2TDXA

Diphtheria tox repressor (c102d mutant) complexed with nickel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2tdxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2tdxA02
3KZYA 1G3TA 4PGGA 4BXUA 2G7UA 1ONVA 4A0ZA 4KIBA 4IF4A 3KP5A 1EH8A 1MD0A 2V1DA 4WCGA 1WI9A 2F5DA 5L3GA 5K5OA 1XGSA 2NRAC 2FF4A 5IT9K 1TW2A 1TTYA 1FY7A 1MKMA 3GXOA 4I02A 2HYFA 4G9YA 4XLNF 2EJRA 2QENA 3U2RA 1YW9A 2IRFG 3I5UA 3MZHA 2DQLA 3I58A 3S2WA 4B09A 3BJ6A 2FRHA 5EEHA 1JHHA 2HKXA 3LQRA 4HX8A 2GZWA 2LDUA 2W24A 2VOOA 2DU9A 4LFUA 1LVAA 3ABTA 2P7CB 3GYHX 1ODDA 1KQ0A 2ISZA 2A6HF 1SD5A 4G7OF 3D5LA 2WTEA 1B9MA 3CLOA 1U78A 3JSOA 3C3WA 5IT9Z 1L3LA 4RGXA 1TQMA 1YW7A 1B4AA 2H09A 3V8LA 1EH6A 1FBQA 4MGRA 3B02A 2XKPA 5J6XA 1ZRFA 3CDHA 3KETA 2HS5A 2DPUA 2G7HA 3ELKA 3TO9A 2VBYA 4M74A 5DEQA 2IPQX 2R7FA 3RYRA 1ON2A 1UB9A 2X4HA 3IRRA 4GXOA 5L3EA 3SZTA 3K1MA 5JFRA 2MBFA 1O3SA 3FM5A 1RIOH 1XCVA 4ZZLA 3NQOA 4KICA 3W6JB 5LRRA 4BYYA 3SQNA 3KP4A 2A3SA 1QZYA 2H27A 3BPXA 2P8TA 1BC7C 4IHTA 4M6XA 4P5OA 1TBXA 1LDKB 4LK1F 4ZYEA 3GVAA 2V1UA 1ZN2A 1P2FA 5EEGA 1QBJA 1XGMA 1R00A 4I0AA 6PAXA 2VT2A 4YFKF 4I7HA 5AONA 2ZKZA 3ZN1A 2VE9A 4KNYA 2OQRA 2IJLA 2ZXJA 3QOPA 5D5XB 1BN5A 3CTAA 2VBZA 3I54A 3QP5A 2XASA 3TO7A 2BV6A 4XRFA 2EWNA 4PZJA 3DPTA 4EJUA 4MTEA 2D1HA 2HFHA 4DNCA 3QPTA 3E6DA 4U7DA 3ZMSA 3P9KA 4L9TA 2JSCA 4D0PA 3DFGA 3ZMZA 4HW0A 3VEPA 4CDGA 4EJTA 2G9WA 1A04A 3EETA 4I98B 2DK8A 1G6NA 1FYLA 3DPLC 1W7PD 5JVTA 1IXCA 2M87A 3ERED 5LHHA 3WTSC 2FNPA 1K79A 3HHGA 5E17F 1T2KA 2FBIA 2XUBA 4XSZF 3HSFA 3WODF 3V7CA 3I59B 4UVBA 2IVMA 4R79A 1BC8C 3LFKA 3I59A 3F8NA 1B6AA 2PFBA 1ZAOA 3E5XA 5BPIA 1KGSA 5DD4A 4YIIA 4L9JA 5ILSA 4KIFA 4HV5A 3T0YA 2L01A 1V4RA 1QNTA 2L02A 1ON1A 2BYVE 2HGCA 1IZ1A 1LNWA 2QBYB 3EQLF 1OYYA 4AIKA 1IXRC 4EV0A 4G94A 4CO8A 4Y15A 2Y0MA 1IN8A 5FLXK 4M6YA 4Q47A 1XMKA 4WX9A 3I71A 1IN6A 2P7VB 1YTYA 5H6QA 4CICA 3KEOA 5KK1A 3CO7C 4Q48A 1FOKA 5ERIA 1XGNA 3M1EA 4LG0B 4BNCA 2EA4A 1SD7A 5D5UB 3L7WA 2RNJA 3RI4A 1O3TA 4M9ZA 5E18F 4KYWA 3E6CC 4LG0A 3ZP5A 3OOPA 2QZ8A 1FBUA 3G3ZA 1OR7A 1J5YA 1GVJA 2JZYA 1E17A 2EFNA 1GXQA 4UUVA 1T6SA 1SAXA 3HIFA 3GUDA 2K02A 5FLXZ 5LGUA 1HQCA 2FA5A 2LSOA 2OA4A 4RB0A 5D8LB 1F4KA 3KP2A 3P7NA 2HTSA 5DUIA 1YS7A 4P9FA 3L2CA 4M71A 3O6BB 1Z6TA 2PBIA 1YO5C 3W6KB 1W5SA 2O0YA 3JTHA 5HS7A 3HHHA 3NRVA 4L5JA 4FHTA 4LB6B 5DCFA 1Z9CA 2EFOA 3F23A 5ICGA 4ENKA 2A69F 3ZQ7A 2UXXA 1ZRCA 3K69A 5E1XA 1FP1D 1BIBA 4A6DA 5TRDA 2BBYA 2PI0A 1FNNA 2GA2A 3TOAA 2RN7A 4HBLA 4PDKA 4JBAA 4LMYA 4IRIA 3BDDA 2YPRA 4WWCA 2GXGA 5BPDA 1HXDA 1ZGAA 1B9NA 1STZA 1O7FA 1TNSA 5LEJA 2H6BA 2CWEA 2VXZA 1REPC 1R1TA 2HEOA 2M8EA 5FFZA 4H0EA 2J5PA 3ROUA 1JHFA 2XAFA 2E7WA 2VT3A 1Y0UA 4OIPF 5CVRA 3F22A 2NS0A 4P9UA 1F9NA 2VBXA 1IW7F 4MTDA 1BJAA 3K1PA 3Q9SA 3J81Z 3TOBA 4G7ZF 3DKWA 4HQMA 2AS5F 3JTGA 2A5YB 4UNOA 1VTNC 1TQPA 1BOAA 3GW2A 5BS6A 1PDNC 2L54A 2B0LA 2ESNA 3GF2A 5J8FA 4L0ZB 2ISYA 3EUHA 5LGTA 3FM3A 2ZNYA 2EV5A 3VODA 1MZBA 5E20A 2FXAA 1YG2A 5E8GA 4XBFA 3DEUA 1IXSB 4GGGA 1KYZA 1I5ZA 3H92A 4Q4ZF 5HLGA 3SFZA 2O8XA 2IA2A 1OPCA 2LF7A 2HZTA 1IAWA 4ZZDA 5LEKA 3R6SA 5LHIA 2CSOA 2DAOA 1R23A 5BMZA 4G6QA 1P4XA 3V7RA 1OYWA 1ZARA 1BI3A 1XN7A 2K86A 4BHCA 3MEXA 1J59A 2PEXA 2GQQA 3BPVA 2A68F 1DUXC 4WXCA 2HKOA 1U8RA 1I6XA 4ZYGA 2RV8A 3RPQA 2GXBA 1QQIA 2A61A 1FYMA 1J2XA 2PLYA 2GIVA 3IWZA 2ELHA 3GFJA 4YG2F 1JXSA 1P4AA 1Z6RA 2KKOA 2ZJ2A 2IP2A 3NEUA 1MGTA 2UZKA 4RB2C 3RPUA 3KP6A 5HLHA 3V8KA 4ESJA 4AD9A 2EFQA 3QU6A 1HKQA 2QUFA 2EV6A 1G3WA 2FU4A 2QWWA 1I1GA 4DQ2A 4BH9A 2DBBA 1TQIA 2FNAA 1SD6A 3I64A 2CG4A 5TJJA 3IC7A 3T1BA 2Z33A 4ZYHA 2XV4S 4S05A 5F1RA 1RNLA 2LNBA 3DF8A 2WV0A 1QPMA 2R7DA 3H3UA 5DCMB 2EV0A 3U9GA 1HW1A 3F6OA 1LEAA 3VFZA 2ESHA 4OIQF 3C7JA 5DCMA 4LLLA 3HSRA 2AXLA 2VODA 5DDGA 2A07F 4MHGA 2K4JA 3FXUA 3R0JA 3FMSA 2BE5F 1IRGA 1FYKA 3BY6A 2HWVA 2PQ8A 1SMTA 2CO5A 3PQKA 5K5QA 2QM3A 2FMLA 3ML6A 4LJZF 3IWFA 2KRFA 3KEQA 5L3CA 3J7AO 4LK0F 2K7LA 3WE3A 5ED4A 2XAJA 4QLCU 1ZLKA 3WTWC 4A0XA 3CUOA 1SFXA 3T5XA 2OD5A 1MJ9A 3Q5FA 3VOEA 4K2EA 4PGHA 1YYVA 3EYYA 3V7SA 3GZ6A 4OMYA 4YFXF 5ILVA 5CVJA 4FX0A 3E6BA 2P6TA 1IRFA 1HSTA 3GEZA 4HF1A 4LGWA 3WU0A 1WQ2A 4P55A 5CYVA 2JTVA 4L0YB 1U3EM 2YX7A 3GLXA 5AIPA 3LA3A 2DPDA 1O57A 4LD5A 1XGOA 5D8KB 3LA7A 3KP7A 2XAGA 4ZYDA 3FX3A 2STWA 3TDUC 5FD5A 3GFMA 4ETSA 3P9CA 3CJNA 2XHKA 2O61A 3MWMA 2H6CA 3R61A 4L9NA 1IN5A 4ZH4F 4KMFA 4FX4A 3F21A 2CGPA 2VBWA 3DP7A 3ZMUA 3FMRA 1CF7A 4G6DA 2HOEA 3V4GA 1GHCA 1R58A 1L0OC 3N97A 2OBPA 2EFWA 3B73A 1W4MA 2E1NA 4S04A 3HUGA 4OIOF 3U1DA 1BIAA 2FEZA 1MJAA 1YLFA 2OZ6A 2QYOA 1S29A 2M1BA 4HF0A 3WTZA 2W85A 3AAFA 3IRQA 1G4DA 5H6RA 3JSPA 3RJPA 1UCRA 1ZG5A 2K4BA 1DPUA 1DP7P 1TW3A 3KE2A 2YSRA 3K9TA 1F1ZA 4RGSA 4LLGF 2CQKA 2O03A 3MZYA 3OV8A 3TDZC 4PCQA 2Q0OA 4WXDA 3DV8A 1R5HA 1W7PB 2RKHA 4EQQA 4HDUA 5CVUA 3P9IA 4RAZA 2L4MA 1YW8A 3QRFF 1W7PA 4AIHA 1FC3A 2KJBA 3HTUA 3M7GA 1R5GA 2BGCA 3R0AA 4HA8A 2VC1A 3F8BA 4M73A 2FMYA 1HKSA 3WU1B 2RGVA 4HX4A 3WGIA 1AWCA 5JHUA 3CUQB 4HDVA 4ASNA 3I4PA 1TNTA 2C6YA 4I2OA 4IXAA 3L9FA 3CUQA 4U88A 1BI0A 4I0BA 3TKYA 4HOBA 1YQAA 3E5QA 1D8JA 5CVVA 2DO7A 5BQTA 3HRMA 1HW2A 2JPCA 2P4WA 5J8CA 5ICEA 3IHUA 4NB5A 3BWGA 1LDDA 2CFXA 2GA1A 3BROA 3FZVA 3EYIA 4MQVA 3LQQA 2KIUA 4UVAA 2FE3A 1ULYA 2MH9A 1EH7A 2D2WA 5AIQA 3M8EA 3O2PE 3E6MA 1BI1A 2F5CA 2XAHA 2PG4A 5D5WB 4MNUA 4P96A 2COMA 2J5OA 1KQ9A 2ZBKA 5ILUA 3MAJA 5FD6A 4LLNA 5F64A 5KVRA 3F8MA 1SD4A 4NQWA 3MCZA 1USTA 3V8JA 1IN4A 2MA3A 1USSA 4MEYF 3J81K 5L3FA 4AWXB 1JGSA 3HRUA 2NNNA 2CW0F 4U0WA 5LRSA 1ZHFA 1LQ1A 2HDCA 2A6EF 4MQ9F 1R36A 1I1SA 1ZYRF 1MJBA 3ULQB 2R3SA 2FQ3A 5H20A 3TGNA 4AIJA 5K1YA 5D6EA 2LKPA 1FT9A 4I01A 4UV8A 5HS8A 1U5TA 3WTXC 4M9SA 2F5FA 3E97A 1YFHA 5LLQA 1XMAA 3FMQA 3PQJA 1ZH5A 5ICCA 3EDPA 1JE8A 3BP8A 3QAHA 3ZMTA 4Y17A 1QGPA 1PP7U 5DD8A 4UXNA 1YIOA 2DQRA 1T39A 3VB2A 3HTSB 1V3FA 1FBSA 1BM9A 2UXNA 1O3RA 3ZN0A 2DFIA 1XDUA 1XDSA 5F6FA 3C18A 4IRHA 1J9IA 2JPBA 1E2XA 1UHWA 1XSXA 1XD7A 3WTUC 2UWMA 2STTA 4A6EA 2VONA 3E5UA 2O6GE 3ZPLA 5FO5A 2F2EA 4L5IA 5HLIA 1LJ9A 4A5MA 1Z91A 5HS9A 3LAJA 3BZ6A 3GFLA 1FLIA 3IL2A 2D45A 3M8FA 1ZGJA 2RVCA 4RAYA 5L3BA 1U2WA 2M45A 4Z2YA 3RIRA 1R1VA 4BQAA 3QU3A 3WGHA 4GCVA 3RYPA 3HRSA 4A12A 5FB2A 1SFUA 1J7KA 4F7ZA 2FBHA 4M9XA 4XLPF 2YR2A 3GFIA 3T8TA 4HV6A 2XIGA 4N9IA 3K2ZA 4OOIA 2P6SA 3ZMVA 2EB7A 2VE8A 3HSEA 4O3MA 1LDJA 3G73A 2GAUA 3J80K 1I27A 1K78B 1ZRDA 1FSEA 4FT8A 2IA0A 3FWEA 2L3DA 4RB3C 5E1WA 4ENJA 1K78A 1ZG1A 3COAC 4WK8F 1RUOA 2YX4A 1RI7A 1O7LA 2W25A 4IVNA 5FGMA 5JR3A 2IW5A 4L18B 3F72A 5K5RA 3SHFA 1WSUA 2Y48A 3KLNA 3E3VA 4CHUA 3QPHA 2QLZA 4A5NA 1DDNA 4KFCA 3LA2A 2XGXA 3RDIA 1QZZA 2QQAA 4UV9A 2Z99A 3CUQC 4KUMA 3J80Z 1D8KA 1KYWA 2WWYA 2M30A 2W84A 2NYXA 4CGZA 3SXYA 4TV7A 1T98A 3GZ5A 3KFWX 4LB5A 1D5VA 2LF8A 2RQPA 2E7XA 2P5LC 3R4KA 4O6JA 2Z5UA 3DQVC 1CGPA 2DI3A 4R1HA 3RKYA 1B1BA 4RGRA 4G7HF 2VN2A 1RUNA 1U6GA 2RC4A 3F6VA 3WGGA 4G8XA 2MD5A 1RZ4A 2HQRA 2VOPA 4KIGA 3HOSA 4BHPA 3L09A 2ZNZA 3I53A 5JI6A 3F8FA 3DXJF 4U7BA 2ZCWA 2GWRA 4Y13A 5HOOA 1LEBA 2FBKA 2XKOA 4ESFA 1F5TA 5LGNA 1IF1A 3SZPA 2PMHA 4B8XA 1S7AA 3WTYC 3C1DA 2V9VA 1GXPA 2QVOA 2PN6A 2V6CA 2HYGD 3L00A 3RKXA 1B59A 3RKWA 2FOKA 1Z7UA 2MC3A 1HKTA 3FXQA 1K7AA 4NHJA 1XSDA 1CF7B 4EJOA 4KDPA 4IRGA 3BOQA 4U0YA 1MDMB 2Z3YA 4A0YA 5ICFA 3WTVC 3F3XA 3FXRA 1XB4A 1H0MA 2H94A 2IA1A 3GWZA 1MDMA 2Y75A 1W5TA 1QO0D 1U5TC 4OINF 1HBXG 2RDPA 1NHAA 5LHGA 3LWFA 2HR3A 2JRTA 4HLYA 4N9HA 3WE2A 2L4AA 3WG9A 1BI2A 1AOYA 4IPAA 4EGYA 4XSXF 1H9GA 3PFIA 4UVCA 2OQGA 3ECOA 1R1UA 4CYDA 1G3YA 2ZFWA 3JW4A 1R22A 4KT5C 4MEXF 2EA2A 2NNYA 3BJAA 4OMZA 3K0LA 2JT1A 1KA8A 2PMUA 5FFXA 4HX7A 4EJWA 1PUEE 2XAQA 4KMUX 1Z1DA 3H3ZA 5DUKA 2DT5A 5HVQC 4WF2A 1ZLJA 2DTRA 3QP6A 1ZREA 3TQNA 1P92A 4EM0B 2ACJA 1H9TA 2KIMA 4OIRF 1KU3A 1KU9A 2XROA 1P4WA 4UHTA 4EM2A 2W57A 2IT0A 2XRNA 4U0VA 4QWQA 2F5EA 3F8CA 3K1NA 1WRJA 5HDNA 2QBYA 5HDKA 2KIFA 4L9VA 4CXFA 1X3UA 2ETHA 1S7OA 4EM1A 1XSVA 1C0WA 3FF5A 2WC2A 2YU3A 4HAMA 1HW5A 1YS6A 2Q8KA 3HRTA 1OKRA 1S6LA 2V1XA 4HF2A 4EVIA 3KZZA 1SFEA 1OMIA 2D1VA 4Q5SF 5LBQA 4ESBA 4I09A 1FX7A 3D0SA 1WWXA 3N4MA 2P5VA 3IKVA 4GYGA 2K27A 3RTRA 5E8IA 2DW4A 4AVPA 3ABUA 3T8RA 1Z05A 4ENNA 3KCCA 3MQ0A 2QQ9A 2ADUA 3TO6A 2Z9OA 2P5KA 2TDXA 4GYIA 5D4SA 2NAZA 4EGZA 1J0RA 1LB2A 3WTTC 3KLOA 2HQNA 4YIFA 4HLXA 4O5VA 4BHBA 5E1ZB 1WKMA 1FP2A 2DK5A 1IN7A 2V79A 2CYYA 4IJAA 4BAYA 1T0FA 1FZPB 3HYIA 3KP3A 4KN7X 1KQ8A 1G3SA 4KA4A 4RB1A 1ZG3A 3Q9VA 1Q1HA 4CZZA 4ON0A 4ENMA 1FPQA 3M9AA 3GX4X 2VC0A 2ZO4A 3HOTA 2X0LA 4E70A 3CO6C 1DPRA 1U5TB 1XCBA 5HDGA 5D6FA 1KU2A 1S3JA 4HQEA 2MH2A 5L3DA 3FHZA 1EV7A 5A2QK 4GO1A 1T38A 1HSJA 2BEOA 5CVIA 2PJPA 3JAMK 4KN4X 3MFKA 3LSTA 2XVCA 4IHSA 2M5WA 1UHMA 2ZMEB 3IKTA 3I0TA 3R60A 1S8NA 2ZMEA 1IUYA 2EK5A 5BOXA 4N0BA 2FSWA 5CJ9A 1KU7A 4A2UA 4YFNF 4OU0A 2OZUA 5D5VB 3GO5A 4M72A 1D3YA 1UFMA 2EFPA 2O3FA 1OYIA 5D4RA 2MLKA 1TLHB 1P6RA 2OU2A 4JK1X 1R7JA 4HYEA 2MLGA 1FWZA 2E1CA 4EMSA 4RS8A 3LAPA 1FSHA 2DLLA 1PP8F 4HZFA 3REOA 2OAZA 2KJCA 5DV5A 5A2QZ 1SMYF 1K6OA 3ECHA 4JQFA 3JAMZ 5DYMA 2HTJA 4RGUA 2QQBA 3ISPA 3O3KA 3ZMDA 1O3QA 5CLSA 4EJVA 1J75A 3BJOA 2Q2EA 1BBYA 4R8HA 4WXHA 5IT3A
chains in the Genus database with same CATH superfamily
3KZYA 4E7SA 1G3TA 3FKJA 4PGGA 4BXUA 3BTCA 2G7UA 3K4LA 5LFAA 4XICA 2L7FP 1FMWA 1ONVA 3HB9A 4RLQA 4A0ZA 2A6TA 4KIBA 3NARA 4IF4A 3KP5A 1EH8A 4E7HA 1MD0A 1K61A 1LFUP 2V1DA 4WCGA 2R7WA 1WI9A 2F5DA 2HNHA 2VUMJ 1I6HJ 1YOVB 5L3GA 4II3A 5K5OA 3AG3H 3JRFA 1TWHJ 1WJAA 4FISA 4BJ5C 3C2GA 2IGOA 3GTQJ 1XGSA 5GAGJ 2NRAC 2FF4A 5IT9K 2W1OA 1TW2A 1ZTRA 1TTYA 3OSFA 2L9VA 2HDDA 1FY7A 1MKMA 3GXOA 3PL8A 3DBLB 2HYFA 4I02A 1JKPC 2W82A 3H0GJ 2E34A 3BG9A 2JSPA 4G9YA 4XLNF 2LY2A 1R49A 1A5JA 2EJRA 3J81R 2QENA 3U2RA 2IRFG 3I5UA 3MZHA 2HXOA 1IO2A 2LR8A 2DQLA 3I58A 3S2WA 4BU2A 4B09A 3BJ6A 2FRHA 5EEHA 1JHHA 2HKXA 2PMZN 3LQRA 4HX8A 2GZWA 2MYSA 2LDUA 2W24A 1VQNI 2VOOA 2DU9A 5J4YA 2M0CA 4LFUA 1LVAA 2M4KA 4DZPA 4N4NB 3ABTA 5E3NA 1YIJI 2P7CB 3GYHX 1ODDA 3K2AA 3EPZA 5KNLA 1KQ0A 3ZQQA 2FD5A 2ISZA 2A6HF 4GFBA 3QOEA 1SD5A 2VASA 2ZFUA 2XGEA 3D5LA 2WTEA 1B9MA 2XF5A 4G7OF 2HPMA 3CLOA 1R5ID 3ZCOA 1U78A 2CQXA 1N77A 4IO9F 1AU7A 3JSOA 2B9SA 2BOLA 2HOTA 2ME6A 2KT0A 1ITYA 3C3WA 5IT9Z 1L3LA 4RGXA 1FTTA 1TQMA 1YW7A 1B4AA 2H09A 2HVRA 4FE7A 3V8LA 1EH6A 1FBQA 4BGDA 1FJLA 1WI3A 1ZK8A 4MGRA 2OF7A 3F9KA 4XRSA 3B02A 2DOFA 2XKPA 4C30A 4IHVA 3S1NJ 5J6XA 1ZRFA 3CDHA 4XKVA 2XB5A 3KETA 3CCYA 4V2GA 2HS5A 2M7AA 3FBIB 2NXNB 3RCOA 2DPUA 2G7HA 3ELKA 1JKRC 3GMEA 3TO9A 2VBYA 1B8IB 3A52A 2XB0X 4M74A 5DEQA 2IPQX 2R7FA 3RYRA 3M4OJ 1ON2A 2K3FA 1UB9A 3CZ6A 2X4HA 3IRRA 4GXOA 5L3EA 3SZTA 1BR2A 3K1MA 1B8IA 4RMNA 5JFRA 2MBFA 3LMMA 1O3SA 3TP3A 2QA4I 2XSJC 3FM5A 1RIOH 2MFZA 2M7BA 2PX9A 1XCVA 3HDDA 3VYRB 4ZZLA 5HLTA 3NQOA 1ETVA 4KICA 3W6JB 2DA5A 1WH5A 5LRRA 2DCEA 3K4NA 3KX2A 4B44A 3MZ8A 2Y30A 2EINH 4BYYA 2L9NA 3GTOJ 2CQQA 3SQNA 3KP4A 2A3SA 2KLOA 4A93J 3CC4I 2ZXHA 2ZJQF 3D5RC 1YX3A 2E2JJ 1QZYA 1PJRA 2X9DA 3BPXA 1MMGA 2P8TA 3SFIA 2H27A 1TWGJ 3GTJJ 1BC7C 3S2HJ 4IHTA 4M6XA 4P5OA 1HDPA 4E7LA 1TBXA 3VYTB 4GRIA 1LDKB 4ITVA 4LK1F 4ZYEA 2JJ7A 3GVAA 2V1UA 1ZN2A 1P2FA 5EEGA 1QBJA 5C4XJ 1I39A 1XGMA 1R00A 3JRIA 2CW7A 2OCEA 4I0AA 6PAXA 2VT2A 4BQQA 3D1NI 5J1YA 3PO2J 2ID6A 4YFKF 4I7HA 1FIAA 1E3HA 2HOSA 5AONA 2E1MB 1QPIA 2ZKZA 1T0FC 3ZN1A 2VE9A 2R0QC 3EUAA 3KYLA 1TWFJ 4I76A 3X2QH 2YU9J 1RQ6A 4KNYA 4FETA 1BJZA 2BHYA 2OQRA 5B1BH 2IJLA 1X1BA 3VPRA 2ZXJA 3QOPA 2XGCA 4OAYA 5D5XB 4AVZA 1BN5A 4DZJA 3CTAA 3OR1C 1JGGA 4IHWA 2VBZA 2Y9ZA 3OYGA 3I54A 3QP5A 2XASA 3TO7A 2BV6A 4XRFA 3Q0UA 2EWNA 2E71A 3BR3A 5DTDA 3J80R 3HZJA 3D5SC 4PZJA 3DPTA 1ETKA 4CUGA 2VQHA 1WPKA 4EJUA 1D1AA 4MTEA 3JRCA 3K4CA 3PNVA 2D1HA 1LFPA 1RKTA 