2TDXA

Diphtheria tox repressor (c102d mutant) complexed with nickel
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2tdxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2tdxA02
1R5GA 1T2KA 1VTNC 4HQEA 4LB5A 1R58A 1LEAA 5FO5A 2YX4A 3I59B 2K02A 1BC7C 3TDZC 2FNPA 1USTA 3RKYA 2BE5F 2KKOA 4A2UA 5EEGA 1WWXA 3R6SA 2VXZA 2K7LA 1DUXC 5D5UB 2XAJA 2BGCA 2WC2A 3TDUC 1S29A 2A3SA 1OPCA 2EFNA 2NS0A 5E1XA 2VE9A 3FX3A 3V7SA 1IN4A 1P4WA 1F5TA 5ERIA 3WTTC 4KDPA 4YG2F 1MJAA 2ZMEB 4OIOF 4OIQF 3KP4A 4MEYF 1FT9A 2IPQX 2P7CB 1KGSA 1XSVA 1ZG1A 3NQOA 4O6JA 3RYRA 2EV6A 5DCMB 1G4DA 3O2PE 3IWFA 5BS6A 4B8XA 2YX7A 3CO6C 2UXXA 2HEOA 2V1XA 4S04A 4MNUA 3VOEA 3RIRA 2ZNYA 5LGTA 3E6BA 4GXOA 3R0JA 1EV7A 1I27A 1OYYA 2HTJA 4D0PA 1YG2A 3IWZA 1XCVA 3GW2A 1ZG5A 3E6DA 4WK8F 4OMYA 3T8TA 1B59A 1K7AA 4A12A 1G3YA 4L9NA 3K0LA 2Z9OA 2A68F 3GO5A 2RC4A 2V6CA 4O3MA 4ENNA 2MA3A 2J5PA 3LAPA 1HW1A 3DQVC 2DLLA 3KE2A 5J8CA 2DK8A 1RUNA 1W4MA 2OAZA 1T38A 1DP7P 1JE8A 5HS8A 1ZARA 1FP2A 3BJAA 4HW0A 3T1BA 3IL2A 4IPAA 1D8JA 2P4WA 3AAFA 1W5TA 3I64A 5CVIA 5L3GA 4U7DA 1U8RA 2STTA 2DQLA 3MFKA 3KZZA 1R00A 1Z9CA 3HHHA 1WRJA 4BHCA 5LLQA 1LJ9A 3TOAA 4EQQA 1S8NA 2PMHA 4AIHA 1T98A 1KU9A 5KVRA 2H6BA 3TO6A 1B6AA 1FSHA 2CWEA 5AONA 4JK1X 3ZMTA 3FXQA 3R0AA 2FXAA 5LHGA 2MH9A 5D6FA 1MZBA 2CSOA 3I54A 4XSXF 1K78B 4LLLA 4CGZA 4JBAA 3BPXA 4KN7X 4ZYEA 1R1UA 1IN5A 5ILVA 5AIQA 5HLGA 1PP7U 2VOPA 2KIUA 5H6QA 4AVPA 2W85A 2CW0F 3LQQA 3FMRA 2VN2A 1FWZA 4L5IA 3WTYC 4IVNA 1V4RA 3J80K 1SD4A 5JVTA 1USSA 3BJ6A 3F8BA 2EFPA 2HYGD 2E1NA 2HZTA 2JPBA 1R5HA 5BQTA 1IXCA 4OU0A 4KIBA 1LDJA 2DTRA 1RI7A 4U0YA 4HF2A 3DPLC 2F2EA 3RKXA 2XKOA 5BMZA 3EUHA 3FXUA 4BHBA 3WG9A 1TW3A 1ODDA 2V1UA 3M7GA 1BI1A 4BH9A 2DT5A 1L3LA 3T0YA 4EGYA 3BDDA 2K4JA 5K5QA 2QWWA 2HQRA 1BIBA 2L02A 4K2EA 3U1DA 5DYMA 4LB6B 4LG0B 2G7HA 2QYOA 1ZAOA 1P92A 3ECHA 3CUQB 1HSTA 1OR7A 3DEUA 2XIGA 2JSCA 2RN7A 4ENJA 1L0OC 2RNJA 3V4GA 4U7BA 2IRFG 3L2CA 5CVVA 3FMQA 2W24A 4M73A 3E97A 3CLOA 5BPIA 2RVCA 1LDDA 1F9NA 1ZHFA 2EFQA 4M74A 5L3BA 1FP1D 5ICFA 2ZXJA 2QQAA 1ONVA 1PDNC 4Q5SF 3H92A 1SMTA 4PDKA 4A5NA 3DXJF 2IP2A 3PQJA 4ON0A 3PQKA 1ZH5A 2P8TA 2JTVA 4RGUA 2PI0A 3RPUA 1HKTA 2VBYA 1U5TC 3V7RA 3V8JA 3PFIA 1R1TA 3BP8A 1IAWA 3GXOA 4RB0A 4Q4ZF 4L0YB 5JHUA 3QP6A 1QZZA 4L9VA 4EJWA 4ESFA 2PFBA 3WE2A 1IRFA 3SFZA 1XMKA 3DF8A 1Z7UA 2ETHA 2VC0A 2MD5A 1T6SA 4YIFA 2D45A 1SMYF 1STZA 1BM9A 1LNWA 4HV5A 3K9TA 3WGGA 2CFXA 2PG4A 1Z05A 1R22A 4CZZA 3ZN1A 5ILUA 2WTEA 3OV8A 3SZPA 1QO0D 4RAYA 5FFZA 5E17F 2NNNA 3WE3A 2FBIA 2GXGA 5LEJA 2IVMA 4KN4X 3J80Z 4LG0A 4WXHA 2OZ6A 1LVAA 2NNYA 2KJCA 3E6MA 4U0VA 1C0WA 3BY6A 4NQWA 2OQGA 3BZ6A 5K5RA 2DPUA 3C1DA 3COAC 2MBFA 5D8KB 2PLYA 3MCZA 5CVRA 5HDGA 4PGGA 5IT3A 1KQ9A 4A0XA 2NRAC 4LGWA 1B9MA 3N97A 5DD4A 4OIPF 1MD0A 4EMSA 1I5ZA 3HOSA 2P5VA 3I5UA 3WU0A 3QAHA 3HRTA 2Z5UA 2E1CA 2V9VA 1WKMA 3E3VA 1LEBA 1GVJA 1MJ9A 1BI3A 2XAQA 2XUBA 3VFZA 4RAZA 3M8EA 3MEXA 2GAUA 2BV6A 2M8EA 2W57A 1HW2A 1SAXA 2KRFA 1TNTA 4H0EA 5E8IA 4KYWA 1RNLA 5F6FA 5L3FA 3REOA 3RDIA 3U9GA 2XKPA 2L4AA 4IRIA 5ILSA 1H9GA 4EGZA 3D0SA 1G3WA 1ZRDA 4UVBA 3SQNA 1UHMA 2QUFA 4BNCA 3KLOA 3ZP5A 1KYWA 2D1HA 2G7UA 4IJAA 1LDKB 1Y0UA 3HYIA 4XLPF 2L54A 3B73A 1QQIA 4B09A 1TBXA 1ON2A 2V79A 1TW2A 4FT8A 3G73A 4L18B 4IRHA 2Q0OA 2QBYA 3TOBA 2EA2A 2M5WA 3MWMA 2UZKA 3F8CA 3HTSB 1DPUA 1U78A 4ENKA 2JPCA 4OOIA 3HRSA 3LSTA 1IRGA 4Y13A 4ZYHA 3W6JB 3DPTA 2GA2A 4I0BA 3CJNA 3MAJA 4OMZA 2R7DA 4RB1A 1SFEA 4E70A 3KP5A 1FX7A 3J7AO 1REPC 1S3JA 4HDUA 3M8FA 2A61A 2JZYA 3R61A 3QPHA 3BJOA 2HFHA 4BHPA 2X4HA 3FXRA 5LGNA 4BAYA 1O3SA 1BBYA 2W25A 1YIOA 1YW9A 3FF5A 5JR3A 1MKMA 5FB2A 5EEHA 4I0AA 1KU3A 3TO7A 2M1BA 3BPVA 2F5CA 3ZMDA 4UXNA 2OD5A 2Z3YA 1KA8A 1FYLA 5HS7A 3JAMK 3EQLF 4XRFA 1SFUA 2CG4A 2DW4A 1J75A 2FA5A 3FWEA 3J81Z 1J59A 4QWQA 2FOKA 1MDMA 4ZZLA 2DPDA 5BOXA 1FY7A 1O57A 4HDVA 2P7VB 5L3EA 5DUIA 4WXDA 3RKWA 2IA2A 2EJRA 5LRSA 4KMFA 2ZCWA 2HGCA 1U6GA 2CGPA 1AOYA 4AWXB 3CDHA 1HSJA 5DCFA 1TQPA 1R1VA 4CHUA 4A5MA 2HOEA 4HOBA 4FX4A 3EYIA 4OINF 3ULQB 2XAFA 2VT2A 1U3EM 4EM2A 2VONA 3DFGA 2GIVA 5LHHA 3KETA 3I58A 2XHKA 4N0BA 3ZMZA 1J7KA 1TTYA 3GFJA 5DUKA 4A6DA 2XAGA 4Z2YA 4ZYDA 2X0LA 4HF0A 3V7CA 3E5QA 2R7FA 5FFXA 2YPRA 2KIFA 4TV7A 1D5VA 3M1EA 4LK1F 1XDUA 2LF7A 4HBLA 3ECOA 4ZYGA 1FPQA 2DI3A 1HBXG 4Q47A 5E20A 3C18A 2A6EF 4XLNF 1YO5C 1XGNA 2HKOA 3K1NA 5H6RA 2EV0A 1G3SA 4WCGA 3TKYA 4KNYA 5F1RA 2F5EA 3FMSA 1U5TB 4M9SA 4A0ZA 1FSEA 3WGIA 1O7FA 1P6RA 4KFCA 4I2OA 4LLNA 4UNOA 1XB4A 3HRMA 2YU3A 3F6VA 1GXPA 2G9WA 2A69F 5CYVA 3ZMVA 3WTSC 3KP7A 2FRHA 1CGPA 4LFUA 3WODF 4HA8A 4I7HA 5FGMA 3L09A 1YQAA 2O3FA 1IW7F 1W7PD 3JW4A 2YSRA 5DEQA 1UFMA 1A04A 5K1YA 5D4RA 5D5VB 5DD8A 1O7LA 1TNSA 3IRQA 5FLXK 1BC8C 2HQNA 2XASA 1QZYA 3O6BB 2E7XA 3B02A 2IA1A 5E1ZB 4G6QA 4M72A 3ZN0A 1XSXA 5LBQA 3E6CC 4MGRA 3IKTA 3R4KA 2STWA 1FBUA 1CF7A 1B4AA 3LAJA 3C7JA 2AS5F 2O0YA 3LA3A 2OZUA 3V8KA 4BYYA 1GHCA 2FNAA 3EYYA 3P9KA 3JAMZ 4FHTA 4GYIA 5LHIA 5E1WA 2GZWA 4A0YA 1BIAA 3I0TA 2FEZA 3RTRA 2EFOA 2M87A 1WQ2A 2O8XA 1RUOA 5HDNA 4M71A 3T8RA 3SHFA 1RZ4A 1SD6A 4JQFA 2GQQA 5ICGA 2O03A 4HX8A 4G7HF 3E5UA 1FYMA 1KQ8A 4HLYA 4CICA 3QRFF 2DQRA 3KFWX 1IUYA 1WSUA 1TQMA 3I71A 5HDKA 4G7ZF 4HYEA 1LQ1A 2JT1A 2RKHA 4EJVA 5FD5A 1OKRA 2FBHA 2COMA 4GCVA 1ZYRF 4OIRF 1V3FA 2EA4A 2P5KA 4KIFA 1U5TA 4ZH4F 2FQ3A 4HQMA 2VBXA 4CDGA 4PGHA 4WXCA 5FD6A 2JRTA 4NHJA 1QNTA 1YS6A 3VODA 4A6EA 5LRRA 2Y48A 4EM0B 4MHGA 1BOAA 1YW8A 1HKSA 1T39A 1IN7A 3F8NA 4UV8A 2L4MA 1B9NA 2DAOA 2PEXA 3HSEA 4I98B 2FF4A 2A07F 3ABTA 2QBYB 3U2RA 4KICA 1SFXA 2ELHA 2VBWA 2B0LA 2HKXA 5TRDA 1XCBA 2QENA 1Z6TA 1IN8A 3LWFA 3DP7A 1RIOH 1BN5A 2IW5A 2H09A 1J2XA 2P5LC 4I09A 3F3XA 4P55A 1I1GA 2MLGA 2ZO4A 3HIFA 3WGHA 4G94A 1JHFA 1HKQA 3NRVA 1ZRFA 3MZHA 4MQ9F 3KEQA 1ZLKA 4MQVA 3BOQA 1TLHB 2J5OA 4MEXF 2L01A 3LQRA 4YFXF 5JI6A 3P9CA 5CLSA 3QU3A 5DV5A 4HZFA 1EH8A 1UB9A 4M9ZA 3P7NA 2FE3A 3CO7C 2VOOA 4EV0A 4AD9A 5FLXZ 3N4MA 3WU1B 1MDMB 5ICCA 4RGRA 3KP6A 4LD5A 2UWMA 3GFLA 2GA1A 1OMIA 3RJPA 3BWGA 4XBFA 5IT9K 3RYPA 3T5XA 3K2ZA 2H6CA 2ZJ2A 4U0WA 4ESBA 4KT5C 4HX4A 2TDXA 1O3QA 1MJBA 3W6KB 1E2XA 3F6OA 2BEOA 4CO8A 2LKPA 3F8MA 1IXSB 2VE8A 3L00A 2CO5A 3IKVA 3FM3A 4L0ZB 5A2QK 3WTZA 2OA4A 1UCRA 3DV8A 2Q2EA 3CUOA 3ERED 1TQIA 2GXBA 2HR3A 3ABUA 2XGXA 2QZ8A 5JFRA 2MLKA 2LDUA 1FLIA 3FZVA 4UUVA 5ED4A 5D8LB 1ZREA 1KYZA 3ZPLA 3JTGA 4HF1A 1KQ0A 2OQRA 1MGTA 3CTAA 3NEUA 1H0MA 2R3SA 3EETA 4HLXA 4UVAA 2P6SA 1XMAA 2ZNZA 4PCQA 2FSWA 1SD7A 6PAXA 3BROA 2ISZA 3V8LA 3F22A 2EV5A 2LNBA 1UHWA 2MC3A 2NAZA 4ETSA 4EM1A 4IF4A 3WTWC 1F4KA 1PUEE 3DKWA 3KP2A 2H94A 3WTUC 1LB2A 4P5OA 4RGXA 5F64A 4RGSA 4M6XA 3C3WA 3JSOA 2XROA 1XGMA 1DPRA 4FX0A 5HS9A 1AWCA 1DDNA 4LJZF 1J9IA 1IXRC 3RI4A 1ZLJA 5E8GA 2YR2A 1T0FA 2GWRA 3HSFA 1B1BA 2DO7A 4HAMA 2WV0A 5DDGA 1IF1A 5D5WB 3D5LA 1NHAA 2FMYA 1OYIA 2LSOA 4O5VA 1H9TA 3GFMA 2QM3A 3Q5FA 4PZJA 1KU2A 2EFWA 1XDSA 2M30A 4EJUA 4R1HA 5HLIA 3MQ0A 3ML6A 4IRGA 1FC3A 2FU4A 2K86A 2Z33A 2XRNA 4HV6A 2O61A 5E18F 2Y0MA 5CJ9A 2MH2A 1CF7B 4LMYA 1G3TA 1PP8F 2KJBA 1EH7A 2A5YB 4WWCA 2HWVA 2LF8A 3I59A 2IT0A 4GGGA 3EDPA 1FNNA 2QLZA 2RQPA 1XGSA 4UHTA 1S7OA 3KP3A 2HTSA 3P9IA 4KIGA 2OU2A 5H20A 1JXSA 3QOPA 3H3UA 4N9HA 2PBIA 3QPTA 2ISYA 2O6GE 1HQCA 5IT9Z 4G6DA 5AIPA 4MTEA 2DK5A 4EVIA 3Q9SA 3LA2A 3JSPA 2PMUA 1YW7A 5D4SA 3E5XA 3GX4X 1S6LA 2ZMEA 4Q48A 4CXFA 3K1MA 2M45A 4M6YA 1F1ZA 5A2QZ 3GFIA 3L9FA 3FHZA 4BQAA 4S05A 5LGUA 5DCMA 5J6XA 3QU6A 3VEPA 3G3ZA 1HW5A 1YLFA 2D2WA 2XVCA 1XSDA 3KEOA 3I4PA 3LA7A 1FOKA 4DNCA 5L3CA 2QQBA 3I53A 1XN7A 4RB3C 3ZMUA 2ACJA 1JGSA 2DBBA 4ESJA 2ZKZA 2EB7A 5L3DA 3K69A 3M9AA 4F7ZA 4I02A 2ESNA 2EWNA 4L9TA 3OOPA 4ZZDA 1BJAA 4WF2A 2ZFWA 5TJJA 3F23A 2E7WA 1FBSA 2XAHA 5CVUA 1ON1A 4R8HA 1J0RA 1W5SA 2DFIA 2RDPA 1IN6A 1R23A 2HYFA 3IHUA 1FZPB 2HDCA 3ELKA 4IHSA 3SXYA 1P2FA 1W7PB 1FBQA 3ROUA 1KU7A 1Z6RA 4AIKA 1P4XA 1E17A 2PJPA 1J5YA 1JHHA 2H27A 3HHGA 3L7WA 2QQ9A 3KCCA 1YTYA 4BXUA 2UXNA 2RGVA 4R79A 2KIMA 4P9UA 4EJOA 2C6YA 2F5DA 2IA0A 5HVQC 2CQKA 4LLGF 1HXDA 2F5FA 4RB2C 1O3TA 1S7AA 3GWZA 3ZMSA 2BBYA 2ADUA 4YIIA 2NYXA 2D1VA 1Z91A 3GLXA 2AXLA 4U88A 4G9YA 5K5OA 4GO1A 1ZRCA 1D8KA 1R36A 4HX7A 1QPMA 2VBZA 3ISPA 1ZGAA 3GEZA 2Q8KA 1YFHA 1K79A 2EK5A 1XGOA 1K78A 3GF2A 1FYKA 4YFNF 1EH6A 4UV9A 4RS8A 1SD5A 3IRRA 3RPQA 2V1DA 3F72A 3KZYA 2A6HF 4QLCU 3TQNA 2WWYA 4IHTA 3GVAA 4KUMA 5LEKA 3KLNA 3HOTA 4G7OF 3TO9A 1QBJA 3MZYA 1GXQA 2ZBKA 3FM5A 3H3ZA 2PN6A 4DQ2A 1BI2A 2RV8A 3GZ5A 3GUDA 3O3KA 1P4AA 1YYVA 2VT3A 3SZTA 5CVJA 3VB2A 1ZG3A 4L9JA 1BI0A 3HTUA 2K4BA 4Y17A 1K6OA 2VC1A 2P6TA 4MTDA 3R60A 4YFKF 4M9XA 1WI9A 1I6XA 1X3UA 4KA4A 3F8FA 3TGNA 4CYDA 4I01A 4UVCA 3WTXC 1U2WA 4P96A 2CYYA 4ENMA 1Q1HA 1G6NA 5HOOA 1YS7A 2HS5A 1OYWA 4NB5A 2L3DA 1QGPA 2FBKA 3S2WA 3J81K 2PQ8A 5J8FA 4Y15A 3IC7A 4WX9A 1ULYA 5D6EA 1O3RA 1D3YA 3CUQC 3ZQ7A 2Y75A 4P9FA 2DU9A 1XD7A 5BPDA 1IZ1A 1W7PA 4G8XA 5D5XB 3Q9VA 2Z99A 3GZ6A 3CUQA 3JTHA 2W84A 1Z1DA 3F21A 3HRUA 4GYGA 2XV4S 4L5JA 1I1SA 5KK1A 3K1PA 2K27A 1ZN2A 1ZGJA 1R7JA 3WTVC 2ESHA 2VODA 4XSZF 2IJLA 5HLHA 5ICEA 4IXAA 3QP5A 3HSRA 4KMUX 2BYVE 4LK0F 2QVOA 4EJTA 3GYHX 3LFKA 4ASNA 3HUGA 4AIJA 2FMLA 2OBPA 4N9IA
chains in the Genus database with same CATH superfamily
1R5GA 1X2NA 1T2KA 1VTNC 1SVOA 4HQEA 1BJZA 3HOXJ 4P1WA 4N4NB 4LB5A 1R58A 1LEAA 2CV2A 5FO5A 2YX4A 3CCLI 5J3LA 2LYCA 4C2MJ 3I59B 2DMPA 5FJ8J 2K02A 2FUG2 1BC7C 3BTCA 3TDZC 2DCEA 4XORA 1WJDA 5F1JA 4B3AA 2FNPA 1USTA 3RKYA 2BE5F 2HXOA 2KKOA 2V6EA 4A2UA 5EEGA 4MLOA 4DGWB 2HPMA 2M0CA 4IX7A 3I55I 1WWXA 2TCTA 2VJJA 2R5YB 4ZDLA 1LVKA 3AG1H 3OYDA 3R6SA 3ERMA 2VXZA 1FIPA 3HOZJ 2IS4A 2K7LA 3PIPF 4Y52J 1DUXC 3DWLE 3IH4A 5D5UB 2XAJA 4FE4A 2BGCA 1Z3XA 2WC2A 3TP3A 2X1CA 2R7ZJ 3J81R 3TDUC 1D0XA 1S29A 2A3SA 1OPCA 2EFNA 2NS0A 5E1XA 2VE9A 1UG2A 2BY1A 3FX3A 1TWGJ 3L2QA 3HM5A 2EIMH 4M3EA 2AQEA 3V7SA 4CZCA 1I50J 2GOMA 1IN4A 1P4WA 4XLEA 1F5TA 1V55H 4FASD 5ERIA 3WTTC 4KDPA 4YG2F 4C3HJ 1MJAA 2ZMEB 2R5ZB 4OIOF 1ZTRA 4OIQF 3KP4A 4MEYF 4NDLA 1FT9A 5HNFA 2IPQX 3HPGA 2P7CB 3GTMJ 1KGSA 1XSVA 3DLLF 1ZG1A 4HNTA 1EKEA 3NQOA 4O6JA 3RYRA 1HLVA 2VPRA 2EV6A 2M0MA 5DCMB 1G4DA 3O2PE 3ZOBA 3BR3A 3IWFA 5DM6F 2JK3A 1MNEA 5TGTA 2L9NA 5BS6A 4B8XA 1T95A 2KHMA 2YX7A 3SYTA 3CO6C 2E5NA 2UXXA 2HEOA 4RLQA 2ZXIA 3G2BA 2V1XA 4X6AJ 4S04A 3HB9A 4MNUA 2P0WA 3L1PA 4PUSA 2VIXA 3VOEA 1OCRH 4E4HA 3RIRA 2VPLA 2ZNYA 2LVSA 3E6BA 1BOBA 5LGTA 4GXOA 3R0JA 3RZDJ 1EV7A 4AYBA 2HOTA 1I27A 1OYYA 2DYSH 5KAIC 2E1OA 2HTJA 4D0PA 1QPIA 1YG2A 3IWZA 4JX5A 1XCVA 1PJRA 4ZTJA 2VKEA 3FK7A 1U9NA 4BE0A 3GW2A 1ZG5A 3J7ZI 3E6DA 5GAEJ 5E3OA 2EIJH 4NC8A 4WK8F 3FXKA 4OMYA 3T8TA 1B59A 4LIVA 1K7AA 4A12A 3CCQI 2YU9J 1G3YA 4L9NA 3K0LA 2MUNA 2NS7A 1G59A 1D1CA 4II3A 1GT0C 1B72B 2Z9OA 3FBIB 4XLFA 2A68F 3GO5A 2RC4A 1A5JA 2V6CA 4A3IJ 3MKYB 4O3MA 2R0QC 5GPAA 4ENNA 2BY3A 3U1KA 4B47A 2YUSA 1TL8A 2MA3A 2J5PA 2RQQA 4BQQA 2K9NA 3BZKA 3LAPA 3OYGA 3A0BC 1HW1A 2IGNA 3DQVC 4C2UA 2JQ7A 2DLLA 2DN0A 3KE2A 5J8CA 2QQ8A 2DK8A 5EGOB 1WHUA 1W4MA 1RUNA 2OAZA 3Q0UA 3D1NI 1T38A 2L0KA 1DP7P 2LKSA 2JA5J 1JE8A 5HS8A 1ZARA 4N4OB 1FP2A 3QWLA 3BJAA 4HW0A 2IXSA 1QHHD 3T1BA 3IL2A 4IPAA 3DTIA 4CCLA 1D8JA 2P4WA 2QSGX 3AAFA 3DLAA 1VQPI 1W5TA 3I64A 5CVIA 2NS8A 5L3GA 1Y39A 4U7DA 1U8RA 4XONA 3VSLA 4BDZA 1UAAA 3OR2C 3MMYB 2Z16A 5KAFC 2Y0SA 1GVDA 2K40A 4AYBN 3PL8A 3GZNB 2STTA 2L7ZA 2DQLA 3MFKA 2XPUA 3TMOA 2KZVA 3KPHA 3KZZA 1R00A 1Z9CA 3HHHA 2R5YA 2KDZA 1RC9A 1WRJA 4BHCA 2DOEA 1K4TA 5LLQA 1LJ9A 2MSYA 3CC2I 3TOAA 4EQQA 3LSGA 1S8NA 1I3AA 3W2WA 5GAGJ 2X98A 2PMHA 4AIHA 2BY0A 3H35A 1T98A 1KU9A 2WY7Q 5KVRA 3K7AJ 4M3FA 1VQNI 4A3MJ 1X1PA 2H6BA 3LSMA 3TO6A 2VXDA 1WJFA 1B6AA 1RETA 1FSHA 2CWEA 5AONA 4JK1X 3ZMTA 3FXQA 2MC4A 3R0AA 3HL2A 4UB6C 2FXAA 