2QQ9A

Crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
212
Chain Sequence
DLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 73
structure length 212
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qq9A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qq9A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qq9A03
3IL2A 1HSJA 1Z05A 2R7FA 3WODF 2A68F 1Y0UA 1D3YA 1YG2A 3VEPA 1AWCA 4OIQF 2MC3A 1QZZA 2VE9A 5IT9Z 4KFCA 5CLSA 4RB2C 4WK8F 2YR2A 3OOPA 1U5TA 1PP8F 2DPDA 1RUNA 3COAC 2EJRA 3KP5A 4UNOA 1WRJA 2IVMA 3FM5A 3F3XA 1S7AA 4UXNA 2L4MA 3F8BA 1XD7A 1FYLA 1QO0D 2PBIA 4DNCA 3ZP5A 2FE3A 2LF8A 3K69A 2HYFA 2FSWA 2Z99A 2OZUA 2P5KA 5JHUA 3HRUA 2NRAC 3F8CA 2IJLA 5CJ9A 3DXJF 4UV9A 1EV7A 2YPRA 1BN5A 4CDGA 1B6AA 3C18A 3FXQA 4GGGA 1LJ9A 3RDIA 1ZAOA 5JR3A 5BPIA 1U3EM 2HTSA 1MKMA 4HDVA 3LAPA 2E1CA 3L2CA 4HOBA 2XV4S 1TQIA 2EFPA 5D5WB 2FA5A 1U6GA 1J7KA 2F5CA 5H20A 4NB5A 4KT5C 1S3JA 3TO9A 3WTUC 1XSXA 3PQKA 1RUOA 5ICGA 2Q2EA 3P7NA 2EB7A 5DCMB 2UXNA 5CVUA 2ISZA 4G9YA 3ECOA 2ESNA 4BHCA 4A6DA 5HLIA 1SD6A 1JE8A 2A07F 3K2ZA 3LA7A 4KN4X 4UUVA 3CJNA 1G3WA 3R6SA 4MQVA 2DPUA 1FOKA 3T0YA 2DK5A 4LLNA 1Z91A 5J6XA 1JGSA 2LF7A 2VE8A 1P92A 5LEKA 3WTWC 1F1ZA 3DV8A 1O3TA 2DQRA 3CLOA 1HKSA 5ICCA 4AWXB 4PDKA 3LA2A 2WC2A 2UWMA 2GA2A 5LRSA 4S05A 2ELHA 2OAZA 3VOEA 4YFNF 1WKMA 1BI0A 2K5FA 4MHGA 3HOSA 4YIFA 1GXQA 4H0EA 2QBYB 2EV0A 4XSZF 2XKOA 2EWNA 1FP1D 4L9TA 5L3FA 4HLXA 3ROUA 1I6XA 3BJAA 1TQMA 2COMA 1T2KA 4U0YA 2RQPA 2E7WA 3KZYA 3ZN0A 4O3MA 5F6FA 2OQRA 2YX4A 1ZRDA 3WTZA 1U78A 2W57A 1O3RA 1KQ9A 2QLZA 3VFZA 2KKOA 4I98B 1FWZA 1JHFA 1H9GA 3U9GA 2XRNA 2DU9A 2YSRA 5FFXA 5HLHA 1YQAA 3C3WA 2E7XA 1HW5A 3M8EA 2BGCA 1FT9A 1R23A 1DPRA 3JAMK 2PN6A 1L3LA 2FBKA 4G7ZF 4U7BA 2QM3A 3RKYA 4U7DA 3V4GA 2K4BA 5E1WA 3B73A 2Y75A 4EQQA 3QAHA 5HDKA 1HXDA 3RPQA 1Q1HA 2XIGA 3C7JA 3FXRA 1J9IA 1KU3A 2HFHA 2NNNA 3K1PA 1TNTA 3BZ6A 1BC8C 3ZMDA 1MDMB 4UVCA 4LK0F 2QYOA 4WXCA 2RC4A 5K5RA 3J80Z 4YFKF 2EA2A 3FWEA 4RGSA 4N9IA 3MWMA 4ENKA 1BBYA 4LGWA 3E6MA 4G7HF 1UFMA 3IRRA 3CTAA 3G73A 3BPVA 5FLXZ 4KNYA 4GO1A 2FXAA 2D45A 4ENMA 3LFKA 3WU0A 5CVJA 3N4MA 3IKTA 5CVRA 1FLIA 1RNLA 5ILVA 4OIOF 1K7AA 5BPDA 1BI3A 2ZCWA 4OU0A 3E5XA 3K9TA 1IXCA 1OMIA 4BXUA 2RNJA 5AIPA 3PFIA 3JTGA 2XROA 2IT0A 1KQ0A 3F6OA 1JHHA 3HRSA 4GXOA 2JT1A 2IPQX 2O3FA 4MGRA 2QENA 1J75A 3F6VA 3BJOA 4MTEA 2IA0A 4EGYA 2STTA 2J5OA 5F1RA 2F2EA 5ICEA 5FB2A 1CF7A 1AOYA 1ON2A 2QVOA 2WV0A 1BIBA 1IF1A 1USTA 4FX4A 2GXBA 1BOAA 3TGNA 1T98A 5D5UB 2V1XA 3V8JA 2PLYA 2X4HA 2L54A 3ZMTA 1XGNA 4CXFA 1U5TC 2A61A 5KVRA 3V7RA 3FHZA 4M73A 1DUXC 2WTEA 5LBQA 5LGTA 3L09A 3F72A 3KP2A 2CO5A 4O5VA 2K7LA 3MCZA 1YW8A 5E1ZB 3F22A 3P9CA 2HKOA 4WF2A 3HOTA 4YFXF 1R22A 5DV5A 4L9JA 4RGXA 3K1MA 4Y17A 1DP7P 3SXYA 4A2UA 3J7AO 4N9HA 1W7PB 1YW7A 1ZH5A 4Y13A 3KCCA 3L7WA 2L4AA 2VC1A 3NRVA 3RI4A 4EV0A 4CYDA 3WE3A 1OYIA 5LGUA 4PGHA 3LAJA 2QZ8A 2GIVA 3DQVC 4HV6A 4B8XA 1P4AA 4RGRA 2RDPA 3RTRA 2FBHA 3R0AA 4BHPA 1QPMA 4XLNF 1CGPA 1IN7A 4HF0A 1MD0A 5IT9K 2GXGA 4TV7A 3KE2A 3MEXA 1Z1DA 3IRQA 4HX7A 4ZZDA 3DKWA 1YLFA 2L01A 3MHXA 4K2EA 5ERIA 4N0BA 2E1NA 3E6CC 3W6JB 2VT2A 3LSTA 4KMFA 3I4PA 4M6YA 1WI9A 2CWEA 1WWXA 1FNNA 2A5YB 1X3UA 1F9NA 4EM0B 5HLGA 2VT3A 2DFIA 3ULQB 2XAFA 1IW7F 3KETA 4AIKA 1IUYA 3I59A 1K79A 2KJBA 4LB5A 1DDNA 1TBXA 3O3KA 2CGPA 2VONA 3EYIA 1U5TB 5ICFA 1XMAA 1K78A 1HW2A 2ZBKA 2V9VA 3I5UA 3R4KA 2R3SA 1DPUA 1USSA 3QPTA 1W4MA 5IT3A 1D5VA 3GF2A 3E3VA 3WGHA 4KIBA 3Q9SA 3HTSB 2P8TA 5CVIA 3OV8A 1T39A 3D5LA 2DT5A 4YG2F 1YFHA 4MEYF 1P2FA 2YU3A 3WTYC 3GFJA 1BM9A 1Z9CA 1W5SA 3RJPA 4G6QA 1SFUA 3T8TA 2BE5F 1Z6TA 2PFBA 1I27A 3HHHA 1SD5A 4XBFA 2K5IA 1BJAA 2O61A 5ILSA 1ZG3A 3GYHX 2NAZA 4EGZA 1O3QA 3KEQA 3I53A 1I5ZA 3IWZA 3EQLF 2B0LA 3QRFF 4B09A 1FPQA 2K5LA 2GA1A 5FD5A 4M9SA 2G9WA 2F5EA 4ZYDA 4M71A 1J5YA 2PG4A 3NQOA 2HR3A 4RB1A 4XRFA 2P6TA 1HBXG 2GAUA 4HZFA 3BDDA 4Q48A 4DQ2A 4BHBA 4HF1A 2VBYA 2O0YA 4ZZLA 4WCGA 4EMSA 3CO6C 3SFZA 2XAJA 2DTRA 2XAHA 4RB3C 2P5LC 1F5TA 4HAMA 4MNUA 1ZG1A 2L02A 2LNBA 2M87A 1YW9A 3JSPA 2MLKA 2ZNYA 2M8EA 3KP6A 3V7SA 2H6BA 2GQQA 3E6BA 3TKYA 3F8MA 3WTSC 3KP7A 1Z6RA 3H3ZA 1ZLKA 2FMLA 1QW1A 2HYGD 3WTTC 2BYVE 2DLLA 5E8IA 3HSEA 1LB2A 4HF2A 4CICA 5ILUA 4JBAA 3E6DA 1G3TA 2LSOA 3ERED 3AAFA 3T1BA 2RN7A 2XKPA 1LDDA 3GFLA 3WGIA 3WTXC 5HDNA 4EJUA 2J5PA 2A3SA 5A2QZ 4ESFA 2IA2A 2EFWA 2P4WA 1SMYF 2CW0F 1QGPA 4IHTA 3ELKA 1GXPA 1TW2A 1LEBA 4HLYA 2FF4A 4KDPA 3GX4X 3RIRA 1ZYRF 2Z9OA 1B9MA 2CQKA 1PDNC 2HWVA 2QUFA 3CDHA 2XAGA 5JI6A 2GCXA 1YS6A 2P7VB 4MEXF 1UHMA 2VBWA 1BIAA 4EJTA 3T8RA 2D1HA 4HYEA 2A6EF 4ZYHA 2M45A 3HIFA 1FY7A 4ASNA 1OPCA 1XDUA 1ZGAA 4UHTA 3TDZC 3IWFA 3MQ0A 4PCQA 3L9FA 3J80K 1XGMA 2XUBA 3Q5FA 2V1UA 4HX8A 1XN7A 2NYXA 1BI1A 4EJVA 1R7JA 2EFQA 1J59A 3ZMUA 2ZJ2A 5DYMA 2K02A 3M8FA 5KK1A 5LLQA 1IXSB 4P96A 3BJ6A 2Z3YA 1NHAA 5FLXK 3DP7A 3IC7A 3T5XA 1BI2A 2RV8A 4OINF 3FX3A 1XCBA 3I64A 4ETSA 5L3BA 3S2WA 4CGZA 1Z7UA 2W25A 4I09A 1TLHB 3TQNA 2VXZA 2KRFA 3DEUA 2ZMEA 3P9IA 3CUQA 2H6CA 4E70A 1O3SA 3DFGA 2FBIA 5E1XA 4PZJA 1T6SA 4L0YB 1XSVA 2F5FA 1T38A 6PAXA 1SFXA 