1U8RA

Crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
230
structure length
221
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA operator DNA
publication title Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal-binding protein,transcription/dna
total genus 65
structure length 221
sequence length 230
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u8rA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1u8rA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u8rA03
3GLXA 1Z05A 5LLQA 2Z9OA 2P4WA 3HRSA 4CXFA 3ZMZA 2NNNA 4HV6A 2QQAA 5D8LB 4ENNA 2E1CA 4LB6B 4KMUX 1IN5A 3RKWA 1U5TB 5F1RA 2YPRA 2VN2A 4CYDA 1XGMA 2WV0A 2XAQA 3DV8A 1JHHA 2M87A 4P96A 2UXXA 2IRFG 3ZN0A 3BJ6A 5L3EA 4I02A 2Z5UA 4Y17A 1ZG1A 4N0BA 4GO1A 1BJAA 1DP7P 3BPVA 1K78A 3EQLF 2VXZA 1JXSA 5LRRA 1HQCA 1GXPA 3I64A 1V4RA 3LSTA 4IVNA 3TDZC 4L9JA 1KA8A 2XAGA 3CTAA 4KFCA 4KNYA 3T8RA 1T6SA 3FHZA 2MA3A 1IRGA 1I5ZA 2LF7A 5IT3A 3BZ6A 2MBFA 2EV0A 2XAHA 3PQJA 2A61A 2XKPA 3QU3A 5DDGA 5K5OA 2VE9A 4BH9A 3K2ZA 4XSZF 1FC3A 1ZRFA 3SXYA 5DYMA 2F5CA 2MH2A 3EETA 4EQQA 2MC3A 4AD9A 3M1EA 3BJOA 3W6JB 3ZN1A 4U7BA 1STZA 4A5NA 3C3WA 2A07F 3DFGA 2FU4A 4XBFA 4KICA 2LX9A 3I71A 4P5OA 5DEQA 5KK1A 3EDPA 4R79A 5E20A 1ZLKA 4MHGA 1P92A 3KP3A 2ISYA 2K4YA 2BGCA 3LQQA 4Y15A 4EM2A 4CDGA 3KETA 3C7JA 2ESHA 3V7SA 2IW5A 2ZKZA 2YSRA 1I1GA 4A0ZA 4FT8A 1B4AA 1FBUA 5LEKA 4AIKA 2H09A 2RKHA 1DDNA 3CLOA 2XKOA 1HKTA 5BMZA 4IJAA 3BPXA 3CO6C 4JK1X 2VC0A 2M45A 1UB9A 3KP6A 1C0WA 1MJBA 3F3XA 5J8CA 3HOTA 5HOOA 2XGXA 5D8KB 4ETSA 2RC4A 3CUOA 4Q5SF 5L3CA 3R0JA 1O3SA 1YIOA 4UHTA 1LJ9A 3Q5FA 2OZ6A 5LHIA 1BBYA 4ZYHA 3F21A 2EWNA 3MQ0A 3QPTA 2FQ3A 3ECOA 2DK8A 4HLYA 2WTEA 3E19A 3FX3A 4KMFA 4L5JA 1TNTA 5CYVA 1I27A 1J75A 1J9IA 3L00A 4YIIA 2BYVE 3GFIA 1CGPA 4IRGA 4HX7A 2XVCA 3ERED 4LK0F 2VBYA 4EM1A 1R22A 1YS6A 3MCZA 4NHJA 1USTA 3RPQA 3WTWC 3SHFA 2M8EA 5D4SA 4HA8A 2L54A 1TBXA 3C18A 4HW0A 3DKWA 2DPUA 3LFKA 2FF4A 4ENMA 1B1BA 5JFRA 5JHUA 2EFOA 2F2EA 4ESBA 4M74A 1K78B 1YTYA 4F7ZA 3ZMVA 4U0WA 3KFWX 2CWEA 4BXUA 4EV0A 3MEXA 2FOKA 2Y0MA 5DD8A 2FBHA 5ILUA 1LDKB 4G94A 2M30A 1FYKA 3DPLC 1YYVA 2W85A 3PFIA 3FM3A 5E1XA 1KQ8A 4GXOA 1G3WA 5AONA 2EFNA 3TO7A 1LDJA 3I59B 1QNTA 1D5VA 2QBYA 2LDUA 3KP5A 2X0LA 2DLLA 3L09A 4Q47A 4MNUA 4WF2A 4PCQA 4NB5A 3EUHA 4I7HA 2ELHA 1R1UA 4WXCA 4HQEA 2FEZA 5D5UB 4XLPF 2J5PA 3DEUA 4L9NA 4U88A 1HXDA 1YO5C 2R3SA 5H20A 5K1YA 1PP7U 3KEOA 4L9TA 3D5LA 1QW1A 2OU2A 1SD4A 1BI1A 4O3MA 4DQ2A 4MEXF 5E8GA 1SD6A 3ZMDA 3TDUC 5FB2A 5CVVA 4B8XA 3T1BA 4CGZA 1DUXC 5IT9Z 3WGGA 1MDMA 4OIPF 4RAYA 1E17A 1FYMA 1TQMA 4GCVA 4RAZA 3KZZA 2VODA 3GO5A 3F8BA 3I4PA 5ILVA 3L2CA 1XN7A 2X4HA 4KN7X 1TW3A 2ISZA 2P6TA 3QRFF 3E6MA 2ETHA 3GFJA 3MZHA 2F5FA 4BYYA 2OQGA 4P9UA 1K79A 2A68F 3HRTA 2EV5A 3I58A 4CZZA 4N9IA 3HHHA 1XMAA 2HZTA 2FMLA 1SMTA 2E7XA 4EJWA 5JR3A 4FX4A 1ONVA 5DCFA 5D6FA 1JHFA 4WXHA 2XAFA 1ZLJA 2XAJA 4IXAA 4EVIA 3IRQA 3HSRA 3CDHA 2P5KA 2FE3A 5LEJA 3KP7A 1ZRCA 2K5LA 1JGSA 1BYMA 3ZQ7A 4I09A 3WGIA 1Z9CA 2W25A 2RDPA 5CVUA 2E7WA 3KP2A 3R60A 2GXGA 2H27A 4L0YB 4WWCA 1F1ZA 1UHMA 2BE5F 2VT2A 3PQKA 3WTUC 1KU9A 4G9YA 1REPC 2A3SA 4A12A 2EA4A 3K1NA 3VODA 5DCMA 1IXSB 1XSVA 2DTRA 1I1SA 4ASNA 4MTEA 2IPQX 3GXOA 4ENJA 4M9XA 2Z33A 2IJLA 1HW5A 1UHWA 5BS6A 5HDGA 2HYGD 2O8XA 3CUQC 1TTYA 1K6OA 3O2PE 3O6BB 3RJPA 4UXNA 1RIOH 2V79A 1IF1A 4EMSA 1IRFA 2KJBA 2JSCA 4LG0A 4KIBA 4LGWA 3J81Z 1W5TA 2FRHA 2M5WA 2AS5F 3DPTA 4RB1A 3ZP5A 1H9TA 2QBYB 5HDKA 3P7NA 5FFZA 3VFZA 3GWZA 2EB7A 4O6JA 1Z1DA 5D5WB 4QLCU 2PMUA 2CFXA 2CQKA 5FLXK 3RTRA 1Q1HA 2FXAA 2HTSA 1J59A 2FBKA 5DD4A 3FXUA 3K0LA 5KVRA 2DQRA 3L9FA 2PQ8A 4YIFA 4G6QA 3ML6A 1ZARA 5ERIA 2HQNA 2XV4S 5HDNA 5F6FA 3RDIA 4HDUA 3F72A 1G4DA 1ULYA 1LEAA 2GZWA 3BJAA 3LAJA 1ON1A 2STTA 4GGGA 2VE8A 2KIMA 3W6KB 3IWFA 5E8IA 2P7CB 4KUMA 1MDMB 1FT9A 1YQAA 2G7HA 4EM0B 4OMYA 4MTDA 3WE3A 2L02A 2PLYA 4U0YA 2QLZA 4CO8A 2A69F 4L5IA 5JVTA 2UXNA 4LB5A 3BWGA 4IHSA 2MD5A 2RGVA 1SMYF 2PBIA 4ZYEA 2FSWA 5LHGA 1NHAA 1LVAA 1HBXG 3WTYC 1H0MA 1TNSA 3ZMUA 1ZGAA 3K1MA 2B0LA 1BI0A 2P6SA 2A5YB 3FF5A 5LGNA 1YG2A 3GF2A 2MH9A 2DT5A 1WRJA 1KQ9A 4YFKF 1XCVA 4I01A 3JAMZ 1ZRDA 3DP7A 4YFNF 2PI0A 3KEQA 4LLLA 2OD5A 1ZREA 2EK5A 2XUBA 5HLGA 2HDCA 2NYXA 3KZYA 2GQQA 3WTVC 4EGYA 1ZH5A 1Y0UA 2ACJA 1EH6A 2AXLA 2DAOA 4P55A 2PJPA 3MZYA 1PDNC 1U78A 4NQWA 2ZNYA 3LWFA 1VTNC 1B59A 1FY7A 4PGGA 1R23A 3E6CC 2JT1A 4OMZA 2H6BA 2ZO4A 2D2WA 4S05A 3F6OA 2V1XA 2ZFWA 3LA7A 2RN7A 4XSXF 1SD5A 3RPUA 1QVPA 4RGRA 5DCMB 1P4AA 1UCRA 3T0YA 1R7JA 3DQVC 5ICCA 5DUIA 2M1BA 3K1PA 2IA0A 3R61A 1R00A 3GUDA 5BOXA 5BQTA 4LK1F 1MGTA 4LG0B 4M9ZA 3CJNA 3FM5A 4ZZLA 1WWXA 3U9GA 2RV8A 3I53A 4UVBA 2DW4A 1OMIA 3F6VA 2HWVA 2O0YA 2TDXA 2WC2A 4OOIA 2RQPA 1QPMA 2C6YA 3LQRA 3OOPA 3IKVA 1XCBA 2OZUA 4UV9A 3I5UA 4A0YA 4I0AA 2PFBA 3M7GA 3NQOA 4LLGF 2W57A 4P9FA 2WWYA 2O3FA 1YFHA 2KIUA 2Z3YA 3TGNA 2V1UA 1R1VA 1T39A 2D1VA 2GXBA 2A6EF 1YW9A 4CICA 2OBPA 3SFZA 2BEOA 3GFLA 2NS0A 2DPDA 1YLFA 1RUOA 3WTXC 1J0RA 2XRNA 2CYYA 2ZCWA 4G7HF 6PAXA 2OAZA 5FO5A 4MQVA 1S7AA 3RKYA 4G7ZF 1HKQA 1F5TA 5FD5A 3MHXA 4M9SA 2Y48A 4ON0A 