4HX8A

Structure of metal-free mntr mutant e11k
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
SMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of the A and C Sites in the Manganese-Specific Activation of MntR.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator MntR
total genus 53
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hx8A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 4hx8A02
5ICGA 3I64A 3QP5A 1C0WA 3J80K 3KZYA 4A0ZA 3EQLF 2XAQA 3ZMUA 3GEZA 5K5QA 5LGNA 1ZG1A 3ZMZA 3I5UA 4MHGA 2AXLA 3TDUC 1DDNA 1IRGA 3ECOA 1IF1A 3OV8A 4M9XA 4Y15A 3HTUA 2PFBA 3MZYA 4AVPA 4CYDA 3WTYC 1J59A 2EA4A 2ZMEB 1XB4A 2P6SA 1T0FA 4M73A 3JSPA 2GQQA 1W5SA 3CLOA 2XAJA 1UHMA 4K2EA 3DPTA 4KMFA 4U0VA 3K2ZA 1R22A 3K9TA 3BZ6A 4G7ZF 1BI2A 1H9TA 1I6XA 3RIRA 2YX4A 2EJRA 3CUQB 1KU3A 5HS7A 2EB7A 1QNTA 3ABUA 4Q5SF 2HKXA 3GXOA 4M6YA 5ILVA 3O6BB 2W85A 3WTXC 3WGIA 3NQOA 4YIIA 1IUYA 2HZTA 2DBBA 3G73A 4XRFA 1HBXG 1HW5A 5FFXA 3LSTA 1BI3A 2JT1A 1DUXC 3FM3A 2UXXA 3L7WA 3C18A 2W57A 4KT5C 1R1VA 3HSFA 1G6NA 1G3SA 2PMUA 4MNUA 1F9NA 2DO7A 1XGSA 3U2RA 2K86A 4LG0B 2Y0MA 4LLLA 3TO6A 2QM3A 3GF2A 4HZFA 4ENNA 4MEYF 4R79A 2MD5A 1GXPA 1T2KA 1RUNA 4M72A 3K1MA 3MZHA 2NAZA 1EV7A 5LHHA 4ON0A 1LDKB 4AD9A 3JAMZ 5A2QK 1LVAA 3C3WA 3FMRA 2L3DA 4NHJA 3GUDA 3QPTA 1YG2A 2IA2A 1ZH5A 2DTRA 2JPCA 1G4DA 1FYKA 4CO8A 2Z99A 1O3SA 5LRSA 4HLXA 4DNCA 3SXYA 1EH8A 3R4KA 5KVRA 3E6MA 3ABTA 1S3JA 3PQJA 1IN7A 2FRHA 5CVIA 2HKOA 4L9TA 3BDDA 4QWQA 4LLGF 2XRNA 4RB2C 2L01A 1ZHFA 4WCGA 2QQAA 1KU2A 5H6RA 1P4XA 2BE5F 3E6DA 1W4MA 4RB0A 2ZJ2A 2LDUA 4EGYA 2HYGD 2W24A 2CG4A 3DKWA 2ZFWA 1OMIA 1CGPA 3JSOA 5DCMA 4OIOF 4M9ZA 2KIUA 3O3KA 1LB2A 1W5TA 3GYHX 2WTEA 1U78A 1O57A 1ZN2A 3I54A 2HWVA 4G7OF 5ICCA 1OR7A 2VN2A 3HRSA 3ZP5A 1MGTA 3BPVA 5CJ9A 4XLNF 4A5MA 4HX7A 4EJTA 3TOAA 2GA2A 2VOOA 1USSA 3FX3A 4A2UA 4HX8A 3GWZA 4RAZA 2FXAA 1Q1HA 1XGMA 2FF4A 3H3UA 4IRHA 1XDSA 5HLHA 4EM0B 5BPIA 2PN6A 1GXQA 1B4AA 5D4RA 1T39A 3VODA 4HV6A 2M30A 4XBFA 5CVUA 3BJAA 5EEHA 5CVRA 2M45A 1OYIA 2VC0A 4EJOA 2QQ9A 4ESFA 5JI6A 1TQIA 4MEXF 4AIKA 4P9UA 3E6CC 1ZLKA 3WTWC 2FSWA 2FOKA 2A5YB 5H20A 3T8RA 2R7FA 2Q0OA 3TGNA 2LKPA 4L5JA 1SD6A 5L3EA 5JR3A 2FEZA 4UV9A 2UZKA 4HOBA 3I58A 2RC4A 1KQ8A 4LJZF 3F23A 1LQ1A 4G8XA 4EGZA 3VB2A 2WC2A 1FBUA 2RN7A 4ZZDA 2KIMA 2D45A 2ACJA 1UB9A 2VC1A 1X3UA 2R3SA 2E1CA 5FFZA 4IRGA 3L2CA 5BMZA 1HXDA 3ELKA 4M71A 1XSXA 3F6OA 3M9AA 4UHTA 3KEQA 3LWFA 2F2EA 4QLCU 5BPDA 4EJWA 1K78A 5J8FA 4LGWA 4PCQA 1IZ1A 4WX9A 2HTJA 1O7LA 2D1HA 3I4PA 4ETSA 2DAOA 3RDIA 4G7HF 3HRUA 2CW0F 4CZZA 2H09A 3LAJA 3CUQA 2F5FA 1F4KA 1ZRCA 3FF5A 2GXBA 4U88A 1E2XA 2M8EA 2LNBA 3HUGA 1XGNA 4BHPA 1U8RA 3B73A 4U7DA 2HR3A 3FXUA 5DEQA 5D5WB 4ENKA 4BYYA 4B8XA 1EH7A 1DPRA 4LFUA 1ODDA 3CJNA 4AWXB 3BJOA 1XSVA 2YX7A 2DU9A 3T1BA 4YIFA 3K69A 2ZMEA 3MWMA 1SMYF 4GGGA 1U2WA 2JZYA 5E8IA 1B1BA 4UVBA 4UUVA 1FY7A 1ULYA 2ZXJA 2L4MA 1R7JA 2P6TA 4RGUA 3KLNA 2DPDA 2IP2A 1TNSA 2L4AA 1HW2A 4I2OA 2GA1A 5FO5A 1ON2A 2DPUA 1D8JA 2HFHA 1WI9A 3WU1B 1YYVA 1T38A 1W7PB 4L5IA 2MBFA 2V9VA 3SQNA 3ZN0A 5F64A 1I27A 3WG9A 2HTSA 4HF0A 1KA8A 3CDHA 1HKQA 2YPRA 3SZPA 1DPUA 3P7NA 3F8FA 1B9MA 4ZH4F 5IT9K 1KYZA 5D5UB 5ICFA 1TTYA 2FE3A 2V79A 4KA4A 2XKPA 2ZO4A 4PDKA 1BJAA 2HYFA 2COMA 2XVCA 4U7BA 2PG4A 3DPLC 4NQWA 4I0BA 1W7PA 1SFXA 5K1YA 3W6JB 2VE9A 4MQ9F 3WGGA 1RZ4A 3NEUA 1XMKA 4RGXA 2P5KA 3LA7A 4HQMA 1P6RA 1YQAA 1PP8F 4EMSA 4L0ZB 2KKOA 2WV0A 1QBJA 2HEOA 3ZMSA 4KDPA 1MDMA 1Z6TA 3KP7A 2O03A 3M1EA 2K02A 4LG0A 2O3FA 1XMAA 3T8TA 4CHUA 2NYXA 2JPBA 2HQRA 4F7ZA 1ZG5A 1EH6A 2M87A 4FX4A 2DK8A 5HOOA 2V1UA 1ZYRF 2KIFA 3J81Z 1MZBA 2RGVA 4A0YA 2E7XA 3J7AO 3GO5A 3D5LA 4AIJA 1YW7A 1JHHA 2VONA 2VBZA 4OIQF 2HDCA 2DI3A 4U0WA 1U5TB 4GO1A 3ERED 4FHTA 4D0PA 3EUHA 3JTGA 1TW3A 3U9GA 3W6KB 2GAUA 2O6GE 2LSOA 2P7CB 4PGHA 2QQBA 4LLNA 3KP6A 1FOKA 2EA2A 4EV0A 3HSRA 3IWFA 2KJBA 3KZZA 2STWA 1W7PD 1YIOA 2QBYA 1IW7F 1YFHA 2CQKA 5L3DA 1LDJA 4O5VA 1KQ0A 5J8CA 4PGGA 3ZQ7A 3K0LA 1FBSA 3JW4A 3GX4X 3S2WA 3BOQA 4XSXF 1H9GA 2A6HF 2FMYA 2F5DA 3TDZC 3T0YA 1QGPA 1Z6RA 1FPQA 4TV7A 1R1UA 3EYYA 5IT9Z 2VOPA 4YFXF 1H0MA 3E5XA 3RJPA 5D5VB 1WRJA 1K78B 4A0XA 4IXAA 2XASA 5L3FA 2EFOA 1T6SA 3V8LA 1AWCA 1S6LA 3REOA 5BOXA 1BN5A 5KK1A 5DD8A 3HYIA 4EQQA 1SD7A 1U5TC 2A6EF 2HS5A 3E5UA 3J80Z 2Y75A 5ILSA 2D2WA 1TLHB 4P5OA 2XIGA 4EM2A 3ROUA 4KUMA 1BM9A 1ZGJA 1HW1A 4LB5A 3E97A 2ETHA 1TW2A 3LFKA 5LEKA 2QBYB 1QZYA 5D4SA 4I02A 5LEJA 4Z2YA 2OAZA 2K27A 1FP1D 3R0JA 3WE3A 3QRFF 2EFWA 3IRRA 1F5TA 1K6OA 4Q48A 1P4WA 1E17A 1O3TA 2Q8KA 3ZPLA 2J5PA 3KP4A 4L18B 2DFIA 2BEOA 2M5WA 3TO7A 3AAFA 5J6XA 5CLSA 4EM1A 2H27A 3ZMDA 5LGUA 2A3SA 1TQPA 2IA0A 4BH9A 2CWEA 1R00A 5TRDA 5D5XB 4WWCA 1S7AA 2QUFA 1YS6A 1SMTA 3EETA 1IAWA 1XCBA 4G9YA 4P9FA 1B9NA 4ZYEA 1ZLJA 5DUIA 4GYIA 2M1BA 3KE2A 4IVNA 5JHUA 1QO0D 3NRVA 1OPCA 3ECHA 4GYGA 4I7HA 3CTAA 4MQVA 3G3ZA 2CFXA 1GVJA 3F3XA 4HDUA 4FX0A 3FMSA 4ENJA 2DK5A 1HKSA 3MEXA 2MC3A 5K5OA 3F6VA 4NB5A 4HDVA 3PFIA 5DUKA 3F8CA 4WXDA 2NS0A 4WXCA 4KFCA 4N9IA 2G7HA 2D1VA 4BXUA 1JXSA 3K1NA 3PQKA 4CXFA 3IC7A 4A6DA 5AONA 3WTVC 2J5OA 3HHHA 3E5QA 1J5YA 5ICEA 3P9KA 2PJPA 4A12A 2E1NA 2ESNA 2EV5A 2X0LA 3CUQC 4I01A 4O3MA 4Y13A 1Z9CA 1FX7A 5E18F 2G9WA 2Z5UA 5E20A 3P9IA 4LK0F 3FMQA 3BP8A 1P92A 3RPUA 1RI7A 1Z7UA 1YO5C 1FSHA 5D8LB 1XCVA 2LF7A 5BQTA 1A04A 1SD5A 1G3WA 4H0EA 5DDGA 5JVTA 2A69F 4IF4A 5CYVA 1AOYA 1ZARA 2CO5A 2QENA 3RKYA 3R61A 4FT8A 5FGMA 3C7JA 5L3BA 2BGCA 4HQEA 5K5RA 3R0AA 6PAXA 2QWWA 2YU3A 4BAYA 1SFUA 1ONVA 3T5XA 4L9JA 1BIBA 3HRMA 1U6GA 3KCCA 5JFRA 1I5ZA 5EEGA 2XAFA 2OZ6A 5E17F 2YR2A 2ISZA 3ZMTA 1IN5A 3EYIA 2AS5F 2HOEA 2EK5A 1BC7C 1IN6A 1OYYA 2QZ8A 1TNTA 5D8KB 4O6JA 2PBIA 3F8MA 3ML6A 3TQNA 3WE2A 4CDGA 2MLGA 1XGOA 2Z9OA 3MFKA 1ZREA 3DFGA 1CF7A 2Z3YA 2XUBA 3N4MA 2QVOA 5LLQA 3CO7C 2V1XA 1OKRA 3ZMVA 4WK8F 3R6SA 3I71A 3Q5FA 3VFZA 4IPAA 2EV0A 4PZJA 4RS8A 1U3EM 1D8KA 1PUEE 3D0SA 3LA3A 2MLKA 4OIPF 4UVAA 1KQ9A 3L00A 3LQRA 4HLYA 1D5VA 3I59A 2YSRA 3F21A 3QAHA 2K4BA 2EFPA 3GLXA 3J81K 1JHFA 2XAHA 3Q9SA 1Z91A 4Q4ZF 4N0BA 4WF2A 1BBYA 4EVIA 2VXZA 3IKTA 4ENMA 1MJ9A 3QP6A 5FD6A 1JE8A 1CF7B 2F5EA 1REPC 3HRTA 2WWYA 4HAMA 1U5TA 3ULQB 1S7OA 1R58A 3GW2A 4IHTA 2MA3A 2V1DA 1Z1DA 3QOPA 1FWZA 3KP5A 2FNAA 1UCRA 3RKXA 3N97A 1LNWA 4HF2A 3WTSC 3I59B 3V7RA 2OBPA 4JK1X 3F72A 3RI4A 1SFEA 4HYEA 4KIFA 3WGHA 4GCVA 1ZG3A 1WQ2A 1ON1A 2GWRA 4KIBA 2DQRA 3V7SA 3M8FA 1FLIA 3IKVA 3H3ZA 3K1PA 3RYPA 2DW4A 2HQNA 2RV8A 4ASNA 2VODA 4HV5A 4P96A 3RKWA 4BQAA 3F8BA 4HW0A 1ZRDA 2P5LC 4UXNA 2XKOA 3IHUA 4DQ2A 4RB3C 4RGRA 5ILUA 2FMLA 3DF8A 3M7GA 1FNNA 4A6EA 3FXQA 4KN7X 4KN4X 4CICA 2O0YA 5F6FA 5E8GA 4OOIA 5DYMA 4Q47A 4BHBA 5IT3A 3HOSA 1TBXA 5AIQA 2P7VB 1WSUA 3JAMK 3SFZA 4XLPF 1STZA 5HS8A 5LHIA 3DXJF 1R36A 2QYOA 5HS9A 2IVMA 1O3RA 1I1GA 3KP3A 1R5HA 5HDNA 4A5NA 4S04A 1KU7A 2RNJA 3F22A 2L54A 3FXRA 1KU9A 3V4GA 3RTRA 4BHCA 2BBYA 3WTUC 4XSZF 3LQQA 1BC8C 2XV4S 4M6XA 2OA4A 2NNNA 2IT0A 5HDKA 4EJVA 3FHZA 4KIGA 1D3YA 2IJLA 1FZPB 5ERIA 2F5CA 2BYVE 1VTNC 1IXSB 4MTEA 5LHGA 2GIVA 1T98A 4S05A 1J2XA 4OMZA 3CUOA 1ZRFA 2E7WA 4UNOA 5FD5A 4ZYHA 1J0RA 2PQ8A 4AIHA 2X4HA 5LRRA 1BI1A 2DLLA 4N9HA 5D6FA 1IXCA 4M74A 2ZBKA 1G3YA 2FU4A 1BI0A 2LF8A 3MQ0A 1IN8A 2PEXA 1SD4A 1UFMA 1MD0A 1MDMB 2P4WA 3RYRA 4ESBA 5FB2A 2VBYA 1L0OC 2A61A 3M8EA 2ESHA 4G6QA 2EFNA 2P5VA 4BNCA 1J7KA 5ED4A 1Y0UA 2ZNYA 1J9IA 2L02A 3BWGA 1IXRC 3KFWX 2Q2EA 3BROA 3WTTC 5HLGA 2RKHA 1FYMA 2C6YA 2FQ3A 5E1WA 5HVQC 5L3CA 3E6BA 1LDDA 4M9SA 2OD5A 3HIFA 2JTVA 4IJAA 1SAXA 2ZKZA 2XHKA 4LMYA 1FBQA 4E70A 4ZZLA 2FBHA 3GFJA 4P55A 2STTA 3E3VA 2GZWA 2VE8A 4JBAA 3GFIA 2O8XA 1XSDA 5DCFA 1ZAOA 2ELHA 5BS6A 1XDUA 5LBQA 1JGSA 3TKYA 3TO9A 3P9CA 2K4JA 1PP7U 2EWNA 5CVJA 3GFLA 3O2PE 4EJUA 1YS7A 3I53A 2OZUA 1I1SA 1MKMA 2PLYA 3F8NA 1IRFA 4B09A 2MH9A 3U1DA 1FT9A 3LA2A 4KYWA 1IN4A 4ZYGA 5CVVA 4R8HA 1PDNC 1O7FA 4IRIA 3GZ5A 3IRQA 5DV5A 5H6QA 3HHGA 3HTSB 5DD4A 1BIAA 1UHWA 1HSTA 4U0YA 2MH2A 4HF1A 2EFQA 4HX4A 1LEAA 2BV6A 3QPHA 1P2FA 4OU0A 2VT2A 3IWZA 1ZGAA 2RDPA 3TOBA 1HKTA 4L9VA 5DCMB 2RVCA 5FLXK 1S8NA 4RGSA 2CSOA 2XAGA 1HQCA 4OMYA 1G3TA 3V8KA 4YFKF 5L3GA 3MCZA 1L3LA 2TDXA 5TJJA 1GHCA 4OIRF 3WU0A 2H6CA 3COAC 1FP2A 2H6BA 3R60A 2HGCA 1XN7A 3WTZA 2W84A 5LGTA 1RUOA 2UWMA 4YFNF 1O3QA 3SZTA 4JQFA 1QZZA 1V4RA 3Q9VA 4LK1F 3QU6A 2KJCA 2JRTA 4I0AA 2ZCWA 2ZNZA 1RIOH 5HDGA 3I0TA 1P4AA 1TQMA 2K7LA 1B6AA 4LB6B 3HSEA 2NRAC 1QPMA 1OYWA 5A2QZ 1MJAA 2FBKA 3DP7A 3V7CA 2Y48A 1NHAA 2H94A 2VBWA 3WODF 2G7UA 1QQIA 5E1XA 2JSCA 5AIPA 2IPQX 2ADUA 1YLFA 3GZ6A 4YG2F 1MJBA 5HLIA 3GFMA 4RB1A 3FWEA 2R7DA 2VBXA 4WXHA 2RQPA 4KMUX 3CO6C 3KP2A 3H92A 2GXGA 3LAPA 2OU2A 3HOTA 4IHSA 3BY6A 2DQLA 1XD7A 3QU3A 2FNPA 1HSJA 3ZN1A 1BOAA 1LJ9A 1USTA 5FLXZ 2PI0A 1WKMA 1V3FA 1KYWA 3KLOA 1J75A 2ISYA 3JTHA 1S29A 5F1RA 1LEBA 4LD5A 1YTYA 3RPQA 1R23A 1R5GA 4UVCA 4HA8A 4MTDA 2PMHA 2FA5A 1K79A 3OOPA 4UV8A 2EV6A 4OINF 1K7AA 3DEUA 1Z05A 4L0YB 1F1ZA 1FSEA 4HBLA 2IA1A 2OQGA 2VT3A 2NNYA 5D6EA 3DV8A 3DQVC 1KGSA 1FC3A 3BJ6A 1DP7P 2DT5A 1YW9A 2Z33A 3MAJA 4KNYA 4R1HA 3GVAA 3KETA 3C1DA 2O61A 2V6CA 3ISPA 1B59A 4Y17A 3FM5A 2OQRA 2B0LA 2QLZA 1WWXA 2XROA 3VEPA 4ESJA 3B02A 2W25A 3BPXA 4I98B 5E1ZB 4KICA 2CYYA 2P8TA 4G94A 4ZYDA 2IRFG 2A07F 1R1TA 2UXNA 3L09A 4I09A 2XGXA 3FZVA 3EDPA 4RAYA 3IL2A 1FYLA 3V8JA 4G6DA 4GXOA 1RNLA 4MGRA 3KEOA 2FBIA 2KRFA 2CGPA 4CGZA 2A68F 1YW8A 3SHFA 3VOEA 2IW5A 3L9FA 4L9NA
chains in the Genus database with same CATH superfamily
2KZVA 5ICGA 3I64A 3QP5A 1C0WA 5J1RA 3J80K 1K61A 3KZYA 4A0ZA 3EQLF 2BZTA 2BHYA 1EA3A 1H88C 2XAQA 4ZDOA 3MVPA 3ZMUA 1YITI 3GEZA 3S93A 5K5QA 3DLLF 5LGNA 4JX4A 4BY1J 3HC7A 4UY8I 2LY2A 1ZG1A 3ZMZA 1QZEA 3I5UA 4MHGA 1IO2A 2LY1A 1WJFA 1VQNI 2AXLA 3TDUC 1DDNA 1IRGA 1R6RA 3ECOA 1IF1A 3OV8A 1HC8A 4M9XA 1R49A 1VQ4I 1V5EA 2LFBA 4Y15A 1AKHB 3HTUA 2PFBA 1PVEA 2XB0X 3MZYA 4AVPA 4A3BJ 4CYDA 4PFOA 3WTYC 1J59A 2EA4A 2ZMEB 1XB4A 4RLQA 2P6SA 1T0FA 3CMYA 2JUGA 5HODA 4M73A 3RKQA 3JSPA 3OIOA 2GQQA 1W5SA 4FQGA 3CLOA 2XAJA 5J4VA 1JUPA 2CQQA 1F43A 2LYCA 1UHMA 3OIQA 4K2EA 3DPTA 4KMFA 4U0VA 2DMQA 4UB8C 4HNUA 3K2ZA 4XKWA 1YRNB 1R22A 4DJAA 3JRGA 2HNHA 3PJRA 3K9TA 3BZ6A 4G7ZF 1BI2A 1H9TA 5GPAA 4BU2A 2VQCA 5DS9A 2MUNA 2D5VA 2WY7Q 1I6XA 1OFCX 3L1PA 3RIRA 4A69C 5EEAA 2L9NA 2YX4A 3FHNA 2EJRA 3A01A 3CUQB 1KU3A 5HS7A 4LIUA 2EB7A 4BJ5C 3EUKL 3E1SA 1QNTA 3ABUA 4CCJA 4Q5SF 4IZZA 3GBGA 2HKXA 3GXOA 4M6YA 5ILVA 3L2VA 2K3FA 3OWTA 3O6BB 2W85A 3WTXC 2JN6A 1GLNA 1BL0A 3WGIA 3NQOA 4YIIA 1IUYA 4NQWB 1WJDA 2HZTA 2NXNB 2DBBA 3G73A 3QYFA 1OCRH 5B1AH 4XRFA 1HBXG 1HW5A 5FFXA 1Y8RB 3LSTA 2GLOA 1BI3A 4NDLA 1T95A 2GXAA 2E71A 2JT1A 1DUXC 3FM3A 2UXXA 1DU6A 1BOBA 1I50J 5FROA 2BY3A 3L7WA 2IS4A 3C18A 2W57A 3PUBA 4KT5C 5FLMJ 3H5AA 1R1VA 5B66C 1LE8B 3HSFA 2LRDA 1G6NA 1G3SA 3W2WA 2EIKH 2PMUA 4MNUA 2M3AA 1F9NA 2DO7A 1XGSA 3U2RA 3FKIJ 5C44J 2K86A 3MN2A 2EBIA 3DBLB 4LG0B 2Y0MA 2ZXHA 4LLLA 3TO6A 4J19A 2QM3A 3GF2A 4HZFA 4ENNA 1I3AA 4MEYF 4R79A 3RPUD 1LUJB 2MD5A 4PSXA 1GXPA 1T2KA 1RUNA 2X6YA 4M72A 3K1MA 2CS3A 3MZHA 1H8AC 2NAZA 1EV7A 5LHHA 3RSNA 4NBQA 4ON0A 4A3CJ 1LDKB 2ZXIA 4AD9A 3B6AA 3JAMZ 1MMNA 5A2QK 1LVAA 3C3WA 3FMRA 1ETOA 1D1CA 2L3DA 4NHJA 3GUDA 1VI0A 3BQYA 2K40A 3QPTA 1YG2A 2IA2A 3RQIA 1PUFB 1ZH5A 2DTRA 2JPCA 1WJEA 1G4DA 1FYKA 1Z67A 4CO8A 2G0EA 2Z99A 2MC4A 1O3SA 2DOAA 5LRSA 1IRXA 1SEUA 4HLXA 1LVKA 4S0HB 3H1CA 1W36C 1Y6IA 3G4SI 4F93B 4DNCA 5H2FC 1BR2A 3SXYA 4AUXA 1EH8A 3R4KA 2GIZA 4RDUA 1ZELA 4BS9A 2M4KA 2Y0SA 5KVRA 4D7NA 3E6MA 2R7VA 2DJIA 3CCLI 3OSGA 3W2VA 2WADA 3CZ6A 5B3SH 3ABTA 2KISA 1S3JA 3HGYA 5IYBJ 3PQJA 3OYNA 1IN7A 2FRHA 5CVIA 2HKOA 4L9TA 4GDFA 5FKMA 3BDDA 4QWQA 4LLGF 2XRNA 4IOCF 4RB2C 2L01A 5GTIC 2XPWA 1LFBA 1ZHFA 4WCGA 2QQAA 3J7YJ 1WJCA 3H36A 1KU2A 5H6RA 