3R61A

Structure of the mntr co2+ complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
128
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator mntR
total genus 50
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r61A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3r61A02
3LA3A 4YG2F 3DQVC 3RI4A 2A07F 4WXHA 1RI7A 2D45A 3DV8A 1K78B 3F23A 1K7AA 3IL2A 2DTRA 1TQMA 3KP6A 3TO6A 1FWZA 3WTZA 4P55A 3QRFF 1FC3A 3V4GA 1RUOA 3P9CA 4KUMA 4RS8A 5DD8A 1F9NA 2GIVA 5ED4A 5HDKA 4A0YA 1I1SA 2BGCA 2WWYA 3K2ZA 2P6SA 3GX4X 1UHMA 1QZZA 2JPCA 3GFIA 3GWZA 4CYDA 1UB9A 3WU0A 4HA8A 5IT3A 1KQ8A 2LDUA 3F8CA 1OR7A 2O03A 5L3DA 4MGRA 5JFRA 2F5CA 1R5GA 5DCMA 1ON1A 4I01A 3SFZA 2G7HA 3R61A 1Z05A 2FEZA 4UVBA 3B02A 1G3YA 1EV7A 2EA2A 1FZPB 4NQWA 4EGYA 2V1DA 2OZUA 2Z3YA 2FA5A 3M7GA 3H92A 2GXBA 5DDGA 3N97A 4KMFA 2ZCWA 4FT8A 5FFXA 4U7BA 4GXOA 5CVIA 1K6OA 1I6XA 1V3FA 3O6BB 4HBLA 3F6VA 1LDJA 1HKTA 2EFOA 3WTUC 4A6DA 5L3GA 2OAZA 1R1UA 5EEGA 2QQ9A 3H3UA 5BOXA 2V1UA 4ZYHA 2HQRA 2RN7A 4ESFA 2FBKA 5DCMB 3RKYA 2XVCA 3MQ0A 3FM5A 3HHGA 3RTRA 2HYGD 1TNSA 1JGSA 1FYMA 3VB2A 3KP7A 2DAOA 3L7WA 1FY7A 2K4JA 2OA4A 4CICA 4G7ZF 1I27A 3GXOA 1QZYA 4B8XA 4ASNA 4L9TA 4EJOA 4UV8A 2ZJ2A 4Y17A 3CTAA 6PAXA 4JBAA 2WV0A 5LGTA 3JTHA 4MTDA 4WXDA 2Y0MA 5CVVA 3HOTA 1MJ9A 3MCZA 2B0LA 3L2CA 1IN7A 1QNTA 2VE8A 4N9HA 5CYVA 4G7HF 2QBYB 4CDGA 3K1MA 4A2UA 4S04A 5E1XA 3EUHA 2MH9A 1MDMB 3GYHX 2E7WA 2GA1A 1IN8A 1W5TA 4RB0A 2DK8A 2XAHA 4A0ZA 2PG4A 1T98A 3K9TA 4KICA 1ZG1A 3U9GA 2OD5A 3WODF 4H0EA 2MH2A 1LDKB 2ZBKA 3E5QA 1ZREA 1FSEA 3REOA 1REPC 4I0BA 3BDDA 1O7LA 2FE3A 4KN4X 3V7SA 3IC7A 1T2KA 2O61A 1KU2A 4HX8A 2L02A 5HLHA 3WGHA 1KGSA 2DK5A 2PFBA 2RV8A 2CG4A 4M9SA 1SD4A 3WG9A 3BPXA 1SD6A 2HZTA 1TW3A 3CUQC 2XRNA 3D5LA 3BY6A 1LEBA 4F7ZA 4IF4A 1G3WA 2V79A 2VXZA 2W25A 3C3WA 2CW0F 4HOBA 2Q2EA 2EV6A 4DNCA 5F64A 2UXXA 3HRMA 1TNTA 4I02A 3PQJA 3L00A 4EM0B 5DCFA 1UCRA 1XB4A 2M45A 2QQAA 1BJAA 5TRDA 2IPQX 4XLNF 4DQ2A 1IRFA 3KLOA 1JE8A 2QYOA 4ZZDA 3F6OA 5CVJA 1IN4A 1XMAA 1D8KA 2D1HA 1KU7A 1XN7A 3COAC 2M87A 2V1XA 1JHFA 4UUVA 3BROA 4KYWA 4I2OA 3HRUA 1A04A 2DW4A 2K02A 3BP8A 2NS0A 3R6SA 2ZNYA 3TGNA 4MNUA 2R3SA 2FRHA 2STTA 4CZZA 2OBPA 2YU3A 5HS7A 1FSHA 2M8EA 5IT9Z 1ZAOA 3P9KA 4ESJA 4P96A 1S7AA 1ZGAA 4XLPF 2L4AA 2K86A 1DDNA 3HRTA 5D8KB 2R7DA 1HW1A 2XGXA 4YFNF 2WC2A 2QENA 2CGPA 5BS6A 2HQNA 3EYYA 3J81Z 5L3EA 1ZARA 2DU9A 3MZYA 2FOKA 2FBHA 3CO6C 4GGGA 4OIOF 2Z33A 2K7LA 4OINF 4EJUA 2GQQA 1U3EM 2YPRA 5ICEA 4I0AA 1FOKA 3I54A 2P5LC 4ZH4F 2HOEA 3FXUA 2EFPA 3LAJA 1BI2A 2JPBA 5DUKA 2MLGA 3J80K 4RB3C 4K2EA 2Z9OA 3WTXC 1HKQA 1YQAA 1P4AA 4XSXF 3CO7C 5D4RA 4UV9A 3E5UA 3VOEA 1S3JA 4CXFA 4R8HA 3J81K 1XCBA 1MKMA 3F72A 5K1YA 1FBQA 5J8CA 2GXGA 3KE2A 4Q5SF 3K69A 3HSFA 1ULYA 3G3ZA 1DPRA 2QVOA 3G73A 4HDUA 1USSA 4PCQA 4HAMA 2CYYA 4G6QA 3M8EA 4NHJA 3WTSC 3FXQA 2F5DA 2L54A 5ICCA 1S8NA 4LB6B 2LNBA 4OMZA 4UHTA 1RUNA 1B59A 2QWWA 4BHBA 2K27A 3M8FA 2A6EF 1IXRC 2VBWA 3F22A 1MDMA 1IW7F 4HW0A 5LEJA 2HKXA 5ERIA 2M5WA 3E6BA 3DP7A 4HX7A 4LK1F 4EQQA 4ENKA 4BAYA 2F5EA 2IVMA 2JZYA 2QUFA 1DUXC 2VC1A 1U2WA 1XMKA 1YS6A 2COMA 2VE9A 1PP7U 4LGWA 4RAZA 2CFXA 2JTVA 5AIQA 2VOPA 4OOIA 1B6AA 1MGTA 1BIBA 1Y0UA 3P9IA 2P6TA 2J5OA 4D0PA 2LSOA 1QPMA 2VC0A 1CF7A 1T0FA 2YR2A 3ECOA 3T0YA 3HIFA 1KU9A 2KIUA 4RGUA 3K1NA 3GLXA 2H27A 2FQ3A 2GWRA 4AIKA 2ZKZA 3ZMTA 2DPUA 2O8XA 1WKMA 5HS9A 2FBIA 4LLLA 3RDIA 5LHIA 2HR3A 1F5TA 5HDNA 4G8XA 5HDGA 5BPIA 5DD4A 4LB5A 5FLXZ 3I58A 2RC4A 3KFWX 4S05A 3EQLF 1HBXG 1S6LA 4I09A 2NNYA 5LGNA 2EFWA 5E17F 2GZWA 5KVRA 2BBYA 3QU3A 2EV0A 1ZRCA 2STWA 3BZ6A 3LA7A 5LBQA 1L0OC 3M1EA 4HZFA 3E6DA 5FD5A 2R7FA 3HHHA 4O5VA 5EEHA 1R7JA 1LVAA 2W85A 2K4BA 4TV7A 3CUOA 1Z9CA 2UWMA 2QQBA 4RGXA 1STZA 4U7DA 1XDUA 4L18B 1YW8A 5J6XA 3V8KA 3HYIA 1ZN2A 5AIPA 3EDPA 1O3SA 2Q0OA 3TOBA 1BI0A 3O2PE 2HKOA 3CUQA 1FYKA 4FHTA 1ZLKA 5H6RA 2F2EA 1B4AA 1ZH5A 3J80Z 4QWQA 1KU3A 5D6EA 1AOYA 4IRHA 4M74A 4WXCA 5FD6A 3RPUA 3BWGA 3RYPA 2VBXA 5K5RA 1MJAA 2PBIA 2ADUA 2EFNA 3TKYA 1ONVA 1ZRDA 2A6HF 1B1BA 3MWMA 2RVCA 3BPVA 3Q5FA 5LHGA 4AD9A 5LRSA 4JQFA 4IXAA 5E8IA 5FLXK 3KP3A 5ILSA 1GHCA 4PDKA 4Z2YA 1YLFA 1P4WA 1W7PD 1ZG5A 2V9VA 3TDZC 4ENJA 2IW5A 1BC7C 3GF2A 3LA2A 1W7PA 2PLYA 3I64A 2LKPA 1IF1A 5E8GA 3RJPA 1BN5A 3E6MA 3DEUA 1BBYA 4HX4A 3MEXA 2A5YB 2FNAA 1HW2A 1YG2A 2DLLA 5K5OA 1J9IA 3E5XA 3KZZA 3N4MA 2OU2A 2NYXA 1D8JA 1TBXA 2ZMEB 2RGVA 2AXLA 3KEQA 3I71A 4A5NA 1LEAA 3R0AA 4B09A 2EV5A 2PN6A 1FBUA 4LLNA 3WU1B 3ZMVA 4MQVA 1IZ1A 4IVNA 3D0SA 4HDVA 1DP7P 3TO7A 4L9JA 1OKRA 1R00A 4ON0A 1PP8F 1W4MA 2DBBA 4BHCA 5HOOA 2AS5F 2W57A 3CJNA 5CVRA 3PQKA 2OQGA 4M71A 1PDNC 4U0VA 4M6XA 2HDCA 2IRFG 1YW9A 3KP4A 3WTVC 4M73A 3C1DA 1ZRFA 1TLHB 1W5SA 2H6CA 2EK5A 2O0YA 5CJ9A 3NRVA 4ZYEA 5D8LB 3TO9A 3F8FA 1G6NA 2E7XA 1ZG3A 4L5IA 2VT3A 4YIIA 1JXSA 3HSRA 1FPQA 2DI3A 4A12A 2RKHA 1I1GA 4M6YA 5E18F 3LFKA 4KMUX 1IN5A 4HV6A 1JHHA 3U2RA 1FYLA 1KYWA 4Y15A 3FMQA 1LB2A 2DT5A 2QM3A 4BQAA 4LG0B 3VEPA 1ODDA 1ZYRF 4I7HA 3EYIA 5IT9K 3QP6A 2PQ8A 1BM9A 1EH8A 4R79A 2HWVA 3E6CC 3M9AA 1IRGA 1WWXA 1GVJA 3KETA 3ECHA 1G4DA 1KA8A 4MEXF 2IA1A 1P6RA 4IPAA 3S2WA 2A61A 2HEOA 1Q1HA 2DFIA 1H9TA 5CVUA 4L0ZB 2CQKA 4A6EA 5DYMA 1QBJA 3ELKA 4P5OA 1U5TC 3TQNA 2V6CA 2XKOA 4CO8A 4LG0A 2BE5F 2D1VA 1ON2A 3OOPA 2BYVE 2MLKA 1XGNA 3P7NA 2Y75A 5F6FA 5HVQC 4BXUA 4MEYF 4OIQF 2ESHA 3QP5A 1HXDA 2M1BA 4EV0A 3BJAA 4EJWA 1USTA 2VODA 4GCVA 3V7RA 1W7PB 3QPTA 5D5XB 2E1NA 3FF5A 2Z99A 4RGSA 2MA3A 1T6SA 3FM3A 4KA4A 2A69F 1KYZA 2EJRA 5FGMA 1WQ2A 5LGUA 2L01A 2RNJA 3ABTA 1R23A 3LQQA 4HF0A 3ABUA 4O3MA 3SXYA 3FHZA 3ERED 2HYFA 5L3FA 1SFXA 3RKWA 3TOAA 4E70A 2KIMA 2XV4S 5HS8A 2O6GE 4LK0F 1XGMA 2XHKA 2GAUA 2FU4A 4G94A 3K1PA 3VFZA 3R4KA 4HF2A 1R22A 2XUBA 2LF8A 1B9MA 4KFCA 3T8RA 4OU0A 3IHUA 1QQIA 4ENMA 4G9YA 3ZN1A 1R1TA 1OYWA 3WTWC 3WGIA 1GXQA 4KT5C 5D5WB 2A68F 1O3RA 1OYIA 5E1WA 4GO1A 1Z6RA 2RDPA 4BYYA 1OPCA 2LF7A 3RIRA 3SHFA 4EJVA 2BV6A 3GFLA 3DFGA 1SMTA 3O3KA 3FMSA 3CLOA 1C0WA 1XD7A 5FO5A 4ZZLA 5D6FA 3HTUA 1B9NA 3PFIA 3GO5A 3JAMZ 3HOSA 2HFHA 4YFXF 4PGHA 1SFUA 3KZYA 2EA4A 2DPDA 2X4HA 1K79A 4LFUA 4HLXA 3HTSB 4PZJA 1LNWA 5L3BA 2IP2A 2W84A 3GFJA 3Q9SA 3I5UA 3ZP5A 1YS7A 3KEOA 4LMYA 1XSVA 4R1HA 1FBSA 3HSEA 2H6BA 1P4XA 1LJ9A 1D3YA 1Z91A 3DXJF 1P92A 3DF8A 3BJOA 3SZTA 1UHWA 3BOQA 5H6QA 2PMHA 4L9VA 2KIFA 2EWNA 2CSOA 3JAMK 4HQEA 3JTGA 2FNPA 4G7OF 2M30A 1VTNC 4U88A 3RYRA 1CGPA 2XROA 1XDSA 1F4KA 3C7JA 2P4WA 1E17A 4KIFA 4WX9A 4KDPA 4EMSA 3LAPA 4Y13A 4ZYDA 2TDXA 2XAGA 3QAHA 1IXSB 3QPHA 3HRSA 1QGPA 4CHUA 4EVIA 1SD7A 1FLIA 4ENNA 3ISPA 1HQCA 4M9XA 1F1ZA 1WSUA 3FXRA 3H3ZA 2FMYA 4GYGA 2QBYA 4HYEA 3F8BA 1FX7A 3KP2A 4LLGF 2OQRA 1P2FA 4EM2A 3CDHA 4RGRA 2VONA 2D2WA 1U5TA 3I0TA 2ZMEA 2XAQA 3F3XA 2PJPA 3GVAA 2Y48A 1R1VA 1R58A 4L9NA 4LJZF 4KN7X 1XGSA 3KCCA 1LDDA 3QOPA 1LQ1A 1O7FA 4EM1A 1H9GA 4YFKF 1YFHA 1J5YA 1G3SA 1J75A 4AIJA 3GUDA 5A2QK 2MD5A 5A2QZ 3T8TA 1KQ9A 5DV5A 2JRTA 3RKXA 3RPQA 4RB2C 1O3TA 1OMIA 2Z5UA 1I5ZA 5KK1A 2HGCA 2HTSA 2IT0A 4BNCA 2ZO4A 5LEKA 3MZHA 2E1CA 2J5PA 4HQMA 3EETA 4UVAA 1SAXA 1BOAA 2FXAA 2ETHA 4RAYA 2VBYA 5D5UB 2IA2A 4XBFA 4EGZA 1S7OA 4KNYA 2ELHA 3T5XA 1RNLA 3GZ5A 1Z1DA 1MZBA 3ZPLA 4IHTA 4MHGA 1BC8C 3T1BA 3FX3A 5E1ZB 1NHAA 1YO5C 1IAWA 2YSRA 2MBFA 2EFQA 3IRQA 1J7KA 3R0JA 3SZPA 3E97A 5DUIA 3F21A 5H20A 3IRRA 4MQ9F 3IWZA 2ESNA 1Z6TA 3QU6A 3LWFA 2YX7A 1O3QA 5BQTA 4A0XA 2CO5A 3B73A 2VT2A 2VN2A 1H0MA 1ZHFA 2XAJA 5HLIA 4OIPF 1YIOA 1HKSA 1MD0A 1BIAA 1E2XA 4XSZF 5LHHA 3R60A 3DPTA 3ROUA 2NNNA 4EJTA 4JK1X 1V4RA 4IHSA 2FSWA 4FX0A 2F5FA 2P8TA 3F8MA 2WTEA 4ESBA 5LLQA 1U6GA 1YYVA 3ZMUA 3ZQ7A 1TQIA 2CWEA 4NB5A 3AAFA 2ZFWA 2H09A 2G9WA 3WE3A 2EB7A 3VODA 2DQLA 2HTJA 2H94A 3OV8A 3FWEA 3BJ6A 2IA0A 4U0YA 4QLCU 2FMLA 4YIFA 1YW7A 4HF1A 4CGZA 2FF4A 2L3DA 3E3VA 1Z7UA 3KP5A 1EH7A 1XSDA 5D4SA 3WTYC 2VOOA 1DPUA 3GFMA 1WRJA 3I4PA 2W24A 4P9FA 2UXNA 2IJLA 1XCVA 2UZKA 3ML6A 3JW4A 4AVPA 1U78A 3LSTA 4OIRF 2JT1A 4HLYA 1J0RA 2G7UA 1PUEE 4HV5A 3WGGA 2KJBA 4P9UA 1O57A 2ISZA 5E20A 3MFKA 2DQRA 5HLGA 4LD5A 3GZ6A 2BEOA 4RB1A 1T39A 1D5VA 5AONA 4GYIA 4OMYA 3DPLC 3V8LA 5F1RA 4N0BA 2ACJA 1QO0D 1RZ4A 5ILVA 5TJJA 1CF7B 1S29A 1K78A 1TW2A 1IXCA 3ZN0A 3GEZA 5BPDA 3Q9VA 3GW2A 4PGGA 5K5QA 1X3UA 1SFEA 4WK8F 2JSCA 1FP1D 1SD5A 1WI9A 2X0LA 4N9IA 3MAJA 1IUYA 3IKVA 1RIOH 4G6DA 1KQ0A 1YTYA 5ILUA 5JVTA 1L3LA 2QZ8A 2YX4A 2RQPA 5CLSA 3V8JA 3JSOA 1FT9A 5JR3A 4I98B 1T38A 2NRAC 5ICFA 2Q8KA 3ZMDA 2MC3A 5JHUA 1ZLJA 1FP2A 2XASA 1BI1A 2OZ6A 5DEQA 4WF2A 1TTYA 3I59A 4MTEA 4WCGA 4IRIA 2ZNZA 4AWXB 3IKTA 3CUQB 4IRGA 4ZYGA 4Q47A 3WE2A 2PI0A 2KJCA 1IN6A 2P5KA 3JSPA 4U0WA 4IJAA 3J7AO 2P7CB 2QLZA 5JI6A 3W6JB 5L3CA 2GA2A 3IWFA 3NQOA 3L9FA 2NAZA 3ULQB 3V7CA 4KIBA 3WTTC 4FX4A 2VBZA 3NEUA 4KIGA 1UFMA 4L0YB 2C6YA 1EH6A 1HSJA 1R5HA 1J2XA 3W6KB 2ISYA 5D5VB 3I53A 2KKOA 4BHPA 1SMYF 3I59B 3F8NA 2XIGA 3KLNA 1R36A 4A5MA 2L4MA 2A3SA 2PMUA 2XAFA 4XRFA 3SQNA 4Q48A 4ETSA 1OYYA 3HUGA 4M72A 4L5JA 1AWCA 4M9ZA 1J59A 2XKPA 3FMRA 1FNNA 2P5VA 2ZXJA 5J8FA 1XGOA 1BI3A 1MJBA 2P7VB 5FFZA 3DKWA 4UXNA 1TQPA 5LRRA 1GXPA 3ZMZA 1XSXA 2O3FA 4Q4ZF 1HSTA 3L09A 1U8RA 2DO7A 3C18A 4BH9A 3TDUC 4O6JA 4UVCA 1G3TA 3U1DA 4UNOA 5ICGA 5BMZA 3K0LA 1ZGJA 1U5TB 1HW5A 2KRFA 3FZVA 2HS5A 3ZMSA 4WWCA 4AIHA 5FB2A 3LQRA 2PEXA
chains in the Genus database with same CATH superfamily
3LA3A 3KIOA 2R5YA 4YG2F 2HVQA 3DQVC 4RDUA 3GTMJ 3RI4A 2A07F 2HPIA 1D1AA 1VF9A 2YUSA 4WXHA 1S72I 1RI7A 1JJ6C 2DA7A 2D45A 3DV8A 1K78B 3CCQI 3D5SC 3F23A 2DDAA 1K7AA 3IL2A 1EF4A 2DTRA 1TQMA 3KP6A 1DP3A 5LFAA 2CFOA 1GUUA 3TO6A 1FWZA 3WTZA 3EUAA 2VLAA 3A0BC 3K4LA 4P55A 4FASD 3QRFF 1R4NB 1FC3A 3V4GA 1RUOA 3P9CA 4KUMA 4RLFA 2AQFA 4RS8A 2WV1A 3PUBA 1SC7A 5DD8A 1F9NA 2GIVA 2L0KA 3HJEA 3OR2C 1N77A 5ED4A 5HDKA 4A0YA 1I1SA 2K9QA 2BGCA 5IYBJ 5J4YA 2WWYA 3K2ZA 2CUZA 2P6SA 3GX4X 1UHMA 2CV1A 1QZZA 3RCOA 2JPCA 1QZEA 4XM3A 3FHNA 3GFIA 3GWZA 2QKLB 1P7JA 4CYDA 5C3EJ 1UB9A 4HNUA 1HCRA 3WU0A 4HA8A 5IT3A 1S9HA 1KQ8A 2VL8A 1TC3C 2LDUA 2LMDA 3F8CA 4G6TB 1RPWA 1OR7A 2O03A 5L3DA 1Y6IA 2BY0A 4MGRA 5JFRA 2F5CA 1R5GA 5DCMA 3J7AY 1ON1A 4I01A 3SFZA 2G7HA 2DODA 3R61A 4HSTA 4RBOA 1Z05A 5B1BH 2FEZA 3BG6A 4UVBA 1MSEC 3B02A 3CP2A 1DU0A 1G3YA 1EV7A 3K10A 2EA2A 1FZPB 4NQWA 3A1YA 1T0FC 4EGYA 2V1DA 2OZUA 5E3LA 2EZLA 2Z3YA 4AC0A 2FA5A 3M7GA 2E2IJ 3H92A 3VDXA 2GXBA 4D7MA 5DDGA 3N97A 1Y39A 1J09A 4BE0A 4IHYA 4KMFA 2ZCWA 4KITB 4FT8A 5FFXA 2EZIA 1X1AA 1AU7A 5GP9A 4U7BA 4A3MJ 2DOFA 4GXOA 3OYMA 5CVIA 1K6OA 4ITVA 1I6XA 1V3FA 3AL0B 3O6BB 2F4MB 4HBLA 4ZYAA 3BR0A 3PNTA 4YIRX 2XB0X 2ZXWH 3F6VA 4BBSJ 1LDJA 1HKTA 2WAFA 2EFOA 3WTUC 4H4KC 4A6DA 2R0QC 5L3GA 2OAZA 1R1UA 4XONA 1VQLI 2EZKA 5E79C 5EEGA 2DA3A 2QQ9A 2JA8J 3SJMA 3H3UA 1TT5B 5BOXA 2KIQA 2V1UA 4M6VA 4ZYHA 2HQRA 1Z77A 2RN7A 4ESFA 2FBKA 5DCMB 2JN6A 2MABA 3RKYA 2XVCA 1LFUP 1Z3XA 3MQ0A 3CLQA 1IO2A 3FM5A 3HHGA 2M35A 1R71A 3RTRA 2HYGD 1TNSA 1JGSA 1FYMA 4E7KA 3VB2A 1TWGJ 3KP7A 2DAOA 3L7WA 1FY7A 2K4JA 5GAHJ 2OA4A 4CICA 3GXOA 1I27A 4G7ZF 1QZYA 4B8XA 1LVKA 3IH2A 4L9TA 2ME6A 4ASNA 3WU2C 3B6AA 3IAM2 1YOVB 4IL6C 2HNHA 1LUJB 4EJOA 4C2UA 4UV8A 2ZJ2A 3GMEA 5J1UA 1FOXA 3RSNA 4ANJA 3K4BA 4MLOA 1ZTRA 2KMUA 4Y17A 2O9LA 3CJRB 3CTAA 5FROA 2Y2ZA 6PAXA 4UUTA 1LFBA 3DBHB 4JBAA 3O8GA 2WV0A 2VJJA 2WA0A 3H9JA 5LGTA 3JTHA 1HDDC 5M3FJ 1P9QC 3AG1H 4IZZA 1U0JA 4C3HJ 5HNFA 2EQRA 4MTDA 4WXDA 2Y0MA 5CVVA 3HOTA 1MJ9A 3ZOBA 3MCZA 2B0LA 3L2CA 2KDOA 1IN7A 1QNTA 2VE8A 4N9HA 5CYVA 3BR3A 5F0FA 4G7HF 4CDGA 2QBYB 2R7SA 2LRDA 3GTJJ 3K1MA 1VQPI 4A2UA 3P5JA 2LG4A 1W36C 4S04A 2W4SA 5M5YJ 3KZIC 2TRTA 2PX9A 5E1XA 3EUHA 2MH9A 4MO7A 3GYHX 1MDMB 2KT0A 3WG7H 3OIOA 4PFOA 2E7WA 4BQOA 3HDDA 2GA1A 2X85A 3OOUA 1IN8A 1BJZA 1W5TA 3S1MJ 4RB0A 4II2A 2DK8A 2XAHA 3AKZA 5M3MJ 