2COMA 2IT0A 1UFMA 4L9VA 4D0PA 2EV6A 3BDDA 3QAHA 2L3DA 2UWMA 4JBAA 2F5EA 1PUEE 3R6SA 1AOYA 3TOBA 2H94A 4M6YA 2Z99A 4MGRA 5H6QA 5E17F 3GFMA 3GYHX 1G3TA 1OR7A 3MAJA 3OV8A 1B9MA 3KLNA 5AIPA 5F64A 4ZYDA 3WODF 1PP8F 1U8RA 3V7RA 1FBQA 4O5VA 4Q48A 3WG9A 4IF4A 1OYIA 1TLHB 4N9HA 3GZ6A 4H0EA 1V3FA 1P2FA 3RYRA 4IRHA 1ZAOA 4BHBA 4EJOA 3WTSC 1AWCA 1XB4A 4KIFA 1RNLA 2OQRA 1D3YA 1X3UA 3F23A 1FWZA 3JW4A 2KRFA 1SFUA 2R7DA 3HSFA 1MJ9A 4G7OF 2HQRA 3E5QA 4GYIA 1LEBA 1XMKA 1HSTA 4UVCA 3FXQA 5ILSA 3QU6A 1BC7C 2GCXA 3F8CA 1GVJA 5A2QZ 4G6DA 1OKRA 5FGMA 1IAWA 4GYGA 4UVAA 3FWEA 4OIQF 2KIFA 2RVCA 4HBLA 5ICEA 4LMYA 2GWRA 1S8NA 1XSXA 2IVMA 2PG4A 1HKSA 2W84A 3IWZA 4HZFA 1S29A 5CVJA 3E6DA 2EFPA 4BHPA 2G7UA 4A2UA 1FZPB 3J80K 1T2KA 2EFQA 1HSJA 2VT3A 1KYWA 4OINF 1MZBA 4LJZF 2GA1A 5E1WA 3V4GA 5D5VB 2HS5A 1BI3A 1GXQA 5K5QA 5D4RA 4PGHA 3F8NA 5CVIA 4EJVA 2P5VA 2ZNZA 4A0XA 2DI3A 3FMRA 3BROA 4KN4X 3ZMTA 3I0TA 1IW7F 1D8KA 1IN4A 1TW2A 2D45A 1B9NA 3RI4A 3ELKA 4IRIA 5JI6A 4U0VA 2STWA 3Q9VA 3SZPA 3E97A 2VONA 1L0OC 1HW2A 2CSOA 3WU1B 1FSHA 1XDSA 2XROA 2YU3A 5LGUA 1XGNA 4JQFA 3FXRA 3P9KA 4M71A 3EYYA 2ZXJA 1BIBA 3U1DA 1G3SA 2FA5A 1S7OA 4WK8F 3KCCA 1GHCA 2NAZA 2VBXA 4L18B 1Z91A 2DFIA 1D8JA 4IPAA 2MLGA 3M8EA 4RB3C 4U7DA 3D0SA 3N4MA 2K02A 2JPCA 3E3VA 1QO0D 1T98A 2DBBA 5LGTA 1BIAA 1J5YA 4HF2A 1QGPA 5HLHA 5FLXZ 5AIQA 1IXRC 3ROUA 4UUVA 5J8FA 1R58A 5ED4A 1SD7A 4I98B 2KJCA 2FNPA 2L4AA 2P5LC 3F8MA 2HEOA 5J6XA 1ODDA 1FOKA 2YX7A 2W24A 1ZG5A 4FHTA 4ZYGA 3J81K 2NNYA 3V7CA 1J7KA 3G3ZA 4M72A 3WTZA 4RGSA 5CJ9A 1T38A 1Z6RA 2BBYA 2LKPA 1O57A 2HKOA 3IL2A 1U2WA 1ZG3A 5HS9A 5LRSA 3HUGA 4WXDA 3TOAA 2QM3A 3REOA 3GX4X 3TKYA 3TQNA 4HF0A 3M8FA 5DV5A 3JSPA 2QQ9A 2Q0OA 2ESNA 3E5XA 5D5XB 3JTHA 3RYPA 3E5UA 1ZN2A 1QZYA 1FP2A 2NRAC 5FD6A 2OA4A 2P8TA 4IHTA 3ZMSA 3ISPA 4HYEA 3CUQA 1TQPA 1BC8C 2KKOA 3P9CA 4B09A 4ENKA 4ESJA 4YG2F 2VBZA 3GEZA 1W7PD 4HX4A 3I59A 3M9AA 5DUKA 3LAPA 3MWMA 2FNAA 4KYWA 1YW8A 4WX9A 1IXCA 4LFUA 1I6XA 1BM9A 5CLSA 3NRVA 4AIHA 1LDDA 1JE8A 1TQIA 3H3UA 5TJJA 4Q4ZF 5BPIA 3KLOA 4XRFA 1O7LA 4TV7A 3NEUA 1O7FA 3B02A 2VC1A 2JPBA 1U6GA 3ABUA 1P4XA 1QBJA 4MEYF 2K4JA 3HIFA 2JZYA 3V8LA 3ABTA 4I2OA 5LHHA 2CO5A 4RGUA 1XDUA 3BY6A 3WE2A 3RIRA 4EGZA 1W5SA 5L3GA 3HRUA 1S6LA 1H9GA 2K5FA 1P6RA 3VEPA 2XHKA 2O03A 4ESFA 3JAMK 3LA3A 4XLNF 1OYYA 3J7AO 4AIJA 1E2XA 4RB0A 4EJTA 2IA1A 4LD5A 2K7LA 1P4WA 3MFKA 1KU3A 1WKMA 4PZJA 3VOEA 1Z7UA 3HTUA 3DXJF 1LNWA 2K86A 5ICFA 4Z2YA 2IA2A 1R5HA 2JRTA 2PN6A 3BP8A 1FNNA 2ZMEA 2UZKA 2Q2EA 3IHUA 4OIRF 5E18F 2E1NA 1KQ0A 2K5IA 3FZVA 3QPHA 5L3BA 2HYFA 3G73A 2QWWA 2HGCA 2PMHA 3R4KA 5HS7A 5EEGA 4ZH4F 2FBIA 3HYIA 1QQIA 2ZJ2A 1HW1A 3S2WA 1IN6A 2CW0F 1CF7A 4RB2C 1U5TC 1ON2A 2L01A 1KU2A 2QZ8A 1W7PA 3KP4A 4HDVA 4EJUA 4Y13A 4I0BA 3JSOA 4BNCA 2YR2A 4A5MA 1KGSA 4PDKA 2HKXA 4A6EA 1WSUA 3COAC 4M73A 3P9IA 1EH7A 2HTJA 1T0FA 3B73A 4K2EA 5D6EA 5HLIA 4WCGA 1L3LA 5H6RA 3IC7A 2H6CA 2GA2A 1SAXA 2G9WA 2HFHA 1FSEA 4RGXA 2VBWA 2VOPA 3CO7C 2LSOA 2GAUA 4RS8A 2GIVA 1DPRA 3TO9A 2ZBKA 2EJRA 3CUQB 2FMYA 1LB2A 4HF1A 1OYWA 3HSEA 2QVOA 2DO7A 3H92A 3AAFA 4OU0A 1WQ2A 1A04A 3SQNA 1FYLA 2H3JA 3QP6A 3O3KA 1RI7A 4BHCA 3GZ5A 1K7AA 3F22A 1DPUA 1XD7A 1Z6TA 4CHUA 3I54A 2O61A 2HR3A 4L0ZB 2Y75A 1LQ1A 4FX0A 1F4KA 3ECHA 1U5TA 3HTSB 2QENA 2PEXA 4DNCA 3LA2A 5LBQA 2HOEA 3IKTA 3SZTA 1FP1D 2MLKA 3GW2A 5TRDA 3N97A 4G8XA 2DQLA 3V8KA 3FMQA 1J2XA 4OIOF 4HLXA 3IRRA 1F9NA 1XGSA 1W4MA 3K69A 1USSA 4A6DA 5ICGA 4BAYA 1IZ1A 1U3EM 1QZZA 1B6AA 1MJAA 1FLIA 2K27A 5L3DA 2V6CA 3K9TA 4AVPA 1XSDA 3H3ZA 4KA4A 5FFXA 3WGHA 2IP2A 4HV5A 5HS8A 1ZHFA 1G3YA 3C1DA 4R8HA 4R1HA 1G6NA 3BOQA 2XIGA 5L3FA 5CVRA 1RZ4A 3J80Z 1BI2A 4BQAA 3EYIA 5IT9K 2A6HF 2XASA 4HAMA 3L7WA 4AWXB 5BPDA 1KYZA 2ZMEB 4KIGA 1MD0A 5A2QK 2LF8A 3HRMA 2QUFA 5EEHA 1YS7A 4MQ9F 1ZGJA 2YX4A 1EV7A 1MKMA 5HVQC 2QYOA 1FX7A 2DU9A 1R36A 1O3RA 1KU7A 2O6GE 3QP5A 1CF7B 3ZPLA 3R0AA 3TO6A 3RKXA 1R5GA 2CG4A 3FMSA 4UNOA 1W7PB 4YFXF 4E70A 4KDPA 5K5RA 2CGPA 1XGOA 2VOOA 1FPQA 2D1HA 3V8JA 1O3QA 2RNJA 4UV8A 1BOAA 4HOBA 1ZYRF 3HHGA 3GVAA 3T8TA 2K4BA 2DK5A 1EH8A 3T5XA 2EFWA 1OPCA 2Q8KA 2J5OA 5E1ZB 4HX8A 4QWQA 1SFEA 2R7FA 3KE2A 4ZZDA 4S04A 1SFXA 2L4MA 1O3TA 1RUNA 2V9VA 3DF8A 4HQMA 1IN8A 2P7VB 3VB2A 3WU0A 1YW7A 2F5DA 3QOPA 2BV6A 3HOSA 2LNBA 4LLNA 1BN5A 1IN7A 2EA2A 3Q9SA 3JTGA 4M6XA 1IUYA 4KT5C 1R1TA 1WI9A 2ADUA 3WTTC 1FBSA 2V1DA 2JTVA 2QQBA 1S3JA 3U2RA 3ULQB 3E6BA 3F8FA
chains in the Genus database with same CATH superfamily
