2TDXA

Diphtheria tox repressor (c102d mutant) complexed with nickel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
molecule keywords DIPHTHERIA TOX REPRESSOR
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2tdxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2tdxA02
1FZPB 4RAYA 1RIOH 5FFZA 4EVIA 2V9VA 1OMIA 2VXZA 5LHGA 1U8RA 3PQKA 2H6CA 2XGXA 1TTYA 1R7JA 5DEQA 2M87A 4U0WA 2LDUA 5E17F 5IT9K 1B6AA 4HQMA 1FSHA 3BZ6A 3WTSC 1K78A 3P9IA 3HRMA 3CUQB 2EK5A 1DPRA 5K5OA 5CVJA 2O3FA 2OAZA 4NB5A 2FEZA 2VOOA 2HYFA 2DO7A 5BOXA 1G4DA 2NNNA 3W6JB 1ZH5A 1XCBA 1KQ9A 3RPQA 3P9KA 3ZMDA 2DPUA 3C18A 2VC0A 5E8GA 4L5JA 1ZLJA 4RAZA 3HSFA 3F72A 2FBHA 5CVIA 2NS0A 2CGPA 1MJ9A 1XSXA 4EV0A 4U0VA 4KT5C 2F5FA 5FLXZ 2YU3A 3TDZC 3T1BA 1D5VA 5DYMA 1WI9A 1OPCA 4BYYA 4IRIA 1F5TA 3RKYA 2EV0A 4WWCA 2HFHA 5LRSA 1USTA 4ESBA 2EWNA 4ESFA 1MDMB 3E5UA 1Z91A 2V6CA 2M1BA 1EH7A 1MKMA 4PGGA 2IRFG 1PP8F 1XGSA 2FQ3A 3TKYA 4IJAA 4HA8A 5L3FA 1FP2A 2XAFA 2IA0A 1QO0D 1B4AA 3GVAA 3TOBA 4PDKA 4G6QA 4L0YB 1P6RA 2RV8A 5H6RA 1O3RA 2CQKA 5JHUA 2FNPA 5HLIA 3HTUA 2F5EA 1H9GA 1XSDA 2BEOA 2VE9A 2PMUA 3R60A 3DF8A 2XIGA 1E17A 1YO5C 4BXUA 2XAJA 2XAQA 3O6BB 1QGPA 1KYZA 1G3WA 3WTVC 1BJAA 1ONVA 2GIVA 4A2UA 2CFXA 1KU7A 5ILVA 3D5LA 1ODDA 1HKSA 1SD6A 2W57A 3TO7A 4LK0F 1YG2A 3C7JA 1R00A 4HDUA 2HTSA 5F64A 4IRHA 4AVPA 4HV6A 1O57A 4O5VA 2XASA 2OU2A 4HBLA 4BAYA 3FWEA 2M45A 3V4GA 2FOKA 4WK8F 1IN6A 2F5CA 1ZLKA 2E7XA 4CGZA 3RPUA 3GXOA 5K5RA 1Z9CA 5J8FA 1UHMA 2Q0OA 3SZTA 4Q4ZF 1MDMA 2O61A 2JRTA 1SMTA 1YFHA 2ESNA 2QQ9A 4UVAA 1U5TB 3ZN1A 3I59A 3IWZA 2RDPA 5L3DA 5FD6A 2Z9OA 5KK1A 3RI4A 2MD5A 5LGNA 3EYYA 2Z99A 2M8EA 3GO5A 4BNCA 4EJVA 2OZUA 2FA5A 1K6OA 3R61A 1YS7A 4EJWA 2BV6A 4MHGA 3TO6A 3GZ6A 2M5WA 4BHBA 4XSXF 1SFXA 4BHPA 2KIFA 2Z5UA 3K1NA 3P7NA 3U1DA 3E3VA 2UZKA 3HHGA 3SZPA 3RYPA 3FHZA 4M6YA 2BBYA 4QWQA 3Q9SA 2PJPA 2P4WA 2PQ8A 2OZ6A 3KLNA 2KIMA 1BC8C 3PQJA 3KEQA 1B1BA 4LK1F 2DPDA 3KZYA 4BH9A 3KP4A 4GO1A 1TBXA 2ZBKA 4WXCA 3M8EA 5D5VB 1JHFA 1LQ1A 1S8NA 2E1CA 2DK5A 3Q5FA 4YFXF 2ETHA 4IPAA 2ZMEB 3E6BA 3GLXA 3SFZA 5AIPA 2FU4A 4N9HA 1GHCA 1BI0A 2X4HA 2QM3A 4RB3C 3L7WA 3H3ZA 2A5YB 1S6LA 4Y15A 4XLPF 3CDHA 1R22A 1TW3A 3F6VA 4HQEA 3F8MA 1WWXA 4GYGA 3CTAA 2MLKA 1JGSA 2JSCA 5H6QA 2ZNYA 4G9YA 3WTTC 3SQNA 3LAJA 4ZYHA 3I71A 4WX9A 3LQQA 4A0XA 5L3EA 3RDIA 4L0ZB 4MQVA 4A5MA 4XLNF 2GXGA 1BIAA 5E8IA 4G94A 3ULQB 3GUDA 2P7VB 3WGIA 4N0BA 1HSJA 1T39A 4MEYF 2VT2A 1R1TA 4LLNA 2O6GE 2VONA 3IKTA 6PAXA 2IP2A 1FYKA 1HXDA 3D0SA 3ZP5A 2O03A 3WU0A 2QBYB 2STWA 3R0AA 5FFXA 2X0LA 5JI6A 5LGTA 2XKOA 1TNSA 1IAWA 5HLGA 1U2WA 1XGMA 2D2WA 2DK8A 2YPRA 5J8CA 5HS7A 3R4KA 2E1NA 2EJRA 5LHIA 5HDKA 3ZQ7A 4QLCU 3J7AO 5HVQC 5D5WB 3IKVA 3WE2A 1G3YA 1LB2A 3F8BA 3CO7C 5HS9A 4HYEA 5E18F 4LG0B 3FF5A 3CUQA 1QPMA 2ISYA 2HTJA 2D1VA 2Y75A 3V8LA 3MZYA 4HF1A 3CJNA 3LA7A 4M71A 3DPTA 4ENNA 1QZZA 3T8TA 4EJUA 1XN7A 1XMAA 1SAXA 4N9IA 3IHUA 2O8XA 5ILSA 2IA1A 3F3XA 4Q48A 3GYHX 3HOTA 1IRGA 1IUYA 1OYWA 5DD8A 2DFIA 3K9TA 4RB2C 3BDDA 2H6BA 1UHWA 4U7BA 3VFZA 4F7ZA 2K4BA 2BE5F 2WC2A 1S3JA 4Z2YA 4HF0A 3J81Z 1R36A 2ZO4A 2COMA 2RNJA 3IRRA 5HDGA 1TW2A 1O3QA 4O3MA 4LD5A 2D1HA 1P4WA 1SD4A 3I58A 2EV5A 4CICA 4IVNA 3ERED 1Z7UA 4A0YA 5A2QZ 4KIGA 5ICEA 4A6DA 4ENKA 2MH9A 2VODA 2RVCA 4OMZA 4AIJA 1LEBA 1R58A 1HKTA 1T38A 4FX0A 3QRFF 4MTDA 3AAFA 2P8TA 4ZZDA 3M8FA 4Q5SF 2HKOA 1O3SA 4IHSA 2XHKA 1EV7A 2WV0A 1LDDA 2M30A 1FOKA 5FO5A 3WODF 2QVOA 3FX3A 4EJTA 2YR2A 2STTA 1T6SA 2L54A 4IHTA 1P92A 4ESJA 2PI0A 3HHHA 3V8KA 1LNWA 1IN8A 5CVRA 1KQ0A 1MZBA 4A12A 5CYVA 5CLSA 1YW8A 4LGWA 5DCMA 4A5NA 2GAUA 3E97A 3E6MA 3LQRA 2K7LA 2K86A 4EM2A 3BJ6A 3COAC 3EQLF 2QQAA 4A6EA 4ZYGA 4OOIA 3U2RA 2HQRA 1FBUA 3HSEA 1K79A 1EH8A 2Z33A 2Z3YA 2QYOA 3BOQA 4XBFA 1J7KA 2ZNZA 2ACJA 4HX7A 2ZFWA 1C0WA 1FBQA 3EDPA 5D6FA 4XSZF 2PG4A 4ZH4F 3M1EA 3JW4A 1FT9A 4EGYA 2OBPA 3GF2A 3J81K 1ZGJA 3REOA 2QBYA 1DUXC 1DDNA 1A04A 1YW7A 4CZZA 3TGNA 3K0LA 2KKOA 4HLYA 3CO6C 1S7OA 3K69A 1B9NA 2R7DA 1LVAA 1G3SA 3M7GA 3GFJA 2XUBA 2FBIA 1DPUA 5ICFA 4LB6B 2MBFA 3B02A 4S04A 1ZG5A 1KU9A 5LEKA 5JR3A 4AWXB 2AXLA 2G7HA 3W6KB 2RQPA 1W5TA 3ABUA 5LBQA 3KP7A 1HKQA 1ZG3A 1XCVA 1WRJA 2ZJ2A 2HYGD 3GFMA 4BQAA 4UV8A 1GXPA 3DQVC 3F8NA 2OQGA 3WTXC 2IVMA 2VBXA 2VBWA 1L0OC 4UXNA 5D4RA 4I0BA 1X3UA 3NRVA 4M9ZA 3FXQA 1ULYA 4LLLA 2H94A 3T5XA 3BJOA 2HOEA 2H27A 1AOYA 4L9VA 4PCQA 3MEXA 2DT5A 4EQQA 3JTHA 2EB7A 1FNNA 4G7OF 4MTEA 1JHHA 4LMYA 1XSVA 3WTZA 1O7LA 4FHTA 1JE8A 4AIKA 4RB0A 3DV8A 3ROUA 3F22A 5DD4A 1BI1A 1XDSA 3E6CC 1E2XA 2XKPA 5TRDA 2UXNA 4KN7X 4B8XA 1ZHFA 5LHHA 5D8LB 4LFUA 4YFKF 3V7CA 1PDNC 4HOBA 5L3GA 4H0EA 5F6FA 2RGVA 3ZMUA 1BI3A 4LB5A 1FP1D 1SD7A 1B9MA 5EEGA 2ADUA 1BOAA 4DNCA 3F23A 1FYLA 5BPIA 3LWFA 4UVBA 1P4AA 1U5TC 3ZPLA 1OYYA 1YLFA 2P7CB 4M9XA 3JSPA 4M73A 4CDGA 1I1SA 1FY7A 1J75A 4I7HA 3SHFA 3WGGA 4UVCA 4ASNA 2LSOA 5A2QK 1WSUA 3ZMSA 3QPTA 4B09A 5HDNA 3J80K 2IPQX 1G6NA 4I01A 2GWRA 2MH2A 3KP5A 2VN2A 2RN7A 3R6SA 2GA2A 2ESHA 3FMSA 2YSRA 2UWMA 3MFKA 2FF4A 1ZRFA 3IL2A 1J0RA 3RIRA 1OKRA 1R5HA 3WG9A 2QZ8A 2DQLA 2YX7A 1GXQA 2LF8A 1YQAA 3TO9A 3QP5A 2JPCA 1J5YA 2GA1A 2F2EA 2P6TA 4HLXA 5L3BA 2NRAC 2KJBA 1VTNC 4R8HA 2LNBA 2GXBA 2CG4A 4EMSA 5BMZA 3QU6A 3F8CA 1IN5A 2L4MA 2MC3A 3CUQC 4G7HF 5E20A 1BIBA 1UFMA 2H09A 4UV9A 1ON2A 4ENMA 4E70A 3WTYC 3HYIA 1AWCA 2E7WA 4S05A 3G3ZA 2CW0F 4KMFA 3CLOA 1RUNA 5BS6A 3ZMTA 1CF7B 2V79A 1G3TA 2DI3A 1LDJA 3IWFA 5HS8A 3ECHA 2DU9A 3ISPA 5E1ZB 1HQCA 4I0AA 2QQBA 3VEPA 1T2KA 5K1YA 2ZKZA 1YYVA 5ICGA 3K1PA 5LLQA 1TLHB 4M6XA 5D8KB 1XB4A 4CXFA 4RB1A 2FNAA 1PUEE 1FLIA 3L2CA 2HWVA 2QUFA 3RKXA 4CHUA 4JQFA 3DXJF 4L18B 3HSRA 2ZCWA 2A07F 5D6EA 1STZA 1IF1A 2DLLA 2MLGA 1WKMA 3QU3A 4CYDA 2OA4A 3BWGA 3BP8A 3HRUA 3EETA 3BY6A 2D45A 1R1UA 5D5XB 1V3FA 2VOPA 2KJCA 1K7AA 3EUHA 4EM1A 3TDUC 2HGCA 4ETSA 1ZG1A 2NAZA 3C1DA 2FBKA 1QNTA 3U9GA 1XD7A 4M74A 2A68F 2QENA 1LJ9A 1R5GA 4WF2A 2PLYA 1SD5A 3LA2A 3I0TA 1V4RA 2Q2EA 3JAMK 1D8JA 1D3YA 1BM9A 3LA3A 3HOSA 4KMUX 3FMRA 1S29A 5DV5A 5LRRA 3C3WA 2PBIA 3GX4X 2EA4A 2RC4A 3KP2A 3GEZA 4YFNF 1IN7A 1LDKB 2PEXA 4WXDA 2LKPA 1ZARA 2JT1A 3DPLC 4KUMA 2JPBA 5DUKA 3GFIA 1WQ2A 4R79A 4P9UA 2EV6A 2DAOA 5HOOA 5LEJA 5FLXK 5D5UB 3ECOA 3H3UA 1TQIA 2LF7A 4GCVA 2EFQA 1Q1HA 5F1RA 3BROA 5E1WA 3KE2A 2K4JA 2O0YA 4RGUA 1YW9A 4NHJA 1FC3A 1W4MA 2J5OA 3MWMA 3TOAA 1XDUA 4YG2F 4OIQF 1FYMA 5ICCA 2FRHA 3HRTA 1P2FA 4KDPA 4IF4A 2HEOA 3L00A 2K02A 1IW7F 1ON1A 4YIIA 4PZJA 2R3SA 5BPDA 1W7PA 3FXRA 5FGMA 5J6XA 4OMYA 1IRFA 1KU2A 1ZGAA 2L01A 4HW0A 4GXOA 1FWZA 2VT3A 3WGHA 3K1MA 1XGOA 2ELHA 3WE3A 4Y13A 3OV8A 1KA8A 1F4KA 4P96A 2XVCA 5CJ9A 5L3CA 2K27A 2MA3A 3ML6A 4RGXA 4MGRA 2DTRA 4HV5A 1J9IA 4P55A 2C6YA 4EJOA 2HKXA 2FXAA 1F9NA 2W24A 1UCRA 2P5VA 4M72A 1YTYA 4HF2A 3KETA 2NNYA 4YIFA 1HBXG 1ZREA 2EFPA 4RGSA 3I5UA 3BPVA 1D8KA 2ISZA 2WTEA 1OYIA 4Q47A 2V1XA 3M9AA 2Q8KA 5CVVA 3FM5A 4KICA 4JK1X 1FX7A 2GQQA 3I59B 2KIUA 2L02A 3P9CA 5CVUA 5AONA 5K5QA 1FSEA 1BN5A 2A6HF 5JFRA 3G73A 2HR3A 2XAGA 3TQNA 3T8RA 1HSTA 1P4XA 4PGHA 2V1UA 4KIFA 1QBJA 3VOEA 1B59A 2PMHA 2EFWA 3R0JA 4I09A 3ELKA 3MCZA 2UXXA 4EGZA 2VBYA 2PN6A 4HDVA 5IT9Z 3VB2A 4RS8A 2QLZA 4G7ZF 1JXSA 4KYWA 2G9WA 5BQTA 1W7PB 1RI7A 1ZAOA 3CUOA 2HDCA 1I27A 3FM3A 2XAHA 2XROA 1H9TA 1U5TA 3HTSB 1REPC 5KVRA 2DBBA 1I1GA 5ILUA 3DEUA 1Z1DA 3LSTA 3DP7A 3FMQA 2EFNA 3KZZA 3BJAA 2OQRA 4UNOA 2CYYA 1KQ8A 1IZ1A 1IXRC 4XRFA 1IXCA 1ZRDA 2P5KA 4RGRA 3MQ0A 3KFWX 2DW4A 4D0PA 1BI2A 2VC1A 2HQNA 1RNLA 4WCGA 4OIRF 5DUIA 2W85A 4AIHA 3WTWC 1HW2A 4GYIA 1ZYRF 3L9FA 4NQWA 3ABTA 2CWEA 4KN4X 2P5LC 1NHAA 4MEXF 2J5PA 3LFKA 3OOPA 3ZN0A 5IT3A 1RZ4A 1U6GA 3KP3A 3I4PA 3MZHA 1QQIA 4OU0A 3RKWA 2ZXJA 3N4MA 2A61A 2W84A 4UHTA 3HRSA 4HZFA 1U3EM 2TDXA 3DFGA 4HAMA 2R7FA 4ON0A 5DDGA 5AIQA 1FBSA 4MQ9F 1HW5A 5E1XA 4MNUA 4L9JA 5DCFA 1RUOA 4O6JA 4EM0B 2NYXA 1T0FA 3F8FA 3VODA 3WTUC 1F1ZA 3NQOA 4U0YA 3V8JA 3QP6A 4OINF 4G8XA 4ENJA 1HW1A 5ERIA 3B73A 3H92A 3MAJA 4FT8A 1SMYF 4P9FA 3F21A 2JZYA 1MJAA 3O3KA 2A69F 2L4AA 4R1HA 1W5SA 4L5IA 3RTRA 1YIOA 4KIBA 2EA2A 1PP7U 1Y0UA 2FSWA 1L3LA 1SFUA 3BPXA 3EYIA 1K78B 4HX4A 4L9TA 2A6EF 2Y48A 3WU1B 2RKHA 1H0MA 2GZWA 3E6DA 1Z6TA 1R1VA 2G7UA 4Y17A 1XMKA 4TV7A 3O2PE 1T98A 2IA2A 3V7SA 2CO5A 3V7RA 1FPQA 4ZZLA 3DKWA 2L3DA 2HS5A 2FMLA 3QAHA 4KFCA 4BHCA 3T0YA 2ZMEA 2IW5A 3N97A 5EEHA 1UB9A 1O7FA 3E5XA 3JTGA 4IRGA 4LG0A 3F6OA 1BBYA 2IT0A 4WXHA 1IN4A 3KCCA 1CGPA 4U88A 3GFLA 3L09A 4UUVA 3RYRA 1KYWA 4G6DA 4FX4A 4JBAA 4OIPF 1GVJA 1R23A 3FZVA 4CO8A 2HZTA 3LAPA 4K2EA 2XV4S 3GW2A 3HUGA 1IXSB 3Q9VA 1XGNA 2BGCA 3ZMVA 2BYVE 3ZMZA 1SFEA 2OD5A 1S7AA 5D4SA 3K2ZA 1OR7A 1MGTA 2YX4A 3IRQA 1QZYA 5FD5A 3FXUA 2KRFA 3QOPA 3RJPA 1ZN2A 2VBZA 4DQ2A 2DQRA 1KU3A 3PFIA 4L9NA 1TQPA 3KEOA 1LEAA 4U7DA 3S2WA 2PFBA 4ZYEA 2XRNA 3J80Z 2F5DA 2P6SA 5FB2A 5HLHA 1O3TA 1ZRCA 1J59A 3HIFA 2WWYA 1U78A 4A0ZA 4I98B 1DP7P 5LGUA 2V1DA 2JTVA 3KLOA 1MD0A 4M9SA 4LLGF 5H20A 3IC7A 4AD9A 4KNYA 3I53A 3JAMZ 2A3SA 3QPHA 3NEUA 2QWWA 2FE3A 2FMYA 2W25A 4KA4A 5JVTA 2CSOA 1YS6A 4OIOF 4I2OA 3GWZA 2IJLA 3GZ5A 1MJBA 5DCMB 1Z6RA 5TJJA 1EH6A 3SXYA 1BC7C 3E5QA 1I6XA 4HX8A 4P5OA 1USSA 3I64A 1TNTA 4I02A 1KGSA 2EFOA 1CF7A 2AS5F 1Z05A 1J2XA 1W7PD 4LJZF 4IXAA 4ZYDA 2VE8A 3JSOA 2B0LA 2Y0MA 3I54A 1I5ZA 1TQMA 5ED4A 4GGGA 3KP6A
chains in the Genus database with same CATH superfamily
1VI0A 4PFPA 1FZPB 4RAYA 1QPIA 2JUCA 1RIOH 3CP2A 2E5ZA 3CDLA 2R93J 5FFZA 4EVIA 2QEXI 2V9VA 1OMIA 1O4XA 3SEZA 2VXZA 5LHGA 1U8RA 3PQKA 2DCEA 2H6CA 2XGXA 1TTYA 1R7JA 1R6RA 4MLOA 5DEQA 2M87A 4FE7A 5KCMA 4U0WA 1SC7A 2LDUA 1BOBA 2LR8A 4YIRX 5E17F 3CCEI 5IT9K 1B6AA 1QVTA 2K9QA 4HQMA 1FSHA 4XLCA 3BZ6A 3JRDA 3WTSC 1K78A 2NVXJ 3P9IA 3HRMA 2EZIA 3CUQB 1JKRC 2EK5A 3AL0B 3QWLA 1DPRA 4NDLA 3MD2A 4RMNA 5K5OA 5CVJA 2WB1A 2O3FA 3TP0A 2OAZA 4NB5A 2FEZA 4XM3A 3S2DJ 2VOOA 2HYFA 2ZJRF 2DO7A 2CH0A 5BOXA 2XDVA 2NNNA 1G4DA 4RM3A 1ETYA 1T0FC 3W6JB 4DBRA 3OR1C 1ZR4A 4BY1J 3W2WA 1ZH5A 1XCBA 1KQ9A 2MW8A 2X6WA 3RPQA 3P9KA 3ZMDA 2DPUA 3C18A 2VC0A 4I6ZA 5E8GA 4L5JA 3OYAA 1ZLJA 2VJIA 2Z16A 4RAZA 3HSFA 3CCMI 3F72A 2FBHA 3S16J 5CVIA 5FKOA 3FBNB 2NS0A 2IXSA 2CGPA 1MJ9A 2VJ4A 1XSXA 2DMTA 2K40A 4EV0A 1YJNI 5FJ8J 4U0VA 4KT5C 2F5FA 1ENHA 3OL4A 5FLXZ 2YU3A 3TDZC 3T1BA 1D5VA 1SAUA 5DYMA 3H5NA 1NTCA 1WI9A 1OPCA 2X1DA 4BYYA 3G1LA 4IRIA 1F5TA 5FRNA 3RKYA 2EV0A 1AHDP 1GVDA 4WWCA 2EIJH 2ZXIA 3GCMA 2HFHA 5LRSA 1USTA 2E2HJ 5EZHA 4ESBA 2EWNA 2DMUA 4C3HJ 4ESFA 2ME0A 3JAMR 1MDMB 3E5UA 1Z91A 2V6CA 2M1BA 1EH7A 3FHNA 1MKMA 1AA7A 4PGGA 2IRFG 1PP8F 4D5FA 2KIQA 1EF4A 1XGSA 2FQ3A 1YHQI 3TKYA 2D5VA 4IJAA 3VYRB 4HA8A 5L3FA 3OR2C 1FP2A 2XAFA 2IA0A 2DTZA 1QO0D 3HUGB 4XRMA 4Z6YA 1B4AA 3GVAA 2VKDA 3TOBA 2JA5J 1Y8RB 3K70D 3ZQLA 4PDKA 2P0WA 3C2GA 3GTOJ 2LK2A 4G6QA 4L0YB 1IC8A 1P6RA 3BG3A 3QQAA 2AO9A 2RV8A 5H6RA 4XICA 1O3RA 3PNYA 2CQKA 5J1RA 5JHUA 2FNPA 3M8JA 5HLIA 2ELKA 5M5YJ 2ZC2A 3HTUA 2F5EA 1H9GA 1XSDA 2Q2EB 2BEOA 5M5XJ 5IP9J 4YEJA 3HDDA 2VE9A 2PMUA 2M7BA 3R60A 4B48A 2E2IJ 3DF8A 2XIGA 1E17A 1YO5C 4BXUA 2XAJA 2IEKA 2XAQA 3O6BB 1QGPA 1KYZA 1G3WA 3HOXJ 1MBGA 3WTVC 1BJAA 2QCOA 1ONVA 5IYDJ 1UAAA 2GIVA 4A2UA 1SFKA 2HXOA 2CUJA 2WV1A 2CFXA 2M0MA 2ZSHB 1KU7A 5B5EC 5ILVA 3D5LA 4BY7J 1MMSA 1ODDA 1HKSA 1SD6A 2W57A 3TO7A 1FMWA 2I5UA 3HOYJ 3PNVA 4LK0F 4QPQA 1YG2A 1AU7A 2KZGA 3A0HC 2H8WA 3C7JA 3ZQGA 3D5SC 1R00A 3DBLB 4XMYA 4AUXA 3CMAI 4HDUA 2TCTA 2LY1A 4F3QA 2HTSA 5F64A 4IRHA 4E7HA 4AVPA 4HV6A 2R7OA 1ZGWA 3SZGA 1EA3A 1O57A 4O5VA 2XASA 2OU2A 4HBLA 5F08A 4BAYA 3FWEA 2JUGA 2M45A 1WI3A 2BHYA 2R7XA 3V4GA 1BR2A 2FOKA 4WK8F 1IN6A 2F5CA 4C2UA 4LITA 1VQLI 1ZLKA 3L1PA 2M0CA 2E7XA 3JR9A 4CGZA 1EKEA 4A3GJ 3RPUA 3GXOA 5K5RA 1Z9CA 3CC4I 1IRXA 5J8FA 1UHMA 2LY2A 1MMGA 2Q0OA 3SZTA 3OIPA 4PUSA 4Q4ZF 1JJ6C 1X1CA 