2QQBA

Crystal structure of dtxr(m10a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
214
Chain Sequence
DLVDTTEAYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 66
structure length 214
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqbA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqbA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqbA03
4ZYEA 4ENNA 1KU3A 2IA1A 2E7WA 1K6OA 2NNYA 2HYFA 4A5MA 3R0JA 4U7BA 4YIIA 3WE3A 1YW9A 1CGPA 2H27A 4A6DA 5J8CA 4IXAA 2EJRA 3I5UA 5FLXZ 3ZQ7A 4KIGA 1J9IA 3KP5A 4HYEA 3GFIA 3TO9A 5FGMA 2WV0A 5FB2A 3KEQA 1YS6A 3L9FA 2EFQA 4LJZF 4CO8A 4WXDA 3K1PA 3K69A 3KEOA 1U78A 1V3FA 3FWEA 3V8JA 5LHIA 3H3UA 4A0ZA 2QWWA 1TW2A 4F7ZA 3C3WA 3QU3A 1U8RA 5DYMA 1P4XA 1HW2A 4EGYA 2CGPA 1R00A 5LEKA 1LQ1A 1IXCA 3IRRA 4ASNA 2DK5A 2M45A 1Z6RA 3V4GA 4DNCA 2FNPA 1E17A 2FMLA 1XSVA 3COAC 2XROA 1VTNC 4IHSA 3MCZA 4HQMA 3RKYA 3LQRA 4HAMA 3ERED 4Q5SF 1R36A 2UXNA 1KQ9A 2W57A 1QW1A 3ZMSA 3MHXA 3QP5A 3T8TA 1XSXA 3ZMZA 1F9NA 4D0PA 2HOEA 2PQ8A 1FBSA 2HWVA 2K5FA 4UV9A 3KP3A 1S29A 1JGSA 2LF8A 2FEZA 1IN7A 4UHTA 2OD5A 5J6XA 3B73A 1FBQA 4NB5A 5DUIA 4ZZLA 2K5IA 1Z9CA 5D4SA 3F72A 2OQGA 2OBPA 4FT8A 5D5UB 1FSHA 4ENJA 1IAWA 4EJUA 2FOKA 3K0LA 4A5NA 5HS9A 1IN8A 3BPXA 1ZLJA 1SMYF 3NEUA 5ERIA 3ZMTA 3PQKA 2HZTA 1KA8A 2H09A 1SD5A 1KYZA 3ELKA 2PI0A 2OZ6A 4WWCA 2FBHA 4Y17A 2ZJ2A 2ZBKA 5E18F 4L9TA 3QRFF 2VN2A 2XV4S 4B09A 3T1BA 1OKRA 2J5OA 3E6DA 2H6BA 2IA0A 1HXDA 2VBWA 1RUOA 5DV5A 4OIPF 3KZZA 4U0YA 3Q9VA 3L00A 5ILUA 2QBYA 3SZTA 2IJLA 1KU9A 2B0LA 4LFUA 5TJJA 3FXQA 5ICCA 3U1DA 1ZG3A 3DKWA 1JE8A 3E5QA 3P9KA 5DCFA 2P6SA 2W85A 2COMA 3LA2A 4XSZF 3K9TA 2A07F 2NRAC 3VB2A 4M73A 3E97A 2X4HA 3WTXC 1RUNA 1S7AA 5FFXA 4LK1F 3HHHA 5FD6A 3HSRA 4YFNF 5DEQA 4O5VA 2FQ3A 2R7FA 4N9HA 6PAXA 4LG0B 4G7HF 5DUKA 4BHBA 3HUGA 2KJBA 1TQMA 4RAZA 2X0LA 1L0OC 2EFPA 3IRQA 1GVJA 2R7DA 1IRFA 2D1VA 4XBFA 3R60A 3WTTC 2KIUA 5LGUA 4ZZDA 1REPC 3T8RA 1SFEA 4N0BA 3ML6A 1QO0D 5LGNA 3NQOA 2FMYA 3RPQA 4N9IA 5CJ9A 3EQLF 2ESNA 1YS7A 1ZGAA 4UV8A 5D6FA 1SAXA 2XHKA 4KT5C 5E8IA 1F4KA 4KYWA 3I59A 3FF5A 1P4WA 1QZYA 4KN7X 1U3EM 2XAJA 3FM3A 3ECOA 3I54A 5F6FA 3TO6A 1O57A 1QNTA 1W5SA 1OYYA 1G3SA 2VOPA 4HOBA 2QUFA 1FYKA 1S8NA 3R0AA 2BGCA 1R1VA 3RTRA 2A69F 1RIOH 1K7AA 4XSXF 1BI2A 4RS8A 5JFRA 5E8GA 3V8KA 2W24A 3TO7A 5HS8A 3U2RA 5HDKA 4HF1A 3JAMK 4HX8A 1R1UA 1P4AA 2OU2A 4KMFA 2PJPA 3C18A 3DV8A 3I64A 5LBQA 4RB0A 2DO7A 3S2WA 2ZCWA 3L7WA 3QU6A 2UZKA 2YX4A 4LLGF 1HKSA 1I1GA 1FX7A 4M9SA 1IXRC 1LVAA 1J5YA 3N97A 1UCRA 1HSTA 1ZRDA 2EV5A 3F8BA 3SQNA 3F6OA 5HLHA 3V8LA 4ZYHA 1FNNA 3F22A 3JAMZ 3C7JA 2OAZA 2CO5A 1F5TA 3ZN0A 2GWRA 2KKOA 1U5TC 5L3CA 3EDPA 5D6EA 1TNSA 3LFKA 1BOAA 3G73A 2F5CA 4EJOA 5DD4A 1ZRFA 3DPTA 1O3TA 2VC1A 2QLZA 2P5LC 3RDIA 4HW0A 2YSRA 4RB1A 1FWZA 1PP7U 5DCMA 2XAFA 4AIJA 4LK0F 1IN5A 4Q4ZF 4EJTA 2P6TA 4NQWA 2OZUA 2UWMA 3HRSA 2PLYA 4MHGA 4GXOA 5IT9K 1BI1A 2ZKZA 4CXFA 2FBKA 4GYGA 2DTRA 1FBUA 3F8MA 3O6BB 3CUOA 3DF8A 1UB9A 2ISYA 5K5RA 1T2KA 1D8KA 2W84A 2JPCA 1U5TB 1USSA 2G7HA 4IRGA 4XRFA 2LX9A 2QQ9A 2UXXA 1NHAA 2QQAA 1BC7C 1XN7A 3HYIA 2JT1A 1I6XA 3WU0A 5HLGA 4UVCA 2HDCA 1MGTA 3H3ZA 3CLOA 5IT9Z 3KLNA 1H0MA 3KP6A 5DDGA 2E7XA 3PFIA 4E70A 3TOBA 1IN4A 2V6CA 4HV6A 2HEOA 3RYPA 1B6AA 3JTHA 1IF1A 1QBJA 1HW5A 1ON2A 2OQRA 4EGZA 2EV6A 3RYRA 2PG4A 2XASA 1FLIA 3EUHA 4WF2A 2STWA 4UVBA 1R58A 5BOXA 4I01A 3U9GA 2KJCA 1RI7A 1I1SA 1YTYA 4UUVA 4ON0A 1GXPA 3WGGA 2K4JA 3FMQA 3R4KA 3F23A 4G7OF 2NS0A 3LQQA 1BC8C 4WXCA 2IVMA 4CYDA 2FBIA 1FC3A 1YW8A 5K5QA 3KLOA 3ZPLA 3FHZA 2AXLA 3E6BA 4RGUA 1TLHB 5BPDA 1MJAA 5IT3A 3BZ6A 3Q9SA 3WTWC 3LA7A 3MZHA 3GFMA 2Q2EA 2YPRA 5E1WA 4G8XA 4HBLA 2CFXA 2M1BA 1W7PB 2Y48A 4HA8A 4EM0B 4JQFA 2PFBA 4WX9A 1MDMB 3HSEA 3K2ZA 2O8XA 4HX7A 2ETHA 3BWGA 4MTEA 4EM1A 3CUQC 2M5WA 2CQKA 2DU9A 5L3FA 4KIFA 2LDUA 4LG0A 2BEOA 4ZYGA 1XGSA 4KN4X 2FSWA 2A5YB 2ZMEB 4HDVA 2HGCA 4RB3C 4H0EA 3J7AO 2W25A 1LDKB 4ZYDA 4OOIA 2ACJA 4RGRA 3FXRA 1Z1DA 3RKXA 3KZYA 3BDDA 4A12A 1OYIA 1B4AA 4I7HA 1HSJA 1WI9A 3T5XA 1XDUA 2KIFA 3CUQB 3CO6C 4LLNA 2DAOA 2MA3A 2Y75A 2A61A 5ICEA 2E1NA 2E1CA 3BJOA 3IC7A 3TKYA 4IRIA 4LD5A 4HV5A 1FP1D 3DQVC 2IPQX 2CSOA 3TOAA 2RDPA 4K2EA 4UNOA 3DPLC 1T6SA 2QVOA 3OOPA 5L3BA 2GQQA 2TDXA 4OINF 3R61A 4M6XA 3MAJA 5H6QA 3W6JB 3WG9A 3KP7A 1MZBA 3MZYA 3FMRA 2RNJA 3G3ZA 5A2QK 5CVIA 3WTVC 2BYVE 2HKXA 3REOA 3WGIA 3F21A 5FD5A 4JK1X 3VODA 1ZG5A 2MBFA 5ILSA 5TRDA 2HKOA 4IJAA 1WSUA 3DXJF 4IVNA 4Q47A 3V7CA 4L9JA 1ZHFA 3E6CC 1OR7A 3I71A 2WTEA 3ABTA 1W7PD 2HQRA 2GXBA 2DT5A 2JRTA 1T39A 2IA2A 3K1MA 2FRHA 3F8CA 5JR3A 3GW2A 2DK8A 5A2QZ 2HYGD 5KVRA 4HLYA 3FXUA 1HQCA 2EB7A 3BJ6A 4MQVA 1D5VA 3E5XA 2DI3A 2WC2A 2DPDA 1EH6A 1U2WA 2VBZA 2LSOA 1G4DA 4MQ9F 4YIFA 1O7LA 2P4WA 4KDPA 3F3XA 1G3WA 5E1ZB 4A0XA 1ZRCA 5D8LB 2ESHA 2K27A 2QYOA 4HLXA 1U5TA 2DW4A 4L9NA 2XRNA 4L5JA 1YFHA 5ILVA 1SD6A 2QENA 5EEHA 4O3MA 1B9MA 4M6YA 5CYVA 1R1TA 3ZMVA 3MFKA 5L3DA 4YFXF 1Z91A 5DD8A 1JHHA 4EM2A 4GYIA 2RGVA 4I0AA 2F5EA 3OV8A 4S04A 1S6LA 1KYWA 1FP2A 1W4MA 3HRUA 4G7ZF 3W6KB 2H94A 1BIBA 2L3DA 1WKMA 4QWQA 5H6RA 3RKWA 5L3GA 1XB4A 1WRJA 