3MAJA 2QWWA 4HW0A 3R60A 1ON1A 1RIOH 4I02A 1UCRA 3HUGA 2H3JA 1YO5C 2VOOA 1ONVA 4P55A 4HDUA 4EM1A 1GVJA 1T0FA 2GZWA 2ESHA 3LWFA 4MTDA 2DK8A 4L9VA 5BMZA 2HTJA 1XMKA 1G3YA 2CFXA 4ENJA 2XAQA 1IXRC 2DAOA 1CF7B 4JK1X 4M9XA 2X0LA 5HS7A 2C6YA 5K5OA 1LNWA 1XB4A 4GYIA 4M9ZA 1ZGJA 4D0PA 4M74A 3CUOA 3M9AA 2VOPA 2K27A 2Y48A 3BROA 2OD5A 2IP2A 4I0AA 4L5JA 3QP5A 1BYMA 3V8LA 3BP8A 4QLCU 4L9NA 3H3UA 2XASA 5TRDA 2FQ3A 3J81Z 1V3FA 2K4JA 4BQAA 4OMYA 5DUKA 1KU7A 4KN7X 3REOA 4IRIA 3GZ6A 5E18F 2STWA 4Q5SF 5D6FA 4G94A 4R8HA 1J0RA 3I58A 4KMUX 2EA4A 1RI7A 5K5QA 4S04A 2VC0A 3NEUA 5DCFA 3FMQA 3KEOA 2XHKA 1YTYA 4FHTA 3W6KB 1MJAA 5JVTA 1HKQA 4FX0A 4QWQA 2AS5F 5L3DA 3WG9A 1U8RA 1IN6A 4A6EA 2HZTA 3K0LA 4AVPA 5DUIA 2HGCA 4HBLA 2BBYA 1A04A 2P5VA 2PI0A 2V1DA 3KLNA 4BAYA 4ESJA 1SMTA 1LVAA 4MQ9F 3ZQ7A 2ISYA 3GVAA 4LB6B 3M1EA 1F4KA 2DI3A 3RPUA 2K4YA 3GO5A 1B9NA 4ZYGA 2PMHA 4LMYA 1QZYA 2PEXA 4WXHA 4LD5A 2WWYA 3VODA 4GCVA 1ZG5A 5E8GA 1O7LA 3I59B 2L3DA 3HSRA 1SAXA 2O6GE 4Y15A 5H6RA 3CO7C 3ABTA 2BV6A 1EH6A 5FO5A 3KZZA 1BC7C 2IA1A 2W84A 1K78B 1IN8A 3TOBA 3FF5A 2A6HF 4IJAA 5FGMA 3N97A 4R79A 4Q47A 3ABUA 1H9TA 1FC3A 3MFKA 1W7PD 4LG0B 1UHWA 2JZYA 2QQAA 4RS8A 1S6LA 2HEOA 3C1DA 3GWZA 5FFZA 3TDUC 4U88A 1ULYA 2ZKZA 5D5XB 5J8CA 2HQNA 2MA3A 3HHGA 1E2XA 4WX9A 5ED4A 2DBBA 2FU4A 4I01A 2UXXA 1ZRFA 1S7OA 2EK5A 2Q8KA 4LG0A 1IRFA 3JW4A 1OKRA 4LLGF 1J2XA 3R0JA 2ADUA 1YIOA 3M7GA 4WWCA 2DW4A 3WTVC 2CSOA 4KICA 3KLOA 2ZXJA 1C0WA 2HOEA 4EJOA 1TTYA 1XCVA 2JSCA 3ZMVA 3FXUA 4ZH4F 2LKPA 2M1BA 2LDUA 3SZTA 3RKWA 2DQLA 3EDPA 3QU3A 1FYKA 2MH2A 2OZ6A 1U2WA 1XGOA 3SQNA 5H6QA 4ESBA 2OBPA 3HTUA 1B59A 4JQFA 3L00A 3QU6A 2XVCA 5CVVA 5EEHA 1IZ1A 3EUHA 3SZPA 1MJ9A 5J8FA 4AIHA 3TOAA 5D6EA 4PGGA 4WXDA 3BWGA 1TW3A 3PQJA 1EH8A 2MBFA 2Z33A 2JPCA 2P7CB 5DEQA 2XGXA 1R58A 4OOIA 3O2PE 4FT8A 5DDGA 3JTHA 3GZ5A 2Q0OA 2NNYA 2D2WA 5BOXA 5HS8A 5A2QK 2IRFG 3KFWX 2KJCA 2H27A 2EV6A 2VODA 3R61A 2LX9A 4L5IA 2NS0A 3FM3A 1JXSA 2IW5A 1KQ8A 3RYRA 2ACJA 4AD9A 2JTVA 1R00A 3GXOA 2YX7A 1OYWA 1IAWA 1FSEA 3GW2A 3P9KA 4IRHA 2HKXA 3CUQC 1XSDA 3SHFA 2BEOA 1OYYA 1I1SA 2O8XA 4RGUA 3E97A 1KGSA 5E17F 3ZN1A 3LQRA 4ON0A 3IKVA 3H92A 4R1HA 4A0XA 3ZPLA 2MH9A 1FX7A 3O6BB 2CG4A 2O03A 4HX4A 5DD8A 1B4AA 1V4RA 2KIUA 5AONA 3FZVA 1PP7U 3F8NA 5DCMA 4HV5A 2OQGA 5HOOA 5JFRA 3QP6A 4Z2YA 4HA8A 2QQBA 4UV8A 4G7OF 5D8LB 1R1TA 4NHJA 1ZLJA 1I1GA 2VN2A 3FMSA 3ZMZA 4A0YA 5HVQC 1REPC 1QNTA 1IN5A 2KIFA 1R5HA 1P6RA 1OR7A 4IXAA 2FEZA 3QOPA 2Y0MA 1ZRCA 2JPBA 5LHHA 5E20A 5D4RA 4LJZF 4A12A 2RVCA 3E5QA 4KUMA 3ECHA 4EM2A 2K86A 4P9UA 3D0SA 2FMYA 2PJPA 3B02A 3V8KA 2FRHA 1ZHFA 4UVBA 2QBYA 2JRTA 3GEZA 4IPAA 5AIQA 1SD4A 3VB2A 2H09A 1LEAA 5LEJA 2ZMEB 3CUQB 2FNPA 5LGNA 3U1DA 3KP4A 3TO7A 1W5TA 1QVPA 4G6DA 5BQTA 4P9FA 4ENNA 3RKXA 1D8JA 3F23A 1KU2A 4EJWA 3BPXA 3MZYA 2R7DA 1LDJA 2ZFWA 2VBZA 4RAYA 2Z5UA 1PUEE 4KIGA 1LQ1A 3G3ZA 4UVAA 1KA8A 3I54A 3K1NA 4AIJA 4L0ZB 1ZARA 5D5VB 2OA4A 1L0OC 4YIIA 1STZA 2ETHA 1FBUA 2VBXA 1P4XA 1WSUA 3J81K 1O7FA 1MDMA 2PMUA 1ZREA 3LA3A 2MLGA 1IRGA 2EFNA 2HS5A 3Q9VA 3DF8A 1FP2A 1MJBA 2V79A 4LLLA 3JAMZ 4GYGA 1O57A 5FD6A 4U0VA 3MZHA 5D4SA 1ZN2A 1FBQA 3WGGA 1QQIA 2RGVA 5L3GA 2CYYA 4CHUA 4OIRF 3IHUA 3BOQA 5F64A 3HYIA 3V7CA 3ML6A 4Q4ZF 4IVNA 1TQPA 3QPHA 1D8KA 1UB9A 5BS6A 1G6NA 4HQEA 1VTNC 3F21A 4M6XA 1B1BA 4U0WA 1R5GA 1IN4A 2F5DA 2A69F 1ODDA 2HQRA 4CZZA 2EFOA 3LQQA 1S8NA 4KA4A 4IF4A 1KYZA 1FSHA 2RKHA 1SFEA 4O6JA 3WU1B 4A0ZA 3TO6A 2OU2A 1HKTA 2W24A 4G8XA 1P4WA 3HRTA 1FYMA 2EV5A 3BY6A 1RZ4A 4F7ZA 1WQ2A 2G7HA 4BNCA 1HQCA 2AXLA 4A5MA 1HW1A 4LK1F 4EVIA 3F8FA 1E17A 3KP3A 2FOKA 2PQ8A 2G7UA 3U2RA 3HSFA 4ZYEA 1SD7A 3E19A 4XLPF 3RYPA 4A5NA 1GHCA 1KYWA 4I0BA 1TNSA 5HS9A 4RB0A 5HDGA 3ISPA 2KIMA 1FBSA 3DPTA 1G3SA 5DD4A 2W85A 2HDCA 2FNAA 1R1VA 4XSXF 5K1YA 4M72A 4NQWA 4LFUA 3WE2A 4CO8A 5L3EA 3GUDA 5LHIA 2H94A 1YS7A 2ZNZA 5CYVA 1YYVA 1EH7A 2M5WA 4BYYA 1W7PA 5LRRA 2UZKA 1LDKB 1R36A 5EEGA 4IHSA 5LHGA 2MD5A 4OIPF 2D1VA 4KIFA 3EETA 2V6CA 1R1UA 4BH9A 1K6OA 3HRMA 1MZBA 4P5OA 3EYYA 2P6SA 1HSTA 3GLXA 4OMZA 1S29A 2DO7A 4IRGA 3I0TA 1XDSA 3ZMSA 3GFIA 1MGTA 5L3CA 2GWRA 1KU9A 4I2OA 4I7HA 2TDXA 4KYWA 1XGSA 4HQMA 2QQ9A 1H0MA 1QBJA 1G4DA 5TJJA 3FMRA 3I71A 5D8KB 3GFMA 4RAZA 3E5UA 4L18B 3JSOA 2M30A 1FZPB 3DPLC 2ZO4A
chains in the Genus database with same CATH superfamily
3IL2A 1NK2P 3REBB 1HSJA 4XLAA 2OX7A 3SEMA 3GTMJ 2LBFA 1CQTA 1NLOC 1Z05A 2DFHA 1LE8B 2R7FA 5L23A 5J39A 1N8RC 4KISA 1RPWA 3WODF 1IG7A 1TG0A 2K6DA 5J1YA 2MWOA 5GAN5 1K6YA 2A68F 1Y0UA 4L59A 3MEWA 4DOWA 1D3YA 1YG2A 2X9HA 4KJZA 4M7AB 4M3FA 3VEPA 1AWCA 4OIQF 4RG2A 2MC3A 1QZZA 1UHSA 2VE9A 2KBTA 2RB6A 2RO0A 2DT6A 2XI9A 1A0NB 4C5HA 1X1CA 3R6NA 5CQXA 2NVYJ 2EQUA 1M2VB 4JDSA 2LY9A 5IT9Z 1TS9A 1RI9A 2YSQA 3TREA 4BUPA 3G4SI 5GMKl 1OU9A 4XTYA 1UG2A 4KFCA 4FISA 1JUSA 5CLSA 4RB2C 3CCMI 1WXUA 4WK8F 4J7IA 2YR2A 1OOTA 5A0LA 3LGLA 1ZSZB 2M0MA 3A0HC 2SRCA 3OOPA 1U5TA 1PP8F 1DJ7B 3CCEQ 2DPDA 2MVTA 2PVDB 2QA4A 4M7DD 1RUNA 3UATA 4HG2A 3LSKA 3COAC 2EJRA 3KP5A 3LSHA 4NDLA 4UNOA 1UJ8A 3H0IA 4BS9A 2LZ6B 2O9VA 3AG1H 3DU5A 4BU2A 1GFDA 1M1KC 