4HX8A

Structure of metal-free mntr mutant e11k
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
SMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 53
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx8A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx8A02
1Z6TA 2DQRA 1YW9A 5BMZA 3KCCA 1IN6A 2DU9A 3KP3A 1WKMA 1KQ8A 4L9JA 5DUIA 1R5GA 3COAC 2Z9OA 2IA1A 2DFIA 4LG0A 1UB9A 4F7ZA 2IA0A 2LSOA 5F6FA 4MHGA 2K02A 2H09A 1XCVA 2EJRA 3HTUA 1U2WA 1R1VA 4UVCA 4HLYA 4Y13A 4G6DA 1U78A 3F8NA 1HKQA 1G6NA 3ZPLA 1OYWA 4A6EA 2YR2A 2QLZA 3DPLC 2P5VA 3KEOA 3N97A 1FLIA 2STTA 4A0ZA 1D5VA 3TOBA 3KE2A 1WWXA 1ZYRF 2D1HA 3KP7A 1ODDA 4PCQA 3HOSA 5IT9K 2V79A 2GQQA 5D5VB 4U0YA 3WTXC 3CTAA 3REOA 1SMYF 3ZMZA 3FWEA 4A5MA 4IHSA 4ESFA 1R5HA 2DPUA 2EV5A 4HF0A 4D0PA 1U5TA 1ZARA 1DDNA 2BE5F 3KFWX 4UV9A 2XRNA 4ZYDA 1ZRCA 2DT5A 3WTUC 2YU3A 4I09A 1R7JA 5E20A 3BJAA 4RB2C 3QRFF 1R1UA 4LGWA 3L2CA 3V8KA 2V6CA 2RN7A 3G73A 4R8HA 2K4JA 2ZJ2A 5J8CA 1ON2A 5LEKA 3WTVC 4AIJA 4HQEA 1H0MA 2BEOA 4O6JA 2HFHA 1HKSA 5D4SA 4HW0A 4ESBA 5LEJA 1G3WA 2MD5A 1PUEE 3E97A 1LEBA 5ICEA 4Y17A 3LSTA 2CFXA 1TNSA 3J81K 2DO7A 3I54A 1MKMA 1BI0A 2GXBA 1H9TA 3GFJA 5IT9Z 1FBUA 3NEUA 1OYIA 4HX8A 4HF1A 2H94A 4KN4X 1P4XA 1IXRC 1REPC 2KIMA 1GXQA 2G9WA 2W24A 3IC7A 3RYPA 4CDGA 1F4KA 3GZ5A 5LLQA 3D0SA 3KP2A 3EDPA 1LQ1A 2CYYA 2IP2A 2VE9A 3MCZA 5K1YA 2EA2A 3F6OA 1BM9A 2TDXA 3PQJA 3MZYA 4I7HA 2MH9A 2XAQA 1LVAA 4RB3C 2Z3YA 2P6SA 3FHZA 1UHWA 2L4AA 4EM0B 1MJBA 3CO7C 4EVIA 1U8RA 3ROUA 2P4WA 1RNLA 2AS5F 3ZMDA 1A04A 2FSWA 3ERED 4EGZA 1J9IA 2XROA 1RIOH 2VONA 1XCBA 1HW2A 2P6TA 2LF7A 2BGCA 4ASNA 2K7LA 3I59B 1XD7A 3J81Z 4GXOA 5JVTA 4ENMA 2R7DA 1S29A 4Q47A 3N4MA 4BAYA 3IKTA 5D8LB 2XASA 4ENKA 3E6BA 1FBSA 4RB1A 2OAZA 1YS7A 2ELHA 3E6MA 4I02A 1WRJA 5L3EA 1J2XA 3ECOA 3VEPA 2W25A 3T1BA 4YFKF 2KIFA 4EMSA 3MQ0A 1IRGA 4GYIA 1USTA 3KEQA 3HSRA 1XDSA 5HS9A 3S2WA 4O5VA 3F8FA 2LNBA 2QQAA 5E17F 3V8LA 5DCMA 4EJUA 1QBJA 3GXOA 3JTHA 4BNCA 3IRRA 4Q4ZF 3JW4A 3V4GA 2J5PA 2FF4A 1P2FA 1XGNA 3LA7A 1DPRA 1FP1D 2Z5UA 1MD0A 3PFIA 1LDKB 1Z6RA 2O0YA 5D6EA 3CLOA 4BHCA 3I5UA 1MDMB 4A6DA 1B4AA 5CVJA 1WQ2A 3JTGA 4LMYA 1ZGJA 4A0YA 3K9TA 4LB5A 1V3FA 3SZTA 4RGSA 2DW4A 4WXDA 5CYVA 3HHHA 3MFKA 2CWEA 4ZYGA 2ZFWA 2CW0F 4BHPA 3JSPA 5A2QZ 3B02A 2WWYA 1NHAA 3ABTA 2HR3A 2ZXJA 1S6LA 4ON0A 3TQNA 1S7AA 5HLGA 2PMHA 2XHKA 3M1EA 1PP8F 3FX3A 2V1XA 1IF1A 3H92A 2FOKA 5DDGA 5BS6A 1ZLKA 4UVBA 2FE3A 5H6RA 3DEUA 2OQRA 2VBZA 3NQOA 2F5DA 1K7AA 2XKOA 2IW5A 3F72A 1ULYA 3V7RA 3CO6C 1G3SA 1FYKA 3L9FA 3FMSA 5AIPA 1D8JA 4WF2A 3F8MA 4EJVA 4M72A 5L3GA 2VE8A 4ENJA 4OMYA 3WGHA 3TO9A 2ZCWA 5H20A 1YYVA 2H6BA 5E1ZB 3LA2A 2HGCA 2DPDA 2FNPA 3WG9A 1MJAA 3KLOA 3FM3A 1P4WA 2JZYA 2QM3A 3ZP5A 1CF7A 1R00A 1J75A 2Y0MA 2EFWA 1ZRDA 1O3QA 5L3CA 3U2RA 4MQVA 5ED4A 2YPRA 3J7AO 1FSHA 2X4HA 2D2WA 4O3MA 4L9NA 4OIPF 2WTEA 1FOKA 4UVAA 1R1TA 1ZLJA 1DPUA 2FXAA 3R61A 2DI3A 1MGTA 2GA1A 1D3YA 1UCRA 2O61A 3V8JA 3RYRA 2OD5A 3RJPA 2DLLA 1SMTA 5LBQA 2OZUA 5HDKA 3E3VA 2FU4A 3GF2A 2XV4S 2P7VB 1D8KA 3JAMK 1Q1HA 2OQGA 4L9VA 4OIQF 2E7XA 1PDNC 1ZGAA 1MZBA 3BROA 3QP5A 4IXAA 4CGZA 4LLGF 5FFZA 1U5TB 4KIGA 1UFMA 5IT3A 3K1NA 2P5KA 4ZYHA 3K69A 3WU0A 1LDDA 4H0EA 4KMUX 2PQ8A 4A0XA 5HOOA 4K2EA 2WV0A 3MEXA 1TQPA 2M5WA 1C0WA 2F5EA 4CHUA 3F22A 2YSRA 4HV6A 1FSEA 2QQBA 4FT8A 4A12A 4S04A 3KZZA 1YG2A 2F5CA 4ETSA 3DPTA 1QO0D 2DQLA 5JR3A 4ENNA 3R0JA 1HBXG 2M1BA 1K78A 1ZAOA 1YTYA 3K2ZA 4Q48A 1KGSA 1HQCA 2XAJA 2VOOA 2ZNYA 1XB4A 3TGNA 4AWXB 2KJCA 4LLLA 3JAMZ 4ZYEA 2KRFA 1T98A 1K79A 4XBFA 4CXFA 2KIUA 3E5XA 1OKRA 2GWRA 5ILSA 5CJ9A 4UHTA 3R60A 3TDZC 5D8KB 4HV5A 3GW2A 3ABUA 1BOAA 5D5UB 2VT2A 1JXSA 2VBWA 2QBYA 2A5YB 1TBXA 3NRVA 5CLSA 2A3SA 4U0VA 2HTJA 4Y15A 1KYZA 3SQNA 3K1MA 1R22A 5BQTA 1MJ9A 4CYDA 4WXHA 3Q5FA 5K5RA 1ZREA 2VXZA 1YW7A 4IF4A 2Z33A 3R0AA 2XAHA 4P55A 1R23A 2VT3A 2K4BA 1XGOA 5EEGA 1OPCA 2QVOA 4LFUA 3DFGA 2MH2A 1SFXA 2G7HA 4NQWA 2P7CB 5FD6A 2XKPA 3HIFA 4KFCA 4IPAA 3HSEA 2IRFG 2A6EF 5DD8A 2IT0A 5J8FA 2VODA 3FXRA 4GCVA 2L02A 1FZPB 2ISZA 4I01A 2DAOA 4BHBA 3HUGA 1L3LA 3E5UA 1VTNC 2VBYA 2RDPA 1P92A 4QWQA 3WU1B 1F1ZA 5D6FA 3I58A 1E17A 5ICFA 1TNTA 3E6CC 1STZA 5FGMA 4TV7A 5K5QA 1XN7A 3I71A 3F21A 2GZWA 4JQFA 2DBBA 2A6HF 3M8EA 1J0RA 3I53A 5LGNA 1HW5A 4Q5SF 4KDPA 4PZJA 2EK5A 2NYXA 3P7NA 3L00A 4RGXA 3KZYA 4WX9A 2R7FA 1U6GA 3IWFA 5F64A 4M9SA 1ZRFA 2HQRA 4M6XA 2F5FA 2E1CA 2E7WA 3F3XA 3LQRA 2GXGA 2V1DA 1G3YA 4XRFA 3L7WA 2AXLA 3C18A 5E1XA 2VC0A 4KUMA 3GX4X 2FBHA 4E70A 3FZVA 5KK1A 3GVAA 2M30A 4OINF 4KT5C 1O7LA 5E18F 5FLXK 5HDNA 2DTRA 4GO1A 5ILUA 3O6BB 3HRTA 5DYMA 1CGPA 5JFRA 2UWMA 2XAGA 3RDIA 4M71A 3GYHX 3MZHA 4YFXF 2Z99A 2CSOA 2VN2A 5LRRA 4WXCA 3QPHA 4I98B 2HTSA 4N9IA 4A2UA 2RNJA 2OBPA 2B0LA 1BC8C 2MLKA 2MA3A 3VODA 1UHMA 2ZO4A 1XSVA 5EEHA 5E8GA 2A07F 2EFNA 2FQ3A 4YIIA 4CO8A 1IW7F 4B8XA 3K1PA 1EV7A 2GA2A 2IPQX 2ZMEB 4G8XA 4BQAA 2HDCA 3P9IA 4HX7A 5KVRA 2OA4A 1KQ9A 2E1NA 1QZZA 3ELKA 2IJLA 5LGUA 1G4DA 3WE2A 3FXQA 1IN4A 3CUQB 1SD7A 1FY7A 2QYOA 3ZMUA 4L0YB 5ERIA 4UV8A 3C7JA 5DV5A 4B09A 1TTYA 1XGMA 1G3TA 3WE3A 3GFLA 3C3WA 4BH9A 4ZZDA 5ICCA 5E8IA 3LAPA 3OOPA 3KP5A 1KU2A 4CZZA 1SFUA 3EYIA 2UXXA 2GIVA 3VB2A 3I59A 1OR7A 4HZFA 3K0LA 3ZN0A 1OYYA 3IRQA 5LHHA 4BYYA 3HRUA 2XVCA 1QPMA 1LDJA 1J5YA 4QLCU 2RVCA 4EM1A 2O03A 1WSUA 1H9GA 3B73A 3DP7A 2HYFA 2XAFA 2QENA 1FYLA 3VOEA 4R79A 2FEZA 2EB7A 2GAUA 1YS6A 4RAYA 3BJ6A 3EQLF 1SD5A 4P5OA 4R1HA 1Y0UA 1T2KA 1SAXA 2CG4A 1SD6A 1W7PB 2K27A 1BI3A 3H3UA 1B59A 3GFIA 2EV0A 1R58A 1LJ9A 4UUVA 2H27A 3AAFA 5K5OA 2D1VA 1BC7C 1U3EM 1QQIA 2R3SA 2HKXA 1WI9A 1IN8A 4L5JA 2BV6A 1Z91A 3PQKA 1XSXA 1YW8A 2V9VA 3I64A 3ZN1A 2P5LC 3P9CA 2PI0A 2EFOA 4GYGA 2PBIA 3F8BA 2X0LA 4U0WA 3GO5A 4XLPF 5BPIA 4LG0B 2VBXA 4U7DA 5E1WA 5BPDA 4EM2A 1XMAA 1IAWA 3FM5A 3HYIA 5DD4A 1GVJA 4U88A 1FT9A 2MBFA 1IN5A 1MDMA 5LRSA 2MLGA 3L09A 3RPUA 1XGSA 1J59A 6PAXA 3TO6A 4FX0A 3M8FA 1I1SA 4MEXF 1X3UA 2M87A 5LHIA 1HXDA 2A69F 1LB2A 1F5TA 1JHFA 2ETHA 5L3DA 3BPVA 3SFZA 3HSFA 3IL2A 3HHGA 4YG2F 4HA8A 5HDGA 3BZ6A 2EV6A 2NNNA 3T8RA 4EV0A 3WTZA 2FRHA 3W6JB 1USSA 5ICGA 4OU0A 3EETA 3RPQA 2DK8A 4AIHA 2PEXA 1SFEA 3GEZA 2HQNA 3EUHA 1YFHA 3E6DA 3DKWA 2ADUA 5CVUA 4S05A 1TW3A 1IXSB 2FNAA 5JHUA 4HDUA 4AIKA 2O8XA 4HDVA 1IUYA 2HWVA 2LF8A 2QWWA 3I0TA 3BPXA 3M9AA 5DEQA 1T38A 1TW2A 1Z9CA 5J6XA 1GXPA 4DQ2A 2RV8A 5DUKA 3CDHA 4KIBA 3QAHA 4KMFA 2Q0OA 1BJAA 2JPBA 4XSXF 4MTEA 1FWZA 1KA8A 4MQ9F 3H3ZA 2NRAC 1I6XA 3HRMA 3DQVC 1TQIA 4M9ZA 4U7BA 4LJZF 2O6GE 3KP6A 1U5TC 1W4MA 4FHTA 3T5XA 4A5NA 2RGVA 1RI7A 3U1DA 3R4KA 4Z2YA 1LEAA 1FC3A 2Q2EA 1FNNA 4L9TA 2ZBKA 2KKOA 4RAZA 4G6QA 4G94A 3TOAA 1IXCA 1BBYA 1DUXC 2PFBA 2CGPA 4HOBA 3WTYC 3W6KB 3ZMTA 2COMA 4NB5A 3IKVA 3Q9VA 4G7ZF 1HW1A 3GUDA 2HEOA 1FX7A 3O3KA 4BXUA 4OMZA 2OU2A 1HSTA 2HOEA 2FMLA 5DCFA 5CVIA 3U9GA 2LKPA 2OZ6A 1I27A 4YFNF 2ISYA 3QP6A 3HRSA 2H6CA 1T6SA 1JGSA 1IN7A 4UNOA 5FD5A 2MC3A 4M6YA 1QNTA 3J80K 5BOXA 4GGGA 2A68F 2WC2A 5L3BA 3GWZA 1W7PD 2JT1A 3QOPA 1O3RA 1HKTA 2D45A 2P8TA 3ULQB 1JE8A 4LK1F 2XGXA 2PLYA 4AD9A 1AWCA 3SXYA 1S7OA 1S3JA 1DP7P 2DK5A 3ZQ7A 4IHTA 3EYYA 4OIOF 1ZG3A 4P9UA 1KYWA 3RIRA 3KP4A 1SD4A 1B1BA 1ZN2A 3E5QA 1EH6A 4ESJA 5CVVA 3IHUA 2NAZA 5D4RA 2Y75A 3LQQA 4ZZLA 2EFQA 3VFZA 1XSDA 4ZH4F 1J7KA 2L4MA 2IA2A 3RKWA 2ACJA 1YIOA 3GLXA 3T8TA 5DCMB 1B9NA 3LAJA 3SZPA 1L0OC 3WODF 3J80Z 1O57A 3LFKA 3Q9SA 2ZNZA 5AIQA 2V1UA 2JSCA 1ONVA 5CVRA 1YO5C 1T0FA 4HYEA 3WGGA 1T39A 3MAJA 3P9KA 3R6SA 1YQAA 1XMKA 4WWCA 3RKYA 3DF8A 4P9FA 3FXUA 4N0BA 4I0BA 2M8EA 2VC1A 3BDDA 1Z05A 1I1GA 5HLIA 1F9NA 5HS8A 2CQKA 2CO5A 5TRDA 2FBKA 1IRFA 2ZKZA 2O3FA 4JBAA 4JK1X 5HVQC 5LHGA 2RKHA 2L54A 1I5ZA 5TJJA 1ZG1A 1RZ4A 2W84A 5HLHA 1JHHA 3QU3A 2C6YA 1EH8A 1XDUA 2JTVA 3M7GA 4PGGA 4CICA 3DV8A 2FBIA 2L3DA 2EA4A 3WTTC 1KU3A 3G3ZA 1FYMA 2XIGA 1KQ0A 1ZH5A 2NNYA 3F8CA 4MNUA 3I4PA 3OV8A 4IRGA 3LA3A 2FMYA 4AVPA 4M73A 2JPCA 3T0YA 2G7UA 1ZG5A 5A2QK 1V4RA 1O3SA 5LGTA 4G7HF 2VOPA 2YX4A 3ML6A 4KICA 4KA4A 2UZKA 5FLXZ 2Q8KA 2BYVE 4RB0A 2W57A 3SHFA 1BI2A 3V7SA 2F2EA 4LD5A 4MEYF 4G9YA 1TQMA 4HQMA 4L18B 3JSOA 1CF7B 5D5XB 4UXNA 3KETA 4IJAA 1BN5A 4KYWA 3DXJF 1PP7U 1P4AA 1EH7A 4EQQA 2PN6A 1S8NA 4HLXA 4RGUA 3ZMSA 1BIAA 3MWMA 4G7OF 2STWA 4IRIA 3ECHA 3WTWC 5D5WB 2HS5A 4YIFA 1QZYA 5FO5A 3GZ6A 2HKOA 3TO7A 4EJWA 1HSJA 1W5TA 3F23A 4MTDA 4L0ZB 2RQPA 4P96A 3C1DA 4KNYA 3BP8A 2IVMA 4KIFA 1YLFA 2RC4A 3CUQC 3CJNA 3ISPA 1O7FA 2QQ9A 3QPTA 4IVNA 2ESHA 2M45A 4WK8F 1FBQA 4IRHA 1AOYA 3BOQA 4EGYA 2FA5A 2ESNA 2JRTA 4HF2A 1OMIA 4XLNF 3FF5A 2HZTA 1E2XA 1LNWA 4LLNA 1RUNA 2BBYA 4XSZF 5HS7A 2PG4A 1KU7A 4M9XA 2ZMEA 2LDUA 1QGPA 4PDKA 3F6VA 1R36A 3HOTA 3BWGA 4M74A 2UXNA 3V7CA 5JI6A 3TKYA 2J5OA 5ILVA 4HAMA 4RS8A 1KU9A 3O2PE 2QZ8A 3CUQA 1ZHFA 3ZMVA 4LK0F 3WTSC 2PJPA 1Z7UA 2KJBA 4HBLA 4PGHA 4RGRA 4DNCA 1K78B 1TLHB 1GHCA 1ON1A 3RI4A 1FP2A 1FPQA 5FFXA 1B9MA 5FB2A 4WCGA 2K86A 1B6AA 2W85A 4KN7X 1K6OA 5AONA 1W5SA 2YX7A 4I0AA 4I2OA 2NS0A 2A61A 1IZ1A 3WGIA 3KLNA 4N9HA 1P6RA 1RUOA 3GFMA 4LB6B 2PMUA 5L3FA 4L5IA 4NHJA 3TDUC 1BI1A 2EWNA 4FX4A 2L01A 2QBYB 4EJOA 1Z1DA 2Y48A 3RTRA 2XUBA 3HTSB 3LWFA 4OIRF 4MGRA 2EFPA 3IWZA 3RKXA 4OOIA 4HX4A 1W7PA 2QUFA 4EJTA 1BIBA 3CUOA 3FMQA 3QU6A 5F1RA 1O3TA 2HYGD 3BJOA 5H6QA 3D5LA 3FMRA 3BY6A
chains in the Genus database with same CATH superfamily
1Z6TA 2DQRA 1TC3C 4NQWB 5F04A 1YW9A 3MKLA 4IEJA 5BMZA 3KCCA 1IN6A 2DU9A 3IAS2 3KP3A 4BEHA 1WKMA 1KQ8A 2NVYJ 4L9JA 4IHVA 2W1OA 3QWLA 5DUIA 4CA0A 1I50J 2K9LA 1R5GA 1A36A 3COAC 2Z9OA 2IS1A 2R7VA 2EZHA 3LSMA 3ZXSA 2L2OA 5IYBJ 2IA1A 4DBQA 2DFIA 1XMXA 3A02A 3HJEA 1D1AA 3VPRA 4LG0A 1UB9A 2ELKA 3HUGB 4F7ZA 5J40A 4BE1A 2HU9A 2IA0A 2ZXHA 2LSOA 5F6FA 2DMPA 2K02A 3GLLA 4MHGA 4QPOA 5F27A 4D7NA 2H09A 2K3FA 3DBHB 1XCVA 2WY7Q 4XKBA 2EJRA 4B3AA 3HTUA 4BS9A 1U2WA 1X1DA 1R1VA 4UVCA 4A3JJ 2VJJA 2CQ7A 4HLYA 4Y13A 2M2EA 2BOLA 5HNFA 4G6DA 1WFXA 3E0JB 1U78A 3LSGA 5EG0B 3BTIA 1VQ8I 3F8NA 1HKQA 1I3AA 1G6NA 5B1BH 3ZPLA 2X85A 3J7AY 1OYWA 4A6EA 3H9QA 2YR2A 3QOEA 4Y4RA 1X58A 2R93J 3ABKH 2QLZA 3UKGA 4BDZA 2B7EA 4DZPA 2MYSA 3K4LA 3DPLC 1K83J 2P5VA 3KEOA 4M3GA 2LR8A 3N97A 1FLIA 2STTA 4NDLA 2K9SA 4A0ZA 3TOBA 1D5VA 3WG7H 3KE2A 1TT0A 2LP0A 1WWXA 1ZYRF 4JYKA 5KAIC 2D1HA 3KP7A 4Y3OA 1HF0A 1LE8A 1ODDA 4PCQA 3HOSA 3PIOF 2LKSA 5IT9K 2V79A 2GQQA 5D5VB 5M3FJ 3OYCA 4NBQA 4U0YA 2E2HJ 5GPCA 3WTXC 3CTAA 3KYDB 3REOA 2AHQA 1JUPA 4XRMA 1SMYF 3ZMZA 4BGDA 3FWEA 1XS9A 5M5YJ 4A5MA 3LSPA 4IHSA 3A03A 1R5HA 3SDGA 4ESFA 2DPUA 2EV5A 4HF0A 4NUBA 4BE2A 3W2VA 4D0PA 1AHDP 4II2A 1ZK8A 2EINH 1U5TA 1ZARA 1DDNA 3Q0VA 2M0CA 2BE5F 4QTRA 3KFWX 3E7LA 3AL0B 4XN0A 4UV9A 1ETYA 4FQGA 4HNVA 3JRHA 2PJRA 2XRNA 4ZYDA 2KDZA 2LY2A 1RKTA 3HC7A 1ZRCA 2DT5A 3WTUC 2YU3A 4I09A 3QQAA 1R7JA 5E20A 3BJAA 1E0EA 1ACIA 2HXOA 4RB2C 1BR1A 3QRFF 1R1UA 5K7HA 4LGWA 3OYDA 1UMQA 2ZJQF 3CCQI 3L2CA 3SEQA 5JLWA 4ZTJA 3V8KA 3ZQIA 4E7JA 2V6CA 2RN7A 1G59A 3G73A 4R8HA 2ZJ2A 2K4JA 5J8CA 2OTLI 1ON2A 5LEKA 3WTVC 4AIJA 4HQEA 1H0MA 2QSHX 2BEOA 4O6JA 2HFHA 1HKSA 2NVQJ 2KRHA 5D4SA 4HW0A 1UAAA 4PSWA 4ESBA 5LEJA 1G3WA 2MD5A 3IH3A 3FKJA 3FKIJ 1PUEE 3E97A 3ZQGA 5ICEA 4X6AJ 9ANTA 1LEBA 4Y17A 3LSTA 3DPUA 4RMNA 1SANA 3DBRB 3ZQLA 2CFXA 1TNSA 3DTIA 2DO7A 4UB8C 3J81K 3I54A 5K7FA 1K6YA 1MKMA 1BI0A 2GXBA 1H9TA 3GFJA 5LFAA 5IT9Z 2IEKA 1FBUA 2XF5A 3AL0C 3NEUA 1OYIA 4HX8A 1B72B 4HF1A 2LOOA 2HOAA 1QU3A 3HGGA 2H94A 2MUNA 2L0KA 3VYRB 4KN4X 3EPZA 1P4XA 1DGRM 1IXRC 1REPC 1XPXA 2KIMA 1GXQA 2G9WA 1DU0A 2W24A 3IC7A 3RYPA 4CDGA 4HNUA 1F4KA 3BCBA 3PNTA 2M0MA 3GZ5A 5DTDA 2GOXB 1EJ9A 5LLQA 2DA4A 3D0SA 1BR4A 5F0HA 3KP2A 3EDPA 1LQ1A 2CYYA 2IP2A 2VE9A 2VIXA 2E60A 4IOCF 2EH3A 2OF7A 2LBFA 1B8IA 2H8RA 2G0EA 1ETXA 2AQEA 2L5QA 1ETVA 3MCZA 5IT9R 5K1YA 3OYGA 2EA2A 2X9DA 