3R61A

Structure of the mntr co2+ complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
128
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 50
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3r61A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3r61A02
1Z9CA 5ICFA 5E17F 4PZJA 2O6GE 2Q8KA 1AWCA 3T8TA 2PQ8A 2A07F 4ESJA 4XRFA 3BJ6A 2ZXJA 2O8XA 4L9NA 3WGHA 1K79A 2X4HA 5BPIA 2XASA 4N0BA 1BIBA 3ISPA 2K27A 4BHPA 4HLXA 2DQRA 2DK8A 4KMFA 1R36A 4EQQA 3WTXC 3F3XA 5D6EA 2CYYA 2FA5A 2F5EA 2E7WA 3TDZC 1WI9A 2ZJ2A 1E17A 3F23A 1KU3A 4PGGA 4HQEA 1G3SA 5A2QK 3M9AA 4F7ZA 4EM2A 4UVCA 5JI6A 4I09A 4HLYA 2IRFG 2ISYA 2QBYB 4P96A 5CLSA 5FD6A 4YFXF 2XRNA 5HLGA 2UZKA 2LNBA 5HOOA 1IF1A 4XBFA 1ZRCA 3F8NA 2DBBA 1FWZA 2Y75A 4TV7A 3M8FA 1ZHFA 2DTRA 2EWNA 2YX4A 1HW1A 4RGRA 3GW2A 2M8EA 3IRQA 1WQ2A 4Q4ZF 4EGZA 2FMLA 1Z91A 3LQQA 2IW5A 1MD0A 2RQPA 2FU4A 2PBIA 3WTZA 1DUXC 4CDGA 2W25A 2IA1A 2ESHA 1U5TA 2Z99A 4OMZA 1ZREA 4CGZA 2FOKA 2LF7A 2XIGA 2RDPA 2V1UA 3BROA 1FYLA 3TGNA 2CQKA 1KQ9A 2ADUA 5E1WA 5D4SA 1SFXA 4ESBA 4WK8F 1WWXA 3CDHA 5DD4A 1SD6A 2VT2A 2YR2A 2HZTA 4GCVA 2XAHA 4G7ZF 3K69A 1FP2A 1WSUA 1IXSB 1OYYA 2WV0A 3L7WA 2C6YA 4OIQF 1W5SA 3RPQA 4M6XA 5D6FA 2E1NA 3R4KA 3M1EA 4ASNA 4LLGF 2DLLA 2EFWA 2Z9OA 2Z5UA 1JE8A 4I02A 2P5LC 3BOQA 1XN7A 2HEOA 3MWMA 4HBLA 3J81Z 4KIFA 2PG4A 5D5XB 2MLKA 2DU9A 1DPUA 2AS5F 2CG4A 2GXGA 4NQWA 3V8JA 4A0YA 4KYWA 4HDUA 1BI0A 4L5IA 1GXQA 4H0EA 3RIRA 2A5YB 2RC4A 4RAYA 2EFNA 3LQRA 2NS0A 3QP6A 3KLOA 3REOA 3KZYA 3K2ZA 4RS8A 4OINF 5D5UB 2V6CA 3L09A 3T5XA 1T98A 2MH9A 2UXXA 4EJVA 4QLCU 1ZGJA 1XCBA 3H3ZA 3JAMK 2EK5A 2RKHA 1SD4A 1K6OA 3SZPA 3J80Z 1LNWA 4ZYEA 3I0TA 3RJPA 4I01A 1R1TA 4OU0A 5FLXK 1BI1A 3T1BA 3R61A 2VONA 5L3EA 4ENNA 2EFQA 3E5XA 4EJWA 3FWEA 6PAXA 1GVJA 3FHZA 5K5QA 2V79A 3V8LA 1S8NA 5KK1A 1L3LA 2XAQA 1ON2A 3RTRA 2DO7A 1XMAA 3HUGA 2E7XA 2OZUA 1R00A 5FB2A 1QGPA 2H09A 1OKRA 4MTDA 4A5MA 1HSTA 3Q9VA 1T0FA 2Z33A 2A61A 3I58A 3FMSA 2HOEA 2HFHA 3S2WA 1LDKB 1XB4A 3C18A 4HAMA 2F5CA 4KN4X 1P2FA 1I6XA 2F5DA 1SFUA 4Y13A 3VOEA 1YG2A 3EYIA 2L01A 2O3FA 2FNPA 3ECOA 5LBQA 4GYGA 1IAWA 1Z7UA 4Y15A 2H27A 1BIAA 4FX4A 1I5ZA 5LHHA 1J5YA 4YIIA 3E6MA 5CVUA 4IRHA 5HLIA 5EEHA 1LB2A 3I59A 1B9NA 3ERED 5IT9K 3HHHA 1QZYA 1IW7F 1G3TA 3IKVA 4M73A 1ZG5A 1IXCA 3QPTA 1IN7A 2P7CB 2CFXA 3RPUA 3WODF 2YSRA 1DPRA 1PP8F 2V9VA 5JVTA 3CTAA 1V3FA 3CJNA 2GQQA 5ILVA 1ZLKA 4BAYA 1XDSA 5DUIA 4G94A 2GIVA 2HQRA 4LMYA 4A0XA 4U7BA 3MZHA 2PLYA 3I54A 2KJCA 3OV8A 3U9GA 1W7PB 1FNNA 2RGVA 1L0OC 3T0YA 1HW5A 1R7JA 1YTYA 2H6CA 4M71A 2DI3A 1JGSA 4U0YA 3WTSC 5JHUA 1RIOH 3U2RA 4WXCA 5A2QZ 3VEPA 4R79A 3EQLF 2QQBA 1XSVA 2YX7A 4O5VA 2EA2A 3O6BB 4HZFA 5BQTA 4XLPF 4A2UA 3BDDA 3BPVA 3KFWX 5JFRA 3WTUC 1SMTA 2DT5A 1G4DA 1IN5A 5F1RA 1TQPA 4HW0A 5CJ9A 1FYKA 1V4RA 3KP3A 2W24A 4JQFA 1IN8A 1C0WA 4CO8A 1LEBA 3FM5A 5AIPA 2R7DA 1D3YA 1MKMA 1REPC 5AONA 4AD9A 2LKPA 1TQIA 4IF4A 2PMHA 4UXNA 2WWYA 3HTSB 3ZMSA 1XMKA 1Z05A 3GFMA 1F1ZA 4XSXF 1FSHA 2JSCA 3F8MA 3TO9A 1IXRC 2Y48A 5CVVA 1STZA 2ELHA 1BC8C 4IXAA 1U3EM 2VBWA 2OBPA 2HGCA 3ULQB 1FOKA 3IKTA 3ZP5A 5BPDA 2MA3A 3M7GA 2JZYA 3ZMTA 5J6XA 1IRFA 3ZQ7A 1RUNA 4HF0A 2XKPA 5LRSA 3EETA 4U0WA 5DV5A 1J9IA 1JXSA 4UNOA 3QU6A 3GVAA 4AIJA 2CWEA 2K7LA 3FMQA 4WX9A 5D8KB 4IRIA 1YQAA 2QENA 1E2XA 3IC7A 2NYXA 2RN7A 3HIFA 3BP8A 3FM3A 1S6LA 2JT1A 4Q47A 5D5WB 2FSWA 3KEOA 5K5RA 4KFCA 4LB5A 1H9TA 2IT0A 4AIKA 1UB9A 5DEQA 1I27A 4I2OA 2W57A 3M8EA 2AXLA 4MEYF 1O3TA 2BE5F 1F4KA 3QU3A 4XSZF 3DF8A 3KP4A 1D8JA 2LF8A 3ZMZA 2A3SA 3MQ0A 1ZRFA 2VOOA 4OIRF 1B6AA 2L02A 4I7HA 1MDMA 1BJAA 2OD5A 4A12A 2A6HF 1AOYA 4AWXB 2L4MA 4KNYA 5F64A 4AIHA 3LFKA 4RB3C 4LLNA 4NHJA 1RNLA 2HYFA 5LGTA 3IRRA 3HRSA 1YFHA 1KQ8A 2GXBA 5J8FA 1NHAA 4LD5A 1EH6A 4I98B 2K86A 3V8KA 1OMIA 1WRJA 2RVCA 3FXUA 2W84A 4LJZF 1YW7A 4KICA 1USSA 2KIFA 1KU9A 4N9IA 5FLXZ 3GYHX 2IJLA 2XV4S 2XGXA 3BJAA 4EGYA 2J5OA 3EYYA 1Y0UA 1D8KA 4A5NA 3DKWA 3I53A 1P6RA 2FNAA 3F21A 2GAUA 3DPLC 1XD7A 1G3WA 1U2WA 2VBXA 3GFLA 3FXQA 1S7OA 3R6SA 3GXOA 1HQCA 2M5WA 2XKOA 1U5TC 3V4GA 1SD7A 4M9XA 1XDUA 4A6DA 2R7FA 3TQNA 2FXAA 3EUHA 3BPXA 3QP5A 3V7CA 4UVAA 1Z6TA 3C1DA 3K9TA 3HSRA 1U5TB 2Y0MA 4L9TA 3E3VA 2G9WA 1O57A 2P7VB 2HR3A 2QVOA 1ZG3A 2X0LA 1BI3A 3R0AA 3QRFF 4E70A 2LDUA 2BV6A 2CW0F 1TNTA 2O61A 2IA0A 3QOPA 4PCQA 4P9UA 2KJBA 3BJOA 1MJAA 4HF1A 5ICCA 1O7LA 2K4JA 2VBYA 2VE9A 1BC7C 1RI7A 3KLNA 3ELKA 2J5PA 1T39A 2FEZA 4PGHA 2P4WA 4P55A 2XROA 1FBUA 4LG0A 1G6NA 3JW4A 3WTYC 2CGPA 5K1YA 3RKYA 1W7PD 3P9KA 3W6JB 3DFGA 3TOAA 1UCRA 3WTWC 3CUQA 1BBYA 3MCZA 1B59A 2EA4A 2WTEA 5ICEA 3K1PA 3WU0A 4EM0B 2XVCA 1OR7A 1Q1HA 4R8HA 5D8LB 1WKMA 3CUQC 2ZO4A 3F6OA 3E6BA 5TRDA 1R22A 4ZZDA 1TNSA 4KUMA 1P4WA 2D2WA 1KU2A 4L0ZB 4ESFA 2L3DA 3MZYA 2KKOA 1H0MA 1XGSA 3BY6A 3G3ZA 5E20A 5E1ZB 1KQ0A 5HDKA 1OYIA 5E8GA 4GO1A 5E8IA 2VT3A 2FRHA 3DQVC 2QQ9A 4RGXA 2DK5A 1ONVA 1PP7U 3D5LA 3C7JA 1ZGAA 2P5KA 2EFOA 1KYZA 4A0ZA 4BXUA 3DV8A 4HV5A 2DW4A 2MBFA 2MH2A 1SD5A 2HQNA 2VBZA 4U88A 1DP7P 4NB5A 2EV6A 2H6BA 3I71A 5ICGA 2PJPA 1YS7A 4M6YA 1FSEA 4B09A 5L3CA 1YW8A 4G8XA 2IA2A 4WXDA 3WGGA 4ZYDA 2GZWA 2EV5A 1Z6RA 1CF7A 5L3BA 1SAXA 3ECHA 2YPRA 1J2XA 5DCMA 4BHBA 4UV9A 3ZMDA 2XHKA 4UHTA 3KEQA 3IL2A 3TKYA 1TW2A 1J75A 2ZMEA 4OIOF 3J81K 1B4AA 3KP6A 1P92A 5KVRA 4Q48A 2QUFA 3FZVA 2ZBKA 4RB1A 3SFZA 2STTA 4MHGA 1MJBA 4OOIA 1BN5A 4GYIA 1ZLJA 2OQGA 3E5QA 4L9JA 1VTNC 2DPDA 3WGIA 4U0VA 3Q9SA 5BOXA 4LK1F 1EH8A 1ZRDA 4HF2A 1GHCA 2VC0A 2B0LA 1I1GA 5DCMB 3K1MA 2LSOA 1FYMA 5CVIA 1TBXA 1OYWA 4Z2YA 3ZN1A 2V1DA 2FQ3A 3LAPA 3GF2A 2M30A 4JK1X 3I59B 2BEOA 1O7FA 3DEUA 2ZCWA 5IT3A 4O6JA 3FMRA 3O2PE 4KN7X 2RV8A 3TO7A 5BMZA 3N97A 2OA4A 2KIUA 3J80K 1KYWA 3ZPLA 3B73A 1XCVA 4BH9A 1IZ1A 1K78A 4K2EA 3HYIA 2G7UA 4D0PA 3E6CC 1YLFA 4P9FA 4EMSA 3D0SA 2P6SA 4ZYGA 3DPTA 1O3SA 2PI0A 2XAGA 3CO6C 1BI2A 1KGSA 4MGRA 4S04A 1BOAA 2ZFWA 3GWZA 5LGUA 2NRAC 4HYEA 3BWGA 5HDGA 3F8BA 3T8RA 1QQIA 3KP2A 5ED4A 4MTEA 3W6KB 4EM1A 5H6RA 5LHIA 2VOPA 1B9MA 3E5UA 1EH7A 3WTTC 1R5HA 3HOSA 2HDCA 1ON1A 4EJOA 4ENJA 1QZZA 4CXFA 2RNJA 3JSPA 3GZ5A 4HX4A 2BBYA 1FPQA 1O3RA 2IPQX 4ETSA 3NQOA 2M1BA 4EJUA 3FF5A 4RB2C 1USTA 3I5UA 1LJ9A 1ZN2A 3GX4X 1TLHB 1HSJA 3LA3A 4OMYA 5TJJA 2ETHA 3LSTA 4KIBA 5CYVA 3WTVC 2D45A 3F8CA 1U8RA 1XGMA 1IUYA 4L5JA 3IWZA 4G6DA 2VN2A 5DCFA 3J7AO 2NNYA 4CZZA 1GXPA 2WC2A 1EV7A 3P9CA 1FC3A 2FBIA 2HWVA 4LGWA 4L0YB 4ZYHA 3HTUA 2V1XA 3L9FA 2ZKZA 3RDIA 3P7NA 1S3JA 5DYMA 5JR3A 4G6QA 2K4BA 3N4MA 5CVJA 2PFBA 4HA8A 2OAZA 4IJAA 3GO5A 1J59A 3PQJA 1YW9A 3ROUA 2OZ6A 2VE8A 5HS9A 3V7SA 2VODA 2QBYA 4P5OA 4G7OF 4OIPF 4XLNF 2Z3YA 5FGMA 4BNCA 2FBHA 2CSOA 1IN6A 4WF2A 4G7HF 5DDGA 3MFKA 3PQKA 3FXRA 3JAMZ 3TOBA 3MEXA 3KP5A 3JTGA 3VFZA 2L54A 3G73A 4JBAA 3CLOA 3R60A 3SXYA 1MDMB 2QQAA 5LGNA 4UV8A 4BQAA 4UUVA 5D4RA 1T38A 2GA1A 2O0YA 4MQ9F 3P9IA 1ZG1A 1J7KA 4R1HA 3GFIA 5FFXA 3COAC 2DFIA 3OOPA 1PDNC 1TW3A 3ABUA 1UHWA 3RKXA 1FBQA 3H92A 3TO6A 4YFNF 1YO5C 2F5FA 2G7HA 3GEZA 4IHSA 1SFEA 1R1UA 4LLLA 2ESNA 3F72A 2NNNA 5ILSA 4CHUA 3NRVA 4KMUX 4HX8A 4M9SA 4RB0A 3SQNA 2MC3A 3TDUC 1KU7A 2P5VA 5L3DA 4EJTA 2PMUA 2D1VA 4FX0A 4WCGA 2E1CA 1IN4A 4I0AA 2EV0A 5LLQA 4LK0F 2YU3A 5ILUA 1YYVA 1RZ4A 5ERIA 3HRUA 4CYDA 1YS6A 1HXDA 1HW2A 5HVQC 2JPBA 3VB2A 4B8XA 2HYGD 1MJ9A 4RGSA 1FT9A 4PDKA 4LB6B 4A6EA 1ODDA 3WE3A 1ZH5A 3JSOA 4QWQA 1HKTA 5D5VB 1UHMA 4U7DA 5E1XA 4YIFA 5LRRA 1FZPB 3AAFA 4WXHA 1HBXG 3F6VA 2HTJA 4AVPA 3HRMA 1HKSA 1LDDA 5IT9Z 2H94A 2MLGA 1A04A 1QNTA 2O03A 3WG9A 2JTVA 2XUBA 2QZ8A 4EVIA 5HS7A 5LHGA 4MEXF 3RYPA 1T2KA 1FP1D 3DXJF 1R5GA 3ZN0A 1QO0D 3RI4A 5HLHA 1P4AA 2DQLA 2PN6A 3K0LA 1CGPA 4BHCA 4EV0A 5FO5A 5HS8A 3R0JA 4ENKA 1W4MA 3EDPA 5FFZA 2OU2A 1W5TA 3KETA 5FD5A 4KA4A 4LG0B 3LA2A 1B1BA 4HV6A 1FBSA 3BZ6A 3GZ6A 5L3GA 4WWCA 3CUQB 1XGNA 1PUEE 1HKQA 1U6GA 1P4XA 2VC1A 4FHTA 3CUOA 2FMYA 1R58A 2P8TA 1QBJA 4MQVA 3SZTA 3HHGA 5H20A 2QWWA 3HSEA 4UVBA 3I64A 3FX3A 2Q2EA 3RKWA 2XAFA 3V7RA 2FF4A 1G3YA 1J0RA 1XGOA 2IVMA 4MNUA 2JPCA 2TDXA 5DD8A 3GUDA 4ZH4F 4S05A 3K1NA 5HDNA 2KRFA 2BYVE 1KA8A 5DUKA 2HTSA 5LEKA 5EEGA 4IRGA 2HKXA 5CVRA 4RGUA 2EB7A 1JHHA 3ABTA 5E18F 3F8FA 3WE2A 5K5OA 1ULYA 2A6EF 4G9YA 1ZARA 2PEXA 2QLZA 3O3KA 4KIGA 4ENMA 5J8CA 4GGGA 3HSFA 3LA7A 2EFPA 3E6DA 1MZBA 1ZAOA 1LDJA 3LAJA 3H3UA 4I0BA 3QPHA 1O3QA 2QM3A 3HOTA 2STWA 4YG2F 1CF7B 2D1HA 3JTHA 2ZNZA 5H6QA 4Q5SF 1LQ1A 2XAJA 3F22A 4KDPA 1W7PA 2A68F 2F2EA 1F9NA 1R1VA 2DPUA 5L3FA 4BYYA 3PFIA 2ZMEB 4ON0A 4M72A 2COMA 3ZMVA 1S7AA 4LFUA 3NEUA 1QPMA 2A69F 4N9HA 3WU1B 4FT8A 4IVNA 2BGCA 1LVAA 4L9VA 1XSXA 2OQRA 1FX7A 1BM9A 1JHFA 4RAZA 1UFMA 2HKOA 4Y17A 1K7AA 2R3SA 3ZMUA 2GWRA 2VXZA 1TQMA 3L00A 1OPCA 2GA2A 1YIOA 3KCCA 3RYRA 3LWFA 1SMYF 4ZZLA 3L2CA 3QAHA 5BS6A 3IHUA 4CICA 4KT5C 2W85A 3I4PA 5AIQA 2Q0OA 3GLXA 4GXOA 3B02A 3KZZA 1IRGA 2IP2A 4IPAA 1FY7A 4M9ZA 4IHTA 1TTYA 4M74A 3KE2A 2ZNYA 4DQ2A 2QYOA 4YFKF 3HRTA 1K78B 2ACJA 2L4AA 1I1SA 1H9GA 3VODA 2FE3A 1F5TA 4HOBA 2UWMA 1ZYRF 4DNCA 1RUOA 3DP7A 2K02A 3E97A 5LEJA 2NAZA 4HX7A 3C3WA 3KP7A 2DAOA 5F6FA 3Q5FA 3MAJA 3ML6A 4HQMA 2KIMA 1U78A 3CO7C 1DDNA 3U1DA 2ISZA 4O3MA 2HS5A 1MGTA 1R23A 2P6TA 3GFJA 2JRTA 2FBKA 2M45A 1XSDA 1LEAA 2EJRA 3SHFA 1T6SA 2MD5A 1FLIA 4L18B 4HDVA 2UXNA 3IWFA 1S29A 2CO5A 1D5VA 2M87A 1X3UA 1Z1DA
chains in the Genus database with same CATH superfamily
1Z9CA 5ICFA 4PJNA 5E17F 1LFBA 4PZJA 1A35A 2O6GE 2Q8KA 4Z6YA 5HNHA 3W6VA 4IQJA 3OYLA 1AWCA 5EF6A 4CZCA 4ZC3A 2PQ8A 3K4NA 4UUTA 3T8TA 1VQNI 1V55H 4ESJA 2A07F 4XRFA 3BJ6A 2ZXJA 2O8XA 3H9GA 4L9NA 3WGHA 3I4MJ 1S9HA 2XAUA 1UJ8A 3D5RC 5H2FC 1K79A 2HVQA 2X4HA 5BPIA 4IEJA 2XASA 4DGWB 4N0BA 3JRBA 5FLXR 1FIPA 3W3CA 1BIBA 3ISPA 3JRGA 2JJ7A 1CQTA 4Y3OA 4I6ZA 2DFEA 2K27A 4BHPA 2MVTA 4HLXA 2XSDC 2CUZA 3HOXJ 2DQRA 2DTZA 2F4IA 4FCYA 2DK8A 4KMFA 1R36A 1XX5A 3GLLA 4EQQA 3WTXC 3F3XA 5D6EA 3CF2A 3RQIA 4XKVA 2EZHA 2CYYA 2FA5A 2PJRB 2F5EA 2P81A 4HNVA 3OYGA 2E7WA 4XOPA 1P9QC 3TDZC 3VYTB 1EF4A 2X85A 1D5YA 1WI9A 4B44A 1RESA 4J00A 2ZJ2A 4CYCA 1E17A 3BR3A 3NARA 3F23A 5GTIC 1KU3A 3CDLA 4HG2A 3G1OA 4PGGA 4HQEA 1G3SA 2M35A 2E34A 2GLOA 5A2QK 2GXAA 2L7KA 3KYCB 3M9AA 4F7ZA 2O5RA 4ITVA 4G6TB 4XKCA 4EM2A 3HPHA 4UVCA 2WBMA 2EZLA 3FK6A 5JI6A 4HNUA 3CMEI 4UY8I 2WV1A 4I09A 1UAAA 4HLYA 2IRFG 1OQYA 2GOMA 2ISYA 2QBYB 4P96A 1FMVA 5M3MJ 3MD2A 2HPIA 4FE7A 5CLSA 5FD6A 2K40A 1AKHA 4YFXF 2XRNA 5HLGA 3LNQA 2UZKA 2LNBA 4ABZA 5HOOA 1IF1A 3HPGA 3LSMA 4XBFA 1ZRCA 3F8NA 1VQ5I 1ZGWA 2DBBA 1K4TA 1SC7A 1FWZA 2CV1A 2Y75A 4TV7A 1R6RA 3M8FA 1YITI 1YJ9I 4XRMA 2DJIA 3DTEA 4BE2A 1ZHFA 2M4GA 2ZJRF 1N75A 3ZOBA 2DTRA 2EWNA 2YX4A 1HDPA 1HW1A 1X4OA 4RGRA 3GW2A 2MSYA 2M8EA 4CYCB 2JN6A 2ZB9A 1WQ2A 4Q4ZF 4M3DA 3IRQA 4EGZA 1TWFJ 3BCAA 2FMLA 1T33A 1Z91A 2IW5A 1MD0A 3LQQA 3AG3H 1Y0NA 2FQ4A 1IV6A 2RQPA 3L1PA 2HNHA 2Y31A 5HLTA 3IAS2 1XC5A 2FU4A 4F52A 1LE8B 2PBIA 3QYEA 3WTZA 1DUXC 3E0JB 4CDGA 2NOJB 2W25A 2IA1A 2ESHA 1U5TA 1ORKA 2LVSA 3CMAI 2QSGX 2Z99A 4OMZA 1ZREA 3K2AA 2COBA 5GAGJ 2IGMA 2FOKA 3DKYA 4CGZA 3E7LA 2LF7A 2XIGA 1YX5A 2RDPA 3FXJA 2V1UA 3BROA 2JA5J 1FYLA 3TGNA 2CQKA 3CJRB 1KQ9A 2ADUA 5E1WA 5D4SA 1DGRM 2ZXHA 1OLTA 1SFXA 3CCMI 3CC7I 1X3WB 4ESBA 4E7HA 1ZTRA 4WK8F 3IV5A 1WWXA 3CDHA 5DD4A 2EIJH 1JKOC 1SD6A 3FISA 2ECCA 2VT2A 2YR2A 4DBRA 1LFPA 2HZTA 1LPQA 4GCVA 2XAHA 2VJJA 3FKJA 4G7ZF 3K69A 1FP2A 4FE4A 1WSUA 1X2MA 1IXSB 2VJ5A 1OYYA 2WV0A 5E79C 3OYBA 3L7WA 2C6YA 4OIQF 1W5SA 3RPQA 1X3ZB 2EBIA 4M6XA 5FKLA 5D6FA 3KZIC 2E1NA 3CCUI 3BTJA 2LD5A 2HVSA 2OJED 3R4KA 1P7IA 4E7LA 3TMOA 3S15J 4HSRA 3M1EA 3H5RA 3MMYB 4ASNA 3S17J 4LLGF 2DLLA 2EFWA 2R4GA 2HOAA 4BBRJ 4AC0A 2Z9OA 3I9V2 2OV7A 2Z5UA 1JE8A 3OR2C 4I02A 9ANTA 2P5LC 3BOQA 4DIQA 3OYDA 1XN7A 2HEOA 3MWMA 4HBLA 3J81Z 2H8RA 3M4OJ 2R92J 4KIFA 1PVEA 2PG4A 3A0BC 5D5XB 