1XCVA

Crystal structure of (h79ac102d)dtxr complexed with nickel(ii)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor mutant
publication title Mechanism of metal ion activation of the diphtheria toxin repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xcvA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1xcvA02
3DFGA 1IXRC 3V7CA 4EGZA 1HSJA 1J0RA 2JZYA 2K02A 4LG0B 2Q2EA 3SQNA 2D1VA 4S04A 2QLZA 2RGVA 3ZMSA 1K7AA 3WE3A 3JSOA 4OOIA 3WTZA 6PAXA 4KNYA 5H6RA 4A6DA 2OQRA 1STZA 5DCMA 2QQ9A 4A5NA 4H0EA 4UV8A 1XB4A 4MEXF 5E18F 1XN7A 4FX0A 3TOBA 5AONA 1R5GA 2HQNA 3I4PA 4IRHA 5JHUA 1Z6RA 1MJ9A 4EJWA 5L3GA 2ZO4A 5HVQC 2DBBA 1DUXC 3KLOA 3DV8A 4P5OA 4XRFA 1TTYA 4RB1A 1KQ8A 4A0XA 1S7AA 2FBHA 4MQ9F 1BC8C 4Z2YA 4IPAA 3P9CA 1UFMA 1YQAA 5L3EA 3NQOA 2E1NA 3BZ6A 2F2EA 5D4SA 3LAJA 1VTNC 3I59A 2P6TA 4RGRA 5JFRA 4DQ2A 3QP6A 3R6SA 1T2KA 2HDCA 5CVJA 4L5JA 1FSHA 1FLIA 1FBSA 4EM0B 4EV0A 4M6XA 2XUBA 2BEOA 3K1NA 4M74A 3EYIA 2QBYA 4L9VA 3KETA 1XMKA 2R7DA 4I98B 3ULQB 2WWYA 2EFPA 3GFMA 5CVRA 3JTHA 2Z33A 1V4RA 4ZYGA 3EYYA 5A2QK 1B59A 2G7HA 4LD5A 3WU0A 1EH7A 1A04A 3V4GA 3LQQA 5HS8A 2PI0A 2BBYA 2EA2A 1J2XA 1MJAA 3SHFA 4EM1A 1QNTA 3WTSC 2DI3A 3I71A 2HWVA 1FNNA 3RKWA 2P7VB 1WSUA 2VBWA 2CO5A 2K4JA 1P2FA 3EUHA 3HRSA 2STTA 1HW2A 2BV6A 4HYEA 2FQ3A 4KYWA 1L0OC 4RGSA 2NS0A 5CVVA 1I1SA 1Z1DA 2P8TA 3ZMUA 2VT3A 5CYVA 2VODA 2JSCA 1OMIA 2FNAA 4NB5A 5K5RA 1U5TB 1IF1A 3RDIA 2DTRA 5KK1A 4IHSA 5ICFA 3O2PE 2XKOA 3K9TA 4O6JA 2KJBA 3Q9SA 3ZMTA 4OIPF 1Z05A 3RKXA 1RZ4A 3GX4X 5K5OA 4XLPF 1XCVA 3L00A 1EH6A 2WV0A 3MQ0A 5BQTA 2GQQA 5BPDA 1D5VA 3FXRA 3LWFA 2MA3A 4ENKA 2XIGA 5HS7A 5LHHA 3J80K 1YW7A 3DP7A 4WCGA 2P5LC 2VT2A 3CO7C 1FPQA 1IN6A 4KICA 3F8CA 1FYMA 2O3FA 2IP2A 2MLKA 1W7PA 5LGNA 3K1MA 1LDDA 4KUMA 3MFKA 4XSXF 1IXSB 3GFIA 1MD0A 3GZ5A 1LJ9A 2OU2A 3DXJF 2A6EF 2FBIA 3KCCA 1E17A 5LBQA 3SXYA 2YSRA 3SFZA 2Q8KA 1I6XA 5CLSA 3TDZC 4AIJA 2EFOA 5FFXA 1KU7A 2HFHA 1ZHFA 5J8CA 5DYMA 3F72A 4TV7A 3HHHA 2XRNA 3F3XA 3PFIA 1EV7A 4LJZF 3RYPA 3ZMZA 1ZG3A 4MTDA 3TO7A 4I0AA 1LNWA 1ZN2A 2XAFA 4M6YA 3TDUC 3J7AO 1F5TA 5F1RA 1QO0D 2CYYA 4NQWA 3E5XA 3FZVA 4LB5A 3BWGA 4G6DA 3HIFA 3PQJA 1J9IA 1TBXA 2QQAA 5K1YA 4XSZF 3QP5A 2K4BA 2M30A 1J75A 1FSEA 3CO6C 3RYRA 5JVTA 4L9JA 5H6QA 2Y48A 1XGOA 5ERIA 3M7GA 5HS9A 2R3SA 1FZPB 3MWMA 2VC0A 2HTSA 5JI6A 3HRTA 1YW8A 3Q5FA 2FMLA 4ESBA 2RDPA 1P4AA 3T1BA 1MDMA 4OIQF 3ZN1A 3GUDA 4HF2A 2JRTA 2QVOA 4LB6B 4GCVA 2VOPA 2XAHA 3ZN0A 2KJCA 3CUOA 4CGZA 5LEKA 1W5SA 2FMYA 3OV8A 4UNOA 2DAOA 1L3LA 3MAJA 4BAYA 4FHTA 3ZMDA 2XASA 1UCRA 1QZZA 2VE9A 1IXCA 4EM2A 3B02A 5LGTA 2RNJA 3FF5A 1QGPA 1SD4A 3C1DA 3WGGA 3KEQA 5FGMA 3WGHA 3KP5A 4L9TA 3GZ6A 2A5YB 1IN5A 2OA4A 3O3KA 5IT9K 4UVBA 1Q1HA 3DF8A 5LHIA 3EETA 4GGGA 5ICEA 5E20A 3R0AA 2ETHA 2HR3A 2Z3YA 1U8RA 1DDNA 4BHCA 3FMQA 5E1WA 3BY6A 4R1HA 1I5ZA 2IJLA 2ZFWA 1GXQA 1LEAA 3P7NA 1BI1A 3WU1B 1E2XA 2O6GE 1KYZA 5D4RA 1FX7A 1K78A 1BJAA 1USSA 2F5CA 3TO6A 3R61A 2ISZA 4A12A 3Q9VA 2PMUA 4HQMA 3RPQA 3TOAA 2XGXA 3ZQ7A 2L01A 4GYIA 2ESNA 4G7OF 1MZBA 1IAWA 5D6EA 5FLXZ 4KDPA 3ABUA 2GAUA 3REOA 2O61A 3F21A 1SAXA 4EJOA 2O03A 4R8HA 3G73A 3WTXC 4R79A 5E8IA 3P9KA 2B0LA 1W5TA 2FSWA 1BN5A 4G8XA 4KT5C 2YU3A 2XAJA 3B73A 1PUEE 2P4WA 4EVIA 4LLGF 1H9TA 1YTYA 1D8KA 1MKMA 1O3QA 2EFQA 3I53A 2P5VA 2VBXA 5LHGA 2XAQA 1U5TC 2RN7A 1QQIA 3I54A 2ZMEB 3ZP5A 2LDUA 1IZ1A 1B1BA 3RJPA 3V7SA 4AIKA 1G3YA 1D3YA 3GXOA 2V6CA 4ZH4F 4A6EA 1TQPA 1FC3A 4MNUA 1ZG1A 2DK8A 1XD7A 1WWXA 4N9HA 2ELHA 3M1EA 2CSOA 4M9SA 1D8JA 1ULYA 3BROA 2GIVA 2XROA 1XSVA 4RS8A 2E1CA 2MH9A 1SD5A 2YX7A 2EV6A 5F6FA 5D5VB 1R00A 3QU6A 4MTEA 2P7CB 1YIOA 3GVAA 1FP1D 2D45A 4IJAA 4QWQA 1YYVA 3BJ6A 3TGNA 2PLYA 1ZGAA 1OKRA 2CFXA 4U7DA 4MQVA 4EMSA 1P6RA 3U9GA 2L4MA 2M1BA 3L9FA 4L9NA 3QAHA 1AOYA 1T0FA 4EJUA 1P4WA 4HX8A 1CF7B 4Q4ZF 2W25A 4L5IA 3RPUA 2VC1A 2W85A 1HBXG 4IHTA 1P4XA 1HW1A 2XHKA 3GFJA 4Q47A 2HOEA 1FT9A 1H0MA 3WG9A 1FYKA 1TW3A 3WTYC 4GYGA 2V1DA 1BI3A 3G3ZA 1GHCA 4EJVA 1XGNA 2R7FA 2DQRA 4JQFA 4ASNA 1Y0UA 1QBJA 3KLNA 2PN6A 4F7ZA 5D8KB 1YG2A 4QLCU 1JE8A 5TJJA 3BOQA 2K7LA 1R5HA 3GO5A 1J5YA 2ZNYA 2FOKA 2COMA 5E1XA 3C3WA 4BNCA 2K27A 3L7WA 3BP8A 3IRRA 2JT1A 2GA1A 4IVNA 4EJTA 1LEBA 1S7OA 3CUQA 4HV5A 4LMYA 3FMSA 4ESJA 4LLNA 4LGWA 2ISYA 3CUQC 3K69A 3WTTC 4KA4A 2HZTA 3F22A 1RIOH 1CGPA 4ENNA 4U0VA 2DU9A 2IA1A 1TQMA 4WXCA 4EQQA 1LQ1A 1ZAOA 3QPHA 4MGRA 4CYDA 2MD5A 1G6NA 2XVCA 5DCMB 3KFWX 3VB2A 5ILSA 2QM3A 3GLXA 1IRGA 4IRIA 2RC4A 1W7PD 3GEZA 3JTGA 1XSDA 1FY7A 1V3FA 4ENMA 2MH2A 2NNNA 4S05A 4HLXA 3QRFF 4WWCA 2JTVA 1REPC 2HQRA 3TQNA 1U3EM 1KQ0A 5ICGA 2CW0F 1LVAA 2HYFA 2QZ8A 1ZRCA 2UWMA 3NRVA 2HS5A 4AVPA 2EB7A 2NAZA 5DCFA 2K86A 3FXQA 3K1PA 2QQBA 2FBKA 2STWA 1WI9A 1KGSA 1SFEA 1Z7UA 3RTRA 3I59B 3FWEA 4L18B 2P6SA 1SFUA 4UUVA 2FE3A 1C0WA 1ODDA 3S2WA 4HX7A 3HOTA 3C7JA 2ESHA 3KP4A 5L3FA 3PQKA 2ZJ2A 4ZZDA 2A3SA 3WE2A 4CHUA 5IT3A 2QBYB 2VONA 3U2RA 2F5DA 1IN4A 1BI0A 2EV0A 4N9IA 4ENJA 1NHAA 1OYWA 2FA5A 4OMZA 3WTVC 3E5UA 3C18A 1SFXA 1X3UA 1ZYRF 2OBPA 4U7BA 5TRDA 2IA0A 3JAMK 3IHUA 4U0WA 1YS7A 4IRGA 4HQEA 1BIAA 2DLLA 2XV4S 1KYWA 4I02A 2IT0A 4OMYA 3NEUA 5K5QA 3ZPLA 3HSEA 5HDNA 1UB9A 2EWNA 3JAMZ 2BGCA 1G3TA 1Z6TA 1F4KA 1O3RA 3V8KA 3U1DA 3GYHX 4LG0A 3LA3A 1OR7A 5AIQA 2GXBA 4AD9A 4WF2A 1OPCA 1IUYA 3ECHA 2QENA 5DD4A 3H92A 1B9NA 2BYVE 3WODF 4UV9A 3EDPA 2DT5A 2L54A 3KZZA 2O8XA 1JHHA 1T39A 2OZUA 2X0LA 1O7FA 2NNYA 1JGSA 3K0LA 2IPQX 2HKOA 2BE5F 3CJNA 2H27A 2MBFA 2AXLA 4M9ZA 1TW2A 2ZCWA 4RGUA 2EFWA 1HQCA 3E6BA 2HTJA 2EJRA 1KU2A 2NRAC 5HDKA 1PDNC 3MZYA 3BPXA 4GXOA 4U88A 2ZBKA 3EQLF 3K2ZA 4KN4X 2YR2A 2VE8A 5CJ9A 5J6XA 5ILVA 2OZ6A 1W7PB 1TQIA 2FF4A 5FB2A 5HDGA 2O0YA 3FM3A 3LAPA 1T6SA 3HUGA 3VODA 1B4AA 2KKOA 4HLYA 2M87A 4WXDA 3RKYA 1HW5A 2E7XA 2XAGA 4HV6A 1Z9CA 1R1VA 4HF0A 2WTEA 3LFKA 4I0BA 1FYLA 1YFHA 3LQRA 4KIGA 4CXFA 4G7HF 4P55A 4I2OA 5CVIA 4LK0F 3SZTA 2KIFA 1W4MA 2D2WA 3V8LA 5FLXK 4P9UA 3F23A 2F5EA 3CLOA 4AIHA 4KIFA 1KQ9A 3H3UA 2A07F 1RNLA 3ERED 5E1ZB 3H3ZA 2M5WA 2CGPA 3E5QA 2LNBA 3W6KB 3LSTA 3L09A 3LA7A 1IN7A 1F9NA 3TO9A 5E17F 5LRRA 3GWZA 3WTWC 2CWEA 1SD7A 3QU3A 3KP7A 4YFNF 3J81Z 1XGSA 3F6VA 4ETSA 1XMAA 4ZYDA 2Y75A 4KFCA 3P9IA 4WX9A 4HOBA 1DPUA 2H94A 3T0YA 5ICCA 1S29A 3BJAA 4DNCA 5HLHA 2DPUA 1JXSA 2EK5A 1MJBA 1R1TA 4BHBA 5AIPA 4BQAA 1U5TA 1XCBA 2IRFG 4KN7X 2MC3A 4UXNA 2H6CA 2W57A 1QZYA 3GW2A 5ILUA 2IA2A 1WKMA 5JR3A 1KU3A 5D5WB 2GZWA 1IN8A 1S8NA 1R1UA 1BM9A 2HKXA 2M8EA 5D6FA 4I7HA 1MDMB 2QWWA 4D0PA 3FXUA 5BOXA 1USTA 5KVRA 2E7WA 3CTAA 1UHMA 3F8FA 3T5XA 3JSPA 1XDSA 3IL2A 4Y13A 4G6QA 2FNPA 2KIMA 4AWXB 1J7KA 3VOEA 4BYYA 4IF4A 4ZYEA 1HSTA 1S6LA 2UZKA 1BI2A 1AWCA 1O3TA 4EGYA 2G9WA 1OYIA 3SZPA 2J5PA 3TKYA 3QOPA 1T98A 2A6HF 2A68F 3VEPA 5D5XB 1UHWA 3R0JA 5D8LB 2QYOA 1KA8A 5EEGA 5J8FA 2RKHA 1U6GA 1H9GA 3HRMA 4HF1A 4OINF 2P5KA 5DD8A 1XDUA 1U2WA 2Z99A 2GWRA 2DK5A 3FM5A 2M45A 1ZARA 1GXPA 5CVUA 4NHJA 3M8EA 4HBLA 4YFXF 4BHPA 2W24A 2EA4A 4JK1X 2HGCA 4KMFA 1PP8F 4YIIA 3I0TA 3KP3A 3HTSB 1ZREA 1YW9A 3E3VA 4Y15A 1K79A 2HYGD 1IW7F 1BC7C 4OIRF 2DO7A 3O6BB 1K78B 1G3SA 1ZG5A 4HZFA 3M9AA 3R60A 2IVMA 4M9XA 4I09A 1O57A 4OIOF 2V1UA 5EEHA 4M73A 4UVAA 4A2UA 5LRSA 2CG4A 1R22A 2ACJA 4RB3C 3JW4A 2KIUA 2PFBA 3IC7A 4M72A 1QPMA 5A2QZ 5L3BA 5L3DA 3IWFA 2LF7A 4U0YA 3HRUA 1SD6A 3HYIA 1O7LA 4G9YA 2LSOA 5BS6A 2X4HA 1JHFA 5DUIA 2V1XA 2Y0MA 2LF8A 2PBIA 3DPTA 4RB2C 3HSFA 1G4DA 1ZLKA 1ONVA 4CICA 3I5UA 3M8FA 4UHTA 1SMTA 2EFNA 3ISPA 2OQGA 2ADUA 1RUOA 5H20A 4BXUA 4WXHA 3W6JB 3V8JA 5FO5A 2G7UA 1ZH5A 4FT8A 2VOOA 2RQPA 4PGHA 1ZGJA 3HTUA 4P96A 4PCQA 1ZRDA 3HOSA 5FD6A 5F64A 2DQLA 4IXAA 3KEOA 3F8BA 2J5OA 3DKWA 4O5VA 1R58A 4Q48A 4K2EA 2VN2A 3I64A 1RUNA 1ZRFA 2IW5A 1K6OA 3BJOA 3FHZA 1XSXA 3F8MA 3IRQA 2KRFA 3ELKA 1ON2A 4A0YA 4Q5SF 4KIBA 2RVCA 1HKQA 2UXNA 3DEUA 4LK1F 5LLQA 1EH8A 3J80Z 5LEJA 3ECOA 3R4KA 4YFKF 2W84A 3IKVA 2ZNZA 5L3CA 3ZMVA 2RV8A 3ROUA 4HDUA 3D0SA 1I27A 4HDVA 3MCZA 3E6DA 4YG2F 4XLNF 2A69F 1B6AA 2L3DA 4LFUA 1ON1A 2ZKZA 3MEXA 2VBZA 3IKTA 1U78A 2WC2A 2A61A 3D5LA 3WTUC 1Z91A 1TLHB 5DV5A 4B09A 3IWZA 2DFIA 1J59A 4RAYA 1T38A 1LDJA 1OYYA 1S3JA 2H6BA 2GA2A 2XKPA 2AS5F 1F1ZA 4PGGA 5HLGA 2PMHA 2CQKA 3FMRA 3N97A 2PQ8A 2H09A 4HX4A 4M71A 4G94A 2UXXA 1LB2A 3MZHA 4A0ZA 3BPVA 3E97A 3L2CA 1DP7P 4GO1A 4N0BA 2LKPA 3ML6A 4Y17A 1FP2A 3FX3A 1P92A 4L0YB 1R7JA 2VXZA 1YLFA 3I58A 3HHGA 3DQVC 1FBQA 3GF2A 1DPRA 1YS6A 1PP7U 3KP6A 5BMZA 2DW4A 4PZJA 1G3WA 3KE2A 4O3MA 4HAMA 2V9VA 2QUFA 5ED4A 3CUQB 2ZMEA 2Q0OA 3LA2A 2JPBA 3OOPA 3HSRA 4FX4A 2NYXA 5DUKA 4ZZLA 5DDGA 2PEXA 1XGMA 2ZXJA 3E6CC 4ON0A 2D1HA 2FRHA 1WRJA 3DPLC 4RGXA 3E6MA 2MLGA 4KMUX 2PJPA 5HLIA 2PG4A 3QPTA 4HA8A 3KP2A 2HEOA 3ABTA 5E8GA 5FFZA 4OU0A 4MHGA 4PDKA 4CZZA 4XBFA 4P9FA 5BPIA 4CDGA 4ZYHA 4UVCA 2C6YA 2GXGA 4G7ZF 3RI4A 1HKTA 2JPCA 3T8RA 4RAZA 3GFLA 4RB0A 4HW0A 1KU9A 2FU4A 5DEQA 2VBYA 3N4MA 1I1GA 2F5FA 1GVJA 2L4AA 4YIFA 3F6OA 1CF7A 1FBUA 2FXAA 4CO8A 4L0ZB 2TDXA 1BIBA 2L02A 4E70A 5D5UB 2Z9OA 4LLLA 5FD5A 4ESFA 5IT9Z 4B8XA 4I01A 4BH9A 2YX4A 1LDKB 3F8NA 3J81K 3VFZA 1IRFA 1BOAA 2YPRA 1B9MA 2Z5UA 4A5MA 3V7RA 1R36A 5LGUA 1HKSA 1TNTA 2OAZA 1O3SA 2OD5A 5HOOA 2EV5A 1TNSA 4JBAA 3WGIA 1FWZA 1WQ2A 3COAC 4WK8F 3CDHA 3T8TA 1HXDA 4MEYF 3BDDA 1SMYF 2FEZA 3AAFA 1ZLJA 2DPDA 3RIRA 2V79A 1R23A 1FOKA 1YO5C 3KZYA 1RI7A 1MGTA 1BBYA
chains in the Genus database with same CATH superfamily
3DFGA 1IXRC 2A6TA 2K5CA 2L5QA 3TBIA 3V7CA 4QIWN 4EGZA 1I3AA 1HSJA 1IC8A 1J0RA 1MMNA 4Y4RA 1T8IA 2JZYA 2K02A 4LG0B 2LBFA 2Q2EA 3SQNA 3BG6A 2EZHA 5H2FC 2D1VA 2DFEA 2OUMA 4S04A 2QLZA 2RGVA 4A3MJ 1MMSA 3FISA 3ZMSA 1K7AA 3G6EI 2M35A 3WE3A 4X0GA 2E1MB 2H8WA 3JSOA 4OOIA 2DDAA 3WTZA 1VF9A 6PAXA 2E71A 4KNYA 4XONA 1R9TJ 4ZTFA 5H6RA 4A93J 1UHSA 3BTIA 4A6DA 3VSKA 2OQRA 5GAHJ 1STZA 2R7RA 5LD2C 4E7HA 5DCMA 2QQ9A 4CCJA 2DOEA 2I10A 1TWGJ 4A5NA 2BXZA 2EILH 3CCRI 4H0EA 4UV8A 1XB4A 2M3AA 1RETA 3DPUA 1WI3A 4CCOA 2P81A 5GTIC 4MEXF 3VYUB 3BTJA 5E18F 1XN7A 3CESA 2DA5A 4FX0A 3TOBA 5AONA 1OLTA 3L2WA 4DYQA 2Z1DA 4F55A 2AXTC 1R5GA 2HQNA 3IP4B 3I4PA 4IRHA 2N8GA 5JHUA 1Z6RA 1MBGA 1MJ9A 4NC8A 1W0UA 2FUG2 4EJWA 3CF5F 5L3GA 2ZO4A 5HVQC 2DBBA 4C2UA 1UMQA 1DUXC 3KLOA 3DV8A 4P5OA 4XRFA 2L9NA 1TTYA 1QA6A 4RB1A 1VQPI 1KQ8A 2BW3A 4A0XA 4F92B 1POGA 3HOZJ 1S7AA 3JRBA 2FBHA 4MQ9F 4C9YA 1BC8C 4L5EA 4Z2YA 4Z6YA 3HOYJ 4IPAA 3P9CA 2L7ZA 3J7AW 1UFMA 1HCRA 4BXFA 1YQAA 5L3EA 3NQOA 2E1NA 3S8PA 3OYHA 3BZ6A 3H1CA 2F2EA 3H5NA 4E7KA 5D4SA 2R7XA 3LAJA 1X4PA 1VTNC 3I59A 5F0CA 2P6TA 2CS3A 4RGRA 4ZDLA 2V9PA 3HUGB 5JFRA 3R6SA 3QP6A 3N05A 4DQ2A 4HNUA 3OYIA 5CVJA 4L5JA 1X3ZB 1T2KA 3FXJA 1AHDP 2HDCA 1FLIA 1FSHA 1SFOJ 1FBSA 4EM0B 2DOFA 4EV0A 1VFCA 4M6XA 2XUBA 1XG1A 4A3GJ 3SFIA 1TWFJ 1HLVA 2WADA 2M8GX 2BEOA 3K1NA 4M74A 2E5NA 2KFDA 3EYIA 3JRFA 3GTOJ 3OR2C 5A2QR 4HSRA 2QBYA 3LOCA 1EKEA 3A03A 4L9VA 3WU2C 2DFFA 3KETA 1XMKA 1MBHA 2QGUA 2F4OB 2R7DA 4I98B 3ULQB 2WWYA 2EFPA 4IHVA 2XSDC 3UR3C 3GFMA 1JKQC 5CVRA 3JTHA 2Z33A 1T0FC 1V4RA 4ZYGA 1BW5A 3EYYA 5A2QK 1B59A 2G7HA 2KDOA 3C2GA 1MBFA 4LD5A 3WU0A 4IOCF 1EH7A 1A04A 3V4GA 3J7ZI 3LQQA 5IPAA 5HS8A 1WJEA 2PI0A 2BBYA 1SC7A 2EA2A 1J2XA 1MJAA 3W3CA 3BLYA 5FROA 1LUJB 1HA8A 3UNGC 3SHFA 4EM1A 4HEA2 1QNTA 3WTSC 2DI3A 3I71A 2BZTA 2IS4A 3LSMA 5FRNA 5CKTA 2HWVA 1FNNA 3RKWA 2ZJRF 1UELB 2P7VB 5IOYA 4ABZA 1WSUA 1UZCA 2VBWA 2CO5A 2K4JA 4JP0A 1P2FA 3EUHA 4HNTA 3S2HJ 3HRSA 2STTA 1PUFA 1HW2A 2LVSA 2BV6A 5F27A 1OISA 4HYEA 4GFBA 2FQ3A 3D1NI 3NARA 4XN3A 2ZXWH 4KYWA 1L0OC 4RGSA 4F93B 2NS0A 2WBMA 5CVVA 1I1SA 2X98A 3OWTA 1Z1DA 4PSWA 5DM7F 3EUHC 4IO9F 2LD5A 2P8TA 3ZMUA 2VT3A 1LFPA 5CYVA 1X1PA 1T08B 2DMTA 3K4NA 2VODA 2JSCA 5KCMA 1OMIA 2FNAA 3CC7I 2L9SA 3BR0A 4NB5A 3J7YJ 5K5RA 1SEUA 1U5TB 1IF1A 2CUFA 2CRGA 5FKLA 3DEEA 3RDIA 5IYCJ 