3F6OA 2FOWA 1BM9A 2TDXA 3PQJA 4EATA 2DA3A 3CZ6A 3MZYA 4I7HA 3V42A 4MO7A 2MH9A 1YJNI 1GUUA 2V4JC 1LVAA 2XAQA 3DTKA 4XK4A 1YJWI 4RB3C 2Z3YA 3CF2A 2P6SA 3FHZA 2VPRA 1UHWA 2L4AA 1QHGA 1BR2A 4C3JJ 4EM0B 1MJBA 3CO7C 4EVIA 1APLC 1QRYA 1U8BA 1EF4A 3K7AJ 3BG7A 4RA2A 1U8RA 1G8XA 3ROUA 3TW6A 2R0QC 1U9OA 2P4WA 1RNLA 3CP8A 2FUG2 3U21A 2AS5F 3ZMDA 3IH2A 4LIUA 1A04A 5J3LA 3FBIB 2FSWA 3ERED 4V2GA 4EGZA 5GAEJ 1J9IA 2XROA 1IDZA 2UUZA 1RIOH 2VONA 1XCBA 1HW2A 2P6TA 4XM3A 4BY1J 2LF7A 3CJQB 1D0ZA 2X6XA 2BGCA 4ASNA 2K7LA 1X1AA 2BVLA 3I59B 4DBRA 1XD7A 3J81Z 3G4SI 2BY2A 3UNGC 3CESA 5LD2C 3HKZA 3C2BA 4GXOA 2DDAA 3ERMA 3BR2A 5JVTA 3KEYA 3VDXA 4ENMA 2Y30A 1IRXA 2R7DA 1SVLA 1HDPA 1S29A 4Q47A 3N4MA 3OWTA 2DXIA 1A5JA 1TL8A 5C44J 4BAYA 3IKTA 4LITA 5D8LB 4PJJA 1W0UA 2XASA 1JUSA 4ENKA 3E6BA 4F93B 3CF5F 1VNDA 1FBSA 4RB1A 2OAZA 2X48A 3CCJI 4DJAA 1YS7A 2ELHA 3E6MA 4I02A 2NVUB 1IG7A 1WRJA 1YRNA 5GP9A 1X1PA 5KHDA 5L3EA 1J2XA 3ECOA 2DMTA 2CH0A 4YRVA 3VEPA 2W25A 4XKWA 1SAUA 3T1BA 1JKRC 3H0GJ 3H0DA 2M3AA 4UUSA 4YFKF 2KIFA 4EMSA 3MQ0A 1IRGA 1WCMJ 4GYIA 1USTA 1JUMA 3OY9A 5GTHC 3KEQA 3HSRA 1XDSA 1BW6A 1OR7C 4A3DJ 4NC6A 5HS9A 3S2WA 4O5VA 4I6ZA 1WJEA 3F8FA 1MH3A 4DYCA 2LNBA 2QQAA 5E17F 3V8LA 5DCMA 3PO3J 3QYFA 2MD0A 4EJUA 1QBJA 3GXOA 3JTHA 4BNCA 3SZGA 3MKZA 3IRRA 3PNVA 4Q4ZF 2JA6J 3JW4A 1X4PA 3V4GA 2J5PA 4KJZA 2FF4A 4FETA 3K4NA 1P2FA 1XGNA 2K9NA 3LA7A 4RDUA 1DPRA 1ZKGA 1FP1D 2Z5UA 1WJ5A 1MD0A 3PFIA 3A52A 1LDKB 2BY1A 1Z6RA 2GIZA 2K5CA 2E2IJ 2O0YA 2R92J 2TCTA 5D6EA 3CLOA 4BHCA 2ZB9A 3I5UA 3OOUA 1UG2A 5JHFA 1MDMB 4A6DA 1B4AA 4KT6A 3J7ZI 2HOTA 5C4XJ 5CVJA 1Y8RB 1MSEC 2JN6A 1WQ2A 3JTGA 4LMYA 4E6KG 2BZTA 1ZGJA 4A0YA 2ZSIB 5E3MA 3K9TA 3IV5A 4LB5A 1V3FA 4ZYAA 2GXAA 2HVRA 3SZTA 2NS7A 4RGSA 2HOSA 2DW4A 4WXDA 2QSFX 5CYVA 2ZXIA 3BR3A 4XRSG 2JMWA 3HHHA 2HVQA 3ABLH 1IRZA 3MFKA 2CWEA 4ZYGA 1QVUA 2ZFWA 2CW0F 2IGNA 1ORKA 4BHPA 3JSPA 5A2QZ 1HC8A 3B02A 2L7KA 4XQFA 2WWYA 1NHAA 3ABTA 2HR3A 2ZXJA 3OS2A 1S6LA 4ON0A 3TQNA 2DOEA 2GLOA 1S7AA 5HLGA 2PMHA 2XHKA 1XTAA 1R71A 2M34A 2V26A 3M1EA 1VQMI 1PP8F 4CCJA 2EZKA 3FX3A 2R5YA 2V1XA 3DLLF 1IF1A 3HOVJ 2DJNA 3H92A 5KCMA 2FOKA 5DDGA 3ESWB 4B48A 4IO9F 4XLFA 2HPIA 5BS6A 1IO2A 1ZLKA 4UVBA 2FE3A 3A4CA 5H6RA 3X2QH 4UUTA 3DEUA 3HKZN 3P5JA 2OQRA 2VBZA 5EGOA 3NQOA 2F5DA 1LFUP 2XKOA 1K7AA 2IW5A 3G1MA 1WJCA 1GV5A 3F72A 3CMAI 1ULYA 2DFHA 3V7RA 3CO6C 1VQOI 2F6CA 3DTEA 1YIJI 1G3SA 1FYKA 4B43A 3L9FA 3F9KA 3FMSA 5AIPA 1D8JA 3K10A 4WF2A 2CJJA 1I6HJ 3OR1C 5FLVA 4RLFA 3F8MA 2JA8J 4EJVA 4M72A 5L3GA 2HZDA 3BC8A 2VE8A 2KLOA 3MN2A 3OR2C 4X1EA 4ENJA 3ZQQA 1VQ7I 4OMYA 3WGHA 3S1NJ 3TO9A 2ZCWA 5H20A 5FROA 3B6CA 2VUMJ 1YYVA 2DCEA 2H6BA 3L2QA 3S1QJ 4XRSA 1GLNA 5E1ZB 3OL3A 3LA2A 2HGCA 1MMGA 4IQ4A 2DPDA 2EILH 3H5NA 4XLHA 2ZFUA 3FXOA 3BZKA 1BJZA 1Y56A 2FNPA 3WG9A 1MJAA 3KLOA 3FM3A 1P4WA 4E7SA 2JZYA 2QM3A 3ZP5A 2KQRA 1CF7A 1R00A 1J75A 1M1EB 3DKXA 5GTIC 1ETOA 2Y0MA 3VYSB 5IOZA 2EFWA 1ZRDA 3C2HA 1O3QA 3FIWA 1YITI 2OUMA 5C3EJ 5L3CA 2JUGA 3U2RA 1T95A 4IKFA 5JLXA 1Y1VJ 4MQVA 3OYKA 3CC4I 5ED4A 2YPRA 2CQNA 3J7AO 2I5UA 2KISA 4C2MJ 3OIQA 1FSHA 3F0CA 3TP3A 3DWLE 1XG1A 4DYQA 1T08B 3AG2H 1TP4A 3CMYA 2X4HA 2D2WA 1HA8A 4O3MA 2EQRA 4L9NA 4OIPF 3HGYA 3I55I 4CCLA 2Q2EB 2WTEA 1FOKA 4UVAA 4OAZA 1R1TA 3OYHA 1BA5A 2F5VA 1ZLJA 1DPUA 2FXAA 2CV2A 3R61A 2DI3A 4XLCA 1MGTA 4JP0A 3GTMJ 2GA1A 1FMWA 1E3HA 2VKHA 3I3LA 1D3YA 1UCRA 2QF7A 2O61A 2QCOA 2KRCA 3O8GA 1XX5A 4J01A 5CQGA 3V8JA 3RYRA 2AXTC 1KZHA 2HDDA 2EPFA 2OD5A 3IUOA 3RJPA 2DLLA 1SMTA 5LBQA 2OZUA 5HDKA 3E3VA 2MGQA 2FU4A 3HOUJ 3GF2A 4CCMA 2XV4S 2P7VB 1D8KA 3OIOA 1R4MB 3JAMK 1TWHJ 1X3WB 5HODA 1Q1HA 4PK4A 2OQGA 1Z0XA 4L9VA 2GM4A 4OIQF 2E7XA 4XKCA 2JWTA 1PDNC 3D5SC 1ZGWA 2VL8A 5FJ8J 1ZGAA 3TBIA 1MZBA 3BROA 3QP5A 2CFOA 4IXAA 2E1OA 1R49A 5FKOA 4CGZA 2P81A 1HDDC 4ZDPA 4IHYA 1TT5B 4LLGF 5FFZA 4DW6A 1S7EA 1U5TB 4KIGA 1UFMA 5IT3A 3K1NA 2MSYA 2P5KA 1W36C 4ZYHA 1X1CA 3K69A 3WU0A 1LDDA 1POGA 2DOAA 3IAM2 4H0EA 4KMUX 2PQ8A 1D1CA 4A0XA 5HOOA 4K2EA 2WV0A 4NNJA 2EZIA 2X6WA 3MEXA 3SFIA 1TQPA 1UJ8A 5EEAA 2M5WA 1OFCX 1YOVB 1C0WA 2W00A 3ZOBA 4J19A 2F5EA 4CHUA 2R5ZB 4V2FA 1S9HA 3F22A 2YSRA 2CV1A 2XSJC 4HV6A 2DA2A 1FSEA 3CC2I 2QQBA 4FT8A 4A12A 4S04A 2MVTA 2LKXA 3C2GA 3U1KA 3KZZA 5DM6F 3PSFA 1UZCA 1YG2A 2F5CA 2CMPA 1Z7LA 1RR7A 1MMSA 2CRGA 4ETSA 3WU2C 5E3NA 3DPTA 1QO0D 3MZ8A 4ZC3A 2DQLA 5JR3A 4ENNA 3R0JA 3DKYA 3FBNB 1NTCA 1HBXG 2M1BA 3OYNA 1K78A 1ZAOA 3DU6A 1YTYA 3IP4B 3K2ZA 3QPSA 4BKXA 4Q48A 3OYAA 2X1DA 4A3LJ 1KGSA 1HQCA 2XAJA 2VOOA 2ZNYA 1JJ6C 4PUSA 1XB4A 3TGNA 2PX9A 4AWXB 4E4HA 2KJCA 3CLQA 4A3KJ 4CYCB 5GAGJ 1XC5A 2EBIA 4LLLA 3JAMZ 4ZYEA 2KRFA 1T98A 1QA6A 1K79A 2LREA 4XBFA 1P9QC 4CXFA 2KIUA 1MNMC 3E5XA 1OKRA 2GWRA 3RPUD 5ILSA 5TGTA 2P0WA 5CJ9A 4UHTA 3FXJA 1V5GA 3R60A 4OAYA 3TDZC 5D8KB 4HV5A 1JJ8C 5FLMJ 3ASNH 3GW2A 3ABUA 3OYJA 3K4MA 1BOAA 5D5UB 1W1WE 4BQOA 2VT2A 3JRAA 3QPLA 1VQLI 1JXSA 2ZC2A 2MABA 2VBWA 2WA0A 3I56I 2QBYA 2A5YB 3S1MJ 3OIPA 4BDYA 1RKWA 1TBXA 3JAMR 5J47A 2NXNB 1MMNA 3NRVA 5CLSA 3H9JA 2VLAA 2A3SA 4U0VA 4ZDLA 2HTJA 1VFCA 1PUFB 4Y15A 1KYZA 3SQNA 3K1MA 1JT6A 1R22A 5BQTA 3LSJA 1MJ9A 4CYDA 2BW3B 4WXHA 3Q5FA 5K5RA 1ZREA 5EZGA 2E35A 3PSIA 2VXZA 1YW7A 4A3BJ 4IF4A 2Z33A 1PVEA 2NS8A 4AVZA 3R0AA 4Y33A 1FJLA 2F4IA 2XAHA 4P55A 2BHZA 1R23A 2VT3A 2K4BA 1XGOA 1O4XA 5EEGA 1OPCA 1ENHA 2QVOA 2H1LA 2W48A 3DFGA 3M8JA 4LFUA 3DCFA 4S0HB 2MH2A 1SFXA 2G7HA 2ZXWH 2VQCA 4NQWA 3DEWA 2OCCH 2P7CB 3DEEA 5FD6A 2XKPA 3HIFA 4KFCA 3ZR8X 3S8PA 3KYCB 4IPAA 3TW7A 3HSEA 3RQIA 2A6EF 5DD8A 2IRFG 4ZJZA 2IT0A 5J8FA 2VODA 4AUXA 4F52A 3FXRA 3OS1A 1TZLA 4GCVA 3LSRA 2L02A 1FZPB 2ISZA 4E7IA 4I01A 2DAOA 4BHBA 3HUGA 4AIDA 1L3LA 3G1OA 3E5UA 2CV0A 5DM7F 5DS9A 1VTNC 2QSGX 2VBYA 4EEFG 2RDPA 1P92A 4QWQA 3WU1B 1F1ZA 2R7SA 3FHNA 2VJ5A 3RQ4A 2M35A 5D6FA 1F43A 3I58A 3PL8A 1E17A 1T0FC 3D5RC 4D9JA 4C2TA 4CCOA 5EG0A 4MIMA 5ICFA 1TNTA 3FK6A 3E6CC 1STZA 5FGMA 4TV7A 5K5QA 5FRMA 4W97A 1XN7A 4D7MA 3S2HJ 3I71A 2N8GA 3F21A 1MMAA 2L9VA 3PO2J 2GZWA 2I8DA 4JQFA 1OCCH 2Y31A 2DBBA 3AFHA 2A6HF 4C3HJ 3M8EA 1J0RA 3I53A 1P7IA 5LGNA 3H5RA 1HW5A 4Q5SF 3FXKA 4KDPA 1PYVA 4PZJA 2EK5A 1VF9A 1W36D 3G6EI 1OJLA 2NYXA 4XL9A 1MIJA 3BZCA 3P7NA 1GDTA 3L00A 4P1WA 4RGXA 3BTLA 3KZYA 3QODA 1NK2P 3DLAA 4WX9A 3S32A 2R7FA 3OMYA 4BQNA 1U6GA 2LYCA 2VASA 3KYLA 2R7QA 3BR6A 3IWFA 5EJCA 5F64A 2DMNA 4M9SA 1ZRFA 2I10A 2HQRA 5E79C 1OCOH 4M6XA 2NVTJ 1MSFC 2F5FA 2E1CA 1A6IA 2E7WA 2QEXI 1FIAA 3F3XA 2HXIA 3LQRA 1YX5A 2GXGA 2V1DA 1Y39A 5GPAA 4BJ6C 1R9TJ 1G3YA 4XRFA 3L7WA 2AXLA 3C18A 5E1XA 2VC0A 3FDYA 5TISC 1MH4A 1NH3A 2OJED 3A01B 4KUMA 2E36A 1QHHD 3GX4X 2FBHA 2FJ1A 4E70A 3FZVA 5KK1A 3GVAA 2M30A 4A3GJ 2ME6A 2LRDA 2ZJRF 4OINF 4KT5C 1O7LA 4C9YA 1AKHB 2LK2A 4CCNA 5E18F 5FLXK 2O9LA 1IJWC 5HDNA 2ELJA 4V19K 1VQPI 3ONQA 2DTRA 3K4JA 5FKMA 4GO1A 5ILUA 3O6BB 4ITVA 4HSRA 3A2KA 1QZEA 3PJRA 5J4YA 3HRTA 3S1RJ 2H8WA 2M8GX 2BXZA 2BY0A 3JRCA 5DYMA 2HQ5A 3G2BA 3MD2A 4B44A 3Q0WA 1CGPA 4XLAA 5JFRA 1MNDA 2X1CA 2UWMA 4Y52J 4LIVA 1ETKA 1F36A 2IGMA 2XAGA 3AG4H 3RDIA 4M71A 4ABZA 3LSIA 3GYHX 4YFXF 3MZHA 2Z99A 1R4NB 2WB1A 2CSOA 2VN2A 5LRRA 2YU9J 3M1CA 4WXCA 3QPHA 3HG9A 4L5EA 2M4GA 1J09A 4I98B 3TL4X 4XIDA 2HTSA 4N9IA 4A2UA 4RAGA 2RNJA 2OBPA 2B0LA 1BC8C 1ERDA 2MLKA 2MA3A 3VODA 1UHMA 2FD5A 2ZO4A 3O8HA 1T8IA 3BCAA 2DA7A 4NC8A 1LPQA 1XSVA 5EEHA 5E8GA 3S15J 3CCYA 2A07F 2EFNA 4LOCA 3H3VK 2FQ3A 4YIIA 4CO8A 5FKKA 3WHBA 1B72A 1R6RA 1IW7F 3DBLB 4B8XA 4HSTA 2IAIA 3K1PA 1EV7A 3VSLA 2GA2A 2IPQX 1OISA 4AM3A 2ZMEB 2DFFA 2IGOA 4G8XA 2Y9YA 4BQAA 2HDCA 1YJ9I 3P9IA 4HX7A 4HRIA 5KVRA 2OA4A 4DYRA 1KQ9A 4DGWB 2CU7A 2E1NA 1QZZA 3ELKA 3GTJJ 2R7WA 3FXMA 4PJNA 2WAQA 4Y7NJ 3KX2A 3CCVI 2IJLA 5LGUA 2K3PA 1G4DA 3ZCOA 3NWSA 3HPGA 3ZRGA 3A0BC 3WE2A 3FXQA 3L2WA 1AA7A 2DA5A 3CQZJ 3GMEA 2CUEA 4X0GA 1IN4A 4N4NB 2KIQA 2NVXJ 3ZQCA 3AG3H 4BQQA 2LLKA 2VPLA 1YE9A 3CUQB 3OYIA 1VI0A 2RREA 1SD7A 1FY7A 2QYOA 1U9NA 3ZMUA 3CC7I 4L0YB 5ERIA 2OC6A 4UV8A 3C7JA 2DJIA 5DV5A 4A93J 1HOMA 2F4OB 4B09A 1N25A 1TTYA 1XGMA 4E7LA 4E7KA 4XICA 1G3TA 3WE3A 3GFLA 3C3WA 5F0FA 5EDNA 4CCKA 4BH9A 4ZZDA 2A05A 1UHSA 5ICCA 5E8IA 3LAPA 3OOPA 4QSHA 2L9RA 3KP5A 2A6TA 1KU2A 4CZZA 1H89C 1SFUA 5FLXR 3EYIA 2W82A 3NARA 2UXXA 2ZMEC 2GIVA 2M9HA 4GRIA 4B47A 3VB2A 3I59A 3JRGA 1OR7A 4HZFA 3K0LA 3ZN0A 1OYYA 3K4KA 5CKTA 3IRQA 5JVGF 1MBKA 2LMDA 2ID3A 2QKLB 5LHHA 3CCUI 2KHMA 4M3EA 1SEUA 3MVPA 4BYYA 3VWBA 4XMYA 4QIWN 5FKLA 2KP6A 3HRUA 2BXYA 2XVCA 1QPMA 1JKQC 1LDJA 4IL6C 1J5YA 5IP6A 4QLCU 2RVCA 4EM1A 2O03A 4JOMA 1WSUA 4A69C 2VJ4A 1H9GA 3B73A 3CDLA 3DP7A 2HYFA 1UG0A 4PFPA 3G1LA 5IOYA 4IQJA 2XAFA 3MKYB 2ME0A 2QENA 1YX3A 1FYLA 3VOEA 4R79A 3W2AA 2FEZA 3OSGA 2EB7A 2GAUA 3OL4A 4BE0A 1YS6A 4RAYA 2XSDC 3BJ6A 3H36A 3BG6A 3EQLF 1SD5A 1VZ0A 3RKQA 4P5OA 4R1HA 1Y0UA 4CZCA 1T2KA 4H4KC 1S72I 2RNGA 2V7FA 3OYEA 1SAXA 2NOGA 2CG4A 1SD6A 2BY3A 1W7PB 2K27A 5CQEA 2XPVA 2CQXA 1MBEA 1LVKA 3I4NJ 1BI3A 2QQ8A 4MFDA 2WB1N 4IX7A 3H3UA 1B59A 3GFIA 2EV0A 1R58A 1LJ9A 4UUVA 2H27A 3AAFA 3B6AA 5K5OA 2D1VA 1BC7C 1U3EM 1QQIA 3VSKA 2R3SA 2HKXA 1WI9A 3M07A 1FTZA 1IN8A 1H88C 4L5JA 2BV6A 4N4OB 4XLEA 1Z91A 2XGEA 2JA5J 3PQKA 2XPUA 1ZR4A 1XSXA 1YW8A 2V9VA 4BEHB 3I64A 3ZN1A 3LSKA 1JT0A 2P5LC 3P9CA 4Z6YA 2PI0A 2EFOA 4GYGA 1CQTA 1YI2I 2PBIA 3F8BA 2X0LA 4U0WA 1IDYA 1UELB 3GO5A 4XLPF 5BPIA 2HYJA 4LG0B 2B9SA 3IH4A 2VBXA 2VKVA 4U7DA 5E1WA 3HOZJ 5BPDA 1VQ4I 4EM2A 2IS4A 1XMAA 1IAWA 5J1RA 2GBYA 2V9KA 4IOAF 4JX6A 5B1AH 3SJMA 2XB0X 3FM5A 3HYIA 3EUHC 1Y6IA 5DD4A 4KISA 1GVJA 2HPMA 3W2WA 2LG4A 2WAQN 1BW5A 4U88A 1TWGJ 4RBOA 3JRIA 2ID6A 1FT9A 2MBFA 1IN5A 2CW7A 3BQYA 1MDMA 5LRSA 2MLGA 1RESA 3L09A 3RPUA 1DQUA 5M3MJ 3GCMA 1XGSA 1J59A 3J7AW 6PAXA 3TO6A 4FX0A 2Y0SA 3M8FA 1I1SA 4MEXF 4JX5A 2E1MB 1X3UA 2M87A 5LHIA 3GTLJ 3CCLI 1VQ5I 1HXDA 4FASD 1Y1WJ 2VKDA 3CCMI 2A69F 2E2JJ 1LB2A 1F5TA 4E7ZA 4J00A 1FTTA 1JHFA 2ETHA 5L3DA 1FOXA 3BPVA 3SFZA 2RQQA 3HSFA 4U87A 5J4VA 5E3OA 1W0TA 3IL2A 1E3OC 1LE8B 4OWRB 3RZDJ 3HHGA 4YG2F 2OPTA 1T33A 2X51A 4HA8A 4PJLA 5HDGA 2DODA 3BZ6A 2Y69H 2EV6A 2NNNA 3T8RA 4EV0A 3WTZA 2DOFA 2F4MB 2FRHA 5IYDJ 3HBLA 3W6JB 3ZQHA 1IGNA 4HEA2 2M7AA 1USSA 5ICGA 2K40A 2V1NA 3EETA 4OU0A 3N05A 3RPQA 2DK8A 4AIHA 3KZIC 2PEXA 2CUFA 1SFEA 1X4OA 3GEZA 2HQNA 2M4KA 3EUHA 3JR9A 2EZLA 4C30A 2Q1ZB 3E6DA 3NAUA 5C4JJ 1YFHA 3A0HC 3DKWA 4PFOA 2ADUA 4AU7A 3S2DJ 4B3XA 1X2MA 1Z3XA 5CVUA 2PJRB 1JI8A 3HB9A 4S05A 1TW3A 2LY9A 1IXSB 2FNAA 5JHUA 2LTPA 1Q1VA 4JX4A 1VQKI 2CQQA 4HDUA 2VQGA 4AIKA 3M3YJ 4D5CA 2LFBA 2O8XA 4XNFA 4AYBN 4BACA 4HDVA 3PFYA 1IUYA 2HWVA 3BR1A 1I3QJ 1WH5A 2LF8A 3CMEI 2QWWA 3I0TA 2Z2SB 3BPXA 3M9AA 4FISA 5DEQA 1T38A 2IS2A 3HOXJ 1TW2A 1Z9CA 2KPMA 2JRMA 2K85A 3I9V2 2H1KA 5HLTA 5M5XJ 5J6XA 1GXPA 4DQ2A 2RV8A 5DUKA 3CDHA 1Z77A 4KIBA 4XORA 4D5FA 3QAHA 3ZGKA 2B63J 2R7OA 4KMFA 2Q0OA 1BJAA 5F0CA 4II3A 2WAFA 4HPQA 2AO9A 2JPBA 3BT9A 4XSXF 3TP0A 4CSWA 1V55H 3LNQA 1SC7A 4MTEA 1FWZA 1KA8A 1T56A 4MQ9F 1WZ2A 3H3ZA 2V9PA 2XF6A 3HM5A 2NRAC 1RPWA 2E5ZA 1I6XA 3HRMA 1TWCJ 3DQVC 1TQIA 4M9ZA 4U7BA 4LJZF 3TEDA 2O6GE 3JRBA 3KP6A 1D0YA 2KDOA 3HZJA 1U5TC 4YELA 2DT6A 4XOPA 1W4MA 1LUJB 2WBMA 4FHTA 1SFOJ 3T5XA 4A5NA 2RGVA 1RI7A 2P0TA 3U1DA 3R4KA 4XR6A 4GDFA 1V54H 2CW8A 4Z2YA 4BUPA 3H1CA 3OYMA 2YUSA 1LEAA 3GTGJ 1JTYA 1A6QA 1PJRA 1FC3A 2Q2EA 2JA2A 4F91B 1FNNA 1U0JA 4F55A 4L9TA 2ZBKA 4D1QA 2KKOA 4RAZA 4FTHA 1MNEA 4G6QA 4G94A 1RRJA 3L1PA 3TOAA 1IXCA 4G12A 1BBYA 2RAEA 1ZQ3P 3SEZA 2VQHA 3GTPJ 2JSPA 1DUXC 2ZJPF 2JJ7A 2PFBA 2JQ7A 3D1NI 2ECCA 4HOBA 3WTYC 2CGPA 4M6VA 3W6KB 3ZMTA 1B8IB 2LBFB 2COMA 2DYSH 4NB5A 3CDIA 3IKVA 3Q9VA 4G7ZF 2WV1A 3LSHA 2CUZA 2Y0SN 1HW1A 3GUDA 2HEOA 1FX7A 4F3QA 3GZNB 3O3KA 2E34A 4BXUA 4OMZA 2OU2A 4BXXJ 1HSTA 2HOEA 1VQ9I 5K7ZA 2FMLA 1N77A 