2MLKA 2DU9A 1DPUA 2HDWA 3ESWB 4CH7A 3NWTA 2AS5F 5K7FA 3SJMA 5FLVA 2CG4A 2DA4A 2GXGA 4NQWA 3V8JA 4A0YA 4KYWA 4HDUA 4Y52J 1BR2A 4BY1J 4IQ4A 2E2IJ 4C3IJ 1JJ6C 1UHSA 1BI0A 1Z3XA 4IL6C 1YE9A 1G8XA 2XGEA 2MYSA 2X9DA 4L5IA 4XMYA 1GXQA 4H0EA 2NVXJ 2DA7A 3RIRA 4DYQA 2A5YB 4S0HB 1SFOJ 5IOZA 2RC4A 4RAYA 2EFNA 3LQRA 2F4OB 2NS0A 3KLOA 3QP6A 4Y7NJ 3REOA 3KZYA 3K2ZA 4RS8A 4OINF 5D5UB 2V6CA 3CQZJ 4V19K 4FTHA 4II2A 4HRIA 4B47A 3L09A 3T5XA 2CQQA 1T98A 2XGDA 2MH9A 2UXXA 4EJVA 3BTLA 1I50J 4QLCU 1ZGJA 3W2VA 3I56I 1XCBA 3H3ZA 1QU3A 1T56A 3JAMK 2EK5A 1HOMA 4F3QA 3MZ8A 2RKHA 1LFUP 1SD4A 1K6OA 4AUXA 2L5QA 3N05A 2VI6A 2ZXWH 3SZPA 3GTJJ 3J80Z 1LNWA 1WJ5A 4QPQA 5J1UA 4ZYEA 3I0TA 3RJPA 4I01A 2MW8A 1WVRA 1R1TA 3LSGA 2CUFA 4OU0A 3FK7A 3OS2A 5FLXK 3FBNB 1BI1A 2DYSH 3T1BA 4C9YA 3R61A 2VONA 5L3EA 4ENNA 4ZDPA 4XK4A 5F0HA 5F0FA 3OWTA 1OCTC 2FJ1A 1K4SA 2EFQA 2DMTA 2X1DA 2EINH 3E5XA 2ZSIB 1TT0A 2EPFA 4EJWA 5FJ8J 3J7AY 3FWEA 1RETA 6PAXA 4XORA 2CRGA 1GVJA 3FHZA 3BQYA 5K5QA 3FDYA 2V79A 3V8LA 3EPZA 1MBEA 1RRJA 1S8NA 1E3PA 3FXKA 5KK1A 1L3LA 3PNVA 4KITB 2XAQA 2CS3A 2KFDA 2ZSHB 1ON2A 4QIWN 3RTRA 1G59A 2DO7A 2EQRA 1XMAA 3HUGA 3K4BA 3L2QA 3U1KA 2E7XA 2VJIA 2OZUA 1R00A 4ZYAA 3L2WA 2JUGA 4XN0A 5FB2A 1QGPA 2H09A 2GM4A 4E7KA 1OFCX 5EZHA 1OKRA 4MTDA 1F43A 1FJLA 3A01B 4A5MA 1HSTA 3Q9VA 1T0FA 2Z33A 1T95A 1A6QA 2A61A 3A52A 2CQ7A 3I58A 3FMSA 2HOEA 2HFHA 3DEEA 2DA2A 3S2WA 3M07A 4XICA 2FUG2 1I6HJ 1LDKB 1HC8A 4RAGA 1XB4A 3C18A 5KAIC 3S3NA 4HAMA 2F5CA 4KN4X 1JUPA 1P2FA 4A3EJ 1I6XA 1TWGJ 2F5DA 1SFUA 4Y13A 3VOEA 1YG2A 3EYIA 2L01A 1XG1A 5GP9A 2O3FA 4UUSA 2FNPA 1TWHJ 2IGKA 2MC4A 3ECOA 5LBQA 3QYFA 4GYGA 1IAWA 1Z7UA 2O7OA 4Y15A 3IAM2 1BIAA 2Z16A 4FX4A 1AHDP 2H27A 1I5ZA 1J5YA 2EIKH 4YIIA 3E6MA 5CVUA 5LHHA 4IRHA 1IDYA 4XIDA 4BBSJ 1NK2P 5HLIA 5EEHA 1LB2A 3I59A 1B9NA 3BR5A 1V54H 4CCOA 3ERED 3JRCA 3OSFA 3HHHA 1YI2I 5IT9K 4JX6A 1QZYA 2PMZN 4NBQA 2ME6A 1IW7F 1G3TA 3JR9A 3IKVA 4M73A 1ZG5A 4IHWA 1IXCA 3QPTA 2DCEA 3RQ4A 1IN7A 2X6WA 2P7CB 2CFXA 3RPUA 5J1YA 3MKWB 3J7AW 3BR1A 2R7VA 5C3EJ 1D0YA 3H1CA 2W4SA 4RA2A 3WODF 5C4JJ 2YSRA 1BJZA 1U0JA 3K70C 1DPRA 1PP8F 1JI8A 2V9VA 5FRMA 5JVTA 3CTAA 1V3FA 2Q1ZB 2CFOA 4XR6A 2TCTA 3CJNA 3LSRA 2L9SA 2XDVA 1JT6A 2GQQA 2IS1A 5ILVA 1ZLKA 4BAYA 5IY5H 1XDSA 5DUIA 2PMZA 4G94A 4XKWA 4BJ5C 3VYSB 5EG0B 2GIVA 3AFHA 2HQRA 4LMYA 2ZFUA 2HZDA 4A0XA 4U7BA 2Z1DA 2MG4A 3MZHA 2XF6A 2PLYA 3I54A 1N77A 3GTLJ 4NC8A 2V9PA 4B4CA 1WJEA 2KJCA 2WB1N 3OV8A 3U9GA 3S1MJ 1W7PB 2Y9ZA 2M3AA 1Z67A 1FNNA 2RGVA 1L0OC 3T0YA 1YRNA 1HW5A 2V1NA 1R7JA 1JTXA 4XQFA 1YTYA 2H6CA 4M71A 2X6XA 2DI3A 4KISA 1JGSA 4U0YA 3WTSC 5JHUA 1RIOH 1FOXA 2IS2A 3U2RA 4WXCA 3C2BA 5A2QZ 3VEPA 4R79A 3EQLF 2ZC2A 1A31A 2QQBA 1XSVA 2YX7A 3OIOA 3Q0WA 4O5VA 1OCCH 2EA2A 3O6BB 3HGYA 3ASOH 3RSNA 2IGNA 4HZFA 5BQTA 4XLPF 2MZ4A 4A2UA 3BDDA 3BPVA 3KFWX 5JFRA 3WTUC 1VQOI 4BXFA 1SMTA 2DT5A 1G4DA 1IN5A 4RAFA 5F1RA 1TQPA 2R7RA 4HW0A 2WB1A 5CJ9A 1QHGA 2XPVA 2ZXIA 1FYKA 1W5CC 1V4RA 3KP3A 3V42A 3KYDB 2W24A 1HDDC 4JQFA 1IN8A 1UG0A 1C0WA 2DYRH 4PJJA 4CO8A 1RC9A 1MMNA 1LEBA 3FM5A 4DYRA 5AIPA 2R7DA 1D3YA 1MKMA 1SAUA 1REPC 3RZOJ 2WY7Q 5AONA 4AD9A 5IP7J 4CUGA 2LKPA 1TQIA 4IF4A 1PUFB 2PMHA 4UXNA 2WWYA 3HTSB 3ZMSA 1X19A 4N4NB 1MBGA 1XMKA 1Z05A 3LL7A 3CF5F 3GFMA 1F1ZA 4XSXF 2DFHA 1VQ8I 1U9OA 1FSHA 2JSCA 3HOWJ 2R7XA 3F8MA 3TO9A 2BY2A 1IXRC 2DN0A 1H8AC 2Y48A 3SZGA 1D1CA 5CVVA 1GVDA 3UR3C 2ME0A 1KONA 4AM3A 1STZA 2ELHA 1BC8C 4IXAA 4L5EA 1U3EM 2VBWA 2OBPA 2HGCA 3ULQB 1FOKA 3IKTA 3CMYA 2VLAA 3IH3A 3ZP5A 1WJCA 3M8JA 2WA0A 4E7ZA 5BPDA 2MA3A 3M7GA 2JZYA 3L2VA 1VQKI 1MMGA 3ZMTA 3VYRB 1IJWC 4YELA 5J6XA 1IRFA 5IPAA 4BGDA 1VZ0A 3ZQ7A 1RUNA 4HF0A 2XKPA 3DPUA 5LRSA 3EETA 2Y2ZA 4U0WA 5DV5A 1J9IA 4OAYA 1JXSA 4UNOA 4EATA 2GBYA 3QU6A 3S1RJ 1I39A 3GVAA 2OUMA 2JSPA 4F91B 4AIJA 2CWEA 3PIPF 2K7LA 3FMQA 3GTPJ 1IRZA 4WX9A 5D8KB 4A93J 3ZQFA 3VDXA 4M3EA 4IRIA 3FHNA 1YQAA 1ETKA 2QENA 1WJBA 1E2XA 3IC7A 2NYXA 2RN7A 3HIFA 2DMUA 3BP8A 3FM3A 2A6TA 1NG6A 1WH5A 1ZELA 3ZCOA 3ZQCA 3JAMR 3PSFA 3TL4X 1S6LA 2JT1A 4Q47A 3S32A 5D5WB 1X2NA 1BW6A 4PSWA 2FSWA 3PNYA 1DU6A 2H8WA 3KEOA 1S72I 5K5RA 3ZQLA 4KFCA 4LB5A 3ZR8X 1H9TA 2IT0A 4AIKA 2YS9A 1Z3YA 1JGGA 5M5WJ 4Y33A 1UB9A 5DEQA 1I27A 4I2OA 4GDFA 2W57A 3W2AA 2ID6A 5L3CA 3M8EA 2AXLA 4MEYF 1GV5A 1O3TA 2BE5F 1F4KA 3QU3A 4XSZF 3DF8A 3KP4A 4BQNA 4BU2A 1U8BA 3CCYA 2LF8A 1D8JA 3ZMZA 2A3SA 3MQ0A 3GTKJ 1ZRFA 2VOOA 4OIRF 1B6AA 3ZQHA 2L02A 3WHCA 4I7HA 1MDMA 1BJAA 1QA6A 2OD5A 4A12A 1B72B 3IH4A 3H0DA 2A6HF 2JUCA 4ANJA 3G6EI 4XN3A 3ZQGA 1VQMI 1AOYA 2E35A 4D7MA 1OJLA 3D1NI 4AWXB 2DOAA 3CC4I 2DA6A 2L4MA 4B3XA 4KNYA 3ASNH 3LSIA 4YIRX 3VSLA 4UB8C 1RKTA 5F64A 1MMAA 4AIHA 1DU0A 2Y0SN 2NOGA 2DOEA 2MABA 3LFKA 3OL4A 4RB3C 1MBFA 2WADA 4LLNA 4NHJA 1RNLA 4C2MJ 2KPMA 4B48A 2RREA 2HYFA 4M6VA 5LGTA 2VQCA 3IRRA 3HRSA 1YFHA 1KQ8A 2VL8A 4DZPA 3K6GA 2GXBA 5J8FA 4LITA 2ZJQF 1JJ8C 4N4OB 1NHAA 4LD5A 1EH6A 4I98B 1TL8A 3HOZJ 3J7ZI 2K86A 4FASD 1ACIA 2KDOA 3V8KA 1OMIA 1WRJA 2RVCA 3FXUA 2W84A 5F0CA 4LJZF 1YW7A 4KICA 1USSA 1FEXA 2KIFA 1KU9A 4N9IA 5FLXZ 2RNGA 1JKPC 3GYHX 1J09A 2IJLA 3CCEI 3WHBA 2KZGA 2XV4S 4I99C 1DP3A 2XGXA 3DBRB 3S93A 3OS1A 3BJAA 3QODA 5DM7F 3BG3A 4EGYA 2E5NA 2J5OA 1X1PA 3TEDA 1R49A 2NVQJ 3EYYA 1MSFC 1Y0UA 1D8KA 2LMDA 3DKWA 4A5NA 2QSHX 1Q1VA 1WZ2A 3I53A 2X6OA 1P6RA 2KP6A 2FNAA 3F21A 3C2GA 4HSTA 2GAUA 3DPLC 1RR8C 1IV8A 2BXZA 3JCUC 1AKHB 1XD7A 3ZQQA 2DFFA 1G3WA 2P0TA 1U2WA 5IT9R 1VNDA 3K4JA 2VBXA 2ICWG 1W36C 3GFLA 2JA6J 3FXQA 1VQPI 1S7OA 4RM3A 3R6SA 3GXOA 1HQCA 2M5WA 2XKOA 1U5TC 3V4GA 1SD7A 4M9XA 5J4YA 3AKZA 1APLC 5EYRA 1XDUA 4A6DA 3P5JA 1RR7A 2W82A 1Y1VJ 1R71A 2R7FA 2IS4A 2NVTJ 4LG3A 3TQNA 3S1QJ 2FXAA 3EUHA 3DTIA 1G2HA 5HODA 3BPXA 3QP5A 3V7CA 4UVAA 3C1DA 1Z6TA 1SANA 3CMMA 3K9TA 1MBJA 1GV2A 3HSRA 1U5TB 2X1CA 2Y0MA 3HZJA 3AG2H 3KX2A 4L9TA 3E3VA 2G9WA 2XPWA 2HDDA 1O57A 2P7VB 4PJLA 4BDZA 2HR3A 4E7SA 2QVOA 4IOAF 3GCMA 1ZG3A 2X0LA 5KCMA 1MMSA 1BI3A 3BR6A 5B3SH 1OCZH 3G71I 3R0AA 1QVUA 2R0QC 3DEWA 3QRFF 1K83J 3OYCA 4E70A 2LDUA 3EUHC 1S5LC 2BV6A 3HKZN 2CW0F 1TNTA 2LTPA 4M3GA 2O61A 1XMXA 1R5ID 2IA0A 3QOPA 1WFXA 2YUSA 3VPRA 3BCBA 4PCQA 3A0HC 4P9UA 2KJBA 3BJOA 2QGUA 2K9MA 1JTYA 4A3IJ 1MJAA 1OCOH 3K4KA 3OSGA 4OAZA 4HF1A 4ZDLA 5ICCA 1O7LA 2K4JA 2VBYA 2VE9A 4X6AJ 1BC7C 1VQ4I 4J01A 3HDDA 1TC3C 4NC6A 1RI7A 3KLNA 4XRSG 3ELKA 2J5PA 4AIDA 4B43A 1QHHD 1T39A 3VWBA 3IH2A 2FEZA 4PGHA 2B9SA 1BW5A 2P4WA 4A3MJ 2VKDA 4P55A 2XROA 2R5ZA 1FBUA 3TBIA 3BTCA 1P7JA 4LG0A 2F4MB 1G6NA 4FISA 2XRLA 3JW4A 3WTYC 3K70D 4JX5A 2CGPA 5K1YA 1IDZA 2M4KA 3RKYA 1W7PD 2CV0A 3P9KA 3W6JB 3DFGA 3K10A 5J47A 3TOAA 1UCRA 1QPIA 3WTWC 3CUQA 4XOTA 3VSKA 1BBYA 3MCZA 4UB6C 3RPUD 1B59A 2EA4A 2WTEA 4NQWB 5ICEA 2B63J 3K1PA 3WU0A 4EM0B 2XVCA 4DW6A 1OR7A 1A5JA 1Q1HA 4A3LJ 1YJWI 1ETQA 1FTZA 2I5UA 2XSJC 5J1RA 3F0CA 4R8HA 5D8LB 3CZ6A 3G1MA 2CQNA 2HOTA 1NH3A 1VQLI 1Y8QB 4A69C 1WKMA 3CUQC 1IG7A 3LSHA 2ZO4A 3F6OA 3E6BA 5TRDA 1R22A 2M34A 2KRCA 4XONA 1UELB 4ZZDA 1MBHA 1GT0C 1TNSA 4KUMA 3EUKL 2BW3A 1P4WA 2D2WA 1OR7C 3CCQI 1MH4A 1KU2A 1FOYA 4L0ZB 4ESFA 2EZKA 2L3DA 3MZYA 4QTRA 2KKOA 2BVLA 1H0MA 2IAIA 2D5VA 1SVLA 1XGSA 3BY6A 3G3ZA 5E20A 5E1ZB 1SFKA 1KQ0A 5LD2C 5HDKA 1OYIA 5E8GA 4MLOA 4GO1A 3B6CA 5E8IA 2JRMA 2VT3A 4XLCA 2QA4I 2FRHA 1D0ZA 3DQVC 5CKTA 2QQ9A 4RGXA 2DK5A 2QEXI 1ONVA 2X98A 1PP7U 2OCEA 5CPRB 3D5LA 3C7JA 3QPSA 2XB5A 1ZGAA 2LREA 3GTGJ 1B8IA 2P5KA 2EFOA 2KL4A 4J19A 1KYZA 1MBKA 4A0ZA 5JVGF 2VASA 4BXUA 3WG7H 4E7IA 3S2DJ 3DV8A 4HV5A 2E2JJ 4ZDOA 2IS6A 2DW4A 2MBFA 2MH2A 2K85A 1SD5A 2E1MC 2HQNA 2VBZA 3OYAA 4HEA2 4U88A 1DP7P 4NB5A 2VKVA 2EV6A 2QKLB 2H6BA 2JA8J 1X1AA 2E1OA 3I71A 5ICGA 5M5YJ 2JQ7A 3CP2A 4BY7J 3H5AA 2PJPA 1YS7A 5BNGA 1RPWA 4M6YA 1FSEA 3HXLA 3LSKA 1YW8A 3QYBA 2IA2A 4G8XA 4B09A 5GAEJ 2V4JC 5IP9J 4WXDA 3S16J 2E1MB 2WAEA 5F08A 3WGGA 4ZYDA 2GZWA 2EV5A 4M3FA 1T0FC 1Z6RA 1CF7A 1MNEA 3S3OA 5L3BA 5FKKA 1SAXA 2H1LA 3HUGB 2ZJPF 3BLYA 2L9VA 1FIAA 3HG9A 4DYCA 3ECHA 2OTLI 2YPRA 1J2XA 3K4LA 4PFOA 4RBOA 5DCMA 4BHBA 2FD5A 4UV9A 3ZMDA 2XHKA 4UHTA 5FRNA 5JHFA 3KEQA 3IL2A 4E7JA 3TKYA 1TW2A 3PFYA 1J75A 2QCOA 5FKMA 2ZMEA 4BE0A 2H1KA 2FOWA 4RLQA 4OIOF 3J81K 1B4AA 2LBFA 2L7ZA 3OYIA 3KP6A 1P92A 3TP3A 1LUJB 5KVRA 4Q48A 2QUFA 3C2HA 1WJFA 3FZVA 2ZBKA 3FBIB 4RB1A 3H35A 4P1WA 2IXSA 3SFZA 4BJTA 2STTA 4MHGA 4KJZA 1MJBA 1YHQI 2E2HJ 4OOIA 1BN5A 2TRTA 4GYIA 1ZLJA 3PUBA 2OQGA 3E5QA 2NVYJ 4L9JA 1VTNC 2DPDA 3AL0C 3WGIA 3PJRA 4U0VA 3Q9SA 5BOXA 4LIVA 2IBDA 4LK1F 1EH8A 1ZRDA 4HF2A 1GHCA 2LR8A 2VC0A 3HBLA 2B0LA 1I1GA 4CCMA 3D5SC 4UUSB 5DCMB 3K1MA 2JVHA 2LSOA 1FYMA 2BZTA 5CVIA 3I3LA 1LVKA 1V5EA 3AL0B 1TBXA 1OYWA 4Z2YA 3TP0A 4RDUA 3SYTA 3ZN1A 2LKSA 2V1DA 2FQ3A 3LAPA 3OYEA 1ETYA 2WAQN 3GF2A 2M30A 4JK1X 3I59B 1WGXA 2HVRA 2BEOA 2E5ZA 5IP6A 3OYKA 2M0MA 1O7FA 2L2OA 1NTCA 3DEUA 1MH3A 2ZCWA 3MKZA 5IT3A 1HLVA 4O6JA 3SEQA 4M3BA 2HPMA 3FMRA 3O2PE 4KN7X 2RV8A 3TO7A 5BMZA 4JOMA 4XKBA 3N97A 2OA4A 2KIUA 2R5YA 3J80K 1KYWA 5KNLA 3ZPLA 2CH0A 3B73A 3BTIA 1XCVA 3BZCA 2BXYA 4BH9A 2HU9A 1NK3P 1IZ1A 3KEYA 1ETVA 5J40A 1YX3A 1AA7A 4K2EA 1K78A 3HYIA 2WAQA 5DS9A 2HYJA 2G7UA 3OYMA 3DWLE 4D0PA 3TW7A 3E6CC 1YLFA 4P9FA 4EMSA 3D0SA 2BOLA 2P6SA 5B66C 4ZYGA 3MKYB 4II3A 2ELKA 1A6IA 2HQ5A 3DPTA 1O3SA 2PI0A 2QF7A 2AHQA 2XAGA 2AQFA 3CO6C 1BI2A 4MFDA 1KGSA 3GBGA 5B1AH 5K7HA 4OWRB 2L7MP 1ZR2A 2DODA 3OYNA 3CCJI 2LY9A 3DLAA 4MGRA 3OIPA 1YRNB 4S04A 1BOAA 2ZFWA 3GWZA 5LGUA 2Z2SB 2KZVA 2NRAC 3S2HJ 4HYEA 3BWGA 5HDGA 4A3GJ 3F8BA 3RCOA 3UNGC 3T8RA 1QQIA 3KP2A 2VIXA 5ED4A 2XC7A 3DLLF 4MTEA 3W6KB 4EM1A 2JVGA 5H6RA 5LHIA 2VOPA 1B9MA 1ETOA 3E5UA 4PK4A 2LH9A 1OCRH 1EH7A 4YEJA 3WTTC 1R5HA 2F5VA 3HOSA 1AU7A 2HDCA 1ON1A 1X4PA 4EJOA 2L9NA 4GFBA 4ENJA 1QZZA 5F27A 3WU2C 4F92B 1N25A 2CW8A 2RNJA 3G2BA 3GZ5A 2QSFX 4HX4A 3JSPA 2BBYA 1FPQA 3Q3SA 3W2WA 1O3RA 2IPQX 3GMEA 3PM1A 3SDGA 3I55I 1W36D 4XM3A 2HXIA 2R7WA 3IP4B 4XNFA 1ENHA 4ETSA 3NQOA 3U21A 1MSEC 2M1BA 4EJUA 3FF5A 4FQGA 4B3AA 1YIJI 1Y39A 4RB2C 2LFBA 1H89C 1USTA 3I5UA 4IKFA 4A3KJ 1LJ9A 5FROA 3FXLA 2DT6A 1N78A 1ZN2A 4YRVA 2DJNA 3GX4X 1TLHB 1HSJA 2E60A 3LA3A 3SFIA 4OMYA 5TJJA 2KISA 2ETHA 3LSTA 4KIBA 5CYVA 3WTVC 2D45A 4NNJA 3F8CA 2LKXA 4KT6A 3BQZA 1U8RA 2LG4A 1XGMA 1IUYA 4L5JA 1IUFA 2JA7J 5GPAA 2P0WA 3BG7A 2VUMJ 3IWZA 2W48A 4G6DA 4XRSA 2VN2A 1GLNA 5DCFA 4IX7A 5GTHC 3J7AO 2NNYA 4CZZA 2LLKA 1WJAA 1GXPA 3QWLA 2WC2A 1EV7A 3P9CA 2PJRA 1FC3A 2Y30A 3RZDJ 3BR2A 1IRXA 2FBIA 2HWVA 1QZEA 2LYCA 4LGWA 4L0YB 2DA5A 4CXFA 4ZYHA 3HTUA 3NAUA 4IHXA 2V1XA 3L9FA 2ZKZA 3RDIA 2X51A 1W0UA 3P7NA 1FMWA 2MUNA 3PNTA 1S3JA 5DYMA 3O8GA 5JR3A 4G6QA 2RAEA 4XLEA 2K4BA 2K5CA 2DA3A 1E0EA 5HNFA 3N4MA 1HF0A 5CVJA 2PFBA 4D1QA 4HA8A 2ELJA 1ETXA 2OAZA 2CV2A 4IJAA 5IOYA 3JREA 3GO5A 1J59A 3PQJA 3SEZA 1YW9A 3ROUA 2OZ6A 2VE8A 5HS9A 3V7SA 2VODA 1TP4A 2QBYA 4P5OA 3OL3A 3BR0A 2E71A 4G7OF 2VKEA 4OIPF 2DA1A 4XLNF 2Y9YA 2Z3YA 5FGMA 4BNCA 2FBHA 4CSWA 4DOZA 2CSOA 4RM2A 1IN6A 4C30A 4BACA 4V2GA 4WF2A 1SVOA 1X1BA 5M5XJ 4G7HF 1IO2A 1EA3A 3H3VK 2PX9A 2E36A 5DDGA 2K9LA 1TT5B 3MFKA 3PQKA 1UG2A 4X0GA 3FXRA 3JAMZ 4ZTFA 3OIQA 4B1RA 1ZK8A 3TOBA 2A05A 1OISA 3OS0A 2JK3A 3IUOA 3KP5A 3MEXA 3JTGA 3VFZA 2L54A 2R7OA 2DMNA 3K7AJ 3G73A 4JBAA 3CLOA 3QOEA 3R60A 3SXYA 1IGNA 1MDMB 2QQAA 2KQRA 2R7UA 3OR1C 5LGNA 4UV8A 1LE8A 4BQAA 4UUVA 2VJ4A 5D4RA 1T38A 1D1BA 1RKWA 2GA1A 3OYFA 2O0YA 1R4MB 4MQ9F 2Y0SA 3P9IA 3JRDA 1ZG1A 3O8HA 1J7KA 3ABMH 4R1HA 3SDBA 3GFIA 3DKXA 4PJ0C 5FFXA 2DFIA 3COAC 1XS9A 3CC2I 3OOPA 1PDNC 2DOFA 3DTKA 1TW3A 3ABUA 4A3BJ 1UHWA 3RKXA 1FBQA 1I3QJ 3H92A 1WHUA 3TO6A 4YFNF 1YO5C 2F5FA 2G7HA 3GEZA 2KT0A 4IHSA 1SFEA 3ONQA 1R1UA 3EUAA 2BY3A 5KAFC 4LLLA 3HM5A 1MNDA 2ESNA 2JWTA 3F72A 2NNNA 5ILSA 2CUJA 4AVZA 4CHUA 4XL9A 