2QQ9A

Crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
212
Chain Sequence
DLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
total genus 73
structure length 212
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qq9A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qq9A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qq9A03
3FXRA 3TGNA 1XDSA 2X0LA 4EQQA 4OIQF 1AWCA 5EEGA 3KP5A 3WTZA 2MH9A 4LB5A 2VOOA 4OMYA 2DQRA 4MQVA 2Z3YA 4P5OA 4ZZDA 5JI6A 2HR3A 1TQIA 5FB2A 1U6GA 5KVRA 3GZ6A 1I1SA 3E6MA 1BN5A 2EFWA 4RS8A 1NHAA 4HX7A 5ICCA 1YO5C 3QU6A 1P92A 1ZREA 2GWRA 4FX4A 3KP6A 5LHHA 3I0TA 1W5SA 4EJTA 2XAHA 2DPUA 4BAYA 2Y0MA 3F23A 3M8EA 5J8CA 4M9XA 4GYGA 5DUKA 3R61A 2PQ8A 1UHWA 3TOBA 3HRTA 4L0ZB 1SD6A 1IW7F 1TW2A 1R7JA 3GX4X 2DI3A 1FSEA 1IXCA 2QWWA 2CO5A 3QP5A 2QBYB 2Z33A 2IP2A 2ZFWA 2HOEA 3LQQA 2DK5A 3BY6A 4WCGA 4NHJA 3BZ6A 4L18B 1ZLJA 4Q47A 4U0YA 2ZO4A 3WODF 3LFKA 1F9NA 1J2XA 3WU0A 2IJLA 5CVVA 2BEOA 1Z6RA 2XVCA 4G7OF 3V4GA 3F21A 3VOEA 3FHZA 5L3GA 2RQPA 3FXUA 4MHGA 3TDZC 4KA4A 3TO7A 4I0BA 4EJUA 1QQIA 1SFUA 5CLSA 2EFQA 4HBLA 2XHKA 5HDKA 4UHTA 1YLFA 5HLGA 2X4HA 1SD4A 2XASA 4XBFA 5BQTA 2XRNA 3CUQB 3T5XA 1SD5A 2ZKZA 3C1DA 1CF7B 5K5OA 3H3ZA 4A6DA 1PUEE 1BM9A 2FSWA 2M8EA 2QLZA 1YS6A 3ECHA 2LF8A 2VBXA 2YU3A 3GLXA 2ZXJA 5IT9Z 2QUFA 2OU2A 2K02A 1IRFA 1SFXA 3FWEA 1TQMA 3FMRA 3R0JA 5J8FA 4BQAA 3T8TA 4BHPA 1RIOH 2CG4A 2HYFA 1MZBA 4CGZA 3E5QA 2YR2A 2XAGA 1KU2A 2WTEA 1FBUA 4L5IA 4HF2A 1K6OA 2JZYA 1HXDA 2EK5A 3LAJA 5DV5A 4A0ZA 2MLGA 3QOPA 1QGPA 5LGNA 1CGPA 2Q8KA 1WQ2A 3K69A 3EETA 2ESHA 1G3TA 1HBXG 4WK8F 3PFIA 5F6FA 2W84A 5HDGA 1EH8A 4HYEA 4RB1A 1TNSA 5E1XA 1U5TB 4N9IA 3GZ5A 5L3BA 4LK1F 1T98A 4L9TA 2FU4A 3HSFA 2HYGD 5FFZA 2ZCWA 3P7NA 3I64A 4KIFA 3ISPA 1BI1A 2P8TA 1F5TA 2CGPA 2QQBA 2XIGA 2JSCA 4BHCA 2BV6A 4MEXF 2PI0A 1DPRA 1G3WA 1IXSB 3SZPA 2L54A 2GQQA 3R6SA 3G73A 2EWNA 1XDUA 2K4JA 3K2ZA 3U1DA 3CUQC 1T39A 3RKWA 1BIBA 5LGTA 5JR3A 1BC7C 5E8IA 2P6TA 1ZG1A 1G4DA 3Q9VA 3HRMA 1LDDA 3MQ0A 1HQCA 1ODDA 2FXAA 3VEPA 4CHUA 3DPTA 3WU1B 5ICEA 1V3FA 1Y0UA 5D6EA 3NEUA 4WX9A 3WTVC 5ICGA 1PP7U 4QLCU 5TRDA 1XGMA 4D0PA 1T0FA 2EV6A 4AIKA 1SMTA 3CO6C 1XGOA 3LA7A 3F8MA 1EH7A 3M1EA 5A2QK 3TO6A 2MH2A 1LEAA 2IVMA 1FYKA 2STWA 5LEKA 4A2UA 1I1GA 2BBYA 1O7FA 3M8FA 4U88A 4M6XA 4DNCA 2K5IA 1GVJA 3ZMVA 2Z9OA 4KMFA 1OR7A 2QQAA 1MD0A 1BC8C 2HWVA 3CO7C 3HHGA 5ICFA 1FP1D 2NRAC 2A07F 3ZMZA 1B1BA 2J5PA 3QPHA 2RDPA 3QPTA 4TV7A 3KP2A 5D5WB 1YFHA 1O3SA 3ABTA 1Z05A 3BWGA 4G9YA 4RGUA 2W25A 4HDUA 3RI4A 1ZRFA 2K5FA 2O8XA 3IHUA 2PMUA 4HF0A 1BIAA 1J0RA 2EFNA 3IKTA 4WF2A 4CXFA 3M7GA 2P5LC 2VBYA 3U9GA 3F8FA 3BOQA 1USSA 2BYVE 5D4SA 3QRFF 2PN6A 1K79A 3F3XA 4ASNA 1XGSA 3MAJA 3E19A 2OAZA 4GGGA 3V7SA 3JAMZ 1HKTA 4RGRA 2ISYA 4KN4X 1U5TA 1Q1HA 2GXGA 2HS5A 3HTUA 4A12A 5K1YA 4IRIA 2KRFA 4L5JA 1QNTA 3SXYA 3J7AO 2HZTA 5AIPA 5FD5A 2K4YA 2E7WA 3HYIA 4K2EA 1LVAA 2XKPA 1RNLA 5LRSA 3E5XA 2V1XA 1ZGAA 5BPIA 1DDNA 3M9AA 1D8KA 1ZAOA 1LNWA 2H3JA 2DBBA 2L02A 2MBFA 3IC7A 2FBKA 3O2PE 4XSXF 5E20A 2HTJA 2EJRA 4E70A 4O5VA 4GXOA 2H6BA 3Q9SA 2GIVA 5ILVA 1HSTA 4IRHA 1UHMA 5CYVA 3VODA 1J59A 3GFLA 3TKYA 2FMYA 1JHFA 1WI9A 3KEOA 2K4BA 1ZARA 1QZZA 4Y15A 4HAMA 2UXNA 4KNYA 4FHTA 1AOYA 3GUDA 4A0XA 4I09A 2HKXA 4LMYA 3S2WA 4LGWA 1KU3A 1B9MA 2VXZA 2P6SA 3FZVA 5IT3A 1HW5A 4KMUX 2UWMA 3ZMDA 3MWMA 2ZBKA 4O6JA 3LAPA 2P5VA 3JAMK 5D8LB 3COAC 4BXUA 4HLYA 2XROA 1SD7A 2YSRA 1IRGA 2DAOA 4ZYEA 3EDPA 2XAQA 1FT9A 1TNTA 4HF1A 5FLXK 4ZYGA 1U5TC 1DP7P 2TDXA 4AIJA 4CDGA 2L01A 2EB7A 1TTYA 2D1HA 5CVUA 2F2EA 2LNBA 3WTSC 1IF1A 3GVAA 4UVCA 1XCVA 3I5UA 1R1TA 2XAJA 2CSOA 3I4PA 2K27A 2ELHA 2A68F 3QU3A 1JHHA 1P2FA 2BGCA 1W7PB 4L9NA 3ZPLA 1HSJA 3SHFA 1FC3A 4XLNF 2DW4A 4RAZA 4YFNF 4G7HF 4YFXF 4H0EA 2FEZA 2HKOA 3MCZA 1U2WA 2OZ6A 4A5MA 3SQNA 5KK1A 1W7PA 2K86A 2CQKA 2ISZA 4U7DA 1TBXA 2P7CB 2XUBA 3KZYA 3E3VA 5D8KB 3E6BA 1XSXA 5ED4A 2RGVA 1VTNC 2RKHA 2DFIA 1I27A 1I6XA 3ML6A 3IWZA 4WXCA 4I2OA 2EV0A 2VE9A 3L00A 1YS7A 1QO0D 3VFZA 1FYMA 3JTHA 4B8XA 1E2XA 2COMA 2VONA 2IT0A 2LSOA 3H92A 3ROUA 1H9TA 4IXAA 2F5CA 1MDMB 1XSVA 2A5YB 3KP3A 3R60A 5LEJA 5LGUA 1T2KA 1LDKB 1J5YA 3L09A 3W6KB 4G6DA 2KKOA 2VBZA 5ERIA 3ZQ7A 1Z6TA 1E17A 2WWYA 1S29A 5EEHA 1XGNA 2XKOA 3T0YA 3V7RA 1RUOA 1ON1A 4G8XA 4L9JA 1KU7A 5DD4A 3ELKA 1ZGJA 1P6RA 5FO5A 5AONA 2IA2A 2QZ8A 2ZNZA 5DDGA 3RDIA 3W6JB 4LB6B 3CDHA 2A6EF 1FBQA 3L9FA 2HQRA 4AVPA 1ZLKA 2PBIA 3CTAA 4EM1A 4CICA 2FNAA 5AIQA 1S8NA 3V8LA 1OMIA 2CW0F 2A61A 4FT8A 4M9SA 2GXBA 2LX9A 3E97A 1S6LA 2OD5A 4BHBA 1B59A 3ZN0A 1V4RA 5CJ9A 3HSRA 4I02A 1ZRDA 2QM3A 2PFBA 2LDUA 2D45A 3E6DA 2QENA 1R5GA 2YPRA 5H6RA 1ZH5A 3ABUA 1WRJA 2ACJA 5BMZA 3HIFA 4JBAA 2P4WA 5L3FA 3BJ6A 1IN7A 3HRUA 2FNPA 4HQMA 3MEXA 4LJZF 1D5VA 3EQLF 1KGSA 4NB5A 2RV8A 3F22A 1FNNA 1BI0A 5L3DA 2O3FA 1MDMA 4Q5SF 3JSOA 2A6HF 1XN7A 1R22A 2A69F 5E8GA 5JFRA 4IHTA 2PJPA 2Y48A 4ON0A 1P4AA 3I58A 4WXHA 3IRRA 3TQNA 4UUVA 2OA4A 2BE5F 3JW4A 2H27A 1KQ9A 2IRFG 3RPUA 1A04A 1Z9CA 5L3EA 3BPXA 5HS7A 3DEUA 4CO8A 3KP7A 2G7HA 1IN8A 4KICA 4HQEA 4Y13A 2DLLA 4KUMA 1OYWA 3MHXA 4EMSA 2EFOA 3BP8A 