4ESFA 1YYVA 3E19A 2P7VB 2Z5UA 4WCGA 2GAUA 4G94A 2P8TA 4PCQA 2DQLA 3IKVA 1R22A 4I98B 5F1RA 3IKTA 4AIHA 1I27A 1KU7A 2YX7A 5JVTA 1YW7A 4FHTA 1PUEE 2HTSA 1JHFA 2O6GE 1SD7A 4RGSA 3CDHA 3E5UA 4L0YB 2XAHA 3QP6A 4M74A 4OMYA 3SFZA 1MD0A 4P96A 2YU3A 2JZYA 1IZ1A 1FYLA 4CICA 3MQ0A 5H20A 4BNCA 1W7PA 1SFXA 2EFNA 4IPAA 3HHGA 5EEGA 2NNNA 3TDZC 3SXYA 2CG4A 2HQNA 4GGGA 1TW3A 1X3UA 4P55A 1YIOA 1ZG1A 1MJ9A 1B9NA 3JTGA 4P9UA 4EJVA 5LHHA 2H6CA 2QQBA 1FPQA 3HTSB 1LEAA 4B8XA 2ZMEA 5ICGA 4G9YA 4GCVA 4L0ZB 2MD5A 2BE5F 3J81K 2EA2A 4LB6B 1RZ4A 1TBXA 2A3SA 3DFGA 2XIGA 5LRRA 1ZREA 5CVUA 4CGZA 3IWZA 3LAJA 3MEXA 4FX4A 1YO5C 1HBXG 4U88A 1J75A 4CZZA 4BYYA 3GYHX 5LLQA 1USTA 1IN6A 3HIFA 4MEYF 1R5GA 3CUQA 3I4PA 4Q48A 2HTJA 5D8KB 4KIBA 1UFMA 3BP8A 2H3JA 4I0BA 3WODF 3WE2A 4Z2YA 1DP7P 2XVCA 3P9IA 1XGMA 2CWEA 4KA4A 3EETA 3EYIA 1D3YA 3M1EA 3J81Z 3ZMDA 1ZN2A 4PGGA 2LF7A 4I09A 3IL2A 3QAHA 2IT0A 3V7SA 4HZFA 5KK1A 3ABUA 2K4BA 2F5FA 2Y0MA 1BM9A 2XAGA 3HSFA 5FFZA 1P2FA 1W5TA 1S7OA 1J59A 2QZ8A 2GCXA 2VBYA 4OU0A 5LGTA 4M71A 1FSEA 3K1NA 3ROUA 2PBIA 2GIVA 2MH2A 2VONA 3FM5A 4MGRA 4EV0A 4I2OA 1XDSA 5CLSA 3WTSC 1R23A 3GZ5A 4YG2F 1T38A 3H92A 3WGHA 2FA5A 2ZFWA 3ZP5A 2ZNYA 1G3TA 3LSTA 2LKPA 3MWMA 2WWYA 2LNBA 1H9GA 2A6HF 2RV8A 5L3EA 3KCCA 3LAPA 4KUMA 1WWXA 1Z05A 4M9ZA 2PMUA 5D4RA 4BHPA 4G6DA 4AWXB 1QQIA 1P92A 4TV7A 1QZZA 2O03A 3E3VA 1KQ0A 2XKPA 2HR3A 1BN5A 2VT2A 2G9WA 1QPMA 2VBXA 4M72A 1S3JA 4DQ2A 1GXQA 4PDKA 1XCVA 1K78B 4AIKA 2KRFA 4XLPF 3TGNA 1OYWA 1FOKA 1AWCA 2G7UA 3RI4A 2A68F 2K5LA 4RGXA 4L9VA 1A04A 1KQ8A 2IRFG 2ISZA 3GUDA 3T0YA 3D0SA 4Y15A 4A0YA 4ETSA 1J0RA 2Z99A 3BROA 3LWFA 5LHGA 2STTA 3GWZA 4KFCA 4ESJA 4S05A 2QM3A 1AOYA 1MJBA 3DEUA 2ADUA 2IW5A 4LB5A 3VEPA 2R3SA 2Q0OA 1EV7A 3RPUA 3RIRA 2Z9OA 2JPBA 3FZVA 1YQAA 3SHFA 4ENKA 4BH9A 1DDNA 2XKOA 3DP7A 2GA2A 4ZH4F 4L5IA 4OIOF 5HOOA 2HFHA 5BPIA 2V1DA 3I53A 4PZJA 1XGOA 5BQTA 2VC0A 5ED4A 3NRVA 3E6MA 2K7LA 4OIQF 2J5PA 1HKQA 4LGWA 4RB2C 3GFJA 3L09A 4ENMA 2VXZA 5DCMB 3N4MA 1XCBA 4U0WA 4MEXF 2P5VA 2EFOA 1XMKA 1SD4A 2HS5A 2BBYA 1IXSB 1DPRA 1EH7A 5JHUA 1TNTA 3VOEA 2Q8KA 1ZAOA 3QPHA 4LMYA 2D1HA 3CJNA 2DBBA 2P7CB 1ONVA 5E1XA 3IHUA 5AIPA 2YR2A 2F2EA 3FX3A 4XLNF 2XAQA 1GHCA 4UVAA 4RAYA 2FU4A 3RJPA 4G6QA 5CVRA 2K86A 3GEZA 5E17F 2L54A 3GZ6A 2RQPA 1ZARA 3WTUC 1EH8A 2Z33A 3D5LA 3Q5FA 4O6JA 4HX4A 1TQIA 5E20A 1O3SA 2V1XA 1D8JA 4L18B 1K79A 5HS7A 1HKTA 4Y13A 1B59A 4R8HA 1R7JA 3KFWX 1KGSA 2JSCA 1CF7B 2RC4A 1J2XA 1Y0UA 2CW0F 1FYMA 3O2PE 3EYYA 3KE2A 1J7KA 3I58A 3GLXA 2EK5A 1KU2A 4CHUA 2XUBA 2A6EF 1T0FA 3HTUA 3M8EA 5D5VB 2FE3A 4QLCU 3ZN1A 2D45A 1YG2A 1PDNC 4R1HA 3HRMA 1TTYA 3JW4A 5LEJA 4IHTA 2DPUA 4EJWA 3JSPA 1DPUA 2F5DA 4GO1A 4P9FA 3SZPA 1OPCA 3BY6A 5ICFA 1XD7A 3KETA 1I5ZA 2VOOA 2EWNA 4A2UA 3GVAA 4IF4A 2JTVA 2V1UA 4M9XA 5JI6A 3GF2A 2BV6A 4HF2A 3LA3A 3PQJA 2MLGA 4KMUX 4LLLA 1HW1A 5K1YA 1ZYRF 2EV0A 1Z6TA 2M30A 2D2WA 1O3RA 3M9AA 2NAZA 3TDUC 2FNAA 1R5HA 3B02A 5AIQA 1BBYA 1XSDA 1C0WA 4I02A 1SMTA 2VE9A 3P7NA 1BI0A 1UHMA 3QPTA 1LNWA 1OMIA 2EA4A 1JXSA 1Q1HA 5HDNA 3VFZA 3P9CA 2ELHA 3FMSA 1UHWA 3L2CA 3CO7C 3WTZA 3F8NA 1ZGJA 2L02A 2MH9A 2Z3YA 2M8EA 5CVVA 3ISPA 3HRTA 1ULYA 1DUXC 1P6RA 1PP8F 5D5XB 1K78A 2O61A 1WQ2A 2GZWA 3ZMUA 2FF4A 2GA1A 1IRGA 2AS5F 3R6SA 1BYMA 1ON1A 3BPVA 2L4MA 1V4RA 2O3FA 4ESBA 5BMZA 1ODDA 2IP2A 1MDMA 5HDGA 3WTYC 4BXUA 3I0TA 3HOTA 1BI3A 3ECHA 4CDGA 2KIMA 3AAFA 2ZXJA 2VT3A 1T98A 1LDDA 3BJAA 3IWFA 2VE8A 3C1DA 1FT9A 4AVPA 1BJAA 3CTAA 4OIRF 5HLIA 4WXHA 3KP4A 4KICA 2PN6A 4KNYA 4FX0A 3KP2A 1XGNA 4EMSA 3JSOA 2PMHA 5CVJA 1ZH5A 3GXOA 4BAYA 2FXAA 1IUYA 4EVIA 2DQRA 2L4AA 2O0YA 2ZNZA 1FY7A 1G3YA 5HVQC 3TQNA 5BS6A 5AONA 4OMZA 1QGPA 4P5OA 4NHJA 3GO5A 4IRHA 2RVCA 2K02A 5J8FA 2RKHA 2QBYB 1QVPA 2OA4A 3V7RA 3QOPA 2RN7A 3F6VA 1G6NA 4R79A 1FZPB 1H9TA 2GXGA 2XGXA 4HF0A 1LDJA 1LEBA 1BIAA 1U6GA 5K5OA 4WK8F 3WU1B 2MLKA 2ZO4A 1IW7F 2VODA 3HOSA 1SFUA 4JBAA 1LB2A 1YLFA 2M87A 4U0VA 4U7DA 2DFIA 3GFLA 5LRSA 4UXNA 2L01A 3J80K 4MTDA 1B1BA 2DLLA 4A6EA 4PGHA 4MNUA 4YFKF 4HDUA 1O7FA 3GX4X 1MKMA 3F8FA 2PEXA 1O3QA 2CYYA 2P5KA 3O3KA 1E2XA 3M8FA 3M7GA 2EFWA 5F64A 4BQAA 2K4YA 2V9VA 1Z7UA 5FO5A 1CF7A 1STZA 2V79A 4AD9A 1ZLKA 5FLXK 1F1ZA 1RNLA 3ULQB 2C6YA 1TQPA 2MC3A 3J80Z 1L3LA 3I59B 5D5WB 2NYXA 1XMAA 4EQQA 1LJ9A 4HQEA 4BHCA 3BOQA
chains in the Genus database with same CATH superfamily