3NRVA 4KMUX 4HX8A 3S1NJ 4M9SA 4RB0A 1S7EA 3PO3J 4H4KC 2GOXB 3SQNA 2UUZA 5IYDJ 2MC3A 3J81R 3TDUC 1KU7A 2F48A 2P5VA 4NDLA 5J4VA 5L3DA 4EJTA 2PMUA 4I76A 3OY9A 1ERDA 1BR1A 2D1VA 4FX0A 4WCGA 1FTTA 3CJTB 2E1CA 1IN4A 3L2UA 4I0AA 3H36A 2V6EA 2EV0A 5LLQA 5E3MA 4LK0F 1WI3A 2YU3A 2M7BA 4EEFG 4A3DJ 5ILUA 3BZKA 5IYBJ 1YYVA 2CMPA 1MW7A 2EZIA 2R93J 3MVPA 4C3JJ 1RZ4A 2HXOA 3ABLH 5ERIA 2CW7A 3HRUA 4CYDA 3HOVJ 1YS6A 2VQGA 1HXDA 1HW2A 2HOSA 2R7ZJ 4AYBN 5HVQC 2JPBA 3VB2A 4B8XA 3A1YA 3PUFA 2HYGD 3X2QH 1MJ9A 4RGSA 1JT0A 3A02A 2OF7A 1Y1WJ 2EILH 2X1EA 1TWCJ 1FT9A 3OYHA 3HEFA 4PDKA 4LB6B 4A6EA 5K7ZA 1IC8A 2R7TA 1ODDA 3M3YJ 1V5GA 3WE3A 1DGWY 1ZH5A 3JSOA 3DBLB 4QWQA 1SEUA 5JLXA 3OYJA 2BVMA 4A3FJ 1HKTA 2OPTA 5D5VB 3JRFA 1UHMA 4U7DA 5E1XA 4YIFA 5LRRA 1FZPB 1Z77A 3AAFA 4WXHA 4IZZA 2HI3A 3LMMA 3F6VA 2HTJA 1HBXG 2OC6A 4NUBA 1WH7A 3J80R 4AVPA 1YOVB 4AYBA 4XLAA 3HRMA 2GIZA 3S14J 1E3OC 2M9HA 1HKSA 2QKMB 2EIMH 1LDDA 1W0TA 5IT9Z 2CU7A 1VF9A 2H94A 3CCLI 2MLGA 1I3AA 1UMQA 1WJDA 1A36A 4JX4A 2UV1A 2W7NA 3J7YJ 4PUSA 3HKZA 4FETA 1A04A 1QNTA 2O03A 3S8PA 3WG9A 2JTVA 3DBHB 3HB9A 1KZHA 5F1JA 1Y56A 3KYLA 1ETWA 3A2KA 2K9QA 2V7FA 2XPUA 1X1CA 2XUBA 3UKGA 1Z7LA 4QSHA 4PSXA 2QZ8A 3KIOA 2OTJI 3AG1H 4EVIA 4JYKA 3FIWA 5HS7A 5LHGA 4MEXF 3RYPA 1TZLA 1T2KA 4D9JA 2K3FA 1FP1D 1SVMA 1Z0XA 3DXJF 1R5GA 3H9JA 2X6YA 4U87A 2DXIA 3ZN0A 1QO0D 3RI4A 5HLHA 1V5FA 3PO2J 1P4AA 2DQLA 3FKIJ 4A3JJ 2PN6A 1NG7A 3K0LA 1CGPA 3FXOA 4BHCA 4EV0A 5FO5A 5GADJ 5HS8A 3R0JA 2CJJA 3A4CA 4ENKA 1W4MA 5E3OA 2VKHA 3EDPA 5GAHJ 5F04A 5FFZA 1U9NA 1W5TA 2OU2A 4CCNA 4D5CA 3KETA 2R5ZB 1X58A 5FD5A 4KA4A 2VPLA 3HC7A 4LG0B 3LA2A 2DDAA 1B1BA 1VQ9I 4HV6A 2IGOA 1FBSA 3ZRGA 3FXMA 3LOCA 5FLMJ 3BZ6A 2K3PA 3VYUB 3GZ6A 1EJ9A 5L3GA 4WWCA 2ECBA 1Z21A 4C2TA 2WAFA 2KLOA 3CUQB 3F9KA 3H0GJ 1VQ6I 1XGNA 2KMUA 1PJRA 2VXDA 4BJ6C 1PUEE 5CQGA 1BOBA 1HKQA 1U6GA 5DM6F 4W97A 1OCPA 2G0EA 1P4XA 1POGA 2VC1A 4FHTA 3H5NA 3QQAA 3A01A 1LKXA 3CUOA 1ITYA 2M8GX 2FMYA 1R58A 2M7AA 2P8TA 2I8DA 3B6AA 1ZKGA 1QBJA 4MQVA 3SZTA 3AG4H 1D1AA 3E1SA 4IOCF 1WCMJ 2FX0A 4MO7A 5B1BH 3HHGA 5H20A 2QWWA 3HSEA 2ID3A 3I4NJ 2K9SA 4UVBA 3I64A 2NS7A 3K4MA 2BW3B 4F55A 1VQ7I 2CUEA 1UZCA 4LIUA 3FX3A 2Q2EA 3RKWA 2XAFA 4CCKA 3V7RA 2FF4A 3CDIA 1G3YA 2MD0A 4BXXJ 1J0RA 2LY2A 3M1CA 3ZXSA 1XGOA 2DT7B 2IVMA 4MNUA 2JPCA 3BG9A 2V9KA 3DU6A 5IYCJ 2OCCH 2TDXA 4CA0A 5DD8A 3GZNB 3GUDA 4ZH4F 4S05A 3K1NA 4DBQA 5HDNA 1GUUA 4W1UA 3Q0UA 3ERMA 2KRFA 1GDTA 2BYVE 1ZQ3P 1KA8A 2W1OA 5DUKA 2HTSA 3ABKH 5LEKA 5EEGA 4IRGA 4RMNA 4BDYA 2HKXA 1B8IB 4HNTA 5CVRA 2DMQA 4RGUA 2EB7A 4XLHA 1YJNI 1JHHA 3BT9A 4DZJA 5KHDA 2RQQA 4QPOA 3L2RA 3ABTA 1QVTA 5E18F 1VFCA 5DTDA 3CJQB 3F8FA 3WE2A 5K5OA 1JKQC 2KHMA 1TWAJ 2LP0A 1ULYA 1HA8A 2A6EF 2Q2EB 4G9YA 1ZARA 4C3HJ 2PEXA 2QLZA 3DU5A 3O3KA 1XPXA 4KIGA 5J8CA 2EH3A 2VB6A 4GGGA 3G4SI 4ENMA 2MFZA 3HSFA 3LA7A 4CCLA 2KDZA 1M1EB 2EFPA 2Y69H 3E6DA 1MZBA 2JA2A 1ZAOA 1LDJA 3LAJA 5EDNA 5A2QR 4MIMA 5EG0A 3KPHA 3H3UA 2I10A 4I0BA 3QPHA 3HJEA 2QM3A 1O3QA 3HOTA 2STWA 4YG2F 3MN2A 2NVUB 2BHZA 2ZMEC 1CF7B 3TW6A 2D1HA 3JTHA 2ZNZA 5H6QA 4Q5SF 1LQ1A 2XAJA 2QQ8A 3F22A 4KDPA 1W7PA 2A68F 2F2EA 1F9NA 1R1VA 1FOWA 2DPUA 3CCRI 5L3FA 2XF5A 3H9QA 4BYYA 2NXNB 4D7NA 2VQHA 4PFPA 3HOYJ 3GTOJ 2O8KA 2VQLA 3PFIA 2LY1A 4IHVA 2LRDA 2AQEA 1RQ6A 2KRHA 2R7QA 5FKNA 2ZMEB 4ON0A 1O4XA 4GRIA 3JRIA 4M72A 2COMA 2LBFB 3OOUA 5C4XJ 3ZMVA 1S7AA 4LFUA 3NEUA 1K6YA 4BQOA 1QPMA 1W1WE 2A69F 3BG5A 3PIOF 3G1LA 4N9HA 2W00A 3WU1B 1PYVA 5E3LA 4FT8A 2AO9A 4IVNA 4DJAA 2BGCA 1WPKA 5GPCA 1LVAA 4L9VA 1XSXA 2R7SA 2OQRA 1FX7A 5B5EC 1BM9A 3PSIA 1JHFA 4NC7A 4RAZA 4HPQA 5C44J 4E6KG 3LSJA 1UFMA 2HKOA 3HL2A 2E19A 4Y17A 2M0CA 2R3SA 1K7AA 1XTAA 3ZMUA 2GWRA 2BY0A 1JUSA 2VXZA 3CP8A 3HGGA 3CESA 3BC8A 2L7FP 1Y6IA 1TQMA 4MFEA 5M3FJ 2L0KA 3L00A 1MMDA 1OPCA 3PL8A 2GA2A 1YIOA 3KCCA 3RYRA 1BA5A 1T8IA 3GTQJ 3LWFA 1PUFA 1D0XA 1SMYF 5E3NA 4E4HA 4ZZLA 3JRAA 3L2CA 3A03A 2XB0X 2V26A 3QAHA 1T08B 2DDBA 5BS6A 3IHUA 1HCRA 4CICA 4KT5C 4BL0B 2W85A 4IO9F 1R9TJ 1MIJA 4X1EA 3I4PA 5AIQA 2Q0OA 3GLXA 4F93B 4GXOA 3LSPA 3B02A 3KZZA 5EZGA 1JKRC 1E3HA 1IRGA 2IP2A 2AXTC 4BEHA 2LOOA 3NWSA 4LOCA 5FKOA 4IPAA 2CQXA 3Q0VA 1FY7A 2X48A 5LFAA 3LFUA 4M9ZA 4IHTA 4G12A 3ZGKA 1TTYA 2BY1A 3OMYA 2R5YB 3HOUJ 4M74A 5EJCA 2WY8Q 1QRYA 3KE2A 3GTMJ 2ZNYA 4DQ2A 3CLQA 2QYOA 4YFKF 3HRTA 1K78B 4CCJA 2ACJA 2O9LA 3ZQIA 1MNMC 2L4AA 2LC2A 4RLFA 5TGTA 4BUPA 1I1SA 1H9GA 5JLWA 3VODA 2FE3A 2B7EA 1K61A 4HOBA 1BL0A 2L9RA 1F5TA 3CD6I 2UWMA 2IEKA 1ZYRF 4DNCA 5EGOA 2MGQA 4D5FA 1R4NB 3K4CA 4IHYA 2YU9J 3BG6A 1RUOA 3DP7A 1ZR4A 1VI0A 4A3CJ 4AU7A 2K02A 3E97A 2A5WA 5LEJA 2NAZA 2JMWA 4V2FA 4BS9A 4BEHB 1DQUA 1F36A 1Y8RB 5EEAA 2XF7A 4HX7A 3JRHA 3C3WA 2K9NA 3KP7A 2DAOA 1BR4A 1X1DA 5F6FA 4BE1A 3Q5FA 3S3MA 3MAJA 4ZTJA 3ML6A 4HQMA 2NS8A 3CCSI 2KIMA 4BKXA 1U78A 2M2EA 4BQQA 1H88C 3CO7C 1DDNA 3MKLA 2F6CA 3U1DA 4Y4RA 2VPRA 2ISZA 4O3MA 2HS5A 1MGTA 2KIQA 1R23A 2P6TA 3GFJA 4ZJZA 2JRTA 4JP0A 5J3LA 2N8GA 2FBKA 2M45A 1XSDA 2XGCA 1LEAA 5CQEA 2HQAA 5EGOB 2DMPA 2EJRA 3QPLA 3CCVI 3SHFA 1T6SA 2MD5A 1FLIA 4C2UA 4L18B 4HDVA 2UXNA 4XLFA 3IWFA 4PJMA 2BHYA 1B72A 1S29A 2CO5A 2LK2A 1D5VA 3DCFA 5TISC 1JUMA 1EKEA 2M87A 1X3UA 3RKQA 1Z1DA
chains in the Genus database with same CATH topology
1Z9CA 5ICFA 5E17F 4PZJA 2O6GE 2Q8KA 1AWCA 3T8TA 2PQ8A 2A07F 4ESJA 4XRFA 3BJ6A 2ZXJA 2O8XA 4L9NA 3WGHA 1K79A 2X4HA 5BPIA 2XASA 4N0BA 1BIBA 3ISPA 2K27A 4BHPA 4HLXA 2DQRA 2DK8A 4KMFA 1R36A 4EQQA 3WTXC 3F3XA 5D6EA 2CYYA 2FA5A 2F5EA 2E7WA 3TDZC 1WI9A 2ZJ2A 1E17A 3F23A 1KU3A 4PGGA 4HQEA 1G3SA 5A2QK 3M9AA 4F7ZA 4EM2A 4UVCA 5JI6A 4I09A 4HLYA 2IRFG 2ISYA 2QBYB 4P96A 5CLSA 5FD6A 4YFXF 2XRNA 5HLGA 2UZKA 2LNBA 5HOOA 1IF1A 4XBFA 1ZRCA 3F8NA 2DBBA 1FWZA 2Y75A 4TV7A 3M8FA 1ZHFA 2DTRA 2EWNA 2YX4A 1HW1A 4RGRA 3GW2A 2M8EA 3IRQA 1WQ2A 4Q4ZF 4EGZA 2FMLA 1Z91A 3LQQA 2IW5A 1MD0A 2RQPA 2FU4A 2PBIA 3WTZA 1DUXC 4CDGA 2W25A 2IA1A 2ESHA 1U5TA 2Z99A 4OMZA 1ZREA 4CGZA 2FOKA 2LF7A 2XIGA 2RDPA 2V1UA 3BROA 1FYLA 3TGNA 2CQKA 1KQ9A 2ADUA 5E1WA 5D4SA 1SFXA 4ESBA 4WK8F 1WWXA 3CDHA 5DD4A 1SD6A 2VT2A 2YR2A 2HZTA 4GCVA 2XAHA 4G7ZF 3K69A 1FP2A 1WSUA 1IXSB 1OYYA 2WV0A 3L7WA 2C6YA 4OIQF 1W5SA 3RPQA 4M6XA 5D6FA 2E1NA 3R4KA 3M1EA 4ASNA 4LLGF 2DLLA 2EFWA 2Z9OA 2Z5UA 1JE8A 4I02A 2P5LC 3BOQA 1XN7A 2HEOA 3MWMA 4HBLA 3J81Z 4KIFA 2PG4A 5D5XB 2MLKA 2DU9A 1DPUA 2AS5F 2CG4A 2GXGA 4NQWA 3V8JA 4A0YA 4KYWA 4HDUA 1BI0A 4L5IA 1GXQA 4H0EA 3RIRA 2A5YB 2RC4A 4RAYA 2EFNA 3LQRA 2NS0A 3QP6A 3KLOA 3REOA 3KZYA 3K2ZA 4RS8A 4OINF 5D5UB 2V6CA 3L09A 3T5XA 1T98A 2MH9A 2UXXA 4EJVA 4QLCU 1ZGJA 1XCBA 3H3ZA 3JAMK 2EK5A 2RKHA 1SD4A 1K6OA 3SZPA 3J80Z 1LNWA 4ZYEA 3I0TA 3RJPA 4I01A 1R1TA 4OU0A 5FLXK 1BI1A 3T1BA 3R61A 2VONA 5L3EA 4ENNA 2EFQA 3E5XA 4EJWA 3FWEA 6PAXA 1GVJA 3FHZA 5K5QA 2V79A 3V8LA 1S8NA 5KK1A 1L3LA 2XAQA 1ON2A 3RTRA 2DO7A 1XMAA 3HUGA 2E7XA 2OZUA 1R00A 5FB2A 1QGPA 2H09A 1OKRA 4MTDA 4A5MA 1HSTA 3Q9VA 1T0FA 2Z33A 2A61A 3I58A 3FMSA 2HOEA 2HFHA 3S2WA 1LDKB 1XB4A 3C18A 4HAMA 2F5CA 4KN4X 1P2FA 1I6XA 2F5DA 1SFUA 4Y13A 3VOEA 1YG2A 3EYIA 2L01A 2O3FA 2FNPA 3ECOA 5LBQA 4GYGA 1IAWA 1Z7UA 4Y15A 2H27A 1BIAA 4FX4A 1I5ZA 5LHHA 1J5YA 4YIIA 3E6MA 5CVUA 4IRHA 5HLIA 5EEHA 1LB2A 3I59A 1B9NA 3ERED 5IT9K 3HHHA 1QZYA 1IW7F 1G3TA 3IKVA 4M73A 1ZG5A 1IXCA 3QPTA 1IN7A 2P7CB 2CFXA 3RPUA 3WODF 2YSRA 1DPRA 1PP8F 2V9VA 5JVTA 3CTAA 1V3FA 3CJNA 2GQQA 5ILVA 1ZLKA 4BAYA 1XDSA 5DUIA 4G94A 2GIVA 2HQRA 4LMYA 4A0XA 4U7BA 3MZHA 2PLYA 3I54A 2KJCA 3OV8A 3U9GA 1W7PB 1FNNA 2RGVA 1L0OC 3T0YA 1HW5A 1R7JA 1YTYA 2H6CA 4M71A 2DI3A 1JGSA 4U0YA 3WTSC 5JHUA 1RIOH 3U2RA 4WXCA 5A2QZ 3VEPA 4R79A 3EQLF 2QQBA 1XSVA 2YX7A 4O5VA 2EA2A 3O6BB 4HZFA 5BQTA 4XLPF 4A2UA 3BDDA 3BPVA 3KFWX 5JFRA 3WTUC 1SMTA 2DT5A 1G4DA 1IN5A 5F1RA 1TQPA 4HW0A 5CJ9A 1FYKA 1V4RA 3KP3A 2W24A 4JQFA 1IN8A 1C0WA 4CO8A 1LEBA 3FM5A 5AIPA 2R7DA 1D3YA 1MKMA 1REPC 5AONA 4AD9A 2LKPA 1TQIA 4IF4A 2PMHA 4UXNA 2WWYA 3HTSB 3ZMSA 1XMKA 1Z05A 3GFMA 1F1ZA 4XSXF 1FSHA 2JSCA 3F8MA 3TO9A 1IXRC 2Y48A 5CVVA 1STZA 2ELHA 1BC8C 4IXAA 1U3EM 2VBWA 2OBPA 2HGCA 3ULQB 1FOKA 3IKTA 3ZP5A 5BPDA 2MA3A 3M7GA 2JZYA 3ZMTA 5J6XA 1IRFA 3ZQ7A 1RUNA 4HF0A 2XKPA 5LRSA 3EETA 4U0WA 5DV5A 1J9IA 1JXSA 4UNOA 3QU6A 3GVAA 4AIJA 2CWEA 2K7LA 3FMQA 4WX9A 5D8KB 4IRIA 1YQAA 2QENA 1E2XA 3IC7A 2NYXA 2RN7A 3HIFA 3BP8A 3FM3A 1S6LA 2JT1A 4Q47A 5D5WB 2FSWA 3KEOA 5K5RA 4KFCA 4LB5A 1H9TA 2IT0A 4AIKA 1UB9A 5DEQA 1I27A 4I2OA 2W57A 3M8EA 2AXLA 4MEYF 1O3TA 2BE5F 1F4KA 3QU3A 4XSZF 3DF8A 3KP4A 1D8JA 2LF8A 3ZMZA 2A3SA 3MQ0A 1ZRFA 2VOOA 4OIRF 1B6AA 2L02A 4I7HA 1MDMA 1BJAA 2OD5A 4A12A 2A6HF 1AOYA 4AWXB 2L4MA 4KNYA 5F64A 4AIHA 3LFKA 4RB3C 4LLNA 4NHJA 1RNLA 2HYFA 5LGTA 3IRRA 3HRSA 1YFHA 1KQ8A 2GXBA 5J8FA 1NHAA 4LD5A 1EH6A 4I98B 2K86A 3V8KA 1OMIA 1WRJA 2RVCA 3FXUA 2W84A 4LJZF 1YW7A 4KICA 1USSA 2KIFA 1KU9A 4N9IA 5FLXZ 3GYHX 2IJLA 2XV4S 2XGXA 3BJAA 4EGYA 2J5OA 3EYYA 1Y0UA 1D8KA 4A5NA 3DKWA 3I53A 1P6RA 2FNAA 3F21A 2GAUA 3DPLC 1XD7A 1G3WA 1U2WA 2VBXA 3GFLA 3FXQA 1S7OA 3R6SA 3GXOA 1HQCA 2M5WA 2XKOA 1U5TC 3V4GA 1SD7A 4M9XA 1XDUA 4A6DA 2R7FA 3TQNA 2FXAA 3EUHA 3BPXA 3QP5A 3V7CA 4UVAA 1Z6TA 3C1DA 3K9TA 3HSRA 1U5TB 2Y0MA 4L9TA 3E3VA 2G9WA 1O57A 2P7VB 2HR3A 2QVOA 1ZG3A 2X0LA 1BI3A 3R0AA 3QRFF 4E70A 2LDUA 2BV6A 2CW0F 1TNTA 2O61A 2IA0A 3QOPA 4PCQA 4P9UA 2KJBA 3BJOA 1MJAA 4HF1A 5ICCA 1O7LA 2K4JA 2VBYA 2VE9A 1BC7C 1RI7A 3KLNA 3ELKA 2J5PA 1T39A 2FEZA 4PGHA 2P4WA 4P55A 2XROA 1FBUA 4LG0A 1G6NA 3JW4A 3WTYC 2CGPA 5K1YA 3RKYA 1W7PD 3P9KA 3W6JB 3DFGA 3TOAA 1UCRA 3WTWC 3CUQA 1BBYA 3MCZA 1B59A 2EA4A 2WTEA 5ICEA 3K1PA 3WU0A 4EM0B 2XVCA 1OR7A 1Q1HA 4R8HA 5D8LB 1WKMA 3CUQC 2ZO4A 3F6OA 3E6BA 5TRDA 1R22A 4ZZDA 1TNSA 4KUMA 1P4WA 2D2WA 1KU2A 4L0ZB 4ESFA 2L3DA 3MZYA 2KKOA 1H0MA 1XGSA 3BY6A 3G3ZA 5E20A 5E1ZB 1KQ0A 5HDKA 1OYIA 5E8GA 4GO1A 5E8IA 2VT3A 2FRHA 3DQVC 2QQ9A 4RGXA 2DK5A 1ONVA 1PP7U 3D5LA 3C7JA 1ZGAA 2P5KA 2EFOA 1KYZA 4A0ZA 4BXUA 3DV8A 4HV5A 2DW4A 2MBFA 2MH2A 1SD5A 2HQNA 2VBZA 4U88A 1DP7P 4NB5A 2EV6A 2H6BA 3I71A 5ICGA 2PJPA 1YS7A 4M6YA 1FSEA 4B09A 5L3CA 1YW8A 4G8XA 2IA2A 4WXDA 3WGGA 4ZYDA 2GZWA 2EV5A 1Z6RA 1CF7A 5L3BA 1SAXA 3ECHA 2YPRA 1J2XA 5DCMA 4BHBA 4UV9A 3ZMDA 2XHKA 4UHTA 3KEQA 3IL2A 3TKYA 1TW2A 1J75A 2ZMEA 4OIOF 3J81K 1B4AA 3KP6A 1P92A 5KVRA 4Q48A 2QUFA 3FZVA 2ZBKA 4RB1A 3SFZA 2STTA 4MHGA 1MJBA 4OOIA 1BN5A 4GYIA 1ZLJA 2OQGA 3E5QA 4L9JA 1VTNC 2DPDA 3WGIA 4U0VA 3Q9SA 5BOXA 4LK1F 1EH8A 1ZRDA 4HF2A 1GHCA 2VC0A 2B0LA 1I1GA 5DCMB 3K1MA 2LSOA 1FYMA 5CVIA 1TBXA 1OYWA 4Z2YA 3ZN1A 2V1DA 2FQ3A 3LAPA 3GF2A 2M30A 4JK1X 3I59B 2BEOA 1O7FA 3DEUA 2ZCWA 5IT3A 4O6JA 3FMRA 3O2PE 4KN7X 2RV8A 3TO7A 5BMZA 3N97A 2OA4A 2KIUA 3J80K 1KYWA 3ZPLA 3B73A 1XCVA 4BH9A 1IZ1A 1K78A 4K2EA 3HYIA 2G7UA 4D0PA 3E6CC 1YLFA 4P9FA 4EMSA 3D0SA 2P6SA 4ZYGA 3DPTA 1O3SA 2PI0A 2XAGA 3CO6C 1BI2A 1KGSA 4MGRA 4S04A 1BOAA 2ZFWA 3GWZA 5LGUA 2NRAC 4HYEA 3BWGA 5HDGA 3F8BA 3T8RA 1QQIA 3KP2A 5ED4A 4MTEA 3W6KB 4EM1A 5H6RA 5LHIA 2VOPA 1B9MA 3E5UA 1EH7A 3WTTC 1R5HA 3HOSA 2HDCA 1ON1A 4EJOA 4ENJA 1QZZA 4CXFA 2RNJA 3JSPA 3GZ5A 4HX4A 2BBYA 1FPQA 1O3RA 2IPQX 4ETSA 3NQOA 2M1BA 4EJUA 3FF5A 4RB2C 1USTA 3I5UA 1LJ9A 1ZN2A 3GX4X 1TLHB 1HSJA 3LA3A 4OMYA 5TJJA 2ETHA 3LSTA 4KIBA 5CYVA 3WTVC 2D45A 3F8CA 1U8RA 1XGMA 1IUYA 4L5JA 3IWZA 4G6DA 2VN2A 5DCFA 3J7AO 2NNYA 4CZZA 1GXPA 2WC2A 1EV7A 3P9CA 1FC3A 2FBIA 2HWVA 4LGWA 4L0YB 4ZYHA 3HTUA 2V1XA 3L9FA 2ZKZA 3RDIA 3P7NA 1S3JA 5DYMA 5JR3A 4G6QA 2K4BA 3N4MA 5CVJA 2PFBA 4HA8A 2OAZA 4IJAA 3GO5A 1J59A 3PQJA 1YW9A 3ROUA 2OZ6A 2VE8A 5HS9A 3V7SA 2VODA 2QBYA 4P5OA 4G7OF 4OIPF 4XLNF 2Z3YA 5FGMA 4BNCA 2FBHA 2CSOA 1IN6A 4WF2A 4G7HF 5DDGA 3MFKA 3PQKA 3FXRA 3JAMZ 3TOBA 3MEXA 3KP5A 3JTGA 3VFZA 2L54A 3G73A 4JBAA 3CLOA 3R60A 