2QQ9A

Crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
212
Chain Sequence
DLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
total genus 73
structure length 212
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qq9A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qq9A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qq9A03
2JT1A 3GF2A 3IRQA 4G7HF 3R0AA 4I09A 2ZNYA 2FXAA 1BC7C 1FNNA 1HSJA 5HDGA 2HTJA 3P9KA 2QQAA 1YTYA 3HHHA 4PGGA 5AIPA 1R36A 3ZQ7A 2OA4A 2RDPA 1S29A 3M1EA 3COAC 1R1UA 1MD0A 2QQBA 2QZ8A 1LEBA 1YYVA 2J5OA 5ILUA 2OZUA 3K1MA 1TNTA 5BPDA 1OYIA 2NYXA 3KEQA 5ICFA 1FPQA 4P9FA 4M72A 3GFIA 4MEXF 5AIQA 3ZMTA 1BOAA 5F6FA 3W6JB 3EETA 3GXOA 3GFMA 2P5LC 4ENMA 3TKYA 1P4AA 4M73A 4HOBA 4CZZA 1CGPA 3ZMZA 5L3BA 2EA2A 1TW3A 1J2XA 4MTDA 4P9UA 4EM0B 2XHKA 2IW5A 2A07F 2EV6A 1W7PD 3R61A 5LHIA 2V79A 4ZH4F 1EV7A 2H6CA 2IPQX 1HW5A 2D45A 3OV8A 4A12A 2E7XA 1IUYA 3U9GA 2FMYA 3V7SA 1ZLKA 2VN2A 5KVRA 3I0TA 4EM2A 3HSRA 2Z5UA 3OOPA 4EVIA 1J9IA 5DV5A 1W7PB 1LDJA 3KP6A 4GGGA 4G6QA 4KIGA 1Z91A 2DW4A 2F2EA 1FBSA 2MLKA 3DXJF 2VE9A 3L7WA 4HF0A 4ENJA 5J6XA 3I64A 5BPIA 3SHFA 4BH9A 3QPHA 1LVAA 2Z9OA 1PDNC 2E7WA 3IKVA 5L3GA 4HV5A 4UUVA 4B8XA 2HQRA 1F9NA 1P6RA 2XRNA 1S8NA 2ZFWA 2O0YA 1KU9A 2KIMA 3MAJA 2QBYB 1YW7A 3TOBA 4PZJA 4L9VA 2KJCA 5EEHA 1FC3A 2LNBA 2AXLA 3F8CA 2DLLA 2BYVE 5FLXK 4A0ZA 3FZVA 3MCZA 2GA1A 3IWZA 4KMFA 3I71A 4EGYA 2MD5A 1UHWA 1XGNA 2O3FA 4JK1X 1T98A 3IWFA 3E5XA 1HBXG 4IJAA 3I59B 2LX9A 5LRSA 3AAFA 4B09A 3KE2A 2B0LA 2KJBA 1BN5A 3C3WA 1PP8F 1OPCA 2FBHA 3EDPA 3P7NA 3RKYA 2Y0MA 4HV6A 1CF7A 1HKTA 1BIAA 3KETA 3L00A 3KP4A 4OU0A 2K5LA 3ISPA 4L5JA 3WE3A 4UHTA 1BBYA 1IXCA 3JAMZ 3JSPA 1XDUA 2XV4S 5CVRA 5HOOA 1K6OA 1MGTA 2NS0A 1BI2A 5HDKA 5BOXA 1B9NA 5LHGA 3FHZA 2QUFA 1DP7P 4QWQA 5K5RA 2NRAC 2O03A 3IKTA 5F1RA 3BJ6A 2VOOA 4ZYGA 1RZ4A 2K4BA 3V7CA 2F5EA 2W24A 3FF5A 1UFMA 1FSHA 4AWXB 1ON2A 1XMAA 1SD7A 3E19A 4HBLA 4AIJA 1IRGA 2RVCA 3ERED 3HRTA 3GO5A 3ABTA 1GXPA 3LAPA 2ZO4A 5LGNA 1YW9A 5DYMA 3JSOA 3BY6A 3LFKA 4GYGA 4IRGA 3IHUA 3T8TA 2PI0A 5H20A 3M9AA 1HXDA 1P92A 2LSOA 2PG4A 4KN4X 3K9TA 1Z6RA 1YO5C 5K1YA 3MZYA 3QOPA 2VC0A 5ED4A 3CUQC 2C6YA 2EK5A 4I98B 1R1TA 4O5VA 4RGXA 3KCCA 4KDPA 1R22A 2BEOA 1FP1D 3TO6A 3FXUA 3R4KA 3GZ5A 4P96A 2XKOA 2JTVA 1S3JA 3B73A 3GWZA 2DBBA 1BI0A 4BHCA 1IN8A 4RGSA 3W6KB 2XUBA 4G94A 2Z3YA 4XRFA 1JHHA 2D1HA 2GZWA 1SFXA 3K1NA 1I1SA 3J7AO 1TQIA 3WGGA 2QBYA 4U0VA 1K79A 1TQPA 1FP2A 1Z7UA 1U5TC 3HYIA 4CHUA 2ESNA 4LMYA 1TQMA 1Z1DA 4N9HA 2VODA 2CWEA 2L3DA 3I4PA 1YG2A 4LD5A 4N0BA 3FMSA 4F7ZA 2EV0A 2H09A 3HSFA 3WG9A 1IN7A 2CG4A 1FZPB 1X3UA 4K2EA 4FX4A 4L0ZB 3E6CC 3VB2A 3F21A 3PQJA 4RS8A 2BBYA 3QAHA 2A6HF 1ZRCA 4I2OA 2M30A 2QVOA 4HLYA 1MJAA 2RN7A 4KIBA 1O3QA 1H0MA 1JHFA 2NNYA 5E8GA 2XAHA 2BE5F 2M8EA 2FNAA 2RGVA 1FBUA 2P4WA 4L9JA 4ESBA 2FRHA 2VBZA 3QPTA 3WTZA 4LLLA 1OYWA 5D5XB 5E17F 1YS6A 4HQEA 2PFBA 2TDXA 1A04A 2G7UA 3NRVA 1Z6TA 5L3CA 4G8XA 3RTRA 3GLXA 2COMA 2MA3A 2CYYA 2A3SA 4IRHA 2P5KA 3KP2A 3JAMK 4KICA 1USTA 2CO5A 2A69F 1O7LA 4MQ9F 5DCMB 1FT9A 3BWGA 3F8MA 2K7LA 2ELHA 2WTEA 2H3JA 5L3EA 1TW2A 2HS5A 1GHCA 5JR3A 4ZZLA 2DT5A 1T39A 3G73A 4NQWA 3F8NA 4OMYA 4CO8A 3GFLA 1WWXA 4L9TA 2MC3A 2EFWA 2M45A 2GAUA 1XN7A 2E1NA 3O6BB 2OBPA 2ZMEB 4S05A 3H3UA 3MZHA 3FXQA 3N97A 3ZP5A 3DV8A 1ZYRF 3Q9VA 2V9VA 3WE2A 3GUDA 1Y0UA 3HRUA 4Y15A 2ZNZA 5CVVA 4HZFA 3JW4A 2YR2A 2XAQA 1ZLJA 4R1HA 2W57A 4YIIA 3E5UA 2NAZA 3HSEA 1KQ9A 2PJPA 2IP2A 4G6DA 1T2KA 3SZPA 4WWCA 1T38A 3IRRA 1O57A 1GVJA 3T8RA 2IRFG 2X4HA 2ZXJA 3ELKA 3T5XA 1ZG1A 3MQ0A 2XIGA 4M9ZA 2OD5A 2D2WA 1YS7A 3BP8A 3D0SA 1Z9CA 3M8EA 5TRDA 4R79A 5JFRA 1FYMA 1DPUA 4G7ZF 5LGUA 4EM1A 5D4RA 2JPCA 3D5LA 3BPVA 4GO1A 4IF4A 2DQRA 3KP5A 1I6XA 2DI3A 3E3VA 1QQIA 2IA0A 5DD8A 4UV9A 1U5TB 1DPRA 3L2CA 2DK8A 4M71A 4U0WA 4U88A 4HF2A 2W85A 3HUGA 1G3SA 3WTTC 4KN7X 5LEKA 4KIFA 3I58A 2Z33A 5ICEA 2CW0F 4O3MA 2G9WA 4WK8F 2CSOA 3MHXA 5D6EA 3GVAA 2L01A 2HFHA 4A0XA 3J81Z 4OOIA 4FT8A 1AWCA 3I59A 1QZYA 2IA1A 4QLCU 3F6OA 5CYVA 3BPXA 2DAOA 5BS6A 4EJOA 4HDVA 3HTUA 2YX7A 1YQAA 4MEYF 3LQRA 5CJ9A 2FBKA 1HKQA 1SD5A 3DKWA 4G7OF 1L0OC 4I0AA 2CQKA 3RIRA 4MGRA 1BJAA 4CICA 4RGUA 2HR3A 3RI4A 5FB2A 1QNTA 2DPUA 1BYMA 3LA7A 2STTA 2CGPA 1V3FA 3E5QA 5ILVA 3RYRA 1RUNA 5A2QK 5E18F 3RKWA 3H3ZA 1LQ1A 2IJLA 4IHTA 4XSZF 3JTGA 2RKHA 2MH9A 3MWMA 2P7CB 2HQNA 3FWEA 2RNJA 4L0YB 3QU3A 5H6RA 1HW1A 4L9NA 5DCFA 1KYZA 4WX9A 4HX4A 1OR7A 2V6CA 4Q5SF 3ZPLA 5D5UB 2FBIA 1WI9A 5FFZA 1S7AA 3KP7A 1J7KA 2HZTA 4M6XA 5ERIA 5FO5A 1O3SA 1QVPA 5CVIA 4EQQA 3EQLF 3KZYA 5HLIA 3Q5FA 1ULYA 2YU3A 4ZYDA 5ILSA 1ZAOA 1QO0D 1UB9A 5CVJA 3RPQA 1KU7A 2LKPA 1D8KA 4ENKA 3KLNA 1B9MA 1IXSB 3DQVC 2P7VB 5J8FA 1KA8A 1IN6A 2IT0A 3ULQB 5ICGA 5DEQA 4G9YA 2R7FA 1ZHFA 1G3TA 3TOAA 4EMSA 2H27A 3ECOA 3V4GA 1BIBA 5E8IA 2J5PA 1SD6A 2VBYA 1ZH5A 3F8FA 1FYLA 2GXBA 3K0LA 4OIPF 2K27A 4N9IA 2UZKA 3KZZA 3EYYA 1TNSA 3V8JA 3SQNA 3T1BA 2UXNA 3T0YA 3V7RA 2IVMA 2HYFA 3RYPA 4A0YA 3FMRA 1SAXA 2EFPA 1CF7B 3ZMSA 1LJ9A 2YPRA 2L02A 4L18B 4M6YA 1JGSA 2O6GE 3ECHA 1U5TA 3WTWC 1XSDA 1IZ1A 2R3SA 1V4RA 3BZ6A 