1WRJA 2IVMA 1OR7C 4N4IA 1V5FA 3FM5A 2E6NA 3F3XA 4BI3A 3J80E 1WHUA 1WLPB 4CI0C 5BNGA 3T9NA 1B3QA 2CGHA 1VA7A 1S7AA 3H6ZA 2ZJRF 4UXNA 1M2OA 4Q5WA 2L4MA 3F8BA 1LFPA 4M77C 2ZC2A 1XD7A 1LCKA 1FYLA 1QO0D 2PBIA 4DNCA 2DD5A 2E3HA 3ZP5A 1BR4A 2FE3A 2OCEA 2LF8A 3K69A 1V1CA 3PFSA 1VQNQ 2HYFA 2D1XA 2PUKB 2LKXA 1TOVA 2V7FA 5C6SA 3I56Q 2FSWA 2GBYA 2ME6A 1M8MA 2HOAA 2FQ4A 3HTRA 4JRQA 2Z99A 3CCUA 4B48A 3BFMA 2EKHA 2OZUA 2P5KA 3CP8A 4J5YA 5FLXE 4M7DE 3E1SA 4XONA 3CC7A 5JHUA 3HRUA 3H41A 3CCSQ 2C06A 4HSTA 1VIFA 5DY9A 4XQFA 2NRAC 3F8CA 2C0TA 2M1HA 3CC4Q 2IJLA 4UV9A 2DYRH 3DXJF 5CJ9A 1EV7A 2RQTA 2YPRA 2EGCA 1BN5A 2LOOA 4MFEA 1JI8A 1Z9QA 4CDGA 1B6AA 2KQWA 2HQEA 3OSVA 2DDAA 4JX5A 2GFAA 3C18A 2GBQA 5GAN2 2E71A 3FXQA 2DZCA 3NPFA 3J7AW 4MZTA 1VQ7T 1H3HA 4GGGA 1LJ9A 2ATCB 3RDIA 4BY7J 1ZAOA 1AT1B 5JR3A 2DERA 1YJWI 3JREA 1YJ9T 5BPIA 1TSFA 3UKGA 1U3EM 1UEBA 1Q82R 2HMAA 2HTSA 3MMYB 1LUJB 2Y9ZA 2R5AA 5HCKA 5HNFA 2M0YA 1AHJB 1MKMA 2JA6J 3TBIA 4HDVA 4BACA 4ZDOA 3A5ZB 2Y2ZA 3EPZA 3LAPA 1OV3A 2E1CA 3JB9G 5FKMA 4FW2A 3G6ET 3L2CA 4HOBA 5F0CA 2JXBA 2OTJA 2XV4S 1TQIA 4DZPA 2EFPA 5D5WB 2FA5A 2DYIA 2Y0SN 3K7AJ 1U6GA 2G6FX 2KSSA 2RHIA 1WDXA 4M7AG 1J7KA 2F5CA 2X1CA 5H20A 4NB5A 4KT5C 1S3JA 1VUBA 1R4MB 4EMKC 2P4RA 3TO9A 2R0QC 5LD2C 3WG7H 3TW7A 3WTUC 1R71A 2PUOB 3ZFJA 1VQKT 1Q81C 4KGXB 3MJXA 1XSXA 3M0RA 4KUIA 1OZ3A 2O2OA 3OYKA 1VZ0A 3PQKA 4XR6A 1RUOA 3QDFA 2NUTA 3FDYA 4CH7A 2OTLA 1WHJA 5GAN8 2NUZA 1WJAA 5ICGA 4N4GA 2EYZA 3QDRB 4AT1B 4KGZB 4QQGA 1I1JA 2KAFA 2Q2EA 3S3MA 1MIJA 3P7NA 1YJNI 2EB7A 5DCMB 2JWTA 2RI5A 2UXNA 3JRHA 2IAIA 2IGNA 3PNTA 3S1NJ 2EJGA 3CCVI 2EQIA 3OSSC 2LX7A 5CVUA 2ISZA 4G9YA 3ECOA 4C0ZA 2FX0A 2TCTA 2ESNA 4BHCA 1H88C 1UHCA 3M0PA 3CMET 2P84A 4A6DA 5HLIA 1W2BS 1CKAA 1SD6A 1HOMA 1JE8A 2A07F 1NE8A 1G2HA 3K2ZA 3LA7A 1MSFC 4KN4X 2YUPA 4A4GA 2MSYA 4RAFA 4UUVA 4BE0A 3M3YJ 1TZLA 1FYNA 3CJNA 4U87A 1G3WA 4LG3A 2CUDA 4CCJA 4TVRA 3THKA 2LFBA 3R6SA 3CCQA 1B72B 4AG2C 2DXBA 2LQ8A 3CCRQ 1SANA 4MQVA 2DILA 2DPUA 3VS4A 1LFBA 1UG0A 2OPTA 1MBEA 2ICWG 3ZCOA 2E4HA 1FOKA 3T0YA 3REAB 2HQHA 3OYDA 2DK5A 2LQWA 2QKLB 3H0GJ 4X9CA 4LLNA 4ZGDB 1Y7XA 2VQHA 2H8HA 1Z91A 2R7WA 2LQKA 5J6XA 5IAYA 3JCMX 1GFCA 1JGSA 1I6HJ 2LF7A 5E3OA 3G1LA 3OQ5A 4IUQA 2VE8A 3UF4A 2L7FP 1P92A 5FW9A 5LEKA 2O9SA 3WTWC 5KAIC 2CJJA 1G59A 1HK9A 2DL8A 1F1ZA 1SVLA 1U06A 1JJ2A 2QEXI 3PT9A 3DV8A 1O3TA 2DQRA 1AKHB 2FPFA 3CLOA 2M9UA 4NS5A 2EGAA 1IUFA 1HKSA 4J6XA 5GANg 1N8RU 5ICCA 4RLQA 3MEVA 4AWXB 4J6WA 4PDKA 2K5CA 5DLQE 3JCMf 3LA2A 1WH7A 3HOXJ 2RNGA 2KNBB 4A53A 2K2MA 3H8ZA 2KT1A 4C8QF 4M77B 2DF6A 2WC2A 2ZPIB 1W4SA 2MGQA 1FOYA 2KHMA 1BR2A 2UWMA 2GA2A 5LRSA 4S05A 1VQ8I 2ELHA 2OAZA 3MKLA 3VOEA 1TH7A 3BR0A 2L8DA 3AFHA 3A1PA 2QA4Q 3NMZC 3URGA 2G3RA 2O01E 2E60A 3BG3A 1ETXA 2RM4A 4YFNF 4V19K 4MLOA 1UTIA 1WIEA 1WKMA 2ELJA 5E3MA 1HC8A 1BI0A 1SG5A 2K5FA 4HPQA 2KPMA 4MHGA 3HOSA 3EG3A 3Q0VA 1GXQA 4YIFA 4H0EA 2QBYB 4GLKA 3TVTA 2H3EB 2EV0A 4XSZF 4B43A 2V4JC 1Q7YC 2XKOA 2W10A 5FJ8J 1XC5A 1U8BA 1WJQA 3TMOA 2F5TX 2LYCA 4BGDA 3AKZA 4IHVA 4LIUA 3RQIA 2EWNA 3HEFA 2EJ9A 1FP1D 2K3XA 3DBHB 3I9QA 5GAMe 2KXCA 4L9TA 1Y96A 3G2BA 3QPLA 4LDYA 4CCKA 4CC3A 1RAHB 4A3BJ 2CYZB 2V8JA 4BUGA 5L3FA 3HOVJ 1GVDA 2K3BA 2DEUA 4HLXA 3ROUA 3OW2P 2Y69H 3FEOA 1I6XA 1ZBJA 2NYSA 3BJAA 2RJEA 1TQMA 2KXDA 1S72I 3CCUQ 3BDUA 2COMA 1QZEA 5GTHC 3HOYJ 5DLOA 4HNVA 1T2KA 2FG0A 4U0YA 3KYLA 3EG0A 1VQ6T 3HBLA 2RQPA 9ANTA 5IP9J 2ZPBB 1Q82U 3OYNA 1X2NA 2E65A 4N0AC 2E7WA 3IH3A 3KZYA 2J06A 3CXCA 3JCMP 3CDLA 1PNJA 4J9CA 3ZN0A 4M3GA 1NJIR 2ED0A 1ETQA 4O3MA 2J6OA 4D5CA 3A0BC 5F6FA 2BE7D 2OQRA 2VJ5A 5GANh 3IH4A 2HL3A 2YX4A 3QPSA 1ZRDA 3I4NJ 3D7SB 4EMKB 5LJ5f 4EMHA 4CC4B 3WTZA 5IOZA 4BQOA 2L0AA 1U78A 5KHDA 5I21A 3KPHA 1UUEA 1SVMA 2W57A 4YELA 1O3RA 4ME7A 1PRLC 1QRYA 3L1PA 4IIMA 1KQ9A 2QLZA 3VFZA 3HPWA 3VWBA 2KKOA 4I98B 2P0KA 1FWZA 2RI3A 5GMKe 1JHFA 2JTFA 1H9GA 4OMOA 3U9GA 1VQNT 2GIZA 1ZA1B 2R4GA 1YHQI 3VS3A 2XRNA 3I56T 2E35A 3RCOA 2DU9A 3VRZA 2L9NA 2YSRA 5FFXA 3ME9A 5HLHA 3KEYA 3BCBA 1YQAA 3C3WA 1QHGA 2CQ7A 2E7XA 2YUOA 4ELZC 5HK0A 3ABMH 1V5GA 1HW5A 1YITI 1Y39A 3H5RA 3M8EA 2KR3A 2BW3A 1W0UA 1R8OB 2EYXA 3CDIA 4I99C 4FSSA 2XGEA 2BGCA 2HD0A 1FT9A 1R23A 1VQ9T 1K8AC 4BDZA 4FT4A 2E36A 2MYSA 3QHSA 3A01B 1MNEA 3VJPA 3ZL7C 3QO3A 1DPRA 1NEGA 3LX7A 3JAMK 2PN6A 1L3LA 2FBKA 3GTOJ 5IY5H 3CJTB 3S1MJ 1WVRA 3LSJA 4U7BA 4G7ZF 1YJ9A 2EQRA 2QM3A 3RKYA 4U7DA 3V4GA 2R5ZB 2K4BA 4JRIA 5E1WA 4LD6A 4F7UA 5A0DA 2F2WA 2M9HA 2WB1A 3B73A 3H36A 3INZA 4M77G 2XPWA 1Z3YA 4XLCA 2Y75A 4EQQA 2MFZA 2OTLQ 1FOWA 1VQPI 1EKEA 3QAHA 5HDKA 1HXDA 4W1UA 1Q81U 3RPQA 1Q1HA 3G6EA 2XIGA 3GTQJ 2RHXA 4C8QC 4PJOE 2M7BA 3C7JA 1ZUUA 3A4CA 2RJFA 3FXRA 1J9IA 1KU3A 1C0MA 2HFHA 1RAFB 4FTHA 1E6HA 2NNNA 1NG2A 3K1PA 1K61A 1TNTA 1JTXA 1FTZA 3BZ6A 4OGEA 3A98A 1BC8C 2L9RA 3ZMDA 4BY1J 1G5VA 4FSXA 5DM6F 3EAEA 4IHXA 1YN8A 1K8AR 1VQKA 2L89A 4DGWB 1MDMB 2DA7A 4IL6C 1PUFB 4BI4A 1JBMA 4UVCA 4RTWA 2Y30A 4BBRJ 2VGNA 1FOXA 4LK0F 1WXTA 2QYOA 4WXCA 1IC8A 2LRDA 5GAOr 1OCPA 3CCYA 3CCQQ 3JB9F 2RC4A 3D5SC 5K5RA 3J80Z 4F91B 2D6FA 1ACMB 2CS3A 1LVKA 4B3AA 