1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal-binding protein,transcription/dna
molecule keywords mbtA operator DNA
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
3JTGA 3DF8A 1ZH5A 1K79A 1Z7UA 5E18F 1O7FA 2VT2A 3TQNA 2EFOA 4PGGA 4EJTA 1PDNC 2RDPA 4JQFA 2GXGA 2HOEA 2A07F 4HQMA 1XB4A 1MJ9A 3SHFA 5FLXK 1ZRCA 1ZGJA 3L00A 1G3SA 4IHTA 3EUHA 1H0MA 3H3UA 3GFMA 2MH9A 5AONA 4HDVA 2G9WA 3WGIA 2IW5A 3RJPA 1P4WA 4RGXA 1T0FA 4Z2YA 3CO7C 2M1BA 4HV6A 1QW1A 2B0LA 3RYRA 5D8KB 2FNAA 5FD6A 4IVNA 4AWXB 3HSEA 3F6OA 1R1VA 2HGCA 4BAYA 3K69A 4U88A 2DQLA 2G7UA 1XCBA 3DKWA 5IT3A 2Q2EA 1YTYA 2IVMA 3LA2A 2XASA 3IWFA 4YIIA 2OQGA 3ML6A 1W7PD 2RC4A 2GWRA 3KEQA 5D6FA 3T8TA 1NHAA 2PI0A 1RI7A 4UHTA 1YG2A 2LF7A 3V7CA 4Y15A 3GZ6A 2EA2A 1JHHA 2ISYA 2PFBA 1IW7F 1XGMA 4M71A 4ASNA 3WTTC 4CICA 2XRNA 3E3VA 3BWGA 3VODA 3QU6A 2FSWA 3GW2A 2WC2A 5EEHA 3QRFF 4L0ZB 2QLZA 4LLLA 3VOEA 2Z3YA 4AD9A 2NNNA 5CVUA 3KETA 2HYGD 3TDZC 3D5LA 1B59A 2DW4A 2HEOA 5JHUA 2HKXA 3KE2A 1XSVA 2O8XA 2V79A 4LG0B 2VODA 1FP2A 3LA7A 4PGHA 2FMYA 4HBLA 5K5OA 2K4YA 4QWQA 2LKPA 1U5TB 1SAXA 2GZWA 4DQ2A 2Z5UA 2PQ8A 5BOXA 3ULQB 1MJBA 4ENJA 4I0BA 2ZNYA 1WRJA 3HSFA 4U0YA 2KIMA 1TTYA 1ZREA 2CO5A 4UV9A 4BHCA 3R0JA 4U0WA 3RKWA 3PFIA 3OV8A 4L9NA 1IXSB 4OIPF 1B4AA 1I1GA 1S29A 1ON2A 4A5NA 3F3XA 5ICCA 4JBAA 4WXHA 3WTYC 3D0SA 4EM2A 1EH8A 2ZKZA 2MLGA 1BI3A 1IZ1A 1KQ9A 3ZMSA 3GF2A 5HS9A 1ONVA 2FOKA 3BJOA 1Z05A 1R1UA 2PBIA 4LMYA 3B73A 2HS5A 1F4KA 3GFJA 5CJ9A 4G6QA 1ZLJA 3ECOA 2DTRA 1QGPA 3BPXA 4IRGA 1RUOA 1WKMA 1TQIA 1R1TA 3I59A 3T5XA 5HDNA 2FU4A 3WE2A 3Q9SA 1J2XA 4ON0A 5E17F 2ZMEB 2P7CB 5H20A 5L3GA 2XAHA 1OYYA 1LJ9A 5HLGA 4L9JA 3TO6A 2ZNZA 3E97A 1XDUA 2L54A 1U3EM 4EGZA 3J81Z 5DD8A 1XMAA 2JT1A 2NYXA 4Q4ZF 1Z6TA 1QVPA 1YS7A 5LHGA 2UWMA 4LK1F 1K78B 4UXNA 1O3RA 4EMSA 3BDDA 1XD7A 1MZBA 3VFZA 5HLHA 2P4WA 2FBKA 5CVRA 3JTHA 3SQNA 1OMIA 3DV8A 1BYMA 3P9IA 3MHXA 2XKOA 5F6FA 3N4MA 1DPRA 3GYHX 2MLKA 2W85A 3FZVA 2EFNA 4N0BA 2KKOA 1S6LA 2K7LA 1HKSA 3I54A 1U5TA 4WXDA 3KLOA 1G6NA 4CYDA 1IRGA 4HDUA 3FHZA 2X0LA 4Q48A 1BN5A 1FSEA 2V1DA 2P6TA 5CVIA 1BIAA 3I0TA 5D5VB 3CTAA 3IHUA 2A61A 1IUYA 4RGSA 3T8RA 3RI4A 3V8LA 1AWCA 1W7PB 3CLOA 4TV7A 2LNBA 4BNCA 5D8LB 5LGNA 3KCCA 1O3QA 4L5JA 5DEQA 1JE8A 2HQNA 1KGSA 3LAJA 1TNTA 2VT3A 3HYIA 2R7DA 4WCGA 1SD6A 1W4MA 1YQAA 4M6YA 4OOIA 2OZ6A 1B1BA 1R5GA 4G7HF 5E1ZB 1XN7A 1ZGAA 5LRRA 2EA4A 5IT9K 2COMA 4HLYA 4CDGA 3K9TA 1G3YA 3KLNA 3I53A 3WGHA 2P5KA 3R0AA 4GYGA 5ICGA 4E70A 4MNUA 2ZMEA 4MGRA 2VXZA 2QBYB 3RKXA 3IKTA 4XBFA 4EVIA 2L01A 5A2QK 3GWZA 4G7OF 1CF7B 2CFXA 2H6CA 1DPUA 4KNYA 4M73A 2R3SA 4AIJA 2P7VB 4O3MA 3WTVC 5HS7A 1FY7A 1QBJA 1XCVA 2ADUA 1U5TC 5LBQA 2XAQA 5E1XA 2VONA 2IT0A 5D6EA 5K1YA 1OKRA 4DNCA 1IXRC 2W25A 1P92A 4P5OA 4OU0A 4CXFA 1LNWA 2EK5A 5FD5A 4NHJA 1QNTA 2X4HA 3O3KA 3IWZA 1FC3A 2GQQA 4GCVA 3CDHA 1S3JA 2QVOA 2RGVA 4D0PA 3KP4A 4QLCU 2CYYA 3DQVC 3AAFA 2FBHA 4PCQA 5E1WA 1IF1A 3F23A 2QUFA 5JR3A 1ZN2A 3K1NA 3JSPA 2UXNA 4YG2F 5CVVA 1XDSA 2TDXA 3ZQ7A 4ESBA 3MCZA 5DDGA 4CO8A 4M9SA 3BJAA 3IKVA 3KP7A 1RIOH 1E17A 4K2EA 4IJAA 4KMUX 5BMZA 3TDUC 4GO1A 1IN5A 1S7OA 4L9TA 1FX7A 3WODF 3ISPA 4ENMA 1L3LA 2VE9A 3ZP5A 2J5OA 5DCMA 2ELHA 4UV8A 3E6CC 1SD5A 3JW4A 2O3FA 1T39A 3CUQA 2M5WA 1O57A 3LSTA 4HOBA 1WI9A 2L02A 2M8EA 3ZMZA 1Z91A 2M87A 3JAMZ 1D8JA 4IPAA 3SXYA 1EH6A 5D4RA 3DPTA 4A6EA 4GGGA 1W5SA 1R58A 3E6BA 3Q9VA 3V8JA 3BY6A 2QBYA 1TW2A 5E8GA 3QPTA 3J80K 3FXUA 1J0RA 5LGUA 3LQRA 3GEZA 1RNLA 1CF7A 4ESFA 5JFRA 1BC7C 2GA2A 2LX9A 5BPDA 2RV8A 1E2XA 3TO7A 1KU7A 1MDMA 2R7FA 1KU3A 1FBQA 4O5VA 5LHIA 1CGPA 2PLYA 2GIVA 1LDJA 1YW9A 2BE5F 2HKOA 4R79A 4G8XA 3DP7A 3F8BA 3V8KA 2K27A 1BI0A 1LDDA 3F6VA 4XLNF 3HOSA 1BIBA 2EFWA 3ZMVA 2JZYA 2D1VA 2EB7A 2RQPA 5HS8A 2CQKA 3I59B 1HW5A 3KZZA 1FBSA 4HYEA 1DP7P 4FX0A 1SFEA 1QO0D 2H3JA 1MD0A 2BGCA 1FYKA 3KP3A 2RVCA 2PMHA 5HLIA 3PQKA 3MWMA 2OD5A 3GVAA 2K5IA 1GHCA 2K4BA 1R22A 1BI1A 3GO5A 2UZKA 3HHHA 3U2RA 3J80Z 2A68F 4ZH4F 4AIKA 2QQ9A 5ICFA 2KIFA 2QQAA 1HSJA 3FMQA 3M8FA 4A12A 1GVJA 1RUNA 2BBYA 4CGZA 3CUQC 4ETSA 2O6GE 2GCXA 4ENNA 1LDKB 3R61A 2DT5A 1HKTA 3HRUA 2DLLA 2FA5A 1Q1HA 2ZCWA 5J6XA 2FMLA 2QENA 4YFKF 2VOOA 1QZYA 3N97A 2P5VA 3C18A 2EFPA 4HAMA 2XVCA 2K86A 5HVQC 2O0YA 1ZAOA 4ESJA 1C0WA 1L0OC 3P9KA 5FFZA 1P6RA 4A0XA 1J75A 3F8CA 4Q5SF 4I2OA 1XGNA 4HQEA 3CJNA 2RN7A 2QYOA 3E5QA 2MC3A 3MAJA 5D5UB 3MFKA 4ZZDA 3J81K 3C7JA 5JVTA 4MQVA 3MZYA 4HF2A 1Z9CA 4KN7X 3I4PA 3RKYA 3NEUA 1MJAA 2LF8A 2H6BA 2XAJA 4A0YA 2QQBA 1PP8F 1O3SA 1HW2A 1LEBA 4KIBA 4M6XA 1JHFA 4IXAA 1IN6A 1XSXA 1HKQA 3K1MA 1KA8A 3QOPA 4EJOA 2DK8A 3T0YA 3ABTA 2OQRA 5D4SA 2LDUA 5L3BA 2ESHA 3IRQA 1YYVA 1I1SA 2KJBA 2DU9A 2O03A 1T38A 2ZBKA 2Z99A 4M72A 3I58A 2DI3A 1DUXC 4LD5A 2HFHA 5CVJA 1FZPB 2CG4A 4MHGA 1FYMA 2M30A 1QQIA 4YIFA 2G7HA 1EV7A 4UVBA 4H0EA 3ERED 2Q8KA 2VC0A 5D5XB 1V3FA 2P6SA 3IL2A 3C1DA 2PJPA 1R36A 4BYYA 3QP5A 3HRSA 3L2CA 5FO5A 2HYFA 1FP1D 3EQLF 4GYIA 2IA2A 4I0AA 4PDKA 4HF1A 4I01A 4OMYA 4ZYDA 1OR7A 2L4MA 2F5DA 4CZZA 4UUVA 1ZRFA 1QPMA 5HOOA 2A3SA 2K4JA 4UVCA 4A5MA 2OZUA 2DPDA 3C3WA 