2QQBA

Crystal structure of dtxr(m10a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
214
Chain Sequence
DLVDTTEAYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
total genus 66
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqbA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqbA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqbA03
2O0YA 1IRGA 1YW8A 4IHTA 5DCMB 2ISYA 3GEZA 5AONA 3T5XA 4WK8F 2BBYA 4LK1F 2LNBA 3CUQC 1F1ZA 1OMIA 5F1RA 3PQKA 4MQ9F 5TJJA 4BHBA 4MEYF 3MQ0A 3L2CA 4LB5A 2UXXA 5JVTA 5E20A 3HOSA 3E3VA 4XRFA 4I0AA 3N97A 3FHZA 4A12A 3Q9VA 2LF8A 3V8KA 2JRTA 3D0SA 5IT9Z 1UHWA 3SZTA 2FOKA 5BS6A 1R1UA 2DTRA 3B73A 3E97A 1AWCA 3WGGA 4JQFA 2ZMEB 1GXQA 4ZYEA 4KYWA 2P6TA 3ZN1A 1JE8A 4IHSA 2P6SA 4A0ZA 2H27A 4FHTA 2FSWA 2UZKA 2RKHA 1F4KA 1W4MA 2OQGA 3BY6A 4EGZA 3DPTA 4AWXB 1T39A 3FF5A 5L3DA 2BYVE 3ERED 3VFZA 3GVAA 5CVRA 1S29A 5FD5A 1XDUA 3KZYA 2O6GE 4Q47A 1KU9A 4ESBA 2H09A 1W7PB 2X4HA 5A2QZ 4KMUX 2FU4A 2A68F 4ENKA 3KCCA 4U7DA 2F5EA 1RNLA 4ZYGA 1J2XA 4LLNA 2ZKZA 2H6CA 1ZH5A 5AIPA 2FMYA 1Z6RA 3LA7A 2EFNA 3U1DA 4IJAA 2KRFA 2ZNZA 5FO5A 2ESNA 4EM2A 2MD5A 5BMZA 4G8XA 2EB7A 3WTTC 1ZRDA 1IXSB 5L3GA 5HLHA 1XD7A 4CDGA 3RYPA 5EEHA 1R22A 1HSTA 1LEBA 5J8FA 5ILSA 4CZZA 3HTUA 3GFLA 3TQNA 2M87A 3P9KA 5E1WA 3W6JB 2HR3A 3PFIA 4IVNA 3CO7C 3DPLC 4AIHA 2DI3A 1LJ9A 3KFWX 3F3XA 1XB4A 2ADUA 1HKQA 2KJCA 4S05A 3CUQA 2JTVA 3I59B 1ZLJA 2PG4A 5LBQA 5ICEA 1T0FA 1KYWA 2BEOA 5FD6A 2GA2A 4HX7A 1BI3A 3F8MA 2GXGA 3LFKA 1UB9A 1UFMA 4OIQF 3MWMA 4RGUA 2IP2A 1R36A 1C0WA 1ZREA 1LB2A 3WTVC 4S04A 5CVVA 5BOXA 4WWCA 4N9IA 2PN6A 1SMTA 1XMAA 5HLIA 3I53A 1YS6A 3WTXC 1BC8C 2O61A 3Q9SA 1JHFA 1FC3A 4I02A 2ZFWA 1WSUA 4EQQA 1EH6A 1TLHB 3I64A 2YX7A 2ZNYA 2F2EA 3RTRA 2EFWA 3J80Z 1TNTA 1ZRCA 5KK1A 1KU2A 2XAJA 3ISPA 3BPVA 1BIBA 3IHUA 1ON2A 4BXUA 3NQOA 3GZ6A 2NAZA 2K4YA 3WTUC 3O2PE 2RDPA 1DUXC 4OU0A 4A5NA 5DYMA 2G9WA 1RUNA 2DK5A 2P7VB 4HZFA 2PBIA 4WX9A 3WODF 1BBYA 2PJPA 1BJAA 2W84A 3WU0A 4GYGA 4AVPA 2P5VA 1WQ2A 1ZYRF 3BWGA 4EM1A 1KGSA 3I71A 5A2QK 4R79A 4QWQA 2A6HF 4UXNA 3HRMA 4Z2YA 2ZBKA 3BZ6A 5ICFA 5HS9A 5ERIA 2ISZA 2FE3A 2L3DA 2L54A 3VB2A 2K7LA 2BE5F 4HLYA 2QUFA 2VT3A 3C1DA 2VT2A 2MH2A 3QAHA 2O03A 1XN7A 3COAC 5JI6A 5FB2A 1HQCA 1R5HA 4G6DA 4WF2A 2Y48A 1XGMA 3PQJA 4KN7X 5E8GA 3KP3A 1K79A 4KFCA 1LDDA 2XVCA 3R61A 4R8HA 2K5IA 4I0BA 5ILVA 1QBJA 3BDDA 2LF7A 4B09A 4L0YB 2DAOA 1SD7A 3I54A 4UUVA 1USSA 4OINF 4M74A 1EH8A 3WGHA 2Q0OA 3CTAA 3SXYA 1I1SA 3RI4A 5BPDA 2DW4A 1J9IA 1S7AA 1H9TA 5DUIA 1B9MA 3AAFA 1ZAOA 3TOAA 4O6JA 3RPQA 3TDZC 2HEOA 4IXAA 4MTDA 1R00A 2RV8A 2DQLA 5D6FA 2CYYA 2G7UA 4NQWA 4LGWA 3HHHA 2NS0A 5F6FA 3F21A 3P9IA 2PFBA 2L4MA 2STTA 5D8KB 4OOIA 2ESHA 2QBYB 3LSTA 3QPTA 5AIQA 2JPBA 5JR3A 1P4AA 3BROA 1QW1A 5LRRA 3FMQA 3JSPA 5CVJA 2V6CA 3HTSB 2DT5A 4BYYA 3D5LA 4BNCA 1MDMB 3P9CA 2XGXA 2DU9A 4CO8A 4CXFA 4G7OF 1I1GA 3F23A 2YSRA 4L9NA 2MA3A 4L9VA 1UCRA 3MHXA 4YFNF 4XLPF 3SFZA 3U2RA 4ENMA 3LA2A 1FYMA 3BJ6A 3E6DA 2GXBA 2A61A 2V1XA 1L3LA 1WI9A 2Q8KA 1UHMA 4HF0A 2YX4A 2CFXA 3V7SA 4HBLA 3DF8A 1G3YA 1FSEA 3R0AA 4KUMA 1ZGJA 3R60A 3VEPA 1U78A 3RYRA 2VOPA 1BOAA 2QVOA 3TDUC 2HKXA 3HIFA 1GXPA 1QNTA 3F6VA 2F5FA 2ZMEA 1ODDA 2H94A 3KETA 2HS5A 3K69A 1Q1HA 4RB3C 1EV7A 3J81K 5E1XA 1MJAA 3NRVA 2QQAA 3M1EA 5E1ZB 4JBAA 1DPUA 2L02A 3H3UA 5HLGA 4JK1X 3T8TA 1D3YA 2JSCA 1TW3A 1XSVA 1PUEE 2A07F 2OQRA 4GO1A 3I4PA 4XBFA 2HYGD 5F64A 2VE8A 4A0XA 4OIOF 5L3CA 2BV6A 2QENA 4LG0B 1B9NA 5IT9K 4P55A 4EM0B 3MZYA 3MCZA 5D4SA 2PI0A 4Q4ZF 2OZ6A 3KP2A 4PZJA 2QWWA 4Y17A 4RS8A 2NNYA 2XAQA 4H0EA 3GX4X 4ZH4F 2KJBA 4LD5A 4PCQA 1W5TA 1YW7A 4L0ZB 4EJVA 5D4RA 2W24A 1MZBA 3E6CC 1SMYF 1G6NA 1Z7UA 1KU7A 2IJLA 2KIFA 2XIGA 5LEKA 4MEXF 3ZMSA 1K7AA 2EA4A 2WTEA 3JW4A 4ENJA 1FP1D 2AS5F 1WWXA 1T2KA 3GF2A 4U7BA 5ICGA 2K4BA 5LLQA 4U0WA 3E5XA 3IWFA 1O57A 2HGCA 1X3UA 2D1HA 1FT9A 2H3JA 3HYIA 5J8CA 3DV8A 5K5QA 2MH9A 1TW2A 2IA2A 1G3TA 1FLIA 3IWZA 1BC7C 1U2WA 1TBXA 2FBKA 4YIIA 2XASA 1TTYA 3FM5A 2YU3A 2EFQA 4LB6B 2HZTA 1QQIA 1XDSA 2VXZA 3ECHA 2XHKA 5CLSA 4I7HA 1PDNC 1RZ4A 5L3EA 3I5UA 4IRHA 2HWVA 5K5OA 1I27A 4D0PA 3HRSA 1KQ0A 1ZHFA 3B02A 3BP8A 2RGVA 1P4WA 4EMSA 2V79A 2R7DA 2EV6A 3HOTA 5D5WB 5JHUA 4XSZF 2W85A 2EWNA 3I0TA 2YPRA 3EYYA 1MDMA 3REOA 4L18B 5L3BA 2M30A 2R7FA 2Z5UA 3GW2A 2XAGA 3M7GA 3RJPA 5E8IA 4F7ZA 3LAJA 1T38A 2DFIA 4ETSA 5ED4A 3K9TA 2VODA 1YLFA 2DPUA 3LWFA 1LEAA 3FXQA 1O3RA 2XKPA 1SD5A 5DCMA 1KQ8A 1XCBA 1U8RA 5CVIA 1Z9CA 4KDPA 1QO0D 2EA2A 3WU1B 2IT0A 1E2XA 3RKWA 5LHIA 2VBZA 5CVUA 3FMRA 1OYWA 1F9NA 4UVCA 2EFPA 3QU3A 2K86A 3M9AA 3KLOA 4MQVA 4KIBA 3MZHA 1EH7A 3IL2A 1V4RA 4BHCA 5DCFA 1CGPA 2UXNA 4NB5A 4Q5SF 2PQ8A 2LSOA 2QLZA 4AD9A 2FBHA 1OR7A 4RB0A 1DDNA 3FX3A 4AIJA 1YFHA 5HDKA 4Y15A 2EK5A 3L9FA 2FMLA 2FQ3A 2EV0A 1FNNA 3KP4A 4FX0A 4Y13A 1WKMA 1T6SA 3GWZA 4U88A 5HVQC 2E7WA 2Q2EA 4ZZLA 4LLGF 1STZA 4G9YA 4EVIA 3EYIA 2E7XA 1SFEA 3L7WA 4EV0A 3K2ZA 3VOEA 3ZMTA 2GA1A 1ZN2A 1JXSA 1GHCA 1RIOH 4ON0A 3U9GA 2KIUA 1SAXA 3EUHA 4I2OA 4A2UA 1D8KA 1D5VA 1DPRA 4HX8A 1L0OC 4P5OA 3KP7A 3GFJA 2RN7A 2CSOA 3R4KA 4I09A 2W57A 5DEQA 