B;  1LVA A;  1ETK A;  1OR7 A;  1SMY F;  3IAM 2;  5FB2 A;  3JRH A;  3OV8 A;  3BQZ A;  1ZRD A;  3H5N A;  3EYY A;  1POG A;  3CQZ J;  2FMY A;  2K27 A;  1W1W E;  2CW7 A;  2HOE A;  4MFE A;  4BE1 A;  3U1K A;  1Z9C A;  3IV5 A;  5ERI A;  4UY8 I;  3ELK A;  1J59 A;  2ME0 A;  2V1U A;  1TTY A;  2Z33 A;  3JTH A;  4AVZ A;  4F92 B;  4WWC A;  5EZG A;  5DCF A;  3WTY C;  2ESN A;  2DN0 A;  3LMM A;  4M6X A;  3QYF A;  4P55 A;  4AIJ A;  2RAE A;  1W7P A;  2CFO A;  4XSZ F;  4BKX A;  2JA8 J;  4BGD A;  2AS5 F;  1DGW Y;  4LIU A;  3HZJ A;  3BZ6 A;  2O8X A;  2MG4 A;  3PNV A;  5TJJ A;  4D5F A;  3HM5 A;  1NG7 A;  2MYS A;  3TW6 A;  2Q2E B;  4EEF G;  1I27 A;  4WXC A;  2EJR A;  2Y69 H;  5K7H A;  3WGG A;  2BEO A;  2DO7 A;  3KEO A;  4M3E A;  2EFW A;  2KZG A;  4JX4 A;  2IRF G;  3EUA A;  3HUG A;  2I8D A;  3VWB A;  2EFO A;  3FX3 A;  5F1R A;  2LY2 A;  5JHU A;  4ABZ A;  3Q9S A;  4R79 A;  3HRT A;  5B1B H;  1NK2 P;  1OYW A;  2AXT C;  2HXO A;  1IV8 A;  1JGG A;  4RLF A;  4GXO A;  2L9S A;  1B1B A;  1FTZ A;  2QWW A;  4Y52 J;  2KIS A;  2DT6 A;  4ZTJ A;  2RN7 A;  4U0Y A;  3COA C;  3ERM A;  3H36 A;  1U9O A;  1KYW A;  2DFH A;  2KRH A;  3LWF A;  4BU2 A;  3KCC A;  4GO1 A;  3RPU D;  3A0B C;  1ZQ3 P;  1T98 A;  3S1M J;  3CUQ B;  4M6Y A;  3L2C A;  4A3F J;  2M8E A;  2LY1 A;  2HVS A;  1KQ0 A;  4DYR A;  4DIQ A;  2K02 A;  1FBQ A;  1RNL A;  2DJN A;  2GXA A;  4A3G J;  1B4A A;  5IT9 R;  2ZFW A;  3GTM J;  3DLL F;  2FF4 A;  1NTC A;  3GLX A;  4BE2 A;  2LRD A;  3JCU C;  3DEU A;  4BUP A;  4XLP F;  4IX7 A;  3RJP A;  4QSH A;  1IUY A;  2W24 A;  3E0J B;  3WU2 C;  4XLC A;  3RQI A;  4S04 A;  1XC5 A;  4EJV A;  5ILV A;  3H9Q A;  1IC8 A;  2HKX A;  3E97 A;  2LVS A;  5HOD A;  2LH9 A;  4CDG A;  5KAF C;  5CVV A;  1FJL A;  1QGP A;  1PJR A;  2AQF A;  5DDG A;  1U9N A;  4CO8 A;  4HX8 A;  4GYG A;  1MNM C;  3FXL A;  1BW6 A;  1BJA A;  5GAD J;  1Y8R B;  2GOX B;  2J5P A;  3QWL A;  1T8I A;  4A3B J;  3M1C A;  3BTJ A;  4G94 A;  5HDN A;  1WWX A;  4E7K A;  3F6O A;  2KL4 A;  2H27 A;  4NDL A;  5CQG A;  2XV4 S;  4CYC A;  2JN6 A;  3FIS A;  4DJA A;  1QHH D;  2WB1 A;  1DU0 A;  1VQP I;  1ZLK A;  1HKT A;  1YW9 A;  2ZXH A;  1KU3 A;  4XSX F;  1ZYR F;  1MBJ A;  5LGN A;  3CJT B;  4UVB A;  2UWM A;  1CQT A;  2JSC A;  4BQN A;  2UXN A;  2O3F A;  2FX0 A;  1BI2 A;  1VQM I;  2HFH A;  3DKY A;  2L2O A;  3PO3 J;  2ZME B;  1OQY A;  3G6E I;  1FSE A;  3A4C A;  4UUS B;  4HOB A;  3KP6 A;  2EIJ H;  2QLZ A;  5L3C A;  2VBZ A;  2XSD C;  2JVG A;  2MLG A;  3LSM A;  1U5T A;  3EUH C;  4FCY A;  4A5N A;  3CMY A;  1UFM A;  4XL9 A;  3VSL A;  4EMS A;  2L9V A;  2BZT A;  1UG2 A;  4JX6 A;  4Y7N J;  5GPC A;  4LLG F;  5JVT A;  1FBU A;  3LFK A;  4L5E A;  5C44 J;  