4AVPA 4KDPA 2BV6A 4G9YA 3M9AA 4KIFA 1ULYA 2A6HF 1HBXG 2VN2A 2IJLA 2A5YB 1XGOA 4KT5C 1BC8C 4I02A 2KIUA 2E1CA 2PEXA 4KIGA 3K1PA 3KP5A 1RZ4A 4Q47A 3MEXA 2EWNA 2XGXA 5DCMB 3M7GA 4WWCA 1FT9A 1P4XA 1LVAA 3GXOA 2A69F 2WTEA 3EYIA 2VBZA 2HTSA 1SD7A 3CUQB 2AS5F 3R60A 1STZA 1K6OA 4P96A 4LFUA 1G3TA 4KA4A 5F1RA 3FXRA 4O6JA 4BQAA 4RS8A 3FF5A 1TQMA 3BP8A 2FRHA 5LEJA 2RKHA 3LWFA 3ROUA 2VBYA 2E7WA 3T1BA 1IN7A 4I7HA 3Q5FA 3BJ6A 2ZXJA 1WWXA 2K5LA 5FFXA 5HDKA 1AOYA 1UFMA 1U6GA 1DDNA 1SMYF 1R00A 1EH7A 2L3DA 1XSDA 2ISZA 1MDMB 2W57A 3VB2A 3SZPA 2WWYA 3REOA 1FYLA 1IN8A 3M8EA 1X3UA 4LLNA 1YS6A 3E5XA 4RGUA 1OYWA 4RB1A 1BI2A 2Y0MA 3QU3A 4YFXF 2HR3A 3F8MA 5LRSA 3ZMUA 1FWZA 4U7BA 4LJZF 1B9MA 1HSTA 2QWWA 6PAXA 2MD5A 5DD4A 4A2UA 1KYWA 3JAMK 2ETHA 4B8XA 1YW8A 4P9UA 5ED4A 1P4AA 4P9FA 4OINF 4EJUA 1LEAA 4A0ZA 1VTNC 2LSOA 3HRMA 3FM3A 3SZTA 3V7SA 3HIFA 4RB2C 3W6KB 1JXSA 3QP6A 1F5TA 1YIOA 5DCFA 1OPCA 1JGSA 4NB5A 2J5PA 1J7KA 3GUDA 3F8NA 1T98A 3LAPA 3HRTA 5DV5A 4WXCA 4BXUA 4GXOA 5H6RA 4BHBA 2HTJA 1TLHB 3HUGA 4HA8A 4F7ZA 2ZO4A 3F8FA 1TQPA 3QAHA 4L0YB 4ZYEA 4MEXF 5E20A 2W84A 1TW3A 1WSUA 1ZG1A 3M1EA 2HWVA 5L3EA 5J8CA 3GFIA 5KK1A 2YX7A 1ZG3A 4XRFA 1FOKA 1J5YA 4FHTA 3E5UA 3OOPA 4EQQA 3WE3A 4U7DA 2E7XA 3KZYA 5BPIA 4HF0A 3GX4X 1Y0UA 3ABUA 5E8IA 2ZFWA 2NS0A 4HZFA 1ZRDA 4EM0B 3WU0A 4M9XA 3KP6A 1GXQA 2L4AA 3H92A 3RPUA 3HSRA 3HTSB 2K5FA 4EJWA 3B02A 4Y13A 5LHHA 1T6SA 1USSA 4HX7A 2XKPA 2F2EA 4Y17A 4IRHA 2DQRA 1KU9A 5L3FA 3EYYA 3RTRA 4G7ZF 3RPQA 3EDPA 1KQ0A 2XAFA 2YPRA 1YLFA 2V1XA 5D5WB 4P55A 1BOAA 2MBFA 4FX4A 4L9VA 2RNJA 1HXDA 4KICA 5ICEA 3ZMDA 2JTVA 3BZ6A 1W5TA 2F5EA 3K0LA 1Z6RA 1LQ1A 2YR2A 2OA4A 1KQ8A 4LK0F 2Q0OA 2FBIA 4LB6B 4YFNF 5HDGA 4XLPF 1H9TA 5FLXZ 1TBXA 1D5VA 3HOTA 1UHWA 1J9IA 1XGSA 3TOBA 2M45A 3HTUA 5DUKA 3O6BB 2FF4A 2CWEA 3DXJF 4KMFA 2WV0A 4IF4A 3J7AO 3V7RA 4LB5A 1U2WA 3LFKA 1ZYRF 2OU2A 4FT8A 2OBPA 4NQWA 1SFUA 1BM9A 4HX8A 2VE8A 5H6QA 3ZN0A 2XHKA 5TJJA 1HW1A 1YO5C 1BJAA 1G3WA 4BH9A 2XROA 3NQOA 3BROA 1HQCA 4JK1X 2DBBA 5AIPA 2IPQX 3HHGA 1BBYA 4EGYA 4OIRF 4HX4A 1XMKA 2E1NA 2DAOA 1I5ZA 3SFZA 2UXXA 1ZLKA 3CUOA 1FNNA 2EFQA 4HLXA 1PP7U 2H27A 1F9NA 2PMUA 4R1HA 5J8FA 5CLSA 2KJCA 3TO9A 1FLIA 4KYWA 2P5LC 2D45A 3IC7A 2EV6A 3TGNA 3R6SA 2NRAC 2Y75A 1YFHA 5JI6A 1P2FA 1ODDA 3L09A 4KN4X 3KEOA 5K5QA 1T2KA 2JPBA 3QPHA 4RAZA 2HZTA 3WTUC 2K02A 1IRFA 3TKYA 3MQ0A 2NAZA 1D8KA 2JPCA 1U8RA 3ZPLA 1D3YA 2H94A 2PN6A 3LQQA 1K7AA 2NNYA 5TRDA 1Z1DA 3WTSC 5L3DA 1SMTA 2XUBA 3P9CA 2QM3A 3ZMTA 1A04A 3H3ZA 3U1DA 3WU1B 2ESNA 1YW7A 2BEOA 2H09A 2F5FA 2VBWA 1I6XA 2GXBA 5AIQA 3JSOA 3F21A 2XIGA 2FNPA 3O2PE 5ERIA 4MEYF 4UVAA 4U0VA 1UCRA 2XAGA 3PQJA 4RGRA 1ZARA 4I98B 3WG9A 3R4KA 2IP2A 3G3ZA 3U9GA 5EEGA 2FEZA 4OMZA 1PUEE 5BS6A 2FXAA 4ZYHA 4HV5A 4L18B 2OAZA 1I27A 2IA1A 4ENKA 1LB2A 2DFIA 3L9FA 2VBXA 4R8HA 1FBUA 4IRIA 4HW0A 2IRFG 1FSHA 4L5IA 2HQRA 5BQTA 4LG0A 2V6CA 4MTDA 5KVRA 2DPUA 4OIQF 2D2WA 3RIRA 2IA0A 4XSZF 3V4GA 4CHUA 3DPLC 4BHPA 2AXLA 3FMSA 1UB9A 1USTA 1O3TA 2EV0A 1MKMA 4S04A 4IHSA 1TNSA 2KRFA 3WTXC 4KUMA 4B09A 3I64A 2CGPA 5ILVA 4M74A 1U78A 5LLQA 1B9NA 4G94A 5ILSA 1O7LA 1MGTA 4ZZLA 3G73A 1S8NA 1IXCA 4KFCA 5FB2A 4RB3C 4I09A 3TOAA 3I71A 1IN4A 1R7JA 2PG4A 3S2WA 2GA1A 1SFXA 2ACJA 3F22A 2STWA 4UNOA 1R23A 1UHMA 2MA3A 4EJVA 3E6MA 5CYVA 1H9GA 1QZZA 2XV4S 3GFLA 3ZN1A 3WTZA 2JSCA 2YU3A 3W6JB 1OYIA 1J59A 3FM5A 1ZG5A 4XSXF 2GAUA 4OIOF 5K5RA 1SD4A 4RAYA 3P7NA 2JRTA 3FXQA 3VEPA 4S05A 4MQ9F 4WK8F 2STTA 4RB0A 3L7WA 2P8TA 3KFWX 1F1ZA 4G6DA 3GZ5A 2YSRA 5LGTA 5DUIA 3BOQA 3CO6C 4WF2A 4EV0A 4AIHA 4LGWA 2V1UA 3WGGA 1ZHFA 1REPC 2VC1A 1GXPA 4WX9A 5F64A 1K78A 5DYMA 1V4RA 1WQ2A 4LLGF 2O61A 1R5HA 4ZYGA 1ON1A 2EJRA 1B6AA 3FX3A 2Y48A 2Z9OA 1G4DA 3ELKA 2MH2A 3FWEA 2CSOA 3FMRA 5LEKA 3COAC 2V9VA 4MTEA 2W24A 2F5CA 3RDIA 4A6DA 3WTWC 5FGMA 3EETA 3BPVA 3IRRA 3MZHA 2DO7A 3RYPA 5IT9Z 2CW0F 1KU2A 3E6DA 3KP2A 3NRVA 4N9HA 3K2ZA 3GLXA 3I5UA 4EM1A 1S7AA 2YX4A 2BYVE 3LA3A 2ZJ2A 5A2QZ 2DK5A 3DEUA 5L3CA 5ILUA 1FPQA 2HDCA 2FE3A 4M9ZA 2Z33A 4N9IA 2VOPA 1W7PA 2EV5A 4PZJA 3ECHA 3F72A 2C6YA 2FQ3A 2QZ8A 1KYZA 1IAWA 2A6EF 3DFGA 3E19A 2D1HA
chains in the Genus database with same CATH superfamily
3JTGA 4JS4A 1HOMA 3DF8A 1ZH5A 2BZYA 4I6ZA 1GDTA 4J00A 1VQNT 1K79A 1Z7UA 4M4ZA 1Z77A 5E18F 5F0HA 1ETKA 2ECBA 3IUOA 1IO6A 2I5UA 4L5EA 1M30A 1O7FA 1UHCA 2P0PA 1YIJA 1H3HA 2VT2A 3TQNA 3L2UA 3GF5A 2B7EA 1RAGB 1VQ8Q 2EFOA 4LDYA 1WHGA 1CKBA 4PGGA 2YLBA 2JMWA 2TCTA 3EG9A 1ZSZB 2V9KA 4EJTA 1PDNC 2RDPA 3ASOH 5FKNA 1TWCJ 2VB6A 4JQFA 2L7KA 2K3XA 2P0QA 1TL8A 3OW2S 1QWFA 3MEWA 2GXGA 1HDDC 2B9SA 2Z16A 2HOEA 2A07F 3LSJA 2DNUA 4L59A 4DZPA 4HQMA 1XB4A 2QGUA 4DIQA 1NZ9A 4CC4B 4JZ4A 4UY8I 2X4WA 1MJ9A 3SHFA 5FLXK 2DA5A 1ZRCA 1YI2A 1ZGJA 4ELZC 3L00A 5GAGJ 4XN3A 4A3GJ 1G3SA 4IHTA 3JCMQ 3C4SA 2XD0A 5IXFA 1YX5A 3EUHA 4LG3A 1G59A 2PZ1A 1H0MA 3IV5A 1WHMA 5LFAA 3H3UA 3GFMA 2MH9A 3H5AA 5AONA 2G9WA 5E3MA 4HDVA 1AU7A 1PKTA 1Y57A 1SHGA 5GMKi 1VQLQ 3WGIA 1I3QJ 3HXLA 3GPLA 4HVUA 4QIWN 2IW5A 3RJPA 3JRCA 2HBPA 2M0CA 2PMZN 2VQHA 1P4WA 4RGXA 4M7AG 1T0FA 4F52A 