1MDMA 2O61A 1OCTC 2JRTA 4BQQA 5HODA 4IOCF 2XF6A 2E60A 1SMTA 1YFHA 3KYCB 4Y3OA 1ETQA 1ERDA 2ESNA 2QQ9A 4UVAA 1U5TB 3FDYA 3ZN1A 3I59A 3LMMA 3IWZA 3OIOA 2RDPA 1AKHA 1FIAA 5L3DA 5FD6A 2Z9OA 3QPLA 5KK1A 2LYCA 3RI4A 2PJRA 2MD5A 2LBFB 5LGNA 3EYYA 2Z99A 2M8EA 4BEHA 2KT0A 3GO5A 4BNCA 5BNGA 4AYBN 4XLEA 4ZTJA 4EJVA 3HM5A 4L5EA 2OZUA 2FA5A 4E7SA 3CZ6A 1K6OA 4BJ6C 3R61A 2HVRA 3AL0C 1YS7A 4EJWA 2EQRA 4A3DJ 2CU7A 2BV6A 4MHGA 3TO6A 3VYUB 4W1UA 2HNHA 3B6AA 3GZ6A 3K4MA 2O7OA 4PJJA 4HSTA 3VSKA 2M5WA 4E7JA 4BHBA 4XSXF 5FRMA 1SFXA 4YELA 4BHPA 3RQ4A 2KIFA 1Y1VJ 2XPVA 2Z5UA 1FMVA 4IHYA 3K1NA 3P7NA 3U1DA 3E3VA 5F0HA 2EH3A 2UZKA 3HHGA 2LREA 3SZPA 3H35A 4I99C 3NWSA 3RYPA 3S1RJ 3FHZA 4M6YA 2BBYA 4QWQA 3CQZJ 3PIOF 3Q9SA 1LE8A 2PJPA 2P4WA 2GOXB 1PYVA 2DFHA 2PQ8A 2L7ZA 2OZ6A 3KLNA 3M1CA 1E0EA 2KIMA 2VPRA 1K6YA 3PQJA 1BC8C 2CV1A 3KEQA 1B1BA 4LK1F 1QA6A 2DPDA 2XAUA 3LSHA 2EIMH 3DU5A 3KZYA 4PJNA 4BH9A 4BXFA 3RKQA 3KP4A 3FK6A 5KAIC 1W0UA 4GO1A 3OYMA 1TBXA 4BU2A 3ASOH 2X6XA 2ZBKA 4WXCA 2G0EA 3M8EA 1IUFA 5D5VB 2ECBA 1JHFA 1LQ1A 4NQWB 3HL2A 2ID6A 2X85A 2MVTA 1S8NA 3NARA 2E1CA 4HNTA 3RSNA 3S93A 2DK5A 3Q5FA 1N75A 4YFXF 3OYJA 1X2NA 4XLHA 4X0GA 1IDZA 2F48A 2ETHA 2OCEA 3AG1H 1KONA 4IPAA 2ZMEB 3E6BA 4DBQA 1TC3C 1BL0A 3VDXA 5JLXA 4C3IJ 3BR2A 1XPXA 3Q3SA 3GLXA 5E3LA 4ZC3A 3SFZA 2DYRH 5AIPA 2FU4A 1FOWA 4N9HA 1GHCA 1BI0A 2X4HA 2QM3A 3TMOA 4RB3C 1DGRM 2H1KA 2BY2A 3L7WA 1T08B 3OYCA 2QQ8A 4A3BJ 3KX2A 2XGDA 3H3ZA 2A5YB 2HOTA 4HRIA 1S6LA 3HXLA 2ECCA 4Y15A 4XLPF 3CDHA 1R22A 1LFBA 1TW3A 2LP0A 3F6VA 4B4CA 4KITB 4HQEA 3F8MA 2CW7A 1WWXA 4MFDA 4E4HA 4GYGA 3JREA 1A31A 3GTMJ 3CTAA 1X19A 2MLKA 1RC9A 1JGSA 2JSCA 2KPMA 1JUPA 3EUHC 5GAHJ 5H6QA 2ZNYA 4G9YA 4A69C 3WTTC 1ZQ3P 3SQNA 5GADJ 1I6HJ 3LAJA 4ZYHA 4IOAF 3I71A 4WX9A 3LQQA 4A0XA 4RDUA 5K7FA 3PIPF 2GOMA 1RRJA 5L3EA 2W7NA 5F04A 3RDIA 4L0ZB 4XOPA 2GXAA 1I3AA 4MQVA 5TISC 1WJEA 4XKWA 4A5MA 2HXIA 4II3A 4XLNF 1HCRA 1Z7LA 3A0BC 3OYDA 2GXGA 2KQRA 1BIAA 5E8IA 4G94A 3UR3C 1N25A 3GTGJ 4ZTFA 3ULQB 3GUDA 2P7VB 1MBEA 4V19K 1W36D 3WGIA 4N0BA 1HSJA 3FXMA 1T39A 4J00A 1T33A 4MEYF 4JX6A 2VT2A 1R1TA 4LLNA 2O6GE 2VONA 3IKTA 6PAXA 1WJDA 2IP2A 1FYKA 1HXDA 3D0SA 1OFCX 5M3FJ 4CYCA 3ZP5A 2O03A 4XIDA 3WU0A 2QBYB 3BT9A 1TWFJ 2STWA 3R0AA 3I56I 1FTZA 3BTLA 5FFXA 1PUFA 4CCLA 2XC7A 2X0LA 3SJMA 4AIDA 1BR4A 5JI6A 5LGTA 2XKOA 2X98A 1TNSA 4XNFA 3H9GA 1IAWA 4HG2A 5HLGA 2KDOA 3PFYA 2L9VA 2DFEA 3CCVI 1U2WA 1OISA 1XGMA 4CCNA 2D2WA 2A6TA 2DK8A 2NVYJ 2YPRA 4J19A 5J8CA 3GBGA 4QPOA 2R7SA 5HS7A 3R4KA 2E1NA 2EJRA 4JYKA 5K7HA 5LHIA 5HDKA 2L9SA 1BA5A 1JT0A 1DP3A 4BDYA 4A93J 4UB8C 1XC5A 2JRMA 3ZQ7A 4QLCU 4HSRA 2KFDA 3J7AO 3F0CA 2DA6A 3BR0A 5HVQC 4ANJA 3LSRA 5D5WB 2DA3A 3PO3J 3IKVA 1A6QA 3WE2A 1G3YA 1LB2A 2QKMB 3F8BA 3MKLA 3G6EI 3CO7C 1Y6IA 5B3SH 4IEJA 4XONA 5HS9A 1UHSA 4HYEA 5E18F 1IJWC 4LG0B 3FF5A 4PSXA 3CUQA 1QPMA 4IQ4A 2ISYA 4CH7A 3HOZJ 2HTJA 1JTYA 2D1VA 2Y75A 5HLTA 4BQOA 4BJTA 3V8LA 3MZYA 5J1UA 1TWHJ 1UMQA 4CA0A 5EG0B 4HF1A 3CJNA 3LA7A 4M71A 3DPTA 2L7FP 2JVHA 3CP8A 2F4IA 4BGDA 4NC6A 2K3PA 1QZZA 3T8TA 4ENNA 1DU6A 4EJUA 2ZB9A 3HGGA 1XN7A 1IO2A 1XMAA 2DA2A 3I4NJ 3LFUA 1SAXA 4N9IA 3IHUA 2K9NA 4BKXA 2UV1A 3FXLA 2O8XA 5ILSA 1LFPA 2IA1A 1Q1VA 3F3XA 1MNMC 2K85A 4Q48A 3GYHX 1MNDA 1XX5A 3HOTA 1IRGA 4IO9F 1IUYA 1OYWA 4XR6A 4D1QA 5DD8A 2DFIA 3K10A 3K9TA 4RB2C 3BDDA 1FEXA 5FLXR 2H6BA 2WY7Q 2XPUA 1UHWA 3VPRA 2X48A 4U7BA 3VFZA 4F7ZA 1WJFA 2BE5F 2K4BA 2OJED 5HNHA 2WC2A 4BDZA 1S3JA 4Z2YA 5EDNA 2UUZA 3U1KA 2LKSA 4HF0A 5CQEA 4MIMA 3J81Z 5IYCJ 3SFIA 1A36A 3FBIB 1R36A 3DKYA 2ZO4A 2COMA 2RNJA 3IRRA 5HDGA 1TW2A 1O3QA 2OV7A 4O3MA 4D7NA 2MFZA 4LD5A 1F36A 2D1HA 1P4WA 2WB1N 3S1QJ 1SD4A 3DEEA 3I58A 1RR7A 1E3OC 2EV5A 2M3AA 4CICA 2R5ZA 1Y39A 5IPAA 4IVNA 3ERED 1Z7UA 3CCRI 3V42A 1LE8B 4A0YA 1OCOH 4ITVA 3BQYA 4KIGA 5A2QZ 3S3OA 1P7JA 2LTPA 5ICEA 4A6DA 2BW3B 2B7EA 2N8GA 4ENKA 2MH9A 2VODA 4YRVA 2RVCA 3FKIJ 4OMZA 4AIJA 2LKXA 3OS2A 1QU3A 2JJ7A 4CCJA 5IOYA 2Y0SN 1LEBA 5J40A 1U9OA 1R58A 1HKTA 4OAYA 5GAGJ 3WG7H 4FX0A 1T38A 4DYCA 3IH3A 1Y8QB 2PMZN 5FROA 3QRFF 4MTDA 3AAFA 2P8TA 4ZZDA 3M8FA 4Y33A 3GTLJ 5IY5H 4Q5SF 2HKOA 1O3SA 4IHSA 4A3EJ 2XHKA 2HU9A 2EINH 1EV7A 5FKNA 2WV0A 2VL8A 2LOOA 3M3YJ 1V54H 1LDDA 2M30A 1FOKA 4BE1A 1IV8A 5FO5A 2IGMA 2QVOA 3DTIA 3FX3A 4KJZA 3WODF 4EJTA 1M1EB 2YR2A 4XKVA 2STTA 1T6SA 2L54A 3FISA 4CCOA 4BBSJ 4IHTA 1P92A 4ESJA 2PI0A 2NVTJ 3ERMA 1QRYA 3HHHA 3V8KA 2DODA 1LNWA 1IN8A 2XB0X 5CVRA 3S1NJ 2KLOA 3H9QA 1KQ0A 1MZBA 1B8IA 3E0JB 3PO2J 4A12A 5CYVA 5CLSA 1YW8A 2Y9ZA 4LGWA 2LFBA 1IGNA 5DCMA 4A5NA 1N77A 5EF6A 2GAUA 1Y0NA 3VYTB 3E97A 1NK2P 3WHBA 3E6MA 3LQRA 3QYFA 2K7LA 2F5VA 4IKFA 2FUG2 1D0ZA 2K86A 4EM2A 1TL8A 1TT0A 3BJ6A 4FE4A 1X4OA 3COAC 1ZR2A 3EQLF 2QQAA 1JUMA 2M4GA 2M4KA 5EZGA 2CUEA 4Y4RA 4A6EA 3HOUJ 4ZYGA 2R7UA 4OOIA 3U2RA 1FTTA 2HQRA 1FBUA 3DEWA 1E3HA 3KPHA 2LLKA 3K4NA 3HSEA 3HG9A 1K79A 1EH8A 2XPWA 2Y30A 2Z33A 3P5JA 1F43A 2OC6A 2NVUB 2Z3YA 2QYOA 3BOQA 2NVQJ 4XBFA 1J7KA 2ZNZA 2ACJA 2GBYA 4HX7A 3OOUA 5B1AH 2ZFWA 1C0WA 1FBQA 4F91B 3VWBA 2MZ4A 3EDPA 2IBDA 1XMXA 1XTAA 3LSKA 4XSZF 5D6FA 1NG7A 3CCLI 2PG4A 4ZH4F 3M1EA 2E2JJ 1D0XA 1MMDA 2R4GA 3PNTA 2DXIA 2E35A 3H5RA 3JW4A 3EPZA 1FT9A 4EGYA 3ABKH 2OBPA 3GF2A 2E5NA 1GT0C 3J81K 1ZGJA 5K7ZA 3REOA 2QBYA 3K70C 1DUXC 1DDNA 1A04A 1YW7A 4CZZA 2VQGA 4P1WA 3TGNA 2NOGA 3K0LA 4DOZA 3OYLA 1X1PA 4IHVA 1ZTRA 1K4SA 3MKWB 2KKOA 2DMNA 1S9HA 2IGKA 3KZIC 4HLYA 3CO6C 3ASNH 1S7OA 3K69A 5E3MA 1B9NA 2R7DA 4XKBA 3L2WA 4M3BA 1RETA 1HOMA 1LVAA 1G3SA 4RA2A 3M7GA 2DA1A 3GFJA 4AC0A 2XUBA 2FBIA 1DPUA 5C4JJ 4MFEA 2M9HA 2JWTA 2R5YB 1JJ8C 5ICFA 2JN6A 4LB6B 1YRNB 2MBFA 3B02A 4C2TA 1V5EA 3DPUA 1I50J 1CQTA 4S04A 1ZG5A 1KU9A 3OYIA 2AQFA 3NAUA 3O8HA 5JR3A 5KHDA 2HVQA 5LEKA 2M7AA 3ABMH 4AWXB 3OYNA 2WAEA 4LOCA 3PUBA 4F93B 2VKHA 2AXLA 2G7HA 3W6KB 2RQPA 1W5TA 3ABUA 4DGWB 1I39A 3OIQA 5LBQA 3KP7A 2VI6A 1HKQA 1ZG3A 1TWGJ 5C44J 1XCVA 4BEHB 1K61A 1HA8A 1IDYA 2R7ZJ 1WFXA 1WRJA 2ZJ2A 1TWAJ 2HYGD 1R4MB 3GFMA 3L2VA 2EZKA 2P81A 3OYKA 4BQAA 3H3VK 3TW7A 1POGA 1TT5B 4UV8A 1JTXA 1B72B 3HBLA 4BS9A 1GXPA 2JQ7A 2JA6J 2DJNA 1NG6A 4V2GA 4JX5A 3DQVC 3F8NA 2OQGA 4IX7A 3WTXC 4BUPA 2LMDA 3IUOA 2ZMEC 1WJAA 2IVMA 3H0DA 1QHGA 1V55H 4D9JA 3SYTA 2VBXA 2DA4A 3K4JA 2VBWA 5H2FC 1L0OC 2KRCA 1NH3A 4UXNA 2HVSA 3S2HJ 5D4RA 1FOYA 4I0BA 1X3UA 5LD2C 3NRVA 2K3FA 4M9ZA 3HOWJ 3FXQA 2CUFA 2L2OA 4A3JJ 1ULYA 4LLLA 2H94A 3T5XA 2CV2A 2XSDC 3BJOA 2HOEA 2H27A 1AOYA 4L9VA 1WH7A 3BZKA 4PCQA 3MEXA 1WH5A 3CCSI 2DT5A 2ICWG 3CMMA 2KP6A 4EQQA 3JTHA 2R7RA 1YITI 2EB7A 1FNNA 4G7OF 4MTEA 1JHHA 4LMYA 5FKLA 1XSVA 3WTZA 1O7LA 4E7IA 4PJLA 4FHTA 1A35A 2L5QA 3MN2A 2X1EA 1JE8A 4AIKA 4RB0A 5EGOB 2IGNA 3DV8A 1EJ9A 3ROUA 4D7MA 2HOAA 3F22A 5DD4A 1BI1A 1JT6A 1XDSA 3E6CC 2QA4I 1E2XA 1HLVA 4HNUA 2XKPA 1S5LC 5TRDA 2UXNA 4KN7X 1OJLA 4AM3A 2L9RA 3J81R 2R92J 1PVEA 4B8XA 3ONQA 1IG7A 3S3NA 1OCCH 1ZHFA 5D8LB 5LHHA 4LFUA 4BACA 4YFKF 4C30A 3V7CA 2MG4A 1PDNC 4HOBA 1X3WB 1T56A 4OWRB 5L3GA 4H0EA 5F6FA 1LUJB 2RGVA 3ZMUA 2VLAA 1BI3A 4LB5A 1FP1D 1SD7A 1B9MA 1QHHD 3I9V2 5EEGA 2ADUA 1BOAA 4DNCA 2ZJQF 3F23A 1FYLA 5BPIA 2OPTA 1MBHA 2DN0A 3LWFA 3SDBA 4UVBA 1P4AA 1RKWA 1U5TC 2Y0SA 1K83J 4UB6C 1H8AC 3ZPLA 4E6KG 3K2AA 1OYYA 4EEFG 1PUFB 5GAEJ 1YLFA 2K9MA 2P7CB 1U8BA 3H5AA 3BCAA 4QTRA 1ETKA 1SEUA 3IH2A 4M9XA 3JSPA 4M73A 2FX0A 4CDGA 2TRTA 1I1SA 1FY7A 3MKZA 1J75A 4I7HA 2W82A 2Z1DA 4NUBA 3SHFA 5EJCA 3WGGA 5IYBJ 4UVCA 4XORA 2PJRB 4ASNA 2Y2ZA 2Y31A 2QSGX 3IH4A 2LSOA 5A2QK 1B8IB 3J7YJ 4DYRA 2WAQN 4LG3A 3JRAA 4B44A 1WSUA 3BLYA 1JGGA 3ZMSA 1T95A 3QPTA 4B09A 5HDNA 3J80K 3PL8A 3CF2A 2IPQX 1G6NA 2V7FA 4I01A 2GWRA 2MH2A 3KP5A 2VN2A 4FASD 2RN7A 3R6SA 5C3EJ 1VQ8I 2GA2A 2IS2A 2ESHA 3FMSA 4QSHA 2YSRA 2UWMA 3MFKA 2FF4A 1Z67A 3MZ8A 1ZRFA 3IL2A 2X51A 1J0RA 3RIRA 1OKRA 1GUUA 1R5HA 1W5CC 1WHUA 2W4SA 3WG9A 2QZ8A 2DDBA 3HOVJ 1Z0XA 3G1MA 2EPFA 1D1BA 3ZQHA 4A3LJ 3OYFA 1WPKA 4CUGA 1YX5A 2DQLA 5GPCA 1WJCA 3QPSA 2YX7A 1YJWI 1GXQA 3NWTA 2LF8A 1YQAA 1DGWY 3QP5A 3TO9A 1K4TA 2JPCA 4A3KJ 1J5YA 2GA1A 2PMZA 3E1SA 2E1MB 2F2EA 5DS9A 2P6TA 3A01A 3S14J 1OQYA 4HLXA 1ACIA 5L3BA 2NRAC 1WCMJ 2KJBA 2COBA 1XG1A 1VTNC 4BXXJ 1MNEA 2OUMA 1DQUA 4R8HA 2V9KA 2LNBA 2GXBA 3G1OA 2CG4A 4EMSA 5BMZA 3QU6A 4V2FA 3BTCA 3F8CA 3N05A 1MW7A 1G8XA 3DWLE 1IN5A 2EILH 3HJEA 2L4MA 2MC3A 4B43A 4M3FA 2V26A 3CUQC 4G7HF 3H36A 5E20A 1VQ9I 1VQOI 1BIBA 2OTLI 3LSGA 1UFMA 1LVKA 2H09A 3ABLH 4F52A 3HPGA 2RAEA 2DDAA 4UV9A 3DBRB 5J47A 1OCPA 4DYQA 1ON2A 4ENMA 2KHMA 4E70A 2QSHX 1P7IA 3WTYC 2I10A 3HYIA 3DKXA 1W36C 1AWCA 4N4NB 2E7WA 4S05A 4GDFA 4CSWA 3G3ZA 2RQQA 2X6OA 2CW0F 4KMFA 2CW8A 3CJTB 5E3NA 2RNGA 3CLOA 3ZGKA 2BXZA 5BS6A 1RUNA 1VQ4I 3BTIA 3ZMTA 2HYJA 1ZK8A 1CF7B 2V79A 4ZDPA 1G3TA 3KYDB 2DI3A 3BZCA 2LBFA 1LDJA 3IWFA 5HS8A 1LKXA 3ECHA 4C2MJ 2DU9A 3ISPA 2XF7A 1D1CA 5E1ZB 1LPQA 1GV5A 1OR7C 1HQCA 4I0AA 2QQBA 2M8GX 3VEPA 4BBRJ 1U9NA 1T2KA 5K1YA 2ZKZA 1ZELA 3QYEA 1YYVA 1MH4A 3K1PA 5ICGA 5LLQA 1TLHB 2YS9A 4M6XA 5D8KB 1XB4A 1S7EA 2E1MC 4CXFA 3K4CA 4RB1A 2FNAA 1PUEE 1FLIA 1KZHA 2A05A 3L2CA 2V9PA 2HWVA 2QUFA 3RKXA 4CHUA 4PFOA 4JQFA 3DXJF 4L18B 2CRGA 3HSRA 2ZCWA 3JRHA 5TGTA 2A07F 1ITYA 5D6EA 4UUSA 2DYSH 1VQKI 1STZA 1IF1A 2DLLA 4JOMA 2MLGA 1UG2A 1WKMA 3BCBA 1U0JA 2XSJC 2WY8Q 3QU3A 4CYDA 2OA4A 2O5RA 3TEDA 3BWGA 3BP8A 3HRUA 3EETA 3BY6A 3LNQA 2D45A 1R1UA 2JA2A 5D5XB 5EGOA 3CLQA 2E19A 1MBKA 1UJ8A 1V3FA 3OS0A 2DFFA 4UY8I 2KJCA 2VOPA 1K7AA 1ETXA 3EUHA 4XOTA 3UNGC 5DTDA 1RQ6A 4EM1A 4F92B 3OS1A 3TDUC 2HGCA 4ETSA 3CMYA 1X3ZB 1Y56A 2NAZA 3C1DA 1ZG1A 2FBKA 1QNTA 2BW3A 2RREA 3U9GA 1XD7A 4AVZA 4M74A 4ZJZA 2A68F 2QENA 1LJ9A 1R5GA 2ZXWH 4WF2A 2PLYA 1SD5A 2L7MP 1WGXA 3VSLA 3LA2A 3C2HA 3HGYA 3I0TA 1V4RA 2Q2EA 5F1JA 3IAS2 2DOEA 4RLQA 1WZ2A 1ETOA 3JAMK 1TWCJ 1HC8A 1D8JA 1D3YA 3RPUD 1BM9A 3FXKA 3LA3A 3KYLA 3HOSA 3B6CA 4KMUX 3A52A 3HC7A 2VQLA 2HPIA 3FMRA 1S29A 5DV5A 5LRRA 3C3WA 3BR3A 3G71I 1YOVB 2PBIA 2L0KA 3GX4X 4DZJA 3FK7A 2BVMA 4IL6C 3ESWB 2EA4A 2RC4A 4PSWA 3KP2A 1VQMI 1JKQC 1FIPA 3GEZA 1MMNA 4YFNF 1IN7A 2Q1ZB 2EZHA 3L2QA 3LSJA 1LDKB 2PEXA 4BE2A 4WXDA 5CQGA 2LKPA 1ZARA 2JT1A 1BR1A 2I8DA 2VJ5A 3ZRGA 5LFAA 3L2UA 2A5WA 3DPLC 2LY9A 4KUMA 2JPBA 1X58A 3OSGA 2LH9A 1IRZA 3JRCA 5DUKA 3GFIA 1WQ2A 2AXTC 2XRLA 5IP6A 4M3EA 1SFOJ 3CCUI 2L7KA 1R4NB 4R79A 4P9UA 2ZJPF 1HDDC 3HEFA 4XLAA 2EV6A 3A03A 2ME6A 5DM7F 2DAOA 5HOOA 1A5JA 4BE0A 3CMEI 2F4MB 5LEJA 3S3MA 4FTHA 2KRHA 5FLXK 5D5UB 3ECOA 3H3UA 1TQIA 2LF7A 4GCVA 5IOZA 4XKCA 2VXDA 3BG9A 3DTKA 2EFQA 1Q1HA 4XRSA 3ZR8X 2OTJI 2MABA 5F1RA 2R7VA 1HDPA 2E36A 5JLWA 4FISA 3BROA 5E1WA 2FJ1A 3KE2A 2K4JA 2O0YA 4RGUA 1YW9A 2KMUA 3LL7A 4NHJA 1FC3A 1W4MA 5J3LA 2J5OA 3MWMA 3TOAA 3FXJA 1XDUA 1W1WE 4YG2F 2VQCA 2V6EA 4OIQF 2VQHA 1FYMA 3OMYA 5ICCA 2MSYA 2FRHA 2CFOA 3DBHB 3HRTA 1P2FA 5IP7J 4KDPA 3M07A 1YE9A 3ZXSA 2BY3A 4IF4A 4ZDLA 3G2BA 3IP4B 2HEOA 3L00A 2K02A 1IW7F 1ON1A 5M5WJ 1FJLA 4YIIA 1OCRH 4PZJA 3DLLF 4B3XA 2R3SA 5BPDA 1W7PA 3JRBA 2JK3A 5GTIC 3FXRA 3O8GA 5FGMA 3K6GA 5J6XA 3H0GJ 5F27A 4OAZA 3BR1A 4OMYA 3A1YA 1IRFA 1KU2A 1ZGAA 2DJIA 2L01A 2VB6A 4HW0A 2JVGA 4GXOA 2JA8J 1FWZA 3TW6A 2VT3A 1P9QC 3WGHA 3K1MA 3BR5A 1XGOA 1HF0A 2ELHA 3WHCA 3WE3A 2ELJA 2HZDA 2W1OA 4Y13A 1UG0A 4A3FJ 3KEYA 3OV8A 1KA8A 1F4KA 4DW6A 4FCYA 1W0TA 3CJRB 4P96A 2F6CA 1VQ7I 3FIWA 2XVCA 3OYGA 1X1AA 5CJ9A 4F55A 2JA7J 5L3CA 2IS6A 2K27A 2MA3A 1YX3A 5GTHC 2Y9YA 3ML6A 2LC2A 3MVPA 3C2BA 4PJMA 4RGXA 2GIZA 4MGRA 4JX4A 4KISA 3OYBA 2DTRA 4HV5A 1J9IA 4P55A 2C6YA 2QKLB 1WVRA 4EJOA 3ZQIA 2HKXA 2FXAA 4ABZA 4DIQA 1F9NA 1SANA 1RKTA 4EATA 3I55I 2W24A 1UCRA 1X2MA 3MKYB 5CKTA 2P5VA 4M72A 5KAFC 1YTYA 3KIOA 4HF2A 3VYSB 3KETA 2NNYA 2VJJA 4YIFA 1Z3YA 1HBXG 5FKMA 1ZREA 4HPQA 2EFPA 4RGSA 3I5UA 3BPVA 1D8KA 2CQXA 