2QQ9A

Crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
212
Chain Sequence
DLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 73
structure length 212
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qq9A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qq9A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qq9A03
4IRHA 2UXNA 2VN2A 1FT9A 2ZMEA 5ILUA 1OPCA 2M8EA 3LSTA 3BROA 1HKSA 3MZYA 1ZARA 4KA4A 4RGXA 3KCCA 4HYEA 3CUQB 1KU9A 4A6EA 3T8TA 4BHCA 3QOPA 4P9FA 3SZTA 2VE8A 4ZYDA 6PAXA 1J5YA 1H9GA 1YQAA 2D45A 3RJPA 2AXLA 4BXUA 5LGNA 2OU2A 2OAZA 4EJOA 3CUQA 5LLQA 4HQEA 4RB0A 1T98A 3HRTA 1O57A 2JTVA 1LDDA 2EV5A 3TDUC 2DLLA 1Z91A 3RYPA 2G9WA 5CVRA 5KVRA 4YFKF 2PG4A 1G3SA 2QLZA 4UVCA 2NYXA 2VC0A 2LNBA 1QZZA 4OINF 2PFBA 3E19A 5H20A 3TOAA 1L3LA 2VBXA 3COAC 1YLFA 5L3EA 2MD5A 1YTYA 3U9GA 3ZMDA 2DQRA 3R6SA 4KMUX 3I71A 2W85A 2Z33A 5DD4A 1HSJA 4R1HA 1S6LA 3R0JA 4LJZF 5CVIA 1MJAA 3HRMA 2NNNA 2HQRA 2IP2A 1WSUA 5CYVA 2P6TA 3NEUA 2QENA 1P2FA 1T39A 3TOBA 1RI7A 1KYWA 1KQ0A 4N9IA 3GLXA 3T1BA 2VE9A 2FA5A 4HF1A 2EV6A 3QU3A 1ZG3A 5J6XA 2YX4A 1BI2A 4KT5C 2NNYA 4G7ZF 2FEZA 2MLGA 5K5QA 1IXRC 1J75A 1UHWA 5DCFA 5K5OA 4EJWA 3R0AA 3PQKA 5D6FA 4LK0F 2HQNA 3K69A 1TQMA 5ICFA 3QRFF 4EMSA 5IT9K 3I4PA 2FSWA 5A2QK 4XBFA 3F22A 2MC3A 4I2OA 3GFMA 2ACJA 2V9VA 5FFZA 4FHTA 3CDHA 1I1SA 2ETHA 2FOKA 2K5FA 2O61A 4UV8A 4EQQA 3I53A 3JW4A 4YFNF 4TV7A 3WODF 2HFHA 3WTWC 1R5GA 3ZMVA 3V8LA 1LB2A 2LX9A 3ZP5A 5HS7A 2BEOA 4U0WA 1KYZA 2HS5A 1JE8A 1FYLA 1BI3A 5HVQC 2RC4A 4UVBA 2VC1A 1SAXA 5HS9A 1MDMA 4AWXB 3J7AO 1V3FA 5FO5A 5F64A 3HTSB 3JTGA 1YYVA 2UZKA 3GWZA 4OIQF 1J0RA 4ZZDA 2XIGA 3IL2A 1OMIA 5FD5A 2DW4A 3F8FA 1TQIA 3MAJA 1HQCA 2BE5F 1XMAA 5E8GA 1J7KA 1SD6A 1HKTA 5FLXZ 2PLYA 3ELKA 2PJPA 1KU7A 1K6OA 3HIFA 2JSCA 2W57A 1RZ4A 1SFXA 5BS6A 1FBQA 4KIGA 2GXGA 1QO0D 5ICCA 3KLNA 1IN8A 2GWRA 3FWEA 2H09A 1QZYA 2XAHA 5FD6A 2LF7A 2LKPA 3GUDA 2BV6A 5LBQA 1FC3A 4M6XA 5LEJA 4AD9A 2YX7A 4A5NA 2XROA 5ILVA 5LGTA 3R61A 1F9NA 4LLLA 1U3EM 1HW2A 3P7NA 5H6QA 4WCGA 1R1UA 1VTNC 4XLNF 1SFEA 1BC7C 5LRRA 2A61A 2A6EF 5DV5A 3IKTA 5LGUA 3FXRA 4HF0A 4Z2YA 2P5LC 2YU3A 3QPTA 3LA7A 2IA2A 3KZYA 4Q47A 1P6RA 3QU6A 4KIFA 1Z7UA 1SD5A 2GIVA 4HX7A 4RAYA 3KP7A 3TO9A 3FM3A 3LAPA 4L5IA 3FF5A 3IRQA 1HW5A 3ECOA 1ZN2A 5IT3A 1MGTA 4EJVA 4OIOF 1WWXA 2QWWA 2HYFA 1TQPA 1YIOA 1JHFA 4MEYF 1S29A 2G7UA 2K86A 1XGNA 4IRGA 2ZFWA 4MTEA 4U0VA 1W7PD 1ZGJA 1QVPA 5DYMA 2R7DA 3GFLA 2Q8KA 3MWMA 2PBIA 1K7AA 4KN4X 4HV6A 2RNJA 1E17A 1RUOA 5EEGA 1R58A 1O3RA 4N9HA 3FHZA 3HRUA 3CUQC 3FZVA 1XSDA 4HX4A 2K7LA 2F5CA 4PGGA 4RB1A 4HZFA 4L0YB 1S8NA 3M9AA 3ZMZA 4CZZA 3P9IA 2XASA 2O0YA 1IF1A 2V1DA 4DNCA 2EV0A 4N0BA 4HX8A 3FM5A 2ESHA 4Q48A 2YPRA 1EH8A 2C6YA 3HHHA 3E6MA 2MBFA 1W7PB 2VXZA 1XCVA 3V7CA 4KDPA 2J5PA 4UXNA 4L9JA 5L3GA 2RVCA 4MNUA 2D2WA 4HAMA 2NRAC 1D8JA 2A69F 5CVVA 1U6GA 2DAOA 2K5IA 3DV8A 2XAQA 4LLGF 4OIRF 2LSOA 5LHIA 3PFIA 3EYYA 3WTSC 4U0YA 4ZZLA 1YS7A 4ENJA 4LMYA 5DUIA 4M9SA 4IPAA 1G6NA 3R4KA 4M72A 3G73A 2XRNA 2DQLA 2JPBA 5BMZA 1L0OC 5JHUA 3C7JA 2D1VA 1GXPA 2PMHA 2HYGD 3F8NA 4JQFA 4NHJA 1J9IA 2Y0MA 1LEBA 3WTXC 4LD5A 4Y17A 3J81Z 4EVIA 2EK5A 3J80K 4G8XA 2EFNA 1JGSA 1FYMA 2HWVA 3P9KA 2COMA 2A6HF 1HSTA 2GXBA 2EJRA 3JSOA 1QBJA 1I5ZA 3KP6A 2IJLA 2EA2A 3EDPA 3D5LA 3HTUA 2ISZA 5J8CA 2OZUA 4RB2C 2QQAA 5AONA 3CJNA 1Y0UA 4PZJA 3E6BA 3F8BA 2RGVA 3HOSA 3E3VA 1KGSA 1HBXG 2CG4A 2IVMA 4A5MA 3K1PA 4OMYA 3HYIA 2K02A 2FXAA 5D5UB 4BHPA 1F5TA 1IN5A 1W5SA 2P4WA 1XCBA 5CJ9A 3DFGA 1IW7F 3HSEA 2VBWA 3IRRA 2OZ6A 2HTSA 3FXUA 2VOPA 2ELHA 2XAJA 4HOBA 3JSPA 2W25A 1X3UA 3WE2A 1TTYA 2HGCA 2F5DA 1BN5A 4HQMA 3OOPA 2RV8A 4LB5A 1SFUA 2DPUA 3HSRA 2QM3A 1ZHFA 5CVUA 3IWFA 5LEKA 4IF4A 3KETA 5DDGA 4G6QA 3FMSA 1O3SA 2DK8A 2DO7A 4WK8F 3R60A 3E5XA 2CSOA 3P9CA 1I1GA 4A6DA 1BOAA 2IPQX 2PEXA 4I7HA 1UHMA 4JBAA 2OA4A 3REOA 3Q9VA 1XSVA 2D1HA 1ZRDA 1W5TA 1YFHA 3ISPA 3TO6A 3WTYC 2ADUA 2FNAA 1REPC 3IWZA 1FWZA 3Q5FA 1LNWA 5DEQA 2A68F 3HOTA 1ON2A 3GZ6A 4I98B 4HV5A 4KFCA 2L4AA 1RUNA 2MLKA 3LQQA 1O7FA 3GYHX 4PGHA 3ULQB 2JZYA 2EFOA 4P9UA 3C3WA 1F1ZA 2K4BA 4IJAA 1ODDA 2Z9OA 3BWGA 3KEQA 1BBYA 3HUGA 4ZYEA 1UFMA 2OBPA 4HW0A 5DUKA 3L09A 1ZH5A 3B73A 3KP5A 5E17F 4FT8A 5K5RA 1IRFA 2IW5A 5IT9Z 2DFIA 2OD5A 5A2QZ 2OQGA 4XRFA 4ESJA 3WTTC 1F4KA 1MDMB 2Z3YA 4A12A 4G94A 5AIPA 1SMTA 4ENKA 2IRFG 3H3UA 2DI3A 3K0LA 4RGSA 3OV8A 3I58A 1ZLJA 4B09A 3BY6A 5ED4A 3LQRA 1ZG1A 1R5HA 1FX7A 4UVAA 5K1YA 1B4AA 4L18B 1K79A 2K27A 1U8RA 4KYWA 1LJ9A 1USTA 4L0ZB 1TNSA 2BYVE 4U7DA 2KRFA 2VT2A 3WGIA 2PN6A 1CGPA 1LVAA 5HS8A 1XDUA 2P8TA 3DF8A 1TW2A 4OIPF 2K5LA 3WTUC 1YW8A 2XV4S 4UNOA 1Z6TA 2ZNYA 4HA8A 2MH9A 2A3SA 4I09A 2EA4A 3KEOA 2XKPA 1V4RA 1SMYF 2Y48A 3HSFA 3GFIA 4E70A 2CWEA 3RI4A 2O03A 4AVPA 5JFRA 3SHFA 1IN4A 3DQVC 2IA1A 4YFXF 3T0YA 2HKOA 1OYWA 1B9NA 2YSRA 1W4MA 3FXQA 1GXQA 2R7FA 3M1EA 4HLXA 3L7WA 3F3XA 4P5OA 1ZRFA 1MKMA 2H27A 1KU3A 3E6DA 2XUBA 1GVJA 1LEAA 1UB9A 1IRGA 4JK1X 4IVNA 2W84A 2FMLA 3K2ZA 3FMQA 1DP7P 1OR7A 2V6CA 4YIIA 4WF2A 5FB2A 1B1BA 4BNCA 1MJBA 1FSEA 2DU9A 4IHTA 2ZNZA 1LQ1A 1KQ8A 2O8XA 2PMUA 