2JW4A 4Z2YA 2R7SA 1RI9A 2A28A 3CO7C 2M1BA 4RTWA 1WJBA 4HV6A 1QW1A 2B0LA 3I55A 2DJZA 3RYRA 5D8KB 1SRLA 4JDSA 2FNAA 2ZC2A 5FD6A 1IJWC 1A6IA 1S72A 1X58A 1PRMC 3GMEA 1GUUA 4IVNA 1B8IA 2L3RA 1Y0NA 4AWXB 2ENMA 4CH7A 3VRYA 3BR3A 3BCBA 3CMET 3HSEA 5CKFA 3F6OA 2YHTA 4A63B 1R1VA 2Y30A 3OL4A 4FTHA 2ZPEB 4RBOA 3H9NA 1YJWT 2X4XA 1XX5A 3HP9A 2QXFA 2QKLB 5E3NA 3Q1JA 2HGCA 2YUSA 4BAYA 3G1JA 2BXYA 1GCQA 3SDZA 3K69A 3DU5A 4U88A 5HCKA 4UB8C 2DQLA 3DCFA 5K7FA 2G7UA 3CCJA 1BCOA 1XCBA 3DKWA 1OLTA 1T56A 1JXMA 5D6XA 1TS9A 5IT3A 2Q2EA 2CH4A 1IHVA 1VQ4Q 1MNEA 1YTYA 3CC7I 2IVMA 3CCEI 3DPUA 3BG7A 2OTLI 3LA2A 3REAB 2XASA 3J81R 2DM1A 3SWNB 2X6XA 4A3IJ 3NPFA 3E9FA 1JGGA 3CJRB 3IWFA 1XTDA 4GLKA 1I39A 1VYTA 4YIIA 2DF6A 2DXBA 1MBEA 2OQGA 5F1JA 3ML6A 3I35A 1W7PD 2RC4A 3WHCA 5CQEA 5KAIC 2JS2A 4JRKA 1PRLC 2GWRA 4MZPA 1MH4A 3KEQA 9ANTA 4PLIA 3GTMJ 2L9VA 5D6FA 5B66C 3T8TA 2IXSA 2TRTA 2KSSA 3L2RA 2KRHA 3CP8A 1NHAA 2PI0A 1RI7A 4UHTA 1ZELA 1YG2A 2WADA 4A3LJ 2KBTA 1M90R 2LF7A 3V7CA 4C92B 2EFIA 4Y15A 1UE9A 2YUPA 3GZ6A 2EA2A 2WA0A 5GAMf 1J3TA 1JHHA 3F0CA 2ISYA 2PFBA 3ZOBA 1N8RR 5J4YA 1KONA 5CR2A 1RPWA 4J9DA 3M4YA 3H9JA 1R6RA 3FDYA 2QCOA 3BC8A 1IW7F 1LNXA 1XGMA 4M71A 4ASNA 4A53A 3CC2A 4R0KA 3UA7A 3WTTC 4CICA 2XRNA 5HNHA 5IHNA 3OW2P 4A3MJ 3U1KA 1U1TA 2KAFA 2MPXC 3E3VA 2VXDA 4NNJA 5GANh 4FU6A 2JS0A 1UUEA 1JEGA 3BWGA 3VODA 3CQTA 1ZHIA 3QU6A 2R5MA 2HD0A 1JT0A 3CCLI 5LJ3d 5CKHA 2FSWA 3GW2A 4II2A 2WC2A 5EEHA 3QRFF 4L0ZB 1EF4A 3D5RC 3EH2A 2LZ6B 2RB6A 5KYNA 4FETA 4B43A 4C3IJ 3G6EI 2QLZA 1DGWY 2NS7A 2DA1A 4JX6A 1VA7A 4LLLA 3GTQJ 1QVUA 3VOEA 1IC8A 2QEXA 2Z3YA 5KH6A 4A4GA 1D3BB 3OL3A 4AD9A 2NNNA 5CVUA 2AIRB 1D0XA 4QQ6A 1WLPB 3KETA 3JB9F 1FJLA 2HYGD 1XQHA 1YJ9I 2CUBA 4C8QE 4NC6A 4Y33A 2R5ZB 3TDZC 3HKZN 3D5LA 2X9HA 4NUBA 2K9QA 1I0CA 1VQ5A 1B59A 2DW4A 2HEOA 2Q1ZB 4C2TA 5DTDA 5JHUA 4FYYB 2HKXA 3KE2A 1XSVA 4G12A 2D0NA 4PFPA 1WVRA 2O8XA 3VS4A 2V79A 1YIJQ 1NE8A 4LG0B 1AHJB 4OB2B 5J39A 1WIEA 4F14A 3EUHC 4A3EJ 4PFZA 2VODA 3JCMW 4J8OA 1FP2A 3LA7A 2DXTA 4PGHA 4AFZC 2FO0A 2LY2A 4E7HA 2QQSA 5GAN7 4BACA 1K9AA 2FMYA 4HBLA 4BXXJ 1N27A 2NS8A 3TP3A 5IT9E 2WY8Q 2B8AA 5IOZA 1YJNI 5K5OA 1RQ6A 2K4YA 4QWQA 5CQXA 2LKPA 1U5TB 1SAXA 1H88C 2GZWA 2RJDA 1N5ZA 1TUDA 3HOWJ 4DQ2A 3BY7A 3UA6A 1MMGA 2EIMH 2Z5UA 2JK3A 1WHKA 5FU6C 3TCJA 1IV6A 2Z1DA 2O9SA 4XORA 3WG7H 1KD1R 1T0FC 1Y1WJ 2CV2A 2CZ0B 3MJXA 2H3EB 4OMMA 2PQ8A 2LRDA 1OU8A 4XLHA 5BOXA 3AG2H 4FYVB 4QT7A 3ULQB 3RR6A 1MJBA 5LJ3g 1QCNA 4C8QF 4BB7A 1RADB 2E5KA 4ENJA 3CBMA 4I0BA 3ZR8X 4HKEA 1YI2Q 3X20B 4CCLA 2ZNYA 3OIPA 4DW6A 1WRJA 2DCEA 2WAQN 1Q7YR 3UDCA 5C3EJ 2PU9B 4XOTA 2JJ7A 3LSIA 5FJ8J 3EGDB 3HSFA 4U0YA 3VRZA 2KIMA 2JVVA 1TTYA 3KBGA 3E0JB 3EH1A 1ZREA 1BA5A 2CO5A 3OB9A 3I56A 4UV9A 2PJRB 1GCQC 4BHCA 3R0JA 1W70A 4A4HA 3CC4I 4U0WA 2JUCA 5C4XJ 3RKWA 3H9GA 2K6DA 3G71A 3PFIA 3OV8A 5EG2A 2MFZA 4L9NA 3BW1A 3SYTA 1MMDA 2PUKB 2MD0A 4JYKA 1IXSB 4OIPF 2VJ4A 1B4AA 2HXIA 1IGUA 1MSEC 1PD0A 4ME7A 3LSGA 5GMKl 3S1NJ 1I1GA 1S29A 3NHNA 2HXOA 1UGVA 1ON2A 2LTPA 4A5NA 2E36A 3F3XA 2P84A 1ORKA 3OYYA 3X28B 3W2AA 2RK2A 1TSFA 4HRIA 5ICCA 4JBAA 4J9GA 4V19K 4WXHA 1W1WE 3WTYC 2ABLA 4PSWA 5I11A 3CCMI 3D0SA 4PJOB 1RI0A 4EM2A 3DTIA 1EH8A 2ZKZA 3FRNA 2MLGA 3VDXA 2XF7A 5CKEA 1BI3A 1IZ1A 1ARKA 2X3WD 1KQ9A 3K4KA 3ZMSA 3GF2A 3CCUI 3DKMA 3CCJQ 1AA7A 2MI6A 1UECA 5HS9A 2Z2SB 1ONVA 2FOKA 2RO0A 3BJOA 5HKCA 1Z05A 1R1UA 2PBIA 4LMYA 2EZIA 3B73A 2HS5A 4I99C 1F4KA 4BKXA 4X34A 2JVGA 4OVAA 3CPWS 4D1QA 1VQKI 2EGCA 3GFJA 1VQ7T 5CJ9A 4G6QA 1ZLJA 3JB9H 1Y39A 3ECOA 1QVTA 2NVQJ 3O8VA 1ETVA 2DTRA 1QGPA 2VYTA 3BPXA 4IRGA 2C06A 2HPIA 3LWHA 2E70A 3MP8A 3CCLT 4AUXA 1X6BA 3CBOA 1RUOA 4GFBA 1X2NA 1WKMA 1TQIA 5E3LA 1R1TA 3I59A 3T5XA 5HDNA 1LE8B 4BI3A 4EMKB 2FU4A 2KIQA 3WE2A 1B72B 3Q9SA 5LJ5h 1X75C 4XN0A 1J2XA 5B5EC 3ZBDA 2DOAA 3AG4H 4ON0A 5E17F 4CSWA 3IH4A 1ZR4A 4J19A 4M3DA 4ABZA 2AKKA 2H1KA 1KD1U 3C2GA 3OWTA 4E6RA 2ZMEB 2LBFA 3ONQA 4LIUA 2P7CB 5H20A 2VASA 3ESWB 5L3GA 2E65A 4XLFA 3CCST 3FKIJ 2XAHA 1Y96A 2LK2A 5CQYA 3QOEA 3AG3H 1RAAB 1MW7A 4ZYAA 2RHIA 3CC2Q 2OCCH 1OYYA 3S15J 3CCVA 1LJ9A 3HPWA 1UZCA 1X2QA 1BB9A 5HLGA 1TG0A 5CIUA 4L9JA 2ZPIB 4PJMA 3TO6A 3JRFA 3M3YJ 2ZNZA 1TWAJ 4FSXA 3E97A 4KUIA 4PLLA 3B6CA 1WGSA 1KSWA 1RAHB 1XDUA 4CCOA 5FKKA 1X2KA 2L54A 2KYBA 1QLYA 4XLAA 3BTLA 1U3EM 4EGZA 2RNAA 2E35A 4FQGA 5DD8A 3J81Z 2COZA 3P5JA 1XMAA 1VQ9I 1VQ5T 4M7DE 1IHWA 4RTTA 1MIJA 2JT1A 2NYXA 1YJNT 1YX3A 2VKDA 4Q4ZF 1Z6TA 1QVPA 1YS7A 5LHGA 2UWMA 4LK1F 3ERMA 1K78B 1RLQC 3BDUA 4UXNA 2QEXQ 2M35A 2DTIA 3KYCB 3JV3A 4OB3B 2DT6A 1O3RA 3DEWA 4EMSA 1GV2A 5GAOq 3BDDA 4HT8A 1D3BA 2FPDA 1XD7A 1WFXA 1MZBA 3VFZA 1OYXA 5HLHA 2P4WA 4PJOG 1VQMT 2FBKA 1LUJB 2Y0SN 5CVRA 3CDIA 3ZXSA 4FISA 4BQNA 1IZ6A 3JTHA 3FJ5A 4WTOB 3SQNA 1OMIA 3DV8A 4HVWA 4XU1A 3P9IA 1BYMA 1R5ID 2DVEA 3MHXA 1VQ5Q 1V5EA 1K0SA 2XSDC 2XPWA 4XLCA 2R5ZA 3B6AA 4LDWA 2XKOA 5F6FA 2QKMB 3S14J 4IOAF 2CSQA 2W1OA 3N4MA 1DPRA 3GYHX 2MLKA 2CDTA 2W85A 5FWCA 2EIFA 3FZVA 4LIVA 2OC6A 3A03A 4QSHA 1AZEA 2H8WA 3CC4T 2BTTA 3LSRA 4M7DF 3PTAA 2EFNA 4N0BA 1VQMQ 4J5YA 