1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
molecule keywords mbtA operator DNA
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
4UXNA 4ZYDA 1R1TA 2J5OA 3WTXC 4ENMA 2Y0MA 4Q5SF 4HLYA 2V1DA 3F8MA 1ODDA 2IA2A 5EEHA 3REOA 1REPC 1U3EM 5HS8A 4CXFA 1RNLA 1LEAA 1ZLJA 1OKRA 4F7ZA 4L9TA 5BPDA 4ZZDA 1FBSA 4U0YA 2V9VA 2GWRA 3LAPA 5LRSA 3DQVC 4UVBA 1HXDA 3Q5FA 5DUIA 2QQ9A 2ZXJA 5DCMA 4OIOF 5E17F 1IN5A 2KJCA 2IW5A 4MTEA 3FHZA 2NNNA 1LDJA 1OR7A 4G7HF 3HOSA 2QENA 3LQQA 3TKYA 4KMUX 2K27A 3ABTA 1MGTA 4UNOA 2L54A 1T6SA 3VB2A 1PUEE 4KICA 2EFQA 1TW3A 4R1HA 2Z3YA 2EA4A 2VBYA 2O0YA 3DFGA 3WODF 1KU3A 3N4MA 3NEUA 1GVJA 5E8GA 2YPRA 4XBFA 5FFZA 3GUDA 1ZARA 2GXGA 2FNPA 4JQFA 4MQ9F 4A12A 1U8RA 3BY6A 3W6KB 4G9YA 3MZHA 1YFHA 3LA7A 2O3FA 4B8XA 4RB0A 3P7NA 2RN7A 2XAJA 1DP7P 1UB9A 4WX9A 3RI4A 5D5VB 5CJ9A 3OOPA 3QAHA 3MWMA 1Z91A 3U9GA 3WE2A 1MDMB 4I01A 4L9VA 5D4RA 2OD5A 5D5XB 1FP1D 4U0WA 4M9SA 6PAXA 1FNNA 2XUBA 1UFMA 3D5LA 5LHHA 3R0JA 2H3JA 4EMSA 1FC3A 3I54A 3FWEA 3G3ZA 1G4DA 3E5UA 5ICCA 4MEYF 1R00A 5IT9Z 3C1DA 4UUVA 5H6QA 4LD5A 5EEGA 3HRUA 2K02A 2GQQA 2Z33A 1ON1A 1Z1DA 1ZRCA 1IXCA 3KEOA 2FBIA 1U2WA 1O3QA 2ISYA 2FA5A 4UVCA 3CJNA 3K1MA 2Y48A 2FE3A 5DEQA 1BM9A 2D1HA 1ZH5A 2DPDA 2VONA 1KA8A 2EJRA 4A5MA 2XHKA 4O3MA 5AIQA 2KIMA 4N9HA 4MQVA 5E1WA 2K5LA 3N97A 3GXOA 3KETA 1P4WA 4Z2YA 3O6BB 1SD7A 3F8BA 4M74A 1YQAA 4YFNF 4P55A 4OINF 1MZBA 1PP7U 2QBYB 3J7AO 2A6EF 1TQPA 2BGCA 3FMRA 2O8XA 4EM2A 4ZYGA 5F1RA 4HX8A 2VN2A 1H9GA 4I7HA 2HTSA 1Z6TA 2QYOA 2UXXA 2XKPA 2UXNA 3GFLA 1O7LA 2JPBA 5D8LB 4LJZF 4EVIA 2PLYA 1S6LA 3GF2A 2ACJA 1W7PD 4WCGA 1KYZA 3I58A 4G6DA 3GVAA 3GLXA 5ICEA 2DQRA 2KRFA 3ZP5A 3LAJA 2JPCA 1RI7A 1QW1A 4I02A 4IHTA 4HV5A 1R1UA 2K5FA 2P5KA 5D5WB 4KIBA 1XCBA 5TJJA 1FY7A 3JTGA 4G6QA 1D3YA 4BXUA 4OOIA 3FXRA 2K4YA 5DYMA 2V6CA 2XRNA 3ZMSA 2DLLA 1U5TC 1FPQA 1MJAA 1IXSB 1G3YA 2QVOA 1J9IA 2K7LA 1K78A 2LDUA 4G7ZF 3MCZA 3V7RA 1ON2A 2V1XA 3IKVA 4I2OA 1BIBA 3QP5A 4OIQF 5HDGA 5FLXK 4FHTA 2PBIA 5E1ZB 3JAMK 4PGGA 1BI3A 3K1PA 2IA1A 3ZN1A 1QBJA 3DXJF 3T8TA 2LSOA 4MNUA 4I0BA 5CYVA 4UV8A 2R7DA 1LDDA 3FX3A 4ZYHA 1CGPA 3CTAA 5LHIA 4OMYA 1TNTA 1UCRA 3QPHA 4A0XA 3R61A 5J8CA 4WK8F 3KEQA 4L9NA 3WTTC 1SMTA 4AVPA 3GEZA 2FOKA 3IL2A 3EQLF 2EA2A 4PZJA 5HLHA 1G6NA 2HZTA 1WSUA 4YIFA 2ESHA 5CVVA 5BS6A 2MC3A 2E1NA 3BDDA 1MJBA 2PN6A 3FXQA 4RGSA 1H0MA 3K9TA 2EFOA 2XV4S 1TTYA 1WWXA 1XSDA 3E5XA 2P6TA 5FD6A 1D8JA 5K5QA 4EGZA 1FT9A 1OYIA 4DQ2A 3GZ6A 3FM3A 4IRHA 2P7CB 4R8HA 2P7VB 3ZPLA 1VTNC 2CO5A 2FXAA 3T5XA 4KMFA 2EV0A 2Y75A 1S7OA 5JFRA 4NHJA 4HV6A 3I59B 4NB5A 5D6FA 3E3VA 1BYMA 4OIPF 2DFIA 5E1XA 5AONA 1NHAA 1XDUA 1JE8A 4I09A 3KLOA 3WTVC 5ILSA 1HKSA 4MGRA 3DPTA 1TQMA 3RIRA 1R36A 1TW2A 5D4SA 4HX7A 2PFBA 1QVPA 5ICGA 1CF7A 4KFCA 3FMQA 2PQ8A 5HDNA 2DT5A 2L4AA 3R4KA 4QLCU 3DEUA 1IN4A 3JTHA 4LLGF 4CDGA 5ILUA 5CVRA 4RB3C 1XGMA 1BIAA 1B4AA 4LLNA 2DBBA 3L9FA 2BEOA 2F5CA 2LX9A 5JR3A 1P4AA 1FWZA 3GW2A 3HHGA 3JSPA 2EFWA 1BC8C 2YX4A 3IRRA 1B1BA 2A61A 5AIPA 1SAXA 2IPQX 4M72A 1OYYA 3ZMUA 2VOPA 5L3DA 2KJBA 3WGIA 1FLIA 3MZYA 1QGPA 2VOOA 2P5VA 1LEBA 3PQJA 2VC0A 1HSJA 2ZMEB 2ZO4A 3E6MA 5CVJA 2DU9A 4GYIA 4GCVA 1B9MA 2JZYA 1HQCA 2JT1A 4M6YA 3S2WA 3F8NA 2K4JA 1MJ9A 1HKTA 1L3LA 3V8KA 1IAWA 2HOEA 4IRGA 3E6DA 1XGNA 3RYRA 3M7GA 2GCXA 4NQWA 2MLKA 1U5TB 2XROA 3BPXA 1ULYA 2RKHA 2NS0A 1IXRC 5FGMA 1L0OC 3TO7A 2FBKA 2KKOA 4BH9A 1W7PB 3ABUA 2LNBA 1KYWA 3E6CC 2ADUA 3O2PE 3KP5A 5FLXZ 1OMIA 4U0VA 2BBYA 5BPIA 2JRTA 2A68F 4WWCA 2YU3A 2RNJA 1B59A 3CO7C 1IN8A 4AIJA 2IVMA 3ZMTA 3LA2A 3L7WA 3I53A 5ILVA 3U1DA 3M1EA 5DUKA 2NYXA 2MA3A 3JAMZ 1P6RA 2P8TA 1UHWA 2XAHA 2EFPA 3J80K 2A07F 2COMA 1MKMA 3WTSC 4ETSA 4MTDA 2HKOA 4WXCA 1AWCA 3EDPA 5LLQA 1QZZA 4S04A 3D0SA 3BJAA 2LKPA 4HF1A 3C18A 3QP6A 1KU2A 1DDNA 4LB6B 2O61A 1U5TA 4EV0A 3ZMDA 1YW8A 4FX4A 1MD0A 5A2QZ 4I98B 3PFIA 1XSVA 3KE2A 2L01A 5BOXA 3F8FA 5HLIA 4ZYEA 5HS7A 4KUMA 4JK1X 1S29A 4KN4X 4ESBA 4WXHA 1QZYA 3H92A 3WU1B 1JXSA 5LGUA 2DPUA 4N0BA 2XAQA 3U2RA 2STTA 1OYWA 3DP7A 1SFUA 4LLLA 5D8KB 1HSTA 2CGPA 4K2EA 2EWNA 4DNCA 3KP2A 4EJVA 2OA4A 3B73A 3HTUA 1BN5A 1V3FA 2X4HA 2EFNA 2Q2EA 1SD5A 2G7HA 2HR3A 2ZJ2A 4UV9A 1T2KA 2HDCA 1K79A 2GZWA 4P9FA 3F6VA 3C3WA 2F5DA 2FRHA 3M8FA 2ZNZA 3RPUA 1RUOA 3P9KA 2WWYA 5FB2A 3WU0A 2MH2A 3DKWA 5LEKA 3KP7A 4LMYA 3EYIA 2HS5A 1T38A 3KP3A 3RPQA 2LF8A 4Q47A 4A6EA 3I71A 4MEXF 3HSEA 5BMZA 2H6CA 4PDKA 3CUQC 4CYDA 2H09A 5L3BA 3KZYA 2UZKA 1T98A 4LG0A 1WKMA 3R6SA 3E19A 2BE5F 2GA2A 5JI6A 4UHTA 5CLSA 4OU0A 2O6GE 4OMZA 2HGCA 2DTRA 3P9CA 2A3SA 2R3SA 2HWVA 2XASA 5TRDA 4ZH4F 3B02A 1ZREA 5HS9A 3VEPA 1ZG1A 3KP6A 2AXLA 2JTVA 4Y17A 3QPTA 3WTYC 5K1YA 3C7JA 1XB4A 2B0LA 1KU7A 3I59A 5L3FA 5DCMB 1EH6A 3WTZA 3JW4A 4KIGA 1P92A 2V79A 1QPMA 4A5NA 1S3JA 4RGUA 4EJOA 4HOBA 3LSTA 3RJPA 1XDSA 3HRTA 2BYVE 1RIOH 1I5ZA 1FYKA 2EB7A 2HYGD 1HW1A 2E7WA 4IJAA 3GFMA 1XD7A 1J2XA 3CUQA 2M45A 2IRFG 1WRJA 2PMHA 3FMSA 3IHUA 3QU3A 1IF1A 4EJUA 1ZRFA 1IRFA 2Q0OA 2K5IA 3DV8A 1J0RA 2H27A 2OU2A 2RDPA 5DD8A 2ISZA 3F6OA 3GWZA 2A5YB 3GX4X 1W5TA 4IRIA 4RGXA 4LK1F 3I64A 