1FOYA 3GLXA 3A02A 5FJ8J 1Z05A 5LLQA 1AWOA 1WJDA 2Z9OA 1U3OA 3CMAT 2ID3A 2P4WA 2AIRB 3HRSA 5AYFA 1I39A 4CXFA 4QIWN 3RMQA 3ZMZA 5J4VA 2NNNA 4HV6A 2HDWA 2RO0A 3QYGB 2QQAA 5D8LB 2X9HA 1VQKT 4MLOA 4ENNA 2EQRA 3ZCOA 1RETA 2E1CA 4LB6B 3GTJJ 4KMUX 1IN5A 1LFPA 3I3LA 3QPSA 3CD6I 2K6DA 3H6ZA 3CCVQ 1VQ8T 1TWFJ 1U1TA 4F91B 2BUDA 3RKWA 1M1KR 3X25B 4DZPA 1U5TB 1ETXA 1YX3A 2WAEA 1K73C 5F1RA 1VQNT 2YPRA 3CP8A 3DCFA 2VN2A 4CYDA 2D6FA 3FXKA 1XGMA 2W82A 2WV0A 1WJFA 2IGMA 4J9CA 3JCMc 2JA8J 4C8QE 2XAQA 3VPRA 3G4SQ 4I76A 2KP6A 5A0GA 4FISA 4RMOA 3G71Q 3DV8A 4GLMA 1VQ9Q 1JHHA 2M87A 2HQHA 2E1OA 2JK3A 4P96A 4LDYA 3LSKA 2UXXA 3JCMP 4FETA 2IRFG 3FXLA 3LFUA 1V5GA 3ZN0A 3HP9A 3QJ6A 3BJ6A 5L3EA 2E19A 1OCCH 4I02A 2Z5UA 4Y17A 2EINH 2DOEA 1ZG1A 4DEXA 1TUDA 3LLRA 4JYKA 2R7RA 1XX5A 1S9HA 4N0BA 4GO1A 4RBOA 2RI2A 4JX4A 1BJAA 1DP7P 1D0ZA 2VJIA 3BPVA 4E7ZA 1GFCA 2LCLA 3VRZA 4A3DJ 1JUMA 1NE8A 1NG2A 3H3VK 1K78A 2FOWA 1KHCA 3EQLF 2VXZA 1X6OA 1JXSA 2RPNA 5LRRA 1LE8A 1HQCA 1GXPA 5LJ3e 1A35A 3I64A 1V4RA 3LSTA 2RJDA 3OR2C 4IVNA 1AKHA 3TDZC 4L9JA 3HFOA 1RR8C 2WB1N 3REAB 3H0FA 1KA8A 4II3A 2XAGA 4QVDA 4C0FA 3BY7A 4HT9A 3CTAA 1FOXA 4KFCA 4KNYA 3T8RA 3N05A 4C0DB 1T6SA 1QA6A 1MNDA 4PJNA 1QPIA 4HRIA 1WFWA 2VWFA 4X1VA 4C8QB 3FHZA 1Q86U 1U9NA 3Q0UA 2CT3A 1SHGA 2CW7A 2MA3A 1IRGA 2FPEA 2DBKA 2TRTA 4X9CA 2AKKA 2YLCA 5FU7B 1I5ZA 2LF7A 5FKMA 3JV3A 4C3HJ 1BW5A 1M1EB 2DA9A 2L0AA 5IT3A 3BZ6A 1JUSA 2MBFA 4M78C 2EV0A 2XAHA 4XOPA 2KFDA 2DD4A 3E2UA 3PQJA 4J9HA 2QQ8A 1H8AC 2IS6A 3MKWB 4N0AC 1V29B 4OVAA 2A61A 1ETVA 3NARA 3PIPF 5E3OA 2RF0A 3X28B 3G6EQ 1FJLA 2XKPA 9ATCB 1VQ5A 1K8AU 3LSHA 2BY2A 3B6AA 2R7ZJ 2G3RA 2X6OA 3QU3A 3RNJA 3CP2A 1HSQA 4KH0B 2ZPEB 3A1PA 5DDGA 5K5OA 3KEYA 2KEAA 3MKDA 1Q7YC 3VYRB 4DYRA 2CJJA 2IBDA 5J3BA 2VE9A 4BD3A 1RABB 4BH9A 2V9KA 3K2ZA 4XSZF 1R6RA 2EGCA 4MFDA 1FC3A 1MMNA 3I55A 2KE9A 2DZ9A 1RAFB 1ZRFA 4RTVA 3K2AA 3CCRT 2I5UA 3SXYA 2RK2A 3CCUQ 3E9GA 2OJ2A 5DYMA 3EHRA 2F5CA 5I21A 2O7OA 4FL6A 5GAOl 1S72A 3PSIA 4F92B 1OULA 1MUZA 2OTLQ 4AU7A 2MH2A 4XK4A 3MKZA 1GV2A 3CMYA 3EETA 3HBLA 4DYCA 4EQQA 2LD5A 4ZN1A 4CUGA 4XORA 2MC3A 2IEKA 4AD9A 2GM4A 2DKGA 3SWNA 2RQQA 3M1EA 4PJOC 2YRDA 1VQMT 3GIBA 3BJOA 4BS9A 5F04A 3W6JB 2D1XA 1M2VA 3ZN1A 4U7BA 3OS2A 1STZA 4A5NA 5IYDJ 1UJ0A 3C3WA 3HFNA 4HVVA 1YHQT 1VZ0A 2A07F 3DFGA 2L3SA 4C2MJ 2FU4A 3JRFA 4XBFA 3LWIA 2E2HJ 1Y1VJ 4KICA 5EG0A 3HOWJ 3K4NA 2LX9A 3I71A 4JPBW 4P5OA 3QYEA 5DEQA 5KK1A 3EDPA 3AG2H 5E20A 1I50J 4R79A 1ZLKA 3CPFA 4FE4A 1P92A 3KP3A 4MHGA 3H9NA 1PC0A 3CC4A 2ISYA 1W2BS 2H8WA 3EG9A 4IL6C 3K4MA 1YITA 3W6VA 2K4YA 4FASD 2BGCA 3CCJA 1G8XA 3IH3A 3HOXJ 3LQQA 1MH4A 3CCET 1D1CA 4Y15A 3QXEB 1B34B 3ZEHA 4EM2A 2DDAA 4B43A 3QPLA 2CH4W 4CDGA 1NK2P 1S5LC 5KAIC 4M75C 2HPIA 3KETA 3QQAA 5FLXR 1GCQA 4Y28E 1IJWC 2OAUA 5L23A 4KT0E 1QVGP 2QSHX 3C7JA 2KMTA 3SD4A 2ESHA 1RADB 3V7SA 4RM2A 2Y9ZA 2IW5A 3RR6A 5KCOA 2AKLA 2ZKZA 1VYVA 3RSNA 3TBIA 2YSRA 2YSQA 5CCAA 4EMKB 3JB9D 1I1GA 2M4GA 2RQTA 3RCOA 2VKEA 3FISA 5TISC 4IOAF 4EMGA 4A0ZA 2DETA 4FT8A 4J00A 1B4AA 1FBUA 2BY1A 3OS1A 4BJTA 5LEKA 2WAQA 3FXMA 3I4NJ 1PHTA 4OB1B 3TQ7P 2DA5A 5GANd 3CCLQ 3ZR8X 4BEHA 4AIKA 2H09A 5GMKe 2E36A 2RKHA 1DDNA 2DXTA 3BTIA 3CLOA 5C6SA 1WYXA 3LSJA 3H0HA 2DOAA 1E0EA 2JTEA 5LJ3d 1XTAA 3VS4A 2XKOA 1HKTA 4FW2A 3M0RA 5IP7J 3FIWA 5BMZA 2KRNA 5GAOr 4PFOA 4IJAA 3EGDA 3CC2T 3BPXA 3QWYA 1YCYA 2EGEA 2L8DA 2EQIA 4A63B 3CO6C 4JK1X 2JA7J 2VC0A 1C1AA 3P8HA 3HPGA 4QKUA 2X1EA 2M45A 1HCRA 4PUSA 2OTJI 3M57A 1OLTA 1UB9A 2XDVA 3KP6A 1C0WA 3FB9A 1UGVA 1MJBA 3F3XA 3HL2A 5TGTA 5J8CA 1OCPA 1Y0NA 3ZXSA 3CQZJ 2XGXA 5D8KB 4ETSA 5HOOA 3HOTA 2RC4A 1NTCA 3CBOA 3CUOA 4Q5SF 1IHWA 4L6V5 3H5RA 5L3CA 5EZHA 1T8IA 1X69A 2LC4A 3FK7A 3R0JA 1YJWI 4P5NA 3UDCA 3A0HC 2BIVA 2COZA 5GMKm 1Q81R 2RN8A 1O3SA 3RKQA 4RUGA 1YIOA 4UHTA 2D9TA 4KT6A 1NJIR 1ETKA 3AT1B 1VIFA 1LJ9A 1YJNT 3Q5FA 2OZ6A 5LHIA 5IHNA 1BBYA 2G0EA 3WU2C 2LFBA 4ZYHA 2F5VA 1N27A 3QWLA 3S15J 3F21A 3GTGJ 4BI8B 2EWNA 3MQ0A 3QPTA 1BR4A 2FQ3A 1UJYA 1BR1A 3ECOA 2DK8A 4X0GA 2RQWA 3HTRA 4HLYA 2WTEA 1WJ5A 4XKVA 5B66C 3ASKA 1UFFA 3E19A 4C8QA 4XLEA 4Z6YA 3OYCA 3J7AW 2JVVA 4M75G 1A6QA 2FQ4A 2XF6A 3FX3A 4KMFA 4CI0C 2HI3A 4L5JA 2A7YA 2COWA 1TNTA 5CYVA 1KZHA 4E4HA 3PO3J 2DD5A 1I27A 1J75A 3D5SC 1J9IA 2JXBA 1PYVA 2TCTA 1DJ7B 2K9GA 3L00A 2O88A 2NXNB 4YIIA 2KXDA 4KGZB 2ESWA 3U23A 2BYVE 3GFIA 1CGPA 3K4JA 1AOJA 2H3EB 4FCYA 1OR7C 1TS9A 4J6WA 1LUJB 2KT8A 5LJ3f 2HDAA 4BJ5C 4IRGA 4HVUA 1O9SA 3OIQA 1DGWY 4HX7A 1UJ8A 2XVCA 1RESA 3BQZA 5B1BH 2A28A 4RG2A 3ERED 4RTYA 5GAOp 1Z67A 4LK0F 2JM8A 2VBYA 4EM1A 1R22A 1KFZA 1IRXA 1X43A 1H92A 1FXXA 1YS6A 2CQNA 3MCZA 1LOJA 1WXUA 2HL3A 4LDUA 4LE9A 4NHJA 4FYXB 2FB7A 1USTA 2K5CA 3RPQA 3WTWC 3SHFA 4ZDPA 3OYLA 2AZVA 3NWSA 2M8EA 4PFZA 1O4XA 2FG0A 1LFBA 1GV5A 2KDZA 3FLGA 2EBIA 3PNWC 5D4SA 4HA8A 1M3AA 4PNOA 4WTOB 2RQRA 2ABLA 4BY6B 3TP3A 2L54A 5FKLA 1TBXA 2E41A 1WJSA 3JB9G 2QEXT 4YTLA 3MPUB 4IZZA 3C18A 5GANh 1OQKA 4HW0A 3QG1A 2LT1A 3EUKL 3DKWA 1W0UA 2DPUA 3M58A 3LFKA 1C6VX 2VYTA 2EAYA 3PSFA 2Y0SA 2FF4A 4ENMA 1B1BA 5JFRA 3CCRQ 4KISA 4RMNA 5JHUA 1JO8A 4XU0A 4R55A 3AG4H 3CZ6A 3G2BA 2EFOA 1W5CC 4FIBA 4ZGDB 2F2EA 2RM4A 4M77D 3OOUA 1X3WB 4ESBA 2QGGA 2W4SA 4M74A 2OPTA 1K78B 2P4RA 3A98A 2XAUA 2DEUA 3VYUB 1YTYA 4F7ZA 1LE8B 4PJOA 1VQPA 2KQWA 3EAEA 3ZMVA 4LN2A 4U0WA 4M6VA 3HHTB 3KFWX 2CWEA 2PMZN 4BXUA 3MEXA 1T33A 4EV0A 2EQMA 2FOKA 2Y0MA 5DD8A 1RPWA 2FBHA 3U1KA 1AKHB 5ILUA 2L3PA 2VLAA 2WAQN 1IZ6A 1N6AA 2X1DA 3CMMA 4XTUA 1LDKB 3M1CA 1JJ2P 2P4TA 2EGAA 4G94A 4MDWA 2M30A 1FYKA 4XRSG 3DPLC 1H8KA 2L7MP 4RTWA 1YYVA 1MSFC 2JMAA 2HKNA 5GMKh 2DOFA 1OX9A 2PZ1A 2W85A 2W1OA 1LKXA 3PFIA 1M2OA 3FM3A 1Q95G 3M53A 5J1RA 5E1XA 3KUFA 1KQ8A 3A2KA 3VKIA 5M5WJ 4GXOA 5LJ5e 3DLLF 2RHIA 3BZCA 