4BHBA 3WTVC 3U2RA 2YR2A 3L00A 2FRHA 1K78A 1QQIA 1PP8F 1HW1A 1FP2A 4MQVA 5HLGA 4MHGA 4KIBA 5ICEA 2DTRA 3RTRA 1PUEE 2M30A 4WXDA 3K9TA 1I27A 3TDZC 3RDIA 5F6FA 2Q2EA 5E1WA 1IAWA 1XD7A 3SFZA 2V1XA 3WG9A 4M73A 1Z9CA 3GO5A 4WXCA 3WGGA 3ZPLA 2HTJA 3I5UA 2DT5A 3GFJA 3O6BB 3DKWA 3SZPA 2ZO4A 4EJUA 1T6SA 4G7HF 3MCZA 5D6EA 2P7CB 2VT3A 4FX4A 3F8MA 5D4RA 1BYMA 1TNTA 3Q9SA 1BI1A 3FMRA 5L3CA 4HDVA 4ESBA 3BP8A 3QAHA 2ZXJA 1OKRA 1TBXA 3V8KA 2NAZA 1KU2A 5L3DA 3TO7A 4XSZF 2H6CA 2E7XA 3F6VA 1I6XA 2FF4A 1U5TB 1QNTA 1FY7A 1T2KA 3N4MA 4CYDA 4XLPF 1IUYA 1TW3A 5ERIA 2VBYA 2RN7A 4ENMA 2B0LA 3ZQ7A 3M8FA 3GF2A 1E2XA 2EWNA 2QBYA 3BJAA 1U5TA 1FOKA 2Z5UA 1A04A 3V7SA 4O6JA 3EQLF 4U88A 1DUXC 4OMZA 2IT0A 3ROUA 5BPIA 4NQWA 2P5KA 2UWMA 3V8JA 3V7RA 5LRSA 3RPQA 1R22A 4M6YA 2STTA 3KP3A 3LAJA 1FZPB 4EGYA 3K1MA 5TJJA 1BJAA 1DDNA 4MTDA 3E5QA 4KNYA 2GZWA 1YG2A 4IHSA 2LF8A 3CLOA 4BH9A 1O3QA 2A07F 4UV9A 3BPVA 5DCMB 1JHHA 2Q0OA 2HEOA 2E7WA 2KIUA 3TKYA 1SD7A 3ZMSA 4UHTA 3JAMK 1CF7B 4RGRA 4KN7X 1GHCA 2XGXA 4P96A 3M7GA 3CO7C 2ZCWA 3O2PE 2QUFA 4HBLA 3HRSA 3MZHA 1Q1HA 2V79A 5DCMA 3E6CC 3ABTA 2W24A 5F1RA 2JPCA 3BPXA 3E97A 2XAGA 2EB7A 1ZLKA 4GO1A 1CF7A 5JR3A 1EH6A 3QP5A 2O6GE 4M71A 4QWQA 4LK1F 3PQJA 3J80Z 3GW2A 1DPUA 4PDKA 4GCVA 1R00A 3WU0A 4A2UA 3DPTA 3GEZA 2H94A 4K2EA 1G3YA 3RKWA 2CO5A 1WKMA 3BDDA 2HZTA 2CGPA 4M9ZA 5E1ZB 2HOEA 3F23A 2KJCA 2M45A 4ENNA 1USSA 3AAFA 2HKXA 3GXOA 4I01A 3DXJF 1RIOH 4GYIA 3V4GA 2Y75A 1B59A 3F72A 4ASNA 4GGGA 3SQNA 2E1CA 3KE2A 5D5VB 3ZMUA 2L4MA 1ULYA 1P4AA 3G3ZA 4GYGA 1QW1A 4KMFA 3LFKA 2QQBA 2FNPA 1XDSA 3EYIA 4NB5A 4CDGA 1IXSB 5TRDA 4RS8A 4LB6B 2KJBA 1S7OA 2XAFA 4ZYHA 3N97A 4KUMA 4YIFA 4Q5SF 4AIKA 2GAUA 1PDNC 1YW9A 2DPDA 1YO5C 3GX4X 4WX9A 3QPHA 4LLNA 3S2WA 4WWCA 3JTHA 3MFKA 3DP7A 3WGHA 1BI0A 4M74A 3GVAA 5HDGA 3CO6C 1ZRCA 1ZGAA 2X4HA 3BOQA 3MEXA 4R79A 4A0YA 3RIRA 1XMKA 3I0TA 3BJOA 2EFWA 4ETSA 4ZH4F 1S7AA 3NRVA 5L3FA 5D5XB 2HDCA 2AS5F 2O3FA 2K4JA 3IC7A 4OU0A 5HLIA 3RKYA 4L9NA 3VB2A 3T5XA 4BYYA 4CXFA 1OYIA 2DBBA 1UCRA 3TQNA 1YW7A 4HLYA 2P7VB 3ML6A 1BM9A 4RB3C 2GA2A 4QLCU 1ZREA 2E1NA 4GXOA 5H6RA 5D4SA 3CUOA 3MQ0A 1MZBA 5HOOA 2RKHA 3M8EA 2QZ8A 1RNLA 3EUHA 1QGPA 2IA0A 1B9MA 4XSXF 3RYRA 5KK1A 3TGNA 3O3KA 2ZKZA 4EJTA 2P5VA 1MD0A 1R7JA 1R1VA 2MA3A 1T0FA 3QP6A 4L9VA 2F2EA 5BPDA 1LDJA 5JI6A 1R1TA 3I54A 5FFXA 4F7ZA 5J8FA 4S04A 3EETA 2XVCA 3KFWX 3L2CA 4CHUA 1FLIA 1XSXA 1P4WA 5EEHA 1WQ2A 2PQ8A 5HLHA 1IXCA 4L9TA 2DK5A 2L54A 2WTEA 2XKOA 1D8KA 5HDNA 1IN7A 4ESFA 2CW0F 5E1XA 2X0LA 1FBUA 1G4DA 4Q4ZF 5FLXK 1EH7A 3K1NA 4CICA 3F6OA 4MEXF 3MHXA 2H6BA 1G3TA 1D5VA 1R23A 2FQ3A 4M9XA 1DPRA 4HDUA 2WC2A 2STWA 1ON1A 2FBHA 2J5OA 4I0BA 2WV0A 2NS0A 1G3WA 1PP7U 4D0PA 1U5TC 3RPUA 1ZG5A 1XB4A 3VOEA 1IN6A 3H3ZA 2K4YA 1QPMA 3WTZA 5ICGA 2QYOA 3E5UA 5ILSA 2F5FA 1ZAOA 4IXAA 3VFZA 4RGUA 1K78B 3WE3A 3IHUA 1STZA 5BOXA 3GZ5A 2XHKA 2BBYA 4LG0B 4B8XA 5AIQA 4KICA 1ONVA 2RDPA 4G6DA 1FYKA 3B02A 2VBZA 4BAYA 1AOYA 1P92A 2GQQA 2EFPA 5L3BA 1R36A 1OYYA 2FBIA 1TLHB 4I0AA 2QVOA 4EM2A 4LG0A 4BQAA 3ERED 4FX0A 3VEPA 5LHHA 1XGMA 3C18A 2OQRA 1FSHA 2MH2A 3KLOA 3W6KB 3ECHA 1WRJA 4MGRA 3LA2A 1O7LA 5CLSA 4AIHA 1FPQA 1Z05A 1HKQA 2VODA 2CQKA 5D8LB 4Y15A 1U78A 2BGCA 3L9FA 2JRTA 5E8IA 2KIMA 2WWYA 3D0SA 3BZ6A 2M5WA 3IKVA 4A0ZA 5D8KB 5LHGA 4G7OF 1XGSA 1S3JA 1D3YA 1B6AA 2L02A 1J59A 4RAZA 1BC8C 3KP2A 1EV7A 1MJ9A 2ZJ2A 2UXXA 1H0MA 1LDKB 2Z99A 3ABUA 2LDUA 5E20A 3KZZA 3U1DA 1NHAA 4Y13A 2RQPA 3NQOA 4G9YA 2QBYB 2FU4A 2A5YB 2KKOA 4LGWA 1IZ1A 3I59B 4O3MA 3HHGA 1JXSA 1SD4A 4H0EA 4EV0A 2PI0A 2R3SA 1ZYRF 2ESNA 1BIAA 2CFXA 2VONA 5E18F 5FGMA 1T38A 4PCQA 5D5WB 2GCXA 3WU1B 2HR3A 1WI9A 4L5JA 2EFQA 5HDKA 3I59A 3I64A 4CO8A 4HF2A 2VOOA 3FX3A 2CYYA 4LFUA 1XN7A 1FP1D 3LWFA 4OOIA 2V1UA 2JT1A 4S05A 1Z6RA 4MQ9F 4EM0B 4ON0A 4CGZA 2GA1A 2F5EA 3DEUA 3LA3A 4AIJA 2ISYA 3DPLC 2KIFA 3RKXA 5JVTA 2QQ9A 2TDXA 4ZYGA 1P4XA 1XGOA 1BIBA 4I02A 1W7PA 2L3DA 5BQTA 1O3TA 2P6SA 2L01A 3ZN1A 3BJ6A 2M1BA 4EGZA 5CVJA 1J2XA 1KA8A 3F21A 1AWCA 4IRIA 3SXYA 3W6JB 3KP4A 3VODA 1H9TA 2FMYA 5DD8A 3CTAA 1U2WA 1FBSA 3JAMZ 4R8HA 2G7HA 4O5VA 4EM1A 4P55A 2ZMEB 3J81K 3ZN0A 1C0WA 4U7BA 3T8RA 4UUVA 2FBKA 2H3JA 3H92A 2ZBKA 3F8CA 1HXDA 1FNNA 3ZMTA 2FE3A 4YG2F 1Z1DA 3C1DA 4DQ2A 1YS6A 2M87A 4WXHA 4A0XA 1KQ9A
chains in the Genus database with same CATH superfamily
5FU6C 2LQKA 4IRHA 1I50J 1ENHA 2UXNA 2VN2A 1DU0A 1FT9A 2ZMEA 5ILUA 1OPCA 3G6EI 4GLKA 3BG6A 3A01B 2YUQA 2A36A 3CCVA 3UR3C 4C8QC 2K40A 1ETVA 3L2ZA 4R0KA 4C92C 2M8EA 3LSTA 3BROA 2MI6A 3ULRB 1HKSA 3MZYA 4A54A 2HDWA 1ZARA 4MDXA 4KA4A 4A3DJ 5LJ3f 4RGXA 3KCCA 4HYEA 2CP6A 5CKFA 2L9RA 1AEYA 1NJIU 3CUQB 4HRIA 2EYXA 1KU9A 2OCCH 4A6EA 2KQWA 5E3OA 3T8TA 4BHCA 3LGFA 5FLMJ 3QOPA 4P9FA 3JREA 4D1QA 2EQRA 2DBMA 2OTLA 2CV0A 2KXDA 3C0CA 3SZTA 2CSQA 2HVQA 2VE8A 4ZYDA 6PAXA 3EH2A 3CP2A 4FT4A 4CCKA 4LUEA 5CPRB 4F17A 4Y3OA 1J5YA 4EATA 2DNUA 1H9GA 2P0WA 4E7LA 1RPWA 3CC7T 3JRZA 1YQAA 4BJ6C 3BR6A 1Z77A 2D45A 5I2SA 3RJPA 2AXLA 1T0FC 4KGZB 3L2VA 3A01A 3JCMb 4BXUA 1X1CA 2B86A 5LGNA 2E2HJ 1X2KA 1LFPA 2OU2A 2JVHA 3K4KA 2EKHA 1NH3A 3OYYA 4FYXB 