5LHGA 2MH9A 5D6FA 5J4YA 1MZBA 2CSOA 2I10A 2R5ZA 3I54A 2VKDA 4XSXF 3MZ8A 1K78B 4II2A 4LLLA 4MIMA 1TP4A 4GDFA 4CGZA 4JBAA 2X51A 1UZCA 3BPXA 4W97A 1R5ID 4KN7X 4ZYEA 3HOVJ 1R1UA 3SFIA 1WJAA 3L2RA 2JSPA 1IN5A 2WB1A 5HODA 2E34A 1Z67A 3JRFA 5ILVA 5AIQA 3HOYJ 5HLGA 1PP7U 2VOPA 2KIUA 2A6TA 5H6QA 2BW3A 1MMDA 1JJ8C 4AVPA 2W85A 2CW0F 3LQQA 4X1EA 1AHDP 3HOWJ 3FMRA 2E5ZA 2B9SA 5F0CA 2VN2A 1FWZA 4L5IA 2L9RA 3WTYC 1HDPA 2EZIA 3K4LA 4IVNA 3I4MJ 1V4RA 3J80K 2CFOA 1SD4A 5JVTA 5IP6A 1USSA 3BJ6A 3F8BA 4BU2A 2EFPA 2HYGD 1V54H 2E1NA 2HZTA 5KNLA 2ZB9A 2JPBA 1R5HA 2E60A 3A0HC 4BY1J 5BQTA 1IXCA 4OU0A 3LSRA 4KIBA 4LG3A 2ME0A 1LFUP 1IUFA 2W7NA 3EUHC 1LDJA 2EBIA 3HPHA 2DTRA 1RI7A 3DBRB 4U0YA 4HF2A 2OCEA 1B72A 3C2HA 2CQQA 2F2EA 3DPLC 4IQJA 1YE9A 3RKXA 2XKOA 3H5AA 5BMZA 3HKZN 5E3NA 3EUHA 3FXUA 4BHBA 3WG9A 4XKVA 1P9QC 3A1YA 3OR1C 1R6RA 2M7AA 1TW3A 2F4MB 1ODDA 2L7KA 4XIDA 2V1UA 3M7GA 3WU2C 2ECCA 5J47A 1BI1A 1JTYA 1HA8A 4BH9A 2DT5A 1L3LA 3T0YA 2WB1N 4EGYA 3BDDA 2K4JA 1A6QA 5K5QA 2QWWA 2HQRA 2XB0X 1BIBA 2JUGA 2L02A 4K2EA 1QHGA 1RRJA 1GUUA 2H1KA 3I9V2 1WJCA 3U1DA 2L7FP 3LSIA 5DYMA 2MZ4A 4LB6B 2K9SA 3GCMA 4LG0B 2G7HA 2QYOA 1ZAOA 5CQGA 1P92A 1HF0A 4BXFA 3JCUC 4OWRB 2GM4A 3KIOA 3CLQA 3ECHA 3ABKH 3CUQB 2MVTA 2HVRA 1HSTA 1OR7A 1Y1VJ 3DEUA 2XIGA 4NQWB 2VJ5A 1S9HA 2OUMA 1D0ZA 2JSCA 2QEXI 1JJ6C 2RN7A 4D5CA 4ENJA 1L0OC 3PIOF 1FMWA 2RNJA 1DP3A 1RPWA 1SVMA 4XMYA 3V4GA 2HDDA 4B4CA 2QCOA 1WVRA 4U7BA 1K61A 2DDAA 2IRFG 3L2CA 4HNVA 1FTZA 5CVVA 3FMQA 2W24A 2KT0A 1IGNA 3QYEA 2CV0A 2DOFA 2XC7A 4M73A 3E97A 3OSGA 1PVEA 3CLOA 2K3PA 5BPIA 2RVCA 1LDDA 3O8HA 4D1QA 1LFPA 1P7IA 1F9NA 3CMAI 4RA2A 3CMMA 1ZHFA 2EFQA 2PJRB 2HU9A 3SEZA 3H1CA 4M74A 5L3BA 1FP1D 3FDYA 5ICFA 1ZQ3P 2NXNB 2WAFA 4M3DA 2ZXJA 2QQAA 5F27A 1ONVA 2KFDA 1PDNC 3CJTB 1NG6A 4Q5SF 2V1NA 3HUGB 4A3DJ 3H92A 1QVUA 1SMTA 3BCAA 5GAHJ 2OC6A 2FOWA 4PDKA 2BXYA 4A5NA 2HQ5A 3CMYA 3J80R 1D0YA 4XICA 3DXJF 4Y3OA 1JUSA 2E1MC 2IP2A 1ERDA 3PQJA 4ON0A 3PQKA 3E7LA 1ZH5A 2IS2A 2P8TA 2F5VA 5GTHC 3S17J 1ETWA 2EIKH 3DPUA 2ID6A 2JTVA 4RGUA 2PI0A 3RPUA 1FIAA 1HKTA 2VBYA 1MMNA 1U5TC 3BTLA 3V7RA 2XF7A 3V8JA 2NOGA 3PFIA 1JI8A 4B3XA 2HNHA 1R1TA 3BP8A 4IQ4A 3GXOA 4XR6A 3JRAA 1IAWA 4ZDOA 1FEXA 2OJED 4RB0A 3J7AW 3CCSI 3HGGA 4Q4ZF 3JRDA 2NVXJ 3ZXSA 2X85A 5IY5H 2XAUA 2EILH 2CW7A 5J1YA 4L0YB 3GMEA 5JHUA 1VQ6I 1S7EA 3QP6A 4XN3A 1QZZA 1IV6A 4L9VA 4EJWA 4YRVA 3K10A 1JGGA 4ESFA 4FE7A 4CCJA 3W3CA 1HOMA 2PFBA 1UMQA 1RKWA 1R4NB 3WE2A 1IRFA 1A36A 3SFZA 1XMKA 3DF8A 2IGOA 4QPQA 1Z7UA 4F52A 2ETHA 2VC0A 1VQKI 3S1NJ 3ASNH 2MD5A 1T6SA 4YIFA 4KT6A 5F08A 1ZK8A 2D45A 1SMYF 1STZA 1RR7A 2O9LA 1BM9A 1LNWA 4HV5A 3K9TA 3WGGA 2CFXA 2M9HA 4A93J 2PG4A 1Z05A 2O5RA 1V5FA 4I76A 3N05A 2WV1A 1R22A 2XF6A 4CZZA 2ZFUA 2KISA 3ZN1A 5ILUA 3IH3A 2WTEA 3OV8A 2ICWG 3SZPA 5DTDA 1R4MB 4A3KJ 5FRNA 1QO0D 4RAYA 5FFZA 5B1BH 5E17F 1OISA 2NNNA 3MKLA 3WE3A 2FBIA 3BG9A 3NWSA 2GXGA 5LEJA 2DA5A 2IVMA 3LFUA 4KN4X 4D5FA 3J80Z 4LG0A 4WXHA 1YJWI 2OZ6A 2OTLI 1LVAA 2NNYA 2KJCA 4XNFA 3E6MA 3KEYA 3CCMI 1X2MA 4U0VA 3ABMH 1C0WA 3BY6A 4NQWA 1VI0A 2OQGA 3BZ6A 3A52A 1I39A 1EF4A 2VKHA 5K5RA 4AU7A 2DPUA 4BE2A 3K4JA 2CMPA 2XDVA 3C1DA 4IKFA 3COAC 2MBFA 5D8KB 2PLYA 3MCZA 2DFHA 2ECBA 5CVRA 3W6VA 5HDGA 1F36A 4PGGA 4DBRA 5IT3A 3OYLA 5LFAA 1KQ9A 3SDGA 4A0XA 2NRAC 4LGWA 1B9MA 2BVMA 3IAS2 3N97A 5DD4A 1HDDC 4D7MA 4OIPF 1MD0A 2DYRH 1I5ZA 4EMSA 3HOSA 2P5VA 3I5UA 5B3SH 2PJRA 3WU0A 2Y69H 3QAHA 3HRTA 2Z5UA 4XN0A 4E7ZA 2E1CA 2V9VA 1WKMA 2UUZA 3E3VA 1LEBA 5CKTA 3BR0A 4ANJA 1NG7A 1GVJA 1MJ9A 4BKXA 1BI3A 4E7SA 2H8RA 4DOZA 3ZRGA 4C3JJ 1IO2A 2HXIA 2XAQA 2FX0A 2DODA 1X1DA 2XUBA 2XPVA 2QSHX 3VFZA 4RAZA 4HSTA 1JT6A 3M8EA 1YRNB 4CSWA 3MEXA 3MD2A 4CH7A 2GAUA 2BV6A 2M8EA 2K3FA 3S3MA 2HZDA 2DMQA 2W57A 1HW2A 1SAXA 1S5LC 2KRFA 3CCEI 2Y9YA 1TNTA 4H0EA 4XOTA 4ABZA 5GADJ 5E8IA 2CV1A 4KYWA 1NK2P 1RNLA 5F6FA 5L3FA 3OWTA 3REOA 4J01A 5DM7F 3RDIA 3U9GA 2XKPA 3QQAA 2L4AA 4IRIA 5ILSA 1H9GA 3FIWA 4EGZA 2NVTJ 4CA0A 4GFBA 2DMNA 3D0SA 3ZQGA 1G3WA 4QSHA 1ZRDA 4UVBA 3SQNA 1UHMA 2QUFA 2R7TA 3GLLA 3CCVI 3KLOA 4BNCA 4OAZA 4J19A 4LIUA 2VASA 1VQ8I 4B44A 3ZP5A 4HEA2 4AC0A 1KYWA 2D1HA 2G7UA 4IJAA 2GBYA 1LDKB 1Y0UA 3HYIA 3K4BA 2R7RA 3S1RJ 4XLPF 3RZOJ 1Q1VA 2L54A 4PJJA 1WJEA 2IBDA 5E3MA 3B73A 3ZCOA 1T08B 1QQIA 4ZDPA 1I3QJ 2Y31A 2CH0A 3CP8A 4NUBA 1GV5A 4B09A 2IS1A 4BJTA 1Z3YA 1TBXA 1ON2A 2LMDA 1OCPA 3GTOJ 3AG2H 2CRGA 2V79A 1TW2A 2W48A 5J1RA 2ZJRF 2JWTA 4FT8A 5CQEA 3G73A 3IUOA 3BLYA 4L18B 5EF6A 4IRHA 2Q0OA 2QBYA 2VJ4A 2Y2ZA 2CUEA 3TOBA 2WBMA 2EA2A 2M5WA 1ZKGA 4A3EJ 3MWMA 3DKYA 2UZKA 3F8CA 2ID3A 1MSFC 5FROA 1M1EB 3HTSB 1DPUA 1U78A 4ENKA 2KDOA 2JPCA 3CJQB 4OOIA 3HRSA 1FJLA 3IV5A 3LSTA 1IRGA 4Y13A 4ZYHA 2HVQA 4XL9A 3W6JB 4F92B 3DPTA 2BW3B 2M2EA 2GA2A 4I0BA 3S1QJ 3VYUB 1I6HJ 3CJNA 1BR1A 3MAJA 4OMZA 2R7DA 4RB1A 1SFEA 3LSPA 3K70D 4E70A 3KP5A 1FX7A 2W82A 3J7AO 1REPC 3H5RA 2X6YA 3S3OA 1S3JA 5C44J 2KL4A 5GP9A 4HDUA 3M8FA 3JRGA 1W1WE 2A61A 2JZYA 3R61A 3QPHA 2VLAA 2K5CA 1SC7A 3AL0C 3BJOA 4XLCA 2HFHA 4BHPA 2X4HA 3FXRA 1T0FC 5LGNA 2RREA 3G6EI 2KRCA 2XB5A 4BAYA 1O3SA 3BR5A 4RBOA 1BBYA 4F93B 2W25A 1YIOA 2DFFA 1YW9A 3FF5A 5JR3A 1VQ7I 1MKMA 9ANTA 2CUJA 5FB2A 3B6CA 4I0AA 5EEHA 1KU3A 3IP4B 3TO7A 3JRIA 2R7UA 2M1BA 2LK2A 3BPVA 5CPRB 3KYCB 2F5CA 3ZMDA 4UXNA 2OD5A 2A05A 2Z3YA 1KA8A 4RM3A 1FYLA 5HS7A 3OYJA 2M8GX 3JAMK 3EQLF 3OS0A 4CCKA 4XRFA 2L9VA 1SFUA 2CG4A 4S0HB 2LLKA 2LP0A 1TT5B 2DW4A 1J75A 4A3GJ 2FA5A 3FWEA 3J81Z 1J59A 4QWQA 2FJ1A 2FOKA 1X1CA 1MDMA 4ZZLA 4BXXJ 2DPDA 5BOXA 3J7YJ 1FY7A 4MFEA 1O57A 4HDVA 2P7VB 5L3EA 5DUIA 4BE1A 4XK4A 4WXDA 1YRNA 3RKWA 2VKVA 2IA2A 3LSHA 3CP2A 4ZTFA 1MNDA 2EJRA 5LRSA 1ZR4A 4IHWA 3EPZA 4BEHB 2QA4I 4KMFA 2ZCWA 2X6XA 2HGCA 2QKMB 1U6GA 2CGPA 1AOYA 4AWXB 4XKBA 3CDHA 4W1UA 4BDYA 2V9KA 4IHXA 2DDBA 1HSJA 4PSWA 5DCFA 1TQPA 1R1VA 4CHUA 2DMTA 2BVLA 5FKMA 2WADA 4A5MA 2R93J 2HOEA 4HOBA 4FX4A 4Y7NJ 1IG7A 1D5YA 3EYIA 5HLTA 3ZQQA 4OINF 1PUFA 3ULQB 2GLOA 2XAFA 2VT2A 1U3EM 2JA8J 3U21A 4EM2A 2VONA 1MMSA 3OYAA 1JKOC 3DFGA 2GIVA 5LHHA 3KETA 3I58A 2XHKA 1HC8A 1XPXA 4N0BA 3ZMZA 3CC4I 4FCYA 5EYRA 3H3VK 1J7KA 1TTYA 3GFJA 2K9QA 5DUKA 2DXIA 4A6DA 2XAGA 2LOOA 4Z2YA 3MN2A 4ZYDA 3MKZA 1MBHA 2X1EA 3OOUA 2W4SA 2X0LA 4HF0A 3V7CA 3E5QA 2R7FA 1OLTA 1AKHB 1E3PA 2XRLA 2KIFA 2YPRA 5FFXA 1IDZA 4BBSJ 4TV7A 1D5VA 3M1EA 4LK1F 1XDUA 2LF7A 4HBLA 3HKZA 4JX6A 3ECOA 3H0DA 2LY9A 4ZYGA 1FPQA 2X48A 3M4OJ 2HYJA 2ZJQF 2DI3A 1HBXG 3FXJA 4Q47A 1B8IB 2MGQA 3DBHB 5E20A 2ZMEC 5IOYA 2DA1A 3K4MA 1N78A 3K2AA 1OCOH 4J00A 1RR8C 3VWBA 3C18A 2A6EF 4XLNF 1YO5C 1XGNA 2LC2A 2YS9A 2WAEA 1FOYA 2HKOA 3K1NA 5H6RA 2E1MB 2EV0A 2JJ7A 3OYIA 4PFPA 4AIDA 1G3SA 2E36A 4WCGA 3OS2A 2LH9A 3VPRA 3WG7H 3TKYA 4KNYA 3OYCA 5F1RA 1KZHA 2OPTA 2F5EA 3FMSA 2RAEA 3PO3J 1U5TB 4BY7J 3JAMR 2HQAA 1MH3A 5KHDA 2PMZN 2VUMJ 4M9SA 4A0ZA 1FSEA 3WGIA 1O7FA 1P6RA 4XRMA 4KFCA 4I2OA 1DGWY 4LLNA 2JA2A 4UNOA 1XB4A 3HRMA 3B6AA 1W5CC 1JT0A 4JX4A 2YU3A 2AO9A 1Z21A 3F6VA 1GXPA 2G9WA 2A69F 5CYVA 3BG3A 3PNTA 5J4VA 2IAIA 2G0EA 3ZMVA 3WTSC 3KP7A 2FRHA 2Z1DA 1CGPA 3QODA 3CJRB 3QPSA 3QYBA 4UY8I 4LFUA 3WODF 4HA8A 1WFXA 3DTEA 3G71I 4I7HA 2KZGA 5FGMA 3L09A 5JHFA 3DEWA 2OTJI 1YQAA 2O3FA 1IW7F 2CQ7A 1W7PD 1W0TA 3JW4A 3K70C 3H0GJ 2BY2A 3FHNA 1AU7A 2YSRA 5DEQA 1UFMA 3ZQCA 1A04A 5K1YA 2KIQA 2WAQA 4Z6YA 2E2HJ 3WHCA 1TWHJ 1DU0A 5D4RA 3S14J 1N75A 5D5VB 1ETVA 5DD8A 1O7LA 1TNSA 3Q0VA 3IRQA 5FLXK 5IP9J 1FMVA 2P81A 1BC8C 4B43A 4YEJA 2DJIA 2HQNA 1TWFJ 2XASA 5EDNA 2X6OA 1ETYA 1QZYA 3O6BB 4BEHA 2E7XA 2ZXWH 3B02A 2IA1A 3A03A 5E1ZB 4G6QA 4M72A 3ZN0A 3NAUA 5EZGA 2W1OA 2I8DA 1XSXA 5LBQA 3E6CC 4MGRA 3IKTA 3R4KA 4RM2A 4RLFA 2VJIA 2STWA 4IL6C 1FBUA 3AG3H 4EATA 5H2FC 1JUPA 5JLXA 1WGXA 2H8WA 1IJWC 3E0JB 1SAUA 3CCYA 1T8IA 2F4OB 1CF7A 1YIJI 1D1AA 1BR4A 3S2DJ 2E35A 4LITA 5M5XJ 1V5GA 2JVGA 3BQYA 3QPLA 1B4AA 3LAJA 3LSKA 3C7JA 2XSJC 3KZIC 2AS5F 1E0EA 2O0YA 3LA3A 4C2TA 3AFHA 1Y0NA 2OZUA 3V8KA 3W2VA 4BYYA 1GHCA 1NH3A 4CCMA 2FNAA 1RQ6A 3EYYA 3P9KA 3JAMZ 4FHTA 3D5RC 4GYIA 5E1WA 5LHIA 2ELJA 2CS3A 2GZWA 2EZLA 2EZHA 1YITI 4A0YA 4CCNA 4C30A 5IYCJ 1BIAA 3JRHA 1QA6A 3I0TA 2FEZA 3RTRA 2EZKA 4KISA 2EFOA 3BG5A 3VYTB 2M35A 4V2GA 1MBKA 2DA2A 2ELKA 2K9MA 2ZJPF 2M87A 2EPFA 1WQ2A 2O8XA 1H8AC 1AKHA 3Q0WA 3VDXA 1RUOA 2WAQN 5HDNA 4M71A 3T8RA 2K85A 3SHFA 1RZ4A 3J7AY 1SD6A 4JQFA 1TZLA 2GQQA 5ICGA 2ZSHB 2O03A 4HX8A 4G7HF 2N8GA 3E5UA 1FYMA 1B8IA 1KQ8A 3PSFA 4HLYA 1VF9A 4CICA 2LBFA 1MW7A 1YX3A 3QRFF 2DQRA 3KFWX 1IUYA 2CQNA 3DTKA 1WSUA 1TQMA 4NC6A 3I71A 5HDKA 4G7ZF 4HYEA 3HG9A 1LQ1A 2JT1A 2M7BA 2RKHA 2BOLA 2F6CA 4EJVA 5FD5A 3OMYA 2ZXHA 2WY8Q 1OKRA 2B7EA 2COMA 2FBHA 2MD0A 3MVPA 2P0TA 4LOCA 2R7XA 4GCVA 1VZ0A 3FKIJ 5IYDJ 5K7ZA 1ZYRF 4OIRF 1V3FA 2EA4A 2P5KA 4KIFA 1U5TA 3RCOA 3BG6A 2FQ3A 3LOCA 4HQMA 4ZH4F 4IO9F 1OCCH 2VBXA 4CDGA 2JMWA 4PGHA 1IDYA 4WXCA 5FD6A 2I5UA 3OIPA 2JRTA 3TW6A 1A31A 4NHJA 2L9SA 4KJZA 3OS1A 1QNTA 1YS6A 3BR6A 3VODA 3GTPJ 2XGEA 4A6EA 2MFZA 2MW8A 5FLXR 1FOWA 5LRRA 4ZJZA 2R4GA 2Y48A 4EM0B 4MHGA 1BOAA 1YW8A 2KP6A 1HKSA 2DOAA 1T39A 5F04A 4BJ6C 3L2WA 1IN7A 1X58A 4MFDA 1VQOI 2F4IA 3ZR8X 2XSDC 5FRMA 3F8NA 2K9LA 4UV8A 2L4MA 3P5JA 1B9NA 2DAOA 2PEXA 3HSEA 1YJNI 4I98B 3I4NJ 2FF4A 1XC5A 2A07F 3ABTA 2QBYB 1IRZA 2LY1A 3U2RA 4KICA 5DS9A 3ONQA 1SFXA 1ITYA 2ELHA 2VBWA 2B0LA 3X2QH 2HKXA 5TRDA 1XCBA 3JR9A 3HBLA 2QENA 2JVHA 1Z6TA 3PNYA 3NARA 1IN8A 2DT7B 3LWFA 4PK4A 3DP7A 3PJRA 2PX9A 1RIOH 1BN5A 1ENHA 2V7FA 1KONA 1VNDA 2FQ4A 5EEAA 2KLOA 2IW5A 2VQCA 1FTTA 3S15J 4I6ZA 2H09A 1UHSA 3DBLB 3PFYA 1J2XA 1VQ9I 4RMNA 2P5LC 1BW6A 4I09A 3F3XA 4P55A 1I1GA 3V42A 1LE8B 2MLGA 1QVTA 1BW5A 4XKWA 4A3BJ 2ZO4A 3HIFA 1R9TJ 3GTKJ 3S93A 4G94A 3WGHA 3HOUJ 1JHFA 1HKQA 3NRVA 1S72I 3BTJA 1ETOA 2QGUA 1YI2I 1ZRFA 5F0HA 3MZHA 2HPIA 4MQ9F 2EQRA 3AL0B 1G2HA 3A2KA 3KEQA 1IC8A 1NTCA 1ZLKA 4MQVA 3OYBA 3BOQA 2QSFX 1TLHB 2J5OA 4MEXF 4FQGA 2L01A 3LQRA 4YFXF 4D9JA 5JI6A 2R7VA 3P9CA 5CLSA 5FLMJ 3CCJI 3QU3A 5DV5A 4HZFA 1EH8A 4C3IJ 1UB9A 5IOZA 2GOXB 4M9ZA 3P7NA 5J40A 2FE3A 3RKQA 4BBRJ 3CO7C 2VOOA 4EV0A 4NC7A 1R49A 4AD9A 5FLXZ 3N4MA 3WU1B 2LTPA 4B48A 1MDMB 4BUPA 5ICCA 4RGRA 3KP6A 3TBIA 4LD5A 2HVSA 2UWMA 2HDWA 2GA1A 3GFLA 1OMIA 3RJPA 3BWGA 4XBFA 5IT9K 3RYPA 3T5XA 3K2ZA 2H6CA 2ZJ2A 4U0WA 1UG0A 4ESBA 1VFCA 4KT5C 4HX4A 3A01B 1W0UA 2KRHA 2TDXA 1SFKA 1O3QA 3VSKA 1MJBA 3W6KB 1X1BA 1E2XA 3CF2A 3FXOA 3F6OA 2BEOA 1MNMC 4CO8A 3GTLJ 4C9YA 2DA7A 2LKPA 5J1UA 3ZQFA 3KYLA 3F8MA 1IXSB 2IS6A 2DA6A 2VE8A 3L00A 2CO5A 3IKVA 3FM3A 3S16J 5M3MJ 2JA7J 4L0ZB 5A2QK 3I56I 1H89C 1OFCX 3WTZA 3TEDA 1SEUA 2OA4A 1UCRA 3S8PA 2M4KA 2VQHA 3VYSB 3DV8A 4BL0B 3CDIA 2HI3A 1PUFB 2Q2EA 1Y6IA 3CUOA 5E79C 4NNJA 1T56A 3ZQHA 1YJ9I 3BR1A 3ERED 1TQIA 2EH3A 2GXBA 4V2FA 2HR3A 3ABUA 2XGXA 3GTGJ 2QZ8A 5JFRA 2MLKA 2LDUA 1FLIA 2KMUA 3FZVA 4UUVA 3CQZJ 5ED4A 5D8LB 1ZREA 1KYZA 2GXAA 3ZPLA 3JTGA 3CCUI 4HF1A 1N25A 1KQ0A 3M8JA 2OQRA 2A5WA 2BHYA 2R7WA 2NOJB 1MGTA 3CTAA 3NEUA 4HG2A 3F9KA 1JKPC 1H0MA 2DMUA 4XRSG 2R3SA 3EETA 4HLXA 4UVAA 4PJMA 2P6SA 4H4KC 4ZC3A 1XMAA 2ZNZA 4PCQA 2FSWA 1XG1A 1SD7A 6PAXA 2JUCA 3BROA 2ISZA 3V8LA 5FKOA 5E3LA 3CESA 3H36A 3F22A 3DU5A 3Q3SA 2EV5A 2LNBA 4UUSA 2GIZA 1UHWA 2B63J 2QF7A 2MC3A 2NAZA 1WJ5A 4ETSA 5FLVA 3DKXA 3FXLA 4L5EA 4EM1A 4A3CJ 4IF4A 5EJCA 1TWAJ 1XX5A 2CQXA 3WTWC 2M3AA 3ASOH 2E71A 1F4KA 2BZTA 1DQUA 4QIWN 1PUEE 2NVYJ 3DKWA 3KP2A 3EUKL 2E2IJ 2V9PA 5IPAA 3SJMA 5B66C 3WHBA 2CUZA 1LE8A 2H94A 1BL0A 3WTUC 4A3JJ 1LB2A 4P5OA 4RGXA 5F0FA 4RGSA 4M6XA 5F64A 3VYRB 1YX5A 3HEFA 1F43A 3C3WA 3JSOA 2JA6J 3CC7I 3H9QA 3DCFA 2XROA 3UKGA 1XGMA 1DPRA 4Y4RA 3TW7A 3BT9A 3TL4X 4FX0A 1N77A 5HS9A 3RQIA 1XTAA 1AWCA 1APLC 4PFOA 2CU7A 1WJBA 2H1LA 3L2VA 1DDNA 4LJZF 1J9IA 1IXRC 4E7LA 3RI4A 1ZLJA 