2QKMB 4DOZA 1MMDA 5DCFA 3GTKJ 5CVIA 3U9GA 4BU2A 2LKPA 2OZ6A 1A31A 1I27A 1ITYA 4YFNF 2ISYA 2MZ4A 5IP7J 4FE7A 3QP6A 3HRSA 1WI3A 2H6CA 1T6SA 2YS9A 2EIKH 1JGSA 2MC4A 1IN7A 4UNOA 2O5RA 3BR0A 5FD5A 2MC3A 3PUBA 3VYTB 4M6YA 3GBGA 3FK7A 4RLQA 1QNTA 4UB6C 3J80K 1TWFJ 1IV8A 4B1RA 5BOXA 4GGGA 2A68F 4ANJA 2WC2A 5L3BA 3S3OA 3GWZA 2R7TA 1W7PD 2JT1A 2FQ4A 2R7UA 2R5ZA 3QOPA 1O3RA 3HOWJ 1HKTA 4QPQA 3KPHA 2D45A 2P8TA 3ULQB 1JE8A 4LK1F 1K61A 1MBJA 2XGXA 2PLYA 3Q0UA 3ASOH 4BBRJ 3CCRI 4AD9A 4BJTA 1AWCA 3SXYA 3OSFA 1N75A 1S7OA 1S3JA 3BLYA 1DP7P 5F1JA 2DK5A 3HXLA 1VQ6I 2DYRH 3HEFA 3ZQ7A 4IZZA 2L7MP 4IHTA 3EYYA 2V6EA 4OIOF 3M4OJ 1Z21A 1ZG3A 2XB5A 3S14J 4P9UA 3LMMA 1ZR2A 5KAFC 1H8AC 1X2NA 1KYWA 3HL2A 1V5EA 1YRNB 3RIRA 3KP4A 1SD4A 1B1BA 1BOBA 2JVHA 1K4TA 1ZN2A 3E5QA 1EH6A 3G71I 2KFDA 4ESJA 5CVVA 3RZOJ 4DZJA 1W5CC 4CYCA 3IHUA 1X3ZB 5FRNA 2NAZA 3MKWB 5D4RA 2Y75A 1LFBA 3LQQA 4DIQA 1WH7A 3HPHA 4UUSB 2UV1A 2X1EA 4ZZLA 2EFQA 5IP9J 3VFZA 1XSDA 4ZH4F 1J7KA 3EUAA 2L4MA 1Z3YA 3PNYA 2IA2A 2BHYA 3RKWA 2VB6A 3K6GA 4YEJA 3GTQJ 2ACJA 1FOYA 1YIOA 3UR3C 3GLXA 5FKNA 4XN3A 3T8TA 5DCMB 1B9NA 3LAJA 3SZPA 1L0OC 2HVSA 4FCYA 4ZDOA 3WODF 2JA7J 3J80Z 3J7YJ 5J1UA 1O57A 3K70C 1WVRA 2MG4A 3LFKA 3Q9SA 1OCPA 2CUJA 2XRLA 2ZNZA 5AIQA 1GV2A 3H35A 2V1UA 2JSCA 4PJMA 1ONVA 5CVRA 1YO5C 1PUFA 1WJFA 1DU6A 1T0FA 3H5AA 4HYEA 1GVDA 3WGGA 2XC7A 1T39A 2DDBA 3MAJA 2DA6A 4PJ0C 3P9KA 3R6SA 1YQAA 5IY5H 1XMKA 2BW3A 1MBHA 4WWCA 3RKYA 5B3SH 1EKEA 3DF8A 2ECBA 4P9FA 5B66C 3FXUA 4N0BA 4I0BA 2M8EA 4LG3A 2VC1A 2XF7A 3BDDA 1ZELA 1X19A 1Z05A 1I1GA 1SFKA 5HLIA 1F9NA 1BL0A 1WJBA 4C2UA 5HS8A 2CQKA 4NC7A 1DP3A 2CO5A 3J80R 4GFBA 5TRDA 1QVTA 2FBKA 5IPAA 2VI6A 2LY1A 1IRFA 2ZKZA 2O3FA 3BG3A 4JBAA 4XKVA 2KZGA 3K4BA 4JK1X 1D1BA 1JTXA 1I39A 1G2HA 3I4MJ 1WHUA 5HVQC 5GADJ 5LHGA 2RKHA 1ZTRA 3EUKL 1HLVA 2L54A 1I5ZA 5TJJA 1FEXA 1ZG1A 1RZ4A 1RETA 2DFEA 2W84A 3Q3SA 4M3DA 5HLHA 1JHHA 3QU3A 4KITB 2C6YA 3WHCA 1Y8QB 3BTJA 1EH8A 1XDUA 2R5YB 2XGCA 2MW8A 2JTVA 3M7GA 2EIJH 4PGGA 4CICA 3DV8A 2FBIA 2L3DA 4XONA 2EA4A 3WTTC 3JREA 1KU3A 3G3ZA 1FYMA 2XIGA 4UY8I 1KQ0A 1WJDA 3RCOA 1ZH5A 4BBSJ 2NNYA 3LL7A 1OQYA 3F8CA 4MNUA 3I4PA 3OV8A 4IRGA 3LA3A 2FMYA 2JUCA 5EGOB 2KMUA 1IUFA 3W6VA 2F48A 4AVPA 4M73A 2JPCA 3T0YA 2W7NA 1OLTA 2G7UA 2LC2A 1ZG5A 3J81R 5A2QK 4CUGA 2L9NA 4HG2A 4A3IJ 1V4RA 3CCSI 4A3CJ 4AC0A 1O3SA 5LGTA 4G7HF 5GAHJ 1K4SA 2R4GA 2VOPA 2EIMH 2YX4A 3ML6A 4KICA 4KA4A 2VQLA 2VXDA 3S3MA 3H9GA 2UZKA 2O8KA 5FLXZ 1RR8C 2Q8KA 2A5WA 3CD6I 3A1YA 2BYVE 2DMQA 1EA3A 2ICWG 2W4SA 4BXFA 4RB0A 2W57A 3CJTB 3SHFA 1BI2A 2PMZA 3V7SA 2R7XA 5F08A 2IGKA 1HCRA 2F2EA 4LD5A 2DA1A 4MEYF 4G9YA 1TQMA 4HQMA 4L18B 3JSOA 2IXSA 2Y2ZA 1N78A 1CF7B 3HDDA 5D5XB 4UXNA 5EF6A 4F92B 3LFUA 3KETA 4IJAA 1BN5A 2WAEA 4I99C 3DXJF 4KYWA 4IHXA 2LD5A 2QGUA 1P4AA 4B4CA 1PP7U 1EH7A 3A01A 2OCEA 4EQQA 2PN6A 2FX0A 4A3EJ 1S8NA 3K2AA 4HLXA 4RGUA 4ZTFA 3OYLA 3ZMSA 1BIAA 1AKHA 3MWMA 4G7OF 2VJIA 2STWA 3W3CA 4IRIA 3ECHA 3WTWC 2KL4A 5D5WB 2XGDA 3E1SA 4C3IJ 2HS5A 4YIFA 1QZYA 5FO5A 3GZ6A 3JCUC 1S5LC 4MFEA 2HKOA 3TO7A 4EJWA 1HSJA 3QYBA 1W5TA 3F23A 2R7RA 4MTDA 2O7OA 4L0ZB 2RQPA 2X6OA 1ETQA 4P96A 2COBA 3C1DA 4KNYA 1MBGA 5BNGA 3OYFA 1Z67A 3BP8A 2IVMA 4KIFA 1YLFA 1X1BA 2RC4A 3CUQC 2L7ZA 3CJNA 3ISPA 4E7HA 1O7FA 2QQ9A 3CP2A 4AYBA 3KIOA 2BVMA 3QPTA 4IVNA 2ESHA 1VQNI 1ETWA 2M45A 4WK8F 3OYBA 3OS0A 5CPRB 3FXLA 4BL0B 1FBQA 1YHQI 4IRHA 1AOYA 3BOQA 1Y0NA 4EGYA 2FA5A 2ESNA 2JRTA 4HF2A 3NWTA 1OMIA 3JRFA 2DTZA 3PIPF 4XLNF 1SVMA 3FF5A 2HZTA 1E2XA 2LVSA 3K70D 1LNWA 2X6YA 3CJRB 2IBDA 3AG1H 4IHWA 4LLNA 1RQ6A 3S17J 2QA4I 1RUNA 2BBYA 5M5WJ 4XSZF 5HS7A 5KNLA 2PG4A 2Z16A 5HNHA 1KU7A 4M9XA 2ZMEA 1WJAA 5A2QR 4M3BA 3AKZA 2LDUA 1E3PA 2KZVA 1OCTC 1QGPA 1IV6A 4PDKA 1NG6A 3F6VA 1JKPC 2GOMA 1D5YA 2M7BA 1IC8A 1R36A 4MLOA 3BWGA 4M74A 3HOTA 3HOYJ 5H2FC 4RAFA 2UXNA 2HQAA 3V7CA 3TKYA 5JI6A 2J5OA 3PM1A 2Y9ZA 2OTJI 2ZSHB 5ILVA 5J1YA 4HAMA 4RS8A 1R5ID 1KU9A 2R7ZJ 3O2PE 2QZ8A 3CUQA 1JGGA 1ZHFA 2OV7A 2JVGA 3ZMVA 1AU7A 2NOJB 3SYTA 2VKEA 3BR5A 4LK0F 3ABMH 4BJ5C 3WTSC 1KONA 3TMOA 2PJPA 1Z7UA 2KJBA 4HBLA 4PGHA 1OCZH 4RM2A 2KT0A 4RM3A 4RGRA 4DNCA 2XAUA 1K78B 1RC9A 1TLHB 1GHCA 2XPWA 5EZHA 3S3NA 2AQFA 1FMVA 1ON1A 1FIPA 4FE4A 3RI4A 1FP2A 1FPQA 2TRTA 5FFXA 1B9MA 4HNTA 4A3MJ 2PMZN 5FB2A 2DN0A 4WCGA 2K86A 1B6AA 4BY7J 2W85A 3ZQFA 2XDVA 4KN7X 2HDWA 1K6OA 2L7FP 5AONA 1LFPA 1WGXA 2IS6A 5IYCJ 1W5SA 1WPKA 3BG5A 1MW7A 2YX7A 2E5NA 2Z1DA 3LOCA 4G6TB 4I0AA 2X98A 1NK3P 4I2OA 2D5VA 1QPIA 2NS0A 2A61A 3MMYB 1FOWA 1IZ1A 3WGIA 3L2UA 3KLNA 3BQZA 1D0XA 4N9HA 2JK3A 2E71A 1P6RA 1RUOA 3GFMA 4LB6B 2DT7B 2PMUA 2WY8Q 2K9MA 5L3FA 2HI3A 2DMUA 3BTCA 4L5IA 2LH9A 2K9QA 4NHJA 3CMMA 3TDUC 1P7JA 4PSXA 4I76A 3CCEI 3RSNA 1BI1A 1A35A 2EWNA 1DGWY 4XOTA 4FX4A 3S16J 2L01A 2QBYB 3K4CA 4CH7A 1TWAJ 1V5FA 4EJOA 1Z1DA 2Y48A 5EYRA 3RTRA 2XUBA 3HTSB 1LKXA 3LWFA 4A3FJ 4OIRF 3QYEA 2EFPA 4MGRA 4W1UA 3IWZA 2WADA 3RKXA 2HNHA 2L9SA 3SDBA 4YIRX 4OOIA 4HX4A 1W7PA 2MFZA 3VYUB 3JRDA 1GT0C 2QUFA 3PUFA 4EJTA 1JKOC 2E19A 1BIBA 1NG7A 3L2VA 4M3FA 3CUOA 2E1MC 1MBFA 3FMQA 3QU6A 5F1RA 3DU5A 1O3TA 3BG9A 3L2RA 2HYGD 5E3LA 5B5EC 3FISA 3BJOA 5H6QA 1OCRH 3S93A 3D5LA 3GTOJ 2CS3A 3FMRA 3BY6A 1SVOA
chains in the Genus database with same CATH topology
1Z6TA 2DQRA 1YW9A 5BMZA 3KCCA 1IN6A 2DU9A 3KP3A 1WKMA 1KQ8A 4L9JA 5DUIA 1R5GA 3COAC 2Z9OA 2IA1A 2DFIA 4LG0A 1UB9A 4F7ZA 2IA0A 2LSOA 5F6FA 4MHGA 2K02A 2H09A 1XCVA 2EJRA 3HTUA 1U2WA 1R1VA 4UVCA 4HLYA 4Y13A 4G6DA 1U78A 3F8NA 1HKQA 1G6NA 3ZPLA 1OYWA 4A6EA 2YR2A 2QLZA 3DPLC 2P5VA 3KEOA 3N97A 1FLIA 2STTA 4A0ZA 1D5VA 3TOBA 3KE2A 1WWXA 1ZYRF 2D1HA 3KP7A 1ODDA 4PCQA 3HOSA 5IT9K 2V79A 2GQQA 5D5VB 4U0YA 3WTXC 3CTAA 3REOA 1SMYF 3ZMZA 3FWEA 4A5MA 4IHSA 4ESFA 1R5HA 2DPUA 2EV5A 4HF0A 4D0PA 1U5TA 1ZARA 1DDNA 2BE5F 3KFWX 4UV9A 2XRNA 4ZYDA 1ZRCA 2DT5A 3WTUC 2YU3A 4I09A 1R7JA 5E20A 3BJAA 4RB2C 3QRFF 1R1UA 4LGWA 3L2CA 3V8KA 2V6CA 2RN7A 3G73A 4R8HA 2K4JA 2ZJ2A 5J8CA 1ON2A 5LEKA 3WTVC 4AIJA 4HQEA 1H0MA 2BEOA 4O6JA 2HFHA 1HKSA 5D4SA 4HW0A 4ESBA 5LEJA 1G3WA 2MD5A 1PUEE 3E97A 1LEBA 5ICEA 4Y17A 3LSTA 2CFXA 1TNSA 3J81K 2DO7A 3I54A 1MKMA 1BI0A 2GXBA 1H9TA 3GFJA 5IT9Z 1FBUA 3NEUA 1OYIA 4HX8A 4HF1A 2H94A 4KN4X 1P4XA 1IXRC 1REPC 2KIMA 1GXQA 2G9WA 2W24A 3IC7A 3RYPA 4CDGA 1F4KA 3GZ5A 5LLQA 3D0SA 3KP2A 3EDPA 1LQ1A 2CYYA 2IP2A 2VE9A 3MCZA 5K1YA 2EA2A 3F6OA 1BM9A 2TDXA 3PQJA 3MZYA 4I7HA 2MH9A 2XAQA 1LVAA 4RB3C 2Z3YA 2P6SA 3FHZA 1UHWA 2L4AA 4EM0B 1MJBA 3CO7C 4EVIA 1U8RA 3ROUA 2P4WA 1RNLA 2AS5F 3ZMDA 1A04A 2FSWA 3ERED 4EGZA 1J9IA 2XROA 1RIOH 2VONA 1XCBA 1HW2A 2P6TA 2LF7A 2BGCA 4ASNA 2K7LA 3I59B 1XD7A 3J81Z 4GXOA 5JVTA 4ENMA 2R7DA 1S29A 4Q47A 3N4MA 4BAYA 3IKTA 5D8LB 2XASA 4ENKA 3E6BA 1FBSA 4RB1A 2OAZA 1YS7A 2ELHA 3E6MA 4I02A 1WRJA 5L3EA 1J2XA 3ECOA 3VEPA 2W25A 3T1BA 4YFKF 2KIFA 4EMSA 3MQ0A 1IRGA 4GYIA 1USTA 3KEQA 3HSRA 1XDSA 5HS9A 3S2WA 4O5VA 3F8FA 2LNBA 2QQAA 5E17F 3V8LA 5DCMA 4EJUA 1QBJA 3GXOA 3JTHA 4BNCA 3IRRA 4Q4ZF 3JW4A 3V4GA 2J5PA 2FF4A 1P2FA 1XGNA 3LA7A 1DPRA 1FP1D 2Z5UA 1MD0A 3PFIA 1LDKB 1Z6RA 2O0YA 5D6EA 3CLOA 4BHCA 3I5UA 1MDMB 4A6DA 1B4AA 5CVJA 1WQ2A 3JTGA 4LMYA 1ZGJA 4A0YA 3K9TA 4LB5A 1V3FA 3SZTA 4RGSA 2DW4A 4WXDA 5CYVA 3HHHA 3MFKA 2CWEA 4ZYGA 2ZFWA 2CW0F 4BHPA 3JSPA 5A2QZ 3B02A 2WWYA 1NHAA 3ABTA 2HR3A 2ZXJA 1S6LA 4ON0A 3TQNA 1S7AA 5HLGA 2PMHA 2XHKA 3M1EA 1PP8F 3FX3A 2V1XA 1IF1A 3H92A 2FOKA 5DDGA 5BS6A 1ZLKA 4UVBA 2FE3A 5H6RA 3DEUA 2OQRA 2VBZA 3NQOA 2F5DA 1K7AA 2XKOA 2IW5A 3F72A 1ULYA 3V7RA 3CO6C 1G3SA 1FYKA 3L9FA 3FMSA 5AIPA 1D8JA 4WF2A 3F8MA 4EJVA 4M72A 5L3GA 2VE8A 4ENJA 4OMYA 3WGHA 3TO9A 2ZCWA 5H20A 1YYVA 2H6BA 5E1ZB 3LA2A 2HGCA 2DPDA 2FNPA 3WG9A 1MJAA 3KLOA 3FM3A 1P4WA 2JZYA 2QM3A 3ZP5A 1CF7A 1R00A 1J75A 2Y0MA 2EFWA 1ZRDA 1O3QA 5L3CA 3U2RA 4MQVA 5ED4A 2YPRA 3J7AO 1FSHA 2X4HA 2D2WA 4O3MA 4L9NA 4OIPF 2WTEA 1FOKA 4UVAA 1R1TA 1ZLJA 1DPUA 2FXAA 3R61A 2DI3A 1MGTA 2GA1A 1D3YA 1UCRA 2O61A 3V8JA 3RYRA 2OD5A 3RJPA 2DLLA 1SMTA 5LBQA 2OZUA 5HDKA 3E3VA 2FU4A 3GF2A 2XV4S 2P7VB 1D8KA 3JAMK 1Q1HA 2OQGA 4L9VA 4OIQF 2E7XA 1PDNC 1ZGAA 1MZBA 3BROA 3QP5A 4IXAA 4CGZA 4LLGF 5FFZA 1U5TB 4KIGA 1UFMA 5IT3A 3K1NA 2P5KA 4ZYHA 3K69A 3WU0A 1LDDA 4H0EA 4KMUX 2PQ8A 4A0XA 5HOOA 4K2EA 2WV0A 3MEXA 1TQPA 2M5WA 1C0WA 2F5EA 4CHUA 3F22A 2YSRA 4HV6A 1FSEA 2QQBA 4FT8A 4A12A 4S04A 3KZZA 1YG2A 2F5CA 4ETSA 3DPTA 1QO0D 2DQLA 5JR3A 4ENNA 3R0JA 1HBXG 2M1BA 1K78A 1ZAOA 1YTYA 3K2ZA 4Q48A 1KGSA 1HQCA 2XAJA 2VOOA 2ZNYA 1XB4A 3TGNA 4AWXB 2KJCA 4LLLA 3JAMZ 4ZYEA 2KRFA 1T98A 1K79A 4XBFA 4CXFA 2KIUA 3E5XA 1OKRA 2GWRA 5ILSA 5CJ9A 4UHTA 3R60A 3TDZC 5D8KB 4HV5A 3GW2A 3ABUA 1BOAA 5D5UB 2VT2A 1JXSA 2VBWA 2QBYA 2A5YB 1TBXA 3NRVA 5CLSA 2A3SA 4U0VA 2HTJA 4Y15A 1KYZA 3SQNA 3K1MA 1R22A 5BQTA 1MJ9A 4CYDA 4WXHA 3Q5FA 5K5RA 1ZREA 2VXZA 1YW7A 4IF4A 2Z33A 3R0AA 2XAHA 4P55A 1R23A 2VT3A 2K4BA 1XGOA 5EEGA 1OPCA 2QVOA 4LFUA 3DFGA 2MH2A 1SFXA 2G7HA 4NQWA 2P7CB 5FD6A 2XKPA 3HIFA 4KFCA 4IPAA 3HSEA 2IRFG 2A6EF 5DD8A 2IT0A 5J8FA 2VODA 3FXRA 4GCVA 2L02A 1FZPB 2ISZA 4I01A 2DAOA 4BHBA 3HUGA 1L3LA 3E5UA 1VTNC 2VBYA 2RDPA 1P92A 4QWQA 3WU1B 1F1ZA 5D6FA 3I58A 1E17A 5ICFA 1TNTA 3E6CC 1STZA 5FGMA 4TV7A 5K5QA 1XN7A 3I71A 3F21A 2GZWA 4JQFA 2DBBA 2A6HF 3M8EA 1J0RA 3I53A 5LGNA 1HW5A 4Q5SF 4KDPA 4PZJA 2EK5A 2NYXA 3P7NA 3L00A 4RGXA 3KZYA 4WX9A 2R7FA 1U6GA 3IWFA 5F64A 4M9SA 1ZRFA 2HQRA 4M6XA 2F5FA 2E1CA 2E7WA 3F3XA 3LQRA 2GXGA 2V1DA 1G3YA 4XRFA 3L7WA 2AXLA 3C18A 5E1XA 2VC0A 4KUMA 3GX4X 2FBHA 4E70A 3FZVA 5KK1A 3GVAA 2M30A 4OINF 4KT5C 1O7LA 5E18F 5FLXK 5HDNA 2DTRA 4GO1A 5ILUA 3O6BB 3HRTA 5DYMA 1CGPA 5JFRA 2UWMA 2XAGA 3RDIA 4M71A 3GYHX 3MZHA 4YFXF 2Z99A 2CSOA 2VN2A 5LRRA 4WXCA 3QPHA 4I98B 2HTSA 4N9IA 4A2UA 2RNJA 2OBPA 2B0LA 1BC8C 2MLKA 2MA3A 3VODA 1UHMA 2ZO4A 1XSVA 5EEHA 5E8GA 2A07F 2EFNA 2FQ3A 4YIIA 4CO8A 1IW7F 4B8XA 3K1PA 1EV7A 2GA2A 2IPQX 2ZMEB 4G8XA 4BQAA 2HDCA 3P9IA 4HX7A 5KVRA 2OA4A 1KQ9A 2E1NA 1QZZA 3ELKA 2IJLA 5LGUA 1G4DA 3WE2A 3FXQA 1IN4A 3CUQB 1SD7A 1FY7A 2QYOA 3ZMUA 4L0YB 5ERIA 4UV8A 3C7JA 5DV5A 4B09A 1TTYA 1XGMA 1G3TA 3WE3A 3GFLA 3C3WA 4BH9A 4ZZDA 5ICCA 5E8IA 3LAPA 3OOPA 3KP5A 1KU2A 4CZZA 1SFUA 3EYIA 2UXXA 2GIVA 3VB2A 3I59A 1OR7A 4HZFA 3K0LA 3ZN0A 1OYYA 3IRQA 5LHHA 4BYYA 3HRUA 2XVCA 1QPMA 1LDJA 1J5YA 4QLCU 2RVCA 4EM1A 2O03A 1WSUA 1H9GA 3B73A 3DP7A 2HYFA 2XAFA 2QENA 1FYLA 3VOEA 4R79A 2FEZA 2EB7A 2GAUA 1YS6A 4RAYA 3BJ6A 3EQLF 1SD5A 4P5OA 4R1HA 1Y0UA 1T2KA 1SAXA 2CG4A 1SD6A 1W7PB 2K27A 1BI3A 3H3UA 1B59A 3GFIA 2EV0A 1R58A 1LJ9A 4UUVA 2H27A 3AAFA 5K5OA 2D1VA 1BC7C 1U3EM 1QQIA 2R3SA 2HKXA 1WI9A 1IN8A 4L5JA 2BV6A 1Z91A 3PQKA 1XSXA 1YW8A 2V9VA 3I64A 3ZN1A 2P5LC 3P9CA 2PI0A 2EFOA 4GYGA 2PBIA 3F8BA 2X0LA 4U0WA 3GO5A 4XLPF 5BPIA 4LG0B 2VBXA 4U7DA 5E1WA 5BPDA 4EM2A 1XMAA 1IAWA 3FM5A 3HYIA 5DD4A 1GVJA 4U88A 1FT9A 2MBFA 1IN5A 1MDMA 5LRSA 2MLGA 3L09A 3RPUA 1XGSA 1J59A 6PAXA 3TO6A 4FX0A 3M8FA 1I1SA 4MEXF 1X3UA 2M87A 5LHIA 1HXDA 2A69F 1LB2A 1F5TA 1JHFA 2ETHA 5L3DA 3BPVA 3SFZA 3HSFA 3IL2A 3HHGA 4YG2F 4HA8A 5HDGA 3BZ6A 2EV6A 2NNNA 3T8RA 4EV0A 3WTZA 2FRHA 3W6JB 1USSA 5ICGA 4OU0A 3EETA 3RPQA 2DK8A 4AIHA 2PEXA 1SFEA 3GEZA 2HQNA 3EUHA 1YFHA 3E6DA 3DKWA 2ADUA 5CVUA 4S05A 1TW3A 1IXSB 2FNAA 5JHUA 4HDUA 4AIKA 2O8XA 4HDVA 1IUYA 2HWVA 2LF8A 2QWWA 3I0TA 3BPXA 3M9AA 5DEQA 1T38A 1TW2A 1Z9CA 5J6XA 1GXPA 4DQ2A 2RV8A 5DUKA 3CDHA 4KIBA 3QAHA 4KMFA 2Q0OA 1BJAA 2JPBA 4XSXF 4MTEA 1FWZA 1KA8A 4MQ9F 3H3ZA 2NRAC 1I6XA 3HRMA 3DQVC 1TQIA 4M9ZA 4U7BA 4LJZF 2O6GE 3KP6A 1U5TC 1W4MA 4FHTA 3T5XA 4A5NA 2RGVA 1RI7A 3U1DA 3R4KA 4Z2YA 1LEAA 1FC3A 2Q2EA 1FNNA 4L9TA 2ZBKA 2KKOA 4RAZA 4G6QA 4G94A 3TOAA 1IXCA 1BBYA 1DUXC 2PFBA 2CGPA 4HOBA 3WTYC 3W6KB 3ZMTA 2COMA 4NB5A 3IKVA 3Q9VA 4G7ZF 1HW1A 3GUDA 