4ESFA 4XSZF 5BS6A 3FXQA 4EVIA 3ZP5A 4PGGA 3DP7A 2XAFA 4LLGF 4YIIA 1ZG3A 2O6GE 2DK8A 4LLNA 3GEZA 4KT5C 2JRTA 1G3YA 4ESJA 3K0LA 3WTYC 1R36A 2G9WA 4EM2A 4M9ZA 2QBYA 3RKYA 1TLHB 1GXQA 2ADUA 2GA2A 5FD6A 3N4MA 1TW3A 1EH6A 2GCXA 3DV8A 3REOA 2HFHA 2B0LA 3OOPA 1QVPA 5LHIA 2XGXA 5CVJA 4IPAA 3B02A 3K1MA 3RJPA 2VT2A 3FM5A 4O3MA 3EYIA 4UVBA 4EJOA 3FX3A 3E5UA 1BI2A 4HA8A 3KP4A 2R3SA 1SMYF 3T8RA 1IZ1A 5D6FA 4LD5A 4XLPF 5DCFA 4ZZLA 4PCQA 1XD7A 1FPQA 2FOKA 4BH9A 2JPBA 1O3QA 5K5QA 3J80K 5D5VB 3SZTA 3TOAA 1K78B 2VC1A 4YIFA 1J7KA 1DUXC 1XMAA 1SAXA 4OIOF 3WTTC 1Z7UA 4EJVA 5LHGA 4FX0A 1QW1A 3QAHA 1WKMA 3DQVC 4G6QA 1IN5A 3ZMUA 3IL2A 2FMLA 1UCRA 1U3EM 3LA2A 4HDVA 5HLHA 1STZA 5J6XA 4OIPF 3ZN1A 4AWXB 2VODA 1FWZA 4IJAA 3K1PA 1LQ1A 4JK1X 4L0YB 1O57A 1W7PD 2DQLA 1OYYA 1QZYA 1QPMA 2P5KA 4U0WA 3WGHA 2MA3A 5DD8A 3ZMSA 3RTRA 2Z5UA 3LA3A 2AXLA 4N0BA 4ESBA 4PDKA 3CUOA 4PGHA 5DCMA 4MTEA 2EFPA 3FF5A 1SFEA 3I71A 3GFJA 2FA5A 3DPLC 4LLLA 1ZG5A 2E1CA 2YX7A 2V1DA 1G3SA 4M6YA 5BPDA 1G6NA 1YW8A 3JSPA 2K7LA 4B09A 4AIHA 4KN7X 1HW1A 4BNCA 4ZYHA 4LG0B 2L3DA 1B9NA 1FP2A 3WTWC 6PAXA 3GFMA 4KIBA 3T1BA 4RAYA 1YTYA 2DU9A 4Q4ZF 4IRGA 3F6OA 1JXSA 2DO7A 1FOKA 1WSUA 4OINF 3HRSA 5F1RA 4UVAA 3JTGA 5E1ZB 2EV5A 3U2RA 3HOSA 4KYWA 4N9HA 1OYIA 2V1UA 1I5ZA 1P4WA 2D1VA 4OU0A 4A5NA 2O0YA 4ENKA 3AAFA 3KZZA 2MD5A 3J80Z 2R7DA 2MLKA 2Q2EA 3GO5A 1JGSA 2F5EA 3I59B 1ZYRF 3F8CA 2E1NA 3RPQA 3F8NA 4ENMA 1K78A 1DPUA 3I54A 3NQOA 5TJJA 1KYWA 3R0AA 1U78A 2UXXA 4RB3C 3I53A 3D0SA 2IPQX 4M73A 2KIFA 2V79A 4HOBA 1KYZA 2WC2A 2PMHA 4CZZA 2M30A 4WXDA 1XMKA 2W24A 1IUYA 2DTRA 1LJ9A 1OKRA 4HZFA 2C6YA 3O3KA 2EA4A 3DF8A 3ULQB 2YX4A 2DT5A 5D5UB 2ZMEB 3C3WA 1F4KA 4RGSA 1PDNC 3WGGA 4IVNA 2XV4S 5H20A 4PZJA 5LBQA 1HKSA 4U0VA 2JT1A 3BJAA 4XRFA 3NRVA 4HV5A 5JHUA 1XB4A 3RYRA 3B73A 1D8JA 1L3LA 3D5LA 1C0WA 1B6AA 2VBWA 5BOXA 1IN6A 2IA0A 2M87A 4EV0A 5K5RA 3BJOA 3MZHA 2FF4A 3VB2A 3MFKA 4P9FA 1W4MA 1MKMA 1KU9A 1ONVA 5D4RA 2M45A 5HS9A 4NQWA 2PG4A 4Y17A 2E7XA 2QYOA 3N97A 3J81K 3KETA 3BPVA 3ERED 4Q48A 3WTUC 1S7AA 3KCCA 1BJAA 2FRHA 2UZKA 3WG9A 5E17F 1F1ZA 4HX8A 3RKXA 4AD9A 1REPC 1R00A 3HTSB 5HVQC 1BYMA 3V7CA 4MGRA 4F7ZA 2RN7A 1U8RA 4S05A 3RYPA 5A2QZ 3H3UA 4A6EA 3P9CA 3WTXC 3SFZA 1LB2A 5LLQA 4OMZA 3V8KA 2FBHA 1IAWA 1FY7A 2RNJA 3K1NA 3RIRA 5H6QA 1HKQA 1EV7A 1RI7A 3BDDA 3IRQA 5HDNA 2IA1A 1Z91A 3BROA 2ZJ2A 2PEXA 1QBJA 1JE8A 3P9IA 3GW2A 2WV0A 3GWZA 1BI3A 2H94A 2HDCA 4P9UA 2GAUA 2GA1A 3IWFA 4HX4A 4UV8A 4EJWA 2F5DA 2PLYA 5D5XB 2FE3A 2M5WA 2L4MA 1BOAA 1CF7A 2K5LA 1LEBA 2KJCA 3GF2A 1FYLA 1IN4A 2Y75A 4I0AA 5E18F 1K7AA 1GHCA 1MJ9A 4EGZA 1S7OA 2P7VB 4R8HA 1IXRC 4UXNA 2OQGA 1UFMA 4JQFA 2CWEA 3PQKA 2LKPA 4KDPA 3C7JA 1H9GA 4Z2YA 2JPCA 5HLIA 5L3CA 2O03A 2CFXA 2IW5A 4M72A 3GYHX 1R5HA 3L7WA 4P96A 1X3UA 3G3ZA 4M74A 4P55A 2G7UA 3DKWA 1W5TA 4G94A 1O3RA 1J9IA 2RC4A 3DFGA 1YQAA 2KJBA 4WWCA 4MTDA 1ULYA 1PP8F 2W85A 4UV9A 4YG2F 5CVRA 3CUQA 5ILUA 1MJBA 3J81Z 3CJNA 3LQRA 2NNNA 2R7FA 4YFKF 2FQ3A 1ZRCA 4GCVA 3WE2A 2F5FA 4CYDA 2MC3A 1T6SA 2W57A 1BBYA 3F6VA 4LG0A 3F72A 5F64A 2ZMEA 5FFXA 4IHSA 1KQ8A 1RZ4A 3GFIA 3L2CA 1TQPA 2Z99A 2V6CA 5HS8A 1ON2A 1XSDA 3FMSA 2VN2A 3E6CC 2DPDA 3CLOA 4QWQA 2FBIA 5DYMA 4KFCA 5HOOA 2AS5F 4R79A 3QP6A 2VC0A 1H0MA 1OPCA 2EA2A 5JVTA 4I01A 3V8JA 4EM0B 4BYYA 2NS0A 2NNYA 3LWFA 2J5OA 3IKVA 1YW7A 2KIUA 1FX7A 1T38A 2H09A 1FBSA 1J75A 2M1BA 3PQJA 1USTA 3HSEA 5IT9K 3FMQA 2Q0OA 1B4AA 2O61A 3ZMTA 5E1WA 4ZYDA 3EUHA 3HUGA 1YG2A 3MZYA 5DEQA 1KQ0A 4UNOA 5LRRA 1UB9A 2NYXA 4EGYA 1FLIA 1Z1DA 3K9TA 2OZUA 3KEQA 2RVCA 3TDUC 1P4XA 1R1UA 4IF4A 4ENNA 4HV6A 2VE8A 2ETHA 5FLXZ 4HLXA 1O3TA 3WGIA 4ENJA 3DXJF 3OV8A 5DUIA 3I59A 5FGMA 5CVIA 2STTA 1MGTA 3EYYA 3F8BA 4U7BA 2GZWA 4LFUA 1HW2A 1O7LA 4L9VA 2JTVA 2NAZA 2D2WA 3HOTA 4I98B 1FSHA 2OBPA 4HW0A 3P9KA 3KLNA 4GYIA 4MQ9F 1L0OC 1ZHFA 4I7HA 2VOPA 3O6BB 3WE3A 4A0YA 2OQRA 4DQ2A 4RB2C 3FM3A 1YW9A 2KIMA 4KIGA 2QVOA 4S04A 2LF7A 4RGXA 1R1VA 1R58A 2ZNYA 2HGCA 4ZH4F 4LK0F 1WWXA 4MEYF 3KE2A 2HQNA 3GXOA 3LSTA 5DCMB 4R1HA 2L4AA 2CYYA 4GO1A 2ESNA 3TO9A 2HTSA 2A3SA 4OOIA 2VT3A 1KA8A 4RB0A 1R23A 1D3YA 3HHHA 4MNUA 3ECOA 2QQ9A 3KLOA 1MJAA 3KFWX 2H6CA 1ZN2A 4ETSA 1RUNA 5ILSA 1S3JA 1YYVA 4M71A 4G7ZF 3Q5FA 1FZPB 1LDJA 3R4KA 1GXPA 2V9VA 1YIOA 4OIRF 1XCBA 3C18A 2HEOA
chains in the Genus database with same CATH superfamily