2KKOA 4H4KC 3MEAA 1K73U 4E7JA 3DLLF 1KIKA 1S6LA 2DRMA 1X27A 1MBJA 3EFOA 4RTVA 1UGSB 5KCOA 1YHQT 2K7LA 4B3AA 1Q95G 1HKSA 5KYXB 3I54A 2J6KA 1U5TA 3LSMA 2K7AA 1FTTA 3EUAA 4WXDA 3KLOA 4F7UE 4XKCA 4BE0A 1MGQA 3G4ST 1G6NA 2E3IA 3H0HA 4CYDA 2E3HA 1JT6A 1IRGA 2XU8A 4HDUA 1Y8RB 2HQHA 2HAXA 1B34B 3LSPA 4OAZA 3FHZA 1TP4A 2X0LA 4IOCF 1EFNA 4A54A 2QDLA 5L23A 4XK8E 3CPWP 2DEQA 1WZOA 4XICA 2IIMA 2MK5A 3F9KA 2Y4YA 2LY9A 2AHJB 4LDVA 4Q48A 1JB0E 1BN5A 3H6ZA 1FSEA 1X4PA 1EA3A 5J1UA 2V1DA 1JKQC 4B6MA 3JCMP 2P6TA 1HD3A 3DLAA 3JCMd 2GIZA 5CVIA 2MMPA 3CCUT 1BIAA 1SFKA 2DA4A 4F92B 3EGDA 4QQGA 3I56Q 3J7AF 2R5AA 3I0TA 1VIFA 4NDLA 2BE9B 5D5VB 3G71Q 4HT9A 1LOJA 3CTAA 3IHUA 1H641 2FZGB 2A61A 2PJRA 2M0OA 1IUYA 1ZGWA 2X4JA 3EG2A 4RGSA 1GT0C 4DOZA 1D09B 2JRMA 3HOUJ 3T8RA 3RI4A 2CH4W 1X1PA 2RD1A 5IYCJ 1D0YA 3V8LA 1AWCA 2D9TA 4B9XA 2DA7A 4QVCA 1W7PB 2HEQA 4C8QA 3HGGA 1VNDA 3CLOA 2CZ1B 4F7UF 2IGKA 3BTJA 4TV7A 3PJRA 3LWIA 1P7JA 3Q0VA 3CF5F 1QZEA 2EQMA 1MBHA 2LNBA 3H35A 2CSIA 3OMGA 2DDAA 1KD1C 4BNCA 3H9QA 2DA3A 3HC7A 5D8LB 5LGNA 3EGXB 3BCAA 5GAN4 3KCCA 3P8HA 1O3QA 4L5JA 3CP2A 2KRMA 2VGMA 1MHNA 2JTMA 3OIQA 5DEQA 3X25B 1GLNA 2M7AA 4M75E 4JRIA 5GAOr 1JE8A 2HQNA 3EFSA 2ZSIB 2MVTA 1KGSA 2XGCA 1OFCX 3K6GA 3LAJA 3JRDA 2XGEA 2DILA 3O8HA 1TNTA 2VT3A 3HYIA 4FE4A 4D5FA 2R7DA 1SD6A 4WCGA 1V5FA 1W4MA 2E2JJ 2CP0A 4LD9K 2OTJA 1YQAA 4M6YA 2QAZA 2QTXA 4OOIA 1ZBXA 5C6SA 3M0UA 1K4US 2OZ6A 1B1BA 4M3GA 3H0IA 2IS6A 4MMLA 4PJLA 1Z21A 3FXMA 2E60A 1VIEA 2A36A 1R5GA 2NVTJ 1V54H 3EG9B 5KHDA 2MAMA 3JCMg 5EDNA 2IEKA 1IXDA 4YRVA 4G7HF 1WPYA 5E1ZB 1XN7A 1ZGAA 3GNFB 4ATOA 5LRRA 4A4KA 2CRGA 4E7KA 2EA4A 3NARA 2BVMA 2COMA 4HLYA 5IT9K 1OV3A 2DYBA 2LG4A 4RLFA 5GAMh 4CDGA 2E71A 1AWOA 1B72A 2DXUA 3K9TA 1G3YA 4D6WA 3A1YA 5J40A 3JREA 3KLNA 3I53A 2DMPA 2ZJPF 3WGHA 2P5KA 3R0AA 4GYGA 4UUSB 4XQFA 5ICGA 5GTHC 4M75F 5FKMA 4E70A 3A02A 2I10A 4MNUA 2HDWA 3HDDA 2ZMEA 4MGRA 1W36D 2VXZA 1Q82U 1JJ2A 2QBYB 1E6GA 4C5HA 3RKXA 4B1RA 2YUOA 3IKTA 4XBFA 1VQNI 4KGVB 3DKXA 4EVIA 2L01A 5A2QK 2R5YB 3GWZA 4G7OF 1T95A 2HSEB 1K73C 1KQSS 1FTZA 1TH7A 1W36C 1WI7A 1RR7A 1CF7B 1JUPA 5HODA 1BK2A 1H8KA 2XKOC 4ZDPA 5FU6B 2DDBA 2CFXA 1TT5B 2H6CA 3A4CA 4KNYA 1DPUA 3JB9D 3C0CA 2BHYA 1CQTA 4M73A 5H2FC 2HOSA 1KZHA 2NUZA 1TWFJ 2R3SA 4ANJA 2I8DA 4E7ZA 3PIOF 1VUBA 1RESA 5LD2C 4AIJA 2M51A 2PUOB 2P7VB 4O3MA 4RAFA 3WTVC 5HS7A 2K3YA 1FY7A 1B8IB 1QBJA 2QDYB 4FSSA 1XCVA 2ADUA 3OIOA 3X24B 4AG1C 1RAFB 1VQLI 4KH1B 4A69C 2QSGX 4DEYA 1FOWA 1UHFA 1U5TC 3PNVA 5LBQA 1QMCA 2XAQA 5E1XA 2VONA 1CSKA 2IT0A 5D6EA 5EZGA 5K1YA 1ZX6A 4JS5A 1OKRA 2V7FA 4DNCA 4HPQA 1IXRC 4LUEA 1SSHA 2W25A 1IGNA 5GAN5 1P92A 1XS9A 2E2IJ 1WYXA 4P5OA 2FB7A 3FEOA 3M56A 3J80R 4JJBA 2Q2EB 4OU0A 1X01A 4CXFA 1VQKT 1M2OA 1LNWA 2EK5A 5FD5A 4BEHA 1QNTA 4NHJA 2V9PA 2X4HA 3VKIA 2JMCA 6AT1B 4DYRA 3QSUA 1UG0A 1TXQA 3O3KA 4DBRA 3KPHA 3IWZA 4C0DB 1FC3A 1YFNA 2GQIA 2GQQA 4F3QA 3O5ZA 4GCVA 3CDHA 3LFUA 4C8QD 1S3JA 1WA7A 2ZJRF 2NUTB 2YSQA 5DM7F 4BQOA 1A35A 2QVOA 2AKLA 2RGVA 1P9QC 4D0PA 2DMOA 2DXCA 3KP4A 4QLCU 2CYYA 2DOEA 3Q0UA 3SDGA 3DQVC 4C8QC 1ABOA 4PJNA 3AAFA 4YTLA 2E1MB 1KC8C 2VXFA 1S5LC 2FBHA 3VJPA 2BZXA 4PCQA 1K83J 5E1WA 1GRIA 3M0QA 1IF1A 1W1FA 1YJWI 3F23A 4Y4RA 2GTOA 3UWNA 1GFDA 3TL4X 2QUFA 2NOGA 5JR3A 4BDZA 1B34A 3GNGA 1ZN2A 1YNZA 3K1NA 3JSPA 2UXNA 3GCMA 1LJOA 2PMZA 2FYKA 3LH5A 4YG2F 3GOXA 5CVVA 3DTKA 3IAS2 5FROA 2L89A 2VGNA 3DLLA 3JCMJ 1X1DA 3JRHA 1AZGB 3QJ6A 1XDSA 3A0HC 3H5RA 4FCYA 2DMUA 5KNLA 4PJ0C 1I6HJ 2ICWG 3JCMV 2TDXA 1UTIA 1Z3YA 2LCCA 2VKNA 3KYLA 3ZQ7A 4ESBA 1VQOA 3MCZA 3S3NA 5DDGA 2XMFA 4CO8A 1AWJA 2ZSHB 3ZEHA 4M9SA 4D5CA 2LT4A 3I9V2 3BJAA 2LP5A 2DL8A 1R49A 1OCOH 2AQEA 2L9SA 3H8ZA 3IKVA 4F04B 3KP7A 2RQQA 1RIOH 1E17A 3MPUB 2OTJT 4IEJA 4K2EA 4IJAA 1W5CC 2PVOB 4KMUX 5BMZA 2JXBA 3TDUC 4ITVA 4GO1A 3EGXA 1QVFA 4EPCA 3S2HJ 1IN5A 1S7OA 1X3ZB 4L9TA 4D8DA 2ELJA 2DZCA 3CMAA 1VQ8T 1KQSP 1Q82C 1FX7A 2E5ZA 1M1EB 3WODF 3ISPA 4ENMA 2YUQA 1L3LA 2VE9A 5CKBA 5I2MA 3ZP5A 3NGPA 4P5NA 2Y31A 3P8BB 3SJMA 5GADJ 1HC8A 3K7AJ 2J5OA 3OYBA 4JLIA 4LN2A 5DCMA 4C0ZA 2OTJQ 2QQRA 4RG8A 2ELHA 2ZMEC 3I5SA 3JRAA 4UV8A 3E6CC 1SD5A 2M4KA 2GBQA 3TP0A 3VUBA 3JW4A 2O3FA 1AWWA 1OOTA 3MKWB 2HVSA 4W1UA 1OCZH 1RACB 2V1RA 1T39A 3CUQA 5GANg 2M5WA 5DS9A 2D8HA 3CCQA 1M1KU 1O57A 3LSTA 4HOBA 2OUMA 3E7LA 1WI9A 2EYWA 4N4GA 3CMMA 4ZC3A 2IS2A 1R4MB 2L02A 2M8EA 3I3LA 1EJ9A 1WQ7A 3NTHA 2YRVA 3CD6A 3T9NA 4J01A 3ZMZA 4A3CJ 1M5Q1 2KY9A 1Z91A 3W2WA 2XG8D 5CAIA 3D5SC 1VQLT 2M87A 3JAMZ 2F2XA 4GRIA 1D8JA 3S93A 4IPAA 1QRYA 3SXYA 1EH6A 2CMPA 1XG1A 3LSHA 4OAYA 3VYSB 4B47A 2L8DA 2QI2A 1Q81U 4UUSA 5D4RA 4PJJA 3DPTA 4A6EA 4GGGA 2KRNA 1FIPA 1W5SA 2OV7A 4BBRJ 2HKNA 3HFOA 3E2UA 1R58A 3E6BA 3IP4B 3Q9VA 1BBZA 3VYHB 3V8JA 3BY6A 2QBYA 1TW2A 5E8GA 3QPTA 3J80K 2LDMA 3FXUA 3H0DA 2RNGA 1YRNA 2X3XD 2HKQB 2R5YA 1J0RA 5LL6S 2EGEA 1UGQB 5LGUA 3CMEA 2X9DA 3LQRA 2CUEA 2VUBA 4IUUA 3GEZA 1RNLA 5M5XJ 1CF7A 1GV5A 1IO2A 2QGGA 4ESFA 3TW6A 1E6HA 2MW8A 5JFRA 1OPLA 3CJQB 1BC7C 5GANj 1POGA 2GA2A 4AU7A 5K7HA 3PNTA 5M3FJ 3I55Q 2E64A 4OP0A 1K4SA 