1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
b'MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA operator DNA
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
4N9IA 1ZN2A 2K27A 1QO0D 5LGNA 5IT9K 1FX7A 4BHBA 2ZCWA 1HQCA 2ESNA 2GA1A 3LQRA 2P8TA 5H6RA 3L00A 2CGPA 4M72A 3WTXC 2JRTA 2OA4A 2VBYA 1YW7A 1F4KA 3COAC 4OOIA 3BDDA 2VOOA 3ECOA 2FRHA 3I59B 4OINF 3LAPA 3BROA 4Z2YA 3QRFF 3GFIA 3DFGA 3GLXA 5LRSA 3F8MA 1P4WA 3CJNA 4I09A 5BPIA 3ABTA 3N97A 2BEOA 1EH6A 1O7LA 3FXQA 5DYMA 1QQIA 1BC8C 2A69F 3V8JA 1SFXA 5K5OA 2L4MA 4Y17A 4RS8A 2MH9A 5ICCA 2PEXA 2ISYA 1FSHA 4S04A 1RZ4A 4AVPA 1LB2A 2VODA 4EQQA 2LF7A 2VXZA 3OV8A 3L2CA 5LLQA 5BOXA 4RGUA 4KDPA 4G7HF 2ZO4A 3KP7A 2XHKA 5LRRA 3QPTA 1TTYA 2C6YA 2XROA 4A6EA 4KMFA 4ETSA 1B6AA 3BY6A 3O3KA 1Z91A 2PMUA 2CG4A 2IA1A 3KP6A 4M9ZA 2DT5A 3NQOA 2KJBA 3E6CC 1EH7A 4U0YA 4XSXF 5LGTA 1YG2A 2DFIA 1IAWA 1U5TC 2HTSA 2VN2A 2DK5A 1OYIA 1YYVA 2AS5F 3H3UA 1BBYA 3GEZA 4BYYA 3L7WA 1BI1A 4N0BA 4HA8A 2VONA 2KIUA 2NS0A 5AIQA 4L18B 4RB1A 3F8FA 1TQMA 2GZWA 1P4XA 4B8XA 3WTTC 2G7HA 4U0WA 5LBQA 2H3JA 4ZZLA 5K5QA 1XMKA 3ZP5A 2XAGA 1ZRFA 3ERED 4IRHA 1IZ1A 4WX9A 2XKOA 1PDNC 3EQLF 2XAFA 5BQTA 4OIOF 1FBQA 2GAUA 4B09A 3P9CA 4EJOA 3HSFA 2ACJA 1R36A 1DDNA 2D1HA 4E70A 4I0BA 2PI0A 3QU6A 4R8HA 5F6FA 3RDIA 4KIBA 4YG2F 3ZMVA 2FU4A 1QGPA 3MQ0A 4IPAA 2V1UA 1K79A 1R1TA 4IF4A 3BZ6A 3KZYA 3KE2A 1J59A 2JSCA 5E8GA 4UNOA 3E6BA 2K4JA 3WTWC 2K5IA 3NEUA 3GUDA 2KIFA 4LGWA 3HRUA 1BC7C 5BS6A 3GXOA 4GXOA 3BP8A 3V7SA 4UV9A 3B73A 4LK0F 2HOEA 4EGYA 2RN7A 5H6QA 1ZYRF 4YFNF 3W6KB 1XGOA 3V8KA 2EA4A 5D4RA 2QQ9A 4R1HA 4OIRF 3KP5A 2MC3A 2TDXA 4RB3C 2FEZA 5IT9Z 4YFKF 5ED4A 1R1VA 3HHHA 2QQBA 1ZHFA 5HS7A 1Z6RA 3MWMA 2XAJA 3K1MA 1O3RA 1V4RA 1MJAA 1WKMA 3TO9A 3CUQC 5H20A 1U8RA 3ZPLA 2W24A 3RKXA 3TGNA 4OMYA 4HV5A 3S2WA 4LMYA 4G7ZF 3GVAA 2P6SA 3O6BB 3AAFA 2K5LA 3F21A 4IRIA 1OPCA 4P5OA 1D5VA 2H94A 3LQQA 2PN6A 4MTDA 5TRDA 2BBYA 1T39A 3R61A 1XSXA 4CXFA 3C18A 3WU0A 4EM0B 2FNPA 1SD4A 2P7CB 2QVOA 1ZLKA 2DLLA 3F22A 1X3UA 1FPQA 3KZZA 3TO6A 3OOPA 5E20A 3J80K 3TDZC 5E18F 1UFMA 3KLNA 2HYFA 2K02A 2Q8KA 2P5KA 3WGHA 3RJPA 5KK1A 1PP7U 1R22A 2H6CA 4AIKA 1XCBA 4KUMA 2EFWA 3C7JA 4L0ZB 3LA2A 2CSOA 3KP4A 2ADUA 3QP5A 1PP8F 2YU3A 2Z3YA 3R60A 1IXRC 1KQ9A 2D2WA 1XGNA 1RIOH 1FNNA 1L3LA 2UZKA 4Y15A 2M5WA 5DCMB 4LFUA 3VB2A 3BOQA 2X4HA 2D1VA 5D8LB 1UB9A 4CYDA 3GFLA 3F8NA 2G7UA 1FWZA 2ZMEB 5FFXA 1QZZA 1P4AA 3O2PE 1J9IA 3HIFA 1HKQA 2W84A 4MGRA 1SMTA 4OIQF 5BMZA 1IRGA 1J2XA 3WODF 3WE3A 3TDUC 4A5NA 1FSEA 3ZMUA 5F64A 3HOTA 2QQAA 2V6CA 2KKOA 2EJRA 1QNTA 4GCVA 3T0YA 4AD9A 1RI7A 3SQNA 4BXUA 3MAJA 2FA5A 2Q2EA 4KN7X 2KJCA 3REOA 4IVNA 4L9JA 1OKRA 5JR3A 3FXRA 3DEUA 1IUYA 3MCZA 2DI3A 2BE5F 4PCQA 1ZREA 3CUOA 1G3WA 2ZMEA 1XB4A 5FGMA 2OU2A 2UXNA 4A6DA 5D5UB 3WTZA 4P9UA 3ZMDA 4M9XA 1O3SA 2V9VA 3R0AA 2JPBA 2O3FA 2KIMA 3IKVA 2W85A 5D5XB 2E1CA 1AOYA 3Q9VA 2Z9OA 1GVJA 2X0LA 2P5LC 3WU1B 2P4WA 1R7JA 3ROUA 2CWEA 4FT8A 3C1DA 5J8CA 5ILVA 2DPDA 5CVJA 2IVMA 3EETA 5HS9A 3H92A 4A5MA 4OMZA 2V79A 1S29A 1L0OC 2MBFA 4HLXA 3HRMA 4P96A 1ZARA 2RDPA 1HSTA 3ABUA 3G3ZA 1F9NA 2E1NA 4EMSA 1TNTA 2IA0A 3QU3A 3EYIA 1TBXA 1LEBA 5L3CA 2HFHA 2JT1A 1Y0UA 2LX9A 2ZBKA 1ONVA 2CW0F 3D5LA 1IXCA 2F5CA 1IW7F 1J7KA 5JFRA 1SD5A 4UVBA 5L3EA 1BI2A 3I0TA 1YFHA 4CO8A 2EWNA 2GQQA 2HQRA 4RGSA 1XMAA 2FBHA 1FC3A 3RYRA 1MDMA 3F8BA 3T5XA 3PQJA 1IRFA 4HF0A 3JSPA 4KIFA 1XDSA 5L3FA 2HR3A 2M45A 3U9GA 4HDVA 2G9WA 1ZGAA 2FXAA 5EEGA 1EH8A 1BOAA 3M8FA 2FBKA 2M30A 1K78B 3ZN1A 1XCVA 4OU0A 2ZKZA 1KU7A 1KU9A 4GYIA 5CVVA 5CVUA 1ULYA 1KU2A 1WWXA 3B02A 1YO5C 3U2RA 2QZ8A 5D5VB 5DDGA 3VOEA 2Y0MA 1U3EM 3FX3A 1P2FA 4FHTA 2DW4A 2YPRA 2A3SA 1S3JA 4KYWA 3MZHA 4L9NA 2RNJA 1DP7P 1STZA 4XLPF 4LLLA 1U5TA 1SD7A 3GYHX 3EDPA 3SZTA 2L01A 4KFCA 4LLGF 3I54A 5D8KB 4BHCA 2UXXA 4MTEA 2R3SA 4S05A 1FP2A 1IN7A 1RNLA 3HTSB 2QBYB 4BNCA 2AXLA 1DUXC 1FOKA 1T2KA 2OQGA 3R6SA 2O61A 3JSOA 1G4DA 1K78A 1MJ9A 4A0ZA 1GHCA 4HLYA 1MGTA 3J81K 4Q47A 2DTRA 4M73A 1B9MA 4M74A 3GZ6A 4G6QA 5FLXK 2ETHA 4P9FA 4L5JA 2K4BA 2XASA 4EJTA 2O03A 3CTAA 2EA2A 4CDGA 4LG0B 3IRQA 2BGCA 1W5TA 4L9TA 3TKYA 4HBLA 2RV8A 4ESFA 2DAOA 2CFXA 2STWA 1J5YA 2MA3A 1K6OA 2FOKA 2V1DA 4HAMA 3E6DA 2Q0OA 3FMSA 2FE3A 4CHUA 1P6RA 3I53A 5LHGA 1FYMA 1EV7A 3Q9SA 1SFUA 2GXGA 4IHTA 4HX4A 2QBYA 3SFZA 1MZBA 1G3TA 2K7LA 2E7WA 1H0MA 2P5VA 2DK8A 1W7PB 2Y48A 2EFPA 3HYIA 4FX0A 1BI0A 2A61A 3WGGA 1O7FA 1T38A 1MJBA 1HW1A 2EV5A 1E17A 4LG0A 4BQAA 1T98A 4HYEA 3H3ZA 2WV0A 2F5DA 4MEYF 4DQ2A 3WTVC 2JPCA 3E6MA 2EB7A 4AWXB 1WSUA 1UHMA 1I27A 3GO5A 2EK5A 1HW2A 1R1UA 3TQNA 1TLHB 4EM2A 1KYZA 4WXCA 2HGCA 2WWYA 2KRFA 1I1GA 5DCFA 1DPUA 3RYPA 3QAHA 1Z05A 4PDKA 5HLIA 1BYMA 1BIAA 4GYGA 1R5GA 4HF2A 3MEXA 5K1YA 1W7PA 5DD8A 2IJLA 2NYXA 1LJ9A 4ON0A 2XAHA 3P7NA 3M9AA 3KP2A 1BN5A 4MEXF 1JXSA 1KGSA 2COMA 1HBXG 1CF7B 1I5ZA 5AONA 5HDNA 2QM3A 1G3SA 2UWMA 1BI3A 4O5VA 2M1BA 4BHPA 4I2OA 3WTUC 2A68F 3F6VA 1IN8A 4EJWA 3CLOA 3R0JA 3QP6A 4OIPF 2R7DA 2D45A 4ENNA 1D8KA 3M7GA 2LNBA 2J5OA 1QZYA 1ZAOA 4UV8A 4LLNA 2DBBA 3RPQA 4CICA 4IXAA 1XN7A 