3H92A 4EJWA 2XROA 1S6LA 1HW5A 5LGUA 3BJOA 6PAXA 3CO6C 2VC1A 2FF4A 2LX9A 1IN7A 3ZP5A 5ILUA 1XSDA 3N4MA 4LFUA 3ECOA 3C18A 1O3TA 2FXAA 4U0YA 2HDCA 1B4AA 3EETA 4M6XA 4ASNA 1PP8F 2A3SA 5FLXK 1IN4A 4O5VA 3HSFA 2IA0A 2M1BA 1LDKB 5BQTA 2M8EA 2QYOA 3FZVA 1J5YA 2IPQX 4G6QA 3GYHX 2E1NA 2MC3A 1MKMA 2HTJA 1XSXA 3R6SA 4A0YA 1SD4A 1QGPA 1H9GA 1W5SA 2JZYA 4M9ZA 5IT3A 4HV6A 1F5TA 5HS8A 1KYZA 3HSEA 3KEOA 4GYIA 4ZZDA 2FEZA 2PMUA 3TGNA 3JTHA 3ZMDA 4K2EA 3W6KB 2K5LA 1ONVA 4UVAA 3WE3A 4RGRA 1BYMA 5D5UB 4EJOA 4P96A 3BOQA 1SFXA 4G7HF 2PEXA 3ABTA 4KIGA 2GCXA 1IZ1A 2JT1A 2P5LC 1KA8A 3E6MA 3MAJA 3F8CA 3DP7A 2YR2A 4MNUA 4Q48A 3L09A 3T0YA 4BHPA 5LEJA 3QP6A 3OOPA 3SZPA 3ZMZA 1XGSA 2V9VA 2VN2A 5LHHA 3L00A 2HTSA 1YS7A 2D1VA 3RIRA 3FXUA 4M71A 2IVMA 3K1MA 1XGOA 1ZG3A 3TO6A 4YIFA 5L3FA 3ZPLA 1IAWA 2FRHA 1FBQA 3WTYC 2QBYA 4LJZF 4A5MA 1MJ9A 4ENNA 2VOOA 3JAMZ 5H6RA 4HW0A 3WG9A 3C7JA 5LRSA 4HV5A 2O3FA 4R1HA 1K78A 4XLNF 3HUGA 2OBPA 3IKVA 1P2FA 3K0LA 3KEQA 5HS7A 3WTWC 1OYYA 2Z3YA 2Y75A 3LA3A 1U3EM 3O3KA 3KZZA 1W7PD 4L9TA 3DXJF 1E17A 2KIMA 2D45A 3F8FA 3E19A 1WRJA 4BQAA 4MHGA 1ZARA 3RKYA 4XSXF 4L5JA 5HDNA 3ZQ7A 3QOPA 2RC4A 3J80K 2R3SA 3GLXA 1J0RA 4IF4A 3KP5A 1S3JA 2HKOA 1T98A 5J6XA 2IRFG 4BH9A 4RB2C 1HW2A 2F5CA 3ABUA 3E5UA 2K02A 4U0VA 3G73A 3V7RA 3TOBA 1XCVA 2J5OA 3V7CA 3V4GA 2E1CA 1QZZA 4GCVA 3KLNA 2V1UA 4L9JA 4QLCU 4HDVA 3GO5A 2ZXJA 1R5GA 1FY7A 3R0JA 3FM3A 3HSRA 1IXRC 1CF7B 5D5VB 5LGTA 3M8EA 1Z05A 2JPCA 4CYDA 3G3ZA 1OKRA 1HBXG 3TO7A 2CWEA 2DLLA 4WCGA 3JAMK 2FBIA 2NYXA 3E5QA 4NHJA 5E18F 3GZ5A 2XV4S 3T8RA 3F8BA 4KT5C 2VBXA 1Z91A 1ON1A 2P5KA 1YG2A 1FBUA 3LQQA 5HDGA 3QPHA 2DBBA 1G3WA 2Z9OA 2P7CB 2EFOA 4ZYDA 1IF1A 1P4XA 3E6BA 4WXCA 1ZG5A 1S7OA 2STWA 1U5TB 3DQVC 3VODA 5H6QA 2OZUA 1R1TA 1S8NA 4TV7A 2G7HA 4DQ2A 1FBSA 1SFUA 1ULYA 2CO5A 1ZLKA 3F22A 5E17F 5D6EA 4KA4A 2CQKA 1BI0A 1FP2A 3IKTA 1RUOA 3DEUA 4FT8A 1O3SA 3NEUA 3RPUA 1YW9A 2EJRA 2EV5A 2VBWA 4PDKA 5LHGA 2MLGA 4OMYA 3CDHA 4UVBA 3IRQA 2A69F 1FSHA 5HOOA 1R23A 3HRUA 2OU2A 3RKXA 2COMA 1RI7A 3FMSA 1HW1A 3OV8A 3K1PA 2ETHA 2LKPA 2XAHA 3J7AO 1OYIA 1IW7F 2VONA 2B0LA 4HOBA 3HRTA 3CJNA 2P8TA 1B59A 1Z1DA 5D8LB 5DD4A 4WXHA 4UV9A 2TDXA 1B6AA 3RDIA 2NRAC 2K5FA 4OMZA 2DK8A 1Y0UA 2L01A 5K1YA 4LMYA 2DO7A 1ZRFA 1R58A 2MLKA 2FA5A 1LVAA 2V1DA 3EDPA 4EGYA 3F8NA 4G94A 1REPC 2J5PA 1P6RA 2FNAA 5H20A 4HX4A 2L4AA 2F5DA 2WWYA 1XGNA 1HKSA 4HYEA 5EEGA 2DPDA 4BAYA 5JFRA 1CF7A 3CLOA 2OAZA 2ZJ2A 3K1NA 1KU3A 1IRFA 1V3FA 4KIFA 2XAFA 3C3WA 4G7ZF 5ICCA 4CHUA 2QQ9A 3KP6A 4M9SA 1U6GA 1XMKA 1H0MA 1YO5C 1BIAA 3BPXA 1O3QA 1SD6A 2QM3A 3WTSC 1IUYA 3I59A 2Z33A 4RAZA 4HF1A 1QVPA 1A04A 3BJAA 4GGGA 1MD0A 1MJBA 3LQRA 3FXRA 2VE9A 2M5WA 3ZMUA 2LDUA 1QPMA 4IRGA 1U5TA 2XKOA 1KQ9A 5CJ9A 3ULQB 4P9UA 1IXCA 4YG2F 1FPQA 1VTNC 2OD5A 4M72A 4FX4A 4M6YA 4B8XA 3IRRA 3O6BB 5DD8A 3ZN0A 1BM9A 1TQIA 2IA1A 4KICA 1R7JA 2DQRA 2RVCA 3J81Z 3ML6A 5FFXA 3Q5FA 1W7PA 2VBYA 1YQAA 5DUKA 2RQPA 3JTGA 1U5TC 2AXLA 1J7KA 1DP7P 1GVJA 3V8LA 2IW5A 3T1BA 3EQLF 3MFKA 2UWMA 1LDJA 3CUQB 1AOYA 4HQEA 4IPAA 4M9XA 5DDGA 3S2WA 2NNNA 2A5YB 1FWZA 2XUBA 2PLYA 4OIPF 3LAPA 3QP5A 2GWRA 4PGHA 1QZYA 3WGIA 1USTA 1OPCA 1HSJA 1NHAA 2Z99A 5KVRA 1PP7U 4HLXA 1TQPA 2W25A 2CW0F 1B1BA 5CYVA 4LG0A 1P92A 3ZMVA 1G3SA 3GXOA 3KE2A 2QZ8A 4M73A 2OA4A 1R1VA 4GXOA 2WV0A 4HDUA 3DKWA 1O7FA 4RAYA 2ZO4A 2X0LA 3HHGA 3GUDA 3ROUA 2HYFA 1IN6A 2A6EF 4HA8A 4OIRF 4O3MA 1BI2A 2D2WA 1JGSA 1MGTA 4KN4X 2HOEA 1LQ1A 2K4JA 3SQNA 4I01A 2PMHA 2FNPA 3H3ZA 2ACJA 1K6OA 2RNJA 3ELKA 4EJUA 2VC0A 4LLLA 1BN5A 2M45A 3DFGA 1HKTA 2HQNA 4ESFA 2CGPA 2GQQA 3JSOA 4MTEA 1YTYA 2K27A 2BGCA 5BPIA 3F72A 3TO9A 3WE2A 2MBFA 1D8JA 4IRIA 2HFHA 3QRFF 4N9HA 4AIKA 3WTZA 4RGXA 1ZG1A 1YIOA 2GZWA 4KNYA 3IC7A 2KKOA 4KMFA 5FFZA 1FX7A 3I58A 4A6EA 3MEXA 5TRDA 3QU6A 1J75A 5K5RA 4MGRA 1I5ZA 3FWEA 3CUOA 1K78B 3F6OA 1ZGAA 5D5XB 1BI1A 1JHHA 4ZYHA 3TKYA 3M8FA 1HXDA 2ZCWA 4P9FA 2HQRA 4HAMA 1FZPB 3GFIA 2P4WA 4HQMA 2WC2A 1FYKA 4PGGA 4RB1A 1TNSA 5FGMA 3P7NA 4CGZA 4CICA 2O8XA 2XRNA 4ESJA 1J59A 5LGNA 4YFKF 1Z6TA 1O7LA 3V8JA 4RGSA 1IN5A 4UNOA 1FOKA 1IN8A 2ELHA 4LK0F 3GFMA 2C6YA 3SHFA 1G4DA 4WXDA 2H6BA 2GIVA 4L5IA 1LNWA 4I98B 1FYLA 2Y0MA 4HF2A 5DV5A 2GAUA 4N0BA 4DNCA 4UV8A 1TQMA 1YYVA 2QQBA 2CG4A 4A6DA 4UHTA 4E70A 1I6XA 4EJTA 5FLXZ 4YFXF
chains in the Genus database with same CATH superfamily
