2QQ9A

Crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
212
Chain Sequence
b'DLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 73
structure length 212
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qq9A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qq9A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qq9A03
4HBLA 1D3YA 2A6EF 2PJPA 1G6NA 1BI2A 3LAJA 3ZPLA 4CXFA 3BP8A 1BC8C 1TBXA 3GXOA 5J6XA 1J9IA 2YU3A 4UUVA 3R0JA 3JAMZ 4RB2C 1FSHA 4WXCA 1O3SA 2DW4A 1XSDA 1G3WA 1ONVA 3HHHA 3ECOA 1KYZA 1Y0UA 1WI9A 3I4PA 4MNUA 2MC3A 4ZH4F 1UFMA 3L7WA 3E5QA 4EM0B 2H3JA 1DUXC 2XAFA 1G4DA 4R79A 4HDVA 1W7PB 3E97A 2ZFWA 1B9MA 1JGSA 1XGMA 2PMHA 2CYYA 4YIIA 1R7JA 2GCXA 2ZJ2A 2DQRA 1ZGJA 3EQLF 3AAFA 3HRUA 5H6QA 2FOKA 3RTRA 3WU0A 3T8TA 3I71A 2VOPA 3M9AA 4KICA 3IL2A 3HSRA 1SMYF 2QVOA 4ENMA 1XMKA 1FBQA 4ENKA 4WWCA 2FMYA 1YW8A 4RS8A 3DPTA 2EA2A 1OYYA 1ZREA 3ML6A 1P4AA 4L18B 2FF4A 4IRHA 2XKPA 2HTSA 4UVCA 2HEOA 1R5GA 4ZYGA 5HLGA 1FC3A 3EYIA 5LGNA 5AIPA 3LQRA 3CO7C 1QNTA 5DDGA 3R61A 1FZPB 3U2RA 5E8IA 3T8RA 4WF2A 4XLNF 4M73A 2GXGA 5DCMB 1T98A 4PGGA 4LLGF 1F4KA 5A2QZ 1YYVA 3T5XA 3FMSA 5L3DA 2V1XA 1W7PA 2DBBA 2R7FA 4IVNA 2RKHA 3BJ6A 3G73A 2V1UA 3FHZA 3P7NA 2EV5A 4G6DA 1KU3A 2DLLA 1EH8A 4H0EA 1BIAA 3K1PA 3M8EA 4DQ2A 5D8KB 2XRNA 3WE3A 1XSVA 3F8BA 3PQJA 5HDGA 3F21A 2MA3A 4HF1A 2M1BA 1SFXA 3P9KA 4U0WA 4PGHA 3HUGA 4KDPA 4F7ZA 4JK1X 4EJOA 2LX9A 2HYFA 2A68F 1PDNC 3QP5A 2STTA 3GWZA 1KGSA 2V6CA 2UXNA 2K27A 1EH6A 2F5FA 2FRHA 2X0LA 4ZYEA 1KQ8A 3F8CA 4I02A 4HF0A 2VOOA 3DP7A 3R0AA 1PUEE 2LSOA 3HSFA 1ZRFA 2KIFA 1HW2A 5D4RA 3J80Z 2K7LA 2KIMA 4K2EA 1J0RA 1MDMB 2ELHA 2RGVA 1R5HA 4U0VA 3HIFA 2ZNYA 3OOPA 1YG2A 2MH2A 1KQ0A 4BXUA 4LLLA 1O3QA 4WXDA 3CDHA 4P5OA 1UB9A 1ZG3A 3ABUA 3FXRA 2Z99A 3RKWA 1IN6A 1HKQA 2EV0A 3V7SA 2XIGA 1GXPA 3I59A 4RB0A 3P9CA 2PN6A 2FNPA 2VBXA 3RIRA 1IXCA 3RYRA 5DCFA 4ZYDA 2BYVE 3HHGA 2IT0A 4CZZA 3M8FA 2VBWA 4G7OF 1MJAA 2IJLA 3ZMVA 3DFGA 3HTUA 2Z5UA 4OU0A 2CWEA 1W4MA 2D1HA 2E7XA 1NHAA 3M7GA 2HKOA 4U88A 1T2KA 2W84A 2E1CA 1FYMA 1K78A 2RVCA 3IC7A 4N9HA 4A5NA 1MDMA 4KIGA 3O2PE 2P7VB 4L5JA 3MWMA 3V4GA 3FWEA 3WU1B 4KA4A 2L3DA 3WTTC 3CUQC 2QYOA 2KRFA 2OBPA 3Q9VA 3MCZA 3ERED 2QZ8A 1LDDA 1ON1A 2HYGD 4QLCU 1BI3A 1I1GA 1WRJA 3V7CA 4XLPF 2IW5A 3GEZA 1XMAA 4A6DA 4OMZA 4P55A 2OQGA 4UV8A 1YO5C 2L54A 1KU7A 5FD6A 5LHGA 2FXAA 1OMIA 2JSCA 3H92A 3BJOA 1H0MA 2P6TA 3RKYA 4Y13A 2PBIA 3F6VA 4BHPA 3PFIA 5LEKA 2FBHA 4LB6B 4S04A 1FY7A 2QWWA 3IWZA 1J59A 4HQMA 5J8FA 2IPQX 2XAGA 4GYGA 4A2UA 2P8TA 5BMZA 1USTA 3SQNA 3CUOA 3DXJF 2NS0A 5FLXK 4MTDA 1XN7A 4G94A 5FFZA 2H6CA 2YX7A 5EEGA 3EETA 1J2XA 1V4RA 4FHTA 5BOXA 3I64A 2DQLA 2V79A 1O7LA 2HGCA 5L3BA 3MZYA 2HZTA 3EYYA 4U0YA 1FLIA 4HX8A 2OAZA 1IRGA 3R4KA 1SD7A 2KIUA 1W7PD 1ZRCA 5TRDA 4EV0A 2JTVA 1MJBA 3H3UA 4WK8F 2CSOA 2Q2EA 2K5LA 3SHFA 4Y17A 5LRSA 2G7UA 3CJNA 4UHTA 1IN5A 4RGSA 4ZZDA 4L9JA 1BJAA 3RYPA 2LDUA 4OINF 3OV8A 4CHUA 2E1NA 1AOYA 5LLQA 2GZWA 1HBXG 3JTHA 2OZ6A 3P9IA 2XAHA 3FM3A 3T0YA 3ZQ7A 4ZYHA 3JSOA 3LWFA 1AWCA 1S6LA 2ACJA 4MEXF 2PQ8A 2JT1A 3ZMDA 2VONA 1BN5A 5FGMA 3WTUC 3GUDA 4G9YA 4BYYA 2K86A 1MD0A 1SD5A 4HOBA 4PCQA 1F1ZA 2VXZA 1E17A 4L0YB 3GX4X 4IHSA 3M1EA 5ED4A 3E19A 3LA3A 4FX0A 1EV7A 2O6GE 4KFCA 1T6SA 2VBYA 1QZZA 2IA2A 2UXXA 1B59A 2ZKZA 3NRVA 2Y0MA 1IN4A 2FNAA 3R60A 5D6FA 4U7DA 1LEBA 2A6HF 1U2WA 4KYWA 1SAXA 4XSXF 5LBQA 6PAXA 4HQEA 5BPIA 4GO1A 2WWYA 3VODA 1K79A 5J8CA 3F8FA 3B02A 4CDGA 2L02A 5CVIA 1MGTA 4LFUA 3HOTA 2ISYA 2XASA 3BPVA 5E8GA 1ULYA 1D5VA 4U7BA 4KMUX 2VT3A 3ISPA 4Z2YA 4WX9A 2ZBKA 2EJRA 2M5WA 2XGXA 3VB2A 5D6EA 2IRFG 1S7OA 1U5TC 4FX4A 3ZMSA 5FLXZ 1YW9A 4YFXF 4EM1A 2F5EA 4BAYA 1G3SA 4TV7A 2K4BA 4OIRF 4RGRA 2G9WA 2PFBA 4HLYA 4FT8A 3ECHA 4AIKA 3KETA 1HXDA 1LQ1A 4R1HA 3ZMTA 1WWXA 2VE8A 5E20A 5KK1A 4RGUA 1XGSA 2A3SA 4Q48A 1L0OC 1F9NA 4A0ZA 5E18F 5LGTA 4ENNA 3N97A 2O3FA 2B0LA 1BI0A 3ZN1A 2DO7A 2LF7A 2XAQA 1RIOH 5F1RA 2EV6A 1XCBA 1Z05A 1IAWA 2MLGA 3L09A 3KEQA 1ZLKA 3HRSA 4G7ZF 1TW2A 4EGYA 1LEAA 2M30A 1FPQA 2V1DA 4OOIA 3C18A 1O57A 1Z7UA 1QBJA 3F22A 2J5PA 3HTSB 2RDPA 2FA5A 3WTZA 2C6YA 2EFNA 1YS6A 4OMYA 5FO5A 3I59B 3TDZC 3KZYA 3QAHA 1K6OA 4ASNA 2ADUA 2IA0A 1TQPA 4GGGA 2DFIA 3QU6A 4I0AA 1ZG5A 3K1MA 4LJZF 3FXUA 3L2CA 1VTNC 1HSTA 1IUYA 3SZPA 2V9VA 2JRTA 2RV8A 3HYIA 3TKYA 3K9TA 2GQQA 1S29A 1SFEA 2CQKA 5D4SA 5HDNA 1O7FA 4HF2A 4UV9A 3U1DA 1K78B 5DV5A 4A0YA 2K5IA 3LQQA 4KN7X 4E70A 1ZRDA 1J5YA 3QRFF 2J5OA 1DPRA 2NRAC 5DD8A 2PEXA 3KP6A 5E1WA 1XSXA 1U78A 2ZXJA 3CTAA 4RGXA 4LG0A 4UXNA 2ZCWA 3V8LA 4IJAA 2DAOA 1ZARA 4CICA 1CGPA 3ZMZA 4P9FA 3F23A 5ERIA 2E7WA 2MH9A 5BPDA 4EGZA 3U9GA 1OYWA 3VFZA 2H27A 3EUHA 3Q9SA 2DU9A 5LGUA 3IHUA 1R1UA 4HYEA 4YIFA 3MFKA 3E6DA 1JXSA 5HOOA 2TDXA 2XVCA 3V8JA 4B8XA 3TO7A 4IF4A 3KFWX 4I09A 3WGIA 1JE8A 2ZNZA 2ISZA 2F5DA 3O3KA 1QO0D 2HDCA 4L9VA 4P9UA 3PQKA 2QBYA 3KEOA 3RI4A 4BHCA 1FT9A 1Z91A 1BYMA 4I2OA 2L4AA 5HS7A 1TNTA 1XDSA 3KE2A 1REPC 4L9NA 2VBZA 2CFXA 1IZ1A 3FF5A 2VT2A 1IXSB 1I1SA 5K5QA 5L3GA 5L3CA 1SD6A 1BBYA 1WQ2A 2EB7A 3O6BB 5JFRA 3WTVC 3WG9A 3NQOA 4M9SA 2A5YB 2JPCA 