2QQBA

Crystal structure of dtxr(m10a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
214
Chain Sequence
b'DLVDTTEAYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRGHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 66
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqbA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqbA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqbA03
4Y15A 3ABUA 1R1TA 1I6XA 4HV6A 2G7UA 4ETSA 4L9JA 3CO6C 2KKOA 3FX3A 3FF5A 1PP7U 1U5TA 4I98B 4L9NA 5JR3A 2CGPA 1ZREA 1FLIA 1KU9A 1OPCA 2LF8A 1LDDA 4E70A 2R7DA 2BE5F 4L9VA 5FGMA 3CTAA 3HHHA 3JAMK 5DV5A 2EFQA 2FA5A 1IAWA 4R8HA 1UCRA 5DUKA 3RJPA 2GCXA 1Z6RA 3R0JA 1KU2A 3K1NA 5LBQA 4M9SA 1FC3A 4EVIA 3G73A 1GXPA 3J80K 1D8JA 2X0LA 2EWNA 3KP6A 2K7LA 5D4SA 1PUEE 4LLNA 3I58A 3JSOA 4Q4ZF 2DO7A 1U6GA 4HQMA 1S6LA 2Z9OA 3TO7A 3NRVA 1TBXA 1Z6TA 2IT0A 3I5UA 4HAMA 4P9FA 3K1PA 3BWGA 1IN4A 3GFMA 1IUYA 1FBUA 4FX0A 3CUQC 2OBPA 4RB3C 2V6CA 3I59B 1KA8A 4UHTA 5L3GA 3KETA 2F5DA 1ON2A 4RB0A 1DUXC 2M87A 1S7OA 4A12A 2KIMA 4HV5A 3JTGA 4G6QA 1UFMA 2NRAC 3EYYA 3HRTA 5DD8A 4I2OA 4XSXF 1TQPA 3HHGA 1P92A 3ZMVA 2EB7A 3I53A 3L2CA 1J7KA 1U8RA 2O0YA 2P4WA 4CZZA 3GWZA 4IHSA 1T39A 2M1BA 4ZH4F 3K0LA 1QZZA 5ERIA 3K9TA 3QP5A 2H6BA 3ZMTA 2WV0A 2HDCA 4CHUA 3DPTA 1KYWA 4IXAA 1FSEA 1U3EM 1B59A 2WWYA 2RN7A 5DYMA 5J8CA 2VOPA 5A2QZ 2A6HF 4LD5A 2IA2A 2FE3A 4LMYA 1SD7A 4HF0A 3QU6A 1P6RA 3JAMZ 5AIPA 3W6JB 3LA3A 3I54A 4EQQA 1LDKB 1W5TA 3ECOA 2QENA 2VE9A 2DW4A 1EV7A 2QQBA 1O3SA 4GO1A 3ELKA 2IA1A 1XSDA 4A0YA 3LAJA 1FPQA 2CFXA 3WODF 4AWXB 4G7OF 1T98A 3GYHX 2E1CA 1YLFA 1BI0A 2XKOA 4LK0F 4HQEA 4JQFA 4HA8A 4G7HF 1FBSA 2LKPA 2Z99A 3IWZA 3T1BA 4WXDA 2Q0OA 3WGIA 1F5TA 1QNTA 2ZMEB 4RGXA 5TJJA 5HDGA 1SAXA 3BJOA 1P4XA 5FO5A 2RGVA 4OIQF 2QYOA 2YSRA 4YFXF 4UV9A 1XDUA 2YX4A 2GXGA 3RPQA 2W24A 2V1UA 4EV0A 1YW8A 3U9GA 3HOTA 2O8XA 4UXNA 2IP2A 1W7PD 1JHFA 3L00A 1DP7P 2BEOA 1YO5C 5DD4A 2XIGA 2W84A 1T6SA 1XCBA 4ASNA 2RKHA 2MA3A 3TDZC 1LVAA 1R5HA 3ZMDA 2Y75A 1ZYRF 3ULQB 2VBYA 4L5JA 1T0FA 4ENJA 1XSXA 4IHTA 3WTWC 1V3FA 3J81K 2RNJA 4AIHA 2BYVE 3F21A 3ML6A 4GCVA 2HS5A 3HIFA 1KU3A 5JVTA 3LQQA 3LAPA 3REOA 1OKRA 2LX9A 2E1NA 3MQ0A 2PQ8A 3HRUA 1NHAA 3V8LA 2STWA 2QWWA 2GQQA 2D45A 2L4MA 3AAFA 3ROUA 3LQRA 4OINF 3MFKA 4B09A 2FNAA 4GYIA 2HGCA 4ZYEA 3TOBA 1SFUA 4Q47A 3KP2A 4Y17A 2F5CA 4G6DA 3R6SA 5ICEA 4KICA 2CYYA 1IZ1A 3GVAA 4HX7A 5CVJA 2XAQA 2IJLA 2H3JA 4PCQA 1Y0UA 1HXDA 2DFIA 4I0BA 1GXQA 1BI1A 5BOXA 4ZYGA 5HLHA 2FEZA 1TNTA 2HQRA 2CO5A 1MGTA 5HVQC 3B73A 4UUVA 4KMUX 4O6JA 3CLOA 2IA0A 1IRFA 4M71A 3WU0A 2D1HA 3QU3A 4LB6B 3V7RA 3H3ZA 1U2WA 5JI6A 1EH6A 3JTHA 3QPTA 4I7HA 2E7WA 3RKYA 1ZLJA 1LB2A 4LK1F 1EH8A 4DNCA 1OYIA 3HTUA 4HBLA 2QUFA 4U7DA 1ZG3A 1VTNC 3WTYC 2MD5A 3ZN1A 1ZGAA 3MWMA 3K69A 2E7XA 1SD4A 2VBXA 4ZYHA 5ICFA 3KP4A 2CW0F 2CQKA 3LWFA 1S29A 2A3SA 2YX7A 3OV8A 4HF1A 1MJ9A 2COMA 2FMYA 1MZBA 3KLOA 1HW2A 1XSVA 2P7VB 3H3UA 2DQLA 1R5GA 3TO6A 3CUQB 1I27A 2DAOA 5CVRA 2D1VA 4XLNF 2VT3A 5E18F 2ZNZA 2ADUA 3HUGA 3SQNA 4L0YB 3C7JA 1MDMB 4HZFA 1UHMA 3R61A 2HZTA 2MBFA 4M6YA 2OA4A 5LGNA 3I71A 4N9IA 2FF4A 2QQ9A 1XD7A 1F9NA 3DFGA 1SFXA 1IXCA 5BS6A 2ESNA 2LDUA 3F8FA 1YG2A 3EQLF 1J59A 1SMYF 5E17F 2K4JA 3MAJA 5HLGA 1O57A 3M9AA 3GZ5A 3FHZA 2ZCWA 3GZ6A 3GXOA 2F2EA 1YS6A 3C18A 1UB9A 3DF8A 4I0AA 2NS0A 2XRNA 5D5WB 2PI0A 1J2XA 4A6EA 1J0RA 2OZUA 4LGWA 2LF7A 4PGHA 1H0MA 2JRTA 3N4MA 5HLIA 1G3SA 5DCMA 1BC7C 1S7AA 1K78A 3EYIA 1QVPA 1SD5A 2EA2A 5IT9Z 4L18B 4LG0A 5LEKA 5BPIA 3WE2A 3VODA 2GA2A 5E1WA 2UXNA 1ULYA 5ILUA 1T2KA 2C6YA 1TQIA 2EJRA 2FBKA 4HOBA 1P2FA 5DDGA 5LHGA 1BC8C 4I02A 4GGGA 4Y13A 2B0LA 1FBQA 2XASA 4IVNA 5HOOA 1QBJA 2IRFG 3ZMSA 5CJ9A 1KU7A 3E6MA 3L7WA 2K5IA 3M1EA 2HOEA 3U1DA 4FHTA 1TQMA 2H09A 5CVIA 1ZG1A 3S2WA 4EMSA 1J9IA 1LJ9A 5D6FA 4R79A 3MZHA 4JBAA 1B9MA 5J6XA 4U88A 2M30A 4EM2A 3KFWX 3SZTA 2VBWA 5EEGA 3JW4A 3KZZA 1B1BA 3O6BB 4ESFA 4IPAA 2LSOA 3SFZA 2GWRA 4WX9A 1HSJA 1XN7A 3TQNA 4A0XA 3PFIA 3I0TA 2STTA 1R23A 4LFUA 3FMSA 3F8CA 1W7PA 1S3JA 4A5NA 1WRJA 3RPUA 4MQVA 2ISYA 2CG4A 2IPQX 5FLXZ 1BI3A 2YPRA 4OMZA 3CUOA 3GW2A 2HWVA 4AIJA 3RI4A 4MTDA 4IRHA 1T38A 2PJPA 2GAUA 5D5VB 3Q9SA 3PQKA 1KGSA 5K1YA 3E5QA 1R7JA 3COAC 2DPDA 2M45A 3B02A 3CDHA 1WI9A 3RDIA 2MLKA 2PEXA 4L0ZB 4HW0A 2XKPA 1W4MA 3WTTC 2VT2A 4EJVA 3I4PA 5DUIA 5FB2A 1BOAA 2DU9A 3TDUC 4CYDA 1ZARA 3ZMUA 4QLCU 2Z5UA 3T5XA 1AWCA 4PGGA 3RKWA 1IRGA 3GUDA 1W5SA 2Z33A 3W6KB 1HKQA 1REPC 2EK5A 4KFCA 5CVVA 2XAFA 2XUBA 4A2UA 1YTYA 4WF2A 3R0AA 4NQWA 4UVAA 2ZFWA 1GVJA 2K4BA 4G7ZF 2M8EA 3CJNA 3GLXA 5LHHA 3ZN0A 4UV8A 1ZHFA 1CF7B 1G3WA 4Q48A 2UXXA 5H6QA 4LLLA 3KP5A 1ZRFA 1O3RA 4CXFA 3MEXA 1FZPB 1WSUA 2EV6A 3V8KA 1H9GA 2ESHA 2NAZA 3HSRA 2XAJA 1SD6A 1IN5A 1B4AA 1LEAA 3C3WA 3WG9A 3M8FA 2ZXJA 2HQNA 3SZPA 1ZAOA 3D0SA 4YFKF 2QBYA 4LB5A 1BM9A 1I1GA 2Q8KA 4U0WA 3J80Z 2H6CA 5K5QA 1U5TB 3E19A 2Q2EA 4KYWA 3BPXA 4R1HA 4JK1X 3FXQA 4Q5SF 1B9NA 5HDNA 3KP3A 3WTSC 4D0PA 1FSHA 1BIAA 3DKWA 2O6GE 4ZYDA 1L0OC 2RVCA 3VEPA 3FZVA 4BNCA 3HYIA 1S8NA 1KQ0A 3T8RA 4HYEA 2ETHA 2Y0MA 2OQRA 5D6EA 3RYPA 2XAGA 1RIOH 3IHUA 