3CCSI 1G3WA 5AONA 2EFNA 2E2IJ 3DKMA 5GAN5 2DYSH 3TO7A 2GIZA 3LL7A 1LDJA 3I59B 4B4CA 2IAIA 1XOVA 4VUBA 2LOOA 2L9NA 1ZR2A 1U0JA 2GQVA 5GAN3 2PUKB 3VYGA 3I56T 4W1UA 4A93J 1ABOA 1QNTA 3ABKH 1D1BA 1UG0A 1D5VA 2QBYA 1MW7A 2O4XA 2QYZA 1K9MC 1Q86C 5GADJ 2LDUA 1SRLA 1ZBJA 3M0TA 2DERA 2KZVA 2H8RA 1R8OB 3KP5A 3C95A 4B9XA 2CQXA 3CC7T 2VUBA 2X0LA 1V5FA 1EZZB 2DLLA 2MF2A 5CO7A 3CXCA 1W2BP 1NZ9A 1OYXA 2KL4A 1YIJA 3A8GB 3L09A 4LIVA 1DGRM 2XF7A 4Q47A 4MNUA 4WF2A 2RI5A 1X4OA 4PCQA 4NB5A 1J09A 3JCMf 3EUHA 2P81A 4XRSA 3SWNB 2E1HA 4I7HA 3I9QA 2Z1DA 3NTKA 1RKWA 4KBMB 2CP0A 1WQ7A 2ELHA 1R1UA 2GOMA 3BG6A 4UUTA 1E3OC 1A36A 3A52A 1M2VB 2C0TA 4QPOA 2Q1ZB 5GAEJ 3M4OJ 4IIMA 4AFSC 1M90U 4WXCA 5EJCA 4HQEA 2FEZA 4Y33A 5D5UB 4XLPF 4XN3A 4FYVB 4J5YA 1KC8U 2J5PA 1VUBA 2B86A 2RB6A 3DEUA 3UPUA 4L9NA 4U88A 1HXDA 5KYXB 2K9LA 5EG0B 1YO5C 1QU3A 3CCQA 2R3SA 2B8AA 5H20A 4X9DA 3CD6T 2Y9YA 7AT1B 2M9HA 5K1YA 3PE0A 5I11A 2O9SA 4F3QA 2JJ9A 4E7LA 1PP7U 3KEOA 3FDRA 2ATCB 3P8DA 4L9TA 3EG9B 3JCMQ 1BW6A 1RQ6A 3CCMQ 5CPRB 4AFQC 1AU7A 3D5LA 1D09B 1QW1A 2OU2A 1ZTRA 3PL8A 1Q86R 5IOZA 1VFCA 1SD4A 2DMTA 1BI1A 2XGDA 2HXOA 1ITYA 2A05A 4O3MA 3CPWA 3OYMA 4DQ2A 4DOZA 4A3KJ 4IHXA 1DQUA 2XD0A 4MEXF 5JHFA 3LSGA 5E8GA 1A5JA 1HA8A 1QRYA 2ZXWH 4XN0A 1SD6A 3LH0A 4B1RA 4J9DA 2H1LA 3IH2A 2X6YA 4PSWA 3R6OA 2JMCA 1K8AR 3HOVJ 3ZMDA 3TDUC 1JT6A 5FB2A 5CVVA 4L5EA 4PJMA 4B8XA 2V9PA 3T1BA 3V42A 1VQ5I 2D0QB 3DU5A 2LTOA 4CGZA 2V8IA 4QPQA 1DUXC 5IT9Z 2DTOA 3WGGA 1MDMA 4OIPF 2E65A 2NLUA 1H641 4RAYA 2RHYA 4M4ZA 2ZC2A 1E17A 2KSSA 3QO3A 4BEHB 1FYMA 2JZ2A 1AWJA 1TQMA 1Y8RB 4GCVA 5C3EJ 3NTIA 4FQGA 3D7SB 5FLVA 3S3MA 3I55I 4RAZA 1RAEB 3ZOBA 3KZZA 5F0HA 2LDMA 2VODA 1K6YA 3GO5A 1VI0A 3F8BA 3H35A 3I4PA 4IUPA 1S72I 3G1OA 4XLFA 5ILVA 4UY8I 3L2CA 3H9GA 1XN7A 2X4HA 3L2VA 1IGUA 1QWFA 1RUWA 4KN7X 2Z0WA 1WJAA 3JRGA 1TW3A 5M9OA 1VQLA 2ISZA 4AT1B 1VOMA 2P6TA 4CC3A 4DOWA 4C8QG 4QQGA 1E3PA 1PWTA 1YI2Q 3H0IA 3C2BA 5GAGJ 3QRFF 1P9QC 2DFFA 2HSEB 4OAYA 1X2NA 2I2LA 3E6MA 2D0NA 3Q3SA 2ETHA 2R7QA 2WAFA 3PVQA 1WI3A 3GFJA 4F16A 2JN6A 4UB8C 3MZHA 2F5FA 1IB8A 1XQHA 3S17J 3TEEA 2HAXA 3BZKA 1SVMA 2KAFA 1V54H 3SHWA 5LJ5d 1EA3A 1O75A 3HKZA 4BYYA 3NWTA 4OGCA 2OQGA 4P9UA 1K79A 2M16A 2QA4Q 2A68F 4D5FA 1LPQA 1SFKA 3HRTA 4B47A 5HODA 5GMKj 4B9WA 4BU2A 4N4HA 3GLLA 3QYFA 2EV5A 5FWBA 4LITA 3OIPA 2QGFB 3S93A 2JA5J 1AZEA 3L2ZA 1UTIA 3CC4I 3I58A 4OMNA 4M7AC 4CZZA 4N9IA 1WJEA 3HHHA 4LIUA 2DMNA 1YITI 4C2UA 1VQ4A 1VQOQ 3NGPA 1XMAA 2LY2A 3CCJI 5LJ5h 2HZTA 3ULRB 3FXJA 5FKKA 2GLOA 2FMLA 1TU0B 2CUDA 1PD0A 1TWHJ 1SMTA 2E7XA 2BXZA 3VYTB 4EJWA 5JR3A 4HCZA 4J7FA 1AHDP 4PL6A 4ELZC 2F5TX 5GTIC 1MMAA 4FX4A 3A8LB 3ZQFA 1YRNA 1ONVA 5DCFA 4AVZA 5GMKi 5D6FA 3OQ5A 5GAN4 2ED1A 2QGUA 1K61A 3OMGA 1D5YA 2R5AA 1WX6A 5C0MA 1JHFA 1U8BA 4WXHA 1TXQA 3JCMV 1ZSZA 3QSUA 2XAFA 1ZLJA 2XAJA 5CQGA 4CCMA 4HVWA 4IXAA 3H8ZA 4EVIA 3IRQA 3HSRA 3JCMW 3VYSB 1HDPA 3CDHA 1G2BA 2E5KA 2FHDA 4AG1C 3H0DA 2EZLA 5L8RE 2CP5A 3CCVA 5GANj 4CCKA 2P5KA 2XB5A 2FE3A 1NYFA 1JEGA 1JTYA 2ICWG 2KHMA 2CQ7A 5LEJA 1W36C 1IG7A 3KP7A 1BR2A 1ZRCA 2F4MB 1RKTA 5LJ3j 1OI1A 2K5LA 4LNPA 1JGSA 1BYMA 3G4SA 3G71A 4MIMA 3ZQ7A 2EILH 3GTLJ 4CCLA 4E6KG 2KI7A 3BR6A 4I09A 3WGIA 2LBFA 3NTHA 2CZ1B 1VQ9A 3CJQB 2DMPA 1IDZA 4GLKA 5K7ZA 3FBIB 1Z9CA 2W25A 3MN2A 2RDPA 3VSLA 2IS4A 5CVUA 2FRYA 3THKA 2E7WA 3KP2A 2MG4A 1SG5A 2K2MA 3R60A 4PJOG 1IGNA 1NM7A 2CV1A 5CIUA 3PJRA 1QMCA 2GXGA 2H27A 4L0YB 1CSKA 1R5ID 2VKDA 1RLPC 2CZ6B 4WWCA 4HCCA 2KR3A 2M1HA 4AFUC 1CKBA 4AFZC 1YE9A 1VQNA 2AXTC 1F1ZA 1ZA1B 4ZJZA 1UHMA 2BE5F 2VT2A 2V4JC 3MMYB 3PQKA 1SHFA 3ZQQA 1KU9A 1OJLA 4NC7A 3WTUC 2JUFA 4G9YA 1AHJB 2QQSA 2VJ5A 1REPC 2HEQA 2A3SA 3WXMB 4A12A 2DO3A 2Y90A 2EA4A 4QW2A 2ZXIA 2DL8A 3K1NA 3VODA 5DCMA 1IXSB 2VJJA 1YJ9Q 4J19A 4MFEA 1XSVA 1EFNA 3AL0B 4UUSA 3MEVA 3PGGA 2DTRA 2HQAA 1I1SA 4M7AG 4XKCA 3W2VA 4ASNA 4MTEA 3JR9A 2CYZB 1X1CA 2IPQX 2QQRA 5GAOm 4Y7NJ 3BLYA 3GXOA 4ENJA 2VQHA 4M9XA 1F36A 1WCMJ 2K3FA 2IJLA 5E3MA 2Z33A 3G7ZA 1HW5A 1UHWA 3HDDA 5BS6A 5HDGA 2KGTA 5IYCJ 3IP4B 2HYGD 2O8XA 3CUQC 2OTJT 2DIQA 1MSEC 1FTZA 1CKAA 3Q1JA 1TTYA 1K6OA 1M1KC 1ZKGA 3O2PE 1G5VA 4XTYA 1YWOA 3O6BB 3CXCS 4Y3OA 1QCFA 3RJPA 2JM9A 2XICA 1GVDA 5IY5H 1APLC 3JAME 1VQ7Q 3GTOJ 3INZA 4UXNA 4RAGA 3G6EA 4KUDK 4JZ4A 4E6RA 1VQ5T 1PRMC 1XJWB 5KYWB 4MZPA 2NS7A 1YJWT 1RIOH 2J7IA 2V79A 1BKBA 1IF1A 3HL8A 3H36A 1FYNA 4EMSA 4OGEA 1IRFA 2KJBA 2LLKA 2JSCA 2NVTJ 4LG0A 2RK1A 4MZMA 4FSXA 3EG2A 2PVDB 2RHUA 3CCUA 1YNZA 4KIBA 4LGWA 2LC2A 1W5TA 2FRHA 2M5WA 3J81Z 1N9SA 2FD5A 1VQ6Q 2AS5F 1VQ7T 3DWLE 1IUFA 1NH3A 2K2VA 4OB0B 2OTLA 2DA2A 3LYIA 3DPTA 4RB1A 2ENMA 4M7AA 3ZP5A 1H9TA 2QBYB 2O4XB 2R7VA 5HDKA 2XB0X 1ZR4A 3P7NA 1OCTC 2JW4A 2WACA 4EMHA 5FFZA 2MK5A 2X6WA 2FZGB 2CW8A 2EQJA 2JVGA 3JRCA 3VFZA 2JMWA 2EB7A 3GWZA 4O6JA 3RQIA 4GFBA 2VKNA 3DLMA 4C92D 2VL8A 5EZGA 3C0CA 2V8KA 1IO6A 3AG3H 1RAAB 1Z1DA 2NVUB 5D5WB 2LP5A 1NEGA 4J9FA 4HNTA 4QQ6A 4QLCU 1AWXA 2PMUA 3J80R 2B9SA 4BDYA 4J9GA 2CFXA 3CPWS 4XAXB 2CQKA 2P0KA 2FL7A 3G1JA 4OB3B 1IV8A 3LGLA 3K70C 3HOYJ 5FLXK 1T3SA 2FEIA 3RTRA 4E7SA 2DTIA 4LDVA 3BQYA 1Q1HA 1Y07A 