4LLNA 2AS5F 4LG0A 4PCQA 1IN4A 2M5WA 2DFIA 3WTUC 4P5OA 4CDGA 5FD6A 1P4WA 4I0BA 4XBFA 3E6BA 1IAWA 2LDUA 4A2UA 3VEPA 1J5YA 4RAZA 5HLHA 2UWMA 1SMYF 5JVTA 1G3YA 1ZRFA 5D4SA 1U8RA 1TBXA 2PBIA 4HX7A 3ABUA 3M8FA 3HRSA 4U7BA 4NB5A 4KUMA 1ZRDA 5CLSA 1KQ0A 3QU6A 1GXQA 2JZYA 5IT3A 1XD7A 2FA5A 2PMUA 2GCXA 3L9FA 5K5OA 4IVNA 4HYEA 1VTNC 2V1DA 4A6DA 1KQ8A 3FMQA 1B6AA 1XGSA 2XAJA 4LJZF 5LRRA 3I54A 2FU4A 5HVQC 3EYIA 3WTXC 4RAYA 1S7OA 2QWWA 4DNCA 3HRMA 4PDKA 4AD9A 4P55A 3BROA 4OINF 5L3FA 1W7PA 4EJTA 1RUOA 3REOA 2FNPA 6PAXA 2Q2EA 4TV7A 2VT2A 3IC7A 5CVUA 1R7JA 1KU3A 1JE8A 4LFUA 1L3LA 1P2FA 2Y48A 5FGMA 3F23A 3R6SA 1K78A 3HOTA 3PFIA 1EH7A 3BDDA 3RJPA 2K4JA 2VE8A 1U78A 4BQAA 2VC1A 3F6VA 1ZN2A 3DP7A 2DU9A 1WQ2A 4Q47A 3C7JA 2K02A 1FWZA 3CUQA 2FF4A 2FEZA 4E70A 3SZTA 1W5SA 3VOEA 3SFZA 1YIOA 3WTSC 1B1BA 4UNOA 1HW2A 2EA4A 1ODDA 1STZA 4ZZDA 4GCVA 5DD4A 1D5VA 2EJRA 3FM5A 1R58A 3R60A 4KFCA 2K5FA 4XLNF 2XAGA 3F72A 1HKSA 5H6QA 3TO9A 4EV0A 3RKXA 4ESJA 3ZN1A 2ZCWA 2R7DA 3F22A 2YSRA 3C1DA 4LK0F 4HQMA 3M7GA 1FX7A 1QW1A 4H0EA 1R00A 3LAJA 1IRFA 2KIUA 4ZYHA 1S6LA 4KA4A 2BGCA 2MLGA 1D3YA 1WSUA 2A68F 1PUEE 4KNYA 2ISZA 1G6NA 1OKRA 3H92A 4CGZA 1IXRC 4I7HA 4LB6B 4EGZA 4BHBA 3F8BA 4IXAA 2EFOA 3K69A 3MFKA 2ETHA 1H9TA 4EJWA 4YFKF 1FLIA 3TDZC 4WXDA 3DPLC 3P9IA 1XB4A 4ESFA 5D8LB 1ZG3A 2EB7A 5HS8A 2VONA 2HYGD 4KYWA 4HLXA 2OU2A 2O61A 2OZ6A 1F4KA 2ISYA 4LK1F 1AOYA 3C18A 4UV8A 4XSXF 3CO7C 2PLYA 4RB0A 1QBJA 4PGHA 4EJUA 3I5UA 4GYIA 1SD4A 1UHMA 3LWFA 2UXXA 1RNLA 1SFEA 3DEUA 1QZZA 3CDHA 2L4MA 2A61A 4BNCA 1MDMB 2QQ9A 2VT3A 5IT9Z 1U6GA 2PN6A 3K2ZA 2KRFA 1F5TA 5LGTA 1D8JA 2QLZA 3Q9SA 4RB1A 5A2QZ 2E1CA 3WTYC 3FM3A 1T6SA 4KMUX 2ACJA 3TQNA 1TLHB 1MJBA 4CXFA 1B4AA 4LLGF 3ZN0A 1ZREA 4HW0A 1U3EM 4EJVA 1EH8A 4L5IA 4HDUA 1HSTA 4MNUA 3GFJA 3G3ZA 5DUKA 1ZGAA 5ICCA 2GXGA 4RGRA 1XMKA 4BAYA 4LB5A 1H9GA 4Z2YA 1PP7U 2PQ8A 3FXRA 4ETSA 1Q1HA 5HDNA 1UCRA 2HKXA 4S04A 2MBFA 2YX4A 1ZARA 3DF8A 1OYYA 1R5GA 4RB2C 5HS9A 2DQLA 2GA2A 3QRFF 1OMIA 1FYKA 2HWVA 4OIOF 1FBQA 4WF2A 1KYWA 3CO6C 4A6EA 2Q8KA 2H94A 2FMLA 2VBXA 3V8KA 4RB3C 3DPTA 3EUHA 1ZG5A 4MQVA 2F5CA 3I53A 3L09A 3E6MA 3F3XA 5JI6A 3KP3A 2OQGA 5KK1A 2KKOA 2PMHA 4FX0A 1USSA 1J0RA 3FX3A 1G3WA 5D6FA 3RDIA 2P6TA 1R23A 4WCGA 2DK5A 1LDKB 4R8HA 4ASNA 4LG0B 1IF1A 1J75A 1ONVA 2HOEA 2BV6A 2Q0OA 5DDGA 1DDNA 1R5HA 2W84A 2VOPA 1XGOA 3TO7A 5DCMA 1MKMA 5LEJA 4O6JA 1MJ9A 5D8KB 1WKMA 3LA2A 4BXUA 1RIOH 4CYDA 1YFHA 5E1WA 4WXHA 2RC4A 5LLQA 2EFQA 3LQQA 1MDMA 2F5DA 2ZKZA 2QM3A 2H6BA 3KFWX 2F5FA 1P4XA 4BHPA 2V1XA 2XASA 1QPMA 5K5QA 4YG2F 1Z05A 2FQ3A 2DTRA 3GW2A 2JSCA 3ROUA 3NEUA 4YIFA 4LGWA 3ZMDA 5HS7A 5D5VB 4AIHA 1G4DA 1REPC 3GEZA 3KEOA 1MZBA 5J8CA 1O7FA 4FHTA 1J59A 2M87A 2QYOA 4YFNF 4AVPA 3ZMVA 2K4YA 4ON0A 4JQFA 3IL2A 2GIVA 1IW7F 4U0YA 4DQ2A 2JPBA 1I5ZA 3O2PE 2O8XA 1W5TA 3MEXA 1I27A 1YLFA 4IPAA 3U2RA 2P5VA 2XKPA 4MHGA 5E1XA 2A6EF 3WGIA 2WWYA 5TJJA 3LA3A 4Y17A 4OMZA 1SFUA 5HLGA 3BJAA 1ON1A 4GXOA 1ZGJA 2GQQA 3GX4X 1B59A 5EEGA 1HQCA 2OQRA 2RQPA 1JXSA 1XDSA 2FOKA 4HAMA 3P9CA 1QGPA 2P8TA 2JRTA 3HTSB 2D1VA 2OAZA 3NQOA 2ZJ2A 2EFNA 3WU0A 5FD5A 3CUQB 5E20A 2WV0A 1K78B 1K7AA 2QENA 1R1VA 3RPUA 3GYHX 5E1ZB 2RV8A 4AIKA 5F64A 2HGCA 4KT5C 2XAFA 3WU1B 4UVAA 5FFXA 4UXNA 2HEOA 3GZ6A 2W25A 4MTEA 4HA8A 1T0FA 3QP6A 4I01A 3ZMUA 2CFXA 4IRIA 3B02A 4HF1A 2A5YB 3PQKA 3U1DA 3QP5A 3V8LA 5DUIA 2KIFA 2WC2A 2FE3A 2PEXA 3BOQA 4ZYEA 3CJNA 1XGMA 1FOKA 5JHUA 1LB2A 3BJOA 1BI1A 5FLXZ 5D5WB 3CTAA 2V1UA 4JBAA 3CUOA 3TGNA 2EWNA 2X0LA 3VFZA 1WRJA 2IA2A 4OIRF 2XROA 3KLOA 4Y13A 5LBQA 2K5IA 1C0WA 5L3DA 3E97A 2EV5A 4A5NA 3E6DA 4XLPF 3CLOA 2VXZA 1XSXA 3J80Z 3J80K 3HOSA 2Z99A 1XSVA 4Q48A 4D0PA 2MH2A 4Q4ZF 1F1ZA 4ENNA 1O3TA 3O3KA 2VBWA 2GWRA 2HKOA 4UVBA 3WGHA 3TDUC 2DO7A 5LHHA 2L54A 2NNNA 2HTSA 1BI3A 4M9SA 2ZMEA 4YFXF 3WODF 2FSWA 1FSEA 2XGXA 2DPDA 1BC8C 3R0JA 3HHGA 4NHJA 4BYYA 1LNWA 2XVCA 4I02A 1U2WA 1NHAA 2G7HA 2M1BA 3WTVC 5IT9K 2ADUA 3VODA 2L4AA 1SMTA 1LEAA 1EH6A 3S2WA 4A5MA 4UVCA 3N4MA 2Y75A 4U7DA 1KU2A 1TTYA 4IHSA 2ESHA 1BM9A 4M9XA 1YW8A 2K86A 3JTHA 1RI7A 3HIFA 4OIQF 1KGSA 1DUXC 3K1PA 5BQTA 1W4MA 1E17A 1I1GA 4M74A 1IN5A 3J81K 1XCBA 1XCVA 4WXCA 4HX8A 2ZBKA 3SXYA 5AONA 1LDDA 2LF8A 1O3RA 3DFGA 2STWA 2HDCA 1FY7A 2P6SA 3ML6A 2LF7A 1E2XA 5BMZA 3LSTA
chains in the Genus database with same CATH superfamily
