4HX8A

Structure of metal-free mntr mutant e11k
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
SMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
total genus 53
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx8A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx8A02
1KYWA 2L4MA 4ESBA 2P5LC 3GW2A 3TKYA 1BN5A 4OINF 4MGRA 4I7HA 4UVAA 4M72A 1IN5A 3P7NA 1SMYF 4HF2A 3ELKA 2GXBA 2ZNYA 1VTNC 3MQ0A 2L02A 2FU4A 1XGOA 4M9ZA 1F9NA 4AIJA 2K4JA 3FXUA 3BPVA 4Q48A 1ZRDA 2VE8A 4RB3C 3GX4X 2G7UA 4UUVA 2AS5F 5BS6A 4ZYGA 3E6MA 3HRTA 5D4SA 1DUXC 3T5XA 3SZPA 4RGXA 4YIIA 3F8CA 2VC0A 3IRRA 3WU1B 2XASA 4UHTA 2PMUA 2A6HF 4GGGA 4WF2A 3HIFA 5FLXZ 2UXNA 3QPTA 1I27A 1R1VA 4XSZF 4BYYA 1B9MA 3HUGA 5E18F 2K7LA 1F4KA 1LQ1A 3F8FA 2HKXA 1Z6TA 3CUOA 3HTSB 3MWMA 3T1BA 4HOBA 1T2KA 2Z99A 2A69F 1YFHA 1KU3A 5BPDA 1JXSA 1WRJA 2OZUA 1PUEE 3C1DA 2P5KA 4GO1A 3G73A 4WXHA 2XVCA 1LDKB 4BHPA 4ZYEA 1YG2A 3WGHA 3R60A 3SZTA 2OQGA 2P6SA 1R00A 1W7PA 2OZ6A 2XROA 4P96A 4QLCU 1ZG1A 2TDXA 1D8JA 4EJOA 4HV5A 1ODDA 2L01A 3E5XA 3EUHA 1P4WA 1MDMB 4LG0B 4WX9A 3JAMZ 3IL2A 4Y15A 2XKPA 3QU6A 1L0OC 1EV7A 3DKWA 1USSA 2RVCA 3GO5A 4G7OF 4N9IA 1YIOA 2PFBA 3H3ZA 3GLXA 2JT1A 2O0YA 4PGHA 1TQPA 3V7RA 1XB4A 3QOPA 3WODF 4G6QA 1XSDA 4BXUA 3LA7A 3KP7A 3KZYA 2V1DA 3IRQA 2LSOA 2BGCA 4L5JA 3TDZC 1U78A 2FRHA 2FOKA 2HQRA 1BJAA 2V79A 2O3FA 3D5LA 3F72A 2IPQX 3LAJA 1O3QA 1XGMA 1YW9A 3ISPA 5D5UB 3MEXA 4IJAA 1G6NA 1S6LA 1B9NA 3BJ6A 3L9FA 4UXNA 1T39A 3ECHA 3IKVA 3W6KB 2GIVA 4JQFA 1UHMA 1LDJA 2DBBA 2QQ9A 2D45A 5HOOA 4LB5A 1W4MA 5J6XA 2YSRA 4EQQA 2IA2A 1U5TB 1MDMA 1BM9A 1WWXA 3V8KA 4YG2F 5DUIA 2DLLA 2K02A 2QBYA 3L7WA 3HSRA 4ENMA 2CW0F 2BE5F 3EETA 1QZZA 5HDGA 2Q8KA 1K6OA 3REOA 2PBIA 1J0RA 3HSFA 2M30A 5CVIA 2PI0A 1Q1HA 1GVJA 3ML6A 4RGUA 3WE3A 2EA2A 5ED4A 4E70A 5D8LB 3D0SA 3GUDA 1FNNA 3O2PE 3BJOA 3DPLC 2EV6A 3T8RA 4PDKA 3QP6A 2OU2A 5L3BA 2ZMEA 2ZKZA 4KN7X 3DQVC 2D1VA 5AIPA 2A68F 2J5OA 1HSJA 1P92A 1O57A 3ZQ7A 1SAXA 3TO9A 3LSTA 4M9SA 4D0PA 2A5YB 3ZMSA 3J80K 1FWZA 3LQRA 4KYWA 3FMQA 2QENA 5HLIA 3I53A 1TTYA 3QU3A 2KIUA 2K4BA 2DO7A 3NRVA 2ESHA 2Y75A 3QRFF 4WXDA 4R1HA 3CDHA 3WGGA 5TRDA 2H6CA 2HOEA 2LKPA 5FFZA 2OD5A 3VEPA 1MGTA 4L18B 2OBPA 4IHSA 5ILUA 4AIKA 3KP2A 1FZPB 2Q0OA 2H6BA 3CO7C 2X0LA 4MTEA 2VC1A 4A0ZA 5EEHA 1ULYA 1TW3A 3R6SA 3F22A 2VOOA 2QBYB 1B6AA 1XMAA 1S8NA 4O5VA 2UZKA 3HRSA 2R3SA 4DNCA 1J59A 4RB0A 4A0YA 3ECOA 4ZYHA 4QWQA 3GZ5A 1DP7P 4L9JA 1D5VA 5D4RA 3RI4A 5L3GA 3JTHA 3R0AA 3SHFA 3TO7A 2NNNA 1R58A 2VBZA 1MKMA 4CZZA 1P2FA 1UCRA 1B1BA 4MQ9F 1S7AA 2JTVA 3HOSA 1OYIA 3V8JA 3CLOA 3ROUA 2P5VA 2F5DA 4HDVA 4M6XA 2D2WA 2MH9A 5E8IA 3U2RA 4M73A 5DD8A 1MJAA 2E1NA 2Z3YA 1BI1A 1SD6A 4KIBA 3TO6A 2F5EA 2VN2A 4RAZA 5A2QK 2DPUA 4HX4A 2L54A 3IKTA 2DT5A 4AVPA 1J9IA 4UVCA 5E8GA 1S7OA 5LLQA 4HX8A 4IVNA 2JPCA 4LMYA 1W7PB 4P9UA 2BYVE 1R5HA 1K78A 2GWRA 1KU2A 4F7ZA 1H9TA 1STZA 4KMFA 3WE2A 3CTAA 3QAHA 1YS7A 3W6JB 4WWCA 2O61A 2FNAA 1G3YA 2HR3A 3N4MA 5IT3A 1QGPA 1GHCA 3KE2A 5JI6A 1KGSA 3F3XA 5A2QZ 2C6YA 3FXRA 4PZJA 3V7SA 3PFIA 4OMYA 1S29A 4P9FA 5CVUA 1WSUA 1G3WA 4CYDA 3PQKA 1IN6A 2V6CA 2MD5A 4OOIA 3ERED 3M7GA 3F8BA 4EM0B 2GA1A 2JZYA 5DCMB 2G9WA 1Z9CA 3RDIA 3Q9SA 3LA2A 1T98A 5FD5A 3C7JA 1IW7F 1REPC 1ON2A 4M71A 3M1EA 4UV9A 2PLYA 3DEUA 1L3LA 2Z33A 3B73A 3F8NA 2STWA 1UFMA 2VT2A 3M8EA 1TQMA 1MZBA 1UB9A 2JRTA 4XBFA 2CGPA 4YIFA 1SFEA 3DV8A 4MQVA 4I0AA 2HTSA 2J5PA 2XKOA 1CGPA 2ZFWA 1F1ZA 2D1HA 4Q47A 5JHUA 1W5SA 3GFLA 2UXXA 3TGNA 2ISZA 1FC3A 1MJ9A 5LBQA 1OYYA 1Z91A 2DFIA 5J8CA 4ESJA 1R5GA 2XRNA 1FY7A 1WI9A 2QUFA 1P4AA 1R22A 3F21A 1EH6A 3SFZA 2PN6A 3JSOA 3WGIA 1DPUA 3L00A 5LRSA 1HW2A 2W84A 2YU3A 5HLHA 4U88A 4DQ2A 4OMZA 4HF0A 1ZRCA 2HS5A 3RYPA 3I0TA 5K5RA 3CUQB 4MEYF 1HSTA 4G9YA 4EJVA 1J7KA 5F1RA 3BZ6A 1ZGAA 1QQIA 2KJCA 3T0YA 4KIFA 3MZHA 2HFHA 3V4GA 1Y0UA 3V7CA 5FLXK 2VE9A 5CYVA 1IRGA 4Y17A 4ESFA 2CWEA 3WTYC 4MHGA 4GCVA 2UWMA 3GEZA 4OIPF 2QLZA 2ZMEB 3EDPA 3WU0A 4LK0F 5ILSA 1QBJA 5FGMA 1EH7A 1IZ1A 1R36A 3E6CC 2WTEA 5AIQA 2EFOA 3ZN0A 1XSVA 1LVAA 2ZCWA 3MAJA 3BWGA 2F5FA 3HOTA 3H3UA 4ON0A 1FT9A 4EV0A 4GXOA 1FLIA 4BHCA 5LRRA 2XAGA 4BQAA 1E17A 4YFNF 2KKOA 2HWVA 2KRFA 2A3SA 1T0FA 3E97A 1XGSA 1LNWA 3FMRA 2GQQA 2BV6A 3HHGA 3CO6C 4I01A 3AAFA 4G6DA 4L9TA 1ZRFA 1I6XA 5LEJA 2HKOA 4U7BA 5DDGA 1U6GA 1YW7A 1IN7A 3J81Z 4HF1A 2HYGD 1KQ8A 3T8TA 3IWZA 5L3FA 2IT0A 2L4AA 1W5TA 2Y0MA 1T38A 1O3TA 5DUKA 4A6DA 4YFKF 2ZXJA 1W7PD 3K9TA 3ZP5A 5FD6A 4AWXB 4KNYA 3RTRA 3BY6A 1FP1D 2E7XA 2OQRA 2HYFA 1CF7B 5D5WB 1TLHB 3R0JA 5H20A 3GWZA 2EFQA 1OR7A 5CJ9A 4R8HA 4GYIA 4FX4A 4B09A 5D8KB 2W25A 5HDKA 1RUNA 3K1NA 3WTWC 3BDDA 3U9GA 4P55A 4K2EA 1B4AA 1F5TA 1O7FA 1YW8A 4CXFA 3GVAA 4M9XA 2EV0A 4EVIA 2E1CA 3MCZA 2VBWA 1BI3A 4FHTA 4KUMA 5DV5A 2VONA 5EEGA 3B02A 2EWNA 4A6EA 2M1BA 1YLFA 3SXYA 3GFJA 1HW1A 3NEUA 3KZZA 1KQ9A 1ZARA 3DPTA 3LFKA 5LHGA 3P9CA 3ABTA 1J2XA 1PP8F 2H27A 2PJPA 1HW5A 3E5QA 1HKTA 1RUOA 2NAZA 2QVOA 3K1MA 3RKXA 1XD7A 5JFRA 2XIGA 3OV8A 3KLNA 4A12A 1QZYA 4IRIA 2ELHA 2FA5A 3PQJA 4XLNF 2IRFG 1IN4A 1X3UA 1XDUA 3WTUC 1HKSA 3BROA 2IP2A 2ETHA 2XAJA 1ONVA 3VFZA 4EGZA 1SMTA 1A04A 5D6FA 4LB6B 1I1SA 4AD9A 5K5QA 3I5UA 1LB2A 4LLGF 5LGNA 4U0VA 2HZTA 4LD5A 1FOKA 2WC2A 1WKMA 1FBQA 1ZG5A 3GFMA 3SQNA 5BQTA 3COAC 1BI2A 3TOBA 2B0LA 4XRFA 1FBUA 5L3EA 1BC8C 5LGTA 3BJAA 2IJLA 3OOPA 2Q2EA 2DPDA 2HTJA 3KEQA 1GXQA 1ZREA 2VT3A 3FXQA 1YYVA 3E5UA 4HX7A 5BMZA 4A5MA 1ZGJA 4S05A 4MEXF 4WK8F 3CUQA 5FFXA 4UVBA 3ZMVA 2ADUA 3KP6A 5HS8A 1AWCA 2CSOA 1U2WA 3I59A 1FP2A 1T6SA 3GXOA 4KFCA 1JGSA 2A07F 5BPIA 3BP8A 4KIGA 3F23A 2HEOA 1ZN2A 2KIFA 1G3TA 1R1UA 2AXLA 2WWYA 1K78B 1ZYRF 2VXZA 3HYIA 2EA4A 1JE8A 3DXJF 3R4KA 2ZNZA 3LQQA 1ZAOA 1ZG3A 4NB5A 2CG4A 2OA4A 2FBKA 2O03A 4TV7A 4KN4X 3R61A 5LEKA 1IXCA 1ZHFA 4ENKA 1WQ2A 3L2CA 2E7WA 4M74A 4U7DA 1Z1DA 1HQCA 1XSXA 5ICGA 1J75A 4FX0A 1FYKA 2XUBA 1XCBA 2BEOA 2CYYA 2GA2A 4LLLA 2DK5A 2FEZA 2EFNA 4OIQF 5E1XA 5E1ZB 3DF8A 3FMSA 1HBXG 2P6TA 2QM3A 3KETA 5H6RA 2DQRA 4IXAA 3GZ6A 1QNTA 2W57A 1FPQA 3HRUA 3H92A 4L9NA 3CJNA 2V9VA 1J5YA 3N97A 4L9VA 4RB1A 3J7AO 2MLKA 1ZLJA 4U0YA 3E6DA 1Z6RA 5HS9A 4IF4A 1E2XA 1G3SA 2X4HA 3G3ZA 3FZVA 2EB7A 2YR2A 2FMYA 4HQEA 3ZPLA 2YX7A 2CO5A 3BPXA 2HDCA 2NRAC 1TNSA 2P4WA 2XGXA 3IHUA 2EK5A 2FBHA 4IHTA 2XHKA 1MJBA 5ICCA 4IPAA 4RAYA 4IRHA 2DI3A 2QWWA 4UV8A 3EYYA 4KMUX 2DQLA 2EV5A 1YS6A 3IWFA 5KVRA 2DW4A 2XAHA 1RIOH 1B59A 2ESNA 4Z2YA 2RQPA 4BH9A 2CQKA 1BIBA 3U1DA 3TQNA 3I54A 2RN7A 2Z5UA 2XV4S 2ZJ2A 2M5WA 2YX4A 2IA0A 4HZFA 4XSXF 5JVTA 2VODA 3MFKA 3FHZA 1BBYA 2RV8A 2VBYA 2YPRA 5CVRA 3WTZA 3HRMA 5BOXA 2MBFA 3GF2A 4P5OA 3O3KA 3VOEA 2MLGA 4PCQA 5HDNA 4A2UA 2K27A 1K79A 3ULQB 5ILVA 4N9HA 1U8RA 1Z7UA 5ICEA 3P9IA 4L0ZB 4HAMA 1ZH5A 1AOYA 1G4DA 4RB2C 1SD4A 3ZMDA 2NYXA 4HQMA 1H9GA 3BOQA 2GAUA 3ZN1A 2O8XA 4H0EA 3K1PA 1IXSB 1IN8A 4I02A 2KJBA 4G8XA 5IT9Z 1JHFA 2G7HA 3Q5FA 2GZWA 4KA4A 4BHBA 2EFPA 5FB2A 3EQLF 4MNUA 5K1YA 1XDSA 2QQAA 1ZLKA 3WTTC 4EJTA 5D6EA 1IF1A 5JR3A 2RGVA 3WTSC 5AONA 1TNTA 3I4PA 3RIRA 1MD0A 6PAXA 3JAMK 1QO0D 3MZYA 3ZMZA 3CUQC 2M87A 1NHAA 3HTUA 4AIHA 1SD7A 5D5VB 1KQ0A 2F5CA 2FF4A 1FSEA 2RC4A 3EYIA 3VB2A 4I0BA 3C3WA 2P8TA 3KFWX 5F6FA 4ZH4F 2PQ8A 1H0MA 2ZBKA 1PDNC 1IXRC 1U3EM 3JW4A 3RYRA 2DU9A 3IC7A 4KICA 4HBLA 5ICFA 2WV0A 4EJUA 5E17F 5DEQA 3M9AA 2LDUA 4CDGA 3I71A 2FQ3A 2IVMA 5CVJA 4LJZF 1OPCA 4O6JA 3HHHA 2OAZA 2STTA 1LEAA 4ENJA 4LG0A 1OYWA 4ZYDA 4CO8A 2GXGA 1U5TC 3KLOA 5F64A 1R7JA 5L3DA 3FM3A 2Z9OA 4BAYA 4JK1X 2W85A 1I5ZA 2L3DA 3RPQA 1I1GA 4LGWA 2M45A 5CVVA 3L09A 2FNPA 4EGYA 2QQBA 3JTGA 3FX3A 3I59B 4OU0A 3QPHA 4ZZDA 1XMKA 5DCFA 4Q5SF 2O6GE 1SFUA 4XLPF 5D5XB 2FSWA 3F8MA 3WTXC 1OMIA 2JSCA 4LK1F 2Y48A 2DTRA 4HA8A 3DP7A 4L5IA 4N0BA 2H94A 4KDPA 1XN7A 2XAFA 2DK8A 4O3MA 3K2ZA 3LWFA 2IW5A 2VOPA 2KIMA 3FF5A 4KT5C 2XAQA 3QP5A 4Q4ZF 3E6BA 4S04A 4LLNA 4UNOA 1DDNA 1D3YA 3WTVC 5CLSA 3KP3A 2FXAA 1LJ9A 4OIRF 1YTYA 1IRFA 4U0WA 3KP4A 1O3RA 1SFXA 3ZMTA 4HLYA 2LF7A 2VBXA 4OIOF 3DFGA 4HW0A 3V8LA 4EJWA 5K5OA 4G7HF 5KK1A 1XGNA 2RKHA 1KYZA 3GFIA 1FYLA 4M6YA 3KP5A 5DD4A 3VODA 5FO5A 1O7LA 2K86A 1XCVA 2MC3A 1DPRA 4I98B 2PMHA 2H09A 1K7AA 4G7ZF 3FM5A 5LHIA 1LDDA 2RDPA 1JHHA 2JPBA 4EMSA 2LNBA 3HSEA 4Y13A 4NQWA 2ACJA 4YFXF 1OKRA 2MA3A 3RJPA 2COMA 1O3SA 3RKYA 1TW2A 4IRGA 1C0WA 3KEOA 4WXCA 5ERIA 3Q9VA 1UHWA 1V4RA 1BOAA 1TQIA 3I58A 1RZ4A 3J80Z 2RNJA 2FE3A 1LEBA 3E3VA 4ETSA 4I09A 2HGCA 4ASNA 1TBXA 4A0XA 1D8KA 4B8XA 5E20A 2HQNA 2ISYA 3J81K 2MH2A 2P7CB 3TOAA 4A5NA 1FYMA 1V3FA 4GYGA 4FT8A 2PEXA 4ENNA 3KCCA 3FWEA 1CF7A 1HKQA 2NNYA 1BC7C 5L3CA 4JBAA 3F6VA 3TDUC 3C18A 1RNLA 1RI7A 1R23A 3JSPA 5H6QA 4R79A 4RGRA 4HV6A 4PGGA 5HS7A 2PG4A 2DAOA 1KU7A 4RS8A 4G94A 4EM2A 4LFUA 4NHJA 1IAWA 1KU9A 3K69A 2V1UA 5HLGA 1R1TA 2BBYA 2EJRA 5DCMA 3RKWA 4MTDA 2FMLA 1HXDA 5LGUA 3WG9A 4EM1A 1U5TA 1QPMA 5J8FA 1FSHA 3RPUA 1S3JA 5HVQC 1Z05A 2R7FA 1BIAA 2LF8A 1IUYA 4CICA 2F2EA 1GXPA 1SD5A 2W24A 3GYHX 4RGSA 3ABUA 1P4XA 3M8FA 4CGZA 2QYOA 2A6EF 1BI0A 1P6RA 2QZ8A 2A61A 1PP7U 4BNCA 5IT9K 2EFWA 4I2OA 2FBIA 3K0LA 3F6OA 3NQOA 5DYMA 4ZZLA 1FBSA 1FX7A 2NS0A 5TJJA 4HLXA 3ZMUA 2IA1A 3S2WA 4HDUA 5LHHA 1USTA 1YQAA 3P9KA 3LAPA 4L0YB 5E1WA 2R7DA 2CFXA 4CHUA 2V1XA 1ON1A 1EH8A 2M8EA 2ZO4A 3I64A 1KA8A 3LA3A 2P7VB 1YO5C 4HYEA 3O6BB 4WCGA
chains in the Genus database with same CATH superfamily
3EUAA 3JREA 1KYWA 2L4MA 2ZSHB 4ESBA 2P5LC 4A3GJ 3GW2A 3TKYA 2HNHA 2OCEA 2TRTA 1AU7A 2VQGA 3ZRGA 4XICA 3ZXSA 4AVZA 1BN5A 4NUBA 2VQHA 4OINF 3VYTB 4MGRA 4I7HA 4UVAA 4M72A 1IN5A 3P7NA 1SMYF 4HF2A 1I39A 1OFCX 3ELKA 1WJ5A 2EIMH 2Y9YA 2HVRA 1MH3A 2L9RA 2GXBA 3HDDA 2ZNYA 2IGOA 1Y6IA 4PK4A 1VTNC 1ZQ3P 3OY9A 5GPCA 3CMEI 3QYEA 5F0HA 4FE4A 1LFUP 2GLOA 3MQ0A 1SANA 2E19A 2L02A 1A5JA 2FU4A 2PJRA 1XGOA 3OYNA 3GTKJ 4M9ZA 1F9NA 3O8HA 4AIJA 2K4JA 3FXUA 3BPVA 2HQAA 2ID6A 4Q48A 1ZRDA 2VE8A 1X1DA 3AL0B 2M7AA 3GBGA 3K4MA 4XN3A 4BXXJ 4RB3C 4M3EA 2Y9ZA 3GX4X 1PUFB 4M3GA 4ZDLA 2G7UA 4UUVA 2AS5F 4HNUA 4IOCF 5BS6A 4ZYGA 1Y8QB 3HRTA 3E6MA 5D4SA 1DUXC 3T5XA 1VQ7I 4B44A 1YX3A 2HXIA 3SZPA 4RGXA 4YIIA 3ZR8X 1VQKI 2QSGX 1D1BA 3F8CA 1I50J 2VC0A 1IV6A 3IRRA 3WU1B 2R5YB 2XASA 4UHTA 2JQ7A 3S1MJ 5EJCA 2DDBA 1YJNI 2PMUA 2FUG2 2A6HF 1RETA 4GGGA 1OCTC 2XSJC 2GM4A 4WF2A 1AKHA 3CF2A 4DIQA 1X1BA 3HIFA 5FLXZ 2UXNA 1T08B 3QPTA 2H8WA 3WHCA 1I27A 1R1VA 4A93J 3W2WA 3OS0A 2IAIA 4XSZF 2DMQA 1QVUA 3LOCA 4BYYA 1B9MA 2WAEA 3HUGA 4HSRA 5E18F 1CQTA 2K7LA 3FBIB 3Q0WA 4BE0A 1F4KA 1LQ1A 2BVLA 2CUEA 3F8FA 2MABA 2HKXA 1Z6TA 3CUOA 3HTSB 3HOZJ 3MWMA 2E1MB 3T1BA 4HOBA 1T2KA 2Z99A 2A69F 2MZ4A 1YFHA 5EZHA 3IH4A 3FIWA 1KU3A 5BPDA 1JXSA 1WRJA 5BNGA 2YU9J 5DM7F 3H5RA 2OZUA 1PUEE 3C1DA 1YITI 2CH0A 2H1KA 2P5KA 2K9QA 4GO1A 4Y33A 3G73A 2M9HA 1G2HA 4WXHA 3VSKA 1BOBA 2XVCA 1LDKB 2VJ5A 4BHPA 4ZYEA 1YG2A 5FRNA 1VF9A 3H9GA 2X1EA 3OYMA 3WGHA 1ETXA 3PIPF 2ICWG 2E2IJ 4J00A 1P9QC 1W36C 2KDOA 3R60A 1ETYA 1MBEA 3SZTA 1E3PA 3CQZJ 2OQGA 2P6SA 4ZDOA 3BLYA 1FTTA 3S93A 2XRLA 1R00A 1MIJA 1W7PA 2OZ6A 2XROA 4BY1J 5IPAA 4P96A 4QLCU 1ENHA 5EZGA 1ZG1A 2TDXA 1D5YA 2E5NA 1D8JA 4EJOA 4HV5A 1ODDA 3WHBA 2B63J 5GAGJ 2QCOA 2L01A 4II2A 3E5XA 3EUHA 1B72A 2QEXI 1P4WA 2XDVA 1MDMB 4LG0B 4WX9A 3JAMZ 2X48A 4MLOA 3IL2A 3OR2C 1JT0A 4Y15A 2DTZA 2XKPA 5FKNA 3QU6A 2OUMA 5E3MA 3HZJA 1L0OC 1EV7A 3DKWA 3DLLF 1USSA 2FD5A 2RVCA 2CW7A 2P81A 3GO5A 1QA6A 4G7OF 3VYUB 3BT9A 2HXOA 4YEJA 4N9IA 2WV1A 1YIOA 2PFBA 2VPRA 2X6WA 4DZPA 1YHQI 3H3ZA 4KITB 3OYEA 3GLXA 2JT1A 2O0YA 4PGHA 1TQPA 3V7RA 2NOJB 1XB4A 3QOPA 3WODF 5E3NA 2DXIA 1S72I 3K70C 2CQNA 4G6QA 1Z7LA 1XSDA 4BXUA 4BJTA 3LA7A 3KP7A 3KZYA 2V1DA 3ABKH 3ASOH 3IRQA 2LSOA 1Y56A 2BGCA 4L5JA 2IGMA 2H1LA 3TDZC 2ZXHA 1U78A 2TCTA 1BR4A 1T0FC 4X6AJ 3JR9A 2FRHA 1JKOC 4YIRX 2FOKA 1D0ZA 4CCJA 2HQRA 1BJAA 