2QQBA

Crystal structure of dtxr(m10a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
214
Chain Sequence
DLVDTTEAYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 66
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqbA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqbA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqbA03
1U2WA 1HXDA 5D4SA 3ZMUA 4RAYA 1MGTA 1XDSA 3RDIA 5E1ZB 3O3KA 1FWZA 5FLXZ 4WF2A 3WODF 4OIPF 3WG9A 4ENKA 3BZ6A 2FMYA 4M71A 3SQNA 3DF8A 1LB2A 1JXSA 3ZN1A 2JZYA 2CYYA 4AIJA 4G7OF 1QPMA 4IXAA 4S05A 1REPC 5DUIA 5BS6A 4A12A 4HQEA 3GYHX 4G6QA 3ABTA 5BMZA 1ZRCA 2D1HA 5K1YA 3DV8A 2ZMEB 3SZPA 4RB3C 2H27A 1LDJA 3OV8A 4XSXF 5K5QA 3V8LA 1IAWA 2ACJA 1R5HA 3MCZA 4F7ZA 3IWFA 5JFRA 4Q4ZF 5ILSA 1QZZA 3RKYA 2UXXA 4EJOA 3JAMZ 2L4AA 4BH9A 4PDKA 5HOOA 5JHUA 1IN6A 2ESNA 2NS0A 5K5RA 3LA3A 1XGSA 3HSFA 2O6GE 4KICA 5D6FA 2LF7A 1U5TC 5FLXK 3REOA 1TLHB 4IRHA 5LLQA 3W6JB 1W4MA 4I7HA 3T0YA 4EJUA 3GLXA 2HOEA 1USTA 4GCVA 4HV6A 4Y15A 3F8BA 3WGGA 3L00A 4Q5SF 4I0BA 3L2CA 4HF0A 2IJLA 4G7ZF 3NQOA 2GCXA 3G3ZA 3VFZA 4P55A 1PUEE 1J75A 4AWXB 4HX4A 4HX8A 1SAXA 4A5MA 5F64A 2PFBA 3ELKA 2XIGA 3HTSB 3SFZA 4EJVA 4PGGA 5DD8A 5LHGA 3FM3A 3MEXA 3R60A 2DK8A 3WTSC 5ICCA 1FY7A 1HKTA 1G3YA 2Q8KA 2HZTA 4YFKF 5HS7A 3IWZA 5E17F 4ON0A 4ESJA 4M74A 1L3LA 1BJAA 5CVJA 2FBKA 3WTVC 2EFPA 5L3GA 2P4WA 3M8FA 1Z05A 3RPQA 4BNCA 1GXPA 1XCVA 4YFXF 3KE2A 3WTUC 4OU0A 3HHHA 2J5PA 2LF8A 2H94A 4LMYA 4G6DA 4HF2A 4B8XA 1UCRA 3FMSA 4FHTA 4I2OA 4KMUX 5BOXA 2F5DA 5AONA 2O3FA 1FP1D 3CO7C 1ZARA 1W7PD 1LJ9A 1J9IA 3K0LA 3J81K 4WWCA 2VT2A 1R1VA 2NAZA 1HQCA 1GXQA 3HRMA 2YU3A 5E18F 5ICGA 4CDGA 3LQQA 4LLGF 4CXFA 2JT1A 4YIFA 2EV5A 1XSDA 1IZ1A 3RPUA 3DFGA 2K4JA 1STZA 1OR7A 3LA2A 4A0YA 1ODDA 1ZGJA 1FBUA 4QLCU 2TDXA 1BOAA 1NHAA 4HLXA 2A68F 2P7VB 5ICEA 5DEQA 3JW4A 4S04A 3HOSA 2RNJA 1XSXA 2DLLA 2UZKA 2RN7A 4XBFA 2QBYB 1LDKB 2A61A 4UV8A 4HAMA 3F8MA 1B59A 3F8NA 5KVRA 2R3SA 1FZPB 2V9VA 1EH7A 1HKQA 2HGCA 1PP7U 2OA4A 3WTXC 2XAQA 3C18A 3ML6A 1IXCA 4A5NA 3MAJA 4UNOA 1CGPA 4UVBA 1U6GA 4CICA 2QUFA 2OQGA 3HIFA 1O7LA 1K78A 1XN7A 3SXYA 5L3EA 3P9KA 1HKSA 4ZH4F 4RGXA 2YPRA 1ZG5A 2Y48A 4EVIA 1ULYA 3ZMSA 1XSVA 3ZMTA 4N9HA 4OIQF 1FP2A 4HV5A 3WU1B 2GZWA 2W24A 1O3SA 2RQPA 2FRHA 1ON2A 1W5TA 2MLGA 2JRTA 3CUOA 5FFZA 1I27A 1TNSA 4QWQA 3TGNA 3LQRA 3M9AA 2XAFA 1ZLJA 3R4KA 3QOPA 1V4RA 4MEXF 2YR2A 3RJPA 1WKMA 3EQLF 3MFKA 4GYIA 1WSUA 4LG0B 4N9IA 3E5XA 1QGPA 5HDKA 4A2UA 4U0YA 5TRDA 4IRIA 2L02A 3V7SA 1G3SA 1S3JA 3W6KB 2NYXA 3U2RA 1SD7A 3V8KA 3RTRA 1QZYA 4OIOF 1R58A 1R1TA 3BDDA 2A3SA 2STWA 3C7JA 4ZZDA 2J5OA 1IF1A 5LGNA 3D5LA 2Q0OA 3IC7A 4ZYEA 3KZZA 3BY6A 3GZ5A 4XRFA 1JE8A 4M6YA 2XRNA 3ZPLA 5CYVA 2AS5F 2L54A 5E20A 3GO5A 3T8TA 2FBHA 2F5FA 3MWMA 2DT5A 1T6SA 4MQVA 4Z2YA 4I01A 3BJAA 2P5LC 3M1EA 2P7CB 2CQKA 3TQNA 3GW2A 4KYWA 1IN5A 2M1BA 1IN4A 1XD7A 4H0EA 1EH8A 4IPAA 1TQPA 2IPQX 4UVAA 4Q47A 4WXHA 2QQAA 3P9CA 1YYVA 4ZZLA 3VEPA 4L0ZB 5IT9K 1QW1A 5J8CA 2QWWA 5JI6A 2RVCA 4G9YA 2BV6A 1P92A 3QP5A 2X0LA 3E6BA 3TDUC 3QP6A 4LLNA 1W7PB 3VB2A 4MQ9F 1BN5A 3KP6A 4E70A 2LDUA 2MLKA 5HDNA 2A5YB 3I5UA 1YO5C 4ETSA 2COMA 4HW0A 4Q48A 5HLGA 3TOAA 1FYMA 3I53A 2DO7A 3NRVA 2XAGA 3COAC 3QU3A 2BEOA 2PMHA 5DCFA 2H6BA 1RIOH 2VBWA 2XROA 4MGRA 2O61A 1UB9A 2HQRA 2O0YA 3MQ0A 4LD5A 4AIKA 5AIPA 1HBXG 3I58A 2L4MA 2HYGD 3IKTA 4HA8A 3BOQA 3M7GA 3SZTA 3E5QA 3F6VA 2YX4A 4L9JA 2K5FA 1ON1A 4GYGA 4XLNF 4HYEA 4LB5A 3GUDA 3QRFF 3AAFA 3HHGA 4IRGA 1P4WA 3U1DA 4HF1A 3C1DA 4ASNA 3H3ZA 4LLLA 5JVTA 3KP4A 3ECHA 2WWYA 4OMZA 3N97A 1MJAA 2IA2A 3DKWA 4WXCA 1FNNA 2EA2A 3KP5A 4EGYA 1T0FA 2FQ3A 1MDMB 2PN6A 4ZYGA 3ROUA 4RAZA 5CVIA 4FX4A 4O3MA 2RV8A 1SFXA 3IRQA 4A6DA 1O3TA 1YQAA 1SD6A 2VBXA 2P6SA 3WTWC 1T98A 4HDUA 1ZRFA 1WWXA 4GO1A 1XGOA 2EA4A 5A2QZ 2IT0A 1TBXA 2C6YA 1P6RA 3V7RA 2M30A 1QO0D 2DFIA 5DD4A 4BHCA 1U5TB 4OIRF 3HRSA 1Z6RA 1MZBA 4RB0A 2NRAC 5CVRA 3QPHA 3PQKA 2XGXA 4P9FA 3DPLC 4RGUA 3HRTA 2XKOA 4L5IA 2OD5A 2K02A 2VOPA 2B0LA 3WE3A 1FSHA 4KIGA 4EGZA 4G7HF 4G94A 4WXDA 4KN7X 1TTYA 3KEQA 3F23A 2PEXA 5H20A 2K27A 2Z3YA 3JAMK 5FO5A 1IN8A 4KNYA 3HUGA 1DDNA 3NEUA 5D5UB 2HKOA 3FWEA 4LG0A 3ZMDA 4RGRA 2L01A 3E6DA 4KIFA 2DPUA 1X3UA 2O03A 4U88A 3LAJA 1CF7B 2OZ6A 3TDZC 1FT9A 4M9ZA 3V7CA 4CZZA 5HLIA 2F5EA 2DW4A 2ZFWA 3GXOA 5DDGA 1G6NA 1D5VA 1R7JA 4RS8A 4M9SA 4HBLA 4A6EA 2PG4A 3O6BB 1YS6A 2GWRA 4AVPA 1K6OA 1YFHA 1Y0UA 3TO6A 5LBQA 3K1PA 2MBFA 2QLZA 1YIOA 3FMRA 2CO5A 1R1UA 2JPCA 3FXRA 3M8EA 1IUYA 1E17A 2MH2A 5D8KB 4EMSA 2EFOA 2H6CA 3VOEA 2QVOA 3JTGA 2GXBA 3CUQA 3D0SA 3I59A 4P96A 4BYYA 5E1XA 3BPVA 1YS7A 2FBIA 2XAHA 5BQTA 1ZN2A 2K86A 1U3EM 1BBYA 4KA4A 3JSPA 2HQNA 3ZMZA 4KIBA 4I98B 1S8NA 2QQ9A 1EH6A 3V4GA 3KLNA 3MZHA 1KQ8A 2RGVA 2JTVA 4KUMA 1RNLA 2FE3A 5J8FA 5DV5A 5ILUA 3WGIA 2V1DA 5JR3A 1Z6TA 5D4RA 1XCBA 4CYDA 3TO7A 4L5JA 1BIAA 4LK0F 4UUVA 3K2ZA 5F6FA 2R7FA 3WTYC 3GFJA 2P5VA 2NNNA 2DK5A 2Z5UA 2W85A 4R1HA 4O6JA 1MJ9A 1ZLKA 1B1BA 2IA1A 1FBSA 1B6AA 4MHGA 4I0AA 3RKWA 5DYMA 1Z9CA 1TW2A 1JHFA 1FOKA 3E5UA 3DPTA 2D1VA 3R0AA 1FYLA 1J0RA 3BJ6A 4A0ZA 4WCGA 1WI9A 2WC2A 4I09A 1USSA 