4M71A 5FB2A 1RUOA 3FWEA 5E1XA 1T0FA 2ZFWA 4F7ZA 5D5WB 2VC0A 3E5UA 3ZQ7A 5E8IA 4RB2C 2STTA 3GFMA 1TW2A 1YTYA 1HXDA 2J5PA 1TQIA 1BM9A 2BV6A 4KMUX 3RPUA 3DQVC 1H9GA 1CF7A 3ECHA 4RB0A 3RKWA 5HLHA 2EV6A 3I5UA 2H6BA 1QPMA 1S6LA 2CYYA 1VTNC 4ENKA 4M9SA 1R58A 2Y75A 1FYLA 3F23A 1HSJA 4P55A 4TV7A 3E97A 1USTA 5LGUA 1DPRA 4KT5C 4BAYA 2NNYA 3K9TA 4KIGA 1LDDA 3IKTA 4KN4X 1YQAA 2DO7A 1WI9A 1U6GA 3ISPA 3PFIA 2QLZA 4UXNA 2NNNA 4A2UA 1FZPB 3BWGA 2L4AA 3DV8A 5CLSA 4ESJA 2PFBA 2FQ3A 1FT9A 2DU9A 4JK1X 2YX4A 4G9YA 4O3MA 4FX4A 2BYVE 5ILUA 1ZRDA 1G3YA 5HLGA 1BIBA 3CO7C 1T6SA 1ZGJA 3WE2A 4ZYDA 4DNCA 4YIIA 2EV0A 1ZG1A 2A6EF 1U2WA 1XD7A 2A5YB 5BPDA 2DQLA 5CVRA 2GWRA 3DPLC 4LJZF 3DKWA 5E1ZB 2FSWA 1QBJA 1E2XA 1R00A 5D6EA 3IHUA 1B4AA 2W25A 4HQMA 3F8CA 5LEKA 2FF4A 5E1WA 2M87A 2FNAA 4JQFA 1MKMA 3LA3A 1OMIA 3KLOA 1A04A 1SMYF 3QOPA 3ULQB 3RKYA 3PQKA 2YSRA 4ZH4F 4EM1A 2XGXA 4AIJA 3E5XA 2R7FA 4ESBA 4I98B 1MDMB 2PG4A 3G73A 1W5SA 2VBXA 5KVRA 1HW5A 3WG9A 2PQ8A 1JHHA 3I58A 1W4MA 1O3TA 2W57A 3I4PA 3LA7A 4WF2A 1LNWA 3D0SA 3C3WA 2K5FA 1REPC 3HUGA 1C0WA 3LFKA 1YS7A 3E19A 3JAMK 2RVCA 3K1PA 1ZLJA 3FMRA 5A2QK 1GXQA 2XV4S 2EFQA 1I6XA 3K0LA 4WK8F 3IWZA 2PMHA 5JHUA 1FLIA 4EGZA 4HV6A 5LEJA 2V1XA 2ZJ2A 2IPQX 3EUHA 2PBIA 5DV5A 5FFZA 3F72A 4MHGA 1S8NA 1XGSA 1U5TB 5ERIA 2L3DA 3GW2A 1S7AA 4UUVA 1U78A 1G6NA 1YW8A 3ZMSA 2XUBA 4Q5SF 6PAXA 3RI4A 2HS5A 3F6OA 1YW9A 4U7BA 5L3GA 5ICEA 5HDGA 3J80Z 2MH2A 1IN5A 1F1ZA 2ZXJA 2P6TA 1QW1A 3K1NA 3QPHA 1JHFA 4WXDA 2HQNA 2VE8A 1F5TA 1HKTA 4EJVA 1FBUA 3MHXA 4O6JA 3I71A 4L9VA 1ZG5A 4EV0A 3ML6A 2XAQA 3T8TA 3K2ZA 5K5RA 5HS8A 1LQ1A 1SFEA 2OZUA 3FF5A 5DUIA 2L02A 3V4GA 4CZZA 3LWFA 5DD4A 2OQRA 2Z5UA 4NHJA 4LK1F 2LSOA 3L9FA 4ENMA 4NB5A 4NQWA 1ODDA 1PUEE 1B9NA 3SZPA 4BH9A 1Z9CA 3V7RA 3I59A 3IWFA 1S7OA 2JZYA 2JTVA 4G6DA 1FBSA 3HSEA 2ESHA 4GO1A 3CO6C 3NRVA 1OYWA 5TJJA 5HOOA 4EVIA 5DEQA 1USSA 3V7CA 3IL2A 4IHSA 3FXUA 1LEAA 1OR7A 1SAXA 3WTYC 3GZ5A 3KP3A 4ENJA 4ZZDA 3IC7A 4U7DA 2QYOA 3P9IA 2MLKA 2K86A 3IRRA 2NRAC 3W6JB 2EFNA 3E3VA 5ICFA 4IJAA 2PJPA 1YIOA 3RTRA 5CVIA 4RGXA 2ZNYA 2LDUA 3CUQB 1IXSB 2F5EA 3GWZA 1NHAA 4ZYEA 5ILSA 1O57A 4A12A 4YIFA 3JTGA 1B1BA 4G7OF 1XSVA 4HX8A 5L3BA 3DP7A 5E17F 3T1BA 3TOBA 4QWQA 4N9HA 3CDHA 3L09A 5D6FA 3GFJA 5FD5A 1FYKA 3VODA 3BJAA 2IRFG 1BJAA 4XSZF 1CGPA 2Z33A 1J75A 3FM3A 5L3DA 5J6XA 2OD5A 3KEOA 2OBPA 2HKOA 2FMYA 2VE9A 2EFOA 4HF1A 2IW5A 3E5QA 4UVAA 2ELHA 3FMQA 3HRSA 2YX7A 5CYVA 3FHZA 5F1RA 2HWVA 2LKPA 2XIGA 4PGHA 3CUQA 1SD6A 1Q1HA 4A0XA 2P7VB 2RQPA 5CJ9A 4LB5A 4M6YA 2OZ6A 3SHFA 3GX4X 2OAZA 3JAMZ 2GCXA 3R4KA 2L54A 5A2QZ 3KETA 3BPVA 4QLCU 1I1SA 4HW0A 4I7HA 5EEHA 3HOSA 3P9KA 2HKXA 4AIHA 3ELKA 1WRJA 4ZYGA 1K7AA 1KA8A 3ZMTA 2ISZA 3KFWX 1TNSA 2LF8A 4K2EA 3Q5FA 3EYYA 4HDUA 4LD5A 1KQ0A 3SXYA 1ON1A 1R23A 3I64A 1KQ8A 4UHTA 2HZTA 4RGRA 1ZG3A 2IT0A 4GGGA 2FBIA 5J8FA 2VBWA 3K69A 3J7AO 5LHIA 1XSDA 4IRGA 2GA2A 1H9TA 2CO5A 1LVAA 1YLFA 4G8XA 4KA4A 2RC4A 2MLGA 2QENA 1LDKB 4U88A 1B59A 1ON2A 2MD5A 2HTJA 4WXHA 4XBFA 2WC2A 2VT3A 4HZFA 2K4YA 1R5HA 2YR2A 2H09A 4HOBA 4H0EA 5IT3A 3MZYA 1LDJA 3HHGA 3JW4A 2O6GE 3U1DA 1UHWA 3V8LA 1QVPA 3TOAA 3HTUA 3DPTA 4LB6B 4G94A 2GXBA 2CQKA 2VC1A 4I0AA 1IF1A 1P92A 5ICGA 4KNYA 3J81Z 1IN6A 1AWCA 2XKPA 2B0LA 4RAZA 5FLXZ 3M1EA 4PZJA 4EJUA 1YS6A 5D4SA 2VOPA 3GF2A 5LHHA 2HEOA 5DUKA 4XLNF 3T8RA 2A6HF 2WTEA 3FZVA 4HX7A 2A07F 4CGZA 4Y13A 4R79A 2VBZA 2M8EA 4HQEA 2QWWA 2HYGD 3N4MA 2Z99A 2GIVA 3M8EA 4L5IA 4WCGA 3BJOA 3RIRA 1FY7A 2IP2A 4I02A 1KYWA 4ASNA 3ZMZA 4A0YA 3DF8A 4M6XA 1JE8A 3MFKA 2DQRA 5DCMA 1V3FA 2HDCA 1HKSA 1Z1DA 2H27A 1Z6TA 3KEQA 4MQVA 3BPXA 1D3YA 1XGMA 4I01A 1MD0A 2ZNZA 4ZYHA 3BJ6A 3VEPA 1UCRA 1D8JA 1XDUA 4UVCA 4JBAA 4D0PA 4MNUA 3TO7A 1O3QA 2NAZA 1RUNA 3KCCA 1JGSA 3JTHA 1ZH5A 4YFXF 1GXPA 1TW3A 3DXJF 3HSRA 1W7PD 3ZN0A 2F5FA 2DPUA 2O8XA 2XRNA 4PGGA 1J0RA 2FMLA 4U0VA 2IA2A 4KICA 2XVCA 3VFZA 1Z7UA 1IN4A 3WGIA 5JVTA 3FM5A 3LAJA 2PLYA 5JI6A 1WQ2A 1FP1D 4MQ9F 3WTSC 1TQPA 5HDKA 2VT2A 5FO5A 1KU3A 2F2EA 4WWCA 2O0YA 5FD6A 3LSTA 1OYYA 2RGVA 5HVQC 4L0YB 3F3XA 4RAYA 4Q4ZF 1ZRCA 4XRFA 2RKHA 2E7XA 2QUFA 3HRTA 4Q48A 5AIPA
chains in the Genus database with same CATH superfamily
4N9IA 1ZN2A 2K27A 1QO0D 2M4GA 4AIDA 3IQLA 2BW3B 3LGFA 5LGNA 1H3HA 5IT9K 2MGQA 2LG4A 3EGXB 1FX7A 2XPWA 2DMTA 4BHBA 4D5FA 2ZCWA 4XLCA 1VOMA 4OMMA 2F1LA 1NG6A 3G1LA 3HKZN 4F3QA 1HQCA 5JLXA 2ESNA 2GA1A 3KEYA 2N8GA 3LQRA 3OYGA 1VFCA 4KISA 1ZSZB 2E1HA 3ABKH 2P8TA 4R0KA 5FU7C 1K0XA 5H6RA 2GOXB 3G1OA 2LRQA 3L00A 2CGPA 5IN1A 5HNHA 4ZNXA 4UUSA 5GAOn 4M72A 3A03A 3C2GA 4XRSA 3WTXC 3H0HA 4ITVA 4XN0A 2JRTA 2A5WA 1W1WE 1S5LC 2OA4A 2VBYA 4NL3A 4M77A 1YW7A 1F4KA 3OBWA 3QOEA 1C0MA 3COAC 2CP2A 4OOIA 4Y7NJ 3BDDA 2K2VA 1OPLA 2ZXWH 4JX4A 1PC0A 3AL0C 4XR6A 1YJ9I 1LCKA 3VKIA 2PZ1A 2CP0A 4E7ZA 3VYUB 3FHNA 3CP8A 2VOOA 3ECOA 2ENMA 2FRHA 3I59B 4OINF 5EZGA 4C2UA 3M0RA 3LAPA 3BROA 1JT0A 3BR0A 3OYEA 1AEYA 3CQTA 4Z2YA 2A0FB 3RPUD 3NGPA 2R5YB 3CC2I 3HEFA 5J1UA 1NLOC 4JJDA 3ABLH 1FJLA 3QRFF 4PJOF 3GFIA 3I4MJ 1ZUKA 2LKXA 3DFGA 2DYIA 3H36A 4JJNK 3GLXA 3BG6A 