2FVUA 2LX9A 1W2BS 3N05A 5BPDA 2HNIA 2RV8A 2M3AA 3GTPJ 1E2XA 3TO7A 3H41A 1VQ4T 1DU0A 4JPBW 5KYWA 3VYGA 5HNFA 4V2GA 3HM5A 4MDWA 2JN6A 1KU7A 4AIDA 1MDMA 2CQ7A 2R7FA 3PM1A 2JA6J 2Y2ZA 1KU3A 1FBQA 4O5VA 3AFHA 3K4CA 5LHIA 1CGPA 1WJEA 4C2UA 2FZCB 2PLYA 4A93J 3ULRB 4M7DD 2GIVA 1LDJA 1YW9A 2BE5F 2HKOA 4R79A 5FRNA 4G8XA 4UB6C 2FHDA 3DP7A 2PNIA 3F8BA 3V8KA 2E6ZA 4NS5A 3PIOA 2RHZA 2K27A 2ATCB 4FW2A 3TBIA 1BI0A 1T08B 4J9IA 4M78E 1LDDA 3F6VA 3OYEA 3JCMc 4XLNF 4PJOE 2L5QA 3GLLA 4IIMA 1T0JA 1TZLA 2F4OB 2DYSH 4RDUA 3QO3A 5IY5H 2KT8A 3HOSA 1BIBA 2EFWA 3QG1A 3TSZA 3ZMVA 1WDXA 4RCBA 2KMUA 2JZYA 3KEYA 2D1VA 3CCJI 2DO3A 3CC7A 5CKDA 2EB7A 3CCEA 2V6EA 3OR1C 2AT1B 3PUFA 2OTLA 2RQPA 1AWXA 5HS8A 4DJAA 2CQKA 3K4NA 2EPDA 1X4OA 3I59B 2ZXWH 2IGMA 2XDPA 1NYFA 1MSFC 1HW5A 2WAQA 3KZZA 5B1AH 2KPMA 1VQ6T 3MN2A 2NWMA 2V4JC 1FBSA 1WXTA 1N9RA 4BJ5C 1K8AR 2BVLA 2LFBA 3OBYA 2M0MA 4HYEA 1DP7P 2KRSA 5IH2A 4FX0A 2YS9A 1SFEA 1Y8QB 2ZXIA 2LBFB 2LD5A 3K4JA 2XC7A 1V1CA 1QO0D 3SB2A 2H3JA 2NLUA 1MD0A 2BGCA 1FYKA 1OZ3A 3KP3A 2RVCA 1M9SA 2PMHA 5HLIA 4E7LA 1Y96B 4FM4B 5EYRA 4JJCA 4AT1B 3ZQCA 2JUGA 2KZVA 5J47A 1WGXA 3CDLA 3PQKA 2L0KA 1X2MA 2OD5A 2CW8A 3MWMA 3GVAA 3SFIA 2K5IA 1GHCA 2K4BA 2EJ9A 3ZCOA 2CYZB 1R22A 1BI1A 2RJCA 1T8IA 1B3QA 4IUQA 1VQ6Q 1M1KC 3GO5A 2P4RA 3QJYA 3VS7A 2UZKA 3G1MA 3HHHA 3U2RA 2A68F 3J80Z 1VQ7I 2WY7Q 4LOCA 4BU2A 1QP3A 5D6YA 4ZH4F 3RDVA 1VQOQ 2X48A 1O4XA 2K9NA 4KGZB 2ZCFB 4AIKA 1UAAA 2QQ9A 1ZQ3P 1GBQA 5ICFA 2KIFA 2QQAA 2HQAA 1HSJA 1UJ0A 3FMQA 2VC8A 4J6YA 3M8FA 4A12A 1GVJA 3WVDB 2E5QA 1RUNA 1SVMA 2LR8A 1ETWA 2EYZA 2EYQA 2BBYA 2QF7A 4CGZA 3CUQC 2K5CA 1MBKA 3VSLA 4ETSA 1SAUA 2O6GE 1WX6A 2GCXA 2NUPA 3VS5A 4ENNA 1YIJT 2AHQA 1Q81C 1LDKB 3PO2J 2A7YA 3R61A 1WNLA 2KR3A 2M16A 3MEVA 1UELB 5CO7A 5LJ5g 2DT5A 1HKTA 1V76A 3G6EA 3QHSA 3LW5E 3HRUA 2CQQA 3CCSI 2HZDA 3OYFA 3JRGA 3ABLH 3QYGB 3K2AA 1ZA1B 2DLLA 5DM6F 2QEXI 2HL3A 2JUFA 2FA5A 1Q1HA 2GOXB 3MMYB 3OY9A 2ZCWA 2COBA 4FT4A 2MF2A 3UF4A 4EDUA 5J6XA 1YJ9A 5IYBJ 2FMLA 1W2BP 2QENA 4YFKF 2VOOA 1F36A 1QZYA 2H1LA 2IG0A 3N97A 3CCQQ 2P5VA 3C18A 1AOJA 1YI2T 1VQ5I 1U1SA 2LKXA 2EKHA 2EFPA 4HAMA 2LYCA 3A8GB 2EVRA 1I81A 3VWBA 3A98A 2LREA 3EFOB 3ZQLA 4FW1A 4M75D 3CD6Q 4C30A 1BW5A 1DQUA 2Y69H 1DU6A 3BG9A 3PFSA 2RM4A 2XVCA 1VQPA 2EQUA 4A3BJ 2XK0A 4DBFA 2K86A 4LDUA 1WJ5A 5HVQC 4J9HA 3CEYA 1NJIU 2O0YA 3S16J 1ZAOA 4ESJA 1RUWA 4OMNA 4M75C 1M3AA 1C0WA 2FOWA 1L0OC 3P9KA 2VLAA 1RLPC 4A3JJ 1GL5A 5FFZA 1P6RA 1VQMI 4A0XA 1J75A 2YLCA 4JJDA 2AQFA 4QPQA 2KE9A 2M9UA 4ZDOA 3KUFA 5DY9A 3F8CA 3BQYA 4Q5SF 3OYMA 2K2VA 3SDBA 1JKRC 3OYAA 3SD4A 5A2QE 3I55T 2X4YA 3WVEB 4I2OA 2ED1A 1S72T 2KROA 1XGNA 1M2VB 4RCCA 2H8RA 5EJCA 4CYCB 4HQEA 2C0OA 4M77E 4RKUE 5D6WA 1K4TA 3BR2A 3BR6A 2ZJQF 3CJNA 3LOCA 2RN7A 2QYOA 3PMIA 3HSBA 2MYSA 3E5QA 1HK9A 4HEA2 2MC3A 3MAJA 1D1BA 5D5UB 3MFKA 5F08A 1IDZA 2W4SA 2RA2A 3A52A 4ZZDA 3TVTA 3J81K 1A0NB 4BL0B 5KE3A 3C7JA 4C8QB 3OYDA 1QCOA 5A0GA 5M5WJ 1YHQI 1TUGB 2X1CA 5JVTA 3CCJT 4MQVA 2Y0SA 3MZYA 5TISC 4BS9A 4ZN1A 5CPRB 1NTCA 3SEQA 1PWTA 2M1HA 2EZLA 4N4HA 3JRZA 3G71I 4C0DC 1S72Q 3TMOA 2DE0X 4IL6C 3G4SI 3TEEA 2P4TA 4HF2A 1Z9CA 2BE7D 4Y92A 2R7XA 4KN7X 3I4PA 3RKYA 4BY7J 4HNVA 3NEUA 3G1OA 1GXIE 1MJAA 2KI7A 4B3XA 2LF8A 1FMKA 2H6BA 2VJJA 2LC4A 3OW2A 1I3AA 4RM2A 3G1LA 1E7OA 1K9MR 2XAJA 1E0EA 1D0ZA 5KYUB 2E1MC 2ED0A 3VUZA 4A0YA 3A8HB 1BJZA 4JJNK 2DFFA 1X43A 2O4XB 2M02A 2QQBA 3MCAB 1XJWB 1R0CB 1PP8F 2VWFA 2KYMA 1H3ZA 1O3SA 2VXEA 3WXMB 3VYTB 4C3JJ 1K73R 4II3A 1HW2A 4KIBA 1LEBA 3SFMA 1K8AU 2OF7A 2R4GA 4M6XA 1JHFA 4IXAA 2R7ZJ 1IN6A 3GP8A 4DOVA 1XSXA 1HKQA 1WQWA 2LMDA 3A5ZB 3M1CA 4L5GA 5GAN8 3CCMQ 3K1MA 3CC7Q 1KA8A 3QOPA 4EJOA 2H8HA 3JB9G 3CCEQ 5J26A 2OTLQ 5GAOm 2DK8A 2FEIA 4BD3A 1VQKA 3CC2T 2OI3A 2LC2A 3C94A 2HVRA 3DB3A 1U8BA 1JKOC 3OMYA 3OYLA 1M27C 2DERA 1SHFA 3T0YA 3FK6A 2Y4XA 3ABTA 3VS1A 1UDLA 2OQRA 2C0TA 2R7WA 2MWPA 5I21A 3U23A 1IRXA 2QA4Q 5D4SA 4EEFG 3CCRA 2LDUA 1U06A 3CBPA 4AFQC 4JP0A 5L3BA 2ESHA 1OCRH 2X6WA 3JR9A 3L1AA 3UNGC 3IRQA 1YYVA 2ZB9A 3ZL7C 1Y07A 2CW7A 5IP6A 1I1SA 2V26A 3QWLA 4AYBN 2B86A 2QEXT 4XTZA 2VV5A 2KDZA 2KJBA 3MD2A 4C2MJ 2BIVA 1F1BB 2DU9A 4ZDLA 4DGWB 2LRQA 5GMKh 1WJAA 2O03A 4YEJA 1WH7A 1OCPA 2R7QA 5CCAA 1T38A 2Y90A 2VQGA 2ZBKA 3K4LA 2Z99A 2DYRH 4QKUA 5LJ3e 1G5VA 1K0XA 4C8QG 4M72A 1TT0A 2NVUB 2LQWA 3I58A 2DI3A 4XK4A 2XB5A 1DUXC 4RG2A 2IAIA 4JRQA 4LD5A 2HFHA 5FLMJ 3DLMA 3TQ7P 5CVJA 2J7IA 1FZPB 1S1NA 2O5RA 2CG4A 4MHGA 1QKWA 1BCMA 1BR4A 1WJDA 2BY0A 2KEAA 1FYMA 3PVLA 2M30A 1QQIA 2WSFE 5L8RE 1KC8R 4YIFA 1VQ9A 2LTOA 2G7HA 1GCPA 1EV7A 3FLGA 1V55H 1R0BG 4UVBA 4H0EA 3G6EQ 2F4MB 3FIWA 5GAMg 3ERED 2K3BA 4PK4A 1BW6A 2Q8KA 3RZOJ 2VC0A 5D5XB 4Z6YA 1QA6A 1V3FA 2LLKA 2P6SA 1SEUA 2KT1A 3NWTA 3IL2A 1RAIB 3HBLA 3C1DA 4MIMA 1PUFA 2BXZA 1XOVA 2PJPA 1YJ9Q 5CQGA 4BEHB 1KHCA 1R36A 3H0GJ 3J7AY 2CQNA 1BOBA 1K9MU 5A0DA 5J3BA 2LQ8A 4BUPA 1BR1A 1ZUKA 4PUSA 2XDVA 4I76A 4BYYA 1VQ7A 2VPLA 5DLQE 2HI3A 2RQVA 5GAN2 3QP5A 3HPHA 4ZNXA 2K85A 3FDRA 3HRSA 1YITA 4XKWA 3S6WA 2IPOB 3L2CA 1VQPQ 5FO5A 2RJFA 2SEMA 1Y7XA 3MZ8A 