2KIFA 2MD5A 2HTJA 4LK1F 3EYYA 1F5TA 3EYIA 1BC8C 1AOYA 4JBAA 3CDHA 5D5WB 3R61A 3EUHA 4L0YB 3P7NA 2KIMA 1FSEA 1J59A 3OOPA 3RYPA 1FX7A 3GFMA 3GFIA 2FEZA 3JSOA 4U0WA 4IF4A 4OINF 1DPRA 1H0MA 1EV7A 3KP3A 1R22A 1IN7A 2ZMEA 1OKRA 5IT3A 1G3WA 2R7DA 2OBPA 3ZN0A 1QQIA 2FXAA 2EJRA 3K1MA 3T5XA 4P5OA 2GXGA 3F8FA 3ZMVA 2E1NA 3GEZA 1PDNC 4M6XA 2DPDA 4R79A 3FZVA 2OAZA 2VXZA 1ZH5A 3IRRA 4LFUA 2HS5A 1XMKA 2WTEA 1BIBA 2CWEA 3ABUA 4KDPA 2EFWA 1I1SA 2W57A 3K69A 4OMYA 3PFIA 2NNYA 1OYYA 1R36A 2MC3A 1I1GA 3GF2A 2K5IA 1C0WA 4EM0B 4DQ2A 3RKXA 3KZYA 1FYKA 3QU6A 5LHHA 4MEYF 3E6MA 3HYIA 3S2WA 4UHTA 2UWMA 4BHBA 2M8EA 2HWVA 4M9XA 1UHWA 2EV6A 5HS8A 1QNTA 4B09A 1MKMA 1Z1DA 4WK8F 5KK1A 1D8JA 1D8KA 5BPIA 4NQWA 1S29A 4GXOA 3GVAA 2P5KA 3P9IA 4XSZF 2ZNZA 4ENJA 1JHHA 3TKYA 3B02A 3T1BA 2G7UA 3MHXA 1KU9A 1E2XA 5HVQC 2XASA 4L9TA 5L3DA 4N0BA 2W25A 1RUOA 1YG2A 1B9NA 3WU0A 3I64A 3WGHA 1FBQA 2HYFA 2RC4A 2FU4A 1BYMA 2K4YA 5CLSA 3F22A 1U8RA 1IW7F 2P8TA 1OPCA 1T39A 1XB4A 1F4KA 2GAUA 3E3VA 5E8IA 4FX0A 2FNPA 1IRFA 4LB6B 3GX4X 1XGMA 4YIIA 1D3YA 4ZYDA 1AWCA 2A6HF 3SHFA 3GFLA 2HTSA 4EV0A 3F6OA 2HEOA 1OYWA 4MNUA 5D5VB 1UFMA 1MD0A 2Z33A 1H9GA 1Q1HA 5LGUA 3GZ6A 2DQLA 1HW1A 1K78B 4PGHA 4RGSA 3ERED 1F9NA 3R6SA 4EQQA 2AXLA 1BI3A 2FF4A 3E97A 2VC1A 4CO8A 4BHPA 3E6CC 2JSCA 2UXNA 1KQ0A 1SD4A 4L9NA 2KIUA 1K79A 5FFXA 1Z91A 4I02A 2A69F 5H6RA 3F3XA 3HSRA 1TQMA 3LFKA 2KRFA 2E1CA 2IW5A 2G9WA 2QENA 4IHTA 3FXQA 4WX9A 3O2PE 4EM1A 1YW9A 4P9UA 1IRGA 2GQQA 3U9GA 3F21A 2MA3A 5ILVA 1WQ2A 1S7AA 4NHJA 1QVPA 3BJOA 4KN4X 3K1NA 3WTTC 2XKPA 5ED4A 3I71A 2GA1A 2MH9A 5LEKA 1LVAA 3F8CA 2FSWA 2QBYA 5CVVA 4A0XA 3J7AO 2EV0A 1I5ZA 3RYRA 3KFWX 2BBYA 5DCMB 1Z7UA 2ESHA 1GVJA 1J7KA 2GA2A 1U78A 1VTNC 1SFEA 5J6XA 2LSOA 3TO9A 4IVNA 6PAXA 4EJTA 3F72A 3IL2A 1BI0A 4LJZF 1KYWA 3DP7A 3FMQA 3IHUA 5AIQA 1R5GA 3WE2A 3Q9SA 3JTHA 5E8GA 5EEGA 1YTYA 2VONA 3HTUA 4KMFA 2EWNA 1KYZA 2CSOA 4IHSA 5DUKA 2LX9A 3H92A 3EETA 2P6TA 1DUXC 5LEJA 2PBIA 4DNCA 3KEOA 2DAOA 3VODA 2ZO4A 2D2WA 2K4BA 2BYVE 3BPXA 4O5VA 2M87A 3FHZA 5LHIA 2W84A 1LNWA 2EFNA 1FC3A 2VE9A 1H9TA 5A2QK 2FA5A 3DEUA 3J81Z 3CLOA 3H3UA 2LNBA 2KKOA 2A6EF 2PLYA 4HZFA 1YW7A 3L9FA 1HW2A 4BXUA 3ZP5A 3T8RA 3IKVA 2CGPA 4EJWA 3B73A 2PJPA 1SMTA 5BPDA 2D45A 3I54A 2HFHA 5L3CA 2Q2EA 2FNAA 4TV7A 1ZHFA 5LRRA 3HSEA 2PI0A 3LWFA 2VN2A 3PQJA 2QQBA 2YX7A 2EFQA 1RZ4A 3CJNA 4HQMA 1OYIA 1P4AA 3LAPA 3E19A 1ZRDA 2ISZA 4FT8A 4LGWA 1BC7C 1MJBA 2DQRA 2VOOA 1LEBA 2XV4S 1ZREA 2DTRA 2QZ8A 1ZG1A 1G3TA 1W5SA 1RI7A 5K5OA 4ENNA 1PP8F 2F2EA 2H09A 2PQ8A 1SFUA 5FD6A 3V8JA 1J5YA 3HOTA 2IRFG 2BGCA 2H3JA 2L3DA 5FB2A 3N4MA 4CHUA 4IJAA 3L09A 3CO6C 2X4HA 3FM5A 2ZCWA 2OQRA 2ZBKA 2IA0A 4KFCA 2DU9A 1TNTA 2KJCA 4NB5A 4Y17A 1W7PA 2FMLA 1S6LA 1KU3A 1O3QA 3DQVC 3EDPA 2JPBA 5HLHA 5ICFA 1ZGAA 2ISYA 2VE8A 1T38A 1ZG3A 5ERIA 4PCQA 4BAYA 4ESBA 5HDGA 1O3RA 4CGZA 1B9MA 2WV0A 1DP7P 3J80Z 1BM9A 2E7WA 4GGGA 5TJJA 1S7OA 2GIVA 2V1UA 2XHKA 2E7XA 2K7LA 2HDCA 1P2FA 3I4PA 2PMUA 3QPTA 2STTA 4U0VA 1QBJA 4HLYA 4UXNA 3I0TA 3WTZA 4UVCA 3BP8A 4JQFA 1HSJA 4Y13A 2CW0F 1HSTA 2O8XA 4HOBA 1YLFA 1WRJA 1XDUA 5FD5A 2K5LA 4AIHA 1ZAOA 2IP2A 5HS9A 5FGMA 2A07F 1LDDA 4M72A 2KJBA 3ISPA 4JK1X 1TW3A 4YG2F 1A04A 1BI1A 1SD5A 2CG4A 4ENMA 2ADUA 2YSRA 3HRUA 1ZYRF 1T2KA 2ETHA 1MDMA 3J80K 3G73A 4G8XA 1KA8A 4ZYHA 4YFNF 3KETA 1LEAA 2ZXJA 4XLPF 4KT5C 2OU2A 1P4XA 4ESFA 1O7FA 3KP2A 3ULQB 4UV9A 2VT3A 1IXRC 1IXSB 1O57A 1B4AA 3FXUA 2XAJA 5DCMA 1YW8A 2ZKZA 3C3WA 5IT9Z 2M5WA 5CJ9A 3FF5A 1XMAA 3KP7A 4K2EA 1L0OC 4RB2C 2OZUA 5L3BA 1U5TA 5D8LB 2RDPA 1ONVA 5LRSA 2ELHA 4L18B 3MZYA 2V1XA 1GHCA 3RIRA 2M45A 2XVCA 4L9VA 2DBBA 1R23A 2EB7A 2DI3A 2VODA 2QM3A 3CUQC 3K9TA 4PZJA 4OOIA 2RKHA 1KU7A 4BQAA 2FOKA 5D6EA 3CUQB 2F5CA 3I59B 1J2XA 5D5XB 2Z9OA 2Y0MA 4R8HA 3R0JA 3Q5FA 1TQIA 4EM2A 1XGNA 1BI2A 1I6XA 2VC0A 2VBZA 3TOBA 1F1ZA 1R00A 3BROA 5H6QA 3GWZA 1V3FA 1SMYF 3KCCA 5E1WA 4M73A 3ZQ7A 5F1RA 3LA7A 4D0PA 3FX3A 4MTDA 3CTAA 2QYOA 4RB1A 5L3FA 3ECOA 2HKXA 4U7BA 1LQ1A 1DPUA 1CF7A 1KGSA 3KLOA 5CVUA 4HX7A 2XUBA 2IVMA 3Q9VA 4U7DA 3RI4A 2LKPA 4AD9A 2V79A 2ZNYA 1HW5A 1UHMA 2BE5F 2ZJ2A 2Z99A 2EK5A 3QAHA 1KQ9A 5EEHA 4HDVA 1K7AA 5LGTA 1G4DA 1OMIA 3BWGA 1JGSA 2CFXA 2G7HA 1FLIA 3DXJF 1KU2A 4MTEA 1RUNA 1FPQA 3LSTA 3L7WA 2HR3A 2VBYA 2Y75A 2V6CA
chains in the Genus database with same CATH superfamily
