2EV5A

Bacillus subtilis manganese transport regulator (mntr) bound to calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
136
structure length
132
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 54
structure length 132
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev5A02
3DF8A 3GX4X 3S2WA 4L5JA 1KU3A 3ECHA 4UVCA 1ZRDA 2ZJ2A 1USSA 1Q1HA 1DPRA 4G6QA 4EM2A 1J7KA 3MEXA 4IHTA 3FXQA 4P5OA 2RQPA 3SXYA 2LDUA 5HLHA 5IT9K 4ENNA 4EJVA 3R60A 2YX4A 3VOEA 3HUGA 1MDMA 4HQMA 3IL2A 2QBYA 3DP7A 3IWZA 2A68F 5HS8A 4CXFA 5ICGA 1R36A 3L9FA 1J5YA 3GO5A 3V7RA 3CUOA 2HFHA 2O8XA 1A04A 3I54A 3KP3A 2EFQA 1MGTA 1Z6RA 2FE3A 2DPDA 2V79A 4EJTA 2FA5A 4OMZA 2BV6A 1BBYA 2K27A 2K02A 1ZLJA 2P7VB 3WGGA 3T8TA 3I64A 3C18A 2K4BA 2DPUA 1ZHFA 4KIGA 2H6CA 3SZPA 1J9IA 4HDVA 2YX7A 5JVTA 3HTUA 1E2XA 4UVBA 4OIOF 4GGGA 5LEJA 5KVRA 1L3LA 3P9IA 4B8XA 3E97A 2ZCWA 1XCVA 2VBZA 3JW4A 5DEQA 1ZAOA 2ELHA 3KP2A 1H9GA 2VXZA 2DBBA 4EJWA 2KJCA 1LDJA 2C6YA 4KMFA 3BOQA 2V1UA 4G8XA 3FXRA 1IF1A 2AXLA 1XMAA 3WTSC 2LF8A 1W5TA 3F8NA 1L0OC 1FP2A 3WGIA 2R7FA 4ASNA 3LFKA 3GFJA 3JSPA 3ZMDA 3K69A 1IZ1A 2HTSA 4O3MA 2L3DA 3BJOA 4RB2C 1RIOH 2WWYA 2UWMA 5DUKA 2CSOA 3FM5A 2Y75A 2HQRA 2Y0MA 4A5NA 2E7XA 3HTSB 3CTAA 4KN4X 2EA4A 2MLGA 2V9VA 3B02A 4R79A 1ON1A 1JXSA 3E5XA 1IUYA 4OINF 1PUEE 2L02A 5ILVA 3ELKA 2PMUA 1T39A 3KCCA 3HOSA 2M87A 3HRUA 2CQKA 3RI4A 4HX4A 1IN8A 4WXDA 2G7UA 1LNWA 3J81K 3K9TA 4UHTA 2E7WA 3GF2A 4IRHA 1NHAA 4GO1A 5LHHA 2VE9A 1Z7UA 2HKOA 2JRTA 5HS7A 4YFNF 4ZYEA 2STWA 5J8FA 4M9XA 5E1XA 3NQOA 1KYZA 2Z99A 1BC7C 2MD5A 2CYYA 1TW3A 3HIFA 3DQVC 3HOTA 4LD5A 1YQAA 1FSEA 5ICFA 4NB5A 2KIFA 2XUBA 1DPUA 4P96A 4I02A 4A12A 2K86A 4WX9A 1QBJA 5BPIA 4UXNA 2R7DA 1P4AA 4MNUA 2IA0A 1ODDA 4OU0A 3CLOA 5K5OA 3F23A 2HOEA 2DO7A 1JE8A 2XAJA 1FBUA 3QPTA 2OD5A 4HW0A 3DV8A 4HYEA 1B9MA 1ZG1A 2HWVA 4EM1A 2D2WA 5H6QA 4IF4A 3PQJA 1UFMA 3FM3A 1W7PD 5CJ9A 3F8FA 1SMTA 3MZYA 2HKXA 2VOPA 4UUVA 2GXGA 4EJUA 2QQAA 3CO6C 1R5GA 1P4WA 5LGTA 4HQEA 1G3SA 1O3QA 1QZYA 1EV7A 1OYWA 3E6DA 4FHTA 3FWEA 2FBIA 1OYIA 1U5TA 5D5UB 3RKXA 3DEUA 2A6HF 3DPTA 3V4GA 2ZO4A 1GXQA 5IT9Z 1I27A 1PDNC 5JR3A 4HX7A 1SAXA 3H92A 2M45A 3CUQC 4UV8A 1S3JA 2V1DA 1YG2A 2YR2A 3QU3A 1RUOA 5HOOA 1OMIA 3ECOA 5CVVA 4ENKA 3P9CA 2IRFG 5LHGA 3ZMTA 1QO0D 4IVNA 1XSXA 4L9VA 3TO7A 3WU1B 3LA2A 1ZGAA 1R58A 3HRSA 2OQRA 1HW5A 2O61A 1F4KA 1R7JA 3CO7C 1R1TA 4U0WA 5AIPA 1KU9A 4HBLA 2MBFA 4OIPF 2XAQA 1FYMA 3TKYA 4A6EA 4KIBA 4K2EA 1O3RA 5HDKA 3ML6A 4A5MA 1T0FA 5BOXA 1P92A 3KLNA 5HDNA 1BI0A 3NRVA 1LDDA 1FBQA 4CICA 2WTEA 4LK0F 4ETSA 5KK1A 4WK8F 3M8EA 3I53A 1TNTA 1XGNA 1I5ZA 2DQRA 3EETA 2VN2A 2W57A 3OV8A 2KJBA 3WGHA 4AIKA 1V4RA 5K5RA 2L4MA 2XV4S 1B9NA 2MH2A 3I58A 5CVRA 3RKYA 1CF7B 1H0MA 2P5LC 2RKHA 3BPVA 3AAFA 1FLIA 3FHZA 2RV8A 4GXOA 2GAUA 3ZMSA 1BOAA 2XKPA 4IHSA 4LLLA 2HZTA 2P6SA 2FF4A 2W85A 2IPQX 3LQQA 3J80K 3MCZA 2OZ6A 4CZZA 3M9AA 2NAZA 4MGRA 3M7GA 2BBYA 2RGVA 2DAOA 1EH8A 1Z6TA 4PZJA 3E5QA 4L9NA 5DCMB 4LMYA 2COMA 1ONVA 3KZZA 2IW5A 4N9IA 4NQWA 4EJOA 1T98A 2QBYB 2FXAA 5FO5A 5JI6A 2PFBA 2OAZA 2XHKA 3HSFA 2IT0A 5DDGA 2O0YA 3BZ6A 3TDZC 3BROA 3QU6A 3HRTA 3TOAA 1TNSA 5F1RA 4L18B 1FYLA 2CFXA 2QQBA 3C3WA 1O7LA 2OU2A 3FX3A 2ADUA 4ZZLA 2F5FA 2O3FA 3LAJA 4WCGA 1XN7A 1KU2A 3V7SA 1S8NA 2M8EA 1DP7P 4PGGA 3I59B 2Z9OA 1MZBA 1FX7A 4WXHA 2FBKA 3F22A 4EMSA 1U5TC 1FT9A 3E6BA 3D0SA 3WTTC 4A2UA 2ISYA 4XLPF 1W7PB 4A0YA 5A2QK 2XAFA 3WTYC 5ERIA 2HGCA 2O6GE 4RB0A 3SFZA 1PP8F 3O2PE 4UV9A 3RJPA 3F6OA 3QP6A 4KYWA 3QRFF 5L3FA 4BHPA 4YFKF 1SD6A 3COAC 4AWXB 2QQ9A 5H20A 3IKTA 1HKTA 3HSEA 2A69F 3BJAA 1SFUA 1MKMA 1BIBA 4PCQA 3DXJF 2JZYA 2A5YB 2Q8KA 4P9FA 3RTRA 3ZQ7A 3BWGA 4BH9A 2LSOA 1S6LA 1TQMA 3L7WA 3P7NA 1WSUA 1HXDA 4B09A 2EFNA 3F3XA 3SZTA 3ABTA 4LB6B 4RS8A 3SQNA 4UVAA 5DCMA 2P8TA 4LLNA 1DDNA 3CJNA 4AD9A 4I2OA 4YIFA 5LGUA 2OBPA 3C7JA 2YPRA 4XSZF 4HF1A 1I1SA 1O3TA 4UNOA 2MLKA 5K1YA 2YU3A 5L3EA 3K1NA 3QOPA 2P6TA 4G7OF 2V1XA 3Q9VA 1ON2A 4MEXF 1MDMB 1LQ1A 1SD7A 2UZKA 2IVMA 3GZ5A 2FRHA 2VE8A 2GA1A 1RNLA 3L09A 4G7HF 3GFLA 1ZREA 2RVCA 2K4JA 4CO8A 4MEYF 3N97A 5D5VB 3WTVC 3N4MA 1D8KA 1WI9A 1HW2A 4AIJA 1TTYA 2VC1A 2QENA 3W6KB 4Q48A 4M72A 2BGCA 3R6SA 1QQIA 2QWWA 5LLQA 1BI3A 2H94A 4Z2YA 3I71A 2Z5UA 3B73A 3KP4A 2VT3A 4LB5A 5E8IA 1K6OA 3KLOA 1FWZA 2MC3A 1XSVA 3J80Z 3GEZA 3VEPA 3W6JB 2KIUA 1IN5A 5FB2A 1FPQA 2DK8A 4O5VA 2VODA 4IRIA 1B6AA 2MA3A 1R22A 2GZWA 4PDKA 1SFEA 1BM9A 5D6FA 2J5OA 1BJAA 2HS5A 4KDPA 2KKOA 5CVUA 4ZYHA 4HZFA 5J6XA 2CG4A 1Y0UA 4IXAA 1GXPA 2EV0A 1G3TA 1J0RA 3H3ZA 1B1BA 1KA8A 4S05A 5H6RA 3K2ZA 4RB1A 2PN6A 3RYPA 2IA1A 5FD5A 3TQNA 4L5IA 4OIQF 1MJAA 2FEZA 4EGYA 4OOIA 2HEOA 5HLIA 5CYVA 1SD4A 2ZKZA 2FU4A 3JSOA 3JAMK 3E6CC 2L01A 3DFGA 1GHCA 1S29A 1IRGA 3E3VA 5E18F 4YG2F 3NEUA 1JGSA 4LG0A 3SHFA 1F1ZA 2PI0A 1OPCA 4LK1F 1YW9A 3GYHX 1FYKA 4I7HA 4M9SA 4I01A 4HA8A 5FGMA 2ISZA 1O7FA 2QYOA 5JHUA 2VONA 2BE5F 5L3GA 2PG4A 2PQ8A 4OMYA 1FOKA 4MQ9F 2K7LA 1HW1A 2VOOA 2IJLA 1HKQA 3V8JA 4I0BA 3GW2A 1MD0A 1BI2A 4A0ZA 1RZ4A 3IRQA 4RB3C 2D1HA 5F6FA 3R4KA 4I98B 3BP8A 3LAPA 2QM3A 1WKMA 4H0EA 2VBYA 2XIGA 1HQCA 3EYYA 1KU7A 1YYVA 4XBFA 1IXCA 3ULQB 1T38A 2P7CB 3J81Z 2RN7A 1R1UA 3LSTA 5BMZA 2O03A 2Z33A 1REPC 4CGZA 1LEAA 5D4SA 1W7PA 5D4RA 3QAHA 5E20A 1GVJA 3G73A 1LB2A 2JTVA 3BY6A 5HVQC 2EWNA 