5JVGF 2DTRA 5KK1A 1XX5A 3P5JA 1DU0A 3G1LA 3O2PE 5ICFA 1T95A 4IHSA 2NVXJ 3W6VA 1V5GA 2XKOA 3K9TA 4O6JA 1YRNB 2KJBA 3Q9SA 3ZMTA 4OIPF 3HOUJ 1Z05A 3RKXA 2MZ4A 2RQQA 1RZ4A 3GX4X 2PMZN 5K5OA 2F4IA 2BOLA 4XLPF 1XCVA 2F5VA 3L00A 1EH6A 1WJCA 1E0EA 3GLLA 1ZR4A 5IP7J 3BT9A 3J80R 2WV0A 3MQ0A 5K7FA 3CDLA 4BACA 2X9DA 5BQTA 2GQQA 5BPDA 1D5VA 3FXRA 3S3OA 3LWFA 3IAM2 2MA3A 3BCBA 1VQOI 4ENKA 2ZSIB 4W97A 3J7AY 3FIWA 2XIGA 5CQEA 4DJAA 2XPUA 4Y52J 3JCUC 2KZGA 2ELKA 1VQ5I 4A3DJ 3I3LA 5HS7A 5LHHA 2A5WA 2L9RA 1YW7A 2XB0X 3J80K 3DP7A 5GAEJ 5TISC 4WCGA 2P5LC 1YITI 1NH3A 2VT2A 3CO7C 1A6QA 3W2VA 1FPQA 1IN6A 3FKIJ 4KICA 2IS1A 3F8CA 3M07A 1DQUA 1WPKA 1FYMA 1KONA 2LY2A 4LIVA 2JJ7A 2IP2A 2O3FA 2VQLA 4BL0B 4UY8I 2ME0A 3K4CA 2MLKA 2KZVA 1W7PA 4QPOA 2CV1A 4RM2A 2LFBA 5LGNA 3K1MA 1LDDA 2K9LA 4KUMA 3MFKA 4ANJA 4XSXF 1IXSB 1XMXA 1WJFA 3GFIA 4PJJA 2BHZA 1MD0A 4XLCA 4N4OB 3S1MJ 3CZ6A 3LL7A 5IOZA 3GZ5A 1LJ9A 3EUAA 1ZK8A 4B43A 2V6EA 1OCOH 2OU2A 3DXJF 2A6EF 2FBIA 3KCCA 5GADJ 1VQ9I 1E17A 5LBQA 3ESWB 3SXYA 5B5EC 3S3NA 2YSRA 3ONQA 3ZQGA 3SFZA 3OMYA 2Q8KA 4CH7A 1NTCA 1I6XA 2WB1A 5CLSA 5J4VA 1JUSA 3S17J 4DZPA 5HLTA 2CV2A 2F4MB 2W48A 3ZQQA 3TDZC 4B1RA 2EFOA 5FFXA 4AIJA 1KU7A 2HFHA 1ZHFA 5J8CA 1D0YA 5KAFC 5DYMA 4D5FA 3F72A 4TV7A 2YUSA 2XRNA 3HHHA 3F3XA 3PFIA 4UUSA 3H3VK 2DT6A 1EV7A 4LJZF 3RYPA 4C2TA 1BL0A 5M3FJ 3ZMZA 3C2BA 3L1PA 2MC4A 1ZG3A 4MTDA 5C4XJ 3TO7A 4AVZA 4I0AA 5EGOA 1LNWA 4QTRA 4DYRA 1ZN2A 2XAFA 4M6YA 3PO2J 3TDUC 3J7AO 1CQTA 1QVUA 1F5TA 3DBRB 1M1EB 5M5XJ 5F1RA 2ZB9A 1QO0D 2CYYA 4NQWA 3HXLA 3H9GA 3E5XA 4BEHB 1B8IA 3FZVA 4LB5A 2X1CA 3BWGA 2WY8Q 4G6DA 1BOBA 3HIFA 3PQJA 1J9IA 1TBXA 2VJ5A 1S72I 2BVMA 4OAYA 3WHBA 2QQAA 3KPHA 3HZJA 5K1YA 3OS1A 4XSZF 3QP5A 3PO3J 1JUPA 1OCPA 2K4BA 2M30A 2RNGA 2EBIA 1J75A 1FSEA 3CO6C 2W82A 3RYRA 4CCLA 2M4KA 2M7BA 4L9JA 5JVTA 5H6QA 4F52A 2Y48A 1XGOA 5ERIA 3M7GA 1IV8A 5HS9A 3Q0VA 2JVHA 2UUZA 2R3SA 3OL3A 1LE8A 1FZPB 4CYCB 3MWMA 2DJNA 2VC0A 2HTSA 5JI6A 3OYDA 4N4NB 3X2QH 2JUCA 3HRTA 1YW8A 2OCCH 5M5YJ 2X6XA 3Q5FA 2FMLA 3BZCA 4ESBA 2M2EA 4DZJA 2RDPA 1X3WB 3BR3A 1P4AA 3T1BA 1MDMA 4AIDA 4OIQF 3H36A 3ZN1A 3RKQA 2K3PA 5E3NA 2DXIA 3GUDA 1YHQI 4HF2A 1Y1VJ 4YIRX 2JRTA 3JR9A 3ERMA 2QVOA 1LVKA 4LB6B 4M3DA 4GCVA 2KHMA 2VOPA 2VQHA 2Z16A 2XAHA 3S2DJ 3LSPA 5EJCA 3ZN0A 3DTKA 2KJCA 3CUOA 3C2HA 4CGZA 5LEKA 1W5SA 5BNGA 4BQQA 2FMYA 3OV8A 4UNOA 1ETVA 2DAOA 1L3LA 3TL4X 4E7SA 3MAJA 4BAYA 4FHTA 3ZMDA 1H8AC 2CUZA 1ZGWA 2XASA 1UCRA 2OC6A 2WAEA 1QZZA 5DTDA 5C4JJ 3JRAA 2VE9A 1V5FA 1IXCA 1PYVA 3B02A 4EM2A 5LGTA 2RNJA 3AG4H 3FF5A 4UB6C 5B3SH 3A01A 1QGPA 1TT0A 3LSHA 5TGTA 1I3QJ 1LFUP 3GZNB 1RRJA 1SD4A 2NXNB 3C1DA 3WGGA 1K61A 4B44A 3KEQA 5FGMA 3WGHA 3KP5A 1D1BA 2DODA 5E79C 4L9TA 4XLHA 4EATA 2KISA 5IT9R 3GZ6A 2A5YB 3TW6A 2B7EA 5K7HA 1IN5A 2CH0A 5GAGJ 1YX5A 1X58A 2V26A 1TC3C 2B63J 1NG7A 2DJIA 3HJEA 1UG0A 2OA4A 3K7AJ 4XQFA 4BJ6C 2AQEA 3O3KA 5IT9K 4UVBA 1W36D 2H8RA 1Q1HA 3DF8A 2HI3A 5LHIA 1G59A 3EETA 2YU9J 5HNFA 4GGGA 2VXDA 2PX9A 5ICEA 4BS9A 2WAQN 5E20A 3R0AA 2ETHA 2HR3A 2Z3YA 1U8RA 1DDNA 4BHCA 2XC7A 3FBIB 1I6HJ 3FMQA 4BDYA 5E1WA 3CCQI 1TP4A 3J81R 3BY6A 3HG9A 1LFBA 4R1HA 1B72B 4MIMA 1I5ZA 2IJLA 3OR1C 3VYRB 3D5RC 1FOYA 2ZFWA 4BBRJ 1GXQA 1TWCJ 1LEAA 2XRLA 3B6CA 3P7NA 1BI1A 3WU1B 2QQ8A 3E7LA 2CQ7A 3UKGA 1E2XA 2R4GA 2KIQA 1KYZA 3ZGKA 3OY9A 2O6GE 2R92J 5D4RA 1WH5A 4BUPA 1FX7A 1K78A 1BJAA 3F9KA 4PJLA 1USSA 4CZCA 3DLLF 2F5CA 2WA0A 3IH2A 4M3BA 3TO6A 1VQ6I 3R61A 2LG4A 2E2JJ 2ISZA 4A12A 1MMDA 1A5JA 3Q9VA 2PMUA 4HQMA 3RPQA 3TOAA 5FLVA 2K9QA 1F43A 2XGXA 3ZQ7A 3K2AA 2L01A 4D1QA 1X1CA 2X85A 2R7WA 4GYIA 3CC4I 2ESNA 3HBLA 4H4KC 2O9LA 2VL8A 4A3IJ 4G7OF 2TRTA 1MZBA 1IAWA 2OJED 5D6EA 4Y3OA 5FLXZ 2PMZA 4BDZA 1A31A 3D5SC 1OJLA 2Y9YA 4KDPA 4XNFA 1OCCH 1RKTA 1I50J 1SVMA 3ABUA 1QHGA 2GAUA 3OYEA 3REOA 2ZFUA 1WGXA 2O61A 3H5RA 4AM3A 3F21A 1SAXA 4EJOA 3LSRA 2AO9A 1K4SA 2JA5J 2O03A 4R8HA 3G73A 2R7ZJ 5JLWA 3WTXC 2OTJI 2QKLB 5GPAA 1ZTRA 3CJRB 3AL0C 4R79A 2JN6A 5E8IA 3WG7H 3P9KA 3S3MA 2R7VA 1FEXA 2B0LA 3QOEA 1W5TA 2QCOA 3KYLA 2FSWA 1BN5A 4D7NA 4G8XA 4KT5C 3TP3A 2YU3A 2XAJA 3B73A 1PUEE 1MMGA 3E1SA 2P4WA 2JWTA 2VKEA 1MBKA 4EVIA 4II2A 2DA1A 4LLGF 1H9TA 1MBJA 2XF7A 1YTYA 2DCEA 3G1MA 3PNTA 1D8KA 4F91B 1MKMA 1O3QA 1SVOA 2EFQA 3I53A 2ZSHB 2P5VA 1U9NA 2VBXA 3QPLA 5LHGA 3CCEI 3KEYA 2XAQA 1U5TC 5EZGA 2AQFA 2RN7A 2X6YA 1QQIA 3NAUA 3I54A 2ZMEB 3H35A 4NC6A 5HODA 2XPWA 3ZP5A 1DGRM 1N77A 2LDUA 2E35A 3EPZA 4E6KG 1IZ1A 2ZJQF 3ZQFA 1B1BA 5J1UA 3BG3A 3RJPA 4ZJZA 3V7SA 4AIKA 1W5CC 1G3YA 3S32A 4DW6A 1GT0C 2BHYA 1D3YA 3PJRA 3GXOA 1V54H 4YELA 2V6CA 2XDVA 1Z3YA 4ZH4F 4A6EA 3CMEI 1TQPA 1FC3A 1IGNA 4MNUA 1ZG1A 2KPMA 2ME6A 2DK8A 4RAFA 1XD7A 1PJRA 1WWXA 4PUSA 4N9HA 2ELHA 2KMUA 3M1EA 1HC8A 1JKRC 3CP2A 1JTYA 4V19K 5GP9A 2CSOA 4M9SA 1D8JA 1ULYA 3QPSA 2CJJA 2XGDA 3K4JA 3BROA 2GIVA 2XROA 5B1AH 1E3PA 1XSVA 4RS8A 5J40A 2E1CA 2MH9A 4BY1J 1SD5A 3VYSB 5J4YA 2YX7A 2EV6A 5F6FA 5KHDA 5D5VB 1R00A 2O7OA 3QU6A 4MTEA 3NWSA 2P7CB 3I4NJ 1YIOA 3GVAA 2COBA 3L2UA 1FP1D 2D45A 2JVGA 5FKNA 4IJAA 4QWQA 1YYVA 3BJ6A 4BQOA 4AUXA 3TGNA 2PLYA 5KNLA 2NVUB 2Y69H 2DT7B 1ZGAA 3OOUA 1DGWY 1OKRA 2CFXA 4U7DA 1J09A 4MQVA 2BY3A 5GPCA 1P6RA 3LSIA 2E36A 4EMSA 3U9GA 4FASD 2CMPA 3MN2A 1BR2A 2L4MA 2M1BA 2LRDA 3L9FA 3HOXJ 4L9NA 3QAHA 1SVLA 2NS7A 3OYMA 3FK7A 3H0DA 2JA7J 3HKZA 1T0FA 4EJUA 1AOYA 1P4WA 3L2QA 4ZC3A 4AC0A 3GMEA 4JYKA 1G8XA 4HX8A 1CF7B 4Q4ZF 2W25A 4XM3A 1DU6A 4L5IA 3RPUA 2VC1A 2W85A 5FRMA 1HBXG 2LTPA 4IHTA 1P4XA 1HW1A 2XHKA 3GFJA 2E1OA 1FJLA 2PJRA 2NVQJ 4Q47A 1Y56A 2HOEA 2QF7A 1FT9A 1H0MA 3WG9A 1FYKA 4I76A 4J01A 1TW3A 4PSXA 3WTYC 1HOMA 2LC2A 1EA3A 2X6WA 1IV6A 3S1QJ 4GYGA 1EF4A 2V1DA 1BI3A 3G3ZA 1GHCA 2XF6A 3OIPA 4EJVA 1XGNA 2R7FA 2DQRA 4JQFA 4ASNA 2ICWG 1Y0UA 3DKYA 1AKHB 1QBJA 3KLNA 3O8HA 1EJ9A 2PN6A 3QODA 1N75A 5D8KB 4F7ZA 5M5WJ 1YG2A 4QLCU 3G1OA 4D9JA 1JE8A 5TJJA 5EDNA 3PUBA 1X2NA 1IDZA 3MKZA 4DBQA 3BZKA 3QYFA 2MD0A 3DWLE 2IS2A 1WJAA 3BOQA 1MH4A 4HNVA 1D0ZA 2K7LA 1ZELA 2Z2SB 5CPRB 3O8GA 2LH9A 1U8BA 1X2MA 2VQCA 2WY7Q 3FXLA 4QPQA 1R5HA 3GO5A 1D0XA 1J5YA 2V7FA 2ZNYA 4BY7J 4E7JA 2FOKA 2COMA 3CCSI 3QYBA 1JJ6C 2M34A 5E1XA 3C3WA 2FOWA 4BNCA 2K27A 1X4OA 2X48A 3L7WA 5CQGA 4UB8C 2DOAA 3BP8A 2KRHA 3IRRA 3KYDB 2IGOA 4A3BJ 2LY9A 2JT1A 2GA1A 4IVNA 4EJTA 1LEBA 1S7OA 2W4SA 3CUQA 4HV5A 4LMYA 3MKWB 3FMSA 2R5ZA 4ESJA 1U0JA 2XSJC 1MSFC 4LLNA 4C3IJ 3FK6A 4LIUA 5DM6F 4LGWA 2LYCA 2CFOA 2Q2EB 2KT0A 2LBFB 4HG2A 2ISYA 4V2GA 2L7MP 3CUQC 3K69A 3WTTC 3BR5A 1KZHA 2HZTA 4KA4A 3F22A 4KJZA 3OYFA 1RIOH 1FOXA 1CGPA 2EPFA 4B4CA 4ENNA 4U0VA 2DU9A 2IA1A 1XPXA 1TQMA 4WXCA 2JA8J 1OCRH 4EQQA 1LQ1A 1GLNA 1ZAOA 2EIJH 3LFUA 3SZGA 2WAQA 3QPHA 2GIZA 4MGRA 4CYDA 2MD5A 1G6NA 2XVCA 5DCMB 3KFWX 3VB2A 1YJWI 5ILSA 1DP3A 2QM3A 3RZDJ 3GLXA 1IRGA 4XKCA 2DDBA 2ID6A 1YJNI 4IRIA 2NVTJ 3S15J 4XIDA 2VQGA 2RC4A 1W7PD 3MZ8A 4YRVA 3GEZA 3G4SI 3JTGA 1XSDA 4BXXJ 9ANTA 1FY7A 2Y0SN 5EG0B 1V3FA 2M7AA 4ENMA 2EZLA 2MH2A 2NNNA 1GDTA 4S05A 5KAIC 5F0HA 3BC8A 4HLXA 3A0BC 3ZRGA 3QRFF 4WWCA 2JTVA 4BKXA 1REPC 3HOVJ 1T33A 2HQRA 3TQNA 1U3EM 1KQ0A 1YI2I 3ZXSA 5ICGA 2CW0F 2K85A 3DEWA 1YE9A 3HGGA 1UG2A 4F3QA 2R5YA 1LVAA 2DYRH 4MLOA 2HYFA 2MUNA 2QZ8A 4ZDPA 4BE2A 2BW3B 3DBHB 1ZRCA 2UWMA 3NRVA 2HS5A 4AVPA 1VQ7I 3GTLJ 2IAIA 3MKLA 3DTEA 2EB7A 2NAZA 5DCFA 4XK4A 2K86A 1P7IA 3FXQA 2HVSA 3K1PA 2QQBA 1JTXA 2FBKA 3GCMA 1MH3A 3QWLA 2STWA 1WI9A 1KGSA 5J1RA 1A6IA 5HNHA 1SFEA 1XC5A 1Z7UA 3RTRA 3I59B 1G2HA 3BR2A 2VIXA 3FWEA 4L18B 2LKSA 1MIJA 2P6SA 4I99C 1SFUA 4UUVA 2FE3A 3M4OJ 1C0WA 2NOJB 4DBRA 1ODDA 4C30A 3S2WA 4HX7A 2MGQA 3HOTA 5FKOA 3C7JA 2ESHA 3KP4A 5L3FA 1YIJI 3L2VA 1I39A 1V55H 3PQKA 3A4CA 3QYEA 2ZJ2A 1H89C 4ZZDA 2VJIA 1UJ8A 2A3SA 3ABMH 3WE2A 4CHUA 1JJ8C 2E34A 5IT3A 4X6AJ 4HSTA 2QBYB 2VONA 3U2RA 2R7SA 1QRYA 2GOXB 2F5DA 1IN4A 1BI0A 1K83J 2EV0A 4N9IA 4B48A 4ENJA 2MSYA 4BJTA 4D5CA 1NHAA 1VQKI 1OCTC 2TCTA 1D5YA 1OYWA 2FA5A 3VWBA 4OMZA 3WTVC 2HQ5A 3E5UA 1OQYA 2R7TA 3C18A 1FMVA 1SFXA 5IP6A 1H88C 2MG4A 1X3UA 1BR1A 2HOTA 1ZYRF 2OBPA 3LMMA 4U7BA 5TRDA 3HOWJ 2IA0A 2EZKA 3JAMK 3ASOH 3IHUA 1ZR2A 1R71A 4U0WA 1JI8A 1Z3XA 2FX0A 1YS7A 2RAEA 4IRGA 3CP8A 4D7MA 1FTTA 4HQEA 1WJ5A 1VQLI 1BIAA 3HKZN 2DLLA 5E3OA 2XV4S 2GOMA 1WFXA 1KYWA 2XPVA 3FHNA 1Q1VA 1IJWC 4I02A 2IT0A 4OMYA 3NEUA 5K5QA 3ZPLA 3HSEA 5HDNA 1GV5A 2H1KA 1VI0A 3VPRA 1UB9A 2EWNA 2MVTA 3SJMA 2HU9A 3JAMZ 1IUFA 3I55I 3LNQA 3FXOA 2BGCA 3NWTA 2CW7A 1PUFB 4YEJA 5JHFA 1G3TA 1T56A 1Z6TA 1YOVB 1F4KA 2JQ7A 4P1WA 3GTGJ 1O3RA 3V8KA 3U1DA 4M3FA 3GYHX 2F6CA 1R49A 3W2AA 4LG0A 3OIQA 3LA3A 3AKZA 1Z77A 1OR7A 5AIQA 3AFHA 2GXBA 3K4KA 4AD9A 4WF2A 1VQ8I 1OPCA 1IUYA 3A0HC 1IRXA 2HDWA 2QENA 3ECHA 5DD4A 3S1NJ 3H92A 1B9NA 2BYVE 2KQRA 4UV9A 3WODF 2ECBA 4JX4A 3EDPA 2LOOA 2DT5A 2L54A 3KZZA 1OR7C 1QVTA 3K70C 2QKMB 3BG7A 2O8XA 4IQ4A 3FXMA 5GTHC 2MW8A 2E1MC 1JHHA 2E2IJ 1T39A 4IHYA 3Q3SA 2OZUA 3BR1A 2X0LA 1O7FA 2NNYA 1JGSA 3K0LA 1JT6A 2IPQX 5IYBJ 2HKOA 2L2OA 2BE5F 3CJNA 4XICA 2X6OA 1FTZA 2H27A 1TWAJ 2MBFA 2AXLA 4M9ZA 1TZLA 1TW2A 2ZCWA 4RGUA 1MNMC 4M3EA 1RPWA 2IGNA 4G12A 2EFWA 2FD5A 3VDXA 1WJDA 1HQCA 2XF5A 3E6BA 2NS8A 2HDDA 3LSKA 2HTJA 2EJRA 1KU2A 2JRMA 4BJ5C 4MO7A 2NRAC 1W0TA 5HDKA 1WZ2A 1PDNC 2HVRA 3MZYA 3BPXA 4GXOA 3K4LA 4U88A 2DA4A 2K40A 3SYTA 2ZBKA 3EQLF 4GDFA 2KLOA 2QSFX 3K2ZA 2E5ZA 5FKMA 4FCYA 1VZ0A 4KN4X 3EUKL 2YR2A 2VE8A 5CJ9A 5J6XA 5ILVA 2OZ6A 2ZXIA 1W7PB 3KZIC 2HPMA 1TQIA 2FF4A 2JSPA 5FB2A 5HDGA 3KYCB 2O0YA 3LSGA 3FM3A 3LAPA 3A02A 1T6SA 3HUGA 1K6YA 3VODA 2DMUA 1B4AA 2KKOA 4HLYA 2M87A 4WXDA 2VKVA 3RKYA 1ETOA 1HW5A 2E7XA 2XAGA 1HF0A 4HV6A 1Z9CA 4NUBA 2XB5A 1R1VA 4HF0A 3HEFA 2WTEA 2E2HJ 3LFKA 1A36A 1QZEA 1RR7A 4I0BA 2Y9ZA 1FYLA 1YFHA 3LQRA 5EEAA 4KIGA 4CXFA 4G7HF 2P0TA 3JRGA 4P55A 4I2OA 5CVIA 4LK0F 1QU3A 1WH7A 3PSFA 4U87A 2DMQA 2DMPA 3SZTA 2KIFA 4CCKA 3JRIA 3ZQHA 2L7FP 3OS2A 1W4MA 2D2WA 5DS9A 3HC7A 3CCMI 3V8LA 5FLXK 1GUUA 4DOZA 4P9UA 2L0KA 4KT6A 3F23A 3MVPA 2EINH 2F5EA 3CLOA 3IH4A 4AIHA 3OSGA 4UUSB 3HL2A 4KIFA 1KQ9A 3DCFA 2E60A 3H3UA 2A07F 1RNLA 4RLQA 4PJ0C 3ERED 1RKWA 2VJJA 1Y8QB 3GTJJ 2W00A 3MMYB 1GVDA 5E1ZB 4RAGA 3H3ZA 3U1KA 2M5WA 5FKKA 5EGOB 2BY2A 3CCLI 2CGPA 3E5QA 2LNBA 5F04A 3LSTA 3L09A 3W6KB 3LA7A 3JRDA 3CCVI 1IN7A 4XRSG 3I4MJ 1F9NA 3TO9A 4XLAA 3A52A 4XKVA 1E3HA 1Z7LA 3IH3A 2OTLI 5E17F 5LRRA 1ENHA 3GWZA 4RA2A 3WTWC 1S5LC 4NQWB 2CWEA 4BQNA 1SD7A 1ETWA 3QU3A 3KP7A 1B8IB 1ETYA 4YFNF 2MABA 4XLFA 3J81Z 1XGSA 5EF6A 3F6VA 4A3FJ 4ETSA 1XMAA 4ZYDA 2Y75A 4KFCA 3ZQIA 3BQZA 3PM1A 3P9IA 4WX9A 3FBNB 4W1UA 3GTPJ 4ZYAA 1OCZH 4HOBA 1DPUA 2H94A 3T0YA 4KISA 5ICCA 1S29A 3BJAA 4DNCA 5LFAA 5HLHA 2DPUA 2Y0SA 4PJNA 1JXSA 2EK5A 1MJBA 1TWHJ 4J19A 3AG1H 1R1TA 4BHBA 1X1BA 4XOPA 5AIPA 4BQAA 3OYCA 1U5TA 1XCBA 3HGYA 4KN7X 2Y31A 2MC3A 1LE8B 2IRFG 2KL4A 5FLMJ 4UXNA 2H6CA 2W57A 1QZYA 3GW2A 5ILUA 2IA2A 1WKMA 4AYBN 3SEQA 1N78A 2NVYJ 1YRNA 2OCEA 1AU7A 5JR3A 1KU3A 4B47A 2GZWA 5D5WB 1IN8A 1S8NA 1R1UA 1BM9A 1Y1WJ 2HKXA 2M8EA 5D6FA 4I7HA 1MDMB 2QWWA 3OYBA 2LREA 4D0PA 3FXUA 2HYJA 1O4XA 1XTAA 5BOXA 1USTA 4ITVA 1VQNI 4Y33A 3OS0A 5KVRA 2E7WA 3CTAA 1UHMA 3SEZA 4BGDA 2HPIA 3S93A 3F8FA 2CQXA 3T5XA 3JSPA 1RC9A 3E0JB 4X1EA 1XDSA 3V42A 3K10A 1JUMA 2LLKA 3IL2A 3PIPF 4Y13A 4G6QA 2FNPA 2K9SA 2KIMA 3CMMA 1J7KA 3DKXA 3VOEA 4AWXB 4XN0A 4BYYA 5K7ZA 4IF4A 2BY0A 4II3A 5EG0A 4ZYEA 1FMWA 1K4TA 4FQGA 1HSTA 1S6LA 5EZHA 1R4MB 4MFDA 3KX2A 1RESA 4GRIA 2UZKA 2QA4I 1BI2A 2HZDA 1AWCA 2DA6A 1O3TA 4EGYA 1WVRA 2G9WA 1OYIA 3ZCOA 2WV1A 3SZPA 3M8JA 3A01B 2J5PA 1D1AA 4M3GA 3TKYA 4B3AA 2EIMH 3QOPA 1T98A 2A6HF 2DA2A 3OYGA 2A68F 2EH3A 3VEPA 5D5XB 1UHWA 3R0JA 5D8LB 2QYOA 4QSHA 3FKJA 1KA8A 4IHWA 5EEGA 5J8FA 2RKHA 1U6GA 1H9GA 3HRMA 4HF1A 1MBEA 2DMNA 2IGMA 4IOAF 3SDGA 1XS9A 4OINF 