4XKCA 2YR2A 5E8GA 3FKJA 1T0FA 5M3FJ 5M5WJ 1HCRA 5IT9R 2GWRA 1T33A 3HSFA 3M07A 1B1BA 2DO7A 1MBEA 2LRDA 4HAMA 1WPKA 2R7SA 4A3LJ 2WV0A 5DDGA 1IF1A 1WI3A 3S2HJ 5IP7J 2CUFA 4RDUA 5D5WB 1AA7A 4OAYA 4D7NA 5KCMA 1DGRM 3D5LA 1NHAA 2FMYA 1OYIA 2IEKA 1QZEA 2LSOA 4O5VA 1H9TA 3GFMA 3H5NA 2QM3A 3EUAA 3PO2J 3Q5FA 5IYBJ 5A2QR 4YIRX 1Z7LA 3PUBA 5FKKA 4AUXA 4PZJA 1KU2A 2EFWA 1XDSA 5C4XJ 2M30A 2VI6A 3UR3C 4G12A 4EJUA 1ETKA 2TRTA 4R1HA 2O8KA 5HLIA 3MQ0A 3ML6A 1MSEC 4IRGA 3HDDA 3F0CA 1FC3A 2Q1ZB 1Z77A 2FU4A 3D5SC 3A01A 5TISC 2K86A 2Z33A 2BHZA 2XRNA 4HV6A 2O61A 5E18F 1MBJA 1WZ2A 3OYMA 2LFBA 2Y0MA 1U0JA 5CJ9A 2MH2A 1IRXA 4IOAF 3OY9A 3HXLA 1RESA 3S3NA 2FD5A 1CF7B 2D5VA 4LMYA 1G3TA 4FTHA 2KJBA 1PP8F 1QRYA 3GTQJ 1FOXA 1EH7A 2A5YB 2PMZA 2Z2SB 4WWCA 4CYCB 3FK6A 2HWVA 1PYVA 2LF8A 3I59A 1E3OC 2L5QA 2IT0A 2R7OA 4GGGA 3G1OA 2AHQA 2DJNA 3EDPA 2NVQJ 4M6VA 1FNNA 2QLZA 1JKQC 3I3LA 2RQPA 2CJJA 1A6IA 3ZQIA 1XGSA 2LG4A 1MMAA 4UHTA 1Y8QB 1S7OA 1ETXA 2MG4A 4X0GA 1VQ5I 3S1MJ 3IH2A 3KP3A 1CQTA 4DYCA 3PSIA 2HTSA 3RPUD 5M5YJ 2Y9ZA 3IAM2 3P9IA 4KIGA 2OU2A 3E1SA 5H20A 1JXSA 4BS9A 4QPOA 1VQ4I 1MBFA 3QOPA 3H3UA 3M1CA 4N9HA 1OCZH 2PBIA 3QPTA 2ISYA 2O6GE 4DZJA 4IHVA 1HQCA 5IT9Z 2X6WA 4G6DA 3CF5F 1K83J 2XPWA 1X4OA 5AIPA 2MABA 4MTEA 3NWTA 2DK5A 3SEQA 3RQ4A 2LBFB 3HZJA 4EVIA 3Q9SA 4A69C 3LA2A 3BG7A 3BCBA 3JSPA 4EEFG 2PMUA 4CCOA 4F55A 4F3QA 1YW7A 4M3BA 2DTZA 5D4SA 4DZPA 3E5XA 3GX4X 1S6LA 2ZMEA 4Q48A 4CXFA 3HC7A 4ZYAA 3K1MA 2M45A 4UB8C 4PSXA 4M6YA 1F1ZA 5A2QZ 1W36D 3CDLA 1X3WB 3GFIA 3G1LA 3SDBA 3L9FA 3FHZA 2QKLB 3OYFA 4BQAA 4IEJA 4S05A 5LGUA 4YELA 5K7HA 5DCMA 5J6XA 3QU6A 3VEPA 3W2AA 3G3ZA 1H88C 4JOMA 1HW5A 3OL3A 3PM1A 1ZGWA 1Y1WJ 2LREA 4PJNA 2W00A 1YLFA 2D2WA 3QYFA 4BQOA 3OSFA 2Y0SN 2CW8A 4AM3A 2Y30A 2OF7A 2XVCA 3ABLH 1XSDA 3KEOA 1IV8A 2M34A 3I4PA 3LA7A 1FOKA 4PJLA 1JTXA 2AXTC 4DNCA 4E7JA 5L3CA 2QQBA 3K4KA 3JRBA 1GLNA 1X4PA 1YOVB 4JP0A 1LKXA 3I53A 1XN7A 4RB3C 3ZMUA 3K6GA 2ACJA 3L2UA 3ZQLA 1JGSA 2DBBA 3GTJJ 4ESJA 1GDTA 3BQZA 2IGKA 2DFEA 2ZKZA 4FISA 2NVUB 2LD5A 2EB7A 2EINH 3BZCA 2DT6A 1ETQA 3K4NA 4XOPA 5L3DA 3K69A 3ESWB 3M9AA 2DA4A 4F7ZA 1GV2A 2VQGA 3K4CA 2XGDA 4RAFA 1EA3A 4I02A 2ESNA 1K4SA 2IGMA 2ZSIB 3OYNA 2EWNA 1A35A 4BGDA 4L9TA 1Y56A 3OOPA 1WH7A 4ITVA 4ZZDA 3CMEI 1BJAA 4WF2A 4FETA 3H9GA 4BJ5C 3OYEA 1ZELA 3M3YJ 1G8XA 3G1MA 2ZFWA 5TJJA 5EG0B 1JKRC 2OV7A 3F23A 2JRMA 1MMGA 2M4GA 4XM3A 4E7IA 2E7WA 1O4XA 1FBSA 4DW6A 2XAHA 3OYHA 3OIQA 4KITB 5EGOA 5CVUA 1ON1A 1U9OA 4R8HA 1SANA 4MO7A 1X19A 2L7MP 1J0RA 1W5SA 2DFIA 2RDPA 2ME6A 1IN6A 2R92J 1R23A 4IOCF 4CYCA 2HYFA 1OR7C 2AQFA 1TT0A 4BQNA 3IHUA 1XS9A 1FZPB 2HDCA 3ELKA 4IHSA 3SXYA 1P2FA 4XLAA 3O8GA 1W7PB 1FBQA 3ROUA 3ZGKA 1KU7A 1Z6RA 1SFOJ 4AIKA 4DBQA 1P4XA 3HJEA 1E17A 2WA0A 2PJPA 3FBNB 3CD6I 2LKXA 1E3HA 1J5YA 5HNHA 2L2OA 1ACIA 2E2JJ 1UJ8A 1JHHA 2H27A 1MIJA 3HHGA 3L7WA 4B1RA 2HOSA 2QQ9A 3C2GA 3KCCA 1YTYA 4BXUA 2UXNA 2RGVA 4R79A 2KQRA 2KIMA 4P9UA 4F91B 4EJOA 1LUJB 2C6YA 2F5DA 2IA0A 5HVQC 2CQKA 4LLGF 1HXDA 2F5FA 4RB2C 1ZR2A 1O3TA 1S7AA 2XF5A 3GWZA 1YHQI 3ZMSA 2BBYA 3UNGC 2MYSA 4BACA 2ADUA 4YIIA 5B1AH 2NYXA 2D1VA 5EZHA 1Y8RB 2KPMA 1Z91A 3GLXA 3LL7A 2AXLA 4HSRA 4U88A 4G9YA 1MH4A 5K5OA 3OYKA 4GO1A 2F48A 1ZRCA 1D8KA 4NBQA 1R36A 4HX7A 1QPMA 2VBZA 1OCTC 3ISPA 1X3ZB 1ZGAA 3GEZA 2Q8KA 1YFHA 1QU3A 4Y33A 2V26A 1K79A 2EK5A 1XGOA 1K78A 1EJ9A 1TWCJ 3GF2A 1FYKA 2COBA 2R7QA 3PUFA 1EH6A 4YFNF 5GPCA 4UV9A 2X1DA 3OL4A 3DU6A 4RS8A 1SD5A 3RPQA 3IRRA 4RAGA 2V1DA 3F72A 2RNGA 5C3EJ 4XLHA 3BC8A 3KZYA 2A6HF 4JYKA 1MBGA 4QLCU 2Q2EB 4E7KA 3BTIA 3TQNA 4HRIA 1U8BA 5C4JJ 2WWYA 1DU6A 4IHTA 3GVAA 4KUMA 5LEKA 3KLNA 3HOTA 2O7OA 3TO9A 4G7OF 2LR8A 1QBJA 3MZYA 3C2BA 1GXQA 2ZBKA 3FM5A 3H3ZA 4DJAA 2PN6A 4DQ2A 3S32A 1BI2A 2RV8A 3GZ5A 3GUDA 3O3KA 1OJLA 1P4AA 1YYVA 2VT3A 3KX2A 3SZTA 3KYDB 5CVJA 3VB2A 3OIOA 1V5EA 1TC3C 1ZG3A 4A3FJ 4HPQA 4L9JA 1BI0A 1VQLI 3LNQA 3SZGA 3HTUA 2K4BA 4QTRA 4Y17A 1K6OA 2VC1A 1K6YA 2P6TA 1D1BA 4MTDA 1W36C 1BA5A 2LY2A 3R60A 4YFKF 4M9XA 1WI9A 1I6XA 1X3UA 2VQLA 3LMMA 2V4JC 4XQFA 3JREA 3MKWB 4KA4A 3F8FA 3TGNA 4UUTA 4CYDA 3RSNA 3FISA 4I01A 4UVCA 3H9JA 4UUSB 3WTXC 3HGYA 1U2WA 4P96A 2CYYA 4I99C 1XMXA 1J09A 1R71A 1BR2A 5BNGA 1Q1HA 4ENMA 5EG0A 1G6NA 4GRIA 5HOOA 1YS7A 2HS5A 1OYWA 2UV1A 2XGCA 4U87A 3A02A 4NB5A 4IZZA 2L3DA 5JLWA 4DYRA 1QGPA 2FBKA 3S2WA 1JUMA 3J81K 2PQ8A 5J8FA 4DIQA 4Y15A 3DEEA 3IC7A 4WX9A 1ULYA 1LPQA 5D6EA 1WH5A 1O3RA 1ORKA 1D3YA 4E6KG 5JVGF 3FXMA 2VL8A 3CUQC 3AKZA 2OCCH 2DA3A 1X1AA 3ZQ7A 5K7FA 2Y75A 4E7HA 1Z0XA 4P9FA 2DU9A 1XD7A 5BPDA 1IZ1A 1W7PA 4XRSA 4G8XA 3A4CA 3PNVA 5D5XB 3Q9VA 2Z99A 4M3GA 3GZ6A 3CUQA 3TP0A 3CCRI 3JTHA 1LFBA 2W84A 4DYQA 1Z1DA 3F21A 2HOAA 2X9DA 1P7JA 3HRUA 4GYGA 4CUGA 2XV4S 3LSJA 1UELB 4L5JA 5B5EC 1VQMI 1I1SA 4AVZA 5GTIC 5KK1A 5LD2C 2ZC2A 2JN6A 3K1PA 2K27A 1ZN2A 3GBGA 5FKNA 1ZGJA 1R7JA 4V19K 4PJ0C 3WTVC 2ESHA 3JRCA 4XSZF 2VODA 1RKTA 3CZ6A 2IJLA 3BR2A 5HLHA 1OQYA 5ICEA 4IXAA 4G6TB 3QP5A 3QOEA 3HSRA 2E19A 1SVLA 4KMUX 1WCMJ 2BXZA 2BYVE 4LK0F 4HNUA 2QVOA 3AG4H 3GYHX 4EJTA 4IHYA 1POGA 3LFKA 4ASNA 5FKLA 2VB6A 3HUGA 4AIJA 2FMLA 2OBPA 4N9IA 3G4SI 1NK3P
chains in the Genus database with same CATH topology
1R5GA 1T2KA 1VTNC 4HQEA 4LB5A 1R58A 1LEAA 5FO5A 2YX4A 3I59B 2K02A 1BC7C 3TDZC 2FNPA 1USTA 3RKYA 2BE5F 2KKOA 4A2UA 5EEGA 1WWXA 3R6SA 2VXZA 2K7LA 1DUXC 5D5UB 2XAJA 2BGCA 2WC2A 3TDUC 1S29A 2A3SA 1OPCA 2EFNA 2NS0A 5E1XA 2VE9A 3FX3A 3V7SA 1IN4A 1P4WA 1F5TA 5ERIA 3WTTC 4KDPA 4YG2F 1MJAA 2ZMEB 4OIOF 4OIQF 3KP4A 4MEYF 1FT9A 2IPQX 2P7CB 1KGSA 1XSVA 1ZG1A 3NQOA 4O6JA 3RYRA 2EV6A 5DCMB 1G4DA 3O2PE 3IWFA 5BS6A 4B8XA 2YX7A 3CO6C 2UXXA 2HEOA 2V1XA 4S04A 4MNUA 3VOEA 3RIRA 2ZNYA 5LGTA 3E6BA 4GXOA 3R0JA 1EV7A 1I27A 1OYYA 2HTJA 4D0PA 1YG2A 3IWZA 1XCVA 3GW2A 1ZG5A 3E6DA 4WK8F 4OMYA 3T8TA 1B59A 1K7AA 4A12A 1G3YA 4L9NA 3K0LA 2Z9OA 2A68F 3GO5A 2RC4A 2V6CA 4O3MA 4ENNA 2MA3A 2J5PA 3LAPA 1HW1A 3DQVC 2DLLA 3KE2A 5J8CA 2DK8A 1RUNA 1W4MA 2OAZA 1T38A 1DP7P 1JE8A 5HS8A 1ZARA 1FP2A 3BJAA 4HW0A 3T1BA 3IL2A 4IPAA 1D8JA 2P4WA 3AAFA 1W5TA 3I64A 5CVIA 5L3GA 4U7DA 1U8RA 2STTA 2DQLA 3MFKA 3KZZA 1R00A 1Z9CA 3HHHA 1WRJA 4BHCA 5LLQA 1LJ9A 3TOAA 4EQQA 1S8NA 2PMHA 4AIHA 1T98A 1KU9A 5KVRA 2H6BA 3TO6A 1B6AA 1FSHA 2CWEA 5AONA 4JK1X 3ZMTA 3FXQA 3R0AA 2FXAA 5LHGA 2MH9A 5D6FA 1MZBA 2CSOA 3I54A 4XSXF 1K78B 4LLLA 4CGZA 4JBAA 3BPXA 4KN7X 4ZYEA 1R1UA 1IN5A 5ILVA 5AIQA 5HLGA 1PP7U 2VOPA 2KIUA 5H6QA 4AVPA 2W85A 2CW0F 3LQQA 3FMRA 2VN2A 1FWZA 4L5IA 3WTYC 4IVNA 1V4RA 3J80K 1SD4A 5JVTA 1USSA 3BJ6A 3F8BA 2EFPA 2HYGD 2E1NA 2HZTA 2JPBA 1R5HA 5BQTA 1IXCA 4OU0A 4KIBA 1LDJA 2DTRA 1RI7A 4U0YA 4HF2A 3DPLC 2F2EA 3RKXA 2XKOA 5BMZA 3EUHA 3FXUA 4BHBA 3WG9A 1TW3A 1ODDA 2V1UA 3M7GA 1BI1A 4BH9A 2DT5A 1L3LA 3T0YA 4EGYA 3BDDA 2K4JA 5K5QA 2QWWA 2HQRA 1BIBA 2L02A 4K2EA 3U1DA 5DYMA 4LB6B 4LG0B 2G7HA 2QYOA 1ZAOA 1P92A 3ECHA 3CUQB 1HSTA 1OR7A 3DEUA 2XIGA 2JSCA 2RN7A 4ENJA 1L0OC 2RNJA 3V4GA 4U7BA 2IRFG 3L2CA 5CVVA 3FMQA 2W24A 4M73A 3E97A 3CLOA 5BPIA 2RVCA 1LDDA 1F9NA 1ZHFA 2EFQA 4M74A 5L3BA 1FP1D 5ICFA 2ZXJA 2QQAA 1ONVA 1PDNC 4Q5SF 3H92A 1SMTA 4PDKA 4A5NA 3DXJF 2IP2A 3PQJA 4ON0A 3PQKA 1ZH5A 2P8TA 2JTVA 4RGUA 2PI0A 3RPUA 1HKTA 2VBYA 1U5TC 3V7RA 3V8JA 3PFIA 1R1TA 3BP8A 1IAWA 3GXOA 4RB0A 4Q4ZF 4L0YB 5JHUA 3QP6A 1QZZA 4L9VA 4EJWA 4ESFA 2PFBA 3WE2A 1IRFA 3SFZA 1XMKA 3DF8A 1Z7UA 2ETHA 2VC0A 2MD5A 1T6SA 4YIFA 2D45A 1SMYF 1STZA 1BM9A 1LNWA 4HV5A 3K9TA 3WGGA 2CFXA 2PG4A 1Z05A 1R22A 4CZZA 3ZN1A 5ILUA 2WTEA 3OV8A 3SZPA 1QO0D 4RAYA 5FFZA 5E17F 2NNNA 3WE3A 2FBIA 2GXGA 5LEJA 2IVMA 4KN4X 3J80Z 4LG0A 4WXHA 2OZ6A 1LVAA 2NNYA 2KJCA 3E6MA 4U0VA 1C0WA 3BY6A 4NQWA 2OQGA 3BZ6A 5K5RA 2DPUA 3C1DA 3COAC 2MBFA 5D8KB 2PLYA 3MCZA 5CVRA 5HDGA 4PGGA 5IT3A 1KQ9A 4A0XA 2NRAC 4LGWA 1B9MA 3N97A 5DD4A 4OIPF 1MD0A 4EMSA 1I5ZA 3HOSA 2P5VA 3I5UA 3WU0A 3QAHA 3HRTA 2Z5UA 2E1CA 2V9VA 1WKMA 3E3VA 1LEBA 1GVJA 1MJ9A 1BI3A 2XAQA 2XUBA 3VFZA 4RAZA 3M8EA 3MEXA 2GAUA 2BV6A 2M8EA 2W57A 1HW2A 1SAXA 2KRFA 1TNTA 4H0EA 5E8IA 4KYWA 1RNLA 5F6FA 5L3FA 3REOA 3RDIA 3U9GA 2XKPA 2L4AA 4IRIA 5ILSA 1H9GA 4EGZA 3D0SA 1G3WA 1ZRDA 4UVBA 3SQNA 1UHMA 2QUFA 4BNCA 3KLOA 3ZP5A 1KYWA 2D1HA 2G7UA 4IJAA 1LDKB 1Y0UA 3HYIA 4XLPF 2L54A 3B73A 1QQIA 4B09A 1TBXA 1ON2A 2V79A 1TW2A 4FT8A 3G73A 4L18B 4IRHA 2Q0OA 2QBYA 3TOBA 2EA2A 2M5WA 3MWMA 2UZKA 3F8CA 3HTSB 1DPUA 1U78A 4ENKA 2JPCA 4OOIA 3HRSA 3LSTA 1IRGA 4Y13A 4ZYHA 3W6JB 3DPTA 2GA2A 4I0BA 3CJNA 3MAJA 4OMZA 2R7DA 4RB1A 1SFEA 4E70A 3KP5A 1FX7A 3J7AO 1REPC 1S3JA 4HDUA 3M8FA 2A61A 2JZYA 3R61A 3QPHA 3BJOA 2HFHA 4BHPA 2X4HA 3FXRA 5LGNA 4BAYA 1O3SA 1BBYA 2W25A 1YIOA 1YW9A 3FF5A 5JR3A 1MKMA 5FB2A 5EEHA 4I0AA 1KU3A 3TO7A 2M1BA 3BPVA 2F5CA 3ZMDA 4UXNA 2OD5A 2Z3YA 1KA8A 1FYLA 5HS7A 3JAMK 3EQLF 4XRFA 1SFUA 2CG4A 2DW4A 1J75A 2FA5A 3FWEA 3J81Z 1J59A 4QWQA 2FOKA 1MDMA 4ZZLA 2DPDA 5BOXA 1FY7A 1O57A 4HDVA 2P7VB 5L3EA 5DUIA 4WXDA 3RKWA 2IA2A 2EJRA 5LRSA 4KMFA 2ZCWA 2HGCA 1U6GA 2CGPA 1AOYA 4AWXB 3CDHA 1HSJA 5DCFA 1TQPA 1R1VA 4CHUA 4A5MA 2HOEA 4HOBA 4FX4A 3EYIA 4OINF 3ULQB 2XAFA 2VT2A 1U3EM 4EM2A 2VONA 3DFGA 2GIVA 5LHHA 3KETA 3I58A 2XHKA 4N0BA 3ZMZA 1J7KA 1TTYA 3GFJA 5DUKA 4A6DA 2XAGA 4Z2YA 4ZYDA 2X0LA 4HF0A 3V7CA 3E5QA 2R7FA 5FFXA 2YPRA 2KIFA 4TV7A 1D5VA 3M1EA 4LK1F 1XDUA 2LF7A 4HBLA 3ECOA 4ZYGA 1FPQA 2DI3A 1HBXG 4Q47A 5E20A 3C18A 2A6EF 4XLNF 1YO5C 1XGNA 2HKOA 3K1NA 5H6RA 2EV0A 1G3SA 4WCGA 3TKYA 4KNYA 5F1RA 2F5EA 3FMSA 1U5TB 4M9SA 4A0ZA 1FSEA 3WGIA 1O7FA 1P6RA 4KFCA 4I2OA 4LLNA 4UNOA 1XB4A 3HRMA 2YU3A 3F6VA 1GXPA 2G9WA 2A69F 5CYVA 3ZMVA 3WTSC 3KP7A 2FRHA 1CGPA 4LFUA 3WODF 4HA8A 4I7HA 5FGMA 3L09A 1YQAA 2O3FA 1IW7F 1W7PD 3JW4A 2YSRA 5DEQA 1UFMA 1A04A 5K1YA 5D4RA 5D5VB 5DD8A 1O7LA 1TNSA 3IRQA 5FLXK 1BC8C 2HQNA 2XASA 1QZYA 3O6BB 2E7XA 3B02A 2IA1A 5E1ZB 4G6QA 4M72A 3ZN0A 1XSXA 5LBQA 3E6CC 4MGRA 3IKTA 3R4KA 2STWA 1FBUA 1CF7A 1B4AA 3LAJA 3C7JA 2AS5F 2O0YA 3LA3A 2OZUA 3V8KA 4BYYA 1GHCA 2FNAA 3EYYA 3P9KA 3JAMZ 4FHTA 4GYIA 5LHIA 5E1WA 2GZWA 4A0YA 1BIAA 3I0TA 2FEZA 3RTRA 2EFOA 2M87A 1WQ2A 2O8XA 1RUOA 5HDNA 4M71A 3T8RA 3SHFA 1RZ4A 1SD6A 4JQFA 2GQQA 5ICGA 2O03A 4HX8A 4G7HF 3E5UA 1FYMA 1KQ8A 4HLYA 4CICA 3QRFF 2DQRA 3KFWX 1IUYA 1WSUA 1TQMA 3I71A 5HDKA 4G7ZF 4HYEA 1LQ1A 2JT1A 2RKHA 4EJVA 5FD5A 1OKRA 2FBHA 2COMA 4GCVA 1ZYRF 4OIRF 1V3FA 2EA4A 2P5KA 4KIFA 1U5TA 4ZH4F 2FQ3A 4HQMA 2VBXA 4CDGA 4PGHA 4WXCA 5FD6A 2JRTA 4NHJA 1QNTA 1YS6A 3VODA 4A6EA 5LRRA 2Y48A 4EM0B 4MHGA 1BOAA 1YW8A 1HKSA 1T39A 1IN7A 3F8NA 4UV8A 2L4MA 1B9NA 2DAOA 2PEXA 3HSEA 4I98B 2FF4A 2A07F 3ABTA 2QBYB 3U2RA 4KICA 1SFXA 2ELHA 2VBWA 2B0LA 2HKXA 5TRDA 1XCBA 2QENA 1Z6TA 1IN8A 3LWFA 3DP7A 1RIOH 1BN5A 2IW5A 2H09A 1J2XA 2P5LC 4I09A 3F3XA 4P55A 1I1GA 2MLGA 2ZO4A 3HIFA 3WGHA 4G94A 1JHFA 1HKQA 3NRVA 1ZRFA 3MZHA 4MQ9F 3KEQA 1ZLKA 4MQVA 3BOQA 1TLHB 2J5OA 4MEXF 2L01A 3LQRA 4YFXF 5JI6A 3P9CA 5CLSA 3QU3A 5DV5A 4HZFA 1EH8A 1UB9A 4M9ZA 3P7NA 2FE3A 3CO7C 2VOOA 4EV0A 4AD9A 5FLXZ 3N4MA 3WU1B 1MDMB 5ICCA 4RGRA 3KP6A 4LD5A 2UWMA 3GFLA 2GA1A 1OMIA 3RJPA 3BWGA 4XBFA 5IT9K 3RYPA 3T5XA 3K2ZA 2H6CA 2ZJ2A 4U0WA 4ESBA 4KT5C 4HX4A 2TDXA 1O3QA 1MJBA 3W6KB 1E2XA 3F6OA 2BEOA 4CO8A 2LKPA 3F8MA 1IXSB 2VE8A 3L00A 2CO5A 3IKVA 3FM3A 4L0ZB 5A2QK 3WTZA 2OA4A 1UCRA 3DV8A 2Q2EA 3CUOA 3ERED 1TQIA 2GXBA 2HR3A 3ABUA 2XGXA 2QZ8A 5JFRA 2MLKA 2LDUA 1FLIA 3FZVA 4UUVA 5ED4A 5D8LB 1ZREA 1KYZA 3ZPLA 3JTGA 4HF1A 1KQ0A 2OQRA 1MGTA 3CTAA 3NEUA 1H0MA 2R3SA 3EETA 4HLXA 4UVAA 2P6SA 1XMAA 2ZNZA 4PCQA 2FSWA 1SD7A 6PAXA 3BROA 2ISZA 3V8LA 3F22A 2EV5A 2LNBA 1UHWA 2MC3A 2NAZA 4ETSA 4EM1A 4IF4A 3WTWC 1F4KA 1PUEE 3DKWA 3KP2A 2H94A 3WTUC 1LB2A 4P5OA 4RGXA 5F64A 4RGSA 4M6XA 3C3WA 3JSOA 2XROA 1XGMA 1DPRA 4FX0A 5HS9A 1AWCA 1DDNA 4LJZF 