2W25A 3FMSA 1E17A 1CGPA 1ZARA 4EGZA 1ZRFA 3F8MA 3GFIA 4P9UA 2EA2A 2FNAA 1F5TA 2DLLA 2IP2A 1U78A 3IC7A 1P6RA 2X4HA 4KNYA 1YS7A 1J2XA 4YIIA 1G4DA 4PGHA 4GYGA 2XAGA 3WU0A 4HLYA 3RDIA 2Q0OA 1JHHA 5LRRA 4L9TA 3U9GA 3G3ZA 1AWCA 1BIAA 2PJPA 3ZN0A 4BXUA 3HHGA 5J8CA 4I0AA 3P9KA 3M8FA 1QPMA 3M1EA 1O57A 2RNJA 2GA2A 1STZA 1D8JA 1HSTA 4A6DA 2FNPA 1FY7A 5DD4A 4M6XA 2H09A 5L3CA 3QPHA 3TO9A 4GCVA 1U6GA 1HBXG 3PFIA 4R8HA 5L3DA 3U2RA 5DYMA 2BYVE 2HYFA 5F64A 1UHWA 3WTZA 3EDPA 4U0VA 3FF5A 4BAYA 2PEXA 2JPBA 3TDUC 3HYIA 2FQ3A 2D1VA 4KIFA 3T5XA 4KA4A 2EB7A 2A07F 1TLHB 1FP1D 3VFZA 2ZMEA 3GLXA 2CW0F 4ESJA 3ZP5A 2RC4A 1P4XA 4QWQA 3RYRA 3F6VA 3ZMUA 1XCBA 3RIRA 5E1ZB 1R23A 3U1DA 3IRRA 5A2QZ 1ZYRF 2G7HA 2M5WA 3WE2A 4ZYGA 2ACJA 2KIMA 4IPAA 2VBXA 1UHMA 1B59A 1G6NA 3V8LA 1OKRA 4ON0A 1YFHA 2LKPA 4JK1X 4MTDA 1ZH5A 3L00A 2NYXA 2A3SA 2JPCA 2DI3A 4HOBA 1K7AA 5BPDA 1G3WA 2DQLA 3QP5A 1KQ9A 5D5XB 4Y15A 2W84A 4HDUA 5D6EA 1YTYA 1EH6A 1LJ9A 4JQFA 4RGXA 1Z05A 5EEGA 4U88A 3ROUA 2NNYA 4D0PA 4HF0A 4FX4A 2D45A 3T8RA 5ILSA 1ZRCA 2CO5A 2EFPA 2AS5F 4Y17A 1MJ9A 5E17F 5E8GA 1R1VA 3KZYA 2EFOA 2DK5A 4ZH4F 1VTNC 3BJ6A 2EFWA 5K5QA 5ICCA 1SD5A 1FC3A 2CWEA 4LLGF 5D8LB 4N0BA 2MH9A 1B4AA 1UCRA 2HYGD 4CYDA 5AONA 1QZZA 4G94A 3RPQA 4LFUA 5CVIA 5LHIA 2XRNA 3BDDA 3DKWA 2QZ8A 3J7AO 1D5VA 5L3BA 4U7DA 1I1GA 1K78A 3TGNA 2M30A 2H27A 2Z3YA 1YW7A 3Q9SA 2BEOA 3PQKA 3WE3A 1ZG3A 2UXXA 4EVIA 2G9WA 1S7AA 4M71A 2QUFA 4BHBA 2GWRA 3O6BB 3H3UA 3F72A 4AIHA 1AOYA 1FZPB 1Z9CA 3F21A 2B0LA 5LRSA 2OQGA 2JT1A 2TDXA 3I0TA 4KT5C 6PAXA 1Z1DA 3WTWC 4WWCA 3ERED 4Y13A 2XASA 1FBSA 1YLFA 2ZNZA 3ZMZA 1KYWA 4MHGA 4KN7X 4RAYA 5CLSA 3GFMA 2WC2A 2J5PA 1LEBA 1OR7A 3WODF 4BQAA 1TQPA 1U8RA 3ABUA 1WRJA 1IN6A 4RGSA 5D8KB 2ESHA 3T0YA 4S04A 2P4WA 1S7OA 3K0LA 1RI7A 2HTJA 2FMYA 3IWFA 2Y48A 4R1HA 3FZVA 2FBHA 4MTEA 1U2WA 2DTRA 2PMHA 3FMRA 2DFIA 3I5UA 4G6DA 3O3KA 4LJZF 5FLXZ 2DU9A 4DQ2A 2JSCA 4WF2A 1G3YA 1K79A 1IRFA 5ILUA 1LDKB 4WXCA 4HLXA 1T2KA 3KEQA 3JTHA 4Q5SF 1SFXA 1U3EM 2ZMEB 5HLGA 3K1MA 3OOPA 2PLYA 2IA2A 4Q47A 1FSHA 4XLNF 2EV6A 1BI1A 2PBIA 1ULYA 4L0ZB 1X3UA 5ICEA 4FX0A 1KQ0A 3EYIA 1U5TB 3KE2A 5CVJA 2ZBKA 3VB2A 4AVPA 4A0XA 1K78B 1FNNA 3FMQA 5TRDA 5DCFA 1IW7F 1TBXA 2WV0A 2NS0A 1XDSA 1KQ8A 3LWFA 3CUQB 4M9ZA 4NHJA 1YO5C 4G9YA 3GWZA 3KP6A 4KUMA 1BN5A 1ZG5A 1WQ2A 5JFRA 2XROA 3KFWX 3C1DA 1XD7A 2ETHA 4RAZA 3LQRA 3KEOA 1PP7U 3V7CA 1Z91A 3IKVA 1WWXA 1T6SA 2H6BA 3I4PA 4FT8A 3IHUA 1LVAA 1O3SA 1IN7A 4QLCU 1HKSA 4EQQA 1YIOA 3R0AA 3I59A 1IXSB 3GUDA 1TQIA 1UB9A 1YW8A 2XVCA 3MZHA 1IAWA 1IXRC 2LNBA 4E70A 3T1BA 3F8CA 2R3SA 3V8KA 4ESBA 4RGRA 4MQVA 3E6MA 3TOBA 2VBWA 3KP5A 4F7ZA 2F2EA 1YS6A 1H9TA 1USTA 3JTGA 2ZFWA 1V3FA 2HQNA 4EV0A 2F5EA 4HX8A 1JHFA 1R00A 1SMYF 4BYYA 4BNCA 3F8BA 1W4MA 3MWMA 2X0LA 4U0YA 3HHHA 2VC0A 4IRGA 5IT3A 2STTA 1XGSA 2Q2EA 1XB4A 4TV7A 4HV6A 1F9NA 2L54A 5ED4A 1XGMA 1IN4A 2NNNA 3EUHA 5E1WA 3REOA 3KP7A 2GQQA 4YFXF 3MFKA 2M1BA 4GYIA 3CUQA 2A61A 4ENMA 2RDPA 4XSXF 3MQ0A 3GXOA 5FLXK 1DUXC 2ZXJA 3RKWA 5LEKA 3LA7A 1MJBA 5DV5A 4P55A 3WTUC 3RPUA 1ZN2A 3MAJA 2HDCA 4ENJA 3R0JA 4XRFA 1XDUA 3HSRA 2XAHA 5FD6A 5LBQA 4G7ZF 2E1NA 3L2CA 1TW2A 4CDGA 1KGSA 1D3YA 2YSRA 1EH7A 1QNTA 4BHCA 2OZUA 2VT2A 3VODA 1BC8C 4M73A 1ZGJA 2HR3A 5BQTA 2KRFA 4KICA 4CHUA 2A6EF 5DD8A 1QGPA 2NRAC 1P2FA 4M6YA 2DT5A 3D5LA 3CDHA 3DPLC 2F5CA 5DUIA 2OA4A 1J59A 2UXNA 1I6XA 4LG0B 5HS9A 2XKOA 2GIVA 1RUNA 4KMUX 3E5UA 5FFXA 3ZPLA 5HDGA 2F5DA 3FXUA 1HSJA 5FFZA 4ZZDA 5BS6A 4O6JA 1C0WA 4N9HA 4Q4ZF 3TO6A 2GXBA 4IJAA 2P5KA 3HRMA 4RGUA 4OIRF 3JAMZ 2FSWA 1J75A 2EJRA 4L0YB 3K1PA 3BPXA 4EM0B 4KFCA 2FMLA 3LA3A 3ISPA 2W24A 4HV5A 5EEHA 2CGPA 2ZNYA 2E1CA 2V6CA 1ZLKA 2EV5A 4JBAA 4U7BA 2L4AA 4DNCA 2P5VA 3WTXC 4LGWA 1W5SA 3KETA 4HF2A 1XGOA 3GZ6A 3GVAA 2DW4A 2FOKA 1XSDA 5TJJA 2QVOA 1CF7A 3ZN1A 5LGNA 4HAMA 2QLZA 5D5WB 2ESNA 2XGXA 3R61A 4L9JA 1R5HA 4I09A 3Q5FA 1OYYA 3EQLF 4M74A 3ZMVA 5AIQA 2EK5A 2LF7A 1XMKA 3WG9A 4ESFA 4ZYDA
chains in the Genus database with same CATH superfamily
3E7LA 3DF8A 3GX4X 2LKXA 5F0CA 1P7IA 3S2WA 3OSGA 3SDBA 1NK3P 3AG2H 4L5JA 1UG0A 1KU3A 3ECHA 1HLVA 4UVCA 1ZRDA 2ZJ2A 1USSA 1Q1HA 5IYCJ 1DPRA 4G6QA 1E3OC 5HLTA 4EM2A 1ETYA 3SEQA 1IDYA 4IOAF 1J7KA 1Z77A 2GBYA 3PSFA 3MEXA 1MBHA 4IHTA 3FXQA 4P5OA 1MH4A 2RQPA 3SXYA 3CCRI 2LDUA 2EZHA 3OL3A 5HLHA 5IT9K 4ENNA 5C3EJ 4EJVA 2VUMJ 4B44A 3DCFA 3R60A 1OQYA 5GPAA 5J1YA 2YX4A 3VOEA 3HUGA 1PVEA 2E19A 1MDMA 3HOVJ 3HXLA 3Q0WA 1SANA 2LYCA 4HQMA 1SC7A 3IL2A 2R92J 5FKOA 3BG7A 2QBYA 3DP7A 3IWZA 2CUZA 5J4YA 2JA8J 1U0JA 2A68F 3C2HA 1YX5A 5HS8A 4CXFA 1YX3A 4IQ4A 5ICGA 1R36A 4IKFA 2VKVA 5E79C 2YU9J 3L9FA 1J5YA 1ETXA 3GO5A 3V7RA 3CUOA 5FKNA 3S3MA 2BY2A 1X1CA 2HFHA 2O8XA 1SFKA 1A04A 3I54A 3KP3A 2EFQA 2R5YA 1MGTA 5TISC 1Z6RA 1PUFB 3BLYA 2FE3A 2KRCA 2DPDA 1VNDA 5BNGA 4AU7A 2V79A 4EJTA 2FA5A 4OMZA 1ETVA 2BV6A 1BBYA 2K27A 2P7VB 1ZLJA 1QVUA 2K02A 3WGGA 3T8TA 4BE2A 2VQGA 4ZTFA 3I64A 2DMPA 3C18A 2K4BA 4LIUA 2H8WA 4AM3A 1D0YA 3CZ6A 2DPUA 3OY9A 3MVPA 4B48A 1ZHFA 3OWTA 3BC8A 1CQTA 4KIGA 2H6CA 2HVSA 3H5NA 3SZPA 1J9IA 4HDVA 2YX7A 5JVTA 3HTUA 1E2XA 1PUFA 1GLNA 3GTJJ 4UVBA 4OIOF 2FOWA 3G71I 4GGGA 2LREA 2OCEA 2KT0A 5LEJA 5KVRA 3GLLA 1L3LA 4CCLA 1TT0A 3P9IA 4B8XA 3E97A 1ACIA 2ZCWA 3EUKL 1XCVA 2KDOA 2VBZA 3JW4A 2IS4A 5DEQA 1ZAOA 