3SXYA 1MDMB 2QQAA 5LGNA 4UV8A 4BQAA 4UUVA 5D4RA 1T38A 2GA1A 2O0YA 4MQ9F 3P9IA 1ZG1A 1J7KA 4R1HA 3GFIA 5FFXA 3COAC 2DFIA 3OOPA 1PDNC 1TW3A 3ABUA 1UHWA 3RKXA 1FBQA 3H92A 3TO6A 4YFNF 1YO5C 2F5FA 2G7HA 3GEZA 4IHSA 1SFEA 1R1UA 4LLLA 2ESNA 3F72A 2NNNA 5ILSA 4CHUA 3NRVA 4KMUX 4HX8A 4M9SA 4RB0A 3SQNA 2MC3A 3TDUC 1KU7A 2P5VA 5L3DA 4EJTA 2PMUA 2D1VA 4FX0A 4WCGA 2E1CA 1IN4A 4I0AA 2EV0A 5LLQA 4LK0F 2YU3A 5ILUA 1YYVA 1RZ4A 5ERIA 3HRUA 4CYDA 1YS6A 1HXDA 1HW2A 5HVQC 2JPBA 3VB2A 4B8XA 2HYGD 1MJ9A 4RGSA 1FT9A 4PDKA 4LB6B 4A6EA 1ODDA 3WE3A 1ZH5A 3JSOA 4QWQA 1HKTA 5D5VB 1UHMA 4U7DA 5E1XA 4YIFA 5LRRA 1FZPB 3AAFA 4WXHA 1HBXG 3F6VA 2HTJA 4AVPA 3HRMA 1HKSA 1LDDA 5IT9Z 2H94A 2MLGA 1A04A 1QNTA 2O03A 3WG9A 2JTVA 2XUBA 2QZ8A 4EVIA 5HS7A 5LHGA 4MEXF 3RYPA 1T2KA 1FP1D 3DXJF 1R5GA 3ZN0A 1QO0D 3RI4A 5HLHA 1P4AA 2DQLA 2PN6A 3K0LA 1CGPA 4BHCA 4EV0A 5FO5A 5HS8A 3R0JA 4ENKA 1W4MA 3EDPA 5FFZA 2OU2A 1W5TA 3KETA 5FD5A 4KA4A 4LG0B 3LA2A 1B1BA 4HV6A 1FBSA 3BZ6A 3GZ6A 5L3GA 4WWCA 3CUQB 1XGNA 1PUEE 1HKQA 1U6GA 1P4XA 2VC1A 4FHTA 3CUOA 2FMYA 1R58A 2P8TA 1QBJA 4MQVA 3SZTA 3HHGA 5H20A 2QWWA 3HSEA 4UVBA 3I64A 3FX3A 2Q2EA 3RKWA 2XAFA 3V7RA 2FF4A 1G3YA 1J0RA 1XGOA 2IVMA 4MNUA 2JPCA 2TDXA 5DD8A 3GUDA 4ZH4F 4S05A 3K1NA 5HDNA 2KRFA 2BYVE 1KA8A 5DUKA 2HTSA 5LEKA 5EEGA 4IRGA 2HKXA 5CVRA 4RGUA 2EB7A 1JHHA 3ABTA 5E18F 3F8FA 3WE2A 5K5OA 1ULYA 2A6EF 4G9YA 1ZARA 2PEXA 2QLZA 3O3KA 4KIGA 4ENMA 5J8CA 4GGGA 3HSFA 3LA7A 2EFPA 3E6DA 1MZBA 1ZAOA 1LDJA 3LAJA 3H3UA 4I0BA 3QPHA 1O3QA 2QM3A 3HOTA 2STWA 4YG2F 1CF7B 2D1HA 3JTHA 2ZNZA 5H6QA 4Q5SF 1LQ1A 2XAJA 3F22A 4KDPA 1W7PA 2A68F 2F2EA 1F9NA 1R1VA 2DPUA 5L3FA 4BYYA 3PFIA 2ZMEB 4ON0A 4M72A 2COMA 3ZMVA 1S7AA 4LFUA 3NEUA 1QPMA 2A69F 4N9HA 3WU1B 4FT8A 4IVNA 2BGCA 1LVAA 4L9VA 1XSXA 2OQRA 1FX7A 1BM9A 1JHFA 4RAZA 1UFMA 2HKOA 4Y17A 1K7AA 2R3SA 3ZMUA 2GWRA 2VXZA 1TQMA 3L00A 1OPCA 2GA2A 1YIOA 3KCCA 3RYRA 3LWFA 1SMYF 4ZZLA 3L2CA 3QAHA 5BS6A 3IHUA 4CICA 4KT5C 2W85A 3I4PA 5AIQA 2Q0OA 3GLXA 4GXOA 3B02A 3KZZA 1IRGA 2IP2A 4IPAA 1FY7A 4M9ZA 4IHTA 1TTYA 4M74A 3KE2A 2ZNYA 4DQ2A 2QYOA 4YFKF 3HRTA 1K78B 2ACJA 2L4AA 1I1SA 1H9GA 3VODA 2FE3A 1F5TA 4HOBA 2UWMA 1ZYRF 4DNCA 1RUOA 3DP7A 2K02A 3E97A 5LEJA 2NAZA 4HX7A 3C3WA 3KP7A 2DAOA 5F6FA 3Q5FA 3MAJA 3ML6A 4HQMA 2KIMA 1U78A 3CO7C 1DDNA 3U1DA 2ISZA 4O3MA 2HS5A 1MGTA 1R23A 2P6TA 3GFJA 2JRTA 2FBKA 2M45A 1XSDA 1LEAA 2EJRA 3SHFA 1T6SA 2MD5A 1FLIA 4L18B 4HDVA 2UXNA 3IWFA 1S29A 2CO5A 1D5VA 2M87A 1X3UA 1Z1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9C A;  5ICF A;  5E17 F;  4PZJ A;  2O6G E;  2Q8K A;  1AWC A;  3T8T A;  2PQ8 A;  2A07 F;  4ESJ A;  4XRF A;  3BJ6 A;  2ZXJ A;  2O8X A;  4L9N A;  3WGH A;  1K79 A;  2X4H A;  5BPI A;  2XAS A;  4N0B A;  1BIB A;  3ISP A;  2K27 A;  4BHP A;  4HLX A;  2DQR A;  2DK8 A;  4KMF A;  1R36 A;  4EQQ A;  3WTX C;  3F3X A;  5D6E A;  2CYY A;  2FA5 A;  2F5E A;  2E7W A;  3TDZ C;  1WI9 A;  2ZJ2 A;  1E17 A;  3F23 A;  1KU3 A;  4PGG A;  4HQE A;  1G3S A;  5A2Q K;  3M9A A;  4F7Z A;  4EM2 A;  4UVC A;  5JI6 A;  4I09 A;  4HLY A;  2IRF G;  2ISY A;  2QBY B;  4P96 A;  5CLS A;  5FD6 A;  4YFX F;  2XRN A;  5HLG A;  2UZK A;  2LNB A;  5HOO A;  1IF1 A;  4XBF A;  1ZRC A;  3F8N A;  2DBB A;  1FWZ A;  2Y75 A;  4TV7 A;  3M8F A;  1ZHF A;  2DTR A;  2EWN A;  2YX4 A;  1HW1 A;  4RGR A;  3GW2 A;  2M8E A;  3IRQ A;  1WQ2 A;  4Q4Z F;  4EGZ A;  2FML A;  1Z91 A;  3LQQ A;  2IW5 A;  1MD0 A;  2RQP A;  2FU4 A;  2PBI A;  3WTZ A;  1DUX C;  4CDG A;  2W25 A;  2IA1 A;  2ESH A;  1U5T A;  2Z99 A;  4OMZ A;  1ZRE A;  4CGZ A;  2FOK A;  2LF7 A;  2XIG A;  2RDP A;  2V1U A;  3BRO A;  1FYL A;  3TGN A;  2CQK A;  1KQ9 A;  2ADU A;  5E1W A;  5D4S A;  1SFX A;  4ESB A;  4WK8 F;  1WWX A;  3CDH A;  5DD4 A;  1SD6 A;  2VT2 A;  2YR2 A;  2HZT A;  4GCV A;  2XAH A;  4G7Z F;  3K69 A;  1FP2 A;  1WSU A;  1IXS B;  1OYY A;  2WV0 A;  3L7W A;  2C6Y A;  4OIQ F;  1W5S A;  3RPQ A;  4M6X A;  5D6F A;  2E1N A;  3R4K A;  3M1E A;  4ASN A;  4LLG F;  2DLL A;  2EFW A;  2Z9O A;  2Z5U A;  1JE8 A;  4I02 A;  2P5L C;  3BOQ A;  1XN7 A;  2HEO A;  3MWM A;  4HBL A;  3J81 Z;  4KIF A;  2PG4 A;  5D5X B;  2MLK A;  2DU9 A;  1DPU A;  2AS5 F;  2CG4 A;  2GXG A;  4NQW A;  3V8J A;  4A0Y A;  4KYW A;  4HDU A;  1BI0 A;  4L5I A;  1GXQ A;  4H0E A;  3RIR A;  2A5Y B;  2RC4 A;  4RAY A;  2EFN A;  3LQR A;  2NS0 A;  3QP6 A;  3KLO A;  3REO A;  3KZY A;  3K2Z A;  4RS8 A;  4OIN F;  5D5U B;  2V6C A;  3L09 A;  3T5X A;  1T98 A;  2MH9 A;  2UXX A;  4EJV A;  4QLC U;  1ZGJ A;  1XCB A;  3H3Z A;  3JAM K;  2EK5 A;  2RKH A;  1SD4 A;  1K6O A;  3SZP A;  3J80 Z;  1LNW A;  4ZYE A;  3I0T A;  3RJP A;  4I01 A;  1R1T A;  4OU0 A;  5FLX K;  1BI1 A;  3T1B A;  3R61 A;  2VON A;  5L3E A;  4ENN A;  2EFQ A;  3E5X A;  4EJW A;  3FWE A;  6PAX A;  1GVJ A;  3FHZ A;  5K5Q A;  2V79 A;  3V8L A;  1S8N A;  5KK1 A;  1L3L A;  2XAQ A;  1ON2 A;  3RTR A;  2DO7 A;  1XMA A;  3HUG A;  2E7X A;  2OZU A;  1R00 A;  5FB2 A;  1QGP A;  2H09 A;  1OKR A;  4MTD A;  4A5M A;  1HST A;  3Q9V A;  1T0F A;  2Z33 A;  2A61 A;  3I58 A;  3FMS A;  2HOE A;  2HFH A;  3S2W A;  1LDK B;  1XB4 A;  3C18 A;  4HAM A;  2F5C A;  4KN4 X;  1P2F A;  1I6X A;  2F5D A;  1SFU A;  4Y13 A;  3VOE A;  1YG2 A;  3EYI A;  2L01 A;  2O3F A;  2FNP A;  3ECO A;  5LBQ A;  4GYG A;  1IAW A;  1Z7U A;  4Y15 A;  2H27 A;  1BIA A;  4FX4 A;  1I5Z A;  5LHH A;  1J5Y A;  4YII A;  3E6M A;  5CVU A;  4IRH A;  5HLI A;  5EEH A;  1LB2 A;  3I59 A;  1B9N A;  3ERE D;  5IT9 K;  3HHH A;  1QZY A;  1IW7 F;  1G3T A;  3IKV A;  4M73 A;  1ZG5 A;  1IXC A;  3QPT A;  1IN7 A;  2P7C B;  2CFX A;  3RPU A;  3WOD F;  2YSR A;  1DPR A;  1PP8 F;  2V9V A;  5JVT A;  3CTA A;  1V3F A;  3CJN A;  2GQQ A;  5ILV A;  1ZLK A;  4BAY A;  1XDS A;  5DUI A;  4G94 A;  2GIV A;  2HQR A;  4LMY A;  4A0X A;  4U7B A;  3MZH A;  2PLY A;  3I54 A;  2KJC A;  3OV8 A;  3U9G A;  1W7P B;  1FNN A;  2RGV A;  1L0O C;  3T0Y A;  1HW5 A;  1R7J A;  1YTY A;  2H6C A;  4M71 A;  2DI3 A;  1JGS A;  4U0Y A;  3WTS C;  5JHU A;  1RIO H;  3U2R A;  4WXC A;  5A2Q Z;  3VEP A;  4R79 A;  3EQL F;  2QQB A;  1XSV A;  2YX7 A;  4O5V A;  2EA2 A;  3O6B B;  4HZF A;  5BQT A;  4XLP F;  4A2U A;  3BDD A;  3BPV A;  3KFW X;  5JFR A;  3WTU C;  1SMT A;  2DT5 A;  1G4D A;  1IN5 A;  5F1R A;  1TQP A;  4HW0 A;  5CJ9 A;  1FYK A;  1V4R A;  3KP3 A;  2W24 A;  4JQF A;  1IN8 A;  1C0W A;  4CO8 A;  1LEB A;  3FM5 A;  5AIP A;  2R7D A;  1D3Y A;  1MKM A;  1REP C;  5AON A;  4AD9 A;  2LKP A;  1TQI A;  4IF4 A;  2PMH A;  4UXN A;  2WWY A;  3HTS B;  3ZMS A;  1XMK A;  1Z05 A;  3GFM A;  1F1Z A;  4XSX F;  1FSH A;  2JSC A;  3F8M A;  3TO9 A;  1IXR C;  2Y48 A;  5CVV A;  1STZ A;  2ELH A;  1BC8 C;  4IXA A;  1U3E M;  2VBW A;  2OBP A;  2HGC A;  3ULQ B;  1FOK A;  3IKT A;  3ZP5 A;  5BPD A;  2MA3 A;  3M7G A;  2JZY A;  3ZMT A;  5J6X A;  1IRF A;  3ZQ7 A;  1RUN A;  4HF0 A;  2XKP A;  5LRS A;  3EET A;  4U0W A;  5DV5 A;  1J9I A;  1JXS A;  4UNO A;  3QU6 A;  3GVA A;  4AIJ A;  2CWE A;  2K7L A;  3FMQ A;  4WX9 A;  5D8K B;  4IRI A;  1YQA A;  2QEN A;  1E2X A;  3IC7 A;  2NYX A;  2RN7 A;  3HIF A;  3BP8 A;  3FM3 A;  1S6L A;  2JT1 A;  4Q47 A;  5D5W B;  2FSW A;  3KEO A;  5K5R A;  4KFC A;  4LB5 A;  1H9T A;  2IT0 A;  4AIK A;  1UB9 A;  5DEQ A;  1I27 A;  4I2O A;  2W57 A;  3M8E A;  2AXL A;  4MEY F;  1O3T A;  2BE5 F;  1F4K A;  3QU3 A;  4XSZ F;  3DF8 A;  3KP4 A;  1D8J A;  2LF8 A;  3ZMZ A;  2A3S A;  3MQ0 A;  1ZRF A;  2VOO A;  4OIR F;  1B6A A;  2L02 A;  4I7H A;  1MDM A;  1BJA A;  2OD5 A;  4A12 A;  2A6H F;  1AOY A;  4AWX B;  2L4M A;  4KNY A;  5F64 A;  4AIH A;  3LFK A;  4RB3 C;  4LLN A;  4NHJ A;  1RNL A;  2HYF A;  5LGT A;  3IRR A;  3HRS A;  1YFH A;  1KQ8 A;  2GXB A;  5J8F A;  1NHA A;  4LD5 A;  1EH6 A;  4I98 B;  2K86 A;  3V8K A;  1OMI A;  1WRJ A;  2RVC A;  3FXU A;  2W84 A;  4LJZ F;  1YW7 A;  4KIC A;  1USS A;  2KIF A;  1KU9 A;  4N9I A;  5FLX Z;  3GYH X;  2IJL A;  2XV4 S;  2XGX A;  3BJA A;  4EGY A;  2J5O A;  3EYY A;  1Y0U A;  1D8K A;  4A5N A;  3DKW A;  3I53 A;  1P6R A;  2FNA A;  3F21 A;  2GAU A;  3DPL C;  1XD7 A;  1G3W A;  1U2W A;  2VBX A;  3GFL A;  3FXQ A;  1S7O A;  3R6S A;  3GXO A;  1HQC A;  2M5W A;  2XKO A;  1U5T C;  3V4G A;  1SD7 A;  4M9X A;  1XDU A;  4A6D A;  2R7F A;  3TQN A;  2FXA A;  3EUH A;  3BPX A;  3QP5 A;  3V7C A;  4UVA A;  1Z6T A;  3C1D A;  3K9T A;  3HSR A;  1U5T B;  2Y0M A;  4L9T A;  3E3V A;  2G9W A;  1O57 A;  2P7V B;  2HR3 A;  2QVO A;  1ZG3 A;  2X0L A;  1BI3 A;  3R0A A;  3QRF F;  4E70 A;  2LDU A;  2BV6 A;  2CW0 F;  1TNT A;  2O61 A;  2IA0 A;  3QOP A;  4PCQ A;  4P9U A;  2KJB A;  3BJO A;  1MJA A;  4HF1 A;  5ICC A;  1O7L A;  2K4J A;  2VBY A;  2VE9 A;  1BC7 C;  1RI7 A;  3KLN A;  3ELK A;  2J5P A;  1T39 A;  2FEZ A;  4PGH A;  2P4W A;  4P55 A;  2XRO A;  1FBU A;  4LG0 A;  1G6N A;  3JW4 A;  3WTY C;  2CGP A;  5K1Y A;  3RKY A;  1W7P D;  3P9K A;  3W6J B;  3DFG A;  3TOA A;  1UCR A;  3WTW C;  3CUQ A;  1BBY A;  3MCZ A;  1B59 A;  2EA4 A;  2WTE A;  5ICE A;  3K1P A;  3WU0 A;  4EM0 B;  2XVC A;  1OR7 A;  1Q1H A;  4R8H A;  5D8L B;  1WKM A;  3CUQ C;  2ZO4 A;  3F6O A;  3E6B A;  5TRD A;  1R22 A;  4ZZD A;  1TNS A;  4KUM A;  1P4W A;  2D2W A;  1KU2 A;  4L0Z B;  4ESF A;  2L3D A;  3MZY A;  2KKO A;  1H0M A;  1XGS A;  3BY6 A;  3G3Z A;  5E20 A;  5E1Z B;  1KQ0 A;  5HDK A;  1OYI A;  5E8G A;  4GO1 A;  5E8I A;  2VT3 A;  2FRH A;  3DQV C;  2QQ9 A;  4RGX A;  2DK5 A;  1ONV A;  1PP7 U;  3D5L A;  3C7J A;  1ZGA A;  2P5K A;  2EFO A;  1KYZ A;  4A0Z A;  4BXU A;  3DV8 A;  4HV5 A;  2DW4 A;  2MBF A;  2MH2 A;  1SD5 A;  2HQN A;  2VBZ A;  4U88 A;  1DP7 P;  4NB5 A;  2EV6 A;  2H6B A;  3I71 A;  5ICG A;  2PJP A;  1YS7 A;  4M6Y A;  1FSE A;  4B09 A;  5L3C A;  1YW8 A;  4G8X A;  2IA2 A;  4WXD A;  3WGG A;  4ZYD A;  2GZW A;  2EV5 A;  1Z6R A;  1CF7 A;  5L3B A;  1SAX A;  3ECH A;  2YPR A;  1J2X A;  5DCM A;  4BHB A;  4UV9 A;  3ZMD A;  2XHK A;  4UHT A;  3KEQ A;  3IL2 A;  3TKY A;  1TW2 A;  1J75 A;  2ZME A;  4OIO F;  3J81 K;  1B4A A;  3KP6 A;  1P92 A;  5KVR A;  4Q48 A;  2QUF A;  3FZV A;  2ZBK A;  4RB1 A;  3SFZ A;  2STT A;  4MHG A;  1MJB A;  4OOI A;  1BN5 A;  4GYI A;  1ZLJ A;  2OQG A;  3E5Q A;  4L9J A;  1VTN C;  2DPD A;  3WGI A;  4U0V A;  3Q9S A;  5BOX A;  4LK1 F;  1EH8 A;  1ZRD A;  4HF2 A;  1GHC A;  2VC0 A;  2B0L A;  1I1G A;  5DCM B;  3K1M A;  2LSO A;  1FYM A;  5CVI A;  1TBX A;  1OYW A;  4Z2Y A;  3ZN1 A;  2V1D A;  2FQ3 A;  3LAP A;  3GF2 A;  2M30 A;  4JK1 X;  3I59 B;  2BEO A;  1O7F A;  3DEU A;  2ZCW A;  5IT3 A;  4O6J A;  3FMR A;  3O2P E;  4KN7 X;  2RV8 A;  3TO7 A;  5BMZ A;  3N97 A;  2OA4 A;  2KIU A;  3J80 K;  1KYW A;  3ZPL A;  3B73 A;  1XCV A;  4BH9 A;  1IZ1 A;  1K78 A;  4K2E A;  3HYI A;  2G7U A;  4D0P A;  3E6C C;  1YLF A;  4P9F A;  4EMS A;  3D0S A;  2P6S A;  4ZYG A;  3DPT A;  1O3S A;  2PI0 A;  2XAG A;  3CO6 C;  1BI2 A;  1KGS A;  4MGR A;  4S04 A;  1BOA A;  2ZFW A;  3GWZ A;  5LGU A;  2NRA C;  4HYE A;  3BWG A;  5HDG A;  3F8B A;  3T8R A;  1QQI A;  3KP2 A;  5ED4 A;  4MTE A;  3W6K B;  4EM1 A;  5H6R A;  5LHI A;  2VOP A;  1B9M A;  3E5U A;  1EH7 A;  3WTT C;  1R5H A;  3HOS A;  2HDC A;  1ON1 A;  4EJO A;  4ENJ A;  1QZZ A;  4CXF A;  2RNJ A;  3JSP A;  3GZ5 A;  4HX4 A;  2BBY A;  1FPQ A;  1O3R A;  2IPQ X;  4ETS A;  3NQO A;  2M1B A;  4EJU A;  3FF5 A;  4RB2 C;  1UST A;  3I5U A;  1LJ9 A;  1ZN2 A;  3GX4 X;  1TLH B;  1HSJ A;  3LA3 A;  4OMY A;  5TJJ A;  2ETH A;  3LST A;  4KIB A;  5CYV A;  3WTV C;  2D45 A;  3F8C A;  1U8R A;  1XGM A;  1IUY A;  4L5J A;  3IWZ A;  4G6D A;  2VN2 A;  5DCF A;  3J7A O;  2NNY A;  4CZZ A;  1GXP A;  2WC2 A;  1EV7 A;  3P9C A;  1FC3 A;  2FBI A;  2HWV A;  4LGW A;  4L0Y B;  4ZYH A;  3HTU A;  2V1X A;  3L9F