1SANA 3E7LA 3FXRA 1FMVA 2J6OA 1VQ7A 2K9QA 3TGNA 2G3RA 4C3HJ 2EJFA 1XDSA 3CP2A 2C0TA 1HDPA 3RERA 2X0LA 3ZEHA 4EQQA 5GAN5 4OIQF 3H35A 1AWCA 1YHQA 2CP3A 2QSFX 2XKOC 3JB9I 5EEGA 3KP5A 2LG4A 1W0TA 3JCMg 1WJQA 3WTZA 3GMEA 1K9AA 1OCTC 2L9NA 2MH9A 1JGGA 5TISC 3NAUA 4R0KA 1U9OA 3NWTA 1V1CA 4TVRA 4CCOA 5BNGA 4LB5A 2VXDA 2JUGA 2VOOA 4OMYA 1WI7A 4XORA 5HODA 1YI2I 2QTXA 4OMQA 3VSKA 4M7DG 2DQRA 4MQVA 2Z3YA 3DU5A 1JJ2P 1NLOC 1X1AA 5GAGJ 4PJOG 2NUPA 5FKMA 5HCKA 3ZL7C 3SEZA 3CC7A 4P5OA 4Y4RA 2HXIA 1PNJA 4XU2A 4ZZDA 4RTWA 5JI6A 4XM3A 2HR3A 2F1LA 3I56T 1TQIA 3CCVQ 4YELA 5FB2A 3MKWB 1SPKA 3CPFA 1U6GA 2ZC2A 1J09A 5KVRA 3GZ6A 1H641 3A5ZB 1KONA 4M77E 2A05A 4XLEA 3LNQA 2GM4A 3E6MA 1I1SA 1GCQA 2WV1A 4M75E 1BN5A 3DTKA 2LOOA 1MIJA 4RAFA 1UAAA 1OZ3A 2EFWA 3NMZC 5M9OA 4RS8A 2Z0WA 2DL5A 1NHAA 3MO8A 3JRBA 2JW4A 3A03A 4HX7A 1JJ2A 4LDXA 2EQRA 5ICCA 4UUSA 3PT9A 4QQ6A 2HL3A 3VJPA 4AG2C 3CMAT 1YO5C 3QU6A 1HSQA 1M90R 1P92A 1ZREA 5FJ8J 1MHNA 4G6TB 2GWRA 4FSSA 1VQKT 4FX4A 1D0XA 3KP6A 3CCLQ 4A3FJ 3J7AY 4EMHA 5LHHA 3I0TA 1XQHA 2BHYA 4JP0A 1JKRC 4FU6A 1W5SA 1YWOA 1W6XA 1NK2P 4EJTA 2DRKA 2XAHA 2DPUA 4BAYA 2DJNA 2FL7A 4ZN1A 2N8GA 2Y0MA 4E2FB 2DYRH 3VPRA 3F23A 4LDWA 3SDGA 1B72A 3M8EA 1E0EA 5J8CA 4M9XA 3DU6A 4UUTA 4GYGA 2RB6A 4ZDOA 5DUKA 2XGEA 3R61A 1NE8A 1PRLC 2MOXA 5GANj 2PQ8A 3DBHB 3H9JA 5HNFA 5FLVA 4FYYB 4WTOB 1UHWA 3CCEQ 3TOBA 2GLOA 3VU3C 3HRTA 2YHTA 1RETA 3FBNB 2KZVA 4L0ZB 2A28A 2OTLA 1SD6A 2E1HA 1VQ6Q 1QMCA 2KISA 3G71I 1IW7F 2HQHA 1UHFA 1ABQA 2CYZB 2CH0A 1TW2A 1NG2A 1OU8A 1R7JA 4N0AA 3PL8A 3GX4X 3DTEA 2DI3A 5F0CA 2R7TA 1FSEA 4JZ4A 5GAN6 1IXCA 4XONA 2QWWA 3I55T 2BOLA 2VUMJ 5L23A 5J3LA 4ZGJB 3VRZA 3VUBA 2CO5A 3QP5A 2ECCA 4NC8A 4PJ0C 2QBYB 4V2FA 1GDTA 1VQLQ 6AT1B 2Z33A 2IP2A 2ZFWA 2HOEA 3LQQA 1YRNB 2WSEE 2DK5A 4RLFA 1TWAJ 4BUPA 2D5VA 2E64A 4GLKA 1SFKA 2R7QA 1Q81U 3BY6A 4WCGA 4N4NB 1YJ9T 1M1EB 2DA2A 2EINH 4NHJA 5CKFA 2K3PA 3BZ6A 3D5RC 2BW3B 1H88C 4L18B 1AHJB 4KH1B 5JLWA 1ZLJA 1PD0A 4Q47A 4U0YA 2ZO4A 3WODF 1WQWA 3LFKA 1F9NA 2R7ZJ 2V1QA 1VQOA 2BZTA 3BC8A 1J2XA 3L2QA 3WU0A 1KC8R 2IJLA 3GNGA 4FYXB 5CVVA 4XAXB 2BEOA 1WHKA 5IAYA 1FOXA 4DZJA 2EFIA 1VQOI 2L9VA 3HOYJ 1Z6RA 2E4HA 2XC7A 2KYMA 2CS7A 1H8AC 1AA7A 3VRYA 2W0ZA 4PSXA 2Y9YA 2XVCA 3DEWA 2X98A 1D09B 4IUUA 4RKUE 4J6XA 4G7OF 3C4SA 1ZR4A 3V4GA 5GAN8 1A36A 4JJBA 3CCLA 4GRIA 3F21A 4ZGDB 3VOEA 3FHZA 2RI5A 4ESRA 5L3GA 2RQPA 2QA4T 3FXUA 1QWFA 2HCKA 2OTJA 4MHGA 1B7TA 3LSJA 2E5NA 3TDZC 5HLTA 3RPUD 2TRTA 4LITA 1SRMA 2LKSA 3OB9A 4NS5A 3OYDA 4KA4A 1I81A 3TO7A 2DFUA 4I0BA 3CCUT 4M7DB 1N78A 3QYHB 2FPDA 3PUFA 4EJUA 2IG0A 2QEXT 2CP6A 1QQIA 1SFUA 5CLSA 3H0DA 3OSFA 3W6VA 2X4WA 5IPAA 2ZPGB 2EFQA 3K4CA 3OYHA 4HBLA 2XHKA 4I76A 5HDKA 2EW3A 2RHYA 4UHTA 5GMKl 1YLFA 1WJ5A 5A2QE 1MH3A 4JX4A 2LLKA 2FJ1A 2BW3A 1C6VX 4J9DA 1T33A 5HLGA 2M8GX 2X4HA 1BR2A 3BG3A 3HPHA 3K4KA 1QVUA 3FXOA 1VQKI 3PIPA 3M4YA 4ZYAA 1GV5A 1SD4A 2XASA 4XBFA 5K7HA 4RCBA 4F7UE 5BQTA 2YUOA 1S9HA 1JB0E 2XRNA 2K6DA 3CUQB 3RR6A 3T5XA 1SD5A 2FD5A 2ZKZA 2E2JJ 3C1DA 1CF7B 1DQUA 1UG1A 3OYBA 2A37A 3M53A 4M78G 1M8VA 4C0GA 3OR1C 2O01E 3VWBA 3TSZA 3M9QA 5K5OA 1TT0A 1AZGB 3U21A 4IUVA 3H3ZA 2R7XA 5CCAA 4A6DA 4A93J 4PFOA 1CQTA 1PUEE 1EJ9A 3EG1A 1BM9A 2QDYB 3CCET 1NPRA 2M02A 2KRMA 3EGXA 2FSWA 2M8EA 4C8QB 3AT1B 2QLZA 4IOAF 5HY6A 3X25B 5GAOr 4M7DA 4QQDA 1XJWB 5FKKA 3RESA 1YS6A 1ORKA 1X27A 3ECHA 2W7NA 1Z77A 3PJRA 3INZA 2DNUA 2LF8A 2QI2A 4L5GA 1UZCA 2VBXA 2YU3A 1Z3XA 3GLXA 4AT1B 2ZXJA 5KCHA 4C0DB 3TVTA 1FIPA 2VPRA 4EDUA 2M16A 1U06A 4XRSA 2AKKA 3CCSA 3ABMH 5IT9Z 4J9EA 4S0HB 3DPUA 5J39A 2QUFA 1QRYA 2CUBA 2QQRA 2OU2A 4M7AA 2L7FP 3H0HA 2K02A 3U23A 1IRFA 1SFXA 4JOMA 3FWEA 2FYKA 4EIKA 3DBRB 4DW6A 4QW2A 1ZBJA 2VKNA 1TQMA 3M0SA 3FMRA 3R0JA 5J8FA 2O8KA 4BQAA 1H89C 3T8TA 4Y3OA 4JJCA 3SEMA 4Y33A 4BHPA 4C3JJ 1RIOH 1X69A 4KUIA 2LY1A 4ORZA 2CG4A 2HYFA 1SEUA 2D8JA 2YLCA 3NTIA 5CIUA 1MZBA 4CGZA 4FCYA 2DKGA 3E5QA 3QYBA 2RJCA 5E3NA 2YR2A 4E7ZA 2HMAA 2RQWA 2XAGA 1KU2A 4QPOA 5FROA 2QTVA 5DM6F 1X1PA 2VB6A 4LD9K 2HAXA 2WTEA 4CCJA 3M5AA 1FBUA 4L5IA 4HF2A 1I4K1 2KDSA 1K6OA 2JZYA 1W2BS 1R6RA 2QKLB 2JA5J 2O31A 2VI6A 2NOJB 3C0CA 3S8PA 3UT1A 1WXUA 2CZ6B 2COBA 3G4SI 1TWGJ 5E79C 5EG2A 3M4GA 3ZR8X 1HXDA 9ANTA 1WNLA 3R6OA 3CCQT 1TS9A 1QHGA 2H1LA 1JJ2S 1VQ8Q 4PJLA 1D1AA 5KYUB 1IGNA 4M7DE 1ZUKA 4M7DD 2YT6A 2EK5A 3LAJA 5EJCA 4F04B 5DV5A 2DJZA 2MLGA 4A0ZA 3FDYA 3QOPA 4E7SA 1QGPA 5LGNA 3SWNB 1CGPA 2Q8KA 4IEJA 3BG9A 2VKEA 1WQ2A 2QSGX 3K69A 3EETA 3TP3A 1D5YA 1UJ0A 2ESHA 2VQHA 4XU1A 1G3TA 5GMKe 1HBXG 2LCCA 4WK8F 4M75A 3W2VA 1LNXA 5E3MA 4RTVA 5CQYA 4NQWB 3PFIA 5F6FA 2W84A 2V4JC 4KT0E 4A69C 3OSGA 2BY2A 2EGCA 1PCXA 5HDGA 4HRIA 2Y90A 1VI0A 1VZ0A 3OS1A 1M4ZA 2KY9A 2OTLT 1EH8A 3OWTA 2XMFA 1LKXA 3JB9F 4HYEA 2D8HA 3JV3A 3G6EQ 4RB1A 1QCFA 4XLAA 2F48A 1TNSA 3AG4H 1TZLA 1TL8A 2ROLA 5LJ5d 1VQ4A 5E1XA 1U5TB 1SG5A 1ZHIA 2LNHB 3A8OB 4N9IA 3GZ5A 5L3BA 2ELKA 2HBWA 3X26B 5C44J 2OI3A 2LMDA 3ASKA 4LK1F 4UUSB 4KGZB 1M2OA 2CQ7A 5IYCJ 2EBIA 2LY9A 3GIBA 3VYGA 1T98A 1CSKA 2DTIA 3BTLA 4CI0C 2AO9A 2WADA 4L9TA 2FU4A 3HSFA 3CDIA 2HYGD 5FFZA 2CP7A 2UUZA 1D0YA 1FXXA 2ZCWA 1I0CA 3WHBA 3P7NA 2RN8A 3W2WA 3I64A 1VQLT 3H1CA 2YUQA 2WAEA 3ISPA 4KIFA 1X4PA 1GBQA 3DCFA 1BI1A 5IXFA 2AZVA 2P8TA 4LG3A 4XKCA 1F5TA 2CGPA 1QQJA 5K7FA 2QQBA 1SF9A 4LUEA 3Q3SA 1XPXA 1RABB 5GAN3 4OVAA 2XIGA 4H4KC 1WJDA 1K4US 2JSCA 4BHCA 2BV6A 4MEXF 2PI0A 1DPRA 1G3WA 1IXSB 2R5ZA 2ESWA 4Q5WA 3I55I 4WCIA 3SZPA 4ZDPA 3A01B 2E3HA 2L54A 4BB7A 5GAMg 1JXOA 2GQQA 3R6SA 3OYGA 2EWNA 3G73A 4KISA 1SRLA 1AT1B 1WQ7A 1XDUA 2K4JA 1QP3A 3K2ZA 3S93A 3TSWA 3KYCB 3LMMA 3EG9B 3U1DA 3CUQC 2K85A 1T39A 3RKWA 5FRMA 4B4CA 4F16A 3LOCA 1AKHA 3CC4I 2JJ7A 3KX2A 4BGDA 2Z16A 1Z21A 4C92E 1BIBA 5LGTA 1B8IA 5IYBJ 5JR3A 1BC7C 1Y57A 2EPDA 2QKMB 5E8IA 2P6TA 1RAFB 3BCBA 2LNVA 2K3YA 3SDBA 1NK3P 1ZG1A 2C06A 2XAUA 1EIFA 1G4DA 