1P4XA 1A35A 4M6VA 3S3NA 2BE5F 3E6DA 1W4MA 4RB0A 2ZJ2A 2LDUA 3BCAA 3FXOA 4EGYA 2HYGD 2W24A 1WCMJ 3ZQHA 4DYCA 2CG4A 2CH0A 2HQ5A 4Y4RA 2OV7A 3DKWA 2LG4A 2ZFWA 1OMIA 2BXYA 2PX9A 2DA6A 2ZSIB 1CGPA 5GADJ 3JSOA 5DCMA 3SEQA 1GT0C 2EILH 3BR0A 5GPCA 4C3HJ 4OIOF 2RQQA 3CDLA 2JMWA 1V55H 2W82A 2XAUA 4M9ZA 4BKXA 2KIUA 3O3KA 1LB2A 1W5TA 3GYHX 2WTEA 1U78A 1O57A 1ZN2A 1UAAA 4DBRA 1RKWA 3C2BA 3LFUA 3I54A 2HWVA 4G7OF 2BY0A 1WI3A 1Y0NA 5ICCA 3H9JA 3OYBA 1U9NA 1X1DA 2OCCH 1OR7A 2VN2A 3H0GJ 2VJ4A 3HRSA 2Y69H 3ZP5A 1MGTA 1OQYA 3BPVA 5CJ9A 4FE7A 4XLNF 4A5MA 4HX7A 5F0HA 1B8IA 4EJTA 3TOAA 2GA2A 4IHVA 2VOOA 9ANTA 3FX3A 1USSA 1MNDA 2DCEA 4A2UA 5JVGF 3ZQIA 4HX8A 4A3KJ 3GWZA 4RAZA 1Y56A 2FXAA 1Q1HA 2V1NA 1XGMA 2FF4A 3H3UA 4IRHA 3IV5A 4DZJA 1XDSA 5HLHA 4EM0B 5BPIA 1BA5A 2PN6A 3HOVJ 1GXQA 1B4AA 1SAUA 2VPRA 4HPQA 3HOXJ 1TT0A 5D4RA 1T39A 3VODA 2R7TA 4HV6A 2M30A 4XBFA 2Y0SN 5CVUA 2WAQA 3KX2A 3BJAA 2LY9A 4BEHB 5EEHA 5CVRA 2M45A 1VQLI 1OYIA 1SVMA 2VC0A 4EJOA 2QQ9A 4ESFA 2DT6A 2KL4A 5JI6A 1TQIA 3LNQA 3VYUB 3OYDA 5GP9A 3LSPA 4MEXF 4AIKA 4P9UA 3E6CC 1ZLKA 3WTWC 3K4KA 2FSWA 2FOKA 2A5YB 2B9SA 5H20A 3T8RA 2XSJC 3WG7H 4W97A 3MD2A 3KYLA 2R7FA 2Q0OA 2O9LA 3BLYA 1S5LC 3TGNA 2LKPA 1JT6A 5E3LA 4L5JA 1SD6A 5L3EA 3H9QA 2FEZA 5JR3A 4UV9A 2UZKA 1PYVA 4HOBA 3GMEA 3I58A 3RZOJ 4V2FA 2EQRA 2R7QA 2HDDA 2W48A 3ERMA 2ECBA 4BDZA 3LSJA 4BE2A 3K4BA 4XRMA 1D1BA 2RC4A 1KQ8A 3JCUC 3HG9A 4LJZF 3F23A 1LQ1A 3GTGJ 1A31A 4G8XA 4EGZA 3G1OA 2BVLA 3DU6A 2Q2EB 3VB2A 1JT0A 4E6KG 2WC2A 2B63J 2DYSH 1ITYA 1FBUA 2RN7A 1IC8A 4ZZDA 2R5ZB 2KIMA 2D45A 2ACJA 1UB9A 2VC1A 2ZXWH 4KJZA 4M3EA 1WFXA 4HEA2 1X3UA 2R3SA 1R71A 2E1CA 5FFZA 2TCTA 3OYCA 4IRGA 1W36D 3L2CA 3O8HA 1FEXA 3J7ZI 5BMZA 2K3PA 1HXDA 3ELKA 1JJ6C 3AG4H 4M71A 2IGOA 3S2DJ 1XSXA 2CQNA 3BR6A 3F6OA 3M9AA 4UHTA 4CYCA 1XG1A 2F4IA 3KEQA 3LWFA 5IP6A 2F2EA 4QLCU 4DYRA 1V54H 5BPDA 4PUSA 3ZQQA 4EJWA 2KDZA 1TT5B 1K78A 4GFBA 5J8FA 2L9RA 4LGWA 4HNTA 4PCQA 1IZ1A 4WX9A 1U9OA 2HTJA 3KYCB 3NARA 2DA1A 1O7LA 2LTPA 2D1HA 3H5RA 2KP6A 1BJZA 3I4PA 2ZSHB 4ETSA 4B44A 2DAOA 5B1BH 3RDIA 2E2HJ 2XPVA 4G7HF 4LOCA 3HRUA 1X2NA 2CW0F 4OAYA 4XOPA 3J81R 3LSIA 1MH4A 1ZR2A 1ZKGA 4FASD 4CZZA 1R5ID 2H09A 1UMQA 3AG3H 2NOJB 5CQGA 2HVRA 3LAJA 4IL6C 3CUQA 5J4YA 1DP3A 2F5FA 1F4KA 1N78A 1ZRCA 2JSPA 3FF5A 4B3XA 2HVQA 2UV1A 2GXBA 3FXLA 2DA7A 5EDNA 1JTXA 2X98A 5GAHJ 4U88A 1E2XA 2M8EA 3BR2A 2LNBA 3S1MJ 4IQJA 1VQ7I 3HUGA 1D1AA 1XGNA 4BHPA 1U8RA 3B73A 2VPLA 4U7DA 1LFPA 2HR3A 2P81A 1T8IA 1X4PA 1HF0A 3FXUA 2HOSA 5DEQA 2V7FA 4X6AJ 3U21A 5D5WB 4ENKA 4DIQA 4BYYA 4B8XA 1EH7A 1DPRA 2HXIA 1K83J 2VQLA 2JWTA 2HZDA 2IEKA 4LFUA 3D5RC 1FIAA 1ODDA 3IAM2 3CJNA 4QPOA 4AWXB 3BJOA 1XSVA 3X2QH 3CCVI 2YX7A 2DU9A 3VYSB 3T1BA 4E7SA 2LK2A 4XKCA 2BXZA 3IH4A 5HNFA 3PIPF 4YIFA 3H0DA 3K69A 2ZMEA 3VDXA 3MWMA 2BHZA 1SMYF 1MNMC 4GGGA 1U2WA 2F4MB 2JZYA 4BL0B 3EUHC 4P1WA 5CQEA 2KT0A 5E8IA 3JRBA 2W7NA 2JA6J 3LSGA 5IP9J 1B1BA 4UVBA 4DW6A 4JOMA 4UUVA 1FY7A 1HOMA 2M0CA 1ULYA 1OISA 2ZXJA 2F5VA 1WH5A 2I10A 1D0ZA 2L4MA 2ELKA 1R7JA 2E1MC 2CW8A 3ASOH 2P6TA 3K4LA 4RGUA 3KLNA 3CC4I 2DPDA 3L2QA 4W1UA 1ACIA 2IP2A 1TNSA 2L4AA 3JRAA 1HW2A 5M3MJ 4DOZA 4I2OA 2GA1A 4ABZA 2XGDA 5FO5A 4N4NB 1ON2A 2DA2A 4II2A 2GOXB 2DPUA 1D8JA 2HFHA 1MBHA 1WI9A 3WU1B 1YYVA 1T38A 1W7PB 3JRHA 2CQXA 3VSLA 4L5IA 4M3BA 2MBFA 2EPFA 2V9VA 3SQNA 3ZN0A 5F64A 1I27A 4DGWB 3WG9A 2QKLB 2OF7A 3ZRGA 2HTSA 4HF0A 4E4HA 1KA8A 3CDHA 4C3JJ 1HKQA 2YPRA 1N75A 3SZPA 4LIVA 1DPUA 3P7NA 2R7RA 3GTMJ 3F8FA 1YHQI 3PL8A 1ZQ3P 1B9MA 4ZH4F 5IT9K 1KYZA 5D5UB 5ICFA 2XF7A 4PSWA 1TTYA 3FDYA 3BZKA 1HDPA 5GTHC 3OYIA 4LG3A 2E1OA 3ASNH 2JVHA 1LFUP 2FE3A 2V79A 4KA4A 4XICA 2XKPA 2ZO4A 4E7LA 4PDKA 2WAFA 1BJAA 2HYFA 4M3DA 3GCMA 1ETQA 2COMA 2XSDC 2XVCA 4U7BA 1B72A 2PG4A 3DPLC 4NQWA 4I0BA 1W7PA 4CCNA 1SFXA 4HG2A 5K1YA 2R5YB 2XF6A 3W6JB 2VE9A 4MQ9F 3WGGA 3TEDA 1RZ4A 3NEUA 2NVUB 5J47A 1XMKA 4RGXA 2P5KA 3HDDA 3LA7A 4HQMA 1P6RA 4J01A 1YQAA 4BUPA 1PP8F 3GLLA 2DDAA 4EMSA 3PIOF 4L0ZB 3HBLA 2KKOA 2WV0A 1R4NB 3DEWA 2X48A 4BBSJ 4X1EA 2OC6A 1VQ6I 1QBJA 2HEOA 3ZMSA 1XX5A 4KDPA 1MDMA 1Z6TA 3KP7A 3L2RA 4XLCA 1E3PA 2O03A 4XN3A 3M1EA 2K02A 3E7LA 2O3FA 4LG0A 3VYTB 2CQ7A 2F4OB 2VASA 2R0QC 1XMAA 3Q0UA 3BG7A 5FKOA 5TISC 3T8TA 4CHUA 4A3FJ 2NYXA 1SC7A 2JPBA 2HQRA 4F7ZA 3CJRB 3FXJA 1YIJI 3ABKH 1ZG5A 2YS9A 1EH6A 1GV5A 2M7BA 3CCUI 2M87A 4FX4A 2DK8A 2TRTA 3IUOA 3K6GA 5HOOA 1FIPA 5BNGA 2V1UA 1ZYRF 2KIFA 3H9GA 2XPUA 2L7MP 3QYEA 3A52A 3J81Z 1MZBA 2RGVA 1WJAA 4A0YA 4IQ4A 1W0TA 2E7XA 3J7AO 3GO5A 3ZQCA 2WY8Q 2V6EA 3D5LA 3J7AY 4AIJA 1OCPA 1YW7A 1JHHA 2VONA 2VBZA 1JKRC 4OIQF 5IPAA 2HDCA 4A3MJ 1ZR4A 2DI3A 4U0WA 1U5TB 2XC7A 4GO1A 2M4GA 4FHTA 3ERED 2Y2ZA 4D0PA 1XMXA 3EUHA 3JTGA 1TW3A 3U9GA 1MSEC 2A05A 2DYRH 3W6KB 4NNJA 1SVLA 3UKGA 1EKEA 2GAUA 2DOEA 2O6GE 2LSOA 2P7CB 1MH3A 2FQ4A 4PGHA 1VQOI 1XTAA 2QQBA 3OYLA 4LLNA 3KP6A 1JTYA 2K9QA 1FOKA 4B4CA 4A3EJ 2EA2A 4EV0A 3HSRA 3DU5A 1LPQA 3IWFA 2KJBA 3KZZA 5EJCA 2JQ7A 2STWA 3CQZJ 2M2EA 3K7AJ 1W7PD 1YIOA 2QBYA 5K7HA 1IW7F 1YFHA 3PNVA 2CQKA 1QVUA 4F92B 2E60A 2VKVA 3DPUA 5L3DA 1LDJA 4O5VA 1KQ0A 5J8CA 4PGGA 3ZQ7A 3ZOBA 1X1CA 5IP7J 2DFHA 3K0LA 4V19K 1FBSA 4FETA 3FXKA 3JW4A 3GX4X 3S2WA 5EGOA 3BOQA 4PJNA 4XSXF 2R7XA 1H9GA 2A6HF 2V4JC 5IYDJ 1DGWY 2FMYA 2F5DA 3OIPA 4RMNA 3TDZC 3NAUA 3T0YA 1QU3A 1QGPA 1Z6RA 3JAMR 1FPQA 4TV7A 1R1UA 2WA0A 5JLXA 3EYYA 5M5WJ 5IT9Z 4RLFA 2VOPA 3P5JA 4YFXF 5M5XJ 3GTOJ 4PFPA 1H0MA 3E5XA 3RJPA 2L7KA 5EZGA 5D5VB 1IGNA 1WRJA 2DMPA 1K78B 4BE0A 4A0XA 4IXAA 1H89C 2XASA 5L3FA 2EFOA 4JP0A 4PJ0C 1VFCA 1DU0A 2JA8J 1T6SA 2LKSA 3V8LA 1S6LA 4XLHA 3EUAA 3REOA 1AWCA 2WB1N 5BOXA 1OR7C 3A03A 5E3NA 1BN5A 5KK1A 4YIRX 3TW6A 2MSYA 4ZYAA 3HB9A 1BW6A 5DD8A 3HYIA 4EQQA 1SD7A 1U5TC 2VL8A 4F91B 2A6EF 2HS5A 2BW3A 3E5UA 3J80Z 2Y75A 5J40A 5ILSA 3SFIA 4DBQA 1X2MA 1TL8A 2JA2A 3OYEA 2D2WA 3HOZJ 1TLHB 2W4SA 4P5OA 3JREA 2XIGA 4XL9A 4XMYA 3ROUA 4EM2A 3E0JB 4KUMA 1BM9A 1ZGJA 2V26A 3H35A 2ID3A 1HW1A 1MMAA 2DMNA 3E97A 4LB5A 1FTZA 2ETHA 4C3IJ 3OYKA 1TW2A 3LFKA 4BEHA 5LEKA 3I56I 3TP3A 2QBYB 1QZYA 1TZLA 5D4SA 1BR4A 1WPKA 4I02A 1TWFJ 4AYBN 4B3AA 5LEJA 3S1RJ 1AA7A 4Z2YA 4UUTA 2OTLI 2OAZA 2CV2A 2K27A 4HNVA 1YRNA 1MBKA 3MKLA 1FP1D 1UG0A 1Z77A 3LSHA 3R0JA 5KAIC 2R7OA 3WE3A 4B1RA 2HVSA 3QPLA 3QRFF 2UUZA 2EFWA 3IRRA 1F5TA 3PUFA 1K6OA 1RR7A 2H8WA 2O5RA 1P4WA 4Q48A 1E17A 2Y9ZA 2I8DA 3S1NJ 1O3TA 2Q8KA 4Y33A 2LD5A 3ZPLA 1P9QC 2J5PA 4B48A 3KP4A 4L18B 2DFIA 2BEOA 2OPTA 3CC2I 2M5WA 3OMYA 3TO7A 3AAFA 2DN0A 4ZTJA 2NOGA 2BY1A 5J6XA 5CLSA 4EM1A 2H27A 4EATA 3ZMDA 2CW7A 5LGUA 2GM4A 2NVTJ 2A3SA 1TQPA 1Z7LA 3ZQFA 2IA0A 5TGTA 1X4OA 4BH9A 2CWEA 3S8PA 1R00A 1JJ8C 4XQFA 5TRDA 2MD0A 5D5XB 4WWCA 1A6IA 2DFEA 1S7AA 2MYSA 4EEFG 1MMGA 2QUFA 1ORKA 1X1PA 1YS6A 1SMTA 2F6CA 2QGUA 2Z16A 3EETA 5KNLA 1IAWA 1HDDC 3J7AW 3K4MA 2LOOA 1XCBA 4G9YA 4P9FA 1B9NA 4ZYEA 1ZLJA 5DUIA 4GYIA 2O7OA 2M1BA 1GUUA 3KE2A 1T33A 4IVNA 5JHUA 1X1AA 2WBMA 1QO0D 3NRVA 2ZJRF 1OPCA 3ECHA 3C2GA 3FISA 4GYGA 4I7HA 3CTAA 2FX0A 2ZJQF 4MQVA 5EF6A 3EPZA 3G3ZA 2JA7J 4I6ZA 3BG6A 2CFXA 1GVJA 3F3XA 4HDUA 4FX0A 3FMSA 2IS1A 4ENJA 4BDYA 1B72B 4A93J 1TWHJ 2DK5A 1HKSA 3MEXA 2KRCA 4NC7A 4GRIA 2MC3A 3ZXSA 1ETXA 4L5EA 5K5OA 4G12A 3F6VA 1MBEA 1MNEA 4NB5A 4HDVA 3PFIA 3W3CA 5DUKA 3PNYA 3HZJA 1FOXA 3F8CA 3M3YJ 4WXDA 2NS0A 4WXCA 4KFCA 2FUG2 4N9IA 3HUGB 2KZGA 3K2AA 2DMUA 4FE4A 2G7HA 2D1VA 4BXUA 1JXSA 3K1NA 3PQKA 5M5YJ 4CXFA 3IC7A 2CV1A 4A6DA 1T08B 5AONA 3WTVC 1IDYA 2J5OA 2XGCA 3HHHA 3S2HJ 3I4NJ 2R7ZJ 3E5QA 1J5YA 3V42A 5ICEA 1ETYA 3A2KA 3P9KA 2VKEA 2OCEA 2PJPA 4A12A 3DKYA 2E1NA 2ESNA 2EV5A 2M0MA 2X0LA 3CUQC 4I01A 4QSHA 4O3MA 4Y13A 2ZB9A 5K7ZA 1Z9CA 1FX7A 5E18F 2R5YA 2G9WA 3DEEA 3BR3A 2Z5UA 3N05A 5E20A 3P9IA 4XLAA 1P7IA 1TC3C 1QRYA 2AQEA 4LK0F 1X58A 3FMQA 3BP8A 2R93J 1P92A 3RPUA 4XLFA 1RI7A 3BR1A 4U87A 1Z7UA 2QSHX 3OSFA 1YO5C 2LMDA 3B6CA 2CUJA 3S3OA 2NS7A 1VNDA 4JYKA 1FSHA 5D8LB 1XCVA 3OL3A 2LF7A 4IEJA 4JX6A 5BQTA 1A04A 1SD5A 4D7MA 1SFOJ 2VUMJ 1G3WA 2A5WA 4CCLA 4H0EA 5DDGA 5JVTA 2A69F 4IF4A 5CYVA 1UELB 1AOYA 3CCEI 5C4XJ 1ZARA 3BTJA 3JRFA 1RQ6A 2CO5A 2QENA 4FTHA 3RKYA 5DM6F 3R61A 4FT8A 1IUFA 2QSFX 5FGMA 1YE9A 3C7JA 5L3BA 1Q1VA 2ID6A 3CCRI 4QIWN 2BGCA 3Q0VA 4BY7J 5K5RA 4HQEA 1RKTA 3R0AA 6PAXA 2K5CA 3K4NA 2QWWA 1RPWA 2YU3A 4BAYA 1SFUA 2JUCA 1ONVA 3T5XA 4L9JA 2E2IJ 1DGRM 1W5CC 1BIBA 2DDBA 3HRMA 1U6GA 3C2HA 2DA4A 1I3QJ 1TP4A 3KCCA 5FLXR 3CJTB 1WVRA 1WJBA 2P0TA 3HOWJ 1VZ0A 5JFRA 1I5ZA 2JK3A 5EEGA 4CCKA 2L9SA 2XAFA 2VJIA 3TMOA 5KAFC 1MBFA 2OZ6A 2ELJA 5F0FA 1Y39A 5E17F 3CLQA 3TW7A 2YR2A 2ISZA 3NWTA 2K85A 4B43A 4F3QA 4J00A 3ZMTA 1IN5A 3EYIA 1F36A 2AS5F 1CQTA 1SANA 2HOEA 4BQNA 2E36A 2EK5A 1BC7C 1SVOA 1Z3XA 1IN6A 1OYYA 2QZ8A 5FJ8J 1Z21A 1K4TA 1D0YA 4CA0A 1TNTA 5JHFA 2M35A 5D8KB 4IX7A 1BR1A 1I6HJ 2AXTC 2LBFA 4O6JA 1A36A 2PBIA 3MMYB 2M9HA 3F8MA 2VKHA 2N8GA 3VWBA 1U0JA 3ML6A 3TQNA 2L2OA 4XN0A 3OR2C 3WE2A 4Y7NJ 4FCYA 3BZCA 3SEZA 4CDGA 2MLGA 1YJWI 1XGOA 2BVMA 1QVTA 3MFKA 2Z9OA 1ZREA 3DFGA 4AC0A 4BGDA 2JA5J 3DBRB 1CF7A 2QF7A 3OS2A 2Z3YA 1E3OC 2XUBA 3M8JA 4XKBA 3HPGA 3N4MA 2QVOA 1X3ZB 3UR3C 3FK6A 1GV2A 5GAEJ 4MFEA 5LLQA 2XDVA 2K9MA 3CO7C 2V1XA 1OKRA 3ZMVA 4WK8F 3FXMA 3R6SA 3I71A 3Q5FA 3JR9A 3VFZA 4IPAA 2L7ZA 2EV0A 2X9DA 4PZJA 1S9HA 1IV6A 4RS8A 4AVZA 1UHSA 1U3EM 2LBFB 1D8KA 1PUEE 3D0SA 2AO9A 3LA3A 1FMVA 3PSIA 3D5SC 3LOCA 2MLKA 4OIPF 4UVAA 3J80R 1KQ9A 4ANJA 2VXDA 3K4CA 2K9LA 5IT9R 2LH9A 4BXXJ 4A3IJ 3L00A 1ZTRA 3LQRA 4HLYA 1D5VA 4CCMA 3I59A 4PK4A 3LSKA 1O4XA 2X6WA 4M3GA 2YSRA 3F21A 3QAHA 2K4BA 3HEFA 5EG0B 3OYGA 4IOAF 4II3A 2R4GA 2EFPA 2HPMA 3GLXA 2LVSA 3J81K 2PMZN 4A3JJ 1JHFA 2XAHA 3HM5A 3Q9SA 1Z91A 1KZHA 4Q4ZF 2WAQN 1NK2P 4N0BA 4WF2A 2XB5A 2LREA 3A0HC 1BBYA 4EVIA 2VXZA 2X51A 1VF9A 2ZFUA 3IKTA 3QWLA 1FTTA 4BACA 4ENMA 4PJJA 1MJ9A 3CCMI 2HOTA 2L5QA 1IV8A 2KMUA 3ABMH 3QP6A 5FD6A 2PJRA 1JE8A 1CF7B 3DCFA 4AM3A 2F5EA 1REPC 2I5UA 2HPIA 3HRTA 2WWYA 4HAMA 4ZDLA 3RQ4A 1LE8A 3H5NA 1U5TA 3ULQB 1S7OA 1R58A 3GW2A 3OR1C 1Z3YA 3Q3SA 1RR8C 4IHTA 2MA3A 2V1DA 1Z1DA 2Y30A 3QOPA 1FWZA 3KP5A 4KITB 1HLVA 2FNAA 1IRZA 3BTCA 3KIOA 1UCRA 3DWLE 3S14J 4E7JA 3RKXA 5F27A 1N77A 1NK3P 2LC2A 3BT9A 3N97A 3S3MA 5F1JA 1LNWA 3SJMA 4HF2A 1AHDP 3TL4X 3WTSC 3BTLA 3I59B 5E3MA 3V7RA 2OBPA 1V5FA 4JK1X 3F72A 1UG2A 4E7HA 3RI4A 3BR5A 1SFEA 5EZHA 4HYEA 4KIFA 1SFKA 3WGHA 3KEYA 4GCVA 1ZG3A 1WQ2A 4DYQA 1ON1A 2GWRA 4KIBA 3W2AA 2E1MB 2DQRA 3AG1H 4HSTA 3V7SA 3M8FA 1FLIA 3IKVA 5GAGJ 3H3ZA 4XIDA 1YX3A 3K1PA 4X0GA 3HL2A 3RYPA 2CUEA 4PJMA 2DW4A 2HQNA 2RV8A 4M3FA 5C3EJ 2VB6A 3K10A 3WU2C 2YUSA 2EZKA 5LD2C 4ASNA 2VODA 3K4JA 3A4CA 2HYJA 4HV5A 5FKKA 2ICWG 4XRSA 1G2HA 4P96A 3RKWA 3GTLJ 2GBYA 5LFAA 4BQAA 3F8BA 4HW0A 2Z2SB 1ZRDA 3PM1A 2COBA 2P5LC 4D5CA 2KPMA 1RRJA 4UXNA 1MBJA 5CKTA 5IY5H 5JLWA 3ESWB 2EIJH 2X1CA 1S72I 2XKOA 1JKOC 1X19A 4CCOA 2X1EA 3IHUA 4DQ2A 2MG4A 4BJ6C 1W0UA 3U1KA 2EH3A 4RB3C 4RGRA 5A2QR 2ZMEC 5ILUA 2E19A 2FMLA 1QHGA 1NTCA 3HJEA 3DF8A 2VI6A 2FOWA 3M7GA 1FNNA 4A6EA 3FXQA 4KN7X 4KN4X 3WHCA 4CICA 1Y8QB 2O0YA 1JKPC 3UNGC 5F6FA 5J1UA 5E8GA 4OOIA 5DYMA 5IOZA 1GVDA 1MBGA 1FOWA 2AHQA 2FJ1A 4Q47A 2M34A 2X6OA 4BHBA 4N4OB 1QHHD 5IT3A 3HOSA 1TBXA 1GDTA 2VQGA 3ZQGA 4E7ZA 1FMWA 2QSGX 3PO2J 2OTJI 3G1MA 2FD5A 2LLKA 2P7VB 2OJED 5AIQA 1WSUA 3JAMK 1K4SA 3SFZA 4XLPF 1STZA 3FK7A 5HS8A 5LHIA 3W6VA 3DXJF 1R36A 2QYOA 2VJJA 2IAIA 5C4JJ 2MW8A 5HS9A 2IVMA 3AL0C 1D5YA 1O3RA 2R7SA 3G1LA 1IDZA 1I1GA 4I99C 3KP3A 2KFDA 2LP0A 1I39A 4IHWA 1UZCA 1R5HA 5HDNA 4A5NA 4S04A 1KU7A 1PJRA 5FRNA 2RNJA 1UJ8A 3PSFA 3F22A 2L0KA 2L54A 3MKZA 3FXRA 5IOYA 1KU9A 3V4GA 1VQKI 1V5GA 3RTRA 4BHCA 2BBYA 3WTUC 4XSZF 3G6EI 1NH3A 3LQQA 4ZC3A 3SDBA 1XS9A 1BC8C 4BE1A 2XV4S 2CMPA 1R9TJ 4M6XA 5HNHA 2EZHA 2OA4A 2NNNA 3S32A 2IT0A 3G2BA 