2ELKA 4P1WA 1YJ9I 3PIPF 4A0ZA 2CU7A 2E34A 2QCOA 2PG4A 5FKKA 1T98A 3K9TA 4XOTA 4KICA 4AYBA 1ZG1A 2IGNA 2UUZA 3U9GA 2OD5A 2CQ7A 3AFHA 3WODF 3ZQIA 4V2FA 3K4KA 4H0EA 3A02A 3DTKA 2MH2A 1R9TJ 3CCJI 1LDKB 2ZBKA 3E5QA 3TP0A 5DM7F 3GTLJ 1ZREA 1FSEA 1IRZA 2CH0A 3REOA 1REPC 4I0BA 3BDDA 1O7LA 2FE3A 4KN4X 3V7SA 3IC7A 1T2KA 1YHQI 3DTEA 2O61A 1KU2A 4HX8A 2L02A 5HLHA 3WGHA 1KGSA 2DK5A 3CMEI 2PMZN 1RR7A 2PFBA 2L5QA 2RV8A 2CG4A 4M9SA 2JA2A 1SD4A 3H36A 3WG9A 3BPXA 1RKWA 1SD6A 3BTIA 1VZ0A 2HZTA 1TW3A 2LVSA 3CUQC 2XRNA 4A3BJ 3D5LA 2L7KA 3BY6A 1LEBA 4F7ZA 2EIKH 2HDWA 2EIJH 1ETXA 1UELB 4JX6A 4Y7NJ 1MBHA 4IF4A 2XSJC 4LIUA 2LY2A 1G3WA 3DU6A 3DCFA 1A5JA 2V79A 1HF0A 2VXZA 2W25A 3C3WA 4Y4RA 2CW0F 4HOBA 5HODA 3MKZA 1OISA 2Q2EA 3GTKJ 2EV6A 2K9NA 4DNCA 2Y69H 4NNJA 5F64A 2UXXA 3HRMA 1TNTA 3DKYA 3BT9A 1IGNA 1T95A 4I02A 1FMWA 1UZCA 3DU5A 2L7FP 3PQJA 3L00A 4EM0B 2OV7A 5DCFA 2HVRA 1UCRA 1XB4A 2D5VA 4XLEA 2M45A 1ORKA 2QQAA 3CJQB 1BJAA 2R7QA 5TRDA 5EJCA 3HM5A 2IPQX 2F6CA 5EYRA 4XLNF 4C2TA 4DQ2A 1IRFA 1WH7A 3KLOA 1JE8A 1MBFA 2QYOA 3ONQA 4ZZDA 4EEFG 4CCKA 3F6OA 2ME0A 2K9SA 1IN4A 5CVJA 1RQ6A 1XMAA 5K7ZA 2LY1A 3A4CA 1D8KA 2MG4A 2D1HA 2K3PA 3S3MA 1MIJA 1KU7A 1GDTA 2DMTA 5M5XJ 1XN7A 1YJNI 3COAC 1SFOJ 2M87A 3SEZA 2MYSA 3QPSA 2V1XA 2IBDA 1JHFA 1HOMA 4DYQA 4UUVA 3BROA 5EZGA 2FQ4A 2LYCA 4KYWA 4I2OA 2BXZA 3HRUA 1A04A 4NDLA 2E36A 2DW4A 2K02A 3BP8A 1AA7A 3PO3J 5C4JJ 2H8RA 2NS0A 3R6SA 2EPFA 3W6VA 1W0UA 2ZNYA 2ZFUA 3TGNA 2XGCA 5FKLA 4BY1J 4FE4A 4MNUA 2R3SA 3BTCA 2FRHA 4BEHA 4FISA 1TL8A 2STTA 4CZZA 2OBPA 1D0ZA 3CC4I 5JVGF 2CQQA 2F4IA 2YU3A 5HS7A 1YJWI 2M8EA 1FSHA 3G1LA 1V5EA 5IT9Z 2MW8A 1MMGA 1ZAOA 4C3IJ 5GAEJ 1H89C 3P9KA 4ESJA 2WADA 4P96A 1S7AA 1ZGAA 1T8IA 3CJTB 4XLPF 2L4AA 2K86A 3OSFA 3TEDA 1DDNA 2O7OA 2H1LA 3L2UA 1ZQ3P 4BDZA 3HEFA 1DQUA 4DZJA 3HRTA 4PJJA 2CV0A 5D8KB 2R7DA 1HW1A 2XGXA 2ZXHA 4XOPA 4YFNF 2WC2A 2QENA 5EGOA 2V9PA 2CGPA 5BS6A 2HQNA 3EYYA 4KJZA 5L3EA 3J81Z 3H1CA 1ZARA 5CPRB 2JSPA 2XSDC 2DU9A 4BE2A 3HG9A 3RQIA 3MZYA 2FOKA 2FBHA 3CO6C 1QPIA 4BGDA 4GGGA 4OIOF 2Z33A 5C44J 3EPZA 4HEA2 1WZ2A 5KHDA 3I4NJ 1FEXA 2K7LA 3OYFA 3CZ6A 4OINF 4EJUA 2GQQA 4B44A 1U3EM 2YPRA 5ICEA 2EH3A 4I0AA 1FOKA 3I54A 5A2QR 1YITI 2P5LC 4L5EA 4ZH4F 2HOEA 3FXUA 2EFPA 3LAJA 1X1PA 1BI2A 1WPKA 2JPBA 5J4VA 1RESA 5DUKA 1N78A 2MLGA 3J80K 1R5ID 4OWRB 2DA4A 4K2EA 4RB3C 1IG7A 1ITYA 3IH3A 2MFZA 2Z9OA 3WTXC 1HKQA 1YQAA 1ETQA 1P4AA 2HOTA 4XSXF 1POGA 1EKEA 3CO7C 3HXLA 5D4RA 1LE8B 4UV9A 4RLQA 2CUEA 2A05A 4DW6A 4PSXA 3E5UA 3Q0VA 4BUPA 4YELA 2R7WA 1ETOA 1MW7A 3VOEA 1IV8A 4DBQA 1S3JA 4CXFA 1WGXA 3G1MA 1U8BA 3JCUC 4R8HA 3J81K 1XCBA 3E7LA 5KCMA 3OIPA 3X2QH 2VXDA 4BBRJ 3CCVI 1MKMA 3F72A 3LSIA 5K1YA 4V19K 1FBQA 2KQRA 5J8CA 4J01A 1B8IA 1DU6A 2GXGA 3G4SI 1ZELA 2MSYA 2XC7A 2KZGA 3KE2A 4Q5SF 3K69A 3HPHA 3HSFA 2JA7J 2JUCA 3DPUA 4UUSA 4YEJA 1LE8A 2BY3A 1MNMC 1WJDA 2L9SA 1ULYA 3G3ZA 1XMXA 2X51A 1IRXA 2IGKA 3ASOH 1DPRA 2QVOA 3G73A 4HDUA 1VQNI 3S16J 1USSA 4HNVA 2IS4A 4PCQA 1TWHJ 3BQZA 4ZC3A 4HAMA 3UR3C 2DXIA 2CYYA 4G6QA 3M8EA 3TL4X 2HQAA 4NHJA 3WTSC 3FXQA 2F5DA 1NG6A 2L54A 5ICCA 3SFIA 1S8NA 4LB6B 2CV2A 2LNBA 4OMZA 4UHTA 3ZRGA 4AM3A 1JGGA 1RUNA 5HLTA 1B59A 2QWWA 2BVMA 2M4GA 1WJFA 2NVXJ 4BHBA 5HNHA 1FTTA 2K27A 3M8FA 2A6EF 1IXRC 2VBWA 4OAZA 3F22A 1MDMA 3AL0C 3CC7I 2VKDA 1IW7F 4HW0A 5LEJA 2DMNA 3S3NA 2HKXA 4KT6A 5ERIA 2M5WA 3E6BA 2X1EA 3DP7A 4HX7A 5FKMA 5JLWA 4LK1F 5FLMJ 2OCEA 3HOXJ 4EQQA 4ENKA 2ZJQF 3IAS2 4B3AA 4ZDOA 3CCUI 4MIMA 4BAYA 1MMNA 1OJLA 1SVMA 3HB9A 2F5EA 2M3AA 2IVMA 4W1UA 1VQOI 2JZYA 3CD6I 4F92B 4I6ZA 3OYCA 3OYDA 2QUFA 1O4XA 1DUXC 1SANA 2VC1A 1U2WA 1XMKA 4BQQA 3S14J 3CCRI 1YS6A 2COMA 2HPMA 2VE9A 4KISA 1PP7U 3BG9A 3OIQA 1EJ9A 1I6HJ 4LGWA 4RAZA 2CFXA 2JTVA 5AIQA 1FMVA 4HSRA 2VOPA 2DDBA 4OOIA 4XKWA 3ZQHA 1B6AA 1OCRH 2XF7A 1ACIA 1MGTA 1BIBA 1X2MA 1Y0UA 5B3SH 3P9IA 2P6TA 3LNQA 2J5OA 2X6XA 4D0PA 2E60A 2LSOA 1G2HA 3AG2H 3S15J 1QPMA 2VC0A 4M3GA 2VQLA 1U9NA 1CF7A 1T0FA 2YR2A 3ECOA 3T0YA 4QIWN 3HIFA 4XLFA 1KU9A 2E5ZA 3S8PA 1PJRA 2KIUA 4RGUA 3K1NA 2JA5J 1S7EA 2DFHA 5J3LA 1ERDA 2KLOA 3OYKA 4HNTA 3GLXA 2H27A 2FQ3A 2GWRA 4AIKA 1W36D 1K83J 2ZKZA 3ERMA 3ZMTA 2DPUA 4XIDA 2O8XA 2HOAA 1WKMA 5HS9A 4ZDLA 2Y30A 2FBIA 4LLLA 1Z0XA 1S5LC 3RDIA 5LHIA 2HR3A 5HDNA 1F5TA 1YIJI 4G8XA 5HDGA 4AIDA 3C2HA 5BPIA 1VQ9I 2R4GA 3OL3A 5DD4A 3KPHA 3PJRA 5FLXR 4LB5A 5FLXZ 3I58A 2VKVA 2RC4A 2W48A 3KFWX 4NC6A 3EQLF 4S05A 1FTZA 1HBXG 1S6LA 2JJ7A 4I09A 2QQ8A 2NNYA 2R5ZB 5LGNA 2Y31A 2EFWA 5E17F 2GZWA 5KVRA 2DYSH 2BBYA 2ID3A 3QU3A 4BXXJ 2EV0A 1VQKI 1TZLA 2CQNA 1ZRCA 5FJ8J 1XS9A 2STWA 3BZ6A 3LA7A 5GADJ 3PM1A 5LBQA 1L0OC 4D1QA 1NG7A 5F08A 3CF5F 1B72B 3M1EA 1JTXA 4HZFA 1QHHD 1X1BA 3E6DA 5FD5A 4ABZA 1X3WB 4B43A 3JRGA 2ICWG 3QQAA 2R7FA 3HHHA 4O5VA 2Z16A 1BR4A 5EEHA 1ETVA 1LPQA 4FCYA 3ZQCA 3RZOJ 2V9KA 4A3GJ 1R7JA 3BG7A 2R93J 1LVAA 2W85A 2K4BA 3FK7A 4TV7A 2WBMA 3CUOA 2K9LA 3LSMA 5KAIC 1HC8A 4B3XA 4BL0B 4E4HA 1Q1VA 4W97A 2FX0A 1Z9CA 1AHDP 2UWMA 2QQBA 3QODA 4RGXA 1STZA 3S1NJ 1JT6A 4U7DA 1XDUA 4C3JJ 1YW8A 4L18B 5J6XA 3V8KA 2PMZA 3HYIA 1ZN2A 5AIPA 2V7FA 5IY5H 3BR2A 3EDPA 1UJ8A 1O3SA 3QYFA 2Q0OA 3TOBA 1YX5A 1BI0A 3EUHC 2HKOA 3CUQA 3O2PE 1FYKA 1H8AC 2NOJB 4S0HB 2IAIA 4FHTA 1ZLKA 1OCZH 3JREA 3LSRA 2CW8A 5H6RA 2F2EA 4A3EJ 1B4AA 3MKLA 4PFPA 3ZR8X 3PNVA 3QWLA 1ZH5A 1XC5A 3J80Z 2COBA 4QWQA 1KU3A 5D6EA 5IP7J 1AOYA 5GAGJ 4IRHA 4M74A 4WXCA 5FD6A 3RPUA 2XRLA 3TBIA 3BWGA 3RYPA 2RREA 3HOUJ 4UUSB 3OS2A 2E1MB 3CF2A 2VBXA 5K5RA 1MJAA 4U87A 2PBIA 2ADUA 2EFNA 3TKYA 1ONVA 1UG0A 4BKXA 1ZRDA 2A6HF 1B1BA 3MWMA 2RVCA 3BPVA 3I56I 3Q5FA 2W00A 3J7YJ 3GLLA 4XRSG 2BHYA 5LHGA 3PUFA 4AD9A 1KZHA 3RQ4A 5LRSA 4JQFA 4PUSA 4IXAA 1QA6A 5E8IA 5FLXK 3KP3A 1K6YA 5ILSA 2DOEA 1GHCA 2NVYJ 4PDKA 2W82A 1IJWC 4Z2YA 1YI2I 1YLFA 1ZKGA 5E3NA 1P4WA 5EGOB 4HPQA 2KRCA 2G0EA 4DGWB 2K5CA 1W7PD 3OMYA 1ZG5A 1ETYA 4E7ZA 1RR8C 2V9VA 3EUKL 3TDZC 4ENJA 2IW5A 1MMSA 1BC7C 3OYEA 3GF2A 2MC4A 1W7PA 3LA2A 2PLYA 3I64A 3S32A 2LKPA 3CMMA 2MGQA 5E8GA 1IF1A 3RJPA 1BN5A 2LC2A 3E6MA 3DEUA 1BBYA 3HC7A 3MZ8A 3MVPA 4HX4A 1X1DA 3MEXA 2A5YB 2FNAA 1HW2A 2WB1N 1YG2A 3ABLH 5IOZA 4GDFA 2DLLA 3C2GA 9ANTA 4XLHA 5K5OA 1J9IA 3JRBA 1T56A 3E5XA 3KZZA 3N4MA 2OU2A 2NYXA 3QOEA 1D8JA 1TBXA 2ZMEB 1JT0A 2RGVA 2AXLA 5JLXA 1R4MB 4D9JA 2VPLA 3KEQA 1WJEA 5B5EC 3RZDJ 3I71A 4A5NA 1LEAA 2GBYA 3FXMA 3R0AA 2GLOA 1WH5A 4B09A 2EV5A 2PN6A 3CCMI 1FBUA 4IQ4A 2CMPA 3K4NA 2KHMA 1FIAA 4LLNA 4BY7J 3WU1B 3ZMVA 2TCTA 4MQVA 1IZ1A 1AKHB 4IVNA 3G71I 4XLCA 2ZC2A 2ZSIB 1A6IA 3D0SA 1LFPA 2ZXIA 4HDVA 1IUFA 1DP7P 4ZTJA 3K2AA 3KYCB 3TO7A 4L9JA 1OKRA 1R00A 3LSJA 4ON0A 3WHCA 3FBIB 3HKZA 2DA1A 3VYUB 4X0GA 1PP8F 1W4MA 1FOYA 3Q0UA 2DBBA 4BHCA 5HOOA 3A0HC 3ESWB 3L2QA 1QHGA 2DA5A 2AS5F 2XGDA 2WB1A 2W57A 4A3DJ 3CJNA 5CVRA 3PQKA 4RM3A 4V2GA 2DA6A 2EINH 3LOCA 3SZGA 2OQGA 4M71A 1PDNC 4U0VA 4M6XA 3CC2I 2HOSA 2MUNA 3FIWA 2HDCA 3LSHA 4XR6A 2IRFG 1YW9A 3KP4A 2LTPA 4M73A 3C1DA 3WTVC 1ZRFA 4IHWA 3DEWA 1TLHB 4BS9A 4IHXA 3FISA 3S1RJ 1VQ4I 5IT9R 1W5SA 2H6CA 2ZJRF 2EK5A 2X98A 2JRMA 2O0YA 2Z2SB 5CJ9A 3S3OA 3BQYA 3NRVA 4ZYEA 5D8LB 3TO9A 3E1SA 2RAEA 2VKHA 4ZDPA 3CCSI 3F8FA 2BXYA 1G6NA 2E7XA 3DLLF 1V55H 1ZG3A 3M4OJ 2QGUA 1OCCH 4L5IA 3ZQFA 4A3FJ 2VT3A 3JRDA 4PJNA 1VQ6I 4YIIA 3VSLA 1JXSA 3HSRA 1FPQA 2Y9YA 3DBRB 4A3KJ 2IS6A 5LD2C 2DI3A 4A12A 1DGWY 2RKHA 3H5RA 5GPCA 4BACA 2R92J 1I1GA 4M6YA 5E18F 3E0JB 2LY9A 2BZTA 3G2BA 2KP6A 3LFKA 4KMUX 1IN5A 1ETWA 4CH7A 4E7HA 4HV6A 1JHHA 2HU9A 3U2RA 5B1AH 1BL0A 1FYLA 1KYWA 4Y15A 2MD0A 3FMQA 1LB2A 3TW6A 2DT5A 2QM3A 3HOYJ 1MH4A 3SEQA 2M0CA 4BQAA 4AUXA 4LG0B 2DT6A 1FIPA 3HPGA 4LIVA 3VEPA 1ODDA 1ZYRF 1T08B 4I7HA 4XN3A 3EYIA 5IT9K 3ASNH 1OCPA 1XX5A 3QP6A 4ZJZA 2PQ8A 1BM9A 3H5NA 1EH8A 5F04A 1VQ5I 2AO9A 3ZQGA 4OAYA 4CCLA 5F27A 4R79A 2HWVA 2CRGA 4LITA 3M9AA 1P7IA 3E6CC 1IRGA 3ZGKA 1WWXA 2GM4A 2VASA 3HOVJ 1GVJA 4HRIA 2A5WA 3KETA 2OCCH 3ECHA 1G4DA 1B8IB 5FRNA 2GOXB 1X3ZB 3JR9A 1KA8A 4MEXF 2JVGA 2IGOA 2IA1A 1MNDA 1ZGWA 3CCLI 1P6RA 2B7EA 4PJMA 1UHSA 4IPAA 3S2WA 2A61A 3VYTB 2HEOA 3CP8A 1Q1HA 2XPUA 2DFIA 4IQJA 1OCOH 1H9TA 5CVUA 3K70C 4L0ZB 2QEXI 4IKFA 2CQKA 4AU7A 4A6EA 4F93B 5DYMA 3W2VA 4NC8A 1QBJA 4M3DA 4FTHA 3KYLA 2B63J 3ELKA 2OF7A 1Y0NA 4P5OA 4GFBA 1U5TC 2BY1A 3TQNA 2V6CA 1JTYA 3CDLA 2XKOA 1UG2A 4CO8A 5J40A 4B1RA 2Q1ZB 5M5WJ 4IX7A 1M1EB 2WAQN 1MBJA 4M3EA 4LG0A 1VI0A 2BE5F 2D1VA 1ON2A 3OOPA 2BYVE 3I9V2 2MLKA 2BW3A 1SFKA 2CW7A 1XGNA 3P7NA 3L2WA 3UKGA 2Y75A 2JVHA 5F6FA 4CZCA 5HVQC 2NS8A 1JKRC 2P81A 2JK3A 4BXUA 4MEYF 4OIQF 2ESHA 2JA6J 3FXKA 3QP5A 2VQGA 1HXDA 3CMAI 2M1BA 4EV0A 4J00A 2P0WA 3BJAA 4EJWA 1USTA 2VODA 3GTOJ 3M3YJ 4XLAA 4IOAF 3FKJA 2ECBA 4GCVA 3MKYB 3V7RA 1W7PB 3QPTA 4GRIA 5DS9A 2L7MP 4N4OB 5D5XB 2E1NA 3NARA 2AXTC 2AQEA 3CCYA 5TGTA 2L9NA 3FF5A 2ZJPF 2Z99A 3VPRA 4RGSA 4CUGA 3FDYA 2OUMA 2MA3A 3F0CA 1T6SA 3FM3A 5F0CA 4D7NA 4KA4A 2A69F 1KYZA 2EJRA 3K4CA 5FGMA 1WQ2A 3VYSB 5LGUA 2L01A 2RNJA 1MBGA 2DA2A 3ABTA 1W1WE 1R23A 3LQQA 1OFCX 4HF0A 1W0TA 3ABUA 2Y9ZA 4O3MA 3H9GA 3SXYA 3FHZA 3ERED 2HYFA 2V1NA 2L9VA 1VFCA 5FLVA 5L3FA 3S2HJ 5IYDJ 2OPTA 1SFXA 1QVTA 3RKWA 1TP4A 1FOWA 2K3FA 3TOAA 2KIMA 4E70A 1PUFA 2XV4S 4BJ6C 5HS8A 5EF6A 5CKTA 2JQ7A 4DJAA 2O6GE 4M3BA 1GT0C 2DFEA 2HDDA 4PJ0C 2LBFB 2HXOA 3LSKA 4LK0F 1XGMA 2XHKA 2GAUA 3QYBA 2FU4A 3LMMA 3I55I 4G94A 3K1PA 3VFZA 3R4KA 4HF2A 1R22A 2Y0SN 2R7RA 2XUBA 2LF8A 1B9MA 2ZMEC 2XAUA 4KFCA 4EATA 3N05A 3T8RA 4LG3A 1RC9A 2B9SA 4BXFA 3FKIJ 4OU0A 3IHUA 2VKEA 1D1CA 2I8DA 1QQIA 4ENMA 3OYAA 1F36A 4G9YA 3ZN1A 3G1OA 1R1TA 4PJLA 1OYWA 3WTWC 3WGIA 3SDGA 1GXQA 1K4TA 2JMWA 4JX5A 3HOWJ 4KT5C 2CUJA 1E3OC 5D5WB 1N75A 2BW3B 3NAUA 5EZHA 2A68F 1O3RA 1OYIA 4M3FA 5E1WA 4GO1A 1Z6RA 2RDPA 1BOBA 3HGGA 4BYYA 1OPCA 5K7HA 2LF7A 3RIRA 3SHFA 4EJVA 3MD2A 2BV6A 3GFLA 5DTDA 2IS1A 1JI8A 3DFGA 1SMTA 2LP0A 3KYDB 3VWBA 2QSFX 4PSWA 3O3KA 2KFDA 3A2KA 3FMSA 3CLOA 4HG2A 4YRVA 2NXNB 4X1EA 1C0WA 1XD7A 1V54H 5FO5A 4ZZLA 5CQGA 3BR1A 4NBQA 5B66C 5D6FA 3HTUA 1E3HA 2X9DA 1B9NA 3PFIA 3Q0WA 1IC8A 3GO5A 2DCEA 3JAMZ 2HFHA 4YFXF 3HOSA 3JAMR 4PGHA 1WHUA 4XKVA 1SFUA 4XRSA 3KZYA 4XMYA 3GZNB 2EA4A 2X4HA 2DPDA 1K79A 1GLNA 3OYJA 1BR2A 4LFUA 2WY8Q 4HLXA 5EEAA 3HTSB 4PZJA 3OYNA 2OJED 1PUFB 4E7JA 5IOYA 1LNWA 1SVLA 5L3BA 2XDVA 2IP2A 2CQXA 2W84A 3GFJA 3Q9SA 2VB6A 3I5UA 2VJ5A 1YS7A 3KEOA 3ZP5A 4E7SA 4LMYA 4CSWA 1XSVA 2NVQJ 4QTRA 1JUMA 4R1HA 2JUGA 3PL8A 2LREA 1IDZA 1FBSA 3HSEA 4N4NB 2H6BA 2KRHA 1I3QJ 1P4XA 1U9OA 1LJ9A 1D3YA 3OL4A 2BVLA 1Z91A 5BNGA 3AG3H 1I39A 3DXJF 1P92A 5GPAA 1JKOC 3DF8A 3K70D 3BJOA 2VJ4A 3SZTA 1UHWA 4RAGA 3BOQA 5TISC 1HA8A 5H6QA 2PMHA 4L9VA 3PSFA 5F1JA 2KPMA 4BQNA 2KIFA 2EWNA 2CSOA 3H0GJ 3DLAA 3JAMK 4HQEA 3JTGA 2FNPA 4G7OF 3S93A 2M30A 2XF6A 1VTNC 3VSKA 4XNFA 3C2BA 2VJIA 3GTPJ 2KL4A 2XF5A 4U88A 3RYRA 1CGPA 3JRHA 2XROA 1XDSA 2M7AA 1MMDA 3QYEA 1F4KA 2A6TA 3BR6A 4A3LJ 2CUFA 3C7JA 1E0EA 3I3LA 2P4WA 1E17A 4F91B 3TW7A 3JRCA 4KIFA 4WX9A 4KDPA 2XPWA 1Y56A 2VIXA 4EMSA 3LAPA 1TWAJ 4Y13A 4ZYDA 2TDXA 2XAGA 3NWTA 3BLYA 4DBRA 3QAHA 1I3AA 1OR7C 1EA3A 1IXSB 1Y8QB 3QPHA 3HRSA 5CQEA 1QGPA 4CHUA 3RKQA 4EVIA 3S17J 1SD7A 1FLIA 4ENNA 3H0DA 3ISPA 1HQCA 3ABKH 4XKBA 1A35A 3HZJA 3MKWB 1R6RA 4M9XA 5E3OA 3W2WA 2L2OA 1UMQA 2FUG2 4JX4A 1F1ZA 2I5UA 1WSUA 3NWSA 3FXRA 1JUPA 1MH3A 4B47A 3H3ZA 2FMYA 4GYGA 4BJ5C 1JUSA 2E1OA 4HYEA 5K7FA 2QBYA 2Z1DA 3F8BA 1FX7A 3KP2A 1N25A 4LLGF 2OQRA 3D5RC 1P2FA 4EM2A 2P0TA 3CDHA 1RRJA 4RGRA 3FK6A 2VONA 1U5TA 1ZK8A 1Z7LA 2D2WA 3LL7A 3I0TA 3ZXSA 3J81R 2ZMEA 2XAQA 3F3XA 2PJPA 2ECCA 3GVAA 3HKZN 2Y48A 1R1VA 1Y8RB 1RETA 1TWCJ 1R58A 4L9NA 5H2FC 3L1PA 4LJZF 2Y0SA 3BC8A 3H5AA 4KN7X 1WJCA 1GVDA 1CQTA 1XGSA 2CS3A 3L2VA 2LKSA 1NK3P 3KCCA 1LDDA 3QOPA 3OS1A 1LQ1A 1O7FA 3LSGA 2WAEA 4EM1A 