2V79A 2O3FA 3D5LA 3F72A 2IPQX 2L0KA 1FOXA 1WVRA 3MN2A 3NARA 1ETVA 3LAJA 1O3QA 1XGMA 1YW9A 2QKMB 3ISPA 2F4OB 5D5UB 3MEXA 2M0MA 4IJAA 3F0CA 3CCVI 1G6NA 1S6LA 3JRCA 3CP8A 1VQLI 1ERDA 3HL2A 1R4NB 4LIVA 2R7SA 3DCFA 1B9NA 3BJ6A 3L9FA 4UXNA 1T39A 5J1YA 3ECHA 4UUSB 2CQQA 3H9QA 3IKVA 5IOZA 3IAS2 3W6KB 2DYRH 2GIVA 2K9LA 4JQFA 3OSGA 5F0FA 1UHMA 1Z67A 2XAUA 1LDJA 2DBBA 2QQ9A 1K4SA 5C4JJ 2D45A 3RCOA 5HOOA 3WU2C 3RQIA 4LB5A 1W4MA 5J6XA 2YSRA 3AG3H 4EQQA 2IA2A 1UG0A 1Z21A 1IRXA 1U5TB 1NG7A 3V42A 1MDMA 1BM9A 5DM6F 2LK2A 1BJZA 1WWXA 4XLAA 3V8KA 3S3NA 3CDIA 2DFHA 3A0BC 4YG2F 2DLLA 2K02A 5DUIA 2QBYA 3L7WA 3GTMJ 3S2HJ 3HSRA 4ENMA 4IO9F 4I99C 2DN0A 1GV5A 2CW0F 2BE5F 5M5YJ 2L9VA 3EETA 1QZZA 5HDGA 4BDYA 1V5EA 2O5RA 2Q8KA 1K6OA 1WJEA 3REOA 4C3JJ 3CC4I 1LFPA 1UZCA 2PBIA 1J0RA 3HSFA 2M30A 5CVIA 2PI0A 5E79C 1TWHJ 2QQ8A 1Q1HA 2WA0A 1GVJA 3ML6A 1PJRA 4RGUA 1VQNI 3BG9A 2EA2A 3WE3A 5ED4A 4E70A 4E7ZA 5D8LB 3D0SA 3GUDA 2HVSA 4XRSG 3LSPA 4C3HJ 1FNNA 3BZCA 4HSTA 3O2PE 4CH7A 3BJOA 3DPLC 3TMOA 2EV6A 3T8RA 2L2OA 4PDKA 3QP6A 2OU2A 3KPHA 5L3BA 3IV5A 2ZMEA 1X4PA 3VPRA 1YX5A 1JUMA 2ZKZA 4KN7X 3DQVC 2D1VA 5AIPA 3BTCA 2A68F 2J5OA 1F43A 5J1UA 2R7OA 1HSJA 1P92A 1O57A 1RESA 3ZQ7A 1SAXA 3TO9A 2Q2EB 3LSTA 2KIQA 3KYCB 4LOCA 4M9SA 1X3WB 5F04A 4HNTA 3C2GA 4XLHA 4D0PA 2A5YB 3ZMSA 3J80K 5EGOA 2E60A 1IV8A 4L5EA 2F48A 1FWZA 3LQRA 4X1EA 1KZHA 3SEZA 4KYWA 3FMQA 5IOYA 4A3EJ 2NVQJ 2QENA 5HLIA 3MKZA 4D5FA 3M4OJ 3DU6A 3I53A 1TTYA 3QU3A 5GTHC 3RZDJ 2KIUA 2ME0A 4AM3A 2FQ4A 2K4BA 2ZB9A 1AKHB 2DFFA 2DO7A 3G1MA 2ESHA 3MD2A 3NRVA 1R71A 2Y75A 3TBIA 1LPQA 3QRFF 4WXDA 4R1HA 1IDYA 1WJBA 2X9DA 3CDHA 3WGGA 5TRDA 2H6CA 3ERMA 2VKDA 2HOEA 2LKPA 2M35A 5FFZA 2Z16A 2OD5A 3VEPA 1MGTA 1GUUA 2DT7B 4L18B 2OTLI 2OBPA 4IHSA 5DTDA 5ILUA 3G6EI 4AIKA 3KP2A 3JRHA 3HKZN 2Q0OA 1FZPB 2H6BA 1RR7A 3HOUJ 4PJ0C 3CO7C 2E2JJ 2V9KA 2CMPA 2X0LA 4MTEA 2VC1A 2XB5A 4A0ZA 5EEHA 4XRMA 2XPUA 2EIJH 1ULYA 3LMMA 4BL0B 3CCLI 2D5VA 1FMWA 1TW3A 1VFCA 1QZEA 3R6SA 3F22A 1HDDC 2VOOA 3S15J 2QBYB 1B6AA 3GLLA 1XMAA 1S8NA 4O5VA 2UZKA 3ZQIA 3HRSA 2R3SA 3ABLH 2XGDA 4DNCA 1J59A 1VQ4I 4RB0A 4A0YA 3ECOA 4ZYHA 4QWQA 4ZYAA 3GZ5A 1FIPA 1DP7P 4L9JA 1D5VA 2KL4A 2HU9A 5D4RA 2DCEA 5LFAA 1MH4A 2MC4A 3RI4A 3MKLA 5L3GA 2FJ1A 1J09A 3JTHA 2K3PA 2LR8A 3R0AA 1TZLA 3PFYA 3SHFA 1N78A 1R6RA 3TO7A 3ZQHA 2NNNA 3OYCA 1ETQA 1R58A 2VBZA 4PFPA 4RLQA 1MKMA 2JN6A 3BR6A 4CZZA 5EDNA 3U21A 2EH3A 3SYTA 1P2FA 1UCRA 2JMWA 4JX5A 2CW8A 2W00A 1B1BA 4MQ9F 1S7AA 3AG4H 4JX6A 1AHDP 3BZKA 1LE8B 2JTVA 3UR3C 4DYRA 3HOSA 1OYIA 3V8JA 3CLOA 3ROUA 5M3FJ 5J47A 1VI0A 2P5VA 1OCRH 2F5DA 1MBGA 4HDVA 4M6XA 2D2WA 3RKQA 2MH9A 5E8IA 1LVKA 3U2RA 2CRGA 1APLC 4M73A 5DD8A 1MJAA 2E1NA 2Z3YA 1MSFC 2KHMA 1BI1A 1V5GA 1XG1A 1IGNA 1FIAA 3LSGA 1P7IA 4E7SA 1MBJA 1SD6A 4DYQA 3G71I 4KIBA 1ZTRA 3TO6A 2BHZA 4A3JJ 1BW5A 3PSIA 5C44J 3OYHA 2F5EA 2BY1A 4BQQA 3H0DA 2VN2A 2HOAA 1DU6A 4RAZA 3H9JA 2R7VA 5A2QK 3LSMA 2DPUA 3BQYA 4HX4A 2L54A 3IKTA 3E0JB 2DT5A 2KPMA 2QGUA 3HEFA 4AVPA 1J9IA 4UVCA 5E8GA 3IH3A 3HJEA 2MUNA 1S7OA 5LLQA 4HX8A 4IVNA 4B47A 2QF7A 1AA7A 2ELJA 1IRZA 3HBLA 2JPCA 1O4XA 2EZLA 4LMYA 1W7PB 1B8IB 1WCMJ 4P9UA 2BYVE 3QQAA 1R5HA 1K78A 2R7RA 3G1OA 5CQGA 2GWRA 3H1CA 2M4KA 1KU2A 4F7ZA 1H9TA 1STZA 2NS7A 3N05A 2VLAA 2BXYA 4KMFA 3WE2A 4D5CA 5FLXR 1EJ9A 3CTAA 3OIPA 3QAHA 1N77A 2LFBA 1YS7A 5EF6A 3W6JB 4WWCA 3K4KA 2FNAA 2O61A 2EZKA 1G59A 1G3YA 2HR3A 4RA2A 3N4MA 5IT3A 5IT9R 4RM3A 1D0XA 1QGPA 1GHCA 3B6AA 1MBHA 3KE2A 3KYLA 5JI6A 1X3ZB 1KGSA 3F3XA 1OQYA 5A2QZ 2C6YA 2K9SA 4YRVA 1TP4A 2XC7A 1WJFA 2YUSA 3FXRA 2QKLB 1DQUA 4PZJA 3V7SA 2IS4A 3PFIA 2R7TA 4OMYA 1S29A 2LY9A 4P9FA 4QSHA 5CVUA 1WSUA 3B6CA 2R7ZJ 1G3WA 4CCKA 1EKEA 4CYDA 3PQKA 1IN6A 2V6CA 3MKWB 3A03A 2MD5A 3JRFA 4OOIA 3ERED 3ZOBA 1JKPC 1XX5A 3M7GA 3K4LA 3F8BA 4EM0B 2GA1A 2JZYA 2WBMA 3KYDB 3LSKA 4MFEA 1BA5A 4KJZA 1A35A 5DCMB 2G9WA 2MSYA 1Z9CA 1UHSA 3RDIA 1VQMI 3Q9SA 4UUSA 3LA2A 1T98A 2CQ7A 5FD5A 3Q0VA 2N8GA 3C7JA 1IW7F 1REPC 1ON2A 4M71A 3M1EA 4UV9A 2PLYA 3LSRA 3DEUA 2R5YA 1OR7C 1L3LA 3JAMR 2Z33A 1RRJA 1UELB 3B73A 3F8NA 1A36A 2STWA 5C4XJ 1UFMA 2VT2A 3M8EA 1EF4A 1TQMA 3MKYB 2H8RA 4UB6C 1MZBA 1UB9A 2JRTA 1ETKA 3SJMA 2FOWA 3WG7H 2EZIA 4XONA 3CP2A 4XBFA 4E7LA 3OSFA 1PUFA 2CGPA 4YIFA 1HC8A 1SFEA 3DV8A 4MQVA 4I0AA 4U87A 3JRBA 2HTSA 2J5PA 2XKOA 4IKFA 4NC8A 2ZFWA 1CGPA 1SVLA 4F55A 1F1ZA 2D1HA 1X1CA 4Q47A 1W0UA 1DGRM 2E5ZA 1W5SA 5JHUA 5ICCA 3GFLA 3GTLJ 1QPIA 2UXXA 3TGNA 2ISZA 1FC3A 1MJ9A 1PVEA 2IGKA 5LBQA 3M1CA 2R7XA 5E3OA 1OYYA 2K5CA 1Z91A 1WI3A 2AO9A 1Z3YA 2DFIA 2HZDA 3TP3A 2BOLA 5J8CA 4ESJA 2DFEA 1R5GA 2XRNA 1FY7A 1WI9A 1R49A 4DBQA 1W0TA 1NG6A 2QUFA 1P4AA 1R22A 1HA8A 3F21A 2JA2A 1EH6A 3SFZA 2PN6A 2CV1A 3DWLE 1A6QA 3JSOA 1W5CC 3WGIA 3IH2A 3K6GA 5IP7J 5K7FA 4A3IJ 1DPUA 3A0HC 2ZXIA 3DLAA 3L00A 2HQ5A 3BR2A 3PO2J 2VJJA 1OCCH 3M8JA 5LRSA 1JI8A 1HW2A 4BUPA 2W84A 2YU3A 5HLHA 9ANTA 4U88A 2R7WA 4DQ2A 4OMZA 4HF0A 3BTJA 1ZRCA 2HS5A 3RYPA 2ZXWH 3I0TA 1ETOA 2ZJQF 1SC7A 4BS9A 1K6YA 3ASNH 4IX7A 5K5RA 4MO7A 3CUQB 4J19A 4MEYF 2KFDA 1HSTA 2IS6A 3I9V2 4G9YA 4EJVA 1ACIA 3DBRB 1J7KA 1JTXA 2O7OA 2YS9A 5F1RA 3BZ6A 1ZGAA 1QQIA 2KJCA 4NC6A 5EGOB 3T0YA 4D7MA 1VQ5I 4KIFA 3MZHA 3BR5A 3PSFA 2HFHA 3V4GA 3PUFA 1Y0UA 3V7CA 2RNGA 5FKKA 4N4NB 3E7LA 3L2QA 5FLXK 2VE9A 1QVTA 3CMAI 5CYVA 1IRGA 4Y17A 4ESFA 2CWEA 3WTYC 2LKSA 4MHGA 1WJDA 3SDBA 3FKJA 4GCVA 1JKQC 1ORKA 4LITA 2UWMA 4V2FA 2F5VA 3GEZA 4OIPF 5GTIC 2QLZA 1SVMA 2EPFA 3A1YA 3FISA 2XSDC 3AKZA 1TT5B 2XPWA 2ZMEB 3EDPA 3WU0A 4BQOA 3L2RA 4S0HB 3ZGKA 4IL6C 4LK0F 5ILSA 1QBJA 5FGMA 4CCNA 1EH7A 2PMZA 4NBQA 4CYCB 1IZ1A 1IC8A 1R36A 4BBSJ 3E6CC 1X2MA 2WTEA 4BY7J 5AIQA 2EFOA 3ZN0A 1XSVA 1LVAA 4D7NA 3M07A 1TWGJ 2ZCWA 4QIWN 3MAJA 3BWGA 1X4OA 2F5FA 3K70D 3H3UA 3HOTA 1K83J 3BR0A 4ON0A 3ZCOA 4Y7NJ 1FT9A 4EV0A 2ECBA 4GXOA 1FLIA 4RAGA 2V1NA 4BHCA 5LRRA 1LFBA 1YRNB 2XAGA 4BQAA 1E17A 4YFNF 2KKOA 2VJ4A 2HWVA 4XKCA 2WAQA 1FOWA 3HOVJ 1T95A 2A3SA 2KRFA 1BR1A 2VXDA 3ZQFA 3S32A 1T0FA 3S8PA 3E97A 4JOMA 1XGSA 1LNWA 3FMRA 2DMTA 2VKEA 2GQQA 2BV6A 3HHGA 3CO6C 2BVMA 4I01A 4RM2A 3K7AJ 3AAFA 4G6DA 4RAYA 4L9TA 3HB9A 1GLNA 3CJTB 2V6EA 2L7MP 1JGGA 2DODA 2DYSH 1ZRFA 1I6XA 4B3XA 5LEJA 2HKOA 4U7BA 4NNJA 1E0EA 4XLFA 5DDGA 1U6GA 1YW7A 2A6TA 1IN7A 3KEYA 3X2QH 3J81Z 4HF1A 4IQ4A 2HYGD 1KQ8A 3CCQI 3T8TA 3IWZA 5L3FA 2IT0A 2L4AA 1XC5A 2ZC2A 4M3BA 3FXLA 2IXSA 2GIZA 1V5FA 1W5TA 2JRMA 2DDAA 2V7FA 2Y0MA 5C3EJ 2NVYJ 1T38A 1O3TA 1MNEA 3LFUA 5DUKA 4CCLA 4B1RA 4A6DA 1VQ9I 4YFKF 2R5ZB 3FXKA 2ZXJA 2W1OA 5FKMA 1W7PD 2KP6A 3K9TA 3ZP5A 3BG5A 5FD6A 4AWXB 4KNYA 1WJCA 1Z77A 3RTRA 3BY6A 1FP1D 3OYKA 2E7XA 2OQRA 5EG0B 2HYFA 3GTGJ 1CF7B 4BBRJ 5D5WB 1KONA 1TLHB 2KRCA 3R0JA 5H20A 3GWZA 4AUXA 2EFQA 3UKGA 1OR7A 3O8GA 4NDLA 5CJ9A 4R8HA 1V55H 4GYIA 4FX4A 4B09A 4E7IA 5D8KB 2K9MA 2W25A 1YJ9I 5HDKA 1RUNA 3S17J 1JUSA 2JA8J 3K1NA 5B66C 3WTWC 3BDDA 4W1UA 3U9GA 4P55A 4NC7A 4K2EA 4AYBA 1B4AA 5EG0A 3K2AA 3ABMH 1ZKGA 1F5TA 1Y1WJ 1O7FA 4C2MJ 4BJ6C 1YW8A 1IG7A 4CXFA 3GVAA 4M9XA 2EV0A 2WY7Q 4EVIA 2E1OA 2E1CA 5B1BH 3MCZA 3CCYA 4CA0A 2NVXJ 3DPUA 3QYBA 2HOTA 1N25A 2VL8A 2VBWA 4GDFA 1BI3A 4FHTA 4KUMA 4FCYA 5DV5A 5J1RA 1R5ID 1MMAA 2DA4A 1ETWA 5EEGA 4DZJA 2VONA 2L9NA 2LBFA 3B02A 2EWNA 4A6EA 3OYAA 2M1BA 1YLFA 3SXYA 3FDYA 4PFOA 3L2VA 3GFJA 1HW1A 3SFIA 2E2HJ 3NEUA 4C9YA 3KZZA 4IHYA 1KQ9A 1ZARA 3DPTA 3LFKA 4NQWB 5LHGA 3P9CA 3D5SC 3ABTA 2MW8A 4LG3A 1J2XA 2M7BA 2B9SA 1PP8F 2H27A 2ZJPF 2UV1A 2PJPA 1HW5A 1MMDA 1Y0NA 3E5QA 3VSLA 1HKTA 3A52A 2E34A 4RDUA 1X19A 4DGWB 3GCMA 1RUOA 2NAZA 2KZVA 2QVOA 3K1MA 3RKXA 3OS1A 3DTIA 1XD7A 5JFRA 3MMYB 2XIGA 5KNLA 3OV8A 3KLNA 4LIUA 4A12A 4FETA 1QZYA 4IRIA 2ELHA 5CQEA 2B7EA 4Y52J 2FA5A 3PQJA 1UJ8A 4XLNF 1IN4A 4A3KJ 2IRFG 1X3UA 2P0WA 4E7KA 1XDUA 3WTUC 1HKSA 3UNGC 3BROA 4AYBN 2IP2A 2ETHA 2DT6A 2XAJA 2P0TA 1ONVA 3VFZA 4EEFG 4EGZA 1SMTA 1A04A 5D6FA 2EQRA 2LG4A 3J7ZI 4LB6B 2GOMA 3TL4X 4FTHA 1I1SA 4AD9A 5KAIC 5K5QA 2MD0A 4UB8C 3I5UA 3DKYA 3DEEA 3FXJA 1MBKA 1LB2A 4LLGF 5LGNA 1GT0C 4U0VA 2VKVA 3OL3A 2HZTA 4LD5A 3BCBA 1FOKA 2DA1A 2WC2A 1WKMA 1FBQA 4P1WA 1MW7A 1YE9A 4PJLA 1ZG5A 3AG2H 3L1PA 3Q0UA 5IP9J 3KX2A 3GFMA 3SQNA 3CDLA 5BQTA 3COAC 1H88C 4DBRA 1BI2A 3BR1A 3A01B 4IHWA 3TOBA 3S3OA 2B0LA 4XRFA 2LOOA 3LSHA 1FBUA 2JA5J 5L3EA 4MFDA 1BC8C 3OOUA 3CCSI 5LGTA 3Q3SA 5FLMJ 3BJAA 2F6CA 2IJLA 3OOPA 2Q2EA 3EPZA 3F9KA 4XORA 2PJRB 2CS3A 2DPDA 1UMQA 5IP6A 2HTJA 3KEQA 1GXQA 1ZREA 2VT3A 3OYIA 1M1EB 3FXQA 4QPQA 1SFKA 1YYVA 3E5UA 2JVGA 3OR1C 4HX7A 5BMZA 4OAYA 4IHXA 4A5MA 1ZGJA 4S05A 3PIOF 3PNTA 4MEXF 4WK8F 3CUQA 5FFXA 2L5QA 3FHNA 2ADUA 4UVBA 3ZMVA 3KP6A 2BHYA 5HS8A 1WH7A 2VJIA 1AWCA 1YJWI 1JTYA 2CSOA 5IY5H 1U2WA 3QODA 5M3MJ 3I59A 1FP2A 1T6SA 5J4VA 1NH3A 5JHFA 3GXOA 2HI3A 4KFCA 2LY2A 1WPKA 1JGSA 2A07F 4XNFA 5BPIA 1X1PA 3BP8A 4KIGA 1E3HA 1MMGA 1TWCJ 2CUFA 3F23A 2HEOA 1ZN2A 2KIFA 1G3TA 2X1DA 3D1NI 3A2KA 1R1UA 2AXLA 3JRIA 2WWYA 1K78B 1ZYRF 2VXZA 1UG2A 3HYIA 2EA4A 1Y8RB 1JE8A 1OCZH 4DYCA 4BACA 3DXJF 3R4KA 3S1QJ 3S1RJ 1S9HA 1LKXA 2V26A 4XN0A 2ZNZA 2ZJRF 3LQQA 3ZQQA 1X2NA 3CMYA 2JWTA 1ZAOA 1ZG3A 2ME6A 4NB5A 1MMNA 2EZHA 4RBOA 1QRYA 2CG4A 2OA4A 5FJ8J 3KIOA 2FBKA 2K40A 2O03A 4TV7A 4KN4X 4BKXA 3R61A 4XMYA 5LEKA 1IXCA 1ZHFA 4ENKA 1WQ2A 5GP9A 2WADA 5CKTA 3L2CA 2E7WA 4M74A 4U7DA 2VQLA 1Z1DA 2L7ZA 1HQCA 1XSXA 3BG6A 5ICGA 1GDTA 1J75A 5FKLA 2OV7A 4FX0A 1FYKA 3RPUD 5HNHA 5FLVA 2XUBA 1XCBA 2BEOA 2CYYA 1W1WE 1SFOJ 4A3LJ 2GA2A 4PSWA 4RLFA 1I3AA 2DA2A 4LLLA 2DK5A 4XL9A 5FKOA 2FEZA 2EFNA 4PUSA 5F08A 3A4CA 4W97A 4OIQF 2K9NA 5E1XA 5E1ZB 3DF8A 3FMSA 1HBXG 1OCPA 4UUTA 2P6TA 2QM3A 3KETA 1MMSA 4CZCA 3I4NJ 5H6RA 2DQRA 4IXAA 2X6YA 2VASA 3C2HA 3GZ6A 3JCUC 1QNTA 2W57A 2NXNB 1FPQA 1JT6A 3NWTA 2M3AA 3H92A 3HRUA 2VUMJ 4L9NA 3CJNA 1P7JA 2V9VA 3AG1H 3CZ6A 1J5YA 3SDGA 3N97A 4B43A 4L9VA 4RB1A 4B48A 1U0JA 2MLKA 3J7AO 1V54H 5HODA 1ZLJA 3I4MJ 1UAAA 4U0YA 1NK3P 3PUBA 4A3DJ 3EUHC 3E6DA 1Z6RA 3DBLB 5HS9A 3CF5F 4IF4A 1E2XA 1G3SA 1XMXA 2X4HA 3G3ZA 3FZVA 2EB7A 1G8XA 2WAFA 2YR2A 2W48A 1YI2I 2FMYA 4HQEA 3H5AA 2YX7A 3G1LA 3ZPLA 2CO5A 3BC8A 2CV2A 3TW6A 3BPXA 2HDCA 2NRAC 3GZNB 1RPWA 1TNSA 2P4WA 2R4GA 2XGXA 5HNFA 3VWBA 4HEA2 1Y1VJ 3IHUA 3AFHA 2EK5A 2DMNA 2FBHA 4IHTA 2XHKA 2RREA 1VQPI 1MJBA 2Y69H 2WAQN 3JRDA 3CC7I 3PNVA 1VNDA 1WGXA 2EBIA 4IRHA 4IPAA 2DI3A 1WFXA 1IO2A 2M8GX 2QWWA 4UV8A 1MNDA 1RKTA 2X85A 1GV2A 4UY8I 1Z0XA 3EYYA 4KMUX 3L2WA 2DQLA 3DBHB 2EV5A 1YS6A 3IWFA 5KVRA 4D9JA 2DW4A 3LSIA 1R9TJ 2XAHA 2Y31A 2E36A 1RIOH 1T33A 3MVPA 1B59A 2ESNA 2IEKA 4Z2YA 2RQPA 2QSHX 4BH9A 2CQKA 3FKIJ 1RC9A 1FMVA 1BIBA 3U1DA 3TQNA 3I54A 2XB0X 5TGTA 3RQ4A 2RN7A 2Z5UA 4M6VA 2HPIA 5J3LA 2XV4S 2VPLA 3GTPJ 4A3BJ 2ZJ2A 2M5WA 2YX4A 2IA0A 4HZFA 4XSXF 5GAHJ 5JVTA 2VODA 3MFKA 2I10A 3FHZA 1BBYA 2RV8A 2VBYA 2YPRA 4IHVA 5CVRA 3WTZA 3HRMA 5BOXA 1NK2P 4XQFA 2MBFA 3K4JA 3GF2A 3BR3A 4P5OA 3O3KA 3VOEA 2BW3B 2MLGA 4PCQA 2DA6A 2ZSIB 5HDNA 1WH5A 1POGA 3LNQA 4A2UA 2AQFA 3ESWB 2K27A 4JP0A 1NTCA 2HDWA 1K79A 3HUGB 3ULQB 5ILVA 3OYJA 3A01A 4N9HA 3DTKA 1U8RA 3CCJI 1Z7UA 2ZFUA 2AHQA 5ICEA 3P9IA 3BQZA 4L0ZB 5HLTA 4HAMA 2LY1A 2XF5A 3K4CA 1ZH5A 1AOYA 1G4DA 1FEXA 4RB2C 1WHUA 3ZQCA 3LSJA 1Z3XA 1VQOI 1SD4A 1HOMA 5TISC 2JVHA 2E35A 1T8IA 3HOYJ 2KQRA 4HQMA 2NYXA 3ZMDA 1N75A 1H9GA 3S14J 3BOQA 5KHDA 2GAUA 3ZN1A 2O8XA 3OYDA 1HCRA 2PMZN 3VYSB 2XPVA 3L2UA 4H0EA 1LE8A 3K1PA 1IXSB 1IN8A 1TWAJ 4I02A 2KJBA 4G8XA 5IT9Z 2ZMEC 1I6HJ 1JHFA 2G7HA 3PJRA 3Q5FA 2GZWA 2NVTJ 2FX0A 2OTJI 4JX4A 4Z6YA 3OYGA 4KA4A 1HLVA 5JLWA 1MSEC 3M3YJ 5EYRA 4BHBA 4BXFA 2EFPA 5FB2A 2JJ7A 2VI6A 5LD2C 1TWFJ 3EQLF 4MNUA 5K1YA 2A05A 1XDSA 2QQAA 4EATA 2JA6J 4BGDA 1ZLKA 3WTTC 3DU5A 4EJTA 4M3DA 5D6EA 1IF1A 5JR3A 2ECCA 2RGVA 3PO3J 3WTSC 2DA5A 2OCCH 5AONA 1TNTA 3I4PA 3H0GJ 