1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
molecule keywords mbtA operator DNA
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
1PP7U 3J80K 5HS9A 1YW7A 2JPCA 1B1BA 3WGGA 2RC4A 1Z6TA 5L3BA 2ZJ2A 1SFXA 4Q5SF 4A5NA 3O2PE 4EJUA 1MKMA 3WU0A 1JHHA 3FZVA 2P5VA 2STTA 2M5WA 3CDHA 2M30A 3MFKA 1CGPA 4Q4ZF 4HAMA 3WTZA 3BY6A 2YX4A 2JPBA 2IW5A 2K4JA 4M72A 4CICA 2HQRA 5E1WA 4LG0B 4R79A 1SAXA 1R00A 2TDXA 1HKTA 4KT5C 3KEOA 1SD7A 1QW1A 4HBLA 4UXNA 2E1CA 1ZRFA 4M71A 2HFHA 5LEKA 1RNLA 3NRVA 2O3FA 4HDVA 1ODDA 3BZ6A 3C18A 2PBIA 3GFMA 3MWMA 3GXOA 3F6OA 3F8MA 2K5LA 2VBWA 2IA0A 1U5TC 4HA8A 2CGPA 1UHMA 4WXDA 3T5XA 4LB6B 4OU0A 2FBHA 4HZFA 1BYMA 1UCRA 4Y15A 5FLXZ 3ELKA 5ICFA 3R0JA 1P4AA 1WKMA 2FMYA 4EGZA 4UHTA 1K7AA 3PFIA 4PCQA 1YW9A 1STZA 4QLCU 3WTTC 4LLNA 3L7WA 1O3RA 3WTYC 2W57A 1ZRCA 5HVQC 2QQ9A 3WTVC 3HOSA 2IT0A 3IRRA 5DCFA 3KFWX 3IRQA 2M45A 5DUKA 3BOQA 2H27A 5ILUA 4FX4A 1MDMA 5DD8A 2E7XA 4MEXF 2NAZA 2PQ8A 5E8IA 4YIIA 3DFGA 2DLLA 3R61A 2F5EA 1ZAOA 4FT8A 1U5TA 4RAYA 5D6FA 1TNTA 1YG2A 2MD5A 1J9IA 3ECHA 3ULQB 4BHCA 3M9AA 1TQPA 3MHXA 4A0YA 3RYPA 3J81K 1B4AA 2A61A 3KETA 1PDNC 3FM3A 1HQCA 1MDMB 3MZYA 2ZNZA 4NB5A 4OMZA 4OIOF 2KIFA 4ASNA 2WV0A 2OZUA 1FPQA 4G9YA 2O6GE 1FP1D 3ZP5A 3E97A 3CLOA 3TDZC 3MEXA 1S7AA 4EM0B 1FBSA 3J7AO 1BBYA 1ULYA 1I5ZA 2V6CA 1KYZA 2PFBA 3WE2A 2ZMEB 5D5VB 3GVAA 4XRFA 3ZMSA 3Q5FA 5FLXK 5DYMA 1U5TB 2CSOA 2XASA 3K0LA 2KRFA 4HYEA 2JZYA 3SQNA 5LHHA 1SFEA 4S05A 4DQ2A 2UXNA 3KZZA 3WE3A 4HQMA 4TV7A 1P6RA 1EH6A 3Q9SA 3MAJA 1OR7A 4I0BA 1MD0A 3HUGA 4ZZLA 5F64A 2PN6A 4MGRA 3GO5A 3ZMZA 5CYVA 4KA4A 4KN4X 4KIFA 1T39A 2NNYA 2IRFG 2ETHA 2EFOA 2XUBA 2FQ3A 1SMTA 5J6XA 4KDPA 1BN5A 3FWEA 4CHUA 2OQRA 4FX0A 5L3CA 2QUFA 1BIAA 3RPQA 2WC2A 3C3WA 1S3JA 4JQFA 1OYIA 3IHUA 1HW5A 3RKWA 3JTGA 1DP7P 2H6CA 4M9SA 3ZMVA 4YG2F 1YYVA 1OMIA 2ELHA 3PQKA 3BPVA 2EK5A 1LEAA 1G4DA 3ZN0A 1R1UA 3T8TA 2ZXJA 4BXUA 3EQLF 3FXRA 1R23A 1DPUA 1GVJA 2FBIA 1LJ9A 2JT1A 1U2WA 1XGNA 1XD7A 2XAJA 2L3DA 3KP2A 3HOTA 1XCVA 1IRFA 5BPDA 2UZKA 1T2KA 3U2RA 5LGUA 2HTSA 2VC0A 2H6BA 3VEPA 4ENKA 2GQQA 3LQRA 4DNCA 2PI0A 2GXGA 2PLYA 4UUVA 1WQ2A 2P5KA 2VBYA 1XSDA 2VONA 3I0TA 3N4MA 1FSHA 1T0FA 4OMYA 3KP7A 2A68F 3E5QA 1QGPA 4M74A 1YW8A 4B09A 4HF1A 3VODA 3N97A 2FNAA 2NRAC 3I5UA 4L0YB 3I64A 3V7RA 3TO7A 4A0XA 2Z99A 1TQIA 2RVCA 3ISPA 4PGGA 5CVRA 3FXQA 2ISZA 3HSRA 1IZ1A 1KA8A 3IL2A 1RIOH 3E6MA 2VT2A 3TDUC 4ESBA 2A6HF 2Y0MA 2O61A 2YR2A 2K02A 1ZARA 4AIKA 3HIFA 4RS8A 5ILSA 3IWFA 5FD6A 2G7HA 4BHPA 3G3ZA 1ZH5A 3ABTA 4A6DA 1SD6A 3TO9A 2J5OA 1WSUA 4RB0A 4LG0A 1IRGA 1TQMA 4KMFA 3M8EA 3KP6A 4Y17A 1BI0A 1R5HA 4OIRF 2MLGA 4P5OA 2MBFA 3E6DA 2DAOA 4EM2A 2K5FA 2HGCA 2DPUA 3I59A 3DKWA 3JAMK 2QYOA 3ZN1A 3J81Z 4BH9A 1TW3A 3QP6A 1KQ0A 1R1VA 4A5MA 3VFZA 2K86A 1QZYA 3DP7A 3DEUA 5CVIA 1KGSA 1LB2A 1HSTA 4LK1F 3F72A 2FA5A 4EQQA 1V4RA 4WK8F 1F4KA 2DK5A 4R1HA 4HLYA 5LRRA 1G6NA 2IP2A 3E6BA 4GXOA 3J80Z 5TJJA 2DQLA 2W84A 1QNTA 1QO0D 1PP8F 5D5XB 1EH8A 3V8LA 2ZNYA 3TOAA 5CVJA 1FYKA 2XKPA 1W5SA 3AAFA 5HOOA 2VN2A 5JI6A 1G3SA 2YX7A 3F6VA 3KLNA 3M7GA 2R3SA 3P7NA 4YFNF 3F8NA 3WTWC 4OIQF 3GF2A 3MQ0A 3T0YA 1IXCA 5D8KB 2ZBKA 1P2FA 2HOEA 5JR3A 2OQGA 4XLNF 1IN5A 1LDKB 2FNPA 2CWEA 3K69A 2Q0OA 2D45A 1QZZA 2P8TA 3GFIA 5IT9K 4CDGA 2VE9A 2VBXA 2QM3A 5CLSA 4U88A 3FMRA 1OYYA 4PGHA 2JTVA 5H20A 3ROUA 1I27A 5K5OA 2YPRA 3PQJA 5IT3A 1NHAA 3JSPA 3T1BA 4RGXA 6PAXA 4BHBA 4RB3C 1A04A 2F2EA 2KIUA 4RAZA 2CQKA 3V7SA 4LJZF 4RB1A 1B9MA 2VOOA 2QVOA 3D0SA 1KQ8A 3I54A 3ZMUA 1REPC 2WTEA 3S2WA 4G8XA 1H9GA 5DUIA 3MZHA 4Y13A 5AONA 4G7OF 2LNBA 1IN6A 2BE5F 1HSJA 1KU7A 5HLGA 2PMUA 1JGSA 1U3EM 4O5VA 1RUNA 2XIGA 4M9ZA 1J2XA 2EFWA 2D2WA 1L3LA 3P9KA 2MLKA 5CVVA 3WGHA 4RGRA 3HRSA 1F1ZA 1FT9A 4I98B 1LVAA 3V7CA 2EV0A 4UVBA 5ICGA 4LMYA 5AIPA 5F1RA 1S7OA 3RDIA 1W4MA 3E5UA 3BPXA 4EJVA 2HKOA 1J59A 1BI3A 5BPIA 2AS5F 2KJCA 1O3SA 4M6YA 1BI2A 1O3QA 2P7VB 2CW0F 4G7HF 5DDGA 4YFXF 4U7BA 1FLIA 4IXAA 2Q8KA 2XVCA 3SXYA 2LF8A 3VB2A 1T38A 2FBKA 3K1MA 1P4WA 1H0MA 2XAHA 1XDUA 3KP4A 1OPCA 3WTUC 4HDUA 3E3VA 3L00A 4KICA 4GCVA 2HYFA 4BAYA 2STWA 1YS6A 3KEQA 3TGNA 1RUOA 2XAQA 2Y48A 2HZTA 4KNYA 1Z91A 3NQOA 1I1SA 1PUEE 3W6JB 1IXRC 2A5YB 1IW7F 4U0YA 4A6EA 1HXDA 5LGNA 2W24A 3F21A 4I0AA 4LB5A 4MNUA 3FM5A 1FBUA 3P9IA 1WRJA 4FHTA 2VT3A 5KVRA 4BQAA 2EA4A 2H09A 2FF4A 5HDNA 3CJNA 3F3XA 4K2EA 2RNJA 3HHGA 4ZYGA 3K2ZA 3FF5A 4HF2A 2EWNA 1T6SA 4AVPA 4HF0A 5HLIA 4U0VA 2BYVE 3GLXA 2V9VA 4CGZA 2GCXA 3EDPA 3CUOA 2VOPA 2DO7A 3WGIA 4XSXF 1XSXA 2GAUA 3EYYA 4U0WA 3R6SA 2QBYB 1D8KA 1ON1A 3DF8A 3EUHA 4JK1X 5F6FA 3ML6A 2RV8A 1V3FA 1VTNC 1W7PA 4EJWA 1USSA 4KMUX 5BS6A 1DUXC 4OOIA 3FMSA 2Z33A 2P7CB 2VODA 3LSTA 4WWCA 3KZYA 4KFCA 3KCCA 3HTUA 3CUQA 2W25A 2HQNA 1WWXA 1FOKA 1E17A 3B02A 3HHHA 1KU9A 2OZ6A 4WF2A 1YIOA 3F8FA 3B73A 5CJ9A 1OKRA 1BM9A 5A2QZ 1S29A 5DV5A 5A2QK 2QENA 1MJAA 2BBYA 2K5IA 5FB2A 1LQ1A 1R5GA 4A12A 4KIBA 5ED4A 4N9HA 5DD4A 2FRHA 1ZGJA 3WG9A 5FD5A 1K78A 5HDGA 3ERED 3HTSB 1X3UA 1BIBA 4CXFA 5JFRA 3WU1B 3QAHA 2QQAA 3GFLA 4HX7A 2IJLA 3D5LA 1U8RA 1W7PD 1GXQA 4L5JA 3FHZA 