2DA1A 2HFHA 4BBSJ 4DNCA 3CCVI 5C4JJ 3QPTA 3W6VA 3BT9A 2EIJH 1FOXA 1XC5A 3H5AA 3L2UA 1HC8A 3E6DA 4AM3A 4U7DA 3ZMSA 3P9KA 4L9TA 1SANA 2JSCA 1IC8A 4D0PA 3DFGA 2ZXWH 3EUKL 5FROA 3ZMZA 3K4BA 2KIQA 2HXIA 3HBLA 4HW0A 3VEPA 1JUPA 4IEJA 4CDGA 4EJTA 3WG7H 2G9WA 1A04A 1V5EA 3EETA 4I98B 2DK8A 1G6NA 1FYLA 3LNQA 5IYDJ 3DPLC 2ZMEC 1JUSA 1W7PD 5JVTA 3OYBA 1IXCA 4I6ZA 1Y1VJ 2M87A 3ERED 5LHHA 1TT0A 1OCCH 2DA2A 2GM4A 3WTSC 2FNPA 1QVUA 2LBFA 1K79A 2FOWA 4HRIA 3HHGA 5E17F 1T2KA 2FBIA 4XRSG 4B48A 3BC8A 1X1PA 2XUBA 3I9V2 3I3LA 4XSZF 3QPSA 4RM3A 3HSFA 3WODF 9ANTA 2OC6A 3V7CA 3I59B 4CZCA 3MVPA 1X1DA 3MKLA 4UVBA 3ZQHA 2IVMA 4R79A 2IS6A 1BC8C 4PJMA 3LFKA 3CDLA 2W4SA 4J19A 3I59A 2B63J 5FKOA 2QSGX 3F8NA 3L2VA 1B6AA 1JTXA 4FTHA 2PFBA 1ZAOA 1ETWA 2Y9YA 1YHQI 3E5XA 4HPQA 5BPIA 2M9HA 2E1OA 1KGSA 2DFFA 2L2OA 3A4CA 3GZNB 5DD4A 4YIIA 4L9JA 2VPLA 1Z77A 4IL6C 5ILSA 4D1QA 4KIFA 5EZGA 4HV5A 3T0YA 2W48A 4UY8I 3H5NA 2L01A 1V4RA 4XORA 1A6QA 1JKOC 3BR1A 1QNTA 3OYJA 2L02A 3PIOF 3J7AW 3S8PA 1ON1A 2BYVE 3A03A 5IY5H 2HGCA 1LFBA 1IZ1A 4XL9A 1LNWA 3FDYA 4II2A 2QBYB 3EQLF 1OYYA 1WVRA 4AIKA 2EIKH 1IXRC 2HPIA 4EV0A 4XLEA 4G94A 4CO8A 4Y15A 2Y0MA 5FKNA 3HKZA 1IN8A 4D7NA 3FXMA 4UUTA 5F0HA 5FLXK 3CESA 4B3AA 1OCRH 4Y4RA 4M6YA 4Q47A 1XMKA 3AG4H 4WX9A 3I71A 4XR6A 2BY3A 1IN6A 3BG6A 1N25A 2P7VB 1YTYA 5H6QA 3I55I 1E3PA 4CICA 1UG0A 3QPLA 2UV1A 1K4TA 3KEOA 5KK1A 3A01B 3CO7C 2DT6A 4Q48A 5K7ZA 1FOKA 1DQUA 5ERIA 2CJJA 2I5UA 1XGNA 3M1EA 5B3SH 4LG0B 2VLAA 4BNCA 2KPMA 3K7AJ 4CCOA 2EA4A 3MKYB 4HEA2 3A01A 1SD7A 5D5UB 2DMNA 4B3XA 4RBOA 3L7WA 2RNJA 3RI4A 5M3MJ 1O3TA 4LIUA 3BTLA 4XLHA 1WFXA 4M9ZA 2VB6A 5E18F 4KYWA 2AO9A 3E6CC 4LG0A 3ZP5A 3OOPA 2X1DA 3OMYA 4XLFA 4CYCB 2DFHA 1OISA 1FBUA 2QZ8A 2Z16A 3G3ZA 1OR7A 1J5YA 1GVJA 2JZYA 1E17A 2EFNA 3AFHA 2H1LA 1GXQA 4UUVA 3CJTB 1T6SA 1G8XA 1AHDP 1SAXA 4CYCA 5KCMA 3HL2A 4E7IA 3HOWJ 3HIFA 3TW7A 4PUSA 4JYKA 3GUDA 2K02A 3B6CA 4RM2A 5FLXZ 5LGUA 3OR2C 3PSIA 1QU3A 1HQCA 2DTZA 2FA5A 2LSOA 2OA4A 4RB0A 4FASD 1WJDA 4BY7J 5D8LB 4NDLA 3BLYA 4I99C 1WCMJ 1F4KA 3KP2A 3P7NA 3RSNA 2HTSA 3O8HA 2NOGA 4QTRA 5DUIA 2JK3A 1YS7A 5J47A 3GLLA 4A69C 4P9FA 3M3YJ 1XG1A 3L2CA 2EZHA 4M71A 4NNJA 3W2WA 3O6BB 1Z6TA 2PBIA 3SZGA 4OWRB 3OS1A 4XIDA 3H1CA 4AYBN 1YO5C 2IAIA 5E79C 3W6KB 4HNTA 1VNDA 2O7OA 1W5SA 4M3BA 2O0YA 4MFEA 1I3AA 2NVYJ 3JTHA 5HS7A 2CUFA 3HHHA 1YRNA 3NRVA 4L5JA 3E0JB 2Q1ZB 4FHTA 4LB6B 3BTIA 4AIDA 5DCFA 5J3LA 5LD2C 4AC0A 1Z9CA 2EFOA 3F23A 1YJ9I 2IBDA 2VQCA 5ICGA 4ENKA 2VIXA 2A69F 3ZQ7A 2R93J 1E0EA 1XTAA 3ZQIA 2UXXA 4HG2A 3JCUC 4YRVA 1ZRCA 3KPHA 3K69A 5E1XA 3N05A 1FP1D 2DOAA 4FE4A 1BIBA 2H8WA 2Y0SN 1IG7A 4A6DA 3QYBA 5TRDA 3K6GA 2JVGA 5FKLA 2BBYA 2WB1N 2O9LA 4AUXA 4BQOA 4IOCF 2BHZA 1V5FA 3OYFA 2PI0A 1FNNA 2GA2A 3TOAA 2RN7A 5FLMJ 4HBLA 4PDKA 4JBAA 4LMYA 1ZQ3P 4IRIA 3SEQA 3BDDA 2YPRA 5GPAA 4EATA 4WWCA 2GXGA 5BPDA 2NVTJ 1D0YA 5M5WJ 1P7IA 4KITB 1HXDA 1ZGAA 2LP0A 1B9NA 3C2HA 2ME0A 1STZA 1O7FA 1TNSA 5LEJA 2H6BA 2CWEA 2VXZA 4JX4A 4LOCA 1REPC 1R1TA 2HEOA 2M8EA 5FFZA 4H0EA 1MNMC 2XPUA 1JJ6C 2VQGA 2J5PA 3ROUA 1JHFA 1ETOA 2A05A 1MH4A 3DPUA 1U9NA 2XAFA 2VXDA 2E7WA 2VT3A 3ASNH 2GLOA 3JRAA 1Y0UA 4OIPF 1YX5A 2LTPA 5CVRA 2L7MP 3F22A 2NS0A 4P9UA 2IGNA 2OCCH 3J7AY 5EEAA 1F9NA 2VBXA 1IW7F 5HNFA 1O4XA 3HG9A 3ZOBA 4MTDA 1BJAA 3K1PA 2AQFA 1UG2A 2EZKA 3Q9SA 3J81Z 3S17J 3TOBA 5FKMA 4G7ZF 2RAEA 3DKWA 4HQMA 2AS5F 1VQ7I 3JTGA 2A5YB 4UNOA 1VTNC 4D5FA 1TQPA 1QHGA 3CCQI 1D1CA 2E1MC 1BOAA 3GW2A 5BS6A 4A3IJ 1PDNC 3CF5F 2L54A 2B0LA 3CC2I 2ESNA 3GF2A 3BTJA 5J8FA 3DLAA 4L0ZB 2ISYA 3EUHA 2MW8A 5LGTA 3FM3A 4Z6YA 2ZNYA 4GDFA 2EV5A 3VODA 1MZBA 3DBRB 5E20A 2FXAA 1YG2A 3OWTA 5E8GA 3HPHA 4XBFA 5IP9J 1S7EA 3DEUA 3ESWB 1IXSB 2LG4A 2DYSH 4GGGA 2X1EA 4NUBA 1KYZA 3FKIJ 1I5ZA 1Y56A 4ZTFA 3H92A 1IUFA 3FIWA 4Q4ZF 2G0EA 5HLGA 3SFZA 2O8XA 4EEFG 2IA2A 3DU5A 1RC9A 1OPCA 1MSEC 3GTKJ 2LF7A 2HZTA 1IAWA 4ZZDA 3M07A 3R6SA 5LHIA 5LEKA 3ZQFA 3H5RA 2CSOA 1RR7A 2DAOA 1R23A 2LYCA 1CQTA 5BMZA 4G6QA 5M5YJ 2DA6A 1P4XA 3G2BA 1QHHD 3V7RA 1YI2I 2OJED 1OLTA 1OYWA 4W1UA 1ZARA 3S1RJ 1BI3A 1XN7A 2K86A 4BHCA 3MEXA 4BJ6C 1J59A 2PEXA 3Q0VA 2GQQA 4B4CA 2R7UA 3BPVA 2A68F 2KMUA 1DUXC 2LC2A 4WXCA 1W36C 3S2DJ 2HKOA 1U8RA 4OAZA 1I6XA 2WAQA 3LSHA 1IJWC 4ZYGA 2WAQN 4YELA 2RV8A 3RPQA 2GXBA 1QQIA 2A61A 3CCUI 2OTJI 4E6KG 1FYMA 1J2XA 5K7FA 2PLYA 2GIVA 3IWZA 4BDYA 3HGYA 2R7SA 2IEKA 2ELHA 3GFJA 4YG2F 1JXSA 1P4AA 2FJ1A 1Z6RA 4Y3OA 2KKOA 3ZR8X 3Q3SA 1JKQC 2ZJ2A 2IP2A 3NEUA 1W0TA 1MGTA 4DOZA 4B47A 2UZKA 2CV0A 4RB2C 3DKXA 1QRYA 1BR1A 3RPUA 3KP6A 5HLHA 3V8KA 4ESJA 3PFYA 2DDAA 4AD9A 2EFQA 3QU6A 1HKQA 2QUFA 2EV6A 1N75A 1G3WA 2FU4A 2QWWA 1I1GA 4DQ2A 4BH9A 4XKBA 1MBGA 2DBBA 3K70D 1TQIA 2FNAA 1SD6A 3DTIA 2R4GA 3I64A 2O8KA 3JAMR 1EA3A 1VQ8I 2NOJB 2CG4A 5TJJA 1SEUA 2DODA 3IC7A 2MABA 3T1BA 1P7JA 1UELB 2Z33A 2X48A 3HC7A 4ZYHA 3ONQA 3BCBA 2XV4S 3W3CA 5B5EC 4BE2A 4S05A 5F1RA 2P0WA 1RNLA 2LNBA 2P81A 3DF8A 2WV0A 3OIPA 4JOMA 1QPMA 3TW6A 2R7DA 3O8GA 3PNYA 3H3UA 5DCMB 3H0DA 3QWLA 1MMDA 1X1AA 3OSGA 1SAUA 2EV0A 3U9GA 1HW1A 3F6OA 1LEAA 1JI8A 2BY0A 3VFZA 2CUZA 1NG7A 3OYLA 2ESHA 3HM5A 4MO7A 4OIQF 1GLNA 2LY1A 1WGXA 3NWTA 3C7JA 5DCMA 4LLLA 3L1PA 3HSRA 1K6YA 2AXLA 2VODA 2IS4A 5DDGA 3B6AA 4MHGA 4NC8A 2A07F 2K4JA 4CH7A 1WJCA 3FXUA 3R0JA 1OCTC 1MNDA 3FMSA 2A5WA 2BE5F 1IRGA 2E2IJ 1FYKA 3BY6A 2HWVA 3KYCB 2PQ8A 2QKLB 3FXOA 1SMTA 2CO5A 2XGDA 3PQKA 1MMNA 4BL0B 5IOZA 4DW6A 4XLCA 2IS1A 1GDTA 5K5QA 2QM3A 2FMLA 1QZEA 3S14J 3ML6A 1DU0A 4LJZF 1DU6A 3IWFA 3OIOA 4A3JJ 2KRFA 3G71I 3KEQA 5L3CA 3J7AO 4LK0F 2K7LA 3K10A 3WE3A 1GV2A 5ED4A 2XAJA 2Y31A 4QLCU 4DYQA 2HVSA 3DBHB 1ZLKA 1KZHA 3WTWC 4A0XA 4LIVA 3CUOA 2ID3A 1OR7C 1SFXA 3OS2A 3T5XA 2OD5A 1MJ9A 3ASOH 3Q5FA 5JLXA 5J4VA 3VOEA 2OTLI 4K2EA 4D5CA 1Z67A 2BXZA 4PGHA 1YYVA 2XRLA 4IX7A 2BZTA 1N78A 1IRZA 1BOBA 3EYYA 3V7SA 3GZ6A 2OUMA 1W0UA 3S16J 5JVGF 2K9NA 2E60A 4PJJA 1R4NB 4OMYA 4YFXF 3G1MA 5ILVA 5CVJA 4FX0A 3E6BA 4BJTA 2E35A 2P6TA 1IRFA 1HSTA 2I8DA 2M34A 3GEZA 4BACA 4HF1A 2KISA 4LGWA 3WU0A 5J1RA 1WQ2A 2VKDA 2WV1A 4P55A 4B1RA 5CYVA 2JTVA 1NTCA 3H35A 3G1LA 4L0YB 1U3EM 2LREA 1VQ6I 1V55H 2YX7A 3HOXJ 4ZDOA 3GLXA 5AIPA 3CMEI 2VJ4A 3LA3A 5C3EJ 4BXFA 1E3OC 2DPDA 1O57A 3MN2A 4XLAA 4LD5A 2KDOA 4XKWA 4CCMA 4F91B 1MIJA 2OPTA 3VSLA 4C2MJ 1XGOA 5D8KB 5IT9R 1BW5A 2KQRA 3KP7A 3LA7A 2XAGA 5B1AH 2X6XA 4ZYDA 3FX3A 3PNTA 2HU9A 1TL8A 2STWA 3TDUC 5FD5A 1FIPA 3GFMA 3ZRGA 4ETSA 2R7OA 1R6RA 2MVTA 3P9CA 3CJNA 2XHKA 2NVUB 2O61A 1Q1VA 3MWMA 2H6CA 1IDZA 3R61A 4L9NA 1JTYA 4JX5A 4BE1A 5GPCA 1IN5A 4ZH4F 4KMFA 4FX4A 3F21A 2CGPA 3FXLA 1D5YA 3S3NA 4J01A 2VBWA 2KRHA 3DP7A 2ECBA 1HLVA 1X19A 3ZMUA 3FMRA 3DCFA 1CF7A 4G6DA 2HOEA 3V4GA 4ZYAA 4HSRA 1VQ4I 2LBFB 3HUGB 1GHCA 3TEDA 1R58A 4PFPA 3LSKA 1L0OC 3N97A 2OBPA 5DS9A 1H8AC 4F52A 2EFWA 3B73A 1W4MA 4BY1J 2MGQA 4JP0A 2E1NA 3TP0A 4S04A 3HUGA 1NH3A 4X6AJ 4OIOF 3U1DA 1BIAA 2FEZA 3CMMA 1MJAA 1YLFA 2OZ6A 2E5NA 2VJIA 2QYOA 4PJ0C 1RRJA 1S29A 3CD6I 2M1BA 4HF0A 3GTMJ 3WTZA 1MBJA 2W85A 4L5EA 4DIQA 3AAFA 3IRQA 4C2UA 4RAGA 1IRXA 1G4DA 1UMQA 5H6RA 3JSPA 3RJPA 2GXAA 1UCRA 1ZG5A 2X6WA 4XK4A 2K4BA 1DPUA 1DP7P 1TW3A 3KE2A 2YSRA 3K9TA 3QODA 3CMAI 1HF0A 4CSWA 5DM7F 3ABKH 2WY7Q 1F1ZA 1Z3XA 4HNVA 2E5ZA 3DEWA 3UR3C 3JRGA 4RGSA 2V7FA 3IH3A 1LUJB 4LLGF 2CQKA 3EUHC 1UAAA 2O03A 1TWAJ 2WADA 3MZYA 3OV8A 3TDZC 2V26A 4PCQA 2Q0OA 4WXDA 2HDWA 3DV8A 5F1JA 5E3MA 1R5HA 1W7PB 4MFDA 1WJBA 2F4MB 2RKHA 4EQQA 4HDUA 1SVMA 5FRNA 5CVUA 3LOCA 3P9IA 1VFCA 3BR2A 5TGTA 2V1NA 4RAZA 1ZGWA 5F08A 5GP9A 2L4MA 2LH9A 4CCLA 1YW8A 4U87A 3QRFF 4Y52J 2N8GA 1W7PA 4AIHA 3GCMA 3BR6A 4RAFA 3KIOA 1FC3A 3G4SI 2KJBA 3LL7A 2HQ5A 2BY1A 3HTUA 3M7GA 2XF7A 5JHFA 1RKWA 2VJJA 3HKZN 1R5GA 2BGCA 3R0AA 4HA8A 2VC1A 4KJZA 4XONA 3F8BA 3G1OA 1Y39A 1HDDC 4M73A 3HOUJ 2FMYA 1HKSA 5EZHA 3WU1B 1K4SA 2RGVA 1EKEA 2BY2A 4HX4A 4XRMA 3WGIA 1AWCA 5JHUA 2IGMA 3CUQB 5GTHC 1RPWA 1X3WB 5IYCJ 4HDVA 3U1KA 4ASNA 3UNGC 2HYJA 3I4PA 1TNTA 4V19K 1OFCX 2C6YA 1AA7A 4AU7A 4I2OA 3GTLJ 2V6EA 1IDYA 4IXAA 1FMVA 3L9FA 3PM1A 3CUQA 5EJCA 2X85A 4U88A 1BI0A 4I0BA 3TKYA 2KFDA 4HOBA 1JJ8C 1NK2P 1YQAA 2M3AA 1TC3C 3E5QA 1G2HA 1D8JA 4IQJA 3S15J 1YE9A 1YJNI 1FOWA 3CQZJ 1ACIA 2EIMH 1GT0C 5CVVA 2DO7A 5BQTA 5EDNA 2VJ5A 3HRMA 1HW2A 3M8JA 1IGNA 4A3CJ 2JPCA 2CQNA 2P4WA 5J8CA 2M35A 1ETYA 2X6OA 1ZR2A 5ICEA 1FOYA 5IPAA 2UUZA 3IHUA 4C9YA 4NB5A 3BWGA 1LDDA 2CFXA 2GA1A 3BROA 3FZVA 3EYIA 3MMYB 3J7YJ 5IP6A 4MQVA 5JLWA 3BG5A 1YJWI 2E19A 5IP7J 3LQQA 1Y6IA 2KIUA 1BR4A 1F36A 4UVAA 3PUFA 2FE3A 1R71A 1ULYA 2QQ8A 2MH9A 1EH7A 3WHBA 1H89C 2D2WA 5AIQA 3M8EA 3O2PE 4XOTA 3E6MA 1BI1A 2F5CA 1WZ2A 2XAHA 4X0GA 2PG4A 5D5WB 4M3FA 3WU2C 3CJQB 1YRNB 3TBIA 4MNUA 4P96A 2COMA 3ZXSA 2J5OA 3GBGA 4NQWB 1KQ9A 2R5ZB 2ZBKA 1FTZA 2ZXIA 3HJEA 5ILUA 3MAJA 5FD6A 3W2AA 4PJLA 4LLNA 1MBKA 2Y69H 2EZLA 1Z3YA 1VQ5I 5F64A 3S1MJ 1S5LC 1VQMI 4ZDPA 5KVRA 3F8MA 1SD4A 4NQWA 2R5ZA 2E36A 3MCZA 2ECCA 1USTA 3BR0A 3DLLF 3V8JA 3LSJA 5CKTA 1IN4A 2MA3A 3NAUA 1Z21A 4E7ZA 4A3EJ 3ERMA 1USSA 4MEYF 1RESA 2HI3A 4V2FA 3J81K 5L3FA 1TP4A 2R7RA 3KEYA 4AWXB 4IZZA 3K4MA 3QYFA 1JGSA 1A36A 3HRUA 3BZKA 2NNNA 2GBYA 2CW0F 4U0WA 3SDGA 5LRSA 1ZHFA 1LQ1A 2HDCA 3GTPJ 5HODA 1TT5B 2A6EF 4MQ9F 1R36A 1I1SA 1ZYRF 1LKXA 2VL8A 4E7JA 1MJBA 2ELKA 1X3ZB 3ULQB 2R3SA 2FQ3A 5H20A 2DMUA 3TGNA 4AIJA 5K1YA 3RZOJ 5D6EA 2LKPA 1FT9A 4I01A 2X1CA 4MIMA 4F55A 1IV6A 4UV8A 1PVEA 5HS8A 1U5TA 3WTXC 4M9SA 2F5FA 3E97A 3CCJI 3AG2H 3S32A 1YFHA 4IHYA 3LSIA 2LK2A 5LLQA 3S3MA 1XMAA 3FISA 3FMQA 1PUFB 1BL0A 2PJRA 3HOZJ 3PQJA 1ZH5A 5ICCA 2BVMA 1S9HA 3EDPA 1ORKA 2R92J 1JE8A 3G6EI 3BP8A 1PUFA 3AL0C 5HNHA 1GUUA 1DP3A 4M3GA 2IXSA 3OYEA 3QAHA 3F0CA 2K3PA 5EG0A 3ZMTA 3OYHA 4Y17A 3VYSB 3IH2A 1QGPA 1ZELA 1PP7U 1VQ9I 5DD8A 2XPVA 3OYNA 3BG7A 2XAUA 1YIOA 4UXNA 2DQRA 3IP4B 1T39A 2VQLA 2WAFA 3VB2A 2TCTA 4E7KA 3HTSB 1V3FA 1FBSA 4CCNA 3CP8A 3TMOA 4C3IJ 1Y0NA 1BM9A 2UXNA 1SFKA 3BR5A 1O3RA 3I4NJ 3ZN0A 2DJIA 3FK7A 1DGRM 2X6YA 3M1CA 2DFIA 1XDUA 1LE8B 1XDSA 5F6FA 1HCRA 3C18A 1BW6A 4IRHA 3J7ZI 1J9IA 2XSDC 2JPBA 1GVDA 1E2XA 1UHWA 1XSXA 2ZB9A 4RA2A 1XD7A 4DJAA 3WTUC 5CQGA 4BE0A 1OQYA 3CF2A 2UWMA 1B72B 1LE8A 2STTA 2YUSA 2DDBA 4QPOA 2Y2ZA 4A6EA 2VONA 3E5UA 5EF6A 5IT3A 3JREA 1X58A 2O6GE 2H1KA 3K4JA 3ZPLA 5FO5A 1J09A 1B72A 4XMYA 2L5QA 2F2EA 1ZR4A 4L5IA 2R7VA 2R5YB 5HLIA 4A3MJ 1LJ9A 3S3OA 2K9LA 2Z1DA 4A5MA 1Z91A 2CS3A 5FKKA 5HS9A 3LAJA 3BZ6A 2P0TA 3GFLA 2R5YA 1FLIA 2RNGA 3IL2A 1SC7A 2D45A 3M8FA 3Q0WA 2R7XA 1ZGJA 2RVCA 4RAYA 5L3BA 3L2WA 1U2WA 3OOUA 4S0HB 1I3QJ 2M45A 2ZC2A 4Z2YA 4XOPA 3RIRA 1R1VA 2KZGA 4BQAA 3QU3A 4G6TB 3MKZA 2F6CA 4KISA 3E1SA 4BXXJ 4C3JJ 3WGHA 4GCVA 4HSTA 3RYPA 3HRSA 4N4OB 4A12A 5FB2A 3H3VK 2CQ7A 1SFUA 1J7KA 4F7ZA 2FBHA 2GOMA 4M9XA 4CCJA 4XLPF 2YR2A 4UB8C 3GFIA 2JUGA 4MLOA 3T8TA 1A6IA 4HV6A 2XIGA 4N9IA 2X98A 2L9RA 2V9PA 1K83J 1MBFA 3K2ZA 1Y8RB 3E7LA 4OOIA 2NVXJ 2P6SA 3ZMVA 2F4OB 1SVLA 2EB7A 2VE8A 2DXIA 1T08B 3HSEA 4O3MA 1LDJA 3G73A 2F48A 2GAUA 1V54H 2JWTA 3J80K 1I27A 1K78B 1VQLI 2Z2SB 1ZRDA 2JA2A 3HOVJ 1FSEA 4FT8A 2IA0A 5A2QR 3FWEA 2DOEA 2L3DA 2E2HJ 4A3GJ 3AKZA 4RB3C 2PMZA 3CMYA 5E1WA 5CPRB 3OYKA 3I56I 4ENJA 1K78A 2XF6A 3FXJA 2CH0A 5IOYA 1ZG1A 2LKSA 1WJFA 5GTIC 3COAC 3C2BA 2WA0A 4WK8F 1RUOA 5GAEJ 1MMSA 2YX4A 1RI7A 1O7LA 1PYVA 2W25A 4IVNA 5BNGA 1VQPI 2L9SA 5FGMA 5JR3A 2IW5A 3VYUB 5E3OA 2GIZA 3BCAA 2FX0A 4L18B 2IS2A 3F72A 5K5RA 3SHFA 1WSUA 3CC7I 3OYIA 2Y48A 3I4MJ 2CUJA 2HOAA 3KLNA 3E3VA 4CHUA 3QPHA 2LKXA 2M4GA 3OY9A 2QLZA 4A5NA 1DDNA 4KFCA 3LA2A 2XGXA 3H9QA 3RDIA 1QZZA 2CW8A 4F92B 2QQAA 4UV9A 1JT0A 2I10A 2MUNA 2IGKA 2Z99A 3CUQC 3TL4X 1ERDA 4KUMA 3J80Z 1D8KA 1KYWA 2WWYA 2M30A 1WJ5A 2W84A 2NYXA 4QSHA 2OV7A 4CGZA 3SXYA 3L2QA 2MSYA 2DMQA 4TV7A 1T98A 4QPQA 3GZ5A 