1H9GA 4YFKF 3PIOF 1OLTA 1YFHA 1AKHA 2E5NA 1J5YA 1G3SA 2DTZA 1J75A 3GUDA 5A2QK 4QSHA 2QA4I 4AIJA 2MD5A 2FD5A 5A2QZ 3WHBA 1G59A 3DBLB 3T8TA 1KQ9A 2VPRA 5DV5A 3PFYA 2JRTA 4Y33A 3RKXA 3RPQA 4RB2C 1O3TA 1OMIA 2V4JC 1XTAA 2LKXA 1WJ5A 2Z5UA 1I5ZA 3ZCOA 3G6EI 3CMYA 5KK1A 2HGCA 2HTSA 2IT0A 2LD5A 4D5CA 1Z67A 4BNCA 3HBLA 1V5GA 2ZO4A 2O5RA 5LEKA 4XRMA 3S2DJ 3MZHA 2F48A 2E1CA 2J5PA 4A3CJ 4HQMA 5JHFA 3EETA 2DYRH 4UVAA 1SAXA 1BOAA 3GTGJ 2VI6A 2L9RA 2FXAA 5J1YA 2ETHA 2DMQA 4RAYA 4JOMA 4DOZA 2VBYA 5D5UB 2IA2A 2E35A 2R7OA 4XBFA 3FXJA 3OYHA 1IV6A 4EGZA 2OTJI 1S7OA 4KNYA 2ELHA 3K6GA 1Z3YA 3QPLA 2DJIA 3T5XA 2XGEA 1F43A 1RNLA 3BG5A 3GZ5A 1Z1DA 2GOMA 1MZBA 3ZPLA 4IHTA 4MHGA 1BC8C 3T1BA 2QSGX 3FX3A 5E1ZB 1NHAA 5EG0B 2XB5A 5E3MA 3RPUD 1WFXA 1YO5C 1IAWA 2YSRA 2MBFA 2H8WA 1NK2P 3DEEA 2EFQA 3HGYA 4UB8C 3IRQA 1JJ8C 3BZCA 2QKMB 4A69C 4DZPA 1J7KA 3R0JA 3SZPA 3E97A 3IP4B 3OWTA 5DUIA 4CCNA 3F21A 5H20A 3IRRA 4MQ9F 2KZVA 3IWZA 2ESNA 1Z6TA 3QU6A 3LWFA 2YX7A 1O3QA 2IS2A 5BQTA 1IDYA 4A0XA 4FE7A 4C2MJ 2CO5A 4XQFA 3B73A 3L2RA 2VT2A 2VN2A 4XORA 1MBEA 3CCEI 1H0MA 4CYCA 2QSHX 1ZHFA 4IOCF 3OR1C 2XAJA 2HXIA 4G12A 4XK4A 5EG0A 1A31A 5HLIA 4DYRA 1VQ8I 4OIPF 2IEKA 3W3CA 1YIOA 1KONA 4CCMA 4RAFA 1HKSA 2GIZA 2M9HA 1MD0A 2IXSA 1WCMJ 3V42A 3A52A 1BIAA 1GV5A 3LSPA 1E2XA 4XSZF 5LHHA 1G8XA 3CDIA 3R60A 4MFDA 4F52A 2R5YB 2RQQA 3BG3A 3DPTA 2WAQA 3ROUA 2NNNA 4EJTA 4JK1X 3K4JA 2F4OB 1V4RA 4IHSA 2FSWA 3JRAA 1DGRM 1Z21A 4FX0A 4RM2A 2R7TA 2F5FA 1YRNB 2P8TA 3F8MA 1A6QA 1X2NA 2WTEA 4ESBA 5LLQA 1JKPC 1U6GA 1YYVA 3ZMUA 3ZQ7A 1TQIA 2CWEA 4NB5A 3AAFA 2ZFWA 1BW5A 3CESA 2H09A 3D1NI 2YU9J 2G9WA 3WE3A 1JKQC 2EB7A 4E7IA 2O8KA 1K61A 3VODA 2DQLA 2HTJA 4II3A 2H94A 3OV8A 4IEJA 3U21A 3FWEA 5FKOA 3BJ6A 2IA0A 4U0YA 4QLCU 2M0MA 2FMLA 4YIFA 4CYCB 4B48A 1YW7A 1MNEA 1VQ7I 4HF1A 4CGZA 4IO9F 2VUMJ 2FF4A 2K40A 1D0YA 2X48A 2L3DA 4IHVA 3E3VA 2VQCA 2DJNA 1VQMI 2E71A 1Z7UA 3KP5A 1EH7A 1XSDA 1Y1VJ 3OYIA 4DYCA 5D4SA 2ELJA 3WTYC 2VOOA 1DPUA 3GFMA 3FXLA 5C4XJ 1T33A 4F3QA 1WRJA 3I4PA 2W24A 4P9FA 2ID6A 2UXNA 2IJLA 1XCVA 2L7ZA 2UZKA 2RNGA 2HQ5A 3KX2A 1TWFJ 3J7ZI 3ML6A 3JW4A 4AVZA 4AVPA 1U78A 3LSTA 4OIRF 2JT1A 4HLYA 3GCMA 1J0RA 2G7UA 3AG4H 1PUEE 4HV5A 3WGGA 4QPQA 2KJBA 2PJRB 4P9UA 1O57A 2OTLI 2ISZA 1H88C 5E20A 3MFKA 2DQRA 3MMYB 2DOAA 4XKCA 2UV1A 5HLGA 1K4SA 4LD5A 3GZ6A 1MMAA 2DMUA 4B4CA 2BEOA 2EILH 3PO2J 1X58A 4RB1A 1T39A 1D5VA 5AONA 4GYIA 2NVUB 4OMYA 3DPLC 5GTIC 1PYVA 3IV5A 2HZDA 3V8LA 2DMPA 5F1RA 4N0BA 2X6OA 1QO0D 2ACJA 1RZ4A 3SYTA 2M4KA 3UNGC 1XG1A 5ILVA 3H3VK 5TJJA 4C30A 1CF7B 2FOWA 2H1KA 1S29A 1K78A 4AYBN 2MVTA 1YRNA 1TW2A 3IH4A 1IXCA 1NH3A 4ZTFA 3ZN0A 3GEZA 5BPDA 3GTQJ 3MN2A 3BZKA 5IPAA 1GV2A 3Q9VA 3BCBA 3GW2A 4XN0A 1BW6A 4PGGA 5K5QA 3DWLE 1X3UA 1Y1WJ 2X1DA 2M34A 3ABMH 1SFEA 4WK8F 2JSCA 1FP1D 5F0HA 2LBFA 1SD5A 1WI9A 2X0LA 4N9IA 3BTJA 3BR5A 4NUBA 4A3IJ 2R7UA 2DFFA 3MAJA 3K4MA 2Q2EB 5J47A 1B72A 1IUYA 4FQGA 3IKVA 1RIOH 4G6DA 3OYBA 2LK2A 1KQ0A 3Q3SA 1YTYA 2LLKA 4I76A 4FETA 2R7ZJ 3OY9A 5ILUA 5JVTA 1L3LA 4I99C 2QZ8A 1BA5A 2YX4A 2V6EA 2RQPA 5CLSA 3V8JA 2R7XA 3JSOA 4D5FA 1FT9A 2JWTA 1HLVA 5JR3A 2XPVA 3JRIA 4I98B 1T38A 2NRAC 4RMNA 5ICFA 2Q8KA 4A3JJ 3ZMDA 2HI3A 2M7BA 2MC3A 3J80R 3JRFA 2M8GX 1A36A 1D1BA 3U1KA 5JHUA 1ZLJA 1FP2A 2XASA 1BI1A 2E19A 2PJRA 2OZ6A 3PSIA 5DEQA 3H35A 4WF2A 1TTYA 3I59A 4MTEA 3M07A 1QU3A 4WCGA 2FJ1A 1ETKA 2X6YA 1MBKA 4QPOA 4BDYA 4IRIA 2ZNZA 4AWXB 1HDPA 3SDBA 4CA0A 1D5YA 3IKTA 1RKTA 3CUQB 4CCJA 1SEUA 4JYKA 4IRGA 4CCOA 1MSFC 4ZYGA 2K85A 4Q47A 5FRMA 3WE2A 2NOGA 1ZR2A 3HOZJ 2PI0A 2KJCA 1QRYA 5IYCJ 1VNDA 1IN6A 3OYLA 2P5KA 3JSPA 4U0WA 4IJAA 4XL9A 5GTHC 3J7AO 5FKNA 1TT0A 2K9MA 3A01B 2P7CB 3I4MJ 2QLZA 5JI6A 3VYRB 3W6JB 5L3CA 2ZSHB 2W1OA 1WJBA 3FBNB 4RA2A 4Y3OA 1X19A 4BJTA 2GA2A 3M1CA 3J7AW 3IWFA 3NQOA 3L9FA 2DN0A 1D0XA 2IGMA 2NAZA 1NTCA 3ULQB 1R49A 2VQHA 3V7CA 1WVRA 4J19A 2YS9A 4KIBA 3WTTC 4UY8I 4FX4A 2VBZA 3NEUA 1I50J 4KIGA 1UFMA 2KISA 2NS7A 4L0YB 2BY2A 2LOOA 2C6YA 1EH6A 1HSJA 1R5HA 2GXAA 1J2XA 3W6KB 4NC7A 3BTLA 3K7AJ 5IP6A 2BOLA 1BR1A 2LFBA 3OS0A 2ISYA 3A01A 3KEYA 3OYGA 1ENHA 5D5VB 3PNYA 3I53A 2KKOA 4BHPA 1SMYF 1APLC 3DTIA 4JP0A 3I59B 2E2JJ 2I10A 3F8NA 2XIGA 1QVUA 3KLNA 4PK4A 2BHZA 3O8HA 3TMOA 3H9QA 5J1RA 1R36A 4MFEA 1OQYA 4A5MA 2L4MA 2A3SA 2PMUA 3F9KA 2XAFA 4XRFA 3DKXA 3SQNA 2W7NA 4Q48A 1W5CC 4UB6C 1X4PA 4A93J 1V5FA 4ETSA 2NVTJ 1OYYA 3HUGA 4M72A 4L5JA 1AWCA 2EIMH 4M9ZA 1J59A 2F5VA 3S1QJ 2M2EA 2XKPA 3W2AA 4BEHB 3FMRA 2OC6A 1FNNA 2P5VA 2ZXJA 5KNLA 2E2HJ 5J8FA 3M8JA 5DM6F 1X4OA 1XGOA 1BI3A 1MJBA 2LH9A 1WJAA 2E1MC 2P7VB 1XPXA 5FFZA 1SVOA 3DKWA 2DT7B 4UXNA 1WI3A 5IP9J 4Y52J 4E7LA 1TQPA 1YX3A 4X6AJ 2AHQA 4E6KG 2R7VA 5LRRA 1GXPA 1ZR4A 3A03A 4DIQA 1FJLA 3ZMZA 1XSXA 2O3FA 2V26A 2ZB9A 3HUGB 4Z6YA 4Q4ZF 4NQWB 4XICA 3OSGA 4LOCA 1HSTA 3L09A 3FXOA 2EBIA 1U8RA 2HYJA 2DO7A 3C18A 4C9YA 4BH9A 2MZ4A 3ZQLA 3TDUC 3GBGA 4O6JA 1LKXA 4UVCA 1G3TA 3U1DA 5KAFC 5ICGA 4UNOA 2X1CA 2CJJA 3LFUA 5BMZA 1UAAA 1PVEA 2WY7Q 3K0LA 1ZGJA 1U5TB 1SAUA 1YE9A 2LR8A 2X6WA 1HW5A 3IUOA 2KRFA 3FZVA 3ZQQA 3BCAA 2R5ZA 2HS5A 5EDNA 2QF7A 1OCTC 3B6CA 3ZMSA 1E3PA 4F55A 4WWCA 3TP3A 2N8GA 4AIHA 2HVSA 3CQZJ 5FB2A 2KDZA 4BU2A 1X1CA 2EZHA 3LQRA 3HL2A 2PEXA 4BE1A
chains in the Genus database with same CATH topology
3LA3A 4YG2F 3DQVC 3RI4A 2A07F 4WXHA 1RI7A 2D45A 3DV8A 1K78B 3F23A 1K7AA 3IL2A 2DTRA 1TQMA 3KP6A 3TO6A 1FWZA 3WTZA 4P55A 3QRFF 1FC3A 3V4GA 1RUOA 3P9CA 4KUMA 4RS8A 5DD8A 1F9NA 2GIVA 5ED4A 5HDKA 4A0YA 1I1SA 2BGCA 2WWYA 3K2ZA 2P6SA 3GX4X 1UHMA 1QZZA 2JPCA 3GFIA 3GWZA 4CYDA 1UB9A 3WU0A 4HA8A 5IT3A 1KQ8A 2LDUA 3F8CA 1OR7A 2O03A 5L3DA 4MGRA 5JFRA 2F5CA 1R5GA 5DCMA 1ON1A 4I01A 3SFZA 2G7HA 3R61A 1Z05A 2FEZA 4UVBA 3B02A 1G3YA 1EV7A 2EA2A 1FZPB 4NQWA 4EGYA 2V1DA 2OZUA 2Z3YA 2FA5A 3M7GA 3H92A 2GXBA 5DDGA 3N97A 4KMFA 2ZCWA 4FT8A 5FFXA 4U7BA 4GXOA 5CVIA 1K6OA 1I6XA 1V3FA 3O6BB 4HBLA 3F6VA 1LDJA 1HKTA 2EFOA 3WTUC 4A6DA 5L3GA 2OAZA 1R1UA 5EEGA 2QQ9A 3H3UA 5BOXA 2V1UA 4ZYHA 2HQRA 2RN7A 4ESFA 2FBKA 5DCMB 3RKYA 2XVCA 3MQ0A 3FM5A 3HHGA 3RTRA 2HYGD 1TNSA 1JGSA 1FYMA 3VB2A 3KP7A 2DAOA 3L7WA 1FY7A 2K4JA 2OA4A 4CICA 4G7ZF 1I27A 3GXOA 1QZYA 4B8XA 4ASNA 4L9TA 4EJOA 4UV8A 2ZJ2A 4Y17A 3CTAA 6PAXA 4JBAA 2WV0A 5LGTA 3JTHA 4MTDA 4WXDA 2Y0MA 5CVVA 3HOTA 1MJ9A 3MCZA 2B0LA 3L2CA 1IN7A 1QNTA 2VE8A 4N9HA 5CYVA 4G7HF 2QBYB 4CDGA 3K1MA 4A2UA 4S04A 5E1XA 3EUHA 2MH9A 1MDMB 3GYHX 2E7WA 2GA1A 1IN8A 1W5TA 4RB0A 2DK8A 2XAHA 4A0ZA 2PG4A 1T98A 3K9TA 4KICA 1ZG1A 3U9GA 2OD5A 3WODF 4H0EA 2MH2A 1LDKB 2ZBKA 3E5QA 1ZREA 1FSEA 3REOA 1REPC 4I0BA 3BDDA 1O7LA 2FE3A 4KN4X 3V7SA 3IC7A 1T2KA 2O61A 1KU2A 4HX8A 2L02A 5HLHA 3WGHA 1KGSA 2DK5A 2PFBA 2RV8A 2CG4A 4M9SA 1SD4A 3WG9A 3BPXA 1SD6A 2HZTA 1TW3A 3CUQC 2XRNA 3D5LA 3BY6A 1LEBA 4F7ZA 4IF4A 1G3WA 2V79A 2VXZA 2W25A 3C3WA 2CW0F 4HOBA 2Q2EA 2EV6A 4DNCA 5F64A 2UXXA 3HRMA 1TNTA 4I02A 3PQJA 3L00A 4EM0B 5DCFA 1UCRA 1XB4A 2M45A 2QQAA 1BJAA 5TRDA 2IPQX 4XLNF 4DQ2A 1IRFA 3KLOA 1JE8A 2QYOA 4ZZDA 3F6OA 5CVJA 1IN4A 1XMAA 1D8KA 2D1HA 1KU7A 1XN7A 3COAC 2M87A 2V1XA 1JHFA 4UUVA 3BROA 4KYWA 4I2OA 3HRUA 1A04A 2DW4A 2K02A 3BP8A 2NS0A 3R6SA 2ZNYA 3TGNA 4MNUA 2R3SA 2FRHA 2STTA 4CZZA 2OBPA 2YU3A 5HS7A 1FSHA 2M8EA 5IT9Z 1ZAOA 3P9KA 4ESJA 4P96A 1S7AA 1ZGAA 4XLPF 2L4AA 2K86A 1DDNA 3HRTA 5D8KB 2R7DA 1HW1A 2XGXA 4YFNF 2WC2A 2QENA 2CGPA 5BS6A 2HQNA 3EYYA 3J81Z 5L3EA 1ZARA 2DU9A 3MZYA 2FOKA 2FBHA 3CO6C 4GGGA 4OIOF 2Z33A 2K7LA 4OINF 4EJUA 2GQQA 1U3EM 2YPRA 5ICEA 4I0AA 1FOKA 3I54A 2P5LC 4ZH4F 2HOEA 3FXUA 2EFPA 3LAJA 1BI2A 2JPBA 5DUKA 2MLGA 3J80K 4RB3C 4K2EA 2Z9OA 3WTXC 1HKQA 1YQAA 1P4AA 4XSXF 3CO7C 5D4RA 4UV9A 3E5UA 3VOEA 1S3JA 4CXFA 4R8HA 3J81K 1XCBA 1MKMA 3F72A 5K1YA 1FBQA 5J8CA 2GXGA 3KE2A 4Q5SF 3K69A 3HSFA 1ULYA 3G3ZA 1DPRA 2QVOA 3G73A 4HDUA 1USSA 4PCQA 4HAMA 2CYYA 4G6QA 3M8EA 4NHJA 3WTSC 3FXQA 2F5DA 2L54A 5ICCA 1S8NA 4LB6B 2LNBA 4OMZA 4UHTA 1RUNA 1B59A 2QWWA 4BHBA 2K27A 3M8FA 2A6EF 1IXRC 2VBWA 3F22A 1MDMA 1IW7F 4HW0A 5LEJA 2HKXA 5ERIA 2M5WA 3E6BA 3DP7A 4HX7A 4LK1F 4EQQA 4ENKA 4BAYA 2F5EA 2IVMA 2JZYA 2QUFA 1DUXC 2VC1A 1U2WA 1XMKA 1YS6A 2COMA 2VE9A 1PP7U 4LGWA 4RAZA 2CFXA 2JTVA 5AIQA 2VOPA 4OOIA 1B6AA 1MGTA 1BIBA 1Y0UA 3P9IA 2P6TA 2J5OA 4D0PA 2LSOA 1QPMA 2VC0A 1CF7A 1T0FA 2YR2A 3ECOA 3T0YA 3HIFA 1KU9A 2KIUA 4RGUA 3K1NA 3GLXA 2H27A 2FQ3A 2GWRA 4AIKA 2ZKZA 3ZMTA 2DPUA 2O8XA 1WKMA 5HS9A 2FBIA 4LLLA 3RDIA 5LHIA 2HR3A 1F5TA 5HDNA 4G8XA 5HDGA 5BPIA 5DD4A 4LB5A 5FLXZ 3I58A 2RC4A 3KFWX 4S05A 3EQLF 1HBXG 1S6LA 4I09A 2NNYA 5LGNA 2EFWA 5E17F 2GZWA 5KVRA 2BBYA 3QU3A 2EV0A 1ZRCA 2STWA 3BZ6A 3LA7A 5LBQA 1L0OC 3M1EA 4HZFA 3E6DA 5FD5A 2R7FA 3HHHA 4O5VA 5EEHA 1R7JA 1LVAA 2W85A 2K4BA 4TV7A 3CUOA 1Z9CA 2UWMA 2QQBA 4RGXA 1STZA 4U7DA 1XDUA 4L18B 1YW8A 5J6XA 3V8KA 3HYIA 1ZN2A 5AIPA 3EDPA 1O3SA 2Q0OA 3TOBA 1BI0A 3O2PE 2HKOA 3CUQA 1FYKA 4FHTA 1ZLKA 5H6RA 2F2EA 1B4AA 1ZH5A 3J80Z 4QWQA 1KU3A 5D6EA 1AOYA 4IRHA 4M74A 4WXCA 5FD6A 3RPUA 3BWGA 3RYPA 2VBXA 5K5RA 1MJAA 2PBIA 2ADUA 2EFNA 3TKYA 1ONVA 1ZRDA 2A6HF 1B1BA 3MWMA 2RVCA 3BPVA 3Q5FA 5LHGA 4AD9A 5LRSA 4JQFA 4IXAA 5E8IA 5FLXK 3KP3A 5ILSA 1GHCA 4PDKA 4Z2YA 1YLFA 1P4WA 1W7PD 1ZG5A 2V9VA 3TDZC 4ENJA 2IW5A 1BC7C 3GF2A 3LA2A 1W7PA 2PLYA 3I64A 2LKPA 1IF1A 5E8GA 3RJPA 1BN5A 3E6MA 3DEUA 1BBYA 4HX4A 3MEXA 2A5YB 2FNAA 1HW2A 1YG2A 2DLLA 5K5OA 1J9IA 3E5XA 3KZZA 3N4MA 2OU2A 2NYXA 1D8JA 1TBXA 2ZMEB 2RGVA 2AXLA 3KEQA 3I71A 4A5NA 1LEAA 3R0AA 4B09A 2EV5A 2PN6A 1FBUA 4LLNA 3WU1B 3ZMVA 4MQVA 1IZ1A 4IVNA 3D0SA 4HDVA 1DP7P 3TO7A 4L9JA 1OKRA 1R00A 4ON0A 1PP8F 1W4MA 2DBBA 4BHCA 5HOOA 2AS5F 2W57A 3CJNA 5CVRA 3PQKA 2OQGA 4M71A 1PDNC 4U0VA 4M6XA 2HDCA 2IRFG 1YW9A 3KP4A 3WTVC 4M73A 3C1DA 1ZRFA 1TLHB 1W5SA 2H6CA 2EK5A 2O0YA 5CJ9A 3NRVA 4ZYEA 5D8LB 3TO9A 3F8FA 1G6NA 2E7XA 1ZG3A 4L5IA 2VT3A 4YIIA 1JXSA 3HSRA 1FPQA 2DI3A 4A12A 2RKHA 1I1GA 4M6YA 5E18F 3LFKA 4KMUX 1IN5A 4HV6A 1JHHA 3U2RA 1FYLA 1KYWA 4Y15A 3FMQA 1LB2A 2DT5A 2QM3A 4BQAA 4LG0B 3VEPA 1ODDA 1ZYRF 4I7HA 3EYIA 5IT9K 3QP6A 2PQ8A 1BM9A 1EH8A 4R79A 2HWVA 3E6CC 3M9AA 1IRGA 1WWXA 1GVJA 3KETA 3ECHA 1G4DA 1KA8A 4MEXF 2IA1A 1P6RA 4IPAA 3S2WA 2A61A 2HEOA 1Q1HA 2DFIA 1H9TA 5CVUA 4L0ZB 2CQKA 4A6EA 5DYMA 1QBJA 3ELKA 4P5OA 1U5TC 3TQNA 2V6CA 2XKOA 4CO8A 4LG0A 2BE5F 2D1VA 1ON2A 3OOPA 2BYVE 2MLKA 1XGNA 3P7NA 2Y75A 5F6FA 5HVQC 4BXUA 4MEYF 4OIQF 2ESHA 3QP5A 1HXDA 2M1BA 4EV0A 3BJAA 4EJWA 1USTA 2VODA 4GCVA 3V7RA 1W7PB 3QPTA 5D5XB 2E1NA 3FF5A 2Z99A 4RGSA 2MA3A 1T6SA 3FM3A 4KA4A 2A69F 1KYZA 2EJRA 5FGMA 1WQ2A 5LGUA 2L01A 2RNJA 3ABTA 1R23A 3LQQA 4HF0A 3ABUA 4O3MA 3SXYA 3FHZA 3ERED 2HYFA 5L3FA 1SFXA 3RKWA 3TOAA 4E70A 2KIMA 2XV4S 5HS8A 2O6GE 4LK0F 1XGMA 2XHKA 2GAUA 2FU4A 4G94A 3K1PA 3VFZA 3R4KA 4HF2A 1R22A 2XUBA 2LF8A 1B9MA 4KFCA 3T8RA 4OU0A 3IHUA 1QQIA 4ENMA 4G9YA 3ZN1A 1R1TA 1OYWA 3WTWC 3WGIA 1GXQA 4KT5C 5D5WB 2A68F 1O3RA 1OYIA 5E1WA 4GO1A 1Z6RA 2RDPA 4BYYA 1OPCA 2LF7A 3RIRA 3SHFA 4EJVA 2BV6A 3GFLA 3DFGA 1SMTA 3O3KA 3FMSA 3CLOA 1C0WA 1XD7A 5FO5A 4ZZLA 5D6FA 3HTUA 1B9NA 3PFIA 3GO5A 3JAMZ 3HOSA 2HFHA 4YFXF 4PGHA 1SFUA 3KZYA 2EA4A 2DPDA 2X4HA 1K79A 4LFUA 4HLXA 3HTSB 4PZJA 1LNWA 5L3BA 2IP2A 2W84A 3GFJA 3Q9SA 3I5UA 3ZP5A 1YS7A 3KEOA 4LMYA 1XSVA 4R1HA 1FBSA 3HSEA 2H6BA 1P4XA 1LJ9A 1D3YA 1Z91A 3DXJF 1P92A 3DF8A 3BJOA 3SZTA 1UHWA 3BOQA 5H6QA 2PMHA 4L9VA 2KIFA 2EWNA 2CSOA 3JAMK 4HQEA 3JTGA 2FNPA 4G7OF 2M30A 1VTNC 4U88A 3RYRA 1CGPA 2XROA 1XDSA 1F4KA 3C7JA 2P4WA 1E17A 4KIFA 4WX9A 4KDPA 4EMSA 3LAPA 4Y13A 4ZYDA 2TDXA 2XAGA 3QAHA 1IXSB 3QPHA 3HRSA 1QGPA 4CHUA 4EVIA 1SD7A 1FLIA 4ENNA 3ISPA 1HQCA 4M9XA 1F1ZA 1WSUA 3FXRA 3H3ZA 2FMYA 4GYGA 2QBYA 4HYEA 3F8BA 1FX7A 3KP2A 4LLGF 2OQRA 1P2FA 4EM2A 3CDHA 4RGRA 2VONA 2D2WA 1U5TA 3I0TA 2ZMEA 2XAQA 3F3XA 