3SZPA 1C0WA 1CF7A 1B59A 4MQVA 2CO5A 4IVNA 2DU9A 1J7KA 3RYRA 5FFZA 3IC7A 4ZH4F 1D3YA 4WXHA 1ONVA 2XHKA 4IF4A 4IRHA 1IN8A 5KK1A 1QBJA 2FU4A 3TOBA 4P9FA 5EEGA 2R7DA 4LLGF 4N0BA 3ZMTA 1IUYA 2YU3A 4QWQA 1IN4A 3GFJA 4CO8A 3RKXA 1QQIA 1H9TA 1W7PB 1IN7A 2HDCA 2RQPA 1FY7A 1UHWA 3VOEA 4GO1A 3LFKA 2GWRA 1YTYA 3M1EA 3CO7C 4AIJA 1UB9A 2EJRA 2F5CA 4PDKA 1O57A 2Z3YA 1U6GA 4L9NA 2K4YA 2CG4A 2GZWA 3RPUA 5E18F 1XCBA 4MHGA 4MTEA 2XAGA 3V8KA 2Q2EA 4P55A 4MTDA 2QBYA 2ESHA 1XGOA 2A69F 1ZGAA 2UXXA 1TNSA 2OAZA 5H6RA 2E7WA 2G9WA 1S6LA 4EGYA 4I7HA 2MC3A 4KYWA 4HW0A 2HTJA 1B6AA 1ZG3A 2WWYA 2FXAA 2ISYA 2YSRA 4YIFA 5FO5A 5ERIA 2M1BA 1JE8A 5LRSA 3HSEA 5L3GA 3F8BA 4PZJA 3SHFA 2QLZA 1K78B 1IXSB 1ON2A 4HV5A 4ZYEA 4IRGA 2FEZA 5JHUA 2NS0A 2ZKZA 1GXPA 1MZBA 1BC7C 2C6YA 3EETA 1HBXG 4MEYF 1Z1DA 2F5DA 3I71A 1S8NA 4ON0A 2PG4A 1SMYF 1FYLA 3H3ZA 5E8GA 2X0LA 1KU2A 5LBQA 5EEHA 3CUQB 1P92A 1KYWA 2VC1A 4HQEA 1R22A 4R8HA 1G3WA 3I58A 1O7FA 4ZYHA 1IAWA 2V79A 1TTYA 3IKVA 1XDSA 4EM1A 2BV6A 2V1DA 2M87A 1FNNA 4XBFA 5HDKA 5LGTA 3EYIA 3DPTA 1L0OC 1EH7A 1P4XA 1HKSA 1CF7B 4RB2C 1HKQA 2HEOA 4G94A 1ZREA 4HX4A 2L54A 1EV7A 4OINF 2MH2A 2P6TA 4N9IA 2B0LA 2HYGD 4D0PA 2RKHA 2D1HA 3MCZA 4M9XA 3SZTA 1K79A 4S04A 4UVCA 2XGXA 1J5YA 4L9JA 4I01A 4ENJA 4L0ZB 1BJAA 2DW4A 5E20A 3HRUA 5FFXA 1IF1A 1XMAA 4HX8A 1SD4A 4Q48A 3G73A 3R0AA 2ZCWA 5D8LB 4G7ZF 5TRDA 1SFUA 2K4BA 4E70A 3U9GA 4EJOA 2FE3A 4LFUA 4EVIA 4P96A 1O7LA 3REOA 1OYWA 3RJPA 1JXSA 5D6EA 1Q1HA 4NHJA 1FZPB 1FX7A 3R4KA 5BQTA 1ZRDA 4BYYA 5L3FA 4H0EA 2K7LA 5ICEA 2HS5A 2CYYA 3JSOA 2DPDA 1Z05A 3CUQC 1BI1A 3HYIA 2DFIA 1XN7A 3JTHA 1YFHA 3V8JA 2LSOA 3BDDA 1J0RA 3KP3A 3RKYA 5JVTA 3LA2A 1O3TA 1LDDA 4XSZF 3C7JA 2ZFWA 3IKTA 3O6BB 3Q9VA 3T8RA 3E19A 1UFMA 4F7ZA 5J8CA 2JRTA 4EV0A 3QPTA 1FWZA 5E1XA 4AIHA 5K5RA 1FYMA 2KJBA 2O8XA 5LEJA 1KQ9A 2XAFA 3QOPA 4Z2YA 1KU3A 3P9CA 5D5WB 2FMLA 3QP5A 4WX9A 1D8JA 1D5VA 2KKOA 2XKOA 4AD9A 2RN7A 5BOXA 4ENMA 2RDPA 5L3DA 3DXJF 1LNWA 2BGCA 3LAJA 4ZYDA 4UV9A 4JBAA 4LK0F 3K9TA 5D5UB 3OV8A 2HWVA 4YFKF 3WTSC 4IRIA 2O03A 3BJ6A 4HLXA 1G3TA 4WXCA 5ICCA 1LEBA 1FP2A 4O3MA 1MJBA 2QQBA 4BNCA 4UV8A 3V4GA 5K1YA 4O6JA 1F5TA 3TKYA 4B8XA 1BC8C 2BEOA 5HS8A 1YQAA 2EV5A 2HKXA 1YO5C 1DDNA 1XB4A 2GA2A 2ACJA 3RI4A 1ZG5A 5H6QA 1Y0UA 1ZHFA 1RI7A 1R58A 2EB7A 3K1NA 3I59B 2A07F 4IPAA 2ESNA 4HOBA 5E1ZB 2V1UA 3IWZA 1XSVA 2W85A 2A6EF 2XV4S 1JHFA 2Z5UA 3WODF 2P5LC 1K6OA 1MGTA 2OBPA 3LQQA 4EMSA 4P9UA 3ABUA 2DTRA 4Q47A 4LGWA 3LAPA 2LF7A 4L9VA 3JW4A 5HLHA 1B9NA 3E6CC 1ZLJA 4ETSA 4HV6A 1TBXA 2GXBA 3SFZA 5J8FA 1AWCA 3OOPA 3O3KA 1TW2A 2EV6A 2COMA 4L9TA 1I6XA 4ZZDA 2IA1A 1Z7UA 1F9NA 5IT9Z 1W5TA 5E17F 1G3YA 3K1PA 2L01A 2E1NA 3DPLC 3LA7A 2VBZA 1AOYA 5ILVA 3GZ5A 1FSEA 2RGVA 1SD5A 3DQVC 2CFXA 4CZZA 4LD5A 3F8CA 2FOKA 3JAMZ 2G7UA 2V1XA 3BJAA 4AWXB 4A2UA 4RGUA 5K5QA 3RTRA 3GYHX 3LA3A 3GX4X 1TLHB 2PJPA 2EFNA 3F22A 4KUMA 3GW2A 3HRTA 5LHGA 4ENNA 2QWWA 1GHCA 2HR3A 4KIGA 3QU3A 2NYXA 4U7DA 3FX3A 1FBQA 5D4RA 2K27A 2EA2A 1ZLKA 2J5PA 5DEQA 4G6QA 1HW1A 5CVUA 2MA3A 1ZG1A 2XROA 4IHTA 4LLLA 1I1GA 1WI9A 2R7FA 2ZMEA 3H3UA 2Z9OA 2L4MA 1MJ9A 1U78A 5AIQA 2D1VA 4GGGA 4I2OA 4A0ZA 1DPRA 2MH9A 3GWZA 3ZQ7A 2LX9A 5DCMA 4ESFA 3GUDA 4RGSA 2ZO4A 1RZ4A 4GYIA 3M8FA 3FXUA 2L4AA 2P6SA 2DK8A 2DQRA 2ADUA 3CTAA 1R1TA 2XRNA 4I09A 3GEZA 4XLPF 5D4SA 3LWFA 4MQ9F 3QRFF 3RIRA 5DCMB 3BROA 3H92A 1FC3A 2VE8A 2LKPA 2GIVA 4NQWA 2O0YA 2A3SA 1ZN2A 3BP8A 2OD5A 3BJOA 2M8EA 2IPQX 3KP5A 1XGMA 3I53A 3U1DA 3W6KB 3ZPLA 2GA1A 3COAC 1XMKA 4KN7X 1Z9CA 1YS7A 2KIMA 1J75A 2PMHA 4L5IA 4IJAA 3GZ6A 3TO6A 2JSCA 2DI3A 3I4PA 2IVMA 2LDUA 3WTXC 3L9FA 2VXZA 1ZYRF 2Y75A 4M6XA 2UWMA 2FSWA 1XGSA 1BOAA 2P4WA 1T98A 4M73A 3ZMDA 3TQNA 3R60A 5BMZA 1Z6RA 3KE2A 1E2XA 3L09A 2QZ8A 4UNOA 4CYDA 3QU6A 4I02A 2AXLA 2H94A 1QPMA 2OA4A 3ECOA 4ESJA 1YLFA 3NEUA 3C1DA 3KLOA 5FGMA 1R7JA 2EFPA 1USTA 5L3EA 1R36A 1QVPA 2PEXA 3BWGA 2X4HA 4GYGA 5LHIA 1LDJA 4UVAA 5LLQA 4G6DA 5HS7A 2NNNA 2L02A 1HW2A 4IHSA 2DT5A 4L18B 3HRMA 3E5XA 2H3JA 3F23A 2OU2A 4WCGA 3HSFA 2EFQA 2IA2A 4EJTA 4OIPF 2DBBA 3QPHA 3L2CA 3FMQA 3DV8A 3CO6C 2F5FA
chains in the Genus database with same CATH superfamily
3A8LB 3CCUI 1PP7U 3J80K 5HS9A 3N5BB 2E5QA 3VPRA 5FU7B 1U06A 3JRDA 1YW7A 2CUFA 2JPCA 2D9TA 2FYKA 4LE9A 3CBMA 4CRIA 1B1BA 3M1CA 3WGGA 2KI7A 2VGNA 1APLC 2RC4A 2XPWA 3ERMA 1NBEB 1SSHA 1Z6TA 2IGOA 4E7KA 3A8MB 3S1RJ 2JA7J 5L3BA 2X6WA 1I3QJ 2A5WA 4RDUA 2ZJ2A 1SFXA 2QA4A 4Q5SF 4A5NA 3O2PE 3OSVA 4EJUA 3GOXA 4M75C 1I0CA 1MKMA 3OW2P 2WAQA 1AZEA 1OU8A 2OI3A 3WU0A 1JHHA 3AG2H 3FZVA 4X9DA 2P5VA 2STTA 4E47A 3QYGB 4FYVB 4Q5WA 5GAOl 1MH3A 2M5WA 2VJ4A 4W97A 2CZ7B 3A1PA 3C94A 3CDHA 2KRHA 5KCHA 1K1ZA 3OBYA 3OSSC 4M78C 2R5MA 2M30A 3MFKA 1CGPA 1XS9A 4Q4ZF 2CP0A 4KULA 5FKMA 5JLWA 2R7UA 4HAMA 3WTZA 3BY6A 2HI3A 3VV0A 3EG9A 2YX4A 4XTVA 4IQJA 1YITQ 5KYXB 2HOTA 4ORZA 2JPBA 1M8VA 2IW5A 2K4JA 5J3BA 2CQXA 4M72A 2HQRA 5E1WA 4CICA 5IYDJ 1QWEA 4MO7A 3OB9A 3OS5A 3Q1JA 3WXMB 4LG0B 4JJCA 4R79A 3CC4I 2WBMA 3CCUQ 2ELKA 3LSKA 5KCMA 2HPIA 1SAXA 2BIVA 3CCSQ 1YHQQ 2DF6A 1R00A 3SD4A 3THKA 2ID6A 