5LRSA 4BY1J 4M3GA 2KI7A 3F8MA 4OB0B 1U9NA 2X9DA 1VQKI 4Z6YA 2RJCA 1P4WA 1Z7LA 3CJNA 4I09A 3BG9A 1VYUA 2VPRA 1H3ZA 5A0GA 2XU8A 2DDBA 5KYXB 3J80R 5GAN5 5BPIA 2I2LA 3ABTA 3MMYB 2NUPA 3PUFA 3N97A 5E3LA 2BEOA 3PVLA 4YRVA 1EH6A 2M9HA 4M7AF 1O7LA 2XF6A 3FXQA 2ELKA 3CD6Q 1JT6A 4GLKA 3QDFA 2ID3A 5DYMA 1QQIA 3EUHC 1X27A 4XNFA 1BC8C 2DTHA 3PNWC 4OAYA 2GM4A 1QP3A 1BR2A 4D5CA 5GANf 2R7XA 1VQ8T 1WQWA 4L59A 2WY7Q 1WHGA 4DYQA 2ME0A 1IHWA 2A69F 1E3OC 2CSIA 2LD5A 3V8JA 1SFXA 5K5OA 3CCSA 2L4MA 2AK5A 1TWBA 2F5KA 4XKWA 2I0NA 2E5QA 2YRCA 3SB2A 3EGXA 4PNOA 1IDZA 2CUEA 2L9VA 2NVTJ 2JMCA 4Y17A 1TWHJ 4RS8A 1Y96B 2DAQA 2MH9A 5ICCA 3Q1JA 3OYHA 2PEXA 4B6MA 5I21A 2K85A 2LY1A 2K9SA 1IB8A 2XDVA 2XPVA 4F93B 2ISYA 1FIPA 3ZCOA 1RKTA 1FSHA 3CCEQ 1X4OA 1TOVA 2E34A 1RZ4A 4S04A 1MHNA 4IURA 4AVPA 3S6WA 1LB2A 1ZUYA 2P81A 2MSYA 5EJCA 4XU0A 3WG7H 3PSIA 2P4RA 5F0FA 4NC8A 2VODA 1A31A 4EQQA 4IHXA 2LF7A 1ZGWA 2DFHA 2VJ4A 1M3CA 4NDLA 1KJWA 4LUEA 1WJCA 3TCJA 3H8ZA 2VXZA 1QCOA 2F48A 3OV8A 3CF2A 3A02A 3O8GA 4JP0A 3KZIC 1CKAA 3L2CA 5GMKi 1MMNA 5FKMA 5LLQA 5BOXA 5J1YA 4RGUA 2QGGA 2X85A 3IAS2 4KDPA 2R5YA 4G7HF 1LJOA 3RESA 2ZO4A 4C8QC 4L6V5 3KP7A 3E0JB 3G71Q 3C2BA 2XHKA 5LRRA 3QPTA 1TTYA 3DKYA 2C6YA 5M9OA 2XROA 3JCMg 1GCPA 3CCQT 3ZQQA 2OI3A 3MPUB 4A6EA 4KMFA 4RLQA 2EIMH 1GCQC 1W70A 1AHJB 2CGHA 2DJNA 4GRIA 4ETSA 3HPWA 1B6AA 1N77A 1QKWA 4M7AB 3CC7T 1KQSA 3BY6A 3O3KA 2PQWA 4RTUA 1A0NB 1X2QA 1Z91A 4DZPA 5KYXA 2E1MB 3GBQA 1Q1VA 2PMUA 3FK7A 3H0FA 2CG4A 1OOTA 2IA1A 3CJRB 1ETVA 3KP6A 4M9ZA 2DT5A 3UNGC 4BQOA 2CV2A 1N9RA 3NQOA 3Q0VA 4C0GA 2KJBA 3E6CC 8AT1B 3RMQA 1EH7A 3GP8A 3HPHA 4U0YA 1VQ4A 2E1OA 3HGYA 2VASA 3EPZA 4XSXF 5IOYA 5LGTA 1PKSA 2O9VA 4M75A 3OS5A 1YG2A 2ECZA 3JB9J 2PVGB 2DFIA 1TUDA 1IAWA 4QKUA 1U5TC 2HTSA 2VN2A 2HKQB 2BOLA 4QT7A 2DK5A 3CCRA 2RNGA 1OYIA 1YYVA 2K9MA 1NG7A 2AS5F 3ZEHA 1RAIB 1Y96A 1KQSS 2CP5A 3H3UA 4X9CA 3DKMA 1BBYA 2DBKA 3GEZA 3A8OB 2F5VA 3O8HA 3MKDA 4XLAA 4MO7A 1RQ6A 4BYYA 4B9XA 3NAUA 4Y28E 3L7WA 4QPOA 1BJZA 1BI1A 2JJ9A 3NHNA 4RTVA 2FD5A 2X51A 2KR3A 4N0BA 1ZHIA 4HA8A 1B8IB 2VONA 2LCSA 4HT8A 2EQRA 1CQTA 1YJWT 2WSFE 4A4FA 2KIUA 2NS0A 4F7UG 1T0HA 2DZ9A 2LVMA 1RLQC 5AIQA 2VB6A 1UELB 4L18B 5KYUB 4RB1A 3JB9F 3F8FA 1TQMA 4OB3B 2I5UA 5C44J 1XPXA 3G4SA 2EZIA 3CCMA 2QEXA 3PO2J 2GZWA 2EQMA 3OYNA 2ICWG 5B1AH 3NPFA 1P4XA 4B8XA 5DM7F 2QSHX 3WTTC 2G7HA 4U0WA 5LBQA 3JRAA 3S16J 1S1NA 1YCYA 2H3JA 5GAOq 4N4IA 1VQPA 2YUOA 3CCJA 3ZQIA 4ZZLA 5K5QA 4HPQA 4IQ4A 1VQ8Q 4C5GA 3HOWJ 1UEBA 1XMKA 4M78B 2LMJA 3ZP5A 2XAGA 1APLC 1IV6A 1ZRFA 2KPMA 2A3LA 2R0QC 3ERED 3CC4T 2A05A 1IZ1A 4IRHA 4WX9A 2XKOA 3BQZA 1P7JA 5KH6A 2EQUA 1E6GA 1PDNC 3FBNB 3A4CA 3H9QA 2XF5A 1H8AC 3EQLF 2XAFA 2DOEA 3VYTB 1OI1A 2D6FA 2LLKA 5BQTA 4OIOF 1VQMT 1FBQA 1OR7C 2DE0X 3GTJJ 2G0EA 2R7OA 3SYTA 2FUG2 2UUZA 2GAUA 3VSKA 3BZKA 4B09A 3P9CA 4EJOA 3HSFA 2VKHA 1UGVA 4PUSA 2ACJA 1R36A 4PJJA 2D1HA 1DDNA 5KCMA 1WPKA 3FXMA 2JOYA 4M77F 4HRIA 2EZLA 3OR2C 4E70A 3CJQB 4I0BA 1PSEA 2PI0A 2VQLA 4BJ6C 3QU6A 4R8HA 2JNGA 1X1PA 2CU7A 5F6FA 4FW1A 3RDIA 4H4KC 2HYJA 4KIBA 2DTIA 4A53A 2XPUA 4YG2F 3ZQCA 1VQ9I 1XQHA 2M1HA 3CMET 2CREA 1R9TJ 4PJNA 3ZMVA 2WADA 2R5AA 3DU5A 2PUOB 2FU4A 3PGGA 3KYCB 3SFIA 1QU3A 3JRHA 1QGPA 3MQ0A 2VQGA 4ZJZA 4IPAA 3I55A 2AQEA 2V1UA 4CCOA 1K79A 1K61A 1R1TA 2NUTB 3CCQQ 1UHFA 4IF4A 3F0CA 3BZ6A 1MV3A 2DETA 4CUGA 3KZYA 3RQIA 2QKLB 3KE2A 2M35A 2K57A 5FWCA 1J59A 2JSCA 5E8GA 4UNOA 3A5ZB 3CCET 2E36A 3E6BA 4M3DA 2K4JA 4Y92A 2HZYA 3QO3A 3WTWC 2K5IA 1J3TA 2KLOA 3NEUA 2DM1A 3GUDA 5KYUA 4HG2A 1LOJA 2KIFA 3FRNA 4BACA 2P0WA 4LGWA 2HBPA 3JR9A 1AD5A 1NYGA 1B34A 3HRUA 2ID6A 1BC7C 3GXOA 4GXOA 4RM3A 5BS6A 2EQKA 3VRZA 3BP8A 2V9KA 1VA7A 1B7TA 4XM3A 3V7SA 2MC4A 4UV9A 1H641 2XI9A 3B73A 1Y0NA 3Q0WA 4LK0F 3OMCA 4RTXA 1U0JA 2JVVA 4HCBA 2EBIA 2HOEA 3JAMR 2RHYA 3TEEA 4EMKC 5C0MA 4EGYA 4M78A 5A2QR 1Z0XA 1IGUA 1I3AA 2RN7A 5H6QA 2E1MC 1YJNQ 1LFBA 3HG9A 5J40A 1NEGA 4X34A 2K5CA 3CMAT 2JS0A 2RK2A 5IY5H 1ZYRF 1QVUA 4F55A 4YFNF 2V6EA 2HNIA 3W6KB 2Y9YA 2MOXA 3EAEA 4RAGA 4GY5A 1YITT 1XGOA 3V8KA 2EA4A 1M4ZA 5D4RA 2QQ9A 4HNUA 3PNTA 2ZSHB 1IUFA 1WYXA 3SHWA 1H92A 1QWEA 2M8GX 3K6GA 3RZOJ 3CPWP 1WGSA 4R1HA 4OIRF 3BE3A 3KP5A 2MC3A 2TDXA 1KQ1A 1OV3A 1WDXA 3FKJA 2XMFA 4XQFA 1I07A 4D1QA 1NK3P 2DD5A 2OC6A 4RB3C 3SWNC 3E2UA 2FEZA 2JVGA 1VQOI 4YFKF 5ED4A 5IT9Z 2JM9A 4CZCA 1R1VA 1V55H 2DXBA 3UT1A 3RMSA 3HHHA 5LJ5f 5B66C 3CC7I 3JREA 4A93J 1YJWQ 2RQUA 3GTQJ 3EGUA 4JX5A 1Y1VJ 3GNFB 2L0KA 3CBOA 4DZJA 2ZAEA 2QQBA 4JPBW 5GANh 1PJRA 5GAN2 1I5LA 1NPRA 2K79A 4C8QD 1ZHFA 5HS7A 5EEAA 1Z6RA 3FC3A 2CP7A 3DB4A 3H9NA 1WNLA 4C92B 3MWMA 2COZA 2XAJA 3ZRGA 2Y2ZA 3H0DA 2ZJQF 2ABLA 3K1MA 1O3RA 2JQ7A 3CXCA 1K8AC 1MBGA 1X6GA 1V4RA 1X2KA 1MJAA 2KE9A 1WKMA 3TO9A 2LQWA 2X1EA 3JAME 1YI2Q 3A0HC 3CUQC 3LSIA 1M90U 3L2WA 4B3AA 5A2QE 3S15J 3I4NJ 4FYWB 5H20A 4JRKA 3CQZJ 1U8RA 3TSZA 2CQ7A 3ZPLA 1QHHD 2W24A 4XL9A 3RKXA 3TGNA 4OMYA 1D3BB 5CO7A 4HV5A 3S2WA 2NUTA 3K70C 4LMYA 2E60A 1D1CA 1PNJA 2QXFA 3CC4Q 4G7ZF 1K8AR 4N4HA 1A35A 3GVAA 2ZPBB 2P6SA 1UE9A 1HDPA 4LNPA 2HPMA 3O6BB 