3KFWX 2NS7A 4LB5A 5C44J 1D5VA 2LF8A 1LPQA 2RQPA 1D0ZA 5E3LA 2XC7A 2E7XA 1Z7LA 3W2VA 3CCLI 3FK6A 2DFEA 4QIWN 2DJNA 2P5LC 1R9TJ 1I50J 3KYDB 3R4KA 4BQNA 3DTEA 5M5XJ 1G59A 4C3HJ 4O6JA 2Z5UA 3DQVC 1CGPA 2DI3A 2K85A 1W5CC 4R1HA 3RKYA 1B1BA 3AL0B 5KAFC 1T56A 4RGRA 4G7HF 2VN2A 1TZLA 1RUNA 1U6GA 2RC4A 1Z0XA 2JN6A 3VWBA 1SFOJ 3F6VA 3WGGA 4G8XA 2LFBA 2MD5A 3JRBA 1RZ4A 2HQRA 2VOPA 4KIGA 1UHSA 2EZIA 2JRMA 2LLKA 2NS8A 3HOSA 4BHPA 3L09A 2ZNZA 2QEXI 2LMDA 3I53A 2AHQA 4X1EA 3MKWB 5JI6A 3F8FA 3DXJF 1D0XA 4U7BA 3CCEI 2ZCWA 2KHMA 2RREA 2QKMB 3JR9A 2GWRA 4Y13A 3ZQLA 2LVSA 1ENHA 4A3LJ 5H2FC 2W00A 5HOOA 1MH3A 1LEBA 2FBKA 2XKOA 3V42A 1A35A 4ESFA 3CCRI 3CCMI 1VQOI 1F5TA 5LGNA 4CA0A 3LSPA 1IF1A 3SZPA 2PMHA 4B8XA 1S72I 2ZJRF 4NBQA 1S7AA 3CP2A 4CCKA 1WJEA 3WTYC 3C1DA 2V9VA 1MBHA 2JUCA 1W36D 1GXPA 2QVOA 2PN6A 1UJ8A 4PK4A 2V6CA 2HQAA 4DBRA 3OYMA 2HYGD 3L00A 3RKXA 5FJ8J 3PO3J 1B59A 3MD2A 3RKWA 2FOKA 1MBEA 1Z7UA 2MC4A 4Y33A 2MC3A 1HKTA 1MSFC 3FXQA 1K7AA 3FHNA 1DGWY 4NHJA 5B66C 1XSDA 1CF7B 4EJOA 4KDPA 1U9OA 4IRGA 3BOQA 4U0YA 4ZTJA 1MDMB 2Z3YA 4A0YA 5ICFA 1GV5A 3WTVC 3F3XA 3FXRA 3A2KA 1XB4A 2ICWG 1H0MA 4UUSB 2H94A 2IA1A 3GWZA 1ETXA 1MDMA 3A02A 2L7ZA 4E4HA 4IHXA 2Y75A 1X4PA 1W5TA 1QO0D 3CJRB 1U5TC 2ELJA 4XNFA 3LFUA 3RQ4A 4OINF 1HBXG 2RDPA 1NHAA 4UUSA 5LHGA 3LWFA 2HR3A 1VF9A 2JRTA 3OIQA 4FQGA 2XDVA 4HLYA 4N9HA 3WE2A 2L4AA 2R7ZJ 3WG9A 1BI2A 3IH4A 3PSFA 4Y7NJ 1AOYA 3PUBA 4IPAA 1QA6A 4EGYA 4XSXF 1H9GA 4ABZA 3PFIA 4UVCA 2OQGA 3ECOA 1R1UA 2DN0A 4CYDA 4BKXA 1X4OA 1JT6A 1G3YA 2MD0A 2ZFWA 3HXLA 4M3DA 3JW4A 3OYDA 4J00A 1R22A 4KT5C 5F04A 4MEXF 2EA2A 2QF7A 1U8BA 2NNYA 1EF4A 2DT7B 3A0BC 5KAIC 1YITI 3CLQA 3BJAA 3S93A 4OMZA 2CV2A 3K0LA 5J40A 2K40A 4JX6A 5EGOB 2JT1A 3RKQA 1X2MA 1KA8A 2PMUA 5FFXA 3H36A 4HX7A 2D5VA 2R7QA 3WHCA 1TWCJ 4EJWA 4B43A 4ZC3A 3ABLH 3SEZA 5EGOA 3JRHA 1PUEE 1M1EB 3FXKA 2XAQA 1OCZH 1OCOH 3QYEA 4KMUX 3IUOA 1Z1DA 3H3ZA 2X51A 5DUKA 3IV5A 1KONA 2DT5A 1WH7A 5HVQC 2ZSHB 5F0FA 4PJNA 2FQ4A 1IV8A 1OCPA 4WF2A 4LITA 5DM6F 5GADJ 2XPWA 1ZLJA 4NC6A 2JA5J 2DTRA 3QP6A 2VKEA 1ZREA 1T95A 3TQNA 1P92A 4EM0B 2ACJA 1H9TA 1H88C 2KIMA 1QVTA 4YEJA 4OIRF 2BXYA 1KU3A 1KU9A 2XROA 2FUG2 4C2TA 1P4WA 4BBRJ 4G12A 5GAHJ 4UHTA 1UZCA 4M6VA 4EM2A 2W57A 2IT0A 4F93B 2XRNA 5F27A 4U0VA 3DEEA 3AG1H 4RLFA 2HVQA 1NK3P 4QWQA 2WBMA 2F5EA 3F8CA 1MW7A 3K1NA 2K5CA 4HNUA 5K7HA 1WRJA 3H9GA 5HDNA 4KT6A 5M3FJ 4DBQA 2QBYA 3BQZA 5HDKA 4W97A 2KIFA 1XMXA 4L9VA 4PFOA 4CXFA 1X3UA 2ETHA 2LRDA 1P9QC 4IQ4A 4RDUA 1S7OA 2EILH 2EQRA 4EM1A 1XSVA 1C0WA 1HA8A 3FF5A 3VDXA 3PJRA 4BDZA 2WC2A 3DKYA 1RR8C 2CRGA 2YU3A 3LSGA 4HAMA 3JRDA 3QQAA 1HW5A 2CUEA 3CDIA 1YS6A 5F0CA 1BA5A 2Q8KA 3DTKA 3BG3A 3HRTA 1OKRA 1S6LA 3P5JA 4ANJA 2V1XA 4BEHB 1U0JA 4HF2A 2DA4A 4EVIA 2M8GX 2MZ4A 3KZZA 4H4KC 1SFEA 2TRTA 1XS9A 3FBNB 1OMIA 4F3QA 4IOAF 1X1CA 2D1VA 2JA6J 4Q5SF 4BEHA 3OYAA 2M0MA 2AQEA 4D7MA 2DMTA 2NVQJ 5LBQA 4ESBA 4I09A 1FX7A 3D0SA 1WWXA 2QGUA 3N4MA 2P5VA 2JA7J 4UB6C 2EBIA 2ZJPF 1ZKGA 3IKVA 4GYGA 2K27A 2V9KA 5CQEA 3OS0A 3RTRA 5FRMA 5E8IA 4DYRA 1RETA 2DW4A 2CU7A 4AVPA 3OL4A 3ABUA 4XN0A 3T8RA 1Y8QB 3CCSI 1Z05A 2K9QA 3KCCA 4ENNA 3MQ0A 2QQ9A 1FEXA 2ADUA 3TO6A 2Z9OA 5IYBJ 3LSMA 1NG6A 3A1YA 2P5KA 1MNEA 3SYTA 2EH3A 2TDXA 2CMPA 4GYIA 5D4SA 2QSFX 2NAZA 4EGZA 1J0RA 2LOOA 1LB2A 3WTTC 3KLOA 2HQNA 2LD5A 2QCOA 2L0KA 4HLXA 4O5VA 4YIFA 4BHBA 5E1ZB 4IKFA 1WKMA 2DMPA 2M2EA 1T33A 4XM3A 3ZGKA 4FCYA 3VSKA 2COBA 1FP2A 2DK5A 1IN7A 2EPFA 2V79A 2K9MA 2AXTC 2JVHA 3HEFA 2CYYA 4IJAA 4BAYA 2DA7A 3LSRA 1T0FA 1FZPB 3HYIA 3KP3A 3KZIC 4AYBA 4DGWB 4KN7X 1MMAA 1XX5A 1APLC 2L7KA 1KQ8A 1G3SA 1D1BA 4KA4A 4RB1A 1ZG3A 3U21A 2F5VA 1Q1HA 3Q9VA 4CZZA 2RQQA 4ON0A 4ENMA 1OJLA 1FPQA 1JUMA 3M9AA 3GX4X 2VC0A 1VQKI 2ZO4A 3HOTA 1V5GA 3H9JA 2VPRA 3ZQCA 2X0LA 1SVOA 4E70A 3PIPF 3CO6C 1DPRA 1U5TB 1XCBA 3IAM2 5HDGA 3RZDJ 3ABMH 5D6FA 1KU2A 1S3JA 3K70C 4YIRX 4HQEA 2PJRB 2GOXB 2MH2A 2KDZA 5L3DA 1W1WE 3FHZA 1EV7A 2KL4A 1VI0A 2HZDA 2Y0SA 5A2QK 4GO1A 2K9SA 4NC7A 4ZJZA 3S1QJ 3DU6A 1POGA 1HSJA 1T38A 2BEOA 5CVIA 3SJMA 2V4JC 2WB1A 3RQIA 1AKHB 2W7NA 2PJPA 3JAMK 4KN4X 3MFKA 4A3DJ 4XKCA 2KP6A 5EG0B 3LSTA 2XVCA 4IHSA 2M5WA 1Y1WJ 1UHMA 2ZMEB 3K4KA 2MG4A 1ETQA 1AKHA 4BUPA 2JA8J 2KZVA 2LY9A 2WY8Q 3IKTA 3UKGA 3I0TA 2VKVA 4D9JA 2VKHA 3R60A 1S8NA 2ZMEA 2DYRH 5TISC 1IUYA 5FLXR 1EJ9A 4BS9A 5J1UA 2H8RA 2EK5A 5BOXA 4N0BA 2FSWA 5CJ9A 3OL3A 1KU7A 1VZ0A 4A2UA 4YFNF 2JQ7A 4OU0A 2OZUA 5D5VB 2JMWA 3GO5A 4M72A 2VI6A 1D3YA 1UFMA 2EFPA 2O3FA 1OYIA 5D4RA 2MLKA 1A31A 3HOYJ 1TLHB 3HPGA 5EYRA 1P6RA 5KHDA 3OYCA 2OU2A 2WAEA 1XPXA 2B7EA 4JK1X 1R7JA 4HYEA 2MLGA 1FWZA 1WHUA 2BVLA 2E1CA 2BW3B 4EMSA 4RS8A 3IAS2 4P1WA 2R7TA 1F43A 3LAPA 1FSHA 2YS9A 2DLLA 4PSXA 4HZFA 3REOA 3SDBA 1PP8F 3HGGA 2OAZA 2KJCA 1LVKA 3DWLE 5DV5A 5A2QZ 1SMYF 2BW3A 4ZDLA 1K6OA 4M3EA 2ZSIB 3BQYA 3ECHA 4JQFA 4LG3A 4XN3A 3JAMZ 3L2RA 2CFOA 4A3BJ 2CV1A 5DYMA 2HTJA 2DA3A 3A0HC 2F4IA 4RGUA 2QQBA 3ISPA 1X2NA 1T8IA 4A3FJ 3NWSA 1R4MB 3O3KA 2Q2EB 3ZMDA 1O3QA 5CLSA 4EJVA 4XQFA 2QSHX 4DYCA 2KRCA 1J75A 3ZQGA 3RPUD 1HOMA 3BJOA 5FLVA 2Q2EA 3BZCA 4A3KJ 1BBYA 4R8HA 4PSWA 2O5RA 4WXHA 3GTGJ 1YW9A
chains in the Genus database with same CATH topology
3KZYA 1G3TA 4PGGA 4BXUA 2G7UA 1ONVA 4A0ZA 4KIBA 4IF4A 3KP5A 1EH8A 1MD0A 2V1DA 4WCGA 1WI9A 2F5DA 5L3GA 5K5OA 1XGSA 2NRAC 2FF4A 5IT9K 1TW2A 1TTYA 1FY7A 1MKMA 3GXOA 4I02A 2HYFA 4G9YA 4XLNF 2EJRA 2QENA 3U2RA 1YW9A 2IRFG 3I5UA 3MZHA 2DQLA 3I58A 3S2WA 4B09A 3BJ6A 2FRHA 5EEHA 1JHHA 2HKXA 3LQRA 4HX8A 2GZWA 2LDUA 2W24A 2VOOA 2DU9A 4LFUA 1LVAA 3ABTA 2P7CB 3GYHX 1ODDA 1KQ0A 2ISZA 2A6HF 1SD5A 4G7OF 3D5LA 2WTEA 1B9MA 3CLOA 1U78A 3JSOA 3C3WA 5IT9Z 1L3LA 4RGXA 1TQMA 1YW7A 1B4AA 2H09A 3V8LA 1EH6A 1FBQA 4MGRA 3B02A 2XKPA 5J6XA 1ZRFA 3CDHA 3KETA 2HS5A 2DPUA 2G7HA 3ELKA 3TO9A 2VBYA 4M74A 5DEQA 2IPQX 2R7FA 3RYRA 1ON2A 1UB9A 2X4HA 3IRRA 4GXOA 5L3EA 3SZTA 3K1MA 5JFRA 2MBFA 1O3SA 3FM5A 1RIOH 1XCVA 4ZZLA 3NQOA 4KICA 3W6JB 5LRRA 4BYYA 3SQNA 3KP4A 2A3SA 1QZYA 2H27A 3BPXA 2P8TA 1BC7C 4IHTA 4M6XA 4P5OA 1TBXA 1LDKB 4LK1F 4ZYEA 3GVAA 2V1UA 1ZN2A 1P2FA 5EEGA 1QBJA 1XGMA 1R00A 4I0AA 6PAXA 2VT2A 4YFKF 4I7HA 5AONA 2ZKZA 3ZN1A 2VE9A 4KNYA 2OQRA 2IJLA 2ZXJA 3QOPA 5D5XB 1BN5A 3CTAA 2VBZA 3I54A 3QP5A 2XASA 3TO7A 2BV6A 4XRFA 2EWNA 4PZJA 3DPTA 4EJUA 4MTEA 2D1HA 2HFHA 4DNCA 3QPTA 3E6DA 4U7DA 3ZMSA 3P9KA 4L9TA 2JSCA 4D0PA 3DFGA 3ZMZA 4HW0A 3VEPA 4CDGA 4EJTA 2G9WA 1A04A 3EETA 4I98B 2DK8A 1G6NA 1FYLA 3DPLC 1W7PD 5JVTA 1IXCA 2M87A 3ERED 5LHHA 3WTSC 2FNPA 1K79A 3HHGA 5E17F 1T2KA 2FBIA 2XUBA 4XSZF 3HSFA 3WODF 3V7CA 3I59B 4UVBA 2IVMA 4R79A 1BC8C 3LFKA 3I59A 3F8NA 1B6AA 2PFBA 1ZAOA 3E5XA 5BPIA 1KGSA 5DD4A 4YIIA 4L9JA 5ILSA 4KIFA 4HV5A 3T0YA 2L01A 1V4RA 1QNTA 2L02A 1ON1A 2BYVE 2HGCA 1IZ1A 1LNWA 2QBYB 3EQLF 1OYYA 4AIKA 1IXRC 4EV0A 4G94A 4CO8A 4Y15A 2Y0MA 1IN8A 5FLXK 4M6YA 4Q47A 1XMKA 4WX9A 3I71A 1IN6A 2P7VB 1YTYA 5H6QA 4CICA 3KEOA 5KK1A 3CO7C 4Q48A 1FOKA 5ERIA 1XGNA 3M1EA 4LG0B 4BNCA 2EA4A 1SD7A 5D5UB 3L7WA 2RNJA 3RI4A 1O3TA 4M9ZA 5E18F 4KYWA 3E6CC 4LG0A 3ZP5A 3OOPA 2QZ8A 1FBUA 3G3ZA 1OR7A 1J5YA 1GVJA 2JZYA 1E17A 2EFNA 1GXQA 4UUVA 1T6SA 1SAXA 3HIFA 3GUDA 2K02A 5FLXZ 5LGUA 1HQCA 2FA5A 2LSOA 2OA4A 4RB0A 5D8LB 1F4KA 3KP2A 3P7NA 2HTSA 5DUIA 1YS7A 4P9FA 3L2CA 4M71A 3O6BB 1Z6TA 2PBIA 1YO5C 3W6KB 1W5SA 2O0YA 3JTHA 5HS7A 3HHHA 3NRVA 4L5JA 4FHTA 4LB6B 5DCFA 1Z9CA 2EFOA 3F23A 5ICGA 4ENKA 2A69F 3ZQ7A 2UXXA 1ZRCA 3K69A 5E1XA 1FP1D 1BIBA 4A6DA 5TRDA 2BBYA 2PI0A 1FNNA 2GA2A 3TOAA 2RN7A 4HBLA 4PDKA 4JBAA 4LMYA 4IRIA 3BDDA 2YPRA 4WWCA 2GXGA 5BPDA 1HXDA 1ZGAA 1B9NA 1STZA 1O7FA 1TNSA 5LEJA 2H6BA 2CWEA 2VXZA 1REPC 1R1TA 2HEOA 2M8EA 5FFZA 4H0EA 2J5PA 3ROUA 1JHFA 2XAFA 2E7WA 2VT3A 1Y0UA 4OIPF 5CVRA 3F22A 2NS0A 4P9UA 1F9NA 2VBXA 1IW7F 4MTDA 1BJAA 3K1PA 3Q9SA 3J81Z 3TOBA 4G7ZF 3DKWA 4HQMA 2AS5F 3JTGA 2A5YB 4UNOA 1VTNC 1TQPA 1BOAA 3GW2A 5BS6A 1PDNC 2L54A 2B0LA 2ESNA 3GF2A 5J8FA 4L0ZB 2ISYA 3EUHA 5LGTA 3FM3A 2ZNYA 2EV5A 3VODA 1MZBA 5E20A 2FXAA 1YG2A 5E8GA 4XBFA 3DEUA 1IXSB 4GGGA 1KYZA 1I5ZA 3H92A 4Q4ZF 5HLGA 3SFZA 2O8XA 2IA2A 1OPCA 2LF7A 2HZTA 1IAWA 4ZZDA 5LEKA 3R6SA 5LHIA 2CSOA 2DAOA 1R23A 5BMZA 4G6QA 1P4XA 3V7RA 1OYWA 1ZARA 1BI3A 1XN7A 2K86A 4BHCA 3MEXA 1J59A 2PEXA 2GQQA 3BPVA 2A68F 1DUXC 4WXCA 2HKOA 1U8RA 1I6XA 4ZYGA 2RV8A 3RPQA 2GXBA 1QQIA 2A61A 1FYMA 1J2XA 2PLYA 2GIVA 3IWZA 2ELHA 3GFJA 4YG2F 1JXSA 1P4AA 1Z6RA 2KKOA 2ZJ2A 2IP2A 3NEUA 1MGTA 2UZKA 4RB2C 3RPUA 3KP6A 5HLHA 3V8KA 4ESJA 4AD9A 2EFQA 3QU6A 1HKQA 2QUFA 2EV6A 1G3WA 2FU4A 2QWWA 1I1GA 4DQ2A 4BH9A 2DBBA 1TQIA 2FNAA 1SD6A 3I64A 2CG4A 5TJJA 3IC7A 3T1BA 2Z33A 4ZYHA 2XV4S 4S05A 5F1RA 1RNLA 2LNBA 3DF8A 2WV0A 1QPMA 2R7DA 3H3UA 5DCMB 2EV0A 3U9GA 1HW1A 3F6OA 1LEAA 3VFZA 2ESHA 4OIQF 3C7JA 5DCMA 4LLLA 3HSRA 2AXLA 2VODA 5DDGA 2A07F 4MHGA 2K4JA 3FXUA 3R0JA 3FMSA 2BE5F 1IRGA 1FYKA 3BY6A 2HWVA 2PQ8A 1SMTA 2CO5A 3PQKA 5K5QA 2QM3A 2FMLA 3ML6A 4LJZF 3IWFA 2KRFA 3KEQA 5L3CA 3J7AO 4LK0F 2K7LA 3WE3A 5ED4A 2XAJA 4QLCU 1ZLKA 3WTWC 4A0XA 3CUOA 1SFXA 3T5XA 2OD5A 1MJ9A 3Q5FA 3VOEA 4K2EA 4PGHA 1YYVA 3EYYA 3V7SA 3GZ6A 4OMYA 4YFXF 5ILVA 5CVJA 4FX0A 3E6BA 2P6TA 1IRFA 1HSTA 3GEZA 4HF1A 4LGWA 3WU0A 1WQ2A 4P55A 5CYVA 2JTVA 4L0YB 1U3EM 2YX7A 3GLXA 5AIPA 3LA3A 2DPDA 1O57A 4LD5A 1XGOA 5D8KB 3LA7A 3KP7A 2XAGA 4ZYDA 3FX3A 2STWA 3TDUC 5FD5A 3GFMA 4ETSA 3P9CA 3CJNA 2XHKA 2O61A 3MWMA 2H6CA 3R61A 4L9NA 1IN5A 4ZH4F 4KMFA 4FX4A 3F21A 2CGPA 2VBWA 3DP7A 3ZMUA 3FMRA 1CF7A 4G6DA 2HOEA 3V4GA 1GHCA 1R58A 1L0OC 3N97A 2OBPA 2EFWA 3B73A 1W4MA 2E1NA 4S04A 3HUGA 4OIOF 3U1DA 1BIAA 2FEZA 1MJAA 1YLFA 2OZ6A 2QYOA 1S29A 2M1BA 4HF0A 3WTZA 2W85A 3AAFA 3IRQA 1G4DA 5H6RA 3JSPA 3RJPA 1UCRA 1ZG5A 2K4BA 1DPUA 1DP7P 1TW3A 3KE2A 2YSRA 3K9TA 1F1ZA 4RGSA 4LLGF 2CQKA 2O03A 3MZYA 3OV8A 3TDZC 4PCQA 2Q0OA 4WXDA 3DV8A 1R5HA 1W7PB 2RKHA 4EQQA 4HDUA 5CVUA 3P9IA 4RAZA 2L4MA 1YW8A 3QRFF 1W7PA 4AIHA 1FC3A 2KJBA 3HTUA 3M7GA 1R5GA 2BGCA 3R0AA 4HA8A 2VC1A 3F8BA 4M73A 2FMYA 1HKSA 3WU1B 2RGVA 4HX4A 3WGIA 1AWCA 5JHUA 3CUQB 4HDVA 4ASNA 3I4PA 1TNTA 2C6YA 4I2OA 4IXAA 3L9FA 3CUQA 4U88A 1BI0A 4I0BA 3TKYA 4HOBA 1YQAA 3E5QA 1D8JA 5CVVA 2DO7A 5BQTA 3HRMA 1HW2A 2JPCA 2P4WA 5J8CA 5ICEA 3IHUA 4NB5A 3BWGA 1LDDA 2CFXA 2GA1A 3BROA 3FZVA 3EYIA 4MQVA 3LQQA 2KIUA 4UVAA 2FE3A 1ULYA 2MH9A 1EH7A 2D2WA 5AIQA 3M8EA 3O2PE 3E6MA 1BI1A 2F5CA 2XAHA 2PG4A 5D5WB 4MNUA 4P96A 2COMA 2J5OA 1KQ9A 2ZBKA 5ILUA 3MAJA 5FD6A 4LLNA 5F64A 5KVRA 3F8MA 1SD4A 4NQWA 3MCZA 1USTA 3V8JA 1IN4A 2MA3A 1USSA 4MEYF 3J81K 5L3FA 4AWXB 1JGSA 3HRUA 2NNNA 2CW0F 4U0WA 5LRSA 1ZHFA 1LQ1A 2HDCA 2A6EF 4MQ9F 1R36A 1I1SA 1ZYRF 1MJBA 3ULQB 2R3SA 2FQ3A 5H20A 3TGNA 4AIJA 5K1YA 5D6EA 2LKPA 1FT9A 4I01A 4UV8A 5HS8A 1U5TA 3WTXC 4M9SA 2F5FA 3E97A 1YFHA 5LLQA 1XMAA 3FMQA 3PQJA 1ZH5A 5ICCA 3EDPA 1JE8A 3BP8A 3QAHA 3ZMTA 4Y17A 1QGPA 1PP7U 5DD8A 4UXNA 1YIOA 2DQRA 1T39A 3VB2A 3HTSB 1V3FA 1FBSA 1BM9A 2UXNA 1O3RA 3ZN0A 2DFIA 1XDUA 1XDSA 5F6FA 3C18A 4IRHA 1J9IA 2JPBA 1E2XA 1UHWA 1XSXA 1XD7A 3WTUC 2UWMA 2STTA 4A6EA 2VONA 3E5UA 2O6GE 3ZPLA 5FO5A 2F2EA 4L5IA 5HLIA 1LJ9A 4A5MA 1Z91A 5HS9A 3LAJA 3BZ6A 3GFLA 1FLIA 3IL2A 2D45A 3M8FA 1ZGJA 2RVCA 4RAYA 5L3BA 1U2WA 2M45A 4Z2YA 3RIRA 1R1VA 4BQAA 3QU3A 3WGHA 4GCVA 3RYPA 3HRSA 4A12A 5FB2A 1SFUA 1J7KA 4F7ZA 2FBHA 4M9XA 4XLPF 2YR2A 3GFIA 3T8TA 4HV6A 2XIGA 4N9IA 3K2ZA 4OOIA 2P6SA 3ZMVA 2EB7A 2VE8A 3HSEA 4O3MA 1LDJA 3G73A 2GAUA 3J80K 1I27A 1K78B 1ZRDA 1FSEA 4FT8A 2IA0A 3FWEA 2L3DA 4RB3C 5E1WA 4ENJA 1K78A 1ZG1A 3COAC 4WK8F 1RUOA 2YX4A 1RI7A 1O7LA 2W25A 4IVNA 5FGMA 5JR3A 2IW5A 4L18B 3F72A 5K5RA 3SHFA 1WSUA 2Y48A 3KLNA 3E3VA 4CHUA 3QPHA 2QLZA 4A5NA 1DDNA 4KFCA 3LA2A 2XGXA 3RDIA 1QZZA 2QQAA 4UV9A 2Z99A 3CUQC 4KUMA 3J80Z 1D8KA 1KYWA 2WWYA 