4A3IJ 1LPLA 3WHCA 4YFKF 3CPWA 1VIEA 2EA2A 5EG0B 3FWEA 2X48A 2M0CA 4RGSA 3CMEA 4D6WA 5M3MJ 4N9IA 1XNIA 2ID6A 3MWMA 4ENKA 1BBYA 4LGWA 5GMKj 2E2JJ 2A08A 3E6MA 4G7HF 1UFMA 3IRRA 2DXTA 1SHGA 4AYBN 3A52A 4M75A 3CTAA 3CC2I 3G73A 4XLEA 3BPVA 5FLXZ 2LTPA 3I55I 5FWCA 4KNYA 4GO1A 4XU0A 3I5RA 2FXAA 3F9KA 2D45A 1RUWA 3U21A 3TP3A 4ENMA 1QP3A 1YIJI 3LFKA 3WU0A 5CVJA 4AUXA 3N4MA 3IKTA 1GCQC 2P0QA 5CVRA 2QI2A 4JJBA 3CCLA 3FC3A 1FLIA 1RNLA 5ILVA 4CUGA 4QQDA 1SVOA 2DBKA 4OIOF 1KFZA 5GAN6 2MF2A 2DL7A 1M27C 1K7AA 3VYTB 2L7ZA 2VLAA 5BPDA 5TGTA 1VQMI 1BI3A 2K9GA 3SDBA 2CS7A 2LTOA 3KBGA 5B5EC 1X69A 2ZCWA 4OU0A 3E5XA 2F4MB 3K9TA 2HBPA 2E6ZA 4Y7NJ 1TU0B 4Y92A 5CPRB 2YDLA 1IXCA 2GXAA 3S32A 1OMIA 2FHDA 2GOMA 1T8IA 4BXUA 2RNJA 5AIPA 4IHWA 1BKBA 1WFWA 1MHNA 3PFIA 1ZR2A 1WH5A 2AXTC 2XRLA 3JTGA 2XROA 1C6VX 2MIOA 3C94A 2IT0A 4QQ6A 1KQ0A 2O4XB 1JEGA 2EPFA 3JRFA 3F6OA 1QVGS 1JHHA 2NUPB 1MSEC 1YBYA 1SF9A 3HRSA 4GXOA 3JRIA 2RD1A 2JT1A 2IPQX 4RTZA 2ZCFB 3M9QA 1AD5A 4XKVA 2QAZA 2O3FA 8AT1B 1HCRA 5EZHA 4MGRA 3K4CA 2YU9J 4FYXB 1NJIU 2QENA 1KHCA 1J75A 2EW3A 4JRPA 3F6VA 1LNXA 4IHYA 3BJOA 2CH4W 2J05A 3WXMB 4MTEA 2L3QA 3M54A 2L7MP 2IA0A 2W7NA 4EGYA 2XB5A 4XTXA 2MABA 1VQ7A 4M7DC 1WHKA 1MBKA 8ATCB 1H8AC 3OSGA 2STTA 3VS0A 2J5OA 4DOZA 5F1RA 4IKFA 2F2EA 2KDSA 3X28B 3MPUB 4EMGA 5ICEA 1T33A 5FB2A 4R0KA 1D1CA 1CF7A 1AOYA 3CJRB 3LOCA 4A93J 1B07A 2L7KA 2O4XA 3M59A 4Y4RA 1ON2A 1HA8A 3C0CA 1E6GA 4FETA 2QVOA 2R58A 3EHRA 3JCMg 4IIOA 4AFSC 4X0GA 3JB9H 2WV0A 4C2TA 1BIBA 1IF1A 1USTA 2F48A 4BL0B 4FX4A 2GXBA 2BXZA 2CH0A 2Y9YA 1BOAA 3PNYA 3TGNA 4KGVB 3WVEB 1YRNA 1MBGA 3A2KA 3J7AF 3CCEA 1T98A 4F52A 5D5UB 2JZ2A 4M78A 2V1XA 1DGWY 3V8JA 2PLYA 2X4HA 2DRMA 5CKDA 2L2OA 1ZKGA 4F92B 2L54A 3ZMTA 4C30A 3H0FA 1XGNA 4CXFA 5F0FA 1U5TC 1M3BA 4RCBA 4PK4A 3CC4I 2A61A 2DTOA 2LCCA 3QG1A 2Z0WA 1V76A 5KVRA 3QWXX 3V7RA 3FHZA 3JAMR 1VQ6A 1WJFA 2VC8A 2I5UA 3DWLE 2CH4A 1GL5A 3V42A 2HOTA 4M73A 1DUXC 3J7YJ 2NVTJ 4C8QB 2WTEA 5LBQA 2DIQA 5KNLA 2PZ1A 2EJFA 1QLYA 5LGTA 1SC7A 3L09A 3F72A 3KP2A 2DMUA 5IYDJ 2CO5A 4O5VA 2K7LA 1LPQA 4FL6A 4D8DA 2AHQA 1WI3A 2ZPEB 3MCZA 1MBFA 3ZQIA 3M8JA 1YW8A 3BG5A 3JR9A 1N9SA 3SHWA 3KZIC 5GPCA 1KQ1A 2RA2A 5E1ZB 2B63J 3F70A 1VQ7Q 1YI2T 4Y28E 5FKNA 1S7EA 3FXKA 2FPEA 4E7HA 4PNOA 3F22A 3RNJA 4FM4B 4CC7A 1SKUB 1T95A 2A37A 5GAMf 1YJ9Q 3RERA 4KT6A 2QG9B 4M78D 4H4KC 1K8AU 3P9CA 2CDTA 4CYCA 1GDTA 3I56A 2KMTA 2HKOA 2EIMH 2KZGA 3G4ST 1NEBA 2FUG2 4WF2A 3HOTA 1A36A 4YFXF 2W0ZA 2COWA 4GBQA 4A3JJ 1R22A 2XC7A 2X6XA 5DV5A 1M1GA 3VUZA 2WAFA 1FIPA 4L9JA 4RGXA 2BZ8A 3K1MA 4Y17A 2DODA 3JRGA 2DIGA 1RETA 1CKBA 1DP7P 5KCMA 3D5RC 3SXYA 4A2UA 4J01A 3HP9A 1VQ9A 2M7AA 2JS2A 5A2QE 3J7AO 3OR2C 1GT0C 2IPOB 2YWWA 4N9HA 1W7PB 2JN6A 5H2FC 1YW7A 2LJ3A 2HEQA 2K7AA 3S3NA 1ZH5A 2ZJQF 1O9SA 2FZCB 1Q7YR 3JCMh 3PO3J 1VQKQ 4Y13A 3KCCA 3L7WA 1M30A 2XB0X 1ZTRA 4RG8A 2L4AA 1UG1A 3BW1A 3UWNA 5I11A 2VC1A 2Z2SB 2BKDN 2M3AA 3NRVA 2HBWA 4RA2A 3RI4A 3EUKL 1VYTA 4BXXJ 2L3RA 2BY0A 4EV0A 4F04B 1OJLA 4CYDA 2CV1A 1R4NB 3VS7A 4AIDA 4BEHA 3WE3A 4DW6A 1OYIA 1WJEA 1SSHA 2CMPA 2CW7A 3OYIA 2HZYA 2VJJA 2AHJB 1D1AA 2HSEB 1P7JA 4PGHA 5LGUA 3LAJA 2QZ8A 2JVVA 2P4TA 2GIVA 4GRIA 3OW2S 4XKBA 3VYSB 3DQVC 3LL7A 1ZQ1A 3CMEQ 1R0BG 3UT1A 1KJWA 4HV6A 5GAN7 1QVFP 3OS2A 3ER0A 4EEFG 4OMNA 4B8XA 1P4AA 4RGRA 2RDPA 4G6TB 2FBHA 3R0AA 3RTRA 2JA7J 3I4MJ 2P0TA 4M77F 4RDUA 5J26A 4B9XA 4BHPA 1QPMA 4E7ZA 3CCRI 4XLNF 1CGPA 1IN7A 3LGFA 4HF0A 3M0QA 1MD0A 4JX4A 4HCZA 5IT9K 4XN0A 1ENHA 2GXGA 4TV7A 1NPPA 3KE2A 3O5ZA 3VS2A 3FBIB 1KIKA 2JTMA 1M90C 2COBA 2BOLA 3MEXA 2UUZA 2WAEA 1JKOC 3OB9A 5EEAA 4IUTA 3ZOBA 4ZGJB 1Z1DA 3G1OA 3K4LA 2ELKA 1RQ6A 2Y4YA 3CCLQ 2Z16A 3IRQA 4HX7A 4B1RA 4ZZDA 5HLTA 3DKWA 1KSWA 1YLFA 3A1YA 3CBMA 2R7RA 3CCQT 2L01A 3MHXA 2M4KA 1U0JA 1QVTA 4K2EA 4PUSA 5ERIA 2DL5A 2HU9A 4N0BA 1UGVA 2OV7A 2BUDA 3BY7A 4DZJA 1H8KA 3JRZA 2QDLA 3S3OA 4II2A 5GMKi 5IHNA 3M55A 2E1NA 3OYHA 3E6CC 4PJ0C 1MMAA 3W6JB 4BKXA 4XRMA 2VT2A 3OIOA 1UHFA 4C8QG 2DFEA 2EZIA 2VQCA 3LSTA 4NNJA 2LBFB 4KMFA 1BU1A 3I4PA 3OL3A 1X1BA 2PJRA 4M6YA 3AG4H 1UGSB 4J6YA 1WI9A 3RR6A 5J1RA 2CWEA 3RMSA 1WWXA 1FNNA 2A5YB 2EQMA 1X3UA 3FBNB 1K4SA 1F9NA 4EM0B 4BD3A 2JJ9A 5HLGA 1K76A 5IYBJ 3MKDA 2VT3A 3NWSA 2CUJA 4CC2A 2DFIA 1UGPB 2F5KA 2BVLA 3NWTA 3ULQB 2EKOA 2XAFA 1IW7F 2H8WA 1N75A 1Y0NA 3JB9I 3KETA 2QA4I 4AIKA 1IUYA 1MNMC 1M5Q1 3I59A 5GAOq 3OMYA 2FD5A 2RH2A 1ZBXA 3MEUA 1K79A 4HVWA 2HPMA 4C2MJ 1YFNA 2VXFA 3H35A 2KJBA 2DA1A 4A3MJ 4LB5A 1QVUA 1DDNA 1B7TA 1ABOA 1TBXA 1X2KA 3KFVA 4M7DA 3O3KA 4BQNA 2CGPA 2VONA 3EYIA 3ZQFA 1U5TB 5ICFA 4HKEA 1XMAA 5GMKm 1VQLQ 3HM5A 2VL8A 2EH3A 3BQZA 1K78A 1HW2A 1W36D 2ZBKA 2YXYA 1RC9A 2V9VA 1I07A 3I5UA 1IO6A 3L2WA 2LJ1A 3R4KA 4XOPA 2R3SA 3MEAA 2VKVA 1VFCA 4NC8A 3RUXA 4NBQA 1O75A 1PM3A 2YRVA 3FKIJ 1DPUA 5IXBA 3X25B 4E47A 4F7UF 2ZJPF 1USSA 3QPTA 4BB7A 1W4MA 5IT3A 1D5VA 1SFKA 2GTOA 3BLYA 3GF2A 3PMIA 3E3VA 4Z89A 3WGHA 1X1AA 2DMNA 4KIBA 3TW6A 2QSHX 3Q9SA 3AL0C 2IS6A 3AT1B 5K7FA 4GLMA 2NS8A 2NOJB 4XKWA 3HTSB 4JJDA 4MDWA 2P8TA 5CVIA 4JLGA 3OV8A 4CCMA 3CCUI 3D5LA 5JHFA 2BHYA 1T39A 