4HX8A

Structure of metal-free mntr mutant e11k
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
SMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 53
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx8A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx8A02
1O3QA 1X3UA 1FY7A 4Q47A 3MQ0A 4ZYHA 4XLPF 2OBPA 3GFJA 4BYYA 3I54A 3HSEA 4P9UA 2Z3YA 1FT9A 1PP8F 5D5XB 1TQMA 1BJAA 2L54A 2HGCA 4HQMA 2FSWA 1BI1A 4ESBA 2EV5A 5ILUA 2V1DA 3FXRA 4CGZA 2ADUA 4LLGF 2QENA 1ZG1A 3IHUA 2WV0A 1YS7A 4WX9A 2W57A 2A61A 3GZ6A 2KKOA 1JGSA 3R6SA 2HKXA 2L4MA 3SQNA 2FF4A 1MDMB 4F7ZA 3VB2A 3DF8A 2QQBA 3CJNA 4UHTA 2YSRA 4N9HA 3L9FA 2D1VA 3J81K 1U5TB 4HV5A 2PMUA 1IZ1A 1XGSA 3L7WA 5CVUA 1YG2A 3P9KA 4P96A 4HDUA 3IWZA 2F5CA 2NYXA 4IRHA 4B09A 3SZPA 1YO5C 1RNLA 4LG0B 5H20A 3GFMA 1FPQA 1XGOA 2FA5A 3CLOA 2UWMA 4CDGA 4WXCA 5EEHA 4RAYA 1G3SA 2RVCA 1QO0D 2FRHA 1ZH5A 2UXXA 1FOKA 2VN2A 5AONA 1F4KA 2FXAA 2HWVA 1FBSA 4IPAA 3H92A 4AIKA 2DI3A 1J7KA 2XAHA 2TDXA 3QP6A 4A2UA 5K5OA 1TLHB 3KP5A 3PQKA 3E6BA 1T0FA 1FLIA 2ZFWA 1B59A 1LDJA 4AVPA 2DBBA 1KU7A 2EV0A 2XGXA 3WTTC 4P5OA 1R00A 4WF2A 2GQQA 3CO7C 3ML6A 4YIFA 1YIOA 2H09A 1U6GA 5DDGA 2JZYA 5HVQC 1XDSA 1UB9A 2IA1A 1OMIA 2EFNA 1P4WA 4EMSA 5ICEA 3HRSA 4ETSA 3NRVA 5FFZA 2VOOA 1F9NA 1W7PA 1QNTA 1B9MA 4L5JA 5A2QK 3LAPA 1ZREA 1OPCA 5K5RA 4MQ9F 2YR2A 3GW2A 4WWCA 3QRFF 2BYVE 1P2FA 5J6XA 1ZAOA 1S3JA 4O3MA 3CO6C 1P4AA 1IN7A 5DYMA 3VEPA 2ETHA 4IVNA 4HAMA 1ON1A 1T38A 2DW4A 4WK8F 3P7NA 1G3WA 2VBYA 3NEUA 5E1ZB 2L4AA 4HW0A 2EV6A 1CF7A 2HTJA 3HSRA 1ZGJA 3KLNA 4R79A 4KDPA 1R58A 2VT3A 1KQ8A 2LDUA 1SD5A 5IT3A 3F21A 4UV8A 3ECHA 1DUXC 5CYVA 1R7JA 3IC7A 5D5WB 3ULQB 3WTZA 1BOAA 2IT0A 5L3BA 2F5DA 3CDHA 1FP2A 2OQGA 1FX7A 3FXUA 1BC8C 2XAGA 3BJ6A 2JPBA 1YW7A 1ZRFA 5E1WA 1KGSA 1Z05A 2CYYA 4Q5SF 1U3EM 1ZARA 3K69A 2O3FA 4BHPA 1KYZA 4IF4A 3RYPA 5E18F 2XHKA 3ZQ7A 3HOTA 2OU2A 2BE5F 2OQRA 4I0BA 4Y17A 3I4PA 2Y75A 2IVMA 2NNNA 1BI2A 3KP6A 4IRIA 5BPIA 4Q48A 1MDMA 4FX4A 4U0VA 4LLLA 2QZ8A 5HLIA 3HYIA 3WTSC 2GXBA 3WTWC 1K78B 4LB5A 1WQ2A 1U5TA 1P4XA 3ZN1A 4PCQA 3ZMVA 5E8GA 1XN7A 4U88A 1MGTA 3FX3A 1OYIA 5ED4A 2P5LC 3C3WA 4LB6B 2LF8A 4LG0A 4M6YA 3I58A 1IN6A 2VC1A 4UV9A 4LMYA 4EM1A 5K1YA 3D5LA 3IKVA 5LGUA 1IUYA 1W5SA 2NAZA 4KT5C 1IN5A 4DQ2A 2PMHA 5HDGA 4ENMA 1XSVA 1LVAA 1QQIA 2WC2A 1T98A 3K0LA 3TOBA 3KZZA 3R0AA 4L0YB 3QU6A 4FT8A 2ZMEB 5HOOA 1HSTA 3DQVC 1JE8A 1TW3A 1CGPA 2B0LA 1YYVA 4GGGA 4RAZA 3GVAA 5HDKA 1OKRA 2A5YB 2CGPA 1S7AA 3F8CA 3KP3A 2GA2A 2QWWA 2FE3A 3JSOA 4IHSA 3IKTA 3ZMDA 4N0BA 2FNPA 4MGRA 1J59A 5LEKA 3I53A 2A6EF 4N9IA 4CXFA 3N97A 5HDNA 1S8NA 3F6VA 4HYEA 1ZYRF 2GWRA 3FMRA 3L2CA 3RI4A 2EA4A 3KFWX 4UUVA 1RIOH 1W5TA 2YU3A 3DPTA 3MCZA 4EVIA 2VBXA 4A0XA 1OYYA 3V7RA 3FM3A 4I01A 4YG2F 3BJAA 1YFHA 3C7JA 1HQCA 2F5EA 3I5UA 1F1ZA 1YW9A 3T8TA 1HW5A 1JHFA 3HIFA 4RB0A 1SFUA 3S2WA 1WI9A 3I59A 1JXSA 5FLXK 2CG4A 5TJJA 3REOA 4HLXA 3M9AA 1C0WA 2E7XA 1FP1D 2QQ9A 1HKQA 2R7DA 2CW0F 3RKYA 1MKMA 1MZBA 3DPLC 1XMAA 1K79A 1KA8A 3VOEA 4ZYGA 2IA2A 4EGZA 2FOKA 4RB3C 2BGCA 1H9GA 1UCRA 3HHGA 4B8XA 4O6JA 5L3CA 3T8RA 1S7OA 1R22A 1XGMA 3GLXA 3F23A 1IN4A 2PLYA 4M73A 3RKXA 3EETA 4ENJA 2FMLA 5L3EA 5J8FA 3Q9SA 5IT9Z 4RB2C 2KJCA 1FSEA 4UVBA 2H27A 5BQTA 4RGUA 1P6RA 4P9FA 2MH9A 1EH6A 3ZN0A 2QYOA 2DQRA 1LB2A 4XSZF 3KEQA 1O3RA 2EK5A 2G9WA 4LGWA 4G7OF 2X0LA 3Q9VA 3ELKA 2QVOA 3M8FA 4BXUA 5LHGA 3RDIA 2XVCA 2L3DA 4ZYEA 3EYYA 1HW2A 3F8FA 4OU0A 4XRFA 4ZYDA 3T1BA 5D4RA 5D6EA 3O2PE 3ZMZA 5CVIA 1L3LA 2Y48A 1E2XA 3HRUA 1AWCA 2D2WA 3WU0A 1DP7P 1XDUA 2XIGA 4CHUA 3TDUC 4NB5A 4MHGA 2XASA 1DPRA 1ONVA 6PAXA 4XSXF 2H94A 2DPDA 2STTA 3V7CA 3M8EA 1R5GA 1TW2A 5FGMA 2RNJA 2W24A 3CUOA 2ZMEA 4M9SA 3COAC 2DT5A 2EFQA 3F72A 5HLHA 3SFZA 4HF1A 1NHAA 3J7AO 4CO8A 3FWEA 4AIHA 1R1VA 1FBQA 5BS6A 3E5UA 4YFKF 4HDVA 1BIBA 3H3UA 1HKSA 2O0YA 1B4AA 2HZTA 1RI7A 3FMSA 1MD0A 2ELHA 5AIPA 1HBXG 3KZYA 2NRAC 3DKWA 3K1MA 3LA3A 4ENNA 3HTUA 4L0ZB 1O7FA 2V79A 4NQWA 4ASNA 1F5TA 4M72A 2A07F 4BH9A 2A69F 3H3ZA 4LFUA 3CTAA 3CUQB 2OZUA 3GFLA 4RGSA 2LNBA 2P4WA 3F8NA 4OINF 1ZLKA 2HEOA 5K5QA 4JK1X 1U8RA 2F5FA 4HF2A 4A6DA 2Q2EA 2G7HA 3D0SA 1QGPA 1J5YA 2CQKA 1PDNC 1W4MA 2PFBA 3ABUA 2EJRA 4R1HA 1G4DA 3V8KA 2KRFA 2P8TA 4AIJA 2O03A 1REPC 4LLNA 3WTXC 1XSXA 2DPUA 3DXJF 2M1BA 4EJTA 3GX4X 3U9GA 2IP2A 5E17F 2E1NA 3WGGA 5LHHA 2D45A 2Z33A 1YW8A 2HYFA 3KETA 2OAZA 3QPTA 3VFZA 1KU9A 2KIFA 3U2RA 3DEUA 1IF1A 1XCVA 4AD9A 1TNTA 3T0YA 2Q0OA 3ZMUA 3RTRA 5CVJA 1BM9A 5LRRA 3J80Z 3M7GA 1LNWA 3GWZA 2NS0A 4MEXF 2LSOA 3W6JB 2XROA 3KCCA 5H6RA 3WTUC 1R1UA 2XKOA 3L09A 3WODF 1BI3A 2ESHA 2BBYA 1YLFA 2W84A 3TDZC 3KP7A 4QLCU 1Z6TA 3F3XA 5DUKA 4WXHA 3FMQA 2COMA 2Q8KA 2R3SA 2P6SA 2DO7A 3MWMA 2YX7A 1UFMA 5H6QA 2D1HA 2JRTA 5LLQA 2FQ3A 5A2QZ 5BOXA 1O3SA 5DUIA 4U0WA 2MBFA 4E70A 3LAJA 2K02A 3E5QA 3QAHA 2OA4A 1RZ4A 4PZJA 1TTYA 2E1CA 3V4GA 3HHHA 3N4MA 3SZTA 3W6KB 1BIAA 4KN4X 3FF5A 4G7ZF 1KQ9A 4BQAA 2J5PA 3B02A 3GYHX 1T6SA 4G6DA 3GZ5A 2ZKZA 1FC3A 3L00A 5BPDA 4MTDA 4HX4A 3DP7A 4OIRF 1K6OA 5JI6A 3TO7A 5CVRA 2XV4S 1G6NA 4HX7A 5LHIA 2HOEA 4ESJA 3KEOA 1L0OC 3WG9A 3K1PA 1IAWA 5D6FA 1B9NA 5E1XA 4HBLA 2M5WA 1QBJA 1ULYA 2DK8A 5CLSA 2IJLA 4YFXF 5CVVA 5HS8A 2F2EA 1HSJA 1BI0A 1KU2A 4MQVA 3R60A 3WGIA 2ACJA 2QUFA 2CSOA 2UZKA 4RS8A 1PP7U 2ZXJA 3WU1B 3BPXA 3PFIA 2DTRA 5D8LB 2ESNA 3HTSB 3I64A 3BP8A 4MTEA 1ZLJA 3OOPA 5JHUA 2PN6A 4GXOA 2VXZA 2V1XA 1QPMA 1LJ9A 4JBAA 1LDDA 1Q1HA 4OIOF 4Y13A 3HRTA 3G3ZA 2FMYA 1E17A 3LQQA 2A3SA 3CUQA 3DV8A 1Z1DA 4U7BA 3V8LA 4GYGA 2VT2A 3F8BA 2RDPA 4BNCA 4GYIA 4IJAA 1LDKB 1U2WA 1MJBA 3GXOA 3E6CC 4I7HA 3WE2A 5F6FA 3GFIA 5HS7A 2HDCA 2FBKA 2Y0MA 3BWGA 3LWFA 1H0MA 4LJZF 3RPQA 2RKHA 1FYKA 5HLGA 4QWQA 3ZMTA 3QPHA 4EJVA 2PBIA 3G73A 3BZ6A 1ZGAA 1YQAA 1MJAA 4A5MA 2M30A 3JW4A 3WTVC 2M87A 3E6DA 1D3YA 2HTSA 4ESFA 1I6XA 4KICA 2YPRA 2A6HF 2WTEA 1S6LA 1SAXA 4L9JA 3GO5A 3I71A 3E6MA 4HV6A 3BOQA 4Y15A 2RV8A 1O57A 3WTYC 3O3KA 3KE2A 5LRSA 1Y0UA 4Q4ZF 4ENKA 1D5VA 5KVRA 4HZFA 4DNCA 4YFNF 1S29A 5IT9K 1GXQA 3C1DA 3Q5FA 5DCMB 1VTNC 1EV7A 4EJOA 3QU3A 2ZCWA 3GF2A 4LK0F 2PEXA 2ZNYA 1KYWA 2ZNZA 3TO6A 3JAMZ 1MJ9A 5L3GA 2IA0A 2MC3A 1J2XA 2RQPA 4KIGA 4A0ZA 1FNNA 1LEAA 4OIPF 3TQNA 2ZO4A 1ZRCA 1USSA 5AIQA 5DEQA 3MAJA 5BMZA 4KYWA 2Z99A 4L5IA 4WCGA 3PQJA 3HOSA 1KQ0A 2DU9A 1H9TA 5D4SA 4KMFA 3ZMSA 3F6OA 2GXGA 3WGHA 2JT1A 1EH8A 1QZYA 5DV5A 2XAQA 3K2ZA 4KUMA 1STZA 4BHBA 1DPUA 2H6CA 4ZH4F 2FEZA 2ISZA 3JTHA 2XAJA 3ZPLA 3R4KA 2HS5A 1K78A 1XMKA 3T5XA 2K4JA 1GXPA 1ZHFA 1IXCA 1TBXA 1HW1A 4HQEA 2EA2A 4HA8A 1I27A 3BPVA 3TO9A 2EFPA 1YTYA 4M74A 1R36A 1TQPA 2H6BA 3F8MA 4ON0A 5FO5A 1ON2A 2BV6A 3SHFA 3ECOA 1FSHA 3LQRA 1WRJA 1R23A 1SFXA 1DDNA 5LBQA 1KU3A 2P7VB 3R61A 1LEBA 2CO5A 4BAYA 1EH7A 1SD7A 1TNSA 1FBUA 2PI0A 4WXDA 4CYDA 4EM0B 4HLYA 5JFRA 3P9IA 1ZG3A 4G7HF 4PGGA 2X4HA 4KFCA 2VBZA 2PQ8A 4U0YA 2XKPA 5TRDA 2ZBKA 2FNAA 2MA3A 2K7LA 3I0TA 3ISPA 3K1NA 4XLNF 2O6GE 1B6AA 2VODA 2K27A 5ICCA 3P9CA 1TQIA 2AXLA 2O8XA 2STWA 4L18B 2QBYB 1OYWA 2VBWA 2OD5A 3HRMA 2DAOA 1U78A 3B73A 1O3TA 3NQOA 2FU4A 3J81Z 4AWXB 2LF7A 3MFKA 2IPQX 2EFWA 4U7DA 4KIBA 2RGVA 5L3DA 4A5NA 2V6CA 1U5TC 3HSFA 3RJPA 3TOAA 3FZVA 3RKWA 4A12A 3J80K 4I02A 2KIMA 4M9XA 3EDPA 3FM5A 1D8KA 4IHTA 2Z5UA 3ROUA 5ERIA 2FBHA 1ODDA 3E5XA 4K2EA 1IRGA 1USTA 1BC7C 4IRGA 4XBFA 1K7AA 5DCMA 2MLGA 5FD5A 5CJ9A 2QM3A 1IXRC 1UHMA 4UVCA 4HOBA 4M71A 3ERED 2Z9OA 4RGXA 1O7LA 2C6YA 2BEOA 4BHCA 3EYIA 3BDDA 2VE9A 3CUQC 1J0RA 4EV0A 4I98B 2XRNA 3DFGA 3RPUA 4RGRA 2JPCA 4NHJA 1XB4A 4S04A 1B1BA 1OR7A 2JTVA 1FYLA 1XCBA 3I59B 3O6BB 2P6TA 1IRFA 3M1EA 1V4RA 4GCVA 2VOPA 4I2OA 5ICGA 1W7PD 2AS5F 2GIVA 2RN7A 3C18A 1JHHA 2W85A 2A68F 2NNYA 3U1DA 3V7SA 4IXAA 2HR3A 4LK1F 2DK5A 2HFHA 1IN8A 3LA7A 3R0JA 1T39A 4I0AA 4A6EA 2P5KA 1XD7A 3F22A 1GVJA 1Z7UA 4UXNA 1YS6A 2P7CB 4PGHA 5DD8A 4KIFA 4KA4A 1R1TA 3BY6A 5FD6A 3AAFA 1IXSB 1QZZA 4TV7A 2VONA 4S05A 3QOPA 2RC4A 3BROA 2R7FA 1I1SA 1XGNA 4OMYA 1AOYA 5LEJA 3E3VA 2EWNA 2ZJ2A 4LD5A 4L9NA 4EJUA 5ILVA 2HQNA 3RIRA 4YIIA 4L9VA 3GUDA 2MD5A 3ABTA 2PJPA 1ZN2A 5LGNA 4I09A 4M9ZA 4G94A 5LGTA 5J8CA 1LQ1A 3MZYA 4O5VA 5FB2A 2IW5A 1Z9CA 4ZZLA 3BJOA 3HUGA 1BBYA 1P92A 5KK1A 4EM2A 3KLOA 1BN5A 3LSTA 1V3FA 4HF0A 3QP5A 1PUEE 2QBYA 2MH2A 4MNUA 4UNOA 1FYMA 2E7WA 4G8XA 5L3FA 2V1UA 4JQFA 3K9TA 1SD4A 2HYGD 1FWZA 2OZ6A 3RYRA 1J75A 5JR3A 1IW7F 2J5OA 3KP2A 4KN7X 2QLZA 2O61A 3EQLF 1I5ZA 2KIUA 3LFKA 5ILSA 4M6XA 3TKYA 2CWEA 5D5VB 1FZPB 2FBIA 2P5VA 1GHCA 4ZZDA 3JTGA 4HX8A 1RUOA 1HKTA 1WWXA 4UVAA 2K86A 2LKPA 1G3YA 4D0PA 2HKOA 1J9IA 3IL2A 3IWFA 3SXYA 3VODA 2VE8A 1A04A 3MEXA 5D5UB 2L02A 3FHZA 1HXDA 4H0EA 4MEYF 2KJBA 1WSUA 3FXQA 3V8JA 5JVTA 5ICFA 3JAMK 2DQLA 2GZWA 3IRRA 4OOIA 1Z6RA 4EGYA 4KMUX 1SMTA 3EUHA 4A0YA 1ZG5A 2M8EA 4OMZA 1SD6A 3OV8A 5HS9A 2UXNA 1Z91A 1R5HA 4L9TA 4EQQA 4KNYA 1UHWA 2GA1A 3GEZA 5F1RA 2WWYA 5DCFA 2VC0A 4RB1A 2IRFG 2W25A 3E97A 2DLLA 5DD4A 1RUNA 3TGNA 2XUBA 1G3TA 1T2KA 4CZZA 1SFEA 5D8KB 1XSDA 1W7PB 1D8JA 2M45A 2L01A 4FX0A 2K4BA 4EJWA 5FFXA 2XAFA 3LA2A 2JSCA 2G7UA 4R8HA 3KP4A 1ZRDA 2EFOA 2HQRA 5E8IA 3ZP5A 5EEGA 4PDKA 5F64A 4CICA 2MLKA 1WKMA 2GAUA 4G6QA 5FLXZ 3WE3A 4Z2YA 5E20A 1I1GA 4FHTA 2PG4A 4OIQF 2QQAA 2DFIA 2YX4A 1CF7B 2CFXA 3JSPA 2ISYA 1SMYF 2EB7A 2V9VA 4G9YA 4GO1A 3IRQA 3MZHA 4P55A
chains in the Genus database with same CATH superfamily
1O3QA 1X3UA 1ETYA 1FY7A 2MUNA 4Q47A 3MQ0A 4ZYHA 2LR8A 4XLPF 2OBPA 3GFJA 5GTIC 4QTRA 2BZTA 4BYYA 1ZR4A 1I3QJ 2WADA 4F52A 3I54A 3HSEA 1LPQA 4P9UA 2Z3YA 1JJ8C 3QPLA 1FT9A 1PP8F 5D5XB 1TQMA 1MSEC 1BJAA 1LVKA 2L54A 3GTJJ 4DYCA 2ME6A 1RESA 2HGCA 1H8AC 3HEFA 2X51A 3PFYA 3LSKA 4HQMA 2FSWA 2VQGA 1BI1A 4ESBA 1ZK8A 4MLOA 2L0KA 1RETA 1IV8A 2E36A 2FQ4A 2Y9ZA 2EV5A 1Y8QB 2DA4A 1BOBA 5ILUA 1VI0A 2V1DA 3FXRA 2MGQA 2ADUA 2VJJA 4CGZA 3DU6A 2XGEA 2VJ5A 2EINH 4LLGF 2QENA 4C3HJ 1ZG1A 3IHUA 2WV0A 3CZ6A 1YS7A 2GBYA 2VIXA 1Z67A 4WX9A 2W57A 4HEA2 2A61A 1R4MB 2HZDA 3GZ6A 2IS1A 1XTAA 2KKOA 3BG3A 1JGSA 3R6SA 2HKXA 3CMAI 2BY0A 4BE1A 1Y8RB 3HOXJ 1SVOA 2L4MA 3UNGC 1Q1VA 3HOVJ 4II3A 3SQNA 3VYTB 1ETKA 5IYDJ 2DFEA 2FF4A 1MDMB 4BY7J 4F7ZA 4B44A 3VB2A 1TT5B 3DF8A 2QQBA 3WU2C 2DA5A 3H0DA 3CJNA 4UHTA 5GADJ 2L9RA 2YSRA 4N9HA 3L9FA 2I5UA 2D1VA 1MNEA 1U5TB 3A02A 3J81K 4HV5A 2Z16A 5EG0B 2PMUA 3JREA 2LD5A 2OTJI 3A1YA 1IZ1A 1XGSA 3L7WA 5CVUA 1GDTA 2L7KA 1Y1VJ 5B1AH 1YG2A 3P9KA 4P96A 4HDUA 2PJRA 3IWZA 1Y6IA 2F5CA 1E3PA 2NYXA 3D5SC 3MN2A 1D0YA 1SVLA 4IRHA 3SEQA 3SZPA 5E3LA 4B09A 1RNLA 1YO5C 2VJIA 4LG0B 4GFBA 1T56A 5H20A 5M5WJ 1YJNI 3GFMA 1FPQA 1XGOA 2FA5A 3CLOA 5GPAA 4P55A 2XRLA 4CDGA 4WXCA 1K61A 2JA6J 2OF7A 4RAYA 5EEHA 3HKZN 1G3SA 2RVCA 3BR2A 1QO0D 2FRHA 1ZH5A 1GVDA 2R7UA 2UXXA 4BEHA 1FOKA 2VN2A 5E79C 2HOSA 5J1RA 5AONA 5B5EC 1SC7A 1F4KA 4YRVA 2MD0A 2FXAA 2QEXI 2HWVA 4XQFA 2M4KA 1FBSA 1TL8A 4IPAA 2OV7A 3H92A 4AIKA 1IRXA 2DI3A 1J7KA 1FTTA 2KL4A 2QQ8A 1R71A 2XAHA 2NOJB 2TDXA 3QP6A 4BQNA 5CPRB 2NVYJ 2GOXB 5FROA 4A2UA 5K5OA 2JJ7A 1TLHB 3KP5A 3VDXA 3PQKA 3E6BA 1T0FA 1NTCA 2ZFWA 5GAGJ 1FLIA 1B59A 4KITB 2R5ZA 1LDJA 3W2WA 3FBNB 5JLXA 4AVPA 2DBBA 1KU7A 2EV0A 3HPGA 2LBFB 2XGXA 4D5FA 1QZEA 2WA0A 4FASD 3WTTC 4P5OA 1R00A 2E5NA 4WF2A 2GQQA 3CO7C 3K4CA 4CA0A 3ML6A 4YIFA 3CF5F 1Z7LA 4GRIA 4HRIA 4CCLA 1YIOA 1IO2A 2H09A 1U6GA 5DDGA 3QPSA 3CQZJ 2JZYA 5HVQC 1XDSA 2K9MA 1UB9A 2IA1A 4IQJA 4IQ4A 3OR2C 3SDBA 1OMIA 2EFNA 2EBIA 1P4WA 2LG4A 3KPHA 3M8JA 3ZQFA 4EMSA 4AC0A 5ICEA 3HRSA 4Y52J 4ETSA 2VKDA 3NRVA 3OWTA 5FFZA 2VOOA 2KFDA 1F9NA 1W7PA 3ASOH 3D5RC 2L7FP 1QNTA 3C2HA 1B9MA 3DBHB 3A0HC 4L5JA 5A2QK 1BJZA 3LAPA 1ZREA 1OPCA 5K5RA 3F9KA 4XR6A 4XRSA 4MQ9F 5DM6F 4J00A 2YR2A 3GW2A 4WWCA 1ORKA 1YJWI 1ACIA 3QRFF 2BYVE 1P2FA 5K7HA 1A6IA 5J6XA 1ZAOA 4HPQA 1S3JA 4ZYAA 4O3MA 4DZJA 3CO6C 3JAMR 2KP6A 1P4AA 