1R4MB 4BJ6C 2ELJA 3VYSB 1QMCA 2VL8A 3G1JA 4FL6A 3QYBA 1BJZA 1KSWA 2O0YA 3M0TA 2RB6A 2EKOA 2Y4YA 1K4US 1IRGA 1M2VB 2CW7A 1YW8A 2A08A 4B3AA 2COWA 2LP5A 4IHTA 5DCMB 2ISYA 1X58A 1BU1A 2LY1A 3GEZA 1W70A 5AONA 3T5XA 3FDRA 1PRMC 2EYWA 4WK8F 2K7AA 1YRNB 3H0HA 3QWXX 3SEMA 1M3BA 1MMDA 2FO0A 4ESRA 2BBYA 4LK1F 2LNBA 1MIJA 1X2MA 3CUQC 1QKWA 1UG1A 3EGDB 2HOTA 2FD5A 2L9NA 3OYMA 3CCJT 1D09B 3AG4H 3WXMB 4DZJA 2F5VA 3OR2C 5GANf 5LJ5d 2R4GA 1FOXA 4XQFA 2DYBA 4UB8C 2DERA 2K40A 1S7EA 3VS0A 1F1ZA 1OMIA 2IBDA 4D7MA 1Y07A 2F48A 3TU4K 1YWPA 3NPFA 2OPTA 5FKLA 5F1RA 3PQKA 2V6EA 4MQ9F 5TJJA 3HXLA 1TH7A 3EFOA 1VQ7I 3CD6I 3TL4X 4BD3A 4BHBA 4MEYF 5IH2A 2O88A 1WHGA 3MQ0A 3LSPA 3L2CA 4LB5A 2UXXA 2R7SA 2EJFA 5CCAA 5KE2A 1M5Q1 3OWTA 7AT1B 4C3HJ 5JVTA 2VKEA 2P84A 5E20A 3HOSA 3E3VA 2OF7A 4XRFA 3JRAA 2LT1A 3VSKA 3V42A 4QT7A 1B8IA 4V2SA 1H3HA 4M7DE 2LTPA 4I0AA 2EINH 3Q0WA 3N97A 4AMCA 3FHZA 4A12A 2EIJH 3Q9VA 2LF8A 3V8KA 4BEHA 5D6YA 4A4FA 4XTUA 3MCAB 4BQOA 4QIWN 2JRTA 2C0OA 3D0SA 5IT9Z 2LKSA 3G1MA 1XG1A 1WJQA 3AHUA 4X1VA 2JJ7A 1UHWA 3SZTA 3CQZJ 2AT1B 2CYZB 1ENHA 4ZGEB 2P0PA 2FOKA 2M7AA 5BS6A 1R1UA 3G71I 2OJ2A 2DTRA 3B73A 3E97A 1AWCA 3WGGA 5GAMe 4JQFA 4E7JA 3AT1B 2ZMEB 2QA4Q 1GXQA 1WNLA 4ZYEA 4KYWA 2P6TA 3CMET 3ZN1A 1NM7A 1WLPB 2DRKA 4UB6C 1TWCJ 2BZXA 2CUEA 2DAQA 1MW7A 1JE8A 4IHSA 3QYEA 1W36C 2P6SA 4A0ZA 3CCUI 2H27A 1C0MA 4FHTA 2RA2A 2FSWA 4J6WA 3DPUA 3QZ9B 2UZKA 3L2VA 4IHXA 2BTTA 2RKHA 1F4KA 4Y28E 3I5RA 1W4MA 2L5QA 3CCSA 1RACB 2OQGA 2DA6A 2X9DA 3BY6A 4EGZA 1VQMA 3ABLH 2VUBA 4JLIA 3DPTA 4AWXB 1T39A 3FF5A 5L3DA 2GBQA 2BYVE 1MH4A 4B48A 3ERED 4M77F 4JRQA 3PFSA 1LE8B 3VFZA 2FHDA 2LJ3A 4UUSB 1E3OC 3GVAA 5CVRA 3O5ZA 1S29A 3M56A 4M7DA 5FD5A 2DIGA 1JXMA 1XDUA 2DT7B 2Q2EB 3KZYA 5DS9A 3ZQFA 4HNTA 2O6GE 4Q47A 2HQAA 1KHCA 1VA7A 2NUPA 1KU9A 3EG0A 5J4VA 3H6ZA 4JLGA 1CQTA 3VYGA 1QU3A 4ESBA 2H09A 2E5NA 3GMEA 2X1CA 2CT3A 1W7PB 4N4NB 4U87A 2X4HA 1LUJB 2E2HJ 4M7AE 4XMYA 3C12A 2KAFA 5A2QZ 3CCEQ 2O7OA 2DL8A 2WV1A 2LMDA 4DOVA 2HEQA 4KMUX 2FU4A 4A3DJ 3F70A 3G71T 2A68F 2A3LA 4ENKA 2O5RA 2QQRA 2RQRA 4DOZA 1SSFA 4M75F 4MMLA 3KCCA 3S3NA 4U7DA 9ATCB 2F5EA 2EPFA 2VUMJ 1KQSP 2DL4A 1RNLA 2VIXA 3IUOA 2LCCA 1WJSA 2WSCE 3FK6A 4ZYGA 3S2HJ 1J2XA 4LLNA 3PL8A 2ZKZA 2KR3A 1PWTA 3JV3A 2QEXQ 2H6CA 1ZH5A 5AIPA 5KAFC 1IG7A 2FMYA 4J5YA 1Z7LA 3P8HA 3CMAI 1Z6RA 4QSHA 1DJ7B 3QQAA 3LA7A 4RLQA 2PJRA 2LY2A 2OTLT 5AT1B 2EFNA 3U1DA 2RN8A 3LX7A 4HXJA 4N4OB 4IJAA 2KRFA 1JKQC 2ZNZA 3JRZA 2DODA 1VQ8I 5FO5A 4D1QA 1H8AC 3PVQA 1IGUA 2DXBA 1N8RR 2ESNA 4EM2A 2Z0WA 4D8KA 1QVGP 4PJOA 2KPMA 2YRDA 1K8AR 1AWWA 3LGFA 2LP0A 2MD5A 4IIMA 5BMZA 1WJRA 5GMKj 2KRHA 4PL6A 4G8XA 1FMWA 5KYWB 4XU1A 1M90U 1X2NA 2EB7A 3WTTC 2XHCA 1EIFA 2GQIA 1YJ9Q 1ZK8A 2G0EA 1LKXA 4J9GA 4M78G 1ZRDA 2X1EA 1IXSB 4PFPA 2G3RA 3EFSA 5L3GA 4DJAA 3CMEI 5HLHA 1XD7A 4B6MA 4CDGA 3RYPA 5GMKh 1PYVA 2M9UA 5EEHA 1XTAA 1R22A 1UJYA 2Y0SA 1VQ6I 1HSTA 2ZSIB 1JI8A 1LEBA 1EX4A 1TWAJ 5ILSA 5J8FA 1MNDA 2R7OA 1ZQ3P 2DVEA 5IXFA 3OIQA 2IS1A 4CZZA 4ZN3A 4J19A 3M0SA 3HTUA 1AKHB 4KRTA 3NWSA 4M75D 4XNFA 3GFLA 4PSWA 3TQNA 4NUBA 1JO8A 2E34A 5GTIC 1RLPC 3N05A 2M87A 2P0TA 2ED0A 3P9KA 2GFUA 2NYSA 5GPCA 5E1WA 4RTWA 3VS4A 5KYWA 3W6JB 3D7SB 3NHNA 2A0FB 1UJ8A 2HR3A 3PFIA 5I2MA 4IVNA 3CO7C 4J9BA 5GAN3 3DPLC 4AIHA 2DI3A 2O2OA 1Q86C 1RETA 3HPGA 4JOMA 1LJ9A 3KFWX 2GTJA 3F3XA 3JB9D 4ZJZA 2O8KA 2X4WA 4JRKA 1MBHA 4C8QF 1YIJT 4BJTA 1XB4A 2ADUA 1LVKA 1HKQA 2KJCA 4S05A 2NVQJ 2F5TX 3A2KA 3CUQA 2RQTA 2JTVA 4M3FA 1VQPI 3HGYA 1M1GA 3I59B 3CCQQ 2L9RA 4IL6C 1P7JA 2ZMEC 1ZLJA 2E12A 4JP0A 1H3ZA 3ZFJA 2PG4A 5LBQA 3CCMT 4BBSJ 1UFFA 4C5GA 2CRGA 5ICEA 1GBRA 1T0FA 3GIBA 1KYWA 2BEOA 1B3QA 4J7FA 1YJ9A 1YJNT 5FD6A 1KD1U 2GA2A 4HX7A 3OYKA 1BI3A 3F8MA 4AVZA 1TUDA 2EYZA 3EG9B 2GXGA 2VVKA 3LFKA 2ECCA 1U8BA 1UB9A 3IAM2 4A3LJ 1UFMA 4OIQF 2LJ1A 3MWMA 4DBFA 4RGUA 2DA3A 2IP2A 3MMYB 3QPLA 2BHZA 1R36A 3PFYA 1C0WA 1ZREA 1PD0A 1M1EB 2R5AA 3RCOA 4XTVA 1VQ5T 1LB2A 4C5HA 3WTVC 2HZDA 3JCMW 5L23A 4S04A 3MKZA 5CVVA 1VF9A 1SVLA 5BOXA 1B34B 3EFRA 3CXCP 1XX5A 4XKBA 1IUFA 2PN6A 4M3GA 4N9IA 4WWCA 1SMTA 1XMAA 2V26A 2RHYA 5HLIA 1EJ9A 3I53A 1YS6A 3WTXC 1ETVA 1BC8C 3ASKA 4X9DA 2O61A 2CUBA 3Q9SA 4ZTJA 1JHFA 2VKDA 4XK8E 1FC3A 1Q86U 1W0UA 4CCJA 2RNGA 4I02A 5GAN2 3ASNH 4X9CA 4FSSA 2ZFWA 3AG3H 2QEXT 5IOYA 1WSUA 1VYTA 2AHJB 4LDWA 4EQQA 1Q81R 2GM4A 2IG0A 3NFCA 3GOXA 1Q95G 4F52A 3CC2Q 1EH6A 1TLHB 1KC8U 3I64A 1OU8A 2AKKA 4NBQA 3H9NA 2YX7A 2M35A 1VFCA 3PSFA 2ZNYA 4UUTA 2R92J 2VJ5A 2F2EA 3RTRA 1HDDC 2EFWA 1UEBA 1RAHB 1X1DA 3IH4A 2CP5A 2K5CA 3J80Z 4JRPA 1TNTA 1ZRCA 2K9NA 2XPUA 2YUNA 4XIDA 5KK1A 4F3QA 1KU2A 4EMKB 2XAJA 2PJRB 1VQ7Q 3ISPA 3BPVA 3CP2A 1N77A 1BIBA 2Z16A 5TGTA 2CSQA 1UG0A 3IHUA 4BXXJ 1ON2A 4KGZB 3FK7A 4BXUA 1YN8A 3G1OA 1SVOA 3NQOA 2NAZA 5K7FA 3GZ6A 2K4YA 1Q81U 3K4CA 2LQKA 2MABA 5GAN5 3OB9A 3CLQA 3O2PE 2RDPA 3PNYA 3WTUC 3JRDA 1DUXC 4OB0B 1J3TA 4OU0A 2XF6A 4A5NA 5DYMA 2DA9A 2XAUA 4KH1B 2G9WA 5LJ3d 5A2QE 1K76A 4A4HA 1RUNA 2DK5A 1XMXA 2P7VB 3UA6A 1X3WB 4HZFA 2K3PA 2PBIA 4WX9A 1ZSGA 2NS8A 1OI1A 1GXIE 2X48A 1T0HA 2JMWA 2DM1A 4J83A 1M8VA 2ZGWA 5EC7A 3JCMQ 3WODF 2A37A 5GAOp 4XN0A 3G4SI 4BXFA 2LJ0A 3MN2A 4RKUE 1UGPB 1TXQA 1BBYA 2PJPA 2A36A 4RMNA 1X1BA 1WH5A 2R57A 3CC4Q 3TQ7P 2DBKA 1UUEA 2QA4T 1BJAA 4FSXA 2W84A 4J6XA 2HVQA 3CESA 3WU0A 3CCMA 3DTIA 2FL7A 4GYGA 4DEXA 3HPWA 3O8HA 4AVPA 2D6FA 2OTJT 2R7WA 4BI3A 2HVSA 2D8HA 4LXCA 3UPUA 2P5VA 4CCMA 1WQ2A 1ZYRF 3BWGA 4EM1A 1KG1A 3LFUA 1KGSA 3I71A 5A2QK 3GTOJ 4R79A 3A02A 1FTTA 3JRFA 1HSQA 4QWQA 3VUBA 2A6HF 4UXNA 3HRMA 1GV2A 5CIUA 2BIVA 4C92F 1K9MU 4Z2YA 2ZBKA 1DU6A 3WU2C 3BZ6A 5ICFA 1LE8A 2EILH 3PUBA 5HS9A 5ERIA 4D5CA 2ISZA 3OYHA 1IRZA 1I5OB 4MZMA 2O9LA 1RAIB 2FE3A 4LN2A 2M0CA 2VWFA 4ELYC 2WAEA 2E2IJ 2L3DA 1Z3YA 4LG3A 4A3JJ 1Y1VJ 2L54A 4FE4A 1YHQT 3SJMA 1B72A 1A35A 1GFCA 3LSGA 1AEYA 3CPFA 