4AU7A 1JKQC 1R49A 2CU7A 3GBGA 2IS1A 2DT5A 3W2VA 2DXIA 2DXUA 2KYBA 2QF7A 4LD9K 4MDXA 1SRLA 1Q86C 1K0XA 4XTVA 3M5AA 5LJ3d 4YG2F 3CC7I 3NGPA 2FO0A 5KE3A 1YFHA 4MEYF 1P2FA 3PFYA 1G83A 4JPBW 4LUDA 3LH5A 2YU3A 2W82A 3WTYC 3K2AA 1WHLA 3HG9A 2OAWA 3GFJA 2JVHA 1BM9A 3BR5A 1Z9CA 2QK0A 4L6V5 5I2MA 1ETYA 1W5SA 1N8RR 1VQ6Q 4QIWN 3RJPA 4G6QA 4V2FA 1ZSGA 2PVGB 4GFBA 1SFUA 3T8TA 1KQSA 3S8PA 3RSNA 3EHQA 2BE5F 2QTVA 2SEMA 2KE9A 4XIDA 4E7IA 1N77A 1JRIA 3OL4A 1Z6TA 4ELYC 3QSUA 2XKOC 3PL8A 3WHBA 2YLCA 3CMAT 3ABKH 2VJ4A 4OAYA 2PFBA 1I27A 2KQRA 3HHHA 1SD5A 1SEMA 2QEXT 1Z0XA 3RZDJ 3FB9A 1OCTC 5GJVB 1JJ2P 5CKTA 3GNFB 2BVMA 4XBFA 2BZYA 2K5IA 1Q7YU 4XL9A 2ECZA 2F2XA 4F3QA 1BJAA 2QGFB 3PVQA 2CUFA 3L2VA 2O61A 5ILSA 2OTJI 4UUSA 1ZG3A 3BR6A 4RKUE 3GYHX 3EGUA 2JA8J 1JXOA 3FXJA 4J9IA 2NAZA 4EGZA 1O3QA 3PTAA 1V55H 3KEQA 2C0IA 4M75F 3QZ5B 2EFIA 4M7DG 1QCFA 1KG1A 3I53A 2LRQA 2VXEA 1A35A 1M1KR 2DD4A 1M1FA 3G1JA 3DU6A 1I5ZA 2ZPGB 1VQ9Q 3IWZA 4KRTA 3EQLF 5B1AH 2GNCA 3RDVA 2VYTA 1YI2A 2B0LA 2XSDC 4B09A 3QRFF 1HYOA 1FPQA 2YRDA 2K5LA 1JTYA 4J7FA 2OTLI 2DNUA 3JCMV 2GA1A 1X43A 4LDVA 3K4NA 5EJCA 2G0EA 5FD5A 5J47A 1ZA2B 4XU2A 3TEEA 2VI6A 2BY2A 4M9SA 3DLMA 1P9QC 1W5CC 5CKHA 1OCCH 3G4SA 2G9WA 1IREB 1WHGA 2F5EA 1U1TA 3QYBA 4ZYDA 3F0CA 4M71A 1J5YA 2PG4A 1YWPA 5GAOp 2V1NA 2X3WD 3NQOA 2HR3A 4RB1A 2DA2A 2ED1A 4MMKA 4ZYAA 5CCAA 1JB0E 4XRFA 3HOWJ 2RK1A 3FXMA 1ETVA 1POGA 2P6TA 4YIRX 1OU8A 1UB4A 1OLTA 1RAEB 5CQEA 1MMDA 5IT9R 2Q2EB 4J9DA 5IHKA 4AC0A 5CO7A 2Y4XA 1HBXG 2O9LA 3ZQCA 2GAUA 3DB4A 1Y57A 2JSPA 2DLPA 4HZFA 3BDDA 2BXYA 4Q48A 4BHBA 4DQ2A 4HF1A 1FMKA 3SD4A 3VS1A 5LJ5d 2VBYA 2O0YA 2YRCA 4ZZLA 4WCGA 4EMSA 1VYVA 2FRYA 3IAS2 3CO6C 2V1RA 5GAMg 1QVGP 2X35A 2DYSH 1RLPC 2LP5A 3PGGA 3N05A 2XDPA 3SFZA 2XAJA 2HKQB 4A69C 4HNTA 5CR2A 2CQQA 3CXCP 3GTJJ 1UAAA 2DTRA 3CD6T 2CREA 1TXQA 3G71I 3M56A 4A4HA 1DQUA 2XAHA 4RB3C 2P5LC 1K4TA 1F5TA 3VPRA 4HAMA 4DIQA 3OYFA 1MW7A 2XGDA 1QKXA 2WV1A 4MNUA 3H3VK 3PO2J 1ZG1A 2L02A 4XU3A 3L2QA 2HQ5A 4XNFA 1M90U 2LNBA 2RQQA 3HL2A 4M7AE 4ZTJA 3A02A 2M87A 1YW9A 3K70C 3JSPA 3DTIA 2MLKA 1K0SA 2ZNYA 5EYRA 1IGNA 3FJPA 2V1QA 2M8EA 2XSJC 3CP2A 2LJ0A 1VQ4Q 3HKZA 2V8IA 3KP6A 2HVRA 1V29B 3V7SA 2H6BA 2GQQA 1K9AA 2JQ7A 3E6BA 4ZJZA 4IUVA 2X6YA 5KYYA 3J81E 3TKYA 1IDYA 4M78F 5M5YJ 2R7TA 3F8MA 3WTSC 1IO2A 1WNLA 2MI6A 3KP7A 3OYAA 2E2IJ 1Q81R 1Z6RA 3H3ZA 2YUNA 1ZLKA 1MBJA 2FMLA 3AL0B 1QW1A 2XPVA 2HYGD 1A6QA 3WTTC 1E0EA 1WJRA 2QQRA 4C0FA 4OVAA 4F55A 1JKPC 1AWOA 2BYVE 2BY3A 4DOVA 3UA7A 2DLLA 2MW8A 3FKJA 2MAMA 5E8IA 3HSEA 5C3EJ 5DM7F 4N4NB 1LB2A 3A8LB 2QKMB 4HF2A 3S2HJ 4CICA 2WSEE 1S5LC 5ILUA 4UB8C 1WQ7A 2ZXWH 1ZUKA 4K11A 2ZXIA 3ZEHA 1I3AA 4JBAA 1WHMA 3E6DA 2COYA 1G3TA 2HDWA 2F6CA 2X4YA 5M5XJ 2LSOA 3BR1A 2ME0A 1VQOT 3ERED 2FEIA 3SFMA 4JS4A 3AAFA 3T1BA 2RN7A 2GF7A 1JUPA 2XKPA 1LDDA 3E0JB 3GFLA 3WGIA 1PC0A 4M75C 4N4HA 4OMPA 1Y6IA 5GAMh 1D0YA 3WTXC 1OX9A 2VKDA 4A3FJ 4B9WA 5HDNA 4EJUA 3GOXA 2WBMA 4Y33A 2R92J 3HZJA 3EUAA 2J5PA 2A3SA 5A2QZ 2J6FA 4ESFA 1WFXA 2A5WA 2IA2A 2DMQA 3OYBA 2DMOA 4HVVA 3GP8A 2CW8A 3ZGKA 2JA5J 1N6AA 1WJ5A 2EFWA 2IS2A 1Z3XA 2P4WA 3BG7A 1SMYF 4J9EA 2CW0F 4AM3A 1X4OA 1J09A 5KYXA 1Y96B 1QGPA 4IHTA 2WAQA 1Q1VA 3ELKA 1GXPA 2X4XA 1ETKA 2VKHA 3NTKA 3OYYA 1A6IA 1TW2A 2OF7A 2RREA 1LEBA 1ZX6A 2EQJA 4HLYA 1RR8C 2FF4A 4KDPA 3Q1JA 3VU3C 3JRAA 1W6XA 4C9YA 1IB8A 5F27A 3GX4X 1NPRA 3RIRA 2NLUA 1ZYRF 2DTIA 3CPWP 2W00A 2Z9OA 4I76A 1LJOA 1QVFS 3C4SA 1C1AA 1VQLT 3FIWA 2A3LA 4C0DC 2FPDA 1MV0B 2CQNA 3CBPA 2X1DA 1B9MA 2M34A 2CQKA 1PDNC 1OCRH 2HWVA 2DK3A 4D8KA 3M07A 4E4HA 3GNGA 1KZHA 3ULRB 3PVLA 2QUFA 2GOXB 1M1KU 4J9FA 3CDHA 2ECBA 1GRIA 2CP6A 2XAGA 1WJBA 4V2SA 5JI6A 2OJED 5ECAA 1VQ5Q 4OMMA 2GCXA 4E6KG 2CUBA 2KY9A 1GBQA 2Y31A 2K3YA 3M58A 1YS6A 1I39A 2P7VB 4XICA 3C2GA 4MEXF 4D7NA 1UHMA 2VBWA 1UGQB 2A0FB 1W1FA 1BIAA 4EJTA 1AWJA 3T8RA 4C0GA 4PJOA 2D1HA 3HPHA 4A3DJ 1IGUA 1IRZA 4HYEA 3QODA 3LNQA 1JT6A 3E7LA 2LCLA 3WVDB 2KZVA 5J40A 1VQ7I 3H9JA 2A6EF 3QWLA 4ZYHA 2QSGX 2RMOA 3NHNA 5M9OA 3KXTA 2M45A 3QZ9B 1APLC 3HIFA 1FY7A 1YJ9I 3CMAA 4XORA 1I8FA 3QBYA 2A28A 1UJYA 4ASNA 1YI2Q 2BW3B 1OPCA 3OOUA 1XDUA 3Q0WA 2QEXA 1ZGAA 3PUFA 2E2HJ 2RJCA 4LDWA 3VDXA 5KE2A 3D1NI 1TC3C 2V6EA 4UHTA 3TDZC 3IWFA 5J4VA 3H0HA 3MQ0A 3G6EI 4YTLA 4PCQA 3L9FA 3J80K 1XGMA 2XUBA 1WGXA 3JRCA 2CUZA 4BE2A 3MKWB 3Q5FA 2KP6A 1BW5A 4M78C 3EG9A 2V1UA 4HX8A 2RN8A 3PSFA 1XN7A 4F7UB 4LDXA 2NYXA 1BI1A 2GQVA 4Z88A 4PJOD 4EJVA 2D8HA 3CCET 3BG9A 3IQLA 1R7JA 1G2BA 1BCMA 4PFPA 2WACA 2EFQA 1VQKI 1J59A 1H92A 3ZMUA 2EBPA 3IAM2 1Y1VJ 2ZJ2A 5FU6C 4IX7A 5DYMA 2K02A 2ZGWA 4OAZA 1NTCA 2JJ7A 3M8FA 4NC6A 5KK1A 5LLQA 2X6WA 3OA6A 3GIBA 5J3LA 1IXSB 4PKCC 3DTKA 1FTTA 4P96A 4PJMA 3CZ6A 3BJ6A 1ARKA 1TWCJ 2Z3YA 1NHAA 4FYYB 5FLXK 4M6VA 3DP7A 3IC7A 4JJCA 3T5XA 1BI2A 4AFUC 2J7IA 3JRBA 1RADB 2RV8A 2FL7A 3QIIA 5IN1A 3PM1A 4OINF 3FX3A 1XCBA 1M4ZA 4A63B 5LJ3j 4FASD 4M7DF 2BZTA 3I64A 3CMEI 5LJ5e 5GAN3 4RM3A 4G12A 4ETSA 3S2WA 5L3BA 1QP2A 1RLQC 1Y8RB 1I5LA 4CGZA 1AEYA 1GLNA 1Z7UA 2W25A 3K4BA 1ETWA 4I09A 4DBRA 3JRDA 4XTUA 5GAOn 2LMDA 5FKOA 1JJ8C 1TLHB 2WY8Q 