1U1SA 4PUSA 2DDAA 2JT1A 1BCOA 1OYXA 4OP0A 1RESA 3GF2A 3H9QA 3IRQA 4IX7A 2VUBA 5GAHJ 2J6OA 4J7FA 3FB9A 4G7HF 3CCUT 3CQTA 3R0AA 1IV6A 4I09A 1SRMA 1Y7XA 3GF5A 5GTHC 4KUDK 3SWNB 1A5JA 2ZNYA 2FXAA 1QP3A 1R0CB 1BC7C 3LSIA 1RI0A 1FNNA 5GAMh 3OIPA 1HSJA 2NVYJ 5HDGA 3FKIJ 3MEUA 3B6CA 2YLBA 1OISA 2HTJA 3DLMA 1JJ2P 3P9KA 2QQAA 1YTYA 4C5EA 5KYYB 2LK2A 3HHHA 2B63J 2FEIA 4CCOA 2WV1A 2KRHA 3OR1C 3UR3C 4OF1A 1W1WE 2OCEA 1MGQA 3TVTA 1X4PA 2K9NA 4CH7A 4PGGA 5AIPA 4JX5A 1R36A 3ZQ7A 2OA4A 1NK3P 3EFOA 4ZNXA 2RDPA 1S29A 3M1EA 1ACMB 3COAC 1R1UA 1MD0A 3H5RA 2L89A 2QQBA 2M4KA 5J39A 1VQKA 2O5RA 2KISA 3VS0A 2QZ8A 4J9CA 2E60A 1LEBA 1IO2A 1PRMC 4J6YA 3VS6A 1VQ8A 1YYVA 2J5OA 4D7NA 3VRYA 5ILUA 2WY8Q 2I2LA 4RCBA 3VUZA 1J3TA 2LY1A 3CCQI 2VJIA 2M02A 2OZUA 5M9OA 3K1MA 4CSWA 1TNTA 3CCLI 1ZBJA 2CUJA 5BPDA 2LTOA 1OYIA 2Y69H 3OYLA 4MDXA 2NYXA 3KEQA 4M7AB 5ICFA 3RSNA 2EPDA 1ETKA 1FPQA 4XTUA 2XPWA 3HFNA 3JB9J 4P9FA 2K9QA 1YJWI 3BDUA 2X4JA 1M1GA 4M75E 4M72A 3GFIA 2WAFA 3BTJA 4MEXF 5AIQA 4M77F 3KUFA 4AYBN 3TL4X 2JZ2A 3ZMTA 1BOAA 2X48A 5F6FA 3W6JB 2ZJPF 3G6ET 5J1UA 3EETA 3K4LA 4C3JJ 1JJ6C 3EGXA 3QG1A 2ESWA 3GXOA 4Y3OA 2WADA 3GFMA 4PL6A 2A36A 4QKUA 4C5HA 1TWHJ 2Z16A 4UB6C 1I4K1 3OR2C 5FLXR 2E70A 1S72T 2P5LC 4ENMA 3TKYA 5D6YA 2GOMA 2NVTJ 1E3PA 1P4AA 4DBQA 1F36A 4X6AJ 1VQ6Q 4HPQA 4M73A 4HOBA 4M7AE 2BY2A 3J7AF 4GY5A 3LGFA 4CZZA 1CGPA 3ZMZA 2R7ZJ 2XF7A 2FQ4A 5L3BA 1WJSA 4OMMA 2EA2A 1Z3YA 3DBHB 3E1SA 2XD0A 4QW2A 1TW3A 1AWOA 1J2XA 1RLPC 4MTDA 4OMOA 4P9UA 4EM0B 2KEAA 2XHKA 2IW5A 4NC7A 4P1WA 2A07F 1R4NB 5IPAA 2EV6A 1A35A 1POGA 2OUMA 1W7PD 4CA0A 3DB3A 3R61A 2RQQA 3H0DA 5LHIA 5IXFA 1VQOT 1PKSA 2CUDA 2O31A 3QDRB 2VKNA 2V79A 4X1VA 4ZH4F 1EV7A 2H6CA 5FU6B 3BQYA 2EGAA 4HVWA 1RC9A 4A4HA 2IPQX 3MO8A 1HW5A 2D45A 2VC8A 1BR1A 3PIPA 4RAFA 4ESRA 4B43A 2LMJA 1FEXA 2CZ7B 1AEYA 4E2FB 3OV8A 1YIJQ 3OY9A 2E7XA 4A12A 4BY1J 2DOFA 1VQ5Q 1IUYA 3U9GA 2FMYA 3V7SA 3RERA 2IGKA 1TU0B 2MABA 2HZYA 4PJOA 1Z3XA 1ZLKA 1ETOA 2X98A 1WA7A 1RACB 2VN2A 1WX6A 5KVRA 3DU6A 2RPNA 3I0TA 2EKHA 4EM2A 2DVJA 2W0ZA 1IXDA 3HSRA 2Z5UA 4L5GA 2EILH 4X1EA 3OOPA 4EVIA 1K0SA 2A5WA 1J9IA 3BT9A 4RTXA 3JRFA 5DV5A 1W7PB 2ECZA 1JKOC 1LDJA 3P8HA 2X3XD 3CMAI 4XORA 4L6V5 4XU0A 3KP6A 4GGGA 2K5CA 4G6QA 1JO8A 1X2NA 3HG9A 3FXJA 1Z91A 4KIGA 3QBYA 2DW4A 2WY7Q 2F2EA 3ZQLA 2YS9A 3EG0A 5GANe 5EGOB 2FX0A 3EHQA 2ELKA 1FBSA 4JOMA 2MLKA 3DXJF 2X1DA 3J7YJ 5C3EJ 2VE9A 1X2KA 3DB4A 3L7WA 2K79A 3VU3C 5GMKe 3FK7A 1V5FA 2P0WA 4II1A 1JJ2A 4HF0A 4ENJA 3SYTA 5J6XA 1QVFS 3I64A 2O7OA 5J47A 4AU7A 5BPIA 4M75A 3G1LA 3SHFA 4BH9A 4LDVA 3QPHA 2DBKA 2IEKA 3JRGA 1Y1VJ 1LVAA 4J6WA 2Z9OA 1PDNC 3K6GA 3KPHA 4KULA 3NTKA 8AT1B 2E7WA 1UZCA 5GAOp 3IKVA 2QA4T 4NUBA 5M3MJ 5EG2A 2RHZA 3WXMB 5CCAA 5L3GA 4HV5A 4UUVA 3BR3A 4B8XA 4LD9K 2HQRA 1B8IB 1F9NA 1BW6A 3LGLA 1XMXA 1JU5C 3ASKA 4Z88A 1KD1U 4J83A 4DGWB 3OSVA 4A3IJ 1M1EB 1P6RA 2XRNA 1S8NA 3L2ZA 4JZ4A 4A4KA 4U87A 2CP2A 2M0YA 4C8QC 1HDPA 2QEXA 2ZFWA 1H89C 2XB0X 3HL8A 3ZQFA 1DQUA 3ZQHA 1K4US 2O0YA 1VQ9T 3QO3A 1KU9A 2KIMA 4IO9F 3SFMA 3HXLA 2CV0A 2R93J 3CC7T 3C94A 2E6NA 4M78D 3CC7I 3MAJA 3GTJJ 2QBYB 1QKXA 3IH4A 2O9LA 1YW7A 1OZ3A 2GF7A 3QIIA 3H0HA 2DXCA 4C92F 1YI2A 2JA5J 2IBDA 3TOBA 1YITI 4PZJA 1UGSB 2RMOA 4L9VA 1JBMA 2DERA 2KJCA 3ZQCA 1PHTA 4B4CA 1FC3A 2LNBA 5EEHA 2QTXA 3BR6A 2NOGA 1DGRM 4E7SA 2AXLA 3I5RA 2WSFE 4XL9A 3F8CA 2CMPA 2DLLA 2GM4A 3JRZA 2BYVE 5FLXK 3VS2A 4A0ZA 2M0CA 3FZVA 1YWOA 3ZFJA 1WGSA 5EDNA 3MCZA 2BY1A 4BJ5C 1W2BA 2GA1A 2XAUA 3IWZA 4KMFA 3BR5A 3K7AJ 3I71A 1XS9A 1RKWA 1WIEA 4EGYA 3ZQIA 3OBYA 4XKBA 3CC4T 1K73R 3A02A 4M7DB 4FE4A 2MD5A 2J6KA 2L3PA 1UHWA 1XGNA 1MSFC 1VQ6A 2O3FA 4JK1X 2RK1A 1T98A 4C0GA 3MN2A 4QVZA 3IWFA 3E5XA 4A69C 1AZEA 3S3NA 1HBXG 2LMDA 1P7IA 1GUUA 4IJAA 4AFSC 2EW3A 3W2WA 1OV3A 9ATCB 4AYBA 1RAFB 3I59B 1K76A 3M1CA 4ITVA 2AT1B 4BB7A 2HQEA 2HSEB 2LX9A 5LRSA 1JKPC 3M54A 1K73U 3M4OJ 1K6YA 4BEHA 4QQ6A 4PJ0C 2HOTA 3AAFA 2CREA 1KFZA 4M3FA 4B09A 2CH4W 1TT5B 3A52A 2EQKA 3X2QH 3CC4I 3WG7H 3KE2A 2PTKA 1CSKA 5IP9J 3LNQA 2B0LA 2XKOC 2KJBA 5KYUA 2DETA 1BN5A 3OYGA 3C3WA 1PP8F 2YDLA 3PVQA 1NTCA 1MH4A 3GCMA 1OPCA 2FBHA 3EDPA 3P7NA 2F6CA 4RTYA 3RKYA 2Y0MA 2EPFA 4HV6A 2EIMH 1KZHA 1BIAA 1CF7A 1HKTA 2COZA 5CAIA 5L23A 3KETA 3L00A 2BZ8A 3KP4A 4H4KC 4OU0A 2K5LA 3GTGJ 3ISPA 2DA6A 4L5JA 2COWA 4BEHB 3WE3A 1W2BP 1VQ8Q 1IG7A 2FVUA 4M75G 4UHTA 1Z21A 4Z6YA 3GPLA 1ERDA 2H1KA 2FUG2 2A3LA 2V1RA 2ECBA 4R55A 1BBYA 1IXCA 3ONQA 4PFPA 2CP0A 2DXTA 3S1QJ 4B9WA 4DZJA 3JAMZ 3JSPA 3CCJQ 1VYTA 1XDUA 3UT1A 2GXAA 2XV4S 2CV1A 2M35A 3PE0A 3L2QA 3Q1JA 1KC8R 2QSGX 1MIJA 5CVRA 3MKZA 1WHKA 5HOOA 1K6OA 2D9TA 5LJ5e 3CDLA 1MGTA 3A01B 2NS0A 2HPIA 2XIDA 4FIBA 1BI2A 5FLXE 1X69A 4C8QA 2BVLA 5HDKA 5BOXA 1RAHB 2P84A 4QQDA 2MPXC 4J9GA 4XIDA 1W6XA 2B86A 2QK0A 3K10A 1B9NA 2L9NA 2EQMA 4MZPA 1YIJT 5LHGA 1UMQA 3FHZA 3TSZA 2QUFA 1ZQ1A 4XNFA 5C0MA 2L7KA 1DP7P 3I4MJ 2O88A 4QWQA 5K5RA 2O03A 3IKTA 1MBJA 2NRAC 4XICA 5F1RA 3BJ6A 2VOOA 4ZYGA 4LE9A 2RI2A 1RZ4A 5M3FJ 2K4BA 3A0HC 2KDZA 1LE8A 5GPCA 3O5ZA 3HOZJ 5GAOl 3OYBA 5K7ZA 4OMNA 3V7CA 3FDRA 4AMCA 4D8KA 1HF0A 5CO7A 1FYNA 2F5EA 1I81A 2W24A 3GTPJ 3FF5A 2BOLA 2WAQN 1WJRA 1UFMA 3AG3H 3TU4K 1FSHA 2BHYA 2PJRB 4AWXB 1UEBA 2BXZA 5GAMe 1R77A 2DJIA 1WQ7A 2MD0A 2FO0A 4AT1B 4A63B 4BI3A 5M5XJ 1NPPA 3P8BB 4A4EA 1ON2A 3S1NJ 1U3OA 2HCKA 4PKCC 1XMAA 1WHHA 2AKLA 1SD7A 1AZGB 3E19A 4XTXA 1S72A 4HBLA 2COBA 4AIJA 2Y90A 5CKHA 1NBEB 1IRGA 2RVCA 4KH0B 4PJJA 4LDUA 4BY6B 3ERED 3HRTA 3ZR8X 3GO5A 1B8IA 2IIMA 3ABTA 4DOWA 1K9MC 4AM3A 2DA9A 3PIOF 1IJWC 5GMKh 1GXPA 3LAPA 1QCOA 2F48A 1T56A 3K4JA 4C8QB 2CQXA 2W82A 3OW2A 2ZO4A 2CW8A 5J26A 5GPAA 5LGNA 1YW9A 1M30A 3G71Q 1IHWA 2YRDA 3CMYA 2F5KA 5DYMA 4PJOF 4KISA 3FK6A 4B44A 3JSOA 1OQYA 3BY6A 3LFKA 3CPWA 2JMCA 1MMGA 3JR9A 3OMGA 1HLVA 4GYGA 4IRGA 3IHUA 3T8TA 2R5ZA 5H20A 3M9AA 2PI0A 1F1BB 1KQ1A 1HXDA 2XICA 