1WJDA 1IN7A 5DYMA 3VEPA 2ETHA 4IVNA 5IOZA 1MW7A 5IY5H 4HAMA 1ON1A 1T38A 2DW4A 4WK8F 3P7NA 1G3WA 2VBYA 4BGDA 3NEUA 9ANTA 2NVXJ 5E1ZB 1VQ6I 2L4AA 3A01B 4NDLA 3A52A 3CCYA 2TRTA 4HW0A 1YX5A 2EV6A 3HG9A 1CF7A 2HTJA 3HSRA 1J09A 1ZGJA 2UUZA 3KLNA 4R79A 2DMUA 4J01A 5TGTA 4KDPA 1R58A 2VT3A 2V26A 1PUFA 1KQ8A 2LDUA 4XNFA 3WG7H 1SD5A 3OYAA 5IT3A 1VQ8I 3F21A 4UV8A 1B8IA 2ICWG 5BNGA 2H8WA 3OSFA 1W0UA 3ECHA 1DUXC 2LRDA 2M8GX 4XRSG 5CYVA 1R7JA 3IC7A 3DBRB 1YIJI 1JJ6C 4HSRA 5D5WB 1R6RA 3MZ8A 4JYKA 4A3CJ 3ULQB 1E3OC 2O5RA 3QWLA 3WTZA 1BOAA 2IT0A 5L3BA 3OYFA 2F5DA 3CDHA 1FP2A 2X6XA 2OQGA 1FX7A 3FXUA 1TWFJ 1BC8C 1SFKA 1G8XA 1O4XA 1HOMA 2DA3A 2XAGA 3G1OA 4NBQA 3BJ6A 2JPBA 1YW7A 1EKEA 2LVSA 1ZGWA 2A6TA 1ZRFA 3JCUC 5E1WA 1KGSA 2KMUA 4M3EA 4BL0B 2KQRA 4XLEA 2CUEA 1Z05A 2CYYA 2K9NA 4Q5SF 3J7AY 1MMDA 1TZLA 4FISA 1U3EM 4ZDOA 4B4CA 1ZARA 3K69A 2O3FA 2F4MB 4BHPA 2V9KA 1TT0A 1KYZA 3ZQHA 4IF4A 3RYPA 4M6VA 5E18F 1Y39A 2XHKA 3ZQ7A 3HOTA 2X6OA 2M2EA 2OU2A 1P7IA 2BE5F 4J19A 4QPQA 2OQRA 4I0BA 4Y17A 3I4PA 4C2UA 4CYCB 2Y75A 2IVMA 2NNNA 1BI2A 3KP6A 2Z1DA 5J40A 2E2JJ 4IHVA 4IRIA 5BPIA 1ZR2A 4Q48A 2HPMA 3S15J 1MDMA 1APLC 4FX4A 2EIMH 2JA2A 4U0VA 4LLLA 2ID6A 1R9TJ 3L2RA 4IKFA 3QQAA 2QZ8A 5HLIA 3SDGA 3HYIA 3WTSC 3IH3A 2ELJA 2BY2A 1X4PA 2GXBA 3BQZA 3WTWC 1K78B 4LB5A 1WQ2A 1U5TA 2CH0A 1P4XA 3ZN1A 3A03A 5EG0A 1OCTC 4PCQA 3ZMVA 5E8GA 1XN7A 4U88A 1MGTA 3FX3A 1OYIA 5ED4A 4E7HA 2P5LC 1PVEA 3C3WA 2X1EA 4LB6B 2LF8A 4LG0A 3K4BA 3CLQA 4M6YA 3I58A 3CDLA 1IN6A 2ZXIA 2VC1A 4UV9A 4LMYA 4EM1A 5K1YA 3D5LA 3IKVA 5LGUA 1IUYA 2VXDA 1W5SA 3TEDA 4JX4A 3KEYA 3DKYA 3VWBA 3DU5A 3M4OJ 1EF4A 2NAZA 4KT5C 1IN5A 1VF9A 4DQ2A 2PMHA 5HDGA 5IPAA 3EPZA 5F08A 4ENMA 1OCZH 1XSVA 3Q0UA 1LVAA 1A36A 1QQIA 2WC2A 3CCMI 1T98A 3K0LA 5J1YA 3TOBA 3KZZA 3H36A 3R0AA 5B66C 1EJ9A 2JQ7A 3QU6A 4FT8A 4L0YB 2ZSHB 4U87A 1UELB 5J3LA 1WJAA 2XB5A 2ZMEB 5GAHJ 5HOOA 5K7FA 1HSTA 3DQVC 1JE8A 1TW3A 1CGPA 2B0LA 5DM7F 2BXYA 1YYVA 3M07A 4GGGA 4RAZA 3GVAA 5HDKA 1OKRA 2A5YB 2CGPA 1S7AA 4RA2A 1N77A 2KT0A 1QVUA 1WFXA 1Z77A 1E3HA 3F8CA 2LBFA 2CW7A 2GA2A 2QWWA 1BW6A 3KP3A 3Q3SA 3PSFA 4XORA 3J81R 2XGCA 4NC8A 1P9QC 2FE3A 2DDAA 4DYQA 3JSOA 4IHSA 2K85A 3HC7A 3IKTA 3ZMDA 3J7YJ 5IOYA 2BOLA 3FXLA 3DLLF 2IAIA 4E7KA 3HKZA 4N0BA 4X6AJ 3RQIA 2FNPA 1POGA 4MGRA 3BT9A 2HOTA 1U9OA 2FJ1A 1J59A 4FE7A 1BR1A 3I53A 4NQWB 5LEKA 2A6EF 3OYKA 4IOCF 4A69C 4N9IA 4PSXA 4CXFA 3N97A 3HBLA 5HDNA 3RZOJ 1S8NA 3F6VA 4HYEA 4DIQA 1ZYRF 3OIQA 2GWRA 3FMRA 3L2CA 2WY8Q 1KONA 3RI4A 2EA4A 3KFWX 5IYCJ 4UUVA 2A5WA 1RIOH 1W5TA 2YU3A 1MBFA 4A3GJ 1RR8C 2QSGX 5EGOB 3KYLA 1V5GA 2F6CA 3DPTA 2DA7A 3MCZA 3JRFA 4EVIA 1WJCA 2BY1A 3FDYA 1AA7A 2VBXA 4A0XA 1OYYA 1FEXA 2NXNB 2M4GA 3V7RA 1YRNB 3CP2A 1BR2A 2WBMA 3FM3A 2DJIA 2KISA 4UUSB 4I01A 4YG2F 3BJAA 1YFHA 2HXIA 3C7JA 1HQCA 1A35A 3K4LA 2F5EA 2Q2EB 1GV2A 1JKQC 1ETXA 3I5UA 1F1ZA 1YW9A 3T8TA 1HW5A 1JHFA 1MIJA 3LSIA 3HIFA 4RB0A 2LMDA 1SFUA 3S2WA 1WI9A 3I59A 2JMWA 3CC7I 3G4SI 1JXSA 3OS0A 1AKHB 5FLXK 3A01A 5F0CA 5EZHA 4W1UA 2VQHA 3FBIB 2CG4A 5TJJA 3REOA 4HLXA 3M9AA 1C0WA 5IYBJ 4RAFA 3I55I 2E7XA 4XOPA 4D7NA 3FHNA 2V1NA 1FP1D 2QQ9A 1HKQA 4BBRJ 5E3NA 3B6CA 2R7DA 1HCRA 2CW0F 3RKYA 1JTYA 1MKMA 5JLWA 2NVQJ 1MZBA 2VB6A 3NWTA 3DPLC 1PYVA 2EZIA 2EILH 4M3DA 1XMAA 4RDUA 1OCCH 1W1WE 3KZIC 2LY9A 1K79A 4YEJA 1KA8A 3VOEA 5TISC 2R7SA 3PIOF 4ZYGA 2IA2A 4EGZA 1RKTA 1UMQA 2FOKA 2LYCA 3CCUI 4V19K 3BG7A 4RB3C 2BGCA 1H9GA 1UCRA 3HHGA 1JT0A 4B8XA 3BTJA 3H9QA 2I8DA 4O6JA 5L3CA 2UWMA 3SFIA 3T8RA 1S7OA 1R22A 1XGMA 5KAIC 3GLXA 4D9JA 3F23A 1IN4A 2PMZA 4IOAF 1IDZA 2KZVA 2PLYA 4M73A 3RKXA 2DMTA 3EETA 2L7ZA 4ENJA 2XSJC 2FMLA 5L3EA 2HDDA 1MMAA 1LKXA 4IL6C 3HGGA 2W82A 2E2HJ 2VKVA 1RQ6A 5F04A 5J8FA 1SANA 3Q9SA 4AM3A 5IT9Z 1DU6A 4RB2C 1MNDA 2KJCA 3OYBA 1FSEA 4UVBA 4MFEA 4BE0A 5IP7J 2H27A 1X19A 5FJ8J 5BQTA 4MFDA 2X1DA 1N75A 4RGUA 1P6RA 4B43A 4CYCA 4P9FA 2MH9A 4LIUA 4B1RA 1VQKI 3A0BC 2XF6A 4XKWA 2E34A 4CH7A 1EH6A 3ZN0A 4ZC3A 2QYOA 3GTPJ 1WGXA 1MSFC 2VI6A 2DQRA 2DT7B 2OC6A 3GBGA 1LB2A 4XSZF 1YOVB 4D1QA 3KEQA 1O3RA 1CQTA 2EK5A 3G1MA 2G9WA 1UG0A 2MG4A 4LGWA 4G7OF 3S1NJ 4CCNA 3AG1H 2CV1A 2X0LA 3Q9VA 3ELKA 3CCVI 3OSGA 1WJFA 2X85A 2QVOA 3TL4X 4F93B 1S72I 3M8FA 4BXUA 5LHGA 3RDIA 2XVCA 2L3DA 4ZYEA 3EYYA 1HW2A 1SAUA 3PO3J 3HB9A 1VQOI 3F8FA 3K7AJ 1ENHA 5B1BH 4OU0A 4XRFA 4ZYDA 3I4NJ 3T1BA 1R4NB 2BVMA 5D4RA 3K70C 1JKPC 2MC4A 5D6EA 3ZR8X 1HDDC 1DU0A 4JX6A 3O2PE 3ZMZA 3SYTA 2KDZA 5CVIA 2W48A 3OYIA 1L3LA 2Y48A 1E2XA 3HRUA 1ETOA 1OR7C 3BZKA 5CQEA 3U1KA 1Z3XA 4BKXA 1AWCA 2AXTC 2D2WA 2KLOA 4A3FJ 1YI2I 3WU0A 1YX3A 1DP7P 1XDUA 2XIGA 4CHUA 2JN6A 2DOFA 3TDUC 4NB5A 4MHGA 1VQ5I 2XASA 3OYNA 1DPRA 1ONVA 3L2VA 6PAXA 2VPLA 4XSXF 1IGNA 2H94A 2DPDA 2QSFX 2STTA 1GUUA 3V7CA 1B8IB 3OOUA 4YELA 3M8EA 1R5GA 1TW2A 5FGMA 3J7AW 2RNJA 2KZGA 2W24A 2YUSA 3CUOA 5JHFA 3ZQQA 2ZMEA 4M9SA 3MD2A 4XN3A 3COAC 1SVMA 4DJAA 3S1QJ 2R7OA 2DT5A 5C3EJ 2EFQA 3F72A 2CMPA 5EYRA 1JTXA 5HLHA 3SFZA 3FK7A 4HF1A 4BE2A 5FRNA 2DODA 1NHAA 1PJRA 3E0JB 3LSRA 3J7AO 1BL0A 5FLVA 4CO8A 3FWEA 4AIHA 2HQAA 1R1VA 1FBQA 5BS6A 2H8RA 4BJ6C 3NARA 4RM3A 3E5UA 4YFKF 2GXAA 2BHYA 1EA3A 3JRHA 2ZC2A 4HDVA 2CQQA 1BIBA 3H3UA 3HPHA 1RRJA 4XIDA 4IHXA 1HKSA 2O0YA 1B4AA 4HSTA 2HZTA 1RI7A 1W0TA 2LY2A 3AG2H 3FMSA 1MD0A 2ELHA 5AIPA 4A3DJ 1HBXG 4AU7A 2CUFA 3KZYA 4XKCA 3DKWA 2NRAC 1P7JA 3K1MA 3LA3A 3HTUA 4ENNA 4L0ZB 1O7FA 2K5CA 2V79A 3FXOA 4JOMA 4NQWA 4ASNA 1F5TA 3H35A 4M72A 1H89C 3K2AA 5KAFC 4BH9A 3MKYB 1Z0XA 2A07F 3X2QH 2A69F 4BUPA 3G6EI 1NG7A 2QF7A 2ZJPF 1ETQA 2VASA 5EGOA 1TWGJ 3Q0VA 3H3ZA 1JKOC 4LFUA 3CTAA 3BG5A 1WZ2A 2CRGA 4A3EJ 3CUQB 2OZUA 3GFLA 5EF6A 3LMMA 2ID3A 4RGSA 2LNBA 2P4WA 4A3JJ 3F8NA 4OINF 1E0EA 3MMYB 4UUSA 4XLCA 4PJNA 1BR4A 1NK2P 1ZLKA 1JUPA 3CMYA 2HEOA 5K5QA 3HGYA 4JK1X 3H9GA 1U8RA 2F5FA 4HF2A 4PFPA 4A6DA 2Q2EA 3WHCA 2G7HA 2GOMA 4ZJZA 5C4JJ 1F43A 1UHSA 3D0SA 1MBJA 5J4VA 1DQUA 1QGPA 1J5YA 2CQKA 1AKHA 1PDNC 1W4MA 3BLYA 2PFBA 3ABUA 2EJRA 2R7RA 2AHQA 4R1HA 1G4DA 3V8KA 2KRFA 2P8TA 4AIJA 2O03A 3BR5A 2EPFA 1REPC 4ITVA 4LLNA 3WTXC 1XSXA 3RZDJ 2DPUA 5J4YA 5J1UA 2HPIA 1FMWA 2EZKA 3DXJF 2M1BA 4EJTA 3GX4X 1MMNA 2FX0A 2JVGA 3U9GA 3LSPA 5LD2C 4PJLA 2NVTJ 2R7VA 2IP2A 5E17F 2E1NA 2R7XA 1IC8A 3WGGA 5KCMA 4IHYA 5LHHA 3CCJI 2D45A 2Z33A 1YW8A 2HYFA 3KETA 3CCLI 2E1OA 2OAZA 3PUFA 3QPTA 3LL7A 3E1SA 3VFZA 1KU9A 3DTEA 3ZQCA 2KIFA 3U2RA 3DEUA 1Y56A 3TW6A 1IF1A 1BA5A 1ZKGA 1U9NA 1FJLA 1HA8A 1XCVA 4AD9A 2PMZN 1TNTA 2BW3A 3G2BA 3T0YA 2Q0OA 3ZMUA 3ABMH 3RTRA 4A3IJ 3HOUJ 5CVJA 1BM9A 4DW6A 5LRRA 1FIAA 4II2A 4XL9A 4IX7A 4Y33A 2LKXA 3J80Z 1LFUP 4UY8I 3M7GA 3GTQJ 1LNWA 2LLKA 3ZCOA 2BVLA 3I9V2 3S17J 3GWZA 2M7BA 4FE4A 2NS0A 3S8PA 4MEXF 2LSOA 3W6JB 2XROA 2HQ5A 3KCCA 1I50J 4D5CA 1M1EB 5H6RA 2VKHA 1RPWA 3WTUC 1W5CC 4M3BA 1R1UA 2VKEA 2XKOA 3L09A 3V42A 2OCCH 3LSGA 3WODF 2R93J 1BI3A 1GV5A 2ESHA 2BBYA 1YLFA 2W84A 3IP4B 3TDZC 3KP7A 4QLCU 1Z6TA 5FLXR 1U8BA 3F3XA 1ETVA 2E1MC 1X3WB 2COBA 5DUKA 4WXHA 3FMQA 2COMA 2WB1A 2HU9A 4N4OB 2Q8KA 2R3SA 3OIPA 4BY1J 1IV6A 2P6SA 2VQCA 4XLFA 1QPIA 2NOGA 4HG2A 3QYBA 2DO7A 1TWAJ 1XX5A 3MWMA 4IO9F 2MSYA 2YX7A 4OAYA 1UFMA 5H6QA 2D1HA 2JRTA 3HJEA 5LLQA 3HOWJ 2FQ3A 3CC2I 5A2QZ 1MBEA 5BOXA 1D1BA 3QYFA 2XF7A 4LOCA 1O3SA 3H5RA 3PSIA 5DUIA 4U0WA 2MBFA 4E70A 3OR1C 3F0CA 3LAJA 3U21A 3CDIA 1X1PA 2JK3A 2K02A 3E5QA 3QAHA 5HNHA 1VQMI 2LK2A 2OA4A 2JA7J 2ECBA 4KISA 1RZ4A 4PZJA 1TTYA 3A2KA 2E1CA 2LC2A 3V4GA 2E60A 2E35A 3HHHA 1X58A 3N4MA 5J47A 3RPUD 3SZTA 2M9HA 3EUHC 3W6KB 2Q1ZB 1BIAA 4ZDLA 2NS7A 3NAUA 3WHBA 4KN4X 5KNLA 3FF5A 2OPTA 4FTHA 4G7ZF 2OUMA 1KQ9A 4BQAA 2J5PA 3B02A 2CQNA 4YIRX 3GYHX 1QRYA 1T6SA 4G6DA 3GZ5A 2ZKZA 2IXSA 3MKZA 3ESWB 1FC3A 4I76A 3L00A 5BPDA 4MTDA 4HX4A 3DP7A 1B72B 4OIRF 1K6OA 2MZ4A 1XG1A 2HXOA 3TO7A 5CVRA 5JI6A 2X9DA 1IDYA 2XV4S 4NC7A 1G6NA 4HX7A 5LHIA 2HOEA 4ESJA 3KEOA 1L0OC 3S3MA 3WG9A 1A31A 3LSMA 4PFOA 2KRCA 3K1PA 1IAWA 5D6FA 1B9NA 2Y2ZA 2H1KA 5E1XA 4HBLA 2M5WA 4BDYA 1VQNI 3BR3A 1QBJA 1K6YA 3JR9A 1ULYA 2DK8A 1VQLI 5GAEJ 5CLSA 2IJLA 4XONA 4YFXF 3M3YJ 5CKTA 5CVVA 5HS8A 2F2EA 3LSHA 3L2QA 1HSJA 1BI0A 2EIJH 1KU2A 3FIWA 2DOEA 1T95A 4MQVA 3JRIA 4N4NB 3R60A 4DBRA 3WGIA 3MVPA 2ACJA 2QUFA 2CSOA 2UZKA 4F91B 4RS8A 1PP7U 4ANJA 4BJ5C 3CJTB 3W2AA 2Z2SB 4L5EA 2ZXJA 2GIZA 1S5LC 3WU1B 2R4GA 3ZQLA 2KDOA 1LUJB 3BPXA 2Y69H 4F55A 3PFIA 1ITYA 2DTRA 4W97A 2ESNA 5D8LB 4DZPA 3HTSB 4G12A 5EEAA 3I64A 3BP8A 4MTEA 1ZLJA 3OOPA 5JHUA 4BS9A 2PN6A 2HDWA 1S9HA 4GXOA 2DT6A 2VXZA 1T08B 3MKWB 4JP0A 2V1XA 1QPMA 3CMMA 2RREA 1LJ9A 3GTGJ 2DMQA 3K4JA 4JBAA 1LDDA 1Q1HA 3ZQIA 1FOXA 3OY9A 1YITI 4OIOF 4Y13A 2P0TA 3IV5A 2WAEA 4RAGA 3HRTA 2CQ7A 3G3ZA 2FMYA 3CC4I 2GM4A 3LQQA 3QYEA 1E17A 2PX9A 4CCKA 1YHQI 2A3SA 2IGNA 3CUQA 2M0MA 3DV8A 4KT6A 4ZDPA 3ABLH 5C4XJ 1Z1DA 4U7BA 3V8LA 3O8GA 4GYGA 2VT2A 3DKXA 1V5EA 4DOZA 3F8BA 2CUZA 2RDPA 4BNCA 5EZGA 2B63J 4GYIA 2RAEA 4IJAA 3VYSB 4D7MA 3S2HJ 3FXKA 2FOWA 1LDKB 4C3IJ 2F4OB 1U2WA 2EZLA 2I10A 3TP3A 1MJBA 2L2OA 3GXOA 3OYDA 3E6CC 4I7HA 3WE2A 5F6FA 3GFIA 2JUCA 4ZTJA 3C2GA 5HS7A 4BXFA 1HLVA 2QKMB 2HDCA 1UAAA 2FBKA 2Y0MA 2A05A 1MNMC 3BWGA 3LWFA 1H0MA 3VSKA 2XPWA 5EJCA 4BU2A 4LJZF 3RPQA 2RKHA 1FYKA 1WJ5A 3HOYJ 3BTIA 5HLGA 3GZNB 4QWQA 3ZMTA 2DOAA 3QPHA 4EJVA 2PBIA 3G73A 4BXXJ 3BZ6A 1ZGAA 2R5YB 1HF0A 1TWHJ 3FXMA 1YQAA 1MJAA 3FKIJ 4A5MA 4M3FA 2V7FA 1G59A 2M30A 3JW4A 2WV1A 4XICA 3H1CA 3WTVC 2M87A 3E6DA 1D3YA 2HTSA 4ESFA 1I6XA 4KICA 2YPRA 2A6HF 2WTEA 2ME0A 1S6LA 1R5ID 2DFHA 4L9JA 5FKNA 1SAXA 1ZTRA 2V4JC 3GO5A 3I71A 3UKGA 1S7EA 3E6MA 4HV6A 5M5YJ 3BOQA 1MBKA 3KX2A 4Y15A 2RV8A 1O57A 3WTYC 3O3KA 3KE2A 2H1LA 5LRSA 1Y0UA 3IH4A 4Q4ZF 4ENKA 1D5VA 5KVRA 1MBHA 4HZFA 3S16J 4X1EA 3S3OA 4DNCA 1DP3A 2JA5J 4YFNF 2WB1N 1F36A 1S29A 5IT9K 2X6WA 1X4OA 2G0EA 1GXQA 3UR3C 3CCEI 2DN0A 3BG6A 5FKLA 4UB6C 1D5YA 3BC8A 5DS9A 2B7EA 3C1DA 3Q5FA 1FMVA 5DCMB 1EV7A 1RKWA 2QCOA 4EJOA 3QU3A 1VTNC 2QSHX 2XPVA 2ZCWA 3GF2A 4LK0F 2CFOA 1X1DA 2X98A 1GLNA 2PEXA 2DCEA 2ZNYA 2R7QA 1KYWA 2ZNZA 3ZQGA 3TO6A 2XSDC 2K40A 3H0GJ 3EUAA 3JAMZ 1MJ9A 3DCFA 5L3GA 2IA0A 2MC3A 1J2XA 2RQPA 2LOOA 1IRZA 2BHZA 3OYGA 4CCOA 4KIGA 2W00A 4A0ZA 1FNNA 1QHGA 1LEAA 2Y9YA 1T0FC 3OYHA 4OIPF 4C9YA 3TQNA 2M34A 2ZO4A 4E7JA 1USSA 2JWTA 4XKVA 5AIQA 5F0HA 5DEQA 4KJZA 2W4SA 1ZRCA 3MAJA 3NWSA 4XLAA 5BMZA 4F92B 4KYWA 2M35A 2Z99A 4L5IA 4WCGA 3PQJA 2UV1A 4RLQA 1V5FA 3HOSA 1KQ0A 2DU9A 1H9TA 3FXJA 5D4SA 4KMFA 3ZMSA 3W2VA 4CCMA 2F4IA 3F6OA 2LP0A 2GXGA 3WGHA 3K4MA 2JT1A 2M3AA 5LFAA 1EH8A 2EIKH 4FCYA 1QA6A 2LY1A 1QZYA 5DV5A 4E7ZA 1HC8A 5F0FA 1B72A 2R92J 2XAQA 3K2ZA 4HNVA 4KUMA 4C2MJ 1STZA 4BHBA 1DPUA 2H6CA 2AQFA 4ZH4F 3HL2A 4IHWA 2FEZA 4A3KJ 2XB0X 2ISZA 3JTHA 3JRBA 2XAJA 3ZPLA 2XF5A 3R4KA 2HVSA 2JSPA 2KRHA 2HS5A 3DLAA 1K78A 1VNDA 1XMKA 2RQQA 4S0HB 3AG3H 3T5XA 4A93J 1FOYA 2FD5A 4EATA 3KYCB 5JVGF 1WH5A 2D5VA 1D0ZA 2K4JA 1GXPA 2JUGA 1ZHFA 2KPMA 1IXCA 1TBXA 3RSNA 1HW1A 4HQEA 4EEFG 3PIPF 1A5JA 2EA2A 2B9SA 1WVRA 2MYSA 3FKJA 2DYRH 3J7ZI 3DBLB 3IAM2 2F48A 4HA8A 3RCOA 5M3MJ 1I27A 3BPVA 3TO9A 2O8KA 2YU9J 2EFPA 1YTYA 1LE8B 4M74A 1R36A 1TQPA 2H6BA 3F8MA 4ON0A 1FTZA 1TC3C 2RNGA 2ZFUA 1DGRM 2CS3A 1ON2A 5FO5A 2BV6A 4LG3A 4PK4A 3SHFA 5HLTA 3OYLA 3ECOA 4FQGA 1FSHA 3PNVA 4F3QA 5K7ZA 2AO9A 3LQRA 3MKLA 1WRJA 4V2FA 1R23A 5KHDA 2AQEA 1SFXA 2F5VA 1DDNA 3HDDA 3ABKH 1KU3A 2P7VB 3CJRB 3R61A 5LBQA 1LEBA 2MFZA 3AL0C 2CO5A 4OWRB 4BAYA 2MW8A 3H3VK 5FKOA 1EH7A 5FRMA 4CSWA 2EQRA 1SD7A 2QKLB 4C3JJ 1TNSA 2R7WA 1FBUA 2PI0A 1ETWA 1KZHA 4WXDA 4CYDA 2HVRA 5GPCA 1FOWA 1V54H 2XDVA 4EM0B 2VJ4A 2FUG2 4HLYA 2VUMJ 3BCBA 5JFRA 3P9IA 1ZG3A 2N8GA 4G7HF 4PGGA 2L9NA 1Y1WJ 4KFCA 1MMSA 2LREA 2WAQN 2DMNA 5CQGA 5F1JA 2VBZA 3ZXSA 2PQ8A 4U0YA 2XKPA 2DMPA 5IP6A 2JRMA 3CESA 3L2WA 5TRDA 2ZBKA 3DEEA 