1XCVA

Crystal structure of (h79ac102d)dtxr complexed with nickel(ii)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor mutant
publication title Mechanism of metal ion activation of the diphtheria toxin repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xcvA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1xcvA02
1Z9CA 1OMIA 3D5LA 3JW4A 1KYZA 5AONA 2FF4A 2P5VA 2FU4A 1FBSA 1W7PA 3WG9A 2IP2A 5HLHA 2V79A 4LB6B 4MTDA 1HW1A 1HKQA 1I5ZA 3H3ZA 3KZZA 4EGZA 4EJWA 1HSTA 4EJUA 2K86A 4ZYEA 1FNNA 2DQLA 2HZTA 1G3YA 4ENJA 3O2PE 2EJRA 3BZ6A 2CW0F 2HQRA 5E18F 1BIAA 4O6JA 2H6CA 3LAJA 1D3YA 3V8KA 5J6XA 3B02A 3CDHA 3PQJA 3HIFA 1IXRC 2VC0A 1JGSA 2EFWA 1FZPB 1P92A 2HS5A 3BY6A 3I58A 1FP2A 3KP7A 2EFQA 5ILSA 2F5DA 3IKTA 2EA4A 2HTJA 2RVCA 3P9KA 2CYYA 5LEJA 3ZMZA 1Z1DA 1R1UA 2GIVA 5ED4A 4CICA 4A12A 5CVIA 5HVQC 3HRMA 1IUYA 3WTVC 2VONA 2VBWA 3G3ZA 3IWFA 4NHJA 2OZ6A 1QO0D 2ACJA 1BI0A 1IN8A 3R60A 2ESNA 2MH2A 5FB2A 5IT9K 1CGPA 2QLZA 2QQAA 1XGMA 5IT9Z 3EETA 2B0LA 2JPCA 2GQQA 2XKOA 3FMSA 4KDPA 2DLLA 4A5MA 2K4JA 3HRUA 2DFIA 3WTYC 2EV5A 2FBIA 4M6XA 1ZRFA 4PCQA 2H94A 3PFIA 4WXCA 4A0XA 4OMYA 2QENA 1O3SA 2Q0OA 3F8NA 1MJBA 4MQ9F 1P4AA 3F8MA 4HQMA 2V1UA 3DKWA 4FT8A 4G8XA 4LLNA 3H3UA 3ZQ7A 2CG4A 2O8XA 4PGGA 1QBJA 1W7PB 2O3FA 2HWVA 1J2XA 3I64A 3I53A 3KE2A 1XCVA 1TQPA 3TDZC 4RGRA 3GFLA 4MQVA 4LMYA 2M8EA 1ZG1A 4UHTA 4RAYA 4Y13A 4BH9A 3WGHA 3GFIA 2QBYA 4M74A 4KUMA 1UCRA 5E8IA 4HF1A 4EJOA 1LEBA 4BHPA 1B4AA 4IXAA 3WU1B 2CGPA 1IN4A 3GW2A 2BEOA 1ZGAA 4UNOA 3QPHA 3QPTA 2COMA 5D5UB 1JXSA 3F8FA 2NRAC 3M8EA 2XAGA 2CWEA 1W5TA 3WTUC 3JTHA 2XAHA 5JI6A 3T8RA 1R7JA 3OOPA 1T2KA 5CYVA 2VBZA 1S7AA 2M45A 3I5UA 3EUHA 4GYGA 2ZCWA 2CQKA 3ZPLA 4KIGA 4OIOF 2JSCA 2L3DA 5KK1A 2Y48A 1R5HA 1A04A 1BC8C 1ON1A 1GXPA 3F8BA 4HF2A 4OIPF 1ZAOA 2FNAA 5D4RA 1F9NA 3DP7A 4KFCA 5E1XA 3KP5A 4A2UA 2FBHA 3WE3A 5HS8A 5D4SA 2GA2A 1XB4A 1B59A 1BIBA 1G4DA 2MC3A 3WTSC 4DQ2A 4YIIA 3L2CA 1JHHA 3RYPA 5CLSA 2DK5A 2V1DA 3GZ5A 3EDPA 2VE9A 2LF7A 4UV8A 2H09A 5ILVA 3SHFA 1K78A 1WSUA 2KIUA 3K69A 3IC7A 1RUOA 2GZWA 3HSEA 2HR3A 1LQ1A 4I7HA 4YFKF 1IN5A 4ENMA 3M7GA 3I4PA 3F21A 1SFXA 4GCVA 1XMAA 3BJAA 5H6QA 4L5JA 1J75A 2BGCA 3FMQA 2BYVE 3P9CA 3GFJA 2ESHA 4I0AA 2HDCA 4HV6A 3LWFA 1O3RA 1S6LA 3LA3A 2Z99A 4LGWA 3TO6A 1BI2A 1XGOA 5FO5A 2M30A 3DXJF 5F1RA 5HOOA 2OBPA 1KQ9A 3RKXA 1R58A 2QBYB 3KZYA 3KEOA 4OIRF 3IHUA 1S3JA 2DQRA 4Y17A 3HOSA 3TO9A 3F6VA 5FLXK 1D8JA 1E17A 5K5RA 4H0EA 2QQBA 5ICGA 1KU2A 1UHWA 5EEHA 3J81K 3F23A 1V4RA 2HYFA 2R7FA 2F5CA 4NQWA 2FEZA 1ZH5A 2A69F 2ELHA 2K02A 2K4BA 2XAFA 3VB2A 4HBLA 5F6FA 5KVRA 3N4MA 1DDNA 2OQRA 1EH6A 4UVBA 4KIFA 2O6GE 4EM1A 2XAQA 3L09A 3WTTC 1J59A 5D5WB 4HQEA 2IT0A 1FPQA 4DNCA 3D0SA 1FYLA 4UUVA 2D1VA 2X4HA 4UVCA 3NRVA 1OYYA 5E17F 2UWMA 1DPUA 2PBIA 2P5KA 1K78B 2LKPA 4B09A 4A5NA 1FYMA 1H9TA 2CFXA 5D8LB 3HRSA 1HBXG 2W85A 4HDVA 3N97A 3IL2A 1LB2A 5FGMA 5L3CA 2A68F 4K2EA 1XN7A 3HUGA 1IXSB 2Q2EA 2ZMEA 3ABTA 2NYXA 5FD6A 1HKSA 3U9GA 3O6BB 1Z6RA 4ESBA 1EV7A 1PP8F 1S8NA 3KP3A 1ODDA 4WK8F 3GX4X 3RTRA 1UFMA 4WF2A 1XDSA 2IJLA 3K1NA 5E8GA 2EK5A 3C1DA 2D1HA 3E6CC 4HZFA 5DYMA 3GO5A 2OZUA 4P96A 3WGGA 1J7KA 2HTSA 4A0ZA 1YLFA 5EEGA 1T38A 1KU7A 4XRFA 5CVVA 3Q9SA 1MD0A 1IRGA 1H0MA 3MEXA 3OV8A 2K7LA 3KLOA 4CGZA 4KN7X 5HS7A 4LLGF 1P4WA 4HAMA 4CHUA 5FFXA 1QZZA 4RB2C 3CTAA 4HOBA 1IN6A 1ZLJA 3U1DA 5CVRA 1KU9A 3HTSB 1ULYA 2Y0MA 1U5TB 2QWWA 3VOEA 4HV5A 3ROUA 4PDKA 1RIOH 2WWYA 3REOA 3RYRA 2EV0A 3F22A 3ELKA 3GVAA 2QM3A 3M9AA 4RGSA 1P2FA 4HX4A 3EYYA 2X0LA 2MLGA 2V9VA 1R5GA 2R3SA 2DPDA 4G9YA 3RJPA 4UV9A 4KA4A 3F72A 3TGNA 3K9TA 1G6NA 2TDXA 2OAZA 2V1XA 3BROA 1PP7U 5AIQA 1G3WA 1BI1A 1S7OA 1ZYRF 1BOAA 4IHSA 4M6YA 4HLXA 1R1TA 1RNLA 2YSRA 4ZYHA 2G9WA 3M8FA 4IHTA 5CVUA 4IVNA 2XVCA 4BHCA 3RI4A 5JR3A 3L7WA 1U2WA 3HRTA 3LA2A 4BYYA 5FFZA 2ZMEB 3CLOA 2QQ9A 5BPDA 4LK1F 3I71A 4P9UA 2OQGA 2RNJA 3KP6A 4RB3C 1SAXA 3VODA 3COAC 1PUEE 2JZYA 1D8KA 1ON2A 5D6FA 4OMZA 1NHAA 1K6OA 2VE8A 3WE2A 1YTYA 3EQLF 1Z6TA 5D8KB 1FYKA 4IJAA 1K7AA 2RV8A 2VN2A 3HHGA 1FLIA 5J8CA 1DUXC 1H9GA 4L9NA 4MTEA 5JVTA 4I01A 4EM2A 3WTZA 2PI0A 2W57A 3GXOA 2Z3YA 1REPC 1YW8A 3ECOA 3MZHA 4G94A 2JTVA 4BNCA 2PFBA 1I1SA 2ZXJA 4U0YA 4M73A 5L3BA 4ENNA 5ICFA 2Q8KA 4P5OA 1OR7A 4ETSA 1HKTA 4M9SA 2JPBA 4UVAA 3O3KA 3T0YA 4JBAA 3TOAA 4CZZA 2RKHA 1B9MA 4HLYA 1RZ4A 3SQNA 3C3WA 3DFGA 2HYGD 2KKOA 3QU6A 1USSA 2MBFA 1TW3A 2DO7A 1KQ0A 3BJOA 2BE5F 3E5XA 4GO1A 3TKYA 2E1NA 3QP5A 4WXDA 1MGTA 2YR2A 2RC4A 3Q5FA 3GFMA 2UZKA 4KMUX 4N9IA 3ML6A 3FZVA 2JT1A 3GLXA 2RGVA 1HW2A 3FX3A 1ZARA 4U7BA 3V8JA 5LHHA 2O03A 3R4KA 3LQQA 1LEAA 2DAOA 2IPQX 1OYWA 4RAZA 2HKOA 2PLYA 3E6DA 1XSVA 3JTGA 3FXQA 1SD6A 2XKPA 2VBYA 4ZZDA 1YFHA 1YIOA 2D45A 1D5VA 1SFUA 1W7PD 2R7DA 1FY7A 2Z33A 3LA7A 2A6EF 2E7XA 1WI9A 5E20A 2P7VB 3BJ6A 3GUDA 2EFPA 5LLQA 3DEUA 1ZLKA 2L02A 1STZA 1TBXA 3KP2A 5BQTA 1ZRDA 2Z5UA 2ZJ2A 4EMSA 5DCMA 1YW7A 1SFEA 4TV7A 4L18B 4ZYDA 5HDNA 1LDJA 3RKWA 1MKMA 1J5YA 3EYIA 1ZGJA 5TJJA 4ESFA 4LD5A 3VFZA 1TTYA 5A2QK 2CSOA 3RPQA 4CYDA 3LQRA 4M72A 4JQFA 4BHBA 1F4KA 1Q1HA 2DU9A 2FMLA 4XSXF 1Z05A 1QPMA 3J7AO 1OPCA 2C6YA 2XV4S 3LSTA 3GF2A 1HW5A 3HYIA 5L3GA 2W24A 4P9FA 3I59B 1MJ9A 3K1MA 1U3EM 4Q48A 3MZYA 4EGYA 2PQ8A 4ZYGA 4U7DA 4KIBA 4P55A 3BDDA 4FHTA 1MDMB 1QGPA 4B8XA 2H27A 3CUQC 2FSWA 4N9HA 1AOYA 5DD8A 2VOPA 1F1ZA 3K2ZA 3JAMK 1QZYA 4S04A 2P6SA 2ADUA 2EWNA 3QAHA 2FBKA 3MCZA 3R0JA 3MWMA 1CF7A 1SMTA 4G7OF 3JAMZ 4KMFA 1GHCA 2A3SA 3IRRA 3G73A 2KJBA 4R79A 3FF5A 2VT3A 1T6SA 5FLXZ 2QUFA 4RB1A 1OYIA 3GEZA 4I2OA 1WWXA 5LGUA 4HX7A 2A61A 2PG4A 1SD4A 3HHHA 1F5TA 2FOKA 3V7RA 1YO5C 1LNWA 3J81Z 1IAWA 1U78A 3QU3A 2G7UA 3RDIA 1T39A 3QOPA 4MGRA 1Z91A 4A0YA 1U5TA 3S2WA 5HS9A 4ASNA 4YFXF 3F6OA 1HQCA 3HTUA 4L0ZB 2LF8A 4I98B 3KCCA 1B9NA 3TDUC 5BS6A 2G7HA 3E3VA 3BPVA 3K1PA 5L3DA 5DCMB 2MH9A 3VEPA 4KNYA 2VXZA 3SZPA 2FMYA 2XUBA 3B73A 4I0BA 1FP1D 3WTXC 2IA2A 1FSEA 2YU3A 3MAJA 4BQAA 2EV6A 4CXFA 5CJ9A 2L4AA 1W5SA 2EA2A 4M71A 2PEXA 4AIJA 1IZ1A 2W25A 4FX4A 3TO7A 4XLNF 4IRHA 5HDKA 1YS7A 4XSZF 2MA3A 2V6CA 3KFWX 4QLCU 2YX7A 4AIHA 2RN7A 2EFNA 2ZBKA 3ULQB 3AAFA 3JSPA 4LB5A 2FQ3A 2LNBA 5TRDA 1BJAA 4AVPA 2YPRA 4F7ZA 1DP7P 5LGNA 3ZN1A 4HF0A 4GXOA 4XLPF 1G3TA 3KLNA 2P6TA 4MNUA 4LK0F 3IKVA 3V7CA 2VC1A 4MHGA 4Z2YA 1CF7B 2BBYA 3WGIA 3ZMVA 2QVOA 4AIKA 2ZNZA 4ZH4F 3JSOA 5D5VB 1O7LA 1I1GA 2QZ8A 4EJVA 3FM5A 5DD4A 1JE8A 3ZMTA 4G7HF 2KJCA 5ICCA 5JFRA 2HOEA 5BMZA 4L5IA 3MFKA 2GAUA 1KGSA 4WWCA 2VOOA 1PDNC 3V7SA 1W4MA 2NNYA 3MQ0A 2WV0A 2LDUA 3E5UA 4YFNF 5J8FA 1FOKA 3DV8A 1P4XA 4OIQF 5LEKA 1IN7A 4KT5C 2XIGA 3ZN0A 4EQQA 4I09A 1BN5A 3SFZA 4PGHA 2PMHA 1IXCA 3ZMUA 5H6RA 1LJ9A 5L3EA 2AS5F 2M1BA 4BAYA 1WQ2A 2F5EA 1T0FA 1BI3A 2ZKZA 2CO5A 3NQOA 1R23A 4RS8A 1O57A 3HSRA 5LRSA 3NEUA 3T8TA 1EH7A 4IPAA 1QQIA 4IRIA 3RPUA 3HOTA 3C18A 1ZG5A 5DEQA 2J5OA 4L9TA 4D0PA 3Q9VA 1E2XA 2EFOA 4UXNA 2DPUA 4E70A 3CO6C 2KRFA 1I6XA 4MEYF 1YYVA 2LSOA 4L9VA 1QNTA 3R0AA 4G6DA 5DUKA 2W84A 2RDPA 1XSDA 3KETA 4HDUA 4U0WA 1IW7F 3KEQA 4O3MA 1L0OC 4G6QA 2H6BA 3V4GA 1LDKB 1XSXA 1XD7A 3RIRA 4EV0A 2FE3A 2HGCA 1KA8A 4GYIA 3I54A 1RI7A 2OA4A 5HLGA 1G3SA 2Y75A 2HQNA 2NS0A 5ICEA 2IA1A 1R36A 1VTNC 3CO7C 2FRHA 2NNNA 3I59A 5JHUA 1ZN2A 1YW9A 2XAJA 3F8CA 3J80K 3E6BA 5ERIA 3ISPA 2FXAA 1XMKA 1MDMA 3FHZA 1GXQA 1DPRA 4N0BA 1X3UA 4KN4X 2DT5A 3J80Z 5E1ZB 1KQ8A 1FT9A 2M87A 2ISYA 3ABUA 5BOXA 5DCFA 4LG0A 3LFKA 4BXUA 3WU0A 1TLHB 3W6JB 3BP8A 3F3XA 5LRRA 4RGXA 2RQPA 5HDGA 4U88A 1Y0UA 3CJNA 5DDGA 1TW2A 4LJZF 2GWRA 2XGXA 1ZRCA 2JRTA 2DI3A 4FX0A 2HFHA 1V3FA 3FWEA 4YG2F 1UHMA 4ENKA 1IRFA 2O0YA 4MEXF 3IWZA 1XCBA 4AD9A 4ON0A 2E7WA 3C7JA 3KP4A 4O5VA 5K1YA 1USTA 2F5FA 4ZZLA 5LBQA 4G7ZF 2STTA 3CUOA 4OOIA 1ZHFA 5LGTA 4HA8A 3FXRA 1FX7A 1TQIA 3ECHA 4HYEA 2DK8A 2OD5A 1KYWA 1R00A 4Q4ZF 1SD5A 2D2WA 2L4MA 2ETHA 1R22A 4ESJA 2YX4A 2PMUA 1WKMA 1JHFA 4Q5SF 1P6RA 3ZMSA 1RUNA 2ZNYA 4QWQA 5BPIA 3LAPA 5AIPA 3M1EA 1TNSA 3SXYA 5K5OA 1TNTA 2WC2A 4HX8A 5A2QZ 2F2EA 2J5PA 1Z7UA 3H92A 4Y15A 3QP6A 3U2RA 3DF8A 1O7FA 2P7CB 3R61A 4CO8A 5DUIA 4GGGA 3DPTA 1GVJA 4M9XA 1XDUA 1I27A 2STWA 4EM0B 3L00A 1U8RA 3P7NA 3GWZA 5K5QA 2OU2A 4HW0A 4OINF 3DQVC 2XRNA 2M5WA 3E5QA 5D6EA 5ILUA 3ZP5A 4A6DA 4LG0B 2L54A 1ZG3A 4XBFA 3T5XA 4KYWA 1BBYA 2XHKA 5CVJA 4U0VA 4LLLA 4JK1X 1S29A 3FMRA 2GA1A 1L3LA 1O3QA 2DBBA 2K27A 5D5XB 3R6SA 5FD5A 2GXBA 1OKRA 2UXXA 4RB0A 1BM9A 4WX9A 1FC3A 2KIFA 1U5TC 3CUQA 4WCGA 5E1WA 3BPXA 2IRFG 4R1HA 1EH8A 2P4WA 1HXDA 5HLIA 4NB5A 4OU0A 2VODA 3QRFF 4IF4A 2MLKA 1YS6A 2A5YB 2O61A 1B6AA 4KICA 1MZBA 3WTWC 4R8HA 3FM3A 4AWXB 3PQKA 3T1BA 4RGUA 3E6MA 2MD5A 2ZFWA 4S05A 1YG2A 3TOBA 4A6EA 1U6GA 2IVMA 1TQMA 4L9JA 4M9ZA 2BV6A 5DV5A 3E97A 1R1VA 4EJTA 2HEOA 1BC7C 3SZTA 2IW5A 3BOQA 2Z9OA 2UXNA 3HSFA 4CDGA 1SMYF 3WODF 2WTEA 1UB9A 1FWZA 3V8LA 2VT2A 5F64A 3BWGA 5LHIA 1C0WA 1YQAA 1FBUA 5H20A 3DPLC 2FA5A 1J0RA 2FNPA 3I0TA 1LDDA 4LFUA 5LHGA 4EVIA 1ZREA 2GXGA 1ONVA 3P9IA 1T98A 3ERED 1AWCA 2ZO4A 2EB7A 1WRJA 4I02A 5L3FA 1K79A 1FSHA 4YIFA 1FBQA 1O3TA 3IRQA 4WXHA 3GZ6A 3TQNA 1XGSA 6PAXA 2DTRA 4PZJA 2E1CA 2P8TA 2L01A 2DW4A 2XASA 1J9IA 2P5LC 3W6KB 2KIMA 2A07F 1SD7A 1HSJA 2PN6A 2NAZA 1B1BA 2AXLA 1LVAA 3FXUA 1XGNA 3L9FA 5IT3A 2IA0A 2VBXA 3ZMDA 3CUQB 4IRGA 3RKYA 2PJPA 4L0YB 3K0LA 2XROA 2HKXA 2ISZA 2QYOA 4Q47A 1KU3A 3GYHX 1MJAA 2A6HF 1IF1A
chains in the Genus database with same CATH superfamily
1Z9CA 1OMIA 3D5LA 2VLAA 2VJ4A 3JW4A 1KYZA 5AONA 2FF4A 2V4JC 1VQOI 2P5VA 2FU4A 1FBSA 3IH2A 1W7PA 1TL8A 3WG9A 2IP2A 4XKBA 2R7UA 5HLHA 1K83J 2V79A 4LB6B 3DCFA 4MTDA 1HW1A 1B8IA 1HKQA 2DMQA 1I5ZA 3H3ZA 3B6AA 3KZZA 4PSXA 4EGZA 2BY1A 4EJWA 1HSTA 2JRMA 4AIDA 4EJUA 2MVTA 2K86A 3MKWB 2VQHA 3HEFA 4ZYEA 3A0BC 1FNNA 2JUGA 5JHFA 2JWTA 2DQLA 1X3WB 2HZTA 5HODA 1G3YA 4JX6A 5J1UA 4ENJA 3O2PE 2EJRA 1UAAA 3VSLA 4CCNA 3BZ6A 2JA5J 2I5UA 1GVDA 2P81A 1SEUA 1JUMA 3NARA 2CW0F 2HQRA 5E18F 2H8WA 1BIAA 4O6JA 3JRDA 2H6CA 4HSTA 4CUGA 3IUOA 5IT9R 3K7AJ 1IUFA 1D3YA 3V8KA 5J6XA 3LAJA 3OYKA 3B02A 3CDHA 2BVLA 3PQJA 5E3LA 1P7IA 1D0XA 1IG7A 2DT7B 2CQ7A 3HIFA 3FXMA 2L7ZA 1IXRC 2VC0A 1JGSA 3CC4I 2CMPA 2EFWA 5EGOA 1FZPB 1P92A 2HS5A 2HXIA 3S8PA 2LTPA 2PMZA 3BY6A 3I58A 3KZIC 1FP2A 3KP7A 2JA6J 2EFQA 2A05A 5ILSA 4FASD 2F5DA 4BXXJ 3IKTA 3LFUA 2EA4A 2HTJA 2RVCA 2AQFA 1VFCA 3P9KA 4CCOA 1VQLI 1QHHD 2K40A 2KMUA 2CYYA 1E3HA 2XAUA 3BG3A 4LIVA 5LEJA 3OL3A 3C2BA 3ZMZA 1WJCA 1Z1DA 3HOWJ 1R1UA 2GIVA 5ED4A 4CICA 4A12A 2R5YA 1BW5A 1JT6A 5CVIA 5HVQC 2O8KA 3HRMA 1IUYA 3WTVC 2ELJA 2VONA 4RM2A 2VBWA 3G3ZA 3IWFA 3CC2I 4NHJA 2KRCA 1H89C 2OZ6A 2EZLA 1QO0D 2XGEA 4J19A 2ACJA 1BI0A 1IJWC 2Y30A 3PO3J 1IN8A 3R60A 2ESNA 3CMYA 2MH2A 5FB2A 5IT9K 2XSDC 2FUG2 1LE8A 5GAGJ 2HI3A 1D5YA 3L2UA 4PFOA 2EILH 2JK3A 1X1AA 2M7BA 1CGPA 2XF6A 4ZTJA 4DBRA 4AC0A 2QLZA 1E3OC 2CW8A 2QQAA 3X2QH 1XGMA 5IT9Z 3JRBA 1QHGA 3EETA 1OR7C 2B0LA 4AYBA 3OIQA 1UHSA 2JPCA 2GQQA 2XKOA 3FMSA 4RAFA 5B1BH 3QYEA 4KDPA 2DLLA 4A5MA 4XONA 2K4JA 4CCKA 1Z21A 3HRUA 2DFIA 2QF7A 2DMUA 3NWTA 3CQZJ 5E3NA 3WTYC 2EV5A 2FBIA 1Y8QB 4M6XA 2V9KA 3LNQA 4DW6A 1ZQ3P 1ZRFA 2X6WA 5HNHA 5FROA 4PCQA 2H94A 3DKYA 3PFIA 4WXCA 1DGRM 4A0XA 4OMYA 2WA0A 2QENA 1O3SA 2JJ7A 2Q0OA 3F8NA 1UG2A 1MJBA 4MQ9F 1P4AA 3F8MA 2BOLA 4HQMA 2V1UA 3DKWA 4FT8A 2K9QA 4G8XA 3PUBA 1SVOA 5M5YJ 4LLNA 3H36A 3H3UA 3ZQ7A 2CG4A 2O8XA 5FRMA 4PGGA 3G2BA 5EG0A 4Y3OA 1QBJA 2ID6A 3Q0UA 1W7PB 3BR3A 2O3FA 2VKVA 2KQRA 2WAQN 2HWVA 1W0UA 4BGDA 2E1MC 1J2XA 5HLTA 2R7RA 1WZ2A 3I64A 3FHNA 3MKLA 3I53A 1UMQA 3ZXSA 1B8IB 3KE2A 1QU3A 1JKRC 1XCVA 3G1LA 1TQPA 3H9JA 4FE7A 3TDZC 2JMWA 4RGRA 4F93B 3GFLA 3FXJA 4MQVA 4G12A 4LMYA 2M8EA 1ZG1A 1X2NA 4UHTA 4RAYA 4Y13A 4BH9A 5C3EJ 3WGHA 2DODA 1UELB 1V5FA 2DJNA 3GFIA 2QBYA 4M74A 1Y0NA 4KUMA 1X1DA 1JKPC 1UCRA 5E8IA 4BU2A 4HF1A 