5HDKA 3CCYA 4BQOA 2KLOA 4EJVA 3FHZA 3H3VK 4KIGA 1D3YA 2IJLA 2W1OA 1FZPB 5ERIA 2F5CA 2BYVE 3DTEA 1VTNC 1Z0XA 1IXSB 3L2WA 3I9V2 4MTEA 2QA4I 5LHGA 2GIVA 3DBHB 3I3LA 1T98A 4S05A 1J2XA 4LITA 4OMZA 3PO3J 3G71I 1AKHA 3AL0B 3BQZA 2EZIA 3CUOA 3GTPJ 2LR8A 1RC9A 1ZRFA 1YJ9I 1A5JA 2IS2A 2E7WA 4UNOA 3Q0WA 5FD5A 4ZYHA 3VYRB 1EF4A 1RETA 2MGQA 4XOTA 1J0RA 2E34A 1VQMI 2PQ8A 4AIHA 2X4HA 5LRRA 1BI1A 2KDOA 2NS8A 3AG2H 2PJRB 4E7IA 2DLLA 4N9HA 3HOYJ 5D6FA 4H4KC 1IXCA 4M74A 2ZBKA 1G3YA 2FU4A 1BI0A 1OCZH 2LF8A 3MQ0A 1Y1WJ 1R4MB 1IN8A 2IBDA 2E2JJ 4A3LJ 2BW3B 2PEXA 1SD4A 1UFMA 1MD0A 1MDMB 2P4WA 3RYRA 4IKFA 4ESBA 1NG6A 2V9KA 4RBOA 3ZQLA 5FB2A 2VBYA 1L0OC 2A61A 3BCBA 2QCOA 2ESHA 3M8EA 4G6QA 1OCCH 4B47A 2EFNA 4CH7A 1T56A 2KRHA 3IAS2 3DLAA 4C2UA 2P5VA 1ERDA 4BNCA 1J7KA 3CJQB 5ED4A 1Y0UA 1TWCJ 2ZNYA 4XM3A 4C2TA 1J9IA 2L02A 3BWGA 1IXRC 3KFWX 3D1NI 3GTKJ 2Q2EA 3BROA 1OCTC 3WTTC 2NVXJ 1JKQC 1FJLA 4ZDPA 2IXSA 4ITVA 5HLGA 3K70D 2RKHA 1FYMA 2C6YA 2FQ3A 2EIMH 5E1WA 5HVQC 4CSWA 4AYBA 5L3CA 3CESA 3E6BA 1LDDA 4M9SA 5B5EC 2OD5A 2CV0A 3AKZA 3HIFA 3BTIA 2E5NA 2JTVA 4IJAA 1SAXA 2ZKZA 1E3HA 2XHKA 4C9YA 2V9PA 3CDIA 4LMYA 3L2UA 2RREA 3M1CA 1FBQA 1TWGJ 4E70A 1A6QA 5EG0A 4ZZLA 2NVQJ 4CYCB 2FBHA 2OUMA 5FKLA 3GFJA 3CCQI 1QA6A 4P55A 4HRIA 3M07A 4RM2A 2STTA 3E3VA 3ABLH 3CMEI 3CMMA 2GZWA 2VE8A 1W1WE 4JBAA 2Y31A 4KT6A 3GFIA 2O8XA 2XRLA 1XSDA 5DCFA 1ZAOA 1E0EA 5FLVA 2ELHA 4C2MJ 3BG9A 4RA2A 5BS6A 2CUZA 1XDUA 4UUSA 5LBQA 1RESA 3ZR8X 1Y1VJ 3JRIA 4IHXA 1APLC 1DQUA 1JGSA 3OYMA 3TKYA 5K7FA 3TO9A 3P9CA 2K4JA 1PP7U 2EWNA 4MLOA 5CVJA 3S15J 2H1LA 1VQ5I 3IP4B 3GFLA 1WZ2A 3O2PE 4EJUA 1YS7A 2Y9YA 3I53A 2VLAA 1OJLA 1K6YA 2XF5A 4AIDA 2L9VA 2X6XA 2OZUA 1I1SA 1MKMA 2PLYA 1B8IB 2KHMA 3F8NA 1IRFA 4B09A 3RCOA 2MH9A 3O8GA 3U1DA 1FT9A 3LA2A 3QQAA 2O8KA 1JI8A 4BBRJ 4KYWA 1J09A 3DTIA 1IN4A 4ZYGA 3S16J 5CVVA 3ONQA 1U8BA 3CC7I 2IGKA 2L7FP 3MKWB 4R8HA 1PDNC 1O7FA 4IRIA 1P7JA 2DJNA 4YEJA 3GZ5A 3TP0A 3GTJJ 4BQQA 4KISA 3IRQA 2CRGA 4XRSG 2BY2A 4D9JA 5DV5A 3CCSI 5H6QA 2H8RA 2WAEA 3WHBA 3HHGA 5EYRA 3PFYA 2RNGA 3GZNB 3HTSB 2ME0A 5DD4A 1BW5A 1BIAA 3S1QJ 1UHWA 2H1KA 2K9SA 4IHYA 4XONA 1NG7A 4CUGA 4Y3OA 4YRVA 4MIMA 5E3OA 1HSTA 2JJ7A 4U0YA 2MH2A 2JVGA 4HF1A 2EFQA 1YOVB 4HX4A 1LEAA 3HPHA 2BV6A 2W00A 3QPHA 2CU7A 1P2FA 3HKZN 4E7KA 4OU0A 1ETWA 2HU9A 2VT2A 3IWZA 3KPHA 1ZGAA 2RDPA 3TOBA 3CF2A 3JRDA 1HKTA 4C30A 2DA5A 3HKZA 4XKVA 4L9VA 5DCMB 2RAEA 2RVCA 1S8NA 4RGSA 3OYAA 5FLXK 2DODA 1G8XA 2Q1ZB 2EINH 2IGMA 2CSOA 2XAGA 1HQCA 4RAFA 4OMYA 1G3TA 4A3DJ 4XNFA 4CZCA 1WGXA 3V8KA 3LSRA 4YFKF 3F9KA 5L3GA 2QKMB 5J1YA 3MCZA 2MVTA 3SYTA 1L3LA 2TDXA 5TJJA 4OAZA 1GHCA 3LSMA 2MABA 4OIRF 2R7WA 3WU0A 2CFOA 2H6CA 3COAC 1FP2A 3KZIC 1M1EB 2H6BA 1MW7A 3AFHA 3R60A 2HGCA 2DXIA 1XN7A 2X85A 3WTZA 2W84A 3MZ8A 5LGTA 2BOLA 4F52A 2X1DA 1RUOA 4I76A 2UWMA 4YFNF 1O3QA 3SZTA 3M4OJ 5F08A 4JQFA 1QZZA 1AU7A 1HA8A 4XLEA 3OY9A 1V4RA 2CUFA 4PJLA 3BG3A 3FBIB 4QPQA 1T0FC 3Q9VA 4DZPA 4LK1F 3QU6A 1XPXA 2E35A 2ECCA 2JRTA 2KJCA 2ZCWA 4I0AA 5EGOB 3I55I 3RZDJ 1HCRA 3CCJI 2ME6A 2DA3A 2ZNZA 1RIOH 5HDGA 3I0TA 1P4AA 3NWSA 3CD6I 1TQMA 2K7LA 4IO9F 3TBIA 1B6AA 3VPRA 4V2GA 4LB6B 3HSEA 3IH3A 3OS1A 3HGGA 2NRAC 1QPMA 2K9NA 2WV1A 3OYFA 3QYBA 2PMZA 3FKJA 3HOUJ 1OYWA 2KIQA 2HQAA 5A2QZ 1MJAA 5FRMA 2FBKA 5KCMA 3DP7A 3V7CA 1OCOH 2Y48A 5DTDA 2QQ8A 2DOFA 3SZGA 2CJJA 1NHAA 1WJ5A 2H94A 2VBWA 3FIWA 4JX5A 3WODF 4F55A 1JUSA 2G7UA 4XR6A 1QQIA 2JSCA 5E1XA 5AIPA 3ZCOA 2IPQX 2WB1A 2ADUA 1X3WB 1YLFA 3GZ6A 2HI3A 1MJBA 5HLIA 4YG2F 4QTRA 3GFMA 5F04A 2DMTA 3SDGA 4G6TB 2YU9J 4RB1A 3OOUA 3FWEA 2R7DA 2LKXA 1G59A 2VBXA 4WXHA 5HLTA 2RQPA 4KMUX 3VSKA 4UUSB 3CO6C 4Y52J 3KP2A 2ZC2A 3H92A 2GOMA 2GXGA 3QPSA 4A3GJ 3F0CA 3LAPA 2A6TA 2OU2A 3HOTA 2DFFA 3BY6A 1YI2I 4IHSA 2DQLA 1EJ9A 2MZ4A 1XD7A 2M8GX 3QU3A 2FNPA 1POGA 2AQFA 1HSJA 3ZN1A 3I4MJ 1QPIA 1BOAA 3MKYB 1LJ9A 5M3FJ 1YJNI 1USTA 5FLXZ 2PI0A 1WKMA 1N25A 1V3FA 1KYWA 3KLOA 1J75A 2ISYA 4MFDA 3JTHA 3OYHA 1S29A 5F1RA 1LEBA 4LD5A 1YTYA 2R92J 3RPQA 1MMSA 2R5ZA 1R23A 1WH7A 1R5GA 4UVCA 4HA8A 4RAGA 4MTDA 2PMHA 1FOYA 2FA5A 4D1QA 1K79A 3OOPA 1VQ8I 4UV8A 2EV6A 4OINF 1K7AA 3DEUA 1Z05A 4L0YB 4ZJZA 1IG7A 4AU7A 1F1ZA 1FSEA 2VQHA 4HBLA 4BXFA 4D5FA 1JUMA 3BC8A 2VIXA 4XORA 2IA1A 3HXLA 2OQGA 1X1BA 2VT3A 3A0BC 2NNYA 3ZGKA 5D6EA 2DT7B 3DV8A 2HDWA 3DQVC 2HXOA 1D0XA 4Z6YA 1KGSA 5KHDA 2QEXI 2NVYJ 1FC3A 1MMDA 3BJ6A 1YX5A 1JGGA 2M7AA 2EZLA 1VQPI 1DP7P 3DTKA 4NUBA 2DT5A 3CF5F 1YW9A 2Z33A 3MAJA 1LKXA 4KNYA 1WHUA 1ZK8A 3FBNB 4R1HA 1VQ9I 2B7EA 3GVAA 3DKXA 3KETA 2DTZA 3K70C 3C1DA 2O61A 2V6CA 5IYCJ 3BG5A 1XC5A 3ISPA 1B59A 1MIJA 1OLTA 4BJTA 4Y17A 1ZGWA 5CPRB 5F0CA 3FM5A 4NC6A 2OQRA 2R7UA 3QOEA 2VKDA 3CMAI 3OS0A 3IH2A 3LMMA 2JRMA 2B0LA 2MFZA 3OL4A 2QLZA 1WWXA 2XROA 3VEPA 1ETKA 4ESJA 3GTQJ 2KQRA 3A1YA 3B02A 3CP2A 4ZTFA 2W25A 3BPXA 4XK4A 1IJWC 4NC8A 5E79C 4I98B 5E1ZB 4HSRA 2P0WA 4KICA 2CYYA 3KYDB 2IS6A 3S17J 5J3LA 4OWRB 2P8TA 4G94A 4ZYDA 1PUFA 2IRFG 3A02A 2A07F 1R1TA 2UXNA 3L09A 4I09A 4MO7A 1MSFC 2XGXA 4YELA 2F48A 2HOAA 1TWAJ 3PNTA 2VJ5A 3FZVA 4RM3A 1KONA 3EDPA 4RAYA 4UB6C 3QODA 3IL2A 5FKNA 1FYLA 3V8JA 4FISA 1ETVA 1S7EA 3A01B 2E5ZA 4G6DA 4GXOA 1RNLA 4MGRA 3LL7A 5DM7F 3JRCA 3KEOA 2FBIA 1ENHA 2KRFA 3OYJA 2ZJPF 2CGPA 2Z1DA 4CGZA 2A68F 1YW8A 3SHFA 3VOEA 2IW5A 2IGNA 2XGEA 3L9FA 4L9NA 3CP8A
chains in the Genus database with same CATH topology
5ICGA 3I64A 3QP5A 1C0WA 3J80K 3KZYA 4A0ZA 3EQLF 2XAQA 3ZMUA 3GEZA 5K5QA 5LGNA 1ZG1A 3ZMZA 3I5UA 4MHGA 2AXLA 3TDUC 1DDNA 1IRGA 3ECOA 1IF1A 3OV8A 4M9XA 4Y15A 3HTUA 2PFBA 3MZYA 4AVPA 4CYDA 3WTYC 1J59A 2EA4A 2ZMEB 1XB4A 2P6SA 1T0FA 4M73A 3JSPA 2GQQA 1W5SA 3CLOA 2XAJA 1UHMA 4K2EA 3DPTA 4KMFA 4U0VA 3K2ZA 1R22A 3K9TA 3BZ6A 4G7ZF 1BI2A 1H9TA 1I6XA 3RIRA 2YX4A 2EJRA 3CUQB 1KU3A 5HS7A 2EB7A 1QNTA 3ABUA 4Q5SF 2HKXA 3GXOA 4M6YA 5ILVA 3O6BB 2W85A 3WTXC 3WGIA 3NQOA 4YIIA 1IUYA 2HZTA 2DBBA 3G73A 4XRFA 1HBXG 1HW5A 5FFXA 3LSTA 1BI3A 2JT1A 1DUXC 3FM3A 2UXXA 3L7WA 3C18A 2W57A 4KT5C 1R1VA 3HSFA 1G6NA 1G3SA 2PMUA 4MNUA 1F9NA 2DO7A 1XGSA 3U2RA 2K86A 4LG0B 2Y0MA 4LLLA 3TO6A 2QM3A 3GF2A 4HZFA 4ENNA 4MEYF 4R79A 2MD5A 1GXPA 1T2KA 1RUNA 4M72A 3K1MA 3MZHA 2NAZA 1EV7A 5LHHA 4ON0A 1LDKB 4AD9A 3JAMZ 5A2QK 1LVAA 3C3WA 3FMRA 2L3DA 4NHJA 3GUDA 3QPTA 1YG2A 2IA2A 1ZH5A 2DTRA 2JPCA 1G4DA 1FYKA 4CO8A 2Z99A 1O3SA 5LRSA 4HLXA 4DNCA 3SXYA 1EH8A 3R4KA 5KVRA 3E6MA 3ABTA 1S3JA 3PQJA 1IN7A 2FRHA 5CVIA 2HKOA 4L9TA 3BDDA 4QWQA 4LLGF 2XRNA 4RB2C 2L01A 1ZHFA 4WCGA 2QQAA 1KU2A 5H6RA 1P4XA 2BE5F 3E6DA 1W4MA 4RB0A 2ZJ2A 2LDUA 4EGYA 2HYGD 2W24A 2CG4A 3DKWA 2ZFWA 1OMIA 1CGPA 3JSOA 5DCMA 4OIOF 4M9ZA 2KIUA 3O3KA 1LB2A 1W5TA 3GYHX 2WTEA 1U78A 1O57A 1ZN2A 3I54A 2HWVA 4G7OF 5ICCA 1OR7A 2VN2A 3HRSA 3ZP5A 1MGTA 3BPVA 5CJ9A 4XLNF 4A5MA 4HX7A 4EJTA 3TOAA 2GA2A 2VOOA 1USSA 3FX3A 4A2UA 4HX8A 3GWZA 4RAZA 2FXAA 1Q1HA 1XGMA 2FF4A 3H3UA 4IRHA 1XDSA 5HLHA 4EM0B 5BPIA 2PN6A 1GXQA 1B4AA 5D4RA 1T39A 3VODA 4HV6A 2M30A 4XBFA 5CVUA 3BJAA 5EEHA 5CVRA 2M45A 1OYIA 2VC0A 4EJOA 2QQ9A 4ESFA 5JI6A 1TQIA 4MEXF 4AIKA 4P9UA 3E6CC 1ZLKA 3WTWC 2FSWA 2FOKA 2A5YB 5H20A 3T8RA 2R7FA 2Q0OA 3TGNA 2LKPA 4L5JA 1SD6A 5L3EA 5JR3A 2FEZA 4UV9A 2UZKA 4HOBA 3I58A 2RC4A 1KQ8A 4LJZF 3F23A 1LQ1A 4G8XA 4EGZA 3VB2A 2WC2A 1FBUA 2RN7A 4ZZDA 2KIMA 2D45A 2ACJA 1UB9A 2VC1A 1X3UA 2R3SA 2E1CA 5FFZA 4IRGA 3L2CA 5BMZA 1HXDA 3ELKA 4M71A 1XSXA 3F6OA 3M9AA 4UHTA 3KEQA 3LWFA 2F2EA 4QLCU 5BPDA 4EJWA 1K78A 5J8FA 4LGWA 4PCQA 1IZ1A 4WX9A 2HTJA 1O7LA 2D1HA 3I4PA 4ETSA 2DAOA 3RDIA 4G7HF 3HRUA 2CW0F 4CZZA 2H09A 3LAJA 3CUQA 2F5FA 1F4KA 1ZRCA 3FF5A 2GXBA 4U88A 1E2XA 2M8EA 2LNBA 3HUGA 1XGNA 4BHPA 1U8RA 3B73A 4U7DA 2HR3A 3FXUA 5DEQA 5D5WB 4ENKA 4BYYA 4B8XA 1EH7A 1DPRA 4LFUA 1ODDA 3CJNA 4AWXB 3BJOA 1XSVA 2YX7A 2DU9A 3T1BA 4YIFA 3K69A 2ZMEA 3MWMA 1SMYF 4GGGA 1U2WA 2JZYA 5E8IA 1B1BA 4UVBA 4UUVA 1FY7A 1ULYA 2ZXJA 2L4MA 1R7JA 2P6TA 4RGUA 3KLNA 2DPDA 2IP2A 1TNSA 2L4AA 1HW2A 4I2OA 2GA1A 5FO5A 1ON2A 2DPUA 1D8JA 2HFHA 1WI9A 3WU1B 1YYVA 1T38A 1W7PB 4L5IA 2MBFA 2V9VA 3SQNA 3ZN0A 5F64A 1I27A 3WG9A 2HTSA 4HF0A 1KA8A 3CDHA 1HKQA 2YPRA 3SZPA 1DPUA 3P7NA 3F8FA 1B9MA 4ZH4F 5IT9K 1KYZA 5D5UB 5ICFA 1TTYA 2FE3A 2V79A 4KA4A 2XKPA 2ZO4A 4PDKA 1BJAA 2HYFA 2COMA 2XVCA 4U7BA 2PG4A 3DPLC 4NQWA 4I0BA 1W7PA 1SFXA 5K1YA 3W6JB 2VE9A 4MQ9F 3WGGA 1RZ4A 3NEUA 1XMKA 4RGXA 2P5KA 3LA7A 4HQMA 1P6RA 1YQAA 1PP8F 4EMSA 4L0ZB 2KKOA 2WV0A 1QBJA 2HEOA 3ZMSA 4KDPA 1MDMA 1Z6TA 3KP7A 2O03A 3M1EA 2K02A 4LG0A 2O3FA 1XMAA 3T8TA 4CHUA 2NYXA 2JPBA 2HQRA 4F7ZA 1ZG5A 1EH6A 2M87A 4FX4A 2DK8A 5HOOA 2V1UA 1ZYRF 2KIFA 3J81Z 1MZBA 2RGVA 4A0YA 2E7XA 3J7AO 3GO5A 3D5LA 4AIJA 1YW7A 1JHHA 2VONA 2VBZA 4OIQF 2HDCA 2DI3A 4U0WA 1U5TB 4GO1A 3ERED 4FHTA 4D0PA 3EUHA 3JTGA 1TW3A 3U9GA 3W6KB 2GAUA 2O6GE 2LSOA 2P7CB 4PGHA 2QQBA 4LLNA 3KP6A 1FOKA 2EA2A 4EV0A 3HSRA 3IWFA 2KJBA 3KZZA 2STWA 1W7PD 1YIOA 2QBYA 1IW7F 1YFHA 2CQKA 5L3DA 1LDJA 4O5VA 1KQ0A 5J8CA 4PGGA 3ZQ7A 3K0LA 1FBSA 3JW4A 3GX4X 3S2WA 3BOQA 4XSXF 1H9GA 2A6HF 2FMYA 2F5DA 3TDZC 3T0YA 1QGPA 1Z6RA 1FPQA 4TV7A 1R1UA 3EYYA 5IT9Z 2VOPA 4YFXF 1H0MA 3E5XA 3RJPA 5D5VB 1WRJA 1K78B 4A0XA 4IXAA 2XASA 5L3FA 2EFOA 1T6SA 3V8LA 1AWCA 1S6LA 3REOA 5BOXA 1BN5A 5KK1A 5DD8A 3HYIA 4EQQA 1SD7A 1U5TC 2A6EF 2HS5A 3E5UA 3J80Z 2Y75A 5ILSA 2D2WA 1TLHB 4P5OA 2XIGA 4EM2A 3ROUA 4KUMA 1BM9A 1ZGJA 1HW1A 4LB5A 3E97A 2ETHA 1TW2A 3LFKA 5LEKA 2QBYB 1QZYA 5D4SA 4I02A 5LEJA 4Z2YA 2OAZA 2K27A 1FP1D 3R0JA 3WE3A 3QRFF 2EFWA 3IRRA 1F5TA 1K6OA 4Q48A 1P4WA 1E17A 1O3TA 2Q8KA 3ZPLA 2J5PA 3KP4A 4L18B 2DFIA 2BEOA 2M5WA 3TO7A 3AAFA 5J6XA 5CLSA 4EM1A 2H27A 3ZMDA 5LGUA 2A3SA 1TQPA 2IA0A 4BH9A 2CWEA 1R00A 5TRDA 5D5XB 4WWCA 1S7AA 2QUFA 1YS6A 1SMTA 3EETA 1IAWA 1XCBA 4G9YA 4P9FA 1B9NA 4ZYEA 1ZLJA 5DUIA 4GYIA 2M1BA 3KE2A 4IVNA 5JHUA 1QO0D 3NRVA 1OPCA 3ECHA 4GYGA 4I7HA 3CTAA 4MQVA 3G3ZA 2CFXA 1GVJA 3F3XA 4HDUA 4FX0A 3FMSA 4ENJA 2DK5A 1HKSA 3MEXA 2MC3A 5K5OA 3F6VA 4NB5A 4HDVA 3PFIA 5DUKA 3F8CA 4WXDA 2NS0A 4WXCA 4KFCA 4N9IA 2G7HA 2D1VA 4BXUA 1JXSA 3K1NA 3PQKA 4CXFA 3IC7A 4A6DA 5AONA 3WTVC 2J5OA 3HHHA 3E5QA 1J5YA 5ICEA 3P9KA 2PJPA 4A12A 2E1NA 2ESNA 2EV5A 2X0LA 3CUQC 4I01A 4O3MA 4Y13A 1Z9CA 1FX7A 5E18F 2G9WA 2Z5UA 5E20A 3P9IA 4LK0F 3FMQA 3BP8A 1P92A 3RPUA 1RI7A 1Z7UA 1YO5C 1FSHA 5D8LB 1XCVA 2LF7A 5BQTA 1A04A 1SD5A 1G3WA 4H0EA 5DDGA 5JVTA 2A69F 4IF4A 5CYVA 1AOYA 1ZARA 2CO5A 2QENA 3RKYA 3R61A 4FT8A 5FGMA 3C7JA 5L3BA 2BGCA 4HQEA 5K5RA 3R0AA 6PAXA 2QWWA 2YU3A 4BAYA 1SFUA 1ONVA 3T5XA 4L9JA 1BIBA 3HRMA 1U6GA 3KCCA 5JFRA 1I5ZA 5EEGA 2XAFA 2OZ6A 5E17F 2YR2A 2ISZA 3ZMTA 1IN5A 3EYIA 2AS5F 2HOEA 2EK5A 1BC7C 1IN6A 1OYYA 2QZ8A 1TNTA 5D8KB 4O6JA 2PBIA 3F8MA 3ML6A 3TQNA 3WE2A 4CDGA 2MLGA 1XGOA 2Z9OA 3MFKA 1ZREA 3DFGA 1CF7A 2Z3YA 2XUBA 3N4MA 2QVOA 5LLQA 3CO7C 2V1XA 1OKRA 3ZMVA 4WK8F 3R6SA 3I71A 3Q5FA 3VFZA 4IPAA 2EV0A 4PZJA 4RS8A 1U3EM 1D8KA 1PUEE 3D0SA 3LA3A 2MLKA 4OIPF 4UVAA 1KQ9A 3L00A 3LQRA 4HLYA 1D5VA 3I59A 2YSRA 3F21A 3QAHA 2K4BA 2EFPA 3GLXA 3J81K 1JHFA 2XAHA 3Q9SA 1Z91A 4Q4ZF 4N0BA 4WF2A 1BBYA 4EVIA 2VXZA 3IKTA 4ENMA 1MJ9A 3QP6A 5FD6A 1JE8A 1CF7B 2F5EA 1REPC 3HRTA 2WWYA 4HAMA 1U5TA 3ULQB 1S7OA 1R58A 3GW2A 4IHTA 2MA3A 2V1DA 1Z1DA 3QOPA 1FWZA 3KP5A 2FNAA 1UCRA 3RKXA 3N97A 1LNWA 4HF2A 3WTSC 3I59B 3V7RA 2OBPA 4JK1X 3F72A 3RI4A 1SFEA 4HYEA 4KIFA 3WGHA 4GCVA 1ZG3A 1WQ2A 1ON1A 2GWRA 4KIBA 2DQRA 3V7SA 3M8FA 1FLIA 3IKVA 3H3ZA 3K1PA 3RYPA 2DW4A 2HQNA 2RV8A 4ASNA 2VODA 4HV5A 4P96A 3RKWA 4BQAA 3F8BA 4HW0A 1ZRDA 2P5LC 4UXNA 2XKOA 3IHUA 4DQ2A 4RB3C 4RGRA 5ILUA 2FMLA 3DF8A 3M7GA 1FNNA 4A6EA 3FXQA 4KN7X 4KN4X 4CICA 2O0YA 5F6FA 5E8GA 4OOIA 5DYMA 4Q47A 4BHBA 5IT3A 3HOSA 1TBXA 5AIQA 2P7VB 1WSUA 3JAMK 3SFZA 4XLPF 1STZA 5HS8A 5LHIA 3DXJF 1R36A 2QYOA 5HS9A 2IVMA 1O3RA 1I1GA 3KP3A 