3RIRA 1MD0A 1OISA 1W36D 4BEHB 2MFZA 4BEHA 6PAXA 2WY8Q 4C2TA 3IP4B 5B5EC 3JAMK 2LKXA 1QO0D 4PSXA 3MZYA 4A3FJ 3HOWJ 3DTEA 4Y4RA 1SVOA 2X6XA 3OYFA 3HC7A 3ZMZA 3CUQC 1MNMC 2M87A 1NHAA 3HTUA 4I76A 4E7JA 2NVUB 2KRHA 4AIHA 4XKWA 1SD7A 5F27A 4IQJA 3VYRB 1I3QJ 5D5VB 2RAEA 1KQ0A 2F5CA 2FF4A 1FSEA 4PJMA 1IUFA 2JSPA 4IOAF 4XKBA 2RC4A 3EYIA 1H8AC 2AXTC 3FK7A 2F4MB 2HPMA 2WB1N 3PM1A 4KISA 3VB2A 3BTLA 5F1JA 4I0BA 3C3WA 1A6IA 2P8TA 3KFWX 3PNYA 5F6FA 1QU3A 5J40A 2NS8A 4ZH4F 4ABZA 2BZTA 3JRGA 3H3VK 3OS2A 2PQ8A 2GOXB 1H0MA 2L7FP 2ZBKA 1S5LC 1PDNC 5GADJ 3J81R 3OYLA 4HNVA 1IXRC 3HGGA 1U3EM 4XIDA 3I55I 3JW4A 4MIMA 1RKWA 2DU9A 3RYRA 3CCRI 4HPQA 3IC7A 4KICA 4HBLA 5ICFA 1Y39A 2BY2A 2IS2A 2WV0A 4EJUA 2DOAA 1QHHD 2QA4I 5E17F 3OYBA 2OPTA 5DEQA 3CLQA 3HKZA 2LDUA 3M9AA 2V9PA 4ZJZA 1K4TA 3RZOJ 4CSWA 4CDGA 3I71A 3OWTA 3JRAA 1XS9A 2M34A 4IEJA 5B3SH 2FQ3A 2IVMA 3CMMA 5CVJA 4LJZF 2HOSA 1OPCA 4O6JA 3HHHA 2OAZA 2STTA 3W6VA 1LEAA 3OL4A 4ENJA 3FBNB 1X58A 4LG0A 1OYWA 4ZYDA 3GTJJ 4CO8A 1RR8C 2W4SA 2GXGA 2GXAA 1DU0A 1U5TC 3KLOA 4A3MJ 2WB1A 3GTQJ 5F64A 2CQXA 4F92B 1R7JA 5L3DA 3TEDA 3FM3A 2Z9OA 4BAYA 4OWRB 4CUGA 4XK4A 3OMYA 4JK1X 1FJLA 1Q1VA 2W85A 3P5JA 3QOEA 4ZTFA 3DEWA 3BCAA 1I5ZA 4PJJA 4BE2A 2KZGA 2L3DA 3RPQA 1I1GA 4LGWA 2M45A 5JLXA 3I56I 3C2BA 3TP0A 3E1SA 3AL0C 5CVVA 3J7AW 2KDZA 3L09A 2IS1A 3J7AY 2FNPA 4EGYA 4RAFA 2QQBA 2Z1DA 4XRSA 3JTGA 3SZGA 1IDZA 3HOXJ 3FX3A 2X51A 3I59B 5GPAA 3W3CA 4DJAA 4OU0A 1VQ6I 1U9OA 3QPHA 3SEQA 4ZZDA 4BQNA 1XMKA 3S16J 5DCFA 3S2DJ 2BY0A 4Q5SF 3PL8A 4ZTJA 4D1QA 2O6GE 2XF7A 5K7HA 1SFUA 4XLPF 5D5XB 4FQGA 2FSWA 3K10A 2L9SA 2OJED 3F8MA 1OMIA 3WTXC 2JSCA 1B8IA 4II3A 1S7EA 4LK1F 2O8KA 2Y48A 2DTRA 4HA8A 3DP7A 3QYFA 4L5IA 2EILH 4N0BA 3LL7A 2H94A 4KDPA 2VKHA 3CCMI 4CCOA 1XN7A 2EIKH 4JYKA 2XAFA 2DK8A 2Y2ZA 4O3MA 1BW6A 3K2ZA 3LWFA 2DJNA 2IW5A 2VOPA 2KIMA 3FF5A 4G6TB 4AU7A 4F52A 4KT5C 4BJ5C 2XAQA 4CCMA 2R0QC 4E7HA 4A3CJ 3QPLA 3QP5A 3ZQGA 2CUZA 5KCMA 4Q4ZF 1YRNA 3E6BA 4S04A 4LLNA 4UNOA 3OIQA 3H36A 2DA3A 2JUGA 1D3YA 3I3LA 4PJNA 3WTVC 1TT0A 2E71A 1DDNA 3MZ8A 3IAM2 5CLSA 3KP3A 2FXAA 2HVQA 1LJ9A 3K4BA 3QPSA 4OIRF 1YTYA 1IRFA 4U0WA 3J80R 5FRMA 3KP4A 4B3AA 3CJQB 1O3RA 1SFXA 3ZMTA 4HLYA 3DKXA 2LF7A 4XLCA 2VBXA 3BG7A 4XM3A 1EA3A 4FASD 4OIOF 5IYDJ 3DFGA 4HW0A 3V8LA 4EJWA 3D5RC 5K5OA 2R93J 4G7HF 1HDPA 2KLOA 1JUPA 4KT6A 5KK1A 1D1CA 1XGNA 1BL0A 2BXZA 2HYJA 2BY3A 2RKHA 1KYZA 2W82A 3FXOA 2G0EA 5KAFC 3BG3A 2KT0A 1JJ8C 3GFIA 1FYLA 3HG9A 4M6YA 3KP5A 5DD4A 3VODA 5FO5A 3RSNA 1O7LA 2K86A 4F91B 1QHGA 1XCVA 1FTZA 2MC3A 1DPRA 2EINH 4I98B 2PMHA 2H09A 5EEAA 3S3MA 1HF0A 1TL8A 4XKVA 1K7AA 4G7ZF 2DA7A 4ZDPA 2UUZA 1DP3A 3FM5A 1OJLA 5K7ZA 4QTRA 3HGYA 5LHIA 2O9LA 1LDDA 2RDPA 5M5WJ 1JHHA 2JPBA 2XGCA 4BDZA 2VB6A 4EMSA 3EUKL 2LNBA 3HSEA 4Y13A 1VZ0A 4NQWA 3ONQA 3U1KA 1JJ6C 1U8BA 1B72B 1OCOH 2KISA 2LH9A 2ACJA 4YFXF 1OKRA 2MA3A 3RJPA 2I5UA 2COMA 2HDDA 2QSFX 1O3SA 3S1NJ 2LBFB 3RKYA 1TW2A 4IRGA 4IZZA 1C0WA 1ITYA 2I8DA 2M0CA 3KEOA 4WXCA 5ERIA 3Q9VA 1UHWA 5H2FC 1V4RA 1BOAA 4E6KG 2DMPA 2MGQA 2Q1ZB 1XTAA 3CD6I 1TQIA 4V19K 3I58A 2LC2A 4C2UA 1RZ4A 3J80Z 1X1AA 2RNJA 3CESA 2FE3A 5J4YA 4ITVA 2GBYA 1LEBA 4M3FA 3E3VA 4A69C 2M4GA 2LRDA 5M5XJ 1SEUA 4ETSA 2CJJA 4I09A 4FE7A 3KZIC 2DOFA 2HGCA 2LYCA 4ASNA 1TBXA 4FISA 4A0XA 3G2BA 4GRIA 1D8KA 4XLEA 3K4NA 4B8XA 5E20A 2HQNA 2ISYA 3J81K 2LTPA 2MH2A 3VDXA 2IBDA 2P7CB 1A31A 3QWLA 3TOAA 4A5NA 1FYMA 1GVDA 2LVSA 4X0GA 1V3FA 4GYGA 3CCEI 4DW6A 4FT8A 2PEXA 4ENNA 1WZ2A 1SAUA 4RMNA 2VIXA 3KCCA 3FWEA 1CF7A 2VQCA 1HKQA 2CUJA 2NNYA 1BC7C 2BW3A 4XR6A 1D0YA 2MYSA 2LD5A 5DS9A 2E1MC 5IYCJ 5GAEJ 5L3CA 4JBAA 2X98A 1ZK8A 3F6VA 3TDUC 1ZR2A 3C18A 1RNLA 1RI7A 2LP0A 1R23A 2ID3A 4F93B 3JSPA 2JK3A 2KMUA 5H6QA 2DJIA 4R79A 2R5ZA 2CU7A 2MVTA 1LUJB 4RGRA 3H5NA 1WJAA 2K85A 4HV6A 4PGGA 5HS7A 2XF6A 2PG4A 2DAOA 3HPHA 1KU7A 4RS8A 4G94A 4EM2A 1E3OC 4LFUA 2LMDA 4C3IJ 2L7KA 4XOPA 4NHJA 1IAWA 1KU9A 3K69A 2V1UA 5HLGA 1R1TA 2BBYA 2EJRA 5DCMA 4HG2A 2A5WA 3OIOA 4B4CA 2AQEA 3RKWA 1D1AA 4MTDA 1DGWY 1T56A 2FMLA 3HXLA 1HXDA 1U9NA 5LGUA 2K3FA 2COBA 1BR2A 4ANJA 3WG9A 5B1AH 3G4SI 1OLTA 2DOEA 4EM1A 1U5TA 3A02A 1QPMA 2LLKA 1XPXA 5IYBJ 5J8FA 1FSHA 3RPUA 1S3JA 5HVQC 4G12A 5FROA 1Z05A 2RQQA 2M2EA 2R7FA 1BIAA 2LF8A 2Z2SB 4F3QA 1IUYA 4CICA 2X6OA 3CCUI 2F2EA 3CJRB 3BTIA 1GXPA 3HM5A 1R4MB 1IJWC 1SD5A 3IUOA 2LREA 2W24A 2CV0A 3GYHX 4RGSA 4DOZA 3TW7A 3ABUA 1K61A 1P4XA 2ELKA 3M8FA 3NAUA 3HPGA 2QYOA 1ZGWA 4CGZA 1MBFA 2JA7J 2OC6A 2A6EF 4CYCA 1BI0A 1P6RA 4GFBA 2R92J 4HRIA 4AIDA 2QZ8A 1TC3C 1YOVB 3FK6A 1FOYA 1PYVA 3W2AA 1JKRC 2R7QA 2A61A 1RQ6A 4BE1A 3GMEA 3CC2I 1F36A 1PP7U 3W2VA 4Y3OA 1VQ8I 4XOTA 4BNCA 5IT9K 4OAZA 2EFWA 3J7YJ 4ZC3A 4I2OA 4E4HA 4C30A 2FBIA 3K0LA 3NWSA 5CPRB 1ZELA 3F6OA 1H89C 3NQOA 4H4KC 5DYMA 1YIJI 1ZR4A 5JVGF 4QPOA 2IGNA 4ZZLA 1FBSA 1FX7A 2NS0A 2PX9A 4HLXA 5TJJA 3GTOJ 4V2GA 3ZMUA 2IA1A 2NOGA 4BU2A 2F4IA 3S2WA 4HDUA 2R7UA 2Y0SA 5LHHA 1USTA 4I6ZA 4N4OB 1YQAA 2CFOA 2MG4A 3P9KA 3LAPA 4L0YB 5E1WA 2R7DA 5E3LA 4YELA 2CFXA 4CHUA 2DMUA 2V1XA 1ON1A 1EH8A 2X1CA 2M8EA 4AC0A 5F0CA 2ZO4A 2Y0SN 3I64A 4J01A 3H35A 1KA8A 2V4JC 3LA3A 3ZQLA 3FXMA 2Y30A 5A2QR 2JUCA 2P7VB 2W7NA 1YO5C 4HYEA 2OF7A 3O6BB 2XGEA 4WCGA
chains in the Genus database with same CATH topology
1KYWA 2L4MA 4ESBA 2P5LC 3GW2A 3TKYA 1BN5A 4OINF 4MGRA 4I7HA 4UVAA 4M72A 1IN5A 3P7NA 1SMYF 4HF2A 3ELKA 2GXBA 2ZNYA 1VTNC 3MQ0A 2L02A 2FU4A 1XGOA 4M9ZA 1F9NA 4AIJA 2K4JA 3FXUA 3BPVA 4Q48A 1ZRDA 2VE8A 4RB3C 3GX4X 2G7UA 4UUVA 2AS5F 5BS6A 4ZYGA 3E6MA 3HRTA 5D4SA 1DUXC 3T5XA 3SZPA 4RGXA 4YIIA 3F8CA 2VC0A 3IRRA 3WU1B 2XASA 4UHTA 2PMUA 2A6HF 4GGGA 4WF2A 3HIFA 5FLXZ 2UXNA 3QPTA 1I27A 1R1VA 4XSZF 4BYYA 1B9MA 3HUGA 5E18F 2K7LA 1F4KA 1LQ1A 3F8FA 2HKXA 1Z6TA 3CUOA 3HTSB 3MWMA 3T1BA 4HOBA 1T2KA 2Z99A 2A69F 1YFHA 1KU3A 5BPDA 1JXSA 1WRJA 2OZUA 1PUEE 3C1DA 2P5KA 4GO1A 3G73A 4WXHA 2XVCA 1LDKB 4BHPA 4ZYEA 1YG2A 3WGHA 3R60A 3SZTA 2OQGA 2P6SA 1R00A 1W7PA 2OZ6A 2XROA 4P96A 4QLCU 1ZG1A 2TDXA 1D8JA 4EJOA 4HV5A 1ODDA 2L01A 3E5XA 3EUHA 1P4WA 1MDMB 4LG0B 4WX9A 3JAMZ 3IL2A 4Y15A 2XKPA 3QU6A 1L0OC 1EV7A 3DKWA 1USSA 2RVCA 3GO5A 4G7OF 4N9IA 1YIOA 2PFBA 3H3ZA 3GLXA 2JT1A 2O0YA 4PGHA 1TQPA 3V7RA 1XB4A 3QOPA 3WODF 4G6QA 1XSDA 4BXUA 3LA7A 3KP7A 3KZYA 2V1DA 3IRQA 2LSOA 2BGCA 4L5JA 3TDZC 1U78A 2FRHA 2FOKA 2HQRA 1BJAA 2V79A 2O3FA 3D5LA 3F72A 2IPQX 3LAJA 1O3QA 1XGMA 1YW9A 3ISPA 5D5UB 3MEXA 4IJAA 1G6NA 1S6LA 1B9NA 3BJ6A 3L9FA 4UXNA 1T39A 3ECHA 3IKVA 3W6KB 2GIVA 4JQFA 1UHMA 1LDJA 2DBBA 2QQ9A 2D45A 5HOOA 4LB5A 1W4MA 5J6XA 2YSRA 4EQQA 2IA2A 1U5TB 1MDMA 1BM9A 1WWXA 3V8KA 4YG2F 5DUIA 2DLLA 2K02A 2QBYA 3L7WA 3HSRA 4ENMA 2CW0F 2BE5F 3EETA 1QZZA 5HDGA 2Q8KA 1K6OA 3REOA 2PBIA 1J0RA 3HSFA 2M30A 5CVIA 2PI0A 1Q1HA 1GVJA 3ML6A 4RGUA 3WE3A 2EA2A 5ED4A 4E70A 5D8LB 3D0SA 3GUDA 1FNNA 3O2PE 3BJOA 3DPLC 2EV6A 3T8RA 4PDKA 3QP6A 2OU2A 5L3BA 2ZMEA 2ZKZA 4KN7X 3DQVC 2D1VA 5AIPA 2A68F 2J5OA 1HSJA 1P92A 1O57A 3ZQ7A 1SAXA 3TO9A 3LSTA 4M9SA 4D0PA 2A5YB 3ZMSA 3J80K 1FWZA 3LQRA 4KYWA 3FMQA 2QENA 5HLIA 3I53A 1TTYA 3QU3A 2KIUA 2K4BA 2DO7A 3NRVA 2ESHA 2Y75A 3QRFF 4WXDA 4R1HA 3CDHA 3WGGA 5TRDA 2H6CA 2HOEA 2LKPA 5FFZA 2OD5A 3VEPA 1MGTA 4L18B 2OBPA 4IHSA 5ILUA 4AIKA 3KP2A 1FZPB 2Q0OA 2H6BA 3CO7C 2X0LA 4MTEA 2VC1A 4A0ZA 5EEHA 1ULYA 1TW3A 3R6SA 3F22A 2VOOA 2QBYB 1B6AA 1XMAA 1S8NA 4O5VA 2UZKA 3HRSA 2R3SA 4DNCA 1J59A 4RB0A 4A0YA 3ECOA 4ZYHA 4QWQA 3GZ5A 1DP7P 4L9JA 1D5VA 5D4RA 3RI4A 5L3GA 3JTHA 3R0AA 3SHFA 3TO7A 2NNNA 1R58A 2VBZA 1MKMA 4CZZA 1P2FA 1UCRA 1B1BA 4MQ9F 1S7AA 2JTVA 3HOSA 1OYIA 3V8JA 3CLOA 3ROUA 2P5VA 2F5DA 4HDVA 4M6XA 2D2WA 2MH9A 5E8IA 3U2RA 4M73A 5DD8A 1MJAA 2E1NA 2Z3YA 1BI1A 1SD6A 4KIBA 3TO6A 2F5EA 2VN2A 4RAZA 5A2QK 2DPUA 4HX4A 2L54A 3IKTA 2DT5A 4AVPA 1J9IA 4UVCA 5E8GA 1S7OA 5LLQA 4HX8A 4IVNA 2JPCA 4LMYA 1W7PB 4P9UA 2BYVE 1R5HA 1K78A 2GWRA 1KU2A 4F7ZA 1H9TA 1STZA 4KMFA 3WE2A 3CTAA 3QAHA 1YS7A 3W6JB 4WWCA 2O61A 2FNAA 1G3YA 2HR3A 3N4MA 5IT3A 1QGPA 1GHCA 3KE2A 5JI6A 1KGSA 3F3XA 5A2QZ 2C6YA 3FXRA 4PZJA 3V7SA 3PFIA 4OMYA 1S29A 4P9FA 5CVUA 1WSUA 1G3WA 4CYDA 3PQKA 1IN6A 2V6CA 2MD5A 4OOIA 3ERED 3M7GA 3F8BA 4EM0B 2GA1A 2JZYA 5DCMB 2G9WA 1Z9CA 3RDIA 3Q9SA 3LA2A 1T98A 5FD5A 3C7JA 1IW7F 1REPC 1ON2A 4M71A 3M1EA 4UV9A 2PLYA 3DEUA 1L3LA 2Z33A 3B73A 3F8NA 2STWA 1UFMA 2VT2A 3M8EA 1TQMA 1MZBA 1UB9A 2JRTA 4XBFA 2CGPA 4YIFA 1SFEA 3DV8A 4MQVA 4I0AA 2HTSA 2J5PA 2XKOA 1CGPA 2ZFWA 1F1ZA 2D1HA 4Q47A 5JHUA 1W5SA 3GFLA 2UXXA 3TGNA 2ISZA 1FC3A 1MJ9A 5LBQA 1OYYA 1Z91A 2DFIA 5J8CA 4ESJA 1R5GA 2XRNA 1FY7A 1WI9A 2QUFA 1P4AA 1R22A 3F21A 1EH6A 3SFZA 2PN6A 3JSOA 3WGIA 1DPUA 3L00A 5LRSA 1HW2A 2W84A 2YU3A 5HLHA 4U88A 4DQ2A 4OMZA 4HF0A 1ZRCA 2HS5A 3RYPA 3I0TA 5K5RA 3CUQB 4MEYF 1HSTA 4G9YA 4EJVA 1J7KA 5F1RA 3BZ6A 1ZGAA 1QQIA 2KJCA 3T0YA 4KIFA 3MZHA 2HFHA 3V4GA 1Y0UA 3V7CA 5FLXK 2VE9A 5CYVA 1IRGA 4Y17A 4ESFA 2CWEA 3WTYC 4MHGA 4GCVA 2UWMA 3GEZA 4OIPF 2QLZA 2ZMEB 3EDPA 3WU0A 4LK0F 5ILSA 1QBJA 5FGMA 1EH7A 1IZ1A 1R36A 3E6CC 2WTEA 5AIQA 2EFOA 3ZN0A 1XSVA 1LVAA 2ZCWA 3MAJA 3BWGA 2F5FA 3HOTA 3H3UA 4ON0A 1FT9A 4EV0A 4GXOA 1FLIA 4BHCA 5LRRA 2XAGA 4BQAA 1E17A 4YFNF 2KKOA 2HWVA 2KRFA 2A3SA 1T0FA 3E97A 1XGSA 1LNWA 3FMRA 2GQQA 2BV6A 3HHGA 3CO6C 4I01A 3AAFA 4G6DA 4L9TA 1ZRFA 1I6XA 5LEJA 2HKOA 4U7BA 5DDGA 1U6GA 1YW7A 1IN7A 3J81Z 4HF1A 2HYGD 1KQ8A 3T8TA 3IWZA 5L3FA 2IT0A 2L4AA 1W5TA 2Y0MA 1T38A 1O3TA 5DUKA 4A6DA 4YFKF 2ZXJA 1W7PD 3K9TA 3ZP5A 5FD6A 4AWXB 4KNYA 3RTRA 3BY6A 1FP1D 2E7XA 2OQRA 2HYFA 1CF7B 5D5WB 1TLHB 3R0JA 5H20A 3GWZA 2EFQA 1OR7A 5CJ9A 4R8HA 4GYIA 4FX4A 4B09A 5D8KB 2W25A 5HDKA 1RUNA 3K1NA 3WTWC 3BDDA 3U9GA 4P55A 4K2EA 1B4AA 1F5TA 1O7FA 1YW8A 4CXFA 3GVAA 4M9XA 2EV0A 4EVIA 2E1CA 3MCZA 2VBWA 1BI3A 4FHTA 4KUMA 5DV5A 2VONA 5EEGA 3B02A 2EWNA 4A6EA 2M1BA 1YLFA 3SXYA 3GFJA 1HW1A 3NEUA 3KZZA 1KQ9A 1ZARA 3DPTA 3LFKA 5LHGA 3P9CA 3ABTA 1J2XA 1PP8F 2H27A 2PJPA 1HW5A 3E5QA 1HKTA 1RUOA 2NAZA 2QVOA 3K1MA 3RKXA 1XD7A 5JFRA 2XIGA 3OV8A 3KLNA 4A12A 1QZYA 4IRIA 2ELHA 2FA5A 3PQJA 4XLNF 2IRFG 1IN4A 1X3UA 1XDUA 3WTUC 1HKSA 3BROA 2IP2A 2ETHA 2XAJA 1ONVA 3VFZA 4EGZA 1SMTA 1A04A 5D6FA 4LB6B 1I1SA 4AD9A 5K5QA 3I5UA 1LB2A 4LLGF 5LGNA 4U0VA 2HZTA 4LD5A 1FOKA 2WC2A 1WKMA 1FBQA 1ZG5A 3GFMA 3SQNA 5BQTA 3COAC 1BI2A 3TOBA 2B0LA 4XRFA 1FBUA 5L3EA 1BC8C 5LGTA 3BJAA 2IJLA 3OOPA 2Q2EA 2DPDA 2HTJA 3KEQA 1GXQA 1ZREA 2VT3A 3FXQA 1YYVA 3E5UA 4HX7A 5BMZA 4A5MA 1ZGJA 4S05A 4MEXF 4WK8F 3CUQA 5FFXA 4UVBA 3ZMVA 2ADUA 3KP6A 5HS8A 1AWCA 2CSOA 1U2WA 3I59A 1FP2A 1T6SA 3GXOA 4KFCA 1JGSA 2A07F 5BPIA 3BP8A 4KIGA 3F23A 2HEOA 1ZN2A 2KIFA 1G3TA 1R1UA 2AXLA 2WWYA 1K78B 1ZYRF 2VXZA 3HYIA 2EA4A 1JE8A 3DXJF 3R4KA 2ZNZA 3LQQA 1ZAOA 1ZG3A 4NB5A 2CG4A 2OA4A 2FBKA 2O03A 4TV7A 4KN4X 3R61A 5LEKA 1IXCA 1ZHFA 4ENKA 1WQ2A 3L2CA 2E7WA 4M74A 4U7DA 1Z1DA 1HQCA 1XSXA 5ICGA 1J75A 4FX0A 1FYKA 2XUBA 1XCBA 2BEOA 2CYYA 2GA2A 4LLLA 2DK5A 2FEZA 2EFNA 4OIQF 5E1XA 5E1ZB 3DF8A 3FMSA 1HBXG 2P6TA 2QM3A 3KETA 5H6RA 2DQRA 4IXAA 3GZ6A 1QNTA 2W57A 1FPQA 3HRUA 3H92A 4L9NA 3CJNA 2V9VA 1J5YA 3N97A 4L9VA 4RB1A 3J7AO 2MLKA 1ZLJA 4U0YA 3E6DA 1Z6RA 5HS9A 4IF4A 1E2XA 1G3SA 2X4HA 3G3ZA 3FZVA 2EB7A 2YR2A 2FMYA 4HQEA 3ZPLA 2YX7A 2CO5A 3BPXA 2HDCA 2NRAC 1TNSA 2P4WA 2XGXA 3IHUA 2EK5A 2FBHA 4IHTA 2XHKA 1MJBA 5ICCA 4IPAA 4RAYA 4IRHA 2DI3A 2QWWA 4UV8A 3EYYA 4KMUX 2DQLA 2EV5A 1YS6A 3IWFA 5KVRA 2DW4A 2XAHA 1RIOH 1B59A 2ESNA 4Z2YA 2RQPA 4BH9A 2CQKA 1BIBA 3U1DA 3TQNA 3I54A 2RN7A 2Z5UA 2XV4S 2ZJ2A 2M5WA 2YX4A 2IA0A 4HZFA 4XSXF 5JVTA 2VODA 3MFKA 3FHZA 1BBYA 2RV8A 2VBYA 2YPRA 5CVRA 3WTZA 3HRMA 5BOXA 2MBFA 3GF2A 4P5OA 3O3KA 3VOEA 2MLGA 4PCQA 5HDNA 4A2UA 2K27A 1K79A 3ULQB 5ILVA 4N9HA 1U8RA 1Z7UA 5ICEA 3P9IA 4L0ZB 4HAMA 1ZH5A 1AOYA 1G4DA 4RB2C 1SD4A 