2M30A 2W84A 2NYXA 4CGZA 3SXYA 4TV7A 1T98A 3GZ5A 3KFWX 4LB5A 1D5VA 2LF8A 2RQPA 2E7XA 2P5LC 3R4KA 4O6JA 2Z5UA 3DQVC 1CGPA 2DI3A 4R1HA 3RKYA 1B1BA 4RGRA 4G7HF 2VN2A 1RUNA 1U6GA 2RC4A 3F6VA 3WGGA 4G8XA 2MD5A 1RZ4A 2HQRA 2VOPA 4KIGA 3HOSA 4BHPA 3L09A 2ZNZA 3I53A 5JI6A 3F8FA 3DXJF 4U7BA 2ZCWA 2GWRA 4Y13A 5HOOA 1LEBA 2FBKA 2XKOA 4ESFA 1F5TA 5LGNA 1IF1A 3SZPA 2PMHA 4B8XA 1S7AA 3WTYC 3C1DA 2V9VA 1GXPA 2QVOA 2PN6A 2V6CA 2HYGD 3L00A 3RKXA 1B59A 3RKWA 2FOKA 1Z7UA 2MC3A 1HKTA 3FXQA 1K7AA 4NHJA 1XSDA 1CF7B 4EJOA 4KDPA 4IRGA 3BOQA 4U0YA 1MDMB 2Z3YA 4A0YA 5ICFA 3WTVC 3F3XA 3FXRA 1XB4A 1H0MA 2H94A 2IA1A 3GWZA 1MDMA 2Y75A 1W5TA 1QO0D 1U5TC 4OINF 1HBXG 2RDPA 1NHAA 5LHGA 3LWFA 2HR3A 2JRTA 4HLYA 4N9HA 3WE2A 2L4AA 3WG9A 1BI2A 1AOYA 4IPAA 4EGYA 4XSXF 1H9GA 3PFIA 4UVCA 2OQGA 3ECOA 1R1UA 4CYDA 1G3YA 2ZFWA 3JW4A 1R22A 4KT5C 4MEXF 2EA2A 2NNYA 3BJAA 4OMZA 3K0LA 2JT1A 1KA8A 2PMUA 5FFXA 4HX7A 4EJWA 1PUEE 2XAQA 4KMUX 1Z1DA 3H3ZA 5DUKA 2DT5A 5HVQC 4WF2A 1ZLJA 2DTRA 3QP6A 1ZREA 3TQNA 1P92A 4EM0B 2ACJA 1H9TA 2KIMA 4OIRF 1KU3A 1KU9A 2XROA 1P4WA 4UHTA 4EM2A 2W57A 2IT0A 2XRNA 4U0VA 4QWQA 2F5EA 3F8CA 3K1NA 1WRJA 5HDNA 2QBYA 5HDKA 2KIFA 4L9VA 4CXFA 1X3UA 2ETHA 1S7OA 4EM1A 1XSVA 1C0WA 3FF5A 2WC2A 2YU3A 4HAMA 1HW5A 1YS6A 2Q8KA 3HRTA 1OKRA 1S6LA 2V1XA 4HF2A 4EVIA 3KZZA 1SFEA 1OMIA 2D1VA 4Q5SF 5LBQA 4ESBA 4I09A 1FX7A 3D0SA 1WWXA 3N4MA 2P5VA 3IKVA 4GYGA 2K27A 3RTRA 5E8IA 2DW4A 4AVPA 3ABUA 3T8RA 1Z05A 4ENNA 3KCCA 3MQ0A 2QQ9A 2ADUA 3TO6A 2Z9OA 2P5KA 2TDXA 4GYIA 5D4SA 2NAZA 4EGZA 1J0RA 1LB2A 3WTTC 3KLOA 2HQNA 4YIFA 4HLXA 4O5VA 4BHBA 5E1ZB 1WKMA 1FP2A 2DK5A 1IN7A 2V79A 2CYYA 4IJAA 4BAYA 1T0FA 1FZPB 3HYIA 3KP3A 4KN7X 1KQ8A 1G3SA 4KA4A 4RB1A 1ZG3A 3Q9VA 1Q1HA 4CZZA 4ON0A 4ENMA 1FPQA 3M9AA 3GX4X 2VC0A 2ZO4A 3HOTA 2X0LA 4E70A 3CO6C 1DPRA 1U5TB 1XCBA 5HDGA 5D6FA 1KU2A 1S3JA 4HQEA 2MH2A 5L3DA 3FHZA 1EV7A 5A2QK 4GO1A 1T38A 1HSJA 2BEOA 5CVIA 2PJPA 3JAMK 4KN4X 3MFKA 3LSTA 2XVCA 4IHSA 2M5WA 1UHMA 2ZMEB 3IKTA 3I0TA 3R60A 1S8NA 2ZMEA 1IUYA 2EK5A 5BOXA 4N0BA 2FSWA 5CJ9A 1KU7A 4A2UA 4YFNF 4OU0A 2OZUA 5D5VB 3GO5A 4M72A 1D3YA 1UFMA 2EFPA 2O3FA 1OYIA 5D4RA 2MLKA 1TLHB 1P6RA 2OU2A 4JK1X 1R7JA 4HYEA 2MLGA 1FWZA 2E1CA 4EMSA 4RS8A 3LAPA 1FSHA 2DLLA 1PP8F 4HZFA 3REOA 2OAZA 2KJCA 5DV5A 5A2QZ 1SMYF 1K6OA 3ECHA 4JQFA 3JAMZ 5DYMA 2HTJA 4RGUA 2QQBA 3ISPA 3O3KA 3ZMDA 1O3QA 5CLSA 4EJVA 1J75A 3BJOA 2Q2EA 1BBYA 4R8HA 4WXHA 5IT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZY A;  1G3T A;  4PGG A;  4BXU A;  2G7U A;  1ONV A;  4A0Z A;  4KIB A;  4IF4 A;  3KP5 A;  1EH8 A;  1MD0 A;  2V1D A;  4WCG A;  1WI9 A;  2F5D A;  5L3G A;  5K5O A;  1XGS A;  2NRA C;  2FF4 A;  5IT9 K;  1TW2 A;  1TTY A;  1FY7 A;  1MKM A;  3GXO A;  4I02 A;  2HYF A;  4G9Y A;  4XLN F;  2EJR A;  2QEN A;  3U2R A;  1YW9 A;  2IRF G;  3I5U A;  3MZH A;  2DQL A;  3I58 A;  3S2W A;  4B09 A;  3BJ6 A;  2FRH A;  5EEH A;  1JHH A;  2HKX A;  3LQR A;  4HX8 A;  2GZW A;  2LDU A;  2W24 A;  2VOO A;  2DU9 A;  4LFU A;  1LVA A;  3ABT A;  2P7C B;  3GYH X;  1ODD A;  1KQ0 A;  2ISZ A;  2A6H F;  1SD5 A;  4G7O F;  3D5L A;  2WTE A;  1B9M A;  3CLO A;  1U78 A;  3JSO A;  3C3W A;  5IT9 Z;  1L3L A;  4RGX A;  1TQM A;  1YW7 A;  1B4A A;  2H09 A;  3V8L A;  1EH6 A;  1FBQ A;  4MGR A;  3B02 A;  2XKP A;  5J6X A;  1ZRF A;  3CDH A;  3KET A;  2HS5 A;  2DPU A;  2G7H A;  3ELK A;  3TO9 A;  2VBY A;  4M74 A;  5DEQ A;  2IPQ X;  2R7F A;  3RYR A;  1ON2 A;  1UB9 A;  2X4H A;  3IRR A;  4GXO A;  5L3E A;  3SZT A;  3K1M A;  5JFR A;  2MBF A;  1O3S A;  3FM5 A;  1RIO H;  1XCV A;  4ZZL A;  3NQO A;  4KIC A;  3W6J B;  5LRR A;  4BYY A;  3SQN A;  3KP4 A;  2A3S A;  1QZY A;  2H27 A;  3BPX A;  2P8T A;  1BC7 C;  4IHT A;  4M6X A;  4P5O A;  1TBX A;  1LDK B;  4LK1 F;  4ZYE A;  3GVA A;  2V1U A;  1ZN2 A;  1P2F A;  5EEG A;  1QBJ A;  1XGM A;  1R00 A;  4I0A A;  6PAX A;  2VT2 A;  4YFK F;  4I7H A;  5AON A;  2ZKZ A;  3ZN1 A;  2VE9 A;  4KNY A;  2OQR A;  2IJL A;  2ZXJ A;  3QOP A;  5D5X B;  1BN5 A;  3CTA A;  2VBZ A;  3I54 A;  3QP5 A;  2XAS A;  3TO7 A;  2BV6 A;  4XRF A;  2EWN A;  4PZJ A;  3DPT A;  4EJU A;  4MTE A;  2D1H A;  2HFH A;  4DNC A;  3QPT A;  3E6D A;  4U7D A;  3ZMS A;  3P9K A;  4L9T A;  2JSC A;  4D0P A;  3DFG A;  3ZMZ A;  4HW0 A;  3VEP A;  4CDG A;  4EJT A;  2G9W A;  1A04 A;  3EET A;  4I98 B;  2DK8 A;  1G6N A;  1FYL A;  3DPL C;  1W7P D;  5JVT A;  1IXC A;  2M87 A;  3ERE D;  5LHH A;  3WTS C;  2FNP A;  1K79 A;  3HHG A;  5E17 F;  1T2K A;  2FBI A;  2XUB A;  4XSZ F;  3HSF A;  3WOD F;  3V7C A;  3I59 B;  4UVB A;  2IVM A;  4R79 A;  1BC8 C;  3LFK A;  3I59 A;  3F8N A;  1B6A A;  2PFB A;  1ZAO A;  3E5X A;  5BPI A;  1KGS A;  5DD4 A;  4YII A;  4L9J A;  5ILS A;  4KIF A;  4HV5 A;  3T0Y A;  2L01 A;  1V4R A;  1QNT A;  2L02 A;  1ON1 A;  2BYV E;  2HGC A;  1IZ1 A;  1LNW A;  2QBY B;  3EQL F;  1OYY A;  4AIK A;  1IXR C;  4EV0 A;  4G94 A;  4CO8 A;  4Y15 A;  2Y0M A;  1IN8 A;  5FLX K;  4M6Y A;  4Q47 A;  1XMK A;  4WX9 A;  3I71 A;  1IN6 A;  2P7V B;  1YTY A;  5H6Q A;  4CIC A;  3KEO A;  5KK1 A;  3CO7 C;  4Q48 A;  1FOK A;  5ERI A;  1XGN A;  3M1E A;  4LG0 B;  4BNC A;  2EA4 A;  1SD7 A;  5D5U B;  3L7W A;  2RNJ A;  3RI4 A;  1O3T A;  4M9Z A;  5E18 F;  4KYW A;  3E6C C;  4LG0 A;  3ZP5 A;  3OOP A;  2QZ8 A;  1FBU A;  3G3Z A;  1OR7 A;  1J5Y A;  1GVJ A;  2JZY A;  1E17 A;  2EFN A;  1GXQ A;  4UUV A;  1T6S A;  1SAX A;  3HIF A;  3GUD A;  2K02 A;  5FLX Z;  5LGU A;  1HQC A;  2FA5 A;  2LSO A;  2OA4 A;  4RB0 A;  5D8L B;  1F4K A;  3KP2 A;  3P7N A;  2HTS A;  5DUI A;  1YS7 A;  4P9F A;  3L2C A;  4M71 A;  3O6B B;  1Z6T A;  2PBI A;  1YO5 C;  3W6K B;  1W5S A;  2O0Y A;  3JTH A;  5HS7 A;  3HHH A;  3NRV A;  4L5J A;  4FHT A;  4LB6 B;  5DCF A;  1Z9C A;  2EFO A;  3F23 A;  5ICG A;  4ENK A;  2A69 F;  3ZQ7 A;  2UXX A;  1ZRC A;  3K69 A;  5E1X A;  1FP1 D;  1BIB A;  4A6D A;  5TRD A;  2BBY A;  2PI0 A;  1FNN A;  2GA2 A;  3TOA A;  2RN7 A;  4HBL A;  4PDK A;  4JBA A;  4LMY A;  4IRI A;  3BDD A;  2YPR A;  4WWC A;  2GXG A;  5BPD A;  1HXD A;  1ZGA A;  1B9N A;  1STZ A;  1O7F A;  1TNS A;  5LEJ A;  2H6B A;  2CWE A;  2VXZ A;  1REP C;  1R1T A;  2HEO A;  2M8E A;  5FFZ A;  4H0E A;  2J5P A;  3ROU A;  1JHF A;  2XAF A;  2E7W A;  2VT3 A;  1Y0U A;  4OIP F;  5CVR A;  3F22 A;  2NS0 A;  4P9U A;  1F9N A;  2VBX A;  1IW7 F;  4MTD A;  1BJA A;  3K1P A;  3Q9S A;  3J81 Z;  3TOB A;  4G7Z F;  3DKW A;  4HQM A;  2AS5 F;  3JTG A;  2A5Y B;  4UNO A;  1VTN C;  1TQP A;  1BOA A;  3GW2 A;  5BS6 A;  1PDN C;  2L54 A;  2B0L A;  2ESN A;  3GF2 A;  5J8F A;  4L0Z B;  2ISY A;  3EUH A;  5LGT A;  3FM3 A;  2ZNY A;  2EV5 A;  3VOD A;  1MZB A;  5E20 A;  2FXA A;  1YG2 A;  5E8G A;  4XBF A;  3DEU A;  1IXS B;  4GGG A;  1KYZ A;  1I5Z A;  3H92 A;  4Q4Z F;  5HLG A;  3SFZ A;  2O8X A;  2IA2 A;  1OPC A;  2LF7 A;  2HZT A;  1IAW A;  4ZZD A;  5LEK A;  3R6S A;  5LHI A;  2CSO A;  2DAO A;  1R23 A;  5BMZ A;  4G6Q A;  1P4X A;  3V7R A;  1OYW A;  1ZAR A;  1BI3 A;  1XN7 A;  2K86 A;  4BHC A;  3MEX A;  1J59 A;  2PEX A;  2GQQ A;  3BPV A;  2A68 F;  1DUX C;  4WXC A;  2HKO A;  1U8R A;  1I6X A;  4ZYG A;  2RV8 A;  3RPQ A;  2GXB A;  1QQI A;  2A61 A;  1FYM A;  1J2X A;  2PLY A;  2GIV A;  3IWZ A;  2ELH A;  3GFJ A;  4YG2 F;  1JXS A;  1P4A A;  1Z6R A;  2KKO A;  2ZJ2 A;  2IP2 A;  3NEU A;  1MGT A;  2UZK A;  4RB2 C;  3RPU A;  3KP6 A;  5HLH A;  3V8K A;  4ESJ A;  4AD9 A;  2EFQ A;  3QU6 A;  1HKQ A;  2QUF A;  2EV6 A;  1G3W A;  2FU4 A;  2QWW A;  1I1G A;  4DQ2 A;  4BH9 A;  2DBB A;  1TQI A;  2FNA A;  1SD6 A;  3I64 A;  2CG4 A;  5TJJ A;  3IC7 A;  3T1B A;  2Z33 A;  4ZYH A;  2XV4 S;  4S05 A;  5F1R A;  1RNL A;  2LNB A;  3DF8 A;  2WV0 A;  1QPM A;  2R7D A;  3H3U A;  5DCM B;  2EV0 A;  3U9G A;  1HW1 A;  3F6O A;  1LEA A;  3VFZ A;  2ESH A;  4OIQ F;  3C7J A;  5DCM A;  4LLL A;  3HSR A;  2AXL A;  2VOD A;  5DDG A;  2A07 F;  4MHG A;  2K4J A;  3FXU A;  3R0J A;  3FMS A;  2BE5 F;  1IRG A;  1FYK A;  3BY6 A;  2HWV A;  2PQ8 A;  1SMT A;  2CO5 A;  3PQK A;  5K5Q A;  2QM3 A;  2FML A;  3ML6 A;  4LJZ F;  3IWF A;  2KRF A;  3KEQ A;  5L3C A;  3J7A O;  4LK0 F;  2K7L A;  3WE3 A;  5ED4 A;  2XAJ A;  4QLC U;  1ZLK A;  3WTW C;  4A0X A;  3CUO A;  1SFX A;  3T5X A;  2OD5 A;  1MJ9 A;  3Q5F A;  3VOE A;  4K2E A;  4PGH A;  1YYV A;  3EYY A;  3V7S A;  3GZ6 A;  4OMY A;  4YFX F;  5ILV A;  5CVJ A;  4FX0 A;  3E6B A;  2P6T A;  1IRF A;  1HST A;  3GEZ A;  4HF1 A;  4LGW A;  3WU0 A;  1WQ2 A;  4P55 A;  5CYV A;  2JTV A;  4L0Y B;  1U3E M;  2YX7 A;  3GLX A;  5AIP A;  3LA3 A;  2DPD A;  1O57 A;  4LD5 A;  1XGO A;  5D8K B;  3LA7 A;  3KP7 A;  2XAG A;  4ZYD A;  3FX3 A;  2STW A;  3TDU C;  5FD5 A;  3GFM A;  4ETS A;  3P9C A;  3CJN A;  2XHK A;  2O61 A;  3MWM A;  2H6C A;  3R61 A;  4L9N A;  1IN5 A;  4ZH4 F;  4KMF A;  4FX4 A;  3F21 A;  2CGP A;  2VBW A;  3DP7 A;  3ZMU A;  3FMR A;  1CF7 A;  4G6D A;  2HOE A;  3V4G A;  1GHC A;  1R58 A;  1L0O C;  3N97 A;  2OBP A;  2EFW A;  3B73 A;  1W4M A;  2E1N A;  4S04 A;  3HUG A;  4OIO F;  3U1D A;  1BIA A;  2FEZ A;  1MJA A;  1YLF A;  2OZ6 A;  2QYO A;  1S29 A;  2M1B A;  4HF0 A;  3WTZ A;  2W85 A;  3AAF A;  3IRQ A;  1G4D A;  5H6R A;  3JSP A;  3RJP A;  1UCR A;  1ZG5 A;  2K4B A;  1DPU A;  1DP7 P;  1TW3 A;  3KE2 A;  2YSR A;  3K9T A;  1F1Z A;  4RGS A;  4LLG F;  2CQK A;  2O03 A;  3MZY A;  3OV8 A;  3TDZ C;  4PCQ A;  2Q0O A;  4WXD A;  3DV8 A;  1R5H A;  1W7P B;  2RKH A;  4EQQ A;  4HDU A;  5CVU A;  3P9I A;  4RAZ A;  2L4M A;  1YW8 A;  3QRF F;  1W7P A;  4AIH A;  1FC3 A;  2KJB A;  3HTU A;  3M7G A;  1R5G A;  2BGC A;  3R0A A;  4HA8 A;  2VC1 A;  3F8B A;  4M73 A;  2FMY A;  1HKS A;  3WU1 B;  2RGV A;  4HX4 A;  3WGI A;  1AWC A;  5JHU A;  3CUQ B;  4HDV A;  4ASN A;  3I4P A;  1TNT A;  2C6Y A;  4I2O A;  4IXA A;  3L9F A;  3CUQ A;  4U88 A;  1BI0 A;  4I0B A;  3TKY A;  4HOB A;  1YQA A;  3E5Q A;  1D8J A;  5CVV A;  2DO7 A;  5BQT A;  3HRM A;  1HW2 A;  2JPC A;  2P4W A;  5J8C A;  5ICE A;  3IHU A;  4NB5 A;  3BWG A;  1LDD A;  2CFX A;  2GA1 A;  3BRO A;  3FZV A;  3EYI A;  4MQV A;  3LQQ A;  2KIU A;  4UVA A;  2FE3 A;  1ULY A;  2MH9 A;  1EH7 A;  2D2W A;  5AIQ A;  3M8E A;  3O2P E;  3E6M A;  1BI1 A;  2F5C A;  2XAH A;  2PG4 A;  5D5W B;  4MNU A;  4P96 A;  2COM A;  2J5O A;  1KQ9 A;  2ZBK A;  5ILU A;  3MAJ A;  5FD6 A;  4LLN A;  5F64 A;  5KVR A;  3F8M A;  1SD4 A;  4NQW A;  3MCZ A;  1UST A;  3V8J A;  1IN4 A;  2MA3 A;  1USS A;  4MEY F;  3J81 K;  5L3F A;  4AWX B;  1JGS A;  3HRU A;  2NNN A;  2CW0 F;  4U0W A;  5LRS A;  1ZHF A;  1LQ1 A;  2HDC A;  2A6E F;  4MQ9 F;  1R36 A;  1I1S A;  1ZYR F;  1MJB A;  3ULQ B;  2R3S A;  2FQ3 A;  5H20 A;  3TGN A;  4AIJ A;  5K1Y A;  5D6E A;  2LKP A;  1FT9 A;  4I01 A;  4UV8 A;  5HS8 A;  1U5T A;  3WTX C;  4M9S A;  2F5F A;  3E97 A;  1YFH A;  5LLQ A;  1XMA A;  3FMQ A;  3PQJ A;  1ZH5 A;  5ICC A;  3EDP A;  1JE8 A;  3BP8 A;  3QAH A;  3ZMT A;  4Y17 A;  1QGP A;  1PP7 U;  5DD8 A;  4UXN A;  1YIO A;  2DQR A;  1T39 A;  3VB2 A;  3HTS B;  1V3F A;  1FBS A;  1BM9 A;  2UXN A;  1O3R A;  3ZN0 A;  2DFI A;  1XDU A;  1XDS A;  5F6F A;  3C18 A;  4IRH A;  1J9I A;  2JPB A;  1E2X A;  1UHW A;  1XSX A;  1XD7 A;  3WTU C;  2UWM A;  2STT A;  4A6E A;  2VON A;  3E5U A;  2O6G E;  3ZPL A;  5FO5 A;  2F2E A;  4L5I A;  5HLI A;  1LJ9 A;  4A5M A;  1Z91 A;  5HS9 A;  3LAJ A;  3BZ6 A;  3GFL A;  1FLI A;  3IL2 A;  2D45 A;  3M8F A;  1ZGJ A;  2RVC A;  4RAY A;  5L3B A;  1U2W A;  2M45 A;  4Z2Y A;  3RIR A;  1R1V A;  4BQA A;  3QU3 A;  3WGH A;  4GCV A;  3RYP A;  3HRS A;  4A12 A;  5FB2 A;  1SFU A;  1J7K A;  4F7Z A;  2FBH A;  4M9X A;  4XLP F;  2YR2 A;  3GFI A;  3T8T A;  4HV6 A;  2XIG A;  4N9I A;  3K2Z A;  4OOI A;  2P6S A;  3ZMV A;  2EB7 A;  2VE8 A;  