1R5HA 5HDNA 4A5NA 4S04A 1KU7A 2RNJA 3F22A 2L54A 3FXRA 1KU9A 3V4GA 3RTRA 4BHCA 2BBYA 3WTUC 4XSZF 3LQQA 1BC8C 2XV4S 4M6XA 2OA4A 2NNNA 2IT0A 5HDKA 4EJVA 3FHZA 4KIGA 1D3YA 2IJLA 1FZPB 5ERIA 2F5CA 2BYVE 1VTNC 1IXSB 4MTEA 5LHGA 2GIVA 1T98A 4S05A 1J2XA 4OMZA 3CUOA 1ZRFA 2E7WA 4UNOA 5FD5A 4ZYHA 1J0RA 2PQ8A 4AIHA 2X4HA 5LRRA 1BI1A 2DLLA 4N9HA 5D6FA 1IXCA 4M74A 2ZBKA 1G3YA 2FU4A 1BI0A 2LF8A 3MQ0A 1IN8A 2PEXA 1SD4A 1UFMA 1MD0A 1MDMB 2P4WA 3RYRA 4ESBA 5FB2A 2VBYA 1L0OC 2A61A 3M8EA 2ESHA 4G6QA 2EFNA 2P5VA 4BNCA 1J7KA 5ED4A 1Y0UA 2ZNYA 1J9IA 2L02A 3BWGA 1IXRC 3KFWX 2Q2EA 3BROA 3WTTC 5HLGA 2RKHA 1FYMA 2C6YA 2FQ3A 5E1WA 5HVQC 5L3CA 3E6BA 1LDDA 4M9SA 2OD5A 3HIFA 2JTVA 4IJAA 1SAXA 2ZKZA 2XHKA 4LMYA 1FBQA 4E70A 4ZZLA 2FBHA 3GFJA 4P55A 2STTA 3E3VA 2GZWA 2VE8A 4JBAA 3GFIA 2O8XA 1XSDA 5DCFA 1ZAOA 2ELHA 5BS6A 1XDUA 5LBQA 1JGSA 3TKYA 3TO9A 3P9CA 2K4JA 1PP7U 2EWNA 5CVJA 3GFLA 3O2PE 4EJUA 1YS7A 3I53A 2OZUA 1I1SA 1MKMA 2PLYA 3F8NA 1IRFA 4B09A 2MH9A 3U1DA 1FT9A 3LA2A 4KYWA 1IN4A 4ZYGA 5CVVA 4R8HA 1PDNC 1O7FA 4IRIA 3GZ5A 3IRQA 5DV5A 5H6QA 3HHGA 3HTSB 5DD4A 1BIAA 1UHWA 1HSTA 4U0YA 2MH2A 4HF1A 2EFQA 4HX4A 1LEAA 2BV6A 3QPHA 1P2FA 4OU0A 2VT2A 3IWZA 1ZGAA 2RDPA 3TOBA 1HKTA 4L9VA 5DCMB 2RVCA 5FLXK 1S8NA 4RGSA 2CSOA 2XAGA 1HQCA 4OMYA 1G3TA 3V8KA 4YFKF 5L3GA 3MCZA 1L3LA 2TDXA 5TJJA 1GHCA 4OIRF 3WU0A 2H6CA 3COAC 1FP2A 2H6BA 3R60A 2HGCA 1XN7A 3WTZA 2W84A 5LGTA 1RUOA 2UWMA 4YFNF 1O3QA 3SZTA 4JQFA 1QZZA 1V4RA 3Q9VA 4LK1F 3QU6A 2KJCA 2JRTA 4I0AA 2ZCWA 2ZNZA 1RIOH 5HDGA 3I0TA 1P4AA 1TQMA 2K7LA 1B6AA 4LB6B 3HSEA 2NRAC 1QPMA 1OYWA 5A2QZ 1MJAA 2FBKA 3DP7A 3V7CA 2Y48A 1NHAA 2H94A 2VBWA 3WODF 2G7UA 1QQIA 5E1XA 2JSCA 5AIPA 2IPQX 2ADUA 1YLFA 3GZ6A 4YG2F 1MJBA 5HLIA 3GFMA 4RB1A 3FWEA 2R7DA 2VBXA 4WXHA 2RQPA 4KMUX 3CO6C 3KP2A 3H92A 2GXGA 3LAPA 2OU2A 3HOTA 4IHSA 3BY6A 2DQLA 1XD7A 3QU3A 2FNPA 1HSJA 3ZN1A 1BOAA 1LJ9A 1USTA 5FLXZ 2PI0A 1WKMA 1V3FA 1KYWA 3KLOA 1J75A 2ISYA 3JTHA 1S29A 5F1RA 1LEBA 4LD5A 1YTYA 3RPQA 1R23A 1R5GA 4UVCA 4HA8A 4MTDA 2PMHA 2FA5A 1K79A 3OOPA 4UV8A 2EV6A 4OINF 1K7AA 3DEUA 1Z05A 4L0YB 1F1ZA 1FSEA 4HBLA 2IA1A 2OQGA 2VT3A 2NNYA 5D6EA 3DV8A 3DQVC 1KGSA 1FC3A 3BJ6A 1DP7P 2DT5A 1YW9A 2Z33A 3MAJA 4KNYA 4R1HA 3GVAA 3KETA 3C1DA 2O61A 2V6CA 3ISPA 1B59A 4Y17A 3FM5A 2OQRA 2B0LA 2QLZA 1WWXA 2XROA 3VEPA 4ESJA 3B02A 2W25A 3BPXA 4I98B 5E1ZB 4KICA 2CYYA 2P8TA 4G94A 4ZYDA 2IRFG 2A07F 1R1TA 2UXNA 3L09A 4I09A 2XGXA 3FZVA 3EDPA 4RAYA 3IL2A 1FYLA 3V8JA 4G6DA 4GXOA 1RNLA 4MGRA 3KEOA 2FBIA 2KRFA 2CGPA 4CGZA 2A68F 1YW8A 3SHFA 3VOEA 2IW5A 3L9FA 4L9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICG A;  3I64 A;  3QP5 A;  1C0W A;  3J80 K;  3KZY A;  4A0Z A;  3EQL F;  2XAQ A;  3ZMU A;  3GEZ A;  5K5Q A;  5LGN A;  1ZG1 A;  3ZMZ A;  3I5U A;  4MHG A;  2AXL A;  3TDU C;  1DDN A;  1IRG A;  3ECO A;  1IF1 A;  3OV8 A;  4M9X A;  4Y15 A;  3HTU A;  2PFB A;  3MZY A;  4AVP A;  4CYD A;  3WTY C;  1J59 A;  2EA4 A;  2ZME B;  1XB4 A;  2P6S A;  1T0F A;  4M73 A;  3JSP A;  2GQQ A;  1W5S A;  3CLO A;  2XAJ A;  1UHM A;  4K2E A;  3DPT A;  4KMF A;  4U0V A;  3K2Z A;  1R22 A;  3K9T A;  3BZ6 A;  4G7Z F;  1BI2 A;  1H9T A;  1I6X A;  3RIR A;  2YX4 A;  2EJR A;  3CUQ B;  1KU3 A;  5HS7 A;  2EB7 A;  1QNT A;  3ABU A;  4Q5S F;  2HKX A;  3GXO A;  4M6Y A;  5ILV A;  3O6B B;  2W85 A;  3WTX C;  3WGI A;  3NQO A;  4YII A;  1IUY A;  2HZT A;  2DBB A;  3G73 A;  4XRF A;  1HBX G;  1HW5 A;  5FFX A;  3LST A;  1BI3 A;  2JT1 A;  1DUX C;  3FM3 A;  2UXX A;  3L7W A;  3C18 A;  2W57 A;  4KT5 C;  1R1V A;  3HSF A;  1G6N A;  1G3S A;  2PMU A;  4MNU A;  1F9N A;  2DO7 A;  1XGS A;  3U2R A;  2K86 A;  4LG0 B;  2Y0M A;  4LLL A;  3TO6 A;  2QM3 A;  3GF2 A;  4HZF A;  4ENN A;  4MEY F;  4R79 A;  2MD5 A;  1GXP A;  1T2K A;  1RUN A;  4M72 A;  3K1M A;  3MZH A;  2NAZ A;  1EV7 A;  5LHH A;  4ON0 A;  1LDK B;  4AD9 A;  3JAM Z;  5A2Q K;  1LVA A;  3C3W A;  3FMR A;  2L3D A;  4NHJ A;  3GUD A;  3QPT A;  1YG2 A;  2IA2 A;  1ZH5 A;  2DTR A;  2JPC A;  1G4D A;  1FYK A;  4CO8 A;  2Z99 A;  1O3S A;  5LRS A;  4HLX A;  4DNC A;  3SXY A;  1EH8 A;  3R4K A;  5KVR A;  3E6M A;  3ABT A;  1S3J A;  3PQJ A;  1IN7 A;  2FRH A;  5CVI A;  2HKO A;  4L9T A;  3BDD A;  4QWQ A;  4LLG F;  2XRN A;  4RB2 C;  2L01 A;  1ZHF A;  4WCG A;  2QQA A;  1KU2 A;  5H6R A;  1P4X A;  2BE5 F;  3E6D A;  1W4M A;  4RB0 A;  2ZJ2 A;  2LDU A;  4EGY A;  2HYG D;  2W24 A;  2CG4 A;  3DKW A;  2ZFW A;  1OMI A;  1CGP A;  3JSO A;  5DCM A;  4OIO F;  4M9Z A;  2KIU A;  3O3K A;  1LB2 A;  1W5T A;  3GYH X;  2WTE A;  1U78 A;  1O57 A;  1ZN2 A;  3I54 A;  2HWV A;  4G7O F;  5ICC A;  1OR7 A;  2VN2 A;  3HRS A;  3ZP5 A;  1MGT A;  3BPV A;  5CJ9 A;  4XLN F;  4A5M A;  4HX7 A;  4EJT A;  3TOA A;  2GA2 A;  2VOO A;  1USS A;  3FX3 A;  4A2U A;  4HX8 A;  3GWZ A;  4RAZ A;  2FXA A;  1Q1H A;  1XGM A;  2FF4 A;  3H3U A;  4IRH A;  1XDS A;  5HLH A;  4EM0 B;  5BPI A;  2PN6 A;  1GXQ A;  1B4A A;  5D4R A;  1T39 A;  3VOD A;  4HV6 A;  2M30 A;  4XBF A;  5CVU A;  3BJA A;  5EEH A;  5CVR A;  2M45 A;  1OYI A;  2VC0 A;  4EJO A;  2QQ9 A;  4ESF A;  5JI6 A;  1TQI A;  4MEX F;  4AIK A;  4P9U A;  3E6C C;  1ZLK A;  3WTW C;  2FSW A;  2FOK A;  2A5Y B;  5H20 A;  3T8R A;  2R7F A;  2Q0O A;  3TGN A;  2LKP A;  4L5J A;  1SD6 A;  5L3E A;  5JR3 A;  2FEZ A;  4UV9 A;  2UZK A;  4HOB A;  3I58 A;  2RC4 A;  1KQ8 A;  4LJZ F;  3F23 A;  1LQ1 A;  4G8X A;  4EGZ A;  3VB2 A;  2WC2 A;  1FBU A;  2RN7 A;  4ZZD A;  2KIM A;  2D45 A;  2ACJ A;  1UB9 A;  2VC1 A;  1X3U A;  2R3S A;  2E1C A;  5FFZ A;  4IRG A;  3L2C A;  5BMZ A;  1HXD A;  3ELK A;  4M71 A;  1XSX A;  3F6O A;  3M9A A;  4UHT A;  3KEQ A;  3LWF A;  2F2E A;  4QLC U;  5BPD A;  4EJW A;  1K78 A;  5J8F A;  4LGW A;  4PCQ A;  1IZ1 A;  4WX9 A;  2HTJ A;  1O7L A;  2D1H A;  3I4P A;  4ETS A;  2DAO A;  3RDI A;  4G7H F;  3HRU A;  2CW0 F;  4CZZ A;  2H09 A;  3LAJ A;  3CUQ A;  2F5F A;  1F4K A;  1ZRC A;  3FF5 A;  2GXB A;  4U88 A;  1E2X A;  2M8E A;  2LNB A;  3HUG A;  1XGN A;  4BHP A;  1U8R A;  3B73 A;  4U7D A;  2HR3 A;  3FXU A;  5DEQ A;  5D5W B;  4ENK A;  4BYY A;  4B8X A;  1EH7 A;  1DPR A;  4LFU A;  1ODD A;  3CJN A;  4AWX B;  3BJO A;  1XSV A;  2YX7 A;  2DU9 A;  3T1B A;  4YIF A;  3K69 A;  2ZME A;  3MWM A;  1SMY F;  4GGG A;  1U2W A;  2JZY A;  5E8I A;  1B1B A;  4UVB A;  4UUV A;  1FY7 A;  1ULY A;  2ZXJ A;  2L4M A;  1R7J A;  2P6T A;  4RGU A;  3KLN A;  2DPD A;  2IP2 A;  1TNS A;  2L4A A;  1HW2 A;  4I2O A;  2GA1 A;  5FO5 A;  1ON2 A;  2DPU A;  1D8J A;  2HFH A;  1WI9 A;  3WU1 B;  1YYV A;  1T38 A;  1W7P B;  4L5I A;  2MBF A;  2V9V A;  3SQN A;  3ZN0 A;  5F64 A;  1I27 A;  3WG9 A;  2HTS A;  4HF0 A;  1KA8 A;  3CDH A;  1HKQ A;  2YPR A;  3SZP A;  1DPU A;  3P7N A;  3F8F A;  1B9M A;  4ZH4 F;  5IT9 K;  1KYZ A;  5D5U B;  5ICF A;  1TTY A;  2FE3 A;  2V79 A;  4KA4 A;  2XKP A;  2ZO4 A;  4PDK A;  1BJA A;  2HYF A;  2COM A;  2XVC A;  4U7B A;  2PG4 A;  3DPL C;  4NQW A;  4I0B A;  1W7P A;  1SFX A;  5K1Y A;  3W6J B;  2VE9 A;  4MQ9 F;  3WGG A;  1RZ4 A;  3NEU A;  1XMK A;  4RGX A;  2P5K A;  3LA7 A;  4HQM A;  1P6R A;  1YQA A;  1PP8 F;  4EMS A;  4L0Z B;  2KKO A;  2WV0 A;  1QBJ A;  2HEO A;  3ZMS A;  4KDP A;  1MDM A;  1Z6T A;  3KP7 A;  2O03 A;  3M1E A;  2K02 A;  4LG0 A;  2O3F A;  1XMA A;  3T8T A;  4CHU A;  2NYX A;  2JPB A;  2HQR A;  4F7Z A;  1ZG5 A;  1EH6 A;  2M87 A;  4FX4 A;  2DK8 A;  5HOO A;  2V1U A;  1ZYR F;  2KIF A;  3J81 Z;  1MZB A;  2RGV A;  4A0Y A;  2E7X A;  3J7A O;  3GO5 A;  3D5L A;  4AIJ A;  1YW7 A;  1JHH A;  2VON A;  2VBZ A;  4OIQ F;  2HDC A;  2DI3 A;  4U0W A;  1U5T B;  4GO1 A;  3ERE D;  4FHT A;  4D0P A;  3EUH A;  3JTG A;  1TW3 A;  3U9G A;  3W6K B;  2GAU A;  2O6G E;  2LSO A;  2P7C B;  4PGH A;  2QQB A;  4LLN A;  3KP6 A;  1FOK A;  2EA2 A;  4EV0 A;  3HSR A;  3IWF A;  2KJB A;  3KZZ A;  2STW A;  1W7P D;  1YIO A;  2QBY A;  1IW7 F;  1YFH A;  2CQK A;  5L3D A;  1LDJ A;  4O5V A;  1KQ0 A;  5J8C A;  4PGG A;  3ZQ7 A;  3K0L A;  1FBS A;  3JW4 A;  3GX4 X;  3S2W A;  3BOQ A;  4XSX F;  1H9G A;  2A6H F;  2FMY A;  2F5D A;  3TDZ C;  3T0Y A;  1QGP A;  1Z6R A;  1FPQ A;  4TV7 A;  1R1U A;  3EYY A;  5IT9 Z;  2VOP A;  4YFX F;  1H0M A;  3E5X A;  3RJP A;  5D5V B;  1WRJ A;  1K78 B;  4A0X A;  4IXA A;  2XAS A;  5L3F A;  2EFO A;  1T6S A;  3V8L A;  1AWC A;  1S6L A;  3REO A;  5BOX A;  1BN5 A;  5KK1 A;  5DD8 A;  3HYI A;  4EQQ A;  1SD7 A;  1U5T C;  2A6E F;  2HS5 A;  3E5U A;  3J80 Z;  2Y75 A;  5ILS A;  2D2W A;  1TLH B;  4P5O A;  2XIG A;  4EM2 A;  3ROU A;  4KUM A;  1BM9 A;  1ZGJ A;  1HW1 A;  4LB5 A;  3E97 A;  2ETH A;  1TW2 A;  3LFK A;  5LEK A;  2QBY B;  1QZY A;  5D4S A;  4I02 A;  5LEJ A;  4Z2Y A;  2OAZ A;  2K27 A;  1FP1 D;  3R0J A;  3WE3 A;  3QRF F;  2EFW A;  3IRR A;  1F5T A;  1K6O A;  4Q48 A;  1P4W A;  1E17 A;  1O3T A;  2Q8K A;  3ZPL A;  2J5P A;  3KP4 A;  4L18 B;  2DFI A;  2BEO A;  2M5W A;  3TO7 A;  3AAF A;  5J6X A;  5CLS A;  4EM1 A;  2H27 A;  3ZMD A;  5LGU A;  2A3S A;  1TQP A;  2IA0 A;  4BH9 A;  2CWE A;  1R00 A;  5TRD A;  5D5X B;  4WWC A;  1S7A A;  2QUF A;  1YS6 A;  1SMT A;  3EET A;  1IAW A;  1XCB A;  4G9Y A;  4P9F A;  1B9N A;  4ZYE A;  1ZLJ A;  5DUI A;  4GYI A;  2M1B A;  3KE2 A;  4IVN A;  5JHU A;  1QO0 D;  3NRV A;  1OPC A;  3ECH A;  4GYG A;  4I7H A;  3CTA A;  4MQV A;  3G3Z A;  2CFX A;  1GVJ A;  3F3X A;  4HDU A;  4FX0 A;  3FMS A;  4ENJ A;  2DK5 A;  1HKS A;  3MEX A;  2MC3 A;  5K5O A;  3F6V A;  4NB5 A;  4HDV A;  3PFI A;  5DUK A;  3F8C A;  4WXD A;  2NS0 A;  4WXC A;  4KFC A;  4N9I A;  2G7H A;  2D1V A;  4BXU A;  1JXS A;  3K1N A;  3PQK A;  4CXF A;  3IC7 A;  4A6D A;  5AON A;  3WTV C;  2J5O A;  3HHH A;  3E5Q A;  1J5Y A;  5ICE A;  3P9K A;  2PJP A;  4A12 A;  2E1N A;  2ESN A;  2EV5 A;  2X0L A;  3CUQ C;  4I01 A;  4O3M A;  4Y13 A;  1Z9C A;  1FX7 A;  5E18 F;  2G9W A;  2Z5U A;  5E20 A;  3P9I A;  4LK0 F;  3FMQ A;  3BP8 A;  1P92 A;  3RPU A;  1RI7 A;  1Z7U A;  1YO5 C;  1FSH A;  5D8L B;  1XCV A;  2LF7 A;  5BQT A;  1A04 A;  1SD5 A;  1G3W A;  4H0E A;  5DDG A;  5JVT A;  2A69 F;  4IF4 A;  5CYV A;  1AOY A;  1ZAR A;  2CO5 A;  2QEN A;  3RKY A;  3R61 A;  4FT8 A;  5FGM A;  3C7J A;  5L3B A;  2BGC A;  4HQE A;  5K5R A;  3R0A A;  6PAX A;  2QWW A;  2YU3 A;  4BAY A;  1SFU A;  1ONV A;  3T5X A;  4L9J A;  1BIB A;  3HRM A;  1U6G A;  3KCC A;  5JFR A;  1I5Z A;  5EEG A;  2XAF A;  2OZ6 A;  5E17 F;  2YR2 A;  2ISZ A;  3ZMT A;  1IN5 A;  3EYI A;  2AS5 F;  2HOE A;  2EK5 A;  1BC7 C;  1IN6 A;  1OYY A;  2QZ8 A;  1TNT A;  5D8K B;  4O6J A;  2PBI A;  3F8M A;  3ML6 A;  3TQN A;  3WE2 A;  4CDG A;  2MLG A;  1XGO A;  2Z9O A;  3MFK A;  1ZRE A;  3DFG A;  1CF7 A;  2Z3Y A;  2XUB A;  3N4M A;  2QVO A;  5LLQ A;  3CO7 C;  2V1X A;  1OKR A;  3ZMV A;  4WK8 F;  3R6S A;  3I71 A;  3Q5F A;  3VFZ A;  4IPA A;  2EV0 A;  4PZJ A;  4RS8 A;  1U3E M;  1D8K A;  1PUE E;  3D0S A;  3LA3 A;  2MLK A;  4OIP F;  4UVA A;  1KQ9 A;  3L00 A;  3LQR A;  4HLY A;  1D5V A;  3I59 A;  2YSR A;  3F21 A;  3QAH A;  2K4B A;  2EFP A;  3GLX A;  3J81 K;  1JHF A;  2XAH A;  3Q9S A;  1Z91 A;  4Q4Z F;  4N0B A;  4WF2 A;  1BBY A;  4EVI A;  2VXZ A;  3IKT A;  4ENM A;  1MJ9 A;  3QP6 A;  5FD6 A;  1JE8 A;  1CF7 B;  2F5E A;  1REP C;  3HRT A;  2WWY A;  4HAM A;  1U5T A;  3ULQ B;  1S7O A;  1R58 A;  3GW2 A;  4IHT A;  2MA3 A;  2V1D A;  1Z1D A;  3QOP A;  1FWZ A;  3KP5 A;  2FNA A;  1UCR A;  3RKX A;  3N97 A;  1LNW A;  4HF2 A;  3WTS C;  3I59 B;  3V7R A;  2OBP A;  4JK1 X;  3F72 A;  3RI4 A;  1SFE A;  4HYE A;  4KIF A;  3WGH A;  4GCV A;  1ZG3 A;  1WQ2 A;  1ON1 A;  2GWR A;  4KIB A;  2DQR A;  3V7S A;  3M8F A;  1FLI A;  3IKV A;  3H3Z A;  3K1P A;  3RYP A;  2DW4 A;  2HQN A;  2RV8 A;  4ASN A;  2VOD A;  4HV5 A;  4P96 A;  3RKW A;  4BQA A;  3F8B A;  