4L5IA 4OIPF 1X3UA 4PDKA 1BJAA 1ODDA 4OOIA 3KCCA 5F64A 3BROA 4AIKA 3E97A 3GX4X 1IN7A 3JSPA 1JXSA 2AS5F 3IC7A 1BN5A 1Z91A 1MKMA 4RAZA 3Q5FA 2L4AA 1RZ4A 4RAYA 1IN8A 2ZBKA 3HSFA 2DK5A 4KA4A 3ISPA 2QM3A 4A5MA 2XROA 1LQ1A 5HS7A 3BPVA 2QLZA 2HEOA 3BJ6A 5BQTA 2L01A 3KEQA 3BP8A 5D8LB 3F6OA 2DBBA 3WGHA 4KDPA 5D5XB 3HRSA 4XBFA 2FXAA 4EM1A 3DXJF 3EETA 1XMAA 3KZYA 2MH9A 4U0VA 1XGSA 3E5XA 2GIVA 2GZWA 1DPUA 1IXRC 1FYLA 2ZKZA 1HW5A 4KIFA 4NHJA 2K5FA 3D5LA 4IF4A 4G94A 3F8MA 5ILSA 2WC2A 2A6EF 2HKOA 1OR7A 3O2PE 2PBIA 5LRSA 4YIFA 2JSCA 1CGPA 5LGTA 4EGYA 2YR2A 1WWXA 3TOAA 1H9TA 2VBZA 1USSA 4OU0A 2EFOA 1O3TA 4EJOA 2KRFA 2R3SA 3ZPLA 3HRMA 3VOEA 3F22A 1LNWA 4HF2A 3EDPA 2MH2A 4KMFA 4WK8F 3LFKA 2J5PA 4EJUA 2RV8A 1FP1D 1XCVA 4BH9A 5FFZA 4P55A 2VC1A 2EFWA 4ENKA 3CO7C 1I1SA 1LEBA 4RGRA 2W57A 5D4RA 2P5KA 2K4YA 2DTRA 3FXRA 1K79A 3TKYA 2KJBA 2FQ3A 3FMQA 3T8TA 3I59A 2O03A 3V7SA 2EA4A 2J5OA 1JHHA 1MD0A 3BZ6A 4N9HA 1FX7A 4EGZA 2RC4A 4NB5A 1ZLKA 4YG2F 3QAHA 1HSTA 4AD9A 3J81Z 2M5WA 4WXHA 1IF1A 5FFXA 2FBHA 4MEXF 3MZYA 4GXOA 5IT3A 2KIFA 3L09A 1Z9CA 3F3XA 2QQAA 4BAYA 2OZ6A 4L9TA 4IJAA 1HW1A 5AIQA 2ZJ2A 3N97A 2MC3A 1YFHA 2FMLA 3EUHA 3E6DA 1Z05A 3WTZA 5L3FA 1Z7UA 2TDXA 3IRQA 3WTVC 1STZA 2ISZA 4RGUA 2V79A 3QOPA 2JPBA 1HQCA 5H20A 3E6CC 1TLHB 5FD6A 2QVOA 1R00A 1JGSA 1RUOA 1OYYA 4KUMA 1RI7A 3MHXA 4WCGA 2VC0A 1XB4A 4RS8A 2GXBA 2FU4A 2CSOA 4ESJA 1L3LA 1FOKA 1R1UA 3M8EA 2OQGA 4KIBA 3RYRA 4EJWA 3GF2A 1IN6A 2YU3A 2XV4S 2W25A 4U0YA 1R58A 3RIRA 4O3MA 2LNBA 2HR3A 4YIIA 5HDKA 4OIOF 4KNYA 2HFHA 2ZMEA 5A2QK 5BPDA 3VB2A 3P9CA 2OAZA 1QZYA 2HTSA 4A0ZA 1B6AA 1BI2A 5ICGA 4G9YA 1G4DA 4S04A 3ERED 1PDNC 4P9UA 4HLXA 5FD5A 2K5LA 3ZMZA 5JFRA 2VN2A 2H27A 3P7NA 4MHGA 3HSEA 3IKTA 2D2WA 2UZKA 2DQRA 5E1ZB 3F8BA 4CO8A 5HS9A 4A6DA 5LRRA 1ZRDA 3RKXA 2O61A 1KQ9A 1MJBA 5F1RA 3GFLA 1TNSA 4PZJA 3DPLC 3J7AO 2JTVA 5H6RA 4IRIA 2UWMA 3DP7A 3ZP5A 3KP7A 2FBIA 2DPUA 2V1DA 1FYMA 3NEUA 4BYYA 2KJCA 4BHBA 4I01A 1ZG5A 2FNPA 4HLYA 3HTSB 2P8TA 4OMYA 1XMKA 1HKSA 1AOYA 2A07F 5LGUA 2OU2A 2ZNYA 2VONA 3ABTA 2PLYA 3GO5A 4CICA 1ZRCA 6PAXA 4XRFA 4RB1A 4AVPA 5BMZA 1FT9A 4UVCA 5E20A 1FNNA 4UNOA 3ZQ7A 4RGSA 3FWEA 4HX8A 3P9IA 4FX4A 1GHCA 4YFNF 1BIBA 1D3YA 4ZZDA 3LSTA 2DLLA 3E6BA 1OYWA 3WGGA 4M73A 5DCMB 2GA1A 4EM0B 1O7FA 4UVBA 1J5YA 1K78B 1F4KA 4S05A 5D5UB 4HDUA 2A61A 4HX4A 1KQ8A 2Z3YA 1XGMA 4BXUA 1J75A 4LG0B 3V7CA 5EEHA 1XDSA 3F6VA 2NNYA 1C0WA 4FT8A 3O3KA 2XHKA 3SHFA 2L54A 1I5ZA 2DK8A 5D8KB 3PQJA 3BOQA 4BHPA 3IL2A 3KEOA 4IRGA 3GFIA 3GEZA 1FP2A 4MTEA 2V9VA 3QPHA 4U7BA 3WE3A 2PMHA 2JZYA 3CUQA 2OD5A 3P9KA 2MLGA 1OMIA 4GYGA 2G9WA 3FM5A 1IXSB 2PG4A 2EFPA 3T0YA 3E5UA 4KN7X 4CGZA 4RB2C 1MDMA 3MCZA 3FMRA 4M9XA 2L3DA 1UHWA 2A68F 4XSZF 2R7FA 1XGOA 2FOKA 2HYFA 4QWQA 3H92A 2K02A 3L9FA 3K2ZA 5AONA 2XGXA 1EH7A 1XGNA 3M7GA 2P6TA 4I09A 2RDPA 4ENNA 2K86A 5LEJA 5TRDA 2VOOA 3DEUA 2P5VA 2JT1A 1USTA 4MEYF 3G3ZA 2EV0A 1V4RA 3U2RA 5CVUA 5LLQA 1E2XA 4TV7A 1QW1A 3FXUA 3ECHA 1ZN2A 3R4KA 1QQIA 1K7AA 1W7PB 2ZO4A 2EV5A 2EFNA 1QPMA 1FY7A 2FSWA 4KN4X 4G8XA 5CLSA 5ED4A 2HTJA 3IKVA 1YQAA 5K5RA 4M9ZA 2ELHA 2CWEA 3IWFA 5L3BA 2BGCA 3DV8A 4LJZF 4XLPF 1QGPA 1O3QA 1D5VA 5ILVA 2QZ8A 4ON0A 1KYZA 4F7ZA 4EJTA 4MQ9F 1R36A 3RTRA 4O5VA 5E8IA 5HS8A 2RQPA 2F5EA 2NNNA 3LA7A 2X4HA 4HDVA 4N0BA 3F72A 5KVRA 5L3CA 2W85A 1BYMA 2KIUA 2PFBA 5L3DA 1LDJA 2PN6A 5DEQA 2PMUA 1YW9A 5JHUA 2DI3A 1WKMA 5DCFA 5ICCA 4M74A 1BBYA 2JPCA 3QP6A 1TTYA 4K2EA 4WWCA 4P96A 4KT5C 5K5OA 2P6SA 2BBYA 1MJAA 3V4GA 5IT9K 4M72A 1HKTA 2VE8A 2AXLA 2A69F 4BQAA 3FM3A 1SMTA 1ONVA 1G3TA 4H0EA 1PP8F 1WQ2A 1ZH5A 2L02A 5L3EA 3BDDA 4ESBA 5E8GA 3NQOA 1Z1DA 2G7HA 4DQ2A 4LLGF 2IVMA 1D8KA 3KE2A 4Z2YA 1ON1A 5J8FA 1F1ZA 1ZGJA 2VODA 2F5FA 5E1XA 3GFJA 1FWZA 3I64A 1U5TC 5LHIA 2QBYB 1A04A 1U78A 1TW3A 2DT5A 2V1XA 3BJAA 3Q9VA 2ACJA 3WTUC 1HBXG 3WTXC 3R60A 4M6XA 4ZZLA 1YYVA 4B8XA 1JE8A 4KIGA 1YS7A 1G3YA 1P4WA 3TO9A 3C1DA 1QO0D 1TW2A 1R1VA 2A5YB 1G6NA 2IW5A 3E3VA 1K6OA 1Q1HA 2XAHA 4ENMA 1YIOA 3IRRA 2P5LC 4MGRA 1O7LA 2O3FA 2VXZA 4CDGA 2Y48A 5FLXK 3OOPA 3WU1B 2K27A 4MNUA 4BHCA 4WXCA 1RNLA 3SXYA 3QRFF 3F23A 3KLNA 5CYVA 4OIRF 2HKXA 3F8NA 2XVCA 1YW7A 3HOSA 1DPRA 3K1MA 2FRHA 2BV6A 1DDNA 1RUNA 1FYKA 2HYGD 4P5OA 3VFZA 1CF7A 1E17A 2H94A 3TGNA 5KK1A 3LA2A 1R22A 3V8JA 2WTEA 3BY6A 1P4AA 5F6FA 2NYXA 2P7CB 1IW7F 3DQVC 1SFEA
chains in the Genus database with same CATH superfamily