2MCNA 1TUCA 2LTPA 3NFCA 3OR2C 3THKA 1M2VB 4PLLA 3DU5A 2R7RA 1F36A 5F04A 2OAZA 4EJOA 3CUQA 5LLQA 3ZQCA 2I5UA 3RUXA 4IUPA 3FK6A 3IAM2 4HQEA 2ECZA 2DYRH 4JDSA 4MMKA 4OMLA 2LG4A 3EUAA 4RB0A 4DBHA 1W5CC 1T98A 3HRTA 3J7AW 3BDUA 1O57A 2JTVA 2RF0A 1LDDA 2EV5A 4X0GA 3TDUC 2DLLA 4UUTA 4F04B 5FLVA 3UF4A 1Z91A 2XKOC 4LXCA 5KYYB 1YP5A 3RYPA 4P5NA 1JJ8C 3EHQA 4JYKA 3M53A 5GAHJ 2G9WA 2ZB9A 3FKIJ 5CVRA 5KVRA 4YFKF 4BE1A 1ZSZC 3AKZA 2ED1A 2P0KA 3T9NA 4EMKA 4DBFA 5FKLA 2PG4A 1G3SA 4C0FA 2R7SA 4M78A 2QLZA 1V55H 1ERDA 1PVEA 4UVCA 2NYXA 4Z88A 2GOMA 5K7FA 2E1OA 2EW3A 5GAEJ 1M2VA 2VC0A 3TREA 1XMXA 1QZZA 2JJ7A 2EZKA 2NS7A 2PFBA 2LNBA 2XDVA 4OINF 1MNMC 2O9VA 3E19A 2BVLA 5H20A 1TU0B 1ETYA 3TOAA 1L3LA 5DTDA 2GFAA 4ATOA 1GUUA 4C8QD 2HOAA 1GFDA 4RAGA 4DOZA 2D8JA 2BW3A 3ZFJA 1MBKA 1HK9A 4Z8AA 1HCRA 2JA5J 2VBXA 3COAC 1YLFA 2OTJQ 5L3EA 2H1LA 1R4NB 2M7AA 1BBZA 2MD5A 1YTYA 2M0YA 3EG9B 1E3PA 3DB3A 3U9GA 1A0NB 3ZMDA 4IKFA 1QHGA 2TRTA 3HDDA 2DQRA 3R6SA 1NYFA 2LH9A 2OF7A 3I71A 4KMUX 5J26A 2W85A 2Z33A 1IXDA 5DD4A 2RQWA 1HSJA 4R1HA 2EIFA 2X4YA 2VIXA 1S6LA 3CC7A 3ASNH 1NM7A 2E6ZA 2L3SA 4E47A 1UECA 3R0JA 4LJZF 5CVIA 2SEMA 5GJVB 1K8AR 2E60A 5EG0A 1MJAA 3HRMA 2NNNA 1MBJA 2HQRA 2IP2A 4IQ4A 4KISA 2FRWA 1WSUA 3EPZA 2W82A 3OWTA 5CYVA 1IHVA 4XAXB 5CAIA 2P6TA 3DEEA 3NEUA 1N25A 2QENA 4B6MA 1P2FA 1T39A 2DXTA 3JB9J 3GNFB 2COBA 3TOBA 1Y7XA 1RI7A 3FB9A 1KYWA 2AIRB 3WVDB 5GANh 1YITQ 1KQ0A 2ROTA 2DTOA 1H641 2LY1A 3FHNA 5C44J 2DL5A 4N9IA 2H8HA 3M4YA 4U87A 5K7ZA 3GLXA 3T1BA 4JS5A 2VE9A 4CYCB 1SAUA 2ZJPF 2V8KA 2VUBA 2FA5A 3MEWA 4HF1A 2EV6A 1K9MR 2AT1B 4J6YA 2L7MP 4I76A 2IS2A 3JB9H 2ZPEB 4S0HB 3QU3A 1GV2A 1B7TA 2R58A 4J7FA 1DGRM 3JCMd 1KC8R 1G2BA 2VKVA 4XTYA 5B3SH 2F2WA 4IIOA 5H2FC 1MMAA 1GDTA 5HY6A 1ZG3A 2DT7B 1K8AC 1X19A 5J6XA 1GXIE 2YX4A 5CKTA 5EDNA 2PQWA 5GAMe 3OW2A 1ABQA 3CJRB 2CGHA 5GAOp 1BI2A 4KT5C 5F0FA 4GRIA 4BDYA 1ITYA 2C0TA 2NNYA 1WHUA 4G7ZF 1PSEA 1YBYA 1UG0A 5LL6S 5GMKm 2FEZA 2MLGA 4M7DD 2DJQA 5K5QA 5B1AH 5FU6B 1IXRC 1J75A 1ZBJA 2EINH 2V8IA 5IH2A 1VQLQ 4PUSA 5E3NA 1UHWA 2Z1DA 5DCFA 3HOVJ 2E64A 5K5OA 2DRMA 3GF5A 4EJWA 2O7OA 4N4HA 1K9MC 2XIDA 4C92G 3C4SA 3R0AA 1UJ0A 3PQKA 1X2QA 1KC8C 5D6FA 1TL8A 4LK0F 2HQNA 2Y4XA 4XLFA 2XRLA 3K69A 4N4IA 3CMAT 1TQMA 5F0CA 5ICFA 2FZCB 1VIFA 3U21A 3DTEA 3QRFF 4EMSA 1VOMA 1MUZA 2G6FX 4XLAA 4C8QE 4C92E 5IT9K 1TH7A 3I4PA 4QSHA 2FSWA 5A2QK 2ELJA 3I55T 1AVZC 2KRCA 3JRAA 3KFVA 3L1PA 3VSKA 4RBOA 5IHIA 4XBFA 4AYBN 2MC3A 2HQAA 3F22A 3GFMA 2ACJA 4I2OA 3RBBB 4C92F 1V29B 4C8QF 1DP3A 4LUDA 1A6QA 2V9VA 3NWTA 3PM1A 1V1CA 5FFZA 4FHTA 3VPRA 1VQPT 2CUZA 1B3QA 3CDHA 4M3FA 1I1SA 3A5ZB 1X6BA 2ETHA 2FOKA 2K5FA 2O61A 3QUIA 1BA5A 3K7AJ 2JM8A 3S3NA 1VF9A 4UV8A 2M16A 4EQQA 3I53A 2R92J 3OYBA 4Y33A 1HLVA 1C1AA 4F91B 3JW4A 5C4JJ 2LZ6B 4PJLA 1VQPI 2YDLA 2COWA 2VQGA 2DLPA 5FLXR 3E9GA 2AKLA 4YFNF 3OIQA 4TV7A 2K9SA 3WODF 3BG3A 4UUSB 3VRYA 1TT0A 2QSFX 1EFNA 2HFHA 3WTWC 1X1PA 2N8GA 1NK3P 3DBLB 1R5GA 2HZYA 3ZMVA 3H1CA 1AHJB 3VS1A 3GTQJ 3R6OA 3V8LA 1LB2A 5KE2A 2LX9A 1OCPA 3ZP5A 5HS7A 2QG9B 3MKLA 2BEOA 2MFZA 1UEBA 3OBYA 2Q1ZB 1N75A 1J3TA 5GAMg 2CP5A 4U0WA 1M1KU 1KYZA 4OMPA 2QGUA 2VPLA 1Y71A 3CCQT 2P84A 1A31A 2HS5A 1MSEC 1WQWA 1JE8A 4M7DB 1U1TA 2B7EA 1FYLA 1BI3A 5HVQC 3CXCS 2RC4A 4A3LJ 4HKEA 3KEYA 4UVBA 5KAIC 3WVEB 1Q86R 4HVUA 3A0BC 1CQTA 3H9NA 2VC1A 2DAQA 1SAXA 1UAAA 4F3QA 3A8LB 5HS9A 1MDMA 4AWXB 2P0TA 3NPFA 3J7AO 1V3FA 4C0GA 5FO5A 4UUSA 2J7IA 4DOVA 5F64A 3ER0A 3CMAA 4JRQA 3M4GA 4IOCF 3CF5F 3HTSB 4F93B 5GADJ 1SHFA 1S5LC 2E4HA 2DJNA 2DMTA 1YYVA 2Y9YA 3JTGA 3Q3SA 2UZKA 2M51A 3GWZA 4OIQF 1ZUUA 1J0RA 4ZZDA 1B8IA 1KONA 2WAFA 2XIGA 3I55A 3IL2A 5GAN6 3CCJT 1RABB 1OMIA 3W2AA 4DZJA 3X28B 5FD5A 2VB6A 3OIOA 2DW4A 3F8FA 1P7JA 1FOXA 5CQXA 4Z02A 1TQIA 1ZHIA 1MH4A 1E3HA 2XC7A 3J7AY 3MAJA 4P1WA 3NHNA 1UDLA 1SFOJ 1VQPA 5GAOl 4A69C 4C0DC 4M7DA 3W3CA 1HQCA 2BE5F 1XMAA 1JGGA 1N8RU 3H36A 5F27A 1DJ7B 4CC7A 3CCSQ 2AKKA 3HOWJ 5E8GA 1J7KA 1SD6A 2YXYA 3EGDA 1ZELA 1HKTA 1Q86C 1YJNQ 3GOXA 4HCZA 1TUDA 5FLXZ 2PLYA 1E0EA 3ELKA 3RDVA 2PJPA 3BR5A 1IHWA 4BI3A 2DIQA 2VC8A 4E7ZA 1KU7A 1K6OA 3IH3A 1Y96B 3OYLA 4D8DA 1U9OA 1DGWY 3FC3A 2QEXI 3M9QA 3HIFA 1YI2Q 2JSCA 4LIVA 3PGGA 2W57A 1RZ4A 1SFXA 3OSFA 1IC8A 5BS6A 4OP0A 1H3HA 3LSIA 3HSBA 5BNGA 3QWXX 3M07A 3ABMH 2YUPA 1JUSA 1FBQA 1K4TA 1NBEB 2VVKA 4KIGA 1ZR4A 2GXGA 5LD2C 1YHQI 3GTOJ 1T08B 2ZXWH 1QO0D 5ICCA 1OU9A 1YNZA 3KLNA 1GBRA 2I10A 1IREB 1IN8A 4OMMA 3CCQA 1WH5A 2GWRA 3FWEA 2NOGA 1M3CA 3L1AA 3UT1A 4L6V5 2H09A 2DXUA 3CC4T 1QZYA 2XAHA 4FYYB 2OCEA 3PL8A 1AWOA 3E0JB 2CH0A 1XJWB 1IGQA 4OGCA 3S14J 5A0DA 1YJNI 3LLRA 4BUPA 5FD6A 5L23A 1VZ0A 1EKEA 4UB6C 3G1LA 2LF7A 2LKPA 3GUDA 1WI7A 2BV6A 1Y96A 4XLHA 5LBQA 1FC3A 1GL5A 4M6XA 5LEJA 2KPMA 3SDBA 3CC4I 4L59A 2YS9A 4N4OB 1WXBA 2BUDA 1ZA2B 4JJBA 1N78A 4XRMA 2NVQJ 2FEIA 4AD9A 2YX7A 2O2OA 2KGTA 4A5NA 1PD0A 4GLMA 2JTFA 5J3BA 2XROA 2EPDA 3QXEB 2MK5A 3FIFA 5CCAA 5ILVA 2XGEA 2WBMA 5LGTA 2P4TA 4WXHA 2DYIA 4PFPA 4A3EJ 3R61A 1F9NA 4NDLA 4LLLA 1U3EM 1HW2A 2L7KA 4YRVA 3CD6I 1EZZB 1ZUKA 1JRIA 2D1XA 3QDRB 3CCEQ 2DA5A 3P7NA 5H6QA 