1LKXA 1AWOA 1TT5B 4RAFA 4ZYEA 2DYBA 4FU6A 4G6TB 4ENNA 4M4ZA 1KU3A 4UY8I 4JJBA 2IA1A 3G71I 1YCSB 2E7WA 3H0DA 3FKIJ 1K6OA 4HRIA 1IXDA 2NNYA 2G6FX 2A7YA 2HYFA 2CMPA 4A5MA 3R0JA 3WE3A 4YIIA 4U7BA 2FUG2 2VQHA 3WHCA 1BR1A 1MMDA 2KL4A 1OU8A 4P1WA 2HL5C 2EILH 4J5YA 1UGSB 2IIMA 1YW9A 2X51A 2FYKA 2AKLA 1CGPA 2H27A 2L0AA 1WPYA 2YRCA 1RAAB 4A6DA 4FT4A 5J8CA 4XTXA 4BEHA 1SRLA 4IXAA 2EJRA 5F04A 1MH3A 1NJIU 4GY5A 3I5UA 2QDYB 1QVGA 2R7TA 2MPXC 5FLXZ 2DLPA 3CF2A 3ZQ7A 4HSRA 3EGXB 4KIGA 3K2AA 1J9IA 3LSIA 3VWBA 1RC9A 1YITA 3KP5A 4HYEA 4D5FA 3GFIA 2K2MA 2DL4A 3L2VA 1Y39A 3TO9A 3E2UA 1XMXA 5FGMA 2WV0A 5FB2A 4BI3A 3KEQA 5FLVA 5M3MJ 4XRMA 1JI8A 1K9MC 4MFDA 3SJMA 1YS6A 4FE4A 3CMEI 1Y6IA 3L9FA 4M77B 2EFQA 2KRCA 3UKGA 2QK0A 3CCSQ 1V5EA 4LJZF 5FKNA 4CO8A 4WXDA 1FIAA 2NYSA 2EZLA 4KGZB 4A4FA 3K1PA 3K69A 3KEOA 1Q86U 2VGNA 3N5BB 1MH4A 1VQ7T 1U78A 4OMMA 1V3FA 5B66C 2K3BA 4BD3A 3FWEA 3V8JA 1PSEA 1RLQC 3KYDB 5LHIA 4MIMA 2M3AA 3H3UA 2XDVA 2L9NA 4BJ6C 2DNUA 2RMOA 3G4SA 4BDZA 1K8AC 4A0ZA 2QWWA 1TW2A 1T08B 4F7ZA 3CCMI 1IUFA 3C3WA 4A3IJ 1UB4A 2RI2A 3QU3A 3HC7A 1U8RA 3ULRB 2K9LA 3PSIA 1B72A 2DE0X 1Q81C 3A01B 3HXLA 5DYMA 4B4CA 1R71A 1P4XA 4W1UA 3JR9A 3SDGA 1HW2A 1IGNA 3CPFA 4EGYA 2CGPA 1R00A 5LEKA 3I55I 1LQ1A 5CKBA 4UUSA 2BZ8A 5D6WA 1IXCA 2EIKH 3IRRA 4ASNA 2QTVA 2DK5A 2M45A 1VQKI 2VYTA 1YJ9Q 1Z6RA 3V4GA 1QP3A 1VQ9Q 4DNCA 1OEBA 2FNPA 1IGQA 2RJEA 1Q82C 5EEAA 1PUFB 1E17A 3EHQA 4BKXA 2CS3A 1BR2A 1PRMC 2DMOA 2FMLA 1XSVA 1E3PA 3COAC 1JJ6C 3S16J 3QYEA 2XROA 1VTNC 1N9SA 2MOXA 4OF1A 4E6KG 2WY7Q 4IHSA 3JCMW 3MCZA 4HQMA 4RDUA 1ZQ3P 3LL7A 3RKYA 3CZ6A 3LQRA 3M9QA 4HAMA 3ERED 4Q5SF 4Z02A 1QHHD 3B6AA 1R36A 5BNGA 2HU9A 2A08A 2O9SA 2UXNA 1R6RA 3JB9J 1WLPB 2LNHB 2PU9B 2M8GX 3RERA 1XG1A 1KQ9A 3ABKH 3GTLJ 3GTPJ 3VYRB 2OAUA 2W57A 1QW1A 3CBOA 3I5RA 4RUGA 3BG3A 2KAFA 4AG2C 1YBYA 4YRVA 2HL3A 2RI3A 3CMEA 3ZMSA 1N9RA 1M2VB 1ACMB 3CCVT 1S1NA 3G2BA 3ZRGA 3MHXA 3J80E 3QP5A 1OULA 4OMNA 1K9MR 2EJGA 1LOJA 2RD1A 4NQWB 4J9CA 2JVVA 2RK2A 5FW9A 2XICA 3FIFA 1K61A 3T8TA 5GAN3 1XSXA 2A36A 3U23A 3ZMZA 2CP5A 1F9NA 3QDRB 4D0PA 2HOEA 2PQ8A 4FASD 1BCOA 2E1HA 2M16A 3OYGA 2L7FP 4JDSA 2DCEA 4KUIA 1FBSA 5IN1A 3RDVA 2HWVA 2GIZA 1M1FA 1X1DA 2K5FA 2W0ZA 3DLMA 4UV9A 4X9CA 3KP3A 1S29A 3I56I 1JGSA 2LF8A 3H5RA 3FEOA 2F4IA 2FEZA 1IN7A 4UHTA 1OQYA 5DS9A 2OD5A 2NUTA 3KZIC 3MN2A 4AYBN 5J6XA 4A3FJ 1GLNA 2MVTA 1K8AR 2X1EA 3B73A 1FBQA 4D1QA 1M27C 3LGLA 2LD5A 1MSEC 2OTJI 3OYLA 4NB5A 4DOWA 3M57A 5CK9A 5DUIA 1Q81R 1GVDA 4KH1B 4A54A 3CCSI 4ZZLA 3QG1A 2K5IA 1Z9CA 2K40A 2RN8A 3LSKA 3EH2A 5D4SA 2Y9ZA 3F72A 2OQGA 2VC8A 2QGGA 2BW3B 2RH2A 2HDDA 4YEJA 1NEBA 3UA6A 2BY0A 3OYAA 2OBPA 3DLLF 1GCQA 1PCXA 4EMGA 4V19K 2PMZN 5M5XJ 4AM3A 4HCZA 3L2UA 1Q82R 4C30A 4FT8A 3TBIA 5KYWB 4XLEA 5D5UB 1FSHA 2WY8Q 4ENJA 3KBGA 1IAWA 2YWWA 1ZLMA 5FLXE 3VSLA 4EJUA 4A3KJ 2FOKA 3CESA 2KDZA 3H3VK 1Z0XA 4UB8C 3K0LA 2QA4T 3SZGA 4A5NA 4MO7A 4F14A 3JB9D 2VASA 3HPHA 5HS9A 2OTLA 2JN6A 2PX9A 4F3QA 1IN8A 5C3EJ 3BPXA 1W36C 1ZLJA 2DRMA 1VQKA 3PNTA 1SMYF 4OB2B 2OV7A 1YE9A 2HVSA 3MCAB 2X1CA 3BDLA 3NEUA 3GMEA 3OL4A 4LITA 3PQKA 2M7BA 2HZTA 5ERIA 3ZMTA 1Z3XA 1FYNA 2YLBA 2RO0A 2HD0A 2E65A 1KA8A 2W00A 5I2SA 2H09A 1SD5A 1KYZA 4IUTA 3ELKA 3CMYA 1BR4A 2PI0A 3H41A 2OZ6A 4WWCA 3QZ5B 2XD0A 1P7JA 2FBHA 4Y17A 3ZQQA 2ZJ2A 2FOWA 1RPWA 2CREA 1KC8C 2ZBKA 5J4VA 5E18F 4NOYA 2CQNA 4L9TA 3CQZJ 4B3AA 3QRFF 2ZXWH 1MNDA 2VN2A 1K0XA 5KCMA 1G5VA 1UJ0A 2XV4S 4B09A 3GLLA 3T1BA 3S6WA 1CSKA 1OKRA 2J5OA 3EG3A 3E6DA 2AK5A 2DBMA 2GQVA 1M90C 1M3BA 1R4MB 2H6BA 2IA0A 2P81A 1BW6A 1HXDA 4E7SA 3OIOA 2J06A 2VBWA 1AWJA 3BLYA 1VQ7I 2D8HA 1RUOA 5DV5A 4OIPF 4J7IA 5HK0A 2QGUA 1YJNT 1K8AU 1TZLA 1X2QA 2EYZA 2HEQA 3KZZA 1ENHA 2UV1A 4PJ0C 4U0YA 1JUSA 3Q9VA 2I0NA 5D7UA 1LVKA 2DZCA 3L2QA 2KYMA 3L00A 2K9MA 5ILUA 2DTOA 2ZSHB 2QBYA 1OLTA 3S3MA 2EQKA 3BQYA 2L9VA 3G1LA 2IJLA 3SZTA 2F5VA 2EGEA 3VSKA 1K4US 5IHNA 1NBEB 1KU9A 3CCSA 1KD1C 3KPHA 2B0LA 3JRFA 4LFUA 2O01E 5TJJA 5CKFA 1SHGA 4M77D 3FXQA 4DBRA 3OMYA 4L5GA 5ICCA 2WB1N 5GPAA 1PKTA 1M90U 3U1DA 3META 1ZG3A 3DKWA 2GFUA 1M1KU 9ATCB 1JE8A 3JCMJ 3E5QA 3OYMA 5J3BA 4IIOA 3P9KA 5DCFA 2P6SA 1V1CA 4CCMA 2W85A 2COMA 1D0XA 2W4SA 3QJ6A 3LA2A 4NDLA 2LY9A 2X6WA 3K9TA 4XSZF 2A07F 4IHYA 2NRAC 3O8GA 1TTHB 5GAMf 2DVJA 4XLCA 3QZ9B 1UMQA 1J3TA 1M5Q1 4M75F 1ORKA 2ZJQF 1H3HA 1R77A 3P8DA 5GAMj 3VB2A 3I5SA 1KG1A 1WXBA 2Q2EB 2DMQA 1KC8R 4M73A 3E97A 1UELB 2X4HA 3H6ZA 5J47A 3JB9H 3SD4A 2XKOC 2DA9A 3VYHB 1IGUA 2VKEA 1YJ9A 3WTXC 1RUNA 2JT4A 3S2DJ 5GAN5 4XNFA 4C2UA 3L1PA 3ZBDA 2NS8A 3PO2J 2ZPGB 1FEXA 4MZMA 1M90R 2EQMA 1S7AA 5FFXA 1VQ8Q 4LK1F 3RMQA 4AT1B 1NYFA 5KYYB 3HHHA 2WADA 1Z3YA 1VQNQ 2QKMB 1X43A 2HVQA 1CQTA 5IAYA 1W2BS 5FD6A 1IO6A 3HSRA 4YFNF 3VS2A 5TISC 5DEQA 1XX5A 4O5VA 1Y96A 2HBWA 1U0JA 2FQ3A 4H4KC 4LDYA 5EG2A 3CXCS 3DBHB 2JVGA 2KDOA 2R7FA 4N9HA 2BE9B 3VV0A 6PAXA 1Q7YC 4LG0B 4G7HF 5DUKA 4BHBA 2RHZA 3HUGA 5FKMA 3RBBB 5GAOn 2KJBA 1TQMA 4Y28E 4RAZA 2X0LA 1L0OC 4KULA 3UWNA 1Y8RB 2L0KA 1WNLA 2EFPA 3QJYA 3JCMV 3IRQA 4UUTA 2Y90A 1GVJA 2R7DA 1IRFA 3G1OA 2D1VA 4XBFA 2R7WA 4AYBA 2IGKA 3R60A 3WTTC 2F5TX 1KD1R 2EPFA 2KIUA 5LGUA 1U1SA 1I5LA 3ZL7C 1NPPA 1WJBA 3H8ZA 4F7UF 4ZZDA 1REPC 3T8RA 1RQ6A 1SFEA 4N0BA 3QYHB 2RF0A 2QEXT 3ML6A 1QO0D 4JZ3A 3R6NA 5LGNA 3NQOA 2X4WA 4WTOB 2FMYA 3RPQA 1VQ5Q 4N9IA 4J9EA 5CJ9A 2MSYA 2NUZA 3QQAA 3M59A 2PMZA 2ELJA 3EQLF 3K6GA 3G7ZA 1AZEA 1MHNA 3HOUJ 2K85A 3SEZA 3ZCOA 1XQHA 2L3SA 4A69C 3DKMA 2ZC2A 1M2OA 5HODA 2ESNA 1YS7A 5L8RE 2XPWA 2ZJPF 4PJJA 2KZVA 1ZGAA 2FO0A 1U3OA 4UV8A 5D6FA 1SAXA 2XHKA 2XHCA 3LSMA 2L8DA 3OS1A 4KT5C 2BUDA 5E8IA 2L3PA 1F4KA 3K4NA 4KYWA 3I59A 2MF2A 3FF5A 4J6XA 1D1AA 1P4WA 2X35A 2DMUA 4C0FA 4DJAA 2WSCE 1QZYA 3M07A 4RLQA 1HK9A 4NS5A 4HG2A 4KN7X 1AWXA 2COYA 4D6WA 2VKHA 1U3EM 3H9NA 2XAJA 1ETQA 4CC2A 3FM3A 1VQMQ 3ECOA 1M1GA 3OS5A 2AT1B 