2TDXA 5CQEA 2G6FX 4F55A 3VKIA 1TT5B 2E64A 1HKTA 3CCQT 3CF5F 2O8KA 4KT5C 2MVTA 3SB2A 5CKDA 1K9MR 2R57A 2K3FA 3KEOA 4IX7A 1TOVA 3HKZA 2MF2A 3CBPA 1SD7A 4FTHA 3IUOA 1QW1A 1YP5A 4C8QF 4HBLA 4UXNA 3W3CA 1VIEA 1IDYA 2K9MA 2E1CA 1ZRFA 4M71A 2HFHA 5LEKA 1RNLA 4AT1B 2E5ZA 3NRVA 3G6EQ 2DBKA 2O3FA 4XAXB 2QSHX 2Y30A 4HDVA 1X27A 4BXXJ 5KE3A 3GP8A 1ODDA 2V7FA 2GNCA 3BZ6A 2L7FP 1IG7A 3HGYA 3CC7I 3OQ5A 5KAFC 1HOMA 3C18A 2CZ1B 2PBIA 3EGDB 3EGXB 3GFMA 3MWMA 3ASNH 2WB1A 2JNGA 1YX5A 1OOTA 1TWAJ 4UC4A 1BR4A 3GXOA 4GDFA 4C8QA 2JMAA 2KT0A 3F6OA 4UUSA 4KUIA 1GV5A 3F8MA 3GTLJ 2K5LA 2E65A 3PNTA 2VBWA 2VKNA 1KD1R 2IA0A 3C2HA 1U5TC 4HA8A 2CGPA 3EFOA 4XQ3A 3TQ7P 3H9JA 1UHMA 4WXDA 4JZ4A 3T5XA 4FYYB 4LB6B 4OU0A 1BU1A 1T08B 5JHFA 1G2BA 2FBHA 4HZFA 3U23A 1BYMA 1UCRA 2M4KA 4Y15A 3MP6A 3G2BA 3G71A 1AWJA 5FLXZ 3ELKA 2ABLA 3TW7A 3SWNC 5ICFA 3R0JA 1P4AA 2B9SA 3GTGJ 1WKMA 2FMYA 2COYA 2FUG2 3VS4A 2Z0WA 4KGVB 1YRNA 4EGZA 3FHNA 1X43A 4PJOB 4UHTA 3IH3A 3A01B 2EFIA 1N8RR 1K7AA 2HZYA 3PFIA 4X9CA 4PCQA 4XLCA 4BXFA 2CH4W 1QP3A 1K0XA 1OISA 3CJTB 2RK1A 4AG2C 2OTJT 2KL4A 2R7XA 2O88A 1YW9A 2E70A 3VRYA 3I3LA 1WFXA 1STZA 4QLCU 4CZCA 2LCCA 4LXCA 3WTTC 1B72A 5GAN5 4LLNA 3L7WA 5I2MA 1I07A 2P0QA 3H6ZA 1HLVA 1O3RA 3WTYC 2RJEA 5FU7C 2W57A 9ANTA 4KGXB 1ZRCA 4G6TB 3EH2A 2L2OA 3TP0A 2OC6A 4C8QC 4M75B 5HK3A 1X6GA 5HVQC 2QQ9A 1H88C 3WTVC 3HOSA 1SC7A 2IT0A 2LCSA 3VYUB 3H5AA 3IRRA 3TU4K 4V19K 5DCFA 4BD3A 4XONA 3KFWX 2HPMA 3ABLH 2HD0A 3IRQA 1R9TJ 2IVWA 2CW7A 3LW5E 2M45A 5DUKA 3BOQA 2FX0A 4N0AC 2H27A 5ILUA 4FX4A 1MDMA 4C3HJ 2MG4A 5DD8A 2E7XA 4MEXF 1XOVA 3DEWA 3M4YA 2H8HA 4JDSA 1RACB 3F9KA 2MIOA 2NAZA 4F7UE 1BJZA 2PQ8A 1AHDP 4A63B 5E8IA 5F08A 1LE8B 1VQ5T 4YIIA 3VJPA 1ACIA 3QO3A 3JCMd 4RM3A 2DYRH 2ZSHB 3BZKA 3DFGA 3I4NJ 2DLLA 3R61A 4FISA 4OMNA 4A4GA 4DEYA 1N8RC 1D0YA 4YELA 1TL8A 1LFUP 4ME7A 2F5EA 1ZAOA 4BEHA 2D8HA 4FT8A 1U5TA 4RAYA 2VL8A 4M7DB 4BBSJ 5D6FA 2VJJA 5B5EC 1TNTA 1YG2A 2L7MP 2MD5A 3K4BA 1J9IA 1M8MA 3ECHA 4FW2A 4DEXA 1YJ9Q 3ULQB 1VQMI 1ACMB 3S1QJ 4BHCA 1M1FA 3M9AA 1K4SA 1WI3A 1TQPA 2FQ4A 4MFDA 4DBQA 3MHXA 3NTHA 3OYIA 4A0YA 1YJNT 2HOSA 1IJWC 2X51A 3ZQGA 4KBMB 2GF7A 3HGGA 4J9DA 2RJDA 5EG0B 3RYPA 3J81K 1B4AA 2PJRA 1PG5B 2RD1A 1HCRA 4OB0B 2EINH 3JAME 2RH2A 2A61A 3PFYA 3H3VK 5GAOn 1X2KA 3KETA 1RQ6A 2GQVA 1W36C 2E35A 2UUZA 3BR5A 4ABZA 1PDNC 3FM3A 1EIFA 1UGSB 2EKHA 1FMVA 1HQCA 2HL5C 3VS5A 4BY7J 4D7NA 3LSRA 1M30A 4IUQA 1VQPT 1MNDA 4OP0A 3TREA 2RB6A 1Q81U 1MDMB 4BACA 2E3IA 3MZYA 2HMAA 5GAN4 1ZR4A 1A35A 3C2BA 2KK4A 2ZNZA 3L42A 4NB5A 3ME9A 1M1KU 1VQNT 4OMZA 2BUDA 4CUGA 3HJEA 3PSIA 1VZ0A 3HKZN 1UHCA 1ETOA 2BXZA 3BT9A 4RLQA 3DEEA 1H8AC 1WIEA 2AT1B 2H8WA 3CMMA 2BZXA 2EPDA 4B9WA 3BLYA 4D5CA 2VQLA 2FOWA 2D5VA 4OIOF 2FPEA 3B6AA 4F7UG 2M2EA 2KIFA 4ASNA 1FTZA 2ZPGB 1HJDA 2KYBA 2WV0A 2OZUA 4JP0A 2RQWA 1FPQA 4G9YA 1B7TA 2O6GE 1Y56A 4B3AA 1VQ6Q 1FP1D 3URGA 4E7JA 3O8GA 5E3LA 1M2VB 3ZP5A 4RTUA 3CMET 3HSBA 3QYHB 2VPRA 3AHUA 3E97A 3CLOA 3TDZC 3MEXA 1S7AA 4EM0B 1ERDA 3RNJA 1FBSA 2V8KA 2XC7A 2IPOB 1AWXA 4QKUA 5GMKi 3J7AO 3VS7A 1BBYA 4BDZA 3M53A 4GLMA 3AFHA 3KXTA 2HSPA 1ULYA 4IHXA 4R0KA 3CCVQ 3LL7A 2O5RA 2Y9YA 3IH4A 2ZXWH 4NC6A 2KAFA 3I55A 1I5ZA 2Z1DA 5GTIC 4JPBW 2LK2A 2LT4A 2V6EA 3JCMc 1AKHA 1W0UA 2V6CA 1UFFA 1K9MU 1KYZA 2PFBA 3UKGA 1AD5A 1YWPA 1WJRA 2F2XA 2K9NA 3WE2A 4HNUA 2ZMEB 4XU3A 4E7SA 1KONA 2CSQA 3UWNA 2RQUA 5D5VB 3CCUA 2DODA 3OIQA 3JB9D 4MMKA 3GVAA 4XRFA 3ZMSA 3Q5FA 5FLXK 4M7AG 5DYMA 1U5TB 2CSOA 2XASA 3K0LA 2KRFA 1X3WB 1B07A 1VFCA 4HYEA 3HOWJ 1K8AR 2JZYA 1M3BA 4JX5A 2QDLA 3SQNA 2DOEA 3QWLA 5LHHA 2M9UA 1VQ8A 2OAWA 3RQIA 1SFEA 3MN2A 4S05A 1DU0A 1TC3C 3ASKA 1LVKA 4XICA 4JOMA 4NDLA 3W2WA 1WHLA 2PMZA 2HDWA 3J7YJ 1YJ9T 1IGQA 4X1VA 4DQ2A 2JJ7A 1C6VX 2UXNA 4HSTA 3KZZA 1W5CC 2EQRA 3WE3A 4HQMA 3VUBA 5FLXR 2EQIA 4KISA 4TV7A 1P6RA 1EH6A 2RREA 2P4TA 5LJ3j 2OJED 2I10A 2EAYA 1V54H 4A53A 1S72I 3M4OJ 1RI9A 3UNGC 3KZIC 1KFZA 3Q9SA 3MAJA 1AVZC 1OR7A 4M78A 5CKHA 4I0BA 3RZOJ 1X2MA 1MD0A 3HUGA 4ZZLA 5GAN8 2XDVA 5F64A 2ID3A 1GBQA 4CCLA 1HSQA 2PN6A 5IT9R 4MGRA 4B44A 1MSFC 1N8RU 1VQNQ 3GO5A 3CMAQ 5LFAA 3M0QA 5J40A 3ZMZA 2JTFA 1AHJB 4Y91A 4XU1A 1VQ7T 3CC7Q 5CYVA 3PE0A 2XDBA 4BQOA 4KA4A 2CW8A 2L0AA 4KN4X 4KIFA 1T39A 1NJIR 4KUDK 2NNYA 2ED1A 2IRFG 2ETHA 2DMQA 4M78B 3EGDA 3FXOA 2ZXHA 2E19A 2EFOA 1TXQA 2HKNA 2I8DA 3JCMP 4F17A 2E12A 2BOLA 2XUBA 2MC4A 2WY8Q 2FQ3A 1VQ9A 4FETA 1A36A 2LKSA 2GTJA 4VUBA 1HDPA 5DM7F 1WHMA 1PRMC 3CCRQ 1ZELA 1SMTA 1WDXA 5ECAA 5HCKA 5J6XA 4JZ3A 4C92B 4KDPA 5CPRB 3DTEA 3SZGA 4A4HA 1BN5A 3FWEA 3PSFA 1QWFA 1Y8RB 2JK3A 1RI0A 2WV1A 3RSNA 2GTOA 5KH6A 4CHUA 3CC2A 5IP6A 2GIZA 2DCEA 2OQRA 4FX0A 3CP2A 2F2VA 2KQWA 4M3FA 5L3CA 2QUFA 2KRMA 1BIAA 1IUFA 1UMQA 1FOXA 1GBRA 2E6NA 5A0DA 2KMTA 2XGCA 3RPQA 3ZCOA 2WC2A 4F93B 1RABB 1WHHA 4QVDA 1KQSA 3C3WA 1S3JA 4JQFA 1OCZH 1GCQA 3OYCA 2VQGA 3GTQJ 2XKOC 4II3A 3A5ZB 2LNHB 1U9OA 2E34A 4KH0B 3CD6I 5CKFA 1X6BA 1MBJA 4DJAA 3JCMW 4HNTA 3JB9H 1OCRH 1OYIA 3IHUA 1HW5A 2LY9A 4G12A 3RDVA 3RKWA 3JTGA 3QOEA 4CH7A 1PUFB 1AKHB 2K3XA 3MP8A 3Q0VA 4J00A 