A;  2ZKZ A;  3RDI A;  3P7N A;  1S3J A;  5DYM A;  5JR3 A;  4G6Q A;  2K4B A;  3N4M A;  5CVJ A;  2PFB A;  4HA8 A;  2OAZ A;  4IJA A;  3GO5 A;  1J59 A;  3PQJ A;  1YW9 A;  3ROU A;  2OZ6 A;  2VE8 A;  5HS9 A;  3V7S A;  2VOD A;  2QBY A;  4P5O A;  4G7O F;  4OIP F;  4XLN F;  2Z3Y A;  5FGM A;  4BNC A;  2FBH A;  2CSO A;  1IN6 A;  4WF2 A;  4G7H F;  5DDG A;  3MFK A;  3PQK A;  3FXR A;  3JAM Z;  3TOB A;  3MEX A;  3KP5 A;  3JTG A;  3VFZ A;  2L54 A;  3G73 A;  4JBA A;  3CLO A;  3R60 A;  3SXY A;  1MDM B;  2QQA A;  5LGN A;  4UV8 A;  4BQA A;  4UUV A;  5D4R A;  1T38 A;  2GA1 A;  2O0Y A;  4MQ9 F;  3P9I A;  1ZG1 A;  1J7K A;  4R1H A;  3GFI A;  5FFX A;  3COA C;  2DFI A;  3OOP A;  1PDN C;  1TW3 A;  3ABU A;  1UHW A;  3RKX A;  1FBQ A;  3H92 A;  3TO6 A;  4YFN F;  1YO5 C;  2F5F A;  2G7H A;  3GEZ A;  4IHS A;  1SFE A;  1R1U A;  4LLL A;  2ESN A;  3F72 A;  2NNN A;  5ILS A;  4CHU A;  3NRV A;  4KMU X;  4HX8 A;  4M9S A;  4RB0 A;  3SQN A;  2MC3 A;  3TDU C;  1KU7 A;  2P5V A;  5L3D A;  4EJT A;  2PMU A;  2D1V A;  4FX0 A;  4WCG A;  2E1C A;  1IN4 A;  4I0A A;  2EV0 A;  5LLQ A;  4LK0 F;  2YU3 A;  5ILU A;  1YYV A;  1RZ4 A;  5ERI A;  3HRU A;  4CYD A;  1YS6 A;  1HXD A;  1HW2 A;  5HVQ C;  2JPB A;  3VB2 A;  4B8X A;  2HYG D;  1MJ9 A;  4RGS A;  1FT9 A;  4PDK A;  4LB6 B;  4A6E A;  1ODD A;  3WE3 A;  1ZH5 A;  3JSO A;  4QWQ A;  1HKT A;  5D5V B;  1UHM A;  4U7D A;  5E1X A;  4YIF A;  5LRR A;  1FZP B;  3AAF A;  4WXH A;  1HBX G;  3F6V A;  2HTJ A;  4AVP A;  3HRM A;  1HKS A;  1LDD A;  5IT9 Z;  2H94 A;  2MLG A;  1A04 A;  1QNT A;  2O03 A;  3WG9 A;  2JTV A;  2XUB A;  2QZ8 A;  4EVI A;  5HS7 A;  5LHG A;  4MEX F;  3RYP A;  1T2K A;  1FP1 D;  3DXJ F;  1R5G A;  3ZN0 A;  1QO0 D;  3RI4 A;  5HLH A;  1P4A A;  2DQL A;  2PN6 A;  3K0L A;  1CGP A;  4BHC A;  4EV0 A;  5FO5 A;  5HS8 A;  3R0J A;  4ENK A;  1W4M A;  3EDP A;  5FFZ A;  2OU2 A;  1W5T A;  3KET A;  5FD5 A;  4KA4 A;  4LG0 B;  3LA2 A;  1B1B A;  4HV6 A;  1FBS A;  3BZ6 A;  3GZ6 A;  5L3G A;  4WWC A;  3CUQ B;  1XGN A;  1PUE E;  1HKQ A;  1U6G A;  1P4X A;  2VC1 A;  4FHT A;  3CUO A;  2FMY A;  1R58 A;  2P8T A;  1QBJ A;  4MQV A;  3SZT A;  3HHG A;  5H20 A;  2QWW A;  3HSE A;  4UVB A;  3I64 A;  3FX3 A;  2Q2E A;  3RKW A;  2XAF A;  3V7R A;  2FF4 A;  1G3Y A;  1J0R A;  1XGO A;  2IVM A;  4MNU A;  2JPC A;  2TDX A;  5DD8 A;  3GUD A;  4ZH4 F;  4S05 A;  3K1N A;  5HDN A;  2KRF A;  2BYV E;  1KA8 A;  5DUK A;  2HTS A;  5LEK A;  5EEG A;  4IRG A;  2HKX A;  5CVR A;  4RGU A;  2EB7 A;  1JHH A;  3ABT A;  5E18 F;  3F8F A;  3WE2 A;  5K5O A;  1ULY A;  2A6E F;  4G9Y A;  1ZAR A;  2PEX A;  2QLZ A;  3O3K A;  4KIG A;  4ENM A;  5J8C A;  4GGG A;  3HSF A;  3LA7 A;  2EFP A;  3E6D A;  1MZB A;  1ZAO A;  1LDJ A;  3LAJ A;  3H3U A;  4I0B A;  3QPH A;  1O3Q A;  2QM3 A;  3HOT A;  2STW A;  4YG2 F;  1CF7 B;  2D1H A;  3JTH A;  2ZNZ A;  5H6Q A;  4Q5S F;  1LQ1 A;  2XAJ A;  3F22 A;  4KDP A;  1W7P A;  2A68 F;  2F2E A;  1F9N A;  1R1V A;  2DPU A;  5L3F A;  4BYY A;  3PFI A;  2ZME B;  4ON0 A;  4M72 A;  2COM A;  3ZMV A;  1S7A A;  4LFU A;  3NEU A;  1QPM A;  2A69 F;  4N9H A;  3WU1 B;  4FT8 A;  4IVN A;  2BGC A;  1LVA A;  4L9V A;  1XSX A;  2OQR A;  1FX7 A;  1BM9 A;  1JHF A;  4RAZ A;  1UFM A;  2HKO A;  4Y17 A;  1K7A A;  2R3S A;  3ZMU A;  2GWR A;  2VXZ A;  1TQM A;  3L00 A;  1OPC A;  2GA2 A;  1YIO A;  3KCC A;  3RYR A;  3LWF A;  1SMY F;  4ZZL A;  3L2C A;  3QAH A;  5BS6 A;  3IHU A;  4CIC A;  4KT5 C;  2W85 A;  3I4P A;  5AIQ A;  2Q0O A;  3GLX A;  4GXO A;  3B02 A;  3KZZ A;  1IRG A;  2IP2 A;  4IPA A;  1FY7 A;  4M9Z A;  4IHT A;  1TTY A;  4M74 A;  3KE2 A;  2ZNY A;  4DQ2 A;  2QYO A;  4YFK F;  3HRT A;  1K78 B;  2ACJ A;  2L4A A;  1I1S A;  1H9G A;  3VOD A;  2FE3 A;  1F5T A;  4HOB A;  2UWM A;  1ZYR F;  4DNC A;  1RUO A;  3DP7 A;  2K02 A;  3E97 A;  5LEJ A;  2NAZ A;  4HX7 A;  3C3W A;  3KP7 A;  2DAO A;  5F6F A;  3Q5F A;  3MAJ A;  3ML6 A;  4HQM A;  2KIM A;  1U78 A;  3CO7 C;  1DDN A;  3U1D A;  2ISZ A;  4O3M A;  2HS5 A;  1MGT A;  1R23 A;  2P6T A;  3GFJ A;  2JRT A;  2FBK A;  2M45 A;  1XSD A;  1LEA A;  2EJR A;  3SHF A;  1T6S A;  2MD5 A;  1FLI A;  4L18 B;  4HDV A;  2UXN A;  3IWF A;  1S29 A;  2CO5 A;  1D5V A;  2M87 A;  1X3U A;  1Z1D A; 
#chains in the Genus database with same CATH topology
 1Z9C A;  5ICF A;  4PJN A;  5E17 F;  1LFB A;  4PZJ A;  1A35 A;  2O6G E;  2Q8K A;  4Z6Y A;  5HNH A;  3W6V A;  4IQJ A;  3OYL A;  1AWC A;  5EF6 A;  4CZC A;  4ZC3 A;  2PQ8 A;  3K4N A;  4UUT A;  3T8T A;  1VQN I;  1V55 H;  4ESJ A;  2A07 F;  4XRF A;  3BJ6 A;  2ZXJ A;  2O8X A;  3H9G A;  4L9N A;  3WGH A;  3I4M J;  1S9H A;  2XAU A;  1UJ8 A;  3D5R C;  5H2F C;  1K79 A;  2HVQ A;  2X4H A;  5BPI A;  4IEJ A;  2XAS A;  4DGW B;  4N0B A;  3JRB A;  5FLX R;  1FIP A;  3W3C A;  1BIB A;  3ISP A;  3JRG A;  2JJ7 A;  1CQT A;  4Y3O A;  4I6Z A;  2DFE A;  2K27 A;  4BHP A;  2MVT A;  4HLX A;  2XSD C;  2CUZ A;  3HOX J;  2DQR A;  2DTZ A;  2F4I A;  4FCY A;  2DK8 A;  4KMF A;  1R36 A;  1XX5 A;  3GLL A;  4EQQ A;  3WTX C;  3F3X A;  5D6E A;  3CF2 A;  3RQI A;  4XKV A;  2EZH A;  2CYY A;  2FA5 A;  2PJR B;  2F5E A;  2P81 A;  4HNV A;  3OYG A;  2E7W A;  4XOP A;  1P9Q C;  3TDZ C;  3VYT B;  1EF4 A;  2X85 A;  1D5Y A;  1WI9 A;  4B44 A;  1RES A;  4J00 A;  2ZJ2 A;  4CYC A;  1E17 A;  3BR3 A;  3NAR A;  3F23 A;  5GTI C;  1KU3 A;  3CDL A;  4HG2 A;  3G1O A;  4PGG A;  4HQE A;  1G3S A;  2M35 A;  2E34 A;  2GLO A;  5A2Q K;  2GXA A;  2L7K A;  3KYC B;  3M9A A;  4F7Z A;  2O5R A;  4ITV A;  4G6T B;  4XKC A;  4EM2 A;  3HPH A;  4UVC A;  2WBM A;  2EZL A;  3FK6 A;  5JI6 A;  4HNU A;  3CME I;  4UY8 I;  2WV1 A;  4I09 A;  1UAA A;  4HLY A;  2IRF G;  1OQY A;  2GOM A;  2ISY A;  2QBY B;  4P96 A;  1FMV A;  5M3M J;  3MD2 A;  2HPI A;  4FE7 A;  5CLS A;  5FD6 A;  2K40 A;  1AKH A;  4YFX F;  2XRN A;  5HLG A;  3LNQ A;  2UZK A;  2LNB A;  4ABZ A;  5HOO A;  1IF1 A;  3HPG A;  3LSM A;  4XBF A;  1ZRC A;  3F8N A;  1VQ5 I;  1ZGW A;  2DBB A;  1K4T A;  1SC7 A;  1FWZ A;  2CV1 A;  2Y75 A;  4TV7 A;  1R6R A;  3M8F A;  1YIT I;  1YJ9 I;  4XRM A;  2DJI A;  3DTE A;  4BE2 A;  1ZHF A;  2M4G A;  2ZJR F;  1N75 A;  3ZOB A;  2DTR A;  2EWN A;  2YX4 A;  1HDP A;  1HW1 A;  1X4O A;  4RGR A;  3GW2 A;  2MSY A;  2M8E A;  4CYC B;  2JN6 A;  2ZB9 A;  1WQ2 A;  4Q4Z F;  4M3D A;  3IRQ A;  4EGZ A;  1TWF J;  3BCA A;  2FML A;  1T33 A;  1Z91 A;  2IW5 A;  1MD0 A;  3LQQ A;  3AG3 H;  1Y0N A;  2FQ4 A;  1IV6 A;  2RQP A;  3L1P A;  2HNH A;  2Y31 A;  5HLT A;  3IAS 2;  1XC5 A;  2FU4 A;  4F52 A;  1LE8 B;  2PBI A;  3QYE A;  3WTZ A;  1DUX C;  3E0J B;  4CDG A;  2NOJ B;  2W25 A;  2IA1 A;  2ESH A;  1U5T A;  1ORK A;  2LVS A;  3CMA I;  2QSG X;  2Z99 A;  4OMZ A;  1ZRE A;  3K2A A;  2COB A;  5GAG J;  2IGM A;  2FOK A;  3DKY A;  4CGZ A;  3E7L A;  2LF7 A;  2XIG A;  1YX5 A;  2RDP A;  3FXJ A;  2V1U A;  3BRO A;  2JA5 J;  1FYL A;  3TGN A;  2CQK A;  3CJR B;  1KQ9 A;  2ADU A;  5E1W A;  5D4S A;  1DGR M;  2ZXH A;  1OLT A;  1SFX A;  3CCM I;  3CC7 I;  1X3W B;  4ESB A;  4E7H A;  1ZTR A;  4WK8 F;  3IV5 A;  1WWX A;  3CDH A;  5DD4 A;  2EIJ H;  1JKO C;  1SD6 A;  3FIS A;  2ECC A;  2VT2 A;  2YR2 A;  4DBR A;  1LFP A;  2HZT A;  1LPQ A;  4GCV A;  2XAH A;  2VJJ A;  3FKJ A;  4G7Z F;  3K69 A;  1FP2 A;  4FE4 A;  1WSU A;  1X2M A;  1IXS B;  2VJ5 A;  1OYY A;  2WV0 A;  5E79 C;  3OYB A;  3L7W A;  2C6Y A;  4OIQ F;  1W5S A;  3RPQ A;  1X3Z B;  2EBI A;  4M6X A;  5FKL A;  5D6F A;  3KZI C;  2E1N A;  3CCU I;  3BTJ A;  2LD5 A;  2HVS A;  2OJE D;  3R4K A;  1P7I A;  4E7L A;  3TMO A;  3S15 J;  4HSR A;  3M1E A;  3H5R A;  3MMY B;  4ASN A;  3S17 J;  4LLG F;  2DLL A;  2EFW A;  2R4G A;  2HOA A;  4BBR J;  4AC0 A;  2Z9O A;  3I9V 2;  2OV7 A;  2Z5U A;  1JE8 A;  3OR2 C;  4I02 A;  9ANT A;  2P5L C;  3BOQ A;  4DIQ A;  3OYD A;  1XN7 A;  2HEO A;  3MWM A;  4HBL A;  3J81 Z;  2H8R A;  3M4O J;  2R92 J;  4KIF A;  1PVE A;  2PG4 A;  3A0B C;  5D5X B;  2MLK A;  2DU9 A;  1DPU A;  2HDW A;  3ESW B;  4CH7 A;  3NWT A;  2AS5 F;  5K7F A;  3SJM A;  5FLV A;  2CG4 A;  2DA4 A;  2GXG A;  4NQW A;  3V8J A;  4A0Y A;  4KYW A;  4HDU A;  4Y52 J;  1BR2 A;  4BY1 J;  4IQ4 A;  2E2I J;  4C3I J;  1JJ6 C;  1UHS A;  1BI0 A;  1Z3X A;  4IL6 C;  1YE9 A;  1G8X A;  2XGE A;  2MYS A;  2X9D A;  4L5I A;  4XMY A;  1GXQ A;  4H0E A;  2NVX J;  2DA7 A;  3RIR A;  4DYQ A;  2A5Y B;  4S0H B;  1SFO J;  5IOZ A;  2RC4 A;  4RAY A;  2EFN A;  3LQR A;  2F4O B;  2NS0 A;  3KLO A;  3QP6 A;  4Y7N J;  3REO A;  3KZY A;  3K2Z A;  4RS8 A;  4OIN F;  5D5U B;  2V6C A;  3CQZ J;  4V19 K;  4FTH A;  4II2 A;  4HRI A;  4B47 A;  3L09 A;  3T5X A;  2CQQ A;  1T98 A;  2XGD A;  2MH9 A;  2UXX A;  4EJV A;  3BTL A;  1I50 J;  4QLC U;  1ZGJ A;  3W2V A;  3I56 I;  1XCB A;  3H3Z A;  1QU3 A;  1T56 A;  3JAM K;  2EK5 A;  1HOM A;  4F3Q A;  3MZ8 A;  2RKH A;  1LFU P;  1SD4 A;  1K6O A;  4AUX A;  2L5Q A;  3N05 A;  2VI6 A;  2ZXW H;  3SZP A;  3GTJ J;  3J80 Z;  1LNW A;  1WJ5 A;  4QPQ A;  5J1U A;  4ZYE A;  3I0T A;  3RJP A;  4I01 A;  2MW8 A;  1WVR A;  1R1T A;  3LSG A;  2CUF A;  4OU0 A;  3FK7 A;  3OS2 A;  5FLX K;  3FBN B;  1BI1 A;  2DYS H;  3T1B A;  4C9Y A;  3R61 A;  2VON A;  5L3E A;  4ENN A;  4ZDP A;  4XK4 A;  5F0H A;  5F0F A;  3OWT A;  1OCT C;  2FJ1 A;  1K4S A;  2EFQ A;  2DMT A;  2X1D A;  2EIN H;  3E5X A;  2ZSI B;  1TT0 A;  2EPF A;  4EJW A;  5FJ8 J;  3J7A Y;  3FWE A;  1RET A;  6PAX A;  4XOR A;  2CRG A;  1GVJ A;  3FHZ A;  3BQY A;  5K5Q A;  3FDY A;  2V79 A;  3V8L A;  3EPZ A;  1MBE A;  1RRJ A;  1S8N A;  1E3P A;  3FXK A;  5KK1 A;  1L3L A;  3PNV A;  4KIT B;  2XAQ A;  2CS3 A;  2KFD A;  2ZSH B;  1ON2 A;  4QIW N;  3RTR A;  1G59 A;  2DO7 A;  2EQR A;  1XMA A;  3HUG A;  3K4B A;  3L2Q A;  3U1K A;  2E7X A;  2VJI A;  2OZU A;  1R00 A;  4ZYA A;  3L2W A;  2JUG A;  4XN0 A;  5FB2 A;  1QGP A;  2H09 A;  2GM4 A;  4E7K A;  1OFC X;  5EZH A;  1OKR A;  4MTD A;  1F43 A;  1FJL A;  3A01 B;  4A5M A;  1HST A;  3Q9V A;  1T0F A;  2Z33 A;  1T95 A;  1A6Q A;  2A61 A;  3A52 A;  2CQ7 A;  3I58 A;  3FMS A;  2HOE A;  2HFH A;  3DEE A;  2DA2 A;  3S2W A;  3M07 A;  4XIC A;  2FUG 2;  1I6H J;  1LDK B;  1HC8 A;  4RAG A;  1XB4 A;  3C18 A;  5KAI C;  3S3N A;  4HAM A;  2F5C A;  4KN4 X;  1JUP A;  1P2F A;  4A3E J;  1I6X A;  1TWG J;  2F5D A;  1SFU A;  4Y13 A;  3VOE A;  1YG2 A;  3EYI A;  2L01 A;  1XG1 A;  5GP9 A;  2O3F A;  4UUS A;  2FNP A;  1TWH J;  2IGK A;  2MC4 A;  3ECO A;  5LBQ A;  3QYF A;  4GYG A;  1IAW A;  1Z7U A;  2O7O A;  4Y15 A;  3IAM 2;  1BIA A;  2Z16 A;  4FX4 A;  1AHD P;  2H27 A;  1I5Z A;  1J5Y A;  2EIK H;  4YII A;  3E6M A;  5CVU A;  5LHH A;  4IRH A;  1IDY A;  4XID A;  4BBS J;  1NK2 P;  5HLI A;  5EEH A;  1LB2 A;  3I59 A;  1B9N A;  3BR5 A;  1V54 H;  4CCO A;  3ERE D;  3JRC A;  3OSF A;  3HHH A;  1YI2 I;  5IT9 K;  4JX6 A;  1QZY A;  2PMZ N;  4NBQ A;  2ME6 A;  1IW7 F;  1G3T A;  3JR9 A;  3IKV A;  4M73 A;  1ZG5 A;  4IHW A;  1IXC A;  3QPT A;  2DCE A;  3RQ4 A;  1IN7 A;  2X6W A;  2P7C B;  2CFX A;  3RPU A;  5J1Y A;  3MKW B;  3J7A W;  3BR1 A;  2R7V A;  5C3E J;  1D0Y A;  3H1C A;  2W4S A;  4RA2 A;  3WOD F;  5C4J J;  2YSR A;  1BJZ A;  1U0J A;  3K70 C;  1DPR A;  1PP8 F;  1JI8 A;  2V9V A;  5FRM A;  5JVT A;  3CTA A;  1V3F A;  2Q1Z B;  2CFO A;  4XR6 A;  2TCT A;  3CJN A;  3LSR A;  2L9S A;  2XDV A;  1JT6 A;  2GQQ A;  2IS1 A;  5ILV A;  1ZLK A;  4BAY A;  5IY5 H;  1XDS A;  5DUI A;  2PMZ A;  4G94 A;  4XKW A;  4BJ5 C;  3VYS B;  5EG0 B;  2GIV A;  3AFH A;  2HQR A;  4LMY A;  2ZFU A;  2HZD A;  4A0X A;  4U7B A;  2Z1D A;  2MG4 A;  3MZH A;  2XF6 A;  2PLY A;  3I54 A;  1N77 A;  3GTL J;  4NC8 A;  2V9P A;  4B4C A;  1WJE A;  2KJC A;  2WB1 N;  3OV8 A;  3U9G A;  3S1M J;  1W7P B;  2Y9Z A;  2M3A A;  1Z67 