1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
molecule keywords mbtA operator DNA
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
1WI9A 1PP8F 1IN8A 2PQ8A 1DPRA 4OIRF 1O3QA 1XSXA 1S7OA 3EQLF 4O6JA 1XMKA 4CGZA 1MGTA 1L3LA 1ZGAA 1P4WA 1ULYA 5CLSA 4PGGA 1SFXA 4ENJA 4H0EA 4WXHA 3FHZA 2F5DA 4K2EA 1LNWA 2ZMEA 2M5WA 4LG0A 4OIPF 1SD5A 1IF1A 3I5UA 1FYMA 1GHCA 3HSFA 3RPUA 2WV0A 4I09A 3KE2A 4Y17A 2O0YA 4ENMA 3CUQB 3FX3A 1Z91A 1FZPB 2H27A 1BOAA 3RIRA 1H9TA 2F5EA 3FXUA 3QPHA 4U0WA 3BJOA 5AIQA 5K5QA 1FP2A 4L9TA 3EETA 3RKXA 5D5UB 3BOQA 1S3JA 4BHCA 1F9NA 2PG4A 2BGCA 2COMA 5L3CA 3GYHX 2D2WA 3WTYC 3DPLC 2QBYA 4ZZDA 1CGPA 1TQMA 2EFNA 4HAMA 5ICCA 2NYXA 2BBYA 5DDGA 2H6BA 1TW3A 3KFWX 3ABTA 2A6HF 2OQRA 3M8FA 2K02A 1B1BA 4HX8A 3ZMSA 3I4PA 2CFXA 3K69A 3J80K 3OV8A 3C7JA 3JSPA 5ERIA 2QZ8A 1XB4A 1FY7A 3MZHA 5KVRA 6PAXA 3BZ6A 2CW0F 4M71A 1FSHA 1JHHA 2FU4A 4AD9A 2D1VA 2M8EA 5L3EA 4HQEA 3KP4A 3O2PE 4HDVA 2GZWA 5LLQA 2FE3A 1OR7A 2EA4A 2M1BA 4KN4X 1K78B 2BV6A 3QRFF 3IHUA 4CZZA 4KFCA 3RKYA 1UHMA 4YIIA 3NQOA 2OU2A 5D4SA 1OYIA 1UHWA 3ECOA 1ZHFA 2IT0A 2M45A 3NRVA 4XLNF 4YIFA 3C1DA 2XAHA 1Z6TA 4UVAA 3HTSB 4YG2F 3ZN0A 2K4BA 2E1NA 2IVMA 2RV8A 1U3EM 2ISZA 2ISYA 3IWZA 1XSDA 3WE3A 4EJOA 3KCCA 2QENA 2G7UA 5JFRA 2V6CA 2O03A 2PBIA 4M6XA 4Q5SF 2K4YA 2EWNA 2LDUA 4LB5A 3TO9A 4KN7X 5HLGA 2P7CB 4EQQA 2YU3A 2CGPA 2XIGA 3Q9SA 1OMIA 5K1YA 5E8GA 1Y0UA 1B59A 2XV4S 2JSCA 3PFIA 1Z6RA 1G4DA 4A0ZA 5CJ9A 1P4XA 1DDNA 3EYYA 4JBAA 2TDXA 4IPAA 2JT1A 3K2ZA 2XGXA 5HS8A 2JZYA 1ZG5A 3I58A 1YFHA 2R7DA 1K6OA 4G9YA 1MJAA 2P5KA 1TLHB 4UXNA 4IRGA 3DF8A 3ZQ7A 4N0BA 4G7HF 3I53A 4E70A 4GO1A 2NNYA 4AIKA 4XSZF 1RZ4A 4ZYHA 5HLHA 2G9WA 3MFKA 4Y13A 5HLIA 3GX4X 5HOOA 2RNJA 3TQNA 1K7AA 4U88A 2A68F 4HBLA 4Q4ZF 1ZRFA 2F2EA 1OYWA 2XAJA 4MTEA 1E17A 1FX7A 2STTA 2P6TA 2HOEA 1TBXA 2G7HA 5H20A 2FBKA 4I98B 1K78A 3BPVA 4I02A 2FF4A 5J8FA 4WX9A 4GXOA 1I27A 2NNNA 1KQ8A 4I01A 3KLOA 4LB6B 1RIOH 1LDDA 1SD7A 5J8CA 1MD0A 2XAQA 4S04A 5JI6A 2CYYA 5ILVA 1FLIA 1F1ZA 2MH2A 1IN4A 1YYVA 1QZYA 3PQJA 2LX9A 3HRUA 3VEPA 2VONA 3T5XA 3V8JA 1STZA 4NHJA 3MZYA 4IVNA 2DPUA 5HS9A 1T98A 2IJLA 3RYRA 1NHAA 2MA3A 5LHIA 4LK0F 3WGIA 4RGXA 4G7OF 2P8TA 3HTUA 5IT9K 3H92A 1BBYA 1FBQA 2F5CA 4UVCA 3WTXC 1REPC 2DLLA 2JTVA 3IKTA 1I6XA 2Q0OA 4FX4A 1YLFA 3IRQA 3LAPA 4MTDA 3BP8A 4KA4A 3J7AO 1YQAA 1KU7A 1XGSA 1TTYA 2FNPA 5D8KB 3DPTA 1JXSA 2H3JA 2ZKZA 2C6YA 5BMZA 1OYYA 1LDKB 5L3DA 4KICA 1U5TB 4UNOA 2OD5A 3U1DA 4LFUA 4KIBA 4IXAA 4KYWA 3FF5A 2ETHA 4HZFA 5CYVA 3R4KA 1QW1A 1R5GA 3KZYA 4A5NA 1J59A 4HQMA 2PN6A 4OMYA 1JHFA 3CTAA 4L5JA 1XCVA 1YIOA 2HQNA 5E17F 2W84A 2CG4A 1SAXA 2V9VA 3BWGA 4RS8A 4KIFA 3SZTA 5ICEA 3TO7A 5L3BA 2P5LC 1MJ9A 3QPTA 3E6DA 2GAUA 1XGMA 4ENNA 3FM3A 2EJRA 5F1RA 1P92A 2DFIA 1B9NA 1G3TA 2CWEA 3LA7A 1XD7A 1LEBA 1V3FA 3P9IA 2F5FA 3ROUA 4A0YA 5D5XB 1O7FA 3PQKA 1HW1A 4RGRA 2O8XA 2FNAA 2K27A 4HW0A 3DQVC 4BXUA 2VBZA 3V4GA 2PFBA 5K5OA 4GYGA 3EYIA 2K5IA 1G3WA 4PCQA 1U78A 2VODA 2O61A 1O57A 1S8NA 3GXOA 5E8IA 1XGOA 3LQRA 1ZRDA 3E5QA 3F8BA 1SD6A 4HDUA 3REOA 3V7RA 5H6QA 1O3SA 5E18F 2K5FA 4HF1A 2DT5A 1BI2A 1IAWA 3ECHA 2A61A 1IN6A 4IRIA 5AONA 5DCFA 3V7CA 4A0XA 5HVQC 5LGTA 1WSUA 3L00A 3L9FA 5DCMA 3N97A 4B8XA 1YS7A 1MJBA 1YW8A 2VC0A 1D8JA 4AVPA 4A12A 5F64A 4DNCA 2NRAC 2NS0A 2A69F 3FMSA 3S2WA 4U0YA 1U5TA 1ZYRF 1Z1DA 4ETSA 3K9TA 2D45A 2RGVA 1IXCA 5E20A 4CYDA 2W57A 3KP2A 2QQBA 2VT2A 1TNTA 3K1NA 1IN7A 2K5LA 4UHTA 4ZYGA 4ESJA 3K1PA 4A2UA 2EK5A 3F3XA 2PMUA 2KJCA 2EFOA 1UFMA 2V1UA 4S05A 1J0RA 3M1EA 3SQNA 2FMYA 4CDGA 3F6VA 4ASNA 2DK5A 2R3SA 3I64A 4JQFA 2XHKA 3I0TA 1SD4A 3J81K 3SZPA 3WGHA 2UXNA 3CO6C 4N9IA 2VE8A 2DBBA 1LJ9A 3MCZA 3ISPA 1R7JA 3LSTA 4P9FA 1R1TA 1CF7B 1B9MA 1KYWA 4WXCA 5D6FA 2AXLA 4BHBA 4FX0A 3EDPA 3ZP5A 3DKWA 3ZPLA 2QQ9A 1O7LA 2MLGA 4M9XA 2FXAA 3H3UA 4OU0A 2BE5F 2ESNA 2KKOA 1BIAA 4MHGA 2AS5F 2FOKA 4F7ZA 4RGSA 3GZ5A 2EFQA 1HKTA 3K1MA 5FFZA 2WC2A 3QP6A 5BQTA 5JR3A 2GXGA 4EM1A 5ED4A 4G6DA 1IRFA 4HLYA 4HF2A 4P9UA 1GVJA 2A5YB 3CO7C 2FSWA 5BOXA 5D8LB 2Y75A 5FLXK 1T2KA 1YW7A 4U0VA 2IA0A 1XGNA 1JGSA 4I0BA 1QBJA 1T0FA 5K5RA 5DUKA 5ILUA 3B02A 1MKMA 4WXDA 2FBHA 1U6GA 3P9CA 3IL2A 3R0AA 5ILSA 2IA2A 3F8MA 1QVPA 1W7PA 2ESHA 4MNUA 3HOSA 2V1DA 3FXQA 1ZG1A 3HOTA 1BM9A 1T38A 3FMRA 1EH7A 5CVUA 4L9NA 2DQLA 3Q9VA 3ERED 1DP7P 1SFUA 4UV9A 2QLZA 3BROA 2QVOA 3DEUA 4OIOF 5FFXA 2W24A 4YFNF 1G6NA 4KUMA 1QQIA 3T1BA 4M9ZA 3DP7A 5DEQA 2GXBA 3SHFA 2E7WA 3TKYA 1S6LA 4Z2YA 1XSVA 3TOAA 2ACJA 3DFGA 4L9VA 1OPCA 2QYOA 5LEKA 2OZ6A 2K86A 1F4KA 1I1GA 1BC8C 1TQPA 5KK1A 3KLNA 3JSOA 3WU0A 2HFHA 3KP5A 2FMLA 2KIFA 2KIUA 1IN5A 4NB5A 1IRGA 1YS6A 1DUXC 2L02A 2Z99A 2YSRA 2DQRA 3R61A 3BJAA 2IPQX 4FT8A 4Y15A 2XROA 2PI0A 3WTWC 3BPXA 1W4MA 5HDNA 5FO5A 5DD4A 5BS6A 4R1HA 4WF2A 3WTUC 4B09A 1FC3A 5EEGA 1XDSA 3W6KB 1GXPA 3IC7A 4LJZF 1XCBA 5ICFA 3KP6A 2DAOA 3R60A 3TOBA 3LAJA 2MC3A 2KJBA 2LF7A 1VTNC 4PDKA 3M8EA 2PEXA 2NAZA 2IW5A 4BH9A 5CVJA 3GW2A 4M6YA 3BDDA 2M87A 3QU3A 3QAHA 2PJPA 3I59B 4Q47A 2VBYA 5HS7A 3RKWA 1RUOA 1BI3A 1G3SA 2OAZA 2L3DA 1KQ0A 1QZZA 5CVIA 