1P92A 1FMWA 2LSOA 2PG4A 2R7TA 3I35A 2KY9A 4KN4X 3A1YA 3HEFA 4D5CA 3IQLA 1MBEA 3K9TA 1EKEA 2VGNA 1WHLA 2UUZA 1K83J 3FXLA 3K4BA 1SF9A 5GAGJ 1Z6RA 1AWJA 1K8AC 3IAS2 4CCMA 1YO5C 1K1ZA 2KSSA 4PLIA 1M1KC 5K1YA 3K70C 2SRCA 1QVGP 2FRYA 3S32A 2LTPA 3MZYA 3QOPA 1T8IA 1EJ9A 2VC0A 1PRLC 2DTOA 3L1AA 2Y9ZA 5GJVB 4M7DE 2NS8A 2QAZA 3CZ6A 1GCPA 5ED4A 2KGTA 5IH2A 2KE9A 2WA0A 2X6YA 3LSKA 3CUQC 3ER0A 1Z7LA 5FRNA 3CMAA 2C6YA 2ZGWA 4ELZC 2EK5A 4I98B 4EPCA 1R1TA 4O5VA 3JRHA 1KQ2A 2Z0WA 2M9UA 1MW7A 2VL8A 1UB4A 2LQKA 2DMUA 5DLQE 2B7EA 2FL7A 1A6IA 1JTXA 2WSEE 3THKA 4PJMA 5LJ3f 2LCSA 4RGXA 5CKTA 5HODA 2EZIA 4AG1C 2QQ8A 3PFSA 3N5BB 3ASOH 3KCCA 2XSDC 4DYRA 2E36A 2DYBA 2QTVA 5GAN7 4PJOE 1OU8A 3OS2A 4PSXA 1R22A 4KDPA 1R0BG 4J9FA 1XG1A 2BEOA 1FP1D 4XLEA 3TO6A 2MF2A 2CP6A 3FXUA 2OV7A 3R4KA 3GZ5A 4P96A 3OYHA 1K73C 1KIKA 2XKOA 2JTVA 1S3JA 3B73A 1ZR2A 4GDFA 3GWZA 2DBBA 2XF5A 4C2UA 2JM9A 1BI0A 1IV8A 4BHCA 2E2JJ 4ZDLA 1HYOA 2DD5A 1WHMA 3GBQA 1VQPI 2E3HA 1IN8A 4GLKA 2DILA 2ZMEC 4RGSA 2V8JA 4RG2A 3W6KB 2MWOA 2YUQA 3HGYA 2XUBA 4G94A 2Z3YA 3JRBA 4XRFA 3FISA 1JHHA 1WDXA 2DRMA 1WHUA 5FKOA 1ZK8A 1Z9QA 2NUPA 2RO0A 3GNFB 4Y28E 1WXUA 3GMEA 1XTDA 1PD0A 1D09B 2DEQA 2JSPA 2W00A 2QG9B 2D1HA 3VS7A 2YHTA 2GZWA 2ME6A 2QEXI 2DTZA 2EH3A 1SFXA 1PNJA 2CFOA 3K1NA 1JT6A 4LN2A 1I1SA 2DODA 3J7AO 1TQIA 3KEYA 3QPLA 3LH0A 1SANA 7AT1B 2K57A 4FYYB 4N0AA 4XTVA 3CC7A 3WGGA 4ZTJA 1YHQA 4U0VA 2QBYA 5FRMA 4AC0A 1K79A 4L5EA 1TQPA 3O8GA 5LJ5f 3H3VK 1FP2A 1Z7UA 4NC6A 1NK2P 1U5TC 1N5ZA 4MZMA 3G71I 1LVKA 3KX2A 5JHFA 3HYIA 3HC7A 4MIMA 3OYAA 1Y39A 3VWBA 4CHUA 2ESNA 2FD5A 2L9VA 1TQMA 2E1MB 1Z1DA 4LMYA 1VIEA 1ARKA 5IP7J 2JA7J 2VWFA 4IUQA 2NUPB 4BI8B 1O75A 4JJBA 2LFBA 4N9HA 2VODA 1ZSZC 2DL4A 2CWEA 2L3DA 3I4PA 2OCCH 5HNFA 4B6MA 1YG2A 3JCMd 4LD5A 2AXTC 3FMSA 4N0BA 2EV0A 2H09A 4F7ZA 3J7ZI 3JRDA 1W70A 2OJ2A 5FWCA 4BBRJ 1XNIA 3HSFA 5KNLA 3I55Q 3WG9A 4M7AA 1Y8RB 1IN7A 2CG4A 3CCVQ 1FZPB 1OCCH 1PWTA 1GT0C 1X3UA 3DKYA 2HKNA 1M2OA 2YUPA 1E7OA 4AFZC 4K2EA 4FX4A 4B47A 2LQ8A 1WI7A 4ABZA 5LD2C 4HVUA 4PJOD 4M3GA 2LBFA 2A28A 4L0ZB 5LJ5j 1QKWA 3CEYA 3E6CC 3Q3SA 2XDVA 3VB2A 1FMKA 5IHNA 2CT3A 3M0RA 2IS1A 3F21A 5LL6S 3PQJA 3MD2A 4C0ZA 2MZ4A 4RS8A 2C0TA 4RCCA 1KONA 2R7RA 3GTMJ 2BBYA 2CSQA 1QZEA 1WH7A 1SAUA 3QAHA 3CCSA 5FKKA 1GRIA 2A6HF 1ZRCA 4KH1B 4I2OA 2VI6A 2M30A 2MG4A 2AZSA 3SD4A 4XTWA 3OYDA 2P4TA 1ZELA 5CQYA 2QVOA 3OYNA 4HLYA 4Z89A 1MJAA 1N25A 3CCMQ 4M7AG 4PNOA 2RN7A 3KYDB 4KIBA 1O3QA 5KYWA 5CKDA 4XRSG 1H0MA 2EVRA 1JHFA 4YEJA 1VQOQ 2C0IA 2M9HA 2NNYA 2JMWA 3MZ8A 2ED0A 5IOYA 1B72A 3PNVA 2E1OA 5E8GA 3VYUB 2IS2A 2MUNA 1M4ZA 3DCFA 1M5Q1 3O8VA 2XAHA 4LDXA 3VDXA 4EMHA 2BE5F 1WHJA 4XTYA 1MBHA 5GAN2 2JK3A 4BE1A 2K3YA 3CC2T 3SHWA 1VQKT 2M8EA 2RJDA 2FNAA 4XLCA 2RGVA 2L9SA 1FBUA 3FIFA 2P4WA 4E7KA 1XPXA 4RA2A 1YBYA 3JCMb 1OCPA 1VQPA 2JQ7A 1JXMA 4L9JA 1QHGA 2HNHA 2FRHA 4ESBA 2W7NA 5IT9R 2VBZA 3QPTA 5LJ3d 2RF0A 3E7LA 2ZPBB 2A6TA 5J40A 3WTZA 1Z67A 4RG8A 1A6QA 4PSWA 1RKTA 4LLLA 1OYWA 2K40A 2F2WA 3RZDJ 1NG7A 3L1PA 4FCYA 1SPKA 2DMNA 5D5XB 4XRSA 5E17F 1YS6A 2LLKA 4HQEA 2PFBA 2TDXA 1A04A 4PK4A 2G7UA 4XQ3A 4BS9A 5A0DA 3NRVA 1GV2A 1Z6TA 3OOUA 4ATOA 5L3CA 1LKXA 4M7AD 4G8XA 5B5EC 1MBGA 2V6EA 3RTRA 4LDYA 1K8AR 2XF6A 1TS9A 3G6EA 4HNUA 3GLXA 1VQ6I 3I9QA 1X27A 1YHQQ 2GNCA 2LD5A 3SDBA 1MUZA 3QPSA 5KE3A 4FM4B 3A8LB 4W97A 4BI4A 1QVGS 4FW1A 3G4ST 2COMA 3NARA 5D7UA 3JCMe 4HKEA 3ZQGA 2E5NA 2MA3A 1FOYA 2P4RA 4BD3A 2CYYA 2A3SA 3X24B 2KVQG 6AT1B 4IRHA 4FISA 4M78A 1D0XA 2X6OA 1OCRH 2P5KA 4E6KG 3KP2A 2LR8A 5HLTA 5E3MA 3PNYA 3JAMK 2LKXA 1C0MA 4KICA 3E9GA 1USTA 1X3ZB 2CO5A 5LJ3j 2Y4XA 2A69F 1JJ8C 3REBB 4BACA 2CH4A 3FXKA 1O7LA 3RKQA 4OMFB 4MQ9F 5DCMB 3BTIA 3OYYA 3PVLA 4J6XA 4KGZB 1RL2A 4V2FA 3TW7A 3CLQA 5E3NA 3SDZA 4I99C 4IHWA 5GJWB 1VQOA 4RTZA 1FT9A 3BWGA 3F8MA 2K7LA 2ELHA 1M90R 3LSGA 3CCMA 2ME0A 2JOYA 2XI9A 2WTEA 3OS1A 3P5JA 1S72I 2H3JA 4MDWA 1ENHA 2R7QA 5FU6C 2DA2A 5L3EA 2P0QA 3H6ZA 4M77B 1TW2A 3QJYA 2E34A 2IAIA 1OFCX 1OULA 2QA4I 5E3OA 2HS5A 2OTLQ 2DO3A 1N9SA 1V5EA 2CUFA 5JR3A 3EPZA 2JJ7A 1GHCA 1BKBA 2BE9B 2X9HA 4HSRA 5GAOq 4ZZLA 4OB0B 2DT5A 1T39A 1BCMA 3G73A 3VV0A 3DEWA 4EMGA 4NQWA 3F8NA 4XR6A 4OMYA 4CO8A 2RJCA 3M57A 5KCMA 3I56A 1UGPB 3GFLA 3BCBA 2VV5A 1WWXA 4L9TA 2NYSA 3JCMJ 4OAZA 2MC3A 2M45A 2GAUA 1XN7A 2E1NA 2KL4A 3O6BB 2EFWA 1HD3A 5KYWB 3CCJT 2QKMB 2OBPA 1WPKA 1RQ6A 1QMCA 2ZMEB 2HL5C 3D5SC 3DKMA 5TGTA 4D1QA 1LPQA 4HCZA 4DEXA 4S05A 5IYDJ 2FZCB 1UJ0A 2DXUA 1I3AA 3H3UA 5FKLA 3FXQA 3MZHA 2PVDB 4JJDA 2LRDA 3N97A 3ZP5A 3HTRA 1YHQI 3DV8A 3JREA 2DL7A 3PUBA 1ZYRF 2HNIA 3K4MA 2QGFB 1QVFP 2HYJA 3Q9VA 4QSHA 4ORZA 2V9VA 3C2BA 4XLFA 4LUEA 3R6NA 3NFCA 2M34A 3WE2A 3GUDA 1Y0UA 5A0GA 2LRQA 4DOZA 3HRUA 1HSQA 4Y15A 1T08B 1NJIU 2ZNZA 4NDLA 5LFAA 2G3RA 4AG2C 2VKDA 2KZVA 3LYIA 5CVVA 4HZFA 2R57A 3JW4A 3UATA 4RLQA 1K8AU 1QCFA 1AWWA 2YR2A 2V9KA 3WHBA 1SFOJ 1HA8A 2KI7A 2XAQA 4BY7J 1Y56A 1ZLJA 4R1HA 3CCRT 2W57A 2LP0A 5F0CA 4YIIA 3OYJA 2D6FA 3E5UA 2NAZA 4M3EA 4EMKB 3HSEA 2DFUA 1KQ9A 2PJPA 2LVMA 3OS5A 2X1CA 2IP2A 3BG5A 4G6DA 1T2KA 1VQMA 3SZPA 1AU7A 4WWCA 1T38A 