1O3Q A;  2HZD A;  5FJ8 J;  1IO2 A;  2XC7 A;  4AYB A;  2NVY J;  3FK7 A;  3L9F A;  4BXF A;  2ZSH B;  2LC2 A;  2KFD A;  2Y2Z A;  1U78 A;  5FKO A;  2W85 A;  3QPL A;  4BL0 B;  3LQQ A;  4IOC F;  4HNV A;  1MDM A;  3IKV A;  3OYM A;  1FTT A;  2K85 A;  4H0E A;  2AHQ A;  5ICF A;  5D4S A;  1IAW A;  1ULY A;  1A6Q A;  1WH7 A;  4AC0 A;  2F5E A;  1P6R A;  1WH5 A;  1S3J A;  3B02 A;  3IH4 A;  1Y1V J;  1TC3 C;  2Y30 A;  4Z2Y A;  2ZJP F;  3AG3 H;  5ILU A;  1T0F C;  1XMX A;  3S14 J;  3HDD A;  2CSO A;  3HJE A;  2OCE A;  1PUF A;  1Z1D A;  2BY0 A;  4HDU A;  1Y56 A;  2R5Z B;  1W5C C;  1BR2 A;  3RKY A;  4I6Z A;  1YJN I;  1WI9 A;  2ESH A;  2XKP A;  4FE4 A;  5CPR B;  4A69 C;  1ODD A;  1IDY A;  2C6Y A;  3KP5 A;  4G12 A;  5CVJ A;  2R7S A;  2QKL B;  1TW2 A;  2QA4 I;  3KYL A;  1G59 A;  3D5S C;  4U0V A;  2QQ8 A;  4AM3 A;  3FHN A;  1RR8 C;  3SZT A;  1W4M A;  1RQ6 A;  2FBH A;  4CGZ A;  4M74 A;  2ZNY A;  2FA5 A;  3C1D A;  4HZF A;  4CCK A;  1T08 B;  4IQ4 A;  2EV0 A;  2KMU A;  2KQR A;  2W57 A;  1Q1H A;  1IRF A;  4G7O F;  4KIB A;  2K9L A;  6PAX A;  5H2F C;  2LSO A;  5E1Z B;  4EGY A;  4BHP A;  4KN7 X;  4WCG A;  1XSV A;  2DA4 A;  2WTE A;  5EEH A;  3BTL A;  3J80 Z;  4LGW A;  2R5Y B;  1F4K A;  4E6K G;  4MEY F;  4XQF A;  1A5J A;  2BY1 A;  3A01 A;  4O5V A;  4JBA A;  3AL0 B;  3CP8 A;  2K4B A;  2MC4 A;  5A2Q K;  1ZEL A;  2P5V A;  4DNC A;  2GM4 A;  2JMW A;  3WOD F;  3HOV J;  1X3W B;  3H3V K;  3WTV C;  3O8H A;  5E1X A;  1YO5 C;  5DEQ A;  2ICW G;  1A04 A;  3OYJ A;  2DW4 A;  3E6B A;  4F3Q A;  1ZH5 A;  3GTG J;  2GIZ A;  3HRS A;  1MMG A;  2PEX A;  2X1D A;  5FKL A;  4G6Q A;  2ZME C;  3DP7 A;  3KZI C;  3E5Q A;  3L00 A;  2V9V A;  4NC7 A;  2A61 A;  1LFB A;  1MZB A;  1T33 A;  2BW3 B;  3OIP A;  5CJ9 A;  5HLT A;  2E2I J;  1OCC H;  3GFJ A;  3HOX J;  4UB6 C;  2E1C A;  2ZXI A;  3BTC A;  3R0J A;  3TO9 A;  1A36 A;  2JT1 A;  5L3B A;  3DV8 A;  3T0Y A;  3UNG C;  4V19 K;  2CUZ A;  4PJL A;  3SDG A;  2DMU A;  2OV7 A;  2IS6 A;  2DK8 A;  5BS6 A;  3BTI A;  4WK8 F;  2Y48 A;  5FKM A;  1TT0 A;  3L09 A;  1PP8 F;  1S8N A;  1JHH A;  1I39 A;  3DCF A;  4FHT A;  3CC7 I;  4CSW A;  1T39 A;  2JVH A;  1YHQ I;  2XRN A;  3BC8 A;  1YW8 A;  1JTY A;  3BR3 A;  4EJO A;  4XLN F;  1O3R A;  1QNT A;  3FXJ A;  4OAY A;  2IP2 A;  4RAY A;  2E1O A;  5IOY A;  5D5U B;  4NC8 A;  2CV0 A;  2XVC A;  4LLL A;  3DF8 A;  1MMN A;  3F23 A;  1IZ1 A;  3FXM A;  2V1N A;  1J5Y A;  1FOK A;  2QUF A;  2M87 A;  2VI6 A;  3VYS B;  4HLX A;  3GZ5 A;  3JRG A;  2GLO A;  3HOW J;  1U6G A;  5FFZ A;  3ZMU A;  2B0L A;  2JTV A;  1FIA A;  1UCR A;  3K4N A;  4BQA A;  1QA6 A;  2O0Y A;  1H0M A;  4IRH A;  3SFI A;  3RYR A;  2DA3 A;  3I4P A;  1SFU A;  1XDU A;  