2PJPA 3GVAA 2Y48A 1R1VA 1R58A 4L9NA 4LJZF 4KN7X 1XGSA 3KCCA 1LDDA 3QOPA 1LQ1A 1O7FA 4EM1A 1H9GA 4YFKF 1YFHA 1J5YA 1G3SA 1J75A 4AIJA 3GUDA 5A2QK 2MD5A 5A2QZ 3T8TA 1KQ9A 5DV5A 2JRTA 3RKXA 3RPQA 4RB2C 1O3TA 1OMIA 2Z5UA 1I5ZA 5KK1A 2HGCA 2HTSA 2IT0A 4BNCA 2ZO4A 5LEKA 3MZHA 2E1CA 2J5PA 4HQMA 3EETA 4UVAA 1SAXA 1BOAA 2FXAA 2ETHA 4RAYA 2VBYA 5D5UB 2IA2A 4XBFA 4EGZA 1S7OA 4KNYA 2ELHA 3T5XA 1RNLA 3GZ5A 1Z1DA 1MZBA 3ZPLA 4IHTA 4MHGA 1BC8C 3T1BA 3FX3A 5E1ZB 1NHAA 1YO5C 1IAWA 2YSRA 2MBFA 2EFQA 3IRQA 1J7KA 3R0JA 3SZPA 3E97A 5DUIA 3F21A 5H20A 3IRRA 4MQ9F 3IWZA 2ESNA 1Z6TA 3QU6A 3LWFA 2YX7A 1O3QA 5BQTA 4A0XA 2CO5A 3B73A 2VT2A 2VN2A 1H0MA 1ZHFA 2XAJA 5HLIA 4OIPF 1YIOA 1HKSA 1MD0A 1BIAA 1E2XA 4XSZF 5LHHA 3R60A 3DPTA 3ROUA 2NNNA 4EJTA 4JK1X 1V4RA 4IHSA 2FSWA 4FX0A 2F5FA 2P8TA 3F8MA 2WTEA 4ESBA 5LLQA 1U6GA 1YYVA 3ZMUA 3ZQ7A 1TQIA 2CWEA 4NB5A 3AAFA 2ZFWA 2H09A 2G9WA 3WE3A 2EB7A 3VODA 2DQLA 2HTJA 2H94A 3OV8A 3FWEA 3BJ6A 2IA0A 4U0YA 4QLCU 2FMLA 4YIFA 1YW7A 4HF1A 4CGZA 2FF4A 2L3DA 3E3VA 1Z7UA 3KP5A 1EH7A 1XSDA 5D4SA 3WTYC 2VOOA 1DPUA 3GFMA 1WRJA 3I4PA 2W24A 4P9FA 2UXNA 2IJLA 1XCVA 2UZKA 3ML6A 3JW4A 4AVPA 1U78A 3LSTA 4OIRF 2JT1A 4HLYA 1J0RA 2G7UA 1PUEE 4HV5A 3WGGA 2KJBA 4P9UA 1O57A 2ISZA 5E20A 3MFKA 2DQRA 5HLGA 4LD5A 3GZ6A 2BEOA 4RB1A 1T39A 1D5VA 5AONA 4GYIA 4OMYA 3DPLC 3V8LA 5F1RA 4N0BA 2ACJA 1QO0D 1RZ4A 5ILVA 5TJJA 1CF7B 1S29A 1K78A 1TW2A 1IXCA 3ZN0A 3GEZA 5BPDA 3Q9VA 3GW2A 4PGGA 5K5QA 1X3UA 1SFEA 4WK8F 2JSCA 1FP1D 1SD5A 1WI9A 2X0LA 4N9IA 3MAJA 1IUYA 3IKVA 1RIOH 4G6DA 1KQ0A 1YTYA 5ILUA 5JVTA 1L3LA 2QZ8A 2YX4A 2RQPA 5CLSA 3V8JA 3JSOA 1FT9A 5JR3A 4I98B 1T38A 2NRAC 5ICFA 2Q8KA 3ZMDA 2MC3A 5JHUA 1ZLJA 1FP2A 2XASA 1BI1A 2OZ6A 5DEQA 4WF2A 1TTYA 3I59A 4MTEA 4WCGA 4IRIA 2ZNZA 4AWXB 3IKTA 3CUQB 4IRGA 4ZYGA 4Q47A 3WE2A 2PI0A 2KJCA 1IN6A 2P5KA 3JSPA 4U0WA 4IJAA 3J7AO 2P7CB 2QLZA 5JI6A 3W6JB 5L3CA 2GA2A 3IWFA 3NQOA 3L9FA 2NAZA 3ULQB 3V7CA 4KIBA 3WTTC 4FX4A 2VBZA 3NEUA 4KIGA 1UFMA 4L0YB 2C6YA 1EH6A 1HSJA 1R5HA 1J2XA 3W6KB 2ISYA 5D5VB 3I53A 2KKOA 4BHPA 1SMYF 3I59B 3F8NA 2XIGA 3KLNA 1R36A 4A5MA 2L4MA 2A3SA 2PMUA 2XAFA 4XRFA 3SQNA 4Q48A 4ETSA 1OYYA 3HUGA 4M72A 4L5JA 1AWCA 4M9ZA 1J59A 2XKPA 3FMRA 1FNNA 2P5VA 2ZXJA 5J8FA 1XGOA 1BI3A 1MJBA 2P7VB 5FFZA 3DKWA 4UXNA 1TQPA 5LRRA 1GXPA 3ZMZA 1XSXA 2O3FA 4Q4ZF 1HSTA 3L09A 1U8RA 2DO7A 3C18A 4BH9A 3TDUC 4O6JA 4UVCA 1G3TA 3U1DA 4UNOA 5ICGA 5BMZA 3K0LA 1ZGJA 1U5TB 1HW5A 2KRFA 3FZVA 2HS5A 3ZMSA 4WWCA 4AIHA 5FB2A 3LQRA 2PEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA3 A;  4YG2 F;  3DQV C;  3RI4 A;  2A07 F;  4WXH A;  1RI7 A;  2D45 A;  3DV8 A;  1K78 B;  3F23 A;  1K7A A;  3IL2 A;  2DTR A;  1TQM A;  3KP6 A;  3TO6 A;  1FWZ A;  3WTZ A;  4P55 A;  3QRF F;  1FC3 A;  3V4G A;  1RUO A;  3P9C A;  4KUM A;  4RS8 A;  5DD8 A;  1F9N A;  2GIV A;  5ED4 A;  5HDK A;  4A0Y A;  1I1S A;  2BGC A;  2WWY A;  3K2Z A;  2P6S A;  3GX4 X;  1UHM A;  1QZZ A;  2JPC A;  3GFI A;  3GWZ A;  4CYD A;  1UB9 A;  3WU0 A;  4HA8 A;  5IT3 A;  1KQ8 A;  2LDU A;  3F8C A;  1OR7 A;  2O03 A;  5L3D A;  4MGR A;  5JFR A;  2F5C A;  1R5G A;  5DCM A;  1ON1 A;  4I01 A;  3SFZ A;  2G7H A;  3R61 A;  1Z05 A;  2FEZ A;  4UVB A;  3B02 A;  1G3Y A;  1EV7 A;  2EA2 A;  1FZP B;  4NQW A;  4EGY A;  2V1D A;  2OZU A;  2Z3Y A;  2FA5 A;  3M7G A;  3H92 A;  2GXB A;  5DDG A;  3N97 A;  4KMF A;  2ZCW A;  4FT8 A;  5FFX A;  4U7B A;  4GXO A;  5CVI A;  1K6O A;  1I6X A;  1V3F A;  3O6B B;  4HBL A;  3F6V A;  1LDJ A;  1HKT A;  2EFO A;  3WTU C;  4A6D A;  5L3G A;  2OAZ A;  1R1U A;  5EEG A;  2QQ9 A;  3H3U A;  5BOX A;  2V1U A;  4ZYH A;  2HQR A;  2RN7 A;  4ESF A;  2FBK A;  5DCM B;  3RKY A;  2XVC A;  3MQ0 A;  3FM5 A;  3HHG A;  3RTR A;  2HYG D;  1TNS A;  1JGS A;  1FYM A;  3VB2 A;  3KP7 A;  2DAO A;  3L7W A;  1FY7 A;  2K4J A;  2OA4 A;  4CIC A;  4G7Z F;  1I27 A;  3GXO A;  1QZY A;  4B8X A;  4ASN A;  4L9T A;  4EJO A;  4UV8 A;  2ZJ2 A;  4Y17 A;  3CTA A;  6PAX A;  4JBA A;  2WV0 A;  5LGT A;  3JTH A;  4MTD A;  4WXD A;  2Y0M A;  5CVV A;  3HOT A;  1MJ9 A;  3MCZ A;  2B0L A;  3L2C A;  1IN7 A;  1QNT A;  2VE8 A;  4N9H A;  5CYV A;  4G7H F;  2QBY B;  4CDG A;  3K1M A;  4A2U A;  4S04 A;  5E1X A;  3EUH A;  2MH9 A;  1MDM B;  3GYH X;  2E7W A;  2GA1 A;  1IN8 A;  1W5T A;  4RB0 A;  2DK8 A;  2XAH A;  4A0Z A;  2PG4 A;  1T98 A;  3K9T A;  4KIC A;  1ZG1 A;  3U9G A;  2OD5 A;  3WOD F;  4H0E A;  2MH2 A;  1LDK B;  2ZBK A;  3E5Q A;  1ZRE A;  1FSE A;  3REO A;  1REP C;  4I0B A;  3BDD A;  1O7L A;  2FE3 A;  4KN4 X;  3V7S A;  3IC7 A;  1T2K A;  2O61 A;  1KU2 A;  4HX8 A;  2L02 A;  5HLH A;  3WGH A;  1KGS A;  2DK5 A;  2PFB A;  2RV8 A;  2CG4 A;  4M9S A;  1SD4 A;  3WG9 A;  3BPX A;  1SD6 A;  2HZT A;  1TW3 A;  3CUQ C;  2XRN A;  3D5L A;  3BY6 A;  1LEB A;  4F7Z A;  4IF4 A;  1G3W A;  2V79 A;  2VXZ A;  2W25 A;  3C3W A;  2CW0 F;  4HOB A;  2Q2E A;  2EV6 A;  4DNC A;  5F64 A;  2UXX A;  3HRM A;  1TNT A;  4I02 A;  3PQJ A;  3L00 A;  4EM0 B;  5DCF A;  1UCR A;  1XB4 A;  2M45 A;  2QQA A;  1BJA A;  5TRD A;  2IPQ X;  4XLN F;  4DQ2 A;  1IRF A;  3KLO A;  1JE8 A;  2QYO A;  4ZZD A;  3F6O A;  5CVJ A;  1IN4 A;  1XMA A;  1D8K A;  2D1H A;  1KU7 A;  1XN7 A;  3COA C;  2M87 A;  2V1X A;  1JHF A;  4UUV A;  3BRO A;  4KYW A;  4I2O A;  3HRU A;  1A04 A;  2DW4 A;  2K02 A;  3BP8 A;  2NS0 A;  3R6S A;  2ZNY A;  3TGN A;  4MNU A;  2R3S A;  2FRH A;  2STT A;  4CZZ A;  2OBP A;  2YU3 A;  5HS7 A;  1FSH A;  2M8E A;  5IT9 Z;  1ZAO A;  3P9K A;  4ESJ A;  4P96 A;  1S7A A;  1ZGA A;  4XLP F;  2L4A A;  2K86 A;  1DDN A;  3HRT A;  5D8K B;  2R7D A;  1HW1 A;  2XGX A;  4YFN F;  2WC2 A;  2QEN A;  2CGP A;  5BS6 A;  2HQN A;  3EYY A;  3J81 Z;  5L3E A;  1ZAR A;  2DU9 A;  3MZY A;  2FOK A;  2FBH A;  3CO6 C;  4GGG A;  4OIO F;  2Z33 A;  2K7L A;  4OIN F;  4EJU A;  2GQQ A;  1U3E M;  2YPR A;  5ICE A;  4I0A A;  1FOK A;  3I54 A;  2P5L C;  4ZH4 F;  2HOE A;  3FXU A;  2EFP A;  3LAJ A;  1BI2 A;  2JPB A;  5DUK A;  2MLG A;  3J80 K;  4RB3 C;  4K2E A;  2Z9O A;  3WTX C;  1HKQ A;  1YQA A;  1P4A A;  4XSX F;  3CO7 C;  5D4R A;  4UV9 A;  3E5U A;  3VOE A;  1S3J A;  4CXF A;  4R8H A;  3J81 K;  1XCB A;  1MKM A;  3F72 A;  5K1Y A;  1FBQ A;  5J8C A;  2GXG A;  3KE2 A;  4Q5S F;  3K69 A;  3HSF A;  1ULY A;  3G3Z A;  1DPR A;  2QVO A;  3G73 A;  4HDU A;  1USS A;  4PCQ A;  4HAM A;  2CYY A;  4G6Q A;  3M8E A;  4NHJ A;  3WTS C;  3FXQ A;  2F5D A;  2L54 A;  5ICC A;  1S8N A;  4LB6 B;  2LNB A;  4OMZ A;  4UHT A;  1RUN A;  1B59 A;  2QWW A;  4BHB A;  2K27 A;  3M8F A;  2A6E F;  1IXR C;  2VBW A;  3F22 A;  1MDM A;  1IW7 F;  4HW0 A;  5LEJ A;  2HKX A;  5ERI A;  2M5W A;  3E6B A;  3DP7 A;  4HX7 A;  4LK1 F;  4EQQ A;  4ENK A;  4BAY A;  2F5E A;  2IVM A;  2JZY A;  2QUF A;  1DUX C;  2VC1 A;  1U2W A;  1XMK A;  1YS6 A;  2COM A;  2VE9 A;  1PP7 U;  4LGW A;  4RAZ A;  2CFX A;  2JTV A;  5AIQ A;  2VOP A;  4OOI A;  1B6A A;  1MGT A;  1BIB A;  1Y0U A;  3P9I A;  2P6T A;  2J5O A;  4D0P A;  2LSO A;  1QPM A;  2VC0 A;  1CF7 A;  1T0F A;  2YR2 A;  3ECO A;  3T0Y A;  3HIF A;  1KU9 A;  2KIU A;  4RGU A;  3K1N A;  3GLX A;  2H27 A;  2FQ3 A;  2GWR A;  4AIK A;  2ZKZ A;  3ZMT A;  2DPU A;  2O8X A;  1WKM A;  5HS9 A;  2FBI A;  4LLL A;  3RDI A;  5LHI A;  2HR3 A;  1F5T A;  5HDN A;  4G8X A;  5HDG A;  5BPI A;  5DD4 A;  4LB5 A;  5FLX Z;  3I58 A;  2RC4 A;  3KFW X;  4S05 A;  3EQL F;  1HBX G;  1S6L A;  4I09 A;  2NNY A;  5LGN A;  2EFW A;  5E17 F;  2GZW A;  5KVR A;  2BBY A;  3QU3 A;  2EV0 A;  1ZRC A;  2STW A;  3BZ6 A;  3LA7 A;  5LBQ A;  1L0O C;  3M1E A;  4HZF A;  3E6D A;  5FD5 A;  2R7F A;  3HHH A;  4O5V A;  5EEH A;  1R7J A;  1LVA A;  2W85 A;  2K4B A;  4TV7 A;  3CUO A;  1Z9C A;  2UWM A;  2QQB A;  4RGX A;  1STZ A;  4U7D A;  1XDU A;  4L18 B;  1YW8 A;  5J6X A;  3V8K A;  3HYI A;  1ZN2 A;  5AIP A;  3EDP A;  1O3S A;  2Q0O A;  3TOB A;  1BI0 A;  3O2P E;  2HKO A;  3CUQ A;  1FYK A;  4FHT A;  1ZLK A;  5H6R A;  2F2E A;  1B4A A;  1ZH5 A;  3J80 Z;  4QWQ A;  1KU3 A;  5D6E A;  1AOY A;  4IRH A;  4M74 A;  4WXC A;  5FD6 A;  3RPU A;  3BWG A;  3RYP A;  2VBX A;  5K5R A;  1MJA A;  2PBI A;  2ADU A;  2EFN A;  3TKY A;  1ONV A;  1ZRD A;  2A6H F;  1B1B A;  3MWM A;  2RVC A;  3BPV A;  3Q5F A;  5LHG A;  4AD9 A;  5LRS A;  4JQF A;  4IXA A;  5E8I A;  5FLX K;  3KP3 A;  5ILS A;  1GHC A;  4PDK A;  4Z2Y A;  1YLF A;  1P4W A;  1W7P D;  1ZG5 A;  2V9V A;  3TDZ C;  4ENJ A;  2IW5 A;  1BC7 C;  3GF2 A;  3LA2 A;  1W7P A;  2PLY A;  3I64 A;  2LKP A;  1IF1 A;  5E8G A;  3RJP A;  1BN5 A;  3E6M A;  3DEU A;  1BBY A;  4HX4 A;  3MEX A;  2A5Y B;  2FNA A;  1HW2 A;  1YG2 A;  2DLL A;  5K5O A;  1J9I A;  3E5X A;  3KZZ A;  3N4M A;  2OU2 A;  2NYX A;  1D8J A;  1TBX A;  2ZME B;  2RGV A;  2AXL A;  3KEQ A;  3I71 A;  4A5N A;  1LEA A;  3R0A A;  4B09 A;  2EV5 A;  2PN6 A;  1FBU A;  4LLN A;  3WU1 B;  3ZMV A;  4MQV A;  1IZ1 A;  4IVN A;  3D0S A;  4HDV A;  1DP7 P;  3TO7 A;  4L9J A;  1OKR A;  1R00 A;  4ON0 A;  1PP8 F;  1W4M A;  2DBB A;  4BHC A;  5HOO A;  2AS5 F;  2W57 A;  3CJN A;  5CVR A;  3PQK A;  2OQG A;  4M71 A;  1PDN C;  4U0V A;  4M6X A;  2HDC A;  2IRF G;  1YW9 A;  3KP4 A;  3WTV C;  4M73 A;  3C1D A;  1ZRF A;  1TLH B;  1W5S A;  2H6C A;  2EK5 A;  2O0Y A;  5CJ9 A;  3NRV A;  4ZYE A;  5D8L B;  3TO9 A;  3F8F A;  1G6N A;  2E7X A;  1ZG3 A;  4L5I A;  2VT3 A;  4YII A;  1JXS A;  3HSR A;  1FPQ A;  2DI3 A;  4A12 A;  2RKH A;  1I1G A;  4M6Y A;  5E18 F;  3LFK A;  4KMU X;  1IN5 A;  4HV6 A;  1JHH A;  3U2R A;  1FYL A;  1KYW A;  4Y15 A;  3FMQ A;  1LB2 A;  2DT5 A;  2QM3 A;  4BQA A;  4LG0 B;  3VEP A;  1ODD A;  1ZYR F;  4I7H A;  3EYI A;  5IT9 K;  3QP6 A;  2PQ8 A;  1BM9 A;  1EH8 A;  4R79 A;  2HWV A;  3E6C C;  3M9A A;  1IRG A;  1WWX A;  1GVJ A;  3KET A;  3ECH A;  1G4D A;  1KA8 A;  4MEX F;  2IA1 A;  1P6R A;  4IPA A;  3S2W A;  2A61 A;  2HEO A;  1Q1H A;  2DFI A;  1H9T A;  5CVU A;  4L0Z B;  2CQK A;  4A6E A;  5DYM A;  1QBJ A;  3ELK A;  4P5O A;  1U5T C;  3TQN A;  2V6C A;  2XKO A;  4CO8 A;  4LG0 A;  2BE5 F;  2D1V A;  1ON2 A;  3OOP A;  2BYV E;  2MLK A;  1XGN A;  3P7N A;  2Y75 A;  5F6F A;  5HVQ C;  4BXU A;  4MEY F;  4OIQ F;  2ESH A;  3QP5 A;  1HXD A;  2M1B A;  4EV0 A;  3BJA A;  4EJW A;  1UST A;  2VOD A;  4GCV A;  3V7R A;  1W7P B;  3QPT A;  5D5X B;  2E1N A;  3FF5 A;  2Z99 A;  4RGS A;  2MA3 A;  1T6S A;  3FM3 A;  4KA4 A;  2A69 F;  1KYZ A;  2EJR A;  5FGM A;  1WQ2 A;  5LGU A;  2L01 A;  2RNJ A;  3ABT A;  1R23 A;  3LQQ A;  4HF0 A;  3ABU A;  4O3M A;  3SXY A;  3FHZ A;  3ERE D;  2HYF A;  5L3F A;  1SFX A;  3RKW A;  3TOA A;  4E70 A;  2KIM A;  2XV4 S;  5HS8 A;  2O6G E;  4LK0 F;  1XGM A;  2XHK A;  2GAU A;  2FU4 A;  4G94 A;  3K1P A;  3VFZ A;  3R4K A;  4HF2 A;  1R22 A;  2XUB A;  2LF8 A;  1B9M A;  4KFC A;  3T8R A;  4OU0 A;  3IHU A;  1QQI A;  4ENM A;  4G9Y A;  3ZN1 A;  1R1T A;  1OYW A;  3WTW C;  3WGI A;  1GXQ A;  4KT5 C;  5D5W B;  2A68 F;  1O3R A;  1OYI A;  5E1W A;  4GO1 A;  1Z6R A;  2RDP A;  4BYY A;  1OPC A;  2LF7 A;  3RIR A;  3SHF A;  4EJV A;  2BV6 A;  3GFL A;  3DFG A;  1SMT A;  3O3K A;  3FMS A;  3CLO A;  1C0W A;  1XD7 A;  5FO5 A;  4ZZL A;  5D6F A;  3HTU A;  1B9N A;  3PFI A;  3GO5 A;  3JAM Z;  3HOS A;  2HFH A;  4YFX F;  4PGH A;  1SFU A;  3KZY A;  2EA4 A;  2DPD A;  2X4H A;  1K79 A;  4LFU A;  4HLX A;  3HTS B;  4PZJ A;  1LNW A;  5L3B A;  2IP2 A;  2W84 A;  3GFJ A;  3Q9S A;  3I5U A;  3ZP5 A;  1YS7 A;  3KEO A;  4LMY A;  1XSV A;  4R1H A;  1FBS A;  3HSE A;  2H6B A;  1P4X A;  1LJ9 A;  1D3Y A;  1Z91 A;  3DXJ F;  1P92 A;  3DF8 A;  3BJO A;  3SZT A;  1UHW A;  3BOQ A;  5H6Q A;  2PMH A;  4L9V A;  2KIF A;  2EWN A;  2CSO A;  3JAM K;  4HQE A;  3JTG A;  2FNP A;  4G7O F;  2M30 A;  1VTN C;  4U88 A;  3RYR A;  1CGP A;  2XRO