3ZMDA 2NYXA 4HQMA 1H9GA 3BOQA 2GAUA 3ZN1A 2O8XA 4H0EA 3K1PA 1IXSB 1IN8A 4I02A 2KJBA 4G8XA 5IT9Z 1JHFA 2G7HA 3Q5FA 2GZWA 4KA4A 4BHBA 2EFPA 5FB2A 3EQLF 4MNUA 5K1YA 1XDSA 2QQAA 1ZLKA 3WTTC 4EJTA 5D6EA 1IF1A 5JR3A 2RGVA 3WTSC 5AONA 1TNTA 3I4PA 3RIRA 1MD0A 6PAXA 3JAMK 1QO0D 3MZYA 3ZMZA 3CUQC 2M87A 1NHAA 3HTUA 4AIHA 1SD7A 5D5VB 1KQ0A 2F5CA 2FF4A 1FSEA 2RC4A 3EYIA 3VB2A 4I0BA 3C3WA 2P8TA 3KFWX 5F6FA 4ZH4F 2PQ8A 1H0MA 2ZBKA 1PDNC 1IXRC 1U3EM 3JW4A 3RYRA 2DU9A 3IC7A 4KICA 4HBLA 5ICFA 2WV0A 4EJUA 5E17F 5DEQA 3M9AA 2LDUA 4CDGA 3I71A 2FQ3A 2IVMA 5CVJA 4LJZF 1OPCA 4O6JA 3HHHA 2OAZA 2STTA 1LEAA 4ENJA 4LG0A 1OYWA 4ZYDA 4CO8A 2GXGA 1U5TC 3KLOA 5F64A 1R7JA 5L3DA 3FM3A 2Z9OA 4BAYA 4JK1X 2W85A 1I5ZA 2L3DA 3RPQA 1I1GA 4LGWA 2M45A 5CVVA 3L09A 2FNPA 4EGYA 2QQBA 3JTGA 3FX3A 3I59B 4OU0A 3QPHA 4ZZDA 1XMKA 5DCFA 4Q5SF 2O6GE 1SFUA 4XLPF 5D5XB 2FSWA 3F8MA 3WTXC 1OMIA 2JSCA 4LK1F 2Y48A 2DTRA 4HA8A 3DP7A 4L5IA 4N0BA 2H94A 4KDPA 1XN7A 2XAFA 2DK8A 4O3MA 3K2ZA 3LWFA 2IW5A 2VOPA 2KIMA 3FF5A 4KT5C 2XAQA 3QP5A 4Q4ZF 3E6BA 4S04A 4LLNA 4UNOA 1DDNA 1D3YA 3WTVC 5CLSA 3KP3A 2FXAA 1LJ9A 4OIRF 1YTYA 1IRFA 4U0WA 3KP4A 1O3RA 1SFXA 3ZMTA 4HLYA 2LF7A 2VBXA 4OIOF 3DFGA 4HW0A 3V8LA 4EJWA 5K5OA 4G7HF 5KK1A 1XGNA 2RKHA 1KYZA 3GFIA 1FYLA 4M6YA 3KP5A 5DD4A 3VODA 5FO5A 1O7LA 2K86A 1XCVA 2MC3A 1DPRA 4I98B 2PMHA 2H09A 1K7AA 4G7ZF 3FM5A 5LHIA 1LDDA 2RDPA 1JHHA 2JPBA 4EMSA 2LNBA 3HSEA 4Y13A 4NQWA 2ACJA 4YFXF 1OKRA 2MA3A 3RJPA 2COMA 1O3SA 3RKYA 1TW2A 4IRGA 1C0WA 3KEOA 4WXCA 5ERIA 3Q9VA 1UHWA 1V4RA 1BOAA 1TQIA 3I58A 1RZ4A 3J80Z 2RNJA 2FE3A 1LEBA 3E3VA 4ETSA 4I09A 2HGCA 4ASNA 1TBXA 4A0XA 1D8KA 4B8XA 5E20A 2HQNA 2ISYA 3J81K 2MH2A 2P7CB 3TOAA 4A5NA 1FYMA 1V3FA 4GYGA 4FT8A 2PEXA 4ENNA 3KCCA 3FWEA 1CF7A 1HKQA 2NNYA 1BC7C 5L3CA 4JBAA 3F6VA 3TDUC 3C18A 1RNLA 1RI7A 1R23A 3JSPA 5H6QA 4R79A 4RGRA 4HV6A 4PGGA 5HS7A 2PG4A 2DAOA 1KU7A 4RS8A 4G94A 4EM2A 4LFUA 4NHJA 1IAWA 1KU9A 3K69A 2V1UA 5HLGA 1R1TA 2BBYA 2EJRA 5DCMA 3RKWA 4MTDA 2FMLA 1HXDA 5LGUA 3WG9A 4EM1A 1U5TA 1QPMA 5J8FA 1FSHA 3RPUA 1S3JA 5HVQC 1Z05A 2R7FA 1BIAA 2LF8A 1IUYA 4CICA 2F2EA 1GXPA 1SD5A 2W24A 3GYHX 4RGSA 3ABUA 1P4XA 3M8FA 4CGZA 2QYOA 2A6EF 1BI0A 1P6RA 2QZ8A 2A61A 1PP7U 4BNCA 5IT9K 2EFWA 4I2OA 2FBIA 3K0LA 3F6OA 3NQOA 5DYMA 4ZZLA 1FBSA 1FX7A 2NS0A 5TJJA 4HLXA 3ZMUA 2IA1A 3S2WA 4HDUA 5LHHA 1USTA 1YQAA 3P9KA 3LAPA 4L0YB 5E1WA 2R7DA 2CFXA 4CHUA 2V1XA 1ON1A 1EH8A 2M8EA 2ZO4A 3I64A 1KA8A 3LA3A 2P7VB 1YO5C 4HYEA 3O6BB 4WCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYW A;  2L4M A;  4ESB A;  2P5L C;  3GW2 A;  3TKY A;  1BN5 A;  4OIN F;  4MGR A;  4I7H A;  4UVA A;  4M72 A;  1IN5 A;  3P7N A;  1SMY F;  4HF2 A;  3ELK A;  2GXB A;  2ZNY A;  1VTN C;  3MQ0 A;  2L02 A;  2FU4 A;  1XGO A;  4M9Z A;  1F9N A;  4AIJ A;  2K4J A;  3FXU A;  3BPV A;  4Q48 A;  1ZRD A;  2VE8 A;  4RB3 C;  3GX4 X;  2G7U A;  4UUV A;  2AS5 F;  5BS6 A;  4ZYG A;  3E6M A;  3HRT A;  5D4S A;  1DUX C;  3T5X A;  3SZP A;  4RGX A;  4YII A;  3F8C A;  2VC0 A;  3IRR A;  3WU1 B;  2XAS A;  4UHT A;  2PMU A;  2A6H F;  4GGG A;  4WF2 A;  3HIF A;  5FLX Z;  2UXN A;  3QPT A;  1I27 A;  1R1V A;  4XSZ F;  4BYY A;  1B9M A;  3HUG A;  5E18 F;  2K7L A;  1F4K A;  1LQ1 A;  3F8F A;  2HKX A;  1Z6T A;  3CUO A;  3HTS B;  3MWM A;  3T1B A;  4HOB A;  1T2K A;  2Z99 A;  2A69 F;  1YFH A;  1KU3 A;  5BPD A;  1JXS A;  1WRJ A;  2OZU A;  1PUE E;  3C1D A;  2P5K A;  4GO1 A;  3G73 A;  4WXH A;  2XVC A;  1LDK B;  4BHP A;  4ZYE A;  1YG2 A;  3WGH A;  3R60 A;  3SZT A;  2OQG A;  2P6S A;  1R00 A;  1W7P A;  2OZ6 A;  2XRO A;  4P96 A;  4QLC U;  1ZG1 A;  2TDX A;  1D8J A;  4EJO A;  4HV5 A;  1ODD A;  2L01 A;  3E5X A;  3EUH A;  1P4W A;  1MDM B;  4LG0 B;  4WX9 A;  3JAM Z;  3IL2 A;  4Y15 A;  2XKP A;  3QU6 A;  1L0O C;  1EV7 A;  3DKW A;  1USS A;  2RVC A;  3GO5 A;  4G7O F;  4N9I A;  1YIO A;  2PFB A;  3H3Z A;  3GLX A;  2JT1 A;  2O0Y A;  4PGH A;  1TQP A;  3V7R A;  1XB4 A;  3QOP A;  3WOD F;  4G6Q A;  1XSD A;  4BXU A;  3LA7 A;  3KP7 A;  3KZY A;  2V1D A;  3IRQ A;  2LSO A;  2BGC A;  4L5J A;  3TDZ C;  1U78 A;  2FRH A;  2FOK A;  2HQR A;  1BJA A;  2V79 A;  2O3F A;  3D5L A;  3F72 A;  2IPQ X;  3LAJ A;  1O3Q A;  1XGM A;  1YW9 A;  3ISP A;  5D5U B;  3MEX A;  4IJA A;  1G6N A;  1S6L A;  1B9N A;  3BJ6 A;  3L9F A;  4UXN A;  1T39 A;  3ECH A;  3IKV A;  3W6K B;  2GIV A;  4JQF A;  1UHM A;  1LDJ A;  2DBB A;  2QQ9 A;  2D45 A;  5HOO A;  4LB5 A;  1W4M A;  5J6X A;  2YSR A;  4EQQ A;  2IA2 A;  1U5T B;  1MDM A;  1BM9 A;  1WWX A;  3V8K A;  4YG2 F;  5DUI A;  2DLL A;  2K02 A;  2QBY A;  3L7W A;  3HSR A;  4ENM A;  2CW0 F;  2BE5 F;  3EET A;  1QZZ A;  5HDG A;  2Q8K A;  1K6O A;  3REO A;  2PBI A;  1J0R A;  3HSF A;  2M30 A;  5CVI A;  2PI0 A;  1Q1H A;  1GVJ A;  3ML6 A;  4RGU A;  3WE3 A;  2EA2 A;  5ED4 A;  4E70 A;  5D8L B;  3D0S A;  3GUD A;  1FNN A;  3O2P E;  3BJO A;  3DPL C;  2EV6 A;  3T8R A;  4PDK A;  3QP6 A;  2OU2 A;  5L3B A;  2ZME A;  2ZKZ A;  4KN7 X;  3DQV C;  2D1V A;  5AIP A;  2A68 F;  2J5O A;  1HSJ A;  1P92 A;  1O57 A;  3ZQ7 A;  1SAX A;  3TO9 A;  3LST A;  4M9S A;  4D0P A;  2A5Y B;  3ZMS A;  3J80 K;  1FWZ A;  3LQR A;  4KYW A;  3FMQ A;  2QEN A;  5HLI A;  3I53 A;  1TTY A;  3QU3 A;  2KIU A;  2K4B A;  2DO7 A;  3NRV A;  2ESH A;  2Y75 A;  3QRF F;  4WXD A;  4R1H A;  3CDH A;  3WGG A;  5TRD A;  2H6C A;  2HOE A;  2LKP A;  5FFZ A;  2OD5 A;  3VEP A;  1MGT A;  4L18 B;  2OBP A;  4IHS A;  5ILU A;  4AIK A;  3KP2 A;  1FZP B;  2Q0O A;  2H6B A;  3CO7 C;  2X0L A;  4MTE A;  2VC1 A;  4A0Z A;  5EEH A;  1ULY A;  1TW3 A;  3R6S A;  3F22 A;  2VOO A;  2QBY B;  1B6A A;  1XMA A;  1S8N A;  4O5V A;  2UZK A;  3HRS A;  2R3S A;  4DNC A;  1J59 A;  4RB0 A;  4A0Y A;  3ECO A;  4ZYH A;  4QWQ A;  3GZ5 A;  1DP7 P;  4L9J A;  1D5V A;  5D4R A;  3RI4 A;  5L3G A;  3JTH A;  3R0A A;  3SHF A;  3TO7 A;  2NNN A;  1R58 A;  2VBZ A;  1MKM A;  4CZZ A;  1P2F A;  1UCR A;  1B1B A;  4MQ9 F;  1S7A A;  2JTV A;  3HOS A;  1OYI A;  3V8J A;  3CLO A;  3ROU A;  2P5V A;  2F5D A;  4HDV A;  4M6X A;  2D2W A;  2MH9 A;  5E8I A;  3U2R A;  4M73 A;  5DD8 A;  1MJA A;  2E1N A;  2Z3Y A;  1BI1 A;  1SD6 A;  4KIB A;  3TO6 A;  2F5E A;  2VN2 A;  4RAZ A;  5A2Q K;  2DPU A;  4HX4 A;  2L54 A;  3IKT A;  2DT5 A;  4AVP A;  1J9I A;  4UVC A;  5E8G A;  1S7O A;  5LLQ A;  4HX8 A;  4IVN A;  2JPC A;  4LMY A;  1W7P B;  4P9U A;  2BYV E;  1R5H A;  1K78 A;  2GWR A;  1KU2 A;  4F7Z A;  1H9T A;  1STZ A;  4KMF A;  3WE2 A;  3CTA A;  3QAH A;  1YS7 A;  3W6J B;  4WWC A;  2O61 A;  2FNA A;  1G3Y A;  2HR3 A;  3N4M A;  5IT3 A;  1QGP A;  1GHC A;  3KE2 A;  5JI6 A;  1KGS A;  3F3X A;  5A2Q Z;  2C6Y A;  3FXR A;  4PZJ A;  3V7S A;  3PFI A;  4OMY A;  1S29 A;  4P9F A;  5CVU A;  1WSU A;  1G3W A;  4CYD A;  3PQK A;  1IN6 A;  2V6C A;  2MD5 A;  4OOI A;  3ERE D;  3M7G A;  3F8B A;  4EM0 B;  2GA1 A;  2JZY A;  5DCM B;  2G9W A;  1Z9C A;  3RDI A;  3Q9S A;  3LA2 A;  1T98 A;  5FD5 A;  3C7J A;  1IW7 F;  1REP C;  1ON2 A;  4M71 A;  3M1E A;  4UV9 A;  2PLY A;  3DEU A;  1L3L A;  2Z33 A;  3B73 A;  3F8N A;  2STW A;  1UFM A;  2VT2 A;  3M8E A;  1TQM A;  1MZB A;  1UB9 A;  2JRT A;  4XBF A;  2CGP A;  4YIF A;  1SFE A;  3DV8 A;  4MQV A;  4I0A A;  2HTS A;  2J5P A;  2XKO A;  1CGP A;  2ZFW A;  1F1Z A;  2D1H A;  4Q47 A;  5JHU A;  1W5S A;  3GFL A;  2UXX A;  3TGN A;  2ISZ A;  1FC3 A;  1MJ9 A;  5LBQ A;  1OYY A;  1Z91 A;  2DFI A;  5J8C A;  4ESJ A;  1R5G A;  2XRN A;  1FY7 A;  1WI9 A;  2QUF A;  1P4A A;  1R22 A;  3F21 A;  1EH6 A;  3SFZ A;  2PN6 A;  3JSO A;  3WGI A;  1DPU A;  3L00 A;  5LRS A;  1HW2 A;  2W84 A;  2YU3 A;  5HLH A;  4U88 A;  4DQ2 A;  4OMZ A;  4HF0 A;  1ZRC A;  2HS5 A;  3RYP A;  3I0T A;  5K5R A;  3CUQ B;  4MEY F;  1HST A;  4G9Y A;  4EJV A;  1J7K A;  5F1R A;  3BZ6 A;  1ZGA A;  1QQI A;  2KJC A;  3T0Y A;  4KIF A;  3MZH A;  2HFH A;  3V4G A;  1Y0U A;  3V7C A;  5FLX K;  2VE9 A;  5CYV A;  1IRG A;  4Y17 A;  4ESF A;  2CWE A;  3WTY C;  4MHG A;  4GCV A;  2UWM A;  3GEZ A;  4OIP F;  2QLZ A;  2ZME B;  3EDP A;  3WU0 A;  4LK0 F;  5ILS A;  1QBJ A;  5FGM A;  1EH7 A;  1IZ1 A;  1R36 A;  3E6C C;  2WTE A;  5AIQ A;  2EFO A;  3ZN0 A;  1XSV A;  1LVA A;  2ZCW A;  3MAJ A;  3BWG A;  2F5F A;  3HOT A;  3H3U A;  4ON0 A;  1FT9 A;  4EV0 A;  4GXO A;  1FLI A;  4BHC A;  5LRR A;  2XAG A;  4BQA A;  1E17 A;  4YFN F;  2KKO A;  2HWV A;  2KRF A;  2A3S A;  1T0F A;  3E97 A;  1XGS A;  1LNW A;  3FMR A;  2GQQ A;  2BV6 A;  3HHG A;  3CO6 C;  4I01 A;  3AAF A;  4G6D A;  4L9T A;  1ZRF A;  1I6X A;  5LEJ A;  2HKO A;  4U7B A;  5DDG A;  1U6G A;  1YW7 A;  1IN7 A;  3J81 Z;  4HF1 A;  2HYG D;  1KQ8 A;  3T8T A;  3IWZ A;  5L3F A;  2IT0 A;  2L4A A;  1W5T A;  2Y0M A;  1T38 A;  1O3T A;  5DUK A;  4A6D A;  4YFK F;  2ZXJ A;  1W7P D;  3K9T A;  3ZP5 A;  5FD6 A;  4AWX B;  4KNY A;  3RTR A;  3BY6 A;  1FP1 D;  2E7X A;  2OQR A;  2HYF A;  1CF7 B;  5D5W B;  1TLH B;  3R0J A;  5H20 A;  3GWZ A;  2EFQ A;  1OR7 A;  5CJ9 A;  4R8H A;  4GYI A;  4FX4 A;  4B09 A;  5D8K B;  2W25 A;  5HDK A;  1RUN A;  3K1N A;  3WTW C;  3BDD A;  3U9G A;  4P55 A;  4K2E A;  1B4A A;  1F5T A;  1O7F A;  1YW8 A;  4CXF A;  3GVA A;  4M9X A;  2EV0 A;  4EVI A;  2E1C A;  3MCZ A;  2VBW A;  1BI3 A;  4FHT A;  4KUM A;  5DV5 A;  2VON A;  5EEG A;  3B02 A;  2EWN A;  4A6E A;  2M1B A;  1YLF A;  3SXY A;  3GFJ A;  1HW1 A;  3NEU A;  3KZZ A;  1KQ9 A;  1ZAR A;  3DPT A;  3LFK A;  5LHG A;  3P9C A;  3ABT A;  1J2X A;  1PP8 F;  2H27 A;  2PJP A;  1HW5 A;  3E5Q A;  1HKT A;  1RUO A;  2NAZ A;  2QVO A;  3K1M A;  3RKX A;  1XD7 A;  5JFR A;  2XIG A;  3OV8 A;  3KLN A;  4A12 A;  1QZY A;  4IRI A;  2ELH A;  2FA5 A;  3PQJ A;  4XLN F;  2IRF G;  1IN4 A;  1X3U A;  1XDU A;  3WTU C;  1HKS A;  3BRO A;  2IP2 A;  2ETH A;  2XAJ A;  1ONV A;  3VFZ A;  4EGZ A;  1SMT A;  1A04 A;  5D6F A;  4LB6 B;  1I1S A;  4AD9 A;  5K5Q A;  3I5U A;  1LB2 A;  4LLG F;  5LGN A;  4U0V A;  2HZT A;  4LD5 A;  1FOK A;  2WC2 A;  1WKM A;  1FBQ A;  1ZG5 A;  3GFM A;  3SQN A;  5BQT A;  3COA C;  1BI2 A;  3TOB A;  2B0L A;  4XRF A;  1FBU A;  5L3E A;  1BC8 C;  5LGT A;  3BJA A;  2IJL A;  3OOP A;  2Q2E A;  2DPD A;  2HTJ A;  3KEQ A;  1GXQ A;  1ZRE A;  2VT3 A;  3FXQ A;  1YYV A;  3E5U A;  4HX7 A;  5BMZ A;  4A5M A;  1ZGJ A;  4S05 A;  4MEX F;  4WK8 F;  3CUQ A;  5FFX A;  4UVB A;  3ZMV A;  2ADU A;  3KP6 A;  5HS8 A;  1AWC A;  2CSO A;  1U2W A;  3I59 A;  1FP2 A;  1T6S A;  3GXO A;  4KFC A;  1JGS A;  2A07 F;  5BPI A;  3BP8 A;  4KIG A;  3F23 A;  2HEO A;  1ZN2 A;  2KIF A;  1G3T A;  1R1U A;  2AXL A;  2WWY A;  1K78 B;  1ZYR F;  2VXZ A;  3HYI A;  2EA4 A;  1JE8 A;  3DXJ F;  3R4K A;  2ZNZ A;  3LQQ A;  1ZAO A;  1ZG3 A;  4NB5 A;  2CG4 A;  2OA4 A;  2FBK A;  2O03 A;  4TV7 A;  4KN4 X;  3R61 A;  5LEK A;  1IXC A;  1ZHF A;  4ENK A;  1WQ2 A;  3L2C A;  2E7W A;  4M74 A;  4U7D A;  1Z1D A;  1HQC A;  1XSX A;  5ICG A;  1J75 A;  4FX0 A;  1FYK A;  2XUB A;  1XCB A;  2BEO A;  2CYY A;  2GA2 A;  4LLL A;  2DK5 A;  2FEZ A;  2EFN A;  4OIQ F;  5E1X A;  5E1Z B;  3DF8 A;  3FMS A;  1HBX G;  2P6T A;  2QM3 A;  3KET A;  5H6R A;  2DQR A;  4IXA A;  3GZ6 A;  1QNT A;  2W57 A;  1FPQ A;  3HRU A;  3H92 A;  4L9N A;  3CJN A;  2V9V A;  1J5Y A;  3N97 A;  4L9V A;  4RB1 A;  3J7A O;  2MLK A;  1ZLJ A;  4U0Y A;  3E6D A;  1Z6R A;  5HS9 A;  4IF4 A;  1E2X A;  1G3S A;  2X4H A;  3G3Z A;  3FZV A;  2EB7 A;  2YR2 A;  2FMY A;  4HQE A;  3ZPL A;  2YX7 A;  2CO5 A;  3BPX A;  2HDC A;  2NRA C;  1TNS A;  2P4W A;  2XGX A;  3IHU A;  2EK5 A;  2FBH A;  4IHT A;  2XHK A;  1MJB A;  5ICC A;  4IPA A;  4RAY A;  4IRH A;  2DI3 A;  2QWW A;  4UV8 A;  3EYY A;  4KMU X;  2DQL A;  2EV5 A;  1YS6 A;  3IWF A;  5KVR A;  2DW4 A;  2XAH A;  1RIO H;  1B59 A;  2ESN A;  4Z2Y A;  2RQP