1XCVA

Crystal structure of (h79ac102d)dtxr complexed with nickel(ii)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor mutant
publication title Mechanism of metal ion activation of the diphtheria toxin repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xcvA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1xcvA02
5LBQA 1QO0D 1CF7B 4HF1A 1U5TC 5ICFA 3PQKA 2E7WA 1IF1A 1FLIA 3JSOA 4H0EA 4U7DA 2GA1A 2CW0F 4LB5A 3VOEA 3RKWA 1XSDA 3RDIA 4R1HA 2KKOA 3KP2A 4RB0A 1OPCA 3EQLF 3HRSA 1WKMA 3M8FA 5BPDA 1R22A 4I7HA 5LGUA 1L3LA 1F1ZA 4M6XA 5CJ9A 4KICA 3GFMA 3BJAA 2EV6A 2W25A 1Z1DA 2ADUA 1BC8C 3DP7A 2IP2A 1P4WA 3ABUA 5LEJA 4CGZA 3HSFA 1J7KA 4KIGA 4PCQA 2QQ9A 1LNWA 4E70A 2HWVA 3E6DA 1FZPB 3C1DA 1G6NA 1XMAA 4EJWA 1K78A 5ED4A 5FD5A 1OKRA 1DDNA 1R00A 2FBHA 3WE3A 2LNBA 1TW3A 3B02A 3GFJA 4Y13A 2ZFWA 4Q4ZF 2XUBA 1OYYA 1U3EM 4GYGA 5CVJA 1B9NA 1W7PB 2MLGA 1HW1A 2VOPA 3ML6A 2RV8A 4MEYF 4GXOA 4XBFA 3RPUA 2Q8KA 4ZYDA 5CVVA 4G9YA 2GIVA 4ZYEA 1IN8A 2HYGD 1G4DA 4CYDA 4AIHA 2KIUA 2JRTA 2DPUA 3COAC 3M9AA 3BWGA 4LB6B 3DQVC 2ESNA 3BP8A 5ILVA 1L0OC 5K5RA 4XLPF 2A6EF 1LDDA 3WTWC 2YX4A 4HX7A 4XLNF 2IA2A 5IT9K 1J2XA 1LJ9A 1KGSA 2D1HA 3V7CA 2HDCA 1XGNA 3O2PE 2OD5A 2M1BA 3TOBA 1SD4A 5L3DA 1DUXC 2PFBA 3B73A 4HZFA 1JXSA 1XB4A 2COMA 2FBIA 3O3KA 5LGNA 2K86A 5DD4A 2JZYA 4Z2YA 4EJOA 1QGPA 5LHHA 3P9KA 2Y75A 1QZYA 2DT5A 4U0WA 4M9ZA 3D0SA 4UVAA 3QPTA 3JAMK 1MDMA 3F22A 2EV0A 3CUQB 2O03A 2KJCA 5FD6A 2A6HF 3WE2A 4GGGA 2E1NA 5E20A 3CO6C 3F6VA 5HLGA 3TOAA 1Z6RA 2EFOA 3EYYA 4F7ZA 2XIGA 3PFIA 1BN5A 2K02A 3FXRA 3KP7A 3RKXA 1K79A 3J7AO 4KNYA 3RYPA 1ZHFA 3HIFA 1D5VA 4U88A 3T0YA 3QPHA 4S05A 4UV8A 3FMRA 1ZLKA 2FOKA 3W6KB 1BOAA 3M7GA 1FNNA 1V3FA 1EH6A 1TQIA 1WWXA 4HV5A 5E8IA 3WGGA 3IWFA 5DEQA 3QP6A 3M8EA 1IW7F 4M72A 3P9CA 2V1UA 2LSOA 4HLXA 1TNTA 5D4RA 4FX0A 5LGTA 3DEUA 3HUGA 1GHCA 1ZN2A 4IHTA 4M71A 2PN6A 2EB7A 1R5GA 2EV5A 4HBLA 3KP5A 2FXAA 3K1NA 4AWXB 4RAZA 2DTRA 5D5WB 2KRFA 3GF2A 2PMHA 5L3BA 1BM9A 5LRSA 2PI0A 1EH7A 4YG2F 3VFZA 1ZGAA 1SD7A 4IF4A 3WODF 1DPUA 4Q48A 1U2WA 3L9FA 2GA2A 4MQ9F 1QNTA 3E5QA 2BYVE 3K69A 1J5YA 4UXNA 3TDZC 2WC2A 2FEZA 2F5FA 1LDJA 5BS6A 4Y15A 3MEXA 3I0TA 3R0AA 3IKTA 2DBBA 4IRHA 3FZVA 3DV8A 1G3WA 3LA7A 3MFKA 4R79A 1CGPA 2QUFA 3FM5A 4CXFA 4N0BA 5ILUA 2CO5A 3LQQA 4G8XA 4NQWA 4DQ2A 3KLOA 2DO7A 4HYEA 3U9GA 2STWA 4UVBA 3VEPA 3KP3A 2V1XA 4M73A 2NRAC 1QQIA 2VT2A 5KVRA 1R1TA 3ZMUA 3R0JA 1J59A 5D5VB 1UHMA 2P5KA 1KA8A 2NAZA 3ERED 4LLLA 5CLSA 5J6XA 1OMIA 4AIJA 2IJLA 4EGZA 1F9NA 5HLIA 3RTRA 3U2RA 5L3CA 1E2XA 1F4KA 3MAJA 2J5PA 1XCVA 1YQAA 4LG0B 2RKHA 1IRFA 5DV5A 2VOOA 5D8KB 3I71A 1VTNC 2ISZA 3W6JB 1IXSB 2JPCA 2XROA 1I1SA 2QQAA 1JGSA 3RKYA 1W7PD 1Z05A 4QLCU 2X0LA 4IRGA 4WF2A 1LQ1A 2P6TA 1QPMA 3DF8A 3G73A 5HDGA 1Z7UA 3KLNA 2FNAA 3HSEA 4CICA 5HDNA 1BIBA 1MJ9A 1KYWA 4LGWA 5AIPA 5LHIA 3LAJA 4FX4A 1X3UA 1ZRCA 3TGNA 2EFQA 3GUDA 3FMSA 1Y0UA 3HRTA 1YW7A 1MKMA 2O61A 1QZZA 2H6CA 4M9SA 2QM3A 1D8KA 3IRQA 3CUQC 4B8XA 4FHTA 2PEXA 1V4RA 3J80K 3GVAA 2FBKA 3WTZA 3ROUA 1K78B 4ZYHA 4IRIA 4A2UA 3ECOA 4G6DA 1LDKB 1TLHB 1XGOA 3L2CA 1RUNA 1BI2A 5DD8A 1O7LA 3LSTA 4BYYA 1T38A 1O7FA 2V6CA 2L4AA 3IRRA 4P9UA 3R6SA 3S2WA 1R7JA 4O6JA 3FF5A 3HTSB 1IXCA 3HOSA 3BY6A 1IN7A 5FGMA 3DPTA 2HKOA 4BHPA 3CO7C 3GZ6A 3BOQA 3GFIA 5CVIA 6PAXA 1FSEA 4I98B 5K1YA 4WWCA 4OIOF 1MJBA 1FY7A 2F5DA 4UNOA 1H9GA 1ON1A 4HF0A 2VN2A 1XDSA 2CYYA 2LKPA 1USTA 2CFXA 1IXRC 1FSHA 4ESFA 4PDKA 1KU9A 3F8NA 4HQEA 2W57A 5ICGA 1YLFA 2GXBA 2HQNA 1HW2A 2VXZA 4N9IA 4MTEA 1T39A 4HV6A 1O57A 1FYLA 1OYWA 4G94A 3DXJF 1YS6A 5BPIA 3QU3A 2JSCA 3MCZA 5DYMA 5F64A 5HDKA 1C0WA 1O3SA 2E7XA 2MD5A 5E18F 3LA3A 3Q5FA 1XSVA 4OU0A 5E1XA 2P5VA 1PP8F 1YW8A 1PP7U 1ZARA 2ZNYA 4RB3C 4M6YA 3RI4A 4A0YA 2ETHA 3LWFA 5FLXZ 3TO6A 2Z99A 1TTYA 4YIIA 1ZG5A 2IA0A 4HDVA 2LF8A 2VC1A 3WTTC 2ZCWA 1USSA 1RI7A 3ZQ7A 5H20A 3MZHA 3L09A 4L5JA 2ZNZA 1B9MA 3C18A 1MDMB 3SXYA 2EFPA 2VT3A 1T98A 4WXDA 4YIFA 3SFZA 2MA3A 4A0XA 1T6SA 3KZYA 1IRGA 5CVRA 1R36A 4A5NA 2Y0MA 2EK5A 4UVCA 4UHTA 3NRVA 2RGVA 1GXPA 1XCBA 4M74A 4JQFA 3EYIA 3LA2A 3R60A 1BBYA 1KU7A 2HQRA 2F5EA 3FX3A 3FXQA 5FFZA 2BV6A 2XAGA 2YSRA 3V7RA 1DP7P 4I0BA 4L18B 1HBXG 2A3SA 2Z9OA 1OYIA 3H3UA 3GEZA 1BC7C 2A69F 1JHHA 4OOIA 5LLQA 4MHGA 1S3JA 3AAFA 4ZYGA 3JTGA 4HAMA 3LQRA 4QWQA 1IN6A 4BH9A 2XRNA 1UFMA 1HQCA 1UHWA 4ZZDA 1FT9A 2TDXA 3V8KA 3F8CA 3WTVC 2VE8A 2DPDA 2EA2A 1FWZA 3NQOA 4NHJA 2BBYA 2UWMA 2ELHA 3P9IA 2VBWA 2XAHA 3REOA 2KIMA 2J5OA 2LDUA 4OIPF 5CVUA 2G7UA 2ZO4A 4EGYA 3F8MA 5ERIA 3O6BB 3HYIA 2XAFA 2GWRA 2Z33A 4HQMA 5LEKA 1WSUA 3C3WA 1YYVA 3D5LA 3GW2A 3K9TA 4HOBA 4G7ZF 4L0ZB 2P7VB 5J8FA 1U5TB 4OMYA 1FYKA 4MGRA 5DUKA 3KFWX 5D5UB 1FC3A 1RIOH 5DCMA 1Z6TA 5LHGA 2OA4A 1I1GA 4EJUA 4G7HF 1AWCA 1T0FA 1W5TA 2VC0A 4R8HA 3QU6A 2F5CA 4CZZA 1FBUA 2EA4A 3TQNA 4WX9A 4ZZLA 1YO5C 4LD5A 1G3YA 1RUOA 3EETA 2H09A 3EDPA 2PG4A 3IHUA 3E5XA 1FBQA 2IA1A 2R7FA 3ABTA 3ULQB 2CG4A 3ZMZA 4UV9A 3J81Z 4EVIA 4Q47A 3BJ6A 4L9VA 5KK1A 2STTA 4LFUA 4WK8F 3HOTA 1ON2A 1U5TA 2FA5A 2QENA 1KQ9A 3ELKA 3TO9A 3G3ZA 1QBJA 2WTEA 2PLYA 2FMYA 1LEBA 1WI9A 3SHFA 2FF4A 3HHHA 4LJZF 4EJTA 1J75A 5E17F 4AVPA 2YR2A 2L01A 2QVOA 2R3SA 4GYIA 4BQAA 2AXLA 1WQ2A 2H94A 1HSJA 1TBXA 5FB2A 1ZRFA 4WXCA 2XGXA 2EJRA 1ZH5A 2XAQA 2M45A 1B6AA 2PMUA 3BDDA 4XRFA 4KUMA 3QRFF 3I54A 5AONA 1REPC 1KQ0A 4GCVA 2MBFA 4OIQF 1BJAA 4WXHA 3I58A 2DAOA 2GZWA 2CWEA 5ICCA 4KMUX 2KIFA 4G7OF 3K0LA 1TNSA 1ZRDA 4NB5A 4BNCA 2D45A 2G9WA 1F5TA 2O6GE 3H3ZA 3F21A 2RNJA 3BZ6A 2FQ3A 3Q9VA 4KT5C 1G3TA 1I6XA 2P5LC 1ZREA 4DNCA 4RGUA 2RN7A 2DQRA 3OOPA 2H6BA 4I2OA 4L0YB 4CO8A 4ON0A 4PGHA 4ZH4F 1FX7A 2FNPA 4S04A 1IN4A 3SQNA 4IPAA 1BI3A 3L7WA 1XGSA 1HSTA 4IJAA 1JHFA 3ZMTA 2ISYA 3ECHA 4KIFA 3DFGA 4LK0F 2Z5UA 4M9XA 2JPBA 4YFNF 4RGXA 1LVAA 5K5OA 5JI6A 1K7AA 2HFHA 2PQ8A 3CDHA 1W5SA 2XKPA 3QP5A 4O3MA 2XHKA 1PDNC 2NNNA 1TQPA 2HTSA 2P8TA 2FMLA 4U7BA 1BI0A 1R1VA 5E1WA 3R61A 1D3YA 2A68F 4HA8A 3V8JA 2QBYA 2QWWA 4HDUA 2OAZA 3GWZA 3E97A 2DK5A 1SD5A 1S7OA 2VODA 2E1CA 5LRRA 1EV7A 4RS8A 4XSXF 1FP1D 3EUHA 3FM3A 4I01A 2XV4S 1KYZA 2CGPA 2EFWA 4FT8A 2D1VA 4JBAA 1HKTA 2NNYA 1A04A 2VONA 1XN7A 3T8RA 5D6EA 5EEHA 1P4AA 4IXAA 3V7SA 4EV0A 2RDPA 3RYRA 1YS7A 3ZMDA 5CYVA 1S7AA 4ASNA 2ZMEB 2H27A 4RB2C 2O0YA 1Z9CA 3VODA 3E3VA 1IAWA 1JE8A 2OZ6A 1RNLA 5L3GA 1ULYA 2IRFG 4EMSA 3KE2A 4HF2A 4OIRF 5JFRA 2AS5F 2GXGA 2ZXJA 1K6OA 4ESBA 4A5MA 2IW5A 3HHGA 3BPXA 1J9IA 3V8LA 1ONVA 5L3FA 2W24A 4KFCA 5JVTA 1XD7A 2M5WA 1STZA 2RQPA 3KEQA 2A61A 3GXOA 4P96A 4MTDA 3KP6A 2F2EA 2OQGA 2Q2EA 2MLKA 3C7JA 4L9JA 1YIOA 1O3RA 1R5HA 3MWMA 5H6RA 2XVCA 4WCGA 2FRHA 5F6FA 4LK1F 4AD9A 3KP4A 3R4KA 4PGGA 2ZMEA 2V1DA 1SAXA 4RGRA 1CF7A 2Y48A 1DPRA 3KCCA 5D5XB 2VBZA 1XSXA 5FLXK 3PQJA 5DUIA 1SMTA 4L9TA 3ZN0A 1HKSA 3JW4A 3ISPA 3WU1B 2L02A 4BAYA 2Z3YA 1TQMA 2G7HA 4AIKA 1EH8A 5DDGA 3KEOA 2DQLA 5H6QA 3F23A 3TDUC 2WWYA 1ZAOA 2ZBKA 4BHBA 2L54A 4ENNA 1W4MA 4HX4A 2UXNA 4P9FA 1HXDA 1P2FA 2RVCA 1U78A 3FWEA 3F72A 1GXQA 2RC4A 3K1PA 1FPQA 3E6MA 4MQVA 1KQ8A 4P55A 3E5UA 1SD6A 2GAUA 3LFKA 2UXXA 3I64A 2HR3A 2XASA 1H0MA 5IT9Z 4A0ZA 5BQTA 1E17A 2BEOA 3ZMSA 2V79A 1SFUA 3OV8A 3KETA 2HS5A 3T5XA 1R23A 5F1RA 4D0PA 4KA4A 4BXUA 1ZYRF 2JT1A 3RIRA 2M30A 5DCMB 5HLHA 1W7PA 3GO5A 3U1DA 4EM1A 1OR7A 1T2KA 3TKYA 2VBXA 3P7NA 3WG9A 3K1MA 1I5ZA 3WTYC 2L4MA 3IWZA 4HX8A 2DLLA 3MQ0A 2HKXA 2Q0OA 1YW9A 3JAMZ 5ICEA 5L3EA 2OZUA 2P4WA 3GLXA 1UCRA 5TRDA 1LEAA 3I5UA 3IL2A 5BMZA 1HW5A 3H92A 5A2QZ 3GX4X 1MGTA 1P6RA 5D4SA 2GQQA 5A2QK 3E6BA 2ACJA 4A6EA 4A12A 1U8RA 1FP2A 2W84A 1IUYA 2QQBA 2HOEA 2HTJA 4O5VA 4ESJA 4A6DA 2DI3A 4N9HA 3E6CC 2YX7A 3BPVA 3HTUA 2PJPA 5E1ZB 3RPQA 2ZKZA 3ZN1A 1KU3A 3I53A 4HW0A 2MH2A 3HRUA 4JK1X 2KJBA 2FSWA 3IC7A 4EM0B 2A5YB 1ZG1A 4KIBA 2ZJ2A 2YPRA 3WTXC 2XKOA 1TW2A 5TJJA 3SZTA 2R7DA 4KYWA 2K4JA 1ODDA 2K4BA 2HYFA 2IT0A 1S8NA 3CTAA 1O3QA 1Z91A 2MC3A 2O8XA 1IZ1A 1MZBA 3CUQA 3RJPA 5ILSA 2DW4A 1YFHA 1J0RA 3FXUA 4KMFA 3FMQA 4ENMA 1FBSA 3WTUC 1Q1HA 3J81K 2UZKA 2LF7A 1YTYA 4LMYA 4XSZF 2QYOA 3CLOA 2HGCA 4LLGF 3N97A 1XMKA 3WTSC 5E8GA 4B09A 3GYHX 2HEOA 5FO5A 2XAJA 2K27A 2VE9A 2IVMA 3QAHA 3ZP5A 4CHUA 1R1UA 1FYMA 4PZJA 4ENJA 1S29A 1ZLJA 3HSRA 2QLZA 3I59B 5AIQA 2P6SA 3DKWA 5JHUA 4CDGA 3BJOA 4EM2A 1O3TA 2P7CB 4RGSA 1YG2A 4OINF 2EFNA 3SZPA 4IVNA 4GO1A 5DCFA 5K5QA 2MH9A 2C6YA 3T1BA 1S6LA 4RAYA 4KDPA 1XGMA 3IKVA 2JTVA 2DK8A 3ZPLA 3F3XA 2OBPA 5IT3A 2YU3A 2QBYB 5FFXA 2IPQX 3NEUA 2NS0A 3MZYA 3F6OA 2X4HA 2DFIA 2M8EA 2V9VA 4KN4X 1FOKA 4L5IA 4K2EA 3GZ5A 5HOOA 4OMZA 4EJVA 2FU4A 1MJAA 4Y17A 1UB9A 3JTHA 2EWNA 2QZ8A 3F8BA 3GFLA 3I4PA 3I59A 5BOXA 1P92A 4YFKF 2D2WA 3FHZA 1RZ4A 1SMYF 2CSOA 2VBYA 1BI1A 4L9NA 4ENKA 2O3FA 1B1BA 5D6FA 2BGCA 4I02A 1LB2A 4BHCA 3DPLC 2CQKA 1ZG3A 3WU0A 4HLYA 5D8LB 4MNUA 1B4AA 5J8CA 3T8TA 3ZMVA 1SFXA 2K7LA 4G6QA 2DU9A 1BIAA 4P5OA 4TV7A 4ETSA 2FE3A 2PBIA 3CUOA 1AOYA 1HKQA 2L3DA 4KN7X 5HVQC 4I0AA 1D8JA 5HS7A 1MD0A 2OU2A 1KU2A 5HS8A 3M1EA 2A07F 3N4MA 2NYXA 1G3SA 2HZTA 3KZZA 5EEGA 5JR3A 3LAPA 5HS9A 2OQRA 3V4GA 3WGHA 4UUVA 4IHSA 3HRMA 2BE5F 1H9TA 3K2ZA 3Q9SA 4Q5SF 4LG0A 3VB2A 4RB1A 1PUEE 3TO7A 2W85A 2B0LA 1I27A 2WV0A 3JSPA 4MEXF 3F8FA 4U0YA 1WRJA 1B59A 3J80Z 4EQQA 1U6GA 1XDUA 1ZGJA 4YFXF 1IN5A 3L00A 2ESHA 1P4XA 3QOPA 1GVJA 1SFEA 3CJNA 4I09A 4U0VA 3BROA 3WGIA 2M87A 4LLNA 1NHAA 1R58A
chains in the Genus database with same CATH superfamily
5LBQA 1QO0D 3H5AA 1CF7B 3AL0B 4HF1A 4RLFA 1U5TC 3N05A 5ICFA 2JVGA 4PUSA 1JJ6C 3PQKA 3MKZA 2E7WA 1IF1A 1YITI 2R5ZB 1FLIA 3JSOA 4H0EA 4U7DA 2KIQA 3DU5A 2OTLI 2GA1A 2CW0F 1FOXA 3JRAA 3S1RJ 4LB5A 1XPXA 3VOEA 3RKWA 1XSDA 3RDIA 3MKLA 4R1HA 3OYCA 2DA3A 2KKOA 2E19A 3HGYA 2M34A 3DLAA 2FX0A 2MYSA 5FRMA 3HOZJ 3KP2A 3JRFA 4RB0A 3PSFA 1OPCA 3EQLF 3HRSA 1SVMA 3ZQIA 3J7YJ 4PSWA 5GPAA 1WKMA 3M8FA 3MD2A 3I3LA 1WJEA 2LH9A 2E34A 5BPDA 1R22A 4I7HA 3WHBA 3A0HC 4DZPA 3QODA 1OCPA 1F1ZA 4DYCA 4M6XA 4F91B 5LGUA 1L3LA 5CJ9A 3BTIA 3GFMA 4KICA 2EH3A 5E3OA 4BKXA 3BJAA 4HRIA 2FD5A 2EV6A 2W25A 2M2EA 1Z1DA 3BTJA 1A31A 2ADUA 3Q0WA 5EF6A 5F0CA 3ESWB 3BZCA 1BC8C 3DP7A 4D5CA 2B9SA 1UELB 4XIDA 5IPAA 2IP2A 3GZNB 1P4WA 2H8RA 3ABUA 2H1LA 5J47A 5LEJA 4CGZA 3HSFA 3AKZA 1J7KA 4KIGA 4IOAF 5FLXR 1SANA 2ELKA 4PCQA 2QQ9A 1LNWA 4E70A 2HWVA 1N25A 1W5CC 2E1MB 3E6DA 1FZPB 3CJTB 3C1DA 2IXSA 1G6NA 1XMAA 4EEFG 4EJWA 1K78A 5ED4A 4XKWA 2KRCA 1X1CA 2R4GA 4W1UA 5FKOA 2P0TA 1JJ8C 1N78A 1VZ0A 1XX5A 3ZQGA 5FD5A 1OKRA 3BG6A 1ERDA 1VI0A 1DDNA 3A4CA 4DBQA 1R00A 1UZCA 2FBHA 4N4NB 3WE3A 4BL0B 2LNBA 3H5RA 1TW3A 4AUXA 2GXAA 3B02A 4XORA 3GFJA 3UR3C 3TW7A 1FMVA 4Y13A 2DA6A 2L2OA 2ZFWA 4A3KJ 2WB1N 2DA2A 2VJ5A 2R5ZA 2XB0X 4Q4ZF 2XUBA 1X1PA 4ZC3A 1OYYA 2AQFA 1FJLA 1U3EM 4ZJZA 4A3DJ 3OL4A 1YJWI 5IP7J 4GYGA 5CVJA 1B9NA 5FLVA 4A3LJ 1W7PB 2BZTA 1HW1A 2MLGA 4XONA 2VOPA 3ML6A 2RV8A 4MEYF 2I8DA 4GXOA 2R7TA 4HNUA 4XBFA 2KMUA 3H9GA 4FISA 2EIJH 3RPUA 3P5JA 2Q8KA 4ZYDA 1E0EA 5M5WJ 3PL8A 1KONA 3CJQB 3CMMA 2A5WA 3KIOA 5JLXA 1H88C 5CVVA 3G1MA 4G9YA 1BJZA 2GIVA 4ZYEA 1IN8A 4NBQA 2HYGD 2LG4A 3CCSI 1G4DA 4CYDA 2COBA 1OCOH 1T95A 2V4JC 1T56A 4AIHA 2HVRA 3S3MA 2CW7A 2KIUA 4NNJA 2JRTA 3HXLA 2DPUA 3JRIA 2RQQA 3COAC 2HOAA 2KLOA 3M9AA 3BWGA 5DS9A 3S15J 1ZQ3P 4LB6B 1E3OC 1SFKA 3BTLA 3DQVC 2HVSA 2DYSH 2ESNA 3BP8A 3D5SC 5ILVA 5IY5H 4ABZA 1L0OC 1WZ2A 2L7MP 1WPKA 5K5RA 1FMWA 4B43A 2VPRA 3F9KA 4XLPF 3E1SA 1F43A 2A6EF 1LDDA 3S3OA 2LVSA 4BACA 3RSNA 2XSDC 4RM2A 3WTWC 2YX4A 1UG2A 5IYCJ 4HX7A 4XLNF 3OYBA 4XLHA 2IA2A 5IT9K 1J2XA 1LJ9A 1KGSA 2D1HA 4XICA 2FJ1A 2R92J 3VSLA 3V7CA 4NC8A 2HDCA 1XGNA 3O2PE 2OD5A 1QRYA 3I55I 2M1BA 1WGXA 2TCTA 3TOBA 1SD4A 5L3DA 2LBFA 1Z7LA 2L5QA 3FIWA 1DUXC 2PFBA 3B73A 2V9KA 4GRIA 2VUMJ 1MNEA 2X6XA 4HZFA 1Y1WJ 5FJ8J 1JXSA 1XB4A 2DCEA 3EUHC 3I9V2 2COMA 2FBIA 2HQAA 