2HEOA 1FX7A 3O3KA 4BXUA 4OMZA 2OU2A 1HSTA 2HOEA 2FMLA 5DCFA 5CVIA 3U9GA 2LKPA 2OZ6A 1I27A 4YFNF 2ISYA 3QP6A 3HRSA 2H6CA 1T6SA 1JGSA 1IN7A 4UNOA 5FD5A 2MC3A 4M6YA 1QNTA 3J80K 5BOXA 4GGGA 2A68F 2WC2A 5L3BA 3GWZA 1W7PD 2JT1A 3QOPA 1O3RA 1HKTA 2D45A 2P8TA 3ULQB 1JE8A 4LK1F 2XGXA 2PLYA 4AD9A 1AWCA 3SXYA 1S7OA 1S3JA 1DP7P 2DK5A 3ZQ7A 4IHTA 3EYYA 4OIOF 1ZG3A 4P9UA 1KYWA 3RIRA 3KP4A 1SD4A 1B1BA 1ZN2A 3E5QA 1EH6A 4ESJA 5CVVA 3IHUA 2NAZA 5D4RA 2Y75A 3LQQA 4ZZLA 2EFQA 3VFZA 1XSDA 4ZH4F 1J7KA 2L4MA 2IA2A 3RKWA 2ACJA 1YIOA 3GLXA 3T8TA 5DCMB 1B9NA 3LAJA 3SZPA 1L0OC 3WODF 3J80Z 1O57A 3LFKA 3Q9SA 2ZNZA 5AIQA 2V1UA 2JSCA 1ONVA 5CVRA 1YO5C 1T0FA 4HYEA 3WGGA 1T39A 3MAJA 3P9KA 3R6SA 1YQAA 1XMKA 4WWCA 3RKYA 3DF8A 4P9FA 3FXUA 4N0BA 4I0BA 2M8EA 2VC1A 3BDDA 1Z05A 1I1GA 5HLIA 1F9NA 5HS8A 2CQKA 2CO5A 5TRDA 2FBKA 1IRFA 2ZKZA 2O3FA 4JBAA 4JK1X 5HVQC 5LHGA 2RKHA 2L54A 1I5ZA 5TJJA 1ZG1A 1RZ4A 2W84A 5HLHA 1JHHA 3QU3A 2C6YA 1EH8A 1XDUA 2JTVA 3M7GA 4PGGA 4CICA 3DV8A 2FBIA 2L3DA 2EA4A 3WTTC 1KU3A 3G3ZA 1FYMA 2XIGA 1KQ0A 1ZH5A 2NNYA 3F8CA 4MNUA 3I4PA 3OV8A 4IRGA 3LA3A 2FMYA 4AVPA 4M73A 2JPCA 3T0YA 2G7UA 1ZG5A 5A2QK 1V4RA 1O3SA 5LGTA 4G7HF 2VOPA 2YX4A 3ML6A 4KICA 4KA4A 2UZKA 5FLXZ 2Q8KA 2BYVE 4RB0A 2W57A 3SHFA 1BI2A 3V7SA 2F2EA 4LD5A 4MEYF 4G9YA 1TQMA 4HQMA 4L18B 3JSOA 1CF7B 5D5XB 4UXNA 3KETA 4IJAA 1BN5A 4KYWA 3DXJF 1PP7U 1P4AA 1EH7A 4EQQA 2PN6A 1S8NA 4HLXA 4RGUA 3ZMSA 1BIAA 3MWMA 4G7OF 2STWA 4IRIA 3ECHA 3WTWC 5D5WB 2HS5A 4YIFA 1QZYA 5FO5A 3GZ6A 2HKOA 3TO7A 4EJWA 1HSJA 1W5TA 3F23A 4MTDA 4L0ZB 2RQPA 4P96A 3C1DA 4KNYA 3BP8A 2IVMA 4KIFA 1YLFA 2RC4A 3CUQC 3CJNA 3ISPA 1O7FA 2QQ9A 3QPTA 4IVNA 2ESHA 2M45A 4WK8F 1FBQA 4IRHA 1AOYA 3BOQA 4EGYA 2FA5A 2ESNA 2JRTA 4HF2A 1OMIA 4XLNF 3FF5A 2HZTA 1E2XA 1LNWA 4LLNA 1RUNA 2BBYA 4XSZF 5HS7A 2PG4A 1KU7A 4M9XA 2ZMEA 2LDUA 1QGPA 4PDKA 3F6VA 1R36A 3HOTA 3BWGA 4M74A 2UXNA 3V7CA 5JI6A 3TKYA 2J5OA 5ILVA 4HAMA 4RS8A 1KU9A 3O2PE 2QZ8A 3CUQA 1ZHFA 3ZMVA 4LK0F 3WTSC 2PJPA 1Z7UA 2KJBA 4HBLA 4PGHA 4RGRA 4DNCA 1K78B 1TLHB 1GHCA 1ON1A 3RI4A 1FP2A 1FPQA 5FFXA 1B9MA 5FB2A 4WCGA 2K86A 1B6AA 2W85A 4KN7X 1K6OA 5AONA 1W5SA 2YX7A 4I0AA 4I2OA 2NS0A 2A61A 1IZ1A 3WGIA 3KLNA 4N9HA 1P6RA 1RUOA 3GFMA 4LB6B 2PMUA 5L3FA 4L5IA 4NHJA 3TDUC 1BI1A 2EWNA 4FX4A 2L01A 2QBYB 4EJOA 1Z1DA 2Y48A 3RTRA 2XUBA 3HTSB 3LWFA 4OIRF 4MGRA 2EFPA 3IWZA 3RKXA 4OOIA 4HX4A 1W7PA 2QUFA 4EJTA 1BIBA 3CUOA 3FMQA 3QU6A 5F1RA 1O3TA 2HYGD 3BJOA 5H6QA 3D5LA 3FMRA 3BY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6T A;  2DQR A;  1YW9 A;  5BMZ A;  3KCC A;  1IN6 A;  2DU9 A;  3KP3 A;  1WKM A;  1KQ8 A;  4L9J A;  5DUI A;  1R5G A;  3COA C;  2Z9O A;  2IA1 A;  2DFI A;  4LG0 A;  1UB9 A;  4F7Z A;  2IA0 A;  2LSO A;  5F6F A;  4MHG A;  2K02 A;  2H09 A;  1XCV A;  2EJR A;  3HTU A;  1U2W A;  1R1V A;  4UVC A;  4HLY A;  4Y13 A;  4G6D A;  1U78 A;  3F8N A;  1HKQ A;  1G6N A;  3ZPL A;  1OYW A;  4A6E A;  2YR2 A;  2QLZ A;  3DPL C;  2P5V A;  3KEO A;  3N97 A;  1FLI A;  2STT A;  4A0Z A;  1D5V A;  3TOB A;  3KE2 A;  1WWX A;  1ZYR F;  2D1H A;  3KP7 A;  1ODD A;  4PCQ A;  3HOS A;  5IT9 K;  2V79 A;  2GQQ A;  5D5V B;  4U0Y A;  3WTX C;  3CTA A;  3REO A;  1SMY F;  3ZMZ A;  3FWE A;  4A5M A;  4IHS A;  4ESF A;  1R5H A;  2DPU A;  2EV5 A;  4HF0 A;  4D0P A;  1U5T A;  1ZAR A;  1DDN A;  2BE5 F;  3KFW X;  4UV9 A;  2XRN A;  4ZYD A;  1ZRC A;  2DT5 A;  3WTU C;  2YU3 A;  4I09 A;  1R7J A;  5E20 A;  3BJA A;  4RB2 C;  3QRF F;  1R1U A;  4LGW A;  3L2C A;  3V8K A;  2V6C A;  2RN7 A;  3G73 A;  4R8H A;  2K4J A;  2ZJ2 A;  5J8C A;  1ON2 A;  5LEK A;  3WTV C;  4AIJ A;  4HQE A;  1H0M A;  2BEO A;  4O6J A;  2HFH A;  1HKS A;  5D4S A;  4HW0 A;  4ESB A;  5LEJ A;  1G3W A;  2MD5 A;  1PUE E;  3E97 A;  1LEB A;  5ICE A;  4Y17 A;  3LST A;  2CFX A;  1TNS A;  3J81 K;  2DO7 A;  3I54 A;  1MKM A;  1BI0 A;  2GXB A;  1H9T A;  3GFJ A;  5IT9 Z;  1FBU A;  3NEU A;  1OYI A;  4HX8 A;  4HF1 A;  2H94 A;  4KN4 X;  1P4X A;  1IXR C;  1REP C;  2KIM A;  1GXQ A;  2G9W A;  2W24 A;  3IC7 A;  3RYP A;  4CDG A;  1F4K A;  3GZ5 A;  5LLQ A;  3D0S A;  3KP2 A;  3EDP A;  1LQ1 A;  2CYY A;  2IP2 A;  2VE9 A;  3MCZ A;  5K1Y A;  2EA2 A;  3F6O A;  1BM9 A;  2TDX A;  3PQJ A;  3MZY A;  4I7H A;  2MH9 A;  2XAQ A;  1LVA A;  4RB3 C;  2Z3Y A;  2P6S A;  3FHZ A;  1UHW A;  2L4A A;  4EM0 B;  1MJB A;  3CO7 C;  4EVI A;  1U8R A;  3ROU A;  2P4W A;  1RNL A;  2AS5 F;  3ZMD A;  1A04 A;  2FSW A;  3ERE D;  4EGZ A;  1J9I A;  2XRO A;  1RIO H;  2VON A;  1XCB A;  1HW2 A;  2P6T A;  2LF7 A;  2BGC A;  4ASN A;  2K7L A;  3I59 B;  1XD7 A;  3J81 Z;  4GXO A;  5JVT A;  4ENM A;  2R7D A;  1S29 A;  4Q47 A;  3N4M A;  4BAY A;  3IKT A;  5D8L B;  2XAS A;  4ENK A;  3E6B A;  1FBS A;  4RB1 A;  2OAZ A;  1YS7 A;  2ELH A;  3E6M A;  4I02 A;  1WRJ A;  5L3E A;  1J2X A;  3ECO A;  3VEP A;  2W25 A;  3T1B A;  4YFK F;  2KIF A;  4EMS A;  3MQ0 A;  1IRG A;  4GYI A;  1UST A;  3KEQ A;  3HSR A;  1XDS A;  5HS9 A;  3S2W A;  4O5V A;  3F8F A;  2LNB A;  2QQA A;  5E17 F;  3V8L A;  5DCM A;  4EJU A;  1QBJ A;  3GXO A;  3JTH A;  4BNC A;  3IRR A;  4Q4Z F;  3JW4 A;  3V4G A;  2J5P A;  2FF4 A;  1P2F A;  1XGN A;  3LA7 A;  1DPR A;  1FP1 D;  2Z5U A;  1MD0 A;  3PFI A;  1LDK B;  1Z6R A;  2O0Y A;  5D6E A;  3CLO A;  4BHC A;  3I5U A;  1MDM B;  4A6D A;  1B4A A;  5CVJ A;  1WQ2 A;  3JTG A;  4LMY A;  1ZGJ A;  4A0Y A;  3K9T A;  4LB5 A;  1V3F A;  3SZT A;  4RGS A;  2DW4 A;  4WXD A;  5CYV A;  3HHH A;  3MFK A;  2CWE A;  4ZYG A;  2ZFW A;  2CW0 F;  4BHP A;  3JSP A;  5A2Q Z;  3B02 A;  2WWY A;  1NHA A;  3ABT A;  2HR3 A;  2ZXJ A;  1S6L A;  4ON0 A;  3TQN A;  1S7A A;  5HLG A;  2PMH A;  2XHK A;  3M1E A;  1PP8 F;  3FX3 A;  2V1X A;  1IF1 A;  3H92 A;  2FOK A;  5DDG A;  5BS6 A;  1ZLK A;  4UVB A;  2FE3 A;  5H6R A;  3DEU A;  2OQR A;  2VBZ A;  3NQO A;  2F5D A;  1K7A A;  2XKO A;  2IW5 A;  3F72 A;  1ULY A;  3V7R A;  3CO6 C;  1G3S A;  1FYK A;  3L9F A;  3FMS A;  5AIP A;  1D8J A;  4WF2 A;  3F8M A;  4EJV A;  4M72 A;  5L3G A;  2VE8 A;  4ENJ A;  4OMY A;  3WGH A;  3TO9 A;  2ZCW A;  5H20 A;  1YYV A;  2H6B A;  5E1Z B;  3LA2 A;  2HGC A;  2DPD A;  2FNP A;  3WG9 A;  1MJA A;  3KLO A;  3FM3 A;  1P4W A;  2JZY A;  2QM3 A;  3ZP5 A;  1CF7 A;  1R00 A;  1J75 A;  2Y0M A;  2EFW A;  1ZRD A;  1O3Q A;  5L3C A;  3U2R A;  4MQV A;  5ED4 A;  2YPR A;  3J7A O;  1FSH A;  2X4H A;  2D2W A;  4O3M A;  4L9N A;  4OIP F;  2WTE A;  1FOK A;  4UVA A;  1R1T A;  1ZLJ A;  1DPU A;  2FXA A;  3R61 A;  2DI3 A;  1MGT A;  2GA1 A;  1D3Y A;  1UCR A;  2O61 A;  3V8J A;  3RYR A;  2OD5 A;  3RJP A;  2DLL A;  1SMT A;  5LBQ A;  2OZU A;  5HDK A;  3E3V A;  2FU4 A;  3GF2 A;  2XV4 S;  2P7V B;  1D8K A;  3JAM K;  1Q1H A;  2OQG A;  4L9V A;  4OIQ F;  2E7X A;  1PDN C;  1ZGA A;  1MZB A;  3BRO A;  3QP5 A;  4IXA A;  4CGZ A;  4LLG F;  5FFZ A;  1U5T B;  4KIG A;  1UFM A;  5IT3 A;  3K1N A;  2P5K A;  4ZYH A;  3K69 A;  3WU0 A;  1LDD A;  4H0E A;  4KMU X;  2PQ8 A;  4A0X A;  5HOO A;  4K2E A;  2WV0 A;  3MEX A;  1TQP A;  2M5W A;  1C0W A;  2F5E A;  4CHU A;  3F22 A;  2YSR A;  4HV6 A;  1FSE A;  2QQB A;  4FT8 A;  4A12 A;  4S04 A;  3KZZ A;  1YG2 A;  2F5C A;  4ETS A;  3DPT A;  1QO0 D;  2DQL A;  5JR3 A;  4ENN A;  3R0J A;  1HBX G;  2M1B A;  1K78 A;  1ZAO A;  1YTY A;  3K2Z A;  4Q48 A;  1KGS A;  1HQC A;  2XAJ A;  2VOO A;  2ZNY A;  1XB4 A;  3TGN A;  4AWX B;  2KJC A;  4LLL A;  3JAM Z;  4ZYE A;  2KRF A;  1T98 A;  1K79 A;  4XBF A;  4CXF A;  2KIU A;  3E5X A;  1OKR A;  2GWR A;  5ILS A;  5CJ9 A;  4UHT A;  3R60 A;  3TDZ C;  5D8K B;  4HV5 A;  3GW2 A;  3ABU A;  1BOA A;  5D5U B;  2VT2 A;  1JXS A;  2VBW A;  2QBY A;  2A5Y B;  1TBX A;  3NRV A;  5CLS A;  2A3S A;  4U0V A;  2HTJ A;  4Y15 A;  1KYZ A;  3SQN A;  3K1M A;  1R22 A;  5BQT A;  1MJ9 A;  4CYD A;  4WXH A;  3Q5F A;  5K5R A;  1ZRE A;  2VXZ A;  1YW7 A;  4IF4 A;  2Z33 A;  3R0A A;  2XAH A;  4P55 A;  1R23 A;  2VT3 A;  2K4B A;  1XGO A;  5EEG A;  1OPC A;  2QVO A;  4LFU A;  3DFG A;  2MH2 A;  1SFX A;  2G7H A;  4NQW A;  2P7C B;  5FD6 A;  2XKP A;  3HIF A;  4KFC A;  4IPA A;  3HSE A;  2IRF G;  2A6E F;  5DD8 A;  2IT0 A;  5J8F A;  2VOD A;  3FXR A;  4GCV A;  2L02 A;  1FZP B;  2ISZ A;  4I01 A;  2DAO A;  4BHB A;  3HUG A;  1L3L A;  3E5U A;  1VTN C;  2VBY A;  2RDP A;  1P92 A;  4QWQ A;  3WU1 B;  1F1Z A;  5D6F A;  3I58 A;  1E17 A;  5ICF A;  1TNT A;  3E6C C;  1STZ A;  5FGM A;  4TV7 A;  5K5Q A;  1XN7 A;  3I71 A;  3F21 A;  2GZW A;  4JQF A;  2DBB A;  2A6H F;  3M8E A;  1J0R A;  3I53 A;  5LGN A;  1HW5 A;  4Q5S F;  4KDP A;  4PZJ A;  2EK5 A;  2NYX A;  3P7N A;  3L00 A;  4RGX A;  3KZY A;  4WX9 A;  2R7F A;  1U6G A;  3IWF A;  5F64 A;  4M9S A;  1ZRF A;  2HQR A;  4M6X A;  2F5F A;  2E1C A;  2E7W A;  3F3X A;  3LQR A;  2GXG A;  2V1D A;  1G3Y A;  4XRF A;  3L7W A;  2AXL A;  3C18 A;  5E1X A;  2VC0 A;  4KUM A;  3GX4 X;  2FBH A;  4E70 A;  3FZV A;  5KK1 A;  3GVA A;  2M30 A;  4OIN F;  4KT5 C;  1O7L A;  5E18 F;  5FLX K;  5HDN A;  2DTR A;  4GO1 A;  5ILU A;  3O6B B;  3HRT A;  5DYM A;  1CGP A;  5JFR A;  2UWM A;  2XAG A;  3RDI A;  4M71 A;  3GYH X;  3MZH A;  4YFX F;  2Z99 A;  2CSO A;  2VN2 A;  5LRR A;  4WXC A;  3QPH A;  4I98 B;  2HTS A;  4N9I A;  4A2U A;  2RNJ A;  2OBP A;  2B0L A;  1BC8 C;  2MLK A;  2MA3 A;  3VOD A;  1UHM A;  2ZO4 A;  1XSV A;  5EEH A;  5E8G A;  2A07 F;  2EFN A;  2FQ3 A;  4YII A;  4CO8 A;  1IW7 F;  4B8X A;  3K1P A;  1EV7 A;  2GA2 A;  2IPQ X;  2ZME B;  4G8X A;  4BQA A;  2HDC A;  3P9I A;  4HX7 A;  5KVR A;  2OA4 A;  1KQ9 A;  2E1N A;  1QZZ A;  3ELK A;  2IJL A;  5LGU A;  1G4D A;  3WE2 A;  3FXQ A;  1IN4 A;  3CUQ B;  1SD7 A;  1FY7 A;  2QYO A;  3ZMU A;  4L0Y B;  5ERI A;  4UV8 A;  3C7J A;  5DV5 A;  4B09 A;  1TTY A;  1XGM A;  1G3T A;  3WE3 A;  3GFL A;  3C3W A;  4BH9 A;  4ZZD A;  5ICC A;  5E8I A;  3LAP A;  3OOP A;  3KP5 A;  1KU2 A;  4CZZ A;  1SFU A;  3EYI A;  2UXX A;  2GIV A;  3VB2 A;  3I59 A;  1OR7 A;  4HZF A;  3K0L A;  3ZN0 A;  1OYY A;  3IRQ A;  5LHH A;  4BYY A;  3HRU A;  2XVC A;  1QPM A;  1LDJ A;  1J5Y A;  4QLC U;  2RVC A;  4EM1 A;  2O03 A;  1WSU A;  1H9G A;  3B73 A;  3DP7 A;  2HYF A;  2XAF A;  2QEN A;  1FYL A;  3VOE A;  4R79 A;  2FEZ A;  2EB7 A;  2GAU A;  1YS6 A;  4RAY A;  3BJ6 A;  3EQL F;  1SD5 A;  4P5O A;  4R1H A;  1Y0U A;  1T2K A;  1SAX A;  2CG4 A;  1SD6 A;  1W7P B;  2K27 A;  1BI3 A;  3H3U A;  1B59 A;  3GFI A;  2EV0 A;  1R58 A;  1LJ9 A;  4UUV A;  2H27 A;  3AAF A;  5K5O A;  2D1V A;  1BC7 C;  1U3E M;  1QQI A;  2R3S A;  2HKX A;  1WI9 A;  1IN8 A;  4L5J A;  2BV6 A;  1Z91 A;  3PQK A;  1XSX A;  1YW8 A;  2V9V A;  3I64 A;  3ZN1 A;  2P5L C;  3P9C A;  2PI0 A;  2EFO A;  4GYG A;  2PBI A;  3F8B A;  2X0L A;  4U0W A;  3GO5 A;  4XLP F;  5BPI A;  4LG0 B;  2VBX A;  4U7D A;  5E1W A;  5BPD A;  4EM2 A;  1XMA A;  1IAW A;  3FM5 A;  3HYI A;  5DD4 A;  1GVJ A;  4U88 A;  1FT9 A;  2MBF A;  1IN5 A;  1MDM A;  5LRS A;  2MLG A;  3L09 A;  3RPU A;  1XGS A;  1J59 A;  6PAX A;  3TO6 A;  4FX0 A;  3M8F A;  1I1S A;  4MEX F;  1X3U A;  2M87 A;  5LHI A;  1HXD A;  2A69 F;  1LB2 A;  1F5T A;  1JHF A;  2ETH A;  5L3D A;  3BPV A;  3SFZ A;  3HSF A;  3IL2 A;  3HHG A;  4YG2 F;  4HA8 A;  5HDG A;  3BZ6 A;  2EV6 A;  2NNN A;  3T8R A;  4EV0 A;  3WTZ A;  2FRH A;  3W6J B;  1USS A;  5ICG A;  4OU0 A;  3EET A;  3RPQ A;  2DK8 A;  4AIH A;  2PEX A;  1SFE A;  3GEZ A;  2HQN A;  3EUH A;  1YFH A;  3E6D A;  3DKW A;  2ADU A;  5CVU A;  4S05 A;  1TW3 A;  1IXS B;  2FNA A;  5JHU A;  4HDU A;  4AIK A;  2O8X A;  4HDV A;  1IUY A;  2HWV A;  2LF8 A;  2QWW A;  3I0T A;  3BPX A;  3M9A A;  5DEQ A;  1T38 A;  1TW2 A;  1Z9C A;  5J6X A;  1GXP A;  4DQ2 A;  2RV8 A;  5DUK A;  3CDH A;  4KIB A;  3QAH A;  4KMF A;  2Q0O A;  1BJA A;  2JPB A;  