1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA operator DNA
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
4RAZA 3GYHX 4JQFA 4P5OA 3C3WA 3GZ6A 2EWNA 5E8IA 4WF2A 2COMA 3ZMDA 1P4WA 4L9JA 2QYOA 2NAZA 5DYMA 2AXLA 5J8FA 1U8RA 5AONA 2D1HA 3E5UA 5DCMB 4MHGA 1LDDA 4U0YA 2XHKA 3RYRA 2OQGA 3IRQA 4AIJA 2C6YA 5FLXK 4LJZF 1J7KA 1Z6TA 2OAZA 4RB0A 1KA8A 1V4RA 4WXHA 4RGUA 2FA5A 2QWWA 3JTGA 2K4JA 3AAFA 2ZNYA 3GF2A 3KE2A 1G3SA 5FD6A 1TNSA 3L7WA 2XRNA 2LNBA 3NRVA 5FFXA 2A07F 2L4MA 1J75A 2OD5A 1KGSA 1Z05A 2EB7A 1R22A 1SD4A 2P5VA 4GYIA 5FO5A 1HW1A 3BP8A 2JPCA 5BPDA 1MZBA 1BYMA 3JAMZ 1FYKA 3CUOA 1HKSA 5DCMA 3J81K 4MNUA 4Y15A 2JSCA 1YW8A 2YX4A 1QGPA 4HAMA 4IF4A 2MC3A 4M6YA 4Y17A 1STZA 2A3SA 4Q48A 1R1TA 2P5LC 4A2UA 2OU2A 1ZHFA 2LX9A 4M9XA 4R79A 4PGHA 1MJ9A 3KP6A 3K1NA 1XDSA 1ODDA 1P4AA 2FQ3A 3ZMZA 1XGMA 2EV5A 3JSOA 3R4KA 3DEUA 3GFIA 2FU4A 2GIVA 3WTWC 2LDUA 2A68F 1GHCA 2VC0A 1R5GA 1TTYA 3F8CA 2Z99A 4LK1F 4ZYGA 3FMSA 3EETA 4N0BA 3ZMTA 3RKWA 1XD7A 4AIKA 3HSRA 2FBKA 5AIQA 2HOEA 3RKYA 4AD9A 1AWCA 2RN7A 5ED4A 4ZZLA 3ZPLA 2UZKA 5K5RA 3KZZA 4I0AA 3M9AA 1Q1HA 2K27A 1F1ZA 1LDKB 1QNTA 1HKQA 1MJBA 3DPLC 1TNTA 3G3ZA 3M8EA 3E6CC 3EUHA 2GQQA 3B02A 2VBZA 2M87A 1ZLJA 4R1HA 4AIHA 4ZYHA 3KETA 2ISYA 3HHHA 2HR3A 4HOBA 5D8KB 4A6EA 3DXJF 3P9CA 2OA4A 2UWMA 4KNYA 1SD6A 2GWRA 4KIGA 1QVPA 1U5TB 3N4MA 2ZFWA 4OIRF 2GXGA 3ECHA 5CVVA 1IN7A 3NEUA 5HS9A 3M1EA 1SD7A 1WWXA 3DV8A 3TOAA 2XAGA 4CGZA 1LEBA 3CUQC 3WGGA 4XLNF 4HZFA 1J2XA 1P4XA 4G7OF 1BI0A 2ACJA 1O3RA 4Z2YA 2Z9OA 5EEGA 1EV7A 1T98A 2VXZA 2K4YA 3KEQA 1SFUA 3RJPA 1XB4A 2JPBA 4CYDA 3CTAA 3BJOA 2EFNA 4PDKA 5D4RA 2STWA 2DK8A 2YR2A 4UVCA 1JE8A 3R0AA 5LLQA 5DUIA 4L0YB 1LEAA 3L09A 5F1RA 3IHUA 1U6GA 4KA4A 1GXQA 5JHUA 1T39A 3QP5A 1ZRDA 3WTXC 1U5TA 4L18B 4ZZDA 2R3SA 4EJWA 2CO5A 3I0TA 3MWMA 4Q47A 3P9KA 1LDJA 1FT9A 4KN4X 1Z91A 3D0SA 1IXSB 3MQ0A 4HLYA 4L0ZB 4IJAA 4ESBA 3ZMSA 1B1BA 2CFXA 1ZN2A 4LD5A 4G94A 3WGHA 5LRSA 3ZP5A 1B59A 3F3XA 1PP7U 1TLHB 2PBIA 3BPXA 4IPAA 3DP7A 4Y13A 4QWQA 2HQNA 5DUKA 1K78B 1R5HA 3COAC 1YW7A 1ZYRF 5L3BA 1ZH5A 3LWFA 3L9FA 4EJTA 2QLZA 1B9MA 1IN5A 4ESJA 2IPQX 5CVUA 3GX4X 5H6QA 5D5XB 2HKOA 2ZNZA 2DTRA 5TJJA 2FXAA 4ZH4F 1IXRC 2F5EA 2VN2A 3E6MA 3QU3A 1IW7F 2MA3A 1K6OA 3KFWX 1XN7A 3U9GA 5EEHA 2MBFA 4PCQA 5FB2A 5FD5A 4GXOA 2ZCWA 1ZRCA 3BZ6A 5E1ZB 3TQNA 2EA2A 4L9NA 2J5PA 2XKOA 1K78A 1AOYA 4EMSA 3WTVC 5L3GA 1WKMA 1I1SA 3ZQ7A 3E5XA 5F6FA 1KQ9A 1YS6A 1UCRA 3RI4A 4P55A 3QPHA 2RQPA 3DF8A 5LGUA 1B4AA 5HS7A 1U78A 5D5WB 3JW4A 1KYWA 3V8LA 2HZTA 4RAYA 3H3UA 4AWXB 3HOSA 2ISZA 2AS5F 4YFKF 2P4WA 2RNJA 4ASNA 3WTTC 1ZGJA 1LB2A 4HV6A 5DD4A 5K5OA 4RS8A 4G6DA 2F2EA 2ESHA 3RPQA 2PJPA 2X4HA 5CJ9A 3KP4A 2W85A 3K69A 4ENJA 1O3TA 1TW3A 2DFIA 4BHBA 4EJVA 3ULQB 2OQRA 1UB9A 3ZMUA 6PAXA 4LB5A 3JTHA 1DDNA 2PLYA 2D45A 1W5SA 3MHXA 4B8XA 5CVIA 4MTDA 1XCVA 2NNYA 3HTSB 1XCBA 1YIOA 1S3JA 3K9TA 1J59A 4M6XA 3R61A 2BGCA 3M7GA 2KIUA 2W25A 2HTSA 4YIIA 3C7JA 3ZN0A 3GVAA 2PFBA 4P96A 1U2WA 1H9GA 1RUOA 1B6AA 2FE3A 2O8XA 4U0VA 1P92A 5DDGA 1XMAA 5TRDA 2YU3A 3TO7A 1HW2A 2V79A 4U0WA 4KT5C 1X3UA 3IRRA 2LSOA 1R36A 2K5IA 2GA1A 2G9WA 4ENKA 4NB5A 5LGTA 1TQIA 4RGXA 4HBLA 4AVPA 4HA8A 3V7RA 1SD5A 2P5KA 2CSOA 3I54A 2VBYA 3RTRA 5ICFA 1J9IA 2DPDA 2FF4A 1BIAA 1FY7A 2IA0A 2STTA 2WTEA 3C1DA 5LHIA 3MFKA 2CG4A 1BBYA 4ON0A 5D5UB 2NYXA 5IT3A 3WGIA 1ULYA 4QLCU 2A6EF 2IA1A 5JI6A 5J8CA 2ZMEA 2IW5A 4OIPF 2FMYA 4I7HA 2V9VA 4UVBA 1IRGA 3V8JA 3LQRA 2V1XA 4BAYA 5JVTA 2F5CA 1YLFA 2VONA 1ZLKA 1EH6A 1W7PB 1U3EM 4EV0A 3BY6A 4WWCA 2D2WA 3NQOA 4HV5A 2Y75A 3V7CA 3I64A 3BJ6A 3KP3A 4P9FA 3F23A 5FLXZ 2H6CA 2QZ8A 5CLSA 4UHTA 1UHWA 3LAJA 4BQAA 1ZGAA 4M9ZA 2EJRA 1IUYA 5HLHA 2DPUA 4IRHA 1ZREA 3HRMA 1IRFA 3J80K 4K2EA 4LG0A 3O6BB 1R1VA 1B9NA 3R60A 4WCGA 4RGRA 5CVJA 4FX0A 1XSVA 3QOPA 3E6BA 2EV0A 1FP2A 2O6GE 3HHGA 3K1PA 1FYLA 2J5OA 1QPMA 3LQQA 5JFRA 2VT3A 1JHHA 1W7PA 4PZJA 2PG4A 2Q0OA 2EFQA 3T5XA 3J81Z 3ML6A 4JK1X 3CO7C 1DP7P 3HYIA 1WRJA 2RKHA 4N9IA 2DK5A 3F21A 3T0YA 4LGWA 4LMYA 1FBSA 4I0BA 1S7AA 4CO8A 1MKMA 3B73A 1H9TA 3IKVA 4HF0A 1P6RA 2K4BA 4U7DA 1ZARA 2Z5UA 1DPUA 2DO7A 5KVRA 5E1XA 3I4PA 3J80Z 1I5ZA 2IP2A 1BM9A 3MEXA 4A0ZA 4RB1A 3QPTA 2NNNA 1MDMB 2CW0F 1WQ2A 3FHZA 4KDPA 4HYEA 3QU6A 4E70A 1IAWA 2L3DA 1FLIA 4L9TA 2IJLA 2W57A 3HUGA 2PEXA 1K7AA 3QRFF 5HS8A 4IHSA 3O2PE 3U1DA 3CO6C 4HDVA 4ENNA 2QQ9A 1RNLA 4EM1A 4HW0A 3BPVA 1FBQA 2CGPA 2R7FA 5FGMA 4LLGF 2FRHA 2VOOA 4I09A 5ILUA 3GZ5A 4RB3C 2MLGA 4D0PA 2XASA 1OYYA 1XGSA 2RVCA 4U7BA 2FBIA 2DT5A 1BI1A 4Q5SF 2HWVA 5A2QK 2RDPA 3LA3A 4MEYF 1HXDA 2A6HF 4S05A 4L9VA 2L54A 3FM5A 1MDMA 4XRFA 2HFHA 1FC3A 3HRSA 3V8KA 3TO6A 4O6JA 3FMQA 1TQMA 2BV6A 2P6TA 1E17A 4YFXF 1PP8F 1IN8A 3FZVA 1YFHA 1L3LA 3BWGA 1BC7C 2MLKA 2Q2EA 3GEZA 2VC1A 1QO0D 3BDDA 1SAXA 1MJAA 2DQRA 2H09A 3TDUC 2FBHA 5L3FA 2ZBKA 5KK1A 2XAHA 3EYYA 3GW2A 3F6OA 2A69F 1TW2A 2WC2A 2ZJ2A 5CVRA 1LQ1A 3ISPA 3SZTA 3FMRA 3K0LA 3ROUA 2KJBA 3OOPA 1T6SA 3CDHA 2PQ8A 3J7AO 3WU1B 3DPTA 3PQKA 2XVCA 3KP2A 1FSEA 2FSWA 3ABUA 5A2QZ 3VFZA 4OIQF 4UNOA 3L00A 3REOA 2K5FA 1ONVA 