3AAFA 4M7AE 3H5RA 2K5LA 3E9FA 5F1JA 3F21A 3JSCA 5EC7A 3QJ6A 1VQMQ 4IRIA 3PVQA 4NUBA 3ZR8X 2EW3A 1OPCA 4P5OA 2EZHA 1D5VA 2GQVA 2H94A 3CXCS 1V54H 3LQQA 5IAYA 1MH4A 2IXSA 1Q7YR 2R7ZJ 3TREA 2COYA 4DBQA 4J9GA 4BD3A 4LITA 1VF9A 2PN6A 4MTDA 4M75F 3CD6A 3CCUI 5TRDA 2BBYA 1AZGB 1ORKA 2JK3A 1T39A 2RHUA 3R61A 2GFAA 1XSXA 2X1DA 5GANd 3WU2C 1YIJT 2L8DA 4OGCA 2GFUA 3LSJA 4E6KG 4CXFA 3LW5E 3QZ5B 2BTTA 2OPTA 3C18A 3F9KA 3WU0A 3CMEQ 4EM0B 1IHVA 3WVDB 1EX4A 2GNCA 2DL3A 3IP4B 2FNPA 1R77A 2V1QA 2XG8D 2C0TA 2J6FA 1SD4A 4PJOB 1AOJA 2P7CB 2QVOA 2LVSA 2CSQA 1ZLKA 2DLLA 1AWXA 1MBHA 3DEEA 3F22A 1NLPC 3SD4A 1X3UA 2PX9A 1FPQA 1Q82R 1CKBA 2BIVA 3KZZA 3VU3C 3JCMe 1D1AA 3O8VA 3TO6A 2FZKB 4MMKA 4C5HA 3HGGA 3OOPA 2B7EA 5E20A 3HSBA 3J80K 3TDZC 5E18F 1IXDA 1UFMA 3KLNA 2HYFA 1K83J 5M5YJ 2K02A 2E12A 3MJXA 4QQDA 3CMMA 1UHCA 1N27A 4FYYB 3CCLT 2Q8KA 2P5KA 3WGHA 4YTLA 4II2A 3DU6A 3RJPA 5KK1A 4BEHB 1PP7U 1Z9ZA 1W0TA 1R22A 2GXAA 2E6ZA 2H6CA 1ARKA 4AIKA 1DQUA 1XCBA 4KUMA 5GADJ 2EFWA 2E3HA 4UB8C 1UG1A 3C7JA 3C4SA 1WIEA 1DJ7B 1TUCA 3H5AA 2BZYA 4OB1B 3MEVA 2B63J 2CV0A 4L0ZB 3LA2A 2YS9A 2CSOA 2KZGA 1OCZH 3DBRB 2ADUA 3KP4A 2M02A 4HSTA 3LYIA 3QP5A 1PP8F 2YU3A 2Z3YA 3R60A 1D3BA 1IXRC 4JZ4A 1KQ9A 2AXTC 2D2WA 3A0BC 4KJZA 4KITB 1X75C 4M78E 4OMFB 4XTUA 1XGNA 3MKZA 1FNNA 1RIOH 1L3LA 2RPNA 3G71A 3CMAQ 1K73C 2DEUA 2UZKA 3QYEA 4Y15A 2RJFA 2M5WA 3RNJA 5DCMB 2KRNA 3JCMc 4DW6A 4J6XA 1YITQ 4LFUA 3I5RA 2A28A 2QA4I 2Q2EB 2DYSH 5CKTA 3VB2A 3BOQA 3OYMA 2DMOA 1NE8A 3M57A 3QYBA 1Q81U 1JJ2P 5GAMf 2DOFA 2X4HA 1GV5A 2ZJRF 2D1XA 2PVDB 1VQ7T 3OS2A 3BCBA 2L3RA 2K7AA 1B72B 2D1VA 2M0MA 4XRSG 5D8LB 2DMPA 1UB9A 2HVSA 3INZA 4FT4A 2RN8A 1E3PA 3G6EI 3OYFA 4CYDA 2XB5A 3GFLA 2P84A 3F8NA 5DTDA 3GTMJ 2G7UA 3J81R 4XU2A 2LOOA 1FWZA 2ZMEB 5FFXA 1QZZA 2OTLI 3MP8A 3ONQA 1PUFA 1P4AA 4LUDA 3O2PE 1J9IA 1JKRC 5FLXR 2HCKA 2RD1A 3EGDB 3HIFA 5GAOp 4BQNA 1XNIA 9ATCB 1MNEA 5IHKA 2HQXA 2HOAA 2Y0SN 2DL7A 2D8HA 3WXMB 4AFQC 2G6FX 2WSEE 4JYKA 1HKQA 1X6BA 4A4GA 2IPOB 2W84A 1SVMA 3CCVI 2Y4XA 4MGRA 2CW8A 1SMTA 1QP2A 2FJ1A 4OIQF 4XTWA 5BMZA 1SG5A 3R6OA 2R5MA 3BDLA 2LY2A 1WH7A 1SRLA 4F17A 3QDRB 1IRGA 2L2OA 1WJEA 4XRMA 1J2XA 3QODA 1G59A 1XS9A 3CF5F 3QWYA 3EG9A 1Z3XA 2WBMA 4BEHA 3H41A 3WODF 2E10A 1ETYA 2H8WA 3WE3A 2LKSA 3TDUC 4A5NA 4J6YA 3G1JA 1FSEA 3ZMUA 2M0OA 1DGRM 5F64A 3CC2T 3HOTA 2QQAA 3OS0A 1HDDC 2E35A 4Q5WA 1QHGA 2V6CA 2BE9B 2KKOA 4BUGA 2UV1A 2EJRA 1QNTA 1T08B 4GCVA 2CP6A 3D7SB 3T0YA 3PUBA 4AD9A 1RI7A 1YIJQ 3BW1A 3BC8A 3SQNA 1C6VX 5GAMe 4DGWB 5GMKe 1F1BB 1UG0A 1VQ8A 1RPWA 2DIQA 2DMNA 1A6QA 2MK5A 2CJJA 4BXUA 3MAJA 4BI4A 2LMDA 2FA5A 1T0JA 2Q2EA 5FLVA 1R4MB 3DBLB 4BDYA 2MABA 4KN7X 2KJCA 1LPQA 2PUKB 3REOA 4IVNA 4BY6C 1KD1U 1UG2A 1TT0A 4L9JA 3JRCA 3NTKA 4HNTA 1OKRA 4ESRA 5CIUA 5JR3A 2H1LA 3FXRA 3GCMA 5GAHJ 1B72A 3DEUA 1U06A 2AZSA 1N8RU 3BR3A 3PL8A 1IUYA 4MZTA 4F7UF 2EYYA 3QG1A 3MCZA 1MNDA 2DI3A 3A8MB 5DY9A 1SVLA 2BE5F 4PCQA 1ZREA 3CCLQ 3QPLA 3CUOA 3SFMA 1G3WA 1AZEA 2ZMEA 1XB4A 5FGMA 2OU2A 2UXNA 4A6DA 5D5UB 3WTZA 4BE0A 2L7FP 3ASOH 4HEA2 2R7SA 5I2SA 1K9MC 4P9UA 3ERMA 5C6SA 5DM6F 5GPCA 3ZMDA 3EGDA 3NMZC 5J1RA 4M9XA 4C92E 5IP9J 3HOZJ 4AFSC 3HM5A 3K70D 2V9VA 2ZJPF 1O3SA 1JBMA 1QLYA 2NOGA 4KGXB 3VS6A 3R0AA 3X25B 5GMKl 2XRLA 2JPBA 5F0CA 2KDZA 3JCUC 1AKHB 3T9NA 2O3FA 3U23A 1QRYA 2KIMA 4FSXA 1OCPA 4B44A 3IKVA 2LYCA 4E7LA 4AT1B 1K9MR 5IHNA 2MPXC 2W85A 3LSGA 4I6ZA 2X98A 2EYXA 4LDUA 4QW2A 3JCMJ 2JW4A 3K4BA 2NYSA 3UA6A 2F6CA 2FX0A 3DTIA 5D5XB 5GAMh 3CCQA 3NTHA 4M3FA 2EYWA 3ULRB 5LJ5h 3FXOA 3JCMb 2E1CA 3CCRI 2QTVA 1AOYA 3Q9VA 2Z9OA 2FEIA 3M3YJ 1VQ7Q 3X24B 3FDYA 1T95A 3CBPA 5HCKA 3V42A 2Y30A 1GVJA 4XOTA 1FMVA 1WJ5A 3I9QA 3MP1A 2HQAA 4BDZA 2X0LA 1X58A 3WHBA 1SVOA 4RG8A 3IUOA 3L2VA 2P5LC 1RAAB 3CBMA 3WU1B 2E5NA 3OL3A 1YE9A 4UB6C 2P4WA 1DU6A 1R7JA 2DVEA 4FL6A 4M7DB 3ROUA 2CWEA 2J6KA 2K9LA 4FT8A 1RI0A 2KSSA 3C1DA 2P0TA 1U1SA 5JLWA 2ME6A 5J8CA 5ILVA 3HFOA 4FT2A 2DPDA 1JB0E 3M4YA 2XDBA 2AZVA 3ZQHA 3AT1B 1R8OB 2XK0A 2MCNA 2JN6A 1YJNA 5CVJA 5GJWB 5A0LA 2IVMA 3EETA 5DS9A 3HFNA 4PJOE 1HYOA 4N4GA 3OIQA 1WPYA 2EJGA 5GAGJ 1C1AA 2H8HA 2HL5C 2LJ0A 4V2SA 2A36A 3GTOJ 3EH2A 1QA6A 5HS9A 2LR8A 1WQ7A 2OCEA 3H92A 4A5MA 1CSKA 4OMZA 1S9HA 1MH3A 1YCSB 4XU3A 4NBQA 1RI9A 2V79A 2NUPB 2V7FA 1MMGA 2RMOA 3OYDA 5IHIA 1S29A 3RSNA 5GAMd 1L0OC 2MBFA 4HLXA 5LJ5d 1I0CA 1YJ9Q 3HRMA 2O9LA 2IS1A 4ZTJA 5FKLA 5IOZA 2XF7A 4P96A 1ZARA 2RDPA 1HSTA 3ABUA 4D7MA 4E4HA 1SEUA 2EVRA 2ROTA 3GTLJ 1YJWA 3G3ZA 2DA5A 5C4JJ 2IGKA 1F9NA 2E1NA 2K2MA 2QASA 4A3KJ 4EMSA 4ZDOA 3CC2Q 1TNTA 4QIWN 2IA0A 3B6CA 3QU3A 4U87A 3JRGA 3EYIA 1KK7A 1TBXA 1BW5A 4IO9F 1LEBA 2NVYJ 1LVKA 4JLGA 2R92J 5M5WJ 1BA5A 5L3CA 5GANg 3J7AF 2HFHA 3OOUA 1YI2A 2RI5A 2JT1A 4XIDA 1Y0UA 1AKHA 2DVJA 2LX9A 1VQKQ 2ZBKA 3RUXA 2WAQA 5CKDA 2ZPHB 3SDZA 1ONVA 2VQCA 2CW0F 3D5LA 1OQKA 1IXCA 3S93A 5HNFA 2GF7A 4M7AG 5CKHA 1K76A 3UDCA 2RO0A 2KBTA 3CC4A 2F5CA 1PWTA 1ETXA 1IW7F 3L2ZA 1NJIU 3W3CA 2FG0A 1J7KA 5JFRA 1SD5A 1WH5A 1U8BA 3H35A 4IQJA 1A5JA 2VJ5A 4UVBA 1MGQA 2O01E 1KSWA 2LQNA 5L3EA 3ZL7C 1BI2A 3I0TA 3JRBA 