3FBIB 3LSHA 3I54A 2IEKA 1B3QA 3UF4A 1JU5C 1VYTA 3ZQLA 5C4XJ 1WQWA 2XDDA 5F6FA 4D8KA 3TO6A 1O57A 3DEEA 4W97A 1QNTA 2ECCA 1D0ZA 1W5SA 1OYYA 1JRIA 2ATCB 2RPNA 1G3SA 2VOPA 4HOBA 4YELA 4E7KA 2QUFA 1ITYA 3FDRA 1G59A 2CUZA 4HT8A 1FYKA 1S8NA 3R0AA 4M7DC 1WYXA 2FEIA 2BGCA 5EGOB 1R1VA 4PJLA 3M3YJ 3RTRA 4K11A 4JOMA 2A69F 3VYUB 1RIOH 3OYKA 4XSXF 1BI2A 1K7AA 4RS8A 1VQNI 3ESWB 3Q0WA 2X1DA 2MUNA 1SKUB 3BY7A 4AU7A 1VYVA 3QDFA 1BL0A 2DYSH 2X85A 2JA7J 5LJ3f 5JFRA 2W82A 5CQGA 4E7JA 5A0GA 5E8GA 3V8KA 3MKWB 3EG1A 2W24A 3TO7A 5HS8A 1QCOA 3U2RA 5HDKA 1RAFB 4HF1A 4AG1C 2VKDA 5LJ3j 3RZDJ 3WG7H 1EA3A 3JAMK 1ZUKA 5IP9J 4HX8A 1TXQA 1R1UA 1SFKA 2KT0A 5C0MA 3VS0A 2XDPA 2DJZA 3EGXA 3IUOA 2LX7A 1P4AA 2OU2A 4KMFA 1LE8B 4RBOA 1SFOJ 5GAN7 1VF9A 2PJPA 4XLAA 4NBQA 3C18A 3DV8A 1YWPA 2JMAA 1HJDA 2IGOA 3LSRA 1RAEB 2RQRA 3I64A 1NG2A 5LBQA 2DMTA 1YIJT 1A6QA 4FISA 1K6YA 4RB0A 2WB1A 4EMHA 3CQTA 2XK0A 1YX3A 2DO7A 3S2WA 3CMAT 4M77A 3VYGA 2ZCWA 3L7WA 8AT1B 2X6YA 1IV8A 3QU6A 2UZKA 2YX4A 3C2HA 3LSPA 4RTWA 4LLGF 4QPOA 5FKKA 2HXOA 1VQ5I 2JK3A 3IAM2 5B3SH 4BDYA 1HKSA 1W1FA 2CGHA 1I1GA 5KYUA 3K4JA 3G4ST 1FX7A 3BZCA 4M9SA 1IXRC 1I50J 4BQOA 2B9SA 1LVAA 1J5YA 5GP9A 2DIQA 2HDAA 4RM2A 2DVEA 4CH7A 3N97A 4FCYA 2L2OA 4HNTA 3FB9A 4CSWA 5E3OA 1Q95G 4OMOA 4EMKA 3GPLA 5GJVB 1OU9A 4Y4RA 3M8JA 1YRNB 1HOMA 3CCJT 1UCRA 1HSTA 3HPWA 2FG0A 7AT1B 5J26A 1ZRDA 4C92E 2EV5A 3G1MA 4C0GA 3F8BA 4KITB 2R92J 3SQNA 3A01A 3TVTA 4F7UA 3F6OA 5HLHA 3V8LA 1TS9A 3JRBA 3SWNC 4Y91A 4ZYHA 1FNNA 2EIFA 2QQ8A 2LTPA 3C2BA 4CRIA 3KYCB 1N25A 2O8KA 3OIQA 2IPOB 2EFIA 3F22A 3LYIA 2MCNA 4GRIA 3JAMZ 3C7JA 1KHCA 1J09A 2OAZA 1VQ6Q 1QPIA 5GAGJ 3BCBA 2V8JA 2CO5A 5FRMA 1YITQ 1PUFA 3PM1A 1IV6A 1X2NA 3ZN0A 4FE7A 3ZQFA 1F5TA 4QQGA 4Y33A 5FU6C 1X4OA 1QVGS 3M5AA 2GWRA 2KKOA 1HC8A 2YUQA 4JJDA 1WJSA 3G71T 2E19A 1U5TC 5L3CA 2F1LA 4ITVA 3EDPA 4DGWB 2GNCA 5D6EA 2IGNA 2JS0A 1ZR4A 5KCOA 4BXXJ 4IEJA 1TNSA 3VS1A 3VUBA 2PVDB 1HDDC 3QWLA 4HPQA 3PSFA 3LFKA 1RL2A 5GAN4 1BOAA 2E1OA 2F5CA 3G73A 4FIBA 1WJDA 2DDAA 5DD4A 3UNGC 4EJOA 1ZRFA 1UJYA 3CXCA 2E41A 2KROA 3DPTA 1M1KR 1O3TA 3QODA 1QHGA 2LKXA 2VC1A 1X4PA 3VU3C 2QLZA 1RKWA 2YUOA 2P5LC 4JX4A 3RDIA 3BR0A 4HW0A 1M2VA 3CCEQ 2YSRA 1S72A 4RB1A 1FWZA 2HQEA 2FZKB 1PP7U 5DCMA 2XAFA 4AIJA 3TSZA 4LK0F 3CDIA 4NC7A 4C2TA 1IN5A 4Q4ZF 5GAHJ 2DFUA 1MBJA 2EINH 4EJTA 2P6TA 2M9UA 4NQWA 1B34B 2DD5A 4A4EA 3FXJA 1U1TA 2OZUA 1QVFP 5I11A 1BJZA 1EKEA 1JB0E 5IPAA 2UWMA 2BZYA 3HRSA 4CZCA 4C8QE 2PLYA 2RJDA 4MHGA 4M7AE 4XR6A 5GMKe 3CMET 2A3LA 3X28B 5KYNA 2YS9A 4GXOA 5IT9K 3GP8A 4BQNA 2MFZA 2KRSA 2OX7A 5LJ5g 2K3PA 1BI1A 2MW8A 1GT0C 2JMCA 1A31A 2H8WA 4II1A 4OAZA 1ERDA 4XKVA 2ZKZA 1MSFC 3FISA 3U21A 3TQ7P 4MLOA 4CXFA 2FBKA 3SWNB 3ZXSA 5M5WJ 2ZPBB 1UTIA 2KEAA 2O5RA 4GYGA 2DTRA 4XRSG 1FBUA 3BR1A 3F8MA 3H9JA 4V2FA 4C92C 4CC4B 2JWTA 3O6BB 2LREA 4FT2A 3CUOA 3DF8A 1UB9A 2ISYA 3SFIA 5K5RA 4D9JA 3J80R 1NZ9A 1RABB 2PQWA 1T2KA 1LCKA 1D8KA 1JXMA 1JJ2P 1DGWY 2OUMA 3AG3H 3PJRA 2W84A 3DEWA 2BW3A 3AG4H 2JPCA 2VVKA 3S3NA 5FU6B 1QQJA 3HL8A 3I55T 1U5TB 3TP0A 1W70A 5KYWA 2LQ8A 1USSA 2G7HA 2KGTA 2EKOA 4GBQA 1VQKT 2BOLA 2VGMA 3K4CA 4IRGA 4BUPA 4XRFA 3M53A 4XOTA 1A0NB 2LX9A 2QQ9A 4B9WA 3M4GA 4QVDA 1MBEA 3AKZA 2UXXA 2QQRA 4MZPA 2B86A 1ZK8A 1TWAJ 1NHAA 2CP7A 4JRKA 2QQAA 5GANg 3EFOB 1BC7C 4A3GJ 1XN7A 3HYIA 2MD0A 2JT1A 1I6XA 1UEBA 2RHIA 3WU0A 5HLGA 2HQXA 1E3HA 2HI3A 4UVCA 1VQMA 4J83A 2HDCA 2M0CA 1KZHA 1MGTA 3H3ZA 4M77G 1YITI 1PD0A 3CLOA 5IT9Z 2R5MA 3KLNA 1H0MA 5GAMh 1LPQA 1Z9ZA 4XK8E 5HY6A 2C06A 3KP6A 4ELYC 5EYRA 5DM6F 4KH0B 3BCAA 5DDGA 2E7XA 4FETA 1U9NA 2BE7D 3PFIA 1QCFA 4E70A 1IN4A 4HV6A 2V6CA 3TOBA 1KQ1A 2HXIA 1JKOC 3RYPA 2HEOA 1B6AA 4GFBA 1FJLA 3TSWA 3A8MB 2KFDA 4FYVB 3CCLQ 5FLXR 1R8OB 3JTHA 4AIDA 3J7YJ 1IF1A 4Z8AA 4D7MA 2EVRA 2FPEA 2QG9B 2JTEA 5KE3A 1QBJA 4Q5WA 5LJ5f 1HW5A 1ON2A 2OQRA 1VZ0A 2MGQA 4XN3A 2DA1A 3W2WA 2LR8A 2EV6A 4EGZA 2P0KA 3UATA 5E3MA 2DEUA 2FVUA 3CCEI 5LJ5j 3RYRA 2PG4A 1KSWA 1ZQ1A 4BY6C 4C92B 3SEMA 2XASA 2BKDN 4L59A 3RQIA 5J1RA 1FLIA 4E47A 3EUHA 3JAME 3I56T 5CKDA 4WF2A 4JLGA 4ELZC 1VQPA 3OMGA 3ABMH 3JCMP 2STWA 5GAOm 2K7AA 1MMAA 4UVBA 1FMVA 2WBMA 1M3CA 2EBIA 4C3HJ 3NTHA 2OJED 1FMKA 4QVCA 2BXYA 2H1KA 2YHTA 4F17A 3HOWJ 3S1MJ 2EQIA 2XB0X 1WZ2A 1R58A 5GAN8 5BOXA 2OTLQ 4F92B 4I01A 2H8HA 3U9GA 1I07A 2IBDA 2XGDA 2EW3A 2JNGA 4OMPA 3CCST 1QVFA 3IH4A 3KX2A 5DLQE 2KJCA 1RI7A 4E7ZA 4ZN3A 1I1SA 1TSFA 1YTYA 4NC8A 4XQ3A 1NYGA 3X24B 4UUVA 3BTIA 1NJIC 4XN0A 4ON0A 1GXPA 3CC2Q 2P0QA 3QOEA 4JX6A 4C5HA 2DTHA 1ETVA 1R0CB 3WGGA 2R7VA 4LXCA 2K4JA 2R5YB 5GTHC 4KJZA 1XPXA 3FMQA 3R4KA 2AQFA 1GV5A 2JJ7A 3F23A 4G7OF 2Z1DA 2QDLA 1XJWB 2ZMEC 3HP9A 4N4HA 1VQ9A 2NS0A 3OYIA 4B43A 2DMNA 1JKRC 3LQQA 1BC8C 2OJ2A 5GANf 4WXCA 4DYQA 3I9V2 5IOZA 2HOTA 2PJRB 2IVMA 2CZ1B 3MD2A 4CYDA 2FBIA 1X2KA 1G2HA 5GANj 2WAEA 1FC3A 1YW8A 5K5QA 2D5VA 1YFNA 4IKFA 3KLOA 4Y3OA 3PFSA 1JTYA 1APLC 2DA2A 3ZPLA 5FRNA 3FHZA 2VJ5A 2AXLA 3E6BA 2RNGA 5JHFA 4KT6A 3HGYA 1TLHB 4RGUA 1K4SA 2E2HJ 3J7AW 1D3BB 4XM3A 2FL7A 3DLAA 1ABQA 5BPDA 3CCYA 2EZHA 1YJ9T 1MJAA 3FXKA 5IT3A 4FL6A 4LDXA 3BZ6A 