1J9IA 1IXRC 3RI4A 1ZLJA 5E8GA 2YR2A 1T0FA 2GWRA 3HSFA 1B1BA 2DO7A 4HAMA 2WV0A 5DDGA 1IF1A 5D5WB 3D5LA 1NHAA 2FMYA 1OYIA 2LSOA 4O5VA 1H9TA 3GFMA 2QM3A 3Q5FA 4PZJA 1KU2A 2EFWA 1XDSA 2M30A 4EJUA 4R1HA 5HLIA 3MQ0A 3ML6A 4IRGA 1FC3A 2FU4A 2K86A 2Z33A 2XRNA 4HV6A 2O61A 5E18F 2Y0MA 5CJ9A 2MH2A 1CF7B 4LMYA 1G3TA 1PP8F 2KJBA 1EH7A 2A5YB 4WWCA 2HWVA 2LF8A 3I59A 2IT0A 4GGGA 3EDPA 1FNNA 2QLZA 2RQPA 1XGSA 4UHTA 1S7OA 3KP3A 2HTSA 3P9IA 4KIGA 2OU2A 5H20A 1JXSA 3QOPA 3H3UA 4N9HA 2PBIA 3QPTA 2ISYA 2O6GE 1HQCA 5IT9Z 4G6DA 5AIPA 4MTEA 2DK5A 4EVIA 3Q9SA 3LA2A 3JSPA 2PMUA 1YW7A 5D4SA 3E5XA 3GX4X 1S6LA 2ZMEA 4Q48A 4CXFA 3K1MA 2M45A 4M6YA 1F1ZA 5A2QZ 3GFIA 3L9FA 3FHZA 4BQAA 4S05A 5LGUA 5DCMA 5J6XA 3QU6A 3VEPA 3G3ZA 1HW5A 1YLFA 2D2WA 2XVCA 1XSDA 3KEOA 3I4PA 3LA7A 1FOKA 4DNCA 5L3CA 2QQBA 3I53A 1XN7A 4RB3C 3ZMUA 2ACJA 1JGSA 2DBBA 4ESJA 2ZKZA 2EB7A 5L3DA 3K69A 3M9AA 4F7ZA 4I02A 2ESNA 2EWNA 4L9TA 3OOPA 4ZZDA 1BJAA 4WF2A 2ZFWA 5TJJA 3F23A 2E7WA 1FBSA 2XAHA 5CVUA 1ON1A 4R8HA 1J0RA 1W5SA 2DFIA 2RDPA 1IN6A 1R23A 2HYFA 3IHUA 1FZPB 2HDCA 3ELKA 4IHSA 3SXYA 1P2FA 1W7PB 1FBQA 3ROUA 1KU7A 1Z6RA 4AIKA 1P4XA 1E17A 2PJPA 1J5YA 1JHHA 2H27A 3HHGA 3L7WA 2QQ9A 3KCCA 1YTYA 4BXUA 2UXNA 2RGVA 4R79A 2KIMA 4P9UA 4EJOA 2C6YA 2F5DA 2IA0A 5HVQC 2CQKA 4LLGF 1HXDA 2F5FA 4RB2C 1O3TA 1S7AA 3GWZA 3ZMSA 2BBYA 2ADUA 4YIIA 2NYXA 2D1VA 1Z91A 3GLXA 2AXLA 4U88A 4G9YA 5K5OA 4GO1A 1ZRCA 1D8KA 1R36A 4HX7A 1QPMA 2VBZA 3ISPA 1ZGAA 3GEZA 2Q8KA 1YFHA 1K79A 2EK5A 1XGOA 1K78A 3GF2A 1FYKA 4YFNF 1EH6A 4UV9A 4RS8A 1SD5A 3IRRA 3RPQA 2V1DA 3F72A 3KZYA 2A6HF 4QLCU 3TQNA 2WWYA 4IHTA 3GVAA 4KUMA 5LEKA 3KLNA 3HOTA 4G7OF 3TO9A 1QBJA 3MZYA 1GXQA 2ZBKA 3FM5A 3H3ZA 2PN6A 4DQ2A 1BI2A 2RV8A 3GZ5A 3GUDA 3O3KA 1P4AA 1YYVA 2VT3A 3SZTA 5CVJA 3VB2A 1ZG3A 4L9JA 1BI0A 3HTUA 2K4BA 4Y17A 1K6OA 2VC1A 2P6TA 4MTDA 3R60A 4YFKF 4M9XA 1WI9A 1I6XA 1X3UA 4KA4A 3F8FA 3TGNA 4CYDA 4I01A 4UVCA 3WTXC 1U2WA 4P96A 2CYYA 4ENMA 1Q1HA 1G6NA 5HOOA 1YS7A 2HS5A 1OYWA 4NB5A 2L3DA 1QGPA 2FBKA 3S2WA 3J81K 2PQ8A 5J8FA 4Y15A 3IC7A 4WX9A 1ULYA 5D6EA 1O3RA 1D3YA 3CUQC 3ZQ7A 2Y75A 4P9FA 2DU9A 1XD7A 5BPDA 1IZ1A 1W7PA 4G8XA 5D5XB 3Q9VA 2Z99A 3GZ6A 3CUQA 3JTHA 2W84A 1Z1DA 3F21A 3HRUA 4GYGA 2XV4S 4L5JA 1I1SA 5KK1A 3K1PA 2K27A 1ZN2A 1ZGJA 1R7JA 3WTVC 2ESHA 2VODA 4XSZF 2IJLA 5HLHA 5ICEA 4IXAA 3QP5A 3HSRA 4KMUX 2BYVE 4LK0F 2QVOA 4EJTA 3GYHX 3LFKA 4ASNA 3HUGA 4AIJA 2FMLA 2OBPA 4N9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5G A;  1T2K A;  1VTN C;  4HQE A;  4LB5 A;  1R58 A;  1LEA A;  5FO5 A;  2YX4 A;  3I59 B;  2K02 A;  1BC7 C;  3TDZ C;  2FNP A;  1UST A;  3RKY A;  2BE5 F;  2KKO A;  4A2U A;  5EEG A;  1WWX A;  3R6S A;  2VXZ A;  2K7L A;  1DUX C;  5D5U B;  2XAJ A;  2BGC A;  2WC2 A;  3TDU C;  1S29 A;  2A3S A;  1OPC A;  2EFN A;  2NS0 A;  5E1X A;  2VE9 A;  3FX3 A;  3V7S A;  1IN4 A;  1P4W A;  1F5T A;  5ERI A;  3WTT C;  4KDP A;  4YG2 F;  1MJA A;  2ZME B;  4OIO F;  4OIQ F;  3KP4 A;  4MEY F;  1FT9 A;  2IPQ X;  2P7C B;  1KGS A;  1XSV A;  1ZG1 A;  3NQO A;  4O6J A;  3RYR A;  2EV6 A;  5DCM B;  1G4D A;  3O2P E;  3IWF A;  5BS6 A;  4B8X A;  2YX7 A;  3CO6 C;  2UXX A;  2HEO A;  2V1X A;  4S04 A;  4MNU A;  3VOE A;  3RIR A;  2ZNY A;  5LGT A;  3E6B A;  4GXO A;  3R0J A;  1EV7 A;  1I27 A;  1OYY A;  2HTJ A;  4D0P A;  1YG2 A;  3IWZ A;  1XCV A;  3GW2 A;  1ZG5 A;  3E6D A;  4WK8 F;  4OMY A;  3T8T A;  1B59 A;  1K7A A;  4A12 A;  1G3Y A;  4L9N A;  3K0L A;  2Z9O A;  2A68 F;  3GO5 A;  2RC4 A;  2V6C A;  4O3M A;  4ENN A;  2MA3 A;  2J5P A;  3LAP A;  1HW1 A;  3DQV C;  2DLL A;  3KE2 A;  5J8C A;  2DK8 A;  1RUN A;  1W4M A;  2OAZ A;  1T38 A;  1DP7 P;  1JE8 A;  5HS8 A;  1ZAR A;  1FP2 A;  3BJA A;  4HW0 A;  3T1B A;  3IL2 A;  4IPA A;  1D8J A;  2P4W A;  3AAF A;  1W5T A;  3I64 A;  5CVI A;  5L3G A;  4U7D A;  1U8R A;  2STT A;  2DQL A;  3MFK A;  3KZZ A;  1R00 A;  1Z9C A;  3HHH A;  1WRJ A;  4BHC A;  5LLQ A;  1LJ9 A;  3TOA A;  4EQQ A;  1S8N A;  2PMH A;  4AIH A;  1T98 A;  1KU9 A;  5KVR A;  2H6B A;  3TO6 A;  1B6A A;  1FSH A;  2CWE A;  5AON A;  4JK1 X;  3ZMT A;  3FXQ A;  3R0A A;  2FXA A;  5LHG A;  2MH9 A;  5D6F A;  1MZB A;  2CSO A;  3I54 A;  4XSX F;  1K78 B;  4LLL A;  4CGZ A;  4JBA A;  3BPX A;  4KN7 X;  4ZYE A;  1R1U A;  1IN5 A;  5ILV A;  5AIQ A;  5HLG A;  1PP7 U;  2VOP A;  2KIU A;  5H6Q A;  4AVP A;  2W85 A;  2CW0 F;  3LQQ A;  3FMR A;  2VN2 A;  1FWZ A;  4L5I A;  3WTY C;  4IVN A;  1V4R A;  3J80 K;  1SD4 A;  5JVT A;  1USS A;  3BJ6 A;  3F8B A;  2EFP A;  2HYG D;  2E1N A;  2HZT A;  2JPB A;  1R5H A;  5BQT A;  1IXC A;  4OU0 A;  4KIB A;  1LDJ A;  2DTR A;  1RI7 A;  4U0Y A;  4HF2 A;  3DPL C;  2F2E A;  3RKX A;  2XKO A;  5BMZ A;  3EUH A;  3FXU A;  4BHB A;  3WG9 A;  1TW3 A;  1ODD A;  2V1U A;  3M7G A;  1BI1 A;  4BH9 A;  2DT5 A;  1L3L A;  3T0Y A;  4EGY A;  3BDD A;  2K4J A;  5K5Q A;  2QWW A;  2HQR A;  1BIB A;  2L02 A;  4K2E A;  3U1D A;  5DYM A;  4LB6 B;  4LG0 B;  2G7H A;  2QYO A;  1ZAO A;  1P92 A;  3ECH A;  3CUQ B;  1HST A;  1OR7 A;  3DEU A;  2XIG A;  2JSC A;  2RN7 A;  4ENJ A;  1L0O C;  2RNJ A;  3V4G A;  4U7B A;  2IRF G;  3L2C A;  5CVV A;  3FMQ A;  2W24 A;  4M73 A;  3E97 A;  3CLO A;  5BPI A;  2RVC A;  1LDD A;  1F9N A;  1ZHF A;  2EFQ A;  4M74 A;  5L3B A;  1FP1 D;  5ICF A;  2ZXJ A;  2QQA A;  1ONV A;  1PDN C;  4Q5S F;  3H92 A;  1SMT A;  4PDK A;  4A5N A;  3DXJ F;  2IP2 A;  3PQJ A;  4ON0 A;  3PQK A;  1ZH5 A;  2P8T A;  2JTV A;  4RGU A;  2PI0 A;  3RPU A;  1HKT A;  2VBY A;  1U5T C;  3V7R A;  3V8J A;  3PFI A;  1R1T A;  3BP8 A;  1IAW A;  3GXO A;  4RB0 A;  4Q4Z F;  4L0Y B;  5JHU A;  3QP6 A;  1QZZ A;  4L9V A;  4EJW A;  4ESF A;  2PFB A;  3WE2 A;  1IRF A;  3SFZ A;  1XMK A;  3DF8 A;  1Z7U A;  2ETH A;  2VC0 A;  2MD5 A;  1T6S A;  4YIF A;  2D45 A;  1SMY F;  1STZ A;  1BM9 A;  1LNW A;  4HV5 A;  3K9T A;  3WGG A;  2CFX A;  2PG4 A;  1Z05 A;  1R22 A;  4CZZ A;  3ZN1 A;  5ILU A;  2WTE A;  3OV8 A;  3SZP A;  1QO0 D;  4RAY A;  5FFZ A;  5E17 F;  2NNN A;  3WE3 A;  2FBI A;  2GXG A;  5LEJ A;  2IVM A;  4KN4 X;  3J80 Z;  4LG0 A;  4WXH A;  2OZ6 A;  1LVA A;  2NNY A;  2KJC A;  3E6M A;  4U0V A;  1C0W A;  3BY6 A;  4NQW A;  2OQG A;  3BZ6 A;  5K5R A;  2DPU A;  3C1D A;  3COA C;  2MBF A;  5D8K B;  2PLY A;  3MCZ A;  5CVR A;  5HDG A;  4PGG A;  5IT3 A;  1KQ9 A;  4A0X A;  2NRA C;  4LGW A;  1B9M A;  3N97 A;  5DD4 A;  4OIP F;  1MD0 A;  4EMS A;  1I5Z A;  3HOS A;  2P5V A;  3I5U A;  3WU0 A;  3QAH A;  3HRT A;  2Z5U A;  2E1C A;  2V9V A;  1WKM A;  3E3V A;  1LEB A;  1GVJ A;  1MJ9 A;  1BI3 A;  2XAQ A;  2XUB A;  3VFZ A;  4RAZ A;  3M8E A;  3MEX A;  2GAU A;  2BV6 A;  2M8E A;  2W57 A;  1HW2 A;  1SAX A;  2KRF A;  1TNT A;  4H0E A;  5E8I A;  4KYW A;  1RNL A;  5F6F A;  5L3F A;  3REO A;  3RDI A;  3U9G A;  2XKP A;  2L4A A;  4IRI A;  5ILS A;  1H9G A;  4EGZ A;  3D0S A;  1G3W A;  1ZRD A;  4UVB A;  3SQN A;  1UHM A;  2QUF A;  4BNC A;  3KLO A;  3ZP5 A;  1KYW A;  2D1H A;  2G7U A;  4IJA A;  1LDK B;  1Y0U A;  3HYI A;  4XLP F;  2L54 A;  3B73 A;  1QQI A;  4B09 A;  1TBX A;  1ON2 A;  2V79 A;  1TW2 A;  4FT8 A;  3G73 A;  4L18 B;  4IRH A;  2Q0O A;  2QBY A;  3TOB A;  2EA2 A;  2M5W A;  3MWM A;  2UZK A;  3F8C A;  3HTS B;  1DPU A;  1U78 A;  4ENK A;  2JPC A;  4OOI A;  3HRS A;  3LST A;  1IRG A;  4Y13 A;  4ZYH A;  3W6J B;  3DPT A;  2GA2 A;  4I0B A;  3CJN A;  3MAJ A;  4OMZ A;  2R7D A;  4RB1 A;  1SFE A;  4E70 A;  3KP5 A;  1FX7 A;  3J7A O;  1REP C;  1S3J A;  4HDU A;  3M8F A;  2A61 A;  2JZY A;  3R61 A;  3QPH A;  3BJO A;  2HFH A;  4BHP A;  2X4H A;  3FXR A;  5LGN A;  4BAY A;  1O3S A;  1BBY A;  2W25 A;  1YIO A;  1YW9 A;  3FF5 A;  5JR3 A;  1MKM A;  5FB2 A;  5EEH A;  4I0A A;  1KU3 A;  3TO7 A;  2M1B A;  3BPV A;  2F5C A;  3ZMD A;  4UXN A;  2OD5 A;  2Z3Y A;  1KA8 A;  1FYL A;  5HS7 A;  3JAM K;  3EQL F;  4XRF A;  1SFU A;  2CG4 A;  2DW4 A;  1J75 A;  2FA5 A;  3FWE A;  3J81 Z;  1J59 A;  4QWQ A;  2FOK A;  1MDM A;  4ZZL A;  2DPD A;  5BOX A;  1FY7 A;  1O57 A;  4HDV A;  2P7V B;  5L3E A;  5DUI A;  4WXD A;  3RKW A;  2IA2 A;  2EJR A;  5LRS A;  4KMF A;  2ZCW A;  2HGC A;  1U6G A;  2CGP A;  1AOY A;  4AWX B;  3CDH A;  1HSJ A;  5DCF A;  1TQP A;  1R1V A;  4CHU A;  4A5M A;  2HOE A;  4HOB A;  4FX4 A;  3EYI A;  4OIN F;  3ULQ B;  2XAF A;  2VT2 A;  1U3E M;  4EM2 A;  2VON A;  3DFG A;  2GIV A;  5LHH A;  3KET A;  3I58 A;  2XHK A;  4N0B A;  3ZMZ A;  1J7K A;  1TTY A;  3GFJ A;  5DUK A;  4A6D A;  2XAG A;  4Z2Y A;  4ZYD A;  2X0L A;  4HF0 A;  3V7C A;  3E5Q A;  2R7F A;  5FFX A;  2YPR A;  2KIF A;  4TV7 A;  1D5V A;  3M1E A;  4LK1 F;  1XDU A;  2LF7 A;  4HBL A;  3ECO A;  4ZYG A;  1FPQ A;  2DI3 A;  1HBX G;  4Q47 A;  5E20 A;  3C18 A;  2A6E F;  4XLN F;  1YO5 C;  1XGN A;  2HKO A;  3K1N A;  5H6R A;  2EV0 A;  1G3S A;  4WCG A;  3TKY A;  4KNY A;  5F1R A;  2F5E A;  3FMS A;  1U5T B;  4M9S A;  4A0Z A;  1FSE A;  3WGI A;  1O7F A;  1P6R A;  4KFC A;  4I2O A;  4LLN A;  4UNO A;  1XB4 A;  3HRM A;  2YU3 A;  3F6V A;  1GXP A;  2G9W A;  2A69 F;  5CYV A;  3ZMV A;  3WTS C;  3KP7 A;  2FRH A;  1CGP A;  4LFU A;  3WOD F;  4HA8 A;  4I7H A;  5FGM A;  3L09 A;  1YQA A;  2O3F A;  1IW7 F;  1W7P D;  3JW4 A;  2YSR A;  5DEQ A;  1UFM A;  1A04 A;  5K1Y A;  5D4R A;  5D5V B;  5DD8 A;  1O7L A;  1TNS A;  3IRQ A;  5FLX K;  1BC8 C;  2HQN A;  2XAS A;  1QZY A;  3O6B B;  2E7X A;  3B02 A;  2IA1 A;  5E1Z B;  4G6Q A;  4M72 A;  3ZN0 A;  1XSX A;  5LBQ A;  3E6C C;  4MGR A;  3IKT A;  3R4K A;  2STW A;  1FBU A;  1CF7 A;  1B4A A;  3LAJ A;  3C7J A;  2AS5 F;  2O0Y A;  3LA3 A;  2OZU A;  3V8K A;  4BYY A;  1GHC A;  2FNA A;  3EYY A;  3P9K A;  3JAM Z;  4FHT A;  4GYI A;  5LHI A;  5E1W A;  2GZW A;  4A0Y A;  1BIA A;  3I0T A;  2FEZ A;  3RTR A;  2EFO A;  2M87 A;  1WQ2 A;  2O8X A;  1RUO A;  5HDN A;  4M71 A;  3T8R A;  3SHF A;  1RZ4 A;  1SD6 A;  4JQF A;  2GQQ A;  5ICG A;  2O03 A;  4HX8 A;  4G7H F;  3E5U A;  1FYM A;  1KQ8 A;  4HLY A;  4CIC A;  3QRF F;  2DQR A;  3KFW X;  1IUY A;  1WSU A;  1TQM A;  3I71 A;  5HDK A;  4G7Z F;  4HYE A;  1LQ1 A;  2JT1 A;  2RKH A;  4EJV A;  5FD5 A;  1OKR A;  2FBH A;  2COM A;  4GCV A;  1ZYR F;  4OIR F;  1V3F A;  2EA4 A;  2P5K A;  4KIF A;  1U5T A;  4ZH4 F;  2FQ3 A;  4HQM A;  2VBX A;  4CDG A;  4PGH A;  4WXC A;  5FD6 A;  2JRT A;  4NHJ A;  1QNT A;  1YS6 A;  3VOD A;  4A6E A;  5LRR A;  2Y48 A;  4EM0 B;  4MHG A;  1BOA A;  1YW8 A;  1HKS A;  1T39 A;  1IN7 A;  3F8N A;  4UV8 A;  2L4M A;  1B9N A;  2DAO A;  2PEX A;  3HSE A;  4I98 B;  2FF4 A;  2A07 F;  3ABT A;  2QBY B;  3U2R A;  4KIC A;  1SFX A;  2ELH A;  2VBW A;  2B0L A;  2HKX A;  5TRD A;  1XCB A;  2QEN A;  1Z6T A;  1IN8 A;  3LWF A;  3DP7 A;  1RIO H;  1BN5 A;  2IW5 A;  2H09 A;  1J2X A;  2P5L C;  4I09 A;  3F3X A;  4P55 A;  1I1G A;  2MLG A;  2ZO4 A;  3HIF A;  3WGH A;  4G94 A;  1JHF A;  1HKQ A;  3NRV A;  1ZRF A;  3MZH A;  4MQ9 F;  3KEQ A;  1ZLK A;  4MQV A;  3BOQ A;  1TLH B;  2J5O A;  4MEX F;  2L01 A;  3LQR A;  4YFX F;  5JI6 A;  3P9C A;  5CLS A;  3QU3 A;  5DV5 A;  4HZF A;  1EH8 A;  1UB9 A;  4M9Z A;  3P7N A;  2FE3 A;  3CO7 C;  2VOO A;  4EV0 A;  4AD9 A;  5FLX Z;  3N4M A;  3WU1 B;  1MDM B;  5ICC A;  4RGR A;  3KP6 A;  4LD5 A;  2UWM A;  3GFL A;  2GA1 A;  1OMI A;  3RJP A;  3BWG A;  4XBF A;  5IT9 K;  3RYP A;  3T5X A;  3K2Z A;  2H6C A;  2ZJ2 A;  4U0W A;  4ESB A;  4KT5 C;  4HX4 A;  2TDX A;  1O3Q A;  1MJB A;  3W6K B;  1E2X A;  3F6O A;  2BEO A;  4CO8 A;  2LKP A;  3F8M A;  1IXS B;  2VE8 A;  3L00 A;  2CO5 A;  3IKV A;  3FM3 A;  4L0Z B;  5A2Q K;  3WTZ A;  2OA4 A;  1UCR A;  3DV8 A;  2Q2E A;  3CUO A;  3ERE D;  1TQI A;  2GXB A;  2HR3 A;  3ABU A;  2XGX A;  2QZ8 A;  5JFR A;  2MLK A;  2LDU A;  1FLI A;  3FZV A;  4UUV A;  5ED4 A;  5D8L B;  