2FNAA 2MA3A 2K7LA 3I0TA 1YE9A 3ISPA 3DEWA 3K1NA 2K9LA 1B6AA 4XLNF 5EDNA 2O6GE 4Y3OA 2VODA 2K27A 5ICCA 3P9CA 3HUGB 1TQIA 2AXLA 2O8XA 3DWLE 1RC9A 3OL4A 4HNUA 2R0QC 1K4TA 2STWA 5M5XJ 4L18B 2QBYB 1OYWA 2R5YA 5B3SH 2VBWA 2OD5A 1D1AA 3HRMA 2DAOA 3HZJA 1U78A 3B73A 4DBQA 1YRNA 2DJNA 1O3TA 3NQOA 3ASNH 1UG2A 4PSWA 4QSHA 3CF2A 2FU4A 2LTPA 1JT6A 3J81Z 2XGDA 4AWXB 2LF7A 2IGKA 3MFKA 2IPQX 2M0CA 2EFWA 4U7DA 3HM5A 3PJRA 4KIBA 2RGVA 1N25A 1WH7A 4PJMA 2XC7A 4RLFA 3TBIA 5L3DA 2JA8J 3C2BA 2V6CA 4PUSA 4A5NA 1U5TC 2MVTA 2QA4I 2O9LA 1IJWC 1QVTA 2LH9A 1ZELA 3HSFA 4NUBA 3RJPA 3TOAA 1LFPA 3FZVA 4G6TB 3RKWA 4XKBA 3JRAA 4A12A 1OCPA 4AYBN 4XRMA 3J80K 4I02A 2KIMA 1NK3P 3CCQI 2DA2A 4M9XA 1WCMJ 1ZQ3P 1U0JA 3EDPA 1WPKA 3VYUB 3FM5A 1D8KA 4IHTA 4AIDA 2E71A 2Z5UA 4GDFA 3ROUA 2E5ZA 3BZCA 5ERIA 2HVQA 1Y0NA 2FBHA 3SJMA 1ODDA 3E5XA 2IS6A 2E1MB 4K2EA 1IRGA 1USTA 1BC7C 4Y7NJ 3O8HA 4IRGA 4XBFA 3OYMA 5IP9J 4DGWB 2IEKA 1V55H 4BDZA 1K7AA 2Y30A 5DCMA 4JX5A 2CU7A 3IH2A 3KIOA 2MLGA 3GTOJ 2NVUB 5FD5A 2VQLA 5CJ9A 3S32A 2BY3A 1WHUA 2QM3A 1IXRC 1MMGA 1UHMA 4UVCA 4HOBA 3S2DJ 2HYJA 1X2MA 1TP4A 2DTZA 2WAFA 4M71A 4BACA 4P1WA 3LSJA 3ERED 2Z9OA 4RGXA 1O7LA 3PUBA 2X6YA 3OIOA 2C6YA 2BEOA 3D1NI 4FETA 4BHCA 3EYIA 3BDDA 1WJBA 2VE9A 2K9SA 3CUQC 1J0RA 5DTDA 4EV0A 5H2FC 4I98B 2XRNA 1X1CA 1H88C 4XOTA 3BR6A 4PJJA 3DFGA 3RPUA 3I56I 4IZZA 4RGRA 3BG9A 2JPCA 3A4CA 4XLHA 1XB4A 4NHJA 4S04A 1B1BA 3ZOBA 1OR7A 4HNTA 2JTVA 1FYLA 1W36C 4A3BJ 1XCBA 3HXLA 2L9VA 3I59B 3GTMJ 2OJED 3O6BB 4E7LA 3W6VA 2ZXHA 2LFBA 2P6TA 4NC6A 4BJTA 2DA1A 1IRFA 3M1EA 1JUSA 1V4RA 5HNFA 1VQ9I 1X1BA 4GCVA 4XK4A 2VOPA 4XM3A 2IBDA 5IT9R 2ZJQF 4I2OA 5ICGA 1W7PD 2AS5F 2CV2A 2GIVA 3OS1A 3ZGKA 2RN7A 3C18A 3H5AA 1JHHA 4OAZA 2W85A 1IG7A 4UB8C 3HOZJ 2A68F 3JRCA 1JI8A 2NNYA 3S93A 2V9PA 3U1DA 1XS9A 3V7SA 3OS2A 3OMYA 3CCSI 2P0WA 1VZ0A 1YJ9I 4IXAA 3PM1A 2OCEA 3K70D 4BBSJ 2HR3A 4LK1F 4RMNA 2DK5A 2HFHA 2W7NA 1BW5A 2Y0SA 1IN8A 3G1LA 3LA7A 3GLLA 3R0JA 5FKKA 1T39A 3DPUA 3RKQA 4I0AA 1LE8A 4A6EA 2P5KA 1XD7A 3F22A 3K6GA 1GVJA 1Z7UA 3CJQB 4UXNA 1YS6A 1ERDA 3S1RJ 3AFHA 2P7CB 4PGHA 1UZCA 3BTLA 5DD8A 2IS4A 4KIFA 4KA4A 3OL3A 1IUFA 4AUXA 3S3NA 1R1TA 3BY6A 5FD6A 2DXIA 3AAFA 1Z3YA 1IXSB 4E6KG 1N78A 1QZZA 3K4KA 1OJLA 4XMYA 1XC5A 4TV7A 3SEZA 2VONA 4S05A 3QOPA 2RC4A 3BROA 1DGWY 4XN0A 1D1CA 2V6EA 4Y4RA 2R7FA 1QU3A 2XPUA 2IS2A 4E7SA 2HOAA 1I1SA 1XGNA 4OMYA 4A3LJ 1AOYA 3KYDB 5LEJA 1T8IA 2L9SA 3PNTA 3E3VA 2EWNA 2ECCA 2ZJ2A 3OYEA 4LD5A 4L9NA 4EJUA 3JRGA 5ILVA 4UUTA 4I6ZA 2HQNA 3RIRA 4YIIA 4L9VA 3GUDA 2MD5A 2VLAA 2ELKA 4E7IA 3S1MJ 3ABTA 1X2NA 3H9JA 2CJJA 2ZB9A 2R7TA 4BQOA 3ERMA 2PJPA 2CW8A 1K4SA 1ZN2A 5LGNA 4B48A 2KIQA 1SEUA 4I09A 4M9ZA 4G94A 3BTCA 3CP8A 5J8CA 5LGTA 3MZYA 1LQ1A 1VQPI 4O5VA 1UJ8A 4B3AA 4CCJA 3L2UA 5FB2A 2IW5A 2YS9A 1Z9CA 4ZZLA 3BJOA 4RM2A 3GTLJ 5FKMA 3HUGA 1BBYA 1P92A 3BCAA 1A6QA 4MIMA 4I99C 2QGUA 5KK1A 4EM2A 3KLOA 1BN5A 2ZXWH 3LSTA 1V3FA 2HNHA 1VQ7I 4HF0A 2E2IJ 3QP5A 2TCTA 1PUEE 2QBYA 1OQYA 2MH2A 4MNUA 1QHHD 4UNOA 3S14J 1FYMA 1NG6A 2E7WA 4G8XA 5L3FA 2GLOA 2V1UA 4JQFA 3K9TA 1SD4A 4BQQA 2HYGD 2Y31A 1FWZA 4B47A 2OZ6A 2L5QA 3RYRA 1OCOH 2WY7Q 4C30A 1J75A 5E3OA 5JR3A 1IW7F 2CV0A 2J5OA 3SZGA 3KP2A 2BXZA 3IAS2 1VFCA 4KN7X 2QLZA 2WAQA 1AU7A 3PO2J 3EQLF 2O61A 1D0XA 1I5ZA 2KIUA 2PJRB 3LFKA 5ILSA 2LKSA 4M6XA 3TKYA 1T33A 2CWEA 3FISA 4QIWN 5D5VB 2FBIA 1FZPB 3I4MJ 2NS8A 2P5VA 3OYCA 1GHCA 2CUJA 3K4NA 4ZZDA 3JTGA 2K3PA 4HX8A 3PNYA 1RUOA 1HKTA 1OCRH 1WWXA 4UVAA 2MABA 3LNQA 2K86A 4IEJA 4H4KC 1K83J 2K9QA 2LKPA 1G3YA 3GMEA 4M3GA 2HKOA 4V2GA 4BEHB 4D0PA 3CMEI 1JGGA 1J9IA 3BR0A 3IL2A 1LFBA 1I39A 1R49A 3IWFA 1VQ4I 3SXYA 3E7LA 4CZCA 2K3FA 3VODA 1WI3A 1OISA 3CD6I 3OYJA 4RBOA 1XMXA 3GCMA 2VE8A 1A04A 3MEXA 5D5UB 2L02A 4NNJA 3FHZA 1NH3A 4C2TA 3BQYA 2EZHA 1HXDA 1AHDP 4H0EA 3JRDA 4MEYF 2KJBA 1TWCJ 1RR7A 1OLTA 1I3AA 3VPRA 1WSUA 3FXQA 3V8JA 3IUOA 1HDPA 2HI3A 3P5JA 5JVTA 2E19A 2ZMEC 5ICFA 4DYRA 3EUKL 4X0GA 4PJ0C 3JAMK 3VYRB 2DQLA 2GZWA 1X1AA 3IRRA 2P81A 2VL8A 4OOIA 4AVZA 2R5ZB 1Z6RA 4EGYA 2M7AA 4CUGA 5M3FJ 4KMUX 4A3MJ 3QOEA 1MH3A 3W3CA 1SMTA 1X3ZB 3EUHA 4A0YA 1ZG5A 2M8EA 4OMZA 1SD6A 2O7OA 5GTHC 3H5NA 3GTKJ 4AYBA 3OV8A 5HS9A 1W36D 2UXNA 1Z91A 1SFOJ 1R5HA 4L9TA 4EQQA 4E4HA 2DDBA 2W1OA 3AG4H 3DTKA 4KNYA 2ZJRF 1UHWA 3ONQA 2GA1A 3J80R 3GEZA 3K10A 2JVHA 5F1RA 3PL8A 2WWYA 5DCFA 2R7ZJ 2VC0A 5E3MA 2ZSIB 4RB1A 2IRFG 2W25A 3E97A 2DLLA 5DD4A 3ZRGA 1RUNA 2X48A 1JUMA 3TGNA 2XUBA 2KHMA 3TP0A 1G2HA 1G3TA 1T2KA 4CZZA 1SFEA 5D8KB 2CQXA 3LOCA 3TMOA 1XSDA 3LFUA 3L1PA 1W7PB 3B6AA 2EH3A 2DYSH 3N05A 1D8JA 2M45A 2L01A 3DTIA 4FX0A 2K4BA 4B3XA 4EJWA 3QODA 3AKZA 2IGOA 5F27A 5HODA 5FFXA 2XAFA 4ZTFA 1I6HJ 3LA2A 4ABZA 2VPRA 4LITA 2JSCA 1GT0C 2G7UA 4R8HA 3KP4A 3VSLA 1ZRDA 2EFOA 2Y0SN 2HQRA 5E8IA 3TW7A 1JKRC 3ZP5A 1XPXA 5EEGA 4PDKA 5F64A 2BW3B 2IGMA 4CICA 1FIPA 2MLKA 5A2QR 3I3LA 5C44J 2DA6A 1WKMA 5FLMJ 1WJEA 2X1CA 2GAUA 1OFCX 1MH4A 3BR1A 4G6QA 5FLXZ 3WE3A 4Z2YA 2OTLI 3M1CA 1MBGA 5E20A 1I1GA 4FHTA 2PG4A 4OIQF 2QQAA 3FK6A 2DFIA 3RQ4A 2YX4A 1CF7B 2CFXA 3JSPA 3G71I 2ISYA 2XAUA 1SMYF 2DFFA 3CCRI 2EB7A 4MO7A 1PUFB 2V9VA 4G9YA 4GO1A 1Z21A 3AL0B 4LIVA 3IRQA 3Q0WA 3MZHA 2L7MP 5GP9A 4QPOA 4Z6YA 2X4HA
chains in the Genus database with same CATH topology
1O3QA 1X3UA 1FY7A 4Q47A 3MQ0A 4ZYHA 4XLPF 2OBPA 3GFJA 4BYYA 3I54A 3HSEA 4P9UA 2Z3YA 1FT9A 1PP8F 5D5XB 1TQMA 1BJAA 2L54A 2HGCA 4HQMA 2FSWA 1BI1A 4ESBA 2EV5A 5ILUA 2V1DA 3FXRA 4CGZA 2ADUA 4LLGF 2QENA 1ZG1A 3IHUA 2WV0A 1YS7A 4WX9A 2W57A 2A61A 3GZ6A 2KKOA 1JGSA 3R6SA 2HKXA 2L4MA 3SQNA 2FF4A 1MDMB 4F7ZA 3VB2A 3DF8A 2QQBA 3CJNA 4UHTA 2YSRA 4N9HA 3L9FA 2D1VA 3J81K 1U5TB 4HV5A 2PMUA 1IZ1A 1XGSA 3L7WA 5CVUA 1YG2A 3P9KA 4P96A 4HDUA 3IWZA 2F5CA 2NYXA 4IRHA 4B09A 3SZPA 1YO5C 1RNLA 4LG0B 5H20A 3GFMA 1FPQA 1XGOA 2FA5A 3CLOA 2UWMA 4CDGA 4WXCA 5EEHA 4RAYA 1G3SA 2RVCA 1QO0D 2FRHA 1ZH5A 2UXXA 1FOKA 2VN2A 5AONA 1F4KA 2FXAA 2HWVA 1FBSA 4IPAA 3H92A 4AIKA 2DI3A 1J7KA 2XAHA 2TDXA 3QP6A 4A2UA 5K5OA 1TLHB 3KP5A 3PQKA 3E6BA 1T0FA 1FLIA 2ZFWA 1B59A 1LDJA 4AVPA 2DBBA 1KU7A 2EV0A 2XGXA 3WTTC 4P5OA 1R00A 4WF2A 2GQQA 3CO7C 3ML6A 4YIFA 1YIOA 2H09A 1U6GA 5DDGA 2JZYA 5HVQC 1XDSA 1UB9A 2IA1A 1OMIA 2EFNA 1P4WA 4EMSA 5ICEA 3HRSA 4ETSA 3NRVA 5FFZA 2VOOA 1F9NA 1W7PA 1QNTA 1B9MA 4L5JA 5A2QK 3LAPA 1ZREA 1OPCA 5K5RA 4MQ9F 2YR2A 3GW2A 4WWCA 3QRFF 2BYVE 1P2FA 5J6XA 1ZAOA 1S3JA 4O3MA 3CO6C 1P4AA 1IN7A 5DYMA 3VEPA 2ETHA 4IVNA 4HAMA 1ON1A 1T38A 2DW4A 4WK8F 3P7NA 1G3WA 2VBYA 3NEUA 5E1ZB 2L4AA 4HW0A 2EV6A 1CF7A 2HTJA 3HSRA 1ZGJA 3KLNA 4R79A 4KDPA 1R58A 2VT3A 1KQ8A 2LDUA 1SD5A 5IT3A 3F21A 4UV8A 3ECHA 1DUXC 5CYVA 1R7JA 3IC7A 5D5WB 3ULQB 3WTZA 1BOAA 2IT0A 5L3BA 2F5DA 3CDHA 1FP2A 2OQGA 1FX7A 3FXUA 1BC8C 2XAGA 3BJ6A 2JPBA 1YW7A 1ZRFA 5E1WA 1KGSA 1Z05A 2CYYA 4Q5SF 1U3EM 1ZARA 3K69A 2O3FA 4BHPA 1KYZA 4IF4A 3RYPA 5E18F 2XHKA 3ZQ7A 3HOTA 2OU2A 2BE5F 2OQRA 4I0BA 4Y17A 3I4PA 2Y75A 2IVMA 2NNNA 1BI2A 3KP6A 4IRIA 5BPIA 4Q48A 1MDMA 4FX4A 4U0VA 4LLLA 2QZ8A 5HLIA 3HYIA 3WTSC 2GXBA 3WTWC 1K78B 4LB5A 1WQ2A 1U5TA 1P4XA 3ZN1A 4PCQA 3ZMVA 5E8GA 1XN7A 4U88A 1MGTA 3FX3A 1OYIA 5ED4A 2P5LC 3C3WA 4LB6B 2LF8A 4LG0A 4M6YA 3I58A 1IN6A 2VC1A 4UV9A 4LMYA 4EM1A 5K1YA 3D5LA 3IKVA 5LGUA 1IUYA 1W5SA 2NAZA 4KT5C 1IN5A 4DQ2A 2PMHA 5HDGA 4ENMA 1XSVA 1LVAA 1QQIA 2WC2A 1T98A 3K0LA 3TOBA 3KZZA 3R0AA 4L0YB 3QU6A 4FT8A 2ZMEB 5HOOA 1HSTA 3DQVC 1JE8A 1TW3A 1CGPA 2B0LA 1YYVA 4GGGA 4RAZA 3GVAA 5HDKA 1OKRA 2A5YB 2CGPA 1S7AA 3F8CA 3KP3A 2GA2A 2QWWA 2FE3A 3JSOA 4IHSA 3IKTA 3ZMDA 4N0BA 2FNPA 4MGRA 1J59A 5LEKA 3I53A 2A6EF 4N9IA 4CXFA 3N97A 5HDNA 1S8NA 3F6VA 4HYEA 1ZYRF 2GWRA 3FMRA 3L2CA 3RI4A 2EA4A 3KFWX 4UUVA 1RIOH 1W5TA 2YU3A 3DPTA 3MCZA 4EVIA 2VBXA 4A0XA 1OYYA 3V7RA 3FM3A 4I01A 4YG2F 3BJAA 1YFHA 3C7JA 1HQCA 2F5EA 3I5UA 1F1ZA 1YW9A 3T8TA 1HW5A 1JHFA 3HIFA 4RB0A 1SFUA 3S2WA 1WI9A 3I59A 1JXSA 5FLXK 2CG4A 5TJJA 3REOA 4HLXA 3M9AA 1C0WA 2E7XA 1FP1D 2QQ9A 1HKQA 2R7DA 2CW0F 3RKYA 1MKMA 1MZBA 3DPLC 1XMAA 1K79A 1KA8A 3VOEA 4ZYGA 2IA2A 4EGZA 2FOKA 4RB3C 2BGCA 1H9GA 1UCRA 3HHGA 4B8XA 4O6JA 5L3CA 3T8RA 1S7OA 1R22A 1XGMA 3GLXA 3F23A 1IN4A 2PLYA 4M73A 3RKXA 3EETA 4ENJA 2FMLA 5L3EA 5J8FA 3Q9SA 5IT9Z 4RB2C 2KJCA 1FSEA 4UVBA 2H27A 5BQTA 4RGUA 1P6RA 4P9FA 2MH9A 1EH6A 3ZN0A 2QYOA 2DQRA 1LB2A 4XSZF 3KEQA 1O3RA 2EK5A 2G9WA 4LGWA 4G7OF 2X0LA 3Q9VA 3ELKA 2QVOA 3M8FA 4BXUA 5LHGA 3RDIA 2XVCA 2L3DA 4ZYEA 3EYYA 1HW2A 3F8FA 4OU0A 4XRFA 4ZYDA 3T1BA 5D4RA 5D6EA 3O2PE 3ZMZA 5CVIA 1L3LA 2Y48A 1E2XA 3HRUA 1AWCA 2D2WA 3WU0A 1DP7P 1XDUA 2XIGA 4CHUA 3TDUC 4NB5A 4MHGA 2XASA 1DPRA 1ONVA 6PAXA 4XSXF 2H94A 2DPDA 2STTA 3V7CA 3M8EA 1R5GA 1TW2A 5FGMA 2RNJA 2W24A 3CUOA 2ZMEA 4M9SA 3COAC 2DT5A 2EFQA 3F72A 5HLHA 3SFZA 4HF1A 1NHAA 3J7AO 4CO8A 3FWEA 4AIHA 1R1VA 1FBQA 5BS6A 3E5UA 4YFKF 4HDVA 1BIBA 3H3UA 1HKSA 2O0YA 1B4AA 2HZTA 1RI7A 3FMSA 1MD0A 2ELHA 5AIPA 1HBXG 3KZYA 2NRAC 3DKWA 3K1MA 3LA3A 4ENNA 3HTUA 4L0ZB 1O7FA 2V79A 4NQWA 4ASNA 1F5TA 4M72A 2A07F 4BH9A 2A69F 3H3ZA 4LFUA 3CTAA 3CUQB 2OZUA 3GFLA 4RGSA 2LNBA 2P4WA 3F8NA 4OINF 1ZLKA 2HEOA 5K5QA 4JK1X 1U8RA 2F5FA 4HF2A 4A6DA 2Q2EA 2G7HA 3D0SA 1QGPA 1J5YA 2CQKA 1PDNC 1W4MA 2PFBA 3ABUA 2EJRA 4R1HA 1G4DA 3V8KA 2KRFA 2P8TA 4AIJA 2O03A 1REPC 4LLNA 3WTXC 1XSXA 2DPUA 3DXJF 2M1BA 4EJTA 3GX4X 3U9GA 2IP2A 5E17F 2E1NA 3WGGA 5LHHA 2D45A 2Z33A 1YW8A 2HYFA 3KETA 2OAZA 3QPTA 3VFZA 1KU9A 2KIFA 3U2RA 3DEUA 1IF1A 1XCVA 4AD9A 1TNTA 3T0YA 2Q0OA 3ZMUA 3RTRA 5CVJA 1BM9A 5LRRA 3J80Z 3M7GA 1LNWA 3GWZA 2NS0A 4MEXF 2LSOA 3W6JB 2XROA 3KCCA 5H6RA 3WTUC 1R1UA 2XKOA 3L09A 3WODF 1BI3A 2ESHA 2BBYA 1YLFA 2W84A 3TDZC 3KP7A 4QLCU 1Z6TA 3F3XA 5DUKA 4WXHA 3FMQA 2COMA 2Q8KA 2R3SA 2P6SA 2DO7A 3MWMA 2YX7A 1UFMA 5H6QA 2D1HA 2JRTA 5LLQA 2FQ3A 5A2QZ 5BOXA 1O3SA 5DUIA 4U0WA 2MBFA 4E70A 3LAJA 2K02A 3E5QA 3QAHA 2OA4A 1RZ4A 4PZJA 1TTYA 2E1CA 3V4GA 3HHHA 3N4MA 3SZTA 3W6KB 1BIAA 4KN4X 3FF5A 4G7ZF 1KQ9A 4BQAA 2J5PA 3B02A 3GYHX 1T6SA 4G6DA 3GZ5A 2ZKZA 1FC3A 3L00A 5BPDA 4MTDA 4HX4A 3DP7A 4OIRF 1K6OA 5JI6A 3TO7A 5CVRA 2XV4S 1G6NA 4HX7A 5LHIA 2HOEA 4ESJA 3KEOA 1L0OC 3WG9A 3K1PA 1IAWA 5D6FA 1B9NA 5E1XA 4HBLA 2M5WA 1QBJA 1ULYA 2DK8A 5CLSA 2IJLA 4YFXF 5CVVA 5HS8A 2F2EA 1HSJA 1BI0A 1KU2A 4MQVA 3R60A 3WGIA 2ACJA 2QUFA 2CSOA 2UZKA 4RS8A 1PP7U 2ZXJA 3WU1B 3BPXA 3PFIA 2DTRA 5D8LB 2ESNA 3HTSB 3I64A 3BP8A 4MTEA 1ZLJA 3OOPA 5JHUA 2PN6A 4GXOA 2VXZA 2V1XA 1QPMA 1LJ9A 4JBAA 1LDDA 1Q1HA 4OIOF 4Y13A 3HRTA 3G3ZA 2FMYA 1E17A 3LQQA 2A3SA 3CUQA 3DV8A 1Z1DA 4U7BA 3V8LA 4GYGA 2VT2A 3F8BA 2RDPA 4BNCA 4GYIA 4IJAA 1LDKB 1U2WA 1MJBA 3GXOA 3E6CC 4I7HA 3WE2A 5F6FA 3GFIA 5HS7A 2HDCA 2FBKA 2Y0MA 3BWGA 3LWFA 1H0MA 4LJZF 3RPQA 2RKHA 1FYKA 5HLGA 4QWQA 3ZMTA 3QPHA 4EJVA 2PBIA 3G73A 3BZ6A 1ZGAA 1YQAA 1MJAA 4A5MA 2M30A 3JW4A 3WTVC 2M87A 3E6DA 1D3YA 2HTSA 4ESFA 1I6XA 4KICA 2YPRA 2A6HF 2WTEA 1S6LA 1SAXA 4L9JA 3GO5A 3I71A 3E6MA 4HV6A 3BOQA 4Y15A 2RV8A 1O57A 3WTYC 3O3KA 3KE2A 5LRSA 1Y0UA 4Q4ZF 4ENKA 1D5VA 5KVRA 4HZFA 4DNCA 4YFNF 1S29A 5IT9K 1GXQA 3C1DA 3Q5FA 5DCMB 1VTNC 1EV7A 4EJOA 3QU3A 2ZCWA 3GF2A 4LK0F 2PEXA 2ZNYA 1KYWA 2ZNZA 3TO6A 3JAMZ 1MJ9A 5L3GA 2IA0A 2MC3A 1J2XA 2RQPA 4KIGA 4A0ZA 1FNNA 1LEAA 4OIPF 3TQNA 2ZO4A 1ZRCA 1USSA 5AIQA 5DEQA 3MAJA 5BMZA 4KYWA 2Z99A 4L5IA 4WCGA 3PQJA 3HOSA 1KQ0A 2DU9A 1H9TA 5D4SA 4KMFA 3ZMSA 3F6OA 2GXGA 3WGHA 2JT1A 1EH8A 1QZYA 5DV5A 2XAQA 3K2ZA 4KUMA 1STZA 4BHBA 1DPUA 2H6CA 4ZH4F 2FEZA 2ISZA 3JTHA 2XAJA 3ZPLA 3R4KA 2HS5A 1K78A 1XMKA 3T5XA 2K4JA 1GXPA 1ZHFA 1IXCA 1TBXA 1HW1A 4HQEA 2EA2A 4HA8A 1I27A 3BPVA 3TO9A 2EFPA 1YTYA 4M74A 1R36A 1TQPA 2H6BA 3F8MA 4ON0A 5FO5A 1ON2A 2BV6A 3SHFA 3ECOA 1FSHA 3LQRA 1WRJA 1R23A 1SFXA 1DDNA 5LBQA 1KU3A 2P7VB 3R61A 1LEBA 2CO5A 4BAYA 1EH7A 1SD7A 1TNSA 1FBUA 2PI0A 