3G7ZA 3CMET 3UPUA 2VQCA 3LSMA 2DX1A 1YN8A 3IRRA 1CKAA 1T0HA 3QWYA 1VQNI 4M78E 1O57A 1GVJA 3VYHB 4JX6A 3LMMA 3T8RA 2DJQA 2IRFG 2X4HA 1PD1A 4D8DA 3HM5A 4OWRB 4RTVA 1VQ9A 4CUGA 3OMYA 1W0UA 4KUIA 1X3WB 2ZXJA 3BG6A 3ELKA 3T5XA 1VQLT 2CUZA 1ZG1A 3MQ0A 1YRNB 2XIGA 4C8QE 4M9ZA 1VF9A 2OD5A 1N75A 2D2WA 4NBQA 4J7IA 2J06A 3DBRB 1YS7A 4HVVA 5CIUA 3BP8A 1DGWY 1BK2A 2Y0SA 3D0SA 1SEUA 1M2VB 3QHSA 1Z9CA 3M8EA 5TRDA 4A3DJ 2MCNA 1YJNQ 1Q81C 1CKBA 1Q86U 4R79A 1Y8QB 5JFRA 3OMCA 1FYMA 1DPUA 4G7ZF 2QQRA 5LGUA 1M90C 1VQ4Q 2CSIA 4EM1A 5D4RA 2JPCA 3D5LA 1K4TA 1RPWA 3BPVA 4GO1A 4IF4A 4QPOA 2DQRA 3KP5A 2IVWA 1I6XA 3CCUQ 3RMQA 2JVVA 1YJWT 1PC0A 2DI3A 2DD4A 3E3VA 1QQIA 5AYFA 1YRNA 2LH9A 2G6FX 2IA0A 2RAEA 2FPDA 4WTOB 5F27A 5DD8A 1W2BS 2ICWG 4UV9A 1U5TB 3I56I 2JN0A 3HFOA 1DPRA 5DY9A 2LBFB 2XPVA 1QCNA 3L2CA 2DK8A 4M71A 4U0WA 4U88A 4HF2A 2NVQJ 4OMLA 3CCQT 4M77G 2DBMA 2ROTA 1VQ9Q 3FEOA 3N05A 2W85A 3HUGA 1G3SA 1MNEA 3OB9A 2MIOA 4RM3A 3JB9G 2E64A 4C92B 2MGQA 2ZPHB 3ME9A 2YSQA 3CMEI 3WTTC 3GP8A 2L0AA 1M3AA 2V9PA 2G0EA 1Y96A 1Z9ZA 2CU7A 2L7ZA 4KN7X 2K3XA 2OI3A 3JAME 3H41A 3G71T 3JRAA 5LEKA 4KIFA 2H8RA 3I58A 3ZGKA 2Z33A 2CUBA 4DZPA 2EQJA 3CXCP 5ICEA 3CCRI 4FW2A 5IT9E 3JAMR 1Q86C 3AT1B 3S2HJ 1NE8A 4KGXB 2CW0F 4A3GJ 5FROA 4O3MA 3QSUA 2JA2A 2G9WA 2I10A 4XOTA 3QOEA 2CH0A 1PSEA 4WK8F 2ED1A 2CSOA 3MHXA 2EBIA 5D6EA 1APLC 1TWGJ 2L01A 3GVAA 4JS4A 3VYGA 2GTOA 2HFHA 3VKIA 5IP6A 4A0XA 1I0CA 1VYUA 1IRXA 3WVEB 3J81Z 1KSWA 1LJOA 1AKHA 2HBPA 4OOIA 3CBMA 2UV1A 4FT8A 3VSLA 2FPEA 4M7DG 3K4KA 1AWCA 3I59A 3QZ5B 3RQ4A 2YU9J 1JXOA 3A8MB 4ZTFA 1G83A 3X20B 1VQMI 3C2HA 2VASA 4OMQA 2DTIA 1QZYA 2DIGA 4J9DA 2IA1A 4AFQC 3H9NA 2AHJB 3JCMV 4QLCU 3UDCA 4YIRX 4M7DA 3BW1A 2NLUA 3ABKH 3F6OA 2Z1DA 1WXTA 2HQ5A 5GTIC 5CYVA 1AOJA 1SVOA 3BPXA 1UJ8A 1V54H 2DAOA 3ERMA 4NC8A 5BS6A 4EJOA 4FSSA 4HDVA 2MYSA 1ZR4A 1ZTRA 3ULRB 2ZXWH 3I56Q 3HTUA 4JYKA 2OF7A 3LL7A 3QJ6A 4MZTA 2YX7A 1YQAA 4MEYF 4BL0B 3LQRA 3AHUA 2JUCA 1VNDA 5FWBA 1D0YA 5CJ9A 1HKQA 2FBKA 3D1NI 5IHKA 3G1JA 2BW3B 1V5GA 1FTZA 1TUDA 4M77E 3RMSA 1ZA2B 4PJNA 2H3EB 4DBHA 8ATCB 2HAXA 4HSTA 1SD5A 2IGMA 3BZKA 2MI6A 3LWIA 3DKWA 1R71A 5BNGA 1YJNA 1VQKQ 3BR2A 1H641 2BW3A 1LPLA 2CDTA 3SFIA 2C06A 3EGXB 4G7OF 1L0OC 4I0AA 4BQOA 1SHGA 1PCXA 2X4XA 4AVZA 3DPUA 3L2VA 2CQKA 3RIRA 3S3MA 5HCKA 3EUAA 3ZCOA 3NHNA 4MGRA 1UG2A 2R7WA 1LE8B 2L2PA 1NH3A 1TWFJ 1BJAA 4CICA 2DPPB 4FT4A 5FW9A 3AG2H 1KHCA 1YJ9Q 4RGUA 1SEMA 5TISC 4JRPA 2DMTA 1V1CA 2HR3A 3RI4A 5FB2A 2R58A 1QNTA 1B7TA 2IG0A 1KQSP 3CCLA 3K4NA 4ME7A 5D6WA 2K9MA 3OSGA 2CV2A 2Y0SN 2LVSA 2DPUA 2JNGA 4NL2A 1BYMA 2GFUA 2VIXA 3LA7A 1GLNA 1VI0A 2STTA 1Q7YR 2NUTB 1IGQA 2QF7A 2CGPA 4FYXB 3BTLA 1V3FA 3E5QA 1ETYA 1VA7A 2FOWA 5ILVA 1U9NA 3RYRA 1RUNA 5A2QK 2E10A 2M16A 3QYEA 2XDPA 5E18F 3EG9B 4XONA 3RKWA 3H3ZA 4DJAA 3KXTA 1M1KR 1LQ1A 2W48A 2HOAA 2IJLA 5J1RA 3SJMA 2E1HA 2O9VA 5KAIC 5GAOm 2DK3A 4Z02A 4IHTA 1SVLA 4XOPA 3MKYB 1V29B 4F93B 4XSZF 3J81R 1Y57A 1Y96B 3AKZA 3TREA 4CC2A 5HK3A 1TT0A 3JTGA 1KD1R 1D5YA 2RKHA 2LJ0A 2MH9A 1T3LA 2CZ1B 4N0AC 1MNMC 2WB1N 4M78C 3MWMA 1ABQA 2HQNA 2P7CB 3FWEA 2OPTA 1JGGA 1ETXA 2IGOA 3HUGB 2RNJA 4L0YB 3QU3A 5H6RA 1HW1A 2M3AA 2EQRA 4L9NA 3JV3A 3M0UA 3W2VA 3ZQQA 2RD1A 2KIQA 5DCFA 1Z0XA 1AHJB 2BZXA 2PNIA 2JS0A 1KYZA 2F5VA 2GBYA 4HX4A 4ZJZA 4WX9A 1OR7A 2V6CA 2M4GA 3L2WA 4Q5SF 3CMAT 1W1FA 4QIWN 3ZPLA 1XOVA 3ABLH 5D5UB 1OLTA 4Y7NJ 2FBIA 3IAM2 4M3BA 2O2OA 1VQ4T 3S6WA 3M3YJ 1SSHA 1WI9A 5FFZA 4ANJA 4MFEA 2CQ7A 2VKHA 1YJ9I 1S7AA 3KP7A 2OTLI 1J7KA 1TC3C 2A08A 4F17A 2E2IJ 4JLGA 2HZTA 4B9XA 3CBPA 1J09A 4M6XA 4M77A 5ERIA 5FO5A 2M2EA 3CCMT 3LFUA 3RNJA 2AK5A 2DDBA 1O3SA 2EZKA 1M1FA 1NZ9A 1QVPA 5CVIA 4EQQA 4BE0A 3EQLF 1OX8A 3KZYA 5HLIA 1OR7C 5JLXA 4B3AA 3Q5FA 1ULYA 4HRIA 5GANd 3W3CA 1XJWB 2VPRA 1VQ7A 4CCNA 3MPUB 2YU3A 4RBOA 1YI2T 4C9YA 1PVEA 3HB9A 2R7XA 2XB5A 4ZYDA 3PSIA 3L2RA 3HOXJ 1U5SA 2MAMA 5ILSA 5IY5H 1ZAOA 1QO0D 1UB9A 2LZ6B 3HKSA 5CVJA 1MMAA 2L2OA 3RPQA 1KU7A 1MNDA 2MW8A 3PSFA 2LKPA 1D8KA 5CPRB 4ENKA 2MOXA 3LLRA 3FKJA 3FXOA 3KLNA 1B9MA 1IXSB 5KYXA 1MBKA 3A8OB 3FHNA 2QI2A 5B3SH 3DQVC 2P7VB 5J8FA 4OB2B 1BOBA 1O4XA 1KA8A 1PM3A 1IN6A 1JI8A 2IT0A 3ULQB 3GTLJ 1SRLA 2LP5A 2CQQA 1S1NA 5ICGA 1SG5A 1H3HA 2L7MP 5DEQA 4G9YA 4JJNK 2R7FA 1ZHFA 2DL3A 2P81A 1G3TA 3TOAA 4EMSA 4BDZA 2H27A 3BY7A 4A54A 3ECOA 1VQ6T 3V4GA 1BIBA 3G2BA 1QVUA 2DA5A 3K2AA 2J5PA 5E8IA 1KHIA 1SD6A 1OEBA 2DIQA 3F0CA 2F4MB 1AKHB 1Q86R 3E0JB 4XKCA 5CKBA 2VBYA 3LX7A 2PVOB 1ZH5A 2JTMA 3PO2J 3F8FA 1FYLA 4XU3A 3MJXA 1UFFA 2K9LA 3X26B 1WXBA 1LUJB 3DKXA 5M5WJ 2GXBA 2X6XA 2E5KA 5H2FC 3K0LA 4OIPF 4TVRA 2K27A 4XLHA 4N9IA 1A31A 1MBFA 4F7UF 1X6OA 2DMQA 1ETQA 4BQQA 2UZKA 1N77A 3KZZA 2COYA 1QHHD 3EYYA 3MP8A 1TNSA 5DTDA 1Y07A 3V8JA 1IREB 3EFSA 3SQNA 3T1BA 2UXNA 2ZJQF 1PG5B 3T0YA 3V7RA 2IVMA 2HYFA 3RYPA 4A0YA 3FMRA 2NWMA 4QVCA 1SAXA 1MMNA 1S9HA 2EFPA 5DM6F 3CCJI 4HT8A 1UDLA 3OW2S 5K7HA 5B66C 5DLOA 4CCJA 2YRVA 1CF7B 3ZMSA 1LJ9A 2YPRA 4YRVA 2L02A 4L18B 4A3EJ 1AHDP 1UAAA 4C0DC 4DA4A 3M07A 2HVRA 4RMOA 2ZCFB 4M6YA 1VFCA 2R7OA 1JGSA 2O6GE 2HZDA 3GTOJ 3ECHA 1U5TA 2M7AA 