4BQQA 3TQNA 2HNHA 2M35A 5A0GA 3H9NA 2VXZA 5KCOA 2KRFA 4IOAF 1Y07A 1PVEA 3QKJA 2VGMA 1ITYA 3RQ4A 3M4YA 3PIPA 3DEUA 2ZMEA 4DYCA 1B34B 3P9IA 1UFFA 1WX6A 1X2QA 2K9SA 3CUQA 3I3LA 3OIQA 3VYHB 2H6CA 4E70A 3CD6A 3CCLT 4M75B 1O3SA 3DFGA 2FBIA 5E1XA 3OS0A 1P7IA 1NYGA 4II1A 1KD1C 3HUGB 4PZJA 1SEUA 2R93J 3K4MA 1H89C 1T6SA 1WJSA 4ZC3A 4L0YB 2HL5C 3KYCB 1EZZB 2MCNA 1JJ2S 3JCUC 1XSVA 4A3LJ 1WYXA 2F5FA 2RHZA 3W3CA 1OQYA 2F1LA 1T38A 4J9BA 2KMUA 6PAXA 2A05A 1IDZA 2CZ1B 1SFXA 3MAJA 3M4GA 1MMGA 1B34A 2HVQA 3OMCA 1AWWA 3LH0A 5CKEA 2QWWA 3IUOA 4HW0A 1XTDA 3R60A 3OBWA 3OMGA 1ON1A 2CUEA 1RIOH 2K3FA 4I02A 1F1BB 3K6GA 2AZVA 2M8GX 2VUBA 3K4JA 1VQ4T 1UCRA 1CSKA 4B6MA 3EGDA 3DKYA 1X2MA 2LH9A 1UELB 3HUGA 4RM2A 3FK6A 3CCJI 3TEDA 1JJ6C 1IGQA 2HVSA 2DXCA 2DCEA 3JCMW 1KD1R 2H3JA 2JVGA 1YO5C 4UY8I 5GTIC 1OYXA 2ZAEA 2VOOA 1ONVA 3VSLA 2DEQA 4P55A 3X20B 1Z7LA 1K83J 4HDUA 4EM1A 1GVJA 4VUBA 1T0FA 2X6OA 2K3PA 2GZWA 2KISA 2QXFA 4F7UG 1NYFA 4MFDA 3TSZA 5GANe 2ESHA 3LWFA 1MUZA 4MTDA 1ORKA 2R7OA 2DK8A 1WGSA 2ZSIB 4AG1C 4L9VA 3LSRA 2ZZDA 2XIDA 2DL3A 1VQOA 5BMZA 1XOVA 3S17J 1YJNQ 1I3QJ 5LJ5j 3CCVQ 1W36C 1OI1A 2HTJA 1S9HA 2RJDA 3LYIA 1XMKA 1G3YA 2CFXA 2DN0A 1NM7A 1ERDA 1ZGWA 1RI0A 2XF7A 2XAQA 4ENJA 3MO8A 2EIJH 1WJCA 1IXRC 2DAOA 3S1RJ 4JK1X 1CF7B 5GANd 4M9XA 2X0LA 4Z6YA 4V2GA 1NG6A 2E5ZA 5HS7A 1VNDA 5F1JA 5K5OA 2C6YA 1JQQA 2DX1A 4C92A 2FJ1A 4A54A 1LNWA 2E1MC 1D3BA 3CXCS 3FRNA 4QW2A 2XF5A 1VQ6I 2L3PA 1YRNB 2EYWA 5KYUB 1RKTA 1XB4A 4XLFA 5EZGA 4GYIA 4M9ZA 1ZGJA 5F08A 4D0PA 4M74A 2NWMA 3CUOA 3M9AA 4M78B 1Q95G 1UGRB 2VOPA 4QVDA 1KC8C 4QTRA 1MH4A 1HDPA 2K27A 2Y48A 4AMCA 5FKLA 3BROA 2R7UA 2OD5A 4C3JJ 2IP2A 2PNIA 1VQLA 4MZPA 4I0AA 4RAGA 4L5JA 1BBZA 3QP5A 5J3BA 3J80R 4XM3A 1U9OA 3V8LA 5FU6B 1BYMA 3A8GB 4DBHA 2E34A 3BP8A 1ACIA 5GPAA 2GQIA 4NL2A 1VQNI 4A3CJ 3CMAQ 1J3TA 2R5MA 1IHWA 4E7LA 3J7AY 2JNGA 1DU6A 1RAAB 2WSCE 5FRNA 3EH1A 3I56I 4M75G 4PSWA 2QEXQ 3HL8A 4F16A 1W1WE 1X4PA 4QLCU 4L9NA 2HXOA 2JOYA 4B47A 3H3UA 4C92D 2XASA 2QQSA 5KYUA 2XD0A 2CP0A 3AG2H 3FK7A 1N27A 2JT4A 2KRMA 2YHTA 3QWYA 5TRDA 2FQ3A 1PD1A 3J81Z 3VKIA 1E7OA 4FU6A 1VQ5T 5JVGF 1VQ9I 3CCSI 1V3FA 2K4JA 4BQAA 5FLXR 4OMYA 5DUKA 4CYCB 2I2LA 1KC8R 1KU7A 2M0OA 1EF4A 4KN7X 2EQKA 4DYRA 3REOA 4IRIA 3GZ6A 2ID3A 3QUIA 6AT1B 4OMFB 4PJLA 1KK7A 2EIKH 5E18F 2STWA 4Q5SF 4XAXB 2XDVA 1MV3A 2LVMA 2VWFA 5D6FA 4G94A 2VPLA 4R8HA 5KCHA 1J0RA 4JOMA 3I58A 4KMUX 2JUCA 4C3HJ 2EA4A 1RI7A 2MG4A 1BCOA 3O8VA 2PTKA 2IXSA 1ZLMA 1X58A 5GADJ 5B66C 5IOYA 5K5QA 3U1KA 4S04A 3ZQHA 2VC0A 1A5JA 2K9MA 2LCSA 2LREA 3NEUA 4Y3OA 2OJ2A 5DCFA 5IPAA 2N8GA 3FMQA 3KEOA 4C92E 4D1QA 2X9DA 2XHKA 4JX6A 3GPLA 1SAUA 2DJIA 3ESWB 1YTYA 1X01A 2CZ7B 1GUUA 2LMJA 4C5IA 5CKFA 4FHTA 3W6KB 1U5SA 3OWTA 4XLHA 1X6OA 2DBMA 2LC4A 1S1NA 1MJAA 3UA6A 2DFFA 4BEHB 3LSGA 1HKQA 4FX0A 3O8HA 4QWQA 5JVTA 5J4YA 2AS5F 3CCMT 5HODA 4LOCA 5L3DA 5IHIA 3WG9A 2VVKA 1U8RA 3A8MB 4M3DA 4F93B 4LE9A 3OYGA 3L42A 3QJ6A 1IN6A 1X3ZB 2E5KA 2DFUA 5FWBA 4A6EA 3CPWS 1WPKA 2HZTA 5D7UA 3K0LA 4AVPA 1AVZC 1M9SA 3ZQGA 2MK5A 1XTAA 5DUIA 1JKRC 1WJDA 3E9FA 2L0KA 3JCMQ 3PIOA 1KQSP 3CD6Q 1OFCX 2HGCA 1D09B 3RESA 3MVPA 3OS1A 3VYUB 2E5NA 4HBLA 2BBYA 4ZGEB 1A04A 3ZR8X 2P5VA 1HSQA 1IRXA 1MMSA 3HB9A 4KUDK 5FKKA 2FVUA 2IS4A 4NUBA 2PI0A 5F0HA 2V1DA 2MZ4A 2D8JA 2XG8D 3KLNA 3S1QJ 1XX5A 4BAYA 4M78G 1KD1U 4ESJA 4J19A 1SMTA 4E6RA 1LVAA 2KDOA 4MQ9F 4A3GJ 3BT9A 1M1EB 1GV2A 3ZQ7A 4B44A 1A31A 1SRMA 3JCMJ 5KAFC 2ISYA 1UJ0A 3GVAA 1QCOA 3OS5A 1N25A 4LB6B 2BTTA 3KYDB 3M1EA 2DI3A 3TP0A 1F4KA 3RPUA 2K4YA 3KX2A 3I5SA 3GO5A 4IOCF 5M3FJ 3HOUJ 1K9MC 2PMZA 2PJRB 1YE9A 1RL2A 1B9NA 3HKSA 4ZYGA 2PMHA 4LMYA 3OY9A 1RACB 2DKGA 1QZYA 4F14A 1GXIE 3QJYA 2PEXA 2DJZA 5EGOA 4WXHA 4LD5A 1R6RA 1YX3A 2KDZA 3HDDA 1K73C 2AQFA 4PJOF 5KYWA 3CLQA 2NVUB 1V54H 1GBRA 2WWYA 1KQ2A 2CV2A 4J9HA 1T56A 1TWFJ 3VODA 4GCVA 4ABZA 5FLMJ 1ZG5A 2BZXA 1XMXA 4CRIA 3LMMA 5E8GA 5LJ3e 2E1MB 3P5JA 1O7LA 3I59B 1AOJA 2AZSA 2YS9A 2L3DA 3HSRA 1SAXA 2KRCA 3C2HA 2O6GE 1DGRM 1U9NA 2LY1A 4Y15A 5EG2A 4JRKA 1YJWT 5H6RA 3CO7C 5FRMA 2KLOA 4E2FB 3ABTA 1SSFA 2E10A 5GMKh 2BV6A 4KBMB 1EH6A 2ECCA 1VQ4A 5FO5A 3KZZA 1BC7C 2IA1A 2CFOA 3RPUD 3BG6A 2W84A 4E7KA 1K9MR 1K78B 2VPRA 4D5FA 1OISA 1IN8A 3QYHB 3QOEA 3BTCA 5C0MA 3TOBA 2ZXHA 2A6HF 3FF5A 4IJAA 2K79A 4CZCA 5FGMA 4M3EA 3N97A 4R79A 2FB7A 1M90R 2EZKA 1MNDA 4Q47A 3ABUA 2DTZA 3MKZA 3CQZJ 3DKMA 5E3LA 1H9TA 3M0UA 4HRIA 1RESA 1FC3A 3MFKA 4MIMA 3L2RA 1HD3A 2AK5A 1W7PD 3CF2A 2HDAA 2M02A 4LG0B 4J8OA 1UHWA 2KGTA 2KVQG 2JZYA 3G71T 1XPXA 2QQAA 4XRSA 3MZ8A 4RS8A 1K4US 3BZCA 1S6LA 1BOBA 2E70A 2HEOA 4DBFA 2EAYA 1ZK8A 1QWFA 2B8AA 1WHHA 3C1DA 3UPUA 3DEEA 3MP1A 1TUCA 3GWZA 1YJNT 4NOYA 2EIFA 4XQ3A 5FFZA 3TDUC 4U88A 1ULYA 2ZKZA 5D5XB 5J8CA 3L2ZA 3CCVT 5J1UA 1KC8U 2RQRA 2P81A 3OIPA 3AHUA 2HQNA 2E1OA 2MA3A 1E2XA 3HHGA 2MWPA 4WX9A 4WTOB 5ED4A 5CIUA 2DBBA 2FU4A 3M0SA 4I01A 3CBOA 2WY7Q 2UXXA 2EILH 2JUGA 1ZRFA 3SWNA 1W2BA 1W70A 1S7OA 1YIJQ 3ASOH 1TWBA 2EK5A 2Q8KA 1YWOA 4LG0A 2XK0A 1IRFA 2XGCA 1OKRA 3JW4A 3EFSA 1WXBA 2L2PA 4KH1B 4LLGF 1J2XA 2MD0A 3R0JA 4CSWA 2ADUA 1YIOA 