2QQAA 2HOEA 2Q0OA 4ZZLA 1QGPA 2XAJA 2HWVA 4A6EA 2KJCA 3E6CC 2HQRA 1KYWA 1QW1A 1R1VA 3I0TA 5CVVA 3TOBA 3FXQA 1G3TA 2JPBA 3MHXA 1D8KA 4EJUA 4RB3C 2QLZA 2A07F 3GFIA 1L3LA 1BM9A 2YPRA 4JQFA 4LK0F 4KIBA 3JAMK 2FQ3A 2OD5A 4CO8A 1JHHA 3WTWC 4RAYA 1SD4A 3E5UA 5CYVA 2R7DA 4G8XA 2D1VA 2QM3A 1Z1DA 1P4WA 2ZMEA 2FSWA 5DUKA 3RJPA 3I5UA 4IXAA 1J7KA 1LB2A 4LMYA 1TLHB 2PG4A 4AWXB 1TQMA 2FBIA 3LFKA 5LHHA 3TO9A 1G3YA 3COAC 5CVRA 1QVPA 3FM5A 1OR7A 1T0FA 3WE2A 1RUNA 4EM2A 1PP8F 1FP2A 5ICGA 2NAZA 1F5TA 3JTGA 2DT5A 1UCRA 1UHMA 4BH9A 1H9TA 1I6XA 3DF8A 1QZYA 3GLXA 1P2FA 3NEUA 3BJAA 2GIVA 1P4XA 4HA8A 3LSTA 3WGHA 1BC7C 2COMA 2Z9OA 3ABTA 3D5LA 2L01A 1V3FA 5HLHA 1P92A 2EFWA 3BDDA 4EJWA 2K4JA 2W85A 4LD5A 1DP7P 3FZVA 1KQ9A 5CJ9A 4EJVA 2BV6A 1OKRA 2P6SA 2ZO4A 4GXOA 2KJBA 4P96A 5A2QK 3HSEA 3SFZA 2EFPA 1Z6RA 1RZ4A 3GF2A 2OU2A 3V7RA 4M6YA 2UWMA 3G3ZA 3K0LA 1P6RA 2AS5F 1R00A 3QPHA 5LRRA 3RDIA 3BROA 3GFLA 2R3SA 2VE9A 5CVJA 4A0XA 1WKMA 2MD5A 2MLKA 1FOKA 1FP1D 3E6MA 1I5ZA 4YG2F 2FBKA 2F2EA 5BQTA 4IRIA 5JVTA 3WGGA 1LJ9A 5ILSA 5HVQC 2RC4A 3W6KB 2OA4A 4XBFA 2H94A 3QU3A 4EJTA 1E2XA 1LVAA 1ZYRF 2O61A 2D2WA 3CLOA 3GVAA 5E1XA 4HDUA 1HSJA 2EFOA 3SZTA 3HRTA 1GHCA 4A5MA 5AONA 2PLYA 4Q5SF 5IT9K 5DYMA 2Y75A 4HZFA 1MZBA 2IA1A 1USSA 1XCVA 3DQVC 1BIBA 3SXYA 1XD7A 1HKSA 2P5VA 5H20A 1R22A 2RN7A 2WC2A 4OIQF 2DI3A 2ESNA 2OQRA 3BPXA 1T39A 2FEZA 2M45A 5E1ZB 3HRMA 1ZAOA 5BS6A 2VODA 1B9NA 2WV0A 4KIFA 3F8NA 1J75A 3MQ0A 1BI1A 1S3JA 3W6JB 2QENA 1RI7A 3BWGA 2A61A 1XB4A 3GFJA 1D8JA 2DK8A 1HKTA 4L5IA 5F6FA 3KP4A 4ESBA 2W57A 1STZA 1QPMA 4HX7A 2XHKA 3LAPA 2RNJA 3RKXA 3F72A 3J7AO 5CLSA 2G7HA 3JW4A 4M72A 4MQ9F 2JZYA 4NHJA 4UNOA 4Y15A 4KT5C 2K4YA 2CW0F 3ZN0A 2EA4A 4NB5A 3D0SA 2DK5A 2OZUA 3REOA 1U5TB 3V8KA 4YFNF 3RPQA 1YFHA 1ZHFA 1B6AA 2FMLA 5D5WB 3GFMA 2MBFA 5ILVA 4M9XA 4I01A 3RPUA 2NNNA 2P7CB 2WTEA 1HW5A 3GW2A 5IT3A 2O0YA 5HDKA 3H3ZA 5D5UB 3KCCA 3IKTA 4LB5A 2L4MA 1W5TA 4NQWA 1B4AA 3C1DA 5DUIA 1RUOA 4ENJA 3F8MA 1BOAA 1GXQA 4YFKF 1ON2A 1W5SA 3ZMUA 5TJJA 5L3FA 3E5XA 2CG4A 4ON0A 2VN2A 4LG0B 4HV5A 4BNCA 3WTXC 2P4WA 4AVPA 2KKOA 3ULQB 2Z33A 3FMRA 1TTYA 3I54A 5D5XB 2D45A 1TQIA 4IHTA 2K5FA 2IVMA 4UVAA 1DPUA 1R1TA 4HW0A 2LF8A 4KUMA 3TDUC 2K02A 4EMSA 1U5TA 3VOEA 3GZ5A 5HS9A 1PP7U 1YTYA 5K5OA 4HX4A 3LA7A 3I58A 5HLIA 4BQAA 1A04A 2QBYB 2QQ9A 1B1BA 3WODF 2W25A 3E6BA 2QQBA 4A12A 4MHGA 4DNCA 1MJ9A 2FE3A 3GYHX 5JHUA 3B73A 1YW7A 3TGNA 1FX7A 4B09A 1MKMA 3R6SA 3N4MA 4M9ZA 5JI6A 5E17F 1KU9A 1IXRC 4M71A 2NNYA 4AIHA 5IT9Z 4O3MA 4AD9A 2XUBA 2DPDA 1IN7A 4MEYF 4PZJA 3JSPA 5L3EA 5K5RA 2O03A 3IRQA 5F64A 5DCMA 5ICFA 5JR3A 4GYIA 1XGOA 2Z3YA 4Q4ZF 3K69A 2CGPA 3QP6A 2ESHA 1K7AA 3BOQA 1R36A 3J81K 2BBYA 1OYIA 1Z9CA 5DD4A 2O8XA 4M74A 2HTJA 2EWNA 1UHWA 4MGRA 3CO6C 3ELKA 2UZKA 4LLNA 2VC1A 2AXLA 3I53A 4IPAA 3C7JA 1H9GA 5H6RA 1EH7A 1HW1A 1YQAA 4AIJA 1R23A 3DPLC 3GZ6A 2ZMEB 3WTSC 1T38A 2LNBA 2W24A 2Q8KA 5KVRA 4G6QA 4UVBA 2Y48A 5FFXA 4N9IA 1ZGAA 2ETHA 4XRFA 2M87A 1I27A 1IN8A 2XV4S 4PDKA 3Q5FA 3S2WA 4LK1F 1X3UA 3C3WA 4LGWA 3ROUA 4KMFA 2HFHA 1FYLA 1ODDA 3KP2A 1ZH5A 5HS8A 1Z6TA 3K2ZA 1FBSA 5ILUA 3L00A 4WXHA 1O3TA 4JBAA 3FMQA 2XKOA 1U6GA 3KP5A 5EEHA 1ZLJA 4EQQA 4QWQA 3K1NA 3CUQB 3DV8A 3ZP5A 3F6OA 4L0ZB 2P5LC 5DEQA 3GO5A 1FYKA 3IKVA 4KNYA 1O3RA 2YX4A 4O5VA 1KU2A 2FU4A 4BHBA 1DDNA 5LHIA 3TOAA 1OPCA 3HOSA 1YIOA 1LDKB 4KN4X 1Q1HA 5ICEA 2HKXA 3KP3A 3KZZA 5CVUA 2STWA 1SMTA 1HQCA 1LNWA 3L9FA 5D5VB 4RB1A 4I7HA 4RAZA 4GCVA 5FD5A 4S05A 1KA8A 4OIOF 1XDUA 2YR2A 1C0WA 3KLOA 4EVIA 4CYDA 2IP2A 1CF7B 1S7AA 1YLFA 4ETSA 2PMUA 4G7HF 4L9TA 4WCGA 1IW7F 2CO5A 3T1BA 2DTRA 1WSUA 1ZG1A 3IWFA 1FBUA 2GWRA 3WTYC 1FWZA 2HR3A 2BEOA 2RQPA 3FX3A 4I0BA 2GXBA 5D8LB 1YS7A 3IRRA 2HS5A 4HV6A 2PI0A 3CUQA 1ZN2A 3LA2A 3MEXA 4HLXA 3BZ6A 4I98B 2P5KA 1TW3A 4HAMA 2XROA 4M6XA 2QUFA 3F3XA 2HQNA 1U3EM 2LKPA 1U8RA 1S8NA 4MTEA 3J81Z 4CGZA 2GA2A 3BY6A 2BE5F 3TO6A 3EDPA 5ICCA 1RNLA 3MZHA 3QPTA 2EK5A 1R58A 1FSEA 2BGCA 1CF7A 4N0BA 3E3VA 3DEUA 5K1YA 3KP7A 1FNNA 3TQNA 2GAUA 5FB2A 2VC0A 2DPUA 1QQIA 2EFQA 4XSZF 2X4HA 3DKWA 4R8HA 3MAJA 3VEPA 2NYXA 1GVJA 2M8EA 4D0PA 1TNSA 2YSRA 4ESJA 5AIQA 4Q47A 1IF1A 4MQVA 1LDJA 2A69F 2GA1A 5LEJA 2F5CA 2H09A 4O6JA 3QOPA 1IRFA 1SFUA 4ESFA 3KLNA 2H6BA 1JHFA 3J80K 4IRGA 1XGNA 4OIPF
chains in the Genus database with same CATH superfamily
3BY7A 3H9GA 1VQ6I 4HBLA 1D3YA 2A6EF 2PJPA 2JS0A 1KD1U 3CD6Q 1G6NA 1BI2A 2VJIA 3D1NI 2VYTA 3GNGA 2ROLA 4FIBA 3BR6A 3LAJA 3CBPA 3JRCA 3ZL7C 3ZPLA 2CH4W 2P84A 4CXFA 1VQ9A 4BY6C 2P0WA 1FOWA 4FYVB 4M77A 2MVTA 1IO6A 1NPPA 3BP8A 1K76A 1EIFA 2X6OA 4I6ZA 1WXBA 1BC8C 2LKXA 1TBXA 1VQMA 3GXOA 4I76A 5J6XA 2M0MA 2YU3A 1J9IA 1RAGB 4UUVA 1G2HA 2A36A 3MKLA 3R0JA 2LDMA 3QKJA 4M7AA 3H5AA 4C30A 3JAMZ 1SKUB 4RB2C 1FSHA 3VYGA 2X9DA 2W4SA 3VS7A 4WXCA 3TW7A 3M0UA 1O3SA 4QSHA 2DW4A 1XSDA 1G3WA 3LWHA 2K5CA 1ONVA 1IHVA 1VQPT 1R5ID 4M3BA 3HHHA 2C0OA 4IURA 5DLOA 3G71I 3DCFA 3ECOA 2E36A 1KYZA 1D0ZA 2RHXA 4M78C 3PMTA 1Y0UA 2BW3B 3MO8A 3CC4I 3EGDA 3BG3A 2MAMA 1K73C 2LQWA 1WI9A 3QQAA 1E3HA 1B34B 2QKLB 3I4PA 1V5FA 1B07A 3RQIA 1M27C 1S1NA 4MNUA 