1FWZA 2PI0A 3DFGA 3R6SA 3T8RA 1BC8C 1REPC 1I6XA 1LVAA 2YSRA 5LHHA 2K02A 3FWEA 1ZG1A 5LBQA 1OPCA 4RGSA 4LLLA 3WTZA 3TOBA 1LNWA 3Q5FA 4KMUX 3P7NA 3HSFA 5E8GA 3FXRA 5D5VB 2GAUA 2QENA 4KUMA 1D5VA 4FHTA 4M71A 1OKRA 2PN6A 1G6NA 3GFLA 1KU7A 3L2CA 1G3YA 2FMLA 2FOKA 3PQJA 5E20A 1BIBA 2QM3A 3WE2A 1L0OC 3VOEA 4ZYDA 1YW9A 4CICA 2GZWA 2E7XA 4EGYA 1FYMA 3KZYA 1ON2A 3KP7A 2CWEA 3CUQB 4G6QA 2K86A 3MAJA 4GO1A 4BYYA 1GXPA 2XAQA 2XV4S 4O3MA 2MH2A 4XLPF 2H94A 1QZYA 2W24A 5FFZA 1KQ0A 4A0YA 2ELHA 5L3CA 2BEOA 3CLOA 4FX4A 3F72A 1G4DA 3OV8A 2JTVA 4XSXF 4DQ2A 5E17F 3SQNA 2PMUA 2HGCA 1XGNA 1FOKA 1HSTA 1MGTA 1DPRA 4NHJA 5ICGA 4A6DA 5DCFA 2KJCA 1R58A 1Z1DA 3CUQA 2H3JA 4L5IA 3U2RA 2E1NA 4LB6B 2L4AA 2P8TA 3BJAA 1RIOH 1F9NA 3SXYA 3ZMVA 1I27A 1VTNC 1IZ1A 2NS0A 3WTYC 1S29A 3ZN1A 2X0LA 5D6EA 2P7VB 4YG2F 3WODF 5HDGA 4U88A 1CGPA 2B0LA 1QQIA 1G3WA 2YX7A 4GGGA 2IRFG 4OIOF 1T2KA 3PFIA 1XSDA 5ICCA 3LAPA 1YS7A 2E7WA 1RUNA 4CXFA 1O3QA 4MEXF 1KU2A 4I01A 3SHFA 1D8JA 1JXSA 3GO5A 5HOOA 2ZMEB 1D8KA 3LA7A 3KLNA 3I58A 4EJOA 3C18A 3IWZA 1ZG5A 1J0RA 2V6CA 1YG2A 4A5MA 2ZXJA 2ZO4A 1K79A 4ZYEA 4UV9A 2VBXA 2GA2A 1IF1A 1KQ8A 1EH7A 2HTJA 2P6SA 2BYVE 4HDUA 3GFMA 1IN6A 5ERIA 2XKPA 2HYFA 2JRTA 2HDCA 5D4SA 4M73A 3DKWA 3QP6A 5E18F 3ERED 4IRGA 2H6BA 4OOIA 1QZZA 3W6KB 3KLOA 4A0XA 2Q8KA 4CZZA 4LG0B 5LGNA 4OMZA 1F5TA 1WSUA 2L02A 2KKOA 2YPRA 1ZRFA 2BBYA 2HEOA 3LSTA 1GVJA 2QQBA 1QBJA 1EH8A 4JBAA 2UXNA 3T8TA 4I02A 3N97A 5DV5A 1R00A 4BHPA 1C0WA 3GXOA 2EK5A 4B09A 3TGNA 3IL2A 2IVMA 4KN7X 2PMHA 1U5TC 2DAOA 4DNCA 4YIFA 5LEJA 2R7DA 3RYPA 3O3KA 1FNNA 3LA2A 3MCZA 1W5TA 4CHUA 4EGZA 3LFKA 2QUFA 3S2WA 2M8EA 3H3ZA 4O5VA 1KU9A 4N9HA 4R8HA 1BI3A 1H0MA 5BMZA 1T38A 1WI9A 2NRAC 1I1GA 2F5DA 4BXUA 5HLGA 4KIFA 2ETHA 1J5YA 4WXDA 1V3FA 2GCXA 3ECOA 2ZKZA 1OR7A 5HDNA 4XBFA 5JR3A 1YTYA 5D8LB 4IRIA 1RI7A 2IA2A 2XAFA 2KIMA 3FF5A 4HLXA 2K7LA 2EV6A 3I59B 1W4MA 2BE5F 2MD5A 3EQLF 5K1YA 5H20A 3BROA 1E2XA 1USTA 4NQWA 4G7HF 1SFEA 3MZYA 4HQMA 3E97A 4EJUA 2OZ6A 3FM3A 5DD8A 2DU9A 4LK0F 1PUEE 2LKPA 3HTUA 1T0FA 2FEZA 3SFZA 4WXCA 3Q9SA 2H27A 1TBXA 4UV8A 2E1CA 3TO9A 2O3FA 3ABTA 3I71A 1Y0UA 1S8NA 2Z33A 3F8FA 4KYWA 3E3VA 4MQ9F 3GUDA 3R0JA 5D6FA 3Q9VA 5ICEA 1UHMA 2A61A 2M1BA 3I59A 3JSPA 2HYGD 2FNAA 2JZYA 3ELKA 3D5LA 2WV0A 3KCCA 1Z7UA 4S04A 2DQLA 2HS5A 3FX3A 3I53A 1HBXG 2XGXA 2O0YA 4WX9A 3FXQA 3WTSC 2TDXA 5HLIA 4YFNF 2VBWA 3P9IA 1OYIA 2VE9A 3DQVC 5HVQC 5H6RA 3SZPA 2VOPA 5IT9K 2ADUA 2DW4A 4HF2A 1Z6RA 3M8FA 5E1WA 4HQEA 5DEQA 4Q4ZF 4EQQA 2Z3YA 1HKTA 3RPUA 3GFJA 3KP5A 4KICA 2M5WA 3RIRA 5F64A 5CYVA 2VE8A 4A5NA 1USSA 2QVOA 2DLLA 2MH9A 3F6VA 3WTUC 3HSEA 2LF7A 4HX7A 2QBYB 3E6DA 5LRRA 1IN4A 1F4KA 5LEKA 2RC4A 1R7JA 3WG9A 1ZAOA 3G73A 3WU0A 1FP1D 2LF8A 4LFUA 3E5QA 1XDUA 5BQTA 1O3SA 1SFXA 4M72A 4L5JA 3WE3A 2VT2A 2GXBA 1YQAA 1A04A 1R23A 2HQRA 1JHFA 2FNPA 3RKXA 4G9YA 4OU0A 5IT9Z 3HOTA 2Y0MA 1D3YA 4ENMA 3GWZA 2XUBA 2K5LA 1FPQA 4M9SA 4EVIA 1KYZA 2QBYA 2OBPA 2IT0A 2HKXA 3TKYA 2JT1A 3F8MA 4BNCA 1JGSA 3V4GA 4HX4A 3MZHA 5HDKA 2P7CB 2XROA 2DBBA 2L01A 3K1MA 1XMKA 4LLNA 2V1DA 3CJNA 4RB2C 4UVAA 4H0EA 2A5YB 2V1UA 1QW1A 4ETSA 2EFWA 4MTEA 2F5FA 4MGRA 3W6JB 1S6LA 3K2ZA 2Y48A 1O7FA 3E19A 2D1VA 1XSXA 4I98B 1R1UA 1YO5C 2DI3A 4GCVA 4I2OA 4CDGA 4IHTA 3T1BA 1FSHA 5ILSA 2RGVA 1OMIA 4OINF 4A12A 1S7OA 2EA4A 5L3DA 4UUVA 2W84A 4ESFA 3BOQA 5BS6A 4MQVA 3HIFA 4G7ZF 3KEOA 4IXAA 1TQPA 3HRUA 1BI2A 1Z9CA 1BN5A 3EYIA 2RV8A 3VEPA 2QQAA 1BJAA 3FXUA 1ZG3A 5BOXA 1LJ9A 1HW5A 3IC7A 1MD0A 2VODA 2O03A 2KIFA 2EFOA 1UFMA 3EDPA 1ON1A 4KMFA 4HX8A 3HRTA 3V7SA 3H92A 3GLXA 2XIGA 5ILVA 3VODA 5J6XA 1KU3A 4BHCA 1CF7B 4IVNA 4FT8A 2G7UA 2EFPA 4P9UA 4F7ZA 1NHAA 4XSZF 4KIBA 3QAHA 3RDIA 2M30A 2CQKA 1SMTA 1OYWA 1BOAA 3F8NA 2XAJA 2CYYA 5LHGA 2KRFA 4G8XA 1HQCA 4PGGA 2OZUA 4OMYA 4EM0B 4TV7A 1FBUA 2UXXA 3TDZC 4WK8F 4EM2A 1O7LA 4KFCA 3VB2A 1SMYF 3IKTA 3F8BA 4M74A 2WWYA 1DUXC 1P2FA 5AIPA 1O57A 5K5QA 2G7HA 1FX7A 2O61A 3F22A 5L3EA 1G3TA 1W7PD 5BPIA 1PDNC 1HSJA 1FZPB 4UXNA 2M45A 1CF7A 3I5UA 4GYGA 1RZ4A 1XGOA 1IXCA 1YYVA 2ESNA 3JAMK 4HF1A 3IWFA 4BH9A
chains in the Genus database with same CATH superfamily
3I4MJ 4RAZA 2CP5A 3GYHX 2E2HJ 2OX7A 4JQFA 4P5OA 1YP5A 3C3WA 4ZDLA 3GZ6A 5LJ5d 1Y8RB 2BY1A 2EWNA 5E8IA 4WF2A 4IZZA 4KGZB 3QSUA 2F4MB 4C92G 2COMA 3ZMDA 4M7AC 3I3LA 5DM6F 5GMKj 3CCJT 3CC7Q 4RCBA 4I76A 4GLKA 1P4WA 4L9JA 3SZGA 5GAHJ 3CQTA 2QYOA 1FEXA 3JCMf 1TWHJ 4FE7A 1YJNA 1VQLQ 2NAZA 2JWTA 5CKEA 3QYEA 3W2AA 5DYMA 2AXLA 2LFBA 1TWAJ 5GAEJ 5J8FA 3H36A 1U8RA 2DL8A 5AONA 4XRMA 2NWMA 4J7FA 3U23A 5FRMA 3CC2T 2EINH 2QKMB 2WSEE 2KMTA 4XONA 2FZCB 4G6TB 2D1HA 3E5UA 5DCMB 2NVXJ 4A54A 5CO7A 4MHGA 5LFAA 2DIGA 4C2UA 2M34A 1D1AA 2HQ5A 1LDDA 4U0YA 2XHKA 1KQ1A 1M1EB 2IEKA 2OQGA 3RYRA 5FU7B 3IRQA 5F04A 4AIJA 2XICA 3BDUA 2DYBA 4ME7A 1MMGA 2HKQB 1VQPT 3VRZA 2C6YA 3AL0B 4DZJA 5FLXK 4LJZF 1J7KA 2FL7A 3ZCOA 1S7EA 1YHQQ 2RM4A 1Z6TA 2AXTC 2OAZA 2RREA 1K8AC 1TTHB 2M9HA 1KQSP 4RB0A 1WA7A 4N0AA 3OYYA 2KT1A 4M7DD 3H1CA 1RETA 1MSFC 1M2OA 1KA8A 1V4RA 4WXHA 3BTJA 2GQIA 2NS8A 4RGUA 2FA5A 2QWWA 1V5FA 