1ZRE A;  1KYZ A;  3ZPL A;  3JTG A;  4HF1 A;  1KQ0 A;  2OQR A;  1MGT A;  3CTA A;  3NEU A;  1H0M A;  2R3S A;  3EET A;  4HLX A;  4UVA A;  2P6S A;  1XMA A;  2ZNZ A;  4PCQ A;  2FSW A;  1SD7 A;  6PAX A;  3BRO A;  2ISZ A;  3V8L A;  3F22 A;  2EV5 A;  2LNB A;  1UHW A;  2MC3 A;  2NAZ A;  4ETS A;  4EM1 A;  4IF4 A;  3WTW C;  1F4K A;  1PUE E;  3DKW A;  3KP2 A;  2H94 A;  3WTU C;  1LB2 A;  4P5O A;  4RGX A;  5F64 A;  4RGS A;  4M6X A;  3C3W A;  3JSO A;  2XRO A;  1XGM A;  1DPR A;  4FX0 A;  5HS9 A;  1AWC A;  1DDN A;  4LJZ F;  1J9I A;  1IXR C;  3RI4 A;  1ZLJ A;  5E8G A;  2YR2 A;  1T0F A;  2GWR A;  3HSF A;  1B1B A;  2DO7 A;  4HAM A;  2WV0 A;  5DDG A;  1IF1 A;  5D5W B;  3D5L A;  1NHA A;  2FMY A;  1OYI A;  2LSO A;  4O5V A;  1H9T A;  3GFM A;  2QM3 A;  3Q5F A;  4PZJ A;  1KU2 A;  2EFW A;  1XDS A;  2M30 A;  4EJU A;  4R1H A;  5HLI A;  3MQ0 A;  3ML6 A;  4IRG A;  1FC3 A;  2FU4 A;  2K86 A;  2Z33 A;  2XRN A;  4HV6 A;  2O61 A;  5E18 F;  2Y0M A;  5CJ9 A;  2MH2 A;  1CF7 B;  4LMY A;  1G3T A;  1PP8 F;  2KJB A;  1EH7 A;  2A5Y B;  4WWC A;  2HWV A;  2LF8 A;  3I59 A;  2IT0 A;  4GGG A;  3EDP A;  1FNN A;  2QLZ A;  2RQP A;  1XGS A;  4UHT A;  1S7O A;  3KP3 A;  2HTS A;  3P9I A;  4KIG A;  2OU2 A;  5H20 A;  1JXS A;  3QOP A;  3H3U A;  4N9H A;  2PBI A;  3QPT A;  2ISY A;  2O6G E;  1HQC A;  5IT9 Z;  4G6D A;  5AIP A;  4MTE A;  2DK5 A;  4EVI A;  3Q9S A;  3LA2 A;  3JSP A;  2PMU A;  1YW7 A;  5D4S A;  3E5X A;  3GX4 X;  1S6L A;  2ZME A;  4Q48 A;  4CXF A;  3K1M A;  2M45 A;  4M6Y A;  1F1Z A;  5A2Q Z;  3GFI A;  3L9F A;  3FHZ A;  4BQA A;  4S05 A;  5LGU A;  5DCM A;  5J6X A;  3QU6 A;  3VEP A;  3G3Z A;  1HW5 A;  1YLF A;  2D2W A;  2XVC A;  1XSD A;  3KEO A;  3I4P A;  3LA7 A;  1FOK A;  4DNC A;  5L3C A;  2QQB A;  3I53 A;  1XN7 A;  4RB3 C;  3ZMU A;  2ACJ A;  1JGS A;  2DBB A;  4ESJ A;  2ZKZ A;  2EB7 A;  5L3D A;  3K69 A;  3M9A A;  4F7Z A;  4I02 A;  2ESN A;  2EWN A;  4L9T A;  3OOP A;  4ZZD A;  1BJA A;  4WF2 A;  2ZFW A;  5TJJ A;  3F23 A;  2E7W A;  1FBS A;  2XAH A;  5CVU A;  1ON1 A;  4R8H A;  1J0R A;  1W5S A;  2DFI A;  2RDP A;  1IN6 A;  1R23 A;  2HYF A;  3IHU A;  1FZP B;  2HDC A;  3ELK A;  4IHS A;  3SXY A;  1P2F A;  1W7P B;  1FBQ A;  3ROU A;  1KU7 A;  1Z6R A;  4AIK A;  1P4X A;  1E17 A;  2PJP A;  1J5Y A;  1JHH A;  2H27 A;  3HHG A;  3L7W A;  2QQ9 A;  3KCC A;  1YTY A;  4BXU A;  2UXN A;  2RGV A;  4R79 A;  2KIM A;  4P9U A;  4EJO A;  2C6Y A;  2F5D A;  2IA0 A;  5HVQ C;  2CQK A;  4LLG F;  1HXD A;  2F5F A;  4RB2 C;  1O3T A;  1S7A A;  3GWZ A;  3ZMS A;  2BBY A;  2ADU A;  4YII A;  2NYX A;  2D1V A;  1Z91 A;  3GLX A;  2AXL A;  4U88 A;  4G9Y A;  5K5O A;  4GO1 A;  1ZRC A;  1D8K A;  1R36 A;  4HX7 A;  1QPM A;  2VBZ A;  3ISP A;  1ZGA A;  3GEZ A;  2Q8K A;  1YFH A;  1K79 A;  2EK5 A;  1XGO A;  1K78 A;  3GF2 A;  1FYK A;  4YFN F;  1EH6 A;  4UV9 A;  4RS8 A;  1SD5 A;  3IRR A;  3RPQ A;  2V1D A;  3F72 A;  3KZY A;  2A6H F;  4QLC U;  3TQN A;  2WWY A;  4IHT A;  3GVA A;  4KUM A;  5LEK A;  3KLN A;  3HOT A;  4G7O F;  3TO9 A;  1QBJ A;  3MZY A;  1GXQ A;  2ZBK A;  3FM5 A;  3H3Z A;  2PN6 A;  4DQ2 A;  1BI2 A;  2RV8 A;  3GZ5 A;  3GUD A;  3O3K A;  1P4A A;  1YYV A;  2VT3 A;  3SZT A;  5CVJ A;  3VB2 A;  1ZG3 A;  4L9J A;  1BI0 A;  3HTU A;  2K4B A;  4Y17 A;  1K6O A;  2VC1 A;  2P6T A;  4MTD A;  3R60 A;  4YFK F;  4M9X A;  1WI9 A;  1I6X A;  1X3U A;  4KA4 A;  3F8F A;  3TGN A;  4CYD A;  4I01 A;  4UVC A;  3WTX C;  1U2W A;  4P96 A;  2CYY A;  4ENM A;  1Q1H A;  1G6N A;  5HOO A;  1YS7 A;  2HS5 A;  1OYW A;  4NB5 A;  2L3D A;  1QGP A;  2FBK A;  3S2W A;  3J81 K;  2PQ8 A;  5J8F A;  4Y15 A;  3IC7 A;  4WX9 A;  1ULY A;  5D6E A;  1O3R A;  1D3Y A;  3CUQ C;  3ZQ7 A;  2Y75 A;  4P9F A;  2DU9 A;  1XD7 A;  5BPD A;  1IZ1 A;  1W7P A;  4G8X A;  5D5X B;  3Q9V A;  2Z99 A;  3GZ6 A;  3CUQ A;  3JTH A;  2W84 A;  1Z1D A;  3F21 A;  3HRU A;  4GYG A;  2XV4 S;  4L5J A;  1I1S A;  5KK1 A;  3K1P A;  2K27 A;  1ZN2 A;  1ZGJ A;  1R7J A;  3WTV C;  2ESH A;  2VOD A;  4XSZ F;  2IJL A;  5HLH A;  5ICE A;  4IXA A;  3QP5 A;  3HSR A;  4KMU X;  2BYV E;  4LK0 F;  2QVO A;  4EJT A;  3GYH X;  3LFK A;  4ASN A;  3HUG A;  4AIJ A;  2FML A;  2OBP A;  4N9I A; 
#chains in the Genus database with same CATH topology
 1R5G A;  1X2N A;  1T2K A;  1VTN C;  1SVO A;  4HQE A;  1BJZ A;  3HOX J;  4P1W A;  4N4N B;  4LB5 A;  1R58 A;  1LEA A;  2CV2 A;  5FO5 A;  2YX4 A;  3CCL I;  5J3L A;  2LYC A;  4C2M J;  3I59 B;  2DMP A;  5FJ8 J;  2K02 A;  2FUG 2;  1BC7 C;  3BTC A;  3TDZ C;  2DCE A;  4XOR A;  1WJD A;  5F1J A;  4B3A A;  2FNP A;  1UST A;  3RKY A;  2BE5 F;  2HXO A;  2KKO A;  2V6E A;  4A2U A;  5EEG A;  4MLO A;  4DGW B;  2HPM A;  2M0C A;  4IX7 A;  3I55 I;  1WWX A;  2TCT A;  2VJJ A;  2R5Y B;  4ZDL A;  1LVK A;  3AG1 H;  3OYD A;  3R6S A;  3ERM A;  2VXZ A;  1FIP A;  3HOZ J;  2IS4 A;  2K7L A;  3PIP F;  4Y52 J;  1DUX C;  3DWL E;  3IH4 A;  5D5U B;  2XAJ A;  4FE4 A;  2BGC A;  1Z3X A;  2WC2 A;  3TP3 A;  2X1C A;  2R7Z J;  3J81 R;  3TDU C;  1D0X A;  1S29 A;  2A3S A;  1OPC A;  2EFN A;  2NS0 A;  5E1X A;  2VE9 A;  1UG2 A;  2BY1 A;  3FX3 A;  1TWG J;  3L2Q A;  3HM5 A;  2EIM H;  4M3E A;  2AQE A;  3V7S A;  4CZC A;  1I50 J;  2GOM A;  1IN4 A;  1P4W A;  4XLE A;  1F5T A;  1V55 H;  4FAS D;  5ERI A;  3WTT C;  4KDP A;  4YG2 F;  4C3H J;  1MJA A;  2ZME B;  2R5Z B;  4OIO F;  1ZTR A;  4OIQ F;  3KP4 A;  4MEY F;  4NDL A;  1FT9 A;  5HNF A;  2IPQ X;  3HPG A;  2P7C B;  3GTM J;  1KGS A;  1XSV A;  3DLL F;  1ZG1 A;  4HNT A;  1EKE A;  3NQO A;  4O6J A;  3RYR A;  1HLV A;  2VPR A;  2EV6 A;  2M0M A;  5DCM B;  1G4D A;  3O2P E;  3ZOB A;  3BR3 A;  3IWF A;  5DM6 F;  2JK3 A;  1MNE A;  5TGT A;  2L9N A;  5BS6 A;  4B8X A;  1T95 A;  2KHM A;  2YX7 A;  3SYT A;  3CO6 C;  2E5N A;  2UXX A;  2HEO A;  4RLQ A;  2ZXI A;  3G2B A;  2V1X A;  4X6A J;  4S04 A;  3HB9 A;  4MNU A;  2P0W A;  3L1P A;  4PUS A;  2VIX A;  3VOE A;  1OCR H;  4E4H A;  3RIR A;  2VPL A;  2ZNY A;  2LVS A;  3E6B A;  1BOB A;  5LGT A;  4GXO A;  3R0J A;  3RZD J;  1EV7 A;  4AYB A;  2HOT A;  1I27 A;  1OYY A;  2DYS H;  5KAI C;  2E1O A;  2HTJ A;  4D0P A;  1QPI A;  1YG2 A;  3IWZ A;  4JX5 A;  1XCV A;  1PJR A;  4ZTJ A;  2VKE A;  3FK7 A;  1U9N A;  4BE0 A;  3GW2 A;  1ZG5 A;  3J7Z I;  3E6D A;  5GAE J;  5E3O A;  2EIJ H;  4NC8 A;  4WK8 F;  3FXK A;  4OMY A;  3T8T A;  1B59 A;  4LIV A;  1K7A A;  4A12 A;  3CCQ I;  2YU9 J;  1G3Y A;  4L9N A;  3K0L A;  2MUN A;  2NS7 A;  1G59 A;  1D1C A;  4II3 A;  1GT0 C;  1B72 B;  2Z9O A;  3FBI B;  4XLF A;  2A68 F;  3GO5 A;  2RC4 A;  1A5J A;  2V6C A;  4A3I J;  3MKY B;  4O3M A;  2R0Q C;  5GPA A;  4ENN A;  2BY3 A;  3U1K A;  4B47 A;  2YUS A;  1TL8 A;  2MA3 A;  2J5P A;  2RQQ A;  4BQQ A;  2K9N A;  3BZK A;  3LAP A;  3OYG A;  3A0B C;  1HW1 A;  2IGN A;  3DQV C;  4C2U A;  2JQ7 A;  2DLL A;  2DN0 A;  3KE2 A;  5J8C A;  2QQ8 A;  2DK8 A;  5EGO B;  1WHU A;  1W4M A;  1RUN A;  2OAZ A;  3Q0U A;  3D1N I;  1T38 A;  2L0K A;  1DP7 P;  2LKS A;  2JA5 J;  1JE8 A;  5HS8 A;  1ZAR A;  4N4O B;  1FP2 A;  3QWL A;  3BJA A;  4HW0 A;  2IXS A;  1QHH D;  3T1B A;  3IL2 A;  4IPA A;  3DTI A;  4CCL A;  1D8J A;  2P4W A;  2QSG X;  3AAF A;  3DLA A;  1VQP I;  1W5T A;  3I64 A;  5CVI A;  2NS8 A;  5L3G A;  1Y39 A;  4U7D A;  1U8R A;  4XON A;  3VSL A;  4BDZ A;  1UAA A;  3OR2 C;  3MMY B;  2Z16 A;  5KAF C;  2Y0S A;  1GVD A;  2K40 A;  4AYB N;  3PL8 A;  3GZN B;  2STT A;  2L7Z A;  2DQL A;  3MFK A;  2XPU A;  3TMO A;  2KZV A;  3KPH A;  3KZZ A;  1R00 A;  1Z9C A;  3HHH A;  2R5Y A;  2KDZ A;  1RC9 A;  1WRJ A;  4BHC A;  2DOE A;  1K4T A;  5LLQ A;  1LJ9 A;  2MSY A;  3CC2 I;  3TOA A;  4EQQ A;  3LSG A;  1S8N A;  1I3A A;  3W2W A;  5GAG J;  2X98 A;  2PMH A;  4AIH A;  2BY0 A;  3H35 A;  1T98 A;  1KU9 A;  2WY7 Q;  5KVR A;  3K7A J;  4M3F A;  1VQN I;  4A3M J;  1X1P A;  2H6B A;  3LSM A;  3TO6 A;  2VXD A;  1WJF A;  1B6A A;  1RET A;  1FSH A;  2CWE A;  5AON A;  4JK1 X;  3ZMT A;  3FXQ A;  2MC4 A;  3R0A A;  3HL2 A;  4UB6 C;  2FXA A;  5LHG A;  2MH9 A;  5D6F A;  5J4Y A;  1MZB A;  2CSO A;  2I10 A;  2R5Z A;  3I54 A;  2VKD A;  4XSX F;  3MZ8 A;  1K78 B;  4II2 A;  4LLL A;  4MIM A;  1TP4 A;  4GDF A;  4CGZ A;  4JBA A;  2X51 A;  1UZC A;  3BPX A;  4W97 A;  1R5I D;  4KN7 X;  4ZYE A;  3HOV J;  1R1U A;  3SFI A;  1WJA A;  3L2R A;  2JSP A;  1IN5 A;  2WB1 A;  5HOD A;  2E34 A;  1Z67 A;  3JRF A;  5ILV A;  5AIQ A;  3HOY J;  5HLG A;  1PP7 U;  2VOP A;  2KIU A;  2A6T A;  5H6Q A;  2BW3 A;  1MMD A;  1JJ8 C;  4AVP A;  2W85 A;  2CW0 F;  3LQQ A;  4X1E A;  1AHD P;  3HOW J;  3FMR A;  2E5Z A;  2B9S A;  5F0C A;  2VN2 A;  1FWZ A;  4L5I A;  2L9R A;  3WTY C;  1HDP A;  2EZI A;  3K4L A;  4IVN A;  3I4M J;  1V4R A;  3J80 K;  2CFO A;  1SD4 A;  5JVT A;  5IP6 A;  1USS A;  3BJ6 A;  3F8B A;  4BU2 A;  2EFP A;  2HYG D;  1V54 H;  2E1N A;  2HZT A;  5KNL A;  2ZB9 A;  2JPB A;  1R5H A;  2E60 A;  3A0H C;  4BY1 J;  5BQT A;  1IXC A;  4OU0 A;  3LSR A;  4KIB A;  4LG3 A;  2ME0 A;  1LFU P;  1IUF A;  2W7N A;  3EUH C;  1LDJ A;  2EBI A;  3HPH A;  2DTR A;  1RI7 A;  3DBR B;  4U0Y A;  4HF2 A;  2OCE A;  1B72 A;  3C2H A;  2CQQ A;  2F2E A;  3DPL C;  4IQJ A;  1YE9 A;  3RKX A;  2XKO A;  3H5A A;  5BMZ A;  3HKZ N;  5E3N A;  3EUH A;  3FXU A;  4BHB A;  3WG9 A;  4XKV A;  1P9Q C;  3A1Y A;  3OR1 C;  1R6R A;  2M7A A;  1TW3 A;  2F4M B;  1ODD A;  2L7K A;  4XID A;  2V1U A;  3M7G A;  3WU2 C;  2ECC A;  5J47 A;  1BI1 A;  1JTY A;  1HA8 A;  4BH9 A;  2DT5 A;  1L3L A;  3T0Y A;  2WB1 N;  4EGY A;  3BDD A;  2K4J A;  1A6Q A;  5K5Q A;  2QWW A;  2HQR A;  2XB0 X;  1BIB A;  2JUG A;  2L02 A;  4K2E A;  1QHG A;  1RRJ A;  1GUU A;  2H1K A;  3I9V 2;  1WJC A;  3U1D A;  2L7F P;  3LSI A;  5DYM A;  2MZ4 A;  4LB6 B;  2K9S A;  3GCM A;  4LG0 B;  2G7H A;  2QYO A;  1ZAO A;  5CQG A;  1P92 A;  1HF0 A;  4BXF A;  3JCU C;  4OWR B;  2GM4 A;  3KIO A;  3CLQ A;  3ECH A;  3ABK H;  3CUQ B;  2MVT A;  2HVR A;  1HST A;  1OR7 A;  1Y1V J;  3DEU A;  2XIG A;  4NQW B;  2VJ5 A;  1S9H A;  2OUM A;  1D0Z A;  2JSC A;  2QEX I;  1JJ6 C;  2RN7 A;  4D5C A;  4ENJ A;  1L0O C;  3PIO F;  1FMW A;  2RNJ A;  1DP3 A;  1RPW A;  1SVM A;  4XMY A;  3V4G A;  2HDD A;  4B4C A;  2QCO A;  1WVR A;  4U7B A;  1K61 A;  2DDA A;  2IRF G;  3L2C A;  4HNV A;  1FTZ A;  5CVV A;  3FMQ A;  2W24 A;  2KT0 A;  1IGN A;  3QYE A;  2CV0 A;  2DOF A;  2XC7 A;  4M73 A;  3E97 A;  3OSG A;  1PVE A;  3CLO A;  2K3P A;  5BPI A;  2RVC A;  1LDD A;  3O8H A;  4D1Q A;  1LFP A;  1P7I A;  1F9N A;  3CMA I;  4RA2 A;  3CMM A;  1ZHF A;  2EFQ A;  2PJR B;  2HU9 A;  3SEZ A;  3H1C A;  4M74 A;  5L3B A;  1FP1 D;  3FDY A;  5ICF A;  1ZQ3 P;  2NXN B;  2WAF A;  4M3D A;  2ZXJ A;  2QQA A;  5F27 A;  1ONV A;  2KFD A;  1PDN C;  3CJT B;  1NG6 A;  4Q5S F;  2V1N A;  3HUG B;  4A3D J;  3H92 A;  1QVU A;  1SMT A;  3BCA A;  5GAH J;  2OC6 A;  2FOW A;  4PDK A;  2BXY A;  4A5N A;  2HQ5 A;  3CMY A;  3J80 R;  1D0Y A;  4XIC A;  3DXJ F;  4Y3O A;  1JUS A;  2E1M C;  2IP2 A;  1ERD A;  3PQJ A;  4ON0 A;  3PQK A;  3E7L A;  1ZH5 A;  2IS2 A;  2P8T A;  2F5V A;  5GTH C;  3S17 J;  1ETW A;  2EIK H;  3DPU A;  2ID6 A;  2JTV A;  4RGU A;  2PI0 A;  3RPU A;  1FIA A;  1HKT A;  2VBY A;  1MMN A;  1U5T C;  3BTL A;  3V7R A;  2XF7 A;  3V8J A;  2NOG A;  3PFI A;  1JI8 A;  4B3X A;  2HNH A;  1R1T A;  3BP8 A;  4IQ4 A;  3GXO A;  4XR6 A;  3JRA A;  1IAW A;  4ZDO A;  1FEX A;  2OJE D;  4RB0 A;  3J7A W;  3CCS I;  3HGG A;  4Q4Z F;  3JRD A;  2NVX J;  3ZXS A;  2X85 A;  5IY5 H;  2XAU A;  2EIL H;  2CW7 A;  5J1Y A;  4L0Y B;  3GME A;  5JHU A;  1VQ6 I;  1S7E A;  3QP6 A;  4XN3 A;  1QZZ A;  1IV6 A;  4L9V A;  4EJW A;  4YRV A;  3K10 A;  1JGG A;  4ESF A;  4FE7 A;  4CCJ A;  3W3C A;  1HOM A;  2PFB A;  