2ISZA 2WTEA 4G12A 1OYIA 2HDDA 4Q47A 4XN0A 2BHZA 2V1XA 3M9AA 1R71A 4IQJA 1TP4A 2X6YA 2Q8KA 5EEAA 5CVVA 3FM5A 5B66C 4KICA 2CMPA 4JK1X 2IS4A 3K7AJ 5M3MJ 4CCMA 3IAM2 1FX7A 2GQQA 3I59B 2M34A 2AHQA 2O8KA 2KIUA 2L02A 4LIVA 3P9CA 3PM1A 5CVUA 5AONA 5K5QA 1FSEA 1BN5A 2A6HF 4NC7A 5FLVA 2E1OA 5JFRA 3G73A 3BC8A 2HR3A 2XAGA 3TQNA 5A2QR 4PK4A 3T8RA 3JRGA 1HSTA 1P4XA 4PGHA 2V1UA 5FLMJ 4KIFA 1QBJA 3VOEA 3H1CA 1B59A 2FD5A 2PMHA 3FKJA 5F0CA 4NNJA 3R0JA 2EFWA 4I09A 3S1MJ 1R5ID 3ELKA 3MCZA 1V5GA 2UXXA 2NS8A 3AG4H 4EGZA 3QOEA 2LD5A 3DCFA 3U21A 3CESA 3HPHA 2VBYA 2H1LA 3I4MJ 2H8RA 4XRSG 2NS7A 2FQ4A 2LRDA 3LOCA 2PN6A 3WU2C 4HDVA 1RPWA 3G4SI 1VQPI 5IT9Z 1S72I 3W2AA 3H9JA 3VB2A 4IHWA 4RS8A 2QLZA 4G7ZF 1JXSA 4KYWA 2G9WA 1G2HA 3CC7I 2IGOA 5BQTA 2R7WA 2DT7B 4RBOA 4AYBA 2MC4A 1W7PB 4Y52J 2CQQA 2M2EA 1RI7A 1GV2A 3E7LA 1ZAOA 3A02A 3CUOA 3S8PA 2HDCA 1I27A 1VF9A 4M3DA 3FM3A 2XAHA 2XROA 1H9TA 1GLNA 1U5TA 1REPC 3HTSB 5KVRA 2CJJA 2DBBA 1I1GA 2XGEA 3DEUA 1Z1DA 2DOAA 3LSTA 3DP7A 4HEA2 3FMQA 5ILUA 2EFNA 2MYSA 3KZZA 4G6TB 3BJAA 3BG5A 3CJQB 2OQRA 4UNOA 2CYYA 3J7AY 1KQ8A 1IZ1A 1IXRC 1VQ5I 1MIJA 4XRFA 1JI8A 1IXCA 1ZRDA 3RZDJ 2P5KA 4NBQA 4RGRA 3MQ0A 4M3GA 3KFWX 2ZSIB 1APLC 2DW4A 5DM6F 2CUZA 4XL9A 4D0PA 1BI2A 4PJ0C 2VC1A 9ANTA 2HQNA 1RNLA 5GPAA 4WCGA 4OIRF 2EIKH 3GZNB 4UUTA 5DUIA 2W85A 4AIHA 1SVOA 3WTWC 1VFCA 1HW2A 2VASA 4GYIA 1QVUA 1ZYRF 3CC2I 3L9FA 4NQWA 4XK4A 2NOJB 1RR8C 4DJAA 5KNLA 2P0TA 3ABTA 4RM2A 2CWEA 2K9SA 3BG7A 4KN4X 2P5LC 3S15J 1NHAA 4MEXF 2J5PA 3LFKA 3OOPA 2KISA 2F4OB 3AG3H 3ZN0A 5IT3A 3GTJJ 3BR6A 2OCCH 2WAQA 1RZ4A 2BVLA 1RESA 5HNFA 3FXOA 1U6GA 2K9LA 3S32A 3KP3A 2CV0A 3I4PA 4X6AJ 1G59A 4BL0B 3MZHA 4RLFA 1J09A 3HKZA 2VPLA 1QQIA 3PUFA 4OU0A 3RKWA 2FOWA 2ZXJA 3N4MA 2A61A 2W84A 4UHTA 1YI2I 3HRSA 4B1RA 3PSFA 2X9DA 1A6IA 2HQAA 1D0YA 2CQ7A 4HZFA 1VNDA 2QF7A 2O9LA 3OWTA 1U3EM 1I3QJ 3EUKL 2TDXA 3DFGA 4HAMA 5F0FA 4B47A 4ZDOA 3CDIA 2R7FA 4ON0A 4XQFA 4CCKA 3ZQQA 5DDGA 5AIQA 1FBSA 2W48A 2R7TA 4MQ9F 1HW5A 5E1XA 3LSMA 4MNUA 4L9JA 5DCFA 5J1YA 1RUOA 4A3MJ 2DA7A 4O6JA 4EM0B 2NYXA 1T0FA 3F8FA 5C4XJ 3VODA 2GLOA 3WTUC 3X2QH 1F1ZA 4GFBA 3NQOA 4U0YA 3V8JA 3QP6A 4OINF 1JUSA 4G8XA 1YJ9I 4ENJA 4IHXA 1HW1A 2L9NA 3LSIA 3IV5A 5ERIA 4GRIA 3B73A 3H92A 4E7KA 3MAJA 2HI3A 4FT8A 5CPRB 3L2RA 1Z3XA 2KZVA 3M4OJ 1SMYF 2MD0A 3I3LA 4P9FA 3GLLA 1ETWA 3F21A 2JZYA 1MJAA 2DA5A 3O3KA 2A69F 3DU6A 1ETVA 1MMAA 2L4AA 4IZZA 4R1HA 2XF5A 2R7QA 1H88C 2YUSA 2EZLA 1MBJA 3AKZA 1W5SA 4L5IA 3RTRA 2R5ZB 1YIOA 2AQEA 4KIBA 4I76A 3GTKJ 2EA2A 1OLTA 2JSPA 1OCZH 1PP7U 1Y0UA 3W6VA 2FSWA 1L3LA 5JVGF 1SFUA 5JHFA 3BPXA 2ID3A 3EYIA 3J7AW 1K78B 4HX4A 3RQIA 2WAFA 4L9TA 3A01B 1X1DA 4CZCA 2A6EF 2Y48A 1D1AA 3HKZN 3OL3A 4JP0A 3SEQA 2RKHA 3WU1B 1H0MA 4II2A 2KDZA 2GZWA 3E6DA 3W3CA 3OYEA 1Z6TA 1R1VA 1E3PA 2G7UA 1Z21A 4Y17A 1XMKA 2BXYA 2R5YA 4TV7A 2DMQA 3RZOJ 4Y7NJ 2MGQA 3O2PE 1T98A 1T8IA 2JMWA 2IA2A 3V7SA 2YU9J 1V5FA 1VQNI 2CO5A 3V7RA 1FPQA 3CCYA 4BQNA 4ZZLA 3JRFA 4U87A 2XGCA 3DKWA 2L3DA 2HS5A 2LVSA 2FMLA 3QAHA 3ZQCA 4KFCA 3K4KA 4BHCA 3T0YA 2ZMEA 1QZEA 2IW5A 2V1NA 3N97A 1GDTA 2VUMJ 4X1EA 5EEHA 1UB9A 1O7FA 3E5XA 3ZQFA 3D1NI 3JRIA 3TBIA 2PX9A 3W2VA 1PJRA 3TP3A 2LG4A 3JTGA 5E3OA 1SVMA 3MMYB 3Q0UA 2WA0A 1MSEC 4MO7A 4IRGA 4LG0A 3J80R 3F6OA 1BBYA 2IAIA 2B9SA 2HQ5A 2IT0A 4E7ZA 1JKPC 4WXHA 1XS9A 4HNVA 1IN4A 3KCCA 3BTJA 1CGPA 4U88A 3GFLA 3D5RC 3A4CA 3L09A 4UUVA 3RYRA 1KYWA 4G6DA 3RCOA 4W97A 4FX4A 1ORKA 4S0HB 2M35A 3GMEA 4JBAA 4OIPF 4QIWN 3BQZA 2DMPA 4AU7A 1D5YA 1GVJA 1R23A 3FZVA 4N4OB 4CO8A 3K4LA 2HZTA 2HOSA 1X4PA 3A2KA 1N78A 3SDGA 5IT9R 2DOFA 5FKKA 2HDWA 3GTPJ 2BY1A 3LAPA 3BG6A 2V4JC 4NC8A 4K2EA 3OSFA 2WADA 2XV4S 3GW2A 3HUGA 1IXSB 1UZCA 1Y1WJ 3Q9VA 1XGNA 2BGCA 1BW6A 1WJ5A 3ZMVA 4H4KC 2B63J 4M6VA 5J4YA 5EYRA 2QSFX 1JKOC 3J7ZI 2CS3A 3UKGA 2BYVE 3ZMZA 4UUSB 1SFEA 3CD6I 3K4BA 3GTQJ 2BOLA 4B3AA 2OD5A 1S7AA 5D4SA 2E71A 2EBIA 3ZOBA 3K2ZA 1OR7A 1MGTA 2YX4A 4XLFA 1QZYA 4BJ5C 3IRQA 5FD5A 5EG0A 3FXUA 4A3IJ 2KRFA 2MUNA 1LFUP 3QOPA 3RJPA 1ZN2A 5J4VA 3PSIA 2VBZA 4DQ2A 2DQRA 4C3JJ 4J01A 3S17J 1KU3A 3PFIA 4E7LA 4FQGA 4L9NA 1H89C 3OYHA 1TQPA 3KEOA 1LEAA 5GP9A 5E79C 3S2WA 2PFBA 3TL4X 4U7DA 1MH3A 4ZYEA 2ZXHA 2XRNA 3J80Z 2R0QC 2F5DA 2P6SA 1DU0A 4FETA 5FB2A 5HLHA 1O3TA 1ZRCA 1J59A 3HIFA 2WWYA 1U78A 1BW5A 4A0ZA 1MBFA 4I98B 4RAFA 5B1BH 3CF5F 1DP7P 5LGUA 2V1DA 4KT6A 2JTVA 3KLOA 2ZFUA 1MD0A 3AG2H 4M9SA 4XN3A 4LLGF 3JCUC 5H20A 2DT6A 3IC7A 4AD9A 1IV6A 4KNYA 3I53A 1R49A 3JAMZ 2NXNB 2A3SA 2WBMA 3QPHA 4ZYAA 3NEUA 3DLAA 3CCJI 2QWWA 3HZJA 2FE3A 2FMYA 4DZPA 2W25A 2HPMA 4KA4A 1YRNA 5JVTA 2CSOA 1YS6A 3LSPA 2K5CA 4OIOF 2QGUA 3AFHA 4I2OA 3GWZA 2IJLA 1NK3P 1R9TJ 4LIUA 1Z77A 3GZ5A 1X1BA 2VKEA 1MJBA 2VIXA 5DCMB 1Z6RA 3HB9A 5TJJA 1VQ6I 1EH6A 3Q0VA 2E34A 3SXYA 4D5CA 1BC7C 2KL4A 3CCQI 2BY0A 3E5QA 1I6XA 1B72A 2OF7A 4HX8A 4P5OA 3ZCOA 1ZKGA 1USSA 3I64A 1TNTA 1UELB 4CYCB 1AKHB 2W00A 1YIJI 4I02A 2XB5A 3F9KA 4C9YA 1SVLA 1KGSA 2EFOA 3OY9A 1CF7A 2AS5F 1MSFC 1Z05A 1BJZA 1J2XA 4RAGA 2X1CA 2VKVA 1W7PD 3PJRA 4LJZF 4IXAA 1VZ0A 4A3CJ 2VE8A 4ZYDA 2GM4A 3JSOA 3DTEA 1TZLA 2CQNA 2B0LA 3QYBA 3QODA 2IS1A 3Q0WA 2Y0MA 2Z2SB 1I5ZA 3I54A 1TQMA 5ED4A 3EUAA 4GGGA 1WJBA 2BZTA 2Y69H 3KP6A 1FOXA
chains in the Genus database with same CATH topology
1FZPB 4RAYA 1RIOH 5FFZA 4EVIA 2V9VA 1OMIA 2VXZA 5LHGA 1U8RA 3PQKA 2H6CA 2XGXA 1TTYA 1R7JA 5DEQA 2M87A 4U0WA 2LDUA 5E17F 5IT9K 1B6AA 4HQMA 1FSHA 3BZ6A 3WTSC 1K78A 3P9IA 3HRMA 3CUQB 2EK5A 1DPRA 5K5OA 5CVJA 2O3FA 2OAZA 4NB5A 2FEZA 2VOOA 2HYFA 2DO7A 5BOXA 1G4DA 2NNNA 3W6JB 1ZH5A 1XCBA 1KQ9A 3RPQA 3P9KA 3ZMDA 2DPUA 3C18A 2VC0A 5E8GA 4L5JA 1ZLJA 4RAZA 3HSFA 3F72A 2FBHA 5CVIA 2NS0A 2CGPA 1MJ9A 1XSXA 4EV0A 4U0VA 4KT5C 2F5FA 5FLXZ 2YU3A 3TDZC 3T1BA 1D5VA 5DYMA 1WI9A 1OPCA 4BYYA 4IRIA 1F5TA 3RKYA 2EV0A 4WWCA 2HFHA 5LRSA 1USTA 4ESBA 2EWNA 4ESFA 1MDMB 3E5UA 1Z91A 2V6CA 2M1BA 1EH7A 1MKMA 4PGGA 2IRFG 1PP8F 1XGSA 2FQ3A 3TKYA 4IJAA 4HA8A 5L3FA 1FP2A 2XAFA 2IA0A 1QO0D 1B4AA 3GVAA 3TOBA 4PDKA 4G6QA 4L0YB 1P6RA 2RV8A 5H6RA 1O3RA 2CQKA 5JHUA 2FNPA 5HLIA 3HTUA 2F5EA 1H9GA 1XSDA 2BEOA 2VE9A 2PMUA 3R60A 3DF8A 2XIGA 1E17A 1YO5C 4BXUA 2XAJA 2XAQA 3O6BB 1QGPA 1KYZA 1G3WA 3WTVC 1BJAA 1ONVA 2GIVA 4A2UA 2CFXA 1KU7A 5ILVA 3D5LA 1ODDA 1HKSA 1SD6A 2W57A 3TO7A 4LK0F 1YG2A 3C7JA 1R00A 4HDUA 2HTSA 5F64A 4IRHA 4AVPA 4HV6A 1O57A 4O5VA 2XASA 2OU2A 4HBLA 4BAYA 3FWEA 2M45A 3V4GA 2FOKA 4WK8F 1IN6A 2F5CA 1ZLKA 2E7XA 4CGZA 3RPUA 3GXOA 5K5RA 1Z9CA 5J8FA 1UHMA 2Q0OA 3SZTA 4Q4ZF 1MDMA 2O61A 2JRTA 1SMTA 1YFHA 2ESNA 2QQ9A 4UVAA 1U5TB 3ZN1A 3I59A 3IWZA 2RDPA 5L3DA 5FD6A 2Z9OA 5KK1A 3RI4A 2MD5A 5LGNA 3EYYA 2Z99A 2M8EA 3GO5A 4BNCA 4EJVA 2OZUA 2FA5A 1K6OA 3R61A 1YS7A 4EJWA 2BV6A 4MHGA 3TO6A 3GZ6A 2M5WA 4BHBA 4XSXF 1SFXA 4BHPA 2KIFA 2Z5UA 3K1NA 3P7NA 3U1DA 3E3VA 2UZKA 3HHGA 3SZPA 3RYPA 3FHZA 4M6YA 2BBYA 4QWQA 3Q9SA 2PJPA 2P4WA 2PQ8A 2OZ6A 3KLNA 2KIMA 1BC8C 3PQJA 3KEQA 1B1BA 4LK1F 2DPDA 3KZYA 4BH9A 3KP4A 4GO1A 1TBXA 2ZBKA 4WXCA 3M8EA 5D5VB 1JHFA 1LQ1A 1S8NA 2E1CA 2DK5A 3Q5FA 4YFXF 2ETHA 4IPAA 2ZMEB 3E6BA 3GLXA 3SFZA 5AIPA 2FU4A 4N9HA 1GHCA 1BI0A 2X4HA 2QM3A 4RB3C 3L7WA 3H3ZA 2A5YB 1S6LA 4Y15A 4XLPF 3CDHA 1R22A 1TW3A 3F6VA 4HQEA 3F8MA 1WWXA 4GYGA 3CTAA 2MLKA 1JGSA 2JSCA 5H6QA 2ZNYA 4G9YA 3WTTC 3SQNA 3LAJA 4ZYHA 3I71A 4WX9A 3LQQA 4A0XA 5L3EA 3RDIA 4L0ZB 4MQVA 4A5MA 4XLNF 2GXGA 1BIAA 5E8IA 4G94A 3ULQB 3GUDA 2P7VB 3WGIA 4N0BA 1HSJA 1T39A 4MEYF 2VT2A 1R1TA 4LLNA 2O6GE 2VONA 3IKTA 6PAXA 2IP2A 1FYKA 1HXDA 3D0SA 3ZP5A 2O03A 3WU0A 2QBYB 2STWA 3R0AA 5FFXA 2X0LA 5JI6A 5LGTA 2XKOA 1TNSA 1IAWA 5HLGA 1U2WA 1XGMA 2D2WA 2DK8A 2YPRA 5J8CA 5HS7A 3R4KA 2E1NA 2EJRA 5LHIA 5HDKA 3ZQ7A 4QLCU 3J7AO 5HVQC 5D5WB 3IKVA 3WE2A 1G3YA 1LB2A 3F8BA 3CO7C 5HS9A 4HYEA 5E18F 4LG0B 3FF5A 3CUQA 1QPMA 2ISYA 2HTJA 2D1VA 2Y75A 3V8LA 3MZYA 4HF1A 3CJNA 3LA7A 4M71A 3DPTA 4ENNA 1QZZA 3T8TA 4EJUA 1XN7A 1XMAA 1SAXA 4N9IA 3IHUA 2O8XA 5ILSA 2IA1A 3F3XA 4Q48A 3GYHX 3HOTA 1IRGA 1IUYA 1OYWA 5DD8A 2DFIA 3K9TA 4RB2C 3BDDA 2H6BA 1UHWA 4U7BA 3VFZA 4F7ZA 2K4BA 2BE5F 2WC2A 1S3JA 4Z2YA 4HF0A 3J81Z 1R36A 2ZO4A 2COMA 2RNJA 3IRRA 5HDGA 1TW2A 1O3QA 4O3MA 4LD5A 2D1HA 1P4WA 1SD4A 3I58A 2EV5A 4CICA 4IVNA 3ERED 1Z7UA 4A0YA 5A2QZ 4KIGA 5ICEA 4A6DA 4ENKA 2MH9A 2VODA 2RVCA 4OMZA 4AIJA 1LEBA 1R58A 1HKTA 1T38A 4FX0A 3QRFF 4MTDA 3AAFA 2P8TA 4ZZDA 3M8FA 4Q5SF 2HKOA 1O3SA 4IHSA 2XHKA 1EV7A 2WV0A 1LDDA 2M30A 1FOKA 5FO5A 3WODF 2QVOA 3FX3A 4EJTA 2YR2A 2STTA 1T6SA 2L54A 4IHTA 1P92A 4ESJA 2PI0A 3HHHA 3V8KA 1LNWA 1IN8A 5CVRA 1KQ0A 1MZBA 4A12A 5CYVA 5CLSA 1YW8A 4LGWA 5DCMA 4A5NA 2GAUA 3E97A 3E6MA 3LQRA 2K7LA 2K86A 4EM2A 3BJ6A 3COAC 3EQLF 2QQAA 4A6EA 4ZYGA 4OOIA 3U2RA 2HQRA 1FBUA 3HSEA 1K79A 1EH8A 2Z33A 2Z3YA 2QYOA 3BOQA 4XBFA 1J7KA 2ZNZA 2ACJA 4HX7A 2ZFWA 1C0WA 1FBQA 3EDPA 5D6FA 4XSZF 2PG4A 4ZH4F 3M1EA 3JW4A 1FT9A 4EGYA 2OBPA 3GF2A 3J81K 1ZGJA 3REOA 2QBYA 1DUXC 1DDNA 1A04A 1YW7A 4CZZA 3TGNA 3K0LA 2KKOA 4HLYA 3CO6C 1S7OA 3K69A 1B9NA 2R7DA 1LVAA 1G3SA 3M7GA 3GFJA 2XUBA 2FBIA 1DPUA 5ICFA 4LB6B 2MBFA 3B02A 4S04A 1ZG5A 1KU9A 5LEKA 5JR3A 4AWXB 2AXLA 2G7HA 3W6KB 2RQPA 1W5TA 3ABUA 5LBQA 3KP7A 1HKQA 1ZG3A 1XCVA 1WRJA 2ZJ2A 2HYGD 3GFMA 4BQAA 4UV8A 1GXPA 3DQVC 3F8NA 2OQGA 3WTXC 2IVMA 2VBXA 2VBWA 1L0OC 4UXNA 5D4RA 4I0BA 1X3UA 3NRVA 4M9ZA 3FXQA 1ULYA 4LLLA 2H94A 3T5XA 3BJOA 2HOEA 2H27A 1AOYA 4L9VA 4PCQA 3MEXA 2DT5A 4EQQA 3JTHA 2EB7A 1FNNA 4G7OF 4MTEA 1JHHA 4LMYA 1XSVA 3WTZA 1O7LA 4FHTA 1JE8A 4AIKA 4RB0A 3DV8A 3ROUA 3F22A 5DD4A 1BI1A 1XDSA 3E6CC 1E2XA 2XKPA 5TRDA 2UXNA 4KN7X 4B8XA 1ZHFA 5LHHA 5D8LB 4LFUA 4YFKF 3V7CA 1PDNC 4HOBA 5L3GA 4H0EA 5F6FA 2RGVA 3ZMUA 1BI3A 4LB5A 1FP1D 1SD7A 1B9MA 5EEGA 2ADUA 1BOAA 4DNCA 3F23A 1FYLA 5BPIA 3LWFA 4UVBA 1P4AA 1U5TC 3ZPLA 1OYYA 1YLFA 2P7CB 4M9XA 3JSPA 4M73A 4CDGA 1I1SA 1FY7A 1J75A 4I7HA 3SHFA 3WGGA 4UVCA 4ASNA 2LSOA 5A2QK 1WSUA 3ZMSA 3QPTA 4B09A 5HDNA 3J80K 2IPQX 1G6NA 4I01A 2GWRA 2MH2A 3KP5A 2VN2A 2RN7A 3R6SA 2GA2A 2ESHA 3FMSA 2YSRA 2UWMA 3MFKA 2FF4A 1ZRFA 3IL2A 1J0RA 3RIRA 1OKRA 1R5HA 3WG9A 2QZ8A 2DQLA 2YX7A 1GXQA 2LF8A 1YQAA 3TO9A 3QP5A 2JPCA 1J5YA 2GA1A 2F2EA 2P6TA 4HLXA 5L3BA 2NRAC 2KJBA 1VTNC 4R8HA 2LNBA 2GXBA 2CG4A 4EMSA 5BMZA 3QU6A 3F8CA 1IN5A 2L4MA 2MC3A 3CUQC 4G7HF 5E20A 1BIBA 1UFMA 2H09A 4UV9A 1ON2A 4ENMA 4E70A 3WTYC 3HYIA 1AWCA 2E7WA 4S05A 3G3ZA 2CW0F 4KMFA 3CLOA 1RUNA 5BS6A 3ZMTA 1CF7B 2V79A 1G3TA 2DI3A 1LDJA 3IWFA 5HS8A 3ECHA 2DU9A 3ISPA 5E1ZB 1HQCA 4I0AA 2QQBA 3VEPA 1T2KA 5K1YA 2ZKZA 1YYVA 5ICGA 3K1PA 5LLQA 1TLHB 4M6XA 5D8KB 1XB4A 4CXFA 4RB1A 2FNAA 1PUEE 1FLIA 3L2CA 2HWVA 2QUFA 3RKXA 4CHUA 4JQFA 3DXJF 4L18B 3HSRA 2ZCWA 2A07F 5D6EA 1STZA 1IF1A 2DLLA 2MLGA 1WKMA 3QU3A 4CYDA 2OA4A 3BWGA 3BP8A 3HRUA 3EETA 3BY6A 2D45A 1R1UA 5D5XB 1V3FA 2VOPA 2KJCA 1K7AA 3EUHA 4EM1A 3TDUC 2HGCA 4ETSA 1ZG1A 2NAZA 3C1DA 2FBKA 1QNTA 3U9GA 1XD7A 4M74A 2A68F 2QENA 1LJ9A 1R5GA 4WF2A 2PLYA 1SD5A 3LA2A 3I0TA 1V4RA 2Q2EA 3JAMK 1D8JA 1D3YA 1BM9A 3LA3A 3HOSA 4KMUX 3FMRA 1S29A 5DV5A 5LRRA 3C3WA 2PBIA 3GX4X 2EA4A 2RC4A 3KP2A 3GEZA 4YFNF 1IN7A 1LDKB 2PEXA 4WXDA 2LKPA 1ZARA 2JT1A 3DPLC 4KUMA 2JPBA 5DUKA 3GFIA 1WQ2A 4R79A 4P9UA 2EV6A 2DAOA 5HOOA 5LEJA 5FLXK 5D5UB 3ECOA 3H3UA 1TQIA 2LF7A 4GCVA 2EFQA 1Q1HA 5F1RA 3BROA 5E1WA 3KE2A 2K4JA 2O0YA 4RGUA 1YW9A 4NHJA 1FC3A 1W4MA 2J5OA 3MWMA 3TOAA 1XDUA 4YG2F 4OIQF 1FYMA 5ICCA 2FRHA 3HRTA 1P2FA 4KDPA 4IF4A 2HEOA 3L00A 2K02A 1IW7F 1ON1A 4YIIA 4PZJA 2R3SA 5BPDA 1W7PA 3FXRA 5FGMA 5J6XA 4OMYA 1IRFA 1KU2A 1ZGAA 2L01A 4HW0A 4GXOA 1FWZA 2VT3A 3WGHA 3K1MA 1XGOA 2ELHA 3WE3A 4Y13A 3OV8A 1KA8A 1F4KA 4P96A 2XVCA 5CJ9A 5L3CA 2K27A 2MA3A 3ML6A 4RGXA 4MGRA 2DTRA 4HV5A 1J9IA 4P55A 2C6YA 4EJOA 2HKXA 2FXAA 1F9NA 2W24A 1UCRA 2P5VA 4M72A 