5J3BA 2WB1A 3WTWC 2ZSIB 2O4XA 2RJFA 4XAXB 2NS7A 1XSDA 1IZ1A 4X0GA 1ETVA 4A3KJ 5J4YA 3Q0UA 2R3SA 3SWNA 1V4RA 2CZ6B 2DE0X 3LSPA 4JS5A 4C92C 3BZCA 2HVSA 3BQZA 5GANh 3BZ6A 2RQUA 2K85A 4LLNA 2RHYA 3DLAA 2AS5F 2QQSA 3GLLA 2K2VA 4LG0A 3RCOA 3CC2A 3AG4H 3CCSQ 1YP5A 4PCQA 1IN4A 4M75C 2M5WA 4GRIA 2HXIA 2DFIA 3WTUC 1VQ4I 4P5OA 4CDGA 3HOWJ 1BB9A 5FD6A 1GFCA 2CP5A 1DU6A 1P4WA 1B34B 1QPIA 1IC8A 4I6ZA 3FXMA 4I0BA 4XBFA 3E6BA 1UECA 2EJ9A 1IAWA 2LDUA 2VVKA 4C3HJ 3DLLF 2OTJI 1WZ2A 3PIOA 5IYBJ 3TCJA 4M6VA 1PKTA 4A2UA 3G4SI 2HBWA 3VEPA 3CCVA 1J5YA 4RAZA 5HLHA 2UWMA 2Z2SB 1EIFA 3MEVA 1NPRA 4DOVA 2O9SA 4CC3A 1SMYF 4C92A 5JVTA 1K9MR 1LFBA 3JCMc 1EFNA 1G3YA 1ZRFA 1UG1A 4MLOA 4BJTA 2EJFA 2KPMA 4IIMA 1QQJA 5D4SA 1U8RA 1JJ2S 2X3WD 4RTWA 4M3DA 1TBXA 2XGCA 3TW6A 1IDZA 2PBIA 4HX7A 3CCQQ 3S3OA 1NG6A 1I5LA 1QU3A 5KE2A 3ABUA 3M8FA 3Q0WA 5KYXB 3HRSA 2KYBA 3CCRQ 1NJIC 4U7BA 4NB5A 3H35A 4IIOA 1UUEA 1AT1B 4KUMA 1K9MU 1ZRDA 2KLOA 2H1LA 5GAOn 3BTCA 1WFWA 5CLSA 5I2MA 3W6VA 1MV3A 2LT4A 3A0BC 4CCKA 3UKGA 4IHXA 1YJWQ 1TXQA 1QP2A 2RA2A 1Q82R 3C4SA 1I39A 1KQ0A 3QU6A 4PJLA 5C4XJ 1GXQA 2JZYA 3JRCA 5IT3A 2P0TA 4RKUE 4NL3A 3HDDA 1NM7A 3FRNA 1XD7A 2FA5A 2PMUA 3CCUA 5FLVA 1CQTA 1M8MA 4J9BA 3OYKA 2RJEA 1GBRA 2V7FA 2GCXA 2EZLA 2VJJA 3PJRA 2LNHB 1BU1A 4JPBW 2OAWA 3L9FA 3C2GA 5K5OA 2PZ1A 4IVNA 2VPLA 3MKDA 2ZPGB 2OC6A 2TRTA 4XN3A 4D9JA 1YCYA 4WCIA 4M7AC 4HYEA 1SSFA 1VTNC 2DYRH 2ZPIB 2V1DA 2FYKA 3LSRA 4FQGA 1UELB 1D1CA 1B6AA 3FMQA 1XGSA 4A6DA 1KQ8A 1EZZB 2O4XB 2XAJA 1N8RC 4XLAA 2NOJB 4LJZF 5LRRA 3LW5E 1IGNA 1BL0A 2A05A 3I54A 2GQIA 2FU4A 2DOEA 2QXFA 4MMLA 5KYYA 5HVQC 1ZX6A 3CCEA 1TUGB 3EYIA 1HJDA 3WTXC 3PNWC 4RAYA 1S7OA 5KCHA 1X58A 3A8HB 2QWWA 3TQ7P 4DNCA 3ZBDA 1FJLA 4EMKC 3HKZN 3HRMA 1TWAJ 4PDKA 4AD9A 5KAFC 1GFDA 2L3SA 4K11A 4P55A 2E12A 4JRKA 1T0JA 3QYFA 4LITA 3I55T 2LOOA 3BROA 4OINF 4ZYAA 5L3FA 2RNAA 3G1MA 3TEDA 1TZLA 1I5OB 1W7PA 1H88C 2RB6A 4JRQA 4F16A 4EJTA 1NG2A 1RUOA 3REOA 1Y71A 2CJJA 2FNPA 6PAXA 3H9JA 2Q2EA 3S2DJ 2EYZA 2HL3A 4YTLA 1VQ7I 1JUMA 1AA7A 4TV7A 4UUSB 2VT2A 3M59A 3IC7A 1VQNQ 5CVUA 4E4HA 2QCOA 1Y0MA 2LQNA 3BFMA 3A8GB 2FPFA 1R7JA 1QVTA 2WAQA 4X9CA 4OVAA 4JRIA 1D0ZA 2BVMA 1KU3A 1JE8A 1K61A 5GANf 1A36A 4LFUA 4QTRA 1L3LA 4M78B 2GGRA 2KBTA 2R5ZB 4JX4A 3J7AW 3MEAA 4F7UB 1P2FA 2Y48A 1BW5A 1LFUP 1BBZA 5FGMA 3F23A 3GOXA 3R6SA 2E5ZA 5JLWA 1K78A 3HOTA 3PFIA 3B6AA 4KBMB 1EH7A 3BDDA 2LT1A 1OCOH 1C1AA 1X2QA 2YLCA 2YUOA 2ZAEA 2DFEA 3MCAB 4FL6A 3GNGA 3RJPA 1MH3A 1YJNI 2K4JA 2DXIA 2LY2A 2DN0A 2VE8A 5GAMg 1U78A 2A7YA 4BQAA 2VC1A 3F6VA 5DS9A 1HDDC 1NLPC 2XU8A 4Y4RA 1ZN2A 3DP7A 2ZFUA 2J7IA 1ZKGA 4CZCA 1S5LC 1ABOA 2MMPA 1KG1A 1OPKA 1E3OC 2QGUA 2DU9A 3H5NA 1WQ2A 4Q47A 3BG3A 3C7JA 3A2KA 1VQMT 2K02A 1FWZA 2HVQA 3CUQA 2FF4A 2FEZA 4E70A 1OCTC 4V2SA 2F2XA 4E7HA 3SZTA 2E4HA 1RAEB 2KXDA 1JUPA 1W5SA 2DA7A 2BTTA 2KMTA 1QA6A 3VOEA 2E6ZA 1GCQA 2Y4YA 3SFZA 2O01E 1YIOA 2JM8A 3WTSC 1FMVA 1B1BA 4UNOA 2E5QA 2RHUA 1STZA 1ODDA 2EA4A 4B48A 4ZZDA 1UHSA 1HW2A 2R5YA 1UGRB 2FHDA 1W36D 4GCVA 5DD4A 1GBQA 3C12A 4BXXJ 1D5VA 2EJRA 1FTTA 5A2QR 1RABB 1I3QJ 3A5ZB 2KP6A 3FM5A 1NYGA 2QYZA 1ZSGA 1R58A 2DTHA 3R60A 4KFCA 1N27A 2K5FA 4XLNF 2XAGA 3F72A 4OGEA 1R4MB 1HKSA 5GMKm 1G2BA 1SKUB 1UG0A 1PSFA 1ZA1B 3CP2A 1WJ5A 2KT1A 1RRJA 3DLLA 3CCEI 4NNJA 3INZA 2CP7A 4FU6A 4BBSJ 2BY0A 2K7AA 3QYHB 5H6QA 3TO9A 4EV0A 2X1EA 3RKXA 4XMYA 4ESJA 1X43A 3RR6A 2I0NA 1M1KU 1YJWA 4BUGA 3CCVI 3ZN1A 1EF4A 2F4IA 3SZGA 5FU7C 2IPOB 2ZCWA 2BUDA 2R7DA 2XGEA 3F22A 5CR2A 3PFYA 3G6EQ 2YSRA 3C1DA 4IHYA 2DL5A 1GL5A 4LK0F 1VQLI 4HQMA 2MC4A 2KZGA 4BU2A 3M7GA 1FX7A 1QW1A 4H0EA 3CCQA 2BKDN 3EGDA 5E3LA 2LREA 1R00A 3OYCA 3ESWB 3LAJA 4B1RA 2GBQA 1QLYA 1IRFA 2KIUA 1VQ9I 4RTUA 4ZYHA 5IOZA 2YXYA 4A3BJ 1S6LA 4KA4A 1BA5A 2BGCA 3VS5A 3F70A 1X4OA 4M7DD 2MLGA 4CC4B 1D3YA 1R6RA 4BDYA 5I21A 1WSUA 2A68F 3I4NJ 1Q82U 1WNLA 2LX7A 1PUEE 2BXYA 4KNYA 4G6TB 2QA4Q 2ISZA 1G6NA 1OKRA 5GAMd 1AD5A 3G71A 5HY6A 3H92A 2Y31A 4CGZA 1IXRC 1VQPQ 1ORKA 4I7HA 4LB6B 4EGZA 4N4IA 5C6SA 2VKEA 4BHBA 4UUSA 1BJZA 3F8BA 4IXAA 2LCLA 5J1YA 5GAN3 4M75D 2EYQA 2EFOA 3CDIA 3CPWS 3K69A 3WVDB 3MFKA 2ETHA 5F08A 3CF5F 1H9TA 3JCMh 1Y0NA 1RR8C 2W1OA 1XX5A 1D1AA 4CYCB 1IO6A 3VS3A 4EJWA 4BKXA 5CQXA 2RQTA 4YFKF 1FLIA 3TDZC 4WXDA 4BGDA 2DOAA 4A3FJ 1X1AA 3DPLC 3P9IA 2IS6A 3CCYA 2NVUB 4MFDA 1OPLA 4UB8C 2MK5A 1XB4A 3CPFA 3LSJA 4ESFA 5LJ3h 2Q1ZB 3I3LA 5D8LB 1ZG3A 5CQEA 4DBRA 4HEA2 1ZSZB 2EB7A 3K70D 2JA8J 5HS8A 1B07A 2E71A 4M75F 2VONA 2XSJC 3PM1A 3HP9A 3M4YA 3PMTA 5GANg 2HYGD 3VSKA 2MSYA 1GDTA 1Q95G 4KYWA 2VKVA 1ZGWA 4HLXA 2F69A 4LDWA 1ZQ3P 3ZOBA 2PMZA 2OU2A 2R92J 2RI5A 2JJ9A 4QQGA 2O61A 1VQ5T 4OGCA 4HT9A 1E3HA 2OZ6A 3CJRB 2B9SA 3EH2A 3CBOA 5GAMj 3G4SA 5J3LA 3DTKA 1F4KA 1KC8U 5GAEJ 2ISYA 4LK1F 1WZOA 2KXCA 2AQFA 1OZ2A 3JSCA 1A0NB 1AOYA 3M0TA 2RI3A 3CC4Q 2E3IA 3C18A 5FKMA 1C6VX 4UV8A 4XSXF 5F0HA 3CO7C 2PLYA 4RB0A 1QBJA 4D6WA 2F5TX 2ZB9A 4BUPA 3S16J 2KK4A 4PGHA 2LCCA 1Q7YU 2Y9YA 4EJUA 1WQWA 3BDLA 3NTIA 4XU1A 1YITT 1VQ7T 2M7BA 2QKLB 3I5UA 3SEMA 2ZJRF 4GYIA 3D7SB 1ACIA 1WI3A 4LIVA 1SD4A 3J81E 1UHMA 3LWFA 