3K4LA 1Y8QB 4Y15A 3QKJA 2X6XA 3ABUA 3H5AA 4ZJZA 1IZ6A 4OGEA 1R1TA 3QQAA 2DMQA 3KPHA 1I6XA 2IPOB 1IC8A 4HV6A 2RK1A 1X3ZB 2E2IJ 1I50J 2A6TA 2G7UA 2C06A 4DBQA 4ETSA 5KYXA 4L9JA 3CO6C 1Q81R 2TRTA 1Q7YU 2KKOA 3KX2A 2RAEA 2HAXA 2RNGA 3DEWA 2KK4A 1U9OA 4WCIA 2CQ7A 2XGEA 3M0QA 3FX3A 4AYBA 3DCFA 4BXFA 2XF5A 2GQIA 3FF5A 1AWXA 3BG3A 1U5TA 4I98B 1PP7U 1UELB 1VIFA 3EGDA 4L9NA 5JR3A 2CGPA 3I5RA 3JCMb 4A3JJ 1FOWA 4IUQA 3X2QH 2HL3A 1X69A 1ZREA 4QPQA 2LD5A 2FJ1A 2XIDA 2BOLA 2R7OA 3H35A 2PJRB 2CP3A 1QKXA 1FLIA 1KU9A 2EINH 1OPCA 2LF8A 5J40A 3AKZA 3PIPA 5FRMA 1WJFA 1A31A 1LDDA 1AWJA 2CP2A 4KH0B 4E70A 2R7DA 2BE5F 4LIUA 4IX7A 1AHJB 4M78E 3LGLA 5FU6C 3CC2Q 1RAAB 3I56Q 2KISA 2RO0A 1Y39A 4L9VA 5FGMA 1KQ1A 3CTAA 1TH7A 2W7NA 2LJ0A 3NAUA 3OWTA 1LPQA 4BJ5C 1ACMB 2OC6A 3HHHA 3ZEHA 5E3OA 2D1XA 3Q0WA 5DV5A 2CW7A 2EFQA 3JAMK 3R6NA 2NVUB 3RUXA 4R55A 2V1NA 2LOOA 4OGCA 3DBLB 2FA5A 3AG2H 2K57A 3WHCA 2A05A 1IAWA 2EQMA 2L7ZA 4R8HA 5CPRB 1SRLA 4A4KA 1O4XA 3FRNA 3CBMA 2DILA 1UCRA 5LJ5g 3OW2S 5DUKA 2VL8A 3RJPA 2KQWA 2KT8A 2GCXA 2Z0WA 3CXCP 2DODA 1Z6RA 3R0JA 2COZA 1KU2A 4XLAA 2X85A 3K1NA 5IOZA 5LBQA 2ED1A 3P8DA 4FYXB 4M9SA 2BKDN 4V19K 2JXBA 3QZ5B 2IS2A 2ZXIA 5GAOm 1FC3A 1MNMC 4PSXA 3H41A 4EVIA 1VQNT 1WPYA 3G73A 2DX1A 3EFSA 3OYEA 3OOUA 4C8QB 2KDOA 1GXPA 4LDUA 3J80K 3UATA 3SFIA 2DMUA 5FLMJ 1D8JA 2X0LA 2EWNA 1VQ9T 1OCPA 3KP6A 2K7LA 3CC4I 1VOMA 2RHZA 4FIBA 5D4SA 2L7FP 2HBWA 1PUEE 4DEXA 4LLNA 2QEXT 3B6CA 3G2BA 3I58A 3JSOA 1V5GA 2NLUA 4Q4ZF 2BW3B 1S7EA 2DO7A 2VXDA 2DFEA 3K6GA 1YWOA 3PO3J 1U6GA 3I5SA 3QYGB 5LJ3f 3PMTA 1GDTA 5I2MA 4HCKA 5KYWB 4HQMA 4FETA 5FLXE 1S6LA 2Z9OA 3TO7A 2M16A 3NRVA 2NS8A 1FJLA 3VUBA 2JN0A 1TBXA 1Z6TA 2IT0A 3CD6I 1KFZA 4NUBA 3DTEA 1NLPC 3I5UA 3GNGA 4HAMA 1I0CA 2VKVA 1YCSB 5F27A 4NL3A 3CCRA 3QYEA 1XC5A 1MW7A 4P9FA 1M3CA 3VS3A 4V2FA 4B43A 3K1PA 4BY6B 3BWGA 4YEJA 1G5VA 2CZ0B 1YJ9A 1KJWA 2NVQJ 2YLCA 3X20B 4GBQA 1IN4A 3GFMA 2MW8A 3CCYA 1IUYA 1M2VA 4A69C 1U1SA 2V9PA 1WFWA 2XPWA 1FBUA 2M4GA 3G4SQ 4FX0A 1YE9A 2XKOC 3W2WA 3CUQC 2OBPA 4J9GA 4RB3C 2V6CA 3BZCA 3I59B 3ZR8X 1APLC 3CC4Q 3PSIA 1E0EA 4OMNA 3RNJA 1R5ID 1KA8A 4NC6A 3SB2A 3WXMB 4UHTA 5L3GA 1I81A 2KNBB 3X26B 3KETA 2F5DA 5KE3A 4BE2A 4RCCA 1ON2A 1K73C 1VQKI 3HM5A 4RB0A 4QSHA 1YHQA 2YDLA 2DETA 1DUXC 4XRMA 5GMKe 2M87A 1Q82U 4KISA 3M9QA 2DYSH 4M7AF 3H9GA 2CU7A 2LP5A 1S7OA 5GANg 1JUPA 4A12A 3HPWA 1VUBA 4J8OA 3CMAT 2VASA 1IGNA 3E1SA 1MH3A 1YJWA 2KIMA 1XX5A 4HV5A 3JTGA 4G6QA 1UFMA 1DP3A 2NRAC 1NG7A 3EYYA 3HRTA 1Z67A 2EBPA 3CQTA 5DD8A 4KT0E 1WIEA 3UT1A 4I2OA 2DTHA 4J6YA 4JLIA 4JLGA 4HNTA 2LC2A 1GFCA 5LJ3e 3BQZA 2WADA 4XSXF 3IQLA 1TQPA 2GOMA 3HHGA 2VKHA 1P92A 3ZMVA 2JUCA 1CSKA 4KGVB 2EB7A 3CJTB 4IKFA 2E6ZA 2CFOA 3CCQQ 3I53A 2HVRA 2FZGB 2COWA 3L2CA 1UEBA 1M90R 4PNOA 1D0YA 4FYYB 3E2UA 1RESA 2M0MA 2H1KA 1G59A 1J7KA 4QQDA 3A4CA 1U8RA 3I55A 2O0YA 4M7DA 2HDDA 1ETQA 2P4WA 4IO9F 3VKIA 1Y0NA 3H3VK 2JMCA 4RMOA 3K7AJ 3G1OA 1KG1A 4CZZA 2JUFA 1E3PA 3GWZA 3JRCA 1QLYA 2K3YA 3JCMP 3NWTA 1TWGJ 5IYBJ 4IHSA 2VXFA 2ENMA 5CR2A 2QTVA 3IAM2 1TWHJ 3EG3A 1MMGA 2JWTA 3S32A 1RI0A 2DK3A 1T39A 3OY9A 3JRFA 3PJRA 2M1BA 1T0FC 3PMIA 2QKMB 4ZH4F 1AZEA 4IHYA 2Y2ZA 3K0LA 4BEHA 4QQGA 4EDUA 1QP3A 2Z2SB 1QZZA 2K9LA 2JVHA 3K9TA 1LVKA 3QP5A 5ERIA 4RTXA 1SVMA 2H6BA 3ZMTA 3SD4A 5IHKA 3CCRT 1Z9ZA 3QPSA 2WV0A 4BY1J 1VQNI 2EH3A 2HDCA 3DPTA 4CHUA 3S16J 2B86A 2WACA 2R7XA 3S3OA 1KYWA 3MMYB 4IXAA 1Q95G 1FSEA 3JCMd 4NS5A 4ATOA 4NNJA 1U3EM 1B59A 3HJEA 2CT3A 2WWYA 3OS5A 3VSKA 5GAN3 4IQ4A 1OFCX 2RN7A 5DYMA 2DE0X 1VQ9I 1KHIA 5J8CA 3W2AA 2VOPA 4HEA2 1UGPB 3ZRGA 1BJZA 2A6HF 4LD5A 5A2QZ 2VIXA 2R7WA 2IA2A 1K73R 1JEGA 2HVSA 5B1AH 2FE3A 2EYQA 1HA8A 2VKDA 4LMYA 1SD7A 4HF0A 4J9DA 2JVVA 3CCUA 3QU6A 1P6RA 3CCLI 1M1FA 2C0TA 2MAMA 2ELKA 1BA5A 1IHVA 3HKZN 3PNTA 1XJWB 4RTZA 5JLWA 3JAMZ 1YHQT 3CCVI 3SEZA 4NC8A 5K7ZA 3TSZA 4G12A 1ENHA 5AIPA 2CV1A 1TG0A 3W6JB 2X6WA 3LA3A 4BY7J 4D5FA 2HZYA 4OB2B 4EMHA 2EIJH 1MBHA 3I54A 4XKVA 4EQQA 1LDKB 5M5XJ 2OJ2A 2YSQA 1W5TA 3ECOA 4OP0A 5FU7B 5GAN8 3J80E 2QENA 2VE9A 5FROA 3CMYA 4CC2A 4JRIA 2DW4A 4ZNXA 1EV7A 2QQBA 2ZC2A 1O3SA 3WVDB 1LJOA 5A0LA 4GO1A 3ELKA 1J3TA 1SVLA 3CF5F 2QK0A 2IA1A 4OVAA 2ZPEB 3EUKL 4CI0C 3WVEB 1XSDA 2ELJA 2VJ5A 3KIOA 2EQRA 4A0YA 3LAJA 1PM3A 1QCFA 2YRVA 4JS5A 1PVEA 4A3LJ 1C6VX 5KYXB 1FPQA 2CFXA 2QSGX 2OTLT 3WODF 2CW8A 4AWXB 3G4SA 1Q7YR 1VQOQ 2E3HA 3F9KA 2NOGA 4G7OF 1T98A 2QYZA 3GYHX 2E1CA 2JA5J 2K3BA 2VC8A 2O5RA 1MUZA 4DBFA 4F7UG 3VS4A 2RJEA 2IG0A 1ETVA 1YLFA 1BI0A 2PTKA 1ETYA 1Y71A 4PFOA 1M27C 2XKOA 4LK0F 2GLOA 2RMOA 2FRWA 5IAYA 4HQEA 2K7AA 2CDTA 4N4NB 3OSVA 4JQFA 4XU0A 3I55T 4HA8A 3C2GA 3F0CA 4G7HF 1ZA1B 2YUPA 1FBSA 2LKPA 1BBZA 2Z99A 2K2VA 3CMAI 3IWZA 1X1PA 1KC8U 1WJQA 1XMXA 1TUCA 4AFZC 3T1BA 5E3MA 1JKOC 4WXDA 2Q0OA 3WGIA 3M54A 5GJVB 3M0TA 1F5TA 1QNTA 2CUZA 5GAGJ 3GLLA 4M75D 5EG2A 2DTZA 2ZMEB 4RGXA 4FSXA 1IV8A 5TJJA 4F7UA 5AYFA 2CYZB 4ZGDB 2OJED 2HDWA 2Z16A 2DT7B 4PJNA 5HDGA 1SAXA 3BJOA 5E79C 4YRVA 2X4WA 2RF0A 1KIKA 2QA4I 1WGSA 1P4XA 1GFDA 5FO5A 2RGVA 4OIQF 2QYOA 4BU2A 4C0ZA 2YSRA 4YFXF 4UV9A 4XR6A 3M53A 1Q82C 1XDUA 1YIJQ 2YX4A 1YI2A 2GXGA 1WJAA 3RPQA 4CCMA 2W4SA 5GPAA 4B1RA 2W24A 4JJBA 4M7DE 2DXCA 4M75F 1PUFA 4RG8A 3GNFB 4ZDPA 2V1UA 4EV0A 2DIQA 1YW8A 3U9GA 3HOTA 2O8XA 4LE9A 3BQYA 4GDFA 3AL0B 4C5HA 4AM3A 4UXNA 3G71A 2IP2A 1W7PD 5EF6A 4HCZA 1JHFA 3JB9D 3RPUD 3L00A 1Z3YA 2MCNA 1DP7P 2BEOA 1YO5C 5GMKi 5M5WJ 5DD4A 2L0KA 2KRHA 2XIGA 1N78A 4BI4A 4M77D 3OYLA 2JM9A 1K61A 2PMZN 2YUQA 3MVPA 2E4HA 2W84A 3PO2J 3K4KA 4II3A 5LJ5d 1T6SA 3A0BC 3J7AY 5B3SH 3AG1H 1XCBA 1K4SA 5GPCA 1TL8A 4ASNA 2RKHA 2MA3A 3LSHA 3TDZC 2XRLA 3CC7I 1LVAA 1R5HA 1W5CC 3J81R 2E41A 3ZMDA 1DU6A 1X2MA 4S0HB 2AQEA 2Y75A 1ZYRF 3MP1A 1VQ7A 3ULQB 4CC7A 2VBYA 2OV7A 1SFOJ 2KY9A 4L5JA 4J9FA 4II1A 3I4NJ 1T0FA 4ENJA 2EW3A 1XSXA 