A;  1XDS A;  1F4K A;  3C7J A;  2P4W A;  1E17 A;  4KIF A;  4WX9 A;  4KDP A;  4EMS A;  3LAP A;  4Y13 A;  4ZYD A;  2TDX A;  2XAG A;  3QAH A;  1IXS B;  3QPH A;  3HRS A;  1QGP A;  4CHU A;  4EVI A;  1SD7 A;  1FLI A;  4ENN A;  3ISP A;  1HQC A;  4M9X A;  1F1Z A;  1WSU A;  3FXR A;  3H3Z A;  2FMY A;  4GYG A;  2QBY A;  4HYE A;  3F8B A;  1FX7 A;  3KP2 A;  4LLG F;  2OQR A;  1P2F A;  4EM2 A;  3CDH A;  4RGR A;  2VON A;  2D2W A;  1U5T A;  3I0T A;  2ZME A;  2XAQ A;  3F3X A;  2PJP A;  3GVA A;  2Y48 A;  1R1V A;  1R58 A;  4L9N A;  4LJZ F;  4KN7 X;  1XGS A;  3KCC A;  1LDD A;  3QOP A;  1LQ1 A;  1O7F A;  4EM1 A;  1H9G A;  4YFK F;  1YFH A;  1J5Y A;  1G3S A;  1J75 A;  4AIJ A;  3GUD A;  5A2Q K;  2MD5 A;  5A2Q Z;  3T8T A;  1KQ9 A;  5DV5 A;  2JRT A;  3RKX A;  3RPQ A;  4RB2 C;  1O3T A;  1OMI A;  2Z5U A;  1I5Z A;  5KK1 A;  2HGC A;  2HTS A;  2IT0 A;  4BNC A;  2ZO4 A;  5LEK A;  3MZH A;  2E1C A;  2J5P A;  4HQM A;  3EET A;  4UVA A;  1SAX A;  1BOA A;  2FXA A;  2ETH A;  4RAY A;  2VBY A;  5D5U B;  2IA2 A;  4XBF A;  4EGZ A;  1S7O A;  4KNY A;  2ELH A;  3T5X A;  1RNL A;  3GZ5 A;  1Z1D A;  1MZB A;  3ZPL A;  4IHT A;  4MHG A;  1BC8 C;  3T1B A;  3FX3 A;  5E1Z B;  1NHA A;  1YO5 C;  1IAW A;  2YSR A;  2MBF A;  2EFQ A;  3IRQ A;  1J7K A;  3R0J A;  3SZP A;  3E97 A;  5DUI A;  3F21 A;  5H20 A;  3IRR A;  4MQ9 F;  3IWZ A;  2ESN A;  1Z6T A;  3QU6 A;  3LWF A;  2YX7 A;  1O3Q A;  5BQT A;  4A0X A;  2CO5 A;  3B73 A;  2VT2 A;  2VN2 A;  1H0M A;  1ZHF A;  2XAJ A;  5HLI A;  4OIP F;  1YIO A;  1HKS A;  1MD0 A;  1BIA A;  1E2X A;  4XSZ F;  5LHH A;  3R60 A;  3DPT A;  3ROU A;  2NNN A;  4EJT A;  4JK1 X;  1V4R A;  4IHS A;  2FSW A;  4FX0 A;  2F5F A;  2P8T A;  3F8M A;  2WTE A;  4ESB A;  5LLQ A;  1U6G A;  1YYV A;  3ZMU A;  3ZQ7 A;  1TQI A;  2CWE A;  4NB5 A;  3AAF A;  2ZFW A;  2H09 A;  2G9W A;  3WE3 A;  2EB7 A;  3VOD A;  2DQL A;  2HTJ A;  2H94 A;  3OV8 A;  3FWE A;  3BJ6 A;  2IA0 A;  4U0Y A;  4QLC U;  2FML A;  4YIF A;  1YW7 A;  4HF1 A;  4CGZ A;  2FF4 A;  2L3D A;  3E3V A;  1Z7U A;  3KP5 A;  1EH7 A;  1XSD A;  5D4S A;  3WTY C;  2VOO A;  1DPU A;  3GFM A;  1WRJ A;  3I4P A;  2W24 A;  4P9F A;  2UXN A;  2IJL A;  1XCV A;  2UZK A;  3ML6 A;  3JW4 A;  4AVP A;  1U78 A;  3LST A;  4OIR F;  2JT1 A;  4HLY A;  1J0R A;  2G7U A;  1PUE E;  4HV5 A;  3WGG A;  2KJB A;  4P9U A;  1O57 A;  2ISZ A;  5E20 A;  3MFK A;  2DQR A;  5HLG A;  4LD5 A;  3GZ6 A;  2BEO A;  4RB1 A;  1T39 A;  1D5V A;  5AON A;  4GYI A;  4OMY A;  3DPL C;  3V8L A;  5F1R A;  4N0B A;  2ACJ A;  1QO0 D;  1RZ4 A;  5ILV A;  5TJJ A;  1CF7 B;  1S29 A;  1K78 A;  1TW2 A;  1IXC A;  3ZN0 A;  3GEZ A;  5BPD A;  3Q9V A;  3GW2 A;  4PGG A;  5K5Q A;  1X3U A;  1SFE A;  4WK8 F;  2JSC A;  1FP1 D;  1SD5 A;  1WI9 A;  2X0L A;  4N9I A;  3MAJ A;  1IUY A;  3IKV A;  1RIO H;  4G6D A;  1KQ0 A;  1YTY A;  5ILU A;  5JVT A;  1L3L A;  2QZ8 A;  2YX4 A;  2RQP A;  5CLS A;  3V8J A;  3JSO A;  1FT9 A;  5JR3 A;  4I98 B;  1T38 A;  2NRA C;  5ICF A;  2Q8K A;  3ZMD A;  2MC3 A;  5JHU A;  1ZLJ A;  1FP2 A;  2XAS A;  1BI1 A;  2OZ6 A;  5DEQ A;  4WF2 A;  1TTY A;  3I59 A;  4MTE A;  4WCG A;  4IRI A;  2ZNZ A;  4AWX B;  3IKT A;  3CUQ B;  4IRG A;  4ZYG A;  4Q47 A;  3WE2 A;  2PI0 A;  2KJC A;  1IN6 A;  2P5K A;  3JSP A;  4U0W A;  4IJA A;  3J7A O;  2P7C B;  2QLZ A;  5JI6 A;  3W6J B;  5L3C A;  2GA2 A;  3IWF A;  3NQO A;  3L9F A;  2NAZ A;  3ULQ B;  3V7C A;  4KIB A;  3WTT C;  4FX4 A;  2VBZ A;  3NEU A;  4KIG A;  1UFM A;  4L0Y B;  2C6Y A;  1EH6 A;  1HSJ A;  1R5H A;  1J2X A;  3W6K B;  2ISY A;  5D5V B;  3I53 A;  2KKO A;  4BHP A;  1SMY F;  3I59 B;  3F8N A;  2XIG A;  3KLN A;  1R36 A;  4A5M A;  2L4M A;  2A3S A;  2PMU A;  2XAF A;  4XRF A;  3SQN A;  4Q48 A;  4ETS A;  1OYY A;  3HUG A;  4M72 A;  4L5J A;  1AWC A;  4M9Z A;  1J59 A;  2XKP A;  3FMR A;  1FNN A;  2P5V A;  2ZXJ A;  5J8F A;  1XGO A;  1BI3 A;  1MJB A;  2P7V B;  5FFZ A;  3DKW A;  4UXN A;  1TQP A;  5LRR A;  1GXP A;  3ZMZ A;  1XSX A;  2O3F A;  4Q4Z F;  1HST A;  3L09 A;  1U8R A;  2DO7 A;  3C18 A;  4BH9 A;  3TDU C;  4O6J A;  4UVC A;  1G3T A;  3U1D A;  4UNO A;  5ICG A;  5BMZ A;  3K0L A;  1ZGJ A;  1U5T B;  1HW5 A;  2KRF A;  3FZV A;  2HS5 A;  3ZMS A;  4WWC A;  4AIH A;  5FB2 A;  3LQR A;  2PEX A; 
#chains in the Genus database with same CATH topology
 3LA3 A;  3KIO A;  2R5Y A;  4YG2 F;  2HVQ A;  3DQV C;  4RDU A;  3GTM J;  3RI4 A;  2A07 F;  2HPI A;  1D1A A;  1VF9 A;  2YUS A;  4WXH A;  1S72 I;  1RI7 A;  1JJ6 C;  2DA7 A;  2D45 A;  3DV8 A;  1K78 B;  3CCQ I;  3D5S C;  3F23 A;  2DDA A;  1K7A A;  3IL2 A;  1EF4 A;  2DTR A;  1TQM A;  3KP6 A;  1DP3 A;  5LFA A;  2CFO A;  1GUU A;  3TO6 A;  1FWZ A;  3WTZ A;  3EUA A;  2VLA A;  3A0B C;  3K4L A;  4P55 A;  4FAS D;  3QRF F;  1R4N B;  1FC3 A;  3V4G A;  1RUO A;  3P9C A;  4KUM A;  4RLF A;  2AQF A;  4RS8 A;  2WV1 A;  3PUB A;  1SC7 A;  5DD8 A;  1F9N A;  2GIV A;  2L0K A;  3HJE A;  3OR2 C;  1N77 A;  5ED4 A;  5HDK A;  4A0Y A;  1I1S A;  2K9Q A;  2BGC A;  5IYB J;  5J4Y A;  2WWY A;  3K2Z A;  2CUZ A;  2P6S A;  3GX4 X;  1UHM A;  2CV1 A;  1QZZ A;  3RCO A;  2JPC A;  1QZE A;  4XM3 A;  3FHN A;  3GFI A;  3GWZ A;  2QKL B;  1P7J A;  4CYD A;  5C3E J;  1UB9 A;  4HNU A;  1HCR A;  3WU0 A;  4HA8 A;  5IT3 A;  1S9H A;  1KQ8 A;  2VL8 A;  1TC3 C;  2LDU A;  2LMD A;  3F8C A;  4G6T B;  1RPW A;  1OR7 A;  2O03 A;  5L3D A;  1Y6I A;  2BY0 A;  4MGR A;  5JFR A;  2F5C A;  1R5G A;  5DCM A;  3J7A Y;  1ON1 A;  4I01 A;  3SFZ A;  2G7H A;  2DOD A;  3R61 A;  4HST A;  4RBO A;  1Z05 A;  5B1B H;  2FEZ A;  3BG6 A;  4UVB A;  1MSE C;  3B02 A;  3CP2 A;  1DU0 A;  1G3Y A;  1EV7 A;  3K10 A;  2EA2 A;  1FZP B;  4NQW A;  3A1Y A;  1T0F C;  4EGY A;  2V1D A;  2OZU A;  5E3L A;  2EZL A;  2Z3Y A;  4AC0 A;  2FA5 A;  3M7G A;  2E2I J;  3H92 A;  3VDX A;  2GXB A;  4D7M A;  5DDG A;  3N97 A;  1Y39 A;  1J09 A;  4BE0 A;  4IHY A;  4KMF A;  2ZCW A;  4KIT B;  4FT8 A;  5FFX A;  2EZI A;  1X1A A;  1AU7 A;  5GP9 A;  4U7B A;  4A3M J;  2DOF A;  4GXO A;  3OYM A;  5CVI A;  1K6O A;  4ITV A;  1I6X A;  1V3F A;  3AL0 B;  3O6B B;  2F4M B;  4HBL A;  4ZYA A;  3BR0 A;  3PNT A;  4YIR X;  2XB0 X;  2ZXW H;  3F6V A;  4BBS J;  1LDJ A;  1HKT A;  2WAF A;  2EFO A;  3WTU C;  4H4K C;  4A6D A;  2R0Q C;  5L3G A;  2OAZ A;  1R1U A;  4XON A;  1VQL I;  2EZK A;  5E79 C;  5EEG A;  2DA3 A;  2QQ9 A;  2JA8 J;  3SJM A;  3H3U A;  1TT5 B;  5BOX A;  2KIQ A;  2V1U A;  4M6V A;  4ZYH A;  2HQR A;  1Z77 A;  2RN7 A;  4ESF A;  2FBK A;  5DCM B;  2JN6 A;  2MAB A;  3RKY A;  2XVC A;  1LFU P;  1Z3X A;  3MQ0 A;  3CLQ A;  1IO2 A;  3FM5 A;  3HHG A;  2M35 A;  1R71 A;  3RTR A;  2HYG D;  1TNS A;  1JGS A;  1FYM A;  4E7K A;  3VB2 A;  1TWG J;  3KP7 A;  2DAO A;  3L7W A;  1FY7 A;  2K4J A;  5GAH J;  2OA4 A;  4CIC A;  3GXO A;  1I27 A;  4G7Z F;  1QZY A;  4B8X A;  1LVK A;  3IH2 A;  4L9T A;  2ME6 A;  4ASN A;  3WU2 C;  3B6A A;  3IAM 2;  1YOV B;  4IL6 C;  2HNH A;  1LUJ B;  4EJO A;  4C2U A;  4UV8 A;  2ZJ2 A;  3GME A;  5J1U A;  1FOX A;  3RSN A;  4ANJ A;  3K4B A;  4MLO A;  1ZTR A;  2KMU A;  4Y17 A;  2O9L A;  3CJR B;  3CTA A;  5FRO A;  2Y2Z A;  6PAX A;  4UUT A;  1LFB A;  3DBH B;  4JBA A;  3O8G A;  2WV0 A;  2VJJ A;  2WA0 A;  3H9J A;  5LGT A;  3JTH A;  1HDD C;  5M3F J;  1P9Q C;  3AG1 H;  4IZZ A;  1U0J A;  4C3H J;  5HNF A;  2EQR A;  4MTD A;  4WXD A;  2Y0M A;  5CVV A;  3HOT A;  1MJ9 A;  3ZOB A;  3MCZ A;  2B0L A;  3L2C A;  2KDO A;  1IN7 A;  1QNT A;  2VE8 A;  4N9H A;  5CYV A;  3BR3 A;  5F0F A;  4G7H F;  4CDG A;  2QBY B;  2R7S A;  2LRD A;  3GTJ J;  3K1M A;  1VQP I;  4A2U A;  3P5J A;  2LG4 A;  1W36 C;  4S04 A;  2W4S A;  5M5Y J;  3KZI C;  2TRT A;  2PX9 A;  5E1X A;  3EUH A;  2MH9 A;  4MO7 A;  3GYH X;  1MDM B;  2KT0 A;  3WG7 H;  3OIO A;  4PFO A;  2E7W A;  4BQO A;  3HDD A;  2GA1 A;  2X85 A;  3OOU A;  1IN8 A;  1BJZ A;  1W5T A;  3S1M J;  4RB0 A;  4II2 A;  2DK8 A;  2XAH A;  3AKZ A;  5M3M J;  2ELK A;  4P1W A;  1YJ9 I;  3PIP F;  4A0Z A;  2CU7 A;  2E34 A;  2QCO A;  2PG4 A;  5FKK A;  1T98 A;  3K9T A;  4XOT A;  4KIC A;  4AYB A;  1ZG1 A;  2IGN A;  2UUZ A;  3U9G A;  2OD5 A;  2CQ7 A;  3AFH A;  3WOD F;  3ZQI A;  4V2F A;  3K4K A;  4H0E A;  3A02 A;  3DTK A;  2MH2 A;  1R9T J;  3CCJ I;  1LDK B;  2ZBK A;  3E5Q A;  3TP0 A;  5DM7 F;  3GTL J;  1ZRE A;  1FSE A;  1IRZ A;  2CH0 A;  3REO A;  1REP C;  4I0B A;  3BDD A;  1O7L A;  2FE3 A;  4KN4 X;  3V7S A;  3IC7 A;  1T2K A;  1YHQ I;  3DTE A;  2O61 A;  1KU2 A;  4HX8 A;  2L02 A;  5HLH A;  3WGH A;  1KGS A;  2DK5 A;  3CME I;  2PMZ N;  1RR7 A;  2PFB A;  2L5Q A;  2RV8 A;  2CG4 A;  4M9S A;  2JA2 A;  1SD4 A;  3H36 A;  3WG9 A;  3BPX A;  1RKW A;  1SD6 A;  3BTI A;  1VZ0 A;  2HZT A;  1TW3 A;  2LVS A;  3CUQ C;  2XRN A;  4A3B J;  3D5L A;  2L7K A;  3BY6 A;  1LEB A;  4F7Z A;  2EIK H;  2HDW A;  2EIJ H;  1ETX A;  1UEL B;  4JX6 A;  4Y7N J;  1MBH A;  4IF4 A;  2XSJ C;  4LIU A;  2LY2 A;  1G3W A;  3DU6 A;  3DCF A;  1A5J A;  2V79 A;  1HF0 A;  2VXZ A;  2W25 A;  3C3W A;  4Y4R A;  2CW0 F;  4HOB A;  5HOD A;  3MKZ A;  1OIS A;  2Q2E A;  3GTK J;  2EV6 A;  2K9N A;  4DNC A;  2Y69 H;  4NNJ A;  5F64 A;  2UXX A;  3HRM A;  1TNT A;  3DKY A;  3BT9 A;  1IGN A;  1T95 A;  4I02 A;  1FMW A;  1UZC A;  3DU5 A;  2L7F P;  3PQJ A;  3L00 A;  4EM0 B;  2OV7 A;  5DCF A;  2HVR A;  1UCR A;  1XB4 A;  2D5V A;  4XLE A;  2M45 A;  1ORK A;  2QQA A;  3CJQ B;  1BJA A;  2R7Q A;  5TRD A;  5EJC A;  3HM5 A;  2IPQ X;  2F6C A;  5EYR A;  4XLN F;  4C2T A;  4DQ2 A;  1IRF A;  1WH7 A;  3KLO A;  1JE8 A;  1MBF A;  2QYO A;  3ONQ A;  4ZZD A;  4EEF G;  4CCK A;  3F6O A;  2ME0 A;  2K9S A;  1IN4 A;  5CVJ A;  1RQ6 A;  1XMA A;  5K7Z A;  2LY1 A;  3A4C A;  1D8K A;  2MG4 A;  2D1H A;  2K3P A;  3S3M A;  1MIJ A;  1KU7 A;  1GDT A;  2DMT A;  5M5X J;  1XN7 A;  1YJN I;  3COA C;  1SFO J;  2M87 A;  3SEZ A;  2MYS A;  3QPS A;  2V1X A;  2IBD A;  1JHF A;  1HOM A;  4DYQ A;  4UUV A;  3BRO A;  5EZG A;  2FQ4 A;  2LYC A;  4KYW A;  4I2O A;  2BXZ A;  3HRU A;  1A04 A;  4NDL A;  2E36 A;  2DW4 A;  2K02 A;  3BP8 A;  1AA7 A;  3PO3 J;  5C4J J;  2H8R A;  2NS0 A;  3R6S A;  2EPF A;  3W6V A;  1W0U A;  2ZNY A;  2ZFU A;  3TGN A;  2XGC A;  5FKL A;  4BY1 J;  4FE4 A;  4MNU A;  2R3S A;  3BTC A;  2FRH A;  4BEH A;  4FIS A;  1TL8 A;  2STT A;  4CZZ A;  2OBP A;  1D0Z A;  3CC4 I;  5JVG F;  2CQQ A;  2F4I A;  2YU3 A;  5HS7 A;  1YJW I;  2M8E A;  1FSH A;  3G1L A;  1V5E A;  5IT9 Z;  2MW8 A;  1MMG A;  1ZAO A;  4C3I J;  5GAE J;  1H89 C;  3P9K A;  4ESJ A;  2WAD A;  4P96 A;  1S7A A;  1ZGA A;  1T8I A;  3CJT B;  4XLP F;  2L4A A;  2K86 A;  3OSF A;  3TED A;  1DDN A;  2O7O A;  2H1L A;  3L2U A;  1ZQ3 P;  4BDZ A;  3HEF A;  1DQU A;  4DZJ A;  3HRT A;  4PJJ A;  2CV0 A;  5D8K B;  2R7D A;  1HW1 A;  2XGX A;  2ZXH A;  4XOP A;  4YFN F;  2WC2 A;  2QEN A;  5EGO A;  2V9P A;  2CGP A;  5BS6 A;  2HQN A;  3EYY A;  4KJZ A;  5L3E A;  3J81 Z;  3H1C A;  1ZAR A;  5CPR B;  2JSP A;  2XSD C;  2DU9 A;  4BE2 A;  3HG9 A;  3RQI A;  3MZY A;  2FOK A;  2FBH A;  3CO6 C;  1QPI A;  4BGD A;  4GGG A;  4OIO F;  2Z33 A;  5C44 J;  3EPZ A;  4HEA 2;  1WZ2 A;  5KHD A;  3I4N J;  1FEX A;  2K7L A;  3OYF A;  3CZ6 A;  4OIN F;  4EJU A;  2GQQ A;  4B44 A;  1U3E M;  2YPR A;  5ICE A;  2EH3 A;  4I0A A;  1FOK A;  3I54 A;  5A2Q R;  1YIT I;  2P5L C;  4L5E A;  4ZH4 F;  2HOE A;  3FXU A;  2EFP A;  3LAJ A;  1X1P A;  1BI2 A;  1WPK A;  2JPB A;  5J4V A;  1RES A;  5DUK A;  1N78 A;  2MLG A;  3J80 K;  1R5I D;  4OWR B;  2DA4 A;  4K2E A;  4RB3 C;  1IG7 A;  1ITY A;  3IH3 A;  2MFZ A;  2Z9O A;  3WTX C;  1HKQ A;  1YQA A;  1ETQ A;  1P4A A;  2HOT A;  4XSX F;  1POG A;  1EKE A;  3CO7 C;  3HXL A;  5D4R A;  1LE8 B;  4UV9 A;  4RLQ A;  2CUE A;  2A05 A;  4DW6 A;  4PSX