1E2XA 4L5IA 1YW9A 1KA8A 1RUNA 1QNTA 4ESBA 2STWA 3C18A 4YFKF 1YTYA 1W5SA 2L01A 4FHTA 1TQIA 5HDGA 3T8RA 1EV7A 1OKRA 2L54A 3HRMA 5FD5A 3CUOA 1A04A 1XMAA 3MQ0A 3E6BA 4IRHA 2YPRA 2J5PA 3HSRA 1J2XA 4ON0A 3GFMA 4GYIA 4MGRA 4ZYDA 4HV6A 3VOEA 2O6GE 3DXJF 4EM2A 4EJTA 4GCVA 1AWCA 2VT3A 1S7AA 3FWEA 3HUGA 3IWFA 2ZO4A 2FRHA 2HDCA 1Z05A 3E6MA 4HA8A 2W85A 3ZMTA 2PLYA 1HQCA 2CQKA 2K4JA 3T0YA 4KNYA 1BIBA 2L4AA 5F6FA 3KZZA 3ABUA 2A07F 3RJPA 4LK1F 1FPQA 2VOPA 3E5UA 3ZMVA 3ZN1A 1P2FA 3U9GA 3WTTC 1FYLA 1HW5A 1ZN2A 4BYYA 5LGNA 3FXRA 3ELKA 1T39A 2BYVE 5DYMA 5JVTA 1ON1A 2ELHA 1MZBA 3I54A 2LNBA 3HRTA 3NEUA 1C0WA 2YX4A 1F5TA 1FBSA 1RNLA 3TGNA 1HKSA 5LRSA 4O5VA 3WTZA 2RN7A 4EVIA 4O3MA 2XKPA 3QOPA 2CSOA 2DU9A 5LEJA 4KMUX 3WU1B 4L0YB 5L3FA 2HZTA 1LQ1A 4AIHA 1R36A 1HKQA 2ZBKA 3MAJA 1KU2A 3FMQA 1UCRA 4EJWA 2MH9A 4U7BA 2P6SA 4EV0A 4P55A 4RGUA 5A2QZ 1ZLJA 3WODF 3HHHA 2FBIA 4RAZA 4HX4A 4G6QA 5LHHA 1FNNA 2EV0A 3J81Z 4LG0B 4CO8A 2ZMEB 2Z3YA 5DCMB 2VBXA 3VFZA 3WTSC 5IT9Z 2ZNZA 4KT5C 3L7WA 3MWMA 2P7VB 3P9KA 3CDHA 2XASA 2HKOA 3HSEA 2O3FA 2GA1A 1B6AA 3RYPA 3WE2A 2RVCA 3KP7A 1V4RA 2B0LA 2KIMA 2EA2A 2Z33A 2HEOA 5E1XA 4HYEA 2QUFA 1L0OC 5CVVA 2HS5A 4IHTA 1LB2A 4NQWA 1ZGJA 4ZYEA 4L0ZB 1P6RA 4R8HA 1WKMA 3RTRA 4PGHA 3AAFA 4UUVA 1ZARA 1I5ZA 4M9SA 5D6EA 1BI1A 4I7HA 2X4HA 1R22A 2ZNYA 2A6EF 1EH8A 2M30A 3CJNA 4WCGA 1O3RA 4MQ9F 2KRFA 3BJ6A 3RI4A 4P96A 4I0AA 2RC4A 1XDUA 2FEZA 3GWZA 1FT9A 2DW4A 2Q8KA 2GQQA 4XLPF 1SMYF 1IZ1A 4G94A 5LRRA 1KU9A 1PUEE 2JPCA 3F8CA 4BNCA 5DUIA 1IXRC 3FM5A 3D5LA 2VN2A 2HR3A 1Z9CA 4HLXA 1ONVA 3LFKA 2VXZA 3M9AA 4WWCA 3O3KA 4XRFA 4HV5A 4EJVA 4EJUA 4P5OA 2OA4A 3F8FA 5DD8A 2P5VA 3RPQA 5FD6A 3TO6A 4Q48A 4EM0B 5TJJA 1ZAOA 4XBFA 3I59A 4ENKA 3L09A 3W6JB 2XAFA 1R1UA 4RB3C 1LVAA 1MDMB 3HHGA 3OOPA 3QP5A 2PMHA 1BI0A 3R6SA 1KYZA 2HTJA 5ICGA 1U2WA 3LA2A 2OBPA 1ZG3A 1W5TA 4LLNA 2UWMA 4I2OA 2WWYA 1ZH5A 5FGMA 5BPIA 3WG9A 3VODA 2V79A 5D5WB 3KEQA 3LWFA 1GXQA 2ZCWA 1KGSA 4LD5A 2H6CA 3Q5FA 5FLXZ 3E5XA 1D3YA 5DV5A 3BY6A 4LMYA 4IF4A 2EFWA 2IP2A 1ZLKA 2VBWA 1FOKA 2XAGA 4OMZA 4LLLA 2RDPA 1EH6A 1J75A 1D5VA 4CXFA 3WGGA 4D0PA 5TRDA 3E3VA 2D1HA 1H9GA 1SFEA 4OIQF 5L3GA 5LBQA 3F6OA 3J80Z 5E1ZB 1B4AA 1D8KA 1T6SA 2V1XA 2W25A 4N9HA 2R7FA 1Q1HA 1K79A 2MD5A 4A5MA 4RB0A 2BEOA 4IHSA 1U5TC 2H09A 3N4MA 1USSA 4LGWA 2L4MA 1BYMA 1W7PD 5LHGA 4ESFA 4HF0A 1TNSA 1IXSB 3IRRA 3GF2A 3V8LA 1QPMA 2LKPA 3P7NA 1RI7A 4L18B 1R1VA 1SMTA 4G8XA 1FYKA 3HIFA 3M7GA 2GIVA 5HDKA 3GLXA 2GCXA 4CHUA 1WQ2A 3HYIA 4DQ2A 3MEXA 2HTSA 1TW2A 4MEXF 2DPDA 4R79A 4UV8A 2HYGD 3K0LA 1YO5C 2RQPA 3F72A 2HQRA 2XKOA 4BHPA 1AOYA 5J6XA 1LDJA 3E19A 5CVRA 3ML6A 1R23A 5AIPA 3GFJA 2RKHA 3CUQC 3JTHA 3JTGA 3GFLA 4RB1A 3DV8A 2XVCA 2Z9OA 2GA2A 3LA3A 3IKVA 5FB2A 3ULQB 3F21A 5EEHA 3F22A 1H0MA 4OINF 2FQ3A 4PZJA 3D0SA 2LSOA 4XSXF 1KU3A 1FWZA 2H94A 1P4AA 2E1CA 3GZ6A 1HSTA 1R5HA 3H3ZA 4KIGA 5LGUA 3QU6A 1BN5A 4AWXB 3L2CA 4MQVA 4A6EA 4M73A 4QWQA 3GVAA 3LQQA 1J7KA 2DI3A 1O3TA 3CUQA 2J5OA 2IA1A 1J9IA 4EMSA 1R00A 5H6RA 2ZXJA 1UB9A 4JK1X 4MEYF 1HXDA 1XN7A 1X3UA 2P4WA 1USTA 2QM3A 2JRTA 2CO5A 3KETA 1CF7A 2DK8A 2Y48A 3JAMK 2VOOA 2OZUA 3GO5A 3ZMUA 2X0LA 3HRSA 5D4RA 2DTRA 1R58A 1G3YA 4KDPA 2LF8A 2YX7A 1FP1D 1PDNC 1ODDA 4KMFA 4CICA 2XRNA 3E97A 4GGGA 4LLGF 4HOBA 1MDMA 1Z7UA 3GUDA 5A2QK 1BC7C 1FBUA 4M72A 4BAYA 4EGYA 1HSJA 3G3ZA 3V8KA 4U7DA 3B73A 2ZFWA 4YFXF 4HX7A 2HWVA 3MHXA 4WK8F 3GEZA 3ZMDA 4G7ZF 3KP3A 1W7PB 2HGCA 4TV7A 1HBXG 1IW7F 2YR2A 2Y0MA 2QWWA 3JAMZ 2HYFA 2FA5A 3I71A 2OQGA 1KQ9A 2MBFA 4A6DA 2IRFG 3O6BB 5JHUA 1JE8A 1WWXA 2QQAA 4UVBA 3V7SA 1YG2A 3F23A 2EFPA 2MLKA 4M74A 4RB2C 5D5VB 2VE9A 4IJAA 2QBYB 4OOIA 2HKXA 3R0JA 2EB7A 1ZREA 1PP7U 1HW2A 3FZVA 2E7XA 2VC1A 2Z5UA 2EV5A 3GFIA 1LEAA 3ZMZA 4AIJA 5E1WA 4ZH4F 3RDIA 2WTEA 4L9JA 4ZZLA 1QGPA 3WTVC 1WRJA 3TDUC 4EGZA 3COAC 2UXXA 3T8TA 3VB2A 5IT3A 4RAYA 4QLCU 3G73A 1DPUA 3KEOA 2XUBA 1I1SA 4BQAA 2GWRA 1J5YA 1U8RA 3SXYA 2ADUA 5BPDA 1QO0D 3TDZC 3F8NA 1ZRCA 3JW4A 1ON2A 2ZJ2A 1FSEA 2K7LA 1IUYA 3E6CC 2Q2EA 2A3SA 3U2RA 3CLOA 1BJAA 1S29A 3EUHA 2JPBA 3SFZA 2UZKA 2EV6A 2DO7A 3C3WA
chains in the Genus database with same CATH superfamily
2EQUA 1YJNQ 2NUTB 1D0XA 3EFRA 2EGEA 3HG9A 3S2HJ 1Y7XA 4JX4A 4D5CA 4IUUA 3HJEA 1WI9A 3GCMA 2QXFA 3JCMc 1PP8F 2RB6A 3CMEI 2RM4A 1GRIA 4M78B 3FK7A 2HCKA 1WI3A 1IN8A 4C5HA 2PQ8A 1DPRA 4OIRF 4F55A 1O3QA 4XTZA 3SWNC 2DETA 1XSXA 4JUVA 1S7OA 1Z7LA 3EQLF 3ZQQA 3VKIA 4O6JA 5A0DA 4IURA 4Z02A 1N9SA 3JCMb 1XMKA 5EZGA 4CGZA 1MGTA 1L3LA 3LSJA 1ZGAA 1JXMA 1ZLMA 4OB1B 5GAOn 1P4WA 1ULYA 1JUMA 3EAEA 2M7BA 4M78A 1R0CB 5CLSA 4XQFA 2JVGA 2RJDA 1DGRM 2HMAA 1I81A 4PGGA 4J6WA 1WJBA 3N05A 1SFXA 1HC8A 4ENJA 2LJ0A 4H0EA 2R7SA 1RETA 3FXKA 3UR3C 1KC8R 2VC8A 3PFSA 2VQHA 4WXHA 3OYMA 2MAMA 2CT3A 3FHZA 3CC4A 2COWA 3BTLA 2XPWA 1M1FA 2F5DA 4K2EA 2ABLA 1LNWA 2X85A 2ZMEA 3SB2A 2M5WA 4B9WA 4V19K 1KQ2A 2W1OA 1XQHA 4LG0A 2RJEA 4CC4B 4M7AF 4OIPF 1R5ID 4BEHB 2DRKA 1SD5A 2DT6A 1TWBA 2LLKA 5KCMA 1IF1A 3I5UA 1FYMA 1GHCA 2CYZB 2YT6A 5J39A 1VYUA 3HSFA 2DL5A 1VIFA 3BG6A 1GDTA 2RJFA 2PU9B 4D9JA 3RPUA 