4WXDA 4CYDA 4EM0B 4HLYA 5JFRA 3P9IA 1ZG3A 4G7HF 4PGGA 2X4HA 4KFCA 2VBZA 2PQ8A 4U0YA 2XKPA 5TRDA 2ZBKA 2FNAA 2MA3A 2K7LA 3I0TA 3ISPA 3K1NA 4XLNF 2O6GE 1B6AA 2VODA 2K27A 5ICCA 3P9CA 1TQIA 2AXLA 2O8XA 2STWA 4L18B 2QBYB 1OYWA 2VBWA 2OD5A 3HRMA 2DAOA 1U78A 3B73A 1O3TA 3NQOA 2FU4A 3J81Z 4AWXB 2LF7A 3MFKA 2IPQX 2EFWA 4U7DA 4KIBA 2RGVA 5L3DA 4A5NA 2V6CA 1U5TC 3HSFA 3RJPA 3TOAA 3FZVA 3RKWA 4A12A 3J80K 4I02A 2KIMA 4M9XA 3EDPA 3FM5A 1D8KA 4IHTA 2Z5UA 3ROUA 5ERIA 2FBHA 1ODDA 3E5XA 4K2EA 1IRGA 1USTA 1BC7C 4IRGA 4XBFA 1K7AA 5DCMA 2MLGA 5FD5A 5CJ9A 2QM3A 1IXRC 1UHMA 4UVCA 4HOBA 4M71A 3ERED 2Z9OA 4RGXA 1O7LA 2C6YA 2BEOA 4BHCA 3EYIA 3BDDA 2VE9A 3CUQC 1J0RA 4EV0A 4I98B 2XRNA 3DFGA 3RPUA 4RGRA 2JPCA 4NHJA 1XB4A 4S04A 1B1BA 1OR7A 2JTVA 1FYLA 1XCBA 3I59B 3O6BB 2P6TA 1IRFA 3M1EA 1V4RA 4GCVA 2VOPA 4I2OA 5ICGA 1W7PD 2AS5F 2GIVA 2RN7A 3C18A 1JHHA 2W85A 2A68F 2NNYA 3U1DA 3V7SA 4IXAA 2HR3A 4LK1F 2DK5A 2HFHA 1IN8A 3LA7A 3R0JA 1T39A 4I0AA 4A6EA 2P5KA 1XD7A 3F22A 1GVJA 1Z7UA 4UXNA 1YS6A 2P7CB 4PGHA 5DD8A 4KIFA 4KA4A 1R1TA 3BY6A 5FD6A 3AAFA 1IXSB 1QZZA 4TV7A 2VONA 4S05A 3QOPA 2RC4A 3BROA 2R7FA 1I1SA 1XGNA 4OMYA 1AOYA 5LEJA 3E3VA 2EWNA 2ZJ2A 4LD5A 4L9NA 4EJUA 5ILVA 2HQNA 3RIRA 4YIIA 4L9VA 3GUDA 2MD5A 3ABTA 2PJPA 1ZN2A 5LGNA 4I09A 4M9ZA 4G94A 5LGTA 5J8CA 1LQ1A 3MZYA 4O5VA 5FB2A 2IW5A 1Z9CA 4ZZLA 3BJOA 3HUGA 1BBYA 1P92A 5KK1A 4EM2A 3KLOA 1BN5A 3LSTA 1V3FA 4HF0A 3QP5A 1PUEE 2QBYA 2MH2A 4MNUA 4UNOA 1FYMA 2E7WA 4G8XA 5L3FA 2V1UA 4JQFA 3K9TA 1SD4A 2HYGD 1FWZA 2OZ6A 3RYRA 1J75A 5JR3A 1IW7F 2J5OA 3KP2A 4KN7X 2QLZA 2O61A 3EQLF 1I5ZA 2KIUA 3LFKA 5ILSA 4M6XA 3TKYA 2CWEA 5D5VB 1FZPB 2FBIA 2P5VA 1GHCA 4ZZDA 3JTGA 4HX8A 1RUOA 1HKTA 1WWXA 4UVAA 2K86A 2LKPA 1G3YA 4D0PA 2HKOA 1J9IA 3IL2A 3IWFA 3SXYA 3VODA 2VE8A 1A04A 3MEXA 5D5UB 2L02A 3FHZA 1HXDA 4H0EA 4MEYF 2KJBA 1WSUA 3FXQA 3V8JA 5JVTA 5ICFA 3JAMK 2DQLA 2GZWA 3IRRA 4OOIA 1Z6RA 4EGYA 4KMUX 1SMTA 3EUHA 4A0YA 1ZG5A 2M8EA 4OMZA 1SD6A 3OV8A 5HS9A 2UXNA 1Z91A 1R5HA 4L9TA 4EQQA 4KNYA 1UHWA 2GA1A 3GEZA 5F1RA 2WWYA 5DCFA 2VC0A 4RB1A 2IRFG 2W25A 3E97A 2DLLA 5DD4A 1RUNA 3TGNA 2XUBA 1G3TA 1T2KA 4CZZA 1SFEA 5D8KB 1XSDA 1W7PB 1D8JA 2M45A 2L01A 4FX0A 2K4BA 4EJWA 5FFXA 2XAFA 3LA2A 2JSCA 2G7UA 4R8HA 3KP4A 1ZRDA 2EFOA 2HQRA 5E8IA 3ZP5A 5EEGA 4PDKA 5F64A 4CICA 2MLKA 1WKMA 2GAUA 4G6QA 5FLXZ 3WE3A 4Z2YA 5E20A 1I1GA 4FHTA 2PG4A 4OIQF 2QQAA 2DFIA 2YX4A 1CF7B 2CFXA 3JSPA 2ISYA 1SMYF 2EB7A 2V9VA 4G9YA 4GO1A 3IRQA 3MZHA 4P55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3Q A;  1X3U A;  1FY7 A;  4Q47 A;  3MQ0 A;  4ZYH A;  4XLP F;  2OBP A;  3GFJ A;  4BYY A;  3I54 A;  3HSE A;  4P9U A;  2Z3Y A;  1FT9 A;  1PP8 F;  5D5X B;  1TQM A;  1BJA A;  2L54 A;  2HGC A;  4HQM A;  2FSW A;  1BI1 A;  4ESB A;  2EV5 A;  5ILU A;  2V1D A;  3FXR A;  4CGZ A;  2ADU A;  4LLG F;  2QEN A;  1ZG1 A;  3IHU A;  2WV0 A;  1YS7 A;  4WX9 A;  2W57 A;  2A61 A;  3GZ6 A;  2KKO A;  1JGS A;  3R6S A;  2HKX A;  2L4M A;  3SQN A;  2FF4 A;  1MDM B;  4F7Z A;  3VB2 A;  3DF8 A;  2QQB A;  3CJN A;  4UHT A;  2YSR A;  4N9H A;  3L9F A;  2D1V A;  3J81 K;  1U5T B;  4HV5 A;  2PMU A;  1IZ1 A;  1XGS A;  3L7W A;  5CVU A;  1YG2 A;  3P9K A;  4P96 A;  4HDU A;  3IWZ A;  2F5C A;  2NYX A;  4IRH A;  4B09 A;  3SZP A;  1YO5 C;  1RNL A;  4LG0 B;  5H20 A;  3GFM A;  1FPQ A;  1XGO A;  2FA5 A;  3CLO A;  2UWM A;  4CDG A;  4WXC A;  5EEH A;  4RAY A;  1G3S A;  2RVC A;  1QO0 D;  2FRH A;  1ZH5 A;  2UXX A;  1FOK A;  2VN2 A;  5AON A;  1F4K A;  2FXA A;  2HWV A;  1FBS A;  4IPA A;  3H92 A;  4AIK A;  2DI3 A;  1J7K A;  2XAH A;  2TDX A;  3QP6 A;  4A2U A;  5K5O A;  1TLH B;  3KP5 A;  3PQK A;  3E6B A;  1T0F A;  1FLI A;  2ZFW A;  1B59 A;  1LDJ A;  4AVP A;  2DBB A;  1KU7 A;  2EV0 A;  2XGX A;  3WTT C;  4P5O A;  1R00 A;  4WF2 A;  2GQQ A;  3CO7 C;  3ML6 A;  4YIF A;  1YIO A;  2H09 A;  1U6G A;  5DDG A;  2JZY A;  5HVQ C;  1XDS A;  1UB9 A;  2IA1 A;  1OMI A;  2EFN A;  1P4W A;  4EMS A;  5ICE A;  3HRS A;  4ETS A;  3NRV A;  5FFZ A;  2VOO A;  1F9N A;  1W7P A;  1QNT A;  1B9M A;  4L5J A;  5A2Q K;  3LAP A;  1ZRE A;  1OPC A;  5K5R A;  4MQ9 F;  2YR2 A;  3GW2 A;  4WWC A;  3QRF F;  2BYV E;  1P2F A;  5J6X A;  1ZAO A;  1S3J A;  4O3M A;  3CO6 C;  1P4A A;  1IN7 A;  5DYM A;  3VEP A;  2ETH A;  4IVN A;  4HAM A;  1ON1 A;  1T38 A;  2DW4 A;  4WK8 F;  3P7N A;  1G3W A;  2VBY A;  3NEU A;  5E1Z B;  2L4A A;  4HW0 A;  2EV6 A;  1CF7 A;  2HTJ A;  3HSR A;  1ZGJ A;  3KLN A;  4R79 A;  4KDP A;  1R58 A;  2VT3 A;  1KQ8 A;  2LDU A;  1SD5 A;  5IT3 A;  3F21 A;  4UV8 A;  3ECH A;  1DUX C;  5CYV A;  1R7J A;  3IC7 A;  5D5W B;  3ULQ B;  3WTZ A;  1BOA A;  2IT0 A;  5L3B A;  2F5D A;  3CDH A;  1FP2 A;  2OQG A;  1FX7 A;  3FXU A;  1BC8 C;  2XAG A;  3BJ6 A;  2JPB A;  1YW7 A;  1ZRF A;  5E1W A;  1KGS A;  1Z05 A;  2CYY A;  4Q5S F;  1U3E M;  1ZAR A;  3K69 A;  2O3F A;  4BHP A;  1KYZ A;  4IF4 A;  3RYP A;  5E18 F;  2XHK A;  3ZQ7 A;  3HOT A;  2OU2 A;  2BE5 F;  2OQR A;  4I0B A;  4Y17 A;  3I4P A;  2Y75 A;  2IVM A;  2NNN A;  1BI2 A;  3KP6 A;  4IRI A;  5BPI A;  4Q48 A;  1MDM A;  4FX4 A;  4U0V A;  4LLL A;  2QZ8 A;  5HLI A;  3HYI A;  3WTS C;  2GXB A;  3WTW C;  1K78 B;  4LB5 A;  1WQ2 A;  1U5T A;  1P4X A;  3ZN1 A;  4PCQ A;  3ZMV A;  5E8G A;  1XN7 A;  4U88 A;  1MGT A;  3FX3 A;  1OYI A;  5ED4 A;  2P5L C;  3C3W A;  4LB6 B;  2LF8 A;  4LG0 A;  4M6Y A;  3I58 A;  1IN6 A;  2VC1 A;  4UV9 A;  4LMY A;  4EM1 A;  5K1Y A;  3D5L A;  3IKV A;  5LGU A;  1IUY A;  1W5S A;  2NAZ A;  4KT5 C;  1IN5 A;  4DQ2 A;  2PMH A;  5HDG A;  4ENM A;  1XSV A;  1LVA A;  1QQI A;  2WC2 A;  1T98 A;  3K0L A;  3TOB A;  3KZZ A;  3R0A A;  4L0Y B;  3QU6 A;  4FT8 A;  2ZME B;  5HOO A;  1HST A;  3DQV C;  1JE8 A;  1TW3 A;  1CGP A;  2B0L A;  1YYV A;  4GGG A;  4RAZ A;  3GVA A;  5HDK A;  1OKR A;  2A5Y B;  2CGP A;  1S7A A;  3F8C A;  3KP3 A;  2GA2 A;  2QWW A;  2FE3 A;  3JSO A;  4IHS A;  3IKT A;  3ZMD A;  4N0B A;  2FNP A;  4MGR A;  1J59 A;  5LEK A;  3I53 A;  2A6E F;  4N9I A;  4CXF A;  3N97 A;  5HDN A;  1S8N A;  3F6V A;  4HYE A;  1ZYR F;  2GWR A;  3FMR A;  3L2C A;  3RI4 A;  2EA4 A;  3KFW X;  4UUV A;  1RIO H;  1W5T A;  2YU3 A;  3DPT A;  3MCZ A;  4EVI A;  2VBX A;  4A0X A;  1OYY A;  3V7R A;  3FM3 A;  4I01 A;  4YG2 F;  3BJA A;  1YFH A;  3C7J A;  1HQC A;  2F5E A;  3I5U A;  1F1Z A;  1YW9 A;  3T8T A;  1HW5 A;  1JHF A;  3HIF A;  4RB0 A;  1SFU A;  3S2W A;  1WI9 A;  3I59 A;  1JXS A;  5FLX K;  2CG4 A;  5TJJ A;  3REO A;  4HLX A;  3M9A A;  1C0W A;  2E7X A;  1FP1 D;  2QQ9 A;  1HKQ A;  2R7D A;  2CW0 F;  3RKY A;  1MKM A;  1MZB A;  3DPL C;  1XMA A;  1K79 A;  1KA8 A;  3VOE A;  4ZYG A;  2IA2 A;  4EGZ A;  2FOK A;  4RB3 C;  2BGC A;  1H9G A;  1UCR A;  3HHG A;  4B8X A;  4O6J A;  5L3C A;  3T8R A;  1S7O A;  1R22 A;  1XGM A;  3GLX A;  3F23 A;  1IN4 A;  2PLY A;  4M73 A;  3RKX A;  3EET A;  4ENJ A;  2FML A;  5L3E A;  5J8F A;  3Q9S A;  5IT9 Z;  4RB2 C;  2KJC A;  1FSE A;  4UVB A;  2H27 A;  5BQT A;  4RGU A;  1P6R A;  4P9F A;  2MH9 A;  1EH6 A;  3ZN0 A;  2QYO A;  2DQR A;  1LB2 A;  4XSZ F;  3KEQ A;  1O3R A;  2EK5 A;  2G9W A;  4LGW A;  4G7O F;  2X0L A;  3Q9V A;  3ELK A;  2QVO A;  3M8F A;  4BXU A;  5LHG A;  3RDI A;  2XVC A;  2L3D A;  4ZYE A;  3EYY A;  1HW2 A;  3F8F A;  4OU0 A;  4XRF A;  4ZYD A;  3T1B A;  5D4R A;  5D6E A;  3O2P E;  3ZMZ A;  5CVI A;  1L3L A;  2Y48 A;  1E2X A;  3HRU A;  1AWC A;  2D2W A;  3WU0 A;  1DP7 P;  1XDU A;  2XIG A;  4CHU A;  3TDU C;  4NB5 A;  4MHG A;  2XAS A;  1DPR A;  1ONV A;  6PAX A;  4XSX F;  2H94 A;  2DPD A;  2STT A;  3V7C A;  3M8E A;  1R5G A;  1TW2 A;  5FGM A;  2RNJ A;  2W24 A;  3CUO A;  2ZME A;  4M9S A;  3COA C;  2DT5 A;  2EFQ A;  3F72 A;  5HLH A;  3SFZ A;  4HF1 A;  1NHA A;  3J7A O;  4CO8 A;  3FWE A;  4AIH A;  1R1V A;  1FBQ A;  5BS6 A;  3E5U A;  4YFK F;  4HDV A;  1BIB A;  3H3U A;  1HKS A;  2O0Y A;  1B4A A;  2HZT A;  1RI7 A;  3FMS A;  1MD0 A;  2ELH A;  5AIP A;  1HBX G;  3KZY A;  2NRA C;  3DKW A;  3K1M A;  3LA3 A;  4ENN A;  3HTU A;  4L0Z B;  1O7F A;  2V79 A;  4NQW A;  4ASN A;  1F5T A;  4M72 A;  2A07 F;  4BH9 A;  2A69 F;  3H3Z A;  4LFU A;  3CTA A;  3CUQ B;  2OZU A;  3GFL A;  4RGS A;  2LNB A;  2P4W A;  3F8N A;  4OIN F;  1ZLK A;  2HEO A;  5K5Q A;  4JK1 X;  1U8R A;  2F5F A;  4HF2 A;  4A6D A;  2Q2E A;  2G7H A;  3D0S A;  1QGP A;  1J5Y A;  2CQK A;  1PDN C;  1W4M A;  2PFB A;  3ABU A;  2EJR A;  4R1H A;  1G4D A;  3V8K A;  2KRF A;  2P8T A;  4AIJ A;  2O03 A;  1REP C;  4LLN A;  3WTX C;  1XSX A;  2DPU A;  3DXJ F;  2M1B A;  4EJT A;  3GX4 X;  3U9G A;  2IP2 A;  5E17 F;  2E1N A;  3WGG A;  5LHH A;  2D45 A;  2Z33 A;  1YW8 A;  2HYF A;  3KET A;  2OAZ A;  3QPT A;  3VFZ A;  1KU9 A;  2KIF A;  3U2R A;  3DEU A;  1IF1 A;  1XCV A;  4AD9 A;  1TNT A;  3T0Y A;  2Q0O A;  3ZMU A;  3RTR A;  5CVJ A;  1BM9 A;  5LRR A;  3J80 Z;  3M7G A;  1LNW A;  3GWZ A;  2NS0 A;  4MEX F;  2LSO A;  3W6J B;  2XRO A;  3KCC A;  5H6R A;  3WTU C;  1R1U A;  2XKO A;  3L09 A;  3WOD F;  1BI3 A;  2ESH A;  2BBY A;  1YLF A;  2W84 A;  3TDZ C;  3KP7 A;  4QLC U;  1Z6T A;  3F3X A;  5DUK A;  4WXH A;  3FMQ A;  2COM A;  2Q8K A;  2R3S A;  2P6S A;  2DO7 A;  3MWM A;  2YX7 A;  1UFM A;  5H6Q A;  2D1H A;  2JRT A;  5LLQ A;  2FQ3 A;  5A2Q Z;  5BOX A;  1O3S A;  5DUI A;  4U0W A;  2MBF A;  4E70 A;  3LAJ A;  2K02 A;  3E5Q A;  3QAH A;  2OA4 A;  1RZ4 A;  4PZJ A;  1TTY A;  2E1C A;  3V4G A;  3HHH A;  3N4M A;  3SZT A;  3W6K B;  1BIA A;  4KN4 X;  3FF5 A;  4G7Z F;  1KQ9 A;  4BQA A;  2J5P A;  3B02 A;  3GYH X;  1T6S A;  4G6D A;  3GZ5 A;  2ZKZ A;  1FC3 A;  3L00 A;  5BPD A;  4MTD A;  4HX4 A;  3DP7 A;  4OIR F;  1K6O A;  5JI6 A;  3TO7 A;  5CVR A;  2XV4 S;  1G6N A;  4HX7 A;  5LHI A;  2HOE A;  4ESJ A;  3KEO A;  1L0O C;  3WG9 A;  3K1P A;  1IAW A;  5D6F A;  1B9N A;  5E1X A;  4HBL A;  2M5W A;  1QBJ A;  1ULY A;  2DK8 A;  5CLS A;  2IJL A;  4YFX F;  5CVV A;  5HS8 A;  2F2E A;  1HSJ A;  1BI0 A;  1KU2 A;  4MQV A;  3R60 A;  3WGI A;  2ACJ A;  2QUF A;  2CSO A;  2UZK A;  4RS8 A;  1PP7 U;  2ZXJ A;  3WU1 B;  3BPX A;  3PFI A;  2DTR A;  5D8L B;  2ESN A;  3HTS B;  3I64 A;  3BP8 A;  4MTE A;  1ZLJ A;  3OOP A;  5JHU A;  2PN6 A;  4GXO A;  2VXZ A;  2V1X A;  1QPM A;  1LJ9 A;  4JBA A;  1LDD A;  1Q1H A;  4OIO F;  4Y13 A;  3HRT A;  3G3Z A;  2FMY A;  1E17 A;  3LQQ A;  2A3S A;  3CUQ A;  3DV8 A;  1Z1D A;  4U7B A;  3V8L A;  4GYG A;  2VT2 A;  3F8B A;  2RDP A;  4BNC A;  4GYI A;  4IJA A;  1LDK B;  1U2W A;  1MJB A;  3GXO A;  3E6C C;  4I7H A;  3WE2 A;  5F6F A;  3GFI A;  5HS7 A;  2HDC A;  2FBK A;  2Y0M A;  3BWG A;  3LWF A;  1H0M A;  4LJZ F;  3RPQ A;  2RKH A;  1FYK A;  5HLG A;  4QWQ A;  3ZMT A;  3QPH A;  4EJV A;  2PBI A;  3G73 A;  3BZ6 A;  1ZGA A;  1YQA A;  1MJA A;  4A5M A;  2M30 A;  3JW4 A;  3WTV C;  2M87 A;  3E6D A;  1D3Y A;  2HTS A;  4ESF A;  1I6X A;  4KIC A;  2YPR A;  2A6H F;  2WTE A;  1S6L A;  1SAX A;  4L9J A;  3GO5 A;  3I71 A;  3E6M A;  4HV6 A;  3BOQ A;  4Y15 A;  2RV8 A;  1O57 A;  3WTY C;  3O3K A;  3KE2 A;  5LRS A;  1Y0U A;  4Q4Z F;  4ENK A;  1D5V A;  5KVR A;  4HZF A;  4DNC A;  4YFN F;  1S29 A;  5IT9 K;  1GXQ A;  3C1D A;  3Q5F A;  5DCM B;  1VTN C;  1EV7 A;  4EJO A;  3QU3 A;  2ZCW A;  3GF2 A;  4LK0 F;  2PEX A;  2ZNY A;  1KYW A;  2ZNZ A;  3TO6 A;  3JAM Z;  1MJ9 A;  5L3G A;  2IA0 A;  2MC3 A;  1J2X A;  2RQP A;  4KIG A;  4A0Z A;  1FNN A;  1LEA A;  4OIP F;  3TQN A;  2ZO4 A;  1ZRC A;  1USS A;  5AIQ A;  5DEQ A;  3MAJ A;  5BMZ A;  4KYW A;  2Z99 A;  4L5I A;  4WCG A;  3PQJ A;  3HOS A;  1KQ0 A;  2DU9 A;  1H9T A;  5D4S A;  4KMF A;  3ZMS A;  3F6O A;  2GXG A;  3WGH A;  2JT1 A;  1EH8 A;  1QZY A;  5DV5 A;  2XAQ A;  3K2Z A;  4KUM A;  1STZ A;  4BHB A;  1DPU A;  2H6C A;  4ZH4 F;  