1YTYA 4HF2A 3KETA 2NNYA 4YIFA 1HBXG 1ZREA 2EFPA 4RGSA 3I5UA 3BPVA 1D8KA 2ISZA 2WTEA 1OYIA 4Q47A 2V1XA 3M9AA 2Q8KA 5CVVA 3FM5A 4KICA 4JK1X 1FX7A 2GQQA 3I59B 2KIUA 2L02A 3P9CA 5CVUA 5AONA 5K5QA 1FSEA 1BN5A 2A6HF 5JFRA 3G73A 2HR3A 2XAGA 3TQNA 3T8RA 1HSTA 1P4XA 4PGHA 2V1UA 4KIFA 1QBJA 3VOEA 1B59A 2PMHA 2EFWA 3R0JA 4I09A 3ELKA 3MCZA 2UXXA 4EGZA 2VBYA 2PN6A 4HDVA 5IT9Z 3VB2A 4RS8A 2QLZA 4G7ZF 1JXSA 4KYWA 2G9WA 5BQTA 1W7PB 1RI7A 1ZAOA 3CUOA 2HDCA 1I27A 3FM3A 2XAHA 2XROA 1H9TA 1U5TA 3HTSB 1REPC 5KVRA 2DBBA 1I1GA 5ILUA 3DEUA 1Z1DA 3LSTA 3DP7A 3FMQA 2EFNA 3KZZA 3BJAA 2OQRA 4UNOA 2CYYA 1KQ8A 1IZ1A 1IXRC 4XRFA 1IXCA 1ZRDA 2P5KA 4RGRA 3MQ0A 3KFWX 2DW4A 4D0PA 1BI2A 2VC1A 2HQNA 1RNLA 4WCGA 4OIRF 5DUIA 2W85A 4AIHA 3WTWC 1HW2A 4GYIA 1ZYRF 3L9FA 4NQWA 3ABTA 2CWEA 4KN4X 2P5LC 1NHAA 4MEXF 2J5PA 3LFKA 3OOPA 3ZN0A 5IT3A 1RZ4A 1U6GA 3KP3A 3I4PA 3MZHA 1QQIA 4OU0A 3RKWA 2ZXJA 3N4MA 2A61A 2W84A 4UHTA 3HRSA 4HZFA 1U3EM 2TDXA 3DFGA 4HAMA 2R7FA 4ON0A 5DDGA 5AIQA 1FBSA 4MQ9F 1HW5A 5E1XA 4MNUA 4L9JA 5DCFA 1RUOA 4O6JA 4EM0B 2NYXA 1T0FA 3F8FA 3VODA 3WTUC 1F1ZA 3NQOA 4U0YA 3V8JA 3QP6A 4OINF 4G8XA 4ENJA 1HW1A 5ERIA 3B73A 3H92A 3MAJA 4FT8A 1SMYF 4P9FA 3F21A 2JZYA 1MJAA 3O3KA 2A69F 2L4AA 4R1HA 1W5SA 4L5IA 3RTRA 1YIOA 4KIBA 2EA2A 1PP7U 1Y0UA 2FSWA 1L3LA 1SFUA 3BPXA 3EYIA 1K78B 4HX4A 4L9TA 2A6EF 2Y48A 3WU1B 2RKHA 1H0MA 2GZWA 3E6DA 1Z6TA 1R1VA 2G7UA 4Y17A 1XMKA 4TV7A 3O2PE 1T98A 2IA2A 3V7SA 2CO5A 3V7RA 1FPQA 4ZZLA 3DKWA 2L3DA 2HS5A 2FMLA 3QAHA 4KFCA 4BHCA 3T0YA 2ZMEA 2IW5A 3N97A 5EEHA 1UB9A 1O7FA 3E5XA 3JTGA 4IRGA 4LG0A 3F6OA 1BBYA 2IT0A 4WXHA 1IN4A 3KCCA 1CGPA 4U88A 3GFLA 3L09A 4UUVA 3RYRA 1KYWA 4G6DA 4FX4A 4JBAA 4OIPF 1GVJA 1R23A 3FZVA 4CO8A 2HZTA 3LAPA 4K2EA 2XV4S 3GW2A 3HUGA 1IXSB 3Q9VA 1XGNA 2BGCA 3ZMVA 2BYVE 3ZMZA 1SFEA 2OD5A 1S7AA 5D4SA 3K2ZA 1OR7A 1MGTA 2YX4A 3IRQA 1QZYA 5FD5A 3FXUA 2KRFA 3QOPA 3RJPA 1ZN2A 2VBZA 4DQ2A 2DQRA 1KU3A 3PFIA 4L9NA 1TQPA 3KEOA 1LEAA 4U7DA 3S2WA 2PFBA 4ZYEA 2XRNA 3J80Z 2F5DA 2P6SA 5FB2A 5HLHA 1O3TA 1ZRCA 1J59A 3HIFA 2WWYA 1U78A 4A0ZA 4I98B 1DP7P 5LGUA 2V1DA 2JTVA 3KLOA 1MD0A 4M9SA 4LLGF 5H20A 3IC7A 4AD9A 4KNYA 3I53A 3JAMZ 2A3SA 3QPHA 3NEUA 2QWWA 2FE3A 2FMYA 2W25A 4KA4A 5JVTA 2CSOA 1YS6A 4OIOF 4I2OA 3GWZA 2IJLA 3GZ5A 1MJBA 5DCMB 1Z6RA 5TJJA 1EH6A 3SXYA 1BC7C 3E5QA 1I6XA 4HX8A 4P5OA 1USSA 3I64A 1TNTA 4I02A 1KGSA 2EFOA 1CF7A 2AS5F 1Z05A 1J2XA 1W7PD 4LJZF 4IXAA 4ZYDA 2VE8A 3JSOA 2B0LA 2Y0MA 3I54A 1I5ZA 1TQMA 5ED4A 4GGGA 3KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZP B;  4RAY A;  1RIO H;  5FFZ A;  4EVI A;  2V9V A;  1OMI A;  2VXZ A;  5LHG A;  1U8R A;  3PQK A;  2H6C A;  2XGX A;  1TTY A;  1R7J A;  5DEQ A;  2M87 A;  4U0W A;  2LDU A;  5E17 F;  5IT9 K;  1B6A A;  4HQM A;  1FSH A;  3BZ6 A;  3WTS C;  1K78 A;  3P9I A;  3HRM A;  3CUQ B;  2EK5 A;  1DPR A;  5K5O A;  5CVJ A;  2O3F A;  2OAZ A;  4NB5 A;  2FEZ A;  2VOO A;  2HYF A;  2DO7 A;  5BOX A;  1G4D A;  2NNN A;  3W6J B;  1ZH5 A;  1XCB A;  1KQ9 A;  3RPQ A;  3P9K A;  3ZMD A;  2DPU A;  3C18 A;  2VC0 A;  5E8G A;  4L5J A;  1ZLJ A;  4RAZ A;  3HSF A;  3F72 A;  2FBH A;  5CVI A;  2NS0 A;  2CGP A;  1MJ9 A;  1XSX A;  4EV0 A;  4U0V A;  4KT5 C;  2F5F A;  5FLX Z;  2YU3 A;  3TDZ C;  3T1B A;  1D5V A;  5DYM A;  1WI9 A;  1OPC A;  4BYY A;  4IRI A;  1F5T A;  3RKY A;  2EV0 A;  4WWC A;  2HFH A;  5LRS A;  1UST A;  4ESB A;  2EWN A;  4ESF A;  1MDM B;  3E5U A;  1Z91 A;  2V6C A;  2M1B A;  1EH7 A;  1MKM A;  4PGG A;  2IRF G;  1PP8 F;  1XGS A;  2FQ3 A;  3TKY A;  4IJA A;  4HA8 A;  5L3F A;  1FP2 A;  2XAF A;  2IA0 A;  1QO0 D;  1B4A A;  3GVA A;  3TOB A;  4PDK A;  4G6Q A;  4L0Y B;  1P6R A;  2RV8 A;  5H6R A;  1O3R A;  2CQK A;  5JHU A;  2FNP A;  5HLI A;  3HTU A;  2F5E A;  1H9G A;  1XSD A;  2BEO A;  2VE9 A;  2PMU A;  3R60 A;  3DF8 A;  2XIG A;  1E17 A;  1YO5 C;  4BXU A;  2XAJ A;  2XAQ A;  3O6B B;  1QGP A;  1KYZ A;  1G3W A;  3WTV C;  1BJA A;  1ONV A;  2GIV A;  4A2U A;  2CFX A;  1KU7 A;  5ILV A;  3D5L A;  1ODD A;  1HKS A;  1SD6 A;  2W57 A;  3TO7 A;  4LK0 F;  1YG2 A;  3C7J A;  1R00 A;  4HDU A;  2HTS A;  5F64 A;  4IRH A;  4AVP A;  4HV6 A;  1O57 A;  4O5V A;  2XAS A;  2OU2 A;  4HBL A;  4BAY A;  3FWE A;  2M45 A;  3V4G A;  2FOK A;  4WK8 F;  1IN6 A;  2F5C A;  1ZLK A;  2E7X A;  4CGZ A;  3RPU A;  3GXO A;  5K5R A;  1Z9C A;  5J8F A;  1UHM A;  2Q0O A;  3SZT A;  4Q4Z F;  1MDM A;  2O61 A;  2JRT A;  1SMT A;  1YFH A;  2ESN A;  2QQ9 A;  4UVA A;  1U5T B;  3ZN1 A;  3I59 A;  3IWZ A;  2RDP A;  5L3D A;  5FD6 A;  2Z9O A;  5KK1 A;  3RI4 A;  2MD5 A;  5LGN A;  3EYY A;  2Z99 A;  2M8E A;  3GO5 A;  4BNC A;  4EJV A;  2OZU A;  2FA5 A;  1K6O A;  3R61 A;  1YS7 A;  4EJW A;  2BV6 A;  4MHG A;  3TO6 A;  3GZ6 A;  2M5W A;  4BHB A;  4XSX F;  1SFX A;  4BHP A;  2KIF A;  2Z5U A;  3K1N A;  3P7N A;  3U1D A;  3E3V A;  2UZK A;  3HHG A;  3SZP A;  3RYP A;  3FHZ A;  4M6Y A;  2BBY A;  4QWQ A;  3Q9S A;  2PJP A;  2P4W A;  2PQ8 A;  2OZ6 A;  3KLN A;  2KIM A;  1BC8 C;  3PQJ A;  3KEQ A;  1B1B A;  4LK1 F;  2DPD A;  3KZY A;  4BH9 A;  3KP4 A;  4GO1 A;  1TBX A;  2ZBK A;  4WXC A;  3M8E A;  5D5V B;  1JHF A;  1LQ1 A;  1S8N A;  2E1C A;  2DK5 A;  3Q5F A;  4YFX F;  2ETH A;  4IPA A;  2ZME B;  3E6B A;  3GLX A;  3SFZ A;  5AIP A;  2FU4 A;  4N9H A;  1GHC A;  1BI0 A;  2X4H A;  2QM3 A;  4RB3 C;  3L7W A;  3H3Z A;  2A5Y B;  1S6L A;  4Y15 A;  4XLP F;  3CDH A;  1R22 A;  1TW3 A;  3F6V A;  4HQE A;  3F8M A;  1WWX A;  4GYG A;  3CTA A;  2MLK A;  1JGS A;  2JSC A;  5H6Q A;  2ZNY A;  4G9Y A;  3WTT C;  3SQN A;  3LAJ A;  4ZYH A;  3I71 A;  4WX9 A;  3LQQ A;  4A0X A;  5L3E A;  3RDI A;  4L0Z B;  4MQV A;  4A5M A;  4XLN F;  2GXG A;  1BIA A;  5E8I A;  4G94 A;  3ULQ B;  3GUD A;  2P7V B;  3WGI A;  4N0B A;  1HSJ A;  1T39 A;  4MEY F;  2VT2 A;  1R1T A;  4LLN A;  2O6G E;  2VON A;  3IKT A;  6PAX A;  2IP2 A;  1FYK A;  1HXD A;  3D0S A;  3ZP5 A;  2O03 A;  3WU0 A;  2QBY B;  2STW A;  3R0A A;  5FFX A;  2X0L A;  5JI6 A;  5LGT A;  2XKO A;  1TNS A;  1IAW A;  5HLG A;  1U2W A;  1XGM A;  2D2W A;  2DK8 A;  2YPR A;  5J8C A;  5HS7 A;  3R4K A;  2E1N A;  2EJR A;  5LHI A;  5HDK A;  3ZQ7 A;  4QLC U;  3J7A O;  5HVQ C;  5D5W B;  3IKV A;  3WE2 A;  1G3Y A;  1LB2 A;  3F8B A;  3CO7 C;  5HS9 A;  4HYE A;  5E18 F;  4LG0 B;  3FF5 A;  3CUQ A;  1QPM A;  2ISY A;  2HTJ A;  2D1V A;  2Y75 A;  3V8L A;  3MZY A;  4HF1 A;  3CJN A;  3LA7 A;  4M71 A;  3DPT A;  4ENN A;  1QZZ A;  3T8T A;  4EJU A;  1XN7 A;  1XMA A;  1SAX A;  4N9I A;  3IHU A;  2O8X A;  5ILS A;  2IA1 A;  3F3X A;  4Q48 A;  3GYH X;  3HOT A;  1IRG A;  1IUY A;  1OYW A;  5DD8 A;  2DFI A;  3K9T A;  4RB2 C;  3BDD A;  2H6B A;  1UHW A;  4U7B A;  3VFZ A;  4F7Z A;  2K4B A;  2BE5 F;  2WC2 A;  1S3J A;  4Z2Y A;  4HF0 A;  3J81 Z;  1R36 A;  2ZO4 A;  2COM A;  2RNJ A;  3IRR A;  5HDG A;  1TW2 A;  1O3Q A;  4O3M A;  4LD5 A;  2D1H A;  1P4W A;  1SD4 A;  3I58 A;  2EV5 A;  4CIC A;  4IVN A;  3ERE D;  1Z7U A;  4A0Y A;  5A2Q Z;  4KIG A;  5ICE A;  4A6D A;  4ENK A;  2MH9 A;  2VOD A;  2RVC A;  4OMZ A;  4AIJ A;  1LEB A;  1R58 A;  1HKT A;  1T38 A;  4FX0 A;  3QRF F;  4MTD A;  3AAF A;  2P8T A;  4ZZD A;  3M8F A;  4Q5S F;  2HKO A;  1O3S A;  4IHS A;  2XHK A;  1EV7 A;  2WV0 A;  1LDD A;  2M30 A;  1FOK A;  5FO5 A;  3WOD F;  2QVO A;  3FX3 A;  4EJT A;  2YR2 A;  2STT A;  1T6S A;  2L54 A;  4IHT A;  1P92 A;  4ESJ A;  2PI0 A;  3HHH A;  3V8K A;  1LNW A;  1IN8 A;  5CVR A;  1KQ0 A;  1MZB A;  4A12 A;  5CYV A;  5CLS A;  1YW8 A;  4LGW A;  5DCM A;  4A5N A;  2GAU A;  3E97 A;  3E6M A;  3LQR A;  2K7L A;  2K86 A;  4EM2 A;  3BJ6 A;  3COA C;  3EQL F;  2QQA A;  4A6E A;  4ZYG A;  4OOI A;  3U2R A;  2HQR A;  1FBU A;  3HSE A;  1K79 A;  1EH8 A;  2Z33 A;  2Z3Y A;  2QYO A;  3BOQ A;  4XBF A;  1J7K A;  2ZNZ A;  2ACJ A;  4HX7 A;  2ZFW A;  1C0W A;  1FBQ A;  3EDP A;  5D6F A;  4XSZ F;  2PG4 A;  4ZH4 F;  3M1E A;  3JW4 A;  1FT9 A;  4EGY A;  2OBP A;  3GF2 A;  3J81 K;  1ZGJ A;  3REO A;  2QBY A;  1DUX C;  1DDN A;  1A04 A;  1YW7 A;  4CZZ A;  3TGN A;  3K0L A;  2KKO A;  4HLY A;  3CO6 C;  1S7O A;  3K69 A;  1B9N A;  2R7D A;  1LVA A;  1G3S A;  3M7G A;  3GFJ A;  2XUB A;  2FBI A;  1DPU A;  5ICF A;  4LB6 B;  2MBF A;  3B02 A;  4S04 A;  1ZG5 A;  1KU9 A;  5LEK A;  5JR3 A;  4AWX B;  2AXL A;  2G7H A;  3W6K B;  2RQP A;  1W5T A;  3ABU A;  5LBQ A;  3KP7 A;  1HKQ A;  1ZG3 A;  1XCV A;  1WRJ A;  2ZJ2 A;  2HYG D;  3GFM A;  4BQA A;  4UV8 A;  1GXP A;  3DQV C;  3F8N A;  2OQG A;  3WTX C;  2IVM A;  2VBX A;  2VBW A;  1L0O C;  4UXN A;  5D4R A;  4I0B A;  1X3U A;  3NRV A;  4M9Z A;  3FXQ A;  1ULY A;  4LLL A;  2H94 A;  3T5X A;  3BJO A;  2HOE A;  2H27 A;  1AOY A;  4L9V A;  4PCQ A;  3MEX A;  2DT5 A;  4EQQ A;  3JTH A;  2EB7 A;  1FNN A;  4G7O F;  4MTE A;  1JHH A;  4LMY A;  1XSV A;  3WTZ A;  1O7L A;  4FHT A;  1JE8 A;  4AIK A;  4RB0 A;  3DV8 A;  3ROU A;  3F22 A;  5DD4 A;  1BI1 A;  1XDS A;  3E6C C;  1E2X A;  2XKP A;  5TRD A;  2UXN A;  4KN7 X;  4B8X A;  1ZHF A;  5LHH A;  5D8L B;  4LFU A;  4YFK F;  3V7C A;  1PDN C;  4HOB A;  5L3G A;  4H0E A;  5F6F A;  2RGV A;  3ZMU A;  1BI3 A;  4LB5 A;  1FP1 D;  1SD7 A;  1B9M A;  5EEG A;  2ADU A;  1BOA A;  4DNC A;  3F23 A;  1FYL A;  5BPI A;  3LWF A;  4UVB A;  1P4A A;  1U5T C;  3ZPL A;  1OYY A;  1YLF A;  2P7C B;  4M9X A;  3JSP A;  4M73 A;  4CDG A;  1I1S A;  1FY7 A;  1J75 A;  4I7H A;  3SHF A;  3WGG A;  4UVC A;  4ASN A;  2LSO A;  5A2Q K;  1WSU A;  3ZMS A;  3QPT A;  4B09 A;  5HDN A;  3J80 K;  2IPQ X;  1G6N A;  4I01 A;  2GWR A;  2MH2 A;  3KP5 A;  2VN2 A;  2RN7 A;  3R6S A;  2GA2 A;  2ESH A;  3FMS A;  2YSR A;  2UWM A;  3MFK A;  2FF4 A;  1ZRF A;  3IL2 A;  1J0R A;  3RIR A;  1OKR A;  1R5H A;  3WG9 A;  2QZ8 A;  2DQL A;  2YX7 A;  1GXQ A;  2LF8 A;  1YQA A;  3TO9 A;  3QP5 A;  2JPC A;  1J5Y A;  2GA1 A;  2F2E A;  2P6T A;  4HLX A;  5L3B A;  2NRA C;  2KJB A;  1VTN C;  4R8H A;  2LNB A;  2GXB A;  2CG4 A;  4EMS A;  5BMZ A;  3QU6 A;  3F8C A;  1IN5 A;  2L4M A;  2MC3 A;  3CUQ C;  4G7H F;  5E20 A;  1BIB A;  1UFM A;  2H09 A;  4UV9 A;  1ON2 A;  4ENM A;  4E70 A;  3WTY C;  3HYI A;  1AWC A;  2E7W A;  4S05 A;  3G3Z A;  2CW0 F;  4KMF A;  3CLO A;  1RUN A;  5BS6 A;  3ZMT A;  1CF7 B;  2V79 A;  1G3T A;  2DI3 A;  1LDJ A;  3IWF A;  5HS8 A;  3ECH A;  2DU9 A;  3ISP A;  5E1Z B;  1HQC A;  4I0A A;  2QQB A;  3VEP A;  1T2K A;  5K1Y A;  2ZKZ A;  1YYV A;  5ICG A;  3K1P A;  5LLQ A;  1TLH B;  4M6X A;  5D8K B;  1XB4 A;  4CXF A;  4RB1 A;  2FNA A;  1PUE E;  1FLI A;  3L2C A;  2HWV A;  2QUF A;  3RKX A;  4CHU A;  4JQF A;  3DXJ F;  4L18 B;  3HSR A;  2ZCW A;  2A07 F;  5D6E A;  1STZ A;  1IF1 A;  2DLL A;  2MLG A;  1WKM A;  3QU3 A;  4CYD A;  2OA4 A;  3BWG A;  3BP8 A;  3HRU A;  3EET A;  3BY6 A;  2D45 A;  1R1U A;  5D5X B;  1V3F A;  2VOP A;  2KJC A;  1K7A A;  3EUH A;  4EM1 A;  3TDU C;  2HGC A;  4ETS A;  1ZG1 A;  2NAZ A;  3C1D A;  2FBK A;  1QNT A;  3U9G A;  1XD7 A;  4M74 A;  2A68 F;  2QEN A;  1LJ9 A;  1R5G A;  4WF2 A;  2PLY A;  1SD5 A;  3LA2 A;  3I0T A;  1V4R A;  2Q2E A;  3JAM K;  1D8J A;  1D3Y A;  1BM9 A;  3LA3 A;  3HOS A;  4KMU X;  3FMR A;  1S29 A;  5DV5 A;  5LRR A;  3C3W A;  2PBI A;  3GX4 X;  2EA4 A;  2RC4 A;  3KP2 A;  3GEZ A;  4YFN F;  1IN7 A;  1LDK B;  2PEX A;  4WXD A;  2LKP A;  1ZAR A;  2JT1 A;  3DPL C;  4KUM A;  2JPB A;  5DUK A;  3GFI A;  1WQ2 A;  4R79 A;  4P9U A;  2EV6 A;  2DAO A;  5HOO A;  5LEJ A;  5FLX K;  5D5U B;  3ECO A;  3H3U A;  1TQI A;  2LF7 A;  4GCV A;  2EFQ A;  1Q1H A;  5F1R A;  3BRO A;  5E1W A;  3KE2 A;  2K4J A;  2O0Y A;  4RGU A;  1YW9 A;  4NHJ A;  1FC3 A;  1W4M A;  2J5O A;  3MWM A;  3TOA A;  1XDU A;  4YG2 F;  4OIQ F;  1FYM A;  5ICC A;  2FRH A;  3HRT A;  1P2F A;  4KDP A;  4IF4 A;  2HEO A;  