3ONQA 2VKVA 4M6VA 3O3KA 2GM4A 5LGNA 4M3EA 2K86A 5EDNA 5DD4A 3MMYB 2JZYA 4Z2YA 5B5EC 1RKTA 1Y1VJ 1ZTRA 4EJOA 1RKWA 5F04A 1QGPA 5J1RA 4DIQA 5LHHA 2JWTA 2OF7A 3HUGB 3P9KA 2Y75A 1QZYA 2DT5A 4U0WA 1QHHD 1TWHJ 4M9ZA 3D0SA 4M3BA 4UVAA 1K4TA 3QPTA 3JAMK 4A3GJ 1V55H 2BW3B 1MDMA 3F22A 2EV0A 2JA5J 3CUQB 4XKBA 2O03A 2KJCA 1Z77A 5FD6A 9ANTA 2LYCA 3C2BA 1BR2A 2A6HF 3G1LA 3WE2A 3ZOBA 4D7NA 2XC7A 4GGGA 1V5FA 2E1NA 4XLFA 1W36C 3DEWA 5E20A 3CO6C 3F6VA 5HLGA 2BHYA 3TOAA 1Z0XA 3C2GA 1YE9A 3SEQA 2W7NA 1Z6RA 4NUBA 1WJ5A 2EZHA 2EFOA 5HODA 3EYYA 4F7ZA 2XIGA 3NWTA 1VQ4I 3H9JA 3PFIA 1BN5A 2K02A 1X4PA 3FXRA 2JA6J 2LY1A 5F1JA 3A1YA 3KP7A 4GFBA 3RKXA 1K79A 3J7AO 2X9DA 4KNYA 4IZZA 3RYPA 1ZHFA 3DWLE 3HIFA 4U88A 1D5VA 3T0YA 2NVUB 3QPHA 2LKSA 4S05A 2LFBA 2Z1DA 2WAQN 4BJ5C 2QSFX 4UV8A 1IV6A 3FMRA 3FXKA 2FOKA 3BCBA 1ZLKA 3RZDJ 3W6KB 1BOAA 5J1UA 3M7GA 1FNNA 1V3FA 4A3JJ 1EH6A 1TQIA 1WWXA 2QKMB 2HQ5A 3PNTA 2GIZA 5E3NA 4HV5A 5E8IA 3BG5A 4UB8C 1SFOJ 2M4GA 3WGGA 3IWFA 1RETA 3LL7A 3RCOA 1EF4A 5IYBJ 5DEQA 4RA2A 3QP6A 3A02A 3BR2A 3M8EA 2G0EA 1Y8QB 1PUFB 3PO2J 1IW7F 4M72A 3P9CA 2V1UA 3JRBA 2LSOA 5IP9J 4HLXA 1TNTA 5D4RA 4FX0A 2BXYA 2MC4A 3M3YJ 5LGTA 3DEUA 2WY7Q 1B8IA 3HUGA 2PJRB 3O8HA 1GHCA 2DXIA 1ZN2A 2DJIA 3CP8A 2XGDA 4IHTA 3ERMA 2BW3A 4M71A 4IEJA 2PN6A 2EB7A 4LIVA 1R5GA 2EV5A 2XPVA 4HBLA 3KP5A 4E7IA 2FXAA 1Y39A 3K1NA 4AWXB 1JKPC 4RAZA 2DTRA 5D5WB 1D0YA 2KRFA 4LIUA 3GF2A 2W48A 2ZMEC 2PMHA 2MW8A 4MO7A 1AHDP 4AYBN 5L3BA 1BM9A 1YRNA 5LRSA 3S1QJ 3BZKA 3SDBA 2M7BA 3S14J 1M1EB 3QYFA 3AL0C 2PI0A 3GCMA 2P0WA 1EH7A 4YG2F 4X1EA 3VFZA 1GT0C 3CQZJ 1ZGAA 1SD7A 4IF4A 3WODF 3OYJA 1DPUA 1WH5A 3ZQFA 2IS1A 4NC7A 4Q48A 1U2WA 1A5JA 3L9FA 2GA2A 4MQ9F 1QNTA 2WB1A 1VQ5I 3E5QA 4NC6A 2HOSA 3OWTA 2BYVE 3K69A 3SFIA 2R5YA 1J5YA 2DMNA 1U9NA 1WCMJ 3H5NA 4UXNA 3TDZC 2WC2A 1ITYA 3LSJA 4CYCA 2FEZA 2F5FA 1R9TJ 2QGUA 4M3GA 5E3MA 4IQ4A 1PYVA 1X1BA 1LDJA 5BS6A 1W0TA 1AKHA 4Y15A 3MEXA 1PUFA 3I0TA 3R0AA 3W2AA 2DFEA 1WH7A 4XLAA 2CUJA 3IKTA 2DBBA 3HKZA 1T08B 4IRHA 3FZVA 3SZGA 3DV8A 1G3WA 3LA7A 4IQJA 3IAS2 5E3LA 2V1NA 2PJRA 3MFKA 4R79A 1YJNI 1CGPA 1E3HA 2QUFA 3FM5A 1ZGWA 3LOCA 1BOBA 1IV8A 2X51A 4CXFA 1UG0A 4N0BA 1VQKI 2QCOA 3LSHA 5ILUA 2CO5A 3LQQA 4G8XA 4NQWA 4DQ2A 3KLOA 2QA4I 4BU2A 3M4OJ 2DO7A 3JCUC 4HYEA 2JUCA 3RPUD 2X85A 3U9GA 1ETYA 2STWA 4UVBA 3VEPA 1XC5A 3KP3A 2V1XA 4M73A 3GTKJ 4N4OB 2NRAC 4CCJA 1QQIA 2VT2A 5KVRA 1R1TA 3ZMUA 2K85A 3R0JA 5FKLA 4CCMA 1J59A 5JVGF 2WADA 5D5VB 4X0GA 4OAYA 1UHMA 5EGOB 1TZLA 1R71A 2P5KA 2X48A 1KA8A 2NAZA 4PFOA 3ERED 1WJAA 3VYTB 1ZKGA 3MZ8A 4LLLA 5CLSA 5J6XA 3HB9A 1VNDA 2VLAA 1OMIA 4AIJA 2IJLA 4EGZA 1XS9A 4XLEA 4J00A 3RZOJ 3KX2A 3OS0A 1F9NA 5HLIA 4PJNA 2AXTC 3RTRA 1ETKA 2R7QA 3U2RA 5L3CA 1DGRM 4BDYA 1E2XA 1X1AA 1F4KA 2R93J 1MBJA 3DTEA 3MAJA 2J5PA 3ABMH 5HNHA 1Z3YA 3PM1A 1XCVA 4YEJA 2V6EA 3AG1H 1YQAA 4LG0B 1SEUA 3KYLA 1Z3XA 2RKHA 3PUFA 1YIJI 1IRFA 5DV5A 2VOOA 1LPQA 3D5RC 5KNLA 5D8KB 3DLLF 2IS2A 3I71A 1VTNC 4E7JA 2ZFUA 1VQ9I 2K9LA 1V5EA 4FQGA 1IRXA 1R4NB 4JX4A 2ISZA 4Z6YA 3W6JB 2W82A 1IXSB 2JPCA 2XROA 1I1SA 4IKFA 2QQAA 2UUZA 1JGSA 3RKYA 1W7PD 1YX5A 2M0MA 1D1CA 1Z05A 4QLCU 2X0LA 4IRGA 4WF2A 1LQ1A 2P6TA 1QPMA 4D9JA 2ZJQF 3DF8A 3G73A 1B72A 1A36A 5HDGA 2WA0A 1NG6A 3HBLA 4B47A 4FETA 2BVMA 4HG2A 1Z7UA 3KLNA 4QSHA 2FNAA 4PFPA 4F92B 3HSEA 2CJJA 3C2HA 2IEKA 4CICA 1POGA 5HDNA 1JTXA 3CDIA 1HOMA 3BG3A 1BIBA 4CCLA 4E7HA 1MJ9A 4B3XA 3L2QA 1KYWA 1MMAA 2CS3A 2WAQA 1XG1A 4RLQA 4IX7A 1MBKA 2MD0A 1PJRA 3FDYA 4LGWA 5AIPA 4ZYAA 5KAFC 5LHIA 3LSRA 3LAJA 4FX4A 1BR4A 1X3UA 1ZRCA 1T0FC 5H2FC 3B6CA 3TGNA 2R7VA 2EFQA 3GUDA 2FOWA 2TRTA 3CC2I 3FMSA 2DT6A 1Y0UA 3BT9A 2D5VA 4XRSA 3HRTA 5J40A 1YW7A 1MKMA 2HVQA 4RAGA 2O61A 2HXIA 1QZZA 2H6CA 4M9SA 1JKRC 1BW5A 2BVLA 2QM3A 1D8KA 4UB6C 3IRQA 3CUQC 4A3BJ 4DW6A 4IOCF 4CCNA 4B8XA 4FHTA 5C4XJ 5F27A 1MIJA 3DPUA 3W6VA 3KPHA 2PEXA 1V4RA 3J80K 4YRVA 2VQHA 2IBDA 3GTJJ 3GVAA 2VQCA 2FBKA 3WTZA 1MMGA 2KRHA 3ROUA 4XMYA 1K78B 4ZYHA 1VF9A 2N8GA 4A2UA 4IRIA 3ECOA 1MBEA 2AHQA 4G6DA 1LDKB 1TLHB 1XGOA 1MNDA 3L2CA 1RUNA 1BI2A 5DD8A 1O7LA 2KISA 3K4KA 3LSTA 4L5EA 4CZCA 1P7JA 3HEFA 2HPMA 4BYYA 2X1DA 1T38A 1O7FA 2V6CA 2ECCA 2L4AA 3E0JB 3IRRA 3MKYB 4AYBA 4P9UA 3R6SA 3S2WA 1R7JA 3K70C 4O6JA 3FF5A 1JTYA 3Q0UA 3HTSB 3JRGA 3CC7I 1IXCA 3HOSA 3OYEA 3BY6A 1IN7A 5FGMA 3DPTA 3K4CA 1Z67A 3L2VA 2HKOA 4BHPA 3CO7C 3G6EI 3GZ6A 1Y0NA 3BOQA 4XK4A 3G71I 3GFIA 4BEHA 3TP3A 5CVIA 6PAXA 2VL8A 2XDVA 3J7AW 3HZJA 1VQNI 4HPQA 1R49A 1ACIA 3S1NJ 1FSEA 2CV1A 4I98B 3QOEA 5K1YA 4WWCA 1X1DA 4OIOF 1WHUA 3VPRA 5EEAA 1MJBA 2KHMA 1FY7A 2F5DA 2XF7A 4UNOA 2JSPA 3W2VA 1H9GA 1ON1A 4HF0A 3A03A 2LK2A 3K70D 2DMUA 3J7AY 2VN2A 1XDSA 1D1AA 2CYYA 2LKPA 1EKEA 4LOCA 1USTA 2OCCH 2CFXA 2VPLA 1IXRC 1FSHA 2QEXI 2VJ4A 2HDWA 4ESFA 4PDKA 1KU9A 3F8NA 5CQGA 4HQEA 4KISA 1ETVA 2W57A 5ICGA 1YLFA 3OYGA 4IHWA 1MH3A 2GXBA 2HQNA 3GTLJ 4AC0A 1HW2A 2VXZA 4N9IA 4MTEA 2Y30A 1T39A 4HV6A 1O57A 4KT6A 1FYLA 1OYWA 4X6AJ 4G94A 3DXJF 1IG7A 1YS6A 3K2AA 2M9HA 3PUBA 5BPIA 3QU3A 2JSCA 2VJIA 5EYRA 2L7KA 4CCKA 3MCZA 4ZTFA 3TBIA 5DYMA 1K4SA 4V19K 2KPMA 5F64A 5HDKA 1C0WA 1O3SA 2E7XA 2MD5A 1IRZA 2LBFB 2OPTA 5E18F 3LA3A 3Q5FA 1XSVA 2XAUA 1NH3A 2E2IJ 2AQEA 4OU0A 4QPOA 1EA3A 5E1XA 2P5VA 3S3NA 1PP8F 4C3JJ 1YW8A 1PP7U 1ZARA 2I10A 2ZNYA 3OOUA 4M6YA 4RB3C 3B6AA 4C30A 3CCJI 3RI4A 3CCLI 4A0YA 3CDLA 3CF2A 3HJEA 2ETHA 3FXOA 3LWFA 5FLXZ 1JI8A 3TO6A 2Z99A 3PSIA 1TTYA 4H4KC 4YIIA 4C3IJ 3FKIJ 1A6IA 1ZG5A 1NG7A 2IA0A 4HDVA 2LF8A 2KFDA 2VC1A 3WTTC 2ZCWA 1HA8A 1USSA 4JX6A 2V26A 1RI7A 2CMPA 3ABLH 3HKZN 3ZQ7A 5H20A 4AVZA 2ZJRF 3DBLB 3DTKA 3MZHA 2H1KA 4BY1J 2CUFA 3L09A 1S5LC 4L5JA 4BS9A 3AFHA 2Z2SB 3CP2A 3DBHB 2ZNZA 4Y33A 3OYAA 1B9MA 3C18A 3CCVI 3SXYA 1MDMB 2EFPA 3ABKH 1U9OA 2R7XA 3TMOA 2JMWA 2KT0A 5IT9R 2VT3A 3JREA 1JKOC 1T98A 4WXDA 4YIFA 3SFZA 2NOJB 2MA3A 3LSKA 4A0XA 3HL2A 2ZXWH 3RKQA 1T6SA 3KZYA 2E1OA 3WHCA 1VQOI 3BC8A 5GPCA 4A3IJ 4UUSA 1IRGA 5CVRA 1V5GA 2VJJA 1X58A 1R36A 2VKEA 2Y0MA 4A5NA 1O4XA 4DYQA 2R0QC 5GTIC 4D7MA 2EK5A 4UVCA 4UHTA 3NRVA 2RGVA 4CH7A 2XPUA 3AG2H 4D5FA 1GXPA 1XCBA 4M74A 3ZQCA 4JQFA 3EYIA 3PFYA 3LA2A 3R60A 3JRCA 1VFCA 1X3ZB 1BBYA 3RQIA 4XKVA 3FBNB 3ZXSA 1KU7A 2HQRA 3MN2A 2F5EA 4MFEA 1UHSA 3CCQI 1LUJB 4XQFA 3FX3A 3FXQA 5FFZA 2E71A 2EIMH 1IO2A 2BV6A 2XAGA 2YSRA 3V7RA 3PO3J 3I4NJ 1DP7P 3S93A 2K3PA 1ZR2A 3JAMR 4I0BA 4XRSG 1VQMI 4L18B 3QPLA 1HBXG 3VWBA 3NARA 2A3SA 1GUUA 3BQZA 3K4JA 3AG3H 2Z9OA 3BR0A 1OYIA 3H3UA 1NK3P 3GEZA 5M5YJ 1BC7C 3S1MJ 4IL6C 4FASD 1H8AC 2A69F 2HDDA 2JA8J 1JHHA 4OOIA 5HNFA 5A2QR 1MBGA 5LLQA 4HNVA 1I6HJ 3FXJA 4G12A 2OCEA 4MHGA 1S3JA 1FTZA 1B8IB 3AAFA 1Q1VA 4ZYGA 5EJCA 2R7WA 2E2HJ 3JTGA 4YIRX 2OTJI 4HAMA 3LQRA 4QWQA 1IN6A 4BH9A 2XRNA 1UFMA 1HQCA 1UHWA 3S32A 4ZZDA 2KDZA 1FT9A 1HC8A 2VKDA 2TDXA 3V8KA 3F8CA 2GBYA 3WTVC 2VE8A 2DPDA 3OR2C 2E60A 2EA2A 2I5UA 1FWZA 3NQOA 4HSRA 5FKNA 4NHJA 4ZDOA 2DDAA 3JR9A 2GOMA 2BBYA 2UWMA 2CQNA 2ELHA 5B66C 2XRLA 1YRNB 2DDBA 3P9IA 1P9QC 4P1WA 3OSFA 2VBWA 1R6RA 2XAHA 3REOA 2KIMA 2EZLA 3UKGA 4FE4A 2J5OA 2LDUA 2NVYJ 1OJLA 4OIPF 5CVUA 2G7UA 3OY9A 2QKLB 2ZO4A 4EGYA 3F8MA 5ERIA 3O6BB 3HYIA 2XAFA 2BHZA 2GWRA 2Z33A 2JJ7A 4HQMA 3HPGA 5LEKA 1WVRA 1WSUA 3C3WA 1QHGA 1YYVA 1IDZA 2R5YB 4MLOA 1TL8A 2Y9ZA 3D5LA 3GW2A 2IGMA 3K9TA 4HOBA 4CYCB 4G7ZF 4L0ZB 2IS4A 2P7VB 5J8FA 1U5TB 2DA1A 4OWRB 4XN3A 1QZEA 3O8GA 2JVHA 4OMYA 3K6GA 1AKHB 1FYKA 4BGDA 4DZJA 4MGRA 2LMDA 1OQYA 5DUKA 1OISA 3KFWX 3CZ6A 3OSGA 4XN0A 2QSHX 1E3PA 5DTDA 5D5UB 2O8KA 1EJ9A 1FC3A 4OAZA 1RIOH 5DCMA 4BQNA 1Z6TA 1TWFJ 2RAEA 3CF5F 1X2MA 5LHGA 2OA4A 2DOEA 1I1GA 4EJUA 4G7HF 1AWCA 1T0FA 3ZCOA 2PX9A 2XF5A 3BR5A 3CC4I 3CMYA 5GADJ 1OCZH 1W5TA 2VC0A 2VB6A 3FKJA 4R8HA 4V2FA 5EG0A 3J81R 3QU6A 2F5CA 4CZZA 1FBUA 2EA4A 3TQNA 4WX9A 4PJJA 5LFAA 4NQWB 4ZZLA 2DJNA 1YO5C 1P7IA 4LD5A 5J4YA 1DU6A 1G3YA 4NDLA 1RUOA 4PK4A 1LE8A 1FOWA 3EETA 4RM3A 3BR6A 2F4OB 2H09A 5LD2C 5KCMA 3EDPA 2PG4A 2XGCA 3IHUA 3DBRB 3E5XA 2WBMA 4QPQA 4A3CJ 3W3CA 1FBQA 2IA1A 2R7FA 2R7OA 2RNGA 3ABTA 3ULQB 4IHVA 3FBIB 3A2KA 2CG4A 2R7RA 1H89C 3UNGC 3J7ZI 1JUSA 2IS6A 4U87A 3ZMZA 2LOOA 3S2HJ 4UV9A 4BE1A 3J81Z 4EVIA 3HOYJ 2NVTJ 4Q47A 2EILH 3BJ6A 1DU0A 3JRDA 4L9VA 5KK1A 2STTA 2KL4A 4BQQA 4LFUA 4WK8F 3HOTA 1ON2A 1U5TA 2FA5A 2QENA 1KQ9A 3ELKA 3HOUJ 1ETWA 3TO9A 3G3ZA 1FEXA 1QBJA 4FE7A 2WTEA 2PLYA 3DU6A 4F3QA 2FMYA 1LEBA 1WI9A 3LFUA 2ZXHA 1WJCA 3SHFA 1JT6A 2FF4A 3G2BA 3HHHA 2BY0A 3CCEI 3DCFA 4LJZF 2O9LA 1IJWC 1RPWA 4EJTA 3OIQA 1J75A 5E17F 4AVPA 2EZIA 2YR2A 2L01A 2QVOA 1YI2I 3HM5A 3EUKL 3OYNA 3GBGA 5C4JJ 2BXZA 5FROA 3L2UA 2R3SA 2MVTA 4GYIA 1VQ6I 4BQAA 2AXLA 1WQ2A 2H94A 4E7KA 1HSJA 1TBXA 2E1MC 5FB2A 3TL4X 1ZRFA 2FUG2 4WXCA 1QA6A 1B72B 4B4CA 2XGXA 2HNHA 2EJRA 1SVLA 1ZH5A 4CSWA 2XAQA 2M45A 1B6AA 3LNQA 2PMUA 3BDDA 2DMPA 4XRFA 4ANJA 1G59A 4KUMA 4JP0A 2PMZN 3L2WA 2LD5A 3QRFF 1S9HA 3I54A 3DEEA 5AONA 1MSFC 3OYHA 1D5YA 1KQ0A 1REPC 3SJMA 4GCVA 2MBFA 3A0BC 4QTRA 4OIQF 1BJAA 4WXHA 2KZGA 1HDPA 3I58A 2IGKA 2L9SA 4FCYA 2JA7J 1YOVB 2DAOA 3S17J 2GZWA 2CWEA 1KZHA 5ICCA 1OR7C 2KIFA 3BQYA 4KMUX 4GDFA 2L9NA 3IV5A 4G7OF 3OYLA 3K0LA 1TNSA 1ZRDA 2WAEA 4NB5A 4BNCA 2D45A 2G9WA 1F5TA 2O6GE 3H3ZA 3F21A 2RNJA 3BZ6A 2FQ3A 3Q9VA 3TP0A 4KT5C 1ETOA 1G3TA 1I6XA 3HOXJ 2P5LC 1ZREA 4G6TB 2HZDA 4DNCA 4E7SA 4RGUA 4BY7J 2RN7A 2DQRA 3TEDA 3OOPA 2H6BA 2CUEA 4I2OA 2MG4A 4L0YB 3QYEA 4CO8A 4ON0A 2QF7A 2DMQA 4PGHA 4ZH4F 4BBRJ 1FX7A 2FNPA 4S04A 3FK6A 1IN4A 5B1AH 3PNVA 4A93J 2HI3A 3SQNA 2NVQJ 4IPAA 1BI3A 3L7WA 4ZDLA 1XGSA 1HSTA 4IJAA 1JHFA 3ZMTA 3GLLA 4DOZA 2ISYA 3BLYA 5M5XJ 4Y3OA 5C3EJ 4XLCA 3Q3SA 1Z21A 3ECHA 3CCMI 1FIPA 2JUGA 3SDGA 3KZIC 4CA0A 2DOAA 4KIFA 3DFGA 4LK0F 2Z5UA 5J3LA 4M9XA 2JPBA 4YFNF 4RGXA 4IHYA 1LVAA 3PIOF 5K5OA 5JI6A 1FIAA 1K7AA 2R7SA 2HFHA 2PQ8A 3CDHA 2JRMA 5J4VA 5J1YA 4B3AA 3K10A 1W5SA 5M3MJ 2XKPA 3OYMA 3QP5A 4O3MA 2XHKA 1PDNC 2NNNA 4BEHB 4YELA 3V42A 1TQPA 2HTSA 2P8TA 3TW6A 3RQ4A 2FMLA 2MABA 3VYUB 2LP0A 4F93B 4U7BA 1BI0A 1LFPA 1R1VA 3J80R 5E1WA 2K9SA 2DFFA 3R61A 1D3YA 2A68F 4HA8A 4XR6A 3V8JA 2QBYA 2QWWA 4HDUA 1IC8A 2OAZA 1XTAA 4IO9F 3GWZA 4J19A 3I4MJ 4BQOA 3E97A 1LFBA 2DK5A 4QIWN 1SD5A 2E36A 1S7OA 2VODA 2WY8Q 3DTIA 2E1CA 1FOYA 1OFCX 5LRRA 1EV7A 4RS8A 4XSXF 1FP1D 3EUHA 2X1CA 3FM3A 1ETQA 4I01A 2IGNA 4HSTA 2XV4S 2WAFA 1MW7A 2ECBA 3G4SI 1KYZA 2FQ4A 2CGPA 3NWSA 1F36A 2EFWA 4RDUA 4FT8A 3OS2A 2X98A 2MUNA 2D1VA 1HLVA 2XPWA 4JBAA 3S16J 1HKTA 1YHQI 4C2UA 2CRGA 1WJBA 3PIPF 2NNYA 3GTPJ 1A35A 2R7ZJ 4E4HA 1A04A 2VONA 4I6ZA 1XN7A 3AG4H 4B44A 1OCTC 3T8RA 2L9RA 4BUPA 5GAHJ 5D6EA 5EEHA 4BXFA 1P4AA 2ZSHB 4IXAA 3M8JA 3V7SA 3H3VK 2CQQA 4EV0A 2Z16A 2RDPA 3RYRA 1YS7A 3ZMDA 3OIOA 5CYVA 2W4SA 1S7AA 2ZSIB 3GTMJ 1BA5A 4I99C 4ASNA 1QPIA 3ASNH 1K61A 3OR1C 1MSEC 2X6WA 2ELJA 2ZMEB 3A01A 1BR1A 1GLNA 2LRDA 2H27A 4RB2C 5F08A 4EATA 2O0YA 4Y7NJ 1Z9CA 3VODA 1GV2A 3E3VA 2K9MA 3BG9A 1IAWA 1JE8A 2OZ6A 1RNLA 5L3GA 2M4KA 1BW6A 1ULYA 5KAIC 2IRFG 1MBFA 4EMSA 3KE2A 2YU9J 4HF2A 4OIRF 5JFRA 2AS5F 2L7FP 2HPIA 2F6CA 2GXGA 2ZXJA 3WU2C 1K6OA 4ESBA 3HDDA 4A5MA 2IW5A 3HHGA 3BPXA 4A3FJ 1X4OA 1X3WB 1J9IA 4PJMA 3V8LA 2M7AA 4E7LA 1ONVA 2QSGX 5L3FA 2A6TA 2W24A 1IGNA 5CPRB 2DMTA 4KFCA 3U1KA 3CCUI 5E79C 5JVTA 1XD7A 2M5WA 1RR7A 4UUSB 1STZA 2RQPA 1TP4A 1J09A 3K7AJ 3KEQA 4XOTA 2JQ7A 2A61A 3GXOA 4P96A 4F52A 5DM6F 4XNFA 1RQ6A 4MTDA 3KP6A 2F2EA 3IH4A 3QQAA 2OQGA 2Q2EA 2MLKA 4IHXA 3C7JA 4L9JA 1YIOA 2K3FA 2OC6A 2L9VA 1O3RA 2DODA 3EUAA 1R5HA 3MWMA 4S0HB 3CESA 2PMZA 5H6RA 1HDDC 2XVCA 4WCGA 2FRHA 5K7FA 5F6FA 4LK1F 1LVKA 3M07A 4AD9A 2ZJPF 1I3AA 3KP4A 3R4KA 3CLQA 2KZVA 3KEYA 4PGGA 2BY3A 2ZMEA 4DJAA 3LSMA 4DGWB 3U21A 4E7ZA 4C2TA 2V1DA 3OL3A 1SAXA 4RGRA 1CF7A 2Y48A 1DPRA 2QQ8A 3KCCA 5FKMA 5D5XB 2VBZA 1XSXA 5FLXK 3PQJA 