3BTIA 2WAQA 1IV8A 2ELHA 3KP2A 3TW7A 5IYBJ 2W1OA 1H9GA 5EZHA 2VXZA 2KPMA 1U9NA 2DBBA 4EJWA 3JCUC 4RDUA 4BJ5C 2KJCA 1LDJA 2C6YA 4KMFA 3BOQA 2V1UA 2ZXWH 4G8XA 3FXRA 3JR9A 1IF1A 4DGWB 2AXLA 2Z16A 1XMAA 3WTSC 2LF8A 3EPZA 1W5TA 2IBDA 3O8HA 3F8NA 1L0OC 2NS8A 2X1DA 3F0CA 1WJFA 1FP2A 1RKTA 2VB6A 3WGIA 2AXTC 2R7FA 4MFDA 4ASNA 5B66C 3LFKA 1N77A 1U8BA 3GFJA 5LD2C 3JSPA 3ZMDA 3OR1C 3K69A 1IZ1A 3ZRGA 3QWLA 1ETWA 3OOUA 2HTSA 3W6VA 4O3MA 2L3DA 3BJOA 4RB2C 1F43A 1JJ6C 1RIOH 1HC8A 2WWYA 2UWMA 5DUKA 4CCOA 2CSOA 3FM5A 2Y75A 2HQRA 2Y0MA 4A5NA 3PIPF 1GV2A 2E7XA 3FK6A 3HTSB 2TCTA 3CTAA 3RPUD 4KN4X 2EA4A 2MLGA 2V9VA 2V1NA 2V9KA 3B02A 4R79A 1ON1A 1JXSA 3E5XA 3FXMA 4BXFA 1DU0A 5FKLA 1VQ4I 1IUYA 1RQ6A 4OINF 1PUEE 2L02A 4A3EJ 5ILVA 1X4PA 2IS1A 1JT0A 3ELKA 3P5JA 4HPQA 2PMUA 2WY8Q 2MW8A 3AL0B 1T39A 2CUJA 1WJEA 3KCCA 3QYBA 3RCOA 1D1BA 3J7ZI 3HOSA 2M87A 3HRUA 4Y3OA 2CQKA 3RI4A 4HX4A 4HRIA 1IN8A 1TZLA 1EKEA 4WXDA 1ERDA 2G7UA 1LNWA 1X1BA 3J81K 4KJZA 1BA5A 2H1LA 4XNFA 1I39A 3EUAA 4C9YA 2Y9YA 3K9TA 4UHTA 1SVOA 2E7WA 4BE0A 2ME6A 3GF2A 3LSMA 5K7ZA 4D1QA 2IEKA 5E3MA 4IRHA 3IV5A 1NHAA 2DCEA 4GO1A 1Z7UA 2HKOA 2ME0A 2JRTA 3G1OA 5HS7A 2K9QA 5LHHA 2VE9A 4YFNF 2JUCA 4ZYEA 3QOEA 2RAEA 2STWA 5J8FA 4M9XA 5E1XA 3NQOA 3L1PA 1KYZA 2Z99A 2DA1A 1BC7C 2MD5A 1ZR4A 2MUNA 1IC8A 2CYYA 1TW3A 2BY0A 3SFIA 3AG4H 3HIFA 3DQVC 3HOTA 5IOZA 3DKYA 2WBMA 4LD5A 1YQAA 1FSEA 5ICFA 3W3CA 4NB5A 4QPQA 1YJ9I 3JAMR 2LKSA 2KIFA 2XUBA 2XF6A 1DPUA 4P96A 4I02A 1WH5A 2LR8A 4A12A 3KEYA 4FE7A 3A02A 3CC2I 2K86A 2L7FP 2WADA 4WX9A 2IGKA 1QBJA 3PUBA 2BXYA 3K2AA 2CRGA 5BPIA 4UXNA 1WJ5A 3TW6A 2R5ZA 3OS2A 5FRMA 2R7DA 4XOTA 1P4AA 3HOWJ 4MNUA 3S1QJ 2BHZA 3H0DA 2IA0A 4E7KA 3FXOA 1LVKA 1T56A 3I3LA 1ODDA 1FMVA 3ZXSA 4OU0A 4CYCB 3CLOA 5K5OA 3F23A 4XMYA 4ANJA 2HOEA 2DO7A 4BJTA 5FLVA 1JE8A 2Y69H 2XAJA 3H5AA 1FBUA 3KYCB 2LVSA 4E4HA 3JRIA 1Y1VJ 3QPTA 3OYJA 3CF5F 3AKZA 1FTTA 2ZXIA 2OD5A 4HW0A 5DTDA 4AYBN 3DV8A 9ANTA 4RM2A 4HYEA 3O8GA 4A3DJ 1B9MA 3S2DJ 1I6HJ 5HNFA 3V42A 3KYDB 4JX6A 4W97A 2HWVA 1ZG1A 4EM1A 2D2WA 5H6QA 4DOZA 1VF9A 1XC5A 4IF4A 5DM7F 3H9JA 1WGXA 3PQJA 2F4OB 2FJ1A 1UFMA 3FM3A 4DYQA 1W7PD 5CJ9A 2X1EA 3NWSA 3QODA 2M4GA 4Y4RA 3F8FA 1SMTA 3MZYA 3SYTA 1LFUP 2HKXA 2VOPA 4UUVA 1FEXA 4QSHA 2GXGA 3FHNA 4EJUA 5GAEJ 4KISA 5IT9R 2QQAA 5J1RA 3CO6C 2XPUA 1R5GA 1P4WA 5LGTA 4HQEA 4BQQA 1G3SA 2KMUA 1MMGA 1O3QA 1QZYA 1EV7A 1OYWA 3E6DA 4FHTA 3M8JA 4BU2A 3S17J 1FTZA 3FWEA 4BL0B 2FBIA 1WI3A 1OYIA 1U5TA 5D5UB 2OUMA 3KZIC 1HOMA 4JX4A 3RKXA 2DODA 2PMZN 3DEUA 4XLHA 1SVMA 2A6HF 3A4CA 5EGOB 3AG1H 4LG3A 3ZQLA 3CD6I 4LITA 3DPTA 4CCNA 1XS9A 3V4GA 1MBKA 2Y30A 2ZO4A 1GXQA 1OLTA 5IT9Z 1I27A 1IUFA 1PDNC 1X3WB 2LC2A 2DA4A 5JR3A 3C2BA 3LSRA 3L2UA 2OV7A 4HX7A 1SAXA 3H92A 2M45A 1LFPA 4CH7A 3CUQC 1EF4A 4UV8A 1S3JA 2V1DA 1K4SA 1YG2A 2YR2A 3PNTA 3QU3A 1RUOA 3AL0C 3HGGA 2EINH 5HOOA 3ECOA 1OMIA 5CVVA 4ENKA 3RKQA 2Y31A 3P9CA 3S15J 2IRFG 5LHGA 4CCKA 2JA2A 2Q2EB 4DZPA 1E3PA 3IH2A 3ZMTA 5IOYA 2DA3A 1MMDA 3QYEA 3SEZA 4MEXF 2GXAA 1QO0D 2M35A 2VKDA 4IVNA 4IHWA 3GZNB 1XSXA 4L9VA 2K3FA 2OPTA 3TO7A 4F93B 3WU1B 3J7AW 2ELKA 3BG6A 2L0KA 2ZSIB 3I9V2 1ZGAA 3LA2A 2LBFB 1R58A 3MMYB 3HRSA 3CC4I 2OQRA 1HW5A 2O61A 1F4KA 1R7JA 4BQNA 3CO7C 1R1TA 4U0WA 2HPMA 5AIPA 1KU9A 3PL8A 5F04A 2KDZA 3Q0UA 2IS2A 4HBLA 2F5VA 2MBFA 4OIPF 2XAQA 1FYMA 3M3YJ 3TKYA 3GTPJ 4A6EA 4KIBA 4K2EA 1O3RA 5HDKA 2IAIA 3ML6A 4A5MA 1T0FA 5BOXA 1P92A 5GAGJ 2LLKA 3KLNA 5HDNA 2F48A 3JRAA 1BI0A 1X1PA 3NRVA 2DOEA 5EGOA 2VQHA 1LDDA 2K9LA 1FBQA 4G12A 1BR4A 4CICA 2WTEA 4Y33A 3ABLH 3OYEA 4HG2A 4LK0F 4LOCA 4ETSA 5KK1A 2X6WA 3ZQGA 2M7BA 2EPFA 4WK8F 3M8EA 1MBEA 3K4BA 4OWRB 3I53A 1TNTA 1XGNA 2XF7A 1I5ZA 1SEUA 2DQRA 2WB1A 2CQQA 1TC3C 3OS0A 3EETA 2AHQA 2VN2A 3HJEA 2W57A 3OV8A 2KJBA 3CF2A 4I99C 3K10A 3WGHA 4AIKA 2LG4A 1V4RA 5K5RA 4DYRA 2L4MA 2XV4S 1B9NA 2MH2A 3I58A 5CVRA 3RKYA 1ORKA 1CF7B 1H0MA 2P5LC 2RKHA 3BPVA 4PJLA 1TP4A 3AAFA 5LFAA 1FLIA 3FHZA 4XLCA 3L2WA 2A05A 1R4NB 3ABMH 2RV8A 4GXOA 3VYRB 3FK7A 4EATA 3LNQA 4Z6YA 2GAUA 3H9GA 2R5YB 3ZMSA 1BOAA 2XKPA 4IHSA 4AVZA 3TEDA 4LLLA 2B7EA 2HZTA 3ZQIA 2P6SA 3HOYJ 2FF4A 2W85A 2IPQX 3LQQA 3J80K 3CCEI 3MCZA 3A52A 4BGDA 2OZ6A 4CZZA 3M9AA 3C2GA 4A3MJ 3CCJI 1JKQC 2NAZA 3CCVI 4MGRA 4D9JA 3M7GA 3DU5A 2BBYA 2RGVA 4GFBA 5GTIC 2DAOA 1EH8A 1Z6TA 3GTGJ 2JQ7A 4PZJA 3E5QA 4DBQA 1G8XA 3VYSB 4MLOA 3LSPA 2M7AA 2AO9A 4L9NA 5DCMB 2EZLA 5JHFA 2NXNB 2M0CA 3HG9A 5H2FC 1DU6A 4A3BJ 3MKYB 2VJ5A 4LMYA 4CUGA 2COMA 1MMAA 1ONVA 3PSIA 1F36A 1BR2A 3KZZA 5GP9A 2IW5A 1W0UA 4N9IA 5EZGA 4NQWA 4EJOA 3MKLA 4FISA 1T98A 3D5RC 2QBYB 2FXAA 4XRSG 2KFDA 5FO5A 4XONA 3S32A 4XOPA 3KYLA 4C30A 4NC6A 2V26A 2PFBA 2X9DA 3BTJA 2OAZA 5JI6A 2XHKA 3GTKJ 2W7NA 2HDWA 3HSFA 2IT0A 4CA0A 3G6EI 1HCRA 2ZSHB 2LRDA 5DS9A 4J01A 1VQOI 2E60A 3VYTB 5DDGA 1ZTRA 2XGCA 2IXSA 1T33A 2O0YA 1P9QC 2IS6A 3BZ6A 3TDZC 2PJRA 3BROA 3QU6A 3HRTA 3TOAA 1TNSA 2F4MB 5F1RA 4L18B 1ITYA 4YIRX 1FYLA 4FE4A 3HKZN 2CFXA 2LK2A 2QQBA 4A93J 3C3WA 2MFZA 1O7LA 2OU2A 3CMEI 2K9SA 2JA6J 1VQLI 3FX3A 2ADUA 2VLAA 1HDDC 4A3JJ 4ZZLA 2F5FA 2O3FA 3LAJA 4WCGA 1X58A 1V5EA 3HM5A 5M5XJ 1XN7A 2ZJPF 1KU2A 4E7SA 3V7SA 1S8NA 3CP8A 1HA8A 2M8EA 1DP7P 3CCYA 4E7JA 1YHQI 5J3LA 3JRGA 1A35A 1K6YA 4PGGA 3I59B 3BZKA 3TBIA 2NVXJ 4E7IA 2Z9OA 1MZBA 3HB9A 1A31A 