3L00 A;  2K02 A;  1IW7 F;  1ON1 A;  4YII A;  4PZJ A;  2R3S A;  5BPD A;  1W7P A;  3FXR A;  5FGM A;  5J6X A;  4OMY A;  1IRF A;  1KU2 A;  1ZGA A;  2L01 A;  4HW0 A;  4GXO A;  1FWZ A;  2VT3 A;  3WGH A;  3K1M A;  1XGO A;  2ELH A;  3WE3 A;  4Y13 A;  3OV8 A;  1KA8 A;  1F4K A;  4P96 A;  2XVC A;  5CJ9 A;  5L3C A;  2K27 A;  2MA3 A;  3ML6 A;  4RGX A;  4MGR A;  2DTR A;  4HV5 A;  1J9I A;  4P55 A;  2C6Y A;  4EJO A;  2HKX A;  2FXA A;  1F9N A;  2W24 A;  1UCR A;  2P5V A;  4M72 A;  1YTY A;  4HF2 A;  3KET A;  2NNY A;  4YIF A;  1HBX G;  1ZRE A;  2EFP A;  4RGS A;  3I5U A;  3BPV A;  1D8K A;  2ISZ A;  2WTE A;  1OYI A;  4Q47 A;  2V1X A;  3M9A A;  2Q8K A;  5CVV A;  3FM5 A;  4KIC A;  4JK1 X;  1FX7 A;  2GQQ A;  3I59 B;  2KIU A;  2L02 A;  3P9C A;  5CVU A;  5AON A;  5K5Q A;  1FSE A;  1BN5 A;  2A6H F;  5JFR A;  3G73 A;  2HR3 A;  2XAG A;  3TQN A;  3T8R A;  1HST A;  1P4X A;  4PGH A;  2V1U A;  4KIF A;  1QBJ A;  3VOE A;  1B59 A;  2PMH A;  2EFW A;  3R0J A;  4I09 A;  3ELK A;  3MCZ A;  2UXX A;  4EGZ A;  2VBY A;  2PN6 A;  4HDV A;  5IT9 Z;  3VB2 A;  4RS8 A;  2QLZ A;  4G7Z F;  1JXS A;  4KYW A;  2G9W A;  5BQT A;  1W7P B;  1RI7 A;  1ZAO A;  3CUO A;  2HDC A;  1I27 A;  3FM3 A;  2XAH A;  2XRO A;  1H9T A;  1U5T A;  3HTS B;  1REP C;  5KVR A;  2DBB A;  1I1G A;  5ILU A;  3DEU A;  1Z1D A;  3LST A;  3DP7 A;  3FMQ A;  2EFN A;  3KZZ A;  3BJA A;  2OQR A;  4UNO A;  2CYY A;  1KQ8 A;  1IZ1 A;  1IXR C;  4XRF A;  1IXC A;  1ZRD A;  2P5K A;  4RGR A;  3MQ0 A;  3KFW X;  2DW4 A;  4D0P A;  1BI2 A;  2VC1 A;  2HQN A;  1RNL A;  4WCG A;  4OIR F;  5DUI A;  2W85 A;  4AIH A;  3WTW C;  1HW2 A;  4GYI A;  1ZYR F;  3L9F A;  4NQW A;  3ABT A;  2CWE A;  4KN4 X;  2P5L C;  1NHA A;  4MEX F;  2J5P A;  3LFK A;  3OOP A;  3ZN0 A;  5IT3 A;  1RZ4 A;  1U6G A;  3KP3 A;  3I4P A;  3MZH A;  1QQI A;  4OU0 A;  3RKW A;  2ZXJ A;  3N4M A;  2A61 A;  2W84 A;  4UHT A;  3HRS A;  4HZF A;  1U3E M;  2TDX A;  3DFG A;  4HAM A;  2R7F A;  4ON0 A;  5DDG A;  5AIQ A;  1FBS A;  4MQ9 F;  1HW5 A;  5E1X A;  4MNU A;  4L9J A;  5DCF A;  1RUO A;  4O6J A;  4EM0 B;  2NYX A;  1T0F A;  3F8F A;  3VOD A;  3WTU C;  1F1Z A;  3NQO A;  4U0Y A;  3V8J A;  3QP6 A;  4OIN F;  4G8X A;  4ENJ A;  1HW1 A;  5ERI A;  3B73 A;  3H92 A;  3MAJ A;  4FT8 A;  1SMY F;  4P9F A;  3F21 A;  2JZY A;  1MJA A;  3O3K A;  2A69 F;  2L4A A;  4R1H A;  1W5S A;  4L5I A;  3RTR A;  1YIO A;  4KIB A;  2EA2 A;  1PP7 U;  1Y0U A;  2FSW A;  1L3L A;  1SFU A;  3BPX A;  3EYI A;  1K78 B;  4HX4 A;  4L9T A;  2A6E F;  2Y48 A;  3WU1 B;  2RKH A;  1H0M A;  2GZW A;  3E6D A;  1Z6T A;  1R1V A;  2G7U A;  4Y17 A;  1XMK A;  4TV7 A;  3O2P E;  1T98 A;  2IA2 A;  3V7S A;  2CO5 A;  3V7R A;  1FPQ A;  4ZZL A;  3DKW A;  2L3D A;  2HS5 A;  2FML A;  3QAH A;  4KFC A;  4BHC A;  3T0Y A;  2ZME A;  2IW5 A;  3N97 A;  5EEH A;  1UB9 A;  1O7F A;  3E5X A;  3JTG A;  4IRG A;  4LG0 A;  3F6O A;  1BBY A;  2IT0 A;  4WXH A;  1IN4 A;  3KCC A;  1CGP A;  4U88 A;  3GFL A;  3L09 A;  4UUV A;  3RYR A;  1KYW A;  4G6D A;  4FX4 A;  4JBA A;  4OIP F;  1GVJ A;  1R23 A;  3FZV A;  4CO8 A;  2HZT A;  3LAP A;  4K2E A;  2XV4 S;  3GW2 A;  3HUG A;  1IXS B;  3Q9V A;  1XGN A;  2BGC A;  3ZMV A;  2BYV E;  3ZMZ A;  1SFE A;  2OD5 A;  1S7A A;  5D4S A;  3K2Z A;  1OR7 A;  1MGT A;  2YX4 A;  3IRQ A;  1QZY A;  5FD5 A;  3FXU A;  2KRF A;  3QOP A;  3RJP A;  1ZN2 A;  2VBZ A;  4DQ2 A;  2DQR A;  1KU3 A;  3PFI A;  4L9N A;  1TQP A;  3KEO A;  1LEA A;  4U7D A;  3S2W A;  2PFB A;  4ZYE A;  2XRN A;  3J80 Z;  2F5D A;  2P6S A;  5FB2 A;  5HLH A;  1O3T A;  1ZRC A;  1J59 A;  3HIF A;  2WWY A;  1U78 A;  4A0Z A;  4I98 B;  1DP7 P;  5LGU A;  2V1D A;  2JTV A;  3KLO A;  1MD0 A;  4M9S A;  4LLG F;  5H20 A;  3IC7 A;  4AD9 A;  4KNY A;  3I53 A;  3JAM Z;  2A3S A;  3QPH A;  3NEU A;  2QWW A;  2FE3 A;  2FMY A;  2W25 A;  4KA4 A;  5JVT A;  2CSO A;  1YS6 A;  4OIO F;  4I2O A;  3GWZ A;  2IJL A;  3GZ5 A;  1MJB A;  5DCM B;  1Z6R A;  5TJJ A;  1EH6 A;  3SXY A;  1BC7 C;  3E5Q A;  1I6X A;  4HX8 A;  4P5O A;  1USS A;  3I64 A;  1TNT A;  4I02 A;  1KGS A;  2EFO A;  1CF7 A;  2AS5 F;  1Z05 A;  1J2X A;  1W7P D;  4LJZ F;  4IXA A;  4ZYD A;  2VE8 A;  3JSO A;  2B0L A;  2Y0M A;  3I54 A;  1I5Z A;  1TQM A;  5ED4 A;  4GGG A;  3KP6 A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  4PFP A;  1FZP B;  4RAY A;  1QPI A;  2JUC A;  1RIO H;  3CP2 A;  2E5Z A;  3CDL A;  2R93 J;  5FFZ A;  4EVI A;  2QEX I;  2V9V A;  1OMI A;  1O4X A;  3SEZ A;  2VXZ A;  5LHG A;  1U8R A;  3PQK A;  2DCE A;  2H6C A;  2XGX A;  1TTY A;  1R7J A;  1R6R A;  4MLO A;  5DEQ A;  2M87 A;  4FE7 A;  5KCM A;  4U0W A;  1SC7 A;  2LDU A;  1BOB A;  2LR8 A;  4YIR X;  5E17 F;  3CCE I;  5IT9 K;  1B6A A;  1QVT A;  2K9Q A;  4HQM A;  1FSH A;  4XLC A;  3BZ6 A;  3JRD A;  3WTS C;  1K78 A;  2NVX J;  3P9I A;  3HRM A;  2EZI A;  3CUQ B;  1JKR C;  2EK5 A;  3AL0 B;  3QWL A;  1DPR A;  4NDL A;  3MD2 A;  4RMN A;  5K5O A;  5CVJ A;  2WB1 A;  2O3F A;  3TP0 A;  2OAZ A;  4NB5 A;  2FEZ A;  4XM3 A;  3S2D J;  2VOO A;  2HYF A;  2ZJR F;  2DO7 A;  2CH0 A;  5BOX A;  2XDV A;  2NNN A;  1G4D A;  4RM3 A;  1ETY A;  1T0F C;  3W6J B;  4DBR A;  3OR1 C;  1ZR4 A;  4BY1 J;  3W2W A;  1ZH5 A;  1XCB A;  1KQ9 A;  2MW8 A;  2X6W A;  3RPQ A;  3P9K A;  3ZMD A;  2DPU A;  3C18 A;  2VC0 A;  4I6Z A;  5E8G A;  4L5J A;  3OYA A;  1ZLJ A;  2VJI A;  2Z16 A;  4RAZ A;  3HSF A;  3CCM I;  3F72 A;  2FBH A;  3S16 J;  5CVI A;  5FKO A;  3FBN B;  2NS0 A;  2IXS A;  2CGP A;  1MJ9 A;  2VJ4 A;  1XSX A;  2DMT A;  2K40 A;  4EV0 A;  1YJN I;  5FJ8 J;  4U0V A;  4KT5 C;  2F5F A;  1ENH A;  3OL4 A;  5FLX Z;  2YU3 A;  3TDZ C;  3T1B A;  1D5V A;  1SAU A;  5DYM A;  3H5N A;  1NTC A;  1WI9 A;  1OPC A;  2X1D A;  4BYY A;  3G1L A;  4IRI A;  1F5T A;  5FRN A;  3RKY A;  2EV0 A;  1AHD P;  1GVD A;  4WWC A;  2EIJ H;  2ZXI A;  3GCM A;  2HFH A;  5LRS A;  1UST A;  2E2H J;  5EZH A;  4ESB A;  2EWN A;  2DMU A;  4C3H J;  4ESF A;  2ME0 A;  3JAM R;  1MDM B;  3E5U A;  1Z91 A;  2V6C A;  2M1B A;  1EH7 A;  3FHN A;  1MKM A;  1AA7 A;  4PGG A;  2IRF G;  1PP8 F;  4D5F A;  2KIQ A;  1EF4 A;  1XGS A;  2FQ3 A;  1YHQ I;  3TKY A;  2D5V A;  4IJA A;  3VYR B;  4HA8 A;  5L3F A;  3OR2 C;  1FP2 A;  2XAF A;  2IA0 A;  2DTZ A;  1QO0 D;  3HUG B;  4XRM A;  4Z6Y A;  1B4A A;  3GVA A;  2VKD A;  3TOB A;  2JA5 J;  1Y8R B;  3K70 D;  3ZQL A;  4PDK A;  2P0W A;  3C2G A;  3GTO J;  2LK2 A;  4G6Q A;  4L0Y B;  1IC8 A;  1P6R A;  3BG3 A;  3QQA A;  2AO9 A;  2RV8 A;  5H6R A;  4XIC A;  1O3R A;  3PNY A;  2CQK A;  5J1R A;  5JHU A;  2FNP A;  3M8J A;  5HLI A;  2ELK A;  5M5Y J;  2ZC2 A;  3HTU A;  2F5E A;  1H9G A;  1XSD A;  2Q2E B;  2BEO A;  5M5X J;  5IP9 J;  4YEJ A;  3HDD A;  2VE9 A;  2PMU A;  2M7B A;  3R60 A;  4B48 A;  2E2I J;  3DF8 A;  2XIG A;  1E17 A;  1YO5 C;  4BXU A;  2XAJ A;  2IEK A;  2XAQ A;  3O6B B;  1QGP A;  1KYZ A;  1G3W A;  3HOX J;  1MBG A;  3WTV C;  1BJA A;  2QCO A;  1ONV A;  5IYD J;  1UAA A;  2GIV A;  4A2U A;  1SFK A;  2HXO A;  2CUJ A;  2WV1 A;  2CFX A;  2M0M A;  2ZSH B;  1KU7 A;  5B5E C;  5ILV A;  3D5L A;  4BY7 J;  1MMS A;  1ODD A;  1HKS A;  1SD6 A;  2W57 A;  3TO7 A;  1FMW A;  2I5U A;  3HOY J;  3PNV A;  4LK0 F;  4QPQ A;  1YG2 A;  1AU7 A;  2KZG A;  3A0H C;  2H8W A;  3C7J A;  3ZQG A;  3D5S C;  1R00 A;  3DBL B;  4XMY A;  4AUX A;  3CMA I;  4HDU A;  2TCT A;  2LY1 A;  4F3Q A;  2HTS A;  5F64 A;  4IRH A;  4E7H A;  4AVP A;  4HV6 A;  2R7O A;  1ZGW A;  3SZG A;  1EA3 A;  1O57 A;  4O5V A;  2XAS A;  2OU2 A;  4HBL A;  5F08 A;  4BAY A;  3FWE A;  2JUG A;  2M45 A;  1WI3 A;  2BHY A;  2R7X A;  3V4G A;  1BR2 A;  2FOK A;  4WK8 F;  1IN6 A;  2F5C A;  4C2U A;  4LIT A;  1VQL I;  1ZLK A;  3L1P A;  2M0C A;  2E7X A;  3JR9 A;  4CGZ A;  1EKE A;  4A3G J;  3RPU A;  3GXO A;  5K5R A;  1Z9C A;  3CC4 I;  1IRX A;  5J8F A;  1UHM A;  2LY2 A;  1MMG A;  2Q0O A;  3SZT A;  3OIP A;  4PUS A;  4Q4Z F;  1JJ6 C;  1X1C A;  1MDM A;  2O61 A;  1OCT C;  2JRT A;  4BQQ A;  5HOD A;  4IOC F;  2XF6 A;  2E60 A;  1SMT A;  1YFH A;  3KYC B;  4Y3O A;  1ETQ A;  1ERD A;  2ESN A;  2QQ9 A;  4UVA A;  1U5T B;  3FDY A;  3ZN1 A;  3I59 A;  3LMM A;  3IWZ A;  3OIO A;  2RDP A;  1AKH A;  1FIA A;  5L3D A;  5FD6 A;  2Z9O A;  3QPL A;  5KK1 A;  2LYC A;  3RI4 A;  2PJR A;  2MD5 A;  2LBF B;  5LGN A;  3EYY A;  2Z99 A;  2M8E A;  4BEH A;  2KT0 A;  3GO5 A;  4BNC A;  5BNG A;  4AYB N;  4XLE A;  4ZTJ A;  4EJV A;  3HM5 A;  4L5E A;  2OZU A;  2FA5 A;  4E7S A;  3CZ6 A;  1K6O A;  4BJ6 C;  3R61 A;  2HVR A;  3AL0 C;  1YS7 A;  4EJW A;  2EQR A;  4A3D J;  2CU7 A;  2BV6 A;  4MHG A;  3TO6 A;  3VYU B;  4W1U A;  2HNH A;  3B6A A;  3GZ6 A;  3K4M A;  2O7O A;  4PJJ A;  4HST A;  3VSK A;  2M5W A;  4E7J A;  4BHB A;  4XSX F;  5FRM A;  1SFX A;  4YEL A;  4BHP A;  3RQ4 A;  2KIF A;  1Y1V J;  2XPV A;  2Z5U A;  1FMV A;  4IHY A;  3K1N A;  3P7N A;  3U1D A;  3E3V A;  5F0H A;  2EH3 A;  2UZK A;  3HHG A;  2LRE A;  3SZP A;  3H35 A;  4I99 C;  3NWS A;  3RYP A;  3S1R J;  3FHZ A;  4M6Y A;  2BBY A;  4QWQ A;  3CQZ J;  3PIO F;  3Q9S A;  1LE8 A;  2PJP A;  2P4W A;  2GOX B;  1PYV A;  2DFH A;  2PQ8 A;  2L7Z A;  2OZ6 A;  3KLN A;  3M1C A;  1E0E A;  2KIM A;  2VPR A;  1K6Y A;  3PQJ A;  1BC8 C;  2CV1 A;  3KEQ A;  1B1B A;  4LK1 F;  1QA6 A;  2DPD A;  2XAU A;  3LSH A;  2EIM H;  3DU5 A;  3KZY A;  4PJN A;  4BH9 A;  4BXF A;  3RKQ A;  3KP4 A;  3FK6 A;  5KAI C;  1W0U A;  4GO1 A;  3OYM A;  1TBX A;  4BU2 A;  3ASO H;  2X6X A;  2ZBK A;  4WXC A;  2G0E A;  3M8E A;  1IUF A;  5D5V B;  2ECB A;  1JHF A;  1LQ1 A;  4NQW B;  3HL2 A;  2ID6 A;  2X85 A;  2MVT A;  1S8N A;  3NAR A;  2E1C A;  4HNT A;  3RSN A;  3S93 A;  2DK5 A;  3Q5F A;  1N75 A;  4YFX F;  3OYJ A;  1X2N A;  4XLH A;  4X0G A;  1IDZ A;  2F48 A;  2ETH A;  2OCE A;  3AG1 H;  1KON A;  4IPA A;  2ZME B;  3E6B A;  4DBQ A;  1TC3 C;  1BL0 A;  3VDX A;  5JLX A;  4C3I J;  3BR2 A;  1XPX A;  3Q3S A;  3GLX A;  5E3L A;  4ZC3 A;  3SFZ A;  2DYR H;  5AIP A;  2FU4 A;  1FOW A;  4N9H A;  1GHC A;  1BI0 A;  2X4H A;  2QM3 A;  3TMO A;  4RB3 C;  1DGR M;  2H1K A;  2BY2 A;  3L7W A;  1T08 B;  3OYC A;  2QQ8 A;  4A3B J;  3KX2 A;  2XGD A;  3H3Z A;  2A5Y B;  2HOT A;  4HRI A;  1S6L A;  3HXL A;  2ECC A;  4Y15 A;  4XLP F;  3CDH A;  1R22 A;  1LFB A;  1TW3 A;  2LP0 A;  3F6V A;  4B4C A;  4KIT B;  4HQE A;  3F8M A;  2CW7 A;  1WWX A;  4MFD A;  4E4H A;  4GYG A;  3JRE A;  1A31 A;  3GTM J;  3CTA A;  1X19 A;  2MLK A;  1RC9 A;  1JGS A;  2JSC A;  2KPM A;  1JUP A;  3EUH C;  5GAH J;  5H6Q A;  2ZNY A;  4G9Y A;  4A69 C;  3WTT C;  1ZQ3 P;  3SQN A;  5GAD J;  1I6H J;  3LAJ A;  4ZYH A;  4IOA F;  3I71 A;  4WX9 A;  3LQQ A;  4A0X A;  4RDU A;  5K7F A;  3PIP F;  2GOM A;  1RRJ A;  5L3E A;  2W7N A;  5F04 A;  3RDI A;  4L0Z B;  4XOP A;  2GXA A;  1I3A A;  4MQV A;  5TIS C;  1WJE A;  4XKW A;  4A5M A;  2HXI A;  4II3 A;  4XLN F;  1HCR A;  1Z7L A;  3A0B C;  3OYD A;  2GXG A;  2KQR A;  1BIA A;  5E8I A;  4G94 A;  3UR3 C;  1N25 A;  3GTG J;  4ZTF A;  3ULQ B;  3GUD A;  2P7V B;  1MBE A;  4V19 K;  1W36 D;  3WGI A;  4N0B A;  1HSJ A;  3FXM A;  1T39 A;  4J00 A;  1T33 A;  4MEY F;  4JX6 A;  2VT2 A;  1R1T A;  4LLN A;  2O6G E;  2VON A;  3IKT A;  6PAX A;  1WJD A;  2IP2 A;  1FYK A;  1HXD A;  3D0S A;  1OFC X;  5M3F J;  4CYC A;  3ZP5 A;  2O03 A;  4XID A;  3WU0 A;  2QBY B;  3BT9 A;  1TWF J;  2STW A;  3R0A A;  3I56 I;  1FTZ A;  3BTL A;  5FFX A;  1PUF A;  4CCL A;  2XC7 A;  2X0L A;  3SJM A;  4AID A;  1BR4 A;  5JI6 A;  5LGT A;  2XKO A;  2X98 A;  1TNS A;  4XNF A;  3H9G A;  1IAW A;  4HG2 A;  5HLG A;  2KDO A;  3PFY A;  2L9V A;  2DFE A;  3CCV I;  1U2W A;  1OIS A;  1XGM A;  4CCN A;  2D2W A;  2A6T A;  2DK8 A;  2NVY J;  2YPR A;  4J19 A;  5J8C A;  3GBG A;  4QPO A;  2R7S