3Q9SA 1UG2A 3WTWC 4N4IA 4IQ4A 1N8RU 3LA7A 3AG2H 1W1WE 3GFMA 2Q2EA 5F1JA 3MZHA 2YPRA 3I4NJ 5E1WA 2FRWA 3JREA 4A3EJ 4G8XA 5IXFA 4HBLA 3KXTA 2CFXA 2M1BA 4II2A 2RI5A 1W7PB 1Q86C 1VQ6A 2GFAA 2VXDA 2Y48A 2RAEA 3K4LA 2CUJA 2DBKA 2XI9A 4BY6B 5EJCA 1W0TA 4HA8A 4EM0B 4JQFA 2PFBA 4XTVA 4WX9A 3NHNA 1UG0A 1MDMB 2NS7A 2R5ZB 3HSEA 3K2ZA 2O8XA 4HX7A 2DXBA 2ETHA 2LP5A 5KYYA 4MZTA 4M7DE 2XF6A 1UGRB 4PJOC 2COBA 3BWGA 2FHDA 4MTEA 4GLKA 4OB3B 4EM1A 3CUQC 2PVOB 1PSFA 3CCLI 2M5WA 4DOVA 2DDBA 2BIVA 2YUNA 2CQKA 3C4SA 2DU9A 4ZGEB 5L3FA 3Q0VA 1SHFA 3M55A 1AKHB 2A6TA 2LDUA 4JX5A 4KIFA 4LG0A 1EIFA 2M51A 3MKDA 4F52A 2BEOA 2E71A 3FKJA 1AHJB 2CZ6B 2P84A 4ZYGA 3G1JA 4RTYA 2OCEA 3CCEA 1XGSA 1PC0A 4KN4X 1NJIR 3VS3A 2FSWA 1X1BA 2NUPB 2VI6A 2E36A 4V2GA 1V29B 3CC7Q 4DOZA 4A93J 1YX5A 2A5YB 2ZMEB 4HDVA 3JCMd 2EGCA 2HGCA 3DB4A 4RB3C 4F91B 2QQSA 3EFRA 4H0EA 1KONA 3J7AO 5IT9E 2W25A 4QW2A 1LDKB 4ZYDA 4OOIA 1VA7A 1VQ8A 5LJ3h 1N77A 2OTLI 1RR8C 3EG2A 3M54A 1QVUA 1ZBXA 2VKNA 2ACJA 2F48A 4RGRA 2W1OA 4XLHA 4ZC3A 2IG0A 4JS5A 3FXRA 3HOZJ 4OGEA 5EDNA 3CC2I 1QCNA 2ROLA 3JCMh 3FXMA 2LRQA 4BACA 1OFCX 4ZTFA 2O4XB 1Z1DA 1B8IB 3EAEA 4JP0A 4BI4A 3RKXA 2JS2A 3G6EA 2E3IA 2BY3A 3SEQA 3JCMb 3IP4B 2L89A 2CW7A 2RNAA 4HCBA 3KZYA 3BDDA 4JYKA 4A12A 4XU1A 1Q86R 1OYIA 2Z0WA 1CKBA 2YU9J 1B4AA 1R0BG 1JXOA 4I7HA 1HSJA 2K3YA 1WI9A 5GJWB 3T5XA 4OMLA 1XDUA 5KAIC 1XNIA 4PJOB 3K4BA 2JRMA 3AFHA 1ETKA 3DKYA 2KIFA 2V1NA 3CUQB 3CO6C 4XKWA 1LFUP 4LLNA 2DAOA 4IIMA 1M30A 2MA3A 4HSTA 2Y75A 2V9KA 2VUBA 2HOSA 2JVHA 2A61A 5ICEA 3ZGKA 2NLUA 2HPIA 4NUBA 3W3CA 2E1NA 4IUUA 2LMDA 2E1CA 1GL5A 1OV3A 4F55A 3BJOA 3IC7A 2CSQA 3TKYA 4IRIA 4LD5A 5DM7R 3UT1A 2XC7A 5GAN2 4HV5A 1Y1VJ 1FP1D 3DQVC 1C1AA 2LJ3A 4PJNA 3S32A 1X1CA 3WVEB 2IPQX 2CH4A 3BTLA 2CSOA 3MEUA 2DL7A 1IZ6A 3CCLA 3TOAA 2RDPA 5J4YA 2DJIA 3ZQCA 4K2EA 2DL8A 2LLKA 4UNOA 2E12A 2V9PA 3DPLC 4ZDPA 1TUGB 2EQJA 1T6SA 3L1AA 2QVOA 5B1AH 1XTDA 1JBMA 2ZPFB 4QT7A 1VQOQ 3OOPA 4RAGA 4XTZA 5L3BA 2GQQA 2TDXA 1JKQC 4OINF 4IHXA 3R61A 5K7HA 1X6OA 2XSDC 2ZB9A 4M6XA 3HDDA 4C92D 3CC7I 3HB9A 1OZ3A 3MAJA 5H6QA 4BBRJ 1LE8A 2CKKA 2JM8A 1PKSA 2BXZA 2CUDA 3DCFA 6AT1B 1YJWA 2Y4YA 2KRHA 2JA2A 2E2IJ 1WI3A 4FYWB 1T33A 1SVOA 2E60A 3BT9A 5KH6A 1Z67A 3W6JB 2KIQA 3WG9A 3A52A 1RR7A 1YJ9I 3KP7A 1QKWA 1MZBA 3MZYA 3FMRA 1D09B 2KISA 1ETWA 4C5IA 5KCHA 5GAOr 3GBGA 3CC2A 2RNJA 2V1QA 2PNIA 1R9TJ 2OPTA 2X48A 3G3ZA 5A2QK 5CVIA 3WTVC 2BYVE 2HKXA 3REOA 3WGIA 2FX0A 3F21A 2CT3A 4JRIA 5FD5A 1M9SA 2GOXB 4JK1X 3VODA 2AZSA 1ZG5A 3S1QJ 1OPKA 3OYEA 1CKAA 2KE9A 1VQLQ 3JRZA 1YWOA 1VIFA 3LSGA 2RA2A 2RJCA 2MBFA 4J9FA 3VKIA 1WGXA 1SG5A 3FLGA 5ILSA 1S7EA 5TRDA 3VJPA 4A3CJ 1QLYA 1M1KC 3TP3A 3BTCA 5HK3A 2X4YA 2GBYA 2HKOA 1UHFA 1WJFA 1AVZC 4C8QC 4M7AC 5FKLA 4XL9A 1NH3A 4IJAA 4BUGA 5J40A 3RKQA 2AHQA 3DXJF 4IVNA 4Q47A 3V7CA 1WSUA 2Y9YA 5LD2C 4L9JA 1TT0A 2KQRA 1VQNT 1ZHFA 2MYSA 5K7ZA 1OR7A 3I71A 3E6CC 2HKNA 3ABTA 2BY2A 1W7PD 2WTEA 2HQRA 2YRVA 4ZGDB 2GXBA 2DT5A 1JO8A 2BHYA 2JRTA 5EG0B 1T39A 4IHWA 2IA2A 3K1MA 2I2LA 2KBTA 4C3JJ 2FRHA 1QWEA 1I3QJ 1TWGJ 1TC3C 4RLFA 1PRLC 4IHVA 3F8CA 4M78E 3JSCA 2QF7A 1WGSA 5JR3A 2Y30A 3HG9A 3K4MA 4XAXB 3SHWA 1ACIA 4X6AJ 5EZHA 3GW2A 4E7HA 2DK8A 5A2QZ 2VPLA 2CP2A 5HCKA 2EYWA 2W48A 2EQRA 2WAFA 2JQ7A 1E6GA 1WFWA 3BR2A 4D5CA 2BY1A 1VQOI 4UB6C 1B34A 2HYGD 2HKQB 4NL3A 5KVRA 1XS9A 4HLYA 3FXUA 3P5JA 1HQCA 2EB7A 3J7ZI 3BJ6A 1HYOA 1Y7XA 2ABLA 5CAIA 4M75E 4MQVA 1D5VA 3EGDB 3CC7A 3E5XA 5B5EC 1UE9A 2DI3A 2NWMA 2WC2A 2DPDA 1EH6A 1U2WA 2LG4A 4HNVA 5LJ5h 2VBZA 2KDSA 3C95A 2K3FA 4XMYA 1UECA 1VQ5T 2VQCA 2LSOA 4C9YA 2LQKA 1G4DA 4AMCA 4N4OB 4MQ9F 4YIFA 1FMWA 4KBMB 1YN8A 1O7LA 2BTTA 2P4WA 4KDPA 4TVRA 3SWNA 3F3XA 1G3WA 2DTZA 4X1EA 2KY9A 4A63B 5E1ZB 4KGVB 2K9NA 4NC6A 2RHXA 4A0XA 1WJAA 2D9TA 2ENMA 1ZRCA 3INZA 5D8LB 3DTKA 2GQIA 2MZ4A 1EFNA 2ESHA 2K27A 1T3SA 2KMTA 2QYOA 2L2PA 4HLXA 4A3JJ 1LNXA 4M7AB 4C8QB 4F04B 4J00A 3FK7A 1WHKA 2CV0A 1E6HA 2E6NA 1R49A 1A5JA 2DA5A 3FXOA 2QAZA 1BA5A 3PE0A 1TG0A 3PNYA 2HBPA 1H8AC 3GTJJ 1U5TA 2DW4A 4L9NA 4M77F 2XRNA 1JUPA 1PD1A 4L5JA 3HKZN 2VKVA 1YFHA 1ZKGA 1S72Q 5ILVA 3CD6Q 1SD6A 2ZAEA 3RMSA 2QKLB 3M1CA 2QENA 4ZYAA 2M2EA 1LFPA 1C6VX 1VQLI 1R5ID 5CPRB 1EZZB 4WCIA 1VQMT 3MP1A 1T3LA 5EEHA 1UZCA 2CUFA 3PL8A 4O3MA 1B9MA 3PO3J 5GANh 3UPUA 3ER0A 4M6YA 3C12A 4OMQA 2WV1A 3EFOA 5CYVA 3K7AJ 2AIRB 2MIOA 1R1TA 3ZMVA 3MFKA 1TWFJ 5L3DA 4YFXF 1Z91A 2FZCB 5DD8A 1JHHA 4EM2A 2RHUA 4GYIA 3LH5A 2RGVA 1UFFA 3E9GA 4I0AA 4U87A 4PLLA 2JJ9A 2F5EA 2UUZA 3OV8A 2X3XD 4S04A 4BBSJ 2F69A 3CPWP 1S6LA 1KYWA 1UDLA 2JXBA 2YSQA 1FP2A 2DA7A 1W4MA 3HRUA 3TW6A 4G7ZF 2PUOB 4RMOA 2JA5J 3W6KB 1ZR2A 4PJOE 1Y56A 1JKPC 3DPUA 4KGXB 5E3NA 3LX7A 2ED0A 2H94A 1I4K1 1BIBA 2L3DA 2ME6A 1WH7A 1WKMA 1TUCA 1WX6A 2LZ6B 2HSEB 1VQ4Q 3HL2A 1D0YA 4QWQA 2J6KA 5H6RA 3RKWA 2RB6A 2VWFA 2YDLA 5L3GA 1XB4A 3KYLA 2O2OA 2R58A 3QIIA 1WRJA 4ESFA 2LCSA 1YYVA 3E19A 4C92A 3HFOA 2OCCH 2P7VB 1VQOA 3BE3A 2Z5UA 4WCGA 4UUSB 2GAUA 2K5CA 3H36A 4G94A 3GNFB 3I4MJ 2CRGA 2P8TA 2DQLA 4PCQA 4EEFG 1WDXA 3MEAA 3IKVA 1POGA 4LIVA 1X6BA 1R22A 1V5GA 4I98B 4HT9A 2O7OA 5F1RA 5GPCA 