4HW0 A;  1ZRD A;  2P5L C;  4UXN A;  2XKO A;  3IHU A;  4DQ2 A;  4RB3 C;  4RGR A;  5ILU A;  2FML A;  3DF8 A;  3M7G A;  1FNN A;  4A6E A;  3FXQ A;  4KN7 X;  4KN4 X;  4CIC A;  2O0Y A;  5F6F A;  5E8G A;  4OOI A;  5DYM A;  4Q47 A;  4BHB A;  5IT3 A;  3HOS A;  1TBX A;  5AIQ A;  2P7V B;  1WSU A;  3JAM K;  3SFZ A;  4XLP F;  1STZ A;  5HS8 A;  5LHI A;  3DXJ F;  1R36 A;  2QYO A;  5HS9 A;  2IVM A;  1O3R A;  1I1G A;  3KP3 A;  1R5H A;  5HDN A;  4A5N A;  4S04 A;  1KU7 A;  2RNJ A;  3F22 A;  2L54 A;  3FXR A;  1KU9 A;  3V4G A;  3RTR A;  4BHC A;  2BBY A;  3WTU C;  4XSZ F;  3LQQ A;  1BC8 C;  2XV4 S;  4M6X A;  2OA4 A;  2NNN A;  2IT0 A;  5HDK A;  4EJV A;  3FHZ A;  4KIG A;  1D3Y A;  2IJL A;  1FZP B;  5ERI A;  2F5C A;  2BYV E;  1VTN C;  1IXS B;  4MTE A;  5LHG A;  2GIV A;  1T98 A;  4S05 A;  1J2X A;  4OMZ A;  3CUO A;  1ZRF A;  2E7W A;  4UNO A;  5FD5 A;  4ZYH A;  1J0R A;  2PQ8 A;  4AIH A;  2X4H A;  5LRR A;  1BI1 A;  2DLL A;  4N9H A;  5D6F A;  1IXC A;  4M74 A;  2ZBK A;  1G3Y A;  2FU4 A;  1BI0 A;  2LF8 A;  3MQ0 A;  1IN8 A;  2PEX A;  1SD4 A;  1UFM A;  1MD0 A;  1MDM B;  2P4W A;  3RYR A;  4ESB A;  5FB2 A;  2VBY A;  1L0O C;  2A61 A;  3M8E A;  2ESH A;  4G6Q A;  2EFN A;  2P5V A;  4BNC A;  1J7K A;  5ED4 A;  1Y0U A;  2ZNY A;  1J9I A;  2L02 A;  3BWG A;  1IXR C;  3KFW X;  2Q2E A;  3BRO A;  3WTT C;  5HLG A;  2RKH A;  1FYM A;  2C6Y A;  2FQ3 A;  5E1W A;  5HVQ C;  5L3C A;  3E6B A;  1LDD A;  4M9S A;  2OD5 A;  3HIF A;  2JTV A;  4IJA A;  1SAX A;  2ZKZ A;  2XHK A;  4LMY A;  1FBQ A;  4E70 A;  4ZZL A;  2FBH A;  3GFJ A;  4P55 A;  2STT A;  3E3V A;  2GZW A;  2VE8 A;  4JBA A;  3GFI A;  2O8X A;  1XSD A;  5DCF A;  1ZAO A;  2ELH A;  5BS6 A;  1XDU A;  5LBQ A;  1JGS A;  3TKY A;  3TO9 A;  3P9C A;  2K4J A;  1PP7 U;  2EWN A;  5CVJ A;  3GFL A;  3O2P E;  4EJU A;  1YS7 A;  3I53 A;  2OZU A;  1I1S A;  1MKM A;  2PLY A;  3F8N A;  1IRF A;  4B09 A;  2MH9 A;  3U1D A;  1FT9 A;  3LA2 A;  4KYW A;  1IN4 A;  4ZYG A;  5CVV A;  4R8H A;  1PDN C;  1O7F A;  4IRI A;  3GZ5 A;  3IRQ A;  5DV5 A;  5H6Q A;  3HHG A;  3HTS B;  5DD4 A;  1BIA A;  1UHW A;  1HST A;  4U0Y A;  2MH2 A;  4HF1 A;  2EFQ A;  4HX4 A;  1LEA A;  2BV6 A;  3QPH A;  1P2F A;  4OU0 A;  2VT2 A;  3IWZ A;  1ZGA A;  2RDP A;  3TOB A;  1HKT A;  4L9V A;  5DCM B;  2RVC A;  5FLX K;  1S8N A;  4RGS A;  2CSO A;  2XAG A;  1HQC A;  4OMY A;  1G3T A;  3V8K A;  4YFK F;  5L3G A;  3MCZ A;  1L3L A;  2TDX A;  5TJJ A;  1GHC A;  4OIR F;  3WU0 A;  2H6C A;  3COA C;  1FP2 A;  2H6B A;  3R60 A;  2HGC A;  1XN7 A;  3WTZ A;  2W84 A;  5LGT A;  1RUO A;  2UWM A;  4YFN F;  1O3Q A;  3SZT A;  4JQF A;  1QZZ A;  1V4R A;  3Q9V A;  4LK1 F;  3QU6 A;  2KJC A;  2JRT A;  4I0A A;  2ZCW A;  2ZNZ A;  1RIO H;  5HDG A;  3I0T A;  1P4A A;  1TQM A;  2K7L A;  1B6A A;  4LB6 B;  3HSE A;  2NRA C;  1QPM A;  1OYW A;  5A2Q Z;  1MJA A;  2FBK A;  3DP7 A;  3V7C A;  2Y48 A;  1NHA A;  2H94 A;  2VBW A;  3WOD F;  2G7U A;  1QQI A;  5E1X A;  2JSC A;  5AIP A;  2IPQ X;  2ADU A;  1YLF A;  3GZ6 A;  4YG2 F;  1MJB A;  5HLI A;  3GFM A;  4RB1 A;  3FWE A;  2R7D A;  2VBX A;  4WXH A;  2RQP A;  4KMU X;  3CO6 C;  3KP2 A;  3H92 A;  2GXG A;  3LAP A;  2OU2 A;  3HOT A;  4IHS A;  3BY6 A;  2DQL A;  1XD7 A;  3QU3 A;  2FNP A;  1HSJ A;  3ZN1 A;  1BOA A;  1LJ9 A;  1UST A;  5FLX Z;  2PI0 A;  1WKM A;  1V3F A;  1KYW A;  3KLO A;  1J75 A;  2ISY A;  3JTH A;  1S29 A;  5F1R A;  1LEB A;  4LD5 A;  1YTY A;  3RPQ A;  1R23 A;  1R5G A;  4UVC A;  4HA8 A;  4MTD A;  2PMH A;  2FA5 A;  1K79 A;  3OOP A;  4UV8 A;  2EV6 A;  4OIN F;  1K7A A;  3DEU A;  1Z05 A;  4L0Y B;  1F1Z A;  1FSE A;  4HBL A;  2IA1 A;  2OQG A;  2VT3 A;  2NNY A;  5D6E A;  3DV8 A;  3DQV C;  1KGS A;  1FC3 A;  3BJ6 A;  1DP7 P;  2DT5 A;  1YW9 A;  2Z33 A;  3MAJ A;  4KNY A;  4R1H A;  3GVA A;  3KET A;  3C1D A;  2O61 A;  2V6C A;  3ISP A;  1B59 A;  4Y17 A;  3FM5 A;  2OQR A;  2B0L A;  2QLZ A;  1WWX A;  2XRO A;  3VEP A;  4ESJ A;  3B02 A;  2W25 A;  3BPX A;  4I98 B;  5E1Z B;  4KIC A;  2CYY A;  2P8T A;  4G94 A;  4ZYD A;  2IRF G;  2A07 F;  1R1T A;  2UXN A;  3L09 A;  4I09 A;  2XGX A;  3FZV A;  3EDP A;  4RAY A;  3IL2 A;  1FYL A;  3V8J A;  4G6D A;  4GXO A;  1RNL A;  4MGR A;  3KEO A;  2FBI A;  2KRF A;  2CGP A;  4CGZ A;  2A68 F;  1YW8 A;  3SHF A;  3VOE A;  2IW5 A;  3L9F A;  4L9N A; 
#chains in the Genus database with same CATH topology
 2KZV A;  5ICG A;  3I64 A;  3QP5 A;  1C0W A;  5J1R A;  3J80 K;  1K61 A;  3KZY A;  4A0Z A;  3EQL F;  2BZT A;  2BHY A;  1EA3 A;  1H88 C;  2XAQ A;  4ZDO A;  3MVP A;  3ZMU A;  1YIT I;  3GEZ A;  3S93 A;  5K5Q A;  3DLL F;  5LGN A;  4JX4 A;  4BY1 J;  3HC7 A;  4UY8 I;  2LY2 A;  1ZG1 A;  3ZMZ A;  1QZE A;  3I5U A;  4MHG A;  1IO2 A;  2LY1 A;  1WJF A;  1VQN I;  2AXL A;  3TDU C;  1DDN A;  1IRG A;  1R6R A;  3ECO A;  1IF1 A;  3OV8 A;  1HC8 A;  4M9X A;  1R49 A;  1VQ4 I;  1V5E A;  2LFB A;  4Y15 A;  1AKH B;  3HTU A;  2PFB A;  1PVE A;  2XB0 X;  3MZY A;  4AVP A;  4A3B J;  4CYD A;  4PFO A;  3WTY C;  1J59 A;  2EA4 A;  2ZME B;  1XB4 A;  4RLQ A;  2P6S A;  1T0F A;  3CMY A;  2JUG A;  5HOD A;  4M73 A;  3RKQ A;  3JSP A;  3OIO A;  2GQQ A;  1W5S A;  4FQG A;  3CLO A;  2XAJ A;  5J4V A;  1JUP A;  2CQQ A;  1F43 A;  2LYC A;  1UHM A;  3OIQ A;  4K2E A;  3DPT A;  4KMF A;  4U0V A;  2DMQ A;  4UB8 C;  4HNU A;  3K2Z A;  4XKW A;  1YRN B;  1R22 A;  4DJA A;  3JRG A;  2HNH A;  3PJR A;  3K9T A;  3BZ6 A;  4G7Z F;  1BI2 A;  1H9T A;  5GPA A;  4BU2 A;  2VQC A;  5DS9 A;  2MUN A;  2D5V A;  2WY7 Q;  1I6X A;  1OFC X;  3L1P A;  3RIR A;  4A69 C;  5EEA A;  2L9N A;  2YX4 A;  3FHN A;  2EJR A;  3A01 A;  3CUQ B;  1KU3 A;  5HS7 A;  4LIU A;  2EB7 A;  4BJ5 C;  3EUK L;  3E1S A;  1QNT A;  3ABU A;  4CCJ A;  4Q5S F;  4IZZ A;  3GBG A;  2HKX A;  3GXO A;  4M6Y A;  5ILV A;  3L2V A;  2K3F A;  3OWT A;  3O6B B;  2W85 A;  3WTX C;  2JN6 A;  1GLN A;  1BL0 A;  3WGI A;  3NQO A;  4YII A;  1IUY A;  4NQW B;  1WJD A;  2HZT A;  2NXN B;  2DBB A;  3G73 A;  3QYF A;  1OCR H;  5B1A H;  4XRF A;  1HBX G;  1HW5 A;  5FFX A;  1Y8R B;  3LST A;  2GLO A;  1BI3 A;  4NDL A;  1T95 A;  2GXA A;  2E71 A;  2JT1 A;  1DUX C;  3FM3 A;  2UXX A;  1DU6 A;  1BOB A;  1I50 J;  5FRO A;  2BY3 A;  3L7W A;  2IS4 A;  3C18 A;  2W57 A;  3PUB A;  4KT5 C;  5FLM J;  3H5A A;  1R1V A;  5B66 C;  1LE8 B;  3HSF A;  2LRD A;  1G6N A;  1G3S A;  3W2W A;  2EIK H;  2PMU A;  4MNU A;  2M3A A;  1F9N A;  2DO7 A;  1XGS A;  3U2R A;  3FKI J;  5C44 J;  2K86 A;  3MN2 A;  2EBI A;  3DBL B;  4LG0 B;  2Y0M A;  2ZXH A;  4LLL A;  3TO6 A;  4J19 A;  2QM3 A;  3GF2 A;  4HZF A;  4ENN A;  1I3A A;  4MEY F;  4R79 A;  3RPU D;  1LUJ B;  2MD5 A;  4PSX A;  1GXP A;  1T2K A;  1RUN A;  2X6Y A;  4M72 A;  3K1M A;  2CS3 A;  3MZH A;  1H8A C;  2NAZ A;  1EV7 A;  5LHH A;  3RSN A;  4NBQ A;  4ON0 A;  4A3C J;  1LDK B;  2ZXI A;  4AD9 A;  3B6A A;  3JAM Z;  1MMN A;  5A2Q K;  1LVA A;  3C3W A;  3FMR A;  1ETO A;  1D1C A;  2L3D A;  4NHJ A;  3GUD A;  1VI0 A;  3BQY A;  2K40 A;  3QPT A;  1YG2 A;  2IA2 A;  3RQI A;  1PUF B;  1ZH5 A;  2DTR A;  2JPC A;  1WJE A;  1G4D A;  1FYK A;  1Z67 A;  4CO8 A;  2G0E A;  2Z99 A;  2MC4 A;  1O3S A;  2DOA A;  5LRS A;  1IRX A;  1SEU A;  4HLX A;  1LVK A;  4S0H B;  3H1C A;  1W36 C;  1Y6I A;  3G4S I;  4F93 B;  4DNC A;  5H2F C;  1BR2 A;  3SXY A;  4AUX A;  1EH8 A;  3R4K A;  2GIZ A;  4RDU A;  1ZEL A;  4BS9 A;  2M4K A;  2Y0S A;  5KVR A;  4D7N A;  3E6M A;  2R7V A;  2DJI A;  3CCL I;  3OSG A;  3W2V A;  2WAD A;  3CZ6 A;  5B3S H;  3ABT A;  2KIS A;  1S3J A;  3HGY A;  5IYB J;  3PQJ A;  3OYN A;  1IN7 A;  2FRH A;  5CVI A;  2HKO A;  4L9T A;  4GDF A;  5FKM A;  3BDD A;  4QWQ A;  4LLG F;  2XRN A;  4IOC F;  4RB2 C;  2L01 A;  5GTI C;  2XPW A;  1LFB A;  1ZHF A;  4WCG A;  2QQA A;  3J7Y J;  1WJC A;  3H36 A;  1KU2 A;  5H6R A;  1P4X A;  1A35 A;  4M6V A;  3S3N A;  2BE5 F;  3E6D A;  1W4M A;  4RB0 A;  2ZJ2 A;  2LDU A;  3BCA A;  3FXO A;  4EGY A;  2HYG D;  2W24 A;  1WCM J;  3ZQH A;  4DYC A;  2CG4 A;  2CH0 A;  2HQ5 A;  4Y4R A;  2OV7 A;  3DKW A;  2LG4 A;  2ZFW A;  1OMI A;  2BXY A;  2PX9 A;  2DA6 A;  2ZSI B;  1CGP A;  5GAD J;  3JSO A;  5DCM A;  3SEQ A;  1GT0 C;  2EIL H;  3BR0 A;  5GPC A;  4C3H J;  4OIO F;  2RQQ A;  3CDL A;  2JMW A;  1V55 H;  2W82 A;  2XAU A;  4M9Z A;  4BKX A;  2KIU A;  3O3K A;  1LB2 A;  1W5T A;  3GYH X;  2WTE A;  1U78 A;  1O57 A;  1ZN2 A;  1UAA A;  4DBR A;  1RKW A;  3C2B A;  3LFU A;  3I54 A;  2HWV A;  4G7O F;  2BY0 A;  1WI3 A;  1Y0N A;  5ICC A;  3H9J A;  3OYB A;  1U9N A;  1X1D A;  2OCC H;  1OR7 A;  2VN2 A;  3H0G J;  2VJ4 A;  3HRS A;  2Y69 H;  3ZP5 A;  1MGT A;  1OQY A;  3BPV A;  5CJ9 A;  4FE7 A;  4XLN F;  4A5M A;  4HX7 A;  5F0H A;  1B8I A;  4EJT A;  3TOA A;  2GA2 A;  4IHV A;  2VOO A;  9ANT A;  3FX3 A;  1USS A;  1MND A;  2DCE A;  4A2U A;  5JVG F;  3ZQI A;  4HX8 A;  4A3K J;  3GWZ A;  4RAZ A;  1Y56 A;  2FXA A;  1Q1H A;  2V1N A;  1XGM A;  2FF4 A;  3H3U A;  4IRH A;  3IV5 A;  4DZJ A;  1XDS A;  5HLH A;  4EM0 B;  5BPI A;  1BA5 A;  2PN6 A;  3HOV J;  1GXQ A;  1B4A A;  1SAU A;  2VPR A;  4HPQ A;  3HOX J;  1TT0 A;  5D4R A;  1T39 A;  3VOD A;  2R7T A;  4HV6 A;  2M30 A;  4XBF A;  2Y0S N;  5CVU A;  2WAQ A;  3KX2 A;  3BJA A;  2LY9 A;  4BEH B;  5EEH A;  5CVR A;  2M45 A;  1VQL I;  1OYI A;  1SVM A;  2VC0 A;  4EJO A;  2QQ9 A;  4ESF A;  2DT6 A;  2KL4 A;  5JI6 A;  1TQI A;  3LNQ A;  3VYU B;  3OYD A;  5GP9 A;  3LSP A;  4MEX F;  4AIK A;  4P9U A;  3E6C C;  1ZLK A;  3WTW C;  3K4K A;  2FSW A;  2FOK A;  2A5Y B;  2B9S A;  5H20 A;  3T8R A;  2XSJ C;  3WG7 H;  4W97 A;  3MD2 A;  3KYL A;  2R7F A;  2Q0O A;  2O9L A;  3BLY A;  1S5L C;  3TGN A;  2LKP A;  1JT6 A;  5E3L A;  4L5J A;  1SD6 A;  5L3E A;  3H9Q A;  2FEZ A;  5JR3 A;  4UV9 A;  2UZK A;  1PYV A;  4HOB A;  3GME A;  3I58 A;  3RZO J;  4V2F A;  2EQR A;  2R7Q A;  2HDD A;  2W48 A;  3ERM A;  2ECB A;  4BDZ A;  3LSJ A;  4BE2 A;  3K4B A;  4XRM A;  1D1B A;  2RC4 A;  1KQ8 A;  3JCU C;  3HG9 A;  4LJZ F;  3F23 A;  1LQ1 A;  3GTG J;  1A31 A;  4G8X A;  4EGZ A;  3G1O A;  2BVL A;  3DU6 A;  2Q2E B;  3VB2 A;  1JT0 A;  4E6K G;  2WC2 A;  2B63 J;  2DYS H;  1ITY A;  1FBU A;  2RN7 A;  1IC8 A;  4ZZD A;  2R5Z B;  2KIM A;  2D45 A;  2ACJ A;  1UB9 A;  2VC1 A;  2ZXW H;  4KJZ A;  4M3E A;  1WFX A;  4HEA 2;  1X3U A;  2R3S A;  1R71 A;  2E1C A;  5FFZ A;  2TCT A;  3OYC A;  4IRG A;  1W36 D;  3L2C A;  3O8H A;  1FEX A;  3J7Z I;  5BMZ A;  2K3P A;  1HXD A;  3ELK A;  1JJ6 C;  3AG4 H;  4M71 A;  2IGO A;  3S2D J;  1XSX A;  2CQN A;  3BR6 A;  3F6O A;  3M9A A;  4UHT A;  4CYC A;  1XG1 A;  2F4I A;  3KEQ A;  3LWF A;  5IP6 A;  2F2E A;  4QLC U;  4DYR A;  1V54 H;  5BPD A;  4PUS A;  3ZQQ A;  4EJW A;  2KDZ A;  1TT5 B;  1K78 A;  4GFB A;  5J8F A;  2L9R A;  4LGW A;  4HNT A;  4PCQ A;  1IZ1 A;  4WX9 A;  1U9O A;  2HTJ A;  3KYC B;  3NAR A;  2DA1 A;  1O7L A;  2LTP A;  2D1H A;  3H5R A;  2KP6 A;  1BJZ A;  3I4P A;  2ZSH B;  4ETS A;  4B44 A;  2DAO A;  5B1B H;  3RDI A;  2E2H J;  2XPV A;  4G7H F;  4LOC A;  3HRU A;  1X2N A;  2CW0 F;  4OAY A;  4XOP A;  3J81 R;  3LSI A;  1MH4 A;  1ZR2 A;  1ZKG A;  4FAS D;  4CZZ A;  1R5I D;  2H09 A;  1UMQ A;  3AG3 H;  2NOJ B;  5CQG A;  2HVR A;  3LAJ A;  4IL6 C;  3CUQ A;  5J4Y A;  1DP3 A;  2F5F A;  1F4K A;  1N78 A;  1ZRC A;  2JSP A;  3FF5 A;  4B3X A;  2HVQ A;  2UV1 A;  2GXB A;  3FXL A;  2DA7 A;  5EDN A;  1JTX A;  2X98 A;  5GAH J;  4U88 A;  1E2X A;  2M8E A;  3BR2 A;  2LNB A;  3S1M J;  4IQJ A;  1VQ7 I;  3HUG A;  1D1A A;  1XGN A;  4BHP A;  1U8R A;  3B73 A;  2VPL A;  4U7D A;  1LFP A;  2HR3 A;  2P81 A;  1T8I A;  1X4P A;  1HF0 A;  3FXU A;  2HOS A;  5DEQ A;  2V7F A;  4X6A J;  3U21 A;  5D5W B;  4ENK A;  4DIQ A;  4BYY A;  4B8X A;  1EH7 A;  1DPR A;  2HXI A;  1K83 J;  