A;  5HS7 A;  3R4K A;  2E1N A;  2EJR A;  4JYK A;  5K7H A;  5LHI A;  5HDK A;  2L9S A;  1BA5 A;  1JT0 A;  1DP3 A;  4BDY A;  4A93 J;  4UB8 C;  1XC5 A;  2JRM A;  3ZQ7 A;  4QLC U;  4HSR A;  2KFD A;  3J7A O;  3F0C A;  2DA6 A;  3BR0 A;  5HVQ C;  4ANJ A;  3LSR A;  5D5W B;  2DA3 A;  3PO3 J;  3IKV A;  1A6Q A;  3WE2 A;  1G3Y A;  1LB2 A;  2QKM B;  3F8B A;  3MKL A;  3G6E I;  3CO7 C;  1Y6I A;  5B3S H;  4IEJ A;  4XON A;  5HS9 A;  1UHS A;  4HYE A;  5E18 F;  1IJW C;  4LG0 B;  3FF5 A;  4PSX A;  3CUQ A;  1QPM A;  4IQ4 A;  2ISY A;  4CH7 A;  3HOZ J;  2HTJ A;  1JTY A;  2D1V A;  2Y75 A;  5HLT A;  4BQO A;  4BJT A;  3V8L A;  3MZY A;  5J1U A;  1TWH J;  1UMQ A;  4CA0 A;  5EG0 B;  4HF1 A;  3CJN A;  3LA7 A;  4M71 A;  3DPT A;  2L7F P;  2JVH A;  3CP8 A;  2F4I A;  4BGD A;  4NC6 A;  2K3P A;  1QZZ A;  3T8T A;  4ENN A;  1DU6 A;  4EJU A;  2ZB9 A;  3HGG A;  1XN7 A;  1IO2 A;  1XMA A;  2DA2 A;  3I4N J;  3LFU A;  1SAX A;  4N9I A;  3IHU A;  2K9N A;  4BKX A;  2UV1 A;  3FXL A;  2O8X A;  5ILS A;  1LFP A;  2IA1 A;  1Q1V A;  3F3X A;  1MNM C;  2K85 A;  4Q48 A;  3GYH X;  1MND A;  1XX5 A;  3HOT A;  1IRG A;  4IO9 F;  1IUY A;  1OYW A;  4XR6 A;  4D1Q A;  5DD8 A;  2DFI A;  3K10 A;  3K9T A;  4RB2 C;  3BDD A;  1FEX A;  5FLX R;  2H6B A;  2WY7 Q;  2XPU A;  1UHW A;  3VPR A;  2X48 A;  4U7B A;  3VFZ A;  4F7Z A;  1WJF A;  2BE5 F;  2K4B A;  2OJE D;  5HNH A;  2WC2 A;  4BDZ A;  1S3J A;  4Z2Y A;  5EDN A;  2UUZ A;  3U1K A;  2LKS A;  4HF0 A;  5CQE A;  4MIM A;  3J81 Z;  5IYC J;  3SFI A;  1A36 A;  3FBI B;  1R36 A;  3DKY A;  2ZO4 A;  2COM A;  2RNJ A;  3IRR A;  5HDG A;  1TW2 A;  1O3Q A;  2OV7 A;  4O3M A;  4D7N A;  2MFZ A;  4LD5 A;  1F36 A;  2D1H A;  1P4W A;  2WB1 N;  3S1Q J;  1SD4 A;  3DEE A;  3I58 A;  1RR7 A;  1E3O C;  2EV5 A;  2M3A A;  4CIC A;  2R5Z A;  1Y39 A;  5IPA A;  4IVN A;  3ERE D;  1Z7U A;  3CCR I;  3V42 A;  1LE8 B;  4A0Y A;  1OCO H;  4ITV A;  3BQY A;  4KIG A;  5A2Q Z;  3S3O A;  1P7J A;  2LTP A;  5ICE A;  4A6D A;  2BW3 B;  2B7E A;  2N8G A;  4ENK A;  2MH9 A;  2VOD A;  4YRV A;  2RVC A;  3FKI J;  4OMZ A;  4AIJ A;  2LKX A;  3OS2 A;  1QU3 A;  2JJ7 A;  4CCJ A;  5IOY A;  2Y0S N;  1LEB A;  5J40 A;  1U9O A;  1R58 A;  1HKT A;  4OAY A;  5GAG J;  3WG7 H;  4FX0 A;  1T38 A;  4DYC A;  3IH3 A;  1Y8Q B;  2PMZ N;  5FRO A;  3QRF F;  4MTD A;  3AAF A;  2P8T A;  4ZZD A;  3M8F A;  4Y33 A;  3GTL J;  5IY5 H;  4Q5S F;  2HKO A;  1O3S A;  4IHS A;  4A3E J;  2XHK A;  2HU9 A;  2EIN H;  1EV7 A;  5FKN A;  2WV0 A;  2VL8 A;  2LOO A;  3M3Y J;  1V54 H;  1LDD A;  2M30 A;  1FOK A;  4BE1 A;  1IV8 A;  5FO5 A;  2IGM A;  2QVO A;  3DTI A;  3FX3 A;  4KJZ A;  3WOD F;  4EJT A;  1M1E B;  2YR2 A;  4XKV A;  2STT A;  1T6S A;  2L54 A;  3FIS A;  4CCO A;  4BBS J;  4IHT A;  1P92 A;  4ESJ A;  2PI0 A;  2NVT J;  3ERM A;  1QRY A;  3HHH A;  3V8K A;  2DOD A;  1LNW A;  1IN8 A;  2XB0 X;  5CVR A;  3S1N J;  2KLO A;  3H9Q A;  1KQ0 A;  1MZB A;  1B8I A;  3E0J B;  3PO2 J;  4A12 A;  5CYV A;  5CLS A;  1YW8 A;  2Y9Z A;  4LGW A;  2LFB A;  1IGN A;  5DCM A;  4A5N A;  1N77 A;  5EF6 A;  2GAU A;  1Y0N A;  3VYT B;  3E97 A;  1NK2 P;  3WHB A;  3E6M A;  3LQR A;  3QYF A;  2K7L A;  2F5V A;  4IKF A;  2FUG 2;  1D0Z A;  2K86 A;  4EM2 A;  1TL8 A;  1TT0 A;  3BJ6 A;  4FE4 A;  1X4O A;  3COA C;  1ZR2 A;  3EQL F;  2QQA A;  1JUM A;  2M4G A;  2M4K A;  5EZG A;  2CUE A;  4Y4R A;  4A6E A;  3HOU J;  4ZYG A;  2R7U A;  4OOI A;  3U2R A;  1FTT A;  2HQR A;  1FBU A;  3DEW A;  1E3H A;  3KPH A;  2LLK A;  3K4N A;  3HSE A;  3HG9 A;  1K79 A;  1EH8 A;  2XPW A;  2Y30 A;  2Z33 A;  3P5J A;  1F43 A;  2OC6 A;  2NVU B;  2Z3Y A;  2QYO A;  3BOQ A;  2NVQ J;  4XBF A;  1J7K A;  2ZNZ A;  2ACJ A;  2GBY A;  4HX7 A;  3OOU A;  5B1A H;  2ZFW A;  1C0W A;  1FBQ A;  4F91 B;  3VWB A;  2MZ4 A;  3EDP A;  2IBD A;  1XMX A;  1XTA A;  3LSK A;  4XSZ F;  5D6F A;  1NG7 A;  3CCL I;  2PG4 A;  4ZH4 F;  3M1E A;  2E2J J;  1D0X A;  1MMD A;  2R4G A;  3PNT A;  2DXI A;  2E35 A;  3H5R A;  3JW4 A;  3EPZ A;  1FT9 A;  4EGY A;  3ABK H;  2OBP A;  3GF2 A;  2E5N A;  1GT0 C;  3J81 K;  1ZGJ A;  5K7Z A;  3REO A;  2QBY A;  3K70 C;  1DUX C;  1DDN A;  1A04 A;  1YW7 A;  4CZZ A;  2VQG A;  4P1W A;  3TGN A;  2NOG A;  3K0L A;  4DOZ A;  3OYL A;  1X1P A;  4IHV A;  1ZTR A;  1K4S A;  3MKW B;  2KKO A;  2DMN A;  1S9H A;  2IGK A;  3KZI C;  4HLY A;  3CO6 C;  3ASN H;  1S7O A;  3K69 A;  5E3M A;  1B9N A;  2R7D A;  4XKB A;  3L2W A;  4M3B A;  1RET A;  1HOM A;  1LVA A;  1G3S A;  4RA2 A;  3M7G A;  2DA1 A;  3GFJ A;  4AC0 A;  2XUB A;  2FBI A;  1DPU A;  5C4J J;  4MFE A;  2M9H A;  2JWT A;  2R5Y B;  1JJ8 C;  5ICF A;  2JN6 A;  4LB6 B;  1YRN B;  2MBF A;  3B02 A;  4C2T A;  1V5E A;  3DPU A;  1I50 J;  1CQT A;  4S04 A;  1ZG5 A;  1KU9 A;  3OYI A;  2AQF A;  3NAU A;  3O8H A;  5JR3 A;  5KHD A;  2HVQ A;  5LEK A;  2M7A A;  3ABM H;  4AWX B;  3OYN A;  2WAE A;  4LOC A;  3PUB A;  4F93 B;  2VKH A;  2AXL A;  2G7H A;  3W6K B;  2RQP A;  1W5T A;  3ABU A;  4DGW B;  1I39 A;  3OIQ A;  5LBQ A;  3KP7 A;  2VI6 A;  1HKQ A;  1ZG3 A;  1TWG J;  5C44 J;  1XCV A;  4BEH B;  1K61 A;  1HA8 A;  1IDY A;  2R7Z J;  1WFX A;  1WRJ A;  2ZJ2 A;  1TWA J;  2HYG D;  1R4M B;  3GFM A;  3L2V A;  2EZK A;  2P81 A;  3OYK A;  4BQA A;  3H3V K;  3TW7 A;  1POG A;  1TT5 B;  4UV8 A;  1JTX A;  1B72 B;  3HBL A;  4BS9 A;  1GXP A;  2JQ7 A;  2JA6 J;  2DJN A;  1NG6 A;  4V2G A;  4JX5 A;  3DQV C;  3F8N A;  2OQG A;  4IX7 A;  3WTX C;  4BUP A;  2LMD A;  3IUO A;  2ZME C;  1WJA A;  2IVM A;  3H0D A;  1QHG A;  1V55 H;  4D9J A;  3SYT A;  2VBX A;  2DA4 A;  3K4J A;  2VBW A;  5H2F C;  1L0O C;  2KRC A;  1NH3 A;  4UXN A;  2HVS A;  3S2H J;  5D4R A;  1FOY A;  4I0B A;  1X3U A;  5LD2 C;  3NRV A;  2K3F A;  4M9Z A;  3HOW J;  3FXQ A;  2CUF A;  2L2O A;  4A3J J;  1ULY A;  4LLL A;  2H94 A;  3T5X A;  2CV2 A;  2XSD C;  3BJO A;  2HOE A;  2H27 A;  1AOY A;  4L9V A;  1WH7 A;  3BZK A;  4PCQ A;  3MEX A;  1WH5 A;  3CCS I;  2DT5 A;  2ICW G;  3CMM A;  2KP6 A;  4EQQ A;  3JTH A;  2R7R A;  1YIT I;  2EB7 A;  1FNN A;  4G7O F;  4MTE A;  1JHH A;  4LMY A;  5FKL A;  1XSV A;  3WTZ A;  1O7L A;  4E7I A;  4PJL A;  4FHT A;  1A35 A;  2L5Q A;  3MN2 A;  2X1E A;  1JE8 A;  4AIK A;  4RB0 A;  5EGO B;  2IGN A;  3DV8 A;  1EJ9 A;  3ROU A;  4D7M A;  2HOA A;  3F22 A;  5DD4 A;  1BI1 A;  1JT6 A;  1XDS A;  3E6C C;  2QA4 I;  1E2X A;  1HLV A;  4HNU A;  2XKP A;  1S5L C;  5TRD A;  2UXN A;  4KN7 X;  1OJL A;  4AM3 A;  2L9R A;  3J81 R;  2R92 J;  1PVE A;  4B8X A;  3ONQ A;  1IG7 A;  3S3N A;  1OCC H;  1ZHF A;  5D8L B;  5LHH A;  4LFU A;  4BAC A;  4YFK F;  4C30 A;  3V7C A;  2MG4 A;  1PDN C;  4HOB A;  1X3W B;  1T56 A;  4OWR B;  5L3G A;  4H0E A;  5F6F A;  1LUJ B;  2RGV A;  3ZMU A;  2VLA A;  1BI3 A;  4LB5 A;  1FP1 D;  1SD7 A;  1B9M A;  1QHH D;  3I9V 2;  5EEG A;  2ADU A;  1BOA A;  4DNC A;  2ZJQ F;  3F23 A;  1FYL A;  5BPI A;  2OPT A;  1MBH A;  2DN0 A;  3LWF A;  3SDB A;  4UVB A;  1P4A A;  1RKW A;  1U5T C;  2Y0S A;  1K83 J;  4UB6 C;  1H8A C;  3ZPL A;  4E6K G;  3K2A A;  1OYY A;  4EEF G;  1PUF B;  5GAE J;  1YLF A;  2K9M A;  2P7C B;  1U8B A;  3H5A A;  3BCA A;  4QTR A;  1ETK A;  1SEU A;  3IH2 A;  4M9X A;  3JSP A;  4M73 A;  2FX0 A;  4CDG A;  2TRT A;  1I1S A;  1FY7 A;  3MKZ A;  1J75 A;  4I7H A;  2W82 A;  2Z1D A;  4NUB A;  3SHF A;  5EJC A;  3WGG A;  5IYB J;  4UVC A;  4XOR A;  2PJR B;  4ASN A;  2Y2Z A;  2Y31 A;  2QSG X;  3IH4 A;  2LSO A;  5A2Q K;  1B8I B;  3J7Y J;  4DYR A;  2WAQ N;  4LG3 A;  3JRA A;  4B44 A;  1WSU A;  3BLY A;  1JGG A;  3ZMS A;  1T95 A;  3QPT A;  4B09 A;  5HDN A;  3J80 K;  3PL8 A;  3CF2 A;  2IPQ X;  1G6N A;  2V7F A;  4I01 A;  2GWR A;  2MH2 A;  3KP5 A;  2VN2 A;  4FAS D;  2RN7 A;  3R6S A;  5C3E J;  1VQ8 I;  2GA2 A;  2IS2 A;  2ESH A;  3FMS A;  4QSH A;  2YSR A;  2UWM A;  3MFK A;  2FF4 A;  1Z67 A;  3MZ8 A;  1ZRF A;  3IL2 A;  2X51 A;  1J0R A;  3RIR A;  1OKR A;  1GUU A;  1R5H A;  1W5C C;  1WHU A;  2W4S A;  3WG9 A;  2QZ8 A;  2DDB A;  3HOV J;  1Z0X A;  3G1M A;  2EPF A;  1D1B A;  3ZQH A;  4A3L J;  3OYF A;  1WPK A;  4CUG A;  1YX5 A;  2DQL A;  5GPC A;  1WJC A;  3QPS A;  2YX7 A;  1YJW I;  1GXQ A;  3NWT A;  2LF8 A;  1YQA A;  1DGW Y;  3QP5 A;  3TO9 A;  1K4T A;  2JPC A;  4A3K J;  1J5Y A;  2GA1 A;  2PMZ A;  3E1S A;  2E1M B;  2F2E A;  5DS9 A;  2P6T A;  3A01 A;  3S14 J;  1OQY A;  4HLX A;  1ACI A;  5L3B A;  2NRA C;  1WCM J;  2KJB A;  2COB A;  1XG1 A;  1VTN C;  4BXX J;  1MNE A;  2OUM A;  1DQU A;  4R8H A;  2V9K A;  2LNB A;  2GXB A;  3G1O A;  2CG4 A;  4EMS A;  5BMZ A;  3QU6 A;  4V2F A;  3BTC A;  3F8C A;  3N05 A;  1MW7 A;  1G8X A;  3DWL E;  1IN5 A;  2EIL H;  3HJE A;  2L4M A;  2MC3 A;  4B43 A;  4M3F A;  2V26 A;  3CUQ C;  4G7H F;  3H36 A;  5E20 A;  1VQ9 I;  1VQO I;  1BIB A;  2OTL I;  3LSG A;  1UFM A;  1LVK A;  2H09 A;  3ABL H;  4F52 A;  3HPG A;  2RAE A;  2DDA A;  4UV9 A;  3DBR B;  5J47 A;  1OCP A;  4DYQ A;  1ON2 A;  4ENM A;  2KHM A;  4E70 A;  2QSH X;  1P7I A;  3WTY C;  2I10 A;  3HYI A;  3DKX A;  1W36 C;  1AWC A;  4N4N B;  2E7W A;  4S05 A;  4GDF A;  4CSW A;  3G3Z A;  2RQQ A;  2X6O A;  2CW0 F;  4KMF A;  2CW8 A;  3CJT B;  5E3N A;  2RNG A;  3CLO A;  3ZGK A;  2BXZ A;  5BS6 A;  1RUN A;  1VQ4 I;  3BTI A;  3ZMT A;  2HYJ A;  1ZK8 A;  1CF7 B;  2V79 A;  4ZDP A;  1G3T A;  3KYD B;  2DI3 A;  3BZC A;  2LBF A;  1LDJ A;  3IWF A;  5HS8 A;  1LKX A;  3ECH A;  4C2M J;  2DU9 A;  3ISP A;  2XF7 A;  1D1C A;  5E1Z B;  1LPQ A;  1GV5 A;  1OR7 C;  1HQC A;  4I0A A;  2QQB A;  2M8G X;  3VEP A;  4BBR J;  1U9N A;  1T2K A;  5K1Y A;  2ZKZ A;  1ZEL A;  3QYE A;  1YYV A;  1MH4 A;  3K1P A;  5ICG A;  5LLQ A;  1TLH B;  2YS9 A;  4M6X A;  5D8K B;  1XB4 A;  1S7E A;  2E1M C;  4CXF A;  3K4C A;  4RB1 A;  2FNA A;  1PUE E;  1FLI A;  1KZH A;  2A05 A;  3L2C A;  2V9P A;  2HWV A;  2QUF A;  3RKX A;  4CHU A;  4PFO A;  4JQF A;  3DXJ F;  4L18 B;  2CRG A;  3HSR A;  2ZCW A;  3JRH A;  5TGT A;  2A07 F;  1ITY A;  5D6E A;  4UUS A;  2DYS H;  1VQK I;  1STZ A;  1IF1 A;  2DLL A;  4JOM A;  2MLG A;  1UG2 A;  1WKM A;  3BCB A;  1U0J A;  2XSJ C;  2WY8 Q;  3QU3 A;  4CYD A;  2OA4 A;  2O5R A;  3TED A;  3BWG A;  3BP8 A;  3HRU A;  3EET A;  3BY6 A;  3LNQ A;  2D45 A;  1R1U A;  2JA2 A;  5D5X B;  5EGO A;  3CLQ A;  2E19 A;  1MBK A;  1UJ8 A;  1V3F A;  3OS0 A;  2DFF A;  4UY8 I;  2KJC A;  2VOP A;  1K7A A;  1ETX A;  3EUH A;  4XOT A;  3UNG C;  5DTD A;  1RQ6 A;  4EM1 A;  4F92 B;  3OS1 A;  3TDU C;  2HGC A;  4ETS A;  3CMY A;  1X3Z B;  1Y56 A;  2NAZ A;  3C1D A;  1ZG1 A;  2FBK A;  1QNT A;  2BW3 A;  2RRE A;  3U9G A;  1XD7 A;  4AVZ A;  4M74 A;  4ZJZ A;  2A68 F;  2QEN A;  1LJ9 A;  1R5G A;  2ZXW H;  4WF2 A;  2PLY A;  1SD5 A;  2L7M P;  1WGX A;  3VSL A;  3LA2 A;  3C2H A;  3HGY A;  3I0T A;  1V4R A;  2Q2E A;  5F1J A;  3IAS 2;  2DOE A;  4RLQ A;  1WZ2 A;  1ETO A;  3JAM K;  1TWC J;  1HC8 A;  1D8J A;  1D3Y A;  3RPU D;  1BM9 A;  3FXK A;  3LA3 A;  3KYL A;  3HOS A;  3B6C A;  4KMU X;  3A52 A;  3HC7 A;  2VQL A;  2HPI A;  3FMR A;  1S29 A;  5DV5 A;  5LRR A;  3C3W A;  3BR3 A;  3G71 I;  1YOV B;  2PBI A;  2L0K A;  3GX4 X;  4DZJ A;  3FK7 A;  2BVM A;  4IL6 C;  3ESW B;  2EA4 A;  2RC4 A;  4PSW A;  3KP2 A;  1VQM I;  1JKQ C;  1FIP A;  3GEZ A;  1MMN A;  4YFN F;  1IN7 A;  2Q1Z B;  2EZH A;  3L2Q A;  3LSJ A;  1LDK B;  2PEX A;  4BE2 A;  4WXD A;  5CQG A;  2LKP A;  1ZAR A;  2JT1 A;  1BR1 A;  2I8D A;  2VJ5 A;  3ZRG A;  5LFA A;  3L2U A;  2A5W A;  3DPL C;  2LY9 A;  4KUM A;  2JPB A;  1X58 A;  3OSG A;  2LH9 A;  1IRZ A;  3JRC A;  5DUK A;  3GFI A;  1WQ2 A;  2AXT C;  2XRL A;  5IP6 A;  4M3E A;  1SFO J;  3CCU I;  2L7K A;  1R4N B;  4R79 A;  4P9U A;  2ZJP F;  1HDD C;  3HEF A;  4XLA A;  2EV6 A;  3A03 A;  2ME6 A;  5DM7 F;  2DAO