1FX7A 4WXHA 3CESA 2DFEA 1Y1WJ 4ZDPA 2LY2A 1JKPC 4Y52J 1Z67A 2FBKA 4CCMA 4D7NA 1MSFC 2JWTA 2XSJC 3HPGA 1IGNA 1FOYA 1ZQ3P 1R9TJ 3F22A 1IRZA 3ZGKA 4EMSA 1FJLA 1U5TC 1FT9A 3E6BA 3D0SA 5KNLA 2EBIA 3WTTC 4A2UA 2ISYA 1Z3XA 4XLPF 3A01B 1W7PB 3TP3A 4C3HJ 4A0YA 5A2QK 2XAFA 3JRHA 3WTYC 2LTPA 1TWFJ 3CLQA 4CZCA 5ERIA 1Y0NA 3QPLA 2EILH 2HGCA 3W2AA 2O6GE 3K70C 2HPIA 1T0FC 2E1MC 1W1WE 5CQGA 4IHXA 4RB0A 3OYKA 3G2BA 1VQ7I 1J09A 3SFZA 1PP8F 2W82A 3O2PE 4OAZA 5E3LA 4BY1J 4UV9A 3RJPA 3H35A 2E5ZA 3F6OA 3QP6A 2HVRA 4KYWA 3QRFF 4FTHA 1D5YA 2Q1ZB 5L3FA 5M3FJ 4XICA 4BHPA 4YFKF 1SD6A 2DYRH 3COAC 3BG3A 4YEJA 4AWXB 2QQ9A 4V2GA 5H20A 4E7LA 4OAYA 4HNUA 2XF5A 3IKTA 1HKTA 2P0TA 1YJWI 3HSEA 2A69F 3BJAA 1SFUA 1MKMA 1BIBA 4PCQA 3DXJF 2JZYA 2A5YB 2Q8KA 3M1CA 4P9FA 3NARA 3RTRA 2RREA 1A5JA 3ZQ7A 3GCMA 3JRCA 2E1OA 3BWGA 4BH9A 2LSOA 5EJCA 3ASNH 1S6LA 2QKLB 2OF7A 5M5WJ 3OYBA 3UNGC 1TQMA 1S72I 1G59A 3ONQA 3HZJA 1NTCA 3L7WA 3P7NA 1HXDA 2KQRA 1WSUA 4B09A 2EFNA 3F3XA 4F91B 2HXIA 3SZTA 3ABTA 3CJTB 4LB6B 2KHMA 4FQGA 2JRMA 4RS8A 2JJ7A 2ZB9A 3SQNA 4QTRA 4UVAA 4QPOA 5DCMA 5KAFC 2P8TA 4LLNA 1DDNA 3CJNA 4AD9A 2ID6A 2GM4A 3S14J 3KIOA 4I2OA 2R7RA 2LY1A 3GBGA 4YIFA 1ZELA 3DBLB 5LGUA 1IO2A 4BE1A 3IAM2 2OBPA 2M9HA 3C7JA 2QQ8A 2YPRA 3ERMA 4XSZF 4HF1A 1I1SA 1X1AA 3FXJA 1O3TA 1UELB 2K3PA 4UNOA 4BEHB 2VQCA 2R7OA 2MLKA 2MD0A 3WG7H 2YU3A 5K1YA 2JUGA 3VSKA 1JKOC 5L3EA 1X4OA 3K1NA 3QOPA 1RKWA 3PO2J 2P6TA 4B3XA 4G7OF 2V1XA 3ZCOA 2IGNA 3Q9VA 1ON2A 4BJ6C 2TRTA 1JUPA 2CQNA 5HNHA 1MDMB 1X2MA 2VKHA 4BKXA 1SD7A 1LQ1A 2UZKA 2L7KA 2P0WA 3LL7A 5B5EC 3K4LA 2X6YA 2IVMA 3BR6A 3GZ5A 3ZR8X 2FRHA 2VE8A 3TP0A 2P81A 2GA1A 1RNLA 3L09A 1OFCX 4G7HF 3GFLA 2RVCA 4X0GA 1ZREA 2K4JA 4C2MJ 1UG2A 2EQRA 3H36A 1OCRH 4CO8A 3JRDA 4BDZA 1QZEA 4MEYF 3N97A 5D5VB 3WTVC 3N4MA 1D8KA 1WI9A 1HW2A 1VFCA 4ZYAA 4C2UA 3U21A 2OC6A 4AIJA 1TTYA 3G1MA 2VC1A 2QENA 4Q48A 1TWGJ 4W1UA 3W6KB 2KISA 3VSLA 4M72A 2BGCA 1T8IA 2BW3B 2L9VA 3R6SA 4IL6C 4JYKA 3X2QH 1QQIA 3G4SI 2QWWA 3CCMI 5LLQA 1BI3A 5J40A 2H94A 1QRYA 2M3AA 2MC4A 4Z2YA 3I71A 2Z5UA 3B73A 3KP4A 2NVTJ 1E3HA 1AKHA 3BG9A 4H4KC 2VT3A 3S93A 1WPKA 3BR5A 2F4IA 4B47A 4LB5A 5FROA 5E8IA 3IH4A 1K6OA 3KLOA 5F08A 4ZDLA 1MIJA 1PJRA 2NVYJ 1S5LC 2WAEA 3ZQHA 1FWZA 4V2FA 2MC3A 4F92B 3BR0A 1XSVA 3J80Z 3GEZA 4HNVA 1POGA 4XKCA 3VEPA 2OCCH 3W6JB 2KIUA 1IN5A 5FB2A 1FPQA 1XG1A 1JGGA 1IDZA 2DK8A 4O5VA 2ZJRF 4XK4A 4UUSB 2K5CA 2E2JJ 1OCPA 2VODA 4IRIA 4RMNA 1B6AA 2MA3A 1R22A 1Q1VA 2GZWA 4XN3A 5GAHJ 2DDAA 1XMXA 3A03A 3TL4X 4PDKA 1SFEA 2DA5A 1BM9A 2WV1A 4M3GA 1D1CA 5D6FA 5K7FA 2CUFA 2J5OA 3H0GJ 1QA6A 3SZGA 2KP6A 3RZOJ 1BJAA 2BZTA 2HS5A 4KDPA 2M0MA 1LUJB 2KKOA 5CVUA 4ZYHA 4XRMA 4HZFA 5J6XA 2R7TA 2CG4A 3S1MJ 1Y0UA 4IXAA 1GXPA 2EV0A 2FUG2 3U1KA 1YIJI 2DMUA 5EDNA 1G3TA 5CQEA 1J0RA 1FOWA 1O4XA 3H3ZA 1B1BA 4ZDOA 1KA8A 1LE8A 4S05A 5H6RA 3K2ZA 1Y39A 5FLMJ 3FKJA 2DN0A 3GTQJ 3HUGB 4RB1A 2PN6A 5B1BH 2VXDA 3RYPA 2IA1A 1BR1A 5FD5A 4RLFA 3TQNA 4L5IA 3FDYA 3BR3A 4OIQF 1MJAA 2FEZA 4EGYA 5IPAA 4E7ZA 2AQFA 3DBRB 4OOIA 2HEOA 2IGMA 4XLFA 5HLIA 4B3AA 5CYVA 1BOBA 1Y6IA 3WU2C 1JKRC 4JP0A 4FASD 1SD4A 1BL0A 2ZKZA 2FU4A 3JSOA 3JAMK 2DT6A 5EG0B 1QU3A 3TMOA 3E6CC 2L01A 2LH9A 3BG5A 3DFGA 2X98A 1GHCA 1S29A 1OJLA 4F3QA 1IRGA 3E3VA 1FIAA 4XORA 2BOLA 5F0HA 4YG2F 5E18F 4RM3A 2M2EA 4DIQA 4PUSA 5F1JA 3NEUA 1JGSA 4LG0A 3SHFA 1F1ZA 2R7ZJ 2PI0A 1OPCA 2DA7A 1YW9A 3DU6A 4LK1F 3GYHX 3H5RA 4E7HA 1FYKA 4I7HA 4M9SA 4I01A 4HA8A 5FGMA 1AKHB 2ISZA 1O7FA 2R7SA 4GRIA 2QYOA 2R4GA 2VKEA 5JHUA 2BE5F 2VONA 5L3GA 2PG4A 2D5VA 2PQ8A 3K4MA 4OMYA 1FOKA 4BBSJ 2E1MB 2LP0A 4IHVA 4XL9A 4MQ9F 2K7LA 1HW1A 2VOOA 2IJLA 3PNVA 3M4OJ 1HKQA 4ZTJA 1XX5A 2E5NA 4M3DA 2E2IJ 3V8JA 2EIJH 4I0BA 3GW2A 2QSHX 1VQ8I 1MD0A 2L7MP 2QSFX 1BI2A 4A0ZA 1FIPA 1RZ4A 3IRQA 4LIVA 4II3A 3IAS2 4RB3C 3OL4A 4RAFA 1LFBA 2D1HA 5F6FA 2LBFA 3S1RJ 3R4KA 5IY5H 4I98B 1D1AA 3BP8A 3K7AJ 3LAPA 2QM3A 1WKMA 5FKKA 2DJNA 4H0EA 2VBYA 2VQLA 2XIGA 1HQCA 3EYYA 2AQEA 4PSWA 1KU7A 1YOVB 1YYVA 4XBFA 1BJZA 1IXCA 4NQWB 4A69C 1EJ9A 3ULQB 2V4JC 4KT6A 5FKMA 2CV0A 1T38A 2NVQJ 2P7CB 4GDFA 3S3OA 5IP6A 1WH7A 3J81Z 4YRVA 2RN7A 1R1UA 3RZDJ 3A0BC 3LSTA 3CQZJ 1KZHA 2O03A 2Z33A 5BMZA 3ESWB 3HL2A 1REPC 3OIQA 4CGZA 1LEAA 4QIWN 5D4SA 1W7PA 5D4RA 1VQKI 4MO7A 3JREA 2O8KA 3QAHA 3WHBA 4M3BA 5E20A 3ZQCA 1GVJA 2V7FA 1RR7A 2GIZA 3G73A 2DA2A 4IOCF 1LB2A 2JTVA 3BY6A 3PO3J 5HVQC 4XN0A 2EWNA 1I50J 1S9HA 2W25A 3DEWA 1UMQA 2VJ4A 3FMSA 5CPRB 1E17A 1IV6A 1CGPA 1ZKGA 1ZARA 3ZQQA 4EGZA 1ZRFA 3F8MA 1ZGWA 3GFIA 4P9UA 2OTJI 2EA2A 2FNAA 2K9NA 5FRNA 2DTZA 1F5TA 2DLLA 2IP2A 2XC7A 3BT9A 1U78A 4XKBA 3IC7A 1HDPA 1P6RA 3JRBA 2A6TA 1KONA 3FIWA 2X4HA 4KNYA 1YS7A 1J2XA 4YIIA 1G4DA 1Y8RB 2ZFUA 4PGHA 1E0EA 1W5CC 2I5UA 2CU7A 4GYGA 3HDDA 3OYCA 2XAGA 3WU0A 4DW6A 1V55H 4HLYA 3JRFA 2VPRA 1R6RA 2CV1A 3N05A 4V19K 3RDIA 2Q0OA 4KITB 1B8IB 3PIOF 1APLC 1JHHA 2G0EA 5LRRA 3MD2A 4L9TA 3U9GA 3A1YA 3G3ZA 1AWCA 2CJJA 1BIAA 1OISA 2A5WA 2VASA 2PJPA 3ZN0A 4BXUA 3HHGA 2COBA 2XB0X 2CS3A 5J8CA 1IRXA 2DMQA 3LSJA 4I0AA 3P9KA 3M8FA 1QPMA 4XQFA 4B1RA 4XM3A 1MH3A 3M1EA 3NWTA 4XKVA 5FLXR 4D5FA 1O57A 2RNJA 1X19A 2GA2A 3OR2C 1W36D 1STZA 2Y0SN 1D8JA 4UB6C 3CJQB 1DP3A 2KLOA 1DGWY 3PNYA 3RSNA 1HSTA 3OYMA 1ETOA 4A6DA 3OS1A 2FNPA 1FY7A 5DD4A 4M6XA 2H09A 4EEFG 5L3CA 