1UMQ A;  1RKW A;  1R4N B;  3WE2 A;  1IRF A;  1A36 A;  3SFZ A;  1XMK A;  3DF8 A;  2IGO A;  4QPQ A;  1Z7U A;  4F52 A;  2ETH A;  2VC0 A;  1VQK I;  3S1N J;  3ASN H;  2MD5 A;  1T6S A;  4YIF A;  4KT6 A;  5F08 A;  1ZK8 A;  2D45 A;  1SMY F;  1STZ A;  1RR7 A;  2O9L A;  1BM9 A;  1LNW A;  4HV5 A;  3K9T A;  3WGG A;  2CFX A;  2M9H A;  4A93 J;  2PG4 A;  1Z05 A;  2O5R A;  1V5F A;  4I76 A;  3N05 A;  2WV1 A;  1R22 A;  2XF6 A;  4CZZ A;  2ZFU A;  2KIS A;  3ZN1 A;  5ILU A;  3IH3 A;  2WTE A;  3OV8 A;  2ICW G;  3SZP A;  5DTD A;  1R4M B;  4A3K J;  5FRN A;  1QO0 D;  4RAY A;  5FFZ A;  5B1B H;  5E17 F;  1OIS A;  2NNN A;  3MKL A;  3WE3 A;  2FBI A;  3BG9 A;  3NWS A;  2GXG A;  5LEJ A;  2DA5 A;  2IVM A;  3LFU A;  4KN4 X;  4D5F A;  3J80 Z;  4LG0 A;  4WXH A;  1YJW I;  2OZ6 A;  2OTL I;  1LVA A;  2NNY A;  2KJC A;  4XNF A;  3E6M A;  3KEY A;  3CCM I;  1X2M A;  4U0V A;  3ABM H;  1C0W A;  3BY6 A;  4NQW A;  1VI0 A;  2OQG A;  3BZ6 A;  3A52 A;  1I39 A;  1EF4 A;  2VKH A;  5K5R A;  4AU7 A;  2DPU A;  4BE2 A;  3K4J A;  2CMP A;  2XDV A;  3C1D A;  4IKF A;  3COA C;  2MBF A;  5D8K B;  2PLY A;  3MCZ A;  2DFH A;  2ECB A;  5CVR A;  3W6V A;  5HDG A;  1F36 A;  4PGG A;  4DBR A;  5IT3 A;  3OYL A;  5LFA A;  1KQ9 A;  3SDG A;  4A0X A;  2NRA C;  4LGW A;  1B9M A;  2BVM A;  3IAS 2;  3N97 A;  5DD4 A;  1HDD C;  4D7M A;  4OIP F;  1MD0 A;  2DYR H;  1I5Z A;  4EMS A;  3HOS A;  2P5V A;  3I5U A;  5B3S H;  2PJR A;  3WU0 A;  2Y69 H;  3QAH A;  3HRT A;  2Z5U A;  4XN0 A;  4E7Z A;  2E1C A;  2V9V A;  1WKM A;  2UUZ A;  3E3V A;  1LEB A;  5CKT A;  3BR0 A;  4ANJ A;  1NG7 A;  1GVJ A;  1MJ9 A;  4BKX A;  1BI3 A;  4E7S A;  2H8R A;  4DOZ A;  3ZRG A;  4C3J J;  1IO2 A;  2HXI A;  2XAQ A;  2FX0 A;  2DOD A;  1X1D A;  2XUB A;  2XPV A;  2QSH X;  3VFZ A;  4RAZ A;  4HST A;  1JT6 A;  3M8E A;  1YRN B;  4CSW A;  3MEX A;  3MD2 A;  4CH7 A;  2GAU A;  2BV6 A;  2M8E A;  2K3F A;  3S3M A;  2HZD A;  2DMQ A;  2W57 A;  1HW2 A;  1SAX A;  1S5L C;  2KRF A;  3CCE I;  2Y9Y A;  1TNT A;  4H0E A;  4XOT A;  4ABZ A;  5GAD J;  5E8I A;  2CV1 A;  4KYW A;  1NK2 P;  1RNL A;  5F6F A;  5L3F A;  3OWT A;  3REO A;  4J01 A;  5DM7 F;  3RDI A;  3U9G A;  2XKP A;  3QQA A;  2L4A A;  4IRI A;  5ILS A;  1H9G A;  3FIW A;  4EGZ A;  2NVT J;  4CA0 A;  4GFB A;  2DMN A;  3D0S A;  3ZQG A;  1G3W A;  4QSH A;  1ZRD A;  4UVB A;  3SQN A;  1UHM A;  2QUF A;  2R7T A;  3GLL A;  3CCV I;  3KLO A;  4BNC A;  4OAZ A;  4J19 A;  4LIU A;  2VAS A;  1VQ8 I;  4B44 A;  3ZP5 A;  4HEA 2;  4AC0 A;  1KYW A;  2D1H A;  2G7U A;  4IJA A;  2GBY A;  1LDK B;  1Y0U A;  3HYI A;  3K4B A;  2R7R A;  3S1R J;  4XLP F;  3RZO J;  1Q1V A;  2L54 A;  4PJJ A;  1WJE A;  2IBD A;  5E3M A;  3B73 A;  3ZCO A;  1T08 B;  1QQI A;  4ZDP A;  1I3Q J;  2Y31 A;  2CH0 A;  3CP8 A;  4NUB A;  1GV5 A;  4B09 A;  2IS1 A;  4BJT A;  1Z3Y A;  1TBX A;  1ON2 A;  2LMD A;  1OCP A;  3GTO J;  3AG2 H;  2CRG A;  2V79 A;  1TW2 A;  2W48 A;  5J1R A;  2ZJR F;  2JWT A;  4FT8 A;  5CQE A;  3G73 A;  3IUO A;  3BLY A;  4L18 B;  5EF6 A;  4IRH A;  2Q0O A;  2QBY A;  2VJ4 A;  2Y2Z A;  2CUE A;  3TOB A;  2WBM A;  2EA2 A;  2M5W A;  1ZKG A;  4A3E J;  3MWM A;  3DKY A;  2UZK A;  3F8C A;  2ID3 A;  1MSF C;  5FRO A;  1M1E B;  3HTS B;  1DPU A;  1U78 A;  4ENK A;  2KDO A;  2JPC A;  3CJQ B;  4OOI A;  3HRS A;  1FJL A;  3IV5 A;  3LST A;  1IRG A;  4Y13 A;  4ZYH A;  2HVQ A;  4XL9 A;  3W6J B;  4F92 B;  3DPT A;  2BW3 B;  2M2E A;  2GA2 A;  4I0B A;  3S1Q J;  3VYU B;  1I6H J;  3CJN A;  1BR1 A;  3MAJ A;  4OMZ A;  2R7D A;  4RB1 A;  1SFE A;  3LSP A;  3K70 D;  4E70 A;  3KP5 A;  1FX7 A;  2W82 A;  3J7A O;  1REP C;  3H5R A;  2X6Y A;  3S3O A;  1S3J A;  5C44 J;  2KL4 A;  5GP9 A;  4HDU A;  3M8F A;  3JRG A;  1W1W E;  2A61 A;  2JZY A;  3R61 A;  3QPH A;  2VLA A;  2K5C A;  1SC7 A;  3AL0 C;  3BJO A;  4XLC A;  2HFH A;  4BHP A;  2X4H A;  3FXR A;  1T0F C;  5LGN A;  2RRE A;  3G6E I;  2KRC A;  2XB5 A;  4BAY A;  1O3S A;  3BR5 A;  4RBO A;  1BBY A;  4F93 B;  2W25 A;  1YIO A;  2DFF A;  1YW9 A;  3FF5 A;  5JR3 A;  1VQ7 I;  1MKM A;  9ANT A;  2CUJ A;  5FB2 A;  3B6C A;  4I0A A;  5EEH A;  1KU3 A;  3IP4 B;  3TO7 A;  3JRI A;  2R7U A;  2M1B A;  2LK2 A;  3BPV A;  5CPR B;  3KYC B;  2F5C A;  3ZMD A;  4UXN A;  2OD5 A;  2A05 A;  2Z3Y A;  1KA8 A;  4RM3 A;  1FYL A;  5HS7 A;  3OYJ A;  2M8G X;  3JAM K;  3EQL F;  3OS0 A;  4CCK A;  4XRF A;  2L9V A;  1SFU A;  2CG4 A;  4S0H B;  2LLK A;  2LP0 A;  1TT5 B;  2DW4 A;  1J75 A;  4A3G J;  2FA5 A;  3FWE A;  3J81 Z;  1J59 A;  4QWQ A;  2FJ1 A;  2FOK A;  1X1C A;  1MDM A;  4ZZL A;  4BXX J;  2DPD A;  5BOX A;  3J7Y J;  1FY7 A;  4MFE A;  1O57 A;  4HDV A;  2P7V B;  5L3E A;  5DUI A;  4BE1 A;  4XK4 A;  4WXD A;  1YRN A;  3RKW A;  2VKV A;  2IA2 A;  3LSH A;  3CP2 A;  4ZTF A;  1MND A;  2EJR A;  5LRS A;  1ZR4 A;  4IHW A;  3EPZ A;  4BEH B;  2QA4 I;  4KMF A;  2ZCW A;  2X6X A;  2HGC A;  2QKM B;  1U6G A;  2CGP A;  1AOY A;  4AWX B;  4XKB A;  3CDH A;  4W1U A;  4BDY A;  2V9K A;  4IHX A;  2DDB A;  1HSJ A;  4PSW A;  5DCF A;  1TQP A;  1R1V A;  4CHU A;  2DMT A;  2BVL A;  5FKM A;  2WAD A;  4A5M A;  2R93 J;  2HOE A;  4HOB A;  4FX4 A;  4Y7N J;  1IG7 A;  1D5Y A;  3EYI A;  5HLT A;  3ZQQ A;  4OIN F;  1PUF A;  3ULQ B;  2GLO A;  2XAF A;  2VT2 A;  1U3E M;  2JA8 J;  3U21 A;  4EM2 A;  2VON A;  1MMS A;  3OYA A;  1JKO C;  3DFG A;  2GIV A;  5LHH A;  3KET A;  3I58 A;  2XHK A;  1HC8 A;  1XPX A;  4N0B A;  3ZMZ A;  3CC4 I;  4FCY A;  5EYR A;  3H3V K;  1J7K A;  1TTY A;  3GFJ A;  2K9Q A;  5DUK A;  2DXI A;  4A6D A;  2XAG A;  2LOO A;  4Z2Y A;  3MN2 A;  4ZYD A;  3MKZ A;  1MBH A;  2X1E A;  3OOU A;  2W4S A;  2X0L A;  4HF0 A;  3V7C A;  3E5Q A;  2R7F A;  1OLT A;  1AKH B;  1E3P A;  2XRL A;  2KIF A;  2YPR A;  5FFX A;  1IDZ A;  4BBS J;  4TV7 A;  1D5V A;  3M1E A;  4LK1 F;  1XDU A;  2LF7 A;  4HBL A;  3HKZ A;  4JX6 A;  3ECO A;  3H0D A;  2LY9 A;  4ZYG A;  1FPQ A;  2X48 A;  3M4O J;  2HYJ A;  2ZJQ F;  2DI3 A;  1HBX G;  3FXJ A;  4Q47 A;  1B8I B;  2MGQ A;  3DBH B;  5E20 A;  2ZME C;  5IOY A;  2DA1 A;  3K4M A;  1N78 A;  3K2A A;  1OCO H;  4J00 A;  1RR8 C;  3VWB A;  3C18 A;  2A6E F;  4XLN F;  1YO5 C;  1XGN A;  2LC2 A;  2YS9 A;  2WAE A;  1FOY A;  2HKO A;  3K1N A;  5H6R A;  2E1M B;  2EV0 A;  2JJ7 A;  3OYI A;  4PFP A;  4AID A;  1G3S A;  2E36 A;  4WCG A;  3OS2 A;  2LH9 A;  3VPR A;  3WG7 H;  3TKY A;  4KNY A;  3OYC A;  5F1R A;  1KZH A;  2OPT A;  2F5E A;  3FMS A;  2RAE A;  3PO3 J;  1U5T B;  4BY7 J;  3JAM R;  2HQA A;  1MH3 A;  5KHD A;  2PMZ N;  2VUM J;  4M9S A;  4A0Z A;  1FSE A;  3WGI A;  1O7F A;  1P6R A;  4XRM A;  4KFC A;  4I2O A;  1DGW Y;  4LLN A;  2JA2 A;  4UNO A;  1XB4 A;  3HRM A;  3B6A A;  1W5C C;  1JT0 A;  4JX4 A;  2YU3 A;  2AO9 A;  1Z21 A;  3F6V A;  1GXP A;  2G9W A;  2A69 F;  5CYV A;  3BG3 A;  3PNT A;  5J4V A;  2IAI A;  2G0E A;  3ZMV A;  3WTS C;  3KP7 A;  2FRH A;  2Z1D A;  1CGP A;  3QOD A;  3CJR B;  3QPS A;  3QYB A;  4UY8 I;  4LFU A;  3WOD F;  4HA8 A;  1WFX A;  3DTE A;  3G71 I;  4I7H A;  2KZG A;  5FGM A;  3L09 A;  5JHF A;  3DEW A;  2OTJ I;  1YQA A;  2O3F A;  1IW7 F;  2CQ7 A;  1W7P D;  1W0T A;  3JW4 A;  3K70 C;  3H0G J;  2BY2 A;  3FHN A;  1AU7 A;  2YSR A;  5DEQ A;  1UFM A;  3ZQC A;  1A04 A;  5K1Y A;  2KIQ A;  2WAQ A;  4Z6Y A;  2E2H J;  3WHC A;  1TWH J;  1DU0 A;  5D4R A;  3S14 J;  1N75 A;  5D5V B;  1ETV A;  5DD8 A;  1O7L A;  1TNS A;  3Q0V A;  3IRQ A;  5FLX K;  5IP9 J;  1FMV A;  2P81 A;  1BC8 C;  4B43 A;  4YEJ A;  2DJI A;  2HQN A;  1TWF J;  2XAS A;  5EDN A;  2X6O A;  1ETY A;  1QZY A;  3O6B B;  4BEH A;  2E7X A;  2ZXW H;  3B02 A;  2IA1 A;  3A03 A;  5E1Z B;  4G6Q A;  4M72 A;  3ZN0 A;  3NAU A;  5EZG A;  2W1O A;  2I8D A;  1XSX A;  5LBQ A;  3E6C C;  4MGR A;  3IKT A;  3R4K A;  4RM2 A;  4RLF A;  2VJI A;  2STW A;  4IL6 C;  1FBU A;  3AG3 H;  4EAT A;  5H2F C;  1JUP A;  5JLX A;  1WGX A;  2H8W A;  1IJW C;  3E0J B;  1SAU A;  3CCY A;  1T8I A;  2F4O B;  1CF7 A;  1YIJ I;  1D1A A;  1BR4 A;  3S2D J;  2E35 A;  4LIT A;  5M5X J;  1V5G A;  2JVG A;  3BQY A;  3QPL A;  1B4A A;  3LAJ A;  3LSK A;  3C7J A;  2XSJ C;  3KZI C;  2AS5 F;  1E0E A;  2O0Y A;  3LA3 A;  4C2T A;  3AFH A;  1Y0N A;  2OZU A;  3V8K A;  3W2V A;  4BYY A;  1GHC A;  1NH3 A;  4CCM A;  2FNA A;  1RQ6 A;  3EYY A;  3P9K A;  3JAM Z;  4FHT A;  3D5R C;  4GYI A;  5E1W A;  5LHI A;  2ELJ A;  2CS3 A;  2GZW A;  2EZL A;  2EZH A;  1YIT I;  4A0Y A;  4CCN A;  4C30 A;  5IYC J;  1BIA A;  3JRH A;  1QA6 A;  3I0T A;  2FEZ A;  3RTR A;  2EZK A;  4KIS A;  2EFO A;  3BG5 A;  3VYT B;  2M35 A;  4V2G A;  1MBK A;  2DA2 A;  2ELK A;  2K9M A;  2ZJP F;  2M87 A;  2EPF A;  1WQ2 A;  2O8X A;  1H8A C;  1AKH A;  3Q0W A;  3VDX A;  1RUO A;  2WAQ N;  5HDN A;  4M71 A;  3T8R A;  2K85 A;  3SHF A;  1RZ4 A;  3J7A Y;  1SD6 A;  4JQF A;  1TZL A;  2GQQ A;  5ICG A;  2ZSH B;  2O03 A;  4HX8 A;  4G7H F;  2N8G A;  3E5U A;  1FYM A;  1B8I A;  1KQ8 A;  3PSF A;  4HLY A;  1VF9 A;  4CIC A;  2LBF A;  1MW7 A;  1YX3 A;  3QRF F;  2DQR A;  3KFW X;  1IUY A;  2CQN A;  3DTK A;  1WSU A;  1TQM A;  4NC6 A;  3I71 A;  5HDK A;  4G7Z F;  4HYE A;  3HG9 A;  1LQ1 A;  2JT1 A;  2M7B A;  2RKH A;  2BOL A;  2F6C A;  4EJV A;  5FD5 A;  3OMY A;  2ZXH A;  2WY8 Q;  1OKR A;  2B7E A;  2COM A;  2FBH A;  2MD0 A;  3MVP A;  2P0T A;  4LOC A;  2R7X A;  4GCV A;  1VZ0 A;  3FKI J;  5IYD J;  5K7Z A;  1ZYR F;  4OIR F;  1V3F A;  2EA4 A;  2P5K A;  4KIF A;  1U5T A;  3RCO A;  3BG6 A;  2FQ3 A;  3LOC A;  4HQM A;  4ZH4 F;  4IO9 F;  1OCC H;  2VBX A;  4CDG A;  2JMW A;  4PGH A;  1IDY A;  4WXC A;  5FD6 A;  2I5U A;  3OIP A;  2JRT A;  3TW6 A;  1A31 A;  4NHJ A;  2L9S A;  4KJZ A;  3OS1 A;  1QNT A;  1YS6 A;  3BR6 A;  3VOD A;  3GTP J;  2XGE A;  4A6E A;  2MFZ A;  2MW8 A;  5FLX R;  1FOW A;  5LRR A;  4ZJZ A;  2R4G A;  2Y48 A;  4EM0 B;  4MHG A;  1BOA A;  1YW8 A;  2KP6 A;  1HKS A;  2DOA A;  1T39 A;  5F04 A;  4BJ6 C;  3L2W A;  1IN7 A;  1X58 A;  4MFD A;  1VQO I;  2F4I A;  3ZR8 X;  2XSD C;  5FRM A;  3F8N A;  2K9L A;  4UV8 A;  2L4M A;  3P5J A;  1B9N A;  2DAO A;  2PEX A;  3HSE A;  1YJN I;  4I98 B;  3I4N J;  2FF4 A;  1XC5 A;  2A07 F;  3ABT A;  2QBY B;  1IRZ A;  2LY1 A;  3U2R A;  4KIC A;  5DS9 A;  3ONQ A;  1SFX A;  1ITY A;  2ELH A;  2VBW A;  2B0L A;  3X2Q H;  2HKX A;  5TRD A;  1XCB A;  3JR9 A;  3HBL A;  2QEN A;  2JVH A;  1Z6T A;  3PNY A;  3NAR A;  1IN8 A;  2DT7 B;  3LWF A;  4PK4 A;  3DP7 A;  3PJR A;  2PX9 A;  1RIO H;  1BN5 A;  1ENH A;  2V7F A;  1KON A;  1VND A;  2FQ4 A;  5EEA A;  2KLO A;  2IW5 A;  2VQC A;  1FTT A;  3S15 J;  4I6Z A;  2H09 A;  1UHS A;  3DBL B;  3PFY A;  1J2X A;  1VQ9 I;  4RMN A;  2P5L C;  1BW6 A;  4I09 A;  3F3X A;  4P55 A;  1I1G A;  3V42 A;  1LE8 B;  2MLG A;  1QVT A;  1BW5 A;  4XKW A;  4A3B J;  2ZO4 A;  3HIF A;  1R9T J;  3GTK J;  3S93 A;  4G94 A;  3WGH A;  3HOU J;  1JHF A;  1HKQ A;  3NRV A;  1S72 I;  3BTJ A;  1ETO A;  2QGU A;  1YI2 I;  1ZRF A;  5F0H A;  3MZH A;  2HPI A;  4MQ9 F;  2EQR A;  3AL0 B;  1G2H A;  3A2K A;  3KEQ A;  1IC8 A;  1NTC A;  1ZLK A;  4MQV A;  3OYB A;  3BOQ A;  2QSF X;  1TLH B;  2J5O A;  4MEX F;  4FQG A;  2L01 A;  3LQR A;  4YFX F;  4D9J A;  5JI6 A;  2R7V A;  3P9C A;  5CLS A;  5FLM J;  3CCJ I;  3QU3 A;  5DV5 A;  4HZF A;  1EH8 A;  4C3I J;  1UB9 A;  5IOZ A;  2GOX B;  4M9Z A;  3P7N A;  5J40 A;  2FE3 A;  3RKQ A;  4BBR J;  3CO7 C;  2VOO A;  4EV0 A;  4NC7 A;  1R49 A;  4AD9 A;  5FLX Z;  3N4M A;  3WU1 B;  2LTP A;  4B48 A;  1MDM B;  4BUP A;  5ICC A;  4RGR A;  3KP6 A;  3TBI A;  4LD5 A;  2HVS A;  2UWM A;  2HDW A;  2GA1 A;  3GFL A;  1OMI A;  3RJP A;  3BWG A;  4XBF A;  5IT9 K;  3RYP A;  3T5X A;  3K2Z A;  2H6C A;  2ZJ2 A;  4U0W A;  1UG0 A;  4ESB A;  1VFC A;  4KT5 C;  4HX4 A;  