4XSX F;  4MTE A;  1FWZ A;  1KA8 A;  4MQ9 F;  3H3Z A;  2NRA C;  1I6X A;  3HRM A;  3DQV C;  1TQI A;  4M9Z A;  4U7B A;  4LJZ F;  2O6G E;  3KP6 A;  1U5T C;  1W4M A;  4FHT A;  3T5X A;  4A5N A;  2RGV A;  1RI7 A;  3U1D A;  3R4K A;  4Z2Y A;  1LEA A;  1FC3 A;  2Q2E A;  1FNN A;  4L9T A;  2ZBK A;  2KKO A;  4RAZ A;  4G6Q A;  4G94 A;  3TOA A;  1IXC A;  1BBY A;  1DUX C;  2PFB A;  2CGP A;  4HOB A;  3WTY C;  3W6K B;  3ZMT A;  2COM A;  4NB5 A;  3IKV A;  3Q9V A;  4G7Z F;  1HW1 A;  3GUD A;  2HEO A;  1FX7 A;  3O3K A;  4BXU A;  4OMZ A;  2OU2 A;  1HST A;  2HOE A;  2FML A;  5DCF A;  5CVI A;  3U9G A;  2LKP A;  2OZ6 A;  1I27 A;  4YFN F;  2ISY A;  3QP6 A;  3HRS A;  2H6C A;  1T6S A;  1JGS A;  1IN7 A;  4UNO A;  5FD5 A;  2MC3 A;  4M6Y A;  1QNT A;  3J80 K;  5BOX A;  4GGG A;  2A68 F;  2WC2 A;  5L3B A;  3GWZ A;  1W7P D;  2JT1 A;  3QOP A;  1O3R A;  1HKT A;  2D45 A;  2P8T A;  3ULQ B;  1JE8 A;  4LK1 F;  2XGX A;  2PLY A;  4AD9 A;  1AWC A;  3SXY A;  1S7O A;  1S3J A;  1DP7 P;  2DK5 A;  3ZQ7 A;  4IHT A;  3EYY A;  4OIO F;  1ZG3 A;  4P9U A;  1KYW A;  3RIR A;  3KP4 A;  1SD4 A;  1B1B A;  1ZN2 A;  3E5Q A;  1EH6 A;  4ESJ A;  5CVV A;  3IHU A;  2NAZ A;  5D4R A;  2Y75 A;  3LQQ A;  4ZZL A;  2EFQ A;  3VFZ A;  1XSD A;  4ZH4 F;  1J7K A;  2L4M A;  2IA2 A;  3RKW A;  2ACJ A;  1YIO A;  3GLX A;  3T8T A;  5DCM B;  1B9N A;  3LAJ A;  3SZP A;  1L0O C;  3WOD F;  3J80 Z;  1O57 A;  3LFK A;  3Q9S A;  2ZNZ A;  5AIQ A;  2V1U A;  2JSC A;  1ONV A;  5CVR A;  1YO5 C;  1T0F A;  4HYE A;  3WGG A;  1T39 A;  3MAJ A;  3P9K A;  3R6S A;  1YQA A;  1XMK A;  4WWC A;  3RKY A;  3DF8 A;  4P9F A;  3FXU A;  4N0B A;  4I0B A;  2M8E A;  2VC1 A;  3BDD A;  1Z05 A;  1I1G A;  5HLI A;  1F9N A;  5HS8 A;  2CQK A;  2CO5 A;  5TRD A;  2FBK A;  1IRF A;  2ZKZ A;  2O3F A;  4JBA A;  4JK1 X;  5HVQ C;  5LHG A;  2RKH A;  2L54 A;  1I5Z A;  5TJJ A;  1ZG1 A;  1RZ4 A;  2W84 A;  5HLH A;  1JHH A;  3QU3 A;  2C6Y A;  1EH8 A;  1XDU A;  2JTV A;  3M7G A;  4PGG A;  4CIC A;  3DV8 A;  2FBI A;  2L3D A;  2EA4 A;  3WTT C;  1KU3 A;  3G3Z A;  1FYM A;  2XIG A;  1KQ0 A;  1ZH5 A;  2NNY A;  3F8C A;  4MNU A;  3I4P A;  3OV8 A;  4IRG A;  3LA3 A;  2FMY A;  4AVP A;  4M73 A;  2JPC A;  3T0Y A;  2G7U A;  1ZG5 A;  5A2Q K;  1V4R A;  1O3S A;  5LGT A;  4G7H F;  2VOP A;  2YX4 A;  3ML6 A;  4KIC A;  4KA4 A;  2UZK A;  5FLX Z;  2Q8K A;  2BYV E;  4RB0 A;  2W57 A;  3SHF A;  1BI2 A;  3V7S A;  2F2E A;  4LD5 A;  4MEY F;  4G9Y A;  1TQM A;  4HQM A;  4L18 B;  3JSO A;  1CF7 B;  5D5X B;  4UXN A;  3KET A;  4IJA A;  1BN5 A;  4KYW A;  3DXJ F;  1PP7 U;  1P4A A;  1EH7 A;  4EQQ A;  2PN6 A;  1S8N A;  4HLX A;  4RGU A;  3ZMS A;  1BIA A;  3MWM A;  4G7O F;  2STW A;  4IRI A;  3ECH A;  3WTW C;  5D5W B;  2HS5 A;  4YIF A;  1QZY A;  5FO5 A;  3GZ6 A;  2HKO A;  3TO7 A;  4EJW A;  1HSJ A;  1W5T A;  3F23 A;  4MTD A;  4L0Z B;  2RQP A;  4P96 A;  3C1D A;  4KNY A;  3BP8 A;  2IVM A;  4KIF A;  1YLF A;  2RC4 A;  3CUQ C;  3CJN A;  3ISP A;  1O7F A;  2QQ9 A;  3QPT A;  4IVN A;  2ESH A;  2M45 A;  4WK8 F;  1FBQ A;  4IRH A;  1AOY A;  3BOQ A;  4EGY A;  2FA5 A;  2ESN A;  2JRT A;  4HF2 A;  1OMI A;  4XLN F;  3FF5 A;  2HZT A;  1E2X A;  1LNW A;  4LLN A;  1RUN A;  2BBY A;  4XSZ F;  5HS7 A;  2PG4 A;  1KU7 A;  4M9X A;  2ZME A;  2LDU A;  1QGP A;  4PDK A;  3F6V A;  1R36 A;  3HOT A;  3BWG A;  4M74 A;  2UXN A;  3V7C A;  5JI6 A;  3TKY A;  2J5O A;  5ILV A;  4HAM A;  4RS8 A;  1KU9 A;  3O2P E;  2QZ8 A;  3CUQ A;  1ZHF A;  3ZMV A;  4LK0 F;  3WTS C;  2PJP A;  1Z7U A;  2KJB A;  4HBL A;  4PGH A;  4RGR A;  4DNC A;  1K78 B;  1TLH B;  1GHC A;  1ON1 A;  3RI4 A;  1FP2 A;  1FPQ A;  5FFX A;  1B9M A;  5FB2 A;  4WCG A;  2K86 A;  1B6A A;  2W85 A;  4KN7 X;  1K6O A;  5AON A;  1W5S A;  2YX7 A;  4I0A A;  4I2O A;  2NS0 A;  2A61 A;  1IZ1 A;  3WGI A;  3KLN A;  4N9H A;  1P6R A;  1RUO A;  3GFM A;  4LB6 B;  2PMU A;  5L3F A;  4L5I A;  4NHJ A;  3TDU C;  1BI1 A;  2EWN A;  4FX4 A;  2L01 A;  2QBY B;  4EJO A;  1Z1D A;  2Y48 A;  3RTR A;  2XUB A;  3HTS B;  3LWF A;  4OIR F;  4MGR A;  2EFP A;  3IWZ A;  3RKX A;  4OOI A;  4HX4 A;  1W7P A;  2QUF A;  4EJT A;  1BIB A;  3CUO A;  3FMQ A;  3QU6 A;  5F1R A;  1O3T A;  2HYG D;  3BJO A;  5H6Q A;  3D5L A;  3FMR A;  3BY6 A; 
#chains in the Genus database with same CATH topology
 1Z6T A;  2DQR A;  1TC3 C;  4NQW B;  5F04 A;  1YW9 A;  3MKL A;  4IEJ A;  5BMZ A;  3KCC A;  1IN6 A;  2DU9 A;  3IAS 2;  3KP3 A;  4BEH A;  1WKM A;  1KQ8 A;  2NVY J;  4L9J A;  4IHV A;  2W1O A;  3QWL A;  5DUI A;  4CA0 A;  1I50 J;  2K9L A;  1R5G A;  1A36 A;  3COA C;  2Z9O A;  2IS1 A;  2R7V A;  2EZH A;  3LSM A;  3ZXS A;  2L2O A;  5IYB J;  2IA1 A;  4DBQ A;  2DFI A;  1XMX A;  3A02 A;  3HJE A;  1D1A A;  3VPR A;  4LG0 A;  1UB9 A;  2ELK A;  3HUG B;  4F7Z A;  5J40 A;  4BE1 A;  2HU9 A;  2IA0 A;  2ZXH A;  2LSO A;  5F6F A;  2DMP A;  2K02 A;  3GLL A;  4MHG A;  4QPO A;  5F27 A;  4D7N A;  2H09 A;  2K3F A;  3DBH B;  1XCV A;  2WY7 Q;  4XKB A;  2EJR A;  4B3A A;  3HTU A;  4BS9 A;  1U2W A;  1X1D A;  1R1V A;  4UVC A;  4A3J J;  2VJJ A;  2CQ7 A;  4HLY A;  4Y13 A;  2M2E A;  2BOL A;  5HNF A;  4G6D A;  1WFX A;  3E0J B;  1U78 A;  3LSG A;  5EG0 B;  3BTI A;  1VQ8 I;  3F8N A;  1HKQ A;  1I3A A;  1G6N A;  5B1B H;  3ZPL A;  2X85 A;  3J7A Y;  1OYW A;  4A6E A;  3H9Q A;  2YR2 A;  3QOE A;  4Y4R A;  1X58 A;  2R93 J;  3ABK H;  2QLZ A;  3UKG A;  4BDZ A;  2B7E A;  4DZP A;  2MYS A;  3K4L A;  3DPL C;  1K83 J;  2P5V A;  3KEO A;  4M3G A;  2LR8 A;  3N97 A;  1FLI A;  2STT A;  4NDL A;  2K9S A;  4A0Z A;  3TOB A;  1D5V A;  3WG7 H;  3KE2 A;  1TT0 A;  2LP0 A;  1WWX A;  1ZYR F;  4JYK A;  5KAI C;  2D1H A;  3KP7 A;  4Y3O A;  1HF0 A;  1LE8 A;  1ODD A;  4PCQ A;  3HOS A;  3PIO F;  2LKS A;  5IT9 K;  2V79 A;  2GQQ A;  5D5V B;  5M3F J;  3OYC A;  4NBQ A;  4U0Y A;  2E2H J;  5GPC A;  3WTX C;  3CTA A;  3KYD B;  3REO A;  2AHQ A;  1JUP A;  4XRM A;  1SMY F;  3ZMZ A;  4BGD A;  3FWE A;  1XS9 A;  5M5Y J;  4A5M A;  3LSP A;  4IHS A;  3A03 A;  1R5H A;  3SDG A;  4ESF A;  2DPU A;  2EV5 A;  4HF0 A;  4NUB A;  4BE2 A;  3W2V A;  4D0P A;  1AHD P;  4II2 A;  1ZK8 A;  2EIN H;  1U5T A;  1ZAR A;  1DDN A;  3Q0V A;  2M0C A;  2BE5 F;  4QTR A;  3KFW X;  3E7L A;  3AL0 B;  4XN0 A;  4UV9 A;  1ETY A;  4FQG A;  4HNV A;  3JRH A;  2PJR A;  2XRN A;  4ZYD A;  2KDZ A;  2LY2 A;  1RKT A;  3HC7 A;  1ZRC A;  2DT5 A;  3WTU C;  2YU3 A;  4I09 A;  3QQA A;  1R7J A;  5E20 A;  3BJA A;  1E0E A;  1ACI A;  2HXO A;  4RB2 C;  1BR1 A;  3QRF F;  1R1U A;  5K7H A;  4LGW A;  3OYD A;  1UMQ A;  2ZJQ F;  3CCQ I;  3L2C A;  3SEQ A;  5JLW A;  4ZTJ A;  3V8K A;  3ZQI A;  4E7J A;  2V6C A;  2RN7 A;  1G59 A;  3G73 A;  4R8H A;  2ZJ2 A;  2K4J A;  5J8C A;  2OTL I;  1ON2 A;  5LEK A;  3WTV C;  4AIJ A;  4HQE A;  1H0M A;  2QSH X;  2BEO A;  4O6J A;  2HFH A;  1HKS A;  2NVQ J;  2KRH A;  5D4S A;  4HW0 A;  1UAA A;  4PSW A;  4ESB A;  5LEJ A;  1G3W A;  2MD5 A;  3IH3 A;  3FKJ A;  3FKI J;  1PUE E;  3E97 A;  3ZQG A;  5ICE A;  4X6A J;  9ANT A;  1LEB A;  4Y17 A;  3LST A;  3DPU A;  4RMN A;  1SAN A;  3DBR B;  3ZQL A;  2CFX A;  1TNS A;  3DTI A;  2DO7 A;  4UB8 C;  3J81 K;  3I54 A;  5K7F A;  1K6Y A;  1MKM A;  1BI0 A;  2GXB A;  1H9T A;  3GFJ A;  5LFA A;  5IT9 Z;  2IEK A;  1FBU A;  2XF5 A;  3AL0 C;  3NEU A;  1OYI A;  4HX8 A;  1B72 B;  4HF1 A;  2LOO A;  2HOA A;  1QU3 A;  3HGG A;  2H94 A;  2MUN A;  2L0K A;  3VYR B;  4KN4 X;  3EPZ A;  1P4X A;  1DGR M;  1IXR C;  1REP C;  1XPX A;  2KIM A;  1GXQ A;  2G9W A;  1DU0 A;  2W24 A;  3IC7 A;  3RYP A;  4CDG A;  4HNU A;  1F4K A;  3BCB A;  3PNT A;  2M0M A;  3GZ5 A;  5DTD A;  2GOX B;  1EJ9 A;  5LLQ A;  2DA4 A;  3D0S A;  1BR4 A;  5F0H A;  3KP2 A;  3EDP A;  1LQ1 A;  2CYY A;  2IP2 A;  2VE9 A;  2VIX A;  2E60 A;  4IOC F;  2EH3 A;  2OF7 A;  2LBF A;  1B8I A;  2H8R A;  2G0E A;  1ETX A;  2AQE A;  2L5Q A;  1ETV A;  3MCZ A;  5IT9 R;  5K1Y A;  3OYG A;  2EA2 A;  2X9D A;  3F6O A;  2FOW A;  1BM9 A;  2TDX A;  3PQJ A;  4EAT A;  2DA3 A;  3CZ6 A;  3MZY A;  4I7H A;  3V42 A;  4MO7 A;  2MH9 A;  1YJN I;  1GUU A;  2V4J C;  1LVA A;  2XAQ A;  3DTK A;  4XK4 A;  1YJW I;  4RB3 C;  2Z3Y A;  3CF2 A;  2P6S A;  3FHZ A;  2VPR A;  1UHW A;  2L4A A;  1QHG A;  1BR2 A;  4C3J J;  4EM0 B;  1MJB A;  3CO7 C;  4EVI A;  1APL C;  1QRY A;  1U8B A;  1EF4 A;  3K7A J;  3BG7 A;  4RA2 A;  1U8R A;  1G8X A;  3ROU A;  3TW6 A;  2R0Q C;  1U9O A;  2P4W A;  1RNL A;  3CP8 A;  2FUG 2;  3U21 A;  2AS5 F;  3ZMD A;  3IH2 A;  4LIU A;  1A04 A;  5J3L A;  3FBI B;  2FSW A;  3ERE D;  4V2G A;  4EGZ A;  5GAE J;  1J9I A;  2XRO A;  1IDZ A;  2UUZ A;  1RIO H;  2VON A;  1XCB A;  1HW2 A;  2P6T A;  4XM3 A;  4BY1 J;  2LF7 A;  3CJQ B;  1D0Z A;  2X6X A;  2BGC A;  4ASN A;  2K7L A;  1X1A A;  2BVL A;  3I59 B;  4DBR A;  1XD7 A;  3J81 Z;  3G4S I;  2BY2 A;  3UNG C;  3CES A;  5LD2 C;  3HKZ A;  3C2B A;  4GXO A;  2DDA A;  3ERM A;  3BR2 A;  5JVT A;  3KEY A;  3VDX A;  4ENM A;  2Y30 A;  1IRX A;  2R7D A;  1SVL A;  1HDP A;  1S29 A;  4Q47 A;  3N4M A;  3OWT A;  2DXI A;  1A5J A;  1TL8 A;  5C44 J;  4BAY A;  3IKT A;  4LIT A;  5D8L B;  4PJJ A;  1W0U A;  2XAS A;  1JUS A;  4ENK A;  3E6B A;  4F93 B;  3CF5 F;  1VND A;  1FBS A;  4RB1 A;  2OAZ A;  2X48 A;  3CCJ I;  4DJA A;  1YS7 A;  2ELH A;  3E6M A;  4I02 A;  2NVU B;  1IG7 A;  1WRJ A;  1YRN A;  5GP9 A;  1X1P A;  5KHD A;  5L3E A;  1J2X A;  3ECO A;  2DMT A;  2CH0 A;  4YRV A;  3VEP A;  2W25 A;  4XKW A;  1SAU A;  3T1B A;  1JKR C;  3H0G J;  3H0D A;  2M3A A;  4UUS A;  4YFK F;  2KIF A;  4EMS A;  3MQ0 A;  1IRG A;  1WCM J;  4GYI A;  1UST A;  1JUM A;  3OY9 A;  5GTH C;  3KEQ A;  3HSR A;  1XDS A;  1BW6 A;  1OR7 C;  4A3D J;  4NC6 A;  5HS9 A;  3S2W A;  4O5V A;  4I6Z A;  1WJE A;  3F8F A;  1MH3 A;  4DYC A;  2LNB A;  2QQA A;  5E17 F;  3V8L A;  5DCM A;  3PO3 J;  3QYF A;  2MD0 A;  4EJU A;  1QBJ A;  3GXO A;  3JTH A;  4BNC A;  3SZG A;  3MKZ A;  3IRR A;  3PNV A;  4Q4Z F;  2JA6 J;  3JW4 A;  1X4P A;  3V4G A;  2J5P A;  4KJZ A;  2FF4 A;  4FET A;  3K4N A;  1P2F A;  1XGN A;  2K9N A;  3LA7 A;  4RDU A;  1DPR A;  1ZKG A;  1FP1 D;  2Z5U A;  1WJ5 A;  1MD0 A;  3PFI A;  3A52 A;  1LDK B;  2BY1 A;  1Z6R A;  2GIZ A;  2K5C A;  2E2I J;  2O0Y A;  2R92 J;  2TCT A;  5D6E A;  3CLO A;  4BHC A;  2ZB9 A;  3I5U A;  3OOU A;  1UG2 A;  5JHF A;  1MDM B;  4A6D A;  1B4A A;  4KT6 A;  3J7Z I;  2HOT A;  5C4X J;  5CVJ A;  1Y8R B;  1MSE C;  2JN6 A;  1WQ2 A;  3JTG A;  4LMY A;  4E6K G;  2BZT A;  1ZGJ A;  4A0Y A;  2ZSI B;  5E3M A;  3K9T A;  3IV5 A;  4LB5 A;  1V3F A;  4ZYA A;  2GXA A;  2HVR A;  3SZT A;  2NS7 A;  4RGS A;  2HOS A;  2DW4 A;  4WXD A;  2QSF X;  5CYV A;  2ZXI A;  3BR3 A;  4XRS G;  2JMW A;  3HHH A;  2HVQ A;  3ABL H;  1IRZ A;  3MFK A;  2CWE A;  4ZYG A;  1QVU A;  2ZFW A;  2CW0 F;  2IGN A;  1ORK A;  4BHP A;  3JSP A;  5A2Q Z;  1HC8 A;  3B02 A;  2L7K A;  4XQF A;  2WWY A;  1NHA A;  3ABT A;  2HR3 A;  2ZXJ A;  3OS2 A;  1S6L A;  4ON0 A;  3TQN A;  2DOE A;  2GLO A;  1S7A A;  5HLG A;  2PMH A;  2XHK A;  1XTA A;  1R71 A;  2M34 A;  2V26 A;  3M1E A;  1VQM I;  1PP8 F;  4CCJ A;  2EZK A;  3FX3 A;  2R5Y A;  2V1X A;  3DLL F;  1IF1 A;  3HOV J;  2DJN A;  3H92 A;  5KCM A;  2FOK A;  5DDG A;  3ESW B;  4B48 A;  4IO9 F;  4XLF A;  2HPI A;  5BS6 A;  1IO2 A;  1ZLK A;  4UVB A;  2FE3 A;  3A4C A;  5H6R A;  3X2Q H;  4UUT A;  3DEU A;  3HKZ N;  3P5J A;  2OQR A;  2VBZ A;  5EGO A;  3NQO A;  2F5D A;  1LFU P;  2XKO A;  1K7A A;  2IW5 A;  3G1M A;  1WJC A;  1GV5 A;  3F72 A;  3CMA I;  1ULY A;  2DFH A;  3V7R A;  3CO6 C;  1VQO I;  2F6C A;  3DTE A;  1YIJ I;  1G3S A;  1FYK A;  4B43 A;  3L9F A;  3F9K A;  3FMS A;  5AIP A;  1D8J A;  3K10 A;  4WF2 A;  2CJJ A;  1I6H J;  3OR1 C;  5FLV A;  4RLF A;  