2XGDA 1U2WA 4EMKB 3S1NJ 1HXDA 2O31A 3ZGKA 2QAZA 3MKWB 3JREA 5D4SA 4X9DA 3ZMUA 4RAYA 1MGTA 5GANe 2KFDA 4QQDA 3PIPF 1XDSA 3RDIA 1CKAA 4RG2A 4G12A 2L3PA 5KCOA 2Y30A 1M2VA 5E1ZB 2K3YA 3O3KA 1FWZA 5FLXZ 4KGXB 4WF2A 3SWNA 5GAN2 3WODF 4OIPF 3WG9A 1R77A 4IQ4A 2DCEA 1V5EA 2L7ZA 4BD3A 4ENKA 3M54A 5J3LA 3BZ6A 4QKUA 2FMYA 4M71A 4C3JJ 2DMNA 3SQNA 3REAB 1ZSGA 3DF8A 4V2GA 3ASNH 1LB2A 1K4US 1JXSA 3RERA 3ZN1A 2JZYA 2CYYA 4XRMA 4AIJA 1QPMA 4BUPA 4G7OF 4IXAA 4S05A 1IJWC 1WJSA 4NC6A 3VDXA 1QKWA 2FPDA 3G1MA 3PSFA 2BVMA 4XKBA 1REPC 2DMUA 5DUIA 1WXBA 5BS6A 2NVXJ 4A12A 4M78B 1K6YA 4HQEA 3GYHX 4G6QA 1M1GA 3ABTA 5BMZA 2CH0A 2IBDA 1ZRCA 2QCOA 2D1HA 5K1YA 2XIDA 4PJOB 2V7FA 2EIJH 3J7YJ 2C0OA 3KBGA 3GIBA 4UUSA 3DV8A 3CCYA 2OTLQ 2ZMEB 3SZPA 2DYSH 1WPKA 1NEBA 3A8MB 4DEYA 4RB3C 2LY9A 2QF7A 1LDJA 1R4MB 3OV8A 2H27A 1VQPQ 1FTTA 4XTVA 2LCLA 1AEYA 4XSXF 5K5QA 3V8LA 1KZHA 4MDXA 2DZ9A 4M75D 3URGA 2LREA 1IAWA 2ACJA 1I5OB 4HKEA 1KQ2A 4XLEA 1R5HA 3MCZA 2HQEA 1VQ9Q 2ZGWA 3O5ZA 2COZA 4A3BJ 2RQQA 4F7ZA 3IWFA 5JFRA 1VNDA 2EQMA 3OS1A 1IDZA 1WHKA 4Q4ZF 4FT4A 2KAFA 5FLXE 1YNZA 5ILSA 1QZZA 4KBMB 2NUPB 4CZCA 1GL5A 1V5GA 3CCJI 1YIJT 4CCOA 1LFPA 3RKYA 1VQ7Q 2H8RA 2UXXA 3EAEA 1YBYA 2L0AA 1IV8A 3ZQCA 2LD5A 4EJOA 3JAMZ 2L4AA 5IYCJ 4BH9A 3ZQHA 2ZXIA 2B9SA 2QASA 4PDKA 2HD0A 2DMTA 2ZPBB 2KQWA 5HOOA 3VYTB 5JHUA 4XRSG 2GOXB 3QYBA 4N0AC 1IN6A 2L7KA 5IY5H 1R8OB 5EYRA 2FJ1A 3CCLQ 2ESNA 2NS0A 2V1NA 2NYSA 5K5RA 4XIDA 2A28A 4RTYA 3LA3A 1EX4A 1XGSA 3HSFA 3A1YA 1OX9A 2QTVA 2O6GE 2R7XA 1Y71A 2JM8A 3NHNA 1K73C 3CD6T 4KICA 1I3AA 2LF7A 5D6FA 1GCPA 1X6OA 4OGCA 1AA7A 4HT9A 2EZIA 1U5TC 2WAQN 2R7ZJ 5FLXK 3QZ5B 3QYEA 1M1FA 3HZJA 3REOA 3RNJA 3HP9A 2VKDA 1TLHB 3GCMA 2PJRB 4IRHA 2LC2A 4Y4RA 4MO7A 1QVGP 2M8GX 5LLQA 1UGRB 3W6JB 4H4KC 3JRCA 1W4MA 2R7UA 3AG4H 3EFOB 1UHCA 1O75A 5C6SA 2EZKA 4I7HA 1YHQT 3FJ5A 3CP8A 1H8KA 4BEHA 4HVVA 2NS7A 3T0YA 4EJUA 4QVCA 3GLXA 2CP3A 2V4JC 3C12A 2LY1A 2HOEA 1USTA 3HXLA 4GCVA 4HV6A 4Y15A 3F8BA 2BW3B 4YRVA 3WGGA 2X6YA 3L00A 5I2MA 3W2VA 4QQGA 4F3QA 4N4GA 4Q5SF 4I0BA 5EC7A 3L2CA 3IP4B 1HJDA 2WA0A 2AO9A 4ZTJA 4HF0A 2D8HA 4B3AA 2E71A 3P8HA 2IJLA 3BR1A 2PQWA 4G7ZF 4GBQA 3NQOA 2GCXA 2R5AA 4IZZA 2EVRA 2E1MC 2XSJC 4N4HA 8AT1B 3G3ZA 4NQWB 4RLQA 3VFZA 4P55A 1PUEE 1MSEC 4KGVB 3CCMI 4V19K 1UEBA 3L1AA 2OAUA 2COBA 4AWXB 1J75A 2E1MB 3GTPJ 4HX4A 4J9IA 4HX8A 1SAXA 2GQIA 3F9KA 4A5MA 4BY7J 1QQJA 2H3EB 3QBYA 5FWBA 1XTAA 2WSCE 5KYUB 1GFCA 1TWHJ 3DBHB 3QQAA 5F64A 2PFBA 3ELKA 2XIGA 3JB9J 1SG5A 2NXNB 5CCAA 1G5VA 2E19A 2QSGX 3HTSB 4D8KA 2VQGA 3SFZA 2M02A 3KX2A 2BXYA 3TEDA 1VQ8I 1YJNA 2HXIA 4GFBA 3HOXJ 3MPUB 3S17J 2QGGA 2DNUA 4EJVA 2LRDA 3QXEB 2V1QA 4PGGA 5DD8A 2M35A 5LHGA 1S7EA 2CMPA 3HGYA 2D1XA 2Z16A 2M51A 3FM3A 3ZFJA 2LTPA 2X1EA 3MZ8A 3MEXA 4XU3A 1Y96A 3R60A 2DK8A 4IL6C 3SDBA 3W3CA 2QSHX 2FZKB 4RTUA 3WTSC 3IH4A 3VYSB 5ICCA 1FY7A 1HKTA 3ZRGA 2DA9A 2XPUA 1G3YA 3GTMJ 3K7AJ 2Q8KA 2HZTA 4YFKF 1QCNA 2EKHA 3QWYA 4C8QD 1VQNT 5HS7A 2HDDA 3RQ4A 3IWZA 3THKA 4AG1C 5E17F 1F1BB 4ON0A 4ESJA 2L2PA 4M74A 3JV3A 1L3LA 3MJXA 3SDZA 2RJFA 4F14A 1HDPA 4ZN1A 2Y4XA 1YITQ 2FUG2 5CQEA 2R5ZA 5E3NA 5GANg 2OCCH 5HK3A 3CCJQ 3OSSC 1BJAA 2Y2ZA 1ZTRA 4Y33A 5CVJA 1ACMB 2FBKA 3BTIA 4PLIA 2AK5A 1QP2A 3WTVC 3SEZA 4XKCA 3NAUA 2EFPA 3C2BA 5L3GA 3RZOJ 1M1KU 2LVMA 2P4WA 1N25A 4C2MJ 3G7ZA 3M8FA 1GFDA 1Z05A 3RPQA 1WJRA 3H35A 3QKJA 2LNVA 5A0GA 1YJWI 3KUFA 4IEJA 4HNVA 4BNCA 4NDLA 1GXPA 2IGKA 5A2QR 1IHVA 2E6ZA 3OL4A 5FU7C 3VYHB 4D7NA 4ZDOA 1XCVA 3FK7A 4YFXF 4OB0B 3LFUA 1T95A 3OYMA 1ZBXA 2L9VA 5FU7B 2SEMA 3KE2A 3J81E 2V6EA 3WTUC 2PX9A 2MG4A 4OU0A 5L23A 1VQ4T 2MW8A 2Y90A 3HHHA 2DEUA 5GAOp 1WI3A 4D6WA 2J5PA 2FZGB 3DBLB 2LF8A 5LJ3d 2H94A 2R7OA 2BUDA 4LMYA 4G6DA 3G71I 3TW7A 4EMGA 2GLOA 4HF2A 3PFSA 4JDSA 2JTMA 3TQ7P 4B8XA 3BG3A 2XI9A 1XPXA 1M2OA 2ZAEA 1UCRA 4F55A 4E7JA 2UV1A 4DBHA 2E1HA 3FMSA 4FHTA 3V42A 4I2OA 4KMUX 3PJRA 1AZEA 2E2JJ 2V8JA 2K2MA 5BOXA 2Y0SA 1SANA 1WJDA 2F5DA 1GBRA 5AONA 2O3FA 1ERDA 1MNMC 1KQ1A 5ECAA 2MABA 2K9NA 1FP1D 4M3EA 4JOMA 5EZHA 2VGNA 2ME0A 1J3TA 3DEEA 1Z0XA 3CO7C 1ZARA 1W7PD 1FJLA 1LJ9A 1J9IA 1VF9A 3K0LA 3J81K 5FKLA 4B3XA 4WWCA 2JN0A 2YRVA 4M77C 5GAMf 2QA4T 3OW2P 4KUDK 4CYCA 2VT2A 4BXXJ 1R1VA 2NAZA 1HQCA 4ZN3A 3PUBA 4OP0A 3G2BA 3CMMA 4A54A 2BY1A 1GXQA 2MK5A 3HRMA 5E79C 2JA7J 1Y07A 4RCBA 2YU3A 1TWBA 1UDLA 3HPWA 3CCMQ 5KCMA 5ICGA 3DLAA 5E18F 3SHWA 1ENHA 3SWNC 4AFSC 4G6TB 1K8AU 4CDGA 3MO8A 3LQQA 4LLGF 4C92C 4CXFA 3EFRA 3E1SA 4A3JJ 1W4SA 2JT1A 2F6CA 1POGA 2LLKA 4PSWA 3ZQFA 4YIFA 2EV5A 3IQLA 3VS0A 4C92B 3S3MA 1XSDA 1IZ1A 1UB4A 1BR2A 3RPUA 3DFGA 2KDSA 3QUIA 2K4JA 1STZA 2HEQA 1OR7A 1VQ8Q 3LA2A 4P1WA 4M78E 4XU1A 4A0YA 1ODDA 2HPIA 5F04A 1DGRM 1ZGJA 3LNQA 2DD5A 2BKDN 1FBUA 3GTOJ 4QLCU 4Y3OA 1AWJA 2TDXA 1C0MA 4DZPA 2RF0A 1YIJI 1Z3YA 3TU4K 1VQKT 1MMAA 1PHTA 1BOAA 1S72A 3I3LA 1NHAA 3OR2C 4M3DA 1U9OA 4HLXA 2Z0WA 2A68F 2P7VB 3ZR8X 4AYBA 5DEQA 3BZKA 5ICEA 1M27C 3EUAA 3JW4A 4DBRA 4S04A 1ZA2B 2RQRA 2YDLA 5IN1A 1IXDA 1PRMC 3CBOA 3HOSA 2RNJA 4MLOA 4JJCA 3CF5F 4FE4A 1MV0B 1XSXA 4PJ0C 2DLLA 4M7DE 2UZKA 2RN7A 4XBFA 4MFEA 2QBYB 3EG3A 5DLOA 2V9KA 5GP9A 2K57A 1LDKB 2A61A 3DLMA 4UV8A 1KC8U 1JJ2S 3GBQA 1KK7A 4HAMA 3F8MA 1YWPA 3QZ9B 1M1KC 1B59A 3F8NA 5KVRA 1E3OC 2LG4A 1I6HJ 2R3SA 5J40A 1B72B 2V9VA 1FZPB 4GDFA 3PFYA 1C6VX 2E3HA 1PNJA 1EH7A 4ZJZA 5GANj 1HKQA 2HGCA 1PP7U 1YJWQ 2OA4A 2AT1B 2DN0A 2EJ9A 3PGGA 3E0JB 1J09A 1GCQA 3H3VK 4XN3A 1H88C 3RKQA 2CDTA 3WTXC 1D09B 3PNVA 1PCXA 2XAQA 3BR3A 3C18A 2X6WA 3ML6A 1IXCA 4MIMA 5C44J 3RCOA 1DJ7B 1JI8A 4A5NA 4U87A 3MAJA 3HOZJ 2GM4A 1I8FA 1T0JA 4UNOA 5GAMh 3LSHA 1D3BB 1CGPA 4C2TA 3K6GA 4UVBA 1G2BA 1MBKA 3RMQA 3G71Q 3BCBA 4A63B 3OYFA 1YFNA 1U6GA 2A36A 3TCJA 1X6GA 1Y1WJ 1IB8A 2A08A 3ONQA 4OAZA 4CICA 1SEUA 1VA7A 3VS5A 3U23A 4JP0A 3HFOA 2RI5A 2QUFA 2OQGA 2MYSA 3HIFA 3H8ZA 3QYHB 1R0BG 1O7LA 1YJ9A 4IOCF 2EINH 