1YFHA 2BZ8A 4CO8A 4LD9K 2EWNA 4M7DA 2GQQA 2HQRA 2E71A 2WB1A 4RGSA 1XMAA 2DA4A 1O4XA 4B3XA 3S1MJ 3VUBA 2FBHA 1FC3A 4OB2B 4HVWA 4JS4A 3RYRA 2NS7A 1GL5A 1MDMA 2JJ7A 3F8BA 4DEYA 1OU8A 2JN0A 3T5XA 3PQJA 3EUKL 1IRFA 2JMWA 4HF0A 5C3EJ 1JJ2A 4RTWA 1PD0A 2HNHA 2Z2SB 2AKLA 5J47A 2EGEA 4JRQA 3JSPA 1IV8A 3CMEA 2DJIA 1MBFA 3RERA 4KIFA 1XDSA 5H2FC 5L3FA 3H0GJ 4C3IJ 2HR3A 2M45A 2AQFA 3U9GA 4HDVA 2G9WA 2VKDA 1TWCJ 1N25A 1ZGAA 2FXAA 2QK0A 4WCIA 2DO3A 1RC9A 1R4NB 5EEGA 4F04B 1EH8A 1BOAA 3BQYA 3M8FA 2FBKA 2M30A 3TMOA 3VDXA 4IKFA 2FZGB 3W2AA 2LQKA 2RNAA 1K78B 5FU6C 2VXEA 2FVUA 2YRDA 4OMQA 1NTCA 3ZN1A 1VQ9T 1XCVA 4OU0A 1VIFA 2KRCA 2ZKZA 1KU7A 3CCEA 3BLYA 4II3A 4DIQA 4FU6A 4A4HA 2OX7A 2RK1A 4M75B 4BU2A 1JJ2S 2PMZA 4C0DB 4EEFG 1KU9A 3K2AA 4GYIA 4A4KA 5CVVA 5L23A 5IPAA 2ROLA 4M78G 5CVUA 1SFOJ 3FXKA 5GPAA 2R7RA 3RDVA 5CK9A 2R4GA 1ULYA 1KU2A 1WWXA 3B02A 3KX2A 3U2RA 1YO5C 1GCQA 5EF6A 2QZ8A 1U5SA 2XGDA 2KDSA 3M0TA 4BI3A 4XORA 1TWGJ 2WV1A 1YX3A 3BR2A 5D5VB 4M77C 4R55A 2CV1A 2MWOA 5DDGA 4DEXA 2LP0A 3CMAA 2X4WA 2QAZA 3EG1A 1M90R 2YLBA 1PCXA 3VOEA 2Y0MA 1KC8C 1YITA 2VUBA 1UMQA 1U3EM 4RTYA 3LNQA 4J9IA 3FX3A 1P2FA 2CQNA 2MW8A 2A37A 4FHTA 2DW4A 2YPRA 2A3SA 4Y3OA 1VQNI 1S3JA 4AG2C 5LJ3d 4KYWA 3MZHA 4ATOA 4GBQA 2IS6A 1LFUP 4L9NA 2RNJA 1Z21A 4Y4RA 2CUBA 3OSVA 1DP7P 4J9CA 3FIWA 1STZA 4XLPF 1KC8R 4LLLA 1U5TA 2JTEA 1SD7A 2X6OA 1FIAA 1SANA 3EDPA 3GYHX 5K7HA 3SZTA 2AT1B 2L01A 4C3JJ 4LLGF 4KFCA 4KT0E 3I54A 1EKEA 5D8KB 2JWTA 2CH0A 2VKEA 2UXXA 4BJ5C 4BHCA 3OY9A 4MTEA 2RQQA 2R3SA 3J7ZI 1W4SA 1VQ6I 4OWRB 4S05A 1FP2A 1IN7A 1ZR4A 1RNLA 3HTSB 1WHLA 1VQOT 1KFZA 3MN2A 3TQ7P 2QBYB 1X4PA 4BNCA 2TRTA 1Z67A 4CC2A 2AXLA 5EG0A 1DUXC 1R5ID 1FOKA 1RL2A 2LC2A 1T2KA 4MDWA 2OQGA 2ZCFB 2VKVA 3R6SA 4E7IA 3C0CA 2IG0A 5FW9A 4BBRJ 4A3FJ 2O61A 2HZDA 3JSOA 1FYNA 2DA2A 1G4DA 3I56I 1K78A 2KGTA 1MJ9A 1MBKA 1RR8C 2DOAA 4A0ZA 4FCYA 1GHCA 3WHCA 4PJ0C 4AUXA 5B5EC 4HLYA 1SSFA 1MGTA 2LP5A 4YELA 1UUEA 1M1KC 5CQGA 2MF2A 1ABOA 2M7AA 2RQTA 4E6RA 1Q7YU 3E1SA 5AT1B 3J81K 2DCEA 4Q47A 3AKZA 2EGAA 1D5YA 3P8DA 2DTRA 1WGXA 3QJYA 4M77E 1QZEA 4M73A 1B9MA 4M74A 5F0HA 4F91B 3GZ6A 2YUQA 5L8RE 1ZSZC 1OULA 1BOBA 3KYDB 4G6QA 5KNLA 5FLXK 1Y56A 4OMNA 2ETHA 4P9FA 4L5JA 2DFUA 2PU9B 2CKKA 2X4XA 1M1KR 5IXFA 2K4BA 2XASA 4EJTA 2O03A 1JJ6C 1Z9QA 2D0NA 2ESWA 4JRPA 3ASNH 3CTAA 2EA2A 3X20B 4CDGA 5M5XJ 1YIJA 2W0ZA 1QVGP 2Z0WA 4LG0B 3IRQA 2YRVA 4QTRA 1D0ZA 5KCHA 1OCCH 1MUZA 5KYWA 2BGCA 1W5TA 1UB4A 4L9TA 4HSRA 2R7UA 1KQ2A 2GTJA 3TKYA 3J7YJ 4HBLA 2CUFA 2RV8A 2DEQA 4BY7J 1UGRB 4AU7A 2OAUA 4EDUA 4ESFA 2X9HA 1GDTA 3CCUT 2DAOA 4XMYA 2CFXA 5M3FJ 2H1KA 3M4GA 4FYXB 2C06A 2OTJI 2STWA 1J5YA 2BY0A 3CJTB 2KEAA 4CA0A 2MA3A 1K6OA 2FOKA 1B34B 1Q86U 2F4IA 3P8HA 2V1DA 4GDFA 1VQ9Q 2EZKA 4HAMA 3E6DA 2Q0OA 3FMSA 3IH4A 4FETA 3RKQA 4C92G 2FE3A 4CHUA 1P6RA 3UPUA 2W10A 3CCLA 3AG3H 3I53A 1X2NA 2LY9A 4XLEA 5GTHC 5LHGA 1EV7A 1FYMA 3EHQA 3HB9A 1N9SA 2DLPA 3Q9SA 4N4OB 3UF4A 5FROA 2X1CA 1TU0B 2KQWA 3DEWA 3VV0A 1SSHA 1KZHA 3PIOA 1W2BP 5F08A 2GXGA 1SFUA 4FIBA 4A3MJ 4IHTA 4HX4A 4RDUA 3D1NI 1GFCA 1RAHB 1SF9A 5K7FA 1KONA 1MZBA 3SFZA 2QBYA 1HD3A 2GLOA 1M27C 2EYQA 5LD2C 1G3TA 2DA9A 4LD6A 2RF0A 2K7LA 2COWA 2YUSA 1I81A 2K3BA 2KP6A 1TSFA 2E7WA 4IIOA 2HOSA 1P9QC 2WB1N 1VQLI 3K4JA 5JHFA 2A6TA 2ZC2A 1H0MA 1AU7A 2FB7A 1VQ5A 3HOVJ 2EIFA 3EG0A 5FKNA 2P5VA 3WVEB 3PMIA 3OBYA 1JXMA 4F7UB 2XAUA 2DK8A 3HOXJ 3ZBDA 4EMGA 2RI3A 3CPFA 1W7PB 4B1RA 4C30A 2F5TX 5IYCJ 5GAMg 2Y48A 1XC5A 2EFPA 3HYIA 5J4VA 1T3LA 4FX0A 4EMKA 5LJ5g 4M7DF 1BI0A 1BL0A 2A61A 3PO3J 3WGGA 5J3LA 1H89C 1UHSA 1LUJB 2DJZA 2JMAA 3M54A 4LDWA 1G83A 2B8AA 3OA6A 1O7FA 1BR4A 2RJEA 5LL6S 2X6YA 4S0HB 3UR3C 1T38A 3C12A 1MJBA 4D9JA 2MFZA 1PVEA 1HW1A 1WHJA 1NEBA 2YWWA 5GMKj 5GAMj 2EV5A 1E17A 4PJOG 4LG0A 1MBEA 4BQAA 3HZJA 1QWFA 3VRYA 4RCBA 4RA2A 2DL4A 1T98A 4HYEA 3SZGA 2KMTA 5GANe 1VQOQ 1K4US 3G6ET 5GAN4 2DERA 2KT0A 2PJRA 3H3ZA 3CC7Q 1MSEC 2VIXA 2WV0A 5HODA 2V1NA 1N8RC 2JTMA 1JKQC 2EILH 2CT4A 2F5DA 2BY2A 4MEYF 4DQ2A 4KH1B 4XTZA 1EA3A 3HHTB 2OTLT 3WTVC 2JPCA 3E6MA 2RHIA 5I11A 2EB7A 2X3WD 1GUUA 2VGMA 2IGMA 4AWXB 1WSUA 1JTXA 1SHFA 1UHMA 3RZDJ 5IP6A 1XTDA 5KE3A 2LT4A 4W1UA 1Y71A 4IUTA 3QUIA 1I27A 3GO5A 1YJ9A 4IHWA 2EK5A 4BS9A 1HW2A 1Z77A 1R1UA 3TQNA 1TLHB 4EM2A 3L1AA 1KYZA 4E2FB 4C8QF 1N8RR 4WXCA 2HSEB 4M75E 4M7AC 2HGCA 1JXOA 4QQ6A 3PTAA 3CCVT 3CC2A 3VYHB 1K4TA 2BKDN 3VYGA 3LSHA 2WWYA 1S72I 1PYVA 4QQGA 5ECAA 5CAIA 2QKMB 2KRFA 2NVXJ 1I1GA 4XN3A 5DCFA 1DPUA 2SRCA 3RYPA 3VS1A 2X4YA 4AC0A 3M55A 4IUUA 3QAHA 1Z05A 4ME7A 1VQKA 3OIPA 2RAEA 1R49A 2D5VA 4ANJA 3LGLA 1FOWA 4PDKA 5HLIA 1BYMA 3FK6A 1BIAA 1V5GA 3LH0A 4GYGA 3OIOA 4ZTFA 1R5GA 3FXJA 3KYLA 4HF2A 4F7UA 3H9GA 2CS7A 4IOCF 3MEXA 2CH4A 2XGEA 2LCCA 3CZ6A 5K1YA 1W7PA 2D0QB 2KXDA 1SPKA 5I2MA 3CCUQ 1GBRA 2OF7A 5DD8A 2HOTA 3DTEA 2IJLA 5IT9R 1YBYA 2KYMA 2XHCA 2BY3A 2NYXA 1TWAJ 1LJ9A 5J39A 4ON0A 4BE2A 2VGNA 3CESA 1JKPC 4ZGEB 2VJIA 2EJ9A 2EYZA 2M16A 1EZZB 2KL4A 1RKWA 4F52A 2NVQJ 2LCLA 3C95A 2QI2A 1YHQI 3HBLA 2KROA 2DN0A 3OB9A 2XAHA 2ZZDA 3EFSA 2LBFB 1M2OA 