3A8MB 1XTDA 4WCGA 1Y1WJ 1R1UA 1VTNC 4XLNF 1SFEA 3QJYA 3FXMA 5LRRA 4L5EA 1BC7C 3RERA 1C6VX 2A61A 2VQHA 1H8AC 4M75B 2A6EF 4NL2A 1G8XA 3SEMA 5DV5A 3IKTA 4C2TA 5LGUA 3ZQLA 3KZIC 2EJFA 4XRSG 2IGKA 3FXRA 3BG7A 3G7ZA 4HF0A 1Z3XA 4Z2YA 2P5LC 2YU3A 2VV5A 3URGA 3MP6A 3NAUA 1UJYA 3MJXA 3P8HA 1E6HA 3QPTA 3LA7A 2JOYA 2QQSA 4NC6A 2XG8D 3QOEA 1I07A 5LJ5d 2IA2A 2CW7A 3KZYA 4Q47A 1N27A 1P6RA 3QU6A 2IAIA 4C2UA 1ZSGA 4KIFA 3TVTA 2QDYB 2DA4A 2DA6A 2YUSA 1Z7UA 4V2SA 1SD5A 2GIVA 2L0KA 4HX7A 4RAYA 4HNUA 3KP7A 3TO9A 1GT0C 1IV6A 3FM3A 3LAPA 1CKAA 4L5IA 1WHHA 3EHRA 1VQNT 3FF5A 5D6YA 1ZLMA 4XKBA 4D9JA 3TP0A 3IRQA 3CC2I 1HW5A 4PSXA 1PUFB 3CC4A 3ECOA 1ZN2A 4FYVB 1YJ9T 4M75A 1X1AA 2HXIA 5IT3A 3CCMQ 1OPLA 5FKOA 2DFUA 1MH3A 1K0XA 2DYSH 1ETWA 1MGTA 2KDSA 4AC0A 4CI0C 1ZQ1A 3FRNA 4BQOA 1JKOC 4EJVA 1M1KR 3DKXA 1RR8C 2KEAA 4II3A 3E1SA 1JKPC 4RTVA 3KXTA 4OIOF 1WWXA 3MKWB 4M3DA 2FO0A 3SEQA 2QWWA 4F7UE 2HYFA 5GAN3 1TQPA 1YIOA 1JHFA 4MEYF 1S29A 2CT4A 2FPFA 4IHWA 2M9UA 3BG5A 1W0TA 1D0YA 1WPKA 2RJCA 4F7UF 2FD5A 2BOLA 1YX3A 2G7UA 4RLQA 2DEQA 3M54A 1X2MA 3VYUB 1XQHA 2F69A 1RAAB 2A08A 2K86A 1R6RA 4KULA 1PUFA 3LWHA 2KLOA 2EQMA 4XLCA 4C5GA 1Z0XA 4QT7A 4KITB 1XGNA 2XPUA 4IRGA 4NUBA 2ZFWA 3J7AF 2A5WA 2OUMA 3H5AA 3S2HJ 4E7SA 4LDXA 2CUFA 2B8AA 4B3XA 1U5SA 1Q1VA 3BTJA 4MTEA 4U0VA 1GV5A 1XS9A 2IS4A 1W7PD 2RO0A 5FLXE 1ZGJA 5KCMA 1QVPA 1R0BG 3CPWA 3PIOF 2J06A 3EFSA 4Y52J 3A0HC 1M1KC 3UATA 4C0DB 4BXFA 2WY7Q 5DYMA 2AZSA 1QVUA 2LBFB 1N8RR 5FW9A 2HBWA 2R7DA 3GFLA 1PJRA 3FKJA 2Q8KA 4NL3A 3MWMA 4Y7NJ 3LSRA 4XN3A 2PBIA 2X3XD 4ZC3A 4KN4X 2ICWG 1K7AA 1YJWQ 5CQEA 2DN0A 4HV6A 5IN1A 3JCMe 5GAN7 2RNJA 1OCZH 1RUOA 1E17A 2BIVA 4I99C 4IHVA 4OMNA 4G6TB 1K9AA 5HK0A 1VQNA 5EEGA 3HPGA 4XICA 4XKCA 1KFZA 2QSGX 1YJ9A 2F4MB 4D7MA 5GPCA 1R58A 3GTPJ 1O3RA 3QZ5B 4N9HA 3FHZA 2KAFA 3HRUA 4XU0A 1Q82R 3CUQC 3FZVA 5J40A 2XDDA 1VQ5T 1XSDA 1H3ZA 2FZGB 4HX4A 1A36A 1H8KA 1PC0A 2HMAA 2HL3A 4C5HA 1OFCX 2K7LA 3OL4A 2F5CA 4OWRB 4DBRA 2E10A 1N8RC 3JCMc 4PGGA 3O8HA 4HEA2 1VQ4Q 4RB1A 4HZFA 3RZDJ 3PVQA 4QIWN 4L0YB 1S72I 4CC2A 3FDRA 1S8NA 1XC5A 4BQNA 2L9SA 3M9AA 1VQ5I 2KYBA 3H9QA 3MD2A 2KZVA 4UY8I 2DMNA 3PJRA 1QVGA 3ZMZA 4CZZA 5M3FJ 3P9IA 2XASA 4DYQA 4JX6A 4OF1A 4EEFG 4EMKC 1RQ6A 1QPIA 2JN6A 2O0YA 1IF1A 2YLBA 1M3AA 4M78C 2XHCA 3ABKH 2HQEA 1YE9A 3K2AA 3GZNB 2V1DA 4DNCA 2EV0A 2A37A 1MGQA 4N0BA 4HX8A 3FM5A 2ESHA 4JRPA 4Q48A 5KAFC 2FHDA 5KYNA 2YPRA 3KYCB 2PUKB 3VS0A 2R93J 4W1UA 3M58A 1Q82C 4CCMA 2RJDA 4LDYA 1EH8A 5KCOA 2F5KA 2C6YA 2RHZA 2NUPB 3H9JA 3OYCA 4IOAF 2KMTA 4CA0A 2B63J 1F1BB 4A4GA 1PNJA 1X1BA 4CCLA 2EBIA 3HHHA 4A53A 3E6MA 4B3AA 2RNAA 2MBFA 1W7PB 2BE9B 4HCBA 2VXZA 2M9HA 1VQ6Q 2VQCA 2VJJA 1XCVA 4XNFA 2MSYA 3SFIA 3PNTA 1KHCA 3V7CA 3UA7A 4KDPA 1NG7A 4NNJA 2J5PA 4UXNA 4HVVA 4L9JA 5L3GA 1OQYA 1K61A 1I3QJ 4GDFA 1M1FA 2RVCA 2X48A 3VYRB 1OOTA 2ATCB 2A05A 4MNUA 2IXSA 2DA7A 3L2RA 1D09B 2D2WA 1QWFA 4LE9A 1TC3C 2H1KA 1LJOA 2JSPA 4BUGA 3CCLT 1MW7A 2X1DA 3OS1A 1ARKA 4HAMA 3J81R 1S7EA 4NC7A 1NPRA 3HBLA 3VRZA 1VQKQ 3IH2A 4DJAA 2NRAC 2EAYA 2NUPA 2VL8A 1D8JA 2A69F 2CP3A 1VQ5A 4BY1J 3F70A 5CVVA 1U6GA 2DAOA 4XKVA 2K5IA 3CCLI 5AT1B 5GANd 2GIZA 4KT0E 4BBRJ 3S6WA 3DV8A 5GAGJ 4M7AG 5GPAA 3I4MJ 3JCMW 1VQMQ 2XAQA 4LLGF 4MFEA 4OIRF 1UE9A 2BVMA 2LSOA 1X43A 4FIBA 3S16J 5LHIA 1JB0E 2ENMA 4XIDA 2KI7A 3PFIA 1VUBA 2O01E 3EYYA 2MGQA 3KBGA 3WTSC 3VS7A 2ECBA 1FOWA 4JZ3A 3OYEA 4U0YA 4ZZLA 3CCVI 4MFDA 1RACB 2WSFE 5JVGF 1YS7A 4FE7A 3SDZA 2BY3A 1QKWA 3VS2A 4ZN1A 4ENJA 4LMYA 4II1A 5DUIA 3VJPA 4M9SA 3JRFA 4IPAA 1G6NA 1GCPA 3K4CA 3R4KA 4M72A 3G73A 1I8FA 1LPLA 2XRNA 1T0JA 3I35A 4M78D 4PJOA 2DQLA 2MWPA 4F55A 1TT5B 2JPBA 3RMSA 2DM1A 2IEKA 1Q95G 4ELZC 2E1MC 5BMZA 4M75C 4N0AC 1SVOA 1VQ8T 2E70A 3JCMX 1ZR2A 4AIDA 1L0OC 2DOFA 5JHUA 3TW6A 3M5AA 6AT1B 1WHJA 3M1CA 3G6EQ 3C7JA 1WJBA 2D1VA 3GTJJ 1GXPA 2QQ8A 2ZPHB 5LJ3j 4IZZA 1BCOA 1QA6A 2PMHA 2JN0A 2HYGD 2RQQA 2ABLA 2KDZA 3F8NA 4JQFA 2V8JA 1X1DA 2KY9A 4NHJA 5J4VA 1J9IA 2DDBA 2Y0MA 1LEBA 1UGSB 3REAB 4C3JJ 1JTXA 3WTXC 2HQHA 3N5BB 1M4ZA 3U1KA 2CQNA 1SKUB 1JU5C 2KZGA 2KR3A 2FQ4A 2JT4A 4LD5A 3CCLA 4Y17A 3BQYA 3J81Z 4A4KA 4EVIA 3GTMJ 3GLLA 3DLMA 2EK5A 3BG9A 3J80K 4XQ3A 1JJ2S 4G8XA 4A4HA 1ZTRA 1UG2A 1UMQA 2EFNA 3HP9A 3BCBA 1R8OB 1JJ2P 1HJDA 1JGSA 2K3FA 4BQQA 1FYMA 2QKLB 3CMET 2HWVA 2HQ5A 2COMA 3P9KA 2FPDA 2EJ9A 3PT9A 2PX9A 4VUBA 1MHNA 3PIPA 2A6HF 3ZBDA 3CC7Q 3BY7A 3OBWA 5C4XJ 5FU7C 1K83J 1HSTA 4MZPA 4ZN3A 4XONA 1R4MB 3VKIA 4XU1A 2GXBA 2EJRA 3LSJA 3HOXJ 3JSOA 1QBJA 4QPQA 1I5ZA 3KP6A 3PSIA 1BL0A 2IJLA 2EA2A 4LD6A 1KQSP 3EDPA 1XG1A 2EH3A 3GPLA 3D5LA 3HTUA 2ISZA 3CCRT 3N05A 2AXTC 5J8CA 2OZUA 1UG1A 2IG0A 4PKCC 4RCCA 4RB2C 5GMKe 2QQAA 1K1ZA 5AONA 3CJNA 1UZCA 1VNDA 1Y0UA 4PZJA 1N9RA 1YWPA 4DYRA 3Q0UA 4QVDA 3GIBA 3E6BA 3F8BA 2RGVA 3HOSA 2JS2A 4EMKB 1VQ8A 3Q1JA 1IRZA 3E3VA 3NMZC 4M77D 1KGSA 4M78B 4XR6A 1HBXG 3QPSA 3CCRI 1SEMA 2CG4A 1KZHA 2IVMA 4A5MA 2VWFA 3K1PA 3CC7I 4IHXA 3PO3J 1T3LA 3L2UA 4OMYA 3HYIA 2GBYA 2K02A 4JX5A 2FXAA 3HC7A 3MEVA 1OLTA 2BW3B 5D5UB 1NEGA 2PU9B 2W48A 5E79C 2GOXB 4BHPA 1HC8A 2DD4A 1TWAJ 3OB9A 