1VQPQ 3CMAQ 2DPPB 2E70A 2FXAA 2EIFA 4BY1J 3PIOF 4BACA 2HTSA 2XGEA 2KRHA 3A1YA 1J59A 1D3BA 3RPUD 3ZGKA 4IQJA 1WXBA 2ECBA 2JS2A 3OY9A 1UZCA 2VGMA 1VQKQ 2FBKA 1VQ8Q 5DD4A 1F43A 3A8HB 3FXUA 3K0LA 5CK9A 3TU4K 5KVRA 2DQRA 3L9FA 2PQ8A 4YIFA 2DVEA 2ZPFB 2NUZA 3VV0A 4F7UE 5GAN2 1VQNQ 4ITVA 2DFEA 3JSCA 4G6QA 4M78D 2YWWA 3KYCB 3ML6A 1XNIA 1ZARA 2F48A 1KQSS 5ERIA 3S32A 5IP9J 3BR0A 3A01A 3GTQJ 2DCEA 2HQNA 4FTHA 3GTPJ 2CU7A 2CSIA 2DL4A 4OAZA 2XV4S 5HDNA 2LJ3A 5F6FA 2XRLA 5GAOn 1M90C 3LSIA 1D0XA 1T0HA 3CBPA 3RDIA 3F72A 4HDUA 1U06A 1G4DA 4M77E 1ULYA 1LEAA 2GZWA 2LH9A 3BJAA 2CH0A 1Y0MA 3JB9I 4Z89A 3DBRB 3A0BC 4G12A 4HPQA 2RNGA 3M0QA 3LAJA 1ON1A 5M3FJ 3CCLA 2M3AA 1B7TA 1ZUUA 2DL5A 2VJ4A 2L7KA 4GGGA 2STTA 2JOYA 2KY9A 1RAHB 2VE8A 2KIMA 3W6KB 1K76A 1X58A 2HVRA 3IWFA 5E8IA 1XMXA 5C4XJ 1SSFA 3VDXA 2LP0A 4C3IJ 3MP6A 5DS9A 1XG1A 2V26A 4RA2A 2P7CB 4C8QF 5IXBA 2MC4A 2OCCH 2MVTA 3AHUA 1FOWA 4KUMA 4CYCB 1W1FA 1MDMB 1OCZH 4A4EA 3DBHB 1FT9A 1YQAA 2DBMA 5HK0A 2X85A 1JXMA 3DKXA 1RC9A 4JS4A 2G7HA 2CUJA 4PJOD 1SEMA 4EM0B 1I8FA 2GF7A 5GANe 2MFZA 4OMYA 4MTDA 5DM7R 2IIMA 3WE3A 2L02A 2PLYA 2DF6A 3M56A 3ME9A 3DU6A 2CDTA 4PLIA 5FKOA 5HKCA 4F7UB 3PUBA 4M7DC 4U0YA 2RJEA 3VS7A 2QLZA 4CO8A 1YIJI 3BG7A 2R7TA 4F7UF 5GAMf 4LUEA 4DEYA 2A69F 3LWHA 1OCRH 4L5IA 5JVTA 3DKYA 2ZMEC 2JUCA 1M90R 2UXNA 1UHCA 4LB5A 1Q82U 2QKMB 1V5EA 3BWGA 2LJ0A 3CCST 5J47A 2EYQA 4BGDA 2ZFUA 3GNGA 4IHSA 4CSWA 2MD5A 4M77B 1KC8R 2RGVA 3CF2A 9ANTA 3RERA 4M77F 1SMYF 4Z02A 2PBIA 4ZYEA 2FSWA 2L9VA 1NHAA 5LHGA 1R77A 4HSTA 2DTHA 2QCOA 4BY7J 2CUEA 1KD1U 1LVAA 3CCQI 2ZAEA 1HBXG 3WTYC 3RZDJ 4M75D 1H0MA 1SVLA 1TNSA 3ZMUA 1R0CB 1UUEA 1ZGAA 4DJAA 3MKLA 3K1MA 5EYRA 4B48A 2GXAA 2R7XA 2YXYA 2BTTA 4XU2A 2B0LA 4C92G 1HLVA 1BI0A 2OI3A 3JREA 3EFOA 2QDLA 2P6SA 1JXOA 4YIRX 5E3NA 1A31A 2W00A 2CH4A 2A5YB 3FF5A 5LGNA 1YG2A 4LXCA 5FW9A 3LSMA 4D8KA 4N4OB 3GF2A 2FRWA 2K3PA 2ZSHB 1SVOA 2DT5A 2MH9A 2YS9A 1WRJA 3ERMA 1SPKA 1KQ9A 5FWCA 2PVGB 4YFKF 2FZCB 5IN1A 1XCVA 4I01A 2E34A 3JAMZ 1ZRDA 3W3CA 5M3MJ 2J6OA 3DP7A 3J7YJ 1I07A 2O01E 1HF0A 2VGNA 1VQMQ 4YFNF 4XLHA 3O5ZA 3EUAA 3FKJA 2PI0A 2ZJQF 1ZSZB 3KEQA 3PTAA 4LLLA 2OD5A 1I4K1 1ZREA 4HXJA 1YHQQ 2EK5A 1OV3A 1JJ8C 2XUBA 5HLGA 2HDCA 1Y7XA 2NYXA 3KZYA 1M3BA 2GQQA 3WTVC 4EGYA 4ZTJA 1LCKA 4M78G 4HT8A 2O9LA 1ZH5A 4C5EA 1Q81C 4G6TB 1Y0UA 3QBYA 3K10A 2ACJA 2CP6A 2DODA 2V1QA 1NJIC 1EH6A 1ZELA 2AXLA 2DAOA 2FJ1A 1ZUKA 3J81R 2X6XA 2GBYA 4P55A 3EG1A 2DEQA 4QVZA 2XC7A 4BUPA 3MZYA 1PDNC 2PJPA 4C92A 3JCMe 3OS5A 3CCEQ 4RTXA 2HVQA 2BZXA 2LQ8A 4E7KA 1YOVB 2F2VA 4M7DG 1T0FC 4NQWA 2ZNYA 3LWFA 2W48A 1VTNC 1U78A 1ZLMA 1B59A 1FY7A 4PGGA 1UGRB 1R9TJ 1K0XA 1R23A 5M5YJ 1VQLI 5FRMA 2K57A 2E64A 3HGGA 3E6CC 4FM4B 2JT1A 2NS8A 1WH7A 2H6BA 4OMZA 1WHUA 1JGGA 3FXOA 4IX7A 2ZO4A 4N4NB 4BDZA 2ZGWA 3CJTB 5F08A 2D2WA 3ABLH 3LSRA 3S2DJ 4B44A 4S05A 3F6OA 1GLNA 2V1XA 1UMQA 1X4PA 2RN7A 2ZFWA 3LA7A 4XSXF 1XS9A 3CMET 5LJ5j 1TUGB 3GP8A 3CXCP 4OMFB 3UA6A 1PNJA 4CRIA 3QZ9B 2BXYA 1TT0A 2X4XA 3PM1A 1X6BA 2XGCA 4YELA 1SD5A 5J3LA 4XTXA 3RPUA 4XLCA 4F52A 4RGRA 1QVPA 3REBB 5DCMB 2ROLA 2WSCE 5LJ3h 3DEEA 1JKOC 1P4AA 2DTZA 4UUSB 1BCOA 4M7AE 5B5EC 3A4CA 2HKQB 3I55T 5CKEA 4J83A 3S1RJ 4M78A 5E79C 1UCRA 1X27A 3T0YA 2IVWA 2DJZA 2E71A 2E6NA 2JTFA 3H41A 2YRCA 4N0AA 4Y92A 1R7JA 3DQVC 1VQ4I 5ICCA 4JLIA 3BTJA 1S72T 3CC2Q 1B07A 2BZTA 2KYMA 1U5SA 3C12A 4PJJA 5DUIA 2XPWA 2M1BA 2H8HA 4XOTA 2X9DA 3K1PA 4M7DA 5CQEA 2M0OA 2IA0A 3R61A 2R5ZA 1R00A 1KK7A 4F04B 3GUDA 5BOXA 2K9SA 3PT9A 2COBA 4XIDA 3RUXA 1QHHD 5BQTA 4LK1F 2IG0A 2BW3A 3IQLA 1SF9A 2VXDA 2NUPB 4F14A 2RAEA 3LSPA 2E5NA 2HXIA 1MIJA 4DBHA 4GDFA 2EPDA 1VQPI 2BE7D 3S8PA 3CCVI 1MGTA 1WZOA 2R7WA 1YJNQ 4ATOA 4LG0B 3CPWP 1UDLA 1R71A 2JVHA 4M9ZA 3MEAA 3CJNA 3FM5A 3QHSA 4OMMA 5HK3A 4ZZLA 3CC4T 1WWXA 2FX0A 3U9GA 4OMQA 2RQUA 2LCCA 2RV8A 2LT4A 1YITT 3I53A 2W7NA 3G4SI 3CCJT 3G71I 3OYBA 4UVBA 2YU9J 1VQ9I 2DW4A 3M07A 1OMIA 3F6VA 2HWVA 4C30A 3JRDA 4CC2A 3VJPA 3VUZA 2O0YA 2NVXJ 2TDXA 2WC2A 4OOIA 4A3GJ 2RQPA 3URGA 4A54A 3DB4A 5IT9E 5HCKA 2M34A 1QPMA 4J9EA 2C6YA 3L2RA 3A5ZB 2EIMH 3LQRA 1UGPB 2GBQA 2KBTA 3OOPA 2I0NA 1KQSP 3IKVA 1SFOJ 1XCBA 2ELJA 3NAUA 4RM3A 2OZUA 4UV9A 3I5UA 4A0YA 4I0AA 2M02A 2PFBA 2DT6A 3M7GA 4JJDA 2EYYA 5A2QE 1QVFA 1SSHA 2GNCA 3C2HA 2CREA 3NQOA 4LLGF 2W57A 4M75A 2DIGA 4AC0A 1NG6A 4P9FA 2WWYA 3EFRA 2LNHB 3CCMA 2O3FA 1YFHA 2KIUA 2C0IA 2Z3YA 3TGNA 2KRMA 2ZJRF 2O31A 2QXFA 2V1UA 2E1MB 2BY3A 4NC8A 2OJED 2EJGA 3SEZA 1R1VA 1PKTA 5IPAA 1T39A 4B6MA 2D1VA 2GXBA 1PM3A 1MV3A 2A6EF 4HCBA 5GAN8 2DDBA 1YW9A 2VQCA 2LG4A 4CICA 1H3HA 2EW3A 2QTVA 2OBPA 2W0ZA 2EBPA 3BR5A 3SFZA 3AKZA 2XSJC 3PVLA 2M0MA 2BEOA 3GFLA 2NOJB 3JRBA 2NS0A 1SC7A 2YDLA 3JCMd 3A01B 2DPDA 4XMYA 4Y91A 1YLFA 1W1WE 1K4TA 1JJ6C 1RUOA 2QEXQ 4HSRA 3WTXC 1J0RA 2KIQA 1Z9QA 2KXCA 2XRNA 2CYYA 2BHZA 2ZCWA 4G7HF 2DMOA 2KNBB 6PAXA 2OAZA 3G6EI 5JLXA 1TG0A 3H9QA 4MMLA 4C0DC 2OF7A 4ZGJB 1M8VA 4C8QC 3DBLB 5FO5A 3JAMR 5AT1B 3OSGA 4A4HA 4MQVA 3JCMh 4A4GA 1UGSB 2EFIA 2ROTA 5FU7C 2V8JA 1S7AA 1N25A 1IGQA 1GBRA 3MCAB 1YFNA 3RKYA 3CCUI 4G7ZF 2PUOB 1HKQA 2BKDN 2CQQA 2VPRA 1F5TA 