4M75G 3JTGA 2RHUA 1TL8A 3E0JB 4PJ0C 4E7LA 3PIPF 2I8DA 4ZN3A 1VIFA 3ABKH 1DGWY 2K4JA 3AAFA 2ZNYA 3GF2A 2HQHA 3KE2A 1G3SA 4UB8C 1JKPC 2L7ZA 2LJ1A 1Q82C 1JEGA 3OYLA 3A02A 3URGA 3CC7A 5FD6A 1TNSA 5GMKe 3L7WA 3FRNA 2XRNA 1ZSZA 1RC9A 2LNBA 4M7AF 4AUXA 2QEXQ 2W1OA 1VQ9I 4VUBA 2GNCA 3NRVA 2O7OA 5FFXA 2B9SA 2A07F 1FXXA 2L4MA 1J75A 1WXTA 2OD5A 2YWWA 4X6AJ 1KGSA 1WJRA 3EGDB 1Z05A 4QW2A 5KCOA 1O9SA 3QJYA 2EB7A 1R22A 3LMMA 3OMYA 4MLOA 3EHRA 3H6ZA 2WACA 3MEAA 5FW9A 1SD4A 2P5VA 2CS7A 4JPBW 5LJ3h 1PJRA 3K7AJ 4GYIA 2KP6A 1QVTA 1WJDA 2LNVA 3DBLB 5FO5A 1HW1A 1V55H 3BP8A 4Z6YA 3NTHA 2JPCA 4MIMA 5BPDA 1A31A 4OB0B 1MZBA 2XB0X 1YE9A 4M78G 1BYMA 2R7ZJ 4F7UB 3JAMZ 1QHGA 1YHQA 3CMET 3S3NA 1UZCA 3E7LA 2HQEA 4LOCA 1FYKA 3CUOA 1HKSA 2DA2A 2LNHB 1R6RA 4CC7A 4BB7A 4RBOA 5DCMA 3J81K 1X27A 5GAN5 4MNUA 2DE0X 4Y15A 1E0EA 2JSCA 4J00A 3M0UA 1YW8A 3I56I 2JA2A 2E35A 3AG3H 2CZ7B 2VXEA 4LDYA 3F9KA 4RG8A 2OAUA 3S16J 1DJ7B 4IUUA 4XK8E 2YX4A 2X35A 1QGPA 5EGOB 2YRVA 1ZSGA 4FIBA 1M30A 1T33A 4HAMA 2PVOB 4IF4A 1BA5A 3GTQJ 1V5GA 2A3LA 1MNEA 1YOVB 2GOXB 2LC2A 2MC3A 1N77A 1WI3A 2EIJH 2EYZA 5J26A 2LDMA 4M6YA 4Y17A 1STZA 2A3SA 2VL8A 1Y0NA 2A7YA 2DM1A 3LGLA 4Q48A 2A0FB 1R1TA 4BI4A 2P5LC 4A2UA 2OU2A 1VQLT 2M0MA 2FEIA 1LFPA 4C5IA 4I99C 1ZHFA 1K1ZA 4QVDA 1V5EA 1WHJA 2LX9A 4II3A 2P4RA 5GAMg 3JRZA 2NS7A 3A2KA 4M9XA 3C4SA 4M77E 3I35A 2IGKA 4R79A 1G2BA 5I2MA 3S93A 4PGHA 1MJ9A 5I11A 4B1RA 1NYFA 4HNTA 4RM3A 5IYDJ 3OQ5A 3JAMR 4J19A 1W70A 3VYTB 1WXUA 4LIUA 3J80E 3KP6A 1YITI 3K1NA 2OTLI 2HPMA 1U06A 3GBQA 1XDSA 1NTCA 1ODDA 3A01A 1P4AA 3IAS2 2ESWA 5AT1B 1O4XA 2GBYA 2FQ3A 1TC3C 3ZMZA 1M1KC 1XGMA 3MKWB 2DK3A 4A3CJ 1VQOT 3G1MA 4OWRB 3EGDA 1VOMA 4C5GA 1W36D 2EV5A 1ZA2B 4LXCA 3AHUA 1NG7A 2LH9A 3JSOA 4ZGEB 2F48A 3R4KA 3DEUA 3OWTA 3GFIA 4A4EA 4ZDOA 2FU4A 4QVCA 1YJ9T 2GIVA 2VV5A 2CQNA 3EGXB 4IUPA 3JCMc 2W82A 1DGRM 3TW6A 2LDUA 2A68F 3WTWC 2NLUA 5A0DA 3I55T 3A8LB 3UA6A 5GAMf 1UJYA 4OB3B 2A08A 2R5AA 1GHCA 2JA5J 2VC0A 1R4NB 1R5GA 1TTYA 4XTWA 4F7UA 1W2BS 1PKSA 2M7BA 2P0WA 3F8CA 4RCCA 5GJWB 2Z99A 4XOTA 2R7OA 1W0UA 2SEMA 2QF7A 5GMKi 1JTYA 1RPWA 4LK1F 3X2QH 2KQRA 4ZYGA 2YHTA 1YIJI 4KISA 2X1EA 3FMSA 1WCMJ 1S72I 2J6FA 3EETA 4EMGA 4N0BA 3ZMTA 3VPRA 4PJOE 2DEQA 3RKWA 3JB9G 2DO3A 3HDDA 3K4CA 2A05A 4IEJA 5FLXR 3CCQQ 1ZUUA 4XKVA 1XD7A 4AIKA 1VNDA 1EF4A 3HSRA 3BG6A 5EGOA 2FBKA 2CGHA 5AIQA 3EPZA 3OW2A 3MEVA 1WQWA 1WXBA 1KHCA 2HOEA 3RKYA 2MD0A 1NK2P 4AD9A 3H9NA 1AWCA 3AKZA 4JJBA 2G6FX 4IIMA 1PUFB 2RN7A 4A3MJ 4C92C 2CKKA 5D6WA 1B07A 1LKXA 5ED4A 4B47A 2DZCA 3E1SA 4HCCA 1K8AR 2VQCA 1WPKA 4ZZLA 3ZPLA 4A3DJ 2P0QA 2H1KA 4DOZA 2UZKA 3THKA 1V54H 4C0ZA 1VQ8Q 5K5RA 3KZZA 2EIFA 2KYBA 5K7ZA 4I0AA 4XLCA 3HL2A 1H88C 4QQ6A 3LOCA 5LJ5j 3CCLA 4FASD 3M9AA 7AT1B 2ZGWA 1HC8A 2A28A 1Q1HA 1SSFA 3NFCA 2RQVA 2M0CA 2KLOA 5GANh 3GOXA 2VIXA 3QWYA 3JRCA 2W0ZA 4V2GA 2OC6A 3I5SA 3GNFB 2HNHA 1WJSA 2K27A 1F1ZA 1LDKB 3CCQA 1OX8A 1QNTA 1LFBA 4HG2A 2P4TA 1LJOA 3EGXA 2HDAA 3OA6A 1QU3A 4OMFB 3CCJI 1HKQA 1MBFA 1MJBA 2LYCA 3DPLC 1TNTA 3PSIA 3W2VA 2JVHA 1GCQA 3EGUA 4HVVA 1AD5A 3TL4X 3G3ZA 3J81R 3M8EA 3E6CC 1QP2A 3SFIA 2XSJC 3NGPA 4M75C 4XKBA 2CRGA 2XGEA 3CC2I 3OL4A 8ATCB 3EUHA 3MP6A 1YBYA 2GQQA 3EHQA 1JB0E 2RQUA 3RKQA 1I50J 3P8DA 2KQWA 3AG1H 3HOZJ 4AFZC 4C92F 3B02A 3C94A 2VBZA 2HI3A 2M87A 2DTOA 1ZLJA 4R1HA 4J9HA 1VQKT 4AIHA 4FW2A 2XD0A 4ZYHA 2FQ4A 4IURA 2X4WA 4II2A 4B9WA 2X4XA 3KETA 4JP0A 1VQPI 2ISYA 4BACA 3HHHA 1PHTA 2NXNB 1WHHA 2MK5A 2YLCA 2HR3A 1WDXA 1VZ0A 4HOBA 4OMLA 3CJQB 4HPQA 5D8KB 1PD1A 4A6EA 5LJ5e 2DXCA 1ETWA 3DXJF 3VUBA 3P9CA 2OA4A 5B1AH 2VQHA 3Q0UA 1LPQA 2LY9A 4KNYA 2UWMA 1SRMA 1RQ6A 1SD6A 1SVOA 2GWRA 4B9XA 3HKZA 4KIGA 1QVPA 3EUAA 1U5TB 4JYKA 2X3WD 2MCNA 3N4MA 1RI0A 2ZFWA 4OIRF 2DVEA 1RADB 1MMNA 2GXGA 3T9NA 3C2HA 1OCRH 1YJNT 3S1RJ 3OR1C 4BY1J 3ECHA 5CVVA 1IN7A 5HNHA 3NEUA 5HS9A 3M1EA 4B44A 1SD7A 1D5YA 3PTAA 8AT1B 1X4PA 1WWXA 3BG3A 1PM3A 1MUZA 2QTXA 3J7YJ 5C3EJ 2LC4A 3DV8A 5J1YA 4M4ZA 3TOAA 3PIOF 4AMCA 3RESA 3HP9A 4M78E 3CEYA 3JRHA 4OMPA 2XAGA 3DWLE 5CKHA 3CCYA 3TP3A 4CGZA 2O01E 2IS2A 1K73R 1LEBA 3CUQC 4M75F 3WGGA 4XLNF 2DMUA 1BW6A 4HZFA 2JA8J 1W1FA 2ECZA 2PU9B 3G1JA 3JCMX 1M3AA 1VQ6T 1J2XA 2KRNA 1P4XA 4G7OF 5EZGA 1BI0A 1AU7A 2ACJA 5KCHA 1O3RA 1M1KR 2RI3A 4Z2YA 3M3YJ 2Z9OA 3JB9J 2EQKA 3KYLA 5EEGA 1EV7A 1T98A 4IQ4A 2VXZA 4CCKA 3HB9A 2R0QC 3A52A 2K4YA 2E5NA 2RA2A 1APLC 3KEQA 1SFUA 3RJPA 1ABQA 2X6OA 3CMEI 1F43A 2DXTA 2JUGA 5J4VA 1XB4A 4AIDA 1QVGA 2JPBA 3OS0A 4CYDA 1KC8U 1VYVA 3CTAA 1TUCA 1Z21A 3BJOA 2EFNA 4PDKA 4QKUA 3TW7A 2WAEA 1TUGB 5D4RA 3BZCA 2ZSHB 2STWA 2LQWA 2DK8A 2YR2A 4UVCA 1I5OB 3CCRQ 2DYRH 1JE8A 2YSQA 4F91B 1GLNA 1WJ5A 4XU1A 3BY7A 1K4US 3ER0A 2HAXA 2RHIA 2HXIA 3R0AA 5EG0B 5LLQA 4I6ZA 1K4TA 3HOVJ 2O2OA 2ROLA 3VYHB 4DYQA 5DUIA 3M5AA 2ZSIB 4L0YB 5GAN7 1LEAA 4M78F 2VVKA 2R92J 3W3CA 1UG2A 2QXFA 3FXLA 1X58A 1JKOC 4OMOA 3L09A 5F1RA 4CCOA 2VWFA 3DEWA 1BL0A 3IHUA 3EH1A 5KH6A 1U6GA 1UGQB 2ECCA 4FM4B 4ELZC 4KA4A 1GXQA 1IRXA 4C30A 5JHUA 1T39A 3QP5A 2RK2A 2YRCA 1POGA 1Y1WJ 2BXZA 3WTXC 2EPFA 1ZRDA 1N8RC 