A;  1FNN A;  2RGV A;  1L0O C;  3T0Y A;  1YRN A;  1HW5 A;  2V1N A;  1R7J A;  1JTX A;  4XQF A;  1YTY A;  2H6C A;  4M71 A;  2X6X A;  2DI3 A;  4KIS A;  1JGS A;  4U0Y A;  3WTS C;  5JHU A;  1RIO H;  1FOX A;  2IS2 A;  3U2R A;  4WXC A;  3C2B A;  5A2Q Z;  3VEP A;  4R79 A;  3EQL F;  2ZC2 A;  1A31 A;  2QQB A;  1XSV A;  2YX7 A;  3OIO A;  3Q0W A;  4O5V A;  1OCC H;  2EA2 A;  3O6B B;  3HGY A;  3ASO H;  3RSN A;  2IGN A;  4HZF A;  5BQT A;  4XLP F;  2MZ4 A;  4A2U A;  3BDD A;  3BPV A;  3KFW X;  5JFR A;  3WTU C;  1VQO I;  4BXF A;  1SMT A;  2DT5 A;  1G4D A;  1IN5 A;  4RAF A;  5F1R A;  1TQP A;  2R7R A;  4HW0 A;  2WB1 A;  5CJ9 A;  1QHG A;  2XPV A;  2ZXI A;  1FYK A;  1W5C C;  1V4R A;  3KP3 A;  3V42 A;  3KYD B;  2W24 A;  1HDD C;  4JQF A;  1IN8 A;  1UG0 A;  1C0W A;  2DYR H;  4PJJ A;  4CO8 A;  1RC9 A;  1MMN A;  1LEB A;  3FM5 A;  4DYR A;  5AIP A;  2R7D A;  1D3Y A;  1MKM A;  1SAU A;  1REP C;  3RZO J;  2WY7 Q;  5AON A;  4AD9 A;  5IP7 J;  4CUG A;  2LKP A;  1TQI A;  4IF4 A;  1PUF B;  2PMH A;  4UXN A;  2WWY A;  3HTS B;  3ZMS A;  1X19 A;  4N4N B;  1MBG A;  1XMK A;  1Z05 A;  3LL7 A;  3CF5 F;  3GFM A;  1F1Z A;  4XSX F;  2DFH A;  1VQ8 I;  1U9O A;  1FSH A;  2JSC A;  3HOW J;  2R7X A;  3F8M A;  3TO9 A;  2BY2 A;  1IXR C;  2DN0 A;  1H8A C;  2Y48 A;  3SZG A;  1D1C A;  5CVV A;  1GVD A;  3UR3 C;  2ME0 A;  1KON A;  4AM3 A;  1STZ A;  2ELH A;  1BC8 C;  4IXA A;  4L5E A;  1U3E M;  2VBW A;  2OBP A;  2HGC A;  3ULQ B;  1FOK A;  3IKT A;  3CMY A;  2VLA A;  3IH3 A;  3ZP5 A;  1WJC A;  3M8J A;  2WA0 A;  4E7Z A;  5BPD A;  2MA3 A;  3M7G A;  2JZY A;  3L2V A;  1VQK I;  1MMG A;  3ZMT A;  3VYR B;  1IJW C;  4YEL A;  5J6X A;  1IRF A;  5IPA A;  4BGD A;  1VZ0 A;  3ZQ7 A;  1RUN A;  4HF0 A;  2XKP A;  3DPU A;  5LRS A;  3EET A;  2Y2Z A;  4U0W A;  5DV5 A;  1J9I A;  4OAY A;  1JXS A;  4UNO A;  4EAT A;  2GBY A;  3QU6 A;  3S1R J;  1I39 A;  3GVA A;  2OUM A;  2JSP A;  4F91 B;  4AIJ A;  2CWE A;  3PIP F;  2K7L A;  3FMQ A;  3GTP J;  1IRZ A;  4WX9 A;  5D8K B;  4A93 J;  3ZQF A;  3VDX A;  4M3E A;  4IRI A;  3FHN A;  1YQA A;  1ETK A;  2QEN A;  1WJB A;  1E2X A;  3IC7 A;  2NYX A;  2RN7 A;  3HIF A;  2DMU A;  3BP8 A;  3FM3 A;  2A6T A;  1NG6 A;  1WH5 A;  1ZEL A;  3ZCO A;  3ZQC A;  3JAM R;  3PSF A;  3TL4 X;  1S6L A;  2JT1 A;  4Q47 A;  3S32 A;  5D5W B;  1X2N A;  1BW6 A;  4PSW A;  2FSW A;  3PNY A;  1DU6 A;  2H8W A;  3KEO A;  1S72 I;  5K5R A;  3ZQL A;  4KFC A;  4LB5 A;  3ZR8 X;  1H9T A;  2IT0 A;  4AIK A;  2YS9 A;  1Z3Y A;  1JGG A;  5M5W J;  4Y33 A;  1UB9 A;  5DEQ A;  1I27 A;  4I2O A;  4GDF A;  2W57 A;  3W2A A;  2ID6 A;  5L3C A;  3M8E A;  2AXL A;  4MEY F;  1GV5 A;  1O3T A;  2BE5 F;  1F4K A;  3QU3 A;  4XSZ F;  3DF8 A;  3KP4 A;  4BQN A;  4BU2 A;  1U8B A;  3CCY A;  2LF8 A;  1D8J A;  3ZMZ A;  2A3S A;  3MQ0 A;  3GTK J;  1ZRF A;  2VOO A;  4OIR F;  1B6A A;  3ZQH A;  2L02 A;  3WHC A;  4I7H A;  1MDM A;  1BJA A;  1QA6 A;  2OD5 A;  4A12 A;  1B72 B;  3IH4 A;  3H0D A;  2A6H F;  2JUC A;  4ANJ A;  3G6E I;  4XN3 A;  3ZQG A;  1VQM I;  1AOY A;  2E35 A;  4D7M A;  1OJL A;  3D1N I;  4AWX B;  2DOA A;  3CC4 I;  2DA6 A;  2L4M A;  4B3X A;  4KNY A;  3ASN H;  3LSI A;  4YIR X;  3VSL A;  4UB8 C;  1RKT A;  5F64 A;  1MMA A;  4AIH A;  1DU0 A;  2Y0S N;  2NOG A;  2DOE A;  2MAB A;  3LFK A;  3OL4 A;  4RB3 C;  1MBF A;  2WAD A;  4LLN A;  4NHJ A;  1RNL A;  4C2M J;  2KPM A;  4B48 A;  2RRE A;  2HYF A;  4M6V A;  5LGT A;  2VQC A;  3IRR A;  3HRS A;  1YFH A;  1KQ8 A;  2VL8 A;  4DZP A;  3K6G A;  2GXB A;  5J8F A;  4LIT A;  2ZJQ F;  1JJ8 C;  4N4O B;  1NHA A;  4LD5 A;  1EH6 A;  4I98 B;  1TL8 A;  3HOZ J;  3J7Z I;  2K86 A;  4FAS D;  1ACI A;  2KDO A;  3V8K A;  1OMI A;  1WRJ A;  2RVC A;  3FXU A;  2W84 A;  5F0C A;  4LJZ F;  1YW7 A;  4KIC A;  1USS A;  1FEX A;  2KIF A;  1KU9 A;  4N9I A;  5FLX Z;  2RNG A;  1JKP C;  3GYH X;  1J09 A;  2IJL A;  3CCE I;  3WHB A;  2KZG A;  2XV4 S;  4I99 C;  1DP3 A;  2XGX A;  3DBR B;  3S93 A;  3OS1 A;  3BJA A;  3QOD A;  5DM7 F;  3BG3 A;  4EGY A;  2E5N A;  2J5O A;  1X1P A;  3TED A;  1R49 A;  2NVQ J;  3EYY A;  1MSF C;  1Y0U A;  1D8K A;  2LMD A;  3DKW A;  4A5N A;  2QSH X;  1Q1V A;  1WZ2 A;  3I53 A;  2X6O A;  1P6R A;  2KP6 A;  2FNA A;  3F21 A;  3C2G A;  4HST A;  2GAU A;  3DPL C;  1RR8 C;  1IV8 A;  2BXZ A;  3JCU C;  1AKH B;  1XD7 A;  3ZQQ A;  2DFF A;  1G3W A;  2P0T A;  1U2W A;  5IT9 R;  1VND A;  3K4J A;  2VBX A;  2ICW G;  1W36 C;  3GFL A;  2JA6 J;  3FXQ A;  1VQP I;  1S7O A;  4RM3 A;  3R6S A;  3GXO A;  1HQC A;  2M5W A;  2XKO A;  1U5T C;  3V4G A;  1SD7 A;  4M9X A;  5J4Y A;  3AKZ A;  1APL C;  5EYR A;  1XDU A;  4A6D A;  3P5J A;  1RR7 A;  2W82 A;  1Y1V J;  1R71 A;  2R7F A;  2IS4 A;  2NVT J;  4LG3 A;  3TQN A;  3S1Q J;  2FXA A;  3EUH A;  3DTI A;  1G2H A;  5HOD A;  3BPX A;  3QP5 A;  3V7C A;  4UVA A;  3C1D A;  1Z6T A;  1SAN A;  3CMM A;  3K9T A;  1MBJ A;  1GV2 A;  3HSR A;  1U5T B;  2X1C A;  2Y0M A;  3HZJ A;  3AG2 H;  3KX2 A;  4L9T A;  3E3V A;  2G9W A;  2XPW A;  2HDD A;  1O57 A;  2P7V B;  4PJL A;  4BDZ A;  2HR3 A;  4E7S A;  2QVO A;  4IOA F;  3GCM A;  1ZG3 A;  2X0L A;  5KCM A;  1MMS A;  1BI3 A;  3BR6 A;  5B3S H;  1OCZ H;  3G71 I;  3R0A A;  1QVU A;  2R0Q C;  3DEW A;  3QRF F;  1K83 J;  3OYC A;  4E70 A;  2LDU A;  3EUH C;  1S5L C;  2BV6 A;  3HKZ N;  2CW0 F;  1TNT A;  2LTP A;  4M3G A;  2O61 A;  1XMX A;  1R5I D;  2IA0 A;  3QOP A;  1WFX A;  2YUS A;  3VPR A;  3BCB A;  4PCQ A;  3A0H C;  4P9U A;  2KJB A;  3BJO A;  2QGU A;  2K9M A;  1JTY A;  4A3I J;  1MJA A;  1OCO H;  3K4K A;  3OSG A;  4OAZ A;  4HF1 A;  4ZDL A;  5ICC A;  1O7L A;  2K4J A;  2VBY A;  2VE9 A;  4X6A J;  1BC7 C;  1VQ4 I;  4J01 A;  3HDD A;  1TC3 C;  4NC6 A;  1RI7 A;  3KLN A;  4XRS G;  3ELK A;  2J5P A;  4AID A;  4B43 A;  1QHH D;  1T39 A;  3VWB A;  3IH2 A;  2FEZ A;  4PGH A;  2B9S A;  1BW5 A;  2P4W A;  4A3M J;  2VKD A;  4P55 A;  2XRO A;  2R5Z A;  1FBU A;  3TBI A;  3BTC A;  1P7J A;  4LG0 A;  2F4M B;  1G6N A;  4FIS A;  2XRL A;  3JW4 A;  3WTY C;  3K70 D;  4JX5 A;  2CGP A;  5K1Y A;  1IDZ A;  2M4K A;  3RKY A;  1W7P D;  2CV0 A;  3P9K A;  3W6J B;  3DFG A;  3K10 A;  5J47 A;  3TOA A;  1UCR A;  1QPI A;  3WTW C;  3CUQ A;  4XOT A;  3VSK A;  1BBY A;  3MCZ A;  4UB6 C;  3RPU D;  1B59 A;  2EA4 A;  2WTE A;  4NQW B;  5ICE A;  2B63 J;  3K1P A;  3WU0 A;  4EM0 B;  2XVC A;  4DW6 A;  1OR7 A;  1A5J A;  1Q1H A;  4A3L J;  1YJW I;  1ETQ A;  1FTZ A;  2I5U A;  2XSJ C;  5J1R A;  3F0C A;  4R8H A;  5D8L B;  3CZ6 A;  3G1M A;  2CQN A;  2HOT A;  1NH3 A;  1VQL I;  1Y8Q B;  4A69 C;  1WKM A;  3CUQ C;  1IG7 A;  3LSH A;  2ZO4 A;  3F6O A;  3E6B A;  5TRD A;  1R22 A;  2M34 A;  2KRC A;  4XON A;  1UEL B;  4ZZD A;  1MBH A;  1GT0 C;  1TNS A;  4KUM A;  3EUK L;  2BW3 A;  1P4W A;  2D2W A;  1OR7 C;  3CCQ I;  1MH4 A;  1KU2 A;  1FOY A;  4L0Z B;  4ESF A;  2EZK A;  2L3D A;  3MZY A;  4QTR A;  2KKO A;  2BVL A;  1H0M A;  2IAI A;  2D5V A;  1SVL A;  1XGS A;  3BY6 A;  3G3Z A;  5E20 A;  5E1Z B;  1SFK A;  1KQ0 A;  5LD2 C;  5HDK A;  1OYI A;  5E8G A;  4MLO A;  4GO1 A;  3B6C A;  5E8I A;  2JRM A;  2VT3 A;  4XLC A;  2QA4 I;  2FRH A;  1D0Z A;  3DQV C;  5CKT A;  2QQ9 A;  4RGX A;  2DK5 A;  2QEX I;  1ONV A;  2X98 A;  1PP7 U;  2OCE A;  5CPR B;  3D5L A;  3C7J A;  3QPS A;  2XB5 A;  1ZGA A;  2LRE A;  3GTG J;  1B8I A;  2P5K A;  2EFO A;  2KL4 A;  4J19 A;  1KYZ A;  1MBK A;  4A0Z A;  5JVG F;  2VAS A;  4BXU A;  3WG7 H;  4E7I A;  3S2D J;  3DV8 A;  4HV5 A;  2E2J J;  4ZDO A;  2IS6 A;  2DW4 A;  2MBF A;  2MH2 A;  2K85 A;  1SD5 A;  2E1M C;  2HQN A;  2VBZ A;  3OYA A;  4HEA 2;  4U88 A;  1DP7 P;  4NB5 A;  2VKV A;  2EV6 A;  2QKL B;  2H6B A;  2JA8 J;  1X1A A;  2E1O A;  3I71 A;  5ICG A;  5M5Y J;  2JQ7 A;  3CP2 A;  4BY7 J;  3H5A A;  2PJP A;  1YS7 A;  5BNG A;  1RPW A;  4M6Y A;  1FSE A;  3HXL A;  3LSK A;  1YW8 A;  3QYB A;  2IA2 A;  4G8X A;  4B09 A;  5GAE J;  2V4J C;  5IP9 J;  4WXD A;  3S16 J;  2E1M B;  2WAE A;  5F08 A;  3WGG A;  4ZYD A;  2GZW A;  2EV5 A;  4M3F A;  1T0F C;  1Z6R A;  1CF7 A;  1MNE A;  3S3O A;  5L3B A;  5FKK A;  1SAX A;  2H1L A;  3HUG B;  2ZJP F;  3BLY A;  2L9V A;  1FIA A;  3HG9 A;  4DYC A;  3ECH A;  2OTL I;  2YPR A;  1J2X A;  3K4L A;  4PFO A;  4RBO A;  5DCM A;  4BHB A;  2FD5 A;  4UV9 A;  3ZMD A;  2XHK A;  4UHT A;  5FRN A;  5JHF A;  3KEQ A;  3IL2 A;  4E7J A;  3TKY A;  1TW2 A;  3PFY A;  1J75 A;  2QCO A;  5FKM A;  2ZME A;  4BE0 A;  2H1K A;  2FOW A;  4RLQ A;  4OIO F;  3J81 K;  1B4A A;  2LBF A;  2L7Z A;  3OYI A;  3KP6 A;  1P92 A;  3TP3 A;  1LUJ B;  5KVR A;  4Q48 A;  2QUF A;  3C2H A;  1WJF A;  3FZV A;  2ZBK A;  3FBI B;  4RB1 A;  3H35 A;  4P1W A;  2IXS A;  3SFZ A;  4BJT A;  2STT A;  4MHG A;  4KJZ A;  1MJB A;  1YHQ I;  2E2H J;  4OOI A;  1BN5 A;  2TRT A;  4GYI A;  1ZLJ A;  3PUB A;  2OQG A;  3E5Q A;  2NVY J;  4L9J A;  1VTN C;  2DPD A;  3AL0 C;  3WGI A;  3PJR A;  4U0V A;  3Q9S A;  5BOX A;  4LIV A;  2IBD A;  4LK1 F;  1EH8 A;  1ZRD A;  4HF2 A;  1GHC A;  2LR8 A;  2VC0 A;  3HBL A;  2B0L A;  1I1G A;  4CCM A;  3D5S C;  4UUS B;  5DCM B;  3K1M A;  2JVH A;  2LSO A;  1FYM A;  2BZT A;  5CVI A;  3I3L A;  1LVK A;  1V5E A;  3AL0 B;  1TBX A;  1OYW A;  4Z2Y A;  3TP0 A;  4RDU A;  3SYT A;  3ZN1 A;  2LKS A;  2V1D A;  2FQ3 A;  3LAP A;  3OYE A;  1ETY A;  2WAQ N;  3GF2 A;  2M30 A;  4JK1 X;  3I59 B;  1WGX A;  2HVR A;  2BEO A;  2E5Z A;  5IP6 A;  3OYK A;  2M0M A;  1O7F A;  2L2O A;  1NTC A;  3DEU A;  1MH3 A;  2ZCW A;  3MKZ A;  5IT3 A;  1HLV A;  4O6J A;  3SEQ A;  4M3B A;  2HPM A;  3FMR A;  3O2P E;  4KN7 X;  2RV8 A;  3TO7 A;  5BMZ A;  4JOM A;  4XKB A;  3N97 A;  2OA4 A;  2KIU A;  2R5Y A;  3J80 K;  1KYW A;  5KNL A;  3ZPL A;  2CH0 A;  3B73 A;  3BTI A;  1XCV A;  3BZC A;  2BXY A;  4BH9 A;  2HU9 A;  1NK3 P;  1IZ1 A;  3KEY A;  1ETV A;  5J40 A;  1YX3 A;  1AA7 A;  4K2E A;  1K78 A;  3HYI A;  2WAQ A;  5DS9 A;  2HYJ A;  2G7U A;  3OYM A;  3DWL E;  4D0P A;  3TW7 A;  3E6C C;  1YLF A;  4P9F A;  4EMS A;  3D0S A;  2BOL A;  2P6S A;  5B66 C;  4ZYG A;  3MKY B;  4II3 A;  2ELK A;  1A6I A;  2HQ5 A;  3DPT A;  1O3S A;  2PI0 A;  2QF7 A;  2AHQ A;  2XAG A;  2AQF A;  3CO6 C;  1BI2 A;  4MFD A;  1KGS A;  3GBG A;  5B1A H;  5K7H A;  4OWR B;  2L7M P;  1ZR2 A;  2DOD A;  3OYN A;  3CCJ I;  2LY9 A;  3DLA A;  4MGR A;  3OIP A;  1YRN B;  4S04 A;  1BOA A;  2ZFW A;  3GWZ A;  5LGU A;  2Z2S B;  2KZV A;  2NRA C;  3S2H J;  4HYE A;  3BWG A;  5HDG A;  4A3G J;  3F8B A;  3RCO A;  3UNG C;  3T8R A;  1QQI A;  3KP2 A;  2VIX A;  5ED4 A;  2XC7 A;  3DLL F;  4MTE A;  3W6K B;  4EM1 A;  2JVG A;  5H6R A;  5LHI A;  2VOP A;  1B9M A;  1ETO A;  3E5U A;  4PK4 A;  2LH9 A;  1OCR H;  1EH7 A;  4YEJ A;  3WTT C;  1R5H A;  2F5V A;  3HOS A;  1AU7 A;  2HDC A;  1ON1 A;  1X4P A;  4EJO A;  2L9N A;  4GFB A;  4ENJ A;  1QZZ A;  5F27 A;  3WU2 C;  4F92 B;  1N25 A;  2CW8 A;  2RNJ A;  3G2B A;  3GZ5 A;  2QSF X;  4HX4 A;  3JSP A;  2BBY A;  1FPQ A;  3Q3S A;  3W2W A;  1O3R A;  2IPQ X;  3GME A;  3PM1 A;  3SDG A;  3I55 I;  1W36 D;  4XM3 A;  2HXI A;  2R7W A;  3IP4 B;  4XNF A;  1ENH A;  4ETS A;  3NQO A;  3U21 A;  1MSE C;  2M1B A;  4EJU A;  3FF5 A;  4FQG A;  4B3A A;  1YIJ I;  1Y39 A;  4RB2 C;  2LFB A;  1H89 C;  1UST A;  3I5U A;  4IKF A;  4A3K J;  1LJ9 A;  5FRO A;  3FXL A;  2DT6 A;  1N78 A;  1ZN2 A;  4YRV A;  2DJN A;  3GX4 X;  1TLH B;  1HSJ A;  2E60 A;  3LA3 A;  3SFI A;  4OMY A;  5TJJ A;  2KIS A;  2ETH A;  3LST A;  4KIB A;  5CYV A;  3WTV C;  2D45 A;  4NNJ A;  3F8C A;  2LKX A;  4KT6 A;  3BQZ A;  1U8R A;  2LG4 A;  1XGM A;  1IUY A;  4L5J A;  1IUF A;  2JA7 J;  5GPA A;  2P0W A;  3BG7 A;  2VUM J;  3IWZ A;  2W48 A;  4G6D A;  4XRS A;  2VN2 A;  1GLN A;  5DCF A;  4IX7 A;  5GTH C;  3J7A O;  2NNY