2NVXJ 3I56T 2W7NA 2KNBB 2DT7B 2HYFA 1FP1D 4M3BA 2KMTA 3TW7A 5IAYA 2BY1A 1QWEA 3OR2C 2BZ8A 3QWYA 3G71T 3EQLF 1RL2A 1ZSGA 3PUBA 3KX2A 1Q82R 4GYIA 1H8AC 2KL4A 4EIKA 2IA2A 2CQXA 4I0AA 4PDKA 4II1A 4HF1A 5FW9A 2EQJA 3JRBA 4XOPA 1KG1A 4HSRA 4I01A 4M7DB 4OMYA 1M4ZA 4ZYDA 2VJ5A 1WFWA 2JN0A 3EPZA 4RM3A 1OR7A 2L4MA 2F5DA 4CZZA 5CKTA 4UUVA 1R77A 1ZRFA 4IUVA 3DBRB 3J80E 1QPMA 2JA5J 2HVQA 4A3DJ 1N78A 2RI3A 1N77A 1EZZB 5GJVB 5HOOA 2A3SA 2K4JA 1QKXA 2E1HA 3NTIA 4XTVA 1M2VA 3KYDB 3A2KA 9ATCB 1Y1VJ 4CA0A 4CYCA 2EJGA 4UVCA 4A5MA 4CUGA 1SRMA 2RK1A 3CXCS 2OZUA 4JOMA 2DPDA 3C3WA 4AVPA 4KDPA 2CGHA 2BV6A 4G9YA 3IQLA 1E3OC 3DWLE 2CH0A 3M9AA 4KIFA 2L0AA 3OS0A 4LD6A 4DYQA 1ULYA 1TWGJ 2A6HF 3OYHA 2RJEA 1HBXG 2VN2A 2KDOA 1QHHD 2MABA 3D1NI 2O9LA 3QZ5B 2IJLA 3RKQA 1F43A 3JAMR 1KHIA 3A8OB 5GAN6 4CI0C 2A5YB 1XGOA 1DP3A 1SVLA 2P81A 4KT5C 3GTOJ 2QG9B 3FIFA 1BC8C 2M7BA 4I02A 1J09A 2KIUA 2PVGB 4C0GA 2E1CA 2ME6A 2YRCA 3HEFA 2PEXA 3Q3SA 2RN8A 4KIGA 4HSTA 3K1PA 3KP5A 2CS3A 1RZ4A 4ZGJB 4Q47A 4AC0A 2FRWA 3MEXA 1KC8U 4LDXA 2M2EA 1UGPB 2L7FP 2XPUA 2EQIA 2DTZA 3HUGB 3OMCA 1WH5A 2O31A 2RF0A 2RQUA 2EWNA 2XDBA 1P7IA 1IV8A 2WB1N 2DD5A 2XGXA 4RA2A 5DCMB 3M7GA 1VYUA 1YOVB 3BG3A 5HLTA 4WWCA 3HOZJ 1FT9A 2W10A 4F7UB 2O4XA 1P4XA 3VSKA 1QHGA 1LVAA 3GXOA 4D9JA 1OI1A 2A69F 3I9QA 2ID6A 2WTEA 2PQWA 4A4FA 3KIOA 3EYIA 2VBZA 2X6YA 1C6VX 2HTSA 2DBKA 1SD7A 1IGQA 3CUQB 2AS5F 4C92D 2HL5C 4C5GA 1IRZA 3OYGA 3W2VA 1MBFA 3R60A 4NOYA 2OAUA 1NH3A 4C5IA 3RBBB 1M8VA 1STZA 1VQKQ 5LJ3j 2GOMA 2IVWA 3CCVT 2OTJI 3UT1A 4BBSJ 3FJPA 1K6OA 2XF5A 4P96A 4LFUA 4ORZA 1G3TA 4KA4A 2L3QA 5F1RA 4M78D 3S32A 1Z0XA 2KVQG 4C9YA 1NYGA 2RMOA 1I5OB 2WV1A 2JM8A 3FXRA 1VQ8I 1RRJA 2KGTA 4O6JA 4BQAA 2GNCA 3QKJA 3CCRQ 1ETXA 5J1YA 4RS8A 2CP7A 3QBYA 2QSFX 3FF5A 3WU2C 5F0CA 2VIXA 2VKHA 4G6TB 1TQMA 3BP8A 1KK7A 4J6XA 4M7DG 1GBRA 1K9MC 2FRHA 3CJTB 1WXBA 4IHVA 5KCHA 2A08A 2GBYA 2DOFA 1U3OA 3CCVQ 2A0FB 3PT9A 5IP7J 5LEJA 3M57A 1OCCH 2RKHA 3LWFA 1ZTRA 4QTRA 1YRNB 4LXCA 3ROUA 4AG2C 2VBYA 2E7WA 3T1BA 2PX9A 1IN7A 1TWBA 2EGAA 2RI5A 1SEMA 4OGEA 1VI0A 4XTUA 1U9NA 2KFDA 4I7HA 5E79C 3BJ6A 3Q5FA 2DTOA 3EG0A 7AT1B 1UGRB 2ZXJA 1HDPA 1WWXA 5IOYA 1FIAA 2JA2A 3BTCA 5M5YJ 5FFXA 2K5LA 3L1PA 2EPFA 5HDKA 1Q86C 1VQNA 3V42A 4M75B 1BU1A 1AOYA 1A36A 2HYJA 1UFMA 1U6GA 2M9HA 3VS0A 1DDNA 2G3RA 2X1DA 3AHUA 1SMYF 1B7TA 5KYYB 2ROTA 1R00A 3I4MJ 5KYWB 1EH7A 1VZ0A 2CUJA 2L3DA 1XSDA 1VQ9Q 2ISZA 1MDMB 2K40A 2HZYA 2W57A 1Y56A 5F0FA 3VB2A 3SZPA 2WWYA 2QYZA 3L2ZA 5HY6A 3CXCP 1JTXA 2XI9A 3M0SA 3LL7A 2YDLA 2CU7A 3K70D 2DJQA 3REOA 1WJQA 4R55A 2V8KA 1FYLA 1NLOC 1IN8A 2L2OA 5J4VA 2BW3A 4KT6A 4RMOA 2XF6A 1S7EA 2BUDA 2DVJA 3M8EA 4F7UG 5J3LA 1BR2A 1M1KR 3R6OA 1X3UA 1T3LA 1OR7C 4N0AA 4LLNA 4PL6A 3QYFA 1YS6A 2RREA 3E5XA 4RGUA 1OYWA 3LYIA 3PNWC 1JJ8C 2HDDA 3LGFA 3QYBA 1X1CA 3LSKA 1EX4A 4RB1A 3RESA 1BI2A 4NBQA 3SEMA 2Y0MA 5FLXR 3QU3A 4YFXF 4Z02A 2DLPA 4DBHA 2HR3A 3NFCA 3F8MA 2O01E 5LRSA 4IIOA 1YITQ 3ZMUA 2RPNA 3CLQA 1FWZA 5GPAA 4U7BA 4LJZF 1B9MA 4DYCA 2A6TA 2HNHA 1VQ4I 1HSTA 1NG6A 5GPCA 2QWWA 6PAXA 1FOXA 2MD5A 1QU3A 2COYA 1Q81R 3MO8A 2FQ4A 2L3PA 5DD4A 4A2UA 1KYWA 2P0WA 3JAMK 3OYNA 3S2DJ 1QVGA 2ETHA 4B8XA 1YW8A 4P9UA 4CCNA 4E6KG 2HDAA 2F69A 2V8JA 2KISA 5ED4A 4M7AE 3IH2A 4QVZA 2ESWA 1P4AA 1OEBA 2AZSA 4P9FA 3FK7A 3GZNB 5B3SH 4OINF 4EJUA 1LEAA 4F55A 1K61A 4JX4A 5KAFC 4MO7A 2N8GA 3X2QH 4A0ZA 1VTNC 1MNMC 4M7DA 1ACMB 3JCMe 3EHQA 3QUIA 5J1RA 5IYDJ 4X9CA 2LSOA 3OSSC 5GANd 2R7UA 2K9GA 3JSCA 5AYFA 3IAM2 1YJWA 4BI8B 3MKLA 3HRMA 1Z7LA 5KYUA 3J81E 4F93B 3OSVA 5EG0A 3FM3A 2A37A 3SZTA 3V7SA 3QODA 3M4OJ 2DL3A 4OMQA 4LITA 3HIFA 4Y52J 4Z88A 2D6FA 4RB2C 2VJIA 2R0QC 1GFCA 1OCTC 4Q5WA 1A31A 2E2HJ 3W6KB 1WZ2A 3GTJJ 1JXSA 4M75G 4M7AF 3QP6A 5JVGF 5FLVA 1F5TA 3RZDJ 4LE9A 5IN1A 2A05A 1YIOA 1RKWA 5DCFA 2LVMA 1VQ6I 1YWPA 2NUPB 2DRKA 3S1QJ 2DD4A 4M77D 1OPCA 1JGSA 2OCEA 4NB5A 2LY1A 3OS2A 1VQOI 1ZUYA 2EYYA 2J5PA 1J7KA 2DL4A 3GUDA 2CFOA 3F8NA 3HHTB 1T98A 4FT2A 2L7ZA 3LAPA 3CZ6A 1X19A 3HRTA 5DV5A 2RI2A 2MSYA 4ZJZA 1PJRA 4WXCA 1YCYA 4BXUA 3AG1H 4GXOA 4QPOA 1C1AA 2X1EA 3A01B 4MFEA 2ZZDA 3M0TA 5H6RA 2A5WA 2HTJA 2RAEA 4BHBA 3S17J 4RTZA 1ZQ1A 1TLHB 3DBHB 3HUGA 4HA8A 4B4CA 3S3OA 4F7ZA 2RQTA 2ZO4A 2MWOA 8ATCB 3F8FA 3VYRB 2EW3A 4IKFA 2LT1A 2ZPBB 1WCMJ 3URGA 3HL2A 4F7UA 2NOJB 3E9GA 1UJ8A 5GMKm 2DFUA 2JM9A 1TQPA 4J83A 1NK3P 5ECAA 3QAHA 3OBWA 4L0YB 3QYEA 4FE7A 5GP9A 4ZYEA 3BR5A 4A3FJ 4MEXF 3BTIA 5E20A 2E10A 1VFCA 2W84A 2GFUA 2WSCE 5LJ3f 2ZAEA 4XQ3A 4EMKC 1TW3A 1AVZC 1AKHA 1RR8C 2A3LA 1OU9A 5FKOA 1WSUA 4KISA 2EBPA 1KQ2A 1E3HA 4CZCA 3DBLB 5GTIC 1ZG1A 2JTFA 2ZGWA 4RTXA 3HTRA 3M1EA 2EQKA 1YIJI 5IPAA 4J6WA 2HWVA 2FPFA 4Y3OA 3VS6A 1ZR2A 5L3EA 3CCQI 3H3VK 1YBYA 5J8CA 5KK1A 2YX7A 1ZG3A 3GFIA 4XRFA 1FOKA 2F5VA 3SZGA 4Y91A 1J5YA 2J6FA 2K2MA 3CD6I 4FHTA 1KQ1A 1PC0A 3EGUA 5IP9J 4EMHA 4B48A 3NWSA 4RAGA 3EHRA 3E5UA 4BY6C 3BG6A 3OOPA 3RCOA 2RHUA 2EBIA 3WE3A 4EQQA 4IHWA 3EUKL 4U7DA 2E7XA 3KZYA 4DA4A 4UC4A 5JHFA 5BPIA 3ASNH 2R7RA 4HF0A 2WSEE 3TREA 3PO3J 3KFVA 3ZQIA 2HCKA 3GX4X 4HCCA 1I50J 2FJ1A 1WXUA 