2FEZ A;  2ISZ A;  3JTH A;  2XAJ A;  3ZPL A;  3R4K A;  2HS5 A;  1K78 A;  1XMK A;  3T5X A;  2K4J A;  1GXP A;  1ZHF A;  1IXC A;  1TBX A;  1HW1 A;  4HQE A;  2EA2 A;  4HA8 A;  1I27 A;  3BPV A;  3TO9 A;  2EFP A;  1YTY A;  4M74 A;  1R36 A;  1TQP A;  2H6B A;  3F8M A;  4ON0 A;  5FO5 A;  1ON2 A;  2BV6 A;  3SHF A;  3ECO A;  1FSH A;  3LQR A;  1WRJ A;  1R23 A;  1SFX A;  1DDN A;  5LBQ A;  1KU3 A;  2P7V B;  3R61 A;  1LEB A;  2CO5 A;  4BAY A;  1EH7 A;  1SD7 A;  1TNS A;  1FBU A;  2PI0 A;  4WXD A;  4CYD A;  4EM0 B;  4HLY A;  5JFR A;  3P9I A;  1ZG3 A;  4G7H F;  4PGG A;  2X4H A;  4KFC A;  2VBZ A;  2PQ8 A;  4U0Y A;  2XKP A;  5TRD A;  2ZBK A;  2FNA A;  2MA3 A;  2K7L A;  3I0T A;  3ISP A;  3K1N A;  4XLN F;  2O6G E;  1B6A A;  2VOD A;  2K27 A;  5ICC A;  3P9C A;  1TQI A;  2AXL A;  2O8X A;  2STW A;  4L18 B;  2QBY B;  1OYW A;  2VBW A;  2OD5 A;  3HRM A;  2DAO A;  1U78 A;  3B73 A;  1O3T A;  3NQO A;  2FU4 A;  3J81 Z;  4AWX B;  2LF7 A;  3MFK A;  2IPQ X;  2EFW A;  4U7D A;  4KIB A;  2RGV A;  5L3D A;  4A5N A;  2V6C A;  1U5T C;  3HSF A;  3RJP A;  3TOA A;  3FZV A;  3RKW A;  4A12 A;  3J80 K;  4I02 A;  2KIM A;  4M9X A;  3EDP A;  3FM5 A;  1D8K A;  4IHT A;  2Z5U A;  3ROU A;  5ERI A;  2FBH A;  1ODD A;  3E5X A;  4K2E A;  1IRG A;  1UST A;  1BC7 C;  4IRG A;  4XBF A;  1K7A A;  5DCM A;  2MLG A;  5FD5 A;  5CJ9 A;  2QM3 A;  1IXR C;  1UHM A;  4UVC A;  4HOB A;  4M71 A;  3ERE D;  2Z9O A;  4RGX A;  1O7L A;  2C6Y A;  2BEO A;  4BHC A;  3EYI A;  3BDD A;  2VE9 A;  3CUQ C;  1J0R A;  4EV0 A;  4I98 B;  2XRN A;  3DFG A;  3RPU A;  4RGR A;  2JPC A;  4NHJ A;  1XB4 A;  4S04 A;  1B1B A;  1OR7 A;  2JTV A;  1FYL A;  1XCB A;  3I59 B;  3O6B B;  2P6T A;  1IRF A;  3M1E A;  1V4R A;  4GCV A;  2VOP A;  4I2O A;  5ICG A;  1W7P D;  2AS5 F;  2GIV A;  2RN7 A;  3C18 A;  1JHH A;  2W85 A;  2A68 F;  2NNY A;  3U1D A;  3V7S A;  4IXA A;  2HR3 A;  4LK1 F;  2DK5 A;  2HFH A;  1IN8 A;  3LA7 A;  3R0J A;  1T39 A;  4I0A A;  4A6E A;  2P5K A;  1XD7 A;  3F22 A;  1GVJ A;  1Z7U A;  4UXN A;  1YS6 A;  2P7C B;  4PGH A;  5DD8 A;  4KIF A;  4KA4 A;  1R1T A;  3BY6 A;  5FD6 A;  3AAF A;  1IXS B;  1QZZ A;  4TV7 A;  2VON A;  4S05 A;  3QOP A;  2RC4 A;  3BRO A;  2R7F A;  1I1S A;  1XGN A;  4OMY A;  1AOY A;  5LEJ A;  3E3V A;  2EWN A;  2ZJ2 A;  4LD5 A;  4L9N A;  4EJU A;  5ILV A;  2HQN A;  3RIR A;  4YII A;  4L9V A;  3GUD A;  2MD5 A;  3ABT A;  2PJP A;  1ZN2 A;  5LGN A;  4I09 A;  4M9Z A;  4G94 A;  5LGT A;  5J8C A;  1LQ1 A;  3MZY A;  4O5V A;  5FB2 A;  2IW5 A;  1Z9C A;  4ZZL A;  3BJO A;  3HUG A;  1BBY A;  1P92 A;  5KK1 A;  4EM2 A;  3KLO A;  1BN5 A;  3LST A;  1V3F A;  4HF0 A;  3QP5 A;  1PUE E;  2QBY A;  2MH2 A;  4MNU A;  4UNO A;  1FYM A;  2E7W A;  4G8X A;  5L3F A;  2V1U A;  4JQF A;  3K9T A;  1SD4 A;  2HYG D;  1FWZ A;  2OZ6 A;  3RYR A;  1J75 A;  5JR3 A;  1IW7 F;  2J5O A;  3KP2 A;  4KN7 X;  2QLZ A;  2O61 A;  3EQL F;  1I5Z A;  2KIU A;  3LFK A;  5ILS A;  4M6X A;  3TKY A;  2CWE A;  5D5V B;  1FZP B;  2FBI A;  2P5V A;  1GHC A;  4ZZD A;  3JTG A;  4HX8 A;  1RUO A;  1HKT A;  1WWX A;  4UVA A;  2K86 A;  2LKP A;  1G3Y A;  4D0P A;  2HKO A;  1J9I A;  3IL2 A;  3IWF A;  3SXY A;  3VOD A;  2VE8 A;  1A04 A;  3MEX A;  5D5U B;  2L02 A;  3FHZ A;  1HXD A;  4H0E A;  4MEY F;  2KJB A;  1WSU A;  3FXQ A;  3V8J A;  5JVT A;  5ICF A;  3JAM K;  2DQL A;  2GZW A;  3IRR A;  4OOI A;  1Z6R A;  4EGY A;  4KMU X;  1SMT A;  3EUH A;  4A0Y A;  1ZG5 A;  2M8E A;  4OMZ A;  1SD6 A;  3OV8 A;  5HS9 A;  2UXN A;  1Z91 A;  1R5H A;  4L9T A;  4EQQ A;  4KNY A;  1UHW A;  2GA1 A;  3GEZ A;  5F1R A;  2WWY A;  5DCF A;  2VC0 A;  4RB1 A;  2IRF G;  2W25 A;  3E97 A;  2DLL A;  5DD4 A;  1RUN A;  3TGN A;  2XUB A;  1G3T A;  1T2K A;  4CZZ A;  1SFE A;  5D8K B;  1XSD A;  1W7P B;  1D8J A;  2M45 A;  2L01 A;  4FX0 A;  2K4B A;  4EJW A;  5FFX A;  2XAF A;  3LA2 A;  2JSC A;  2G7U A;  4R8H A;  3KP4 A;  1ZRD A;  2EFO A;  2HQR A;  5E8I A;  3ZP5 A;  5EEG A;  4PDK A;  5F64 A;  4CIC A;  2MLK A;  1WKM A;  2GAU A;  4G6Q A;  5FLX Z;  3WE3 A;  4Z2Y A;  5E20 A;  1I1G A;  4FHT A;  2PG4 A;  4OIQ F;  2QQA A;  2DFI A;  2YX4 A;  1CF7 B;  2CFX A;  3JSP A;  2ISY A;  1SMY F;  2EB7 A;  2V9V A;  4G9Y A;  4GO1 A;  3IRQ A;  3MZH A;  4P55 A; 
#chains in the Genus database with same CATH topology
 1O3Q A;  1X3U A;  1ETY A;  1FY7 A;  2MUN A;  4Q47 A;  3MQ0 A;  4ZYH A;  2LR8 A;  4XLP F;  2OBP A;  3GFJ A;  5GTI C;  4QTR A;  2BZT A;  4BYY A;  1ZR4 A;  1I3Q J;  2WAD A;  4F52 A;  3I54 A;  3HSE A;  1LPQ A;  4P9U A;  2Z3Y A;  1JJ8 C;  3QPL A;  1FT9 A;  1PP8 F;  5D5X B;  1TQM A;  1MSE C;  1BJA A;  1LVK A;  2L54 A;  3GTJ J;  4DYC A;  2ME6 A;  1RES A;  2HGC A;  1H8A C;  3HEF A;  2X51 A;  3PFY A;  3LSK A;  4HQM A;  2FSW A;  2VQG A;  1BI1 A;  4ESB A;  1ZK8 A;  4MLO A;  2L0K A;  1RET A;  1IV8 A;  2E36 A;  2FQ4 A;  2Y9Z A;  2EV5 A;  1Y8Q B;  2DA4 A;  1BOB A;  5ILU A;  1VI0 A;  2V1D A;  3FXR A;  2MGQ A;  2ADU A;  2VJJ A;  4CGZ A;  3DU6 A;  2XGE A;  2VJ5 A;  2EIN H;  4LLG F;  2QEN A;  4C3H J;  1ZG1 A;  3IHU A;  2WV0 A;  3CZ6 A;  1YS7 A;  2GBY A;  2VIX A;  1Z67 A;  4WX9 A;  2W57 A;  4HEA 2;  2A61 A;  1R4M B;  2HZD A;  3GZ6 A;  2IS1 A;  1XTA A;  2KKO A;  3BG3 A;  1JGS A;  3R6S A;  2HKX A;  3CMA I;  2BY0 A;  4BE1 A;  1Y8R B;  3HOX J;  1SVO A;  2L4M A;  3UNG C;  1Q1V A;  3HOV J;  4II3 A;  3SQN A;  3VYT B;  1ETK A;  5IYD J;  2DFE A;  2FF4 A;  1MDM B;  4BY7 J;  4F7Z A;  4B44 A;  3VB2 A;  1TT5 B;  3DF8 A;  2QQB A;  3WU2 C;  2DA5 A;  3H0D A;  3CJN A;  4UHT A;  5GAD J;  2L9R A;  2YSR A;  4N9H A;  3L9F A;  2I5U A;  2D1V A;  1MNE A;  1U5T B;  3A02 A;  3J81 K;  4HV5 A;  2Z16 A;  5EG0 B;  2PMU A;  3JRE A;  2LD5 A;  2OTJ I;  3A1Y A;  1IZ1 A;  1XGS A;  3L7W A;  5CVU A;  1GDT A;  2L7K A;  1Y1V J;  5B1A H;  1YG2 A;  3P9K A;  4P96 A;  4HDU A;  2PJR A;  3IWZ A;  1Y6I A;  2F5C A;  1E3P A;  2NYX A;  3D5S C;  3MN2 A;  1D0Y A;  1SVL A;  4IRH A;  3SEQ A;  3SZP A;  5E3L A;  4B09 A;  1RNL A;  1YO5 C;  2VJI A;  4LG0 B;  4GFB A;  1T56 A;  5H20 A;  5M5W J;  1YJN I;  3GFM A;  1FPQ A;  1XGO A;  2FA5 A;  3CLO A;  5GPA A;  4P55 A;  2XRL A;  4CDG A;  4WXC A;  1K61 A;  2JA6 J;  2OF7 A;  4RAY A;  5EEH A;  3HKZ N;  1G3S A;  2RVC A;  3BR2 A;  1QO0 D;  2FRH A;  1ZH5 A;  1GVD A;  2R7U A;  2UXX A;  4BEH A;  1FOK A;  2VN2 A;  5E79 C;  2HOS A;  5J1R A;  5AON A;  5B5E C;  1SC7 A;  1F4K A;  4YRV A;  2MD0 A;  2FXA A;  2QEX I;  2HWV A;  4XQF A;  2M4K A;  1FBS A;  1TL8 A;  4IPA A;  2OV7 A;  3H92 A;  4AIK A;  1IRX A;  2DI3 A;  1J7K A;  1FTT A;  2KL4 A;  2QQ8 A;  1R71 A;  2XAH A;  2NOJ B;  2TDX A;  3QP6 A;  4BQN A;  5CPR B;  2NVY J;  2GOX B;  5FRO A;  4A2U A;  5K5O A;  2JJ7 A;  1TLH B;  3KP5 A;  3VDX A;  3PQK A;  3E6B A;  1T0F A;  1NTC A;  2ZFW A;  5GAG J;  1FLI A;  1B59 A;  4KIT B;  2R5Z A;  1LDJ A;  3W2W A;  3FBN B;  5JLX A;  4AVP A;  2DBB A;  1KU7 A;  2EV0 A;  3HPG A;  2LBF B;  2XGX A;  4D5F A;  1QZE A;  2WA0 A;  4FAS D;  3WTT C;  4P5O A;  1R00 A;  2E5N A;  4WF2 A;  2GQQ A;  3CO7 C;  3K4C A;  4CA0 A;  3ML6 A;  4YIF A;  3CF5 F;  1Z7L A;  4GRI A;  4HRI A;  4CCL A;  1YIO A;  1IO2 A;  2H09 A;  1U6G A;  5DDG A;  3QPS A;  3CQZ J;  2JZY A;  5HVQ C;  1XDS A;  2K9M A;  1UB9 A;  2IA1 A;  4IQJ A;  4IQ4 A;  3OR2 C;  3SDB A;  1OMI A;  2EFN A;  2EBI A;  1P4W A;  2LG4 A;  3KPH A;  3M8J A;  3ZQF A;  4EMS A;  4AC0 A;  5ICE A;  3HRS A;  4Y52 J;  4ETS A;  2VKD A;  3NRV A;  3OWT A;  5FFZ A;  2VOO A;  2KFD A;  1F9N A;  1W7P A;  3ASO H;  3D5R C;  2L7F P;  1QNT A;  3C2H A;  1B9M A;  3DBH B;  3A0H C;  4L5J A;  5A2Q K;  1BJZ A;  3LAP A;  1ZRE A;  1OPC A;  5K5R A;  3F9K A;  4XR6 A;  4XRS A;  4MQ9 F;  5DM6 F;  4J00 A;  2YR2 A;  3GW2 A;  4WWC A;  1ORK A;  1YJW I;  1ACI A;  3QRF F;  2BYV E;  1P2F A;  5K7H A;  1A6I A;  5J6X A;  1ZAO A;  4HPQ A;  1S3J A;  4ZYA A;  4O3M A;  4DZJ A;  3CO6 C;  3JAM R;  2KP6 A;  1P4A A;  1WJD A;  1IN7 A;  5DYM A;  3VEP A;  2ETH A;  4IVN A;  5IOZ A;  1MW7 A;  5IY5 H;  4HAM A;  1ON1 A;  1T38 A;  2DW4 A;  4WK8 F;  3P7N A;  1G3W A;  2VBY A;  4BGD A;  3NEU A;  9ANT A;  2NVX J;  5E1Z B;  1VQ6 I;  2L4A A;  3A01 B;  4NDL A;  3A52 A;  3CCY A;  2TRT A;  4HW0 A;  1YX5 A;  2EV6 A;  3HG9 A;  1CF7 A;  2HTJ A;  3HSR A;  1J09 A;  1ZGJ A;  2UUZ A;  3KLN A;  4R79 A;  2DMU A;  4J01 A;  5TGT A;  4KDP A;  1R58 A;  2VT3 A;  2V26 A;  1PUF A;  1KQ8 A;  2LDU A;  4XNF A;  3WG7 H;  1SD5 A;  3OYA A;  5IT3 A;  1VQ8 I;  3F21 A;  4UV8 A;  1B8I A;  2ICW G;  5BNG A;  2H8W A;  3OSF A;  1W0U A;  3ECH A;  1DUX C;  2LRD A;  2M8G X;  4XRS G;  5CYV A;  1R7J A;  3IC7 A;  3DBR B;  1YIJ I;  1JJ6 C;  4HSR A;  5D5W B;  1R6R A;  3MZ8 A;  4JYK A;  4A3C J;  3ULQ B;  1E3O C;  2O5R A;  3QWL A;  3WTZ A;  1BOA A;  2IT0 A;  5L3B A;  3OYF A;  2F5D A;  3CDH A;  1FP2 A;  2X6X A;  2OQG A;  1FX7 A;  3FXU A;  1TWF J;  1BC8 C;  1SFK A;  1G8X A;  1O4X A;  1HOM A;  2DA3 A;  2XAG A;  3G1O A;  4NBQ A;  3BJ6 A;  2JPB A;  1YW7 A;  1EKE A;  2LVS A;  1ZGW A;  2A6T A;  1ZRF A;  3JCU C;  5E1W A;  1KGS A;  2KMU A;  4M3E A;  4BL0 B;  2KQR A;  4XLE A;  2CUE A;  1Z05 A;  2CYY A;  2K9N A;  4Q5S F;  3J7A Y;  1MMD A;  1TZL A;  4FIS A;  1U3E M;  4ZDO A;  4B4C A;  1ZAR A;  3K69 A;  2O3F A;  2F4M B;  4BHP A;  2V9K A;  1TT0 A;  1KYZ A;  3ZQH A;  4IF4 A;  3RYP A;  4M6V A;  5E18 F;  1Y39 A;  2XHK A;  3ZQ7 A;  3HOT A;  2X6O A;  2M2E A;  2OU2 A;  1P7I A;  2BE5 F;  4J19 A;  4QPQ A;  2OQR A;  4I0B A;  4Y17 A;  3I4P A;  4C2U A;  4CYC B;  2Y75 A;  2IVM A;  2NNN A;  1BI2 A;  3KP6 A;  2Z1D A;  5J40 A;  2E2J J;  4IHV A;  4IRI A;  5BPI A;  1ZR2 A;  4Q48 A;  2HPM A;  3S15 J;  1MDM A;  1APL C;  4FX4 A;  2EIM H;  2JA2 A;  4U0V A;  4LLL A;  2ID6 A;  1R9T J;  3L2R A;  4IKF A;  3QQA A;  2QZ8 A;  5HLI A;  3SDG A;  3HYI A;  3WTS C;  3IH3 A;  2ELJ A;  2BY2 A;  1X4P A;  2GXB A;  3BQZ A;  3WTW C;  1K78 B;  4LB5 A;  1WQ2 A;  1U5T A;  2CH0 A;  1P4X A;  3ZN1 A;  3A03 A;  5EG0 A;  1OCT C;  4PCQ A;  3ZMV A;  5E8G A;  1XN7 A;  4U88 A;  1MGT A;  3FX3 A;  1OYI A;  5ED4 A;  4E7H A;  2P5L C;  1PVE A;  3C3W A;  2X1E A;  4LB6 B;  2LF8 A;  4LG0 A;  3K4B A;  3CLQ A;  4M6Y A;  3I58 A;  3CDL A;  1IN6 A;  2ZXI A;  2VC1 A;  4UV9 A;  4LMY A;  4EM1 A;  5K1Y A;  3D5L A;  3IKV A;  5LGU A;  1IUY A;  2VXD A;  1W5S A;  3TED A;  4JX4 A;  3KEY A;  3DKY A;  3VWB A;  3DU5 A;  3M4O J;  1EF4 A;  2NAZ A;  4KT5 C;  1IN5 A;  1VF9 A;  4DQ2 A;  2PMH A;  5HDG A;  5IPA A;  3EPZ A;  5F08 A;  4ENM A;  1OCZ H;  1XSV A;  3Q0U A;  1LVA A;  1A36 A;  1QQI A;  2WC2 A;  3CCM I;  1T98 A;  3K0L A;  5J1Y A;  3TOB A;  3KZZ A;  3H36 A;  3R0A A;  5B66 C;  1EJ9 A;  2JQ7 A;  3QU6 A;  4FT8 A;  4L0Y B;  2ZSH B;  4U87 A;  1UEL B;  5J3L A;  1WJA A;  2XB5 A;  2ZME B;  5GAH J;  5HOO A;  5K7F A;  1HST A;  3DQV C;  1JE8 A;  1TW3 A;  1CGP A;  2B0L A;  5DM7 F;  2BXY A;  1YYV A;  3M07 A;  4GGG A;  4RAZ A;  3GVA A;  5HDK A;  1OKR A;  2A5Y B;  2CGP A;  1S7A A;  4RA2 A;  1N77 A;  2KT0 A;  1QVU A;  1WFX A;  1Z77 A;  1E3H A;  3F8C A;  2LBF A;  2CW7 A;  2GA2 A;  2QWW A;  1BW6 A;  3KP3 A;  3Q3S A;  3PSF A;  4XOR A;  3J81 R;  2XGC A;  4NC8 A;  1P9Q C;  2FE3 A;  2DDA A;  4DYQ A;  3JSO A;  4IHS A;  2K85 A;  3HC7 A;  3IKT A;  3ZMD A;  3J7Y J;  5IOY A;  2BOL A;  3FXL A;  3DLL F;  2IAI A;  4E7K A;  3HKZ A;  4N0B A;  4X6A J;  3RQI A;  2FNP A;  1POG A;  4MGR A;  3BT9 A;  2HOT A;  1U9O A;  2FJ1 A;  1J59 A;  4FE7 A;  1BR1 A;  3I53 A;  4NQW B;  5LEK A;  2A6E F;  3OYK A;  4IOC F;  4A69 C;  4N9I A;  4PSX A;  4CXF A;  3N97 A;  3HBL A;  5HDN A;  3RZO J;  1S8N A;  3F6V A;  4HYE A;  4DIQ A;  1ZYR F;  3OIQ A;  2GWR A;  3FMR A;  3L2C A;  2WY8 Q;  1KON A;  