3M7GA 4WWCA 3PIPF 1B8IA 4X9DA 5GAHJ 3J7ZI 2OUMA 2GGRA 1YI2I 3LWIA 2DW4A 1O4XA 1VQMQ 4UUSB 3JSCA 3WTVC 3HGGA 4W97A 2CSOA 4Y52J 5HKCA 4BY6C 4KICA 4OB1B 1D5YA 1EFNA 3FXLA 2ZXJA 3KLOA 4J00A 1AA7A 1C0WA 3VUBA 2WA0A 2HOEA 1X75C 3EGXA 2VB6A 1TTYA 2DA4A 1XCVA 2JSCA 2X51A 3FXUA 3ZMVA 4EJOA 4ZH4F 4UB6C 3HHTB 2LKPA 4IURA 2M1BA 1OQKA 1VYUA 2PQWA 3JCMd 1YOVB 2LDUA 2DOEA 2DZ9A 2LQNA 1LKXA 4IQ4A 1ETOA 1MH3A 4ZDPA 5IXFA 3SZTA 3RKWA 2DQLA 3BTIA 4RCCA 3EDPA 1VQ5A 3QU3A 3UNGC 1OULA 1FYKA 1LE8A 2HDDA 2MH2A 2OZ6A 1U2WA 3SDGA 1XGOA 2VXDA 3SQNA 2R5YB 3KIOA 5H6QA 2OBPA 4ESBA 2DA9A 3HTUA 1B59A 4JQFA 2CT3A 5EDNA 2MUNA 4RTTA 1RABB 4Z8AA 1Q86R 4M7AA 3PSIA 4PLLA 3DKXA 2ZFUA 4QSHA 4PJOC 1NG7A 3L00A 3QU6A 4R56A 2XVCA 5I2SA 2QGGA 5CVVA 3R6OA 1HLVA 1TT0A 1M2VA 4XRSG 3SWNB 1N5ZA 5DS9A 5EEHA 1VQ8T 3TL4X 1TTHB 5GANj 1IZ1A 3EUHA 2QQ8A 3BR3A 2MMPA 3S14J 1ZSZA 3W2AA 3SZPA 3GTPJ 4L5GA 2DVJA 4N4OB 2Y0SA 1MJ9A 2R7SA 5J8FA 3M1CA 4AIHA 3TOAA 4PFOA 4QPOA 1QVFA 2Z1DA 5D6EA 2R5YA 1YCSB 2DA5A 4PGGA 2OAUA 4ZN1A 4IQJA 4WXDA 1Q82C 1WZOA 3BWGA 3JB9D 1TW3A 4GDFA 1RAIB 1TUDA 2X85A 3PQJA 1EH8A 4D9JA 1QWEA 3CCMA 3LLRA 2MBFA 2FOWA 3E9GA 3GMEA 2Z33A 1OCZH 4PL6A 2YUQA 2JPCA 2P7CB 5D6YA 4NL3A 3CMMA 1N9RA 5DEQA 2HQXA 1X1PA 2MOXA 3JAME 4M7AD 2DO3A 2XGXA 1R58A 2B86A 2A36A 4OOIA 1KHIA 3O2PE 4FE7A 4FT8A 2ZB9A 1PRMC 3PNVA 5DDGA 3JTHA 3DBLB 2RQUA 4QVZA 1D1BA 2KROA 3GZ5A 4UUTA 2QYZA 4C3IJ 1BB9A 2Q0OA 5GP9A 2NNYA 2CZ0B 2CP2A 2D2WA 4C92F 1S72T 2NOGA 3CCQI 3QYFA 4PJNA 2EPDA 5BOXA 1RRJA 2DOAA 3DLAA 1PCXA 5HS8A 2A7YA 2KRSA 5A2QK 2QDYB 2IRFG 3DEWA 1UZCA 4JYKA 5KYYB 2EZLA 3KFWX 5CQGA 2KJCA 1WI7A 2JUFA 4XTZA 2H27A 2F5VA 1Y71A 4HCKA 4M7DB 2EV6A 2VODA 3SZGA 1K9MU 3R61A 3G7ZA 2LX9A 5HY6A 3VS5A 2KL4A 3M53A 4L5IA 2NS0A 3FM3A 2AQEA 2M4GA 1X1DA 2O5RA 1JXSA 1U1SA 2IW5A 3BTJA 1KQ8A 1U3OA 2CSQA 3RYRA 3TCJA 1K73U 1KONA 1X19A 1BA5A 1FIAA 1QU3A 2ACJA 4JZ4A 1TUGB 3FHNA 2GTJA 4AD9A 2JTVA 1OEBA 1FEXA 4YEJA 1XQHA 4E7SA 2JMWA 1MGQA 1R00A 3GXOA 2YX7A 1OYWA 3L2UA 1Z67A 2FZGB 2CZ6B 4J9GA 4UC4A 1IAWA 2ENMA 2E19A 3RMQA 1FSEA 4Y91A 1YHQT 4BXFA 1QPIA 2IG0A 2ZMEC 3GW2A 3P9KA 4IRHA 1SHFA 2HKNA 2WADA 1I0CA 2HKXA 3CUQC 3NFCA 1DU0A 1YITT 1XSDA 3SHFA 2BEOA 1M3AA 1XJWB 3DLLA 1OYYA 2GLOA 1I1SA 2O8XA 4RGUA 4PLIA 3KUFA 4B3XA 5DTDA 1AWXA 3E97A 3S6WA 2LNVA 3DBRB 3Q3SA 5F04A 2E41A 3CPFA 3ASKA 3TQ7P 2CP3A 4RTVA 1RAGB 1KGSA 5E17F 3ZN1A 5GAOm 1LFUP 2GFUA 5EC7A 1YJWA 3MP6A 1W0TA 2RK2A 5I22A 7AT1B 2HAXA 3I9V2 3LQRA 1AHDP 1T0HA 3ONQA 3JB9J 2DETA 2O8KA 2ABLA 2CP7A 2KFDA 2VJIA 3O8GA 5CKBA 5KYXB 1DP3A 4ON0A 3OYLA 4X1EA 1VQPT 2AO9A 3OYJA 2LVSA 3IKVA 3H92A 4R1HA 2E3IA 4A4KA 4A0XA 3ZPLA 2MH9A 4CCNA 1FX7A 2UV1A 2CG4A 3O6BB 1LOJA 4BY6B 2O03A 1OCOH 3BCAA 5CQYA 1BJZA 2LG4A 2PU9B 3RBBB 1F43A 4HX4A 5DD8A 5JLWA 4HXJA 5GAN4 4HEA2 1B4AA 1V4RA 3G1MA 3VS6A 2KIUA 5AONA 3FZVA 1PP7U 3F8NA 2KYMA 5DCMA 4HV5A 1NK3P 2CSIA 1WZ2A 1V5EA 2OQGA 5HOOA 5JFRA 1R9TJ 5GJWB 1KQSS 1MBHA 3QP6A 3QXEB 4Z2YA 3SYTA 4HA8A 2QQBA 3G71A 2R7QA 4UV8A 2IGKA 2NS7A 3HKZN 1BL0A 3TU4K 4G7OF 5D8LB 5LJ3f 1T0FC 1R1TA 2M16A 4NHJA 4B4CA 3LFUA 4BBSJ 3CMAI 3ZQLA 4P5NA 4BI8B 4PJOB 1ZLJA 3CCVA 1I1GA 2K9LA 2VN2A 1E3OC 2VV5A 2O31A 4FE4A 3FMSA 3ZXSA 1EJ9A 1Q86U 2EGEA 2K9QA 3ZMZA 1B72A 3W6VA 1FMWA 3PIOF 1YX5A 4JUVA 4EIKA 4A0YA 2LT1A 3EG1A 2QGUA 5HVQC 1NH3A 4XOTA 1PJRA 2HQAA 3OYCA 1QNTA 1REPC 2A6TA 5C44J 1HF0A 4OB0B 3BDLA 4FQGA 4AFZC 4C5GA 5IP6A 1IN5A 3UR3C 4C92C 3S2DJ 3G4SQ 3CC2T 2KIFA 3CCJT 5B1BH 3GTKJ 1R0CB 2KRNA 4PJJA 3C2BA 4OMLA 3I55T 2KT8A 2B9SA 3FJ5A 2V26A 3GF5A 2VASA 4KH0B 4ESRA 2DOFA 3Q0UA 1R5HA 4NC7A 2ROTA 1YIJT 3ZRGA 1P6RA 1R77A 4QKUA 3EG9B 2NVQJ 1OR7A 3BZKA 2XDDA 3H5AA 3DB3A 4IXAA 2FEZA 1AKHA 2LKSA 1UE9A 3QOPA 4DA4A 2R57A 1NJIC 1VF9A 2PX9A 2Y0MA 2Y90A 1ZRCA 2JPBA 1VQMT 3GCMA 5LHHA 2KK4A 1X6GA 5E20A 3H1CA 2KI7A 2K85A 2LT4A 4IO9F 5D4RA 5AYFA 1EIFA 4LJZF 2WAQN 3VYRB 4A12A 2RVCA 3E5QA 4KUMA 4RTXA 5IP7J 3RKQA 3ECHA 2D5VA 4EM2A 2EYQA 1GV5A 2K86A 2V8KA 4P9UA 2HZDA 4WCIA 1OPLA 2HCKA 1TP4A 3D0SA 3OR1C 2FMYA 4QT7A 4C5EA 2PJPA 3B02A 1TWHJ 3V8KA 2FRHA 2H1KA 2TRTA 2L3SA 1ZHFA 2VKNA 3CCMQ 4UVBA 1QVGA 4DJAA 1X27A 2QBYA 2JRTA 3OSFA 2XU8A 1TT5B 2O7OA 2HNIA 3A8OB 4R55A 3CC7Q 3GEZA 4FT2A 1QHHD 4IPAA 5AIQA 3ABLH 2L5QA 1VQ8A 5A2QR 4OF1A 1JUMA 1ZR4A 4OB3B 1TWGJ 4RBOA 1QA6A 3CD6I 1SD4A 3VB2A 2H09A 4XK4A 4JP0A 3M0TA 2ZSHB 1PSFA 2I0NA 1LEAA 2PVOB 1IHVA 2GM4A 4M77D 5LEJA 1ABQA 2NXNB 2ZMEB 1G8XA 1OX8A 2HYJA 3LSIA 3CUQB 2QTXA 3EG2A 3DCFA 4CCOA 2RF0A 3HGYA 3BC8A 2FNPA 5LGNA 1ZUYA 1I4K1 4XKCA 2JN0A 5GAGJ 3U1DA 1QQJA 3CJQB 5K7HA 4JZ3A 3SFIA 5IH2A 3KP4A 2DMPA 3VV0A 4ZTFA 3CF5F 4BJ6C 3TO7A 5FROA 1W5TA 4XK8E 1BW6A 5HNHA 1QVPA 3MN2A 3SDZA 2OTJQ 2X1EA 3CQTA 4EPCA 4PJOG 3CEYA 1UECA 4C0DB 4G6DA 2DA3A 3S93A 4FYVB 3CCST 1S72A 3VSKA 1GCPA 4EMKA 2LK2A 5BQTA 3EFOB 4P9FA 4ENNA 3M4OJ 3CC4T 2HOSA 2RQWA 3RKXA 4FCYA 5DM7R 3WU2C 1MMNA 1D8JA 3F23A 4RMOA 4DYQA 3H5NA 1KU2A 1TWAJ 4EJWA 3CCLI 1WPYA 3PNWC 3BPXA 3BR2A 1K1ZA 1M3CA 2DTHA 4FYWB 2D0NA 5GAMd 1X6BA 4M77E 2W48A 2AT1B 4ATOA 4AYBA 4XMYA 3MZYA 2R7DA 3EGDB 1LDJA 4CA0A 