2WAFA 2BHYA 5F27A 3QPHA 3TO9A 4GCVA 3FKIJ 1U6GA 4A3GJ 5KCMA 1HBXG 3PFIA 2QCOA 4R8HA 5L3DA 3U2RA 2OJED 2WA0A 5DYMA 2BYVE 2HYFA 5F64A 2X6XA 1UHWA 1WFXA 2JMWA 3WTZA 3EDPA 4U0VA 3HKZA 1SFOJ 2FD5A 3FF5A 4BAYA 2PEXA 2JPBA 3TDUC 1WVRA 3CCUI 3HYIA 2FQ3A 3K70D 2D1VA 4KIFA 3T5XA 4KA4A 2MABA 2EB7A 1V54H 2A07F 5EF6A 1TLHB 3F9KA 1FP1D 3VFZA 2XSDC 5J47A 2ICWG 2ZMEA 3GLXA 3CMAI 4FETA 2CW0F 4ESJA 3HPHA 2MG4A 3B6AA 3ZP5A 4C2TA 5CKTA 2RC4A 1P4XA 4QWQA 4UY8I 3RYRA 3F6VA 3B6CA 1XCBA 3ZMUA 3RIRA 1OR7C 2GOXB 5E1ZB 1R23A 3U1DA 3IRRA 3CP2A 2Y0SA 5M3MJ 1ZYRF 2BXZA 2G7HA 2M5WA 3WHCA 5A2QZ 2CQXA 3WE2A 4ZYGA 2HOAA 1WHUA 4HSRA 3HOXJ 2ACJA 2ZC2A 2KIMA 2L9RA 3LOCA 4PSXA 4IPAA 2VBXA 4BUPA 1UHMA 1B59A 1G6NA 3V8LA 5JVGF 1OKRA 3BCBA 3OIPA 4ON0A 1YFHA 3OYDA 3A0HC 1A36A 2LKPA 4JK1X 4MTDA 1ZH5A 3L00A 2NYXA 2A3SA 2JPCA 3S3NA 2DI3A 4PK4A 2R7XA 3CDIA 4HOBA 4IEJA 2V6EA 1K7AA 3E1SA 2QF7A 1G3WA 5BPDA 1VQMI 2DQLA 4BS9A 1MBJA 2JVGA 2DMNA 3QP5A 1BW6A 3DWLE 1KQ9A 3HBLA 5D5XB 1JT6A 4Y15A 1RC9A 2W84A 2DDBA 4HDUA 4UB8C 5D6EA 1YTYA 3GTMJ 3ZOBA 1EH6A 3BZCA 3FBNB 2VPLA 1LJ9A 1G2HA 4JQFA 4RGXA 1Z05A 3H1CA 4B4CA 5EEGA 1RESA 1W0TA 1YJNI 2MZ4A 3J81R 5J4VA 3S2HJ 4U88A 3FXKA 3ROUA 2NNYA 4D0PA 4HF0A 4FX4A 2L7ZA 2YS9A 2D45A 2WY7Q 3T8RA 1X2NA 5ILSA 1B72A 1ZRCA 2CO5A 2EFPA 2AS5F 4Y17A 1MJ9A 2B63J 4A3CJ 4AC0A 3VPRA 5E17F 2JVHA 2ECBA 2HVQA 5E8GA 1R1VA 3I4MJ 2HU9A 5FJ8J 3ASOH 3KZYA 1N75A 2PJRB 2ZJQF 2EFOA 4XRSA 2DK5A 4ZH4F 2CMPA 1VTNC 1TWHJ 1WJDA 3BJ6A 1NK2P 4N4OB 2EFWA 5K5QA 5ICCA 5B3SH 1SD5A 1FC3A 2CWEA 4LLGF 2E36A 1RRJA 5D8LB 4N0BA 2MH9A 1DGRM 1B4AA 1UCRA 2HYGD 3AFHA 5GPCA 2DT7B 4CYDA 5AONA 1QZZA 2JK3A 5B1AH 4XLEA 1MSEC 4G94A 4G6TB 2K9MA 3DKXA 3RPQA 4BBRJ 4LFUA 3S1NJ 5CVIA 4Y7NJ 2R0QC 2H1KA 4XKWA 3LSHA 5LHIA 2XRNA 2DOFA 1MBGA 2UV1A 3BDDA 3DKWA 2QZ8A 3J7AO 1D5VA 5L3BA 4U7DA 1I1GA 2Y9ZA 1K78A 3TGNA 2M30A 4HSTA 3I4NJ 5C4JJ 2H27A 1N78A 5EEAA 1ETKA 2Z3YA 5KAIC 1YW7A 2PMZA 3Q9SA 5IYDJ 5K7HA 2BEOA 2X85A 3SJMA 3VDXA 2JN6A 2LD5A 3PQKA 3WE3A 2XPVA 2HXOA 2E71A 4YELA 1ZG3A 1WCMJ 3S16J 3DEEA 5TGTA 2UXXA 4NDLA 3FISA 2HI3A 1I3AA 3BR2A 1T08B 4EVIA 1A6IA 4PJMA 2G9WA 2R7WA 2E35A 2HYJA 1S7AA 4MFEA 4RLQA 2HQ5A 3AG3H 3PJRA 4M71A 4M6VA 4UUTA 2QUFA 4BHBA 2FX0A 2DFFA 2GWRA 3O6BB 2N8GA 3RQ4A 3H3UA 2HQAA 1OCZH 2XDVA 4DBRA 3CDLA 2K40A 3F72A 4AIHA 1AOYA 1FZPB 5C4XJ 1Z9CA 5HODA 3F21A 2B0LA 3PFYA 5LRSA 2LOOA 2OQGA 2KZVA 2JT1A 2TDXA 3I0TA 4KT5C 6PAXA 1Z1DA 3WTWC 4WWCA 3ERED 1HF0A 4Y13A 3L2RA 4BXXJ 2XASA 1FBSA 1YLFA 2ZNZA 3ZMZA 3PUFA 4DZJA 1KYWA 4MHGA 4KN7X 1SVLA 4RAYA 4NC7A 5CLSA 4I76A 2HDDA 1XPXA 3GFMA 1UJ8A 2JSPA 3CCLI 5DM6F 1I3QJ 3NAUA 1BW5A 3KX2A 2WC2A 2J5PA 1VQ5I 1D0ZA 4XLAA 2XGDA 1QHHD 1JI8A 1LEBA 1OR7A 3OYFA 2HOSA 3WODF 2EIMH 4BQAA 4RBOA 1TQPA 2KZGA 4RA2A 2R93J 3OMYA 5GADJ 1VQNI 1WJAA 2XGEA 3ABUA 4NC8A 5M5YJ 1U8RA 2ELJA 3D5SC 1WRJA 2HOTA 1UHSA 4HNTA 1IN6A 4RGSA 5D8KB 3E0JB 2GLOA 2ESHA 3T0YA 1K61A 4S04A 2P4WA 3A01A 2VIXA 3KPHA 1S7OA 3BQYA 3K0LA 1RI7A 4BACA 2HTJA 1NH3A 2FMYA 3K4CA 3IWFA 2Y48A 4R1HA 2VJIA 1RR8C 2WB1N 2L9SA 3FZVA 1YRNA 3CJRB 2FBHA 2XRLA 4MTEA 1U2WA 2DTRA 2PMHA 3FMRA 2DFIA 2W00A 3HC7A 2XB5A 3I5UA 4G6DA 3O3KA 4LJZF 2F6CA 4S0HB 3CMMA 5FLXZ 2DU9A 4DQ2A 1LKXA 1MW7A 2JSCA 4WF2A 1G3YA 1MNDA 1K79A 1IRFA 3M07A 5ILUA 4CSWA 1LDKB 4WXCA 4HLXA 1T2KA 1D0XA 3KEQA 1R5ID 3JTHA 3Q3SA 4Q5SF 2CFOA 3OSFA 2HZDA 1QPIA 1SFXA 1U3EM 2ZMEB 5HLGA 1V5GA 2HNHA 3K1MA 1IG7A 2EZKA 3OOPA 2PLYA 2IA2A 1JTYA 4Q47A 1YE9A 5F0FA 4BY7J 1K4TA 1FSHA 4F55A 4XLNF 2EV6A 1AHDP 1BI1A 4CYCA 2PBIA 1ULYA 4L0ZB 2R7VA 1X3UA 4AIDA 3DBHB 3PM1A 5ICEA 1TT5B 3BTCA 4FX0A 3VYUB 1KQ0A 3EYIA 1U5TB 3KE2A 3ABKH 5CVJA 2ZBKA 1Z7LA 3VB2A 1H88C 2MYSA 3OYLA 2OTLI 4AVPA 4A0XA 1K78B 4C3IJ 1NG6A 4XIDA 2MGQA 1FNNA 3FMQA 5TRDA 3J80R 4JOMA 5DCFA 1JJ8C 1OCOH 1IW7F 3BCAA 1NG7A 3LMMA 4P1WA 1TBXA 1U9OA 5GTHC 2WV0A 2NS0A 1WJBA 2R5ZB 1XDSA 2M4KA 1KQ8A 3LWFA 3CUQB 4M9ZA 4NHJA 1YO5C 5A2QR 4G9YA 3GWZA 2EH3A 3I55I 3BTLA 3HGYA 2BW3A 2X48A 1RETA 3KP6A 4KUMA 1BN5A 1N25A 3H3VK 1ZG5A 1WQ2A 3G1LA 5JFRA 2XROA 3KFWX 2I8DA 3C1DA 1XD7A 4I6ZA 2ETHA 4RAZA 1GUUA 3LQRA 3IUOA 3KEOA 3V7CA 1PP7U 2CW8A 5IP9J 1Z91A 2L5QA 1WWXA 1T6SA 2H6BA 2W4SA 3IKVA 1ZK8A 3I4PA 4FT8A 2I10A 3IHUA 1LVAA 1O3SA 1IN7A 4C3JJ 4QLCU 1HKSA 1MNMC 4EQQA 4DJAA 1YIOA 4J19A 3R0AA 1V5FA 3I59A 1IXSB 3GUDA 2K85A 1TQIA 1QVTA 1MMNA 1UB9A 1YI2I 1YW8A 1VQPI 2XVCA 3MZHA 2V9PA 1IAWA 1IXRC 2LNBA 3GTLJ 3CMYA 3K4NA 1WJCA 3T1BA 4E70A 3F8CA 1MBFA 4A3KJ 2VI6A 3Q0VA 2R3SA 4II2A 3CCSI 3IH3A 2EZIA 3V8KA 4ESBA 4RGRA 3FXLA 2DFHA 4RAGA 4A3IJ 4MQVA 5E3OA 1YRNB 5C44J 3QPSA 2DXIA 3GTOJ 1OCTC 3E6MA 1UAAA 3D1NI 2LMDA 2NS7A 3TOBA 3HEFA 2O9LA 2VBWA 3HOUJ 2X51A 3KP5A 4F7ZA 2F2EA 1YS6A 1M1EB 1H9TA 2YUSA 1Z21A 3K4JA 3DLLF 1USTA 3CCQI 1XTAA 2LFBA 2WAQN 3JTGA 2ZFWA 1V3FA 2ZXHA 2HQNA 4EV0A 3QQAA 2F5EA 1R71A 1GDTA 4HX8A 1JHFA 2EIKH 2CH0A 4AUXA 1R00A 1SMYF 1Y56A 4BYYA 2DJIA 4BNCA 2CW7A 2X1CA 3F8BA 2O7OA 1W4MA 3MWMA 3J7YJ 2X0LA 3S8PA 4U0YA 3HHHA 2VC0A 4M3FA 4IX7A 4IRGA 3DPUA 5IT3A 4J00A 1XGSA 2STTA 2Q2EA 1XB4A 4IZZA 4TV7A 4HV6A 1F9NA 2L54A 2NOJB 5ED4A 1XGMA 1IN4A 2NNNA 3EUHA 5E1WA 3OYIA 3HOZJ 3REOA 3KP7A 2GQQA 2H8RA 2Z2SB 1P7JA 4YFXF 1PYVA 4A3FJ 4JX5A 3MFKA 2M1BA 4GYIA 2UUZA 3CUQA 2VL8A 2QA4I 4DYCA 2NVUB 1OCCH 1S7EA 