2MMPA 3P7NA 3M9AA 3KP2A 1BN5A 2L9SA 4MEXF 1TP4A 2JTFA 3ZQGA 5FJ8J 2V8IA 3FDRA 1TZLA 4IOAF 3SJMA 1KGSA 2COMA 1JXSA 2Y4YA 1VZ0A 1T33A 1ETKA 1HOMA 2KRHA 4YEJA 1HBXG 4XONA 4C9YA 4DBRA 2MYSA 1CF7B 1OEBA 2E70A 3UA7A 4XICA 4FISA 3RBBB 1I5ZA 5AONA 2BVMA 5HDNA 5IH2A 1WFXA 2OJED 2VXDA 2QM3A 3AG2H 1G3SA 4DBFA 3TU4K 2UWMA 1BI3A 4O5VA 2M1BA 4BHPA 4I2OA 4D8DA 5HK3A 3WTUC 4M78C 2COBA 2A68F 2QTXA 4PL6A 3EH1A 3F6VA 3OW2P 2CUZA 3QBYA 1IN8A 5E3NA 4V2FA 3CLOA 3R0JA 3QP6A 4EJWA 1YJNI 4E47A 1WZ2A 1OCRH 4X6AJ 4BXXJ 4OF1A 2YUNA 5IT9E 4OIPF 2C0OA 2R7DA 2DYRH 2D45A 3OYYA 1Q82C 1PUFB 4HXJA 4ENNA 1WX6A 1D8KA 3M7GA 2LNBA 3QSUA 1I5OB 2W82A 2ZXHA 2BXYA 4PJLA 2J5OA 1QZYA 1ZAOA 4UV8A 4LLNA 2CZ6B 1QVFP 2DBBA 4B9WA 5FKKA 2QA4Q 1U9OA 1WFWA 2FPFA 3CCRT 3VUZA 4IHYA 3GTGJ 1X69A 1LFPA 5HKCA 1IDYA 3RPQA 4CICA 4IXAA 4V2GA 2QDYB 2HSPA 1XN7A 5GTIC 4UUTA 2IIMA 2KIQA 2R7QA 2JA7J 2QGFB 3G6EQ 1NJIC 4M71A 2BY1A 2EJFA 2QQRA 5C4XJ 5FB2A 1Y8QB 3EG9B 1D09B 1RUOA 3FWEA 5E1XA 2ZPEB 2KMUA 4RTTA 4DOWA 4F14A 3GZNB 2JS2A 1T0FA 2F2VA 2ZFWA 2DDAA 3JB9G 2OTLQ 3ZGKA 4PKCC 2KRSA 4F7ZA 4DJAA 5D5WB 4KRTA 2VC0A 3E5UA 1OQYA 4N0AC 3ZQ7A 5E8IA 4RB2C 2STTA 1FEXA 2MI6A 4KH0B 3GFMA 1TW2A 1YTYA 1NJIR 1UDLA 3G4ST 1K4SA 1QVGA 2L89A 1HXDA 2LBFA 1UGPB 1Y7XA 4AG1C 1LNXA 2J5PA 1X1BA 3S2HJ 1TQIA 2O88A 3NFCA 4LN2A 1BM9A 3PIOF 2EGCA 2BV6A 4AMCA 1JUPA 1VYVA 3A1PA 3CCVQ 3A52A 1GLNA 3S3MA 4KT6A 3LSKA 4KMUX 3RPUA 2J7IA 3DQVC 4J83A 4EMHA 3PM1A 4UC4A 1H9GA 1CF7A 4D6WA 3ECHA 2DBMA 4A3IJ 3A98A 3DKXA 4RB0A 2I8DA 2FHDA 3FJPA 3RKWA 3TL4X 3KPHA 1W1FA 5HLHA 4CCLA 5LJ3f 2EV6A 2EAYA 3I5UA 4XK4A 4CRIA 5DLOA 2E2JJ 2CQQA 7AT1B 1IZ6A 3OMGA 1YX5A 2H6BA 1QPMA 1ERDA 2JZ2A 1S6LA 2CYYA 2M4KA 4PFOA 4FASD 1VTNC 3GTPJ 4M77G 4F7UE 1QVGS 4ENKA 4M9SA 4J5YA 4LG3A 1H88C 1R58A 1YNZA 1MMAA 3OSGA 3E9GA 3BTJA 1P7IA 2HQ5A 2Y75A 2K6DA 1YFNA 1FYLA 1I39A 1M1EB 3F23A 1E0EA 3GBGA 1HSJA 4P55A 1OFCX 3H0IA 4AVZA 2Q1ZB 1AVZC 1NYFA 2MD0A 3E97A 4TV7A 4J6WA 1USTA 5LGUA 1DPRA 3OMYA 1SHGA 1WI3A 3K10A 1IC8A 4KT5C 3I9V2 1DU0A 4BAYA 3HKZA 2NNYA 3K9TA 4KIGA 2LNHB 2VXFA 5F04A 4M3EA 4OP0A 1LDDA 2XSJC 4MLOA 4KN4X 3IKTA 2DXCA 3REAB 1YQAA 2DO7A 1WI9A 1HC8A 5EGOB 2Y31A 2J6OA 1U6GA 2F4OB 2XDPA 3ISPA 4BI8B 2L9NA 4C92C 3PFIA 3TVTA 1E7OA 3I55T 1W36C 2R7WA 1V76A 2QLZA 4UXNA 1R71A 2NNNA 2VYTA 3CCSI 4IUQA 4A2UA 3H3VK 1FZPB 3BWGA 2L4AA 3BR1A 1HSQA 2F2WA 3DV8A 3HL2A 5CLSA 4Z89A 4M7AD 1RR7A 4ESJA 2PFBA 3IH2A 2IBDA 1M8MA 1QPIA 3D5SC 2FQ3A 1FT9A 2MZ4A 1JUMA 2DU9A 1AWOA 2W1OA 2BZXA 1X43A 4JK1X 2YX4A 3J7AY 1VYTA 1RADB 4BJTA 3OQ5A 4G9YA 2QSFX 2K3FA 5B3SH 1VQ9A 5FKOA 4O3MA 2LQ8A 4FX4A 1VIEA 2KY9A 2BYVE 5KYYB 5ILUA 2JSPA 4PFPA 1ZRDA 1G3YA 5HLGA 5LJ5e 1B3QA 3H1CA 1IRXA 3M58A 1OZ3A 2ZPFB 1BIBA 1PRMC 2E64A 2HAXA 3CO7C 1WCMJ 1T6SA 1ZGJA 4PK4A 1WI7A 2JUFA 3QYFA 3WE2A 1QCFA 2O4XB 5FU7B 3CCRQ 2CZ1B 2WSCE 4FTHA 4ZYDA 1RABB 2CP3A 3U1KA 4DNCA 1WHHA 4YIIA 2EV0A 3M59A 1ZG1A 1WHMA 2A6EF 1U2WA 1XD7A 2HDDA 3HL8A 3PIPA 1I1JA 2M2EA 4PJOC 2A5YB 1WJRA 2HQEA 5BPDA 3AL0B 5D6WA 2CDTA 1ZLMA 2DQLA 5CVRA 2GWRA 2DODA 3DPLC 1SKUB 2DL5A 4LJZF 3DKWA 2HVQA 5TGTA 1HCRA 2V1RA 3SDGA 2HI3A 2FSWA 5E1ZB 3TP3A 1QBJA 4GLMA 3CPWA 1E2XA 1R00A 5D6EA 3IHUA 2DFEA 3OYIA 1B4AA 1G2HA 2W25A 2QDLA 4JX6A 4R56A 4XTVA 4HQMA 1RUWA 3QWXX 1WZOA 3X28B 3F8CA 5LEKA 3H9JA 4JDSA 4EIKA 1T56A 2FF4A 1KQSP 5E1WA 4N4NB 4VUBA 3AG4H 2M87A 2BHYA 2WA0A 5EGOA 1VQ4I 4LIUA 3X26B 2FNAA 2GQIA 1ACIA 1VQNT 4M78D 3ZOBA 4JQFA 4ZDLA 1MKMA 1FOYA 2IAIA 1NZ9A 1JRIA 1O75A 3LA3A 2LT1A 4KBMB 1IO2A 1OMIA 3KLOA 4D7NA 1A04A 1YWOA 3MP6A 1SMYF 2LC4A 2GBYA 1VQOA 2ED0A 4J9HA 1Z3YA 2R5ZA 3QOPA 2L5QA 2DT7B 2DD4A 1SRMA 4NS5A 4HT9A 3ULQB 5GAOr 3M0UA 3CC7A 3I35A 3RKYA 1LE8A 3L2QA 2P0QA 3PQKA 3CPWS 2YSRA 2F69A 4ZH4F 3W2VA 5EG2A 3VS4A 4EM1A 3LFUA 2AHQA 2XGXA 4M75G 4AIJA 2DA1A 4X0GA 1VQ6T 2JRMA 4G12A 3E5XA 5KYYA 2R7FA 4D8KA 4ESBA 4OMOA 4I98B 4RKUE 1MDMB 2HMAA 3A2KA 1ZTRA 2PG4A 1IGNA 2R93J 2JM8A 1GXIE 3G73A 1W5SA 2VBXA 4B47A 3DBHB 4XLFA 5KVRA 2YT6A 3S1QJ 3TW6A 3LH5A 1HW5A 5CQXA 3GOXA 3G4SI 3DLAA 3CCMI 2V8JA 4CC7A 3WG9A 5GAN6 2QEXI 2O4XA 3I56T 3PJRA 2PQ8A 4B43A 1ABQA 1JHHA 2EPFA 3I58A 1W4MA 3D5RC 4Z8AA 2QYZA 2HU9A 2ATCB 1BCMA 2X35A 2ZMEC 1VQPI 1O3TA 3CMYA 2KT8A 3OL4A 3CCJI 1T3SA 1K8AU 2W57A 3I4PA 3LA7A 1JGGA 4WF2A 1LNWA 3SEMA 4M3BA 4BGDA 3D0SA 3VPRA 1G5VA 2QGUA 2M0CA 3C3WA 4A63B 3MVPA 2G3RA 2K5FA 1REPC 3KXTA 1R0CB 4LXCA 3HUGA 1C0WA 1LPLA 3LFKA 1YS7A 3CP2A 4PLIA 2QCOA 3VS2A 4C3HJ 1N78A 3E19A 4A3JJ 2VLAA 2JUGA 3JAMK 3LWIA 4FW2A 2RVCA 3K1PA 2RQWA 3CCUA 1ZLJA 1X3ZB 4RM2A 3FKIJ 2HDWA 3FMRA 5A2QK 2AHJB 2WACA 4C8QB 2DNUA 2LZ6B 1GXQA 2CW7A 2DRMA 1RESA 2FOWA 4M4ZA 1M1GA 5LJ3e 2XV4S 1VQ5I 2E5KA 1WXTA 1W5CC 3B6AA 2EFQA 3REBB 3IV5A 1I6XA 4ZN1A 1RAEB 2NOJB 4J9DA 1MW7A 3K0LA 3S2DJ 1K0SA 3M07A 4WK8F 5GAOl 3IWZA 4PLLA 4XKVA 4DYCA 5GANj 3DTKA 2OTJT 2PMHA 2DILA 4FE4A 5JHUA 1JUSA 1FLIA 2QA4T 5F27A 2P0PA 4EGZA 4IX7A 1PKTA 2M7BA 4HV6A 1RAFB 4OAZA 2EIJH 5LEJA 1UJ0A 2V1XA 2ZJ2A 2D8JA 1HA8A 2YDLA 2YU9J 2IPQX 1M2VB 3EUHA 1VQMA 3I55I 1EIFA 2PBIA 4RAFA 5DV5A 5FFZA 