4EJOA 1LEBA 4BHPA 1PYVA 4QSHA 2R92J 3HOVJ 1MMGA 1B4AA 1P7JA 3TW6A 4CCLA 3TL4X 4IXAA 1H88C 1H8AC 1F43A 3CF2A 3WU1B 2CGPA 1IN4A 3GW2A 5EGOB 2Z1DA 3P5JA 2BEOA 1ZGAA 4UNOA 3QPHA 3QPTA 4IHXA 2COMA 3UR3C 4P1WA 5D5UB 1JGGA 2MYSA 1W36D 1JXSA 3F8FA 1SVMA 2NRAC 3M8EA 2XAGA 3IV5A 4II3A 2CWEA 1W5TA 3WTUC 1GV2A 3JTHA 2ZSIB 2K9MA 2XAHA 5JI6A 2QCOA 3T8RA 2PMZN 5GAEJ 1R7JA 3OOPA 1R49A 3WG7H 1T2KA 5IPAA 4CYCA 3CJTB 2HXOA 2KP6A 5CYVA 2VBZA 1MH3A 1S7AA 4PUSA 2M45A 3I5UA 2R5YB 3EUHA 2W7NA 1MNDA 4GYGA 2ZCWA 3HOXJ 2CQKA 3ZPLA 4KIGA 1TP4A 3PUFA 2V7FA 2LVSA 4B48A 4IO9F 4OIOF 2JSCA 2L3DA 5KK1A 3CCMI 2RAEA 1XPXA 2Y48A 1R5HA 1A04A 1BC8C 2L9RA 2HVRA 2VXDA 3U1KA 1TWHJ 1ON1A 3OS1A 3D5SC 2NVUB 1GXPA 3F8BA 1SANA 4HF2A 4OIPF 1RQ6A 1ZAOA 3BCBA 3CF5F 2FNAA 5D4RA 1TWGJ 1LE8B 3CCLI 1F9NA 3DP7A 2AO9A 4KFCA 3RSNA 2HZDA 2BW3A 5DTDA 4IEJA 5E1XA 3KP5A 4A2UA 2IS6A 3A52A 2FBHA 3WE3A 5HS8A 2VB6A 5D4SA 2GA2A 1XB4A 4RM3A 1B59A 1BIBA 3VPRA 1G4DA 2MC3A 3WTSC 4E7ZA 3KX2A 4DQ2A 4YIIA 4HNUA 3E1SA 3VYTB 1U9NA 3L2CA 1JHHA 3RYPA 4BACA 5CLSA 2DK5A 2V1DA 2Y0SA 1R4MB 1U0JA 3EDPA 3GZ5A 3NWSA 2CH0A 2JA8J 2LF7A 4UV8A 2H09A 5ILVA 3OYIA 2VE9A 3SHFA 1K78A 1WSUA 3K6GA 2KIUA 3K69A 1D1BA 1R5ID 3IC7A 3MMYB 1RUOA 1N75A 2GZWA 5EEAA 3HSEA 2MFZA 4F91B 2HR3A 1LQ1A 4I7HA 4YFKF 1IN5A 3MKYB 1RC9A 4ENMA 4A3LJ 2XF5A 3M7GA 3PM1A 3I4PA 3F21A 1SFXA 4GCVA 1XMAA 3PFYA 5IP9J 3BJAA 5H6QA 3JRGA 3PIOF 4B43A 3BG7A 4L5JA 2QGUA 1XX5A 4IQ4A 1ITYA 1J75A 1W1WE 2BGCA 3FMQA 3FXLA 2BYVE 3P9CA 3GFJA 5C44J 2ESHA 1S9HA 3EPZA 4I0AA 2HDCA 3HJEA 3OSGA 4M3BA 4A3DJ 2R7TA 4HV6A 3LWFA 1LKXA 1WFXA 2BHYA 1S6LA 1O3RA 3LA3A 2Z99A 4LGWA 4BDYA 4A3CJ 3TO6A 1Z3YA 3GTLJ 4ZDOA 1BI2A 3OY9A 1XGOA 2P0WA 5FO5A 1YJWI 1ZK8A 2M30A 3DXJF 5F1RA 1WH7A 5HOOA 4A3IJ 2OBPA 1KQ9A 2DDBA 3RKXA 2L9SA 3S1MJ 1YJNI 1R58A 2K85A 2QBYB 3KZYA 3KEOA 4OIRF 4BE0A 3IHUA 3S17J 1S3JA 2DQRA 2CU7A 3K4CA 4Y17A 3JREA 3HOSA 4BJTA 4E7HA 3TO9A 3S14J 4BKXA 4DYRA 3MD2A 3F6VA 5FLXK 1D8JA 1E17A 1JUSA 3ABKH 5K5RA 4H0EA 3LSKA 2KISA 2QQBA 4UUSB 3JRCA 5ICGA 4LOCA 1KU2A 1ENHA 5M5WJ 3S3MA 1UHWA 5EEHA 2LRDA 3J81K 3F23A 2CUFA 1V4RA 2VPLA 2HYFA 2ZJRF 2R7FA 2F5CA 3GTGJ 3PNVA 4XKCA 2Y31A 4OWRB 5CPRB 4NQWA 2FEZA 2HVSA 1ZH5A 3BQZA 1GLNA 2HDWA 2A69F 2ELHA 2K02A 4CYCB 3G4SI 2K4BA 2DN0A 2XAFA 3VB2A 4HBLA 4C2TA 2K3PA 5F6FA 5KVRA 5FJ8J 3N4MA 1DGWY 2X1CA 1DDNA 2DOAA 2OQRA 5FLVA 2W00A 1EH6A 4UVBA 1R71A 4KIFA 3CCJI 2L7FP 2O6GE 4EM1A 2XDVA 5TISC 2E19A 2XAQA 3V42A 3L09A 3WTTC 2DYRH 3F0CA 5CQEA 5E3MA 3I9V2 4XICA 1J59A 5D5WB 4HQEA 2IT0A 1FPQA 2BW3B 4DNCA 1X19A 2X1DA 3OYBA 4C2UA 4PSWA 3D0SA 1FTZA 5GAHJ 1FYLA 3S3NA 1GT0C 4UUVA 4NC6A 4UUTA 2D1VA 2HQ5A 2X4HA 4UVCA 3K2AA 1OFCX 3JR9A 5K7HA 3NRVA 2QSHX 2ZC2A 1OYYA 5E17F 3ZQIA 2UWMA 1DPUA 2CW7A 2PBIA 1WPKA 4XK4A 2P5KA 5F0CA 1K78B 1JTXA 5GTIC 2LKPA 4B09A 5B5EC 4A5NA 1FYMA 3TW7A 1H9TA 4BY1J 1FOXA 4E7LA 2CFXA 5D8LB 2IGOA 1A6IA 3GZNB 1K4TA 5F08A 2Y0SN 3HRSA 4XLCA 5JLXA 1HBXG 2W85A 2H8RA 3MVPA 3MN2A 5EZGA 2X85A 3RZOJ 3QYFA 4HDVA 2OF7A 3N97A 1PJRA 2CFOA 3KYDB 2E34A 3ZQGA 2VJ5A 4PJJA 9ANTA 5J1YA 3IL2A 4NC7A 1LB2A 3M3YJ 5FGMA 5L3CA 2ZJQF 2A68F 4K2EA 3HZJA 2EPFA 1VQ4I 1XN7A 3HUGA 3OYCA 1KONA 1IXSB 1JI8A 4V19K 2Q2EA 2ZMEA 3ABTA 3QWLA 2NYXA 5FD6A 1HKSA 2HVQA 3U9GA 3O6BB 3BR0A 4U87A 1V5EA 1Z6RA 1OCTC 2NS7A 4X1EA 1SC7A 4ESBA 1EV7A 1G2HA 2IGNA 1PP8F 1S8NA 3KP3A 4F3QA 1W36C 1ODDA 4WK8F 4PJMA 3GX4X 2NS8A 4B3AA 1K61A 3RTRA 3HM5A 2NVQJ 1UFMA 4ZDLA 4WF2A 1XDSA 2IJLA 3K1NA 4D7MA 5E8GA 4IKFA 2EK5A 3C1DA 1I3AA 2D1HA 2BY3A 3E6CC 4HZFA 5DYMA 1MBFA 4E6KG 3GO5A 2OZUA 1Y1VJ 4P96A 3WGGA 2QA4I 1J7KA 2HTSA 2XPVA 3B6CA 3A01A 4A0ZA 1OCCH 3CDLA 4Y52J 1YLFA 3LSMA 4LIUA 5EEGA 2CUJA 1T38A 4E4HA 1KU7A 3AG3H 4XRFA 5CVVA 2KIQA 3ZR8X 3Q9SA 2VKDA 1MD0A 3OYMA 1IRGA 2VKEA 1FTTA 1H0MA 2WAQA 3MEXA 2W82A 3OV8A 2K7LA 4B1RA 3G71I 1VQ6I 3KLOA 4KJZA 5C4XJ 2AHQA 4CH7A 4CGZA 4KN7X 5HS7A 4LLGF 4YELA 1AKHA 1OISA 1P4WA 1FOWA 1BW6A 4HAMA 4E7KA 1I3QJ 2E36A 5FFXA 1QZZA 4NQWB 4RB2C 4CHUA 4V2GA 2ZB9A 2G0EA 3OR2C 5KAFC 3CTAA 4XLFA 1YRNA 2Y9ZA 4HOBA 1IN6A 3OOUA 2WADA 1ZLJA 2M3AA 3U1DA 5CVRA 1RESA 1KU9A 1T0FC 1J09A 3HTSB 2OTLI 1ULYA 2N8GA 2BHZA 2Y0MA 1U5TB 1BR4A 2WY8Q 2QWWA 3JRHA 4YEJA 3VOEA 4HV5A 3ROUA 4PDKA 5KAIC 1RIOH 1X4OA 2WWYA 2CV0A 4XLEA 3REOA 3RYRA 2EV0A 3F22A 1ETQA 1WHUA 3ELKA 2HPIA 2W4SA 3GVAA 4XMYA 3IAM2 2QM3A 3M9AA 4RGSA 2F4IA 3FKIJ 2LBFA 4I99C 1P2FA 3OL4A 4HX4A 3EYYA 2X0LA 5E79C 2MLGA 4G6TB 2ME6A 1OLTA 3FXOA 2V9VA 1R5GA 3ZQQA 2R3SA 2F48A 2DPDA 2LD5A 4G9YA 2NOGA 4FE4A 3RJPA 3FBNB 2NVTJ 3D5RC 4UY8I 3BZKA 4UV9A 4S0HB 4KA4A 4BJ6C 3F72A 3K4JA 3TGNA 4ZYAA 3K9TA 1G6NA 2TDXA 1U9OA 1R9TJ 2OAZA 1OCOH 2V1XA 3BROA 1PP7U 3M1CA 5AIQA 3IAS2 1G3WA 2FJ1A 1BI1A 1S7OA 1ZYRF 2EZKA 2MG4A 4BUPA 3CCSI 1BOAA 3PSFA 4IHSA 3H3VK 2KLOA 4M6YA 4HLXA 1R1TA 1RNLA 4Z6YA 2YSRA 2YUSA 4ZYHA 3CMEI 2G9WA 3OIPA 2E2IJ 4CSWA 1AU7A 3M8FA 4IHTA 1HLVA 5CVUA 1BR2A 4IVNA 4B47A 2XVCA 4BHCA 2HU9A 4N4OB 3RI4A 5JR3A 3L7WA 1X1CA 1ZR4A 1U2WA 3HRTA 3LA2A 3HUGB 4BYYA 3S1RJ 2HDDA 5FFZA 2Q2EB 2ZMEB 3CLOA 4N4NB 2QQ9A 3HDDA 5BPDA 4LK1F 1WJDA 3I71A 4P9UA 2OQGA 2ZXIA 4C3IJ 2RNJA 3KP6A 2AXTC 2DXIA 1JKQC 4RB3C 1SAXA 1A31A 3VODA 3COAC 1PUEE 2JZYA 4HEA2 1D8KA 3ZRGA 4CZCA 1ON2A 5D6FA 3CCEI 4OMZA 2LY1A 1X1BA 4GRIA 1NHAA 1K6OA 2VE8A 4F52A 4CCMA 3WE2A 1YTYA 3EQLF 2WB1N 1Z6TA 3BR2A 3GTJJ 3LSPA 1TZLA 1RPWA 5D8KB 1M1EB 3CCYA 3K4MA 1FYKA 4IJAA 1K7AA 2RV8A 4RAGA 4IOAF 2VN2A 3HHGA 1FLIA 4Y33A 5J8CA 2VASA 2EIKH 2R0QC 3A01B 1DUXC 1ETVA 1GDTA 2CS3A 1H9GA 4L9NA 2EIMH 2MD0A 2D5VA 4MTEA 3WU2C 5JVTA 5GTHC 4I01A 4EM2A 5J4YA 3WTZA 5B3SH 2PI0A 3A02A 2W57A 1BOBA 1HDPA 4JOMA 3GXOA 3I56I 2Z3YA 1REPC 2IS4A 1YW8A 2LMDA 2L9VA 3ECOA 1BR1A 3MZHA 4G94A 2JTVA 4BNCA 3CCRI 2PFBA 3GMEA 4PJLA 1AKHB 1I1SA 3OYEA 3AG1H 2ZXJA 4U0YA 4M73A 2MGQA 5L3BA 3OYAA 1WJ5A 4ENNA 1VQ8I 3GTPJ 5ICFA 2Q8KA 4P5OA 1OR7A 1D1AA 2OUMA 4ETSA 2KRHA 1HKTA 4M9SA 3TMOA 4PFPA 2I8DA 2BY0A 2JPBA 1YRNB 3W2VA 4UVAA 3FISA 2LFBA 2TRTA 3O3KA 3QODA 3T0YA 2L0KA 4JBAA 3TOAA 3BLYA 1JJ6C 1GV5A 4CZZA 2RKHA 3W3CA 1B9MA 4HLYA 1RZ4A 2JA2A 2IS1A 1MBJA 1KZHA 3VWBA 3SQNA 3C3WA 3DFGA 5FKLA 2HYGD 3G1OA 2WAEA 2KKOA 1I39A 1USSA 2MBFA 3QU6A 1TW3A 4XKVA 4ZC3A 5CKTA 2XF7A 2E71A 3BR5A 2DO7A 1KQ0A 3BJOA 1RRJA 2BE5F 3E5XA 3DU6A 4GO1A 1B72A 4KITB 3TKYA 4I6ZA 3ERMA 2E1NA 2NOJB 1E3PA 3QP5A 4WXDA 1MGTA 2YR2A 2RC4A 4NDLA 4D5FA 3Q5FA 3GFMA 2LBFB 2UZKA 3UKGA 2DMTA 4KMUX 4N9IA 1WI3A 4RMNA 3ML6A 3FZVA 1Y8RB 2JT1A 3DTEA 3GLXA 4UUSA 3QOEA 2RGVA 4ZDPA 3LSJA 3E0JB 4M3GA 1HW2A 3FX3A 1ZARA 4U7BA 4C2MJ 2LLKA 3ZGKA 1VNDA 3V8JA 3K4LA 2COBA 2DFEA 3SZGA 5LHHA 2O03A 3R4KA 3SEQA 4GFBA 3S15J 3AL0C 3LQQA 1LEAA 2DAOA 1SFKA 3OYLA 2IPQX 1OYWA 4RAZA 4B4CA 2HKOA 2PLYA 3E6DA 1XSVA 3JTGA 2DA7A 3FXQA 1R6RA 1SD6A 2E60A 2EBIA 2XKPA 3H5NA 3OYFA 4QPQA 1RKWA 2VBYA 4ZZDA 2PX9A 1YFHA 1YIOA 2D45A 1D5VA 2M35A 2CUZA 4XR6A 3D1NI 1V5GA 1SFUA 1W7PD 3KEYA 1MW7A 2GIZA 3LL7A 2R7DA 3DTIA 1FY7A 2Z33A 3LA7A 2A6EF 1MMSA 2E7XA 5IYDJ 1WI9A 5E20A 2P7VB 3BJ6A 3GUDA 2EFPA 3DEUA 5LLQA 2DTZA 1ZLKA 1FIPA 1A6QA 1Z67A 2L02A 1STZA 1TBXA 4E7SA 3KP2A 5BQTA 1ZRDA 2HNHA 2Z5UA 2ZJ2A 4EMSA 5DCMA 1YW7A 4IHYA 1SFEA 4TV7A 4L18B 4ZYDA 2O7OA 2QKLB 1JT0A 2R7XA 5HDNA 4D7NA 4PK4A 3OSFA 1LDJA 2F4OB 2UV1A 3RKWA 2X6XA 2NVYJ 1RKTA 1MKMA 1J5YA 3EYIA 2KT0A 2XB0X 1ZGJA 1OQYA 5TJJA 4ESFA 4LD5A 4HSRA 5IYBJ 2LK2A 3VFZA 2GLOA 1HC8A 2ME0A 1TTYA 1Z77A 5A2QK 2CSOA 4X6AJ 1D1CA 3JAMR 3RPQA 3QPLA 4IL6C 4CYDA 3LQRA 3G6EI 3GTQJ 4M72A 4JQFA 4BHBA 1Y56A 2HYJA 1F4KA 2KZGA 1Q1HA 3K10A 2K9NA 5FLXR 5J3LA 3ZQCA 2DU9A 2FMLA 3LOCA 3S1NJ 4XSXF 3AKZA 1Z05A 1QPMA 3PNYA 3J7AO 5BNGA 3JRFA 1NK3P 1OPCA 2C6YA 3J81R 2XV4S 3L1PA 3LSTA 1LUJB 1V54H 2QKMB 3GF2A 5FKNA 1HW5A 3HYIA 5L3GA 3OWTA 2CV2A 2W24A 4P9FA 3I59B 2DMPA 1MJ9A 3Q3SA 3W6VA 3BG5A 3K1MA 1U3EM 5LD2C 3M07A 2HPMA 3QYBA 4IZZA 4Q48A 4RLQA 3MZYA 4EGYA 1YITI 2PQ8A 2JQ7A 4MFDA 4ZYGA 4U7DA 2EZHA 3CD6I 2O5RA 2XGDA 4KIBA 4Y7NJ 2M4KA 1HCRA 2LG4A 3K4KA 4P55A 2JSPA 3L2WA 3BDDA 4FHTA 1MDMB 2E1OA 4XIDA 4A3EJ 1QGPA 2ECCA 3ASNH 4B8XA 1ZGWA 4LITA 2H27A 3CUQC 5EJCA 4QTRA 2FSWA 4N9HA 4IHWA 2JUCA 1AOYA 5DD8A 1IV8A 3PL8A 2VOPA 1F1ZA 4J01A 3K2ZA 3JAMK 1QZYA 3FBIB 4S04A 2DT6A 2P6SA 1B72B 2ADUA 2EWNA 1POGA 2FX0A 3LMMA 3QAHA 2FBKA 3MCZA 1ORKA 3N05A 3R0JA 2NXNB 2XPWA 3MWMA 1CF7A 1T08B 1SMTA 3TBIA 4G7OF 2E1MB 3JAMZ 4NC8A 1WJAA 3KIOA 4KMFA 1GHCA 2A3SA 3IRRA 3G73A 2KJBA 3TEDA 1JKOC 4R79A 2KHMA 3A4CA 3VYUB 1AA7A 1WGXA 3FF5A 4NUBA 5K7ZA 2ELKA 2VT3A 3DBHB 1K6YA 1MMNA 1T6SA 5FLXZ 2QUFA 4RB1A 4M6VA 1OYIA 3GEZA 3HPHA 4I2OA 3ZOBA 3LSRA 1WWXA 3DLAA 4HX7A 5LGUA 2A61A 5IY5H 2PG4A 1SD4A 3HHHA 1F5TA 2FOKA 3J7YJ 1XMXA 1Q1VA 3V7RA 1YO5C 1LNWA 1UG0A 3J81Z 1IAWA 1U78A 4HNTA 3HOZJ 3QU3A 2VI6A 4D9JA 2G7UA 4BXFA 1CQTA 3QPSA 3RDIA 5F04A 1T39A 1RUNA 4XLAA 4AUXA 2B63J 3QOPA 2LP0A 4MGRA 3C2GA 1Z91A 3PNTA 2XSJC 4A0YA 2M2EA 1U5TA 3S2WA 1QZEA 5K7FA 5HS9A 4ASNA 2K9SA 4YFXF 1IRXA 3F6OA 1HQCA 2VL8A 3HTUA 2L7KA 4L0ZB 2LF8A 4I98B 3KCCA 4IHVA 1ETWA 1B9NA 3TDUC 3CLQA 5BS6A 1P9QC 2G7HA 4BS9A 2DFFA 2OC6A 4A3GJ 4FTHA 3FK6A 3E3VA 3BPVA 4XOTA 4A3MJ 2CUEA 3K1PA 5L3DA 4B3XA 1SVLA 5DCMB 2MH9A 3VEPA 4EEFG 4KNYA 4FETA 3SFIA 2VXZA 4H4KC 3SZPA 2FMYA 3OYJA 2XUBA 3B73A 4RBOA 4I0BA 5FRNA 1FP1D 1JUPA 4A3JJ 3TP3A 1TC3C 3WTXC 5M3FJ 2DA3A 3BG9A 1S7EA 2IA2A 4ITVA 1FSEA 1OJLA 5IOZA 2Z16A 2YU3A 2QSFX 3MAJA 4ABZA 3MZ8A 4BQAA 3SDBA 4YIRX 3I4MJ 2EV6A 3K4BA 4CXFA 5J47A 3Q0VA 1QPIA 4OAYA 2I10A 5C4JJ 5CJ9A 5IOYA 5LFAA 2VKHA 5M5XJ 1HA8A 1Z3XA 2L4AA 4DYQA 1G8XA 2QSGX 2BY2A 1W5SA 2EA2A 1D0YA 4M71A 2DFHA 2KDZA 2H1LA 2PEXA 3VYSB 4AIJA 1VQPI 3CESA 4II2A 3EUKL 1IDZA 1IZ1A 2MABA 3FKJA 2W25A 4FX4A 1FMWA 4E7JA 3W2AA 3TO7A 4XLNF 2ZSHB 2OV7A 3I55I 1LVKA 4IRHA 1TT0A 4BY7J 1O4XA 5HDKA 5JLWA 1YS7A 4XSZF 2GBYA 2MA3A 2V6CA 3KFWX 2R7QA 2ZFUA 4QLCU 3JCUC 1QA6A 2YX7A 4AIHA 2RN7A 3VYRB 3A0HC 3DLLF 3U21A 2ZJPF 2EFNA 2WBMA 1MBGA 2ZBKA 2WB1A 3ULQB 3JSPA 3AAFA 3HOUJ 1ERDA 4LB5A 2DMNA 2FQ3A 2LNBA 5TRDA 1BJAA 2Q1ZB 2CJJA 3IP4B 4AVPA 5DM6F 2JVGA 1U8BA 3RQIA 2YPRA 4F7ZA 1DP7P 4FCYA 5LGNA 3ZN1A 4F55A 4XL9A 4HF0A 3O8GA 5CQGA 4GXOA 4XLPF 1G3TA 1TWCJ 2EINH 3KLNA 2P6TA 4MNUA 4LK0F 2KZVA 1LFUP 3IKVA 1Y39A 3V7CA 2VC1A 4XOPA 4C3HJ 4UB6C 4MHGA 4Z2YA 2X9DA 5GPCA 4W1UA 1CF7B 1TT5B 2BBYA 3WGIA 1AHDP 3CCVI 3ZMVA 2R7OA 2QVOA 4AIKA 1WJFA 2ZNZA 2MSYA 3SDGA 4ZH4F 2JA7J 3JSOA 5D5VB 1O7LA 1I1GA 3BTCA 2QZ8A 4EJVA 2V6EA 2YU9J 3FM5A 2HOSA 5DD4A 1JE8A 3ZMTA 4G7HF 2KJCA 2KFDA 5ICCA 2M7AA 3NAUA 5JFRA 2DDAA 3BG6A 3KYCB 1PUFB 5E3OA 2HOEA 2B9SA 5BMZA 4L5IA 5FKMA 2IXSA 3MFKA 2GAUA 2E5ZA 2BVMA 3L2RA 1KGSA 2DCEA 1MH4A 4AVZA 4WWCA 1PDNC 2VOOA 2M4GA 1Z0XA 3BTJA 3V7SA 1W4MA 2NNYA 1HOMA 3MQ0A 2WV0A 3WHBA 4IX7A 5IYCJ 2LDUA 3PO2J 1BA5A 4ZJZA 3E5UA 1GUUA 4YFNF 1SFOJ 5J8FA 1FOKA 3DV8A 1IO2A 3BCAA 4BQQA 1P4XA 4BE1A 4XRSA 4OIQF 2RNGA 1R4NB 2EZIA 3ESWB 2EH3A 1I6HJ 5LEKA 1MSEC 1IN7A 1EA3A 2XIGA 4KT5C 3ZN0A 4EQQA 4KT6A 1VQKI 3CDIA 3JRIA 4I09A 5FKKA 1BN5A 1XTAA 3SFZA 4PGHA 3GBGA 4DGWB 1QRYA 2PMHA 1IXCA 3ZMUA 2UUZA 5H6RA 1LJ9A 2X6OA 5L3EA 2VQGA 4DYCA 3H0DA 2AS5F 2M1BA 4BAYA 3DPUA 5GP9A 1WQ2A 2CQNA 2F4MB 2VQCA 2PJRA 2F5EA 4C9YA 3SJMA 1T0FA 1ETXA 5DS9A 5DM7F 2ZKZA 1BI3A 1WJBA 2CO5A 3NQOA 1R23A 2IGMA 2DJIA 4RS8A 1O57A 3ZCOA 2X6YA 3HSRA 5LRSA 3NEUA 3T8TA 3JRAA 1EH7A 4IPAA 4Y4RA 3RCOA 1LFPA 1QQIA 4IRIA 3RPUA 5B1AH 4JX4A 3L2VA 3C18A 3HOTA 1ZG5A 2DOFA 1MBHA 1YHQI 2CV1A 3SEZA 2KL4A 2K9LA 1I50J 4J00A 5DEQA 1XS9A 1VQ5I 4XNFA 2WY7Q 2L2OA 4DZPA 4ZTFA 2J5OA 4IQJA 1NTCA 3O8HA 3S16J 1VF9A 4L9TA 4XORA 4M3DA 1ETKA 4D0PA 4A93J 4RLFA 2VJIA 4A3FJ 1VZ0A 1WH5A 3HGGA 3K4NA 1MIJA 3Q9VA 5FKOA 1E2XA 1WVRA 2EFOA 4UXNA 5EYRA 4BBRJ 5KNLA 3OYNA 2DPUA 2TCTA 4E70A 3CO6C 