2MC3A 2H8HA 2AZVA 3HDDA 1K6YA 4ZH4F 3OS5A 1RESA 1UFMA 2AT1B 3L7WA 3CMAA 1I3AA 2DOEA 1YIJT 3E5QA 4EM0B 1NEBA 2H3JA 4XLEA 3OIPA 3QYGB 2KT8A 1DUXC 2XAFA 1T8IA 1G4DA 1KK7A 1AZEA 4R79A 4HDVA 2YWWA 1SANA 1X1PA 1W7PB 2R7QA 3CXCA 2IXSA 1VI0A 4IUTA 3M07A 1HDDC 5GMKi 1PM3A 1ZBXA 5J39A 4A3EJ 2QAZA 4OF1A 4ABZA 2K3XA 4C92D 3E97A 2ZFWA 2MFZA 1QVUA 2V1NA 1B9MA 1JGSA 1XGMA 4IOAF 2PMHA 2CYYA 4YIIA 3QYHB 3REAB 5FJ8J 4M75B 5I2MA 1M1KR 1R7JA 2VJ5A 3QO3A 1TTHB 2RN8A 2GCXA 2ZJ2A 2KRCA 3L1AA 4EIKA 2DQRA 2KMUA 1ZGJA 2EZKA 1X4PA 4LD6A 3EQLF 5IP9J 3AAFA 2JK3A 3L2QA 3HRUA 3MKZA 2OF7A 1VQKI 2FG0A 5H6QA 2FOKA 3RTRA 3WU0A 2DIQA 1VUBA 3T8TA 3CCUT 3OR2C 3S1RJ 2RA2A 3I71A 2VOPA 3M9AA 4KICA 3IL2A 3JB9H 3SEQA 3HSRA 4A54A 4X6AJ 3VYSB 1SMYF 4CC4B 2QVOA 3FXKA 4ENMA 1C6VX 2QA4T 1YI2Q 2KYBA 4D6WA 3GMEA 1I5OB 1XMKA 1JUMA 3FXOA 1FBQA 3G6EA 4C92G 5F04A 4ENKA 4WWCA 1WDXA 2HSEB 2XDVA 5GMKj 3BTCA 2FMYA 4IL6C 4AG1C 1YW8A 2DZCA 2DRMA 5GANe 1VQ5I 1Y0NA 4Y92A 4RS8A 2RD1A 2DXIA 3I5RA 1U06A 1N8RU 3DPTA 2EA2A 1OYYA 1ZREA 3ML6A 1P4AA 4L18B 3CD6A 2CV1A 2FF4A 2PTKA 4ELYC 4IRHA 2XKPA 2HTSA 4BI8B 5IXBA 2DODA 4UVCA 4RLQA 2HEOA 1R5GA 2A3LA 2HKNA 4ZYGA 3NAUA 4QTRA 1RLPC 4A3DJ 1V1CA 2MIOA 5HLGA 1N78A 3EG1A 2CUFA 3OOUA 1UECA 5FLXE 2DA5A 3I55A 3RQ4A 4IHYA 1QKWA 1FC3A 3EYIA 3CC7Q 5LGNA 3ABMH 5FRNA 2DJNA 4C0DB 5AIPA 4BY7J 5AYFA 1KC8C 3LQRA 3CO7C 2EPDA 3LGFA 3JCMe 2RI5A 2RHUA 1QNTA 2JNGA 2DA2A 5GAMe 1AU7A 2QGUA 3K10A 5DDGA 3K70C 3UT1A 3R61A 1ORKA 3OYKA 2RH2A 2WBMA 2R58A 2V8JA 2WAQA 3X24B 1FZPB 3PJRA 3U2RA 3FKJA 5E8IA 3QYEA 1IV6A 2BZYA 3P8HA 1B34A 2LCSA 3T8RA 4WF2A 4XLNF 4M73A 4M77E 2GXGA 5DCMB 3BW1A 1T98A 3BR0A 4LLGF 4PGGA 1F4KA 4AT1B 4DEYA 3EUHC 4RDUA 5A2QZ 1UAAA 4FW2A 4CRIA 2CZ7B 5CCAA 2E1HA 3FXMA 1YYVA 3T5XA 1D1AA 5B66C 3FMSA 5L3DA 2VPLA 1N5ZA 5J47A 4RAFA 2KQRA 2R5AA 2V1XA 1W7PA 2DBBA 2M0CA 2R7FA 2W1OA 2RKHA 4IVNA 3BJ6A 2KMTA 4M7AE 5CAIA 4XIDA 1VQ9I 4FSSA 5F1JA 3G73A 1OISA 2WAEA 1X2QA 1VQ4T 1XTAA 2CQ7A 5HNFA 2V1UA 3CCLA 3FHZA 1ZA2B 4RCCA 1RPWA 1Q81C 4M75A 3P7NA 4N0AC 4RAGA 2EV5A 4G6DA 1VQMI 2OTJQ 1KU3A 2DLLA 1EH8A 4H0EA 3NWSA 3ZOBA 1Z0XA 3G1OA 4E7IA 1BR2A 1BIAA 3K1PA 2O4XB 3UDCA 3M8EA 4DQ2A 2VUBA 4F7UB 5D8KB 2XRNA 3WE3A 1XSVA 4CC3A 2NS8A 3F8BA 4F04B 4B9WA 2EQKA 3OYNA 3A01B 3PQJA 5HDGA 1TWGJ 3F21A 3TMOA 2MA3A 2CH0A 2DCEA 4HF1A 1WHUA 2XB5A 2EYQA 2HQHA 3E9GA 1NJIC 2M1BA 1SFXA 1BOBA 2GBYA 4GBQA 1PSEA 2HZDA 1IJWC 1I3QJ 3OIOA 1ZBJA 5LJ3j 1M3BA 4H4KC 1G59A 3H35A 2L5QA 4BDZA 4RTYA 3P9KA 1TSFA 2KSSA 4U0WA 1IGUA 3FK6A 2LG4A 2GNCA 4PGHA 3HUGA 4KDPA 2GFAA 4F7ZA 4JK1X 4EJOA 2LX9A 3VS5A 3MEWA 2HYFA 4R55A 2A68F 2LH9A 1OQKA 3CMAI 5FLXR 2KGTA 3P8BB 1RR8C 1PDNC 1UGQB 4DIQA 3QP5A 1IRZA 1VIFA 2STTA 2IG0A 2ROTA 2D8HA 2LY1A 1AWJA 3GWZA 4M7DC 1PUFB 2PUOB 3ZQFA 1KGSA 1BCMA 3EHQA 3JCMb 1M90R 3OMYA 3P5JA 3HJEA 1IXDA 4A4FA 1M1EB 2V6CA 4I99C 1TWBA 3KBGA 1X3WB 4ZYAA 2JM9A 2UXNA 3VDXA 1RAHB 2K27A 3ZRGA 1EH6A 1I81A 3C12A 2F5FA 2FRHA 3EUKL 1XNIA 3BDLA 2X0LA 2ZC2A 4ZYEA 3K6GA 1KQ8A 3F8CA 4I02A 4HF0A 4DZPA 3MP8A 2VOOA 3DP7A 2VKVA 3R0AA 2FB7A 3REBB 1QP3A 1PUEE 2L2OA 4E4HA 1S72A 4C3IJ 3BR5A 1GRIA 2LSOA 3PUFA 1NPRA 3HSFA 1ZRFA 2KIFA 1QQJA 2X51A 2DAQA 2JOYA 1HW2A 2VGNA 4XTUA 5D4RA 3J80Z 2K7LA 1OJLA 2KIMA 3BTLA 3KIOA 4CUGA 4K2EA 2MUNA 4C92C 4CCLA 2BZ8A 1VQ6Q 2WY8Q 2FHDA 3G1LA 1J0RA 2E3IA 5I21A 1MDMB 2ELHA 1CSKA 4A3CJ 3JCMQ 2WSFE 1WH5A 4NS5A 4N4IA 3JRBA 2JA5J 3BG5A 3HFOA 5GAN3 1TT5B 2RGVA 1R5HA 4U0VA 4ZDPA 3Q1JA 3G6EI 3HIFA 2ZNYA 3VSLA 2YRCA 3OOPA 1U9NA 3BR1A 1YG2A 2M0OA 1K8AR 3OYCA 2ED0A 2MH2A 1KQ0A 2R7SA 2IGMA 4BXUA 4PUSA 2CZ1B 5CR2A 1KD1R 3K4BA 4LLLA 1O3QA 2EKHA 4WXDA 1KSWA 3OBYA 3CDHA 1SC7A 4M3EA 4P5OA 2J05A 2OV7A 3FISA 3PFYA 3CBOA 4W97A 1UB9A 1ZG3A 3OYDA 1RI9A 4ZN3A 1VQOT 2HDDA 5TISC 3ABUA 3FXRA 5IOYA 1F43A 2JMCA 4YELA 2Z99A 2O4XA 3VS4A 3RKWA 3QJYA 2K3YA 4F7UA 3G71Q 3M8JA 1IN6A 1HKQA 2EV0A 3PNYA 3V7SA 3I55I 2XIGA 1GXPA 1X6BA 3I59A 3A01A 1WXUA 2P4RA 4RB0A 2WAQN 3P9CA 1TUGB 3TSWA 2PN6A 2FNPA 3CC4Q 2VBXA 3RIRA 3ZR8X 1IXCA 1OCZH 3RYRA 3OSGA 2HL5C 4BD3A 2RJCA 5DCFA 4CZCA 4ZYDA 2GOMA 1R49A 2P4TA 4F17A 3H1CA 2BYVE 2LY9A 2L9RA 4CA0A 2AHJB 1YJ9I 2ZMEC 3IV5A 3VS0A 1NYFA 3HHGA 1UGVA 3FDYA 2V9PA 3VYHB 2C0IA 4S0HB 2IT0A 2L2PA 4XQFA 4GRIA 4CZZA 4L59A 3AKZA 4OB0B 2ZJPF 2Y9ZA 3BT9A 3M8FA 3WVDB 2VBWA 3OL4A 1O4XA 3E2UA 1YJ9A 3DLLF 5GADJ 4KITB 4G7OF 1Q7YU 1MJAA 4FE4A 1YHQA 2IJLA 3ZMVA 1GXIE 3DFGA 4M75E 3CPFA 3S93A 5IYBJ 1PUFA 3HTUA 2HDWA 2PUKB 2GFUA 2COWA 1V55H 2Z5UA 4OU0A 2CWEA 2OUMA 4DBHA 3BFMA 1W4MA 1QCNA 3DKMA 3JB9I 2MG4A 4J9BA 2D1HA 2E7XA 3J7AY 2YU9J 3KYCB 3C2HA 3CCLI 2HOTA 1NHAA 4RTVA 3CCQT 1VQKQ 4B3XA 1MV3A 1W4SA 3M7GA 5CPRB 2KP6A 1N27A 5GJVB 2HKOA 3C4SA 1WPKA 1R77A 3ZGKA 1T08B 3CJQB 2I5UA 4U88A 3ZCOA 1T2KA 2W84A 2E1CA 2F5KA 1OR7C 1K78A 1FYMA 2K9SA 4M77D 1MMAA 1T0FC 2RVCA 4IO9F 4C8QB 3EG0A 2P81A 3IC7A 4E7JA 1ZQ3P 2HBPA 2MC4A 1VQNA 2YUPA 4N9HA 3OB9A 4A5NA 3LOCA 4DOVA 2QTVA 1MDMA 1MBGA 2L7ZA 4KIGA 4M7AD 3GLLA 4FQGA 1CQTA 4PJNA 1GVDA 3O2PE 1VQ5Q 2VPRA 1Y96B 1HSQA 2DBMA 4QVCA 2KRHA 2X1EA 1X2KA 4A3KJ 2ATCB 2FPDA 3HFNA 