3F8M A;  2JA8 J;  4EJV A;  4M72 A;  5L3G A;  2HZD A;  3BC8 A;  2VE8 A;  2KLO A;  3MN2 A;  3OR2 C;  4X1E A;  4ENJ A;  3ZQQ A;  1VQ7 I;  4OMY A;  3WGH A;  3S1N J;  3TO9 A;  2ZCW A;  5H20 A;  5FRO A;  3B6C A;  2VUM J;  1YYV A;  2DCE A;  2H6B A;  3L2Q A;  3S1Q J;  4XRS A;  1GLN A;  5E1Z B;  3OL3 A;  3LA2 A;  2HGC A;  1MMG A;  4IQ4 A;  2DPD A;  2EIL H;  3H5N A;  4XLH A;  2ZFU A;  3FXO A;  3BZK A;  1BJZ A;  1Y56 A;  2FNP A;  3WG9 A;  1MJA A;  3KLO A;  3FM3 A;  1P4W A;  4E7S A;  2JZY A;  2QM3 A;  3ZP5 A;  2KQR A;  1CF7 A;  1R00 A;  1J75 A;  1M1E B;  3DKX A;  5GTI C;  1ETO A;  2Y0M A;  3VYS B;  5IOZ A;  2EFW A;  1ZRD A;  3C2H A;  1O3Q A;  3FIW A;  1YIT I;  2OUM A;  5C3E J;  5L3C A;  2JUG A;  3U2R A;  1T95 A;  4IKF A;  5JLX A;  1Y1V J;  4MQV A;  3OYK A;  3CC4 I;  5ED4 A;  2YPR A;  2CQN A;  3J7A O;  2I5U A;  2KIS A;  4C2M J;  3OIQ A;  1FSH A;  3F0C A;  3TP3 A;  3DWL E;  1XG1 A;  4DYQ A;  1T08 B;  3AG2 H;  1TP4 A;  3CMY A;  2X4H A;  2D2W A;  1HA8 A;  4O3M A;  2EQR A;  4L9N A;  4OIP F;  3HGY A;  3I55 I;  4CCL A;  2Q2E B;  2WTE A;  1FOK A;  4UVA A;  4OAZ A;  1R1T A;  3OYH A;  1BA5 A;  2F5V A;  1ZLJ A;  1DPU A;  2FXA A;  2CV2 A;  3R61 A;  2DI3 A;  4XLC A;  1MGT A;  4JP0 A;  3GTM J;  2GA1 A;  1FMW A;  1E3H A;  2VKH A;  3I3L A;  1D3Y A;  1UCR A;  2QF7 A;  2O61 A;  2QCO A;  2KRC A;  3O8G A;  1XX5 A;  4J01 A;  5CQG A;  3V8J A;  3RYR A;  2AXT C;  1KZH A;  2HDD A;  2EPF A;  2OD5 A;  3IUO A;  3RJP A;  2DLL A;  1SMT A;  5LBQ A;  2OZU A;  5HDK A;  3E3V A;  2MGQ A;  2FU4 A;  3HOU J;  3GF2 A;  4CCM A;  2XV4 S;  2P7V B;  1D8K A;  3OIO A;  1R4M B;  3JAM K;  1TWH J;  1X3W B;  5HOD A;  1Q1H A;  4PK4 A;  2OQG A;  1Z0X A;  4L9V A;  2GM4 A;  4OIQ F;  2E7X A;  4XKC A;  2JWT A;  1PDN C;  3D5S C;  1ZGW A;  2VL8 A;  5FJ8 J;  1ZGA A;  3TBI A;  1MZB A;  3BRO A;  3QP5 A;  2CFO A;  4IXA A;  2E1O A;  1R49 A;  5FKO A;  4CGZ A;  2P81 A;  1HDD C;  4ZDP A;  4IHY A;  1TT5 B;  4LLG F;  5FFZ A;  4DW6 A;  1S7E A;  1U5T B;  4KIG A;  1UFM A;  5IT3 A;  3K1N A;  2MSY A;  2P5K A;  1W36 C;  4ZYH A;  1X1C A;  3K69 A;  3WU0 A;  1LDD A;  1POG A;  2DOA A;  3IAM 2;  4H0E A;  4KMU X;  2PQ8 A;  1D1C A;  4A0X A;  5HOO A;  4K2E A;  2WV0 A;  4NNJ A;  2EZI A;  2X6W A;  3MEX A;  3SFI A;  1TQP A;  1UJ8 A;  5EEA A;  2M5W A;  1OFC X;  1YOV B;  1C0W A;  2W00 A;  3ZOB A;  4J19 A;  2F5E A;  4CHU A;  2R5Z B;  4V2F A;  1S9H A;  3F22 A;  2YSR A;  2CV1 A;  2XSJ C;  4HV6 A;  2DA2 A;  1FSE A;  3CC2 I;  2QQB A;  4FT8 A;  4A12 A;  4S04 A;  2MVT A;  2LKX A;  3C2G A;  3U1K A;  3KZZ A;  5DM6 F;  3PSF A;  1UZC A;  1YG2 A;  2F5C A;  2CMP A;  1Z7L A;  1RR7 A;  1MMS A;  2CRG A;  4ETS A;  3WU2 C;  5E3N A;  3DPT A;  1QO0 D;  3MZ8 A;  4ZC3 A;  2DQL A;  5JR3 A;  4ENN A;  3R0J A;  3DKY A;  3FBN B;  1NTC A;  1HBX G;  2M1B A;  3OYN A;  1K78 A;  1ZAO A;  3DU6 A;  1YTY A;  3IP4 B;  3K2Z A;  3QPS A;  4BKX A;  4Q48 A;  3OYA A;  2X1D A;  4A3L J;  1KGS A;  1HQC A;  2XAJ A;  2VOO A;  2ZNY A;  1JJ6 C;  4PUS A;  1XB4 A;  3TGN A;  2PX9 A;  4AWX B;  4E4H A;  2KJC A;  3CLQ A;  4A3K J;  4CYC B;  5GAG J;  1XC5 A;  2EBI A;  4LLL A;  3JAM Z;  4ZYE A;  2KRF A;  1T98 A;  1QA6 A;  1K79 A;  2LRE A;  4XBF A;  1P9Q C;  4CXF A;  2KIU A;  1MNM C;  3E5X A;  1OKR A;  2GWR A;  3RPU D;  5ILS A;  5TGT A;  2P0W A;  5CJ9 A;  4UHT A;  3FXJ A;  1V5G A;  3R60 A;  4OAY A;  3TDZ C;  5D8K B;  4HV5 A;  1JJ8 C;  5FLM J;  3ASN H;  3GW2 A;  3ABU A;  3OYJ A;  3K4M A;  1BOA A;  5D5U B;  1W1W E;  4BQO A;  2VT2 A;  3JRA A;  3QPL A;  1VQL I;  1JXS A;  2ZC2 A;  2MAB A;  2VBW A;  2WA0 A;  3I56 I;  2QBY A;  2A5Y B;  3S1M J;  3OIP A;  4BDY A;  1RKW A;  1TBX A;  3JAM R;  5J47 A;  2NXN B;  1MMN A;  3NRV A;  5CLS A;  3H9J A;  2VLA A;  2A3S A;  4U0V A;  4ZDL A;  2HTJ A;  1VFC A;  1PUF B;  4Y15 A;  1KYZ A;  3SQN A;  3K1M A;  1JT6 A;  1R22 A;  5BQT A;  3LSJ A;  1MJ9 A;  4CYD A;  2BW3 B;  4WXH A;  3Q5F A;  5K5R A;  1ZRE A;  5EZG A;  2E35 A;  3PSI A;  2VXZ A;  1YW7 A;  4A3B J;  4IF4 A;  2Z33 A;  1PVE A;  2NS8 A;  4AVZ A;  3R0A A;  4Y33 A;  1FJL A;  2F4I A;  2XAH A;  4P55 A;  2BHZ A;  1R23 A;  2VT3 A;  2K4B A;  1XGO A;  1O4X A;  5EEG A;  1OPC A;  1ENH A;  2QVO A;  2H1L A;  2W48 A;  3DFG A;  3M8J A;  4LFU A;  3DCF A;  4S0H B;  2MH2 A;  1SFX A;  2G7H A;  2ZXW H;  2VQC A;  4NQW A;  3DEW A;  2OCC H;  2P7C B;  3DEE A;  5FD6 A;  2XKP A;  3HIF A;  4KFC A;  3ZR8 X;  3S8P A;  3KYC B;  4IPA A;  3TW7 A;  3HSE A;  3RQI A;  2A6E F;  5DD8 A;  2IRF G;  4ZJZ A;  2IT0 A;  5J8F A;  2VOD A;  4AUX A;  4F52 A;  3FXR A;  3OS1 A;  1TZL A;  4GCV A;  3LSR A;  2L02 A;  1FZP B;  2ISZ A;  4E7I A;  4I01 A;  2DAO A;  4BHB A;  3HUG A;  4AID A;  1L3L A;  3G1O A;  3E5U A;  2CV0 A;  5DM7 F;  5DS9 A;  1VTN C;  2QSG X;  2VBY A;  4EEF G;  2RDP A;  1P92 A;  4QWQ A;  3WU1 B;  1F1Z A;  2R7S A;  3FHN A;  2VJ5 A;  3RQ4 A;  2M35 A;  5D6F A;  1F43 A;  3I58 A;  3PL8 A;  1E17 A;  1T0F C;  3D5R C;  4D9J A;  4C2T A;  4CCO A;  5EG0 A;  4MIM A;  5ICF A;  1TNT A;  3FK6 A;  3E6C C;  1STZ A;  5FGM A;  4TV7 A;  5K5Q A;  5FRM A;  4W97 A;  1XN7 A;  4D7M A;  3S2H J;  3I71 A;  2N8G A;  3F21 A;  1MMA A;  2L9V A;  3PO2 J;  2GZW A;  2I8D A;  4JQF A;  1OCC H;  2Y31 A;  2DBB A;  3AFH A;  2A6H F;  4C3H J;  3M8E A;  1J0R A;  3I53 A;  1P7I A;  5LGN A;  3H5R A;  1HW5 A;  4Q5S F;  3FXK A;  4KDP A;  1PYV A;  4PZJ A;  2EK5 A;  1VF9 A;  1W36 D;  3G6E I;  1OJL A;  2NYX A;  4XL9 A;  1MIJ A;  3BZC A;  3P7N A;  1GDT A;  3L00 A;  4P1W A;  4RGX A;  3BTL A;  3KZY A;  3QOD A;  1NK2 P;  3DLA A;  4WX9 A;  3S32 A;  2R7F A;  3OMY A;  4BQN A;  1U6G A;  2LYC A;  2VAS A;  3KYL A;  2R7Q A;  3BR6 A;  3IWF A;  5EJC A;  5F64 A;  2DMN A;  4M9S A;  1ZRF A;  2I10 A;  2HQR A;  5E79 C;  1OCO H;  4M6X A;  2NVT J;  1MSF C;  2F5F A;  2E1C A;  1A6I A;  2E7W A;  2QEX I;  1FIA A;  3F3X A;  2HXI A;  3LQR A;  1YX5 A;  2GXG A;  2V1D A;  1Y39 A;  5GPA A;  4BJ6 C;  1R9T J;  1G3Y A;  4XRF A;  3L7W A;  2AXL A;  3C18 A;  5E1X A;  2VC0 A;  3FDY A;  5TIS C;  1MH4 A;  1NH3 A;  2OJE D;  3A01 B;  4KUM A;  2E36 A;  1QHH D;  3GX4 X;  2FBH A;  2FJ1 A;  4E70 A;  3FZV A;  5KK1 A;  3GVA A;  2M30 A;  4A3G J;  2ME6 A;  2LRD A;  2ZJR F;  4OIN F;  4KT5 C;  1O7L A;  4C9Y A;  1AKH B;  2LK2 A;  4CCN A;  5E18 F;  5FLX K;  2O9L A;  1IJW C;  5HDN A;  2ELJ A;  4V19 K;  1VQP I;  3ONQ A;  2DTR A;  3K4J A;  5FKM A;  4GO1 A;  5ILU A;  3O6B B;  4ITV A;  4HSR A;  3A2K A;  1QZE A;  3PJR A;  5J4Y A;  3HRT A;  3S1R J;  2H8W A;  2M8G X;  2BXZ A;  2BY0 A;  3JRC A;  5DYM A;  2HQ5 A;  3G2B A;  3MD2 A;  4B44 A;  3Q0W A;  1CGP A;  4XLA A;  5JFR A;  1MND A;  2X1C A;  2UWM A;  4Y52 J;  4LIV A;  1ETK A;  1F36 A;  2IGM A;  2XAG A;  3AG4 H;  3RDI A;  4M71 A;  4ABZ A;  3LSI A;  3GYH X;  4YFX F;  3MZH A;  2Z99 A;  1R4N B;  2WB1 A;  2CSO A;  2VN2 A;  5LRR A;  2YU9 J;  3M1C A;  4WXC A;  3QPH A;  3HG9 A;  4L5E A;  2M4G A;  1J09 A;  4I98 B;  3TL4 X;  4XID A;  2HTS A;  4N9I A;  4A2U A;  4RAG A;  2RNJ A;  2OBP A;  2B0L A;  1BC8 C;  1ERD A;  2MLK A;  2MA3 A;  3VOD A;  1UHM A;  2FD5 A;  2ZO4 A;  3O8H A;  1T8I A;  3BCA A;  2DA7 A;  4NC8 A;  1LPQ A;  1XSV A;  5EEH A;  5E8G A;  3S15 J;  3CCY A;  2A07 F;  2EFN A;  4LOC A;  3H3V K;  2FQ3 A;  4YII A;  4CO8 A;  5FKK A;  3WHB A;  1B72 A;  1R6R A;  1IW7 F;  3DBL B;  4B8X A;  4HST A;  2IAI A;  3K1P A;  1EV7 A;  3VSL A;  2GA2 A;  2IPQ X;  1OIS A;  4AM3 A;  2ZME B;  2DFF A;  2IGO A;  4G8X A;  2Y9Y A;  4BQA A;  2HDC A;  1YJ9 I;  3P9I A;  4HX7 A;  4HRI A;  5KVR A;  2OA4 A;  4DYR A;  1KQ9 A;  4DGW B;  2CU7 A;  2E1N A;  1QZZ A;  3ELK A;  3GTJ J;  2R7W A;  3FXM A;  4PJN A;  2WAQ A;  4Y7N J;  3KX2 A;  3CCV I;  2IJL A;  5LGU A;  2K3P A;  1G4D A;  3ZCO A;  3NWS A;  3HPG A;  3ZRG A;  3A0B C;  3WE2 A;  3FXQ A;  3L2W A;  1AA7 A;  2DA5 A;  3CQZ J;  3GME A;  2CUE A;  4X0G A;  1IN4 A;  4N4N B;  2KIQ A;  2NVX J;  3ZQC A;  3AG3 H;  4BQQ A;  2LLK A;  2VPL A;  1YE9 A;  3CUQ B;  3OYI A;  1VI0 A;  2RRE A;  1SD7 A;  1FY7 A;  2QYO A;  1U9N A;  3ZMU A;  3CC7 I;  4L0Y B;  5ERI A;  2OC6 A;  4UV8 A;  3C7J A;  2DJI A;  5DV5 A;  4A93 J;  1HOM A;  2F4O B;  4B09 A;  1N25 A;  1TTY A;  1XGM A;  4E7L A;  4E7K A;  4XIC A;  1G3T A;  3WE3 A;  3GFL A;  3C3W A;  5F0F A;  5EDN A;  4CCK A;  4BH9 A;  4ZZD A;  2A05 A;  1UHS A;  5ICC A;  5E8I A;  3LAP A;  3OOP A;  4QSH A;  2L9R A;  3KP5 A;  2A6T A;  1KU2 A;  4CZZ A;  1H89 C;  1SFU A;  5FLX R;  3EYI A;  2W82 A;  3NAR A;  2UXX A;  2ZME C;  2GIV A;  2M9H A;  4GRI A;  4B47 A;  3VB2 A;  3I59 A;  3JRG A;  1OR7 A;  4HZF A;  3K0L A;  3ZN0 A;  1OYY A;  3K4K A;  5CKT A;  3IRQ A;  5JVG F;  1MBK A;  2LMD A;  2ID3 A;  2QKL B;  5LHH A;  3CCU I;  2KHM A;  4M3E A;  1SEU A;  3MVP A;  4BYY A;  3VWB A;  4XMY A;  4QIW N;  5FKL A;  2KP6 A;  3HRU A;  2BXY A;  2XVC A;  1QPM A;  1JKQ C;  1LDJ A;  4IL6 C;  1J5Y A;  5IP6 A;  4QLC U;  2RVC A;  4EM1 A;  2O03 A;  4JOM A;  1WSU A;  4A69 C;  2VJ4 A;  1H9G A;  3B73 A;  3CDL A;  3DP7 A;  2HYF A;  1UG0 A;  4PFP A;  3G1L A;  5IOY A;  4IQJ A;  2XAF A;  3MKY B;  2ME0 A;  2QEN A;  1YX3 A;  1FYL A;  3VOE A;  4R79 A;  3W2A A;  2FEZ A;  3OSG A;  2EB7 A;  2GAU A;  3OL4 A;  4BE0 A;  1YS6 A;  4RAY A;  2XSD C;  3BJ6 A;  3H36 A;  3BG6 A;  3EQL F;  1SD5 A;  1VZ0 A;  3RKQ A;  4P5O A;  4R1H A;  1Y0U A;  4CZC A;  1T2K A;  4H4K C;  1S72 I;  2RNG A;  2V7F A;  3OYE A;  1SAX A;  2NOG A;  2CG4 A;  1SD6 A;  2BY3 A;  1W7P B;  2K27 A;  5CQE A;  2XPV A;  2CQX A;  1MBE A;  1LVK A;  3I4N J;  1BI3 A;  2QQ8 A;  4MFD A;  2WB1 N;  4IX7 A;  3H3U A;  1B59 A;  3GFI A;  2EV0 A;  1R58 A;  1LJ9 A;  4UUV A;  2H27 A;  3AAF A;  3B6A A;  5K5O A;  2D1V A;  1BC7 C;  1U3E M;  1QQI A;  3VSK A;  2R3S A;  2HKX A;  1WI9 A;  3M07 A;  1FTZ A;  1IN8 A;  1H88 C;  4L5J A;  2BV6 A;  4N4O B;  4XLE A;  1Z91 A;  2XGE A;  2JA5 J;  3PQK A;  2XPU A;  1ZR4 A;  1XSX A;  1YW8 A;  2V9V A;  4BEH B;  3I64 A;  3ZN1 A;  3LSK A;  1JT0 A;  2P5L C;  3P9C A;  4Z6Y A;  2PI0 A;  2EFO A;  4GYG A;  1CQT A;  1YI2 I;  2PBI A;  3F8B A;  2X0L A;  4U0W A;  1IDY A;  1UEL B;  3GO5 A;  4XLP F;  5BPI A;  2HYJ A;  4LG0 B;  2B9S A;  3IH4 A;  2VBX A;  2VKV A;  4U7D A;  5E1W A;  3HOZ J;  5BPD A;  1VQ4 I;  4EM2 A;  2IS4 A;  1XMA A;  1IAW A;  5J1R A;  2GBY A;  2V9K A;  4IOA F;  4JX6 A;  5B1A H;  3SJM A;  2XB0 X;  3FM5 A;  3HYI A;  3EUH C;  1Y6I A;  5DD4 A;  4KIS A;  1GVJ A;  2HPM A;  3W2W A;  2LG4 A;  2WAQ N;  1BW5 A;  4U88 A;  1TWG J;  4RBO A;  3JRI A;  2ID6 A;  1FT9 A;  2MBF A;  1IN5 A;  2CW7 A;  3BQY A;  1MDM A;  5LRS A;  2MLG A;  1RES A;  3L09 A;  3RPU A;  1DQU A;  5M3M J;  3GCM A;  1XGS A;  1J59 A;  3J7A W;  6PAX A;  3TO6 A;  4FX0 A;  2Y0S A;  3M8F A;  1I1S A;  4MEX F;  4JX5 A;  2E1M B;  1X3U A;  2M87 A;  5LHI A;  3GTL J;  3CCL I;  1VQ5 I;  1HXD A;  4FAS D;  1Y1W J;  2VKD A;  3CCM I;  2A69 F;  2E2J J;  1LB2 A;  1F5T A;  4E7Z A;  4J00 A;  1FTT A;  1JHF A;  2ETH A;  5L3D A;  1FOX A;  3BPV A;  3SFZ A;  2RQQ A;  3HSF A;  4U87 A;  5J4V A;  5E3O A;  1W0T A;  3IL2 A;  1E3O C;  1LE8 B;  4OWR B;  3RZD J;  3HHG A;  4YG2 F;  2OPT A;  1T33 A;  2X51 A;  4HA8 A;  4PJL A;  5HDG A;  2DOD A;  3BZ6 A;  2Y69 H;  2EV6 A;  2NNN A;  3T8R A;  4EV0 A;  3WTZ A;  2DOF A;  2F4M B;  2FRH A;  5IYD J;  3HBL A;  3W6J B;  3ZQH A;  1IGN A;  4HEA 2;  2M7A A;  1USS A;  5ICG A;  2K40 A;  2V1N A;  3EET A;  4OU0 A;  3N05 A;  3RPQ A;  2DK8 A;  4AIH A;  3KZI C;  2PEX A;  2CUF A;  1SFE A;  1X4O A;  3GEZ A;  2HQN A;  2M4K A;  3EUH A;  3JR9 A;  2EZL A;  4C30 A;  2Q1Z B;  3E6D A;  3NAU A;  5C4J J;  1YFH A;  3A0H C;  3DKW A;  4PFO A;  2ADU A;  4AU7 A;  3S2D