2X6W A;  4E7J A;  4XM3 A;  4I02 A;  3F8M A;  5CYV A;  1ZRF A;  1WJA A;  2DA1 A;  3OWT A;  2H8R A;  2R7V A;  2R4G A;  2JJ7 A;  5F27 A;  1HXD A;  4YIR X;  3FMR A;  3RDI A;  5J6X A;  3JTG A;  5F0F A;  4OIO F;  3DTI A;  4P1W A;  5JI6 A;  1NH3 A;  2IA2 A;  1S29 A;  1BN5 A;  1S9H A;  2WV1 A;  2NRA C;  2NVT J;  3ZQ7 A;  1GHC A;  5IT9 Z;  1ZAR A;  3SZG A;  1XGO A;  2HEO A;  4DBQ A;  3EUH A;  2R93 J;  4A0X A;  1CF7 B;  2ADU A;  3CTA A;  5LEJ A;  4J00 A;  4L18 B;  3GO5 A;  2M34 A;  3NWT A;  5C3E J;  4IKF A;  1L0O C;  5IT3 A;  2NS0 A;  2EIK H;  4E4H A;  1F5T A;  4M9S A;  2Q2E A;  4UUT A;  5D6E A;  3RTR A;  4A5M A;  2HOA A;  1Z67 A;  4JQF A;  2JSP A;  4P96 A;  3AL0 C;  3SQN A;  1WJC A;  1EV7 A;  3KYD B;  1BR4 A;  4BBR J;  1W36 C;  1ETQ A;  2KJC A;  5EEG A;  3IL2 A;  2VQC A;  4BJ5 C;  1E3H A;  4BAC A;  1UG0 A;  4ZJZ A;  2HYG D;  1BI0 A;  2ZXJ A;  3UR3 C;  5KHD A;  3LSP A;  3QP5 A;  4E7Z A;  5ILS A;  1JKQ C;  2H09 A;  4BHC A;  1YJW I;  1UHS A;  2V6C A;  3CJQ B;  2ZO4 A;  2B7E A;  4I76 A;  3M7G A;  4PJN A;  3KYC B;  3W6J B;  4PJ0 C;  5FRO A;  3H0D A;  2FQ3 A;  2LKX A;  4EJT A;  1E3O C;  3RKW A;  2R7F A;  2IGK A;  3GFM A;  2K4J A;  4IQJ A;  1K4T A;  3S3N A;  1IXR C;  2O8K A;  3HTU A;  1AKH B;  1BM9 A;  2I10 A;  3IH3 A;  2FUG 2;  2XPU A;  5LRR A;  4E70 A;  3BPV A;  4EQQ A;  3CUQ A;  2XB5 A;  3FXO A;  4L9J A;  3IRQ A;  2VQL A;  2MA3 A;  4AIK A;  3JSO A;  2YX4 A;  4ZDL A;  3KEQ A;  4ETS A;  1HDP A;  3U9G A;  4KIF A;  3HC7 A;  3U2R A;  4F93 B;  3LST A;  4CCJ A;  1HSJ A;  1E2X A;  3QU3 A;  4FET A;  5GTI C;  3JRI A;  2E2J J;  2LYC A;  4GDF A;  1PP7 U;  3WG7 H;  2H6B A;  2NOJ B;  3Q0V A;  4LB6 B;  1LB2 A;  4FIS A;  3IUO A;  4ZH4 F;  1MBF A;  2BXY A;  3H3U A;  3JW4 A;  2XGE A;  1HKQ A;  5EEA A;  4LK1 F;  1I1S A;  2CW0 F;  4B47 A;  5EGO B;  3O8G A;  1EJ9 A;  1ETV A;  3OR2 C;  1SVO A;  1JE8 A;  4HW0 A;  2R7U A;  3G1M A;  1FLI A;  4XMY A;  4DZP A;  1V5F A;  2COM A;  3CDI A;  2XKO A;  1LDD A;  2IJL A;  4OIR F;  4GFB A;  2E19 A;  5E8I A;  5F0H A;  2CQX A;  3I54 A;  3P9K A;  4HV6 A;  2VJJ A;  1BC8 C;  4ESF A;  2R0Q C;  2GXB A;  1S5L C;  1EH8 A;  1P7I A;  2DA6 A;  2MAB A;  3TED A;  3K70 D;  4V2G A;  3C2H A;  3DKW A;  1FMV A;  2DBB A;  2E1M C;  3DFG A;  3I64 A;  2EZL A;  3F6V A;  2XGC A;  1ETY A;  3CME I;  5IP9 J;  2HPI A;  1SVL A;  2ZME A;  3PUF A;  4UUS A;  2IVM A;  4E7I A;  3KIO A;  1BBY A;  1Y8Q B;  3S2W A;  3ZOB A;  4A3J J;  3H3Z A;  4HSR A;  1STZ A;  2DFI A;  5HVQ C;  1YOV B;  5FKK A;  2ELJ A;  4N4O B;  2CUE A;  2WV0 A;  1SAN A;  3Q0W A;  4NUB A;  4PJJ A;  5D6F A;  3A52 A;  2JPB A;  4DQ2 A;  1U5T C;  5D4R A;  1T2K A;  2RNG A;  4ESJ A;  1KU9 A;  3CUO A;  5TGT A;  1R23 A;  3OYC A;  1S7E A;  2VXD A;  3PUB A;  1MNE A;  1XSX A;  1FPQ A;  3BJA A;  3P9I A;  2D5V A;  4ZYG A;  3AG2 H;  1X4O A; 