3LW5E 3VS6A 1KD1R 3Q9VA 3HRMA 4AYBA 4HT9A 2J6KA 1LDDA 3MQ0A 3ZQGA 5IOZA 1HQCA 1VIFA 2J6FA 4NOYA 4D6WA 1ODDA 4QVZA 2FXAA 4UB6C 3VEPA 3UATA 3NTKA 4CHUA 3DPTA 1ZX6A 3OYJA 3WU1B 3S3NA 5ICEA 2FX0A 1U8BA 3OIOA 1V3FA 1O75A 2FPFA 1QVFP 1OOTA 1Y0UA 2ZSIB 5D6EA 3NEUA 1WJEA 4WX9A 5ICGA 3WTVC 5DM7R 2XIDA 5CK9A 2ME6A 1KQSA 1PP7U 4AIDA 2EIMH 2HI3A 2WY7Q 4HG2A 4QLCU 2V1NA 1XGMA 5TRDA 1H8KA 2YXYA 4D0PA 3OL3A 2K9SA 1K0XA 1RESA 1T0FA 1PUFB 2EV6A 1MV0B 2HSPA 4BI8B 2M2EA 3JAME 4AIKA 2F5KA 2FZKB 3VS0A 1VQ5A 2LBFA 2YS9A 3OYMA 1SMTA 5IHIA 3CO6C 1XGOA 3LA7A 4B48A 1X6OA 3F8MA 1MW7A 1VQOQ 1EH7A 2LJ3A 3M1EA 2L9SA 4P1WA 1QVFA 3BLYA 3FXLA 5A2QK 4DYCA 2QDLA 2M34A 1R77A 3TO6A 2MH2A 1LEAA 2LQKA 2LRQA 1SVMA 2IVMA 1FYKA 5CQEA 3PIPF 3HJEA 2STWA 3LSKA 3QPSA 4X1EA 5I2SA 3MEUA 5LEKA 4A2UA 3K10A 1I1GA 1YFNA 2BBYA 3Q1JA 4FM4B 1O7FA 3M8FA 2M35A 4HPQA 4U88A 4ELYC 1RAHB 4M6XA 1VYTA 3LLRA 3SD4A 1YJNT 4DNCA 5HK3A 1PC0A 1ERDA 4FE4A 2K5IA 1GVJA 2RJEA 4DGWB 5M3FJ 3ZMVA 1I1JA 2Z9OA 2EIKH 3JB9G 1UHCA 1QVGS 4KMFA 1OR7A 1VQ6I 2QQAA 3W3CA 2O9LA 3WVDB 1MD0A 3K6GA 1BC8C 3QDRB 5DTDA 3ZFJA 1VQMI 3JB9D 1GCPA 2DAQA 5GANg 4BQQA 2HWVA 3CO7C 2Y9ZA 3DLLF 5IYDJ 4BACA 1IDZA 2C0IA 3HHGA 1JJ8C 3CCJT 5ICFA 4E6RA 2OX7A 2R0QC 2MZ4A 1FP1D 1NJIR 3J7AF 3PNYA 1VQLI 4D8KA 3OYCA 1WHGA 3HHTB 4DYQA 3JRDA 2NRAC 1YI2A 1R5ID 3ZMZA 5J47A 2A07F 4N4HA 5CQXA 5EYRA 1B1BA 3OYEA 3U1KA 2D0QB 4B1RA 4BXFA 1ETWA 1UGQB 3HOUJ 2OAWA 4IX7A 2J5PA 3QPHA 2RDPA 1R49A 1KIKA 3SEQA 3QPTA 1DP3A 2IS4A 1K73U 4TV7A 2DXBA 5LFAA 2AKLA 2DDAA 1MUZA 3KP2A 5D5WB 3A1PA 5C0MA 3CCMT 1YFHA 1O3SA 2PQWA 2OC6A 3ER0A 2GIZA 1M27C 3MP8A 3ABTA 1Z05A 5KYYA 3BWGA 5EZGA 4FT2A 3A52A 3OL4A 3CC4T 1FMWA 4G9YA 3JAMR 2LY2A 1VQNA 2SEMA 2CREA 4RGUA 2W25A 4HDUA 3RI4A 3FDRA 1LFPA 3BT9A 2K40A 1ZRFA 1N27A 3OOUA 1HLVA 2K5FA 3SDZA 3AFHA 4Z89A 2O8XA 3BDLA 2PMUA 3IHUA 1TC3C 4F17A 3CCEA 4C5IA 2LH9A 4HF0A 1UG2A 2HXOA 2G6FX 1BIAA 2QGGA 1J0RA 1T8IA 2EFNA 3HPWA 2O7OA 2AHQA 1V55H 2FO0A 3JSCA 2XPUA 1VQ5Q 2K9LA 3IKTA 2BHZA 1Z9ZA 2JN0A 3M4OJ 4WF2A 4CXFA 1XOVA 3B6AA 4CCKA 2QEXA 2M4KA 3M7GA 3TEDA 2XRLA 2P5LC 1M8MA 2ZJQF 5CQGA 1BCOA 2VBYA 5LJ3h 4IHVA 3U9GA 5GPCA 3F8FA 5CKHA 1Y96A 1CKAA 5GAN7 3BOQA 3MZ8A 2E65A 1USSA 2BYVE 4E7IA 2P0TA 4M75C 2JRMA 4A3KJ 5D4SA 3QRFF 2PU9B 2YRDA 2PN6A 1FTTA 5FU6C 2YUPA 1I3QJ 2Y0SA 3F3XA 1K79A 3GBGA 4IHXA 3J7AW 4ASNA 1XGSA 2KMTA 3MAJA 3E19A 4QPQA 3X24B 2CQQA 3ZQHA 5M5WJ 3FXJA 3PVQA 2X6XA 1WCMJ 2OAZA 4GGGA 2DA5A 3SB2A 1D1BA 1KJWA 3FBIB 3V7SA 2MWPA 3HG9A 3M8JA 2LBFB 4RBOA 2VASA 1PSFA 3JAMZ 1HKTA 2KRSA 4AMCA 5K7ZA 1EA3A 3J81R 2KT1A 4QKUA 4RGRA 2D6FA 2K3BA 3SFMA 5LJ3d 2ISYA 1VA7A 1R4NB 4NL3A 2MC4A 2CJJA 2E5ZA 1U5TA 1Q1HA 2GXGA 2HS5A 3HTUA 4KN4X 4A12A 3EH1A 1QCNA 3FIFA 3G7ZA 4BY6B 1YIJT 1KQSP 2L2PA 4F3QA 5K1YA 4PJOF 2JM9A 2L7KA 2DXTA 2AXTC 4IRIA 1LVKA 2X6YA 2CH4W 2JS2A 2KRFA 4L5JA 4C8QD 1QNTA 3SXYA 4JLIA 2RHIA 3J7AO 2ZZDA 2HZTA 5AIPA 5FD5A 2K4YA 3L2UA 1AVZC 1FEXA 2DMUA 3UWNA 2E7WA 2HVSA 3HYIA 2PJRB 4C8QG 1GRIA 4K2EA 3GTLJ 3CCRT 5GTHC 4JX6A 1JEGA 1LVAA 2VJ4A 2XKPA 3F0CA 4C8QF 1YJWT 2I10A 2P4RA 1RNLA 5LRSA 3MEWA 2DA9A 3E5XA 2CUZA 2V1XA 3CZ6A 1VIEA 2GF7A 5I11A 1ZGAA 1S72Q 1A6QA 4PJOD 1G5VA 5BPIA 1DDNA 3IH4A 3Q0WA 3M9AA 1D8KA 1ZAOA 3QWLA 3GTKJ 2F2XA 4GLMA 1LNWA 1QVGP 2E60A 2H3JA 4A4KA 2DIQA 2DBBA 2DM1A 2L02A 2MBFA 3DKXA 4KITB 2OTLI 3IC7A 2JTMA 2FBKA 2MUNA 2ZPIB 5E3OA 3VS7A 3O2PE 1ENHA 2X85A 4XSXF 1AZEA 4C0ZA 1DGRM 3H9GA 3HBLA 3N05A 5E20A 1GT0C 1QHHD 4RLQA 3OYIA 2HTJA 2AZSA 1I39A 4MMLA 2EJRA 4E70A 2OAUA 1WJCA 4XK4A 4HT8A 2LR8A 4O5VA 4ABZA 4GXOA 4B44A 2IEKA 2LD5A 2EZHA 2JUFA 2H6BA 2VGMA 5CR2A 3Q9SA 4UB8C 4QVDA 2HYJA 2GIVA 5ILVA 1VQ9I 1HSTA 4IRHA 2ID3A 1IRXA 1WPKA 5JHFA 1FMKA 1PVEA 1UHMA 5CYVA 1JO8A 2XHCA 4JRIA 3VODA 4XTVA 4HCCA 2L3RA 1VUBA 2VQGA 3TMOA 2XB0X 2B63J 1J59A 3G1JA 1RLPC 1UGPB 2VV5A 2VL8A 1K76A 3GFLA 2K2VA 3TKYA 3RDVA 1XC5A 2E71A 2FMYA 3FKJA 3X28B 4KH0B 4MZTA 1JHFA 1WI9A 4E4HA 1QVTA 2ED0A 2AQFA 2QG9B 3KEOA 2HZYA 3M58A 4XTUA 8ATCB 1K4SA 2K4BA 3C2GA 2NVTJ 1ZARA 4LDUA 5FWCA 2YU9J 2VJIA 4J9FA 2AT1B 4PFZA 1ARKA 1QZZA 3CP8A 4Y15A 1RQ6A 1WHLA 1Q7YR 2CT4A 1IHWA 4HAMA 1AD5A 1X19A 1IUFA 2UXNA 4KNYA 1ZK8A 4FHTA 1AOYA 1XTDA 2JXBA 3GUDA 1M90C 1ETYA 4A0XA 2VXEA 4II2A 2PUKB 4I09A 4EPCA 2HKXA 4DIQA 2MVTA 3S2HJ 2DILA 4LMYA 2HKNA 2COYA 3S2WA 3VYHB 4LGWA 1KU3A 1B9MA 2VXZA 2X48A 4FL6A 4C5GA 4FISA 2P6SA 3FZVA 5IT3A 3UA7A 1HW5A 3G2BA 4KMUX 3HL2A 2UWMA 3ZMDA 1X01A 4OB1B 4OWRB 2KROA 3HUGB 3MWMA 1A35A 2ZBKA 1IREB 1GXIE 4JJNK 4O6JA 2V9KA 2XK0A 3OMYA 2DMTA 1XNIA 1SHFA 3HEFA 3LAPA 1VNDA 1CKBA 2OCEA 1MMSA 1S72T 2P5VA 5DLOA 5GTIC 2K9MA 3JAMK 1WXBA 2FVUA 3HP9A 3M0QA 5LD2C 3CCJA 2ELJA 5D8LB 2H8WA 2EKOA 3CCUA 4PJOC 3COAC 4A3JJ 3QYFA 4BXUA 2LQWA 5LJ3e 4M7DC 1IXDA 4U87A 2NWMA 4HLYA 4OAZA 1W36C 2XROA 1SD7A 1WX6A 3MEVA 2DERA 5J1UA 2FZCB 2DX1A 2JZ2A 2KQRA 1WGSA 2YSRA 3TBIA 4Y92A 4NDLA 1WZ2A 1IRGA 2DAOA 4IZZA 1RI9A 2FRWA 1OCZH 4ZYEA 3EDPA 2XAQA 2EIFA 1N25A 2ZB9A 3OW2S 3LH0A 1FT9A 3QJ6A 1AEYA 1FJLA 1TNTA 2YLBA 4HF1A 5CKBA 5FLXK 2PVOB 5GJWB 1NH3A 1Q86U 5J1YA 3GTMJ 