3IKTA 1MBGA 4AIHA 1I27A 1KU7A 2COZA 2SEMA 5KYXB 2YX7A 2FB7A 2E4HA 2FJ1A 5JVTA 3OW2P 3PUFA 1YW7A 3A1PA 1Y71A 1ZBJA 4FHTA 2F5KA 1PUEE 2ELKA 2HTSA 1JHFA 1VYUA 2VQGA 2O6GE 1OCOH 1Y07A 1N5ZA 2M4GA 3OYBA 1SD7A 1LPLA 4JUVA 2R5YA 3HOVJ 5C4JJ 4LDVA 4RGSA 2DJNA 2RQQA 3CDHA 3E5UA 5HNHA 2IXSA 1RETA 3OYDA 3BR6A 2XAHA 5GAEJ 3QP6A 4L0YB 3HKSA 4JJNK 4M74A 2O31A 5A2QE 4OMYA 3OR1C 4XRSA 2PJRA 3JAMR 2HOAA 3SFZA 2HQHA 4D8DA 1MD0A 4P96A 2H3EB 3SB2A 1VQ8I 2YU3A 1W4SA 4M3FA 3QWYA 2JZYA 1TWBA 2VJIA 1M8VA 2DO3A 1DU0A 4QKUA 4Z88A 1IZ1A 2DL5A 2DK3A 2PVGB 4N0AC 3CCVA 1D3BA 1FYLA 3CD6I 1XOVA 3ASNH 1S72I 1MV3A 2ED1A 3NFCA 2JTFA 1VQLA 1VQ6T 4CICA 1VQPQ 4G12A 5IOYA 1YCYA 1YITT 3CCQQ 2E35A 5IY5H 5K7FA 3CP2A 2D1XA 1V55H 3LW5E 3OSVA 3MQ0A 2DX1A 3TEEA 3LFUA 1PWTA 2P4RA 2NUTB 2HYJA 2QSHX 4EDUA 5H20A 4BNCA 1W7PA 3KEYA 3W2VA 4PKCC 2JZ2A 1SFXA 2QTXA 2EZIA 1P7IA 2EFNA 2VXEA 1O75A 4IPAA 2A0FB 3HHGA 2F2XA 3CCRQ 5EEGA 2NNNA 2LY1A 1X01A 2K9GA 2LC4A 3I35A 3TDZC 3OBYA 3QKJA 4DEXA 2LDMA 3SXYA 1QVFS 2CG4A 2HQNA 4GGGA 1TW3A 1ZSZC 5CIUA 3TMOA 2DT6A 2R93J 2QXFA 1X3UA 2XGCA 4P55A 5CKHA 1OQKA 3CCET 1YIOA 3D5RC 2CDTA 1MMGA 2LK2A 5F0CA 1ZG1A 3J7AY 5F0HA 1UHCA 1MJ9A 3O8HA 4VUBA 3TW7A 1B9NA 1OPLA 2M02A 3JTGA 4PL6A 3CPWA 4P9UA 3DTIA 4EJVA 1VQ4I 1WHJA 1TP4A 1OJLA 2R4GA 1HCRA 3IH2A 5LHHA 2H6CA 2ECZA 1ZSGA 2QQBA 1FPQA 5GMKm 3HTSB 1W36D 1LEAA 4B8XA 1X3ZB 2DRKA 3DU6A 1T0FC 3H5NA 1K73U 4LUEA 3FK6A 2ZMEA 5ICGA 3A5ZB 4G9YA 2YXYA 3GCMA 1AU7A 1GFCA 3Q3SA 2CQ7A 1WHMA 1X1PA 4RTXA 2ZJRF 4M7DB 4GCVA 2C0OA 1JJ2S 4IUPA 4L0ZB 1YNZA 2KT1A 2R7UA 5DTDA 1N27A 4OGCA 1YHQQ 3HSBA 2MD5A 2EBPA 3R6OA 2HVRA 2BE5F 3J81K 2A37A 2EA2A 5AYFA 4LB6B 1VQMI 1RZ4A 1TBXA 2ICWG 1K76A 3Q0UA 2R7RA 2A3SA 3DFGA 3OYJA 2XIGA 3HKZA 1B8IA 5LRRA 1ZREA 3TEDA 2O4XA 2PTKA 4GDFA 5CVUA 4CGZA 3OW2A 2TCTA 3CC4Q 2DXIA 3IWZA 3LAJA 3MEXA 2QGFB 5I21A 4FX4A 1FOYA 3ONQA 4NNJA 4U88A 1YO5C 1HBXG 1J75A 1WHGA 2IVWA 4BY7J 4CZZA 3UDCA 2KYBA 4C8QD 4C92G 4M7AD 4BYYA 4PSWA 1MNMC 3GYHX 3ZQIA 1WHUA 5IT9R 2EIJH 5LLQA 1USTA 1X58A 1IN6A 4LNPA 3CD6A 1ZSZB 4P5NA 1JQQA 3GTOJ 3HIFA 4X34A 4IUVA 5FWCA 1BKBA 4MEYF 4FSSA 2C0IA 1R5GA 4A4HA 3CUQA 3I4PA 2DOFA 2HTJA 4Q48A 2JA8J 1VQPI 2E5KA 3H35A 4BE1A 2L5QA 5D8KB 4KIBA 2JM9A 1UFMA 3CCQI 3BP8A 1DU6A 4C5EA 3O8VA 2H3JA 3L2ZA 5FWBA 4I0BA 3WODF 2DAQA 4HNUA 4MFEA 4QVZA 1YJNA 3WE2A 1M1EB 3E0JB 4Z2YA 2V4JC 4EATA 1DP7P 2J05A 3JCMQ 2XVCA 3ASOH 4RTUA 3S1NJ 3CCLT 3P9IA 1XGMA 2CWEA 4KA4A 2CH0A 2K9QA 3EETA 5CCAA 3EYIA 3LGFA 1D3YA 3NARA 1XC5A 3M1EA 3ZMDA 4DZPA 3J81Z 1ZN2A 1GDTA 3WHBA 2XGEA 4PGGA 2LF7A 4I09A 1D5YA 4LD6A 2MK5A 3IL2A 3NGPA 3BG5A 3QAHA 2IT0A 3V7SA 2K79A 2ZPEB 2C0TA 4HZFA 3RPUD 5KK1A 3ABUA 2CT4A 1YI2Q 2K4BA 2F5FA 1VQ9I 3G6EQ 2XIDA 4RCBA 3OL3A 1C0MA 2Y0MA 2AKKA 2DETA 1OCZH 1JJ8C 2Q1ZB 3CCJQ 1VQ4A 1H3ZA 5FKOA 1BM9A 4C8QF 2XAGA 2LQNA 2VPRA 2Y0SN 3HSFA 1BOBA 2H1LA 3MZ8A 2NVXJ 2Y31A 5FFZA 3OYFA 3A8HB 1P2FA 3FRNA 1W5TA 4C0DC 1S7OA 2OTLT 2XPVA 1J59A 2R7ZJ 3VRYA 4X9DA 4KRTA 2QZ8A 3RCOA 3JRDA 2JMWA 4HVUA 2GCXA 2VBYA 3S17J 5GAMd 2OF7A 4XONA 1T0JA 2HAXA 3A0BC 4OU0A 2GBQA 2EZKA 5HNFA 1X27A 3JV3A 3RR6A 3CC2T 5LGTA 1LFBA 3A1YA 1HF0A 4M71A 1X6GA 3QUIA 1FSEA 4M3BA 1U5SA 2JSPA 1YHQI 3G71Q 4DBQA 1ZUUA 3K1NA 3ROUA 2DN0A 2PBIA 1VQ6I 2DT7B 2MG4A 4A53A 2GIVA 2MH2A 1BU1A 2VONA 3NAUA 2RM4A 3FM5A 2AXTC 3A0HC 4I99C 2JUGA 4MGRA 5M3FJ 1NEGA 4EV0A 2QYZA 2GXAA 2XG8D 4PNOA 4BJTA 4I2OA 2HCKA 2VXFA 1XDSA 3D5SC 5CLSA 5HKCA 4DEYA 2LP0A 4RCCA 4IUQA 3WTSC 1H92A 2A5WA 4M78C 5CQYA 1R23A 3GZ5A 2L9RA 4CCKA 1ETYA 4YG2F 3BR5A 4YIRX 2QCOA 2VJ4A 1T38A 3M0RA 4RG2A 3H92A 1PNJA 4HCKA 3WGHA 1VOMA 3JRGA 1QA6A 4JJCA 2FA5A 2ZFWA 2AZVA 1OCRH 1ZGWA 3ZP5A 2ZNYA 1RADB 2JTMA 1G3TA 2K9SA 3LSTA 2DFEA 2LBFB 2LKPA 3MWMA 1OX9A 4PJMA 2WWYA 2D8JA 3EG9A 3NTKA 3DB3A 3OQ5A 2LNBA 1H9GA 2HMAA 2A6HF 2RV8A 1SPKA 4KISA 5DLOA 3CCQA 2PUKB 2B7EA 4M75C 5L3EA 5JVGF 3HHTB 1IRZA 3KCCA 3LAPA 3M0QA 4JLIA 1Y1WJ 4KUMA 2HZYA 3GZNB 1YJWQ 4LUDA 3OSFA 1WWXA 1Z05A 2LRDA 2DA3A 4C0DB 4PFPA 4MMLA 5CQXA 3HFNA 4ORZA 2BZTA 1N8RC 4M9ZA 1LUJB 2P0TA 1W5CC 2PMUA 5D4RA 1M8MA 3CCRA 2LJ0A 2DYIA 4BHPA 2E5ZA 1RACB 5EG0A 4B1RA 4G6DA 2LYCA 4AWXB 1QQIA 4E4HA 1P92A 3CCMQ 3S2HJ 3W2AA 1DJ7B 3QYFA 1GCPA 3L42A 4IURA 1SANA 3M58A 4BU2A 4TV7A 3JRHA 4MDWA 1QZZA 2O03A 3E3VA 2LTOA 1KQ0A 2O9LA 2X3WD 5D6YA 3S93A 1AD5A 1NK2P 2XKPA 3CC7T 1YI2I 2HR3A 3I55Q 1BN5A 3G6EI 2VT2A 4BJ5C 2DD4A 2R7QA 2G9WA 3VS4A 1QPMA 5L23A 3ABLH 1A6IA 3B6CA 2XPUA 2CV2A 1V76A 2K57A 2VBXA 4OB0B 4ZNXA 4OVAA 4M72A 1D1CA 4PJOG 4AFUC 1S3JA 3GIBA 4DQ2A 1GXQA 3F70A 3IAS2 4RTTA 4AFSC 2NOJB 1NG7A 3MMYB 4PDKA 1XCVA 1K78B 2SRCA 1JJ2A 4AIKA 2KRFA 4XLPF 2L7ZA 4CI0C 1KQSP 3TGNA 1OYWA 1FOKA 1AWCA 3RZOJ 1NG6A 2KT8A 2M0YA 2MI6A 3PIPA 5EZGA 2G7UA 3RSNA 4N4NB 3RI4A 4M78B 2A68F 2K5LA 2F4MB 1KFZA 1VI0A 4LDWA 3CCUQ 4M7DD 4RGXA 2CZ7B 2LVSA 4C5GA 4XU2A 2E1MC 4HVWA 2O9VA 3J81E 4L9VA 1YHQA 1A04A 1KQ8A 2CSIA 2KR3A 5FU7C 2IRFG 1FTZA 2ISZA 3CD6T 3GUDA 2M35A 3SFMA 1QU3A 5ECAA 2DERA 1WJ5A 3T0YA 4C8QA 3D0SA 4M7AA 1TWCJ 4Y15A 3DBLB 4A0YA 4M75B 2CU7A 3A2KA 1HLVA 4EIKA 2LH9A 5IHKA 