#chains in the Genus database with same CATH homology
 4BH9 A;  2LNB A;  2ZCW A;  5L3D A;  2EV5 A;  5K1Y A;  2VBY A;  2DPU A;  1ZHF A;  1IN5 A;  2E7W A;  4M71 A;  4PGG A;  3IWZ A;  4IVN A;  4CHU A;  3ECH A;  1OYI A;  3IRR A;  4UV9 A;  4FX0 A;  4Q4Z F;  5D8L B;  5BQT A;  2VOD A;  2QQB A;  2LF7 A;  2FNP A;  1FT9 A;  5FGM A;  3KP7 A;  1V4R A;  5LHG A;  3VFZ A;  3ZN0 A;  3ZPL A;  1O57 A;  1DPR A;  5LGU A;  3K0L A;  4N9H A;  4ZYH A;  1TQP A;  4ENM A;  4UVA A;  1TNS A;  2P5L C;  2FEZ A;  2FU4 A;  3VOD A;  3WGI A;  1OYY A;  2K86 A;  1RUO A;  3G73 A;  2P8T A;  1K6O A;  2LKP A;  2J5O A;  3GW2 A;  4ENN A;  3CLO A;  1P2F A;  3LA3 A;  3CDH A;  3LQR A;  2VON A;  4B8X A;  4I0B A;  1ZAO A;  2EV6 A;  5K5O A;  1HW1 A;  5HOO A;  1FP2 A;  2M5W A;  1R36 A;  1IF1 A;  2O6G E;  1KQ9 A;  3GXO A;  4G9Y A;  4OIN F;  3WTS C;  1JGS A;  4KA4 A;  2OBP A;  1ZLJ A;  5D5X B;  2X4H A;  4PGH A;  4F7Z A;  2IT0 A;  2P5K A;  4WXD A;  4KFC A;  4LG0 B;  1WSU A;  2CFX A;  4KNY A;  1IXC A;  1AWC A;  3IKT A;  4MNU A;  1IN6 A;  2DK5 A;  5CVU A;  3K2Z A;  2A6H F;  2VOP A;  2V1D A;  4O3M A;  2VOO A;  2X0L A;  3D5L A;  1Z6T A;  4GGG A;  3TDZ C;  4UNO A;  1B6A A;  2XHK A;  3BWG A;  2XAF A;  3REO A;  1XGN A;  2OA4 A;  1O3T A;  2DAO A;  5A2Q Z;  2HTS A;  3PQK A;  2DI3 A;  1LEB A;  1O3S A;  3E5U A;  4Y17 A;  4PDK A;  2W84 A;  3ABT A;  3TOA A;  4NHJ A;  4NB5 A;  2ZJ2 A;  2O61 A;  3FXQ A;  4M9Z A;  2STW A;  1FYL A;  1CF7 A;  4RGX A;  3J7A O;  4YG2 F;  5AIQ A;  1FSH A;  2MLK A;  3CO6 C;  1B9M A;  3I58 A;  4XRF A;  4RGS A;  2FRH A;  3BRO A;  3EQL F;  3Q9V A;  1DP7 P;  1P4X A;  2RDP A;  2PQ8 A;  1G3S A;  4RB2 C;  2OAZ A;  1YG2 A;  5HLI A;  2STT A;  2V1X A;  5HS9 A;  4IRI A;  4LK0 F;  5HDG A;  1S7O A;  1BIA A;  2Y0M A;  2PN6 A;  4AIH A;  2VXZ A;  4IJA A;  1ONV A;  4RAZ A;  1P4A A;  1KA8 A;  2EA2 A;  2PMU A;  1S6L A;  2QQA A;  4HBL A;  1IXS B;  3CUQ C;  4UHT A;  4IF4 A;  2OZ6 A;  4EM1 A;  1MJ9 A;  1MGT A;  2IA1 A;  2IW5 A;  1YS6 A;  1G3W A;  2OD5 A;  1MJA A;  1NHA A;  2E7X A;  2G9W A;  5HS8 A;  1R1U A;  2ZNZ A;  4IHS A;  4G7Z F;  5E20 A;  3HHG A;  4L9T A;  4ZYD A;  2F5F A;  4U88 A;  2EK5 A;  2LF8 A;  3DXJ F;  2EB7 A;  1P92 A;  2HQN A;  4I0A A;  3WTT C;  2RQP A;  5LHI A;  1USS A;  4HF2 A;  4ASN A;  3RPU A;  2PLY A;  1TQI A;  2E1N A;  2VT2 A;  2PI0 A;  4MHG A;  4P9U A;  4WX9 A;  3V8K A;  2WWY A;  1QQI A;  5DD8 A;  3HSF A;  3E6D A;  2RNJ A;  1XCV A;  2DU9 A;  3T1B A;  5BOX A;  2ZBK A;  4Q5S F;  3M9A A;  1K7A A;  1HST A;  2PG4 A;  3MCZ A;  1J0R