4ZYGA 2PX9A 3HFNA 1U5TC 2MG4A 3CC4Q 1DP7P 2TDXA 4AM3A 3CMEA 5KYXB 4AIJA 2AQEA 1YJ9Q 4CDGA 2L01A 1WZOA 1VQMQ 4EATA 3MP1A 1VOMA 4J9HA 2R5MA 3CCUI 1TTYA 2EB7A 2D1HA 5CVUA 2F2EA 2LNBA 4F52A 2X51A 2B9SA 3WTSC 1IF1A 1NLPC 1RAEB 3OYYA 3G6EA 1TUDA 4IUQA 2IGOA 3GVAA 4UVCA 3CCRA 4J83A 2MCNA 1XCVA 2LVSA 3I5UA 5EG0A 3ZQIA 1GVDA 1R1TA 1IHVA 2XAJA 3BR2A 4OAYA 4ANJA 2F2WA 2KBTA 2VC8A 4N4GA 5KAFC 5I2MA 1YJWA 1VQ9Q 2CSOA 2R93J 4XMYA 4RTXA 2H8RA 5KNLA 1B3QA 4XNFA 2RNGA 2PMZA 2K27A 3I4PA 2ELHA 3GTOJ 2QGUA 2A68F 2KRNA 4ME7A 4A4GA 3QU3A 4BU2A 1PKTA 2GQIA 3KUFA 1Q7YU 1JHHA 1P2FA 1V29B 1W7PB 2BGCA 4L9NA 3ZPLA 4J19A 1U5SA 2QA4I 5LJ5e 1HSJA 2OJ2A 3SHFA 1FC3A 2HL5C 3FHNA 4XLNF 2DW4A 4LUDA 3I56A 2BKDN 4RAZA 4YFNF 1ZA1B 2QA4A 2OTJQ 3E9GA 4G7HF 3C12A 1ITYA 2RQTA 3MKYB 3CQTA 4HNVA 4A4FA 4GY5A 2AIRB 2R7VA 2XI9A 5DY9A 1IC8A 3BTIA 2OCCH 4YFXF 1AWJA 5F08A 4H0EA 1I5OB 1B07A 2FEZA 4DOVA 4BI4A 4J9GA 2HKOA 3MCZA 3PNVA 3HC7A 1EFNA 1T3SA 2FB7A 3PFSA 3VUZA 3JCMW 1U2WA 5CO7A 2OZ6A 4A5MA 2CDTA 3SQNA 5KK1A 1W7PA 2K86A 4MDWA 1X43A 4D8DA 3CMAI 2CQKA 2NUTB 2ISZA 2V6EA 4U7DA 2QYZA 1UE9A 1TBXA 2Z2SB 4XKVA 2P7CB 4NL2A 2XUBA 2E2IJ 3KZYA 4A3CJ 2K9GA 5GAMf 3E3VA 5D8KB 3E6BA 1XSXA 4NUBA 1WJSA 2YDLA 5ED4A 4FW2A 1LPLA 2RGVA 2JWTA 1ZTRA 2IS1A 1VTNC 1DJ7B 3NPFA 2XDBA 2DCEA 1PG5B 2E5QA 2G0EA 1TU0B 3M0UA 1QLYA 4DEXA 1SFOJ 4OB2B 3DLAA 5GMKi 3CD6A 2RKHA 2L7MP 2DFIA 2HNHA 2V1RA 1NYFA 3H5AA 1BR4A 2DJQA 1I27A 2NVYJ 3CCJI 2EILH 4PJNA 2DBKA 3DEEA 3VKIA 4A4EA 1XG1A 3N5BB 3EPZA 2XU8A 1I6XA 1KQ1A 3G71Q 2DDBA 3ML6A 1HCRA 3IWZA 1M2VB 3M54A 1HC8A 4WXCA 1ABOA 3FRNA 3HM5A 3CDLA 2JTFA 3LWHA 2A7YA 4I2OA 2EV0A 2VE9A 5CKEA 3WG7H 4CSWA 4X0GA 2BZ8A 3A4CA 1WFWA 2VYTA 1MBHA 3PGGA 1KFZA 2FHDA 4ZNXA 3L00A 1VQKQ 3AHUA 1YS7A 1QO0D 1UJ8A 3VFZA 1FYMA 3NFCA 3JTHA 4B8XA 4AFQC 1YJ9A 2WY8Q 1E2XA 2W1OA 2COMA 2GBYA 3Q0VA 4L5EA 1JUMA 4M3DA 4C2UA 3GZNB 1YIJI 2VONA 3RZOJ 3CCQI 2LSOA 2IT0A 1K1ZA 2CP0A 1YITQ 1TT5B 4PNOA 3JCMd 3H92A 3ROUA 1D1CA 1BBZA 2EYYA 2VJ5A 2DA3A 4D7MA 1BCMA 3TCJA 4JRQA 1H9TA 2GBQA 3I55Q 4IXAA 1M1GA 1M3BA 2KQWA 2E36A 5F0FA 3PUBA 2HDAA 4V2SA 2F5CA 2BVLA 1MMGA 2Q2EB 2HDWA 3CCRI 1VFCA 1MDMB 3R6NA 4JS5A 3JRGA 3ZRGA 1XSVA 4M75G 2A5YB 2LDMA 2DOFA 3KP3A 3R60A 3OIPA 5KCMA 4DOWA 5LEJA 5FU7C 4M7AD 1U1SA 3IAM2 5LGUA 1T2KA 2WA0A 4LNPA 1W2BP 1LDKB 1J5YA 1FOWA 5B1AH 1EF4A 4Y28E 3L09A 3W6KB 3SFIA 4G6DA 3D7SB 1MMAA 4IHYA 5ECAA 2KKOA 2VBZA 5ERIA 3ZQ7A 1Z6TA 1WA7A 5GAMh 1M3CA 2PMZN 3URGA 2DXIA 1E17A 2GGRA 3GF5A 3S6WA 2WWYA 1S29A 3D1NI 3M0RA 2EZKA 5EEHA 3PSFA 1D3BA 4J6YA 2ATCB 1XGNA 2XKOA 3T0YA 3V7RA 4C0FA 1RUOA 5KH6A 4IURA 2E5KA 1ETKA 1ON1A 4G8XA 4L9JA 3OS0A 4X9DA 1PD1A 3CBOA 5CKDA 3X20B 3I4NJ 4LIVA 1KU7A 2EYQA 2EYWA 5FLXR 1MH4A 2AHJB 2CH4A 4XL9A 2HVRA 2EAYA 2EQUA 3PMIA 5GJVB 4F14A 4HEA2 2COZA 5DD4A 2BY3A 3ELKA 1N9RA 1ZGJA 4MO7A 3MVPA 4LE9A 1P6RA 1K83J 5FO5A 2ZMEC 1OYXA 5AONA 2IA2A 2QZ8A 2ZNZA 5DDGA 1Q95G 2GOXB 2ZJPF 1RR8C 1DU0A 3RDIA 4QIWN 3W6JB 2P81A 3KPHA 1K73R 4XKBA 4LB6B 1TXQA 3CDHA 1OPKA 2A6EF 1NM7A 3CXCA 1FBQA 3L9FA 2E19A 2HQRA 1QVFS 4LDVA 4AVPA 5D6XA 3CMEQ 1WHMA 4BKXA 4C3IJ 1WHHA 1Z9QA 4LOCA 3CC4A 1ZLKA 3OY9A 2RHUA 4PJMA 1HYOA 2PBIA 3CTAA 2DD4A 2HVQA 3M55A 2CZ7B 4EM1A 2RK2A 3I5RA 2P0KA 4CICA 2IVWA 2FNAA 2X6WA 3H36A 5F0HA 1VYUA 4MFDA 2DODA 1S8NA 5AIQA 3V8LA 1S72I 2ECBA 3A8HB 3HB9A 3SWNA 1OMIA 2CW0F 3QG1A 2A61A 4FT8A 4M9SA 2GXBA 2HNIA 2LX9A 1VQOT 3OA6A 3E97A 2M7BA 3S14J 3REAB 2XF7A 3MP6A 1VQMT 2HEOA 1K9MC 1RPWA 5E3LA 1VQ4I 3LSPA 1S6LA 4AYBN 2OD5A 5EZHA 1S5LC 4BHBA 2F5TX 1B59A 2LJ0A 2XICA 1Z7LA 3JCMb 3ZN0A 4ZGEB 1H3ZA 1V4RA 2BY0A 2RH2A 5GAOp 3JREA 3WU2C 3C95A 4QQGA 3JCMh 2ZPEB 3I3LA 1PWTA 5CJ9A 3HSRA 1VQ6A 5KCOA 4I02A 5J26A 3LSMA 3CCSQ 1Y8RB 2LKXA 4C5EA 2B7EA 1ZRDA 3RMQA 2QM3A 3UDCA 3CD6T 3BQYA 1RUWA 4YIRX 4FW1A 2PFBA 1X3WB 2LDUA 1M5Q1 1GBRA 2D45A 3E6DA 1GCQC 3J81E 2QENA 3FLGA 4CCNA 2DLPA 3G71T 1R5GA 1X2KA 5CPRB 3CC2A 2YPRA 4F91B 5H6RA 1OLTA 2DL7A 4HCKA 1NG6A 4PLLA 1AOJA 5A0DA 1ZH5A 2JSPA 3VYUB 2HD0A 3ABUA 3CCQA 1WRJA 1YX5A 2ACJA 5B5EC 2L5QA 2A0FB 4JX5A 3VSLA 5BMZA 3HIFA 4JBAA 2P4WA 4A3LJ 1LE8B 1MBFA 1UGRB 3CESA 1B34B 4W1UA 5L3FA 4IQJA 1M2VA 2RQVA 3OYFA 5B1BH 2HOTA 3BJ6A 4J00A 5KYWB 1E6HA 1TUGB 1IN7A 2SRCA 2CUDA 2LZ6B 2HZDA 5FU6B 3G1LA 7AT1B 2R7RA 1ZQ3P 3HRUA 2ZPHB 1NBEB 3DLMA 2FNPA 4HQMA 1U1TA 3VDXA 3MEXA 4LJZF 3M07A 3GTGJ 2KK4A 4XTXA 1D5VA 3EQLF 5DS9A 4C9YA 1KGSA 4NB5A 1LOJA 2MAMA 3NTHA 4K11A 4F93B 4M78E 2HPIA 4QT7A 2RV8A 1OZ2A 4M78D 2DT7B 1N77A 2DT6A 4B3XA 3F22A 4XN0A 1YITT 1FNNA 2HSEB 2O4XB 1EZZB 3ABKH 1K9MR 3OR2C 4D9JA 5HK0A 1KD1U 5B3SH 1RADB 4C8QA 2JMWA 2X1EA 1ZQ1A 3H41A 1KSWA 1OISA 1BI0A 5L3DA 4M77A 3O5ZA 2CT3A 2EZLA 2O3FA 3PO2J 2CS3A 1MDMA 4Q5SF 4BEHA 2K9NA 3FKIJ 1YJNQ 3BR1A 3VS5A 1X75C 3CEYA 1JTXA 1QPIA 2L0KA 3JSOA 2A6HF 1KK7A 2RJFA 4JYKA 1I50J 2QASA 1NJIC 2ME0A 4RMNA 1XN7A 3CMMA 4A3EJ 1R22A 3CC7I 2A69F 2KT0A 2JA2A 2DEUA 5E8GA 5JFRA 1W2BA 2W48A 4IHTA 1ETVA 1YE9A 2PJPA 2K7AA 4E7HA 4C5HA 1LJOA 4BE2A 2V8KA 4OB3B 1Y1WJ 1EKEA 2Y48A 4ON0A 2OTJI 2UV1A 3H6ZA 4NC7A 1P4AA 3I58A 4C8QC 2KSSA 2OJED 