5DUIA 1SMTA 4L9TA 3ZN0A 1MMSA 4MFDA 1HKSA 1RR8C 2F5VA 3JW4A 3ISPA 1WFXA 1HF0A 3WU1B 2L02A 3K4LA 4BAYA 2Z3YA 1TQMA 2G7HA 2F4MB 4AIKA 1G8XA 1EH8A 5DDGA 3KEOA 2X6OA 2DQLA 5H6QA 3F23A 2NOGA 3TDUC 2WWYA 1ZAOA 2ZBKA 4HEA2 4A3MJ 3VDXA 5GTHC 2HU9A 4BHBA 2W1OA 1D1BA 2E35A 2L54A 4ENNA 2Y0SN 1W4MA 5TISC 4HX4A 3IP4B 3KYCB 3QPSA 2UXNA 1VQ8I 2GLOA 3FISA 2V9PA 4P9FA 1ZK8A 1HXDA 5GP9A 1P2FA 3PNYA 1JGGA 1R4MB 2Y31A 5EZGA 5IOYA 4XRMA 1SAUA 2RVCA 1U78A 2XSJC 4KITB 3FWEA 1TC3C 4RBOA 3ZQQA 2A05A 4Y52J 4LG3A 1RC9A 3F72A 2HOTA 4B1RA 1GXQA 1R5ID 2RC4A 1Y6IA 2DYRH 3K1PA 1FPQA 3E6MA 1UAAA 4MQVA 1KQ8A 4P55A 3E5UA 1SD6A 2LLKA 2GAUA 2KP6A 3LFKA 2UXXA 3I64A 3L1PA 2Y9YA 5F0FA 2HR3A 2XASA 1H0MA 5IT9Z 1PVEA 4A0ZA 3ZQLA 1WJFA 5BQTA 1E17A 2BEOA 3QYBA 3ZMSA 2V79A 1SFUA 2CUZA 1Y8RB 3OV8A 4BDZA 3BR3A 3KETA 2HS5A 3OYDA 3T5XA 1APLC 3LSPA 1R23A 2DTZA 5F1RA 4D0PA 4KA4A 4BXUA 1ZYRF 2JT1A 3RIRA 2MSYA 1X19A 2M30A 1MMNA 2MFZA 5DCMB 5KHDA 5HLHA 2XB5A 4C2MJ 3OIPA 1W7PA 3GO5A 3U1DA 4EM1A 1OR7A 3MVPA 5M3FJ 1T2KA 3GTQJ 5EG0B 4UY8I 3K4BA 3TKYA 2VBXA 1I50J 1DQUA 3P7NA 3WG9A 4BXXJ 3K1MA 1I5ZA 3WTYC 2EBIA 2L4MA 3G1OA 5CKTA 3IWZA 1I39A 4HX8A 2CW8A 2DLLA 3MQ0A 2CQ7A 2HKXA 4XM3A 1YJ9I 2Q0OA 1YW9A 3JAMZ 3BCAA 1S72I 2O7OA 5ICEA 5L3EA 3GTOJ 1LE8B 1XMXA 2OZUA 2P4WA 4FTHA 5HLTA 3GLXA 4MIMA 3MKWB 1UCRA 5IYDJ 5TRDA 3W2WA 1LEAA 1W1WE 3I5UA 3H35A 3IL2A 2F48A 5BMZA 1ZELA 1HW5A 2BOLA 2ZXIA 2B7EA 4DBRA 2JN6A 3H92A 5A2QZ 3GX4X 1MGTA 1P6RA 3CCRI 5D4SA 3A52A 2GQQA 5A2QK 3QWLA 2UV1A 2ID6A 3E6BA 2JK3A 2ACJA 4A6EA 4A12A 2BY2A 1U8RA 1FP2A 2W84A 2ZC2A 4D1QA 1IUYA 2QQBA 5K7HA 2HOEA 2HTJA 4O5VA 4ESJA 1NK2P 4A6DA 2DI3A 4N9HA 3E6CC 2YX7A 3BPVA 3HTUA 2PJPA 2M8GX 5E1ZB 3RPQA 2ZKZA 3ZN1A 2M35A 2VI6A 1OLTA 3ZRGA 1KU3A 3I53A 4HW0A 2R7UA 1N77A 3HOWJ 2MH2A 2O5RA 2NS8A 1U0JA 3HRUA 2MGQA 4JK1X 3S2DJ 2KJBA 2FSWA 5IOZA 4JX5A 3IC7A 3KYDB 1W36D 4EM0B 2A5YB 1ZG1A 4C9YA 4J01A 2VXDA 4KIBA 2OJED 2ZJ2A 5GAGJ 2YPRA 3LSGA 3ZR8X 2XKOA 3HC7A 3WTXC 1TW2A 2KQRA 2M3AA 4II3A 4BBSJ 5TJJA 3SZTA 5FRNA 4BE2A 2R7DA 4KYWA 1ENHA 2K4JA 1ODDA 2K4BA 2X1EA 1IDYA 2HYFA 2IT0A 1AA7A 1S8NA 1K83J 2DA7A 2K40A 2XGEA 4ITVA 1DGWY 3H0GJ 3BG7A 3CTAA 3H36A 1MNMC 1O3QA 1Z91A 2MC3A 2O8XA 3Q0VA 4E6KG 1IZ1A 1UMQA 4I76A 1MZBA 4RAFA 2L7ZA 1TT5B 3CUQA 3K4NA 1LKXA 2IAIA 2XF6A 3RJPA 5EZHA 5ILSA 2DW4A 1YFHA 2DA4A 5F0HA 1J0RA 3FXUA 2NS7A 4KMFA 2LREA 1BL0A 2GOXB 1LFUP 5B3SH 3FMQA 1YX3A 2DN0A 2B63J 4ENMA 1VQ7I 2JA2A 1FBSA 3WTUC 1Q1HA 1OCRH 3WG7H 3ZGKA 3J81K 2UZKA 2LF7A 1YTYA 3CJRB 5B1BH 4LMYA 3FXMA 1MBHA 4XSZF 3FK7A 2LR8A 2QYOA 3CLOA 4LITA 2VQGA 1AU7A 2HGCA 3DKYA 4F55A 4DYRA 1T33A 4LLGF 3N97A 1U8BA 4PSXA 1XMKA 3DKXA 1VQLI 3WTSC 5E8GA 4B09A 3GYHX 2CH0A 1TWCJ 2HEOA 5FO5A 4C3HJ 2XAJA 2K27A 1JT0A 2VE9A 1QU3A 2IVMA 3QAHA 3ZP5A 4CHUA 1R1UA 1S7EA 2OUMA 2WV1A 1FYMA 2LY9A 4PZJA 4ENJA 1JUPA 1S29A 1ZLJA 4XOPA 2VKHA 3HSRA 5FKKA 1ORKA 1V54H 2QLZA 4KJZA 2LC2A 3I59B 5AIQA 2Y0SA 2ID3A 2ME6A 2P6SA 3GMEA 1WI3A 3DKWA 3CMEI 5JHUA 2E5ZA 4CDGA 2CV0A 2BY1A 3BJOA 1SC7A 3IH2A 4EM2A 5CQEA 1O3TA 2LY2A 2P7CB 4RGSA 1ETXA 1YG2A 1IUFA 2Q1ZB 3HGGA 4OINF 2EFNA 3SZPA 1X2NA 2OV7A 4IVNA 4GO1A 5DCFA 4M3DA 5K5QA 3K4MA 1JKQC 2MH9A 2NVXJ 2C6YA 3HPHA 2Y69H 3T1BA 1S6LA 4RAYA 1D0XA 5BNGA 2DFHA 1SVOA 2K9QA 4V2GA 4KDPA 3H9QA 1XGMA 3IKVA 2JTVA 4BE0A 4M3FA 2DT7B 4CUGA 2DK8A 3ZPLA 4W97A 1G2HA 1I3QJ 3F3XA 2OBPA 5IT3A 2EZKA 1JUMA 2YU3A 1TT0A 3OMYA 5GAEJ 3OS1A 3JRHA 4HNTA 1ZR4A 2QBYB 5FFXA 2IPQX 3NEUA 3OYKA 2NS0A 4AU7A 3MZYA 3F6OA 2X4HA 2DFIA 2M8EA 3IUOA 2K9NA 2V9VA 4KN4X 3F0CA 1GV5A 2H8WA 2ME0A 4Y4RA 2X6YA 1FOKA 3NAUA 4L5IA 4K2EA 1Y56A 3GZ5A 5HOOA 4OMZA 1HCRA 4EJVA 1RESA 3VYSB 2FU4A 5JLWA 3H0DA 3OYFA 3I56I 1MJAA 4Y17A 1UB9A 2Y2ZA 3JTHA 2EWNA 4A69C 2QZ8A 2VIXA 1DP3A 3F8BA 3GFLA 1NTCA 3I4PA 5K7ZA 2ICWG 1CQTA 3SEZA 3I59A 4RMNA 1OCCH 5BOXA 1P92A 2DA5A 4YFKF 2HYJA 3PJRA 2D2WA 3FHZA 2L0KA 3FXLA 1W0UA 1A6QA 1RZ4A 1SMYF 2CSOA 2VBYA 1BI1A 3ZQHA 4XKCA 2CQXA 4L9NA 4BJ6C 4ENKA 3GTGJ 2O3FA 1B1BA 5D6FA 1K6YA 2YS9A 3LSIA 2BGCA 4I02A 3H1CA 2ZB9A 1LB2A 4BHCA 3DPLC 1MMDA 2CU7A 2KDOA 3OYIA 2CQKA 4ZTJA 1ZG3A 3WU0A 2IGOA 2VQLA 4HLYA 4UUTA 1D0ZA 5D8LB 4JYKA 4MNUA 1B4AA 5J8CA 2CFOA 5IP6A 3T8TA 3ZMVA 3A01B 3E7LA 2MZ4A 2P81A 1SFXA 2K7LA 5DM7F 4G6QA 2DU9A 1BIAA 4P5OA 3VSKA 4TV7A 3VYRB 4ETSA 3CD6I 2FE3A 2PBIA 3CUOA 3M1CA 5EGOA 3LMMA 4CCOA 1AOYA 1HKQA 2L3DA 4KN7X 4XL9A 5HVQC 1N75A 2E5NA 4II2A 4I0AA 3SYTA 1T8IA 5JHFA 1D8JA 3X2QH 5HS7A 4A3EJ 2M0CA 1MD0A 2LTPA 2OU2A 1TWAJ 1KU2A 3CMAI 5HS8A 3M1EA 4PJ0C 2A07F 2V7FA 2NYXA 3N4MA 1G3SA 2HZTA 3KZZA 1GDTA 5EEGA 5JR3A 2EINH 3EPZA 4ZDPA 2YUSA 3LAPA 5HS9A 2RREA 2F4IA 2OQRA 4PJLA 5TGTA 3V4GA 3WGHA 4UUVA 4IHSA 3D1NI 1UJ8A 3HRMA 2BE5F 3L2RA 4AM3A 1H9TA 3IH3A 1WJDA 4JOMA 3K2ZA 2K5CA 3Q9SA 2EPFA 4Q5SF 2EQRA 4LG0A 3VB2A 1FTTA 4RB1A 3CCYA 1PUEE 3TO7A 2W85A 2B0LA 5FLMJ 1I27A 2WV0A 3JSPA 3FHNA 4MEXF 2HXOA 3F8FA 4U0YA 1RRJA 1QVUA 2Q2EB 4BJTA 1WRJA 1B59A 3IAM2 5C44J 2E2JJ 3J80Z 2VASA 2CV2A 4EQQA 1U6GA 1XDUA 1ZGJA 4YFXF 1IN5A 2W00A 2AO9A 4AIDA 3HOVJ 3L00A 4B48A 3HG9A 3S8PA 2NXNB 1VQPI 1QVTA 2ESHA 1P4XA 3BTCA 3BR1A 3QOPA 1MH4A 1GVJA 1SFEA 3ASOH 3CJNA 1TWGJ 1GVDA 4I09A 4U0VA 3BROA 3WGIA 2M87A 4LLNA 2DOFA 2EIKH 2LKXA 1NHAA 1R58A
chains in the Genus database with same CATH topology
5LBQA 1QO0D 1CF7B 4HF1A 1U5TC 5ICFA 3PQKA 2E7WA 1IF1A 1FLIA 3JSOA 4H0EA 4U7DA 2GA1A 2CW0F 4LB5A 3VOEA 3RKWA 1XSDA 3RDIA 4R1HA 2KKOA 3KP2A 4RB0A 1OPCA 3EQLF 3HRSA 1WKMA 3M8FA 5BPDA 1R22A 4I7HA 5LGUA 1L3LA 1F1ZA 4M6XA 5CJ9A 4KICA 3GFMA 3BJAA 2EV6A 2W25A 1Z1DA 2ADUA 1BC8C 3DP7A 2IP2A 1P4WA 3ABUA 5LEJA 4CGZA 3HSFA 1J7KA 4KIGA 4PCQA 2QQ9A 1LNWA 4E70A 2HWVA 3E6DA 1FZPB 3C1DA 1G6NA 1XMAA 4EJWA 1K78A 5ED4A 5FD5A 1OKRA 1DDNA 1R00A 2FBHA 3WE3A 2LNBA 1TW3A 3B02A 3GFJA 4Y13A 2ZFWA 4Q4ZF 2XUBA 1OYYA 1U3EM 4GYGA 5CVJA 1B9NA 1W7PB 2MLGA 1HW1A 2VOPA 3ML6A 2RV8A 4MEYF 4GXOA 4XBFA 3RPUA 2Q8KA 4ZYDA 5CVVA 4G9YA 2GIVA 4ZYEA 1IN8A 2HYGD 1G4DA 4CYDA 4AIHA 2KIUA 2JRTA 2DPUA 3COAC 3M9AA 3BWGA 4LB6B 3DQVC 2ESNA 3BP8A 5ILVA 1L0OC 5K5RA 4XLPF 2A6EF 1LDDA 3WTWC 2YX4A 4HX7A 4XLNF 2IA2A 5IT9K 1J2XA 1LJ9A 1KGSA 2D1HA 3V7CA 2HDCA 1XGNA 3O2PE 2OD5A 2M1BA 3TOBA 1SD4A 5L3DA 1DUXC 2PFBA 3B73A 4HZFA 1JXSA 1XB4A 2COMA 2FBIA 3O3KA 5LGNA 2K86A 5DD4A 2JZYA 4Z2YA 4EJOA 1QGPA 5LHHA 3P9KA 2Y75A 1QZYA 2DT5A 4U0WA 4M9ZA 3D0SA 4UVAA 3QPTA 3JAMK 1MDMA 3F22A 2EV0A 3CUQB 2O03A 2KJCA 5FD6A 2A6HF 3WE2A 4GGGA 2E1NA 5E20A 3CO6C 3F6VA 5HLGA 3TOAA 1Z6RA 2EFOA 3EYYA 4F7ZA 2XIGA 3PFIA 1BN5A 2K02A 3FXRA 3KP7A 3RKXA 1K79A 3J7AO 4KNYA 3RYPA 1ZHFA 3HIFA 1D5VA 4U88A 3T0YA 3QPHA 4S05A 4UV8A 3FMRA 1ZLKA 2FOKA 3W6KB 1BOAA 3M7GA 1FNNA 1V3FA 1EH6A 1TQIA 1WWXA 4HV5A 5E8IA 3WGGA 3IWFA 5DEQA 3QP6A 3M8EA 1IW7F 4M72A 3P9CA 2V1UA 2LSOA 4HLXA 1TNTA 5D4RA 4FX0A 5LGTA 3DEUA 3HUGA 1GHCA 1ZN2A 4IHTA 4M71A 2PN6A 2EB7A 1R5GA 2EV5A 4HBLA 3KP5A 2FXAA 3K1NA 4AWXB 4RAZA 2DTRA 5D5WB 2KRFA 3GF2A 2PMHA 5L3BA 1BM9A 5LRSA 2PI0A 1EH7A 4YG2F 3VFZA 1ZGAA 1SD7A 4IF4A 3WODF 1DPUA 4Q48A 1U2WA 3L9FA 2GA2A 4MQ9F 1QNTA 3E5QA 2BYVE 3K69A 1J5YA 4UXNA 3TDZC 2WC2A 2FEZA 2F5FA 1LDJA 5BS6A 4Y15A 3MEXA 3I0TA 3R0AA 3IKTA 2DBBA 4IRHA 3FZVA 3DV8A 1G3WA 3LA7A 3MFKA 4R79A 1CGPA 2QUFA 3FM5A 4CXFA 4N0BA 5ILUA 2CO5A 3LQQA 4G8XA 4NQWA 4DQ2A 3KLOA 2DO7A 4HYEA 3U9GA 2STWA 4UVBA 3VEPA 3KP3A 2V1XA 4M73A 2NRAC 1QQIA 2VT2A 5KVRA 1R1TA 3ZMUA 3R0JA 1J59A 5D5VB 1UHMA 2P5KA 1KA8A 2NAZA 3ERED 4LLLA 5CLSA 5J6XA 1OMIA 4AIJA 2IJLA 4EGZA 1F9NA 5HLIA 3RTRA 3U2RA 5L3CA 1E2XA 1F4KA 3MAJA 2J5PA 1XCVA 1YQAA 4LG0B 2RKHA 1IRFA 5DV5A 2VOOA 5D8KB 3I71A 1VTNC 2ISZA 3W6JB 1IXSB 2JPCA 2XROA 1I1SA 2QQAA 1JGSA 3RKYA 1W7PD 1Z05A 4QLCU 2X0LA 4IRGA 4WF2A 1LQ1A 2P6TA 1QPMA 3DF8A 3G73A 5HDGA 1Z7UA 3KLNA 2FNAA 3HSEA 4CICA 5HDNA 1BIBA 1MJ9A 1KYWA 4LGWA 5AIPA 5LHIA 3LAJA 4FX4A 1X3UA 1ZRCA 3TGNA 2EFQA 3GUDA 3FMSA 1Y0UA 3HRTA 1YW7A 1MKMA 2O61A 1QZZA 2H6CA 4M9SA 2QM3A 1D8KA 3IRQA 3CUQC 4B8XA 4FHTA 2PEXA 1V4RA 3J80K 3GVAA 2FBKA 3WTZA 3ROUA 1K78B 4ZYHA 4IRIA 4A2UA 3ECOA 4G6DA 1LDKB 1TLHB 1XGOA 3L2CA 1RUNA 1BI2A 5DD8A 1O7LA 3LSTA 4BYYA 1T38A 1O7FA 2V6CA 2L4AA 3IRRA 4P9UA 3R6SA 3S2WA 1R7JA 4O6JA 3FF5A 3HTSB 1IXCA 3HOSA 3BY6A 1IN7A 5FGMA 3DPTA 2HKOA 4BHPA 3CO7C 3GZ6A 3BOQA 3GFIA 5CVIA 6PAXA 1FSEA 4I98B 5K1YA 4WWCA 4OIOF 1MJBA 1FY7A 2F5DA 4UNOA 1H9GA 1ON1A 4HF0A 2VN2A 1XDSA 2CYYA 2LKPA 1USTA 2CFXA 1IXRC 1FSHA 4ESFA 4PDKA 1KU9A 3F8NA 4HQEA 2W57A 5ICGA 1YLFA 2GXBA 2HQNA 1HW2A 2VXZA 4N9IA 4MTEA 1T39A 4HV6A 1O57A 1FYLA 1OYWA 4G94A 3DXJF 1YS6A 5BPIA 3QU3A 2JSCA 3MCZA 5DYMA 5F64A 5HDKA 1C0WA 1O3SA 2E7XA 2MD5A 5E18F 3LA3A 3Q5FA 1XSVA 4OU0A 5E1XA 2P5VA 1PP8F 1YW8A 1PP7U 1ZARA 2ZNYA 4RB3C 4M6YA 3RI4A 4A0YA 2ETHA 3LWFA 5FLXZ 3TO6A 2Z99A 1TTYA 4YIIA 1ZG5A 2IA0A 4HDVA 2LF8A 2VC1A 3WTTC 2ZCWA 1USSA 1RI7A 3ZQ7A 5H20A 3MZHA 3L09A 4L5JA 2ZNZA 1B9MA 3C18A 1MDMB 3SXYA 2EFPA 2VT3A 1T98A 4WXDA 4YIFA 3SFZA 2MA3A 4A0XA 1T6SA 3KZYA 1IRGA 5CVRA 1R36A 4A5NA 2Y0MA 2EK5A 4UVCA 4UHTA 3NRVA 2RGVA 1GXPA 1XCBA 4M74A 4JQFA 3EYIA 3LA2A 3R60A 1BBYA 1KU7A 2HQRA 2F5EA 3FX3A 3FXQA 5FFZA 2BV6A 2XAGA 2YSRA 3V7RA 1DP7P 4I0BA 4L18B 1HBXG 2A3SA 2Z9OA 1OYIA 3H3UA 3GEZA 1BC7C 2A69F 1JHHA 4OOIA 5LLQA 4MHGA 1S3JA 3AAFA 4ZYGA 3JTGA 4HAMA 3LQRA 4QWQA 1IN6A 4BH9A 2XRNA 1UFMA 1HQCA 1UHWA 4ZZDA 1FT9A 2TDXA 3V8KA 3F8CA 3WTVC 2VE8A 2DPDA 2EA2A 1FWZA 3NQOA 4NHJA 2BBYA 2UWMA 2ELHA 3P9IA 2VBWA 2XAHA 3REOA 2KIMA 2J5OA 2LDUA 4OIPF 5CVUA 2G7UA 2ZO4A 4EGYA 3F8MA 5ERIA 3O6BB 3HYIA 2XAFA 2GWRA 2Z33A 4HQMA 5LEKA 1WSUA 3C3WA 1YYVA 3D5LA 3GW2A 3K9TA 4HOBA 4G7ZF 4L0ZB 2P7VB 5J8FA 1U5TB 4OMYA 1FYKA 4MGRA 5DUKA 3KFWX 5D5UB 1FC3A 1RIOH 5DCMA 1Z6TA 5LHGA 2OA4A 1I1GA 4EJUA 4G7HF 1AWCA 1T0FA 1W5TA 2VC0A 4R8HA 3QU6A 2F5CA 4CZZA 1FBUA 2EA4A 3TQNA 4WX9A 4ZZLA 1YO5C 4LD5A 1G3YA 1RUOA 3EETA 2H09A 3EDPA 2PG4A 3IHUA 3E5XA 1FBQA 2IA1A 2R7FA 3ABTA 3ULQB 2CG4A 3ZMZA 4UV9A 3J81Z 4EVIA 4Q47A 3BJ6A 4L9VA 5KK1A 2STTA 4LFUA 4WK8F 3HOTA 1ON2A 1U5TA 2FA5A 2QENA 1KQ9A 3ELKA 3TO9A 3G3ZA 1QBJA 2WTEA 2PLYA 2FMYA 1LEBA 1WI9A 3SHFA 2FF4A 3HHHA 4LJZF 4EJTA 1J75A 5E17F 4AVPA 2YR2A 2L01A 2QVOA 2R3SA 4GYIA 4BQAA 2AXLA 1WQ2A 2H94A 1HSJA 1TBXA 5FB2A 1ZRFA 4WXCA 2XGXA 2EJRA 1ZH5A 2XAQA 2M45A 1B6AA 2PMUA 3BDDA 4XRFA 4KUMA 3QRFF 3I54A 5AONA 1REPC 1KQ0A 4GCVA 2MBFA 4OIQF 1BJAA 4WXHA 3I58A 2DAOA 2GZWA 2CWEA 5ICCA 4KMUX 2KIFA 4G7OF 3K0LA 1TNSA 1ZRDA 4NB5A 4BNCA 2D45A 2G9WA 1F5TA 2O6GE 3H3ZA 3F21A 2RNJA 3BZ6A 2FQ3A 3Q9VA 4KT5C 1G3TA 1I6XA 2P5LC 1ZREA 4DNCA 4RGUA 2RN7A 2DQRA 3OOPA 2H6BA 4I2OA 4L0YB 4CO8A 4ON0A 4PGHA 4ZH4F 1FX7A 2FNPA 4S04A 1IN4A 3SQNA 4IPAA 1BI3A 3L7WA 1XGSA 1HSTA 4IJAA 1JHFA 3ZMTA 2ISYA 3ECHA 4KIFA 3DFGA 4LK0F 2Z5UA 4M9XA 2JPBA 4YFNF 4RGXA 1LVAA 5K5OA 5JI6A 1K7AA 2HFHA 2PQ8A 3CDHA 1W5SA 2XKPA 3QP5A 4O3MA 2XHKA 1PDNC 2NNNA 1TQPA 2HTSA 2P8TA 2FMLA 4U7BA 1BI0A 1R1VA 5E1WA 3R61A 1D3YA 2A68F 4HA8A 3V8JA 2QBYA 2QWWA 4HDUA 2OAZA 3GWZA 3E97A 2DK5A 1SD5A 1S7OA 2VODA 2E1CA 5LRRA 1EV7A 4RS8A 4XSXF 1FP1D 3EUHA 3FM3A 4I01A 2XV4S 1KYZA 2CGPA 2EFWA 4FT8A 2D1VA 4JBAA 1HKTA 2NNYA 1A04A 2VONA 1XN7A 3T8RA 5D6EA 5EEHA 1P4AA 4IXAA 3V7SA 4EV0A 2RDPA 3RYRA 1YS7A 3ZMDA 5CYVA 1S7AA 4ASNA 2ZMEB 2H27A 4RB2C 2O0YA 1Z9CA 3VODA 3E3VA 1IAWA 1JE8A 2OZ6A 1RNLA 5L3GA 1ULYA 2IRFG 4EMSA 3KE2A 4HF2A 4OIRF 5JFRA 2AS5F 2GXGA 2ZXJA 1K6OA 4ESBA 4A5MA 2IW5A 3HHGA 3BPXA 1J9IA 3V8LA 1ONVA 5L3FA 2W24A 4KFCA 5JVTA 1XD7A 2M5WA 1STZA 2RQPA 3KEQA 2A61A 3GXOA 4P96A 4MTDA 3KP6A 2F2EA 2OQGA 2Q2EA 2MLKA 3C7JA 4L9JA 1YIOA 1O3RA 1R5HA 3MWMA 5H6RA 2XVCA 4WCGA 2FRHA 5F6FA 4LK1F 4AD9A 3KP4A 3R4KA 4PGGA 2ZMEA 2V1DA 1SAXA 4RGRA 1CF7A 2Y48A 1DPRA 3KCCA 5D5XB 2VBZA 1XSXA 5FLXK 3PQJA 5DUIA 1SMTA 4L9TA 3ZN0A 1HKSA 