A;  4CZZ A;  2LLK A;  1WJA A;  1GXP A;  3QWL A;  2WC2 A;  1EV7 A;  3P9C A;  2PJR A;  1FC3 A;  2Y30 A;  3RZD J;  3BR2 A;  1IRX A;  2FBI A;  2HWV A;  1QZE A;  2LYC A;  4LGW A;  4L0Y B;  2DA5 A;  4CXF A;  4ZYH A;  3HTU A;  3NAU A;  4IHX A;  2V1X A;  3L9F A;  2ZKZ A;  3RDI A;  2X51 A;  1W0U A;  3P7N A;  1FMW A;  2MUN A;  3PNT A;  1S3J A;  5DYM A;  3O8G A;  5JR3 A;  4G6Q A;  2RAE A;  4XLE A;  2K4B A;  2K5C A;  2DA3 A;  1E0E A;  5HNF A;  3N4M A;  1HF0 A;  5CVJ A;  2PFB A;  4D1Q A;  4HA8 A;  2ELJ A;  1ETX A;  2OAZ A;  2CV2 A;  4IJA A;  5IOY A;  3JRE A;  3GO5 A;  1J59 A;  3PQJ A;  3SEZ A;  1YW9 A;  3ROU A;  2OZ6 A;  2VE8 A;  5HS9 A;  3V7S A;  2VOD A;  1TP4 A;  2QBY A;  4P5O A;  3OL3 A;  3BR0 A;  2E71 A;  4G7O F;  2VKE A;  4OIP F;  2DA1 A;  4XLN F;  2Y9Y A;  2Z3Y A;  5FGM A;  4BNC A;  2FBH A;  4CSW A;  4DOZ A;  2CSO A;  4RM2 A;  1IN6 A;  4C30 A;  4BAC A;  4V2G A;  4WF2 A;  1SVO A;  1X1B A;  5M5X J;  4G7H F;  1IO2 A;  1EA3 A;  3H3V K;  2PX9 A;  2E36 A;  5DDG A;  2K9L A;  1TT5 B;  3MFK A;  3PQK A;  1UG2 A;  4X0G A;  3FXR A;  3JAM Z;  4ZTF A;  3OIQ A;  4B1R A;  1ZK8 A;  3TOB A;  2A05 A;  1OIS A;  3OS0 A;  2JK3 A;  3IUO A;  3KP5 A;  3MEX A;  3JTG A;  3VFZ A;  2L54 A;  2R7O A;  2DMN A;  3K7A J;  3G73 A;  4JBA A;  3CLO A;  3QOE A;  3R60 A;  3SXY A;  1IGN A;  1MDM B;  2QQA A;  2KQR A;  2R7U A;  3OR1 C;  5LGN A;  4UV8 A;  1LE8 A;  4BQA A;  4UUV A;  2VJ4 A;  5D4R A;  1T38 A;  1D1B A;  1RKW A;  2GA1 A;  3OYF A;  2O0Y A;  1R4M B;  4MQ9 F;  2Y0S A;  3P9I A;  3JRD A;  1ZG1 A;  3O8H A;  1J7K A;  3ABM H;  4R1H A;  3SDB A;  3GFI A;  3DKX A;  4PJ0 C;  5FFX A;  2DFI A;  3COA C;  1XS9 A;  3CC2 I;  3OOP A;  1PDN C;  2DOF A;  3DTK A;  1TW3 A;  3ABU A;  4A3B J;  1UHW A;  3RKX A;  1FBQ A;  1I3Q J;  3H92 A;  1WHU A;  3TO6 A;  4YFN F;  1YO5 C;  2F5F A;  2G7H A;  3GEZ A;  2KT0 A;  4IHS A;  1SFE A;  3ONQ A;  1R1U A;  3EUA A;  2BY3 A;  5KAF C;  4LLL A;  3HM5 A;  1MND A;  2ESN A;  2JWT A;  3F72 A;  2NNN A;  5ILS A;  2CUJ A;  4AVZ A;  4CHU A;  4XL9 A;  3NRV A;  4KMU X;  4HX8 A;  3S1N J;  4M9S A;  4RB0 A;  1S7E A;  3PO3 J;  4H4K C;  2GOX B;  3SQN A;  2UUZ A;  5IYD J;  2MC3 A;  3J81 R;  3TDU C;  1KU7 A;  2F48 A;  2P5V A;  4NDL A;  5J4V A;  5L3D A;  4EJT A;  2PMU A;  4I76 A;  3OY9 A;  1ERD A;  1BR1 A;  2D1V A;  4FX0 A;  4WCG A;  1FTT A;  3CJT B;  2E1C A;  1IN4 A;  3L2U A;  4I0A A;  3H36 A;  2V6E A;  2EV0 A;  5LLQ A;  5E3M A;  4LK0 F;  1WI3 A;  2YU3 A;  2M7B A;  4EEF G;  4A3D J;  5ILU A;  3BZK A;  5IYB J;  1YYV A;  2CMP A;  1MW7 A;  2EZI A;  2R93 J;  3MVP A;  4C3J J;  1RZ4 A;  2HXO A;  3ABL H;  5ERI A;  2CW7 A;  3HRU A;  4CYD A;  3HOV J;  1YS6 A;  2VQG A;  1HXD A;  1HW2 A;  2HOS A;  2R7Z J;  4AYB N;  5HVQ C;  2JPB A;  3VB2 A;  4B8X A;  3A1Y A;  3PUF A;  2HYG D;  3X2Q H;  1MJ9 A;  4RGS A;  1JT0 A;  3A02 A;  2OF7 A;  1Y1W J;  2EIL H;  2X1E A;  1TWC J;  1FT9 A;  3OYH A;  3HEF A;  4PDK A;  4LB6 B;  4A6E A;  5K7Z A;  1IC8 A;  2R7T A;  1ODD A;  3M3Y J;  1V5G A;  3WE3 A;  1DGW Y;  1ZH5 A;  3JSO A;  3DBL B;  4QWQ A;  1SEU A;  5JLX A;  3OYJ A;  2BVM A;  4A3F J;  1HKT A;  2OPT A;  5D5V B;  3JRF A;  1UHM A;  4U7D A;  5E1X A;  4YIF A;  5LRR A;  1FZP B;  1Z77 A;  3AAF A;  4WXH A;  4IZZ A;  2HI3 A;  3LMM A;  3F6V A;  2HTJ A;  1HBX G;  2OC6 A;  4NUB A;  1WH7 A;  3J80 R;  4AVP A;  1YOV B;  4AYB A;  4XLA A;  3HRM A;  2GIZ A;  3S14 J;  1E3O C;  2M9H A;  1HKS A;  2QKM B;  2EIM H;  1LDD A;  1W0T A;  5IT9 Z;  2CU7 A;  1VF9 A;  2H94 A;  3CCL I;  2MLG A;  1I3A A;  1UMQ A;  1WJD A;  1A36 A;  4JX4 A;  2UV1 A;  2W7N A;  3J7Y J;  4PUS A;  3HKZ A;  4FET A;  1A04 A;  1QNT A;  2O03 A;  3S8P A;  3WG9 A;  2JTV A;  3DBH B;  3HB9 A;  1KZH A;  5F1J A;  1Y56 A;  3KYL A;  1ETW A;  3A2K A;  2K9Q A;  2V7F A;  2XPU A;  1X1C A;  2XUB A;  3UKG A;  1Z7L A;  4QSH A;  4PSX A;  2QZ8 A;  3KIO A;  2OTJ I;  3AG1 H;  4EVI A;  4JYK A;  3FIW A;  5HS7 A;  5LHG A;  4MEX F;  3RYP A;  1TZL A;  1T2K A;  4D9J A;  2K3F A;  1FP1 D;  1SVM A;  1Z0X A;  3DXJ F;  1R5G A;  3H9J A;  2X6Y A;  4U87 A;  2DXI A;  3ZN0 A;  1QO0 D;  3RI4 A;  5HLH A;  1V5F A;  3PO2 J;  1P4A A;  2DQL A;  3FKI J;  4A3J J;  2PN6 A;  1NG7 A;  3K0L A;  1CGP A;  3FXO A;  4BHC A;  4EV0 A;  5FO5 A;  5GAD J;  5HS8 A;  3R0J A;  2CJJ A;  3A4C A;  4ENK A;  1W4M A;  5E3O A;  2VKH A;  3EDP A;  5GAH J;  5F04 A;  5FFZ A;  1U9N A;  1W5T A;  2OU2 A;  4CCN A;  4D5C A;  3KET A;  2R5Z B;  1X58 A;  5FD5 A;  4KA4 A;  2VPL A;  3HC7 A;  4LG0 B;  3LA2 A;  2DDA A;  1B1B A;  1VQ9 I;  4HV6 A;  2IGO A;  1FBS A;  3ZRG A;  3FXM A;  3LOC A;  5FLM J;  3BZ6 A;  2K3P A;  3VYU B;  3GZ6 A;  1EJ9 A;  5L3G A;  4WWC A;  2ECB A;  1Z21 A;  4C2T A;  2WAF A;  2KLO A;  3CUQ B;  3F9K A;  3H0G J;  1VQ6 I;  1XGN A;  2KMU A;  1PJR A;  2VXD A;  4BJ6 C;  1PUE E;  5CQG A;  1BOB A;  1HKQ A;  1U6G A;  5DM6 F;  4W97 A;  1OCP A;  2G0E A;  1P4X A;  1POG A;  2VC1 A;  4FHT A;  3H5N A;  3QQA A;  3A01 A;  1LKX A;  3CUO A;  1ITY A;  2M8G X;  2FMY A;  1R58 A;  2M7A A;  2P8T A;  2I8D A;  3B6A A;  1ZKG A;  1QBJ A;  4MQV A;  3SZT A;  3AG4 H;  1D1A A;  3E1S A;  4IOC F;  1WCM J;  2FX0 A;  4MO7 A;  5B1B H;  3HHG A;  5H20 A;  2QWW A;  3HSE A;  2ID3 A;  3I4N J;  2K9S A;  4UVB A;  3I64 A;  2NS7 A;  3K4M A;  2BW3 B;  4F55 A;  1VQ7 I;  2CUE A;  1UZC A;  4LIU A;  3FX3 A;  2Q2E A;  3RKW A;  2XAF A;  4CCK A;  3V7R A;  2FF4 A;  3CDI A;  1G3Y A;  2MD0 A;  4BXX J;  1J0R A;  2LY2 A;  3M1C A;  3ZXS A;  1XGO A;  2DT7 B;  2IVM A;  4MNU A;  2JPC A;  3BG9 A;  2V9K A;  3DU6 A;  5IYC J;  2OCC H;  2TDX A;  4CA0 A;  5DD8 A;  3GZN B;  3GUD A;  4ZH4 F;  4S05 A;  3K1N A;  4DBQ A;  5HDN A;  1GUU A;  4W1U A;  3Q0U A;  3ERM A;  2KRF A;  1GDT A;  2BYV E;  1ZQ3 P;  1KA8 A;  2W1O A;  5DUK A;  2HTS A;  3ABK H;  5LEK A;  5EEG A;  4IRG A;  4RMN A;  4BDY A;  2HKX A;  1B8I B;  4HNT A;  5CVR A;  2DMQ A;  4RGU A;  2EB7 A;  4XLH A;  1YJN I;  1JHH A;  3BT9 A;  4DZJ A;  5KHD A;  2RQQ A;  4QPO A;  3L2R A;  3ABT A;  1QVT A;  5E18 F;  1VFC A;  5DTD A;  3CJQ B;  3F8F A;  3WE2 A;  5K5O A;  1JKQ C;  2KHM A;  1TWA J;  2LP0 A;  1ULY A;  1HA8 A;  2A6E F;  2Q2E B;  4G9Y A;  1ZAR A;  4C3H J;  2PEX A;  2QLZ A;  3DU5 A;  3O3K A;  1XPX A;  4KIG A;  5J8C A;  2EH3 A;  2VB6 A;  4GGG A;  3G4S I;  4ENM A;  2MFZ A;  3HSF A;  3LA7 A;  4CCL A;  2KDZ A;  1M1E B;  2EFP A;  2Y69 H;  3E6D A;  1MZB A;  2JA2 A;  1ZAO A;  1LDJ A;  3LAJ A;  5EDN A;  5A2Q R;  4MIM A;  5EG0 A;  3KPH A;  3H3U A;  2I10 A;  4I0B A;  3QPH A;  3HJE A;  2QM3 A;  1O3Q A;  3HOT A;  2STW A;  4YG2 F;  3MN2 A;  2NVU B;  2BHZ A;  2ZME C;  1CF7 B;  3TW6 A;  2D1H A;  3JTH A;  2ZNZ A;  5H6Q A;  4Q5S F;  1LQ1 A;  2XAJ A;  2QQ8 A;  3F22 A;  4KDP A;  1W7P A;  2A68 F;  2F2E A;  1F9N A;  1R1V A;  1FOW A;  2DPU A;  3CCR I;  5L3F A;  2XF5 A;  3H9Q A;  4BYY A;  2NXN B;  4D7N A;  2VQH A;  4PFP A;  3HOY J;  3GTO J;  2O8K A;  2VQL A;  3PFI A;  2LY1 A;  4IHV A;  2LRD A;  2AQE A;  1RQ6 A;  2KRH A;  2R7Q A;  5FKN A;  2ZME B;  4ON0 A;  1O4X A;  4GRI A;  3JRI A;  4M72 A;  2COM A;  2LBF B;  3OOU A;  5C4X J;  3ZMV A;  1S7A A;  4LFU A;  3NEU A;  1K6Y A;  4BQO A;  1QPM A;  1W1W E;  2A69 F;  3BG5 A;  3PIO F;  3G1L A;  4N9H A;  2W00 A;  3WU1 B;  1PYV A;  5E3L A;  4FT8 A;  2AO9 A;  4IVN A;  4DJA A;  2BGC A;  1WPK A;  5GPC A;  1LVA A;  4L9V A;  1XSX A;  2R7S A;  2OQR A;  1FX7 A;  5B5E C;  1BM9 A;  3PSI A;  1JHF A;  4NC7 A;  4RAZ A;  4HPQ A;  5C44 J;  4E6K G;  3LSJ A;  1UFM A;  2HKO A;  3HL2 A;  2E19 A;  4Y17 A;  2M0C A;  2R3S A;  1K7A A;  1XTA A;  3ZMU A;  2GWR A;  2BY0 A;  1JUS A;  2VXZ A;  3CP8 A;  3HGG A;  3CES A;  3BC8 A;  2L7F P;  1Y6I A;  1TQM A;  4MFE A;  5M3F J;  2L0K A;  3L00 A;  1MMD A;  1OPC A;  3PL8 A;  2GA2 A;  1YIO A;  3KCC A;  3RYR A;  1BA5 A;  1T8I A;  3GTQ J;  3LWF A;  1PUF A;  1D0X A;  1SMY F;  5E3N A;  4E4H A;  4ZZL A;  3JRA A;  3L2C A;  3A03 A;  2XB0 X;  2V26 A;  3QAH A;  1T08 B;  2DDB A;  5BS6 A;  3IHU A;  1HCR A;  4CIC A;  4KT5 C;  4BL0 B;  2W85 A;  4IO9 F;  1R9T J;  1MIJ A;  4X1E A;  3I4P A;  5AIQ A;  2Q0O A;  3GLX A;  4F93 B;  4GXO A;  3LSP A;  3B02 A;  3KZZ A;  5EZG A;  1JKR C;  1E3H A;  1IRG A;  2IP2 A;  2AXT C;  4BEH A;  2LOO A;  3NWS A;  4LOC A;  5FKO A;  4IPA A;  2CQX A;  3Q0V A;  1FY7 A;  2X48 A;  5LFA A;  3LFU A;  4M9Z A;  4IHT A;  4G12 A;  3ZGK A;  1TTY A;  2BY1 A;  3OMY A;  2R5Y B;  3HOU J;  4M74 A;  5EJC A;  2WY8 Q;  1QRY A;  3KE2 A;  3GTM J;  2ZNY A;  4DQ2 A;  3CLQ A;  2QYO A;  4YFK F;  3HRT A;  1K78 B;  4CCJ A;  2ACJ A;  2O9L A;  3ZQI A;  1MNM C;  2L4A A;  2LC2 A;  4RLF A;  5TGT A;  4BUP A;  1I1S A;  1H9G A;  5JLW A;  3VOD A;  2FE3 A;  2B7E A;  1K61 A;  4HOB A;  1BL0 A;  2L9R A;  1F5T A;  3CD6 I;  2UWM A;  2IEK A;  1ZYR F;  4DNC A;  5EGO A;  2MGQ A;  4D5F A;  1R4N B;  3K4C A;  4IHY A;  2YU9 J;  3BG6 A;  1RUO A;  3DP7 A;  1ZR4 A;  1VI0 A;  4A3C J;  4AU7 A;  2K02 A;  3E97 A;  2A5W A;  5LEJ A;  2NAZ A;  2JMW A;  4V2F A;  4BS9 A;  4BEH B;  1DQU A;  1F36 A;  1Y8R B;  5EEA A;  2XF7 A;  4HX7 A;  3JRH A;  3C3W A;  2K9N A;  3KP7 A;  2DAO A;  1BR4 A;  1X1D A;  5F6F A;  4BE1 A;  3Q5F A;  3S3M A;  3MAJ A;  4ZTJ A;  3ML6 A;  4HQM A;  2NS8 A;  3CCS I;  2KIM A;  4BKX A;  1U78 A;  2M2E A;  4BQQ A;  1H88 C;  3CO7 C;  1DDN A;  3MKL A;  2F6C A;  3U1D A;  4Y4R A;  2VPR A;  2ISZ A;  4O3M A;  2HS5 A;  1MGT A;  2KIQ A;  1R23 A;  2P6T A;  3GFJ A;  4ZJZ A;  2JRT A;  4JP0 A;  5J3L A;  2N8G A;  2FBK A;  2M45 A;  1XSD A;  2XGC A;  1LEA A;  5CQE A;  2HQA A;  5EGO B;  2DMP A;  2EJR A;  3QPL A;  3CCV I;  3SHF A;  1T6S A;  2MD5 A;  1FLI A;  4C2U A;  4L18 B;  4HDV A;  2UXN A;  4XLF A;  3IWF A;  4PJM A;  2BHY A;  1B72 A;  1S29 A;  2CO5 A;  2LK2 A;  1D5V A;  3DCF A;  5TIS C;  1JUM A;  1EKE A;  2M87 A;  1X3U A;  3RKQ A;  1Z1D A; 
#chains in the Genus database with same CATH homology
 1Z9C A;  5ICF A;  5E17 F;  4PZJ A;  2O6G E;  2Q8K A;  1AWC A;  3T8T A;  2PQ8 A;  2A07 F;  4ESJ A;  4XRF A;  3BJ6 A;  2ZXJ A;  2O8X A;  4L9N A;  3WGH A;  1K79 A;  2X4H A;  5BPI A;  2XAS A;  4N0B A;  1BIB A;  3ISP A;  2K27 A;  4BHP A;  4HLX A;  2DQR A;  2DK8 A;  4KMF A;  1R36 A;  4EQQ A;  3WTX C;  3F3X A;  5D6E A;  2CYY A;  2FA5 A;  2F5E A;  2E7W A;  3TDZ C;  1WI9 A;  2ZJ2 A;  1E17 A;  3F23 A;  1KU3 A;  4PGG A;  4HQE A;  1G3S A;  5A2Q K;  3M9A A;  4F7Z A;  4EM2 A;  4UVC A;  5JI6 A;  4I09 A;  4HLY A;  2IRF G;  2ISY A;  2QBY B;  4P96 A;  5CLS A;  5FD6 A;  4YFX F;  2XRN A;  5HLG A;  2UZK A;  2LNB A;  5HOO A;  1IF1 A;  4XBF A;  1ZRC A;  3F8N A;  2DBB A;  1FWZ A;  2Y75 A;  4TV7 A;  3M8F A;  1ZHF A;  2DTR A;  2EWN A;  2YX4 A;  1HW1 A;  4RGR A;  3GW2 A;  2M8E A;  3IRQ A;  1WQ2 A;  4Q4Z F;  4EGZ A;  2FML A;  1Z91 A;  3LQQ A;  2IW5 A;  1MD0 A;  2RQP A;  2FU4 A;  2PBI A;  3WTZ A;  1DUX C;  4CDG A;  2W25 A;  2IA1 A;  2ESH A;  1U5T A;  2Z99 A;  4OMZ A;  1ZRE A;  4CGZ A;  2FOK A;  2LF7 A;  2XIG A;  2RDP A;  2V1U A;  3BRO A;  1FYL A;  3TGN A;  2CQK A;  1KQ9 A;  2ADU A;  5E1W A;  5D4S A;  1SFX A;  4ESB A;  4WK8 F;  1WWX A;  3CDH A;  5DD4 A;  1SD6 A;  2VT2 A;  2YR2 A;  2HZT A;  4GCV A;  2XAH A;  4G7Z F;  3K69 A;  1FP2 A;  1WSU A;  1IXS B;  1OYY A;  2WV0 A;  3L7W A;  2C6Y A;  4OIQ F;  1W5S A;  3RPQ A;  4M6X A;  5D6F A;  2E1N A;  3R4K A;  3M1E A;  4ASN A;  4LLG F;  2DLL A;  2EFW A;  2Z9O A;  2Z5U A;  1JE8 A;  4I02 A;  2P5L C;  3BOQ A;  1XN7 A;  2HEO A;  3MWM A;  4HBL A;  3J81 Z;  4KIF A;  2PG4 A;  5D5X B;  2MLK A;  2DU9 A;  1DPU A;  2AS5 F;  2CG4 A;  2GXG A;  4NQW A;  3V8J A;  4A0Y A;  4KYW A;  4HDU A;  1BI0 A;  4L5I A;  1GXQ A;  4H0E A;  3RIR