4Y91A 2OTJT 2W4SA 2AO9A 3I9V2 3WU2C 2UXXA 4J9EA 2GQVA 1RNLA 1SFEA 2R5AA 3QDFA 3DEUA 4F3QA 1UTIA 1Q7YC 1QZZA 2XRLA 3CDHA 2L4MA 4FETA 4I76A 3ZL7C 5GMKl 2A61A 1WJEA 1FIPA 2XPUA 4GFBA 5GANj 4BNCA 3V42A 3DTEA 1G5VA 1MDMB 2VB6A 2QQ9A 3HPWA 1VOMA 2E35A 3REAB 4M7DF 2VT3A 5IT9Z 1U6GA 2PN6A 3K2ZA 2BIVA 2FZKB 3OWTA 1TH7A 3Q0VA 2CS7A 5GMKj 4NS5A 2EQIA 2KRFA 4IQ4A 1F5TA 4DYCA 5LGTA 1D8JA 2QLZA 2DKGA 1WVRA 3J80E 3IH3A 1K4SA 2A37A 2RM4A 3MEWA 3Q9SA 1U1TA 4Y92A 2WSCE 4RB1A 1W36C 5A2QZ 1ZUYA 2E1CA 3G6EI 3M8JA 2PMZN 2HU9A 2XC7A 3WTYC 3FM3A 3KYLA 1T6SA 4KMUX 5J4VA 2ACJA 5CK9A 2GLOA 5EJCA 2CRGA 2WBMA 3TQNA 1OI1A 1ZLMA 2V8KA 3CESA 4C92G 2CUEA 1TLHB 1MJBA 4P5NA 5F04A 2HSPA 1U0JA 4CXFA 2PVGB 2JWTA 2DA3A 3CD6A 1B4AA 2K3PA 4LLGF 3ZN0A 1R49A 1ZREA 1YIJA 3NPFA 2Y30A 5LJ3g 4HW0A 1U3EM 3DU5A 4EJVA 2GFAA 1EH8A 4L5IA 4XKVA 4JUVA 4HDUA 1HSTA 3LWHA 4C30A 4MNUA 5EC7A 3RQIA 3GFJA 3G3ZA 4D7MA 5DUKA 1ZGAA 5ICCA 2HOSA 4XK8E 2E65A 9ANTA 2GXGA 1B72B 4RGRA 3NGPA 1XMKA 4BAYA 1NEBA 3BCAA 4LB5A 2EGCA 3RZOJ 5DM7F 5HNHA 2X4YA 4GBQA 2QDLA 4PLLA 1K0XA 4RLFA 3CMAQ 3AL0C 4JZ3A 2I5UA 3FJ5A 2HQXA 1H9GA 4HNVA 1D3BB 2KDSA 2HMAA 3SB2A 4Z2YA 1RR7A 4IEJA 2ID6A 2PQ8A 3FXRA 3ZRGA 4F92B 1PP7U 1ZHIA 2PQWA 2XG8D 3S1MJ 4ETSA 1Q1HA 2E19A 3H9GA 5HDNA 1UCRA 2ZPFB 4E6RA 3A4CA 3M0SA 1M90U 3EUKL 1UE9A 2HKXA 4XN0A 1TL8A 4S04A 3OS0A 3P8DA 4ZN3A 1VQLA 2MBFA 5GAN5 1X75C 4RDUA 3NTHA 2DEUA 2EIFA 3KYCB 1JUSA 2A0FB 3CCUI 1ZUKA 1IUFA 2YX4A 1ZARA 3HGGA 3M5AA 2KRCA 1V76A 1YNZA 2JMAA 3DF8A 2V26A 1OYYA 1R5GA 4RB2C 2M1HA 3E9FA 4D5FA 3IH2A 5E79C 2JXBA 5HS9A 2K9SA 4IURA 2LC4A 4IQJA 3VYSB 5A0LA 2E41A 3GTKJ 2KHMA 2DQLA 3PIPF 3NWSA 2DNUA 5GP9A 2GA2A 4QVDA 3QRFF 3AG1H 2EQUA 4QT7A 1OMIA 3JCMP 2DYSH 1MMSA 1FOXA 1FYKA 2HWVA 4IHVA 4OIOF 4C92E 1FBQA 2EIJH 2KROA 4WF2A 5ECAA 1M9SA 1T3SA 3SWNC 1KYWA 2VQHA 3CO6C 4ZC3A 3M58A 4A6EA 1PJRA 2CT4A 2Q8KA 4M4ZA 2H94A 4ZGDB 2FMLA 1MHNA 2ROLA 2HQHA 2VBXA 1F43A 3A1PA 3V8KA 2CW7A 4N4NB 2CS3A 3DPTA 4RB3C 4FASD 3W2AA 1JQQA 3X28B 4EMKA 5HK0A 1YJ9A 3EUHA 1VQ5I 1ZG5A 4MQVA 2F5CA 3TP0A 4E7IA 3C0CA 3I53A 1SC7A 4AIDA 3L09A 2DJZA 3E6MA 2IS4A 5CKEA 3S93A 2VQLA 3U1KA 4F04B 3F3XA 5JI6A 2LG4A 1W4SA 3H0IA 4C8QD 3KP3A 2KDOA 2OQGA 3HL2A 5KK1A 3D5RC 4C2TA 2LKSA 2L8DA 4UC4A 2D8HA 4C5IA 2QEXT 2KKOA 2PMHA 2DVEA 2H8HA 2XDDA 1I07A 4EDUA 3RUXA 2BY3A 1KC8C 4FX0A 1USSA 3EFRA 4QPQA 1J0RA 3FX3A 1G3WA 5EYRA 3U21A 4BXFA 2HDDA 1AWXA 2CKKA 3H36A 3BR1A 4A3CJ 1LCKA 3CP8A 1VIFA 5D6FA 3RDIA 2JT4A 2KYMA 2YUNA 3QYGB 4CC7A 2P6TA 1WJCA 1R23A 3F9KA 4WCGA 1UGVA 1ZUUA 2DM1A 3TSWA 4XM3A 2DK5A 1U9OA 4LD6A 2RHXA 3CCLQ 1RLQC 5EF6A 1LDKB 2VUMJ 4R8HA 2X85A 2YRCA 4ASNA 4LG0B 2VXEA 1UJYA 1IF1A 1Q1VA 1VQNA 4NQWB 1QVFA 1JKRC 1J75A 1ONVA 2HOEA 2PX9A 2R7VA 3OW2P 1YJNT 2EINH 3CJQB 1WHGA 5C4JJ 1N8RR 1XQHA 1WPYA 1YITQ 2H8WA 2BV6A 3QZ9B 3OQ5A 2Q0OA 5DDGA 1EX4A 2DF6A 3QWLA 3PTAA 1MV0B 2DJNA 4XK4A 1DDNA 3CC4A 2BHZA 1R5HA 3OIOA 2EIKH 1FOWA 2W84A 3MKLA 2VOPA 4FYWB 1YOVB 3IV5A 4A3JJ 4J01A 1XGOA 3TO7A 1DU0A 5DCMA 3JCMW 2DA1A 1RADB 3FBNB 1MKMA 1YHQT 1X1BA 2K3BA 3CCEQ 5LEJA 3CC7Q 4O6JA 5GAN6 3PGGA 1T33A 1MJ9A 2ATCB 4C2MJ 2RQWA 3M0QA 5D8KB 3I56T 4IOAF 1WKMA 2L5QA 3LA2A 3DBLB 4BXUA 3NMZC 3TEEA 1RAIB 3I5SA 3CCVT 1RIOH 1Y6IA 4CYDA 1YFHA 5IAYA 4Y33A 4A4GA 3BG7A 5E1WA 3I55I 1ITYA 4EIKA 2PUOB 3VS4A 4WXHA 1NYFA 2HD0A 2RC4A 3EH1A 5LLQA 2DYIA 3EHRA 2GOXB 5JVGF 3QUIA 2EFQA 1O9SA 2NVXJ 3FDYA 4LOCA 4FYVB 3BR0A 3LQQA 2FZGB 2K2MA 2J6FA 4L59A 1MDMA 2F5DA 4AUXA 2EGEA 1JTYA 2ZKZA 2O8KA 4IUPA 2QM3A 2H6BA 2XMFA 3KFWX 1OQKA 3CXCS 2F5FA 4XQFA 3CD6I 2L3QA 2X4WA 1P4XA 5EG0B 1YIJI 2VYTA 5I2SA 4MMKA 2ID3A 4BHPA 1GXIE 2V1XA 2W10A 4EATA 2DMOA 3UNGC 1JT0A 2CP3A 3JCMQ 2HPMA 1YX5A 4C0DB 1QWFA 2XASA 3DEEA 1QPMA 5K5QA 4NOYA 2OTJA 2D0NA 4YG2F 1Z05A 3H1CA 2R0QC 1X19A 2DTRA 2FQ3A 3GW2A 4C3IJ 4IKFA 2JSCA 3ROUA 3S14J 2MVTA 3NEUA 3CCST 3QYBA 4JJCA 3OSFA 4LNPA 4YIFA 2ZXHA 3CCRA 2EFIA 1S72Q 4LGWA 4ZN1A 1X1DA 4PJOC 3ZMDA 3ZEHA 5HS7A 4C0FA 1P9QC 4Z8AA 2Q2EB 3UA6A 5D5VB 3UA7A 3O8HA 4AIHA 1KJWA 1VQ4A 1VQNT 4KRTA 3JB9H 1ZSZA 3OSSC 2R7SA 5L8RE 1NLOC 1UGQB 5EZGA 2M8GX 2MFZA 1G4DA 5IXBA 4C8QF 3RBBB 1X2MA 5GMKi 3AL0B 5GAN8 1REPC 4IUTA 4VUBA 4M7AF 2WAEA 1PYVA 3EFOB 3VJPA 1MSEC 3GEZA 3KEOA 1LOJA 1TTHB 2AQEA 3HHTB 1H3ZA 3GBGA 1MZBA 2N8GA 4AFUC 5KHDA 5J8CA 3VYRB 1O7FA 3VYTB 4A93J 1G2HA 2JVHA 2BZTA 3IUOA 4FHTA 1I1JA 2QGGA 2V1QA 3HPHA 1J59A 5LJ5d 3M4GA 2M87A 2X6WA 3TMOA 4S0HB 1IGUA 2QYOA 3EUHC 3HSBA 3HOYJ 1GVDA 1OCZH 3OL3A 2L7FP 2D5VA 1WJAA 4YFNF 5GAN4 4AVPA 2XDBA 5EGOA 2FG0A 4XU2A 2V8IA 1X1CA 3ZMVA 1OJLA 4HCBA 2K4YA 1M3CA 4E7LA 4ON0A 3MMYB 4RAGA 3PUFA 3CXCA 3CC2Q 1M8VA 4JQFA 2J05A 3IL2A 2GTJA 3EGUA 3MKWB 3OL4A 1GCQC 2V4JC 1WH5A 3HKZA 3PT9A 1YITA 1TSFA 2KT0A 3HPGA 2KRSA 4OAYA 4M78G 2EYWA 1EA3A 4BQNA 2GIVA 3M53A 1IW7F 4U0YA 2D0QB 2RQRA 1M2VA 2KNBB 1IZ6A 2LY9A 2JPBA 4DQ2A 1BR2A 1I5ZA 3QODA 4V2GA 2RREA 5B1BH 3CD6T 4E47A 1R8OB 5I22A 4DBFA 3O2PE 4M77C 3OYEA 1H92A 1E0EA 2O8XA 1W5TA 4DW6A 2EYXA 3C95A 3MEXA 4J9HA 1I6HJ 5FJ8J 2HQAA 5GADJ 1I27A 4B3XA 5CQGA 5FLMJ 1YLFA 4IPAA 3T9NA 2HDAA 5FKNA 