3JW4A 3ISPA 3WU1B 2L02A 4BAYA 2Z3YA 1TQMA 2G7HA 4AIKA 1EH8A 5DDGA 3KEOA 2DQLA 5H6QA 3F23A 3TDUC 2WWYA 1ZAOA 2ZBKA 4BHBA 2L54A 4ENNA 1W4MA 4HX4A 2UXNA 4P9FA 1HXDA 1P2FA 2RVCA 1U78A 3FWEA 3F72A 1GXQA 2RC4A 3K1PA 1FPQA 3E6MA 4MQVA 1KQ8A 4P55A 3E5UA 1SD6A 2GAUA 3LFKA 2UXXA 3I64A 2HR3A 2XASA 1H0MA 5IT9Z 4A0ZA 5BQTA 1E17A 2BEOA 3ZMSA 2V79A 1SFUA 3OV8A 3KETA 2HS5A 3T5XA 1R23A 5F1RA 4D0PA 4KA4A 4BXUA 1ZYRF 2JT1A 3RIRA 2M30A 5DCMB 5HLHA 1W7PA 3GO5A 3U1DA 4EM1A 1OR7A 1T2KA 3TKYA 2VBXA 3P7NA 3WG9A 3K1MA 1I5ZA 3WTYC 2L4MA 3IWZA 4HX8A 2DLLA 3MQ0A 2HKXA 2Q0OA 1YW9A 3JAMZ 5ICEA 5L3EA 2OZUA 2P4WA 3GLXA 1UCRA 5TRDA 1LEAA 3I5UA 3IL2A 5BMZA 1HW5A 3H92A 5A2QZ 3GX4X 1MGTA 1P6RA 5D4SA 2GQQA 5A2QK 3E6BA 2ACJA 4A6EA 4A12A 1U8RA 1FP2A 2W84A 1IUYA 2QQBA 2HOEA 2HTJA 4O5VA 4ESJA 4A6DA 2DI3A 4N9HA 3E6CC 2YX7A 3BPVA 3HTUA 2PJPA 5E1ZB 3RPQA 2ZKZA 3ZN1A 1KU3A 3I53A 4HW0A 2MH2A 3HRUA 4JK1X 2KJBA 2FSWA 3IC7A 4EM0B 2A5YB 1ZG1A 4KIBA 2ZJ2A 2YPRA 3WTXC 2XKOA 1TW2A 5TJJA 3SZTA 2R7DA 4KYWA 2K4JA 1ODDA 2K4BA 2HYFA 2IT0A 1S8NA 3CTAA 1O3QA 1Z91A 2MC3A 2O8XA 1IZ1A 1MZBA 3CUQA 3RJPA 5ILSA 2DW4A 1YFHA 1J0RA 3FXUA 4KMFA 3FMQA 4ENMA 1FBSA 3WTUC 1Q1HA 3J81K 2UZKA 2LF7A 1YTYA 4LMYA 4XSZF 2QYOA 3CLOA 2HGCA 4LLGF 3N97A 1XMKA 3WTSC 5E8GA 4B09A 3GYHX 2HEOA 5FO5A 2XAJA 2K27A 2VE9A 2IVMA 3QAHA 3ZP5A 4CHUA 1R1UA 1FYMA 4PZJA 4ENJA 1S29A 1ZLJA 3HSRA 2QLZA 3I59B 5AIQA 2P6SA 3DKWA 5JHUA 4CDGA 3BJOA 4EM2A 1O3TA 2P7CB 4RGSA 1YG2A 4OINF 2EFNA 3SZPA 4IVNA 4GO1A 5DCFA 5K5QA 2MH9A 2C6YA 3T1BA 1S6LA 4RAYA 4KDPA 1XGMA 3IKVA 2JTVA 2DK8A 3ZPLA 3F3XA 2OBPA 5IT3A 2YU3A 2QBYB 5FFXA 2IPQX 3NEUA 2NS0A 3MZYA 3F6OA 2X4HA 2DFIA 2M8EA 2V9VA 4KN4X 1FOKA 4L5IA 4K2EA 3GZ5A 5HOOA 4OMZA 4EJVA 2FU4A 1MJAA 4Y17A 1UB9A 3JTHA 2EWNA 2QZ8A 3F8BA 3GFLA 3I4PA 3I59A 5BOXA 1P92A 4YFKF 2D2WA 3FHZA 1RZ4A 1SMYF 2CSOA 2VBYA 1BI1A 4L9NA 4ENKA 2O3FA 1B1BA 5D6FA 2BGCA 4I02A 1LB2A 4BHCA 3DPLC 2CQKA 1ZG3A 3WU0A 4HLYA 5D8LB 4MNUA 1B4AA 5J8CA 3T8TA 3ZMVA 1SFXA 2K7LA 4G6QA 2DU9A 1BIAA 4P5OA 4TV7A 4ETSA 2FE3A 2PBIA 3CUOA 1AOYA 1HKQA 2L3DA 4KN7X 5HVQC 4I0AA 1D8JA 5HS7A 1MD0A 2OU2A 1KU2A 5HS8A 3M1EA 2A07F 3N4MA 2NYXA 1G3SA 2HZTA 3KZZA 5EEGA 5JR3A 3LAPA 5HS9A 2OQRA 3V4GA 3WGHA 4UUVA 4IHSA 3HRMA 2BE5F 1H9TA 3K2ZA 3Q9SA 4Q5SF 4LG0A 3VB2A 4RB1A 1PUEE 3TO7A 2W85A 2B0LA 1I27A 2WV0A 3JSPA 4MEXF 3F8FA 4U0YA 1WRJA 1B59A 3J80Z 4EQQA 1U6GA 1XDUA 1ZGJA 4YFXF 1IN5A 3L00A 2ESHA 1P4XA 3QOPA 1GVJA 1SFEA 3CJNA 4I09A 4U0VA 3BROA 3WGIA 2M87A 4LLNA 1NHAA 1R58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBQ A;  1QO0 D;  1CF7 B;  4HF1 A;  1U5T C;  5ICF A;  3PQK A;  2E7W A;  1IF1 A;  1FLI A;  3JSO A;  4H0E A;  4U7D A;  2GA1 A;  2CW0 F;  4LB5 A;  3VOE A;  3RKW A;  1XSD A;  3RDI A;  4R1H A;  2KKO A;  3KP2 A;  4RB0 A;  1OPC A;  3EQL F;  3HRS A;  1WKM A;  3M8F A;  5BPD A;  1R22 A;  4I7H A;  5LGU A;  1L3L A;  1F1Z A;  4M6X A;  5CJ9 A;  4KIC A;  3GFM A;  3BJA A;  2EV6 A;  2W25 A;  1Z1D A;  2ADU A;  1BC8 C;  3DP7 A;  2IP2 A;  1P4W A;  3ABU A;  5LEJ A;  4CGZ A;  3HSF A;  1J7K A;  4KIG A;  4PCQ A;  2QQ9 A;  1LNW A;  4E70 A;  2HWV A;  3E6D A;  1FZP B;  3C1D A;  1G6N A;  1XMA A;  4EJW A;  1K78 A;  5ED4 A;  5FD5 A;  1OKR A;  1DDN A;  1R00 A;  2FBH A;  3WE3 A;  2LNB A;  1TW3 A;  3B02 A;  3GFJ A;  4Y13 A;  2ZFW A;  4Q4Z F;  2XUB A;  1OYY A;  1U3E M;  4GYG A;  5CVJ A;  1B9N A;  1W7P B;  2MLG A;  1HW1 A;  2VOP A;  3ML6 A;  2RV8 A;  4MEY F;  4GXO A;  4XBF A;  3RPU A;  2Q8K A;  4ZYD A;  5CVV A;  4G9Y A;  2GIV A;  4ZYE A;  1IN8 A;  2HYG D;  1G4D A;  4CYD A;  4AIH A;  2KIU A;  2JRT A;  2DPU A;  3COA C;  3M9A A;  3BWG A;  4LB6 B;  3DQV C;  2ESN A;  3BP8 A;  5ILV A;  1L0O C;  5K5R A;  4XLP F;  2A6E F;  1LDD A;  3WTW C;  2YX4 A;  4HX7 A;  4XLN F;  2IA2 A;  5IT9 K;  1J2X A;  1LJ9 A;  1KGS A;  2D1H A;  3V7C A;  2HDC A;  1XGN A;  3O2P E;  2OD5 A;  2M1B A;  3TOB A;  1SD4 A;  5L3D A;  1DUX C;  2PFB A;  3B73 A;  4HZF A;  1JXS A;  1XB4 A;  2COM A;  2FBI A;  3O3K A;  5LGN A;  2K86 A;  5DD4 A;  2JZY A;  4Z2Y A;  4EJO A;  1QGP A;  5LHH A;  3P9K A;  2Y75 A;  1QZY A;  2DT5 A;  4U0W A;  4M9Z A;  3D0S A;  4UVA A;  3QPT A;  3JAM K;  1MDM A;  3F22 A;  2EV0 A;  3CUQ B;  2O03 A;  2KJC A;  5FD6 A;  2A6H F;  3WE2 A;  4GGG A;  2E1N A;  5E20 A;  3CO6 C;  3F6V A;  5HLG A;  3TOA A;  1Z6R A;  2EFO A;  3EYY A;  4F7Z A;  2XIG A;  3PFI A;  1BN5 A;  2K02 A;  3FXR A;  3KP7 A;  3RKX A;  1K79 A;  3J7A O;  4KNY A;  3RYP A;  1ZHF A;  3HIF A;  1D5V A;  4U88 A;  3T0Y A;  3QPH A;  4S05 A;  4UV8 A;  3FMR A;  1ZLK A;  2FOK A;  3W6K B;  1BOA A;  3M7G A;  1FNN A;  1V3F A;  1EH6 A;  1TQI A;  1WWX A;  4HV5 A;  5E8I A;  3WGG A;  3IWF A;  5DEQ A;  3QP6 A;  3M8E A;  1IW7 F;  4M72 A;  3P9C A;  2V1U A;  2LSO A;  4HLX A;  1TNT A;  5D4R A;  4FX0 A;  5LGT A;  3DEU A;  3HUG A;  1GHC A;  1ZN2 A;  4IHT A;  4M71 A;  2PN6 A;  2EB7 A;  1R5G A;  2EV5 A;  4HBL A;  3KP5 A;  2FXA A;  3K1N A;  4AWX B;  4RAZ A;  2DTR A;  5D5W B;  2KRF A;  3GF2 A;  2PMH A;  5L3B A;  1BM9 A;  5LRS A;  2PI0 A;  1EH7 A;  4YG2 F;  3VFZ A;  1ZGA A;  1SD7 A;  4IF4 A;  3WOD F;  1DPU A;  4Q48 A;  1U2W A;  3L9F A;  2GA2 A;  4MQ9 F;  1QNT A;  3E5Q A;  2BYV E;  3K69 A;  1J5Y A;  4UXN A;  3TDZ C;  2WC2 A;  2FEZ A;  2F5F A;  1LDJ A;  5BS6 A;  4Y15 A;  3MEX A;  3I0T A;  3R0A A;  3IKT A;  2DBB A;  4IRH A;  3FZV A;  3DV8 A;  1G3W A;  3LA7 A;  3MFK A;  4R79 A;  1CGP A;  2QUF A;  3FM5 A;  4CXF A;  4N0B A;  5ILU A;  2CO5 A;  3LQQ A;  4G8X A;  4NQW A;  4DQ2 A;  3KLO A;  2DO7 A;  4HYE A;  3U9G A;  2STW A;  4UVB A;  3VEP A;  3KP3 A;  2V1X A;  4M73 A;  2NRA C;  1QQI A;  2VT2 A;  5KVR A;  1R1T A;  3ZMU A;  3R0J A;  1J59 A;  5D5V B;  1UHM A;  2P5K A;  1KA8 A;  2NAZ A;  3ERE D;  4LLL A;  5CLS A;  5J6X A;  1OMI A;  4AIJ A;  2IJL A;  4EGZ A;  1F9N A;  5HLI A;  3RTR A;  3U2R A;  5L3C A;  1E2X A;  1F4K A;  3MAJ A;  2J5P A;  1XCV A;  1YQA A;  4LG0 B;  2RKH A;  1IRF A;  5DV5 A;  2VOO A;  5D8K B;  3I71 A;  1VTN C;  2ISZ A;  3W6J B;  1IXS B;  2JPC A;  2XRO A;  1I1S A;  2QQA A;  1JGS A;  3RKY A;  1W7P D;  1Z05 A;  4QLC U;  2X0L A;  4IRG A;  4WF2 A;  1LQ1 A;  2P6T A;  1QPM A;  3DF8 A;  3G73 A;  5HDG A;  1Z7U A;  3KLN A;  2FNA A;  3HSE A;  4CIC A;  5HDN A;  1BIB A;  1MJ9 A;  1KYW A;  4LGW A;  5AIP A;  5LHI A;  3LAJ A;  4FX4 A;  1X3U A;  1ZRC A;  3TGN A;  2EFQ A;  3GUD A;  3FMS A;  1Y0U A;  3HRT A;  1YW7 A;  1MKM A;  2O61 A;  1QZZ A;  2H6C A;  4M9S A;  2QM3 A;  1D8K A;  3IRQ A;  3CUQ C;  4B8X A;  4FHT A;  2PEX A;  1V4R A;  3J80 K;  3GVA A;  2FBK A;  3WTZ A;  3ROU A;  1K78 B;  4ZYH A;  4IRI A;  4A2U A;  3ECO A;  4G6D A;  1LDK B;  1TLH B;  1XGO A;  3L2C A;  1RUN A;  1BI2 A;  5DD8 A;  1O7L A;  3LST A;  4BYY A;  1T38 A;  1O7F A;  2V6C A;  2L4A A;  3IRR A;  4P9U A;  3R6S A;  3S2W A;  1R7J A;  4O6J A;  3FF5 A;  3HTS B;  1IXC A;  3HOS A;  3BY6 A;  1IN7 A;  5FGM A;  3DPT A;  2HKO A;  4BHP A;  3CO7 C;  3GZ6 A;  3BOQ A;  3GFI A;  5CVI A;  6PAX A;  1FSE A;  4I98 B;  5K1Y A;  4WWC A;  4OIO F;  1MJB A;  1FY7 A;  2F5D A;  4UNO A;  1H9G A;  1ON1 A;  4HF0 A;  2VN2 A;  1XDS A;  2CYY A;  2LKP A;  1UST A;  2CFX A;  1IXR C;  1FSH A;  4ESF A;  4PDK A;  1KU9 A;  3F8N A;  4HQE A;  2W57 A;  5ICG A;  1YLF A;  2GXB A;  2HQN A;  1HW2 A;  2VXZ A;  4N9I A;  4MTE A;  1T39 A;  4HV6 A;  1O57 A;  1FYL A;  1OYW A;  4G94 A;  3DXJ F;  1YS6 A;  5BPI A;  3QU3 A;  2JSC A;  3MCZ A;  5DYM A;  5F64 A;  5HDK A;  1C0W A;  1O3S A;  2E7X A;  2MD5 A;  5E18 F;  3LA3 A;  3Q5F A;  1XSV A;  4OU0 A;  5E1X A;  2P5V A;  1PP8 F;  1YW8 A;  1PP7 U;  1ZAR A;  2ZNY A;  4RB3 C;  4M6Y A;  3RI4 A;  4A0Y A;  2ETH A;  3LWF A;  5FLX Z;  3TO6 A;  2Z99 A;  1TTY A;  4YII A;  1ZG5 A;  2IA0 A;  4HDV A;  2LF8 A;  2VC1 A;  3WTT C;  2ZCW A;  1USS A;  1RI7 A;  3ZQ7 A;  5H20 A;  3MZH A;  3L09 A;  4L5J A;  2ZNZ A;  1B9M A;  3C18 A;  1MDM B;  3SXY A;  2EFP A;  2VT3 A;  1T98 A;  4WXD A;  4YIF A;  3SFZ A;  2MA3 A;  4A0X A;  1T6S A;  3KZY A;  1IRG A;  5CVR A;  1R36 A;  4A5N A;  2Y0M A;  2EK5 A;  4UVC A;  4UHT A;  3NRV A;  2RGV A;  1GXP A;  1XCB A;  4M74 A;  4JQF A;  3EYI A;  3LA2 A;  3R60 A;  1BBY A;  1KU7 A;  2HQR A;  2F5E A;  3FX3 A;  3FXQ A;  5FFZ A;  2BV6 A;  2XAG A;  2YSR A;  3V7R A;  1DP7 P;  4I0B A;  4L18 B;  1HBX G;  2A3S A;  2Z9O A;  1OYI A;  3H3U A;  3GEZ A;  1BC7 C;  2A69 F;  1JHH A;  4OOI A;  5LLQ A;  4MHG A;  1S3J A;  3AAF A;  4ZYG A;  3JTG A;  4HAM A;  3LQR A;  4QWQ A;  1IN6 A;  4BH9 A;  2XRN A;  1UFM A;  1HQC A;  1UHW A;  4ZZD A;  1FT9 A;  2TDX A;  3V8K A;  3F8C A;  3WTV C;  2VE8 A;  2DPD A;  2EA2 A;  1FWZ A;  3NQO A;  4NHJ A;  2BBY A;  2UWM A;  2ELH A;  3P9I A;  2VBW A;  2XAH A;  3REO A;  2KIM A;  2J5O A;  2LDU A;  4OIP F;  5CVU A;  2G7U A;  2ZO4 A;  4EGY A;  3F8M A;  5ERI A;  3O6B B;  3HYI A;  2XAF A;  2GWR A;  2Z33 A;  4HQM A;  5LEK A;  1WSU A;  3C3W A;  1YYV A;  3D5L A;  3GW2 A;  3K9T A;  4HOB A;  4G7Z F;  4L0Z B;  2P7V B;  5J8F A;  1U5T B;  4OMY A;  1FYK A;  4MGR A;  5DUK A;  3KFW X;  5D5U B;  1FC3 A;  1RIO H;  5DCM A;  1Z6T A;  5LHG A;  2OA4 A;  1I1G A;  4EJU A;  4G7H F;  1AWC A;  1T0F A;  1W5T A;  2VC0 A;  4R8H A;  3QU6 A;  2F5C A;  4CZZ A;  1FBU A;  2EA4 A;  3TQN A;  4WX9 A;  4ZZL A;  1YO5 C;  4LD5 A;  1G3Y A;  1RUO A;  3EET A;  2H09 A;  3EDP A;  2PG4 A;  3IHU A;  3E5X A;  1FBQ A;  2IA1 A;  2R7F A;  3ABT A;  3ULQ B;  2CG4 A;  3ZMZ A;  4UV9 A;  3J81 Z;  4EVI A;  4Q47 A;  3BJ6 A;  4L9V A;  5KK1 A;  2STT A;  4LFU A;  4WK8 F;  3HOT A;  1ON2 A;  1U5T A;  2FA5 A;  2QEN A;  1KQ9 A;  3ELK A;  3TO9 A;  3G3Z A;  1QBJ A;  2WTE A;  2PLY A;  2FMY A;  1LEB A;  1WI9 A;  3SHF A;  2FF4 A;  3HHH A;  4LJZ F;  4EJT A;  1J75 A;  5E17 F;  4AVP A;  2YR2 A;  2L01 A;  2QVO A;  2R3S A;  4GYI A;  4BQA A;  2AXL A;  1WQ2 A;  2H94 A;  1HSJ A;  1TBX A;  5FB2 A;  1ZRF A;  4WXC A;  2XGX A;  2EJR A;  1ZH5 A;  2XAQ A;  2M45 A;  1B6A A;  2PMU A;  3BDD A;  4XRF A;  4KUM A;  3QRF F;  3I54 A;  5AON A;  1REP C;  1KQ0 A;  4GCV A;  2MBF A;  4OIQ F;  1BJA A;  4WXH A;  3I58 A;  2DAO A;  2GZW A;  2CWE A;  5ICC A;  4KMU X;  2KIF A;  4G7O F;  3K0L A;  1TNS A;  1ZRD A;  4NB5 A;  4BNC A;  2D45 A;  2G9W A;  1F5T A;  2O6G E;  3H3Z A;  3F21 A;  2RNJ A;  3BZ6 A;  2FQ3 A;  3Q9V A;  4KT5 C;  1G3T A;  1I6X A;  2P5L C;  1ZRE A;  4DNC A;  4RGU A;  2RN7 A;  2DQR A;  3OOP A;  2H6B A;  4I2O A;  4L0Y B;  4CO8 A;  4ON0 A;  4PGH A;  4ZH4 F;  1FX7 A;  2FNP A;  4S04 A;  1IN4 A;  3SQN A;  4IPA A;  1BI3 A;  3L7W A;  1XGS A;  1HST A;  4IJA A;  1JHF A;  3ZMT A;  2ISY A;  3ECH A;  4KIF A;  3DFG A;  4LK0 F;  2Z5U A;  4M9X A;  2JPB A;  4YFN F;  4RGX A;  1LVA A;  5K5O A;  5JI6 A;  1K7A A;  2HFH A;  2PQ8 A;  3CDH A;  1W5S A;  2XKP A;  3QP5 A;  4O3M A;  2XHK A;  1PDN C;  2NNN A;  1TQP A;  2HTS A;  2P8T A;  2FML A;  4U7B A;  1BI0 A;  1R1V A;  5E1W A;  3R61 A;  1D3Y A;  2A68 F;  4HA8 A;  3V8J A;  2QBY A;  2QWW A;  4HDU A;  2OAZ A;  3GWZ A;  3E97 A;  2DK5 A;  1SD5 A;  1S7O A;  2VOD A;  2E1C A;  5LRR A;  1EV7 A;  4RS8 A;  4XSX F;  1FP1 D;  3EUH A;  3FM3 A;  4I01 A;  2XV4 S;  1KYZ A;  2CGP A;  2EFW A;  4FT8 A;  2D1V A;  4JBA A;  1HKT A;  2NNY A;  1A04 A;  2VON A;  1XN7 A;  3T8R A;  5D6E A;  5EEH A;  1P4A A;  4IXA A;  3V7S A;  4EV0 A;  2RDP A;  3RYR A;  1YS7 A;  3ZMD A;  5CYV A;  1S7A A;  4ASN A;  2ZME B;  2H27 A;  4RB2 C;  2O0Y A;  1Z9C A;  3VOD A;  3E3V A;  1IAW A;  1JE8 A;  2OZ6 A;  1RNL A;  5L3G A;  1ULY A;  2IRF G;  4EMS A;  3KE2 A;  4HF2 A;  4OIR F;  5JFR A;  2AS5 F;  2GXG A;  2ZXJ A;  1K6O A;  4ESB A;  4A5M A;  2IW5 A;  3HHG A;  3BPX A;  1J9I A;  3V8L A;  1ONV A;  5L3F A;  