3EFSA 3EUKL 2DOAA 4WXHA 4XRSG 3IRRA 1YN8A 2A36A 1OI1A 3G1OA 3TQNA 4UUVA 2OA4A 2R7UA 3HZJA 2BE5F 3S15J 3A1YA 2DE0X 3JW4A 2IBDA 2H27A 1UEBA 4M7AF 1KQ9A 2IRFG 3RPUA 1A04A 4F7UB 1Z9CA 2LREA 4ZTFA 1VQ7I 2J7IA 4OMFB 5L3EA 1Y0MA 3RBBB 3JCMc 1E3HA 1JUSA 1JT6A 3K2AA 3BPXA 5HS7A 2QK0A 3DEUA 4CO8A 2L9RA 1R0CB 2CUFA 2EQJA 2ZCFB 5GAN4 1IGUA 2FUG2 3KP7A 3IAS2 3P8DA 2G7HA 4IOCF 2X4JA 2HQAA 4LIUA 3ZQFA 3CXCP 5KHDA 4PJJA 1IN8A 4KICA 2WSFE 5A0LA 4QSHA 3NARA 2E41A 3H8ZA 4HQEA 3WXMB 1EX4A 4Y13A 2DLLA 4KUMA 4A63B 1OYWA 3MHXA 5FW9A 4EMSA 2EFOA 2YUSA 2R92J 3BP8A 4ESFA 4XSZF 2Y0SN 4UY8I 3VV0A 1N75A 4BBRJ 2IGMA 3FXQA 5BS6A 3HOXJ 4EVIA 3ZP5A 4E7KA 2IS6A 2EJ9A 4QVCA 2OTLQ 4PGGA 1VYVA 2LT4A 3DP7A 2XAFA 3PMTA 4LLGF 4BQOA 5GAMd 4YIIA 1ZG3A 3JR9A 2ZXWH 1OCCH 2O6GE 3EAEA 2DK8A 2W82A 3A01A 3KZIC 2R7WA 4LLNA 3TL4X 3QBYA 4JLGA 2D1XA 3GEZA 3VYTB 3CBMA 1TTHB 4BQNA 3UR3C 2LCSA 4KT5C 2RQRA 2JRTA 1G3YA 4N0AC 5GMKm 2EYZA 2CQXA 2K5CA 3AG2H 4ESJA 2VLAA 3K0LA 3WTYC 2ED1A 2P4TA 3ZBDA 1R36A 2G9WA 1X6BA 2DVEA 2BXZA 4I99C 4EM2A 1WJAA 4M9ZA 3S1QJ 4NC6A 2RD1A 2QBYA 3CCQQ 2M0OA 3E0JB 4BE0A 5HKCA 4EMKA 3RKYA 1TLHB 1GXQA 1YNZA 2ADUA 2GA2A 5FD6A 3N4MA 2YWWA 1TW3A 1EH6A 2JA8J 1U3OA 2GCXA 2VXFA 3DV8A 3QO3A 3REOA 2HFHA 3AG1H 3CMYA 2GFAA 3ME9A 4CYCA 2VQCA 2B0LA 3OOPA 4EMKC 1VQ8T 4PKCC 1QVPA 4HCBA 5A0GA 5LHIA 3AKZA 2XGXA 4MDXA 3GCMA 4M77C 5CVJA 1Y71A 4Z8AA 4IPAA 4JUVA 2O4XA 4XLFA 2ABLA 3LGLA 3B02A 1Z3YA 2YUNA 3K1MA 4M78F 4C92D 3RJPA 1GLNA 2VT2A 2NVXJ 2F6CA 3FM5A 2QCOA 4O3MA 3EYIA 1I8FA 2BE9B 3DKMA 4UVBA 9ATCB 4EJOA 3FX3A 2LVMA 4CCLA 2KXCA 2BIVA 1YJNA 2DMOA 3E5UA 3META 1BI2A 4HA8A 2CW8A 3K4BA 3KP4A 5F04A 3OYNA 4ITVA 1VQ8I 3BG7A 2V8IA 2R3SA 1SMYF 1WFXA 3CCVI 3T8RA 4KRTA 4RTZA 3TU4K 1KC8U 2OTJT 3I55A 3RMSA 1IZ1A 1N9SA 5IP6A 3THKA 4CC4B 1Q82C 5D6FA 4FASD 2K79A 2DMQA 2KRHA 4LD5A 2MYSA 4XLPF 3L1PA 2JK3A 1K61A 1NTCA 5DCFA 1RI0A 3BCAA 2EJGA 1P7JA 2R57A 1WI3A 3M59A 4ZZLA 3L2RA 2ZPBB 1JKOC 3L1AA 1QVGA 4PCQA 5LJ3j 1SVLA 1W36D 2EVRA 2MK5A 1XD7A 3OBWA 3GTJJ 4JPBW 4EMKB 3OSSC 2R7OA 4MMKA 4XU3A 3C18A 1FPQA 2FOKA 1ZSZA 3HKSA 1KQ2A 3QZ9B 1BK2A 4BH9A 1T95A 2JPBA 4D1QA 4J01A 1O3QA 1UJYA 3E9FA 5IT9E 5K5QA 3J80K 3JRFA 1YOVB 3JRZA 1C0MA 3NWSA 5D5VB 5IH2A 3SZTA 3TOAA 5GANh 1K78B 4N4IA 2VC1A 2X6OA 3CXCS 4YIFA 1SVOA 1J7KA 4ZJZA 1IO6A 1LUJB 1DUXC 1VQ4T 5GAOq 1XMAA 2B86A 3CCMA 3JRAA 4J7IA 1SAXA 2E6NA 4CCMA 2LRDA 2GFUA 4OMOA 2I0NA 2DTZA 4OIOF 2NS7A 4IL6C 3WTTC 2DVJA 4XICA 3JCMe 3JCMV 3K70C 1Z7UA 2BVMA 3CF5F 4EJVA 2X4YA 3EUHC 5LHGA 2WSCE 4FX0A 1AHDP 1QW1A 2MWOA 3QAHA 1WKMA 3DQVC 4G6QA 2HOAA 3F70A 2V26A 1PYVA 1IN5A 4XU0A 3ZMUA 2XPWA 4AC0A 4A4HA 1WVRA 1GUUA 3BR5A 1X2MA 4R56A 5IP9J 1YJ9I 2H3EB 3HGYA 3IL2A 2FMLA 1UCRA 1U3EM 1QU3A 2EZIA 3LA2A 1JU5C 4J8OA 1N8RC 4HDVA 5HLHA 1SKUB 2CP5A 2CZ1B 1STZA 4B43A 1W1WE 3DKYA 2NYSA 5J6XA 4BD3A 1IDYA 4OIPF 2EIJH 2VJJA 5KAIC 1Z0XA 5CKTA 3ZN1A 4AWXB 2VODA 3P5JA 1FWZA 1OR7C 2LFBA 3K1PA 4IJAA 2M0MA 2XGCA 1LQ1A 2LC2A 4JK1X 1X6GA 4L0YB 4XOTA 1O57A 1W7PD 3BR3A 5C4JJ 1B34A 1OU9A 1LE8A 1ZSZC 2DQLA 2BXYA 1VQNI 2QA4Q 2FG0A 3BG6A 4DOZA 3EFOB 1OYYA 1QZYA 1MMDA 2KPMA 3HOVJ 3HOWJ 1R0BG 2DTOA 2K2MA 1QPMA 2P5KA 4M77F 4RTTA 2R5ZB 4M3BA 4A3GJ 3UA6A 4U0WA 4F7UA 4YTLA 4MIMA 3WGHA 2IS2A 3W2AA 2JJ9A 3QSUA 2MA3A 1UFFA 3UNGC 4XTYA 1V5EA 1XTAA 4I6ZA 5DD8A 3ZMSA 3A0HC 2ZXHA 4XRMA 3B6CA 1VF9A 2F2VA 3RTRA 4KBMB 2X9DA 1ZBXA 3BTJA 4NNJA 2Z5UA 3KIOA 3LA3A 1G83A 3ABLH 4PK4A 2WAFA 2BUDA 2HQXA 2R5AA 1Q81R 1N5ZA 2DA6A 2AXLA 4N0BA 3JB9J 3MCAB 3M1CA 4ESBA 4PDKA 1UUEA 3CUOA 3PFYA 4PGHA 5EF6A 5DCMA 1B8IB 4IO9F 1WJBA 4MTEA 4D5FA 2EFPA 2JN6A 3FF5A 3IH2A 3OMGA 4LDYA 1YX3A 1LPQA 3J80E 2MSYA 3LSHA 2F4OB 2LJ1A 2DL3A 2MF2A 5B66C 2KGTA 3MPUB 4HVVA 4MZMA 1SFEA 1OV3A 3ASNH 3I71A 3PSIA 3GFJA 3GTQJ 2FPEA 1XMXA 2BZXA 2JVVA 2FA5A 3OBYA 3DPLC 4XQFA 1R9TJ 4LLLA 1ZG5A 4XLCA 2E1CA 4MFEA 2YX7A 2V1DA 1G3SA 4M6YA 1BL0A 2XDPA 4OF1A 5BPDA 1YI2Q 4J9CA 1G6NA 1X1BA 1YW8A 4RAGA 4YEJA 3OYAA 2K7LA 4B09A 3WHCA 3JSPA 2HOSA 4XIDA 2VKHA 3FK6A 2JA7J 1TWBA 4X6AJ 2DYIA 4FQGA 4AIHA 4KN7X 4BDYA 2RHXA 3GOXA 3UPUA 1VQPQ 1HW1A 3Q0UA 1T08B 3EGDB 3CC7T 3H5RA 4BNCA 1Y39A 4LN2A 4OMLA 4X34A 2CU7A 4ZYHA 2MI6A 1ETQA 1OJLA 4LG0B 1M9SA 2X1DA 2L3DA 1B9NA 1JI8A 1FP2A 3IP4B 2E3IA 5GANd 1A6IA 3WTWC 1IRZA 2DO3A 6PAXA 3GFMA 4KIBA 5FU7B 3KEYA 3MKLA 3T1BA 4CYCB 4RAYA 5GP9A 1YTYA 2DU9A 2IAIA 5EDNA 2JT4A 4Q4ZF 1AU7A 1QA6A 2J06A 4IRGA 1ZELA 3MMYB 1M90U 2IPOB 2DYBA 3F6OA 1JXSA 2DO7A 1R4MB 4M6VA 4IKFA 3IV5A 1IO2A 1WSUA 1FOKA 4A54A 4OINF 3ZQCA 1BW6A 4XR6A 3RNJA 3SJMA 3G1MA 3HRSA 4UVAA 5F1RA 3JTGA 1A5JA 1OX8A 2KT8A 5E1ZB 3IQLA 3MEAA 2O2OA 5IHKA 1RL2A 1K73C 2EV5A 2JVHA 1YRNA 4C92A 1HDDC 3U2RA 1K0SA 2KIQA 2KNBB 3G4SA 2P0QA 1YIJQ 2VIXA 3BR6A 3HOSA 4KYWA 3ZGKA 4AFZC 4L6V5 1H3HA 4N9HA 2KR3A 1OYIA 1BJZA 1I5ZA 2V1UA 1MNDA 1P4WA 2D1VA 4OU0A 5J4YA 3TEEA 3AL0C 5GANf 4J6WA 3BTCA 4A5NA 3QWXX 1ZA2B 4PJOE 2QXFA 2O0YA 4ENKA 3C2HA 3AAFA 4BDZA 4BBSJ 3LSIA 4B9XA 3KZZA 4RG8A 2MD5A 2A5WA 2CW7A 2C0OA 2YRVA 3J80Z 2R7DA 3BW1A 2MLKA 2Q2EA 3GO5A 1JGSA 3KYDB 1IG7A 1BKBA 3DB3A 2F5EA 