1UE9A 5FD5A 2P0TA 2JNGA 3M9QA 3PFYA 3FK6A 2OTLI 1K9AA 3ZQIA 2EJFA 4M9SA 3MHXA 4HNVA 2CV2A 2Y48A 4ON0A 4RKUE 2HVSA 2COMA 3SEQA 2K3XA 3W2AA 1BU1A 4NNJA 4S0HB 1B72A 2IT0A 1FTTA 1GBQA 1WQWA 1YI2A 3KYLA 2J06A 2KROA 3LOCA 1UFMA 3JRIA 4L9VA 4D0PA 4HNUA 2E3HA 2EV6A 5KHDA 3BDDA 3GBGA 3QAHA 4RLFA 5I22A 5CR2A 1NG7A 2L3DA 3E7LA 3D1NI 4JBAA 2UWMA 1EIFA 2F5EA 3CDIA 2R7SA 2QA4A 1PUEE 4JDSA 3R6SA 4PJLA 5BNGA 3P8BB 2NVYJ 1AOYA 3TOBA 2DXBA 1Z7LA 2H94A 4M6YA 2Z99A 5GAMj 3L1AA 1K73U 4MGRA 5H6QA 2M7AA 2YHTA 5E17F 1OCOH 3GFMA 3UA7A 4IKFA 2ZPIB 1K8AC 4A3FJ 1VQOA 2EKOA 4LOCA 4BBRJ 1WLPB 3GYHX 1G3TA 3I56Q 1OR7A 3MAJA 1IC8A 2K3BA 3ONQA 3JB9J 3OV8A 4AG2C 1B9MA 4C92E 3KLNA 2DMUA 4C0ZA 3FJ5A 1PJRA 4J01A 2LVSA 5AIPA 5GMKl 5F64A 1ZUYA 2A37A 4J6XA 3OW2A 4ZYDA 3WODF 1PP8F 1Y96A 2M2EA 4AYBA 1U8RA 2BHYA 1U1SA 5CKTA 3X24B 1K1ZA 3H0GJ 3V7RA 1FBQA 2HOAA 3QYBA 3PNTA 3AFHA 4O5VA 4Q48A 2IGOA 3WG9A 4RTUA 3QUIA 2M7BA 4IF4A 1RR7A 3SEMA 1QLYA 4F55A 1OYIA 1TLHB 4N9HA 1TC3C 4L59A 3R6NA 5CKDA 4U87A 5DM7F 2HQ5A 3GZ6A 3CCLI 3BDLA 4H0EA 1V3FA 1P2FA 1MMSA 4NOYA 3TVTA 4DBRA 1AT1B 1JBMA 5GP9A 2CRGA 1ZAOA 2KLOA 4IRHA 3RYRA 2R0QC 1K4US 1X75C 3VS0A 4BHBA 2FZKB 1X1BA 4RLQA 4EJOA 4M78E 3WTSC 4EMKC 3GPLA 3CD6Q 1AWCA 2K85A 1WZ2A 2L2PA 1XB4A 1GT0C 3J7ZI 4KIFA 3VYHB 1RNLA 2OQRA 4AM3A 1D3YA 4JP0A 1X2KA 1X3UA 5IP6A 3F23A 1FWZA 3JW4A 2L3RA 2LQNA 2QI2A 3DPUA 2MWOA 2KRFA 2QK0A 2XDPA 3MEWA 4HCKA 2NUTA 3ZL7C 1SFUA 4RG8A 1YP5A 2R7DA 3HSFA 1PUFA 1X01A 1MJ9A 3HOUJ 4G7OF 3UNGC 1M9SA 2CGHA 2RQVA 4N4IA 2KISA 2HQRA 4II1A 2DA6A 3E5QA 4GYIA 3UKGA 1LEBA 1QCNA 1XMKA 1HSTA 3K4KA 3FXQA 4UVCA 2ECCA 1RI0A 2Y0SN 2DK3A 3OBYA 1QKWA 3KX2A 1Q82R 5ILSA 3KXTA 4DGWB 3M0PA 1KQSA 3BTLA 1N8RU 3QU6A 1BC7C 4E2FB 2DT7B 3ASNH 1YJ9A 2GCXA 1Q7YU 2J6KA 3F8CA 3EGDB 4M7AD 1GVJA 1MBHA 2R5YA 5A2QZ 1T56A 5K7FA 2ZPBB 1B8IA 4JJBA 2E4HA 3M0SA 2UV1A 1ZGWA 1KD1R 2EIKH 4PJOE 3LNQA 2OV7A 5FRNA 1WXTA 2HMAA 4G6DA 1N9RA 1OKRA 5FGMA 4C92B 3L42A 1IAWA 4GYGA 5F1JA 4UVAA 2M35A 2IGKA 1LNXA 3FWEA 5EEAA 4OIQF 1I6HJ 2F1LA 3OYNA 4GBQA 2DXCA 4M78B 4OF1A 2KIFA 2XMFA 3OYJA 3FJPA 2RVCA 4HBLA 2P0QA 5ICEA 4LMYA 2GWRA 3EPZA 1S8NA 2MAMA 1XSXA 1WHKA 1VQ7A 3J7AF 2BZ8A 4XM3A 1YIJT 3DTKA 1TP4A 2IVMA 4DYQA 1V1CA 2PG4A 3C2GA 1HKSA 2W84A 3IWZA 4HZFA 4FYYB 2ED0A 2OUMA 2R5ZB 3CEYA 1S29A 5CVJA 2WY7Q 1W36D 2GOXB 4PFPA 4ABZA 1M1GA 4C5HA 2AHQA 1OISA 3E6DA 2EFPA 5HNFA 2GFAA 4IUVA 4IUQA 4NS5A 1AZGB 1VQ6A 4BHPA 1Y6IA 2CP7A 4M75E 1WJQA 2DLPA 3OA6A 2G7UA 3TMOA 4A2UA 1ZBXA 1FZPB 5J1UA 3J80K 4E7JA 1T2KA 2K40A 4C2TA 2DFUA 4AMCA 4F17A 2EFQA 3CCQT 1QVFS 1HSJA 4V19K 1NBEB 3F9KA 2VT3A 4PJOB 1KYWA 3SDGA 4OINF 2MYSA 1S1NA 1MZBA 1T08B 1D1AA 4Z8AA 1GL5A 4LJZF 2GA1A 5E1WA 1M3CA 2MIOA 3GBQA 2JS0A 5GJWB 2VPLA 3GF5A 3V4GA 5D5VB 2HS5A 1BI3A 4UC4A 5GAMe 1V55H 3BR3A 3BT9A 4Y4RA 2KDSA 1GXQA 3LMMA 4JX6A 2O2OA 2QG9B 3SDZA 5K5QA 5D4RA 5H2FC 2V6EA 2JRMA 2E60A 2KRCA 4PGHA 3F8NA 2A3LA 3JRHA 5CVIA 3S6WA 3VS5A 3N5BB 1U9OA 2BOLA 4EJVA 3J81E 2P5VA 4IOCF 2EVRA 5FLMJ 1FIPA 2ZNZA 1SEUA 4A3IJ 4A0XA 2DI3A 2K9NA 2KK4A 3CMAA 4BY6C 2M0CA 2CT4A 4ESRA 5CAIA 2MW8A 3EG3A 1VYUA 3QDRB 3FMRA 3BROA 1M5Q1 1VQKA 3ZRGA 2XPUA 3JCUC 4KN4X 2V1NA 3WVDB 2RD1A 1VQ8A 3ZMTA 4CCJA 3I0TA 1IW7F 4PJ0C 1D8KA 3SZGA 4M75B 3K7AJ 2PNIA 4BQNA 3I5SA 3S1NJ 1IN4A 3RDVA 1MNMC 1TW2A 2E6ZA 2Y31A 4M75F 2D45A 1GFDA 1B9NA 4E47A 1UGQB 5GANg 3RI4A 1LJOA 3ELKA 4IRIA 2X3WD 5JI6A 4HKEA 3RMSA 4OB2B 1BL0A 5KH6A 4U0VA 2STWA 2CS3A 1W6XA 3Q9VA 2X3XD 3SZPA 3E97A 3BDUA 5LJ3g 3BR1A 4D9JA 3FBNB 1VQLT 1W0TA 2VONA 2MZ4A 5FROA 2VI6A 1L0OC 1M4ZA 1HW2A 3OL4A 2KVQG 2CSOA 3WU1B 2DA7A 1H88C 2A36A 2LQWA 1FSHA 1XDSA 2R58A 2CV0A 1WHGA 2XROA 5IOYA 2YU3A 5LGUA 2E10A 2AK5A 4FE7A 2CP3A 1XGNA 2EKHA 2DM1A 1NPRA 4JQFA 3FXRA 3P9KA 4M71A 2F6CA 2A0FB 3EYYA 4A4KA 3BTCA 2ZXJA 1KQ2A 4B3XA 2PX9A 1BIBA 4RDUA 2GGRA 3U1DA 1G3SA 2FA5A 1S7OA 4WK8F 3GOXA 3KCCA 2HQXA 5HY6A 5CQXA 1FMWA 5EF6A 2CP2A 4D6WA 2MSYA 3RBBB 1GHCA 2AO9A 2NAZA 5DLOA 3NFCA 2HYJA 2CFOA 2VBXA 1Z91A 2DFIA 4L18B 2VXFA 1D8JA 1Z9ZA 4RCCA 5D6XA 1OU9A 3JB9F 4IPAA 1VQ4T 2MLGA 3M8EA 1VNDA 4RB3C 4U7DA 3S3NA 3BR2A 2EH3A 3D0SA 1E3HA 3K4CA 4BI4A 3ZQLA 3N4MA 2K02A 3SDBA 2DILA 2JPCA 1G83A 2BZYA 4XTZA 3E3VA 2XSDC 1QO0D 1T98A 4BI3A 3K70D 2GQIA 2DBBA 1LFUP 2OTJQ 4UB6C 4LUDA 4BL0B 5LGTA 4XTWA 2R57A 1BIAA 1QQJA 2PU9B 1FMVA 3OW2S 2L7FP 3OL3A 1RLQC 1J5YA 2JA2A 4IHVA 5IT9R 4HF2A 4B3AA 1QGPA 4FYWB 5HLHA 4JRIA 5FLXZ 3HKZN 5DLQE 4CC4B 5GAOq 5AIQA 3DB3A 1IXRC 2EIJH 4BJ6C 1QKXA 1YJWQ 1G2HA 3ROUA 2WY8Q 4UUVA 1PD1A 1WI7A 3QODA 3FHNA 1R58A 2BVMA 5J8FA 5ED4A 1HK9A 3CCVT 1SD7A 3IAM2 4I98B 2KJCA 3SWNC 3VUBA 3MD2A 1PKSA 2FNPA 2MMPA 2L4AA 5DTDA 2ZZDA 3EFSA 2P5LC 2Y4YA 4IEJA 3WG7H 3F8MA 3FKIJ 3OYIA 5A2QR 2KQRA 2KYBA 4GRIA 1R0BG 2OAWA 1HOMA 2HEOA 3CCMI 2KRSA 4ANJA 3OR1C 5J6XA 3OYFA 4J9IA 1ODDA 4JRKA 3G4ST 3L2WA 1FOKA 2YX7A 3G71T 2W24A 1ZG5A 3DTIA 3MKYB 2R93J 4IIOA 2CUFA 4JRQA 1VQ9T 2XG8D 4FHTA 4FSSA 5KYYA 4BQOA 4ZYGA 1OOTA 2LMJA 3VS3A 2LTPA 5IXFA 5F27A 4CZCA 2CS7A 3M4GA 3VS6A 4JJNK 5GAMd 1VQMA 4XONA 3MP8A 2ECZA 2BVLA 2P0PA 2HU9A 3J81K 5EGOA 2NNYA 3KBGA 