5GMKi 1DQUA 2Y2ZA 2D0QB 3H0HA 1WPKA 2CQXA 2L7MP 4ETSA 3OS0A 3OYNA 1SSFA 2DL3A 1J0RA 1JUMA 3BW1A 4UC4A 1N6AA 3BZKA 1OCTC 2KMUA 2Z99A 3BROA 3F0CA 3GTKJ 2X98A 5LJ3d 1X69A 3LWFA 4XIDA 2RQUA 3TCJA 5LHGA 2STTA 4KT0E 3FBNB 1IDZA 1UUEA 3I56Q 3CJTB 5AT1B 3GWZA 1N8RR 4J6YA 3E1SA 4LG3A 4KFCA 8ATCB 4PUSA 4ESJA 1NM7A 2W10A 3GBQA 4OB1B 5IH2A 2E6ZA 2GGRA 2E2JJ 1S5LC 4S05A 3LH0A 2QM3A 5F08A 1K9AA 2KRMA 2OTJQ 1AOYA 3MO8A 2LC2A 3JB9G 1MJBA 3BTJA 3DEUA 2GOMA 2EQUA 1EF4A 2ADUA 4RA2A 2IW5A 1IRXA 3PFYA 2IS2A 3EH1A 3JRAA 5KYUB 1I1JA 1ETXA 4M7DF 1YIJA 5GAMe 1YJWI 4LB5A 2A28A 2R3SA 3VEPA 2F4OB 2Q0OA 1EV7A 2R7SA 2R7OA 2ZXHA 3S8PA 3OY9A 1UAAA 4J6WA 3JCMX 3RPUA 4C2MJ 3CMAA 3RIRA 3OIPA 3QYGB 3GTQJ 2Z9OA 3S3OA 3C2GA 3PUBA 2Y0SA 2JPBA 1BB9A 4J9GA 1KK7A 2FQ4A 4OP0A 2D6FA 1TWHJ 3BG7A 1VQOT 5C6SA 1X1AA 5IP7J 1H88C 3FZVA 3M4OJ 1RAGB 1YQAA 2DIGA 3HBLA 3SHFA 4JPBW 5GMKj 3HOXJ 2E1MB 4I6ZA 4ENKA 1I6HJ 4B48A 2MWPA 4F7UB 4BH9A 1MGQA 1DDNA 2XKOA 3QYBA 1YI2A 3DP7A 2GA2A 4XU0A 5FU7B 1GXIE 4ZH4F 4L5IA 1WJRA 3AT1B 3CCJA 1AHDP 2BVMA 5HOOA 1IG7A 4OIOF 5FROA 2YT6A 4C0ZA 2K2VA 1K9MU 2HFHA 3BDUA 3DWLE 1UG1A 2YLCA 4LN2A 1NK3P 1WIEA 3VYTB 2MABA 3QPSA 5J1UA 4CC7A 5BPIA 2V1DA 4BGDA 4ZTJA 3EGUA 5KYXA 4LD9K 2ID6A 3I53A 3L2RA 1ZA1B 2ZGWA 3QWXX 2M7AA 4PZJA 1XGOA 2KI7A 5BQTA 2VC0A 4D7NA 1HSQA 5ED4A 4Y92A 3NRVA 3SDBA 3GTGJ 1KHIA 3E6MA 3CCUI 3QXEB 1RI9A 2K7LA 2CV1A 2FRYA 4OIQF 2J5PA 3G71A 1KQSA 2R7XA 1GUUA 1FTTA 1MNEA 1QKXA 1HKQA 2XSJC 3HJEA 4S0HB 1Q81U 4LGWA 3QSUA 4RB2C 3M0UA 4J8OA 2NVYJ 2X4XA 3HGGA 3GFJA 2D0NA 4IOAF 3L09A 3U1KA 3M0PA 4ENMA 4XTYA 2VXZA 1R4NB 4BL0B 1UJ8A 2R0QC 5DCMB 2ZFUA 3N4MA 1RLPC 1XCBA 2I5UA 3A4CA 5EGOA 3OYCA 4B47A 1SF9A 4U0WA 1WHLA 2IAIA 4BI8B 2XF5A 1VQ7Q 1VIEA 1K83J 4FM4B 1SVLA 3X20B 2XRLA 2O88A 1JGGA 4B6MA 3DTEA 3K10A 1RUWA 4MEXF 2V8IA 3ZQHA 3VYSB 5LL6S 3RNJA 3K70C 2P5VA 1V54H 2ZSIB 4QPQA 3V42A 2EFOA 1AT1B 2IS6A 1XMKA 2R57A 1SD4A 2EJ9A 4RG8A 2HS5A 4XTWA 2BBYA 1IXSB 1MIJA 1JT0A 1DPRA 1EH7A 1U9OA 5JHUA 3UR3C 3CEYA 1W0UA 1E7OA 3PT9A 1TNTA 3PGGA 4E2FB 3DBRB 2KXCA 3OB9A 2DM1A 1XTAA 3VOEA 3I3LA 2Q8KA 3WU2C 1K4TA 1F43A 4CUGA 1RKTA 1ZAOA 2FD5A 3DU5A 3QPHA 4LMYA 1WA7A 3PNVA 2D1HA 3CJNA 4CYCB 2QASA 2A05A 2DBBA 3LMMA 5A2QR 2P7CB 1ONVA 3EUHC 1RAHB 5E1XA 5JLXA 1AOJA 1G8XA 4J9DA 3IHUA 3KUFA 3CBMA 2XAUA 3FDYA 5AIPA 1AZGB 2YR2A 1B7TA 2YUPA 4C8QG 2QEXQ 2F2EA 4AUXA 4BE2A 1QP2A 2CH4W 3FX3A 5KE2A 4M7AG 4XLNF 1PM3A 2HNIA 2XAQA 3MJXA 3OOUA 1GHCA 3KIOA 3CCMA 4UVAA 1TOVA 1X3WB 4RAYA 2FU4A 3RJPA 4G6QA 2CW8A 5CVRA 4J01A 2K86A 1Y57A 4JRPA 4ATOA 1AWWA 1Z7LA 2L7KA 2M34A 2HPMA 2BZXA 5KHDA 2DEQA 2LFBA 3FJ5A 1V5FA 3GEZA 4QTRA 5E17F 1YRNA 3N05A 3I55A 2L54A 3NWTA 2FZGB 1MMNA 3H0GJ 1A35A 2RHYA 3EFSA 4DBFA 3CCVQ 2F2VA 2V8KA 1T56A 2GLOA 3GZ6A 2RQPA 1ZARA 3WTUC 1KJWA 1EH8A 2Z33A 3AHUA 4M7DA 2WSFE 3D5LA 3Q5FA 1IB8A 2GTOA 1IC8A 2E64A 2KSSA 2J6FA 2RK1A 4O6JA 4HX4A 3VDXA 4OMFB 1RI0A 3OYYA 4M3GA 4FQGA 2DPPB 5LJ3e 3M0TA 4FW1A 1M3AA 3CBPA 2BVLA 1EX4A 4C92F 5GAMg 1TQIA 4HVVA 4N0AA 1Y0NA 5GMKl 1T8IA 5E20A 2DXTA 5CKTA 3HEFA 2V1XA 1O3SA 1NE8A 2JN0A 3CCUA 3OWTA 2AHJB 4M78D 3ZQGA 1VQ8T 1D8JA 4L18B 3JCMe 2V26A 2JA6J 1K79A 2DILA 5E79C 2GF7A 5HS7A 3EHRA 1ZHIA 2KP6A 1I81A 2DJQA 1KQ2A 2CJJA 1HKTA 4Y13A 2V6EA 1Y0MA 3D1NI 5IXBA 1S72T 1B59A 2ID3A 3AL0C 3MEVA 2P0WA 1WJCA 1FIPA 4R8HA 3HTRA 4BXFA 1OCCH 4M75D 1R7JA 2LJ1A 3KFWX 1KGSA 2JSCA 5LJ5d 1CF7B 2RC4A 2LMJA 1ABOA 1J2XA 2LQWA 4PFOA 1ZSZA 1G83A 3MKLA 1BW5A 2KXDA 3CPWS 1Y0UA 2F2WA 5CKEA 2CW0F 1FYMA 3O2PE 3EYYA 1QRYA 5J3LA 2E34A 3KE2A 3I56A 2OAWA 2LVMA 1WZOA 1J7KA 4J7FA 2KPMA 2DODA 9ANTA 2QA4Q 3I58A 4XORA 1U06A 1KC8U 1Z21A 1MBHA 3DKXA 3IV5A 2VL8A 1RRJA 1MMSA 1E0EA 4CCOA 1K1ZA 2OTJA 3GLXA 2RJFA 2EK5A 1KU2A 2WAQN 4CHUA 4FYXB 2XUBA 4BS9A 3HOYJ 2A6EF 1T0FA 1H89C 5GADJ 1QWFA 1OCPA 3HTUA 2M9HA 3M8EA 2LOOA 5D5VB 1PHTA 3PIOF 4M78F 2XF7A 1O9SA 4MMKA 1VQ4T 4Y52J 3GNGA 4DBHA 1BBZA 2XU8A 2QEXI 3EG0A 2FE3A 3ZEHA 4DYCA 3FXLA 2DYRH 3A8LB 2DOAA 3M0SA 4QLCU 2BHZA 2E70A 3ZN1A 4F93B 4AVZA 4ZDLA 1NTCA 2D45A 1YG2A 2EYXA 5GANd 1PDNC 3EUKL 4AFQC 4R1HA 4Z6YA 4IQJA 2KQWA 3PVQA 3HRMA 2VV5A 4M77E 4PLIA 5D6XA 1TTYA 3OW2S 3JW4A 5LEJA 2MMPA 4IHTA 2DPUA 4EJWA 2XMFA 2ZPIB 3JSPA 1PJRA 3OA6A 1DPUA 2F5DA 4GO1A 4BEHB 5C44J 4HXJA 5GAOp 4P9FA 2ZXIA 2HSPA 3SZPA 1PG5B 3CCVI 1OPCA 3BY6A 5ICFA 1XD7A 2HZDA 3KETA 2XDBA 3BG6A 3PNWC 1I5ZA 2N8GA 3MKZA 3AL0B 2VOOA 2EWNA 3VPRA 1N78A 1KD1U 4A2UA 3TL4X 3GVAA 4B44A 4RMNA 4IF4A 1OYXA 1GFDA 2JTVA 5DY9A 3JCMc 2LKSA 4DZJA 2V1UA 4M9XA 1YJNQ 2ROTA 5JI6A 3DLLA 4PJOD 4F7UE 2VJJA 4QSHA 3A03A 2X9HA 3GF2A 4LOCA 4FYYB 3WXMB 2Z2SB 2RQTA 2BV6A 3OR2C 4HF2A 5FLMJ 3LA3A 3PQJA 2MLGA 3LNQA 4A3DJ 2IS4A 1X75C 1X19A 4KMUX 2EYQA 1SAUA 1WHHA 4LLLA 2G0EA 2B63J 3RQ4A 5F0FA 1HW1A 1GV2A 4J19A 5K1YA 2CUEA 1TH7A 5HLTA 1MBKA 1ZYRF 4M3DA 2Y4XA 3D7SB 3VS7A 2EV0A 3FC3A 3KFVA 1VQPT 2EAYA 4EPCA 1Z6TA 1VQ7A 3CCQT 3GTMJ 1B72B 4II3A 4Z89A 2M30A 2DTIA 1WI7A 2HDWA 2RREA 5IYBJ 2I10A 3H9GA 1SSHA 2D2WA 3BG9A 3M9AA 2LBFA 1O3RA 2K6DA 2NAZA 3A8OB 3TDUC 4M6VA 4M7DG 5LJ3g 4FW2A 2FNAA 1R5HA 3B02A 5AIQA 