2W82A 3JREA 4N0AA 2JXBA 3VB2A 2L8DA 1N8RC 5KNLA 2K7LA 3REAB 2BE5F 1OV3A 4KBMB 4HLYA 2CFOA 2QUFA 3CC2T 3H0IA 2XIDA 4Z02A 2WY8Q 1QP3A 2VT3A 3C1DA 1FEXA 3CEYA 2VT2A 5KHDA 3OSVA 3SHWA 1K73C 2MH2A 3QAHA 2M0YA 2DKGA 2O03A 4TVRA 1JXOA 1XN7A 3COAC 1I3QJ 5JI6A 5FB2A 3CCLQ 3S2DJ 1HQCA 3RERA 1R5HA 1D3BA 3C0CA 4G6DA 1OCCH 4B44A 1Z0XA 4WF2A 1IJWC 4FTHA 3JB9H 2BY0A 3HHTB 3S32A 2LC4A 1FIPA 3K2AA 2BHYA 3A8HB 3JCMb 3CC7Q 1QRYA 2OCCH 2Y48A 1XGMA 3PQJA 3BZCA 4KN7X 5E79C 5C0MA 5E8GA 3KP3A 1K79A 3NAUA 2RHZA 4WCIA 2JNGA 3D1NI 3CP8A 4EEFG 5EG0A 1M4ZA 4KFCA 4RTXA 1LDDA 2XVCA 3R61A 5GMKi 4R8HA 2JUGA 4E7LA 2K5IA 1VQ6A 4V2GA 2V1QA 2XICA 1AKHA 1M90R 2FRYA 5DTDA 3BG3A 3H9QA 3QODA 3RSNA 1M27C 4I0BA 3L2QA 1Y96B 5ILVA 1QBJA 3SWNC 1MNEA 3HG9A 3BDDA 5J1YA 2LF7A 4B09A 4L0YB 1V76A 3RNJA 2KRMA 3C2HA 2BVLA 2DAOA 1SD7A 1X1CA 3FBNB 3I54A 1E0EA 4M78D 1VQ7A 4PJMA 1SC7A 2ZPGB 4MZPA 4UUVA 1USSA 4OINF 1IV6A 4M74A 2EJ9A 1EH8A 3HZJA 3RUXA 3WGHA 4M75A 2Q0OA 2M3AA 2BW3A 1WFXA 1NYFA 3CTAA 3SXYA 3ABMH 1I1SA 3RI4A 5BPDA 3BW1A 2W7NA 2AHQA 2NUPB 1JTXA 1FIAA 2DW4A 4KITB 1ERDA 3H9GA 1S7AA 3I56I 1H9TA 1J9IA 2XSJC 2QDLA 3RDVA 5LJ5f 5DUIA 3CMYA 3LMMA 1B9MA 4X0GA 3AAFA 2ZSHB 1W5CC 3LSJA 1HA8A 3OBWA 1JEGA 1ZAOA 3TOAA 2LVSA 3DCFA 4O6JA 3RPQA 3TDZC 3I55I 2HEOA 5CKBA 5FLXE 4M75C 4RCBA 5GAOq 4IXAA 4XR6A 3S1NJ 2AKLA 4EIKA 4MTDA 3M55A 3PUFA 1R00A 1YOVB 2ID6A 2LYCA 2RV8A 4UC4A 1R49A 1ZR4A 3EG9A 2DQLA 1R6RA 2WSFE 3BG9A 3DBLB 4EATA 2YUOA 3FLGA 5D6FA 2CYYA 1D3BB 4RTTA 2G7UA 1QHHD 4XRSG 3META 4NQWA 1EA3A 5CPRB 4LGWA 2X4YA 2W1OA 2D9TA 3HHHA 5GTHC 3S16J 1MSFC 2NS0A 5F6FA 3F21A 2JJ9A 3P9IA 4OMNA 1VQMQ 1BR2A 2CQQA 4IX7A 3OL3A 4JX5A 3JRBA 2PFBA 2L4MA 3BZKA 4PJOB 2STTA 5D8KB 4OOIA 1YJWI 3JR9A 2ESHA 4FISA 1S72A 2BKDN 2LG4A 3LSTA 2QBYB 2LQNA 1XC5A 1HC8A 1VQ6T 3QPTA 2DEUA 5AIQA 2D0NA 2JPBA 1YCSB 4WTOB 2QGUA 4QPQA 5JR3A 1P4AA 3BROA 2FG0A 4QQDA 4FQGA 3PE0A 1QW1A 2CMPA 3OMGA 5LRRA 4BL0B 2ZPEB 1VQOQ 3FMQA 3JSPA 5DLQE 2CUDA 1XTDA 5CVJA 4CCLA 4A93J 5D6XA 3CJTB 2EZIA 1WHUA 2V6CA 2QSHX 3HTSB 2DT5A 4A3CJ 1M3CA 2JM9A 4BYYA 5HNHA 3D5LA 4BNCA 2W10A 2X6XA 4JS4A 1MDMB 3P9CA 2XGXA 4C8QA 1BOBA 2DU9A 4CO8A 4CXFA 3Q0VA 3PSIA 1I1GA 2JVHA 3MD2A 4ABZA 4G7OF 3KEYA 4HVVA 4LE9A 3F23A 2YSRA 4L9NA 3A03A 2MA3A 4L9VA 2IAIA 3H35A 1Y57A 5JHFA 4BY1J 1UCRA 2CUFA 3BTJA 4JDSA 2JTMA 2DYSH 1NJIC 2DJQA 2EH3A 3FKJA 4GDFA 1UGSB 3MHXA 3QYHB 1IB8A 3ZEHA 4RTZA 3CMAT 4BGDA 1I07A 1ZELA 4PLIA 4YFNF 5FLXR 4XLPF 3SFZA 2JM8A 1TUCA 1G5VA 1PCXA 4M78F 3U2RA 2FRWA 4ENMA 1EFNA 4PJLA 3LA2A 2RHUA 1XPXA 1JUPA 1FYMA 1VQNI 3BJ6A 3E6DA 2GXBA 4MDWA 3KX2A 2MFZA 3S14J 3JCMf 2GFAA 2P81A 1VQ5Q 1Z3XA 2RPNA 3SB2A 4DBQA 1YJNI 3CCST 1HD3A 4BQQA 3JSCA 4CCNA 2A61A 4QVDA 2V1XA 1TWBA 3GLLA 1AVZC 4OMPA 2X98A 1L3LA 1WHLA 4AC0A 1E6GA 1OX9A 4RAGA 1WI9A 2Q8KA 4RG2A 1UHMA 2K85A 4HF0A 4ZDLA 2E1MC 2YX4A 3RPUD 2CFXA 1GDTA 2KMUA 4A3GJ 4FT2A 1RR7A 3V7SA 3HL2A 2KGTA 1Z67A 5GAOn 3H1CA 2DBMA 1KFZA 2LOOA 3JCMX 4HBLA 1GCQC 3DF8A 3CCQI 4GLKA 1G3YA 1FSEA 3R0AA 3N5BB 4KUMA 4PJJA 1ZGJA 2A5WA 3R60A 3VEPA 2COZA 5LJ3f 3VRZA 1B07A 1U78A 3RYRA 1H89C 1YITI 2D5VA 3QWYA 2DL7A 2VOPA 1BOAA 1GLNA 4R0KA 3CXCA 5GAMd 2DFFA 2QVOA 2JS0A 3TDUC 2HKXA 1Y56A 2TRTA 3HIFA 1GXPA 2UUZA 4RTUA 2R7TA 4C8QE 3I55A 1VQPA 2QK0A 1ZGWA 1X69A 4MDXA 3QOEA 2KRCA 1QNTA 3F6VA 2F5FA 5FRNA 1OEBA 2EYYA 5GJVB 5DLOA 2ZMEA 1ODDA 1Z21A 2H94A 5GAHJ 3KETA 1FXXA 3VYUB 2EKHA 3JCMe 5KYXB 2FPDA 2F69A 3I9QA 1MMAA 5GJWB 4OP0A 2HS5A 3TEDA 3K69A 5CKFA 2ED1A 1Q1HA 1ETKA 4RB3C 3SWNB 1EV7A 1Q81C 5FKMA 2E5ZA 3E9GA 3J81K 5E1XA 2FPFA 1U1SA 2KXCA 2ECZA 3URGA 1JT0A 1MJAA 2XK0A 2FUG2 4BY6B 1YI2Q 3RBBB 4FYYB 1VQ4Q 3NRVA 3UR3C 4LITA 2QQAA 3BR0A 3K70C 2Y9ZA 3M1EA 1AA7A 5E1ZB 3M4YA 4JBAA 4LIUA 1GCQA 3ZQCA 4PFZA 1VQ8A 1DPUA 2L02A 5E3MA 5C4XJ 3H3UA 3S1QJ 2XF5A 5HLGA 4JK1X 3ZR8X 1HK9A 2L89A 3OBYA 3T8TA 3K6GA 1D3YA 2JSCA 2L3QA 2P0KA 1TW3A 4HCZA 1XSVA 1PUEE 2A07F 2H3EB 3CCVQ 2HYJA 2OQRA 4GO1A 3OS0A 1BCOA 1V1CA 2JZ2A 2CH4W 1TWFJ 5GMKm 3I4PA 1VQLA 2O31A 2ZZDA 3BY7A 1RC9A 4XBFA 3OYIA 3VKIA 2EGEA 3W2VA 2QA4A 1W2BP 4F16A 2HYGD 5F64A 2VE8A 4A0XA 3A0HC 3CMMA 4OIOF 2O9SA 5L3CA 4FYVB 3BTLA 4LNPA 5GP9A 1KQSS 2BV6A 2QCOA 2CDTA 2QENA 4LG0B 3GTKJ 2KEAA 4RTYA 1QZEA 2K9GA 4PJOC 3BR6A 1JB0E 3C94A 4NOYA 1OISA 3CCJA 1B9NA 5IT9K 4P55A 2E70A 1VYUA 2VI6A 4EM0B 3RMSA 5LJ5g 3MZYA 3SEZA 4QVCA 2X85A 3MCZA 4D7NA 5J26A 1Q7YU 4NDLA 5D4SA 4AYBN 2MWOA 2PI0A 4Q4ZF 1YHQQ 3AFHA 4LD9K 1VQ9I 4XONA 3VPRA 4M7AC 1WXBA 5M5WJ 5HK0A 2OZ6A 3KP2A 3M54A 1QVGA 3RKQA 4KISA 4PZJA 3P8DA 2QWWA 2HQHA 1X1AA 4Y17A 1G59A 5EGOB 4OF1A 4RS8A 4OMMA 2PMZN 2NNYA 2CV2A 1LCKA 2N8GA 2XAQA 4PNOA 3CJQB 4H0EA 4HCBA 2YLCA 2R7RA 1WZ2A 5C3EJ 1BA5A 3CCSQ 4RTVA 3GX4X 4XU3A 2WAQA 2IS2A 4ZH4F 1QPIA 3GF5A 1NK3P 2XDDA 2KJBA 4LD5A 1ZBJA 4PCQA 1W5TA 1YW7A 3FDYA 4EJVA 4L0ZB 1HCRA 2KI7A 1RADB 3ZOBA 3EGXA 5D4RA 2W24A 1MZBA 1SVMA 3OYDA 2KL4A 3E6CC 2KQRA 1SMYF 3RQIA 2E3HA 1G6NA 1Z7UA 3CCJI 4ZDPA 1NEBA 4LDXA 1KU7A 4X34A 2Y2ZA 2IJLA 2KIFA 2XIGA 5LEKA 4MEXF 5GANg 3ZMSA 3M58A 2B63J 1BB9A 2KNBB 2LR8A 1K7AA 1U9NA 1OPLA 5KE3A 2EA4A 