2LR8A 5F08A 2P5KA 5DD8A 2CQNA 3BQYA 1XDUA 1U2WA 2Z99A 2GWRA 2DK5A 2KRCA 3FM5A 2M45A 5F0FA 3A2KA 1W1WE 1ZARA 2VKDA 2LK2A 1GXPA 5CVUA 4NHJA 3RPUD 3MD2A 1NG6A 3M8EA 2A05A 5J3LA 3BTLA 1MNDA 3CD6I 4BE1A 3FDYA 3W2WA 4HBLA 1JGGA 2JUGA 3JRHA 3TP0A 4YFXF 1V5EA 4BHPA 4BE0A 3CMYA 4A3EJ 2W24A 1BR4A 2EA4A 3M1CA 3G71I 3RCOA 4JK1X 2HGCA 3CC2I 2B9SA 4KMFA 2IXSA 4XOTA 5IY5H 1PP8F 2UV1A 4YIIA 3I0TA 3F0CA 2IS6A 3KP3A 3HTSB 2X1DA 3CCJI 1ZREA 2I8DA 3IV5A 1YW9A 3E3VA 4Y15A 2K3FA 2HYGD 1K79A 3CDIA 1IW7F 5IYDJ 1BC7C 4OIRF 2DO7A 3H5AA 4XLEA 3O6BB 1K78B 1G3SA 1ZG5A 4HZFA 2RREA 2X1EA 3M9AA 2VPRA 3R60A 2IVMA 4M9XA 4BEHA 4E7LA 4I09A 2Y2ZA 3WHCA 1O57A 2M0CA 5B1BH 4OIOF 2V1UA 2VUMJ 5EEHA 4IEJA 4M73A 4UVAA 4A2UA 2IEKA 1NK3P 5LRSA 2JA2A 2CG4A 2OV7A 1APLC 1R22A 2ACJA 4RB3C 2AHQA 3JW4A 2KIUA 2PFBA 2VASA 3IC7A 2X51A 4A69C 3PSIA 4M72A 3AL0B 1QPMA 5A2QZ 3FXKA 5E3MA 5L3BA 5L3DA 3IWFA 2LF7A 4MFEA 2HVQA 4JX5A 4U0YA 3CCUI 4XRSA 3HRUA 1SD6A 4PK4A 4CYCA 3HYIA 1O7LA 4G9YA 4JX6A 4PFPA 2LSOA 2P0WA 2GBYA 5BS6A 2X4HA 1JHFA 3DBLB 2IBDA 3CJTB 5DUIA 2V1XA 2Y0MA 2VLAA 2LF8A 2I5UA 1FOWA 2PBIA 3DPTA 4EEFG 4RB2C 3HSFA 1E3OC 4FETA 1QHHD 1Z67A 3Q0UA 1G4DA 1ZLKA 2K9NA 1ONVA 4CICA 3CCYA 1X1DA 3I5UA 2FJ1A 1JKPC 4OWRB 3M8FA 2VPLA 4UHTA 4BBSJ 1SMTA 4C3JJ 2EFNA 1ETQA 2OQGA 3ISPA 4C3HJ 2R7QA 3G2BA 2M4GA 3AG2H 1IG7A 1Z21A 3K4BA 2ADUA 1MSEC 3GTKJ 3ABKH 2BXYA 2HQAA 1RUOA 3JRCA 3HDDA 5H20A 4BXUA 3HM5A 4WXHA 3CLQA 3W6JB 3BR6A 1TT5B 1D1CA 2DYSH 3V8JA 3VYTB 1GV2A 2W1OA 4NC7A 2G7UA 5FO5A 4FT8A 3OYNA 1ZH5A 2VOOA 2RQPA 4PGHA 3ASNH 1ZGJA 3HTUA 4UUTA 2HNHA 3H9JA 1RQ6A 2D5VA 4P96A 2OF7A 4PCQA 3HOSA 1ZRDA 2XGCA 5FD6A 4NBQA 2VJ4A 5F64A 2DQLA 4IXAA 2CUJA 3KEOA 3F8BA 2J5OA 3DKWA 4O5VA 4B3XA 1R58A 4Q48A 4DGWB 2M0MA 4FISA 3ZQCA 4K2EA 2VN2A 3QQAA 2MYSA 3I64A 1RUNA 4A3JJ 1ETXA 2MFZA 2CUEA 2WAFA 1ZRFA 3ZR8X 4XKWA 2IW5A 2HXOA 1K6OA 1Y0NA 5J47A 2BVLA 3BJOA 3FHZA 1XSXA 3F8MA 3IRQA 4HRIA 2KRFA 1X1AA 1R4NB 3ELKA 4RM3A 5B66C 1ON2A 4A0YA 4Q5SF 4FTHA 2R7UA 4KIBA 2RVCA 5C44J 2KP6A 1HKQA 2UXNA 3DEUA 4LK1F 5LLQA 1EH8A 5LEJA 3J80Z 3ECOA 3R4KA 4YFKF 2NOGA 2W84A 3OIOA 3IKVA 2ZNZA 4RMNA 5L3CA 3IUOA 3ZMVA 2ZJPF 3BTCA 2Q1ZB 1R5ID 2RV8A 3ROUA 4PFOA 4HDUA 3GBGA 4I6ZA 2H1LA 3D0SA 1I27A 4HDVA 3MCZA 3E6DA 4YG2F 4IKFA 1BA5A 2BY1A 2VKHA 2CU7A 4XLNF 1B72A 2A69F 1ITYA 1B6AA 2L3DA 4LFUA 4IHXA 1ON1A 2ZKZA 3MEXA 4E4HA 1S7EA 2VBZA 3IKTA 1U78A 2WC2A 2A61A 3KIOA 4BU2A 2LMDA 3CJQB 4HPQA 3D5LA 3I9V2 3WTUC 4DIQA 1Z91A 1TLHB 4A3KJ 5DV5A 4J00A 2DN0A 1N25A 3IWZA 4B09A 2DFIA 2V4JC 1J59A 2EQRA 4RAYA 4DYCA 3PNYA 3OL4A 1T38A 5JLXA 2R93J 4XL9A 1LDJA 1OYYA 1S3JA 2H6BA 3JAMR 1X19A 3RZOJ 4XMYA 3PNVA 1QPIA 4XR6A 3PUFA 4XORA 2GA2A 2XKPA 3I56I 2AS5F 1F1ZA 1NK2P 4PGGA 5HLGA 3B6AA 4AYBA 3RQIA 2PMHA 2PJRB 1WHUA 1Y39A 2CQKA 3DLAA 3FMRA 4G6TB 3N97A 1BW6A 2PQ8A 2H09A 4HX4A 3M3YJ 2QEXI 1A35A 3DU6A 4M71A 1FIAA 4G94A 2UXXA 1LB2A 2ZXHA 3MZHA 1ETKA 4A0ZA 3BPVA 3E97A 4A3LJ 2ELJA 3L2CA 1DP7P 3Q0WA 4GO1A 1MNEA 2LKPA 4N0BA 1Y6IA 3OYJA 1F36A 3ML6A 4AU7A 4Y17A 1FP2A 2O8KA 4LOCA 3FX3A 1P92A 1SAUA 4E7ZA 1ACIA 2OPTA 1R7JA 4S0HB 4L0YB 1WCMJ 2VXZA 1YLFA 3VSLA 3K70D 2VI6A 3I58A 3JREA 1S9HA 3HHGA 3DQVC 3CF2A 1FBQA 4LITA 2DA3A 3GF2A 2JMWA 1DPRA 2XAUA 2CV0A 1YS6A 3S1RJ 1PP7U 3KP6A 5BMZA 1JT0A 2DW4A 4LG3A 4PZJA 1VQ4I 2DTZA 2GLOA 2L7KA 3MKYB 1G3WA 1YX3A 1PVEA 3KE2A 4O3MA 3GTMJ 3U21A 2KDZA 4HAMA 2EIKH 1HDDC 2V9VA 2QUFA 3ABLH 5ED4A 3CUQB 2ZMEA 4CSWA 2R5ZB 2Q0OA 3LA2A 1P7JA 3H0GJ 2YS9A 1FIPA 2JPBA 3OOPA 3HSRA 4FX4A 2NYXA 1P9QC 5DUKA 4ZZLA 2O5RA 1VNDA 2PEXA 5DDGA 1XGMA 2IGKA 2ZXJA 3E6CC 3A1YA 4CA0A 4ON0A 2D1HA 2ZMEC 4CCNA 4XRMA 2FRHA 2LY1A 4KITB 1WRJA 3DPLC 2VB6A 4OAZA 1MMAA 4RGXA 2K9MA 3E6MA 2MLGA 5C3EJ 4KMUX 2PJPA 5HLIA 3OYAA 3OYLA 2W7NA 2LP0A 4E7IA 2PG4A 3QPTA 4C2MJ 4HA8A 3KP2A 2HEOA 3ABTA 5E8GA 5FFZA 4OU0A 4MHGA 1SFKA 3CQZJ 4CCMA 1HDPA 4PDKA 2F48A 3CMAI 3PIOF 3K4MA 4CZZA 1IDYA 3DTIA 4XBFA 4P9FA 3HPHA 3PFYA 5BPIA 4PJMA 3ZOBA 4CDGA 4ZYHA 2M9HA 4V2FA 4UVCA 2C6YA 2GXGA 4G7ZF 4XKBA 3RI4A 1ORKA 2R7OA 2L9VA 3LSJA 3IAS2 4RDUA 1HKTA 2R5YB 4IZZA 3TEDA 2JPCA 5EYRA 2ECCA 3T8RA 4RAZA 4RLFA 4RBOA 3GFLA 4RB0A 2HOSA 3SDBA 4A3CJ 5IP9J 3H9QA 4HW0A 2GXAA 1R6RA 2E19A 1OFCX 1KU9A 2FQ4A 4ZDOA 4CUGA 3RQ4A 2FU4A 2DFHA 5DEQA 1JKOC 5FLXR 3DU5A 2VBYA 3HB9A 3N4MA 2LKXA 1I1GA 2F5FA 2HXIA 1GVJA 2L4AA 2HOAA 4YIFA 3F6OA 1ZKGA 5M3MJ 1CF7A 1YJ9I 1FBUA 2FXAA 4IL6C 1ERDA 1LPQA 4CO8A 1ZQ3P 4L0ZB 1IO2A 2TDXA 1BIBA 3BG9A 2L02A 4E70A 4M6VA 5D5UB 4NNJA 2GM4A 2JK3A 2Z9OA 4LLLA 5FD5A 3TW7A 2V1NA 3OSFA 4ESFA 5IT9Z 4B8XA 2CW8A 1IRZA 4I01A 5J1YA 2QSGX 1BJZA 4BH9A 3RSNA 1W36C 5F1JA 2YX4A 1LDKB 3F8NA 3J81K 2V9KA 3PL8A 4FE4A 3VFZA 1UAAA 3OYKA 1IRFA 1U9OA 4Y7NJ 1BOAA 2YPRA 1AA7A 1B9MA 2Y30A 2G0EA 2Z5UA 4A5MA 3HPGA 3V7RA 4ZTJA 1AKHA 1R36A 5LGUA 1HKSA 1TNTA 2OAZA 1O3SA 2OD5A 2DA7A 5HOOA 2ZC2A 2R0QC 2JA6J 1Y8RB 3AG3H 2EV5A 3BG5A 1TNSA 4JBAA 3WGIA 3S14J 1WJBA 1FWZA 1WQ2A 3COAC 2WB1N 3TMOA 1LKXA 3K6GA 4WK8F 4JOMA 4IQJA 3CDHA 2ID3A 3T8TA 3GTQJ 1HXDA 4MEYF 2EZIA 3BDDA 4FE7A 1SMYF 2FEZA 2QSHX 5FJ8J 1ZLJA 3AAFA 2DPDA 1VQMI 1RR8C 3RIRA 3L2RA 2V79A 1R23A 3BCAA 1MW7A 1FOKA 1YO5C 1Z0XA 2CQQA 3KZYA 2XGEA 4NDLA 3S16J 1RI7A 1MGTA 3ZQLA 4IX7A 1SANA 1TL8A 1BBYA 5E3LA
chains in the Genus database with same CATH topology
3DFGA 1IXRC 3V7CA 4EGZA 1HSJA 1J0RA 2JZYA 2K02A 4LG0B 2Q2EA 3SQNA 2D1VA 4S04A 2QLZA 2RGVA 3ZMSA 1K7AA 3WE3A 3JSOA 4OOIA 3WTZA 6PAXA 4KNYA 5H6RA 4A6DA 2OQRA 1STZA 5DCMA 2QQ9A 4A5NA 4H0EA 4UV8A 1XB4A 4MEXF 5E18F 1XN7A 4FX0A 3TOBA 5AONA 1R5GA 2HQNA 3I4PA 4IRHA 5JHUA 1Z6RA 1MJ9A 4EJWA 5L3GA 2ZO4A 5HVQC 2DBBA 1DUXC 3KLOA 3DV8A 4P5OA 4XRFA 1TTYA 4RB1A 1KQ8A 4A0XA 1S7AA 2FBHA 4MQ9F 1BC8C 4Z2YA 4IPAA 3P9CA 1UFMA 1YQAA 5L3EA 3NQOA 2E1NA 3BZ6A 2F2EA 5D4SA 3LAJA 1VTNC 3I59A 2P6TA 4RGRA 5JFRA 4DQ2A 3QP6A 3R6SA 1T2KA 2HDCA 5CVJA 4L5JA 1FSHA 1FLIA 1FBSA 4EM0B 4EV0A 4M6XA 2XUBA 2BEOA 3K1NA 4M74A 3EYIA 2QBYA 4L9VA 3KETA 1XMKA 2R7DA 4I98B 3ULQB 2WWYA 2EFPA 3GFMA 5CVRA 3JTHA 2Z33A 1V4RA 4ZYGA 3EYYA 5A2QK 1B59A 2G7HA 4LD5A 3WU0A 1EH7A 1A04A 3V4GA 3LQQA 5HS8A 2PI0A 2BBYA 2EA2A 1J2XA 1MJAA 3SHFA 4EM1A 1QNTA 3WTSC 2DI3A 3I71A 2HWVA 1FNNA 3RKWA 2P7VB 1WSUA 2VBWA 2CO5A 2K4JA 1P2FA 3EUHA 3HRSA 2STTA 1HW2A 2BV6A 4HYEA 2FQ3A 4KYWA 1L0OC 4RGSA 2NS0A 5CVVA 1I1SA 1Z1DA 2P8TA 3ZMUA 2VT3A 5CYVA 2VODA 2JSCA 1OMIA 2FNAA 4NB5A 5K5RA 1U5TB 1IF1A 3RDIA 2DTRA 5KK1A 4IHSA 5ICFA 3O2PE 2XKOA 3K9TA 4O6JA 2KJBA 3Q9SA 3ZMTA 4OIPF 1Z05A 3RKXA 1RZ4A 3GX4X 5K5OA 4XLPF 1XCVA 3L00A 1EH6A 2WV0A 3MQ0A 5BQTA 2GQQA 5BPDA 1D5VA 3FXRA 3LWFA 2MA3A 4ENKA 2XIGA 5HS7A 5LHHA 3J80K 1YW7A 3DP7A 4WCGA 2P5LC 2VT2A 3CO7C 1FPQA 1IN6A 4KICA 3F8CA 1FYMA 2O3FA 2IP2A 2MLKA 1W7PA 5LGNA 3K1MA 1LDDA 4KUMA 3MFKA 4XSXF 1IXSB 3GFIA 1MD0A 3GZ5A 1LJ9A 2OU2A 3DXJF 2A6EF 2FBIA 3KCCA 1E17A 5LBQA 3SXYA 2YSRA 3SFZA 2Q8KA 1I6XA 5CLSA 3TDZC 4AIJA 2EFOA 5FFXA 1KU7A 2HFHA 1ZHFA 5J8CA 5DYMA 3F72A 4TV7A 3HHHA 2XRNA 3F3XA 3PFIA 1EV7A 4LJZF 3RYPA 3ZMZA 1ZG3A 4MTDA 3TO7A 4I0AA 1LNWA 1ZN2A 2XAFA 4M6YA 3TDUC 3J7AO 1F5TA 5F1RA 1QO0D 2CYYA 4NQWA 3E5XA 3FZVA 4LB5A 3BWGA 4G6DA 3HIFA 3PQJA 1J9IA 1TBXA 2QQAA 5K1YA 4XSZF 3QP5A 2K4BA 2M30A 1J75A 1FSEA 3CO6C 3RYRA 5JVTA 4L9JA 5H6QA 2Y48A 1XGOA 5ERIA 3M7GA 5HS9A 2R3SA 1FZPB 3MWMA 2VC0A 2HTSA 5JI6A 3HRTA 1YW8A 3Q5FA 2FMLA 4ESBA 2RDPA 1P4AA 3T1BA 1MDMA 4OIQF 3ZN1A 3GUDA 4HF2A 2JRTA 2QVOA 4LB6B 4GCVA 2VOPA 2XAHA 3ZN0A 2KJCA 3CUOA 4CGZA 5LEKA 1W5SA 2FMYA 3OV8A 4UNOA 2DAOA 1L3LA 3MAJA 4BAYA 4FHTA 3ZMDA 2XASA 1UCRA 1QZZA 2VE9A 1IXCA 4EM2A 3B02A 5LGTA 2RNJA 3FF5A 1QGPA 1SD4A 3C1DA 3WGGA 3KEQA 5FGMA 3WGHA 3KP5A 4L9TA 3GZ6A 2A5YB 1IN5A 2OA4A 3O3KA 5IT9K 4UVBA 1Q1HA 3DF8A 5LHIA 3EETA 4GGGA 5ICEA 5E20A 3R0AA 2ETHA 2HR3A 2Z3YA 1U8RA 1DDNA 4BHCA 3FMQA 5E1WA 3BY6A 4R1HA 1I5ZA 2IJLA 2ZFWA 1GXQA 1LEAA 3P7NA 1BI1A 3WU1B 1E2XA 2O6GE 1KYZA 5D4RA 1FX7A 1K78A 1BJAA 1USSA 2F5CA 3TO6A 3R61A 2ISZA 4A12A 3Q9VA 2PMUA 4HQMA 3RPQA 3TOAA 2XGXA 3ZQ7A 2L01A 4GYIA 2ESNA 4G7OF 1MZBA 1IAWA 5D6EA 5FLXZ 4KDPA 3ABUA 2GAUA 3REOA 2O61A 3F21A 1SAXA 4EJOA 2O03A 4R8HA 3G73A 3WTXC 4R79A 5E8IA 3P9KA 2B0LA 1W5TA 2FSWA 1BN5A 4G8XA 4KT5C 2YU3A 2XAJA 3B73A 1PUEE 2P4WA 4EVIA 4LLGF 1H9TA 1YTYA 1D8KA 1MKMA 1O3QA 2EFQA 3I53A 2P5VA 2VBXA 5LHGA 2XAQA 1U5TC 2RN7A 1QQIA 3I54A 2ZMEB 3ZP5A 2LDUA 1IZ1A 1B1BA 3RJPA 3V7SA 4AIKA 1G3YA 1D3YA 3GXOA 2V6CA 4ZH4F 4A6EA 1TQPA 1FC3A 4MNUA 1ZG1A 2DK8A 1XD7A 1WWXA 4N9HA 2ELHA 3M1EA 2CSOA 4M9SA 1D8JA 1ULYA 3BROA 2GIVA 2XROA 1XSVA 4RS8A 2E1CA 2MH9A 1SD5A 2YX7A 2EV6A 5F6FA 5D5VB 1R00A 3QU6A 4MTEA 2P7CB 1YIOA 3GVAA 1FP1D 2D45A 4IJAA 4QWQA 1YYVA 3BJ6A 3TGNA 2PLYA 1ZGAA 1OKRA 2CFXA 4U7DA 4MQVA 4EMSA 1P6RA 3U9GA 2L4MA 2M1BA 3L9FA 4L9NA 3QAHA 1AOYA 1T0FA 4EJUA 1P4WA 4HX8A 1CF7B 4Q4ZF 2W25A 4L5IA 3RPUA 2VC1A 2W85A 1HBXG 4IHTA 1P4XA 1HW1A 2XHKA 3GFJA 4Q47A 2HOEA 1FT9A 1H0MA 3WG9A 1FYKA 1TW3A 3WTYC 4GYGA 2V1DA 1BI3A 3G3ZA 1GHCA 4EJVA 1XGNA 2R7FA 2DQRA 4JQFA 4ASNA 1Y0UA 1QBJA 3KLNA 2PN6A 4F7ZA 5D8KB 1YG2A 4QLCU 1JE8A 5TJJA 3BOQA 2K7LA 1R5HA 3GO5A 1J5YA 2ZNYA 2FOKA 2COMA 5E1XA 3C3WA 4BNCA 2K27A 3L7WA 3BP8A 3IRRA 2JT1A 2GA1A 4IVNA 4EJTA 1LEBA 1S7OA 3CUQA 4HV5A 4LMYA 3FMSA 4ESJA 4LLNA 4LGWA 2ISYA 3CUQC 3K69A 3WTTC 4KA4A 2HZTA 3F22A 1RIOH 1CGPA 4ENNA 4U0VA 2DU9A 2IA1A 1TQMA 4WXCA 4EQQA 1LQ1A 1ZAOA 3QPHA 4MGRA 4CYDA 2MD5A 1G6NA 2XVCA 5DCMB 3KFWX 3VB2A 5ILSA 2QM3A 3GLXA 1IRGA 4IRIA 2RC4A 1W7PD 3GEZA 3JTGA 1XSDA 1FY7A 1V3FA 4ENMA 2MH2A 2NNNA 4S05A 4HLXA 3QRFF 4WWCA 2JTVA 1REPC 2HQRA 3TQNA 1U3EM 1KQ0A 5ICGA 2CW0F 1LVAA 2HYFA 2QZ8A 1ZRCA 2UWMA 3NRVA 2HS5A 4AVPA 2EB7A 2NAZA 5DCFA 2K86A 3FXQA 3K1PA 2QQBA 2FBKA 2STWA 1WI9A 1KGSA 1SFEA 1Z7UA 3RTRA 3I59B 3FWEA 4L18B 2P6SA 1SFUA 4UUVA 2FE3A 1C0WA 1ODDA 3S2WA 4HX7A 3HOTA 3C7JA 2ESHA 3KP4A 5L3FA 3PQKA 2ZJ2A 4ZZDA 2A3SA 3WE2A 4CHUA 5IT3A 2QBYB 2VONA 3U2RA 2F5DA 1IN4A 1BI0A 2EV0A 4N9IA 4ENJA 1NHAA 1OYWA 2FA5A 4OMZA 3WTVC 3E5UA 3C18A 1SFXA 1X3UA 1ZYRF 2OBPA 4U7BA 5TRDA 2IA0A 3JAMK 3IHUA 4U0WA 1YS7A 4IRGA 4HQEA 1BIAA 2DLLA 2XV4S 1KYWA 4I02A 2IT0A 4OMYA 3NEUA 5K5QA 3ZPLA 3HSEA 5HDNA 1UB9A 2EWNA 3JAMZ 2BGCA 1G3TA 1Z6TA 1F4KA 1O3RA 3V8KA 3U1DA 3GYHX 4LG0A 3LA3A 1OR7A 5AIQA 2GXBA 4AD9A 4WF2A 1OPCA 1IUYA 3ECHA 2QENA 5DD4A 3H92A 1B9NA 2BYVE 3WODF 4UV9A 3EDPA 2DT5A 2L54A 3KZZA 2O8XA 1JHHA 1T39A 2OZUA 2X0LA 1O7FA 2NNYA 1JGSA 3K0LA 2IPQX 2HKOA 2BE5F 3CJNA 2H27A 2MBFA 2AXLA 4M9ZA 1TW2A 2ZCWA 4RGUA 2EFWA 1HQCA 3E6BA 2HTJA 2EJRA 1KU2A 2NRAC 5HDKA 1PDNC 3MZYA 3BPXA 4GXOA 4U88A 2ZBKA 3EQLF 3K2ZA 4KN4X 2YR2A 2VE8A 5CJ9A 5J6XA 5ILVA 2OZ6A 1W7PB 1TQIA 2FF4A 5FB2A 5HDGA 2O0YA 3FM3A 3LAPA 1T6SA 3HUGA 3VODA 1B4AA 2KKOA 4HLYA 2M87A 4WXDA 3RKYA 1HW5A 2E7XA 2XAGA 4HV6A 1Z9CA 1R1VA 4HF0A 2WTEA 3LFKA 4I0BA 1FYLA 1YFHA 3LQRA 4KIGA 4CXFA 4G7HF 4P55A 4I2OA 5CVIA 4LK0F 3SZTA 2KIFA 1W4MA 2D2WA 3V8LA 5FLXK 4P9UA 3F23A 2F5EA 3CLOA 4AIHA 4KIFA 1KQ9A 3H3UA 2A07F 1RNLA 3ERED 5E1ZB 3H3ZA 2M5WA 2CGPA 3E5QA 2LNBA 3W6KB 3LSTA 3L09A 3LA7A 1IN7A 1F9NA 3TO9A 5E17F 5LRRA 3GWZA 3WTWC 2CWEA 1SD7A 3QU3A 3KP7A 4YFNF 3J81Z 1XGSA 3F6VA 4ETSA 1XMAA 4ZYDA 2Y75A 4KFCA 3P9IA 4WX9A 4HOBA 1DPUA 2H94A 3T0YA 5ICCA 1S29A 3BJAA 4DNCA 5HLHA 2DPUA 1JXSA 2EK5A 1MJBA 1R1TA 4BHBA 5AIPA 4BQAA 1U5TA 1XCBA 2IRFG 4KN7X 2MC3A 4UXNA 2H6CA 2W57A 1QZYA 3GW2A 5ILUA 2IA2A 1WKMA 5JR3A 1KU3A 5D5WB 2GZWA 1IN8A 1S8NA 1R1UA 1BM9A 2HKXA 2M8EA 5D6FA 4I7HA 1MDMB 2QWWA 4D0PA 3FXUA 5BOXA 1USTA 5KVRA 2E7WA 3CTAA 1UHMA 3F8FA 3T5XA 3JSPA 1XDSA 3IL2A 4Y13A 4G6QA 2FNPA 2KIMA 4AWXB 1J7KA 3VOEA 4BYYA 4IF4A 4ZYEA 1HSTA 1S6LA 2UZKA 1BI2A 1AWCA 1O3TA 4EGYA 2G9WA 1OYIA 3SZPA 2J5PA 3TKYA 3QOPA 1T98A 2A6HF 2A68F 3VEPA 5D5XB 1UHWA 3R0JA 5D8LB 2QYOA 