1U5TA 1GCPA 1ARKA 2P81A 4L18B 4ZZDA 5EEAA 1W4SA 4HT9A 2WAFA 3ZR8X 2BY0A 2M7AA 2R3SA 3M8JA 4EJWA 4A3EJ 2VKHA 2CV0A 2K9GA 2CO5A 1YHQT 4J9DA 3H0FA 3I0TA 1AT1B 4E7KA 2ZXIA 3HKSA 1FOXA 1Z9ZA 2HNIA 3A8GB 3MWMA 2KT8A 4F7UG 4Q47A 3P9KA 2JMAA 3FC3A 1WX6A 1ZLMA 1Q81C 1LDJA 1FT9A 4KN4X 3G6ET 3LSIA 2ED1A 4D9JA 1PC0A 1VQOI 2X1CA 2E1MC 1U0JA 2ATCB 1Z91A 5KHDA 2CJJA 1N9RA 3CCRA 1ZQ1A 3D0SA 5FRNA 2IS1A 2VQLA 3QPLA 3L2WA 1YJ9I 1IXSB 1X6GA 3EH2A 3SJMA 3MQ0A 3HOUJ 1NE8A 4HLYA 4L0ZB 1A6QA 3I55I 2AZVA 4IJAA 1E6GA 2QEXT 2DOFA 2R7XA 4ESBA 2AT1B 4FYVB 2QGFB 3M4YA 3ZMSA 1H8AC 3QZ5B 3VS5A 3JCMQ 2AKKA 1B1BA 2CFXA 2WAQN 1ZN2A 4FSSA 3X20B 4C9YA 4LD5A 4G94A 3WGHA 1SHFA 2FZGB 3LYIA 5LRSA 3ZP5A 1B59A 3F3XA 2DOEA 1PP7U 4XLHA 1YJNI 5IXBA 2YUSA 2BE9B 2M02A 3JCMh 2COWA 1QVGS 1TLHB 3OS5A 2PBIA 2Y9YA 2CQQA 3BPXA 1BKBA 3QYGB 4IPAA 3DP7A 2H8WA 3UATA 3VDXA 4Y13A 3VYSB 4NUBA 3CMAQ 4DGWB 3EFOB 2K3XA 4QWQA 2R7WA 2RJEA 3C0CA 2HEQA 2LT1A 3LH0A 2EKHA 2HQNA 3ONQA 5DUKA 5F27A 3G4SQ 1MBJA 3DU5A 1CSKA 1VQ4Q 1K78B 2QK0A 2Z16A 1R5HA 3JB9F 3COAC 4A4HA 1YW7A 2XF6A 1WHKA 1ZYRF 2DTZA 5L3BA 1ZH5A 1ETYA 3L2UA 3LWFA 1JRIA 3L9FA 4EJTA 1ABOA 2F4OB 2QLZA 2JRMA 1OQKA 2P0KA 4MFEA 4X9CA 2VLAA 1B9MA 1NLPC 3PNTA 1XMXA 2K9LA 2V6EA 1SF9A 4JJDA 2BZYA 5FJ8J 1IN5A 1JI8A 4ESJA 2HQXA 3X25B 2E71A 4C5HA 4JS4A 2IPQX 1R9TJ 5CVUA 2W4SA 2LRQA 3CJTB 3GX4X 4X34A 1TXQA 3CMYA 4ZNXA 3GF5A 5H6QA 5D5XB 2HKOA 2ZNZA 2ID3A 1EKEA 3HC7A 1B8IB 2HVSA 2XGDA 2DTRA 4XLEA 3OL3A 3ZQQA 2J05A 5TJJA 2DTIA 2FXAA 5J3BA 4A4KA 4ZH4F 1GRIA 2QEXA 3OYBA 1K73U 1IXRC 1D0YA 2BY3A 2F5EA 4A3GJ 1WZOA 2VN2A 3WXMB 3TSZA 3QODA 4DBQA 1JBMA 2MAMA 3E6MA 3QU3A 5A2QR 2HKNA 1OPKA 1IW7F 4ZC3A 3BTLA 1HOMA 2MA3A 3PUBA 1JT0A 1RAGB 2K9NA 2R7RA 3CQZJ 5IYBJ 1K6OA 1YWOA 3M0TA 3KFWX 1XN7A 2VKDA 3U9GA 2E5QA 5EEHA 3G4SA 1VQ4A 2MBFA 4PCQA 3LNQA 1FIPA 5B66C 5FB2A 1WPYA 3P8HA 3RCOA 3JB9I 2M9UA 5FD5A 4GXOA 2ZCWA 1OOTA 5HK0A 2CT4A 1WHMA 1ZRCA 3BZ6A 4CSWA 2OTJQ 4C2TA 5KYYB 3CXCS 1K4SA 2CUBA 3U1KA 3PO2J 1EA3A 1VQKI 3SD4A 3F0CA 3VJPA 4F3QA 1NPPA 2MWOA 5E1ZB 3P8BB 2LKSA 3TQNA 2EA2A 2EBPA 3X26B 5L23A 4AVZA 1SC7A 3BE3A 3EFOA 2W7NA 4L9NA 2GF7A 3DBHB 1Q1VA 3PT9A 4AC0A 1M5Q1 5J4YA 1C1AA 2J5PA 2BZ8A 4LDVA 2XKOA 1K78A 1AOYA 2FYKA 4EMSA 3WTVC 3TCJA 5L3GA 2CZ1B 2E70A 3CCQT 2AQEA 1WKMA 1TH7A 4N4IA 1M1FA 1I1SA 2DMNA 3E5XA 3ZQ7A 3OBYA 5F6FA 3S6WA 1KQ9A 1YS6A 1UCRA 1FMVA 2YS9A 3HZJA 3BG5A 4QPOA 3RQIA 2HU9A 4FCYA 4P55A 1KONA 3QPHA 3RI4A 3NHNA 1QHHD 2RQPA 2KROA 2HQAA 1R77A 1OISA 3REAB 2Z1DA 1N8RR 3DF8A 2P84A 3HGYA 5LGUA 1T3SA 1B4AA 5HS7A 1U78A 2K3YA 3QWXX 5IOYA 1E3PA 2VASA 2HSEB 5D5WB 9ATCB 3JW4A 4PK4A 3S2DJ 4RTWA 1J3TA 5B5EC 1B8IA 1OR7C 2JSPA 4Y7NJ 2JJ9A 1KYWA 1TZLA 3J7AF 5J47A 3V8LA 3DCFA 2HZTA 3MD2A 4BE2A 5GADJ 2QSGX 2H8HA 2LCLA 4XTUA 4C0DC 1Q81R 2OTJA 4RTYA 2E64A 1VQ8T 4RAYA 3H3UA 4AWXB 4HNUA 3HOSA 1O75A 2ISZA 1OPLA 2G3RA 5CKFA 2BW3A 4RLFA 1MMDA 5CQYA 4M77A 1YI2A 4BKXA 2AS5F 4HRIA 4ITVA 2HBWA 4BY6B 4YFKF 3DB3A 3H9GA 5FU6C 1X1DA 2L0KA 2DT7B 5C4XJ 2JZ2A 2P4WA 3CCMQ 1RKWA 3ZOBA 2RNJA 2QDLA 2BVMA 1QVFS 2CDTA 2L0AA 1X3WB 4ASNA 2COYA 2ZPHB 5GAN8 1BR1A 3WTTC 3OMGA 1ZGJA 4EEFG 1TP4A 2ID6A 2KDOA 2CP3A 2LX7A 1WLPB 4MMKA 3UA7A 2XDVA 5GAMh 1LB2A 3PNVA 2VJJA 5KAFC 3QIIA 4M77G 4HV6A 1TUDA 4X1EA 4AT1B 5KYYA 5DD4A 5K5OA 4RS8A 1VQLI 4G6DA 2B8AA 2F2EA 3L2VA 1WH7A 1NM7A 2PQWA 1I07A 2ESHA 3JRBA 2ABLA 2QDYB 4XU0A 3RPQA 2PJPA 1VQ8A 3SEZA 4CUGA 2X4HA 4F55A 1EX4A 3H0IA 4C8QD 3ABMH 2ZJQF 2LTPA 5CJ9A 3KP4A 2W85A 4F7UE 2K9MA 3K69A 1LUJB 5LJ3d 1WHLA 2K9QA 5CQXA 4ENJA 4JX5A 2V1NA 1O3TA 3QQAA 3CCEQ 3E2UA 2DJNA 4IKFA 1NYGA 3JCUC 1TW3A 2DFIA 2DOAA 1K61A 1UECA 2DBMA 2F5KA 4BHBA 3ASKA 3MEUA 5IPAA 4PKCC 2JQ7A 1OJLA 2ZPEB 4D7MA 3M56A 1T0FC 4EDUA 1YHQI 4EJVA 2XDDA 3ULQB 3FJPA 4DIQA 2OQRA 1UB9A 3ZMUA 1PG5B 6PAXA 1Y96B 2VXFA 1SVMA 3JTHA 1U8BA 1DDNA 4LB5A 2L3PA 1BR2A 1Q95G 2PLYA 4R55A 2D45A 4GBQA 1W5SA 3MHXA 2OF7A 2FRWA 5KCMA 3NPFA 3CCMA 4B8XA 2F2XA 5CVIA 4MTDA 1XCVA 2NNYA 3HTSB 3G6EI 2XI9A 1V29B 1XCBA 2X1DA 2R58A 2RD1A 4PJOG 2KISA 1YJWQ 4IQJA 1YIOA 1S3JA 3K9TA 1S5LC 2DMPA 5E79C 1J59A 5A0GA 4JRQA 3LSHA 4M6XA 4XORA 3R61A 2BGCA 1OFCX 4E47A 3M7GA 5LL6S 1HF0A 5M3MJ 2QEXI 1M9SA 1UHFA 2JUCA 2KIUA 1WJBA 4AG1C 2W25A 2HTSA 1QPIA 5HODA 2KBTA 4MDXA 4YIIA 4F7UF 3SEQA 1PKTA 2CUJA 3C7JA 2O9VA 2RJDA 4RKUE 3ZN0A 2V4JC 2L7KA 3SDZA 3K70C 3GVAA 2M4GA 2PFBA 4P96A 1OYXA 1U2WA 1H9GA 1OQYA 2I5UA 2VKVA 1W6XA 3EAEA 3ULRB 1RUOA 4D8KA 4PJNA 3VYGA 5E3LA 1B6AA 2FE3A 2O8XA 1ZUYA 4U0VA 4CC3A 4D8DA 1GFDA 2WV1A 1ETXA 1P92A 2QQ8A 5DDGA 3OYFA 1XMAA 4KBMB 4YIRX 5TRDA 4CCMA 3IQLA 3KBGA 1ZELA 2YU3A 3DTIA 3MJXA 4LE9A 1VQ7Q 3CPWP 3TO7A 2D8JA 3JAME 1IREB 1HW2A 3OYAA 2V79A 1PD0A 2JT4A 2RHXA 4U0WA 3LLRA 4KT5C 3HPGA 4X9DA 4AFSC 2KAFA 1YRNB 3CCRT 1X3UA 1B7TA 1KQSS 1YJWA 1JUSA 1A35A 3IRRA 2DEUA 3VRYA 2LSOA 1ETVA 3CD6Q 1R36A 1Y71A 4ESRA 2K79A 3LSPA 1Y6IA 4M7DE 2K5IA 2GA1A 3L42A 1Y96A 2G9WA 4ENKA 3PMIA 4NB5A 1VA7A 5LGTA 3IH4A 1TQIA 1E3OC 4M3DA 2CP2A 2DRKA 4B6MA 4F14A 4RGXA 2LREA 4D7NA 4HBLA 4AVPA 4HA8A 3V7RA 