2CZ6B 2NVTJ 3SDGA 2P7VB 1VYTA 2CUJA 4L5JA 1FOXA 1Q95G 1UJ0A 5EZHA 1Q7YC 2F4IA 4C5EA 2BHYA 3MWMA 2RAEA 3S6WA 3CDIA 1JO8A 1YJNI 4JLIA 3V4GA 3FWEA 2IS4A 4BDYA 2KQWA 2SEMA 3EH1A 3WU1B 4JRIA 4M77G 4E7KA 1QVFA 4KA4A 2L3DA 3WTTC 1IC8A 4M3GA 3S1QJ 2EKOA 4LXCA 3CUQC 1QWEA 5J26A 2QYOA 1K9MC 2AK5A 1XG1A 2KVQG 1VZ0A 2LFBA 3U21A 2CKKA 2O9VA 4A4EA 2KRFA 2OBPA 2LP5A 3CCET 3MMYB 3E1SA 3Q9VA 4M7AG 5J4YA 3MCZA 3ERED 2R7RA 4J7FA 2QZ8A 1LDDA 2KZVA 4GLMA 1ON1A 4F52A 3OSVA 4QQ6A 2D9TA 2JJ7A 4RBOA 2L3QA 2HYGD 2A37A 1S72I 4QLCU 1BI3A 1I1GA 1WRJA 1X75C 1B7TA 1LUJB 2COZA 3V7CA 4BQOA 2FQ4A 4AVZA 1JUPA 1GDTA 1WJRA 3DLLA 3LSPA 3BG7A 4QPOA 2NVYJ 2Q2EB 4XLPF 1ZELA 5FRMA 2IW5A 3GEZA 4A3BJ 5DLQE 4N4HA 1XMAA 4A6DA 1VQ8T 4OMZA 4RUGA 2JS2A 3FDRA 2DVEA 1MNDA 2CV2A 2DD4A 3PMIA 5LJ3g 3AHUA 2BXYA 1VQ9Q 3K4KA 2OQGA 4P55A 3SWNB 4XTYA 1ZUYA 4UV8A 1TH7A 2EYYA 1YO5C 2L54A 2EBPA 3D7SB 1KU7A 5FD6A 2EW3A 4BI4A 5LHGA 2X4JA 2FXAA 4FTHA 1OMIA 2JSCA 3H92A 3JRHA 3BJOA 4F7UE 5GANf 1H0MA 3PTAA 1VQMQ 2E2IJ 4LDUA 2KBTA 2P6TA 3VRZA 3RKYA 4Y13A 2PBIA 3F6VA 3M59A 4BHPA 3PFIA 4DJAA 4QPQA 5FU7C 3VS3A 5A0DA 4GDFA 5L23A 5LEKA 4E2FB 2FBHA 2BE7D 4LB6B 4S04A 1FY7A 2QWWA 5KNLA 3LSRA 4KGZB 3IWZA 3CMYA 2K9NA 1J59A 4LDWA 4HQMA 5J8FA 4C8QA 5IHIA 2IPQX 2XAGA 4JDSA 4GYGA 4A2UA 4C0ZA 1TWFJ 2P8TA 2M4KA 5BMZA 1USTA 5KHDA 2CUBA 1PWTA 4MLOA 3JRZA 3SQNA 5FWBA 3PGGA 5GTIC 4XOPA 2DDAA 3HXLA 3CUOA 3CBMA 2EGEA 2YUNA 1ZSZC 3DXJF 2DM1A 2NS0A 2NUZA 1G5VA 2C0TA 4PJOC 5FLXK 4MTDA 1XN7A 5CKTA 2RMOA 2XF6A 4MO7A 3EG9B 4KH1B 3MKYB 1Y96A 5C4JJ 1N77A 3AFHA 1WGXA 4UUTA 3H0IA 4G94A 3HB9A 5FFZA 2K9QA 1E6GA 3E9FA 2BY0A 2H6CA 1OCPA 4A3GJ 3ZEHA 4V2FA 3CMAQ 2YX7A 3HKSA 5EEGA 2M8GX 3EETA 1B72B 1IHWA 1J2XA 1V4RA 4MFDA 5GAHJ 4NDLA 4FHTA 5BOXA 1XOVA 1YWPA 3H0GJ 5M3MJ 2E41A 3JCMd 1SF9A 2DKGA 2M0YA 2PX9A 2JT4A 5GAMd 2LRQA 2KIQA 3I64A 2DOAA 5M5XJ 2DFHA 2DQLA 2HXOA 1YHQI 1A6IA 2V79A 1O7LA 2HGCA 3K4LA 1QWFA 2BZXA 2JRMA 3DTIA 4NBQA 3JCMW 5L3BA 4HVUA 1QVFP 1PD1A 1H3ZA 3MZYA 3O8HA 2HZTA 4RTWA 1W5CC 1ETVA 4RM3A 3EGXB 4DOZA 1UZCA 2VJ4A 1ZA1B 3EYYA 4U0YA 1FLIA 3UR3C 1Q7YR 2XGCA 3HPGA 1XTDA 2C06A 1X3ZB 4HX8A 3S1NJ 4J9EA 4UY8I 2CS7A 9ATCB 2OAZA 2AQEA 1IRGA 3PNWC 1M2OA 3R4KA 1SD7A 2E10A 5EGOB 2KIUA 1W7PD 1ZRCA 2VUMJ 3DB4A 1K0SA 2GLOA 5TRDA 5GMKm 3KX2A 1XS9A 2DVJA 3M4OJ 2GTOA 1U0JA 4EV0A 2LCLA 4JS5A 2JTVA 3CCUA 2JN6A 4A3LJ 1MJBA 3H3UA 5KCHA 3OR1C 2CRGA 4WK8F 2DTOA 2CMPA 3S8PA 4LDVA 2OCCH 4P1WA 2CSOA 1VQNI 4M75D 3G6EQ 3I56I 2Q2EA 4IX7A 4BJ6C 2VKEA 2K5LA 3O8VA 3SHFA 1D0YA 3URGA 2DZ9A 2LMJA 2BY3A 1FIAA 2JA7J 3HOVJ 2J6KA 4Y17A 2MF2A 4FYWB 2K9LA 5KCOA 3KZIC 2LQNA 3H9JA 3SWNA 5LRSA 2G7UA 3CJNA 1JT6A 1QA6A 4Z02A 1WX6A 1QVFS 3B6AA 1IN5A 4RGSA 1N25A 4UHTA 4ZZDA 4AFZC 5LJ5j 1GCQC 2E5ZA 4DBQA 1ZGWA 4L9JA 1BJAA 4DYRA 5IXFA 2AXTC 2HQ5A 3RYPA 2LDUA 2RI2A 4IUQA 3MD2A 5CO7A 1YI2T 4OINF 4BY1J 1LVKA 3OV8A 2D0QB 5DTDA 3LL7A 3PNVA 4CHUA 3W3CA 2E1NA 3S32A 1BBZA 2ZGWA 3JB9G 1AOYA 4KGVB 5LLQA 2GZWA 2HKQB 1ZHIA 1QP2A 4PNOA 4HPQA 2X35A 1QRYA 4M75G 1QVGS 1HCRA 2QEXA 3CCJA 4F93B 5C4XJ 1WJCA 4DYCA 5IYCJ 1RAFB 2QK0A 4RTZA 5GAOm 4J9DA 3OYEA 1YJ9Q 1HBXG 2JUCA 4ATOA 2OCEA 2WV1A 3HC7A 3J7AW 1KHCA 3JTHA 1OEBA 2HI3A 1KIKA 3I35A 3DLMA 2OZ6A 3M4GA 3P9IA 2XAHA 3FM3A 1MNMC 3EG9A 2X4XA 2J6OA 1HC8A 3EGDB 1MIJA 1LFUP 4OMOA 3T0YA 1QKXA 2MZ4A 4J83A 5F0FA 3ZQ7A 4ZYHA 5KYYB 1VFCA 4HKEA 4L6V5 1XJWB 3JSOA 3TEEA 2TRTA 1ETOA 3DKXA 3NARA 1B72A 3CC7T 3M1CA 1QLYA 1X69A 3LW5E 4Z89A 1Q82C 1OYXA 3LWFA 1AWCA 5I22A 2EQRA 1S6LA 3EFOA 1WI3A 5E79C 2ACJA 3K4CA 5CQXA 4MEXF 2PQ8A 2R7WA 4LDYA 2JT1A 2JA2A 1S9HA 3ZMDA 1IUFA 2VONA 8ATCB 2R0QC 2AZSA 2M9UA 1OULA 4XONA 1BN5A 5FGMA 3S3MA 2DDBA 5GMKe 3CCLQ 3A5ZB 3WTUC 1GLNA 3EGXA 5EG2A 2BOLA 1PVEA 3GUDA 4C8QE 1PHTA 4G9YA 4A3IJ 1E0EA 4BYYA 4FW1A 2K86A 1TP4A 2L9NA 1VQ8A 4XKWA 3LFUA 5JVGF 1MD0A 1SD5A 4HOBA 4PCQA 5EGOA 2AKLA 2Y30A 3PIOA 1F1ZA 2FJ1A 2HOAA 4JX6A 4XU0A 4XN0A 1B3QA 2KK4A 5GAOn 2VXZA 1UFFA 3ER0A 2I10A 3BCAA 1WHJA 1E17A 4L0YB 2IBDA 2MWPA 3INZA 2K85A 2R5YB 3TL4X 1X19A 2K2VA 3JCMV 4J9IA 3GX4X 4BACA 4IHSA 4G12A 1BJZA 1K8AU 3M1EA 5ED4A 3E19A 4ELZC 1X2MA 2LOOA 3AG3H 1RC9A 3LA3A 4FX0A 2KRMA 1EV7A 3EHRA 2O6GE 1F36A 2LC2A 4KFCA 3ZBDA 1T6SA 2NVUB 2VBYA 4ANJA 1QZZA 1R9TJ 3ONQA 3SEMA 2IA2A 4PJ0C 2MK5A 1M30A 1ZLMA 1YJNQ 1NEGA 1NLOC 2UXXA 1FJLA 1B59A 2ZKZA 3NRVA 3CCVA 2Y0MA 1NTCA 4DW6A 1IN4A 2L3SA 4B4CA 2QGFB 1DGWY 2FNAA 3R60A 5D6FA 4ORZA 1M4ZA 4U7DA 3QPSA 2DILA 1LEBA 4BJTA 3VS1A 4MZPA 3AG4H 1AT1B 1MH3A 2A6HF 1A36A 1U2WA 2P0KA 4KYWA 4EMKC 1SAXA 4XSXF 2MOXA 3CC2I 5LBQA 4IQJA 2XDDA 6PAXA 1OCOH 1FOYA 1S72Q 4HQEA 3OW2S 5BPIA 2NYSA 2COBA 2NLUA 2MI6A 2YUSA 2M7BA 5GTHC 2DETA 4F7UG 2LKSA 3C2BA 4GO1A 1E7OA 2DIGA 4BB7A 4KGXB 4G6TB 1K83J 2WWYA 3KYLA 3VODA 1K79A 4BY6B 5J8CA 3F8FA 5DY9A 2FD5A 2EIMH 3B02A 2LT4A 5IN1A 5CKFA 4CDGA 3CCUI 1UE9A 2ESWA 2RQTA 3LH5A 2LJ3A 2L02A 5CVIA 2Y31A 2BIVA 1MGTA 5KYYA 4LFUA 1HK9A 2IGOA 1T56A 4PFOA 2WSEE 1YRNB 2JVHA 4C5HA 1EX4A 2KNBB 3HOTA 1JTXA 2ISYA 2XASA 3BQZA 3BPVA 1GBQA 5GAMh 5E8GA 4HCCA 1LPQA 3SYTA 4RCBA 1ULYA 1OI1A 2CSIA 