3LSHA 1YIJI 2DMPA 4IIOA 2WTEA 2X6OA 3JW4A 5JLWA 4ENJA 2QTXA 2LQ8A 4A54A 3QDRB 1FP1D 2AS5F 2E6NA 1WWXA 2HL5C 4HVWA 2CW8A 4E6RA 4F55A 2CZ6B 1T2KA 5KYUA 3BCBA 3GF2A 1LJOA 1M2VA 4N4IA 3G4SA 1Y0MA 4U7BA 3VDXA 5ICGA 2K4BA 5LLQA 2HOAA 1Y96A 2K79A 2L3SA 5HY6A 4U0WA 5E3NA 1T33A 3E5XA 3ZQIA 3W2WA 3FBIB 3IWFA 2F2XA 2NVUB 3EH1A 4AYBA 1VQ8T 1O57A 1X1PA 2HGCA 1X3UA 2KLOA 4XORA 1X75C 2D1HA 2DT6A 1KZHA 1SSHA 4KUIA 1FT9A 3H9JA 2H3JA 1M90C 5ECAA 4DW6A 2VQGA 3HYIA 5J8CA 1SF9A 3DV8A 5CO7A 2L0KA 5K5QA 1D1AA 1H641 2MH9A 3CC7I 1TW2A 3WVDB 1PKTA 3L2ZA 3UT1A 2EYXA 2MGQA 2IA2A 2W00A 2EGCA 5J3BA 1VQLT 1G3TA 2DXIA 1FLIA 3IWZA 1VQKT 3CC4T 3CMEA 2BY3A 1AHJB 2EJGA 1RQ6A 3SD4A 2KYBA 3OYJA 1BC7C 1U2WA 2DE0X 1TBXA 2DO3A 2QI2A 1I0CA 2FBKA 1TOVA 1PVEA 4YIIA 2E2JJ 1BKBA 3IH3A 4R56A 2XASA 4OMFB 1TTYA 4J00A 3FXMA 4J9IA 1MMNA 2HXOA 3DU5A 3FM5A 3KFVA 1TT0A 2YU3A 1OOTA 2RK2A 3BDUA 4HCCA 1ETWA 1HJDA 5IT9E 3BQYA 1QCFA 2EFQA 4C2UA 2R5YB 2K9MA 4DBRA 2WAFA 2JA8J 4JJBA 4LB6B 2HZTA 3CCRI 5CKDA 3I5SA 4BY6C 4OAZA 2QTVA 1XOVA 1QQIA 3S1RJ 1XDSA 3OW2P 2VXZA 3ECHA 2XHKA 5CLSA 3X25B 4I7HA 4UY8I 1SEMA 1PDNC 1RZ4A 4AFZC 2VPRA 1NE8A 2WACA 5L3EA 3I5UA 2XDBA 4IRHA 2HWVA 2JQ7A 4N4HA 5K5OA 5J39A 1I27A 2LFBA 4D0PA 1J09A 2VGMA 3HRSA 2M1HA 2PUOB 3A8GB 4M75B 1W2BS 1KQ0A 4AU7A 1ZHFA 1OU9A 3B02A 2WA0A 1JU5C 3BP8A 1B34A 3I55Q 3HP9A 2RGVA 1P4WA 2MC4A 5GAOr 4EMSA 5M9OA 4A53A 2XB5A 4CYCB 2V79A 2R7DA 2EV6A 3O8GA 3HOTA 5D5WB 2DYIA 5JHUA 2KROA 4XSZF 2L3PA 5FRMA 3PIOF 3I56A 3CCLT 1PUFA 1VQPT 2M8GX 1WPYA 4M3DA 2W85A 2EWNA 1UG2A 3ABKH 1YRNA 4M77G 2OCEA 4F04B 3I0TA 2YPRA 5F27A 3OW2A 4HSTA 3JCMh 1WJFA 1YITA 1DU0A 3EYYA 2CP3A 3M07A 1MDMA 1SANA 2F4OB 1YX5A 2Y30A 1WI7A 2OI3A 4RAFA 2JA6J 3REOA 1PG5B 2RNAA 3AKZA 4L18B 3K4MA 1VQMI 5L3BA 1KHIA 4D9JA 3S17J 1T3LA 2M30A 3U23A 2R7FA 1JKOC 1N9RA 2Z5UA 4CC2A 2K9LA 1WXUA 3GW2A 2XAGA 3M7GA 3RJPA 5E8IA 2MZ4A 1N8RU 1WPKA 1H8KA 5GPAA 1RKWA 4F7ZA 1VYVA 2XD0A 1UJ0A 4S0HB 3JCMJ 3CC4A 3LAJA 1T38A 3BG5A 1K0SA 2DFIA 3D5SC 1CSKA 1K6YA 4ETSA 5ED4A 4A3MJ 2J6KA 2XU8A 3K9TA 2QG9B 4AFUC 3TCJA 2VODA 2QXFA 2H8WA 5KYYB 1YLFA 2OC6A 2E10A 2QDYB 2DPUA 1WJBA 3LWFA 4DZPA 3L1PA 1OZ2A 2ATCB 1LEAA 3BLYA 3FXQA 1LFBA 1W4SA 2HBWA 2K2MA 4Z89A 3CCVA 2XF7A 4OB3B 1O3RA 4LD6A 3ONQA 1HLVA 1YBYA 5EDNA 1X4OA 2XKPA 3TW7A 3J7ZI 3KZIC 1U5SA 1ZHIA 4KT0E 2ZCFB 1E7OA 5I22A 1SD5A 5DCMA 1KQ8A 2RJFA 2HDAA 4CA0A 1S72Q 2RQVA 1RESA 2YT6A 3ZBDA 5GANh 4A3KJ 1XCBA 1JBMA 1U8RA 2ESWA 5GMKl 3FISA 2LCSA 2OX7A 2QKLB 5CVIA 1Z9CA 4KDPA 1QO0D 2EA2A 4MFDA 1XNIA 2RD1A 4YTLA 3WU1B 2IT0A 1BK2A 1E2XA 4G6TB 4LIVA 2VB6A 2KRSA 4HKEA 2LTOA 3RKWA 2RI2A 5LHIA 2VBZA 1M1FA 4F7UG 1G8XA 4C5IA 5EJCA 3OL4A 1NJIU 3Q3SA 1IDZA 2E5QA 4F92B 4Y91A 5CVUA 1YJWA 4V2FA 1NEGA 1VQ8Q 3FMRA 4JPBW 1OYWA 4YEJA 1F9NA 1JQQA 4UVCA 2EFPA 3QU3A 3KYDB 2DK3A 2FEIA 4ZC3A 3DBRB 3EFOB 5L8RE 2HDDA 3C95A 4XKVA 2K86A 3M9AA 2J6OA 3Q0UA 1K4SA 3BCAA 2M02A 2MAMA 3EG3A 3HL8A 3KLOA 1Q1VA 4MQVA 1WVRA 1V5FA 4KIBA 2E1MB 3MZHA 2ROTA 3CPWP 3FC3A 1OLTA 1EH7A 2FYKA 5GAN8 1K9MR 3IL2A 3NARA 1PHTA 1V4RA 5FWBA 1K73R 4CC3A 4BHCA 1YJ9T 2R7UA 3CMEQ 2LRQA 1IO6A 5IT9R 3VYHB 2BUDA 5DCFA 2H1KA 1NG6A 2QF7A 2UXNA 1CGPA 2B7EA 3BT9A 3PMIA 4AUXA 3VS2A 1VQ6Q 1VQ7T 3CD6T 1QKXA 4NB5A 2MD0A 4XAXB 3C2GA 5B5EC 1RLQC 2KDOA 3VSLA 4BJ5C 2E71A 4Q5SF 1YITQ 2PQ8A 2LSOA 2QLZA 4RDUA 1AT1B 5IYBJ 4BUPA 3P5JA 5M5XJ 1PD1A 5FW9A 1RL2A 3CCUQ 2YHTA 4AD9A 2FBHA 1JT6A 1R9TJ 1ZUUA 4C0ZA 2PMZA 1OR7A 2P0QA 1NH3A 5FKOA 2EIKH 2KYMA 4RB0A 4OB1B 4A4EA 3CCVT 1SEUA 1DDNA 1TC3C 2NOGA 3FX3A 1AZEA 3DLAA 3H3VK 4AIJA 1WQWA 2WADA 5GAN4 2JVGA 2H8RA 1UELB 3GTPJ 2CUJA 1B8IB 1YFHA 5HDKA 3L2WA 3HFNA 2M4KA 1JGGA 1QVFA 3BG7A 2RHIA 3BR5A 4Y15A 4A63B 2EK5A 2X51A 2X1DA 3L9FA 2ECBA 4YELA 2B8AA 2CT4A 2X3XD 2YUQA 1YX3A 1QWEA 1OCOH 2Y69H 2FMLA 2FQ3A 2JSPA 3FXKA 2Y31A 3RZOJ 2EV0A 1RI9A 5GMKe 5GAMj 3CCQT 4XICA 4ATOA 3LSRA 1FNNA 1Y0NA 3FXJA 4XOTA 4RM3A 3KP4A 2KVQG 1VQ5A 3NTIA 4HSRA 1W2BA 2DMOA 4FX0A 4Y13A 3WVEB 1WKMA 4M7AB 5KYUB 1T6SA 4BKXA 3GWZA 4U88A 1TS9A 1WFWA 5I2SA 1D1BA 5HVQC 2E7WA 2Q2EA 4ZZLA 1SKUB 2OTLI 3A8OB 2JA7J 2J7IA 4W97A 1TWGJ 4LLGF 3JCMg 4BBRJ 4C0GA 1STZA 3MKLA 2ZXWH 3EAEA 1QHGA 4G9YA 5EG0B 2L9SA 1AU7A 4KGXB 1RUWA 4CCKA 4EVIA 3EYIA 2E7XA 4M6VA 1Y6IA 2HKQB 1SFEA 3L7WA 4EV0A 4KULA 3CCRT 3K2ZA 1WI3A 3VOEA 2NS7A 2XRLA 3ZMTA 4HVUA 3VJPA 3H0GJ 4IEJA 3I3LA 2DFUA 2GA1A 3NTKA 3VS6A 1KJWA 1ZN2A 4PJOF 3X20B 4M7AD 4M77B 3CCET 1JXSA 3HJEA 8ATCB 1GHCA 1WHMA 1UMQA 1GVDA 4NC8A 1RIOH 4IUUA 1MSEC 4ON0A 3U9GA 4F7UE 1A0NB 4E7IA 3I35A 3G6EQ 1N6AA 3ESWB 3A01B 4HNVA 2PVGB 4C92E 1S72T 2RM4A 5DY9A 1WJ5A 2H8HA 2BOLA 2KIUA 1YNZA 3MKDA 4M7AF 1NJIR 1SAXA 2FVUA 1OULA 1KIKA 3LNQA 2FX0A 3EUHA 4I2OA 4A2UA 3CC2I 1D8KA 4IOAF 1ZA1B 4F17A 2JA2A 1ORKA 9ANTA 2UV1A 5D7UA 3CD6A 2KFDA 1D5VA 4IUVA 3HOWJ 1DPRA 2DTOA 4HX8A 1D5YA 1L0OC 4P5OA 3KP7A 2IIMA 1NBEB 3GFJA 2RN7A 3GCMA 2BVMA 2CSOA 3R4KA 2W57A 3NWTA 4I09A 4L5EA 2F2VA 1YJ9I 5GAN6 4J7IA 5DEQA 1VUBA 1ZSZC 3H92A 5LD2C 1YI2T 1A6QA 2L9VA 1LFPA 2FZKB 4EJWA 2KXDA 4CI0C 2LH9A 2YXYA 1ZQ1A 2XROA 3SWNA 1S6LA 1HW5A 3QYFA 