3RI4 A;  2EA4 A;  3KFW X;  5IYC J;  4UUV A;  2A5W A;  1RIO H;  1W5T A;  2YU3 A;  1MBF A;  4A3G J;  1RR8 C;  2QSG X;  5EGO B;  3KYL A;  1V5G A;  2F6C A;  3DPT A;  2DA7 A;  3MCZ A;  3JRF A;  4EVI A;  1WJC A;  2BY1 A;  3FDY A;  1AA7 A;  2VBX A;  4A0X A;  1OYY A;  1FEX A;  2NXN B;  2M4G A;  3V7R A;  1YRN B;  3CP2 A;  1BR2 A;  2WBM A;  3FM3 A;  2DJI A;  2KIS A;  4UUS B;  4I01 A;  4YG2 F;  3BJA A;  1YFH A;  2HXI A;  3C7J A;  1HQC A;  1A35 A;  3K4L A;  2F5E A;  2Q2E B;  1GV2 A;  1JKQ C;  1ETX A;  3I5U A;  1F1Z A;  1YW9 A;  3T8T A;  1HW5 A;  1JHF A;  1MIJ A;  3LSI A;  3HIF A;  4RB0 A;  2LMD A;  1SFU A;  3S2W A;  1WI9 A;  3I59 A;  2JMW A;  3CC7 I;  3G4S I;  1JXS A;  3OS0 A;  1AKH B;  5FLX K;  3A01 A;  5F0C A;  5EZH A;  4W1U A;  2VQH A;  3FBI B;  2CG4 A;  5TJJ A;  3REO A;  4HLX A;  3M9A A;  1C0W A;  5IYB J;  4RAF A;  3I55 I;  2E7X A;  4XOP A;  4D7N A;  3FHN A;  2V1N A;  1FP1 D;  2QQ9 A;  1HKQ A;  4BBR J;  5E3N A;  3B6C A;  2R7D A;  1HCR A;  2CW0 F;  3RKY A;  1JTY A;  1MKM A;  5JLW A;  2NVQ J;  1MZB A;  2VB6 A;  3NWT A;  3DPL C;  1PYV A;  2EZI A;  2EIL H;  4M3D A;  1XMA A;  4RDU A;  1OCC H;  1W1W E;  3KZI C;  2LY9 A;  1K79 A;  4YEJ A;  1KA8 A;  3VOE A;  5TIS C;  2R7S A;  3PIO F;  4ZYG A;  2IA2 A;  4EGZ A;  1RKT A;  1UMQ A;  2FOK A;  2LYC A;  3CCU I;  4V19 K;  3BG7 A;  4RB3 C;  2BGC A;  1H9G A;  1UCR A;  3HHG A;  1JT0 A;  4B8X A;  3BTJ A;  3H9Q A;  2I8D A;  4O6J A;  5L3C A;  2UWM A;  3SFI A;  3T8R A;  1S7O A;  1R22 A;  1XGM A;  5KAI C;  3GLX A;  4D9J A;  3F23 A;  1IN4 A;  2PMZ A;  4IOA F;  1IDZ A;  2KZV A;  2PLY A;  4M73 A;  3RKX A;  2DMT A;  3EET A;  2L7Z A;  4ENJ A;  2XSJ C;  2FML A;  5L3E A;  2HDD A;  1MMA A;  1LKX A;  4IL6 C;  3HGG A;  2W82 A;  2E2H J;  2VKV A;  1RQ6 A;  5F04 A;  5J8F A;  1SAN A;  3Q9S A;  4AM3 A;  5IT9 Z;  1DU6 A;  4RB2 C;  1MND A;  2KJC A;  3OYB A;  1FSE A;  4UVB A;  4MFE A;  4BE0 A;  5IP7 J;  2H27 A;  1X19 A;  5FJ8 J;  5BQT A;  4MFD A;  2X1D A;  1N75 A;  4RGU A;  1P6R A;  4B43 A;  4CYC A;  4P9F A;  2MH9 A;  4LIU A;  4B1R A;  1VQK I;  3A0B C;  2XF6 A;  4XKW A;  2E34 A;  4CH7 A;  1EH6 A;  3ZN0 A;  4ZC3 A;  2QYO A;  3GTP J;  1WGX A;  1MSF C;  2VI6 A;  2DQR A;  2DT7 B;  2OC6 A;  3GBG A;  1LB2 A;  4XSZ F;  1YOV B;  4D1Q A;  3KEQ A;  1O3R A;  1CQT A;  2EK5 A;  3G1M A;  2G9W A;  1UG0 A;  2MG4 A;  4LGW A;  4G7O F;  3S1N J;  4CCN A;  3AG1 H;  2CV1 A;  2X0L A;  3Q9V A;  3ELK A;  3CCV I;  3OSG A;  1WJF A;  2X85 A;  2QVO A;  3TL4 X;  4F93 B;  1S72 I;  3M8F A;  4BXU A;  5LHG A;  3RDI A;  2XVC A;  2L3D A;  4ZYE A;  3EYY A;  1HW2 A;  1SAU A;  3PO3 J;  3HB9 A;  1VQO I;  3F8F A;  3K7A J;  1ENH A;  5B1B H;  4OU0 A;  4XRF A;  4ZYD A;  3I4N J;  3T1B A;  1R4N B;  2BVM A;  5D4R A;  3K70 C;  1JKP C;  2MC4 A;  5D6E A;  3ZR8 X;  1HDD C;  1DU0 A;  4JX6 A;  3O2P E;  3ZMZ A;  3SYT A;  2KDZ A;  5CVI A;  2W48 A;  3OYI A;  1L3L A;  2Y48 A;  1E2X A;  3HRU A;  1ETO A;  1OR7 C;  3BZK A;  5CQE A;  3U1K A;  1Z3X A;  4BKX A;  1AWC A;  2AXT C;  2D2W A;  2KLO A;  4A3F J;  1YI2 I;  3WU0 A;  1YX3 A;  1DP7 P;  1XDU A;  2XIG A;  4CHU A;  2JN6 A;  2DOF A;  3TDU C;  4NB5 A;  4MHG A;  1VQ5 I;  2XAS A;  3OYN A;  1DPR A;  1ONV A;  3L2V A;  6PAX A;  2VPL A;  4XSX F;  1IGN A;  2H94 A;  2DPD A;  2QSF X;  2STT A;  1GUU A;  3V7C A;  1B8I B;  3OOU A;  4YEL A;  3M8E A;  1R5G A;  1TW2 A;  5FGM A;  3J7A W;  2RNJ A;  2KZG A;  2W24 A;  2YUS A;  3CUO A;  5JHF A;  3ZQQ A;  2ZME A;  4M9S A;  3MD2 A;  4XN3 A;  3COA C;  1SVM A;  4DJA A;  3S1Q J;  2R7O A;  2DT5 A;  5C3E J;  2EFQ A;  3F72 A;  2CMP A;  5EYR A;  1JTX A;  5HLH A;  3SFZ A;  3FK7 A;  4HF1 A;  4BE2 A;  5FRN A;  2DOD A;  1NHA A;  1PJR A;  3E0J B;  3LSR A;  3J7A O;  1BL0 A;  5FLV A;  4CO8 A;  3FWE A;  4AIH A;  2HQA A;  1R1V A;  1FBQ A;  5BS6 A;  2H8R A;  4BJ6 C;  3NAR A;  4RM3 A;  3E5U A;  4YFK F;  2GXA A;  2BHY A;  1EA3 A;  3JRH A;  2ZC2 A;  4HDV A;  2CQQ A;  1BIB A;  3H3U A;  3HPH A;  1RRJ A;  4XID A;  4IHX A;  1HKS A;  2O0Y A;  1B4A A;  4HST A;  2HZT A;  1RI7 A;  1W0T A;  2LY2 A;  3AG2 H;  3FMS A;  1MD0 A;  2ELH A;  5AIP A;  4A3D J;  1HBX G;  4AU7 A;  2CUF A;  3KZY A;  4XKC A;  3DKW A;  2NRA C;  1P7J A;  3K1M A;  3LA3 A;  3HTU A;  4ENN A;  4L0Z B;  1O7F A;  2K5C A;  2V79 A;  3FXO A;  4JOM A;  4NQW A;  4ASN A;  1F5T A;  3H35 A;  4M72 A;  1H89 C;  3K2A A;  5KAF C;  4BH9 A;  3MKY B;  1Z0X A;  2A07 F;  3X2Q H;  2A69 F;  4BUP A;  3G6E I;  1NG7 A;  2QF7 A;  2ZJP F;  1ETQ A;  2VAS A;  5EGO A;  1TWG J;  3Q0V A;  3H3Z A;  1JKO C;  4LFU A;  3CTA A;  3BG5 A;  1WZ2 A;  2CRG A;  4A3E J;  3CUQ B;  2OZU A;  3GFL A;  5EF6 A;  3LMM A;  2ID3 A;  4RGS A;  2LNB A;  2P4W A;  4A3J J;  3F8N A;  4OIN F;  1E0E A;  3MMY B;  4UUS A;  4XLC A;  4PJN A;  1BR4 A;  1NK2 P;  1ZLK A;  1JUP A;  3CMY A;  2HEO A;  5K5Q A;  3HGY A;  4JK1 X;  3H9G A;  1U8R A;  2F5F A;  4HF2 A;  4PFP A;  4A6D A;  2Q2E A;  3WHC A;  2G7H A;  2GOM A;  4ZJZ A;  5C4J J;  1F43 A;  1UHS A;  3D0S A;  1MBJ A;  5J4V A;  1DQU A;  1QGP A;  1J5Y A;  2CQK A;  1AKH A;  1PDN C;  1W4M A;  3BLY A;  2PFB A;  3ABU A;  2EJR A;  2R7R A;  2AHQ A;  4R1H A;  1G4D A;  3V8K A;  2KRF A;  2P8T A;  4AIJ A;  2O03 A;  3BR5 A;  2EPF A;  1REP C;  4ITV A;  4LLN A;  3WTX C;  1XSX A;  3RZD J;  2DPU A;  5J4Y A;  5J1U A;  2HPI A;  1FMW A;  2EZK A;  3DXJ F;  2M1B A;  4EJT A;  3GX4 X;  1MMN A;  2FX0 A;  2JVG A;  3U9G A;  3LSP A;  5LD2 C;  4PJL A;  2NVT J;  2R7V A;  2IP2 A;  5E17 F;  2E1N A;  2R7X A;  1IC8 A;  3WGG A;  5KCM A;  4IHY A;  5LHH A;  3CCJ I;  2D45 A;  2Z33 A;  1YW8 A;  2HYF A;  3KET A;  3CCL I;  2E1O A;  2OAZ A;  3PUF A;  3QPT A;  3LL7 A;  3E1S A;  3VFZ A;  1KU9 A;  3DTE A;  3ZQC A;  2KIF A;  3U2R A;  3DEU A;  1Y56 A;  3TW6 A;  1IF1 A;  1BA5 A;  1ZKG A;  1U9N A;  1FJL A;  1HA8 A;  1XCV A;  4AD9 A;  2PMZ N;  1TNT A;  2BW3 A;  3G2B A;  3T0Y A;  2Q0O A;  3ZMU A;  3ABM H;  3RTR A;  4A3I J;  3HOU J;  5CVJ A;  1BM9 A;  4DW6 A;  5LRR A;  1FIA A;  4II2 A;  4XL9 A;  4IX7 A;  4Y33 A;  2LKX A;  3J80 Z;  1LFU P;  4UY8 I;  3M7G A;  3GTQ J;  1LNW A;  2LLK A;  3ZCO A;  2BVL A;  3I9V 2;  3S17 J;  3GWZ A;  2M7B A;  4FE4 A;  2NS0 A;  3S8P A;  4MEX F;  2LSO A;  3W6J B;  2XRO A;  2HQ5 A;  3KCC A;  1I50 J;  4D5C A;  1M1E B;  5H6R A;  2VKH A;  1RPW A;  3WTU C;  1W5C C;  4M3B A;  1R1U A;  2VKE A;  2XKO A;  3L09 A;  3V42 A;  2OCC H;  3LSG A;  3WOD F;  2R93 J;  1BI3 A;  1GV5 A;  2ESH A;  2BBY A;  1YLF A;  2W84 A;  3IP4 B;  3TDZ C;  3KP7 A;  4QLC U;  1Z6T A;  5FLX R;  1U8B A;  3F3X A;  1ETV A;  2E1M C;  1X3W B;  2COB A;  5DUK A;  4WXH A;  3FMQ A;  2COM A;  2WB1 A;  2HU9 A;  4N4O B;  2Q8K A;  2R3S A;  3OIP A;  4BY1 J;  1IV6 A;  2P6S A;  2VQC A;  4XLF A;  1QPI A;  2NOG A;  4HG2 A;  3QYB A;  2DO7 A;  1TWA J;  1XX5 A;  3MWM A;  4IO9 F;  2MSY A;  2YX7 A;  4OAY A;  1UFM A;  5H6Q A;  2D1H A;  2JRT A;  3HJE A;  5LLQ A;  3HOW J;  2FQ3 A;  3CC2 I;  5A2Q Z;  1MBE A;  5BOX A;  1D1B A;  3QYF A;  2XF7 A;  4LOC A;  1O3S A;  3H5R A;  3PSI A;  5DUI A;  4U0W A;  2MBF A;  4E70 A;  3OR1 C;  3F0C A;  3LAJ A;  3U21 A;  3CDI A;  1X1P A;  2JK3 A;  2K02 A;  3E5Q A;  3QAH A;  5HNH A;  1VQM I;  2LK2 A;  2OA4 A;  2JA7 J;  2ECB A;  4KIS A;  1RZ4 A;  4PZJ A;  1TTY A;  3A2K A;  2E1C A;  2LC2 A;  3V4G A;  2E60 A;  2E35 A;  3HHH A;  1X58 A;  3N4M A;  5J47 A;  3RPU D;  3SZT A;  2M9H A;  3EUH C;  3W6K B;  2Q1Z B;  1BIA A;  4ZDL A;  2NS7 A;  3NAU A;  3WHB A;  4KN4 X;  5KNL A;  3FF5 A;  2OPT A;  4FTH A;  4G7Z F;  2OUM A;  1KQ9 A;  4BQA A;  2J5P A;  3B02 A;  2CQN A;  4YIR X;  3GYH X;  1QRY A;  1T6S A;  4G6D A;  3GZ5 A;  2ZKZ A;  2IXS A;  3MKZ A;  3ESW B;  1FC3 A;  4I76 A;  3L00 A;  5BPD A;  4MTD A;  4HX4 A;  3DP7 A;  1B72 B;  4OIR F;  1K6O A;  2MZ4 A;  1XG1 A;  2HXO A;  3TO7 A;  5CVR A;  5JI6 A;  2X9D A;  1IDY A;  2XV4 S;  4NC7 A;  1G6N A;  4HX7 A;  5LHI A;  2HOE A;  4ESJ A;  3KEO A;  1L0O C;  3S3M A;  3WG9 A;  1A31 A;  3LSM A;  4PFO A;  2KRC A;  3K1P A;  1IAW A;  5D6F A;  1B9N A;  2Y2Z A;  2H1K A;  5E1X A;  4HBL A;  2M5W A;  4BDY A;  1VQN I;  3BR3 A;  1QBJ A;  1K6Y A;  3JR9 A;  1ULY A;  2DK8 A;  1VQL I;  5GAE J;  5CLS A;  2IJL A;  4XON A;  4YFX F;  3M3Y J;  5CKT A;  5CVV A;  5HS8 A;  2F2E A;  3LSH A;  3L2Q A;  1HSJ A;  1BI0 A;  2EIJ H;  1KU2 A;  3FIW A;  2DOE A;  1T95 A;  4MQV A;  3JRI A;  4N4N B;  3R60 A;  4DBR A;  3WGI A;  3MVP A;  2ACJ A;  2QUF A;  2CSO A;  2UZK A;  4F91 B;  4RS8 A;  1PP7 U;  4ANJ A;  4BJ5 C;  3CJT B;  3W2A A;  2Z2S B;  4L5E A;  2ZXJ A;  2GIZ A;  1S5L C;  3WU1 B;  2R4G A;  3ZQL A;  2KDO A;  1LUJ B;  3BPX A;  2Y69 H;  4F55 A;  3PFI A;  1ITY A;  2DTR A;  4W97 A;  2ESN A;  5D8L B;  4DZP A;  3HTS B;  4G12 A;  5EEA A;  3I64 A;  3BP8 A;  4MTE A;  1ZLJ A;  3OOP A;  5JHU A;  4BS9 A;  2PN6 A;  2HDW A;  1S9H A;  4GXO A;  2DT6 A;  2VXZ A;  1T08 B;  3MKW B;  4JP0 A;  2V1X A;  1QPM A;  3CMM A;  2RRE A;  1LJ9 A;  3GTG J;  2DMQ A;  3K4J A;  4JBA A;  1LDD A;  1Q1H A;  3ZQI A;  1FOX A;  3OY9 A;  1YIT I;  4OIO F;  4Y13 A;  2P0T A;  3IV5 A;  2WAE A;  4RAG A;  3HRT A;  2CQ7 A;  3G3Z A;  2FMY A;  3CC4 I;  2GM4 A;  3LQQ A;  3QYE A;  1E17 A;  2PX9 A;  4CCK A;  1YHQ I;  2A3S A;  2IGN A;  3CUQ A;  2M0M A;  3DV8 A;  4KT6 A;  4ZDP A;  3ABL H;  5C4X J;  1Z1D A;  4U7B A;  3V8L A;  3O8G A;  4GYG A;  2VT2 A;  3DKX A;  1V5E A;  4DOZ A;  3F8B A;  2CUZ A;  2RDP A;  4BNC A;  5EZG A;  2B63 J;  4GYI A;  2RAE A;  4IJA A;  3VYS B;  4D7M A;  3S2H J;  3FXK A;  2FOW A;  1LDK B;  4C3I J;  2F4O B;  1U2W A;  2EZL A;  2I10 A;  3TP3 A;  1MJB A;  2L2O A;  3GXO A;  3OYD A;  3E6C C;  4I7H A;  3WE2 A;  5F6F A;  3GFI A;  2JUC A;  4ZTJ A;  3C2G A;  5HS7 A;  4BXF A;  1HLV A;  2QKM B;  2HDC A;  1UAA A;  2FBK A;  2Y0M A;  2A05 A;  1MNM C;  3BWG A;  3LWF A;  1H0M A;  3VSK A;  2XPW A;  5EJC A;  4BU2 A;  4LJZ F;  3RPQ A;  2RKH A;  1FYK A;  1WJ5 A;  3HOY J;  3BTI A;  5HLG A;  3GZN B;  4QWQ A;  3ZMT A;  2DOA A;  3QPH A;  4EJV A;  2PBI A;  3G73 A;  4BXX J;  3BZ6 A;  1ZGA A;  2R5Y B;  1HF0 A;  1TWH J;  3FXM A;  1YQA A;  1MJA A;  3FKI J;  4A5M A;  4M3F A;  2V7F A;  1G59 A;  2M30 A;  3JW4 A;  2WV1 A;  4XIC A;  3H1C A;  3WTV C;  2M87 A;  3E6D A;  1D3Y A;  2HTS A;  4ESF A;  1I6X A;  4KIC A;  2YPR A;  2A6H F;  2WTE A;  2ME0 A;  1S6L A;  1R5I D;  2DFH A;  4L9J A;  5FKN A;  1SAX A;  1ZTR A;  2V4J C;  3GO5 A;  3I71 A;  3UKG A;  1S7E A;  3E6M A;  4HV6 A;  5M5Y J;  3BOQ A;  1MBK A;  3KX2 A;  4Y15 A;  2RV8 A;  1O57 A;  3WTY C;  3O3K A;  3KE2 A;  2H1L A;  5LRS A;  1Y0U A;  3IH4 A;  4Q4Z F;  4ENK A;  1D5V A;  5KVR A;  1MBH A;  4HZF A;  3S16 J;  4X1E A;  3S3O A;  4DNC A;  1DP3 A;  2JA5 J;  4YFN F;  2WB1 N;  1F36 A;  1S29 A;  5IT9 K;  2X6W A;  1X4O A;  2G0E A;  1GXQ A;  3UR3 C;  3CCE I;  2DN0 A;  3BG6 A;  5FKL A;  4UB6 C;  1D5Y A;  3BC8 A;  5DS9 A;  2B7E A;  3C1D A;  3Q5F A;  1FMV A;  5DCM B;  1EV7 A;  1RKW A;  2QCO A;  4EJO A;  3QU3 A;  1VTN C;  2QSH X;  2XPV A;  2ZCW A;  3GF2 A;  4LK0 F;  2CFO A;  1X1D A;  2X98 A;  1GLN A;  2PEX A;  2DCE A;  2ZNY A;  2R7Q A;  1KYW A;  2ZNZ A;  3ZQG A;  3TO6 A;  2XSD C;  2K40 A;  3H0G J;  3EUA A;  3JAM Z;  1MJ9 A;  3DCF A;  5L3G A;  2IA0 A;  2MC3 A;  1J2X A;  2RQP A;  2LOO A;  1IRZ A;  2BHZ A;  3OYG A;  4CCO A;  4KIG A;  2W00 A;  4A0Z A;  1FNN A;  1QHG A;  1LEA A;  2Y9Y A;  1T0F C;  3OYH A;  4OIP F;  4C9Y A;  3TQN A;  2M34 A;  2ZO4 A;  4E7J A;  1USS A;  2JWT A;  4XKV A;  5AIQ A;  5F0H A;  5DEQ A;  4KJZ A;  2W4S A;  1ZRC A;  3MAJ A;  3NWS A;  4XLA A;  5BMZ A;  4F92 B;  4KYW A;  2M35 A;  2Z99 A;  4L5I A;  4WCG A;  3PQJ A;  2UV1 A;  4RLQ A;  1V5F