2KRFA 1I6XA 3J7AY 1D0ZA 3M4OJ 4MEYF 2Y69H 1YYVA 2OTJI 2LSOA 4BDZA 1QVUA 1FIAA 4L9VA 1QNTA 3J80R 2Y9YA 3R0AA 1XG1A 2YS9A 4G6DA 5DUKA 2W84A 2RDPA 1XSDA 5F1JA 2H1KA 4KISA 3KETA 4HDUA 4U0WA 1IW7F 2R7SA 3CP8A 1WCMJ 3KPHA 3KEQA 4O3MA 1L0OC 4G6QA 3CJQB 2R93J 2H6BA 3V4GA 1LDKB 1XSXA 1XD7A 3AG2H 3RIRA 4RA2A 4EV0A 3I4NJ 3VSKA 2FE3A 2HGCA 1KA8A 1YX3A 4GYIA 3S1QJ 2B7EA 3I54A 3WHCA 1T33A 2M9HA 3BR1A 1LFBA 1RI7A 2E5NA 1A35A 2LH9A 2OA4A 5B66C 5HLGA 1G3SA 1VQNI 2Y75A 2HQNA 3CJRB 2OCEA 2E2HJ 1S72I 2NS0A 2X98A 5ICEA 4EATA 3IH3A 1XC5A 2R7VA 2IA1A 3BTIA 1R36A 1VTNC 1EKEA 3OYHA 3HXLA 1LPQA 4XRMA 3CO7C 2FRHA 2NNNA 1YOVB 3BZCA 3K70D 3I59A 2LC2A 2R7WA 1YI2I 1FJLA 1YJ9I 4DBQA 3OYDA 1F36A 1MBEA 3OMYA 1ZN2A 1YW9A 2OJED 5JHUA 2XAJA 3F8CA 4FQGA 3S3OA 1UJ8A 3OYGA 3J80K 3E6BA 2ZXWH 5ERIA 3ISPA 2FXAA 2E2JJ 1XMKA 3F9KA 2X48A 3LSHA 2VUMJ 1YIJI 1MDMA 3G1MA 3FHZA 3RZDJ 1X3ZB 1GXQA 1DPRA 2EIJH 3DTKA 3J7ZI 1ZR2A 1DU6A 4N0BA 1X3UA 4KN4X 1JJ8C 2DT5A 3KYLA 1HDDC 3J80Z 3M8JA 2OPTA 3VDXA 3ONQA 5E1ZB 1KQ8A 3BTLA 2IEKA 1FT9A 2M87A 4PJ0C 4E7IA 2FOWA 3ABLH 2GOXB 2X51A 2ISYA 2LY2A 3L2QA 1Y1WJ 3ABUA 5BOXA 2A5WA 3SYTA 1X4PA 5DCFA 4LG0A 3AFHA 3LFKA 4XN0A 4BXUA 3WU0A 1TLHB 3W2WA 3W6JB 3H9GA 3BP8A 3S2HJ 2XC7A 1VI0A 3F3XA 5LRRA 2M0CA 4RGXA 2RQPA 3GLLA 2A6TA 5HDGA 5M3MJ 4I76A 4U88A 2LREA 4JX5A 2PJRB 1MMAA 3EUHC 1Y0UA 3LSIA 3E7LA 3CJNA 5DDGA 5KCMA 1TW2A 4LJZF 3PJRA 2GWRA 2XGXA 1UZCA 1ZRCA 2DA4A 5A2QR 2JRTA 1BJZA 2DI3A 2ZXHA 4FX0A 2HFHA 1V3FA 3FWEA 4YG2F 3OS2A 4CCJA 1UHMA 4ENKA 1IRFA 2O0YA 4MEXF 4C3JJ 3IWZA 3ZQLA 1VQ7I 3DEEA 2IS2A 1XCBA 4AD9A 4ON0A 2E7WA 3C7JA 3HB9A 3KP4A 4O5VA 2LKSA 1MBKA 5K1YA 1USTA 3CP2A 2GM4A 2F5FA 4XQFA 4UB8C 4ZZLA 5LBQA 4G7ZF 2LY9A 2FD5A 2STTA 5HNFA 3DWLE 2V1NA 1ZTRA 5EZHA 3H5AA 3CUOA 1FEXA 3ASOH 4OOIA 1V55H 3HC7A 1ZHFA 5LGTA 2HOTA 1A5JA 4HA8A 2L9NA 3FXRA 4D1QA 3A2KA 1S5LC 5F27A 3CCQI 4XLHA 1FX7A 2X1EA 1IC8A 1Y6IA 4PJNA 1ACIA 2K5CA 3QQAA 5GPAA 1TQIA 3ECHA 4BE2A 4HYEA 2DK8A 2OD5A 2VQLA 1KYWA 1T95A 1R00A 4Q4ZF 1SD5A 2D2WA 2L4MA 2DA6A 2ETHA 1ZKGA 1R22A 4ESJA 2YX4A 3BT9A 1QVTA 2PMUA 1WKMA 1IDYA 4V2FA 4BEHA 3Q0WA 1JHFA 3H5RA 4Q5SF 2BXZA 3HL2A 2CQQA 3IH4A 3HBLA 4MO7A 3ZQFA 1P6RA 3HKZA 1N25A 3ZMSA 1NG6A 2ZNYA 1NG7A 4QWQA 3LAPA 3HG9A 5BPIA 4M3EA 5AIPA 3M1EA 4IOCF 1TNSA 3SXYA 5K5OA 1TNTA 2WC2A 4HX8A 5J4VA 2F2EA 5A2QZ 2J5PA 1Z7UA 2QQ8A 3H92A 5FLMJ 3HOYJ 4Y15A 3QP6A 1MMDA 3I3LA 2FQ4A 4BQOA 4AYBN 2CQXA 3U2RA 3DF8A 4BJ5C 2BXYA 1O7FA 2P7CB 3LSGA 2E35A 2F6CA 3R61A 4GGGA 3RPUD 4CO8A 3DPTA 5DUIA 1GVJA 4M9XA 1XDUA 1I27A 2IGKA 4DOZA 3FXKA 2STWA 4EM0B 3L00A 1U8RA 1FOYA 2M0MA 3P7NA 2R5ZA 1IGNA 4XRSG 3GWZA 5K5QA 5EG0B 4BQNA 2OU2A 3CMMA 4HW0A 4OINF 2LKXA 3RQ4A 3DQVC 2XRNA 2DA5A 2M5WA 2R4GA 3E5QA 2VJJA 5D6EA 5ILUA 3ZP5A 2R7ZJ 4MLOA 4ANJA 3EUAA 4XN3A 4F92B 5F0FA 4A6DA 3GTMJ 3DKXA 4LG0B 2O9LA 4D5CA 2L54A 1ZG3A 4XBFA 3T5XA 1VQ9I 4KYWA 2RREA 3CMAI 1VQMI 2VPRA 1BBYA 2XHKA 3H0GJ 5CVJA 4CA0A 3BR6A 2GXAA 4DJAA 4U0VA 4DZJA 2HOAA 4LLLA 1DP3A 2NVXJ 3ABMH 4JK1X 2DA2A 1S29A 1YE9A 3FMRA 1NH3A 5JVGF 4NBQA 2GA1A 2V9PA 1L3LA 1O3QA 2MZ4A 2K3FA 3J7AW 2DBBA 2K27A 2DA1A 3FIWA 3R6SA 3HPGA 5FD5A 5D5XB 2GXBA 1IRZA 4HNVA 2XPUA 3BC8A 1OKRA 2UXXA 4RB0A 1BM9A 4WX9A 1FC3A 2KIFA 1U5TC 1TWAJ 3CUQA 4WCGA 5F0HA 5E1WA 3BPXA 3DBRB 3CZ6A 3GCMA 5EF6A 1PUFA 2IRFG 4R1HA 1EH8A 2XB5A 2P4WA 1K4SA 1HXDA 4BL0B 4B44A 5HLIA 2BZTA 4NB5A 2MW8A 4AM3A 1OCPA 4OU0A 2W1OA 2VODA 4XM3A 2CRGA 3QRFF 4IF4A 2MLKA 1YX5A 4MIMA 4GDFA 1HF0A 1YS6A 2A5YB 2O61A 1ETOA 1B6AA 4KICA 1MZBA 3WTWC 4R8HA 5TGTA 3OIOA 2DYSH 1APLC 3FM3A 5H2FC 4AWXB 3PQKA 3T1BA 4RGUA 4W97A 3TP0A 3E6MA 1SAUA 1PVEA 2WV1A 3C2HA 4YRVA 4AU7A 2V26A 3AL0B 2MD5A 3OR1C 2ICWG 1ZELA 2ECBA 1X2MA 4M3FA 2ZFWA 3BQYA 3A03A 2MC4A 4XKWA 4S05A 1YG2A 3TOBA 4A6EA 2QEXI 1U6GA 2IVMA 1TQMA 4L5EA 1MNMC 3K70C 1OCRH 4L9JA 3H9QA 2F5VA 3CCUI 4M9ZA 3GTOJ 5GADJ 1X58A 2AQEA 2BV6A 5DV5A 3OS0A 2L7MP 3E97A 2KDOA 4BEHB 1R1VA 2XGCA 4EJTA 2HEOA 4HG2A 4C30A 3S2DJ 4A69C 1RR7A 3DEWA 1X1PA 2LYCA 1TWFJ 1Z7LA 1BC7C 3SZTA 2IW5A 2ZMEC 3BOQA 2RQQA 2LOOA 2Z9OA 2UXNA 2ID3A 3A1YA 4RDUA 2Y2ZA 3HSFA 4CDGA 1SMYF 1ETYA 4BBSJ 3HKZN 2IBDA 3WODF 2WTEA 2VIXA 1UB9A 1FWZA 3V8LA 2VT2A 5F64A 3BWGA 2IAIA 5LHIA 3FK7A 1C0WA 2M34A 1YQAA 1FBUA 4QIWN 3PIPF 1T8IA 5H20A 3DPLC 3AG4H 2FA5A 3HGYA 3PSIA 1J0RA 2FNPA 3I0TA 1LDDA 4LFUA 1NK2P 5LHGA 4HRIA 4EVIA 5KHDA 1ZREA 2WAFA 3S32A 2JN6A 2R5ZB 1IV6A 2GXGA 1ONVA 3P9IA 1EJ9A 1T98A 3ERED 1AWCA 3RKQA 2P0TA 1FMVA 2ZO4A 4JP0A 2EB7A 1WRJA 4I02A 1DQUA 4FISA 5L3FA 1E0EA 2DOEA 2M8GX 1OCZH 3H1CA 3MKZA 1K79A 1EF4A 2L5QA 4YIFA 1FSHA 1FBQA 3UNGC 1O3TA 3IRQA 5IP7J 1T56A 4WXHA 3GZ6A 4JYKA 4QPOA 3TQNA 3GTKJ 1XGSA 2OCCH 5EDNA 3DU5A 3S93A 1W5CC 1A36A 6PAXA 2DTRA 4PZJA 2E1CA 4MFEA 2P8TA 2L01A 2DW4A 1G59A 2XASA 1J9IA 2P5LC 3W6KB 2KIMA 1MSFC 1N78A 2JVHA 2KPMA 2W48A 4DIQA 2A07F 1SD7A 4LG3A 2EQRA 2XRLA 2MUNA 1JTYA 1HSJA 1RETA 1W0TA 3DBLB 3FDYA 1DU0A 2PN6A 2NAZA 5J40A 2HQAA 4OAZA 1B1BA 1MNEA 1LVAA 2AXLA 1XGNA 3FXUA 3L9FA 5IT3A 1RR8C 1N77A 2Z2SB 4A3BJ 2IA0A 2VBXA 3ZMDA 4A3KJ 2GOMA 3CC7I 3CUQB 2LR8A 4IRGA 5J1RA 3RKYA 3ZQHA 3H35A 2PJPA 4L0YB 3K0LA 4X0GA 2XROA 2HKXA 4HPQA 2ISZA 2QYOA 4Q47A 1KU3A 5IP6A 1BL0A 1WJEA 3GYHX 1MJAA 2A6HF 4NNJA 1IF1A
chains in the Genus database with same CATH topology
1Z9CA 1OMIA 3D5LA 3JW4A 1KYZA 5AONA 2FF4A 2P5VA 2FU4A 1FBSA 1W7PA 3WG9A 2IP2A 5HLHA 2V79A 4LB6B 4MTDA 1HW1A 1HKQA 1I5ZA 3H3ZA 3KZZA 4EGZA 4EJWA 1HSTA 4EJUA 2K86A 4ZYEA 1FNNA 2DQLA 2HZTA 1G3YA 4ENJA 3O2PE 2EJRA 3BZ6A 2CW0F 2HQRA 5E18F 1BIAA 4O6JA 2H6CA 3LAJA 1D3YA 3V8KA 5J6XA 3B02A 3CDHA 3PQJA 3HIFA 1IXRC 2VC0A 1JGSA 2EFWA 1FZPB 1P92A 2HS5A 3BY6A 3I58A 1FP2A 3KP7A 2EFQA 5ILSA 2F5DA 3IKTA 2EA4A 2HTJA 2RVCA 3P9KA 2CYYA 5LEJA 3ZMZA 1Z1DA 1R1UA 2GIVA 5ED4A 4CICA 4A12A 5CVIA 5HVQC 3HRMA 1IUYA 3WTVC 2VONA 2VBWA 3G3ZA 3IWFA 4NHJA 2OZ6A 1QO0D 2ACJA 1BI0A 1IN8A 3R60A 2ESNA 2MH2A 5FB2A 5IT9K 1CGPA 2QLZA 2QQAA 1XGMA 5IT9Z 3EETA 2B0LA 2JPCA 2GQQA 2XKOA 3FMSA 4KDPA 2DLLA 4A5MA 2K4JA 3HRUA 2DFIA 3WTYC 2EV5A 2FBIA 4M6XA 1ZRFA 4PCQA 2H94A 3PFIA 4WXCA 4A0XA 4OMYA 2QENA 1O3SA 2Q0OA 3F8NA 1MJBA 4MQ9F 1P4AA 3F8MA 4HQMA 2V1UA 3DKWA 4FT8A 4G8XA 4LLNA 3H3UA 3ZQ7A 2CG4A 2O8XA 4PGGA 1QBJA 1W7PB 2O3FA 2HWVA 1J2XA 3I64A 3I53A 3KE2A 1XCVA 1TQPA 3TDZC 4RGRA 3GFLA 4MQVA 4LMYA 2M8EA 1ZG1A 4UHTA 4RAYA 4Y13A 4BH9A 3WGHA 3GFIA 2QBYA 4M74A 4KUMA 1UCRA 5E8IA 4HF1A 4EJOA 1LEBA 4BHPA 1B4AA 4IXAA 3WU1B 2CGPA 1IN4A 3GW2A 2BEOA 1ZGAA 4UNOA 3QPHA 3QPTA 2COMA 5D5UB 1JXSA 3F8FA 2NRAC 3M8EA 2XAGA 2CWEA 1W5TA 3WTUC 3JTHA 2XAHA 5JI6A 3T8RA 1R7JA 3OOPA 1T2KA 5CYVA 2VBZA 1S7AA 2M45A 3I5UA 3EUHA 4GYGA 2ZCWA 2CQKA 3ZPLA 4KIGA 4OIOF 2JSCA 2L3DA 5KK1A 2Y48A 1R5HA 1A04A 1BC8C 1ON1A 1GXPA 3F8BA 4HF2A 4OIPF 1ZAOA 2FNAA 5D4RA 1F9NA 3DP7A 4KFCA 5E1XA 3KP5A 4A2UA 2FBHA 3WE3A 5HS8A 5D4SA 2GA2A 1XB4A 1B59A 1BIBA 1G4DA 2MC3A 3WTSC 4DQ2A 4YIIA 3L2CA 1JHHA 3RYPA 5CLSA 2DK5A 2V1DA 3GZ5A 3EDPA 2VE9A 2LF7A 4UV8A 2H09A 5ILVA 3SHFA 1K78A 1WSUA 2KIUA 3K69A 3IC7A 1RUOA 2GZWA 3HSEA 2HR3A 1LQ1A 4I7HA 4YFKF 1IN5A 4ENMA 3M7GA 3I4PA 3F21A 1SFXA 4GCVA 1XMAA 3BJAA 5H6QA 4L5JA 1J75A 2BGCA 3FMQA 2BYVE 3P9CA 3GFJA 2ESHA 4I0AA 2HDCA 4HV6A 3LWFA 1O3RA 1S6LA 3LA3A 2Z99A 4LGWA 3TO6A 1BI2A 1XGOA 5FO5A 2M30A 3DXJF 5F1RA 5HOOA 2OBPA 1KQ9A 3RKXA 1R58A 2QBYB 3KZYA 3KEOA 4OIRF 3IHUA 1S3JA 2DQRA 4Y17A 3HOSA 3TO9A 3F6VA 5FLXK 1D8JA 1E17A 5K5RA 4H0EA 2QQBA 5ICGA 1KU2A 1UHWA 5EEHA 3J81K 3F23A 1V4RA 2HYFA 2R7FA 2F5CA 4NQWA 2FEZA 1ZH5A 2A69F 2ELHA 2K02A 2K4BA 2XAFA 3VB2A 4HBLA 5F6FA 5KVRA 3N4MA 1DDNA 2OQRA 1EH6A 4UVBA 4KIFA 2O6GE 4EM1A 2XAQA 3L09A 3WTTC 1J59A 5D5WB 4HQEA 2IT0A 1FPQA 4DNCA 3D0SA 1FYLA 4UUVA 2D1VA 2X4HA 4UVCA 3NRVA 1OYYA 5E17F 2UWMA 1DPUA 2PBIA 2P5KA 1K78B 2LKPA 4B09A 4A5NA 1FYMA 1H9TA 2CFXA 5D8LB 3HRSA 1HBXG 2W85A 4HDVA 3N97A 3IL2A 1LB2A 5FGMA 5L3CA 2A68F 4K2EA 1XN7A 3HUGA 1IXSB 2Q2EA 2ZMEA 3ABTA 2NYXA 5FD6A 1HKSA 3U9GA 3O6BB 1Z6RA 4ESBA 1EV7A 1PP8F 1S8NA 3KP3A 1ODDA 4WK8F 3GX4X 3RTRA 1UFMA 4WF2A 1XDSA 2IJLA 3K1NA 5E8GA 2EK5A 3C1DA 2D1HA 3E6CC 4HZFA 5DYMA 3GO5A 2OZUA 4P96A 3WGGA 1J7KA 2HTSA 4A0ZA 1YLFA 5EEGA 1T38A 1KU7A 4XRFA 5CVVA 3Q9SA 1MD0A 1IRGA 1H0MA 3MEXA 3OV8A 2K7LA 3KLOA 4CGZA 4KN7X 5HS7A 4LLGF 1P4WA 4HAMA 4CHUA 5FFXA 1QZZA 4RB2C 3CTAA 4HOBA 1IN6A 1ZLJA 3U1DA 5CVRA 1KU9A 3HTSB 1ULYA 2Y0MA 1U5TB 2QWWA 3VOEA 4HV5A 3ROUA 4PDKA 1RIOH 2WWYA 3REOA 3RYRA 2EV0A 3F22A 3ELKA 3GVAA 2QM3A 3M9AA 4RGSA 1P2FA 4HX4A 3EYYA 2X0LA 2MLGA 2V9VA 1R5GA 2R3SA 2DPDA 4G9YA 3RJPA 4UV9A 4KA4A 3F72A 3TGNA 3K9TA 1G6NA 2TDXA 2OAZA 2V1XA 3BROA 1PP7U 5AIQA 1G3WA 1BI1A 1S7OA 1ZYRF 1BOAA 4IHSA 4M6YA 4HLXA 1R1TA 1RNLA 2YSRA 4ZYHA 2G9WA 3M8FA 4IHTA 5CVUA 4IVNA 2XVCA 4BHCA 3RI4A 5JR3A 3L7WA 1U2WA 3HRTA 3LA2A 4BYYA 5FFZA 2ZMEB 3CLOA 2QQ9A 5BPDA 4LK1F 3I71A 4P9UA 2OQGA 2RNJA 3KP6A 4RB3C 1SAXA 3VODA 3COAC 1PUEE 2JZYA 1D8KA 1ON2A 5D6FA 4OMZA 1NHAA 1K6OA 2VE8A 3WE2A 1YTYA 3EQLF 1Z6TA 5D8KB 1FYKA 4IJAA 1K7AA 2RV8A 2VN2A 3HHGA 1FLIA 5J8CA 1DUXC 1H9GA 4L9NA 4MTEA 5JVTA 4I01A 4EM2A 3WTZA 2PI0A 2W57A 3GXOA 2Z3YA 1REPC 1YW8A 3ECOA 3MZHA 4G94A 2JTVA 4BNCA 2PFBA 1I1SA 2ZXJA 4U0YA 4M73A 5L3BA 4ENNA 5ICFA 2Q8KA 4P5OA 1OR7A 4ETSA 1HKTA 4M9SA 2JPBA 4UVAA 3O3KA 3T0YA 4JBAA 3TOAA 4CZZA 2RKHA 1B9MA 4HLYA 1RZ4A 3SQNA 3C3WA 3DFGA 2HYGD 2KKOA 3QU6A 1USSA 2MBFA 1TW3A 2DO7A 1KQ0A 3BJOA 2BE5F 3E5XA 4GO1A 3TKYA 2E1NA 3QP5A 4WXDA 1MGTA 2YR2A 2RC4A 3Q5FA 3GFMA 2UZKA 4KMUX 4N9IA 3ML6A 3FZVA 2JT1A 3GLXA 2RGVA 1HW2A 3FX3A 1ZARA 4U7BA 3V8JA 5LHHA 2O03A 3R4KA 3LQQA 1LEAA 2DAOA 2IPQX 1OYWA 4RAZA 2HKOA 2PLYA 3E6DA 1XSVA 3JTGA 3FXQA 1SD6A 2XKPA 2VBYA 4ZZDA 1YFHA 1YIOA 2D45A 1D5VA 1SFUA 1W7PD 2R7DA 1FY7A 2Z33A 3LA7A 2A6EF 2E7XA 1WI9A 5E20A 2P7VB 3BJ6A 3GUDA 2EFPA 5LLQA 3DEUA 1ZLKA 2L02A 1STZA 1TBXA 3KP2A 5BQTA 1ZRDA 2Z5UA 2ZJ2A 4EMSA 5DCMA 1YW7A 1SFEA 4TV7A 4L18B 4ZYDA 5HDNA 1LDJA 3RKWA 1MKMA 1J5YA 3EYIA 1ZGJA 5TJJA 4ESFA 4LD5A 3VFZA 1TTYA 5A2QK 2CSOA 3RPQA 4CYDA 3LQRA 4M72A 4JQFA 4BHBA 1F4KA 1Q1HA 2DU9A 2FMLA 4XSXF 1Z05A 1QPMA 3J7AO 1OPCA 2C6YA 2XV4S 3LSTA 3GF2A 1HW5A 3HYIA 5L3GA 2W24A 4P9FA 3I59B 1MJ9A 3K1MA 1U3EM 4Q48A 3MZYA 4EGYA 2PQ8A 4ZYGA 4U7DA 4KIBA 4P55A 3BDDA 4FHTA 1MDMB 1QGPA 4B8XA 2H27A 3CUQC 2FSWA 4N9HA 1AOYA 5DD8A 2VOPA 1F1ZA 3K2ZA 3JAMK 1QZYA 4S04A 2P6SA 2ADUA 2EWNA 3QAHA 2FBKA 3MCZA 3R0JA 3MWMA 1CF7A 1SMTA 4G7OF 3JAMZ 4KMFA 1GHCA 2A3SA 3IRRA 3G73A 2KJBA 4R79A 3FF5A 2VT3A 1T6SA 5FLXZ 2QUFA 4RB1A 1OYIA 3GEZA 4I2OA 1WWXA 5LGUA 4HX7A 2A61A 2PG4A 1SD4A 3HHHA 1F5TA 2FOKA 3V7RA 1YO5C 1LNWA 3J81Z 1IAWA 1U78A 3QU3A 2G7UA 3RDIA 1T39A 3QOPA 4MGRA 1Z91A 4A0YA 1U5TA 3S2WA 5HS9A 4ASNA 4YFXF 3F6OA 1HQCA 3HTUA 4L0ZB 2LF8A 4I98B 3KCCA 1B9NA 3TDUC 5BS6A 2G7HA 3E3VA 3BPVA 3K1PA 5L3DA 5DCMB 2MH9A 3VEPA 4KNYA 2VXZA 3SZPA 2FMYA 2XUBA 3B73A 4I0BA 1FP1D 3WTXC 2IA2A 1FSEA 2YU3A 3MAJA 4BQAA 2EV6A 4CXFA 5CJ9A 2L4AA 1W5SA 2EA2A 4M71A 2PEXA 4AIJA 1IZ1A 2W25A 4FX4A 3TO7A 4XLNF 4IRHA 5HDKA 1YS7A 4XSZF 2MA3A 2V6CA 3KFWX 4QLCU 2YX7A 4AIHA 2RN7A 2EFNA 2ZBKA 3ULQB 3AAFA 3JSPA 4LB5A 2FQ3A 2LNBA 5TRDA 1BJAA 4AVPA 2YPRA 4F7ZA 1DP7P 5LGNA 3ZN1A 4HF0A 4GXOA 4XLPF 1G3TA 3KLNA 2P6TA 4MNUA 4LK0F 3IKVA 3V7CA 2VC1A 4MHGA 4Z2YA 1CF7B 2BBYA 3WGIA 3ZMVA 2QVOA 4AIKA 2ZNZA 4ZH4F 3JSOA 5D5VB 1O7LA 1I1GA 2QZ8A 4EJVA 3FM5A 5DD4A 1JE8A 3ZMTA 4G7HF 2KJCA 5ICCA 5JFRA 2HOEA 5BMZA 4L5IA 3MFKA 2GAUA 1KGSA 4WWCA 2VOOA 1PDNC 3V7SA 1W4MA 2NNYA 3MQ0A 2WV0A 2LDUA 3E5UA 4YFNF 5J8FA 1FOKA 3DV8A 1P4XA 4OIQF 5LEKA 1IN7A 4KT5C 2XIGA 3ZN0A 4EQQA 4I09A 1BN5A 3SFZA 4PGHA 2PMHA 1IXCA 3ZMUA 5H6RA 1LJ9A 5L3EA 2AS5F 2M1BA 4BAYA 1WQ2A 2F5EA 1T0FA 1BI3A 2ZKZA 2CO5A 3NQOA 1R23A 4RS8A 1O57A 3HSRA 5LRSA 3NEUA 