2CP3A 1MMDA 1Y8QB 1DP7P 4B48A 2H6CA 2LG4A 2CUBA 3LMMA 4M9SA 2LQNA 3BY7A 1QVFS 3ZMVA 3JREA 2KVQG 2MI6A 1JJ2S 4OAYA 4YG2F 4NC8A 2P0TA 4RTWA 1YYVA 2MWPA 3HFOA 1S5LC 1OMIA 1RL2A 2ELHA 2ZMEC 3PQKA 4M75F 4NUBA 4RMOA 2HQHA 2DAQA 3K4MA 3BPVA 2EK5A 3G1OA 1LEAA 3D5RC 2PX9A 4HVWA 4ZNXA 1AEYA 2XGEA 1YJNI 1G4DA 2X48A 4QSHA 2R7WA 3ZN0A 1ABOA 1R1UA 3T8TA 2QGUA 2ZXJA 1VQ8I 2XPVA 2ESWA 1KZHA 4BXUA 3D7SB 4MZPA 3EQLF 3M59A 3FXRA 1R23A 2RAEA 3ZQHA 3UPUA 2DXTA 4RA2A 3A0HC 1N27A 4BEHB 1DPUA 1I4K1 1ZSZC 2DYIA 1GVJA 2FBIA 2GGRA 3JRZA 2Y69H 4PKCC 1LJ9A 3MO8A 2JT1A 1VQOI 2DYBA 3DLLA 3VDXA 3H1CA 1U2WA 3FXKA 3LLRA 1VNDA 1VQ4T 2E1MB 1XGNA 3E9FA 2X6XA 4RKUE 1E3PA 1Q81R 1XD7A 2XAJA 3QSUA 2L3DA 3KP2A 3HOTA 2JM8A 2AKLA 4A3FJ 1XCVA 1IRFA 2NOGA 3G4SQ 2RNAA 3BG3A 5BPDA 2B63J 3K4JA 3J80R 4PJOD 1YCSB 1X69A 2UZKA 5F0HA 2CP5A 2DX1A 3CCRT 1ETYA 2IBDA 1GFDA 4C0GA 3DPUA 3LGLA 1BA5A 2KXDA 5IHKA 1T2KA 1MBGA 1X4OA 1ZUKA 3U2RA 2HTSA 2VC0A 2H6BA 5LGUA 3VEPA 4ENKA 5A2QR 2D0NA 2E10A 2AK5A 2GQQA 1UUEA 2EW3A 3LQRA 4DNCA 4CC4B 2PI0A 3IP4B 2GXGA 2IS4A 2YLBA 3RMQA 2PLYA 3CMYA 4UUVA 2L5QA 4XRMA 1OCPA 3CCRI 1SRLA 1ZBXA 2R92J 2CSIA 1WQ2A 2GQIA 3P8DA 3CC2I 2P5KA 1Q86U 3JSCA 2VBYA 4JJNK 1XSDA 2AIRB 2JN6A 2NS7A 3I0TA 3QODA 3N4MA 4LIUA 2VONA 2SEMA 1U3OA 4AU7A 4XTZA 2QA4T 2LREA 1FSHA 1T0FA 3KP7A 4OMYA 2LFBA 3H0DA 2A68F 4C92A 3E5QA 4FE4A 5HK0A 4JS4A 2OTJQ 2F5TX 3EHRA 1SHGA 5I2SA 1QGPA 2EIKH 3LWHA 4M7DC 3EG2A 2CREA 2FRWA 5GAN6 4PFZA 3SJMA 4M78E 2DZ9A 4A3IJ 2XGDA 1TG0A 1VQ8Q 4GY5A 1XMXA 1Q95G 3GMEA 4M74A 2IS6A 1YW8A 4B09A 4BGDA 4HF1A 3VODA 4AM3A 3N97A 2FNAA 1YCYA 2B86A 4BJ6C 1SVMA 4P1WA 2NUTA 3ZQLA 2JUCA 1KHCA 1UE9A 2NUTB 1MBKA 4D8DA 1Y71A 5FKOA 3I4MJ 2NRAC 4FL6A 3I5UA 3HOYJ 4M7DD 3BR1A 4L0YB 2DNUA 4RTXA 3HOUJ 2M7BA 2UV1A 2RQTA 2DA7A 4HCCA 1Q86R 4PJMA 1W70A 2WY7Q 3FKJA 3I64A 3S16J 1AZGB 2DD5A 3V7RA 3TO7A 2AO9A 4A0XA 1Y07A 4OF1A 2F4IA 2Z99A 3S1NJ 1WJFA 1TQIA 2RVCA 3ISPA 4PGGA 2R5ZA 5CVRA 4PLLA 1YJ9A 3FXQA 4XNFA 2XDPA 4M77A 2ISZA 1RC9A 1AWOA 2CQNA 3HSRA 2L3PA 1IZ1A 2O9LA 1KA8A 3WU2C 5EDNA 3IL2A 3K4KA 2R5YA 1RIOH 3E6MA 1NE8A 2ZPFB 4PJOA 2VT2A 3VUZA 3O5ZA 3TDUC 5IYBJ 4FT4A 4WCIA 3BR6A 1X2NA 4ESBA 2A6HF 2BZYA 2Y0MA 1YE9A 2O61A 4XKBA 1RAGB 5AT1B 1OX8A 2YR2A 1VQ6A 3X26B 3TEDA 2K02A 1ZARA 3C2GA 3FIFA 4AIKA 2CH4A 3CMEI 3HIFA 4RS8A 3G71T 5ILSA 3VSLA 1YIJI 3IWFA 5FD6A 4IHWA 2LC2A 2MOXA 2O2OA 1EX4A 5GJWB 2G7HA 3HOXJ 4BHPA 1TWBA 3EFOB 3G3ZA 1ZH5A 3ABTA 3MJXA 1SFOJ 4A6DA 3G1JA 1SD6A 4NBQA 3TO9A 4HNVA 1YFNA 2XU8A 2J5OA 2PUKB 1WSUA 2M7AA 2EZKA 3A4CA 4X0GA 1EJ9A 4RB0A 3VYTB 1JI8A 2BY0A 4LG0A 2KDSA 1IRGA 2RJCA 1YHQI 1TQMA 5KYYA 1X01A 1M2OA 2FD5A 1X75C 2COWA 4KMFA 5DY9A 2DFHA 4OGCA 4FCYA 2XB5A 3M8EA 1SVOA 3KP6A 2QGGA 1W2BP 1FMKA 1TWFJ 2HVRA 4Y17A 4J9GA 4UUTA 4BUGA 3K7AJ 4TVRA 1BI0A 3L2WA 2ENMA 1R5HA 4QPOA 2ME6A 4OIRF 2MLGA 3B6CA 1Z3XA 1H89C 2YU9J 1PM3A 3CPWA 4P5OA 5GMKh 2MBFA 1R5ID 3E6DA 3IAM2 4XKCA 3CEYA 2JTMA 3L2ZA 2DAOA 1XC5A 2MGQA 3N05A 3FXMA 4ZJZA 3JRAA 4EM2A 1WH5A 2M35A 1HD3A 1UGQB 2K5FA 4IUPA 1QHGA 2HGCA 2DPUA 2ROLA 3I59A 1KK7A 2QXFA 3DKWA 3JAMK 1EFNA 2LVMA 2QYOA 3LOCA 2X3WD 1VQNA 3ZN1A 5LJ5e 1YX3A 1JXOA 3J81Z 4X34A 2BHYA 3E0JB 2EQKA 1TTHB 2R4GA 1VQLT 4BH9A 3MCAB 3HEFA 2EIMH 1NEGA 2VXFA 1TW3A 2LQKA 4DOVA 3CCEI 2MD0A 3QP6A 1KQ0A 1R1VA 4A5MA 4BS9A 3VFZA 4J7IA 2K86A 2E5NA 1QZYA 3DP7A 1WA7A 3DEUA 5CVIA 1O9SA 4M78G 1KGSA 1IHVA 2EGCA 2RHIA 1LB2A 2V9PA 3VS3A 1HSTA 2RQQA 3F72A 4LK1F 1FYNA 2MPXC 2FL7A 4PNOA 2FA5A 3PUBA 5GP9A 4EQQA 4M7DG 5GAHJ 3VYSB 2KFDA 4IUUA 4HT8A 1M3AA 3G7ZA 2QQRA 1VUBA 4J7FA 2LRQA 1V4RA 1QVFA 4WK8F 1EZZB 1F4KA 2DK5A 4D8KA 4R1HA 4HLYA 5LRRA 1U8BA 4QQGA 2OTLT 1G6NA 2Q1ZB 1ZUUA 5IHIA 2DXCA 1VQOQ 5GAMj 2IP2A 4CYCA 1AOJA 3E6BA 5KYUB 3H5RA 4LG3A 3SEZA 5GAMg 1EA3A 3JB9J 2ECZA 2EKOA 4GXOA 4RBOA 4C8QG 3J80Z 5TJJA 2VYTA 4QW2A 2HSEB 1PJRA 2DQLA 3FLGA 2W84A 1XJWB 1QNTA 4PLIA 1QO0D 1PP8F 1PSEA 5D5XB 1EH8A 1MMGA 3V8LA 5AYFA 2ZNYA 2CT4A 3TOAA 1VI0A 1YITT 2JVHA 5CVJA 1VQ5I 1FYKA 5D7UA 2XKPA 4IL6C 1X1AA 1W5SA 2L9SA 4HEA2 4S0HB 3JRBA 3CJQB 2YUOA 1YI2A 3GF5A 1ZHIA 4EPCA 1D1BA 3HFNA 3AAFA 5HOOA 3OS2A 2VN2A 4BKXA 5JI6A 3O8VA 5I11A 1G3SA 2YX7A 5F0CA 2KT8A 3PMTA 3SEMA 2M51A 1JT6A 3F6VA 3KLNA 3CCEQ 4ANJA 4C3IJ 2DXBA 3S6WA 3M7GA 5KYWB 2R3SA 1FXXA 4J9BA 3P7NA 1VQKQ 1VQ6I 2W4SA 3REBB 4Y52J 5IOYA 1RKTA 4YFNF 3F8NA 1LUJB 3BG6A 3WTWC 2Y0SA 3GF2A 4OIQF 3MQ0A 4CCOA 1E3HA 1YJWA 5GANe 2IGNA 1I39A 1VYVA 2HQ5A 5IOZA 1I1JA 1QCOA 1FOYA 1Q1VA 2AKKA 3T0YA 1A6IA 2LVSA 1JKRC 1R8OB 4XRSA 2JVVA 4EMKC 2J7IA 2QKLB 1IXCA 5D8KB 4C30A 1WLPB 2CP7A 3OYBA 2KISA 1QP2A 1Y1VJ 1Q7YC 2ZBKA 3KBGA 4AC0A 4J5YA 1P2FA 2HOEA 1UG2A 5JR3A 1N77A 5LJ5h 4DZPA 2OQGA 4NL2A 4XLNF 3G6EI 1IN5A 5CAIA 1LDKB 3A8GB 4M4ZA 3OMGA 2XG8D 1Z7LA 2EJ9A 2F48A 2FNPA 2CWEA 3MKYB 3K69A 2QAZA 2Q0OA 1DGWY 4M3BA 2D45A 4C0DB 2FPFA 3JB9G 1YN8A 1QZZA 2P8TA 3JCUC 3GFIA 2RHUA 1SEMA 4A3BJ 4F3QA 2VPLA 1OR7C 4XR6A 3LWIA 2RF0A 5IT9K 2WSFE 4CDGA 2P84A 4JJDA 5A0GA 1M1GA 4QT7A 3JCMh 1K83J 2E2JJ 3QQAA 2BE9B 4ATOA 3BDLA 3L2UA 3G71I 2M4GA 2VBXA 