A;  5LLQ A;  3FMQ A;  3E3V A;  4JK1 X;  3KP2 A;  5E1W A;  1DUX C;  3SXY A;  4AVP A;  2XAJ A;  3FHZ A;  1W5T A;  1YW7 A;  5TRD A;  4Y15 A;  4UVC A;  3WTW C;  1O7L A;  1ZN2 A;  3WE2 A;  5AIP A;  5DCM B;  2NAZ A;  2HTJ A;  2FXA A;  3I59 A;  4MTD A;  1RZ4 A;  5DUK A;  1K79 A;  3HTS B;  1H9T A;  3BJ6 A;  4O6J A;  1WKM A;  2OQR A;  1ZRE A;  2BBY A;  4R1H A;  3U1D A;  3BY6 A;  2FNA A;  2DT5 A;  3ZMD A;  5F64 A;  5BPD A;  2K7L A;  2QZ8 A;  3NEU A;  2L4A A;  3L7W A;  4A0Y A;  1OMI A;  3GX4 X;  1C0W A;  4L0Z B;  4RGR A;  3K9T A;  1RI7 A;  3V7R A;  2EA4 A;  4I98 B;  3E6C C;  1B9N A;  3K1P A;  2JZY A;  2MC3 A;  3VEP A;  4A12 A;  3KFW X;  3R4K A;  1G3Y A;  2D1V A;  5ICC A;  1WRJ A;  2HR3 A;  3TKY A;  2XAH A;  1SAX A;  3I5U A;  1UST A;  2LDU A;  3F8F A;  3MZY A;  3F3X A;  4HX4 A;  3ABU A;  2ISZ A;  2YU3 A;  3Q5F A;  2FML A;  5CVR A;  5H20 A;  3JSP A;  3SFZ A;  2EFN A;  2XIG A;  2BGC A;  2CGP A;  1T6S A;  5AON A;  3KP4 A;  1TBX A;  4IPA A;  3ROU A;  1FYM A;  1ON2 A;  3SZP A;  4YFN F;  2NYX A;  3C18 A;  2EWN A;  3LAJ A;  1FWZ A;  2VE8 A;  2HZT A;  3P7N A;  3KZZ A;  2DLL A;  2DQR A;  4LG0 A;  5HLG A;  1W5S A;  1W7P D;  2QVO A;  2VE9 A;  3WE3 A;  2XRO A;  1BI3 A;  2BYV E;  2BV6 A;  3E5X A;  1D8J A;  2H6C A;  4BYY A;  1YIO A;  5ICG A;  2P6T A;  3EYI A;  1ZGJ A;  3P9C A;  3T8R A;  5FLX K;  2O03 A;  4QLC U;  1HW2 A;  2OQG A;  1K78 B;  1KU7 A;  4KMU X;  4HV5 A;  1XGS A;  2L02 A;  2DPD A;  4QWQ A;  3NQO A;  2A68 F;  3GYH X;  3IC7 A;  3WGH A;  1ZGA A;  1LEA A;  2GWR A;  3SHF A;  1ZRC A;  1Z05 A;  2ZKZ A;  1Y0U A;  2QEN A;  4L5J A;  1J9I A;  4A6D A;  1V3F A;  5H6Q A;  4RB0 A;  4N9I A;  3FM5 A;  3ISP A;  4LFU A;  1OKR A;  4ENJ A;  1LQ1 A;  1EH6 A;  4EVI A;  3N4M A;  1D3Y A;  4UV8 A;  1OPC A;  1BC7 C;  4YIF A;  4MEX F;  2GZW A;  4R8H A;  4HQE A;  1X3U A;  5D8K B;  1FP1 D;  2RGV A;  1R1V A;  2VC0 A;  1LNW A;  2M45 A;  2PJP A;  3HRM A;  3AAF A;  3MEX A;  3MQ0 A;  3ZMS A;  1LDK B;  2Y75 A;  4ESB A;  2IPQ X;  2OU2 A;  1R58 A;  3V7C A;  4LB5 A;  3ULQ B;  1TW3 A;  1KU2 A;  1SMT A;  3CJN A;  2Z5U A;  4HAM A;  3VOE A;  1PDN C;  4G6D A;  1YS7 A;  1FBS A;  1U8R A;  1R22 A;  5K5Q A;  1CGP A;  1SD7 A;  3ZP5 A;  1XCB A;  1XMA A;  5KK1 A;  1EH7 A;  2KIM A;  3GF2 A;  5E18 F;  2XUB A;  3O6B B;  1G6N A;  4MTE A;  2A3S A;  3NRV A;  2DQL A;  1ZG5 A;  1HQC A;  1XDS A;  1GXP A;  2M1B A;  3D0S A;  4AD9 A;  5F6F A;  1MJB A;  2CG4 A;  4U0W A;  1Z91 A;  2GA1 A;  3BPX A;  1FY7 A;  1TLH B;  4Q48 A;  1RIO H;  3DPT A;  3TO7 A;  3ECO A;  1QO0 D;  3F22 A;  3FMS A;  1ZG1 A;  5BPI A;  1MKM A;  1QZZ A;  3H92 A;  5HDK A;  2FOK A;  1FC3 A;  3VB2 A;  1F9N A;  3HSR A;  3FWE A;  3I71 