2ZFWA 4JS5A 3FLGA 2VBZA 4II3A 1VQOI 1QMCA 4RAYA 1I5OB 2Z5UA 1PUEE 4KIGA 4OB2B 2YUSA 2D0QB 1YJWQ 1LQ1A 1IXDA 3G3ZA 2MPXC 4UVAA 2R7ZJ 1KA8A 3ERMA 3I54A 3K1NA 3SEZA 5IT9E 4AIJA 3ASNH 3A01A 1AU7A 1YHQA 2QASA 4ORZA 4L0ZB 3EFOA 2CV0A 3GBQA 3HC7A 2W1OA 3BTLA 4IZZA 4LUEA 1WQWA 2AIRB 3DTEA 1ZARA 2LDMA 5D5VB 5M5WJ 2I10A 2OA4A 2R5ZA 2WB1N 2OI3A 1YITA 1L0OC 4YIIA 1WCMJ 3A03A 1IV8A 5C4XJ 1STZA 4X1VA 2F4IA 2IEKA 3BE3A 2M2EA 1IZ6A 1BR1A 4RMNA 2RHUA 1Y8QB 4BE1A 2ETHA 3GTGJ 1D0ZA 1Y0MA 2CP5A 2YLBA 1FBUA 2VBXA 2I8DA 4M7AF 3HFNA 3SJMA 1P4XA 1PWTA 3OBYA 2IGOA 4X34A 1PSEA 2IGMA 1I50J 4LIVA 1WSUA 1T3SA 3J81K 4C92B 2LR8A 2JA2A 2RAEA 3HPGA 1VQLI 2LNHB 3G71Q 4AVZA 3K70D 1EA3A 4A4EA 4IUPA 1D3BB 5FLVA 1O7FA 2P0WA 1YJNA 3HFOA 2JMCA 5CK9A 1VQPA 4LXCA 5JLXA 1MDMA 2E1HA 2PMUA 3AG3H 5IYCJ 1PUFA 1E3HA 1ZREA 2DE0X 1IJWC 4MMLA 3NTHA 4ZN3A 2K9NA 2LP0A 2VIXA 4LITA 1IV6A 2RNAA 1AZGB 4OP0A 3LA3A 2MLGA 3OYMA 1JT0A 1IRGA 3C12A 2EFNA 2HS5A 3Q9VA 3DF8A 1T3LA 3MP8A 1FP2A 2HI3A 1MJBA 1HDDC 3EH2A 2V79A 4LLLA 3JAMZ 2DPPB 4QVCA 4GYGA 1O57A 3B6CA 3IH2A 5FD6A 2FYKA 2R7XA 4U0VA 2X4WA 3OW2A 5FU7C 1N78A 3MZHA 2EINH 5D4SA 3P8BB 1ZN2A 2O88A 4F7UE 5EG0A 1FBQA 2QCOA 3WGGA 4BJ5C 2BE9B 1QQIA 2KIQA 2DDBA 2RGVA 1Y56A 2CYYA 5L3GA 4CHUA 3CCRT 2QSFX 2KRHA 1QKWA 3W2WA 4LDUA 4OIRF 1QCNA 3IHUA 1PHTA 3BQYA 5K7ZA 3BOQA 5F64A 1YP5A 3HYIA 3V7CA 4A3EJ 2K57A 4M75D 1PYVA 4RLFA 2IBDA 3PJRA 3ML6A 3QYEA 4X6AJ 2K2VA 3I35A 3P8HA 3PMTA 5L8RE 4M3BA 1M8VA 4LNPA 4Q4ZF 4OWRB 4IVNA 1TQPA 3QPHA 1D8KA 1UB9A 5BS6A 3SB2A 2BY1A 1G6NA 4E7JA 3CCEI 2DA6A 4HQEA 1VTNC 3CC2A 2F4OB 3F21A 3CCJA 4HT8A 2DT7B 1Z77A 2E64A 4M6XA 3I55A 3NAUA 1B1BA 4JJNK 4OGCA 4U0WA 2VUMJ 4MO7A 1R5GA 1T0JA 5LJ3g 1IN4A 1YIJA 1Z21A 1Y1WJ 2F5DA 3HJEA 3H0DA 2A69F 3SWNC 4DEXA 4F17A 4D7MA 2RHYA 3E2UA 2FZKB 1ODDA 2HQRA 2XDBA 1PKSA 4CZZA 2EFOA 2DVEA 4GY5A 4MZMA 2QA4T 3LQQA 2VKEA 4XTWA 1S8NA 4KA4A 5EF6A 4IF4A 2LLKA 1JXMA 1KYZA 2EVRA 4N0AA 1VQMA 2JTEA 2NUTB 1FSHA 4FW1A 2BHZA 2RKHA 1VQ8Q 1RKWA 3SEQA 2NUPA 3TSWA 2DRKA 1JGGA 1VOMA 2L9SA 1SFEA 5CAIA 4O6JA 4M75E 3WU1B 4IEJA 3DLLF 3A8HB 4FIBA 1ZQ3P 5AT1B 1FJLA 4A0ZA 5TISC 2DYBA 3VRYA 3TO6A 2OU2A 2EYYA 1HKTA 2M51A 4EDUA 2W24A 4G8XA 2ESWA 4RTYA 3CMYA 1ZHIA 1P4WA 3HRTA 1D0XA 1FYMA 2EV5A 3BY6A 1HJDA 4Z02A 9ATCB 2W4SA 1F36A 1UMQA 1RZ4A 4F7ZA 3S15J 1NBEB 4HCCA 1WQ2A 2G7HA 2XF6A 3K10A 2L9VA 4BNCA 1T08B 1ZELA 4HNUA 3JCMb 2E5QA 4KULA 4C92G 3HSBA 2JM8A 3JCMc 1HQCA 2AXLA 4KT0E 3FIFA 2XPUA 2OCCH 3MD2A 4XN3A 4P1WA 4A5MA 1HW1A 4M7AC 5LFAA 4ANJA 3CCUT 3IP4B 4LK1F 4EVIA 1W2BP 3F8FA 3OYEA 3L1AA 4XU1A 1E17A 3KP3A 4JLIA 2FOKA 2PQ8A 2F2VA 3HOZJ 2G7UA 3U2RA 2RI2A 3NTIA 3CC7T 3HSFA 4ZYEA 1SD7A 3E19A 1R5ID 2JRMA 2E12A 4NQWB 1S72Q 2H1LA 3JV3A 1JO8A 4XLPF 2XICA 1SPKA 1FMVA 3RYPA 2RQVA 4A5NA 1FXXA 2CT4A 2JK3A 4RUGA 3RZOJ 3B6AA 3EUHC 5B3SH 5D6XA 2V9KA 1VQNA 4EATA 5GAEJ 1GHCA 1ZSZC 1YNZA 3H9QA 3IV5A 3FDRA 1PD0A 4IUUA 1KYWA 4I0BA 3LSPA 1TNSA 5E3NA 5HS9A 2IIMA 2RPNA 5LJ3h 4RB0A 3FXOA 5HDGA 2EZHA 2B7EA 2VQGA 3ISPA 2KIMA 4CCLA 1XG1A 1NLPC 1FBSA 5EGOB 3DPTA 5E79C 4C8QA 2COZA 1G3SA 3G6EQ 3DPUA 2JMAA 4DBQA 5DD4A 5KYWB 2LC2A 2EBIA 2W85A 2HDCA 1EX4A 1VQ4I 2XAUA 2FNAA 3CCSA 1R1VA 4XSXF 2X3XD 2KEAA 3ZBDA 2HXIA 2LD5A 5K1YA 2YT6A 4M72A 2OC6A 1H641 3U23A 3CC4A 4NQWA 1YHQQ 4LFUA 3WE2A 4CO8A 5L3EA 1I81A 5LJ5g 2OTJT 2MC4A 1E3PA 3GUDA 5LHIA 2H94A 2LY2A 3FISA 3J81R 2JM9A 1YS7A 1YITQ 2ZNZA 3NARA 4AFQC 3EFRA 1OPKA 1PG5B 2ZPFB 3S16J 3C95A 2HSPA 2WSFE 3CESA 3PE0A 5CYVA 1XS9A 1BK2A 4PSXA 3META 3N5BB 4M4ZA 5FU7B 2X4JA 1YYVA 3ZQQA 1EH7A 4M78E 4YRVA 3LW5E 4M77A 2M5WA 2AKLA 4RTUA 3GTLJ 2OTLT 2R7VA 2C0OA 4ZNXA 4C8QD 2X98A 4BYYA 3X24B 4BDYA 1NZ9A 2XHCA 1W7PA 5KH6A 5LRRA 4BJTA 5C4JJ 2P0PA 4HVUA 2IVWA 2XMFA 1H3ZA 1VQPQ 2UZKA 3VYGA 1LDKB 1R36A 5LL6S 3GLLA 5EEGA 4ZDLA 4IHSA 5D6WA 4C2UA 4J83A 5LHGA 2MD5A 4OIPF 3K4KA 4ITVA 4OMQA 4L5EA 2VQLA 4HCBA 4S0HB 2D1VA 4KIFA 3EETA 2V6CA 1TL8A 2BIVA 3PUBA 2ROLA 3P8DA 2D9TA 3X26B 5HK3A 3JCMe 4HT9A 2CKKA 1R1UA 1GCQA 4I6ZA 3M57A 1Z9ZA 2J6KA 4BH9A 1K6OA 2F69A 5GANf 3HRMA 1MZBA 4LN2A 3GZNB 3LSMA 4QPQA 1WA7A 2JS0A 1AZEA 1RR7A 2DJNA 4P5OA 2DAQA 1K73R 3EYYA 2K40A 3MCAB 1VQOQ 1X3WB 2P6SA 1HSTA 3GLXA 2H8RA 2DL4A 2DM1A 4OMZA 1S29A 4HSRA 4PFZA 2DJQA 2DMTA 1SFOJ 2PMZN 1UDLA 2Q1ZB 2DO7A 4IRGA 3I0TA 1XDSA 3ZMSA 2FRWA 4C8QE 3GFIA 2KT0A 1MGTA 2CQXA 5L3CA 4DEYA 2HPIA 3UDCA 2GWRA 1KU9A 4I2OA 3HXLA 4I7HA 3LWHA 2TDXA 4KYWA 2JW4A 4KITB 1B8IB 3QYGB 4A4FA 1XGSA 4HQMA 1OZ2A 2QQ9A 5KYNA 5LJ5h 1H0MA 3X2QH 2V9PA 1QBJA 2NVXJ 5GAMj 5GAOl 1G4DA 1YCYA 2AKKA 5TJJA 1VQ5I 3FMRA 3I71A 3QQAA 3GFMA 4RAZA 5D8KB 1JU5C 3E5UA 1VI0A 3EGXB 3CCRA 3H9GA 3MKYB 4L18B 1PKTA 4A3KJ 2ZPHB 3CC2Q 3CCJQ 3JSOA 2CRGA 2M30A 3I55Q 1FZPB 3DPLC 2ZO4A
chains in the Genus database with same CATH topology
3IL2A 1HSJA 1Z05A 2R7FA 5J39A 1N8RC 3WODF 2MWOA 5GAN5 2A68F 1Y0UA 4L59A 3MEWA 4DOWA 1D3YA 1YG2A 4M7AB 3VEPA 1AWCA 4OIQF 4RG2A 2MC3A 1QZZA 2VE9A 2RB6A 2RO0A 2XI9A 4C5HA 5CQXA 2EQUA 4JDSA 5IT9Z 3TREA 5GMKl 4XTYA 4KFCA 5CLSA 4RB2C 4WK8F 4J7IA 2YR2A 5A0LA 3LGLA 3OOPA 1U5TA 1PP8F