A;  4BH9 A;  2CQK A;  1BIB A;  3U1D A;  3TQN A;  3I54 A;  2RN7 A;  2Z5U A;  2XV4 S;  2ZJ2 A;  2M5W A;  2YX4 A;  2IA0 A;  4HZF A;  4XSX F;  5JVT A;  2VOD A;  3MFK A;  3FHZ A;  1BBY A;  2RV8 A;  2VBY A;  2YPR A;  5CVR A;  3WTZ A;  3HRM A;  5BOX A;  2MBF A;  3GF2 A;  4P5O A;  3O3K A;  3VOE A;  2MLG A;  4PCQ A;  5HDN A;  4A2U A;  2K27 A;  1K79 A;  3ULQ B;  5ILV A;  4N9H A;  1U8R A;  1Z7U A;  5ICE A;  3P9I A;  4L0Z B;  4HAM A;  1ZH5 A;  1AOY A;  1G4D A;  4RB2 C;  1SD4 A;  3ZMD A;  2NYX A;  4HQM A;  1H9G A;  3BOQ A;  2GAU A;  3ZN1 A;  2O8X A;  4H0E A;  3K1P A;  1IXS B;  1IN8 A;  4I02 A;  2KJB A;  4G8X A;  5IT9 Z;  1JHF A;  2G7H A;  3Q5F A;  2GZW A;  4KA4 A;  4BHB A;  2EFP A;  5FB2 A;  3EQL F;  4MNU A;  5K1Y A;  1XDS A;  2QQA A;  1ZLK A;  3WTT C;  4EJT A;  5D6E A;  1IF1 A;  5JR3 A;  2RGV A;  3WTS C;  5AON A;  1TNT A;  3I4P A;  3RIR A;  1MD0 A;  6PAX A;  3JAM K;  1QO0 D;  3MZY A;  3ZMZ A;  3CUQ C;  2M87 A;  1NHA A;  3HTU A;  4AIH A;  1SD7 A;  5D5V B;  1KQ0 A;  2F5C A;  2FF4 A;  1FSE A;  2RC4 A;  3EYI A;  3VB2 A;  4I0B A;  3C3W A;  2P8T A;  3KFW X;  5F6F A;  4ZH4 F;  2PQ8 A;  1H0M A;  2ZBK A;  1PDN C;  1IXR C;  1U3E M;  3JW4 A;  3RYR A;  2DU9 A;  3IC7 A;  4KIC A;  4HBL A;  5ICF A;  2WV0 A;  4EJU A;  5E17 F;  5DEQ A;  3M9A A;  2LDU A;  4CDG A;  3I71 A;  2FQ3 A;  2IVM A;  5CVJ A;  4LJZ F;  1OPC A;  4O6J A;  3HHH A;  2OAZ A;  2STT A;  1LEA A;  4ENJ A;  4LG0 A;  1OYW A;  4ZYD A;  4CO8 A;  2GXG A;  1U5T C;  3KLO A;  5F64 A;  1R7J A;  5L3D A;  3FM3 A;  2Z9O A;  4BAY A;  4JK1 X;  2W85 A;  1I5Z A;  2L3D A;  3RPQ A;  1I1G A;  4LGW A;  2M45 A;  5CVV A;  3L09 A;  2FNP A;  4EGY A;  2QQB A;  3JTG A;  3FX3 A;  3I59 B;  4OU0 A;  3QPH A;  4ZZD A;  1XMK A;  5DCF A;  4Q5S F;  2O6G E;  1SFU A;  4XLP F;  5D5X B;  2FSW A;  3F8M A;  3WTX C;  1OMI A;  2JSC A;  4LK1 F;  2Y48 A;  2DTR A;  4HA8 A;  3DP7 A;  4L5I A;  4N0B A;  2H94 A;  4KDP A;  1XN7 A;  2XAF A;  2DK8 A;  4O3M A;  3K2Z A;  3LWF A;  2IW5 A;  2VOP A;  2KIM A;  3FF5 A;  4KT5 C;  2XAQ A;  3QP5 A;  4Q4Z F;  3E6B A;  4S04 A;  4LLN A;  4UNO A;  1DDN A;  1D3Y A;  3WTV C;  5CLS A;  3KP3 A;  2FXA A;  1LJ9 A;  4OIR F;  1YTY A;  1IRF A;  4U0W A;  3KP4 A;  1O3R A;  1SFX A;  3ZMT A;  4HLY A;  2LF7 A;  2VBX A;  4OIO F;  3DFG A;  4HW0 A;  3V8L A;  4EJW A;  5K5O A;  4G7H F;  5KK1 A;  1XGN A;  2RKH A;  1KYZ A;  3GFI A;  1FYL A;  4M6Y A;  3KP5 A;  5DD4 A;  3VOD A;  5FO5 A;  1O7L A;  2K86 A;  1XCV A;  2MC3 A;  1DPR A;  4I98 B;  2PMH A;  2H09 A;  1K7A A;  4G7Z F;  3FM5 A;  5LHI A;  1LDD A;  2RDP A;  1JHH A;  2JPB A;  4EMS A;  2LNB A;  3HSE A;  4Y13 A;  4NQW A;  2ACJ A;  4YFX F;  1OKR A;  2MA3 A;  3RJP A;  2COM A;  1O3S A;  3RKY A;  1TW2 A;  4IRG A;  1C0W A;  3KEO A;  4WXC A;  5ERI A;  3Q9V A;  1UHW A;  1V4R A;  1BOA A;  1TQI A;  3I58 A;  1RZ4 A;  3J80 Z;  2RNJ A;  2FE3 A;  1LEB A;  3E3V A;  4ETS A;  4I09 A;  2HGC A;  4ASN A;  1TBX A;  4A0X A;  1D8K A;  4B8X A;  5E20 A;  2HQN A;  2ISY A;  3J81 K;  2MH2 A;  2P7C B;  3TOA A;  4A5N A;  1FYM A;  1V3F A;  4GYG A;  4FT8 A;  2PEX A;  4ENN A;  3KCC A;  3FWE A;  1CF7 A;  1HKQ A;  2NNY A;  1BC7 C;  5L3C A;  4JBA A;  3F6V A;  3TDU C;  3C18 A;  1RNL A;  1RI7 A;  1R23 A;  3JSP A;  5H6Q A;  4R79 A;  4RGR A;  4HV6 A;  4PGG A;  5HS7 A;  2PG4 A;  2DAO A;  1KU7 A;  4RS8 A;  4G94 A;  4EM2 A;  4LFU A;  4NHJ A;  1IAW A;  1KU9 A;  3K69 A;  2V1U A;  5HLG A;  1R1T A;  2BBY A;  2EJR A;  5DCM A;  3RKW A;  4MTD A;  2FML A;  1HXD A;  5LGU A;  3WG9 A;  4EM1 A;  1U5T A;  1QPM A;  5J8F A;  1FSH A;  3RPU A;  1S3J A;  5HVQ C;  1Z05 A;  2R7F A;  1BIA A;  2LF8 A;  1IUY A;  4CIC A;  2F2E A;  1GXP A;  1SD5 A;  2W24 A;  3GYH X;  4RGS A;  3ABU A;  1P4X A;  3M8F A;  4CGZ A;  2QYO A;  2A6E F;  1BI0 A;  1P6R A;  2QZ8 A;  2A61 A;  1PP7 U;  4BNC A;  5IT9 K;  2EFW A;  4I2O A;  2FBI A;  3K0L A;  3F6O A;  3NQO A;  5DYM A;  4ZZL A;  1FBS A;  1FX7 A;  2NS0 A;  5TJJ A;  4HLX A;  3ZMU A;  2IA1 A;  3S2W A;  4HDU A;  5LHH A;  1UST A;  1YQA A;  3P9K A;  3LAP A;  4L0Y B;  5E1W A;  2R7D A;  2CFX A;  4CHU A;  2V1X A;  1ON1 A;  1EH8 A;  2M8E A;  2ZO4 A;  3I64 A;  1KA8 A;  3LA3 A;  2P7V B;  1YO5 C;  4HYE A;  3O6B B;  4WCG A; 
#chains in the Genus database with same CATH topology
 3EUA A;  3JRE A;  1KYW A;  2L4M A;  2ZSH B;  4ESB A;  2P5L C;  4A3G J;  3GW2 A;  3TKY A;  2HNH A;  2OCE A;  2TRT A;  1AU7 A;  2VQG A;  3ZRG A;  4XIC A;  3ZXS A;  4AVZ A;  1BN5 A;  4NUB A;  2VQH A;  4OIN F;  3VYT B;  4MGR A;  4I7H A;  4UVA A;  4M72 A;  1IN5 A;  3P7N A;  1SMY F;  4HF2 A;  1I39 A;  1OFC X;  3ELK A;  1WJ5 A;  2EIM H;  2Y9Y A;  2HVR A;  1MH3 A;  2L9R A;  2GXB A;  3HDD A;  2ZNY A;  2IGO A;  1Y6I A;  4PK4 A;  1VTN C;  1ZQ3 P;  3OY9 A;  5GPC A;  3CME I;  3QYE A;  5F0H A;  4FE4 A;  1LFU P;  2GLO A;  3MQ0 A;  1SAN A;  2E19 A;  2L02 A;  1A5J A;  2FU4 A;  2PJR A;  1XGO A;  3OYN A;  3GTK J;  4M9Z A;  1F9N A;  3O8H A;  4AIJ A;  2K4J A;  3FXU A;  3BPV A;  2HQA A;  2ID6 A;  4Q48 A;  1ZRD A;  2VE8 A;  1X1D A;  3AL0 B;  2M7A A;  3GBG A;  3K4M A;  4XN3 A;  4BXX J;  4RB3 C;  4M3E A;  2Y9Z A;  3GX4 X;  1PUF B;  4M3G A;  4ZDL A;  2G7U A;  4UUV A;  2AS5 F;  4HNU A;  4IOC F;  5BS6 A;  4ZYG A;  1Y8Q B;  3HRT A;  3E6M A;  5D4S A;  1DUX C;  3T5X A;  1VQ7 I;  4B44 A;  1YX3 A;  2HXI A;  3SZP A;  4RGX A;  4YII A;  3ZR8 X;  1VQK I;  2QSG X;  1D1B A;  3F8C A;  1I50 J;  2VC0 A;  1IV6 A;  3IRR A;  3WU1 B;  2R5Y B;  2XAS A;  4UHT A;  2JQ7 A;  3S1M J;  5EJC A;  2DDB A;  1YJN I;  2PMU A;  2FUG 2;  2A6H F;  1RET A;  4GGG A;  1OCT C;  2XSJ C;  2GM4 A;  4WF2 A;  1AKH A;  3CF2 A;  4DIQ A;  1X1B A;  3HIF A;  5FLX Z;  2UXN A;  1T08 B;  3QPT A;  2H8W A;  3WHC A;  1I27 A;  1R1V A;  4A93 J;  3W2W A;  3OS0 A;  2IAI A;  4XSZ F;  2DMQ A;  1QVU A;  3LOC A;  4BYY A;  1B9M A;  2WAE A;  3HUG A;  4HSR A;  5E18 F;  1CQT A;  2K7L A;  3FBI B;  3Q0W A;  4BE0 A;  1F4K A;  1LQ1 A;  2BVL A;  2CUE A;  3F8F A;  2MAB A;  2HKX A;  1Z6T A;  3CUO A;  3HTS B;  3HOZ J;  3MWM A;  2E1M B;  3T1B A;  4HOB A;  1T2K A;  2Z99 A;  2A69 F;  2MZ4 A;  1YFH A;  5EZH A;  3IH4 A;  3FIW A;  1KU3 A;  5BPD A;  1JXS A;  1WRJ A;  5BNG A;  2YU9 J;  5DM7 F;  3H5R A;  2OZU A;  1PUE E;  3C1D A;  1YIT I;  2CH0 A;  2H1K A;  2P5K A;  2K9Q A;  4GO1 A;  4Y33 A;  3G73 A;  2M9H A;  1G2H A;  4WXH A;  3VSK A;  1BOB A;  2XVC A;  1LDK B;  2VJ5 A;  4BHP A;  4ZYE A;  1YG2 A;  5FRN A;  1VF9 A;  3H9G A;  2X1E A;  3OYM A;  3WGH A;  1ETX A;  3PIP F;  2ICW G;  2E2I J;  4J00 A;  1P9Q C;  1W36 C;  2KDO A;  3R60 A;  1ETY A;  1MBE A;  3SZT A;  1E3P A;  3CQZ J;  2OQG A;  2P6S A;  4ZDO A;  3BLY A;  1FTT A;  3S93 A;  2XRL A;  1R00 A;  1MIJ A;  1W7P A;  2OZ6 A;  2XRO A;  4BY1 J;  5IPA A;  4P96 A;  4QLC U;  1ENH A;  5EZG A;  1ZG1 A;  2TDX A;  1D5Y A;  2E5N A;  1D8J A;  4EJO A;  4HV5 A;  1ODD A;  3WHB A;  2B63 J;  5GAG J;  2QCO A;  2L01 A;  4II2 A;  3E5X A;  3EUH A;  1B72 A;  2QEX I;  1P4W A;  2XDV A;  1MDM B;  4LG0 B;  4WX9 A;  3JAM Z;  2X48 A;  4MLO A;  3IL2 A;  3OR2 C;  1JT0 A;  4Y15 A;  2DTZ A;  2XKP A;  5FKN A;  3QU6 A;  2OUM A;  5E3M A;  3HZJ A;  1L0O C;  1EV7 A;  3DKW A;  3DLL F;  1USS A;  2FD5 A;  2RVC A;  2CW7 A;  2P81 A;  3GO5 A;  1QA6 A;  4G7O F;  3VYU B;  3BT9 A;  2HXO A;  4YEJ A;  4N9I A;  2WV1 A;  1YIO A;  2PFB A;  2VPR A;  2X6W A;  4DZP A;  1YHQ I;  3H3Z A;  4KIT B;  3OYE A;  3GLX A;  2JT1 A;  2O0Y A;  4PGH A;  1TQP A;  3V7R A;  2NOJ B;  1XB4 A;  3QOP A;  3WOD F;  5E3N A;  2DXI A;  1S72 I;  3K70 C;  2CQN A;  4G6Q A;  1Z7L A;  1XSD A;  4BXU A;  4BJT A;  3LA7 A;  3KP7 A;  3KZY A;  2V1D A;  3ABK H;  3ASO H;  3IRQ A;  2LSO A;  1Y56 A;  2BGC A;  4L5J A;  2IGM A;  2H1L A;  3TDZ C;  2ZXH A;  1U78 A;  2TCT A;  1BR4 A;  1T0F C;  4X6A J;  3JR9 A;  2FRH A;  1JKO C;  4YIR X;  2FOK A;  1D0Z A;  4CCJ A;  2HQR A;  1BJA A;  2V79 A;  2O3F A;  3D5L A;  3F72 A;  2IPQ X;  2L0K A;  1FOX A;  1WVR A;  3MN2 A;  3NAR A;  1ETV A;  3LAJ A;  1O3Q A;  1XGM A;  1YW9 A;  2QKM B;  3ISP A;  2F4O B;  5D5U B;  3MEX A;  2M0M A;  4IJA A;  3F0C A;  3CCV I;  1G6N A;  1S6L A;  3JRC A;  3CP8 A;  1VQL I;  1ERD A;  3HL2 A;  1R4N B;  4LIV A;  2R7S A;  3DCF A;  1B9N A;  3BJ6 A;  3L9F A;  4UXN A;  1T39 A;  5J1Y A;  3ECH A;  4UUS B;  2CQQ A;  3H9Q A;  3IKV A;  5IOZ A;  3IAS 2;  3W6K B;  2DYR H;  2GIV A;  2K9L A;  4JQF A;  3OSG A;  5F0F A;  1UHM A;  1Z67 A;  2XAU A;  1LDJ A;  2DBB A;  2QQ9 A;  1K4S A;  5C4J J;  2D45 A;  3RCO A;  5HOO A;  3WU2 C;  3RQI A;  4LB5 A;  1W4M A;  5J6X A;  2YSR A;  3AG3 H;  4EQQ A;  2IA2 A;  1UG0 A;  1Z21 A;  1IRX A;  1U5T B;  1NG7 A;  3V42 A;  1MDM A;  1BM9 A;  5DM6 F;  2LK2 A;  1BJZ A;  1WWX A;  4XLA A;  3V8K A;  3S3N A;  3CDI A;  2DFH A;  3A0B C;  4YG2 F;  2DLL A;  2K02 A;  5DUI A;  2QBY A;  3L7W A;  3GTM J;  3S2H J;  3HSR A;  4ENM A;  4IO9 F;  4I99 C;  2DN0 A;  1GV5 A;  2CW0 F;  2BE5 F;  5M5Y J;  2L9V A;  3EET A;  1QZZ A;  5HDG A;  4BDY A;  1V5E A;  2O5R A;  2Q8K A;  1K6O A;  1WJE A;  3REO A;  4C3J J;  3CC4 I;  1LFP A;  1UZC A;  2PBI A;  1J0R A;  3HSF A;  2M30 A;  5CVI A;  2PI0 A;  5E79 C;  1TWH J;  2QQ8 A;  1Q1H A;  2WA0 A;  1GVJ A;  3ML6 A;  1PJR A;  4RGU A;  1VQN I;  3BG9 A;  2EA2 A;  3WE3 A;  5ED4 A;  4E70 A;  4E7Z A;  5D8L B;  3D0S A;  3GUD A;  2HVS A;  4XRS G;  3LSP A;  4C3H J;  1FNN A;  3BZC A;  4HST A;  3O2P E;  4CH7 A;  3BJO A;  3DPL C;  3TMO A;  2EV6 A;  3T8R A;  2L2O A;  4PDK A;  3QP6 A;  2OU2 A;  3KPH A;  5L3B A;  3IV5 A;  2ZME A;  1X4P A;  3VPR A;  1YX5 A;  1JUM A;  2ZKZ A;  4KN7 X;  3DQV C;  2D1V A;  5AIP A;  3BTC A;  2A68 F;  2J5O A;  1F43 A;  5J1U A;  2R7O A;  1HSJ A;  1P92 A;  1O57 A;  1RES A;  3ZQ7 A;  1SAX A;  3TO9 A;  2Q2E B;  3LST A;  2KIQ A;  3KYC B;  4LOC A;  4M9S A;  1X3W B;  5F04 A;  4HNT A;  3C2G A;  4XLH A;  4D0P A;  2A5Y B;  3ZMS A;  3J80 K;  5EGO A;  2E60 A;  1IV8 A;  4L5E A;  2F48 A;  1FWZ A;  3LQR A;  4X1E A;  1KZH A;  3SEZ A;  4KYW A;  3FMQ A;  5IOY A;  4A3E J;  2NVQ J;  2QEN A;  5HLI A;  3MKZ A;  4D5F A;  3M4O J;  3DU6 A;  3I53 A;  1TTY A;  3QU3 A;  5GTH C;  3RZD J;  2KIU A;  2ME0 A;  4AM3 A;  2FQ4 A;  2K4B A;  2ZB9 A;  1AKH B;  2DFF A;  2DO7 A;  3G1M A;  2ESH A;  3MD2 A;  3NRV A;  1R71 A;  2Y75 A;  3TBI A;  1LPQ A;  3QRF F;  4WXD A;  4R1H A;  1IDY A;  1WJB A;  2X9D A;  3CDH A;  3WGG A;  5TRD A;  2H6C A;  3ERM A;  2VKD A;  2HOE A;  2LKP A;  2M35 A;  5FFZ A;  2Z16 A;  2OD5 A;  3VEP A;  1MGT A;  1GUU A;  2DT7 B;  4L18 B;  2OTL I;  2OBP A;  4IHS A;  5DTD A;  5ILU A;  3G6E I;  4AIK A;  3KP2 A;  3JRH A;  3HKZ N;  2Q0O A;  1FZP B;  2H6B A;  1RR7 A;  3HOU J;  4PJ0 C;  3CO7 C;  2E2J J;  2V9K A;  2CMP A;  2X0L A;  4MTE A;  2VC1 A;  2XB5 A;  4A0Z A;  5EEH A;  4XRM A;  2XPU A;  2EIJ H;  1ULY A;  3LMM A;  4BL0 B;  3CCL I;  2D5V A;  1FMW A;  1TW3 A;  1VFC A;  1QZE A;  3R6S A;  3F22 A;  1HDD C;  2VOO A;  3S15 J;  2QBY B;  1B6A A;  3GLL A;  1XMA A;  1S8N A;  4O5V A;  2UZK A;  3ZQI A;  3HRS A;  2R3S A;  3ABL H;  2XGD A;  4DNC A;  1J59 A;  1VQ4 I;  4RB0 A;  4A0Y A;  3ECO A;  4ZYH A;  4QWQ A;  4ZYA A;  3GZ5 A;  1FIP A;  1DP7 P;  4L9J A;  1D5V A;  2KL4 A;  2HU9 A;  5D4R A;  2DCE A;  5LFA A;  1MH4 A;  2MC4 A;  3RI4 A;  3MKL A;  5L3G A;  2FJ1 A;  1J09 A;  3JTH A;  2K3P A;  2LR8 A;  3R0A A;  1TZL A;  3PFY A;  3SHF A;  1N78 A;  1R6R A;  3TO7 A;  3ZQH A;  2NNN A;  3OYC A;  1ETQ A;  1R58 A;  2VBZ A;  4PFP A;  4RLQ A;  1MKM A;  2JN6 A;  3BR6 A;  4CZZ A;  5EDN A;  3U21 A;  2EH3 A;  3SYT A;  1P2F A;  1UCR A;  2JMW A;  4JX5 A;  2CW8 A;  2W00 A;  1B1B A;  4MQ9 F;  1S7A A;  3AG4 H;  4JX6 A;  1AHD P;  3BZK