1XN7A 4ENNA 3GFJA 1JHHA 1LVAA 1IN6A 2CFXA 5J8FA 1G3WA 2D2WA 4AIHA 3E97A 1SD4A 4HX4A 4HDUA 4OIRF 4EJTA 1ZN2A 4H0EA 2IJLA 3TDZC 1FYLA 1S8NA 4XSZF 1J7KA 4A6DA 1P4XA 3TGNA 1R22A 1S7AA 2K4BA 4HW0A 4I0AA 2QWWA 3R60A 2XAFA 1ZG3A 5LEJA 3WTWC 2G9WA 4A0YA 3HYIA 5LGNA 5IT3A 4QWQA 4GXOA 1GHCA 4IF4A 4XRFA 2ZNYA 1LQ1A 3TDUC 1GXPA 3TO9A 2HQNA 2HKXA 4BAYA 1ZRDA 3HOTA 2IP2A 4ZZLA 2Z9OA 1T0FA 1W5SA 1FBQA 2M1BA 3HRMA 4ON0A 3IKTA 3RYPA 5K5OA 2ETHA 2DAOA 5LRRA 1KU9A 1E2XA 2LF7A 2FSWA 4B09A 3F3XA 4HYEA 2XIGA 1RZ4A 2RV8A 1EV7A 2QM3A 3DPLC 1QO0D 4CZZA 2W57A 2IT0A 1F5TA 1EH7A 2ZMEA 2MLGA 2NNYA 3ZMVA 1HW5A 5HOOA 1XSXA 3L00A 4KIFA 1JGSA 4E70A 4L0ZB 1YO5C 3PQKA 1J5YA 3V7SA 1W7PA 3KP4A 3SZTA 4L0YB 3I0TA 1TLHB 1B6AA 2VBZA 3LA3A 1KGSA 1U78A 1SD6A 1LDKB 4HF0A 4YIIA 2Z99A 1EH8A 3BWGA 2M8EA 2VXZA 3GO5A 3ECOA 3WG9A 3J80Z 4UVAA 2OQRA 2IA0A 5BQTA 3J81K 3EETA 2EK5A 2A69F 4G94A 1R23A 1HW2A 4RB2C 3K2ZA 2STWA 2P6SA 3V8LA 2P5LC 3IC7A 2ZBKA 3Q9SA 1K7AA 1BI1A 4ESFA 4BHBA 2RGVA 3TOBA 4A0ZA 2RC4A 1LJ9A 4RS8A 2OZ6A 4KNYA 4LFUA 3COAC 1STZA 1FP2A 4M9XA 1YS7A 1FX7A 5J6XA 4EJWA 2EV5A 3VODA 3BOQA 3TOAA 1USTA 2HTJA 2GAUA 3KCCA 5IT9K 3LWFA 2D45A 4RAZA 4BQAA 2VT3A 3BP8A 3QOPA 4WXDA 4XLNF 1P2FA 2FU4A 3SXYA 5CVUA 5D5UB 1I6XA 2WTEA 5D6EA 2XVCA 3RDIA 5ED4A 1R58A 3ECHA 1OPCA 2L4MA 4M73A 5E8IA 4LB5A 1BBYA 1Y0UA 1I1SA 5KVRA 3O3KA 3IWZA 1YW7A 4HF2A 1XMAA 3SHFA 3M9AA 4GGGA 2OZUA 4P9UA 5ERIA 3RKXA 1LB2A 4ENJA 4LGWA 1I1GA 5E20A 1DUXC 1ZG5A 1RUNA 1UHMA 2CG4A 1C0WA 2PI0A 5F64A 2CWEA 2FBHA 2F5FA 3W6JB 3WE3A 4L9JA 2HYFA 3MEXA 5JVTA 2CQKA 3CUQB 5H6RA 2W25A 2FEZA 3E6BA 1TBXA 2DI3A 2OBPA 5L3GA 4LG0B 3T1BA 5DCFA 3BPVA 2VE9A 3HIFA 4AIKA 3R0AA 2GA1A 3QRFF 1K78B 2PG4A 3IWFA 4KT5C 1G3TA 3G73A 4U7DA 2FNAA 2ELHA 5JHUA 1BI2A 1FSEA 2PMUA 4MHGA 1O57A 3P9IA 4P96A 1YW9A 3SQNA 4D0PA 4Q4ZF 2VE8A 1F4KA 1A04A 3CUOA 2W84A 4KYWA 5CVIA 2MH9A 1I27A 2VC1A 2DW4A 4M9ZA 4HQEA 1YS6A 3WGGA 5FO5A 3HUGA 5LBQA 1FSHA 4JBAA 4Y13A 1BC7C 4O5VA 4ENKA 1F9NA 3WTUC 3H3UA 4EQQA 3H3ZA 2DO7A 3BJOA 1FYMA 1JHFA 3F8CA 1R1VA 4BHCA 4XSXF 1XGOA 1TNSA 4R79A 1IZ1A 2BV6A 1DPRA 1Z6RA 2FQ3A 4YFKF 1K6OA 2E7XA 3LQRA 1Z7UA 1QQIA 1H9TA 3ML6A 2ZCWA 5DV5A 1CF7B 1V4RA 2F5EA 3J81Z 1YIOA 1D8KA 3E5QA 2AS5F 2WC2A 4CICA 1ZGAA 1G3SA 2QLZA 2HFHA 1DPUA 5LGTA 2XGXA 2D1VA 4WF2A 2M5WA 4G8XA 2HQRA 3BZ6A 2OAZA 2H6BA 4ASNA 3HTSB 4Q48A 2M30A 2CW0F 3CLOA 4KN7X 2JSCA 2MD5A 2QZ8A 1ZLKA 2C6YA 2Z5UA 4FX0A 1Z05A 1GXQA 4PCQA 1SFEA 2RQPA 4HA8A 4HBLA 1TQIA 3JSOA 1SMYF 4S05A 1KQ9A 3AAFA 1O3TA 1IRGA 4IHSA 3HSFA 2W85A 1U6GA 4RAYA 4P5OA 2KIUA 2W24A 4EM1A 5FD5A 3RKYA 2EV6A 3ERED 1J59A 4AWXB 2GIVA 2K86A 2J5PA 4HQMA 3V4GA 3EUHA 5DD4A 4RGRA 3DF8A 3SZPA 5HDKA 3ZN0A 1YG2A 2QQBA 4G7OF 3F23A 2FMYA 3M8EA 3FXUA 1W4MA 2G7UA 2VBXA 3GZ5A 5ICFA 4Y15A 1MDMA 2ZKZA 3ROUA 3ELKA 4XLPF 4ESJA 4GYGA 3F72A 5A2QK 1FOKA 4PGHA 3RTRA 2P4WA 2A6HF 5L3CA 1FBUA 5H20A 2ESNA 1O7FA 3EYYA 3TQNA 3IRQA 3ZMZA 1BI0A 1PDNC 4M6XA 3VFZA 4IVNA 4CO8A 5E18F 3FM5A 4GO1A 3MFKA 2CSOA 1O3RA 4HAMA 2HEOA 3LFKA 4A2UA 2WV0A 1XMKA 4BYYA 3RKWA 2QBYA 1X3UA 2MBFA 1YYVA 5HVQC 3TO6A 5HLGA 5LHGA 4HLXA 3K0LA 2RVCA 2PJPA 3BROA 2YX7A 3V8JA 3ULQB 1ZHFA 3CDHA 4IXAA 2F2EA 3HHHA 3K1NA 4EGYA 2YR2A 2Q8KA 4IPAA 4BHPA 1R7JA 3QU6A 1XCVA 1SFXA 2NAZA 3ZQ7A 1E17A 1HKQA 2XAGA 2V1UA 2R7FA 4HDVA 5K5RA 3L2CA 4U7BA 4CGZA 1T39A 4KDPA 1WQ2A 2NRAC 3WGHA 1WI9A 3V7CA 5DDGA 3F22A 1FZPB 2FF4A 1B9NA 3Q9VA 3SFZA 4CHUA 2ZFWA 2M87A 4N9IA 3MAJA 3OV8A 3KFWX 3I4PA 3GYHX 2DK8A 2L3DA 4L5JA 2X0LA 3F21A 2XKOA 3HSRA 2VODA 3KZZA 3K69A 3I5UA 5FFXA 2OQGA 1HBXG 3FF5A 2GXBA 3MHXA 5L3EA 2VBWA 4L18B 1F1ZA 3NQOA 1XGSA 2PEXA 2TDXA 3GFIA 4O6JA 4L5IA 3CO6C 4HZFA 2QUFA 4RB1A 1PP8F 3BJ6A 1Q1HA 1ONVA 3VOEA 3MQ0A 5KK1A 1ZGJA 1IUYA 1BJAA 2H94A 2FMLA 1YTYA 1KQ0A 1ZYRF 3KLNA 2QQAA 5F6FA 1O3SA 2YSRA 4YG2F 3T8RA 2DK5A 4U88A 3L09A 2L02A 1USSA 3HRSA 2KIFA 3ISPA 1KQ8A 4BNCA 1D5VA 2O03A 2UWMA 1J75A 2E1CA 3NRVA 1IW7F 1AOYA 4M71A 1QNTA 4LK0F 1BOAA 1YLFA 1LNWA 4EM0B 4KA4A 2CYYA 3T0YA 2DQLA 4FT8A 4AD9A 2VT2A 3FZVA 1IN7A 1Z9CA 1ZAOA 4YFXF 1R5HA 1R5GA 4TV7A
chains in the Genus database with same CATH superfamily
4UXNA 2A37A 3BG6A 2DXTA 1V76A 1YRNB 3P8HA 4PNOA 4Y91A 3M56A 2ELJA 4ZYDA 1R1TA 4QIWN 5LJ5d 2J5OA 3WTXC 1IC8A 1ABOA 2A6TA 1X01A 3A8LB 3PNWC 4ENMA 1FOXA 2Y0MA 1JI8A 4UB8C 4Q5SF 2VKVA 1H88C 3LMMA 3CP2A 4HLYA 2V1DA 2L9RA 3ZXSA 4L5GA 4G6TB 3PUBA 3F8MA 4AM3A 1ZSZC 2CT3A 1ODDA 2ENMA 4J19A 2K57A 7AT1B 1M2VB 2IA2A 5EEHA 3Q0UA 3REOA 1QHGA 1REPC 1U3EM 4C8QF 4N4NB 5HS8A 4CXFA 4BB7A 3JRHA 1XS9A 1RNLA 4M78A 3A02A 3VSKA 2IG0A 2VGMA 4IURA 1ZKGA 4M77C 4OB0B 1WJDA 2MUNA 1LEAA 1ZX6A 2XDDA 2I5UA 4BUPA 1ZLJA 1OKRA 4DZPA 3OYDA 5KYNA 3CPFA 2VPRA 4XN3A 5FLXR 5GAOm 4F7ZA 5F27A 2MABA 2YUPA 2LLKA 4XTYA 4L9TA 2X9DA 4DGWB 4ZZDA 5BPDA 1FBSA 4TVRA 1XNIA 1H8AC 4U0YA 3FISA 3HC7A 1O4XA 2LH9A 2V9VA 1N5ZA 1ZUUA 1XG1A 1JKQC 4J9BA 2W82A 1S72T 4X1EA 2NUZA 2GWRA 3NTIA 3VRZA 3LAPA 5I11A 3NPFA 1GCQC 3TQ7P 4DYRA 2DA5A 4PFOA 2R7XA 1RKWA 5LRSA 3DQVC 1DGRM 3IH4A 1WJSA 2K2MA 3QWYA 3W2AA 1M9SA 4UVBA 