3A01 B;  1W0U A;  2KRH A;  2TDX A;  1SFK A;  1O3Q A;  3VSK A;  1MJB A;  3W6K B;  1X1B A;  1E2X A;  3CF2 A;  3FXO A;  3F6O A;  2BEO A;  1MNM C;  4CO8 A;  3GTL J;  4C9Y A;  2DA7 A;  2LKP A;  5J1U A;  3ZQF A;  3KYL A;  3F8M A;  1IXS B;  2IS6 A;  2DA6 A;  2VE8 A;  3L00 A;  2CO5 A;  3IKV A;  3FM3 A;  3S16 J;  5M3M J;  2JA7 J;  4L0Z B;  5A2Q K;  3I56 I;  1H89 C;  1OFC X;  3WTZ A;  3TED A;  1SEU A;  2OA4 A;  1UCR A;  3S8P A;  2M4K A;  2VQH A;  3VYS B;  3DV8 A;  4BL0 B;  3CDI A;  2HI3 A;  1PUF B;  2Q2E A;  1Y6I A;  3CUO A;  5E79 C;  4NNJ A;  1T56 A;  3ZQH A;  1YJ9 I;  3BR1 A;  3ERE D;  1TQI A;  2EH3 A;  2GXB A;  4V2F A;  2HR3 A;  3ABU A;  2XGX A;  3GTG J;  2QZ8 A;  5JFR A;  2MLK A;  2LDU A;  1FLI A;  2KMU A;  3FZV A;  4UUV A;  3CQZ J;  5ED4 A;  5D8L B;  1ZRE A;  1KYZ A;  2GXA A;  3ZPL A;  3JTG A;  3CCU I;  4HF1 A;  1N25 A;  1KQ0 A;  3M8J A;  2OQR A;  2A5W A;  2BHY A;  2R7W A;  2NOJ B;  1MGT A;  3CTA A;  3NEU A;  4HG2 A;  3F9K A;  1JKP C;  1H0M A;  2DMU A;  4XRS G;  2R3S A;  3EET A;  4HLX A;  4UVA A;  4PJM A;  2P6S A;  4H4K C;  4ZC3 A;  1XMA A;  2ZNZ A;  4PCQ A;  2FSW A;  1XG1 A;  1SD7 A;  6PAX A;  2JUC A;  3BRO A;  2ISZ A;  3V8L A;  5FKO A;  5E3L A;  3CES A;  3H36 A;  3F22 A;  3DU5 A;  3Q3S A;  2EV5 A;  2LNB A;  4UUS A;  2GIZ A;  1UHW A;  2B63 J;  2QF7 A;  2MC3 A;  2NAZ A;  1WJ5 A;  4ETS A;  5FLV A;  3DKX A;  3FXL A;  4L5E A;  4EM1 A;  4A3C J;  4IF4 A;  5EJC A;  1TWA J;  1XX5 A;  2CQX A;  3WTW C;  2M3A A;  3ASO H;  2E71 A;  1F4K A;  2BZT A;  1DQU A;  4QIW N;  1PUE E;  2NVY J;  3DKW A;  3KP2 A;  3EUK L;  2E2I J;  2V9P A;  5IPA A;  3SJM A;  5B66 C;  3WHB A;  2CUZ A;  1LE8 A;  2H94 A;  1BL0 A;  3WTU C;  4A3J J;  1LB2 A;  4P5O A;  4RGX A;  5F0F A;  4RGS A;  4M6X A;  5F64 A;  3VYR B;  1YX5 A;  3HEF A;  1F43 A;  3C3W A;  3JSO A;  2JA6 J;  3CC7 I;  3H9Q A;  3DCF A;  2XRO A;  3UKG A;  1XGM A;  1DPR A;  4Y4R A;  3TW7 A;  3BT9 A;  3TL4 X;  4FX0 A;  1N77 A;  5HS9 A;  3RQI A;  1XTA A;  1AWC A;  1APL C;  4PFO A;  2CU7 A;  1WJB A;  2H1L A;  3L2V A;  1DDN A;  4LJZ F;  1J9I A;  1IXR C;  4E7L A;  3RI4 A;  1ZLJ A;  4XKC A;  2YR2 A;  5E8G A;  3FKJ A;  1T0F A;  5M3F J;  5M5W J;  1HCR A;  5IT9 R;  2GWR A;  1T33 A;  3HSF A;  3M07 A;  1B1B A;  2DO7 A;  1MBE A;  2LRD A;  4HAM A;  1WPK A;  2R7S A;  4A3L J;  2WV0 A;  5DDG A;  1IF1 A;  1WI3 A;  3S2H J;  5IP7 J;  2CUF A;  4RDU A;  5D5W B;  1AA7 A;  4OAY A;  4D7N A;  5KCM A;  1DGR M;  3D5L A;  1NHA A;  2FMY A;  1OYI A;  2IEK A;  1QZE A;  2LSO A;  4O5V A;  1H9T A;  3GFM A;  3H5N A;  2QM3 A;  3EUA A;  3PO2 J;  3Q5F A;  5IYB J;  5A2Q R;  4YIR X;  1Z7L A;  3PUB A;  5FKK A;  4AUX A;  4PZJ A;  1KU2 A;  2EFW A;  1XDS A;  5C4X J;  2M30 A;  2VI6 A;  3UR3 C;  4G12 A;  4EJU A;  1ETK A;  2TRT A;  4R1H A;  2O8K A;  5HLI A;  3MQ0 A;  3ML6 A;  1MSE C;  4IRG A;  3HDD A;  3F0C A;  1FC3 A;  2Q1Z B;  1Z77 A;  2FU4 A;  3D5S C;  3A01 A;  5TIS C;  2K86 A;  2Z33 A;  2BHZ A;  2XRN A;  4HV6 A;  2O61 A;  5E18 F;  1MBJ A;  1WZ2 A;  3OYM A;  2LFB A;  2Y0M A;  1U0J A;  5CJ9 A;  2MH2 A;  1IRX A;  4IOA F;  3OY9 A;  3HXL A;  1RES A;  3S3N A;  2FD5 A;  1CF7 B;  2D5V A;  4LMY A;  1G3T A;  4FTH A;  2KJB A;  1PP8 F;  1QRY A;  3GTQ J;  1FOX A;  1EH7 A;  2A5Y B;  2PMZ A;  2Z2S B;  4WWC A;  4CYC B;  3FK6 A;  2HWV A;  1PYV A;  2LF8 A;  3I59 A;  1E3O C;  2L5Q A;  2IT0 A;  2R7O A;  4GGG A;  3G1O A;  2AHQ A;  2DJN A;  3EDP A;  2NVQ J;  4M6V A;  1FNN A;  2QLZ A;  1JKQ C;  3I3L A;  2RQP A;  2CJJ A;  1A6I A;  3ZQI A;  1XGS A;  2LG4 A;  1MMA A;  4UHT A;  1Y8Q B;  1S7O A;  1ETX A;  2MG4 A;  4X0G A;  1VQ5 I;  3S1M J;  3IH2 A;  3KP3 A;  1CQT A;  4DYC A;  3PSI A;  2HTS A;  3RPU D;  5M5Y J;  2Y9Z A;  3IAM 2;  3P9I A;  4KIG A;  2OU2 A;  3E1S A;  5H20 A;  1JXS A;  4BS9 A;  4QPO A;  1VQ4 I;  1MBF A;  3QOP A;  3H3U A;  3M1C A;  4N9H A;  1OCZ H;  2PBI A;  3QPT A;  2ISY A;  2O6G E;  4DZJ A;  4IHV A;  1HQC A;  5IT9 Z;  2X6W A;  4G6D A;  3CF5 F;  1K83 J;  2XPW A;  1X4O A;  5AIP A;  2MAB A;  4MTE A;  3NWT A;  2DK5 A;  3SEQ A;  3RQ4 A;  2LBF B;  3HZJ A;  4EVI A;  3Q9S A;  4A69 C;  3LA2 A;  3BG7 A;  3BCB A;  3JSP A;  4EEF G;  2PMU A;  4CCO A;  4F55 A;  4F3Q A;  1YW7 A;  4M3B A;  2DTZ A;  5D4S A;  4DZP A;  3E5X A;  3GX4 X;  1S6L A;  2ZME A;  4Q48 A;  4CXF A;  3HC7 A;  4ZYA A;  3K1M A;  2M45 A;  4UB8 C;  4PSX A;  4M6Y A;  1F1Z A;  5A2Q Z;  1W36 D;  3CDL A;  1X3W B;  3GFI A;  3G1L A;  3SDB A;  3L9F A;  3FHZ A;  2QKL B;  3OYF A;  4BQA A;  4IEJ A;  4S05 A;  5LGU A;  4YEL A;  5K7H A;  5DCM A;  5J6X A;  3QU6 A;  3VEP A;  3W2A A;  3G3Z A;  1H88 C;  4JOM A;  1HW5 A;  3OL3 A;  3PM1 A;  1ZGW A;  1Y1W J;  2LRE A;  4PJN A;  2W00 A;  1YLF A;  2D2W A;  3QYF A;  4BQO A;  3OSF A;  2Y0S N;  2CW8 A;  4AM3 A;  2Y30 A;  2OF7 A;  2XVC A;  3ABL H;  1XSD A;  3KEO A;  1IV8 A;  2M34 A;  3I4P A;  3LA7 A;  1FOK A;  4PJL A;  1JTX A;  2AXT C;  4DNC A;  4E7J A;  5L3C A;  2QQB A;  3K4K A;  3JRB A;  1GLN A;  1X4P A;  1YOV B;  4JP0 A;  1LKX A;  3I53 A;  1XN7 A;  4RB3 C;  3ZMU A;  3K6G A;  2ACJ A;  3L2U A;  3ZQL A;  1JGS A;  2DBB A;  3GTJ J;  4ESJ A;  1GDT A;  3BQZ A;  2IGK A;  2DFE A;  2ZKZ A;  4FIS A;  2NVU B;  2LD5 A;  2EB7 A;  2EIN H;  3BZC A;  2DT6 A;  1ETQ A;  3K4N A;  4XOP A;  5L3D A;  3K69 A;  3ESW B;  3M9A A;  2DA4 A;  4F7Z A;  1GV2 A;  2VQG A;  3K4C A;  2XGD A;  4RAF A;  1EA3 A;  4I02 A;  2ESN A;  1K4S A;  2IGM A;  2ZSI B;  3OYN A;  2EWN A;  1A35 A;  4BGD A;  4L9T A;  1Y56 A;  3OOP A;  1WH7 A;  4ITV A;  4ZZD A;  3CME I;  1BJA A;  4WF2 A;  4FET A;  3H9G A;  4BJ5 C;  3OYE A;  1ZEL A;  3M3Y J;  1G8X A;  3G1M A;  2ZFW A;  5TJJ A;  5EG0 B;  1JKR C;  2OV7 A;  3F23 A;  2JRM A;  1MMG A;  2M4G A;  4XM3 A;  4E7I A;  2E7W A;  1O4X A;  1FBS A;  4DW6 A;  2XAH A;  3OYH A;  3OIQ A;  4KIT B;  5EGO A;  5CVU A;  1ON1 A;  1U9O A;  4R8H A;  1SAN A;  4MO7 A;  1X19 A;  2L7M P;  1J0R A;  1W5S A;  2DFI A;  2RDP A;  2ME6 A;  1IN6 A;  2R92 J;  1R23 A;  4IOC F;  4CYC A;  2HYF A;  1OR7 C;  2AQF A;  1TT0 A;  4BQN A;  3IHU A;  1XS9 A;  1FZP B;  2HDC A;  3ELK A;  4IHS A;  3SXY A;  1P2F A;  4XLA A;  3O8G A;  1W7P B;  1FBQ A;  3ROU A;  3ZGK A;  1KU7 A;  1Z6R A;  1SFO J;  4AIK A;  4DBQ A;  1P4X A;  3HJE A;  1E17 A;  2WA0 A;  2PJP A;  3FBN B;  3CD6 I;  2LKX A;  1E3H A;  1J5Y A;  5HNH A;  2L2O A;  1ACI A;  2E2J J;  1UJ8 A;  1JHH A;  2H27 A;  1MIJ A;  3HHG A;  3L7W A;  4B1R A;  2HOS A;  2QQ9 A;  3C2G A;  3KCC A;  1YTY A;  4BXU A;  2UXN A;  2RGV A;  4R79 A;  2KQR A;  2KIM A;  4P9U A;  4F91 B;  4EJO A;  1LUJ B;  2C6Y A;  2F5D A;  2IA0 A;  5HVQ C;  2CQK A;  4LLG F;  1HXD A;  2F5F A;  4RB2 C;  1ZR2 A;  1O3T A;  1S7A A;  2XF5 A;  3GWZ A;  1YHQ I;  3ZMS A;  2BBY A;  3UNG C;  2MYS A;  4BAC A;  2ADU A;  4YII A;  5B1A H;  2NYX A;  2D1V A;  5EZH A;  1Y8R B;  2KPM A;  1Z91 A;  3GLX A;  3LL7 A;  2AXL A;  4HSR A;  4U88 A;  4G9Y A;  1MH4 A;  5K5O A;  3OYK A;  4GO1 A;  2F48 A;  1ZRC A;  1D8K A;  4NBQ A;  1R36 A;  4HX7 A;  1QPM A;  2VBZ A;  1OCT C;  3ISP A;  1X3Z B;  1ZGA A;  3GEZ A;  2Q8K A;  1YFH A;  1QU3 A;  4Y33 A;  2V26 A;  1K79 A;  2EK5 A;  1XGO A;  1K78 A;  1EJ9 A;  1TWC J;  3GF2 A;  1FYK A;  2COB A;  2R7Q A;  3PUF A;  1EH6 A;  4YFN F;  5GPC A;  4UV9 A;  2X1D A;  3OL4 A;  3DU6 A;  4RS8 A;  1SD5 A;  3RPQ A;  3IRR A;  4RAG A;  2V1D A;  3F72 A;  2RNG A;  5C3E J;  4XLH A;  3BC8 A;  3KZY A;  2A6H F;  4JYK A;  1MBG A;  4QLC U;  2Q2E B;  4E7K A;  3BTI A;  3TQN A;  4HRI A;  1U8B A;  5C4J J;  2WWY A;  1DU6 A;  4IHT A;  3GVA A;  4KUM A;  5LEK A;  3KLN A;  3HOT A;  2O7O A;  3TO9 A;  4G7O F;  2LR8 A;  1QBJ A;  3MZY A;  3C2B A;  1GXQ A;  2ZBK A;  3FM5 A;  3H3Z A;  4DJA A;  2PN6 A;  4DQ2 A;  3S32 A;  1BI2 A;  2RV8 A;  3GZ5 A;  3GUD A;  3O3K A;  1OJL A;  1P4A A;  1YYV A;  2VT3 A;  3KX2 A;  3SZT A;  3KYD B;  5CVJ A;  3VB2 A;  3OIO A;  1V5E A;  1TC3 C;  1ZG3 A;  4A3F J;  4HPQ A;  4L9J A;  1BI0 A;  1VQL I;  3LNQ A;  3SZG A;  3HTU A;  2K4B A;  4QTR A;  4Y17 A;  1K6O A;  2VC1 A;  1K6Y A;  2P6T A;  1D1B A;  4MTD A;  1W36 C;  1BA5 A;  2LY2 A;  3R60 A;  4YFK F;  4M9X A;  1WI9 A;  1I6X A;  1X3U A;  2VQL A;  3LMM A;  2V4J C;  4XQF A;  3JRE A;  3MKW B;  4KA4 A;  3F8F A;  3TGN A;  4UUT A;  4CYD A;  3RSN A;  3FIS A;  4I01 A;  4UVC A;  3H9J A;  4UUS B;  3WTX C;  3HGY A;  1U2W A;  4P96 A;  2CYY A;  4I99 C;  1XMX A;  1J09 A;  1R71 A;  1BR2 A;  5BNG A;  1Q1H A;  4ENM A;  5EG0 A;  1G6N A;  4GRI A;  5HOO A;  1YS7 A;  2HS5 A;  1OYW A;  2UV1 A;  2XGC A;  4U87 A;  3A02 A;  4NB5 A;  4IZZ A;  2L3D A;  5JLW A;  4DYR A;  1QGP A;  2FBK A;  3S2W A;  1JUM A;  3J81 K;  2PQ8 A;  5J8F A;  4DIQ A;  4Y15 A;  3DEE A;  3IC7 A;  4WX9 A;  1ULY A;  1LPQ A;  5D6E A;  1WH5 A;  1O3R A;  1ORK A;  1D3Y A;  4E6K G;  5JVG F;  3FXM A;  2VL8 A;  3CUQ C;  3AKZ A;  2OCC H;  2DA3 A;  1X1A A;  3ZQ7 A;  5K7F A;  2Y75 A;  4E7H A;  1Z0X A;  4P9F A;  2DU9 A;  1XD7 A;  5BPD A;  1IZ1 A;  1W7P A;  4XRS A;  4G8X A;  3A4C A;  3PNV A;  5D5X B;  3Q9V A;  2Z99 A;  4M3G A;  3GZ6 A;  3CUQ A;  3TP0 A;  3CCR I;  3JTH A;  1LFB A;  2W84 A;  4DYQ A;  1Z1D A;  3F21 A;  2HOA A;  2X9D A;  1P7J A;  3HRU A;  4GYG A;  4CUG A;  2XV4 S;  3LSJ A;  1UEL B;  4L5J A;  5B5E C;  1VQM I;  1I1S A;  4AVZ A;  5GTI C;  5KK1 A;  5LD2 C;  2ZC2 A;  2JN6 A;  3K1P A;  2K27 A;  1ZN2 A;  3GBG A;  5FKN A;  1ZGJ A;  1R7J A;  4V19 K;  4PJ0 C;  3WTV C;  2ESH A;  3JRC A;  4XSZ F;  2VOD A;  1RKT A;  3CZ6 A;  2IJL A;  3BR2 A;  5HLH A;  1OQY A;  5ICE A;  4IXA A;  4G6T B;  3QP5 A;  3QOE A;  3HSR A;  2E19 A;  1SVL A;  4KMU X;  1WCM J;  2BXZ A;  2BYV E;  4LK0 F;  4HNU A;  2QVO A;  3AG4 H;  3GYH X;  4EJT A;  4IHY A;  1POG A;  3LFK A;  4ASN A;  5FKL A;  2VB6 A;  3HUG A;  4AIJ A;  2FML A;  2OBP A;  4N9I A;  3G4S I;  1NK3 P; 
#chains in the Genus database with same CATH homology
 1R5G A;  1T2K A;  1VTN C;  4HQE A;  4LB5 A;  1R58 A;  1LEA A;  5FO5 A;  2YX4 A;  3I59 B;  2K02 A;  1BC7 C;  3TDZ C;  2FNP A;  1UST A;  3RKY A;  2BE5 F;  2KKO A;  4A2U A;  5EEG A;  1WWX A;  3R6S A;  2VXZ A;  2K7L A;  1DUX C;  5D5U B;  2XAJ A;  2BGC A;  2WC2 A;  3TDU C;  1S29 A;  2A3S A;  1OPC A;  2EFN A;  2NS0 A;  5E1X A;  2VE9 A;  3FX3 A;  3V7S A;  1IN4 A;  1P4W A;  1F5T A;  5ERI A;  3WTT C;  4KDP A;  4YG2 F;  1MJA A;  2ZME B;  4OIO F;  4OIQ F;  3KP4 A;  4MEY F;  1FT9 A;  2IPQ X;  2P7C B;  1KGS A;  1XSV A;  1ZG1 A;  3NQO A;  4O6J A;  3RYR A;  2EV6 A;  5DCM B;  1G4D A;  3O2P E;  3IWF A;  5BS6 A;  4B8X A;  2YX7 A;  3CO6 C;  2UXX A;  2HEO A;  2V1X A;  4S04 A;  4MNU A;  3VOE A;  3RIR A;  2ZNY A;  5LGT A;  3E6B A;  4GXO A;  3R0J A;  1EV7 A;  1I27 A;  1OYY A;  2HTJ A;  4D0P A;  1YG2 A;  3IWZ A;  1XCV A;  3GW2 A;  1ZG5 A;  3E6D A;  4WK8 F;  4OMY A;  3T8T A;  1B59 A;  1K7A A;  4A12 A;  1G3Y A;  4L9N A;  3K0L A;  2Z9O A;  2A68 F;  3GO5 A;  2RC4 A;  2V6C A;  4O3M A;  4ENN A;  2MA3 A;  2J5P A;  3LAP A;  1HW1 A;  3DQV C;  2DLL A;  3KE2 A;  5J8C A;  2DK8 A;  1RUN A;  1W4M A;  2OAZ A;  1T38 A;  1DP7 P;  1JE8 A;  5HS8 A;  1ZAR A;  1FP2 A;  3BJA A;  4HW0 A;  3T1B A;  3IL2 A;  4IPA A;  1D8J A;  2P4W A;  3AAF A;  1W5T A;  3I64 A;  5CVI A;  5L3G A;  4U7D A;  1U8R A;  2STT A;  2DQL A;  3MFK A;  3KZZ A;  1R00 A;  1Z9C A;  3HHH A;  1WRJ A;  4BHC A;  5LLQ A;  1LJ9 A;  3TOA A;  4EQQ A;  1S8N A;  2PMH A;  4AIH A;  1T98 A;  1KU9 A;  5KVR A;  2H6B A;  3TO6 A;  1B6A A;  1FSH A;  2CWE A;  5AON A;  4JK1 X;  3ZMT A;  3FXQ A;  3R0A A;  2FXA A;  5LHG A;  2MH9 A;  5D6F A;  1MZB A;  2CSO A;  3I54 A;  4XSX F;  1K78 B;  4LLL A;  4CGZ A;  4JBA A;  3BPX A;  4KN7 X;  4ZYE