A;  1LE8 B;  2JTV A;  3UR3 C;  4DYR A;  3HOS A;  1OYI A;  3V8J A;  3CLO A;  3ROU A;  5M3F J;  5J47 A;  1VI0 A;  2P5V A;  1OCR H;  2F5D A;  1MBG A;  4HDV A;  4M6X A;  2D2W A;  3RKQ A;  2MH9 A;  5E8I A;  1LVK A;  3U2R A;  2CRG A;  1APL C;  4M73 A;  5DD8 A;  1MJA A;  2E1N A;  2Z3Y A;  1MSF C;  2KHM A;  1BI1 A;  1V5G A;  1XG1 A;  1IGN A;  1FIA A;  3LSG A;  1P7I A;  4E7S A;  1MBJ A;  1SD6 A;  4DYQ A;  3G71 I;  4KIB A;  1ZTR A;  3TO6 A;  2BHZ A;  4A3J J;  1BW5 A;  3PSI A;  5C44 J;  3OYH A;  2F5E A;  2BY1 A;  4BQQ A;  3H0D A;  2VN2 A;  2HOA A;  1DU6 A;  4RAZ A;  3H9J A;  2R7V A;  5A2Q K;  3LSM A;  2DPU A;  3BQY A;  4HX4 A;  2L54 A;  3IKT A;  3E0J B;  2DT5 A;  2KPM A;  2QGU A;  3HEF A;  4AVP A;  1J9I A;  4UVC A;  5E8G A;  3IH3 A;  3HJE A;  2MUN A;  1S7O A;  5LLQ A;  4HX8 A;  4IVN A;  4B47 A;  2QF7 A;  1AA7 A;  2ELJ A;  1IRZ A;  3HBL A;  2JPC A;  1O4X A;  2EZL A;  4LMY A;  1W7P B;  1B8I B;  1WCM J;  4P9U A;  2BYV E;  3QQA A;  1R5H A;  1K78 A;  2R7R A;  3G1O A;  5CQG A;  2GWR A;  3H1C A;  2M4K A;  1KU2 A;  4F7Z A;  1H9T A;  1STZ A;  2NS7 A;  3N05 A;  2VLA A;  2BXY A;  4KMF A;  3WE2 A;  4D5C A;  5FLX R;  1EJ9 A;  3CTA A;  3OIP A;  3QAH A;  1N77 A;  2LFB A;  1YS7 A;  5EF6 A;  3W6J B;  4WWC A;  3K4K A;  2FNA A;  2O61 A;  2EZK A;  1G59 A;  1G3Y A;  2HR3 A;  4RA2 A;  3N4M A;  5IT3 A;  5IT9 R;  4RM3 A;  1D0X A;  1QGP A;  1GHC A;  3B6A A;  1MBH A;  3KE2 A;  3KYL A;  5JI6 A;  1X3Z B;  1KGS A;  3F3X A;  1OQY A;  5A2Q Z;  2C6Y A;  2K9S A;  4YRV A;  1TP4 A;  2XC7 A;  1WJF A;  2YUS A;  3FXR A;  2QKL B;  1DQU A;  4PZJ A;  3V7S A;  2IS4 A;  3PFI A;  2R7T A;  4OMY A;  1S29 A;  2LY9 A;  4P9F A;  4QSH A;  5CVU A;  1WSU A;  3B6C A;  2R7Z J;  1G3W A;  4CCK A;  1EKE A;  4CYD A;  3PQK A;  1IN6 A;  2V6C A;  3MKW B;  3A03 A;  2MD5 A;  3JRF A;  4OOI A;  3ERE D;  3ZOB A;  1JKP C;  1XX5 A;  3M7G A;  3K4L A;  3F8B A;  4EM0 B;  2GA1 A;  2JZY A;  2WBM A;  3KYD B;  3LSK A;  4MFE A;  1BA5 A;  4KJZ A;  1A35 A;  5DCM B;  2G9W A;  2MSY A;  1Z9C A;  1UHS A;  3RDI A;  1VQM I;  3Q9S A;  4UUS A;  3LA2 A;  1T98 A;  2CQ7 A;  5FD5 A;  3Q0V A;  2N8G A;  3C7J A;  1IW7 F;  1REP C;  1ON2 A;  4M71 A;  3M1E A;  4UV9 A;  2PLY A;  3LSR A;  3DEU A;  2R5Y A;  1OR7 C;  1L3L A;  3JAM R;  2Z33 A;  1RRJ A;  1UEL B;  3B73 A;  3F8N A;  1A36 A;  2STW A;  5C4X J;  1UFM A;  2VT2 A;  3M8E A;  1EF4 A;  1TQM A;  3MKY B;  2H8R A;  4UB6 C;  1MZB A;  1UB9 A;  2JRT A;  1ETK A;  3SJM A;  2FOW A;  3WG7 H;  2EZI A;  4XON A;  3CP2 A;  4XBF A;  4E7L A;  3OSF A;  1PUF A;  2CGP A;  4YIF A;  1HC8 A;  1SFE A;  3DV8 A;  4MQV A;  4I0A A;  4U87 A;  3JRB A;  2HTS A;  2J5P A;  2XKO A;  4IKF A;  4NC8 A;  2ZFW A;  1CGP A;  1SVL A;  4F55 A;  1F1Z A;  2D1H A;  1X1C A;  4Q47 A;  1W0U A;  1DGR M;  2E5Z A;  1W5S A;  5JHU A;  5ICC A;  3GFL A;  3GTL J;  1QPI A;  2UXX A;  3TGN A;  2ISZ A;  1FC3 A;  1MJ9 A;  1PVE A;  2IGK A;  5LBQ A;  3M1C A;  2R7X A;  5E3O A;  1OYY A;  2K5C A;  1Z91 A;  1WI3 A;  2AO9 A;  1Z3Y A;  2DFI A;  2HZD A;  3TP3 A;  2BOL A;  5J8C A;  4ESJ A;  2DFE A;  1R5G A;  2XRN A;  1FY7 A;  1WI9 A;  1R49 A;  4DBQ A;  1W0T A;  1NG6 A;  2QUF A;  1P4A A;  1R22 A;  1HA8 A;  3F21 A;  2JA2 A;  1EH6 A;  3SFZ A;  2PN6 A;  2CV1 A;  3DWL E;  1A6Q A;  3JSO A;  1W5C C;  3WGI A;  3IH2 A;  3K6G A;  5IP7 J;  5K7F A;  4A3I J;  1DPU A;  3A0H C;  2ZXI A;  3DLA A;  3L00 A;  2HQ5 A;  3BR2 A;  3PO2 J;  2VJJ A;  1OCC H;  3M8J A;  5LRS A;  1JI8 A;  1HW2 A;  4BUP A;  2W84 A;  2YU3 A;  5HLH A;  9ANT A;  4U88 A;  2R7W A;  4DQ2 A;  4OMZ A;  4HF0 A;  3BTJ A;  1ZRC A;  2HS5 A;  3RYP A;  2ZXW H;  3I0T A;  1ETO A;  2ZJQ F;  1SC7 A;  4BS9 A;  1K6Y A;  3ASN H;  4IX7 A;  5K5R A;  4MO7 A;  3CUQ B;  4J19 A;  4MEY F;  2KFD A;  1HST A;  2IS6 A;  3I9V 2;  4G9Y A;  4EJV A;  1ACI A;  3DBR B;  1J7K A;  1JTX A;  2O7O A;  2YS9 A;  5F1R A;  3BZ6 A;  1ZGA A;  1QQI A;  2KJC A;  4NC6 A;  5EGO B;  3T0Y A;  4D7M A;  1VQ5 I;  4KIF A;  3MZH A;  3BR5 A;  3PSF A;  2HFH A;  3V4G A;  3PUF A;  1Y0U A;  3V7C A;  2RNG A;  5FKK A;  4N4N B;  3E7L A;  3L2Q A;  5FLX K;  2VE9 A;  1QVT A;  3CMA I;  5CYV A;  1IRG A;  4Y17 A;  4ESF A;  2CWE A;  3WTY C;  2LKS A;  4MHG A;  1WJD A;  3SDB A;  3FKJ A;  4GCV A;  1JKQ C;  1ORK A;  4LIT A;  2UWM A;  4V2F A;  2F5V A;  3GEZ A;  4OIP F;  5GTI C;  2QLZ A;  1SVM A;  2EPF A;  3A1Y A;  3FIS A;  2XSD C;  3AKZ A;  1TT5 B;  2XPW A;  2ZME B;  3EDP A;  3WU0 A;  4BQO A;  3L2R A;  4S0H B;  3ZGK A;  4IL6 C;  4LK0 F;  5ILS A;  1QBJ A;  5FGM A;  4CCN A;  1EH7 A;  2PMZ A;  4NBQ A;  4CYC B;  1IZ1 A;  1IC8 A;  1R36 A;  4BBS J;  3E6C C;  1X2M A;  2WTE A;  4BY7 J;  5AIQ A;  2EFO A;  3ZN0 A;  1XSV A;  1LVA A;  4D7N A;  3M07 A;  1TWG J;  2ZCW A;  4QIW N;  3MAJ A;  3BWG A;  1X4O A;  2F5F A;  3K70 D;  3H3U A;  3HOT A;  1K83 J;  3BR0 A;  4ON0 A;  3ZCO A;  4Y7N J;  1FT9 A;  4EV0 A;  2ECB A;  4GXO A;  1FLI A;  4RAG A;  2V1N A;  4BHC A;  5LRR A;  1LFB A;  1YRN B;  2XAG A;  4BQA A;  1E17 A;  4YFN F;  2KKO A;  2VJ4 A;  2HWV A;  4XKC A;  2WAQ A;  1FOW A;  3HOV J;  1T95 A;  2A3S A;  2KRF A;  1BR1 A;  2VXD A;  3ZQF A;  3S32 A;  1T0F A;  3S8P A;  3E97 A;  4JOM A;  1XGS A;  1LNW A;  3FMR A;  2DMT A;  2VKE A;  2GQQ A;  2BV6 A;  3HHG A;  3CO6 C;  2BVM A;  4I01 A;  4RM2 A;  3K7A J;  3AAF A;  4G6D A;  4RAY A;  4L9T A;  3HB9 A;  1GLN A;  3CJT B;  2V6E A;  2L7M P;  1JGG A;  2DOD A;  2DYS H;  1ZRF A;  1I6X A;  4B3X A;  5LEJ A;  2HKO A;  4U7B A;  4NNJ A;  1E0E A;  4XLF A;  5DDG A;  1U6G A;  1YW7 A;  2A6T A;  1IN7 A;  3KEY A;  3X2Q H;  3J81 Z;  4HF1 A;  4IQ4 A;  2HYG D;  1KQ8 A;  3CCQ I;  3T8T A;  3IWZ A;  5L3F A;  2IT0 A;  2L4A A;  1XC5 A;  2ZC2 A;  4M3B A;  3FXL A;  2IXS A;  2GIZ A;  1V5F A;  1W5T A;  2JRM A;  2DDA A;  2V7F A;  2Y0M A;  5C3E J;  2NVY J;  1T38 A;  1O3T A;  1MNE A;  3LFU A;  5DUK A;  4CCL A;  4B1R A;  4A6D A;  1VQ9 I;  4YFK F;  2R5Z B;  3FXK A;  2ZXJ A;  2W1O A;  5FKM A;  1W7P D;  2KP6 A;  3K9T A;  3ZP5 A;  3BG5 A;  5FD6 A;  4AWX B;  4KNY A;  1WJC A;  1Z77 A;  3RTR A;  3BY6 A;  1FP1 D;  3OYK A;  2E7X A;  2OQR A;  5EG0 B;  2HYF A;  3GTG J;  1CF7 B;  4BBR J;  5D5W B;  1KON A;  1TLH B;  2KRC A;  3R0J A;  5H20 A;  3GWZ A;  4AUX A;  2EFQ A;  3UKG A;  1OR7 A;  3O8G A;  4NDL A;  5CJ9 A;  4R8H A;  1V55 H;  4GYI A;  4FX4 A;  4B09 A;  4E7I A;  5D8K B;  2K9M A;  2W25 A;  1YJ9 I;  5HDK A;  1RUN A;  3S17 J;  1JUS A;  2JA8 J;  3K1N A;  5B66 C;  3WTW C;  3BDD A;  4W1U A;  3U9G A;  4P55 A;  4NC7 A;  4K2E A;  4AYB A;  1B4A A;  5EG0 A;  3K2A A;  3ABM H;  1ZKG A;  1F5T A;  1Y1W J;  1O7F A;  4C2M J;  4BJ6 C;  1YW8 A;  1IG7 A;  4CXF A;  3GVA A;  4M9X A;  2EV0 A;  2WY7 Q;  4EVI A;  2E1O A;  2E1C A;  5B1B H;  3MCZ A;  3CCY A;  4CA0 A;  2NVX J;  3DPU A;  3QYB A;  2HOT A;  1N25 A;  2VL8 A;  2VBW A;  4GDF A;  1BI3 A;  4FHT A;  4KUM A;  4FCY A;  5DV5 A;  5J1R A;  1R5I D;  1MMA A;  2DA4 A;  1ETW A;  5EEG A;  4DZJ A;  2VON A;  2L9N A;  2LBF A;  3B02 A;  2EWN A;  4A6E A;  3OYA A;  2M1B A;  1YLF A;  3SXY A;  3FDY A;  4PFO A;  3L2V A;  3GFJ A;  1HW1 A;  3SFI A;  2E2H J;  3NEU A;  4C9Y A;  3KZZ A;  4IHY A;  1KQ9 A;  1ZAR A;  3DPT A;  3LFK A;  4NQW B;  5LHG A;  3P9C A;  3D5S C;  3ABT A;  2MW8 A;  4LG3 A;  1J2X A;  2M7B A;  2B9S A;  1PP8 F;  2H27 A;  2ZJP F;  2UV1 A;  2PJP A;  1HW5 A;  1MMD A;  1Y0N A;  3E5Q A;  3VSL A;  1HKT A;  3A52 A;  2E34 A;  4RDU A;  1X19 A;  4DGW B;  3GCM A;  1RUO A;  2NAZ A;  2KZV A;  2QVO A;  3K1M A;  3RKX A;  3OS1 A;  3DTI A;  1XD7 A;  5JFR A;  3MMY B;  2XIG A;  5KNL A;  3OV8 A;  3KLN A;  4LIU A;  4A12 A;  4FET A;  1QZY A;  4IRI A;  2ELH A;  5CQE A;  2B7E A;  4Y52 J;  2FA5 A;  3PQJ A;  1UJ8 A;  4XLN F;  1IN4 A;  4A3K J;  2IRF G;  1X3U A;  2P0W A;  4E7K A;  1XDU A;  3WTU C;  1HKS A;  3UNG C;  3BRO A;  4AYB N;  2IP2 A;  2ETH A;  2DT6 A;  2XAJ A;  2P0T A;  1ONV A;  3VFZ A;  4EEF G;  4EGZ A;  1SMT A;  1A04 A;  5D6F A;  2EQR A;  2LG4 A;  3J7Z I;  4LB6 B;  2GOM A;  3TL4 X;  4FTH A;  1I1S A;  4AD9 A;  5KAI C;  5K5Q A;  2MD0 A;  4UB8 C;  3I5U A;  3DKY A;  3DEE A;  3FXJ A;  1MBK A;  1LB2 A;  4LLG F;  5LGN A;  1GT0 C;  4U0V A;  2VKV A;  3OL3 A;  2HZT A;  4LD5 A;  3BCB A;  1FOK A;  2DA1 A;  2WC2 A;  1WKM A;  1FBQ A;  4P1W A;  1MW7 A;  1YE9 A;  4PJL A;  1ZG5 A;  3AG2 H;  3L1P A;  3Q0U A;  5IP9 J;  3KX2 A;  3GFM A;  3SQN A;  3CDL A;  5BQT A;  3COA C;  1H88 C;  4DBR A;  1BI2 A;  3BR1 A;  3A01 B;  4IHW A;  3TOB A;  3S3O A;  2B0L A;  4XRF A;  2LOO A;  3LSH A;  1FBU A;  2JA5 J;  5L3E A;  4MFD A;  1BC8 C;  3OOU A;  3CCS I;  5LGT A;  3Q3S A;  5FLM J;  3BJA A;  2F6C A;  2IJL A;  3OOP A;  2Q2E A;  3EPZ A;  3F9K A;  4XOR A;  2PJR B;  2CS3 A;  2DPD A;  1UMQ A;  5IP6 A;  2HTJ A;  3KEQ A;  1GXQ A;  1ZRE A;  2VT3 A;  3OYI A;  1M1E B;  3FXQ A;  4QPQ A;  1SFK A;  1YYV A;  3E5U A;  2JVG A;  3OR1 C;  4HX7 A;  5BMZ A;  4OAY A;  4IHX A;  4A5M A;  1ZGJ A;  4S05 A;  3PIO F;  3PNT A;  4MEX F;  4WK8 F;  3CUQ A;  5FFX A;  2L5Q A;  3FHN A;  2ADU A;  4UVB A;  3ZMV A;  3KP6 A;  2BHY A;  5HS8 A;  1WH7 A;  2VJI A;  1AWC A;  1YJW I;  1JTY A;  2CSO A;  5IY5 H;  1U2W A;  3QOD A;  5M3M J;  3I59 A;  1FP2 A;  1T6S A;  5J4V A;  1NH3 A;  5JHF A;  3GXO A;  2HI3 A;  4KFC A;  2LY2 A;  1WPK A;  1JGS A;  2A07 F;  4XNF A;  5BPI A;  1X1P A;  3BP8 A;  4KIG A;  1E3H A;  1MMG A;  1TWC J;  2CUF A;  3F23 A;  2HEO A;  1ZN2 A;  2KIF A;  1G3T A;  2X1D A;  3D1N I;  3A2K A;  1R1U A;  2AXL A;  3JRI A;  2WWY A;  1K78 B;  1ZYR F;  2VXZ A;  1UG2 A;  3HYI A;  2EA4 A;  1Y8R B;  1JE8 A;  1OCZ H;  4DYC A;  4BAC A;  3DXJ F;  3R4K A;  3S1Q J;  3S1R J;  1S9H A;  1LKX A;  2V26 A;  4XN0 A;  2ZNZ A;  2ZJR F;  3LQQ A;  3ZQQ A;  1X2N A;  3CMY A;  2JWT A;  1ZAO A;  1ZG3 A;  2ME6 A;  4NB5 A;  1MMN A;  2EZH A;  4RBO A;  1QRY A;  2CG4 A;  2OA4 A;  5FJ8 J;  3KIO A;  2FBK A;  2K40 A;  2O03 A;  4TV7 A;  4KN4 X;  4BKX A;  3R61 A;  4XMY A;  5LEK A;  1IXC A;  1ZHF A;  4ENK A;  1WQ2 A;  5GP9 A;  2WAD A;  5CKT A;  3L2C A;  2E7W A;  4M74 A;  4U7D A;  2VQL A;  1Z1D A;  2L7Z A;  1HQC A;  1XSX A;  3BG6 A;  5ICG A;  1GDT A;  1J75 A;  5FKL A;  2OV7 A;  4FX0 A;  1FYK A;  3RPU D;  5HNH A;  5FLV A;  2XUB A;  1XCB A;  2BEO A;  2CYY A;  1W1W E;  1SFO J;  4A3L J;  2GA2 A;  4PSW A;  4RLF A;  1I3A A;  2DA2 A;  4LLL A;  2DK5 A;  4XL9 A;  5FKO A;  2FEZ A;  2EFN A;  4PUS A;  5F08 A;  3A4C A;  4W97 A;  4OIQ F;  2K9N A;  5E1X A;  5E1Z B;  3DF8 A;  3FMS A;  1HBX G;  1OCP A;  4UUT A;  2P6T A;  2QM3 A;  3KET A;  1MMS A;  4CZC A;  3I4N J;  5H6R A;  2DQR A;  4IXA A;  2X6Y A;  2VAS A;  3C2H A;  3GZ6 A;  3JCU C;  1QNT A;  2W57 A;  2NXN B;  1FPQ A;  1JT6 A;  3NWT A;  2M3A A;  3H92 A;  3HRU A;  2VUM J;  4L9N A;  3CJN A;  1P7J A;  2V9V A;  3AG1 H;  3CZ6 A;  1J5Y A;  3SDG A;  3N97 A;  4B43 A;  4L9V A;  4RB1 A;  4B48 A;  1U0J A;  2MLK A;  3J7A O;  1V54 H;  5HOD A;  1ZLJ A;  3I4M J;  1UAA A;  4U0Y A;  1NK3 P;  3PUB A;  4A3D J;  3EUH C;  3E6D A;  1Z6R A;  3DBL B;  5HS9 A;  3CF5 F;  4IF4 A;  1E2X A;  1G3S A;  1XMX A;  2X4H A;  3G3Z A;  3FZV A;  2EB7 A;  1G8X A;  2WAF A;  2YR2 A;  2W48 A;  1YI2 I;  2FMY A;  4HQE A;  3H5A A;  2YX7 A;  3G1L A;  3ZPL A;  2CO5 A;  3BC8 A;  2CV2 A;  3TW6 A;  3BPX A;  2HDC A;  2NRA C;  3GZN B;  1RPW A;  1TNS A;  2P4W A;  2R4G A;  2XGX A;  5HNF A;  3VWB A;  4HEA 2;  1Y1V J;  3IHU A;  3AFH A;  2EK5 A;  2DMN A;  2FBH A;  4IHT A;  2XHK A;  2RRE A;  1VQP I;  1MJB A;  2Y69 H;  2WAQ N;  3JRD A;  3CC7 I;  3PNV A;  1VND A;  1WGX A;  2EBI A;  4IRH A;  4IPA A;  2DI3 A;  1WFX A;  1IO2 A;  2M8G X;  2QWW A;  4UV8 A;  1MND A;  1RKT A;  2X85 A;  