3ZFJA 4EMKB 4CH7A 1UFFA 3VSLA 4IHTA 3LMMA 3WTWC 1ETOA 2E5KA 5CK9A 1N6AA 2PVDB 3JR9A 3UNGC 4Y3OA 2BXYA 4LD9K 2HI3A 3A52A 5GADJ 4OB0B 1IV6A 1V3FA 3GTKJ 2F48A 3K4MA 2RNJA 3J81K 4N4GA 4NL2A 4AIHA 3NGPA 3CCJQ 2BYVE 3CC2T 3CCEQ 3LSGA 3ML6A 3F21A 4GCVA 3I56T 1RLPC 2HS5A 2K3FA 3HIFA 1KU3A 2E1MB 5JVTA 2I10A 2KMUA 3LQQA 2EGAA 4EIKA 1T3LA 1WH7A 3LAPA 3HOVJ 3REOA 1T56A 3LSPA 2G6FX 3DLMA 1H3HA 4X0GA 4RM2A 1OKRA 3VYRB 1VQPI 4LITA 3H8ZA 1V76A 2LX9A 2E1NA 3MQ0A 3RMQA 2DVEA 2XMFA 1Q86C 4A3IJ 2CKKA 2PQ8A 3HRUA 5CKEA 1YNZA 1NHAA 1SPKA 2QGFB 3V8LA 4XICA 3HB9A 2STWA 1HC8A 4JZ3A 2AKKA 4OMOA 2IGKA 2OTLI 2L9SA 1IB8A 4KBMB 2OPTA 2QWWA 2GQQA 2GIZA 2D45A 1FTTA 2L4MA 2X98A 1WHGA 4LUDA 1Q82R 3AAFA 4ORZA 2B63J 3ROUA 3GBQA 3LQRA 2CUBA 2MMPA 4JDSA 4A54A 3JB9H 4OINF 3MFKA 1RR8C 1RAEB 3VS2A 1KQSA 3UA7A 3I3LA 2CS3A 3BT9A 4BDZA 4B09A 1RR7A 2FNAA 1OULA 4GYIA 3RZOJ 1UUEA 1Y96B 4X6AJ 2EGCA 2HGCA 4ZYEA 3TOBA 5CAIA 1SFUA 1MSEC 5H2FC 1X27A 4Q47A 3DBHB 3IH2A 5HLTA 3KP2A 1VQ5I 4Y17A 5GANd 2ECBA 2F5CA 4G6DA 3R6SA 1X1AA 2PNIA 2NYSA 5ICEA 1JJ2A 3DPUA 2CYYA 4KICA 1WI7A 1IZ1A 1WJSA 3GVAA 4HX7A 5CVJA 3DKMA 3QHSA 4F7UE 2XAQA 1NG2A 4M3DA 1LPLA 1HDDC 1RETA 2IJLA 1RAFB 4J01A 1M9SA 1QHHD 4HPQA 2H3JA 1Z3XA 2HXIA 4PCQA 2KYMA 1HJDA 2LY1A 3MKDA 1Y0UA 1HXDA 2DFIA 4I0BA 4DYQA 1GXQA 1BI1A 1HK9A 2DRMA 4KRTA 5BOXA 4ZYGA 4CYCA 1HF0A 3GP8A 5FU6B 4J9IA 1Q1VA 2DN0A 5HLHA 1OCTC 2M8GX 2FEZA 1TNTA 2L9NA 3FLGA 2HQRA 5D6XA 1QVFS 2CO5A 3L1AA 4RTTA 1B72A 1KC8C 1MGTA 4GFBA 4U87A 5HVQC 3B73A 1R71A 4KMUX 2H8WA 4O6JA 4UUVA 3CXCS 1GBRA 3CLOA 1I4K1 3PGGA 3G4ST 4XOTA 1JTYA 1WZOA 3A01A 4GLMA 2VGMA 1RKWA 1ZKGA 2IA0A 1IRFA 4M71A 2VUBA 3WU0A 1VF9A 2D1HA 3QODA 3HL8A 4E2FB 3FC3A 3QU3A 2XAUA 4LB6B 2C0OA 3OS0A 3V7RA 3H3ZA 1U2WA 2HSEB 2H8HA 3TSWA 3EG9B 2OTJT 5GTHC 2ZSHB 3W3CA 1W1WE 3SDGA 5JI6A 1EH6A 3JTHA 3JRGA 3VWBA 2M0YA 4AMCA 4J9BA 3QPTA 4I7HA 4BS9A 2NS7A 2JS0A 4MFDA 1JBMA 2E7WA 2E70A 3RKYA 1VQ8Q 2V26A 2HQ5A 2NWMA 1ZLJA 4N0AC 3D7SB 1B34B 2HVQA 1LB2A 1BW5A 4LK1F 1EH8A 4DNCA 2KYBA 1OYIA 4HKEA 5KYUA 3TEEA 2CUJA 3CBOA 3HTUA 2HMAA 5LJ3j 4HBLA 3EG1A 4J9HA 2CQXA 2QUFA 4U7DA 2I2LA 2HOSA 1D3BA 1ZG3A 1VTNC 1H641 2P0KA 3TREA 2COBA 3HZJA 2BZXA 2DFUA 3WTYC 1ZR4A 3EGXA 3ZL7C 3CMEQ 1OCCH 4A3EJ 3SWNC 1UGVA 1YITQ 2MD5A 4LDWA 2VJIA 1PWTA 3ZN1A 1ZGAA 5B66C 2CP5A 2RI2A 3MWMA 1YCYA 2D5VA 1QVGA 4JUVA 3CC2I 2MG4A 2E7XA 1SD4A 3K69A 2VBXA 5K7FA 4ZYHA 3CZ6A 2QDLA 5J3BA 3CD6A 3BZKA 5ICFA 3KP4A 1C0MA 2CW0F 2CQKA 3KBGA 1Z0XA 4BJTA 3BTLA 3LWFA 1S29A 1K1ZA 4XKCA 1VYVA 2A3SA 3OIOA 2YX7A 3OV8A 4OWRB 4HF1A 1WXTA 3HTRA 3MEUA 2RH2A 1M1KU 1Y56A 1MJ9A 4HVVA 2JZ2A 1X1BA 2COMA 1I1JA 2AKLA 3O5ZA 3CC7Q 2FMYA 5A0DA 1MZBA 4M7AG 1R0BG 2EZKA 3D5SC 1OCOH 4JOMA 4C2MJ 4AFQC 3VDXA 1WCMJ 1ZHIA 3KLOA 3OBYA 1HW2A 1N25A 1XSVA 4F91B 5DM6F 2P7VB 3CEYA 4D1QA 2JVGA 2QXFA 3EH1A 4C92F 5CCAA 1XOVA 1JXMA 2AO9A 3H3UA 2DQLA 2R57A 1R5GA 3TO6A 1ZA2B 1JT0A 7AT1B 3J81E 1PYVA 3CUQB 1I27A 1VQKA 1QA6A 2DAOA 3BR1A 2JT4A 1YJNQ 2R4GA 3L2QA 2XF7A 3C95A 3HGGA 1Z7LA 5CVRA 3EAEA 2FZCB 1QU3A 1KC8R 1Q81C 2J6OA 2ZPFB 2D1VA 4AYBN 1Z21A 4M7AA 3CPFA 4XLNF 1M90U 1JQQA 2VT3A 5E18F 3S17J 4A3GJ 4E47A 2ZNZA 4F7UB 2ADUA 1KHCA 3BTCA 3HUGA 3SQNA 2M9UA 4JJCA 4L0YB 3C7JA 2QQRA 1MDMB 4HZFA 3WG7H 1UHMA 1QZEA 3R61A 4M75C 3H36A 3OB9A 2HZTA 2MBFA 4M6YA 2OA4A 5LGNA 3I71A 1NK2P 4N9IA 1OZ2A 2FF4A 1UMQA 1RABB 2QQ9A 3CJRB 2RJFA 1TP4A 1XD7A 2NUTA 1F9NA 3DFGA 1SFXA 4C0GA 5EG0A 4KITB 3B6AA 4Y91A 3ULRB 3VYHB 1IXCA 5BS6A 2XC7A 1YFNA 2JMAA 2ESNA 2LDUA 5DTDA 4CCKA 2VGNA 3F8FA 5LJ3h 1YG2A 3EQLF 3U21A 3H0GJ 1J59A 4HSRA 1SMYF 2FUG2 5E17F 1KQSP 1ZBXA 3CC4T 2K4JA 3MAJA 2EKHA 5HLGA 2L2PA 2L3QA 1O57A 3OSGA 1MNEA 2L7MP 3M9AA 3GZ5A 3J7ZI 1W2BA 4Y33A 2RA2A 2CH4A 3FHZA 4CUGA 3TW7A 3SEMA 2ZCWA 3GZ6A 3GXOA 2FPEA 3QYHB 3G4SI 2F2EA 3WHBA 2PVGB 1A0NB 4ME7A 1YS6A 3C18A 2MI6A 3GTPJ 1UB9A 5FKNA 3DF8A 4I0AA 3TP0A 3OYCA 3CCMI 4IL6C 1XPXA 1X4OA 2NS0A 3TVTA 1JJ2P 2XRNA 5D5WB 2QQ8A 2PI0A 1WXUA 1Z9QA 3CDLA 2V9KA 3NTHA 4L5GA 4M77C 3L1PA 1I8FA 2O9VA 1J2XA 1SSHA 4A6EA 2RJDA 4IUTA 4Z6YA 4RTUA 1J0RA 3NHNA 2HKQB 2OZUA 4LGWA 2LF7A 1VQNA 1I5LA 2LJ1A 1J09A 2QGUA 4J9EA 4DBRA 1YRNB 4PGHA 1H0MA 1E7OA 2HBPA 2JRTA 1LE8B 1UG0A 2NUPA 3KXTA 3N4MA 5KNLA 3OS1A 4HVWA 4MMLA 4RUGA 2J06A 5HLIA 1OV3A 3QOEA 2BY2A 2HD0A 3NPFA 1VQ9A 3TBIA 2X4XA 1G3SA 5DCMA 1BC7C 1S7AA 1UTIA 2QEXA 5KAFC 2VI6A 2NVXJ 1Y7XA 3ZOBA 2TCTA 1K78A 2E3IA 3EYIA 4PK4A 3META 1QVPA 4N0AA 2MYSA 3S6WA 1VQKT 3HSBA 1POGA 4UUSA 1GCPA 2K9SA 4BACA 1SD5A 3HG9A 1ETKA 1X3WB 5DS9A 5CQXA 4Y52J 2EA2A 2IS4A 4M4ZA 4E7IA 2QASA 2DJNA 1Y6IA 5IT9Z 1LOJA 4L18B 2M3AA 1ETXA 4LG0A 3QWXX 2KMTA 3A1PA 2X4YA 3SWNA 4XL9A 5LEKA 5BPIA 1M3AA 3WE2A 1V1CA 3VODA 4PJOB 1BK2A 2GA2A 1AKHA 5E1WA 2MIOA 4NDLA 2F69A 5M5YJ 2UXNA 1ULYA 2DOEA 5HNHA 5ILUA 1EKEA 1T2KA 3BTIA 1H8AC 1G2HA 1QHGA 2LFBA 2C6YA 1TQIA 2EJRA 1OI1A 3JCMf 4M7DC 2FBKA 1PD0A 2R7ZJ 2P84A 3Q1JA 4HOBA 3E7LA 1P2FA 5DDGA 5HKCA 3K4BA 5LHGA 1BC8C 2P81A 5DY9A 2MZ4A 1TUGB 2M7AA 4I02A 4IIOA 1PRLC 4GGGA 4Y13A 2B0LA 3OS2A 1F43A 2DJQA 4B44A 1FBQA 2XASA 4IVNA 5HOOA 2D0QB 