1K78A 1XN7A 2DDAA 3SXYA 3EGXB 5L3EA 3P9KA 3NGPA 4IOAF 5FLMJ 1IREB 1HKSA 4ZH4F 4KISA 1RLPC 3H0HA 4M75B 4RGXA 5KE2A 3OBWA 2YT6A 3B6CA 3CCRT 3QYFA 2YPRA 2JVVA 1ZG5A 2Y48A 3BW1A 4OB2B 4EVIA 4BACA 1IC8A 3KIOA 2BVLA 1ULYA 3AT1B 3ZMSA 1XSVA 3ZMTA 2Y31A 3FRNA 4N9HA 4OIQF 1FP2A 4AC0A 4A53A 1KIKA 2JJ7A 4HV5A 1Q81R 2X48A 3WU1B 1IDYA 2XPVA 1VQMA 4OB1B 3M56A 2GZWA 2W24A 1LFUP 5TGTA 1AHDP 4A4EA 1O3SA 2RQPA 2P0TA 1G2HA 1MW7A 3S3NA 5A0LA 4JX5A 3L2UA 5FKKA 2F69A 2FRHA 1ON2A 1W5TA 2MLGA 2JRTA 3CUOA 2RQWA 1FEXA 5GANf 1QVGS 4BE2A 4EMKA 4M7AG 2KT1A 2E65A 2IXSA 3H5NA 5FFZA 2ROTA 1I27A 1N8RU 1TNSA 4QWQA 4M78F 3CMEA 4IHXA 3TGNA 2R0QC 2OX7A 4PJOF 3LQRA 2VQHA 2EAYA 3M9AA 1PG5B 1SRLA 2XAFA 1W0TA 3HDDA 2MI6A 2QQRA 1ZLJA 2XGCA 1VQNI 2VUMJ 2XHCA 3R4KA 3FC3A 3QOPA 1OU9A 1V4RA 1K73R 2JVGA 4MEXF 4II2A 2YR2A 2YUSA 1WKMA 3RJPA 4ZTFA 3R6NA 1YIJQ 3EQLF 3MFKA 1OYXA 1IRZA 4GYIA 1T3LA 1WSUA 2H1LA 4LG0B 2GFUA 4BQQA 1Z7LA 4N9IA 3E5XA 2X9HA 1QGPA 5HDKA 2DXUA 1X19A 2HQHA 1RACB 4JLIA 2DA2A 1UG0A 4R55A 3CDIA 4A2UA 4XLHA 2RD1A 5HKCA 3OW2A 1RAEB 4U0YA 1IO2A 2O4XB 3GBGA 4KULA 2RJCA 5TRDA 2AKLA 4IRIA 4XOPA 2L02A 2MD0A 2L7FP 3V7SA 2FG0A 3CBMA 1G3SA 1S3JA 3W6KB 2NYXA 2CT3A 3ZQQA 4FU6A 4PUSA 2E3IA 2ESWA 4OMPA 4RG8A 3JCMe 3CD6Q 3NPFA 3U2RA 2MWPA 3LWIA 2V8IA 1SVLA 5FWCA 1VQ4I 2CUBA 1SD7A 1TWFJ 3V8KA 3RTRA 1A5JA 4XK4A 3EUKL 5GAMd 4Y91A 1RAFB 1QZYA 1WFXA 1R58A 4OIOF 1K9AA 1VYTA 1R1TA 3UKGA 3BDDA 3LL7A 3O8GA 2A3SA 2XB0X 2KGTA 2P81A 2STWA 3QPLA 4M7DA 3C7JA 4HPQA 1RKWA 4RM3A 4ZZDA 4QQ6A 3JRIA 2J5OA 1TP4A 3KYLA 2XU8A 1IF1A 2QDYB 1WJCA 5CQGA 3HC7A 3CCEI 4M7AB 4DOVA 3CPWS 5LGNA 1MMGA 2R4GA 3DU5A 1QA6A 4Y92A 3TMOA 3C95A 4B9WA 4IURA 2DT7B 2QKMB 3D5LA 3HM5A 2DERA 3JRGA 3BT9A 2Q0OA 4FTHA 3TREA 2YHTA 2KE9A 9ANTA 2O8KA 4Q5WA 2QA4I 2OTLA 4FYXB 3Q0UA 3OYNA 3JRFA 3HG9A 3FBNB 2ATCB 1VQPA 4I76A 3HOYJ 3IC7A 5GAOl 4ZYEA 4XU0A 3MEAA 3KZZA 1MIJA 3BY6A 3GZ5A 1OCOH 4XRFA 1W36C 2HZDA 1HDDC 1I1JA 1WHMA 2DYBA 1T33A 3I9QA 2CSIA 1JE8A 4C8QC 4M6YA 3OY9A 1VQLT 2XRNA 4ANJA 3ZPLA 1NPPA 2VC8A 3RMSA 1VQ9A 5CYVA 2AS5F 1UJ8A 2L54A 3CJRB 5E20A 2KEAA 4IUTA 3GO5A 3T8TA 1NM7A 2FBHA 4J9BA 5GAGJ 4XMYA 2F5FA 3KZIC 1FYNA 2OTJT 3MWMA 2VJJA 4F7UG 3LSMA 2DT5A 4RLFA 3A1PA 5GAOq 3K2AA 2M16A 5B66C 1VQ7A 3S15J 5IPAA 1I07A 2K3XA 4JLGA 1T6SA 4A3IJ 1RC9A 4MQVA 4Z2YA 3EFOA 2O7OA 2EKOA 3M58A 4I01A 3BJAA 3I55A 5GAOm 2R57A 4KUIA 1JT6A 1BB9A 2P5LC 3M1EA 3M57A 1G59A 5IT9E 1K76A 5LFAA 2P7CB 2XD0A 2CQKA 2XPWA 1SHGA 3CCLA 3TQNA 2WACA 1VQKI 2HBPA 2RN8A 4J00A 2EQRA 4I99C 2NOJB 3GW2A 3TBIA 2NOGA 5GADJ 4KYWA 1T3SA 2YLBA 1IN5A 1VQ5A 2VXEA 3IUOA 4JS4A 1EKEA 1ETKA 2M1BA 1IN4A 1XD7A 3GF5A 4C9YA 3DLLF 2CQXA 4H0EA 4LG3A 1EH8A 4M3GA 2X4XA 2CP2A 4IPAA 2E70A 2D9TA 4C0DC 1VQNQ 3CCVA 5D6WA 3C94A 2DAQA 1TQPA 2IPQX 2RNGA 5E3LA 1ZHIA 4UVAA 2DVEA 1IRXA 2LQKA 1I4K1 4Q47A 4WXHA 1WQWA 1I81A 2QQAA 3P9CA 1X01A 2V1RA 4BY6B 5HLTA 3OW2S 1YYVA 4ZZLA 3HEFA 3KEYA 1YWOA 3VEPA 4FM4B 2DFEA 2EIMH 2ZXHA 1B8IB 5KYUA 3RUXA 1I3QJ 2CZ7B 4L0ZB 2RB6A 4XRSA 2W4SA 3MN2A 5IT9K 4V2SA 1Y39A 1QW1A 5J8CA 2PVGB 1K9MU 2QWWA 5JI6A 3L42A 4LNPA 2RVCA 3HBLA 4G9YA 2BV6A 1P92A 3QP5A 2HPMA 3CMAT 2X0LA 4XNFA 3WVDB 3E6BA 3TDUC 1A35A 1N77A 3VS3A 3QP6A 3PM1A 1PUFB 1TS9A 4PKCC 3JCMX 2RHZA 1PKSA 2VUBA 5IOZA 1VQ4Q 4CC4B 4LLNA 1W7PB 2HQAA 1VQ8T 3VB2A 4MQ9F 1H641 5FKNA 5C4JJ 2RM4A 3FK6A 1BN5A 2RNAA 3KP6A 4E70A 3DKXA 5HODA 2LDUA 2SRCA 4F7UB 1SEMA 1UTIA 1QRYA 2RAEA 4X1VA 2MLKA 2EBIA 2IS1A 2QI2A 3BQZA 5K7FA 2NUTB 1KFZA 2ZPFB 4M4ZA 4UB6C 5HDNA 3ABLH 3DTIA 2A5YB 3I5UA 1YO5C 3GTQJ 4JRQA 4ETSA 1QMCA 2COMA 3CCEQ 2DRMA 4MZPA 3FXKA 3ME9A 1WXUA 4HW0A 4IIMA 4Q48A 5HLGA 5CKTA 3UA7A 3CCRI 3HGGA 4B1RA 4E6RA 3TOAA 4GY5A 2FD5A 4PJOG 1FYMA 3I53A 1X1AA 1NPRA 2DO7A 2W0ZA 5J4YA 2KROA 3NRVA 1JUPA 2XAGA 3ABMH 4OMMA 2QA4Q 1D5YA 3RDVA 2AQFA 4PJNA 3COAC 4FL6A 5LJ5f 3QU3A 2BEOA 2DOEA 2OI3A 2PMHA 2EYZA 3RBBB 3M1CA 2VKEA 3OYAA 2LX7A 1HOMA 5DCFA 1X1BA 2H6BA 4XLFA 3SYTA 1RIOH 4BY1J 2J05A 2VBWA 1JJ8C 4M75E 2KRHA 1LVKA 2XB5A 2XROA 3JB9D 3JCMg 4L59A 4C5GA 2MFZA 3RSNA 3CCJA 2GGRA 1ETVA 4MGRA 2VQLA 3HOWJ 5J3BA 2I2LA 1AWWA 4Z02A 1LE8A 2O61A 3K4JA 3DTEA 1UB9A 2HQRA 2UUZA 2O0YA 3A0HC 3MQ0A 4XU2A 1R5ID 1XC5A 3UDCA 1KG1A 2EBPA 4OMFB 4LD5A 3G71T 2RQVA 4AIKA 5AIPA 4ITVA 1HF0A 2LQWA 3C0CA 3AG1H 1HBXG 2R7RA 3I58A 2D5VA 2K7AA 2L4MA 3UWNA 1M1KR 2HYGD 4PJMA 3IKTA 1AHJB 1HSQA 4HA8A 1VQKQ 3SEQA 5KYYB 4KITB 1Y7XA 1QPIA 2I10A 1XG1A 3BOQA 3NARA 3C4SA 1VQOT 2P0WA 1SSFA 3M7GA 3HJEA 3SZTA 2B63J 1TT0A 1S5LC 3E5QA 2QGUA 3F6VA 2ID6A 1ACIA 4BKXA 4MZMA 4A4GA 3L2QA 3JCMJ 1MBHA 2YX4A 4L9JA 3X2QH 1ON1A 2K5FA 3O8VA 4GYGA 4CA0A 4CH7A 1UGQB 3GTKJ 4QPOA 4XLNF 4HYEA 4LB5A 3GUDA 3QRFF 2F2VA 3TSWA 3FBIB 3AAFA 3HHGA 4IRGA 1OU8A 3D7SB 3RR6A 4LD9K 1P4WA 1IUFA 3U1DA 4HF1A 2TCTA 3C1DA 2O9SA 5IXBA 2W00A 5KHDA 4ASNA 3H3ZA 4LLLA 5JVTA 2WAQA 3KP4A 2A0FB 3ECHA 3LX7A 2WWYA 3K4MA 4ORZA 3QSUA 2HDAA 4OMZA 3N97A 4LDWA 4XICA 2BY3A 4LITA 3PL8A 3P8BB 4GLMA 3BE3A 2KQRA 4PLLA 1TT5B 1K9MC 1MJAA 2IA2A 4Z89A 2IEKA 3PIOF 2IGOA 3AL0C 4XORA 2VXDA 3DKWA 1WH5A 2ZFUA 2CKKA 2COWA 