J;  4B3X A;  1X2M A;  1Z3X A;  5CVU A;  2PJR B;  1JI8 A;  3HB9 A;  4S05 A;  1TW3 A;  2LY9 A;  1IXS B;  2FNA A;  5JHU A;  2LTP A;  1Q1V A;  4JX4 A;  1VQK I;  2CQQ A;  4HDU A;  2VQG A;  4AIK A;  3M3Y J;  4D5C A;  2LFB A;  2O8X A;  4XNF A;  4AYB N;  4BAC A;  4HDV A;  3PFY A;  1IUY A;  2HWV A;  3BR1 A;  1I3Q J;  1WH5 A;  2LF8 A;  3CME I;  2QWW A;  3I0T A;  2Z2S B;  3BPX A;  3M9A A;  4FIS A;  5DEQ A;  1T38 A;  2IS2 A;  3HOX J;  1TW2 A;  1Z9C A;  2KPM A;  2JRM A;  2K85 A;  3I9V 2;  2H1K A;  5HLT A;  5M5X J;  5J6X A;  1GXP A;  4DQ2 A;  2RV8 A;  5DUK A;  3CDH A;  1Z77 A;  4KIB A;  4XOR A;  4D5F A;  3QAH A;  3ZGK A;  2B63 J;  2R7O A;  4KMF A;  2Q0O A;  1BJA A;  5F0C A;  4II3 A;  2WAF A;  4HPQ A;  2AO9 A;  2JPB A;  3BT9 A;  4XSX F;  3TP0 A;  4CSW A;  1V55 H;  3LNQ A;  1SC7 A;  4MTE A;  1FWZ A;  1KA8 A;  1T56 A;  4MQ9 F;  1WZ2 A;  3H3Z A;  2V9P A;  2XF6 A;  3HM5 A;  2NRA C;  1RPW A;  2E5Z A;  1I6X A;  3HRM A;  1TWC J;  3DQV C;  1TQI A;  4M9Z A;  4U7B A;  4LJZ F;  3TED A;  2O6G E;  3JRB A;  3KP6 A;  1D0Y A;  2KDO A;  3HZJ A;  1U5T C;  4YEL A;  2DT6 A;  4XOP A;  1W4M A;  1LUJ B;  2WBM A;  4FHT A;  1SFO J;  3T5X A;  4A5N A;  2RGV A;  1RI7 A;  2P0T A;  3U1D A;  3R4K A;  4XR6 A;  4GDF A;  1V54 H;  2CW8 A;  4Z2Y A;  4BUP A;  3H1C A;  3OYM A;  2YUS A;  1LEA A;  3GTG J;  1JTY A;  1A6Q A;  1PJR A;  1FC3 A;  2Q2E A;  2JA2 A;  4F91 B;  1FNN A;  1U0J A;  4F55 A;  4L9T A;  2ZBK A;  4D1Q A;  2KKO A;  4RAZ A;  4FTH A;  1MNE A;  4G6Q A;  4G94 A;  1RRJ A;  3L1P A;  3TOA A;  1IXC A;  4G12 A;  1BBY A;  2RAE A;  1ZQ3 P;  3SEZ A;  2VQH A;  3GTP J;  2JSP A;  1DUX C;  2ZJP F;  2JJ7 A;  2PFB A;  2JQ7 A;  3D1N I;  2ECC A;  4HOB A;  3WTY C;  2CGP A;  4M6V A;  3W6K B;  3ZMT A;  1B8I B;  2LBF B;  2COM A;  2DYS H;  4NB5 A;  3CDI A;  3IKV A;  3Q9V A;  4G7Z F;  2WV1 A;  3LSH A;  2CUZ A;  2Y0S N;  1HW1 A;  3GUD A;  2HEO A;  1FX7 A;  4F3Q A;  3GZN B;  3O3K A;  2E34 A;  4BXU A;  4OMZ A;  2OU2 A;  4BXX J;  1HST A;  2HOE A;  1VQ9 I;  5K7Z A;  2FML A;  1N77 A;  2QKM B;  4DOZ A;  1MMD A;  5DCF A;  3GTK J;  5CVI A;  3U9G A;  4BU2 A;  2LKP A;  2OZ6 A;  1A31 A;  1I27 A;  1ITY A;  4YFN F;  2ISY A;  2MZ4 A;  5IP7 J;  4FE7 A;  3QP6 A;  3HRS A;  1WI3 A;  2H6C A;  1T6S A;  2YS9 A;  2EIK H;  1JGS A;  2MC4 A;  1IN7 A;  4UNO A;  2O5R A;  3BR0 A;  5FD5 A;  2MC3 A;  3PUB A;  3VYT B;  4M6Y A;  3GBG A;  3FK7 A;  4RLQ A;  1QNT A;  4UB6 C;  3J80 K;  1TWF J;  1IV8 A;  4B1R A;  5BOX A;  4GGG A;  2A68 F;  4ANJ A;  2WC2 A;  5L3B A;  3S3O A;  3GWZ A;  2R7T A;  1W7P D;  2JT1 A;  2FQ4 A;  2R7U A;  2R5Z A;  3QOP A;  1O3R A;  3HOW J;  1HKT A;  4QPQ A;  3KPH A;  2D45 A;  2P8T A;  3ULQ B;  1JE8 A;  4LK1 F;  1K61 A;  1MBJ A;  2XGX A;  2PLY A;  3Q0U A;  3ASO H;  4BBR J;  3CCR I;  4AD9 A;  4BJT A;  1AWC A;  3SXY A;  3OSF A;  1N75 A;  1S7O A;  1S3J A;  3BLY A;  1DP7 P;  5F1J A;  2DK5 A;  3HXL A;  1VQ6 I;  2DYR H;  3HEF A;  3ZQ7 A;  4IZZ A;  2L7M P;  4IHT A;  3EYY A;  2V6E A;  4OIO F;  3M4O J;  1Z21 A;  1ZG3 A;  2XB5 A;  3S14 J;  4P9U A;  3LMM A;  1ZR2 A;  5KAF C;  1H8A C;  1X2N A;  1KYW A;  3HL2 A;  1V5E A;  1YRN B;  3RIR A;  3KP4 A;  1SD4 A;  1B1B A;  1BOB A;  2JVH A;  1K4T A;  1ZN2 A;  3E5Q A;  1EH6 A;  3G71 I;  2KFD A;  4ESJ A;  5CVV A;  3RZO J;  4DZJ A;  1W5C C;  4CYC A;  3IHU A;  1X3Z B;  5FRN A;  2NAZ A;  3MKW B;  5D4R A;  2Y75 A;  1LFB A;  3LQQ A;  4DIQ A;  1WH7 A;  3HPH A;  4UUS B;  2UV1 A;  2X1E A;  4ZZL A;  2EFQ A;  5IP9 J;  3VFZ A;  1XSD A;  4ZH4 F;  1J7K A;  3EUA A;  2L4M A;  1Z3Y A;  3PNY A;  2IA2 A;  2BHY A;  3RKW A;  2VB6 A;  3K6G A;  4YEJ A;  3GTQ J;  2ACJ A;  1FOY A;  1YIO A;  3UR3 C;  3GLX A;  5FKN A;  4XN3 A;  3T8T A;  5DCM B;  1B9N A;  3LAJ A;  3SZP A;  1L0O C;  2HVS A;  4FCY A;  4ZDO A;  3WOD F;  2JA7 J;  3J80 Z;  3J7Y J;  5J1U A;  1O57 A;  3K70 C;  1WVR A;  2MG4 A;  3LFK A;  3Q9S A;  1OCP A;  2CUJ A;  2XRL A;  2ZNZ A;  5AIQ A;  1GV2 A;  3H35 A;  2V1U A;  2JSC A;  4PJM A;  1ONV A;  5CVR A;  1YO5 C;  1PUF A;  1WJF A;  1DU6 A;  1T0F A;  3H5A A;  4HYE A;  1GVD A;  3WGG A;  2XC7 A;  1T39 A;  2DDB A;  3MAJ A;  2DA6 A;  4PJ0 C;  3P9K A;  3R6S A;  1YQA A;  5IY5 H;  1XMK A;  2BW3 A;  1MBH A;  4WWC A;  3RKY A;  5B3S H;  1EKE A;  3DF8 A;  2ECB A;  4P9F A;  5B66 C;  3FXU A;  4N0B A;  4I0B A;  2M8E A;  4LG3 A;  2VC1 A;  2XF7 A;  3BDD A;  1ZEL A;  1X19 A;  1Z05 A;  1I1G A;  1SFK A;  5HLI A;  1F9N A;  1BL0 A;  1WJB A;  4C2U A;  5HS8 A;  2CQK A;  4NC7 A;  1DP3 A;  2CO5 A;  3J80 R;  4GFB A;  5TRD A;  1QVT A;  2FBK A;  5IPA A;  2VI6 A;  2LY1 A;  1IRF A;  2ZKZ A;  2O3F A;  3BG3 A;  4JBA A;  4XKV A;  2KZG A;  3K4B A;  4JK1 X;  1D1B A;  1JTX A;  1I39 A;  1G2H A;  3I4M J;  1WHU A;  5HVQ C;  5GAD J;  5LHG A;  2RKH A;  1ZTR A;  3EUK L;  1HLV A;  2L54 A;  1I5Z A;  5TJJ A;  1FEX A;  1ZG1 A;  1RZ4 A;  1RET A;  2DFE A;  2W84 A;  3Q3S A;  4M3D A;  5HLH A;  1JHH A;  3QU3 A;  4KIT B;  2C6Y A;  3WHC A;  1Y8Q B;  3BTJ A;  1EH8 A;  1XDU A;  2R5Y B;  2XGC A;  2MW8 A;  2JTV A;  3M7G A;  2EIJ H;  4PGG A;  4CIC A;  3DV8 A;  2FBI A;  2L3D A;  4XON A;  2EA4 A;  3WTT C;  3JRE A;  1KU3 A;  3G3Z A;  1FYM A;  2XIG A;  4UY8 I;  1KQ0 A;  1WJD A;  3RCO A;  1ZH5 A;  4BBS J;  2NNY A;  3LL7 A;  1OQY A;  3F8C A;  4MNU A;  3I4P A;  3OV8 A;  4IRG A;  3LA3 A;  2FMY A;  2JUC A;  5EGO B;  2KMU A;  1IUF A;  3W6V A;  2F48 A;  4AVP A;  4M73 A;  2JPC A;  3T0Y A;  2W7N A;  1OLT A;  2G7U A;  2LC2 A;  1ZG5 A;  3J81 R;  5A2Q K;  4CUG A;  2L9N A;  4HG2 A;  4A3I J;  1V4R A;  3CCS I;  4A3C J;  4AC0 A;  1O3S A;  5LGT A;  4G7H F;  5GAH J;  1K4S A;  2R4G A;  2VOP A;  2EIM H;  2YX4 A;  3ML6 A;  4KIC A;  4KA4 A;  2VQL A;  2VXD A;  3S3M A;  3H9G A;  2UZK A;  2O8K A;  5FLX Z;  1RR8 C;  2Q8K A;  2A5W A;  3CD6 I;  3A1Y A;  2BYV E;  2DMQ A;  1EA3 A;  2ICW G;  2W4S A;  4BXF A;  4RB0 A;  2W57 A;  3CJT B;  3SHF A;  1BI2 A;  2PMZ A;  3V7S A;  2R7X A;  5F08 A;  2IGK A;  1HCR A;  2F2E A;  4LD5 A;  2DA1 A;  4MEY F;  4G9Y A;  1TQM A;  4HQM A;  4L18 B;  3JSO A;  2IXS A;  2Y2Z A;  1N78 A;  1CF7 B;  3HDD A;  5D5X B;  4UXN A;  5EF6 A;  4F92 B;  3LFU A;  3KET A;  4IJA A;  1BN5 A;  2WAE A;  4I99 C;  3DXJ F;  4KYW A;  4IHX A;  2LD5 A;  2QGU A;  1P4A A;  4B4C A;  1PP7 U;  1EH7 A;  3A01 A;  2OCE A;  4EQQ A;  2PN6 A;  2FX0 A;  4A3E J;  1S8N A;  3K2A A;  4HLX A;  4RGU A;  4ZTF A;  3OYL A;  3ZMS A;  1BIA A;  1AKH A;  3MWM A;  4G7O F;  2VJI A;  2STW A;  3W3C A;  4IRI A;  3ECH A;  3WTW C;  2KL4 A;  5D5W B;  2XGD A;  3E1S A;  4C3I J;  2HS5 A;  4YIF A;  1QZY A;  5FO5 A;  3GZ6 A;  3JCU C;  1S5L C;  4MFE A;  2HKO A;  3TO7 A;  4EJW A;  1HSJ A;  3QYB A;  1W5T A;  3F23 A;  2R7R A;  4MTD A;  2O7O A;  4L0Z B;  2RQP A;  2X6O A;  1ETQ A;  4P96 A;  2COB A;  3C1D A;  4KNY A;  1MBG A;  5BNG A;  3OYF A;  1Z67 A;  3BP8 A;  2IVM A;  4KIF A;  1YLF A;  1X1B A;  2RC4 A;  3CUQ C;  2L7Z A;  3CJN A;  3ISP A;  4E7H A;  1O7F A;  2QQ9 A;  3CP2 A;  4AYB A;  3KIO A;  2BVM A;  3QPT A;  4IVN A;  2ESH A;  1VQN I;  1ETW A;  2M45 A;  4WK8 F;  3OYB A;  3OS0 A;  5CPR B;  3FXL A;  4BL0 B;  1FBQ A;  1YHQ I;  4IRH A;  1AOY A;  3BOQ A;  1Y0N A;  4EGY A;  2FA5 A;  2ESN A;  2JRT A;  4HF2 A;  3NWT A;  1OMI A;  3JRF A;  2DTZ A;  3PIP F;  4XLN F;  1SVM A;  3FF5 A;  2HZT A;  1E2X A;  2LVS A;  3K70 D;  1LNW A;  2X6Y A;  3CJR B;  2IBD A;  3AG1 H;  4IHW A;  4LLN A;  1RQ6 A;  3S17 J;  2QA4 I;  1RUN A;  2BBY A;  5M5W J;  4XSZ F;  5HS7 A;  5KNL A;  2PG4 A;  2Z16 A;  5HNH A;  1KU7 A;  4M9X A;  2ZME A;  1WJA A;  5A2Q R;  4M3B A;  3AKZ A;  2LDU A;  1E3P A;  2KZV A;  1OCT C;  1QGP A;  1IV6 A;  4PDK A;  1NG6 A;  3F6V A;  1JKP C;  2GOM A;  1D5Y A;  2M7B A;  1IC8 A;  1R36 A;  4MLO A;  3BWG A;  4M74 A;  3HOT A;  3HOY J;  5H2F C;  4RAF A;  2UXN A;  2HQA A;  3V7C A;  3TKY A;  5JI6 A;  2J5O A;  3PM1 A;  2Y9Z A;  2OTJ I;  2ZSH B;  5ILV A;  5J1Y A;  4HAM A;  4RS8 A;  1R5I D;  1KU9 A;  2R7Z J;  3O2P E;  2QZ8 A;  3CUQ A;  1JGG A;  1ZHF A;  2OV7 A;  2JVG A;  3ZMV A;  1AU7 A;  2NOJ B;  3SYT A;  2VKE A;  3BR5 A;  4LK0 F;  3ABM H;  4BJ5 C;  3WTS C;  1KON A;  3TMO A;  2PJP A;  1Z7U A;  2KJB A;  4HBL A;  4PGH A;  1OCZ H;  4RM2 A;  2KT0 A;  4RM3 A;  4RGR A;  4DNC A;  2XAU A;  1K78 B;  1RC9 A;  1TLH B;  1GHC A;  2XPW A;  5EZH A;  3S3N A;  2AQF A;  1FMV A;  1ON1 A;  1FIP A;  4FE4 A;  3RI4 A;  1FP2 A;  1FPQ A;  2TRT A;  5FFX A;  1B9M A;  4HNT A;  4A3M J;  2PMZ N;  5FB2 A;  2DN0 A;  4WCG A;  2K86 A;  1B6A A;  4BY7 J;  2W85 A;  3ZQF A;  2XDV A;  4KN7 X;  2HDW A;  1K6O A;  2L7F P;  5AON A;  1LFP A;  1WGX A;  2IS6 A;  5IYC J;  1W5S A;  1WPK A;  3BG5 A;  1MW7 A;  2YX7 A;  2E5N A;  2Z1D A;  3LOC A;  4G6T B;  4I0A A;  2X98 A;  1NK3 P;  4I2O A;  2D5V A;  1QPI A;  2NS0 A;  2A61 A;  3MMY B;  1FOW A;  1IZ1 A;  3WGI A;  3L2U A;  3KLN A;  3BQZ A;  1D0X A;  4N9H A;  2JK3 A;  2E71 A;  1P6R A;  1RUO A;  3GFM A;  4LB6 B;  2DT7 B;  2PMU A;  2WY8 Q;  2K9M A;  5L3F A;  2HI3 A;  2DMU A;  3BTC A;  4L5I A;  2LH9 A;  2K9Q A;  4NHJ A;  3CMM A;  3TDU C;  1P7J A;  4PSX A;  4I76 A;  3CCE I;  3RSN A;  1BI1 A;  1A35 A;  2EWN A;  1DGW Y;  4XOT A;  4FX4 A;  3S16 J;  2L01 A;  2QBY B;  3K4C A;  4CH7 A;  1TWA J;  1V5F A;  4EJO A;  1Z1D A;  2Y48 A;  5EYR A;  3RTR A;  2XUB A;  3HTS B;  1LKX A;  3LWF A;  4A3F J;  4OIR F;  3QYE A;  2EFP A;  4MGR A;  4W1U A;  3IWZ A;  2WAD A;  3RKX A;  2HNH A;  2L9S A;  3SDB A;  4YIR X;  4OOI A;  4HX4 A;  1W7P A;  2MFZ A;  3VYU B;  3JRD A;  1GT0 C;  2QUF A;  3PUF A;  4EJT A;  1JKO C;  2E19 A;  1BIB A;  1NG7 A;  3L2V A;  4M3F A;  3CUO A;  2E1M C;  1MBF A;  3FMQ A;  3QU6 A;  5F1R A;  3DU5 A;  1O3T A;  3BG9 A;  3L2R A;  2HYG D;  5E3L A;  5B5E C;  3FIS A;  3BJO A;  5H6Q A;  1OCR H;  3S93 A;  3D5L A;  3GTO J;  2CS3 A;  3FMR A;  3BY6 A;  1SVO A; 
#chains in the Genus database with same CATH homology
 1Z6T A;  2DQR A;  1YW9 A;  5BMZ A;  3KCC A;  1IN6 A;  2DU9 A;  3KP3 A;  1WKM A;  1KQ8 A;  4L9J A;  5DUI A;  1R5G A;  3COA C;  2Z9O A;  2IA1 A;  2DFI A;  4LG0 A;  1UB9 A;  4F7Z A;  2IA0 A;  2LSO A;  5F6F A;  4MHG A;  2K02 A;  2H09 A;  1XCV A;  2EJR A;  3HTU A;  1U2W A;  1R1V A;  4UVC A;  4HLY A;  4Y13 A;  4G6D A;  1U78 A;  3F8N A;  1HKQ A;  1G6N A;  3ZPL A;  1OYW A;  4A6E A;  2YR2 A;  2QLZ A;  3DPL C;  2P5V A;  3KEO A;  3N97 A;  1FLI A;  2STT A;  4A0Z A;  1D5V A;  3TOB A;  3KE2 A;  1WWX A;  1ZYR F;  2D1H A;  3KP7 A;  1ODD A;  4PCQ A;  3HOS A;  5IT9 K;  2V79 A;  2GQQ A;  5D5V B;  4U0Y A;  3WTX C;  3CTA A;  3REO A;  1SMY F;  3ZMZ A;  3FWE A;  4A5M A;  4IHS A;  4ESF A;  1R5H A;  2DPU A;  2EV5 A;  4HF0 A;  4D0P A;  1U5T A;  1ZAR A;  1DDN A;  2BE5 F;  3KFW X;  4UV9 A;  2XRN A;  4ZYD A;  1ZRC A;  2DT5 A;  3WTU C;  2YU3 A;  4I09 A;  1R7J A;  5E20 A;  3BJA A;  4RB2 C;  3QRF F;  1R1U A;  4LGW A;  3L2C A;  3V8K A;  2V6C A;  2RN7 A;  3G73 A;  4R8H A;  2K4J A;  2ZJ2 A;  5J8C A;  1ON2 A;  5LEK A;  3WTV C;  4AIJ A;  4HQE A;  1H0M A;  2BEO A;  4O6J A;  2HFH A;  1HKS A;  5D4S A;  4HW0 A;  4ESB A;  5LEJ A;  1G3W A;  2MD5 A;  1PUE E;  3E97 A;  1LEB A;  5ICE A;  4Y17 A;  3LST A;  2CFX A;  1TNS A;  3J81 K;  2DO7 A;  3I54 A;  1MKM A;  1BI0 A;  2GXB A;  1H9T A;  3GFJ A;  5IT9 Z;  1FBU A;  3NEU A;  1OYI A;  4HX8 A;  4HF1 A;  2H94 A;  4KN4 X;  1P4X A;  1IXR C;  1REP C;  2KIM A;  1GXQ A;  2G9W A;  2W24 A;  3IC7 A;  3RYP A;  4CDG A;  1F4K A;  3GZ5 A;  5LLQ A;  3D0S A;  3KP2 A;  3EDP A;  1LQ1 A;  2CYY A;  2IP2 A;  2VE9 A;  3MCZ A;  5K1Y A;  2EA2 A;  3F6O A;  1BM9 A;  2TDX A;  3PQJ A;  3MZY A;  4I7H A;  2MH9 A;  2XAQ A;  1LVA A;  4RB3 C;  2Z3Y A;  2P6S