1QBJA 2IRFG 2GTOA 4CC4B 5KYWA 1TT0A 2QSFX 1E3OC 2F1LA 3ZMSA 2Y4YA 5CJ9A 1M1KC 2DYRH 2F4IA 2KSSA 1GUUA 1KU7A 3E6MA 3L7WA 3CMAA 2K5IA 1W6XA 2H3EB 3M1EA 3IH3A 2HOEA 1C1AA 3LH0A 2KZGA 2M35A 1SKUB 4A4FA 3UPUA 3U1DA 1XG1A 4FHTA 4A63B 3G6EQ 2M02A 1QCNA 2X3WD 1K9AA 2X3XD 3H9NA 4M75G 1TQMA 2H09A 2XF6A 5CVIA 2KRSA 4KH1B 4BDYA 4IHWA 3CCQI 1ZG1A 3BTJA 2WB1N 3S2WA 2VB6A 3HP9A 2L2OA 1GVDA 4CYCB 4EMSA 1J9IA 2LG4A 2MGQA 1NYGA 1NE8A 1RLQC 3JCMX 2QA4A 1LJ9A 5D6FA 2RJCA 1K4US 3MP8A 1WH5A 1B8IA 3ZCOA 2VJ4A 4R79A 5IPAA 4RAFA 3MZHA 4OF1A 4X1EA 4JBAA 1WNLA 4CCOA 4C8QF 1W36D 2MUNA 4HRIA 1HOMA 2BHYA 1B9MA 3FEOA 1V54H 5J1YA 2E1HA 1M90C 1K83J 5J6XA 1AU7A 1V5FA 4U88A 4X9DA 4XNFA 4M75A 2IGMA 3EFOA 2JMWA 2DMOA 2K9NA 5FRNA 2R7UA 1VQOI 2RHUA 3OSSC 2O4XA 4I76A 3JCMe 3JB9G 4CRIA 2M30A 3GTMJ 2JJ9A 3THKA 4EM2A 3BR5A 1MMSA 2BHZA 3KFWX 2X51A 1JGGA 4M3BA 1VQMQ 3OW2P 3SZTA 3QYBA 4WTOB 2VBWA 2RQQA 4M77G 5EEGA 3JW4A 3KZZA 1B1BA 5I22A 3CCLT 3RMSA 3O6BB 2V8JA 1YI2Q 1ORKA 4ESFA 4ELYC 2K3PA 2JK3A 2LSOA 4IPAA 2GWRA 3SFZA 4WX9A 1HSJA 1VQLI 1PKSA 5GAMj 1XN7A 2P0QA 3CCVT 1S72Q 1GBQA 1OU8A 3TQNA 3P5JA 3NWSA 4A0XA 2P0TA 2HQEA 3PFIA 3I0TA 2STTA 1IGUA 1PSFA 5GAN6 3CC7A 1R23A 4LFUA 2XDDA 2KXDA 1OX8A 3FMSA 4XTVA 2JA7J 4JX5A 3EH2A 3VYGA 3F8CA 2XK0A 1W7PA 1S3JA 2KIQA 4A5NA 1WRJA 2M4KA 3RPUA 2FX0A 1TSFA 3H0IA 2FQ4A 1RAHB 2XGDA 2DXUA 1B3QA 4MO7A 4MQVA 2QG9B 2ISYA 2LJ3A 2CG4A 2IPQX 4DBHA 3JRHA 3G1JA 1MMNA 1OLTA 5FLXZ 5IYDJ 4M77A 2XSJC 1BI3A 2YPRA 4OMZA 3CUOA 5K7HA 2LBFB 2NVTJ 1PKTA 1U5SA 1U3OA 3GW2A 2YUNA 3QJ6A 3JCMJ 3S8PA 1SRMA 2LK2A 3CCMQ 3MN2A 3FIFA 2HWVA 2RN8A 4AIJA 2BZ8A 1W2BP 3QWLA 3RI4A 4MTDA 4IUPA 3HXLA 3M57A 3CMMA 4IRHA 2EBIA 4YELA 1YBYA 2F6CA 4N4IA 2LNHB 1T38A 2PJPA 2GAUA 4LIVA 1M1KR 5D5VB 2KZVA 2VLAA 1Y1WJ 1FOYA 1VQ4Q 5F04A 3Q9SA 3PQKA 3S1RJ 1KGSA 5K1YA 3SYTA 3E5QA 1R7JA 1YIJI 2DMNA 2FB7A 2FPFA 3TEDA 4ELZC 3OMYA 4RAGA 3COAC 2DPDA 1UAAA 3GZNB 1D1AA 2SRCA 5L23A 3CDHA 3B02A 2M45A 3JRDA 3X25B 1WI9A 3RDIA 2MLKA 3UDCA 2PEXA 4L0ZB 5J3LA 2CRGA 4HW0A 4M78F 2XKPA 2OCCH 2OTJQ 4M78B 2LP0A 4ITVA 3VRYA 4C0DB 2OTLA 1W4MA 3HEFA 3WTTC 1X2QA 4QKUA 3CCSQ 2WB1A 5GAOr 3VYSB 2VT2A 3CCST 1WA7A 3R6OA 3S2HJ 2QA4T 1X58A 3RZDJ 3EUAA 1FIPA 2RI5A 1Q7YC 2AXTC 2W0ZA 3KYDB 4EJVA 3I4PA 3TU4K 5DUIA 5FB2A 2ZZDA 2OF7A 4RTVA 5IP9J 1BOAA 2DA2A 2DU9A 3GTLJ 3TDUC 3O8GA 4CYDA 4FSSA 3A8GB 1VQ8T 1ZARA 5GAOn 3ZMUA 1WDXA 2V7FA 4QLCU 1ZX6A 2Z5UA 3FK7A 5TGTA 3T5XA 1AWCA 4PGGA 3RKWA 2R93J 1IRGA 1MIJA 3GUDA 1CKBA 2DEQA 2K5CA 1W5SA 1YX5A 5GAMh 1QP2A 2Z33A 4E7ZA 3CMET 3C94A 4HT9A 3W6KB 2BUDA 2MPXC 1HKQA 4MLOA 2GFAA 1REPC 3FKJA 2EK5A 4KFCA 5CVVA 2XAFA 5EG0B 4E7LA 1CQTA 2DA1A 2XUBA 1LFBA 4A2UA 5EZGA 4WF2A 1YTYA 3C12A 3HOWJ 3CCJI 4XTWA 3KFVA 3CJQB 1TOVA 4XTZA 5GAOq 3CC7T 3R0AA 4IHVA 4F93B 4AVZA 3CCEI 1QWFA 1HCRA 2KFDA 4NQWA 4UVAA 1MGQA 2L3PA 3DLLA 3OYDA 2ZFWA 1GVJA 2K4BA 1VI0A 4G7ZF 2M8EA 1OISA 3CJNA 3GLXA 2CSQA 4M75E 5LHHA 3DBRB 1H88C 3QDFA 5JLXA 3ZN0A 2B8AA 4UV8A 1ZHFA 1CF7B 3Q0UA 2DYIA 3QJYA 4IQJA 3J7AW 1G3WA 3INZA 5IP7J 3RSNA 1JXOA 1OU9A 2DVJA 4Q48A 2XU8A 2UXXA 5H6QA 4XU2A 3MEAA 1RC9A 4LLLA 3KP5A 3HL2A 2R5ZA 2LKXA 1ZRFA 2JSPA 3JB9J 3JCMW 1O3RA 1PRMC 2LQKA 4A3MJ 4CXFA 3KUFA 3MEXA 5IH2A 2AZSA 1FZPB 2R58A 3GCMA 1YJNT 3LSKA 3VPRA 1M1GA 1WSUA 2EV6A 2NUPB 1WGXA 1R9TJ 2KDSA 3OYKA 3NTKA 4PJMA 3BG7A 2ICWG 2H1LA 4RDUA 3V8KA 3ZBDA 1VQPT 3M0UA 1H9GA 2ESHA 2NAZA 3Q0VA 3HSRA 4QIWN 2VPLA 2EFIA 2DDAA 2VPRA 2DA7A 2XAJA 1SEUA 2DXTA 1SD6A 2Y9ZA 2SEMA 4IUVA 1K9MR 4M77E 1IN5A 1B4AA 1LEAA 2DZCA 3C3WA 4DOWA 3G6EA 2D8JA 5IHIA 1G8XA 3WG9A 4LUEA 1FYNA 4P5NA 3J7AF 3L42A 1VYTA 3M8FA 2CQQA 2XSDC 2ZXJA 2HQNA 3SZPA 3I35A 1VQLQ 1ZAOA 5HCKA 3CPWA 3D0SA 4QVZA 3JCMc 3TQ7P 1AWWA 4XKBA 4YFKF 2QBYA 4LB5A 3S1QJ 3LFUA 1BM9A 1I1GA 2Q8KA 2J05A 1KD1U 4U0WA 3CC2A 1PSEA 3J80Z 3A5ZB 3I9QA 2H6CA 1OPLA 1M3BA 2F4MB 3OYHA 3I56A 2QQSA 3OA6A 5K5QA 1U5TB 1JUMA 3HBLA 2FRYA 3E19A 3EGDB 2Q2EA 4Z88A 4KYWA 2HOAA 4C0FA 5FKOA 1OEBA 2CP6A 3A8OB 2BVLA 3BPXA 3SHWA 3FK6A 4QVCA 2LQWA 3BC8A 4IIMA 1VQ5T 2XPUA 3BR2A 3PIPF 1OZ3A 4JRKA 1VQ6Q 5CKDA 4R1HA 4JK1X 3PVQA 2XD0A 3FXQA 4Q5SF 4XQ3A 1B9NA 2OX7A 4PFZA 2JA6J 2LQNA 4RCBA 1AEYA 5GAN7 2Y69H 4IURA 1X2NA 3M07A 5HDNA 3A03A 3BG5A 1X19A 2YT6A 2QCOA 1PNJA 3KP3A 2EZHA 4IZZA 1QVFP 1UZCA 3CESA 3WTSC 4D0PA 4RTYA 4A4GA 1FSHA 2KQRA 1X2KA 2CV0A 1BIAA 3DKWA 2M34A 2O6GE 4B48A 1OR7C 4ZYDA 2D9TA 1SFKA 1SHFA 1L0OC 2RVCA 3EGUA 2LH9A 1SANA 4DIQA 3VEPA 4L5EA 1VQ8I 2EYWA 1A6IA 3FZVA 4BNCA 3HYIA 4PJ0C 1TTHB 2R7QA 3BDUA 1GV5A 1S8NA 3OMCA 4GY5A 2KRCA 3ASNH 2BY0A 1KQ0A 2LTPA 2ZGWA 1D09B 4TVRA 2KR3A 4BI3A 3CMEI 1E6HA 3VYUB 4PSWA 1YITI 2AZVA 2YUOA 3T8RA 3VS7A 4HYEA 2QKLB 1JJ8C 2RQUA 1NPRA 4EMGA 3GOXA 4AC0A 2LCLA 2ETHA 1RL2A 2W82A 1WYXA 1RAIB 3LH5A 1KQSS 3OL4A 2FPDA 2Y0MA 2LMJA 2D8HA 2IGNA 4C3JJ 2OQRA 2I0NA 3FDRA 4BD3A 1K8AU 2CS7A 2XPVA 1D5YA 2DL8A 5D6EA 3RYPA 2XAGA 1BCMA 4M7DG 1X75C 1RIOH 5GAMf 3HDDA 3IHUA 4L5IA 3QBYA 4OIPF 1W36C 2MF2A 2DIGA 2AHQA 5C44J 2HKNA 4Z02A 4HSTA 3OYNA 1X3UA 1JJ2S 2E12A 4PDKA 1BJAA 1ODDA 1RRJA 1FTZA 4OOIA 1OPKA 1QWEA 2FZKB 2HSPA 