2VE9A 1NK3P 1JBMA 2QM3A 1QKWA 3AT1B 2LLKA 5CLSA 5GAMh 3D5SC 3CDIA 4U88A 2LX7A 3PTAA 4BI8B 5DM7R 4M77C 2IS1A 2ZPEB 1IHWA 1MBFA 1UDLA 3FMRA 4A3GJ 1OYYA 4PGHA 2JTVA 2Z2SB 5HODA 5HLTA 2FZKB 2HQEA 5H20A 3ROUA 4ZGDB 1VQOT 1NG2A 2L0KA 2PVOB 2L3SA 4C5GA 3U21A 3K70D 1WXUA 1ZLMA 2ZJRF 3H36A 1I27A 2K9QA 5K5OA 3VSKA 2YPRA 3PQJA 2PUOB 5IT3A 1NHAA 2YWWA 2RNGA 3T1BA 3JSPA 1T8IA 4RGXA 1MV0B 4JX6A 4PL6A 4V2SA 6PAXA 4BHBA 2HXOA 1YIJA 2K85A 5J3LA 1YWOA 1EF4A 1QQJA 1GVDA 4AVZA 2V4JC 3LNQA 1R49A 1YJNA 1UGPB 1OEBA 4RB3C 1W1FA 1A04A 3J81E 4B4CA 4M7AA 2F2EA 2KIUA 2KQRA 4RAZA 5GAN2 3OSGA 2CQKA 2RMOA 3EG1A 4PSXA 3V7SA 4LJZF 4RB1A 3TW6A 5C4XJ 1WI7A 4A3EJ 2Y4YA 3M57A 4HCZA 1K9MC 1B9MA 1OX9A 3I55Q 2VOOA 3OY9A 1TS9A 4AFQC 1VQNI 4XN3A 2AXTC 2DFUA 2HXIA 2QVOA 1K73U 1VQ5Q 3D0SA 1KQ8A 1UB4A 3I54A 4RAFA 1TZLA 1RAFB 4J9IA 5GANd 2P0PA 4D7MA 1ENHA 3ZMUA 2K3BA 3S3OA 2JW4A 3C95A 1REPC 1BK2A 2WTEA 3S2WA 2DOFA 4RCBA 1V5FA 2KLOA 4G8XA 2VKDA 3S17J 1H9GA 3M55A 5DUIA 1FOWA 1YBYA 3MZHA 4Y13A 5GANj 3KEYA 1SANA 5AONA 4G7OF 2LNBA 2MUNA 4PFPA 2GBQA 4PJOC 2AHQA 1IN6A 3KYLA 5TISC 4ELZC 2BE5F 3VU3C 1HSJA 4IO9F 2EJFA 3HG9A 1KU7A 2PQWA 3PMIA 2OTLA 4N4NB 4BL0B 3HPGA 3CQZJ 2L9NA 5EF6A 2BVMA 5HLGA 1FJLA 1K76A 1QRYA 4J9EA 4CC2A 2PU9B 2NVXJ 1NLOC 3FDRA 2PMUA 1JGSA 1JKOC 1NPPA 1HYOA 1U3EM 2DT7B 4O5VA 2XF5A 1RUNA 2M02A 3CESA 2F4OB 2GOXB 2DTOA 2XIGA 4M9ZA 3OL3A 5M3MJ 4YRVA 4LN2A 3PVLA 2VIXA 5IH2A 3OW2S 1PSFA 1I3AA 1J2XA 2BE7D 2EFWA 2D2WA 2QEXT 2CV0A 3OBWA 4JRKA 1L3LA 2LBFA 2F69A 4NOYA 1YI2I 2HDAA 5GAOm 3P9KA 3OYFA 3OA6A 4XOPA 2MLKA 5EC7A 5CVVA 3WGHA 4RGRA 2E71A 1QVGA 4II2A 1K4TA 2IXSA 5LJ3f 3HRSA 1F1ZA 1FT9A 2EH3A 1NZ9A 4I98B 5GPCA 2B8AA 1LVAA 3V7CA 2JS0A 2PNIA 1QKXA 2EV0A 3ZEHA 1FIPA 1D3BA 1NJIC 3LSHA 2KGTA 1S72T 4BY6C 4UVBA 5ICGA 2QSFX 4LMYA 3PM1A 5AIPA 5F1RA 2QEXI 1W0TA 1IREB 1T0JA 5FLXE 1S7OA 3RDIA 2EGAA 1W4MA 4XU2A 1R4MB 1YIJQ 4EMKB 3E5UA 2TCTA 3BPXA 4EJVA 2E2IJ 3BTLA 4IHVA 2HKOA 3OW2A 2R0QC 1J59A 1Y6IA 1BI3A 2JA2A 5BPIA 2L3RA 4ZYAA 2HVSA 3VS0A 4RTTA 2AS5F 2LT1A 2F6CA 1LOJA 5DLOA 2DTZA 2KJCA 1O3SA 4M6YA 1BI2A 1O3QA 2AQFA 3EG9B 1IO6A 1MNEA 2CW0F 2P7VB 2QCOA 1JJ8C 4G7HF 3BW1A 5DDGA 3SDZA 4YFXF 3I35A 4MMLA 4U7BA 2W0ZA 5J4YA 3G4SI 1FLIA 3PNWC 2NUZA 4IXAA 2Q8KA 4C0DC 4ITVA 1ZR2A 2XVCA 1NPRA 2H1KA 1F1BB 2E1OA 1RAAB 2YUPA 1G2HA 2XF6A 3SXYA 2M0CA 3JV3A 1K73C 3HBLA 1RETA 2LZ6B 4M7DA 2LF8A 3CC4T 3CXCP 1Q7YR 1T33A 5GANh 3H9GA 3VB2A 1JTXA 3BQYA 1T38A 3CCJQ 2FBKA 4HRIA 3K1MA 2DL4A 1VYTA 3FJ5A 5GTHC 3LH0A 2F4MB 2LJ3A 3VYGA 4NC7A 1P4WA 1H0MA 1WXTA 2F5VA 2QG9B 1N75A 2XAHA 1XDUA 3NWTA 1LE8A 1NG6A 3QYEA 3H8ZA 3I5SA 1DGRM 1QVUA 3CDLA 2AZSA 2KRSA 4Z88A 4BI4A 2EQJA 4OMMA 3KP4A 5C0MA 3CCMA 1KD1U 4C92D 4H4KC 1OPCA 1IV8A 3WTUC 4HDUA 2DA5A 3E3VA 4JX4A 3L00A 4I99C 4KICA 4GCVA 3BG9A 2HYFA 4BAYA 2STWA 3JRFA 3I5RA 2EVRA 3J7AF 1YS6A 3KEQA 2K2MA 2RI3A 3TGNA 2BVLA 1SPKA 1RUOA 2XAQA 2Y48A 2DVJA 2EZHA 4V2GA 2HZTA 1RUWA 3CXCS 3QWYA 1U0JA 2KRCA 2BW3A 3CMAT 5KHDA 2Z16A 4KNYA 4M7AF 3CF2A 2IEKA 2EILH 1JTYA 1Z91A 3ESWB 2RQRA 3KYDB 3VS2A 2JRMA 4HPQA 1T3LA 5EYRA 1GV2A 1LKXA 1X1CA 3M0TA 1VQKA 2HAXA 5JLXA 2LMDA 3NQOA 5FKNA 1I1SA 1ZSZA 3OSFA 1PUEE 2PTKA 3DB3A 1R0BG 3W6JB 5M5XJ 1WJAA 1JB0E 2VC8A 3SWNB 1LPQA 1IXRC 3PT9A 3CD6Q 3M3YJ 1E6GA 1GCQC 2Y0SN 1D5YA 1PKSA 2FZGB 2A5YB 2DA1A 2NVTJ 3M0SA 2DL7A 4XIDA 2LBFB 1IW7F 1FIAA 4U0YA 2V1RA 4FE7A 4MZTA 1YI2Q 1IRZA 4A6EA 4UB6C 1HXDA 5LGNA 1VIFA 2W24A 3F21A 4I0AA 4EMKA 5FRMA 1GCPA 3OL4A 4LB5A 3L2QA 3EFRA 1KG1A 4MNUA 3FM5A 2Y2ZA 3OYAA 1FBUA 3P9IA 1KQ1A 3RQ4A 1V76A 1WRJA 4FHTA 5J1UA 3CCJI 2I0NA 2VT3A 1YHQT 3K70C 2DTIA 3ZRGA 3ZBDA 5IAYA 2CKKA 3DB4A 5KVRA 1WZOA 4BQAA 3FXJA 3HM5A 3HOZJ 2LC4A 3FDYA 1X3ZB 2PZ1A 1ZTRA 2EA4A 2H09A 3K4NA 4M77D 2FF4A 5HDNA 1WGXA 3G71Q 3DLMA 2XPUA 1VQKI 2JT4A 3CJNA 2VUBA 1NLPC 3F3XA 4OB2B 3M58A 5D6WA 2DA3A 1V55H 4K2EA 2RNJA 3O8HA 3HHGA 2M3AA 4OMLA 1EKEA 3K2ZA 3M8JA 4ZYGA 1X2QA 3FF5A 4CCJA 2AZVA 2FEIA 4HF2A 2EWNA 1T6SA 2H3EB 4CCMA 2P0KA 4J8OA 3UA6A 4QQDA 3EG3A 4AVPA 4HF0A 3PNYA 5HLIA 4E7LA 3BE3A 1UG0A 1VQ9Q 1DU6A 2CZ6B 3META 4JYKA 4D6WA 5GAMe 2JA5J 4U0VA 4DOZA 2BYVE 4IOCF 2R7TA 1MSEC 1BKBA 3GLXA 2V9VA 4XN0A 1KQ2A 4CGZA 1PNJA 2F1LA 2GCXA 4OMPA 3JCMe 3EDPA 3CUOA 3GTKJ 2VOPA 2EPFA 2JM9A 5GMKm 4X1EA 2DO7A 1MW7A 1OQKA 3PFSA 3WGIA 1JO8A 4XSXF 3BCBA 4FQGA 4UUSB 2KIQA 2VKVA 2GFAA 2LP0A 1SFKA 2E3HA 2DMPA 1XSXA 2JA6J 3PO2J 2GAUA 3CP8A 4EIKA 3EYYA 4U0WA 4XLEA 3R6SA 2W1OA 4JLGA 2QBYB 3X2QH 2GM4A 4Y92A 4A54A 5KYXA 1D8KA 1ON1A 3DF8A 3EUHA 3MKZA 3BCAA 4BE0A 4JK1X 1D09B 2JN0A 3CCJA 3MEWA 1WJEA 5F6FA 1MV3A 2DEQA 3ML6A 2V26A 2WB1N 2O4XB 2RV8A 4I76A 4A3DJ 1V3FA 3MD2A 4AYBA 2YLCA 5GAN7 1VTNC 1R4NB 4LDXA 3A52A 1W7PA 3Q0WA 4EJWA 1USSA 1P7JA 2VVKA 4KMUX 5BS6A 1Z3YA 1BOBA 2Y31A 3HC7A 1OCCH 1DUXC 2M0YA 3UDCA 2E1HA 4QQ6A 4OOIA 4A4EA 3FMSA 2Z33A 1GFCA 3I56A 2P7CB 2VODA 1MBEA 3LSTA 4IURA 4WWCA 3KZYA 2D0QB 3ABKH 3A1YA 4AFUC 4KFCA 5GMKj 3G4ST 3LH5A 3C12A 3KCCA 4XTWA 3HTUA 4GBQA 3CUQA 2K6DA 8ATCB 5FRNA 2CU7A 1RAIB 1IO2A 1M1KC 2R5YB 1ARKA 2X1DA 4QIWN 