5KYXB 2BHYA 3I55A 2WV0A 3FEOA 1UJ8A 1NJIR 2HSPA 4F7UG 4I09A 1JT6A 3KE2A 4Y17A 2JMAA 2ZMEC 5LL6S 1RUWA 2PVOB 1PRLC 4JS5A 5GANf 4A3DJ 2O0YA 4CUGA 3RUXA 5M9OA 5GAN6 4ENMA 1ZUYA 2R7TA 3BDUA 1VQOA 4JX5A 4AC0A 3FDRA 4LD6A 3CUQB 3FX3A 1D1AA 4X1VA 2F6CA 1Z91A 2XSDC 1KHCA 2M0YA 4CC7A 1FZPB 3VSKA 2H27A 4PJOE 1BOAA 3RIRA 1H9TA 5LJ3g 4M78G 2F5EA 2AQFA 1QP2A 2DMOA 3PVLA 3FXUA 3QPHA 1MMAA 1T56A 4U0WA 4XAXB 3BJOA 3OSGA 4PJLA 3CCVA 5AIQA 2R7ZJ 5K5QA 2MWPA 2VPRA 2CQXA 1XNIA 2FO0A 2JXBA 3SD4A 1FP2A 2LY1A 2N8GA 4L9TA 3EETA 2CU7A 2R7QA 3M55A 2DA6A 4D1QA 1H641 1YJ9Q 1FMKA 2K9GA 3RKXA 2V1QA 4HCCA 5D5UB 3BOQA 1S3JA 2HL3A 4DYRA 4DBQA 2FPDA 1ETKA 4BHCA 2V8IA 4PLIA 1F9NA 2VB6A 2PG4A 1X2NA 2BGCA 2COMA 3OIOA 2QA4I 1VQOI 1WZOA 5L3CA 5FW9A 4XOTA 2DRMA 4AM3A 3NTKA 4MFDA 2E41A 3GYHX 2D2WA 5JVGF 1SPKA 1ETYA 4ABZA 2X6WA 2Z2SB 3M56A 4OMLA 3CPWP 1OCTC 1VQNQ 1IB8A 4A93J 3WTYC 1NPRA 3NAUA 3PO2J 3DCFA 3W2VA 4V2FA 2A3LA 3PMIA 4F7UA 3H36A 4F92B 3I56T 3F9KA 3OBWA 3DPLC 1YHQA 1QVUA 2QBYA 3M0SA 3BG9A 4ZZDA 1CGPA 1TQMA 1ZTRA 2EFNA 5F04A 3GZNB 1R71A 1D09B 2AKLA 3C94A 3UT1A 3BT9A 1DU6A 1Q86U 4F17A 3SJMA 4IQJA 4DGWB 4HAMA 5ICCA 3LSPA 2EYXA 1VI0A 2BBYA 2NYXA 2GOXB 1X3ZB 2H6BA 3CQZJ 2LVSA 1X1PA 2Z16A 5DDGA 1Z3XA 1DJ7B 3GOXA 2ZSIB 4C8QB 2QEXQ 2KXDA 1TW3A 4JLIA 3KFWX 1YCYA 2J6OA 3L2ZA 1PWTA 1ZSZC 2HBPA 2E5KA 4Q5WA 4F7UE 2VIXA 3ABTA 2PUKB 2E1MC 3QDFA 1Y0MA 4FCYA 1NK3P 2A6HF 2OQRA 1OCRH 3M8FA 1KC8C 2K02A 2XGDA 1B1BA 1BW5A 4HX8A 2F2WA 4G12A 2EJFA 1X6GA 3ZMSA 1RI9A 2W48A 3I4PA 2CFXA 3K69A 1K9MU 1MHNA 3J80K 2K3PA 3C7JA 3OV8A 5ERIA 3JSPA 2QZ8A 1XB4A 2L9SA 3S2DJ 1KFZA 1FY7A 3BR2A 4EMKB 3MZHA 1A36A 3BZCA 1G2HA 1QCFA 1QPIA 1RAFB 3GP8A 2DEUA 1J09A 1X75C 5KVRA 3MEAA 4AU7A 2QQRA 2K2MA 2DL8A 2COYA 6PAXA 4XR6A 4Y52J 4CCKA 2OTJA 3BZ6A 2CW0F 4M71A 5I22A 1FSHA 1R49A 3DU6A 1JT0A 2BVMA 3HB9A 3GTMJ 1JHHA 1ZA2B 2FU4A 1VQLI 2XD0A 2CSQA 1WPYA 3CC7I 2L9VA 4AD9A 2KBTA 1K0SA 2D1VA 2M8EA 5F08A 5L3EA 4HQEA 2LC4A 3KP4A 3SZGA 1B72A 1QKWA 3PIPF 3O2PE 1XTAA 1VQNT 1JTXA 2DE0X 2KK4A 4C8QD 4HDVA 4MDXA 2GZWA 5LLQA 3GTPJ 2BIVA 5EJCA 4XLAA 1N9RA 3REAB 1FYNA 1M8VA 2FE3A 3HOXJ 1OR7A 1M30A 2YLBA 2ZJRF 4LUEA 3K4CA 4PSXA 2EA4A 3CESA 3RQIA 2M1BA 3CDLA 4B3XA 1ACIA 2LNHB 3CP8A 3HKSA 2E19A 1QQJA 2X4YA 1B3QA 1PVEA 4KN4X 4LOCA 1AA7A 2JK3A 1K78B 2BV6A 2FZKB 4PJOG 3QRFF 4M7DC 3IHUA 4CZZA 4KFCA 1UDLA 2PX9A 2DNUA 2CUEA 3RKYA 5IYDJ 1UHMA 1TC3C 3GBQA 4YIIA 1PD1A 4XU0A 3S1NJ 1Y07A 4XICA 2ID6A 2OU2A 3NQOA 2HDWA 1U8BA 4FL6A 4BI4A 5D4SA 1X4PA 1FMWA 1OYIA 3CCMI 1UHWA 3PNYA 3H8ZA 3ECOA 4M75F 2RK1A 2DTOA 5D7UA 3KXTA 3ZXSA 3M57A 3CLQA 4QVDA 2LRDA 1ZHFA 3OYLA 4LDUA 3CXCP 2VVKA 2K9LA 4ZTJA 2IT0A 1JUSA 2M45A 3NRVA 4XLNF 1TU0B 4PKCC 4GBQA 4BUGA 1VQOQ 3M53A 3EGUA 4YIFA 4PUSA 3AL0C 2VYTA 2XDPA 3C1DA 2YRDA 2XAHA 1Z6TA 4UVAA 1ORKA 3HTSB 4UB6C 5KYWB 4YG2F 1KG1A 2E12A 3ASOH 3ZN0A 2K4BA 2X4XA 2CP3A 4XOPA 3QO3A 2E1NA 2WB1N 2DJZA 2IVMA 2ZGWA 1IDYA 2R7RA 2MGQA 4A3LJ 2RV8A 5E3LA 2Y4XA 2LX9A 1U3EM 2ISZA 2ISYA 3IWZA 4LITA 1XSDA 3NWTA 1TL8A 4ZDPA 3A01B 2YU9J 3WE3A 3OSVA 2K40A 3KFVA 4EJOA 2QSGX 3Q1JA 1MBGA 3CC2T 5CKHA 1R9TJ 3KCCA 2QA4A 5FWCA 2QENA 5KAIC 1M9SA 2G7UA 2DBKA 5JFRA 3INZA 3OIQA 2B9SA 1WHHA 2JQ7A 1W6XA 5GAOr 2V6CA 4M77E 4KT6A 4XRSA 2CW8A 2G3RA 2J7IA 1OJLA 4RCBA 2O03A 2PBIA 3CP2A 3H0DA 1JO8A 3EG2A 3QSUA 4M6XA 4Q5SF 3BW1A 2R5YA 2K4YA 4HVVA 2IVWA 2EWNA 2LDUA 1Q82C 1BA5A 1KQSA 4LB5A 1KD1R 4NC8A 3L1AA 3URGA 1UAAA 1ENHA 3TO9A 1OOTA 5FKNA 4KN7X 3BDLA 5HLGA 3M4GA 2ELKA 2P7CB 4DEYA 3HP9A 1AZGB 1XPXA 2O8KA 1SFKA 4EQQA 2YU3A 2CGPA 1H88C 2KNBB 4J9FA 4OP0A 3CC4T 1N77A 2XIGA 3Q9SA 2GQVA 1OMIA 5K1YA 2A37A 4E4HA 4E6RA 2K6DA 5E8GA 1Y0UA 2SRCA 1OU9A 3W2WA 1B59A 2XV4S 2JSCA 1K8AR 1T8IA 3PFIA 3H0IA 1Z6RA 3QYFA 3H5NA 4C9YA 2RF0A 4LIVA 2HNHA 2BZ8A 3GBGA 4DBRA 1G4DA 1HDPA 1VUBA 2E6NA 3CCJI 2DXBA 1VQLT 4B48A 1K9AA 1QVFA 4A0ZA 1N27A 2ESWA 3EUKL 3CCEA 2KRHA 5FKMA 5CJ9A 2MYSA 1P4XA 1B34A 4WCIA 1DDNA 3EYYA 2EILH 2ZAEA 4JBAA 2TDXA 5H2FC 4M75G 5GAMg 2K7AA 1BR2A 4IPAA 1CKAA 2CV2A 5LJ3h 3V42A 3C2GA 3UKGA 4OB2B 4A53A 2E1HA 3UA6A 2LJ1A 2JT1A 3K2ZA 4HEA2 4GFBA 5HLTA 1TG0A 2XGXA 1VOMA 2L0AA 5HS8A 3CCRT 2JZYA 1ZG5A 1UGRB 3CCRA 3IUOA 5CQYA 3I58A 1FXXA 1YFHA 2PNIA 2R7DA 1IZ6A 3EG9B 1K6OA 3HOZJ 2DN0A 4G9YA 5EG2A 1MJAA 2P5KA 3IH3A 3K4KA 1ZA1B 2GFAA 2MG4A 1Q82R 1TLHB 2D5VA 3VRZA 4M75C 5IOZA 4B43A 2PMZN 2EBIA 4UXNA 5C4JJ 4HVWA 1BR4A 4RLFA 3S1MJ 4D7MA 1LFPA 4IRGA 4PFOA 2A36A 3DF8A 2CGHA 3R6OA 5FLMJ 1IG7A 4ME7A 4MZMA 3REBB 4AFSC 1U1TA 1KZHA 2JJ9A 3OMCA 2KVQG 3ZQ7A 1Y8RB 2AXTC 4N0BA 2B8AA 2QDLA 2RHUA 3MN2A 1C0MA 1GBRA 4G7HF 3I53A 4E70A 1K73C 4E7ZA 1Z77A 5I2SA 1ZR4A 2WSCE 4IKFA 3O5ZA 2QK0A 5IXBA 3QODA 4GO1A 2NNYA 3S3NA 2CH4W 3BY7A 3PIOF 2ZC2A 1IV8A 1RACB 1MNDA 5JLXA 4AIKA 4XSZF 9ANTA 5LJ3j 3K70D 3I4MJ 3VS5A 4UC4A 4JJNK 4H4KC 4JOMA 4FTHA 2EZIA 2O01E 2NXNB 2QQ8A 4D6WA 4C2MJ 2O9LA 3NFCA 1RZ4A 2A5WA 1YITA 4DZJA 4ZYHA 2EH3A 5HLHA 1VQOT 2G9WA 3TSWA 1Y57A 3E2UA 3MFKA 5FLXE 1S72A 1RRJA 4Y13A 1VQ9T 3BG7A 1E3PA 4LIUA 4NDLA 5HLIA 2MC4A 3GX4X 3FXOA 4BE0A 