4FYVB 5J39A 2BY3A 2OUMA 2DCEA 2XB0X 3O8HA 4IHXA 3KCCA 4LOCA 1MNDA 3SEQA 5F64A 2CSIA 2LZ6B 3BROA 3C0CA 4AIKA 5JVGF 4XAXB 3FDYA 3KYLA 4XOPA 5B1BH 3E97A 4XTUA 4A3CJ 3GX4X 1UJYA 1IN7A 4XONA 2JM8A 3FXMA 5F0HA 4I6ZA 2HOTA 1S9HA 3JSPA 4HVUA 5LL6S 1JXSA 3G7ZA 2AS5F 1M2VB 1YJNI 4J5YA 1LUJB 2DRKA 3IC7A 2FD5A 1BN5A 3BCBA 1Z91A 2R7TA 1MKMA 4RAZA 5KCMA 1HSQA 2M1HA 4KGZB 3HOZJ 2R5YA 5IOYA 2M0CA 3ASKA 5KYYA 4JRPA 3C4SA 4W97A 3Q5FA 5GMKl 4Z89A 2L4AA 1RZ4A 2QF7A 2G3RA 4IEJA 3PE0A 4RAYA 4F92B 3FJ5A 1IN8A 2ZBKA 4OMPA 4M7AC 3SJMA 3OYFA 2J6FA 4QVDA 4B3XA 1IDZA 3MP6A 4FCYA 3HSFA 2DK5A 1AD5A 1PD1A 2R7VA 1UJ0A 4JPBW 3NARA 4KA4A 3ISPA 4A53A 4XRSA 1ZGWA 1QMCA 2L9RA 1YWPA 1RQ6A 2L3RA 5GJWB 3CF2A 5IP6A 2QM3A 4A5MA 2CT4A 4DZJA 2XROA 1LQ1A 1WPKA 5HS7A 3BPVA 1WX6A 2QLZA 2QAZA 2MFZA 3OYMA 5GAMe 5DLOA 2HEOA 4PL6A 1CGPA 3BJ6A 5BQTA 2DA4A 5M3FJ 2F2WA 5IXBA 2QEXQ 2L01A 3KEQA 3BP8A 3EG2A 5D8LB 2E36A 3F6OA 2DBBA 1V29B 2EYXA 4QT7A 3WGHA 1JJ6C 4KDPA 4XTXA 1FMWA 5C0MA 2LC4A 2OAWA 5D5XB 3HRSA 2GBYA 1R8OB 4XBFA 2FXAA 4EM1A 2GNCA 3DXJF 3DTIA 3EETA 3UKGA 2PJRA 4AG1C 4J6XA 3DU5A 2CZ7B 3TMOA 3CQZJ 3HKSA 3DLAA 1XMAA 3ABMH 4N4OB 3KZYA 1ZK8A 2MH9A 4U0VA 1YP5A 2LCCA 3JCMQ 1XGSA 3E5XA 1UG1A 1KD1C 1NG6A 1QVTA 2GIVA 2GZWA 2IAIA 4JP0A 4UB6C 1IXRC 3IV5A 2JA8J 1GLNA 1DPUA 1NEGA 3JSCA 1FYLA 4M7DB 2ZKZA 1HW5A 3O8VA 5KYNA 3CPWP 1T95A 2EJFA 4KIFA 2ATCB 4RG2A 4XQFA 3T9NA 5J4YA 1TU0B 3EUHC 2CUEA 4NHJA 4DEYA 2K5FA 3D5LA 4Z8AA 5D6WA 2DOAA 2A5WA 4IF4A 4V2GA 5F0FA 1EIFA 2DA9A 2P4RA 2PVOB 2ROTA 1PC0A 1N27A 3PL8A 4C8QG 3FIWA 4G94A 4RM3A 1KQ2A 4J00A 3F8MA 1M5Q1 2WSCE 5ILSA 3DU6A 3BY7A 2B7EA 2KE9A 2WC2A 2A6EF 2EZIA 1PJRA 4BEHB 3E0JB 2HKOA 1WXBA 3CCQA 4IOCF 1OR7A 3O2PE 2PBIA 2O31A 2V8IA 5LRSA 3CCMT 2JN6A 4YIFA 2RQVA 2JSCA 3UF4A 5FKMA 5LGTA 4EGYA 2NXNB 2YR2A 1WWXA 1R6RA 4RA2A 3TOAA 5J1RA 1H9TA 4BXXJ 2VBZA 5F0CA 3OIQA 5LFAA 5EGOA 1N9RA 1USSA 2V6EA 1G83A 4OU0A 3QO3A 2EFOA 4Y4RA 1O3TA 4EJOA 1ETWA 2KRFA 2EQIA 1UGRB 2R3SA 3ZPLA 1N9SA 1UDLA 1VQ4T 2XB5A 5CKTA 2ZJRF 3HRMA 4FT4A 3VOEA 4JYKA 5EZHA 3F22A 4C8QA 1LNWA 4HF2A 5D6YA 1KZHA 2Y4XA 1ARKA 1A36A 3EDPA 2MH2A 3FXJA 4ZTFA 2E5NA 3CC4A 4KMFA 3ABLH 1ABQA 2DF6A 1FEXA 4WK8F 5DM7F 2BY1A 1IGQA 3LFKA 2J5PA 4EJUA 1ABOA 2WSEE 1AVZC 5FU7C 5C4XJ 2BW3A 2RV8A 1FP1D 2DL7A 1XCVA 1GT0C 2L0AA 4BH9A 5FFZA 4P55A 4NC7A 3ZGKA 4C9YA 2VC1A 2EFWA 4ENKA 3CO7C 3I9V2 2YUSA 1I1SA 2DJIA 5KAIC 2OAUA 5A0GA 5I2SA 1LEBA 3SDZA 3GBGA 4HNVA 2GOXB 3HFOA 3JCMh 1IG7A 1K8AC 1OYXA 4C92D 4RGRA 2W57A 4JX6A 1K0SA 1BR4A 3G1LA 5D4RA 2JNGA 2P5KA 4ZYAA 2FVUA 2P0PA 2K4YA 2KI7A 2DTRA 3FXRA 4RMNA 2LRQA 2W10A 2EQJA 4ZN1A 2WAFA 4XORA 1K79A 2O9SA 4F17A 1W2BS 3U1KA 3TKYA 2CZ6B 4GLKA 3A1YA 4E7JA 1AOJA 2LTOA 2KJBA 2YLBA 4J19A 2FQ3A 3FMQA 3T8TA 1DU0A 3I59A 2ZXWH 3G6EI 1KD1R 1LNXA 2GF7A 1PG5B 3HGYA 2O03A 4XLFA 3V7SA 1H92A 1BR2A 5LJ5j 3CCRQ 2EA4A 4MIMA 4AG2C 4XLCA 4CZCA 4Y28E 4FE7A 5C4JJ 2J5OA 1BU1A 4RLQA 1JHHA 3HPGA 5KCOA 1YJ9Q 1MD0A 3BZ6A 4N9HA 2J6KA 5FKLA 2KRNA 1FX7A 3M55A 2ZMEC 3PIOF 1QVFA 1DGRM 2XHCA 3H0HA 3QUIA 4LN2A 2J7IA 4PFPA 4EGZA 2HDAA 2YRDA 3OBWA 1YIJA 5KCHA 4D9JA 2RC4A 4NB5A 3PFSA 4B9WA 4BUGA 4F7UF 1ZLKA 4JS4A 3VJPA 4YG2F 9ANTA 1TUDA 3QAHA 3MKZA 2NOJB 1HSTA 4A3BJ 5C6SA 4AD9A 3J81Z 2WBMA 3REAB 2COYA 4A3DJ 3KEYA 2M5WA 4WXHA 1BW6A 2QDYB 3CCQT 1GXIE 3VV0A 1R4NB 1YHQQ 3QIIA 3LWIA 1IF1A 1QQJA 2DTIA 3ESWB 1VQMI 3LX7A 3N5BB 2YS9A 5FFXA 4MMKA 4F04B 2FBHA 4MEXF 4LDVA 1IXDA 3CD6T 3AL0C 4X9CA 1YI2I 3MZYA 4GXOA 3GTGJ 4UC4A 1YJWQ 2KHMA 5IT3A 1S72I 1PUFB 2ZAEA 3LW5E 2M51A 2KIFA 1UGQB 1T0HA 1NZ9A 4OMFB 2JUGA 3L09A 4PJJA 1Z9CA 4EATA 3F3XA 5B5EC 2QQAA 2RHXA 3VS6A 4LDYA 3K70D 3S15J 4BAYA 2LNVA 3HHTB 1VQOT 2OZ6A 4L9TA 3NMZC 4C5EA 1NJIR 2DJZA 4IJAA 1U0JA 1DJ7B 3A8LB 1HW1A 2BE7D 2M7BA 5AIQA 2NUZA 2ZJ2A 5FKKA 2EYYA 4RKUE 3PT9A 2JTMA 1KONA 2LREA 3MZ8A 3N97A 2MC3A 1YFHA 2IS6A 1VQLT 1F1BB 4M3GA 4FQGA 2GGRA 3MKWB 4FW2A 5KHDA 3H9QA 1K8AR 2FMLA 3EUHA 3E6DA 2CMPA 3JCMg 3I55Q 3VU3C 2ZPIB 2EIFA 2A3LA 1Z05A 3CCEA 2HPMA 1AHDP 3HOYJ 4FTHA 3S3MA 3OR2C 4R56A 3WTZA 5L3FA 1Z7UA 2TDXA 2GM4A 1SEMA 3EFRA 3GF5A 1VQ4I 1FOXA 3IRQA 3WTVC 1R49A 2EVRA 3HC7A 5CKFA 5GANj 2W1OA 1NYFA 3LSIA 1M8VA 4A3KJ 1STZA 2H8RA 2ISZA 4RGUA 1SG5A 2HCKA 1VQ6T 2V79A 3QOPA 2WY7Q 4BUPA 2K6DA 1HYOA 1VYUA 1ZLMA 5LJ5h 2JPBA 3MKLA 2ZFUA 1TS9A 2RM4A 1K9MU 4PJOD 1HQCA 5H20A 1TWBA 2OTJI 3UR3C 3FBIB 4XN0A 1TLHB 3E6CC 5ECAA 2LMDA 1IRZA 3CCLA 1H3ZA 3CDIA 4KUIA 2XGCA 5FD6A 4XLHA 3CCSI 5FW9A 3CCVA 2QVOA 2E35A 3ZQIA 3WU2C 1F36A 1E6GA 1OJLA 1JUSA 2HQXA 3AG3H 3FBNB 1R00A 3HOUJ 1JGSA 2X1EA 1YIJT 1RUOA 4J9CA 3SDBA 4A4EA 1OYYA 1AA7A 2G0EA 2DDBA 3C2HA 1RI7A 4KUMA 3BW1A 3MHXA 4XU3A 4PJOF 2P4TA 2LCSA 4WCGA 2VC0A 1NLOC 3CCUQ 4L59A 1XB4A 2K9QA 1T3SA 1WHKA 3VS1A 8ATCB 4CSWA 5IN1A 4RS8A 2DLPA 2OCEA 3BG6A 2BZYA 2MSYA 1VZ0A 2JS2A 2Y0SN 1MHNA 2GXBA 3ZQCA 2FU4A 2CSOA 1EX4A 4LDXA 4ESJA 4HCBA 2WAQN 1L3LA 1I3AA 2Y31A 1NH3A 1R1UA 1FOKA 2UUZA 1U06A 2DKGA 1N8RR 2JA2A 4EEFG 5A2QR 4BJ6C 3M8EA 2OQGA 4BBRJ 4ZDOA 1O9SA 3ZQGA 4KIBA 3RYRA 3VS5A 2K79A 4M7AE 3A0HC 1GV2A 4EJWA 3GF2A 1QVGP 3H5NA 4MDXA 