4WXCA 2FQ4A 1FNNA 4E7KA 2ICWG 1SFOJ 2E5QA 2GTOA 2WSEE 2KZVA 5FKMA 1KHCA 1X69A 4QVZA 3H0DA 1TTHB 2QXFA 3PO2J 2JTEA 2VV5A 2EA2A 3KP5A 5LJ3e 4EGYA 2DZCA 4RBOA 1T0FA 2FQ3A 3VYUB 1MDMB 2PN6A 4ZYGA 3ROUA 2CQNA 3GTGJ 4RAZA 2YUNA 5GJVB 1SKUB 5CVIA 4FX4A 1PWTA 4O3MA 3M4GA 5LJ5h 4A69C 2RV8A 1Q7YU 3CEYA 3CCMA 4KGZB 5GAOn 2F1LA 3QWLA 3OQ5A 1JUMA 1Q81C 2HOAA 1SFXA 2VGMA 3G1OA 3BC8A 3IRQA 1K8AR 1I50J 4A6DA 3PIOA 4HXJA 5DY9A 3P8DA 5HK0A 1O3TA 2JQ7A 2R58A 2A05A 3FXMA 1YQAA 3BTCA 1E0EA 4M7DC 2EIKH 1SD6A 3CC2T 2VBXA 2P6SA 3WTWC 1NLPC 4M7AE 1T98A 4HDUA 3E7LA 1VQLI 2X4WA 3VS6A 1ZRFA 3CCRQ 1OFCX 3MCAB 2EQJA 2K3BA 1WWXA 5GAN5 2PVOB 4PNOA 3G4ST 2KRCA 5J1UA 5GMKe 1E3PA 4GO1A 2OTJI 4RTTA 1XGOA 3RQIA 4C2UA 2GBQA 3ZQIA 4JUVA 1MH4A 2EA4A 2JWTA 2VL8A 5A2QZ 3OYKA 2KZGA 3DU6A 1UG2A 2IT0A 3EH2A 1TBXA 5GANh 3CC7T 5JLXA 2C6YA 1P6RA 2NVTJ 1Y0MA 1YP5A 5KYXA 2L0KA 4QTRA 3V7RA 2M30A 1QO0D 1TL8A 2JA8J 2DFIA 5DD4A 4M75F 1FMWA 1BU1A 1K0XA 4BHCA 1NYGA 4C0GA 2X35A 1U5TB 1U06A 3OYHA 1SAUA 4OIRF 4FCYA 1D3BA 1UGVA 3HRSA 3OS2A 1Z6RA 1MZBA 5KAFC 2DYIA 4EDUA 4C30A 4RB0A 2NRAC 5CVRA 4ZDPA 3BDLA 3NMZC 3QPHA 4YTLA 3GZNB 2DFHA 4KH1B 1D0XA 1W70A 4A3KJ 3RZDJ 3PQKA 2XGXA 1M4ZA 1BOBA 2HKNA 4P9FA 3M55A 3DPLC 4FIBA 4RGUA 1KC8R 3HRTA 2EYXA 3QJ6A 5I21A 2EJGA 3VV0A 3JAME 3MKLA 2XKOA 3EGXA 2JUCA 2LBFB 1ZSZC 2LFBA 4TVRA 4L5IA 2OD5A 2K02A 1YJWA 2VOPA 2B0LA 3CP2A 4UUTA 5B1BH 5M9OA 5M3FJ 2KT8A 3JCMb 1B34A 1X4OA 3WE3A 5M5YJ 1FSHA 3SJMA 4KIGA 4C0FA 1C1AA 2WV1A 1X1PA 4EGZA 3JB9I 5B5EC 3WG7H 4G7HF 4G94A 4WXDA 1H92A 3GP8A 1M3CA 1JKOC 5EGOA 3META 4KN7X 1OLTA 2JXBA 4HCKA 1TTYA 3VSKA 2DA1A 3CMAI 2KHMA 3KEQA 4PSXA 1M9SA 2E10A 4E7ZA 5M3MJ 2HSEB 1T08B 2PEXA 5H20A 4XLAA 3F23A 2K27A 1GDTA 1Q86U 4B9XA 2XF7A 2Z3YA 2FRYA 3M0SA 2ZB9A 3TVTA 4OWRB 2DETA 1PD0A 2ECZA 4II1A 3JAMK 4A4KA 4QVDA 5FO5A 1IN8A 3BG9A 4BJ5C 4ELYC 1N78A 3OYEA 3CJQB 1SC7A 3H9NA 4KNYA 4FYVB 4IIOA 3VS1A 5LJ5d 4DA4A 3HUGA 1SVMA 2NVUB 1DDNA 1YRNA 2EQKA 4BI8B 3NEUA 5CKDA 4HRIA 2VKVA 4X6AJ 4XK8E 2QGFB 2CUZA 4M3BA 3JRZA 1RAIB 5D5UB 1QVUA 1W36D 3QHSA 1SHFA 2E41A 2HKOA 3A8LB 3FWEA 2ABLA 4LG0A 3ZMDA 4RGRA 1O9SA 2LCSA 2L01A 2M7BA 3E6DA 3A01B 3BQYA 1XQHA 1Q7YC 3HKZN 3SDGA 3MEUA 2R93J 4M77G 4KIFA 1QZEA 3CCST 8ATCB 4F7UE 4RDUA 2LKSA 4L5EA 3S8PA 2DPUA 2KXDA 4XTYA 3CCQI 3G6ET 1X3UA 2O03A 3H6ZA 4U88A 1R4NB 3LAJA 1AKHA 1CF7B 2OZ6A 4RM2A 1U3OA 2N8GA 5LJ3j 4M7AF 5EG0A 3TDZC 1TC3C 3HL2A 2XDDA 1FT9A 4M9ZA 3GMEA 1TOVA 3VU3C 4AIDA 2DFFA 1AOJA 1VQLQ 4C92G 2LJ0A 2VPRA 3KYDB 4FQGA 3V7CA 2A7YA 2LC4A 4CZZA 3H0IA 3PT9A 4KT6A 5HLIA 3A0BC 1BL0A 2F5EA 2DW4A 4AT1B 3K70C 2ZFWA 2OTJQ 3GXOA 2DMPA 1H89C 2ME6A 1RRJA 2HSPA 2PMZN 5DDGA 1YIJA 3EGDA 1G6NA 3DPUA 1D5VA 3QOEA 4FW2A 1R7JA 1OPKA 1OX8A 4ZDLA 2DK3A 4RS8A 2MUNA 4BXFA 5HY6A 4M9SA 4HBLA 4DYRA 4A6EA 3I9V2 3PUFA 2ED0A 3RPUD 2PG4A 3HOUJ 4DOWA 2R7VA 4M7AA 3O6BB 3IAM2 1YS6A 4YEJA 1FOYA 2GWRA 3BR0A 4YIRX 5GMKj 2AZSA 1QWEA 3EG9A 3TL4X 3I5RA 3JB9G 4LDVA 4AVPA 1K6OA 1A31A 2DJQA 3M59A 3CDLA 1YFHA 4BL0B 1Y0UA 1EJ9A 3TO6A 1M30A 1X6BA 1VQOI 5LJ3g 5LBQA 2FOWA 3CCET 3K1PA 3GNGA 3CD6A 4FSSA 4HCZA 2L3RA 2HOSA 2KYBA 2K9QA 4NBQA 4IUQA 2XF6A 4CCMA 2MBFA 3M0TA 2L8DA 3QJYA 2QLZA 1YIOA 3FMRA 2CO5A 2C06A 1MMNA 1R1UA 2JPCA 3FXRA 3M8EA 4XLCA 1TWAJ 1OISA 1IUYA 2BHZA 1E17A 2Y4YA 1E6HA 2MH2A 5D8KB 4EMSA 4M77B 5EEAA 2EFOA 2H6CA 3S6WA 2DL3A 2XF5A 1UZCA 3BR2A 2A3LA 4RMOA 1ZLMA 1N6AA 3D5RC 3HPHA 4D5CA 3PNYA 3VOEA 1YHQA 2QVOA 3JTGA 2GXBA 4J8OA 3CUQA 3D0SA 6AT1B 2VPLA 2J6OA 1EF4A 3CMAQ 3I59A 1M1EB 4HNUA 1M2VB 3SWNB 2JOYA 2ZPIB 4P96A 2HMAA 1ZK8A 4QSHA 1X2KA 3CMET 1Q86C 4BYYA 3K4NA 5E1XA 3JRDA 5GAMe 2CW8A 4ZGEB 1P7IA 3BPVA 1YS7A 4K11A 2JA5J 4BGDA 2RO0A 2FBIA 5KH6A 3QIIA 2JM9A 2KK4A 2XAHA 5BQTA 1VOMA 2NLUA 4B47A 1ZN2A 3S2DJ 1YITT 2K86A 4PJOE 2LR8A 1U3EM 2XDPA 1BBYA 5CKBA 5CKFA 4KA4A 3EPZA 3JSPA 2HQNA 3ZMZA 1NG6A 2LDMA 3QYGB 4WTOB 4BBRJ 4KIBA 5KYNA 3D1NI 2KBTA 2YUPA 4M75G 1UMQA 4I98B 2XC7A 4NS5A 2DO3A 1S8NA 1XX5A 2AKKA 2QQ9A 2PZ1A 2W82A 3S1QJ 1EH6A 1FOWA 1Y6IA 3FEOA 2OAWA 2A6TA 2JT4A 5EJCA 3V4GA 2F4IA 4UUSB 3L2RA 5DM7F 1B8IA 3KLNA 3CC2I 2F5TX 4B6MA 4F7UF 3MZHA 2X3WD 1KQ8A 1JKPC 2RGVA 2JTVA 1BW6A 2DL7A 1K0SA 4XKVA 5F0HA 3I4MJ 3NTHA 3G4SI 4KUMA 1MUZA 4Y52J 2M7AA 1RNLA 2FE3A 4KH0B 1T0FC 2RHIA 5CIUA 3CCQQ 5GJWB 1RI0A 5J8FA 1EFNA 3VJPA 1Z3XA 1AZGB 3BDUA 3JCMc 5C0MA 3CC7I 5DV5A 1QVFP 3OYDA 2LYCA 1QLYA 3LW5E 4XONA 3X28B 2DJNA 1TH7A 5ILUA 2B7EA 3BG6A 2R7WA 3CC4T 1HLVA 2R92J 1HK9A 2DF6A 1WLPB 4R0KA 1VQNA 2P84A 3WGIA 1JKQC 2V1DA 1LPQA 3MP1A 5JR3A 4F7UA 1Z6TA 5D4RA 2X98A 1XCBA 3M9QA 2KMTA 1Q1VA 4HEA2 3IH3A 4CYDA 2O88A 3H36A 5GAN6 1X58A 2X1DA 3TO7A 4L5JA 1BIAA 4LK0F 3VSLA 5IYBJ 4UUVA 3K2ZA 1SFKA 2R7FA 5F6FA 3WTYC 4CCLA 3GFJA 1W0UA 2P5VA 2ZC2A 4LXCA 2NNNA 1OPLA 5IXFA 2DK5A 2BZYA 1KD1U 2WAFA 1UHSA 4LIVA 2Z5UA 4XAXB 2VASA 5HCKA 1XOVA 1K9MR 2W85A 2L3QA 5IOYA 2CRGA 4CUGA 3CXCP 4R1HA 4O6JA 1MJ9A 1ZLKA 1B1BA 1VQOQ 1Q82U 1QHGA 3G1JA 4HNTA 2IA1A 1FBSA 1B6AA 2ID3A 2W1OA 2P0QA 3LWHA 4HCCA 1OQYA 2JRMA 4MHGA 1VQ4A 4I0AA 3RKWA 2CREA 3OYCA 5DYMA 1LKXA 1Z9CA 1TW2A 1JHFA 