4XR6A 2B9SA 2A61A 4ENMA 2Y2ZA 2RDPA 3QYFA 2ID3A 1ZR2A 4XSXF 3MQ0A 2ECCA 3GXOA 2NOGA 2E34A 3CC7I 4FCYA 5FLXK 2L2OA 3W2WA 2E2HJ 1DUXC 2ZXJA 3RKWA 5LEKA 3LA7A 1MJBA 5DV5A 1MMSA 4ZC3A 3VWBA 3OIOA 4B43A 4P55A 3WTUC 3RPUA 2BY1A 1ZN2A 3MAJA 2JA7J 5EG0A 2IGOA 3GMEA 1R4MB 1UZCA 4ENJA 2HDCA 3R0JA 3MN2A 4XRFA 1ETQA 3K6GA 4HEA2 1XDUA 3HSRA 5JLWA 2XAHA 2BVMA 3DTKA 5FD6A 5LBQA 1VQ6I 4X6AJ 2XAUA 1JUMA 4D5CA 1AA7A 3MKZA 4G7ZF 2E1NA 5JLXA 3L2CA 1Y8QB 3J7AY 1QHGA 1GVDA 1JUSA 1TW2A 2M34A 1VZ0A 4CDGA 1KGSA 1D3YA 3MZ8A 2YSRA 1EH7A 1QNTA 2QEXI 2QGUA 1SAUA 2OZUA 4BHCA 2VT2A 2CUEA 4PFPA 3VODA 2MSYA 2JA5J 4X1EA 1BC8C 3UKGA 4M73A 2GOMA 1ZGJA 2HR3A 3BQZA 3UR3C 5BQTA 3FBIB 2KRFA 4KICA 4CHUA 1Z3YA 2A6EF 5DD8A 1QGPA 2QSGX 2NRAC 1P2FA 4M6YA 2XPWA 2DT5A 3D5LA 2BY3A 2KIQA 2R7QA 4F52A 2DA6A 3CDHA 3DPLC 3SDGA 2F5CA 5DUIA 1H89C 2OA4A 3L2QA 1J59A 2UXNA 1I6XA 4IQJA 2W48A 4D7MA 4LG0B 5HS9A 2XKOA 4NUBA 2GIVA 3K4KA 1LE8B 4IO9F 3A2KA 1RUNA 2CQ7A 1GV5A 4KMUX 3E5UA 5FFXA 4ZJZA 2VJJA 3ZPLA 5HDGA 2F5DA 3FXUA 1HSJA 2DOAA 5FFZA 4ZZDA 5BS6A 4O6JA 1C0WA 4N9HA 4Q4ZF 1FOXA 3TO6A 2BVLA 1IJWC 2GXBA 1W36C 1TL8A 4IJAA 2P5KA 3HRMA 4RGUA 3OYHA 4OIRF 3JAMZ 1VI0A 5J1UA 2FSWA 1J75A 1JTXA 2EJRA 4L0YB 1FMWA 4MIMA 3K1PA 3OYGA 4ITVA 2RQQA 4AYBA 4PJNA 3BPXA 1ENHA 3DTIA 4PJJA 4BDYA 1R49A 4EM0B 1H8AC 2M8GX 3DLAA 4KFCA 2FMLA 3LA3A 3ISPA 2W24A 3I56I 2KL4A 5IP7J 1B8IA 4HV5A 5E3NA 4PJ0C 5EEHA 2CGPA 3ZQFA 2ZMEC 2ZNYA 3RQIA 2E1CA 2V6CA 1ZLKA 4M3EA 3DTEA 2EV5A 3IP4B 4JBAA 4U7BA 2L4AA 4NNJA 1T95A 1TWCJ 1MNEA 4DNCA 4IHYA 2P5VA 3WTXC 2RNGA 1GT0C 4LGWA 3BR1A 2X6OA 1W5SA 3KETA 2PX9A 3MKWB 4HF2A 1XGOA 1LPQA 1VQ9I 1Z0XA 3GZ6A 3GVAA 2DW4A 4ABZA 1WZ2A 2FOKA 1XSDA 3OYNA 4U87A 2QVOA 5TJJA 3W2VA 4CCJA 1CF7A 3ZN1A 2QKMB 2CV2A 3L2VA 3OYAA 5LGNA 4HAMA 2QLZA 4PFOA 4UUSA 5D5WB 1X1DA 1TWAJ 2ESNA 2XGXA 3LSKA 2FQ4A 1EA3A 3R61A 2DMTA 4L9JA 3EUHC 2KRHA 3H9QA 2R7UA 2O5RA 4A3LJ 1R5HA 4I09A 5KHDA 4NBQA 3Q5FA 1OYYA 1YITI 2DYSH 3EQLF 1AU7A 4M74A 3ZMVA 1DQUA 4E6KG 2L9NA 5AIQA 2EK5A 2LF7A 1A6QA 4BEHA 3LSIA 2MVTA 4L5EA 5EYRA 1XMKA 1B72B 3WG9A 1X3ZB 1RPWA 4ESFA 2LY9A 4BQOA 3LSGA 1K83J 4ZYDA 4N4NB 3LFUA 2Z1DA
chains in the Genus database with same CATH topology
3DF8A 3GX4X 3S2WA 4L5JA 1KU3A 3ECHA 4UVCA 1ZRDA 2ZJ2A 1USSA 1Q1HA 1DPRA 4G6QA 4EM2A 1J7KA 3MEXA 4IHTA 3FXQA 4P5OA 2RQPA 3SXYA 2LDUA 5HLHA 5IT9K 4ENNA 4EJVA 3R60A 2YX4A 3VOEA 3HUGA 1MDMA 4HQMA 3IL2A 2QBYA 3DP7A 3IWZA 2A68F 5HS8A 4CXFA 5ICGA 1R36A 3L9FA 1J5YA 3GO5A 3V7RA 3CUOA 2HFHA 2O8XA 1A04A 3I54A 3KP3A 2EFQA 1MGTA 1Z6RA 2FE3A 2DPDA 2V79A 4EJTA 2FA5A 4OMZA 2BV6A 1BBYA 2K27A 2K02A 1ZLJA 2P7VB 3WGGA 3T8TA 3I64A 3C18A 2K4BA 2DPUA 1ZHFA 4KIGA 2H6CA 3SZPA 1J9IA 4HDVA 2YX7A 5JVTA 3HTUA 1E2XA 4UVBA 4OIOF 4GGGA 5LEJA 5KVRA 1L3LA 3P9IA 4B8XA 3E97A 2ZCWA 1XCVA 2VBZA 3JW4A 5DEQA 1ZAOA 2ELHA 3KP2A 1H9GA 2VXZA 2DBBA 4EJWA 2KJCA 1LDJA 2C6YA 4KMFA 3BOQA 2V1UA 4G8XA 3FXRA 1IF1A 2AXLA 1XMAA 3WTSC 2LF8A 1W5TA 3F8NA 1L0OC 1FP2A 3WGIA 2R7FA 4ASNA 3LFKA 3GFJA 3JSPA 3ZMDA 3K69A 1IZ1A 2HTSA 4O3MA 2L3DA 3BJOA 4RB2C 1RIOH 2WWYA 2UWMA 5DUKA 2CSOA 3FM5A 2Y75A 2HQRA 2Y0MA 4A5NA 2E7XA 3HTSB 3CTAA 4KN4X 2EA4A 2MLGA 2V9VA 3B02A 4R79A 1ON1A 1JXSA 3E5XA 1IUYA 4OINF 1PUEE 2L02A 5ILVA 3ELKA 2PMUA 1T39A 3KCCA 3HOSA 2M87A 3HRUA 2CQKA 3RI4A 4HX4A 1IN8A 4WXDA 2G7UA 1LNWA 3J81K 3K9TA 4UHTA 2E7WA 3GF2A 4IRHA 1NHAA 4GO1A 5LHHA 2VE9A 1Z7UA 2HKOA 2JRTA 5HS7A 4YFNF 4ZYEA 2STWA 5J8FA 4M9XA 5E1XA 3NQOA 1KYZA 2Z99A 1BC7C 2MD5A 2CYYA 1TW3A 3HIFA 3DQVC 3HOTA 4LD5A 1YQAA 1FSEA 5ICFA 4NB5A 2KIFA 2XUBA 1DPUA 4P96A 4I02A 4A12A 2K86A 4WX9A 1QBJA 5BPIA 4UXNA 2R7DA 1P4AA 4MNUA 2IA0A 1ODDA 4OU0A 3CLOA 5K5OA 3F23A 2HOEA 2DO7A 1JE8A 2XAJA 1FBUA 3QPTA 2OD5A 4HW0A 3DV8A 4HYEA 1B9MA 1ZG1A 2HWVA 4EM1A 2D2WA 5H6QA 4IF4A 3PQJA 1UFMA 3FM3A 1W7PD 5CJ9A 3F8FA 1SMTA 3MZYA 2HKXA 2VOPA 4UUVA 2GXGA 4EJUA 2QQAA 3CO6C 1R5GA 1P4WA 5LGTA 4HQEA 1G3SA 1O3QA 1QZYA 1EV7A 1OYWA 3E6DA 4FHTA 3FWEA 2FBIA 1OYIA 1U5TA 5D5UB 3RKXA 3DEUA 2A6HF 3DPTA 3V4GA 2ZO4A 1GXQA 5IT9Z 1I27A 1PDNC 5JR3A 4HX7A 1SAXA 3H92A 2M45A 3CUQC 4UV8A 1S3JA 2V1DA 1YG2A 2YR2A 3QU3A 1RUOA 5HOOA 1OMIA 3ECOA 5CVVA 4ENKA 3P9CA 2IRFG 5LHGA 3ZMTA 1QO0D 4IVNA 1XSXA 4L9VA 3TO7A 3WU1B 3LA2A 1ZGAA 1R58A 3HRSA 2OQRA 1HW5A 2O61A 1F4KA 1R7JA 3CO7C 1R1TA 4U0WA 5AIPA 1KU9A 4HBLA 2MBFA 4OIPF 2XAQA 1FYMA 3TKYA 4A6EA 4KIBA 4K2EA 1O3RA 5HDKA 3ML6A 4A5MA 1T0FA 5BOXA 1P92A 3KLNA 5HDNA 1BI0A 3NRVA 1LDDA 1FBQA 4CICA 2WTEA 4LK0F 4ETSA 5KK1A 4WK8F 3M8EA 3I53A 1TNTA 1XGNA 1I5ZA 2DQRA 3EETA 2VN2A 2W57A 3OV8A 2KJBA 3WGHA 4AIKA 1V4RA 5K5RA 2L4MA 2XV4S 1B9NA 2MH2A 3I58A 5CVRA 3RKYA 1CF7B 1H0MA 2P5LC 2RKHA 3BPVA 3AAFA 1FLIA 3FHZA 2RV8A 4GXOA 2GAUA 3ZMSA 1BOAA 2XKPA 4IHSA 4LLLA 2HZTA 2P6SA 2FF4A 2W85A 2IPQX 3LQQA 3J80K 3MCZA 2OZ6A 4CZZA 3M9AA 2NAZA 4MGRA 3M7GA 2BBYA 2RGVA 2DAOA 1EH8A 1Z6TA 4PZJA 3E5QA 4L9NA 5DCMB 4LMYA 2COMA 1ONVA 3KZZA 2IW5A 4N9IA 4NQWA 4EJOA 1T98A 2QBYB 2FXAA 5FO5A 5JI6A 2PFBA 2OAZA 2XHKA 3HSFA 2IT0A 5DDGA 2O0YA 3BZ6A 3TDZC 3BROA 3QU6A 3HRTA 3TOAA 1TNSA 5F1RA 4L18B 1FYLA 2CFXA 2QQBA 3C3WA 1O7LA 2OU2A 3FX3A 2ADUA 4ZZLA 2F5FA 2O3FA 3LAJA 4WCGA 1XN7A 1KU2A 3V7SA 1S8NA 2M8EA 1DP7P 4PGGA 3I59B 2Z9OA 1MZBA 1FX7A 4WXHA 2FBKA 3F22A 4EMSA 1U5TC 1FT9A 3E6BA 3D0SA 