3HSE A;  4O3M A;  1LDJ A;  3G73 A;  2GAU A;  3J80 K;  1I27 A;  1K78 B;  1ZRD A;  1FSE A;  4FT8 A;  2IA0 A;  3FWE A;  2L3D A;  4RB3 C;  5E1W A;  4ENJ A;  1K78 A;  1ZG1 A;  3COA C;  4WK8 F;  1RUO A;  2YX4 A;  1RI7 A;  1O7L A;  2W25 A;  4IVN A;  5FGM A;  5JR3 A;  2IW5 A;  4L18 B;  3F72 A;  5K5R A;  3SHF A;  1WSU A;  2Y48 A;  3KLN A;  3E3V A;  4CHU A;  3QPH A;  2QLZ A;  4A5N A;  1DDN A;  4KFC A;  3LA2 A;  2XGX A;  3RDI A;  1QZZ A;  2QQA A;  4UV9 A;  2Z99 A;  3CUQ C;  4KUM A;  3J80 Z;  1D8K A;  1KYW A;  2WWY A;  2M30 A;  2W84 A;  2NYX A;  4CGZ A;  3SXY A;  4TV7 A;  1T98 A;  3GZ5 A;  3KFW X;  4LB5 A;  1D5V A;  2LF8 A;  2RQP A;  2E7X A;  2P5L C;  3R4K A;  4O6J A;  2Z5U A;  3DQV C;  1CGP A;  2DI3 A;  4R1H A;  3RKY A;  1B1B A;  4RGR A;  4G7H F;  2VN2 A;  1RUN A;  1U6G A;  2RC4 A;  3F6V A;  3WGG A;  4G8X A;  2MD5 A;  1RZ4 A;  2HQR A;  2VOP A;  4KIG A;  3HOS A;  4BHP A;  3L09 A;  2ZNZ A;  3I53 A;  5JI6 A;  3F8F A;  3DXJ F;  4U7B A;  2ZCW A;  2GWR A;  4Y13 A;  5HOO A;  1LEB A;  2FBK A;  2XKO A;  4ESF A;  1F5T A;  5LGN A;  1IF1 A;  3SZP A;  2PMH A;  4B8X A;  1S7A A;  3WTY C;  3C1D A;  2V9V A;  1GXP A;  2QVO A;  2PN6 A;  2V6C A;  2HYG D;  3L00 A;  3RKX A;  1B59 A;  3RKW A;  2FOK A;  1Z7U A;  2MC3 A;  1HKT A;  3FXQ A;  1K7A A;  4NHJ A;  1XSD A;  1CF7 B;  4EJO A;  4KDP A;  4IRG A;  3BOQ A;  4U0Y A;  1MDM B;  2Z3Y A;  4A0Y A;  5ICF A;  3WTV C;  3F3X A;  3FXR A;  1XB4 A;  1H0M A;  2H94 A;  2IA1 A;  3GWZ A;  1MDM A;  2Y75 A;  1W5T A;  1QO0 D;  1U5T C;  4OIN F;  1HBX G;  2RDP A;  1NHA A;  5LHG A;  3LWF A;  2HR3 A;  2JRT A;  4HLY A;  4N9H A;  3WE2 A;  2L4A A;  3WG9 A;  1BI2 A;  1AOY A;  4IPA A;  4EGY A;  4XSX F;  1H9G A;  3PFI A;  4UVC A;  2OQG A;  3ECO A;  1R1U A;  4CYD A;  1G3Y A;  2ZFW A;  3JW4 A;  1R22 A;  4KT5 C;  4MEX F;  2EA2 A;  2NNY A;  3BJA A;  4OMZ A;  3K0L A;  2JT1 A;  1KA8 A;  2PMU A;  5FFX A;  4HX7 A;  4EJW A;  1PUE E;  2XAQ A;  4KMU X;  1Z1D A;  3H3Z A;  5DUK A;  2DT5 A;  5HVQ C;  4WF2 A;  1ZLJ A;  2DTR A;  3QP6 A;  1ZRE A;  3TQN A;  1P92 A;  4EM0 B;  2ACJ A;  1H9T A;  2KIM A;  4OIR F;  1KU3 A;  1KU9 A;  2XRO A;  1P4W A;  4UHT A;  4EM2 A;  2W57 A;  2IT0 A;  2XRN A;  4U0V A;  4QWQ A;  2F5E A;  3F8C A;  3K1N A;  1WRJ A;  5HDN A;  2QBY A;  5HDK A;  2KIF A;  4L9V A;  4CXF A;  1X3U A;  2ETH A;  1S7O A;  4EM1 A;  1XSV A;  1C0W A;  3FF5 A;  2WC2 A;  2YU3 A;  4HAM A;  1HW5 A;  1YS6 A;  2Q8K A;  3HRT A;  1OKR A;  1S6L A;  2V1X A;  4HF2 A;  4EVI A;  3KZZ A;  1SFE A;  1OMI A;  2D1V A;  4Q5S F;  5LBQ A;  4ESB A;  4I09 A;  1FX7 A;  3D0S A;  1WWX A;  3N4M A;  2P5V A;  3IKV A;  4GYG A;  2K27 A;  3RTR A;  5E8I A;  2DW4 A;  4AVP A;  3ABU A;  3T8R A;  1Z05 A;  4ENN A;  3KCC A;  3MQ0 A;  2QQ9 A;  2ADU A;  3TO6 A;  2Z9O A;  2P5K A;  2TDX A;  4GYI A;  5D4S A;  2NAZ A;  4EGZ A;  1J0R A;  1LB2 A;  3WTT C;  3KLO A;  2HQN A;  4YIF A;  4HLX A;  4O5V A;  4BHB A;  5E1Z B;  1WKM A;  1FP2 A;  2DK5 A;  1IN7 A;  2V79 A;  2CYY A;  4IJA A;  4BAY A;  1T0F A;  1FZP B;  3HYI A;  3KP3 A;  4KN7 X;  1KQ8 A;  1G3S A;  4KA4 A;  4RB1 A;  1ZG3 A;  3Q9V A;  1Q1H A;  4CZZ A;  4ON0 A;  4ENM A;  1FPQ A;  3M9A A;  3GX4 X;  2VC0 A;  2ZO4 A;  3HOT A;  2X0L A;  4E70 A;  3CO6 C;  1DPR A;  1U5T B;  1XCB A;  5HDG A;  5D6F A;  1KU2 A;  1S3J A;  4HQE A;  2MH2 A;  5L3D A;  3FHZ A;  1EV7 A;  5A2Q K;  4GO1 A;  1T38 A;  1HSJ A;  2BEO A;  5CVI A;  2PJP A;  3JAM K;  4KN4 X;  3MFK A;  3LST A;  2XVC A;  4IHS A;  2M5W A;  1UHM A;  2ZME B;  3IKT A;  3I0T A;  3R60 A;  1S8N A;  2ZME A;  1IUY A;  2EK5 A;  5BOX A;  4N0B A;  2FSW A;  5CJ9 A;  1KU7 A;  4A2U A;  4YFN F;  4OU0 A;  2OZU A;  5D5V B;  3GO5 A;  4M72 A;  1D3Y A;  1UFM A;  2EFP A;  2O3F A;  1OYI A;  5D4R A;  2MLK A;  1TLH B;  1P6R A;  2OU2 A;  4JK1 X;  1R7J A;  4HYE A;  2MLG A;  1FWZ A;  2E1C A;  4EMS A;  4RS8 A;  3LAP A;  1FSH A;  2DLL A;  1PP8 F;  4HZF A;  3REO A;  2OAZ A;  2KJC A;  5DV5 A;  5A2Q Z;  1SMY F;  1K6O A;  3ECH A;  4JQF A;  3JAM Z;  5DYM A;  2HTJ A;  4RGU A;  2QQB A;  3ISP A;  3O3K A;  3ZMD A;  1O3Q A;  5CLS A;  4EJV A;  1J75 A;  3BJO A;  2Q2E A;  1BBY A;  4R8H A;  4WXH A;  5IT3 A; 
#chains in the Genus database with same CATH topology
 3KZY A;  4E7S A;  1G3T A;  3FKJ A;  4PGG A;  4BXU A;  3BTC A;  2G7U A;  3K4L A;  5LFA A;  4XIC A;  2L7F P;  1FMW A;  1ONV A;  3HB9 A;  4RLQ A;  4A0Z A;  2A6T A;  4KIB A;  3NAR A;  4IF4 A;  3KP5 A;  1EH8 A;  4E7H A;  1MD0 A;  1K61 A;  1LFU P;  2V1D A;  4WCG A;  2R7W A;  1WI9 A;  2F5D A;  2HNH A;  2VUM J;  1I6H J;  1YOV B;  5L3G A;  4II3 A;  5K5O A;  3AG3 H;  3JRF A;  1TWH J;  1WJA A;  4FIS A;  4BJ5 C;  3C2G A;  2IGO A;  3GTQ J;  1XGS A;  5GAG J;  2NRA C;  2FF4 A;  5IT9 K;  2W1O A;  1TW2 A;  1ZTR A;  1TTY A;  3OSF A;  2L9V A;  2HDD A;  1FY7 A;  1MKM A;  3GXO A;  3PL8 A;  3DBL B;  2HYF A;  4I02 A;  1JKP C;  2W82 A;  3H0G J;  2E34 A;  3BG9 A;  2JSP A;  4G9Y A;  4XLN F;  2LY2 A;  1R49 A;  1A5J A;  2EJR A;  3J81 R;  2QEN A;  3U2R A;  2IRF G;  3I5U A;  3MZH A;  2HXO A;  1IO2 A;  2LR8 A;  2DQL A;  3I58 A;  3S2W A;  4BU2 A;  4B09 A;  3BJ6 A;  2FRH A;  5EEH A;  1JHH A;  2HKX A;  2PMZ N;  3LQR A;  4HX8 A;  2GZW A;  2MYS A;  2LDU A;  2W24 A;  1VQN I;  2VOO A;  2DU9 A;  5J4Y A;  2M0C A;  4LFU A;  1LVA A;  2M4K A;  4DZP A;  4N4N B;  3ABT A;  5E3N A;  1YIJ I;  2P7C B;  3GYH X;  1ODD A;  3K2A A;  3EPZ A;  5KNL A;  1KQ0 A;  3ZQQ A;  2FD5 A;  2ISZ A;  2A6H F;  4GFB A;  3QOE A;  1SD5 A;  2VAS A;  2ZFU A;  2XGE A;  3D5L A;  2WTE A;  1B9M A;  2XF5 A;  4G7O F;  2HPM A;  3CLO A;  1R5I D;  3ZCO A;  1U78 A;  2CQX A;  1N77 A;  4IO9 F;  1AU7 A;  3JSO A;  2B9S A;  2BOL A;  2HOT A;  2ME6 A;  2KT0 A;  1ITY A;  3C3W A;  5IT9 Z;  1L3L A;  4RGX A;  1FTT A;  1TQM A;  1YW7 A;  1B4A A;  2H09 A;  2HVR A;  4FE7 A;  3V8L A;  1EH6 A;  1FBQ A;  4BGD A;  1FJL A;  1WI3 A;  1ZK8 A;  4MGR A;  2OF7 A;  3F9K A;  4XRS A;  3B02 A;  2DOF A;  2XKP A;  4C30 A;  4IHV A;  3S1N J;  5J6X A;  1ZRF A;  3CDH A;  4XKV A;  2XB5 A;  3KET A;  3CCY A;  4V2G A;  2HS5 A;  2M7A A;  3FBI B;  2NXN B;  3RCO A;  2DPU A;  2G7H A;  3ELK A;  1JKR C;  3GME A;  3TO9 A;  2VBY A;  1B8I B;  3A52 A;  2XB0 X;  4M74 A;  5DEQ A;  2IPQ X;  2R7F A;  3RYR A;  3M4O J;  1ON2 A;  2K3F A;  1UB9 A;  3CZ6 A;  2X4H A;  3IRR A;  4GXO A;  5L3E A;  3SZT A;  1BR2 A;  3K1M A;  1B8I A;  4RMN A;  5JFR A;  2MBF A;  3LMM A;  1O3S A;  3TP3 A;  2QA4 I;  2XSJ C;  3FM5 A;  1RIO H;  2MFZ A;  2M7B A;  2PX9 A;  1XCV A;  3HDD A;  3VYR B;  4ZZL A;  5HLT A;  3NQO A;  1ETV A;  4KIC A;  3W6J B;  2DA5 A;  1WH5 A;  5LRR A;  2DCE A;  3K4N A;  3KX2 A;  4B44 A;  3MZ8 A;  2Y30 A;  2EIN H;  4BYY A;  2L9N A;  3GTO J;  2CQQ A;  3SQN A;  3KP4 A;  2A3S A;  2KLO A;  4A93 J;  3CC4 I;  2ZXH A;  2ZJQ F;  3D5R C;  1YX3 A;  2E2J J;  1QZY A;  1PJR A;  2X9D A;  3BPX A;  1MMG A;  2P8T A;  3SFI A;  2H27 A;  1TWG J;  3GTJ J;  1BC7 C;  3S2H J;  4IHT A;  4M6X A;  4P5O A;  1HDP A;  4E7L A;  1TBX A;  3VYT B;  4GRI A;  1LDK B;  4ITV A;  4LK1 F;  4ZYE A;  2JJ7 A;  3GVA A;  2V1U A;  1ZN2 A;  1P2F A;  5EEG A;  1QBJ A;  5C4X J;  1I39 A;  1XGM A;  1R00 A;  3JRI A;  2CW7 A;  2OCE A;  4I0A A;  6PAX A;  2VT2 A;  4BQQ A;  3D1N I;  5J1Y A;  3PO2 J;  2ID6 A;  4YFK F;  4I7H A;  1FIA A;  1E3H A;  2HOS A;  5AON A;  2E1M B;  1QPI A;  2ZKZ A;  1T0F C;  3ZN1 A;  2VE9 A;  2R0Q C;  3EUA A;  3KYL A;  1TWF J;  4I76 A;  3X2Q H;  2YU9 J;  1RQ6 A;  4KNY A;  4FET A;  1BJZ A;  2BHY A;  2OQR A;  5B1B H;  2IJL A;  1X1B A;  3VPR A;  2ZXJ A;  3QOP A;  2XGC A;  4OAY A;  5D5X B;  4AVZ A;  1BN5 A;  4DZJ A;  3CTA A;  3OR1 C;  1JGG A;  4IHW A;  2VBZ A;  2Y9Z A;  3OYG A;  3I54 A;  3QP5 A;  2XAS A;  3TO7 A;  2BV6 A;  4XRF A;  3Q0U A;  2EWN A;  2E71 A;  3BR3 A;  5DTD A;  3J80 R;  3HZJ A;  3D5S C;  4PZJ A;  3DPT A;  1ETK A;  4CUG A;  2VQH A;  1WPK A;  4EJU A;  1D1A A;  4MTE A;  3JRC A;  3K4C A;  3PNV A;  2D1H A;  1LFP A;  1RKT A;  2DA1 A;  2HFH A;  4BBS J;  4DNC A;  3CCV I;  5C4J J;  3QPT A;  3W6V A;  3BT9 A;  2EIJ H;  1FOX A;  1XC5 A;  3H5A A;  3L2U A;  1HC8 A;  3E6D A;  4AM3 A;  4U7D A;  3ZMS A;  3P9K A;  4L9T A;  1SAN A;  2JSC A;  1IC8 A;  4D0P A;  3DFG A;  2ZXW H;  3EUK L;  5FRO A;  3ZMZ A;  3K4B A;  2KIQ A;  2HXI A;  3HBL A;  4HW0 A;  3VEP A;  1JUP A;  4IEJ A;  4CDG A;  4EJT A;  3WG7 H;  2G9W A;  1A04 A;  1V5E A;  3EET A;  4I98 B;  2DK8 A;  1G6N A;  1FYL A;  3LNQ A;  5IYD J;  3DPL C;  2ZME C;  1JUS A;  1W7P D;  5JVT A;  3OYB A;  1IXC A;  4I6Z A;  1Y1V J;  2M87 A;  3ERE D;  5LHH A;  1TT0 A;  1OCC H;  2DA2 A;  2GM4 A;  3WTS C;  2FNP A;  1QVU A;  2LBF A;  1K79 A;  2FOW A;  4HRI A;  3HHG A;  5E17 F;  1T2K A;  2FBI A;  4XRS G;  4B48 A;  3BC8 A;  1X1P A;  2XUB A;  3I9V 2;  3I3L A;  4XSZ F;  3QPS A;  4RM3 A;  3HSF A;  3WOD F;  9ANT A;  2OC6 A;  3V7C A;  3I59 B;  4CZC A;  3MVP A;  1X1D A;  3MKL A;  4UVB A;  3ZQH A;  2IVM A;  4R79 A;  2IS6 A;  1BC8 C;  4PJM A;  3LFK A;  3CDL A;  2W4S A;  4J19 A;  3I59 A;  2B63 J;  5FKO A;  2QSG X;  3F8N A;  3L2V A;  1B6A A;  1JTX A;  4FTH A;  2PFB A;  1ZAO A;  1ETW A;  2Y9Y A;  1YHQ I;  3E5X A;  4HPQ A;  5BPI A;  2M9H A;  2E1O A;  1KGS A;  2DFF A;  2L2O A;  3A4C A;  3GZN B;  5DD4 A;  4YII A;  4L9J A;  2VPL A;  1Z77 A;  4IL6 C;  5ILS A;  4D1Q A;  4KIF A;  5EZG A;  4HV5 A;  3T0Y A;  2W48 A;  4UY8 I;  3H5N A;  2L01 A;  1V4R A;  4XOR A;  1A6Q A;  1JKO C;  3BR1 A;  1QNT A;  3OYJ A;  2L02 A;  3PIO F;  3J7A W;  3S8P A;  1ON1 A;  2BYV E;  3A03 A;  5IY5 H;  2HGC A;  1LFB A;  1IZ1 A;  4XL9 A;  1LNW A;  3FDY A;  4II2 A;  2QBY B;  3EQL F;  1OYY A;  1WVR A;  4AIK A;  2EIK H;  1IXR C;  2HPI A;  4EV0 A;  4XLE A;  4G94 A;  4CO8 A;  4Y15 A;  2Y0M A;  5FKN A;  3HKZ A;  1IN8 A;  4D7N A;  3FXM A;  4UUT A;  5F0H A;  5FLX K;  3CES A;  4B3A A;  1OCR H;  4Y4R A;  4M6Y A;  4Q47 A;  1XMK A;  3AG4 H;  4WX9 A;  3I71 A;  4XR6 A;  2BY3 A;  1IN6 A;  3BG6 A;  1N25 A;  2P7V B;  1YTY A;  5H6Q A;  3I55 I;  1E3P A;  4CIC A;  1UG0 A;  3QPL A;  2UV1 A;  1K4T A;  3KEO A;  5KK1 A;  3A01 B;  3CO7 C;  2DT6 A;  4Q48 A;  5K7Z A;  1FOK A;  1DQU A;  5ERI A;  2CJJ A;  2I5U A;  1XGN A;  3M1E A;  5B3S H;  4LG0 B;  2VLA A;  4BNC A;  2KPM A;  3K7A J;  4CCO A;  2EA4 A;  3MKY B;  4HEA 2;  3A01 A;  1SD7 A;  5D5U B;  2DMN A;  4B3X A;  4RBO A;  3L7W A;  2RNJ A;  3RI4 A;  5M3M J;  1O3T A;  4LIU A;  3BTL A;  4XLH A;  1WFX A;  4M9Z A;  2VB6 A;  5E18 F;  4KYW A;  2AO9 A;  3E6C C;  4LG0 A;  3ZP5 A;  3OOP A;  2X1D A;  3OMY A;  4XLF A;  4CYC B;  2DFH A;  1OIS A;  1FBU A;  2QZ8 A;  2Z16 A;  3G3Z A;  1OR7 A;  1J5Y A;  1GVJ A;  2JZY A;  1E17 A;  2EFN A;  3AFH A;  2H1L A;  1GXQ A;  4UUV A;  3CJT B;  1T6S A;  1G8X A;  1AHD P;  1SAX A;  4CYC A;  5KCM A;  3HL2 A;  4E7I A;  3HOW J;  3HIF A;  3TW7 A;  4PUS A;  4JYK A;  3GUD A;  2K02 A;  3B6C A;  4RM2 A;  5FLX Z;  5LGU A;  3OR2 C;  3PSI A;  1QU3 A;  1HQC A;  2DTZ A;  2FA5 A;  2LSO A;  2OA4 A;  4RB0 A;  4FAS D;  1WJD A;  4BY7 J;  5D8L B;  4NDL A;  3BLY A;  4I99 C;  1WCM J;  1F4K A;  3KP2 A;  3P7N A;  3RSN A;  2HTS A;  3O8H A;  2NOG A;  4QTR A;  5DUI A;  2JK3 A;  1YS7 A;  5J47 A;  3GLL A;  4A69 C;  4P9F A;  3M3Y J;  1XG1 A;  3L2C A;  2EZH A;  4M71 A;  4NNJ A;  3W2W A;  3O6B B;  1Z6T A;  2PBI A;  3SZG A;  4OWR B;  3OS1 A;  4XID A;  3H1C A;  4AYB N;  1YO5 C;  2IAI A;  5E79 C;  3W6K B;  4HNT A;  1VND A;  2O7O A;  1W5S A;  4M3B A;  2O0Y A;  4MFE A;  1I3A A;  2NVY J;  3JTH A;  5HS7 A;  2CUF A;  3HHH A;  1YRN A;  3NRV A;  4L5J A;  3E0J B;  2Q1Z B;  4FHT A;  4LB6 B;  3BTI A;  4AID A;  5DCF A;  5J3L A;  5LD2 C;  4AC0 A;  