5FKLA 3MEUA 4J9CA 1W2BS 2CQNA 3Q0VA 3A98A 2F5VA 4BQOA 5HOOA 1X69A 3A2KA 2RNJA 2YHTA 5LJ3f 3TQNA 4II3A 3G4ST 1K7AA 3C12A 4U88A 2A68F 4BB7A 2KMUA 5FKKA 1MMDA 4Z89A 4HBLA 3JCMf 2WB1A 4Q4ZF 1VQ6A 1ZRFA 2HQXA 2EQKA 4HRIA 2F2EA 4M77D 1OYWA 2XAJA 2E1OA 3BQYA 3I9V2 4MTEA 1M8MA 1PRMC 3D7SB 1NG6A 3Q0WA 1SEUA 3CPWA 1E17A 1FX7A 2STTA 2P6TA 2HOEA 3OQ5A 1TBXA 2G7HA 2DZCA 5HCKA 5H20A 3L2WA 4A3KJ 3CMAA 2FBKA 2HYJA 4I98B 3M8JA 1K78A 4AMCA 1OLTA 1AHDP 2XB0X 1YJNA 1T3SA 3BPVA 4I02A 1AWWA 4ZC3A 4LN2A 4PFZA 4XNFA 2FF4A 3SEQA 1YP5A 4HVUA 3VYUB 3GTQJ 5J8FA 4WX9A 2IIMA 1Y96B 1T0FC 4GXOA 1OPLA 1I27A 1R0BG 3DTKA 2NNNA 2WAQN 3LYIA 1KQ8A 4NL3A 4I01A 5HK0A 1ETOA 2OF7A 5J3LA 3KLOA 4LB6B 3CCVI 1RIOH 3SFIA 2JVHA 3HBLA 2RQWA 3UF4A 4QT7A 4JPBW 3CZ6A 1LDDA 4IHWA 4ZYAA 1SD7A 5J8CA 1MD0A 1RC9A 2XAQA 2DILA 1ETQA 4QPOA 4S04A 3CCQQ 2LH9A 2FRYA 5KCHA 2DA2A 5JI6A 1T08B 2WAEA 2BY1A 2CYYA 5ILVA 1C1AA 1ZUUA 2JRMA 3DBRB 2OJ2A 1A0NB 1UHSA 5EEAA 1W2BA 2P0KA 3EG0A 1FLIA 1F1ZA 1OCPA 2MH2A 3BE3A 1TP4A 2KROA 2XICA 4KH0B 4OMQA 5A0GA 5IP7J 1IN4A 1YYVA 3META 1BR1A 1W0UA 1AHJB 1QZYA 4IUTA 2E34A 3PQJA 2WAFA 2IS2A 1WJRA 3VYTB 3JCUC 2BZYA 2DOAA 3HRUA 3VEPA 2VONA 1BOBA 1PC0A 3T5XA 3V8JA 1STZA 1UE9A 2CH4A 2CREA 4J6YA 4XLCA 1PHTA 2X9DA 1I8FA 1Q81U 4NHJA 3MZYA 4IVNA 2HQHA 2HQ5A 5HS9A 2DPUA 1WCMJ 1VFCA 1T98A 3A8HB 1YIJI 3PO3J 3MP1A 3CCLT 5CKBA 1YI2Q 2IJLA 3PJRA 1UG2A 4A4FA 1FOYA 1RAIB 3RYRA 3E9FA 3BC8A 3EGDB 5DLOA 1NHAA 2MA3A 2X1CA 5LHIA 1ZK8A 4LK0F 5LD2C 3WGIA 1QLYA 2ZB9A 2E6ZA 3LSRA 2HKNA 1V5EA 3OMGA 3MP8A 4RGXA 3VRYA 5KE2A 4G7OF 2P8TA 3A52A 2LT4A 1A35A 3E9GA 4JRQA 2TCTA 3HXLA 3HPHA 3HTUA 2AZSA 2MABA 2GFUA 3QWXX 3H35A 1T3LA 1UG1A 3IH2A 2EINH 4FT2A 4BGDA 3JCMP 5IT9K 3H92A 3L2QA 1LFUP 2JM8A 1BBYA 3FXMA 1QCNA 1FBQA 3EUAA 3HPGA 4IEJA 2F5CA 2OUMA 2QSFX 4UVCA 2KLOA 4JP0A 3WTXC 5DM6F 3RKQA 2IEKA 2I2LA 2H1LA 4HNVA 1W1FA 3LGFA 1WJFA 1REPC 4JZ3A 2DLLA 2JTVA 3TEEA 4PSWA 2M7AA 3IKTA 3QPLA 4C8QA 2F1LA 3L2UA 1NH3A 1LJOA 4KJZA 3BZKA 1I6XA 2Q0OA 4FX4A 2Y90A 2FPFA 2K2VA 1YLFA 4XK4A 3UNGC 3IRQA 4KT0E 3VV0A 5GAN7 1TWHJ 3LAPA 4KITB 5B3SH 5CO7A 1K83J 2W7NA 1PNJA 4MTDA 1V5FA 2LTPA 3BP8A 4KA4A 3VYRB 5FRMA 1YQAA 1KU7A 1XGSA 3J7AO 2XI9A 1MV0B 4NBQA 1M90R 3X25B 1TTYA 2FNPA 2F2VA 1V29B 2D0NA 3H0HA 3JCMW 4HT9A 2L5QA 1WX6A 1IJWC 1RAEB 5D8KB 5B5EC 3DPTA 1HDDC 5GJVB 2ME6A 2CS3A 2XF7A 2ZJQF 3KYDB 3AKZA 4CYCB 1JXSA 1VYVA 3J7YJ 2H3JA 2ZKZA 4LXCA 3CC2I 3GIBA 1H8AC 5KHDA 4ZJZA 5BMZA 2C6YA 1OYYA 1Z9QA 1O75A 4RBOA 2J05A 2QDYB 4XL9A 2A05A 3LFUA 1LDKB 3PM1A 3PE0A 2I8DA 5LJ3d 5L3DA 3F70A 4KICA 1R6RA 1U5TB 3ZRGA 4BXXJ 1NEBA 2CDTA 2EIFA 3X20B 4RTVA 4M78C 2ZCFB 2M0CA 1GV5A 2ZPGB 3CQTA 2DTZA 3SWNB 4UNOA 3K4LA 2XK0A 2OD5A 3P8DA 1ETXA 4AFQC 1NBEB 3G71Q 5CKEA 2XPVA 2VI6A 3U1DA 4OAZA 5IAYA 4LFUA 1WHLA 1YJWA 3H0FA 2Y69H 2E5ZA 2RNGA 4KISA 4KIBA 2L2OA 4M7AD 4RDUA 1K73U 1M2OA 4AG2C 4IXAA 2K3XA 4KYWA 1MH3A 1WZ2A 4YIRX 3AT1B 2BW3A 4CCOA 2COZA 3FF5A 1UEBA 2L3PA 3PTAA 2YXYA 4N4OB 3I55Q 2ETHA 3CCMT 4HZFA 2QA4T 5CYVA 1X58A 3R4KA 1QW1A 3CF2A 3CCUQ 3AL0B 1R5GA 2KAFA 4BU2A 3X24B 3BR6A 4HCBA 5CK9A 3ONQA 3KZYA 1FEXA 3HKZN 4A5NA 2JA5J 1J59A 2AO9A 4HQMA 2PN6A 2CKKA 2WSFE 2W00A 3ESWB 3KX2A 4OMYA 1JHFA 3CTAA 4L5JA 3G4SI 2R93J 1IRXA 3S3OA 4BEHA 3CC4Q 4IIMA 2QCOA 1XCVA 1YIOA 2HQNA 2WBMA 2DFUA 5E17F 2RQUA 5GAOp 2W84A 3CBMA 4P5NA 2CG4A 1SAXA 1IDZA 1Y1WJ 4XKCA 5EDNA 1M2VA 1X43A 4FW1A 4KGZB 3HL2A 2QKMB 4IOCF 2V9VA 3KPHA 2EIKH 3WU2C 2FPEA 1K0XA 3BWGA 1MH4A 4RS8A 1PUFA 2VV5A 3VYHB 4KIFA 2ELJA 2VKHA 1ZELA 3SZTA 5ICEA 3SEMA 4E2FB 3E7LA 5J40A 3TO7A 1VQMQ 2O88A 5L3BA 2P5LC 1MJ9A 4RAGA 5E79C 3QPTA 3CDIA 3E6DA 1FTZA 2GAUA 2V8KA 3LGLA 3OYNA 4CCLA 5IT9E 1XGMA 4ENNA 3FM3A 1DQUA 1ZSZA 1H8KA 3RPUD 5A0LA 2EJRA 1IO6A 5F1RA 1F36A 5IPAA 3CCLI 1P92A 2DFIA 1M3AA 3MCAB 3P8HA 2DL3A 2P81A 3J81E 1B9NA 1AKHB 1G3TA 2CWEA 3LA7A 4BD3A 1VQKI 3JRHA 2CUZA 5FU6C 1KIKA 3AG2H 5EYRA 1UUEA 1XD7A 1LEBA 1V3FA 3P9IA 2F5FA 2QKLB 3ROUA 4A0YA 5D5XB 3OS1A 2MUNA 1O7FA 3QYEA 3ZQFA 3GTOJ 3H9JA 1WGXA 3PQKA 1HW1A 3CD6Q 4M78F 4RGRA 2O8XA 2OTLI 2X3XD 2FNAA 3PMTA 4M7AA 3KYLA 1SVLA 3K70C 3DTEA 2P4RA 4HKEA 3VS1A 3I35A 2DYBA 2K27A 4R56A 2KE9A 4PJOD 2JNGA 3OW2S 4HW0A 2RHYA 3PIOA 3WHBA 3GPLA 4NC7A 3DQVC 2L7MP 2PJRB 2JUFA 4BXUA 1YJNI 3PNTA 2VBZA 1Y1VJ 1I39A 3V4GA 2PFBA 5K5OA 2X9HA 5TISC 3S1QJ 3W6VA 2OAUA 2FYKA 4GYGA 3K4BA 3PUFA 4MO7A 1ZQ1A 1JUPA 5F0FA 3EYIA 1U5SA 2K5IA 2NUPA 4M77A 2VJ5A 1K8AC 1G3WA 3FB9A 2R0QC 4PCQA 1U78A 1MSEC 3TQ7P 1OV3A 5C44J 4XKBA 2K3BA 2VGMA 4C8QF 2HOSA 2VODA 2O61A 2EZLA 2O4XB 1EFNA 1VQPQ 1O57A 1GFDA 1S8NA 1WFXA 3J7AF 1JKPC 2X3WD 3GXOA 5E8IA 2DL4A 1XGOA 3LQRA 1ZSZB 1APLC 1ZRDA 4NS5A 4M7DF 3E5QA 1TUDA 3A8LB 3SDBA 4B44A 4NQWB 3F8BA 3S1RJ 3I55I 1SD6A 4HDUA 3QQAA 3A8MB 4Z88A 3DTIA 3REOA 2GF7A 2LMJA 4Y28E 4C3IJ 4BY7J 2HVSA 4C92E 4EIKA 2CP7A 3HTRA 1PUFB 1NM7A 1Q7YU 1IGQA 5IHKA 3V7RA 4BQNA 1Q7YR 4EDUA 2LX7A 5H6QA 2E5QA 4M75B 1I50J 4IX7A 2HVRA 1WJAA 3ASKA 4C0FA 5GAHJ 1M2VB 4ELYC 2X48A 1O3SA 3QKJA 5E18F 2K5FA 3CC4I 4HF1A 2DT5A 1BI2A 4IQ4A 1UMQA 1IAWA 