3WTTC 4A2UA 2ISYA 4XLPF 1W7PB 4A0YA 5A2QK 2XAFA 3WTYC 5ERIA 2HGCA 2O6GE 4RB0A 3SFZA 1PP8F 3O2PE 4UV9A 3RJPA 3F6OA 3QP6A 4KYWA 3QRFF 5L3FA 4BHPA 4YFKF 1SD6A 3COAC 4AWXB 2QQ9A 5H20A 3IKTA 1HKTA 3HSEA 2A69F 3BJAA 1SFUA 1MKMA 1BIBA 4PCQA 3DXJF 2JZYA 2A5YB 2Q8KA 4P9FA 3RTRA 3ZQ7A 3BWGA 4BH9A 2LSOA 1S6LA 1TQMA 3L7WA 3P7NA 1WSUA 1HXDA 4B09A 2EFNA 3F3XA 3SZTA 3ABTA 4LB6B 4RS8A 3SQNA 4UVAA 5DCMA 2P8TA 4LLNA 1DDNA 3CJNA 4AD9A 4I2OA 4YIFA 5LGUA 2OBPA 3C7JA 2YPRA 4XSZF 4HF1A 1I1SA 1O3TA 4UNOA 2MLKA 5K1YA 2YU3A 5L3EA 3K1NA 3QOPA 2P6TA 4G7OF 2V1XA 3Q9VA 1ON2A 4MEXF 1MDMB 1LQ1A 1SD7A 2UZKA 2IVMA 3GZ5A 2FRHA 2VE8A 2GA1A 1RNLA 3L09A 4G7HF 3GFLA 1ZREA 2RVCA 2K4JA 4CO8A 4MEYF 3N97A 5D5VB 3WTVC 3N4MA 1D8KA 1WI9A 1HW2A 4AIJA 1TTYA 2VC1A 2QENA 3W6KB 4Q48A 4M72A 2BGCA 3R6SA 1QQIA 2QWWA 5LLQA 1BI3A 2H94A 4Z2YA 3I71A 2Z5UA 3B73A 3KP4A 2VT3A 4LB5A 5E8IA 1K6OA 3KLOA 1FWZA 2MC3A 1XSVA 3J80Z 3GEZA 3VEPA 3W6JB 2KIUA 1IN5A 5FB2A 1FPQA 2DK8A 4O5VA 2VODA 4IRIA 1B6AA 2MA3A 1R22A 2GZWA 4PDKA 1SFEA 1BM9A 5D6FA 2J5OA 1BJAA 2HS5A 4KDPA 2KKOA 5CVUA 4ZYHA 4HZFA 5J6XA 2CG4A 1Y0UA 4IXAA 1GXPA 2EV0A 1G3TA 1J0RA 3H3ZA 1B1BA 1KA8A 4S05A 5H6RA 3K2ZA 4RB1A 2PN6A 3RYPA 2IA1A 5FD5A 3TQNA 4L5IA 4OIQF 1MJAA 2FEZA 4EGYA 4OOIA 2HEOA 5HLIA 5CYVA 1SD4A 2ZKZA 2FU4A 3JSOA 3JAMK 3E6CC 2L01A 3DFGA 1GHCA 1S29A 1IRGA 3E3VA 5E18F 4YG2F 3NEUA 1JGSA 4LG0A 3SHFA 1F1ZA 2PI0A 1OPCA 4LK1F 1YW9A 3GYHX 1FYKA 4I7HA 4M9SA 4I01A 4HA8A 5FGMA 2ISZA 1O7FA 2QYOA 5JHUA 2VONA 2BE5F 5L3GA 2PG4A 2PQ8A 4OMYA 1FOKA 4MQ9F 2K7LA 1HW1A 2VOOA 2IJLA 1HKQA 3V8JA 4I0BA 3GW2A 1MD0A 1BI2A 4A0ZA 1RZ4A 3IRQA 4RB3C 2D1HA 5F6FA 3R4KA 4I98B 3BP8A 3LAPA 2QM3A 1WKMA 4H0EA 2VBYA 2XIGA 1HQCA 3EYYA 1KU7A 1YYVA 4XBFA 1IXCA 3ULQB 1T38A 2P7CB 3J81Z 2RN7A 1R1UA 3LSTA 5BMZA 2O03A 2Z33A 1REPC 4CGZA 1LEAA 5D4SA 1W7PA 5D4RA 3QAHA 5E20A 1GVJA 3G73A 1LB2A 2JTVA 3BY6A 5HVQC 2EWNA 2W25A 3FMSA 1E17A 1CGPA 1ZARA 4EGZA 1ZRFA 3F8MA 3GFIA 4P9UA 2EA2A 2FNAA 1F5TA 2DLLA 2IP2A 1U78A 3IC7A 1P6RA 2X4HA 4KNYA 1YS7A 1J2XA 4YIIA 1G4DA 4PGHA 4GYGA 2XAGA 3WU0A 4HLYA 3RDIA 2Q0OA 1JHHA 5LRRA 4L9TA 3U9GA 3G3ZA 1AWCA 1BIAA 2PJPA 3ZN0A 4BXUA 3HHGA 5J8CA 4I0AA 3P9KA 3M8FA 1QPMA 3M1EA 1O57A 2RNJA 2GA2A 1STZA 1D8JA 1HSTA 4A6DA 2FNPA 1FY7A 5DD4A 4M6XA 2H09A 5L3CA 3QPHA 3TO9A 4GCVA 1U6GA 1HBXG 3PFIA 4R8HA 5L3DA 3U2RA 5DYMA 2BYVE 2HYFA 5F64A 1UHWA 3WTZA 3EDPA 4U0VA 3FF5A 4BAYA 2PEXA 2JPBA 3TDUC 3HYIA 2FQ3A 2D1VA 4KIFA 3T5XA 4KA4A 2EB7A 2A07F 1TLHB 1FP1D 3VFZA 2ZMEA 3GLXA 2CW0F 4ESJA 3ZP5A 2RC4A 1P4XA 4QWQA 3RYRA 3F6VA 3ZMUA 1XCBA 3RIRA 5E1ZB 1R23A 3U1DA 3IRRA 5A2QZ 1ZYRF 2G7HA 2M5WA 3WE2A 4ZYGA 2ACJA 2KIMA 4IPAA 2VBXA 1UHMA 1B59A 1G6NA 3V8LA 1OKRA 4ON0A 1YFHA 2LKPA 4JK1X 4MTDA 1ZH5A 3L00A 2NYXA 2A3SA 2JPCA 2DI3A 4HOBA 1K7AA 5BPDA 1G3WA 2DQLA 3QP5A 1KQ9A 5D5XB 4Y15A 2W84A 4HDUA 5D6EA 1YTYA 1EH6A 1LJ9A 4JQFA 4RGXA 1Z05A 5EEGA 4U88A 3ROUA 2NNYA 4D0PA 4HF0A 4FX4A 2D45A 3T8RA 5ILSA 1ZRCA 2CO5A 2EFPA 2AS5F 4Y17A 1MJ9A 5E17F 5E8GA 1R1VA 3KZYA 2EFOA 2DK5A 4ZH4F 1VTNC 3BJ6A 2EFWA 5K5QA 5ICCA 1SD5A 1FC3A 2CWEA 4LLGF 5D8LB 4N0BA 2MH9A 1B4AA 1UCRA 2HYGD 4CYDA 5AONA 1QZZA 4G94A 3RPQA 4LFUA 5CVIA 5LHIA 2XRNA 3BDDA 3DKWA 2QZ8A 3J7AO 1D5VA 5L3BA 4U7DA 1I1GA 1K78A 3TGNA 2M30A 2H27A 2Z3YA 1YW7A 3Q9SA 2BEOA 3PQKA 3WE3A 1ZG3A 2UXXA 4EVIA 2G9WA 1S7AA 4M71A 2QUFA 4BHBA 2GWRA 3O6BB 3H3UA 3F72A 4AIHA 1AOYA 1FZPB 1Z9CA 3F21A 2B0LA 5LRSA 2OQGA 2JT1A 2TDXA 3I0TA 4KT5C 6PAXA 1Z1DA 3WTWC 4WWCA 3ERED 4Y13A 2XASA 1FBSA 1YLFA 2ZNZA 3ZMZA 1KYWA 4MHGA 4KN7X 4RAYA 5CLSA 3GFMA 2WC2A 2J5PA 1LEBA 1OR7A 3WODF 4BQAA 1TQPA 1U8RA 3ABUA 1WRJA 1IN6A 4RGSA 5D8KB 2ESHA 3T0YA 4S04A 2P4WA 1S7OA 3K0LA 1RI7A 2HTJA 2FMYA 3IWFA 2Y48A 4R1HA 3FZVA 2FBHA 4MTEA 1U2WA 2DTRA 2PMHA 3FMRA 2DFIA 3I5UA 4G6DA 3O3KA 4LJZF 5FLXZ 2DU9A 4DQ2A 2JSCA 4WF2A 1G3YA 1K79A 1IRFA 5ILUA 1LDKB 4WXCA 4HLXA 1T2KA 3KEQA 3JTHA 4Q5SF 1SFXA 1U3EM 2ZMEB 5HLGA 3K1MA 3OOPA 2PLYA 2IA2A 4Q47A 1FSHA 4XLNF 2EV6A 1BI1A 2PBIA 1ULYA 4L0ZB 1X3UA 5ICEA 4FX0A 1KQ0A 3EYIA 1U5TB 3KE2A 5CVJA 2ZBKA 3VB2A 4AVPA 4A0XA 1K78B 1FNNA 3FMQA 5TRDA 5DCFA 1IW7F 1TBXA 2WV0A 2NS0A 1XDSA 1KQ8A 3LWFA 3CUQB 4M9ZA 4NHJA 1YO5C 4G9YA 3GWZA 3KP6A 4KUMA 1BN5A 1ZG5A 1WQ2A 5JFRA 2XROA 3KFWX 3C1DA 1XD7A 2ETHA 4RAZA 3LQRA 3KEOA 1PP7U 3V7CA 1Z91A 3IKVA 1WWXA 1T6SA 2H6BA 3I4PA 4FT8A 3IHUA 1LVAA 1O3SA 1IN7A 4QLCU 1HKSA 4EQQA 1YIOA 3R0AA 3I59A 1IXSB 3GUDA 1TQIA 1UB9A 1YW8A 2XVCA 3MZHA 1IAWA 1IXRC 2LNBA 4E70A 3T1BA 3F8CA 2R3SA 3V8KA 4ESBA 4RGRA 4MQVA 3E6MA 3TOBA 2VBWA 3KP5A 4F7ZA 2F2EA 1YS6A 1H9TA 1USTA 3JTGA 2ZFWA 1V3FA 2HQNA 4EV0A 2F5EA 4HX8A 1JHFA 1R00A 1SMYF 4BYYA 4BNCA 3F8BA 1W4MA 3MWMA 2X0LA 4U0YA 3HHHA 2VC0A 4IRGA 5IT3A 2STTA 1XGSA 2Q2EA 1XB4A 4TV7A 4HV6A 1F9NA 2L54A 5ED4A 1XGMA 1IN4A 2NNNA 3EUHA 5E1WA 3REOA 3KP7A 2GQQA 4YFXF 3MFKA 2M1BA 4GYIA 3CUQA 2A61A 4ENMA 2RDPA 4XSXF 3MQ0A 3GXOA 5FLXK 1DUXC 2ZXJA 3RKWA 5LEKA 3LA7A 1MJBA 5DV5A 4P55A 3WTUC 3RPUA 1ZN2A 3MAJA 2HDCA 4ENJA 3R0JA 4XRFA 1XDUA 3HSRA 2XAHA 5FD6A 5LBQA 4G7ZF 2E1NA 3L2CA 1TW2A 4CDGA 1KGSA 1D3YA 2YSRA 1EH7A 1QNTA 4BHCA 2OZUA 2VT2A 3VODA 1BC8C 4M73A 1ZGJA 2HR3A 5BQTA 2KRFA 4KICA 4CHUA 2A6EF 5DD8A 1QGPA 2NRAC 1P2FA 4M6YA 2DT5A 3D5LA 3CDHA 3DPLC 2F5CA 5DUIA 2OA4A 1J59A 2UXNA 