A;  3E5U A;  3Q0V A;  4BUP A;  4YEL A;  2R7W A;  1ETO A;  1MW7 A;  3VOE A;  1IV8 A;  4DBQ A;  1S3J A;  4CXF A;  1WGX A;  3G1M A;  1U8B A;  3JCU C;  4R8H A;  3J81 K;  1XCB A;  3E7L A;  5KCM A;  3OIP A;  3X2Q H;  2VXD A;  4BBR J;  3CCV I;  1MKM A;  3F72 A;  3LSI A;  5K1Y A;  4V19 K;  1FBQ A;  2KQR A;  5J8C A;  4J01 A;  1B8I A;  1DU6 A;  2GXG A;  3G4S I;  1ZEL A;  2MSY A;  2XC7 A;  2KZG A;  3KE2 A;  4Q5S F;  3K69 A;  3HPH A;  3HSF A;  2JA7 J;  2JUC A;  3DPU A;  4UUS A;  4YEJ A;  1LE8 A;  2BY3 A;  1MNM C;  1WJD A;  2L9S A;  1ULY A;  3G3Z A;  1XMX A;  2X51 A;  1IRX A;  2IGK A;  3ASO H;  1DPR A;  2QVO A;  3G73 A;  4HDU A;  1VQN I;  3S16 J;  1USS A;  4HNV A;  2IS4 A;  4PCQ A;  1TWH J;  3BQZ A;  4ZC3 A;  4HAM A;  3UR3 C;  2DXI A;  2CYY A;  4G6Q A;  3M8E A;  3TL4 X;  2HQA A;  4NHJ A;  3WTS C;  3FXQ A;  2F5D A;  1NG6 A;  2L54 A;  5ICC A;  3SFI A;  1S8N A;  4LB6 B;  2CV2 A;  2LNB A;  4OMZ A;  4UHT A;  3ZRG A;  4AM3 A;  1JGG A;  1RUN A;  5HLT A;  1B59 A;  2QWW A;  2BVM A;  2M4G A;  1WJF A;  2NVX J;  4BHB A;  5HNH A;  1FTT A;  2K27 A;  3M8F A;  2A6E F;  1IXR C;  2VBW A;  4OAZ A;  3F22 A;  1MDM A;  3AL0 C;  3CC7 I;  2VKD A;  1IW7 F;  4HW0 A;  5LEJ A;  2DMN A;  3S3N A;  2HKX A;  4KT6 A;  5ERI A;  2M5W A;  3E6B A;  2X1E A;  3DP7 A;  4HX7 A;  5FKM A;  5JLW A;  4LK1 F;  5FLM J;  2OCE A;  3HOX J;  4EQQ A;  4ENK A;  2ZJQ F;  3IAS 2;  4B3A A;  4ZDO A;  3CCU I;  4MIM A;  4BAY A;  1MMN A;  1OJL A;  1SVM A;  3HB9 A;  2F5E A;  2M3A A;  2IVM A;  4W1U A;  1VQO I;  2JZY A;  3CD6 I;  4F92 B;  4I6Z A;  3OYC A;  3OYD A;  2QUF A;  1O4X A;  1DUX C;  1SAN A;  2VC1 A;  1U2W A;  1XMK A;  4BQQ A;  3S14 J;  3CCR I;  1YS6 A;  2COM A;  2HPM A;  2VE9 A;  4KIS A;  1PP7 U;  3BG9 A;  3OIQ A;  1EJ9 A;  1I6H J;  4LGW A;  4RAZ A;  2CFX A;  2JTV A;  5AIQ A;  1FMV A;  4HSR A;  2VOP A;  2DDB A;  4OOI A;  4XKW A;  3ZQH A;  1B6A A;  1OCR H;  2XF7 A;  1ACI A;  1MGT A;  1BIB A;  1X2M A;  1Y0U A;  5B3S H;  3P9I A;  2P6T A;  3LNQ A;  2J5O A;  2X6X A;  4D0P A;  2E60 A;  2LSO A;  1G2H A;  3AG2 H;  3S15 J;  1QPM A;  2VC0 A;  4M3G A;  2VQL A;  1U9N A;  1CF7 A;  1T0F A;  2YR2 A;  3ECO A;  3T0Y A;  4QIW N;  3HIF A;  4XLF A;  1KU9 A;  2E5Z A;  3S8P A;  1PJR A;  2KIU A;  4RGU A;  3K1N A;  2JA5 J;  1S7E A;  2DFH A;  5J3L A;  1ERD A;  2KLO A;  3OYK A;  4HNT A;  3GLX A;  2H27 A;  2FQ3 A;  2GWR A;  4AIK A;  1W36 D;  1K83 J;  2ZKZ A;  3ERM A;  3ZMT A;  2DPU A;  4XID A;  2O8X A;  2HOA A;  1WKM A;  5HS9 A;  4ZDL A;  2Y30 A;  2FBI A;  4LLL A;  1Z0X A;  1S5L C;  3RDI A;  5LHI A;  2HR3 A;  5HDN A;  1F5T A;  1YIJ I;  4G8X A;  5HDG A;  4AID A;  3C2H A;  5BPI A;  1VQ9 I;  2R4G A;  3OL3 A;  5DD4 A;  3KPH A;  3PJR A;  5FLX R;  4LB5 A;  5FLX Z;  3I58 A;  2VKV A;  2RC4 A;  2W48 A;  3KFW X;  4NC6 A;  3EQL F;  4S05 A;  1FTZ A;  1HBX G;  1S6L A;  2JJ7 A;  4I09 A;  2QQ8 A;  2NNY A;  2R5Z B;  5LGN A;  2Y31 A;  2EFW A;  5E17 F;  2GZW A;  5KVR A;  2DYS H;  2BBY A;  2ID3 A;  3QU3 A;  4BXX J;  2EV0 A;  1VQK I;  1TZL A;  2CQN A;  1ZRC A;  5FJ8 J;  1XS9 A;  2STW A;  3BZ6 A;  3LA7 A;  5GAD J;  3PM1 A;  5LBQ A;  1L0O C;  4D1Q A;  1NG7 A;  5F08 A;  3CF5 F;  1B72 B;  3M1E A;  1JTX A;  4HZF A;  1QHH D;  1X1B A;  3E6D A;  5FD5 A;  4ABZ A;  1X3W B;  4B43 A;  3JRG A;  2ICW G;  3QQA A;  2R7F A;  3HHH A;  4O5V A;  2Z16 A;  1BR4 A;  5EEH A;  1ETV A;  1LPQ A;  4FCY A;  3ZQC A;  3RZO J;  2V9K A;  4A3G J;  1R7J A;  3BG7 A;  2R93 J;  1LVA A;  2W85 A;  2K4B A;  3FK7 A;  4TV7 A;  2WBM A;  3CUO A;  2K9L A;  3LSM A;  5KAI C;  1HC8 A;  4B3X A;  4BL0 B;  4E4H A;  1Q1V A;  4W97 A;  2FX0 A;  1Z9C A;  1AHD P;  2UWM A;  2QQB A;  3QOD A;  4RGX A;  1STZ A;  3S1N J;  1JT6 A;  4U7D A;  1XDU A;  4C3J J;  1YW8 A;  4L18 B;  5J6X A;  3V8K A;  2PMZ A;  3HYI A;  1ZN2 A;  5AIP A;  2V7F A;  5IY5 H;  3BR2 A;  3EDP A;  1UJ8 A;  1O3S A;  3QYF A;  2Q0O A;  3TOB A;  1YX5 A;  1BI0 A;  3EUH C;  2HKO A;  3CUQ A;  3O2P E;  1FYK A;  1H8A C;  2NOJ B;  4S0H B;  2IAI A;  4FHT A;  1ZLK A;  1OCZ H;  3JRE A;  3LSR A;  2CW8 A;  5H6R A;  2F2E A;  4A3E J;  1B4A A;  3MKL A;  4PFP A;  3ZR8 X;  3PNV A;  3QWL A;  1ZH5 A;  1XC5 A;  3J80 Z;  2COB A;  4QWQ A;  1KU3 A;  5D6E A;  5IP7 J;  1AOY A;  5GAG J;  4IRH A;  4M74 A;  4WXC A;  5FD6 A;  3RPU A;  2XRL A;  3TBI A;  3BWG A;  3RYP A;  2RRE A;  3HOU J;  4UUS B;  3OS2 A;  2E1M B;  3CF2 A;  2VBX A;  5K5R A;  1MJA A;  4U87 A;  2PBI A;  2ADU A;  2EFN A;  3TKY A;  1ONV A;  1UG0 A;  4BKX A;  1ZRD A;  2A6H F;  1B1B A;  3MWM A;  2RVC A;  3BPV A;  3I56 I;  3Q5F A;  2W00 A;  3J7Y J;  3GLL A;  4XRS G;  2BHY A;  5LHG A;  3PUF A;  4AD9 A;  1KZH A;  3RQ4 A;  5LRS A;  4JQF A;  4PUS A;  4IXA A;  1QA6 A;  5E8I A;  5FLX K;  3KP3 A;  1K6Y A;  5ILS A;  2DOE A;  1GHC A;  2NVY J;  4PDK A;  2W82 A;  1IJW C;  4Z2Y A;  1YI2 I;  1YLF A;  1ZKG A;  5E3N A;  1P4W A;  5EGO B;  4HPQ A;  2KRC A;  2G0E A;  4DGW B;  2K5C A;  1W7P D;  3OMY A;  1ZG5 A;  1ETY A;  4E7Z A;  1RR8 C;  2V9V A;  3EUK L;  3TDZ C;  4ENJ A;  2IW5 A;  1MMS A;  1BC7 C;  3OYE A;  3GF2 A;  2MC4 A;  1W7P A;  3LA2 A;  2PLY A;  3I64 A;  3S32 A;  2LKP A;  3CMM A;  2MGQ A;  5E8G A;  1IF1 A;  3RJP A;  1BN5 A;  2LC2 A;  3E6M A;  3DEU A;  1BBY A;  3HC7 A;  3MZ8 A;  3MVP A;  4HX4 A;  1X1D A;  3MEX A;  2A5Y B;  2FNA A;  1HW2 A;  2WB1 N;  1YG2 A;  3ABL H;  5IOZ A;  4GDF A;  2DLL A;  3C2G A;  9ANT A;  4XLH A;  5K5O A;  1J9I A;  3JRB A;  1T56 A;  3E5X A;  3KZZ A;  3N4M A;  2OU2 A;  2NYX A;  3QOE A;  1D8J A;  1TBX A;  2ZME B;  1JT0 A;  2RGV A;  2AXL A;  5JLX A;  1R4M B;  4D9J A;  2VPL A;  3KEQ A;  1WJE A;  5B5E C;  3RZD J;  3I71 A;  4A5N A;  1LEA A;  2GBY A;  3FXM A;  3R0A A;  2GLO A;  1WH5 A;  4B09 A;  2EV5 A;  2PN6 A;  3CCM I;  1FBU A;  4IQ4 A;  2CMP A;  3K4N A;  2KHM A;  1FIA A;  4LLN A;  4BY7 J;  3WU1 B;  3ZMV A;  2TCT A;  4MQV A;  1IZ1 A;  1AKH B;  4IVN A;  3G71 I;  4XLC A;  2ZC2 A;  2ZSI B;  1A6I A;  3D0S A;  1LFP A;  2ZXI A;  4HDV A;  1IUF A;  1DP7 P;  4ZTJ A;  3K2A A;  3KYC B;  3TO7 A;  4L9J A;  1OKR A;  1R00 A;  3LSJ A;  4ON0 A;  3WHC A;  3FBI B;  3HKZ A;  2DA1 A;  3VYU B;  4X0G A;  1PP8 F;  1W4M A;  1FOY A;  3Q0U A;  2DBB A;  4BHC A;  5HOO A;  3A0H C;  3ESW B;  3L2Q A;  1QHG A;  2DA5 A;  2AS5 F;  2XGD A;  2WB1 A;  2W57 A;  4A3D J;  3CJN A;  5CVR A;  3PQK A;  4RM3 A;  4V2G A;  2DA6 A;  2EIN H;  3LOC A;  3SZG A;  2OQG A;  4M71 A;  1PDN C;  4U0V A;  4M6X A;  3CC2 I;  2HOS A;  2MUN A;  3FIW A;  2HDC A;  3LSH A;  4XR6 A;  2IRF G;  1YW9 A;  3KP4 A;  2LTP A;  4M73 A;  3C1D A;  3WTV C;  1ZRF A;  4IHW A;  3DEW A;  1TLH B;  4BS9 A;  4IHX A;  3FIS A;  3S1R J;  1VQ4 I;  5IT9 R;  1W5S A;  2H6C A;  2ZJR F;  2EK5 A;  2X98 A;  2JRM A;  2O0Y A;  2Z2S B;  5CJ9 A;  3S3O A;  3BQY A;  3NRV A;  4ZYE A;  5D8L B;  3TO9 A;  3E1S A;  2RAE A;  2VKH A;  4ZDP A;  3CCS I;  3F8F A;  2BXY A;  1G6N A;  2E7X A;  3DLL F;  1V55 H;  1ZG3 A;  3M4O J;  2QGU A;  1OCC H;  4L5I A;  3ZQF A;  4A3F J;  2VT3 A;  3JRD A;  4PJN A;  1VQ6 I;  4YII A;  3VSL A;  1JXS A;  3HSR A;  1FPQ A;  2Y9Y A;  3DBR B;  4A3K J;  2IS6 A;  5LD2 C;  2DI3 A;  4A12 A;  1DGW Y;  2RKH A;  3H5R A;  5GPC A;  4BAC A;  2R92 J;  1I1G A;  4M6Y A;  5E18 F;  3E0J B;  2LY9 A;  2BZT A;  3G2B A;  2KP6 A;  3LFK A;  4KMU X;  1IN5 A;  1ETW A;  4CH7 A;  4E7H A;  4HV6 A;  1JHH A;  2HU9 A;  3U2R A;  5B1A H;  1BL0 A;  1FYL A;  1KYW A;  4Y15 A;  2MD0 A;  3FMQ A;  1LB2 A;  3TW6 A;  2DT5 A;  2QM3 A;  3HOY J;  1MH4 A;  3SEQ A;  2M0C A;  4BQA A;  4AUX A;  4LG0 B;  2DT6 A;  1FIP A;  3HPG A;  4LIV A;  3VEP A;  1ODD A;  1ZYR F;  1T08 B;  4I7H A;  4XN3 A;  3EYI A;  5IT9 K;  3ASN H;  1OCP A;  1XX5 A;  3QP6 A;  4ZJZ A;  2PQ8 A;  1BM9 A;  3H5N A;  1EH8 A;  5F04 A;  1VQ5 I;  2AO9 A;  3ZQG A;  4OAY A;  4CCL A;  5F27 A;  4R79 A;  2HWV A;  2CRG A;  4LIT A;  3M9A A;  1P7I A;  3E6C C;  1IRG A;  3ZGK A;  1WWX A;  2GM4 A;  2VAS A;  3HOV J;  1GVJ A;  4HRI A;  2A5W A;  3KET A;  2OCC H;  3ECH A;  1G4D A;  1B8I B;  5FRN A;  2GOX B;  1X3Z B;  3JR9 A;  1KA8 A;  4MEX F;  2JVG A;  2IGO A;  2IA1 A;  1MND A;  1ZGW A;  3CCL I;  1P6R A;  2B7E A;  4PJM A;  1UHS A;  4IPA A;  3S2W A;  2A61 A;  3VYT B;  2HEO A;  3CP8 A;  1Q1H A;  2XPU A;  2DFI A;  4IQJ A;  1OCO H;  1H9T A;  5CVU A;  3K70 C;  4L0Z B;  2QEX I;  4IKF A;  2CQK A;  4AU7 A;  4A6E A;  4F93 B;  5DYM A;  3W2V A;  4NC8 A;  1QBJ A;  4M3D A;  4FTH A;  3KYL A;  2B63 J;  3ELK A;  2OF7 A;  1Y0N A;  4P5O A;  4GFB A;  1U5T C;  2BY1 A;  3TQN A;  2V6C A;  1JTY A;  3CDL A;  2XKO A;  1UG2 A;  4CO8 A;  5J40 A;  4B1R A;  2Q1Z B;  5M5W J;  4IX7 A;  1M1E B;  2WAQ N;  1MBJ A;  4M3E A;  4LG0 A;  1VI0 A;  2BE5 F;  2D1V A;  1ON2 A;  3OOP A;  2BYV E;  3I9V 2;  2MLK A;  2BW3 A;  1SFK A;  2CW7 A;  1XGN A;  3P7N A;  3L2W A;  3UKG A;  2Y75 A;  2JVH A;  5F6F A;  4CZC A;  5HVQ C;  2NS8 A;  1JKR C;  2P81 A;  2JK3 A;  4BXU A;  4MEY F;  4OIQ F;  2ESH A;  2JA6 J;  3FXK A;  3QP5 A;  2VQG A;  1HXD A;  3CMA I;  2M1B A;  4EV0 A;  4J00 A;  2P0W A;  3BJA A;  4EJW A;  1UST A;  2VOD A;  3GTO J;  3M3Y J;  4XLA A;  4IOA F;  3FKJ A;  2ECB A;  4GCV A;  3MKY B;  3V7R A;  1W7P B;  3QPT A;  4GRI A;  5DS9 A;  2L7M P;  4N4O B;  5D5X B;  2E1N A;  3NAR A;  2AXT C;  2AQE A;  3CCY A;  5TGT A;  2L9N A;  3FF5 A;  2ZJP F;  2Z99 A;  3VPR A;  4RGS A;  4CUG A;  3FDY A;  2OUM A;  2MA3 A;  3F0C A;  1T6S A;  3FM3 A;  5F0C A;  4D7N A;  4KA4 A;  2A69 F;  1KYZ A;  2EJR A;  3K4C A;  5FGM A;  1WQ2 A;  3VYS B;  5LGU A;  2L01 A;  2RNJ A;  1MBG A;  2DA2 A;  3ABT A;  1W1W E;  1R23 A;  3LQQ A;  1OFC X;  4HF0 A;  1W0T A;  3ABU A;  2Y9Z A;  4O3M A;  3H9G A;  3SXY A;  3FHZ A;  3ERE D;  2HYF A;  2V1N A;  2L9V A;  1VFC A;  5FLV A;  5L3F A;  3S2H J;  5IYD J;  2OPT A;  1SFX A;  1QVT A;  3RKW A;  1TP4 A;  1FOW A;  2K3F A;  3TOA A;  2KIM A;  4E70 A;  1PUF A;  2XV4 S;  4BJ6 C;  5HS8 A;  5EF6 A;  5CKT A;  2JQ7 A;  4DJA A;  2O6G E;  4M3B A;  1GT0 C;  2DFE A;  2HDD A;  4PJ0 C;  2LBF B;  2HXO A;  3LSK A;  4LK0 F;  1XGM A;  2XHK A;  2GAU A;  3QYB A;  2FU4 A;  3LMM A;  3I55 I;  4G94 A;  3K1P A;  3VFZ A;  3R4K A;  4HF2 A;  1R22 A;  2Y0S N;  2R7R A;  2XUB A;  2LF8 A;  1B9M A;  2ZME C;  2XAU A;  4KFC A;  4EAT A;  3N05 A;  3T8R A;  4LG3 A;  1RC9 A;  2B9S A;  4BXF A;  3FKI J;  4OU0 A;  3IHU A;  2VKE A;  1D1C A;  2I8D A;  1QQI A;  4ENM A;  3OYA A;  1F36 A;  4G9Y A;  3ZN1 A;  3G1O A;  1R1T A;  4PJL A;  1OYW A;  3WTW C;  3WGI A;  3SDG A;  1GXQ A;  1K4T A;  2JMW A;  4JX5 A;  3HOW J;  4KT5 C;  2CUJ A;  1E3O C;  5D5W B;  1N75 A;  2BW3 B;  3NAU A;  5EZH A;  2A68 F;  1O3R A;  1OYI A;  4M3F A;  5E1W A;  4GO1 A;  1Z6R A;  2RDP A;  1BOB A;  3HGG A;  4BYY A;  1OPC A;  5K7H A;  2LF7 A;  3RIR A;  3SHF A;  4EJV A;  3MD2 A;  2BV6 A;  3GFL A;  5DTD A;  2IS1 A;  1JI8 A;  3DFG A;  1SMT A;  2LP0 A;  3KYD B;  3VWB A;  2QSF X;  4PSW A;  3O3K A;  2KFD A;  3A2K A;  3FMS A;  3CLO A;  4HG2 A;  4YRV A;  2NXN B;  4X1E A;  1C0W A;  1XD7 A;  1V54 H;  5FO5 A;  4ZZL A;  5CQG A;  3BR1 A;  4NBQ A;  5B66 C;  5D6F A;  3HTU A;  1E3H A;  2X9D A;  1B9N A;  3PFI A;  3Q0W A;  1IC8 A;  3GO5 A;  2DCE A;  3JAM Z;  2HFH A;  4YFX F;  3HOS A;  3JAM R;  4PGH A;  1WHU A;  4XKV A;  1SFU A;  4XRS A;  3KZY A;  4XMY A;  3GZN B;  2EA4 A;  2X4H A;  2DPD A;  1K79 A;  1GLN A;  3OYJ A;  1BR2 A;  4LFU A;  2WY8 Q;  4HLX A;  5EEA A;  3HTS B;  4PZJ A;  3OYN A;  2OJE D;  1PUF B;  4E7J A;  5IOY A;  1LNW A;  1SVL A;  5L3B A;  2XDV A;  2IP2 A;  2CQX A;  2W84 A;  3GFJ A;  3Q9S A;  2VB6 A;  3I5U A;  2VJ5 A;  1YS7 A;  3KEO A;  3ZP5 A;  4E7S A;  4LMY A;  4CSW A;  1XSV A;  2NVQ J;  