1KA8A 5EEGA 5J8FA 2RKHA 1U6GA 1H9GA 3HRMA 4HF1A 4OINF 2P5KA 5DD8A 1XDUA 1U2WA 2Z99A 2GWRA 2DK5A 3FM5A 2M45A 1ZARA 1GXPA 5CVUA 4NHJA 3M8EA 4HBLA 4YFXF 4BHPA 2W24A 2EA4A 4JK1X 2HGCA 4KMFA 1PP8F 4YIIA 3I0TA 3KP3A 3HTSB 1ZREA 1YW9A 3E3VA 4Y15A 1K79A 2HYGD 1IW7F 1BC7C 4OIRF 2DO7A 3O6BB 1K78B 1G3SA 1ZG5A 4HZFA 3M9AA 3R60A 2IVMA 4M9XA 4I09A 1O57A 4OIOF 2V1UA 5EEHA 4M73A 4UVAA 4A2UA 5LRSA 2CG4A 1R22A 2ACJA 4RB3C 3JW4A 2KIUA 2PFBA 3IC7A 4M72A 1QPMA 5A2QZ 5L3BA 5L3DA 3IWFA 2LF7A 4U0YA 3HRUA 1SD6A 3HYIA 1O7LA 4G9YA 2LSOA 5BS6A 2X4HA 1JHFA 5DUIA 2V1XA 2Y0MA 2LF8A 2PBIA 3DPTA 4RB2C 3HSFA 1G4DA 1ZLKA 1ONVA 4CICA 3I5UA 3M8FA 4UHTA 1SMTA 2EFNA 3ISPA 2OQGA 2ADUA 1RUOA 5H20A 4BXUA 4WXHA 3W6JB 3V8JA 5FO5A 2G7UA 1ZH5A 4FT8A 2VOOA 2RQPA 4PGHA 1ZGJA 3HTUA 4P96A 4PCQA 1ZRDA 3HOSA 5FD6A 5F64A 2DQLA 4IXAA 3KEOA 3F8BA 2J5OA 3DKWA 4O5VA 1R58A 4Q48A 4K2EA 2VN2A 3I64A 1RUNA 1ZRFA 2IW5A 1K6OA 3BJOA 3FHZA 1XSXA 3F8MA 3IRQA 2KRFA 3ELKA 1ON2A 4A0YA 4Q5SF 4KIBA 2RVCA 1HKQA 2UXNA 3DEUA 4LK1F 5LLQA 1EH8A 3J80Z 5LEJA 3ECOA 3R4KA 4YFKF 2W84A 3IKVA 2ZNZA 5L3CA 3ZMVA 2RV8A 3ROUA 4HDUA 3D0SA 1I27A 4HDVA 3MCZA 3E6DA 4YG2F 4XLNF 2A69F 1B6AA 2L3DA 4LFUA 1ON1A 2ZKZA 3MEXA 2VBZA 3IKTA 1U78A 2WC2A 2A61A 3D5LA 3WTUC 1Z91A 1TLHB 5DV5A 4B09A 3IWZA 2DFIA 1J59A 4RAYA 1T38A 1LDJA 1OYYA 1S3JA 2H6BA 2GA2A 2XKPA 2AS5F 1F1ZA 4PGGA 5HLGA 2PMHA 2CQKA 3FMRA 3N97A 2PQ8A 2H09A 4HX4A 4M71A 4G94A 2UXXA 1LB2A 3MZHA 4A0ZA 3BPVA 3E97A 3L2CA 1DP7P 4GO1A 4N0BA 2LKPA 3ML6A 4Y17A 1FP2A 3FX3A 1P92A 4L0YB 1R7JA 2VXZA 1YLFA 3I58A 3HHGA 3DQVC 1FBQA 3GF2A 1DPRA 1YS6A 1PP7U 3KP6A 5BMZA 2DW4A 4PZJA 1G3WA 3KE2A 4O3MA 4HAMA 2V9VA 2QUFA 5ED4A 3CUQB 2ZMEA 2Q0OA 3LA2A 2JPBA 3OOPA 3HSRA 4FX4A 2NYXA 5DUKA 4ZZLA 5DDGA 2PEXA 1XGMA 2ZXJA 3E6CC 4ON0A 2D1HA 2FRHA 1WRJA 3DPLC 4RGXA 3E6MA 2MLGA 4KMUX 2PJPA 5HLIA 2PG4A 3QPTA 4HA8A 3KP2A 2HEOA 3ABTA 5E8GA 5FFZA 4OU0A 4MHGA 4PDKA 4CZZA 4XBFA 4P9FA 5BPIA 4CDGA 4ZYHA 4UVCA 2C6YA 2GXGA 4G7ZF 3RI4A 1HKTA 2JPCA 3T8RA 4RAZA 3GFLA 4RB0A 4HW0A 1KU9A 2FU4A 5DEQA 2VBYA 3N4MA 1I1GA 2F5FA 1GVJA 2L4AA 4YIFA 3F6OA 1CF7A 1FBUA 2FXAA 4CO8A 4L0ZB 2TDXA 1BIBA 2L02A 4E70A 5D5UB 2Z9OA 4LLLA 5FD5A 4ESFA 5IT9Z 4B8XA 4I01A 4BH9A 2YX4A 1LDKB 3F8NA 3J81K 3VFZA 1IRFA 1BOAA 2YPRA 1B9MA 2Z5UA 4A5MA 3V7RA 1R36A 5LGUA 1HKSA 1TNTA 2OAZA 1O3SA 2OD5A 5HOOA 2EV5A 1TNSA 4JBAA 3WGIA 1FWZA 1WQ2A 3COAC 4WK8F 3CDHA 3T8TA 1HXDA 4MEYF 3BDDA 1SMYF 2FEZA 3AAFA 1ZLJA 2DPDA 3RIRA 2V79A 1R23A 1FOKA 1YO5C 3KZYA 1RI7A 1MGTA 1BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DFG A;  1IXR C;  3V7C A;  4EGZ A;  1HSJ A;  1J0R A;  2JZY A;  2K02 A;  4LG0 B;  2Q2E A;  3SQN A;  2D1V A;  4S04 A;  2QLZ A;  2RGV A;  3ZMS A;  1K7A A;  3WE3 A;  3JSO A;  4OOI A;  3WTZ A;  6PAX A;  4KNY A;  5H6R A;  4A6D A;  2OQR A;  1STZ A;  5DCM A;  2QQ9 A;  4A5N A;  4H0E A;  4UV8 A;  1XB4 A;  4MEX F;  5E18 F;  1XN7 A;  4FX0 A;  3TOB A;  5AON A;  1R5G A;  2HQN A;  3I4P A;  4IRH A;  5JHU A;  1Z6R A;  1MJ9 A;  4EJW A;  5L3G A;  2ZO4 A;  5HVQ C;  2DBB A;  1DUX C;  3KLO A;  3DV8 A;  4P5O A;  4XRF A;  1TTY A;  4RB1 A;  1KQ8 A;  4A0X A;  1S7A A;  2FBH A;  4MQ9 F;  1BC8 C;  4Z2Y A;  4IPA A;  3P9C A;  1UFM A;  1YQA A;  5L3E A;  3NQO A;  2E1N A;  3BZ6 A;  2F2E A;  5D4S A;  3LAJ A;  1VTN C;  3I59 A;  2P6T A;  4RGR A;  5JFR A;  4DQ2 A;  3QP6 A;  3R6S A;  1T2K A;  2HDC A;  5CVJ A;  4L5J A;  1FSH A;  1FLI A;  1FBS A;  4EM0 B;  4EV0 A;  4M6X A;  2XUB A;  2BEO A;  3K1N A;  4M74 A;  3EYI A;  2QBY A;  4L9V A;  3KET A;  1XMK A;  2R7D A;  4I98 B;  3ULQ B;  2WWY A;  2EFP A;  3GFM A;  5CVR A;  3JTH A;  2Z33 A;  1V4R A;  4ZYG A;  3EYY A;  5A2Q K;  1B59 A;  2G7H A;  4LD5 A;  3WU0 A;  1EH7 A;  1A04 A;  3V4G A;  3LQQ A;  5HS8 A;  2PI0 A;  2BBY A;  2EA2 A;  1J2X A;  1MJA A;  3SHF A;  4EM1 A;  1QNT A;  3WTS C;  2DI3 A;  3I71 A;  2HWV A;  1FNN A;  3RKW A;  2P7V B;  1WSU A;  2VBW A;  2CO5 A;  2K4J A;  1P2F A;  3EUH A;  3HRS A;  2STT A;  1HW2 A;  2BV6 A;  4HYE A;  2FQ3 A;  4KYW A;  1L0O C;  4RGS A;  2NS0 A;  5CVV A;  1I1S A;  1Z1D A;  2P8T A;  3ZMU A;  2VT3 A;  5CYV A;  2VOD A;  2JSC A;  1OMI A;  2FNA A;  4NB5 A;  5K5R A;  1U5T B;  1IF1 A;  3RDI A;  2DTR A;  5KK1 A;  4IHS A;  5ICF A;  3O2P E;  2XKO A;  3K9T A;  4O6J A;  2KJB A;  3Q9S A;  3ZMT A;  4OIP F;  1Z05 A;  3RKX A;  1RZ4 A;  3GX4 X;  5K5O A;  4XLP F;  1XCV A;  3L00 A;  1EH6 A;  2WV0 A;  3MQ0 A;  5BQT A;  2GQQ A;  5BPD A;  1D5V A;  3FXR A;  3LWF A;  2MA3 A;  4ENK A;  2XIG A;  5HS7 A;  5LHH A;  3J80 K;  1YW7 A;  3DP7 A;  4WCG A;  2P5L C;  2VT2 A;  3CO7 C;  1FPQ A;  1IN6 A;  4KIC A;  3F8C A;  1FYM A;  2O3F A;  2IP2 A;  2MLK A;  1W7P A;  5LGN A;  3K1M A;  1LDD A;  4KUM A;  3MFK A;  4XSX F;  1IXS B;  3GFI A;  1MD0 A;  3GZ5 A;  1LJ9 A;  2OU2 A;  3DXJ F;  2A6E F;  2FBI A;  3KCC A;  1E17 A;  5LBQ A;  3SXY A;  2YSR A;  3SFZ A;  2Q8K A;  1I6X A;  5CLS A;  3TDZ C;  4AIJ A;  2EFO A;  5FFX A;  1KU7 A;  2HFH A;  1ZHF A;  5J8C A;  5DYM A;  3F72 A;  4TV7 A;  3HHH A;  2XRN A;  3F3X A;  3PFI A;  1EV7 A;  4LJZ F;  3RYP A;  3ZMZ A;  1ZG3 A;  4MTD A;  3TO7 A;  4I0A A;  1LNW A;  1ZN2 A;  2XAF A;  4M6Y A;  3TDU C;  3J7A O;  1F5T A;  5F1R A;  1QO0 D;  2CYY A;  4NQW A;  3E5X A;  3FZV A;  4LB5 A;  3BWG A;  4G6D A;  3HIF A;  3PQJ A;  1J9I A;  1TBX A;  2QQA A;  5K1Y A;  4XSZ F;  3QP5 A;  2K4B A;  2M30 A;  1J75 A;  1FSE A;  3CO6 C;  3RYR A;  5JVT A;  4L9J A;  5H6Q A;  2Y48 A;  1XGO A;  5ERI A;  3M7G A;  5HS9 A;  2R3S A;  1FZP B;  3MWM A;  2VC0 A;  2HTS A;  5JI6 A;  3HRT A;  1YW8 A;  3Q5F A;  2FML A;  4ESB A;  2RDP A;  1P4A A;  3T1B A;  1MDM A;  4OIQ F;  3ZN1 A;  3GUD A;  4HF2 A;  2JRT A;  2QVO A;  4LB6 B;  4GCV A;  2VOP A;  2XAH A;  3ZN0 A;  2KJC A;  3CUO A;  4CGZ A;  5LEK A;  1W5S A;  2FMY A;  3OV8 A;  4UNO A;  2DAO A;  1L3L A;  3MAJ A;  4BAY A;  4FHT A;  3ZMD A;  2XAS A;  1UCR A;  1QZZ A;  2VE9 A;  1IXC A;  4EM2 A;  3B02 A;  5LGT A;  2RNJ A;  3FF5 A;  1QGP A;  1SD4 A;  3C1D A;  3WGG A;  3KEQ A;  5FGM A;  3WGH A;  3KP5 A;  4L9T A;  3GZ6 A;  2A5Y B;  1IN5 A;  2OA4 A;  3O3K A;  5IT9 K;  4UVB A;  1Q1H A;  3DF8 A;  5LHI A;  3EET A;  4GGG A;  5ICE A;  5E20 A;  3R0A A;  2ETH A;  2HR3 A;  2Z3Y A;  1U8R A;  1DDN A;  4BHC A;  3FMQ A;  5E1W A;  3BY6 A;  4R1H A;  1I5Z A;  2IJL A;  2ZFW A;  1GXQ A;  1LEA A;  3P7N A;  1BI1 A;  3WU1 B;  1E2X A;  2O6G E;  1KYZ A;  5D4R A;  1FX7 A;  1K78 A;  1BJA A;  1USS A;  2F5C A;  3TO6 A;  3R61 A;  2ISZ A;  4A12 A;  3Q9V A;  2PMU A;  4HQM A;  3RPQ A;  3TOA A;  2XGX A;  3ZQ7 A;  2L01 A;  4GYI A;  2ESN A;  4G7O F;  1MZB A;  1IAW A;  5D6E A;  5FLX Z;  4KDP A;  3ABU A;  2GAU A;  3REO A;  2O61 A;  3F21 A;  1SAX A;  4EJO A;  2O03 A;  4R8H A;  3G73 A;  3WTX C;  4R79 A;  5E8I A;  3P9K A;  2B0L A;  1W5T A;  2FSW A;  1BN5 A;  4G8X A;  4KT5 C;  2YU3 A;  2XAJ A;  3B73 A;  1PUE E;  2P4W A;  4EVI A;  4LLG F;  1H9T A;  1YTY A;  1D8K A;  1MKM A;  1O3Q A;  2EFQ A;  3I53 A;  2P5V A;  2VBX A;  5LHG A;  2XAQ A;  1U5T C;  2RN7 A;  1QQI A;  3I54 A;  2ZME B;  3ZP5 A;  2LDU A;  1IZ1 A;  1B1B A;  3RJP A;  3V7S A;  4AIK A;  1G3Y A;  1D3Y A;  3GXO A;  2V6C A;  4ZH4 F;  4A6E A;  1TQP A;  1FC3 A;  4MNU A;  1ZG1 A;  2DK8 A;  1XD7 A;  1WWX A;  4N9H A;  2ELH A;  3M1E A;  2CSO A;  4M9S A;  1D8J A;  1ULY A;  3BRO A;  2GIV A;  2XRO A;  1XSV A;  4RS8 A;  2E1C A;  2MH9 A;  1SD5 A;  2YX7 A;  2EV6 A;  5F6F A;  5D5V B;  1R00 A;  3QU6 A;  4MTE A;  2P7C B;  1YIO A;  3GVA A;  1FP1 D;  2D45 A;  4IJA A;  4QWQ A;  1YYV A;  3BJ6 A;  3TGN A;  2PLY A;  1ZGA A;  1OKR A;  2CFX A;  4U7D A;  4MQV A;  4EMS A;  1P6R A;  3U9G A;  2L4M A;  2M1B A;  3L9F A;  4L9N A;  3QAH A;  1AOY A;  1T0F A;  4EJU A;  1P4W A;  4HX8 A;  1CF7 B;  4Q4Z F;  2W25 A;  4L5I A;  3RPU A;  2VC1 A;  2W85 A;  1HBX G;  4IHT A;  1P4X A;  1HW1 A;  2XHK A;  3GFJ A;  4Q47 A;  2HOE A;  1FT9 A;  1H0M A;  3WG9 A;  1FYK A;  1TW3 A;  3WTY C;  4GYG A;  2V1D A;  1BI3 A;  3G3Z A;  1GHC A;  4EJV A;  1XGN A;  2R7F A;  2DQR A;  4JQF A;  4ASN A;  1Y0U A;  1QBJ A;  3KLN A;  2PN6 A;  4F7Z A;  5D8K B;  1YG2 A;  4QLC U;  1JE8 A;  5TJJ A;  3BOQ A;  2K7L A;  1R5H A;  3GO5 A;  1J5Y A;  2ZNY A;  2FOK A;  2COM A;  5E1X A;  3C3W A;  4BNC A;  2K27 A;  3L7W A;  3BP8 A;  3IRR A;  2JT1 A;  2GA1 A;  4IVN A;  4EJT A;  1LEB A;  1S7O A;  3CUQ A;  4HV5 A;  4LMY A;  3FMS A;  4ESJ A;  4LLN A;  4LGW A;  2ISY A;  3CUQ C;  3K69 A;  3WTT C;  4KA4 A;  2HZT A;  3F22 A;  1RIO H;  1CGP A;  4ENN A;  4U0V A;  2DU9 A;  2IA1 A;  1TQM A;  4WXC A;  4EQQ A;  1LQ1 A;  1ZAO A;  3QPH A;  4MGR A;  4CYD A;  2MD5 A;  1G6N A;  2XVC A;  5DCM B;  3KFW X;  3VB2 A;  5ILS A;  2QM3 A;  3GLX A;  1IRG A;  4IRI A;  2RC4 A;  1W7P D;  3GEZ A;  3JTG A;  1XSD A;  1FY7 A;  1V3F A;  4ENM A;  2MH2 A;  2NNN A;  4S05 A;  4HLX A;  3QRF F;  4WWC A;  2JTV A;  1REP C;  2HQR A;  3TQN A;  1U3E M;  1KQ0 A;  5ICG A;  2CW0 F;  1LVA A;  2HYF A;  2QZ8 A;  1ZRC A;  2UWM A;  3NRV A;  2HS5 A;  4AVP A;  2EB7 A;  2NAZ A;  5DCF A;  2K86 A;  3FXQ A;  3K1P A;  2QQB A;  2FBK A;  2STW A;  1WI9 A;  1KGS A;  1SFE A;  1Z7U A;  3RTR A;  3I59 B;  3FWE A;  4L18 B;  2P6S A;  1SFU A;  4UUV A;  2FE3 A;  1C0W A;  1ODD A;  3S2W A;  4HX7 A;  3HOT A;  3C7J A;  2ESH A;  3KP4 A;  5L3F A;  3PQK A;  2ZJ2 A;  4ZZD A;  2A3S A;  3WE2 A;  4CHU A;  5IT3 A;  2QBY B;  2VON A;  3U2R A;  2F5D A;  1IN4 A;  1BI0 A;  2EV0 A;  4N9I A;  4ENJ A;  1NHA A;  1OYW A;  2FA5 A;  4OMZ A;  3WTV C;  3E5U A;  3C18 A;  1SFX A;  1X3U A;  1ZYR F;  2OBP A;  4U7B A;  5TRD A;  2IA0 A;  3JAM K;  3IHU A;  4U0W A;  1YS7 A;  4IRG A;  4HQE A;  1BIA A;  2DLL A;  2XV4 S;  1KYW A;  4I02 A;  2IT0 A;  4OMY A;  3NEU A;  5K5Q A;  3ZPL A;  3HSE A;  5HDN A;  1UB9 A;  2EWN A;  3JAM Z;  2BGC A;  1G3T A;  1Z6T A;  1F4K A;  1O3R A;  3V8K A;  3U1D A;  3GYH X;  4LG0 A;  3LA3 A;  1OR7 A;  5AIQ A;  2GXB A;  4AD9 A;  4WF2 A;  1OPC A;  1IUY A;  3ECH A;  2QEN A;  5DD4 A;  3H92 A;  1B9N A;  2BYV E;  3WOD F;  4UV9 A;  3EDP A;  2DT5 A;  2L54 A;  3KZZ A;  2O8X A;  1JHH A;  1T39 A;  2OZU A;  2X0L A;  1O7F A;  2NNY A;  1JGS A;  3K0L A;  2IPQ X;  2HKO A;  2BE5 F;  3CJN A;  2H27 A;  2MBF A;  2AXL A;  4M9Z A;  1TW2 A;  2ZCW A;  4RGU A;  2EFW A;  1HQC A;  3E6B A;  2HTJ A;  2EJR A;  1KU2 A;  2NRA C;  5HDK A;  1PDN C;  3MZY A;  3BPX A;  4GXO A;  4U88 A;  2ZBK A;  3EQL F;  3K2Z A;  4KN4 X;  2YR2 A;  2VE8 A;  5CJ9 A;  5J6X A;  5ILV A;  2OZ6 A;  1W7P B;  1TQI A;  2FF4 A;  5FB2 A;  5HDG A;  2O0Y A;  3FM3 A;  3LAP A;  1T6S A;  3HUG A;  3VOD A;  1B4A A;  2KKO A;  4HLY A;  2M87 A;  4WXD A;  3RKY A;  1HW5 A;  2E7X A;  2XAG A;  4HV6 A;  1Z9C A;  1R1V A;  4HF0 A;  2WTE A;  3LFK A;  4I0B A;  1FYL A;  1YFH A;  3LQR A;  4KIG A;  4CXF A;  4G7H F;  4P55 A;  4I2O A;  5CVI A;  4LK0 F;  3SZT A;  2KIF A;  1W4M A;  2D2W A;  3V8L A;  5FLX K;  4P9U A;  3F23 A;  2F5E A;  3CLO A;  4AIH A;  4KIF A;  1KQ9 A;  3H3U A;  2A07 F;  1RNL A;  3ERE D;  5E1Z B;  3H3Z A;  2M5W A;  2CGP A;  3E5Q A;  2LNB A;  3W6K B;  3LST A;  3L09 A;  3LA7 A;  1IN7 A;  1F9N A;  3TO9 A;  5E17 F;  5LRR A;  3GWZ A;  3WTW C;  2CWE A;  1SD7 A;  3QU3 A;  3KP7 A;  4YFN F;  3J81 Z;  1XGS A;  3F6V A;  4ETS A;  1XMA A;  4ZYD A;  2Y75 A;  4KFC A;  3P9I A;  4WX9 A;  4HOB A;  1DPU A;  2H94 A;  3T0Y A;  5ICC A;  1S29 A;  3BJA A;  4DNC A;  5HLH A;  2DPU A;  1JXS A;  2EK5 A;  1MJB A;  1R1T A;  4BHB A;  5AIP A;  4BQA A;  1U5T A;  1XCB A;  2IRF G;  4KN7 X;  2MC3 A;  4UXN A;  2H6C A;  2W57 A;  1QZY A;  3GW2 A;  5ILU A;  2IA2 A;  1WKM A;  5JR3 A;  1KU3 A;  5D5W B;  2GZW A;  1IN8 A;  1S8N A;  1R1U A;  1BM9 A;  2HKX A;  