A;  5HOO A;  1A5J A;  4BE0 A;  3CME I;  2F4M B;  5LEJ A;  3S3M A;  4FTH A;  2KRH A;  5FLX K;  5D5U B;  3ECO A;  3H3U A;  1TQI A;  2LF7 A;  4GCV A;  5IOZ A;  4XKC A;  2VXD A;  3BG9 A;  3DTK A;  2EFQ A;  1Q1H A;  4XRS A;  3ZR8 X;  2OTJ I;  2MAB A;  5F1R A;  2R7V A;  1HDP A;  2E36 A;  5JLW A;  4FIS A;  3BRO A;  5E1W A;  2FJ1 A;  3KE2 A;  2K4J A;  2O0Y A;  4RGU A;  1YW9 A;  2KMU A;  3LL7 A;  4NHJ A;  1FC3 A;  1W4M A;  5J3L A;  2J5O A;  3MWM A;  3TOA A;  3FXJ A;  1XDU A;  1W1W E;  4YG2 F;  2VQC A;  2V6E A;  4OIQ F;  2VQH A;  1FYM A;  3OMY A;  5ICC A;  2MSY A;  2FRH A;  2CFO A;  3DBH B;  3HRT A;  1P2F A;  5IP7 J;  4KDP A;  3M07 A;  1YE9 A;  3ZXS A;  2BY3 A;  4IF4 A;  4ZDL A;  3G2B A;  3IP4 B;  2HEO A;  3L00 A;  2K02 A;  1IW7 F;  1ON1 A;  5M5W J;  1FJL A;  4YII A;  1OCR H;  4PZJ A;  3DLL F;  4B3X A;  2R3S A;  5BPD A;  1W7P A;  3JRB A;  2JK3 A;  5GTI C;  3FXR A;  3O8G A;  5FGM A;  3K6G A;  5J6X A;  3H0G J;  5F27 A;  4OAZ A;  3BR1 A;  4OMY A;  3A1Y A;  1IRF A;  1KU2 A;  1ZGA A;  2DJI A;  2L01 A;  2VB6 A;  4HW0 A;  2JVG A;  4GXO A;  2JA8 J;  1FWZ A;  3TW6 A;  2VT3 A;  1P9Q C;  3WGH A;  3K1M A;  3BR5 A;  1XGO A;  1HF0 A;  2ELH A;  3WHC A;  3WE3 A;  2ELJ A;  2HZD A;  2W1O A;  4Y13 A;  1UG0 A;  4A3F J;  3KEY A;  3OV8 A;  1KA8 A;  1F4K A;  4DW6 A;  4FCY A;  1W0T A;  3CJR B;  4P96 A;  2F6C A;  1VQ7 I;  3FIW A;  2XVC A;  3OYG A;  1X1A A;  5CJ9 A;  4F55 A;  2JA7 J;  5L3C A;  2IS6 A;  2K27 A;  2MA3 A;  1YX3 A;  5GTH C;  2Y9Y A;  3ML6 A;  2LC2 A;  3MVP A;  3C2B A;  4PJM A;  4RGX A;  2GIZ A;  4MGR A;  4JX4 A;  4KIS A;  3OYB A;  2DTR A;  4HV5 A;  1J9I A;  4P55 A;  2C6Y A;  2QKL B;  1WVR A;  4EJO A;  3ZQI A;  2HKX A;  2FXA A;  4ABZ A;  4DIQ A;  1F9N A;  1SAN A;  1RKT A;  4EAT A;  3I55 I;  2W24 A;  1UCR A;  1X2M A;  3MKY B;  5CKT A;  2P5V A;  4M72 A;  5KAF C;  1YTY A;  3KIO A;  4HF2 A;  3VYS B;  3KET A;  2NNY A;  2VJJ A;  4YIF A;  1Z3Y A;  1HBX G;  5FKM A;  1ZRE A;  4HPQ A;  2EFP A;  4RGS A;  3I5U A;  3BPV A;  1D8K A;  2CQX A;  2ISZ A;  2WTE A;  4G12 A;  1OYI A;  2HDD A;  4Q47 A;  4XN0 A;  2BHZ A;  2V1X A;  3M9A A;  1R71 A;  4IQJ A;  1TP4 A;  2X6Y A;  2Q8K A;  5EEA A;  5CVV A;  3FM5 A;  5B66 C;  4KIC A;  2CMP A;  4JK1 X;  2IS4 A;  3K7A J;  5M3M J;  4CCM A;  3IAM 2;  1FX7 A;  2GQQ A;  3I59 B;  2M34 A;  2AHQ A;  2O8K A;  2KIU A;  2L02 A;  4LIV A;  3P9C A;  3PM1 A;  5CVU A;  5AON A;  5K5Q A;  1FSE A;  1BN5 A;  2A6H F;  4NC7 A;  5FLV A;  2E1O A;  5JFR A;  3G73 A;  3BC8 A;  2HR3 A;  2XAG A;  3TQN A;  5A2Q R;  4PK4 A;  3T8R A;  3JRG A;  1HST A;  1P4X A;  4PGH A;  2V1U A;  5FLM J;  4KIF A;  1QBJ A;  3VOE A;  3H1C A;  1B59 A;  2FD5 A;  2PMH A;  3FKJ A;  5F0C A;  4NNJ A;  3R0J A;  2EFW A;  4I09 A;  3S1M J;  1R5I D;  3ELK A;  3MCZ A;  1V5G A;  2UXX A;  2NS8 A;  3AG4 H;  4EGZ A;  3QOE A;  2LD5 A;  3DCF A;  3U21 A;  3CES A;  3HPH A;  2VBY A;  2H1L A;  3I4M J;  2H8R A;  4XRS G;  2NS7 A;  2FQ4 A;  2LRD A;  3LOC A;  2PN6 A;  3WU2 C;  4HDV A;  1RPW A;  3G4S I;  1VQP I;  5IT9 Z;  1S72 I;  3W2A A;  3H9J A;  3VB2 A;  4IHW A;  4RS8 A;  2QLZ A;  4G7Z F;  1JXS A;  4KYW A;  2G9W A;  1G2H A;  3CC7 I;  2IGO A;  5BQT A;  2R7W A;  2DT7 B;  4RBO A;  4AYB A;  2MC4 A;  1W7P B;  4Y52 J;  2CQQ A;  2M2E A;  1RI7 A;  1GV2 A;  3E7L A;  1ZAO A;  3A02 A;  3CUO A;  3S8P A;  2HDC A;  1I27 A;  1VF9 A;  4M3D A;  3FM3 A;  2XAH A;  2XRO A;  1H9T A;  1GLN A;  1U5T A;  1REP C;  3HTS B;  5KVR A;  2CJJ A;  2DBB A;  1I1G A;  2XGE A;  3DEU A;  1Z1D A;  2DOA A;  3LST A;  3DP7 A;  4HEA 2;  3FMQ A;  5ILU A;  2EFN A;  2MYS A;  3KZZ A;  4G6T B;  3BJA A;  3BG5 A;  3CJQ B;  2OQR A;  4UNO A;  2CYY A;  3J7A Y;  1KQ8 A;  1IZ1 A;  1IXR C;  1VQ5 I;  1MIJ A;  4XRF A;  1JI8 A;  1IXC A;  1ZRD A;  3RZD J;  2P5K A;  4NBQ A;  4RGR A;  3MQ0 A;  4M3G A;  3KFW X;  2ZSI B;  1APL C;  2DW4 A;  5DM6 F;  2CUZ A;  4XL9 A;  4D0P A;  1BI2 A;  4PJ0 C;  2VC1 A;  9ANT A;  2HQN A;  1RNL A;  5GPA A;  4WCG A;  4OIR F;  2EIK H;  3GZN B;  4UUT A;  5DUI A;  2W85 A;  4AIH A;  1SVO A;  3WTW C;  1VFC A;  1HW2 A;  2VAS A;  4GYI A;  1QVU A;  1ZYR F;  3CC2 I;  3L9F A;  4NQW A;  4XK4 A;  2NOJ B;  1RR8 C;  4DJA A;  5KNL A;  2P0T A;  3ABT A;  4RM2 A;  2CWE A;  2K9S A;  3BG7 A;  4KN4 X;  2P5L C;  3S15 J;  1NHA A;  4MEX F;  2J5P A;  3LFK A;  3OOP A;  2KIS A;  2F4O B;  3AG3 H;  3ZN0 A;  5IT3 A;  3GTJ J;  3BR6 A;  2OCC H;  2WAQ A;  1RZ4 A;  2BVL A;  1RES A;  5HNF A;  3FXO A;  1U6G A;  2K9L A;  3S32 A;  3KP3 A;  2CV0 A;  3I4P A;  4X6A J;  1G59 A;  4BL0 B;  3MZH A;  4RLF A;  1J09 A;  3HKZ A;  2VPL A;  1QQI A;  3PUF A;  4OU0 A;  3RKW A;  2FOW A;  2ZXJ A;  3N4M A;  2A61 A;  2W84 A;  4UHT A;  1YI2 I;  3HRS A;  4B1R A;  3PSF A;  2X9D A;  1A6I A;  2HQA A;  1D0Y A;  2CQ7 A;  4HZF A;  1VND A;  2QF7 A;  2O9L A;  3OWT A;  1U3E M;  1I3Q J;  3EUK L;  2TDX A;  3DFG A;  4HAM A;  5F0F A;  4B47 A;  4ZDO A;  3CDI A;  2R7F A;  4ON0 A;  4XQF A;  4CCK A;  3ZQQ A;  5DDG A;  5AIQ A;  1FBS A;  2W48 A;  2R7T A;  4MQ9 F;  1HW5 A;  5E1X A;  3LSM A;  4MNU A;  4L9J A;  5DCF A;  5J1Y A;  1RUO A;  4A3M J;  2DA7 A;  4O6J A;  4EM0 B;  2NYX A;  1T0F A;  3F8F A;  5C4X J;  3VOD A;  2GLO A;  3WTU C;  3X2Q H;  1F1Z A;  4GFB A;  3NQO A;  4U0Y A;  3V8J A;  3QP6 A;  4OIN F;  1JUS A;  4G8X A;  1YJ9 I;  4ENJ A;  4IHX A;  1HW1 A;  2L9N A;  3LSI A;  3IV5 A;  5ERI A;  4GRI A;  3B73 A;  3H92 A;  4E7K A;  3MAJ A;  2HI3 A;  4FT8 A;  5CPR B;  3L2R A;  1Z3X A;  2KZV A;  3M4O J;  1SMY F;  2MD0 A;  3I3L A;  4P9F A;  3GLL A;  1ETW A;  3F21 A;  2JZY A;  1MJA A;  2DA5 A;  3O3K A;  2A69 F;  3DU6 A;  1ETV A;  1MMA A;  2L4A A;  4IZZ A;  4R1H A;  2XF5 A;  2R7Q A;  1H88 C;  2YUS A;  2EZL A;  1MBJ A;  3AKZ A;  1W5S A;  4L5I A;  3RTR A;  2R5Z B;  1YIO A;  2AQE A;  4KIB A;  4I76 A;  3GTK J;  2EA2 A;  1OLT A;  2JSP A;  1OCZ H;  1PP7 U;  1Y0U A;  3W6V A;  2FSW A;  1L3L A;  5JVG F;  1SFU A;  5JHF A;  3BPX A;  2ID3 A;  3EYI A;  3J7A W;  1K78 B;  4HX4 A;  3RQI A;  2WAF A;  4L9T A;  3A01 B;  1X1D A;  4CZC A;  2A6E F;  2Y48 A;  1D1A A;  3HKZ N;  3OL3 A;  4JP0 A;  3SEQ A;  2RKH A;  3WU1 B;  1H0M A;  4II2 A;  2KDZ A;  2GZW A;  3E6D A;  3W3C A;  3OYE A;  1Z6T A;  1R1V A;  1E3P A;  2G7U A;  1Z21 A;  4Y17 A;  1XMK A;  2BXY A;  2R5Y A;  4TV7 A;  2DMQ A;  3RZO J;  4Y7N J;  2MGQ A;  3O2P E;  1T98 A;  1T8I A;  2JMW A;  2IA2 A;  3V7S A;  2YU9 J;  1V5F A;  1VQN I;  2CO5 A;  3V7R A;  1FPQ A;  3CCY A;  4BQN A;  4ZZL A;  3JRF A;  4U87 A;  2XGC A;  3DKW A;  2L3D A;  2HS5 A;  2LVS A;  2FML A;  3QAH A;  3ZQC A;  4KFC A;  3K4K A;  4BHC A;  3T0Y A;  2ZME A;  1QZE A;  2IW5 A;  2V1N A;  3N97 A;  1GDT A;  2VUM J;  4X1E A;  5EEH A;  1UB9 A;  1O7F A;  3E5X A;  3ZQF A;  3D1N I;  3JRI A;  3TBI A;  2PX9 A;  3W2V A;  1PJR A;  3TP3 A;  2LG4 A;  3JTG A;  5E3O A;  1SVM A;  3MMY B;  3Q0U A;  2WA0 A;  1MSE C;  4MO7 A;  4IRG A;  4LG0 A;  3J80 R;  3F6O A;  1BBY A;  2IAI A;  2B9S A;  2HQ5 A;  2IT0 A;  4E7Z A;  1JKP C;  4WXH A;  1XS9 A;  4HNV A;  1IN4 A;  3KCC A;  3BTJ A;  1CGP A;  4U88 A;  3GFL A;  3D5R C;  3A4C A;  3L09 A;  4UUV A;  3RYR A;  1KYW A;  4G6D A;  3RCO A;  4W97 A;  4FX4 A;  1ORK A;  4S0H B;  2M35 A;  3GME A;  4JBA A;  4OIP F;  4QIW N;  3BQZ A;  2DMP A;  4AU7 A;  1D5Y A;  1GVJ A;  1R23 A;  3FZV A;  4N4O B;  4CO8 A;  3K4L A;  2HZT A;  2HOS A;  1X4P A;  3A2K A;  1N78 A;  3SDG A;  5IT9 R;  2DOF A;  5FKK A;  2HDW A;  3GTP J;  2BY1 A;  3LAP A;  3BG6 A;  2V4J C;  4NC8 A;  4K2E A;  3OSF A;  2WAD A;  2XV4 S;  3GW2 A;  3HUG A;  1IXS B;  1UZC A;  1Y1W J;  3Q9V A;  1XGN A;  2BGC A;  1BW6 A;  1WJ5 A;  3ZMV A;  4H4K C;  2B63 J;  4M6V A;  5J4Y A;  5EYR A;  2QSF X;  1JKO C;  3J7Z I;  2CS3 A;  3UKG A;  2BYV E;  3ZMZ A;  4UUS B;  1SFE A;  3CD6 I;  3K4B A;  3GTQ J;  2BOL A;  4B3A A;  2OD5 A;  1S7A A;  5D4S A;  2E71 A;  2EBI A;  3ZOB A;  3K2Z A;  1OR7 A;  1MGT A;  2YX4 A;  4XLF A;  1QZY A;  4BJ5 C;  3IRQ A;  5FD5 A;  5EG0 A;  3FXU A;  4A3I J;  2KRF A;  2MUN A;  1LFU P;  3QOP A;  3RJP A;  1ZN2 A;  5J4V A;  3PSI A;  2VBZ A;  4DQ2 A;  2DQR A;  4C3J J;  4J01 A;  3S17 J;  1KU3 A;  3PFI A;  4E7L A;  4FQG A;  4L9N A;  1H89 C;  3OYH A;  1TQP A;  3KEO A;  1LEA A;  5GP9 A;  5E79 C;  3S2W A;  2PFB A;  3TL4 X;  4U7D A;  1MH3 A;  4ZYE A;  2ZXH A;  2XRN A;  3J80 Z;  2R0Q C;  2F5D A;  2P6S A;  1DU0 A;  4FET A;  5FB2 A;  5HLH A;  1O3T A;  1ZRC A;  1J59 A;  3HIF A;  2WWY A;  1U78 A;  1BW5 A;  4A0Z A;  1MBF A;  4I98 B;  4RAF A;  5B1B H;  3CF5 F;  1DP7 P;  5LGU A;  2V1D A;  4KT6 A;  2JTV A;  3KLO A;  2ZFU A;  1MD0 A;  3AG2 H;  4M9S A;  4XN3 A;  4LLG F;  3JCU C;  5H20 A;  2DT6 A;  3IC7 A;  4AD9 A;  1IV6 A;  4KNY A;  3I53 A;  1R49 A;  3JAM Z;  2NXN B;  2A3S A;  2WBM A;  3QPH A;  4ZYA A;  3NEU A;  3DLA A;  3CCJ I;  2QWW A;  3HZJ A;  2FE3 A;  2FMY A;  4DZP A;  2W25 A;  2HPM A;  4KA4 A;  1YRN A;  5JVT A;  2CSO A;  1YS6 A;  3LSP A;  2K5C A;  4OIO F;  2QGU A;  3AFH A;  4I2O A;  3GWZ A;  2IJL A;  1NK3 P;  1R9T J;  4LIU A;  1Z77 A;  3GZ5 A;  1X1B A;  2VKE A;  1MJB A;  2VIX A;  5DCM B;  1Z6R A;  3HB9 A;  5TJJ A;  1VQ6 I;  1EH6 A;  3Q0V A;  2E34 A;  3SXY A;  4D5C A;  1BC7 C;  2KL4 A;  3CCQ I;  2BY0 A;  3E5Q A;  1I6X A;  1B72 A;  2OF7 A;  4HX8 A;  4P5O A;  3ZCO A;  1ZKG A;  1USS A;  3I64 A;  1TNT A;  1UEL B;  4CYC B;  1AKH B;  2W00 A;  1YIJ I;  4I02 A;  2XB5 A;  3F9K A;  4C9Y A;  1SVL A;  1KGS A;  2EFO A;  3OY9 A;  1CF7 A;  2AS5 F;  1MSF C;  1Z05 A;  1BJZ A;  1J2X A;  4RAG A;  2X1C A;  2VKV A;  1W7P D;  3PJR A;  4LJZ F;  4IXA A;  1VZ0 A;  4A3C J;  2VE8 A;  4ZYD A;  2GM4 A;  3JSO A;  3DTE A;  1TZL A;  2CQN A;  2B0L A;  3QYB A;  3QOD A;  2IS1 A;  3Q0W A;  2Y0M A;  2Z2S B;  1I5Z A;  3I54 A;  1TQM A;  5ED4 A;  3EUA A;  4GGG A;  1WJB A;  2BZT A;  2Y69 H;  3KP6 A;  1FOX A; 
#chains in the Genus database with same CATH homology
 1FZP B;  4RAY A;  1RIO H;  5FFZ A;  4EVI A;  2V9V A;  1OMI A;  2VXZ A;  5LHG A;  1U8R A;  3PQK A;  2H6C A;  2XGX A;  1TTY A;  1R7J A;  5DEQ A;  2M87 A;  4U0W A;  2LDU A;  5E17 F;  5IT9 K;  1B6A A;  4HQM A;  1FSH A;  3BZ6 A;  3WTS C;  1K78 A;  3P9I A;  3HRM A;  3CUQ B;  2EK5 A;  1DPR A;  5K5O A;  5CVJ A;  2O3F A;  2OAZ A;  4NB5 A;  2FEZ A;  2VOO A;  2HYF A;  2DO7 A;  5BOX A;  1G4D A;  2NNN A;  3W6J B;  1ZH5 A;  1XCB A;  1KQ9 A;  3RPQ A;  3P9K A;  3ZMD A;  2DPU A;  3C18 A;  2VC0 A;  5E8G A;  4L5J A;  1ZLJ A;  4RAZ A;  3HSF A;  3F72 A;  2FBH A;  5CVI A;  2NS0 A;  2CGP A;  1MJ9 A;  1XSX A;  4EV0 A;  4U0V A;  4KT5 C;  2F5F A;  5FLX Z;  2YU3 A;  3TDZ C;  3T1B A;  1D5V A;  5DYM A;  1WI9 A;  1OPC A;  4BYY A;  4IRI A;  1F5T A;  3RKY A;  2EV0 A;  4WWC A;  2HFH A;  5LRS A;  1UST A;  4ESB A;  2EWN A;  4ESF A;  1MDM B;  3E5U A;  1Z91 A;  2V6C A;  2M1B A;  1EH7 A;  1MKM A;  4PGG A;  2IRF G;  1PP8 F;  1XGS A;  2FQ3 A;  3TKY A;  4IJA A;  4HA8 A;  5L3F A;  1FP2 A;  2XAF A;  2IA0 A;  1QO0 D;  1B4A A;  3GVA A;  3TOB A;  4PDK A;  4G6Q A;  4L0Y B;  1P6R A;  2RV8 A;  5H6R A;  1O3R A;  2CQK A;  5JHU A;  2FNP A;  5HLI A;  3HTU A;  2F5E A;  1H9G A;  1XSD A;  2BEO A;  2VE9 A;  2PMU A;  3R60 A;  3DF8 A;  2XIG A;  1E17 A;  1YO5 C;  4BXU A;  2XAJ A;  2XAQ A;  3O6B B;  1QGP A;  1KYZ A;  1G3W A;  3WTV C;  1BJA A;  1ONV A;  2GIV A;  4A2U A;  2CFX A;  1KU7 A;  5ILV A;  3D5L A;  1ODD A;  1HKS A;  1SD6 A;  2W57 A;  3TO7 A;  4LK0 F;  1YG2 A;  3C7J A;  1R00 A;  4HDU A;  2HTS A;  5F64 A;  4IRH A;  4AVP A;  4HV6 A;  1O57 A;  4O5V A;  2XAS A;  2OU2 A;  4HBL A;  4BAY A;  3FWE A;  2M45 A;  3V4G A;  2FOK A;  4WK8 F;  1IN6 A;  2F5C A;  1ZLK A;  2E7X A;  4CGZ A;  3RPU