3WVEB 2RJDA 3I59B 2QQ8A 1VQNT 1ZYRF 3EG3A 3F8CA 2XSJC 3F9KA 2E1NA 2QSHX 3RPQA 1P7IA 3F8NA 5A2QR 3CCUQ 3VS2A 1K9MU 4ENMA 1K78A 4ZDLA 1KZHA 3G4ST 1DPUA 4ATOA 3I54A 3S16J 1W0UA 5IY5H 3NQOA 2CV2A 4M78A 3HKZA 5TJJA 5GAOl 1RAGB 3VS3A 4AG1C 1KYWA 3CCMQ 3R0AA 4C30A 2ZGWA 1U78A 1NEBA 2UXXA 4RB3C 2RHZA 4GDFA 3LX7A 3I53A 3HXLA 4CC7A 4LD6A 3D0SA 2IPQX 4M73A 4BY1J 2PNIA 2KIFA 3JRIA 3PO3J 2RREA 2Q1ZB 5IP7J 3A02A 2HQ5A 4C92G 2V79A 2MABA 4HOBA 2JM8A 1P9QC 1KYZA 3JCMQ 4VUBA 2WC2A 2PMHA 3H5NA 4CZZA 2M30A 4WXDA 4IUPA 1XMKA 1G2BA 2W24A 1IUYA 2DTRA 1LJ9A 1I07A 3MKDA 1OKRA 1E3OC 4HZFA 3CMEI 2R5YB 2E1MC 3K70D 2O5RA 2C6YA 1V5GA 3NHNA 5D6WA 8AT1B 1JRIA 3O3KA 4DYRA 1TWFJ 2MGQA 2EA4A 1OEBA 2DD5A 3DF8A 1MV3A 3ULQB 1GFCA 4ELZC 3QXEB 2YX4A 2DT5A 1T3LA 1Q1VA 4EMGA 5LJ3g 5GADJ 2NLUA 1NEGA 2ZMEB 5D5UB 3GPLA 3C3WA 4A3BJ 2EQKA 3CPWA 2H1KA 1F4KA 2M1HA 3OW2P 1HOMA 2CQNA 2IXSA 3VYRB 5DM7F 4RGSA 1VQPI 1PDNC 2LTPA 1R8OB 1K8AR 1M1KU 3GBQA 2AK5A 2DZCA 3CCEI 3WGGA 2JMCA 3EGXB 2ROTA 4GFBA 4IVNA 1IV8A 2XV4S 2FZGB 1UG0A 4XQ3A 3CMET 3EHRA 5H20A 1Y8QB 1VQ4Q 2OPTA 4PZJA 1ZKGA 5LBQA 4OMNA 2ID6A 2RK1A 1HKSA 5AYFA 2L3PA 1HJDA 2BZYA 1Y0NA 3M0PA 2V9PA 4U0VA 3O8HA 2I8DA 3JCUC 2JT1A 3BJAA 4XRFA 3NRVA 4BJTA 2M4GA 3FXKA 1XX5A 2DFHA 4HV5A 3IUOA 5JHUA 2E1OA 1VQPT 1XB4A 3RYRA 1SSFA 2KRCA 3B73A 1UMQA 2GTOA 4KULA 1D8JA 1DGWY 1L3LA 3DLLA 3CCJQ 3D5LA 2GTJA 1C0WA 2RA2A 3TREA 1B6AA 2VKDA 2VBWA 5BOXA 2GQVA 1T56A 1IN6A 5LL6S 5GAMe 1MBJA 2IA0A 2M87A 2GNCA 1WHJA 2DTHA 4EV0A 5K5RA 3BJOA 3K4NA 3ONQA 2EQMA 2LQ8A 3REBB 4M7DF 1WHUA 3L2ZA 3UF4A 3JRHA 3H0FA 1YHQT 3MZHA 4PJOB 3K4MA 3TW6A 1VQ8A 2Y2ZA 2FF4A 1MSFC 3ZCOA 2DXUA 3HGGA 3VB2A 2E6ZA 1H92A 1KG1A 3MFKA 4P9FA 1W4MA 5FKNA 1IV6A 1MKMA 1KU9A 3K4LA 5GAOm 1GFDA 3I9V2 2DL8A 3M3YJ 4M78B 5LJ5g 1ONVA 1B72B 1G2HA 3CPWS 5D4RA 3MKZA 4C92B 2M45A 2E70A 4IIMA 5HS9A 3ZQQA 4NQWA 2K3XA 3CC2Q 2JS0A 3QIIA 1A0NB 1YHQI 2PG4A 1SAUA 4Y17A 2CGHA 1U9NA 2E7XA 2QYOA 3S32A 3HOZJ 3PVLA 3N97A 1ETXA 1X2NA 3J81K 3KETA 2X3WD 3BPVA 2XDDA 5CAIA 1Q82U 2K3FA 3ERED 4Q48A 4CUGA 1UTIA 3MJXA 2DEQA 3WTUC 4C2TA 1S7AA 4M78C 2OF7A 1OPLA 2EGAA 1WH5A 1BW5A 3KCCA 4FE7A 1BJAA 1NG7A 4BY7J 3A0BC 2FRHA 4HNTA 2M0CA 4RTYA 2UZKA 4HSRA 3HSBA 2E10A 3BR0A 2VVKA 3CJRB 3QODA 5KE2A 3WG9A 4HVUA 2X9HA 1F1BB 3JB9H 5E17F 2LP5A 3CLQA 5M5XJ 5GAHJ 1RLQC 3RUXA 3CC7Q 1F1ZA 1OCOH 4HX8A 3CCLT 2NUZA 4AFUC 2ZAEA 3RKXA 2DL4A 2PJRA 4AD9A 1REPC 4M3GA 1SSHA 4ZC3A 1R00A 2DN0A 3S3MA 3HTSB 2EYXA 5HVQC 1TOVA 1BYMA 3V7CA 3A8LB 2B8AA 2TCTA 4MGRA 2RN7A 4AVZA 4F7ZA 4Y7NJ 3RSNA 4S05A 1U8RA 2M9UA 3RYPA 2O9VA 1AWWA 1O4XA 2I5UA 1M1KC 3BE3A 5A2QZ 2WAQN 1WGXA 3H3UA 1Q81C 4XLHA 4A6EA 3S17J 2RPNA 2XF6A 2W00A 4BEHB 2PTKA 3I5SA 3P9CA 3WTXC 1S72A 3SFZA 1LB2A 5LLQA 2P0PA 4OMZA 3C2BA 3RKQA 3KBGA 4DEYA 2DBMA 1VQ7Q 3FJPA 3FJ5A 4RMOA 3PIOA 3V8KA 4DBFA 2XGDA 3KFVA 2FBHA 4A3MJ 1IAWA 5IXBA 1FY7A 2RNJA 3K1NA 3RIRA 5H6QA 1WYXA 2ENMA 1OFCX 2L7ZA 1Y56A 2F5VA 1QWEA 1HKQA 4HSTA 1EV7A 4YRVA 1ZR2A 1VQ6T 1MNEA 1YITI 1RI7A 4UC4A 3BDDA 2QGFB 3IRQA 1K4TA 4L59A 5I21A 5HDNA 2LMJA 2IA1A 3FEOA 1Z91A 2CSIA 3JCMX 5EEAA 3BROA 3ESWB 2DFFA 2ZJ2A 2PEXA 2RM4A 3L2WA 2QEXI 1QBJA 1JE8A 3P9IA 3GW2A 4ZN3A 2WV0A 1KD1C 3K7AJ 3GWZA 2LTOA 3HTRA 1OQYA 2Z1DA 1ACMB 1WLPB 1BI3A 3DTIA 2H94A 2HDCA 4P9UA 3DBLB 4BUGA 2GAUA 3MD2A 2KDOA 3EFRA 2GA1A 3H9QA 3ASOH 3OW2A 3IWFA 2K57A 1WJFA 4HX4A 1PJRA 4UV8A 4RG2A 2E35A 1TP4A 2NXNB 5IT9R 2DZ9A 4EJWA 3A98A 1VQNQ 1BOBA 1Q86C 2RNAA 5GAMj 1VQ5T 4XOPA 2F5DA 2PLYA 5D5XB 1NPPA 2FE3A 4OB0B 2M5WA 2L4MA 1BOAA 3GLLA 1CF7A 1HD3A 2DJIA 5J1RA 3EH2A 2K5LA 1LEBA 1YP5A 4F7UG 3I56Q 4J9BA 2KJCA 3GF2A 1FYLA 1UB4A 5LJ3f 3JRCA 1VQPA 3CJTB 1JKPC 2O9SA 1OCPA 4B9WA 1IN4A 2A3LA 3HPGA 1E3PA 4PSWA 2YRCA 1HF0A 5GMKj 5FRNA 2EBPA 3CD6I 2RI2A 2W10A 2Y75A 4I0AA 5E18F 1K7AA 1TH7A 3CQZJ 1GHCA 2LQNA 2RO0A 3BQZA 1GV2A 1MJ9A 2XG8D 3EG2A 1UHSA 3I35A 4HXJA 4X1VA 2DOEA 2MMPA 4PL6A 4JRPA 5FKOA 4EGZA 1S7OA 2OV7A 2P7VB 4R8HA 1VQKA 1YWPA 1JJ6C 4Z88A 1ZUUA 2KEAA 2DYSH 4D5CA 5KYXA 5IOYA 1IXRC 1X2QA 2KDZA 4UXNA 2OQGA 3ZXSA 1UFMA 1M1FA 1OCRH 3MN2A 4JQFA 2CWEA 3PQKA 2JTEA 5GANe 3CPWP 2VQLA 3FISA 2MIOA 1W4SA 1Q7YC 3CF2A 2DA7A 2NVUB 1PKSA 2LKPA 4RM3A 2BTTA 3OIQA 4XKWA 3C7JA 4KDPA 1VQ9T 4CC2A 1I3AA 4RDUA 1H9GA 2L2OA 3PE0A 1TUCA 2R7SA 3O8GA 1MBEA 2JPCA 5HLIA 4Z2YA 2O03A 5L3CA 3AL0B 1PSEA 2CFXA 1YCSB 2XB5A 2R5YA 2ZJRF 2IW5A 3S1NJ 1TSFA 4M72A 1X3ZB 4DA4A 3GYHX 1BA5A 2IGNA 2EKHA 4M4ZA 2X1CA 1R5HA 4BE1A 4C92C 2M0YA 2HDDA 3L7WA 3CMAQ 4P96A 5GAN2 1X3UA 2FOWA 3FXMA 3G6EI 3NGPA 3G3ZA 4M74A 4M77D 1U0JA 2XF5A 3S2DJ 3EGUA 4M75D 3OMCA 2JUCA 2I2LA 4CRIA 4P55A 2A08A 2G7UA 3DKWA 3QWYA 1TWHJ 1W5TA 4G94A 3EUAA 1O3RA 1J9IA 4M7AG 3QZ5B 5EC7A 1Q86R 2RC4A 3DFGA 5M3MJ 3L42A 1YQAA 3M0TA 5FWBA 4M3EA 2NVQJ 2KJBA 3CCSI 4WWCA 2LCLA 4MTDA 4A3DJ 1ULYA 1XS9A 1PP8F 2QAZA 3LSGA 2W4SA 4A3IJ 1BB9A 2W85A 4UV9A 4BJ6C 2L0AA 2VWFA 1RKTA 4E6KG 1YJWI 4FIBA 4YG2F 3QUIA 4C2MJ 2XSDC 3ERMA 5CVRA 3CUQA 5ILUA 1MJBA 3J81Z 1D3BB 3CJNA 2YSQA 3LQRA 3A8MB 2KMUA 2NNNA 4DBHA 2R7FA 5M5YJ 1F36A 4FYVB 3E1SA 4YFKF 1ZGWA 2FQ3A 4PLIA 3FIWA 