3ECHA 2NVXJ 2A61A 5GAMh 2LQNA 1IN6A 3FRNA 4IRIA 5AONA 5DCFA 2JSPA 3IV5A 4IO9F 4A3BJ 1VQ4T 4C3JJ 3M0RA 2FJ1A 2FZGB 3V7CA 4NUBA 4XTXA 3O8GA 4A0XA 4DOVA 2HEQA 4CI0C 2DMQA 4EATA 5HVQC 3DLLF 2DPPB 4M7AE 2VGNA 4M77G 4BDZA 1R8OB 5LGTA 3RERA 1WSUA 3ZQIA 3L00A 2Y4YA 1WQ7A 3L9FA 1RLPC 2EPDA 5L23A 2ECBA 2Z1DA 5BNGA 4X0GA 5DCMA 3N97A 1Q82U 3VWBA 3OYEA 1WH7A 4B8XA 2OTLQ 1WHGA 1YS7A 1WJDA 1MJBA 2L7FP 2MIOA 1PJRA 2O4XA 3G1OA 1X1AA 5D6WA 5CIUA 4CSWA 1UJ0A 3BQZA 1EKEA 2LVMA 5FKOA 5L8RE 1S9HA 1YCSB 4M77B 4DZPA 1GVDA 1YW8A 4E7JA 1MIJA 1J3TA 2G0EA 2KHMA 2VC0A 4B47A 2VXDA 5IOYA 4IL6C 4XQ3A 1D8JA 4AVPA 1TTHB 3RESA 4QSHA 4A12A 1E0EA 3C95A 5F64A 4PJOF 2MW8A 4E7IA 1MNMC 3QPSA 1M90C 3SWNA 4QPQA 4DNCA 2E2HJ 2NRAC 2DTIA 2E65A 4QKUA 2NS0A 4QQGA 3M5AA 1VQ8I 4FIBA 3BTIA 2A69F 3FMSA 3S2WA 4U0YA 1U5TA 4DOZA 2JN0A 2ZXHA 3JB9J 3CCLQ 4ZDOA 1NLPC 1ZYRF 2QI2A 3JB9D 2DIQA 1IGUA 1QVGP 3AHUA 2YSQA 1Z1DA 4ETSA 3K9TA 3H1CA 4OGEA 4F04B 3G6EA 1XMXA 4JRKA 1WHMA 2DD4A 2O9SA 2XB5A 4CYCA 3BLYA 3I4NJ 2D45A 3OYYA 2RGVA 4B6MA 1IXCA 5E20A 4CYDA 2LJ3A 1YJ9I 2W57A 3KP2A 2VQLA 2QQBA 1W4SA 1D5YA 1M1KC 4XTVA 3VS4A 2VT2A 5GAN2 1TNTA 4EMHA 2ZFUA 1AKHA 3K1NA 4ZGDB 1O4XA 2DL7A 1IN7A 2LP5A 2XF5A 4C92F 2QA4Q 3PNWC 5TGTA 4AG1C 1M90U 2K5LA 2MF2A 1XS9A 4UHTA 1F43A 4ZYGA 2OTJI 2JMCA 4ESJA 3HFNA 3K1PA 2QEXI 4S0HB 4LDXA 3Q3SA 1LNXA 4A2UA 2EK5A 1BU1A 3F3XA 4ZDLA 3G6EQ 3TSZA 1OYXA 2PMUA 1XOVA 4LD9K 2ZPEB 3JSCA 2JA8J 5EZHA 1CKBA 2KJCA 2W10A 1HSQA 1LE8A 4GRIA 1UJYA 1YRNA 3GTJJ 2EFOA 1UFMA 2VJJA 3BG5A 2V1UA 5DS9A 1NK2P 1EF4A 4GLKA 5AYFA 2FX0A 2ZZDA 3MMYB 1I6HJ 4S05A 2JTEA 1FIAA 2YUNA 1J0RA 2RI3A 3M1EA 2WA0A 3SQNA 1K9MC 3D1NI 2FMYA 4BXFA 3DLLA 3ABKH 4CDGA 3CCMQ 3OIPA 3F6VA 4ASNA 4HSTA 1Z0XA 1VQNI 3KBGA 2DK5A 1UG0A 3VDXA 3PNVA 2R3SA 1RR8C 3I64A 4JQFA 1JXOA 2XHKA 4KGXB 4OGCA 3CCVQ 1LVKA 3I0TA 5CR2A 1V54H 2LCLA 1SD4A 3J81K 2OC6A 2EZHA 3FBNB 3SZPA 4AYBN 4BACA 4HT8A 3UWNA 3WGHA 1JJ8C 2UXNA 2M2EA 3CO6C 2LD5A 1TUCA 3OYIA 3HOUJ 2P0QA 4N9IA 3SYTA 5GMKi 3JAME 2VE8A 2DBBA 2CZ6B 5J1RA 1MV3A 1LJ9A 1SEMA 1HF0A 3MCZA 4G6TB 3ISPA 1G83A 4CCJA 1R7JA 3LSTA 4P9FA 1YFNA 2LQWA 1R1TA 4OB3B 1D0YA 1CF7B 1B9MA 1KYWA 4WXCA 5D6FA 2AXLA 4Z8AA 4A4GA 4BHBA 2HOAA 4FX0A 3EDPA 3ZP5A 3OS2A 3DKWA 3ZPLA 2QQ9A 2WV1A 1WQWA 2KQWA 2RK2A 1KONA 3HGGA 4C92D 1O7LA 2MLGA 2DT7B 4M9XA 1MBEA 2FXAA 3H3UA 2DXUA 4OU0A 2BE5F 4DOWA 3CC7Q 3QZ9B 3HM5A 2ESNA 2KKOA 3RZOJ 3K4MA 1SKUB 3SDZA 1BIAA 3MEVA 3JCMV 1ZQ3P 3QWLA 4C2UA 2AT1B 2QGUA 4MHGA 1JJ2S 2IGNA 2AS5F 2FOKA 4F7ZA 2M9UA 4RGSA 3GZ5A 2DOEA 3JB9F 2RQVA 2EFQA 1HLVA 1HKTA 4KRTA 3VS3A 3K1MA 4C3HJ 2XHCA 4JS4A 1Z3YA 5FFZA 2WC2A 3KUFA 1C6VX 3QP6A 5BQTA 3W2AA 4CRIA 2DVEA 3CCEQ 3ZFJA 3Q0UA 5JR3A 1X27A 2LKXA 1IHWA 3MVPA 1BCMA 4FYYB 2XIDA 4FSXA 1H3HA 2GXGA 5GADJ 2FZCB 4RCCA 2CH0A 4TVRA 3EHQA 1YITT 2KRMA 4EM1A 5ED4A 4G6DA 1V76A 3TP3A 2KISA 4DIQA 1IRFA 5F1JA 4HLYA 4HF2A 1FIPA 5HNFA 4P9UA 5GMKj 2NS7A 2DVJA 1GVJA 1JJ2P 2A5YB 3CO7C 2FSWA 5BOXA 5CCAA 2VLAA 5D8LB 5E3NA 2DLPA 1YX3A 1X1BA 2YLCA 3I56Q 4OMPA 4LE9A 2Y75A 1PD0A 4M78D 5FLXK 4R0KA 4N4HA 2DEQA 1YI2A 1X3WB 3VS2A 1T2KA 1YW7A 2VWFA 4U0VA 2IAIA 1I3QJ 2IA0A 3TW6A 3ZL7C 1XGNA 1JGSA 4DA4A 4F93B 1AD5A 1AT1B 5GANj 3LWHA 1GCPA 4I0BA 4DYCA 4BDYA 4J9GA 4Y3OA 3QZ5B 1XC5A 1QBJA 3CC2Q 4RTTA 1T0FA 2CJJA 2CZ1B 2KT1A 2XU8A 2J06A 3VS0A 3O8VA 3R6NA 5K5RA 1M4ZA 5DUKA 3GTLJ 1N5ZA 3QIIA 3IAM2 4A3CJ 3JCMg 2EIJH 2CV0A 2Y9YA 5ILUA 3B02A 1MKMA 4WXDA 2FBHA 4V2GA 1AWJA 2BTTA 5K7FA 2FL7A 4CCNA 2JTMA 1U6GA 3P9CA 3IL2A 4HXJA 3R0AA 2GIZA 1WJSA 3PGGA 2HZYA 3M3YJ 3VJPA 1T95A 5ILSA 1FTTA 1UGVA 5KYYA 2IA2A 3OYBA 3F8MA 1QVPA 1W7PA 3LNQA 4F16A 4II2A 5EGOB 2ESHA 3WXMB 4MNUA 3HOSA 2V1DA 4M7DD 3OBYA 3ZR8X 5CPRB 3FXQA 3TEDA 1ZG1A 3HOTA 3OA6A 1SG5A 1BM9A 4BKXA 5F0HA 1T38A 3FMRA 1HA8A 1OU8A 1X2KA 2P0PA 4II1A 1EH7A 5CVUA 2WY8Q 4L9NA 5M5YJ 4W97A 3ZGKA 1VYTA 2BE7D 2D9TA 4MDWA 5LJ3e 2R5ZA 2OTLT 2DQLA 5GAEJ 2DKGA 3FLGA 2TRTA 1V55H 2K3FA 3Q9VA 2IGMA 3ERED 1SFUA 1DP7P 4UV9A 4DJAA 2Z0WA 2QF7A 2QLZA 5J4YA 3QG1A 5C6SA 3BROA 2QVOA 3A0BC 5IY5H 1OX9A 3CCVT 1OR7C 2PVDB 2K9MA 4Y91A 1TWFJ 4BJ6C 5M3MJ 1WHJA 4A4KA 1QZEA 4C30A 2XMFA 4B9XA 5J47A 3H0GJ 1WJEA 3FKIJ 3DEUA 2R7UA 4OIOF 3LH0A 3JRBA 5FFXA 1ERDA 2MZ4A 4NL2A 3G4SQ 2W24A 1EA3A 4FYWB 4YFNF 2QGGA 4OVAA 1OCZH 3VSLA 1G6NA 1E3OC 4KUMA 1VA7A 3LSMA 1M1GA 3CPFA 3QOEA 2F4OB 1RABB 3A8GB 3HZJA 3S15J 2DZ9A 4C5IA 3QYGB 1QQIA 4M3BA 1TUGB 3T1BA 4M9ZA 1Z21A 4RG2A 3DP7A 5DEQA 3SDGA 2GXBA 3SHFA 3M0TA 2E7WA 1I3AA 3A02A 3TKYA 1S6LA 1YHQT 3CD6T 4Z2YA 1NLOC 1BW6A 2L8DA 1XSVA 4FQGA 4XM3A 1LOJA 1U9OA 2GXAA 3TOAA 2ACJA 2XRLA 3GNFB 3DFGA 4L9VA 2L0KA 5GANe 4RTYA 1OPCA 2QYOA 5LEKA 1CQTA 2E70A 2KY9A 2OZ6A 1MGQA 2K86A 3HL8A 2V7FA 4AVZA 4HCKA 3VUZA 3FC3A 1JJ6C 3DB3A 1OZ3A 1ITYA 1F4KA 4X9DA 1I1GA 1BC8C 2ZPBB 4QQDA 3FK6A 2KGTA 3GMEA 1SVOA 1TQPA 3EG1A 5KK1A 5GAMf 3KLNA 3K4JA 3JSOA 4BI8B 3WU0A 2M9HA 5GAOq 2HFHA 1WFWA 3L2RA 2ID3A 2L9NA 2OJED 3CD6I 3KP5A 5CQGA 4I6ZA 1Q81R 2VUBA 3QWYA 2FMLA 2KIFA 2KIUA 1IN5A 1MBJA 2LMDA 4NB5A 4CH7A 2LG4A 5GPCA 2XC7A 1VQ6I 