A;  3FHZ A;  1UHW A;  2L4A A;  4EM0 B;  1MJB A;  3CO7 C;  4EVI A;  1U8R A;  3ROU A;  2P4W A;  1RNL A;  2AS5 F;  3ZMD A;  1A04 A;  2FSW A;  3ERE D;  4EGZ A;  1J9I A;  2XRO A;  1RIO H;  2VON A;  1XCB A;  1HW2 A;  2P6T A;  2LF7 A;  2BGC A;  4ASN A;  2K7L A;  3I59 B;  1XD7 A;  3J81 Z;  4GXO A;  5JVT A;  4ENM A;  2R7D A;  1S29 A;  4Q47 A;  3N4M A;  4BAY A;  3IKT A;  5D8L B;  2XAS A;  4ENK A;  3E6B A;  1FBS A;  4RB1 A;  2OAZ A;  1YS7 A;  2ELH A;  3E6M A;  4I02 A;  1WRJ A;  5L3E A;  1J2X A;  3ECO A;  3VEP A;  2W25 A;  3T1B A;  4YFK F;  2KIF A;  4EMS A;  3MQ0 A;  1IRG A;  4GYI A;  1UST A;  3KEQ A;  3HSR A;  1XDS A;  5HS9 A;  3S2W A;  4O5V A;  3F8F A;  2LNB A;  2QQA A;  5E17 F;  3V8L A;  5DCM A;  4EJU A;  1QBJ A;  3GXO A;  3JTH A;  4BNC A;  3IRR A;  4Q4Z F;  3JW4 A;  3V4G A;  2J5P A;  2FF4 A;  1P2F A;  1XGN A;  3LA7 A;  1DPR A;  1FP1 D;  2Z5U A;  1MD0 A;  3PFI A;  1LDK B;  1Z6R A;  2O0Y A;  5D6E A;  3CLO A;  4BHC A;  3I5U A;  1MDM B;  4A6D A;  1B4A A;  5CVJ A;  1WQ2 A;  3JTG A;  4LMY A;  1ZGJ A;  4A0Y A;  3K9T A;  4LB5 A;  1V3F A;  3SZT A;  4RGS A;  2DW4 A;  4WXD A;  5CYV A;  3HHH A;  3MFK A;  2CWE A;  4ZYG A;  2ZFW A;  2CW0 F;  4BHP A;  3JSP A;  5A2Q Z;  3B02 A;  2WWY A;  1NHA A;  3ABT A;  2HR3 A;  2ZXJ A;  1S6L A;  4ON0 A;  3TQN A;  1S7A A;  5HLG A;  2PMH A;  2XHK A;  3M1E A;  1PP8 F;  3FX3 A;  2V1X A;  1IF1 A;  3H92 A;  2FOK A;  5DDG A;  5BS6 A;  1ZLK A;  4UVB A;  2FE3 A;  5H6R A;  3DEU A;  2OQR A;  2VBZ A;  3NQO A;  2F5D A;  1K7A A;  2XKO A;  2IW5 A;  3F72 A;  1ULY A;  3V7R A;  3CO6 C;  1G3S A;  1FYK A;  3L9F A;  3FMS A;  5AIP A;  1D8J A;  4WF2 A;  3F8M A;  4EJV A;  4M72 A;  5L3G A;  2VE8 A;  4ENJ A;  4OMY A;  3WGH A;  3TO9 A;  2ZCW A;  5H20 A;  1YYV A;  2H6B A;  5E1Z B;  3LA2 A;  2HGC A;  2DPD A;  2FNP A;  3WG9 A;  1MJA A;  3KLO A;  3FM3 A;  1P4W A;  2JZY A;  2QM3 A;  3ZP5 A;  1CF7 A;  1R00 A;  1J75 A;  2Y0M A;  2EFW A;  1ZRD A;  1O3Q A;  5L3C A;  3U2R A;  4MQV A;  5ED4 A;  2YPR A;  3J7A O;  1FSH A;  2X4H A;  2D2W A;  4O3M A;  4L9N A;  4OIP F;  2WTE A;  1FOK A;  4UVA A;  1R1T A;  1ZLJ A;  1DPU A;  2FXA A;  3R61 A;  2DI3 A;  1MGT A;  2GA1 A;  1D3Y A;  1UCR A;  2O61 A;  3V8J A;  3RYR A;  2OD5 A;  3RJP A;  2DLL A;  1SMT A;  5LBQ A;  2OZU A;  5HDK A;  3E3V A;  2FU4 A;  3GF2 A;  2XV4 S;  2P7V B;  1D8K A;  3JAM K;  1Q1H A;  2OQG A;  4L9V A;  4OIQ F;  2E7X A;  1PDN C;  1ZGA A;  1MZB A;  3BRO A;  3QP5 A;  4IXA A;  4CGZ A;  4LLG F;  5FFZ A;  1U5T B;  4KIG A;  1UFM A;  5IT3 A;  3K1N A;  2P5K A;  4ZYH A;  3K69 A;  3WU0 A;  1LDD A;  4H0E A;  4KMU X;  2PQ8 A;  4A0X A;  5HOO A;  4K2E A;  2WV0 A;  3MEX A;  1TQP A;  2M5W A;  1C0W A;  2F5E A;  4CHU A;  3F22 A;  2YSR A;  4HV6 A;  1FSE A;  2QQB A;  4FT8 A;  4A12 A;  4S04 A;  3KZZ A;  1YG2 A;  2F5C A;  4ETS A;  3DPT A;  1QO0 D;  2DQL A;  5JR3 A;  4ENN A;  3R0J A;  1HBX G;  2M1B A;  1K78 A;  1ZAO A;  1YTY A;  3K2Z A;  4Q48 A;  1KGS A;  1HQC A;  2XAJ A;  2VOO A;  2ZNY A;  1XB4 A;  3TGN A;  4AWX B;  2KJC A;  4LLL A;  3JAM Z;  4ZYE A;  2KRF A;  1T98 A;  1K79 A;  4XBF A;  4CXF A;  2KIU A;  3E5X A;  1OKR A;  2GWR A;  5ILS A;  5CJ9 A;  4UHT A;  3R60 A;  3TDZ C;  5D8K B;  4HV5 A;  3GW2 A;  3ABU A;  1BOA A;  5D5U B;  2VT2 A;  1JXS A;  2VBW A;  2QBY A;  2A5Y B;  1TBX A;  3NRV A;  5CLS A;  2A3S A;  4U0V A;  2HTJ A;  4Y15 A;  1KYZ A;  3SQN A;  3K1M A;  1R22 A;  5BQT A;  1MJ9 A;  4CYD A;  4WXH A;  3Q5F A;  5K5R A;  1ZRE A;  2VXZ A;  1YW7 A;  4IF4 A;  2Z33 A;  3R0A A;  2XAH A;  4P55 A;  1R23 A;  2VT3 A;  2K4B A;  1XGO A;  5EEG A;  1OPC A;  2QVO A;  4LFU A;  3DFG A;  2MH2 A;  1SFX A;  2G7H A;  4NQW A;  2P7C B;  5FD6 A;  2XKP A;  3HIF A;  4KFC A;  4IPA A;  3HSE A;  2IRF G;  2A6E F;  5DD8 A;  2IT0 A;  5J8F A;  2VOD A;  3FXR A;  4GCV A;  2L02 A;  1FZP B;  2ISZ A;  4I01 A;  2DAO A;  4BHB A;  3HUG A;  1L3L A;  3E5U A;  1VTN C;  2VBY A;  2RDP A;  1P92 A;  4QWQ A;  3WU1 B;  1F1Z A;  5D6F A;  3I58 A;  1E17 A;  5ICF A;  1TNT A;  3E6C C;  1STZ A;  5FGM A;  4TV7 A;  5K5Q A;  1XN7 A;  3I71 A;  3F21 A;  2GZW A;  4JQF A;  2DBB A;  2A6H F;  3M8E A;  1J0R A;  3I53 A;  5LGN A;  1HW5 A;  4Q5S F;  4KDP A;  4PZJ A;  2EK5 A;  2NYX A;  3P7N A;  3L00 A;  4RGX A;  3KZY A;  4WX9 A;  2R7F A;  1U6G A;  3IWF A;  5F64 A;  4M9S A;  1ZRF A;  2HQR A;  4M6X A;  2F5F A;  2E1C A;  2E7W A;  3F3X A;  3LQR A;  2GXG A;  2V1D A;  1G3Y A;  4XRF A;  3L7W A;  2AXL A;  3C18 A;  5E1X A;  2VC0 A;  4KUM A;  3GX4 X;  2FBH A;  4E70 A;  3FZV A;  5KK1 A;  3GVA A;  2M30 A;  4OIN F;  4KT5 C;  1O7L A;  5E18 F;  5FLX K;  5HDN A;  2DTR A;  4GO1 A;  5ILU A;  3O6B B;  3HRT A;  5DYM A;  1CGP A;  5JFR A;  2UWM A;  2XAG A;  3RDI A;  4M71 A;  3GYH X;  3MZH A;  4YFX F;  2Z99 A;  2CSO A;  2VN2 A;  5LRR A;  4WXC A;  3QPH A;  4I98 B;  2HTS A;  4N9I A;  4A2U A;  2RNJ A;  2OBP A;  2B0L A;  1BC8 C;  2MLK A;  2MA3 A;  3VOD A;  1UHM A;  2ZO4 A;  1XSV A;  5EEH A;  5E8G A;  2A07 F;  2EFN A;  2FQ3 A;  4YII A;  4CO8 A;  1IW7 F;  4B8X A;  3K1P A;  1EV7 A;  2GA2 A;  2IPQ X;  2ZME B;  4G8X A;  4BQA A;  2HDC A;  3P9I A;  4HX7 A;  5KVR A;  2OA4 A;  1KQ9 A;  2E1N A;  1QZZ A;  3ELK A;  2IJL A;  5LGU A;  1G4D A;  3WE2 A;  3FXQ A;  1IN4 A;  3CUQ B;  1SD7 A;  1FY7 A;  2QYO A;  3ZMU A;  4L0Y B;  5ERI A;  4UV8 A;  3C7J A;  5DV5 A;  4B09 A;  1TTY A;  1XGM A;  1G3T A;  3WE3 A;  3GFL A;  3C3W A;  4BH9 A;  4ZZD A;  5ICC A;  5E8I A;  3LAP A;  3OOP A;  3KP5 A;  1KU2 A;  4CZZ A;  1SFU A;  3EYI A;  2UXX A;  2GIV A;  3VB2 A;  3I59 A;  1OR7 A;  4HZF A;  3K0L A;  3ZN0 A;  1OYY A;  3IRQ A;  5LHH A;  4BYY A;  3HRU A;  2XVC A;  1QPM A;  1LDJ A;  1J5Y A;  4QLC U;  2RVC A;  4EM1 A;  2O03 A;  1WSU A;  1H9G A;  3B73 A;  3DP7 A;  2HYF A;  2XAF A;  2QEN A;  1FYL A;  3VOE A;  4R79 A;  2FEZ A;  2EB7 A;  2GAU A;  1YS6 A;  4RAY A;  3BJ6 A;  3EQL F;  1SD5 A;  4P5O A;  4R1H A;  1Y0U A;  1T2K A;  1SAX A;  2CG4 A;  1SD6 A;  1W7P B;  2K27 A;  1BI3 A;  3H3U A;  1B59 A;  3GFI A;  2EV0 A;  1R58 A;  1LJ9 A;  4UUV A;  2H27 A;  3AAF A;  5K5O A;  2D1V A;  1BC7 C;  1U3E M;  1QQI A;  2R3S A;  2HKX A;  1WI9 A;  1IN8 A;  4L5J A;  2BV6 A;  1Z91 A;  3PQK A;  1XSX A;  1YW8 A;  2V9V A;  3I64 A;  3ZN1 A;  2P5L C;  3P9C A;  2PI0 A;  2EFO A;  4GYG A;  2PBI A;  3F8B A;  2X0L A;  4U0W A;  3GO5 A;  4XLP F;  5BPI A;  4LG0 B;  2VBX A;  4U7D A;  5E1W A;  5BPD A;  4EM2 A;  1XMA A;  1IAW A;  3FM5 A;  3HYI A;  5DD4 A;  1GVJ A;  4U88 A;  1FT9 A;  2MBF A;  1IN5 A;  1MDM A;  5LRS A;  2MLG A;  3L09 A;  3RPU A;  1XGS A;  1J59 A;  6PAX A;  3TO6 A;  4FX0 A;  3M8F A;  1I1S A;  4MEX F;  1X3U A;  2M87 A;  5LHI A;  1HXD A;  2A69 F;  1LB2 A;  1F5T A;  1JHF A;  2ETH A;  5L3D A;  3BPV A;  3SFZ A;  3HSF A;  3IL2 A;  3HHG A;  4YG2 F;  4HA8 A;  5HDG A;  3BZ6 A;  2EV6 A;  2NNN A;  3T8R A;  4EV0 A;  3WTZ A;  2FRH A;  3W6J B;  1USS A;  5ICG A;  4OU0 A;  3EET A;  3RPQ A;  2DK8 A;  4AIH A;  2PEX A;  1SFE A;  3GEZ A;  2HQN A;  3EUH A;  1YFH A;  3E6D A;  3DKW A;  2ADU A;  5CVU A;  4S05 A;  1TW3 A;  1IXS B;  2FNA A;  5JHU A;  4HDU A;  4AIK A;  2O8X A;  4HDV A;  1IUY A;  2HWV A;  2LF8 A;  2QWW A;  3I0T A;  3BPX A;  3M9A A;  5DEQ A;  1T38 A;  1TW2 A;  1Z9C A;  5J6X A;  1GXP A;  4DQ2 A;  2RV8 A;  5DUK A;  3CDH A;  4KIB A;  3QAH A;  4KMF A;  2Q0O A;  1BJA A;  2JPB A;  4XSX F;  4MTE A;  1FWZ A;  1KA8 A;  4MQ9 F;  3H3Z A;  2NRA C;  1I6X A;  3HRM A;  3DQV C;  1TQI A;  4M9Z A;  4U7B A;  4LJZ F;  2O6G E;  3KP6 A;  1U5T C;  1W4M A;  4FHT A;  3T5X A;  4A5N A;  2RGV A;  1RI7 A;  3U1D A;  3R4K A;  4Z2Y A;  1LEA A;  1FC3 A;  2Q2E A;  1FNN A;  4L9T A;  2ZBK A;  2KKO A;  4RAZ A;  4G6Q A;  4G94 A;  3TOA A;  1IXC A;  1BBY A;  1DUX C;  2PFB A;  2CGP A;  4HOB A;  3WTY C;  3W6K B;  3ZMT A;  2COM A;  4NB5 A;  3IKV A;  3Q9V A;  4G7Z F;  1HW1 A;  3GUD A;  2HEO A;  1FX7 A;  3O3K A;  4BXU A;  4OMZ A;  2OU2 A;  1HST A;  2HOE A;  2FML A;  5DCF A;  5CVI A;  3U9G A;  2LKP A;  2OZ6 A;  1I27 A;  4YFN F;  2ISY A;  3QP6 A;  3HRS A;  2H6C A;  1T6S A;  1JGS A;  1IN7 A;  4UNO A;  5FD5 A;  2MC3 A;  4M6Y A;  1QNT A;  3J80 K;  5BOX A;  4GGG A;  2A68 F;  2WC2 A;  5L3B A;  3GWZ A;  1W7P D;  2JT1 A;  3QOP A;  1O3R A;  1HKT A;  2D45 A;  2P8T A;  3ULQ B;  1JE8 A;  4LK1 F;  2XGX A;  2PLY A;  4AD9 A;  1AWC A;  3SXY A;  1S7O A;  1S3J A;  1DP7 P;  2DK5 A;  3ZQ7 A;  4IHT A;  3EYY A;  4OIO F;  1ZG3 A;  4P9U A;  1KYW A;  3RIR A;  3KP4 A;  1SD4 A;  1B1B A;  1ZN2 A;  3E5Q A;  1EH6 A;  4ESJ A;  5CVV A;  3IHU A;  2NAZ A;  5D4R A;  2Y75 A;  3LQQ A;  4ZZL A;  2EFQ A;  3VFZ A;  1XSD A;  4ZH4 F;  1J7K A;  2L4M A;  2IA2 A;  3RKW A;  2ACJ A;  1YIO A;  3GLX A;  3T8T A;  5DCM B;  1B9N A;  3LAJ A;  3SZP A;  1L0O C;  3WOD F;  3J80 Z;  1O57 A;  3LFK A;  3Q9S A;  2ZNZ A;  5AIQ A;  2V1U A;  2JSC A;  1ONV A;  5CVR A;  1YO5 C;  1T0F A;  4HYE A;  3WGG A;  1T39 A;  3MAJ A;  3P9K A;  3R6S A;  1YQA A;  1XMK A;  4WWC A;  3RKY A;  3DF8 A;  4P9F A;  3FXU A;  4N0B A;  4I0B A;  2M8E A;  2VC1 A;  3BDD A;  1Z05 A;  1I1G A;  5HLI A;  1F9N A;  5HS8 A;  2CQK A;  2CO5 A;  5TRD A;  2FBK A;  1IRF A;  2ZKZ A;  2O3F A;  4JBA A;  4JK1 X;  5HVQ C;  5LHG A;  2RKH A;  2L54 A;  1I5Z A;  5TJJ A;  1ZG1 A;  1RZ4 A;  2W84 A;  5HLH A;  1JHH A;  3QU3 A;  2C6Y A;  1EH8 A;  1XDU A;  2JTV A;  3M7G A;  4PGG A;  4CIC A;  3DV8 A;  2FBI A;  2L3D A;  2EA4 A;  3WTT C;  1KU3 A;  3G3Z A;  1FYM A;  2XIG A;  1KQ0 A;  1ZH5 A;  2NNY A;  3F8C A;  4MNU A;  3I4P A;  3OV8 A;  4IRG A;  3LA3 A;  2FMY A;  4AVP A;  4M73 A;  2JPC A;  3T0Y A;  2G7U A;  1ZG5 A;  5A2Q K;  1V4R A;  1O3S A;  5LGT A;  4G7H F;  2VOP A;  2YX4 A;  3ML6 A;  4KIC A;  4KA4 A;  2UZK A;  5FLX Z;  2Q8K A;  2BYV E;  4RB0 A;  2W57 A;  3SHF A;  1BI2 A;  3V7S A;  2F2E A;  4LD5 A;  4MEY F;  4G9Y A;  1TQM A;  4HQM A;  4L18 B;  3JSO A;  1CF7 B;  5D5X B;  4UXN A;  3KET A;  4IJA A;  1BN5 A;  4KYW A;  3DXJ F;  1PP7 U;  1P4A A;  1EH7 A;  4EQQ A;  2PN6 A;  1S8N A;  4HLX A;  4RGU A;  3ZMS A;  1BIA A;  3MWM A;  4G7O F;  2STW A;  4IRI A;  3ECH A;  3WTW C;  5D5W B;  2HS5 A;  4YIF A;  1QZY A;  5FO5 A;  3GZ6 A;  2HKO A;  3TO7 A;  4EJW A;  1HSJ A;  1W5T A;  3F23 A;  4MTD A;  4L0Z B;  2RQP A;  4P96 A;  3C1D A;  4KNY A;  3BP8 A;  2IVM A;  4KIF A;  1YLF A;  2RC4 A;  3CUQ C;  3CJN A;  3ISP A;  1O7F A;  2QQ9 A;  3QPT A;  4IVN A;  2ESH A;  2M45 A;  4WK8 F;  1FBQ A;  4IRH A;  1AOY A;  3BOQ A;  4EGY A;  2FA5 A;  2ESN A;  2JRT A;  4HF2 A;  1OMI A;  4XLN F;  3FF5 A;  2HZT A;  1E2X A;  1LNW A;  4LLN A;  1RUN A;  2BBY A;  4XSZ F;  5HS7 A;  2PG4 A;  1KU7 A;  4M9X A;  2ZME A;  2LDU A;  1QGP A;  4PDK A;  3F6V A;  1R36 A;  3HOT A;  3BWG A;  4M74 A;  2UXN A;  3V7C A;  5JI6 A;  3TKY A;  2J5O A;  5ILV A;  4HAM A;  4RS8 A;  1KU9 A;  3O2P E;  2QZ8 A;  3CUQ A;  1ZHF A;  3ZMV A;  4LK0 F;  3WTS C;  2PJP A;  1Z7U A;  2KJB A;  4HBL A;  4PGH A;  4RGR A;  4DNC A;  1K78 B;  1TLH B;  1GHC A;  1ON1 A;  3RI4 A;  1FP2 A;  1FPQ A;  5FFX A;  1B9M A;  5FB2 A;  4WCG A;  2K86 A;  1B6A A;  2W85 A;  4KN7 X;  1K6O A;  5AON A;  1W5S A;  2YX7 A;  4I0A A;  4I2O A;  2NS0 A;  2A61 A;  1IZ1 A;  3WGI A;  3KLN A;  4N9H A;  1P6R A;  1RUO A;  3GFM A;  4LB6 B;  2PMU A;  5L3F A;  4L5I A;  4NHJ A;  3TDU C;  1BI1 A;  2EWN A;  4FX4 A;  2L01 A;  2QBY B;  4EJO A;  1Z1D A;  2Y48 A;  3RTR A;  2XUB A;  3HTS B;  3LWF A;  4OIR F;  4MGR A;  2EFP A;  3IWZ A;  3RKX A;  4OOI A;  4HX4 A;  1W7P A;  2QUF A;  4EJT A;  1BIB A;  3CUO A;  3FMQ A;  3QU6 A;  5F1R A;  1O3T A;  2HYG D;  3BJO A;  5H6Q A;  3D5L A;  3FMR A;  3BY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...