1FMKA 1IO6A 2D6FA 4N4OB 3GIBA 1K0SA 1SD5A 2P5KA 3S3MA 2NUTB 2CSOA 1UG0A 3I54A 1UGPB 2KEAA 1Q86C 2ELJA 2V9PA 2DFFA 2VBYA 2VI6A 3RTRA 1BBZA 2EYQA 1H3ZA 2HZDA 3C2BA 2O88A 5ICFA 2JW4A 4B43A 3ZXSA 1J9IA 1AWOA 4M7AD 2DPDA 1X6BA 4CI0C 1VQ7A 2FF4A 2JTEA 1BIAA 1FY7A 3KPHA 4PJMA 4ZDPA 2EZHA 2XSDC 2IA0A 1ZR2A 2STTA 2WTEA 1XX5A 3IP4B 3C1DA 5LHIA 3CC4Q 3OIQA 3MFKA 3A01B 3M0PA 2CG4A 1BBYA 2QGGA 3VS0A 3HOYJ 5HKCA 2MOXA 3CCSQ 2DODA 3TP0A 1VIEA 4WCIA 2KYMA 4ON0A 3WU2C 4JX4A 2R4GA 4OVAA 2PJRB 4C8QB 2HL5C 1TT5B 5D5UB 4XLFA 2NYXA 4RTXA 2VPLA 2F4IA 2WY8Q 2KRHA 5IT3A 3WGIA 5TISC 1ULYA 4QLCU 3HEFA 3CD6A 2ECBA 2ZCFB 4XMYA 1W2BA 3MP8A 2DJZA 2A6EF 2CW7A 2IA1A 4ZJZA 5JI6A 4FTHA 2PNIA 2Y69H 5J8CA 2ZMEA 2IW5A 2R5MA 2RHZA 4NBQA 4OIPF 3HSBA 1TWCJ 2FMYA 3M4OJ 1D3BB 3NARA 1NJIC 2JXBA 4BU2A 2ICWG 5B3SH 4I7HA 1X1PA 1Q7YC 3SWNC 4JLIA 2V9VA 4UVBA 1YRNA 1IRGA 2CFOA 3V8JA 2YUOA 3CCQI 1DP3A 3IH2A 2EQRA 2WAQA 1ETOA 2LT4A 3KYDB 3LQRA 5D6YA 2V1XA 4BAYA 5JVTA 2F5CA 1YLFA 1MSEC 1ZLKA 2ZB9A 2R5YB 2VONA 4C0GA 1EH6A 1W7PB 1U3EM 4EV0A 1ZA1B 3BY6A 1S9HA 5GP9A 3J7AY 2OV7A 5DM7F 2AZSA 2DDBA 3G4ST 2DT6A 3GTMJ 4WWCA 3QBYA 3CC4A 2D2WA 4NL2A 2MABA 3CCSA 2R7SA 5GAGJ 3NQOA 1K83J 1U5SA 4HV5A 3EFRA 4M77C 1UJ8A 2Y75A 3DKYA 3V7CA 2DXIA 5IHIA 1U1SA 4R56A 2GM4A 2NUTA 2ME0A 1M27C 5BNGA 2LTOA 3DPUA 3I64A 3JRIA 1C6VX 1VQ8I 4RG2A 3BJ6A 3KP3A 1XS9A 3OSSC 4P9FA 4JLGA 3L2RA 3F23A 5IH2A 5FLXZ 2XK0A 2H6CA 2QZ8A 5CLSA 4ORZA 4UHTA 1RAFB 1UHWA 3LAJA 4BQAA 4J8OA 1ZGAA 3N05A 3DU6A 3CLQA 2EJRA 4M9ZA 1IUYA 5HLHA 2KRMA 1M3BA 2DPUA 4IRHA 1ZREA 2H8RA 3HRMA 1HD3A 1N6AA 2QAZA 3MKDA 3CC2Q 1UJ0A 1BR4A 1IRFA 3J80K 2ZPBB 3VU3C 4K2EA 5GMKm 2ENMA 3CCVQ 1AWXA 4RDUA 2LVSA 4LG0A 3O6BB 2PJRA 4C8QA 1R1VA 1X2NA 3BR5A 3MKLA 2NVTJ 5IXFA 2DFHA 4IUVA 1ZX6A 3MN2A 1B9NA 4V19K 2PMZN 3LWHA 2IGMA 3R60A 4WCGA 2AIRB 1G5VA 3BTCA 1ZTRA 4RGRA 5CVJA 2BXYA 5LJ3j 1WJAA 4FX0A 1W0TA 1XSVA 3QOPA 5K7FA 1KK7A 1PCXA 2WBMA 3E6BA 5AYFA 1HCRA 2EV0A 1FP2A 3GBGA 1PSFA 1BK2A 1GFCA 1OZ2A 5CAIA 2O6GE 1D3BA 4PJOC 3HHGA 3SB2A 1S1NA 3PJRA 1KSWA 3EG9B 4HSTA 3NWSA 1MBGA 3CCLQ 2HVQA 3QWLA 1ERDA 2OTJT 3K1PA 1FYLA 2J5OA 1Z9QA 2FUG2 1WIEA 4S0HB 3SDBA 3K4BA 2DL3A 4M77F 4E7ZA 1QPMA 3MP1A 3Q0WA 4D5CA 3K4KA 3LQQA 1EFNA 5JFRA 2VT3A 1WJFA 2RQRA 3QO3A 1JHHA 2KGTA 2EYWA 1RKTA 2R5YA 3M0QA 1W7PA 4PFPA 4PZJA 5E3MA 4M7DB 4BI8B 3EG2A 2PG4A 1IGQA 1LPLA 4CCJA 2Q0OA 4HT8A 4ZTFA 5GAOq 1N9SA 1QCFA 2EFQA 3T5XA 1SEUA 2MUNA 2E4HA 2RF0A 4XTZA 3EG0A 2IS4A 4HVWA 3J81Z 4M7AB 1AOJA 4FSXA 2LOOA 4JJNK 3ML6A 4JK1X 3HUGB 3CO7C 1DP7P 4PFOA 1M1GA 2L3QA 3HYIA 1WRJA 3CCVA 4IX7A 2RKHA 2E65A 2DA1A 2Y31A 3S15J 1E7OA 2CH4W 2LY1A 1KD1R 2QCOA 4N9IA 2DK5A 3ZBDA 3F21A 2CS3A 3JV3A 3FXKA 3T0YA 1JU5C 5LJ3e 2QYZA 4LGWA 1VQNT 2MYSA 4LMYA 1FBSA 2TRTA 3JRFA 3MVPA 4I0BA 1S7AA 3I56Q 4CO8A 2O31A 4ATOA 3A0HC 1MKMA 2BY2A 3B73A 3LFUA 1SEMA 1Q82R 2R5ZB 4PJOF 1H9TA 3G1OA 3RDVA 3IKVA 1R8OB 1YX5A 4HF0A 2IVWA 3L2QA 3BQYA 3NMZC 1ACIA 1P6RA 2K4BA 3A4CA 4A3KJ 4U7DA 3VKIA 3UPUA 2DPPB 2LP5A 1VQ9A 1ZARA 2EBIA 3H35A 5GANd 4HEA2 2Z5UA 1WFWA 1DU6A 5IYCJ 5CPRB 1XC5A 3PNYA 1DPUA 1N75A 2M4KA 2BVLA 3CDIA 1FTZA 3ZQFA 1OI1A 5M5YJ 3CCMT 4KUDK 3CPFA 4EMKC 3OSGA 3CF5F 2DO7A 2HCKA 5KVRA 5E1XA 1T0JA 3I4PA 4BD3A 2DKGA 3J80Z 3EG9A 2E36A 1I5ZA 1N25A 3CCRI 1IGUA 4PUSA 2M0OA 2IP2A 3OS2A 1NEBA 4FW1A 1BM9A 3MEXA 3ZQLA 1B3QA 2DNUA 3META 1NK3P 4RAFA 4A0ZA 2OTLQ 1XQHA 4C92D 4RB1A 3QPTA 3FB9A 3S32A 2LQNA 2Y9ZA 2LR8A 2JUFA 4IO9F 2NNNA 1MDMB 2CW0F 3PIPA 3H0HA 1WQ2A 2DA9A 3FHZA 4KDPA 2X6WA 1ETQA 2WB1A 4HYEA 3QU6A 3OYCA 1M3CA 1WI7A 2EJGA 2Y4YA 2BHYA 3VS6A 1QVUA 1X1AA 4E70A 2AHJB 3I56A 1SAUA 3K4MA 5I21A 1QA6A 2IXSA 4R0KA 3JCMd 1IAWA 1MHNA 2L3DA 2EZIA 5L8RE 4LUEA 4Y92A 2DETA 1FLIA 3CCET 1HDPA 2IJLA 4L9TA 4M7AA 2NOJB 2R7VA 4FE4A 2FVUA 5KYNA 2W57A 2CUFA 3HUGA 1Z3XA 3R6NA 4JZ3A 2PEXA 2B7EA 1K7AA 5C6SA 3QRFF 2K3FA 1UFFA 3VS2A 1AKHB 1CKAA 5HS8A 2ZC2A 4IHSA 4M78C 3M59A 2Q2EB 3HBLA 1YIJQ 3O2PE 4BY7J 3U1DA 1K9MC 5IT9E 4E4HA 4UY8I 4L5EA 1FMWA 2A36A 2PZ1A 3J80R 3CO6C 4HDVA 4ENNA 2EGEA 2COBA 2QQ9A 1RNLA 1JJ8C 4A4GA 1YJWT 4EM1A 1WJQA 1Z3YA 2JMWA 1X3ZB 4BGDA 4HW0A 2E10A 3Q1JA 2R5ZA 4M75D 2KL4A 3LH5A 1MV3A 3BPVA 1FBQA 1A36A 2CGPA 2R7FA 2QTVA 2YLBA 1ZQ3P 4NS5A 5FGMA 2HXOA 4OMQA 4LLGF 2FRHA 3D1NI 4BDYA 3FKIJ 4I09A 5ILUA 3GZ5A 1OCOH 1XPXA 2VOOA 1XTDA 4RB3C 2E1HA 4BUGA 4WTOB 2OTLA 2MLGA 3A1YA 3UR3C 4D0PA 2DYIA 2XASA 3GTKJ 1OYYA 1XGSA 2EPDA 2RVCA 1JJ2A 5E3OA 4U7BA 2K7AA 5IHNA 3N5BB 4NC6A 1YI2Q 2FBIA 2KIQA 3BCBA 3UNGC 2LJ3A 2DT5A 2E5KA 3CMAA 1BI1A 2QG9B 1RR8C 2EVRA 4Q5SF 2E5ZA 2G0EA 5FKNA 3QYFA 5GAOn 3BQZA 2VGMA 4AM3A 2CP0A 1SG5A 3K2AA 4PJJA 1KFZA 3O5ZA 1D0ZA 2HWVA 5A2QK 2RH2A 5CK9A 4AG2C 3CBMA 1FOYA 4V2SA 3HG9A 2RDPA 1SANA 3LA3A 4MEYF 1HXDA 2A6HF 2HBPA 4NOYA 3OW2P 1GXIE 3CC7T 1VQ7T 4S05A 1YIJA 2W00A 2L54A 3FM5A 4L9VA 4XRFA 1MDMA 4M78D 5IOZA 1WJEA 1XG1A 3A0BC 1G2HA 2HFHA 1FC3A 3HRSA 3V8KA 2CSIA 2LQ8A 5IHKA 3TO6A 1ORKA 2WADA 2AO9A 3KEYA 4A3FJ 1I3AA 3UKGA 4W1UA 1P7IA 3CESA 4O6JA 3FMQA 2AQFA 1TQMA 2BV6A 1WVRA 2EIMH 2YU9J 2JVVA 