3JAMR 1IN6A 1I07A 2YU3A 3NFCA 2XV4S 4PLLA 2W25A 4U0YA 1R58A 2KP6A 1JU5C 2YU9J 3RIRA 3OYYA 4O3MA 2LNBA 2HR3A 3BDLA 4C8QD 2D0NA 3S93A 1X1DA 4YIIA 2ID3A 2JRMA 5HDKA 4KNYA 4OIOF 2HFHA 1FXXA 2LT1A 2ZMEA 5A2QK 3ZQFA 1MV3A 2LT4A 5I11A 5BPDA 5GAN4 3OYAA 3VB2A 3P9CA 2R5MA 1BR1A 2OAZA 2UV1A 5E3LA 2DD4A 3S14J 2DAQA 1QZYA 3CCJT 2K2MA 2HTSA 4XMYA 3CCET 1WVRA 4A0ZA 2DO3A 1B6AA 3UA6A 1EF4A 1B72B 1DGWY 1BI2A 5ICGA 4M3EA 1EFNA 5GANh 3LSRA 2EJ9A 3AFHA 3A98A 4G9YA 3QG1A 1S5LC 2HEQA 1VQ8A 1G4DA 3J80R 3A01B 2AIRB 3BG9A 4D7MA 1TZLA 1XTAA 4S04A 3OYIA 3ERED 3S3NA 3M4GA 3MO8A 3M58A 2DM1A 2QGGA 2GXAA 4C5GA 1D0ZA 2D6FA 1PDNC 4P9UA 4HLXA 5FD5A 4DJAA 2O2OA 2O88A 5EGOB 3CMEA 2WAEA 1YITA 3H0DA 2K5LA 3L2WA 3ZMZA 3K10A 5JFRA 2VN2A 2JTEA 2H27A 2WSFE 3P7NA 4MHGA 4KUDK 3HSEA 2ID6A 2MWPA 3QZ9B 1B07A 1PHTA 5DLQE 3IKTA 2D2WA 1Z77A 2KL4A 3RCOA 5KYUB 2UZKA 5EYRA 2DZ9A 2DQRA 3H6ZA 5E1ZB 5KH6A 2FOWA 1MBJA 3F8BA 2P0WA 2RHIA 3G71Q 4CO8A 1E3HA 4HCCA 3FJPA 3ZXSA 1D3BB 1PCXA 4XK8E 2HZDA 5HS9A 2XDVA 3KZIC 5LRRA 4A6DA 2I5UA 1XS9A 1N75A 1ZRDA 2KXCA 3EGXB 3VS0A 3RKXA 5D7UA 1Y1VJ 2O61A 2OI3A 1KQ9A 4M75B 4EMKA 1MJBA 3OQ5A 1VQ6I 1NEBA 1JB0E 2LYCA 5F1RA 1WLPB 3BFMA 3GFLA 4PLIA 4CA0A 1TNSA 2M0OA 2ZPHB 3JV3A 2Y0SA 3DPLC 4PZJA 2KGTA 1AZGB 3QSUA 1K76A 2XICA 1HD3A 3J7AO 2JTVA 2WAQA 4M78D 1VQ7Q 5H6RA 3TW6A 4IRIA 2UWMA 5GMKm 3DP7A 4HG2A 4KULA 3ZP5A 1GCQC 3KP7A 3OR1C 2PUOB 1I5OB 1YJNA 2FBIA 2MABA 4XM3A 4BQQA 2DPUA 5LJ5f 4C92C 2V1DA 1FYMA 3L2UA 3JRIA 2MOXA 1VQPA 3NEUA 4FE4A 2E34A 4BYYA 2ME6A 1IUFA 2R92J 4ZN3A 1ZSZC 2KJCA 1K0XA 2YWWA 4BHBA 3JCMV 2CH0A 3OW2A 1A5JA 1UECA 4I01A 4LXCA 4FM4B 4E7KA 1ZG5A 3V42A 2IBDA 3M4OJ 2C0IA 2FNPA 2RD1A 1K9MC 3D1NI 4HLYA 1ZUYA 5M3MJ 4BQOA 3P8HA 1UHSA 1UG2A 3HTSB 2X9HA 1CKAA 4D8KA 4F14A 1A35A 2P8TA 2YRCA 2RPNA 3U23A 4OMYA 2AQFA 3ONQA 2CUDA 4QW2A 3GMEA 1X6GA 4C5IA 4M7AB 2VQHA 2DPPB 1XMKA 1HKSA 1AOYA 2A28A 4JJNK 1JKQC 4FU6A 2A07F 2A37A 2IEKA 2HQAA 5EC7A 2K85A 2PX9A 1Y57A 2CH4W 1MMAA 3HUGB 5LGUA 1Y96A 4M77F 3LOCA 1JRIA 1SHGA 4AUXA 4W1UA 1OCRH 2OU2A 2E65A 1RI9A 5J26A 3Q3SA 3A2KA 1W0UA 1VQ5A 4HT8A 2KBTA 3GTJJ 3PUBA 2ZNYA 5EDNA 1IJWC 2Y9YA 1YN8A 2VONA 1WQWA 2R0QC 1OCZH 2JQ7A 2GBQA 4DOVA 4KJZA 2DYBA 1YITT 3ABTA 3GPLA 4G6TB 4XK4A 2PLYA 3CPWS 3M0SA 2AK5A 2DL3A 2E2JJ 4ZC3A 2NUTB 2BIVA 2L8DA 4E7HA 3M5AA 5DM7R 3K4CA 3GO5A 3FXLA 1TC3C 4CICA 1ZRCA 2O8KA 6PAXA 3K4NA 4XRFA 4RB1A 1NM7A 5LJ5e 4AVPA 5BMZA 2ESWA 1QPIA 1FT9A 3DKXA 3ERMA 2HU9A 1W0TA 4ZDLA 4UVCA 1WJBA 5HNFA 4UY8I 5E20A 4NOYA 5CO7A 1FNNA 3HOXJ 2RK2A 4BBSJ 2X9DA 1ZSGA 4XTYA 4UNOA 4MFEA 4FASD 4QTRA 4I99C 3ZQ7A 5GAOp 4M7AD 2WV1A 4YIRX 2DTOA 4PUSA 4RGSA 1EJ9A 3RDVA 3FWEA 4HX8A 3K70C 1U9NA 4F52A 3TCJA 3P9IA 4FX4A 1GHCA 4K11A 2EKOA 4Y7NJ 8AT1B 3FB9A 3IUOA 4YFNF 3MEWA 5KYYB 4DYRA 3QWYA 1BIBA 5A2QE 5GANf 2O01E 1W1FA 1D3YA 4ZZDA 3IH4A 3EG9A 5EEAA 1P9QC 1N5ZA 3CBPA 3LSTA 2DLLA 1YJ9T 2VQLA 1X4PA 2JOYA 3JAME 4H4KC 2VJJA 3E6BA 3URGA 1X1CA 3S1MJ 3DKYA 2EIKH 1OYWA 3WGGA 4D6WA 2NVYJ 4M73A 5CQEA 1I39A 4ZGJB 1B34A 4MZMA 1Q86U 5DCMB 2GA1A 4EM0B 1O7FA 4F3QA 4UVBA 1RKTA 2QEXI 1M2OA 4J83A 2A7YA 3QDRB 2KLOA 4XLEA 1J5YA 1V5EA 1K78B 2DD5A 3MPUB 1F4KA 4C2TA 3ZQHA 4S05A 4UUSB 5D5UB 5FJ8J 3JRAA 4HDUA 2HL5C 2A61A 1UHFA 2LX7A 4HX4A 1LFPA 2R7RA 4AT1B 1KQ8A 2Z3YA 3OYJA 5CQYA 1XGMA 9ATCB 4PJOC 4BXUA 3BCAA 1J75A 4LG0B 3V7CA 2LY2A 2QI2A 3SWNB 4C92G 4JJDA 5TISC 5FWCA 1MBEA 3RERA 1MBGA 2DA5A 2RREA 1XDSA 3F6VA 5EEHA 2NNYA 1C0WA 3HFNA 4FT8A 2KT0A 1BOBA 4BQNA 3O3KA 2ZJPF 1AKHB 2XHKA 3SHFA 4E6KG 1WHUA 4J7IA 4B4CA 3L2RA 1EZZB 2L54A 2M9HA 1I5ZA 2DK8A 1TWAJ 2IIMA 5I21A 5GAMg 5D8KB 3PQJA 2RI3A 1T08B 3BOQA 4BHPA 3IL2A 3AT1B 4AFSC 3M0RA 3H9JA 3KEOA 4IRGA 3GFIA 3GEZA 1GCQA 5GANe 3CD6Q 1FP2A 1Y07A 4MTEA 3RESA 2V9VA 3QPHA 4U7BA 2F2VA 4C92A 1T33A 3WE3A 2PMHA 3FHNA 2JZYA 2W48A 4C3IJ 3CUQA 1H89C 2K40A 2OD5A 3P9KA 4C2UA 1TXQA 2MLGA 2DFHA 2LVSA 4D8DA 1RACB 1UGSB 1ZSZA 1OMIA 3CP2A 4X1VA 4GYGA 3S2DJ 4XU1A 1D0XA 2G9WA 1BB9A 3FKIJ 3FM5A 1ACIA 1KSWA 4AFUC 3PIOA 1AWOA 3MCAB 2EGEA 1IXSB 2E6NA 2FL7A 2VVKA 2VQGA 1O75A 1LKXA 2ED0A 1JO8A 2R5AA 5LJ3d 2PG4A 2EFPA 4BKXA 4UUTA 3T0YA 4DGWB 3DWLE 3E5UA 4KN7X 5J47A 3I4MJ 2E5QA 2RQRA 4CGZA 5E3NA 3A8HB 3PVLA 3M3YJ 1VQKQ 4RB2C 1MDMA 1EA3A 3MCZA 1NJIU 3FMRA 2EQKA 2XG8D 4C8QC 4M9XA 2E1OA 2L3DA 1VQMA 4XN3A 1UHWA 3N05A 1B8IB 4JX4A 2A68F 3L2ZA 4XSZF 2EIMH 2R7FA 5EJCA 4II2A 3OMGA 1XGOA 2FOKA 2HYFA 4OB3B 2E5ZA 4QWQA 2PU9B 3H92A 2K02A 3L9FA 2RB6A 5GAN2 4M3FA 3JREA 3K2ZA 5AONA 1FMVA 1JKRC 1S72A 1I6HJ 1XQHA 4QQ6A 2XGXA 2PUKB 1EH7A 1XGNA 1R0CB 1RPWA 1SF9A 3M7GA 2P6TA 4I09A 3EFOB 2RDPA 4ENNA 4FL6A 5IHNA 2K86A 2O4XB 5LEJA 5TRDA 3UWNA 3DTKA 2VOOA 2GTJA 3LGFA 1ZUUA 1RUWA 3DEUA 2P5VA 2E2HJ 1JT6A 1WFXA 2DT6A 1VIEA 1ITYA 2JT1A 1USTA 5GAOl 2Z1DA 4MEYF 1LFUP 1OX9A 3G3ZA 2EV0A 2L5QA 2I8DA 4F55A 2QTXA 3CCUT 1ZUKA 1V4RA 3U2RA 4AU7A 1YX3A 1MBKA 2BE9B 5CVUA 4RTWA 2ECZA 4OAZA 3HKZA 5LLQA 1IHWA 1E2XA 3H0FA 4FT2A 4BY6C 3EG0A 2DXBA 2DEUA 4TV7A 2LR8A 2QSHX 2XDPA 3CCMA 2A0FB 3ME9A 3FISA 1QW1A 3OYGA 1I3QJ 3FXUA 1WJDA 3ECHA 5JHFA 1ZN2A 3CCRI 3R4KA 3BR6A 1M4ZA 