1F5TA 1IN5A 5GAMh 1W5SA 2P4WA 1R71A 3H0HA 4M78F 1XCBA 5CJ9A 3VS5A 1JKQC 2J6OA 5IXBA 3I56T 4C8QB 3DFGA 1IW7F 2Z2SB 1VQ7A 1TP4A 3HSEA 1POGA 3BR1A 2VBWA 5LJ5e 2DKGA 2LCCA 3IRRA 4ZDLA 2MAMA 1IG7A 4RTYA 2OZ6A 2HTSA 2XDBA 2CU7A 3FXUA 2VOPA 3I56I 2O9SA 4PJ0C 3CMEA 2CREA 3PSFA 3LL7A 5EG0B 2ELHA 2XAJA 4HOBA 4J6WA 3JSPA 4XTUA 2DFEA 1Q86U 3MMYB 2DRKA 3CBPA 3MEAA 3LWIA 1VQMT 3OMYA 2W25A 3FDYA 5HODA 2M8GX 1X3UA 3WE2A 4HNTA 3DLLA 1TTYA 5FKNA 2HGCA 2F5DA 1W0UA 4JPBW 1BN5A 3S1RJ 1M8VA 3F9KA 4HQMA 2E5NA 3M56A 3CJTB 1G83A 5EC7A 5LJ3h 3OOPA 1BW6A 1D3BA 1VQOT 2RV8A 1I3AA 4LB5A 1VQMI 3VWBA 1GCQC 3CF2A 1SFUA 2R7XA 1QLYA 3GBQA 2DPUA 3CCRA 2MYSA 4XKWA 3H6ZA 4B9WA 3HSRA 2DA1A 1X6OA 2VJ4A 2QM3A 4KJZA 2XMFA 1ZHFA 2FVUA 5CVUA 4HVWA 3IWFA 3MN2A 1VQOI 4UC4A 2KYMA 5D7UA 2W0ZA 2YHTA 3M0RA 5LEKA 2R7OA 3VYSB 4Y4RA 4IF4A 4BEHA 4ZJZA 1Y07A 3M57A 3KETA 2MC4A 3SJMA 2EQKA 4IX7A 5DDGA 3CMYA 4G6QA 5CKBA 5I11A 1QQJA 3FMSA 1WJEA 5JLWA 2GM4A 2DPPB 2L2OA 1O3SA 4M77B 2DK8A 3CBMA 1QVFA 2FUG2 2DO7A 2RI3A 4WK8F 2E1MB 2DVEA 4EDUA 1H92A 2CSIA 1VI0A 3R60A 2QCOA 2HU9A 3E5XA 2CSOA 3P9CA 1I1GA 4A6DA 4HT8A 4KGXB 1BOAA 4E2FB 5CKEA 2IPQX 2PEXA 4I7HA 5IOYA 5C3EJ 1UHMA 3PFYA 4JBAA 2IPOB 2OA4A 3REOA 5IT9R 3I56A 3Q9VA 2DOEA 2OTJT 3J81E 5A2QR 1XSVA 2D1HA 1ZRDA 3EGXB 1W5TA 2VKHA 3FLGA 5GTHC 1YFHA 1UHCA 3ISPA 4D6WA 1FEXA 4LIUA 4XL9A 2KT0A 3TO6A 1FIPA 3WTYC 2JS0A 1MBGA 4ANJA 2F5TX 2FG0A 2ADUA 4NOYA 2FNAA 1Q81C 3OQ5A 3A02A 1REPC 1E6GA 1WHKA 4M77A 4ZDPA 2HQXA 1YFNA 3IWZA 1FWZA 3Q5FA 5EEAA 2ID3A 4PFZA 1LNWA 3GTGJ 1A5JA 1VQMA 5DEQA 4EMHA 2A68F 3HOTA 4JX4A 1ACIA 1ON2A 4PJJA 2EQIA 3G4ST 2HPMA 2WB1N 3GZ6A 4I98B 4HV5A 2IGMA 4KFCA 2GF7A 2F2XA 2WACA 1QHHD 2HL5C 2L4AA 2QGFB 1RUNA 2MLKA 1VQOA 2DO3A 5J1YA 1RI0A 1TUGB 2EGEA 2LT1A 4C8QG 3LQQA 3EGXA 1YITT 1O7FA 1GLNA 3GYHX 1NEBA 4PGHA 2DE0X 5FU7B 3VS6A 4A63B 5HNFA 3ULQB 3G4SI 2JZYA 4RDUA 3DB4A 1OU8A 4D8KA 1BK2A 1VQPQ 2E5ZA 3HFNA 1JEGA 2C06A 2EFOA 2KL4A 3HB9A 4BKXA 4P9UA 3OYAA 1SVMA 2NWMA 3C3WA 1F1ZA 1FMKA 2K4BA 2XAUA 3HG9A 2HOSA 4IJAA 4RTWA 3A52A 2QSHX 1ODDA 2Z9OA 3BWGA 2QDLA 2LD5A 1D1CA 1BBYA 2F5VA 3KEQA 1RKTA 1SPKA 3HUGA 3NTIA 2DEUA 4B44A 4ZYEA 1UFMA 2OBPA 4HW0A 5FWCA 5GAOn 5DUKA 1YIJT 3L09A 1ZH5A 3A2KA 3B73A 3KP5A 5JHFA 3CMAI 1SHGA 3LYIA 5E17F 4FT8A 4AVZA 5K5RA 2JTMA 4OMOA 3CXCA 3I5RA 1BOBA 1IRFA 2IW5A 2LMJA 5F0HA 4LITA 2OJED 1YRNB 4QQGA 1TWGJ 2ZSIB 3H0GJ 3WHBA 3I55I 1IGUA 5IT9Z 4E6RA 5CO7A 1YIJI 2DFIA 2OD5A 4JP0A 5A2QZ 4E7IA 2OQGA 2OTJA 4V19K 1YWOA 4XRFA 1VQLT 4XOPA 4ESJA 4ORZA 3WTTC 1B72B 2KK4A 2ZZDA 5HLTA 2W7NA 1F4KA 1MDMB 2BZTA 5C6SA 2Z3YA 1WGSA 2HYJA 2JMWA 3QODA 4G94A 5AIPA 1SMTA 2V4JC 3RQIA 4A12A 4ENKA 4MLOA 3JCMQ 1AWWA 4CSWA 2LQWA 2IRFG 3H3UA 3OW2P 1B8IB 4BI4A 2DI3A 3K0LA 4RGSA 5J4YA 3RQ4A 2LY9A 4DZPA 5IP9J 4PNOA 4MZTA 3ZL7C 1T0HA 2DT6A 2LMDA 3HHTB 3OV8A 1YRNA 1JBMA 4BJ5C 3I58A 1ZLJA 3ZXSA 4B09A 2RI2A 2KBTA 4LDUA 5CK9A 3OYJA 3PMIA 3G4SA 3BY6A 5ED4A 3LQRA 1ZG1A 1KK7A 2V9PA 1R5HA 2XF5A 1FX7A 2WY8Q 1LUJB 2EILH 4UVAA 5K1YA 1B4AA 4AUXA 4L18B 5GANe 3S1MJ 2ZFUA 1K79A 4M7DG 2KP6A 1WHGA 3LH0A 1KD1U 2K27A 1B72A 1U8RA 4KYWA 3QYGB 1LJ9A 2IIMA 3EGDB 4RAFA 4Y28E 4J5YA 3CCQI 4L0ZB 3IAS2 2WB1A 1TNSA 5HNHA 1WJQA 1RADB 2BYVE 1R9TJ 2XPWA 2JRMA 4M7DE 2XB5A 2KRFA 2VT2A 4U7DA 2PN6A 3WGIA 3GBGA 1CGPA 1HSQA 2KMUA 1I81A 2EGAA 2QEXQ 2ELKA 2UUZA 3CP8A 1LOJA 2FB7A 1FJLA 1Q7YU 1LVAA 3BR0A 5HS8A 1XDUA 2P8TA 2G0EA 1RLQC 1W1FA 3DF8A 2LTOA 4NS5A 1TW2A 3R6NA 1YIJA 1P9QC 2YT6A 4M7DF 2X6YA 4OIPF 5LJ3g 2K5LA 2BZYA 3WTUC 2IVWA 1YHQQ 1YW8A 2K5CA 4FETA 5KNLA 3GTKJ 2XV4S 3CCJI 2MOXA 4M75D 4UNOA 1QCNA 1Z6TA 2YRCA 2EQJA 1JUPA 2X1CA 4WCIA 3OS0A 5D6XA 2JA2A 1PRMC 2IGOA 4XK8E 1RKWA 1X58A 4AYBA 2ZNYA 1NG2A 2AZVA 3QPLA 3JCMf 4HCCA 4HA8A 2MH9A 2CZ1B 2A3SA 5F08A 4I09A 1SF9A 3S93A 2Y9ZA 1OJLA 2EA4A 3KEOA 1OV3A 1BR2A 1RAFB 2XKPA 3JSCA 9ATCB 1I5LA 2CUBA 2OX7A 2Z16A 1V4RA 4IL6C 5D6WA 4C3HJ 2DTZA 2E19A 1WZ2A 3MEUA 3CC4Q 1GCQA 1SMYF 2Y48A 5ECAA 3HSFA 4FW1A 3LX7A 1WGXA 4XLEA 1PYVA 3GFIA 4DIQA 4OGEA 5I21A 4XQFA 4MMLA 2KHMA 4E70A 1PSFA 2ZAEA 2P0PA 2CWEA 1Q82U 2IBDA 3RI4A 3C2HA 3MKDA 4YIRX 2K9LA 1EJ9A 3BTCA 2AQFA 4XTWA 2LY2A 2O03A 4AVPA 1VFCA 3M3YJ 5JFRA 2DTIA 2LRDA 1NTCA 1WYXA 3META 3SHFA 3KYLA 4J9IA 3UKGA 1IN4A 3DQVC 2IA1A 4X6AJ 3UWNA 4M7DC 2WSCE 1N77A 3H9GA 2L3RA 4ZGEB 3T0YA 4MO7A 2HKOA 3O8GA 4YFXF 4D5CA 1NZ9A 1PCXA 4KUIA 1Y0NA 1JI8A 2HBPA 2VKDA 2VXEA 1ETQA 1OYWA 2JUFA 1B9NA 1UHFA 4II2A 2YSRA 1UTIA 1W4MA 3FXQA 3OMCA 5KYWB 3CCST 1GXQA 2R7FA 2BY2A 3M1EA 2PUOB 2VJIA 4HLXA 3L7WA 9ANTA 2HVRA 3F3XA 4P5OA 4JZ4A 1ZRFA 1MKMA 2O31A 4OAYA 4DYCA 3CCJA 2H27A 1KU3A 3E6DA 1WLPB 2AQEA 2XUBA 1MMDA 3GNGA 4A3MJ 4QQDA 2DL8A 2RHYA 1GVJA 2DYBA 2QASA 4E7HA 3RR6A 1LEAA 1UB9A 1IRGA 2GBQA 2NVXJ 1OEBA 1OPKA 4JRKA 2IS6A 4OB2B 3BDLA 5CQGA 3EGUA 3PNVA 5GAN4 3K4JA 4JK1X 2KFDA 4IVNA 2W84A 2GNCA 2FMLA 2X6OA 3EFOB 3CC2Q 1KQ1A 3K2ZA 5A2QE 2XDPA 3FMQA 4GY5A 4C3IJ 5FROA 4AM3A 2DVJA 4Y91A 2K3YA 2Z0WA 5FRNA 2LP5A 1CSKA 5KYWA 3AFHA 3W2WA 4E7KA 1DP7P 3JR9A 1OR7A 2V6CA 4YIIA 5IY5H 4WF2A 1VYUA 4XU3A 1M90U 1VQNQ 5FRMA 3M0PA 