3LX7A 2P6TA 2CZ6B 1VQ6A 3CD6T 4L5GA 1E17A 4J6WA 5JVGF 5DTDA 3K4NA 3OY9A 1H89C 4YFXF 1CQTA 2XB5A 1PP8F 3A1PA 1IN8A 3FZVA 1YFHA 1AKHA 3LSKA 1L3LA 1N27A 1MMAA 3BWGA 3M07A 2MLKA 1BC7C 2BKDN 2DD4A 2Q2EA 2KI7A 3X28B 3SYTA 4XRSA 3SEMA 1I8FA 3GEZA 2JMCA 1KIKA 2VC1A 1QO0D 3PVQA 3BDDA 1RLQC 3FBNB 1SAXA 2M3AA 4G12A 1K8AU 2W48A 1MJAA 2DQRA 2H09A 3HFNA 3BDLA 3I9QA 3OR2C 5C0MA 1R71A 2KDZA 3TDUC 1U9OA 1MMSA 2FBHA 5L3FA 2ZBKA 5KK1A 2M35A 1KJWA 1X01A 2F1LA 3TREA 3VS4A 5LJ5g 2XAHA 3EYYA 1GDTA 4ZN1A 2V9KA 2XPVA 2V8JA 5FKOA 1Q82U 3GW2A 1I39A 5D6XA 3F6OA 2A69F 1TW2A 2WC2A 2ZJ2A 5CVRA 1RRJA 3ISPA 3SZTA 5E3NA 3FMRA 2QI2A 1D1CA 2JN6A 3K0LA 2BUDA 2ZXWH 4J9BA 2XF5A 3NTKA 4C92B 3ROUA 4XK4A 1TWFJ 2KJBA 4OGCA 3CCST 3OOPA 2ED0A 2CP7A 2FO0A 1RL2A 1E6HA 1T6SA 1TWBA 1JJ2S 3CXCA 3CDHA 2PQ8A 1VQ6Q 2OTJI 2L7MP 2PVDB 3PSFA 1VF9A 4M6VA 3J7AO 4DEYA 3WU1B 3DPTA 1LNXA 3DEEA 3PQKA 2NUPA 2XVCA 5LJ5f 1AWWA 3KP2A 1NEGA 3BZKA 1FSEA 3CC2A 2I10A 2FHDA 2KPMA 2FSWA 1UTIA 2VUBA 2XMFA 3ME9A 5HLTA 1MW7A 1BCMA 3ABUA 2LP0A 3GPLA 3RQ4A 2DIQA 3PL8A 5A2QZ 2XU8A 2CV2A 3A8MB 5GAMd 3VFZA 4OIQF 3PUFA 4UNOA 3L00A 1QLYA 3MMYB 4YELA 1EZZB 3REOA 2Y0SA 3H5AA 3A8OB 3G7ZA 1CKBA 4C5EA 2KXCA 2O9LA 1QCNA 2K5FA 1ONVA 1SRLA 1IHVA 1FWZA 3JB9D 4JUVA 4BEHB 4XN0A 4J01A 3H8ZA 3L1AA 2PI0A 3DFGA 3R6SA 3PGGA 4M75B 5CKTA 3T8RA 4AFQC 4HNVA 1BC8C 1REPC 1I6XA 1LVAA 2YSRA 4CA0A 2K02A 5LHHA 1VQNI 3ERMA 2CZ0B 2KR3A 3QDRB 2HDWA 4IHXA 4BE1A 1I0CA 3FWEA 1SPKA 1ZG1A 4OF1A 5LBQA 1OPCA 4N0AC 4RGSA 4LLLA 2LBFB 3TOBA 1LNWA 3WTZA 4QTRA 3ABLH 2X98A 3HFOA 5GANj 2X4JA 3Q5FA 4XLAA 4KMUX 2GXAA 3P7NA 1K9MR 3HSFA 4OP0A 3OIPA 5E8GA 2DTHA 3FXRA 5D5VB 1NBEB 4BJ6C 3W6VA 4Y52J 2GAUA 2OJED 2QENA 4KUMA 4A3IJ 1UHCA 2FRYA 2JM8A 4HCBA 1D5VA 1YFNA 4FHTA 4M71A 1QVGP 1I5LA 1OKRA 2PN6A 1G6NA 3GFLA 1ZSZC 4M7DG 1KU7A 3CCMI 3L2CA 2LKXA 2E3IA 1QVFA 2LMDA 2KXDA 2RB6A 4MDWA 4DOWA 2M2EA 4C92A 1G3YA 2BW3B 2FMLA 2KFDA 1ENHA 3GMEA 2CP6A 2FOKA 3TU4K 1M1KU 3PQJA 5E20A 1BIBA 2XPWA 1OCTC 1C0MA 1X69A 2J6OA 1X19A 3LSRA 1PRLC 2EGAA 3CCVT 2BZTA 3JREA 2QM3A 3WE2A 5KE3A 3HOWJ 4OMMA 1L0OC 2V8IA 3O8GA 3VOEA 4ZYDA 1YW9A 3QYHB 2X51A 4B48A 4PLIA 4KRTA 4CICA 2GZWA 1IG7A 2E7XA 3SHWA 3CP8A 2HL3A 5K7HA 4EGYA 2WSFE 1FYMA 2E19A 3KZYA 1ON2A 2DZ9A 3KP7A 1SFOJ 2AK5A 3TEEA 3CPWS 2CWEA 3CUQB 4G6QA 4XIDA 1MNMC 1RUWA 4C0FA 2I0NA 3E9FA 3CCLT 2XAUA 2K86A 3MAJA 4GO1A 3H0DA 3EFSA 5A0LA 2PMZA 4BYYA 5DS9A 3CCEI 4FQGA 1GXPA 2XAQA 3M0SA 5KYWA 1IV6A 5GANe 5CR2A 2XV4S 3IAM2 1NG2A 2CSQA 2EYYA 4M3GA 5HY6A 1X2QA 3AG4H 5FU7C 4BEHA 3CCUQ 2FZKB 4O3MA 2P0TA 1RAEB 2DFUA 3BR1A 4M75A 2MH2A 3D5SC 3VWBA 4XLPF 1LVKA 2H94A 1QZYA 2W24A 5FFZA 3OYNA 3AL0C 1KQ0A 4X1VA 4A0YA 2ELHA 5L3CA 3VS1A 2C0OA 2CH0A 3WVEB 3RMQA 3BG9A 2LBFA 3KYCB 3IH3A 2BEOA 5J1RA 1XTAA 3BC8A 1AHJB 1G83A 2C0TA 3JR9A 2DVJA 4GY5A 1NPRA 3CLOA 4NNJA 4FX4A 1K76A 2K57A 1WYXA 2QASA 3F72A 1G4DA 3QJ6A 1R4MB 3OV8A 2JTVA 4DW6A 2D5VA 3BCAA 4XSXF 5J1UA 3JCMe 2K40A 4DQ2A 5E17F 1M8MA 2M0YA 4OGEA 3TSWA 3I56T 3SQNA 3HPHA 1K0XA 2E1OA 5GPCA 2PMUA 2HGCA 5J3LA 1B72B 1XGNA 2EIKH 4MFDA 4MZPA 5I2SA 4XKCA 3JRDA 1FOKA 1HSTA 2BOLA 1B34B 3LGFA 1KQ2A 1G59A 2XHCA 1OCPA 1MGTA 2DA7A 1LOJA 2GIZA 2L9NA 1AZGB 2BIVA 3GTLJ 3CBPA 1DPRA 3H41A 3I55A 4KUIA 2YRDA 2CU7A 4NHJA 3QOEA 5F0FA 4OAZA 3CCUA 5M5WJ 4IUTA 2COZA 3QHSA 1BJZA 2HPIA 2WB1N 4BQOA 5ICGA 5KE2A 5FKLA 4A6DA 1TOVA 3CC7I 3QUIA 1W1WE 4OAYA 1VQ7I 4C8QE 2VKEA 5DCFA 4RTTA 5TGTA 2E1MB 2KJCA 1R58A 1Z1DA 3CUQA 2H3JA 2PUKB 3DLLA 3JB9H 4L5IA 5D7UA 2M1HA 1KQSA 2BTTA 3U2RA 2E1NA 4LB6B 1X6OA 2L4AA 4BUPA 1Z0XA 4QQDA 2P8TA 3A5ZB 5IAYA 5H2FC 3BJAA 5C44J 1RIOH 5M5XJ 1F9NA 3SXYA 3ZMVA 2X3XD 1I27A 1LCKA 3CD6I 1KG1A 3JCMP 1VTNC 1IZ1A 2DD5A 2CQXA 1X1CA 2NS0A 3ASOH 3A98A 3CDLA 3WTYC 2EYXA 3CMAT 2EAYA 1IDZA 1S29A 2MGQA 4KT6A 1MBHA 3ZN1A 1T0HA 2X85A 2X0LA 3RUXA 5F0CA 5D6EA 1IC8A 2CT3A 3KUFA 3R6OA 2P7VB 4MZMA 3BW1A 5GMKh 3MZ8A 3FKJA 1OCCH 2E2IJ 2QA4Q 4QT7A 4PNOA 3L2ZA 4YG2F 2XG8D 1KD1C 4FISA 3WODF 5HDGA 4ZGJB 4U88A 2KZVA 1GV2A 1JKRC 1CGPA 2B0LA 1QQIA 2EZLA 4K11A 2DAQA 1YIJT 4M7DA 3OYMA 1G3WA 2FPEA 2YX7A 4GGGA 2RQTA 2EFIA 2IRFG 1BW5A 1KHIA 1QWFA 4JRIA 3M0RA 2NYSA 1B72A 2DL7A 1VQ5Q 4OIOF 1UE9A 5EC7A 1UAAA 3CCSI 1T2KA 1B34A 3PFIA 5M3FJ 3FDRA 4YEJA 3BFMA 1XSDA 2HDDA 2MG4A 3LWIA 1GVDA 5CQGA 5ICCA 3LAPA 1YS7A 2E7WA 3WHBA 3OYGA 4IOAF 3MEWA 2C06A 4J9FA 1RUNA 3G71Q 3GP8A 3PE0A 4CXFA 3CCUT 4CC4B 3GTOJ 2EGCA 2I2LA 2MPXC 4RTUA 1O3QA 4CRIA 2JA7J 4ZGDB 2F2VA 4MEXF 1KU2A 2LCSA 2P0PA 1YI2T 2ZPGB 5GAMj 1HJDA 3MO8A 1UMQA 2L9SA 4I01A 3SHFA 1IGNA 1D8JA 1JXSA 3GO5A 1IRZA 1GCQC 3E9GA 3FLGA 3HTRA 3H5NA 3OYEA 5HOOA 1HDDC 2DBKA 1KZHA 4XN3A 3S8PA 2ZMEB 4A63B 3QZ9B 2IS6A 3LSJA 1D8KA 3LA7A 2K3PA 3EUHC 3HGGA 2QA4A 1IV8A 2QKLB 2RNGA 4PLLA 3KLNA 1YJ9A 4CCNA 3OS1A 4J9GA 2L9RA 9ANTA 3KX2A 1UDLA 3I58A 2FOWA 4EJOA 4M7DC 3C18A 3FDYA 1YWPA 3IWZA 2A37A 1ZG5A 1J0RA 3S1NJ 4RA2A 2E12A 2FPDA 1RESA 2W10A 3M58A 1KC8C 2V6CA 1MNDA 2CH4A 1YG2A 4NDLA 2HMAA 4XM3A 5GTIC 3FIWA 4A5MA 4PL6A 2JK3A 3KXTA 1VQ5A 2ZXJA 2CQ7A 1UGRB 5FWBA 2ZO4A 4RMNA 