3LSKA 1D5VA 2DTIA 2JZ2A 4U7BA 3DWLE 1Z21A 4YTLA 1VQLT 3HKZA 4KMUX 1AVZC 5LJ3e 1TU0B 1Q86C 1UGPB 2X3WD 2VT3A 1Z77A 3ISPA 3FBIB 4AIDA 1X4OA 2BZTA 2HVRA 2IS6A 4Z2YA 2EZHA 4WX9A 1WNLA 4FT4A 4M78B 2ZBKA 1TWCJ 2EJRA 1UHCA 4UB6C 3S17J 4RG2A 2M5WA 1VQ7T 2FRYA 4OGEA 2L89A 2XGXA 4DEXA 4BJ5C 3JB9F 3VB2A 4M78F 1UG2A 4B48A 4FISA 4HNTA 5D6EA 2ZPGB 3QDFA 1WQ7A 2IRFG 1S7OA 1U5TC 1H8AC 1WPYA 3KUFA 2QYZA 2RPNA 4M75F 5EJCA 4FL6A 4FX4A 2E1OA 3C95A 2QEXI 3ZMSA 3CCJI 2R5YA 5FLXZ 1YW9A 4YFXF 3RKQA 4PL6A 4EM1A 1R71A 4XLFA 2F5EA 4BAYA 2LJ0A 4IHXA 2QDYB 1V76A 3A98A 3CCMA 3FIWA 1G3SA 3ESWB 2HNIA 2X98A 4QKUA 4TV7A 1RAIB 2K4BA 1MMGA 4OIRF 4HSTA 2G9WA 4RGRA 4XMYA 2PFBA 3J7YJ 3MKWB 4HLYA 2JA6J 4FT8A 1MSFC 3UF4A 3ECHA 4GLKA 2JVGA 4XTVA 3G71T 4AIKA 3HUGB 1YHQQ 3KETA 2YRDA 5GANh 1HXDA 5FW9A 1LQ1A 2JA8J 1ARKA 4R1HA 3ZMTA 1T33A 2L3RA 2LLKA 1GV2A 3CC4T 1WWXA 2VE8A 3DTKA 5E20A 5IPAA 3FK7A 2E2JJ 4IIMA 4BU2A 5CKEA 5KK1A 4OMQA 2D1XA 2YSQA 4RGUA 5LJ5g 3QWYA 4JX5A 2D8JA 2V9KA 1XGSA 2A3SA 1U1TA 2ZCFB 3G1MA 1W36D 4Q48A 1L0OC 1W6XA 3MP6A 4C0DC 1F9NA 4A0ZA 4B43A 5E18F 1IB8A 1K73U 5LGTA 4ENNA 3N97A 2O3FA 3K4NA 2HVSA 4FM4B 3AG2H 2R5MA 2B0LA 3EPZA 1BI0A 3ZN1A 2D0NA 1RKWA 2LP0A 3X26B 1UG1A 3Q0UA 2DO7A 2LF7A 2XAQA 1VQNQ 2VKDA 3CPWA 4XTXA 1RIOH 3I56Q 5F1RA 2RQQA 2EV6A 1XCBA 1I6HJ 2RM4A 3PO2J 1Z05A 1IAWA 2DYSH 2O5RA 2MLGA 2XGEA 3L09A 2BXZA 2VL8A 2PU9B 2R57A 3KEQA 1GL5A 1UDLA 2EZLA 1YRNA 1N9RA 1VQKT 1ZLKA 4MIMA 1U5SA 3HRSA 4G7ZF 1TW2A 3ZQHA 1EJ9A 2V26A 5K7FA 2HNHA 5FWCA 3QOEA 4EGYA 2B86A 1LEAA 4C8QD 3K7AJ 4VUBA 3PSFA 2M30A 1Z67A 3TBIA 1FPQA 4BKXA 3JRIA 2K3FA 1ZSGA 2XICA 3DPUA 2ZPHB 4MMLA 3AT1B 2V1DA 1JKQC 3PNTA 1TZLA 4OOIA 3C18A 1O57A 1Z7UA 3WHBA 4EATA 2GBQA 2M35A 1QBJA 4OMPA 2X85A 3F22A 3CCVI 3M0QA 1VYUA 2K3PA 4J19A 2E12A 2ZPEB 4M78A 3VUZA 4B9XA 2J5PA 3HTSB 3P8DA 1WHLA 1UJYA 2RDPA 2FA5A 3DEWA 3WTZA 1ITYA 2A08A 4QW2A 3QWXX 1VQ5T 2E5QA 1SHFA 2DT6A 2C6YA 2Y4YA 4ZGDB 3CCRT 2EFNA 4LE9A 1X2NA 1YS6A 2X1CA 5IAYA 3BR2A 4OMYA 5FO5A 1IZ6A 1W1FA 2PNIA 3RERA 3I59B 4MFEA 3TDZC 3KZYA 4C8QG 1Y39A 1UELB 4J8OA 3QAHA 4F7UF 1K6OA 2OTLT 2LK2A 2XI9A 3CP8A 4ASNA 3HZJA 3OYMA 4IOCF 1WZOA 5B5EC 2J06A 2ADUA 1AHDP 2HCKA 3LWIA 8AT1B 1K4US 4CI0C 2IA0A 3NFCA 1TQPA 4GGGA 3KYDB 2DFIA 2DE0X 1I1JA 3QU6A 4I0AA 1ZG5A 3K1MA 1HJDA 4LJZF 4AUXA 1JTYA 3FXUA 3HKZN 3L2CA 1CKAA 3LSGA 1VTNC 5IH2A 4JRQA 2BKDN 1HSTA 4FCYA 3SZPA 1IUYA 4HVWA 2E1MC 2V9VA 1GUUA 1FMVA 1WHGA 1PNJA 3OYIA 2B8AA 2F69A 3K4JA 2EFIA 2JRTA 2DYBA 1MH4A 3I4NJ 2RV8A 3HYIA 2M51A 4EPCA 3TKYA 3K9TA 3LX7A 4FYXB 3HG9A 4JP0A 3MN2A 4HRIA 2XF5A 2GQQA 2VQCA 2DNUA 1S29A 4CCMA 4KUDK 1JEGA 1KQSA 4XN3A 1SFEA 2CQKA 1SRLA 5D4SA 2F2WA 3L2VA 2GQIA 3LMMA 2PJRA 5HDNA 2LY2A 1YITT 1O7FA 4V19K 2MWOA 4F3QA 4HF2A 4UV9A 1YWOA 2CP7A 2OPTA 3CPWP 1X6OA 3DU5A 3U1DA 1K78B 2ZFUA 4BS9A 5DV5A 4KBMB 5AT1B 4A0YA 9ANTA 2K5IA 5FKMA 5GAN8 4OP0A 3LQQA 5J1YA 2RO0A 1VQMT 4P5NA 4M7DB 2XSDC 4F14A 4KN7X 4E70A 3JSCA 2UV1A 3S2DJ 4F92B 1M1FA 5GP9A 3OMCA 3G4SA 2GXAA 3OSFA 4KISA 4GFBA 1ZRDA 1J5YA 3CCMI 1KONA 2J5OA 3QRFF 1WHMA 1AWWA 1DPRA 3JR9A 1RLQC 4M7DF 2HYJA 2WSCE 2NRAC 2BHZA 3KPHA 2HEQA 4ZDLA 3GCMA 3UA6A 5DD8A 2PEXA 1Q81U 3KEYA 3KP6A 1SRMA 3CMET 3CCST 2QSFX 5E1WA 1AHJB 2DLPA 1XSXA 3META 5GAN5 1U78A 2QXFA 2ZXJA 1AZGB 4A3FJ 3HL8A 3CTAA 5D6YA 4C5IA 2XKOC 3OYYA 4RGXA 4JLGA 2B9SA 2EJ9A 2VGMA 4LG0A 4UXNA 3PVQA 2ZCWA 3V8LA 3CC2Q 4AU7A 4IJAA 5HNHA 2DAOA 3CD6I 1ZARA 2DD5A 4OVAA 2K79A 4CICA 5IHKA 1CGPA 1WA7A 3ZMZA 3HOUJ 2IVWA 4P9FA 3F23A 5LD2C 3L2RA 4E6RA 5ERIA 1R0CB 2E7WA 5KYWB 2K40A 3CCJT 3TVTA 3CMAT 2MH9A 5BPDA 4EGZA 1PC0A 4D9JA 3U9GA 1OYWA 3VFZA 2H27A 4JJCA 4UC4A 3EUHA 1WYXA 3MEAA 3CPWS 2XDBA 3Q9SA 2DU9A 1YJNA 5LGUA 2X6YA 2ZXIA 2HQEA 4DA4A 5GAOq 4A3JJ 2ZAEA 2P0QA 3CCUQ 1SVLA 3IHUA 2IAIA 3M3YJ 3ZQLA 1R1UA 2JWTA 1BW6A 4HYEA 4YIFA 3MFKA 3E6DA 5IYDJ 1JJ6C 1JXSA 2ECBA 2ICWG 5HOOA 2LR8A 3CP2A 1OX9A 2HZYA 3CEYA 2TDXA 2XVCA 1K4SA 3V8JA 4PFPA 4B8XA 4XQ3A 5IT9E 3TO7A 4N0AA 2F6CA 2DFFA 4IF4A 3KFWX 4I09A 3L1PA 1RACB 1DGRM 3WGIA 2ZNZA 4XKBA 2F5DA 1JE8A 3O3KA 2ISZA 4M78E 4OMFB 1UEBA 2PVDB 1NYGA 5JLWA 4Q5WA 1MW7A 1QO0D 2HDCA 4IEJA 2XC7A 4L9VA 2QSGX 3QHSA 1B8IB 4P9UA 2P0TA 3H5RA 1SSHA 1NG6A 3PQKA 3E0JB 2QBYA 5HK3A 3KEOA 4QIWN 3RI4A 3M58A 2A5WA 5E3MA 4NC8A 3GTOJ 2K3BA 2QTXA 2VASA 3OBWA 2H8RA 2Y0SN 4BHCA 2K7AA 3NHNA 3G6ET 1FT9A 1KQSP 1Z91A 5EG0B 1TXQA 1BYMA 2DMQA 4I2OA 2WACA 5E3NA 1I07A 2MPXC 2L4AA 5HS7A 1TNTA 1XDSA 1JKRC 2QEXQ 3CCJQ 4LNPA 3KE2A 1REPC 2LREA 2IEKA 4L9NA 2DYIA 3DB3A 2R7UA 3HTRA 1WFXA 4Y4RA 2VBZA 2CFXA 4V2GA 4ZDOA 5FU6B 3M4YA 1IREB 1IZ1A 3FF5A 1M5Q1 2JN0A 3CZ6A 2NVQJ 2KY9A 5M5YJ 2EQIA 2VT2A 2QGGA 1TWAJ 4M7DA 1Y1WJ 1IXSB 1I1SA 1WGSA 4TVRA 1LE8B 4DGWB 4C8QF 2R92J 5DM6F 2DJIA 2ZJRF 2O31A 5K5QA 4IIOA 5L3GA 5L3CA 1EFNA 1SD6A 3CCYA 3A1PA 3LNQA 1BBYA 1WQ2A 2EB7A 3VS2A 3O6BB 4HNUA 5GANj 5JFRA 3HOZJ 3IUOA 3WTVC 2G3RA 3WG9A 3NQOA 1M1KC 2DEUA 4HT9A 4M9SA 1XMXA 2MMPA 4NC6A 4L5EA 1YJWA 2A5YB 2MGQA 2O7OA 4C9YA 2B7EA 2JPCA 3JCMf 1Z3XA 3C2GA 2QQAA 2IS1A 5GAMf 2HOEA 2Q0OA 4XTZA 1PKTA 1KQSS 1P7IA 3U1KA 