A;  5DV5 A;  5E17 F;  4YII A;  2KRF A;  1REP C;  5ICE A;  1UHW A;  3K1N A;  3QP6 A;  2VN2 A;  3W6K B;  1YFH A;  3KLN A;  3F8C A;  3J81 K;  4HF1 A;  1T38 A;  2ISY A;  4NQW A;  4KDP A;  1YYV A;  5LHH A;  4MQV A;  1YQA A;  5DCM A;  3T5X A;  5CLS A;  3WU1 B;  3ZN1 A;  3TGN A;  2UXX A;  4I09 A;  2H94 A;  3HSE A;  4RB1 A;  3F72 A;  3QOP A;  4Y13 A;  3GFL A;  3EDP A;  3IWF A;  4KUM A;  3JAM K;  5BMZ A;  2QBY B;  1B59 A;  1R7J A;  5HS7 A;  1SD6 A;  1P4W A;  4I01 A;  3B73 A;  3LA7 A;  1QBJ A;  3ZMV A;  3R0A A;  2HS5 A;  2Z3Y A;  3F8B A;  4OU0 A;  1TNT A;  2PFB A;  4MQ9 F;  3TOB A;  5CVI A;  2YX7 A;  2GQQ A;  2XAQ A;  1R5G A;  2D45 A;  2GAU A;  3KE2 A;  2BE5 F;  4AWX B;  3FXR A;  4UUV A;  3DQV C;  1PUE E;  3T8T A;  1HBX G;  1XSD A;  4OIP F;  3V8L A;  4EM2 A;  3RI4 A;  2EFP A;  5DUI A;  3WTU C;  4K2E A;  1HW5 A;  4KIG A;  1YLF A;  3QRF F;  3RYP A;  2FSW A;  3V8J A;  1XMK A;  5LBQ A;  5JR3 A;  1AOY A;  4CXF A;  1J2X A;  4I2O A;  5E8G A;  5D5V B;  1QZY A;  4BXU A;  4GYI A;  3F8N A;  3C3W A;  1KQ8 A;  2HGC A;  4LLN A;  2XGX A;  3IHU A;  2KIF A;  2Q0O A;  2QYO A;  3RPQ A;  4ZZL A;  3RKX A;  3TDU C;  4UXN A;  3ZMZ A;  2KIU A;  2RKH A;  3R6S A;  4B09 A;  2MH9 A;  3E6M A;  3KZY A;  3QAH A;  4PZJ A;  4CIC A;  3MAJ A;  1O7F A;  2YR2 A;  5J8F A;  4L5I A;  4M73 A;  4U7D A;  1IN8 A;  2OZU A;  3O3K A;  2XAS A;  4CYD A;  2WC2 A;  1G4D A;  5FFX A;  2CWE A;  3FF5 A;  2GIV A;  3FXU A;  1YTY A;  3QU6 A;  1Z6R A;  2PMH A;  1KYZ A;  2XAG A;  2R3S A;  3GFI A;  2AXL A;  2KJB A;  3HOS A;  5HLH A;  4N0B A;  4L9N A;  4S05 A;  1BIB A;  1K78 A;  1MD0 A;  3FZV A;  4G7H F;  4KYW A;  1SD4 A;  2CYY A;  5L3E A;  3WTX C;  2YPR A;  1SD5 A;  4HA8 A;  4P9F A;  3HRU A;  1G3T A;  2EFQ A;  1W7P B;  3I53 A;  5JFR A;  3N97 A;  1KGS A;  3R60 A;  4ON0 A;  2P4W A;  4U7B A;  3KET A;  3TO6 A;  4A2U A;  2NNN A;  3MFK A;  2P7C B;  1GXQ A;  4LD5 A;  3FM3 A;  3WU0 A;  4HDV A;  1S7A A;  2HDC A;  1XGM A;  3LAP A;  4HX7 A;  2D1H A;  2HYF A;  4GCV A;  5FD6 A;  3MZH A;  3MWM A;  2TDX A;  2KKO A;  2F5C A;  1UHM A;  1H9G A;  2YSR A;  5FLX Z;  1HKS A;  2CQK A;  4ZZD A;  3TQN A;  2VT3 A;  4TV7 A;  2FBI A;  2ACJ A;  1FZP B;  4BHB A;  2L4M A;  4ENK A;  1F1Z A;  4KMF A;  4ZYE A;  4HF0 A;  4HYE A;  3G3Z A;  2HQR A;  5KVR A;  2P7V B;  2V79 A;  4FX4 A;  2G7U A;  1JHF A;  3KP3 A;  4RGU A;  2Z99 A;  3R61 A;  4G8X A;  2VBX A;  1R1T A;  4CZZ A;  1U2W A;  1VTN C;  3GZ6 A;  1L3L A;  1I6X A;  3WG9 A;  2D2W A;  3GUD A;  4YFK F;  2DTR A;  5DD4 A;  1RUN A;  4WF2 A;  1J7K A;  4EM0 B;  5ED4 A;  3HIF A;  3K1M A;  1FYK A;  1I5Z A;  1JXS A;  2L01 A;  4RB3 C;  1XN7 A;  4BNC A;  2R7D A;  4FT8 A;  2UZK A;  4IHT A;  