5FB2A 1WA7A 4KH0B 1B1BA 1X3WB 1MJBA 4BNCA 1FSEA 1Y0MA 5KH6A 4NBQA 3OYIA 2DU9A 2DBKA 2OC6A 1Y6IA 5EZGA 4IHTA 2ZNZA 1LQ1A 3K4BA 3D5SC 5EYRA 3AG4H 3LSHA 2E71A 4X34A 4M75E 1OCOH 2D6FA 4CH7A 1XPXA 1KQ8A 2O8XA 2PMUA 2YWWA 4PJOC 2A7YA 3MP8A 7AT1B 1WJ5A 2M4KA 2F6CA 4BHBA 3RSNA 3WTVC 3U2RA 4M75F 2YR2A 3L00A 4MDWA 3EFOA 2FRHA 1LE8A 1K78A 1QQIA 1PP8F 4FT2A 2I0NA 1AHDP 1HW1A 1FP2A 4MQVA 5HLGA 1KJWA 2GTJA 4MHGA 3JCMP 3M0QA 2EKOA 2VGMA 3DTIA 4J8OA 4KIBA 5ICEA 4F7UG 1U3OA 1YX5A 2R5YB 2LRQA 2RA2A 1K73R 2DTRA 3HPHA 1VQNI 3RTRA 1PUEE 2M30A 3RCOA 1HDDC 3CCSA 2RHXA 3CCUT 1WJFA 2GTOA 2HAXA 4A3BJ 4E4HA 2DFFA 4WXDA 3H0IA 2HXOA 1YJ9I 3JV3A 3OIPA 3TQ7P 3G71T 1LPQA 1R5ID 3K9TA 3FXJA 4JRIA 1I27A 4R55A 3K70C 2L89A 2KIQA 3TDZC 1TTHB 3S15J 2JK3A 2LCSA 2Y30A 1AWJA 1KD1R 3FXLA 3RDIA 5F6FA 3OOUA 4N4NB 2XICA 2Q2EA 4CRIA 3SWNB 1WPYA 5E1WA 1IAWA 2DZCA 2OJ2A 1XD7A 4RTXA 3SFZA 1Z67A 2FX0A 4ZYAA 2V1XA 3WG9A 2RQUA 3A03A 2VQLA 4Z6YA 3BQZA 4X9DA 2CW8A 3H3VK 4ZGDB 4A3CJ 4M73A 1Z9CA 4XM3A 3QYEA 3GO5A 4WXCA 3WGGA 3CPFA 3TEEA 3X24B 1Q7YR 3ZPLA 2HTJA 3HOUJ 3ASOH 2R5YA 1QRYA 3I5UA 2I2LA 2DT5A 3IV5A 2A6TA 5GMKj 4QKUA 2D0NA 2MZ4A 4CCNA 1O75A 3GFJA 3O6BB 2QF7A 4GFBA 1MSFC 3DKWA 2M3AA 2J6FA 3DU6A 2DL7A 2R4GA 2K3BA 3CCMT 3HL2A 4X1EA 4BJTA 3VDXA 4MZMA 2CV1A 1Y1VJ 4C30A 3SZPA 2ZO4A 4EJUA 4QVZA 2C0IA 4RG2A 3PNYA 5GTIC 1T6SA 4G7HF 3MCZA 2BZ8A 4KRTA 4EMGA 1FXXA 1S72Q 2VJ5A 3SWNA 2KXCA 2NS8A 1KD1C 2NYSA 5DLOA 3D1NI 1VQ5Q 5D6EA 2P7CB 1I6HJ 2CJJA 2VT3A 2X3WD 2JJ9A 4HCKA 4AFQC 2K57A 1W70A 4FX4A 3S1QJ 5IYCJ 3F8MA 4PJOD 2CZ6B 1X01A 1TS9A 3PTAA 2RH2A 4B1RA 5D4RA 3ZQIA 4IHYA 2PZ1A 1M1GA 1BYMA 1Q7YC 1TNTA 3MKYB 3Q9SA 1BI1A 2PVOB 2RREA 2CS3A 3FMRA 1X4OA 5L3CA 2ROLA 4J9FA 5KYUB 1VQ7Q 2E2IJ 4HDVA 5A0LA 1RAIB 3O8VA 4ESBA 2ZXIA 3JCUC 2X98A 3LSKA 2F2VA 4RMOA 3SDGA 2MMPA 3CCUA 4AFZC 3BP8A 3QAHA 1N5ZA 2J05A 1V5FA 5LJ5j 2ZXJA 1W36C 2A0FB 2MG4A 1K73C 4AMCA 3G71A 1RAGB 4A4EA 1OKRA 1TBXA 2K9MA 3V8KA 3UDCA 2NAZA 2NOJB 5GAMd 1KU2A 4PK4A 3DTKA 5L3DA 3MPUB 1D1AA 3TO7A 4XSZF 5FJ8J 3D5RC 2H6CA 1JT6A 4LOCA 1X3ZB 4FYWB 2E7XA 1BR1A 3FISA 3K70D 3HKSA 3F6VA 1I6XA 3TSWA 3BW1A 2FF4A 4PJNA 1U5TB 2MUNA 1QNTA 1D0XA 1FY7A 1UGQB 1T2KA 4F92B 2DXBA 1Z7LA 2E35A 3N4MA 4CYDA 3OMGA 2R7UA 2X9HA 4XLPF 1IUYA 5KYUA 1Q81R 4I6ZA 4M4ZA 1TW3A 5ERIA 4BXXJ 2X1EA 3ZOBA 1FYNA 2VBYA 1W6XA 2CYZB 1RETA 3HEFA 5CQYA 2JA8J 2R7WA 4NQWB 2DERA 2RN7A 2ZSHB 2CKKA 3SD4A 4ENMA 1FOYA 2DDAA 2B0LA 4XN0A 1AU7A 3ZQ7A 2XSJC 3CCMA 1M1EB 2BY0A 1F43A 3M8FA 2PNIA 2KRHA 3GF2A 3CCLQ 1IUFA 5LJ3d 5LJ5f 1WIEA 4FTHA 3OSSC 4BACA 1E2XA 2XGDA 2AO9A 5GAN5 4YEJA 1NE8A 2EWNA 2WAEA 2QBYA 5KE3A 3J7ZI 2M0CA 2RNGA 3BJAA 1U5TA 1FOKA 3BT9A 4A3KJ 2HD0A 3A98A 2Z5UA 1A04A 1GVDA 3QJ6A 1AD5A 1VQ4T 1T3SA 1W2BS 3CCVQ 3V7SA 1I1JA 2NUTB 5L8RE 4HT9A 1W2BP 4G12A 5KYXB 4O6JA 3EQLF 1AA7A 3JCMV 1WFXA 4U88A 4OMZA 1DUXC 2CH4A 3JCMg 5B66C 3RKQA 3ROUA 5BPIA 2IT0A 1MBEA 3TL4X 1A6IA 3CLQA 3F0CA 4NQWA 1V76A 1OCTC 2LP0A 2P5KA 1WHLA 2UWMA 2EVRA 2L3PA 4JOMA 2LK2A 2BTTA 3C95A 3V8JA 4B9XA 2OV7A 3V7RA 2OAWA 2X4JA 5LRSA 3WU2C 2BXYA 1M5Q1 3QG1A 4J9EA 5J47A 3CD6Q 1WX6A 3DKMA 3I9V2 2O4XB 3JB9D 4OB0B 2KNBB 2BHZA 3RPQA 3X20B 1R22A 3HKZN 3LSPA 4ME7A 5I2MA 4M6YA 4CCOA 5CKHA 3ZQGA 2STTA 4XORA 3KP3A 3LAJA 5LJ3e 2W4SA 2ECCA 1W36D 3NWSA 3QBYA 4ESRA 1ABOA 4PJOE 4W97A 5GMKi 4KBMB 1FZPB 2GXAA 4EGYA 4QW2A 3K1MA 1QVGP 2MPXC 2NUTA 2JUCA 1TWCJ 1BJAA 2XF7A 5TJJA 1ETXA 1DDNA 2VGNA 4PJOF 1M90C 4HPQA 3S3OA 4DGWB 3J80R 5KYXA 4MTDA 1VQ6T 4RTTA 3E5QA 5CIUA 4KNYA 4IIMA 3BLYA 2GZWA 2R7TA 3EG3A 5KCHA 1QCOA 1ETOA 1YG2A 4IHSA 4XTVA 3PVLA 1LFUP 1JJ2A 2LF8A 3CLOA 4C2MJ 3OS2A 4M7AB 4A4FA 1Z9QA 4BH9A 1O3QA 2A07F 5B5EC 4M77C 3BE3A 1QP2A 4UV9A 3LOCA 2QK0A 3BPVA 1JXOA 5DCMB 1R0CB 1JHHA 1RI9A 4IUVA 3P8BB 1XX5A 4JJCA 2Q0OA 2HEOA 2O4XA 5GJWB 4BBSJ 1AWXA 2E7WA 2ZJRF 3AT1B 1WCMJ 2KIUA 5TISC 3TKYA 1SD7A 1S9HA 1SFKA 3ZMSA 1C0MA 2YSQA 4UHTA 2HNHA 1G5VA 1QZEA 3JAMK 1MBFA 3BCAA 1JKRC 1XNIA 1VQKT 1CF7B 3VUBA 2OTLT 1AZEA 3O5ZA 1QVFS 1W1WE 2E2JJ 4RGRA 3MO8A 3QKJA 4KN7X 2YLCA 3E7LA 1GHCA 1VQ8I 1SG5A 1Z9ZA 2IGNA 1G59A 3MVPA 4BI8B 4EIKA 1VQ9T 1K4US 2XGXA 4P96A 3A1YA 1QMCA 1NG6A 1VYVA 3VYGA 4QVCA 3M7GA 4RCBA 4C5IA 2DOAA 3CO7C 1VQ4A 2PMZN 2ZCWA 1WXUA 2QA4T 2R7ZJ 3O2PE 3JB9I 2QUFA 3CMMA 4HBLA 2QQRA 4M7AA 1VQ9I 2GQIA 3HRSA 2XK0A 1Z3YA 3MZHA 1Q1HA 5DLQE 3B6CA 1XTAA 2V79A 5DCMA 3E6CC 2R7VA 2LDMA 3ABTA 2W24A 5F1RA 2JPCA 2CRGA 2EYZA 3BPXA 2M0MA 2JW4A 1MMGA 2GLOA 3HZJA 3E97A 1Z21A 2MF2A 3PIPF 2XAGA 2GFUA 2EB7A 1ZLKA 4GO1A 1IZ6A 1UUEA 1CF7A 4OMFB 3CQTA 2DMOA 3REBB 3CCRQ 2HSPA 1RRJA 5JR3A 1Y57A 1EH6A 1UGVA 2EPFA 3QP5A 1SC7A 4M71A 2O6GE 1NK2P 1U06A 4QWQA 4ELYC 1UB4A 3OYHA 4LK1F 3PQJA 3G6ET 5EGOB 3J80Z 3SYTA 1H88C 3GW2A 1M9SA 4M3EA 1OCCH 1DPUA 4PDKA 3CMEI 1BR4A 3FBNB 4GCVA 4NC8A 4BU2A 2KRMA 3HKZA 1KQSS 1VQ6A 2R5ZB 4KGVB 2GQVA 1DQUA 1R00A 4BDZA 3ZGKA 3WU0A 2LLKA 4A2UA 4C9YA 2ZPIB 1D1BA 3DPTA 5GANj 2SRCA 2L5QA 3GEZA 1QKXA 2H94A 2QKMB 3J7YJ 3U23A 4HSRA 2E5QA 4K2EA 1G3YA 2DTHA 3RKWA 4AG2C 2E3HA 2HPIA 3EUHC 3P5JA 2EIMH 4E6KG 3SHWA 2CO5A 1X4PA 1WKMA 