1Z9C A;  2EFO A;  3F23 A;  1YJ9 I;  2IBD A;  2VQC A;  5ICG A;  4ENK A;  2VIX A;  2A69 F;  3ZQ7 A;  2R93 J;  1E0E A;  1XTA A;  3ZQI A;  2UXX A;  4HG2 A;  3JCU C;  4YRV A;  1ZRC A;  3KPH A;  3K69 A;  5E1X A;  3N05 A;  1FP1 D;  2DOA A;  4FE4 A;  1BIB A;  2H8W A;  2Y0S N;  1IG7 A;  4A6D A;  3QYB A;  5TRD A;  3K6G A;  2JVG A;  5FKL A;  2BBY A;  2WB1 N;  2O9L A;  4AUX A;  4BQO A;  4IOC F;  2BHZ A;  1V5F A;  3OYF A;  2PI0 A;  1FNN A;  2GA2 A;  3TOA A;  2RN7 A;  5FLM J;  4HBL A;  4PDK A;  4JBA A;  4LMY A;  1ZQ3 P;  4IRI A;  3SEQ A;  3BDD A;  2YPR A;  5GPA A;  4EAT A;  4WWC A;  2GXG A;  5BPD A;  2NVT J;  1D0Y A;  5M5W J;  1P7I A;  4KIT B;  1HXD A;  1ZGA A;  2LP0 A;  1B9N A;  3C2H A;  2ME0 A;  1STZ A;  1O7F A;  1TNS A;  5LEJ A;  2H6B A;  2CWE A;  2VXZ A;  4JX4 A;  4LOC A;  1REP C;  1R1T A;  2HEO A;  2M8E A;  5FFZ A;  4H0E A;  1MNM C;  2XPU A;  1JJ6 C;  2VQG A;  2J5P A;  3ROU A;  1JHF A;  1ETO A;  2A05 A;  1MH4 A;  3DPU A;  1U9N A;  2XAF A;  2VXD A;  2E7W A;  2VT3 A;  3ASN H;  2GLO A;  3JRA A;  1Y0U A;  4OIP F;  1YX5 A;  2LTP A;  5CVR A;  2L7M P;  3F22 A;  2NS0 A;  4P9U A;  2IGN A;  2OCC H;  3J7A Y;  5EEA A;  1F9N A;  2VBX A;  1IW7 F;  5HNF A;  1O4X A;  3HG9 A;  3ZOB A;  4MTD A;  1BJA A;  3K1P A;  2AQF A;  1UG2 A;  2EZK A;  3Q9S A;  3J81 Z;  3S17 J;  3TOB A;  5FKM A;  4G7Z F;  2RAE A;  3DKW A;  4HQM A;  2AS5 F;  1VQ7 I;  3JTG A;  2A5Y B;  4UNO A;  1VTN C;  4D5F A;  1TQP A;  1QHG A;  3CCQ I;  1D1C A;  2E1M C;  1BOA A;  3GW2 A;  5BS6 A;  4A3I J;  1PDN C;  3CF5 F;  2L54 A;  2B0L A;  3CC2 I;  2ESN A;  3GF2 A;  3BTJ A;  5J8F A;  3DLA A;  4L0Z B;  2ISY A;  3EUH A;  2MW8 A;  5LGT A;  3FM3 A;  4Z6Y A;  2ZNY A;  4GDF A;  2EV5 A;  3VOD A;  1MZB A;  3DBR B;  5E20 A;  2FXA A;  1YG2 A;  3OWT A;  5E8G A;  3HPH A;  4XBF A;  5IP9 J;  1S7E A;  3DEU A;  3ESW B;  1IXS B;  2LG4 A;  2DYS H;  4GGG A;  2X1E A;  4NUB A;  1KYZ A;  3FKI J;  1I5Z A;  1Y56 A;  4ZTF A;  3H92 A;  1IUF A;  3FIW A;  4Q4Z F;  2G0E A;  5HLG A;  3SFZ A;  2O8X A;  4EEF G;  2IA2 A;  3DU5 A;  1RC9 A;  1OPC A;  1MSE C;  3GTK J;  2LF7 A;  2HZT A;  1IAW A;  4ZZD A;  3M07 A;  3R6S A;  5LHI A;  5LEK A;  3ZQF A;  3H5R A;  2CSO A;  1RR7 A;  2DAO A;  1R23 A;  2LYC A;  1CQT A;  5BMZ A;  4G6Q A;  5M5Y J;  2DA6 A;  1P4X A;  3G2B A;  1QHH D;  3V7R A;  1YI2 I;  2OJE D;  1OLT A;  1OYW A;  4W1U A;  1ZAR A;  3S1R J;  1BI3 A;  1XN7 A;  2K86 A;  4BHC A;  3MEX A;  4BJ6 C;  1J59 A;  2PEX A;  3Q0V A;  2GQQ A;  4B4C A;  2R7U A;  3BPV A;  2A68 F;  2KMU A;  1DUX C;  2LC2 A;  4WXC A;  1W36 C;  3S2D J;  2HKO A;  1U8R A;  4OAZ A;  1I6X A;  2WAQ A;  3LSH A;  1IJW C;  4ZYG A;  2WAQ N;  4YEL A;  2RV8 A;  3RPQ A;  2GXB A;  1QQI A;  2A61 A;  3CCU I;  2OTJ I;  4E6K G;  1FYM A;  1J2X A;  5K7F A;  2PLY A;  2GIV A;  3IWZ A;  4BDY A;  3HGY A;  2R7S A;  2IEK A;  2ELH A;  3GFJ A;  4YG2 F;  1JXS A;  1P4A A;  2FJ1 A;  1Z6R A;  4Y3O A;  2KKO A;  3ZR8 X;  3Q3S A;  1JKQ C;  2ZJ2 A;  2IP2 A;  3NEU A;  1W0T A;  1MGT A;  4DOZ A;  4B47 A;  2UZK A;  2CV0 A;  4RB2 C;  3DKX A;  1QRY A;  1BR1 A;  3RPU A;  3KP6 A;  5HLH A;  3V8K A;  4ESJ A;  3PFY A;  2DDA A;  4AD9 A;  2EFQ A;  3QU6 A;  1HKQ A;  2QUF A;  2EV6 A;  1N75 A;  1G3W A;  2FU4 A;  2QWW A;  1I1G A;  4DQ2 A;  4BH9 A;  4XKB A;  1MBG A;  2DBB A;  3K70 D;  1TQI A;  2FNA A;  1SD6 A;  3DTI A;  2R4G A;  3I64 A;  2O8K A;  3JAM R;  1EA3 A;  1VQ8 I;  2NOJ B;  2CG4 A;  5TJJ A;  1SEU A;  2DOD A;  3IC7 A;  2MAB A;  3T1B A;  1P7J A;  1UEL B;  2Z33 A;  2X48 A;  3HC7 A;  4ZYH A;  3ONQ A;  3BCB A;  2XV4 S;  3W3C A;  5B5E C;  4BE2 A;  4S05 A;  5F1R A;  2P0W A;  1RNL A;  2LNB A;  2P81 A;  3DF8 A;  2WV0 A;  3OIP A;  4JOM A;  1QPM A;  3TW6 A;  2R7D A;  3O8G A;  3PNY A;  3H3U A;  5DCM B;  3H0D A;  3QWL A;  1MMD A;  1X1A A;  3OSG A;  1SAU A;  2EV0 A;  3U9G A;  1HW1 A;  3F6O A;  1LEA A;  1JI8 A;  2BY0 A;  3VFZ A;  2CUZ A;  1NG7 A;  3OYL A;  2ESH A;  3HM5 A;  4MO7 A;  4OIQ F;  1GLN A;  2LY1 A;  1WGX A;  3NWT A;  3C7J A;  5DCM A;  4LLL A;  3L1P A;  3HSR A;  1K6Y A;  2AXL A;  2VOD A;  2IS4 A;  5DDG A;  3B6A A;  4MHG A;  4NC8 A;  2A07 F;  2K4J A;  4CH7 A;  1WJC A;  3FXU A;  3R0J A;  1OCT C;  1MND A;  3FMS A;  2A5W A;  2BE5 F;  1IRG A;  2E2I J;  1FYK A;  3BY6 A;  2HWV A;  3KYC B;  2PQ8 A;  2QKL B;  3FXO A;  1SMT A;  2CO5 A;  2XGD A;  3PQK A;  1MMN A;  4BL0 B;  5IOZ A;  4DW6 A;  4XLC A;  2IS1 A;  1GDT A;  5K5Q A;  2QM3 A;  2FML A;  1QZE A;  3S14 J;  3ML6 A;  1DU0 A;  4LJZ F;  1DU6 A;  3IWF A;  3OIO A;  4A3J J;  2KRF A;  3G71 I;  3KEQ A;  5L3C A;  3J7A O;  4LK0 F;  2K7L A;  3K10 A;  3WE3 A;  1GV2 A;  5ED4 A;  2XAJ A;  2Y31 A;  4QLC U;  4DYQ A;  2HVS A;  3DBH B;  1ZLK A;  1KZH A;  3WTW C;  4A0X A;  4LIV A;  3CUO A;  2ID3 A;  1OR7 C;  1SFX A;  3OS2 A;  3T5X A;  2OD5 A;  1MJ9 A;  3ASO H;  3Q5F A;  5JLX A;  5J4V A;  3VOE A;  2OTL I;  4K2E A;  4D5C A;  1Z67 A;  2BXZ A;  4PGH A;  1YYV A;  2XRL A;  4IX7 A;  2BZT A;  1N78 A;  1IRZ A;  1BOB A;  3EYY A;  3V7S A;  3GZ6 A;  2OUM A;  1W0U A;  3S16 J;  5JVG F;  2K9N A;  2E60 A;  4PJJ A;  1R4N B;  4OMY A;  4YFX F;  3G1M A;  5ILV A;  5CVJ A;  4FX0 A;  3E6B A;  4BJT A;  2E35 A;  2P6T A;  1IRF A;  1HST A;  2I8D A;  2M34 A;  3GEZ A;  4BAC A;  4HF1 A;  2KIS A;  4LGW A;  3WU0 A;  5J1R A;  1WQ2 A;  2VKD A;  2WV1 A;  4P55 A;  4B1R A;  5CYV A;  2JTV A;  1NTC A;  3H35 A;  3G1L A;  4L0Y B;  1U3E M;  2LRE A;  1VQ6 I;  1V55 H;  2YX7 A;  3HOX J;  4ZDO A;  3GLX A;  5AIP A;  3CME I;  2VJ4 A;  3LA3 A;  5C3E J;  4BXF A;  1E3O C;  2DPD A;  1O57 A;  3MN2 A;  4XLA A;  4LD5 A;  2KDO A;  4XKW A;  4CCM A;  4F91 B;  1MIJ A;  2OPT A;  3VSL A;  4C2M J;  1XGO A;  5D8K B;  5IT9 R;  1BW5 A;  2KQR A;  3KP7 A;  3LA7 A;  2XAG A;  5B1A H;  2X6X A;  4ZYD A;  3FX3 A;  3PNT A;  2HU9 A;  1TL8 A;  2STW A;  3TDU C;  5FD5 A;  1FIP A;  3GFM A;  3ZRG A;  4ETS A;  2R7O A;  1R6R A;  2MVT A;  3P9C A;  3CJN A;  2XHK A;  2NVU B;  2O61 A;  1Q1V A;  3MWM A;  2H6C A;  1IDZ A;  3R61 A;  4L9N A;  1JTY A;  4JX5 A;  4BE1 A;  5GPC A;  1IN5 A;  4ZH4 F;  4KMF A;  4FX4 A;  3F21 A;  2CGP A;  3FXL A;  1D5Y A;  3S3N A;  4J01 A;  2VBW A;  2KRH A;  3DP7 A;  2ECB A;  1HLV A;  1X19 A;  3ZMU A;  3FMR A;  3DCF A;  1CF7 A;  4G6D A;  2HOE A;  3V4G A;  4ZYA A;  4HSR A;  1VQ4 I;  2LBF B;  3HUG B;  1GHC A;  3TED A;  1R58 A;  4PFP A;  3LSK A;  1L0O C;  3N97 A;  2OBP A;  5DS9 A;  1H8A C;  4F52 A;  2EFW A;  3B73 A;  1W4M A;  4BY1 J;  2MGQ A;  4JP0 A;  2E1N A;  3TP0 A;  4S04 A;  3HUG A;  1NH3 A;  4X6A J;  4OIO F;  3U1D A;  1BIA A;  2FEZ A;  3CMM A;  1MJA A;  1YLF A;  2OZ6 A;  2E5N A;  2VJI A;  2QYO A;  4PJ0 C;  1RRJ A;  1S29 A;  3CD6 I;  2M1B A;  4HF0 A;  3GTM J;  3WTZ A;  1MBJ A;  2W85 A;  4L5E A;  4DIQ A;  3AAF A;  3IRQ A;  4C2U A;  4RAG A;  1IRX A;  1G4D A;  1UMQ A;  5H6R A;  3JSP A;  3RJP A;  2GXA A;  1UCR A;  1ZG5 A;  2X6W A;  4XK4 A;  2K4B A;  1DPU A;  1DP7 P;  1TW3 A;  3KE2 A;  2YSR A;  3K9T A;  3QOD A;  3CMA I;  1HF0 A;  4CSW A;  5DM7 F;  3ABK H;  2WY7 Q;  1F1Z A;  1Z3X A;  4HNV A;  2E5Z A;  3DEW A;  3UR3 C;  3JRG A;  4RGS A;  2V7F A;  3IH3 A;  1LUJ B;  4LLG F;  2CQK A;  3EUH C;  1UAA A;  2O03 A;  1TWA J;  2WAD A;  3MZY A;  3OV8 A;  3TDZ C;  2V26 A;  4PCQ A;  2Q0O A;  4WXD A;  2HDW A;  3DV8 A;  5F1J A;  5E3M A;  1R5H A;  1W7P B;  4MFD A;  1WJB A;  2F4M B;  2RKH A;  4EQQ A;  4HDU A;  1SVM A;  5FRN A;  5CVU A;  3LOC A;  3P9I A;  1VFC A;  3BR2 A;  5TGT A;  2V1N A;  4RAZ A;  1ZGW A;  5F08 A;  5GP9 A;  2L4M A;  2LH9 A;  4CCL A;  1YW8 A;  4U87 A;  3QRF F;  4Y52 J;  2N8G A;  1W7P A;  4AIH A;  3GCM A;  3BR6 A;  4RAF A;  3KIO A;  1FC3 A;  3G4S I;  2KJB A;  3LL7 A;  2HQ5 A;  2BY1 A;  3HTU A;  3M7G A;  2XF7 A;  5JHF A;  1RKW A;  2VJJ A;  3HKZ N;  1R5G A;  2BGC A;  3R0A A;  4HA8 A;  2VC1 A;  4KJZ A;  4XON A;  3F8B A;  3G1O A;  1Y39 A;  1HDD C;  4M73 A;  3HOU J;  2FMY A;  1HKS A;  5EZH A;  3WU1 B;  1K4S A;  2RGV A;  1EKE A;  2BY2 A;  4HX4 A;  4XRM A;  3WGI A;  1AWC A;  5JHU A;  2IGM A;  3CUQ B;  5GTH C;  1RPW A;  1X3W B;  5IYC J;  4HDV A;  3U1K A;  4ASN A;  3UNG C;  2HYJ A;  3I4P A;  1TNT A;  4V19 K;  1OFC X;  2C6Y A;  1AA7 A;  4AU7 A;  4I2O A;  3GTL J;  2V6E A;  1IDY A;  4IXA A;  1FMV A;  3L9F A;  3PM1 A;  3CUQ A;  5EJC A;  2X85 A;  4U88 A;  1BI0 A;  4I0B A;  3TKY A;  2KFD A;  4HOB A;  1JJ8 C;  1NK2 P;  1YQA A;  2M3A A;  1TC3 C;  3E5Q A;  1G2H A;  1D8J A;  4IQJ A;  3S15 J;  1YE9 A;  1YJN I;  1FOW A;  3CQZ J;  1ACI A;  2EIM H;  1GT0 C;  5CVV A;  2DO7 A;  5BQT A;  5EDN A;  2VJ5 A;  3HRM A;  1HW2 A;  3M8J A;  1IGN A;  4A3C J;  2JPC A;  2CQN A;  2P4W A;  5J8C A;  2M35 A;  1ETY A;  2X6O A;  1ZR2 A;  5ICE A;  1FOY A;  5IPA A;  2UUZ A;  3IHU A;  4C9Y A;  4NB5 A;  3BWG A;  1LDD A;  2CFX A;  2GA1 A;  3BRO A;  3FZV A;  3EYI A;  3MMY B;  3J7Y J;  5IP6 A;  4MQV A;  5JLW A;  3BG5 A;  1YJW I;  2E19 A;  5IP7 J;  3LQQ A;  1Y6I A;  2KIU A;  1BR4 A;  1F36 A;  4UVA A;  3PUF A;  2FE3 A;  1R71 A;  1ULY A;  2QQ8 A;  2MH9 A;  1EH7 A;  3WHB A;  1H89 C;  2D2W A;  5AIQ A;  3M8E A;  3O2P E;  4XOT A;  3E6M A;  1BI1 A;  2F5C A;  1WZ2 A;  2XAH A;  4X0G A;  2PG4 A;  5D5W B;  4M3F A;  3WU2 C;  3CJQ B;  1YRN B;  3TBI A;  4MNU A;  4P96 A;  2COM A;  3ZXS A;  2J5O A;  3GBG A;  4NQW B;  1KQ9 A;  2R5Z B;  2ZBK A;  1FTZ A;  2ZXI A;  3HJE A;  5ILU A;  3MAJ A;  5FD6 A;  3W2A A;  4PJL A;  4LLN A;  1MBK A;  2Y69 H;  2EZL A;  1Z3Y A;  1VQ5 I;  5F64 A;  3S1M J;  1S5L C;  1VQM I;  4ZDP A;  5KVR A;  3F8M A;  1SD4 A;  4NQW A;  2R5Z A;  2E36 A;  3MCZ A;  2ECC A;  1UST A;  3BR0 A;  3DLL F;  3V8J A;  3LSJ A;  5CKT A;  1IN4 A;  2MA3 A;  3NAU A;  1Z21 A;  4E7Z A;  4A3E J;  3ERM A;  1USS A;  4MEY F;  1RES A;  2HI3 A;  4V2F A;  3J81 K;  5L3F A;  1TP4 A;  2R7R A;  3KEY A;  4AWX B;  4IZZ A;  3K4M A;  3QYF A;  1JGS A;  1A36 A;  3HRU A;  3BZK A;  2NNN A;  2GBY A;  2CW0 F;  4U0W A;  3SDG A;  5LRS A;  1ZHF A;  1LQ1 A;  2HDC A;  3GTP J;  5HOD A;  1TT5 B;  2A6E F;  4MQ9 F;  1R36 A;  1I1S A;  1ZYR F;  1LKX A;  2VL8 A;  4E7J A;  1MJB A;  2ELK A;  1X3Z B;  3ULQ B;  2R3S A;  2FQ3 A;  5H20 A;  2DMU A;  3TGN A;  4AIJ A;  5K1Y A;  3RZO J;  5D6E A;  2LKP A;  1FT9 A;  4I01 A;  2X1C A;  4MIM A;  4F55 A;  1IV6 A;  4UV8 A;  1PVE A;  5HS8 A;  1U5T A;  3WTX C;  4M9S A;  2F5F A;  3E97 A;  3CCJ I;  3AG2 H;  3S32 A;  1YFH A;  4IHY A;  3LSI A;  2LK2 A;  5LLQ A;  3S3M A;  1XMA A;  3FIS A;  3FMQ A;  1PUF B;  1BL0 A;  2PJR A;  3HOZ J;  3PQJ A;  1ZH5 A;  5ICC A;  2BVM A;  1S9H A;  3EDP A;  1ORK A;  2R92 J;  1JE8 A;  3G6E I;  3BP8 A;  1PUF A;  3AL0 C;  5HNH A;  1GUU A;  1DP3 A;  4M3G A;  2IXS A;  3OYE A;  3QAH A;  3F0C A;  2K3P A;  5EG0 A;  3ZMT A;  3OYH A;  4Y17 A;  3VYS B;  3IH2 A;  1QGP A;  1ZEL A;  1PP7 U;  1VQ9 I;  5DD8 A;  2XPV A;  3OYN A;  3BG7 A;  2XAU A;  1YIO A;  4UXN A;  2DQR A;  3IP4 B;  1T39 A;  2VQL A;  2WAF A;  3VB2 A;  2TCT A;  4E7K A;  3HTS B;  1V3F A;  1FBS A;  4CCN A;  3CP8 A;  3TMO A;  4C3I J;  1Y0N A;  1BM9 A;  2UXN A;  1SFK A;  3BR5 A;  1O3R A;  3I4N J;  3ZN0 A;  2DJI A;  3FK7 A;  1DGR M;  2X6Y A;  3M1C A;  2DFI A;  1XDU A;  1LE8 B;  1XDS A;  5F6F A;  1HCR A;  3C18 A;  1BW6 A;  4IRH A;  3J7Z I;  1J9I A;  2XSD C;  2JPB A;  1GVD A;  1E2X A;  1UHW A;  1XSX A;  2ZB9 A;  4RA2 A;  1XD7 A;  4DJA A;  3WTU C;  5CQG A;  4BE0 A;  1OQY A;  3CF2 A;  2UWM A;  1B72 B;  1LE8 A;  2STT A;  2YUS A;  2DDB A;  4QPO A;  2Y2Z A;  4A6E A;  2VON A;  3E5U A;  5EF6 A;  5IT3 A;  3JRE A;  1X58 A;  2O6G E;  2H1K A;  3K4J A;  3ZPL A;  5FO5 A;  1J09 A;  1B72 A;  4XMY A;  2L5Q A;  2F2E A;  1ZR4 A;  