3T8TA 1EH7A 4IPAA 1QQIA 4IRIA 3RPUA 3HOTA 3C18A 1ZG5A 5DEQA 2J5OA 4L9TA 4D0PA 3Q9VA 1E2XA 2EFOA 4UXNA 2DPUA 4E70A 3CO6C 2KRFA 1I6XA 4MEYF 1YYVA 2LSOA 4L9VA 1QNTA 3R0AA 4G6DA 5DUKA 2W84A 2RDPA 1XSDA 3KETA 4HDUA 4U0WA 1IW7F 3KEQA 4O3MA 1L0OC 4G6QA 2H6BA 3V4GA 1LDKB 1XSXA 1XD7A 3RIRA 4EV0A 2FE3A 2HGCA 1KA8A 4GYIA 3I54A 1RI7A 2OA4A 5HLGA 1G3SA 2Y75A 2HQNA 2NS0A 5ICEA 2IA1A 1R36A 1VTNC 3CO7C 2FRHA 2NNNA 3I59A 5JHUA 1ZN2A 1YW9A 2XAJA 3F8CA 3J80K 3E6BA 5ERIA 3ISPA 2FXAA 1XMKA 1MDMA 3FHZA 1GXQA 1DPRA 4N0BA 1X3UA 4KN4X 2DT5A 3J80Z 5E1ZB 1KQ8A 1FT9A 2M87A 2ISYA 3ABUA 5BOXA 5DCFA 4LG0A 3LFKA 4BXUA 3WU0A 1TLHB 3W6JB 3BP8A 3F3XA 5LRRA 4RGXA 2RQPA 5HDGA 4U88A 1Y0UA 3CJNA 5DDGA 1TW2A 4LJZF 2GWRA 2XGXA 1ZRCA 2JRTA 2DI3A 4FX0A 2HFHA 1V3FA 3FWEA 4YG2F 1UHMA 4ENKA 1IRFA 2O0YA 4MEXF 3IWZA 1XCBA 4AD9A 4ON0A 2E7WA 3C7JA 3KP4A 4O5VA 5K1YA 1USTA 2F5FA 4ZZLA 5LBQA 4G7ZF 2STTA 3CUOA 4OOIA 1ZHFA 5LGTA 4HA8A 3FXRA 1FX7A 1TQIA 3ECHA 4HYEA 2DK8A 2OD5A 1KYWA 1R00A 4Q4ZF 1SD5A 2D2WA 2L4MA 2ETHA 1R22A 4ESJA 2YX4A 2PMUA 1WKMA 1JHFA 4Q5SF 1P6RA 3ZMSA 1RUNA 2ZNYA 4QWQA 5BPIA 3LAPA 5AIPA 3M1EA 1TNSA 3SXYA 5K5OA 1TNTA 2WC2A 4HX8A 5A2QZ 2F2EA 2J5PA 1Z7UA 3H92A 4Y15A 3QP6A 3U2RA 3DF8A 1O7FA 2P7CB 3R61A 4CO8A 5DUIA 4GGGA 3DPTA 1GVJA 4M9XA 1XDUA 1I27A 2STWA 4EM0B 3L00A 1U8RA 3P7NA 3GWZA 5K5QA 2OU2A 4HW0A 4OINF 3DQVC 2XRNA 2M5WA 3E5QA 5D6EA 5ILUA 3ZP5A 4A6DA 4LG0B 2L54A 1ZG3A 4XBFA 3T5XA 4KYWA 1BBYA 2XHKA 5CVJA 4U0VA 4LLLA 4JK1X 1S29A 3FMRA 2GA1A 1L3LA 1O3QA 2DBBA 2K27A 5D5XB 3R6SA 5FD5A 2GXBA 1OKRA 2UXXA 4RB0A 1BM9A 4WX9A 1FC3A 2KIFA 1U5TC 3CUQA 4WCGA 5E1WA 3BPXA 2IRFG 4R1HA 1EH8A 2P4WA 1HXDA 5HLIA 4NB5A 4OU0A 2VODA 3QRFF 4IF4A 2MLKA 1YS6A 2A5YB 2O61A 1B6AA 4KICA 1MZBA 3WTWC 4R8HA 3FM3A 4AWXB 3PQKA 3T1BA 4RGUA 3E6MA 2MD5A 2ZFWA 4S05A 1YG2A 3TOBA 4A6EA 1U6GA 2IVMA 1TQMA 4L9JA 4M9ZA 2BV6A 5DV5A 3E97A 1R1VA 4EJTA 2HEOA 1BC7C 3SZTA 2IW5A 3BOQA 2Z9OA 2UXNA 3HSFA 4CDGA 1SMYF 3WODF 2WTEA 1UB9A 1FWZA 3V8LA 2VT2A 5F64A 3BWGA 5LHIA 1C0WA 1YQAA 1FBUA 5H20A 3DPLC 2FA5A 1J0RA 2FNPA 3I0TA 1LDDA 4LFUA 5LHGA 4EVIA 1ZREA 2GXGA 1ONVA 3P9IA 1T98A 3ERED 1AWCA 2ZO4A 2EB7A 1WRJA 4I02A 5L3FA 1K79A 1FSHA 4YIFA 1FBQA 1O3TA 3IRQA 4WXHA 3GZ6A 3TQNA 1XGSA 6PAXA 2DTRA 4PZJA 2E1CA 2P8TA 2L01A 2DW4A 2XASA 1J9IA 2P5LC 3W6KB 2KIMA 2A07F 1SD7A 1HSJA 2PN6A 2NAZA 1B1BA 2AXLA 1LVAA 3FXUA 1XGNA 3L9FA 5IT3A 2IA0A 2VBXA 3ZMDA 3CUQB 4IRGA 3RKYA 2PJPA 4L0YB 3K0LA 2XROA 2HKXA 2ISZA 2QYOA 4Q47A 1KU3A 3GYHX 1MJAA 2A6HF 1IF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9C A;  1OMI A;  3D5L A;  3JW4 A;  1KYZ A;  5AON A;  2FF4 A;  2P5V A;  2FU4 A;  1FBS A;  1W7P A;  3WG9 A;  2IP2 A;  5HLH A;  2V79 A;  4LB6 B;  4MTD A;  1HW1 A;  1HKQ A;  1I5Z A;  3H3Z A;  3KZZ A;  4EGZ A;  4EJW A;  1HST A;  4EJU A;  2K86 A;  4ZYE A;  1FNN A;  2DQL A;  2HZT A;  1G3Y A;  4ENJ A;  3O2P E;  2EJR A;  3BZ6 A;  2CW0 F;  2HQR A;  5E18 F;  1BIA A;  4O6J A;  2H6C A;  3LAJ A;  1D3Y A;  3V8K A;  5J6X A;  3B02 A;  3CDH A;  3PQJ A;  3HIF A;  1IXR C;  2VC0 A;  1JGS A;  2EFW A;  1FZP B;  1P92 A;  2HS5 A;  3BY6 A;  3I58 A;  1FP2 A;  3KP7 A;  2EFQ A;  5ILS A;  2F5D A;  3IKT A;  2EA4 A;  2HTJ A;  2RVC A;  3P9K A;  2CYY A;  5LEJ A;  3ZMZ A;  1Z1D A;  1R1U A;  2GIV A;  5ED4 A;  4CIC A;  4A12 A;  5CVI A;  5HVQ C;  3HRM A;  1IUY A;  3WTV C;  2VON A;  2VBW A;  3G3Z A;  3IWF A;  4NHJ A;  2OZ6 A;  1QO0 D;  2ACJ A;  1BI0 A;  1IN8 A;  3R60 A;  2ESN A;  2MH2 A;  5FB2 A;  5IT9 K;  1CGP A;  2QLZ A;  2QQA A;  1XGM A;  5IT9 Z;  3EET A;  2B0L A;  2JPC A;  2GQQ A;  2XKO A;  3FMS A;  4KDP A;  2DLL A;  4A5M A;  2K4J A;  3HRU A;  2DFI A;  3WTY C;  2EV5 A;  2FBI A;  4M6X A;  1ZRF A;  4PCQ A;  2H94 A;  3PFI A;  4WXC A;  4A0X A;  4OMY A;  2QEN A;  1O3S A;  2Q0O A;  3F8N A;  1MJB A;  4MQ9 F;  1P4A A;  3F8M A;  4HQM A;  2V1U A;  3DKW A;  4FT8 A;  4G8X A;  4LLN A;  3H3U A;  3ZQ7 A;  2CG4 A;  2O8X A;  4PGG A;  1QBJ A;  1W7P B;  2O3F A;  2HWV A;  1J2X A;  3I64 A;  3I53 A;  3KE2 A;  1XCV A;  1TQP A;  3TDZ C;  4RGR A;  3GFL A;  4MQV A;  4LMY A;  2M8E A;  1ZG1 A;  4UHT A;  4RAY A;  4Y13 A;  4BH9 A;  3WGH A;  3GFI A;  2QBY A;  4M74 A;  4KUM A;  1UCR A;  5E8I A;  4HF1 A;  4EJO A;  1LEB A;  4BHP A;  1B4A A;  4IXA A;  3WU1 B;  2CGP A;  1IN4 A;  3GW2 A;  2BEO A;  1ZGA A;  4UNO A;  3QPH A;  3QPT A;  2COM A;  5D5U B;  1JXS A;  3F8F A;  2NRA C;  3M8E A;  2XAG A;  2CWE A;  1W5T A;  3WTU C;  3JTH A;  2XAH A;  5JI6 A;  3T8R A;  1R7J A;  3OOP A;  1T2K A;  5CYV A;  2VBZ A;  1S7A A;  2M45 A;  3I5U A;  3EUH A;  4GYG A;  2ZCW A;  2CQK A;  3ZPL A;  4KIG A;  4OIO F;  2JSC A;  2L3D A;  5KK1 A;  2Y48 A;  1R5H A;  1A04 A;  1BC8 C;  1ON1 A;  1GXP A;  3F8B A;  4HF2 A;  4OIP F;  1ZAO A;  2FNA A;  5D4R A;  1F9N A;  3DP7 A;  4KFC A;  5E1X A;  3KP5 A;  4A2U A;  2FBH A;  3WE3 A;  5HS8 A;  5D4S A;  2GA2 A;  1XB4 A;  1B59 A;  1BIB A;  1G4D A;  2MC3 A;  3WTS C;  4DQ2 A;  4YII A;  3L2C A;  1JHH A;  3RYP A;  5CLS A;  2DK5 A;  2V1D A;  3GZ5 A;  3EDP A;  2VE9 A;  2LF7 A;  4UV8 A;  2H09 A;  5ILV A;  3SHF A;  1K78 A;  1WSU A;  2KIU A;  3K69 A;  3IC7 A;  1RUO A;  2GZW A;  3HSE A;  2HR3 A;  1LQ1 A;  4I7H A;  4YFK F;  1IN5 A;  4ENM A;  3M7G A;  3I4P A;  3F21 A;  1SFX A;  4GCV A;  1XMA A;  3BJA A;  5H6Q A;  4L5J A;  1J75 A;  2BGC A;  3FMQ A;  2BYV E;  3P9C A;  3GFJ A;  2ESH A;  4I0A A;  2HDC A;  4HV6 A;  3LWF A;  1O3R A;  1S6L A;  3LA3 A;  2Z99 A;  4LGW A;  3TO6 A;  1BI2 A;  1XGO A;  5FO5 A;  2M30 A;  3DXJ F;  5F1R A;  5HOO A;  2OBP A;  1KQ9 A;  3RKX A;  1R58 A;  2QBY B;  3KZY A;  3KEO A;  4OIR F;  3IHU A;  1S3J A;  2DQR A;  4Y17 A;  3HOS A;  3TO9 A;  3F6V A;  5FLX K;  1D8J A;  1E17 A;  5K5R A;  4H0E A;  2QQB A;  5ICG A;  1KU2 A;  1UHW A;  5EEH A;  3J81 K;  3F23 A;  1V4R A;  2HYF A;  2R7F A;  2F5C A;  4NQW A;  2FEZ A;  1ZH5 A;  2A69 F;  2ELH A;  2K02 A;  2K4B A;  2XAF A;  3VB2 A;  4HBL A;  5F6F A;  5KVR A;  3N4M A;  1DDN A;  2OQR A;  1EH6 A;  4UVB A;  4KIF A;  2O6G E;  4EM1 A;  2XAQ A;  3L09 A;  3WTT C;  1J59 A;  5D5W B;  4HQE A;  2IT0 A;  1FPQ A;  4DNC A;  3D0S A;  1FYL A;  4UUV A;  2D1V A;  2X4H A;  4UVC A;  3NRV A;  1OYY A;  5E17 F;  2UWM A;  1DPU A;  2PBI A;  2P5K A;  1K78 B;  2LKP A;  4B09 A;  4A5N A;  1FYM A;  1H9T A;  2CFX A;  5D8L B;  3HRS A;  1HBX G;  2W85 A;  4HDV A;  3N97 A;  3IL2 A;  1LB2 A;  5FGM A;  5L3C A;  2A68 F;  4K2E A;  1XN7 A;  3HUG A;  1IXS B;  2Q2E A;  2ZME A;  3ABT A;  2NYX A;  5FD6 A;  1HKS A;  3U9G A;  3O6B B;  1Z6R A;  4ESB A;  1EV7 A;  1PP8 F;  1S8N A;  3KP3 A;  1ODD A;  4WK8 F;  3GX4 X;  3RTR A;  1UFM A;  4WF2 A;  1XDS A;  2IJL A;  3K1N A;  5E8G A;  2EK5 A;  3C1D A;  2D1H A;  3E6C C;  4HZF A;  5DYM A;  3GO5 A;  2OZU A;  4P96 A;  3WGG A;  1J7K A;  2HTS A;  4A0Z A;  1YLF A;  5EEG A;  1T38 A;  1KU7 A;  4XRF A;  5CVV A;  3Q9S A;  1MD0 A;  1IRG A;  1H0M A;  3MEX A;  3OV8 A;  2K7L A;  3KLO A;  4CGZ A;  4KN7 X;  5HS7 A;  4LLG F;  1P4W A;  4HAM A;  4CHU A;  5FFX A;  1QZZ A;  4RB2 C;  3CTA A;  4HOB A;  1IN6 A;  1ZLJ A;  3U1D A;  5CVR A;  1KU9 A;  3HTS B;  1ULY A;  2Y0M A;  1U5T B;  2QWW A;  3VOE A;  4HV5 A;  3ROU A;  4PDK A;  1RIO H;  2WWY A;  3REO A;  3RYR A;  2EV0 A;  3F22 A;  3ELK A;  3GVA A;  2QM3 A;  3M9A A;  4RGS A;  1P2F A;  4HX4 A;  3EYY A;  2X0L A;  2MLG A;  2V9V A;  1R5G A;  2R3S A;  2DPD A;  4G9Y A;  3RJP A;  4UV9 A;  4KA4 A;  3F72 A;  3TGN A;  3K9T A;  1G6N A;  2TDX A;  2OAZ A;  2V1X A;  3BRO A;  1PP7 U;  5AIQ A;  1G3W A;  1BI1 A;  1S7O A;  1ZYR F;  1BOA A;  4IHS A;  4M6Y A;  4HLX A;  1R1T A;  1RNL A;  2YSR A;  4ZYH A;  2G9W A;  3M8F A;  4IHT A;  5CVU A;  4IVN A;  2XVC A;  4BHC A;  3RI4 A;  5JR3 A;  3L7W A;  1U2W A;  3HRT A;  3LA2 A;  4BYY A;  5FFZ A;  2ZME B;  3CLO A;  2QQ9 A;  5BPD A;  4LK1 F;  3I71 A;  4P9U A;  2OQG A;  2RNJ A;  3KP6 A;  4RB3 C;  1SAX A;  3VOD A;  3COA C;  1PUE E;  2JZY A;  1D8K A;  1ON2 A;  5D6F A;  4OMZ A;  1NHA A;  1K6O A;  2VE8 A;  3WE2 A;  1YTY A;  3EQL F;  1Z6T A;  5D8K B;  1FYK A;  4IJA A;  1K7A A;  2RV8 A;  2VN2 A;  3HHG A;  1FLI A;  5J8C A;  1DUX C;  1H9G A;  4L9N A;  4MTE A;  5JVT A;  4I01 A;  4EM2 A;  3WTZ A;  2PI0 A;  2W57 A;  3GXO A;  2Z3Y A;  1REP C;  1YW8 A;  3ECO A;  3MZH A;  4G94 A;  2JTV A;  4BNC A;  2PFB A;  1I1S A;  2ZXJ A;  4U0Y A;  4M73 A;  5L3B A;  4ENN A;  5ICF A;  2Q8K A;  4P5O A;  1OR7 A;  4ETS A;  1HKT A;  4M9S A;  2JPB A;  4UVA A;  3O3K A;  3T0Y A;  4JBA A;  3TOA A;  4CZZ A;  2RKH A;  1B9M A;  4HLY A;  1RZ4 A;  3SQN A;  3C3W A;  3DFG A;  2HYG D;  2KKO A;  3QU6 A;  1USS A;  2MBF A;  1TW3 A;  2DO7 A;  1KQ0 A;  3BJO A;  2BE5 F;  3E5X A;  4GO1 A;  3TKY A;  2E1N A;  3QP5 A;  4WXD A;  1MGT A;  2YR2 A;  2RC4 A;  3Q5F A;  3GFM A;  2UZK A;  4KMU X;  4N9I A;  3ML6 A;  3FZV A;  2JT1 A;  3GLX A;  2RGV A;  1HW2 A;  3FX3 A;  1ZAR A;  4U7B A;  3V8J A;  5LHH A;  2O03 A;  3R4K A;  3LQQ A;  1LEA A;  2DAO A;  2IPQ X;  1OYW A;  4RAZ A;  2HKO A;  2PLY A;  3E6D A;  1XSV A;  3JTG A;  3FXQ A;  1SD6 A;  2XKP A;  2VBY A;  4ZZD A;  1YFH A;  1YIO A;  2D45 A;  1D5V A;  1SFU A;  1W7P D;  2R7D A;  1FY7 A;  2Z33 A;  3LA7 A;  2A6E F;  2E7X A;  1WI9 A;  5E20 A;  2P7V B;  3BJ6 A;  3GUD A;  2EFP A;  5LLQ A;  3DEU A;  1ZLK A;  2L02 A;  1STZ A;  1TBX A;  3KP2 A;  5BQT A;  1ZRD A;  2Z5U A;  2ZJ2 A;  4EMS A;  5DCM A;  1YW7 A;  1SFE A;  4TV7 A;  4L18 B;  4ZYD A;  5HDN A;  1LDJ A;  3RKW A;  1MKM A;  1J5Y A;  3EYI A;  1ZGJ A;  5TJJ A;  4ESF A;  4LD5 A;  3VFZ A;  1TTY A;  5A2Q K;  2CSO A;  3RPQ A;  4CYD A;  3LQR A;  4M72 A;  4JQF A;  4BHB A;  1F4K A;  1Q1H A;  2DU9 A;  2FML A;  4XSX F;  1Z05 A;  1QPM A;  3J7A O;  1OPC A;  2C6Y A;  2XV4 S;  3LST A;  3GF2 A;  1HW5 A;  3HYI A;  5L3G A;  2W24 A;  4P9F A;  3I59 B;  1MJ9 A;  3K1M A;  1U3E M;  4Q48 A;  3MZY A;  4EGY A;  2PQ8 A;  4ZYG A;  4U7D A;  4KIB A;  4P55 A;  3BDD A;  4FHT A;  1MDM B;  1QGP A;  4B8X A;  2H27 A;  3CUQ C;  2FSW A;  4N9H A;  1AOY A;  5DD8 A;  2VOP A;  1F1Z A;  3K2Z A;  3JAM K;  1QZY A;  4S04 A;  2P6S A;  2ADU A;  2EWN A;  3QAH A;  2FBK A;  3MCZ A;  3R0J A;  3MWM A;  1CF7 A;  1SMT A;  4G7O F;  3JAM Z;  4KMF A;  1GHC A;  2A3S A;  3IRR A;  3G73 A;  2KJB A;  4R79 A;  3FF5 A;  2VT3 A;  1T6S A;  5FLX Z;  2QUF A;  4RB1 A;  1OYI A;  3GEZ A;  4I2O A;  1WWX A;  5LGU A;  4HX7 A;  2A61 A;  2PG4 A;  1SD4 A;  3HHH A;  1F5T A;  2FOK A;  3V7R A;  1YO5 C;  1LNW A;  3J81 Z;  1IAW A;  1U78 A;  3QU3 A;  2G7U A;  3RDI A;  1T39 A;  3QOP A;  4MGR A;  1Z91 A;  4A0Y A;  1U5T A;  3S2W A;  5HS9 A;  4ASN A;  4YFX F;  3F6O A;  1HQC A;  3HTU A;  4L0Z B;  2LF8 A;  4I98 B;  3KCC A;  1B9N A;  3TDU C;  5BS6 A;  2G7H A;  3E3V A;  3BPV A;  3K1P A;  5L3D A;  5DCM B;  2MH9 A;  3VEP A;  4KNY A;  2VXZ A;  3SZP A;  2FMY A;  2XUB A;  3B73 A;  4I0B A;  1FP1 D;  3WTX C;  2IA2 A;  1FSE A;  2YU3 A;  3MAJ A;  4BQA A;  2EV6 A;  4CXF A;  5CJ9 A;  2L4A A;  1W5S A;  2EA2 A;  4M71 A;  2PEX A;  4AIJ A;  1IZ1 A;  2W25 A;  4FX4 A;  3TO7 A;  4XLN F;  4IRH A;  5HDK A;  1YS7 A;  4XSZ F;  2MA3 A;  2V6C A;  3KFW X;  4QLC U;  2YX7 A;  4AIH A;  2RN7 A;  2EFN A;  2ZBK A;  3ULQ B;  3AAF A;  3JSP A;  4LB5 A;  2FQ3 A;  2LNB A;  5TRD A;  1BJA A;  4AVP A;  2YPR A;  4F7Z A;  1DP7 P;  5LGN A;  3ZN1 A;  4HF0 A;  4GXO A;  4XLP F;  1G3T A;  3KLN A;  2P6T A;  4MNU A;  4LK0 F;  3IKV A;  3V7C A;  2VC1 A;  4MHG A;  4Z2Y A;  1CF7 B;  2BBY A;  3WGI A;  3ZMV A;  2QVO A;  4AIK A;  2ZNZ A;  4ZH4 F;  3JSO A;  5D5V B;  1O7L A;  1I1G A;  2QZ8 A;  4EJV A;  3FM5 A;  5DD4 A;  1JE8 A;  3ZMT A;  4G7H F;  2KJC A;  5ICC A;  5JFR A;  2HOE A;  5BMZ A;  4L5I A;  3MFK A;  2GAU A;  1KGS A;  4WWC A;  2VOO A;  1PDN C;  3V7S A;  1W4M A;  2NNY A;  3MQ0 A;  2WV0 A;  2LDU A;  3E5U A;  4YFN F;  5J8F A;  1FOK A;  3DV8 A;  1P4X A;  4OIQ F;  5LEK A;  1IN7 A;  4KT5 C;  2XIG A;  3ZN0 A;  4EQQ A;  4I09 A;  1BN5 A;  3SFZ A;  4PGH A;  2PMH A;  1IXC A;  3ZMU A;  5H6R A;  1LJ9 A;  5L3E A;  2AS5 F;  2M1B A;  4BAY A;  1WQ2 A;  2F5E A;  1T0F A;  1BI3 A;  2ZKZ A;  2CO5 A;  3NQO A;  1R23 A;  4RS8 A;  1O57 A;  3HSR A;  5LRS A;  3NEU A;  3T8T A;  1EH7 A;  4IPA A;  1QQI A;  4IRI A;  3RPU A;  3HOT A;  3C18 A;  1ZG5 A;  5DEQ A;  2J5O A;  4L9T A;  4D0P A;  3Q9V A;  1E2X A;  2EFO A;  4UXN A;  2DPU A;  4E70 A;  3CO6 C;  2KRF A;  1I6X A;  4MEY F;  1YYV A;  2LSO A;  4L9V A;  1QNT A;  3R0A A;  4G6D A;  5DUK A;  2W84 A;  2RDP A;  1XSD A;  3KET A;  4HDU A;  4U0W A;  1IW7 F;  3KEQ A;  4O3M A;  1L0O C;  4G6Q A;  2H6B A;  3V4G A;  1LDK B;  1XSX A;  1XD7 A;  3RIR A;  4EV0 A;  2FE3 A;  2HGC A;  1KA8 A;  4GYI A;  3I54 A;  1RI7 A;  2OA4 A;  5HLG A;  1G3S A;  2Y75 A;  2HQN A;  2NS0 A;  5ICE A;  2IA1 A;  1R36 A;  1VTN C;  3CO7 C;  2FRH A;  2NNN A;  3I59 A;  5JHU A;  1ZN2 A;  1YW9 A;  2XAJ A;  3F8C A;  3J80 K;  3E6B A;  5ERI A;  3ISP A;  2FXA A;  1XMK A;  1MDM A;  3FHZ A;  1GXQ A;  1DPR A;  4N0B A;  1X3U A;  4KN4 X;  2DT5 A;  3J80 Z;  5E1Z B;  1KQ8 A;  1FT9 A;  2M87 A;  2ISY A;  3ABU A;  5BOX A;  5DCF A;  4LG0 A;  3LFK A;  4BXU A;  3WU0 A;  1TLH B;  3W6J B;  3BP8 A;  3F3X A;  5LRR A;  4RGX A;  2RQP A;  5HDG A;  4U88 A;  1Y0U A;  3CJN A;  5DDG A;  1TW2 A;  4LJZ F;  2GWR A;  2XGX A;  1ZRC A;  2JRT A;  2DI3 A;  4FX0 A;  2HFH A;  1V3F A;  3FWE A;  4YG2 F;  1UHM A;  4ENK A;  1IRF A;  2O0Y A;  4MEX F;  3IWZ A;  1XCB A;  4AD9 A;  4ON0 A;  2E7W A;  3C7J A;  3KP4 A;  4O5V A;  5K1Y A;  1UST A;  2F5F A;  4ZZL A;  5LBQ A;  4G7Z F;  2STT A;  3CUO A;  4OOI A;  1ZHF A;  5LGT A;  4HA8 A;  3FXR A;  1FX7 A;  1TQI A;  3ECH A;  4HYE A;  2DK8 A;  2OD5 A;  1KYW A;  1R00 A;  4Q4Z F;  1SD5 A;  2D2W A;  2L4M A;  2ETH A;  1R22 A;  4ESJ A;  2YX4 A;  2PMU A;  1WKM A;  1JHF A;  4Q5S F;  1P6R A;  3ZMS A;  1RUN A;  2ZNY A;  4QWQ A;  5BPI A;  3LAP A;  5AIP A;  3M1E A;  1TNS A;  3SXY A;  5K5O A;  1TNT A;  2WC2 A;  4HX8 A;  5A2Q Z;  2F2E A;  2J5P A;  1Z7U A;  3H92 A;  4Y15 A;  3QP6 A;  3U2R A;  3DF8 A;  1O7F A;  2P7C B;  3R61 A;  4CO8 A;  5DUI A;  4GGG A;  3DPT A;  1GVJ A;  4M9X A;  1XDU A;  1I27 A;  2STW A;  4EM0 B;  3L00 A;  1U8R A;  3P7N A;  3GWZ A;  5K5Q A;  2OU2 A;  4HW0 A;  4OIN F;  3DQV C;  2XRN A;  2M5W A;  3E5Q A;  5D6E A;  5ILU A;  3ZP5 A;  4A6D A;  4LG0 B;  2L54 A;  1ZG3 A;  4XBF A;  3T5X A;  4KYW A;  1BBY A;  2XHK A;  5CVJ A;  4U0V A;  4LLL A;  4JK1 X;  1S29 A;  3FMR A;  2GA1 A;  1L3L A;  1O3Q A;  2DBB A;  2K27 A;  5D5X B;  3R6S A;  5FD5 A;  2GXB A;  1OKR A;  2UXX A;  4RB0 A;  1BM9 A;  4WX9 A;  1FC3 A;  2KIF A;  1U5T C;  3CUQ A;  4WCG A;  5E1W A;  3BPX A;  2IRF G;  4R1H A;  1EH8 A;  2P4W A;  1HXD A;  5HLI A;  4NB5 A;  4OU0 A;  2VOD A;  3QRF F;  4IF4 A;  2MLK A;  1YS6 A;  2A5Y B;  2O61 A;  1B6A A;  4KIC A;  1MZB A;  3WTW C;  4R8H A;  3FM3 A;  4AWX B;  3PQK A;  3T1B A;  4RGU A;  3E6M A;  2MD5 A;  2ZFW A;  4S05 A;  1YG2 A;  3TOB A;  4A6E A;  1U6G A;  2IVM A;  1TQM A;  4L9J A;  4M9Z A;  2BV6 A;  5DV5 A;  3E97 A;  1R1V A;  4EJT A;  2HEO A;  1BC7 C;  3SZT A;  2IW5 A;  3BOQ A;  2Z9O A;  2UXN A;  3HSF A;  4CDG A;  1SMY F;  3WOD F;  2WTE A;  1UB9 A;  1FWZ A;  3V8L A;  2VT2 A;  5F64 A;  3BWG A;  5LHI A;  1C0W A;  1YQA A;  1FBU A;  5H20 A;  3DPL C;  2FA5 A;  1J0R A;  2FNP A;  3I0T A;  1LDD A;  4LFU A;  5LHG A;  4EVI A;  1ZRE A;  2GXG A;  1ONV A;  3P9I A;  1T98 A;  3ERE D;  1AWC A;  2ZO4 A;  2EB7 A;  1WRJ A;  4I02 A;  5L3F A;  1K79 A;  1FSH A;  4YIF A;  1FBQ A;  1O3T A;  3IRQ A;  4WXH A;  3GZ6 A;  3TQN A;  1XGS A;  6PAX A;  2DTR A;  4PZJ A;  2E1C A;  2P8T A;  2L01 A;  2DW4 A;  2XAS A;  1J9I A;  2P5L C;  3W6K B;  2KIM A;  2A07 F;  1SD7 A;  1HSJ A;  2PN6 A;  2NAZ A;  1B1B A;  2AXL A;  1LVA A;  3FXU A;  1XGN A;  3L9F A;  5IT3 A;  2IA0 A;  2VBX A;  3ZMD A;  3CUQ B;  4IRG A;  3RKY A;  2PJP A;  4L0Y B;  3K0L A;  2XRO A;  2HKX A;  2ISZ A;  2QYO A;  4Q47 A;  1KU3 A;  3GYH X;  1MJA A;  2A6H F;  1IF1 A; 
#chains in the Genus database with same CATH topology
 1Z9C A;  1OMI A;  3D5L A;  2VLA A;  2VJ4 A;  3JW4 A;  1KYZ A;  5AON A;  2FF4 A;  2V4J C;  1VQO I;  2P5V A;  2FU4 A;  1FBS A;  3IH2 A;  1W7P A;  1TL8 A;  3WG9 A;  2IP2 A;  4XKB A;  2R7U A;  5HLH A;  1K83 J;  2V79 A;  4LB6 B;  3DCF A;  4MTD A;  1HW1 A;  1B8I A;  1HKQ A;  2DMQ A;  1I5Z A;  3H3Z A;  3B6A A;  3KZZ A;  4PSX A;  4EGZ A;  2BY1 A;  4EJW A;  1HST A;  2JRM A;  4AID A;  4EJU A;  2MVT A;  2K86 A;  3MKW B;  2VQH A;  3HEF A;  4ZYE A;  3A0B C;  1FNN A;  2JUG A;  5JHF A;  2JWT A;  2DQL A;  1X3W B;  2HZT A;  5HOD A;  1G3Y A;  4JX6 A;  5J1U A;  4ENJ A;  3O2P E;  2EJR A;  1UAA A;  3VSL A;  4CCN A;  3BZ6 A;  2JA5 J;  2I5U A;  1GVD A;  2P81 A;  1SEU A;  1JUM A;  3NAR A;  2CW0 F;  2HQR A;  5E18 F;  2H8W A;  1BIA A;  4O6J A;  3JRD A;  2H6C A;  4HST A;  4CUG A;  3IUO A;  5IT9 R;  3K7A J;  1IUF A;  1D3Y A;  3V8K A;  5J6X A;  3LAJ A;  3OYK A;  3B02 A;  3CDH A;  2BVL A;  3PQJ A;  5E3L A;  1P7I A;  1D0X A;  1IG7 A;  2DT7 B;  2CQ7 A;  3HIF A;  3FXM A;  2L7Z A;  1IXR C;  2VC0 A;  1JGS A;  3CC4 I;  2CMP A;  2EFW A;  5EGO A;  1FZP B;  1P92 A;  2HS5 A;  2HXI A;  3S8P A;  2LTP A;  2PMZ A;  3BY6 A;  3I58 A;  3KZI C;  1FP2 A;  3KP7 A;  2JA6 J;  2EFQ A;  2A05 A;  5ILS A;  4FAS D;  2F5D A;  4BXX J;  3IKT A;  3LFU A;  2EA4 A;  2HTJ A;  2RVC A;  2AQF A;  1VFC A;  3P9K A;  4CCO A;  1VQL I;  1QHH D;  2K40 A;  2KMU A;  2CYY A;  1E3H A;  2XAU A;  3BG3 A;  4LIV A;  5LEJ A;  3OL3 A;  3C2B A;  3ZMZ A;  1WJC A;  1Z1D A;  3HOW J;  1R1U A;  2GIV A;  5ED4 A;  4CIC A;  4A12 A;  2R5Y A;  1BW5 A;  1JT6 A;  5CVI A;  5HVQ C;  2O8K A;  3HRM A;  1IUY A;  3WTV C;  2ELJ A;  2VON A;  4RM2 A;  2VBW A;  3G3Z A;  3IWF A;  3CC2 I;  4NHJ A;  2KRC A;  1H89 C;  2OZ6 A;  2EZL A;  1QO0 D;  2XGE A;  4J19 A;  2ACJ A;  1BI0 A;  1IJW C;  2Y30 A;  3PO3 J;  1IN8 A;  3R60 A;  2ESN A;  3CMY A;  2MH2 A;  5FB2 A;  5IT9 K;  2XSD C;  2FUG 2;  1LE8 A;  5GAG J;  2HI3 A;  1D5Y A;  3L2U A;  4PFO A;  2EIL H;  2JK3 A;  1X1A A;  2M7B A;  1CGP A;  2XF6 A;  4ZTJ A;  4DBR A;  4AC0 A;  2QLZ A;  1E3O C;  2CW8 A;  2QQA A;  3X2Q H;  1XGM A;  5IT9 Z;  3JRB A;  1QHG A;  3EET A;  1OR7 C;  2B0L A;  4AYB A;  3OIQ A;  1UHS A;  2JPC A;  2GQQ A;  2XKO A;  3FMS A;  4RAF A;  5B1B H;  3QYE A;  4KDP A;  2DLL A;  4A5M A;  4XON A;  2K4J A;  4CCK A;  1Z21 A;  3HRU A;  2DFI A;  2QF7 A;  2DMU A;  3NWT A;  3CQZ J;  5E3N A;  3WTY C;  2EV5 A;  2FBI A;  1Y8Q B;  4M6X A;  2V9K A;  3LNQ A;  4DW6 A;  1ZQ3 P;  1ZRF A;  2X6W A;  5HNH A;  5FRO A;  4PCQ A;  2H94 A;  3DKY A;  3PFI A;  4WXC A;  1DGR M;  4A0X A;  4OMY A;  2WA0 A;  2QEN A;  1O3S A;  2JJ7 A;  2Q0O A;  3F8N A;  1UG2 A;  1MJB A;  4MQ9 F;  1P4A A;  3F8M A;  2BOL A;  4HQM A;  2V1U A;  3DKW A;  4FT8 A;  2K9Q A;  4G8X A;  3PUB A;  1SVO A;  5M5Y J;  4LLN A;  3H36 A;  3H3U A;  3ZQ7 A;  2CG4 A;  2O8X A;  5FRM A;  4PGG A;  3G2B A;  5EG0 A;  4Y3O A;  1QBJ A;  2ID6 A;  3Q0U A;  1W7P B;  3BR3 A;  2O3F A;  2VKV A;  2KQR A;  2WAQ N;  2HWV A;  1W0U A;  4BGD A;  2E1M C;  1J2X A;  5HLT A;  2R7R A;  1WZ2 A;  3I64 A;  3FHN A;  3MKL A;  3I53 A;  1UMQ A;  3ZXS A;  1B8I B;  3KE2 A;  1QU3 A;  1JKR C;  1XCV A;  3G1L A;  1TQP A;  3H9J A;  4FE7 A;  3TDZ C;  2JMW A;  4RGR A;  4F93 B;  3GFL A;  3FXJ A;  4MQV A;  4G12 A;  4LMY A;  2M8E A;  1ZG1 A;  1X2N A;  4UHT A;  4RAY A;  4Y13 A;  4BH9 A;  5C3E J;  3WGH A;  2DOD A;  1UEL B;  1V5F A;  2DJN A;  3GFI A;  2QBY A;  4M74 A;  1Y0N A;  4KUM A;  1X1D A;  1JKP C;  1UCR A;  5E8I A;  4BU2 A;  4HF1 A;  4EJO A;  1LEB A;  4BHP A;  1PYV A;  4QSH A;  2R92 J;  3HOV J;  1MMG A;  1B4A A;  1P7J A;  3TW6 A;  4CCL A;  3TL4 X;  4IXA A;  1H88 C;  1H8A C;  1F43 A;  3CF2 A;  3WU1 B;  2CGP A;  1IN4 A;  3GW2 A;  5EGO B;  2Z1D A;  3P5J A;  2BEO A;  1ZGA A;  4UNO A;  3QPH A;  3QPT A;  4IHX A;  2COM A;  3UR3 C;  4P1W A;  5D5U B;  1JGG A;  2MYS A;  1W36 D;  1JXS A;  3F8F A;  1SVM A;  2NRA C;  3M8E A;  2XAG A;  3IV5 A;  4II3 A;  2CWE A;  1W5T A;  3WTU C;  1GV2 A;  3JTH A;  2ZSI B;  2K9M A;  2XAH A;  5JI6 A;  2QCO A;  3T8R A;  2PMZ N;  5GAE J;  1R7J A;  3OOP A;  1R49 A;  3WG7 H;  1T2K A;  5IPA A;  4CYC A;  3CJT B;  2HXO A;  2KP6 A;  5CYV A;  2VBZ A;  1MH3 A;  1S7A A;  4PUS A;  2M45 A;  3I5U A;  2R5Y B;  3EUH A;  2W7N A;  1MND A;  4GYG A;  2ZCW A;  3HOX J;  2CQK A;  3ZPL A;  4KIG A;  1TP4 A;  3PUF A;  2V7F A;  2LVS A;  4B48 A;  4IO9 F;  4OIO F;  2JSC A;  2L3D A;  5KK1 A;  3CCM I;  2RAE A;  1XPX A;  2Y48 A;  1R5H A;  1A04 A;  1BC8 C;  2L9R A;  2HVR A;  2VXD A;  3U1K A;  1TWH J;  1ON1 A;  3OS1 A;  3D5S C;  2NVU B;  1GXP A;  3F8B A;  1SAN A;  4HF2 A;  4OIP F;  1RQ6 A;  1ZAO A;  3BCB A;  3CF5 F;  2FNA A;  5D4R A;  1TWG J;  1LE8 B;  3CCL I;  1F9N A;  3DP7 A;  2AO9 A;  4KFC A;  3RSN A;  2HZD A;  2BW3 A;  5DTD A;  4IEJ A;  5E1X A;  3KP5 A;  4A2U A;  2IS6 A;  3A52 A;  2FBH A;  3WE3 A;  5HS8 A;  2VB6 A;  5D4S A;  2GA2 A;  1XB4 A;  4RM3 A;  1B59 A;  1BIB A;  3VPR A;  1G4D A;  2MC3 A;  3WTS C;  4E7Z A;  3KX2 A;  4DQ2 A;  4YII A;  4HNU A;  3E1S A;  3VYT B;  1U9N A;  3L2C A;  1JHH A;  3RYP A;  4BAC A;  5CLS A;  2DK5 A;  2V1D A;  2Y0S A;  1R4M B;  1U0J A;  3EDP A;  3GZ5 A;  3NWS A;  2CH0 A;  2JA8 J;  2LF7 A;  4UV8 A;  2H09 A;  5ILV A;  3OYI A;  2VE9 A;  3SHF A;  1K78 A;  1WSU A;  3K6G A;  2KIU A;  3K69 A;  1D1B A;  1R5I D;  3IC7 A;  3MMY B;  1RUO A;  1N75 A;  2GZW A;  5EEA A;  3HSE A;  2MFZ A;  4F91 B;  2HR3 A;  1LQ1 A;  4I7H A;  4YFK F;  1IN5 A;  3MKY B;  1RC9 A;  4ENM A;  4A3L J;  2XF5 A;  3M7G A;  3PM1 A;  3I4P A;  3F21 A;  1SFX A;  4GCV A;  1XMA A;  3PFY A;  5IP9 J;  3BJA A;  5H6Q A;  3JRG A;  3PIO F;  4B43 A;  3BG7 A;  4L5J A;  2QGU A;  1XX5 A;  4IQ4 A;  1ITY A;  1J75 A;  1W1W E;  2BGC A;  3FMQ A;  3FXL A;  2BYV E;  3P9C A;  3GFJ A;  5C44 J;  2ESH A;  1S9H A;  3EPZ A;  4I0A A;  2HDC A;  3HJE A;  3OSG A;  4M3B A;  4A3D J;  2R7T A;  4HV6 A;  3LWF A;  1LKX A;  1WFX A;  2BHY A;  1S6L A;  1O3R A;  3LA3 A;  2Z99 A;  4LGW A;  4BDY A;  4A3C J;  3TO6 A;  1Z3Y A;  3GTL J;  4ZDO A;  1BI2 A;  3OY9 A;  1XGO A;  2P0W A;  5FO5 A;  1YJW I;  1ZK8 A;  2M30 A;  3DXJ F;  5F1R A;  1WH7 A;  5HOO A;  4A3I J;  2OBP A;  1KQ9 A;  2DDB A;  3RKX A;  2L9S A;  3S1M J;  1YJN I;  1R58 A;  2K85 A;  2QBY B;  3KZY A;  3KEO A;  4OIR F;  4BE0 A;  3IHU A;  3S17 J;  1S3J A;  2DQR A;  2CU7 A;  3K4C A;  4Y17 A;  3JRE A;  3HOS A;  4BJT A;  4E7H A;  3TO9 A;  3S14 J;  4BKX A;  4DYR A;  3MD2 A;  3F6V A;  5FLX K;  1D8J A;  1E17 A;  1JUS A;  3ABK H;  5K5R A;  4H0E A;  3LSK A;  2KIS A;  2QQB A;  4UUS B;  3JRC A;  5ICG A;  4LOC A;  1KU2 A;  1ENH A;  5M5W J;  3S3M A;  1UHW A;  5EEH A;  2LRD A;  3J81 K;  3F23 A;  2CUF A;  1V4R A;  2VPL A;  2HYF A;  2ZJR F;  2R7F A;  2F5C A;  3GTG J;  3PNV A;  4XKC A;  2Y31 A;  4OWR B;  5CPR B;  4NQW A;  2FEZ A;  2HVS A;  1ZH5 A;  3BQZ A;  1GLN A;  2HDW A;  2A69 F;  2ELH A;  2K02 A;  4CYC B;  3G4S I;  2K4B A;  2DN0 A;  2XAF A;  3VB2 A;  4HBL A;  4C2T A;  2K3P A;  5F6F A;  5KVR A;  5FJ8 J;  3N4M A;  1DGW Y;  2X1C A;  1DDN A;  2DOA A;  2OQR A;  5FLV A;  2W00 A;  1EH6 A;  4UVB A;  1R71 A;  4KIF A;  3CCJ I;  2L7F P;  2O6G E;  4EM1 A;  2XDV A;  5TIS C;  2E19 A;  2XAQ A;  3V42 A;  3L09 A;  3WTT C;  2DYR H;  3F0C A;  5CQE A;  5E3M A;  3I9V 2;  4XIC A;  1J59 A;  5D5W B;  4HQE A;  