2VQL A;  2JWT A;  2HZD A;  2IEK A;  4LFU A;  3D5R C;  1FIA A;  1ODD A;  3IAM 2;  3CJN A;  4QPO A;  4AWX B;  3BJO A;  1XSV A;  3X2Q H;  3CCV I;  2YX7 A;  2DU9 A;  3VYS B;  3T1B A;  4E7S A;  2LK2 A;  4XKC A;  2BXZ A;  3IH4 A;  5HNF A;  3PIP F;  4YIF A;  3H0D A;  3K69 A;  2ZME A;  3VDX A;  3MWM A;  2BHZ A;  1SMY F;  1MNM C;  4GGG A;  1U2W A;  2F4M B;  2JZY A;  4BL0 B;  3EUH C;  4P1W A;  5CQE A;  2KT0 A;  5E8I A;  3JRB A;  2W7N A;  2JA6 J;  3LSG A;  5IP9 J;  1B1B A;  4UVB A;  4DW6 A;  4JOM A;  4UUV A;  1FY7 A;  1HOM A;  2M0C A;  1ULY A;  1OIS A;  2ZXJ A;  2F5V A;  1WH5 A;  2I10 A;  1D0Z A;  2L4M A;  2ELK A;  1R7J A;  2E1M C;  2CW8 A;  3ASO H;  2P6T A;  3K4L A;  4RGU A;  3KLN A;  3CC4 I;  2DPD A;  3L2Q A;  4W1U A;  1ACI A;  2IP2 A;  1TNS A;  2L4A A;  3JRA A;  1HW2 A;  5M3M J;  4DOZ A;  4I2O A;  2GA1 A;  4ABZ A;  2XGD A;  5FO5 A;  4N4N B;  1ON2 A;  2DA2 A;  4II2 A;  2GOX B;  2DPU A;  1D8J A;  2HFH A;  1MBH A;  1WI9 A;  3WU1 B;  1YYV A;  1T38 A;  1W7P B;  3JRH A;  2CQX A;  3VSL A;  4L5I A;  4M3B A;  2MBF A;  2EPF A;  2V9V A;  3SQN A;  3ZN0 A;  5F64 A;  1I27 A;  4DGW B;  3WG9 A;  2QKL B;  2OF7 A;  3ZRG A;  2HTS A;  4HF0 A;  4E4H A;  1KA8 A;  3CDH A;  4C3J J;  1HKQ A;  2YPR A;  1N75 A;  3SZP A;  4LIV A;  1DPU A;  3P7N A;  2R7R A;  3GTM J;  3F8F A;  1YHQ I;  3PL8 A;  1ZQ3 P;  1B9M A;  4ZH4 F;  5IT9 K;  1KYZ A;  5D5U B;  5ICF A;  2XF7 A;  4PSW A;  1TTY A;  3FDY A;  3BZK A;  1HDP A;  5GTH C;  3OYI A;  4LG3 A;  2E1O A;  3ASN H;  2JVH A;  1LFU P;  2FE3 A;  2V79 A;  4KA4 A;  4XIC A;  2XKP A;  2ZO4 A;  4E7L A;  4PDK A;  2WAF A;  1BJA A;  2HYF A;  4M3D A;  3GCM A;  1ETQ A;  2COM A;  2XSD C;  2XVC A;  4U7B A;  1B72 A;  2PG4 A;  3DPL C;  4NQW A;  4I0B A;  1W7P A;  4CCN A;  1SFX A;  4HG2 A;  5K1Y A;  2R5Y B;  2XF6 A;  3W6J B;  2VE9 A;  4MQ9 F;  3WGG A;  3TED A;  1RZ4 A;  3NEU A;  2NVU B;  5J47 A;  1XMK A;  4RGX A;  2P5K A;  3HDD A;  3LA7 A;  4HQM A;  1P6R A;  4J01 A;  1YQA A;  4BUP A;  1PP8 F;  3GLL A;  2DDA A;  4EMS A;  3PIO F;  4L0Z B;  3HBL A;  2KKO A;  2WV0 A;  1R4N B;  3DEW A;  2X48 A;  4BBS J;  4X1E A;  2OC6 A;  1VQ6 I;  1QBJ A;  2HEO A;  3ZMS A;  1XX5 A;  4KDP A;  1MDM A;  1Z6T A;  3KP7 A;  3L2R A;  4XLC A;  1E3P A;  2O03 A;  4XN3 A;  3M1E A;  2K02 A;  3E7L A;  2O3F A;  4LG0 A;  3VYT B;  2CQ7 A;  2F4O B;  2VAS A;  2R0Q C;  1XMA A;  3Q0U A;  3BG7 A;  5FKO A;  5TIS C;  3T8T A;  4CHU A;  4A3F J;  2NYX A;  1SC7 A;  2JPB A;  2HQR A;  4F7Z A;  3CJR B;  3FXJ A;  1YIJ I;  3ABK H;  1ZG5 A;  2YS9 A;  1EH6 A;  1GV5 A;  2M7B A;  3CCU I;  2M87 A;  4FX4 A;  2DK8 A;  2TRT A;  3IUO A;  3K6G A;  5HOO A;  1FIP A;  5BNG A;  2V1U A;  1ZYR F;  2KIF A;  3H9G A;  2XPU A;  2L7M P;  3QYE A;  3A52 A;  3J81 Z;  1MZB A;  2RGV A;  1WJA A;  4A0Y A;  4IQ4 A;  1W0T A;  2E7X A;  3J7A O;  3GO5 A;  3ZQC A;  2WY8 Q;  2V6E A;  3D5L A;  3J7A Y;  4AIJ A;  1OCP A;  1YW7 A;  1JHH A;  2VON A;  2VBZ A;  1JKR C;  4OIQ F;  5IPA A;  2HDC A;  4A3M J;  1ZR4 A;  2DI3 A;  4U0W A;  1U5T B;  2XC7 A;  4GO1 A;  2M4G A;  4FHT A;  3ERE D;  2Y2Z A;  4D0P A;  1XMX A;  3EUH A;  3JTG A;  1TW3 A;  3U9G A;  1MSE C;  2A05 A;  2DYR H;  3W6K B;  4NNJ A;  1SVL A;  3UKG A;  1EKE A;  2GAU A;  2DOE A;  2O6G E;  2LSO A;  2P7C B;  1MH3 A;  2FQ4 A;  4PGH A;  1VQO I;  1XTA A;  2QQB A;  3OYL A;  4LLN A;  3KP6 A;  1JTY A;  2K9Q A;  1FOK A;  4B4C A;  4A3E J;  2EA2 A;  4EV0 A;  3HSR A;  3DU5 A;  1LPQ A;  3IWF A;  2KJB A;  3KZZ A;  5EJC A;  2JQ7 A;  2STW A;  3CQZ J;  2M2E A;  3K7A J;  1W7P D;  1YIO A;  2QBY A;  5K7H A;  1IW7 F;  1YFH A;  3PNV A;  2CQK A;  1QVU A;  4F92 B;  2E60 A;  2VKV A;  3DPU A;  5L3D A;  1LDJ A;  4O5V A;  1KQ0 A;  5J8C A;  4PGG A;  3ZQ7 A;  3ZOB A;  1X1C A;  5IP7 J;  2DFH A;  3K0L A;  4V19 K;  1FBS A;  4FET A;  3FXK A;  3JW4 A;  3GX4 X;  3S2W A;  5EGO A;  3BOQ A;  4PJN A;  4XSX F;  2R7X A;  1H9G A;  2A6H F;  2V4J C;  5IYD J;  1DGW Y;  2FMY A;  2F5D A;  3OIP A;  4RMN A;  3TDZ C;  3NAU A;  3T0Y A;  1QU3 A;  1QGP A;  1Z6R A;  3JAM R;  1FPQ A;  4TV7 A;  1R1U A;  2WA0 A;  5JLX A;  3EYY A;  5M5W J;  5IT9 Z;  4RLF A;  2VOP A;  3P5J A;  4YFX F;  5M5X J;  3GTO J;  4PFP A;  1H0M A;  3E5X A;  3RJP A;  2L7K A;  5EZG A;  5D5V B;  1IGN A;  1WRJ A;  2DMP A;  1K78 B;  4BE0 A;  4A0X A;  4IXA A;  1H89 C;  2XAS A;  5L3F A;  2EFO A;  4JP0 A;  4PJ0 C;  1VFC A;  1DU0 A;  2JA8 J;  1T6S A;  2LKS A;  3V8L A;  1S6L A;  4XLH A;  3EUA A;  3REO A;  1AWC A;  2WB1 N;  5BOX A;  1OR7 C;  3A03 A;  5E3N A;  1BN5 A;  5KK1 A;  4YIR X;  3TW6 A;  2MSY A;  4ZYA A;  3HB9 A;  1BW6 A;  5DD8 A;  3HYI A;  4EQQ A;  1SD7 A;  1U5T C;  2VL8 A;  4F91 B;  2A6E F;  2HS5 A;  2BW3 A;  3E5U A;  3J80 Z;  2Y75 A;  5J40 A;  5ILS A;  3SFI A;  4DBQ A;  1X2M A;  1TL8 A;  2JA2 A;  3OYE A;  2D2W A;  3HOZ J;  1TLH B;  2W4S A;  4P5O A;  3JRE A;  2XIG A;  4XL9 A;  4XMY A;  3ROU A;  4EM2 A;  3E0J B;  4KUM A;  1BM9 A;  1ZGJ A;  2V26 A;  3H35 A;  2ID3 A;  1HW1 A;  1MMA A;  2DMN A;  3E97 A;  4LB5 A;  1FTZ A;  2ETH A;  4C3I J;  3OYK A;  1TW2 A;  3LFK A;  4BEH A;  5LEK A;  3I56 I;  3TP3 A;  2QBY B;  1QZY A;  1TZL A;  5D4S A;  1BR4 A;  1WPK A;  4I02 A;  1TWF J;  4AYB N;  4B3A A;  5LEJ A;  3S1R J;  1AA7 A;  4Z2Y A;  4UUT A;  2OTL I;  2OAZ A;  2CV2 A;  2K27 A;  4HNV A;  1YRN A;  1MBK A;  3MKL A;  1FP1 D;  1UG0 A;  1Z77 A;  3LSH A;  3R0J A;  5KAI C;  2R7O A;  3WE3 A;  4B1R A;  2HVS A;  3QPL A;  3QRF F;  2UUZ A;  2EFW A;  3IRR A;  1F5T A;  3PUF A;  1K6O A;  1RR7 A;  2H8W A;  2O5R A;  1P4W A;  4Q48 A;  1E17 A;  2Y9Z A;  2I8D A;  3S1N J;  1O3T A;  2Q8K A;  4Y33 A;  2LD5 A;  3ZPL A;  1P9Q C;  2J5P A;  4B48 A;  3KP4 A;  4L18 B;  2DFI A;  2BEO A;  2OPT A;  3CC2 I;  2M5W A;  3OMY A;  3TO7 A;  3AAF A;  2DN0 A;  4ZTJ A;  2NOG A;  2BY1 A;  5J6X A;  5CLS A;  4EM1 A;  2H27 A;  4EAT A;  3ZMD A;  2CW7 A;  5LGU A;  2GM4 A;  2NVT J;  2A3S A;  1TQP A;  1Z7L A;  3ZQF A;  2IA0 A;  5TGT A;  1X4O A;  4BH9 A;  2CWE A;  3S8P A;  1R00 A;  1JJ8 C;  4XQF A;  5TRD A;  2MD0 A;  5D5X B;  4WWC A;  1A6I A;  2DFE A;  1S7A A;  2MYS A;  4EEF G;  1MMG A;  2QUF A;  1ORK A;  1X1P A;  1YS6 A;  1SMT A;  2F6C A;  2QGU A;  2Z16 A;  3EET A;  5KNL A;  1IAW A;  1HDD C;  3J7A W;  3K4M A;  2LOO A;  1XCB A;  4G9Y A;  4P9F A;  1B9N A;  4ZYE A;  1ZLJ A;  5DUI A;  4GYI A;  2O7O A;  2M1B A;  1GUU A;  3KE2 A;  1T33 A;  4IVN A;  5JHU A;  1X1A A;  2WBM A;  1QO0 D;  3NRV A;  2ZJR F;  1OPC A;  3ECH A;  3C2G A;  3FIS A;  4GYG A;  4I7H A;  3CTA A;  2FX0 A;  2ZJQ F;  4MQV A;  5EF6 A;  3EPZ A;  3G3Z A;  2JA7 J;  4I6Z A;  3BG6 A;  2CFX A;  1GVJ A;  3F3X A;  4HDU A;  4FX0 A;  3FMS A;  2IS1 A;  4ENJ A;  4BDY A;  1B72 B;  4A93 J;  1TWH J;  2DK5 A;  1HKS A;  3MEX A;  2KRC A;  4NC7 A;  4GRI A;  2MC3 A;  3ZXS A;  1ETX A;  4L5E A;  5K5O A;  4G12 A;  3F6V A;  1MBE A;  1MNE A;  4NB5 A;  4HDV A;  3PFI A;  3W3C A;  5DUK A;  3PNY A;  3HZJ A;  1FOX A;  3F8C A;  3M3Y J;  4WXD A;  2NS0 A;  4WXC A;  4KFC A;  2FUG 2;  4N9I A;  3HUG B;  2KZG A;  3K2A A;  2DMU A;  4FE4 A;  2G7H A;  2D1V A;  4BXU A;  1JXS A;  3K1N A;  3PQK A;  5M5Y J;  4CXF A;  3IC7 A;  2CV1 A;  4A6D A;  1T08 B;  5AON A;  3WTV C;  1IDY A;  2J5O A;  2XGC A;  3HHH A;  3S2H J;  3I4N J;  2R7Z J;  3E5Q A;  1J5Y A;  3V42 A;  5ICE A;  1ETY A;  3A2K A;  3P9K A;  2VKE A;  2OCE A;  2PJP A;  4A12 A;  3DKY A;  2E1N A;  2ESN A;  2EV5 A;  2M0M A;  2X0L A;  3CUQ C;  4I01 A;  4QSH A;  4O3M A;  4Y13 A;  2ZB9 A;  5K7Z A;  1Z9C A;  1FX7 A;  5E18 F;  2R5Y A;  2G9W A;  3DEE A;  3BR3 A;  2Z5U A;  3N05 A;  5E20 A;  3P9I A;  4XLA A;  1P7I A;  1TC3 C;  1QRY A;  2AQE A;  4LK0 F;  1X58 A;  3FMQ A;  3BP8 A;  2R93 J;  1P92 A;  3RPU A;  4XLF A;  1RI7 A;  3BR1 A;  4U87 A;  1Z7U A;  2QSH X;  3OSF A;  1YO5 C;  2LMD A;  3B6C A;  2CUJ A;  3S3O A;  2NS7 A;  1VND A;  4JYK A;  1FSH A;  5D8L B;  1XCV A;  3OL3 A;  2LF7 A;  4IEJ A;  4JX6 A;  5BQT A;  1A04 A;  1SD5 A;  4D7M A;  1SFO J;  2VUM J;  1G3W A;  2A5W A;  4CCL A;  4H0E A;  5DDG A;  5JVT A;  2A69 F;  4IF4 A;  5CYV A;  1UEL B;  1AOY A;  3CCE I;  5C4X J;  1ZAR A;  3BTJ A;  3JRF A;  1RQ6 A;  2CO5 A;  2QEN A;  4FTH A;  3RKY A;  5DM6 F;  3R61 A;  4FT8 A;  1IUF A;  2QSF X;  5FGM A;  1YE9 A;  3C7J A;  5L3B A;  1Q1V A;  2ID6 A;  3CCR I;  4QIW N;  2BGC A;  3Q0V A;  4BY7 J;  5K5R A;  4HQE A;  1RKT A;  3R0A A;  6PAX A;  2K5C A;  3K4N A;  2QWW A;  1RPW A;  2YU3 A;  4BAY A;  1SFU A;  2JUC A;  1ONV A;  3T5X A;  4L9J A;  2E2I J;  1DGR M;  1W5C C;  1BIB A;  2DDB A;  3HRM A;  1U6G A;  3C2H A;  2DA4 A;  1I3Q J;  1TP4 A;  3KCC A;  5FLX R;  3CJT B;  1WVR A;  1WJB A;  2P0T A;  3HOW J;  1VZ0 A;  5JFR A;  1I5Z A;  2JK3 A;  5EEG A;  4CCK A;  2L9S A;  2XAF A;  2VJI A;  3TMO A;  5KAF C;  1MBF A;  2OZ6 A;  2ELJ A;  5F0F A;  1Y39 A;  5E17 F;  3CLQ A;  3TW7 A;  2YR2 A;  2ISZ A;  3NWT A;  2K85 A;  4B43 A;  4F3Q A;  4J00 A;  3ZMT A;  1IN5 A;  3EYI A;  1F36 A;  2AS5 F;  1CQT A;  1SAN A;  2HOE A;  4BQN A;  2E36 A;  2EK5 A;  1BC7 C;  1SVO A;  1Z3X A;  1IN6 A;  1OYY A;  2QZ8 A;  5FJ8 J;  1Z21 A;  1K4T A;  1D0Y A;  4CA0 A;  1TNT A;  5JHF A;  2M35 A;  5D8K B;  4IX7 A;  1BR1 A;  1I6H J;  2AXT C;  2LBF A;  4O6J A;  1A36 A;  2PBI A;  3MMY B;  2M9H A;  3F8M A;  2VKH A;  2N8G A;  3VWB A;  1U0J A;  3ML6 A;  3TQN A;  2L2O A;  4XN0 A;  3OR2 C;  3WE2 A;  4Y7N J;  4FCY A;  3BZC A;  3SEZ A;  4CDG A;  2MLG A;  1YJW I;  1XGO A;  2BVM A;  1QVT A;  3MFK A;  2Z9O A;  1ZRE A;  3DFG A;  4AC0 A;  4BGD A;  2JA5 J;  3DBR B;  1CF7 A;  2QF7 A;  3OS2 A;  2Z3Y A;  1E3O C;  2XUB A;  3M8J A;  4XKB A;  3HPG A;  3N4M A;  2QVO A;  1X3Z B;  3UR3 C;  3FK6 A;  1GV2 A;  5GAE J;  4MFE A;  5LLQ A;  2XDV A;  2K9M A;  3CO7 C;  2V1X A;  1OKR A;  3ZMV A;  4WK8 F;  3FXM A;  3R6S A;  3I71 A;  3Q5F A;  3JR9 A;  3VFZ A;  4IPA A;  2L7Z A;  2EV0 A;  2X9D A;  4PZJ A;  1S9H A;  1IV6 A;  4RS8 A;  4AVZ A;  1UHS A;  1U3E M;  2LBF B;  1D8K A;  1PUE E;  3D0S A;  2AO9 A;  3LA3 A;  1FMV A;  3PSI A;  3D5S C;  3LOC A;  2MLK A;  4OIP F;  4UVA A;  3J80 R;  1KQ9 A;  4ANJ A;  2VXD A;  3K4C A;  2K9L A;  5IT9 R;  2LH9 A;  4BXX J;  4A3I J;  3L00 A;  1ZTR A;  3LQR A;  4HLY A;  1D5V A;  4CCM A;  3I59 A;  4PK4 A;  3LSK A;  1O4X A;  2X6W A;  4M3G A;  2YSR A;  3F21 A;  3QAH A;  2K4B A;  3HEF A;  5EG0 B;  3OYG A;  4IOA F;  4II3 A;  2R4G A;  2EFP A;  2HPM A;  3GLX A;  2LVS A;  3J81 K;  2PMZ N;  4A3J J;  1JHF A;  2XAH A;  3HM5 A;  3Q9S A;  1Z91 A;  1KZH A;  4Q4Z F;  2WAQ N;  1NK2 P;  4N0B A;  4WF2 A;  2XB5 A;  2LRE A;  3A0H C;  1BBY A;  4EVI A;  2VXZ A;  2X51 A;  1VF9 A;  2ZFU A;  3IKT A;  3QWL A;  1FTT A;  4BAC A;  4ENM A;  4PJJ A;  1MJ9 A;  3CCM I;  2HOT A;  2L5Q A;  1IV8 A;  2KMU A;  3ABM H;  3QP6 A;  5FD6 A;  2PJR A;  1JE8 A;  1CF7 B;  3DCF A;  4AM3 A;  2F5E A;  1REP C;  2I5U A;  2HPI A;  3HRT A;  2WWY A;  4HAM A;  4ZDL A;  3RQ4 A;  1LE8 A;  3H5N A;  1U5T A;  3ULQ B;  1S7O A;  1R58 A;  3GW2 A;  3OR1 C;  1Z3Y A;  3Q3S A;  1RR8 C;  4IHT A;  2MA3 A;  2V1D A;  1Z1D A;  2Y30 A;  3QOP A;  1FWZ A;  3KP5 A;  4KIT B;  1HLV A;  2FNA A;  1IRZ A;  3BTC A;  3KIO A;  1UCR A;  3DWL E;  3S14 J;  4E7J A;  3RKX A;  5F27 A;  1N77 A;  1NK3 P;  2LC2 A;  3BT9 A;  3N97 A;  3S3M A;  5F1J A;  1LNW A;  3SJM A;  4HF2 A;  1AHD P;  3TL4 X;  3WTS C;  3BTL A;  3I59 B;  5E3M A;  3V7R A;  2OBP A;  1V5F A;  4JK1 X;  3F72 A;  1UG2 A;  4E7H A;  3RI4 A;  3BR5 A;  1SFE A;  5EZH A;  4HYE A;  4KIF A;  1SFK A;  3WGH A;  3KEY A;  4GCV A;  1ZG3 A;  1WQ2 A;  4DYQ A;  1ON1 A;  2GWR A;  4KIB A;  3W2A A;  2E1M B;  2DQR A;  3AG1 H;  4HST A;  3V7S A;  3M8F A;  1FLI A;  3IKV A;  5GAG J;  3H3Z