A;  3HOS A;  1KQ0 A;  2DU9 A;  1H9T A;  3FXJ A;  5D4S A;  4KMF A;  3ZMS A;  3W2V A;  4CCM A;  2F4I A;  3F6O A;  2LP0 A;  2GXG A;  3WGH A;  3K4M A;  2JT1 A;  2M3A A;  5LFA A;  1EH8 A;  2EIK H;  4FCY A;  1QA6 A;  2LY1 A;  1QZY A;  5DV5 A;  4E7Z A;  1HC8 A;  5F0F A;  1B72 A;  2R92 J;  2XAQ A;  3K2Z A;  4HNV A;  4KUM A;  4C2M J;  1STZ A;  4BHB A;  1DPU A;  2H6C A;  2AQF A;  4ZH4 F;  3HL2 A;  4IHW A;  2FEZ A;  4A3K J;  2XB0 X;  2ISZ A;  3JTH A;  3JRB A;  2XAJ A;  3ZPL A;  2XF5 A;  3R4K A;  2HVS A;  2JSP A;  2KRH A;  2HS5 A;  3DLA A;  1K78 A;  1VND A;  1XMK A;  2RQQ A;  4S0H B;  3AG3 H;  3T5X A;  4A93 J;  1FOY A;  2FD5 A;  4EAT A;  3KYC B;  5JVG F;  1WH5 A;  2D5V A;  1D0Z A;  2K4J A;  1GXP A;  2JUG A;  1ZHF A;  2KPM A;  1IXC A;  1TBX A;  3RSN A;  1HW1 A;  4HQE A;  4EEF G;  3PIP F;  1A5J A;  2EA2 A;  2B9S A;  1WVR A;  2MYS A;  3FKJ A;  2DYR H;  3J7Z I;  3DBL B;  3IAM 2;  2F48 A;  4HA8 A;  3RCO A;  5M3M J;  1I27 A;  3BPV A;  3TO9 A;  2O8K A;  2YU9 J;  2EFP A;  1YTY A;  1LE8 B;  4M74 A;  1R36 A;  1TQP A;  2H6B A;  3F8M A;  4ON0 A;  1FTZ A;  1TC3 C;  2RNG A;  2ZFU A;  1DGR M;  2CS3 A;  1ON2 A;  5FO5 A;  2BV6 A;  4LG3 A;  4PK4 A;  3SHF A;  5HLT A;  3OYL A;  3ECO A;  4FQG A;  1FSH A;  3PNV A;  4F3Q A;  5K7Z A;  2AO9 A;  3LQR A;  3MKL A;  1WRJ A;  4V2F A;  1R23 A;  5KHD A;  2AQE A;  1SFX A;  2F5V A;  1DDN A;  3HDD A;  3ABK H;  1KU3 A;  2P7V B;  3CJR B;  3R61 A;  5LBQ A;  1LEB A;  2MFZ A;  3AL0 C;  2CO5 A;  4OWR B;  4BAY A;  2MW8 A;  3H3V K;  5FKO A;  1EH7 A;  5FRM A;  4CSW A;  2EQR A;  1SD7 A;  2QKL B;  4C3J J;  1TNS A;  2R7W A;  1FBU A;  2PI0 A;  1ETW A;  1KZH A;  4WXD A;  4CYD A;  2HVR A;  5GPC A;  1FOW A;  1V54 H;  2XDV A;  4EM0 B;  2VJ4 A;  2FUG 2;  4HLY A;  2VUM J;  3BCB A;  5JFR A;  3P9I A;  1ZG3 A;  2N8G A;  4G7H F;  4PGG A;  2L9N A;  1Y1W J;  4KFC A;  1MMS A;  2LRE A;  2WAQ N;  2DMN A;  5CQG A;  5F1J A;  2VBZ A;  3ZXS A;  2PQ8 A;  4U0Y A;  2XKP A;  2DMP A;  5IP6 A;  2JRM A;  3CES A;  3L2W A;  5TRD A;  2ZBK A;  3DEE A;  2FNA A;  2MA3 A;  2K7L A;  3I0T A;  1YE9 A;  3ISP A;  3DEW A;  3K1N A;  2K9L A;  1B6A A;  4XLN F;  5EDN A;  2O6G E;  4Y3O A;  2VOD A;  2K27 A;  5ICC A;  3P9C A;  3HUG B;  1TQI A;  2AXL A;  2O8X A;  3DWL E;  1RC9 A;  3OL4 A;  4HNU A;  2R0Q C;  1K4T A;  2STW A;  5M5X J;  4L18 B;  2QBY B;  1OYW A;  2R5Y A;  5B3S H;  2VBW A;  2OD5 A;  1D1A A;  3HRM A;  2DAO A;  3HZJ A;  1U78 A;  3B73 A;  4DBQ A;  1YRN A;  2DJN A;  1O3T A;  3NQO A;  3ASN H;  1UG2 A;  4PSW A;  4QSH A;  3CF2 A;  2FU4 A;  2LTP A;  1JT6 A;  3J81 Z;  2XGD A;  4AWX B;  2LF7 A;  2IGK A;  3MFK A;  2IPQ X;  2M0C A;  2EFW A;  4U7D A;  3HM5 A;  3PJR A;  4KIB A;  2RGV A;  1N25 A;  1WH7 A;  4PJM A;  2XC7 A;  4RLF A;  3TBI A;  5L3D A;  2JA8 J;  3C2B A;  2V6C A;  4PUS A;  4A5N A;  1U5T C;  2MVT A;  2QA4 I;  2O9L A;  1IJW C;  1QVT A;  2LH9 A;  1ZEL A;  3HSF A;  4NUB A;  3RJP A;  3TOA A;  1LFP A;  3FZV A;  4G6T B;  3RKW A;  4XKB A;  3JRA A;  4A12 A;  1OCP A;  4AYB N;  4XRM A;  3J80 K;  4I02 A;  2KIM A;  1NK3 P;  3CCQ I;  2DA2 A;  4M9X A;  1WCM J;  1ZQ3 P;  1U0J A;  3EDP A;  1WPK A;  3VYU B;  3FM5 A;  1D8K A;  4IHT A;  4AID A;  2E71 A;  2Z5U A;  4GDF A;  3ROU A;  2E5Z A;  3BZC A;  5ERI A;  2HVQ A;  1Y0N A;  2FBH A;  3SJM A;  1ODD A;  3E5X A;  2IS6 A;  2E1M B;  4K2E A;  1IRG A;  1UST A;  1BC7 C;  4Y7N J;  3O8H A;  4IRG A;  4XBF A;  3OYM A;  5IP9 J;  4DGW B;  2IEK A;  1V55 H;  4BDZ A;  1K7A A;  2Y30 A;  5DCM A;  4JX5 A;  2CU7 A;  3IH2 A;  3KIO A;  2MLG A;  3GTO J;  2NVU B;  5FD5 A;  2VQL A;  5CJ9 A;  3S32 A;  2BY3 A;  1WHU A;  2QM3 A;  1IXR C;  1MMG A;  1UHM A;  4UVC A;  4HOB A;  3S2D J;  2HYJ A;  1X2M A;  1TP4 A;  2DTZ A;  2WAF A;  4M71 A;  4BAC A;  4P1W A;  3LSJ A;  3ERE D;  2Z9O A;  4RGX A;  1O7L A;  3PUB A;  2X6Y A;  3OIO A;  2C6Y A;  2BEO A;  3D1N I;  4FET A;  4BHC A;  3EYI A;  3BDD A;  1WJB A;  2VE9 A;  2K9S A;  3CUQ C;  1J0R A;  5DTD A;  4EV0 A;  5H2F C;  4I98 B;  2XRN A;  1X1C A;  1H88 C;  4XOT A;  3BR6 A;  4PJJ A;  3DFG A;  3RPU A;  3I56 I;  4IZZ A;  4RGR A;  3BG9 A;  2JPC A;  3A4C A;  4XLH A;  1XB4 A;  4NHJ A;  4S04 A;  1B1B A;  3ZOB A;  1OR7 A;  4HNT A;  2JTV A;  1FYL A;  1W36 C;  4A3B J;  1XCB A;  3HXL A;  2L9V A;  3I59 B;  3GTM J;  2OJE D;  3O6B B;  4E7L A;  3W6V A;  2ZXH A;  2LFB A;  2P6T A;  4NC6 A;  4BJT A;  2DA1 A;  1IRF A;  3M1E A;  1JUS A;  1V4R A;  5HNF A;  1VQ9 I;  1X1B A;  4GCV A;  4XK4 A;  2VOP A;  4XM3 A;  2IBD A;  5IT9 R;  2ZJQ F;  4I2O A;  5ICG A;  1W7P D;  2AS5 F;  2CV2 A;  2GIV A;  3OS1 A;  3ZGK A;  2RN7 A;  3C18 A;  3H5A A;  1JHH A;  4OAZ A;  2W85 A;  1IG7 A;  4UB8 C;  3HOZ J;  2A68 F;  3JRC A;  1JI8 A;  2NNY A;  3S93 A;  2V9P A;  3U1D A;  1XS9 A;  3V7S A;  3OS2 A;  3OMY A;  3CCS I;  2P0W A;  1VZ0 A;  1YJ9 I;  4IXA A;  3PM1 A;  2OCE A;  3K70 D;  4BBS J;  2HR3 A;  4LK1 F;  4RMN A;  2DK5 A;  2HFH A;  2W7N A;  1BW5 A;  2Y0S A;  1IN8 A;  3G1L A;  3LA7 A;  3GLL A;  3R0J A;  5FKK A;  1T39 A;  3DPU A;  3RKQ A;  4I0A A;  1LE8 A;  4A6E A;  2P5K A;  1XD7 A;  3F22 A;  3K6G A;  1GVJ A;  1Z7U A;  3CJQ B;  4UXN A;  1YS6 A;  1ERD A;  3S1R J;  3AFH A;  2P7C B;  4PGH A;  1UZC A;  3BTL A;  5DD8 A;  2IS4 A;  4KIF A;  4KA4 A;  3OL3 A;  1IUF A;  4AUX A;  3S3N A;  1R1T A;  3BY6 A;  5FD6 A;  2DXI A;  3AAF A;  1Z3Y A;  1IXS B;  4E6K G;  1N78 A;  1QZZ A;  3K4K A;  1OJL A;  4XMY A;  1XC5 A;  4TV7 A;  3SEZ A;  2VON A;  4S05 A;  3QOP A;  2RC4 A;  3BRO A;  1DGW Y;  4XN0 A;  1D1C A;  2V6E A;  4Y4R A;  2R7F A;  1QU3 A;  2XPU A;  2IS2 A;  4E7S A;  2HOA A;  1I1S A;  1XGN A;  4OMY A;  4A3L J;  1AOY A;  3KYD B;  5LEJ A;  1T8I A;  2L9S A;  3PNT A;  3E3V A;  2EWN A;  2ECC A;  2ZJ2 A;  3OYE A;  4LD5 A;  4L9N A;  4EJU A;  3JRG A;  5ILV A;  4UUT A;  4I6Z A;  2HQN A;  3RIR A;  4YII A;  4L9V A;  3GUD A;  2MD5 A;  2VLA A;  2ELK A;  4E7I A;  3S1M J;  3ABT A;  1X2N A;  3H9J A;  2CJJ A;  2ZB9 A;  2R7T A;  4BQO A;  3ERM A;  2PJP A;  2CW8 A;  1K4S A;  1ZN2 A;  5LGN A;  4B48 A;  2KIQ A;  1SEU A;  4I09 A;  4M9Z A;  4G94 A;  3BTC A;  3CP8 A;  5J8C A;  5LGT A;  3MZY A;  1LQ1 A;  1VQP I;  4O5V A;  1UJ8 A;  4B3A A;  4CCJ A;  3L2U A;  5FB2 A;  2IW5 A;  2YS9 A;  1Z9C A;  4ZZL A;  3BJO A;  4RM2 A;  3GTL J;  5FKM A;  3HUG A;  1BBY A;  1P92 A;  3BCA A;  1A6Q A;  4MIM A;  4I99 C;  2QGU A;  5KK1 A;  4EM2 A;  3KLO A;  1BN5 A;  2ZXW H;  3LST A;  1V3F A;  2HNH A;  1VQ7 I;  4HF0 A;  2E2I J;  3QP5 A;  2TCT A;  1PUE E;  2QBY A;  1OQY A;  2MH2 A;  4MNU A;  1QHH D;  4UNO A;  3S14 J;  1FYM A;  1NG6 A;  2E7W A;  4G8X A;  5L3F A;  2GLO A;  2V1U A;  4JQF A;  3K9T A;  1SD4 A;  4BQQ A;  2HYG D;  2Y31 A;  1FWZ A;  4B47 A;  2OZ6 A;  2L5Q A;  3RYR A;  1OCO H;  2WY7 Q;  4C30 A;  1J75 A;  5E3O A;  5JR3 A;  1IW7 F;  2CV0 A;  2J5O A;  3SZG A;  3KP2 A;  2BXZ A;  3IAS 2;  1VFC A;  4KN7 X;  2QLZ A;  2WAQ A;  1AU7 A;  3PO2 J;  3EQL F;  2O61 A;  1D0X A;  1I5Z A;  2KIU A;  2PJR B;  3LFK A;  5ILS A;  2LKS A;  4M6X A;  3TKY A;  1T33 A;  2CWE A;  3FIS A;  4QIW N;  5D5V B;  2FBI A;  1FZP B;  3I4M J;  2NS8 A;  2P5V A;  3OYC A;  1GHC A;  2CUJ A;  3K4N A;  4ZZD A;  3JTG A;  2K3P A;  4HX8 A;  3PNY A;  1RUO A;  1HKT A;  1OCR H;  1WWX A;  4UVA A;  2MAB A;  3LNQ A;  2K86 A;  4IEJ A;  4H4K C;  1K83 J;  2K9Q A;  2LKP A;  1G3Y A;  3GME A;  4M3G A;  2HKO A;  4V2G A;  4BEH B;  4D0P A;  3CME I;  1JGG A;  1J9I A;  3BR0 A;  3IL2 A;  1LFB A;  1I39 A;  1R49 A;  3IWF A;  1VQ4 I;  3SXY A;  3E7L A;  4CZC A;  2K3F A;  3VOD A;  1WI3 A;  1OIS A;  3CD6 I;  3OYJ A;  4RBO A;  1XMX A;  3GCM A;  2VE8 A;  1A04 A;  3MEX A;  5D5U B;  2L02 A;  4NNJ A;  3FHZ A;  1NH3 A;  4C2T A;  3BQY A;  2EZH A;  1HXD A;  1AHD P;  4H0E A;  3JRD A;  4MEY F;  2KJB A;  1TWC J;  1RR7 A;  1OLT A;  1I3A A;  3VPR A;  1WSU A;  3FXQ A;  3V8J A;  3IUO A;  1HDP A;  2HI3 A;  3P5J A;  5JVT A;  2E19 A;  2ZME C;  5ICF A;  4DYR A;  3EUK L;  4X0G A;  4PJ0 C;  3JAM K;  3VYR B;  2DQL A;  2GZW A;  1X1A A;  3IRR A;  2P81 A;  2VL8 A;  4OOI A;  4AVZ A;  2R5Z B;  1Z6R A;  4EGY A;  2M7A A;  4CUG A;  5M3F J;  4KMU X;  4A3M J;  3QOE A;  1MH3 A;  3W3C A;  1SMT A;  1X3Z B;  3EUH A;  4A0Y A;  1ZG5 A;  2M8E A;  4OMZ A;  1SD6 A;  2O7O A;  5GTH C;  3H5N A;  3GTK J;  4AYB A;  3OV8 A;  5HS9 A;  1W36 D;  2UXN A;  1Z91 A;  1SFO J;  1R5H A;  4L9T A;  4EQQ A;  4E4H A;  2DDB A;  2W1O A;  3AG4 H;  3DTK A;  4KNY A;  2ZJR F;  1UHW A;  3ONQ A;  2GA1 A;  3J80 R;  3GEZ A;  3K10 A;  2JVH A;  5F1R A;  3PL8 A;  2WWY A;  5DCF A;  2R7Z J;  2VC0 A;  5E3M A;  2ZSI B;  4RB1 A;  2IRF G;  2W25 A;  3E97 A;  2DLL A;  5DD4 A;  3ZRG A;  1RUN A;  2X48 A;  1JUM A;  3TGN A;  2XUB A;  2KHM A;  3TP0 A;  1G2H A;  1G3T A;  1T2K A;  4CZZ A;  1SFE A;  5D8K B;  2CQX A;  3LOC A;  3TMO A;  1XSD A;  3LFU A;  3L1P A;  1W7P B;  3B6A A;  2EH3 A;  2DYS H;  3N05 A;  1D8J A;  2M45 A;  2L01 A;  3DTI A;  4FX0 A;  2K4B A;  4B3X A;  4EJW A;  3QOD A;  3AKZ A;  2IGO A;  5F27 A;  5HOD A;  5FFX A;  2XAF A;  4ZTF A;  1I6H J;  3LA2 A;  4ABZ A;  2VPR A;  4LIT A;  2JSC A;  1GT0 C;  2G7U A;  4R8H A;  3KP4 A;  3VSL A;  1ZRD A;  2EFO A;  2Y0S N;  2HQR A;  5E8I A;  3TW7 A;  1JKR C;  3ZP5 A;  1XPX A;  5EEG A;  4PDK A;  5F64 A;  2BW3 B;  2IGM A;  4CIC A;  1FIP A;  2MLK A;  5A2Q R;  3I3L A;  5C44 J;  2DA6 A;  1WKM A;  5FLM J;  1WJE A;  2X1C A;  2GAU A;  1OFC X;  1MH4 A;  3BR1 A;  4G6Q A;  5FLX Z;  3WE3 A;  4Z2Y A;  2OTL I;  3M1C A;  1MBG A;  5E20 A;  1I1G A;  4FHT A;  2PG4 A;  4OIQ F;  2QQA A;  3FK6 A;  2DFI A;  3RQ4 A;  2YX4 A;  1CF7 B;  2CFX A;  3JSP A;  3G71 I;  2ISY A;  2XAU A;  1SMY F;  2DFF A;  3CCR I;  2EB7 A;  4MO7 A;  1PUF B;  2V9V A;  4G9Y A;  4GO1 A;  1Z21 A;  3AL0 B;  4LIV A;  3IRQ A;  3Q0W A;  3MZH A;  2L7M P;  5GP9 A;  4QPO A;  4Z6Y A;  2X4H A; 
#chains in the Genus database with same CATH homology
 1O3Q A;  1X3U A;  1FY7 A;  4Q47 A;  3MQ0 A;  4ZYH A;  4XLP F;  2OBP A;  3GFJ A;  4BYY A;  3I54 A;  3HSE A;  4P9U A;  2Z3Y A;  1FT9 A;  1PP8 F;  5D5X B;  1TQM A;  1BJA A;  2L54 A;  2HGC A;  4HQM A;  2FSW A;  1BI1 A;  4ESB A;  2EV5 A;  5ILU A;  2V1D A;  3FXR A;  4CGZ A;  2ADU A;  4LLG F;  2QEN A;  1ZG1 A;  3IHU A;  2WV0 A;  1YS7 A;  4WX9 A;  2W57 A;  2A61 A;  3GZ6 A;  2KKO A;  1JGS A;  3R6S A;  2HKX A;  2L4M A;  3SQN A;  2FF4 A;  1MDM B;  4F7Z A;  3VB2 A;  3DF8 A;  2QQB A;  3CJN A;  4UHT A;  2YSR A;  4N9H A;  3L9F A;  2D1V A;  3J81 K;  1U5T B;  4HV5 A;  2PMU A;  1IZ1 A;  1XGS A;  3L7W A;  5CVU A;  1YG2 A;  3P9K A;  4P96 A;  4HDU A;  3IWZ A;  2F5C A;  2NYX A;  4IRH A;  4B09 A;  3SZP A;  1YO5 C;  1RNL A;  4LG0 B;  5H20 A;  3GFM A;  1FPQ A;  1XGO A;  2FA5 A;  3CLO A;  2UWM A;  4CDG A;  4WXC A;  5EEH A;  4RAY A;  1G3S A;  2RVC A;  1QO0 D;  2FRH A;  1ZH5 A;  2UXX A;  1FOK A;  2VN2 A;  5AON A;  1F4K A;  2FXA A;  2HWV A;  1FBS A;  4IPA A;  3H92 A;  4AIK A;  2DI3 A;  1J7K A;  2XAH A;  2TDX A;  3QP6 A;  4A2U A;  5K5O A;  1TLH B;  3KP5 A;  3PQK A;  3E6B A;  1T0F A;  1FLI A;  2ZFW A;  1B59 A;  1LDJ A;  4AVP A;  2DBB A;  1KU7 A;  2EV0 A;  2XGX A;  3WTT C;  4P5O A;  1R00 A;  4WF2 A;  2GQQ A;  3CO7 C;  3ML6 A;  4YIF A;  1YIO A;  2H09 A;  1U6G A;  5DDG A;  2JZY A;  5HVQ C;  1XDS A;  1UB9 A;  2IA1 A;  1OMI A;  2EFN A;  1P4W A;  4EMS A;  5ICE A;  3HRS A;  4ETS A;  3NRV A;  5FFZ A;  2VOO A;  1F9N A;  1W7P A;  1QNT A;  1B9M A;  4L5J A;  5A2Q K;  3LAP A;  1ZRE A;  1OPC A;  5K5R A;  4MQ9 F;  2YR2 A;  3GW2 A;  4WWC A;  3QRF F;  2BYV E;  1P2F A;  5J6X A;  1ZAO A;  1S3J A;  4O3M A;  3CO6 C;  1P4A A;  1IN7 A;  5DYM A;  3VEP A;  2ETH A;  4IVN A;  4HAM