2IT0 A;  1FPQ A;  2BW3 B;  4DNC A;  1X19 A;  2X1D A;  3OYB A;  4C2U A;  4PSW A;  3D0S A;  1FTZ A;  5GAH J;  1FYL A;  3S3N A;  1GT0 C;  4UUV A;  4NC6 A;  4UUT A;  2D1V A;  2HQ5 A;  2X4H A;  4UVC A;  3K2A A;  1OFC X;  3JR9 A;  5K7H A;  3NRV A;  2QSH X;  2ZC2 A;  1OYY A;  5E17 F;  3ZQI A;  2UWM A;  1DPU A;  2CW7 A;  2PBI A;  1WPK A;  4XK4 A;  2P5K A;  5F0C A;  1K78 B;  1JTX A;  5GTI C;  2LKP A;  4B09 A;  5B5E C;  4A5N A;  1FYM A;  3TW7 A;  1H9T A;  4BY1 J;  1FOX A;  4E7L A;  2CFX A;  5D8L B;  2IGO A;  1A6I A;  3GZN B;  1K4T A;  5F08 A;  2Y0S N;  3HRS A;  4XLC A;  5JLX A;  1HBX G;  2W85 A;  2H8R A;  3MVP A;  3MN2 A;  5EZG A;  2X85 A;  3RZO J;  3QYF A;  4HDV A;  2OF7 A;  3N97 A;  1PJR A;  2CFO A;  3KYD B;  2E34 A;  3ZQG A;  2VJ5 A;  4PJJ A;  9ANT A;  5J1Y A;  3IL2 A;  4NC7 A;  1LB2 A;  3M3Y J;  5FGM A;  5L3C A;  2ZJQ F;  2A68 F;  4K2E A;  3HZJ A;  2EPF A;  1VQ4 I;  1XN7 A;  3HUG A;  3OYC A;  1KON A;  1IXS B;  1JI8 A;  4V19 K;  2Q2E A;  2ZME A;  3ABT A;  3QWL A;  2NYX A;  5FD6 A;  1HKS A;  2HVQ A;  3U9G A;  3O6B B;  3BR0 A;  4U87 A;  1V5E A;  1Z6R A;  1OCT C;  2NS7 A;  4X1E A;  1SC7 A;  4ESB A;  1EV7 A;  1G2H A;  2IGN A;  1PP8 F;  1S8N A;  3KP3 A;  4F3Q A;  1W36 C;  1ODD A;  4WK8 F;  4PJM A;  3GX4 X;  2NS8 A;  4B3A A;  1K61 A;  3RTR A;  3HM5 A;  2NVQ J;  1UFM A;  4ZDL A;  4WF2 A;  1XDS A;  2IJL A;  3K1N A;  4D7M A;  5E8G A;  4IKF A;  2EK5 A;  3C1D A;  1I3A A;  2D1H A;  2BY3 A;  3E6C C;  4HZF A;  5DYM A;  1MBF A;  4E6K G;  3GO5 A;  2OZU A;  1Y1V J;  4P96 A;  3WGG A;  2QA4 I;  1J7K A;  2HTS A;  2XPV A;  3B6C A;  3A01 A;  4A0Z A;  1OCC H;  3CDL A;  4Y52 J;  1YLF A;  3LSM A;  4LIU A;  5EEG A;  2CUJ A;  1T38 A;  4E4H A;  1KU7 A;  3AG3 H;  4XRF A;  5CVV A;  2KIQ A;  3ZR8 X;  3Q9S A;  2VKD A;  1MD0 A;  3OYM A;  1IRG A;  2VKE A;  1FTT A;  1H0M A;  2WAQ A;  3MEX A;  2W82 A;  3OV8 A;  2K7L A;  4B1R A;  3G71 I;  1VQ6 I;  3KLO A;  4KJZ A;  5C4X J;  2AHQ A;  4CH7 A;  4CGZ A;  4KN7 X;  5HS7 A;  4LLG F;  4YEL A;  1AKH A;  1OIS A;  1P4W A;  1FOW A;  1BW6 A;  4HAM A;  4E7K A;  1I3Q J;  2E36 A;  5FFX A;  1QZZ A;  4NQW B;  4RB2 C;  4CHU A;  4V2G A;  2ZB9 A;  2G0E A;  3OR2 C;  5KAF C;  3CTA A;  4XLF A;  1YRN A;  2Y9Z A;  4HOB A;  1IN6 A;  3OOU A;  2WAD A;  1ZLJ A;  2M3A A;  3U1D A;  5CVR A;  1RES A;  1KU9 A;  1T0F C;  1J09 A;  3HTS B;  2OTL I;  1ULY A;  2N8G A;  2BHZ A;  2Y0M A;  1U5T B;  1BR4 A;  2WY8 Q;  2QWW A;  3JRH A;  4YEJ A;  3VOE A;  4HV5 A;  3ROU A;  4PDK A;  5KAI C;  1RIO H;  1X4O A;  2WWY A;  2CV0 A;  4XLE A;  3REO A;  3RYR A;  2EV0 A;  3F22 A;  1ETQ A;  1WHU A;  3ELK A;  2HPI A;  2W4S A;  3GVA A;  4XMY A;  3IAM 2;  2QM3 A;  3M9A A;  4RGS A;  2F4I A;  3FKI J;  2LBF A;  4I99 C;  1P2F A;  3OL4 A;  4HX4 A;  3EYY A;  2X0L A;  5E79 C;  2MLG A;  4G6T B;  2ME6 A;  1OLT A;  3FXO A;  2V9V A;  1R5G A;  3ZQQ A;  2R3S A;  2F48 A;  2DPD A;  2LD5 A;  4G9Y A;  2NOG A;  4FE4 A;  3RJP A;  3FBN B;  2NVT J;  3D5R C;  4UY8 I;  3BZK A;  4UV9 A;  4S0H B;  4KA4 A;  4BJ6 C;  3F72 A;  3K4J A;  3TGN A;  4ZYA A;  3K9T A;  1G6N A;  2TDX A;  1U9O A;  1R9T J;  2OAZ A;  1OCO H;  2V1X A;  3BRO A;  1PP7 U;  3M1C A;  5AIQ A;  3IAS 2;  1G3W A;  2FJ1 A;  1BI1 A;  1S7O A;  1ZYR F;  2EZK A;  2MG4 A;  4BUP A;  3CCS I;  1BOA A;  3PSF A;  4IHS A;  3H3V K;  2KLO A;  4M6Y A;  4HLX A;  1R1T A;  1RNL A;  4Z6Y A;  2YSR A;  2YUS A;  4ZYH A;  3CME I;  2G9W A;  3OIP A;  2E2I J;  4CSW A;  1AU7 A;  3M8F A;  4IHT A;  1HLV A;  5CVU A;  1BR2 A;  4IVN A;  4B47 A;  2XVC A;  4BHC A;  2HU9 A;  4N4O B;  3RI4 A;  5JR3 A;  3L7W A;  1X1C A;  1ZR4 A;  1U2W A;  3HRT A;  3LA2 A;  3HUG B;  4BYY A;  3S1R J;  2HDD A;  5FFZ A;  2Q2E B;  2ZME B;  3CLO A;  4N4N B;  2QQ9 A;  3HDD A;  5BPD A;  4LK1 F;  1WJD A;  3I71 A;  4P9U A;  2OQG A;  2ZXI A;  4C3I J;  2RNJ A;  3KP6 A;  2AXT C;  2DXI A;  1JKQ C;  4RB3 C;  1SAX A;  1A31 A;  3VOD A;  3COA C;  1PUE E;  2JZY A;  4HEA 2;  1D8K A;  3ZRG A;  4CZC A;  1ON2 A;  5D6F A;  3CCE I;  4OMZ A;  2LY1 A;  1X1B A;  4GRI A;  1NHA A;  1K6O A;  2VE8 A;  4F52 A;  4CCM A;  3WE2 A;  1YTY A;  3EQL F;  2WB1 N;  1Z6T A;  3BR2 A;  3GTJ J;  3LSP A;  1TZL A;  1RPW A;  5D8K B;  1M1E B;  3CCY A;  3K4M A;  1FYK A;  4IJA A;  1K7A A;  2RV8 A;  4RAG A;  4IOA F;  2VN2 A;  3HHG A;  1FLI A;  4Y33 A;  5J8C A;  2VAS A;  2EIK H;  2R0Q C;  3A01 B;  1DUX C;  1ETV A;  1GDT A;  2CS3 A;  1H9G A;  4L9N A;  2EIM H;  2MD0 A;  2D5V A;  4MTE A;  3WU2 C;  5JVT A;  5GTH C;  4I01 A;  4EM2 A;  5J4Y A;  3WTZ A;  5B3S H;  2PI0 A;  3A02 A;  2W57 A;  1BOB A;  1HDP A;  4JOM A;  3GXO A;  3I56 I;  2Z3Y A;  1REP C;  2IS4 A;  1YW8 A;  2LMD A;  2L9V A;  3ECO A;  1BR1 A;  3MZH A;  4G94 A;  2JTV A;  4BNC A;  3CCR I;  2PFB A;  3GME A;  4PJL A;  1AKH B;  1I1S A;  3OYE A;  3AG1 H;  2ZXJ A;  4U0Y A;  4M73 A;  2MGQ A;  5L3B A;  3OYA A;  1WJ5 A;  4ENN A;  1VQ8 I;  3GTP J;  5ICF A;  2Q8K A;  4P5O A;  1OR7 A;  1D1A A;  2OUM A;  4ETS A;  2KRH A;  1HKT A;  4M9S A;  3TMO A;  4PFP A;  2I8D A;  2BY0 A;  2JPB A;  1YRN B;  3W2V A;  4UVA A;  3FIS A;  2LFB A;  2TRT A;  3O3K A;  3QOD A;  3T0Y A;  2L0K A;  4JBA A;  3TOA A;  3BLY A;  1JJ6 C;  1GV5 A;  4CZZ A;  2RKH A;  3W3C A;  1B9M A;  4HLY A;  1RZ4 A;  2JA2 A;  2IS1 A;  1MBJ A;  1KZH A;  3VWB A;  3SQN A;  3C3W A;  3DFG A;  5FKL A;  2HYG D;  3G1O A;  2WAE A;  2KKO A;  1I39 A;  1USS A;  2MBF A;  3QU6 A;  1TW3 A;  4XKV A;  4ZC3 A;  5CKT A;  2XF7 A;  2E71 A;  3BR5 A;  2DO7 A;  1KQ0 A;  3BJO A;  1RRJ A;  2BE5 F;  3E5X A;  3DU6 A;  4GO1 A;  1B72 A;  4KIT B;  3TKY A;  4I6Z A;  3ERM A;  2E1N A;  2NOJ B;  1E3P A;  3QP5 A;  4WXD A;  1MGT A;  2YR2 A;  2RC4 A;  4NDL A;  4D5F A;  3Q5F A;  3GFM A;  2LBF B;  2UZK A;  3UKG A;  2DMT A;  4KMU X;  4N9I A;  1WI3 A;  4RMN A;  3ML6 A;  3FZV A;  1Y8R B;  2JT1 A;  3DTE A;  3GLX A;  4UUS A;  3QOE A;  2RGV A;  4ZDP A;  3LSJ A;  3E0J B;  4M3G A;  1HW2 A;  3FX3 A;  1ZAR A;  4U7B A;  4C2M J;  2LLK A;  3ZGK A;  1VND A;  3V8J A;  3K4L A;  2COB A;  2DFE A;  3SZG A;  5LHH A;  2O03 A;  3R4K A;  3SEQ A;  4GFB A;  3S15 J;  3AL0 C;  3LQQ A;  1LEA A;  2DAO A;  1SFK A;  3OYL A;  2IPQ X;  1OYW A;  4RAZ A;  4B4C A;  2HKO A;  2PLY A;  3E6D A;  1XSV A;  3JTG A;  2DA7 A;  3FXQ A;  1R6R A;  1SD6 A;  2E60 A;  2EBI A;  2XKP A;  3H5N A;  3OYF A;  4QPQ A;  1RKW A;  2VBY A;  4ZZD A;  2PX9 A;  1YFH A;  1YIO A;  2D45 A;  1D5V A;  2M35 A;  2CUZ A;  4XR6 A;  3D1N I;  1V5G A;  1SFU A;  1W7P D;  3KEY A;  1MW7 A;  2GIZ A;  3LL7 A;  2R7D A;  3DTI A;  1FY7 A;  2Z33 A;  3LA7 A;  2A6E F;  1MMS A;  2E7X A;  5IYD J;  1WI9 A;  5E20 A;  2P7V B;  3BJ6 A;  3GUD A;  2EFP A;  3DEU A;  5LLQ A;  2DTZ A;  1ZLK A;  1FIP A;  1A6Q A;  1Z67 A;  2L02 A;  1STZ A;  1TBX A;  4E7S A;  3KP2 A;  5BQT A;  1ZRD A;  2HNH A;  2Z5U A;  2ZJ2 A;  4EMS A;  5DCM A;  1YW7 A;  4IHY A;  1SFE A;  4TV7 A;  4L18 B;  4ZYD A;  2O7O A;  2QKL B;  1JT0 A;  2R7X A;  5HDN A;  4D7N A;  4PK4 A;  3OSF A;  1LDJ A;  2F4O B;  2UV1 A;  3RKW A;  2X6X A;  2NVY J;  1RKT A;  1MKM A;  1J5Y A;  3EYI A;  2KT0 A;  2XB0 X;  1ZGJ A;  1OQY A;  5TJJ A;  4ESF A;  4LD5 A;  4HSR A;  5IYB J;  2LK2 A;  3VFZ A;  2GLO A;  1HC8 A;  2ME0 A;  1TTY A;  1Z77 A;  5A2Q K;  2CSO A;  4X6A J;  1D1C A;  3JAM R;  3RPQ A;  3QPL A;  4IL6 C;  4CYD A;  3LQR A;  3G6E I;  3GTQ J;  4M72 A;  4JQF A;  4BHB A;  1Y56 A;  2HYJ A;  1F4K A;  2KZG A;  1Q1H A;  3K10 A;  2K9N A;  5FLX R;  5J3L A;  3ZQC A;  2DU9 A;  2FML A;  3LOC A;  3S1N J;  4XSX F;  3AKZ A;  1Z05 A;  1QPM A;  3PNY A;  3J7A O;  5BNG A;  3JRF A;  1NK3 P;  1OPC A;  2C6Y A;  3J81 R;  2XV4 S;  3L1P A;  3LST A;  1LUJ B;  1V54 H;  2QKM B;  3GF2 A;  5FKN A;  1HW5 A;  3HYI A;  5L3G A;  3OWT A;  2CV2 A;  2W24 A;  4P9F A;  3I59 B;  2DMP A;  1MJ9 A;  3Q3S A;  3W6V A;  3BG5 A;  3K1M A;  1U3E M;  5LD2 C;  3M07 A;  2HPM A;  3QYB A;  4IZZ A;  4Q48 A;  4RLQ A;  3MZY A;  4EGY A;  1YIT I;  2PQ8 A;  2JQ7 A;  4MFD A;  4ZYG A;  4U7D A;  2EZH A;  3CD6 I;  2O5R A;  2XGD A;  4KIB A;  4Y7N J;  2M4K A;  1HCR A;  2LG4 A;  3K4K A;  4P55 A;  2JSP A;  3L2W A;  3BDD A;  4FHT A;  1MDM B;  2E1O A;  4XID A;  4A3E J;  1QGP A;  2ECC A;  3ASN H;  4B8X A;  1ZGW A;  4LIT A;  2H27 A;  3CUQ C;  5EJC A;  4QTR A;  2FSW A;  4N9H A;  4IHW A;  2JUC A;  1AOY A;  5DD8 A;  1IV8 A;  3PL8 A;  2VOP A;  1F1Z A;  4J01 A;  3K2Z A;  3JAM K;  1QZY A;  3FBI B;  4S04 A;  2DT6 A;  2P6S A;  1B72 B;  2ADU A;  2EWN A;  1POG A;  2FX0 A;  3LMM A;  3QAH A;  2FBK A;  3MCZ A;  1ORK A;  3N05 A;  3R0J A;  2NXN B;  2XPW A;  3MWM A;  1CF7 A;  1T08 B;  1SMT A;  3TBI A;  4G7O F;  2E1M B;  3JAM Z;  4NC8 A;  1WJA A;  3KIO A;  4KMF A;  1GHC A;  2A3S A;  3IRR A;  3G73 A;  2KJB A;  3TED A;  1JKO C;  4R79 A;  2KHM A;  3A4C A;  3VYU B;  1AA7 A;  1WGX A;  3FF5 A;  4NUB A;  5K7Z A;  2ELK A;  2VT3 A;  3DBH B;  1K6Y A;  1MMN A;  1T6S A;  5FLX Z;  2QUF A;  4RB1 A;  4M6V A;  1OYI A;  3GEZ A;  3HPH A;  4I2O A;  3ZOB A;  3LSR A;  1WWX A;  3DLA A;  4HX7 A;  5LGU A;  2A61 A;  5IY5 H;  2PG4 A;  1SD4 A;  3HHH A;  1F5T A;  2FOK A;  3J7Y J;  1XMX A;  1Q1V A;  3V7R A;  1YO5 C;  1LNW A;  1UG0 A;  3J81 Z;  1IAW A;  1U78 A;  4HNT A;  3HOZ J;  3QU3 A;  2VI6 A;  4D9J A;  2G7U A;  4BXF A;  1CQT A;  3QPS A;  3RDI A;  5F04 A;  1T39 A;  1RUN A;  4XLA A;  4AUX A;  2B63 J;  3QOP A;  2LP0 A;  4MGR A;  3C2G A;  1Z91 A;  3PNT A;  2XSJ C;  4A0Y A;  2M2E A;  1U5T A;  3S2W A;  1QZE A;  5K7F A;  5HS9 A;  4ASN A;  2K9S A;  4YFX F;  1IRX A;  3F6O A;  1HQC A;  2VL8 A;  3HTU A;  2L7K A;  4L0Z B;  2LF8 A;  4I98 B;  3KCC A;  4IHV A;  1ETW A;  1B9N A;  3TDU C;  3CLQ A;  5BS6 A;  1P9Q C;  2G7H A;  4BS9 A;  2DFF A;  2OC6 A;  4A3G J;  4FTH A;  3FK6 A;  3E3V A;  3BPV A;  4XOT A;  4A3M J;  2CUE A;  3K1P A;  5L3D A;  4B3X A;  1SVL A;  5DCM B;  2MH9 A;  3VEP A;  4EEF G;  4KNY A;  4FET A;  3SFI A;  2VXZ A;  4H4K C;  3SZP A;  2FMY A;  3OYJ A;  2XUB A;  3B73 A;  4RBO A;  4I0B A;  5FRN A;  1FP1 D;  1JUP A;  4A3J J;  3TP3 A;  1TC3 C;  3WTX C;  5M3F J;  2DA3 A;  3BG9 A;  1S7E A;  2IA2 A;  4ITV A;  1FSE A;  1OJL A;  5IOZ A;  2Z16 A;  2YU3 A;  2QSF X;  3MAJ A;  4ABZ A;  3MZ8 A;  4BQA A;  3SDB A;  4YIR X;  3I4M J;  2EV6 A;  3K4B A;  4CXF A;  5J47 A;  3Q0V A;  1QPI A;  4OAY A;  2I10 A;  5C4J J;  5CJ9 A;  5IOY A;  5LFA A;  2VKH A;  5M5X J;  1HA8 A;  1Z3X A;  2L4A A;  4DYQ A;  1G8X A;  2QSG X;  2BY2 A;  1W5S A;  2EA2 A;  1D0Y A;  4M71 A;  2DFH A;  2KDZ A;  2H1L A;  2PEX A;  3VYS B;  4AIJ A;  1VQP I;  3CES A;  4II2 A;  3EUK L;  1IDZ A;  1IZ1 A;  2MAB A;  3FKJ A;  2W25 A;  4FX4 A;  1FMW A;  4E7J A;  3W2A A;  3TO7 A;  4XLN F;  2ZSH B;  2OV7 A;  3I55 I;  1LVK A;  4IRH A;  1TT0 A;  4BY7 J;  1O4X A;  5HDK A;  5JLW A;  1YS7 A;  4XSZ F;  2GBY A;  2MA3 A;  2V6C A;  3KFW X;  2R7Q A;  2ZFU A;  4QLC U;  3JCU C;  1QA6 A;  2YX7 A;  4AIH A;  2RN7 A;  3VYR B;  3A0H C;  3DLL F;  3U21 A;  2ZJP F;  2EFN A;  2WBM A;  1MBG A;  2ZBK A;  2WB1 A;  3ULQ B;  3JSP A;  3AAF A;  3HOU J;  1ERD A;  4LB5 A;  2DMN A;  2FQ3 A;  2LNB A;  5TRD A;  1BJA A;  2Q1Z B;  2CJJ A;  3IP4 B;  4AVP A;  5DM6 F;  2JVG A;  1U8B A;  3RQI A;  2YPR A;  4F7Z A;  1DP7 P;  4FCY A;  5LGN A;  3ZN1 A;  4F55 A;  4XL9 A;  4HF0 A;  3O8G A;  5CQG A;  4GXO A;  4XLP F;  1G3T A;  1TWC J;  2EIN H;  3KLN A;  2P6T A;  4MNU A;  4LK0 F;  2KZV A;  1LFU P;  3IKV A;  1Y39 A;  3V7C A;  2VC1 A;  4XOP A;  4C3H J;  4UB6 C;  4MHG A;  4Z2Y A;  2X9D A;  5GPC A;  4W1U A;  1CF7 B;  1TT5 B;  2BBY A;  3WGI A;  1AHD P;  3CCV I;  3ZMV A;  2R7O A;  2QVO A;  4AIK A;  1WJF A;  2ZNZ A;  2MSY A;  3SDG A;  4ZH4 F;  2JA7 J;  