1K79A 2F2WA 4ZYEA 4UV9A 3I9V2 4GFBA 2J06A 5I22A 1WNLA 1N8RU 2VBXA 1OCZH 3K70D 3G71A 2Z2SB 4ZYAA 2GA2A 4M7AE 1IF1A 1UELB 1KQ8A 2RPNA 1EH7A 2HTJA 4ELYC 2EQIA 3C2GA 1R5ID 2P6SA 2JM9A 4LD9K 1YX3A 2BYVE 4HDUA 5GAMe 4LDWA 3GFMA 2EQJA 1IN6A 5ERIA 4Y33A 3WHCA 2XKPA 4PSWA 2DCEA 3UF4A 2HYFA 2ZPIB 4LDUA 5FLXE 1X4OA 2JRTA 2HDCA 2LMJA 2K3BA 1D0XA 2LLKA 4M73A 5D4SA 1Q81U 2CYZB 3H3VK 3DKWA 3QP6A 5E18F 2FPFA 4DOVA 3ERED 5C4JJ 1WGXA 3CCVI 2Z0WA 5EDNA 2WA0A 4IRGA 4XOPA 1VUBA 2H6BA 4OOIA 3WG7H 1QZZA 3W6KB 3H0GJ 3KLOA 3RZDJ 3LW5E 1D1BA 1ZKGA 1OV3A 2NVUB 4A0XA 1MH4A 1QQJA 1YCYA 5CKBA 1RAIB 3OYHA 1FYNA 2Q8KA 4CZZA 1ITYA 4LG0B 3BLYA 5LGNA 2GGRA 4OMZA 2FX0A 1F5TA 4C3IJ 2KK4A 3G6EQ 4M7DF 2O4XB 2SRCA 4XQFA 1IDYA 1WSUA 1RAHB 2L02A 2KKOA 3M53A 2YPRA 1ZRFA 2BBYA 2Y0SN 2HEOA 1VQMQ 3LSTA 1GVJA 2QQBA 3CCLI 1QBJA 1EH8A 1P9QC 4JBAA 4C0DB 3ZQIA 2DA5A 4JRKA 1VQLA 3OSVA 2X6YA 2KHMA 3O8HA 2UXNA 2E41A 3T8TA 3F70A 1ZBJA 3JSCA 1JT6A 5FU6B 4I02A 3RPUD 1BU1A 1HSQA 2R93J 3N97A 3KFVA 2Y30A 3DKXA 2RI2A 1X1BA 1JJ6C 5DV5A 1R00A 2L5QA 4JX6A 3HL8A 4BHPA 1C0WA 4LUDA 4XAXB 2LD5A 5EZHA 2HOTA 1X75C 2XDBA 2EH3A 3GXOA 4JS5A 2KE9A 1V1CA 2EK5A 2QSFX 4B09A 4F52A 3BTIA 2VQGA 1VQ4T 2OPTA 3TGNA 3IL2A 2MWPA 2IVMA 1IO2A 4KN7X 4E7HA 1M4ZA 1QP3A 2PMHA 4NQWB 3TQ7P 1U5TC 2RJFA 2EKOA 3A8HB 2DAOA 2F6CA 3J81E 2WY7Q 4DNCA 4YIFA 4A3JJ 5LEJA 2R7DA 1RR7A 3RYPA 2L2PA 5KYXA 1IHWA 2IPOB 3O3KA 1FNNA 3LA2A 3MCZA 1W5TA 5GTHC 3ESWB 4EGZA 3PM1A 1DQUA 3LFKA 3P5JA 4CHUA 4Z02A 2OUMA 2QUFA 1W36C 3S2WA 4J83A 3G6EA 2M8EA 2CUEA 3H3ZA 2M8GX 3K4LA 4N4HA 4O5VA 1KU9A 3H9QA 4N9HA 4R8HA 1BI3A 4EATA 1H0MA 2EQUA 1VQMA 4H4KC 5BMZA 1T38A 1HK9A 4E2FB 4L59A 5F08A 3JRAA 3JCMJ 2Y4XA 1WI9A 2NRAC 1I1GA 3LSMA 4OB1B 2X4YA 2F5DA 4BXUA 3GZNB 1MGQA 3QG1A 2NVYJ 1H8KA 2YT6A 3GNGA 5HLGA 4BXXJ 1I81A 4KIFA 4X0GA 4Z88A 5M9OA 5J40A 4EIKA 4KGXB 3RERA 3HM5A 2ETHA 1J5YA 2ZFUA 4WXDA 2O4XA 1V3FA 2KRCA 1PRMC 1YN8A 2GFUA 2HD0A 4IOCF 2RK1A 2GCXA 3UDCA 5DY9A 3ECOA 2ZKZA 1OR7A 2KNBB 1IUFA 1MV0B 5HDNA 4XBFA 5JR3A 2ELKA 2Y2ZA 1K73C 1J09A 1YTYA 5D8LB 4ANJA 2JTFA 5LJ5h 4FYXB 1XNIA 4OB2B 4JRPA 4IHVA 1VI0A 1Y56A 4IRIA 1RI7A 2IA2A 1TSFA 4N4NB 4PSXA 2XAFA 3M57A 2KIMA 4M77D 3FF5A 4KULA 4HLXA 2K7LA 2DRMA 1VQ9Q 3CMAI 4RUGA 5EJCA 4F93B 2EV6A 2RI5A 1Z67A 3I59B 1GUUA 2HSPA 1SFKA 2CV1A 1W4MA 2BE5F 2MD5A 2IGNA 2XPUA 3Q0VA 2JA6J 3J7ZI 1ACMB 3EQLF 1NLOC 5K1YA 4A3BJ 5H20A 1TWGJ 4XKWA 2EILH 4Y91A 3K6GA 1ETKA 3BROA 4XTXA 1E2XA 1KC8R 1H92A 1USTA 2K85A 1FTTA 4NQWA 2XF7A 4G7HF 2E60A 1T8IA 1R0CB 4UC4A 1Z77A 2X48A 1SFEA 4QPQA 4XL9A 2DA6A 3MZYA 4HQMA 3HXLA 4JZ4A 4F17A 3E97A 4EJUA 2OZ6A 3FM3A 5DD8A 3AFHA 3FIFA 1UHSA 2X9DA 3I5RA 2OCCH 2LG4A 3UWNA 2DU9A 4LK0F 1YCSB 1PVEA 2MC4A 2LQKA 2OJ2A 1PUEE 3CBOA 1Q86R 5GMKl 3FEOA 2LKPA 3TBIA 1VQ6I 1IJWC 4PJOD 3HTUA 1W2BP 5LD2C 5DM7R 1T0FA 1MBKA 2FEZA 3SFZA 5CKDA 3K4JA 2NUZA 4WXCA 1MIJA 3Q9SA 2H27A 3G1LA 2R57A 4GRIA 1YI2I 1VYUA 4Z89A 3PNWC 1TBXA 4UV8A 2E1CA 4V2FA 4QVZA 2VXDA 2QQSA 3TO9A 3MPUB 1UEBA 4M3EA 4B3XA 4A93J 2VC8A 3GLLA 5FLMJ 5KYUB 4MZTA 5KNLA 1BB9A 5GAN3 2O3FA 4UUSB 2OCEA 1JUPA 2ME6A 1I4K1 3ABTA 4C92E 3I71A 1OX9A 1T3LA 2M51A 1JXOA 1Y0UA 1GBQA 2K2MA 1S8NA 2Z33A 1ZUKA 1Y1VJ 3F8FA 4KYWA 3E3VA 3DKMA 5FROA 5CCAA 4MQ9F 2BZXA 4RMOA 3GUDA 4J9IA 3R0JA 5D6FA 3Q9VA 2AKLA 2JS0A 5ICEA 1NH3A 2ZZDA 3HJEA 2PUOB 1YITQ 1NJIR 1UHMA 1OULA 2J6KA 1N78A 3M9QA 2A61A 2KDSA 3OBWA 4E6KG 1EJ9A 2M1BA 1X2KA 2Y90A 3I59A 4D6WA 1Q7YR 1RAAB 3ZFJA 1JQQA 2JOYA 3AG2H 3JSPA 1PSEA 2HYGD 1OZ3A 2FNAA 2JZYA 1QZEA 3ELKA 1TS9A 2RN8A 2JNGA 3D5LA 2WSCE 2XKOC 2DILA 2X9HA 2WV0A 3KCCA 2L8DA 1Z7UA 4S04A 3PFSA 2DQLA 2F5VA 2HS5A 3FX3A 2L3SA 3I53A 1AHDP 2L7FP 1MBEA 2XGXA 1HBXG 3FJ5A 2DMTA 3QXEB 1GL5A 2MIOA 2O0YA 2DA4A 3CMMA 1QWEA 2AHQA 4WX9A 4DBRA 3FXQA 4Y4RA 4Q5WA 3WTSC 1RABB 3BR6A 1PYVA 3SWNB 3LL7A 3J7AW 2D9TA 4AFUC 2TDXA 5HLIA 4YFNF 4M75E 4DA4A 3ZEHA 1F36A 2UV1A 2IGOA 2VBWA 3P9IA 4BS9A 1ZBXA 2QA4T 1S72Q 1OYIA 2VE9A 4LN2A 4L6V5 2FB7A 3DQVC 3G2BA 5HVQC 5H6RA 1KD1U 3WVDB 3SZPA 2V8KA 1M8VA 2VOPA 4Y28E 3ZQCA 5IT9K 2ADUA 2DW4A 4HF2A 1Z6RA 3M8FA 3PFYA 5E1WA 1M90C 4HQEA 4B3AA 1SVLA 2MFZA 2RHYA 4CC2A 3B6CA 1PUFA 5DEQA 4Q4ZF 4KT0E 3REBB 1VQ5T 1Z7LA 2F69A 3AT1B 4FYYB 1R0BG 4NL3A 3OW2S 4EQQA 5IP9J 1OU9A 2Z3YA 2XDPA 4M77B 1HKTA 3RPUA 3GFJA 1IXDA 1RI9A 3KP5A 5KYUA 4BJTA 5GAN2 4KICA 2M5WA 3RIRA 4UUSA 5LJ3g 3G71T 1JUMA 2IAIA 3NTIA 4CZCA 5F64A 4C3JJ 3OIOA 5CYVA 3RNJA 2VE8A 4C3HJ 2FG0A 1I6HJ 4FL6A 4A5NA 5EYRA 1USSA 1RLPC 4FYWB 2QVOA 5CQEA 2V1QA 4NC8A 2DLLA 2LK2A 4HVUA 2LY2A 4BJ5C 3PO3J 2CUDA 3RBBB 2MH9A 3F6VA 3WTUC 3CF2A 2NUPB 3BR2A 3IUOA 3DB4A 3ZQHA 4F92B 3HSEA 2LF7A 4HX7A 5IP6A 2QBYB 3INZA 3GCMA 3E6DA 1S72A 5LRRA 1IN4A 3JRGA 3G4SI 1F4KA 1VQ4I 1EIFA 1X43A 2F5TX 2XGCA 2JTMA 5A2QE 1LFUP 5GAOp 1AVZC 4BDZA 2L9VA 5LEKA 3OSFA 2QQRA 2RC4A 3DTEA 4UB6C 1IZ6A 3GTJJ 4Y3OA 3C95A 3UT1A 1R7JA 2BHZA 5LJ3f 3JCMb 3WG9A 3CCJQ 3M4GA 1ZAOA 5JHFA 3BT9A 2XC7A 3G73A 3WU0A 1FP1D 4E7SA 2LF8A 3OYJA 3D7SB 4LFUA 3PMTA 2O9SA 4XQ3A 3ZL7C 4PJOB 4C8QG 2V26A 3E5QA 1WHUA 1XDUA 