A;  1ON1 A;  1T38 A;  2DW4 A;  4WK8 F;  3P7N A;  1G3W A;  2VBY A;  3NEU A;  5E1Z B;  2L4A A;  4HW0 A;  2EV6 A;  1CF7 A;  2HTJ A;  3HSR A;  1ZGJ A;  3KLN A;  4R79 A;  4KDP A;  1R58 A;  2VT3 A;  1KQ8 A;  2LDU A;  1SD5 A;  5IT3 A;  3F21 A;  4UV8 A;  3ECH A;  1DUX C;  5CYV A;  1R7J A;  3IC7 A;  5D5W B;  3ULQ B;  3WTZ A;  1BOA A;  2IT0 A;  5L3B A;  2F5D A;  3CDH A;  1FP2 A;  2OQG A;  1FX7 A;  3FXU A;  1BC8 C;  2XAG A;  3BJ6 A;  2JPB A;  1YW7 A;  1ZRF A;  5E1W A;  1KGS A;  1Z05 A;  2CYY A;  4Q5S F;  1U3E M;  1ZAR A;  3K69 A;  2O3F A;  4BHP A;  1KYZ A;  4IF4 A;  3RYP A;  5E18 F;  2XHK A;  3ZQ7 A;  3HOT A;  2OU2 A;  2BE5 F;  2OQR A;  4I0B A;  4Y17 A;  3I4P A;  2Y75 A;  2IVM A;  2NNN A;  1BI2 A;  3KP6 A;  4IRI A;  5BPI A;  4Q48 A;  1MDM A;  4FX4 A;  4U0V A;  4LLL A;  2QZ8 A;  5HLI A;  3HYI A;  3WTS C;  2GXB A;  3WTW C;  1K78 B;  4LB5 A;  1WQ2 A;  1U5T A;  1P4X A;  3ZN1 A;  4PCQ A;  3ZMV A;  5E8G A;  1XN7 A;  4U88 A;  1MGT A;  3FX3 A;  1OYI A;  5ED4 A;  2P5L C;  3C3W A;  4LB6 B;  2LF8 A;  4LG0 A;  4M6Y A;  3I58 A;  1IN6 A;  2VC1 A;  4UV9 A;  4LMY A;  4EM1 A;  5K1Y A;  3D5L A;  3IKV A;  5LGU A;  1IUY A;  1W5S A;  2NAZ A;  4KT5 C;  1IN5 A;  4DQ2 A;  2PMH A;  5HDG A;  4ENM A;  1XSV A;  1LVA A;  1QQI A;  2WC2 A;  1T98 A;  3K0L A;  3TOB A;  3KZZ A;  3R0A A;  4L0Y B;  3QU6 A;  4FT8 A;  2ZME B;  5HOO A;  1HST A;  3DQV C;  1JE8 A;  1TW3 A;  1CGP A;  2B0L A;  1YYV A;  4GGG A;  4RAZ A;  3GVA A;  5HDK A;  1OKR A;  2A5Y B;  2CGP A;  1S7A A;  3F8C A;  3KP3 A;  2GA2 A;  2QWW A;  2FE3 A;  3JSO A;  4IHS A;  3IKT A;  3ZMD A;  4N0B A;  2FNP A;  4MGR A;  1J59 A;  5LEK A;  3I53 A;  2A6E F;  4N9I A;  4CXF A;  3N97 A;  5HDN A;  1S8N A;  3F6V A;  4HYE A;  1ZYR F;  2GWR A;  3FMR A;  3L2C A;  3RI4 A;  2EA4 A;  3KFW X;  4UUV A;  1RIO H;  1W5T A;  2YU3 A;  3DPT A;  3MCZ A;  4EVI A;  2VBX A;  4A0X A;  1OYY A;  3V7R A;  3FM3 A;  4I01 A;  4YG2 F;  3BJA A;  1YFH A;  3C7J A;  1HQC A;  2F5E A;  3I5U A;  1F1Z A;  1YW9 A;  3T8T A;  1HW5 A;  1JHF A;  3HIF A;  4RB0 A;  1SFU A;  3S2W A;  1WI9 A;  3I59 A;  1JXS A;  5FLX K;  2CG4 A;  5TJJ A;  3REO A;  4HLX A;  3M9A A;  1C0W A;  2E7X A;  1FP1 D;  2QQ9 A;  1HKQ A;  2R7D A;  2CW0 F;  3RKY A;  1MKM A;  1MZB A;  3DPL C;  1XMA A;  1K79 A;  1KA8 A;  3VOE A;  4ZYG A;  2IA2 A;  4EGZ A;  2FOK A;  4RB3 C;  2BGC A;  1H9G A;  1UCR A;  3HHG A;  4B8X A;  4O6J A;  5L3C A;  3T8R A;  1S7O A;  1R22 A;  1XGM A;  3GLX A;  3F23 A;  1IN4 A;  2PLY A;  4M73 A;  3RKX A;  3EET A;  4ENJ A;  2FML A;  5L3E A;  5J8F A;  3Q9S A;  5IT9 Z;  4RB2 C;  2KJC A;  1FSE A;  4UVB A;  2H27 A;  5BQT A;  4RGU A;  1P6R A;  4P9F A;  2MH9 A;  1EH6 A;  3ZN0 A;  2QYO A;  2DQR A;  1LB2 A;  4XSZ F;  3KEQ A;  1O3R A;  2EK5 A;  2G9W A;  4LGW A;  4G7O F;  2X0L A;  3Q9V A;  3ELK A;  2QVO A;  3M8F A;  4BXU A;  5LHG A;  3RDI A;  2XVC A;  2L3D A;  4ZYE A;  3EYY A;  1HW2 A;  3F8F A;  4OU0 A;  4XRF A;  4ZYD A;  3T1B A;  5D4R A;  5D6E A;  3O2P E;  3ZMZ A;  5CVI A;  1L3L A;  2Y48 A;  1E2X A;  3HRU A;  1AWC A;  2D2W A;  3WU0 A;  1DP7 P;  1XDU A;  2XIG A;  4CHU A;  3TDU C;  4NB5 A;  4MHG A;  2XAS A;  1DPR A;  1ONV A;  6PAX A;  4XSX F;  2H94 A;  2DPD A;  2STT A;  3V7C A;  3M8E A;  1R5G A;  1TW2 A;  5FGM A;  2RNJ A;  2W24 A;  3CUO A;  2ZME A;  4M9S A;  3COA C;  2DT5 A;  2EFQ A;  3F72 A;  5HLH A;  3SFZ A;  4HF1 A;  1NHA A;  3J7A O;  4CO8 A;  3FWE A;  4AIH A;  1R1V A;  1FBQ A;  5BS6 A;  3E5U A;  4YFK F;  4HDV A;  1BIB A;  3H3U A;  1HKS A;  2O0Y A;  1B4A A;  2HZT A;  1RI7 A;  3FMS A;  1MD0 A;  2ELH A;  5AIP A;  1HBX G;  3KZY A;  2NRA C;  3DKW A;  3K1M A;  3LA3 A;  4ENN A;  3HTU A;  4L0Z B;  1O7F A;  2V79 A;  4NQW A;  4ASN A;  1F5T A;  4M72 A;  2A07 F;  4BH9 A;  2A69 F;  3H3Z A;  4LFU A;  3CTA A;  3CUQ B;  2OZU A;  3GFL A;  4RGS A;  2LNB A;  2P4W A;  3F8N A;  4OIN F;  1ZLK A;  2HEO A;  5K5Q A;  4JK1 X;  1U8R A;  2F5F A;  4HF2 A;  4A6D A;  2Q2E A;  2G7H A;  3D0S A;  1QGP A;  1J5Y A;  2CQK A;  1PDN C;  1W4M A;  2PFB A;  3ABU A;  2EJR A;  4R1H A;  1G4D A;  3V8K A;  2KRF A;  2P8T A;  4AIJ A;  2O03 A;  1REP C;  4LLN A;  3WTX C;  1XSX A;  2DPU A;  3DXJ F;  2M1B A;  4EJT A;  3GX4 X;  3U9G A;  2IP2 A;  5E17 F;  2E1N A;  3WGG A;  5LHH A;  2D45 A;  2Z33 A;  1YW8 A;  2HYF A;  3KET A;  2OAZ A;  3QPT A;  3VFZ A;  1KU9 A;  2KIF A;  3U2R A;  3DEU A;  1IF1 A;  1XCV A;  4AD9 A;  1TNT A;  3T0Y A;  2Q0O A;  3ZMU A;  3RTR A;  5CVJ A;  1BM9 A;  5LRR A;  3J80 Z;  3M7G A;  1LNW A;  3GWZ A;  2NS0 A;  4MEX F;  2LSO A;  3W6J B;  2XRO A;  3KCC A;  5H6R A;  3WTU C;  1R1U A;  2XKO A;  3L09 A;  3WOD F;  1BI3 A;  2ESH A;  2BBY A;  1YLF A;  2W84 A;  3TDZ C;  3KP7 A;  4QLC U;  1Z6T A;  3F3X A;  5DUK A;  4WXH A;  3FMQ A;  2COM A;  2Q8K A;  2R3S A;  2P6S A;  2DO7 A;  3MWM A;  2YX7 A;  1UFM A;  5H6Q A;  2D1H A;  2JRT A;  5LLQ A;  2FQ3 A;  5A2Q Z;  5BOX A;  1O3S A;  5DUI A;  4U0W A;  2MBF A;  4E70 A;  3LAJ A;  2K02 A;  3E5Q A;  3QAH A;  2OA4 A;  1RZ4 A;  4PZJ A;  1TTY A;  2E1C A;  3V4G A;  3HHH A;  3N4M A;  3SZT A;  3W6K B;  1BIA A;  4KN4 X;  3FF5 A;  4G7Z F;  1KQ9 A;  4BQA A;  2J5P A;  3B02 A;  3GYH X;  1T6S A;  4G6D A;  3GZ5 A;  2ZKZ A;  1FC3 A;  3L00 A;  5BPD A;  4MTD A;  4HX4 A;  3DP7 A;  4OIR F;  1K6O A;  5JI6 A;  3TO7 A;  5CVR A;  2XV4 S;  1G6N A;  4HX7 A;  5LHI A;  2HOE A;  4ESJ A;  3KEO A;  1L0O C;  3WG9 A;  3K1P A;  1IAW A;  5D6F A;  1B9N A;  5E1X A;  4HBL A;  2M5W A;  1QBJ A;  1ULY A;  2DK8 A;  5CLS A;  2IJL A;  4YFX F;  5CVV A;  5HS8 A;  2F2E A;  1HSJ A;  1BI0 A;  1KU2 A;  4MQV A;  3R60 A;  3WGI A;  2ACJ A;  2QUF A;  2CSO A;  2UZK A;  4RS8 A;  1PP7 U;  2ZXJ A;  3WU1 B;  3BPX A;  3PFI A;  2DTR A;  5D8L B;  2ESN A;  3HTS B;  3I64 A;  3BP8 A;  4MTE A;  1ZLJ A;  3OOP A;  5JHU A;  2PN6 A;  4GXO A;  2VXZ A;  2V1X A;  1QPM A;  1LJ9 A;  4JBA A;  1LDD A;  1Q1H A;  4OIO F;  4Y13 A;  3HRT A;  3G3Z A;  2FMY A;  1E17 A;  3LQQ A;  2A3S A;  3CUQ A;  3DV8 A;  1Z1D A;  4U7B A;  3V8L A;  4GYG A;  2VT2 A;  3F8B A;  2RDP A;  4BNC A;  4GYI A;  4IJA A;  1LDK B;  1U2W A;  1MJB A;  3GXO A;  3E6C C;  4I7H A;  3WE2 A;  5F6F A;  3GFI A;  5HS7 A;  2HDC A;  2FBK A;  2Y0M A;  3BWG A;  3LWF A;  1H0M A;  4LJZ F;  3RPQ A;  2RKH A;  1FYK A;  5HLG A;  4QWQ A;  3ZMT A;  3QPH A;  4EJV A;  2PBI A;  3G73 A;  3BZ6 A;  1ZGA A;  1YQA A;  1MJA A;  4A5M A;  2M30 A;  3JW4 A;  3WTV C;  2M87 A;  3E6D A;  1D3Y A;  2HTS A;  4ESF A;  1I6X A;  4KIC A;  2YPR A;  2A6H F;  2WTE A;  1S6L A;  1SAX A;  4L9J A;  3GO5 A;  3I71 A;  3E6M A;  4HV6 A;  3BOQ A;  4Y15 A;  2RV8 A;  1O57 A;  3WTY C;  3O3K A;  3KE2 A;  5LRS A;  1Y0U A;  4Q4Z F;  4ENK A;  1D5V A;  5KVR A;  4HZF A;  4DNC A;  4YFN F;  1S29 A;  5IT9 K;  1GXQ A;  3C1D A;  3Q5F A;  5DCM B;  1VTN C;  1EV7 A;  4EJO A;  3QU3 A;  2ZCW A;  3GF2 A;  4LK0 F;  2PEX A;  2ZNY A;  1KYW A;  2ZNZ A;  3TO6 A;  3JAM Z;  1MJ9 A;  5L3G A;  2IA0 A;  2MC3 A;  1J2X A;  2RQP A;  4KIG A;  4A0Z A;  1FNN A;  1LEA A;  4OIP F;  3TQN A;  2ZO4 A;  1ZRC A;  1USS A;  5AIQ A;  5DEQ A;  3MAJ A;  5BMZ A;  4KYW A;  2Z99 A;  4L5I A;  4WCG A;  3PQJ A;  3HOS A;  1KQ0 A;  2DU9 A;  1H9T A;  5D4S A;  4KMF A;  3ZMS A;  3F6O A;  2GXG A;  3WGH A;  2JT1 A;  1EH8 A;  1QZY A;  5DV5 A;  2XAQ A;  3K2Z A;  4KUM A;  1STZ A;  4BHB A;  1DPU A;  2H6C A;  4ZH4 F;  2FEZ A;  2ISZ A;  3JTH A;  2XAJ A;  3ZPL A;  3R4K A;  2HS5 A;  1K78 A;  1XMK A;  3T5X A;  2K4J A;  1GXP A;  1ZHF A;  1IXC A;  1TBX A;  1HW1 A;  4HQE A;  2EA2 A;  4HA8 A;  1I27 A;  3BPV A;  3TO9 A;  2EFP A;  1YTY A;  4M74 A;  1R36 A;  1TQP A;  2H6B A;  3F8M A;  4ON0 A;  5FO5 A;  1ON2 A;  2BV6 A;  3SHF A;  3ECO A;  1FSH A;  3LQR A;  1WRJ A;  1R23 A;  1SFX A;  1DDN A;  5LBQ A;  1KU3 A;  2P7V B;  3R61 A;  1LEB A;  2CO5 A;  4BAY A;  1EH7 A;  1SD7 A;  1TNS A;  1FBU A;  2PI0 A;  4WXD A;  4CYD A;  4EM0 B;  4HLY A;  5JFR A;  3P9I A;  1ZG3 A;  4G7H F;  4PGG A;  2X4H A;  4KFC A;  2VBZ A;  2PQ8 A;  4U0Y A;  2XKP A;  5TRD A;  2ZBK A;  2FNA A;  2MA3 A;  2K7L A;  3I0T A;  3ISP A;  3K1N A;  4XLN F;  2O6G E;  1B6A A;  2VOD A;  2K27 A;  5ICC A;  3P9C A;  1TQI A;  2AXL A;  2O8X A;  2STW A;  4L18 B;  2QBY B;  1OYW A;  2VBW A;  2OD5 A;  3HRM A;  2DAO A;  1U78 A;  3B73 A;  1O3T A;  3NQO A;  2FU4 A;  3J81 Z;  4AWX B;  2LF7 A;  3MFK A;  2IPQ X;  2EFW A;  4U7D A;  4KIB A;  2RGV A;  5L3D A;  4A5N A;  2V6C A;  1U5T C;  3HSF A;  3RJP A;  3TOA A;  3FZV A;  3RKW A;  4A12 A;  3J80 K;  4I02 A;  2KIM A;  4M9X A;  3EDP A;  3FM5 A;  1D8K A;  4IHT A;  2Z5U A;  3ROU A;  5ERI A;  2FBH A;  1ODD A;  3E5X A;  4K2E A;  1IRG A;  1UST A;  1BC7 C;  4IRG A;  4XBF A;  1K7A A;  5DCM A;  2MLG A;  5FD5 A;  5CJ9 A;  2QM3 A;  1IXR C;  1UHM A;  4UVC A;  4HOB A;  4M71 A;  3ERE D;  2Z9O A;  4RGX A;  1O7L A;  2C6Y A;  2BEO A;  4BHC A;  3EYI A;  3BDD A;  2VE9 A;  3CUQ C;  1J0R A;  4EV0 A;  4I98 B;  2XRN A;  3DFG A;  3RPU A;  4RGR A;  2JPC A;  4NHJ A;  1XB4 A;  4S04 A;  1B1B A;  1OR7 A;  2JTV A;  1FYL A;  1XCB A;  3I59 B;  3O6B B;  2P6T A;  1IRF A;  3M1E A;  1V4R A;  4GCV A;  2VOP A;  4I2O A;  5ICG A;  1W7P D;  2AS5 F;  2GIV A;  2RN7 A;  3C18 A;  1JHH A;  2W85 A;  2A68 F;  2NNY A;  3U1D A;  3V7S A;  4IXA A;  2HR3 A;  4LK1 F;  2DK5 A;  2HFH A;  1IN8 A;  3LA7 A;  3R0J A;  1T39 A;  4I0A A;  4A6E A;  2P5K A;  1XD7 A;  3F22 A;  1GVJ A;  1Z7U A;  4UXN A;  1YS6 A;  2P7C B;  4PGH A;  5DD8 A;  4KIF A;  4KA4 A;  1R1T A;  3BY6 A;  5FD6 A;  3AAF A;  1IXS B;  1QZZ A;  4TV7 A;  2VON A;  4S05 A;  3QOP A;  2RC4 A;  3BRO A;  2R7F A;  1I1S A;  1XGN A;  4OMY A;  1AOY A;  5LEJ A;  3E3V A;  2EWN A;  2ZJ2 A;  4LD5 A;  4L9N A;  4EJU A;  5ILV A;  2HQN A;  3RIR A;  4YII A;  4L9V A;  3GUD A;  2MD5 A;  3ABT A;  2PJP A;  1ZN2 A;  5LGN A;  4I09 A;  4M9Z A;  4G94 A;  5LGT A;  5J8C A;  1LQ1 A;  3MZY A;  4O5V A;  5FB2 A;  2IW5 A;  1Z9C A;  4ZZL A;  3BJO A;  3HUG A;  1BBY A;  1P92 A;  5KK1 A;  4EM2 A;  3KLO A;  1BN5 A;  3LST A;  1V3F A;  4HF0 A;  3QP5 A;  1PUE E;  2QBY A;  2MH2 A;  4MNU A;  4UNO A;  1FYM A;  2E7W A;  4G8X A;  5L3F A;  2V1U A;  4JQF A;  3K9T A;  1SD4 A;  2HYG D;  1FWZ A;  2OZ6 A;  3RYR A;  1J75 A;  5JR3 A;  1IW7 F;  2J5O A;  3KP2 A;  4KN7 X;  2QLZ A;  2O61 A;  3EQL F;  1I5Z A;  2KIU A;  3LFK A;  5ILS A;  4M6X A;  3TKY A;  2CWE A;  5D5V B;  1FZP B;  2FBI A;  2P5V A;  1GHC A;  4ZZD A;  3JTG A;  4HX8 A;  1RUO A;  1HKT A;  1WWX A;  4UVA A;  2K86 A;  2LKP A;  1G3Y A;  4D0P A;  2HKO A;  1J9I A;  3IL2 A;  3IWF A;  3SXY A;  3VOD A;  2VE8 A;  1A04 A;  3MEX A;  5D5U B;  2L02 A;  3FHZ A;  1HXD A;  4H0E A;  4MEY F;  2KJB A;  1WSU A;  3FXQ A;  3V8J A;  5JVT A;  5ICF A;  3JAM K;  2DQL A;  2GZW A;  3IRR A;  4OOI A;  1Z6R A;  4EGY A;  4KMU X;  1SMT A;  3EUH A;  4A0Y A;  1ZG5 A;  2M8E A;  4OMZ A;  1SD6 A;  3OV8 A;  5HS9 A;  2UXN A;  1Z91 A;  1R5H A;  4L9T A;  4EQQ A;  4KNY A;  1UHW A;  2GA1 A;  3GEZ A;  5F1R A;  2WWY A;  5DCF A;  2VC0 A;  4RB1 A;  2IRF G;  2W25 A;  3E97 A;  2DLL A;  5DD4 A;  1RUN A;  3TGN A;  2XUB A;  1G3T A;  1T2K A;  4CZZ A;  1SFE A;  5D8K B;  1XSD A;  1W7P B;  1D8J A;  2M45 A;  2L01 A;  4FX0 A;  2K4B A;  4EJW A;  5FFX A;  2XAF A;  3LA2 A;  2JSC A;  2G7U A;  4R8H A;  3KP4 A;  1ZRD A;  2EFO A;  2HQR A;  5E8I A;  3ZP5 A;  5EEG A;  4PDK A;  5F64 A;  4CIC A;  2MLK A;  1WKM A;  2GAU A;  4G6Q A;  5FLX Z;  3WE3 A;  4Z2Y A;  5E20 A;  1I1G A;  4FHT A;  2PG4 A;  4OIQ F;  2QQA A;  2DFI A;  2YX4 A;  1CF7 B;  2CFX A;  3JSP A;  2ISY A;  1SMY F;  2EB7 A;  2V9V A;  4G9Y A;  4GO1 A;  3IRQ A;  3MZH A;  4P55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...