2W25A 3PNVA 3CCLQ 2HQNA 2K9LA 1WWXA 4BBRJ 3ONQA 1FOKA 3CCVI 4ZDOA 1E17A 1VQ7A 3B02A 3HHHA 1KU9A 2YXYA 2OZ6A 3LSGA 1YIOA 2VJIA 2ELJA 3B73A 3F8FA 4WF2A 5CJ9A 3JB9I 2MZ4A 1OKRA 3AG4H 1BM9A 1VQPQ 2CRGA 1PUFA 5A2QZ 2JVGA 1VQPI 1S29A 3M07A 5DV5A 5A2QK 3I55I 2A7YA 3ASOH 2ECCA 1VQLI 2VWFA 4LD6A 4C8QE 2QENA 4IIOA 1MJAA 2BBYA 1OI1A 5GAOr 2K5IA 3WVEB 3RPUD 2K9GA 1M1EB 1TWCJ 2MAMA 1QVGS 5F0FA 5GADJ 3S2HJ 2ZPIB 3C0CA 5FB2A 5C44J 2R93J 2KROA 1LQ1A 1W2BA 1R5GA 4A12A 4KIBA 3V42A 5ED4A 4N9HA 2OCEA 2QGFB 5FWCA 1PKTA 3LSMA 5DD4A 2LJ0A 3J80E 3HZJA 2FRHA 1LCKA 4JUVA 1V5EA 1ZGJA 5FD5A 3WG9A 1K78A 2LNVA 3RMSA 4C5HA 5HDGA 2ZCFB 4CSWA 3HTRA 1X19A 3ERED 2EBPA 3G1LA 1YJWQ 3OYNA 3HTSB 1X3UA 2P81A 4KJZA 1Z9ZA 1D0ZA 2QDYB 1BIBA 1KSWA 3UATA 2P0WA 4CXFA 3U1KA 3DBLB 5JFRA 3WU1B 2A28A 3QAHA 1WX6A 2QQAA 1VF9A 5J47A 3DU6A 8AT1B 4XOTA 2G3RA 4F7UB 3GFLA 3MVPA 3NARA 1MMSA 2E4HA 2YRCA 4HX7A 4KH1B 2ZPHB 4RM2A 3T9NA 3SDBA 2WAQN 2IJLA 2NS8A 2WSCE 2D8JA 2RK2A 3H0HA 1U1TA 3D5LA 2HQAA 3IQLA 2B7EA 1U8RA 2F2WA 4BY1J 2EQUA 4M7AE 1X1DA 5GAEJ 1W7PD 1GXQA 4L5JA 3UT1A 2A36A 3BR3A 5B1AH 3FHZA 1LPLA 3QXEB 2RO0A 3FXLA 3SZPA 1C0WA 4HVUA 2KZGA 1CF7A 1B59A 3ZQIA 5FLVA 4MQVA 2X1CA 2CO5A 4M75E 1LFBA 4IVNA 2DU9A 2LP5A 1JUPA 5J39A 2MW8A 1WHJA 3CXCA 2O9VA 4R56A 1J7KA 1A5JA 1AWWA 4Y4RA 2Y90A 5CKEA 3RYRA 5FFZA 3IC7A 1SAUA 4ZH4F 1D3YA 2H8RA 1MGQA 2BW3B 4CA0A 4WXHA 1NH3A 1ONVA 4F7UA 3AG1H 4EMHA 1UJYA 1OJLA 2XHKA 4PUSA 2DIQA 2N8GA 2MCNA 3DKMA 4B43A 3QUIA 3QIIA 2GLOA 4ZTFA 1E7OA 2DMUA 1A0NB 4IF4A 4IRHA 1OULA 1N9SA 4A3KJ 1IN8A 1B34A 5L8RE 3PVQA 5GMKe 5KK1A 1QBJA 5FKLA 1M4ZA 4KITB 2FU4A 1VQMA 3TOBA 1H3ZA 1W4SA 3PIOA 2LTOA 1ZQ3P 2YHTA 1QCNA 3ZOBA 2OV7A 3CCQQ 2M1HA 2COZA 4IZZA 3M4GA 4P9FA 1RPWA 1PCXA 5EEGA 2R7DA 2XSJC 1QPIA 3CMEA 3QJYA 2V9KA 4OB1B 4LLGF 4N0BA 3CC7T 3KUFA 3NTKA 3ZMTA 1IUYA 2YSQA 2YU3A 1ZUYA 1PVEA 2DZCA 4QPQA 4QWQA 2X4WA 3JCMX 1IN4A 3GFJA 4RAGA 2R58A 4OMQA 4CO8A 3RKXA 2NLUA 1QQIA 4XK4A 1H9TA 3NFCA 3BR0A 1K4US 1WZ2A 1W7PB 1OQYA 5EGOB 3H35A 1T56A 1IN7A 5LD2C 4JRIA 2HDCA 1TP4A 4A4KA 5IPAA 3J7AW 1WJBA 2EYYA 4ZN3A 3M54A 1S1NA 2RQPA 5KAIC 1FY7A 3TEEA 5LJ5f 3FJPA 4Y7NJ 3A98A 2AQEA 3JCMg 1UHWA 4GO1A 3Q3SA 3VOEA 1VA7A 1YJ9I 1YNZA 2BY3A 2CV2A 3LFKA 1ZA1B 1UTIA 2GWRA 1YTYA 2J6OA 3MKDA 4F16A 4BQQA 1M90R 3G1MA 3M1EA 4LIVA 3P5JA 3CO7C 4AIJA 2HOAA 5EEAA 2OAUA 2KR3A 2RHZA 4ZGEB 2L89A 3S3NA 5KYYB 3CCST 1UB9A 2EJRA 2F5CA 4E4HA 1F43A 2FPDA 4BE2A 2DMTA 2CS7A 4PDKA 1O57A 2QTXA 2Z3YA 4M75D 4XTUA 1U6GA 3H9QA 3JCMf 2QEXQ 1UELB 3ZQFA 2LY1A 4L9NA 4A3MJ 1D1AA 2BHZA 2CG4A 4CYCB 2K4YA 2GZWA 3RPUA 1UAAA 5KYUA 5E18F 2OX7A 2JS2A 5CO7A 2Y9ZA 1M27C 1VQ4I 2W82A 2HL3A 2X3XD 2OTLQ 3G6ET 1QVGP 1XCBA 4MHGA 1ITYA 3HHTB 4MTEA 4RMNA 3S32A 1ETVA 2XAGA 5FJ8J 1QVTA 3EPZA 3MZ8A 3V8KA 2X1EA 5HNFA 3L1PA 1SKUB 2ZJPF 2ZGWA 4R55A 2Q2EA 2PVDB 3TMOA 4P55A 2RN8A 4MTDA 3OIPA 4D1QA 3I56I 2NOJB 2LJ1A 2I5UA 2WAFA 1JQQA 3QG1A 2QBYA 2ESHA 2DK3A 1G5VA 1XGOA 2A69F 5KNLA 1ZGAA 4PJOG 2UXXA 1TNSA 2LR8A 2OAZA 5H6RA 2RHYA 3OWTA 2E7WA 1M3CA 1M2VA 2ZXIA 2G9WA 1N78A 1S6LA 4EGYA 4FT2A 2DL8A 3S93A 3CPWS 4I7HA 3JRCA 2MC3A 4XU0A 4RG8A 4WTOB 4KYWA 4HW0A 1VQ5A 1JKPC 2HTJA 1CKBA 1RAEB 1WYXA 4AFZC 3AG3H 1B6AA 1ZG3A 2WWYA 2FXAA 2ISYA 1OCTC 4BB7A 2YSRA 2J05A 1PC0A 4C5EA 4ELYC 1JU5C 2QK0A 2JMWA 1T0HA 2A0FB 2RQVA 3JRHA 3WHCA 4QTRA 3X25B 5BNGA 2JTEA 4DOWA 4YIFA 5IN1A 1KC8R 5DLQE 3UF4A 2CFOA 1ZQ1A 4NNJA 5FO5A 1MBHA 4Y33A 2L3QA 5ERIA 3G6EA 2M1BA 2V8JA 3GNFB 1K8AC 2XD0A 2M0MA 5LRSA 3HSEA 1JE8A 2J6FA 4P5NA 1G59A 4AFSC 3FK7A 1R6RA 4JS5A 3SWNA 5L3GA 2DLPA 2RHXA 1ABQA 5B66C 1K8AU 1KHIA 3F8BA 2OJ2A 4PZJA 5J4VA 1PWTA 3SHFA 2QLZA 3BC8A 1K78B 1JRIA 2X4JA 4J9CA 1IXSB 4LUEA 5J1RA 2RM4A 2OTLI 1ON2A 4HV5A 1JJ6C 4ZYEA 4IRGA 2EYXA 1VQ4Q 1OPKA 4AIDA 5KE2A 1BR2A 3L2VA 2FEZA 5JHUA 4IHYA 2MMPA 1T95A 4A93J 4C8QD 9ATCB 4CCKA 2NVUB 2DA9A 2NS0A 2ZKZA 1GXPA 1MZBA 1HDDC 1BC7C 2C6YA 3OYLA 5CIUA 3EETA 5H2FC 4E7HA 1HBXG 1G83A 4FW1A 2EQMA 5JVGF 4M77F 3LSIA 2XK0A 4M77E 4MEYF 3FC3A 1Z1DA 3JRIA 3I56Q 2F5DA 3K2AA 3I71A 4GLKA 1S8NA 5K7HA 4ON0A 3LFUA 4Y28E 1UHSA 2XHCA 2PG4A 1SMYF 1FYLA 2EJGA 3NPFA 3H3ZA 5LJ3e 2NVYJ 5GAOq 4DYQA 3MP1A 5E8GA 1V1CA 2X0LA 1KU2A 2X6OA 1A6QA 2JXBA 5LBQA 5EEHA 3CUQB 1P92A 3RZDJ 2L8DA 1KYWA 2VC1A 4ZDPA 4HQEA 1R22A 4R8HA 1KJWA 3OYYA 2QA4Q 5E3MA 1VQLA 4C5IA 1X58A 2DJZA 1B8IA 1G3WA 3I58A 2A37A 1O7FA 4BUPA 1CSKA 4B6MA 4ZYHA 4F14A 1PYVA 4BQNA 3A0BC 1T0FC 2DDAA 4E7ZA 3L2RA 2V79A 5GAGJ 1IAWA 4C92C 2COBA 1XNIA 1RAHB 1QVFP 2D1XA 1TTYA 3A02A 3IKVA 1XDSA 4EM1A 2LTPA 1WJDA 1VQ7I 3CCVA 3BTCA 2W7NA 2BV6A 2DRMA 1YI2T 3CC4A 4ZN1A 2DT6A 2M87A 1FNNA 2V1DA 3BG5A 4XLAA 4XBFA 5HDKA 5LGTA 2KEAA 3EHQA 5D6XA 5A0LA 4C0FA 3EYIA 1W2BS 3DPTA 1QZEA 1L0OC 1EH7A 1P4XA 2KDOA 2DM1A 1HKSA 1XPXA 2GFUA 1WQWA 3DTKA 4PJ0C 1CF7B 5F1JA 3OYMA 3LSJA 2P4RA 3PGGA 5IHNA 4RB2C 1HKQA 3PIPA 4Z89A 1FEXA 3CCLI 2HEOA 2CUEA 4G94A 3QJ6A 3BDUA 1ZREA 5IP7J 4HX4A 4M7DF 3HDDA 2L54A 2DJIA 2JSPA 3EUAA 3M0UA 1EV7A 4OINF 2MH2A 5HKCA 2BY2A 2DJQA 1BW6A 3ER0A 3GBQA 1LJOA 2P6TA 4N9IA 1PD0A 