2W25 A;  1U5T B;  4IRG A;  2RVC A;  4A6E A;  1U3E M;  2L3D A;  5LRS A;  3QPT A;  4EV0 A;  3J80 K;  2JPC A;  3M8E A;  3LA2 A;  5FO5 A;  2ETH A;  4KT5 C;  4WXH A;  1XB4 A;  5DYM A;  3BJO A;  2GXG A;  1BOA A;  1MDM B;  2G7H A;  1WQ2 A;  1I1G A;  3BDD A;  4A0Z A;  4OIQ F;  3M8F A;  1FNN A;  4EJU A;  1T0F A;  2F5D A;  3BOQ A;  1DDN A;  4OMY A;  2Z9O A;  1LJ9 A;  4EGZ A;  4P5O A;  2PBI A;  1SFE A;  3BP8 A;  2L54 A;  3HYI A;  3KLO A;  1LDJ A;  2A07 F;  2QBY A;  3GWZ A;  3CO7 C;  2VC1 A;  1Z7U A;  3M1E A;  4XBF A;  4M72 A;  3ZMT A;  5K5R A;  1QPM A;  5LGT A;  2M30 A;  5LEK A;  2MBF A;  3PQJ A;  5L3F A;  4L0Y B;  3DPL C;  2ELH A;  3C7J A;  3OOP A;  4HQM A;  3K69 A;  3I0T A;  1R00 A;  1SFX A;  3J81 Z;  2HWV A;  2QQ9 A;  4RS8 A;  3GVA A;  2HKO A;  1XD7 A;  1ZG3 A;  3EET A;  4MGR A;  2VBW A;  1UB9 A;  4LMY A;  5FD5 A;  4PCQ A;  1D8K A;  4YFX F;  1IN7 A;  2A5Y B;  2F2E A;  3V4G A;  3PFI A;  4I7H A;  3QPH A;  3V7S A;  1TQM A;  1GVJ A;  1FX7 A;  2MH2 A;  4OMZ A;  3JAM Z;  4IXA A;  2Q8K A;  1ON1 A;  3F21 A;  3RIR A;  1BI1 A;  2RV8 A;  3HOT A;  2FBK A;  2A69 F;  5IT9 K;  2FE3 A;  1IN4 A;  1J75 A;  2A6E F;  4OOI A;  2CO5 A;  4BAY A;  3ML6 A;  2NNY A;  5D5W B;  4Q47 A;  3GEZ A;  1IRG A;  1D5V A;  5H6R A;  4KN4 X;  4M9X A;  4KIC A;  1DPU A;  3I59 B;  2QM3 A;  2MD5 A;  5J8C A;  3O2P E;  4L9V A;  4LJZ F;  3ERE D;  2GA2 A;  1E17 A;  3WTZ A;  4D0P A;  1R5H A;  2RC4 A;  2JRT A;  4EJW A;  5L3G A;  4HLY A;  2IA0 A;  2P6S A;  3HHH A;  1IW7 F;  1LVA A;  1OR7 A;  1SMY F;  5FB2 A;  3OV8 A;  1ZRD A;  3EYY A;  2FMY A;  2K27 A;  2HOE A;  1Z9C A;  5ERI A;  3ELK A;  1J59 A;  2V1U A;  1TTY A;  2Z33 A;  3JTH A;  4WWC A;  5DCF A;  3WTY C;  2ESN A;  4M6X A;  4P55 A;  4AIJ A;  1W7P A;  4XSZ F;  2AS5 F;  3BZ6 A;  2O8X A;  5TJJ A;  1I27 A;  4WXC A;  2EJR A;  3WGG A;  2BEO A;  2DO7 A;  3KEO A;  2EFW A;  2IRF G;  3HUG A;  2EFO A;  3FX3 A;  5F1R A;  5JHU A;  3Q9S A;  4R79 A;  3HRT A;  1OYW A;  4GXO A;  1B1B A;  2QWW A;  2RN7 A;  4U0Y A;  3COA C;  1KYW A;  3LWF A;  3KCC A;  4GO1 A;  1T98 A;  3CUQ B;  4M6Y A;  3L2C A;  2M8E A;  1KQ0 A;  2K02 A;  1FBQ A;  1RNL A;  1B4A A;  2ZFW A;  3GLX A;  2FF4 A;  3DEU A;  4XLP F;  3RJP A;  1IUY A;  2W24 A;  4S04 A;  4EJV A;  5ILV A;  2HKX A;  3E97 A;  4CDG A;  5CVV A;  1QGP A;  5DDG A;  4CO8 A;  4HX8 A;  4GYG A;  1BJA A;  2J5P A;  5HDN A;  4G94 A;  2H27 A;  1WWX A;  3F6O A;  2XV4 S;  1ZLK A;  1HKT A;  1YW9 A;  1KU3 A;  4XSX F;  1ZYR F;  5LGN A;  2UWM A;  4UVB A;  2JSC A;  2UXN A;  2O3F A;  1BI2 A;  2HFH A;  2ZME B;  1FSE A;  4HOB A;  3KP6 A;  2QLZ A;  5L3C A;  2VBZ A;  2MLG A;  1U5T A;  4A5N A;  1UFM A;  4EMS A;  4LLG F;  5JVT A;  1FBU