1YITA 2JA6J 2WBMA 1JBMA 1ZRCA 1M3AA 1ACIA 2QEXQ 4E47A 4GCVA 2HU9A 3WE2A 2VPLA 3ULRB 1X4OA 3OYKA 1SEMA 3H0IA 3O8VA 2F5FA 4CYDA 4AFSC 2ECZA 2CZ0B 2MC3A 1T6SA 2W57A 2CP2A 2L8DA 1BBYA 3H0GJ 1WH7A 3F6VA 3CCLI 4LG0A 2L3QA 5D6YA 4M7AE 3F72A 2O88A 4XTZA 5TGTA 4C8QE 3QQAA 1RAAB 5F64A 5EG0B 4FTHA 2RAEA 2LK2A 2ZMEA 2EQIA 1IGQA 5DLQE 5FFXA 2RF0A 4JZ3A 4IHSA 1KQ8A 1Y6IA 2MD0A 1RZ4A 4FETA 1BR1A 5GAEJ 3LH5A 4FSXA 3CCYA 1IZ6A 3GP8A 3CCST 1JTYA 3FK7A 4Y91A 4X9CA 3H3VK 1HK9A 3BZCA 3LGFA 3GFIA 2J05A 3E2UA 1JT0A 3L2CA 1TQPA 2CV0A 1BU1A 2V7FA 4F7UF 1YBYA 2XPVA 2Z99A 3CCRQ 2V6CA 2ZSHB 4NBQA 2KZGA 5HS8A 1ON2A 1A31A 1RC9A 1XSDA 2QF7A 2NOGA 3FMSA 5KYYB 3CD6Q 4IIOA 3QYGB 5LJ5h 4J5YA 2VN2A 3OS2A 4Z6YA 3E6CC 3OSVA 4QWQA 3CLOA 2DPDA 1I5LA 3CJQB 2LT1A 3EG9A 2FBIA 3M57A 2NUTA 4PJOA 2WACA 2BY1A 5DYMA 1T0FC 4BS9A 4OGEA 5KYUA 4KFCA 3TP0A 3TW7A 5HOOA 2Y30A 2AS5F 4OMPA 2LX7A 2COWA 4R79A 1M30A 1R71A 1RKWA 3K4JA 3I56I 2DK3A 1QZEA 4IQ4A 3DWLE 1FYNA 3QP6A 2VC0A 1MMNA 5J4VA 1OPCA 2EA2A 2KP6A 5JVTA 5J40A 1H0MA 4I01A 3EGDA 3LYIA 3V8JA 2ZPFB 2PVGB 1RRJA 1MSEC 3KYLA 4EM0B 2RQUA 4BYYA 3HFOA 4KGXB 1YI2T 2NS0A 4V2GA 4KJZA 2NNYA 1MBGA 2KLOA 2Y31A 3LWFA 2J5OA 2WAQA 3IKVA 3RCOA 1V76A 2X4XA 1YW7A 4DZPA 3G71A 2KIUA 1FX7A 1GL5A 1T38A 4C92F 2JQ7A 2CFOA 3BZKA 3QYEA 3J80R 1SHGA 2HQEA 2H09A 3QDFA 3G4SQ 1FBSA 1PRMC 2M1BA 1J75A 3PQJA 3EHQA 4RA2A 1USTA 4OMMA 1VQ7T 3HSEA 2PVDB 5IT9K 3FMQA 3QJYA 1LFBA 2IGKA 2Q0OA 5HNHA 1B4AA 2DFEA 1VQ5I 3ZMTA 5E1WA 2O61A 2PZ1A 3HL8A 4M77B 4ZYDA 3EUHA 3HUGA 4QTRA 1JKQC 1YG2A 3LFUA 3MZYA 4JJDA 3JCMf 4HCZA 1IB8A 3D5SC 3AG3H 2CUEA 5DEQA 2GOMA 1JQQA 2E34A 1KQ0A 1QKXA 1X58A 2KYBA 4UNOA 1ETOA 5C4XJ 4DBQA 3PIOF 5LRRA 1UB9A 2X35A 3QKJA 4JRKA 2NYXA 2DRMA 1K6YA 5GAOn 3UKGA 2RMOA 4IUTA 2PUOB 4EGYA 4R55A 1FLIA 3I9QA 1NYGA 2Y4XA 3JCMP 1VQ9A 1Z1DA 4FYWB 2NUPB 1YJWQ 1JXMA 2JNGA 5IN1A 3K9TA 1AWXA 5H2FC 1MNMC 1RACB 1Y7XA 4P5NA 5JVGF 2OZUA 1J3TA 5D7UA 5LJ5f 4M7AC 1T0JA 2M9HA 1WJRA 1Y07A 2X3XD 1TWCJ 3SZGA 5C3EJ 2P0WA 3QPLA 3EG0A 4DJAA 1FIAA 3KEQA 2KI7A 2RVCA 5LJ5j 2A6TA 3CCVT 3TDUC 3RQ4A 2VGNA 2CRGA 1P4XA 1R1UA 4Z02A 1AWOA 3OYLA 3L2VA 1V54H 4CC3A 4OGCA 2E2HJ 4IF4A 1FOYA 4RM2A 3HDDA 4BY6C 3CBPA 3SHWA 4ENNA 4M7AB 4HV6A 2Y4YA 1NJIU 4V19K 3LSRA 2VE8A 2ETHA 3J7YJ 1YIJA 5FLXZ 4HLXA 2NS8A 2L3SA 1ZUYA 1K8AC 1KHIA 2XDVA 1O3TA 2LYCA 2LP0A 1O9SA 1YJNI 2JMAA 1IJWC 5F27A 3WGIA 1YCYA 3PNWC 3FC3A 3G6ET 4ENJA 3DXJF 3CC2I 1UECA 1ZSZB 3VS4A 4J7FA 2D9TA 2F4MB 2Y69H 1FTZA 4F55A 3GNFB 4BI3A 3OV8A 5DUIA 3I59A 5FGMA 1Y96B 5CVIA 3PTAA 4N4OB 1UGSB 2STTA 2LC4A 2EGEA 2DMNA 1MGTA 3EYYA 2OUMA 1AKHB 1N8RR 4BXXJ 3F8BA 4U7BA 2R4GA 1UDLA 5IHNA 1K8AU 4J9IA 2DPPB 1G59A 3RQIA 2P84A 2WB1A 3FB9A 2GZWA 4XK8E 3QOEA 2R58A 4M75F 1Q82R 4LFUA 1QCOA 1W70A 1PM3A 4KT6A 3S1MJ 4GBQA 2FQ4A 3X2QH 2FRYA 4JDSA 3SWNC 5KYNA 2MFZA 3V42A 1D0ZA 1NZ9A 2KE9A 1RAIB 5EGOA 1HW2A 1O7LA 2L89A 2DA1A 4L9VA 2M3AA 2JTVA 1G8XA 2NAZA 4BL0B 5KE3A 2D2WA 3HOTA 4II1A 2CV1A 2DA4A 4I98B 2XD0A 4RTUA 1FSHA 4PFPA 3LL7A 4CA0A 3J7ZI 4HKEA 1ZLMA 1LFUP 4HVWA 1Y1VJ 4CH7A 1N6AA 5FLXE 4MLOA 2OBPA 4PUSA 2HPMA 1WPYA 4HW0A 1Z67A 2DXCA 2KXDA 3P9KA 2ICWG 4DBRA 4CZCA 3CCMI 3KLNA 3PNTA 4GYIA 4II3A 4MQ9F 2M51A 2MPXC 1KC8C 5FKLA 5KYWA 3A8GB 1L0OC 2EH3A 2EPFA 1E6GA 3I4MJ 1ZHFA 1PUFA 3VS1A 2H8HA 4HNUA 3CC2T 4C0DC 1S7EA 1MBKA 4I7HA 2ZXIA 2VOPA 1APLC 3CMAA 3S1RJ 1LCKA 4KGVB 4Y52J 1S1NA 1VQLA 3O6BB 3BG5A 3WE3A 3GTPJ 2HBPA 2KL4A 2HEQA 3BY7A 1RR7A 4A0YA 3DB4A 4F92B 2JVGA 5AT1B 2OQRA 1UGVA 1C1AA 2DMPA 4DQ2A 4B47A 1WDXA 1E7OA 2M7AA 1W1FA 1WXTA 4RB2C 3T9NA 3FM3A 2HKQB 1YW9A 5GPAA 2KIMA 2KAFA 4M77G 3A2KA 4KIGA 4IHWA 4MZPA 2QVOA 4M75B 4S04A 2LF7A 2CKKA 5EGOB 4RGXA 1R1VA 1QKWA 4E7LA 3OQ5A 3KXTA 1POGA 1R58A 4B6MA 3HKZN 3PM1A 3ZOBA 2ZNYA 3LWIA 4ZTJA 2KVQG 2CMPA 4BJ5C 4D7NA 2HGCA 4ZH4F 1PHTA 1W5CC 2FEIA 3H9NA 3SYTA 4RUGA 4LK0F 3BFMA 4JS4A 1WWXA 4MEYF 1QP2A 2E12A 3KE2A 1VQMA 2HQNA 3GXOA 3LSTA 4RCCA 3BDUA 5I22A 5GMKh 5DCMB 1F43A 2DIGA 4R1HA 2IIMA 2L4AA 2WB1N 2CYYA 2KFDA 3VYSB 4B3AA 2VUBA 4XTWA 4GO1A 5L8RE 4KUDK 1JUPA 2CUJA 5FLMJ 1M1KR 2ESNA 3TQ7P 3TO9A 1T0HA 3ZQLA 2HTSA 3RZDJ 2A3SA 2CSQA 2E1MB 2VT3A 1KA8A 4OOIA 4RB0A 2VKVA 5JLXA 1R23A 1SC7A 3P8BB 1D3YA 2DF6A 1DU6A 3HHHA 2DETA 3OS5A 3IH3A 3ECOA 4MNUA 1WIEA 4W97A 2QQ9A 4OP0A 1N8RU 3KLOA 1MJAA 1OX9A 3KFWX 2JOYA 3EFOA 5C6SA 4XN3A 2RI3A 4LXCA 3M56A 2H6CA 3CCVA 1X1CA 1ZN2A 1I6HJ 4ETSA 4AU7A 1RUNA 5J3BA 2D0NA 3C94A 2F4IA 4M3FA 5ILSA 1S3JA 1MGQA 1X1DA 1YYVA 2MW8A 1OQKA 1ZSGA 1TG0A 4G12A 1KQSS 2QQSA 5F1JA 4FT4A 1UELB 3S3OA 4M71A 4E7JA 4G7ZF 1HA8A 3Q5FA 1FZPB 3P8HA 2BE7D 2V8JA 2KHMA 1LDJA 4A53A 3R4KA 1GXPA 2V9VA 1YIOA 4OIRF 1XCBA 2F69A 4AUXA 1KHCA 1OULA 3QHSA 3JCMJ 1V5FA 1YHQQ 2ZFUA 2RQQA 2GXAA 4EEFG
chains in the Genus database with same CATH topology
3FXRA 1VQ7A 2G3RA 3TGNA 2EJFA 1XDSA 3RERA 2X0LA 3ZEHA 4EQQA 5GAN5 4OIQF 1AWCA 1YHQA 2XKOC 3JB9I 5EEGA 3KP5A 3JCMg 1WJQA 3WTZA 2MH9A 4TVRA 4LB5A 2VOOA 2QTXA 4OMYA 4M7DG 2DQRA 4MQVA 2Z3YA 4PJOG 3CC7A 4P5OA 4XU2A 4ZZDA 5JI6A 2HR3A 3I56T 1TQIA 5FB2A 3CPFA 1U6GA 5KVRA 1H641 3GZ6A