1PKTA 2EZHA 1P7IA 1ZSZA 1HXDA 3LX7A 3Q5FA 5KE3A 2JMWA 5DUIA 3D7SB 2QQ9A 2HDDA 1ZSGA 1EIFA 2ZXJA 5DCMA 2CQNA 4OIOF 1IN5A 5E17F 4N0AC 3JB9I 4M78B 4N0AA 1PM3A 5M9OA 2KJCA 3AL0C 2CP5A 1TWGJ 3OYCA 2IW5A 4MTEA 1E0EA 3FHZA 2NNNA 2LD5A 3AT1B 3CC7A 2DK3A 2QTXA 3CCMT 2LRQA 1LDJA 1G2HA 1OR7A 4G7HF 3BG7A 2HPMA 2LR8A 2YU9J 3A8OB 3HOSA 4BY6B 4RG8A 2QENA 3LQQA 4AU7A 3TKYA 2X6WA 1NYFA 4KMUX 2K27A 1GLNA 2M9UA 2ROTA 3PNTA 1PSFA 3JRDA 2F69A 1BR4A 3ABTA 2KXCA 1YITI 1QVFA 1MGTA 1W4SA 3NFCA 2HZYA 3SEMA 4UNOA 5CKHA 4IOAF 2FQ4A 2L54A 2E5ZA 1T6SA 5CR2A 2XAUA 3CCLT 1AZEA 3BC8A 3HB9A 3VB2A 1PUEE 3EFRA 1ZUYA 4A4HA 4KICA 4OF1A 2EFQA 1TW3A 4Z6YA 1RRJA 4R1HA 3HL8A 4ATOA 2GIZA 2AO9A 2Z3YA 2EA4A 1VQ8Q 2VBYA 4QSHA 3UATA 2O0YA 5GANh 5GJWB 3CCJI 2HQXA 3DFGA 3WODF 5IP7J 1KU3A 1BL0A 4FW1A 3GOXA 3N4MA 1K73R 3NEUA 5B3SH 3L2WA 2W48A 2X3XD 5ECAA 1N8RC 2DIGA 5J4VA 1GVJA 2R7WA 5LD2C 5KCHA 2J06A 3OYNA 5E8GA 2YPRA 3OIQA 4E7ZA 3EG0A 3QXEB 4XBFA 5FFZA 1AZGB 4J9DA 3GUDA 2Y30A 1ZARA 2GXGA 1V55H 4W97A 3BG9A 4XAXB 5LJ5e 1I6HJ 4OMMA 3ZQCA 2FNPA 1BW5A 4JQFA 2R7QA 1MBJA 3MN2A 4MQ9F 1D0YA 2HEQA 3SYTA 4A12A 1U8RA 1QWFA 1FIAA 3BY6A 1A0NB 3W6KB 5IYCJ 1KFZA 4G9YA 3MZHA 1YFHA 4OB3B 3LA7A 4EMHA 2O3FA 3CCMQ 1NJIC 5FKLA 4B8XA 1RABB 1MHNA 4RB0A 3P7NA 2RN7A 2XAJA 1DP7P 2RNAA 1KC8U 3BFMA 3JAMR 3JRGA 3ZQFA 2WAFA 3FIWA 1I5LA 2DBKA 1F43A 1UB9A 3VYUB 2YDLA 1QVGP 3LFUA 1UAAA 2VQCA 2X1DA 5E3OA 2L3QA 3X20B 3C94A 2NOJB 4CSWA 4WX9A 3CCSA 4MLOA 3RI4A 2G6FX 5D5VB 3CC4Q 2MI6A 1VQMQ 5CJ9A 3OOPA 2ME0A 2EGEA 2RPNA 1N8RU 4I76A 2FZGB 3G4SA 1ERDA 1JEGA 3QAHA 3KXTA 3A2KA 2RNGA 3JCMV 3SJMA 3G6EQ 1VA7A 3ZQQA 2L0AA 3MWMA 3A8GB 1Z91A 3IH3A 3SZGA 3U9GA 2B7EA 3DBLB 3WE2A 2XPVA 1MDMB 4I01A 2HQEA 4EMKC 1DQUA 4L9VA 5D4RA 2OD5A 1IB8A 5D5XB 4M75C 1KHCA 4M75A 3KIOA 1FP1D 1WJBA 2CFOA 3EH2A 3FJPA 4U0WA 3VS2A 2FRWA 4C5IA 5F0CA 4N4OB 4M9SA 5GAEJ 6PAXA 1FNNA 2XUBA 1UFMA 1OU9A 2ZPHB 3LSJA 3D5LA 5LHHA 2YXYA 3R0JA 2H3JA 4EMSA 3VV0A 3IAM2 4A4FA 1WFXA 1FC3A 3ULRB 2BZXA 3UT1A 3X26B 3I54A 3FWEA 3G3ZA 1G4DA 3EUHC 1PG5B 2KT1A 1OLTA 3E5UA 4BEHA 5ICCA 4MEYF 4GRIA 5KCMA 1WJRA 1R00A 2FB7A 5IT9Z 1E6HA 3QHSA 3KX2A 4BY7J 2DJQA 2P4TA 3VJPA 3C1DA 2CUFA 4UUVA 3A98A 4XRMA 2ED1A 4HSRA 4M7AF 5H6QA 4LD5A 2COZA 2AXTC 2OTLI 1AWWA 2J6KA 1PD1A 4NL3A 5EEGA 4OGEA 1PC0A 3M54A 3G6EI 1PCXA 3HRUA 2XG8D 5KYUA 2K02A 1OZ3A 2MCNA 2GQQA 2Z33A 1X6GA 1ON1A 4XN0A 1X1PA 1Z1DA 1ZRCA 1IXCA 3KEOA 2FBIA 2LREA 1FJLA 2FUG2 2HNHA 2CYZB 5GAN3 3C4SA 2H3EB 1U2WA 1Z7LA 4BE0A 3M9QA 1O3QA 4EDUA 2O2OA 4XICA 2ISYA 2FA5A 2M0OA 4UVCA 2L7ZA 3JREA 3CJNA 4II2A 4QTRA 5IXBA 3PTAA 3K1MA 3JRBA 1D0XA 2Y48A 2FE3A 5DEQA 1BM9A 2D1HA 1ZH5A 3J80R 2JJ7A 3U21A 2DPDA 3A03A 3I56A 1HC8A 2VONA 3ASOH 2QYZA 1YJ9Q 1VQOT 2FD5A 2C0OA 1KA8A 2LBFB 3GBQA 2EJRA 2WAQA 4XTVA 1V5EA 4A5MA 2XHKA 4O3MA 4C8QA 2VXDA 5AIQA 1RL2A 2FPEA 2R0QC 2KIMA 3MVPA 4N9HA 4MQVA 5E1WA 1H3ZA 2K5LA 2AHJB 4ABZA 3N97A 3J81R 1JT6A 4IHVA 2NVXJ 2DOAA 1IZ6A 3GXOA 2KAFA 3BT9A 4B3AA 4B44A 3KETA 2HVSA 2DCEA 1P4WA 1F36A 3THKA 3DPUA 4Z2YA 2QXFA 3CBMA 2H1KA 5FLXE 3O6BB 1SD7A 4RTUA 3M3YJ 3X28B 3H5RA 5KNLA 1Y96B 1TWAJ 3F8BA 4M74A 1YQAA 1B72B 4C2TA 4YFNF 3OW2A 1AOJA 4P55A 4OINF 1MZBA 4B47A 1PP7U 1VQLQ 2OAWA 2P0QA 2I10A 1LUJB 2QBYB 4UY8I 2EQMA 3EGUA 4E47A 1VQOA 4M77D 3J7AO 2A6EF 3HKSA 2VI6A 3OS2A 1TQPA 2BGCA 3FMRA 4IQJA 5C6SA 3GP8A 3G71T 2O8XA 5FLVA 3CD6T 4EM2A 1GCQA 2OTJT 2HQ5A 4ZYGA 3NARA 5F1RA 2MWPA 4C92C 2PU9B 4C5HA 1WH5A 4HX8A 4J7IA 4ZGDB 2VN2A 4N4GA 1H9GA 3BR1A 4I7HA 2C0TA 2HTSA 2HXOA 1Z6TA 2X4XA 3QIIA 2F48A 2QSFX 3H9JA 3S2DJ 2QYOA 2RI3A 1OCZH 5EG0B 2UXXA 4FETA 2XKPA 4J9IA 5IT9R 4PSXA 4LOCA 1TWHJ 4FYWB 2UXNA 3GFLA 1O7LA 2JPBA 4M3EA 5D8LB 4LJZF 4EVIA 5B1AH 5EG0A 2PLYA 2RB6A 5FU7B 1S6LA 2ID6A 1XX5A 3GF2A 4JJCA 5FKNA 4U87A 1JKRC 2ACJA 1W7PD 4WCGA 1KYZA 3I58A 4BY1J 1JJ2A 2E2HJ 2LRDA 2RREA 5E3MA 1H89C 4IOCF 2LCSA 2LKSA 5IP6A 4G6DA 3HOZJ 4XLEA 3GLLA 3GLXA 3GVAA 1MBGA 2M7AA 2NOGA 5ICEA 4J5YA 2DQRA 2KRFA 2MG4A 1B07A 2EZIA 3Q0WA 2DILA 3ZP5A 1WVRA 4GLKA 3LAJA 2JPCA 3JB9G 1RI7A 1QW1A 2DEQA 2E70A 3TP0A 4I02A 4IHTA 4A3CJ 1NYGA 4F55A 4HV5A 1R1UA 3OYIA 2K5FA 3M0SA 4M7DA 1VQ7Q 2P5KA 5IOZA 2CUBA 4IO9F 1IGNA 1QQJA 2NWMA 4M78G 4JP0A 4NNJA 2MGQA 2EQKA 1OCOH 4BD3A 4KT6A 4KIBA 5D5WB 1S9HA 3MEUA 4RKUE 1VQ4I 2FRYA 1WIEA 1XCBA 2JUCA 2JS0A 1VQ9Q 5TJJA 1RAIB 1FY7A 1MW7A 2KHMA 4G6QA 3JTGA 1B8IA 4J9HA 3WU2C 2JK3A 5F0FA 1R0BG 4UUSA 1D3YA 3OYGA 4DW6A 4BXUA 3PGGA 2ATCB 4OOIA 2XDPA 3FXRA 1XC5A 2GOMA 2LYCA 4FISA 5DYMA 2V6CA 2DN0A 1JUMA 2K4YA 2V8JA 1A6QA 1Q82C 2XRNA 3MEAA 2E6NA 3CCST 3I56I 3ZMSA 2DLLA 1U5TC 2K79A 1FPQA 5LL6S 3S93A 3OMYA 4II1A 1VFCA 2F5TX 3DB3A 1U8BA 2KYMA 2O4XB 1MJAA 2P4RA 4LITA 2K85A 4J7FA 3L2RA 3DEWA 4JX4A 1Y1WJ 2Y90A 5FU7C 2VGNA 1IXSB 3KBGA 1G3YA 3OSVA 2QVOA 4OB1B 1J9IA 2K7LA 3KPHA 2JJ9A 1WXTA 3HTRA 4PJOB 1UFFA 1K78A 2ELKA 2LDUA 2DTOA 1ARKA 4ZYAA 2DFEA 4G7ZF 3MCZA 3V7RA 1JTYA 2AK5A 1RUWA 5A0GA 1ON2A 3H8ZA 4FT4A 1G5VA 1PUFB 2V1XA 3IKVA 5EGOA 4I2OA 1BIBA 2EYZA 5I21A 3QP5A 3TREA 4OIQF 2EBPA 4XRSA 5HDGA 3IV5A 4FHTA 