2M8E A;  5D6F A;  4I7H A;  1MDM B;  2QWW A;  4D0P A;  3FXU A;  5BOX A;  1UST A;  5KVR A;  2E7W A;  3CTA A;  1UHM A;  3F8F A;  3T5X A;  3JSP A;  1XDS A;  3IL2 A;  4Y13 A;  4G6Q A;  2FNP A;  2KIM A;  4AWX B;  1J7K A;  3VOE A;  4BYY A;  4IF4 A;  4ZYE A;  1HST A;  1S6L A;  2UZK A;  1BI2 A;  1AWC A;  1O3T A;  4EGY A;  2G9W A;  1OYI A;  3SZP A;  2J5P A;  3TKY A;  3QOP A;  1T98 A;  2A6H F;  2A68 F;  3VEP A;  5D5X B;  1UHW A;  3R0J A;  5D8L B;  2QYO A;  1KA8 A;  5EEG A;  5J8F A;  2RKH A;  1U6G A;  1H9G A;  3HRM A;  4HF1 A;  4OIN F;  2P5K A;  5DD8 A;  1XDU A;  1U2W A;  2Z99 A;  2GWR A;  2DK5 A;  3FM5 A;  2M45 A;  1ZAR A;  1GXP A;  5CVU A;  4NHJ A;  3M8E A;  4HBL A;  4YFX F;  4BHP A;  2W24 A;  2EA4 A;  4JK1 X;  2HGC A;  4KMF A;  1PP8 F;  4YII A;  3I0T A;  3KP3 A;  3HTS B;  1ZRE A;  1YW9 A;  3E3V A;  4Y15 A;  1K79 A;  2HYG D;  1IW7 F;  1BC7 C;  4OIR F;  2DO7 A;  3O6B B;  1K78 B;  1G3S A;  1ZG5 A;  4HZF A;  3M9A A;  3R60 A;  2IVM A;  4M9X A;  4I09 A;  1O57 A;  4OIO F;  2V1U A;  5EEH A;  4M73 A;  4UVA A;  4A2U A;  5LRS A;  2CG4 A;  1R22 A;  2ACJ A;  4RB3 C;  3JW4 A;  2KIU A;  2PFB A;  3IC7 A;  4M72 A;  1QPM A;  5A2Q Z;  5L3B A;  5L3D A;  3IWF A;  2LF7 A;  4U0Y A;  3HRU A;  1SD6 A;  3HYI A;  1O7L A;  4G9Y A;  2LSO A;  5BS6 A;  2X4H A;  1JHF A;  5DUI A;  2V1X A;  2Y0M A;  2LF8 A;  2PBI A;  3DPT A;  4RB2 C;  3HSF A;  1G4D A;  1ZLK A;  1ONV A;  4CIC A;  3I5U A;  3M8F A;  4UHT A;  1SMT A;  2EFN A;  3ISP A;  2OQG A;  2ADU A;  1RUO A;  5H20 A;  4BXU A;  4WXH A;  3W6J B;  3V8J A;  5FO5 A;  2G7U A;  1ZH5 A;  4FT8 A;  2VOO A;  2RQP A;  4PGH A;  1ZGJ A;  3HTU A;  4P96 A;  4PCQ A;  1ZRD A;  3HOS A;  5FD6 A;  5F64 A;  2DQL A;  4IXA A;  3KEO A;  3F8B A;  2J5O A;  3DKW A;  4O5V A;  1R58 A;  4Q48 A;  4K2E A;  2VN2 A;  3I64 A;  1RUN A;  1ZRF A;  2IW5 A;  1K6O A;  3BJO A;  3FHZ A;  1XSX A;  3F8M A;  3IRQ A;  2KRF A;  3ELK A;  1ON2 A;  4A0Y A;  4Q5S F;  4KIB A;  2RVC A;  1HKQ A;  2UXN A;  3DEU A;  4LK1 F;  5LLQ A;  1EH8 A;  3J80 Z;  5LEJ A;  3ECO A;  3R4K A;  4YFK F;  2W84 A;  3IKV A;  2ZNZ A;  5L3C A;  3ZMV A;  2RV8 A;  3ROU A;  4HDU A;  3D0S A;  1I27 A;  4HDV A;  3MCZ A;  3E6D A;  4YG2 F;  4XLN F;  2A69 F;  1B6A A;  2L3D A;  4LFU A;  1ON1 A;  2ZKZ A;  3MEX A;  2VBZ A;  3IKT A;  1U78 A;  2WC2 A;  2A61 A;  3D5L A;  3WTU C;  1Z91 A;  1TLH B;  5DV5 A;  4B09 A;  3IWZ A;  2DFI A;  1J59 A;  4RAY A;  1T38 A;  1LDJ A;  1OYY A;  1S3J A;  2H6B A;  2GA2 A;  2XKP A;  2AS5 F;  1F1Z A;  4PGG A;  5HLG A;  2PMH A;  2CQK A;  3FMR A;  3N97 A;  2PQ8 A;  2H09 A;  4HX4 A;  4M71 A;  4G94 A;  2UXX A;  1LB2 A;  3MZH A;  4A0Z A;  3BPV A;  3E97 A;  3L2C A;  1DP7 P;  4GO1 A;  4N0B A;  2LKP A;  3ML6 A;  4Y17 A;  1FP2 A;  3FX3 A;  1P92 A;  4L0Y B;  1R7J A;  2VXZ A;  1YLF A;  3I58 A;  3HHG A;  3DQV C;  1FBQ A;  3GF2 A;  1DPR A;  1YS6 A;  1PP7 U;  3KP6 A;  5BMZ A;  2DW4 A;  4PZJ A;  1G3W A;  3KE2 A;  4O3M A;  4HAM A;  2V9V A;  2QUF A;  5ED4 A;  3CUQ B;  2ZME A;  2Q0O A;  3LA2 A;  2JPB A;  3OOP A;  3HSR A;  4FX4 A;  2NYX A;  5DUK A;  4ZZL A;  5DDG A;  2PEX A;  1XGM A;  2ZXJ A;  3E6C C;  4ON0 A;  2D1H A;  2FRH A;  1WRJ A;  3DPL C;  4RGX A;  3E6M A;  2MLG A;  4KMU X;  2PJP A;  5HLI A;  2PG4 A;  3QPT A;  4HA8 A;  3KP2 A;  2HEO A;  3ABT A;  5E8G A;  5FFZ A;  4OU0 A;  4MHG A;  4PDK A;  4CZZ A;  4XBF A;  4P9F A;  5BPI A;  4CDG A;  4ZYH A;  4UVC A;  2C6Y A;  2GXG A;  4G7Z F;  3RI4 A;  1HKT A;  2JPC A;  3T8R A;  4RAZ A;  3GFL A;  4RB0 A;  4HW0 A;  1KU9 A;  2FU4 A;  5DEQ A;  2VBY A;  3N4M A;  1I1G A;  2F5F A;  1GVJ A;  2L4A A;  4YIF A;  3F6O A;  1CF7 A;  1FBU A;  2FXA A;  4CO8 A;  4L0Z B;  2TDX A;  1BIB A;  2L02 A;  4E70 A;  5D5U B;  2Z9O A;  4LLL A;  5FD5 A;  4ESF A;  5IT9 Z;  4B8X A;  4I01 A;  4BH9 A;  2YX4 A;  1LDK B;  3F8N A;  3J81 K;  3VFZ A;  1IRF A;  1BOA A;  2YPR A;  1B9M A;  2Z5U A;  4A5M A;  3V7R A;  1R36 A;  5LGU A;  1HKS A;  1TNT A;  2OAZ A;  1O3S A;  2OD5 A;  5HOO A;  2EV5 A;  1TNS A;  4JBA A;  3WGI A;  1FWZ A;  1WQ2 A;  3COA C;  4WK8 F;  3CDH A;  3T8T A;  1HXD A;  4MEY F;  3BDD A;  1SMY F;  2FEZ A;  3AAF A;  1ZLJ A;  2DPD A;  3RIR A;  2V79 A;  1R23 A;  1FOK A;  1YO5 C;  3KZY A;  1RI7 A;  1MGT A;  1BBY A; 
#chains in the Genus database with same CATH topology
 3DFG A;  1IXR C;  2A6T A;  2K5C A;  2L5Q A;  3TBI A;  3V7C A;  4QIW N;  4EGZ A;  1I3A A;  1HSJ A;  1IC8 A;  1J0R A;  1MMN A;  4Y4R A;  1T8I A;  2JZY A;  2K02 A;  4LG0 B;  2LBF A;  2Q2E A;  3SQN A;  3BG6 A;  2EZH A;  5H2F C;  2D1V A;  2DFE A;  2OUM A;  4S04 A;  2QLZ A;  2RGV A;  4A3M J;  1MMS A;  3FIS A;  3ZMS A;  1K7A A;  3G6E I;  2M35 A;  3WE3 A;  4X0G A;  2E1M B;  2H8W A;  3JSO A;  4OOI A;  2DDA A;  3WTZ A;  1VF9 A;  6PAX A;  2E71 A;  4KNY A;  4XON A;  1R9T J;  4ZTF A;  5H6R A;  4A93 J;  1UHS A;  3BTI A;  4A6D A;  3VSK A;  2OQR A;  5GAH J;  1STZ A;  2R7R A;  5LD2 C;  4E7H A;  5DCM A;  2QQ9 A;  4CCJ A;  2DOE A;  2I10 A;  1TWG J;  4A5N A;  2BXZ A;  2EIL H;  3CCR I;  4H0E A;  4UV8 A;  1XB4 A;  2M3A A;  1RET A;  3DPU A;  1WI3 A;  4CCO A;  2P81 A;  5GTI C;  4MEX F;  3VYU B;  3BTJ A;  5E18 F;  1XN7 A;  3CES A;  2DA5 A;  4FX0 A;  3TOB A;  5AON A;  1OLT A;  3L2W A;  4DYQ A;  2Z1D A;  4F55 A;  2AXT C;  1R5G A;  2HQN A;  3IP4 B;  3I4P A;  4IRH A;  2N8G A;  5JHU A;  1Z6R A;  1MBG A;  1MJ9 A;  4NC8 A;  1W0U A;  2FUG 2;  4EJW A;  3CF5 F;  5L3G A;  2ZO4 A;  5HVQ C;  2DBB A;  4C2U A;  1UMQ A;  1DUX C;  3KLO A;  3DV8 A;  4P5O A;  4XRF A;  2L9N A;  1TTY A;  1QA6 A;  4RB1 A;  1VQP I;  1KQ8 A;  2BW3 A;  4A0X A;  4F92 B;  1POG A;  3HOZ J;  1S7A A;  3JRB A;  2FBH A;  4MQ9 F;  4C9Y A;  1BC8 C;  4L5E A;  4Z2Y A;  4Z6Y A;  3HOY J;  4IPA A;  3P9C A;  2L7Z A;  3J7A W;  1UFM A;  1HCR A;  4BXF A;  1YQA A;  5L3E A;  3NQO A;  2E1N A;  3S8P A;  3OYH A;  3BZ6 A;  3H1C A;  2F2E A;  3H5N A;  4E7K A;  5D4S A;  2R7X A;  3LAJ A;  1X4P A;  1VTN C;  3I59 A;  5F0C A;  2P6T A;  2CS3 A;  4RGR A;  4ZDL A;  2V9P A;  3HUG B;  5JFR A;  3R6S A;  3QP6 A;  3N05 A;  4DQ2 A;  4HNU A;  3OYI A;  5CVJ A;  4L5J A;  1X3Z B;  1T2K A;  3FXJ A;  1AHD P;  2HDC A;  1FLI A;  1FSH A;  1SFO J;  1FBS A;  4EM0 B;  2DOF A;  4EV0 A;  1VFC A;  4M6X A;  2XUB A;  1XG1 A;  4A3G J;  3SFI A;  1TWF J;  1HLV A;  2WAD A;  2M8G X;  2BEO A;  3K1N A;  4M74 A;  2E5N A;  2KFD A;  3EYI A;  3JRF A;  3GTO J;  3OR2 C;  5A2Q R;  4HSR A;  2QBY A;  3LOC A;  1EKE A;  3A03 A;  4L9V A;  3WU2 C;  2DFF A;  3KET A;  1XMK A;  1MBH A;  2QGU A;  2F4O B;  2R7D A;  4I98 B;  3ULQ B;  2WWY A;  2EFP A;  4IHV A;  2XSD C;  3UR3 C;  3GFM A;  1JKQ C;  5CVR A;  3JTH A;  2Z33 A;  1T0F C;  1V4R A;  4ZYG A;  1BW5 A;  3EYY A;  5A2Q K;  1B59 A;  2G7H A;  2KDO A;  3C2G A;  1MBF A;  4LD5 A;  3WU0 A;  4IOC F;  1EH7 A;  1A04 A;  3V4G A;  3J7Z I;  3LQQ A;  5IPA A;  5HS8 A;  1WJE A;  2PI0 A;  2BBY A;  1SC7 A;  2EA2 A;  1J2X A;  1MJA A;  3W3C A;  3BLY A;  5FRO A;  1LUJ B;  1HA8 A;  3UNG C;  3SHF A;  4EM1 A;  4HEA 2;  1QNT A;  3WTS C;  2DI3 A;  3I71 A;  2BZT A;  2IS4 A;  3LSM A;  5FRN A;  5CKT A;  2HWV A;  1FNN A;  3RKW A;  2ZJR F;  1UEL B;  2P7V B;  5IOY A;  4ABZ A;  1WSU A;  1UZC A;  2VBW A;  2CO5 A;  2K4J A;  4JP0 A;  1P2F A;  3EUH A;  4HNT A;  3S2H J;  3HRS A;  2STT A;  1PUF A;  1HW2 A;  2LVS A;  2BV6 A;  5F27 A;  1OIS A;  4HYE A;  4GFB A;  2FQ3 A;  3D1N I;  3NAR A;  4XN3 A;  2ZXW H;  4KYW A;  1L0O C;  4RGS A;  4F93 B;  2NS0 A;  2WBM A;  5CVV A;  1I1S A;  2X98 A;  3OWT A;  1Z1D A;  4PSW A;  5DM7 F;  3EUH C;  4IO9 F;  2LD5 A;  2P8T A;  3ZMU A;  2VT3 A;  1LFP A;  5CYV A;  1X1P A;  1T08 B;  2DMT A;  3K4N A;  2VOD A;  2JSC A;  5KCM A;  1OMI A;  2FNA A;  3CC7 I;  2L9S A;  3BR0 A;  4NB5 A;  3J7Y J;  5K5R A;  1SEU A;  1U5T B;  1IF1 A;  2CUF A;  2CRG A;  5FKL A;  3DEE A;  3RDI A;  5IYC J;  5JVG F;  2DTR A;  5KK1 A;  1XX5 A;  3P5J A;  1DU0 A;  3G1L A;  3O2P E;  5ICF A;  1T95 A;  4IHS A;  2NVX J;  3W6V A;  1V5G A;  2XKO A;  3K9T A;  4O6J A;  1YRN B;  2KJB A;  3Q9S A;  3ZMT A;  4OIP F;  3HOU J;  1Z05 A;  3RKX A;  2MZ4 A;  2RQQ A;  1RZ4 A;  3GX4 X;  2PMZ N;  5K5O A;  2F4I A;  2BOL A;  4XLP F;  1XCV A;  2F5V A;  3L00 A;  1EH6 A;  1WJC A;  1E0E A;  3GLL A;  1ZR4 A;  5IP7 J;  3BT9 A;  3J80 R;  2WV0 A;  3MQ0 A;  5K7F A;  3CDL A;  4BAC A;  2X9D A;  5BQT A;  2GQQ A;  5BPD A;  1D5V A;  3FXR A;  3S3O A;  3LWF A;  3IAM 2;  2MA3 A;  3BCB A;  1VQO I;  4ENK A;  2ZSI B;  4W97 A;  3J7A Y;  3FIW A;  2XIG A;  5CQE A;  4DJA A;  2XPU A;  4Y52 J;  3JCU C;  2KZG A;  2ELK A;  1VQ5 I;  4A3D J;  3I3L A;  5HS7 A;  5LHH A;  2A5W A;  2L9R A;  1YW7 A;  2XB0 X;  3J80 K;  3DP7 A;  5GAE J;  5TIS C;  4WCG A;  2P5L C;  1YIT I;  1NH3 A;  2VT2 A;  3CO7 C;  1A6Q A;  3W2V A;  1FPQ A;  1IN6 A;  3FKI J;  4KIC A;  2IS1 A;  3F8C A;  3M07 A;  1DQU A;  1WPK A;  1FYM A;  1KON A;  2LY2 A;  4LIV A;  2JJ7 A;  2IP2 A;  2O3F A;  2VQL A;  4BL0 B;  4UY8 I;  2ME0 A;  3K4C A;  2MLK A;  2KZV A;  1W7P A;  4QPO A;  2CV1 A;  4RM2 A;  2LFB A;  5LGN A;  3K1M A;  1LDD A;  2K9L A;  4KUM A;  3MFK A;  4ANJ A;  4XSX F;  1IXS B;  1XMX A;  1WJF A;  3GFI A;  4PJJ A;  2BHZ A;  1MD0 A;  4XLC A;  4N4O B;  3S1M J;  3CZ6 A;  3LL7 A;  5IOZ A;  3GZ5 A;  1LJ9 A;  3EUA A;  1ZK8 A;  4B43 A;  2V6E A;  1OCO H;  2OU2 A;  3DXJ F;  2A6E F;  2FBI A;  3KCC A;  5GAD J;  1VQ9 I;  1E17 A;  5LBQ A;  3ESW B;  3SXY A;  5B5E C;  3S3N A;  2YSR A;  3ONQ A;  3ZQG A;  3SFZ A;  3OMY A;  2Q8K A;  4CH7 A;  1NTC A;  1I6X A;  2WB1 A;  5CLS A;  5J4V A;  1JUS A;  3S17 J;  4DZP A;  5HLT A;  2CV2 A;  2F4M B;  2W48 A;  3ZQQ A;  3TDZ C;  4B1R A;  2EFO A;  5FFX A;  4AIJ A;  1KU7 A;  2HFH A;  1ZHF A;  5J8C A;  1D0Y A;  5KAF C;  5DYM A;  4D5F A;  3F72 A;  4TV7 A;  2YUS A;  2XRN A;  3HHH A;  3F3X A;  3PFI A;  4UUS A;  3H3V K;  2DT6 A;  1EV7 A;  4LJZ F;  3RYP A;  4C2T A;  1BL0 A;  5M3F J;  3ZMZ A;  3C2B A;  3L1P A;  2MC4 A;  1ZG3 A;  4MTD A;  5C4X J;  3TO7 A;  4AVZ A;  4I0A A;  5EGO A;  1LNW A;  4QTR A;  4DYR A;  1ZN2 A;  2XAF A;  4M6Y A;  3PO2 J;  3TDU C;  3J7A O;  1CQT A;  1QVU A;  1F5T A;  3DBR B;  1M1E B;  5M5X J;  5F1R A;  2ZB9 A;  1QO0 D;  2CYY A;  4NQW A;  3HXL A;  3H9G A;  3E5X A;  4BEH B;  1B8I A;  3FZV A;  4LB5 A;  2X1C A;  3BWG A;  2WY8 Q;  4G6D A;  1BOB A;  3HIF A;  3PQJ A;  1J9I A;  1TBX A;  2VJ5 A;  1S72 I;  2BVM A;  4OAY A;  3WHB A;  2QQA A;  3KPH A;  3HZJ A;  5K1Y A;  3OS1 A;  4XSZ F;  3QP5 A;  3PO3 J;  1JUP A;  1OCP A;  2K4B A;  2M30 A;  2RNG A;  2EBI A;  1J75 A;  1FSE A;  3CO6 C;  2W82 A;  3RYR A;  4CCL A;  2M4K A;  2M7B A;  4L9J A;  5JVT A;  5H6Q A;  4F52 A;  2Y48 A;  1XGO A;  5ERI A;  3M7G A;  1IV8 A;  5HS9 A;  3Q0V A;  2JVH A;  2UUZ A;  2R3S A;  3OL3 A;  1LE8 A;  1FZP B;  4CYC B;  3MWM A;  2DJN A;  2VC0 A;  2HTS A;  5JI6 A;  3OYD A;  4N4N B;  3X2Q H;  2JUC A;  3HRT A;  1YW8 A;  2OCC H;  5M5Y J;  2X6X A;  3Q5F A;  2FML A;  3BZC A;  4ESB A;  2M2E A;  4DZJ A;  2RDP A;  1X3W B;  3BR3 A;  1P4A A;  3T1B A;  1MDM A;  4AID A;  4OIQ F;  3H36 A;  3ZN1 A;  3RKQ A;  2K3P A;  5E3N A;  2DXI A;  3GUD A;  1YHQ I;  4HF2 A;  1Y1V J;  4YIR X;  2JRT A;  3JR9 A;  3ERM A;  2QVO A;  1LVK A;  4LB6 B;  4M3D A;  4GCV A;  2KHM A;  2VOP A;  2VQH A;  2Z16 A;  2XAH A;  3S2D J;  3LSP A;  5EJC A;  3ZN0 A;  3DTK A;  2KJC A;  3CUO A;  3C2H A;  4CGZ A;  5LEK A;  1W5S A;  5BNG A;  4BQQ A;  2FMY A;  3OV8 A;  4UNO A;  1ETV A;  2DAO A;  1L3L A;  3TL4 X;  4E7S A;  3MAJ A;  4BAY A;  4FHT A;  3ZMD A;  1H8A C;  2CUZ A;  1ZGW A;  2XAS A;  1UCR A;  2OC6 A;  2WAE A;  1QZZ A;  5DTD A;  5C4J J;  3JRA A;  2VE9 A;  1V5F A;  1IXC A;  1PYV A;  3B02 A;  