2W48A 1FOKA 3E5UA 4FW1A 4BE0A 1Z67A 3OMGA 2YUQA 3DPTA 2YUOA 2D1VA 3R0AA 2CT4A 2LK2A 2G0EA 1FYLA 1J0RA 2LVSA 4RTXA 4BEHB 3BJ6A 4A0ZA 1A0NB 2ZSIB 2E35A 4HSTA 5JVGF 2L9RA 2DXIA 4WCGA 1WI9A 2LP0A 4J83A 2DA3A 2JVHA 2WC2A 3CLQA 1VZ0A 3BG7A 4I09A 1WHHA 1USSA 1FOXA 2KIFA 2MD5A 4DGWB 2HTJA 4LK1F 4QT7A 2JJ9A 2KR3A 3EYYA 1F5TA 1PSEA 3LH0A 4N4IA 2DODA 3EYIA 3X20B 4HVWA 1BC8C 1AOYA 4UC4A 1VQ5T 4JBAA 1MBEA 1ZQ3P 4Z88A 2RK2A 3ZL7C 4JJNK 2XGEA 4BJTA 1JO8A 2DIQA 2QA4A 3CDHA 4M7DD 2HXOA 5D5WB 1MH3A 3R61A 2OF7A 3EUHA 4L0YB 2LH9A 3HTRA 4F17A 4EIKA 3P7NA 2E5KA 2KIMA 3GLLA 3BFMA 4F93B 2M0YA 1FSEA 3CCSI 1J59A 2EPDA 2RHXA 3PTAA 2K9MA 5J26A 2QYZA 3OOPA 2K9SA 3RYPA 1RPWA 5KE3A 3G6EI 1UGSB 3EG2A 1JQQA 1FX7A 2R7QA 4KJZA 4ZC3A 4XTXA 3GFMA 3GFIA 5GAMj 4DW6A 2FEZA 3JSOA 4C8QG 2CW7A 2CP5A 2BZXA 4U0WA 4IF4A 4OINF 4DYCA 1DPRA 1H0MA 2D0QB 3H9GA 1EV7A 2M0MA 3KP3A 5JLWA 1E3HA 2JNGA 4M78A 3CC2Q 1YE9A 1R22A 1IV6A 3OIPA 2EJFA 4PJOA 3LSJA 4J9CA 1OJLA 1Y96B 5CKHA 3G4SQ 1IN7A 3MP6A 5GAN3 3JCMf 2ZMEA 1OKRA 5IT3A 3MKZA 4IKFA 1G3WA 2R7DA 3CC7Q 2CQ7A 3UNGC 2OBPA 1VQKA 4JRPA 3ZN0A 1QQIA 2FXAA 4BJ6C 2EJRA 2FX0A 3K1MA 3T5XA 1TU0B 4P5OA 2DFUA 4RTVA 1OULA 3U1KA 2GXGA 5GAN4 2BHYA 3F8FA 2R5ZB 2HI3A 2E1NA 1G8XA 4XOTA 3ZMVA 3GEZA 2RH2A 1PDNC 4M6XA 2DPDA 3DKYA 3FKJA 1NBEB 2KVQG 4R79A 2LT1A 3ASKA 1WGSA 3M5AA 3FZVA 3ABKH 2LMJA 3GPLA 3DEWA 2OAZA 2VXZA 4D9JA 1W6XA 2IG0A 2D6FA 1YI2T 2Q2EB 2R5MA 3UA6A 1V54H 2L2OA 1ZH5A 1RUWA 2WY8Q 2NUPA 1VFCA 1YX3A 3IRRA 5GAMg 4XTWA 3GOXA 4LFUA 1JXOA 5KYWB 4QW2A 3PIPA 1FMVA 2FYKA 3IV5A 2HOTA 4RTWA 2HS5A 1BKBA 1XMKA 1RL2A 2P4TA 2WTEA 1ITYA 1BIBA 4XKWA 1KD1C 2DLPA 2R7SA 2IS2A 3CF2A 2CWEA 3ABUA 3IAS2 3OIOA 4A93J 2MZ4A 1IO6A 2JMCA 2M0CA 2VB6A 3JRAA 4KDPA 2PUKB 1K8AC 3JB9H 1YOVB 3OMYA 2JN6A 2EFWA 1I1SA 1V5FA 2W57A 3J80R 1XTDA 2EGCA 2FO0A 4OF1A 5FU6C 1Q82C 4OMQA 3K69A 3ZEHA 4OMYA 2R5YB 2E2IJ 4N0AA 1JT0A 2WB1N 3PFIA 4A3DJ 1X2MA 2DE0X 2BXZA 2NNYA 1VQMI 1RADB 2DYRH 4HG2A 1W1FA 1NG2A 1OYYA 5FU6B 5F1JA 1FTZA 1R36A 2MC3A 3I56I 1I1GA 2LJ1A 4LDYA 3ULRB 3GF2A 4IHYA 2EYYA 2DIGA 1FIPA 1C0WA 4EM0B 2K5IA 4DQ2A 4C8QB 4HCBA 3DBRB 2QEXT 1QVFA 1P9QC 5C3EJ 3RKXA 3L1PA 3CCUT 3KZYA 2PJRA 1FYKA 2PTKA 3OBYA 3NWSA 3VKIA 1KONA 3CMEI 2AXTC 3QU6A 5LHHA 1Q7YR 2E6NA 4MEYF 1WQ7A 3E6MA 2KT0A 4PJLA 3HYIA 3LYIA 3S2WA 4UHTA 4M77E 3E9GA 2UWMA 3SFIA 4A3FJ 4BHBA 3S3OA 1YITI 5F27A 2M8EA 4ME7A 2HWVA 4M9XA 1UHWA 2EV6A 4XM3A 5HS8A 1QNTA 4CCKA 1WHJA 2BW3A 4B09A 4X0GA 2HAXA 3ZXSA 4CYCB 3OYLA 4LE9A 2BE7D 1A6IA 1MKMA 1GV2A 1U1TA 1Z1DA 2E60A 1OZ3A 2OPTA 4PFPA 4WK8F 4J9EA 4C92E 5KK1A 3JCMh 1Y8RB 2JUFA 1D8JA 4D7MA 1JU5C 4OMOA 4BUGA 4RAGA 1D8KA 3QODA 5BPIA 2DTIA 2RQTA 4J5YA 2DTHA 2KSSA 4OMNA 3X25B 3SEMA 3UT1A 4NQWA 1SVOA 1ORKA 1MNDA 1S29A 3GVAA 2MC4A 4GXOA 5F0FA 5JHFA 3K70D 4C0DB 2P5KA 1PVEA 3CCSQ 3P9IA 1OR7C 3OYBA 4XSZF 2ZNZA 4BDZA 1K83J 3G6EQ 4HSRA 1JHHA 2X1CA 3TKYA 4AU7A 5J47A 4ENJA 1AWOA 1OCTC 3B02A 3VS7A 3T1BA 2G7UA 3MHXA 1KU9A 1E2XA 3ZOBA 1X4PA 5HVQC 1JEGA 2XASA 4L9TA 1NG7A 1WJEA 5L3DA 1OV3A 4N0BA 3INZA 1XS9A 4BDYA 4A3EJ 1RKTA 2JW4A 2W25A 3CC4I 1JRIA 3S2HJ 1RUOA 1YG2A 1B9NA 1H3HA 1WJFA 3WU0A 2F5KA 3DLLA 3I64A 3AHUA 3WGHA 3L2WA 1FBQA 1OCPA 2HYFA 1RAHB 2RC4A 2FU4A 1RESA 4E4HA 1GT0C 1AD5A 5E3OA 1BYMA 3KPHA 1BK2A 3PNWC 2K4YA 3EHRA 3IH2A 5CLSA 3BTJA 3F22A 1U8RA 5GAN8 2O9LA 1VYVA 1IGUA 2HL3A 1IW7F 2P8TA 1OPCA 4BU2A 2CQQA 1T39A 1XB4A 1F4KA 2EYWA 3ER0A 1Z21A 3OL3A 2GAUA 2MVTA 2KNBB 3G1LA 3E3VA 2F5VA 1OOTA 2KXCA 5E8IA 5AYFA 4ABZA 2HDWA 4D1QA 3A01A 3R6OA 4FX0A 2NWMA 1FMKA 2FNPA 1IRFA 3CJTB 2RHUA 4LB6B 4J6XA 3LH5A 1TWCJ 1IGNA 3GX4X 4LUDA 2LCCA 1XGMA 2Z1DA 3H5AA 4PJJA 2DDBA 4YIIA 4E47A 4R56A 1D3YA 1CSKA 1T8IA 1N27A 4ZYDA 2EIFA 1GCQC 1GRIA 5KYXB 2X51A 1AWCA 3SB2A 2A6HF 3SHFA 3HFNA 2XAUA 1Q86R 5B3SH 2AHJB 3GFLA 2CV0A 1WXTA 4J7FA 2HTSA 4EV0A 2Q1ZB 2HYJA 5IH2A 3F6OA 2AZVA 1XMXA 5IT9R 2HEOA 3A98A 1RI9A 1R9TJ 4AUXA 1I39A 4ESRA 5IP9J 1OYWA 4M6VA 1BR4A 3LSPA 4A3CJ 1PM3A 3P5JA 4MNUA 3FXLA 4C5IA 5D5VB 1U9NA 3I55I 1UFMA 1MD0A 3I56Q 1D1AA 4N4NB 1APLC 3S16J 2Z33A 2LMDA 3VPRA 4E7LA 1H9GA 2JA2A 1NJIU 1Q1HA 3OIQA 5LGUA 3GZ6A 4JRIA 3FDRA 4CI0C 5A0DA 2DQLA 2ELKA 3B6AA 1VQ5I 1HW1A 2K9LA 2ZXWH 1Y57A 3HL8A 2VJIA 4M77F 3CMEQ 1RETA 1OCCH 3NFCA 1K78B 5GMKi 3PSIA 4PGHA 2F2WA 4RGSA 1RQ6A 2LOOA 2XDVA 1F9NA 3R6SA 3ERED 5EDNA 4EQQA 3CCVI 1WHGA 2AXLA 2K85A 2EQUA 9ATCB 1BI3A 2FF4A 3E97A 2DJIA 2MOXA 4I6ZA 2VC1A 1HCRA 4CO8A 4BHPA 3E6CC 1HA8A 2JSCA 2UXNA 1KQ0A 1PYVA 1SD4A 4L9NA 2A37A 2J06A 2J6KA 1ZA1B 3BZCA 3FIFA 2KIUA 2TRTA 2RK1A 1K79A 3MP8A 4C92F 3CXCS 4C5EA 5IHIA 2GNCA 1QVTA 1UG1A 4PL6A 5FFXA 2NUZA 2OTJA 2CYZB 2LRQA 1ZELA 1TUDA 3EHQA 1Z91A 4I02A 2JZ2A 4XTUA 4EMKC 7AT1B 2A69F 2MCNA 3FXOA 5H6RA 3F3XA 4M77A 2HVRA 2CFOA 3HSRA 1TQMA 3A4CA 3LFKA 2KRFA 2DXTA 2E1CA 4E2FB 2CUEA 2FEIA 2IW5A 2G9WA 2QENA 3E9FA 4IHTA 3FXQA 2JA6J 3J7AW 4WX9A 5H2FC 3EUHC 1BCMA 1NK3P 3O2PE 1TUCA 1YJNT 2CH4W 3JB9F 2XRLA 2DPPB 4EM1A 1WI7A 1YW9A 3F0CA 4P9UA 2M1HA 4C92A 1IRGA 2BIVA 2GQQA 3DB4A 1GXIE 3U9GA 3F21A 2MA3A 4BB7A 1WGXA 3VUBA 5ILVA 1WIEA 1WQ2A 