4QTR A;  1JUM A;  4R1H A;  2JUG A;  3PL8 A;  2LRE A;  1IDZ A;  1FBS A;  3HSE A;  4N4N B;  2H6B A;  2KRH A;  1I3Q J;  1P4X A;  1U9O A;  1LJ9 A;  1D3Y A;  3OL4 A;  2BVL A;  1Z91 A;  5BNG A;  3AG3 H;  1I39 A;  3DXJ F;  1P92 A;  5GPA A;  1JKO C;  3DF8 A;  3K70 D;  3BJO A;  2VJ4 A;  3SZT A;  1UHW A;  4RAG A;  3BOQ A;  5TIS C;  1HA8 A;  5H6Q A;  2PMH A;  4L9V A;  3PSF A;  5F1J A;  2KPM A;  4BQN A;  2KIF A;  2EWN A;  2CSO A;  3H0G J;  3DLA A;  3JAM K;  4HQE A;  3JTG A;  2FNP A;  4G7O F;  3S93 A;  2M30 A;  2XF6 A;  1VTN C;  3VSK A;  4XNF A;  3C2B A;  2VJI A;  3GTP J;  2KL4 A;  2XF5 A;  4U88 A;  3RYR A;  1CGP A;  3JRH A;  2XRO A;  1XDS A;  2M7A A;  1MMD A;  3QYE A;  1F4K A;  2A6T A;  3BR6 A;  4A3L J;  2CUF A;  3C7J A;  1E0E A;  3I3L A;  2P4W A;  1E17 A;  4F91 B;  3TW7 A;  3JRC A;  4KIF A;  4WX9 A;  4KDP A;  2XPW A;  1Y56 A;  2VIX A;  4EMS A;  3LAP A;  1TWA J;  4Y13 A;  4ZYD A;  2TDX A;  2XAG A;  3NWT A;  3BLY A;  4DBR A;  3QAH A;  1I3A A;  1OR7 C;  1EA3 A;  1IXS B;  1Y8Q B;  3QPH A;  3HRS A;  5CQE A;  1QGP A;  4CHU A;  3RKQ A;  4EVI A;  3S17 J;  1SD7 A;  1FLI A;  4ENN A;  3H0D A;  3ISP A;  1HQC A;  3ABK H;  4XKB A;  1A35 A;  3HZJ A;  3MKW B;  1R6R A;  4M9X A;  5E3O A;  3W2W A;  2L2O A;  1UMQ A;  2FUG 2;  4JX4 A;  1F1Z A;  2I5U A;  1WSU A;  3NWS A;  3FXR A;  1JUP A;  1MH3 A;  4B47 A;  3H3Z A;  2FMY A;  4GYG A;  4BJ5 C;  1JUS A;  2E1O A;  4HYE A;  5K7F A;  2QBY A;  2Z1D A;  3F8B A;  1FX7 A;  3KP2 A;  1N25 A;  4LLG F;  2OQR A;  3D5R C;  1P2F A;  4EM2 A;  2P0T A;  3CDH A;  1RRJ A;  4RGR A;  3FK6 A;  2VON A;  1U5T A;  1ZK8 A;  1Z7L A;  2D2W A;  3LL7 A;  3I0T A;  3ZXS A;  3J81 R;  2ZME A;  2XAQ A;  3F3X A;  2PJP A;  2ECC A;  3GVA A;  3HKZ N;  2Y48 A;  1R1V A;  1Y8R B;  1RET A;  1TWC J;  1R58 A;  4L9N A;  5H2F C;  3L1P A;  4LJZ F;  2Y0S A;  3BC8 A;  3H5A A;  4KN7 X;  1WJC A;  1GVD A;  1CQT A;  1XGS A;  2CS3 A;  3L2V A;  2LKS A;  1NK3 P;  3KCC A;  1LDD A;  3QOP A;  3OS1 A;  1LQ1 A;  1O7F A;  3LSG A;  2WAE A;  4EM1 A;  1H9G A;  4YFK F;  3PIO F;  1OLT A;  1YFH A;  1AKH A;  2E5N A;  1J5Y A;  1G3S A;  2DTZ A;  1J75 A;  3GUD A;  5A2Q K;  4QSH A;  2QA4 I;  4AIJ A;  2MD5 A;  2FD5 A;  5A2Q Z;  3WHB A;  1G59 A;  3DBL B;  3T8T A;  1KQ9 A;  2VPR A;  5DV5 A;  3PFY A;  2JRT A;  4Y33 A;  3RKX A;  3RPQ A;  4RB2 C;  1O3T A;  1OMI A;  2V4J C;  1XTA A;  2LKX A;  1WJ5 A;  2Z5U A;  1I5Z A;  3ZCO A;  3G6E I;  3CMY A;  5KK1 A;  2HGC A;  2HTS A;  2IT0 A;  2LD5 A;  4D5C A;  1Z67 A;  4BNC A;  3HBL A;  1V5G A;  2ZO4 A;  2O5R A;  5LEK A;  4XRM A;  3S2D J;  3MZH A;  2F48 A;  2E1C A;  2J5P A;  4A3C J;  4HQM A;  5JHF A;  3EET A;  2DYR H;  4UVA A;  1SAX A;  1BOA A;  3GTG J;  2VI6 A;  2L9R A;  2FXA A;  5J1Y A;  2ETH A;  2DMQ A;  4RAY A;  4JOM A;  4DOZ A;  2VBY A;  5D5U B;  2IA2 A;  2E35 A;  2R7O A;  4XBF A;  3FXJ A;  3OYH A;  1IV6 A;  4EGZ A;  2OTJ I;  1S7O A;  4KNY A;  2ELH A;  3K6G A;  1Z3Y A;  3QPL A;  2DJI A;  3T5X A;  2XGE A;  1F43 A;  1RNL A;  3BG5 A;  3GZ5 A;  1Z1D A;  2GOM A;  1MZB A;  3ZPL A;  4IHT A;  4MHG A;  1BC8 C;  3T1B A;  2QSG X;  3FX3 A;  5E1Z B;  1NHA A;  5EG0 B;  2XB5 A;  5E3M A;  3RPU D;  1WFX A;  1YO5 C;  1IAW A;  2YSR A;  2MBF A;  2H8W A;  1NK2 P;  3DEE A;  2EFQ A;  3HGY A;  4UB8 C;  3IRQ A;  1JJ8 C;  3BZC A;  2QKM B;  4A69 C;  4DZP A;  1J7K A;  3R0J A;  3SZP A;  3E97 A;  3IP4 B;  3OWT A;  5DUI A;  4CCN A;  3F21 A;  5H20 A;  3IRR A;  4MQ9 F;  2KZV A;  3IWZ A;  2ESN A;  1Z6T A;  3QU6 A;  3LWF A;  2YX7 A;  1O3Q A;  2IS2 A;  5BQT A;  1IDY A;  4A0X A;  4FE7 A;  4C2M J;  2CO5 A;  4XQF A;  3B73 A;  3L2R A;  2VT2 A;  2VN2 A;  4XOR A;  1MBE A;  3CCE I;  1H0M A;  4CYC A;  2QSH X;  1ZHF A;  4IOC F;  3OR1 C;  2XAJ A;  2HXI A;  4G12 A;  4XK4 A;  5EG0 A;  1A31 A;  5HLI A;  4DYR A;  1VQ8 I;  4OIP F;  2IEK A;  3W3C A;  1YIO A;  1KON A;  4CCM A;  4RAF A;  1HKS A;  2GIZ A;  2M9H A;  1MD0 A;  2IXS A;  1WCM J;  3V42 A;  3A52 A;  1BIA A;  1GV5 A;  3LSP A;  1E2X A;  4XSZ F;  5LHH A;  1G8X A;  3CDI A;  3R60 A;  4MFD A;  4F52 A;  2R5Y B;  2RQQ A;  3BG3 A;  3DPT A;  2WAQ A;  3ROU A;  2NNN A;  4EJT A;  4JK1 X;  3K4J A;  2F4O B;  1V4R A;  4IHS A;  2FSW A;  3JRA A;  1DGR M;  1Z21 A;  4FX0 A;  4RM2 A;  2R7T A;  2F5F A;  1YRN B;  2P8T A;  3F8M A;  1A6Q A;  1X2N A;  2WTE A;  4ESB A;  5LLQ A;  1JKP C;  1U6G A;  1YYV A;  3ZMU A;  3ZQ7 A;  1TQI A;  2CWE A;  4NB5 A;  3AAF A;  2ZFW A;  1BW5 A;  3CES A;  2H09 A;  3D1N I;  2YU9 J;  2G9W A;  3WE3 A;  1JKQ C;  2EB7 A;  4E7I A;  2O8K A;  1K61 A;  3VOD A;  2DQL A;  2HTJ A;  4II3 A;  2H94 A;  3OV8 A;  4IEJ A;  3U21 A;  3FWE A;  5FKO A;  3BJ6 A;  2IA0 A;  4U0Y A;  4QLC U;  2M0M A;  2FML A;  4YIF A;  4CYC B;  4B48 A;  1YW7 A;  1MNE A;  1VQ7 I;  4HF1 A;  4CGZ A;  4IO9 F;  2VUM J;  2FF4 A;  2K40 A;  1D0Y A;  2X48 A;  2L3D A;  4IHV A;  3E3V A;  2VQC A;  2DJN A;  1VQM I;  2E71 A;  1Z7U A;  3KP5 A;  1EH7 A;  1XSD A;  1Y1V J;  3OYI A;  4DYC A;  5D4S A;  2ELJ A;  3WTY C;  2VOO A;  1DPU A;  3GFM A;  3FXL A;  5C4X J;  1T33 A;  4F3Q A;  1WRJ A;  3I4P A;  2W24 A;  4P9F A;  2ID6 A;  2UXN A;  2IJL A;  1XCV A;  2L7Z A;  2UZK A;  2RNG A;  2HQ5 A;  3KX2 A;  1TWF J;  3J7Z I;  3ML6 A;  3JW4 A;  4AVZ A;  4AVP A;  1U78 A;  3LST A;  4OIR F;  2JT1 A;  4HLY A;  3GCM A;  1J0R A;  2G7U A;  3AG4 H;  1PUE E;  4HV5 A;  3WGG A;  4QPQ A;  2KJB A;  2PJR B;  4P9U A;  1O57 A;  2OTL I;  2ISZ A;  1H88 C;  5E20 A;  3MFK A;  2DQR A;  3MMY B;  2DOA A;  4XKC A;  2UV1 A;  5HLG A;  1K4S A;  4LD5 A;  3GZ6 A;  1MMA A;  2DMU A;  4B4C A;  2BEO A;  2EIL H;  3PO2 J;  1X58 A;  4RB1 A;  1T39 A;  1D5V A;  5AON A;  4GYI A;  2NVU B;  4OMY A;  3DPL C;  5GTI C;  1PYV A;  3IV5 A;  2HZD A;  3V8L A;  2DMP A;  5F1R A;  4N0B A;  2X6O A;  1QO0 D;  2ACJ A;  1RZ4 A;  3SYT A;  2M4K A;  3UNG C;  1XG1 A;  5ILV A;  3H3V K;  5TJJ A;  4C30 A;  1CF7 B;  2FOW A;  2H1K A;  1S29 A;  1K78 A;  4AYB N;  2MVT A;  1YRN A;  1TW2 A;  3IH4 A;  1IXC A;  1NH3 A;  4ZTF A;  3ZN0 A;  3GEZ A;  5BPD A;  3GTQ J;  3MN2 A;  3BZK A;  5IPA A;  1GV2 A;  3Q9V A;  3BCB A;  3GW2 A;  4XN0 A;  1BW6 A;  4PGG A;  5K5Q A;  3DWL E;  1X3U A;  1Y1W J;  2X1D A;  2M34 A;  3ABM H;  1SFE A;  4WK8 F;  2JSC A;  1FP1 D;  5F0H A;  2LBF A;  1SD5 A;  1WI9 A;  2X0L A;  4N9I A;  3BTJ A;  3BR5 A;  4NUB A;  4A3I J;  2R7U A;  2DFF A;  3MAJ A;  3K4M A;  2Q2E B;  5J47 A;  1B72 A;  1IUY A;  4FQG A;  3IKV A;  1RIO H;  4G6D A;  3OYB A;  2LK2 A;  1KQ0 A;  3Q3S A;  1YTY A;  2LLK A;  4I76 A;  4FET A;  2R7Z J;  3OY9 A;  5ILU A;  5JVT A;  1L3L A;  4I99 C;  2QZ8 A;  1BA5 A;  2YX4 A;  2V6E A;  2RQP A;  5CLS A;  3V8J A;  2R7X A;  3JSO A;  4D5F A;  1FT9 A;  2JWT A;  1HLV A;  5JR3 A;  2XPV A;  3JRI A;  4I98 B;  1T38 A;  2NRA C;  4RMN A;  5ICF A;  2Q8K A;  4A3J J;  3ZMD A;  2HI3 A;  2M7B A;  2MC3 A;  3J80 R;  3JRF A;  2M8G X;  1A36 A;  1D1B A;  3U1K A;  5JHU A;  1ZLJ A;  1FP2 A;  2XAS A;  1BI1 A;  2E19 A;  2PJR A;  2OZ6 A;  3PSI A;  5DEQ A;  3H35 A;  4WF2 A;  1TTY A;  3I59 A;  4MTE A;  3M07 A;  1QU3 A;  4WCG A;  2FJ1 A;  1ETK A;  2X6Y A;  1MBK A;  4QPO A;  4BDY A;  4IRI A;  2ZNZ A;  4AWX B;  1HDP A;  3SDB A;  4CA0 A;  1D5Y A;  3IKT A;  1RKT A;  3CUQ B;  4CCJ A;  1SEU A;  4JYK A;  4IRG A;  4CCO A;  1MSF C;  4ZYG A;  2K85 A;  4Q47 A;  5FRM A;  3WE2 A;  2NOG A;  1ZR2 A;  3HOZ J;  2PI0 A;  2KJC A;  1QRY A;  5IYC J;  1VND A;  1IN6 A;  3OYL A;  2P5K A;  3JSP A;  4U0W A;  4IJA A;  4XL9 A;  5GTH C;  3J7A O;  5FKN A;  1TT0 A;  2K9M A;  3A01 B;  2P7C B;  3I4M J;  2QLZ A;  5JI6 A;  3VYR B;  3W6J B;  5L3C A;  2ZSH B;  2W1O A;  1WJB A;  3FBN B;  4RA2 A;  4Y3O A;  1X19 A;  4BJT A;  2GA2 A;  3M1C A;  3J7A W;  3IWF A;  3NQO A;  3L9F A;  2DN0 A;  1D0X A;  2IGM A;  2NAZ A;  1NTC A;  3ULQ B;  1R49 A;  2VQH A;  3V7C A;  1WVR A;  4J19 A;  2YS9 A;  4KIB A;  3WTT C;  4UY8 I;  4FX4 A;  2VBZ A;  3NEU A;  1I50 J;  4KIG A;  1UFM A;  2KIS A;  2NS7 A;  4L0Y B;  2BY2 A;  2LOO A;  2C6Y A;  1EH6 A;  1HSJ A;  1R5H A;  2GXA A;  1J2X A;  3W6K B;  4NC7 A;  3BTL A;  3K7A J;  5IP6 A;  2BOL A;  1BR1 A;  2LFB A;  3OS0 A;  2ISY A;  3A01 A;  3KEY A;  3OYG A;  1ENH A;  5D5V B;  3PNY A;  3I53 A;  2KKO A;  4BHP A;  1SMY F;  1APL C;  3DTI A;  4JP0 A;  3I59 B;  2E2J J;  2I10 A;  3F8N A;  2XIG A;  1QVU A;  3KLN A;  4PK4 A;  2BHZ A;  3O8H A;  3TMO A;  3H9Q A;  5J1R A;  1R36 A;  4MFE A;  1OQY A;  4A5M A;  2L4M A;  2A3S A;  2PMU A;  3F9K A;  2XAF A;  4XRF A;  3DKX A;  3SQN A;  2W7N A;  4Q48 A;  1W5C C;  4UB6 C;  1X4P A;  4A93 J;  1V5F A;  4ETS A;  2NVT J;  1OYY A;  3HUG A;  4M72 A;  4L5J A;  1AWC A;  2EIM H;  4M9Z A;  1J59 A;  2F5V A;  3S1Q J;  2M2E A;  2XKP A;  3W2A A;  4BEH B;  3FMR A;  2OC6 A;  1FNN A;  2P5V A;  2ZXJ A;  5KNL A;  2E2H J;  5J8F A;  3M8J A;  5DM6 F;  1X4O A;  1XGO A;  1BI3 A;  1MJB A;  2LH9 A;  1WJA A;  2E1M C;  2P7V B;  1XPX A;  5FFZ A;  1SVO A;  3DKW A;  2DT7 B;  4UXN A;  1WI3 A;  5IP9 J;  4Y52 J;  4E7L A;  1TQP A;  1YX3 A;  4X6A J;  2AHQ A;  4E6K G;  2R7V A;  5LRR A;  1GXP A;  1ZR4 A;  3A03 A;  4DIQ A;  1FJL A;  3ZMZ A;  1XSX A;  2O3F A;  2V26 A;  2ZB9 A;  3HUG B;  4Z6Y A;  4Q4Z F;  4NQW B;  4XIC A;  3OSG A;  4LOC A;  1HST A;  3L09 A;  3FXO A;  2EBI A;  1U8R A;  2HYJ A;  2DO7 A;  3C18 A;  4C9Y A;  4BH9 A;  2MZ4 A;  3ZQL A;  3TDU C;  3GBG A;  4O6J A;  1LKX A;  4UVC A;  1G3T A;  3U1D A;  5KAF C;  5ICG A;  4UNO A;  2X1C A;  2CJJ A;  3LFU A;  5BMZ A;  1UAA A;  1PVE A;  2WY7 Q;  3K0L A;  1ZGJ A;  1U5T B;  1SAU A;  1YE9 A;  2LR8 A;  2X6W A;  1HW5 A;  3IUO A;  2KRF A;  3FZV A;  3ZQQ A;  3BCA A;  2R5Z A;  2HS5 A;  5EDN A;  2QF7 A;  1OCT C;  3B6C A;  3ZMS A;  1E3P A;  4F55 A;  4WWC A;  3TP3 A;  2N8G A;  4AIH A;  2HVS A;  3CQZ J;  5FB2 A;  2KDZ A;  4BU2 A;  1X1C A;  2EZH A;  3LQR A;  3HL2 A;  2PEX A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 3LA3 A;  4YG2 F;  3DQV C;  3RI4 A;  2A07 F;  4WXH A;  1RI7 A;  2D45 A;  3DV8 A;  1K78 B;  3F23 A;  1K7A A;  3IL2 A;  2DTR A;  1TQM A;  3KP6 A;  3TO6 A;  1FWZ A;  3WTZ A;  4P55 A;  3QRF F;  1FC3 A;  3V4G A;  1RUO A;  3P9C A;  4KUM A;  4RS8 A;  5DD8 A;  1F9N A;  2GIV A;  5ED4 A;  5HDK A;  4A0Y A;  1I1S A;  2BGC A;  2WWY A;  3K2Z A;  2P6S A;  3GX4 X;  1UHM A;  1QZZ A;  2JPC A;  3GFI A;  3GWZ A;  4CYD A;  1UB9 A;  3WU0 A;  4HA8 A;  5IT3 A;  1KQ8 A;  2LDU A;  3F8C A;  1OR7 A;  2O03 A;  5L3D A;  4MGR A;  5JFR A;  2F5C A;  1R5G A;  5DCM A;  1ON1 A;  4I01 A;  3SFZ A;  2G7H A;  3R61 A;  1Z05 A;  2FEZ A;  4UVB A;  3B02 A;  1G3Y A;  1EV7 A;  2EA2 A;  1FZP B;  4NQW A;  4EGY A;  2V1D A;  2OZU A;  2Z3Y A;  2FA5 A;  3M7G A;  3H92 A;  2GXB A;  5DDG A;  3N97 A;  4KMF A;  2ZCW A;  4FT8 A;  5FFX A;  4U7B A;  4GXO A;  5CVI A;  1K6O A;  1I6X A;  1V3F A;  3O6B B;  4HBL A;  3F6V A;  1LDJ A;  1HKT A;  2EFO A;  3WTU C;  4A6D A;  5L3G A;  2OAZ A;  1R1U A;  5EEG A;  2QQ9 A;  3H3U A;  5BOX A;  2V1U A;  4ZYH A;  2HQR A;  2RN7 A;  4ESF A;  2FBK A;  5DCM B;  3RKY A;  2XVC A;  3MQ0 A;  3FM5 A;  3HHG A;  3RTR A;  2HYG D;  1TNS A;  1JGS A;  1FYM A;  3VB2 A;  3KP7 A;  2DAO A;  3L7W A;  1FY7 A;  2K4J A;  2OA4 A;  4CIC A;  4G7Z F;  1I27 A;  3GXO A;  1QZY A;  4B8X A;  4ASN A;  4L9T A;  4EJO A;  4UV8 A;  2ZJ2 A;  4Y17 A;  3CTA A;  6PAX A;  4JBA A;  2WV0 A;  5LGT A;  3JTH A;  4MTD A;  4WXD A;  2Y0M A;  5CVV A;  3HOT A;  1MJ9 A;  3MCZ A;  2B0L A;  3L2C A;  1IN7 A;  1QNT A;  2VE8 A;  4N9H A;  5CYV A;  4G7H F;  2QBY B;  4CDG A;  3K1M A;  4A2U A;  4S04 A;  5E1X A;  3EUH A;  2MH9 A;  1MDM B;  3GYH X;  2E7W A;  2GA1 A;  1IN8 A;  1W5T A;  4RB0 A;  2DK8 A;  2XAH A;  4A0Z