2D8HA 3OYGA 3JB9F 4B47A 2ZPGB 1SVLA 1WFWA 1ZUYA 3I56Q 3BDDA 2RMOA 2K2MA 4M78G 5DM7R 1VQKA 1Y8QB 2HZTA 2E12A 2H8WA 3HPWA 1I5OB 3C12A 3WG7H 2AK5A 5EGOA 1VQ9A 2CGPA 2D0QB 4ZTJA 4M9ZA 5E1ZB 4AU7A 2DX1A 3M59A 1NLPC 2HOEA 3F23A 4M78E 4JS4A 1JJ6C 1DU6A 4V2GA 2R5ZA 5AYFA 4J9DA 3OYKA 2QA4A 2PVDB 2XF6A 2KJCA 3A8OB 2M45A 4JJDA 3B6AA 4ENNA 3QWYA 4J9HA 1USSA 3AAFA 1D3BB 2M2EA 1FMVA 2HKXA 4XOTA 2D5VA 3GXOA 1SSFA 1AZGB 2GGRA 2VXDA 2W10A 2KT1A 3EG2A 1JT0A 4A3GJ 2QXFA 1LKXA 4C0ZA 1OI1A 3KPHA 3PMTA 4I01A 5GANf 2XSDC 3EG0A 1ZGWA 4CZCA 3DXJF 2PMZA 1RIOH 4GYIA 3V4GA 3CEYA 4OB1B 2Y75A 1B59A 3F72A 4ASNA 1WJCA 2BHYA 2K9QA 3DBHB 1A35A 3BFMA 4GGGA 3SQNA 1ZX6A 1VQOQ 4CCJA 2E1CA 4FM4B 2FL7A 3DLLF 3KE2A 4BEHB 1ZKGA 5D5VB 2PVGB 2FPEA 1X6GA 3GMEA 3ESWB 2B9SA 2ZJQF 3G6EA 3OL3A 2KQRA 4YELA 2Y2ZA 3ZMUA 3JRIA 2MVTA 3IP4B 1WJRA 4RG8A 2DCEA 2L4MA 1ULYA 2LOOA 3WHCA 2DZ9A 1P4AA 3H5RA 2HNIA 1APLC 3G3ZA 1M2OA 4J9GA 4BD3A 3AL0B 1VQ7T 3L2WA 2P81A 4GYGA 1SANA 1V5EA 4V2FA 3HXLA 4KMFA 1QW1A 3LFKA 2YUNA 2QQBA 3HFOA 2FNPA 4FL6A 1XDSA 2WA0A 3I9QA 3EYIA 2COZA 2BZXA 2NVYJ 2DMQA 4NB5A 1VYTA 4N4GA 4CDGA 2IS1A 1OULA 2V6EA 1VQ7I 1HOMA 4C92D 1S1NA 1BU1A 4A3IJ 1XOVA 3OS5A 4AG1C 1IXSB 3ZRGA 1YOVB 2F4IA 3DWLE 5TRDA 3C2GA 4RS8A 1X69A 4LB6B 3C94A 2ME6A 5KYYA 4XK4A 2KJBA 1S7OA 2XAFA 2JQ7A 3ZQFA 4ITVA 2LC2A 3DLAA 4ZYHA 4M77G 2X85A 3K4MA 2LQNA 3QYFA 3N97A 3NGPA 4KUMA 4KH1B 1MIJA 4CUGA 4YIFA 4Q5SF 1OX9A 5C0MA 5K7HA 3JRHA 2GAUA 4AIKA 1VA7A 2E3IA 3A4CA 3RNJA 1WHMA 2DILA 1PDNC 1I0CA 1V54H 1MV0B 1OZ3A 2RHIA 1YW9A 4M77E 2KRSA 5B1BH 3G1MA 2RJFA 3W6VA 3TP3A 2DFHA 2DPDA 4LDVA 2VKEA 1YO5C 3GX4X 3G4SQ 2CV2A 4WX9A 3QPHA 4BL0B 1HYOA 2XI9A 4M77F 4LLNA 3S2WA 2DA9A 4PL6A 4LNPA 3ME9A 3SEZA 4WWCA 2RHUA 3M4OJ 3JTHA 2DF6A 3CBOA 1HF0A 2OTJI 3MFKA 3DP7A 1OZ2A 3LW5E 2L8DA 5LJ5g 1SRMA 3CCYA 3WGHA 3EG9A 3IQLA 1BI0A 4M74A 2CH4W 2NUZA 5GAOr 3GVAA 5HDGA 3CO6C 3HUGB 1TWHJ 1ZRCA 4QTRA 1RC9A 1ZGAA 2O5RA 2X4HA 5CKDA 4DEYA 3CMAQ 4M6VA 2R57A 3BOQA 2MWOA 3WXMB 3MEXA 3J80E 3K4NA 4R79A 4A0YA 3MP1A 2V1NA 4HSTA 1OR7C 3RIRA 1J09A 2RAEA 3M55A 1XMKA 2MABA 3I0TA 3BJOA 1AOJA 2VYTA 3I55Q 1P7IA 1U8BA 1ETKA 4HG2A 3OY9A 2EFWA 1KHIA 3EG1A 4OMQA 4ETSA 1IB8A 1YIJQ 4BS9A 2AHJB 1WI3A 3TW7A 4ZH4F 2M1HA 1ZK8A 3G2BA 2EIJH 3IUOA 3FBIB 2K9NA 4FSSA 1S7AA 2VI6A 8AT1B 3NRVA 1T95A 5L3FA 5D5XB 1ZQ3P 2DD5A 2HDCA 4IUUA 2AS5F 2O3FA 1WJSA 2K4JA 3PO2J 3Q0VA 2CUEA 1YITI 5A0GA 3L42A 4AFUC 1KQ2A 3IC7A 4D5FA 3QZ9B 3NTKA 4LN2A 4CYCA 4OU0A 5HLIA 3RKYA 1WJDA 2EZHA 3ONQA 3JRDA 1O4XA 1GFCA 2XGCA 4L9NA 4FU6A 3VB2A 4XTZA 4JLIA 3T5XA 5IHNA 4C92B 2Y90A 1QVFP 4BYYA 4CXFA 4FISA 2LNHB 1OYIA 2DBBA 3TCJA 3UPUA 2EYYA 1UCRA 3TQNA 4AFSC 1YW7A 4HLYA 2XB0X 2P7VB 3ML6A 1BM9A 2LR8A 4RB3C 3GTLJ 2HSEB 3JAME 2RQTA 3FJ5A 3HOZJ 1NJIR 1QP3A 2GA2A 1RAEB 1UFFA 1G2HA 2CQQA 4E7JA 4QLCU 1ZREA 3JRBA 2PJRB 3K6GA 2E1NA 4GXOA 2CZ0B 2DL4A 2YRDA 4FSXA 2A28A 2WSEE 3RPUD 3E9FA 1ACMB 5H6RA 5TGTA 4BY6C 4WTOB 3AG2H 2XPVA 4PJMA 1D5YA 5GAOq 5D4SA 1MNDA 3CCQQ 2JVGA 2M0OA 2V1QA 4EPCA 3ERMA 3CUOA 5LFAA 1OYXA 5IHKA 3MQ0A 3OW2S 1MZBA 5HOOA 2RKHA 1QWEA 2LT4A 4QQ6A 1VQLI 4C8QA 3M8EA 1FTZA 2K2VA 4C92A 2BE7D 2CP2A 2QZ8A 1FTTA 2DA2A 1RNLA 3EUHA 1QGPA 1T33A 5IP6A 2PTKA 2IA0A 5HCKA 4HNVA 1OISA 3CZ6A 4J6XA 2W1OA 1B9MA 2RQVA 3E2UA 3FK7A 3BTIA 2RQRA 2EYQA 2L9VA 2P4RA 4XSXF 3EAEA 1IV8A 3CCJQ 1NJIC 5EJCA 3RYRA 1VIEA 3CDLA 2EBPA 2PJRA 2MIOA 4LDWA 4M3BA 3OSGA 3TSZA 2RK2A 3M0SA 1YITA 5KK1A 4DOWA 3TGNA 5GAN8 3O3KA 5IAYA 2ZKZA 3TEDA 4EJTA 1PHTA 2P5VA 3SWNC 1MD0A 1R7JA 2EZIA 3DEWA 1ZSZB 2K85A 4Q5WA 3OA6A 1RL2A 1R1VA 2MA3A 4L5GA 1E7OA 1T0FA 3G1JA 3QP6A 5EG2A 1W4SA 4L9VA 2F2EA 3FXKA 5BPDA 2ZC2A 5IYBJ 1EA3A 1LDJA 5JI6A 3I4NJ 1IDYA 1R1TA 2H3EB 3X26B 3I54A 3PE0A 3I3LA 4R56A 2RM4A 5DM7F 5FFXA 3NARA 4F7ZA 4J01A 1KG1A 3S8PA 2O9LA 5J8FA 3ABLH 1R49A 1T8IA 3A8GB 4J9BA 3CXCP 4S04A 2VKNA 2VXFA 3EETA 2XVCA 3HM5A 3KFWX 3L2CA 4CHUA 1FLIA 1XSXA 2EJGA 1P4WA 5EEHA 1WQ2A 2PQ8A 3H0DA 5HLHA 1IXCA 2CP0A 2FZKB 2ME0A 1K73U 3TMOA 4L9TA 2CUJA 2DK5A 2L54A 2WTEA 2XKOA 1D8KA 5HDNA 1WVRA 2X4XA 1IN7A 4ESFA 1MBHA 2E5KA 4KT6A 3PFSA 4BB7A 2KDOA 2CW0F 5E1XA 2M7BA 1M3BA 3C2BA 2X0LA 1ZSZA 1VQLA 1FBUA 1G4DA 1U0JA 3DKYA 4Q4ZF 4IURA 1RR7A 3A8HB 2E6NA 5FLXK 4RLFA 2Y31A 3FXOA 1JUMA 8ATCB 2YU9J 2M34A 2L3QA 2CQXA 3GP8A 1EH7A 3K1NA 4CICA 2Y69H 4RM3A 3F6OA 4MEXF 4Z89A 2LX7A 3KX2A 2K9GA 2H6BA 3MHXA 4OAZA 1RLPC 1G3TA 3LSMA 5IYDJ 5HKCA 4J9CA 2HDDA 4J83A 2QEXT 2LJ1A 1D5VA 1R23A 2FQ3A 4M9XA 3HOYJ 4PJOB 1DPRA 2ID6A 1V5GA 4HDUA 1IRXA 2WC2A 2STWA 5GAMf 2X9DA 3S1NJ 2ZPBB 1ON1A 3HGGA 2TCTA 2E34A 2FBHA 2J5OA 4I0BA 1NLOC 1NYGA 3HTRA 1UELB 1YHQT 2WV0A 2NS0A 2OAUA 1G3WA 4FASD 2ZCFB 1PP7U 4D0PA 1PG5B 2ED0A 2M02A 2R0QC 1JO8A 1BCMA 1BB9A 1IO2A 2DXCA 5GANg 2L9NA 3HJEA 3EH1A 1U5TC 3QQAA 5FWBA 3RPUA 2MD0A 2DETA 1YJNT 1ZG5A 2E36A 1XB4A 3VOEA 3PNWC 1IN6A 4BE0A 2HOTA 1LCKA 3H3ZA 2K4YA 1Q81U 1QPMA 2DMUA 5DY9A 3M8JA 5M9OA 3SB2A 3WTZA 3CCSI 3AG3H 4TVRA 5ICGA 1UGPB 2QYOA 2XD0A 1YI2T 1SRLA 1R77A 3E5UA 5ILSA 1ORKA 2OI3A 4DEXA 2F5FA 1ZAOA 5M5YJ 2CS7A 2HZDA 2D9TA 3NTHA 3P8DA 