2KK4A 2XICA 2IVWA 3VS0A 4E7KA 1R6RA 4J9BA 3P8BB 5HLTA 1JEGA 3F72A 4MHGA 1S8NA 5DLQE 1XGSA 1U5TB 5ERIA 2L3DA 4BKXA 2ECBA 3L2RA 2L7KA 3GW2A 2E19A 1PM3A 4J01A 2J05A 4OMLA 1E3HA 2MG4A 3BTIA 1K9AA 2L2PA 3PFYA 1S7AA 4NQWB 4CCNA 4EATA 3VS5A 1WA7A 2YXYA 3HOYJ 4UUVA 4MMLA 4C92D 4A3EJ 1W36D 2EFIA 4CCKA 1VQLT 4KUDK 4RBOA 3ABMH 3W6VA 3LLRA 1U78A 3CDIA 3FBIB 1G6NA 1YW8A 3ZMSA 2VJJA 1JI8A 3W2WA 1OISA 2XUBA 1MSFC 3A8HB 4Q5SF 2QA4A 3DWLE 5EG0B 1W0UA 1M9SA 2YSQA 1IO6A 3EFOA 6PAXA 5LJ3h 1VQNQ 3RI4A 2Z16A 2RH2A 2KDOA 1MMSA 4AYBA 2E3IA 2HS5A 2FL7A 1ETQA 4TVRA 1F36A 3F6OA 1YW9A 2DXUA 4U7BA 3IAM2 3Q0UA 3HDDA 3G6EA 2KHMA 4MZMA 5L3GA 1FXXA 5HK0A 1K73U 5ICEA 4B4CA 5HDGA 3J80Z 3TEDA 2FQ4A 2VV5A 2DA3A 2MH2A 1NBEB 5DM7R 2OTLA 3L42A 4C8QA 4A3BJ 3FB9A 2DMQA 1IN5A 1F1ZA 2ZXJA 1M90C 2P6TA 3QKJA 3S8PA 1QW1A 2KQRA 1VQ6Q 3K1NA 1ZBJA 2GGRA 3QPHA 1WVRA 1OPKA 1JHFA 2X6XA 2DJQA 3S32A 4FSSA 4WXDA 2HQNA 2VE8A 1A6IA 2KFDA 1F5TA 1QKXA 1HKTA 3ME9A 4EJVA 3MEWA 4JS5A 1FBUA 2JT4A 3MHXA 2ZPIB 4BE1A 3M0SA 4O6JA 3JRFA 3CCVA 2LRDA 4M6VA 3I71A 4ORZA 2VL8A 4L9VA 2BE7D 1ZG5A 1YN8A 3I56Q 4EV0A 4A3LJ 3ML6A 5GAN8 5KYWB 2XAQA 3QPSA 3UKGA 1M3BA 2XD0A 4M7DC 1ZA1B 1V29B 3A8GB 2HL3A 4PJOD 3KBGA 3LWHA 3G2BA 2VC8A 4HNVA 3M56A 3T8TA 3K2ZA 4HVVA 2HPIA 5K5RA 1M2VA 5HS8A 2BW3A 3GMEA 1SFEA 3K4KA 1LQ1A 2OZUA 1TH7A 1Y0MA 3FF5A 5DUIA 2O8KA 1GBQA 5CKEA 2L02A 2L7MP 3V4GA 4Z88A 3PIPF 4CZZA 3LWFA 2W48A 3CXCP 3ZFJA 5DD4A 1ZSZA 2OQRA 1QVFS 2Z5UA 4NHJA 1ETOA 4LOCA 1UECA 4HCZA 1D1BA 4LK1F 3QZ9B 2LSOA 3L9FA 1S72T 1QQJA 1Y07A 4ENMA 4NB5A 4NQWA 3HTRA 3HXLA 1ODDA 1N6AA 2E6NA 1OCTC 2DX1A 4I76A 2ZB9A 1ZBXA 3J80E 1TTHB 4CC4B 2CFOA 1PUEE 4XTXA 4BL0B 3OYBA 1B9NA 3VS3A 1UAAA 3ZQFA 3SZPA 3VYSB 2DZCA 4BH9A 2J06A 2DFFA 1Z9CA 3CD6I 1UJYA 2HQHA 1Y8RB 5J26A 3RQ4A 1T8IA 3V7RA 4LDYA 3I59A 4CH7A 3KIOA 3IWFA 3M1CA 1AWJA 1OX8A 5BNGA 1S7OA 2JZYA 2JTVA 4G6DA 2HXOA 3R6NA 2OTJQ 1FBSA 4UY8I 2A08A 5CKBA 4BB7A 4JZ3A 3HSEA 1V1CA 1YWPA 3QYHB 3A1YA 5E3OA 4NL2A 2QQ8A 2ESHA 2TCTA 4GO1A 3CO6C 4OGEA 1YHQT 3K4NA 1QVTA 2CYZB 3GNGA 4W97A 3NRVA 3M4OJ 1XX5A 4BXFA 1FOXA 1PHTA 4EMKB 3LSPA 1OYWA 1E6HA 4M7DE 2Z1DA 1TC3C 5TJJA 2NVUB 2K3XA 5HOOA 4EVIA 4F16A 1YI2T 2ZSIB 2IGNA 5DEQA 3UWNA 4BBSJ 3LSRA 2VVKA 1USSA 5GAN3 3TP0A 3V7CA 3IL2A 1NPPA 1J09A 3DLMA 4IHSA 3X2QH 4IHVA 2EIKH 1NK2P 3FXUA 2HDAA 1LEAA 1OR7A 1AHDP 2E41A 1SAXA 2KXCA 1Q81C 1VQLQ 5J4YA 3WTYC 3GZ5A 3KP3A 4ENJA 1K9MU 2GOMA 1BW6A 4JOMA 4ZZDA 3SWNB 1YJNT 3IC7A 3MZ8A 4U7DA 2PJRB 4ZGDB 3E7LA 2QYOA 1K1ZA 3P9IA 2MLKA 2F2XA 1JO8A 2K86A 3IRRA 3MKLA 2NRAC 3JCMV 3W6JB 5KAFC 3G71I 3OYJA 3DCFA 1GVDA 1BR1A 1IRZA 2EFNA 1OJLA 4FQGA 3E3VA 1Q81R 5ICFA 1I3QJ 4OVAA 4MDXA 2ZFUA 2LTPA 4IJAA 2PJPA 5B1BH 2WAQN 1YIOA 3NWSA 4LE9A 3RTRA 1RAGB 5CVIA 4RGXA 2M34A 2ZNYA 4YIRX 2LDUA 3CUQB 2B9SA 1RRJA 3BDUA 2B86A 4C8QE 1IXSB 2F5EA 3GWZA 3FIFA 4OMPA 3ZQLA 1XG1A 3BCAA 1NHAA 4XKCA 1HLVA 3VWBA 3BTLA 4ZYEA 5ILSA 1O57A 1NH3A 2FRYA 2GTOA 5GMKm 4A12A 1Y1WJ 4X9DA 5KAIC 4YIFA 3GTKJ 2HD0A 2LJ3A 3JTGA 4LIVA 3K4CA 4HVUA 2QF7A 3JCMf 4WTOB 1B1BA 4M75C 4C0DC 2K3YA 4G7OF 4C5IA 1U3OA 2WAEA 2JA8J 4KUIA 1XSVA 4HX8A 5L3BA 3M5AA 1WJAA 4Y52J 3DP7A 2P4TA 2RQVA 2YHTA 5E17F 1N5ZA 4PFZA 3P5JA 3BT9A 4E7SA 1XMXA 3T1BA 4FM4B 3TOBA 4QWQA 2FO0A 4N9HA 5HY6A 3F70A 3CDHA 4JUVA 2ECCA 1VQ7A 2DTZA 2BXZA 2LNVA 4M7AA 4J19A 2DXIA 2VUMJ 1GT0C 3L09A 5D6FA 3GFJA 5FD5A 3ASKA 1FYKA 2PVOB 1QCNA 3QHSA 3VODA 3BJAA 3BY7A 1VNDA 2ZXIA 4MIMA 2IRFG 3HP9A 3N5BB 3JB9D 1S72Q 3BFMA 1BJAA 4XSZF 4A69C 3LX7A 2EH3A 1CGPA 5LJ5j 2Z33A 4NNJA 1J75A 2K9NA 2NLUA 5D7UA 4RLFA 2LTOA 4AYBN 4RMNA 3ER0A 3FM3A 1Y6IA 1B07A 5L3DA 4ZGJB 5J6XA 3K4MA 1KD1C 2X4JA 3SWNA 2OD5A 3JV3A 3SEQA 3KEOA 2OBPA 4RUGA 1OCOH 2FMYA 2HKOA 1X1DA 2NXNB 2VE9A 3S3NA 4J9EA 4RMOA 2RJDA 2PMZN 5TISC 2EFOA 2LK2A 4HF1A 2IW5A 2VKNA 3E5QA 1AA7A 4UVAA 1VQ8I 1X19A 4X1VA 3OYCA 5EYRA 2ELHA 1ZELA 3FMQA 2YX7A 3HRSA 5CYVA 3FHZA 2WAFA 4ZDPA 1KD1R 1ZR2A 2E2IJ 5F1RA 3CLQA 2A7YA 2CQXA 2HWVA 2XKOC 3LSMA 3VS7A 2LKPA 1YHQQ 2XIGA 1ZSGA 3L1PA 4PGHA 3RR6A 3CUQA 3JRIA 1SD6A 2IEKA 2JA2A 3MKWB 1B8IA 4CSWA 3A8LB 1Q1HA 2V8KA 2AKKA 4J7FA 5D6XA 4M77D 2Y0SA 2W7NA 4JJCA 4A0XA 3L2UA 2P7VB 2RQPA 5CJ9A 4J9FA 3DLLA 4LB5A 1NG2A 4M6YA 2OZ6A 1IREB 3SHFA 3GX4X 2OAZA 3AFHA 4M7DD 3JAMZ 2GCXA 1M30A 2M0YA 3QYGB 3G7ZA 3CCST 3R4KA 2L54A 4FE7A 5A2QZ 3KETA 1WHKA 3BPVA 2IS2A 1HJDA 1ZKGA 4IUPA 3S14J 3GPLA 4QLCU 3IH3A 3CCYA 1I1SA 3BR6A 2DMUA 3MEUA 5E79C 2RB6A 2NWMA 1ZQ1A 1FMWA 3VYRB 4HW0A 3URGA 2DF6A 2KZVA 2L9RA 2V9PA 4I7HA 2E65A 5EEHA 2BZTA 4IEJA 3HOUJ 3PFSA 1JTYA 3HOSA 3P9KA 3META 4RCCA 2HKXA 4AIHA 3N05A 3PNYA 1LKXA 3ELKA 3CCQI 1BB9A 1WRJA 1X2MA 4ZYGA 3JRZA 3SEZA 2O7OA 1K7AA 4CYCB 5KHDA 1V5FA 1KA8A 3ZXSA 2HBWA 4MFDA 1WJSA 4I99C 3ZMTA 2R7TA 2ISZA 3KFWX 1TNSA 2AO9A 4QSHA 2LF8A 5CPRB 4XQ3A 4K2EA 2O2OA 2RHXA 3LOCA 1IJWC 1ITYA 3Q5FA 3EYYA 2O5RA 5IYBJ 2QQSA 4HDUA 1I50J 2LFBA 4LD5A 2L3QA 1KQ0A 1BK2A 3SXYA 1ON1A 1R23A 3I64A 5EDNA 2PTKA 1KQ8A 1BKBA 4UHTA 2HZTA 4P1WA 1VQNA 2FPDA 1MV0B 2EBPA 4RGRA 1O9SA 1ZG3A 1OX9A 2JXBA 3G1MA 2IT0A 2Y69H 