1SVMA 5FLXK 2C0IA 4XU1A 2CQ7A 1LCKA 1WCMJ 2V1NA 5F0HA 2OCCH 2BZ8A 3KUFA 2PBIA 5HNFA 4A3LJ 5E1ZB 3JAMK 4YIRX 3L2UA 1XOVA 3K4KA 1R71A 1SFKA 4PGGA 1P9QC 1V1CA 1BI3A 5EJCA 3SFIA 2WAQN 3K1PA 2R92J 3E9GA 3VS7A 2IA1A 1MNEA 2DDBA 4EMKA 3ZN1A 1MIJA 2EJ9A 5IHNA 1QBJA 1UECA 3L2QA 2DYBA 3DXJF 2E4HA 3T8TA 2LSOA 1WGXA 4MNUA 3ABLH 4XMYA 1BJZA 5DY9A 4I0BA 3K2AA 3BE3A 5CYVA 1IHVA 3M57A 5FRMA 4UV8A 1YIJA 4M77F 1R49A 2R7DA 1AWXA 1LDDA 1WA7A 3FX3A 1ZHIA 2IIMA 4ZYHA 1CGPA 2W10A 2VKEA 1NJIR 1TT5B 3CTAA 1YNZA 3EGDA 5LHIA 4OMYA 1H3HA 1TNTA 2BZYA 1UCRA 1Y8QB 3QPHA 2L7MP 2DNUA 2JRMA 2O9SA 3CEYA 2JVHA 4A0XA 2LY2A 3R61A 4G12A 5J8CA 3CPWA 4WK8F 4JLIA 2BOLA 3KEQA 5C44J 4L9NA 1OJLA 3WTTC 2F2XA 2LDMA 1SMTA 3AHUA 4AVPA 3GEZA 4M75D 2QA4A 4FL6A 3HP9A 2FOKA 4DJAA 3JRZA 2W00A 2IGNA 4P1WA 3K4LA 3FDRA 3QPSA 3IL2A 5CKDA 3EQLF 1RAAB 3CC7T 2QF7A 1TS9A 2EA2A 4PZJA 4XU3A 4M7DC 3OA6A 3LL7A 3PL8A 1KQSP 4M7DD 1BU1A 2DOFA 2XPUA 2MW8A 1RESA 5HLHA 3SWNA 5GMKe 1BW6A 4AVZA 1G6NA 2HZTA 1WSUA 1YX5A 4YIFA 1WZOA 2DMOA 1QVUA 2EKOA 4OB2B 5GANd 2PMZN 1VZ0A 2DL8A 4BL0B 1KK7A 2ESHA 3J7YJ 5CVVA 5BS6A 2MC3A 3CD6I 2E1NA 2HQHA 3FK7A 1IUFA 1X1DA 1VI0A 5GTHC 4ORZA 1BOBA 1JJ2P 3K4BA 2QA4I 3BDDA 2ZPFB 1IV8A 1MJBA 4C3JJ 2PN6A 2KROA 4OAYA 3RKQA 3FXQA 4RGSA 4D9JA 2YLCA 1H0MA 4IHXA 4IHWA 3PJRA 3K9TA 2EFOA 4FW2A 2GTOA 2Z2SB 2XGDA 5GJVB 2E1OA 1YJNQ 1Y56A 2XV4S 1TTYA 1WWXA 1WI7A 5CCAA 4RMNA 2CP7A 1XSDA 3BG5A 1HD3A 3E5XA 3GNGA 1MBEA 2X3WD 2P6TA 4J6YA 1BR1A 5FD6A 2HXIA 1D8JA 5K5QA 4EGZA 3LYIA 1W36D 4ANJA 2AIRB 1FT9A 3M59A 1OYIA 1YHQA 3D5SC 3OYFA 2ABLA 1TZLA 4DQ2A 1QVFP 3AKZA 3C95A 3HFNA 1A6IA 3CESA 1SG5A 2BXZA 2GQIA 1DU0A 3GZ6A 3FM3A 4IRHA 1W0UA 2P7CB 2OJ2A 4R8HA 4AYBN 3A8MB 4FYYB 3X25B 4BI8B 1A36A 1GVDA 2P7VB 1WJAA 2F6CA 3W3CA 3ZPLA 1VTNC 3NHNA 2WB1A 2CO5A 2FXAA 4E7SA 4HSTA 2D5VA 4D7MA 2O31A 3T5XA 4UUTA 3OSGA 2HU9A 1UHFA 4KMFA 4X1VA 1FOWA 1WJCA 2EV0A 3DU6A 4LDUA 1MMNA 2Y75A 1S7OA 2NVYJ 5JFRA 2MVTA 4NHJA 4HV6A 3I59B 4NB5A 5D6FA 3BTJA 3MCAB 2COBA 1NEBA 5J26A 2ME6A 4V2SA 1SVLA 3E3VA 1BYMA 3UR3C 3O8GA 2A08A 2RI2A 1V29B 4OMOA 4OIPF 3VS6A 2DFIA 2WA0A 1OX9A 2CP6A 4MZTA 1WJ5A 5E1XA 1Y57A 2RD1A 3EHQA 4HKEA 1YITT 5AONA 3LSGA 1NHAA 1IDYA 1IO2A 4XNFA 2OPTA 5GAMj 3HPHA 3CXCS 3DKXA 3FHNA 1WPYA 1XDUA 1JE8A 3H9NA 3MKZA 4I09A 3KLOA 5FKMA 1NEGA 3JSCA 3PIOA 3WTVC 5ILSA 1HKSA 1AT1B 5LJ5j 4MGRA 3CCLA 5KYYB 2EGAA 4HCBA 3AL0B 1X1CA 4XKVA 1ZBXA 1RLQC 3S3NA 3RESA 3DPTA 1TQMA 3MMYB 2JSPA 3RIRA 4XQFA 3CCEA 3HSBA 4BJTA 1NZ9A 1R36A 1TW2A 5CQEA 2GNCA 3R6OA 5D4SA 3DB4A 4RTVA 4HX7A 2PFBA 1QVPA 5ICGA 1CF7A 3S1NJ 5J3LA 4KFCA 3FMQA 2DMTA 1ZGWA 2PQ8A 5HDNA 1C1AA 2DT5A 2YWWA 1R77A 1ENHA 4DBQA 3I55T 2CW8A 3GCMA 2L4AA 3CCMA 2VQLA 1V54H 4C5GA 2R4GA 3G1OA 3R4KA 4QLCU 5FLMJ 4HNVA 3JV3A 3HUGB 4YRVA 5D6XA 3DEUA 4RMOA 2DD5A 2DXCA 2DFFA 5M3MJ 1IN4A 2QCOA 3CCQI 3JTHA 2BXYA 4F91B 4LLGF 2BHYA 2E3HA 4CDGA 3F0CA 5ILUA 5CVRA 4RB3C 1XGMA 1BIAA 3W2WA 1B3QA 1N8RR 5J1UA 3TMOA 3PIPF 3U23A 5GP9A 3IUOA 3FEOA 2FL7A 4MDXA 1B4AA 2DA1A 2IBDA 4LLNA 2KVQG 4IUUA 2DJIA 2MIOA 4A3BJ 1YCYA 4JS5A 2L2OA 2DBBA 3ABMH 2E5NA 4KUIA 3ZCOA 4YTLA 3BQYA 3L9FA 2BEOA 1U1SA 2F5CA 2LX9A 5FWBA 1XMXA 5JR3A 3D1NI 2Y9YA 3QJ6A 5EC7A 1P4AA 4D8KA 4PJOG 1FWZA 3GW2A 2VASA 3L2VA 4M7AB 2JZ2A 2IAIA 3HHGA 3JSPA 2EFWA 2EINH 1K9MC 1MV0B 1YRNA 1BC8C 2DZ9A 1K61A 3QYEA 4LNPA 2YX4A 5D7UA 3IRRA 1ZQ1A 1VQ6A 3EUAA 2RMOA 1WYXA 3TSWA 1B1BA 2A61A 3K4NA 5AIPA 5E79C 2CH4W 1SAXA 2E19A 1V5FA 2IPQX 1BB9A 4Y92A 4M72A 4F7UF 2CW7A 1OYYA 3OWTA 2ZJQF 2XICA 1V5GA 3ZMUA 2VOPA 4QQ6A 4C3HJ 5L3DA 4PLLA 1K4US 1WHLA 2KJBA 4PKCC 3WGIA 1M90U 4C5EA 2KZVA 4BS9A 1X27A 1YBYA 1E3OC 1FLIA 3RPUD 1VIEA 4ZTJA 3MZYA 1QGPA 2VOOA 1AVZC 1Z3YA 2EH3A 2P5VA 2QQ8A 3M1CA 5BNGA 1VQOI 3S17J 1QVGA 1U5SA 1LEBA 3G71I 3PQJA 4A54A 5GAN8 4M78E 2VC0A 1HSJA 4M4ZA 1VQ4A 4YEJA 2ZMEB 3CMAI 1IRZA 2ZO4A 3E6MA 5CVJA 4LUEA 4C0FA 2ICWG 2DU9A 4FU6A 4GYIA 4GCVA 1B9MA 1YX3A 1Y71A 3PM1A 2JZYA 1YJWI 1ZK8A 4AIDA 1Q95G 3SDGA 1FMVA 1HQCA 2JT1A 4M6YA 3S2WA 2MZ4A 1S1NA 4L6V5 3F8NA 2DL3A 3QJYA 5FJ8J 3L2ZA 1HCRA 4MO7A 2QEXI 4BI3A 1Q7YU 2K4JA 1XQHA 2O01E 2DA3A 1MJ9A 1HKTA 1L3LA 1ZLMA 4WCIA 3V8KA 5J40A 3A01B 3TCJA 3OYHA 2KRHA 3HPGA 2KEAA 4XK8E 3OS0A 3LSRA 4LDWA 2DPPB 1D1AA 1IAWA 3MP1A 2EYQA 3ONQA 2EIKH 2HOEA 3DTEA 3E6DA 4IRGA 1VQKT 3H0HA 1UB4A 4XR6A 1XGNA 3JCMQ 2E2IJ 2NVUB 2BY1A 3RYRA 3M7GA 2GCXA 4NQWA 2MLKA 4MIMA 3GF5A 1U5TB 1VQMI 1IV6A 2CZ6B 2JA2A 4XL9A 4LN2A 1KD1R 3A1PA 2XROA 3BPXA 2JA8J 1ULYA 2RKHA 1OCRH 2R5ZB 1WPKA 2A7YA 2VJIA 2WSCE 4HPQA 3CMEQ 1N25A 2ZAEA 3LWHA 2HVQA 1I5OB 3HHTB 3QZ9B 2NS0A 1C6VX 1TSFA 3GTMJ 1IXRC 5FGMA 1L0OC 3FXJA 3TO7A 2HKNA 2FBKA 2DL5A 4KULA 2KKOA 5IXFA 3GTQJ 2CP3A 3SWNC 5CQGA 4BH9A 2X6YA 2E12A 1AA7A 1W7PB 3ABUA 2LNBA 1U3OA 1MMGA 3I35A 5CKTA 5KYWA 1KYWA 3E6CC 2ECBA 3M0PA 3S8PA 5DLOA 4M7DF 2ADUA 2DMQA 4IZZA 2DL4A 4E2FB 3O2PE 3KP5A 4YELA 4A69C 1SSHA 4OMNA 5FLXZ 2KI7A 1OMIA 4U0VA 2V8IA 4BDZA 3KFVA 3CF5F 4EEFG 2BBYA 2EJFA 2L3RA 5BPIA 4E7KA 3PVQA 3RERA 2JRTA 1QCFA 2LC4A 5IN1A 2A68F 4KGXB 4WWCA 2CZ0B 1KONA 