A;  4XID A;  1YX3 A;  3K1P A;  4X0G A;  3HL2 A;  3RYP A;  2CUE A;  4PJM A;  2DW4 A;  2HQN A;  2RV8 A;  4M3F A;  5C3E J;  2VB6 A;  3K10 A;  3WU2 C;  2YUS A;  2EZK A;  5LD2 C;  4ASN A;  2VOD A;  3K4J A;  3A4C A;  2HYJ A;  4HV5 A;  5FKK A;  2ICW G;  4XRS A;  1G2H A;  4P96 A;  3RKW A;  3GTL J;  2GBY A;  5LFA A;  4BQA A;  3F8B A;  4HW0 A;  2Z2S B;  1ZRD A;  3PM1 A;  2COB A;  2P5L C;  4D5C A;  2KPM A;  1RRJ A;  4UXN A;  1MBJ A;  5CKT A;  5IY5 H;  5JLW A;  3ESW B;  2EIJ H;  2X1C A;  1S72 I;  2XKO A;  1JKO C;  1X19 A;  4CCO A;  2X1E A;  3IHU A;  4DQ2 A;  2MG4 A;  4BJ6 C;  1W0U A;  3U1K A;  2EH3 A;  4RB3 C;  4RGR A;  5A2Q R;  2ZME C;  5ILU A;  2E19 A;  2FML A;  1QHG A;  1NTC A;  3HJE A;  3DF8 A;  2VI6 A;  2FOW A;  3M7G A;  1FNN A;  4A6E A;  3FXQ A;  4KN7 X;  4KN4 X;  3WHC A;  4CIC A;  1Y8Q B;  2O0Y A;  1JKP C;  3UNG C;  5F6F A;  5J1U A;  5E8G A;  4OOI A;  5DYM A;  5IOZ A;  1GVD A;  1MBG A;  1FOW A;  2AHQ A;  2FJ1 A;  4Q47 A;  2M34 A;  2X6O A;  4BHB A;  4N4O B;  1QHH D;  5IT3 A;  3HOS A;  1TBX A;  1GDT A;  2VQG A;  3ZQG A;  4E7Z A;  1FMW A;  2QSG X;  3PO2 J;  2OTJ I;  3G1M A;  2FD5 A;  2LLK A;  2P7V B;  2OJE D;  5AIQ A;  1WSU A;  3JAM K;  1K4S A;  3SFZ A;  4XLP F;  1STZ A;  3FK7 A;  5HS8 A;  5LHI A;  3W6V A;  3DXJ F;  1R36 A;  2QYO A;  2VJJ A;  2IAI A;  5C4J J;  2MW8 A;  5HS9 A;  2IVM A;  3AL0 C;  1D5Y A;  1O3R A;  2R7S A;  3G1L A;  1IDZ A;  1I1G A;  4I99 C;  3KP3 A;  2KFD A;  2LP0 A;  1I39 A;  4IHW A;  1UZC A;  1R5H A;  5HDN A;  4A5N A;  4S04 A;  1KU7 A;  1PJR A;  5FRN A;  2RNJ A;  1UJ8 A;  3PSF A;  3F22 A;  2L0K A;  2L54 A;  3MKZ A;  3FXR A;  5IOY A;  1KU9 A;  3V4G A;  1VQK I;  1V5G A;  3RTR A;  4BHC A;  2BBY A;  3WTU C;  4XSZ F;  3G6E I;  1NH3 A;  3LQQ A;  4ZC3 A;  3SDB A;  1XS9 A;  1BC8 C;  4BE1 A;  2XV4 S;  2CMP A;  1R9T J;  4M6X A;  5HNH A;  2EZH A;  2OA4 A;  2NNN A;  3S32 A;  2IT0 A;  3G2B A;  5HDK A;  3CCY A;  4BQO A;  2KLO A;  4EJV A;  3FHZ A;  3H3V K;  4KIG A;  1D3Y A;  2IJL A;  2W1O A;  1FZP B;  5ERI A;  2F5C A;  2BYV E;  3DTE A;  1VTN C;  1Z0X A;  1IXS B;  3L2W A;  3I9V 2;  4MTE A;  2QA4 I;  5LHG A;  2GIV A;  3DBH B;  3I3L A;  1T98 A;  4S05 A;  1J2X A;  4LIT A;  4OMZ A;  3PO3 J;  3G71 I;  1AKH A;  3AL0 B;  3BQZ A;  2EZI A;  3CUO A;  3GTP J;  2LR8 A;  1RC9 A;  1ZRF A;  1YJ9 I;  1A5J A;  2IS2 A;  2E7W A;  4UNO A;  3Q0W A;  5FD5 A;  4ZYH A;  3VYR B;  1EF4 A;  1RET A;  2MGQ A;  4XOT A;  1J0R A;  2E34 A;  1VQM I;  2PQ8 A;  4AIH A;  2X4H A;  5LRR A;  1BI1 A;  2KDO A;  2NS8 A;  3AG2 H;  2PJR B;  4E7I A;  2DLL A;  4N9H A;  3HOY J;  5D6F A;  4H4K C;  1IXC A;  4M74 A;  2ZBK A;  1G3Y A;  2FU4 A;  1BI0 A;  1OCZ H;  2LF8 A;  3MQ0 A;  1Y1W J;  1R4M B;  1IN8 A;  2IBD A;  2E2J J;  4A3L J;  2BW3 B;  2PEX A;  1SD4 A;  1UFM A;  1MD0 A;  1MDM B;  2P4W A;  3RYR A;  4IKF A;  4ESB A;  1NG6 A;  2V9K A;  4RBO A;  3ZQL A;  5FB2 A;  2VBY A;  1L0O C;  2A61 A;  3BCB A;  2QCO A;  2ESH A;  3M8E A;  4G6Q A;  1OCC H;  4B47 A;  2EFN A;  4CH7 A;  1T56 A;  2KRH A;  3IAS 2;  3DLA A;  4C2U A;  2P5V A;  1ERD A;  4BNC A;  1J7K A;  3CJQ B;  5ED4 A;  1Y0U A;  1TWC J;  2ZNY A;  4XM3 A;  4C2T A;  1J9I A;  2L02 A;  3BWG A;  1IXR C;  3KFW X;  3D1N I;  3GTK J;  2Q2E A;  3BRO A;  1OCT C;  3WTT C;  2NVX J;  1JKQ C;  1FJL A;  4ZDP A;  2IXS A;  4ITV A;  5HLG A;  3K70 D;  2RKH A;  1FYM A;  2C6Y A;  2FQ3 A;  2EIM H;  5E1W A;  5HVQ C;  4CSW A;  4AYB A;  5L3C A;  3CES A;  3E6B A;  1LDD A;  4M9S A;  5B5E C;  2OD5 A;  2CV0 A;  3AKZ A;  3HIF A;  3BTI A;  2E5N A;  2JTV A;  4IJA A;  1SAX A;  2ZKZ A;  1E3H A;  2XHK A;  4C9Y A;  2V9P A;  3CDI A;  4LMY A;  3L2U A;  2RRE A;  3M1C A;  1FBQ A;  1TWG J;  4E70 A;  1A6Q A;  5EG0 A;  4ZZL A;  2NVQ J;  4CYC B;  2FBH A;  2OUM A;  5FKL A;  3GFJ A;  3CCQ I;  1QA6 A;  4P55 A;  4HRI A;  3M07 A;  4RM2 A;  2STT A;  3E3V A;  3ABL H;  3CME I;  3CMM A;  2GZW A;  2VE8 A;  1W1W E;  4JBA A;  2Y31 A;  4KT6 A;  3GFI A;  2O8X A;  2XRL A;  1XSD A;  5DCF A;  1ZAO A;  1E0E A;  5FLV A;  2ELH A;  4C2M J;  3BG9 A;  4RA2 A;  5BS6 A;  2CUZ A;  1XDU A;  4UUS A;  5LBQ A;  1RES A;  3ZR8 X;  1Y1V J;  3JRI A;  4IHX A;  1APL C;  1DQU A;  1JGS A;  3OYM A;  3TKY A;  5K7F A;  3TO9 A;  3P9C A;  2K4J A;  1PP7 U;  2EWN A;  4MLO A;  5CVJ A;  3S15 J;  2H1L A;  1VQ5 I;  3IP4 B;  3GFL A;  1WZ2 A;  3O2P E;  4EJU A;  1YS7 A;  2Y9Y A;  3I53 A;  2VLA A;  1OJL A;  1K6Y A;  2XF5 A;  4AID A;  2L9V A;  2X6X A;  2OZU A;  1I1S A;  1MKM A;  2PLY A;  1B8I B;  2KHM A;  3F8N A;  1IRF A;  4B09 A;  3RCO A;  2MH9 A;  3O8G A;  3U1D A;  1FT9 A;  3LA2 A;  3QQA A;  2O8K A;  1JI8 A;  4BBR J;  4KYW A;  1J09 A;  3DTI A;  1IN4 A;  4ZYG A;  3S16 J;  5CVV A;  3ONQ A;  1U8B A;  3CC7 I;  2IGK A;  2L7F P;  3MKW B;  4R8H A;  1PDN C;  1O7F A;  4IRI A;  1P7J A;  2DJN A;  4YEJ A;  3GZ5 A;  3TP0 A;  3GTJ J;  4BQQ A;  4KIS A;  3IRQ A;  2CRG A;  4XRS G;  2BY2 A;  4D9J A;  5DV5 A;  3CCS I;  5H6Q A;  2H8R A;  2WAE A;  3WHB A;  3HHG A;  5EYR A;  3PFY A;  2RNG A;  3GZN B;  3HTS B;  2ME0 A;  5DD4 A;  1BW5 A;  1BIA A;  3S1Q J;  1UHW A;  2H1K A;  2K9S A;  4IHY A;  4XON A;  1NG7 A;  4CUG A;  4Y3O A;  4YRV A;  4MIM A;  5E3O A;  1HST A;  2JJ7 A;  4U0Y A;  2MH2 A;  2JVG A;  4HF1 A;  2EFQ A;  1YOV B;  4HX4 A;  1LEA A;  3HPH A;  2BV6 A;  2W00 A;  3QPH A;  2CU7 A;  1P2F A;  3HKZ N;  4E7K A;  4OU0 A;  1ETW A;  2HU9 A;  2VT2 A;  3IWZ A;  3KPH A;  1ZGA A;  2RDP A;  3TOB A;  3CF2 A;  3JRD A;  1HKT A;  4C30 A;  2DA5 A;  3HKZ A;  4XKV A;  4L9V A;  5DCM B;  2RAE A;  2RVC A;  1S8N A;  4RGS A;  3OYA A;  5FLX K;  2DOD A;  1G8X A;  2Q1Z B;  2EIN H;  2IGM A;  2CSO A;  2XAG A;  1HQC A;  4RAF A;  4OMY A;  1G3T A;  4A3D J;  4XNF A;  4CZC A;  1WGX A;  3V8K A;  3LSR A;  4YFK F;  3F9K A;  5L3G A;  2QKM B;  5J1Y A;  3MCZ A;  2MVT A;  3SYT A;  1L3L A;  2TDX A;  5TJJ A;  4OAZ A;  1GHC A;  3LSM A;  2MAB A;  4OIR F;  2R7W A;  3WU0 A;  2CFO A;  2H6C A;  3COA C;  1FP2 A;  3KZI C;  1M1E B;  2H6B A;  1MW7 A;  3AFH A;  3R60 A;  2HGC A;  2DXI A;  1XN7 A;  2X85 A;  3WTZ A;  2W84 A;  3MZ8 A;  5LGT A;  2BOL A;  4F52 A;  2X1D A;  1RUO A;  4I76 A;  2UWM A;  4YFN F;  1O3Q A;  3SZT A;  3M4O J;  5F08 A;  4JQF A;  1QZZ A;  1AU7 A;  1HA8 A;  4XLE A;  3OY9 A;  1V4R A;  2CUF A;  4PJL A;  3BG3 A;  3FBI B;  4QPQ A;  1T0F C;  3Q9V A;  4DZP A;  4LK1 F;  3QU6 A;  1XPX A;  2E35 A;  2ECC A;  2JRT A;  2KJC A;  2ZCW A;  4I0A A;  5EGO B;  3I55 I;  3RZD J;  1HCR A;  3CCJ I;  2ME6 A;  2DA3 A;  2ZNZ A;  1RIO H;  5HDG A;  3I0T A;  1P4A A;  3NWS A;  3CD6 I;  1TQM A;  2K7L A;  4IO9 F;  3TBI A;  1B6A A;  3VPR A;  4V2G A;  4LB6 B;  3HSE A;  3IH3 A;  3OS1 A;  3HGG A;  2NRA C;  1QPM A;  2K9N A;  2WV1 A;  3OYF A;  3QYB A;  2PMZ A;  3FKJ A;  3HOU J;  1OYW A;  2KIQ A;  2HQA A;  5A2Q Z;  1MJA A;  5FRM A;  2FBK A;  5KCM A;  3DP7 A;  3V7C A;  1OCO H;  2Y48 A;  5DTD A;  2QQ8 A;  2DOF A;  3SZG A;  2CJJ A;  1NHA A;  1WJ5 A;  2H94 A;  2VBW A;  3FIW A;  4JX5 A;  3WOD F;  4F55 A;  1JUS A;  2G7U A;  4XR6 A;  1QQI A;  2JSC A;  5E1X A;  5AIP A;  3ZCO A;  2IPQ X;  2WB1 A;  2ADU A;  1X3W B;  1YLF A;  3GZ6 A;  2HI3 A;  1MJB A;  5HLI A;  4YG2 F;  4QTR A;  3GFM A;  5F04 A;  2DMT A;  3SDG A;  4G6T B;  2YU9 J;  4RB1 A;  3OOU A;  3FWE A;  2R7D A;  2LKX A;  1G59 A;  2VBX A;  4WXH A;  5HLT A;  2RQP A;  4KMU X;  3VSK A;  4UUS B;  3CO6 C;  4Y52 J;  3KP2 A;  2ZC2 A;  3H92 A;  2GOM A;  2GXG A;  3QPS A;  4A3G J;  3F0C A;  3LAP A;  2A6T A;  2OU2 A;  3HOT A;  2DFF A;  3BY6 A;  1YI2 I;  4IHS A;  2DQL A;  1EJ9 A;  2MZ4 A;  1XD7 A;  2M8G X;  3QU3 A;  2FNP A;  1POG A;  2AQF A;  1HSJ A;  3ZN1 A;  3I4M J;  1QPI A;  1BOA A;  3MKY B;  1LJ9 A;  5M3F J;  1YJN I;  1UST A;  5FLX Z;  2PI0 A;  1WKM A;  1N25 A;  1V3F A;  1KYW A;  3KLO A;  1J75 A;  2ISY A;  4MFD A;  3JTH A;  3OYH A;  1S29 A;  5F1R A;  1LEB A;  4LD5 A;  1YTY A;  2R92 J;  3RPQ A;  1MMS A;  2R5Z A;  1R23 A;  1WH7 A;  1R5G A;  4UVC A;  4HA8 A;  4RAG A;  4MTD A;  2PMH A;  1FOY A;  2FA5 A;  4D1Q A;  1K79 A;  3OOP A;  1VQ8 I;  4UV8 A;  2EV6 A;  4OIN F;  1K7A A;  3DEU A;  1Z05 A;  4L0Y B;  4ZJZ A;  1IG7 A;  4AU7 A;  1F1Z A;  1FSE A;  2VQH A;  4HBL A;  4BXF A;  4D5F A;  1JUM A;  3BC8 A;  2VIX A;  4XOR A;  2IA1 A;  3HXL A;  2OQG A;  1X1B A;  2VT3 A;  3A0B C;  2NNY A;  3ZGK A;  5D6E A;  2DT7 B;  3DV8 A;  2HDW A;  3DQV C;  2HXO A;  1D0X A;  4Z6Y A;  1KGS A;  5KHD A;  2QEX I;  2NVY J;  1FC3 A;  1MMD A;  3BJ6 A;  1YX5 A;  1JGG A;  2M7A A;  2EZL A;  1VQP I;  1DP7 P;  3DTK A;  4NUB A;  2DT5 A;  3CF5 F;  1YW9 A;  2Z33 A;  3MAJ A;  1LKX A;  4KNY A;  1WHU A;  1ZK8 A;  3FBN B;  4R1H A;  1VQ9 I;  2B7E A;  3GVA A;  3DKX A;  3KET A;  2DTZ A;  3K70 C;  3C1D A;  2O61 A;  2V6C A;  5IYC J;  3BG5 A;  1XC5 A;  3ISP A;  1B59 A;  1MIJ A;  1OLT A;  4BJT A;  4Y17 A;  1ZGW A;  5CPR B;  5F0C A;  3FM5 A;  4NC6 A;  2OQR A;  2R7U A;  3QOE A;  2VKD A;  3CMA I;  3OS0 A;  3IH2 A;  3LMM A;  2JRM A;  2B0L A;  2MFZ A;  3OL4 A;  2QLZ A;  1WWX A;  2XRO A;  3VEP A;  1ETK A;  4ESJ A;  3GTQ J;  2KQR A;  3A1Y A;  3B02 A;  3CP2 A;  4ZTF A;  2W25 A;  3BPX A;  4XK4 A;  1IJW C;  4NC8 A;  5E79 C;  4I98 B;  5E1Z B;  4HSR A;  2P0W A;  4KIC A;  2CYY A;  3KYD B;  2IS6 A;  3S17 J;  5J3L A;  4OWR B;  2P8T A;  4G94 A;  4ZYD A;  1PUF A;  2IRF G;  3A02 A;  2A07 F;  1R1T A;  2UXN A;  3L09 A;  4I09 A;  4MO7 A;  1MSF C;  2XGX A;  4YEL A;  2F48 A;  2HOA A;  1TWA J;  3PNT A;  2VJ5 A;  3FZV A;  4RM3 A;  1KON A;  3EDP A;  4RAY A;  4UB6 C;  3QOD A;  3IL2 A;  5FKN A;  1FYL A;  3V8J A;  4FIS A;  1ETV A;  1S7E A;  3A01 B;  2E5Z A;  4G6D A;  4GXO A;  1RNL A;  4MGR A;  3LL7 A;  5DM7 F;  3JRC A;  3KEO A;  2FBI A;  1ENH A;  2KRF A;  3OYJ A;  2ZJP F;  2CGP A;  2Z1D A;  4CGZ A;  2A68 F;  1YW8 A;  3SHF A;  3VOE A;  2IW5 A;  2IGN A;  2XGE A;  3L9F A;  4L9N A;  3CP8 A; 
#chains in the Genus database with same CATH homology