1Y96B 3V7CA 1EKEA 1LPLA 1WFXA 3RESA 1YHQA 1J7KA 3G3ZA 2X4JA 4M72A 4MO7A 3OWTA 1RRJA 3WTZA 3M8JA 4RGSA 5CJ9A 2CMPA 1MMGA 1PG5B 3PFSA 1T38A 3SJMA 1Z6RA 1T95A 2DFHA 2F4OB 1PSFA 4IURA 4MMKA 2WV1A 2XIDA 5GAMh 2BBYA 3M3YJ 3SYTA 3B6CA 1GCQC 3VWBA 2LKPA 4ZDOA 2A08A 1O57A 2HKOA 2HSPA 3JRZA 3IL2A 1U2WA 1ZG3A 2AQEA 5HS9A 3CF5F 3ZQHA 3HUGA 4WXDA 1K83J 3TOAA 5LRSA 3J7AY 1KQ1A 3QKJA 2QM3A 2HNHA 1KC8C 3REOA 3MZ8A 3GX4X 2YUPA 4M7DD 3TKYA 3TQNA 1CQTA 2DXIA 3CCEA 5KCHA 4HF0A 3QOEA 3M8FA 5K7HA 3JCMX 3LH5A 4KH1B 5DV5A 3JSPA 2XHCA 2QQ9A 3EGXA 3JCMg 1E6GA 2Y69H 4D5CA 2PTKA 2Q0OA 3FRNA 2ESNA 3E5XA 5D5XB 3JTHA 4DBQA 2B63J 3RYPA 2NUTB 3L2QA 3LGFA 1TSFA 3E5UA 1N77A 1PUFB 1DP3A 1YI2I 1ZN2A 1QZYA 1JKRC 1FP2A 3TP0A 3FC3A 2NRAC 2XKOC 5FD6A 2OA4A 1VYTA 2P8TA 3G1MA 4IHTA 2F5KA 3WVEB 2VXEA 3G6ET 4KGVB 2HZDA 4M3EA 4BBSJ 1QHGA 2AHJB 3TREA 1SRMA 1I0CA 1WHMA 2QA4I 4OWRB 2P84A 1K73R 3ZMSA 3IAS2 3ISPA 2DL3A 3MJXA 5DY9A 1YWPA 4HYEA 2R5YB 2D8HA 1UHSA 3CUQA 2RJFA 1I5LA 1K9MU 4RAFA 1B8IB 1TQPA 2ZB9A 1Y1WJ 1BC8C 3CCUT 1YX5A 4M3FA 2KKOA 3P9CA 3DEWA 4B09A 1JU5C 3DLLA 1HYOA 3EH1A 1R49A 4ENKA 4ESJA 1ZQ1A 4YG2F 1VQOI 4XR6A 4J7IA 3CC2A 3HPWA 2OTLT 2VBZA 4AUXA 1ETWA 1ABQA 3CMEA 3GEZA 1JTXA 2M9UA 2DRMA 1W7PD 4M3BA 2UUZA 4HX4A 1QVFP 1ENHA 3I59A 3M9AA 1WJCA 2MWPA 1GRIA 1TTHB 5DUKA 3M59A 3FIFA 4K11A 3K4LA 3LAPA 3MWMA 2FNAA 1XPXA 1QP3A 1N8RC 1FMKA 1SKUB 4KYWA 2ZJPF 3KIOA 1UG2A 4V2GA 1EJ9A 1YW8A 1VA7A 2GFUA 4ZN3A 4WX9A 1IXCA 1JJ2S 4LFUA 1I6XA 4M3GA 1BM9A 5CLSA 2DNUA 4IUTA 3F70A 2DVJA 3NRVA 4AIHA 1LDDA 2JA6J 1JE8A 4Z88A 4NC6A 1YJNA 1TQIA 3H3UA 3VRYA 4D1QA 1ZSGA 5TJJA 4Q4ZF 3M0UA 1I1JA 4PKCC 3CCSQ 2X98A 3JB9H 5BPIA 2K3YA 2LCSA 4Q5WA 2XF5A 1KONA 2XDDA 3KLOA 4XRFA 2HL5C 1O7LA 3H5AA 2WADA 3HXLA 3KPHA 4M3DA 4TV7A 4QSHA 3S3OA 1C0MA 1YRNB 2SEMA 4XQFA 4D7MA 3META 3NEUA 3HM5A 2L9SA 1DU6A 3PNYA 2BE9B 1O7FA 1BJZA 2Y2ZA 3QIIA 3B02A 3CBMA 3IUOA 4QT7A 5EC7A 4CC7A 4X34A 2VC1A 1T0JA 1ZA2B 4C5GA 2JPBA 1U6GA 2RH2A 3ABUA 2QTXA 4RTTA 5KYXA 1P4XA 1QBJA 5GAN7 4MEYF 1ZX6A 2K4JA 3HIFA 2ZPGB 2JZYA 3V8LA 4BQQA 3ABTA 3PMTA 4I2OA 1ETOA 2DA4A 5LHHA 5IHKA 2CO5A 4RGUA 2FO0A 1N8RR 2ID6A 2HQEA 1XDUA 3BY6A 2COYA 2PJRA 1Q7YR 2WSFE 3BCAA 3WE2A 2DA3A 3RIRA 1JT0A 2P0WA 3H1CA 4NL3A 1M30A 4EGZA 1OU8A 2LBFB 1W5SA 3AG1H 4F93B 1YJ9I 5L3GA 5M5XJ 3P5JA 3CCLT 1PVEA 3HRUA 2QF7A 1TWBA 1S6LA 4JX5A 1MGQA 5CKHA 8AT1B 3UF4A 1H9GA 3HEFA 5FU6C 2VQLA 3M5AA 3HB9A 2DN0A 2K5FA 2HNIA 1P6RA 2YUOA 3VEPA 5LL6S 2XHKA 1JKQC 2O03A 1WH5A 4ESFA 1NEBA 2DZCA 3JAMK 1K4SA 4C5IA 5C4JJ 3HGYA 2X35A 4XICA 3OYKA 2PMZA 2MD0A 4TVRA 3LA3A 3PNVA 4XLNF 1OYYA 3AL0C 4D7NA 3OBWA 3OB9A 3MVPA 3KZIC 3MO8A 2WA0A 2QEXA 3J7AO 5A0LA 3GMEA 1ZK8A 4BKXA 5JVGF 2F4IA 1E2XA 2WBMA 4AIJA 4RB0A 1MBJA 1VQ7I 2O9VA 2MCNA 4EJTA 2IA1A 3DLAA 3S16J 2PVOB 3X26B 5D6WA 2FPFA 2LY9A 1OPKA 4X1EA 2V1RA 4LD5A 1MBGA 3HKSA 2K7LA 3HPHA 3TSWA 2KT1A 1P4WA 4ZTFA 1TT5B 2XPVA 2DYIA 3MFKA 3DTEA 1KU3A 3D5RC 1WKMA 3RQ4A 3OSSC 4PZJA 3VOEA 5F0FA 1Z7UA 2LRQA 3HTUA 2ZSIB 2LYCA 2R4GA 2LR8A 3DXJF 3O8GA 2EYWA 4C9YA 3CMEQ 4JRPA 4QTRA 3OW2P 1LNWA 1VQ6I 2VC8A 2K86A 5ICFA 4Z2YA 4R0KA 2IA2A 5LD2C 1VQ5Q 1R4MB 3I4MJ 2WSEE 1R5HA 2F2WA 1TWAJ 2JRTA 2IXSA 3BE3A 3OYHA 2GTJA 3E1SA 3H9JA 2YRVA 2PN6A 3BP8A 1FNNA 2Y4XA 2ZMEA 2E12A 5LJ5g 2UZKA 2Q2EA 2E5ZA 3I55Q 1MBFA 3IHUA 4DIQA 4LD9K 2JSPA 3TL4X 2DL7A 4OIRF 3VSKA 5E18F 2E1NA 2LKXA 1KQ0A 3GZNB 3FZVA 3WHBA 1E6HA 2K5IA 1S72Q 3LW5E 1HD3A 3QPHA 3ZQCA 5D6YA 1UELB 2KPMA 3PO2J 1IHVA 3SFMA 1MNEA 3BC8A 1VF9A 5DM6F 2Z2SB 5L3BA 2HYFA 4XNFA 2QWWA 1Z77A 3G73A 2HGCA 2CZ0B 2PMHA 2JT4A 3C94A 2RA2A 2EYZA 1WHHA 3TCJA 3R4KA 4M7AB 2KDOA 5HS7A 4EATA 1Q1VA 2OC6A 5EEGA 2FBIA 3HYIA 3I9V2 4ZH4F 1EF4A 1W70A 1QQIA 2ZJ2A 2R7UA 3CMAI 2E5QA 4M7AF 1HW1A 3S2WA 1P7IA 1UG1A 1IN6A 5C44J 2X48A 1UHFA 2CW0F 1CF7A 2XU8A 2HD0A 4RB2C 3I56A 3HG9A 2R92J 2YUQA 1U5TC 1VQKI 5GANf 2LRDA 1ON2A 4GY5A 3EUHC 2L01A 2V7FA 1VQ8I 1Y71A 4JUVA 2J05A 2KMUA 2X1CA 3M54A 4IHYA 1KHIA 3I35A 1KU2A 1UECA 2JN0A 2QZ8A 1W7PA 2ELKA 3KP4A 4HDVA 4A3MJ 1VQNI 3NPFA 1QP2A 5KYUA 3CC4Q 2NVQJ 4EJUA 3CC7A 4DA4A 2AZSA 1ACMB 1OZ2A 1I81A 4Y13A 1YITQ 2JQ7A 4I0BA 2ZPHB 1X1DA 4J6YA 3CCJQ 3JSOA 1OZ3A 4BNCA 2YR2A 1X19A 4W97A 1X1AA 3ESWB 5JLWA 4A5MA 4AIDA 5KYYB 1KGSA 2VV5A 4C8QD 1UB4A 4PDKA 2HKXA 2LKSA 1IV6A 4KRTA 4ZGEB 4A6EA 3FDYA 1I5OB 1WSUA 1D3BB 5EGOB 3COAC 4M73A 1A0NB 3P9IA 1FEXA 1A6IA 5CQYA 4LG3A 2X4WA 1UAAA 1EH7A 4A53A 1ZHIA 1KJWA 5ECAA 2B7EA 3EH2A 2DJNA 1KIKA 1WNLA 2YUNA 2KZGA 1AD5A 1SAUA 2HTJA 2AT1B 1WVRA 1T0FA 3UT1A 4DBFA 3J80E 3X2QH 4HG2A 1BK2A 1M1FA 3CD6A 3B73A 4K2EA 5D6EA 3MP1A 3K6GA 2Z16A 3HUGB 3OYYA 4E7IA 5HLIA 2LREA 2XDBA 4WCGA 2MABA 1L3LA 2EYXA 3CDLA 3E0JB 1M1KU 4ZDLA 3IC7A 5H6RA 2HOTA 2DMQA 3H5NA 3E9FA 1NK3P 3CESA 3VU3C 4NL2A 2JUGA 1WPKA 1Z21A 2H6CA 2GA2A 1SAXA 2HOSA 2YT6A 2G9WA 3PMIA 4OMOA 4FW1A 2HFHA 1FSEA 4DZJA 4ZYAA 3EGXB 4RGXA 5B1AH 1X2QA 2VQGA 2VKHA 1BBZA 4MZTA 2VBWA 1PSEA 1V76A 4BXXJ 2VOPA 5KE2A 3CO7C 1LVKA 2LSOA 2GAUA 1OQYA 4RS8A 2YUSA 4CA0A 2HZYA 4PLLA 2GIVA 3MEUA 3M55A 2M8GX 3UR3C 1DPRA 4IUUA 3EHQA 3UATA 1I3AA 3TO9A 2ZBKA 3L2UA 