2B0LA 1NEBA 1Q82U 2HYGD 4D0PA 3CQTA 3ZGKA 1IV6A 3NMZC 3QDFA 2RKHA 3FB9A 2D1HA 2ZJQF 2NUPA 1X1PA 4OB3B 3MCZA 4M9XA 1Z9QA 3SZTA 5I21A 1K79A 2DYSH 4S04A 2C0OA 2FG0A 3QZ5B 3JB9F 4J83A 2VKEA 4UVCA 2QA4I 1M5Q1 2H1LA 1K73R 2XGXA 4L5EA 1DJ7B 5KCOA 1J5YA 2O01E 4J6XA 4L9JA 3MEAA 4I01A 1UZCA 4Z02A 1ETWA 1XTDA 4ENJA 4L0ZB 1K6YA 1BJAA 2DW4A 3OYHA 2MWOA 3FBIB 5E20A 2XICA 2DIGA 2XDDA 4Y3OA 3ZFJA 3HRUA 5LJ3g 5FFXA 1JJ2A 1IF1A 1XMAA 4M77G 2QSGX 4HX8A 2O4XA 5FLMJ 1SD4A 1WXBA 4M78D 4BY6B 4Q48A 3G73A 3R0AA 1ZBJA 2ZCWA 5D8LB 3J81R 3ZXSA 1RR7A 4G7ZF 3TVTA 3M56A 5TRDA 1R77A 1SFUA 2K4BA 4UB8C 4E70A 1P7IA 1VOMA 4RG2A 3I56T 1Q82R 3CD6A 2ICWG 1D0XA 2WAEA 3MKLA 2K40A 2KE9A 1IC8A 3U9GA 3QZ9B 3F0CA 2Q2EB 2W48A 2X4XA 4AMCA 4EJOA 2YRDA 2FE3A 3QYBA 2HNHA 2ECBA 2CJJA 3CZ6A 3PIPF 1MNMC 4LFUA 3HOVJ 4EVIA 2CMPA 4IUVA 3EUHC 1O7LA 4P96A 3REOA 3CCRA 2FHDA 2YUNA 1XG1A 1GLNA 1OYWA 3RJPA 5LJ5j 4BDYA 1E6HA 1JXSA 2HBWA 2Y4XA 3CPFA 4LDUA 3A03A 1JEGA 2LH9A 1I6HJ 5D6EA 1VQ9I 4L5GA 1Q1HA 1WPYA 4NHJA 4HSRA 1Q81C 1FZPB 2KNBB 1FX7A 3R4KA 2JUGA 3A8OB 3H0IA 3DLAA 5BQTA 3J7ZI 3OYDA 1ZRDA 4BYYA 5L3FA 4FSSA 5LJ5d 2CGHA 2CP2A 2F5KA 4H0EA 1TUGB 1VQLQ 4JRQA 4QVZA 1WCMJ 3H5NA 2K7LA 5ICEA 2HS5A 3OR2C 1MH4A 4J9FA 2DO3A 2CYYA 1X1BA 1JJ2P 1P9QC 3JSOA 1IGUA 3RCOA 2DPDA 3A8HB 3AL0C 3IH2A 5DS9A 1VQOA 2EYQA 2R5AA 1Z05A 3CUQC 3ZQQA 1BI1A 3HYIA 2DBMA 4EATA 3CCLT 2K57A 1M90C 2DFIA 1XN7A 3JTHA 4OWRB 5E3NA 3OS1A 1YFHA 1BL0A 2DE0X 3I9QA 3V8JA 4HVVA 4PJOF 3EG0A 3TL4X 1Z77A 1UHFA 2LSOA 3S8PA 5IT9E 3AL0B 3BDDA 2VI6A 2EGEA 1J0RA 3X28B 2FRYA 5E79C 3KP3A 3RKYA 4IOAF 1OZ3A 2LKXA 1XQHA 5JVTA 3LA2A 3ZQCA 1WJCA 4W1UA 1QCFA 1O3TA 5FU6C 2HKQB 1SVLA 1LDDA 1MMAA 3C7JA 2ZFWA 4XSZF 3IKTA 1B72B 1Y0MA 2JMCA 2SRCA 3NGPA 1H92A 3O6BB 4KGZB 5KYNA 1Y39A 2KBTA 1RKWA 3Q9VA 3T8RA 2BY1A 1I5OB 3HP9A 3E19A 1GXIE 4XQFA 3S2DJ 1UFMA 3WHBA 4F7ZA 2PVGB 1ZSZB 1RRJA 4UY8I 2LMJA 4N4HA 1YOVB 2E36A 5J8CA 2JRTA 2KDZA 5IXFA 4M75A 4EV0A 3QPTA 1NYGA 2JJ9A 2IAIA 1Q7YU 1D1CA 1FWZA 5E1XA 1UGRB 4AIHA 5K5RA 3EGUA 1FYMA 2KJBA 2O8XA 2VXDA 2HCKA 4OGEA 5M5WJ 4C92E 5LEJA 1KQ9A 3E2UA 2X9HA 4DBRA 2EZIA 2ZB9A 2XSDC 4C92F 1LFPA 2LCLA 2XAFA 5IP9J 4XRSG 2BTTA 2IIMA 5CQYA 4NL3A 3QOPA 4Z2YA 2RPNA 1WJSA 1KU3A 3BTJA 3P9CA 1MMNA 2IGMA 2FMLA 2MSYA 2VB6A 3QP5A 5D5WB 4WX9A 1D5VA 3HL2A 1D8JA 2KKOA 3E7LA 3DU5A 1TSFA 1VYUA 4LNPA 2R5ZB 3R6NA 1RLPC 4PSWA 2OCCH 4M77B 4HCBA 2XKOA 1SF9A 1VQKT 1YRNB 3JAMR 1JUSA 5M5YJ 1KC8C 3RESA 4AD9A 2RN7A 5CKTA 5BOXA 4ENMA 2RDPA 2K3YA 5L3DA 2J6KA 3VYRB 2MK5A 3DXJF 3BZCA 5J26A 1LNWA 4JJBA 2BGCA 3LAJA 4ZYDA 1NK2P 3M5AA 4ZGJB 4C2MJ 4II1A 3HUGB 1PRLC 2RI5A 3GZNB 2LOOA 4UV9A 1MIJA 3KPHA 3L1AA 4LDVA 4JBAA 1W6XA 4M7AD 1E3OC 4LK0F 3K9TA 4XL9A 5D5UB 2EZLA 3CD6T 5CCAA 3OV8A 2PMZN 2DL5A 1Y1WJ 2HWVA 2R7VA 3GNGA 2WACA 1UJ8A 2E41A 3K10A 3OYEA 3TSWA 4YFKF 4YIRX 3WTSC 5F27A 3BQZA 5M3FJ 4IRIA 3P8HA 1Q86C 2O03A 3UA7A 4E7IA 3A01A 4YEJA 4B9XA 3BJ6A 4C92G 2QEXA 1R0CB 4BU2A 4HLXA 1G3TA 3OIOA 4AG1C 4WXCA 3LSPA 5ICCA 5DM6F 1HK9A 1U1SA 1AU7A 3CCMI 1LEBA 1FP2A 3INZA 3CC2T 4O3MA 1MJBA 5J1YA 3QHSA 1TWHJ 2QQBA 4CC7A 4UV8A 3V4GA 4BNCA 1H641 2VLAA 5K1YA 4O6JA 1F5TA 2CUDA 4M75G 3NWSA 4DGWB 1PHTA 2LQ8A 2YS9A 3FISA 3TKYA 3E9GA 4F04B 3I9V2 1V5GA 4B8XA 5IYCJ 1BW5A 5GAN3 2L9VA 4DZJA 1BC8C 2IS2A 1Y57A 2BEOA 4U87A 4XK8E 1XX5A 5HS8A 3CC7A 1YQAA 2EV5A 1Y7XA 2HKXA 1YO5C 1DDNA 2CP6A 1XB4A 3VS1A 1OCOH 2GA2A 4ZTJA 2ACJA 1X4PA 2FZCB 1WGSA 1VQ8T 1ZGWA 3RI4A 1TU0B 3M0RA 2DTHA 2XB0X 1ZG5A 3S3MA 1A31A 5H6QA 5K7ZA 1KD1C 1VQ7Q 1Y0UA 2DPPB 2V1NA 5M9OA 1ZHFA 3CMEQ 1RI7A 2LYCA 2YUSA 3GTMJ 5FU6B 5GAMf 1R58A 3CCSA 3W2AA 2RI2A 4RTVA 1SG5A 4B47A 1WHKA 3SYTA 2X6YA 1GRIA 5CR2A 2EB7A 1K9AA 4J19A 1HC8A 3K1NA 4YTLA 1M1KR 4A3JJ 3I59B 4FYXB 2A07F 4IPAA 1TUDA 2ESNA 3WG7H 2OTJI 3CCVT 2JZ2A 4HOBA 5E1ZB 2G0EA 5GANg 2V1UA 1TWGJ 3QPSA 2YRVA 1WPKA 1XSVA 2W85A 3IWZA 3NTIA 4DBFA 4ZDLA 2A6EF 2XV4S 1JHFA 2Z5UA 3WODF 4BJTA 4CI0C 2P5LC 1NM7A 5FW9A 3KIOA 2CUJA 1K6OA 1MGTA 2OBPA 3LQQA 2AHJB 4EMSA 2CUZA 3ABUA 4P9UA 3GTJJ 1PD1A 3JCMV 2ZAEA 2DTRA 1ZA2B 4Q47A 2M9HA 2C0TA 4LGWA 2R7QA 2FB7A 3BTIA 3LAPA 3TSZA 1NG7A 2EYZA 2BKDN 4EEFG 2LF7A 2DETA 3MPUB 4L9VA 2EIFA 3JW4A 5HLHA 1B9NA 2QKMB 2DKGA 3K4CA 2LRDA 1Z0XA 3S14J 3E6CC 4KT0E 4E6RA 4FIBA 3VYHB 1ZLJA 4ETSA 3CMAI 3OMYA 2HNIA 3SFMA 1VQMT 5EG0A 2PJRB 4OVAA 1C0MA 4HV6A 4F92B 1UJ0A 5EG2A 5GJVB 1KQSP 2DJNA 4A69C 3HXLA 5C3EJ 2DFFA 3GTPJ 2M8GX 1Y96A 3MKWB 4N0AA 1WQ7A 2K2VA 1TBXA 2XIDA 1Q82C 2GXBA 2VQCA 2BXYA 3SFZA 5J8FA 4CC3A 1S72A 3UR3C 2R7SA 1AWCA 4BE1A 3QKJA 3OOPA 1JGGA 3O3KA 2IG0A 3CC2Q 2KPMA 4OMOA 3GPLA 3GLLA 3AKZA 1TW2A 2EV6A 1QLYA 3SEQA 4M7DE 2COMA 4C3JJ 2KMUA 4L9TA 4N4OB 4F52A 2ED0A 2X4YA 3D1NI 1I6XA 3KX2A 1IZ6A 4ZZDA 1OZ2A 4Z8AA 2DDBA 3ABMH 2IA1A 1Z7UA 1F9NA 2K9SA 5IT9Z 1W5TA 2DFEA 1HF0A 2DXIA 2YDLA 4BI3A 1OU9A 5E17F 3H9NA 3REAB 4ESRA 1G3YA 4RTZA 3P8BB 2R7ZJ 3PJRA 1CQTA 1WH7A 2VKHA 3K1PA 2XMFA 4J9HA 1KQSS 2VASA 1S72Q 2L01A 5IY5H 2BZ8A 2E1NA 1H3HA 3BR2A 3ZL7C 3CCYA 3DPLC 3LA7A 2VBZA 1BBZA 1AOYA 4XKWA 3GZ5A 1FSEA 5ILVA 1ZKGA 