1Y0UA 2W48A 5DM7R 2XICA 1YI2I 1VQNQ 3AL0B 1OPKA 3QDFA 3ABUA 4N0AC 4MMKA 4MLOA 5E8IA 2GXAA 4CCMA 4X6AJ 1FMVA 1G8XA 3O8GA 2ZFWA 1AD5A 2CS7A 2DN0A 3TU4K 1D1AA 4M75A 1ZK8A 2NS0A 4HZFA 1ZRDA 3M55A 4PNOA 4EM0B 3A0BC 4CC7A 5F04A 3CF2A 3WU0A 3HKZA 5GAEJ 4M9XA 3KP6A 1GXQA 3LLRA 5FU7B 4E47A 5KYYA 1XMXA 5GAN3 2L4AA 2OX7A 2E1OA 3H92A 3RPUA 3J7ZI 3VV0A 3GTGJ 5GJWB 3HSRA 2LNHB 3I5RA 3FKJA 3C2BA 3H0FA 4RTYA 3ZRGA 3H36A 4C92E 2OPTA 4K11A 1I8FA 4XLEA 3HTSB 4S0HB 2K5FA 1M1FA 2LCSA 4BY1J 3I55I 4EJWA 2D0QB 3LX7A 3B02A 4Y13A 2AO9A 3MP1A 4LNPA 1S72I 5LHHA 3G2BA 3MKZA 1W6XA 4TVRA 1T6SA 4KT0E 2DMQA 3EG3A 2F2VA 1USSA 2LH9A 4HX7A 2XKPA 2VQLA 2F2EA 4Y17A 1ZKGA 4CCKA 2ECZA 4XU2A 4M7DC 1PCXA 4IRHA 2ME0A 2VI6A 1G2BA 3VS3A 4KUDK 2DQRA 1KU9A 3PNYA 3EYYA 3RTRA 1WJCA 5L3FA 1VF9A 3RPQA 3L2WA 4G7ZF 2KQWA 2DA9A 4HCKA 1OJLA 2K3FA 1NJIR 1K1ZA 4OMOA 5LJ5d 1E3PA 1NJIC 1JJ6C 4HXJA 3EDPA 1AT1B 4UUTA 1KQ0A 2M8GX 1PSFA 2XAFA 3C12A 1KQSA 2DZ9A 2YPRA 1YLFA 1JUMA 2V1XA 5D5WB 1MNDA 4P55A 3OYJA 3JRIA 2GTJA 2KK4A 4IUTA 4AFUC 1BOAA 2MBFA 4P1WA 4FX4A 1FEXA 2KQRA 4L9VA 1FMWA 3BZKA 1O9SA 2CP2A 2RNJA 1SKUB 2QQ8A 1HXDA 2KT0A 3NTKA 4XAXB 1VQOT 4C92F 1Z9QA 2RQRA 2ZFUA 2CREA 2MUNA 1TC3C 3PVQA 1PG5B 3HG9A 4KICA 3CMEQ 4XRSG 5ICEA 4PFOA 3ZMDA 2JOYA 5GANe 2JTVA 3BZ6A 4IQ4A 2D8JA 4JZ3A 1W5TA 2XGDA 2X6OA 1HLVA 2X85A 3ZQQA 3M0PA 1QP2A 2F5EA 1YJWQ 1JRIA 3META 2D5VA 4Z89A 4M78F 4J9BA 3K0LA 4E7IA 1Z6RA 1LQ1A 2QA4I 2LOOA 1Y6IA 1VOMA 3VS2A 1X6GA 2YR2A 3CMAT 2OA4A 2WBMA 3CPFA 4BJ6C 4IURA 4EATA 1KQ8A 4OB1B 3CD6T 2HU9A 2JSPA 2FL7A 1VYVA 2DODA 2MIOA 3INZA 1H89C 1YCSB 1UG1A 2KLOA 4LK0F 2CP6A 2Q0OA 2FBIA 1IREB 4LB6B 4YFNF 3CC2I 5HDGA 4XLPF 2J05A 4XU3A 2QGFB 4EMGA 1H9TA 4M3EA 1C0MA 4KGXB 2JQ7A 5FLXZ 1ZUUA 1U9OA 1TBXA 4BI4A 2DTHA 3OYIA 4M78B 1MMNA 1D5VA 1NLPC 5FWBA 4YELA 3HOTA 3CCLA 3J7YJ 1WHJA 1PNJA 4XM3A 3ASKA 1UHWA 1G2HA 2DL5A 2LMJA 3CCQT 2KXCA 1NG7A 3HGYA 3HPGA 1J9IA 1ETQA 1MV3A 3CMAQ 3HL8A 3L2VA 2EQRA 2LJ0A 1XGSA 4IHYA 4B44A 1X69A 1ZA2B 3TOBA 1JO8A 4KJZA 2M45A 2HBWA 2M34A 4XR6A 2R7TA 3HTUA 1PUFB 3A01A 5DUKA 3O6BB 4IQJA 3BE3A 4XONA 2O8KA 3SEZA 3S1MJ 4Y7NJ 2XIDA 4M7AA 2FF4A 3CCSA 2IGOA 2MC4A 2CWEA 3DXJF 1I4K1 4ESRA 3QIIA 4KMFA 2WV0A 4IF4A 3J7AO 2DK3A 3V7RA 3WHBA 4LB5A 3HOXJ 1U2WA 3FXJA 3LFKA 1BKBA 1NM7A 2JT4A 2L9RA 1SG5A 2LJ1A 2O2OA 3ME9A 1IUFA 3ZQFA 3PFYA 1M3BA 1Y0MA 1UJYA 2EZHA 2D1XA 1ZYRF 2UUZA 2OU2A 4FT8A 2OBPA 2DA6A 4NQWA 4JUVA 3N5BB 4F16A 2JWTA 1SFUA 1BM9A 1OQKA 2KDSA 2V8IA 4QVDA 4HX8A 4AYBA 3RPUD 3GBQA 2VE8A 2CT4A 1YJNA 3UATA 5H6QA 3ZN0A 2XHKA 3RSNA 4D7MA 5TJJA 3CMYA 3REBB 2R92J 1HW1A 1OX9A 3BFMA 2IGNA 1ETOA 4XKBA 1YO5C 3M59A 1BJAA 3PE0A 4MZTA 2HSPA 4C3HJ 2GQVA 1G3WA 3UKGA 4BH9A 2XROA 1GVDA 3NQOA 1VQPI 2F1LA 3BROA 1HQCA 4JK1X 4XRSA 2M0YA 3C95A 2DBBA 3R6NA 5AIPA 2IPQX 2GGRA 3HHGA 1HF0A 3JCUC 4PKCC 4RMNA 4IZZA 4GLMA 4MZMA 1BBYA 1ETYA 3OQ5A 1VQMA 4EGYA 4BXFA 3K4MA 1M3CA 4OIRF 4HX4A 1XMKA 3RQ4A 1B07A 1N25A 1ZSZA 4E2FB 2E1NA 2JA8J 2NVYJ 2DAOA 3PIPF 1I5ZA 2C0IA 2QASA 3SFZA 2R57A 2UXXA 2R7VA 1MUZA 1ZLKA 3CUOA 1NG2A 4J9CA 2CV0A 4C92G 1FNNA 4IHXA 3M9QA 3GTLJ 3W3CA 5EGOB 2KHMA 3X26B 2EFQA 4HLXA 1PP7U 1LKXA 1M90U 4DBQA 1BL0A 2H27A 3CC4A 3I56I 1F9NA 3PGGA 1DJ7B 4X0GA 4KULA 4Z8AA 2PMUA 4R1HA 5J8FA 2F6CA 3LH0A 2QSHX 5CLSA 2VUMJ 4ZTJA 4M78G 2MZ4A 4OF1A 3KXTA 1QPIA 2WACA 4GDFA 4J7IA 1YHQA 1N8RU 2KJCA 2W00A 3HZJA 3TO9A 1HCRA 1LFPA 4RLQA 5FKLA 1JU5C 2K9MA 1JUSA 3D7SB 1FLIA 1G83A 4E7SA 3DEEA 4U87A 4KYWA 4PJOF 3CC7T 3CCET 3PSIA 3DB4A 3OS1A 2P5LC 2EH3A 3G4SA 2D45A 2OTLT 3JCMX 1ERDA 2JMAA 2DJNA 1N9SA 3IC7A 3H5NA 2EYXA 2Z0WA 3CCMA 3VYUB 2DYIA 4M77F 1MH3A 4BGDA 2EV6A 2YXYA 5D7UA 3TGNA 3JCMf 2HOAA 2KP6A 1AHDP 1RC9A 1UHSA 3R6SA 1IB8A 2EKOA 4FYWB 4C0FA 3JCMb 3HKSA 2CJJA 2NRAC 2Y75A 1YFHA 2OJED 5JI6A 2R93J 1PD1A 1P2FA 1XTAA 2QA4T 1CKAA 3CCUA 1UG2A 5K7ZA 1Q86R 3MKYB 4XTWA 2JTEA 2EZKA 5LJ5e 1ODDA 3L09A 2L9NA 4BE2A 1Q1VA 2DEUA 1JJ2S 2E34A 3M4GA 2ECCA 4KN4X 4GY5A 4F17A 3KEOA 5GAMd 5K5QA 2X98A 1A5JA 3JAME 4OMFB 1T2KA 4ZGDB 2JPBA 2CUDA 3QPHA 1K6YA 2HZTA 4RAZA 4CC2A 3WTUC 2K02A 3OSGA 2BKDN 4J9FA 1IRFA 4M77B 4XTXA 3TKYA 3L2QA 2EJFA 3BR1A 3MQ0A 3QQAA 3S8PA 2NAZA 1A6QA 1YJ9T 1D8KA 5C4JJ 1EKEA 5FRMA 2X35A 4OMPA 2JPCA 2DKGA 1W2BA 2DMNA 1TOVA 2F2WA 1U8RA 1H92A 2HQ5A 3ZPLA 3CQZJ 1D3YA 2H94A 2SRCA 2PN6A 3LQQA 1JBMA 3SWNA 4OGCA 4ZGEB 3S3MA 2HQEA 1OZ2A 1K7AA 1RABB 2NNYA 5GMKe 4LUDA 5TRDA 3FXOA 1Z1DA 3WTSC 3J7AW 5M3MJ 4FIBA 2DFEA 4M7AD 2YU9J 5L3DA 4OMLA 1SMTA 2XUBA 4PSXA 2QA4A 3P9CA 3CCRI 4BUGA 2QM3A 3ZMTA 3G6ET 4W97A 1D1CA 2CUFA 4BQQA 1A04A 1UMQA 3H3ZA 4ZTFA 3U1DA 3RMQA 3WU1B 5EZHA 1YP5A 4M7AC 2ESNA 1YW7A 4R56A 1WHLA 2DJIA 3S1RJ 1ENHA 2BEOA 2YRDA 4C92A 2Y9YA 3MVPA 3OOUA 1SC7A 4D8KA 5M9OA 1VQ7Q 2H09A 2JA7J 3CCVI 1SANA 3HOVJ 1X1BA 2VBWA 1X1AA 2F5FA 2L7MP 1I6XA 3NAUA 4DZJA 4MFDA 1SFOJ 1LPQA 2GXBA 3QPSA 2OJ2A 4IO9F 1UB4A 5AIQA 1ACIA 3RQIA 1TTHB 1W0UA 4AVZA 3JSOA 3F21A 1R8OB 3CCLQ 2O7OA 5KE2A 4AMCA 2WB1A 2XIGA 2JNGA 2FNPA 1IG7A 3O2PE 4BY6B 5ERIA 4MEYF 4M78A 4UVAA 4U0VA 1WHUA 3M07A 3DTEA 1Q7YU 2K9SA 