4KJZA 4QQDA 1YN8A 1AEYA 2EJRA 2JWTA 4ZNXA 2HCKA 3CUQB 4DW6A 1QVGA 3CJRB 1WDXA 2FMYA 1LB2A 4HF1A 1J3TA 1H89C 2SRCA 1TWGJ 5KYWA 3BFMA 1H3ZA 3CCRI 2HBWA 4A3BJ 2KT0A 2M51A 4M77C 1OYWA 3HSEA 3LX7A 2C0OA 1G59A 1X2MA 2QVOA 2OCEA 3CCYA 5F0CA 3OS0A 2DO7A 4XTVA 3NHNA 2VB6A 3KYDB 1M27C 1ARKA 3IH4A 3Q0WA 5HLTA 3H92A 3ZFJA 1IDYA 3AAFA 4A69C 2RI3A 4DOVA 4ZC3A 2RJCA 4OU0A 1XC5A 1WQ2A 1N78A 3ABMH 1A04A 1VQMI 3SQNA 5J1YA 4IO9F 1FYLA 2HPMA 2DRKA 3QP6A 2H3JA 3S14J 3O3KA 2F69A 1RI7A 4BHCA 1NLPC 2M0YA 2E35A 3GZ5A 3ZBDA 2FVUA 1NYGA 5KYNA 1K7AA 1YHQI 2K9QA 1Y39A 1F1BB 1WHLA 3F22A 3FEOA 2W10A 5D7UA 1DPUA 3EFOB 1XD7A 2ME0A 2MUNA 1Z6TA 4CHUA 3CC7Q 2O5RA 1Q82C 1N75A 3I54A 2O61A 2HR3A 2M4KA 2ME6A 4L0ZB 2Y75A 1LQ1A 4FX0A 1F4KA 3ECHA 1U5TA 3HTSB 4A3CJ 1RL2A 1Y56A 2QENA 1N5ZA 1W4SA 1TL8A 2RHZA 2PEXA 4OMLA 4DNCA 4RCBA 3CCMT 3LA2A 5LBQA 1ZSZC 4QVCA 2HOEA 3OYEA 3IKTA 3SZTA 1FP1D 2CUZA 1OX8A 2MLKA 3GW2A 1VIEA 1YBYA 2DE0X 2LNVA 4KGXB 5TRDA 3CCEI 3N97A 3OMCA 1KD1C 1HJDA 3ZQGA 3SB2A 3PIOA 5GAMg 4G8XA 3HC7A 5KCMA 1QCOA 3L1PA 2A5WA 2DQLA 3X20B 2VIXA 3V8KA 3FMQA 4EEFG 4XQ3A 3S1MJ 1J2XA 4I99C 4OIOF 1WGXA 1DU0A 4HLXA 3IRRA 3RZOJ 2DXUA 2X51A 1OPLA 1F9NA 1XGSA 1ERDA 2K7AA 2LJ1A 4FT2A 1W4MA 1WJBA 3U21A 3TW6A 4XU1A 2MPXC 4J9BA 3OYDA 4BB7A 2PJRB 3A8MB 5E3LA 4CCOA 3OYAA 2HDDA 4F7UG 1QVUA 5IHIA 4II2A 2GTOA 4OP0A 3K69A 4FT4A 1K9MR 1KSWA 4E7HA 1USSA 1JRIA 1NLOC 4M7DE 3GTMJ 2MGQA 4A6DA 3PUFA 4BAYA 5ICGA 2IS2A 1IZ1A 1RACB 4NQWB 2A6TA 5HNHA 1U3EM 1IREB 1TH7A 2EQUA 1QZZA 4C92F 1D0YA 2DJQA 3QZ5B 5KNLA 1FIAA 2XK0A 1R4NB 3GCMA 4M77G 2DAQA 1B6AA 3W2WA 2E3IA 3HZJA 2JJ7A 1MJAA 2L7ZA 3ASOH 2R5MA 2DJIA 1FLIA 5FLXE 5GJVB 5GTHC 2K27A 2L0KA 5L3DA 3CC2I 4LDWA 4N4GA 2CKKA 2V6CA 6AT1B 3JCMb 4LDXA 1MMDA 1POGA 2LK2A 3K9TA 4PSXA 4AVPA 3CMEI 1XSDA 1RAIB 2LQKA 3H3ZA 2L2OA 4IQ4A 2RNAA 4KA4A 5FFXA 3WGHA 1AVZC 5EG2A 2IP2A 3NMZC 1YI2T 4CYCA 4HV5A 5IH2A 2E2JJ 5HS8A 2I8DA 4P1WA 1ZHFA 3PIPA 4WCIA 2FYKA 4BE1A 1G3YA 4C92C 3OMYA 1WA7A 1Y8QB 1ORKA 5KE3A 2ZXHA 2LX7A 2L9RA 3C1DA 4R8HA 3BG9A 4XK8E 4R1HA 1G6NA 3BOQA 2XIGA 4V2SA 3UWNA 3QWXX 2QA4T 3S1QJ 2K9MA 5J4YA 5L3FA 2X4YA 3BW1A 5CVRA 4M78F 1RZ4A 4F7UA 1TOVA 5FKNA 1YJNI 1GXIE 3A03A 2DX1A 1Y57A 3J80Z 1BI2A 1Z0XA 4A3EJ 1JI8A 4BQAA 2ZCFB 4C0GA 3EYIA 4MDXA 5IT9K 2A6HF 2XASA 5I2SA 4ORZA 4M7DB 4HAMA 2DYBA 1VQOT 1XTDA 1ACIA 2MOXA 1Z3YA 3L7WA 2FPDA 2RREA 4M7DF 4AWXB 2CSQA 4M77A 3WHCA 5BPDA 1KYZA 2N8GA 2ZMEB 3BCBA 1IRZA 2Q2EB 2BW3B 2EZKA 4KIGA 3TW7A 2OTJA 1JUPA 4Y52J 2F2XA 2HBPA 3VS2A 2J6FA 1MD0A 5A2QK 3F0CA 4ME7A 5GAHJ 2VUMJ 1B3QA 1X6GA 2LF8A 3HRMA 4OMPA 2LMDA 4JS5A 4ELYC 2QSFX 1ZQ3P 2LZ6B 3JRAA 2QUFA 1WHJA 5EEHA 1YS7A 3SFIA 4MQ9F 4BE0A 1ZGJA 2YX4A 4XKWA 1EV7A 1MKMA 3OIOA 5J26A 1YIJQ 1I3QJ 3S2HJ 1YJWA 5HVQC 2O8KA 4PJOF 1M8MA 1BCMA 2QYOA 1FX7A 4NUBA 1JB0E 1WGSA 2DU9A 1T3LA 2EJ9A 5CKFA 1R36A 1Z3XA 1O3RA 4KITB 4J8OA 1Q81U 3Q0VA 1P7JA 1KU7A 2O6GE 1YCSB 1JKPC 1NJIU 1JJ2A 1ETYA 3O8HA 5LFAA 2QAZA 2RHXA 4PK4A 4KULA 3QP5A 4XL9A 2I10A 1CF7B 1HDDC 3R0AA 3ZPLA 1NPPA 1OEBA 2IPOB 5KAFC 2JTMA 1RI9A 3GTKJ 4BE2A 2G6FX 3TO6A 3RKXA 3CCQQ 1R5GA 3TSZA 2CG4A 3FMSA 4IHWA 4X6AJ 1B34A 5J39A 4UNOA 2LY1A 1W7PB 3I5RA 5KYUB 2IS1A 4YFXF 2EQKA 1WIEA 2OX7A 2QASA 5GAN6 3JCMJ 4V2FA 4E70A 4D8DA 3ER0A 4AYBN 1K0SA 3QJYA 2D5VA 4KDPA 2QKLB 1HC8A 1X3ZB 5K5RA 2MI6A 2CGPA 2EPFA 4XLAA 2LVMA 3OSFA 1XGOA 2QEXI 2VOOA 2E1MC 3QDFA 4JJCA 1FPQA 4HEA2 2D1HA 2FUG2 4NBQA 3V8JA 1O3QA 4H4KC 4JLGA 2RNJA 4EIKA 4UV8A 4EMKA 1BOAA 4HOBA 1KG1A 1ZYRF 3IV5A 2H1KA 3HHGA 5J40A 2QSGX 3GVAA 3T8TA 3A8OB 5A0DA 1QVTA 3BG3A 2WB1A 3HOZJ 1YJ9T 1PRLC 3G1LA 2D8JA 2K4BA 1W2BA 2DK5A 1EH8A 2CUBA 2C06A 3T5XA 5LJ5f 2EFWA 1OPCA 2L3QA 2L89A 1X1PA 2YLBA 4FU6A 1IO2A 1VQPT 2Q8KA 4BXFA 4R56A 2EZHA 3OSVA 1RAGB 4LD6A 5FU6B 4EDUA 2J5OA 3KFVA 1GUUA 5E1ZB 2AQFA 2R7OA 1MHNA 3EG0A 5IAYA 1QVGS 4L5GA 2BY0A 3T9NA 4JOMA 1UEBA 4HX8A 5B3SH 3OYGA 4QWQA 1E7OA 1AA7A 2NYSA 2CZ7B 1GCPA 2DYRH 2L5QA 4YEJA 4XRMA 1WJRA 1SFEA 5EDNA 3HSBA 2R7FA 5I2MA 3KE2A 5IYBJ 4ZZDA 1SFXA 2L4MA 4S04A 1O3TA 2V9VA 1RUNA 2NWMA 3DF8A 2RMOA 4HQMA 4A3LJ 1IN8A 2P7VB 2VASA 3TEDA 1EX4A 3GNFB 1VQLQ 4I6ZA 1BB9A 5GPCA 3QYHB 3HJEA 1TUCA 3M4YA 1TWCJ 3VB2A 3WU0A 1QZEA 3CQTA 1YW7A 2F5DA 2IGNA 3QOPA 1MBKA 1PCXA 1WPYA 1MBEA 3VS1A 1MH3A 3EGUA 2BV6A 3HOSA 3CCRA 2LNBA 4YRVA 4XKBA 1VQ6T 1IXDA 2XI9A 4LLNA 1BN5A 1SANA 1IN7A 1B72B 1QWEA 1ETQA 2EA2A 2VVKA 2EZIA 3I56I 3Q9SA 3BG5A 3CLQA 3K4BA 2Y30A 3JTGA 4M6XA 4A3JJ 1GDTA 1IUYA 4NDLA 2K79A 4KT5C 1BOBA 1TZLA 1R1TA 2NUPA 1WI9A 4RTZA 2ADUA 4CH7A 3WTTC 1FBSA 5GPAA 3CC7I 1OFCX 4KUIA 2V1DA 4CCNA 1BA5A 1JQQA 4JZ3A 4A4FA 2JTVA 1VQ4Q 1MV0B 4C3JJ 2QDYB 3O8VA 2QQBA 3C4SA 1S3JA 3U2RA 3ULQB 2NOGA 1S7EA 4XU3A 2PQWA 4BUGA 3E6BA 3F8FA 2VKVA 4EPCA 1AWWA 8ATCB 5CKBA 3CCSA 2DA1A
chains in the Genus database with same CATH topology
3GLXA 1Z05A 5LLQA 2Z9OA 3CMAT 2P4WA 3HRSA 5AYFA 4CXFA 3RMQA 3ZMZA 2NNNA 4HV6A 2RO0A 3QYGB 2QQAA 5D8LB 1VQKT 4ENNA 2E1CA 2Y4XA 4LB6B 4KMUX 1IN5A 1VQ8T 3H6ZA 1U1TA 2BUDA 3RKWA 3X25B 1U5TB 1VQNT 1K73C 5F1RA 2D6FA 2YPRA 2VN2A 4CYDA 1XGMA 2WV0A 3JCMc 4C8QE 2XAQA