A;  1R1U A;  1IN5 A;  5ILV A;  5AIQ A;  5HLG A;  1PP7 U;  2VOP A;  2KIU A;  5H6Q A;  4AVP A;  2W85 A;  2CW0 F;  3LQQ A;  3FMR A;  2VN2 A;  1FWZ A;  4L5I A;  3WTY C;  4IVN A;  1V4R A;  3J80 K;  1SD4 A;  5JVT A;  1USS A;  3BJ6 A;  3F8B A;  2EFP A;  2HYG D;  2E1N A;  2HZT A;  2JPB A;  1R5H A;  5BQT A;  1IXC A;  4OU0 A;  4KIB A;  1LDJ A;  2DTR A;  1RI7 A;  4U0Y A;  4HF2 A;  3DPL C;  2F2E A;  3RKX A;  2XKO A;  5BMZ A;  3EUH A;  3FXU A;  4BHB A;  3WG9 A;  1TW3 A;  1ODD A;  2V1U A;  3M7G A;  1BI1 A;  4BH9 A;  2DT5 A;  1L3L A;  3T0Y A;  4EGY A;  3BDD A;  2K4J A;  5K5Q A;  2QWW A;  2HQR A;  1BIB A;  2L02 A;  4K2E A;  3U1D A;  5DYM A;  4LB6 B;  4LG0 B;  2G7H A;  2QYO A;  1ZAO A;  1P92 A;  3ECH A;  3CUQ B;  1HST A;  1OR7 A;  3DEU A;  2XIG A;  2JSC A;  2RN7 A;  4ENJ A;  1L0O C;  2RNJ A;  3V4G A;  4U7B A;  2IRF G;  3L2C A;  5CVV A;  3FMQ A;  2W24 A;  4M73 A;  3E97 A;  3CLO A;  5BPI A;  2RVC A;  1LDD A;  1F9N A;  1ZHF A;  2EFQ A;  4M74 A;  5L3B A;  1FP1 D;  5ICF A;  2ZXJ A;  2QQA A;  1ONV A;  1PDN C;  4Q5S F;  3H92 A;  1SMT A;  4PDK A;  4A5N A;  3DXJ F;  2IP2 A;  3PQJ A;  4ON0 A;  3PQK A;  1ZH5 A;  2P8T A;  2JTV A;  4RGU A;  2PI0 A;  3RPU A;  1HKT A;  2VBY A;  1U5T C;  3V7R A;  3V8J A;  3PFI A;  1R1T A;  3BP8 A;  1IAW A;  3GXO A;  4RB0 A;  4Q4Z F;  4L0Y B;  5JHU A;  3QP6 A;  1QZZ A;  4L9V A;  4EJW A;  4ESF A;  2PFB A;  3WE2 A;  1IRF A;  3SFZ A;  1XMK A;  3DF8 A;  1Z7U A;  2ETH A;  2VC0 A;  2MD5 A;  1T6S A;  4YIF A;  2D45 A;  1SMY F;  1STZ A;  1BM9 A;  1LNW A;  4HV5 A;  3K9T A;  3WGG A;  2CFX A;  2PG4 A;  1Z05 A;  1R22 A;  4CZZ A;  3ZN1 A;  5ILU A;  2WTE A;  3OV8 A;  3SZP A;  1QO0 D;  4RAY A;  5FFZ A;  5E17 F;  2NNN A;  3WE3 A;  2FBI A;  2GXG A;  5LEJ A;  2IVM A;  4KN4 X;  3J80 Z;  4LG0 A;  4WXH A;  2OZ6 A;  1LVA A;  2NNY A;  2KJC A;  3E6M A;  4U0V A;  1C0W A;  3BY6 A;  4NQW A;  2OQG A;  3BZ6 A;  5K5R A;  2DPU A;  3C1D A;  3COA C;  2MBF A;  5D8K B;  2PLY A;  3MCZ A;  5CVR A;  5HDG A;  4PGG A;  5IT3 A;  1KQ9 A;  4A0X A;  2NRA C;  4LGW A;  1B9M A;  3N97 A;  5DD4 A;  4OIP F;  1MD0 A;  4EMS A;  1I5Z A;  3HOS A;  2P5V A;  3I5U A;  3WU0 A;  3QAH A;  3HRT A;  2Z5U A;  2E1C A;  2V9V A;  1WKM A;  3E3V A;  1LEB A;  1GVJ A;  1MJ9 A;  1BI3 A;  2XAQ A;  2XUB A;  3VFZ A;  4RAZ A;  3M8E A;  3MEX A;  2GAU A;  2BV6 A;  2M8E A;  2W57 A;  1HW2 A;  1SAX A;  2KRF A;  1TNT A;  4H0E A;  5E8I A;  4KYW A;  1RNL A;  5F6F A;  5L3F A;  3REO A;  3RDI A;  3U9G A;  2XKP A;  2L4A A;  4IRI A;  5ILS A;  1H9G A;  4EGZ A;  3D0S A;  1G3W A;  1ZRD A;  4UVB A;  3SQN A;  1UHM A;  2QUF A;  4BNC A;  3KLO A;  3ZP5 A;  1KYW A;  2D1H A;  2G7U A;  4IJA A;  1LDK B;  1Y0U A;  3HYI A;  4XLP F;  2L54 A;  3B73 A;  1QQI A;  4B09 A;  1TBX A;  1ON2 A;  2V79 A;  1TW2 A;  4FT8 A;  3G73 A;  4L18 B;  4IRH A;  2Q0O A;  2QBY A;  3TOB A;  2EA2 A;  2M5W A;  3MWM A;  2UZK A;  3F8C A;  3HTS B;  1DPU A;  1U78 A;  4ENK A;  2JPC A;  4OOI A;  3HRS A;  3LST A;  1IRG A;  4Y13 A;  4ZYH A;  3W6J B;  3DPT A;  2GA2 A;  4I0B A;  3CJN A;  3MAJ A;  4OMZ A;  2R7D A;  4RB1 A;  1SFE A;  4E70 A;  3KP5 A;  1FX7 A;  3J7A O;  1REP C;  1S3J A;  4HDU A;  3M8F A;  2A61 A;  2JZY A;  3R61 A;  3QPH A;  3BJO A;  2HFH A;  4BHP A;  2X4H A;  3FXR A;  5LGN A;  4BAY A;  1O3S A;  1BBY A;  2W25 A;  1YIO A;  1YW9 A;  3FF5 A;  5JR3 A;  1MKM A;  5FB2 A;  5EEH A;  4I0A A;  1KU3 A;  3TO7 A;  2M1B A;  3BPV A;  2F5C A;  3ZMD A;  4UXN A;  2OD5 A;  2Z3Y A;  1KA8 A;  1FYL A;  5HS7 A;  3JAM K;  3EQL F;  4XRF A;  1SFU A;  2CG4 A;  2DW4 A;  1J75 A;  2FA5 A;  3FWE A;  3J81 Z;  1J59 A;  4QWQ A;  2FOK A;  1MDM A;  4ZZL A;  2DPD A;  5BOX A;  1FY7 A;  1O57 A;  4HDV A;  2P7V B;  5L3E A;  5DUI A;  4WXD A;  3RKW A;  2IA2 A;  2EJR A;  5LRS A;  4KMF A;  2ZCW A;  2HGC A;  1U6G A;  2CGP A;  1AOY A;  4AWX B;  3CDH A;  1HSJ A;  5DCF A;  1TQP A;  1R1V A;  4CHU A;  4A5M A;  2HOE A;  4HOB A;  4FX4 A;  3EYI A;  4OIN F;  3ULQ B;  2XAF A;  2VT2 A;  1U3E M;  4EM2 A;  2VON A;  3DFG A;  2GIV A;  5LHH A;  3KET A;  3I58 A;  2XHK A;  4N0B A;  3ZMZ A;  1J7K A;  1TTY A;  3GFJ A;  5DUK A;  4A6D A;  2XAG A;  4Z2Y A;  4ZYD A;  2X0L A;  4HF0 A;  3V7C A;  3E5Q A;  2R7F A;  5FFX A;  2YPR A;  2KIF A;  4TV7 A;  1D5V A;  3M1E A;  4LK1 F;  1XDU A;  2LF7 A;  4HBL A;  3ECO A;  4ZYG A;  1FPQ A;  2DI3 A;  1HBX G;  4Q47 A;  5E20 A;  3C18 A;  2A6E F;  4XLN F;  1YO5 C;  1XGN A;  2HKO A;  3K1N A;  5H6R A;  2EV0 A;  1G3S A;  4WCG A;  3TKY A;  4KNY A;  5F1R A;  2F5E A;  3FMS A;  1U5T B;  4M9S A;  4A0Z A;  1FSE A;  3WGI A;  1O7F A;  1P6R A;  4KFC A;  4I2O A;  4LLN A;  4UNO A;  1XB4 A;  3HRM A;  2YU3 A;  3F6V A;  1GXP A;  2G9W A;  2A69 F;  5CYV A;  3ZMV A;  3WTS C;  3KP7 A;  2FRH A;  1CGP A;  4LFU A;  3WOD F;  4HA8 A;  4I7H A;  5FGM A;  3L09 A;  1YQA A;  2O3F A;  1IW7 F;  1W7P D;  3JW4 A;  2YSR A;  5DEQ A;  1UFM A;  1A04 A;  5K1Y A;  5D4R A;  5D5V B;  5DD8 A;  1O7L A;  1TNS A;  3IRQ A;  5FLX K;  1BC8 C;  2HQN A;  2XAS A;  1QZY A;  3O6B B;  2E7X A;  3B02 A;  2IA1 A;  5E1Z B;  4G6Q A;  4M72 A;  3ZN0 A;  1XSX A;  5LBQ A;  3E6C C;  4MGR A;  3IKT A;  3R4K A;  2STW A;  1FBU A;  1CF7 A;  1B4A A;  3LAJ A;  3C7J A;  2AS5 F;  2O0Y A;  3LA3 A;  2OZU A;  3V8K A;  4BYY A;  1GHC A;  2FNA A;  3EYY A;  3P9K A;  3JAM Z;  4FHT A;  4GYI A;  5LHI A;  5E1W A;  2GZW A;  4A0Y A;  1BIA A;  3I0T A;  2FEZ A;  3RTR A;  2EFO A;  2M87 A;  1WQ2 A;  2O8X A;  1RUO A;  5HDN A;  4M71 A;  3T8R A;  3SHF A;  1RZ4 A;  1SD6 A;  4JQF A;  2GQQ A;  5ICG A;  2O03 A;  4HX8 A;  4G7H F;  3E5U A;  1FYM A;  1KQ8 A;  4HLY A;  4CIC A;  3QRF F;  2DQR A;  3KFW X;  1IUY A;  1WSU A;  1TQM A;  3I71 A;  5HDK A;  4G7Z F;  4HYE A;  1LQ1 A;  2JT1 A;  2RKH A;  4EJV A;  5FD5 A;  1OKR A;  2FBH A;  2COM A;  4GCV A;  1ZYR F;  4OIR F;  1V3F A;  2EA4 A;  2P5K A;  4KIF A;  1U5T A;  4ZH4 F;  2FQ3 A;  4HQM A;  2VBX A;  4CDG A;  4PGH A;  4WXC A;  5FD6 A;  2JRT A;  4NHJ A;  1QNT A;  1YS6 A;  3VOD A;  4A6E A;  5LRR A;  2Y48 A;  4EM0 B;  4MHG A;  1BOA A;  1YW8 A;  1HKS A;  1T39 A;  1IN7 A;  3F8N A;  4UV8 A;  2L4M A;  1B9N A;  2DAO A;  2PEX A;  3HSE A;  4I98 B;  2FF4 A;  2A07 F;  3ABT A;  2QBY B;  3U2R A;  4KIC A;  1SFX A;  2ELH A;  2VBW A;  2B0L A;  2HKX A;  5TRD A;  1XCB A;  2QEN A;  1Z6T A;  1IN8 A;  3LWF A;  3DP7 A;  1RIO H;  1BN5 A;  2IW5 A;  2H09 A;  1J2X A;  2P5L C;  4I09 A;  3F3X A;  4P55 A;  1I1G A;  2MLG A;  2ZO4 A;  3HIF A;  3WGH A;  4G94 A;  1JHF A;  1HKQ A;  3NRV A;  1ZRF A;  3MZH A;  4MQ9 F;  3KEQ A;  1ZLK A;  4MQV A;  3BOQ A;  1TLH B;  2J5O A;  4MEX F;  2L01 A;  3LQR A;  4YFX F;  5JI6 A;  3P9C A;  5CLS A;  3QU3 A;  5DV5 A;  4HZF A;  1EH8 A;  1UB9 A;  4M9Z A;  3P7N A;  2FE3 A;  3CO7 C;  2VOO A;  4EV0 A;  4AD9 A;  5FLX Z;  3N4M A;  3WU1 B;  1MDM B;  5ICC A;  4RGR A;  3KP6 A;  4LD5 A;  2UWM A;  3GFL A;  2GA1 A;  1OMI A;  3RJP A;  3BWG A;  4XBF A;  5IT9 K;  3RYP A;  3T5X A;  3K2Z A;  2H6C A;  2ZJ2 A;  4U0W A;  4ESB A;  4KT5 C;  4HX4 A;  2TDX A;  1O3Q A;  1MJB A;  3W6K B;  1E2X A;  3F6O A;  2BEO A;  4CO8 A;  2LKP A;  3F8M A;  1IXS B;  2VE8 A;  3L00 A;  2CO5 A;  3IKV A;  3FM3 A;  4L0Z B;  5A2Q K;  3WTZ A;  2OA4 A;  1UCR A;  3DV8 A;  2Q2E A;  3CUO A;  3ERE D;  1TQI A;  2GXB A;  2HR3 A;  3ABU A;  2XGX A;  2QZ8 A;  5JFR A;  2MLK A;  2LDU A;  1FLI A;  3FZV A;  4UUV A;  5ED4 A;  5D8L B;  1ZRE A;  1KYZ A;  3ZPL A;  3JTG A;  4HF1 A;  1KQ0 A;  2OQR A;  1MGT A;  3CTA A;  3NEU A;  1H0M A;  2R3S A;  3EET A;  4HLX A;  4UVA A;  2P6S A;  1XMA A;  2ZNZ A;  4PCQ A;  2FSW A;  1SD7 A;  6PAX A;  3BRO A;  2ISZ A;  3V8L A;  3F22 A;  2EV5 A;  2LNB A;  1UHW A;  2MC3 A;  2NAZ A;  4ETS A;  4EM1 A;  4IF4 A;  3WTW C;  1F4K A;  1PUE E;  3DKW A;  3KP2 A;  2H94 A;  3WTU C;  1LB2 A;  4P5O A;  4RGX A;  5F64 A;  4RGS A;  4M6X A;  3C3W A;  3JSO A;  2XRO A;  1XGM A;  1DPR A;  4FX0 A;  5HS9 A;  1AWC A;  1DDN A;  4LJZ F;  1J9I A;  1IXR C;  3RI4 A;  1ZLJ A;  5E8G A;  2YR2 A;  1T0F A;  2GWR A;  3HSF A;  1B1B A;  2DO7 A;  4HAM A;  2WV0 A;  5DDG A;  1IF1 A;  5D5W B;  3D5L A;  1NHA A;  2FMY A;  1OYI A;  2LSO A;  4O5V A;  1H9T A;  3GFM A;  2QM3 A;  3Q5F A;  4PZJ A;  1KU2 A;  2EFW A;  1XDS A;  2M30 A;  4EJU A;  4R1H A;  5HLI A;  3MQ0 A;  3ML6 A;  4IRG A;  1FC3 A;  2FU4 A;  2K86 A;  2Z33 A;  2XRN A;  4HV6 A;  2O61 A;  5E18 F;  2Y0M A;  5CJ9 A;  2MH2 A;  1CF7 B;  4LMY A;  1G3T A;  1PP8 F;  2KJB A;  1EH7 A;  2A5Y B;  4WWC A;  2HWV A;  2LF8 A;  3I59 A;  2IT0 A;  4GGG A;  3EDP A;  1FNN A;  2QLZ A;  2RQP A;  1XGS A;  4UHT A;  1S7O A;  3KP3 A;  2HTS A;  3P9I A;  4KIG A;  2OU2 A;  5H20 A;  1JXS A;  3QOP A;  3H3U A;  4N9H A;  2PBI A;  3QPT A;  2ISY A;  2O6G E;  1HQC A;  5IT9 Z;  4G6D A;  5AIP A;  4MTE A;  2DK5 A;  4EVI A;  3Q9S A;  3LA2 A;  3JSP A;  2PMU A;  1YW7 A;  5D4S A;  3E5X A;  3GX4 X;  1S6L A;  2ZME A;  4Q48 A;  4CXF A;  3K1M A;  2M45 A;  4M6Y A;  1F1Z A;  5A2Q Z;  3GFI A;  3L9F A;  3FHZ A;  4BQA A;  4S05 A;  5LGU A;  5DCM A;  5J6X A;  3QU6 A;  3VEP A;  3G3Z A;  1HW5 A;  1YLF A;  2D2W A;  2XVC A;  1XSD A;  3KEO A;  3I4P A;  3LA7 A;  1FOK A;  4DNC A;  5L3C A;  2QQB A;  3I53 A;  1XN7 A;  4RB3 C;  3ZMU A;  2ACJ A;  1JGS A;  2DBB A;  4ESJ A;  2ZKZ A;  2EB7 A;  5L3D A;  3K69 A;  3M9A A;  4F7Z A;  4I02 A;  2ESN A;  2EWN A;  4L9T A;  3OOP A;  4ZZD A;  1BJA A;  4WF2 A;  2ZFW A;  5TJJ A;  3F23 A;  2E7W A;  1FBS A;  2XAH A;  5CVU A;  1ON1 A;  4R8H A;  1J0R A;  1W5S A;  2DFI A;  2RDP A;  1IN6 A;  1R23 A;  2HYF A;  3IHU A;  1FZP B;  2HDC A;  3ELK A;  4IHS A;  3SXY A;  1P2F A;  1W7P B;  1FBQ A;  3ROU A;  1KU7 A;  1Z6R A;  4AIK A;  1P4X A;  1E17 A;  2PJP A;  1J5Y A;  1JHH A;  2H27 A;  3HHG A;  3L7W A;  2QQ9 A;  3KCC A;  1YTY A;  4BXU A;  2UXN A;  2RGV A;  4R79 A;  2KIM A;  4P9U A;  4EJO A;  2C6Y A;  2F5D A;  2IA0 A;  5HVQ C;  2CQK A;  4LLG F;  1HXD A;  2F5F A;  4RB2 C;  1O3T A;  1S7A A;  3GWZ A;  3ZMS A;  2BBY A;  2ADU A;  4YII A;  2NYX A;  2D1V A;  1Z91 A;  3GLX A;  2AXL A;  4U88 A;  4G9Y A;  5K5O A;  4GO1 A;  1ZRC A;  1D8K A;  1R36 A;  4HX7 A;  1QPM A;  2VBZ A;  3ISP A;  1ZGA A;  3GEZ A;  2Q8K A;  1YFH A;  1K79 A;  2EK5 A;  1XGO A;  1K78 A;  3GF2 A;  1FYK A;  4YFN F;  1EH6 A;  4UV9 A;  4RS8 A;  1SD5 A;  3IRR A;  3RPQ A;  2V1D A;  3F72 A;  3KZY A;  2A6H F;  4QLC U;  3TQN A;  2WWY A;  4IHT A;  3GVA A;  4KUM A;  5LEK A;  3KLN A;  3HOT A;  4G7O F;  3TO9 A;  1QBJ A;  3MZY A;  1GXQ A;  2ZBK A;  3FM5 A;  3H3Z A;  2PN6 A;  4DQ2 A;  1BI2 A;  2RV8 A;  3GZ5 A;  3GUD A;  3O3K A;  1P4A A;  1YYV A;  2VT3 A;  3SZT A;  5CVJ A;  3VB2 A;  1ZG3 A;  4L9J A;  1BI0 A;  3HTU A;  2K4B A;  4Y17 A;  1K6O A;  2VC1 A;  2P6T A;  4MTD A;  3R60 A;  4YFK F;  4M9X A;  1WI9 A;  1I6X A;  1X3U A;  4KA4 A;  3F8F A;  3TGN A;  4CYD A;  4I01 A;  4UVC A;  3WTX C;  1U2W A;  4P96 A;  2CYY A;  4ENM A;  1Q1H A;  1G6N A;  5HOO A;  1YS7 A;  2HS5 A;  1OYW A;  4NB5 A;  2L3D A;  1QGP A;  2FBK A;  3S2W A;  3J81 K;  2PQ8 A;  5J8F A;  4Y15 A;  3IC7 A;  4WX9 A;  1ULY A;  5D6E A;  1O3R A;  1D3Y A;  3CUQ C;  3ZQ7 A;  2Y75 A;  4P9F A;  2DU9 A;  1XD7 A;  5BPD A;  1IZ1 A;  1W7P A;  4G8X A;  5D5X B;  3Q9V A;  2Z99 A;  3GZ6 A;  3CUQ A;  3JTH A;  2W84 A;  1Z1D A;  3F21 A;  3HRU A;  4GYG A;  2XV4 S;  4L5J A;  1I1S A;  5KK1 A;  3K1P A;  2K27 A;  1ZN2 A;  1ZGJ A;  1R7J A;  3WTV C;  2ESH A;  2VOD A;  4XSZ F;  2IJL A;  5HLH A;  5ICE A;  4IXA A;  3QP5 A;  3HSR A;  4KMU X;  2BYV E;  4LK0 F;  2QVO A;  4EJT A;  3GYH X;  3LFK A;  4ASN A;  3HUG A;  4AIJ A;  2FML A;  2OBP A;  4N9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...