1JQQA 1UCRA 3VPRA 1WJFA 4YIRX 1PHTA 2XAGA 3PQJA 3GTKJ 4RGRA 1ZARA 2LVSA 2BW3B 1HYOA 1TUCA 1VQPT 1PKSA 1RKTA 4I98B 1AEYA 3DKYA 3ER0A 1QVGS 3CCSQ 3WG9A 5IT9R 3R4KA 4F91B 2GFAA 3M53A 2FD5A 2XRLA 4XKVA 2GM4A 2IP2A 3C2HA 3G3ZA 5BNGA 2LX7A 1M1GA 3U9GA 3A8MB 3U21A 3EAEA 5CK9A 3FBIB 1APLC 5LJ3h 2CKKA 2BY2A 5EEGA 2F4IA 1M90C 4DOWA 4DEXA 2FEZA 4OMZA 4AM3A 2XB0X 1PUEE 1ZSZC 5BS6A 3W6VA 3QYHB 2FXAA 4ZYHA 3H1CA 4HV5A 4L18B 2OAZA 2E4HA 1I27A 2IA1A 1N8RC 3QZ9B 3M0RA 2P0TA 4CRIA 1Q86U 4ENKA 2PVDB 3PSFA 1LB2A 4M77G 2DFIA 2VKEA 3AL0C 3L9FA 2VBXA 5A2QR 1HSQA 3EFRA 1YJNQ 4R8HA 3RERA 2FX0A 5AT1B 2NXNB 1FBUA 5HK0A 4IRIA 4HW0A 2IRFG 3AKZA 1YITI 1FSHA 3JB9I 4L5IA 2HQRA 3FXKA 1JI8A 5BQTA 2JZ2A 3FC3A 4LG0A 1R71A 5FU7C 4ELYC 1XC5A 1NEBA 2V6CA 2DETA 4MTDA 3EG1A 3HB9A 2I2LA 1JJ2P 3CCYA 5KVRA 2DPUA 4OIQF 4A4EA 1QVFS 2D2WA 3RIRA 2IA0A 4XSZF 3V4GA 1D5YA 4CHUA 4BE1A 5EF6A 3DPLC 1ZLMA 2L3SA 2K9LA 2AXLA 4BHPA 5EG0B 3FMSA 3THKA 2GLOA 4MDXA 4XL9A 2PTKA 1UB9A 3GBGA 1USTA 3ZQGA 1O3TA 4JX5A 5FLXE 2EV0A 3HFNA 3AT1B 4B9WA 1MKMA 4S04A 2VKVA 4GBQA 1HJDA 3CCMT 3QWXX 3CC4Q 2G0EA 4WCIA 5LJ5j 4IHSA 2DAQA 3ABKH 5EGOA 2DFHA 3MP6A 1SSFA 2HMAA 1TNSA 2BZTA 2KRFA 4IX7A 2FG0A 3WTXC 4KH0B 5C0MA 2DMTA 1U0JA 4KUMA 1YHQQ 3KZIC 4B09A 1M8MA 3I64A 4X9DA 4OWRB 4A3KJ 2CGPA 1I07A 3UR3C 5ILVA 2W0ZA 4M74A 1QCFA 4ZN3A 3PIPA 4RUGA 3G4SQ 3MEUA 1Y71A 2YWWA 2EIKH 1N6AA 1U78A 5LLQA 5EC7A 1RETA 2QK0A 2IBDA 4HNTA 5A0LA 2V1NA 1B9NA 4G94A 5GANf 5ILSA 5I2SA 1O7LA 2LQNA 1V5GA 4BJTA 1MGTA 4ZZLA 2I0NA 5GMKj 3BZCA 3G73A 2KXDA 1OISA 1S8NA 1IXCA 3SWNC 3VU3C 3QDRB 5E3OA 2V1QA 1QQJA 1XNIA 3CCUQ 3RUXA 3CCRT 3TEDA 2L2PA 1YN8A 3ZFJA 1MMSA 4KFCA 5IHIA 5FB2A 4L6V5 4RB3C 1LFBA 3UPUA 1S9HA 3LGLA 5HK3A 4I09A 3TOAA 3I71A 1IN4A 5GAMe 1R7JA 2B63J 1T33A 2WAFA 3ZGKA 2PG4A 1AKHB 2E12A 4HG2A 4PJOA 1R4NB 3P8DA 3S2WA 3BT9A 3JB9J 3OYKA 2GA1A 2EIJH 3BLYA 1SFXA 2ACJA 3M8JA 4C5EA 4C92C 3F22A 3BR0A 5B1BH 4AFSC 2STWA 3HJEA 1RAEB 4UNOA 1Q7YC 2W82A 4M77A 1R23A 1UHMA 2MA3A 1WHHA 4RTUA 1QVGP 4EJVA 2LCLA 4QW2A 3E6MA 5CYVA 3K4BA 2M4GA 4FYXB 1H9GA 1QZZA 2AXTC 3OS5A 2XV4S 3GFLA 3Q0WA 2CZ7B 3ZN1A 1SPKA 1UEBA 4V2FA 4HNUA 4M78C 3WTZA 2JSCA 1ZBJA 2YU3A 3W6JB 1OYIA 1T0HA 2LJ3A 1J59A 3FM5A 3A1PA 1JKPC 3QXEB 4KITB 1VQ8A 3FISA 4IUPA 1WPKA 1ZG5A 1OX8A 4XSXF 3M5AA 2GAUA 2QTVA 1VQ9T 3IH3A 4OIOF 4XMYA 4HVVA 2GF7A 2JJ9A 2F5TX 5K5RA 1LCKA 2CP5A 2DL7A 4JRPA 1PYVA 1FYNA 1LE8A 1SD4A 3M58A 4CC3A 4EMKA 1SVOA 4CCJA 1JTYA 1N75A 4RAYA 1LVKA 2VQCA 2JRTA 3FXQA 3P7NA 2XHCA 3VEPA 2MCNA 4S05A 2BY3A 4MQ9F 4WK8F 2STTA 4RB0A 1SF9A 3F70A 1X3WB 3L7WA 1NBEB 4FL6A 4HCZA 3CPWA 2K3PA 1JXOA 2P8TA 2VL8A 1PSEA 3PMTA 4N4IA 3KFWX 1X6OA 1Z67A 1F1ZA 4G6DA 3GZ5A 2YSRA 5LGTA 2J06A 2R58A 2O88A 2CT3A 1QVFP 5DUIA 3MKDA 3BOQA 3CO6C 3G7ZA 4XIDA 2FRYA 3FBNB 2BOLA 3PL8A 3E1SA 4WF2A 3M54A 2LKSA 1IDYA 4EV0A 4AIHA 4LGWA 1FXXA 1MV0B 2MGQA 2KZGA 4FASD 2CV1A 2V1UA 1YITT 4NC7A 1VQLA 2ID3A 3WGGA 1TU0B 2K79A 2E19A 4E4HA 5GAOn 1KJWA 3FXLA 2XPVA 1ZHFA 1WJSA 3HOYJ 2F48A 3CESA 4OB0B 2RQWA 4KRTA 2Y9ZA 1REPC 2VC1A 2G6FX 1GXPA 3K70C 4WX9A 2AZVA 5I22A 1YWOA 2YUNA 1FOYA 1NPPA 4NL2A 2DIGA 5F64A 2DXIA 1K78A 4KBMB 4XTYA 5JLXA 2YT6A 5DYMA 5GAOl 1V4RA 2FUG2 4Y28E 1WQ2A 2ZXHA 4LLGF 2HPMA 5IXBA 2O61A 5GAOp 2ZPGB 1R5HA 4ZYGA 3QPLA 4M3FA 3L42A 1ON1A 2EJRA 4N4NB 1LPLA 1EIFA 1B6AA 3FX3A 5F27A 2HQXA 2CUZA 2Y48A 2Z9OA 1G4DA 3LMMA 2EAYA 3ABMH 3A8LB 4J9EA 3ELKA 1I5LA 3GIBA 2MH2A 3OSFA 2XSJC 3FB9A 4J7FA 3FWEA 2CSOA 3FMRA 5LEKA 3COAC 2O9VA 1OQYA 2MG4A 2V9VA 3ZQHA 2NYSA 5IHKA 1VQ4A 4MTEA 2W24A 2F5CA 3FHNA 2EINH 2VPRA 1O75A 3RDIA 5GAHJ 2KRCA 4A6DA 1HA8A 1NEGA 2LQKA 1MMAA 3WTWC 4V2SA 5FGMA 3EETA 4BDYA 2DX1A 1K76A 1TWHJ 2X51A 2EILH 3BPVA 2DA2A 3DU6A 4D7NA 3IRRA 1ITYA 2ZPFB 2P0KA 3MZHA 4X1VA 2DO7A 2COWA 5KYXA 3BG5A 3RYPA 3CMEI 2DIQA 3NMZC 5IT9Z 1NPRA 1ABQA 2F5KA 2J6OA 2VVKA 1KFZA 2ELKA 1NK2P 3RNJA 5LJ5f 1OULA 2R7OA 4PJOD 1MBGA 2CW0F 1KU2A 2FPEA 1U5SA 5GAMj 3E6DA 2XAUA 3KP2A 3NRVA 1LFUP 4X1EA 1UFFA 4N9HA 1R9TJ 3K2ZA 3GLXA 5C44J 3I5UA 4EM1A 2CZ6B 4PJOC 3I4NJ 2NUTA 1S7AA 2WAEA 4N4OB 4XNFA 2LNVA 2YX4A 2BYVE 3LA3A 1VQ6A 2ZJ2A 2JVHA 2DK5A 3DEUA 5L3CA 5A2QZ 5ILUA 2FZKB 1V29B 2MOXA 2RHXA 4XRMA 4M77C 3RMSA 4NC8A 5TGTA 3SHWA 2E6NA 3JCMh 2LP0A 8AT1B 2ROLA 2XDDA 1FPQA 2HDCA 1I1JA 4QQDA 5EEAA 2FE3A 2ZPHB 4M9ZA 1PVEA 2Z33A 2IS4A 4VUBA 4M7AB 3TSWA 4N9IA 4HCBA 1WI3A 1W7PA 2VOPA 1DGRM 3BQZA 1WJRA 4JLGA 2AK5A 5DLOA 3OA6A 2EV5A 3CMAI 5KCMA 4PZJA 4NL3A 1XPXA 4XU0A 1Z9ZA 1K8AC 2HOTA 1YE9A 3LNQA 3K10A 2BHZA 3ECHA 3F72A 1W0TA 2RHYA 2C6YA 2IS1A 2OAWA 1Z3XA 2FQ3A 2DBMA 3CXCA 2QZ8A 2UV1A 4NQWB 2CP3A 4M6VA 1T3SA 2DPPB 3OYCA 1KYZA 1IAWA 2E41A 2RH2A 2A6EF 3DFGA 3BDLA 3E19A 1PM3A 1W4SA 2E5NA 2D1HA 5JLWA 2K57A
chains in the Genus database with same CATH topology
3JTGA 4JS4A 3DF8A 1ZH5A 1VQNT 1K79A 1Z7UA 5E18F 2P0PA 1O7FA 1YIJA 2VT2A 3TQNA 3L2UA 3GF5A 2EFOA 4LDYA 2YLBA 4PGGA 4EJTA 1PDNC 2RDPA 4JQFA 2K3XA 2P0QA 3OW2S 3MEWA 2GXGA 2HOEA 2A07F 4L59A 4HQMA 1XB4A 1NZ9A 2X4WA 1MJ9A 3SHFA 5FLXK 1ZRCA 1YI2A 1ZGJA 4ELZC 3L00A