3OIQA 4A53A 4PFOA 3M56A 4IZZA 4RUGA 3U2RA 1WCMJ 2EKOA 1VQMQ 1JEGA 4BJ6C 2P5VA 3HOUJ 1WFXA 2XKPA 2OJED 1SHFA 3R6OA 4MHGA 2RHIA 5E1XA 2A6EF 2F1LA 1PUFB 1JB0E 3WGIA 2WWYA 4IUVA 2SEMA 1KD1C 5TJJA 2RH2A 3META 3LA3A 3WHCA 2L9RA 4DYQA 4Y17A 4OMZA 1KQSS 1SFUA 3CMMA 3EAEA 2QDYB 2L0KA 3J7AY 5HLGA 1DP3A 1LNXA 2KQRA 3A03A 4LUDA 1QRYA 3BJAA 1QWEA 1ON1A 1ETWA 1WJDA 3MVPA 4GXOA 1JRIA 3GIBA 1FXXA 2DT7B 1ZGJA 3PNTA 3OA6A 2YUSA 1UHFA 4CRIA 2GQQA 1B3QA 3GX4X 2KMUA 2OX7A 1B59A 3KIOA 4PJOG 5EEGA 1N8RU 1HQCA 2OQRA 2RQPA 5EZHA 2E2HJ 2JN6A 1JXSA 2VXFA 4ZGJB 2RQVA 5LJ5g 1XDSA 2FOKA 4HAMA 4F55A 2DRKA 2DZ9A 3P9CA 1QGPA 3EG1A 3UF4A 3HZJA 4M78F 2CZ0B 1X01A 3VS1A 2B8AA 2P8TA 3TP3A 2DA4A 3A01A 3CCJA 2JRTA 3HTSB 2D1VA 2OAZA 3NQOA 1Z77A 4F7UG 4RM2A 4A3LJ 2ZJ2A 2EFNA 1SFKA 1HCRA 3M55A 3WU0A 5FD5A 3H8ZA 3MP6A 3CUQB 1VUBA 5E20A 4KGVB 2JUFA 2WV0A 3JRIA 1K78B 3S15J 1YFNA 1OU9A 5KH6A 2HI3A 1VQLQ 3E2UA 4II2A 3CPWP 1YI2Q 2OTLA 2D1XA 1K7AA 3DWLE 2QSFX 4RTTA 5F1JA 4N4HA 3QKJA 4CCLA 2AHQA 2TCTA 2FB7A 2LC2A 1R1VA 2K3FA 2QENA 3RPUA 3GYHX 4M77D 1NEGA 1D3BA 4LIUA 4FSXA 1KQSA 4IL6C 5E1ZB 2RV8A 3JCMg 2PU9B 3CC2I 2C0OA 2RNGA 2X9DA 2QEXQ 1G59A 2ECCA 3H5AA 4XKWA 1K9AA 3EG9A 4AIKA 3IP4B 2KAFA 2X51A 4R0KA 2GIZA 4HXJA 5F64A 2EYYA 1W5CC 2JRMA 2NUTA 4J00A 2HGCA 4F7UE 4KT5C 1VQ8T 2XAFA 4ZGEB 1VQ8I 1IHVA 3ASNH 4UVAA 5FFXA 3WU1B 4UXNA 2HEOA 2DT6A 4II3A 2R7UA 2DL8A 4PFZA 4X34A 3GZ6A 5AT1B 4BY6C 2ELJA 2W25A 3ZXSA 4MTEA 3K4CA 3VPRA 4HA8A 5LJ5h 1T0FA 3H0GJ 3S17J 4LXCA 3JB9D 2AKKA 1YJ9T 3SEQA 3QP6A 3QWXX 4I01A 5F0FA 5B1AH 1VQOI 1V55H 3ZMUA 1H8KA 3G1OA 4KT0E 2WACA 3AFHA 3JCUC 3EGDB 2EAYA 1R5ID 2CFXA 1I50J 2OTJQ 2EBPA 4IRIA 2D8JA 2BZYA 2JTEA 4DEYA 4XRMA 1OX9A 2VGMA 3B02A 4HF1A 2DCEA 2A5YB 3EG3A 3PQKA 3U1DA 3QP5A 2E1MC 3V8LA 1BR4A 5DUIA 2KT8A 2LNVA 4F14A 4Y52J 2JS2A 2KIFA 3BE3A 5DM7R 5LJ3e 4EEFG 1E6HA 2ZC2A 5D6XA 2WC2A 2FE3A 2PEXA 4UUTA 3OYFA 2BE7D 4ELYC 4IUUA 2I8DA 1IRZA 2HDWA 3BOQA 5K7FA 3VRZA 3CCET 3CCMI 1T95A 2IGNA 1YX3A 4ZYEA 2CGHA 3CJNA 3CQZJ 4LG3A 2R5YB 1T0FC 1XGMA 2F2VA 1FOKA 5JHUA 5I11A 1LB2A 4HCCA 2ZXIA 1WJBA 1VQ5A 2OTLT 3BJOA 3DTIA 1WJQA 5C44J 1TWCJ 1BI1A 5CKFA 4FE7A 2JUGA 5FLXZ 4C5GA 3NWTA 3CTAA 5D5WB 4BE2A 3HOVJ 3I55A 2RN8A 1U8BA 5HKCA 2V1UA 5A2QE 1P7JA 4JBAA 1RAGB 3CUOA 1VZ0A 3TGNA 2EWNA 4YELA 1XC5A 1TOVA 2KRMA 1XTAA 2LQWA 2X0LA 1HK9A 2IXSA 3VFZA 1WRJA 5GAOr 3KZIC 2IA2A 4OIRF 1X6BA 2XROA 1IDYA 3M0PA 3KLOA 3OYIA 4Y13A 2K6DA 4FT2A 2DAQA 3CD6Q 1RI9A 5LBQA 1VQKI 4KT6A 2JVGA 1YWPA 1SVMA 2K5IA 5KYNA 1C0WA 1VQPT 4UY8I 2QASA 4HG2A 5L3DA 4E7JA 3EG2A 2KRNA 3ABMH 4HCKA 3E97A 2EV5A 1YI2I 4A5NA 3BLYA 3E6DA 5EG0A 4J5YA 4M75B 3CMEQ 3S1RJ 3CF2A 1Q82C 4XLPF 1S7EA 3QQAA 2Y2ZA 2XK0A 2YT6A 3SEZA 2OAUA 1X6GA 3CLOA 4F7UA 2VXZA 4JLIA 2R4GA 3JCMf 5KYUB 1NJIR 1XSXA 2LYCA 1LFPA 3J80Z 4V19K 2AZVA 3H0FA 2EZHA 2XHCA 1DJ7B 3J80K 3J80R 3HOSA 1I8FA 1VYVA 2P0KA 4KITB 2LJ3A 2R5MA 2Z99A 1XSVA 3PMIA 2ABLA 1M27C 4Q48A 1HOMA 2NXNB 1ZBXA 4D0PA 2JW4A 3FJPA 3M9QA 4OB1B 4OMPA 2MH2A 4C92D 1YCSB 1W0TA 4Q4ZF 1B34A 5IN1A 1F1ZA 5GAMf 5KCOA 4ENNA 1O3TA 3O3KA 4A3MJ 2VBWA 2GWRA 1TUCA 2HKOA 4F91B 4N4GA 4UVBA 3WGHA 2VQGA 3TDUC 3A98A 2DO7A 2M0MA 3S8PA 3LSHA 4MO7A 5LHHA 3QXEB 2L54A 2NNNA 4OB3B 3URGA 2HTSA 1U06A 4IOCF 2V1NA 4X9DA 1WJFA 2KFDA 4HNTA 1N9RA 2DXBA 2QA4A 1BI3A 4CI0C 4E7ZA 3NAUA 4J19A 4M9SA 3OYMA 2PUKB 1HC8A 2ENMA 2EJGA 3L42A 3JCMX 2ZMEA 4YFXF 3WODF 2FSWA 2NUZA 3L2UA 3FLGA 3X25B 2HKQB 2ZZDA 4A4FA 1FSEA 4F52A 2F4OB 2XGXA 2K9GA 2HEQA 4RMNA 4R56A 2PJRA 2DLPA 3G4SQ 1WGXA 5IHIA 2XGDA 3RPUD 2DPDA 2MWPA 4PJOB 1BC8C 2JTFA 3R0JA 1RUWA 3HHGA 4NHJA 2AIRB 4BYYA 1LNWA 2DMPA 4W1UA 5M5YJ 1UHCA 5EEAA 1FIAA 2XVCA 4I02A 1IB8A 2CQNA 3KFVA 3HBLA 2DFHA 1U2WA 1NHAA 3U23A 2G7HA 3CCLT 2M1BA 4ZDPA 4M7DC 1M3BA 3WTVC 1OOTA 5IT9K 2ADUA 3VODA 3RESA 3JB9I 1GV5A 1SMTA 2L4AA 1LEAA 4JP0A 4C8QG 1EH6A 1RETA 3S2WA 2LDMA 3GTQJ 1AVZC 1TWBA 3VUBA 3TBIA 4FTHA 4A5MA 1TP4A 1KK7A 2VXDA 1QVGA 4UVCA 3N4MA 3CCSI 2Y75A 1R9TJ 1N78A 1WYXA 2DZCA 3OBWA 2HXOA 2JA6J 4U7DA 1KU2A 1TTYA 3PL8A 2LJ1A 4J8OA 2CYZB 4CYCA 4IHSA 2ESHA 3LOCA 3UWNA 3CMEA 2DFFA 4GLMA 1BM9A 4M9XA 2KR3A 3RDVA 1PUFA 3LH5A 1YW8A 3MP1A 3GZNB 1N6AA 2K86A 3JTHA 1RI7A 4ZDOA 3CJTB 3HIFA 3BC8A 5FU7B 4Q5WA 2M51A 1X1PA 4OIQF 1KGSA 1DUXC 1E6GA 3K1PA 3FC3A 1Q81R 5BQTA 2FJ1A 1W4MA 3HJEA 2X35A 1E17A 1WLPB 3KBGA 1I1GA 4M74A 2L3RA 4N4OB 1IN5A 4G12A 3J81K 2QSHX 4DIQA 2KQWA 2YWWA 1XCBA 1XCVA 3FBIB 2FRWA 1TG0A 4WXCA 4HX8A 2ZBKA 4XTZA 1VQ7Q 3SXYA 5AONA 1LDDA 3BG9A 3SDGA 2LF8A 3PO3J 1O3RA 3DFGA 1D1BA 2STWA 2HDCA 1FY7A 2P6SA 2M0OA 2RK2A 2ZPEB 1Q81U 1MMDA 4KJZA 1JKQC 4J9IA 3JB9F 1G8XA 1RAAB 3ML6A 2VLAA 2ZSHB 3FIWA 2VJ5A 2LF7A 1YE9A 2VJ4A 4JDSA 5IYCJ 1E2XA 2P0PA 5BMZA 1H8AC 1Y1WJ 3LSTA
chains in the Genus database with same CATH topology
1U1SA 4HCCA 2JT1A 1OYXA 4OP0A 3GF2A 3IRQA 2VUBA 4J7FA 3FB9A 4G7HF 3CCUT 3R0AA 4I09A 1Y7XA 3GF5A 4KUDK 3SWNB 2ZNYA 2FXAA 1QP3A 1BC7C 1RI0A 1FNNA 5GAMh 1HSJA 5HDGA 3MEUA 2YLBA 3DLMA 2HTJA 3P9KA 2QQAA 1YTYA 4C5EA 5M9OA 4OF1A 3HHHA 1MGQA 4PGGA 5AIPA 1R36A 3ZQ7A 2OA4A 2RDPA 1S29A