A;  3GXO A;  5K5R A;  1Z9C A;  5J8F A;  1UHM A;  2Q0O A;  3SZT A;  4Q4Z F;  1MDM A;  2O61 A;  2JRT A;  1SMT A;  1YFH A;  2ESN A;  2QQ9 A;  4UVA A;  1U5T B;  3ZN1 A;  3I59 A;  3IWZ A;  2RDP A;  5L3D A;  5FD6 A;  2Z9O A;  5KK1 A;  3RI4 A;  2MD5 A;  5LGN A;  3EYY A;  2Z99 A;  2M8E A;  3GO5 A;  4BNC A;  4EJV A;  2OZU A;  2FA5 A;  1K6O A;  3R61 A;  1YS7 A;  4EJW A;  2BV6 A;  4MHG A;  3TO6 A;  3GZ6 A;  2M5W A;  4BHB A;  4XSX F;  1SFX A;  4BHP A;  2KIF A;  2Z5U A;  3K1N A;  3P7N A;  3U1D A;  3E3V A;  2UZK A;  3HHG A;  3SZP A;  3RYP A;  3FHZ A;  4M6Y A;  2BBY A;  4QWQ A;  3Q9S A;  2PJP A;  2P4W A;  2PQ8 A;  2OZ6 A;  3KLN A;  2KIM A;  1BC8 C;  3PQJ A;  3KEQ A;  1B1B A;  4LK1 F;  2DPD A;  3KZY A;  4BH9 A;  3KP4 A;  4GO1 A;  1TBX A;  2ZBK A;  4WXC A;  3M8E A;  5D5V B;  1JHF A;  1LQ1 A;  1S8N A;  2E1C A;  2DK5 A;  3Q5F A;  4YFX F;  2ETH A;  4IPA A;  2ZME B;  3E6B A;  3GLX A;  3SFZ A;  5AIP A;  2FU4 A;  4N9H A;  1GHC A;  1BI0 A;  2X4H A;  2QM3 A;  4RB3 C;  3L7W A;  3H3Z A;  2A5Y B;  1S6L A;  4Y15 A;  4XLP F;  3CDH A;  1R22 A;  1TW3 A;  3F6V A;  4HQE A;  3F8M A;  1WWX A;  4GYG A;  3CTA A;  2MLK A;  1JGS A;  2JSC A;  5H6Q A;  2ZNY A;  4G9Y A;  3WTT C;  3SQN A;  3LAJ A;  4ZYH A;  3I71 A;  4WX9 A;  3LQQ A;  4A0X A;  5L3E A;  3RDI A;  4L0Z B;  4MQV A;  4A5M A;  4XLN F;  2GXG A;  1BIA A;  5E8I A;  4G94 A;  3ULQ B;  3GUD A;  2P7V B;  3WGI A;  4N0B A;  1HSJ A;  1T39 A;  4MEY F;  2VT2 A;  1R1T A;  4LLN A;  2O6G E;  2VON A;  3IKT A;  6PAX A;  2IP2 A;  1FYK A;  1HXD A;  3D0S A;  3ZP5 A;  2O03 A;  3WU0 A;  2QBY B;  2STW A;  3R0A A;  5FFX A;  2X0L A;  5JI6 A;  5LGT A;  2XKO A;  1TNS A;  1IAW A;  5HLG A;  1U2W A;  1XGM A;  2D2W A;  2DK8 A;  2YPR A;  5J8C A;  5HS7 A;  3R4K A;  2E1N A;  2EJR A;  5LHI A;  5HDK A;  3ZQ7 A;  4QLC U;  3J7A O;  5HVQ C;  5D5W B;  3IKV A;  3WE2 A;  1G3Y A;  1LB2 A;  3F8B A;  3CO7 C;  5HS9 A;  4HYE A;  5E18 F;  4LG0 B;  3FF5 A;  3CUQ A;  1QPM A;  2ISY A;  2HTJ A;  2D1V A;  2Y75 A;  3V8L A;  3MZY A;  4HF1 A;  3CJN A;  3LA7 A;  4M71 A;  3DPT A;  4ENN A;  1QZZ A;  3T8T A;  4EJU A;  1XN7 A;  1XMA A;  1SAX A;  4N9I A;  3IHU A;  2O8X A;  5ILS A;  2IA1 A;  3F3X A;  4Q48 A;  3GYH X;  3HOT A;  1IRG A;  1IUY A;  1OYW A;  5DD8 A;  2DFI A;  3K9T A;  4RB2 C;  3BDD A;  2H6B A;  1UHW A;  4U7B A;  3VFZ A;  4F7Z A;  2K4B A;  2BE5 F;  2WC2 A;  1S3J A;  4Z2Y A;  4HF0 A;  3J81 Z;  1R36 A;  2ZO4 A;  2COM A;  2RNJ A;  3IRR A;  5HDG A;  1TW2 A;  1O3Q A;  4O3M A;  4LD5 A;  2D1H A;  1P4W A;  1SD4 A;  3I58 A;  2EV5 A;  4CIC A;  4IVN A;  3ERE D;  1Z7U A;  4A0Y A;  5A2Q Z;  4KIG A;  5ICE A;  4A6D A;  4ENK A;  2MH9 A;  2VOD A;  2RVC A;  4OMZ A;  4AIJ A;  1LEB A;  1R58 A;  1HKT A;  1T38 A;  4FX0 A;  3QRF F;  4MTD A;  3AAF A;  2P8T A;  4ZZD A;  3M8F A;  4Q5S F;  2HKO A;  1O3S A;  4IHS A;  2XHK A;  1EV7 A;  2WV0 A;  1LDD A;  2M30 A;  1FOK A;  5FO5 A;  3WOD F;  2QVO A;  3FX3 A;  4EJT A;  2YR2 A;  2STT A;  1T6S A;  2L54 A;  4IHT A;  1P92 A;  4ESJ A;  2PI0 A;  3HHH A;  3V8K A;  1LNW A;  1IN8 A;  5CVR A;  1KQ0 A;  1MZB A;  4A12 A;  5CYV A;  5CLS A;  1YW8 A;  4LGW A;  5DCM A;  4A5N A;  2GAU A;  3E97 A;  3E6M A;  3LQR A;  2K7L A;  2K86 A;  4EM2 A;  3BJ6 A;  3COA C;  3EQL F;  2QQA A;  4A6E A;  4ZYG A;  4OOI A;  3U2R A;  2HQR A;  1FBU A;  3HSE A;  1K79 A;  1EH8 A;  2Z33 A;  2Z3Y A;  2QYO A;  3BOQ A;  4XBF A;  1J7K A;  2ZNZ A;  2ACJ A;  4HX7 A;  2ZFW A;  1C0W A;  1FBQ A;  3EDP A;  5D6F A;  4XSZ F;  2PG4 A;  4ZH4 F;  3M1E A;  3JW4 A;  1FT9 A;  4EGY A;  2OBP A;  3GF2 A;  3J81 K;  1ZGJ A;  3REO A;  2QBY A;  1DUX C;  1DDN A;  1A04 A;  1YW7 A;  4CZZ A;  3TGN A;  3K0L A;  2KKO A;  4HLY A;  3CO6 C;  1S7O A;  3K69 A;  1B9N A;  2R7D A;  1LVA A;  1G3S A;  3M7G A;  3GFJ A;  2XUB A;  2FBI A;  1DPU A;  5ICF A;  4LB6 B;  2MBF A;  3B02 A;  4S04 A;  1ZG5 A;  1KU9 A;  5LEK A;  5JR3 A;  4AWX B;  2AXL A;  2G7H A;  3W6K B;  2RQP A;  1W5T A;  3ABU A;  5LBQ A;  3KP7 A;  1HKQ A;  1ZG3 A;  1XCV A;  1WRJ A;  2ZJ2 A;  2HYG D;  3GFM A;  4BQA A;  4UV8 A;  1GXP A;  3DQV C;  3F8N A;  2OQG A;  3WTX C;  2IVM A;  2VBX A;  2VBW A;  1L0O C;  4UXN A;  5D4R A;  4I0B A;  1X3U A;  3NRV A;  4M9Z A;  3FXQ A;  1ULY A;  4LLL A;  2H94 A;  3T5X A;  3BJO A;  2HOE A;  2H27 A;  1AOY A;  4L9V A;  4PCQ A;  3MEX A;  2DT5 A;  4EQQ A;  3JTH A;  2EB7 A;  1FNN A;  4G7O F;  4MTE A;  1JHH A;  4LMY A;  1XSV A;  3WTZ A;  1O7L A;  4FHT A;  1JE8 A;  4AIK A;  4RB0 A;  3DV8 A;  3ROU A;  3F22 A;  5DD4 A;  1BI1 A;  1XDS A;  3E6C C;  1E2X A;  2XKP A;  5TRD A;  2UXN A;  4KN7 X;  4B8X A;  1ZHF A;  5LHH A;  5D8L B;  4LFU A;  4YFK F;  3V7C A;  1PDN C;  4HOB A;  5L3G A;  4H0E A;  5F6F A;  2RGV A;  3ZMU A;  1BI3 A;  4LB5 A;  1FP1 D;  1SD7 A;  1B9M A;  5EEG A;  2ADU A;  1BOA A;  4DNC A;  3F23 A;  1FYL A;  5BPI A;  3LWF A;  4UVB A;  1P4A A;  1U5T C;  3ZPL A;  1OYY A;  1YLF A;  2P7C B;  4M9X A;  3JSP A;  4M73 A;  4CDG A;  1I1S A;  1FY7 A;  1J75 A;  4I7H A;  3SHF A;  3WGG A;  4UVC A;  4ASN A;  2LSO A;  5A2Q K;  1WSU A;  3ZMS A;  3QPT A;  4B09 A;  5HDN A;  3J80 K;  2IPQ X;  1G6N A;  4I01 A;  2GWR A;  2MH2 A;  3KP5 A;  2VN2 A;  2RN7 A;  3R6S A;  2GA2 A;  2ESH A;  3FMS A;  2YSR A;  2UWM A;  3MFK A;  2FF4 A;  1ZRF A;  3IL2 A;  1J0R A;  3RIR A;  1OKR A;  1R5H A;  3WG9 A;  2QZ8 A;  2DQL A;  2YX7 A;  1GXQ A;  2LF8 A;  1YQA A;  3TO9 A;  3QP5 A;  2JPC A;  1J5Y A;  2GA1 A;  2F2E A;  2P6T A;  4HLX A;  5L3B A;  2NRA C;  2KJB A;  1VTN C;  4R8H A;  2LNB A;  2GXB A;  2CG4 A;  4EMS A;  5BMZ A;  3QU6 A;  3F8C A;  1IN5 A;  2L4M A;  2MC3 A;  3CUQ C;  4G7H F;  5E20 A;  1BIB A;  1UFM A;  2H09 A;  4UV9 A;  1ON2 A;  4ENM A;  4E70 A;  3WTY C;  3HYI A;  1AWC A;  2E7W A;  4S05 A;  3G3Z A;  2CW0 F;  4KMF A;  3CLO A;  1RUN A;  5BS6 A;  3ZMT A;  1CF7 B;  2V79 A;  1G3T A;  2DI3 A;  1LDJ A;  3IWF A;  5HS8 A;  3ECH A;  2DU9 A;  3ISP A;  5E1Z B;  1HQC A;  4I0A A;  2QQB A;  3VEP A;  1T2K A;  5K1Y A;  2ZKZ A;  1YYV A;  5ICG A;  3K1P A;  5LLQ A;  1TLH B;  4M6X A;  5D8K B;  1XB4 A;  4CXF A;  4RB1 A;  2FNA A;  1PUE E;  1FLI A;  3L2C A;  2HWV A;  2QUF A;  3RKX A;  4CHU A;  4JQF A;  3DXJ F;  4L18 B;  3HSR A;  2ZCW A;  2A07 F;  5D6E A;  1STZ A;  1IF1 A;  2DLL A;  2MLG A;  1WKM A;  3QU3 A;  4CYD A;  2OA4 A;  3BWG A;  3BP8 A;  3HRU A;  3EET A;  3BY6 A;  2D45 A;  1R1U A;  5D5X B;  1V3F A;  2VOP A;  2KJC A;  1K7A A;  3EUH A;  4EM1 A;  3TDU C;  2HGC A;  4ETS A;  1ZG1 A;  2NAZ A;  3C1D A;  2FBK A;  1QNT A;  3U9G A;  1XD7 A;  4M74 A;  2A68 F;  2QEN A;  1LJ9 A;  1R5G A;  4WF2 A;  2PLY A;  1SD5 A;  3LA2 A;  3I0T A;  1V4R A;  2Q2E A;  3JAM K;  1D8J A;  1D3Y A;  1BM9 A;  3LA3 A;  3HOS A;  4KMU X;  3FMR A;  1S29 A;  5DV5 A;  5LRR A;  3C3W A;  2PBI A;  3GX4 X;  2EA4 A;  2RC4 A;  3KP2 A;  3GEZ A;  4YFN F;  1IN7 A;  1LDK B;  2PEX A;  4WXD A;  2LKP A;  1ZAR A;  2JT1 A;  3DPL C;  4KUM A;  2JPB A;  5DUK A;  3GFI A;  1WQ2 A;  4R79 A;  4P9U A;  2EV6 A;  2DAO A;  5HOO A;  5LEJ A;  5FLX K;  5D5U B;  3ECO A;  3H3U A;  1TQI A;  2LF7 A;  4GCV A;  2EFQ A;  1Q1H A;  5F1R A;  3BRO A;  5E1W A;  3KE2 A;  2K4J A;  2O0Y A;  4RGU A;  1YW9 A;  4NHJ A;  1FC3 A;  1W4M A;  2J5O A;  3MWM A;  3TOA A;  1XDU A;  4YG2 F;  4OIQ F;  1FYM A;  5ICC A;  2FRH A;  3HRT A;  1P2F A;  4KDP A;  4IF4 A;  2HEO A;  3L00 A;  2K02 A;  1IW7 F;  1ON1 A;  4YII A;  4PZJ A;  2R3S A;  5BPD A;  1W7P A;  3FXR A;  5FGM A;  5J6X A;  4OMY A;  1IRF A;  1KU2 A;  1ZGA A;  2L01 A;  4HW0 A;  4GXO A;  1FWZ A;  2VT3 A;  3WGH A;  3K1M A;  1XGO A;  2ELH A;  3WE3 A;  4Y13 A;  3OV8 A;  1KA8 A;  1F4K A;  4P96 A;  2XVC A;  5CJ9 A;  5L3C A;  2K27 A;  2MA3 A;  3ML6 A;  4RGX A;  4MGR A;  2DTR A;  4HV5 A;  1J9I A;  4P55 A;  2C6Y A;  4EJO A;  2HKX A;  2FXA A;  1F9N A;  2W24 A;  1UCR A;  2P5V A;  4M72 A;  1YTY A;  4HF2 A;  3KET A;  2NNY A;  4YIF A;  1HBX G;  1ZRE A;  2EFP A;  4RGS A;  3I5U A;  3BPV A;  1D8K A;  2ISZ A;  2WTE A;  1OYI A;  4Q47 A;  2V1X A;  3M9A A;  2Q8K A;  5CVV A;  3FM5 A;  4KIC A;  4JK1 X;  1FX7 A;  2GQQ A;  3I59 B;  2KIU A;  2L02 A;  3P9C A;  5CVU A;  5AON A;  5K5Q A;  1FSE A;  1BN5 A;  2A6H F;  5JFR A;  3G73 A;  2HR3 A;  2XAG A;  3TQN A;  3T8R A;  1HST A;  1P4X A;  4PGH A;  2V1U A;  4KIF A;  1QBJ A;  3VOE A;  1B59 A;  2PMH A;  2EFW A;  3R0J A;  4I09 A;  3ELK A;  3MCZ A;  2UXX A;  4EGZ A;  2VBY A;  2PN6 A;  4HDV A;  5IT9 Z;  3VB2 A;  4RS8 A;  2QLZ A;  4G7Z F;  1JXS A;  4KYW A;  2G9W A;  5BQT A;  1W7P B;  1RI7 A;  1ZAO A;  3CUO A;  2HDC A;  1I27 A;  3FM3 A;  2XAH A;  2XRO A;  1H9T A;  1U5T A;  3HTS B;  1REP C;  5KVR A;  2DBB A;  1I1G A;  5ILU A;  3DEU A;  1Z1D A;  3LST A;  3DP7 A;  3FMQ A;  2EFN A;  3KZZ A;  3BJA A;  2OQR A;  4UNO A;  2CYY A;  1KQ8 A;  1IZ1 A;  1IXR C;  4XRF A;  1IXC A;  1ZRD A;  2P5K A;  4RGR A;  3MQ0 A;  3KFW X;  2DW4 A;  4D0P A;  1BI2 A;  2VC1 A;  2HQN A;  1RNL A;  4WCG A;  4OIR F;  5DUI A;  2W85 A;  4AIH A;  3WTW C;  1HW2 A;  4GYI A;  1ZYR F;  3L9F A;  4NQW A;  3ABT A;  2CWE A;  4KN4 X;  2P5L C;  1NHA A;  4MEX F;  2J5P A;  3LFK A;  3OOP A;  3ZN0 A;  5IT3 A;  1RZ4 A;  1U6G A;  3KP3 A;  3I4P A;  3MZH A;  1QQI A;  4OU0 A;  3RKW A;  2ZXJ A;  3N4M A;  2A61 A;  2W84 A;  4UHT A;  3HRS A;  4HZF A;  1U3E M;  2TDX A;  3DFG A;  4HAM A;  2R7F A;  4ON0 A;  5DDG A;  5AIQ A;  1FBS A;  4MQ9 F;  1HW5 A;  5E1X A;  4MNU A;  4L9J A;  5DCF A;  1RUO A;  4O6J A;  4EM0 B;  2NYX A;  1T0F A;  3F8F A;  3VOD A;  3WTU C;  1F1Z A;  3NQO A;  4U0Y A;  3V8J A;  3QP6 A;  4OIN F;  4G8X A;  4ENJ A;  1HW1 A;  5ERI A;  3B73 A;  3H92 A;  3MAJ A;  4FT8 A;  1SMY F;  4P9F A;  3F21 A;  2JZY A;  1MJA A;  3O3K A;  2A69 F;  2L4A A;  4R1H A;  1W5S A;  4L5I A;  3RTR A;  1YIO A;  4KIB A;  2EA2 A;  1PP7 U;  1Y0U A;  2FSW A;  1L3L A;  1SFU A;  3BPX A;  3EYI A;  1K78 B;  4HX4 A;  4L9T A;  2A6E F;  2Y48 A;  3WU1 B;  2RKH A;  1H0M A;  2GZW A;  3E6D A;  1Z6T A;  1R1V A;  2G7U A;  4Y17 A;  1XMK A;  4TV7 A;  3O2P E;  1T98 A;  2IA2 A;  3V7S A;  2CO5 A;  3V7R A;  1FPQ A;  4ZZL A;  3DKW A;  2L3D A;  2HS5 A;  2FML A;  3QAH A;  4KFC A;  4BHC A;  3T0Y A;  2ZME A;  2IW5 A;  3N97 A;  5EEH A;  1UB9 A;  1O7F A;  3E5X A;  3JTG A;  4IRG A;  4LG0 A;  3F6O A;  1BBY A;  2IT0 A;  4WXH A;  1IN4 A;  3KCC A;  1CGP A;  4U88 A;  3GFL A;  3L09 A;  4UUV A;  3RYR A;  1KYW A;  4G6D A;  4FX4 A;  4JBA A;  4OIP F;  1GVJ A;  1R23 A;  3FZV A;  4CO8 A;  2HZT A;  3LAP A;  4K2E A;  2XV4 S;  3GW2 A;  3HUG A;  1IXS B;  3Q9V A;  1XGN A;  2BGC A;  3ZMV A;  2BYV E;  3ZMZ A;  1SFE A;  2OD5 A;  1S7A A;  5D4S A;  3K2Z A;  1OR7 A;  1MGT A;  2YX4 A;  3IRQ A;  1QZY A;  5FD5 A;  3FXU A;  2KRF A;  3QOP A;  3RJP A;  1ZN2 A;  2VBZ A;  4DQ2 A;  2DQR A;  1KU3 A;  3PFI A;  4L9N A;  1TQP A;  3KEO A;  1LEA A;  4U7D A;  3S2W A;  2PFB A;  4ZYE A;  2XRN A;  3J80 Z;  2F5D A;  2P6S A;  5FB2 A;  5HLH A;  1O3T A;  1ZRC A;  1J59 A;  3HIF A;  2WWY A;  1U78 A;  4A0Z A;  4I98 B;  1DP7 P;  5LGU A;  2V1D A;  2JTV A;  3KLO A;  1MD0 A;  4M9S A;  4LLG F;  5H20 A;  3IC7 A;  4AD9 A;  4KNY A;  3I53 A;  3JAM Z;  2A3S A;  3QPH A;  3NEU A;  2QWW A;  2FE3 A;  2FMY A;  2W25 A;  4KA4 A;  5JVT A;  2CSO A;  1YS6 A;  4OIO F;  4I2O A;  3GWZ A;  2IJL A;  3GZ5 A;  1MJB A;  5DCM B;  1Z6R A;  5TJJ A;  1EH6 A;  3SXY A;  1BC7 C;  3E5Q A;  1I6X A;  4HX8 A;  4P5O A;  1USS A;  3I64 A;  1TNT A;  4I02 A;  1KGS A;  2EFO A;  1CF7 A;  2AS5 F;  1Z05 A;  1J2X A;  1W7P D;  4LJZ F;  4IXA A;  4ZYD A;  2VE8 A;  3JSO A;  2B0L A;  2Y0M A;  3I54 A;  1I5Z A;  1TQM A;  5ED4 A;  4GGG A;  3KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...