2CSIA 1IRGA 1YS6A 1DUXC 3OYAA 2L02A 2Z99A 3S32A 3ABMH 4V2SA 1JKOC 4J8OA 3PFYA 5GAN4 5I21A 1Z9ZA 1KD1U 1GL5A 2DJNA 2DQRA 2YSRA 3R61A 1MBKA 2KFDA 3BJAA 4FW2A 3OYFA 2IPQX 3CCYA 2H8RA 2L9RA 3ERMA 3FXLA 3M4YA 4FT8A 2VKNA 5AT1B 3J7ZI 1KC8U 4Y15A 2XROA 4M7AC 1S72I 3H9GA 3HGYA 1X2MA 3CCQI 3OYDA 5B1BH 2PI0A 3WTWC 3I9QA 1RADB 4IOAF 3BPXA 1NTCA 1W4MA 5FO5A 5HDNA 3J81R 2OX7A 5I2MA 3I56A 5DD4A 4A3GJ 3LSKA 2LCCA 5KYUB 5BS6A 3SHWA 2M35A 3E1SA 4R1HA 3EGXA 1X6OA 2JJ7A 4WF2A 3CBOA 2XGCA 3H3VK 3WTUC 4B09A 1KSWA 1FC3A 4EPCA 5EEGA 2QQSA 1W2BP 4OMNA 1XDSA 3W6KB 3G7ZA 5HKCA 3MP6A 4MZTA 3BTCA 3FJ5A 1GXPA 3CC2A 1QVFP 3IC7A 3VPRA 4LJZF 1GBQA 1XCBA 2M1HA 5ICFA 2DA3A 3KP6A 1YITQ 1TWAJ 3PVQA 1EJ9A 2DAOA 2GNCA 3R60A 3TOBA 3LAJA 4RTZA 2MC3A 3IH4A 3CCJT 5CQEA 1OCOH 2KJBA 2LF7A 1VTNC 1NG7A 1DP3A 3FIWA 4PDKA 1UGPB 1X1CA 3M8EA 2GTJA 2NYSA 1HD3A 4J9DA 3CMET 2PEXA 2NAZA 4CA0A 2IW5A 2ZXWH 4BH9A 1LPQA 5CVJA 3GW2A 4M6YA 1FOXA 1ZSGA 2M8GX 3BDDA 2M87A 3QU3A 2AK5A 2EGAA 3U23A 1GUUA 3J80E 8AT1B 2FVUA 2BOLA 3QAHA 2PJPA 5JHFA 3I59B 4Q47A 2VBYA 1IUFA 5HS7A 1YOVB 3RKWA 1I07A 1JQQA 2O31A 4L6V5 4QQ6A 4RTWA 1VQ5A 1RUOA 5GMKh 1BI3A 2L7KA 1G3SA 1X19A 2OAZA 3LH5A 3KIOA 2VKDA 1V5GA 4PLLA 2HDAA 4AT1B 4XKVA 5FRNA 4RMNA 3HOYJ 2L3DA 4JJBA 1KQ0A 3JCMd 1Y8QB 1M27C 2YWWA 2LZ6B 2VJIA 1QZZA 5CVIA 1E2XA 5KYYB 4L5IA 4IIOA 3JRGA 1YW9A 1PG5B 1ZR2A 1KA8A 2DCEA 1RUNA 3CC7T 1QNTA 2CP2A 2DERA 2RO0A 1X4OA 4E7KA 3EFOA 4XTYA 2BUDA 2KPMA 4QVCA 1GT0C 3CPWS 4ESBA 4Y33A 2STWA 2OAWA 2KEAA 2JMWA 2O7OA 3C18A 4XLHA 3G1MA 1W36C 1B8IA 3RZDJ 4YFKF 3HDDA 3TBIA 2FRWA 1GFCA 2COBA 1YTYA 2X4JA 2HDDA 1W5SA 2ZPFB 4EMKA 2L01A 4FHTA 3JRZA 5EGOA 3OSSC 4XK8E 1OEBA 4FYXB 1TQIA 2CMPA 2I5UA 1OX8A 4IUPA 2JUCA 4E47A 5HDGA 3T8RA 2K57A 1EV7A 1MMNA 3BR0A 1OKRA 5LJ5g 4HNUA 1K61A 4I76A 4BBSJ 2L54A 3HRMA 2DMPA 1TT0A 3CUOA 5FD5A 3TMOA 1A04A 2VKVA 1HCRA 4C92B 2IGKA 1UHFA 1XMAA 3MQ0A 3E6BA 2V1RA 2NVTJ 4IRHA 1VQ9Q 2CUFA 2HXIA 2Q1ZB 2YPRA 1JU5C 2DJQA 4BL0B 2O2OA 4RKUE 5KYWA 4BE2A 3ZOBA 2EW3A 3QJYA 4YEJA 4M75E 1P9QC 3CCQT 2ZJPF 3MEWA 2J5PA 4BE1A 2VPLA 3CMEQ 1XX5A 3HSRA 3MKZA 1J2XA 2KZVA 4ON0A 5J26A 1AEYA 5CKFA 3GFMA 4GYIA 2DMNA 2RHIA 3L42A 1RI0A 1BKBA 3C2HA 3TCJA 2LP0A 4MGRA 3CCLA 4ZYDA 4HV6A 2MWOA 3LX7A 4RM2A 3VOEA 5M5XJ 5JLWA 2EKHA 2SEMA 3H41A 4RG8A 4BUPA 5J4VA 2O6GE 3DXJF 5IT9R 4EM2A 3CC7A 4EJTA 4GCVA 1AWCA 4M75A 1JKRC 2VT3A 1S7AA 5GJWB 3FWEA 2KRCA 2DJIA 1GXIE 1YJ9A 1N8RC 1JJ2A 1WGSA 2RAEA 1P7IA 1BB9A 4FYVB 2RH2A 2JM9A 3JCMQ 1A6IA 3HOWJ 2DO3A 4FASD 1JB0E 3K10A 1RAAB 3AG1H 2K9QA 2ME0A 1NG2A 1ACMB 3JB9I 1T33A 4X1EA 4OF1A 4JRPA 3HUGA 3IWFA 3QYBA 1YE9A 3CMMA 3CCST 2ZO4A 4MFEA 5FJ8J 2LNVA 2FRHA 4M77F 4XONA 5FU7C 1YI2T 2HDCA 2A28A 5EG0B 1NJIC 2NOGA 1QRYA 2H8WA 3BFMA 1Z05A 4MMKA 1ABOA 2FD5A 3E6MA 4C5EA 2DFFA 4HA8A 1VQPI 2CUBA 3G4SA 2VJ4A 1B72B 1XTDA 2W85A 3OYCA 3CF5F 3ZMTA 2PLYA 3CMYA 1HQCA 2CQKA 3DKXA 2RMOA 4OB0B 2CRGA 2K4JA 3T0YA 1PKTA 2FB7A 2MVTA 5EC7A 5LJ5d 2OPTA 4E7SA 1AOJA 4KNYA 1BIBA 4XIDA 2L4AA 3H6ZA 5F6FA 2FEIA 3KZZA 4B1RA 2QG9B 1TWGJ 3ABUA 2A07F 2OTJT 3RJPA 4LK1F 3L2VA 1T0JA 2F5TX 1VQ5T 2F4IA 4E7HA 4GLMA 1FPQA 1Y71A 2VOPA 2DODA 2EYYA 5GAN5 1M1KR 4C5GA 2J6FA 2BXZA 3E5UA 3JCMJ 3ZMVA 2IXSA 4JLGA 3ZN1A 1P2FA 3TW7A 2R92J 4MLOA 4Y4RA 3U9GA 2RI5A 3KZIC 3WTTC 2DIGA 3CD6A 1FYLA 1YJ9T 1HW5A 1ZN2A 4C0ZA 2GM4A 2HD0A 2V26A 5C3EJ 1MBFA 3LOCA 2VXFA 2GBQA 4N0AC 1D3BA 5IYCJ 1SSFA 2D1XA 2M3AA 1WXBA 4BYYA 1WLPB 5GPAA 1VQ5Q 4EMKC 3DB4A 1U1SA 1BL0A 2X35A 5IHNA 1Y56A 2EQRA 1JEGA 2AHJB 2HQAA 3FXRA 4OWRB 5LGNA 1DU0A 4UY8I 3CCRI 4F91B 3ELKA 1UFFA 1T39A 2Y0SA 3P8BB 3UPUA 1RPWA 2BYVE 1TZLA 1M3CA 3BG3A 5DYMA 2M16A 1VQ4A 5JVTA 1ON1A 4HCZA 2JTFA 2ELHA 3X28B 3EPZA 4UUSA 2QTXA 1MZBA 3I54A 1MW7A 4RMOA 2LNBA 3HRTA 3NEUA 5GTIC 3FKJA 3JRFA 1UECA 3OR1C 4M7DG 1C0WA 2YX4A 1ZBJA 1QMCA 1F5TA 2WACA 5GAMj 1FBSA 1RESA 1WVRA 2L2PA 3DBHB 1RNLA 1WHUA 2BVLA 3TGNA 2DF6A 2KMTA 2DXIA 1HKSA 2LTOA 5LRSA 4F52A 3GF5A 4O5VA 3EG3A 2NUTA 3WTZA 2RN7A 4JRIA 4EVIA 4YTLA 2V9KA 2XDBA 4PK4A 2DDAA 1KK7A 4O3MA 2XKPA 3QOPA 4I99C 5K7ZA 1VQKQ 4M7DB 1TT5B 1I0CA 2CSOA 2DU9A 5LEJA 4KMUX 3WU1B 4L0YB 5L3FA 2KYMA 2BW3B 2DYSH 2HZTA 5J1YA 2R58A 1IO2A 2K9NA 1VQMI 1SHFA 2P84A 3M59A 4KUIA 3ZQLA 1LQ1A 4AIHA 1NYFA 4UB8C 4BJTA 3OYGA 1UGQB 1R36A 2YS9A 2BE9B 1Q86C 1K1ZA 5D6YA 1JGGA 1HKQA 4YELA 2ZBKA 1E6GA 1YBYA 3ZBDA 3MAJA 1KU2A 3BCBA 3A03A 2R7XA 3FMQA 2ICWG 2ATCB 1UCRA 3EHRA 4EJWA 4K11A 5KE3A 2MH9A 4U7BA 4IUQA 1CSKA 4NOYA 4X34A 1T0HA 4C2TA 2HVQA 4M78E 2M0OA 1OULA 3M58A 4OMOA 2P6SA 2KL4A 4C8QE 2EQJA 4EV0A 1YIJA 4P55A 4RGUA 4XRMA 1WDXA 1WNLA 3VS6A 1KD1C 5IP9J 5A2QZ 1ZLJA 1Y39A 1N78A 1UZCA 2MSYA 3WODF 5KYXA 3HHHA 2FBIA 1O9SA 4RAZA 2WAQA 1OPKA 1FJLA 3W3CA 4HX4A 2RN8A 3EUHC 8ATCB 4G6QA 5B66C 5LHHA 1FNNA 3EH1A 2EV0A 2AZVA 5KH6A 1BCOA 3J81Z 4LG0B 2HXOA 2B63J 1VIEA 4CO8A 2QASA 3SFMA 2ZMEB 2Z3YA 5DCMB 3D5SC 4RA2A 2VBXA 1VQ7T 3T9NA 3VFZA 1OISA 1PSFA 1S1NA 3JRAA 1WXUA 4PJOA 3WTSC 5IT9Z 2I0NA 2ZNZA 5KAFC 4RTUA 3LWIA 1YIJQ 1U06A 1SANA 1U9NA 1UTIA 1YJNT 1NE8A 5M3FJ 4KT5C 3L7WA 