2EQJA 2ZPBB 4ZZLA 3I4MJ 2DA7A 3J7ZI 3BTJA 2F2VA 4C92A 1IG7A 1DU6A 3S3NA 1O9SA 1QGPA 3BQYA 3H3VK 2XAJA 5KYWA 2HWVA 4A6EA 5LJ5e 3DBHB 2CT3A 2KJCA 3DKYA 3GTGJ 4PLLA 3VYRB 2HQRA 3E6CC 2RQWA 2EH3A 4IUPA 1UGRB 3S15J 1KYWA 1QW1A 1R1VA 4NC7A 1T0HA 1D3BB 2CZ0B 5IT9R 5HK0A 3HL2A 5J3LA 1ZR2A 5LJ3d 4EMKA 4Z6YA 3IAS2 3I0TA 2Z1DA 3HEFA 5CVVA 3FXQA 3TOBA 1QVGA 1Y8QB 1G3TA 2LX7A 3RMQA 2JPBA 3MHXA 1D8KA 4EJUA 5JHFA 2MW8A 1M3CA 1K73R 4RB3C 1ABOA 2DXBA 5C44J 1M8MA 1MMNA 2QLZA 3UNGC 2A07F 2VQLA 2EJGA 3VJPA 3G4SI 1DP3A 2DL3A 5D7UA 3JCMJ 3GFIA 5FROA 3GTQJ 2BUDA 1OOTA 1L3LA 1GFCA 2W7NA 1BM9A 2YPRA 4JQFA 3GP8A 3CJTB 1V5EA 4LK0F 2I2LA 1QCFA 2KISA 4KIBA 3JCUC 3JAMK 3CCVQ 2FQ3A 2XPUA 2Z16A 5KAIC 2DMPA 1WJQA 2OD5A 4CO8A 1V29B 5A0GA 1B8IA 4IUVA 4N4NB 4DOWA 2DERA 1JHHA 3WTWC 4RAYA 1RQ6A 4QT7A 2LCCA 1SD4A 1W1WE 4KT0E 3E5UA 1JKPC 5CYVA 1HYOA 2R7DA 4G8XA 2D1VA 4BBRJ 1D5YA 2K6DA 2QI2A 3KXTA 1H3HA 2QM3A 3RESA 3FKIJ 1Z1DA 1P4WA 5EG0A 3OS2A 2ZMEA 2FSWA 5DUKA 3RJPA 2XF7A 3MEVA 1Q1VA 2CQQA 1I39A 1JJ8C 1C0MA 3I5UA 4M7AC 4IXAA 1LKXA 2R7XA 1VYVA 1J7KA 1BA5A 1LB2A 4Y7NJ 4C2TA 2AKKA 1V54H 4LMYA 4WCIA 2YS9A 1LJOA 1YJNT 4MZTA 4JZ3A 2AO9A 4D8DA 2DOFA 1TLHB 2WB1A 4AFSC 2PG4A 3PFSA 4AWXB 2DA9A 2YUOA 4XOTA 2ZZDA 1TQMA 4II3A 1RAEB 1K4TA 2L8DA 4CC7A 3QYFA 2E4HA 2FBIA 3LSMA 3LFKA 2QSHX 2CW8A 1QU3A 2GQVA 4HEA2 4J7IA 1VQPA 4BL0B 5EDNA 1LE8A 1WVRA 3LH0A 5LHHA 3TO9A 2JMWA 5F0CA 4E7LA 2CP6A 2XMFA 1G3YA 1EF4A 3LSIA 4BBSJ 3COAC 5CVRA 2DMOA 2KT0A 1H8KA 2CP5A 3VKIA 3JCMc 5FU7B 5DM7R 1K9MU 5B3SH 1ACMB 3M5AA 1QVPA 2L7KA 3BE3A 2X48A 1PKSA 1X27A 3FM5A 5DS9A 2FZKB 4II2A 1YIJA 2JXBA 2GGRA 1OR7A 4C3JJ 1BR1A 1T0FA 5K7HA 3WE2A 1VQLA 1H641 2VLAA 1Y1VJ 4OAYA 3MJXA 1RUNA 4EM2A 1PP8F 2E70A 1FP2A 1ZTRA 2CUDA 2RJEA 5ICGA 5IP6A 1UGSB 2NAZA 3GTLJ 1F5TA 3JTGA 1HD3A 4D1QA 2DT5A 1ZSZB 1UCRA 1UHMA 3EG2A 4JS4A 4PJOB 4BH9A 1H9TA 3UWNA 1VQ7A 2HXIA 4B44A 2DL8A 1KC8R 1I6XA 4M7DE 3HOYJ 2LNHB 1NG7A 1ACIA 1D3BA 1OV3A 4N4GA 3DF8A 1LFPA 4PJOF 1YN8A 1K9AA 1QZYA 2UUZA 3GLXA 1P2FA 3NEUA 2YRVA 4K11A 1QVGP 3BJAA 1Y56A 1PSFA 3OYBA 2DL4A 4RG8A 2GIVA 1IGQA 2YLCA 3OW2A 1P4XA 3CCMQ 4XKVA 4LN2A 4M78D 3JB9D 3PUBA 4HA8A 3PIOF 1N9SA 1YCSB 3LSTA 3WGHA 1BC7C 4R56A 1M90C 4GY5A 2COMA 2Z9OA 1OZ3A 3ABTA 3D5LA 3GBGA 2W00A 2KDZA 4FT2A 2QA4A 2L01A 2KLOA 2XSJC 1V3FA 4BQNA 5HLHA 1IGNA 1TUDA 3C0CA 4ZGEB 4LDXA 1P92A 3RZOJ 2ME0A 2B63J 2EFWA 2KZGA 4C2MJ 3RNJA 3BDDA 1AOJA 5M9OA 3HM5A 2I0NA 1LFBA 3VU3C 4EJWA 2RHYA 2K4JA 2VI6A 1APLC 4A4GA 5I2SA 4M77C 1M3AA 3A0HC 2CGHA 3G1JA 3BCBA 2W85A 1D1CA 4LD5A 4YIRX 1DP7P 3FZVA 1KQ9A 2ZB9A 1YJWI 3JRFA 5CJ9A 3M55A 1NBEB 2HPMA 2HQAA 3SZGA 3L2WA 2DMTA 2E6ZA 2CYZB 4EJVA 2RK1A 4AMCA 2R7VA 3VSKA 4OMNA 1Q81R 3QODA 2LD5A 3QZ5B 4M78G 2RJDA 2D6FA 2BV6A 4OB3B 1OKRA 3RSNA 2RQVA 1T3LA 5CKDA 3I55Q 2P6SA 2VWFA 4DZJA 5KH6A 1KJWA 2ZJQF 1JB0E 2EVRA 2ZO4A 1JJ2P 2DJZA 2F2XA 1YHQT 4GXOA 3WU2C 2F5VA 3X20B 4JJNK 1QHGA 3S14J 4BE1A 2KJBA 1E3OC 4BEHB 4P96A 2K2MA 5A2QK 3HSEA 3SFZA 2EFPA 1Z6RA 1NK3P 1UMQA 1RZ4A 5ECAA 2JTFA 3GF2A 2OU2A 3V7RA 4D8KA 1NJIR 2AHQA 4M6YA 2QG9B 2UWMA 1KD1C 3G3ZA 3N05A 4E7HA 3K0LA 3NWTA 2X4YA 1P6RA 1WCMJ 2AS5F 4JX4A 5IY5H 2DX1A 3HOXJ 1R00A 4KRTA 5HKCA 1Z7LA 1MGQA 4D5CA 2CDTA 2RQRA 2MCNA 5D6WA 4M3FA 1FMKA 3OS1A 3QPHA 2HQXA 5LRRA 2K9MA 2KRNA 3RDIA 3BROA 3GFLA 2R3SA 2VE9A 4BGDA 3S3OA 1MUZA 1UUEA 1X1AA 2E60A 2X4WA 1OU9A 5CVJA 4A0XA 1WKMA 1Y7XA 5GANg 3QUIA 2MD5A 3GF5A 3RZDJ 1VQNT 1SVMA 3HPHA 2XK0A 3I56T 1Y8RB 2MLKA 1FOKA 1FP1D 3E6MA 2JUFA 3NTIA 1AWOA 1UB4A 4OMLA 3AL0C 3GBQA 4A53A 1I5ZA 4Y33A 3PT9A 3J81E 4JYKA 2NUTB 1ZSZA 3RDVA 4YG2F 1JJ2S 1X43A 2FBKA 3JCMP 4PJOA 2F2EA 1VQ4A 2M16A 2ME6A 4KJZA 5BQTA 1JGGA 5LJ3h 1FEXA 2QKMB 1YBYA 2WB1N 1UJ8A 4IRIA 5JVTA 3WGGA 1W70A 3PVLA 5KYNA 4MDXA 1XX5A 3CCRA 1LJ9A 2GF7A 3IQLA 3VUBA 5ILSA 3B6CA 5HVQC 1AKHB 2VXEA 4ZTFA 3TQ7P 2RC4A 4XICA 3A2KA 2A05A 4C3HJ 1MV0B 1PG5B 3OW2P 3W6KB 3K70D 3OWTA 1U9OA 1Z9QA 4FASD 3OL3A 1O75A 3DBRB 2NOGA 2OA4A 3I5SA 4XBFA 2DEQA 2F4MB 2R7OA 2QQ8A 1VQPI 2H94A 3H6ZA 1Z3YA 3R6NA 2VJJA 4A63B 2OTLA 1QPIA 3QU3A 2VV5A 4II1A 4R0KA 1GT0C 5FLVA 1KQ2A 2NUPA 4EJTA 1E2XA 2LVSA 3PIPA 2OTJT 1SPKA 1LVAA 1ZYRF 3OA6A 4CYCA 2O61A 3OYLA 3MZ8A 4PSXA 1J3TA 2D2WA 2K9GA 1GFDA 1PRMC 3CLOA 3GVAA 3GNFB 5E1XA 4CC2A 2XAUA 4LUEA 4UB8C 1EA3A 1IDYA 4HDUA 5GAGJ 1TC3C 1HSJA 2EFOA 3SZTA 3HRTA 1GHCA 4A5MA 5BNGA 3Q3SA 3H0DA 1YIJI 4DBFA 1MSEC 5AONA 5HCKA 2PLYA 2DF6A 4XM3A 3U23A 3FC3A 1WJEA 4RA2A 1VQLI 2D5VA 1MBJA 4Q5SF 5GAOr 5IT9K 3QDRB 4CCKA 2CH4A 4QVDA 3M56A 5DYMA 3FXJA 4C0GA 2Y75A 3OYGA 2MYSA 1MZBA 3D5SC 4HZFA 3M9QA 2IA1A 1USSA 4IQ4A 2RK2A 1XCVA 2E64A 3DQVC 1BIBA 2NXNB 3BLYA 1XD7A 3SXYA 3TW6A 4FSXA 1HKSA 2P5VA 5H20A 1R22A 4RMNA 2RN7A 2WC2A 5JLXA 1BW5A 1ENHA 1R8OB 4BE2A 2KR3A 3I9V2 4OIQF 3FRNA 4ZTJA 2DI3A 2ESNA 2OQRA 4BEHA 5CQGA 1VQ7I 3BPXA 2LNVA 1NG2A 3A03A 2J6FA 1T39A 1YITA 4LG3A 5J1UA 2CUZA 3M54A 3OS0A 3RMSA 1Q82U 2FEZA 2M45A 5E1ZB 3QBYA 2M4GA 3HRMA 1ZAOA 2ELJA 1GCQA 2M7AA 5BS6A 2VODA 2X9HA 3SB2A 3G4SQ 1B9NA 2EGCA 1IO2A 3TP0A 2WV0A 4KIFA 3Q0VA 3F8NA 3RR6A 2FZCB 1J75A 3MQ0A 