4L5I A;  2R7V A;  2R5Y B;  5HLI A;  4A3M J;  1LJ9 A;  3S3O A;  2K9L A;  2Z1D A;  4A5M A;  1Z91 A;  2CS3 A;  5FKK A;  5HS9 A;  3LAJ A;  3BZ6 A;  2P0T A;  3GFL A;  2R5Y A;  1FLI A;  2RNG A;  3IL2 A;  1SC7 A;  2D45 A;  3M8F A;  3Q0W A;  2R7X A;  1ZGJ A;  2RVC A;  4RAY A;  5L3B A;  3L2W A;  1U2W A;  3OOU A;  4S0H B;  1I3Q J;  2M45 A;  2ZC2 A;  4Z2Y A;  4XOP A;  3RIR A;  1R1V A;  2KZG A;  4BQA A;  3QU3 A;  4G6T B;  3MKZ A;  2F6C A;  4KIS A;  3E1S A;  4BXX J;  4C3J J;  3WGH A;  4GCV A;  4HST A;  3RYP A;  3HRS A;  4N4O B;  4A12 A;  5FB2 A;  3H3V K;  2CQ7 A;  1SFU A;  1J7K A;  4F7Z A;  2FBH A;  2GOM A;  4M9X A;  4CCJ A;  4XLP F;  2YR2 A;  4UB8 C;  3GFI A;  2JUG A;  4MLO A;  3T8T A;  1A6I A;  4HV6 A;  2XIG A;  4N9I A;  2X98 A;  2L9R A;  2V9P A;  1K83 J;  1MBF A;  3K2Z A;  1Y8R B;  3E7L A;  4OOI A;  2NVX J;  2P6S A;  3ZMV A;  2F4O B;  1SVL A;  2EB7 A;  2VE8 A;  2DXI A;  1T08 B;  3HSE A;  4O3M A;  1LDJ A;  3G73 A;  2F48 A;  2GAU A;  1V54 H;  2JWT A;  3J80 K;  1I27 A;  1K78 B;  1VQL I;  2Z2S B;  1ZRD A;  2JA2 A;  3HOV J;  1FSE A;  4FT8 A;  2IA0 A;  5A2Q R;  3FWE A;  2DOE A;  2L3D A;  2E2H J;  4A3G J;  3AKZ A;  4RB3 C;  2PMZ A;  3CMY A;  5E1W A;  5CPR B;  3OYK A;  3I56 I;  4ENJ A;  1K78 A;  2XF6 A;  3FXJ A;  2CH0 A;  5IOY A;  1ZG1 A;  2LKS A;  1WJF A;  5GTI C;  3COA C;  3C2B A;  2WA0 A;  4WK8 F;  1RUO A;  5GAE J;  1MMS A;  2YX4 A;  1RI7 A;  1O7L A;  1PYV A;  2W25 A;  4IVN A;  5BNG A;  1VQP I;  2L9S A;  5FGM A;  5JR3 A;  2IW5 A;  3VYU B;  5E3O A;  2GIZ A;  3BCA A;  2FX0 A;  4L18 B;  2IS2 A;  3F72 A;  5K5R A;  3SHF A;  1WSU A;  3CC7 I;  3OYI A;  2Y48 A;  3I4M J;  2CUJ A;  2HOA A;  3KLN A;  3E3V A;  4CHU A;  3QPH A;  2LKX A;  2M4G A;  3OY9 A;  2QLZ A;  4A5N A;  1DDN A;  4KFC A;  3LA2 A;  2XGX A;  3H9Q A;  3RDI A;  1QZZ A;  2CW8 A;  4F92 B;  2QQA A;  4UV9 A;  1JT0 A;  2I10 A;  2MUN A;  2IGK A;  2Z99 A;  3CUQ C;  3TL4 X;  1ERD A;  4KUM A;  3J80 Z;  1D8K A;  1KYW A;  2WWY A;  2M30 A;  1WJ5 A;  2W84 A;  2NYX A;  4QSH A;  2OV7 A;  4CGZ A;  3SXY A;  3L2Q A;  2MSY A;  2DMQ A;  4TV7 A;  1T98 A;  4QPQ A;  3GZ5 A;  3KFW X;  2NS7 A;  4LB5 A;  5C44 J;  1D5V A;  2LF8 A;  1LPQ A;  2RQP A;  1D0Z A;  5E3L A;  2XC7 A;  2E7X A;  1Z7L A;  3W2V A;  3CCL I;  3FK6 A;  2DFE A;  4QIW N;  2DJN A;  2P5L C;  1R9T J;  1I50 J;  3KYD B;  3R4K A;  4BQN A;  3DTE A;  5M5X J;  1G59 A;  4C3H J;  4O6J A;  2Z5U A;  3DQV C;  1CGP A;  2DI3 A;  2K85 A;  1W5C C;  4R1H A;  3RKY A;  1B1B A;  3AL0 B;  5KAF C;  1T56 A;  4RGR A;  4G7H F;  2VN2 A;  1TZL A;  1RUN A;  1U6G A;  2RC4 A;  1Z0X A;  2JN6 A;  3VWB A;  1SFO J;  3F6V A;  3WGG A;  4G8X A;  2LFB A;  2MD5 A;  3JRB A;  1RZ4 A;  2HQR A;  2VOP A;  4KIG A;  1UHS A;  2EZI A;  2JRM A;  2LLK A;  2NS8 A;  3HOS A;  4BHP A;  3L09 A;  2ZNZ A;  2QEX I;  2LMD A;  3I53 A;  2AHQ A;  4X1E A;  3MKW B;  5JI6 A;  3F8F A;  3DXJ F;  1D0X A;  4U7B A;  3CCE I;  2ZCW A;  2KHM A;  2RRE A;  2QKM B;  3JR9 A;  2GWR A;  4Y13 A;  3ZQL A;  2LVS A;  1ENH A;  4A3L J;  5H2F C;  2W00 A;  5HOO A;  1MH3 A;  1LEB A;  2FBK A;  2XKO A;  3V42 A;  1A35 A;  4ESF A;  3CCR I;  3CCM I;  1VQO I;  1F5T A;  5LGN A;  4CA0 A;  3LSP A;  1IF1 A;  3SZP A;  2PMH A;  4B8X A;  1S72 I;  2ZJR F;  4NBQ A;  1S7A A;  3CP2 A;  4CCK A;  1WJE A;  3WTY C;  3C1D A;  2V9V A;  1MBH A;  2JUC A;  1W36 D;  1GXP A;  2QVO A;  2PN6 A;  1UJ8 A;  4PK4 A;  2V6C A;  2HQA A;  4DBR A;  3OYM A;  2HYG D;  3L00 A;  3RKX A;  5FJ8 J;  3PO3 J;  1B59 A;  3MD2 A;  3RKW A;  2FOK A;  1MBE A;  1Z7U A;  2MC4 A;  4Y33 A;  2MC3 A;  1HKT A;  1MSF C;  3FXQ A;  1K7A A;  3FHN A;  1DGW Y;  4NHJ A;  5B66 C;  1XSD A;  1CF7 B;  4EJO A;  4KDP A;  1U9O A;  4IRG A;  3BOQ A;  4U0Y A;  4ZTJ A;  1MDM B;  2Z3Y A;  4A0Y A;  5ICF A;  1GV5 A;  3WTV C;  3F3X A;  3FXR A;  3A2K A;  1XB4 A;  2ICW G;  1H0M A;  4UUS B;  2H94 A;  2IA1 A;  3GWZ A;  1ETX A;  1MDM A;  3A02 A;  2L7Z A;  4E4H A;  4IHX A;  2Y75 A;  1X4P A;  1W5T A;  1QO0 D;  3CJR B;  1U5T C;  2ELJ A;  4XNF A;  3LFU A;  3RQ4 A;  4OIN F;  1HBX G;  2RDP A;  1NHA A;  4UUS A;  5LHG A;  3LWF A;  2HR3 A;  1VF9 A;  2JRT A;  3OIQ A;  4FQG A;  2XDV A;  4HLY A;  4N9H A;  3WE2 A;  2L4A A;  2R7Z J;  3WG9 A;  1BI2 A;  3IH4 A;  3PSF A;  4Y7N J;  1AOY A;  3PUB A;  4IPA A;  1QA6 A;  4EGY A;  4XSX F;  1H9G A;  4ABZ A;  3PFI A;  4UVC A;  2OQG A;  3ECO A;  1R1U A;  2DN0 A;  4CYD A;  4BKX A;  1X4O A;  1JT6 A;  1G3Y A;  2MD0 A;  2ZFW A;  3HXL A;  4M3D A;  3JW4 A;  3OYD A;  4J00 A;  1R22 A;  4KT5 C;  5F04 A;  4MEX F;  2EA2 A;  2QF7 A;  1U8B A;  2NNY A;  1EF4 A;  2DT7 B;  3A0B C;  5KAI C;  1YIT I;  3CLQ A;  3BJA A;  3S93 A;  4OMZ A;  2CV2 A;  3K0L A;  5J40 A;  2K40 A;  4JX6 A;  5EGO B;  2JT1 A;  3RKQ A;  1X2M A;  1KA8 A;  2PMU A;  5FFX A;  3H36 A;  4HX7 A;  2D5V A;  2R7Q A;  3WHC A;  1TWC J;  4EJW A;  4B43 A;  4ZC3 A;  3ABL H;  3SEZ A;  5EGO A;  3JRH A;  1PUE E;  1M1E B;  3FXK A;  2XAQ A;  1OCZ H;  1OCO H;  3QYE A;  4KMU X;  3IUO A;  1Z1D A;  3H3Z A;  2X51 A;  5DUK A;  3IV5 A;  1KON A;  2DT5 A;  1WH7 A;  5HVQ C;  2ZSH B;  5F0F A;  4PJN A;  2FQ4 A;  1IV8 A;  1OCP A;  4WF2 A;  4LIT A;  5DM6 F;  5GAD J;  2XPW A;  1ZLJ A;  4NC6 A;  2JA5 J;  2DTR A;  3QP6 A;  2VKE A;  1ZRE A;  1T95 A;  3TQN A;  1P92 A;  4EM0 B;  2ACJ A;  1H9T A;  1H88 C;  2KIM A;  1QVT A;  4YEJ A;  4OIR F;  2BXY A;  1KU3 A;  1KU9 A;  2XRO A;  2FUG 2;  4C2T A;  1P4W A;  4BBR J;  4G12 A;  5GAH J;  4UHT A;  1UZC A;  4M6V A;  4EM2 A;  2W57 A;  2IT0 A;  4F93 B;  2XRN A;  5F27 A;  4U0V A;  3DEE A;  3AG1 H;  4RLF A;  2HVQ A;  1NK3 P;  4QWQ A;  2WBM A;  2F5E A;  3F8C A;  1MW7 A;  3K1N A;  2K5C A;  4HNU A;  5K7H A;  1WRJ A;  3H9G A;  5HDN A;  4KT6 A;  5M3F J;  4DBQ A;  2QBY A;  3BQZ A;  5HDK A;  4W97 A;  2KIF A;  1XMX A;  4L9V A;  4PFO A;  4CXF A;  1X3U A;  2ETH A;  2LRD A;  1P9Q C;  4IQ4 A;  4RDU A;  1S7O A;  2EIL H;  2EQR A;  4EM1 A;  1XSV A;  1C0W A;  1HA8 A;  3FF5 A;  3VDX A;  3PJR A;  4BDZ A;  2WC2 A;  3DKY A;  1RR8 C;  2CRG A;  2YU3 A;  3LSG A;  4HAM A;  3JRD A;  3QQA A;  1HW5 A;  2CUE A;  3CDI A;  1YS6 A;  5F0C A;  1BA5 A;  2Q8K A;  3DTK A;  3BG3 A;  3HRT A;  1OKR A;  1S6L A;  3P5J A;  4ANJ A;  2V1X A;  4BEH B;  1U0J A;  4HF2 A;  2DA4 A;  4EVI A;  2M8G X;  2MZ4 A;  3KZZ A;  4H4K C;  1SFE A;  2TRT A;  1XS9 A;  3FBN B;  1OMI A;  4F3Q A;  4IOA F;  1X1C A;  2D1V A;  2JA6 J;  4Q5S F;  4BEH A;  3OYA A;  2M0M A;  2AQE A;  4D7M A;  2DMT A;  2NVQ J;  5LBQ A;  4ESB A;  4I09 A;  1FX7 A;  3D0S A;  1WWX A;  2QGU A;  3N4M A;  2P5V A;  2JA7 J;  4UB6 C;  2EBI A;  2ZJP F;  1ZKG A;  3IKV A;  4GYG A;  2K27 A;  2V9K A;  5CQE A;  3OS0 A;  3RTR A;  5FRM A;  5E8I A;  4DYR A;  1RET A;  2DW4 A;  2CU7 A;  4AVP A;  3OL4 A;  3ABU A;  4XN0 A;  3T8R A;  1Y8Q B;  3CCS I;  1Z05 A;  2K9Q A;  3KCC A;  4ENN A;  3MQ0 A;  2QQ9 A;  1FEX A;  2ADU A;  3TO6 A;  2Z9O A;  5IYB J;  3LSM A;  1NG6 A;  3A1Y A;  2P5K A;  1MNE A;  3SYT A;  2EH3 A;  2TDX A;  2CMP A;  4GYI A;  5D4S A;  2QSF X;  2NAZ A;  4EGZ A;  1J0R A;  2LOO A;  1LB2 A;  3WTT C;  3KLO A;  2HQN A;  2LD5 A;  2QCO A;  2L0K A;  4HLX A;  4O5V A;  4YIF A;  4BHB A;  5E1Z B;  4IKF A;  1WKM A;  2DMP A;  2M2E A;  1T33 A;  4XM3 A;  3ZGK A;  4FCY A;  3VSK A;  2COB A;  1FP2 A;  2DK5 A;  1IN7 A;  2EPF A;  2V79 A;  2K9M A;  2AXT C;  2JVH A;  3HEF A;  2CYY A;  4IJA A;  4BAY A;  2DA7 A;  3LSR A;  1T0F A;  1FZP B;  3HYI A;  3KP3 A;  3KZI C;  4AYB A;  4DGW B;  4KN7 X;  1MMA A;  1XX5 A;  1APL C;  2L7K A;  1KQ8 A;  1G3S A;  1D1B A;  4KA4 A;  4RB1 A;  1ZG3 A;  3U21 A;  2F5V A;  1Q1H A;  3Q9V A;  4CZZ A;  2RQQ A;  4ON0 A;  4ENM A;  1OJL A;  1FPQ A;  1JUM A;  3M9A A;  3GX4 X;  2VC0 A;  1VQK I;  2ZO4 A;  3HOT A;  1V5G A;  3H9J A;  2VPR A;  3ZQC A;  2X0L A;  1SVO A;  4E70 A;  3PIP F;  3CO6 C;  1DPR A;  1U5T B;  1XCB A;  3IAM 2;  5HDG A;  3RZD J;  3ABM H;  5D6F A;  1KU2 A;  1S3J A;  3K70 C;  4YIR X;  4HQE A;  2PJR B;  2GOX B;  2MH2 A;  2KDZ A;  5L3D A;  1W1W E;  3FHZ A;  1EV7 A;  2KL4 A;  1VI0 A;  2HZD A;  2Y0S A;  5A2Q K;  4GO1 A;  2K9S A;  4NC7 A;  4ZJZ A;  3S1Q J;  3DU6 A;  1POG A;  1HSJ A;  1T38 A;  2BEO A;  5CVI A;  3SJM A;  2V4J C;  2WB1 A;  3RQI A;  1AKH B;  2W7N A;  2PJP A;  3JAM K;  4KN4 X;  3MFK A;  4A3D J;  4XKC A;  2KP6 A;  5EG0 B;  3LST A;  2XVC A;  4IHS A;  2M5W A;  1Y1W J;  1UHM A;  2ZME B;  3K4K A;  2MG4 A;  1ETQ A;  1AKH A;  4BUP A;  2JA8 J;  2KZV A;  2LY9 A;  2WY8 Q;  3IKT A;  3UKG A;  3I0T A;  2VKV A;  4D9J A;  2VKH A;  3R60 A;  1S8N A;  2ZME A;  2DYR H;  5TIS C;  1IUY A;  5FLX R;  1EJ9 A;  4BS9 A;  5J1U A;  2H8R A;  2EK5 A;  5BOX A;  4N0B A;  2FSW A;  5CJ9 A;  3OL3 A;  1KU7 A;  1VZ0 A;  4A2U A;  4YFN F;  2JQ7 A;  4OU0 A;  2OZU A;  5D5V B;  2JMW A;  3GO5 A;  4M72 A;  2VI6 A;  1D3Y A;  1UFM A;  2EFP A;  2O3F A;  1OYI A;  5D4R A;  2MLK A;  1A31 A;  3HOY J;  1TLH B;  3HPG A;  5EYR A;  1P6R A;  5KHD A;  3OYC A;  2OU2 A;  2WAE A;  1XPX A;  2B7E A;  4JK1 X;  1R7J A;  4HYE A;  2MLG A;  1FWZ A;  1WHU A;  2BVL A;  2E1C A;  2BW3 B;  4EMS A;  4RS8 A;  3IAS 2;  4P1W A;  2R7T A;  1F43 A;  3LAP A;  1FSH A;  2YS9 A;  2DLL A;  4PSX A;  4HZF A;  3REO A;  3SDB A;  1PP8 F;  3HGG A;  2OAZ A;  2KJC A;  1LVK A;  3DWL E;  5DV5 A;  5A2Q Z;  1SMY F;  2BW3 A;  4ZDL A;  1K6O A;  4M3E A;  2ZSI B;  3BQY A;  3ECH A;  4JQF A;  4LG3 A;  4XN3 A;  3JAM Z;  3L2R A;  2CFO A;  4A3B J;  2CV1 A;  5DYM A;  2HTJ A;  2DA3 A;  3A0H C;  2F4I A;  4RGU A;  2QQB A;  3ISP A;  1X2N A;  1T8I A;  4A3F J;  3NWS A;  1R4M B;  3O3K A;  2Q2E B;  3ZMD A;  1O3Q A;  5CLS A;  4EJV A;  4XQF A;  2QSH X;  4DYC A;  2KRC A;  1J75 A;  3ZQG A;  3RPU D;  1HOM A;  3BJO A;  5FLV A;  2Q2E A;  3BZC A;  4A3K J;  1BBY A;  4R8H A;  4PSW A;  2O5R A;  4WXH A;  3GTG J;  1YW9 A; 
#chains in the Genus database with same CATH homology
 3KZY A;  1G3T A;  4PGG A;  4BXU A;  2G7U A;  1ONV A;  4A0Z A;  4KIB A;  4IF4 A;  3KP5 A;  1EH8 A;  1MD0 A;  2V1D A;  4WCG A;  1WI9 A;  2F5D A;  5L3G A;  5K5O A;  1XGS A;  2NRA C;  2FF4 A;  5IT9 K;  1TW2 A;  1TTY A;  1FY7 A;  1MKM A;  3GXO A;  4I02 A;  2HYF A;  4G9Y A;  4XLN F;  2EJR A;  2QEN A;  3U2R A;  1YW9 A;  2IRF G;  3I5U A;  3MZH A;  2DQL A;  3I58 A;  3S2W A;  4B09 A;  3BJ6 A;  2FRH A;  5EEH A;  1JHH A;  2HKX A;  3LQR A;  4HX8 A;  2GZW A;  2LDU A;  2W24 A;  2VOO A;  2DU9 A;  4LFU A;  1LVA A;  3ABT A;  2P7C B;  3GYH X;  1ODD A;  1KQ0 A;  2ISZ A;  2A6H F;  1SD5 A;  4G7O F;  3D5L A;  2WTE A;  1B9M A;  3CLO A;  1U78 A;  3JSO A;  3C3W A;  5IT9 Z;  1L3L A;  4RGX A;  1TQM A;  1YW7 A;  1B4A A;  2H09 A;  3V8L A;  1EH6 A;  1FBQ A;  4MGR A;  3B02 A;  2XKP A;  5J6X A;  1ZRF A;  3CDH A;  3KET A;  2HS5 A;  2DPU A;  2G7H A;  3ELK A;  3TO9 A;  2VBY A;  4M74 A;  5DEQ A;  2IPQ X;  2R7F A;  3RYR A;  1ON2 A;  1UB9 A;  2X4H A;  3IRR A;  4GXO A;  5L3E A;  3SZT A;  3K1M A;  5JFR A;  2MBF A;  1O3S A;  3FM5 A;  1RIO H;  1XCV A;  4ZZL A;  3NQO A;  4KIC A;  3W6J B;  5LRR A;  4BYY A;  3SQN A;  3KP4 A;  2A3S A;  1QZY A;  2H27 A;  3BPX A;  2P8T A;  1BC7 C;  4IHT A;  4M6X A;  4P5O A;  1TBX A;  1LDK B;  4LK1 F;  4ZYE A;  3GVA A;  2V1U A;  1ZN2 A;  1P2F A;  5EEG A;  1QBJ A;  1XGM A;  1R00 A;  4I0A A;  6PAX A;  2VT2 A;  4YFK F;  4I7H A;  5AON A;  2ZKZ A;  3ZN1 A;  2VE9 A;  4KNY A;  2OQR A;  2IJL A;  2ZXJ A;  3QOP A;  5D5X B;  1BN5 A;  3CTA A;  2VBZ A;  3I54 A;  3QP5 A;  2XAS A;  3TO7 A;  2BV6 A;  4XRF A;  2EWN A;  4PZJ A;  3DPT A;  4EJU A;  4MTE A;  2D1H A;  2HFH A;  4DNC A;  3QPT A;  3E6D A;  4U7D A;  3ZMS A;  3P9K A;  4L9T A;  2JSC A;  4D0P A;  3DFG A;  3ZMZ A;  4HW0 A;  3VEP A;  4CDG A;  4EJT A;  2G9W A;  1A04 A;  3EET A;  4I98 B;  2DK8 A;  1G6N A;  1FYL A;  3DPL C;  1W7P D;  5JVT A;  1IXC A;  2M87 A;  3ERE D;  5LHH A;  3WTS C;  2FNP A;  1K79 A;  3HHG A;  5E17 F;  1T2K A;  2FBI A;  2XUB A;  4XSZ F;  3HSF A;  3WOD F;  3V7C A;  3I59 B;  4UVB A;  2IVM A;  4R79 A;  1BC8 C;  3LFK A;  3I59 A;  3F8N A;  1B6A A;  2PFB A;  1ZAO A;  3E5X A;  5BPI A;  1KGS A;  5DD4 A;  4YII A;  4L9J A;  5ILS A;  4KIF A;  4HV5 A;  3T0Y A;  2L01 A;  1V4R A;  1QNT A;  2L02 A;  1ON1 A;  2BYV E;  2HGC A;  1IZ1 A;  1LNW A;  2QBY B;  3EQL F;  1OYY A;  4AIK A;  1IXR C;  4EV0 A;  4G94 A;  4CO8 A;  4Y15 A;  2Y0M A;  1IN8 A;  5FLX K;  4M6Y A;  4Q47 A;  1XMK A;  4WX9 A;  3I71 A;  1IN6 A;  2P7V B;  1YTY A;  5H6Q A;  4CIC A;  3KEO A;  5KK1 A;  3CO7 C;  4Q48 A;  1FOK A;  5ERI A;  1XGN A;  3M1E A;  4LG0 B;  4BNC A;  2EA4 A;  1SD7 A;  5D5U B;  3L7W A;  2RNJ A;  3RI4 A;  1O3T A;  4M9Z A;  5E18 F;  4KYW A;  3E6C C;  4LG0 A;  3ZP5 A;  3OOP A;  2QZ8 A;  1FBU A;  3G3Z A;  1OR7 A;  1J5Y A;  1GVJ A;  2JZY A;  1E17 A;  2EFN A;  1GXQ A;  4UUV A;  1T6S A;  1SAX A;  3HIF A;  3GUD A;  2K02 A;  5FLX Z;  5LGU A;  1HQC A;  2FA5 A;  2LSO A;  2OA4 A;  4RB0 A;  5D8L B;  1F4K A;  3KP2 A;  3P7N A;  2HTS A;  5DUI A;  1YS7 A;  4P9F A;  3L2C A;  4M71 A;  3O6B B;  1Z6T A;  2PBI A;  1YO5 C;  3W6K B;  1W5S A;  2O0Y A;  3JTH A;  5HS7 A;  3HHH A;  3NRV A;  4L5J A;  4FHT A;  4LB6 B;  5DCF A;  1Z9C A;  2EFO A;  3F23 A;  5ICG A;  4ENK A;  2A69 F;  3ZQ7 A;  2UXX A;  1ZRC A;  3K69 A;  5E1X A;  1FP1 D;  1BIB A;  4A6D A;  5TRD A;  2BBY A;  2PI0 A;  1FNN A;  2GA2 A;  3TOA A;  2RN7 A;  4HBL A;  4PDK A;  4JBA A;  4LMY A;  4IRI A;  3BDD A;  2YPR A;  4WWC A;  2GXG A;  5BPD A;  1HXD A;  1ZGA A;  1B9N A;  1STZ A;  1O7F A;  1TNS A;  5LEJ A;  2H6B A;  2CWE A;  2VXZ A;  1REP C;  1R1T A;  2HEO A;  2M8E A;  5FFZ A;  4H0E A;  2J5P A;  3ROU A;  1JHF A;  2XAF A;  2E7W A;  2VT3 A;  1Y0U A;  4OIP F;  5CVR A;  3F22 A;  2NS0 A;  4P9U A;  1F9N A;  2VBX A;  1IW7 F;  4MTD A;  1BJA A;  3K1P A;  3Q9S A;  3J81 Z;  3TOB A;  4G7Z F;  3DKW A;  4HQM A;  2AS5 F;  3JTG A;  2A5Y B;  4UNO A;  1VTN C;  1TQP A;  1BOA A;  3GW2 A;  5BS6 A;  1PDN C;  2L54 A;  2B0L A;  2ESN A;  3GF2 A;  5J8F A;  4L0Z B;  2ISY A;  3EUH A;  5LGT A;  3FM3 A;  2ZNY A;  2EV5 A;  3VOD A;  1MZB A;  5E20 A;  2FXA A;  1YG2 A;  5E8G A;  4XBF A;  3DEU A;  1IXS B;  4GGG A;  1KYZ A;  1I5Z A;  3H92 A;  4Q4Z F;  5HLG A;  3SFZ A;  2O8X A;  2IA2 A;  1OPC A;  2LF7 A;  2HZT A;  1IAW A;  4ZZD A;  5LEK A;  3R6S A;  5LHI A;  2CSO A;  2DAO A;  1R23 A;  5BMZ A;  4G6Q A;  1P4X A;  3V7R A;  1OYW A;  1ZAR A;  1BI3 A;  1XN7 A;  2K86 A;  4BHC A;  3MEX A;  1J59 A;  2PEX A;  2GQQ A;  3BPV A;  2A68 F;  1DUX C;  4WXC A;  2HKO A;  1U8R A;  1I6X A;  4ZYG A;  2RV8 A;  3RPQ A;  2GXB A;  1QQI A;  2A61 A;  1FYM A;  1J2X A;  2PLY A;  2GIV A;  3IWZ A;  2ELH A;  3GFJ A;  4YG2 F;  1JXS A;  1P4A A;  1Z6R A;  2KKO A;  2ZJ2 A;  2IP2 A;  3NEU A;  1MGT A;  2UZK A;  4RB2 C;  3RPU A;  3KP6 A;  5HLH A;  3V8K A;  4ESJ A;  4AD9 A;  2EFQ A;  3QU6 A;  1HKQ A;  2QUF A;  2EV6 A;  1G3W A;  2FU4 A;  2QWW A;  1I1G A;  4DQ2 A;  4BH9 A;  2DBB A;  1TQI A;  2FNA A;  1SD6 A;  3I64 A;  2CG4 A;  5TJJ A;  3IC7 A;  3T1B A;  2Z33 A;  4ZYH A;  2XV4 S;  4S05 A;  5F1R A;  1RNL A;  2LNB A;  3DF8 A;  2WV0 A;  1QPM A;  2R7D A;  3H3U A;  5DCM B;  2EV0 A;  3U9G A;  1HW1 A;  3F6O A;  1LEA A;  3VFZ A;  2ESH A;  4OIQ F;  3C7J A;  5DCM A;  4LLL A;  3HSR A;  2AXL A;  2VOD A;  5DDG A;  2A07 F;  4MHG A;  2K4J A;  3FXU A;  3R0J A;  3FMS A;  2BE5 F;  1IRG A;  1FYK A;  3BY6 A;  2HWV A;  2PQ8 A;  1SMT A;  2CO5 A;  3PQK A;  5K5Q A;  2QM3 A;  2FML A;  3ML6 A;  4LJZ F;  3IWF A;  2KRF A;  3KEQ A;  5L3C A;  3J7A O;  4LK0 F;  2K7L A;  3WE3 A;  5ED4 A;  2XAJ A;  4QLC U;  1ZLK A;  3WTW C;  4A0X A;  3CUO A;  1SFX A;  3T5X A;  2OD5 A;  1MJ9 A;  3Q5F A;  3VOE A;  4K2E A;  4PGH A;  1YYV A;  3EYY A;  3V7S A;  3GZ6 A;  4OMY A;  4YFX F;  5ILV A;  5CVJ A;  4FX0 A;  3E6B A;  2P6T A;  1IRF A;  1HST A;  3GEZ A;  4HF1 A;  4LGW A;  3WU0 A;  1WQ2 A;  4P55 A;  5CYV A;  2JTV A;  4L0Y B;  1U3E M;  2YX7 A;  3GLX A;  5AIP A;  3LA3 A;  2DPD A;  1O57 A;  4LD5 A;  1XGO A;  5D8K B;  3LA7 A;  3KP7 A;  2XAG A;  4ZYD A;  3FX3 A;  2STW A;  3TDU C;  5FD5 A;  3GFM A;  4ETS A;  3P9C A;  3CJN A;  2XHK A;  2O61 A;  3MWM A;  2H6C A;  3R61 A;  4L9N A;  1IN5 A;  4ZH4 F;  4KMF A;  4FX4 A;  3F21 A;  2CGP A;  2VBW A;  3DP7 A;  3ZMU A;  3FMR A;  1CF7 A;  4G6D A;  2HOE A;  3V4G A;  1GHC A;  1R58 A;  1L0O C;  3N97 A;  2OBP A;  2EFW A;  3B73 A;  1W4M A;  2E1N A;  4S04 A;  3HUG A;  4OIO F;  3U1D A;  1BIA A;  2FEZ A;  1MJA A;  1YLF A;  2OZ6 A;  2QYO A;  1S29 A;  2M1B A;  4HF0 A;  3WTZ A;  2W85 A;  3AAF A;  3IRQ A;  1G4D A;  5H6R A;  3JSP A;  3RJP A;  1UCR A;  1ZG5 A;  2K4B A;  1DPU A;  1DP7 P;  1TW3 A;  3KE2 A;  2YSR A;  3K9T A;  1F1Z A;  4RGS A;  4LLG F;  2CQK A;  2O03 A;  3MZY A;  3OV8 A;  3TDZ C;  4PCQ A;  2Q0O A;  4WXD A;  3DV8 A;  1R5H A;  1W7P B;  2RKH A;  4EQQ A;  4HDU A;  5CVU A;  3P9I A;  4RAZ A;  2L4M A;  1YW8 A;  3QRF F;  1W7P A;  4AIH A;  1FC3 A;  2KJB A;  3HTU A;  3M7G A;  1R5G A;  2BGC A;  3R0A A;  4HA8 A;  2VC1 A;  3F8B A;  4M73 A;  2FMY A;  1HKS A;  3WU1 B;  2RGV A;  4HX4 A;  3WGI A;  1AWC A;  5JHU A;  3CUQ B;  4HDV A;  4ASN A;  3I4P A;  1TNT A;  2C6Y A;  4I2O A;  4IXA A;  3L9F A;  3CUQ A;  4U88 A;  1BI0 A;  4I0B A;  3TKY A;  4HOB A;  1YQA A;  3E5Q A;  1D8J A;  5CVV A;  2DO7 A;  5BQT A;  3HRM A;  1HW2 A;  2JPC A;  2P4W A;  5J8C A;  5ICE A;  3IHU A;  4NB5 A;  3BWG A;  1LDD A;  2CFX A;  2GA1 A;  3BRO A;  3FZV A;  3EYI A;  4MQV A;  3LQQ A;  2KIU A;  4UVA A;  2FE3 A;  1ULY A;  2MH9 A;  1EH7 A;  2D2W A;  5AIQ A;  3M8E A;  3O2P E;  3E6M A;  1BI1 A;  2F5C A;  2XAH A;  2PG4 A;  5D5W B;  4MNU A;  4P96 A;  2COM A;  2J5O A;  1KQ9 A;  2ZBK A;  5ILU A;  3MAJ A;  5FD6 A;  4LLN A;  5F64 A;  5KVR A;  3F8M A;  1SD4 A;  4NQW A;  3MCZ A;  1UST A;  3V8J A;  1IN4 A;  2MA3 A;  1USS A;  4MEY F;  3J81 K;  5L3F A;  4AWX B;  1JGS A;  3HRU A;  2NNN A;  2CW0 F;  4U0W A;  5LRS A;  1ZHF A;  1LQ1 A;  2HDC A;  2A6E F;  4MQ9 F;  1R36 A;  1I1S A;  1ZYR F;  1MJB A;  3ULQ B;  2R3S A;  2FQ3 A;  5H20 A;  3TGN A;  4AIJ A;  5K1Y A;  5D6E A;  2LKP A;  1FT9 A;  4I01 A;  4UV8 A;  5HS8 A;  1U5T A;  3WTX C;  4M9S A;  2F5F A;  3E97 A;  1YFH A;  5LLQ A;  1XMA A;  3FMQ A;  3PQJ A;  1ZH5 A;  5ICC A;  3EDP A;  1JE8 A;  3BP8 A;  3QAH A;  3ZMT A;  4Y17 A;  1QGP A;  1PP7 U;  5DD8 A;  4UXN A;  1YIO A;  2DQR A;  1T39 A;  3VB2 A;  3HTS B;  1V3F A;  1FBS A;  1BM9 A;  2UXN A;  1O3R A;  3ZN0 A;  2DFI A;  1XDU A;  1XDS A;  5F6F A;  3C18 A;  4IRH A;  1J9I A;  2JPB A;  1E2X A;  1UHW A;  1XSX A;  1XD7 A;  3WTU C;  2UWM A;  2STT A;  4A6E A;  2VON A;  3E5U A;  2O6G E;  3ZPL A;  5FO5 A;  2F2E A;  4L5I A;  5HLI A;  1LJ9 A;  4A5M A;  1Z91 A;  5HS9 A;  3LAJ A;  3BZ6 A;  3GFL A;  1FLI A;  3IL2 A;  2D45 A;  3M8F A;  1ZGJ A;  2RVC A;  4RAY A;  5L3B A;  1U2W A;  2M45 A;  4Z2Y A;  3RIR A;  1R1V A;  4BQA A;  3QU3 A;  3WGH A;  4GCV A;  3RYP A;  3HRS A;  4A12 A;  5FB2 A;  1SFU A;  1J7K A;  4F7Z A;  2FBH A;  4M9X A;  4XLP F;  2YR2 A;  3GFI A;  3T8T A;  4HV6 A;  2XIG A;  4N9I A;  3K2Z A;  4OOI A;  2P6S A;  3ZMV A;  2EB7 A;  2VE8 A;  3HSE A;  4O3M A;  1LDJ A;  3G73 A;  2GAU A;  3J80 K;  1I27 A;  1K78 B;  1ZRD A;  1FSE A;  4FT8 A;  2IA0 A;  3FWE A;  2L3D A;  4RB3 C;  5E1W A;  4ENJ A;  1K78 A;  1ZG1 A;  3COA C;  4WK8 F;  1RUO A;  2YX4 A;  1RI7 A;  1O7L A;  2W25 A;  4IVN A;  5FGM A;  5JR3 A;  2IW5 A;  4L18 B;  3F72 A;  5K5R A;  3SHF A;  1WSU A;  2Y48 A;  3KLN A;  3E3V A;  4CHU A;  3QPH A;  2QLZ A;  4A5N A;  1DDN A;  4KFC A;  3LA2 A;  2XGX A;  3RDI A;  1QZZ A;  2QQA A;  4UV9 A;  2Z99 A;  3CUQ C;  4KUM A;  3J80 Z;  1D8K A;  1KYW A;  2WWY A;  2M30 A;  2W84 A;  2NYX A;  4CGZ A;  3SXY A;  4TV7 A;  1T98 A;  3GZ5 A;  3KFW X;  4LB5 A;  1D5V A;  2LF8 A;  2RQP A;  2E7X A;  2P5L C;  3R4K A;  4O6J A;  2Z5U A;  3DQV C;  1CGP A;  2DI3 A;  4R1H A;  3RKY A;  1B1B A;  4RGR A;  4G7H F;  2VN2 A;  1RUN A;  1U6G A;  2RC4 A;  3F6V A;  3WGG A;  4G8X A;  2MD5 A;  1RZ4 A;  2HQR A;  2VOP A;  4KIG A;  3HOS A;  4BHP A;  3L09 A;  2ZNZ A;  3I53 A;  5JI6 A;  3F8F A;  3DXJ F;  4U7B A;  2ZCW A;  2GWR A;  4Y13 A;  5HOO A;  1LEB A;  2FBK A;  2XKO A;  4ESF A;  1F5T A;  5LGN A;  1IF1 A;  3SZP A;  2PMH A;  4B8X A;  1S7A A;  3WTY C;  3C1D A;  2V9V A;  1GXP A;  2QVO A;  2PN6 A;  2V6C A;  2HYG D;  3L00 A;  3RKX A;  1B59 A;  3RKW A;  2FOK A;  1Z7U A;  2MC3 A;  1HKT A;  3FXQ A;  1K7A A;  4NHJ A;  1XSD A;  1CF7 B;  4EJO A;  4KDP A;  4IRG A;  3BOQ A;  4U0Y A;  1MDM B;  2Z3Y A;  4A0Y A;  5ICF A;  3WTV C;  3F3X A;  3FXR A;  1XB4 A;  1H0M A;  2H94 A;  2IA1 A;  3GWZ A;  1MDM A;  2Y75 A;  1W5T A;  1QO0 D;  1U5T C;  4OIN F;  1HBX G;  2RDP A;  1NHA A;  5LHG A;  3LWF A;  2HR3 A;  2JRT A;  4HLY A;  4N9H A;  3WE2 A;  2L4A A;  3WG9 A;  1BI2 A;  1AOY A;  4IPA A;  4EGY A;  4XSX F;  1H9G A;  3PFI A;  4UVC A;  2OQG A;  3ECO A;  1R1U A;  4CYD A;  1G3Y A;  2ZFW A;  3JW4 A;  1R22 A;  4KT5 C;  4MEX F;  2EA2 A;  2NNY A;  3BJA A;  4OMZ A;  3K0L A;  2JT1 A;  1KA8 A;  2PMU A;  5FFX A;  4HX7 A;  4EJW A;  1PUE E;  2XAQ A;  4KMU X;  1Z1D A;  3H3Z A;  5DUK A;  2DT5 A;  5HVQ C;  4WF2 A;  1ZLJ A;  2DTR A;  3QP6 A;  1ZRE A;  3TQN A;  1P92 A;  4EM0 B;  2ACJ A;  1H9T A;  2KIM A;  4OIR F;  1KU3 A;  1KU9 A;  2XRO A;  1P4W A;  4UHT A;  4EM2 A;  2W57 A;  2IT0 A;  2XRN A;  4U0V A;  4QWQ A;  2F5E A;  3F8C A;  3K1N A;  1WRJ A;  5HDN A;  2QBY A;  5HDK A;  2KIF A;  4L9V A;  4CXF A;  1X3U A;  2ETH A;  1S7O A;  4EM1 A;  1XSV A;  1C0W A;  3FF5 A;  2WC2 A;  2YU3 A;  4HAM A;  1HW5 A;  1YS6 A;  2Q8K A;  3HRT A;  1OKR A;  1S6L A;  2V1X A;  4HF2 A;  4EVI A;  3KZZ A;  1SFE A;  1OMI A;  2D1V A;  4Q5S F;  5LBQ A;  4ESB A;  4I09 A;  1FX7 A;  3D0S A;  1WWX A;  3N4M A;  2P5V A;  3IKV A;  4GYG A;  2K27 A;  3RTR A;  5E8I A;  2DW4 A;  4AVP A;  3ABU A;  3T8R A;  1Z05 A;  4ENN A;  3KCC A;  3MQ0 A;  2QQ9 A;  2ADU A;  3TO6 A;  2Z9O A;  2P5K A;  2TDX A;  4GYI A;  5D4S A;  2NAZ A;  4EGZ A;  1J0R A;  1LB2 A;  3WTT C;  3KLO A;  2HQN A;  4YIF A;  4HLX A;  4O5V A;  4BHB A;  5E1Z B;  1WKM A;  1FP2 A;  2DK5 A;  1IN7 A;  2V79 A;  2CYY A;  4IJA A;  4BAY A;  1T0F A;  1FZP B;  3HYI A;  3KP3 A;  4KN7 X;  1KQ8 A;  1G3S A;  4KA4 A;  4RB1 A;  1ZG3 A;  3Q9V A;  1Q1H A;  4CZZ A;  4ON0 A;  4ENM A;  1FPQ A;  3M9A A;  3GX4 X;  2VC0 A;  2ZO4 A;  3HOT A;  2X0L A;  4E70 A;  3CO6 C;  1DPR A;  1U5T B;  1XCB A;  5HDG A;  5D6F A;  1KU2 A;  1S3J A;  4HQE A;  2MH2 A;  5L3D A;  3FHZ A;  1EV7 A;  5A2Q K;  4GO1 A;  1T38 A;  1HSJ A;  2BEO A;  5CVI A;  2PJP A;  3JAM K;  4KN4 X;  3MFK A;  3LST A;  2XVC A;  4IHS A;  2M5W A;  1UHM A;  2ZME B;  3IKT A;  3I0T A;  3R60 A;  1S8N A;  2ZME A;  1IUY A;  2EK5 A;  5BOX A;  4N0B A;  2FSW A;  5CJ9 A;  1KU7 A;  4A2U A;  4YFN F;  4OU0 A;  2OZU A;  5D5V B;  3GO5 A;  4M72 A;  1D3Y A;  1UFM A;  2EFP A;  2O3F A;  1OYI A;  5D4R A;  2MLK A;  1TLH B;  1P6R A;  2OU2 A;  4JK1 X;  1R7J A;  4HYE A;  2MLG A;  1FWZ A;  2E1C A;  4EMS A;  4RS8 A;  3LAP A;  1FSH A;  2DLL A;  1PP8 F;  4HZF A;  3REO A;  2OAZ A;  2KJC A;  5DV5 A;  5A2Q Z;  1SMY F;  1K6O A;  3ECH A;  4JQF A;  3JAM Z;  5DYM A;  2HTJ A;  4RGU A;  2QQB A;  3ISP A;  3O3K A;  3ZMD A;  1O3Q A;  5CLS A;  4EJV A;  1J75 A;  3BJO A;  2Q2E A;  1BBY A;  4R8H A;  4WXH A;  5IT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...