A;  2A5Y B;  2RC4 A;  4RAY A;  2EFN A;  3LQR A;  2NS0 A;  3QP6 A;  3KLO A;  3REO A;  3KZY A;  3K2Z A;  4RS8 A;  4OIN F;  5D5U B;  2V6C A;  3L09 A;  3T5X A;  1T98 A;  2MH9 A;  2UXX A;  4EJV A;  4QLC U;  1ZGJ A;  1XCB A;  3H3Z A;  3JAM K;  2EK5 A;  2RKH A;  1SD4 A;  1K6O A;  3SZP A;  3J80 Z;  1LNW A;  4ZYE A;  3I0T A;  3RJP A;  4I01 A;  1R1T A;  4OU0 A;  5FLX K;  1BI1 A;  3T1B A;  3R61 A;  2VON A;  5L3E A;  4ENN A;  2EFQ A;  3E5X A;  4EJW A;  3FWE A;  6PAX A;  1GVJ A;  3FHZ A;  5K5Q A;  2V79 A;  3V8L A;  1S8N A;  5KK1 A;  1L3L A;  2XAQ A;  1ON2 A;  3RTR A;  2DO7 A;  1XMA A;  3HUG A;  2E7X A;  2OZU A;  1R00 A;  5FB2 A;  1QGP A;  2H09 A;  1OKR A;  4MTD A;  4A5M A;  1HST A;  3Q9V A;  1T0F A;  2Z33 A;  2A61 A;  3I58 A;  3FMS A;  2HOE A;  2HFH A;  3S2W A;  1LDK B;  1XB4 A;  3C18 A;  4HAM A;  2F5C A;  4KN4 X;  1P2F A;  1I6X A;  2F5D A;  1SFU A;  4Y13 A;  3VOE A;  1YG2 A;  3EYI A;  2L01 A;  2O3F A;  2FNP A;  3ECO A;  5LBQ A;  4GYG A;  1IAW A;  1Z7U A;  4Y15 A;  2H27 A;  1BIA A;  4FX4 A;  1I5Z A;  5LHH A;  1J5Y A;  4YII A;  3E6M A;  5CVU A;  4IRH A;  5HLI A;  5EEH A;  1LB2 A;  3I59 A;  1B9N A;  3ERE D;  5IT9 K;  3HHH A;  1QZY A;  1IW7 F;  1G3T A;  3IKV A;  4M73 A;  1ZG5 A;  1IXC A;  3QPT A;  1IN7 A;  2P7C B;  2CFX A;  3RPU A;  3WOD F;  2YSR A;  1DPR A;  1PP8 F;  2V9V A;  5JVT A;  3CTA A;  1V3F A;  3CJN A;  2GQQ A;  5ILV A;  1ZLK A;  4BAY A;  1XDS A;  5DUI A;  4G94 A;  2GIV A;  2HQR A;  4LMY A;  4A0X A;  4U7B A;  3MZH A;  2PLY A;  3I54 A;  2KJC A;  3OV8 A;  3U9G A;  1W7P B;  1FNN A;  2RGV A;  1L0O C;  3T0Y A;  1HW5 A;  1R7J A;  1YTY A;  2H6C A;  4M71 A;  2DI3 A;  1JGS A;  4U0Y A;  3WTS C;  5JHU A;  1RIO H;  3U2R A;  4WXC A;  5A2Q Z;  3VEP A;  4R79 A;  3EQL F;  2QQB A;  1XSV A;  2YX7 A;  4O5V A;  2EA2 A;  3O6B B;  4HZF A;  5BQT A;  4XLP F;  4A2U A;  3BDD A;  3BPV A;  3KFW X;  5JFR A;  3WTU C;  1SMT A;  2DT5 A;  1G4D A;  1IN5 A;  5F1R A;  1TQP A;  4HW0 A;  5CJ9 A;  1FYK A;  1V4R A;  3KP3 A;  2W24 A;  4JQF A;  1IN8 A;  1C0W A;  4CO8 A;  1LEB A;  3FM5 A;  5AIP A;  2R7D A;  1D3Y A;  1MKM A;  1REP C;  5AON A;  4AD9 A;  2LKP A;  1TQI A;  4IF4 A;  2PMH A;  4UXN A;  2WWY A;  3HTS B;  3ZMS A;  1XMK A;  1Z05 A;  3GFM A;  1F1Z A;  4XSX F;  1FSH A;  2JSC A;  3F8M A;  3TO9 A;  1IXR C;  2Y48 A;  5CVV A;  1STZ A;  2ELH A;  1BC8 C;  4IXA A;  1U3E M;  2VBW A;  2OBP A;  2HGC A;  3ULQ B;  1FOK A;  3IKT A;  3ZP5 A;  5BPD A;  2MA3 A;  3M7G A;  2JZY A;  3ZMT A;  5J6X A;  1IRF A;  3ZQ7 A;  1RUN A;  4HF0 A;  2XKP A;  5LRS A;  3EET A;  4U0W A;  5DV5 A;  1J9I A;  1JXS A;  4UNO A;  3QU6 A;  3GVA A;  4AIJ A;  2CWE A;  2K7L A;  3FMQ A;  4WX9 A;  5D8K B;  4IRI A;  1YQA A;  2QEN A;  1E2X A;  3IC7 A;  2NYX A;  2RN7 A;  3HIF A;  3BP8 A;  3FM3 A;  1S6L A;  2JT1 A;  4Q47 A;  5D5W B;  2FSW A;  3KEO A;  5K5R A;  4KFC A;  4LB5 A;  1H9T A;  2IT0 A;  4AIK A;  1UB9 A;  5DEQ A;  1I27 A;  4I2O A;  2W57 A;  3M8E A;  2AXL A;  4MEY F;  1O3T A;  2BE5 F;  1F4K A;  3QU3 A;  4XSZ F;  3DF8 A;  3KP4 A;  1D8J A;  2LF8 A;  3ZMZ A;  2A3S A;  3MQ0 A;  1ZRF A;  2VOO A;  4OIR F;  1B6A A;  2L02 A;  4I7H A;  1MDM A;  1BJA A;  2OD5 A;  4A12 A;  2A6H F;  1AOY A;  4AWX B;  2L4M A;  4KNY A;  5F64 A;  4AIH A;  3LFK A;  4RB3 C;  4LLN A;  4NHJ A;  1RNL A;  2HYF A;  5LGT A;  3IRR A;  3HRS A;  1YFH A;  1KQ8 A;  2GXB A;  5J8F A;  1NHA A;  4LD5 A;  1EH6 A;  4I98 B;  2K86 A;  3V8K A;  1OMI A;  1WRJ A;  2RVC A;  3FXU A;  2W84 A;  4LJZ F;  1YW7 A;  4KIC A;  1USS A;  2KIF A;  1KU9 A;  4N9I A;  5FLX Z;  3GYH X;  2IJL A;  2XV4 S;  2XGX A;  3BJA A;  4EGY A;  2J5O A;  3EYY A;  1Y0U A;  1D8K A;  4A5N A;  3DKW A;  3I53 A;  1P6R A;  2FNA A;  3F21 A;  2GAU A;  3DPL C;  1XD7 A;  1G3W A;  1U2W A;  2VBX A;  3GFL A;  3FXQ A;  1S7O A;  3R6S A;  3GXO A;  1HQC A;  2M5W A;  2XKO A;  1U5T C;  3V4G A;  1SD7 A;  4M9X A;  1XDU A;  4A6D A;  2R7F A;  3TQN A;  2FXA A;  3EUH A;  3BPX A;  3QP5 A;  3V7C A;  4UVA A;  1Z6T A;  3C1D A;  3K9T A;  3HSR A;  1U5T B;  2Y0M A;  4L9T A;  3E3V A;  2G9W A;  1O57 A;  2P7V B;  2HR3 A;  2QVO A;  1ZG3 A;  2X0L A;  1BI3 A;  3R0A A;  3QRF F;  4E70 A;  2LDU A;  2BV6 A;  2CW0 F;  1TNT A;  2O61 A;  2IA0 A;  3QOP A;  4PCQ A;  4P9U A;  2KJB A;  3BJO A;  1MJA A;  4HF1 A;  5ICC A;  1O7L A;  2K4J A;  2VBY A;  2VE9 A;  1BC7 C;  1RI7 A;  3KLN A;  3ELK A;  2J5P A;  1T39 A;  2FEZ A;  4PGH A;  2P4W A;  4P55 A;  2XRO A;  1FBU A;  4LG0 A;  1G6N A;  3JW4 A;  3WTY C;  2CGP A;  5K1Y A;  3RKY A;  1W7P D;  3P9K A;  3W6J B;  3DFG A;  3TOA A;  1UCR A;  3WTW C;  3CUQ A;  1BBY A;  3MCZ A;  1B59 A;  2EA4 A;  2WTE A;  5ICE A;  3K1P A;  3WU0 A;  4EM0 B;  2XVC A;  1OR7 A;  1Q1H A;  4R8H A;  5D8L B;  1WKM A;  3CUQ C;  2ZO4 A;  3F6O A;  3E6B A;  5TRD A;  1R22 A;  4ZZD A;  1TNS A;  4KUM A;  1P4W A;  2D2W A;  1KU2 A;  4L0Z B;  4ESF A;  2L3D A;  3MZY A;  2KKO A;  1H0M A;  1XGS A;  3BY6 A;  3G3Z A;  5E20 A;  5E1Z B;  1KQ0 A;  5HDK A;  1OYI A;  5E8G A;  4GO1 A;  5E8I A;  2VT3 A;  2FRH A;  3DQV C;  2QQ9 A;  4RGX A;  2DK5 A;  1ONV A;  1PP7 U;  3D5L A;  3C7J A;  1ZGA A;  2P5K A;  2EFO A;  1KYZ A;  4A0Z A;  4BXU A;  3DV8 A;  4HV5 A;  2DW4 A;  2MBF A;  2MH2 A;  1SD5 A;  2HQN A;  2VBZ A;  4U88 A;  1DP7 P;  4NB5 A;  2EV6 A;  2H6B A;  3I71 A;  5ICG A;  2PJP A;  1YS7 A;  4M6Y A;  1FSE A;  4B09 A;  5L3C A;  1YW8 A;  4G8X A;  2IA2 A;  4WXD A;  3WGG A;  4ZYD A;  2GZW A;  2EV5 A;  1Z6R A;  1CF7 A;  5L3B A;  1SAX A;  3ECH A;  2YPR A;  1J2X A;  5DCM A;  4BHB A;  4UV9 A;  3ZMD A;  2XHK A;  4UHT A;  3KEQ A;  3IL2 A;  3TKY A;  1TW2 A;  1J75 A;  2ZME A;  4OIO F;  3J81 K;  1B4A A;  3KP6 A;  1P92 A;  5KVR A;  4Q48 A;  2QUF A;  3FZV A;  2ZBK A;  4RB1 A;  3SFZ A;  2STT A;  4MHG A;  1MJB A;  4OOI A;  1BN5 A;  4GYI A;  1ZLJ A;  2OQG A;  3E5Q A;  4L9J A;  1VTN C;  2DPD A;  3WGI A;  4U0V A;  3Q9S A;  5BOX A;  4LK1 F;  1EH8 A;  1ZRD A;  4HF2 A;  1GHC A;  2VC0 A;  2B0L A;  1I1G A;  5DCM B;  3K1M A;  2LSO A;  1FYM A;  5CVI A;  1TBX A;  1OYW A;  4Z2Y A;  3ZN1 A;  2V1D A;  2FQ3 A;  3LAP A;  3GF2 A;  2M30 A;  4JK1 X;  3I59 B;  2BEO A;  1O7F A;  3DEU A;  2ZCW A;  5IT3 A;  4O6J A;  3FMR A;  3O2P E;  4KN7 X;  2RV8 A;  3TO7 A;  5BMZ A;  3N97 A;  2OA4 A;  2KIU A;  3J80 K;  1KYW A;  3ZPL A;  3B73 A;  1XCV A;  4BH9 A;  1IZ1 A;  1K78 A;  4K2E A;  3HYI A;  2G7U A;  4D0P A;  3E6C C;  1YLF A;  4P9F A;  4EMS A;  3D0S A;  2P6S A;  4ZYG A;  3DPT A;  1O3S A;  2PI0 A;  2XAG A;  3CO6 C;  1BI2 A;  1KGS A;  4MGR A;  4S04 A;  1BOA A;  2ZFW A;  3GWZ A;  5LGU A;  2NRA C;  4HYE A;  3BWG A;  5HDG A;  3F8B A;  3T8R A;  1QQI A;  3KP2 A;  5ED4 A;  4MTE A;  3W6K B;  4EM1 A;  5H6R A;  5LHI A;  2VOP A;  1B9M A;  3E5U A;  1EH7 A;  3WTT C;  1R5H A;  3HOS A;  2HDC A;  1ON1 A;  4EJO A;  4ENJ A;  1QZZ A;  4CXF A;  2RNJ A;  3JSP A;  3GZ5 A;  4HX4 A;  2BBY A;  1FPQ A;  1O3R A;  2IPQ X;  4ETS A;  3NQO A;  2M1B A;  4EJU A;  3FF5 A;  4RB2 C;  1UST A;  3I5U A;  1LJ9 A;  1ZN2 A;  3GX4 X;  1TLH B;  1HSJ A;  3LA3 A;  4OMY A;  5TJJ A;  2ETH A;  3LST A;  4KIB A;  5CYV A;  3WTV C;  2D45 A;  3F8C A;  1U8R A;  1XGM A;  1IUY A;  4L5J A;  3IWZ A;  4G6D A;  2VN2 A;  5DCF A;  3J7A O;  2NNY A;  4CZZ A;  1GXP A;  2WC2 A;  1EV7 A;  3P9C A;  1FC3 A;  2FBI A;  2HWV A;  4LGW A;  4L0Y B;  4ZYH A;  3HTU A;  2V1X A;  3L9F A;  2ZKZ A;  3RDI A;  3P7N A;  1S3J A;  5DYM A;  5JR3 A;  4G6Q A;  2K4B A;  3N4M A;  5CVJ A;  2PFB A;  4HA8 A;  2OAZ A;  4IJA A;  3GO5 A;  1J59 A;  3PQJ A;  1YW9 A;  3ROU A;  2OZ6 A;  2VE8 A;  5HS9 A;  3V7S A;  2VOD A;  2QBY A;  4P5O A;  4G7O F;  4OIP F;  4XLN F;  2Z3Y A;  5FGM A;  4BNC A;  2FBH A;  2CSO A;  1IN6 A;  4WF2 A;  4G7H F;  5DDG A;  3MFK A;  3PQK A;  3FXR A;  3JAM Z;  3TOB A;  3MEX A;  3KP5 A;  3JTG A;  3VFZ A;  2L54 A;  3G73 A;  4JBA A;  3CLO A;  3R60 A;  3SXY A;  1MDM B;  2QQA A;  5LGN A;  4UV8 A;  4BQA A;  4UUV A;  5D4R A;  1T38 A;  2GA1 A;  2O0Y A;  4MQ9 F;  3P9I A;  1ZG1 A;  1J7K A;  4R1H A;  3GFI A;  5FFX A;  3COA C;  2DFI A;  3OOP A;  1PDN C;  1TW3 A;  3ABU A;  1UHW A;  3RKX A;  1FBQ A;  3H92 A;  3TO6 A;  4YFN F;  1YO5 C;  2F5F A;  2G7H A;  3GEZ A;  4IHS A;  1SFE A;  1R1U A;  4LLL A;  2ESN A;  3F72 A;  2NNN A;  5ILS A;  4CHU A;  3NRV A;  4KMU X;  4HX8 A;  4M9S A;  4RB0 A;  3SQN A;  2MC3 A;  3TDU C;  1KU7 A;  2P5V A;  5L3D A;  4EJT A;  2PMU A;  2D1V A;  4FX0 A;  4WCG A;  2E1C A;  1IN4 A;  4I0A A;  2EV0 A;  5LLQ A;  4LK0 F;  2YU3 A;  5ILU A;  1YYV A;  1RZ4 A;  5ERI A;  3HRU A;  4CYD A;  1YS6 A;  1HXD A;  1HW2 A;  5HVQ C;  2JPB A;  3VB2 A;  4B8X A;  2HYG D;  1MJ9 A;  4RGS A;  1FT9 A;  4PDK A;  4LB6 B;  4A6E A;  1ODD A;  3WE3 A;  1ZH5 A;  3JSO A;  4QWQ A;  1HKT A;  5D5V B;  1UHM A;  4U7D A;  5E1X A;  4YIF A;  5LRR A;  1FZP B;  3AAF A;  4WXH A;  1HBX G;  3F6V A;  2HTJ A;  4AVP A;  3HRM A;  1HKS A;  1LDD A;  5IT9 Z;  2H94 A;  2MLG A;  1A04 A;  1QNT A;  2O03 A;  3WG9 A;  2JTV A;  2XUB A;  2QZ8 A;  4EVI A;  5HS7 A;  5LHG A;  4MEX F;  3RYP A;  1T2K A;  1FP1 D;  3DXJ F;  1R5G A;  3ZN0 A;  1QO0 D;  3RI4 A;  5HLH A;  1P4A A;  2DQL A;  2PN6 A;  3K0L A;  1CGP A;  4BHC A;  4EV0 A;  5FO5 A;  5HS8 A;  3R0J A;  4ENK A;  1W4M A;  3EDP A;  5FFZ A;  2OU2 A;  1W5T A;  3KET A;  5FD5 A;  4KA4 A;  4LG0 B;  3LA2 A;  1B1B A;  4HV6 A;  1FBS A;  3BZ6 A;  3GZ6 A;  5L3G A;  4WWC A;  3CUQ B;  1XGN A;  1PUE E;  1HKQ A;  1U6G A;  1P4X A;  2VC1 A;  4FHT A;  3CUO A;  2FMY A;  1R58 A;  2P8T A;  1QBJ A;  4MQV A;  3SZT A;  3HHG A;  5H20 A;  2QWW A;  3HSE A;  4UVB A;  3I64 A;  3FX3 A;  2Q2E A;  3RKW A;  2XAF A;  3V7R A;  2FF4 A;  1G3Y A;  1J0R A;  1XGO A;  2IVM A;  4MNU A;  2JPC A;  2TDX A;  5DD8 A;  3GUD A;  4ZH4 F;  4S05 A;  3K1N A;  5HDN A;  2KRF A;  2BYV E;  1KA8 A;  5DUK A;  2HTS A;  5LEK A;  5EEG A;  4IRG A;  2HKX A;  5CVR A;  4RGU A;  2EB7 A;  1JHH A;  3ABT A;  5E18 F;  3F8F A;  3WE2 A;  5K5O A;  1ULY A;  2A6E F;  4G9Y A;  1ZAR A;  2PEX A;  2QLZ A;  3O3K A;  4KIG A;  4ENM A;  5J8C A;  4GGG A;  3HSF A;  3LA7 A;  2EFP A;  3E6D A;  1MZB A;  1ZAO A;  1LDJ A;  3LAJ A;  3H3U A;  4I0B A;  3QPH A;  1O3Q A;  2QM3 A;  3HOT A;  2STW A;  4YG2 F;  1CF7 B;  2D1H A;  3JTH A;  2ZNZ A;  5H6Q A;  4Q5S F;  1LQ1 A;  2XAJ A;  3F22 A;  4KDP A;  1W7P A;  2A68 F;  2F2E A;  1F9N A;  1R1V A;  2DPU A;  5L3F A;  4BYY A;  3PFI A;  2ZME B;  4ON0 A;  4M72 A;  2COM A;  3ZMV A;  1S7A A;  4LFU A;  3NEU A;  1QPM A;  2A69 F;  4N9H A;  3WU1 B;  4FT8 A;  4IVN A;  2BGC A;  1LVA A;  4L9V A;  1XSX A;  2OQR A;  1FX7 A;  1BM9 A;  1JHF A;  4RAZ A;  1UFM A;  2HKO A;  4Y17 A;  1K7A A;  2R3S A;  3ZMU A;  2GWR A;  2VXZ A;  1TQM A;  3L00 A;  1OPC A;  2GA2 A;  1YIO A;  3KCC A;  3RYR A;  3LWF A;  1SMY F;  4ZZL A;  3L2C A;  3QAH A;  5BS6 A;  3IHU A;  4CIC A;  4KT5 C;  2W85 A;  3I4P A;  5AIQ A;  2Q0O A;  3GLX A;  4GXO A;  3B02 A;  3KZZ A;  1IRG A;  2IP2 A;  4IPA A;  1FY7 A;  4M9Z A;  4IHT A;  1TTY A;  4M74 A;  3KE2 A;  2ZNY A;  4DQ2 A;  2QYO A;  4YFK F;  3HRT A;  1K78 B;  2ACJ A;  2L4A A;  1I1S A;  1H9G A;  3VOD A;  2FE3 A;  1F5T A;  4HOB A;  2UWM A;  1ZYR F;  4DNC A;  1RUO A;  3DP7 A;  2K02 A;  3E97 A;  5LEJ A;  2NAZ A;  4HX7 A;  3C3W A;  3KP7 A;  2DAO A;  5F6F A;  3Q5F A;  3MAJ A;  3ML6 A;  4HQM A;  2KIM A;  1U78 A;  3CO7 C;  1DDN A;  3U1D A;  2ISZ A;  4O3M A;  2HS5 A;  1MGT A;  1R23 A;  2P6T A;  3GFJ A;  2JRT A;  2FBK A;  2M45 A;  1XSD A;  1LEA A;  2EJR A;  3SHF A;  1T6S A;  2MD5 A;  1FLI A;  4L18 B;  4HDV A;  2UXN A;  3IWF A;  1S29 A;  2CO5 A;  1D5V A;  2M87 A;  1X3U A;  1Z1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...