5BQTA 1A0NB 4B4CA 1O3SA 3SWNA 2YUNA 4ZTJA 2CW8A 3V42A 4AYBA 1SFXA 4M72A 3JCMV 4L5JA 4IIOA 3VYUB 3WE3A 2R7UA 3MCAB 3TVTA 4JOMA 4DBHA 1AEYA 2MMPA 2VT2A 1UGSB 2GXBA 2DYSH 1YQAA 4C2MJ 1YITA 1A04A 4E7JA 4FU6A 1R23A 3SDGA 2HQRA 1Y57A 1Q86U 1JHFA 2OI3A 4FT2A 1VQPQ 2YUQA 1P7JA 2K9SA 1UG1A 1Y7XA 4XNFA 2RMOA 2FNPA 4HSRA 1K6YA 5EG2A 4BY6C 3LSGA 3DLLF 1XJWB 3S1QJ 3RKXA 4G9YA 2QGUA 3HOXJ 2L2OA 1UUEA 4FT4A 2X6XA 5B1BH 4IUQA 1GV5A 3Q3SA 4OU0A 2CREA 3VV0A 1SSHA 2H3EB 5F0HA 1DU0A 3CC4T 3BR3A 3DTKA 4RM2A 5IT9Z 1HA8A 4FETA 3HOTA 3OYKA 2Y0MA 5HCKA 1D3YA 3CCJA 2NVQJ 1T95A 4ENMA 4XTYA 3CPWA 3GWZA 4E6RA 2K5CA 2KVQG 3TEDA 3DLMA 2XUBA 1Y0MA 2K5LA 2D8HA 2YDLA 1FPQA 4M9SA 1VQMT 4EVIA 1A6IA 1KYZA 1TG0A 1WQ7A 1HYOA 2M16A 4HCZA 1IB8A 4KH1B 2Q1ZB 3S17J 4MMLA 2ZPFB 2QBYA 3S2HJ 2V7FA 1N5ZA 3QDFA 1NJIU 1W5CC 5GPAA 2GTOA 4Z8AA 2OBPA 1WFXA 4DJAA 1Q7YU 4CCLA 2IT0A 1F1BB 3K10A 2HKXA 3CCUI 5FKMA 3TKYA 4E7IA 1VYTA 2JT1A 4EMKB 1VQPA 2NOGA 4II1A 3FXOA 3F8MA 4PJOA 4BNCA 3CMEQ 1JGSA 2E2JJ 2DJQA 3V4GA 4HX4A 1A5JA 4M3FA 3FXMA 3MZHA 2O5RA 5HDKA 2P7CB 4DZPA 3RZOJ 2XROA 2DBBA 4NC7A 3VSKA 2L01A 1NZ9A 3K1MA 5EG0A 5IT9R 2LJ0A 3M1CA 1XMKA 3X24B 4LLNA 2V1DA 3CJNA 3OYIA 1JGGA 2CMPA 1WGSA 4RB2C 2LVMA 2RO0A 5IY5H 2VJ4A 1ZR4A 3MKZA 2DDAA 1JJ2P 4UVAA 4H0EA 2A5YB 2V1UA 4JJCA 4RTVA 2DLPA 3D5RC 1QW1A 5ECAA 4ETSA 3S1MJ 3I4NJ 1YNZA 2EFWA 2DN0A 4MTEA 1Y39A 1WJCA 2F5FA 3FK6A 4MGRA 2J7IA 2KY9A 3QYBA 3W6JB 1WH5A 1S6LA 1M90R 4XR6A 3K2ZA 4LITA 2Y48A 2PX9A 2KMUA 1M2VB 2C0IA 2E3HA 2V1RA 4KGVB 4YRVA 1FIAA 3EG3A 3M54A 4XU2A 4J9EA 4XTVA 1GBRA 3RR6A 1LQ1A 1O7FA 4LG3A 2RQWA 4M78B 2EZKA 3E19A 2D1VA 1XSXA 4I98B 2B63J 3PVLA 4HKEA 4M7AG 2D1XA 1R1UA 1E3HA 1YO5C 3GTPJ 2DI3A 2RNAA 3OMCA 2HOAA 1T56A 4GCVA 1LE8B 4I2OA 1TU0B 3O8VA 3CMEA 1AZEA 4CDGA 2R7TA 4IHTA 3T1BA 2ZMEC 2LRDA 4TVRA 2GQVA 2D0QB 1AA7A 1FSHA 5ILSA 1VQOQ 5KYXB 4P5NA 2RGVA 1GT0C 1OMIA 4KH0B 4OINF 4QIWN 2GOMA 3ZQGA 4A12A 1V76A 1YJ9Q 1PNJA 1S7OA 4BQNA 1QRYA 1Y07A 2EA4A 4EMHA 3U21A 3ZRGA 4ABZA 5HNFA 2A6TA 2XRLA 1R49A 1UGVA 4F04B 5L3DA 3I55Q 2BE7D 1VQ9T 4UUVA 4EMKA 2W84A 3FHNA 4IHYA 2LZ6B 2MF2A 3PIOA 2GLOA 4P1WA 2DXBA 3KZIC 2VUMJ 4ESFA 4IHWA 4OMNA 2MZ4A 3BOQA 1VFCA 5BS6A 4GDFA 2VB6A 3B6AA 4CYCB 2VPRA 3EUKL 4MQVA 2O8KA 2QA4I 3HIFA 4G7ZF 5JLWA 5GAOr 3KEOA 3IV5A 4IXAA 3SFMA 1TQPA 2DA3A 3HRUA 2JVGA 3ZGKA 3EG1A 4GLMA 1YJWI 3S14J 1BI2A 1Z9CA 1U3OA 1BN5A 2DXUA 1JTXA 2DMQA 3A03A 4LDXA 1FOWA 5FLVA 3EYIA 2K2VA 4XU3A 2RV8A 3VEPA 1OLTA 2VJ5A 3FISA 1X2MA 2QQAA 2L89A 5GAN6 1U1TA 4UUTA 4A69C 2JJ7A 1BJAA 3CZ6A 3FXUA 6AT1B 1ZG3A 1VQ5I 5BOXA 4J9CA 2KSSA 3OB9A 4DEXA 3CXCP 1OEBA 2DF6A 1I1JA 5CIUA 1VQOA 2D0NA 1LJ9A 5JLXA 1HW5A 3IC7A 1M2VA 3G71I 1MD0A 2RAEA 2UUZA 1FJLA 2VODA 3GTGJ 1RACB 2O03A 4PJLA 1T08B 3QPSA 4HXJA 5KYWB 2VKNA 4C8QC 4M78A 2KIFA 2EFOA 1VQNQ 1UFMA 3ASNH 3EDPA 2H1LA 3BG7A 3CJRB 1ON1A 2MSYA 5F1JA 4KMFA 3M55A 4HX8A 5FWCA 2K6DA 2EW3A 2IG0A 3HRTA 2OAWA 2TCTA 1LE8A 2QSHX 3KIOA 4RLQA 1QMCA 3V7SA 3FXJA 3H92A 4IL6C 3GLXA 4BBRJ 4KJZA 5IP7J 2XIGA 5ILVA 2DX1A 1H3HA 3VODA 5J6XA 4MO7A 4BBSJ 1SKUB 1XOVA 1KU3A 2DL5A 2E34A 4BHCA 5FKKA 4RAGA 4XRSG 4A3LJ 3S3OA 4LIVA 1QKWA 1CF7B 5GJVB 4IVNA 4BI3A 1MH3A 4FT8A 2E6ZA 2G7UA 2EFPA 5EF6A 4P9UA 4F7ZA 2XIDA 5GAOm 2JN0A 1NHAA 4XSZF 3TMOA 4KIBA 3QAHA 3RDIA 3QKJA 4J5YA 1YITT 1NG6A 2M30A 1OU8A 2OTLT 3C12A 2CQKA 1SMTA 4XICA 1OYWA 4PFZA 1BOAA 4RTZA 2MI6A 3BR0A 2EJFA 3F8NA 2FJ1A 4DYCA 3DBRB 2XAJA 2CYYA 3NWTA 5LHGA 2VJIA 2KRFA 4G8XA 2MVTA 1HQCA 4CH7A 2DJIA 1BOBA 4PGGA 2OZUA 4CYCA 1AWJA 3HPWA 2DERA 3OYDA 1HLVA 4OMYA 4EM0B 2EQMA 4W97A 4TV7A 1QCOA 4D1QA 2IIMA 4D5FA 1FBUA 3L1PA 2KRSA 2JS2A 2LCCA 2ZJPF 3HKZN 1BCOA 1VQKQ 2A5WA 1VQNA 2UXXA 3TDZC 4WK8F 3VS3A 5DLOA 1QVFP 4EM2A 3FBIB 5GANg 1I3QJ 4C8QF 5J39A 1K9AA 1WHGA 1O7LA 3CP2A 1TT0A 2ZXHA 4KFCA 1Y8QB 4YTLA 1ZK8A 3VB2A 1S72T 1SMYF 1JO8A 2PVGB 3IKTA 1K9MU 3F8BA 3VSLA 2HZYA 4M74A 3RSNA 2WWYA 1UB4A 4QQGA 5IN1A 5GAN4 1PWTA 1DUXC 2EJ9A 1G8XA 4A4FA 4KITB 2GBQA 1P2FA 3W2WA 3CC4I 5DLQE 5AIPA 2DL4A 2HOSA 1O57A 4JDSA 4QSHA 4AU7A 4F16A 2KZGA 1WZ2A 2YXYA 5K5QA 4LNPA 2G7HA 1JXMA 1M90U 2VGNA 1FX7A 1JKQC 2O61A 1SHGA 2YUPA 5HK3A 2FD5A 1YJNQ 3RMSA 3DLAA 3VUZA 4BL0B 3FK7A 3F22A 2CUZA 5L3EA 2ROTA 2VYTA 1G3TA 4N4GA 3OOUA 1W7PD 3HHTB 5BPIA 2GTJA 1VQMI 2MW8A 1PDNC 1QKXA 1ZHIA 4LD6A 4EPCA 4DYRA 2GFAA 5GANf 2L3RA 1HSJA 3H5RA 1FZPB 4UXNA 2RJCA 4J7IA 5GAOl 4A53A 4HCKA 3MKYB 2ZAEA 2E6NA 2KT0A 2DFEA 3NAUA 4U87A 1D09B 3JCMg 2M45A 4BQQA 2B86A 1U9NA 1CF7A 4M3BA 5KAIC 3I5UA 3JCMW 4GYGA 2IBDA 1RZ4A 2RQQA 1ZSZB 2ZJRF 1VQKA 2R7QA 2N8GA 1XGOA 2DMOA 1IXCA 4DBFA 1ZGWA 1YYVA 4BE0A 2PTKA 2ESNA 4J6YA 2HYJA 4AYBN 4J6XA 3JAMK 3VS7A 4BXFA 4HF1A 1H641 3IWFA 3CCEA 3VYRB 4BH9A 2HVRA 3H9JA
chains in the Genus database with same CATH topology
4RAZA 3GYHX 5LJ5d 4JQFA 4P5OA 3C3WA 3GZ6A 2EWNA 5E8IA 4WF2A 3QSUA 4C92G 2COMA 3ZMDA 4M7AC 5GMKj 3CCJT 4RCBA 4GLKA 1P4WA 4L9JA 1YJNA 2QYOA 3JCMf 2NAZA 5CKEA 5DYMA 2AXLA 5J8FA 1U8RA 5AONA 4J7FA 3CC2T 5FRMA 2WSEE 2KMTA 2D1HA 3E5UA 5DCMB 4A54A 5CO7A 4MHGA 2DIGA