2W24 A;  4KFC A;  5JVT A;  1XD7 A;  2M5W A;  1STZ A;  2RQP A;  3KEQ A;  2A61 A;  3GXO A;  4P96 A;  4MTD A;  3KP6 A;  2F2E A;  2OQG A;  2Q2E A;  2MLK A;  3C7J A;  4L9J A;  1YIO A;  1O3R A;  1R5H A;  3MWM A;  5H6R A;  2XVC A;  4WCG A;  2FRH A;  5F6F A;  4LK1 F;  4AD9 A;  3KP4 A;  3R4K A;  4PGG A;  2ZME A;  2V1D A;  1SAX A;  4RGR A;  1CF7 A;  2Y48 A;  1DPR A;  3KCC A;  5D5X B;  2VBZ A;  1XSX A;  5FLX K;  3PQJ A;  5DUI A;  1SMT A;  4L9T A;  3ZN0 A;  1HKS A;  3JW4 A;  3ISP A;  3WU1 B;  2L02 A;  4BAY A;  2Z3Y A;  1TQM A;  2G7H A;  4AIK A;  1EH8 A;  5DDG A;  3KEO A;  2DQL A;  5H6Q A;  3F23 A;  3TDU C;  2WWY A;  1ZAO A;  2ZBK A;  4BHB A;  2L54 A;  4ENN A;  1W4M A;  4HX4 A;  2UXN A;  4P9F A;  1HXD A;  1P2F A;  2RVC A;  1U78 A;  3FWE A;  3F72 A;  1GXQ A;  2RC4 A;  3K1P A;  1FPQ A;  3E6M A;  4MQV A;  1KQ8 A;  4P55 A;  3E5U A;  1SD6 A;  2GAU A;  3LFK A;  2UXX A;  3I64 A;  2HR3 A;  2XAS A;  1H0M A;  5IT9 Z;  4A0Z A;  5BQT A;  1E17 A;  2BEO A;  3ZMS A;  2V79 A;  1SFU A;  3OV8 A;  3KET A;  2HS5 A;  3T5X A;  1R23 A;  5F1R A;  4D0P A;  4KA4 A;  4BXU A;  1ZYR F;  2JT1 A;  3RIR A;  2M30 A;  5DCM B;  5HLH A;  1W7P A;  3GO5 A;  3U1D A;  4EM1 A;  1OR7 A;  1T2K A;  3TKY A;  2VBX A;  3P7N A;  3WG9 A;  3K1M A;  1I5Z A;  3WTY C;  2L4M A;  3IWZ A;  4HX8 A;  2DLL A;  3MQ0 A;  2HKX A;  2Q0O A;  1YW9 A;  3JAM Z;  5ICE A;  5L3E A;  2OZU A;  2P4W A;  3GLX A;  1UCR A;  5TRD A;  1LEA A;  3I5U A;  3IL2 A;  5BMZ A;  1HW5 A;  3H92 A;  5A2Q Z;  3GX4 X;  1MGT A;  1P6R A;  5D4S A;  2GQQ A;  5A2Q K;  3E6B A;  2ACJ A;  4A6E A;  4A12 A;  1U8R A;  1FP2 A;  2W84 A;  1IUY A;  2QQB A;  2HOE A;  2HTJ A;  4O5V A;  4ESJ A;  4A6D A;  2DI3 A;  4N9H A;  3E6C C;  2YX7 A;  3BPV A;  3HTU A;  2PJP A;  5E1Z B;  3RPQ A;  2ZKZ A;  3ZN1 A;  1KU3 A;  3I53 A;  4HW0 A;  2MH2 A;  3HRU A;  4JK1 X;  2KJB A;  2FSW A;  3IC7 A;  4EM0 B;  2A5Y B;  1ZG1 A;  4KIB A;  2ZJ2 A;  2YPR A;  3WTX C;  2XKO A;  1TW2 A;  5TJJ A;  3SZT A;  2R7D A;  4KYW A;  2K4J A;  1ODD A;  2K4B A;  2HYF A;  2IT0 A;  1S8N A;  3CTA A;  1O3Q A;  1Z91 A;  2MC3 A;  2O8X A;  1IZ1 A;  1MZB A;  3CUQ A;  3RJP A;  5ILS A;  2DW4 A;  1YFH A;  1J0R A;  3FXU A;  4KMF A;  3FMQ A;  4ENM A;  1FBS A;  3WTU C;  1Q1H A;  3J81 K;  2UZK A;  2LF7 A;  1YTY A;  4LMY A;  4XSZ F;  2QYO A;  3CLO A;  2HGC A;  4LLG F;  3N97 A;  1XMK A;  3WTS C;  5E8G A;  4B09 A;  3GYH X;  2HEO A;  5FO5 A;  2XAJ A;  2K27 A;  2VE9 A;  2IVM A;  3QAH A;  3ZP5 A;  4CHU A;  1R1U A;  1FYM A;  4PZJ A;  4ENJ A;  1S29 A;  1ZLJ A;  3HSR A;  2QLZ A;  3I59 B;  5AIQ A;  2P6S A;  3DKW A;  5JHU A;  4CDG A;  3BJO A;  4EM2 A;  1O3T A;  2P7C B;  4RGS A;  1YG2 A;  4OIN F;  2EFN A;  3SZP A;  4IVN A;  4GO1 A;  5DCF A;  5K5Q A;  2MH9 A;  2C6Y A;  3T1B A;  1S6L A;  4RAY A;  4KDP A;  1XGM A;  3IKV A;  2JTV A;  2DK8 A;  3ZPL A;  3F3X A;  2OBP A;  5IT3 A;  2YU3 A;  2QBY B;  5FFX A;  2IPQ X;  3NEU A;  2NS0 A;  3MZY A;  3F6O A;  2X4H A;  2DFI A;  2M8E A;  2V9V A;  4KN4 X;  1FOK A;  4L5I A;  4K2E A;  3GZ5 A;  5HOO A;  4OMZ A;  4EJV A;  2FU4 A;  1MJA A;  4Y17 A;  1UB9 A;  3JTH A;  2EWN A;  2QZ8 A;  3F8B A;  3GFL A;  3I4P A;  3I59 A;  5BOX A;  1P92 A;  4YFK F;  2D2W A;  3FHZ A;  1RZ4 A;  1SMY F;  2CSO A;  2VBY A;  1BI1 A;  4L9N A;  4ENK A;  2O3F A;  1B1B A;  5D6F A;  2BGC A;  4I02 A;  1LB2 A;  4BHC A;  3DPL C;  2CQK A;  1ZG3 A;  3WU0 A;  4HLY A;  5D8L B;  4MNU A;  1B4A A;  5J8C A;  3T8T A;  3ZMV A;  1SFX A;  2K7L A;  4G6Q A;  2DU9 A;  1BIA A;  4P5O A;  4TV7 A;  4ETS A;  2FE3 A;  2PBI A;  3CUO A;  1AOY A;  1HKQ A;  2L3D A;  4KN7 X;  5HVQ C;  4I0A A;  1D8J A;  5HS7 A;  1MD0 A;  2OU2 A;  1KU2 A;  5HS8 A;  3M1E A;  2A07 F;  3N4M A;  2NYX A;  1G3S A;  2HZT A;  3KZZ A;  5EEG A;  5JR3 A;  3LAP A;  5HS9 A;  2OQR A;  3V4G A;  3WGH A;  4UUV A;  4IHS A;  3HRM A;  2BE5 F;  1H9T A;  3K2Z A;  3Q9S A;  4Q5S F;  4LG0 A;  3VB2 A;  4RB1 A;  1PUE E;  3TO7 A;  2W85 A;  2B0L A;  1I27 A;  2WV0 A;  3JSP A;  4MEX F;  3F8F A;  4U0Y A;  1WRJ A;  1B59 A;  3J80 Z;  4EQQ A;  1U6G A;  1XDU A;  1ZGJ A;  4YFX F;  1IN5 A;  3L00 A;  2ESH A;  1P4X A;  3QOP A;  1GVJ A;  1SFE A;  3CJN A;  4I09 A;  4U0V A;  3BRO A;  3WGI A;  2M87 A;  4LLN A;  1NHA A;  1R58 A; 
#chains in the Genus database with same CATH topology
 5LBQ A;  1QO0 D;  3H5A A;  1CF7 B;  3AL0 B;  4HF1 A;  4RLF A;  1U5T C;  3N05 A;  5ICF A;  2JVG A;  4PUS A;  1JJ6 C;  3PQK A;  3MKZ A;  2E7W A;  1IF1 A;  1YIT I;  2R5Z B;  1FLI A;  3JSO A;  4H0E A;  4U7D A;  2KIQ A;  3DU5 A;  2OTL I;  2GA1 A;  2CW0 F;  1FOX A;  3JRA A;  3S1R J;  4LB5 A;  1XPX A;  3VOE A;  3RKW A;  1XSD A;  3RDI A;  3MKL A;  4R1H A;  3OYC A;  2DA3 A;  2KKO A;  2E19 A;  3HGY A;  2M34 A;  3DLA A;  2FX0 A;  2MYS A;  5FRM A;  3HOZ J;  3KP2 A;  3JRF A;  4RB0 A;  3PSF A;  1OPC A;  3EQL F;  3HRS A;  1SVM A;  3ZQI A;  3J7Y J;  4PSW A;  5GPA A;  1WKM A;  3M8F A;  3MD2 A;  3I3L A;  1WJE A;  2LH9 A;  2E34 A;  5BPD A;  1R22 A;  4I7H A;  3WHB A;  3A0H C;  4DZP A;  3QOD A;  1OCP A;  1F1Z A;  4DYC A;  4M6X A;  4F91 B;  5LGU A;  1L3L A;  5CJ9 A;  3BTI A;  3GFM A;  4KIC A;  2EH3 A;  5E3O A;  4BKX A;  3BJA A;  4HRI A;  2FD5 A;  2EV6 A;  2W25 A;  2M2E A;  1Z1D A;  3BTJ A;  1A31 A;  2ADU A;  3Q0W A;  5EF6 A;  5F0C A;  3ESW B;  3BZC A;  1BC8 C;  3DP7 A;  4D5C A;  2B9S A;  1UEL B;  4XID A;  5IPA A;  2IP2 A;  3GZN B;  1P4W A;  2H8R A;  3ABU A;  2H1L A;  5J47 A;  5LEJ A;  4CGZ A;  3HSF A;  3AKZ A;  1J7K A;  4KIG A;  4IOA F;  5FLX R;  1SAN A;  2ELK A;  4PCQ A;  2QQ9 A;  1LNW A;  4E70 A;  2HWV A;  1N25 A;  1W5C C;  2E1M B;  3E6D A;  1FZP B;  3CJT B;  3C1D A;  2IXS A;  1G6N A;  1XMA A;  4EEF G;  4EJW A;  1K78 A;  5ED4 A;  4XKW A;  2KRC A;  1X1C A;  2R4G A;  4W1U A;  5FKO A;  2P0T A;  1JJ8 C;  1N78 A;  1VZ0 A;  1XX5 A;  3ZQG A;  5FD5 A;  1OKR A;  3BG6 A;  1ERD A;  1VI0 A;  1DDN A;  3A4C A;  4DBQ A;  1R00 A;  1UZC A;  2FBH A;  4N4N B;  3WE3 A;  4BL0 B;  2LNB A;  3H5R A;  1TW3 A;  4AUX A;  2GXA A;  3B02 A;  4XOR A;  3GFJ A;  3UR3 C;  3TW7 A;  1FMV A;  4Y13 A;  2DA6 A;  2L2O A;  2ZFW A;  4A3K J;  2WB1 N;  2DA2 A;  2VJ5 A;  2R5Z A;  2XB0 X;  4Q4Z F;  2XUB A;  1X1P A;  4ZC3 A;  1OYY A;  2AQF A;  1FJL A;  1U3E M;  4ZJZ A;  4A3D J;  3OL4 A;  1YJW I;  5IP7 J;  4GYG A;  5CVJ A;  1B9N A;  5FLV A;  4A3L J;  1W7P B;  2BZT A;  1HW1 A;  2MLG A;  4XON A;  2VOP A;  3ML6 A;  2RV8 A;  4MEY F;  2I8D A;  4GXO A;  2R7T A;  4HNU A;  4XBF A;  2KMU A;  3H9G A;  4FIS A;  2EIJ H;  3RPU A;  3P5J A;  2Q8K A;  4ZYD A;  1E0E A;  5M5W J;  3PL8 A;  1KON A;  3CJQ B;  3CMM A;  2A5W A;  3KIO A;  5JLX A;  1H88 C;  5CVV A;  3G1M A;  4G9Y A;  1BJZ A;  2GIV A;  4ZYE A;  1IN8 A;  4NBQ A;  2HYG D;  2LG4 A;  3CCS I;  1G4D A;  4CYD A;  2COB A;  1OCO H;  1T95 A;  2V4J C;  1T56 A;  4AIH A;  2HVR A;  3S3M A;  2CW7 A;  2KIU A;  4NNJ A;  2JRT A;  3HXL A;  2DPU A;  3JRI A;  2RQQ A;  3COA C;  2HOA A;  2KLO A;  3M9A A;  3BWG A;  5DS9 A;  3S15 J;  1ZQ3 P;  4LB6 B;  1E3O C;  1SFK A;  3BTL A;  3DQV C;  2HVS A;  2DYS H;  2ESN A;  3BP8 A;  3D5S C;  5ILV A;  5IY5 H;  4ABZ A;  1L0O C;  1WZ2 A;  2L7M P;  1WPK A;  5K5R A;  1FMW A;  4B43 A;  2VPR A;  3F9K A;  4XLP F;  3E1S A;  1F43 A;  2A6E F;  1LDD A;  3S3O A;  2LVS A;  4BAC A;  3RSN A;  2XSD C;  4RM2 A;  3WTW C;  2YX4 A;  1UG2 A;  5IYC J;  4HX7 A;  4XLN F;  3OYB A;  4XLH A;  2IA2 A;  5IT9 K;  1J2X A;  1LJ9 A;  1KGS A;  2D1H A;  4XIC A;  2FJ1 A;  2R92 J;  3VSL A;  3V7C A;  4NC8 A;  2HDC A;  1XGN A;  3O2P E;  2OD5 A;  1QRY A;  3I55 I;  2M1B A;  1WGX A;  2TCT A;  3TOB A;  1SD4 A;  5L3D A;  2LBF A;  1Z7L A;  2L5Q A;  3FIW A;  1DUX C;  2PFB A;  3B73 A;  2V9K A;  4GRI A;  2VUM J;  1MNE A;  2X6X A;  4HZF A;  1Y1W J;  5FJ8 J;  1JXS A;  1XB4 A;  2DCE A;  3EUH C;  3I9V 2;  2COM A;  2FBI A;  2HQA A;  3ONQ A;  2VKV A;  4M6V A;  3O3K A;  2GM4 A;  5LGN A;  4M3E A;  2K86 A;  5EDN A;  5DD4 A;  3MMY B;  2JZY A;  4Z2Y A;  5B5E C;  1RKT A;  1Y1V J;  1ZTR A;  4EJO A;  1RKW A;  5F04 A;  1QGP A;  5J1R A;  4DIQ A;  5LHH A;  2JWT A;  2OF7 A;  3HUG B;  3P9K A;  2Y75 A;  1QZY A;  2DT5 A;  4U0W A;  1QHH D;  1TWH J;  4M9Z A;  3D0S A;  4M3B A;  4UVA A;  1K4T A;  3QPT A;  3JAM K;  4A3G J;  1V55 H;  2BW3 B;  1MDM A;  3F22 A;  2EV0 A;  2JA5 J;  3CUQ B;  4XKB A;  2O03 A;  2KJC A;  1Z77 A;  5FD6 A;  9ANT A;  2LYC A;  3C2B A;  1BR2 A;  2A6H F;  3G1L A;  3WE2 A;  3ZOB A;  4D7N A;  2XC7 A;  4GGG A;  1V5F A;  2E1N A;  4XLF A;  1W36 C;  3DEW A;  5E20 A;  3CO6 C;  3F6V A;  5HLG A;  2BHY A;  3TOA A;  1Z0X A;  3C2G A;  1YE9 A;  3SEQ A;  2W7N A;  1Z6R A;  4NUB A;  1WJ5 A;  2EZH A;  2EFO A;  5HOD A;  3EYY A;  4F7Z A;  2XIG A;  3NWT A;  1VQ4 I;  3H9J A;  3PFI A;  1BN5 A;  2K02 A;  1X4P A;  3FXR A;  2JA6 J;  2LY1 A;  5F1J A;  3A1Y A;  3KP7 A;  4GFB A;  3RKX A;  1K79 A;  3J7A O;  2X9D A;  4KNY A;  4IZZ A;  3RYP A;  1ZHF A;  3DWL E;  3HIF A;  4U88 A;  1D5V A;  3T0Y A;  2NVU B;  3QPH A;  2LKS A;  4S05 A;  2LFB A;  2Z1D A;  2WAQ N;  4BJ5 C;  2QSF X;  4UV8 A;  1IV6 A;  3FMR A;  3FXK A;  2FOK A;  3BCB A;  1ZLK A;  3RZD J;  3W6K B;  1BOA A;  5J1U A;  3M7G A;  1FNN A;  1V3F A;  4A3J J;  1EH6 A;  1TQI A;  1WWX A;  2QKM B;  2HQ5 A;  3PNT A;  2GIZ A;  5E3N A;  4HV5 A;  5E8I A;  3BG5 A;  4UB8 C;  1SFO J;  2M4G A;  3WGG A;  3IWF A;  1RET A;  3LL7 A;  3RCO A;  1EF4 A;  5IYB J;  5DEQ A;  4RA2 A;  3QP6 A;  3A02 A;  3BR2 A;  3M8E A;  2G0E A;  1Y8Q B;  1PUF B;  3PO2 J;  1IW7 F;  4M72 A;  3P9C A;  2V1U A;  3JRB A;  2LSO A;  5IP9 J;  4HLX A;  1TNT A;  5D4R A;  4FX0 A;  2BXY A;  2MC4 A;  3M3Y J;  5LGT A;  3DEU A;  2WY7 Q;  1B8I A;  3HUG A;  2PJR B;  3O8H A;  1GHC A;  2DXI A;  1ZN2 A;  2DJI A;  3CP8 A;  2XGD A;  4IHT A;  3ERM A;  2BW3 A;  4M71 A;  4IEJ A;  2PN6 A;  2EB7 A;  4LIV A;  1R5G A;  2EV5 A;  2XPV A;  4HBL A;  3KP5 A;  4E7I A;  2FXA A;  1Y39 A;  3K1N A;  4AWX B;  1JKP C;  4RAZ A;  2DTR A;  5D5W B;  1D0Y A;  2KRF A;  4LIU A;  3GF2 A;  2W48 A;  2ZME C;  2PMH A;  2MW8 A;  4MO7 A;  1AHD P;  4AYB N;  5L3B A;  1BM9 A;  1YRN A;  5LRS A;  3S1Q J;  3BZK A;  3SDB A;  2M7B A;  3S14 J;  1M1E B;  3QYF A;  3AL0 C;  2PI0 A;  3GCM A;  2P0W A;  1EH7 A;  4YG2 F;  4X1E A;  3VFZ A;  1GT0 C;  3CQZ J;  1ZGA A;  1SD7 A;  4IF4 A;  3WOD F;  3OYJ A;  1DPU A;  1WH5 A;  3ZQF A;  2IS1 A;  4NC7 A;  4Q48 A;  1U2W A;  1A5J A;  3L9F A;  2GA2 A;  4MQ9 F;  1QNT A;  2WB1 A;  1VQ5 I;  3E5Q A;  4NC6 A;  2HOS A;  3OWT A;  2BYV E;  3K69 A;  3SFI A;  2R5Y A;  1J5Y A;  2DMN A;  1U9N A;  1WCM J;  3H5N A;  4UXN A;  3TDZ C;  2WC2 A;  1ITY A;  3LSJ A;  4CYC A;  2FEZ A;  2F5F A;  1R9T J;  2QGU A;  4M3G A;  5E3M A;  4IQ4 A;  1PYV A;  1X1B A;  1LDJ A;  5BS6 A;  1W0T A;  1AKH A;  4Y15 A;  3MEX A;  1PUF A;  3I0T A;  3R0A A;  3W2A A;  2DFE A;  1WH7 A;  4XLA A;  2CUJ A;  3IKT A;  2DBB A;  3HKZ A;  1T08 B;  4IRH A;  3FZV A;  3SZG A;  3DV8 A;  1G3W A;  3LA7 A;  4IQJ A;  3IAS 2;  5E3L A;  2V1N A;  2PJR A;  3MFK A;  4R79 A;  1YJN I;  1CGP A;  1E3H A;  2QUF A;  3FM5 A;  1ZGW A;  3LOC A;  1BOB A;  1IV8 A;  2X51 A;  4CXF A;  1UG0 A;  4N0B A;  1VQK I;  2QCO A;  3LSH A;  5ILU A;  2CO5 A;  3LQQ A;  4G8X A;  4NQW A;  4DQ2 A;  3KLO A;  2QA4 I;  4BU2 A;  3M4O J;  2DO7 A;  3JCU C;  4HYE A;  2JUC A;  3RPU D;  2X85 A;  3U9G A;  1ETY A;  2STW A;  4UVB A;  3VEP A;  1XC5 A;  3KP3 A;  2V1X A;  4M73 A;  3GTK J;  4N4O B;  2NRA C;  4CCJ A;  1QQI A;  2VT2 A;  5KVR A;  1R1T A;  3ZMU A;  2K85 A;  3R0J A;  5FKL A;  4CCM A;  1J59 A;  5JVG F;  2WAD A;  5D5V B;  4X0G A;  4OAY A;  1UHM A;  5EGO B;  1TZL A;  1R71 A;  2P5K A;  2X48 A;  1KA8 A;  2NAZ A;  