1RESA 4IXAA 3VFZA 4RGUA 5IT9E 1LE8B 2JMAA 1K78B 2M35A 3WE3A 2F4OB 5IXFA 3IHUA 2WADA 1YI2I 4RA2A 2HKNA 1QVTA 3CD6T 5M5WJ 4CC3A 1STZA 4F52A 5KHDA 3GZ5A 5BOXA 3JCMh 4M75G 2XHKA 4A3JJ 1KIKA 2KISA 2JZ2A 1U1SA 2BBYA 1I39A 4LG0B 3LMMA 1B34B 4B8XA 3H8ZA 3VU3C 2LCLA 3VSLA 1YJ9Q 1M30A 1TZLA 2K79A 5AIQA 4KICA 1ONVA 2RDPA 4G6DA 1FYKA 2L2PA 3B02A 2VBZA 2VPRA 4BAYA 3SZGA 1YCSB 5I22A 2V26A 4BY6B 3CCUQ 1HDPA 3DCFA 3PUFA 3ZR8X 1AOYA 1P92A 2GQQA 2EIKH 2EFPA 2Y0SN 2Q2EB 5L3BA 3LH5A 2QEXA 3UNGC 1R36A 3G71Q 2LVMA 1OYYA 1PM3A 2E41A 3CJQB 2X4WA 2ZPFB 1AT1B 2K7AA 2LNVA 2FBIA 1OX8A 1D0ZA 4GBQA 4FQGA 1YHQA 2JA6J 3INZA 3VS4A 1TLHB 3G1OA 4I0AA 3CCET 2ZGWA 3L2QA 2QVOA 2G3RA 4DW6A 4EM2A 4IUTA 3CC2T 4LG0A 2DXIA 4BQAA 1B34A 3OYFA 2JTEA 5FKKA 3ERED 1RUWA 4Y92A 4FW2A 2E1HA 1GRIA 1UHSA 2CQ7A 4FX0A 1YJNA 3VEPA 1WDXA 3JRGA 4XU2A 5LHHA 2EQUA 2VASA 5EZHA 3CCEI 1XGMA 4M7AC 3C18A 4PSWA 2DJIA 1ZA1B 2HDAA 4RM2A 2OQRA 2WV1A 1FSHA 3CCUI 5JLXA 2MH2A 2FJ1A 2QYZA 4F7UB 1YI2A 2FRYA 5IOZA 1T56A 3KLOA 3LFUA 3W6KB 4XRSA 1PKTA 3G71I 1PKSA 2BKDN 1K0SA 2AHQA 3VUZA 3JCMJ 2UV1A 2V1RA 1H89C 1NPPA 3EUKL 3ECHA 1TG0A 2DIGA 3QHSA 1RAHB 1WRJA 2JA7J 4LD9K 3S3MA 5DM6F 3BZCA 4MGRA 2RI5A 3LA2A 2K3XA 1O7LA 5CLSA 4AIHA 1FPQA 1SEUA 3VV0A 2QAZA 5E3LA 1GBQA 1TOVA 3CD6A 2KRNA 1Z05A 1HKQA 2VODA 5FKMA 2KE9A 2CQKA 3KIOA 5D8LB 4Y15A 1U78A 1MMNA 1EX4A 4IUQA 4IQJA 3I5SA 2YRVA 4X1VA 2BGCA 4M3GA 4PFOA 2JNGA 3H5NA 3L9FA 2CDTA 2RB6A 5HK3A 3BR3A 5J1UA 4B4CA 2JRTA 1UGRB 5E8IA 2RJEA 2KIMA 3HL8A 3BR2A 4RTZA 2WWYA 4F7UA 2ZMEC 3D0SA 4BGDA 1WNLA 1WH7A 3BZ6A 2KSSA 4IO9F 2M5WA 2A3LA 3ZEHA 3CCMI 1PD1A 1LVKA 1EF4A 2M4GA 4RTUA 2R5AA 4CC4B 3IKVA 1WJAA 4A0ZA 5D8KB 5IPAA 1Y8RB 5LHGA 4ZNXA 1TWFJ 4G7OF 2NXNB 2RK1A 2DMPA 1XGSA 1S3JA 1D3YA 3BC8A 2RPNA 1B6AA 2L02A 1X27A 3OYDA 4JUVA 1J59A 4RAZA 1IDZA 1BC8C 2Y0SA 3KUFA 2DODA 2V7FA 1EV7A 3KP2A 2C0OA 3CCEA 1N6AA 1MV3A 3PIOA 1MJ9A 2ZJ2A 4JJNK 3CC2A 2JWTA 2UXXA 1H0MA 4PLIA 4DBQA 2OPTA 3LSGA 3S2DJ 1LDKB 2Z99A 3CESA 2X6WA 3ABUA 2LDUA 5E20A 1OCRH 3MKZA 3H41A 1W2BA 3FIWA 3KZZA 1NHAA 3U1DA 4Y13A 3JRCA 2F1LA 3RMQA 1M90R 3V42A 2RQPA 4FE4A 1O9SA 3NQOA 4G9YA 2JVVA 2QBYB 2KROA 4M7AD 2FU4A 1OQKA 4J00A 2HVSA 3W2VA 1S72T 2A5YB 2KKOA 3HGYA 5F1JA 3K4LA 4LGWA 1IZ1A 3S32A 3RZOJ 3I59B 2L7FP 1YJWT 4O3MA 2LBFA 1B07A 3HHGA 3H0FA 1JXSA 1SD4A 3H35A 2HCKA 4H0EA 4ZTFA 2HEQA 4K11A 2ZXHA 1JXMA 4C5EA 2COYA 4EV0A 2KVQG 2PI0A 3CPWS 3CPWP 3DBRB 2QGGA 2R3SA 1ZYRF 2ESNA 4QPOA 4H4KC 1YJWI 1CKBA 1N9SA 3M0TA 1BIAA 2CMPA 4DA4A 2VUMJ 1K4SA 1IJWC 2CFXA 1TXQA 1X2NA 2X51A 2QTXA 2VONA 4B43A 2DL3A 2JXBA 5E18F 4OVAA 3KYDB 2WAQN 3MZ8A 1HA8A 5FGMA 4A93J 5GP9A 1T38A 2J6KA 1YN8A 4PCQA 5D5WB 2GCXA 3WU1B 2HR3A 1WI9A 4L5JA 4XMYA 2NLUA 3ZQQA 1WQ7A 2EFQA 1FIAA 5HDKA 3QO3A 2DK3A 5GMKl 3I59A 3I64A 4ZGJB 3DPUA 2L0AA 4CO8A 3Q0WA 3ZCOA 4HF2A 2VOOA 1K76A 3QYHB 2QI2A 5EF6A 3FX3A 3JAMR 2CYYA 4LFUA 1XN7A 1BKBA 2LQ8A 5M5XJ 1FMWA 1VQ4I 1PWTA 1FP1D 4MIMA 2KT8A 3FJPA 2JUGA 4RUGA 4AT1B 1I4K1 3QYBA 3LWFA 3LNQA 4PJOG 4OOIA 2V1UA 2LKXA 2H8RA 4XTXA 2JT1A 5IP7J 4S05A 3MCAB 1Z6RA 3IH4A 4MQ9F 2JMCA 4EM0B 2W00A 2RN8A 4ON0A 3AL0C 1KSWA 4CGZA 1IGNA 2DJZA 2CUDA 2OTLQ 3LGLA 3FEOA 1TWBA 1LNXA 2GA1A 3UA6A 1BJZA 2LYCA 4BY7J 3K10A 2EYWA 5GMKh 2F5EA 3DEUA 1QVGS 1AKHB 2VLAA 3QIIA 1VQ8Q 3QWLA 1WXTA 4KUDK 4ABZA 4X9CA 3LA3A 3CQZJ 4AIJA 5M3MJ 4J19A 2ISYA 2LVSA 3DPLC 2O88A 4F16A 1Y56A 2KIFA 3RKXA 3VYHB 2L7ZA 2QQ9A 2TDXA 5JVTA 2RD1A 1X75C 1S72A 3AHUA 2CT3A 4ZYGA 1K6YA 2FYKA 1P4XA 1XGOA 1BIBA 2HI3A 4I02A 5CR2A 1YJWA 1VQ9Q 3GCMA 5GAOm 5J1RA 3SFMA 3ASKA 3CCVT 1W7PA 2L3DA 5BQTA 3TU4K 2QTVA 1O3TA 2P6SA 2BY1A 2L01A 3ZN1A 1LFBA 2M1BA 3BJ6A 3BZKA 3X2QH 1VQ6I 2CFOA 4EGZA 3AG1H 5CVJA 4OB3B 5GAMj 1J2XA 1SSHA 1KA8A 3F21A 1AWCA 1MMSA 1ZBXA 2QA4Q 4IRIA 3A1PA 4J7IA 3SXYA 2CZ7B 1K8AU 4LG3A 1HD3A 4RMNA 4B48A 4M7AE 3CDIA 1AKHA 2K3PA 1KQSA 3X25B 3W6JB 3KP4A 3VODA 2CP7A 2R5MA 5E3MA 2I8DA 5LJ5h 1YCYA 4M7AF 2DA3A 3VYTB 1MNEA 1Y39A 1H9TA 2NVUB 2HKQB 3ZQHA 2ESWA 4HXJA 2OTLI 2FMYA 5DD8A 3OYMA 1VQKI 4ZDOA 3CTAA 2LJ3A 2YUOA 3QDFA 4N0AA 3CMEQ 1U2WA 1FBSA 1IO6A 3JAMZ 3OSVA 3BTLA 2LREA 3TBIA 3VS3A 4R8HA 2G7HA 1M8MA 2MW8A 2LJ0A 2WAQA 4O5VA 4EM1A 3EFRA 3OR1C 1UJ8A 2K6DA 2XU8A 4P55A 2ZMEB 5J3LA 1PRLC 4BE2A 3OYNA 3M0UA 1QCFA 1BW5A 3J81K 1K9MU 3ZN0A 1C0WA 3PUBA 2EZLA 2R7QA 2QA4I 4U7BA 3T8RA 2X6XA 2P0QA 1KC8U 4UUVA 2FBKA 3S17J 3H92A 2H3JA 4JLGA 1QU3A 2JM9A 2BXZA 2ZBKA 1JTYA 1U9NA 2O8KA 1M27C 2EGCA 4D7NA 2LC4A 5DS9A 5J39A 2X35A 2Y4YA 1EIFA 3F8CA 1HXDA 1FNNA 2LFBA 3ZMTA 1WZOA 2FE3A 2EFIA 2NVTJ 3QSUA 4YG2F 1Z1DA 4IEJA 2LKSA 4A3FJ 2E65A 4RKUE 3C1DA 2V9KA 4YTLA 3D7SB 5GAN2 4DQ2A 1TSFA 3JB9G 1YS6A 4FCYA 4F14A 4UB8C 1JQQA 1E3OC 2M87A 2FOWA 1USTA 3RESA 4A0XA 1KQ9A 2F48A
chains in the Genus database with same CATH topology
5FU6C 2LQKA 4IRHA 2UXNA 2VN2A 1FT9A 2ZMEA 5ILUA 1OPCA 4GLKA 3CCVA 4C8QC 3L2ZA 4C92C 2M8EA 3LSTA 3BROA 2MI6A 1HKSA 3MZYA 4A54A 4MDXA 1ZARA 4KA4A 5LJ3f 4RGXA 3KCCA 4HYEA 5CKFA 1NJIU 3CUQB 1KU9A 4A6EA 2KQWA 3LGFA 3T8TA 4BHCA 2OTLA 3QOPA 4P9FA 3SZTA 2VE8A 4ZYDA 6PAXA 4FT4A 1J5YA