3A8HB 4WCIA 3CC4Q 4C3IJ 2ELJA 3CESA 1K61A 1VQ6I 2RQUA 1S7AA 4NHJA 1QVPA 1SSHA 2GOMA 3Q0WA 1WHLA 4JJDA 3BJOA 3AL0B 2H8WA 3M8JA 1YI2I 2EGEA 2WADA 4M78C 4KN4X 1VIFA 1NYFA 1MNEA 1VI0A 3K1NA 3WTTC 3MKYB 2XKPA 2OJ2A 4PJOC 5LJ3f 5ED4A 1ETQA 1JJ2P 4OB3B 5D7UA 3H5RA 5J1RA 3DKMA 2ZMEC 3ZQLA 3WHBA 1B07A 1VQ8A 3I71A 1WZ2A 2DA4A 4QIWN 2F4MB 2GA1A 1UUEA 4NNJA 3U21A 2MH9A 2DOFA 5LEKA 1LVAA 1QHHD 2C0IA 1U8BA 3TSZA 3F8CA 4B44A 2FSWA 2OCEA 3CMAA 4DIQA 2QBYA 4FETA 2LQ8A 3OYYA 2GF7A 5FROA 4AVZA 4BE1A 1VUBA 2YRCA 2EPFA 5CVVA 3EG1A 5GPAA 2YXYA 2VJ5A 1PRLC 2CSQA 4A0XA 3J7AO 2EV0A 1X43A 2IS6A 2ZZDA 3UF4A 3H9QA 1I5ZA 5K7HA 4NOYA 2OUMA 3RYRA 1B72A 3VYRB 2I5UA 5I2SA 3KFWX 1M5Q1 4M7DB 1WVRA 2ZJQF 3H0FA 2BBYA 3NTIA 2QEXI 2E64A 1BCOA 5DCMB 2CZ6B 1Z7UA 2KRSA 2ESHA 3CCUI 3LLRA 1GVJA 1J7KA 1D1BA 5GTHC 2GA2A 1U78A 1W2BP 2O2OA 1VTNC 2BZ8A 3DWLE 1SFEA 4JX4A 5J6XA 3ZCOA 5GAEJ 1Z9QA 5CK9A 2LSOA 3TO9A 3I55Q 4IVNA 6PAXA 4EJTA 3F72A 3IL2A 1NJIC 2QTXA 4MFDA 1UGPB 1BI0A 1BR1A 1RAAB 1XNIA 4V2FA 1M90U 3N5BB 2X9DA 4LJZF 4C8QE 1KYWA 1VQ5Q 3AG3H 1NTCA 1QCFA 1OCRH 2W7NA 3DP7A 3CCQA 3FMQA 3IHUA 5AIQA 3HKZA 1R5GA 2A5WA 3WE2A 2E5ZA 5E3MA 3Q9SA 1ZR4A 1WJBA 2P4RA 3CCVQ 2XMFA 3A8GB 4J9DA 4XN0A 3H0GJ 2AIRB 4HVUA 3JTHA 5E8GA 4CCJA 5EEGA 5B1AH 1YTYA 1LJOA 2DM1A 2ZJRF 2GFAA 2VONA 4J7IA 3JCMQ 4M75A 1PJRA 2K5CA 2LY2A 3HTUA 3QDRB 4KMFA 1X2NA 2EWNA 2DOAA 1ZSZB 2XK0A 3A03A 1CQTA 3WU2C 5GAOr 1T0HA 2XSDC 1PC0A 4C3HJ 4XQ3A 5LJ5j 1QP3A 1KYZA 2CSOA 4IHSA 2DILA 2JTFA 5DUKA 3PE0A 2LX9A 2I8DA 4IHWA 5FW9A 5KCHA 4UB8C 2HVQA 3EETA 3H92A 4J19A 2NVQJ 5LJ3h 2P6TA 4S0HB 5LEJA 1DUXC 4A3LJ 5A2QE 2L7MP 4OGEA 5EF6A 2KRMA 2PMZA 1DU0A 5FLXR 3G71A 3M0QA 1JBMA 2PBIA 4DNCA 4DYQA 3KEOA 5J1YA 3HOVJ 2RA2A 3KXTA 1V1CA 2DAOA 3VODA 2L89A 2O01E 2ZO4A 1KD1R 2FPFA 4F52A 2WAEA 5FJ8J 2D2WA 3ASOH 2K4BA 1UJ0A 2BYVE 2YSQA 3OYIA 1VQOA 3M07A 5CR2A 1Q82R 5IAYA 3BY7A 1R49A 3BPXA 3BR5A 4O5VA 2M87A 1VQ6Q 3QDFA 3PVQA 3J7ZI 1JGGA 2J6FA 3FHZA 2E34A 5LHIA 1S72T 2W84A 1YI2Q 3UATA 4M7AD 4DOZA 5GMKh 1LNWA 2CZ0B 2EFNA 1FC3A 2VE9A 1H9TA 3I4NJ 2J7IA 2M9UA 3FLGA 5LD2C 4FSXA 4Y28E 5CO7A 3T9NA 5LJ5g 1N75A 5A2QK 2FA5A 1ARKA 2RJEA 4LN2A 2DMOA 2VKHA 4J9FA 5J4VA 4E7HA 3DEUA 3J81Z 2VWFA 2DTOA 2EYQA 4F91B 3CLOA 3H3UA 4RTZA 2LNBA 2KKOA 2NVYJ 5C4XJ 1LPLA 2A6EF 2WBMA 3Q0VA 2O4XA 4FT2A 2PUOB 5GANd 2PLYA 2AQEA 1JTXA 1YCSB 2LZ6B 1M8VA 1S1NA 4J9HA 3OSVA 2DEQA 2D8JA 4HZFA 3TP0A 1YW7A 3L9FA 3OYGA 2G6FX 1HW2A 2ZCFB 4ELZC 2E12A 3CPWP 4CC3A 2JMWA 3A02A 3AG2H 3FDYA 4Y7NJ 4BXUA 4F92B 1JKRC 2GBYA 1Q95G 4C0ZA 5K7ZA 4FASD 3ZP5A 3T8RA 1XJWB 3IKVA 4OAYA 2CGPA 4EJWA 3B73A 2PJPA 3JAMR 4AFQC 2V26A 4AFZC 2QEXQ 3CCUQ 1MBGA 4RUGA 1LUJB 1T56A 2E2HJ 1PKTA 3PO3J 1JUSA 4MZTA 1SMTA 5BPDA 1N8RR 2D45A 4CC2A 2KMUA 1H8AC 2EGAA 3I54A 2HFHA 5L3CA 3FIWA 3I35A 2Q2EA 2FNAA 4TV7A 3LGLA 4MMKA 3QG1A 5GMKl 4EATA 1DU6A 2DA5A 3BTLA 5KYWA 4L6V5 1ZHFA 4C8QF 5LRRA 3HSEA 2PI0A 1M90C 1SF9A 3CC2A 3LWFA 2VN2A 4NUBA 3PQJA 2QQBA 3S1RJ 1TG0A 1JJ2A 3G4SA 4FYWB 1YJ9T 2EFIA 1BBZA 2ECCA 1ZUUA 1ZX6A 1I5LA 2YX7A 1VQ6T 2EFQA 3M0UA 3REBB 1RZ4A 4JS5A 3CJNA 4HQMA 1K4TA 1GV5A 1OYIA 3D5SC 4EEFG 1P4AA 1ABOA 4RKUE 3CC7A 3J7AF 2IGMA 3OMCA 4X34A 2R5YA 3HSBA 3A5ZB 2L9NA 3LAPA 2VJ4A 1ZRDA 2DD4A 1ZR2A 3E19A 1WFWA 3TW6A 5GMKm 3WVEB 4ZGDB 3OOUA 2ISZA 4PFZA 4BI4A 1RR8C 4FT8A 4LGWA 2DX1A 3HPGA 1BC7C 1B7TA 1JTYA 2E1OA 4PK4A 2GXAA 2M34A 2CP0A 3SFMA 4C8QA 2MF2A 1LE8B 1MJBA 2DQRA 1VQMT 1YJNI 2JUGA 2VOOA 1Y8QB 3ZQGA 1ZBJA 1X1DA 1D1CA 3MD2A 4IUPA 2PNIA 4MMLA 3PNTA 1LEBA 5GAHJ 5IHNA 2HNIA 5CAIA 3I56T 2LP5A 2XV4S 5L8RE 1WJQA 1WHUA 3N05A 3K4LA 1W2BA 4CSWA 1ZREA 2DTRA 3OSFA 2QZ8A 2X6OA 1E6GA 2B8AA 2P0PA 2DRKA 3C2GA 3EGUA 4C5HA 2EILH 1N9RA 5DM7R 1KQSP 1ZG1A 1G3TA 2Z2SB 1YCYA 1Y1VJ 3I56A 3OSGA 1W5SA 4LIUA 2CH4A 4F04B 1TUGB 1RI7A 2KISA 5K5OA 4ENNA 3ZBDA 1PP8F 3MEWA 4JYKA 3S93A 2F2EA 2V9PA 2BTTA 2HKQB 3JRBA 2H09A 1W1WE 1RR7A 2PQ8A 3OB9A 1SFUA 3LOCA 1X3WB 5FD6A 2ZJPF 2CUDA 3V8JA 2CP7A 2VYTA 1J5YA 3ESWB 3HOTA 4A4HA 2IRFG 2BGCA 4ZGJB 1FIAA 2YRDA 1NEGA 1M8MA 2Y69H 3H1CA 2H3JA 2XDBA 2RPNA 3FB9A 4DBQA 4XL9A 3J81R 2MIOA 2L3DA 1MV3A 5FB2A 3N4MA 1SPKA 1H3ZA 4CHUA 4Z8AA 2L3SA 3QPSA 1AT1B 4IJAA 1QVGA 3DTKA 2DKGA 3L09A 4EMHA 3CO6C 1CKBA 5CQXA 3F70A 2X4HA 3FM5A 2M9HA 2ZCWA 4B4CA 3W2AA 1ETWA 3S1MJ 4DEXA 2OQRA 2ZBKA 1ZUKA 2IA0A 4KFCA 2G3RA 3CQTA 5D6YA 4JPBW 1UJYA 2DU9A 2CV1A 4D8DA 3JCMW 5TISC 5I11A 1KSWA 1TNTA 2KJCA 2M4GA 1PUFA 4RAFA 4J6WA 4NB5A 2KL4A 4NL3A 2RJDA 4NL2A 4Y17A 1W7PA 3OWTA 1MGQA 4YELA 5AT1B 1K1ZA 2Y0SN 5IHKA 1X3ZB 2FMLA 3CZ6A 1O4XA 4BBSJ 2C0TA 2DJZA 4M3FA 1W5CC 3Q3SA 1S6LA 2MAMA 4ZNXA 1M3AA 1KU3A 1O3QA 2RI3A 4JRKA 5D6XA 3CCSA 3KFVA 3FXJA 2HQ5A 3HKSA 2ENMA 3MMYB 1HYOA 2NUTA 4E7SA 3CD6I 3G6EA 3DQVC 3EDPA 2JPBA 5HLHA 4OMLA 1WYXA 3L2ZA 2D0NA 5CQYA 5ICFA 5EG2A 4GLKA 1ZGAA 2ISYA 4E6KG 1M3BA 1NZ9A 4XQFA 2MWOA 3FISA 2VE8A 4RMNA 2CUJA 1T38A 1Y0NA 1ZG3A 5ERIA 4FISA 4PCQA 4BAYA 4ESBA 3K10A 2OTLT 2NS8A 2HVSA 1D0ZA 4AM3A 1VQPT 3S32A 5HDGA 1TZLA 1Z77A 1R71A 3O8HA 4NC8A 1O3RA 4CGZA 1B9MA 2M3AA 3JSCA 2WV0A 4A3MJ 3K4CA 1YHQI 1DP7P 3J80Z 