3JSO A;  5D5V B;  1O7L A;  1I1G A;  3BTC A;  2QZ8 A;  4EJV A;  2V6E A;  2YU9 J;  3FM5 A;  2HOS A;  5DD4 A;  1JE8 A;  3ZMT A;  4G7H F;  2KJC A;  2KFD A;  5ICC A;  2M7A A;  3NAU A;  5JFR A;  2DDA A;  3BG6 A;  3KYC B;  1PUF B;  5E3O A;  2HOE A;  2B9S A;  5BMZ A;  4L5I A;  5FKM A;  2IXS A;  3MFK A;  2GAU A;  2E5Z A;  2BVM A;  3L2R A;  1KGS A;  2DCE A;  1MH4 A;  4AVZ A;  4WWC A;  1PDN C;  2VOO A;  2M4G A;  1Z0X A;  3BTJ A;  3V7S A;  1W4M A;  2NNY A;  1HOM A;  3MQ0 A;  2WV0 A;  3WHB A;  4IX7 A;  5IYC J;  2LDU A;  3PO2 J;  1BA5 A;  4ZJZ A;  3E5U A;  1GUU A;  4YFN F;  1SFO J;  5J8F A;  1FOK A;  3DV8 A;  1IO2 A;  3BCA A;  4BQQ A;  1P4X A;  4BE1 A;  4XRS A;  4OIQ F;  2RNG A;  1R4N B;  2EZI A;  3ESW B;  2EH3 A;  1I6H J;  5LEK A;  1MSE C;  1IN7 A;  1EA3 A;  2XIG A;  4KT5 C;  3ZN0 A;  4EQQ A;  4KT6 A;  1VQK I;  3CDI A;  3JRI A;  4I09 A;  5FKK A;  1BN5 A;  1XTA A;  3SFZ A;  4PGH A;  3GBG A;  4DGW B;  1QRY A;  2PMH A;  1IXC A;  3ZMU A;  2UUZ A;  5H6R A;  1LJ9 A;  2X6O A;  5L3E A;  2VQG A;  4DYC A;  3H0D A;  2AS5 F;  2M1B A;  4BAY A;  3DPU A;  5GP9 A;  1WQ2 A;  2CQN A;  2F4M B;  2VQC A;  2PJR A;  2F5E A;  4C9Y A;  3SJM A;  1T0F A;  1ETX A;  5DS9 A;  5DM7 F;  2ZKZ A;  1BI3 A;  1WJB A;  2CO5 A;  3NQO A;  1R23 A;  2IGM A;  2DJI A;  4RS8 A;  1O57 A;  3ZCO A;  2X6Y A;  3HSR A;  5LRS A;  3NEU A;  3T8T A;  3JRA A;  1EH7 A;  4IPA A;  4Y4R A;  3RCO A;  1LFP A;  1QQI A;  4IRI A;  3RPU A;  5B1A H;  4JX4 A;  3L2V A;  3C18 A;  3HOT A;  1ZG5 A;  2DOF A;  1MBH A;  1YHQ I;  2CV1 A;  3SEZ A;  2KL4 A;  2K9L A;  1I50 J;  4J00 A;  5DEQ A;  1XS9 A;  1VQ5 I;  4XNF A;  2WY7 Q;  2L2O A;  4DZP A;  4ZTF A;  2J5O A;  4IQJ A;  1NTC A;  3O8H A;  3S16 J;  1VF9 A;  4L9T A;  4XOR A;  4M3D A;  1ETK A;  4D0P A;  4A93 J;  4RLF A;  2VJI A;  4A3F J;  1VZ0 A;  1WH5 A;  3HGG A;  3K4N A;  1MIJ A;  3Q9V A;  5FKO A;  1E2X A;  1WVR A;  2EFO A;  4UXN A;  5EYR A;  4BBR J;  5KNL A;  3OYN A;  2DPU A;  2TCT A;  4E70 A;  3CO6 C;  2KRF A;  1I6X A;  3J7A Y;  1D0Z A;  3M4O J;  4MEY F;  2Y69 H;  1YYV A;  2OTJ I;  2LSO A;  4BDZ A;  1QVU A;  1FIA A;  4L9V A;  1QNT A;  3J80 R;  2Y9Y A;  3R0A A;  1XG1 A;  2YS9 A;  4G6D A;  5DUK A;  2W84 A;  2RDP A;  1XSD A;  5F1J A;  2H1K A;  4KIS A;  3KET A;  4HDU A;  4U0W A;  1IW7 F;  2R7S A;  3CP8 A;  1WCM J;  3KPH A;  3KEQ A;  4O3M A;  1L0O C;  4G6Q A;  3CJQ B;  2R93 J;  2H6B A;  3V4G A;  1LDK B;  1XSX A;  1XD7 A;  3AG2 H;  3RIR A;  4RA2 A;  4EV0 A;  3I4N J;  3VSK A;  2FE3 A;  2HGC A;  1KA8 A;  1YX3 A;  4GYI A;  3S1Q J;  2B7E A;  3I54 A;  3WHC A;  1T33 A;  2M9H A;  3BR1 A;  1LFB A;  1RI7 A;  2E5N A;  1A35 A;  2LH9 A;  2OA4 A;  5B66 C;  5HLG A;  1G3S A;  1VQN I;  2Y75 A;  2HQN A;  3CJR B;  2OCE A;  2E2H J;  1S72 I;  2NS0 A;  2X98 A;  5ICE A;  4EAT A;  3IH3 A;  1XC5 A;  2R7V A;  2IA1 A;  3BTI A;  1R36 A;  1VTN C;  1EKE A;  3OYH A;  3HXL A;  1LPQ A;  4XRM A;  3CO7 C;  2FRH A;  2NNN A;  1YOV B;  3BZC A;  3K70 D;  3I59 A;  2LC2 A;  2R7W A;  1YI2 I;  1FJL A;  1YJ9 I;  4DBQ A;  3OYD A;  1F36 A;  1MBE A;  3OMY A;  1ZN2 A;  1YW9 A;  2OJE D;  5JHU A;  2XAJ A;  3F8C A;  4FQG A;  3S3O A;  1UJ8 A;  3OYG A;  3J80 K;  3E6B A;  2ZXW H;  5ERI A;  3ISP A;  2FXA A;  2E2J J;  1XMK A;  3F9K A;  2X48 A;  3LSH A;  2VUM J;  1YIJ I;  1MDM A;  3G1M A;  3FHZ A;  3RZD J;  1X3Z B;  1GXQ A;  1DPR A;  2EIJ H;  3DTK A;  3J7Z I;  1ZR2 A;  1DU6 A;  4N0B A;  1X3U A;  4KN4 X;  1JJ8 C;  2DT5 A;  3KYL A;  1HDD C;  3J80 Z;  3M8J A;  2OPT A;  3VDX A;  3ONQ A;  5E1Z B;  1KQ8 A;  3BTL A;  2IEK A;  1FT9 A;  2M87 A;  4PJ0 C;  4E7I A;  2FOW A;  3ABL H;  2GOX B;  2X51 A;  2ISY A;  2LY2 A;  3L2Q A;  1Y1W J;  3ABU A;  5BOX A;  2A5W A;  3SYT A;  1X4P A;  5DCF A;  4LG0 A;  3AFH A;  3LFK A;  4XN0 A;  4BXU A;  3WU0 A;  1TLH B;  3W2W A;  3W6J B;  3H9G A;  3BP8 A;  3S2H J;  2XC7 A;  1VI0 A;  3F3X A;  5LRR A;  2M0C A;  4RGX A;  2RQP A;  3GLL A;  2A6T A;  5HDG A;  5M3M J;  4I76 A;  4U88 A;  2LRE A;  4JX5 A;  2PJR B;  1MMA A;  3EUH C;  1Y0U A;  3LSI A;  3E7L A;  3CJN A;  5DDG A;  5KCM A;  1TW2 A;  4LJZ F;  3PJR A;  2GWR A;  2XGX A;  1UZC A;  1ZRC A;  2DA4 A;  5A2Q R;  2JRT A;  1BJZ A;  2DI3 A;  2ZXH A;  4FX0 A;  2HFH A;  1V3F A;  3FWE A;  4YG2 F;  3OS2 A;  4CCJ A;  1UHM A;  4ENK A;  1IRF A;  2O0Y A;  4MEX F;  4C3J J;  3IWZ A;  3ZQL A;  1VQ7 I;  3DEE A;  2IS2 A;  1XCB A;  4AD9 A;  4ON0 A;  2E7W A;  3C7J A;  3HB9 A;  3KP4 A;  4O5V A;  2LKS A;  1MBK A;  5K1Y A;  1UST A;  3CP2 A;  2GM4 A;  2F5F A;  4XQF A;  4UB8 C;  4ZZL A;  5LBQ A;  4G7Z F;  2LY9 A;  2FD5 A;  2STT A;  5HNF A;  3DWL E;  2V1N A;  1ZTR A;  5EZH A;  3H5A A;  3CUO A;  1FEX A;  3ASO H;  4OOI A;  1V55 H;  3HC7 A;  1ZHF A;  5LGT A;  2HOT A;  1A5J A;  4HA8 A;  2L9N A;  3FXR A;  4D1Q A;  3A2K A;  1S5L C;  5F27 A;  3CCQ I;  4XLH A;  1FX7 A;  2X1E A;  1IC8 A;  1Y6I A;  4PJN A;  1ACI A;  2K5C A;  3QQA A;  5GPA A;  1TQI A;  3ECH A;  4BE2 A;  4HYE A;  2DK8 A;  2OD5 A;  2VQL A;  1KYW A;  1T95 A;  1R00 A;  4Q4Z F;  1SD5 A;  2D2W A;  2L4M A;  2DA6 A;  2ETH A;  1ZKG A;  1R22 A;  4ESJ A;  2YX4 A;  3BT9 A;  1QVT A;  2PMU A;  1WKM A;  1IDY A;  4V2F A;  4BEH A;  3Q0W A;  1JHF A;  3H5R A;  4Q5S F;  2BXZ A;  3HL2 A;  2CQQ A;  3IH4 A;  3HBL A;  4MO7 A;  3ZQF A;  1P6R A;  3HKZ A;  1N25 A;  3ZMS A;  1NG6 A;  2ZNY A;  1NG7 A;  4QWQ A;  3LAP A;  3HG9 A;  5BPI A;  4M3E A;  5AIP A;  3M1E A;  4IOC F;  1TNS A;  3SXY A;  5K5O A;  1TNT A;  2WC2 A;  4HX8 A;  5J4V A;  2F2E A;  5A2Q Z;  2J5P A;  1Z7U A;  2QQ8 A;  3H92 A;  5FLM J;  3HOY J;  4Y15 A;  3QP6 A;  1MMD A;  3I3L A;  2FQ4 A;  4BQO A;  4AYB N;  2CQX A;  3U2R A;  3DF8 A;  4BJ5 C;  2BXY A;  1O7F A;  2P7C B;  3LSG A;  2E35 A;  2F6C A;  3R61 A;  4GGG A;  3RPU D;  4CO8 A;  3DPT A;  5DUI A;  1GVJ A;  4M9X A;  1XDU A;  1I27 A;  2IGK A;  4DOZ A;  3FXK A;  2STW A;  4EM0 B;  3L00 A;  1U8R A;  1FOY A;  2M0M A;  3P7N A;  2R5Z A;  1IGN A;  4XRS G;  3GWZ A;  5K5Q A;  5EG0 B;  4BQN A;  2OU2 A;  3CMM A;  4HW0 A;  4OIN F;  2LKX A;  3RQ4 A;  3DQV C;  2XRN A;  2DA5 A;  2M5W A;  2R4G A;  3E5Q A;  2VJJ A;  5D6E A;  5ILU A;  3ZP5 A;  2R7Z J;  4MLO A;  4ANJ A;  3EUA A;  4XN3 A;  4F92 B;  5F0F A;  4A6D A;  3GTM J;  3DKX A;  4LG0 B;  2O9L A;  4D5C A;  2L54 A;  1ZG3 A;  4XBF A;  3T5X A;  1VQ9 I;  4KYW A;  2RRE A;  3CMA I;  1VQM I;  2VPR A;  1BBY A;  2XHK A;  3H0G J;  5CVJ A;  4CA0 A;  3BR6 A;  2GXA A;  4DJA A;  4U0V A;  4DZJ A;  2HOA A;  4LLL A;  1DP3 A;  2NVX J;  3ABM H;  4JK1 X;  2DA2 A;  1S29 A;  1YE9 A;  3FMR A;  1NH3 A;  5JVG F;  4NBQ A;  2GA1 A;  2V9P A;  1L3L A;  1O3Q A;  2MZ4 A;  2K3F A;  3J7A W;  2DBB A;  2K27 A;  2DA1 A;  3FIW A;  3R6S A;  3HPG A;  5FD5 A;  5D5X B;  2GXB A;  1IRZ A;  4HNV A;  2XPU A;  3BC8 A;  1OKR A;  2UXX A;  4RB0 A;  1BM9 A;  4WX9 A;  1FC3 A;  2KIF A;  1U5T C;  1TWA J;  3CUQ A;  4WCG A;  5F0H A;  5E1W A;  3BPX A;  3DBR B;  3CZ6 A;  3GCM A;  5EF6 A;  1PUF A;  2IRF G;  4R1H A;  1EH8 A;  2XB5 A;  2P4W A;  1K4S A;  1HXD A;  4BL0 B;  4B44 A;  5HLI A;  2BZT A;  4NB5 A;  2MW8 A;  4AM3 A;  1OCP A;  4OU0 A;  2W1O A;  2VOD A;  4XM3 A;  2CRG A;  3QRF F;  4IF4 A;  2MLK A;  1YX5 A;  4MIM A;  4GDF A;  1HF0 A;  1YS6 A;  2A5Y B;  2O61 A;  1ETO A;  1B6A A;  4KIC A;  1MZB A;  3WTW C;  4R8H A;  5TGT A;  3OIO A;  2DYS H;  1APL C;  3FM3 A;  5H2F C;  4AWX B;  3PQK A;  3T1B A;  4RGU A;  4W97 A;  3TP0 A;  3E6M A;  1SAU A;  1PVE A;  2WV1 A;  3C2H A;  4YRV A;  4AU7 A;  2V26 A;  3AL0 B;  2MD5 A;  3OR1 C;  2ICW G;  1ZEL A;  2ECB A;  1X2M A;  4M3F A;  2ZFW A;  3BQY A;  3A03 A;  2MC4 A;  4XKW A;  4S05 A;  1YG2 A;  3TOB A;  4A6E A;  2QEX I;  1U6G A;  2IVM A;  1TQM A;  4L5E A;  1MNM C;  3K70 C;  1OCR H;  4L9J A;  3H9Q A;  2F5V A;  3CCU I;  4M9Z A;  3GTO J;  5GAD J;  1X58 A;  2AQE A;  2BV6 A;  5DV5 A;  3OS0 A;  2L7M P;  3E97 A;  2KDO A;  4BEH B;  1R1V A;  2XGC A;  4EJT A;  2HEO A;  4HG2 A;  4C30 A;  3S2D J;  4A69 C;  1RR7 A;  3DEW A;  1X1P A;  2LYC A;  1TWF J;  1Z7L A;  1BC7 C;  3SZT A;  2IW5 A;  2ZME C;  3BOQ A;  2RQQ A;  2LOO A;  2Z9O A;  2UXN A;  2ID3 A;  3A1Y A;  4RDU A;  2Y2Z A;  3HSF A;  4CDG A;  1SMY F;  1ETY A;  4BBS J;  3HKZ N;  2IBD A;  3WOD F;  2WTE A;  2VIX A;  1UB9 A;  1FWZ A;  3V8L A;  2VT2 A;  5F64 A;  3BWG A;  2IAI A;  5LHI A;  3FK7 A;  1C0W A;  2M34 A;  1YQA A;  1FBU A;  4QIW N;  3PIP F;  1T8I A;  5H20 A;  3DPL C;  3AG4 H;  2FA5 A;  3HGY A;  3PSI A;  1J0R A;  2FNP A;  3I0T A;  1LDD A;  4LFU A;  1NK2 P;  5LHG A;  4HRI A;  4EVI A;  5KHD A;  1ZRE A;  2WAF A;  3S32 A;  2JN6 A;  2R5Z B;  1IV6 A;  2GXG A;  1ONV A;  3P9I A;  1EJ9 A;  1T98 A;  3ERE D;  1AWC A;  3RKQ A;  2P0T A;  1FMV A;  2ZO4 A;  4JP0 A;  2EB7 A;  1WRJ A;  4I02 A;  1DQU A;  4FIS A;  5L3F A;  1E0E A;  2DOE A;  2M8G X;  1OCZ H;  3H1C A;  3MKZ A;  1K79 A;  1EF4 A;  2L5Q A;  4YIF A;  1FSH A;  1FBQ A;  3UNG C;  1O3T A;  3IRQ A;  5IP7 J;  1T56 A;  4WXH A;  3GZ6 A;  4JYK A;  4QPO A;  3TQN A;  3GTK J;  1XGS A;  2OCC H;  5EDN A;  3DU5 A;  3S93 A;  1W5C C;  1A36 A;  6PAX A;  2DTR A;  4PZJ A;  2E1C A;  4MFE A;  2P8T A;  2L01 A;  2DW4 A;  1G59 A;  2XAS A;  1J9I A;  2P5L C;  3W6K B;  2KIM A;  1MSF C;  1N78 A;  2JVH A;  2KPM A;  2W48 A;  4DIQ A;  2A07 F;  1SD7 A;  4LG3 A;  2EQR A;  2XRL A;  2MUN A;  1JTY A;  1HSJ A;  1RET A;  1W0T A;  3DBL B;  3FDY A;  1DU0 A;  2PN6 A;  2NAZ A;  5J40 A;  2HQA A;  4OAZ A;  1B1B A;  1MNE A;  1LVA A;  2AXL A;  1XGN A;  3FXU A;  3L9F A;  5IT3 A;  1RR8 C;  1N77 A;  2Z2S B;  4A3B J;  2IA0 A;  2VBX A;  3ZMD A;  4A3K J;  2GOM A;  3CC7 I;  3CUQ B;  2LR8 A;  4IRG A;  5J1R A;  3RKY A;  3ZQH A;  3H35 A;  2PJP A;  4L0Y B;  3K0L A;  4X0G A;  2XRO A;  2HKX A;  4HPQ A;  2ISZ A;  2QYO A;  4Q47 A;  1KU3 A;  5IP6 A;  1BL0 A;  1WJE A;  3GYH X;  1MJA A;  2A6H F;  4NNJ A;  1IF1 A; 
#chains in the Genus database with same CATH homology