 5ICG A;  3I64 A;  3QP5 A;  1C0W A;  3J80 K;  3KZY A;  4A0Z A;  3EQL F;  2XAQ A;  3ZMU A;  3GEZ A;  5K5Q A;  5LGN A;  1ZG1 A;  3ZMZ A;  3I5U A;  4MHG A;  2AXL A;  3TDU C;  1DDN A;  1IRG A;  3ECO A;  1IF1 A;  3OV8 A;  4M9X A;  4Y15 A;  3HTU A;  2PFB A;  3MZY A;  4AVP A;  4CYD A;  3WTY C;  1J59 A;  2EA4 A;  2ZME B;  1XB4 A;  2P6S A;  1T0F A;  4M73 A;  3JSP A;  2GQQ A;  1W5S A;  3CLO A;  2XAJ A;  1UHM A;  4K2E A;  3DPT A;  4KMF A;  4U0V A;  3K2Z A;  1R22 A;  3K9T A;  3BZ6 A;  4G7Z F;  1BI2 A;  1H9T A;  1I6X A;  3RIR A;  2YX4 A;  2EJR A;  3CUQ B;  1KU3 A;  5HS7 A;  2EB7 A;  1QNT A;  3ABU A;  4Q5S F;  2HKX A;  3GXO A;  4M6Y A;  5ILV A;  3O6B B;  2W85 A;  3WTX C;  3WGI A;  3NQO A;  4YII A;  1IUY A;  2HZT A;  2DBB A;  3G73 A;  4XRF A;  1HBX G;  1HW5 A;  5FFX A;  3LST A;  1BI3 A;  2JT1 A;  1DUX C;  3FM3 A;  2UXX A;  3L7W A;  3C18 A;  2W57 A;  4KT5 C;  1R1V A;  3HSF A;  1G6N A;  1G3S A;  2PMU A;  4MNU A;  1F9N A;  2DO7 A;  1XGS A;  3U2R A;  2K86 A;  4LG0 B;  2Y0M A;  4LLL A;  3TO6 A;  2QM3 A;  3GF2 A;  4HZF A;  4ENN A;  4MEY F;  4R79 A;  2MD5 A;  1GXP A;  1T2K A;  1RUN A;  4M72 A;  3K1M A;  3MZH A;  2NAZ A;  1EV7 A;  5LHH A;  4ON0 A;  1LDK B;  4AD9 A;  3JAM Z;  5A2Q K;  1LVA A;  3C3W A;  3FMR A;  2L3D A;  4NHJ A;  3GUD A;  3QPT A;  1YG2 A;  2IA2 A;  1ZH5 A;  2DTR A;  2JPC A;  1G4D A;  1FYK A;  4CO8 A;  2Z99 A;  1O3S A;  5LRS A;  4HLX A;  4DNC A;  3SXY A;  1EH8 A;  3R4K A;  5KVR A;  3E6M A;  3ABT A;  1S3J A;  3PQJ A;  1IN7 A;  2FRH A;  5CVI A;  2HKO A;  4L9T A;  3BDD A;  4QWQ A;  4LLG F;  2XRN A;  4RB2 C;  2L01 A;  1ZHF A;  4WCG A;  2QQA A;  1KU2 A;  5H6R A;  1P4X A;  2BE5 F;  3E6D A;  1W4M A;  4RB0 A;  2ZJ2 A;  2LDU A;  4EGY A;  2HYG D;  2W24 A;  2CG4 A;  3DKW A;  2ZFW A;  1OMI A;  1CGP A;  3JSO A;  5DCM A;  4OIO F;  4M9Z A;  2KIU A;  3O3K A;  1LB2 A;  1W5T A;  3GYH X;  2WTE A;  1U78 A;  1O57 A;  1ZN2 A;  3I54 A;  2HWV A;  4G7O F;  5ICC A;  1OR7 A;  2VN2 A;  3HRS A;  3ZP5 A;  1MGT A;  3BPV A;  5CJ9 A;  4XLN F;  4A5M A;  4HX7 A;  4EJT A;  3TOA A;  2GA2 A;  2VOO A;  1USS A;  3FX3 A;  4A2U A;  4HX8 A;  3GWZ A;  4RAZ A;  2FXA A;  1Q1H A;  1XGM A;  2FF4 A;  3H3U A;  4IRH A;  1XDS A;  5HLH A;  4EM0 B;  5BPI A;  2PN6 A;  1GXQ A;  1B4A A;  5D4R A;  1T39 A;  3VOD A;  4HV6 A;  2M30 A;  4XBF A;  5CVU A;  3BJA A;  5EEH A;  5CVR A;  2M45 A;  1OYI A;  2VC0 A;  4EJO A;  2QQ9 A;  4ESF A;  5JI6 A;  1TQI A;  4MEX F;  4AIK A;  4P9U A;  3E6C C;  1ZLK A;  3WTW C;  2FSW A;  2FOK A;  2A5Y B;  5H20 A;  3T8R A;  2R7F A;  2Q0O A;  3TGN A;  2LKP A;  4L5J A;  1SD6 A;  5L3E A;  5JR3 A;  2FEZ A;  4UV9 A;  2UZK A;  4HOB A;  3I58 A;  2RC4 A;  1KQ8 A;  4LJZ F;  3F23 A;  1LQ1 A;  4G8X A;  4EGZ A;  3VB2 A;  2WC2 A;  1FBU A;  2RN7 A;  4ZZD A;  2KIM A;  2D45 A;  2ACJ A;  1UB9 A;  2VC1 A;  1X3U A;  2R3S A;  2E1C A;  5FFZ A;  4IRG A;  3L2C A;  5BMZ A;  1HXD A;  3ELK A;  4M71 A;  1XSX A;  3F6O A;  3M9A A;  4UHT A;  3KEQ A;  3LWF A;  2F2E A;  4QLC U;  5BPD A;  4EJW A;  1K78 A;  5J8F A;  4LGW A;  4PCQ A;  1IZ1 A;  4WX9 A;  2HTJ A;  1O7L A;  2D1H A;  3I4P A;  4ETS A;  2DAO A;  3RDI A;  4G7H F;  3HRU A;  2CW0 F;  4CZZ A;  2H09 A;  3LAJ A;  3CUQ A;  2F5F A;  1F4K A;  1ZRC A;  3FF5 A;  2GXB A;  4U88 A;  1E2X A;  2M8E A;  2LNB A;  3HUG A;  1XGN A;  4BHP A;  1U8R A;  3B73 A;  4U7D A;  2HR3 A;  3FXU A;  5DEQ A;  5D5W B;  4ENK A;  4BYY A;  4B8X A;  1EH7 A;  1DPR A;  4LFU A;  1ODD A;  3CJN A;  4AWX B;  3BJO A;  1XSV A;  2YX7 A;  2DU9 A;  3T1B A;  4YIF A;  3K69 A;  2ZME A;  3MWM A;  1SMY F;  4GGG A;  1U2W A;  2JZY A;  5E8I A;  1B1B A;  4UVB A;  4UUV A;  1FY7 A;  1ULY A;  2ZXJ A;  2L4M A;  1R7J A;  2P6T A;  4RGU A;  3KLN A;  2DPD A;  2IP2 A;  1TNS A;  2L4A A;  1HW2 A;  4I2O A;  2GA1 A;  5FO5 A;  1ON2 A;  2DPU A;  1D8J A;  2HFH A;  1WI9 A;  3WU1 B;  1YYV A;  1T38 A;  1W7P B;  4L5I A;  2MBF A;  2V9V A;  3SQN A;  3ZN0 A;  5F64 A;  1I27 A;  3WG9 A;  2HTS A;  4HF0 A;  1KA8 A;  3CDH A;  1HKQ A;  2YPR A;  3SZP A;  1DPU A;  3P7N A;  3F8F A;  1B9M A;  4ZH4 F;  5IT9 K;  1KYZ A;  5D5U B;  5ICF A;  1TTY A;  2FE3 A;  2V79 A;  4KA4 A;  2XKP A;  2ZO4 A;  4PDK A;  1BJA A;  2HYF A;  2COM A;  2XVC A;  4U7B A;  2PG4 A;  3DPL C;  4NQW A;  4I0B A;  1W7P A;  1SFX A;  5K1Y A;  3W6J B;  2VE9 A;  4MQ9 F;  3WGG A;  1RZ4 A;  3NEU A;  1XMK A;  4RGX A;  2P5K A;  3LA7 A;  4HQM A;  1P6R A;  1YQA A;  1PP8 F;  4EMS A;  4L0Z B;  2KKO A;  2WV0 A;  1QBJ A;  2HEO A;  3ZMS A;  4KDP A;  1MDM A;  1Z6T A;  3KP7 A;  2O03 A;  3M1E A;  2K02 A;  4LG0 A;  2O3F A;  1XMA A;  3T8T A;  4CHU A;  2NYX A;  2JPB A;  2HQR A;  4F7Z A;  1ZG5 A;  1EH6 A;  2M87 A;  4FX4 A;  2DK8 A;  5HOO A;  2V1U A;  1ZYR F;  2KIF A;  3J81 Z;  1MZB A;  2RGV A;  4A0Y A;  2E7X A;  3J7A O;  3GO5 A;  3D5L A;  4AIJ A;  1YW7 A;  1JHH A;  2VON A;  2VBZ A;  4OIQ F;  2HDC A;  2DI3 A;  4U0W A;  1U5T B;  4GO1 A;  3ERE D;  4FHT A;  4D0P A;  3EUH A;  3JTG A;  1TW3 A;  3U9G A;  3W6K B;  2GAU A;  2O6G E;  2LSO A;  2P7C B;  4PGH A;  2QQB A;  4LLN A;  3KP6 A;  1FOK A;  2EA2 A;  4EV0 A;  3HSR A;  3IWF A;  2KJB A;  3KZZ A;  2STW A;  1W7P D;  1YIO A;  2QBY A;  1IW7 F;  1YFH A;  2CQK A;  5L3D A;  1LDJ A;  4O5V A;  1KQ0 A;  5J8C A;  4PGG A;  3ZQ7 A;  3K0L A;  1FBS A;  3JW4 A;  3GX4 X;  3S2W A;  3BOQ A;  4XSX F;  1H9G A;  2A6H F;  2FMY A;  2F5D A;  3TDZ C;  3T0Y A;  1QGP A;  1Z6R A;  1FPQ A;  4TV7 A;  1R1U A;  3EYY A;  5IT9 Z;  2VOP A;  4YFX F;  1H0M A;  3E5X A;  3RJP A;  5D5V B;  1WRJ A;  1K78 B;  4A0X A;  4IXA A;  2XAS A;  5L3F A;  2EFO A;  1T6S A;  3V8L A;  1AWC A;  1S6L A;  3REO A;  5BOX A;  1BN5 A;  5KK1 A;  5DD8 A;  3HYI A;  4EQQ A;  1SD7 A;  1U5T C;  2A6E F;  2HS5 A;  3E5U A;  3J80 Z;  2Y75 A;  5ILS A;  2D2W A;  1TLH B;  4P5O A;  2XIG A;  4EM2 A;  3ROU A;  4KUM A;  1BM9 A;  1ZGJ A;  1HW1 A;  4LB5 A;  3E97 A;  2ETH A;  1TW2 A;  3LFK A;  5LEK A;  2QBY B;  1QZY A;  5D4S A;  4I02 A;  5LEJ A;  4Z2Y A;  2OAZ A;  2K27 A;  1FP1 D;  3R0J A;  3WE3 A;  3QRF F;  2EFW A;  3IRR A;  1F5T A;  1K6O A;  4Q48 A;  1P4W A;  1E17 A;  1O3T A;  2Q8K A;  3ZPL A;  2J5P A;  3KP4 A;  4L18 B;  2DFI A;  2BEO A;  2M5W A;  3TO7 A;  3AAF A;  5J6X A;  5CLS A;  4EM1 A;  2H27 A;  3ZMD A;  5LGU A;  2A3S A;  1TQP A;  2IA0 A;  4BH9 A;  2CWE A;  1R00 A;  5TRD A;  5D5X B;  4WWC A;  1S7A A;  2QUF A;  1YS6 A;  1SMT A;  3EET A;  1IAW A;  1XCB A;  4G9Y A;  4P9F A;  1B9N A;  4ZYE A;  1ZLJ A;  5DUI A;  4GYI A;  2M1B A;  3KE2 A;  4IVN A;  5JHU A;  1QO0 D;  3NRV A;  1OPC A;  3ECH A;  4GYG A;  4I7H A;  3CTA A;  4MQV A;  3G3Z A;  2CFX A;  1GVJ A;  3F3X A;  4HDU A;  4FX0 A;  3FMS A;  4ENJ A;  2DK5 A;  1HKS A;  3MEX A;  2MC3 A;  5K5O A;  3F6V A;  4NB5 A;  4HDV A;  3PFI A;  5DUK A;  3F8C A;  4WXD A;  2NS0 A;  4WXC A;  4KFC A;  4N9I A;  2G7H A;  2D1V A;  4BXU A;  1JXS A;  3K1N A;  3PQK A;  4CXF A;  3IC7 A;  4A6D A;  5AON A;  3WTV C;  2J5O A;  3HHH A;  3E5Q A;  1J5Y A;  5ICE A;  3P9K A;  2PJP A;  4A12 A;  2E1N A;  2ESN A;  2EV5 A;  2X0L A;  3CUQ C;  4I01 A;  4O3M A;  4Y13 A;  1Z9C A;  1FX7 A;  5E18 F;  2G9W A;  2Z5U A;  5E20 A;  3P9I A;  4LK0 F;  3FMQ A;  3BP8 A;  1P92 A;  3RPU A;  1RI7 A;  1Z7U A;  1YO5 C;  1FSH A;  5D8L B;  1XCV A;  2LF7 A;  5BQT A;  1A04 A;  1SD5 A;  1G3W A;  4H0E A;  5DDG A;  5JVT A;  2A69 F;  4IF4 A;  5CYV A;  1AOY A;  1ZAR A;  2CO5 A;  2QEN A;  3RKY A;  3R61 A;  4FT8 A;  5FGM A;  3C7J A;  5L3B A;  2BGC A;  4HQE A;  5K5R A;  3R0A A;  6PAX A;  2QWW A;  2YU3 A;  4BAY A;  1SFU A;  1ONV A;  3T5X A;  4L9J A;  1BIB A;  3HRM A;  1U6G A;  3KCC A;  5JFR A;  1I5Z A;  5EEG A;  2XAF A;  2OZ6 A;  5E17 F;  2YR2 A;  2ISZ A;  3ZMT A;  1IN5 A;  3EYI A;  2AS5 F;  2HOE A;  2EK5 A;  1BC7 C;  1IN6 A;  1OYY A;  2QZ8 A;  1TNT A;  5D8K B;  4O6J A;  2PBI A;  3F8M A;  3ML6 A;  3TQN A;  3WE2 A;  4CDG A;  2MLG A;  1XGO A;  2Z9O A;  3MFK A;  1ZRE A;  3DFG A;  1CF7 A;  2Z3Y A;  2XUB A;  3N4M A;  2QVO A;  5LLQ A;  3CO7 C;  2V1X A;  1OKR A;  3ZMV A;  4WK8 F;  3R6S A;  3I71 A;  3Q5F A;  3VFZ A;  4IPA A;  2EV0 A;  4PZJ A;  4RS8 A;  1U3E M;  1D8K A;  1PUE E;  3D0S A;  3LA3 A;  2MLK A;  4OIP F;  4UVA A;  1KQ9 A;  3L00 A;  3LQR A;  4HLY A;  1D5V A;  3I59 A;  2YSR A;  3F21 A;  3QAH A;  2K4B A;  2EFP A;  3GLX A;  3J81 K;  1JHF A;  2XAH A;  3Q9S A;  1Z91 A;  4Q4Z F;  4N0B A;  4WF2 A;  1BBY A;  4EVI A;  2VXZ A;  3IKT A;  4ENM A;  1MJ9 A;  3QP6 A;  5FD6 A;  1JE8 A;  1CF7 B;  2F5E A;  1REP C;  3HRT A;  2WWY A;  4HAM A;  1U5T A;  3ULQ B;  1S7O A;  1R58 A;  3GW2 A;  4IHT A;  2MA3 A;  2V1D A;  1Z1D A;  3QOP A;  1FWZ A;  3KP5 A;  2FNA A;  1UCR A;  3RKX A;  3N97 A;  1LNW A;  4HF2 A;  3WTS C;  3I59 B;  3V7R A;  2OBP A;  4JK1 X;  3F72 A;  3RI4 A;  1SFE A;  4HYE A;  4KIF A;  3WGH A;  4GCV A;  1ZG3 A;  1WQ2 A;  1ON1 A;  2GWR A;  4KIB A;  2DQR A;  3V7S A;  3M8F A;  1FLI A;  3IKV A;  3H3Z A;  3K1P A;  3RYP A;  2DW4 A;  2HQN A;  2RV8 A;  4ASN A;  2VOD A;  4HV5 A;  4P96 A;  3RKW A;  4BQA A;  3F8B A;  4HW0 A;  1ZRD A;  2P5L C;  4UXN A;  2XKO A;  3IHU A;  4DQ2 A;  4RB3 C;  4RGR A;  5ILU A;  2FML A;  3DF8 A;  3M7G A;  1FNN A;  4A6E A;  3FXQ A;  4KN7 X;  4KN4 X;  4CIC A;  2O0Y A;  5F6F A;  5E8G A;  4OOI A;  5DYM A;  4Q47 A;  4BHB A;  5IT3 A;  3HOS A;  1TBX A;  5AIQ A;  2P7V B;  1WSU A;  3JAM K;  3SFZ A;  4XLP F;  1STZ A;  5HS8 A;  5LHI A;  3DXJ F;  1R36 A;  2QYO A;  5HS9 A;  2IVM A;  1O3R A;  1I1G A;  3KP3 A;  1R5H A;  5HDN A;  4A5N A;  4S04 A;  1KU7 A;  2RNJ A;  3F22 A;  2L54 A;  3FXR A;  1KU9 A;  3V4G A;  3RTR A;  4BHC A;  2BBY A;  3WTU C;  4XSZ F;  3LQQ A;  1BC8 C;  2XV4 S;  4M6X A;  2OA4 A;  2NNN A;  2IT0 A;  5HDK A;  4EJV A;  3FHZ A;  4KIG A;  1D3Y A;  2IJL A;  1FZP B;  5ERI A;  2F5C A;  2BYV E;  1VTN C;  1IXS B;  4MTE A;  5LHG A;  2GIV A;  1T98 A;  4S05 A;  1J2X A;  4OMZ A;  3CUO A;  1ZRF A;  2E7W A;  4UNO A;  5FD5 A;  4ZYH A;  1J0R A;  2PQ8 A;  4AIH A;  2X4H A;  5LRR A;  1BI1 A;  2DLL A;  4N9H A;  5D6F A;  1IXC A;  4M74 A;  2ZBK A;  1G3Y A;  2FU4 A;  1BI0 A;  2LF8 A;  3MQ0 A;  1IN8 A;  2PEX A;  1SD4 A;  1UFM A;  1MD0 A;  1MDM B;  2P4W A;  3RYR A;  4ESB A;  5FB2 A;  2VBY A;  1L0O C;  2A61 A;  3M8E A;  2ESH A;  4G6Q A;  2EFN A;  2P5V A;  4BNC A;  1J7K A;  5ED4 A;  1Y0U A;  2ZNY A;  1J9I A;  2L02 A;  3BWG A;  1IXR C;  3KFW X;  2Q2E A;  3BRO A;  3WTT C;  5HLG A;  2RKH A;  1FYM A;  2C6Y A;  2FQ3 A;  5E1W A;  5HVQ C;  5L3C A;  3E6B A;  1LDD A;  4M9S A;  2OD5 A;  3HIF A;  2JTV A;  4IJA A;  1SAX A;  2ZKZ A;  2XHK A;  4LMY A;  1FBQ A;  4E70 A;  4ZZL A;  2FBH A;  3GFJ A;  4P55 A;  2STT A;  3E3V A;  2GZW A;  2VE8 A;  4JBA A;  3GFI A;  2O8X A;  1XSD A;  5DCF A;  1ZAO A;  2ELH A;  5BS6 A;  1XDU A;  5LBQ A;  1JGS A;  3TKY A;  3TO9 A;  3P9C A;  2K4J A;  1PP7 U;  2EWN A;  5CVJ A;  3GFL A;  3O2P E;  4EJU A;  1YS7 A;  3I53 A;  2OZU A;  1I1S A;  1MKM A;  2PLY A;  3F8N A;  1IRF A;  4B09 A;  2MH9 A;  3U1D A;  1FT9 A;  3LA2 A;  4KYW A;  1IN4 A;  4ZYG A;  5CVV A;  4R8H A;  1PDN C;  1O7F A;  4IRI A;  3GZ5 A;  3IRQ A;  5DV5 A;  5H6Q A;  3HHG A;  3HTS B;  5DD4 A;  1BIA A;  1UHW A;  1HST A;  4U0Y A;  2MH2 A;  4HF1 A;  2EFQ A;  4HX4 A;  1LEA A;  2BV6 A;  3QPH A;  1P2F A;  4OU0 A;  2VT2 A;  3IWZ A;  1ZGA A;  2RDP A;  3TOB A;  1HKT A;  4L9V A;  5DCM B;  2RVC A;  5FLX K;  1S8N A;  4RGS A;  2CSO A;  2XAG A;  1HQC A;  4OMY A;  1G3T A;  3V8K A;  4YFK F;  5L3G A;  3MCZ A;  1L3L A;  2TDX A;  5TJJ A;  1GHC A;  4OIR F;  3WU0 A;  2H6C A;  3COA C;  1FP2 A;  2H6B A;  3R60 A;  2HGC A;  1XN7 A;  3WTZ A;  2W84 A;  5LGT A;  1RUO A;  2UWM A;  4YFN F;  1O3Q A;  3SZT A;  4JQF A;  1QZZ A;  1V4R A;  3Q9V A;  4LK1 F;  3QU6 A;  2KJC A;  2JRT A;  4I0A A;  2ZCW A;  2ZNZ A;  1RIO H;  5HDG A;  3I0T A;  1P4A A;  1TQM A;  2K7L A;  1B6A A;  4LB6 B;  3HSE A;  2NRA C;  1QPM A;  1OYW A;  5A2Q Z;  1MJA A;  2FBK A;  3DP7 A;  3V7C A;  2Y48 A;  1NHA A;  2H94 A;  2VBW A;  3WOD F;  2G7U A;  1QQI A;  5E1X A;  2JSC A;  5AIP A;  2IPQ X;  2ADU A;  1YLF A;  3GZ6 A;  4YG2 F;  1MJB A;  5HLI A;  3GFM A;  4RB1 A;  3FWE A;  2R7D A;  2VBX A;  4WXH A;  2RQP A;  4KMU X;  3CO6 C;  3KP2 A;  3H92 A;  2GXG A;  3LAP A;  2OU2 A;  3HOT A;  4IHS A;  3BY6 A;  2DQL A;  1XD7 A;  3QU3 A;  2FNP A;  1HSJ A;  3ZN1 A;  1BOA A;  1LJ9 A;  1UST A;  5FLX Z;  2PI0 A;  1WKM A;  1V3F A;  1KYW A;  3KLO A;  1J75 A;  2ISY A;  3JTH A;  1S29 A;  5F1R A;  1LEB A;  4LD5 A;  1YTY A;  3RPQ A;  1R23 A;  1R5G A;  4UVC A;  4HA8 A;  4MTD A;  2PMH A;  2FA5 A;  1K79 A;  3OOP A;  4UV8 A;  2EV6 A;  4OIN F;  1K7A A;  3DEU A;  1Z05 A;  4L0Y B;  1F1Z A;  1FSE A;  4HBL A;  2IA1 A;  2OQG A;  2VT3 A;  2NNY A;  5D6E A;  3DV8 A;  3DQV C;  1KGS A;  1FC3 A;  3BJ6 A;  1DP7 P;  2DT5 A;  1YW9 A;  2Z33 A;  3MAJ A;  4KNY A;  4R1H A;  3GVA A;  3KET A;  3C1D A;  2O61 A;  2V6C A;  3ISP A;  1B59 A;  4Y17 A;  3FM5 A;  2OQR A;  2B0L A;  2QLZ A;  1WWX A;  2XRO A;  3VEP A;  4ESJ A;  3B02 A;  2W25 A;  3BPX A;  4I98 B;  5E1Z B;  4KIC A;  2CYY A;  2P8T A;  4G94 A;  4ZYD A;  2IRF G;  2A07 F;  1R1T A;  2UXN A;  3L09 A;  4I09 A;  2XGX A;  3FZV A;  3EDP A;  4RAY A;  3IL2 A;  1FYL A;  3V8J A;  4G6D A;  4GXO A;  1RNL A;  4MGR A;  3KEO A;  2FBI A;  2KRF A;  2CGP A;  4CGZ A;  2A68 F;  1YW8 A;  3SHF A;  3VOE A;  2IW5 A;  3L9F A;  4L9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...