3OS5A 1Y0MA 5LJ3g 2YU3A 2RNJA 3KZIC 1B59A 3RSNA 1GFDA 4B48A 3HZJA 3CO7C 2H8HA 1JXOA 2X4JA 3CCJQ 1N6AA 4NC7A 3EH1A 4F7UB 1IN8A 1VQ8I 4IEJA 4PJMA 4FE7A 4AIJA 2RHXA 2IVMA 1NLOC 1UELB 3ZMTA 1TC3C 3HOUJ 2RK2A 3ME9A 3LA2A 3BG3A 4J6WA 3WVDB 3L7WA 1JRIA 3I53A 4OAZA 5ILVA 1LPQA 3GTLJ 3U1DA 2XD0A 2D8HA 4Z89A 1PWTA 4DBFA 3M1EA 1YI2I 2PMZA 2LNHB 2P0PA 2ZCFB 1E3HA 5DUKA 2NYXA 2MA3A 3JRIA 1I07A 1NPPA 3BDLA 2K7AA 4LDVA 1YI2A 1MUZA 2JTMA 2XSJC 3JAMZ 3MJXA 1P6RA 3IAS2 4HEA2 1UGQB 4PJOF 2P8TA 5J1YA 3REBB 1VQ5Q 3HOWJ 1UHWA 2XAHA 3CCSI 1UJ8A 2PJRA 3H5AA 2J6OA 4OVAA 2EFPA 4J9EA 2HKQB 3MP8A 5CPRB 3J80K 2A07F 2COMA 2QQSA 1J09A 4Q5WA 4RTYA 1TL8A 1MKMA 2DMUA 3WTSC 3FKJA 4F52A 1RAGB 2V1QA 2B8AA 1T33A 4ETSA 4MTDA 3VYHB 2DO3A 4M7DE 3E2UA 2KIQA 1TG0A 3UF4A 4X34A 2K9QA 1WJFA 1I1JA 1AKHA 2ZXIA 2HKOA 4PJLA 4WXCA 2GFUA 1PUFA 3BTLA 4BY6C 1GV2A 3BR3A 2ZSIB 3EDPA 5LLQA 1AWCA 4BBSJ 4JJBA 1QZZA 4S04A 4CC2A 3D0SA 3BJAA 4BKXA 2EQJA 2QGFB 2LKPA 1EKEA 4HF1A 1UG1A 2HMAA 1IDZA 2LT1A 3BR0A 3C18A 4FCYA 1MSFC 3QP6A 4JDSA 2PVGB 5CKEA 2XGCA 2DTIA 2XKOC 1KU2A 2AQEA 4ZN1A 1EJ9A 1WH7A 3RZDJ 1DDNA 4LB6B 5KCOA 2RQRA 3GZNB 2IGOA 1U5TA 3LSKA 2K9LA 4EV0A 2O61A 3EFSA 4MZPA 4C0GA 2BUDA 2DRMA 1X3ZB 2XF6A 1YJWT 3UWNA 3E1SA 2DYRH 3ZMDA 1YW8A 2V9KA 2NUPA 3LGLA 1Y8RB 3VYSB 1LOJA 1SEMA 4XOTA 4FX4A 1MD0A 3P5JA 2ZGWA 4F7UA 5A2QZ 4PK4A 1YFNA 4I98B 1UGPB 3EFOA 3V42A 3PFIA 1CKAA 2WSEE 1S5LC 2YRCA 3J80E 2VJJA 2JQ7A 1G59A 3W2VA 1SRLA 1XSVA 1ZQ3P 4RAGA 2FO0A 4HVWA 3OSFA 4ZDPA 2X98A 5CKBA 2Y9ZA 5JHFA 3VS3A 4N4IA 3QSUA 4XK4A 3QDFA 3KE2A 1VOMA 3DKMA 2QKLB 3OR2C 2HBPA 3OYYA 1CQTA 2JS2A 2L01A 5BOXA 3F8FA 3LWIA 5HLIA 1MSEC 5IY5H 4Y52J 4ZYEA 5GMKm 4JJNK 5HS7A 2IGKA 4KUMA 3MZ8A 2VUMJ 2KQWA 4FT2A 4JK1X 1YITA 1S29A 1GDTA 1BKBA 2KRSA 2RN8A 4KN4X 1Q81C 2DE0X 4ZJZA 1VQ6I 2O4XA 4ESBA 2BW3A 4WXHA 3OYAA 2RQWA 4QT7A 5D6YA 1QZYA 4F17A 2QEXA 2HL3A 2XF7A 1K0SA 1SVOA 3H92A 3WU1B 1JXSA 5LGUA 2CGHA 2DPUA 2PUKB 4N0BA 2JTFA 1XTDA 2KL4A 1YJWA 4DA4A 2XAQA 2Y31A 3BLYA 3U2RA 5GMKj 2STTA 2K9MA 3G2BA 3OL4A 2DA2A 1OYWA 2DT6A 3DP7A 4F93B 1MH3A 5LJ5f 4IIOA 2C06A 1SFUA 2E65A 4LLLA 3OYKA 2RA2A 1QHHD 3G71A 5A2QE 3RZOJ 1OI1A 2VJ5A 1EZZB 5D8KB 3CBOA 3H6ZA 1HSTA 3TP3A 2F4IA 2CGPA 4K2EA 2EWNA 4BGDA 4M77E 4DNCA 3KP2A 3GMEA 4EJVA 3N05A 2NUTA 2OA4A 2DERA 2KYBA 2K9NA 3B73A 5DS9A 4EMKB 1Q1VA 1WX6A 2A28A 3HTUA 2R58A 1BN5A 4C8QB 5A0DA 3JCMW 1V3FA 2KGTA 4Y3OA 2X4HA 2EFNA 2Q2EA 1SD5A 2G7HA 2HR3A 4M3DA 3F70A 1EFNA 2ZJ2A 1X6OA 4UV9A 3ERMA 3C0CA 2JN0A 1TT0A 1QLYA 1OOTA 3EG1A 1ABQA 2CZ7B 1T2KA 1VQ6T 4Z8AA 3META 4RTZA 2E35A 5TISC 2VLAA 2RHUA 2HDCA 2E71A 1K79A 1QKXA 1X75C 2GZWA 2PX9A 4P9FA 4M6VA 3F6VA 5GANf 3C3WA 4Z02A 1YI2T 2K9GA 2F5DA 4LE9A 2FRHA 2HDAA 2LP5A 3CCRT 3M8FA 5GAOq 2H1LA 2ZNZA 4BE2A 4FIBA 3QG1A 3RPUA 2DVJA 2PVOB 3CC4A 1RUOA 2X1EA 1RAEB 1D5YA 2DJZA 2XMFA 2D0QB 3G4SQ 4NS5A 3P9KA 2L3SA 4LG3A 2WWYA 1Q82U 5FB2A 1A35A 1M3AA 2NUTB 1O75A 3WU0A 2YLBA 2IS1A 4PLIA 3G6EA 2MH2A 3DKWA 5LEKA 3KP7A 4LMYA 4D7NA 3PFYA 2MAMA 4M78D 3PIOF 3EYIA 1I50J 2HS5A 3K10A 3LSPA 1CKBA 2XHCA 1T38A 3PO2J 3TEEA 5GAMd 3JCUC 3KP3A 1GL5A 1KZHA 3RPQA 2LF8A 2BY2A 3JCMe 2B63J 2L89A 2F2WA 4Q47A 2NUPB 4B9WA 3JB9F 1H92A 4A6EA 4LUDA 1PNJA 3I71A 1KHIA 2CSQA 3QZ5B 3TW6A 4MMLA 2DYSH 4UB6C 1POGA 3MKYB 4MEXF 1AWJA 1T0HA 2COWA 3HSEA 5BMZA 3MKLA 1X58A 3QODA 5JLXA 3HDDA 2H6CA 1HOMA 4PDKA 4AFZC 3CPWP 3CUQC 4CYDA 5F08A 4V19K 1K9AA 1M5Q1 1WHJA 3CC2T 2H09A 5L3BA 2VWFA 2XB5A 2L2PA 3ZQGA 1HLVA 1M90C 3KZYA 2UZKA 1T98A 1ZSZB 3SDBA 4LG0A 1WKMA 3VKIA 2IVWA 3LSHA 3DBHB 3R6SA 2ECCA 4DZJA 3OYEA 3E19A 1OCCH 3FJ5A 1VQKA 1GT0C 2BE5F 5EZHA 3H3VK 2GA2A 5JI6A 2R7ZJ 4UHTA 3A4CA 1K1ZA 5CLSA 4OU0A 4C30A 4GDFA 2R57A 1R5ID 2O6GE 3HM5A 4OMZA 4FE4A 1WXUA 2HGCA 1QA6A 2CT4A 2OC6A 4KJZA 2HNIA 4JUVA 4Y33A 4DBRA 3CCEI 2V4JC 3WHBA 2DTRA 3P9CA 2A3SA 5GPAA 1QPIA 1T0FC 1R9TJ 2E6ZA 4M7DB 3M07A 2G0EA 1VQKQ 1JO8A 3C2BA 4FYVB 2R3SA 4DEXA 1M30A 2BTTA 2PNIA 2QAZA 2HWVA 2LOOA 2XASA 5TRDA 1M2VA 2ECZA 4ZH4F 2K9SA 3H0DA 2J7IA 2L7KA 5LFAA 3B02A 5GAOr 3M8JA 2NXNB 2LFBA 3CCUI 5HS9A 3VEPA 1ZREA 1ZG1A 3KP6A 3QUIA 2AXLA 3HGGA 2JTVA 3AG1H 4Y17A 3B6AA 4XORA 3ZQLA 3QPTA 2R7RA 1HSQA 3WTYC 1U1TA 4PFZA 5K1YA 3CD6A 3C7JA 1XB4A 2Q1ZB 2B0LA 1M27C 4J9GA 1KU7A 4C92E 1R4MB 3I59A 1QVFS 5L3FA 5DCMB 2DMNA 1EH6A 2DF6A 1VQ8A 3WTZA 3JW4A 3SB2A 3FKIJ 3VUZA 1VQPI 3VYGA 4KIGA 1P92A 2V79A 1Z77A 2HI3A 3K4JA 3SWNB 1YHQT 2IS4A 3PIPA 1VYUA 2O9VA 1QPMA 5J1RA 2HOTA 4A5NA 2BE7D 4IUQA 1S3JA 2EYWA 5I2MA 2DDAA 1HDDC 2RQUA 4QVCA 5CO7A 4PJJA 4RGUA 1SAUA 1UG2A 2TCTA 3ABKH 3TBIA 2XDVA 2KBTA 1KC8R 5I22A 4EJOA 1MBHA 4HOBA 2LZ6B 3LSTA 3RJPA 4LD9K 4A3DJ 4CA0A 3BQZA 2Y4YA 2E2JJ 1XDSA 3J7AY 3QYFA 3KYLA 3QKJA 3HRTA 3JB9D 2BYVE 2X35A 3TSZA 4M77A 1RIOH 5GANg 1I5ZA 2KDSA 3CCVQ 1FYKA 2EB7A 2JW4A 1Z3XA 2HYGD 1HW1A 2E7WA 2XRLA 5GAHJ 4IJAA 4M78F 4AG2C 4NC8A 4E7HA 4HNTA 3TU4K 1W0TA 3GFMA 2WBMA 4ZDLA 1SHFA 1XD7A 2KLOA 1J2XA 1D0ZA 5K7HA 1OU8A 2DJNA 3QO3A 1VQPA 1QWEA 4F92B 4D5CA 2X51A 3IH2A 5F04A 3CMEA 2VKDA 1WFWA 2QEXT 5E3NA 1PYVA 2VKNA 2GM4A 