4PFO A;  3ERE D;  1WJA A;  3VYT B;  1ZKG A;  3MZ8 A;  4LLL A;  5CLS A;  5J6X A;  3HB9 A;  1VND A;  2VLA A;  1OMI A;  4AIJ A;  2IJL A;  4EGZ A;  1XS9 A;  4XLE A;  4J00 A;  3RZO J;  3KX2 A;  3OS0 A;  1F9N A;  5HLI A;  4PJN A;  2AXT C;  3RTR A;  1ETK A;  2R7Q A;  3U2R A;  5L3C A;  1DGR M;  4BDY A;  1E2X A;  1X1A A;  1F4K A;  2R93 J;  1MBJ A;  3DTE A;  3MAJ A;  2J5P A;  3ABM H;  5HNH A;  1Z3Y A;  3PM1 A;  1XCV A;  4YEJ A;  2V6E A;  3AG1 H;  1YQA A;  4LG0 B;  1SEU A;  3KYL A;  1Z3X A;  2RKH A;  3PUF A;  1YIJ I;  1IRF A;  5DV5 A;  2VOO A;  1LPQ A;  3D5R C;  5KNL A;  5D8K B;  3DLL F;  2IS2 A;  3I71 A;  1VTN C;  4E7J A;  2ZFU A;  1VQ9 I;  2K9L A;  1V5E A;  4FQG A;  1IRX A;  1R4N B;  4JX4 A;  2ISZ A;  4Z6Y A;  3W6J B;  2W82 A;  1IXS B;  2JPC A;  2XRO A;  1I1S A;  4IKF A;  2QQA A;  2UUZ A;  1JGS A;  3RKY A;  1W7P D;  1YX5 A;  2M0M A;  1D1C A;  1Z05 A;  4QLC U;  2X0L A;  4IRG A;  4WF2 A;  1LQ1 A;  2P6T A;  1QPM A;  4D9J A;  2ZJQ F;  3DF8 A;  3G73 A;  1B72 A;  1A36 A;  5HDG A;  2WA0 A;  1NG6 A;  3HBL A;  4B47 A;  4FET A;  2BVM A;  4HG2 A;  1Z7U A;  3KLN A;  4QSH A;  2FNA A;  4PFP A;  4F92 B;  3HSE A;  2CJJ A;  3C2H A;  2IEK A;  4CIC A;  1POG A;  5HDN A;  1JTX A;  3CDI A;  1HOM A;  3BG3 A;  1BIB A;  4CCL A;  4E7H A;  1MJ9 A;  4B3X A;  3L2Q A;  1KYW A;  1MMA A;  2CS3 A;  2WAQ A;  1XG1 A;  4RLQ A;  4IX7 A;  1MBK A;  2MD0 A;  1PJR A;  3FDY A;  4LGW A;  5AIP A;  4ZYA A;  5KAF C;  5LHI A;  3LSR A;  3LAJ A;  4FX4 A;  1BR4 A;  1X3U A;  1ZRC A;  1T0F C;  5H2F C;  3B6C A;  3TGN A;  2R7V A;  2EFQ A;  3GUD A;  2FOW A;  2TRT A;  3CC2 I;  3FMS A;  2DT6 A;  1Y0U A;  3BT9 A;  2D5V A;  4XRS A;  3HRT A;  5J40 A;  1YW7 A;  1MKM A;  2HVQ A;  4RAG A;  2O61 A;  2HXI A;  1QZZ A;  2H6C A;  4M9S A;  1JKR C;  1BW5 A;  2BVL A;  2QM3 A;  1D8K A;  4UB6 C;  3IRQ A;  3CUQ C;  4A3B J;  4DW6 A;  4IOC F;  4CCN A;  4B8X A;  4FHT A;  5C4X J;  5F27 A;  1MIJ A;  3DPU A;  3W6V A;  3KPH A;  2PEX A;  1V4R A;  3J80 K;  4YRV A;  2VQH A;  2IBD A;  3GTJ J;  3GVA A;  2VQC A;  2FBK A;  3WTZ A;  1MMG A;  2KRH A;  3ROU A;  4XMY A;  1K78 B;  4ZYH A;  1VF9 A;  2N8G A;  4A2U A;  4IRI A;  3ECO A;  1MBE A;  2AHQ A;  4G6D A;  1LDK B;  1TLH B;  1XGO A;  1MND A;  3L2C A;  1RUN A;  1BI2 A;  5DD8 A;  1O7L A;  2KIS A;  3K4K A;  3LST A;  4L5E A;  4CZC A;  1P7J A;  3HEF A;  2HPM A;  4BYY A;  2X1D A;  1T38 A;  1O7F A;  2V6C A;  2ECC A;  2L4A A;  3E0J B;  3IRR A;  3MKY B;  4AYB A;  4P9U A;  3R6S A;  3S2W A;  1R7J A;  3K70 C;  4O6J A;  3FF5 A;  1JTY A;  3Q0U A;  3HTS B;  3JRG A;  3CC7 I;  1IXC A;  3HOS A;  3OYE A;  3BY6 A;  1IN7 A;  5FGM A;  3DPT A;  3K4C A;  1Z67 A;  3L2V A;  2HKO A;  4BHP A;  3CO7 C;  3G6E I;  3GZ6 A;  1Y0N A;  3BOQ A;  4XK4 A;  3G71 I;  3GFI A;  4BEH A;  3TP3 A;  5CVI A;  6PAX A;  2VL8 A;  2XDV A;  3J7A W;  3HZJ A;  1VQN I;  4HPQ A;  1R49 A;  1ACI A;  3S1N J;  1FSE A;  2CV1 A;  4I98 B;  3QOE A;  5K1Y A;  4WWC A;  1X1D A;  4OIO F;  1WHU A;  3VPR A;  5EEA A;  1MJB A;  2KHM A;  1FY7 A;  2F5D A;  2XF7 A;  4UNO A;  2JSP A;  3W2V A;  1H9G A;  1ON1 A;  4HF0 A;  3A03 A;  2LK2 A;  3K70 D;  2DMU A;  3J7A Y;  2VN2 A;  1XDS A;  1D1A A;  2CYY A;  2LKP A;  1EKE A;  4LOC A;  1UST A;  2OCC H;  2CFX A;  2VPL A;  1IXR C;  1FSH A;  2QEX I;  2VJ4 A;  2HDW A;  4ESF A;  4PDK A;  1KU9 A;  3F8N A;  5CQG A;  4HQE A;  4KIS A;  1ETV A;  2W57 A;  5ICG A;  1YLF A;  3OYG A;  4IHW A;  1MH3 A;  2GXB A;  2HQN A;  3GTL J;  4AC0 A;  1HW2 A;  2VXZ A;  4N9I A;  4MTE A;  2Y30 A;  1T39 A;  4HV6 A;  1O57 A;  4KT6 A;  1FYL A;  1OYW A;  4X6A J;  4G94 A;  3DXJ F;  1IG7 A;  1YS6 A;  3K2A A;  2M9H A;  3PUB A;  5BPI A;  3QU3 A;  2JSC A;  2VJI A;  5EYR A;  2L7K A;  4CCK A;  3MCZ A;  4ZTF A;  3TBI A;  5DYM A;  1K4S A;  4V19 K;  2KPM A;  5F64 A;  5HDK A;  1C0W A;  1O3S A;  2E7X A;  2MD5 A;  1IRZ A;  2LBF B;  2OPT A;  5E18 F;  3LA3 A;  3Q5F A;  1XSV A;  2XAU A;  1NH3 A;  2E2I J;  2AQE A;  4OU0 A;  4QPO A;  1EA3 A;  5E1X A;  2P5V A;  3S3N A;  1PP8 F;  4C3J J;  1YW8 A;  1PP7 U;  1ZAR A;  2I10 A;  2ZNY A;  3OOU A;  4M6Y A;  4RB3 C;  3B6A A;  4C30 A;  3CCJ I;  3RI4 A;  3CCL I;  4A0Y A;  3CDL A;  3CF2 A;  3HJE A;  2ETH A;  3FXO A;  3LWF A;  5FLX Z;  1JI8 A;  3TO6 A;  2Z99 A;  3PSI A;  1TTY A;  4H4K C;  4YII A;  4C3I J;  3FKI J;  1A6I A;  1ZG5 A;  1NG7 A;  2IA0 A;  4HDV A;  2LF8 A;  2KFD A;  2VC1 A;  3WTT C;  2ZCW A;  1HA8 A;  1USS A;  4JX6 A;  2V26 A;  1RI7 A;  2CMP A;  3ABL H;  3HKZ N;  3ZQ7 A;  5H20 A;  4AVZ A;  2ZJR F;  3DBL B;  3DTK A;  3MZH A;  2H1K A;  4BY1 J;  2CUF A;  3L09 A;  1S5L C;  4L5J A;  4BS9 A;  3AFH A;  2Z2S B;  3CP2 A;  3DBH B;  2ZNZ A;  4Y33 A;  3OYA A;  1B9M A;  3C18 A;  3CCV I;  3SXY A;  1MDM B;  2EFP A;  3ABK H;  1U9O A;  2R7X A;  3TMO A;  2JMW A;  2KT0 A;  5IT9 R;  2VT3 A;  3JRE A;  1JKO C;  1T98 A;  4WXD A;  4YIF A;  3SFZ A;  2NOJ B;  2MA3 A;  3LSK A;  4A0X A;  3HL2 A;  2ZXW H;  3RKQ A;  1T6S A;  3KZY A;  2E1O A;  3WHC A;  1VQO I;  3BC8 A;  5GPC A;  4A3I J;  4UUS A;  1IRG A;  5CVR A;  1V5G A;  2VJJ A;  1X58 A;  1R36 A;  2VKE A;  2Y0M A;  4A5N A;  1O4X A;  4DYQ A;  2R0Q C;  5GTI C;  4D7M A;  2EK5 A;  4UVC A;  4UHT A;  3NRV A;  2RGV A;  4CH7 A;  2XPU A;  3AG2 H;  4D5F A;  1GXP A;  1XCB A;  4M74 A;  3ZQC A;  4JQF A;  3EYI A;  3PFY A;  3LA2 A;  3R60 A;  3JRC A;  1VFC A;  1X3Z B;  1BBY A;  3RQI A;  4XKV A;  3FBN B;  3ZXS A;  1KU7 A;  2HQR A;  3MN2 A;  2F5E A;  4MFE A;  1UHS A;  3CCQ I;  1LUJ B;  4XQF A;  3FX3 A;  3FXQ A;  5FFZ A;  2E71 A;  2EIM H;  1IO2 A;  2BV6 A;  2XAG A;  2YSR A;  3V7R A;  3PO3 J;  3I4N J;  1DP7 P;  3S93 A;  2K3P A;  1ZR2 A;  3JAM R;  4I0B A;  4XRS G;  1VQM I;  4L18 B;  3QPL A;  1HBX G;  3VWB A;  3NAR A;  2A3S A;  1GUU A;  3BQZ A;  3K4J A;  3AG3 H;  2Z9O A;  3BR0 A;  1OYI A;  3H3U A;  1NK3 P;  3GEZ A;  5M5Y J;  1BC7 C;  3S1M J;  4IL6 C;  4FAS D;  1H8A C;  2A69 F;  2HDD A;  2JA8 J;  1JHH A;  4OOI A;  5HNF A;  5A2Q R;  1MBG A;  5LLQ A;  4HNV A;  1I6H J;  3FXJ A;  4G12 A;  2OCE A;  4MHG A;  1S3J A;  1FTZ A;  1B8I B;  3AAF A;  1Q1V A;  4ZYG A;  5EJC A;  2R7W A;  2E2H J;  3JTG A;  4YIR X;  2OTJ I;  4HAM A;  3LQR A;  4QWQ A;  1IN6 A;  4BH9 A;  2XRN A;  1UFM A;  1HQC A;  1UHW A;  3S32 A;  4ZZD A;  2KDZ A;  1FT9 A;  1HC8 A;  2VKD A;  2TDX A;  3V8K A;  3F8C A;  2GBY A;  3WTV C;  2VE8 A;  2DPD A;  3OR2 C;  2E60 A;  2EA2 A;  2I5U A;  1FWZ A;  3NQO A;  4HSR A;  5FKN A;  4NHJ A;  4ZDO A;  2DDA A;  3JR9 A;  2GOM A;  2BBY A;  2UWM A;  2CQN A;  2ELH A;  5B66 C;  2XRL A;  1YRN B;  2DDB A;  3P9I A;  1P9Q C;  4P1W A;  3OSF A;  2VBW A;  1R6R A;  2XAH A;  3REO A;  2KIM A;  2EZL A;  3UKG A;  4FE4 A;  2J5O A;  2LDU A;  2NVY J;  1OJL A;  4OIP F;  5CVU A;  2G7U A;  3OY9 A;  2QKL B;  2ZO4 A;  4EGY A;  3F8M A;  5ERI A;  3O6B B;  3HYI A;  2XAF A;  2BHZ A;  2GWR A;  2Z33 A;  2JJ7 A;  4HQM A;  3HPG A;  5LEK A;  1WVR A;  1WSU A;  3C3W A;  1QHG A;  1YYV A;  1IDZ A;  2R5Y B;  4MLO A;  1TL8 A;  2Y9Z A;  3D5L A;  3GW2 A;  2IGM A;  3K9T A;  4HOB A;  4CYC B;  4G7Z F;  4L0Z B;  2IS4 A;  2P7V B;  5J8F A;  1U5T B;  2DA1 A;  4OWR B;  4XN3 A;  1QZE A;  3O8G A;  2JVH A;  4OMY A;  3K6G A;  1AKH B;  1FYK A;  4BGD A;  4DZJ A;  4MGR A;  2LMD A;  1OQY A;  5DUK A;  1OIS A;  3KFW X;  3CZ6 A;  3OSG A;  4XN0 A;  2QSH X;  1E3P A;  5DTD A;  5D5U B;  2O8K A;  1EJ9 A;  1FC3 A;  4OAZ A;  1RIO H;  5DCM A;  4BQN A;  1Z6T A;  1TWF J;  2RAE A;  3CF5 F;  1X2M A;  5LHG A;  2OA4 A;  2DOE A;  1I1G A;  4EJU A;  4G7H F;  1AWC A;  1T0F A;  3ZCO A;  2PX9 A;  2XF5 A;  3BR5 A;  3CC4 I;  3CMY A;  5GAD J;  1OCZ H;  1W5T A;  2VC0 A;  2VB6 A;  3FKJ A;  4R8H A;  4V2F A;  5EG0 A;  3J81 R;  3QU6 A;  2F5C A;  4CZZ A;  1FBU A;  2EA4 A;  3TQN A;  4WX9 A;  4PJJ A;  5LFA A;  4NQW B;  4ZZL A;  2DJN A;  1YO5 C;  1P7I A;  4LD5 A;  5J4Y A;  1DU6 A;  1G3Y A;  4NDL A;  1RUO A;  4PK4 A;  1LE8 A;  1FOW A;  3EET A;  4RM3 A;  3BR6 A;  2F4O B;  2H09 A;  5LD2 C;  5KCM A;  3EDP A;  2PG4 A;  2XGC A;  3IHU A;  3DBR B;  3E5X A;  2WBM A;  4QPQ A;  4A3C J;  3W3C A;  1FBQ A;  2IA1 A;  2R7F A;  2R7O A;  2RNG A;  3ABT A;  3ULQ B;  4IHV A;  3FBI B;  3A2K A;  2CG4 A;  2R7R A;  1H89 C;  3UNG C;  3J7Z I;  1JUS A;  2IS6 A;  4U87 A;  3ZMZ A;  2LOO A;  3S2H J;  4UV9 A;  4BE1 A;  3J81 Z;  4EVI A;  3HOY J;  2NVT J;  4Q47 A;  2EIL H;  3BJ6 A;  1DU0 A;  3JRD A;  4L9V A;  5KK1 A;  2STT A;  2KL4 A;  4BQQ A;  4LFU A;  4WK8 F;  3HOT A;  1ON2 A;  1U5T A;  2FA5 A;  2QEN A;  1KQ9 A;  3ELK A;  3HOU J;  1ETW A;  3TO9 A;  3G3Z A;  1FEX A;  1QBJ A;  4FE7 A;  2WTE A;  2PLY A;  3DU6 A;  4F3Q A;  2FMY A;  1LEB A;  1WI9 A;  3LFU A;  2ZXH A;  1WJC A;  3SHF A;  1JT6 A;  2FF4 A;  3G2B A;  3HHH A;  2BY0 A;  3CCE I;  3DCF A;  4LJZ F;  2O9L A;  1IJW C;  1RPW A;  4EJT A;  3OIQ A;  1J75 A;  5E17 F;  4AVP A;  2EZI A;  2YR2 A;  2L01 A;  2QVO A;  1YI2 I;  3HM5 A;  3EUK L;  3OYN A;  3GBG A;  5C4J J;  2BXZ A;  5FRO A;  3L2U A;  2R3S A;  2MVT A;  4GYI A;  1VQ6 I;  4BQA A;  2AXL A;  1WQ2 A;  2H94 A;  4E7K A;  1HSJ A;  1TBX A;  2E1M C;  5FB2 A;  3TL4 X;  1ZRF A;  2FUG 2;  4WXC A;  1QA6 A;  1B72 B;  4B4C A;  2XGX A;  2HNH A;  2EJR A;  1SVL A;  1ZH5 A;  4CSW A;  2XAQ A;  2M45 A;  1B6A A;  3LNQ A;  2PMU A;  3BDD A;  2DMP A;  4XRF A;  4ANJ A;  1G59 A;  4KUM A;  4JP0 A;  2PMZ N;  3L2W A;  2LD5 A;  3QRF F;  1S9H A;  3I54 A;  3DEE A;  5AON A;  1MSF C;  3OYH A;  1D5Y A;  1KQ0 A;  1REP C;  3SJM A;  4GCV A;  2MBF A;  3A0B C;  4QTR A;  4OIQ F;  1BJA A;  4WXH A;  2KZG A;  1HDP A;  3I58 A;  2IGK A;  2L9S A;  4FCY A;  2JA7 J;  1YOV B;  2DAO A;  3S17 J;  2GZW A;  2CWE A;  1KZH A;  5ICC A;  1OR7 C;  2KIF A;  3BQY A;  4KMU X;  4GDF A;  2L9N A;  3IV5 A;  4G7O F;  3OYL A;  3K0L A;  1TNS A;  1ZRD A;  2WAE A;  4NB5 A;  4BNC A;  2D45 A;  2G9W A;  1F5T A;  2O6G E;  3H3Z A;  3F21 A;  2RNJ A;  3BZ6 A;  2FQ3 A;  3Q9V A;  3TP0 A;  4KT5 C;  1ETO A;  1G3T A;  1I6X A;  3HOX J;  2P5L C;  1ZRE A;  4G6T B;  2HZD A;  4DNC A;  4E7S A;  4RGU A;  4BY7 J;  2RN7 A;  2DQR A;  3TED A;  3OOP A;  2H6B A;  2CUE A;  4I2O A;  2MG4 A;  4L0Y B;  3QYE A;  4CO8 A;  4ON0 A;  2QF7 A;  2DMQ A;  4PGH A;  4ZH4 F;  4BBR J;  1FX7 A;  2FNP A;  4S04 A;  3FK6 A;  1IN4 A;  5B1A H;  3PNV A;  4A93 J;  2HI3 A;  3SQN A;  2NVQ J;  4IPA A;  1BI3 A;  3L7W A;  4ZDL A;  1XGS A;  1HST A;  4IJA A;  1JHF A;  3ZMT A;  3GLL A;  4DOZ A;  2ISY A;  3BLY A;  5M5X J;  4Y3O A;  5C3E J;  4XLC A;  3Q3S A;  1Z21 A;  3ECH A;  3CCM I;  1FIP A;  2JUG A;  3SDG A;  3KZI C;  4CA0 A;  2DOA A;  4KIF A;  3DFG A;  4LK0 F;  2Z5U A;  5J3L A;  4M9X A;  2JPB A;  4YFN F;  4RGX A;  4IHY A;  1LVA A;  3PIO F;  5K5O A;  5JI6 A;  1FIA A;  1K7A A;  2R7S A;  2HFH A;  2PQ8 A;  3CDH A;  2JRM A;  5J4V A;  5J1Y A;  4B3A A;  3K10 A;  1W5S A;  5M3M J;  2XKP A;  3OYM A;  3QP5 A;  4O3M A;  2XHK A;  1PDN C;  2NNN A;  4BEH B;  4YEL A;  3V42 A;  1TQP A;  2HTS A;  2P8T A;  3TW6 A;  3RQ4 A;  2FML A;  2MAB A;  3VYU B;  2LP0 A;  4F93 B;  4U7B A;  1BI0 A;  1LFP A;  1R1V A;  3J80 R;  5E1W A;  2K9S A;  2DFF A;  3R61 A;  1D3Y A;  2A68 F;  4HA8 A;  4XR6 A;  3V8J A;  2QBY A;  2QWW A;  4HDU A;  1IC8 A;  2OAZ A;  1XTA A;  4IO9 F;  3GWZ A;  4J19 A;  3I4M J;  4BQO A;  3E97 A;  1LFB A;  2DK5 A;  4QIW N;  1SD5 A;  2E36 A;  1S7O A;  2VOD A;  2WY8 Q;  3DTI A;  2E1C A;  1FOY A;  1OFC X;  5LRR A;  1EV7 A;  4RS8 A;  4XSX F;  1FP1 D;  3EUH A;  2X1C A;  3FM3 A;  1ETQ A;  4I01 A;  2IGN A;  4HST A;  2XV4 S;  2WAF A;  1MW7 A;  2ECB A;  3G4S I;  1KYZ A;  2FQ4 A;  2CGP A;  3NWS A;  1F36 A;  2EFW A;  4RDU A;  4FT8 A;  3OS2 A;  2X98 A;  2MUN A;  