1GV2 A;  4UY8 I;  1Z0X A;  3EYY A;  4KMU X;  3L2W A;  2DQL A;  3DBH B;  2EV5 A;  1YS6 A;  3IWF A;  5KVR A;  4D9J A;  2DW4 A;  3LSI A;  1R9T J;  2XAH A;  2Y31 A;  2E36 A;  1RIO H;  1T33 A;  3MVP A;  1B59 A;  2ESN A;  2IEK A;  4Z2Y A;  2RQP A;  2QSH X;  4BH9 A;  2CQK A;  3FKI J;  1RC9 A;  1FMV A;  1BIB A;  3U1D A;  3TQN A;  3I54 A;  2XB0 X;  5TGT A;  3RQ4 A;  2RN7 A;  2Z5U A;  4M6V A;  2HPI A;  5J3L A;  2XV4 S;  2VPL A;  3GTP J;  4A3B J;  2ZJ2 A;  2M5W A;  2YX4 A;  2IA0 A;  4HZF A;  4XSX F;  5GAH J;  5JVT A;  2VOD A;  3MFK A;  2I10 A;  3FHZ A;  1BBY A;  2RV8 A;  2VBY A;  2YPR A;  4IHV A;  5CVR A;  3WTZ A;  3HRM A;  5BOX A;  1NK2 P;  4XQF A;  2MBF A;  3K4J A;  3GF2 A;  3BR3 A;  4P5O A;  3O3K A;  3VOE A;  2BW3 B;  2MLG A;  4PCQ A;  2DA6 A;  2ZSI B;  5HDN A;  1WH5 A;  1POG A;  3LNQ A;  4A2U A;  2AQF A;  3ESW B;  2K27 A;  4JP0 A;  1NTC A;  2HDW A;  1K79 A;  3HUG B;  3ULQ B;  5ILV A;  3OYJ A;  3A01 A;  4N9H A;  3DTK A;  1U8R A;  3CCJ I;  1Z7U A;  2ZFU A;  2AHQ A;  5ICE A;  3P9I A;  3BQZ A;  4L0Z B;  5HLT A;  4HAM A;  2LY1 A;  2XF5 A;  3K4C A;  1ZH5 A;  1AOY A;  1G4D A;  1FEX A;  4RB2 C;  1WHU A;  3ZQC A;  3LSJ A;  1Z3X A;  1VQO I;  1SD4 A;  1HOM A;  5TIS C;  2JVH A;  2E35 A;  1T8I A;  3HOY J;  2KQR A;  4HQM A;  2NYX A;  3ZMD A;  1N75 A;  1H9G A;  3S14 J;  3BOQ A;  5KHD A;  2GAU A;  3ZN1 A;  2O8X A;  3OYD A;  1HCR A;  2PMZ N;  3VYS B;  2XPV A;  3L2U A;  4H0E A;  1LE8 A;  3K1P A;  1IXS B;  1IN8 A;  1TWA J;  4I02 A;  2KJB A;  4G8X A;  5IT9 Z;  2ZME C;  1I6H J;  1JHF A;  2G7H A;  3PJR A;  3Q5F A;  2GZW A;  2NVT J;  2FX0 A;  2OTJ I;  4JX4 A;  4Z6Y A;  3OYG A;  4KA4 A;  1HLV A;  5JLW A;  1MSE C;  3M3Y J;  5EYR A;  4BHB A;  4BXF A;  2EFP A;  5FB2 A;  2JJ7 A;  2VI6 A;  5LD2 C;  1TWF J;  3EQL F;  4MNU A;  5K1Y A;  2A05 A;  1XDS A;  2QQA A;  4EAT A;  2JA6 J;  4BGD A;  1ZLK A;  3WTT C;  3DU5 A;  4EJT A;  4M3D A;  5D6E A;  1IF1 A;  5JR3 A;  2ECC A;  2RGV A;  3PO3 J;  3WTS C;  2DA5 A;  2OCC H;  5AON A;  1TNT A;  3I4P A;  3H0G J;  3RIR A;  1MD0 A;  1OIS A;  1W36 D;  4BEH B;  2MFZ A;  4BEH A;  6PAX A;  2WY8 Q;  4C2T A;  3IP4 B;  5B5E C;  3JAM K;  2LKX A;  1QO0 D;  4PSX A;  3MZY A;  4A3F J;  3HOW J;  3DTE A;  4Y4R A;  1SVO A;  2X6X A;  3OYF A;  3HC7 A;  3ZMZ A;  3CUQ C;  1MNM C;  2M87 A;  1NHA A;  3HTU A;  4I76 A;  4E7J A;  2NVU B;  2KRH A;  4AIH A;  4XKW A;  1SD7 A;  5F27 A;  4IQJ A;  3VYR B;  1I3Q J;  5D5V B;  2RAE A;  1KQ0 A;  2F5C A;  2FF4 A;  1FSE A;  4PJM A;  1IUF A;  2JSP A;  4IOA F;  4XKB A;  2RC4 A;  3EYI A;  1H8A C;  2AXT C;  3FK7 A;  2F4M B;  2HPM A;  2WB1 N;  3PM1 A;  4KIS A;  3VB2 A;  3BTL A;  5F1J A;  4I0B A;  3C3W A;  1A6I A;  2P8T A;  3KFW X;  3PNY A;  5F6F A;  1QU3 A;  5J40 A;  2NS8 A;  4ZH4 F;  4ABZ A;  2BZT A;  3JRG A;  3H3V K;  3OS2 A;  2PQ8 A;  2GOX B;  1H0M A;  2L7F P;  2ZBK A;  1S5L C;  1PDN C;  5GAD J;  3J81 R;  3OYL A;  4HNV A;  1IXR C;  3HGG A;  1U3E M;  4XID A;  3I55 I;  3JW4 A;  4MIM A;  1RKW A;  2DU9 A;  3RYR A;  3CCR I;  4HPQ A;  3IC7 A;  4KIC A;  4HBL A;  5ICF A;  1Y39 A;  2BY2 A;  2IS2 A;  2WV0 A;  4EJU A;  2DOA A;  1QHH D;  2QA4 I;  5E17 F;  3OYB A;  2OPT A;  5DEQ A;  3CLQ A;  3HKZ A;  2LDU A;  3M9A A;  2V9P A;  4ZJZ A;  1K4T A;  3RZO J;  4CSW A;  4CDG A;  3I71 A;  3OWT A;  3JRA A;  1XS9 A;  2M34 A;  4IEJ A;  5B3S H;  2FQ3 A;  2IVM A;  3CMM A;  5CVJ A;  4LJZ F;  2HOS A;  1OPC A;  4O6J A;  3HHH A;  2OAZ A;  2STT A;  3W6V A;  1LEA A;  3OL4 A;  4ENJ A;  3FBN B;  1X58 A;  4LG0 A;  1OYW A;  4ZYD A;  3GTJ J;  4CO8 A;  1RR8 C;  2W4S A;  2GXG A;  2GXA A;  1DU0 A;  1U5T C;  3KLO A;  4A3M J;  2WB1 A;  3GTQ J;  5F64 A;  2CQX A;  4F92 B;  1R7J A;  5L3D A;  3TED A;  3FM3 A;  2Z9O A;  4BAY A;  4OWR B;  4CUG A;  4XK4 A;  3OMY A;  4JK1 X;  1FJL A;  1Q1V A;  2W85 A;  3P5J A;  3QOE A;  4ZTF A;  3DEW A;  3BCA A;  1I5Z A;  4PJJ A;  4BE2 A;  2KZG A;  2L3D A;  3RPQ A;  1I1G A;  4LGW A;  2M45 A;  5JLX A;  3I56 I;  3C2B A;  3TP0 A;  3E1S A;  3AL0 C;  5CVV A;  3J7A W;  2KDZ A;  3L09 A;  2IS1 A;  3J7A Y;  2FNP A;  4EGY A;  4RAF A;  2QQB A;  2Z1D A;  4XRS A;  3JTG A;  3SZG A;  1IDZ A;  3HOX J;  3FX3 A;  2X51 A;  3I59 B;  5GPA A;  3W3C A;  4DJA A;  4OU0 A;  1VQ6 I;  1U9O A;  3QPH A;  3SEQ A;  4ZZD A;  4BQN A;  1XMK A;  3S16 J;  5DCF A;  3S2D J;  2BY0 A;  4Q5S F;  3PL8 A;  4ZTJ A;  4D1Q A;  2O6G E;  2XF7 A;  5K7H A;  1SFU A;  4XLP F;  5D5X B;  4FQG A;  2FSW A;  3K10 A;  2L9S A;  2OJE D;  3F8M A;  1OMI A;  3WTX C;  2JSC A;  1B8I A;  4II3 A;  1S7E A;  4LK1 F;  2O8K A;  2Y48 A;  2DTR A;  4HA8 A;  3DP7 A;  3QYF A;  4L5I A;  2EIL H;  4N0B A;  3LL7 A;  2H94 A;  4KDP A;  2VKH A;  3CCM I;  4CCO A;  1XN7 A;  2EIK H;  4JYK A;  2XAF A;  2DK8 A;  2Y2Z A;  4O3M A;  1BW6 A;  3K2Z A;  3LWF A;  2DJN A;  2IW5 A;  2VOP A;  2KIM A;  3FF5 A;  4G6T B;  4AU7 A;  4F52 A;  4KT5 C;  4BJ5 C;  2XAQ A;  4CCM A;  2R0Q C;  4E7H A;  4A3C J;  3QPL A;  3QP5 A;  3ZQG A;  2CUZ A;  5KCM A;  4Q4Z F;  1YRN A;  3E6B A;  4S04 A;  4LLN A;  4UNO A;  3OIQ A;  3H36 A;  2DA3 A;  2JUG A;  1D3Y A;  3I3L A;  4PJN A;  3WTV C;  1TT0 A;  2E71 A;  1DDN A;  3MZ8 A;  3IAM 2;  5CLS A;  3KP3 A;  2FXA A;  2HVQ A;  1LJ9 A;  3K4B A;  3QPS A;  4OIR F;  1YTY A;  1IRF A;  4U0W A;  3J80 R;  5FRM A;  3KP4 A;  4B3A A;  3CJQ B;  1O3R A;  1SFX A;  3ZMT A;  4HLY A;  3DKX A;  2LF7 A;  4XLC A;  2VBX A;  3BG7 A;  4XM3 A;  1EA3 A;  4FAS D;  4OIO F;  5IYD J;  3DFG A;  4HW0 A;  3V8L A;  4EJW A;  3D5R C;  5K5O A;  2R93 J;  4G7H F;  1HDP A;  2KLO A;  1JUP A;  4KT6 A;  5KK1 A;  1D1C A;  1XGN A;  1BL0 A;  2BXZ A;  2HYJ A;  2BY3 A;  2RKH A;  1KYZ A;  2W82 A;  3FXO A;  2G0E A;  5KAF C;  3BG3 A;  2KT0 A;  1JJ8 C;  3GFI A;  1FYL A;  3HG9 A;  4M6Y A;  3KP5 A;  5DD4 A;  3VOD A;  5FO5 A;  3RSN A;  1O7L A;  2K86 A;  4F91 B;  1QHG A;  1XCV A;  1FTZ A;  2MC3 A;  1DPR A;  2EIN H;  4I98 B;  2PMH A;  2H09 A;  5EEA A;  3S3M A;  1HF0 A;  1TL8 A;  4XKV A;  1K7A A;  4G7Z F;  2DA7 A;  4ZDP A;  2UUZ A;  1DP3 A;  3FM5 A;  1OJL A;  5K7Z A;  4QTR A;  3HGY A;  5LHI A;  2O9L A;  1LDD A;  2RDP A;  5M5W J;  1JHH A;  2JPB A;  2XGC A;  4BDZ A;  2VB6 A;  4EMS A;  3EUK L;  2LNB A;  3HSE A;  4Y13 A;  1VZ0 A;  4NQW A;  3ONQ A;  3U1K A;  1JJ6 C;  1U8B A;  1B72 B;  1OCO H;  2KIS A;  2LH9 A;  2ACJ A;  4YFX F;  1OKR A;  2MA3 A;  3RJP A;  2I5U A;  2COM A;  2HDD A;  2QSF X;  1O3S A;  3S1N J;  2LBF B;  3RKY A;  1TW2 A;  4IRG A;  4IZZ A;  1C0W A;  1ITY A;  2I8D A;  2M0C A;  3KEO A;  4WXC A;  5ERI A;  3Q9V A;  1UHW A;  5H2F C;  1V4R A;  1BOA A;  4E6K G;  2DMP A;  2MGQ A;  2Q1Z B;  1XTA A;  3CD6 I;  1TQI A;  4V19 K;  3I58 A;  2LC2 A;  4C2U A;  1RZ4 A;  3J80 Z;  1X1A A;  2RNJ A;  3CES A;  2FE3 A;  5J4Y A;  4ITV A;  2GBY A;  1LEB A;  4M3F A;  3E3V A;  4A69 C;  2M4G A;  2LRD A;  5M5X J;  1SEU A;  4ETS A;  2CJJ A;  4I09 A;  4FE7 A;  3KZI C;  2DOF A;  2HGC A;  2LYC A;  4ASN A;  1TBX A;  4FIS A;  4A0X A;  3G2B A;  4GRI A;  1D8K A;  4XLE A;  3K4N A;  4B8X A;  5E20 A;  2HQN A;  2ISY A;  3J81 K;  2LTP A;  2MH2 A;  3VDX A;  2IBD A;  2P7C B;  1A31 A;  3QWL A;  3TOA A;  4A5N A;  1FYM A;  1GVD A;  2LVS A;  4X0G A;  1V3F A;  4GYG A;  3CCE I;  4DW6 A;  4FT8 A;  2PEX A;  4ENN A;  1WZ2 A;  1SAU A;  4RMN A;  2VIX A;  3KCC A;  3FWE A;  1CF7 A;  2VQC A;  1HKQ A;  2CUJ A;  2NNY A;  1BC7 C;  2BW3 A;  4XR6 A;  1D0Y A;  2MYS A;  2LD5 A;  5DS9 A;  2E1M C;  5IYC J;  5GAE J;  5L3C A;  4JBA A;  2X98 A;  1ZK8 A;  3F6V A;  3TDU C;  1ZR2 A;  3C18 A;  1RNL A;  1RI7 A;  2LP0 A;  1R23 A;  2ID3 A;  4F93 B;  3JSP A;  2JK3 A;  2KMU A;  5H6Q A;  2DJI A;  4R79 A;  2R5Z A;  2CU7 A;  2MVT A;  1LUJ B;  4RGR A;  3H5N A;  1WJA A;  2K85 A;  4HV6 A;  4PGG A;  5HS7 A;  2XF6 A;  2PG4 A;  2DAO A;  3HPH A;  1KU7 A;  4RS8 A;  4G94 A;  4EM2 A;  1E3O C;  4LFU A;  2LMD A;  4C3I J;  2L7K A;  4XOP A;  4NHJ A;  1IAW A;  1KU9 A;  3K69 A;  2V1U A;  5HLG A;  1R1T A;  2BBY A;  2EJR A;  5DCM A;  4HG2 A;  2A5W A;  3OIO A;  4B4C A;  2AQE A;  3RKW A;  1D1A A;  4MTD A;  1DGW Y;  1T56 A;  2FML A;  3HXL A;  1HXD A;  1U9N A;  5LGU A;  2K3F A;  2COB A;  1BR2 A;  4ANJ A;  3WG9 A;  5B1A H;  3G4S I;  1OLT A;  2DOE A;  4EM1 A;  1U5T A;  3A02 A;  1QPM A;  2LLK A;  1XPX A;  5IYB J;  5J8F A;  1FSH A;  3RPU A;  1S3J A;  5HVQ C;  4G12 A;  5FRO A;  1Z05 A;  2RQQ A;  2M2E A;  2R7F A;  1BIA A;  2LF8 A;  2Z2S B;  4F3Q A;  1IUY A;  4CIC A;  2X6O A;  3CCU I;  2F2E A;  3CJR B;  3BTI A;  1GXP A;  3HM5 A;  1R4M B;  1IJW C;  1SD5 A;  3IUO A;  2LRE A;  2W24 A;  2CV0 A;  3GYH X;  4RGS A;  4DOZ A;  3TW7 A;  3ABU A;  1K61 A;  1P4X A;  2ELK A;  3M8F A;  3NAU A;  3HPG A;  2QYO A;  1ZGW A;  4CGZ A;  1MBF A;  2JA7 J;  2OC6 A;  2A6E F;  4CYC A;  1BI0 A;  1P6R A;  4GFB A;  2R92 J;  4HRI A;  4AID A;  2QZ8 A;  1TC3 C;  1YOV B;  3FK6 A;  1FOY A;  1PYV A;  3W2A A;  1JKR C;  2R7Q A;  2A61 A;  1RQ6 A;  4BE1 A;  3GME A;  3CC2 I;  1F36 A;  1PP7 U;  3W2V A;  4Y3O A;  1VQ8 I;  4XOT A;  4BNC A;  5IT9 K;  4OAZ A;  2EFW A;  3J7Y J;  4ZC3 A;  4I2O A;  4E4H A;  4C30 A;  2FBI A;  3K0L A;  3NWS A;  5CPR B;  1ZEL A;  3F6O A;  1H89 C;  3NQO A;  4H4K C;  5DYM A;  1YIJ I;  1ZR4 A;  5JVG F;  4QPO A;  2IGN A;  4ZZL A;  1FBS A;  1FX7 A;  2NS0 A;  2PX9 A;  4HLX A;  5TJJ A;  3GTO J;  4V2G A;  3ZMU A;  2IA1 A;  2NOG A;  4BU2 A;  2F4I A;  3S2W A;  4HDU A;  2R7U A;  2Y0S A;  5LHH A;  1UST A;  4I6Z A;  4N4O B;  1YQA A;  2CFO A;  2MG4 A;  3P9K A;  3LAP A;  4L0Y B;  5E1W A;  2R7D A;  5E3L A;  4YEL A;  2CFX A;  4CHU A;  2DMU A;  2V1X A;  1ON1 A;  1EH8 A;  2X1C A;  2M8E A;  4AC0 A;  5F0C A;  2ZO4 A;  2Y0S N;  3I64 A;  4J01 A;  3H35 A;  1KA8 A;  2V4J C;  3LA3 A;  3ZQL A;  3FXM A;  2Y30 A;  5A2Q R;  2JUC A;  2P7V B;  2W7N A;  1YO5 C;  4HYE A;  2OF7 A;  3O6B B;  2XGE A;  4WCG A; 
#chains in the Genus database with same CATH homology
 1KYW A;  2L4M A;  4ESB A;  2P5L C;  3GW2 A;  3TKY A;  1BN5 A;  4OIN F;  4MGR A;  4I7H A;  4UVA A;  4M72 A;  1IN5 A;  3P7N A;  1SMY F;  4HF2 A;  3ELK A;  2GXB A;  2ZNY A;  1VTN C;  3MQ0 A;  2L02 A;  2FU4 A;  1XGO A;  4M9Z A;  1F9N A;  4AIJ A;  2K4J A;  3FXU A;  3BPV A;  4Q48 A;  1ZRD A;  2VE8 A;  4RB3 C;  3GX4 X;  2G7U A;  4UUV A;  2AS5 F;  5BS6 A;  4ZYG A;  3E6M A;  3HRT A;  5D4S A;  1DUX C;  3T5X A;  3SZP A;  4RGX A;  4YII A;  3F8C A;  2VC0 A;  3IRR A;  3WU1 B;  2XAS A;  4UHT A;  2PMU A;  2A6H F;  4GGG A;  4WF2 A;  3HIF A;  5FLX Z;  2UXN A;  3QPT A;  1I27 A;  1R1V A;  4XSZ F;  4BYY A;  1B9M A;  3HUG A;  5E18 F;  2K7L A;  1F4K A;  1LQ1 A;  3F8F A;  2HKX A;  1Z6T A;  3CUO A;  3HTS B;  3MWM A;  3T1B A;  4HOB A;  1T2K A;  2Z99 A;  2A69 F;  1YFH A;  1KU3 A;  5BPD A;  1JXS A;  1WRJ A;  2OZU A;  1PUE E;  3C1D A;  2P5K A;  4GO1 A;  3G73 A;  4WXH A;  2XVC A;  1LDK B;  4BHP A;  4ZYE A;  1YG2 A;  3WGH A;  3R60 A;  3SZT A;  2OQG A;  2P6S A;  1R00 A;  1W7P A;  2OZ6 A;  2XRO A;  4P96 A;  4QLC U;  1ZG1 A;  2TDX A;  1D8J A;  4EJO A;  4HV5 A;  1ODD A;  2L01 A;  3E5X A;  3EUH A;  1P4W A;  1MDM B;  4LG0 B;  4WX9 A;  3JAM Z;  3IL2 A;  4Y15 A;  2XKP A;  3QU6 A;  1L0O C;  1EV7 A;  3DKW A;  1USS A;  2RVC A;  3GO5 A;  4G7O F;  4N9I A;  1YIO A;  2PFB A;  3H3Z A;  3GLX A;  2JT1 A;  2O0Y A;  4PGH A;  1TQP A;  3V7R A;  1XB4 A;  3QOP A;  3WOD F;  4G6Q A;  1XSD A;  4BXU A;  3LA7 A;  3KP7 A;  3KZY A;  2V1D A;  3IRQ A;  2LSO A;  2BGC A;  4L5J A;  3TDZ C;  1U78 A;  2FRH A;  2FOK A;  2HQR A;  1BJA A;  2V79 A;  2O3F A;  3D5L A;  3F72 A;  2IPQ X;  3LAJ A;  1O3Q A;  1XGM A;  1YW9 A;  3ISP A;  5D5U B;  3MEX A;  4IJA A;  1G6N A;  1S6L A;  1B9N A;  3BJ6 A;  