2KRSA 1BI1A 2Z2SB 1S3JA 3NTKA 2BY2A 3JCMh 2LBFB 2MSYA 2QENA 4NQWB 3W6JB 3X2QH 1RI7A 2CJJA 3BWGA 5C3EJ 2QA4I 3J81R 2RNGA 2A61A 1OZ2A 5M5WJ 4UUSB 2JW4A 4EMKB 1N8RC 2YDLA 1RL2A 1XB4A 2EINH 2OJED 2E65A 2Z0WA 3GFJA 1D8JA 4FE7A 5EYRA 2DK8A 1HKTA 4L5IA 3CMEA 3CCSA 1A31A 5F6FA 3KP4A 4M7DD 3A8HB 4A69C 5F0HA 2CS3A 4ESBA 5GMKl 4CCNA 4AFUC 2QQSA 1VQ6T 2NUTA 2W57A 4J9FA 3S2HJ 4D7NA 3ERMA 2H1LA 4C2UA 1STZA 4M75C 1QPMA 4HX7A 5TGTA 2XHKA 1HF0A 1Y57A 2DXCA 3MCAB 3LAPA 3BDUA 2RNJA 3CESA 3RKXA 3F72A 1I8FA 3J7AO 5CLSA 2G7HA 3CMMA 3JW4A 4M72A 2DMUA 4MQ9F 3QPLA 1NM7A 1VF9A 1VQOA 2E71A 5LFAA 3OYFA 1AKHA 4J5YA 3TCJA 4N4OB 2L0AA 2JZYA 3HHTB 4NHJA 4UNOA 4Y15A 2CFOA 3JAME 2O88A 2HDAA 4BUPA 4KT5C 4LIVA 4XL9A 1SFOJ 2K4YA 3CC2T 2E19A 2A6TA 2BVMA 2CW0F 2G0EA 2BTTA 4AG2C 2ZXWH 4M7DG 3OMGA 3ZN0A 2ED1A 1POGA 5LJ5d 2EA4A 3WG7H 4NB5A 1BK2A 1KZHA 2JTEA 1SEMA 2EBIA 3D0SA 2DK5A 2VXFA 4U87A 1OCCH 2E3HA 4PLIA 3H0HA 2OZUA 3SHWA 5B1BH 4LITA 3REOA 4F16A 1JBMA 1U5TB 3GTPJ 4PJOE 1M8VA 3L42A 3V8KA 4YFNF 2HMAA 3CDLA 2R93J 1AWXA 5GAOl 1P7JA 3RPQA 1UG0A 2F5TX 1YFHA 1ZHFA 3A8GB 3JB9J 4X9DA 1K9MR 1EKEA 3S1MJ 4JRKA 2E5NA 2NOJB 3JV3A 1B6AA 3I9QA 3DBLB 2FMLA 5D5WB 3OYHA 2H3EB 1IV8A 3GFMA 2MBFA 2OAWA 4RTTA 3ZQQA 3BC8A 5ILVA 1R4NB 3IAM2 4M9XA 2ID6A 1VQ4I 1MMSA 1E6HA 1WQWA 4I01A 3RPUA 2JM8A 4XU3A 4ZN1A 3CCQA 1H92A 4XLCA 2NNNA 2VXDA 3MP1A 4DYQA 3GPLA 2PJRB 2P7CB 2WTEA 1HW5A 3GW2A 2DXTA 5IT3A 2RREA 3CCRI 1P9QC 2AIRB 2DFEA 2O0YA 3RUXA 2KYMA 3RCOA 5HDKA 4C5GA 3SD4A 3X25B 1TT0A 3H3ZA 2O2OA 1MMDA 1X58A 2O9SA 5D5UB 5HODA 5DM7F 4JUVA 3KCCA 4ME7A 4XORA 1Q86U 2JJ9A 4CCOA 3W6VA 1TG0A 3O8GA 2Y90A 3QG1A 3IKTA 2DO3A 4B47A 3EFRA 2X6WA 1S7EA 1QHHD 2TCTA 2L4MA 5KCMA 1W5TA 2LBFA 3SJMA 2OTLI 4NQWA 2EIJH 4LB5A 1ZX6A 2JUGA 1SG5A 1B4AA 3C1DA 3K4MA 5DUIA 3VWBA 2EYZA 3PE0A 4UUSA 1RUOA 2PMZN 4J9GA 2QEXT 2QF7A 4ENJA 1U1SA 1YJWQ 3F8MA 2GM4A 1BOAA 3LSJA 1T0JA 4A4KA 3CF2A 3T9NA 1GXQA 4YFKF 2FOWA 2DXUA 1ON2A 3TSZA 2JTMA 1VIEA 3IH2A 1AA7A 1W5SA 3ZMUA 5TJJA 5L3FA 3E5XA 2XB0X 3TU4K 1PYVA 2BW3A 3HOWJ 2CG4A 5F08A 4ON0A 2RB6A 2VN2A 2A28A 4KH0B 4LG0B 3FLGA 4E7SA 2GTJA 1RRJA 3JAMR 4HV5A 4IZZA 4J6XA 4BNCA 1AEYA 5F27A 4DBRA 2P4WA 3WTXC 2Y0SA 1PRLC 1X01A 3ME9A 3GTMJ 1QMCA 4AVPA 4J9CA 5CQYA 1RADB 4ZGJB 4EEFG 3CCEA 2KKOA 4HG2A 3ABLH 2DA4A 1BL0A 2EAYA 3ULQB 3FHNA 2PVOB 2VB6A 2WADA 3IH3A 3FMRA 5J1RA 2Z33A 1TTYA 3CQTA 3I54A 1U3OA 3CXCP 1NE8A 1WXTA 1YITI 2KEAA 3A0BC 5D5XB 4Z8AA 1QVTA 2D45A 3OIQA 2L9SA 1TQIA 2F4OB 2RNAA 4IHTA 3QYBA 2EGAA 2K5FA 2KXCA 2DT7B 1YX3A 4AYBA 2IVMA 3A8LB 4UVAA 5GAN2 1WH7A 1DPUA 1K1ZA 1R1TA 4HW0A 3ASKA 2R5ZB 2LF8A 3ABKH 4KUMA 3TDUC 5KYXB 3WXMB 4XRSA 1WHHA 2K02A 3FBNB 3V42A 4EMSA 3SEZA 2V8IA 2ELKA 1U5TA 3EFOB 5GJWB 5L8RE 4B6MA 3VOEA 3GZ5A 5HS9A 1PP7U 2PZ1A 4HXJA 3VV0A 3GIBA 3H9QA 2CV0A 4X0GA 5K5OA 1YTYA 1KC8U 4HX4A 4X1VA 2R7ZJ 3LA7A 4IHWA 3CMEI 3I58A 5HLIA 3GTJJ 3CCSI 4BQAA 1PCXA 4QQDA 2XDPA 1A04A 1OLTA 2QBYB 5A2QE 3VPRA 1A35A 4M6VA 2QQ9A 3BG9A 2JQ7A 1B1BA 2NWMA 1YCYA 3WODF 1G2BA 2JSPA 5GPAA 1RR7A 2KAFA 2W25A 4B3AA 3E6BA 1UTIA 4Y28E 2QQBA 1W2BA 2V7FA 4A12A 1RAAB 4MHGA 4DNCA 1MJ9A 2FE3A 3CXCS 3GYHX 1ETWA 1KFZA 2A7YA 5JHUA 3OY9A 3TREA 3B73A 2V8KA 1VQ9T 3CCVT 2KDSA 1VQOI 1A5JA 5KYUB 1YW7A 4CH7A 2DMNA 3TGNA 3TEDA 4XAXB 4PJJA 1VQPQ 1FX7A 2E1MB 4B09A 5KE3A 1ETYA 3H8ZA 1MKMA 3R6SA 1GBRA 1IDZA 2OI3A 3PO3J 3N4MA 1BKBA 2RHZA 3OYJA 3HP9A 3ZFJA 4EDUA 1R4MB 3QJ6A 4M9ZA 5EF6A 2WA0A 1BCOA 1ZUUA 2CREA 3H9NA 3EUAA 5JI6A 5IHNA 1TWHJ 5GAN6 2IS2A 5E17F 1KU9A 5GAN7 1DQUA 1IXRC 1ZQ1A 4LD9K 2RHIA 1YIJQ 2L3PA 4E47A 3NPFA 3A02A 4EMHA 2GOXB 4J9HA 4M71A 2NNYA 4AIHA 2LZ6B 1VQLQ 2X6XA 2F1LA 2Q1ZB 5IT9Z 1KQ1A 4HT8A 4O3MA 4AD9A 3PM1A 2XUBA 3PL8A 2DPDA 1IN7A 2VIXA 1OU8A 4MEYF 4PZJA 3FJ5A 3LGLA 4ZNXA 4XNFA 1D0XA 4NL3A 1QCOA 3JSPA 4QQGA 3S16J 1Y07A 2HSPA 5L3EA 1X1CA 2ZXHA 2L7FP 1JT0A 1WJAA 5K5RA 4C92B 2O03A 5B1AH 3IRQA 2V4JC 5DCMA 5F64A 5ICFA 2LT1A 1VQ7Q 2EILH 5JR3A 4GYIA 5IOZA 2DK3A 1XGOA 2Z3YA 4Q4ZF 3K69A 2CGPA 3QP6A 1JKOC 2ESHA 3F70A 5HY6A 2XIDA 1K7AA 4C92F 4NOYA 3BOQA 4JRPA 2EIKH 3CCQI 1R36A 2DBKA 2DTZA 4OB1B 1PD0A 2HPIA 1MBKA 1YNZA 2O9LA 4PJLA 3J81K 1WZ2A 5LJ3f 3NGPA 1NJIU 2BBYA 5LJ5h 3W2VA 1OYIA 3H5NA 2ZPFB 2CW7A 1Z9CA 2CSQA 1OQYA 2DA1A 2EYWA 5A0LA 2HAXA 1WJSA 5DD4A 2QA4Q 4PJOD 2QCOA 3BG6A 2O8XA 4M74A 1H88C 1NK2P 1ABQA 2JMAA 3QWLA 3BZKA 1I4K1 2HTJA 5GAMj 2EWNA 2R5ZA 1SEUA 1G8XA 1UHWA 4MGRA 3CO6C 5A2QR 3MVPA 1W36C 3ELKA 5KYXA 1Q82R 4FU6A 2M34A 3J80E 4E6KG 1Z9ZA 2DN0A 2PQWA 4XK8E 2CT4A 3ASOH 4JOMA 5EZGA 1JXOA 2XG8D 2W82A 1ETQA 3DEEA 4XK4A 2UZKA 2VC1A 2AXLA 3GZNB 1ETXA 3I53A 4LLNA 4IPAA 2FO0A 2RI3A 1G83A 3C7JA 1H9GA 5H6RA 2PVGB 3CCMT 2DYRH 1EH7A 1XPXA 4RLFA 3KFVA 1FYNA 4V2SA 1HW1A 2WAFA 4FYYB 1YQAA 3EG3A 5C0MA 4AIJA 2EZIA 5GPCA 1ETKA 1K0XA 2YT6A 1R23A 4D5FA 3DPLC 4XR6A 3GZ6A 2EQUA 1YI2A 1W2BP 3NMZC 3LSHA 2ZMEB 1J09A 2M9HA 2SRCA 3L2ZA 2LTPA 3A1YA 3QZ9B 2BY1A 4PJOG 4X9CA 3WTSC 2FL7A 2RF0A 1T38A 2LNBA 4RTXA 2LQKA 2P0PA 5FU6C 2W24A 4M4ZA 4C8QC 5KYUA 1PJRA 1ZKGA 4LIUA 4LOCA 4ESRA 2E5KA 1JXMA 2Q8KA 3CCEI 3EAEA 3CD6T 