A;  2PG4 A;  1T98 A;  3K9T A;  4KIC A;  1ZG1 A;  3U9G A;  2OD5 A;  3WOD F;  4H0E A;  2MH2 A;  1LDK B;  2ZBK A;  3E5Q A;  1ZRE A;  1FSE A;  3REO A;  1REP C;  4I0B A;  3BDD A;  1O7L A;  2FE3 A;  4KN4 X;  3V7S A;  3IC7 A;  1T2K A;  2O61 A;  1KU2 A;  4HX8 A;  2L02 A;  5HLH A;  3WGH A;  1KGS A;  2DK5 A;  2PFB A;  2RV8 A;  2CG4 A;  4M9S A;  1SD4 A;  3WG9 A;  3BPX A;  1SD6 A;  2HZT A;  1TW3 A;  3CUQ C;  2XRN A;  3D5L A;  3BY6 A;  1LEB A;  4F7Z A;  4IF4 A;  1G3W A;  2V79 A;  2VXZ A;  2W25 A;  3C3W A;  2CW0 F;  4HOB A;  2Q2E A;  2EV6 A;  4DNC A;  5F64 A;  2UXX A;  3HRM A;  1TNT A;  4I02 A;  3PQJ A;  3L00 A;  4EM0 B;  5DCF A;  1UCR A;  1XB4 A;  2M45 A;  2QQA A;  1BJA A;  5TRD A;  2IPQ X;  4XLN F;  4DQ2 A;  1IRF A;  3KLO A;  1JE8 A;  2QYO A;  4ZZD A;  3F6O A;  5CVJ A;  1IN4 A;  1XMA A;  1D8K A;  2D1H A;  1KU7 A;  1XN7 A;  3COA C;  2M87 A;  2V1X A;  1JHF A;  4UUV A;  3BRO A;  4KYW A;  4I2O A;  3HRU A;  1A04 A;  2DW4 A;  2K02 A;  3BP8 A;  2NS0 A;  3R6S A;  2ZNY A;  3TGN A;  4MNU A;  2R3S A;  2FRH A;  2STT A;  4CZZ A;  2OBP A;  2YU3 A;  5HS7 A;  1FSH A;  2M8E A;  5IT9 Z;  1ZAO A;  3P9K A;  4ESJ A;  4P96 A;  1S7A A;  1ZGA A;  4XLP F;  2L4A A;  2K86 A;  1DDN A;  3HRT A;  5D8K B;  2R7D A;  1HW1 A;  2XGX A;  4YFN F;  2WC2 A;  2QEN A;  2CGP A;  5BS6 A;  2HQN A;  3EYY A;  3J81 Z;  5L3E A;  1ZAR A;  2DU9 A;  3MZY A;  2FOK A;  2FBH A;  3CO6 C;  4GGG A;  4OIO F;  2Z33 A;  2K7L A;  4OIN F;  4EJU A;  2GQQ A;  1U3E M;  2YPR A;  5ICE A;  4I0A A;  1FOK A;  3I54 A;  2P5L C;  4ZH4 F;  2HOE A;  3FXU A;  2EFP A;  3LAJ A;  1BI2 A;  2JPB A;  5DUK A;  2MLG A;  3J80 K;  4RB3 C;  4K2E A;  2Z9O A;  3WTX C;  1HKQ A;  1YQA A;  1P4A A;  4XSX F;  3CO7 C;  5D4R A;  4UV9 A;  3E5U A;  3VOE A;  1S3J A;  4CXF A;  4R8H A;  3J81 K;  1XCB A;  1MKM A;  3F72 A;  5K1Y A;  1FBQ A;  5J8C A;  2GXG A;  3KE2 A;  4Q5S F;  3K69 A;  3HSF A;  1ULY A;  3G3Z A;  1DPR A;  2QVO A;  3G73 A;  4HDU A;  1USS A;  4PCQ A;  4HAM A;  2CYY A;  4G6Q A;  3M8E A;  4NHJ A;  3WTS C;  3FXQ A;  2F5D A;  2L54 A;  5ICC A;  1S8N A;  4LB6 B;  2LNB A;  4OMZ A;  4UHT A;  1RUN A;  1B59 A;  2QWW A;  4BHB A;  2K27 A;  3M8F A;  2A6E F;  1IXR C;  2VBW A;  3F22 A;  1MDM A;  1IW7 F;  4HW0 A;  5LEJ A;  2HKX A;  5ERI A;  2M5W A;  3E6B A;  3DP7 A;  4HX7 A;  4LK1 F;  4EQQ A;  4ENK A;  4BAY A;  2F5E A;  2IVM A;  2JZY A;  2QUF A;  1DUX C;  2VC1 A;  1U2W A;  1XMK A;  1YS6 A;  2COM A;  2VE9 A;  1PP7 U;  4LGW A;  4RAZ A;  2CFX A;  2JTV A;  5AIQ A;  2VOP A;  4OOI A;  1B6A A;  1MGT A;  1BIB A;  1Y0U A;  3P9I A;  2P6T A;  2J5O A;  4D0P A;  2LSO A;  1QPM A;  2VC0 A;  1CF7 A;  1T0F A;  2YR2 A;  3ECO A;  3T0Y A;  3HIF A;  1KU9 A;  2KIU A;  4RGU A;  3K1N A;  3GLX A;  2H27 A;  2FQ3 A;  2GWR A;  4AIK A;  2ZKZ A;  3ZMT A;  2DPU A;  2O8X A;  1WKM A;  5HS9 A;  2FBI A;  4LLL A;  3RDI A;  5LHI A;  2HR3 A;  1F5T A;  5HDN A;  4G8X A;  5HDG A;  5BPI A;  5DD4 A;  4LB5 A;  5FLX Z;  3I58 A;  2RC4 A;  3KFW X;  4S05 A;  3EQL F;  1HBX G;  1S6L A;  4I09 A;  2NNY A;  5LGN A;  2EFW A;  5E17 F;  2GZW A;  5KVR A;  2BBY A;  3QU3 A;  2EV0 A;  1ZRC A;  2STW A;  3BZ6 A;  3LA7 A;  5LBQ A;  1L0O C;  3M1E A;  4HZF A;  3E6D A;  5FD5 A;  2R7F A;  3HHH A;  4O5V A;  5EEH A;  1R7J A;  1LVA A;  2W85 A;  2K4B A;  4TV7 A;  3CUO A;  1Z9C A;  2UWM A;  2QQB A;  4RGX A;  1STZ A;  4U7D A;  1XDU A;  4L18 B;  1YW8 A;  5J6X A;  3V8K A;  3HYI A;  1ZN2 A;  5AIP A;  3EDP A;  1O3S A;  2Q0O A;  3TOB A;  1BI0 A;  3O2P E;  2HKO A;  3CUQ A;  1FYK A;  4FHT A;  1ZLK A;  5H6R A;  2F2E A;  1B4A A;  1ZH5 A;  3J80 Z;  4QWQ A;  1KU3 A;  5D6E A;  1AOY A;  4IRH A;  4M74 A;  4WXC A;  5FD6 A;  3RPU A;  3BWG A;  3RYP A;  2VBX A;  5K5R A;  1MJA A;  2PBI A;  2ADU A;  2EFN A;  3TKY A;  1ONV A;  1ZRD A;  2A6H F;  1B1B A;  3MWM A;  2RVC A;  3BPV A;  3Q5F A;  5LHG A;  4AD9 A;  5LRS A;  4JQF A;  4IXA A;  5E8I A;  5FLX K;  3KP3 A;  5ILS A;  1GHC A;  4PDK A;  4Z2Y A;  1YLF A;  1P4W A;  1W7P D;  1ZG5 A;  2V9V A;  3TDZ C;  4ENJ A;  2IW5 A;  1BC7 C;  3GF2 A;  3LA2 A;  1W7P A;  2PLY A;  3I64 A;  2LKP A;  1IF1 A;  5E8G A;  3RJP A;  1BN5 A;  3E6M A;  3DEU A;  1BBY A;  4HX4 A;  3MEX A;  2A5Y B;  2FNA A;  1HW2 A;  1YG2 A;  2DLL A;  5K5O A;  1J9I A;  3E5X A;  3KZZ A;  3N4M A;  2OU2 A;  2NYX A;  1D8J A;  1TBX A;  2ZME B;  2RGV A;  2AXL A;  3KEQ A;  3I71 A;  4A5N A;  1LEA A;  3R0A A;  4B09 A;  2EV5 A;  2PN6 A;  1FBU A;  4LLN A;  3WU1 B;  3ZMV A;  4MQV A;  1IZ1 A;  4IVN A;  3D0S A;  4HDV A;  1DP7 P;  3TO7 A;  4L9J A;  1OKR A;  1R00 A;  4ON0 A;  1PP8 F;  1W4M A;  2DBB A;  4BHC A;  5HOO A;  2AS5 F;  2W57 A;  3CJN A;  5CVR A;  3PQK A;  2OQG A;  4M71 A;  1PDN C;  4U0V A;  4M6X A;  2HDC A;  2IRF G;  1YW9 A;  3KP4 A;  3WTV C;  4M73 A;  3C1D A;  1ZRF A;  1TLH B;  1W5S A;  2H6C A;  2EK5 A;  2O0Y A;  5CJ9 A;  3NRV A;  4ZYE A;  5D8L B;  3TO9 A;  3F8F A;  1G6N A;  2E7X A;  1ZG3 A;  4L5I A;  2VT3 A;  4YII A;  1JXS A;  3HSR A;  1FPQ A;  2DI3 A;  4A12 A;  2RKH A;  1I1G A;  4M6Y A;  5E18 F;  3LFK A;  4KMU X;  1IN5 A;  4HV6 A;  1JHH A;  3U2R A;  1FYL A;  1KYW A;  4Y15 A;  3FMQ A;  1LB2 A;  2DT5 A;  2QM3 A;  4BQA A;  4LG0 B;  3VEP A;  1ODD A;  1ZYR F;  4I7H A;  3EYI A;  5IT9 K;  3QP6 A;  2PQ8 A;  1BM9 A;  1EH8 A;  4R79 A;  2HWV A;  3E6C C;  3M9A A;  1IRG A;  1WWX A;  1GVJ A;  3KET A;  3ECH A;  1G4D A;  1KA8 A;  4MEX F;  2IA1 A;  1P6R A;  4IPA A;  3S2W A;  2A61 A;  2HEO A;  1Q1H A;  2DFI A;  1H9T A;  5CVU A;  4L0Z B;  2CQK A;  4A6E A;  5DYM A;  1QBJ A;  3ELK A;  4P5O A;  1U5T C;  3TQN A;  2V6C A;  2XKO A;  4CO8 A;  4LG0 A;  2BE5 F;  2D1V A;  1ON2 A;  3OOP A;  2BYV E;  2MLK A;  1XGN A;  3P7N A;  2Y75 A;  5F6F A;  5HVQ C;  4BXU A;  4MEY F;  4OIQ F;  2ESH A;  3QP5 A;  1HXD A;  2M1B A;  4EV0 A;  3BJA A;  4EJW A;  1UST A;  2VOD A;  4GCV A;  3V7R A;  1W7P B;  3QPT A;  5D5X B;  2E1N A;  3FF5 A;  2Z99 A;  4RGS A;  2MA3 A;  1T6S A;  3FM3 A;  4KA4 A;  2A69 F;  1KYZ A;  2EJR A;  5FGM A;  1WQ2 A;  5LGU A;  2L01 A;  2RNJ A;  3ABT A;  1R23 A;  3LQQ A;  4HF0 A;  3ABU A;  4O3M A;  3SXY A;  3FHZ A;  3ERE D;  2HYF A;  5L3F A;  1SFX A;  3RKW A;  3TOA A;  4E70 A;  2KIM A;  2XV4 S;  5HS8 A;  2O6G E;  4LK0 F;  1XGM A;  2XHK A;  2GAU A;  2FU4 A;  4G94 A;  3K1P A;  3VFZ A;  3R4K A;  4HF2 A;  1R22 A;  2XUB A;  2LF8 A;  1B9M A;  4KFC A;  3T8R A;  4OU0 A;  3IHU A;  1QQI A;  4ENM A;  4G9Y A;  3ZN1 A;  1R1T A;  1OYW A;  3WTW C;  3WGI A;  1GXQ A;  4KT5 C;  5D5W B;  2A68 F;  1O3R A;  1OYI A;  5E1W A;  4GO1 A;  1Z6R A;  2RDP A;  4BYY A;  1OPC A;  2LF7 A;  3RIR A;  3SHF A;  4EJV A;  2BV6 A;  3GFL A;  3DFG A;  1SMT A;  3O3K A;  3FMS A;  3CLO A;  1C0W A;  1XD7 A;  5FO5 A;  4ZZL A;  5D6F A;  3HTU A;  1B9N A;  3PFI A;  3GO5 A;  3JAM Z;  3HOS A;  2HFH A;  4YFX F;  4PGH A;  1SFU A;  3KZY A;  2EA4 A;  2DPD A;  2X4H A;  1K79 A;  4LFU A;  4HLX A;  3HTS B;  4PZJ A;  1LNW A;  5L3B A;  2IP2 A;  2W84 A;  3GFJ A;  3Q9S A;  3I5U A;  3ZP5 A;  1YS7 A;  3KEO A;  4LMY A;  1XSV A;  4R1H A;  1FBS A;  3HSE A;  2H6B A;  1P4X A;  1LJ9 A;  1D3Y A;  1Z91 A;  3DXJ F;  1P92 A;  3DF8 A;  3BJO A;  3SZT A;  1UHW A;  3BOQ A;  5H6Q A;  2PMH A;  4L9V A;  2KIF A;  2EWN A;  2CSO A;  3JAM K;  4HQE A;  3JTG A;  2FNP A;  4G7O F;  2M30 A;  1VTN C;  4U88 A;  3RYR A;  1CGP A;  2XRO A;  1XDS A;  1F4K A;  3C7J A;  2P4W A;  1E17 A;  4KIF A;  4WX9 A;  4KDP A;  4EMS A;  3LAP A;  4Y13 A;  4ZYD A;  2TDX A;  2XAG A;  3QAH A;  1IXS B;  3QPH A;  3HRS A;  1QGP A;  4CHU A;  4EVI A;  1SD7 A;  1FLI A;  4ENN A;  3ISP A;  1HQC A;  4M9X A;  1F1Z A;  1WSU A;  3FXR A;  3H3Z A;  2FMY A;  4GYG A;  2QBY A;  4HYE A;  3F8B A;  1FX7 A;  3KP2 A;  4LLG F;  2OQR A;  1P2F A;  4EM2 A;  3CDH A;  4RGR A;  2VON A;  2D2W A;  1U5T A;  3I0T A;  2ZME A;  2XAQ A;  3F3X A;  2PJP A;  3GVA A;  2Y48 A;  1R1V A;  1R58 A;  4L9N A;  4LJZ F;  4KN7 X;  1XGS A;  3KCC A;  1LDD A;  3QOP A;  1LQ1 A;  1O7F A;  4EM1 A;  1H9G A;  4YFK F;  1YFH A;  1J5Y A;  1G3S A;  1J75 A;  4AIJ A;  3GUD A;  5A2Q K;  2MD5 A;  5A2Q Z;  3T8T A;  1KQ9 A;  5DV5 A;  2JRT A;  3RKX A;  3RPQ A;  4RB2 C;  1O3T A;  1OMI A;  2Z5U A;  1I5Z A;  5KK1 A;  2HGC A;  2HTS A;  2IT0 A;  4BNC A;  2ZO4 A;  5LEK A;  3MZH A;  2E1C A;  2J5P A;  4HQM A;  3EET A;  4UVA A;  1SAX A;  1BOA A;  2FXA A;  2ETH A;  4RAY A;  2VBY A;  5D5U B;  2IA2 A;  4XBF A;  4EGZ A;  1S7O A;  4KNY A;  2ELH A;  3T5X A;  1RNL A;  3GZ5 A;  1Z1D A;  1MZB A;  3ZPL A;  4IHT A;  4MHG A;  1BC8 C;  3T1B A;  3FX3 A;  5E1Z B;  1NHA A;  1YO5 C;  1IAW A;  2YSR A;  2MBF A;  2EFQ A;  3IRQ A;  1J7K A;  3R0J A;  3SZP A;  3E97 A;  5DUI A;  3F21 A;  5H20 A;  3IRR A;  4MQ9 F;  3IWZ A;  2ESN A;  1Z6T A;  3QU6 A;  3LWF A;  2YX7 A;  1O3Q A;  5BQT A;  4A0X A;  2CO5 A;  3B73 A;  2VT2 A;  2VN2 A;  1H0M A;  1ZHF A;  2XAJ A;  5HLI A;  4OIP F;  1YIO A;  1HKS A;  1MD0 A;  1BIA A;  1E2X A;  4XSZ F;  5LHH A;  3R60 A;  3DPT A;  3ROU A;  2NNN A;  4EJT A;  4JK1 X;  1V4R A;  4IHS A;  2FSW A;  4FX0 A;  2F5F A;  2P8T A;  3F8M A;  2WTE A;  4ESB A;  5LLQ A;  1U6G A;  1YYV A;  3ZMU A;  3ZQ7 A;  1TQI A;  2CWE A;  4NB5 A;  3AAF A;  2ZFW A;  2H09 A;  2G9W A;  3WE3 A;  2EB7 A;  3VOD A;  2DQL A;  2HTJ A;  2H94 A;  3OV8 A;  3FWE A;  3BJ6 A;  2IA0 A;  4U0Y A;  4QLC U;  2FML A;  4YIF A;  1YW7 A;  4HF1 A;  4CGZ A;  2FF4 A;  2L3D A;  3E3V A;  1Z7U A;  3KP5 A;  1EH7 A;  1XSD A;  5D4S A;  3WTY C;  2VOO A;  1DPU A;  3GFM A;  1WRJ A;  3I4P A;  2W24 A;  4P9F A;  2UXN A;  2IJL A;  1XCV A;  2UZK A;  3ML6 A;  3JW4 A;  4AVP A;  1U78 A;  3LST A;  4OIR F;  2JT1 A;  4HLY A;  1J0R A;  2G7U A;  1PUE E;  4HV5 A;  3WGG A;  2KJB A;  4P9U A;  1O57 A;  2ISZ A;  5E20 A;  3MFK A;  2DQR A;  5HLG A;  4LD5 A;  3GZ6 A;  2BEO A;  4RB1 A;  1T39 A;  1D5V A;  5AON A;  4GYI A;  4OMY A;  3DPL C;  3V8L A;  5F1R A;  4N0B A;  2ACJ A;  1QO0 D;  1RZ4 A;  5ILV A;  5TJJ A;  1CF7 B;  1S29 A;  1K78 A;  1TW2 A;  1IXC A;  3ZN0 A;  3GEZ A;  5BPD A;  3Q9V A;  3GW2 A;  4PGG A;  5K5Q A;  1X3U A;  1SFE A;  4WK8 F;  2JSC A;  1FP1 D;  1SD5 A;  1WI9 A;  2X0L A;  4N9I A;  3MAJ A;  1IUY A;  3IKV A;  1RIO H;  4G6D A;  1KQ0 A;  1YTY A;  5ILU A;  5JVT A;  1L3L A;  2QZ8 A;  2YX4 A;  2RQP A;  5CLS A;  3V8J A;  3JSO A;  1FT9 A;  5JR3 A;  4I98 B;  1T38 A;  2NRA C;  5ICF A;  2Q8K A;  3ZMD A;  2MC3 A;  5JHU A;  1ZLJ A;  1FP2 A;  2XAS A;  1BI1 A;  2OZ6 A;  5DEQ A;  4WF2 A;  1TTY A;  3I59 A;  4MTE A;  4WCG A;  4IRI A;  2ZNZ A;  4AWX B;  3IKT A;  3CUQ B;  4IRG A;  4ZYG A;  4Q47 A;  3WE2 A;  2PI0 A;  2KJC A;  1IN6 A;  2P5K A;  3JSP A;  4U0W A;  4IJA A;  3J7A O;  2P7C B;  2QLZ A;  5JI6 A;  3W6J B;  5L3C A;  2GA2 A;  3IWF A;  3NQO A;  3L9F A;  2NAZ A;  3ULQ B;  3V7C A;  4KIB A;  3WTT C;  4FX4 A;  2VBZ A;  3NEU A;  4KIG A;  1UFM A;  4L0Y B;  2C6Y A;  1EH6 A;  1HSJ A;  1R5H A;  1J2X A;  3W6K B;  2ISY A;  5D5V B;  3I53 A;  2KKO A;  4BHP A;  1SMY F;  3I59 B;  3F8N A;  2XIG A;  3KLN A;  1R36 A;  4A5M A;  2L4M A;  2A3S A;  2PMU A;  2XAF A;  4XRF A;  3SQN A;  4Q48 A;  4ETS A;  1OYY A;  3HUG A;  4M72 A;  4L5J A;  1AWC A;  4M9Z A;  1J59 A;  2XKP A;  3FMR A;  1FNN A;  2P5V A;  2ZXJ A;  5J8F A;  1XGO A;  1BI3 A;  1MJB A;  2P7V B;  5FFZ A;  3DKW A;  4UXN A;  1TQP A;  5LRR A;  1GXP A;  3ZMZ A;  1XSX A;  2O3F A;  4Q4Z F;  1HST A;  3L09 A;  1U8R A;  2DO7 A;  3C18 A;  4BH9 A;  3TDU C;  4O6J A;  4UVC A;  1G3T A;  3U1D A;  4UNO A;  5ICG A;  5BMZ A;  3K0L A;  1ZGJ A;  1U5T B;  1HW5 A;  2KRF A;  3FZV A;  2HS5 A;  3ZMS A;  4WWC A;  4AIH A;  5FB2 A;  3LQR A;  2PEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...