4EM2 A;  5LGT A;  2RNJ A;  3AG4 H;  3FF5 A;  4UB6 C;  5B3S H;  3A01 A;  1QGP A;  1TT0 A;  3LSH A;  5TGT A;  1I3Q J;  1LFU P;  3GZN B;  1RRJ A;  1SD4 A;  2NXN B;  3C1D A;  3WGG A;  1K61 A;  4B44 A;  3KEQ A;  5FGM A;  3WGH A;  3KP5 A;  1D1B A;  2DOD A;  5E79 C;  4L9T A;  4XLH A;  4EAT A;  2KIS A;  5IT9 R;  3GZ6 A;  2A5Y B;  3TW6 A;  2B7E A;  5K7H A;  1IN5 A;  2CH0 A;  5GAG J;  1YX5 A;  1X58 A;  2V26 A;  1TC3 C;  2B63 J;  1NG7 A;  2DJI A;  3HJE A;  1UG0 A;  2OA4 A;  3K7A J;  4XQF A;  4BJ6 C;  2AQE A;  3O3K A;  5IT9 K;  4UVB A;  1W36 D;  2H8R A;  1Q1H A;  3DF8 A;  2HI3 A;  5LHI A;  1G59 A;  3EET A;  2YU9 J;  5HNF A;  4GGG A;  2VXD A;  2PX9 A;  5ICE A;  4BS9 A;  2WAQ N;  5E20 A;  3R0A A;  2ETH A;  2HR3 A;  2Z3Y A;  1U8R A;  1DDN A;  4BHC A;  2XC7 A;  3FBI B;  1I6H J;  3FMQ A;  4BDY A;  5E1W A;  3CCQ I;  1TP4 A;  3J81 R;  3BY6 A;  3HG9 A;  1LFB A;  4R1H A;  1B72 B;  4MIM A;  1I5Z A;  2IJL A;  3OR1 C;  3VYR B;  3D5R C;  1FOY A;  2ZFW A;  4BBR J;  1GXQ A;  1TWC J;  1LEA A;  2XRL A;  3B6C A;  3P7N A;  1BI1 A;  3WU1 B;  2QQ8 A;  3E7L A;  2CQ7 A;  3UKG A;  1E2X A;  2R4G A;  2KIQ A;  1KYZ A;  3ZGK A;  3OY9 A;  2O6G E;  2R92 J;  5D4R A;  1WH5 A;  4BUP A;  1FX7 A;  1K78 A;  1BJA A;  3F9K A;  4PJL A;  1USS A;  4CZC A;  3DLL F;  2F5C A;  2WA0 A;  3IH2 A;  4M3B A;  3TO6 A;  1VQ6 I;  3R61 A;  2LG4 A;  2E2J J;  2ISZ A;  4A12 A;  1MMD A;  1A5J A;  3Q9V A;  2PMU A;  4HQM A;  3RPQ A;  3TOA A;  5FLV A;  2K9Q A;  1F43 A;  2XGX A;  3ZQ7 A;  3K2A A;  2L01 A;  4D1Q A;  1X1C A;  2X85 A;  2R7W A;  4GYI A;  3CC4 I;  2ESN A;  3HBL A;  4H4K C;  2O9L A;  2VL8 A;  4A3I J;  4G7O F;  2TRT A;  1MZB A;  1IAW A;  2OJE D;  5D6E A;  4Y3O A;  5FLX Z;  2PMZ A;  4BDZ A;  1A31 A;  3D5S C;  1OJL A;  2Y9Y A;  4KDP A;  4XNF A;  1OCC H;  1RKT A;  1I50 J;  1SVM A;  3ABU A;  1QHG A;  2GAU A;  3OYE A;  3REO A;  2ZFU A;  1WGX A;  2O61 A;  3H5R A;  4AM3 A;  3F21 A;  1SAX A;  4EJO A;  3LSR A;  2AO9 A;  1K4S A;  2JA5 J;  2O03 A;  4R8H A;  3G73 A;  2R7Z J;  5JLW A;  3WTX C;  2OTJ I;  2QKL B;  5GPA A;  1ZTR A;  3CJR B;  3AL0 C;  4R79 A;  2JN6 A;  5E8I A;  3WG7 H;  3P9K A;  3S3M A;  2R7V A;  1FEX A;  2B0L A;  3QOE A;  1W5T A;  2QCO A;  3KYL A;  2FSW A;  1BN5 A;  4D7N A;  4G8X A;  4KT5 C;  3TP3 A;  2YU3 A;  2XAJ A;  3B73 A;  1PUE E;  1MMG A;  3E1S A;  2P4W A;  2JWT A;  2VKE A;  1MBK A;  4EVI A;  4II2 A;  2DA1 A;  4LLG F;  1H9T A;  1MBJ A;  2XF7 A;  1YTY A;  2DCE A;  3G1M A;  3PNT A;  1D8K A;  4F91 B;  1MKM A;  1O3Q A;  1SVO A;  2EFQ A;  3I53 A;  2ZSH B;  2P5V A;  1U9N A;  2VBX A;  3QPL A;  5LHG A;  3CCE I;  3KEY A;  2XAQ A;  1U5T C;  5EZG A;  2AQF A;  2RN7 A;  2X6Y A;  1QQI A;  3NAU A;  3I54 A;  2ZME B;  3H35 A;  4NC6 A;  5HOD A;  2XPW A;  3ZP5 A;  1DGR M;  1N77 A;  2LDU A;  2E35 A;  3EPZ A;  4E6K G;  1IZ1 A;  2ZJQ F;  3ZQF A;  1B1B A;  5J1U A;  3BG3 A;  3RJP A;  4ZJZ A;  3V7S A;  4AIK A;  1W5C C;  1G3Y A;  3S32 A;  4DW6 A;  1GT0 C;  2BHY A;  1D3Y A;  3PJR A;  3GXO A;  1V54 H;  4YEL A;  2V6C A;  2XDV A;  1Z3Y A;  4ZH4 F;  4A6E A;  3CME I;  1TQP A;  1FC3 A;  1IGN A;  4MNU A;  1ZG1 A;  2KPM A;  2ME6 A;  2DK8 A;  4RAF A;  1XD7 A;  1PJR A;  1WWX A;  4PUS A;  4N9H A;  2ELH A;  2KMU A;  3M1E A;  1HC8 A;  1JKR C;  3CP2 A;  1JTY A;  4V19 K;  5GP9 A;  2CSO A;  4M9S A;  1D8J A;  1ULY A;  3QPS A;  2CJJ A;  2XGD A;  3K4J A;  3BRO A;  2GIV A;  2XRO A;  5B1A H;  1E3P A;  1XSV A;  4RS8 A;  5J40 A;  2E1C A;  2MH9 A;  4BY1 J;  1SD5 A;  3VYS B;  5J4Y A;  2YX7 A;  2EV6 A;  5F6F A;  5KHD A;  5D5V B;  1R00 A;  2O7O A;  3QU6 A;  4MTE A;  3NWS A;  2P7C B;  3I4N J;  1YIO A;  3GVA A;  2COB A;  3L2U A;  1FP1 D;  2D45 A;  2JVG A;  5FKN A;  4IJA A;  4QWQ A;  1YYV A;  3BJ6 A;  4BQO A;  4AUX A;  3TGN A;  2PLY A;  5KNL A;  2NVU B;  2Y69 H;  2DT7 B;  1ZGA A;  3OOU A;  1DGW Y;  1OKR A;  2CFX A;  4U7D A;  1J09 A;  4MQV A;  2BY3 A;  5GPC A;  1P6R A;  3LSI A;  2E36 A;  4EMS A;  3U9G A;  4FAS D;  2CMP A;  3MN2 A;  1BR2 A;  2L4M A;  2M1B A;  2LRD A;  3L9F A;  3HOX J;  4L9N A;  3QAH A;  1SVL A;  2NS7 A;  3OYM A;  3FK7 A;  3H0D A;  2JA7 J;  3HKZ A;  1T0F A;  4EJU A;  1AOY A;  1P4W A;  3L2Q A;  4ZC3 A;  4AC0 A;  3GME A;  4JYK A;  1G8X A;  4HX8 A;  1CF7 B;  4Q4Z F;  2W25 A;  4XM3 A;  1DU6 A;  4L5I A;  3RPU A;  2VC1 A;  2W85 A;  5FRM A;  1HBX G;  2LTP A;  4IHT A;  1P4X A;  1HW1 A;  2XHK A;  3GFJ A;  2E1O A;  1FJL A;  2PJR A;  2NVQ J;  4Q47 A;  1Y56 A;  2HOE A;  2QF7 A;  1FT9 A;  1H0M A;  3WG9 A;  1FYK A;  4I76 A;  4J01 A;  1TW3 A;  4PSX A;  3WTY C;  1HOM A;  2LC2 A;  1EA3 A;  2X6W A;  1IV6 A;  3S1Q J;  4GYG A;  1EF4 A;  2V1D A;  1BI3 A;  3G3Z A;  1GHC A;  2XF6 A;  3OIP A;  4EJV A;  1XGN A;  2R7F A;  2DQR A;  4JQF A;  4ASN A;  2ICW G;  1Y0U A;  3DKY A;  1AKH B;  1QBJ A;  3KLN A;  3O8H A;  1EJ9 A;  2PN6 A;  3QOD A;  1N75 A;  5D8K B;  4F7Z A;  5M5W J;  1YG2 A;  4QLC U;  3G1O A;  4D9J A;  1JE8 A;  5TJJ A;  5EDN A;  3PUB A;  1X2N A;  1IDZ A;  3MKZ A;  4DBQ A;  3BZK A;  3QYF A;  2MD0 A;  3DWL E;  2IS2 A;  1WJA A;  3BOQ A;  1MH4 A;  4HNV A;  1D0Z A;  2K7L A;  1ZEL A;  2Z2S B;  5CPR B;  3O8G A;  2LH9 A;  1U8B A;  1X2M A;  2VQC A;  2WY7 Q;  3FXL A;  4QPQ A;  1R5H A;  3GO5 A;  1D0X A;  1J5Y A;  2V7F A;  2ZNY A;  4BY7 J;  4E7J A;  2FOK A;  2COM A;  3CCS I;  3QYB A;  1JJ6 C;  2M34 A;  5E1X A;  3C3W A;  2FOW A;  4BNC A;  2K27 A;  1X4O A;  2X48 A;  3L7W A;  5CQG A;  4UB8 C;  2DOA A;  3BP8 A;  2KRH A;  3IRR A;  3KYD B;  2IGO A;  4A3B J;  2LY9 A;  2JT1 A;  2GA1 A;  4IVN A;  4EJT A;  1LEB A;  1S7O A;  2W4S A;  3CUQ A;  4HV5 A;  4LMY A;  3MKW B;  3FMS A;  2R5Z A;  4ESJ A;  1U0J A;  2XSJ C;  1MSF C;  4LLN A;  4C3I J;  3FK6 A;  4LIU A;  5DM6 F;  4LGW A;  2LYC A;  2CFO A;  2Q2E B;  2KT0 A;  2LBF B;  4HG2 A;  2ISY A;  4V2G A;  2L7M P;  3CUQ C;  3K69 A;  3WTT C;  3BR5 A;  1KZH A;  2HZT A;  4KA4 A;  3F22 A;  4KJZ A;  3OYF A;  1RIO H;  1FOX A;  1CGP A;  2EPF A;  4B4C A;  4ENN A;  4U0V A;  2DU9 A;  2IA1 A;  1XPX A;  1TQM A;  4WXC A;  2JA8 J;  1OCR H;  4EQQ A;  1LQ1 A;  1GLN A;  1ZAO A;  2EIJ H;  3LFU A;  3SZG A;  2WAQ A;  3QPH A;  2GIZ A;  4MGR A;  4CYD A;  2MD5 A;  1G6N A;  2XVC A;  5DCM B;  3KFW X;  3VB2 A;  1YJW I;  5ILS A;  1DP3 A;  2QM3 A;  3RZD J;  3GLX A;  1IRG A;  4XKC A;  2DDB A;  2ID6 A;  1YJN I;  4IRI A;  2NVT J;  3S15 J;  4XID A;  2VQG A;  2RC4 A;  1W7P D;  3MZ8 A;  4YRV A;  3GEZ A;  3G4S I;  3JTG A;  1XSD A;  4BXX J;  9ANT A;  1FY7 A;  2Y0S N;  5EG0 B;  1V3F A;  2M7A A;  4ENM A;  2EZL A;  2MH2 A;  2NNN A;  1GDT A;  4S05 A;  5KAI C;  5F0H A;  3BC8 A;  4HLX A;  3A0B C;  3ZRG A;  3QRF F;  4WWC A;  2JTV A;  4BKX A;  1REP C;  3HOV J;  1T33 A;  2HQR A;  3TQN A;  1U3E M;  1KQ0 A;  1YI2 I;  3ZXS A;  5ICG A;  2CW0 F;  2K85 A;  3DEW A;  1YE9 A;  3HGG A;  1UG2 A;  4F3Q A;  2R5Y A;  1LVA A;  2DYR H;  4MLO A;  2HYF A;  2MUN A;  2QZ8 A;  4ZDP A;  4BE2 A;  2BW3 B;  3DBH B;  1ZRC A;  2UWM A;  3NRV A;  2HS5 A;  4AVP A;  1VQ7 I;  3GTL J;  2IAI A;  3MKL A;  3DTE A;  2EB7 A;  2NAZ A;  5DCF A;  4XK4 A;  2K86 A;  1P7I A;  3FXQ A;  2HVS A;  3K1P A;  2QQB A;  1JTX A;  2FBK A;  3GCM A;  1MH3 A;  3QWL A;  2STW A;  1WI9 A;  1KGS A;  5J1R A;  1A6I A;  5HNH A;  1SFE A;  1XC5 A;  1Z7U A;  3RTR A;  3I59 B;  1G2H A;  3BR2 A;  2VIX A;  3FWE A;  4L18 B;  2LKS A;  1MIJ A;  2P6S A;  4I99 C;  1SFU A;  4UUV A;  2FE3 A;  3M4O J;  1C0W A;  2NOJ B;  4DBR A;  1ODD A;  4C30 A;  3S2W A;  4HX7 A;  2MGQ A;  3HOT A;  5FKO A;  3C7J A;  2ESH A;  3KP4 A;  5L3F A;  1YIJ I;  3L2V A;  1I39 A;  1V55 H;  3PQK A;  3A4C A;  3QYE A;  2ZJ2 A;  1H89 C;  4ZZD A;  2VJI A;  1UJ8 A;  2A3S A;  3ABM H;  3WE2 A;  4CHU A;  1JJ8 C;  2E34 A;  5IT3 A;  4X6A J;  4HST A;  2QBY B;  2VON A;  3U2R A;  2R7S A;  1QRY A;  2GOX B;  2F5D A;  1IN4 A;  1BI0 A;  1K83 J;  2EV0 A;  4N9I A;  4B48 A;  4ENJ A;  2MSY A;  4BJT A;  4D5C A;  1NHA A;  1VQK I;  1OCT C;  2TCT A;  1D5Y A;  1OYW A;  2FA5 A;  3VWB A;  4OMZ A;  3WTV C;  2HQ5 A;  3E5U A;  1OQY A;  2R7T A;  3C18 A;  1FMV A;  1SFX A;  5IP6 A;  1H88 C;  2MG4 A;  1X3U A;  1BR1 A;  2HOT A;  1ZYR F;  2OBP A;  3LMM A;  4U7B A;  5TRD A;  3HOW J;  2IA0 A;  2EZK A;  3JAM K;  3ASO H;  3IHU A;  1ZR2 A;  1R71 A;  4U0W A;  1JI8 A;  1Z3X A;  2FX0 A;  1YS7 A;  2RAE A;  4IRG A;  3CP8 A;  4D7M A;  1FTT A;  4HQE A;  1WJ5 A;  1VQL I;  1BIA A;  3HKZ N;  2DLL A;  5E3O A;  2XV4 S;  2GOM A;  1WFX A;  1KYW A;  2XPV A;  3FHN A;  1Q1V A;  1IJW C;  4I02 A;  2IT0 A;  4OMY A;  3NEU A;  5K5Q A;  3ZPL A;  3HSE A;  5HDN A;  1GV5 A;  2H1K A;  1VI0 A;  3VPR A;  1UB9 A;  2EWN A;  2MVT A;  3SJM A;  2HU9 A;  3JAM Z;  1IUF A;  3I55 I;  3LNQ A;  3FXO A;  2BGC A;  3NWT A;  2CW7 A;  1PUF B;  4YEJ A;  5JHF A;  1G3T A;  1T56 A;  1Z6T A;  1YOV B;  1F4K A;  2JQ7 A;  4P1W A;  3GTG J;  1O3R A;  3V8K A;  3U1D A;  4M3F A;  3GYH X;  2F6C A;  1R49 A;  3W2A A;  4LG0 A;  3OIQ A;  3LA3 A;  3AKZ A;  1Z77 A;  1OR7 A;  5AIQ A;  3AFH A;  2GXB A;  3K4K A;  4AD9 A;  4WF2 A;  1VQ8 I;  1OPC A;  1IUY A;  3A0H C;  1IRX A;  2HDW A;  2QEN A;  3ECH A;  5DD4 A;  3S1N J;  3H92 A;  1B9N A;  2BYV E;  2KQR A;  4UV9 A;  3WOD F;  2ECB A;  4JX4 A;  3EDP A;  2LOO A;  2DT5 A;  2L54 A;  3KZZ A;  1OR7 C;  1QVT A;  3K70 C;  2QKM B;  3BG7 A;  2O8X A;  4IQ4 A;  3FXM A;  5GTH C;  2MW8 A;  2E1M C;  1JHH A;  2E2I J;  1T39 A;  4IHY A;  3Q3S A;  2OZU A;  3BR1 A;  2X0L A;  1O7F A;  2NNY A;  1JGS A;  3K0L A;  1JT6 A;  2IPQ X;  5IYB J;  2HKO A;  2L2O A;  2BE5 F;  3CJN A;  4XIC A;  2X6O A;  1FTZ A;  2H27 A;  1TWA J;  2MBF A;  2AXL A;  4M9Z A;  1TZL A;  1TW2 A;  2ZCW A;  4RGU A;  1MNM C;  4M3E A;  1RPW A;  2IGN A;  4G12 A;  2EFW A;  2FD5 A;  3VDX A;  1WJD A;  1HQC A;  2XF5 A;  3E6B A;  2NS8 A;  2HDD A;  3LSK A;  2HTJ A;  2EJR A;  1KU2 A;  2JRM A;  4BJ5 C;  4MO7 A;  2NRA C;  1W0T A;  5HDK A;  1WZ2 A;  1PDN C;  2HVR A;  3MZY A;  3BPX A;  4GXO A;  3K4L A;  4U88 A;  2DA4 A;  2K40 A;  3SYT A;  2ZBK A;  3EQL F;  4GDF A;  2KLO A;  2QSF X;  3K2Z A;  2E5Z A;  5FKM A;  4FCY A;  1VZ0 A;  4KN4 X;  3EUK L;  2YR2 A;  2VE8 A;  5CJ9 A;  5J6X A;  5ILV A;  2OZ6 A;  2ZXI A;  1W7P B;  3KZI C;  2HPM A;  1TQI A;  2FF4 A;  2JSP A;  5FB2 A;  5HDG A;  3KYC B;  2O0Y A;  3LSG A;  3FM3 A;  3LAP A;  3A02 A;  1T6S A;  3HUG A;  1K6Y A;  3VOD A;  2DMU A;  1B4A A;  2KKO A;  4HLY A;  2M87 A;  4WXD A;  2VKV A;  3RKY A;  1ETO A;  1HW5 A;  2E7X A;  2XAG A;  1HF0 A;  4HV6 A;  1Z9C A;  4NUB A;  2XB5 A;  1R1V A;  4HF0 A;  3HEF A;  2WTE A;  2E2H J;  3LFK A;  1A36 A;  1QZE A;  1RR7 A;  4I0B A;  2Y9Z A;  1FYL A;  1YFH A;  3LQR A;  5EEA A;  4KIG A;  4CXF A;  4G7H F;  2P0T A;  3JRG A;  4P55 A;  4I2O A;  5CVI A;  4LK0 F;  1QU3 A;  1WH7 A;  3PSF A;  4U87 A;  2DMQ A;  2DMP A;  3SZT A;  2KIF A;  4CCK A;  3JRI A;  3ZQH A;  2L7F P;  3OS2 A;  1W4M A;  2D2W A;  5DS9 A;  3HC7 A;  3CCM I;  3V8L A;  5FLX K;  1GUU A;  4DOZ A;  4P9U A;  2L0K A;  4KT6 A;  3F23 A;  3MVP A;  2EIN H;  2F5E A;  3CLO A;  3IH4 A;  4AIH A;  3OSG A;  4UUS B;  3HL2 A;  4KIF A;  1KQ9 A;  3DCF A;  2E60 A;  3H3U A;  2A07 F;  1RNL A;  4RLQ A;  4PJ0 C;  3ERE D;  1RKW A;  2VJJ A;  1Y8Q B;  3GTJ J;  2W00 A;  3MMY B;  1GVD A;  5E1Z B;  4RAG A;  3H3Z A;  3U1K A;  2M5W A;  5FKK A;  5EGO B;  2BY2 A;  3CCL I;  2CGP A;  3E5Q A;  2LNB A;  5F04 A;  3LST A;  3L09 A;  3W6K B;  3LA7 A;  3JRD A;  3CCV I;  1IN7 A;  4XRS G;  3I4M J;  1F9N A;  3TO9 A;  4XLA A;  3A52 A;  4XKV A;  1E3H A;  1Z7L A;  3IH3 A;  2OTL I;  5E17 F;  5LRR A;  1ENH A;  3GWZ A;  4RA2 A;  3WTW C;  1S5L C;  4NQW B;  2CWE A;  4BQN A;  1SD7 A;  1ETW A;  3QU3 A;  