1BM9A 1VQ9T 2E7WA 4GGGA 3LSRA 5TJJA 4N4OB 2KLOA 5FLVA 4W1UA 1S7OA 1ETOA 3Q1JA 4LUEA 1IHWA 2GIVA 2E36A 2VXFA 1F43A 2V1UA 3CBPA 2XHKA 5HNHA 3EFSA 4M78D 2E7XA 1LCKA 3VYGA 2K7LA 2XG8D 1W2BS 2HDCA 3JCMV 2QQSA 1VQ7T 4PJOD 1P2FA 3BG5A 1RABB 3CPWA 2I0NA 3I4PA 2COYA 2XKOC 1YJNQ 1D0YA 2PMUA 3FKIJ 3I55T 3QPTA 3NTKA 4B48A 2CP6A 4M75C 2QQ8A 2ED1A 3JCMP 3SD4A 2STTA 4X9CA 2X4YA 4U0VA 2IAIA 1P7JA 3CCEA 2E4HA 3VWBA 4BS9A 1QBJA 4AYBN 4HLYA 4UXNA 2RMOA 3CCLT 1X27A 2WY7Q 1K4SA 2QDLA 3I0TA 1RAGB 2LQNA 2HNHA 3AFHA 3WTZA 4UVCA 1S72I 3H41A 1B34B 1V76A 5GTIC 1NLOC 1ETXA 3GTLJ 3BP8A 4JQFA 2KP6A 3TEEA 1HSJA 4Y13A 1NE8A 3M0PA 4CRIA 1IZ6A 2FVUA 2DA6A 1KJWA 5KYYA 2CS7A 1YX5A 1HSTA 2CW0F 3CCVT 5GAN7 2JS2A 2O8XA 5DS9A 2DTZA 2EQIA 2MMPA 4HOBA 5EGOB 1MBJA 1WRJA 1YLFA 1G83A 1DQUA 2RREA 1XDUA 5FD5A 4BQNA 2ZPGB 1UFFA 1R6RA 2K5LA 2V8KA 4AIHA 2Y9ZA 1ZAOA 3A2KA 2E5NA 5IP6A 2CU7A 2IP2A 5HS9A 3J80E 2WB1A 3K4KA 5FGMA 4D5FA 2VLAA 4DBFA 1NJIR 2X3XD 2A07F 4ATOA 1LDDA 3VRYA 3OR1C 4M72A 1E7OA 2JS0A 5DTDA 2KJBA 3ISPA 4JK1X 1I0CA 2F48A 3HUGB 3MVPA 1TW3A 3JR9A 1YRNB 2K9GA 2HL5C 4YG2F 1A04A 2FL7A 1YITA 3GNFB 3LMMA 1BI1A 5M5XJ 1SD5A 2CG4A 4ENMA 2ADUA 2YSRA 1S9HA 2ZPEB 3EH1A 3I5SA 3HRUA 5LL6S 1B3QA 3EG0A 4VUBA 1DP3A 4RA2A 2LJ3A 1ZYRF 2EH3A 1T2KA 1GUUA 4UY8I 1KQSA 4IUVA 2ETHA 3LSGA 2EW3A 2KRNA 3HHTB 4M7DF 1MDMA 1NK2P 3J80K 3QWXX 2CUFA 1UELB 3G73A 2CJJA 2Y9YA 4G8XA 1KA8A 4ZYHA 2L5QA 5I22A 1AKHB 4YFNF 1QKXA 1JXMA 3KETA 2H1KA 2KY9A 5EG0B 1YJ9I 1EZZB 3M4OJ 2AHQA 1LEAA 2DXBA 1WA7A 3BR6A 2ZXJA 2HBWA 4XLPF 2OJED 4KT5C 2RHYA 4LDUA 4E7IA 2DXCA 4RCCA 2OU2A 3FHNA 1R0CB 1P4XA 2FRWA 2LTOA 2EZLA 1O7FA 3KP2A 4ESFA 4F16A 2CZ1B 3MKDA 3OS5A 5CKEA 3LSIA 4A3GJ 1N5ZA 2DL4A 1RLQC 4A4FA 3ULQB 2DT6A 1WNLA 3LGFA 1OEBA 2K3FA 1ETYA 2VT3A 4UV9A 1UAAA 5FRNA 4IQJA 1KHIA 3EGDB 3CC4A 2BOLA 1IXRC 1IXSB 1O57A 1B4AA 5KAIC 2IIMA 2QK0A 3FXUA 2RI2A 2W10A 2XAJA 4AFUC 4M7AC 1GVDA 2OC6A 1YW8A 5DCMA 1TWGJ 2ZKZA 1JJ6C 3C3WA 1YHQQ 5IT9Z 1OQKA 1LFBA 1NH3A 2M5WA 5CPRB 5F0CA 3TP3A 2PU9B 5CJ9A 2L9SA 3FF5A 3A52A 1XMAA 1HD3A 3KP7A 2LNHB 3EG9B 3PMIA 4AMCA 4K2EA 2DA7A 1L0OC 5DM6F 4RB2C 2OZUA 1U5SA 1TXQA 2K2VA 2KI7A 5L3BA 1GBQA 3CCJT 3CQZJ 1U5TA 5D8LB 2RDPA 1ONVA 2EZHA 1U0JA 2O5RA 1BJZA 4GRIA 5LRSA 3S14J 2O9VA 3WHCA 2ELHA 1WZOA 2LT4A 2M4KA 5KNLA 4L18B 1YN8A 3MZYA 2DVJA 1V55H 2BY2A 3M53A 1JB0E 2V1XA 1VIEA 1GHCA 2VIXA 1F36A 5EZGA 2F2XA 3L2VA 3OS0A 3RIRA 1QCOA 2M45A 2XVCA 4L9VA 2K6DA 4IO9F 3CCRA 2DBBA 1S72Q 5HNFA 1R23A 2EB7A 5F08A 2DI3A 2K40A 2VODA 1AVZC 2LBFA 2QM3A 2BE9B 2GTJA 5FRMA 3CUQC 3K9TA 2K79A 3FJPA 3VUZA 1PSFA 2JSPA 4OOIA 4PZJA 2RKHA 1ZKGA 2CS3A 3SZGA 3AKZA 1KU7A 4BQAA 1ABQA 1ZUYA 2ROLA 2VQCA 2FOKA 5D6EA 1ZSZA 3CUQB 2YU9J 4MDWA 2F5CA 1N8RC 2KDZA 5DLQE 4OVAA 1MBFA 3I59B 1J2XA 5D5XB 2Z9OA 3KYCB 2R7TA 2Y0MA 1BW5A 4R8HA 2M2EA 2F4OB 5IYDJ 2DL8A 1UE9A 2MGQA 3R0JA 3JRHA 1MMDA 4JZ4A 2XICA 1N9SA 1SRMA 2ZSHB 4J01A 3Q5FA 2M0OA 1TQIA 1M90R 4LDXA 4EM2A 1XGNA 4B43A 1BI2A 1I6XA 4J6YA 2VC0A 2VBZA 5IP7J 2IS4A 3TOBA 1F1ZA 3ERMA 3OYJA 2FZCB 1MSFC 1R00A 4PFOA 4BY6C 1MMSA 3BROA 1Y56A 5H6QA 3GWZA 4IX7A 1V29B 1X2QA 1DGWY 3CCQT 1ZQ1A 2DBKA 2VVKA 1WJ5A 3OA6A 1KQSS 1LNXA 1EA3A 4IUUA 1GLNA 1V3FA 1SMYF 3KCCA 3LSKA 2JK3A 4JX6A 5E1WA 4QPQA 1A36A 2KDOA 1OI1A 4XTZA 3BLYA 5GPCA 3VS2A 4M73A 2JMAA 2KPMA 3ZQ7A 2CGHA 5F1RA 3LA7A 4EPCA 1VYUA 4D0PA 4W97A 1WJAA 3FX3A 4MTDA 1OZ2A 2HZYA 3DCFA 3VS4A 3WXMB 2BY0A 3C2HA 3CTAA 2QYOA 4LOCA 3UR3C 1LOJA 3CCMT 3PVLA 2X6XA 2ECBA 2QKLB 1MHNA 4RB1A 2OTLI 1Z9ZA 5L3FA 3ECOA 1VQPI 2IPOB 2YLCA 2YS9A 4J9GA 2HKXA 4U7BA 2HQXA 1LQ1A 2KYMA 1DPUA 2VKNA 2FPEA 1YJ9Q 1UHFA 5M5WJ 1AWXA 4HT8A 3CXCA 1WH7A 1CF7A 1KGSA 3KLOA 5CVUA 1VQ9I 4DJAA 4HX7A 2XUBA 4BQOA 4KRTA 2IVMA 2X85A 3Q9VA 4II3A 4AG2C 4U7DA 4NC7A 4CCNA 2LKXA 1WCMJ 2CV2A 1FXXA 3RI4A 2PVDB 2LKPA 2VI6A 4AD9A 4JJBA 1AU7A 3K4BA 4XR6A 3QO3A 4M77D 2V79A 3CMYA 2ZNYA 3NWTA 1PD1A 1BA5A 3X26B 1VQ6A 1VQ7I 1HW5A 1UHMA 2IGNA 1QWFA 1X75C 2BE5F 1Q81U 1QVFS 3PMTA 2WSFE 1YI2A 1VQMQ 2GQVA 3M0RA 2FB7A 2KIQA 5J39A 3HB9A 1WPYA 1WX6A 2IVWA 2MPXC 2QG9B 2ZJ2A 3E2UA 3X24B 2Z99A 3VRZA 2EK5A 3JCUC 1IGQA 2MSYA 2OV7A 2P0KA 3QAHA 4C92D 4LD6A 3CCLI 4BI3A 4M78G 2DL5A 3CPFA 1KQ9A 4IHVA 5EEHA 5FKOA 1QU3A 4HDVA 4KT0E 1K7AA 2ZPHB 4X1EA 3J7AY 5LGTA 2GIZA 1G4DA 1IG7A 1OMIA 3W6VA 2FHDA 3JCMd 3M3YJ 1OCZH 2QSFX 5LJ5e 1K73U 3BCAA 4DZJA 3UPUA 3GTJJ 4Z6YA 4FE7A 1UECA 2HU9A 1JGSA 2CFXA 2G7HA 3BWGA 1HC8A 1KC8C 3DB3A 1FLIA 1YJWT 3DXJF 1KU2A 4MTEA 1RUNA 1TSFA 2H8HA 1VQLA 2B86A 3W2WA 4JZ3A 3M4YA 1FPQA 2K3PA 1WDXA 2DBMA 1ZGWA 2QEXA 3LSTA 1A6QA 1U1SA 3MEVA 4L5GA 4M7DG 4CC7A 3L7WA 3CCUA 1X1CA 3A8OB 2X4JA 2HR3A 4FYYB 5BNGA 4ZYAA 1EIFA 3RESA 2VBYA 2BZTA 2Y75A 2HCKA 3H9JA 2YWWA 2DMQA 2V6CA 4P5NA
chains in the Genus database with same CATH topology
4EMKB 1U2WA 1HXDA 5D4SA 4X9DA 3ZMUA 4RAYA 1MGTA 5GANe 4QQDA 1XDSA 3RDIA 5KCOA 4RG2A 5E1ZB 2K3YA 3O3KA 1FWZA 5FLXZ 3SWNA 4WF2A 5GAN2 3WODF 4OIPF 3WG9A 4BD3A 4ENKA 3M54A 3BZ6A 2FMYA 4M71A 3SQNA 3DF8A 1LB2A 1JXSA 3RERA 3ZN1A 2JZYA 2CYYA 4AIJA 4G7OF 1QPMA 4IXAA 4S05A 1WJSA 1REPC