2Y90A 4GGGA 2DIGA 3A01B 4N0AA 4AM3A 5LJ3g 3TBIA 4PSWA 4Z02A 2KT1A 4BQQA 1WXUA 3QXEB 4NOYA 4RTZA 2FBIA 5I22A 3H6ZA 5FRMA 3NARA 3CEYA 5J8FA 3PT9A 2VBWA 1KIKA 3FISA 4KGZB 3K69A 3J7AO 5LHIA 2OV7A 1XSDA 4IRGA 1G2BA 2AIRB 1VQ4T 2GA2A 1H9TA 2CO5A 1LVAA 2CZ7B 2FRWA 2O9SA 1YLFA 4BUPA 1KC8U 1ETWA 2L7ZA 1EFNA 4G8XA 5LJ3j 2L3PA 3M53A 4IL6C 4KA4A 3DPUA 2QG9B 3JB9I 3OS1A 1XTAA 1VQ6A 2OUMA 1VI0A 2RC4A 2E5ZA 1HF0A 2E4HA 1YJWI 1KHCA 4KGVB 4BY6B 2MLGA 2CMPA 2QENA 2EKHA 3OYLA 1TT5B 2H3EB 2MIOA 3KFVA 1ENHA 1LDKB 1MNMC 3GF5A 4U88A 1BU1A 1YRNB 3HJEA 1OU9A 3BTCA 1OLTA 1B59A 5E3MA 2K9GA 4IUVA 2M3AA 3THKA 3I56A 1Y57A 1ON2A 2MD5A 2X48A 4CC3A 1G8XA 1MMDA 2HTJA 3LL7A 5LFAA 1YI2I 5CKFA 5IXBA 2KYBA 4WXHA 2QSGX 5IP7J 5CQYA 4J7IA 4V19K 2MVTA 1HK9A 4XAXB 4XBFA 2WC2A 2E2HJ 2VT3A 4C5EA 2H8RA 1FTZA 4HZFA 1UGQB 4A4EA 2K4YA 2F4MB 4EPCA 6AT1B 1R5HA 2YR2A 2SEMA 1TUGB 3M9QA 8ATCB 2R7VA 3JB9H 3CCMT 3HC7A 4CYCA 3FLGA 2JVHA 1I6HJ 3CC4I 2H09A 1H8KA 1UGSB 2XIDA 3TSWA 4XK8E 2QEXT 4HOBA 4H0EA 5GAOm 5IT3A 3MZYA 3RCOA 1PSFA 2RHZA 1VQPT 1JQQA 3KUFA 4ZN3A 4M75D 3CCJT 1LDJA 1VQMI 3MD2A 3OR1C 3HHGA 3JW4A 4X1EA 1M1KU 2FYKA 4RG2A 3K7AJ 2O6GE 2V4JC 1PG5B 3U1DA 2L0AA 3C94A 1UHWA 3V8LA 1TL8A 1AT1B 4C92A 3CCSQ 1QVPA 3TOAA 3HTUA 4CCJA 1SC7A 2DA6A 3DPTA 2JUCA 1UFFA 2RQRA 3PSFA 4PSXA 5CQEA 1K6YA 1DGWY 4QVCA 1MBJA 4LB6B 2IS4A 4JLIA 2OTJA 4DBHA 2VQHA 3GIBA 1PD1A 4F92B 4G94A 3TW7A 3A01A 2VPLA 3JCMW 2YUPA 5A0DA 3CMEI 1W2BA 1S7EA 2IGOA 2GXBA 3M8JA 4ZYAA 3EUAA 2MWPA 2ZGWA 2EPDA 3MEAA 2XDDA 2CQKA 3S3OA 1A36A 1VUBA 1VQ5T 4M7DG 1MIJA 1SAUA 2VC1A 1RLPC 2KRMA 2XC7A 2BHZA 2CS3A 4I0AA 1TS9A 1IF1A 4C2TA 4AFUC 2HKNA 2EQJA 2KVQG 1IG7A 2DRKA 1P92A 3U21A 5ICGA 4KNYA 3J81Z 3OYKA 2CZ0B 1IN6A 3O5ZA 3Q3SA 4C2MJ 2DKGA 2YLCA 1UZCA 1AWCA 1K73R 3H5NA 1AWWA 2OJ2A 2XKPA 2XSDC 1V5EA 3CCEI 5GAEJ 1UTIA 3JCMh 2LH9A 4DOVA 1T0FC 1YOVB 2B0LA 4RAZA 5FLXZ 4P5NA 3BG5A 4J00A 1SEMA 3M1EA 2D9TA 4PZJA 4EJUA 2DA7A 4XLHA 3BG3A 1YRNA 3S1NJ 1YS6A 1RACB 2CUJA 1W2BS 1VQLA 1ZK8A 5D4SA 2VOPA 3GF2A 1KG1A 5LHHA 2HEOA 2R5ZB 5DUKA 4XLNF 2KAFA 5CR2A 2X3XD 4PJOA 3LMMA 3FEOA 3T8RA 1LE8B 2A6HF 2WTEA 1YP5A 3FZVA 3PNVA 4HX7A 1JKOC 2C0IA 2A07F 3CMAI 4CGZA 3UATA 4Y13A 4R79A 2VBZA 2M8EA 1WJBA 4C8QG 4IZZA 1M3AA 3K4LA 1SFKA 2QWWA 4HQEA 1YITI 2JA6J 2CT3A 9ANTA 5KE2A 2K9QA 2HYGD 3N4MA 2M51A 3DLLF 3DB3A 1YJ9T 1VQ4Q 2P0KA 2Z99A 2O31A 4ELZC 3BR5A 2GIVA 2V26A 4XTYA 1ZUUA 4LDVA 4L5EA 3M8EA 3OWTA 4L5IA 3OSFA 1ZX6A 4WCGA 3BJOA 1EF4A 3RIRA 1WJDA 2BVLA 1Q95G 1FY7A 4G6TB 2DTOA 3MCAB 2IP2A 2W00A 2M9UA 4I02A 3J81E 1KYWA 3C2HA 3BZCA 4ASNA 4E7HA 3ZMZA 4A0YA 1ZQ3P 1DP3A 1GRIA 2DXTA 4HCKA 3JCMd 2KISA 4M78F 3JRDA 3BG7A 4CI0C 3DF8A 3JCMX 1UJ8A 2X6WA 4M6XA 3FJ5A 5FLXE 3GLLA 2FZCB 1VQKT 1Q7YC 1JE8A 2OCCH 3MFKA 1I4K1 2CH4W 3EFRA 2DQRA 3HUGB 3M0PA 5DCMA 3PMTA 4FYVB 5GP9A 3ESWB 1X01A 1V3FA 2HDCA 1HKSA 1Z1DA 4ZC3A 5AYFA 1WLPB 4JRIA 2H27A 2NS8A 3CDLA 2WY8Q 1X1AA 1TWFJ 3QIIA 2EQIA 3NTIA 1Z6TA 3G4SQ 3CCMQ 3KEQA 4A3GJ 2DPPB 4MQVA 3BPXA 1BBZA 2QEXQ 2KNBB 2R58A 1GFDA 2GBQA 5K7ZA 3QQAA 4A3CJ 1S72A 1KHIA 1PRLC 1WHUA 1D3YA 1XGMA 4I01A 1OYXA 2DK3A 2FPEA 3NWTA 2OAWA 1VQPQ 1MD0A 2ZNZA 4E7JA 4ZYHA 3CCJQ 3SDBA 3BJ6A 2CUDA 1GV2A 3VEPA 3AHUA 1UCRA 2K3PA 4GFBA 3PE0A 1M5Q1 1D8JA 5IYDJ 1WXBA 1XDUA 2MAMA 4HKEA 4L5GA 1JU5C 1X1CA 1M8VA 2HVRA 4UVCA 5GAN7 1FMKA 2MUNA 5JVGF 4JBAA 4D0PA 1IGQA 5FU6B 4ABZA 3QWLA 4DA4A 4MNUA 3TO7A 1O3QA 2NAZA 2PNIA 1QMCA 4IIMA 1Q86C 1RUNA 4NC7A 3KCCA 1W6XA 1JGSA 2HXIA 1YIJI 3JTHA 4J8OA 4XKBA 1ZH5A 3S1RJ 1R0BG 1WJQA 1XJWB 3VSLA 4YFXF 2L3SA 2BUDA 4XOPA 1GXPA 5FWBA 1TW3A 4CCMA 4DOZA 3DXJF 1TXQA 2EKOA 3EG2A 4JJBA 3I5SA 3S17J 1VQ5Q 1OZ2A 5GMKh 1YHQA 1TG0A 3HSRA 1W7PD 2XB0X 2F5FA 3ZN0A 4B48A 4UUSB 2DPUA 3EHRA 3JCMQ 3CD6T 2O8XA 1Q86R 1D0XA 2DL8A 4XU1A 1XOVA 2XRNA 4PGGA 1J0RA 2FMLA 2XGCA 2NUZA 3MO8A 2CRGA 2RM4A 4C0FA 2IA2A 2RREA 2XVCA 4KICA 4U0VA 1F43A 2RA2A 4AFZC 3VFZA 4HCCA 1FTTA 4M77B 1RETA 5FRNA 5D6YA 3HPGA 4K11A 1Z7UA 1M1FA 1I8FA 1IN4A 3WGIA 3OW2A 3EG3A 5JVTA 3FM5A 4QVZA 3CCLI 3AG1H 3LAJA 4C0ZA 1U1TA 3EFOB 2PLYA 1BCOA 5JI6A 1WQ2A 4MFEA 3I55Q 1POGA 1FP1D 3I3LA 4MQ9F 4QPQA 5FLMJ 2JA5J 4II1A 2DYBA 2R57A 3OYAA 4PJMA 1D0YA 2I10A 3WTSC 2ED1A 4LDXA 2ZPGB 3M0QA 4QVDA 1TQPA 2VWFA 5HDKA 2VT2A 5CCAA 4MZPA 2HEQA 5FO5A 5GJVB 1KU3A 3MKYB 2LDMA 1ACMB 2F2EA 3HKSA 2EINH 5J3BA 2DT6A 2LX7A 3FXLA 1QVFA 4WWCA 2Y9ZA 2O0YA 5FD6A 4A54A 4KULA 4A3DJ 1EJ9A 3LSTA 1Y39A 3VJPA 1X6OA 1OYYA 1WJFA 1X3WB 2K40A 2RGVA 3OSSC 5HVQC 2LJ1A 3OW2S 5EZHA 4DYRA 4L0YB 3J7AW 3F3XA 4Y33A 4Y91A 4RAYA 4Q4ZF 5M3MJ 1JJ8C 2ELJA 2W4SA 1ZRCA 1ZA2B 1VQ7I 4C92F 4XRFA 5KYNA 2RKHA 2RI2A 3G71T 2E7XA 1N75A 5KCOA 4ELYC 2LREA 1Q82U 2GIZA 2QUFA 4NC6A 3HRTA 1NM7A 2VI6A 3JCMP 4Q48A 5AIPA
chains in the Genus database with same CATH topology
4N9IA 1ZN2A 2K27A 1QO0D 3LGFA 1QVFS 5LGNA 5IT9K 1FX7A 4BHBA 2ZCWA 3OYGA 1HQCA 2ESNA 2GA1A 3LQRA 2E1HA 5FU7C 2P8TA 5H6RA 2LRQA 3L00A 2CGPA 5IN1A 5GAOn 4M72A 3WTXC 2JRTA 2OA4A 2VBYA 4NL3A 4M77A 1YW7A 1F4KA 3OBWA 2K2VA 3COAC 4OOIA 3BDDA 3VKIA 2VOOA 3ECOA 2FRHA