2D1V A;  1HLV A;  2XPW A;  4JBA A;  3S16 J;  1HKT A;  1YHQ I;  4C2U A;  2CRG A;  1WJB A;  3PIP F;  2NNY A;  3GTP J;  1A35 A;  2R7Z J;  4E4H A;  1A04 A;  2VON A;  4I6Z A;  1XN7 A;  3AG4 H;  4B44 A;  1OCT C;  3T8R A;  2L9R A;  4BUP A;  5GAH J;  5D6E A;  5EEH A;  4BXF A;  1P4A A;  2ZSH B;  4IXA A;  3M8J A;  3V7S A;  3H3V K;  2CQQ A;  4EV0 A;  2Z16 A;  2RDP A;  3RYR A;  1YS7 A;  3ZMD A;  3OIO A;  5CYV A;  2W4S A;  1S7A A;  2ZSI B;  3GTM J;  1BA5 A;  4I99 C;  4ASN A;  1QPI A;  3ASN H;  1K61 A;  3OR1 C;  1MSE C;  2X6W A;  2ELJ A;  2ZME B;  3A01 A;  1BR1 A;  1GLN A;  2LRD A;  2H27 A;  4RB2 C;  5F08 A;  4EAT A;  2O0Y A;  4Y7N J;  1Z9C A;  3VOD A;  1GV2 A;  3E3V A;  2K9M A;  3BG9 A;  1IAW A;  1JE8 A;  2OZ6 A;  1RNL A;  5L3G A;  2M4K A;  1BW6 A;  1ULY A;  5KAI C;  2IRF G;  1MBF A;  4EMS A;  3KE2 A;  2YU9 J;  4HF2 A;  4OIR F;  5JFR A;  2AS5 F;  2L7F P;  2HPI A;  2F6C A;  2GXG A;  2ZXJ A;  3WU2 C;  1K6O A;  4ESB A;  3HDD A;  4A5M A;  2IW5 A;  3HHG A;  3BPX A;  4A3F J;  1X4O A;  1X3W B;  1J9I A;  4PJM A;  3V8L A;  2M7A A;  4E7L A;  1ONV A;  2QSG X;  5L3F A;  2A6T A;  2W24 A;  1IGN A;  5CPR B;  2DMT A;  4KFC A;  3U1K A;  3CCU I;  5E79 C;  5JVT A;  1XD7 A;  2M5W A;  1RR7 A;  4UUS B;  1STZ A;  2RQP A;  1TP4 A;  1J09 A;  3K7A J;  3KEQ A;  4XOT A;  2JQ7 A;  2A61 A;  3GXO A;  4P96 A;  4F52 A;  5DM6 F;  4XNF A;  1RQ6 A;  4MTD A;  3KP6 A;  2F2E A;  3IH4 A;  3QQA A;  2OQG A;  2Q2E A;  2MLK A;  4IHX A;  3C7J A;  4L9J A;  1YIO A;  2K3F A;  2OC6 A;  2L9V A;  1O3R A;  2DOD A;  3EUA A;  1R5H A;  3MWM A;  4S0H B;  3CES A;  2PMZ A;  5H6R A;  1HDD C;  2XVC A;  4WCG A;  2FRH A;  5K7F A;  5F6F A;  4LK1 F;  1LVK A;  3M07 A;  4AD9 A;  2ZJP F;  1I3A A;  3KP4 A;  3R4K A;  3CLQ A;  2KZV A;  3KEY A;  4PGG A;  2BY3 A;  2ZME A;  4DJA A;  3LSM A;  4DGW B;  3U21 A;  4E7Z A;  4C2T A;  2V1D A;  3OL3 A;  1SAX A;  4RGR A;  1CF7 A;  2Y48 A;  1DPR A;  2QQ8 A;  3KCC A;  5FKM A;  5D5X B;  2VBZ A;  1XSX A;  5FLX K;  3PQJ A;  5DUI A;  1SMT A;  4L9T A;  3ZN0 A;  1MMS A;  4MFD A;  1HKS A;  1RR8 C;  2F5V A;  3JW4 A;  3ISP A;  1WFX A;  1HF0 A;  3WU1 B;  2L02 A;  3K4L A;  4BAY A;  2Z3Y A;  1TQM A;  2G7H A;  2F4M B;  4AIK A;  1G8X A;  1EH8 A;  5DDG A;  3KEO A;  2X6O A;  2DQL A;  5H6Q A;  3F23 A;  2NOG A;  3TDU C;  2WWY A;  1ZAO A;  2ZBK A;  4HEA 2;  4A3M J;  3VDX A;  5GTH C;  2HU9 A;  4BHB A;  2W1O A;  1D1B A;  2E35 A;  2L54 A;  4ENN A;  2Y0S N;  1W4M A;  5TIS C;  4HX4 A;  3IP4 B;  3KYC B;  3QPS A;  2UXN A;  1VQ8 I;  2GLO A;  3FIS A;  2V9P A;  4P9F A;  1ZK8 A;  1HXD A;  5GP9 A;  1P2F A;  3PNY A;  1JGG A;  1R4M B;  2Y31 A;  5EZG A;  5IOY A;  4XRM A;  1SAU A;  2RVC A;  1U78 A;  2XSJ C;  4KIT B;  3FWE A;  1TC3 C;  4RBO A;  3ZQQ A;  2A05 A;  4Y52 J;  4LG3 A;  1RC9 A;  3F72 A;  2HOT A;  4B1R A;  1GXQ A;  1R5I D;  2RC4 A;  1Y6I A;  2DYR H;  3K1P A;  1FPQ A;  3E6M A;  1UAA A;  4MQV A;  1KQ8 A;  4P55 A;  3E5U A;  1SD6 A;  2LLK A;  2GAU A;  2KP6 A;  3LFK A;  2UXX A;  3I64 A;  3L1P A;  2Y9Y A;  5F0F A;  2HR3 A;  2XAS A;  1H0M A;  5IT9 Z;  1PVE A;  4A0Z A;  3ZQL A;  1WJF A;  5BQT A;  1E17 A;  2BEO A;  3QYB A;  3ZMS A;  2V79 A;  1SFU A;  2CUZ A;  1Y8R B;  3OV8 A;  4BDZ A;  3BR3 A;  3KET A;  2HS5 A;  3OYD A;  3T5X A;  1APL C;  3LSP A;  1R23 A;  2DTZ A;  5F1R A;  4D0P A;  4KA4 A;  4BXU A;  1ZYR F;  2JT1 A;  3RIR A;  2MSY A;  1X19 A;  2M30 A;  1MMN A;  2MFZ A;  5DCM B;  5KHD A;  5HLH A;  2XB5 A;  4C2M J;  3OIP A;  1W7P A;  3GO5 A;  3U1D A;  4EM1 A;  1OR7 A;  3MVP A;  5M3F J;  1T2K A;  3GTQ J;  5EG0 B;  4UY8 I;  3K4B A;  3TKY A;  2VBX A;  1I50 J;  1DQU A;  3P7N A;  3WG9 A;  4BXX J;  3K1M A;  1I5Z A;  3WTY C;  2EBI A;  2L4M A;  3G1O A;  5CKT A;  3IWZ A;  1I39 A;  4HX8 A;  2CW8 A;  2DLL A;  3MQ0 A;  2CQ7 A;  2HKX A;  4XM3 A;  1YJ9 I;  2Q0O A;  1YW9 A;  3JAM Z;  3BCA A;  1S72 I;  2O7O A;  5ICE A;  5L3E A;  3GTO J;  1LE8 B;  1XMX A;  2OZU A;  2P4W A;  4FTH A;  5HLT A;  3GLX A;  4MIM A;  3MKW B;  1UCR A;  5IYD J;  5TRD A;  3W2W A;  1LEA A;  1W1W E;  3I5U A;  3H35 A;  3IL2 A;  2F48 A;  5BMZ A;  1ZEL A;  1HW5 A;  2BOL A;  2ZXI A;  2B7E A;  4DBR A;  2JN6 A;  3H92 A;  5A2Q Z;  3GX4 X;  1MGT A;  1P6R A;  3CCR I;  5D4S A;  3A52 A;  2GQQ A;  5A2Q K;  3QWL A;  2UV1 A;  2ID6 A;  3E6B A;  2JK3 A;  2ACJ A;  4A6E A;  4A12 A;  2BY2 A;  1U8R A;  1FP2 A;  2W84 A;  2ZC2 A;  4D1Q A;  1IUY A;  2QQB A;  5K7H A;  2HOE A;  2HTJ A;  4O5V A;  4ESJ A;  1NK2 P;  4A6D A;  2DI3 A;  4N9H A;  3E6C C;  2YX7 A;  3BPV A;  3HTU A;  2PJP A;  2M8G X;  5E1Z B;  3RPQ A;  2ZKZ A;  3ZN1 A;  2M35 A;  2VI6 A;  1OLT A;  3ZRG A;  1KU3 A;  3I53 A;  4HW0 A;  2R7U A;  1N77 A;  3HOW J;  2MH2 A;  2O5R A;  2NS8 A;  1U0J A;  3HRU A;  2MGQ A;  4JK1 X;  3S2D J;  2KJB A;  2FSW A;  5IOZ A;  4JX5 A;  3IC7 A;  3KYD B;  1W36 D;  4EM0 B;  2A5Y B;  1ZG1 A;  4C9Y A;  4J01 A;  2VXD A;  4KIB A;  2OJE D;  2ZJ2 A;  5GAG J;  2YPR A;  3LSG A;  3ZR8 X;  2XKO A;  3HC7 A;  3WTX C;  1TW2 A;  2KQR A;  2M3A A;  4II3 A;  4BBS J;  5TJJ A;  3SZT A;  5FRN A;  4BE2 A;  2R7D A;  4KYW A;  1ENH A;  2K4J A;  1ODD A;  2K4B A;  2X1E A;  1IDY A;  2HYF A;  2IT0 A;  1AA7 A;  1S8N A;  1K83 J;  2DA7 A;  2K40 A;  2XGE A;  4ITV A;  1DGW Y;  3H0G J;  3BG7 A;  3CTA A;  3H36 A;  1MNM C;  1O3Q A;  1Z91 A;  2MC3 A;  2O8X A;  3Q0V A;  4E6K G;  1IZ1 A;  1UMQ A;  4I76 A;  1MZB A;  4RAF A;  2L7Z A;  1TT5 B;  3CUQ A;  3K4N A;  1LKX A;  2IAI A;  2XF6 A;  3RJP A;  5EZH A;  5ILS A;  2DW4 A;  1YFH A;  2DA4 A;  5F0H A;  1J0R A;  3FXU A;  2NS7 A;  4KMF A;  2LRE A;  1BL0 A;  2GOX B;  1LFU P;  5B3S H;  3FMQ A;  1YX3 A;  2DN0 A;  2B63 J;  4ENM A;  1VQ7 I;  2JA2 A;  1FBS A;  3WTU C;  1Q1H A;  1OCR H;  3WG7 H;  3ZGK A;  3J81 K;  2UZK A;  2LF7 A;  1YTY A;  3CJR B;  5B1B H;  4LMY A;  3FXM A;  1MBH A;  4XSZ F;  3FK7 A;  2LR8 A;  2QYO A;  3CLO A;  4LIT A;  2VQG A;  1AU7 A;  2HGC A;  3DKY A;  4F55 A;  4DYR A;  1T33 A;  4LLG F;  3N97 A;  1U8B A;  4PSX A;  1XMK A;  3DKX A;  1VQL I;  3WTS C;  5E8G A;  4B09 A;  3GYH X;  2CH0 A;  1TWC J;  2HEO A;  5FO5 A;  4C3H J;  2XAJ A;  2K27 A;  1JT0 A;  2VE9 A;  1QU3 A;  2IVM A;  3QAH A;  3ZP5 A;  4CHU A;  1R1U A;  1S7E A;  2OUM A;  2WV1 A;  1FYM A;  2LY9 A;  4PZJ A;  4ENJ A;  1JUP A;  1S29 A;  1ZLJ A;  4XOP A;  2VKH A;  3HSR A;  5FKK A;  1ORK A;  1V54 H;  2QLZ A;  4KJZ A;  2LC2 A;  3I59 B;  5AIQ A;  2Y0S A;  2ID3 A;  2ME6 A;  2P6S A;  3GME A;  1WI3 A;  3DKW A;  3CME I;  5JHU A;  2E5Z A;  4CDG A;  2CV0 A;  2BY1 A;  3BJO A;  1SC7 A;  3IH2 A;  4EM2 A;  5CQE A;  1O3T A;  2LY2 A;  2P7C B;  4RGS A;  1ETX A;  1YG2 A;  1IUF A;  2Q1Z B;  3HGG A;  4OIN F;  2EFN A;  3SZP A;  1X2N A;  2OV7 A;  4IVN A;  4GO1 A;  5DCF A;  4M3D A;  5K5Q A;  3K4M A;  1JKQ C;  2MH9 A;  2NVX J;  2C6Y A;  3HPH A;  2Y69 H;  3T1B A;  1S6L A;  4RAY A;  1D0X A;  5BNG A;  2DFH A;  1SVO A;  2K9Q A;  4V2G A;  4KDP A;  3H9Q A;  1XGM A;  3IKV A;  2JTV A;  4BE0 A;  4M3F A;  2DT7 B;  4CUG A;  2DK8 A;  3ZPL A;  4W97 A;  1G2H A;  1I3Q J;  3F3X A;  2OBP A;  5IT3 A;  2EZK A;  1JUM A;  2YU3 A;  1TT0 A;  3OMY A;  5GAE J;  3OS1 A;  3JRH A;  4HNT A;  1ZR4 A;  2QBY B;  5FFX A;  2IPQ X;  3NEU A;  3OYK A;  2NS0 A;  4AU7 A;  3MZY A;  3F6O A;  2X4H A;  2DFI A;  2M8E A;  3IUO A;  2K9N A;  2V9V A;  4KN4 X;  3F0C A;  1GV5 A;  2H8W A;  2ME0 A;  4Y4R A;  2X6Y A;  1FOK A;  3NAU A;  4L5I A;  4K2E A;  1Y56 A;  3GZ5 A;  5HOO A;  4OMZ A;  1HCR A;  4EJV A;  1RES A;  3VYS B;  2FU4 A;  5JLW A;  3H0D A;  3OYF A;  3I56 I;  1MJA A;  4Y17 A;  1UB9 A;  2Y2Z A;  3JTH A;  2EWN A;  4A69 C;  2QZ8 A;  2VIX A;  1DP3 A;  3F8B A;  3GFL A;  1NTC A;  3I4P A;  5K7Z A;  2ICW G;  1CQT A;  3SEZ A;  3I59 A;  4RMN A;  1OCC H;  5BOX A;  1P92 A;  2DA5 A;  4YFK F;  2HYJ A;  3PJR A;  2D2W A;  3FHZ A;  2L0K A;  3FXL A;  1W0U A;  1A6Q A;  1RZ4 A;  1SMY F;  2CSO A;  2VBY A;  1BI1 A;  3ZQH A;  4XKC A;  2CQX A;  4L9N A;  4BJ6 C;  4ENK A;  3GTG J;  2O3F A;  1B1B A;  5D6F A;  1K6Y A;  2YS9 A;  3LSI A;  2BGC A;  4I02 A;  3H1C A;  2ZB9 A;  1LB2 A;  4BHC A;  3DPL C;  1MMD A;  2CU7 A;  2KDO A;  3OYI A;  2CQK A;  4ZTJ A;  1ZG3 A;  3WU0 A;  2IGO A;  2VQL A;  4HLY A;  4UUT A;  1D0Z A;  5D8L B;  4JYK A;  4MNU A;  1B4A A;  5J8C A;  2CFO A;  5IP6 A;  3T8T A;  3ZMV A;  3A01 B;  3E7L A;  2MZ4 A;  2P81 A;  1SFX A;  2K7L A;  5DM7 F;  4G6Q A;  2DU9 A;  1BIA A;  4P5O A;  3VSK A;  4TV7 A;  3VYR B;  4ETS A;  3CD6 I;  2FE3 A;  2PBI A;  3CUO A;  3M1C A;  5EGO A;  3LMM A;  4CCO A;  1AOY A;  1HKQ A;  2L3D A;  4KN7 X;  4XL9 A;  5HVQ C;  1N75 A;  2E5N A;  4II2 A;  4I0A A;  3SYT A;  1T8I A;  5JHF A;  1D8J A;  3X2Q H;  5HS7 A;  4A3E J;  2M0C A;  1MD0 A;  2LTP A;  2OU2 A;  1TWA J;  1KU2 A;  3CMA I;  5HS8 A;  3M1E A;  4PJ0 C;  2A07 F;  2V7F A;  2NYX A;  3N4M A;  1G3S A;  2HZT A;  3KZZ A;  1GDT A;  5EEG A;  5JR3 A;  2EIN H;  3EPZ A;  4ZDP A;  2YUS A;  3LAP A;  5HS9 A;  2RRE A;  2F4I A;  2OQR A;  4PJL A;  5TGT A;  3V4G A;  3WGH A;  4UUV A;  4IHS A;  3D1N I;  1UJ8 A;  3HRM A;  2BE5 F;  3L2R A;  4AM3 A;  1H9T A;  3IH3 A;  1WJD A;  4JOM A;  3K2Z A;  2K5C A;  3Q9S A;  2EPF A;  4Q5S F;  2EQR A;  4LG0 A;  3VB2 A;  1FTT A;  4RB1 A;  3CCY A;  1PUE E;  3TO7 A;  2W85 A;  2B0L A;  5FLM J;  1I27 A;  2WV0 A;  3JSP A;  3FHN A;  4MEX F;  2HXO A;  3F8F A;  4U0Y A;  1RRJ A;  1QVU A;  2Q2E B;  4BJT A;  1WRJ A;  1B59 A;  3IAM 2;  5C44 J;  2E2J J;  3J80 Z;  2VAS A;  2CV2 A;  4EQQ A;  1U6G A;  1XDU A;  1ZGJ A;  4YFX F;  1IN5 A;  2W00 A;  2AO9 A;  4AID A;  3HOV J;  3L00 A;  4B48 A;  3HG9 A;  3S8P A;  2NXN B;  1VQP I;  1QVT A;  2ESH A;  1P4X A;  3BTC A;  3BR1 A;  3QOP A;  1MH4 A;  1GVJ A;  1SFE A;  3ASO H;  3CJN A;  1TWG J;  1GVD A;  4I09 A;  4U0V A;  3BRO A;  3WGI A;  2M87 A;  4LLN A;  2DOF A;  2EIK H;  2LKX A;  1NHA A;  1R58 A; 
#chains in the Genus database with same CATH homology