2LCLA 3CUQA 2A05A 2M45A 5IP9J 3OQ5A 4HT8A 2IRFG 3CLQA 2XGEA 1UGRB 1ZR2A 2LTOA 1WRJA 2VQGA 1VQ5I 3UA7A 2PMHA 2YHTA 3FMSA 3IHUA 2D0NA 3QDRB 5DLQE 4C92G 3QU3A 1IF1A 2R7VA 4EJUA 4DYQA 1IRFA 1ZRFA 1QP2A 2N8GA 2WSFE 2Q0OA 2K5IA 3DV8A 2YT6A 1VQ9T 4XU0A 4RTWA 2JMCA 1J0RA 2QK0A 1OV3A 1EX4A 2DA7A 2H27A 1N27A 3CXCP 2HDWA 3FRNA 2L7FP 4PJOA 2OU2A 2RDPA 4ZGJB 3GTJJ 4J83A 4ME7A 1YN8A 5DD8A 2ISZA 4CRIA 3F6OA 2JXBA 2VXEA 3GWZA 1KQ2A 4CUGA 2VYTA 2A5YB 4K11A 5LJ3d 3JCMb 2UUZA 1S72I 2HVRA 1TH7A 3GX4X 1YIJI 3Q3SA 1QP3A 1W5TA 3UA6A 4J9FA 4IRIA 4RGXA 3K4MA 1ZR4A 1UEBA 4LK1F 1VQPT 3I64A 3TL4X 1XN7A 4ENNA 3CCJA 3GFJA 4C9YA 2L9SA 1JHHA 2M4GA 1SKUB 1LVAA 2EYXA 2M51A 1IN6A 5B66C 1RR8C 2CFXA 4XOPA 1G3WA 2D2WA 5J8FA 2BZTA 4AIHA 3E97A 2ZC2A 4FTHA 1TXQA 1SD4A 2JMAA 4HX4A 1WDXA 4HDUA 4OIRF 4EJTA 4MDWA 2CMPA 1ZN2A 1T8IA 1LVKA 4H0EA 1YWPA 1Q7YR 1VQ9A 2IJLA 2X85A 3TDZC 4GBQA 1FYLA 2KY9A 4NL2A 5IT9E 1S8NA 1U9OA 4NUBA 3C12A 2MK5A 5KYUB 4XSZF 1KD1C 1J7KA 4A6DA 1AWOA 1A31A 3S15J 1JKOC 5D6WA 1P4XA 2WV1A 4BBRJ 1UJ0A 1Y07A 4DOVA 4JX5A 2F2VA 2JUFA 2KK4A 4LXCA 2CV0A 2EVRA 4XIDA 3TGNA 1R22A 1JJ8C 1S7AA 2RHYA 2K4BA 4ZNXA 4HW0A 2IS2A 4I0AA 1SHGA 3ZBDA 4CCKA 4KH0B 2QWWA 2OV7A 3R60A 2XAFA 1ZG3A 5LEJA 1X4OA 3CC7I 3WTWC 2G9WA 4BE1A 2VQHA 4A0YA 3HYIA 2A3LA 5LGNA 2NVQJ 1W1FA 3QYHB 3OYJA 1X2MA 5IT3A 2D9TA 2DT7B 5HNHA 4QWQA 4GXOA 5HY6A 4A3EJ 4J8OA 1Q81R 3BZKA 2KE9A 2P84A 1GHCA 4HT9A 2QSHX 4IF4A 2RM4A 5KYWB 4M7DG 4ELYC 4XRFA 2ZNYA 1LQ1A 2LQ8A 1W1WE 3TDUC 4E6KG 2M35A 1C0MA 1W70A 2E5KA 2QI2A 2ZMEC 1VQNQ 1GXPA 3TO9A 1Z0XA 1R0CB 1SSFA 2LNVA 4XLCA 3X24B 1S7EA 2HQNA 2GOXB 2HKXA 2ZPBB 2HZDA 1VF9A 4BAYA 2SEMA 4C8QD 5HK0A 2M7BA 5M3FJ 3RUXA 1ZRDA 3HOTA 1A5JA 4HVVA 2IP2A 1YJNA 2NS7A 4NBQA 4ZZLA 3LGFA 4KBMB 2Z9OA 1VQLT 2R5AA 1T0FA 1W5SA 1FBQA 3CZ6A 3IP4B 1VNDA 2EPFA 2M1BA 2ZB9A 4QPQA 4IHYA 3HRMA 2DXUA 3EUKL 4ON0A 3IKTA 3RYPA 2QQRA 5K5OA 4AG1C 2EZKA 2HSPA 1ACIA 4OMPA 1WLPB 2ETHA 2I2LA 1HJDA 3CMAQ 2DAOA 2K3YA 3VYTB 5LRRA 2NLUA 3CCLI 2DFHA 3CJRB 1KU9A 3GTOJ 3E0JB 1VQOQ 5IPAA 2I8DA 3OS1A 3UKGA 1E2XA 2RHIA 1QVGS 3DU5A 1M1EB 1JTXA 2LF7A 4A93J 2HL5C 3OW2P 4GY5A 4AMCA 2FSWA 4B09A 2VXFA 3F3XA 3PVLA 2D8JA 2OTLQ 1WHUA 2LCCA 4HYEA 2XIGA 3PNYA 3J7ZI 4BI4A 1RZ4A 2RV8A 1T3SA 1EV7A 2QM3A 3DPLC 1F1BB 3RMSA 3JRFA 1MV3A 1YJ9T 3R6NA 1QO0D 1RR7A 1K8AU 4ZC3A 5KAIC 2W57A 4CZZA 4CCOA 2XSDC 2IT0A 4HNUA 2X4WA 3K70C 1F5TA 1EH7A 2WY7Q 2ZMEA 4F14A 3LOCA 3S2HJ 2MLGA 2NNYA 1VQ5A 3ZMVA 5GAN6 1MBKA 1HW5A 2F4OB 5HOOA 3LH0A 1XSXA 3L00A 3BCBA 4M77G 4KIFA 1JGSA 3AFHA 5GPCA 4E70A 4L0ZB 1OCPA 4IQ4A 1YO5C 4A4EA 3PQKA 2ED0A 4HXJA 1R8OB 3MO8A 1J5YA 3V7SA 1PRMC 1Q86C 2M02A 1W7PA 5IHKA 1KD1U 3KP4A 3OR1C 3SZTA 3UNGC 2O7OA 3HOVJ 1ZTRA 3D5RC 4L0YB 3OYLA 1RQ6A 3H1CA 1OPKA 5FU6B 3I0TA 1TLHB 3VS4A 3G4ST 1Q81U 1X2QA 1QMCA 3H35A 5LJ3h 3CCLQ 1RAHB 3TW7A 3CC2A 1GCPA 5B1BH 1QVTA 3A5ZB 1VQ8T 4OMLA 1B6AA 3M4OJ 3JCMX 2YRDA 3JB9J 2CH4A 2VBZA 3LA3A 3SDZA 4R55A 4X9DA 2K5CA 1FXXA 2DODA 3INZA 2KRMA 2R5MA 1KGSA 1U78A 2Y0SN 3H9QA 1JJ6C 3WXMB 1SD6A 1LDKB 4HF0A 2VV5A 2L9NA 3MKWB 5KE2A 2LT4A 3MD2A 4RDUA 3TEDA 4BJ6C 5L8RE 3M0QA 4YIIA 2Z99A 3DTIA 1EH8A 3BWGA 4IL6C 4I6ZA 2SRCA 4C0ZA 3CC2Q 4IUPA 5FKKA 1K76A 2M8EA 2LBFA 2XPWA 1SRMA 1T08B 2VXZA 3QQAA 2EKHA 3FK6A 1VQNI 3GO5A 1TU0B 3ECOA 3WG9A 3J80Z 2QGUA 4UVAA 2OQRA 2IXSA 3P8BB 3HXLA 5K7ZA 3MP6A 2IA0A 5BQTA 2FPFA 1QCNA 5GAGJ 3J81K 1K6YA 2I0NA 2ZFUA 2PQWA 3VRYA 3ZL7C 4Y7NJ 2LJ1A 2KT8A 2MPXC 3L42A 2DIQA 4PJ0C 3REAB 4C0DC 3PSIA 1GXIE 1KIKA 3UDCA 4J9CA 3CCUA 2LJ0A 2CUEA 3EETA 2OF7A 2AZSA 1N77A 1NG7A 2EK5A 4DEYA 2A69F 1X2KA 2XB0X 4G94A 1R23A 1HW2A 2LJ3A 3S6WA 3J7AW 4M7AD 2BY3A 4RB2C 3K2ZA 1LFBA 1QCOA 2LX7A 3CJTB 5E3LA 4JX6A 3CP8A 2STWA 2LQNA 2P6SA 1ZUKA 2X1CA 1AKHB 5FU6C 3V8LA 2P5LC 3CCUQ 2DYIA 2RQQA 3IC7A 2ID3A 5M5YJ 1Y7XA 3CQTA 1Y1VJ 2ZBKA 3Q9SA 1WQ7A 4EATA 1K7AA 5CQXA 1BI1A 4DOZA 4ESFA 4BHBA 2GXAA 2FVUA 5FKOA 1VQKI 3WG7H 2RGVA 2JA7J 3K70D 5IOYA 3TOBA 4A0ZA 2DL7A 4X6AJ 2RC4A 2MYSA 2FZKB 1LJ9A 1U0JA 4RS8A 4OMQA 3DKYA 4JYKA 2OZ6A 4KNYA 3CCEQ 3PO3J 4E7IA 4LDYA 3CCVA 3ZGKA 4LFUA 3GTPJ 1YHQQ 2MMPA 5F1JA 2K3XA 3M0UA 3COAC 1YIJQ 1STZA 2AHQA 1YCSB 2QDYB 2QG9B 1S72Q 1FP2A 4CC4B 2ZZDA 3S3OA 2M0MA 3LLRA 2OUMA 3QBYA 1Q86R 4M9XA 4XLHA 1YS7A 1FX7A 2JA6J 5J6XA 1PSEA 3PFSA 4PFPA 4EJWA 1SF9A 2EV5A 3VODA 2DD4A 2G3RA 1LKXA 3BOQA 3TOAA 4LIUA 1USTA 2HTJA 4AUXA 2OTJA 2LMDA 2GAUA 3KCCA 5IT9K 3J81E 4C0DB 3LWFA 2D45A 4RCBA 4RAZA 4AFUC 5EZGA 2EAYA 1S72A 4BQAA 1Y6IA 2VT3A 3BP8A 3DLMA 3OBYA 4A4KA 3QOPA 4WXDA 3CMMA 4XLNF 3S14J 1P2FA 1W36C 4RLQA 1O9SA 1JT0A 1B34A 2CQXA 1Y96A 4XTWA 1K9MR 1LJOA 2OTJQ 2FU4A 4CZCA 1X3WB 3VPRA 3I5SA 3SXYA 4C8QG 5CVUA 5D5UB 1I6XA 3HOYJ 5GAN7 3FB9A 2KMTA 1TUCA 3G4SI 4P5NA 4OGCA 1M1KR 2XF5A 3MKDA 2WTEA 5D6EA 2XVCA 3RDIA 5ED4A 2OI3A 4C2UA 2OX7A 1JB0E 1OCTC 1R58A 1Z67A 3LNQA 3X2QH 4V2FA 3ECHA 5EG2A 2Q2EB 1LFPA 1OPCA 2L4MA 4M73A 5E8IA 4LB5A 1QU3A 1TWBA 1BBYA 1Y0UA 1I1SA 2BW3B 1KC8C 3S16J 5KVRA 1OULA 1K4TA 1LPLA 3BR2A 5H2FC 1KSWA 1I3AA 1YJNT 3O3KA 1NJIU 3KEYA 3IWZA 1Q82R 3ZQIA 