3L9F A;  4UXN A;  1T39 A;  3ECH A;  3IKV A;  3W6K B;  2GIV A;  4JQF A;  1UHM A;  1LDJ A;  2DBB A;  2QQ9 A;  2D45 A;  5HOO A;  4LB5 A;  1W4M A;  5J6X A;  2YSR A;  4EQQ A;  2IA2 A;  1U5T B;  1MDM A;  1BM9 A;  1WWX A;  3V8K A;  4YG2 F;  5DUI A;  2DLL A;  2K02 A;  2QBY A;  3L7W A;  3HSR A;  4ENM A;  2CW0 F;  2BE5 F;  3EET A;  1QZZ A;  5HDG A;  2Q8K A;  1K6O A;  3REO A;  2PBI A;  1J0R A;  3HSF A;  2M30 A;  5CVI A;  2PI0 A;  1Q1H A;  1GVJ A;  3ML6 A;  4RGU A;  3WE3 A;  2EA2 A;  5ED4 A;  4E70 A;  5D8L B;  3D0S A;  3GUD A;  1FNN A;  3O2P E;  3BJO A;  3DPL C;  2EV6 A;  3T8R A;  4PDK A;  3QP6 A;  2OU2 A;  5L3B A;  2ZME A;  2ZKZ A;  4KN7 X;  3DQV C;  2D1V A;  5AIP A;  2A68 F;  2J5O A;  1HSJ A;  1P92 A;  1O57 A;  3ZQ7 A;  1SAX A;  3TO9 A;  3LST A;  4M9S A;  4D0P A;  2A5Y B;  3ZMS A;  3J80 K;  1FWZ A;  3LQR A;  4KYW A;  3FMQ A;  2QEN A;  5HLI A;  3I53 A;  1TTY A;  3QU3 A;  2KIU A;  2K4B A;  2DO7 A;  3NRV A;  2ESH A;  2Y75 A;  3QRF F;  4WXD A;  4R1H A;  3CDH A;  3WGG A;  5TRD A;  2H6C A;  2HOE A;  2LKP A;  5FFZ A;  2OD5 A;  3VEP A;  1MGT A;  4L18 B;  2OBP A;  4IHS A;  5ILU A;  4AIK A;  3KP2 A;  1FZP B;  2Q0O A;  2H6B A;  3CO7 C;  2X0L A;  4MTE A;  2VC1 A;  4A0Z A;  5EEH A;  1ULY A;  1TW3 A;  3R6S A;  3F22 A;  2VOO A;  2QBY B;  1B6A A;  1XMA A;  1S8N A;  4O5V A;  2UZK A;  3HRS A;  2R3S A;  4DNC A;  1J59 A;  4RB0 A;  4A0Y A;  3ECO A;  4ZYH A;  4QWQ A;  3GZ5 A;  1DP7 P;  4L9J A;  1D5V A;  5D4R A;  3RI4 A;  5L3G A;  3JTH A;  3R0A A;  3SHF A;  3TO7 A;  2NNN A;  1R58 A;  2VBZ A;  1MKM A;  4CZZ A;  1P2F A;  1UCR A;  1B1B A;  4MQ9 F;  1S7A A;  2JTV A;  3HOS A;  1OYI A;  3V8J A;  3CLO A;  3ROU A;  2P5V A;  2F5D A;  4HDV A;  4M6X A;  2D2W A;  2MH9 A;  5E8I A;  3U2R A;  4M73 A;  5DD8 A;  1MJA A;  2E1N A;  2Z3Y A;  1BI1 A;  1SD6 A;  4KIB A;  3TO6 A;  2F5E A;  2VN2 A;  4RAZ A;  5A2Q K;  2DPU A;  4HX4 A;  2L54 A;  3IKT A;  2DT5 A;  4AVP A;  1J9I A;  4UVC A;  5E8G A;  1S7O A;  5LLQ A;  4HX8 A;  4IVN A;  2JPC A;  4LMY A;  1W7P B;  4P9U A;  2BYV E;  1R5H A;  1K78 A;  2GWR A;  1KU2 A;  4F7Z A;  1H9T A;  1STZ A;  4KMF A;  3WE2 A;  3CTA A;  3QAH A;  1YS7 A;  3W6J B;  4WWC A;  2O61 A;  2FNA A;  1G3Y A;  2HR3 A;  3N4M A;  5IT3 A;  1QGP A;  1GHC A;  3KE2 A;  5JI6 A;  1KGS A;  3F3X A;  5A2Q Z;  2C6Y A;  3FXR A;  4PZJ A;  3V7S A;  3PFI A;  4OMY A;  1S29 A;  4P9F A;  5CVU A;  1WSU A;  1G3W A;  4CYD A;  3PQK A;  1IN6 A;  2V6C A;  2MD5 A;  4OOI A;  3ERE D;  3M7G A;  3F8B A;  4EM0 B;  2GA1 A;  2JZY A;  5DCM B;  2G9W A;  1Z9C A;  3RDI A;  3Q9S A;  3LA2 A;  1T98 A;  5FD5 A;  3C7J A;  1IW7 F;  1REP C;  1ON2 A;  4M71 A;  3M1E A;  4UV9 A;  2PLY A;  3DEU A;  1L3L A;  2Z33 A;  3B73 A;  3F8N A;  2STW A;  1UFM A;  2VT2 A;  3M8E A;  1TQM A;  1MZB A;  1UB9 A;  2JRT A;  4XBF A;  2CGP A;  4YIF A;  1SFE A;  3DV8 A;  4MQV A;  4I0A A;  2HTS A;  2J5P A;  2XKO A;  1CGP A;  2ZFW A;  1F1Z A;  2D1H A;  4Q47 A;  5JHU A;  1W5S A;  3GFL A;  2UXX A;  3TGN A;  2ISZ A;  1FC3 A;  1MJ9 A;  5LBQ A;  1OYY A;  1Z91 A;  2DFI A;  5J8C A;  4ESJ A;  1R5G A;  2XRN A;  1FY7 A;  1WI9 A;  2QUF A;  1P4A A;  1R22 A;  3F21 A;  1EH6 A;  3SFZ A;  2PN6 A;  3JSO A;  3WGI A;  1DPU A;  3L00 A;  5LRS A;  1HW2 A;  2W84 A;  2YU3 A;  5HLH A;  4U88 A;  4DQ2 A;  4OMZ A;  4HF0 A;  1ZRC A;  2HS5 A;  3RYP A;  3I0T A;  5K5R A;  3CUQ B;  4MEY F;  1HST A;  4G9Y A;  4EJV A;  1J7K A;  5F1R A;  3BZ6 A;  1ZGA A;  1QQI A;  2KJC A;  3T0Y A;  4KIF A;  3MZH A;  2HFH A;  3V4G A;  1Y0U A;  3V7C A;  5FLX K;  2VE9 A;  5CYV A;  1IRG A;  4Y17 A;  4ESF A;  2CWE A;  3WTY C;  4MHG A;  4GCV A;  2UWM A;  3GEZ A;  4OIP F;  2QLZ A;  2ZME B;  3EDP A;  3WU0 A;  4LK0 F;  5ILS A;  1QBJ A;  5FGM A;  1EH7 A;  1IZ1 A;  1R36 A;  3E6C C;  2WTE A;  5AIQ A;  2EFO A;  3ZN0 A;  1XSV A;  1LVA A;  2ZCW A;  3MAJ A;  3BWG A;  2F5F A;  3HOT A;  3H3U A;  4ON0 A;  1FT9 A;  4EV0 A;  4GXO A;  1FLI A;  4BHC A;  5LRR A;  2XAG A;  4BQA A;  1E17 A;  4YFN F;  2KKO A;  2HWV A;  2KRF A;  2A3S A;  1T0F A;  3E97 A;  1XGS A;  1LNW A;  3FMR A;  2GQQ A;  2BV6 A;  3HHG A;  3CO6 C;  4I01 A;  3AAF A;  4G6D A;  4L9T A;  1ZRF A;  1I6X A;  5LEJ A;  2HKO A;  4U7B A;  5DDG A;  1U6G A;  1YW7 A;  1IN7 A;  3J81 Z;  4HF1 A;  2HYG D;  1KQ8 A;  3T8T A;  3IWZ A;  5L3F A;  2IT0 A;  2L4A A;  1W5T A;  2Y0M A;  1T38 A;  1O3T A;  5DUK A;  4A6D A;  4YFK F;  2ZXJ A;  1W7P D;  3K9T A;  3ZP5 A;  5FD6 A;  4AWX B;  4KNY A;  3RTR A;  3BY6 A;  1FP1 D;  2E7X A;  2OQR A;  2HYF A;  1CF7 B;  5D5W B;  1TLH B;  3R0J A;  5H20 A;  3GWZ A;  2EFQ A;  1OR7 A;  5CJ9 A;  4R8H A;  4GYI A;  4FX4 A;  4B09 A;  5D8K B;  2W25 A;  5HDK A;  1RUN A;  3K1N A;  3WTW C;  3BDD A;  3U9G A;  4P55 A;  4K2E A;  1B4A A;  1F5T A;  1O7F A;  1YW8 A;  4CXF A;  3GVA A;  4M9X A;  2EV0 A;  4EVI A;  2E1C A;  3MCZ A;  2VBW A;  1BI3 A;  4FHT A;  4KUM A;  5DV5 A;  2VON A;  5EEG A;  3B02 A;  2EWN A;  4A6E A;  2M1B A;  1YLF A;  3SXY A;  3GFJ A;  1HW1 A;  3NEU A;  3KZZ A;  1KQ9 A;  1ZAR A;  3DPT A;  3LFK A;  5LHG A;  3P9C A;  3ABT A;  1J2X A;  1PP8 F;  2H27 A;  2PJP A;  1HW5 A;  3E5Q A;  1HKT A;  1RUO A;  2NAZ A;  2QVO A;  3K1M A;  3RKX A;  1XD7 A;  5JFR A;  2XIG A;  3OV8 A;  3KLN A;  4A12 A;  1QZY A;  4IRI A;  2ELH A;  2FA5 A;  3PQJ A;  4XLN F;  2IRF G;  1IN4 A;  1X3U A;  1XDU A;  3WTU C;  1HKS A;  3BRO A;  2IP2 A;  2ETH A;  2XAJ A;  1ONV A;  3VFZ A;  4EGZ A;  1SMT A;  1A04 A;  5D6F A;  4LB6 B;  1I1S A;  4AD9 A;  5K5Q A;  3I5U A;  1LB2 A;  4LLG F;  5LGN A;  4U0V A;  2HZT A;  4LD5 A;  1FOK A;  2WC2 A;  1WKM A;  1FBQ A;  1ZG5 A;  3GFM A;  3SQN A;  5BQT A;  3COA C;  1BI2 A;  3TOB A;  2B0L A;  4XRF A;  1FBU A;  5L3E A;  1BC8 C;  5LGT A;  3BJA A;  2IJL A;  3OOP A;  2Q2E A;  2DPD A;  2HTJ A;  3KEQ A;  1GXQ A;  1ZRE A;  2VT3 A;  3FXQ A;  1YYV A;  3E5U A;  4HX7 A;  5BMZ A;  4A5M A;  1ZGJ A;  4S05 A;  4MEX F;  4WK8 F;  3CUQ A;  5FFX A;  4UVB A;  3ZMV A;  2ADU A;  3KP6 A;  5HS8 A;  1AWC A;  2CSO A;  1U2W A;  3I59 A;  1FP2 A;  1T6S A;  3GXO A;  4KFC A;  1JGS A;  2A07 F;  5BPI A;  3BP8 A;  4KIG A;  3F23 A;  2HEO A;  1ZN2 A;  2KIF A;  1G3T A;  1R1U A;  2AXL A;  2WWY A;  1K78 B;  1ZYR F;  2VXZ A;  3HYI A;  2EA4 A;  1JE8 A;  3DXJ F;  3R4K A;  2ZNZ A;  3LQQ A;  1ZAO A;  1ZG3 A;  4NB5 A;  2CG4 A;  2OA4 A;  2FBK A;  2O03 A;  4TV7 A;  4KN4 X;  3R61 A;  5LEK A;  1IXC A;  1ZHF A;  4ENK A;  1WQ2 A;  3L2C A;  2E7W A;  4M74 A;  4U7D A;  1Z1D A;  1HQC A;  1XSX A;  5ICG A;  1J75 A;  4FX0 A;  1FYK A;  2XUB A;  1XCB A;  2BEO A;  2CYY A;  2GA2 A;  4LLL A;  2DK5 A;  2FEZ A;  2EFN A;  4OIQ F;  5E1X A;  5E1Z B;  3DF8 A;  3FMS A;  1HBX G;  2P6T A;  2QM3 A;  3KET A;  5H6R A;  2DQR A;  4IXA A;  3GZ6 A;  1QNT A;  2W57 A;  1FPQ A;  3HRU A;  3H92 A;  4L9N A;  3CJN A;  2V9V A;  1J5Y A;  3N97 A;  4L9V A;  4RB1 A;  3J7A O;  2MLK A;  1ZLJ A;  4U0Y A;  3E6D A;  1Z6R A;  5HS9 A;  4IF4 A;  1E2X A;  1G3S A;  2X4H A;  3G3Z A;  3FZV A;  2EB7 A;  2YR2 A;  2FMY A;  4HQE A;  3ZPL A;  2YX7 A;  2CO5 A;  3BPX A;  2HDC A;  2NRA C;  1TNS A;  2P4W A;  2XGX A;  3IHU A;  2EK5 A;  2FBH A;  4IHT A;  2XHK A;  1MJB A;  5ICC A;  4IPA A;  4RAY A;  4IRH A;  2DI3 A;  2QWW A;  4UV8 A;  3EYY A;  4KMU X;  2DQL A;  2EV5 A;  1YS6 A;  3IWF A;  5KVR A;  2DW4 A;  2XAH A;  1RIO H;  1B59 A;  2ESN A;  4Z2Y A;  2RQP A;  4BH9 A;  2CQK A;  1BIB A;  3U1D A;  3TQN A;  3I54 A;  2RN7 A;  2Z5U A;  2XV4 S;  2ZJ2 A;  2M5W A;  2YX4 A;  2IA0 A;  4HZF A;  4XSX F;  5JVT A;  2VOD A;  3MFK A;  3FHZ A;  1BBY A;  2RV8 A;  2VBY A;  2YPR A;  5CVR A;  3WTZ A;  3HRM A;  5BOX A;  2MBF A;  3GF2 A;  4P5O A;  3O3K A;  3VOE A;  2MLG A;  4PCQ A;  5HDN A;  4A2U A;  2K27 A;  1K79 A;  3ULQ B;  5ILV A;  4N9H A;  1U8R A;  1Z7U A;  5ICE A;  3P9I A;  4L0Z B;  4HAM A;  1ZH5 A;  1AOY A;  1G4D A;  4RB2 C;  1SD4 A;  3ZMD A;  2NYX A;  4HQM A;  1H9G A;  3BOQ A;  2GAU A;  3ZN1 A;  2O8X A;  4H0E A;  3K1P A;  1IXS B;  1IN8 A;  4I02 A;  2KJB A;  4G8X A;  5IT9 Z;  1JHF A;  2G7H A;  3Q5F A;  2GZW A;  4KA4 A;  4BHB A;  2EFP A;  5FB2 A;  3EQL F;  4MNU A;  5K1Y A;  1XDS A;  2QQA A;  1ZLK A;  3WTT C;  4EJT A;  5D6E A;  1IF1 A;  5JR3 A;  2RGV A;  3WTS C;  5AON A;  1TNT A;  3I4P A;  3RIR A;  1MD0 A;  6PAX A;  3JAM K;  1QO0 D;  3MZY A;  3ZMZ A;  3CUQ C;  2M87 A;  1NHA A;  3HTU A;  4AIH A;  1SD7 A;  5D5V B;  1KQ0 A;  2F5C A;  2FF4 A;  1FSE A;  2RC4 A;  3EYI A;  3VB2 A;  4I0B A;  3C3W A;  2P8T A;  3KFW X;  5F6F A;  4ZH4 F;  2PQ8 A;  1H0M A;  2ZBK A;  1PDN C;  1IXR C;  1U3E M;  3JW4 A;  3RYR A;  2DU9 A;  3IC7 A;  4KIC A;  4HBL A;  5ICF A;  2WV0 A;  4EJU A;  5E17 F;  5DEQ A;  3M9A A;  2LDU A;  4CDG A;  3I71 A;  2FQ3 A;  2IVM A;  5CVJ A;  4LJZ F;  1OPC A;  4O6J A;  3HHH A;  2OAZ A;  2STT A;  1LEA A;  4ENJ A;  4LG0 A;  1OYW A;  4ZYD A;  4CO8 A;  2GXG A;  1U5T C;  3KLO A;  5F64 A;  1R7J A;  5L3D A;  3FM3 A;  2Z9O A;  4BAY A;  4JK1 X;  2W85 A;  1I5Z A;  2L3D A;  3RPQ A;  1I1G A;  4LGW A;  2M45 A;  5CVV A;  3L09 A;  2FNP A;  4EGY A;  2QQB A;  3JTG A;  3FX3 A;  3I59 B;  4OU0 A;  3QPH A;  4ZZD A;  1XMK A;  5DCF A;  4Q5S F;  2O6G E;  1SFU A;  4XLP F;  5D5X B;  2FSW A;  3F8M A;  3WTX C;  1OMI A;  2JSC A;  4LK1 F;  2Y48 A;  2DTR A;  4HA8 A;  3DP7 A;  4L5I A;  4N0B A;  2H94 A;  4KDP A;  1XN7 A;  2XAF A;  2DK8 A;  4O3M A;  3K2Z A;  3LWF A;  2IW5 A;  2VOP A;  2KIM A;  3FF5 A;  4KT5 C;  2XAQ A;  3QP5 A;  4Q4Z F;  3E6B A;  4S04 A;  4LLN A;  4UNO A;  1DDN A;  1D3Y A;  3WTV C;  5CLS A;  3KP3 A;  2FXA A;  1LJ9 A;  4OIR F;  1YTY A;  1IRF A;  4U0W A;  3KP4 A;  1O3R A;  1SFX A;  3ZMT A;  4HLY A;  2LF7 A;  2VBX A;  4OIO F;  3DFG A;  4HW0 A;  3V8L A;  4EJW A;  5K5O A;  4G7H F;  5KK1 A;  1XGN A;  2RKH A;  1KYZ A;  3GFI A;  1FYL A;  4M6Y A;  3KP5 A;  5DD4 A;  3VOD A;  5FO5 A;  1O7L A;  2K86 A;  1XCV A;  2MC3 A;  1DPR A;  4I98 B;  2PMH A;  2H09 A;  1K7A A;  4G7Z F;  3FM5 A;  5LHI A;  1LDD A;  2RDP A;  1JHH A;  2JPB A;  4EMS A;  2LNB A;  3HSE A;  4Y13 A;  4NQW A;  2ACJ A;  4YFX F;  1OKR A;  2MA3 A;  3RJP A;  2COM A;  1O3S A;  3RKY A;  1TW2 A;  4IRG A;  1C0W A;  3KEO A;  4WXC A;  5ERI A;  3Q9V A;  1UHW A;  1V4R A;  1BOA A;  1TQI A;  3I58 A;  1RZ4 A;  3J80 Z;  2RNJ A;  2FE3 A;  1LEB A;  3E3V A;  4ETS A;  4I09 A;  2HGC A;  4ASN A;  1TBX A;  4A0X A;  1D8K A;  4B8X A;  5E20 A;  2HQN A;  2ISY A;  3J81 K;  2MH2 A;  2P7C B;  3TOA A;  4A5N A;  1FYM A;  1V3F A;  4GYG A;  4FT8 A;  2PEX A;  4ENN A;  3KCC A;  3FWE A;  1CF7 A;  1HKQ A;  2NNY A;  1BC7 C;  5L3C A;  4JBA A;  3F6V A;  3TDU C;  3C18 A;  1RNL A;  1RI7 A;  1R23 A;  3JSP A;  5H6Q A;  4R79 A;  4RGR A;  4HV6 A;  4PGG A;  5HS7 A;  2PG4 A;  2DAO A;  1KU7 A;  4RS8 A;  4G94 A;  4EM2 A;  4LFU A;  4NHJ A;  1IAW A;  1KU9 A;  3K69 A;  2V1U A;  5HLG A;  1R1T A;  2BBY A;  2EJR A;  5DCM A;  3RKW A;  4MTD A;  2FML A;  1HXD A;  5LGU A;  3WG9 A;  4EM1 A;  1U5T A;  1QPM A;  5J8F A;  1FSH A;  3RPU A;  1S3J A;  5HVQ C;  1Z05 A;  2R7F A;  1BIA A;  2LF8 A;  1IUY A;  4CIC A;  2F2E A;  1GXP A;  1SD5 A;  2W24 A;  3GYH X;  4RGS A;  3ABU A;  1P4X A;  3M8F A;  4CGZ A;  2QYO A;  2A6E F;  1BI0 A;  1P6R A;  2QZ8 A;  2A61 A;  1PP7 U;  4BNC A;  5IT9 K;  2EFW A;  4I2O A;  2FBI A;  3K0L A;  3F6O A;  3NQO A;  5DYM A;  4ZZL A;  1FBS A;  1FX7 A;  2NS0 A;  5TJJ A;  4HLX A;  3ZMU A;  2IA1 A;  3S2W A;  4HDU A;  5LHH A;  1UST A;  1YQA A;  3P9K A;  3LAP A;  4L0Y B;  5E1W A;  2R7D A;  2CFX A;  4CHU A;  2V1X A;  1ON1 A;  1EH8 A;  2M8E A;  2ZO4 A;  3I64 A;  1KA8 A;  3LA3 A;  2P7V B;  1YO5 C;  4HYE A;  3O6B B;  4WCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...