 1Z9C A;  1OMI A;  3D5L A;  3JW4 A;  1KYZ A;  5AON A;  2FF4 A;  2P5V A;  2FU4 A;  1FBS A;  1W7P A;  3WG9 A;  2IP2 A;  5HLH A;  2V79 A;  4LB6 B;  4MTD A;  1HW1 A;  1HKQ A;  1I5Z A;  3H3Z A;  3KZZ A;  4EGZ A;  4EJW A;  1HST A;  4EJU A;  2K86 A;  4ZYE A;  1FNN A;  2DQL A;  2HZT A;  1G3Y A;  4ENJ A;  3O2P E;  2EJR A;  3BZ6 A;  2CW0 F;  2HQR A;  5E18 F;  1BIA A;  4O6J A;  2H6C A;  3LAJ A;  1D3Y A;  3V8K A;  5J6X A;  3B02 A;  3CDH A;  3PQJ A;  3HIF A;  1IXR C;  2VC0 A;  1JGS A;  2EFW A;  1FZP B;  1P92 A;  2HS5 A;  3BY6 A;  3I58 A;  1FP2 A;  3KP7 A;  2EFQ A;  5ILS A;  2F5D A;  3IKT A;  2EA4 A;  2HTJ A;  2RVC A;  3P9K A;  2CYY A;  5LEJ A;  3ZMZ A;  1Z1D A;  1R1U A;  2GIV A;  5ED4 A;  4CIC A;  4A12 A;  5CVI A;  5HVQ C;  3HRM A;  1IUY A;  3WTV C;  2VON A;  2VBW A;  3G3Z A;  3IWF A;  4NHJ A;  2OZ6 A;  1QO0 D;  2ACJ A;  1BI0 A;  1IN8 A;  3R60 A;  2ESN A;  2MH2 A;  5FB2 A;  5IT9 K;  1CGP A;  2QLZ A;  2QQA A;  1XGM A;  5IT9 Z;  3EET A;  2B0L A;  2JPC A;  2GQQ A;  2XKO A;  3FMS A;  4KDP A;  2DLL A;  4A5M A;  2K4J A;  3HRU A;  2DFI A;  3WTY C;  2EV5 A;  2FBI A;  4M6X A;  1ZRF A;  4PCQ A;  2H94 A;  3PFI A;  4WXC A;  4A0X A;  4OMY A;  2QEN A;  1O3S A;  2Q0O A;  3F8N A;  1MJB A;  4MQ9 F;  1P4A A;  3F8M A;  4HQM A;  2V1U A;  3DKW A;  4FT8 A;  4G8X A;  4LLN A;  3H3U A;  3ZQ7 A;  2CG4 A;  2O8X A;  4PGG A;  1QBJ A;  1W7P B;  2O3F A;  2HWV A;  1J2X A;  3I64 A;  3I53 A;  3KE2 A;  1XCV A;  1TQP A;  3TDZ C;  4RGR A;  3GFL A;  4MQV A;  4LMY A;  2M8E A;  1ZG1 A;  4UHT A;  4RAY A;  4Y13 A;  4BH9 A;  3WGH A;  3GFI A;  2QBY A;  4M74 A;  4KUM A;  1UCR A;  5E8I A;  4HF1 A;  4EJO A;  1LEB A;  4BHP A;  1B4A A;  4IXA A;  3WU1 B;  2CGP A;  1IN4 A;  3GW2 A;  2BEO A;  1ZGA A;  4UNO A;  3QPH A;  3QPT A;  2COM A;  5D5U B;  1JXS A;  3F8F A;  2NRA C;  3M8E A;  2XAG A;  2CWE A;  1W5T A;  3WTU C;  3JTH A;  2XAH A;  5JI6 A;  3T8R A;  1R7J A;  3OOP A;  1T2K A;  5CYV A;  2VBZ A;  1S7A A;  2M45 A;  3I5U A;  3EUH A;  4GYG A;  2ZCW A;  2CQK A;  3ZPL A;  4KIG A;  4OIO F;  2JSC A;  2L3D A;  5KK1 A;  2Y48 A;  1R5H A;  1A04 A;  1BC8 C;  1ON1 A;  1GXP A;  3F8B A;  4HF2 A;  4OIP F;  1ZAO A;  2FNA A;  5D4R A;  1F9N A;  3DP7 A;  4KFC A;  5E1X A;  3KP5 A;  4A2U A;  2FBH A;  3WE3 A;  5HS8 A;  5D4S A;  2GA2 A;  1XB4 A;  1B59 A;  1BIB A;  1G4D A;  2MC3 A;  3WTS C;  4DQ2 A;  4YII A;  3L2C A;  1JHH A;  3RYP A;  5CLS A;  2DK5 A;  2V1D A;  3GZ5 A;  3EDP A;  2VE9 A;  2LF7 A;  4UV8 A;  2H09 A;  5ILV A;  3SHF A;  1K78 A;  1WSU A;  2KIU A;  3K69 A;  3IC7 A;  1RUO A;  2GZW A;  3HSE A;  2HR3 A;  1LQ1 A;  4I7H A;  4YFK F;  1IN5 A;  4ENM A;  3M7G A;  3I4P A;  3F21 A;  1SFX A;  4GCV A;  1XMA A;  3BJA A;  5H6Q A;  4L5J A;  1J75 A;  2BGC A;  3FMQ A;  2BYV E;  3P9C A;  3GFJ A;  2ESH A;  4I0A A;  2HDC A;  4HV6 A;  3LWF A;  1O3R A;  1S6L A;  3LA3 A;  2Z99 A;  4LGW A;  3TO6 A;  1BI2 A;  1XGO A;  5FO5 A;  2M30 A;  3DXJ F;  5F1R A;  5HOO A;  2OBP A;  1KQ9 A;  3RKX A;  1R58 A;  2QBY B;  3KZY A;  3KEO A;  4OIR F;  3IHU A;  1S3J A;  2DQR A;  4Y17 A;  3HOS A;  3TO9 A;  3F6V A;  5FLX K;  1D8J A;  1E17 A;  5K5R A;  4H0E A;  2QQB A;  5ICG A;  1KU2 A;  1UHW A;  5EEH A;  3J81 K;  3F23 A;  1V4R A;  2HYF A;  2R7F A;  2F5C A;  4NQW A;  2FEZ A;  1ZH5 A;  2A69 F;  2ELH A;  2K02 A;  2K4B A;  2XAF A;  3VB2 A;  4HBL A;  5F6F A;  5KVR A;  3N4M A;  1DDN A;  2OQR A;  1EH6 A;  4UVB A;  4KIF A;  2O6G E;  4EM1 A;  2XAQ A;  3L09 A;  3WTT C;  1J59 A;  5D5W B;  4HQE A;  2IT0 A;  1FPQ A;  4DNC A;  3D0S A;  1FYL A;  4UUV A;  2D1V A;  2X4H A;  4UVC A;  3NRV A;  1OYY A;  5E17 F;  2UWM A;  1DPU A;  2PBI A;  2P5K A;  1K78 B;  2LKP A;  4B09 A;  4A5N A;  1FYM A;  1H9T A;  2CFX A;  5D8L B;  3HRS A;  1HBX G;  2W85 A;  4HDV A;  3N97 A;  3IL2 A;  1LB2 A;  5FGM A;  5L3C A;  2A68 F;  4K2E A;  1XN7 A;  3HUG A;  1IXS B;  2Q2E A;  2ZME A;  3ABT A;  2NYX A;  5FD6 A;  1HKS A;  3U9G A;  3O6B B;  1Z6R A;  4ESB A;  1EV7 A;  1PP8 F;  1S8N A;  3KP3 A;  1ODD A;  4WK8 F;  3GX4 X;  3RTR A;  1UFM A;  4WF2 A;  1XDS A;  2IJL A;  3K1N A;  5E8G A;  2EK5 A;  3C1D A;  2D1H A;  3E6C C;  4HZF A;  5DYM A;  3GO5 A;  2OZU A;  4P96 A;  3WGG A;  1J7K A;  2HTS A;  4A0Z A;  1YLF A;  5EEG A;  1T38 A;  1KU7 A;  4XRF A;  5CVV A;  3Q9S A;  1MD0 A;  1IRG A;  1H0M A;  3MEX A;  3OV8 A;  2K7L A;  3KLO A;  4CGZ A;  4KN7 X;  5HS7 A;  4LLG F;  1P4W A;  4HAM A;  4CHU A;  5FFX A;  1QZZ A;  4RB2 C;  3CTA A;  4HOB A;  1IN6 A;  1ZLJ A;  3U1D A;  5CVR A;  1KU9 A;  3HTS B;  1ULY A;  2Y0M A;  1U5T B;  2QWW A;  3VOE A;  4HV5 A;  3ROU A;  4PDK A;  1RIO H;  2WWY A;  3REO A;  3RYR A;  2EV0 A;  3F22 A;  3ELK A;  3GVA A;  2QM3 A;  3M9A A;  4RGS A;  1P2F A;  4HX4 A;  3EYY A;  2X0L A;  2MLG A;  2V9V A;  1R5G A;  2R3S A;  2DPD A;  4G9Y A;  3RJP A;  4UV9 A;  4KA4 A;  3F72 A;  3TGN A;  3K9T A;  1G6N A;  2TDX A;  2OAZ A;  2V1X A;  3BRO A;  1PP7 U;  5AIQ A;  1G3W A;  1BI1 A;  1S7O A;  1ZYR F;  1BOA A;  4IHS A;  4M6Y A;  4HLX A;  1R1T A;  1RNL A;  2YSR A;  4ZYH A;  2G9W A;  3M8F A;  4IHT A;  5CVU A;  4IVN A;  2XVC A;  4BHC A;  3RI4 A;  5JR3 A;  3L7W A;  1U2W A;  3HRT A;  3LA2 A;  4BYY A;  5FFZ A;  2ZME B;  3CLO A;  2QQ9 A;  5BPD A;  4LK1 F;  3I71 A;  4P9U A;  2OQG A;  2RNJ A;  3KP6 A;  4RB3 C;  1SAX A;  3VOD A;  3COA C;  1PUE E;  2JZY A;  1D8K A;  1ON2 A;  5D6F A;  4OMZ A;  1NHA A;  1K6O A;  2VE8 A;  3WE2 A;  1YTY A;  3EQL F;  1Z6T A;  5D8K B;  1FYK A;  4IJA A;  1K7A A;  2RV8 A;  2VN2 A;  3HHG A;  1FLI A;  5J8C A;  1DUX C;  1H9G A;  4L9N A;  4MTE A;  5JVT A;  4I01 A;  4EM2 A;  3WTZ A;  2PI0 A;  2W57 A;  3GXO A;  2Z3Y A;  1REP C;  1YW8 A;  3ECO A;  3MZH A;  4G94 A;  2JTV A;  4BNC A;  2PFB A;  1I1S A;  2ZXJ A;  4U0Y A;  4M73 A;  5L3B A;  4ENN A;  5ICF A;  2Q8K A;  4P5O A;  1OR7 A;  4ETS A;  1HKT A;  4M9S A;  2JPB A;  4UVA A;  3O3K A;  3T0Y A;  4JBA A;  3TOA A;  4CZZ A;  2RKH A;  1B9M A;  4HLY A;  1RZ4 A;  3SQN A;  3C3W A;  3DFG A;  2HYG D;  2KKO A;  3QU6 A;  1USS A;  2MBF A;  1TW3 A;  2DO7 A;  1KQ0 A;  3BJO A;  2BE5 F;  3E5X A;  4GO1 A;  3TKY A;  2E1N A;  3QP5 A;  4WXD A;  1MGT A;  2YR2 A;  2RC4 A;  3Q5F A;  3GFM A;  2UZK A;  4KMU X;  4N9I A;  3ML6 A;  3FZV A;  2JT1 A;  3GLX A;  2RGV A;  1HW2 A;  3FX3 A;  1ZAR A;  4U7B A;  3V8J A;  5LHH A;  2O03 A;  3R4K A;  3LQQ A;  1LEA A;  2DAO A;  2IPQ X;  1OYW A;  4RAZ A;  2HKO A;  2PLY A;  3E6D A;  1XSV A;  3JTG A;  3FXQ A;  1SD6 A;  2XKP A;  2VBY A;  4ZZD A;  1YFH A;  1YIO A;  2D45 A;  1D5V A;  1SFU A;  1W7P D;  2R7D A;  1FY7 A;  2Z33 A;  3LA7 A;  2A6E F;  2E7X A;  1WI9 A;  5E20 A;  2P7V B;  3BJ6 A;  3GUD A;  2EFP A;  5LLQ A;  3DEU A;  1ZLK A;  2L02 A;  1STZ A;  1TBX A;  3KP2 A;  5BQT A;  1ZRD A;  2Z5U A;  2ZJ2 A;  4EMS A;  5DCM A;  1YW7 A;  1SFE A;  4TV7 A;  4L18 B;  4ZYD A;  5HDN A;  1LDJ A;  3RKW A;  1MKM A;  1J5Y A;  3EYI A;  1ZGJ A;  5TJJ A;  4ESF A;  4LD5 A;  3VFZ A;  1TTY A;  5A2Q K;  2CSO A;  3RPQ A;  4CYD A;  3LQR A;  4M72 A;  4JQF A;  4BHB A;  1F4K A;  1Q1H A;  2DU9 A;  2FML A;  4XSX F;  1Z05 A;  1QPM A;  3J7A O;  1OPC A;  2C6Y A;  2XV4 S;  3LST A;  3GF2 A;  1HW5 A;  3HYI A;  5L3G A;  2W24 A;  4P9F A;  3I59 B;  1MJ9 A;  3K1M A;  1U3E M;  4Q48 A;  3MZY A;  4EGY A;  2PQ8 A;  4ZYG A;  4U7D A;  4KIB A;  4P55 A;  3BDD A;  4FHT A;  1MDM B;  1QGP A;  4B8X A;  2H27 A;  3CUQ C;  2FSW A;  4N9H A;  1AOY A;  5DD8 A;  2VOP A;  1F1Z A;  3K2Z A;  3JAM K;  1QZY A;  4S04 A;  2P6S A;  2ADU A;  2EWN A;  3QAH A;  2FBK A;  3MCZ A;  3R0J A;  3MWM A;  1CF7 A;  1SMT A;  4G7O F;  3JAM Z;  4KMF A;  1GHC A;  2A3S A;  3IRR A;  3G73 A;  2KJB A;  4R79 A;  3FF5 A;  2VT3 A;  1T6S A;  5FLX Z;  2QUF A;  4RB1 A;  1OYI A;  3GEZ A;  4I2O A;  1WWX A;  5LGU A;  4HX7 A;  2A61 A;  2PG4 A;  1SD4 A;  3HHH A;  1F5T A;  2FOK A;  3V7R A;  1YO5 C;  1LNW A;  3J81 Z;  1IAW A;  1U78 A;  3QU3 A;  2G7U A;  3RDI A;  1T39 A;  3QOP A;  4MGR A;  1Z91 A;  4A0Y A;  1U5T A;  3S2W A;  5HS9 A;  4ASN A;  4YFX F;  3F6O A;  1HQC A;  3HTU A;  4L0Z B;  2LF8 A;  4I98 B;  3KCC A;  1B9N A;  3TDU C;  5BS6 A;  2G7H A;  3E3V A;  3BPV A;  3K1P A;  5L3D A;  5DCM B;  2MH9 A;  3VEP A;  4KNY A;  2VXZ A;  3SZP A;  2FMY A;  2XUB A;  3B73 A;  4I0B A;  1FP1 D;  3WTX C;  2IA2 A;  1FSE A;  2YU3 A;  3MAJ A;  4BQA A;  2EV6 A;  4CXF A;  5CJ9 A;  2L4A A;  1W5S A;  2EA2 A;  4M71 A;  2PEX A;  4AIJ A;  1IZ1 A;  2W25 A;  4FX4 A;  3TO7 A;  4XLN F;  4IRH A;  5HDK A;  1YS7 A;  4XSZ F;  2MA3 A;  2V6C A;  3KFW X;  4QLC U;  2YX7 A;  4AIH A;  2RN7 A;  2EFN A;  2ZBK A;  3ULQ B;  3AAF A;  3JSP A;  4LB5 A;  2FQ3 A;  2LNB A;  5TRD A;  1BJA A;  4AVP A;  2YPR A;  4F7Z A;  1DP7 P;  5LGN A;  3ZN1 A;  4HF0 A;  4GXO A;  4XLP F;  1G3T A;  3KLN A;  2P6T A;  4MNU A;  4LK0 F;  3IKV A;  3V7C A;  2VC1 A;  4MHG A;  4Z2Y A;  1CF7 B;  2BBY A;  3WGI A;  3ZMV A;  2QVO A;  4AIK A;  2ZNZ A;  4ZH4 F;  3JSO A;  5D5V B;  1O7L A;  1I1G A;  2QZ8 A;  4EJV A;  3FM5 A;  5DD4 A;  1JE8 A;  3ZMT A;  4G7H F;  2KJC A;  5ICC A;  5JFR A;  2HOE A;  5BMZ A;  4L5I A;  3MFK A;  2GAU A;  1KGS A;  4WWC A;  2VOO A;  1PDN C;  3V7S A;  1W4M A;  2NNY A;  3MQ0 A;  2WV0 A;  2LDU A;  3E5U A;  4YFN F;  5J8F A;  1FOK A;  3DV8 A;  1P4X A;  4OIQ F;  5LEK A;  1IN7 A;  4KT5 C;  2XIG A;  3ZN0 A;  4EQQ A;  4I09 A;  1BN5 A;  3SFZ A;  4PGH A;  2PMH A;  1IXC A;  3ZMU A;  5H6R A;  1LJ9 A;  5L3E A;  2AS5 F;  2M1B A;  4BAY A;  1WQ2 A;  2F5E A;  1T0F A;  1BI3 A;  2ZKZ A;  2CO5 A;  3NQO A;  1R23 A;  4RS8 A;  1O57 A;  3HSR A;  5LRS A;  3NEU A;  3T8T A;  1EH7 A;  4IPA A;  1QQI A;  4IRI A;  3RPU A;  3HOT A;  3C18 A;  1ZG5 A;  5DEQ A;  2J5O A;  4L9T A;  4D0P A;  3Q9V A;  1E2X A;  2EFO A;  4UXN A;  2DPU A;  4E70 A;  3CO6 C;  2KRF A;  1I6X A;  4MEY F;  1YYV A;  2LSO A;  4L9V A;  1QNT A;  3R0A A;  4G6D A;  5DUK A;  2W84 A;  2RDP A;  1XSD A;  3KET A;  4HDU A;  4U0W A;  1IW7 F;  3KEQ A;  4O3M A;  1L0O C;  4G6Q A;  2H6B A;  3V4G A;  1LDK B;  1XSX A;  1XD7 A;  3RIR A;  4EV0 A;  2FE3 A;  2HGC A;  1KA8 A;  4GYI A;  3I54 A;  1RI7 A;  2OA4 A;  5HLG A;  1G3S A;  2Y75 A;  2HQN A;  2NS0 A;  5ICE A;  2IA1 A;  1R36 A;  1VTN C;  3CO7 C;  2FRH A;  2NNN A;  3I59 A;  5JHU A;  1ZN2 A;  1YW9 A;  2XAJ A;  3F8C A;  3J80 K;  3E6B A;  5ERI A;  3ISP A;  2FXA A;  1XMK A;  1MDM A;  3FHZ A;  1GXQ A;  1DPR A;  4N0B A;  1X3U A;  4KN4 X;  2DT5 A;  3J80 Z;  5E1Z B;  1KQ8 A;  1FT9 A;  2M87 A;  2ISY A;  3ABU A;  5BOX A;  5DCF A;  4LG0 A;  3LFK A;  4BXU A;  3WU0 A;  1TLH B;  3W6J B;  3BP8 A;  3F3X A;  5LRR A;  4RGX A;  2RQP A;  5HDG A;  4U88 A;  1Y0U A;  3CJN A;  5DDG A;  1TW2 A;  4LJZ F;  2GWR A;  2XGX A;  1ZRC A;  2JRT A;  2DI3 A;  4FX0 A;  2HFH A;  1V3F A;  3FWE A;  4YG2 F;  1UHM A;  4ENK A;  1IRF A;  2O0Y A;  4MEX F;  3IWZ A;  1XCB A;  4AD9 A;  4ON0 A;  2E7W A;  3C7J A;  3KP4 A;  4O5V A;  5K1Y A;  1UST A;  2F5F A;  4ZZL A;  5LBQ A;  4G7Z F;  2STT A;  3CUO A;  4OOI A;  1ZHF A;  5LGT A;  4HA8 A;  3FXR A;  1FX7 A;  1TQI A;  3ECH A;  4HYE A;  2DK8 A;  2OD5 A;  1KYW A;  1R00 A;  4Q4Z F;  1SD5 A;  2D2W A;  2L4M A;  2ETH A;  1R22 A;  4ESJ A;  2YX4 A;  2PMU A;  1WKM A;  1JHF A;  4Q5S F;  1P6R A;  3ZMS A;  1RUN A;  2ZNY A;  4QWQ A;  5BPI A;  3LAP A;  5AIP A;  3M1E A;  1TNS A;  3SXY A;  5K5O A;  1TNT A;  2WC2 A;  4HX8 A;  5A2Q Z;  2F2E A;  2J5P A;  1Z7U A;  3H92 A;  4Y15 A;  3QP6 A;  3U2R A;  3DF8 A;  1O7F A;  2P7C B;  3R61 A;  4CO8 A;  5DUI A;  4GGG A;  3DPT A;  1GVJ A;  4M9X A;  1XDU A;  1I27 A;  2STW A;  4EM0 B;  3L00 A;  1U8R A;  3P7N A;  3GWZ A;  5K5Q A;  2OU2 A;  4HW0 A;  4OIN F;  3DQV C;  2XRN A;  2M5W A;  3E5Q A;  5D6E A;  5ILU A;  3ZP5 A;  4A6D A;  4LG0 B;  2L54 A;  1ZG3 A;  4XBF A;  3T5X A;  4KYW A;  1BBY A;  2XHK A;  5CVJ A;  4U0V A;  4LLL A;  4JK1 X;  1S29 A;  3FMR A;  2GA1 A;  1L3L A;  1O3Q A;  2DBB A;  2K27 A;  5D5X B;  3R6S A;  5FD5 A;  2GXB A;  1OKR A;  2UXX A;  4RB0 A;  1BM9 A;  4WX9 A;  1FC3 A;  2KIF A;  1U5T C;  3CUQ A;  4WCG A;  5E1W A;  3BPX A;  2IRF G;  4R1H A;  1EH8 A;  2P4W A;  1HXD A;  5HLI A;  4NB5 A;  4OU0 A;  2VOD A;  3QRF F;  4IF4 A;  2MLK A;  1YS6 A;  2A5Y B;  2O61 A;  1B6A A;  4KIC A;  1MZB A;  3WTW C;  4R8H A;  3FM3 A;  4AWX B;  3PQK A;  3T1B A;  4RGU A;  3E6M A;  2MD5 A;  2ZFW A;  4S05 A;  1YG2 A;  3TOB A;  4A6E A;  1U6G A;  2IVM A;  1TQM A;  4L9J A;  4M9Z A;  2BV6 A;  5DV5 A;  3E97 A;  1R1V A;  4EJT A;  2HEO A;  1BC7 C;  3SZT A;  2IW5 A;  3BOQ A;  2Z9O A;  2UXN A;  3HSF A;  4CDG A;  1SMY F;  3WOD F;  2WTE A;  1UB9 A;  1FWZ A;  3V8L A;  2VT2 A;  5F64 A;  3BWG A;  5LHI A;  1C0W A;  1YQA A;  1FBU A;  5H20 A;  3DPL C;  2FA5 A;  1J0R A;  2FNP A;  3I0T A;  1LDD A;  4LFU A;  5LHG A;  4EVI A;  1ZRE A;  2GXG A;  1ONV A;  3P9I A;  1T98 A;  3ERE D;  1AWC A;  2ZO4 A;  2EB7 A;  1WRJ A;  4I02 A;  5L3F A;  1K79 A;  1FSH A;  4YIF A;  1FBQ A;  1O3T A;  3IRQ A;  4WXH A;  3GZ6 A;  3TQN A;  1XGS A;  6PAX A;  2DTR A;  4PZJ A;  2E1C A;  2P8T A;  2L01 A;  2DW4 A;  2XAS A;  1J9I A;  2P5L C;  3W6K B;  2KIM A;  2A07 F;  1SD7 A;  1HSJ A;  2PN6 A;  2NAZ A;  1B1B A;  2AXL A;  1LVA A;  3FXU A;  1XGN A;  3L9F A;  5IT3 A;  2IA0 A;  2VBX A;  3ZMD A;  3CUQ B;  4IRG A;  3RKY A;  2PJP A;  4L0Y B;  3K0L A;  2XRO A;  2HKX A;  2ISZ A;  2QYO A;  4Q47 A;  1KU3 A;  3GYH X;  1MJA A;  2A6H F;  1IF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...