3KP7 A;  1B8I B;  1ETY A;  4YFN F;  2MAB A;  4XLF A;  3J81 Z;  1XGS A;  5EF6 A;  3F6V A;  4A3F J;  4ETS A;  1XMA A;  4ZYD A;  2Y75 A;  4KFC A;  3ZQI A;  3BQZ A;  3PM1 A;  3P9I A;  4WX9 A;  3FBN B;  4W1U A;  3GTP J;  4ZYA A;  1OCZ H;  4HOB A;  1DPU A;  2H94 A;  3T0Y A;  4KIS A;  5ICC A;  1S29 A;  3BJA A;  4DNC A;  5LFA A;  5HLH A;  2DPU A;  2Y0S A;  4PJN A;  1JXS A;  2EK5 A;  1MJB A;  1TWH J;  4J19 A;  3AG1 H;  1R1T A;  4BHB A;  1X1B A;  4XOP A;  5AIP A;  4BQA A;  3OYC A;  1U5T A;  1XCB A;  3HGY A;  4KN7 X;  2Y31 A;  2MC3 A;  1LE8 B;  2IRF G;  2KL4 A;  5FLM J;  4UXN A;  2H6C A;  2W57 A;  1QZY A;  3GW2 A;  5ILU A;  2IA2 A;  1WKM A;  4AYB N;  3SEQ A;  1N78 A;  2NVY J;  1YRN A;  2OCE A;  1AU7 A;  5JR3 A;  1KU3 A;  4B47 A;  2GZW A;  5D5W B;  1IN8 A;  1S8N A;  1R1U A;  1BM9 A;  1Y1W J;  2HKX A;  2M8E A;  5D6F A;  4I7H A;  1MDM B;  2QWW A;  3OYB A;  2LRE A;  4D0P A;  3FXU A;  2HYJ A;  1O4X A;  1XTA A;  5BOX A;  1UST A;  4ITV A;  1VQN I;  4Y33 A;  3OS0 A;  5KVR A;  2E7W A;  3CTA A;  1UHM A;  3SEZ A;  4BGD A;  2HPI A;  3S93 A;  3F8F A;  2CQX A;  3T5X A;  3JSP A;  1RC9 A;  3E0J B;  4X1E A;  1XDS A;  3V42 A;  3K10 A;  1JUM A;  2LLK A;  3IL2 A;  3PIP F;  4Y13 A;  4G6Q A;  2FNP A;  2K9S A;  2KIM A;  3CMM A;  1J7K A;  3DKX A;  3VOE A;  4AWX B;  4XN0 A;  4BYY A;  5K7Z A;  4IF4 A;  2BY0 A;  4II3 A;  5EG0 A;  4ZYE A;  1FMW A;  1K4T A;  4FQG A;  1HST A;  1S6L A;  5EZH A;  1R4M B;  4MFD A;  3KX2 A;  1RES A;  4GRI A;  2UZK A;  2QA4 I;  1BI2 A;  2HZD A;  1AWC A;  2DA6 A;  1O3T A;  4EGY A;  1WVR A;  2G9W A;  1OYI A;  3ZCO A;  2WV1 A;  3SZP A;  3M8J A;  3A01 B;  2J5P A;  1D1A A;  4M3G A;  3TKY A;  4B3A A;  2EIM H;  3QOP A;  1T98 A;  2A6H F;  2DA2 A;  3OYG A;  2A68 F;  2EH3 A;  3VEP A;  5D5X B;  1UHW A;  3R0J A;  5D8L B;  2QYO A;  4QSH A;  3FKJ A;  1KA8 A;  4IHW A;  5EEG A;  5J8F A;  2RKH A;  1U6G A;  1H9G A;  3HRM A;  4HF1 A;  1MBE A;  2DMN A;  2IGM A;  4IOA F;  3SDG A;  1XS9 A;  4OIN F;  2LR8 A;  5F08 A;  2P5K A;  5DD8 A;  2CQN A;  3BQY A;  1XDU A;  1U2W A;  2Z99 A;  2GWR A;  2DK5 A;  2KRC A;  3FM5 A;  2M45 A;  5F0F A;  3A2K A;  1W1W E;  1ZAR A;  2VKD A;  2LK2 A;  1GXP A;  5CVU A;  4NHJ A;  3RPU D;  3MD2 A;  1NG6 A;  3M8E A;  2A05 A;  5J3L A;  3BTL A;  1MND A;  3CD6 I;  4BE1 A;  3FDY A;  3W2W A;  4HBL A;  1JGG A;  2JUG A;  3JRH A;  3TP0 A;  4YFX F;  1V5E A;  4BHP A;  4BE0 A;  3CMY A;  4A3E J;  2W24 A;  1BR4 A;  2EA4 A;  3M1C A;  3G71 I;  3RCO A;  4JK1 X;  2HGC A;  3CC2 I;  2B9S A;  4KMF A;  2IXS A;  4XOT A;  5IY5 H;  1PP8 F;  2UV1 A;  4YII A;  3I0T A;  3F0C A;  2IS6 A;  3KP3 A;  3HTS B;  2X1D A;  3CCJ I;  1ZRE A;  2I8D A;  3IV5 A;  1YW9 A;  3E3V A;  4Y15 A;  2K3F A;  2HYG D;  1K79 A;  3CDI A;  1IW7 F;  5IYD J;  1BC7 C;  4OIR F;  2DO7 A;  3H5A A;  4XLE A;  3O6B B;  1K78 B;  1G3S A;  1ZG5 A;  4HZF A;  2RRE A;  2X1E A;  3M9A A;  2VPR A;  3R60 A;  2IVM A;  4M9X A;  4BEH A;  4E7L A;  4I09 A;  2Y2Z A;  3WHC A;  1O57 A;  2M0C A;  5B1B H;  4OIO F;  2V1U A;  2VUM J;  5EEH A;  4IEJ A;  4M73 A;  4UVA A;  4A2U A;  2IEK A;  1NK3 P;  5LRS A;  2JA2 A;  2CG4 A;  2OV7 A;  1APL C;  1R22 A;  2ACJ A;  4RB3 C;  2AHQ A;  3JW4 A;  2KIU A;  2PFB A;  2VAS A;  3IC7 A;  2X51 A;  4A69 C;  3PSI A;  4M72 A;  3AL0 B;  1QPM A;  5A2Q Z;  3FXK A;  5E3M A;  5L3B A;  5L3D A;  3IWF A;  2LF7 A;  4MFE A;  2HVQ A;  4JX5 A;  4U0Y A;  3CCU I;  4XRS A;  3HRU A;  1SD6 A;  4PK4 A;  4CYC A;  3HYI A;  1O7L A;  4G9Y A;  4JX6 A;  4PFP A;  2LSO A;  2P0W A;  2GBY A;  5BS6 A;  2X4H A;  1JHF A;  3DBL B;  2IBD A;  3CJT B;  5DUI A;  2V1X A;  2Y0M A;  2VLA A;  2LF8 A;  2I5U A;  1FOW A;  2PBI A;  3DPT A;  4EEF G;  4RB2 C;  3HSF A;  1E3O C;  4FET A;  1QHH D;  1Z67 A;  3Q0U A;  1G4D A;  1ZLK A;  2K9N A;  1ONV A;  4CIC A;  3CCY A;  1X1D A;  3I5U A;  2FJ1 A;  1JKP C;  4OWR B;  3M8F A;  2VPL A;  4UHT A;  4BBS J;  1SMT A;  4C3J J;  2EFN A;  1ETQ A;  2OQG A;  3ISP A;  4C3H J;  2R7Q A;  3G2B A;  2M4G A;  3AG2 H;  1IG7 A;  1Z21 A;  3K4B A;  2ADU A;  1MSE C;  3GTK J;  3ABK H;  2BXY A;  2HQA A;  1RUO A;  3JRC A;  3HDD A;  5H20 A;  4BXU A;  3HM5 A;  4WXH A;  3CLQ A;  3W6J B;  3BR6 A;  1TT5 B;  1D1C A;  2DYS H;  3V8J A;  3VYT B;  1GV2 A;  2W1O A;  4NC7 A;  2G7U A;  5FO5 A;  4FT8 A;  3OYN A;  1ZH5 A;  2VOO A;  2RQP A;  4PGH A;  3ASN H;  1ZGJ A;  3HTU A;  4UUT A;  2HNH A;  3H9J A;  1RQ6 A;  2D5V A;  4P96 A;  2OF7 A;  4PCQ A;  3HOS A;  1ZRD A;  2XGC A;  5FD6 A;  4NBQ A;  2VJ4 A;  5F64 A;  2DQL A;  4IXA A;  2CUJ A;  3KEO A;  3F8B A;  2J5O A;  3DKW A;  4O5V A;  4B3X A;  1R58 A;  4Q48 A;  4DGW B;  2M0M A;  4FIS A;  3ZQC A;  4K2E A;  2VN2 A;  3QQA A;  2MYS A;  3I64 A;  1RUN A;  4A3J J;  1ETX A;  2MFZ A;  2CUE A;  2WAF A;  1ZRF A;  3ZR8 X;  4XKW A;  2IW5 A;  2HXO A;  1K6O A;  1Y0N A;  5J47 A;  2BVL A;  3BJO A;  3FHZ A;  1XSX A;  3F8M A;  3IRQ A;  4HRI A;  2KRF A;  1X1A A;  1R4N B;  3ELK A;  4RM3 A;  5B66 C;  1ON2 A;  4A0Y A;  4Q5S F;  4FTH A;  2R7U A;  4KIB A;  2RVC A;  5C44 J;  2KP6 A;  1HKQ A;  2UXN A;  3DEU A;  4LK1 F;  5LLQ A;  1EH8 A;  5LEJ A;  3J80 Z;  3ECO A;  3R4K A;  4YFK F;  2NOG A;  2W84 A;  3OIO A;  3IKV A;  2ZNZ A;  4RMN A;  5L3C A;  3IUO A;  3ZMV A;  2ZJP F;  3BTC A;  2Q1Z B;  1R5I D;  2RV8 A;  3ROU A;  4PFO A;  4HDU A;  3GBG A;  4I6Z A;  2H1L A;  3D0S A;  1I27 A;  4HDV A;  3MCZ A;  3E6D A;  4YG2 F;  4IKF A;  1BA5 A;  2BY1 A;  2VKH A;  2CU7 A;  4XLN F;  1B72 A;  2A69 F;  1ITY A;  1B6A A;  2L3D A;  4LFU A;  4IHX A;  1ON1 A;  2ZKZ A;  3MEX A;  4E4H A;  1S7E A;  2VBZ A;  3IKT A;  1U78 A;  2WC2 A;  2A61 A;  3KIO A;  4BU2 A;  2LMD A;  3CJQ B;  4HPQ A;  3D5L A;  3I9V 2;  3WTU C;  4DIQ A;  1Z91 A;  1TLH B;  4A3K J;  5DV5 A;  4J00 A;  2DN0 A;  1N25 A;  3IWZ A;  4B09 A;  2DFI A;  2V4J C;  1J59 A;  2EQR A;  4RAY A;  4DYC A;  3PNY A;  3OL4 A;  1T38 A;  5JLX A;  2R93 J;  4XL9 A;  1LDJ A;  1OYY A;  1S3J A;  2H6B A;  3JAM R;  1X19 A;  3RZO J;  4XMY A;  3PNV A;  1QPI A;  4XR6 A;  3PUF A;  4XOR A;  2GA2 A;  2XKP A;  3I56 I;  2AS5 F;  1F1Z A;  1NK2 P;  4PGG A;  5HLG A;  3B6A A;  4AYB A;  3RQI A;  2PMH A;  2PJR B;  1WHU A;  1Y39 A;  2CQK A;  3DLA A;  3FMR A;  4G6T B;  3N97 A;  1BW6 A;  2PQ8 A;  2H09 A;  4HX4 A;  3M3Y J;  2QEX I;  1A35 A;  3DU6 A;  4M71 A;  1FIA A;  4G94 A;  2UXX A;  1LB2 A;  2ZXH A;  3MZH A;  1ETK A;  4A0Z A;  3BPV A;  3E97 A;  4A3L J;  2ELJ A;  3L2C A;  1DP7 P;  3Q0W A;  4GO1 A;  1MNE A;  2LKP A;  4N0B A;  1Y6I A;  3OYJ A;  1F36 A;  3ML6 A;  4AU7 A;  4Y17 A;  1FP2 A;  2O8K A;  4LOC A;  3FX3 A;  1P92 A;  1SAU A;  4E7Z A;  1ACI A;  2OPT A;  1R7J A;  4S0H B;  4L0Y B;  1WCM J;  2VXZ A;  1YLF A;  3VSL A;  3K70 D;  2VI6 A;  3I58 A;  3JRE A;  1S9H A;  3HHG A;  3DQV C;  3CF2 A;  1FBQ A;  4LIT A;  2DA3 A;  3GF2 A;  2JMW A;  1DPR A;  2XAU A;  2CV0 A;  1YS6 A;  3S1R J;  1PP7 U;  3KP6 A;  5BMZ A;  1JT0 A;  2DW4 A;  4LG3 A;  4PZJ A;  1VQ4 I;  2DTZ A;  2GLO A;  2L7K A;  3MKY B;  1G3W A;  1YX3 A;  1PVE A;  3KE2 A;  4O3M A;  3GTM J;  3U21 A;  2KDZ A;  4HAM A;  2EIK H;  1HDD C;  2V9V A;  2QUF A;  3ABL H;  5ED4 A;  3CUQ B;  2ZME A;  4CSW A;  2R5Z B;  2Q0O A;  3LA2 A;  1P7J A;  3H0G J;  2YS9 A;  1FIP A;  2JPB A;  3OOP A;  3HSR A;  4FX4 A;  2NYX A;  1P9Q C;  5DUK A;  4ZZL A;  2O5R A;  1VND A;  2PEX A;  5DDG A;  1XGM A;  2IGK A;  2ZXJ A;  3E6C C;  3A1Y A;  4CA0 A;  4ON0 A;  2D1H A;  2ZME C;  4CCN A;  4XRM A;  2FRH A;  2LY1 A;  4KIT B;  1WRJ A;  3DPL C;  2VB6 A;  4OAZ A;  1MMA A;  4RGX A;  2K9M A;  3E6M A;  2MLG A;  5C3E J;  4KMU X;  2PJP A;  5HLI A;  3OYA A;  3OYL A;  2W7N A;  2LP0 A;  4E7I A;  2PG4 A;  3QPT A;  4C2M J;  4HA8 A;  3KP2 A;  2HEO A;  3ABT A;  5E8G A;  5FFZ A;  4OU0 A;  4MHG A;  1SFK A;  3CQZ J;  4CCM A;  1HDP A;  4PDK A;  2F48 A;  3CMA I;  3PIO F;  3K4M A;  4CZZ A;  1IDY A;  3DTI A;  4XBF A;  4P9F A;  3HPH A;  3PFY A;  5BPI A;  4PJM A;  3ZOB A;  4CDG A;  4ZYH A;  2M9H A;  4V2F A;  4UVC A;  2C6Y A;  2GXG A;  4G7Z F;  4XKB A;  3RI4 A;  1ORK A;  2R7O A;  2L9V A;  3LSJ A;  3IAS 2;  4RDU A;  1HKT A;  2R5Y B;  4IZZ A;  3TED A;  2JPC A;  5EYR A;  2ECC A;  3T8R A;  4RAZ A;  4RLF A;  4RBO A;  3GFL A;  4RB0 A;  2HOS A;  3SDB A;  4A3C J;  5IP9 J;  3H9Q A;  4HW0 A;  2GXA A;  1R6R A;  2E19 A;  1OFC X;  1KU9 A;  2FQ4 A;  4ZDO A;  4CUG A;  3RQ4 A;  2FU4 A;  2DFH A;  5DEQ A;  1JKO C;  5FLX R;  3DU5 A;  2VBY A;  3HB9 A;  3N4M A;  2LKX A;  1I1G A;  2F5F A;  2HXI A;  1GVJ A;  2L4A A;  2HOA A;  4YIF A;  3F6O A;  1ZKG A;  5M3M J;  1CF7 A;  1YJ9 I;  1FBU A;  2FXA A;  4IL6 C;  1ERD A;  1LPQ A;  4CO8 A;  1ZQ3 P;  4L0Z B;  1IO2 A;  2TDX A;  1BIB A;  3BG9 A;  2L02 A;  4E70 A;  4M6V A;  5D5U B;  4NNJ A;  2GM4 A;  2JK3 A;  2Z9O A;  4LLL A;  5FD5 A;  3TW7 A;  2V1N A;  3OSF A;  4ESF A;  5IT9 Z;  4B8X A;  2CW8 A;  1IRZ A;  4I01 A;  5J1Y A;  2QSG X;  1BJZ A;  4BH9 A;  3RSN A;  1W36 C;  5F1J A;  2YX4 A;  1LDK B;  3F8N A;  3J81 K;  2V9K A;  3PL8 A;  4FE4 A;  3VFZ A;  1UAA A;  3OYK A;  1IRF A;  1U9O A;  4Y7N J;  1BOA A;  2YPR A;  1AA7 A;  1B9M A;  2Y30 A;  2G0E A;  2Z5U A;  4A5M A;  3HPG A;  3V7R A;  4ZTJ A;  1AKH A;  1R36 A;  5LGU A;  1HKS A;  1TNT A;  2OAZ A;  1O3S A;  2OD5 A;  2DA7 A;  5HOO A;  2ZC2 A;  2R0Q C;  2JA6 J;  1Y8R B;  3AG3 H;  2EV5 A;  3BG5 A;  1TNS A;  4JBA A;  3WGI A;  3S14 J;  1WJB A;  1FWZ A;  1WQ2 A;  3COA C;  2WB1 N;  3TMO A;  1LKX A;  3K6G A;  4WK8 F;  4JOM A;  4IQJ A;  3CDH A;  2ID3 A;  3T8T A;  3GTQ J;  1HXD A;  4MEY F;  2EZI A;  3BDD A;  4FE7 A;  1SMY F;  2FEZ A;  2QSH X;  5FJ8 J;  1ZLJ A;  3AAF A;  2DPD A;  1VQM I;  1RR8 C;  3RIR A;  3L2R A;  2V79 A;  1R23 A;  3BCA A;  1MW7 A;  1FOK A;  1YO5 C;  1Z0X A;  2CQQ A;  3KZY A;  2XGE A;  4NDL A;  3S16 J;  1RI7 A;  1MGT A;  3ZQL A;  4IX7 A;  1SAN A;  1TL8 A;  1BBY A;  5E3L A; 
#chains in the Genus database with same CATH homology