A;  3LFK A;  1O3Q A;  3L9F A;  1U78 A;  2W85 A;  3LQQ A;  1MDM A;  3IKV A;  4H0E A;  5ICF A;  5D4S A;  1IAW A;  1ULY A;  2F5E A;  1P6R A;  1S3J A;  3B02 A;  4Z2Y A;  5ILU A;  2CSO A;  1Z1D A;  4HDU A;  3RKY A;  1WI9 A;  2ESH A;  2XKP A;  2C6Y A;  1ODD A;  3KP5 A;  5CVJ A;  1TW2 A;  4U0V A;  3SZT A;  1W4M A;  2FBH A;  4CGZ A;  4M74 A;  2ZNY A;  2FA5 A;  3C1D A;  4HZF A;  2EV0 A;  2W57 A;  1Q1H A;  1IRF A;  4G7O F;  4KIB A;  6PAX A;  2LSO A;  5E1Z B;  4EGY A;  4BHP A;  4KN7 X;  4WCG A;  1XSV A;  2WTE A;  5EEH A;  3J80 Z;  4LGW A;  1F4K A;  4MEY F;  4O5V A;  4JBA A;  2K4B A;  5A2Q K;  2P5V A;  4DNC A;  3WOD F;  3WTV C;  5E1X A;  1YO5 C;  5DEQ A;  1A04 A;  2DW4 A;  3E6B A;  1ZH5 A;  3HRS A;  2PEX A;  4G6Q A;  3DP7 A;  3E5Q A;  3L00 A;  2V9V A;  2A61 A;  1MZB A;  5CJ9 A;  3GFJ A;  2E1C A;  3R0J A;  3TO9 A;  2JT1 A;  5L3B A;  3DV8 A;  3T0Y A;  2DK8 A;  5BS6 A;  4WK8 F;  2Y48 A;  3L09 A;  1PP8 F;  1S8N A;  1JHH A;  4FHT A;  1T39 A;  2XRN A;  1YW8 A;  4EJO A;  4XLN F;  1O3R A;  1QNT A;  2IP2 A;  4RAY A;  5D5U B;  2XVC A;  4LLL A;  3DF8 A;  3F23 A;  1IZ1 A;  1FOK A;  1J5Y A;  2QUF A;  2M87 A;  4HLX A;  3GZ5 A;  1U6G A;  5FFZ A;  3ZMU A;  2B0L A;  2JTV A;  1UCR A;  4BQA A;  2O0Y A;  1H0M A;  4IRH A;  3RYR A;  3I4P A;  1SFU A;  1XDU A;  4I02 A;  3F8M A;  5CYV A;  1ZRF A;  1HXD A;  3FMR A;  3RDI A;  5J6X A;  3JTG A;  4OIO F;  5JI6 A;  2IA2 A;  1BN5 A;  1S29 A;  2NRA C;  3ZQ7 A;  1GHC A;  5IT9 Z;  1ZAR A;  1XGO A;  2HEO A;  3EUH A;  4A0X A;  1CF7 B;  2ADU A;  3CTA A;  5LEJ A;  4L18 B;  3GO5 A;  1L0O C;  5IT3 A;  2NS0 A;  1F5T A;  4M9S A;  2Q2E A;  5D6E A;  3RTR A;  4A5M A;  4JQF A;  4P96 A;  3SQN A;  1EV7 A;  5EEG A;  2KJC A;  3IL2 A;  2HYG D;  1BI0 A;  2ZXJ A;  3QP5 A;  5ILS A;  2H09 A;  4BHC A;  2V6C A;  2ZO4 A;  3M7G A;  3W6J B;  2FQ3 A;  4EJT A;  3RKW A;  2R7F A;  3GFM A;  2K4J A;  1IXR C;  3HTU A;  1BM9 A;  5LRR A;  4E70 A;  3BPV A;  4EQQ A;  3CUQ A;  4L9J A;  3IRQ A;  2MA3 A;  4AIK A;  3JSO A;  2YX4 A;  3KEQ A;  4ETS A;  3U9G A;  4KIF A;  3U2R A;  3LST A;  1HSJ A;  1E2X A;  3QU3 A;  1PP7 U;  2H6B A;  4LB6 B;  1LB2 A;  4ZH4 F;  3H3U A;  3JW4 A;  1HKQ A;  4LK1 F;  1I1S A;  2CW0 F;  1JE8 A;  4HW0 A;  1FLI A;  2COM A;  2XKO A;  1LDD A;  2IJL A;  4OIR F;  5E8I A;  3I54 A;  3P9K A;  4HV6 A;  1BC8 C;  4ESF A;  2GXB A;  1EH8 A;  3DKW A;  2DBB A;  3DFG A;  3I64 A;  3F6V A;  2ZME A;  2IVM A;  1BBY A;  3S2W A;  3H3Z A;  1STZ A;  2DFI A;  5HVQ C;  2WV0 A;  5D6F A;  2JPB A;  4DQ2 A;  1U5T C;  5D4R A;  1T2K A;  4ESJ A;  1KU9 A;  3CUO A;  1R23 A;  1XSX A;  1FPQ A;  3BJA A;  3P9I A;  4ZYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...