3MWMA 1E7OA 2P7VB 3P9KA 3CDHA 5E3OA 3OW2A 1G5VA 2XASA 3AFHA 2HKOA 1RKTA 1Q81C 1K73R 3HSEA 1X1DA 2O3FA 5F27A 4A3MJ 2GA1A 1B6AA 3RYPA 3WE2A 1B07A 2O9VA 1WJ5A 2RVCA 3KP7A 1HJDA 1V4RA 2B0LA 2KIMA 2W0ZA 2EA2A 3ABLH 4XKWA 2I10A 3K2AA 4ESRA 2UV1A 5GAOl 3CCMA 4ORZA 3LL7A 2Z33A 2HEOA 5E1XA 2JOYA 3WVEB 3BR1A 1VQNA 2YUPA 2LQKA 2DA7A 2CQQA 4XLFA 1Q86R 3OYJA 2CS7A 4FT4A 2DFHA 2AKKA 3QHSA 1NEGA 2JA2A 2H8HA 3AG4H 4HYEA 2KIQA 2QUFA 1L0OC 5CVVA 4D5FA 4PL6A 2HS5A 4IHTA 4W1UA 4X9CA 5A2QE 1LB2A 4NQWA 2QSHX 1ZGJA 2NLUA 2KSSA 2IS1A 5DLQE 3CBPA 4ZYEA 2X1EA 2EJGA 3S8PA 1PKSA 3CCSQ 4L0ZB 2JS0A 3JB9H 1OQYA 1P6RA 2ROTA 2FOWA 2QEXA 5LJ5j 3BR3A 4R8HA 4KBMB 1WKMA 2EYQA 3RTRA 2LT1A 2Q2EB 5KNLA 4PGHA 3AAFA 4UUVA 1YN8A 1ZARA 4D8KA 3G71T 4ZN1A 2EAYA 2NUPB 1HK9A 1I5OB 4ZNXA 4M3FA 2VUMJ 2MI6A 3DKYA 4DEXA 3CXCS 5C4XJ 3JV3A 1I5ZA 4XRSG 2K9SA 4JJCA 1YHQQ 4C8QC 4M9SA 1LFBA 5D6EA 2E2IJ 1BI1A 1S7EA 4I7HA 1A5JA 2X4HA 4C0DB 4N4IA 2GGRA 1R22A 2ZNYA 2OI3A 1QHHD 4QTRA 2CUDA 2Y0SN 2A6EF 3CCEI 1EH8A 4GDFA 1WI7A 2M30A 3CJNA 2E1MB 4AYBA 4M7AB 4J9EA 4WCGA 1O3RA 2BHZA 2NS8A 4CC2A 1QP3A 1W70A 2DYIA 1VQ4Q 3VS7A 2X6OA 1D1BA 2VQCA 1EX4A 5GAN3 4MQ9F 1TSFA 2L89A 2KRFA 2RNAA 3BJ6A 3RI4A 3C4SA 2D8JA 3NGPA 1VQ8Q 4PJNA 3RQ4A 5EG0A 2DMUA 4P96A 2EFIA 1B7TA 4I0AA 1TWCJ 2XKOC 2EPFA 2KP6A 4D8DA 1RR7A 3CJQB 1AVZC 2HNIA 2OTLA 2RC4A 1VQ7I 2HKQB 1XDUA 3IAS2 4RTXA 4KH1B 1RAHB 2DMTA 1VQ5I 1R77A 3X26B 2FEZA 4NNJA 3GWZA 4CCMA 1OI1A 1WPKA 1FT9A 3ZEHA 3E0JB 2DW4A 2RI2A 2Q8KA 4NC6A 2JS2A 4F7UF 5GAMe 2DOFA 2GQQA 2LRQA 1EZZB 4XLPF 2KR3A 3GLLA 3WHCA 3JRCA 3JB9G 2JA6J 1XG1A 2F5KA 1N8RU 4ZTFA 1XJWB 1SMYF 2KRSA 3G71A 3S6WA 1IZ1A 5GAN8 4J9HA 1SC7A 4G94A 4ZN3A 5LRRA 4LNPA 1Y0NA 1KU9A 3AG3H 3I56I 3OL4A 1PUEE 3LLRA 3VYSB 2JPCA 3F8CA 3G2BA 1AU7A 4BNCA 5DUIA 2QTVA 1X01A 5ECAA 3OS5A 4OAYA 4A63B 1IXRC 3FM5A 1QVGS 2LY2A 3CJTB 3D5LA 3B6AA 1NJIU 3H5AA 3CMAT 2VN2A 1JI8A 2NVYJ 3J7AW 2HR3A 1Z9CA 4HLXA 1BK2A 3TP0A 1A31A 1TS9A 1ONVA 3ZQGA 2PTKA 2X51A 3LFKA 5LJ5h 2VXZA 3M9AA 4C92C 4WWCA 5HK3A 4M7AG 2V9PA 4L5EA 5GP9A 3RR6A 1OQKA 2KDSA 3O3KA 3TREA 4XRFA 2MFZA 1YHQI 4HV5A 4OMMA 4EJVA 1VQLQ 2JN6A 4EJUA 3OYKA 2DTHA 5C0MA 4CC3A 3OS0A 2JT4A 2PVGB 1YWOA 4A3IJ 2X6YA 4J6XA 4P5OA 3X2QH 1QU3A 2OA4A 3C2BA 4MIMA 3F8FA 3I5SA 5DD8A 2P5VA 3RPQA 5FD6A 1QVTA 3BR5A 1X2QA 1SFOJ 4N0AA 2GBYA 4Q48A 3TO6A 4AIDA 4EM0B 3S3MA 1B8IB 3QBYA 3TVTA 1SRLA 5TJJA 4YRVA 3MKDA 3H9QA 1RKWA 2K79A 4M7DA 1ZAOA 2HPMA 4XBFA 2YDLA 2B86A 3I59A 1W0TA 2MD0A 3EFOB 1Z67A 3OR2C 2AIRB 1VF9A 1E6HA 2RHZA 3WG7H 4ENKA 3LMMA 2E5NA 4E6KG 1IXDA 3L09A 1OZ2A 3W6JB 2XAFA 1R1UA 1N75A 1K6YA 5EF6A 1LVAA 5J1UA 4RB3C 2MOXA 4C0GA 4BY6B 5GAOm 2ECCA 2LBFB 1MDMB 3THKA 2JWTA 3HHGA 4QIWN 2KDZA 2VQGA 3OOPA 1NPPA 5FU6B 3OY9A 3QP5A 4N4NB 2PMHA 2KDOA 1H3ZA 2FHDA 2VL8A 3A5ZB 4LDVA 4FETA 5KCOA 1BI0A 3N5BB 4UUSB 3R6SA 3GTGJ 2DAQA 1IREB 1LUJB 5FU7B 1KYZA 1B34B 3QXEB 2HTJA 5ICGA 2IPOB 1AWOA 4KUDK 1HYOA 1H92A 1U2WA 3LA2A 2GTOA 2BKDN 2OBPA 2XAUA 1K4SA 1W1WE 2HPIA 1ZG3A 5IYBJ 1UELB 2ROLA 1SRMA 7AT1B 2KZGA 3EGDA 3CCET 3EGXB 1W5TA 2MCNA 4LLNA 2UWMA 2C0IA 1KQSS 4P1WA 4I2OA 1VQLA 5KYUA 3HFOA 1D3BB 3C0CA 2WWYA 3CEYA 1RL2A 3S93A 1VQKT 1ZH5A 2O5RA 5FGMA 5BPIA 1VQ7Q 3WG9A 3VODA 2V79A 5D5WB 3KEQA 4FU6A 2JZ2A 3LWFA 2JW4A 4Z6YA 3VUBA 1GXQA 2V8JA 4FE4A 1ZGWA 2ZCWA 3GNGA 1QKXA 1KGSA 4LD5A 2RREA 2H6CA 3Q5FA 1FOWA 5FLXZ 2HZDA 1JBMA 2E35A 3CCUA 3E5XA 1N8RR 2JVVA 1ZX6A 3CMEA 5GTHC 1D3YA 2EBPA 3ULRB 5DV5A 3BY6A 4B3AA 2HL5C 4LMYA 4IF4A 2EFWA 1QWEA 5IN1A 2IP2A 2R5YB 3A0HC 1GV2A 1ZLKA 2J6KA 5IP6A 2VBWA 2UUZA 3M0QA 1FOKA 2XAGA 4RAFA 4OMZA 2CV1A 2H1KA 1LPLA 3MZ8A 4LLLA 1KQ1A 2E36A 3EH2A 4OMFB 3NHNA 2RDPA 2A7YA 1EH6A 1J75A 1D5VA 4CXFA 3WGGA 1POGA 4D0PA 2D0QB 5TRDA 2D8HA 2IBDA 3NTHA 3E3VA 4A4EA 1R4NB 3A01A 1Y96A 4M75D 2D1HA 1SF9A 3QDRB 1H9GA 1SFEA 4OIQF 5L3GA 4U87A 3HUGB 5LBQA 2EGCA 3F6OA 2LR8A 2EIMH 3J80Z 5E1ZB 3M4OJ 1B4AA 2QYZA 1H89C 1D8KA 2B7EA 2W82A 1T6SA 2K85A 2V1XA 2W25A 2R7FA 3DPUA 4FISA 2Y30A 2XF6A 1Q1HA 4N9HA 4A3EJ 3UDCA 3VYGA 1K79A 3RSNA 2MD5A 5DM7F 2EVRA 4A5MA 1YITI 1ZBXA 2ED1A 1VQKA 4RB0A 2BEOA 2ENMA 5GMKe 1SVMA 2Y31A 2AQEA 2P0WA 5FWBA 3G6ET 2KQRA 2MMPA 1U5TC 4IHSA 1EIFA 3CCSA 1WA7A 4M77C 2H09A 1WJQA 4ITVA 3N4MA 2X98A 2E4HA 1USSA 4LGWA 1Q95G 2L4MA 3UATA 1BYMA 2KT8A 3NWSA 1W7PD 2R7VA 3GTKJ 4JX6A 1UGSB 2MPXC 3KYCB 2LOOA 1BBZA 5LHGA 2K5CA 3CCUT 1X6BA 6AT1B 4ESFA 2F69A 3A1PA 2E3HA 3CCQA 4F3QA 3MKWB 2CP6A 4C8QG 4HF0A 2R7OA 2EQIA 2HSEB 2YUOA 3M0PA 1M1KU 1VQ6T 2OTJQ 1TNSA 4RM3A 2G6FX 2WY7Q 3HEFA 4BY1J 1IXSB 3IRRA 2E2JJ 2JUGA 4BI3A 1QCOA 3GF2A 3U21A 4A3FJ 3V8LA 1OFCX 1QPMA 4C92A 1YJWI 2LKPA 1Q1VA 3P7NA 3ME9A 1KQSP 1BJZA 2OV7A 3DKMA 5CAIA 4HSRA 1RI7A 4L18B 1JRIA 3HSBA 2NVQJ 5D6XA 3K4NA 4WTOB 1R1VA 1SAUA 1SMTA 1MUZA 5GANg 2V6EA 4G8XA 1V1CA 1FYKA 2EJ9A 2HQEA 3RBBB 3FJPA 4J5YA 3HKZA 3CMAQ 1WXTA 3HIFA 3M7GA 2GIVA 5HDKA 3GLXA 1VQMT 2FUG2 2GCXA 4RUGA 4CHUA 2CZ0B 2R5MA 4JJDA 1K76A 2NUZA 4UUTA 1WQ2A 5M5WJ 2DFEA 3HYIA 3MEXA 2HTSA 4DQ2A 4J19A 2RA2A 2OCCH 1TW2A 3JRDA 4MEXF 2M34A 2L7ZA 2DPDA 