3PMIA 2NVUB 1I3AA 1BBYA 1XSDA 1C0WA 3CCRT 4IZZA 4I02A 4X0GA 3CJQB 1SMTA 2ME0A 2VE9A 1PYVA 4M3EA 2QA4I 1AA7A 3HM5A 3P7NA 1GCQC 1TU0B 1BI0A 1UHMA 3QPTA 2NVTJ 4PJOF 3JCMg 3SYTA 2L3QA 1Q7YU 1I39A 1LNWA 1OMIA 2EA4A 3JRIA 1VQ9T 1JXSA 3OYHA 4ZDOA 1Q1HA 3VFZA 5HDNA 1B07A 4ANJA 2DOEA 4J9HA 4BB7A 3P9CA 4R0KA 5E3LA 2QEXA 5GAOl 2KVQG 1S9HA 1X2MA 2ELHA 3FMSA 4XK4A 1UHWA 3L2CA 3CO7C 3WTZA 2R5AA 3F8NA 3X2QH 1ZGJA 2L02A 2LNVA 5DM7F 4ZGJB 2MH9A 2KZGA 2Z3YA 2VQLA 2M8EA 5KAFC 5CVVA 1UHSA 3ISPA 1OX8A 4GLMA 4DYRA 5CR2A 3HRTA 2VIXA 4A4GA 1A36A 1ULYA 3CJRB 1DUXC 3OBWA 3MEWA 2F6CA 2LCCA 1W6XA 2M0MA 1P6RA 4FSXA 4R55A 2HQ5A 4I76A 4IL6C 1PP8F 5D5XB 1K78A 5GMKh 1W2BP 3MKYB 1VNDA 1SC7A 2O61A 1YHQT 1D1BA 3VRZA 1WQ2A 2GZWA 3ZMUA 2X6OA 2FF4A 2GA1A 2E10A 2JW4A 5LJ5e 3CXCP 1IRGA 1Q7YR 5CO7A 2AS5F 1VQLT 3PIOA 3JRCA 1NLOC 4M78A 3FIWA 4A3MJ 4BY1J 1ZELA 3TREA 1JT6A 3R6SA 1K73C 1MUZA 1WJQA 2LT1A 1Z77A 1FXXA 4KUDK 1BYMA 1ON1A 3BPVA 3REBB 3HPGA 1YJNI 4A3LJ 1DGRM 1WCMJ 2L4MA 1V4RA 2O3FA 3CC4T 4ESBA 2ECBA 1HDPA 3OS2A 1SRMA 5BMZA 1MW7A 2JUCA 4XOPA 5JLWA 3K70D 4YTLA 1ODDA 2IP2A 1MDMA 4JZ4A 3VUZA 2WACA 4XKCA 4RTZA 2R5ZA 4M75A 5HDGA 3WTYC 1GRIA 1ETOA 4BXUA 3I0TA 3OMCA 3HOTA 1BI3A 3ECHA 4CDGA 2KIMA 1F1BB 5J39A 3JB9F 3AAFA 2ZXJA 1M4ZA 1KIKA 2OI3A 3VS5A 5TGTA 1QVTA 1OR7C 4MDXA 1UGVA 2L3RA 3JCMf 4XQFA 2X9DA 1TL8A 2IGMA 4OWRB 2VT3A 1AKHA 2M0OA 1T98A 4NL2A 4XICA 1LDDA 3X25B 2HNHA 4IOCF 2H8RA 2WAQA 3MP6A 3BJAA 3J81R 1SVMA 4LIUA 2V1RA 3H0IA 3IWFA 3NTIA 5GANe 2VE8A 2NUPA 2QI2A 2Y69H 1QZEA 3C1DA 1I8FA 2COWA 2ESWA 3VS6A 4JS4A 4CCNA 1FT9A 4AVPA 1Q82U 3S15J 1OOTA 1WJEA 1T95A 1BJAA 3CTAA 5GAN6 4ME7A 3BQZA 3S1RJ 4OIRF 5HLIA 4WXHA 3KP4A 4OAYA 3EG9B 2QA4A 4DIQA 3FHNA 4KICA 2DA4A 3T9NA 3M56A 2PN6A 4KNYA 1T0HA 1I0CA 3Q1JA 4FX0A 3GF5A 2E5QA 2AQEA 3JB9I 1BK2A 3KP2A 1XGNA 4EMSA 3JSOA 2CFOA 2PMHA 5M9OA 2J7IA 1P9QC 3S14J 3G6ET 1YI2T 3LLRA 3GOXA 5F27A 5CVJA 2DFFA 1ZH5A 3GXOA 4BAYA 1H8KA 1E3OC 1FOWA 2YUSA 2FXAA 1IUYA 4CCLA 4E7LA 3REAB 2PZ1A 3E9FA 3F9KA 4EVIA 3C94A 2DQRA 2L4AA 4QIWN 3ME9A 4L6V5 2RQVA 3BC8A 2O0YA 1K73R 2W7NA 2ZNZA 1BCMA 2RQWA 2G3RA 1FY7A 1G3YA 5HVQC 1IHVA 1RESA 2J6OA 3TQNA 5BS6A 2VLAA 1VFCA 4R56A 5AONA 4OMZA 1YOVB 2YRDA 1OISA 1QGPA 4P5OA 4NHJA 3GO5A 4PJOA 4B9XA 3TU4K 3QHSA 3MPUB 4PFZA 5CQEA 4IRHA 5FJ8J 4V2SA 3RESA 3J7AF 2EYYA 2EPDA 2RVCA 2K02A 2EIMH 5GTIC 5J8FA 3X26B 4L5EA 1W2BA 2NXNB 4E7IA 4B3XA 1NLPC 3QBYA 3EUAA 3ZOBA 4ZJZA 1VUBA 2RKHA 2QBYB 1QVPA 2OA4A 3V7RA 3ZFJA 1ZTRA 1YIJQ 3QOPA 4J9IA 2RN7A 4C3IJ 4XU3A 4XLFA 2DXUA 2XB5A 1VQNA 1Y8QB 2EKHA 3CMAQ 3F6VA 3MP8A 5M5YJ 1G6NA 1IJWC 3PIPF 3OSGA 3IH3A 2TRTA 2M4KA 4R79A 3CCRI 1FZPB 1EJ9A 2VB6A 1H9TA 2CYZB 4XKBA 4LDUA 5EF6A 2MWOA 3G4SQ 2GXGA 3ERMA 3K4KA 4X1VA 4XTUA 2GM4A 3PVLA 4CCJA 1HD3A 3W6VA 1HA8A 4HKEA 3URGA 2XGXA 4HF0A 2QSGX 1Z9QA 5KNLA 4FTHA 2DA6A 1LDJA 2HQAA 3JCUC 5IYCJ 1LEBA 2KHMA 3CP8A 1I5OB 2P0PA 4ESRA 5IHIA 2DFHA 2Z16A 3M4YA 2CS7A 4CA0A 5LFAA 2IS1A 2DKGA 1IHWA 1BIAA 3MVPA 2EJFA 4M7AF 2LT4A 3BR3A 1NPRA 1U6GA 4AC0A 4IX7A 1G2BA 3H5AA 5K5OA 4WK8F 1YJWT 4M78G 2V7FA 4N4GA 4JRQA 2MC4A 4HEA2 3WU1B 1OI1A 2MLKA 1ZX6A 4CYCA 4EMKB 1WQ7A 2ZO4A 3P8BB 4A4KA 4CC3A 1IW7F 2VODA 5B1BH 3HOSA 3BFMA 1VQ5A 2CP3A 5IP6A 1SFUA 1WH5A 2CUBA 3A98A 1WFXA 5H2FC 3CCMT 4QQDA 3LWHA 1OZ2A 4JBAA 2ZCFB 1LB2A 5A0LA 2EH3A 4M75G 4BQQA 1K0SA 2JUFA 1YLFA 3E7LA 2M87A 4U0VA 3UA7A 4IO9F 2P4TA 4U7DA 4ZN1A 4PSXA 1KQSS 2DFIA 1Y96B 2E5NA 2FPFA 1JTXA 3C0CA 4PK4A 2I8DA 3GFLA 5LRSA 1QVGP 4UXNA 2L01A 2M1HA 2ZZDA 3AG1H 3HZJA 3CDLA 2CP6A 3J80K 2LCLA 2GTJA 4MTDA 4RKUE 3CC4I 3HUGB 2KRNA 1B1BA 3H1CA 2DLLA 4A6EA 4PGHA 2KK4A 4MNUA 2JOYA 4QQ6A 2DZ9A 4ABZA 3IQLA 3CC4A 1IREB 4F16A 3OSSC 4YFKF 1DP3A 2ZPHB 4HDUA 1H641 3CCUT 5IYDJ 2WA0A 4E6RA 3ZR8X 1O7FA 3PMTA 5A0DA 2WSEE 3I9QA 3GX4X 1MKMA 3F8FA 2X4JA 3H0FA 2PEXA 3CMEQ 4DW6A 4DA4A 3CLQA 3EPZA 2DMPA 1O3QA 3WVDB 2CYYA 2K3XA 3LWIA 2P5KA 1WXTA 3O3KA 2NVQJ 1E2XA 4RM3A 4RTVA 1IDYA 2LY2A 1GBRA 3M8FA 3NPFA 1JEGA 1F36A 3NMZC 2L9SA 1QMCA 4HCCA 1ZUYA 2CZ0B 3M7GA 4J9BA 1YIJI 1TUDA 2EFWA 5EC7A 1FOXA 1UGPB 1YP5A 2B8AA 2MAMA 5F64A 3CMAI 4BQAA 3QO3A 2K4YA 5GAOq 1WXUA 2V9VA 4F7UG 3FJPA 3CMMA 5I2MA 2AO9A 2VUMJ 2FPDA 1MBFA 5J1YA 2KLOA 3QPLA 1Z7UA 5FO5A 3G4SI 4BE0A 1SEUA 1U8BA 2EGAA 3ASKA 4LE9A 1CF7A 1ZA2B 2KNBB 1O4XA 1STZA 2V79A 4AD9A 1ZLKA 1LJOA 1RAIB 5FLXK 1F1ZA 1RNLA 2QSFX 3ULQB 3O5ZA 4M77C 2C6YA 1TQPA 2DXCA 2X6XA 2NOGA 3A02A 3L2WA 2MC3A 3J80Z 3CF5F 3I59B 1L3LA 3P8HA 2OTJT 1ARKA 1WVRA 3CCJI 3THKA 1VQKQ 1GBQA 1PVEA 3LOCA 1N75A 4Y7NJ 5D5WB 1MV0B 2CP0A 2NYXA 2DF6A 4A3BJ 2CQQA 3H9QA 3NWSA 2E3HA 1XMAA 4AFZC 1AEYA 1IO2A 1Q1VA 3EGDA 4EQQA 1LJ9A 4HQEA 3A8GB 1SEMA 5I22A 3SDZA 4EMKC 3LSJA 4BHCA 3RUXA 2OC6A 3PTAA 3BOQA 1UGQB
chains in the Genus database with same CATH topology
4ZYEA 4FU6A 4ENNA 1KU3A 2IA1A 2E7WA 1K6OA 2NNYA 2A7YA 2HYFA 4A5MA 3R0JA 4U7BA 4YIIA 3WE3A 4J5YA 1UGSB 1YW9A 2FYKA 1CGPA 2H27A 1WPYA 4FT4A 4A6DA 5J8CA 4XTXA 4IXAA 2EJRA 1NJIU 4GY5A 3I5UA 2QDYB 1QVGA 5FLXZ 3ZQ7A 4KIGA 1J9IA 1YITA 3KP5A 4HYEA 3GFIA 3L2VA 3TO9A 4BI3A 5FGMA 2WV0A