 5LBQ A;  1QO0 D;  1CF7 B;  4HF1 A;  1U5T C;  5ICF A;  3PQK A;  2E7W A;  1IF1 A;  1FLI A;  3JSO A;  4H0E A;  4U7D A;  2GA1 A;  2CW0 F;  4LB5 A;  3VOE A;  3RKW A;  1XSD A;  3RDI A;  4R1H A;  2KKO A;  3KP2 A;  4RB0 A;  1OPC A;  3EQL F;  3HRS A;  1WKM A;  3M8F A;  5BPD A;  1R22 A;  4I7H A;  5LGU A;  1L3L A;  1F1Z A;  4M6X A;  5CJ9 A;  4KIC A;  3GFM A;  3BJA A;  2EV6 A;  2W25 A;  1Z1D A;  2ADU A;  1BC8 C;  3DP7 A;  2IP2 A;  1P4W A;  3ABU A;  5LEJ A;  4CGZ A;  3HSF A;  1J7K A;  4KIG A;  4PCQ A;  2QQ9 A;  1LNW A;  4E70 A;  2HWV A;  3E6D A;  1FZP B;  3C1D A;  1G6N A;  1XMA A;  4EJW A;  1K78 A;  5ED4 A;  5FD5 A;  1OKR A;  1DDN A;  1R00 A;  2FBH A;  3WE3 A;  2LNB A;  1TW3 A;  3B02 A;  3GFJ A;  4Y13 A;  2ZFW A;  4Q4Z F;  2XUB A;  1OYY A;  1U3E M;  4GYG A;  5CVJ A;  1B9N A;  1W7P B;  2MLG A;  1HW1 A;  2VOP A;  3ML6 A;  2RV8 A;  4MEY F;  4GXO A;  4XBF A;  3RPU A;  2Q8K A;  4ZYD A;  5CVV A;  4G9Y A;  2GIV A;  4ZYE A;  1IN8 A;  2HYG D;  1G4D A;  4CYD A;  4AIH A;  2KIU A;  2JRT A;  2DPU A;  3COA C;  3M9A A;  3BWG A;  4LB6 B;  3DQV C;  2ESN A;  3BP8 A;  5ILV A;  1L0O C;  5K5R A;  4XLP F;  2A6E F;  1LDD A;  3WTW C;  2YX4 A;  4HX7 A;  4XLN F;  2IA2 A;  5IT9 K;  1J2X A;  1LJ9 A;  1KGS A;  2D1H A;  3V7C A;  2HDC A;  1XGN A;  3O2P E;  2OD5 A;  2M1B A;  3TOB A;  1SD4 A;  5L3D A;  1DUX C;  2PFB A;  3B73 A;  4HZF A;  1JXS A;  1XB4 A;  2COM A;  2FBI A;  3O3K A;  5LGN A;  2K86 A;  5DD4 A;  2JZY A;  4Z2Y A;  4EJO A;  1QGP A;  5LHH A;  3P9K A;  2Y75 A;  1QZY A;  2DT5 A;  4U0W A;  4M9Z A;  3D0S A;  4UVA A;  3QPT A;  3JAM K;  1MDM A;  3F22 A;  2EV0 A;  3CUQ B;  2O03 A;  2KJC A;  5FD6 A;  2A6H F;  3WE2 A;  4GGG A;  2E1N A;  5E20 A;  3CO6 C;  3F6V A;  5HLG A;  3TOA A;  1Z6R A;  2EFO A;  3EYY A;  4F7Z A;  2XIG A;  3PFI A;  1BN5 A;  2K02 A;  3FXR A;  3KP7 A;  3RKX A;  1K79 A;  3J7A O;  4KNY A;  3RYP A;  1ZHF A;  3HIF A;  1D5V A;  4U88 A;  3T0Y A;  3QPH A;  4S05 A;  4UV8 A;  3FMR A;  1ZLK A;  2FOK A;  3W6K B;  1BOA A;  3M7G A;  1FNN A;  1V3F A;  1EH6 A;  1TQI A;  1WWX A;  4HV5 A;  5E8I A;  3WGG A;  3IWF A;  5DEQ A;  3QP6 A;  3M8E A;  1IW7 F;  4M72 A;  3P9C A;  2V1U A;  2LSO A;  4HLX A;  1TNT A;  5D4R A;  4FX0 A;  5LGT A;  3DEU A;  3HUG A;  1GHC A;  1ZN2 A;  4IHT A;  4M71 A;  2PN6 A;  2EB7 A;  1R5G A;  2EV5 A;  4HBL A;  3KP5 A;  2FXA A;  3K1N A;  4AWX B;  4RAZ A;  2DTR A;  5D5W B;  2KRF A;  3GF2 A;  2PMH A;  5L3B A;  1BM9 A;  5LRS A;  2PI0 A;  1EH7 A;  4YG2 F;  3VFZ A;  1ZGA A;  1SD7 A;  4IF4 A;  3WOD F;  1DPU A;  4Q48 A;  1U2W A;  3L9F A;  2GA2 A;  4MQ9 F;  1QNT A;  3E5Q A;  2BYV E;  3K69 A;  1J5Y A;  4UXN A;  3TDZ C;  2WC2 A;  2FEZ A;  2F5F A;  1LDJ A;  5BS6 A;  4Y15 A;  3MEX A;  3I0T A;  3R0A A;  3IKT A;  2DBB A;  4IRH A;  3FZV A;  3DV8 A;  1G3W A;  3LA7 A;  3MFK A;  4R79 A;  1CGP A;  2QUF A;  3FM5 A;  4CXF A;  4N0B A;  5ILU A;  2CO5 A;  3LQQ A;  4G8X A;  4NQW A;  4DQ2 A;  3KLO A;  2DO7 A;  4HYE A;  3U9G A;  2STW A;  4UVB A;  3VEP A;  3KP3 A;  2V1X A;  4M73 A;  2NRA C;  1QQI A;  2VT2 A;  5KVR A;  1R1T A;  3ZMU A;  3R0J A;  1J59 A;  5D5V B;  1UHM A;  2P5K A;  1KA8 A;  2NAZ A;  3ERE D;  4LLL A;  5CLS A;  5J6X A;  1OMI A;  4AIJ A;  2IJL A;  4EGZ A;  1F9N A;  5HLI A;  3RTR A;  3U2R A;  5L3C A;  1E2X A;  1F4K A;  3MAJ A;  2J5P A;  1XCV A;  1YQA A;  4LG0 B;  2RKH A;  1IRF A;  5DV5 A;  2VOO A;  5D8K B;  3I71 A;  1VTN C;  2ISZ A;  3W6J B;  1IXS B;  2JPC A;  2XRO A;  1I1S A;  2QQA A;  1JGS A;  3RKY A;  1W7P D;  1Z05 A;  4QLC U;  2X0L A;  4IRG A;  4WF2 A;  1LQ1 A;  2P6T A;  1QPM A;  3DF8 A;  3G73 A;  5HDG A;  1Z7U A;  3KLN A;  2FNA A;  3HSE A;  4CIC A;  5HDN A;  1BIB A;  1MJ9 A;  1KYW A;  4LGW A;  5AIP A;  5LHI A;  3LAJ A;  4FX4 A;  1X3U A;  1ZRC A;  3TGN A;  2EFQ A;  3GUD A;  3FMS A;  1Y0U A;  3HRT A;  1YW7 A;  1MKM A;  2O61 A;  1QZZ A;  2H6C A;  4M9S A;  2QM3 A;  1D8K A;  3IRQ A;  3CUQ C;  4B8X A;  4FHT A;  2PEX A;  1V4R A;  3J80 K;  3GVA A;  2FBK A;  3WTZ A;  3ROU A;  1K78 B;  4ZYH A;  4IRI A;  4A2U A;  3ECO A;  4G6D A;  1LDK B;  1TLH B;  1XGO A;  3L2C A;  1RUN A;  1BI2 A;  5DD8 A;  1O7L A;  3LST A;  4BYY A;  1T38 A;  1O7F A;  2V6C A;  2L4A A;  3IRR A;  4P9U A;  3R6S A;  3S2W A;  1R7J A;  4O6J A;  3FF5 A;  3HTS B;  1IXC A;  3HOS A;  3BY6 A;  1IN7 A;  5FGM A;  3DPT A;  2HKO A;  4BHP A;  3CO7 C;  3GZ6 A;  3BOQ A;  3GFI A;  5CVI A;  6PAX A;  1FSE A;  4I98 B;  5K1Y A;  4WWC A;  4OIO F;  1MJB A;  1FY7 A;  2F5D A;  4UNO A;  1H9G A;  1ON1 A;  4HF0 A;  2VN2 A;  1XDS A;  2CYY A;  2LKP A;  1UST A;  2CFX A;  1IXR C;  1FSH A;  4ESF A;  4PDK A;  1KU9 A;  3F8N A;  4HQE A;  2W57 A;  5ICG A;  1YLF A;  2GXB A;  2HQN A;  1HW2 A;  2VXZ A;  4N9I A;  4MTE A;  1T39 A;  4HV6 A;  1O57 A;  1FYL A;  1OYW A;  4G94 A;  3DXJ F;  1YS6 A;  5BPI A;  3QU3 A;  2JSC A;  3MCZ A;  5DYM A;  5F64 A;  5HDK A;  1C0W A;  1O3S A;  2E7X A;  2MD5 A;  5E18 F;  3LA3 A;  3Q5F A;  1XSV A;  4OU0 A;  5E1X A;  2P5V A;  1PP8 F;  1YW8 A;  1PP7 U;  1ZAR A;  2ZNY A;  4RB3 C;  4M6Y A;  3RI4 A;  4A0Y A;  2ETH A;  3LWF A;  5FLX Z;  3TO6 A;  2Z99 A;  1TTY A;  4YII A;  1ZG5 A;  2IA0 A;  4HDV A;  2LF8 A;  2VC1 A;  3WTT C;  2ZCW A;  1USS A;  1RI7 A;  3ZQ7 A;  5H20 A;  3MZH A;  3L09 A;  4L5J A;  2ZNZ A;  1B9M A;  3C18 A;  1MDM B;  3SXY A;  2EFP A;  2VT3 A;  1T98 A;  4WXD A;  4YIF A;  3SFZ A;  2MA3 A;  4A0X A;  1T6S A;  3KZY A;  1IRG A;  5CVR A;  1R36 A;  4A5N A;  2Y0M A;  2EK5 A;  4UVC A;  4UHT A;  3NRV A;  2RGV A;  1GXP A;  1XCB A;  4M74 A;  4JQF A;  3EYI A;  3LA2 A;  3R60 A;  1BBY A;  1KU7 A;  2HQR A;  2F5E A;  3FX3 A;  3FXQ A;  5FFZ A;  2BV6 A;  2XAG A;  2YSR A;  3V7R A;  1DP7 P;  4I0B A;  4L18 B;  1HBX G;  2A3S A;  2Z9O A;  1OYI A;  3H3U A;  3GEZ A;  1BC7 C;  2A69 F;  1JHH A;  4OOI A;  5LLQ A;  4MHG A;  1S3J A;  3AAF A;  4ZYG A;  3JTG A;  4HAM A;  3LQR A;  4QWQ A;  1IN6 A;  4BH9 A;  2XRN A;  1UFM A;  1HQC A;  1UHW A;  4ZZD A;  1FT9 A;  2TDX A;  3V8K A;  3F8C A;  3WTV C;  2VE8 A;  2DPD A;  2EA2 A;  1FWZ A;  3NQO A;  4NHJ A;  2BBY A;  2UWM A;  2ELH A;  3P9I A;  2VBW A;  2XAH A;  3REO A;  2KIM A;  2J5O A;  2LDU A;  4OIP F;  5CVU A;  2G7U A;  2ZO4 A;  4EGY A;  3F8M A;  5ERI A;  3O6B B;  3HYI A;  2XAF A;  2GWR A;  2Z33 A;  4HQM A;  5LEK A;  1WSU A;  3C3W A;  1YYV A;  3D5L A;  3GW2 A;  3K9T A;  4HOB A;  4G7Z F;  4L0Z B;  2P7V B;  5J8F A;  1U5T B;  4OMY A;  1FYK A;  4MGR A;  5DUK A;  3KFW X;  5D5U B;  1FC3 A;  1RIO H;  5DCM A;  1Z6T A;  5LHG A;  2OA4 A;  1I1G A;  4EJU A;  4G7H F;  1AWC A;  1T0F A;  1W5T A;  2VC0 A;  4R8H A;  3QU6 A;  2F5C A;  4CZZ A;  1FBU A;  2EA4 A;  3TQN A;  4WX9 A;  4ZZL A;  1YO5 C;  4LD5 A;  1G3Y A;  1RUO A;  3EET A;  2H09 A;  3EDP A;  2PG4 A;  3IHU A;  3E5X A;  1FBQ A;  2IA1 A;  2R7F A;  3ABT A;  3ULQ B;  2CG4 A;  3ZMZ A;  4UV9 A;  3J81 Z;  4EVI A;  4Q47 A;  3BJ6 A;  4L9V A;  5KK1 A;  2STT A;  4LFU A;  4WK8 F;  3HOT A;  1ON2 A;  1U5T A;  2FA5 A;  2QEN A;  1KQ9 A;  3ELK A;  3TO9 A;  3G3Z A;  1QBJ A;  2WTE A;  2PLY A;  2FMY A;  1LEB A;  1WI9 A;  3SHF A;  2FF4 A;  3HHH A;  4LJZ F;  4EJT A;  1J75 A;  5E17 F;  4AVP A;  2YR2 A;  2L01 A;  2QVO A;  2R3S A;  4GYI A;  4BQA A;  2AXL A;  1WQ2 A;  2H94 A;  1HSJ A;  1TBX A;  5FB2 A;  1ZRF A;  4WXC A;  2XGX A;  2EJR A;  1ZH5 A;  2XAQ A;  2M45 A;  1B6A A;  2PMU A;  3BDD A;  4XRF A;  4KUM A;  3QRF F;  3I54 A;  5AON A;  1REP C;  1KQ0 A;  4GCV A;  2MBF A;  4OIQ F;  1BJA A;  4WXH A;  3I58 A;  2DAO A;  2GZW A;  2CWE A;  5ICC A;  4KMU X;  2KIF A;  4G7O F;  3K0L A;  1TNS A;  1ZRD A;  4NB5 A;  4BNC A;  2D45 A;  2G9W A;  1F5T A;  2O6G E;  3H3Z A;  3F21 A;  2RNJ A;  3BZ6 A;  2FQ3 A;  3Q9V A;  4KT5 C;  1G3T A;  1I6X A;  2P5L C;  1ZRE A;  4DNC A;  4RGU A;  2RN7 A;  2DQR A;  3OOP A;  2H6B A;  4I2O A;  4L0Y B;  4CO8 A;  4ON0 A;  4PGH A;  4ZH4 F;  1FX7 A;  2FNP A;  4S04 A;  1IN4 A;  3SQN A;  4IPA A;  1BI3 A;  3L7W A;  1XGS A;  1HST A;  4IJA A;  1JHF A;  3ZMT A;  2ISY A;  3ECH A;  4KIF A;  3DFG A;  4LK0 F;  2Z5U A;  4M9X A;  2JPB A;  4YFN F;  4RGX A;  1LVA A;  5K5O A;  5JI6 A;  1K7A A;  2HFH A;  2PQ8 A;  3CDH A;  1W5S A;  2XKP A;  3QP5 A;  4O3M A;  2XHK A;  1PDN C;  2NNN A;  1TQP A;  2HTS A;  2P8T A;  2FML A;  4U7B A;  1BI0 A;  1R1V A;  5E1W A;  3R61 A;  1D3Y A;  2A68 F;  4HA8 A;  3V8J A;  2QBY A;  2QWW A;  4HDU A;  2OAZ A;  3GWZ A;  3E97 A;  2DK5 A;  1SD5 A;  1S7O A;  2VOD A;  2E1C A;  5LRR A;  1EV7 A;  4RS8 A;  4XSX F;  1FP1 D;  3EUH A;  3FM3 A;  4I01 A;  2XV4 S;  1KYZ A;  2CGP A;  2EFW A;  4FT8 A;  2D1V A;  4JBA A;  1HKT A;  2NNY A;  1A04 A;  2VON A;  1XN7 A;  3T8R A;  5D6E A;  5EEH A;  1P4A A;  4IXA A;  3V7S A;  4EV0 A;  2RDP A;  3RYR A;  1YS7 A;  3ZMD A;  5CYV A;  1S7A A;  4ASN A;  2ZME B;  2H27 A;  4RB2 C;  2O0Y A;  1Z9C A;  3VOD A;  3E3V A;  1IAW A;  1JE8 A;  2OZ6 A;  1RNL A;  5L3G A;  1ULY A;  2IRF G;  4EMS A;  3KE2 A;  4HF2 A;  4OIR F;  5JFR A;  2AS5 F;  2GXG A;  2ZXJ A;  1K6O A;  4ESB A;  4A5M A;  2IW5 A;  3HHG A;  3BPX A;  1J9I A;  3V8L A;  1ONV A;  5L3F A;  2W24 A;  4KFC A;  5JVT A;  1XD7 A;  2M5W A;  1STZ A;  2RQP A;  3KEQ A;  2A61 A;  3GXO A;  4P96 A;  4MTD A;  3KP6 A;  2F2E A;  2OQG A;  2Q2E A;  2MLK A;  3C7J A;  4L9J A;  1YIO A;  1O3R A;  1R5H A;  3MWM A;  5H6R A;  2XVC A;  4WCG A;  2FRH A;  5F6F A;  4LK1 F;  4AD9 A;  3KP4 A;  3R4K A;  4PGG A;  2ZME A;  2V1D A;  1SAX A;  4RGR A;  1CF7 A;  2Y48 A;  1DPR A;  3KCC A;  5D5X B;  2VBZ A;  1XSX A;  5FLX K;  3PQJ A;  5DUI A;  1SMT A;  4L9T A;  3ZN0 A;  1HKS A;  3JW4 A;  3ISP A;  3WU1 B;  2L02 A;  4BAY A;  2Z3Y A;  1TQM A;  2G7H A;  4AIK A;  1EH8 A;  5DDG A;  3KEO A;  2DQL A;  5H6Q A;  3F23 A;  3TDU C;  2WWY A;  1ZAO A;  2ZBK A;  4BHB A;  2L54 A;  4ENN A;  1W4M A;  4HX4 A;  2UXN A;  4P9F A;  1HXD A;  1P2F A;  2RVC A;  1U78 A;  3FWE A;  3F72 A;  1GXQ A;  2RC4 A;  3K1P A;  1FPQ A;  3E6M A;  4MQV A;  1KQ8 A;  4P55 A;  3E5U A;  1SD6 A;  2GAU A;  3LFK A;  2UXX A;  3I64 A;  2HR3 A;  2XAS A;  1H0M A;  5IT9 Z;  4A0Z A;  5BQT A;  1E17 A;  2BEO A;  3ZMS A;  2V79 A;  1SFU A;  3OV8 A;  3KET A;  2HS5 A;  3T5X A;  1R23 A;  5F1R A;  4D0P A;  4KA4 A;  4BXU A;  1ZYR F;  2JT1 A;  3RIR A;  2M30 A;  5DCM B;  5HLH A;  1W7P A;  3GO5 A;  3U1D A;  4EM1 A;  1OR7 A;  1T2K A;  3TKY A;  2VBX A;  3P7N A;  3WG9 A;  3K1M A;  1I5Z A;  3WTY C;  2L4M A;  3IWZ A;  4HX8 A;  2DLL A;  3MQ0 A;  2HKX A;  2Q0O A;  1YW9 A;  3JAM Z;  5ICE A;  5L3E A;  2OZU A;  2P4W A;  3GLX A;  1UCR A;  5TRD A;  1LEA A;  3I5U A;  3IL2 A;  5BMZ A;  1HW5 A;  3H92 A;  5A2Q Z;  3GX4 X;  1MGT A;  1P6R A;  5D4S A;  2GQQ A;  5A2Q K;  3E6B A;  2ACJ A;  4A6E A;  4A12 A;  1U8R A;  1FP2 A;  2W84 A;  1IUY A;  2QQB A;  2HOE A;  2HTJ A;  4O5V A;  4ESJ A;  4A6D A;  2DI3 A;  4N9H A;  3E6C C;  2YX7 A;  3BPV A;  3HTU A;  2PJP A;  5E1Z B;  3RPQ A;  2ZKZ A;  3ZN1 A;  1KU3 A;  3I53 A;  4HW0 A;  2MH2 A;  3HRU A;  4JK1 X;  2KJB A;  2FSW A;  3IC7 A;  4EM0 B;  2A5Y B;  1ZG1 A;  4KIB A;  2ZJ2 A;  2YPR A;  3WTX C;  2XKO A;  1TW2 A;  5TJJ A;  3SZT A;  2R7D A;  4KYW A;  2K4J A;  1ODD A;  2K4B A;  2HYF A;  2IT0 A;  1S8N A;  3CTA A;  1O3Q A;  1Z91 A;  2MC3 A;  2O8X A;  1IZ1 A;  1MZB A;  3CUQ A;  3RJP A;  5ILS A;  2DW4 A;  1YFH A;  1J0R A;  3FXU A;  4KMF A;  3FMQ A;  4ENM A;  1FBS A;  3WTU C;  1Q1H A;  3J81 K;  2UZK A;  2LF7 A;  1YTY A;  4LMY A;  4XSZ F;  2QYO A;  3CLO A;  2HGC A;  4LLG F;  3N97 A;  1XMK A;  3WTS C;  5E8G A;  4B09 A;  3GYH X;  2HEO A;  5FO5 A;  2XAJ A;  2K27 A;  2VE9 A;  2IVM A;  3QAH A;  3ZP5 A;  4CHU A;  1R1U A;  1FYM A;  4PZJ A;  4ENJ A;  1S29 A;  1ZLJ A;  3HSR A;  2QLZ A;  3I59 B;  5AIQ A;  2P6S A;  3DKW A;  5JHU A;  4CDG A;  3BJO A;  4EM2 A;  1O3T A;  2P7C B;  4RGS A;  1YG2 A;  4OIN F;  2EFN A;  3SZP A;  4IVN A;  4GO1 A;  5DCF A;  5K5Q A;  2MH9 A;  2C6Y A;  3T1B A;  1S6L A;  4RAY A;  4KDP A;  1XGM A;  3IKV A;  2JTV A;  2DK8 A;  3ZPL A;  3F3X A;  2OBP A;  5IT3 A;  2YU3 A;  2QBY B;  5FFX A;  2IPQ X;  3NEU A;  2NS0 A;  3MZY A;  3F6O A;  2X4H A;  2DFI A;  2M8E A;  2V9V A;  4KN4 X;  1FOK A;  4L5I A;  4K2E A;  3GZ5 A;  5HOO A;  4OMZ A;  4EJV A;  2FU4 A;  1MJA A;  4Y17 A;  1UB9 A;  3JTH A;  2EWN A;  2QZ8 A;  3F8B A;  3GFL A;  3I4P A;  3I59 A;  5BOX A;  1P92 A;  4YFK F;  2D2W A;  3FHZ A;  1RZ4 A;  1SMY F;  2CSO A;  2VBY A;  1BI1 A;  4L9N A;  4ENK A;  2O3F A;  1B1B A;  5D6F A;  2BGC A;  4I02 A;  1LB2 A;  4BHC A;  3DPL C;  2CQK A;  1ZG3 A;  3WU0 A;  4HLY A;  5D8L B;  4MNU A;  1B4A A;  5J8C A;  3T8T A;  3ZMV A;  1SFX A;  2K7L A;  4G6Q A;  2DU9 A;  1BIA A;  4P5O A;  4TV7 A;  4ETS A;  2FE3 A;  2PBI A;  3CUO A;  1AOY A;  1HKQ A;  2L3D A;  4KN7 X;  5HVQ C;  4I0A A;  1D8J A;  5HS7 A;  1MD0 A;  2OU2 A;  1KU2 A;  5HS8 A;  3M1E A;  2A07 F;  3N4M A;  2NYX A;  1G3S A;  2HZT A;  3KZZ A;  5EEG A;  5JR3 A;  3LAP A;  5HS9 A;  2OQR A;  3V4G A;  3WGH A;  4UUV A;  4IHS A;  3HRM A;  2BE5 F;  1H9T A;  3K2Z A;  3Q9S A;  4Q5S F;  4LG0 A;  3VB2 A;  4RB1 A;  1PUE E;  3TO7 A;  2W85 A;  2B0L A;  1I27 A;  2WV0 A;  3JSP A;  4MEX F;  3F8F A;  4U0Y A;  1WRJ A;  1B59 A;  3J80 Z;  4EQQ A;  1U6G A;  1XDU A;  1ZGJ A;  4YFX F;  1IN5 A;  3L00 A;  2ESH A;  1P4X A;  3QOP A;  1GVJ A;  1SFE A;  3CJN A;  4I09 A;  4U0V A;  3BRO A;  3WGI A;  2M87 A;  4LLN A;  1NHA A;  1R58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...