3DKMA 1IC8A 2KT0A 5C4JJ 3RMQA 1JRIA 5LGUA 3BJOA 2L3RA 2RAEA 3NMZC 6PAXA 3VRYA 1R4NB 3CO6C 2VC1A 1N27A 2FF4A 1K9MC 4BDYA 3X24B 2KDZA 1T0FC 2DD5A 2LX9A 1VQLQ 2VJJA 2VQLA 4M75G 2CREA 2E3IA 1IN7A 3ZP5A 5ILUA 2MG4A 1XSDA 1RRJA 1G2HA 2PUKB 1VQKQ 3LSIA 2V8KA 3ZQLA 2E1HA 3OSSC 3QHSA 2M7BA 2JK3A 1K9AA 5IXBA 4IHYA 2GGRA 3N4MA 4LFUA 4Z6YA 4D6WA 1YIJQ 3FIWA 3G71A 4KT6A 3DLMA 3ECOA 3C18A 1I50J 3S93A 1OFCX 4CUGA 1NG2A 1O3TA 5B1AH 1I39A 3VWBA 4HNUA 3GTGJ 2FXAA 2CS3A 4U0YA 2XKOC 4XLCA 1UB4A 4Z88A 1R77A 2HDCA 1SG5A 3X26B 2EW3A 2X6WA 2K3FA 5E3OA 4BI8B 1B4AA 3EETA 1VQPQ 4M6XA 1I8FA 5KYNA 3HM5A 5GAOl 4MIMA 4HPQA 4ASNA 5KYYA 1PP8F 2EIFA 3BR3A 2HU9A 3M5AA 1X01A 2A3SA 2R7XA 5FLXK 4FT4A 3JAME 1IN4A 2QGGA 3K4LA 1W1WE 2M0MA 4O5VA 2GF7A 3PNTA 1IHWA 1NPPA 1FOYA 1K61A 1MHNA 2IPOB 3HSFA 3NGPA 4JJDA 5JVGF 5GAMf 2IA0A 2IGKA 2NWMA 2M1BA 2KT8A 1LDKB 5BQTA 1W0TA 4IHVA 4J9EA 2AQFA 2M8EA 3OYAA 3I55T 4C92G 3S8PA 1ZUYA 4ME7A 2QYOA 4LOCA 5IYCJ 2HQEA 2D8JA 3FZVA 3K4NA 5HKCA 1QVGS 3H41A 1P7IA 4IUQA 4EMKC 4GLMA 1J5YA 2IPQX 2YUSA 4G6QA 1JUMA 3GYHX 4V19K 1UGVA 4L6V5 1C1AA 4MMKA 2DOEA 1VQOT 2E1NA 2MC3A 1UHFA 3CCMQ 4RBOA 1MKMA 2HTJA 4NC7A 5J3LA 3GP8A 1K1ZA 1ABQA 1XSXA 2BZYA 2OAUA 3ZXSA 2CSIA 5FU6B 2AZVA 3R6SA 2GOMA 1O9SA 2DEQA 1KC8C 2R93J 2GQVA 2LRDA 4A0YA 2Y0SN 4AM3A 2E64A 5CQEA 3M59A 1SD4A 2BXYA 4J6YA 1QGPA 1H9GA 2QAZA 3IQLA 3MJXA 4EPCA 1W5SA 3OQ5A 2JZYA 4M9ZA 5B1BH 3JRGA 2O01E 1VIFA 2VQCA 4AT1B 3M3YJ 3WG7H 3OR1C 1TU0B 5IT3A 4EMHA 1W1FA 2D0QB 2KRNA 3L2RA 4W1UA 4OGCA 3HOZJ 3MEVA 4HV6A 4QTRA 2HDWA 3TSZA 5GAOm 1JJ2S 1F5TA 2ZPBB 5HS8A 4YIRX 1S1NA 1KYZA 2VKNA 3HSEA 1K4TA 3JAMR 4J9CA 5GAMg 3QIIA 1M1KR 2JN0A 3KEOA 2DFHA 2V4JC 4GYIA 2ME0A 4BQNA 1W36D 3BE3A 3BTIA 4ZZDA 2CUZA 2FEZA 2PMUA 3OYGA 1YP5A 5HK3A 1MV0B 2R7ZJ 3UA7A 2DA7A 2X35A 2QKMB 5HODA 3TGNA 3JTHA 3ZMDA 2H1LA 4H4KC 5E3LA 2OJED 3E0JB 1U06A 3EHRA 1Q82U 1VQNA 4K2EA 1CKBA 2FPEA 3CPWS 3W6KB 2RREA 2K5LA 4DEYA 2OAWA 1ONVA 4UVAA 3WE3A 2DTIA 4ZGDB 2A7YA 3H36A 2DX1A 4RGRA 2RI3A 4LUEA 1AD5A 2K3YA 2LCLA 3L1AA 1E3PA 4RG8A 1BYMA 1Y71A 2DOFA 1P9QC 2VKVA 5D5UB 2CP7A 2DILA 2DDBA 2KSSA 4CRIA 2CQ7A 1ITYA 2CP6A 4XQ3A 2DMUA 4EJOA 1YJNA 3GBGA 4P96A 3BOQA 4PSXA 2VYTA 1SFXA 3JCMV 3QJYA 5CR2A 3SDBA 4ZN1A 4G7HF 2VPLA 3A52A 2M4GA 2R7VA 2PEXA 3ABTA 4KIGA 5M5YJ 2C0TA 1IZ1A 2GCXA 2YLBA 5C6SA 2JT1A 2P5LC 5I21A 3J7AW 3CC4I 1KA8A 1I1JA 3E6MA 3PM1A 3MAJA 3F8CA 1OPKA 1TZLA 2ZXHA 1UE9A 3DP7A 2YRCA 2YR2A 4MNUA 4Q48A 1WGSA 3L09A 3IV5A 3EGDA 4BY7J 3T0YA 4BHPA 3UKGA 1S72I 5LEJA 1VZ0A 2EBPA 3CXCS 3WHBA 3PGGA 3QP6A 3OOPA 3SZPA 2GOXB 4II1A 3ZMZA 2V8IA 1XGSA 3QXEB 5J4YA 3S1MJ 1WGXA 2DXUA 2V9VA 2Z2SB 3FB9A 3CCUT 4FE7A 1UTIA 2VN2A 2L7KA 5LHHA 2LMJA 3FXLA 3L00A 3ERMA 1V5EA 2HTSA 2JMCA 3VS3A 1YJWQ 1YS7A 2JN6A 1N25A 1WXTA 2K9SA 4VUBA 2D1VA 3RIRA 4XK4A 3SEQA 3FXUA 2DA1A 4M71A 2IVMA 1VQ4A 4E6KG 3IAS2 1XGOA 1ZG3A 3HC7A 3K1MA 1PM3A 3TO6A 2NVXJ 4YIFA 1GT0C 5L3FA 2MVTA 2KE9A 3ZPLA 1IAWA 2RK1A 4M77A 2HD0A 1IGNA 2FRHA 2W4SA 5FU7B 5KYXA 1ETOA 3KYCB 5F0CA 1BW5A 1FBQA 2M0OA 1X6OA 3CBPA 3DB3A 3WTYC 5H2FC 2JUFA 2R58A 2QBYA 3QBYA 4XTWA 2DL5A 3VU3C 4LJZF 3OYEA 1T56A 4A5MA 4IURA 1MJ9A 2NVTJ 4ENNA 1TSFA 2VOOA 2G6FX 4QVZA 3RQ4A 3HEFA 1YE9A 1PUFB 3JAMZ 3W2AA 1NLPC 4PJ0C 2HNIA 2HOSA 3KBGA 4J9FA 2VLAA 5H6RA 4HW0A 3WG9A 3C7JA 3EUAA 1RR8C 4JX4A 5LRSA 2DA5A 2CZ0B 4HV5A 2O3FA 4R1HA 1K78A 4ZNXA 3CC7T 4XLNF 3HUGA 2EAYA 1MGQA 5CQXA 4HT9A 3EUKL 1NK2P 1MNMC 2OBPA 2VASA 2PVDB 3EH2A 3IKVA 4XTXA 1P2FA 3K0LA 3CJRB 1AWOA 3KEQA 3B6AA 5HS7A 1BBZA 1UGRB 3WTWC 4OWRB 2EQKA 1OYYA 2XC7A 4BE2A 1WDXA 4A3EJ 2CP2A 4RCCA 2Z3YA 2GBYA 4B9WA 4B4CA 1A5JA 2FZCB 2PVOB 2RMOA 3DEWA 2B86A 1NTCA 3CBOA 1APLC 2Y75A 3LA3A 1U3EM 3O3KA 3KZZA 1W7PD 4C9YA 1IREB 2GNCA 4QW2A 4L9TA 5LJ5h 2DZ9A 1ARKA 1VIEA 4J01A 4M77C 3DXJF 2I8DA 1E17A 3OS5A 2KIMA 2D45A 2SRCA 2YDLA 3KUFA 4AG1C 4M7DC 3F8FA 1RKTA 2JT4A 3E19A 1FTZA 1WRJA 5CK9A 4BQAA 1IRXA 2EZKA 3A1YA 4MHGA 4M77E 1H92A 4M4ZA 4M7DG 1ZARA 4E2FB 3RKYA 3CDLA 1XS9A 2EQMA 4XSXF 2YSQA 1I5LA 1U1TA 2HMAA 3LGLA 2EQJA 2K6DA 1RAFB 2VJIA 1Y1WJ 3I4MJ 4N0AC 3M4OJ 4LUDA 5EEAA 2YS9A 4L5JA 5HDNA 5C44J 3ZQ7A 4M78E 2L0AA 3QOPA 2RC4A 4B47A 1X4PA 2VGNA 1CKAA 2R3SA 3J80K 3GLXA 5K7HA 2XB0X 1J0RA 4IF4A 3SYTA 1VQOI 3MP6A 3KP5A 3H0FA 1Y7XA 1S3JA 2OTLQ 2DD4A 2DMTA 1T98A 2HKOA 4B1RA 5J6XA 2RJEA 2NUTA 2IRFG 2DN0A 2BXZA 2VJ4A 4BH9A 4PKCC 2E19A 1ETXA 5FLVA 2F5CA 3ABUA 3E5UA 4RB2C 4IOCF 5HNFA 1HW2A 2K02A 4U0VA 3G73A 2EQIA 4F7UF 3LWIA 3V7RA 5GAGJ 2V8JA 4J9DA 3TOBA 3CCUA 1XCVA 1WJCA 2J5OA 2JMAA 1MBEA 3LH0A 3V7CA 3DLLF 3V4GA 3ZQHA 2E1CA 4Y3OA 1BW6A 2DXTA 2P0WA 2VQHA 3CQTA 1TTHB 2LBFB 2DXCA 3JB9G 3E1SA 3G1LA 1QZZA 2DF6A 4JX6A 2ID3A 3EUHC 4GCVA 2O4XB 3BDLA 3E9FA 2MCNA 3VV0A 3KLNA 2L2PA 3JCMc 3G6EI 4JYKA 2V1UA 4L9JA 4UUSA 1O4XA 4QLCU 4HDVA 3I4NJ 4HCKA 2COBA 2L2OA 3GO5A 3O8VA 2ZXJA 3ZGKA 2LREA 2KT1A 2MI6A 1R5GA 5IP7J 1FY7A 1WIEA 4Y33A 2HAXA 1KONA 1ZTRA 3R0JA 4OGEA 4M77D 1N75A 1ZUKA 4XN3A 3FM3A 3HSRA 3TBIA 3MEAA 1GCPA 3EHQA 2CU7A 4FYWB 1IXRC 1CF7B 2HCKA 1ZKGA 3AG2H 4PJOG 5IHIA 2W48A 1VOMA 3EGXB 3JCMP 5D5VB 