2B9SA 3JB9F 2EPDA 1QQIA 3TP3A 1W7PB 4XRSG 5GP9A 1K7AA 3PNWC 1QKWA 6AT1B 5J4VA 2ZO4A 1TWFJ 3JB9I 1YJ9I 2EV5A 2EFNA 2V1RA 1BL0A 3E9GA 4MZPA 5M9OA 1QPMA 1FY7A 2ECCA 2FSWA 2JJ7A 2W00A 4KN4X 3OSFA 1YRNA 3K2AA 4G8XA 4JZ4A 4M77B 5CLSA 5ED4A 1VQ4A 5J1UA 2HTJA 3M8JA 4L6V5 3IKVA 2PQWA 1YQAA 5K5RA 4JRQA 1LE8A 1A6QA 2GFUA 4M9ZA 3G6ET 2LDMA 3BR0A 3PSFA 2V8KA 2CP7A 2ELHA 2WY8Q 4PJOG 5GTIC 3SFMA 3RR6A 2CWEA 3IWFA 2OTJA 2AHJB 5L3BA 3PUFA 2A08A 1OQYA 1VQNQ 2KEAA 2BGCA 5FWBA 1YHQI 2DFFA 3DV8A 2Y30A 1WQ7A 4LJZF 2X1CA 2CREA 3CCSA 1UB4A 4A93J 1K4TA 1P7JA 1Q81U 3PNVA 4XLPF 3BE3A 3AHUA 1QGPA 4M78C 1O3QA 2X35A 4DZPA 4PJLA 4HNUA 5IXFA 4C0DC 1D5VA 4X34A 1YJWI 1NBEB 1VQ9Q 5ILVA 2QZ8A 5L8RE 4ON0A 1N8RU 4PKCC 1KYZA 3BR3A 2ZPGB 3LYIA 4F7ZA 3QXEB 4M7DD 1NTCA 2LQ8A 2DA6A 4EJTA 2EYZA 2ZSIB 2EILH 2V4JC 4MQ9F 1R36A 4GRIA 3MJXA 2BVMA 4IUUA 3RTRA 1IO2A 4O5VA 1R4MB 3CCLQ 1T8IA 4PJOA 1RADB 1VA7A 5E8IA 1IRXA 5HS8A 2RQPA 1WZ2A 3CCVQ 3DB4A 2F5EA 2NNNA 4OB1B 3CP8A 4B3AA 2VXEA 5GAN5 1VQMT 2E19A 4DW6A 1YOVB 1Y0MA 2VWFA 5HK0A 2DERA 3G1MA 2FO0A 5CKBA 4C92E 3LA7A 2X4HA 1YI2T 2KPMA 2CQNA 4HDVA 1QVGS 4N0BA 3F72A 5KVRA 5L3CA 4Y92A 5HK3A 1S72T 4M7DF 1OOTA 3LL7A 4DOZA 2KRMA 2W85A 3X28B 1BYMA 4J7FA 3I55I 2KIUA 2PFBA 4F16A 5L3DA 3W6VA 5KE2A 4ESRA 1LDJA 3PM1A 4CCNA 2PN6A 2E10A 3G71T 4A3FJ 2BZTA 5DEQA 2ZCFB 1XTDA 2PMUA 4CCLA 3LSJA 3LNQA 1M30A 4RBOA 1YW9A 3AG4H 5JHUA 2E64A 2DI3A 4CCJA 1WKMA 5DCFA 2AT1B 5IT9R 5ICCA 2L7KA 3RBBB 2PMZA 4M74A 1BBYA 2JPCA 3EHQA 3QP6A 1TTYA 2K3XA 4K2EA 4WWCA 3K4JA 1WJRA 4P96A 4KT5C 3DLLF 2PZ1A 1ERDA 1UJ8A 2JW4A 5AT1B 4NQWB 4B9XA 1QCOA 5K5OA 2F5VA 3JRBA 1FMKA 4NBQA 1VQ7T 2P6SA 2VQCA 3EPZA 2BBYA 3RQIA 1BCOA 4D7NA 3D5RC 2IVWA 3CMAQ 2ZB9A 1MJAA 1P7IA 2JTFA 2E71A 3DEEA 4LG3A 3V4GA 1W4SA 1JKPC 3ASOH 1ZBJA 2ZJQF 2X4JA 5IT9K 4M72A 2ZXHA 1JTXA 1HKTA 1T0JA 4KT6A 2BXZA 2HXOA 2AXLA 1SAUA 2A69F 2VE8A 2DL4A 3JRZA 1QRYA 2CP0A 1MSFC 1WJCA 4BQAA 2BTTA 3FM3A 1JI8A 4Q5WA 1SMTA 1VQOA 3C2BA 1WHHA 1ONVA 2L89A 2DBKA 2KAFA 5GAEJ 2VKNA 2R5ZB 3P8BB 1G3TA 4H0EA 5GMKj 2QA4Q 1ZELA 3CCUI 1PP8F 1XNIA 4B6MA 2EZLA 3MKYB 1NJIC 2E60A 1WQ2A 1NK3P 1ZH5A 4P1WA 1OQKA 1X43A 1VQLA 2L02A 3PFYA 5L3EA 1AT1B 3BDDA 4ESBA 5E8GA 3NQOA 1Z1DA 2G7HA 4FISA 4DQ2A 4MZTA 4EPCA 2O9LA 2IS1A 4ABZA 4OMQA 5GAHJ 4B47A 3M1CA 4LLGF 2IVMA 2KROA 1Q86R 1HDPA 2F2XA 4DA4A 1UHCA 1D8KA 4DYCA 3KE2A 3GTQJ 3M59A 2EPFA 2X1DA 4Z2YA 4ZTJA 1ON1A 5J8FA 1F1ZA 3DB3A 3LLRA 1ZGJA 5CKHA 2L3SA 2VODA 3LWHA 3VRZA 1S1NA 2F5FA 4C30A 2CJJA 5E1XA 1SC7A 4UB8C 4LD6A 3GFJA 4YTLA 1FWZA 4BB7A 1TT5B 3I64A 5F1JA 3ER0A 2F4OB 3M56A 1U5TC 5LHIA 4OMMA 3REBB 3IAS2 1V55H 2M2EA 1U1TA 1VQ6A 2QBYB 1A04A 3LSMA 2LBFA 2Q1ZB 1U78A 1SSFA 2VKEA 1TW3A 5F08A 2MC4A 5IYCJ 1VFCA 2DT5A 3OL3A 2RHYA 4RLFA 2F5KA 2RQTA 3M4YA 4R0KA 2A36A 3I56I 4M78G 2V1XA 2FYKA 3GIBA 3BJAA 3Q9VA 2Q2EB 2ACJA 2N8GA 3WTUC 3JCUC 3IP4B 1HBXG 3A8MB 2LKSA 4J6WA 2DA3A 3BLYA 1D1CA 2DMPA 3WTXC 1IO6A 4ZGEB 3ABKH 2EAYA 3R60A 4M6XA 1ZR2A 2ROLA 1LCKA 4ZZLA 2X6YA 2YHTA 2X48A 1YYVA 4B8XA 1NPPA 3CXCA 1WJ5A 2HNHA 2LRDA 4KIGA 4BGDA 1JE8A 1YS7A 1HLVA 1UE9A 1BKBA 1G3YA 1X6OA 2O7OA 3OYBA 2MK5A 4PJOE 3ZQQA 2DL5A 3VYTB 5C3EJ 3RKQA 2XI9A 4C3HJ 1YJWT 2FG0A 2HPIA 3FXKA 4C92B 1P4WA 3TO9A 1X01A 5FLVA 4M6VA 2MVTA 3C1DA 2Y90A 4M78A 5GAMd 1QO0D 1TW2A 4BL0B 1WHLA 1ZSZB 1R1VA 1MBFA 1U8BA 2EJGA 3F70A 2V1QA 4N4HA 5FLXR 5BNGA 2A5YB 3X24B 1G6NA 2IW5A 4AIDA 3EHRA 2VUMJ 1VQPQ 3E3VA 1K6OA 1WHJA 3A02A 1Q1HA 4BE1A 2WA0A 1ZQ1A 2XAHA 2CGHA 2VYTA 4MDWA 1GL5A 2KDZA 4ENMA 1YIOA 1MMDA 4OAYA 1N8RC 3IRRA 1FIAA 2P5LC 1TWCJ 4D5CA 4MGRA 4OMLA 3G71I 1O7LA 3RQ4A 1VNDA 3S1NJ 2LLKA 2O3FA 3CLQA 1G2BA 5GMKh 1ZQ3P 2OTLQ 1GRIA 1R77A 2K9GA 5CIUA 2L9VA 4E6RA 2VXZA 2R7SA 4A4HA 4FYWB 2DNUA 1ZTRA 2Y48A 2X6OA 1D1BA 2MD0A 4CDGA 2IGOA 3OOPA 3WU1B 5FLXK 1M8MA 2K27A 4QPOA 2YXYA 1Y8RB 1RAGB 3E9FA 4MNUA 5IY5H 1MH4A 3PTAA 4BHCA 4WXCA 3OIPA 3FXOA 1RNLA 5CQGA 3SXYA 4E4HA 4BE0A 3QRFF 2DXIA 4KGXB 2ZPBB 3F23A 4VUBA 3KLNA 2HYJA 5CYVA 4EMKC 2HKXA 2DMTA 3F8NA 4OIRF 2XVCA 1KK7A 1WI3A 1YW7A 2EQUA 2CV2A 2DOFA 3HOSA 2LVMA 3M0PA 3CCJA 3PNYA 3L2VA 1VQ7I 1VQ5Q 2DBMA 4BI8B 1DPRA 3HPHA 4E7SA 4HXJA 3K1MA 1IREB 4C8QE 4V2SA 3VUZA 4XIDA 2FRHA 2BV6A 2F5TX 4LNPA 3W2VA 1DDNA 1RUNA 5HY6A 2ABLA 2RNAA 1FYKA 2E1MC 2HYGD 2LY9A 4XKWA 4P5OA 3VFZA 1CF7A 2HQHA 3MEVA 5HODA 1B7TA 2CUFA 1E17A 2ME0A 2H94A 1K73U 4CC3A 1MV0B 3TGNA 3TL4X 4FW1A 1X6BA 2KT1A 5KK1A 1IDYA 3QYFA 1M1EB 2GQVA 4IOAF 3J7YJ 3LA2A 1R22A 3V8JA 2WTEA 3KYCB 3BY6A 3MD2A 2RQWA 4ANJA 2CZ1B 1P4AA 1DQUA 3GTOJ 5F6FA 5LD2C 1QVUA 1SVOA 2NYXA 2P7CB 2MWOA 1WHMA 1N77A 2VV5A 3QPLA 1H8KA 3H5RA 3H1CA 3SZGA 2R5YB 1WJEA 2KVQG 2XDBA 5LJ3g 2K9MA 1K6YA 3ZQLA 1IW7F 3DQVC 3NTIA 5IT9E 1SFEA 2FHDA 2FEIA 1W70A 2HNIA 2IXSA
chains in the Genus database with same CATH topology
4Y15A 3QKJA 3ABUA 1IZ6A 4OGEA 1R1TA 1I6XA 4HV6A 2RK1A 2G7UA 2C06A 4ETSA 4L9JA 3CO6C 1Q7YU 2KKOA 2HAXA 2KK4A 3FX3A 3FF5A 1PP7U 1U5TA 4I98B 1VIFA 4L9NA 5JR3A 2CGPA 3JCMb 4IUQA 1ZREA 2XIDA 1FLIA 1KU9A 1OPCA 2LF8A 3PIPA 5FRMA 1LDDA 4E70A 2R7DA 2BE5F 1AHJB 4M78E 5FU6C 3LGLA 2RO0A