2KDOA 5KVRA 4G6QA 1RI0A 4UVBA 1LOJA 1HA8A 2Y48A 4AYBN 5FFXA 3M0RA 4MDWA 4N9IA 2XU8A 3R6OA 2W48A 1MBEA 2W10A 1ZGAA 4CCJA 3I55T 1XC5A 1MBFA 2IPOB 2ETHA 2FUG2 4XRFA 3N5BB 3HPWA 1U8BA 2Y4XA 1VNDA 2M87A 2ENMA 1IN8A 1I27A 4Y3OA 1WLPB 4XRMA 4CSWA 1N75A 2XV4S 3OYAA 4PDKA 3Q5FA 2LVMA 2X3XD 3TP3A 3CC7A 3S2WA 3JRDA 1LNXA 2XPWA 3FXLA 4LK1F 4ZJZA 1VQ8I 1X3UA 4NL2A 1YJ9T 3L2UA 4OMMA 3C3WA 2Y9YA 1D09B 1NLPC 1R6RA 4LGWA 3ROUA 3M57A 4KMFA 2KT1A 4J6WA 2FRWA 4JZ4A 4Y91A 3AG1H 1W2BS 3I56A 3W2WA 2HFHA 1FYLA 3DU6A 2M02A 1VQ4Q 4XTWA 1YOVB 1YX5A 1ODDA 1VA7A 1HOMA 3KP2A 1WJFA 5KAFC 1ZH5A 1SVOA 3A52A 4F55A 5HS8A 3C94A 3OQ5A 2I8DA 5H2FC 5EC7A 3DTEA 3JREA 1JRIA 1AD5A 2KE9A 4QVZA 2H1KA 2VKHA 3VYUB 4J00A 1T3SA 3CCRQ 1Z6TA 3K2ZA 2L9VA 3BZCA 1BB9A 2J7IA 2DJQA 1FBSA 5ILUA 3L00A 3LYIA 4WXHA 1O3TA 5GAEJ 2VC8A 6AT1B 3CLQA 4XLHA 3J80R 2WY7Q 3EH2A 1MHNA 4JBAA 1YP5A 3CJRB 2JVVA 2HD0A 4XLAA 4ZC3A 4IUUA 2KROA 2OTLQ 3FMQA 3CCLT 2MD0A 4NUBA 2XKOA 1Y0MA 1U6GA 2OAUA 3UKGA 2O8KA 4FETA 3KP5A 4C0FA 4WTOB 2M2EA 5EEHA 1ZLJA 4EQQA 3MKDA 4KULA 4QWQA 3K1NA 4OAZA 3M0TA 2L7MP 3CUQB 2ID3A 3SDZA 4PK4A 1N8RR 3DV8A 3ZP5A 1WI7A 3HSBA 2OTJA 2GIZA 3EGUA 3SWNC 1OFCX 2ZSHB 1X1BA 4L5GA 3F6OA 1YFNA 1Q86R 5FKNA 2BE9B 4L0ZB 2P5LC 1TOVA 2EJFA 2V1QA 5DEQA 3GO5A 1FYKA 3IKVA 2YUQA 4HCZA 1T95A 4KNYA 2LQ8A 1O3RA 4E7ZA 3SFIA 4JPBW 2XHCA 2F48A 2YX4A 3IH4A 4O5VA 1KU2A 2CU7A 2CP3A 2DL5A 2FYKA 2MABA 2FU4A 3JRAA 2KI7A 2LTOA 4BHBA 4XKCA 1W0TA 4LUDA 5FKOA 2XRLA 2EQMA 3OSSC 3M53A 1OCTC 2FVUA 5GAOp 3NTHA 1EZZB 1KHIA 1M1GA 5CK9A 5M3FJ 1F1BB 1DDNA 2M3AA 5LHIA 1OPKA 2HBWA 4NNJA 1JJ2A 1WJBA 3PSIA 3TOAA 5EEAA 1VOMA 3EFSA 4W1UA 3JCMX 1YITQ 1OPCA 1FIPA 1OX8A 3HOSA 1HLVA 1YIOA 1LDKB 5CIUA 4RMOA 1I5LA 4OGCA 4KN4X 1Q1HA 3JRGA 1M1KU 1D1BA 2HKXA 3KP3A 3KZZA 5ICEA 5CVUA 2STWA 2DL7A 2YXYA 2G6FX 1SMTA 4BI3A 1HQCA 1LCKA 1LNWA 3FIFA 4RTUA 3L9FA 5D5VB 1NH3A 2NS7A 4HSRA 3Q0WA 1UHSA 4I7HA 3G2BA 4RAZA 4RB1A 4GCVA 5FD5A 7AT1B 4S05A 1KA8A 4OIOF 1FTZA 4OB2B 1XDUA 3RPUD 5K7ZA 2W0ZA 1M2VB 5FKLA 2ZSIB 1S72T 2HVQA 3IP4B 5FLMJ 3K2AA 1IRXA 2LRDA 2YR2A 3KLOA 1C0WA 4EVIA 4CYDA 3ASNH 2IP2A 4BE0A 1S7AA 1CF7B 1YLFA 2IGKA 4ETSA 3CMEQ 3CCSQ 3J7AF 3O5ZA 5J40A 2PMUA 4AC0A 4G7HF 1NZ9A 4L9TA 1OCRH 1SAUA 4WCGA 2R4GA 4HVVA 1IW7F 1S5LC 1Y6IA 2CO5A 3I3LA 2E2HJ 1SHGA 3THKA 3G4ST 3VS6A 1XQHA 1ZUKA 3T1BA 1LPLA 2EYXA 5IP7J 2IGNA 3H41A 4J01A 1BU1A 1WJ5A 4J6YA 1VQ6A 2DTRA 4F91B 2XPVA 5I11A 2QASA 1BR4A 1WSUA 2NVXJ 2YLBA 1VQOQ 3DLAA 1YI2I 1K61A 1RKTA 4OWRB 2DRKA 1V5GA 1ZG1A 3IWFA 1FTTA 1FBUA 5E3LA 2GWRA 3ZQCA 1RABB 3WTYC 2KXDA 2M1HA 2FZGB 5D6XA 5GMKh 1FWZA 2HR3A 2BEOA 2RQPA 2L0KA 4YEJA 1N6AA 2OX7A 3FB9A 2QQRA 5CKBA 3BTIA 2YHTA 3FX3A 4I0BA 4BQQA 2GXBA 2LYCA 3M0PA 4YRVA 5HLTA 1DU0A 5D8LB 2EPFA 3A8MB 1WIEA 4JJDA 2VQHA 1YS7A 1SFKA 3IRRA 2A0FB 5GAN4 3QSUA 4A4HA 2HS5A 3A4CA 4HV6A 2PI0A 3CC2A 3CUQA 2KHMA 3WHCA 3LLRA 4XU1A 3H0FA 2NUPB 5C6SA 4MZMA 3GOXA 1KG1A 1RETA 1ZN2A 2KFDA 3FEOA 5CQEA 4CYCB 3RBBB 3LA2A 4HNVA 3JCMg 2COYA 3MEXA 1DJ7B 2X1DA 4HLXA 2LC4A 4BUGA 1FXXA 3BZ6A 2ECCA 4C92E 5GAMg 3G71A 2Y2ZA 2LMDA 3PIPF 4AM3A 2OC6A 1W0UA 1H89C 4I98B 3CC7I 2P5KA 2IIMA 4JJBA 2VVKA 1TW3A 2HOSA 4BXFA 3CC4A 1TS9A 3HGYA 4HAMA 1TUCA 4PFZA 3ULRB 2XROA 3UA7A 4M6XA 2QUFA 3F3XA 3CQZJ 4Z88A 1ZK8A 2HQNA 4MMKA 5FKKA 1U3EM 4A3MJ 2FPEA 1QZEA 2LKPA 3QIIA 1U8RA 1S8NA 1I50J 3CCQQ 4MTEA 1ZR4A 4HCKA 4X34A 4IHVA 2HL3A 3J81Z 2V1RA 4CGZA 2EIFA 2FEIA 2RJFA 3A8OB 2R7TA 1OPLA 2GA2A 2HU9A 3BY6A 4Y52J 4X1EA 1WFWA 2CP2A 1K8AC 1JUSA 2BE5F 3TO6A 3ZQIA 4M77B 2K57A 5GANd 3EDPA 2KPMA 1TL8A 5ICCA 1E3PA 3X28B 4PJMA 3SDBA 2N8GA 4AFQC 3ZXSA 1RNLA 3MZHA 2V6EA 4M77F 3QPTA 2EK5A 5J3BA 4PKCC 1GCPA 3GTKJ 4M7AB 4B1RA 1M2VA 1R58A 4RM2A 1UHFA 1FSEA 1VQKA 2CP0A 2E35A 2OJ2A 2BGCA 1CF7A 2BVLA 3FJPA 2OTJI 4N0BA 4M7AF 3E3VA 2DA6A 3DEUA 3KP7A 5K1YA 4XRSG 1WHKA 3UPUA 2CQNA 1A0NB 1JI8A 2AQFA 1FNNA 3TQNA 2GAUA 5FB2A 3M0SA 3CF5F 2VC0A 3VYTB 4IKFA 2DTHA 3HGGA 2E34A 2DPUA 1GV5A 3UATA 1RUWA 2ABLA 4PSWA 2E6NA 3HBLA 2DFUA 2ECZA 1QQIA 2EFQA 1A6QA 3D5RC 4XSZF 4KUIA 1HDPA 2X4HA 3DKWA 1CKBA 2VKNA 1M90U 1FMWA 1VQ5A 4R8HA 3CCEQ 3SFMA 4EMGA 1SSFA 3MAJA 3VRYA 1YJWT 4HCBA 3H36A 3VEPA 1MBHA 2VQGA 1M9SA 4RKUE 2Y69H 2NYXA 1GVJA 2M8EA 1MNEA 4A93J 4D0PA 3MPUB 1TNSA 1JQQA 1ERDA 1WJDA 2YSRA 4ESJA 5AIQA 4Q47A 2DPPB 3F0CA 1IF1A 1X6GA 4D7MA 4MQVA 3BR3A 3AL0B 2ZPIB 2FPFA 1LDJA 2A69F 2GA1A 5LEJA 2XGDA 2QDLA 2F5CA 2H09A 1JU5C 5LJ5f 5J4VA 1R0BG 3W2AA 1VQ8Q 4ITVA 2KL4A 1C1AA 2O01E 2CUEA 2H8WA 4O6JA 2XD0A 3QOPA 2FX0A 1IRFA 2PMZA 1I0CA 1SFUA 3MEUA 3ZQGA 2LJ1A 1X1DA 3QXEB 2RQUA 5CKHA 4XU2A 4ESFA 3KLNA 3F9KA 5LL6S 1YE9A 4KT6A 1Y71A 3WVEB 5KE2A 2H6BA 1JHFA 3E7LA 4M3DA 3G7ZA 3J80K 4IRGA 1XGNA 2DA3A 4OIPF 4BXXJ 5E3OA 2CQXA
chains in the Genus database with same CATH topology
3BY7A 4HBLA 1D3YA 2A6EF 2PJPA 1KD1U 1G6NA 1BI2A 4FIBA 2VYTA 3GNGA 3LAJA 3CBPA 3ZPLA 4CXFA 1VQ9A 4BY6C 4M77A 1NPPA 3BP8A 1EIFA 1BC8C 1TBXA 1VQMA 3GXOA 5J6XA 1J9IA 2YU3A 4UUVA 3QKJA 3R0JA 2LDMA 4M7AA 3JAMZ 4RB2C 1FSHA 3VYGA 4WXCA 1O3SA 2DW4A 1XSDA 1G3WA 3LWHA 1ONVA 1VQPT 3HHHA