1ETXA 3VWBA 4W1UA 1YW7A 4HF2A 1VQPQ 4J00A 1Z9ZA 4CI0C 1IGUA 4NDLA 2F5VA 1XMAA 1X6BA 2QKMB 3SHFA 3DBRB 3VDXA 4M75G 3SHWA 4QQDA 4RAFA 5AYFA 3M9AA 4GGGA 4QW2A 2OZUA 1HYOA 2EIJH 2JTEA 1UMQA 5ERIA 4P9UA 2PZ1A 3RKXA 1LB2A 2E60A 3MPUB 3S32A 4ENJA 2H8WA 4J01A 5LJ5g 1MH4A 2GGRA 2KDOA 4LGWA 4D1QA 1I1GA 5E20A 1DUXC 1ZG5A 1RUNA 1N78A 1DU6A 1UHMA 2DXBA 2R7OA 2VB6A 5JLWA 2CDTA 2CG4A 1C0WA 2PI0A 1FMKA 5EYRA 2JNGA 3CCRQ 5F64A 2CWEA 3FXLA 2CKKA 1MBFA 2FBHA 2F5FA 1VQMT 1BA5A 1K8AC 1RI9A 3W6JB 3WE3A 2FPDA 4L9JA 5GAN4 1UG0A 2HYFA 2L0KA 3CQZJ 3URGA 3CCRI 2P0TA 2JVGA 2AKKA 3MEXA 5JVTA 4Y4RA 2BVLA 2CQKA 3CUQB 5H6RA 1UUEA 2DLPA 3M0TA 2W25A 3CCET 1VQ6Q 2FEZA 5EDNA 1IO6A 3LSIA 3VS1A 2QA4T 4CCMA 3CCYA 1VQNT 3GBGA 3HOXJ 2VPLA 5C4XJ 1GBQA 2ZPGB 3RMQA 3E6BA 3M53A 1TBXA 2DI3A 2OBPA 1WGSA 1U9NA 5L3GA 4LG0B 5GMKh 3GIBA 3I56Q 2K2VA 3EGDB 3T1BA 3DCFA 1JGGA 1D3BB 1M3CA 3S1QJ 3EG2A 3G1JA 4RG2A 2DOEA 1KQSS 5A0LA 5DCFA 5KYXB 3BPVA 2CP0A 2VE9A 3C2HA 2EZLA 3HIFA 4AIKA 3R0AA 2GTJA 3BY7A 4RTTA 1T0JA 3AG4H 2GA1A 5GTIC 1VQ9I 3HPWA 2CS7A 1K8AR 1VQ4Q 1HDPA 1M8VA 1NG6A 2EIFA 3QRFF 2CUJA 1K78B 1OZ2A 2PG4A 1ETKA 4BXFA 4L59A 3IWFA 2ZPEB 2DFUA 4KT5C 2WACA 5DM7F 1G3TA 1D1BA 5GMKi 1B34B 2CH0A 3G73A 4U7DA 2FNAA 2CQQA 1VQ5T 1VQ7T 2JM8A 2ELHA 4UC4A 2M0CA 5EEAA 4ZN3A 3AG3H 1RKTA 2E64A 5JHUA 3VU3C 1FTZA 5DTDA 1AU7A 2W4SA 3T9NA 1K73U 4L5EA 1BI2A 1FSEA 2PMUA 1RPWA 4MHGA 2O88A 5TGTA 1P7JA 1DGWY 1T56A 2DTZA 4M77B 1O57A 2E34A 3P9IA 2K3BA 4P96A 2KP6A 1W2BP 1YW9A 4XKCA 3SQNA 4D0PA 4Q4ZF 1NH3A 2Y69H 2M9HA 2OJED 4FASD 1FEXA 2VE8A 1X1BA 1F4KA 5A2QR 1A04A 1WJEA 5GAMf 2MD0A 1M8MA 5KYXA 3CUOA 2W84A 4AT1B 1IG7A 4M75E 4M75F 2LVSA 2OTJI 4C92F 1NLPC 1FIPA 4KYWA 2MF2A 5CVIA 4IUTA 1KQSA 4JLGA 2IPOB 5J47A 2J6FA 3M4GA 2MH9A 3FBNB 5GAOp 3HL2A 1I27A 4BDYA 1WHMA 3CCSQ 3N5BB 2VC1A 2DW4A 4FYXB 4Z88A 1OYXA 2A36A 1FYNA 4M9ZA 5FW9A 2LK2A 3PUFA 4A53A 2DM1A 4HQEA 1NM7A 3EAEA 2MWOA 1YS6A 3WGGA 1IREB 1ZELA 5FO5A 3HUGA 5LBQA 3NMZC 1FSHA 4J6XA 2DBMA 3CCQA 2VJ4A 2OTLA 4BQOA 4JBAA 2KZGA 4HG2A 4CCLA 4M3BA 4Y13A 2R5YB 2AZVA 4XKBA 1BC7C 2DA6A 4O5VA 3ZRGA 3EGXB 3PMIA 1NE8A 5GANj 4ENKA 5FROA 3IQLA 1F9NA 3WTUC 3H3UA 1X69A 3PMTA 1SC7A 4QVDA 3A0HC 3Q0VA 4EQQA 4XKWA 5IH2A 1XTAA 3H3ZA 2QGGA 1NK3P 2DO7A 3BJOA 3EG3A 4CYCA 2NYSA 1VQLI 3BDUA 1FYMA 1YHQI 4JRKA 4QKUA 4CC3A 1AHDP 2CS3A 1OEBA 2DX1A 3HKZA 4WTOB 1JHFA 3F8CA 5DM6F 2R93J 2CREA 4F04B 5M5WJ 1R1VA 4BHCA 2JA5J 3CXCA 2AT1B 3HFOA 1RI0A 2M2EA 4M7AA 1JQQA 3I55A 4XSXF 3I9V2 3KYDB 1XGOA 4QQGA 4KT0E 2DA4A 2HD0A 1BCMA 4RM2A 2E10A 5IYBJ 3DLAA 2CUDA 2M8GX 5GAMg 1TNSA 1ETYA 4R79A 4HCZA 3RQIA 3JRAA 1IZ1A 2FHDA 3GNFB 3OBWA 2O9LA 3QWXX 1RC9A 2BV6A 1DPRA 2NVTJ 1M2OA 2GF7A 1VYVA 1Z6RA 2FQ3A 1G83A 2L8DA 5L23A 5I2SA 4D5FA 2L5QA 1ORKA 1E6GA 1TTHB 3VSLA 4CCNA 4YFKF 3DWLE 5KAFC 1YJ9I 1K6OA 3PE0A 3BR5A 2ZXHA 2E7XA 2R5ZA 4XTXA 3LQRA 2GLOA 2EW3A 2YRVA 1YIJT 2EBIA 4IKFA 4CYCB 1Z7UA 1UDLA 2FX0A 4OP0A 5LJ5h 4JOMA 1WHHA 1QQIA 4M78C 1H9TA 2CV1A 3ML6A 3A8HB 1OISA 2ZCWA 5DV5A 4XRSG 3CMEI 1CF7B 1WQWA 5IAYA 2L9VA 1NK2P 1TWCJ 1JUSA 1K73C 1D1CA 4M3FA 4EPCA 1V4RA 2F5EA 3J81Z 1LNXA 4XONA 2MSYA 1ZA2B 1YIOA 1D8KA 3RQ4A 1M90R 1UGSB 1YJ9A 1I81A 2BY0A 4V2GA 3E5QA 1LFUP 3DLLF 1Q86U 4B3XA 2AS5F 2EPDA 2WC2A 3BR6A 2JT4A 2CUZA 1X1AA 4B43A 4KISA 2JOYA 2XU8A 2PUOB 5LJ3f 2VL8A 2CZ1B 4CICA 3CC2I 3CMAA 1ZGAA 5CKFA 1PJRA 3LW5E 1G3SA 3BTCA 4PJOE 1X2NA 2QLZA 3G1LA 2V9PA 2Z16A 2E1HA 1MMDA 6AT1B 4A3GJ 4OWRB 1W2BS 1GUUA 1RETA 2HFHA 5LGTA 2F4MB 1DPUA 1BK2A 2XGXA 2CU7A 2HAXA 4A3JJ 2D1VA 4WF2A 2M5WA 2CP2A 4G8XA 2CRGA 2HQRA 3ASNH 2EFIA 3ASKA 1JJ2S 3BZ6A 4ZDOA 1PVEA 4ESRA 4M7AE 2GBYA 2L3PA 2RK1A 1IHWA 2KXDA 3CJQB 2OAZA 4DIQA 3I5RA 4AC0A 1Q7YC 2H6BA 4ASNA 3HTSB 2K6DA 1IRXA 2LP0A 4E4HA 4Q48A 2BVMA 1OX8A 2M30A 2CW0F 3CLOA 3OIPA 3PSFA 4KN7X 2JSCA 1OQKA 2EQRA 2MD5A 1X4PA 2QZ8A 2RAEA 3OYMA 2ZJRF 1ZLKA 1G2BA 1M4ZA 1MNMC 5LJ3j 4JS4A 4A63B 5GAN2 4DYCA 3RCOA 2C6YA 5KYYA 4DOWA 2Z5UA 2LY9A 1SPKA 4NQWB 1AD5A 4MZMA 5C0MA 1WHKA 4MMKA 3JCMf 4FX0A 8AT1B 5M5XJ 1Z05A 1GXQA 3L1PA 3JCMP 4JJDA 4KH1B 1YI2Q 4PCQA 2BE9B 1H8KA 1SFEA 3S3MA 2OCEA 2RQPA 4HA8A 2D6FA 1KJWA 3B6CA 1ZBJA 3CBPA 3CF2A 4HBLA 3FLGA 4HVUA 2XK0A 1WHGA 1CSKA 3AG2H 1TQIA 2JUGA 3CC4I 1MMSA 5CQYA 4RTXA 2ESWA 2CJJA 4FM4B 4AFQC 2E1MC 1JU5C 8ATCB 3RNJA 2QSGX 3O8VA 2GFAA 5J39A 2BKDN 4D6WA 1FMWA 3KYCB 3JSOA 1SMYF 4S05A 1TP4A 1KQ9A 3AAFA 1O3TA 3H0GJ 3QPLA 3FDYA 1IRGA 3CCMI 4IHSA 5GAOn 3HSFA 2W85A 1U6GA 4OMFB 2FEIA 1TUDA 2DETA 3ESWB 2P0WA 4RAYA 1JXMA 3FXMA 4P5OA 3A01A 2YUQA 2KIUA 2W24A 1SANA 4EM1A 1ZA1B 5FD5A 3QYBA 3RKYA 2F5KA 2LG4A 5KH6A 4BQQA 2EV6A 5HCKA 3ERED 5LJ3e 2RHZA 1J59A 4Y28E 3CCJT 4AWXB 2HOSA 1EA3A 1WXBA 3E7LA 2GIVA 4M3GA 3M58A 2K86A 2J5PA 2DEUA 3E9FA 3OW2S 3H0FA 2Y2ZA 2DVEA 3DEEA 4M75B 1K9MU 3S1RJ 2R7SA 3OY9A 1U06A 2M16A 4HQMA 2DKGA 2MFZA 1ETOA 3M0RA 4E7JA 1WZ2A 3RR6A 4ELZC 5GAN5 5IYDJ 3HJEA 4F3QA 3V4GA 2V8KA 2O8KA 3EUHA 5DD4A 4LIVA 4RGRA 3DF8A 2DA9A 3SZPA 3JAME 3ZEHA 4BACA 5HDKA 3HG9A 2Y0SA 1IGQA 3ZN0A 1YG2A 2B9SA 2V6EA 3NGPA 3J7AF 2YUNA 2AKLA 