4M6VA 4R79A 3TU4K 2CFOA 4M3EA 4UV8A 2GOMA 4PJMA 2M02A 3EG9A 1K9MR 2HYGD 5HODA 1SSHA 2WSEE 3K0LA 3J80R 2GQIA 2W4SA 3SEZA 3RMSA 1YIJT 1YO5C 2RQPA 4KGVB 5DM7R 2XPUA 2QEXT 1K4US 3F72A 2HQRA 2LKSA 2XKOA 2BXYA 4BHPA 3FDYA 1AOYA 5J6XA 1PM3A 1LDJA 2LREA 3FXJA 1D0ZA 3H5RA 1RQ6A 2YRCA 4XU3A 3L1PA 3E19A 1YWPA 2R5AA 2KI7A 2V4JC 2EZKA 2KXCA 4XTWA 1VQ7A 2LC2A 5CVRA 3ML6A 1R23A 4B4CA 5GAGJ 3KEYA 1UB4A 5AIPA 2FQ4A 4JDSA 4DW6A 2YUQA 2RD1A 3GFJA 2RKHA 4ZGJB 1IV6A 2CT4A 2YRVA 3MD2A 3A1YA 3CUQC 3JTHA 3PUBA 3MO8A 5CKDA 1S5LC 4IHYA 1QWFA 1PYVA 3JTGA 3GFLA 4RB1A 3JREA 5LJ5f 3DV8A 2LQ8A 2XVCA 4M7DE 2Z9OA 1WYXA 1AZEA 2GA2A 3LA3A 4PFPA 3HHTB 1VQ8T 2Y2ZA 1RLQC 9ATCB 3IKVA 2P4TA 1MNEA 4DYQA 2RQTA 3WVDB 3MKLA 3DWLE 1E3HA 5FB2A 3OYHA 3ULQB 1OCCH 4PJJA 3F21A 3P5JA 4LDWA 2FG0A 3I5RA 5EEHA 3F22A 1H0MA 4ATOA 4OINF 2FQ3A 5FROA 1VQ9A 4PZJA 4A3JJ 2IGOA 2LDMA 3D0SA 2XG8D 5FLVA 1GCQA 2LBFA 2LSOA 3M0UA 4XSXF 1KU3A 3LSIA 3JCMh 1FWZA 4KULA 2RQQA 2H94A 2D6FA 1P4AA 4L59A 2C0TA 2E1CA 2VKEA 2XSJC 5K7HA 3GZ6A 3IP4B 3M9QA 3QJ6A 1R4MB 1HSTA 1R5HA 3H3ZA 4KIGA 2KRNA 3IQLA 5LGUA 4QW2A 3QU6A 5GMKl 2ZXIA 1BN5A 4RLQA 1GCQC 1PSEA 4QVZA 3ZCOA 1ETVA 4AWXB 4DBHA 4DBFA 3L2CA 4MQVA 3DBLB 1G2BA 2PQWA 3M07A 3EFSA 2EQMA 2BY3A 3OWTA 2DA1A 1W36D 2X1DA 3JCMe 4A6EA 3ZQHA 2PZ1A 2F2XA 4M73A 4QWQA 5HNHA 2V1NA 3GVAA 3CCSI 3LQQA 3VU3C 3RCOA 1FMVA 3PSIA 1J7KA 2L3RA 4FE7A 2DI3A 2DDBA 1O3TA 3CUQA 2J5OA 3LSHA 2IA1A 4HPQA 1J9IA 1M1EB 3A4CA 4EMSA 2R7WA 2EKOA 1R00A 5GANh 2OCEA 2DM1A 3FIFA 1MBHA 1VQ4I 5H6RA 2LK2A 3M54A 4J9IA 3JCMX 3DEEA 4J9BA 2ZXJA 1UB9A 4JK1X 4MEYF 4GY5A 3HPWA 2EYWA 4XTUA 3RNJA 4EEFG 2DA9A 3H9NA 3OW2P 3DU5A 1HXDA 1XN7A 1N6AA 1X3UA 2P4WA 4A69C 3CMAI 1USTA 2QM3A 4FM4B 1IGNA 2JRTA 2NOJB 4LUDA 4VUBA 1Q7YC 2CO5A 3KETA 1QVGA 1CF7A 3J7AY 2DK8A 2M4GA 2Y48A 3JAMK 2OZUA 3GO5A 2JA7J 3O8HA 2VOOA 2C06A 4JYKA 5LJ5e 3K6GA 3ZMUA 1Y6IA 3S16J 2HI3A 2X0LA 3HRSA 4L5GA 5DY9A 2NVUB 4A4HA 2H3EB 2KYBA 5D4RA 2DBMA 2DTRA 2ZPIB 1K4TA 1YRNB 1VQPA 1R58A 4IHVA 4D7NA 1G3YA 4KDPA 3FHNA 1WH5A 4J01A 4BJ5C 2LF8A 4IHXA 2HBWA 3PIPA 2A08A 3QUIA 2XDVA 2IS4A 2YX7A 4M4ZA 1FP1D 4JZ4A 2HOTA 1ZKGA 2E64A 1PDNC 1ODDA 2DA4A 2DXTA 1K8AU 1D1CA 4J7FA 1JKQC 2HAXA 4BQQA 4XLEA 3U1KA 5I11A 3OB9A 1TH7A 4KMFA 3OMYA 4CICA 2XRNA 1LE8B 5CQXA 3JAMR 3E97A 1VQ6Q 4EMGA 1G59A 4GGGA 1YJWQ 4LLGF 4HOBA 2CW7A 1MDMA 1Z7UA 4N4GA 2LCSA 4IZZA 2ZPHB 3GUDA 5HY6A 5A2QK 2M0MA 1BC7C 2RQRA 2YUSA 4J00A 5GAMd 1FBUA 1VNDA 1P7JA 3QYHB 4M72A 3CJRB 3UA7A 2R5ZB 5GANd 1VQ8A 1UHCA 4BAYA 4EGYA 2PMZA 2BZTA 5E3MA 1HSJA 1JTYA 3G3ZA 3NARA 3V8KA 4U7DA 1IC8A 3B73A 2ZFWA 2CZ7B 1S72Q 3HC7A 3A8OB 1VQMA 1GLNA 3FBIB 4YFXF 1KJWA 3OOUA 4BY6C 2BY0A 4HX7A 2HWVA 3MHXA 1TOVA 4Y92A 3OSFA 3DLAA 4WK8F 3NMZC 2QGFB 3GEZA 1A6QA 1PCXA 3ZMDA 4G7ZF 2RJCA 3KP3A 3F0CA 4LG3A 1W7PB 4X6AJ 2HGCA 2WADA 3M1CA 4XORA 3G71I 2X4WA 1DGWY 1VQPT 4TV7A 1ABQA 2HU9A 2DXCA 4F14A 2VASA 3OL3A 3K7AJ 5DTDA 4BBRJ 1HBXG 2GLOA 1NZ9A 2BZXA 2LFBA 1IW7F 2YR2A 2Y0MA 1YI2I 2IS6A 2PUOB 2QWWA 3JAMZ 1NYGA 3ZQCA 2F48A 3BTJA 4M3GA 2HYFA 3I3LA 2DD5A 2FA5A 4HNTA 4HG2A 3FISA 2XGEA 2M51A 3I71A 2OQGA 4IUVA 1KQ9A 2MBFA 4A6DA 2IRFG 1U3OA 3O6BB 2DA5A 5JHUA 1JE8A 1WWXA 2QQAA 4UVBA 2L3SA 3MJXA 3DEWA 3V7SA 4C92G 1YG2A 2R57A 4ANJA 2EFPA 2MLKA 4M74A 3F23A 4MZPA 1QA6A 1F1BB 4M3DA 1M5Q1 4RB2C 1ZHIA 2DYRH 2R4GA 4Y7NJ 1WIEA 3ER0A 5LFAA 5IHIA 2AHQA 3JRIA 5D5VB 2VE9A 2NWMA 2E3IA 2E60A 4R55A 4IJAA 2ZSHB 3JR9A 1MMSA 2C0OA 4J7IA 1SHGA 2QBYB 4OOIA 3CXCA 2HKXA 3LSGA 3R0JA 4F7UB 2DX1A 2K3YA 2EB7A 2X6XA 2Y9ZA 2L3QA 2LY9A 4LDYA 1I1JA 1RAGB 5KYNA 1ZREA 1YJWT 1PP7U 3CCJQ 1HW2A 3FZVA 3CCUI 5FLXR 1IHVA 2BY2A 2VXEA 2E7XA 2VC1A 4BS9A 2RHXA 1I5LA 2Z5UA 3PSFA 3LW5E 2EV5A 3GFIA 4XU2A 4A54A 1LEAA 3ZMZA 4AIJA 5E1WA 4ZH4F 1S72T 2F4MB 3B6CA 3RDIA 1LCKA 2WTEA 4L9JA 4ZZLA 1QGPA 1KHIA 4E7LA 1ZUKA 3WTVC 4AFUC 4C0DC 3G6EI 3HOVJ 3G1JA 1WRJA 3TDUC 5B1AH 3COAC 2UXXA 3T8TA 4EGZA 4MMLA 5J3BA 2RPNA 1G8XA 4PNOA 2KT0A 3VB2A 5IT3A 1LKXA 2CP5A 4ELZC 4RAYA 4QLCU 3G73A 4ZGEB 3CCJA 3CCRQ 1VZ0A 1DPUA 2DK3A 4XMYA 3NTIA 3KEOA 3MKYB 2XUBA 1MMGA 1YNZA 1I1SA 4XN0A 2XDDA 4BQAA 1AWXA 1IRZA 3NPFA 2A6TA 3D5RC 5IH2A 2GWRA 5F0CA 4FSSA 1J5YA 1U8RA 2EYZA 3PT9A 1YX5A 1U0JA 3SXYA 5GMKm 1WJCA 2ADUA 5BPDA 3PL8A 1MSFC 3S17J 2A0FB 3MPUB 2E71A 2M4KA 1QO0D 1QHGA 2CQ7A 3TDZC 3F8NA 1ZRCA 1QVFS 3JW4A 2IG0A 5CKTA 4CZCA 1ON2A 1W5CC 2ZJ2A 2P0TA 1VQ9I 1FSEA 2K7LA 1IUYA 2CP0A 2E10A 4J83A 3RMQA 4XN3A 4AUXA 1M3BA 3E6CC 4PJOC 3BCAA 1ARKA 2MK5A 2ED0A 2Q2EA 2A3SA 2ECZA 4XU1A 3TL4X 2CUJA 3ASNH 3U2RA 1I4K1 3DLMA 2QAZA 3CLOA 3RDVA 4PJOB 2PJRA 5IXFA 1TXQA 1BJAA 3S14J 1S29A 5A2QR 1WHKA 3EUHA 1ETWA 2JPBA 4PJ0C 3SFZA 1HOMA 2UZKA 3I55T 4AFZC 2EV6A 3G1LA 1N25A 2DO7A 2LYCA 3C3WA
chains in the Genus database with same CATH topology
2EQUA 3EFRA 1Y7XA 4IUUA 1WI9A 2QXFA 3JCMc 1PP8F 2RB6A 2RM4A 4M78B 1IN8A 4C5HA 2PQ8A 1DPRA 4OIRF 1O3QA 4XTZA 3SWNC 1XSXA 4JUVA 1S7OA 3EQLF 5A0DA 3VKIA 4O6JA 4IURA 4Z02A 1N9SA 3JCMb 1XMKA 4CGZA 4OB1B 1MGTA 1L3LA 1ZGAA 5GAOn 1P4WA 1ULYA 4M78A 3EAEA 5CLSA 2RJDA