 3DFG A;  1IXR C;  3V7C A;  4EGZ A;  1HSJ A;  1J0R A;  2JZY A;  2K02 A;  4LG0 B;  2Q2E A;  3SQN A;  2D1V A;  4S04 A;  2QLZ A;  2RGV A;  3ZMS A;  1K7A A;  3WE3 A;  3JSO A;  4OOI A;  3WTZ A;  6PAX A;  4KNY A;  5H6R A;  4A6D A;  2OQR A;  1STZ A;  5DCM A;  2QQ9 A;  4A5N A;  4H0E A;  4UV8 A;  1XB4 A;  4MEX F;  5E18 F;  1XN7 A;  4FX0 A;  3TOB A;  5AON A;  1R5G A;  2HQN A;  3I4P A;  4IRH A;  5JHU A;  1Z6R A;  1MJ9 A;  4EJW A;  5L3G A;  2ZO4 A;  5HVQ C;  2DBB A;  1DUX C;  3KLO A;  3DV8 A;  4P5O A;  4XRF A;  1TTY A;  4RB1 A;  1KQ8 A;  4A0X A;  1S7A A;  2FBH A;  4MQ9 F;  1BC8 C;  4Z2Y A;  4IPA A;  3P9C A;  1UFM A;  1YQA A;  5L3E A;  3NQO A;  2E1N A;  3BZ6 A;  2F2E A;  5D4S A;  3LAJ A;  1VTN C;  3I59 A;  2P6T A;  4RGR A;  5JFR A;  4DQ2 A;  3QP6 A;  3R6S A;  1T2K A;  2HDC A;  5CVJ A;  4L5J A;  1FSH A;  1FLI A;  1FBS A;  4EM0 B;  4EV0 A;  4M6X A;  2XUB A;  2BEO A;  3K1N A;  4M74 A;  3EYI A;  2QBY A;  4L9V A;  3KET A;  1XMK A;  2R7D A;  4I98 B;  3ULQ B;  2WWY A;  2EFP A;  3GFM A;  5CVR A;  3JTH A;  2Z33 A;  1V4R A;  4ZYG A;  3EYY A;  5A2Q K;  1B59 A;  2G7H A;  4LD5 A;  3WU0 A;  1EH7 A;  1A04 A;  3V4G A;  3LQQ A;  5HS8 A;  2PI0 A;  2BBY A;  2EA2 A;  1J2X A;  1MJA A;  3SHF A;  4EM1 A;  1QNT A;  3WTS C;  2DI3 A;  3I71 A;  2HWV A;  1FNN A;  3RKW A;  2P7V B;  1WSU A;  2VBW A;  2CO5 A;  2K4J A;  1P2F A;  3EUH A;  3HRS A;  2STT A;  1HW2 A;  2BV6 A;  4HYE A;  2FQ3 A;  4KYW A;  1L0O C;  4RGS A;  2NS0 A;  5CVV A;  1I1S A;  1Z1D A;  2P8T A;  3ZMU A;  2VT3 A;  5CYV A;  2VOD A;  2JSC A;  1OMI A;  2FNA A;  4NB5 A;  5K5R A;  1U5T B;  1IF1 A;  3RDI A;  2DTR A;  5KK1 A;  4IHS A;  5ICF A;  3O2P E;  2XKO A;  3K9T A;  4O6J A;  2KJB A;  3Q9S A;  3ZMT A;  4OIP F;  1Z05 A;  3RKX A;  1RZ4 A;  3GX4 X;  5K5O A;  4XLP F;  1XCV A;  3L00 A;  1EH6 A;  2WV0 A;  3MQ0 A;  5BQT A;  2GQQ A;  5BPD A;  1D5V A;  3FXR A;  3LWF A;  2MA3 A;  4ENK A;  2XIG A;  5HS7 A;  5LHH A;  3J80 K;  1YW7 A;  3DP7 A;  4WCG A;  2P5L C;  2VT2 A;  3CO7 C;  1FPQ A;  1IN6 A;  4KIC A;  3F8C A;  1FYM A;  2O3F A;  2IP2 A;  2MLK A;  1W7P A;  5LGN A;  3K1M A;  1LDD A;  4KUM A;  3MFK A;  4XSX F;  1IXS B;  3GFI A;  1MD0 A;  3GZ5 A;  1LJ9 A;  2OU2 A;  3DXJ F;  2A6E F;  2FBI A;  3KCC A;  1E17 A;  5LBQ A;  3SXY A;  2YSR A;  3SFZ A;  2Q8K A;  1I6X A;  5CLS A;  3TDZ C;  4AIJ A;  2EFO A;  5FFX A;  1KU7 A;  2HFH A;  1ZHF A;  5J8C A;  5DYM A;  3F72 A;  4TV7 A;  3HHH A;  2XRN A;  3F3X A;  3PFI A;  1EV7 A;  4LJZ F;  3RYP A;  3ZMZ A;  1ZG3 A;  4MTD A;  3TO7 A;  4I0A A;  1LNW A;  1ZN2 A;  2XAF A;  4M6Y A;  3TDU C;  3J7A O;  1F5T A;  5F1R A;  1QO0 D;  2CYY A;  4NQW A;  3E5X A;  3FZV A;  4LB5 A;  3BWG A;  4G6D A;  3HIF A;  3PQJ A;  1J9I A;  1TBX A;  2QQA A;  5K1Y A;  4XSZ F;  3QP5 A;  2K4B A;  2M30 A;  1J75 A;  1FSE A;  3CO6 C;  3RYR A;  5JVT A;  4L9J A;  5H6Q A;  2Y48 A;  1XGO A;  5ERI A;  3M7G A;  5HS9 A;  2R3S A;  1FZP B;  3MWM A;  2VC0 A;  2HTS A;  5JI6 A;  3HRT A;  1YW8 A;  3Q5F A;  2FML A;  4ESB A;  2RDP A;  1P4A A;  3T1B A;  1MDM A;  4OIQ F;  3ZN1 A;  3GUD A;  4HF2 A;  2JRT A;  2QVO A;  4LB6 B;  4GCV A;  2VOP A;  2XAH A;  3ZN0 A;  2KJC A;  3CUO A;  4CGZ A;  5LEK A;  1W5S A;  2FMY A;  3OV8 A;  4UNO A;  2DAO A;  1L3L A;  3MAJ A;  4BAY A;  4FHT A;  3ZMD A;  2XAS A;  1UCR A;  1QZZ A;  2VE9 A;  1IXC A;  4EM2 A;  3B02 A;  5LGT A;  2RNJ A;  3FF5 A;  1QGP A;  1SD4 A;  3C1D A;  3WGG A;  3KEQ A;  5FGM A;  3WGH A;  3KP5 A;  4L9T A;  3GZ6 A;  2A5Y B;  1IN5 A;  2OA4 A;  3O3K A;  5IT9 K;  4UVB A;  1Q1H A;  3DF8 A;  5LHI A;  3EET A;  4GGG A;  5ICE A;  5E20 A;  3R0A A;  2ETH A;  2HR3 A;  2Z3Y A;  1U8R A;  1DDN A;  4BHC A;  3FMQ A;  5E1W A;  3BY6 A;  4R1H A;  1I5Z A;  2IJL A;  2ZFW A;  1GXQ A;  1LEA A;  3P7N A;  1BI1 A;  3WU1 B;  1E2X A;  2O6G E;  1KYZ A;  5D4R A;  1FX7 A;  1K78 A;  1BJA A;  1USS A;  2F5C A;  3TO6 A;  3R61 A;  2ISZ A;  4A12 A;  3Q9V A;  2PMU A;  4HQM A;  3RPQ A;  3TOA A;  2XGX A;  3ZQ7 A;  2L01 A;  4GYI A;  2ESN A;  4G7O F;  1MZB A;  1IAW A;  5D6E A;  5FLX Z;  4KDP A;  3ABU A;  2GAU A;  3REO A;  2O61 A;  3F21 A;  1SAX A;  4EJO A;  2O03 A;  4R8H A;  3G73 A;  3WTX C;  4R79 A;  5E8I A;  3P9K A;  2B0L A;  1W5T A;  2FSW A;  1BN5 A;  4G8X A;  4KT5 C;  2YU3 A;  2XAJ A;  3B73 A;  1PUE E;  2P4W A;  4EVI A;  4LLG F;  1H9T A;  1YTY A;  1D8K A;  1MKM A;  1O3Q A;  2EFQ A;  3I53 A;  2P5V A;  2VBX A;  5LHG A;  2XAQ A;  1U5T C;  2RN7 A;  1QQI A;  3I54 A;  2ZME B;  3ZP5 A;  2LDU A;  1IZ1 A;  1B1B A;  3RJP A;  3V7S A;  4AIK A;  1G3Y A;  1D3Y A;  3GXO A;  2V6C A;  4ZH4 F;  4A6E A;  1TQP A;  1FC3 A;  4MNU A;  1ZG1 A;  2DK8 A;  1XD7 A;  1WWX A;  4N9H A;  2ELH A;  3M1E A;  2CSO A;  4M9S A;  1D8J A;  1ULY A;  3BRO A;  2GIV A;  2XRO A;  1XSV A;  4RS8 A;  2E1C A;  2MH9 A;  1SD5 A;  2YX7 A;  2EV6 A;  5F6F A;  5D5V B;  1R00 A;  3QU6 A;  4MTE A;  2P7C B;  1YIO A;  3GVA A;  1FP1 D;  2D45 A;  4IJA A;  4QWQ A;  1YYV A;  3BJ6 A;  3TGN A;  2PLY A;  1ZGA A;  1OKR A;  2CFX A;  4U7D A;  4MQV A;  4EMS A;  1P6R A;  3U9G A;  2L4M A;  2M1B A;  3L9F A;  4L9N A;  3QAH A;  1AOY A;  1T0F A;  4EJU A;  1P4W A;  4HX8 A;  1CF7 B;  4Q4Z F;  2W25 A;  4L5I A;  3RPU A;  2VC1 A;  2W85 A;  1HBX G;  4IHT A;  1P4X A;  1HW1 A;  2XHK A;  3GFJ A;  4Q47 A;  2HOE A;  1FT9 A;  1H0M A;  3WG9 A;  1FYK A;  1TW3 A;  3WTY C;  4GYG A;  2V1D A;  1BI3 A;  3G3Z A;  1GHC A;  4EJV A;  1XGN A;  2R7F A;  2DQR A;  4JQF A;  4ASN A;  1Y0U A;  1QBJ A;  3KLN A;  2PN6 A;  4F7Z A;  5D8K B;  1YG2 A;  4QLC U;  1JE8 A;  5TJJ A;  3BOQ A;  2K7L A;  1R5H A;  3GO5 A;  1J5Y A;  2ZNY A;  2FOK A;  2COM A;  5E1X A;  3C3W A;  4BNC A;  2K27 A;  3L7W A;  3BP8 A;  3IRR A;  2JT1 A;  2GA1 A;  4IVN A;  4EJT A;  1LEB A;  1S7O A;  3CUQ A;  4HV5 A;  4LMY A;  3FMS A;  4ESJ A;  4LLN A;  4LGW A;  2ISY A;  3CUQ C;  3K69 A;  3WTT C;  4KA4 A;  2HZT A;  3F22 A;  1RIO H;  1CGP A;  4ENN A;  4U0V A;  2DU9 A;  2IA1 A;  1TQM A;  4WXC A;  4EQQ A;  1LQ1 A;  1ZAO A;  3QPH A;  4MGR A;  4CYD A;  2MD5 A;  1G6N A;  2XVC A;  5DCM B;  3KFW X;  3VB2 A;  5ILS A;  2QM3 A;  3GLX A;  1IRG A;  4IRI A;  2RC4 A;  1W7P D;  3GEZ A;  3JTG A;  1XSD A;  1FY7 A;  1V3F A;  4ENM A;  2MH2 A;  2NNN A;  4S05 A;  4HLX A;  3QRF F;  4WWC A;  2JTV A;  1REP C;  2HQR A;  3TQN A;  1U3E M;  1KQ0 A;  5ICG A;  2CW0 F;  1LVA A;  2HYF A;  2QZ8 A;  1ZRC A;  2UWM A;  3NRV A;  2HS5 A;  4AVP A;  2EB7 A;  2NAZ A;  5DCF A;  2K86 A;  3FXQ A;  3K1P A;  2QQB A;  2FBK A;  2STW A;  1WI9 A;  1KGS A;  1SFE A;  1Z7U A;  3RTR A;  3I59 B;  3FWE A;  4L18 B;  2P6S A;  1SFU A;  4UUV A;  2FE3 A;  1C0W A;  1ODD A;  3S2W A;  4HX7 A;  3HOT A;  3C7J A;  2ESH A;  3KP4 A;  5L3F A;  3PQK A;  2ZJ2 A;  4ZZD A;  2A3S A;  3WE2 A;  4CHU A;  5IT3 A;  2QBY B;  2VON A;  3U2R A;  2F5D A;  1IN4 A;  1BI0 A;  2EV0 A;  4N9I A;  4ENJ A;  1NHA A;  1OYW A;  2FA5 A;  4OMZ A;  3WTV C;  3E5U A;  3C18 A;  1SFX A;  1X3U A;  1ZYR F;  2OBP A;  4U7B A;  5TRD A;  2IA0 A;  3JAM K;  3IHU A;  4U0W A;  1YS7 A;  4IRG A;  4HQE A;  1BIA A;  2DLL A;  2XV4 S;  1KYW A;  4I02 A;  2IT0 A;  4OMY A;  3NEU A;  5K5Q A;  3ZPL A;  3HSE A;  5HDN A;  1UB9 A;  2EWN A;  3JAM Z;  2BGC A;  1G3T A;  1Z6T A;  1F4K A;  1O3R A;  3V8K A;  3U1D A;  3GYH X;  4LG0 A;  3LA3 A;  1OR7 A;  5AIQ A;  2GXB A;  4AD9 A;  4WF2 A;  1OPC A;  1IUY A;  3ECH A;  2QEN A;  5DD4 A;  3H92 A;  1B9N A;  2BYV E;  3WOD F;  4UV9 A;  3EDP A;  2DT5 A;  2L54 A;  3KZZ A;  2O8X A;  1JHH A;  1T39 A;  2OZU A;  2X0L A;  1O7F A;  2NNY A;  1JGS A;  3K0L A;  2IPQ X;  2HKO A;  2BE5 F;  3CJN A;  2H27 A;  2MBF A;  2AXL A;  4M9Z A;  1TW2 A;  2ZCW A;  4RGU A;  2EFW A;  1HQC A;  3E6B A;  2HTJ A;  2EJR A;  1KU2 A;  2NRA C;  5HDK A;  1PDN C;  3MZY A;  3BPX A;  4GXO A;  4U88 A;  2ZBK A;  3EQL F;  3K2Z A;  4KN4 X;  2YR2 A;  2VE8 A;  5CJ9 A;  5J6X A;  5ILV A;  2OZ6 A;  1W7P B;  1TQI A;  2FF4 A;  5FB2 A;  5HDG A;  2O0Y A;  3FM3 A;  3LAP A;  1T6S A;  3HUG A;  3VOD A;  1B4A A;  2KKO A;  4HLY A;  2M87 A;  4WXD A;  3RKY A;  1HW5 A;  2E7X A;  2XAG A;  4HV6 A;  1Z9C A;  1R1V A;  4HF0 A;  2WTE A;  3LFK A;  4I0B A;  1FYL A;  1YFH A;  3LQR A;  4KIG A;  4CXF A;  4G7H F;  4P55 A;  4I2O A;  5CVI A;  4LK0 F;  3SZT A;  2KIF A;  1W4M A;  2D2W A;  3V8L A;  5FLX K;  4P9U A;  3F23 A;  2F5E A;  3CLO A;  4AIH A;  4KIF A;  1KQ9 A;  3H3U A;  2A07 F;  1RNL A;  3ERE D;  5E1Z B;  3H3Z A;  2M5W A;  2CGP A;  3E5Q A;  2LNB A;  3W6K B;  3LST A;  3L09 A;  3LA7 A;  1IN7 A;  1F9N A;  3TO9 A;  5E17 F;  5LRR A;  3GWZ A;  3WTW C;  2CWE A;  1SD7 A;  3QU3 A;  3KP7 A;  4YFN F;  3J81 Z;  1XGS A;  3F6V A;  4ETS A;  1XMA A;  4ZYD A;  2Y75 A;  4KFC A;  3P9I A;  4WX9 A;  4HOB A;  1DPU A;  2H94 A;  3T0Y A;  5ICC A;  1S29 A;  3BJA A;  4DNC A;  5HLH A;  2DPU A;  1JXS A;  2EK5 A;  1MJB A;  1R1T A;  4BHB A;  5AIP A;  4BQA A;  1U5T A;  1XCB A;  2IRF G;  4KN7 X;  2MC3 A;  4UXN A;  2H6C A;  2W57 A;  1QZY A;  3GW2 A;  5ILU A;  2IA2 A;  1WKM A;  5JR3 A;  1KU3 A;  5D5W B;  2GZW A;  1IN8 A;  1S8N A;  1R1U A;  1BM9 A;  2HKX A;  2M8E A;  5D6F A;  4I7H A;  1MDM B;  2QWW A;  4D0P A;  3FXU A;  5BOX A;  1UST A;  5KVR A;  2E7W A;  3CTA A;  1UHM A;  3F8F A;  3T5X A;  3JSP A;  1XDS A;  3IL2 A;  4Y13 A;  4G6Q A;  2FNP A;  2KIM A;  4AWX B;  1J7K A;  3VOE A;  4BYY A;  4IF4 A;  4ZYE A;  1HST A;  1S6L A;  2UZK A;  1BI2 A;  1AWC A;  1O3T A;  4EGY A;  2G9W A;  1OYI A;  3SZP A;  2J5P A;  3TKY A;  3QOP A;  1T98 A;  2A6H F;  2A68 F;  3VEP A;  5D5X B;  1UHW A;  3R0J A;  5D8L B;  2QYO A;  1KA8 A;  5EEG A;  5J8F A;  2RKH A;  1U6G A;  1H9G A;  3HRM A;  4HF1 A;  4OIN F;  2P5K A;  5DD8 A;  1XDU A;  1U2W A;  2Z99 A;  2GWR A;  2DK5 A;  3FM5 A;  2M45 A;  1ZAR A;  1GXP A;  5CVU A;  4NHJ A;  3M8E A;  4HBL A;  4YFX F;  4BHP A;  2W24 A;  2EA4 A;  4JK1 X;  2HGC A;  4KMF A;  1PP8 F;  4YII A;  3I0T A;  3KP3 A;  3HTS B;  1ZRE A;  1YW9 A;  3E3V A;  4Y15 A;  1K79 A;  2HYG D;  1IW7 F;  1BC7 C;  4OIR F;  2DO7 A;  3O6B B;  1K78 B;  1G3S A;  1ZG5 A;  4HZF A;  3M9A A;  3R60 A;  2IVM A;  4M9X A;  4I09 A;  1O57 A;  4OIO F;  2V1U A;  5EEH A;  4M73 A;  4UVA A;  4A2U A;  5LRS A;  2CG4 A;  1R22 A;  2ACJ A;  4RB3 C;  3JW4 A;  2KIU A;  2PFB A;  3IC7 A;  4M72 A;  1QPM A;  5A2Q Z;  5L3B A;  5L3D A;  3IWF A;  2LF7 A;  4U0Y A;  3HRU A;  1SD6 A;  3HYI A;  1O7L A;  4G9Y A;  2LSO A;  5BS6 A;  2X4H A;  1JHF A;  5DUI A;  2V1X A;  2Y0M A;  2LF8 A;  2PBI A;  3DPT A;  4RB2 C;  3HSF A;  1G4D A;  1ZLK A;  1ONV A;  4CIC A;  3I5U A;  3M8F A;  4UHT A;  1SMT A;  2EFN A;  3ISP A;  2OQG A;  2ADU A;  1RUO A;  5H20 A;  4BXU A;  4WXH A;  3W6J B;  3V8J A;  5FO5 A;  2G7U A;  1ZH5 A;  4FT8 A;  2VOO A;  2RQP A;  4PGH A;  1ZGJ A;  3HTU A;  4P96 A;  4PCQ A;  1ZRD A;  3HOS A;  5FD6 A;  5F64 A;  2DQL A;  4IXA A;  3KEO A;  3F8B A;  2J5O A;  3DKW A;  4O5V A;  1R58 A;  4Q48 A;  4K2E A;  2VN2 A;  3I64 A;  1RUN A;  1ZRF A;  2IW5 A;  1K6O A;  3BJO A;  3FHZ A;  1XSX A;  3F8M A;  3IRQ A;  2KRF A;  3ELK A;  1ON2 A;  4A0Y A;  4Q5S F;  4KIB A;  2RVC A;  1HKQ A;  2UXN A;  3DEU A;  4LK1 F;  5LLQ A;  1EH8 A;  3J80 Z;  5LEJ A;  3ECO A;  3R4K A;  4YFK F;  2W84 A;  3IKV A;  2ZNZ A;  5L3C A;  3ZMV A;  2RV8 A;  3ROU A;  4HDU A;  3D0S A;  1I27 A;  4HDV A;  3MCZ A;  3E6D A;  4YG2 F;  4XLN F;  2A69 F;  1B6A A;  2L3D A;  4LFU A;  1ON1 A;  2ZKZ A;  3MEX A;  2VBZ A;  3IKT A;  1U78 A;  2WC2 A;  2A61 A;  3D5L A;  3WTU C;  1Z91 A;  1TLH B;  5DV5 A;  4B09 A;  3IWZ A;  2DFI A;  1J59 A;  4RAY A;  1T38 A;  1LDJ A;  1OYY A;  1S3J A;  2H6B A;  2GA2 A;  2XKP A;  2AS5 F;  1F1Z A;  4PGG A;  5HLG A;  2PMH A;  2CQK A;  3FMR A;  3N97 A;  2PQ8 A;  2H09 A;  4HX4 A;  4M71 A;  4G94 A;  2UXX A;  1LB2 A;  3MZH A;  4A0Z A;  3BPV A;  3E97 A;  3L2C A;  1DP7 P;  4GO1 A;  4N0B A;  2LKP A;  3ML6 A;  4Y17 A;  1FP2 A;  3FX3 A;  1P92 A;  4L0Y B;  1R7J A;  2VXZ A;  1YLF A;  3I58 A;  3HHG A;  3DQV C;  1FBQ A;  3GF2 A;  1DPR A;  1YS6 A;  1PP7 U;  3KP6 A;  5BMZ A;  2DW4 A;  4PZJ A;  1G3W A;  3KE2 A;  4O3M A;  4HAM A;  2V9V A;  2QUF A;  5ED4 A;  3CUQ B;  2ZME A;  2Q0O A;  3LA2 A;  2JPB A;  3OOP A;  3HSR A;  4FX4 A;  2NYX A;  5DUK A;  4ZZL A;  5DDG A;  2PEX A;  1XGM A;  2ZXJ A;  3E6C C;  4ON0 A;  2D1H A;  2FRH A;  1WRJ A;  3DPL C;  4RGX A;  3E6M A;  2MLG A;  4KMU X;  2PJP A;  5HLI A;  2PG4 A;  3QPT A;  4HA8 A;  3KP2 A;  2HEO A;  3ABT A;  5E8G A;  5FFZ A;  4OU0 A;  4MHG A;  4PDK A;  4CZZ A;  4XBF A;  4P9F A;  5BPI A;  4CDG A;  4ZYH A;  4UVC A;  2C6Y A;  2GXG A;  4G7Z F;  3RI4 A;  1HKT A;  2JPC A;  3T8R A;  4RAZ A;  3GFL A;  4RB0 A;  4HW0 A;  1KU9 A;  2FU4 A;  5DEQ A;  2VBY A;  3N4M A;  1I1G A;  2F5F A;  1GVJ A;  2L4A A;  4YIF A;  3F6O A;  1CF7 A;  1FBU A;  2FXA A;  4CO8 A;  4L0Z B;  2TDX A;  1BIB A;  2L02 A;  4E70 A;  5D5U B;  2Z9O A;  4LLL A;  5FD5 A;  4ESF A;  5IT9 Z;  4B8X A;  4I01 A;  4BH9 A;  2YX4 A;  1LDK B;  3F8N A;  3J81 K;  3VFZ A;  1IRF A;  1BOA A;  2YPR A;  1B9M A;  2Z5U A;  4A5M A;  3V7R A;  1R36 A;  5LGU A;  1HKS A;  1TNT A;  2OAZ A;  1O3S A;  2OD5 A;  5HOO A;  2EV5 A;  1TNS A;  4JBA A;  3WGI A;  1FWZ A;  1WQ2 A;  3COA C;  4WK8 F;  3CDH A;  3T8T A;  1HXD A;  4MEY F;  3BDD A;  1SMY F;  2FEZ A;  3AAF A;  1ZLJ A;  2DPD A;  3RIR A;  2V79 A;  1R23 A;  1FOK A;  1YO5 C;  3KZY A;  1RI7 A;  1MGT A;  1BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...