2IS6A 2K3FA 2Z0WA 3K7AJ 4IUVA 5GAMe 2QQBA 4G7OF 1FTTA 3F23A 2LKXA 2LQKA 2FMYA 3M8EA 3FXUA 3U1KA 1W4MA 2G7UA 2VBXA 3GZ5A 2HYJA 2KFDA 5ICFA 1IJWC 1MMAA 1RAFB 1TOVA 1YITQ 1D09B 4Y15A 1MDMA 5FRNA 2IEKA 2PVDB 2ZKZA 3ROUA 3ELKA 4XLPF 4ESJA 2CV2A 2KR3A 1YWOA 3BTIA 2QEXQ 3CC7Q 1J3TA 1R4NB 4RBOA 1M1FA 4GYGA 1X43A 3M4YA 2WAEA 3F72A 4C92A 4E6RA 1VQMA 5A2QK 1FOKA 4F7UE 4M7AC 2RI5A 1YJWQ 5C4JJ 1QZEA 1UZCA 4PSWA 2DAQA 2A0FB 2HCKA 3RDVA 4PGHA 3RTRA 5B5EC 2DTHA 5J3BA 1RADB 2LMJA 5GAMh 2P4WA 1AEYA 2A6HF 3OMGA 4HRIA 2KDZA 5L3CA 3CCUT 1JUPA 3ZOBA 2YUSA 1APLC 1UHSA 3H36A 4CCJA 3H0IA 3G71Q 1FBUA 2FG0A 4S0HB 5H20A 2JN6A 3G7ZA 2VC8A 2ESNA 2ZXWH 2KRNA 3I56T 4JZ3A 3I9QA 1O7FA 3EYYA 2AQFA 2E36A 1FOYA 3RBBB 3TQNA 4NC6A 4HCCA 4A3FJ 3IRQA 3ZMZA 1BI0A 4C3IJ 5DM7R 5GADJ 1PDNC 3VS5A 4M6XA 3VFZA 4EMGA 1R6RA 2OTLT 3JB9H 4PJOC 4IVNA 4MFDA 4C2MJ 4CO8A 4KRTA 5E18F 4D8DA 2OAUA 1N75A 3GPLA 3FM5A 2ROLA 2KISA 4GO1A 3MFKA 1N9RA 2CSOA 1O3RA 3H9GA 4HAMA 2HEOA 2PJRB 3I4NJ 2E41A 3LFKA 4A2UA 2E1MB 1YP5A 2WV0A 2KNBB 2JWTA 1M3BA 1XMKA 1GV5A 1GFCA 3OIOA 1YJNI 4BYYA 3O8HA 3RKWA 4AYBA 3BZCA 2KRCA 4B4CA 3JCMg 2QBYA 1M1KC 1X3UA 2MBFA 1Y39A 2EQUA 1YYVA 5HVQC 2F1LA 3TO6A 2X6XA 2UV1A 4QPOA 2M34A 2QTVA 5HLGA 5LHGA 4HLXA 3HBLA 3K0LA 1VYTA 3FIFA 2RVCA 2PJPA 4F7UG 1I3QJ 2QA4Q 4H4KC 5GANe 9ANTA 3BROA 2YX7A 4LD6A 4QVZA 3V8JA 3ULQB 2DRKA 4JRPA 3CD6Q 3CPWS 1ZHFA 2O5RA 3CDHA 4N4HA 4IXAA 2F2EA 2YUOA 1Z21A 3HHHA 3K1NA 1ACMB 4GLMA 1UGVA 3SEQA 4EGYA 3CCQQ 2YR2A 2KPMA 2GBQA 3VUBA 2Q8KA 2RF0A 3PNVA 3ZR8X 4C92B 4IPAA 2KT0A 1XJWB 4BHPA 4FSSA 1R7JA 4JRIA 2XDBA 1N9SA 2EQIA 2FZCB 3QU6A 4BQNA 4XTUA 1XCVA 3SFMA 4ZGEB 3ZFJA 1XPXA 2HBWA 2DMPA 3DTKA 3SEZA 1WNLA 4KUDK 4F16A 2FJ1A 3A0BC 1UE9A 3EPZA 1HA8A 4EIKA 1SFXA 3EFOB 2Y4XA 5FWCA 2NAZA 3ZQ7A 2JM9A 2QASA 1E17A 2MOXA 1HKQA 2ZPIB 2XAGA 4A3IJ 3CCVI 1B72A 2V1UA 1WI3A 4A3KJ 4BEHB 2R7FA 4FQGA 5JVGF 4HDVA 1JKPC 1BBZA 5K5RA 2VIXA 2W1OA 4BJ5C 3L2CA 1JBMA 5CIUA 4U7BA 1NPRA 3SD4A 2K3PA 2QDLA 1MGQA 4CGZA 5EGOB 3QOEA 1T39A 2HSEB 4CC7A 5GAOl 1TWFJ 2XC7A 4KDPA 3FC3A 1OPLA 1WQ2A 3WHCA 2NRAC 4XM3A 1Z9QA 3WGHA 1WI9A 3JCMd 3V7CA 5DDGA 4IX7A 2E5QA 1GRIA 1I0CA 4C8QE 3FBIB 3OB9A 4RCCA 4RLFA 3OL3A 3F22A 1FZPB 5HKCA 3I3LA 2IGMA 2FOWA 2FF4A 1DJ7B 1B9NA 3Q9VA 2WB1N 3SFZA 2ZFWA 1K83J 4CHUA 3Q1JA 2EGCA 5CAIA 4R56A 2M87A 4N9IA 2R7UA 2TRTA 3MAJA 3OV8A 2X9HA 4XU2A 3QWLA 3KFWX 3CMYA 3I4PA 2M0YA 2P0KA 1ETVA 2M4KA 1HK9A 2VVKA 3GYHX 1B8IB 2DK8A 3EHRA 3QYGB 5KHDA 1RACB 4VUBA 2L3DA 4L5JA 2X0LA 3F21A 4BXXJ 2JVVA 3DLLA 2XKOA 3HSRA 2VODA 2B86A 3KZZA 1Y0NA 3K69A 3I5UA 5FFXA 1H641 1OFCX 3OOUA 3G6ET 4PUSA 2OQGA 5C3EJ 4BU2A 2FYKA 2RJDA 4M7AG 1W6XA 1HBXG 2DZCA 3FF5A 2HOAA 2GXBA 4KGZB 3MHXA 4R0KA 3VS0A 5L3EA 3CCQT 1D3BA 3CC4T 2VBWA 2J05A 1IXDA 4L18B 2V26A 2E3IA 1M1GA 2ZJPF 1F1ZA 3JCMJ 1PD0A 1ETWA 3WVEB 2X6OA 3BCAA 1ITYA 3NQOA 1TUGB 3ZQHA 2LC2A 1XGSA 1SFOJ 2W0ZA 2PEXA 2TDXA 3C2GA 4O6JA 3GFIA 1NBEB 2EJGA 4A3MJ 4L5IA 3CO6C 2RJFA 5HLTA 2YS9A 4HZFA 3A52A 4X0GA 1RLPC 2QUFA 4RB1A 1PP8F 2KSSA 5GMKl 3GTKJ 3BJ6A 2R7TA 2ZSHB 1Q1HA 5CK9A 3OMCA 3O5ZA 2CSIA 1ONVA 1SEUA 1W5CC 4II3A 1YE9A 4HCKA 3VOEA 3ER0A 1W2BA 1T95A 2RJEA 3MQ0A 3I55Q 2LQWA 2RH2A 1DP3A 1UHCA 4PL6A 3L1AA 4RA2A 3H5NA 2V1RA 1VIFA 3CCRA 2KQRA 5EF6A 4XTZA 3OYBA 5KK1A 4A4GA 4B9XA 1ZGJA 3HKZN 1IUYA 4AFSC 3S1MJ 2KMUA 5J4YA 2EYYA 3CMAT 1PRLC 2HPIA 2W7NA 1KQ1A 4XQ3A 4B6MA 3UPUA 3VYRB 1T3LA 1MNDA 4BUGA 1VQ7A 2PTKA 2RQVA 2X48A 1BJAA 2H94A 3HEFA 2M3AA 3I55I 3JR9A 3NTKA 3W6VA 1VQ7I 5AT1B 4IIMA 2FMLA 2XI9A 1YTYA 4I99C 1UJYA 1KQ0A 2LY1A 3NWTA 1ZYRF 3KLNA 2QQAA 4LDXA 1GBRA 2X4YA 5F6FA 1O3SA 4ITVA 4FSXA 3CDLA 3K4CA 4MFEA 1M1KU 4RUGA 1ETQA 1I4K1 2WY8Q 3NAUA 2YSRA 2GQVA 4JZ4A 4B1RA 3I4MJ 1G8XA 3K6GA 4YG2F 2VUBA 4E7LA 3EG9A 1WJQA 3T8RA 2DK5A 2LTPA 4U88A 9ATCB 4XLAA 2EIMH 2H8RA 3L09A 3EG9B 1K0XA 2L02A 1QRYA 1USSA 2P81A 1HF0A 2MC4A 2M1HA 1PKSA 3JRCA 1BR2A 1I8FA 4NOYA 3HRSA 2DXIA 1QKWA 3P8DA 2KIFA 1VQNA 2WADA 3ISPA 4KITB 2R5YA 4BNCA 1D5VA 1KQ8A 3JCMc 2O03A 2UWMA 2A5WA 2HQAA 5HK3A 1X19A 4XLFA 1J75A 1UTIA 5IHIA 2E1CA 4GFBA 3M5AA 3NRVA 1IW7F 4JPBW 1AOYA 3OSSC 3A1YA 1YOVB 4M71A 2COYA 2Z1DA 1I39A 3MEWA 3BW1A 4ZTFA 4PJOD 4DBHA 1BCOA 1QNTA 4JRQA 4LK0F 1BOAA 2D1XA 2RJCA 1E7OA 5HODA 2RQTA 2XIDA 3F9KA 1LE8A 1YLFA 1PHTA 1LNWA 3H41A 3MEVA 4KGVB 3CCVT 2NS8A 1EF4A 4EM0B 4CH7A 1K4SA 2BHZA 4KA4A 2EILH 1LE8B 2CYYA 1OR7C 2YSQA 3T0YA 3PT9A 2DQLA 3CDIA 4FT8A 2BIVA 4AD9A 1OQYA 1VQ4T 3LSMA 2VT2A 5K7FA 1B7TA 3M55A 2K40A 3EGXA 4X9CA 1NG2A 3FZVA 3JCMh 1NTCA 1AHJB 4UUSB 3NTHA 1VUBA 1IN7A 1Z9CA 3FXKA 1ZAOA 4YFXF 3LH5A 1R5HA 3GTGJ 2LVMA 3HGYA 2V7FA 4PJNA 3TVTA 1R5GA 4RM3A 2RO0A 1E3PA 4TV7A 1KG1A 4C8QC 4C92D 3CMET 3G1MA 3FXOA 2VKHA 1VQLA 3NWSA
chains in the Genus database with same CATH topology
4UXNA 2DXTA 3P8HA 4PNOA 4Y91A 4ZYDA 1R1TA 5LJ5d 2J5OA 3WTXC 3A8LB 3PNWC 4ENMA 2Y0MA 4Q5SF 4HLYA 2V1DA 4L5GA 2K57A 3F8MA 1ODDA 2IA2A 5EEHA 3REOA 1REPC 1U3EM 4C8QF 5HS8A 4CXFA 4BB7A 1RNLA 4M78A 2IG0A 2VGMA 4IURA 4OB0B 1LEAA 2XDDA 1ZLJA 1OKRA 3OYDA 3CPFA 5GAOm