2CH0A 2RGVA 2CYZB 1SD5A 3DQVC 3QBYA 1YJWT 4IUTA 2CFXA 2CT3A 1YIJT 2MABA 3EUKL 4M7AB 4HT9A 4CZZA 4LD5A 2DMNA 3F8CA 2GBYA 1J3TA 1B8IB 2FOKA 5E3OA 5EZHA 1VQPA 3JAMZ 4RTYA 2G7UA 2OF7A 2V1XA 3BJAA 4AWXB 2KYMA 2JWTA 3QPLA 4A2UA 1B3QA 3OR1C 2X98A 1OV3A 3NAUA 3ULRB 3QYFA 1TT0A 4RGUA 3RTRA 5K5QA 3EGXA 2DA4A 1YJWI 3GYHX 1ZX6A 2K7AA 1ETXA 3LA3A 1NTCA 3JCMQ 3M0PA 3GX4X 3MEVA 4MIMA 3LX7A 1RADB 2MFZA 2XI9A 2DMOA 1NJIU 3LYIA 4Z6YA 1TLHB 2QTVA 2PJPA 1Z67A 1OFCX 1IDZA 2EFNA 3F22A 4KUMA 2NUPB 3E1SA 3OYKA 1YITA 3BG7A 2JA8J 4XTXA 4HG2A 2X35A 3GW2A 3HRTA 4PFOA 5LHGA 2DD4A 1ORKA 3RERA 4PJOE 4ENNA 2C0IA 2QWWA 1IGNA 5CKBA 1I5LA 2HYJA 1GDTA 1GHCA 2VV5A 2W10A 4GFBA 3C4SA 2HR3A 2GOMA 1F36A 4DBHA 4IKFA 3CPWP 4KIGA 1U5SA 3JRGA 3QU3A 2EYWA 2K79A 2CQ7A 2E60A 2NYXA 2CS3A 4U7DA 1T3SA 2VXEA 3VS6A 3FX3A 4F7UF 1VQMQ 1FBQA 4IIMA 4HKEA 2WA0A 1QU3A 1ZK8A 5D4RA 4C8QB 2K27A 2A3LA 2E6ZA 4DA4A 3CCMQ 2EA2A 3MMYB 4FM4B 2HQXA 3CMAA 1ZLKA 5GMKl 2HZDA 2J5PA 5DEQA 4G6QA 1HW1A 2DXUA 3H41A 2ZSIB 4LOCA 2OUMA 5CVUA 2MA3A 3TBIA 1ZG1A 3VWBA 4LDWA 2XROA 1UECA 1Z21A 4IHTA 4LLLA 1I1GA 4KT6A 1UG1A 2X9DA 1WI9A 2R7FA 2DOAA 2ZMEA 3H3UA 3DCFA 5GANf 4L59A 4AUXA 3MEUA 4PJLA 2KP6A 1WNLA 2D6FA 3RKQA 3A2KA 1OYXA 2Z9OA 1N5ZA 2L4MA 4M78F 5L23A 3GIBA 1MJ9A 2HDDA 1U78A 4FASD 2YUQA 4MDXA 5AIQA 1W36D 2QQSA 3BFMA 2D1VA 4GGGA 4I2OA 4XKVA 4A0ZA 1JUMA 4M3DA 4DW6A 2A05A 4C2TA 1BCOA 3OOUA 2E2HJ 3H0FA 3CCJT 1DPRA 2MH9A 2FVUA 3GWZA 3ZQ7A 4LUDA 3TCJA 1IB8A 3W2VA 2LX9A 2XAUA 5GAMd 1VQ4A 5DCMA 4XM3A 4E6KG 4ESFA 1K61A 3RUXA 5GAOp 4LD9K 3HL8A 1SEUA 2HBPA 3GUDA 4RGSA 1JT0A 1I8FA 4FU6A 2XRLA 4F91B 2JUFA 2ZO4A 5HNHA 1RZ4A 4GYIA 4XLFA 3M8FA 3FXUA 2DILA 5LJ5g 2L4AA 2K5CA 4ZC3A 4DIQA 2P6SA 3KFVA 3CCSI 2DK8A 3OYJA 1MUZA 4J6YA 4NQWB 5LJ3d 4N4IA 2DQRA 2ADUA 3CTAA 1DP3A 5CQXA 3I55T 1XTAA 4M3EA 3IV5A 1R1TA 2XRNA 4I6ZA 4I09A 1AT1B 2K3PA 3GEZA 4XLPF 1M90U 4FYWB 2MYSA 5D4SA 1QMCA 3LWFA 2L7ZA 1WVRA 2EIJH 3HPHA 2HU9A 4MQ9F 3QRFF 4V2FA 3RIRA 5DCMB 3BROA 3FBNB 5FKKA 4OMFB 3OMCA 5KYWA 5I22A 3H92A 2DA2A 1FC3A 2VE8A 1WHGA 2LKPA 1UEBA 2GIVA 5EZGA 2ZPBB 6AT1B 4PJNA 2X85A 4NQWA 4XLHA 2O0YA 1V29B 5HY6A 2A3SA 1ZN2A 3BP8A 2OD5A 3BJOA 5GPAA 5C4JJ 4MDWA 2M8EA 2IPQX 3KP5A 1XGMA 3I53A 1W1WE 2KHMA 3U1DA 4JRPA 1BR1A 3W6KB 3DLLF 2E5KA 2DEUA 4MLOA 1VQ6T 5DTDA 3EH1A 3CJRB 1GL5A 3ZPLA 2GA1A 4EDUA 1YHQA 1YJNQ 3COAC 1XMKA 3K4LA 2R7OA 4KN7X 2W00A 1Z9CA 1HA8A 1Y0NA 1YS7A 2M34A 3K6GA 4N4GA 3HPWA 3TP3A 1LNXA 1SRMA 2QASA 2VGMA 3CCMT 2KIMA 1J75A 3DBRB 2PMHA 3CCQA 2IGKA 4L5IA 4IJAA 4A3LJ 1MHNA 2OPTA 1RLQC 1IRXA 1FMWA 4M3GA 3GZ6A 1YITI 1NYFA 3TO6A 1N9RA 3DTIA 2JSCA 2VJ5A 2DI3A 2NYSA 1IXDA 4XORA 1BCMA 5B3SH 2OTJA 3I4PA 3DKXA 3SHWA 1POGA 2IVMA 4DYRA 4A3CJ 2LDUA 2RJFA 2ZZDA 4IEJA 3WTXC 4RLFA 2VUMJ 3L9FA 4DYCA 2BZTA 5K7FA 2VXZA 4MZMA 1ZYRF 2YT6A 1WJQA 2XF7A 1WJ5A 2GXAA 2Y75A 1B34B 1KC8U 3QWXX 4HXJA 1I81A 1VQ9T 1K0SA 2DN0A 4M6XA 3IAS2 2LD5A 2WADA 2NXNB 4MFEA 2UWMA 2A08A 4HCKA 2CV1A 1WFWA 4NS5A 5A2QE 2KZVA 1JKQC 2A6TA 2CZ0B 3FKIJ 2FSWA 1XGSA 3JCMb 1BOAA 1I50J 5CQGA 4A4FA 2P4WA 1T98A 1ZSGA 1WHUA 3QDRB 4M73A 3ZMDA 1M9SA 3CLQA 2VQHA 4GRIA 3GCMA 3R60A 3TQNA 4JLIA 4M7AC 3DBHB 5BMZA 4BJ5C 1Z6RA 3M9QA 3KE2A 1S7EA 2M0OA 1G8XA 3G4SA 2EBIA 1DQUA 1E2XA 3L09A 5EJCA 2QZ8A 4UNOA 2I2LA 4L6V5 4EMGA 4CYDA 5F04A 1N6AA 2V1QA 2KRNA 3QU6A 4I02A 3CCUT 3CCET 3FK6A 2AXLA 2H94A 1QPMA 1H8KA 5EGOA 4B1RA 1O4XA 4XTYA 2OA4A 1GUUA 2L7KA 3ECOA 3SDGA 2HEQA 4ESJA 4E2FB 5C6SA 4PJJA 4C2UA 1YLFA 4LDYA 3NEUA 1E0EA 4J01A 2J06A 2O9SA 1C1AA 3FIWA 3W6VA 5CK9A 2ZC2A 3C1DA 4KRTA 3H0GJ 3KLOA 5FGMA 3JR9A 2KY9A 3LGFA 1R7JA 2EFPA 2FJ1A 1OPLA 1U9NA 3J7AY 4AYBN 1USTA 1UGVA 4C0ZA 5D6YA 4RUGA 4PK4A 4CCNA 5L3EA 4IQ4A 2WSEE 2JQ7A 3R6OA 4FSXA 1QHHD 1RR8C 1R36A 2ME0A 2FO0A 2QI2A 2QYZA 2L9RA 2TRTA 2JOYA 3PL8A 2DA6A 4XMYA 1SSFA 2NWMA 2RA2A 2M16A 5LL6S 2LY2A 3RBBB 1X6OA 3S1MJ 1QVPA 4D9JA 5LJ3h 3PO3J 1FTTA 2PEXA 3BWGA 2X4HA 4GYGA 3PUFA 5LHIA 1LDJA 3Q0UA 4UVAA 2O31A 5FROA 3S15J 3CBOA 3HB9A 4QVCA 5LLQA 1AA7A 4G6DA 1Y96B 2NVQJ 1ETKA 2L2PA 2ROTA 3RR6A 3JCMJ 5HS7A 5B1BH 2NNNA 3GTOJ 3CCLA 2L02A 3X20B 2DVEA 2KXCA 1TH7A 2O7OA 1HW2A 4OAZA 4IHSA 1OLTA 3DKYA 3CCQI 3EAEA 1R71A 3WVDB 1N25A 2DT5A 4L18B 3HRMA 3KYCB 1RESA 4M6VA 3F70A 3VRZA 3E5XA 2CQQA 1JXMA 2H3JA 3OYGA 1O75A 2V8IA 3NHNA 2HVQA 2ATCB 4B3XA 3X24B 2OU2A 3F23A 4WCGA 3GBGA 3HSFA 5FWBA 4RCCA 4K11A 2QF7A 3FRNA 1BB9A 1S9HA 2EFQA 1KIKA 2ZFUA 3CC4Q 7AT1B 1GT0C 2C06A 3DWLE 1TUCA 5TGTA 2IA2A 4EJTA 2CDTA 2LDMA 2DERA 3EFSA 2DRKA 2KSSA 3PIOF 4C9YA 4OIPF 2DBBA 3OS0A 3QPHA 2DL3A 5IXBA 2KT1A 3ZR8X 3L2CA 1D3BB 3FEOA 3CCEA 3FMQA 4LITA 1QA6A 1CKAA 1SHFA 3HKSA 2E1MC 2QQ8A 3DV8A 3SFIA 2R7RA 4X6AJ 4D5FA 3CO6C 2LQWA 4J6WA 1ETQA 1J09A 2F5FA
chains in the Genus database with same CATH topology
3A8LB 5FU7B 1PP7U 3J80K 5HS9A 3N5BB 2E5QA 2FYKA 2D9TA 1YW7A 2JPCA 3CBMA 4CRIA 1B1BA 3WGGA 2VGNA 2RC4A 1Z6TA 3A8MB 4E7KA 5L3BA 2ZJ2A 1SFXA 2QA4A 4Q5SF 4A5NA 3O2PE 3OSVA 4EJUA 4M75C 1MKMA 3WU0A 1JHHA 3FZVA 4X9DA 2P5VA 2STTA 4E47A 3QYGB 4Q5WA 5GAOl 2M5WA 2CZ7B