5LGTA 3M8EA 1Q7YC 1Z05A 2C06A 2JPCA 2IGMA 2NOJB 4CYDA 1PKSA 1ZSZB 4M78A 3G3ZA 3GZNB 4NL2A 4F7UB 1QVFS 2DDAA 2DYRH 3CC2A 1OKRA 4PJOD 1X19A 3CBMA 1HBXG 2TCTA 2QEXI 1LNXA 3TO7A 2ICWG 1IHVA 1SHFA 4FM4B 2KY9A 2IS4A 4BI4A 2CWEA 3JCUC 3LW5E 4M78C 3OYNA 3BFMA 4R55A 3CMAQ 2DLLA 2RJCA 4E7KA 3LOCA 1IZ6A 3M0QA 2DJIA 2QSGX 4IUTA 4WCGA 3JRIA 2BZ8A 2GXAA 3EGUA 3JAMK 2FBIA 2NYXA 1VQLI 3E5QA 4NHJA 4AFQC 1TT5B 5E18F 2QASA 4L5GA 3GZ5A 1YHQI 5EG2A 3OYFA 5B3SH 1VQ9Q 1LPLA 3FRNA 4JJCA 2XV4S 4M3BA 2R5YA 1VQ5I 2VXEA 3T8RA 1MBGA 2E60A 2OUMA 3BR2A 3F8BA 1YJNQ 2KK4A 2DPPB 2K2VA 4KT5C 2HPMA 2VBXA 1Z91A 4QQGA 1ON1A 2RHXA 1DQUA 2MPXC 1OCPA 4NS5A 3JB9J 3CZ6A 4KJZA 4ANJA 2LBFA 2R7QA 2P5KA 1YG2A 5DM6F 2V1NA 1OX8A 1ZBXA 4N4GA 2FJ1A 1FBUA 3LQQA 2XGCA 1ABOA 3K7AJ 5HDGA 1VQ4I 2P4TA 1U3OA 2RQUA 3MP8A 3QPHA 3SDZA 2DBBA 1G3WA 1M8MA 2Z9OA 2XDPA 4XTYA 2P7CB 2EFOA 2X4XA 3VYRB 1PSFA 1EF4A 4ZYDA 1IF1A 1P4XA 1SPKA 3E6BA 4K11A 5LJ3e 4WXCA 1ZG5A 1Y39A 5IY5H 1S7OA 3CCJQ 3M8JA 2STWA 1U5TB 3B6CA 3PIOA 3OYCA 3DQVC 4LDVA 5FJ8J 1FMKA 2CV1A 2DZCA 1M3AA 2F2WA 2M34A 2V7FA 1LFUP 1ZLMA 4RUGA 1QVTA 2E1OA 3CCVI 2OTJI 1AHDP 3DWLE 3VODA 5H6QA 2L7ZA 1R1TA 1S8NA 2OZUA 4TV7A 5BNGA 2ZAEA 2G7HA 1F43A 4C8QD 4DQ2A 3OW2S 1FBSA 1UZCA 1VI0A 1K73U 1SFUA 1AOJA 4X1EA 1ULYA 5IOZA 1IGQA 3LSKA 5FU6C 2E4HA 2EYQA 3Q1JA 1TG0A 2X9HA 3PT9A 4KGVB 3PO2J 5CKHA 2CO5A 1ZLKA 5FKNA 3QZ5B 3J81E 4XL9A 3F22A 5E17F 2DJNA 5D6EA 2DTHA 3CCQA 3K4BA 4KA4A 2PQWA 4OAYA 3MO8A 2CQKA 3UWNA 1BI0A 4IQ4A 2HPIA 3A8LB 1FP2A 2PNIA 2NVYJ 3IKTA 1DGRM 4BACA 4IQJA 2XDVA 2EGAA 4XKWA 5IP6A 2E36A 2HVRA 3J81R 3I56T 1RUOA 3G4ST 3BG6A 5EZGA 3DEUA 4FT8A 1O3SA 2GTOA 5IAYA 1Q82C 2VV5A 2NUZA 3NEUA 5FROA 2ENMA 1T0JA 2RO0A 3HKZA 3RPUA 2Y4XA 1SRMA 2BZTA 1YW9A 1VQ9A 2EJRA 2EV5A 2VBWA 2E41A 4PDKA 5LHGA 3SZGA 2MLGA 1OCZH 4OMYA 3HUGB 2DCEA 3CDHA 4UVBA 3GTLJ 3OYYA 3REBB 3CCSI 2ZXIA 3BC8A 2A69F 2Z1DA 1POGA 5J40A 2EBIA 3IRQA 5DM7F 2JA5J 5EGOA 4A3BJ 1FSHA 1MUZA 1QWFA 2AO9A 3GNFB 4XM3A 2COYA 5HOOA 2RI5A 3OMYA 2XPVA 2KDSA 1R23A 2LDMA 3HRUA 2K9QA 4C5EA 5M3FJ 2OU2A 2W0ZA 4C92A 2DFEA 3BR1A 2COMA 3RKXA 1YFNA 4M3EA 1RI7A 1VQKA 3K70D 3FMSA 5KH6A 1HW1A 3G2BA 1JKPC 3OV8A 2VXDA 4BDZA 3TP0A 1R5ID 3K1PA 5EYRA 2ETHA 2LKPA 2XAHA 4E4HA 3J7AO 2DL3A 2I5UA 2HSPA 2YRVA 3TSWA 3CCLA 1OYIA 1IW7F 5FU7C 1YITT 1UDLA 1MBJA 2VONA 4F7UA 2B0LA 2WSEE 2OTLA 4HOBA 3HRTA 4DIQA 3K4KA 3ME9A 2SEMA 1RAGB 4I6ZA 2F5KA 5LJ5j 3CJNA 2P8TA 5A0LA 1QCOA 2LY9A 1GRIA 2XI9A 3INZA 1B59A 2DNUA 1V55H 2MOXA 4OMQA 3M0PA 1Z1DA 5D8LB 1YCYA 1FMVA 1AWXA 5DD4A 3C2BA 4WXHA 3QG1A 5LJ3j 3GPLA 5HLTA 5D6WA 1A36A 4UV9A 2TDXA 4XLAA 1B6AA 2I2LA 5J1UA 3RDIA 2NRAC 2K5FA 4OMZA 2HSEB 3AL0B 3PVLA 5I11A 2DK8A 2HNHA 2KISA 4AG2C 1Y0UA 3RZDJ 2L01A 5LJ5e 5K1YA 4XRMA 4LMYA 3J80R 3QDFA 2CQNA 4CH7A 4CYCA 2DO7A 2EQRA 1ZRFA 1X3ZB 3A8MB 1R58A 2MLKA 4GBQA 2FA5A 1LVAA 3K10A 4I99C 3GTJJ 1BL0A 2V1DA 5AYFA 3R6NA 4DA4A 4C3IJ 2XGDA 3EDPA 4EGYA 3F8NA 4FU6A 3TREA 1ZX6A 3MEUA 4C92C 1M1KC 4G94A 1REPC 2J5PA 4XKCA 3S3MA 1P6RA 2FNAA 2RQQA 5H20A 4HX4A 3KPHA 2MUNA 2X6YA 3PMTA 1KC8R 4ORZA 2R5MA 2L4AA 3QO3A 2F5DA 2WWYA 1DGWY 4IZZA 3PTAA 2J6FA 3DB4A 2QEXA 4M7DB 2E5KA 2O4XA 1E6HA 1XGNA 1HKSA 1ACMB 3FIFA 3LLRA 4HYEA 1TP4A 3H0DA 2MWPA 3MP1A 4OVAA 5EEGA 4IHWA 1A6IA 3L2UA 2NXNB 2JOYA 2DPDA 2YUPA 4BAYA 4OB2B 2AZSA 3BTCA 2F6CA 5JFRA 1CF7A 2DVJA 4JZ4A 2I0NA 1UGQB 3JCMd 3CLOA 3CCRQ 1YWOA 2OAZA 2ZPHB 4C3JJ 1XJWB 4I76A 1RAAB 2EPDA 1M2OA 3FEOA 2ZJ2A 3U1KA 2ABLA 4DYRA 3X28B 3PO3J 2KZGA 3K1NA 4HEA2 1KU3A 3MEWA 4AFSC 4RMOA 4NC6A 1IRFA 4RM2A 4NL3A 1WX6A 1AWJA 2YWWA 4DOWA 2FOWA 1KD1C 1K8AU 1Z77A 2XSDC 2BE7D 2JVVA 4PJNA 2A28A 1V3FA 4KIFA 2XAFA 1SFOJ 3C3WA 4G7ZF 2DIQA 4A3IJ 3ZL7C 3E2UA 4ZYAA 5ICCA 4CHUA 2MMPA 1V54H 2B9SA 4BB7A 1SFKA 2QQ9A 3KP6A 3H8ZA 1N5ZA 4M9SA 4XLHA 2K3BA 4M7DD 3PIPF 1M9SA 1X6GA 4M7DF 1U6GA 3M57A 4Q5WA 1TWHJ 1XMKA 2XPWA 1FJLA 3MKYB 2RF0A 3LWHA 3THKA 4JJNK 2IXSA 4A69C 4F93B 4LDUA 2HI3A 1JKRC 4P5NA 4M7AA 1T3SA 2WB1A 1QLYA 1H0MA 4PUSA 3CCLI 3HDDA 1OQKA 1WQ7A 1YO5C 1BIAA 1WJEA 4C92D 2QGFB 1OZ3A 3BPXA 1X27A 2DETA 1VQNT 1EKEA 1O3QA 4L59A 3OIPA 1SD6A 1HYOA 5CAIA 2OTJA 2QM3A 3GTMJ 3WTSC 1IUYA 2KZVA 5TISC 2LVMA 2VXFA 1C6VX 1N9SA 3I59A 1VQMT 2Z33A 4F91B 4RAZA 4CC4B 3GTQJ 3CF2A 3G4SQ 4HF1A 2F1LA 4B9XA 2PTKA 1QVPA 4E7ZA 3HKSA 1PC0A 2E6ZA 1A04A 3BJAA 4GGGA 1MD0A 1FYNA 1Y8RB 1ETQA 1MJBA 3LQRA 1U0JA 3A4CA 3FXRA 2VE9A 1YI2I 2KIQA 2EZLA 2M5WA 3ZMUA 1KQSA 2LDUA 1QPMA 2V1RA 3J80E 2JTEA 2D1XA 2JW4A 3L42A 4IRGA 3OYLA 2RJDA 1WHJA 2NUTB 5F0FA 5LL6S 1U5TA 3FKIJ 1ZSZA 4M78B 2XKOA 3VUZA 2DMQA 3SDGA 1KQ9A 4IKFA 1MH3A 2E35A 5CJ9A 3ULQB 4P9UA 2XMFA 1IXCA 3MVPA 4PJOE 5LJ3g 4FW2A 1R71A 5GAN7 3UATA 4YG2F 1FPQA 5EF6A 2LKXA 3TW6A 1VTNC 5F0HA 3K4JA 4FETA 4FYXB 5A0DA 5A0GA 2OD5A 5B66C 4E7SA 1XQHA 2X4JA 4XU0A 4M72A 4B3XA 4FX4A 2EZHA 4M6YA 4QPOA 3EG1A 4F14A 4B8XA 3LYIA 3IRRA 2CP0A 4J9HA 1GFDA 2ZJPF 4BE1A 2C0IA 4D8DA 3OY9A 3O6BB 5DD8A 1UECA 3ZN0A 3MPUB 2R0QC 1TUGB 3FJ5A 2ELKA 1Z9ZA 1BM9A 1TQIA 2WB1N 2IA1A 4KICA 1R7JA 4ITVA 4PK4A 2ZFUA 2DQRA 2LK2A 1MMSA 4C8QG 4XTZA 2RVCA 3H5RA 3J81Z 3UDCA 1ZA2B 1RAEB 1WA7A 3ML6A 3QYGB 5K7ZA 5FFXA 2MK5A 3QJ6A 2QQSA 3Q5FA 2GLOA 1X2QA 3PNWC 1W7PA 2VBYA 4FASD 1D1CA 1UHSA 1YQAA 3AL0C 2FB7A 2BY2A 5DUKA 2RQPA 1WHKA 2JUCA 2RH2A 4RA2A 1U5TC 3JTGA 2EQUA 2WBMA 2AXLA 1X2KA 2DRMA 2CS7A 1J7KA 4RLFA 1DP7P 1O75A 2MW8A 3G6ET 2HKNA 3OSFA 3DKXA 1GVJA 1GBQA 3V8LA 1A31A 4C92B 3DBHB 3CCRA 4MFEA 2IW5A 1Q86R 1RI0A 2ROLA 2K57A 3H5AA 3J7AF 2AK5A 3H5NA 3EQLF 3T1BA 3MFKA 2UWMA 4E47A 1LDJA 2LZ6B 3G71Q 4C8QB 2DOAA 3VS1A 3CUQB 1AOYA 4HQEA 1R0BG 4IPAA 4M9XA 4C2MJ 3S2WA 3M1CA 5DDGA 2NNNA 4MLOA 2A5YB 2QA4I 2PZ1A 1FWZA 2IS6A 2DJZA 4LDYA 1I4K1 5IN1A 1YHQA 3NTHA 4HG2A 2XUBA 1K0XA 2EIMH 1T8IA 5EZHA 1F36A 2E65A 4YRVA 2A6TA 3HB9A 2PLYA 4OIPF 3HTRA 1MV3A 4JRIA 5GAMh 4FW1A 3R6OA 3JRCA 2JS2A 3LAPA 2NLUA 2AXTC 1JJ8C 1PSEA 1R8OB 1HOMA 3QP5A 1PRLC 2J05A 4BUGA 2BE9B 3ULRB 2GWRA 1GUUA 1QZYA 4PGHA 3OA6A 3WGIA 1S9HA 3I56Q 2MIOA 1E3HA 2CZ1B 3OS2A 1VQOA 3CD6Q 1OR7C 1VQKI 1WZOA 1VNDA 3FXOA 3QWLA 2ZPIB 1YIJA 1VQNQ 5M3MJ 1KD1R 3TEEA 1U9OA 1USTA 2QQ8A 4QQ6A 1OPCA 1HSJA 3D5RC 3S3OA 2EFIA 3GBQA 3S6WA 1NHAA 3A98A 4XOPA 5IP9J 2Z99A 2OTJQ 5KVRA 4A3FJ 5JLXA 1GL5A 2Q1ZB 1PP7U 3HOYJ 1N78A 2KQWA 5GANd 4HLXA 5J47A 3HBLA 4BEHB 1ETYA 4P1WA 4E7HA 4JZ3A 5CKEA 4C0DC 4C30A 1TQPA 1QP2A 2MF2A 5GADJ 2M9HA 4PFOA 2W25A 2CW0F 3PNVA 1SRLA 4C2TA 3EG2A 4FIBA 3UF4A 1B1BA 5CYVA 2K3XA 3M53A 3OYBA 4LG0A 1P92A 1B72B 1NZ9A 5F08A 3ZMVA 4GFBA 1G3SA 3GXOA 3KE2A 2QZ8A 2PU9B 3A5ZB 1IXDA 4M73A 2VC8A 3G6EA 4HT8A 2OA4A 1AZGB 1R1VA 1RPWA 2DMNA 4GXOA 2WV0A 3J7YJ 1HF0A 1BR1A 4CZCA 4HDUA 1ACIA 4ZDOA 1W6XA 2KHMA 3CCEI 3ASOH 4DYQA 1PNJA 4XRSA 2KP6A 5CKTA 1GV5A 3DKWA 1D0ZA 1NPRA 3QUIA 2LNVA 3LH5A 2ZJQF 2WY7Q 3IH2A 3C4SA 1O7FA 1ZR2A 1YJWT 2JTFA 4RAYA 4BU2A 1KQ2A 3ZQQA 1WJDA 2HZYA 3ZCOA 2ZO4A 3HPHA 2X0LA 2CKKA 2HBPA 4C0FA 3HHGA 1D0XA 4II2A 6AT1B 3GUDA 3F0CA 3ROUA 4BS9A 5LJ3h 3JRHA 1Y8QB 2HYFA 3M0RA 1IN6A 3DKYA 3CCYA 1UAAA 3QSUA 2A6EF 1B7TA 4HA8A 4OIRF 3CCMI 4O3MA 1LOJA 3CF5F 1BI2A 3RR6A 3OSGA 4XLEA 5KCHA 1K83J 3X2QH 3DU6A 1WJAA 1S5LC 1Q7YR 1MMGA 3DLLA 3HGGA 1KK7A 2D2WA 1JGSA 1MGTA 4KN4X 2P4RA 5KCOA 2HOEA 2OV7A 5A2QR 3LSMA 1LQ1A 2K4JA 3SQNA 4I01A 2R5ZB 4ZTFA 5FWCA 4D5FA 2PMHA 4IO9F 2FNPA 3H3ZA 2ACJA 1SHGA 1G2BA 1K6OA 2RNJA 5F04A 3PJRA 3ELKA 1X43A 4EJUA 5DM7R 2VC0A 4MZTA 2YU9J 4LLLA 5GANj 1BN5A 2M45A 3DFGA 3FHNA 4FCYA 1HKTA 2Y9YA 1T95A 2HQNA 2IVWA 2BW3B 4ESFA 3ER0A 2CGPA 2GQQA 2A05A 3JSOA 3M9QA 4EMGA 4MTEA 1YTYA 1JJ2A 4GRIA 2F4MB 3ZQGA 2K27A 2BGCA 5BPIA 1TL8A 2WAQN 3FJPA 3TVTA 1FOWA 3F72A 2MYSA 4Y7NJ 4Y52J 3KIOA 3HKZN 1M1KU 3TO9A 3OMCA 1EZZB 2CH0A 3WE2A 3JB9I 2MBFA 3ZRGA 1D8JA 4JUVA 1F1BB 3SFIA 3UNGC 4IRIA 2HFHA 3QRFF 4N9HA 4AIKA 2J06A 3WTZA 2LT4A 3MKWB 2ME6A 4RGXA 1OCRH 1G83A 4EDUA 1IDYA 1ZG1A 2QYZA 1YIOA 2CQXA 2GZWA 3EPZA 4KNYA 2Y90A 4J8OA 3TMOA 1Q82R 2JWTA 3IC7A 1IV8A 3HSBA 2LNHB 2KKOA 3CDIA 2ZC2A 4KMFA 5FFZA 1FX7A 3HFOA 2BY1A 5F1JA 3I58A 2HQXA 4A6EA 3MEXA 2CGHA 5TRDA 3QU6A 2L7FP 1I3AA 1I6HJ 1J75A 4CC7A 3GNGA 8AT1B 3CMAA 5K5RA 4MGRA 5FKKA 4KH0B 1I5ZA 2IGNA 1NG7A 3DEEA 3DTEA 3FWEA 2QSFX 1V29B 2KBTA 4ELZC 4HRIA 3QKJA 4OMLA 2HXIA 4EMKA 4M7AG 3CUOA 1OYXA 4C8QC 2ZPFB 1JTYA 5IHNA 1K78B 2O9VA 3W3CA 3F6OA 1ZGAA 2GIZA 3OOUA 1WCMJ 5KAIC 1QCNA 4II3A 5D5XB 1BI1A 2LC2A 3I9V2 4AIDA 3PIPA 2MSYA 1JHHA 1VQ4T 1DP3A 1R0CB 4Y4RA 4ZYHA 3TKYA 1PJRA 1HDPA 3M8FA 2IGOA 2CJJA 1HXDA 1X6BA 1QVUA 2VKHA 3A0BC 3CCEA 2DTZA 2ZCWA 3KXTA 4P9FA 3OIOA 4CSWA 1QVFP 2HQRA 4HAMA 3VYTB 1FZPB 1QA6A 3SFMA 4PLLA 3GFIA 2P4WA 5CQYA 4HQMA 4X6AJ 2WC2A 2ZB9A 4PGGA 5IPAA 3A01A 1FYKA 4RB1A 1TNSA 5FGMA 2ZJRF 2L7MP 3P7NA 4CGZA 4CICA 3HOXJ 2DLPA 2KMTA 1LPQA 2HQ5A 1JJ6C 4IUPA 2O8XA 3RESA 4Z8AA 4ZGJB 2XRNA 3HOVJ 3A1PA 4ESJA 1J59A 5LGNA 1QQJA 4DYCA 1T08B 2V9PA 3WHCA 4NNJA 4YFKF 1Z6TA 2LX7A 4QKUA 1O7LA 3V8JA 4M75E 4RGSA 2F4IA 2JRMA 1IN5A 4G12A 4UNOA 1JJ2P 3J7AY 5J1RA 1FOKA 3M4GA 4GY5A 1IN8A 4BE0A 4C0DB 1K8AC 1SAUA 1BR4A 3GFMA 2ELHA 4LK0F 1JUSA 1NLOC 3BQZA 4DGWB 1OCTC 4XLFA 1YI2A 1WH7A 2C6YA 4A4KA 3DTKA 3S15J 2LLKA 1MBKA 3SHFA 4WXDA 2H6BA 1G4DA 1BCMA 4DBHA 2IEKA 3MZ8A 1M30A 4MO7A 2DA4A 2DA2A 2X3WD 2GIVA 4L5IA 4NQWB 1WHHA 1LNWA 4B43A 2XG8D 4I98B 3LL7A 2CZ7B 1FYLA 1VQ9T 3W6VA 2AIRB 1NYGA 3CPWA 2FQ4A 2Y0MA 2HL3A 4HF2A 5GAEJ 3F9KA 5DV5A 2GAUA 5KCMA 1Z9QA 4JS5A 1OQYA 4N0BA 2FZGB 3G7ZA 3P8BB 4DNCA 1D0YA 3CC7A 3QPSA 5IHKA 5FLMJ 2LQWA 4UV8A 1TQMA 1RABB 3VS5A 3U21A 1YYVA 5LFAA 1UHCA 1WYXA 2CH4A 2QQBA 2M16A 5HCKA 2CG4A 2V9KA 4A6DA 4XU2A 4KUDK 2LD5A 2PX9A 5GANe 3OS1A 1OJLA 4CCOA 3HOUJ 3JB9F 3IP4B 4OMOA 4Y92A 1KQ1A 5IYDJ 3M0UA 2I10A 4UHTA 4A4GA 1IO2A 3TP3A 1MBFA 2AQEA 3KYLA 3E7LA 5CQGA 3AG1H 2R5ZA 4E70A 2CV0A 2EVRA 3T9NA 1I6XA 2M2EA 2XGEA 2M51A 2RQWA 4EJTA 3VS7A 1H88C 1V5GA 1I81A 5FLXZ 4YFXF
chains in the Genus database with same CATH topology
4FL6A 2O0YA 2RB6A 2EKOA 2Y4YA 1IRGA 1YW8A 4IHTA 5DCMB 2ISYA 3GEZA 5AONA 3T5XA 3FDRA 4C92E 4WK8F 2BBYA 4LK1F 2LNBA 3JCMc 3CUQC 3CCJT 3CC2T 3OYMA 3WXMB 5GANf 5LJ5d 1F1ZA 1OMIA 1Y07A 3TU4K 5F1RA 3PQKA 4MQ9F 5TJJA 1TH7A 4BD3A 4BHBA 4MEYF 3MQ0A 3L2CA 4LB5A 2EJFA 2UXXA 5KE2A 5CCAA