1I6XA 4LG0B 5HS9A 2XKOA 2GIVA 1RUNA 4KMUX 3E5UA 5FFXA 3ZPLA 5HDGA 2F5DA 3FXUA 1HSJA 5FFZA 4ZZDA 5BS6A 4O6JA 1C0WA 4N9HA 4Q4ZF 3TO6A 2GXBA 4IJAA 2P5KA 3HRMA 4RGUA 4OIRF 3JAMZ 2FSWA 1J75A 2EJRA 4L0YB 3K1PA 3BPXA 4EM0B 4KFCA 2FMLA 3LA3A 3ISPA 2W24A 4HV5A 5EEHA 2CGPA 2ZNYA 2E1CA 2V6CA 1ZLKA 2EV5A 4JBAA 4U7BA 2L4AA 4DNCA 2P5VA 3WTXC 4LGWA 1W5SA 3KETA 4HF2A 1XGOA 3GZ6A 3GVAA 2DW4A 2FOKA 1XSDA 5TJJA 2QVOA 1CF7A 3ZN1A 5LGNA 4HAMA 2QLZA 5D5WB 2ESNA 2XGXA 3R61A 4L9JA 1R5HA 4I09A 3Q5FA 1OYYA 3EQLF 4M74A 3ZMVA 5AIQA 2EK5A 2LF7A 1XMKA 3WG9A 4ESFA 4ZYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF8 A;  3GX4 X;  3S2W A;  4L5J A;  1KU3 A;  3ECH A;  4UVC A;  1ZRD A;  2ZJ2 A;  1USS A;  1Q1H A;  1DPR A;  4G6Q A;  4EM2 A;  1J7K A;  3MEX A;  4IHT A;  3FXQ A;  4P5O A;  2RQP A;  3SXY A;  2LDU A;  5HLH A;  5IT9 K;  4ENN A;  4EJV A;  3R60 A;  2YX4 A;  3VOE A;  3HUG A;  1MDM A;  4HQM A;  3IL2 A;  2QBY A;  3DP7 A;  3IWZ A;  2A68 F;  5HS8 A;  4CXF A;  5ICG A;  1R36 A;  3L9F A;  1J5Y A;  3GO5 A;  3V7R A;  3CUO A;  2HFH A;  2O8X A;  1A04 A;  3I54 A;  3KP3 A;  2EFQ A;  1MGT A;  1Z6R A;  2FE3 A;  2DPD A;  2V79 A;  4EJT A;  2FA5 A;  4OMZ A;  2BV6 A;  1BBY A;  2K27 A;  2K02 A;  1ZLJ A;  2P7V B;  3WGG A;  3T8T A;  3I64 A;  3C18 A;  2K4B A;  2DPU A;  1ZHF A;  4KIG A;  2H6C A;  3SZP A;  1J9I A;  4HDV A;  2YX7 A;  5JVT A;  3HTU A;  1E2X A;  4UVB A;  4OIO F;  4GGG A;  5LEJ A;  5KVR A;  1L3L A;  3P9I A;  4B8X A;  3E97 A;  2ZCW A;  1XCV A;  2VBZ A;  3JW4 A;  5DEQ A;  1ZAO A;  2ELH A;  3KP2 A;  1H9G A;  2VXZ A;  2DBB A;  4EJW A;  2KJC A;  1LDJ A;  2C6Y A;  4KMF A;  3BOQ A;  2V1U A;  4G8X A;  3FXR A;  1IF1 A;  2AXL A;  1XMA A;  3WTS C;  2LF8 A;  1W5T A;  3F8N A;  1L0O C;  1FP2 A;  3WGI A;  2R7F A;  4ASN A;  3LFK A;  3GFJ A;  3JSP A;  3ZMD A;  3K69 A;  1IZ1 A;  2HTS A;  4O3M A;  2L3D A;  3BJO A;  4RB2 C;  1RIO H;  2WWY A;  2UWM A;  5DUK A;  2CSO A;  3FM5 A;  2Y75 A;  2HQR A;  2Y0M A;  4A5N A;  2E7X A;  3HTS B;  3CTA A;  4KN4 X;  2EA4 A;  2MLG A;  2V9V A;  3B02 A;  4R79 A;  1ON1 A;  1JXS A;  3E5X A;  1IUY A;  4OIN F;  1PUE E;  2L02 A;  5ILV A;  3ELK A;  2PMU A;  1T39 A;  3KCC A;  3HOS A;  2M87 A;  3HRU A;  2CQK A;  3RI4 A;  4HX4 A;  1IN8 A;  4WXD A;  2G7U A;  1LNW A;  3J81 K;  3K9T A;  4UHT A;  2E7W A;  3GF2 A;  4IRH A;  1NHA A;  4GO1 A;  5LHH A;  2VE9 A;  1Z7U A;  2HKO A;  2JRT A;  5HS7 A;  4YFN F;  4ZYE A;  2STW A;  5J8F A;  4M9X A;  5E1X A;  3NQO A;  1KYZ A;  2Z99 A;  1BC7 C;  2MD5 A;  2CYY A;  1TW3 A;  3HIF A;  3DQV C;  3HOT A;  4LD5 A;  1YQA A;  1FSE A;  5ICF A;  4NB5 A;  2KIF A;  2XUB A;  1DPU A;  4P96 A;  4I02 A;  4A12 A;  2K86 A;  4WX9 A;  1QBJ A;  5BPI A;  4UXN A;  2R7D A;  1P4A A;  4MNU A;  2IA0 A;  1ODD A;  4OU0 A;  3CLO A;  5K5O A;  3F23 A;  2HOE A;  2DO7 A;  1JE8 A;  2XAJ A;  1FBU A;  3QPT A;  2OD5 A;  4HW0 A;  3DV8 A;  4HYE A;  1B9M A;  1ZG1 A;  2HWV A;  4EM1 A;  2D2W A;  5H6Q A;  4IF4 A;  3PQJ A;  1UFM A;  3FM3 A;  1W7P D;  5CJ9 A;  3F8F A;  1SMT A;  3MZY A;  2HKX A;  2VOP A;  4UUV A;  2GXG A;  4EJU A;  2QQA A;  3CO6 C;  1R5G A;  1P4W A;  5LGT A;  4HQE A;  1G3S A;  1O3Q A;  1QZY A;  1EV7 A;  1OYW A;  3E6D A;  4FHT A;  3FWE A;  2FBI A;  1OYI A;  1U5T A;  5D5U B;  3RKX A;  3DEU A;  2A6H F;  3DPT A;  3V4G A;  2ZO4 A;  1GXQ A;  5IT9 Z;  1I27 A;  1PDN C;  5JR3 A;  4HX7 A;  1SAX A;  3H92 A;  2M45 A;  3CUQ C;  4UV8 A;  1S3J A;  2V1D A;  1YG2 A;  2YR2 A;  3QU3 A;  1RUO A;  5HOO A;  1OMI A;  3ECO A;  5CVV A;  4ENK A;  3P9C A;  2IRF G;  5LHG A;  3ZMT A;  1QO0 D;  4IVN A;  1XSX A;  4L9V A;  3TO7 A;  3WU1 B;  3LA2 A;  1ZGA A;  1R58 A;  3HRS A;  2OQR A;  1HW5 A;  2O61 A;  1F4K A;  1R7J A;  3CO7 C;  1R1T A;  4U0W A;  5AIP A;  1KU9 A;  4HBL A;  2MBF A;  4OIP F;  2XAQ A;  1FYM A;  3TKY A;  4A6E A;  4KIB A;  4K2E A;  1O3R A;  5HDK A;  3ML6 A;  4A5M A;  1T0F A;  5BOX A;  1P92 A;  3KLN A;  5HDN A;  1BI0 A;  3NRV A;  1LDD A;  1FBQ A;  4CIC A;  2WTE A;  4LK0 F;  4ETS A;  5KK1 A;  4WK8 F;  3M8E A;  3I53 A;  1TNT A;  1XGN A;  1I5Z A;  2DQR A;  3EET A;  2VN2 A;  2W57 A;  3OV8 A;  2KJB A;  3WGH A;  4AIK A;  1V4R A;  5K5R A;  2L4M A;  2XV4 S;  1B9N A;  2MH2 A;  3I58 A;  5CVR A;  3RKY A;  1CF7 B;  1H0M A;  2P5L C;  2RKH A;  3BPV A;  3AAF A;  1FLI A;  3FHZ A;  2RV8 A;  4GXO A;  2GAU A;  3ZMS A;  1BOA A;  2XKP A;  4IHS A;  4LLL A;  2HZT A;  2P6S A;  2FF4 A;  2W85 A;  2IPQ X;  3LQQ A;  3J80 K;  3MCZ A;  2OZ6 A;  4CZZ A;  3M9A A;  2NAZ A;  4MGR A;  3M7G A;  2BBY A;  2RGV A;  2DAO A;  1EH8 A;  1Z6T A;  4PZJ A;  3E5Q A;  4L9N A;  5DCM B;  4LMY A;  2COM A;  1ONV A;  3KZZ A;  2IW5 A;  4N9I A;  4NQW A;  4EJO A;  1T98 A;  2QBY B;  2FXA A;  5FO5 A;  5JI6 A;  2PFB A;  2OAZ A;  2XHK A;  3HSF A;  2IT0 A;  5DDG A;  2O0Y A;  3BZ6 A;  3TDZ C;  3BRO A;  3QU6 A;  3HRT A;  3TOA A;  1TNS A;  5F1R A;  4L18 B;  1FYL A;  2CFX A;  2QQB A;  3C3W A;  1O7L A;  2OU2 A;  3FX3 A;  2ADU A;  4ZZL A;  2F5F A;  2O3F A;  3LAJ A;  4WCG A;  1XN7 A;  1KU2 A;  3V7S A;  1S8N A;  2M8E A;  1DP7 P;  4PGG A;  3I59 B;  2Z9O A;  1MZB A;  1FX7 A;  4WXH A;  2FBK A;  3F22 A;  4EMS A;  1U5T C;  1FT9 A;  3E6B A;  3D0S A;  3WTT C;  4A2U A;  2ISY A;  4XLP F;  1W7P B;  4A0Y A;  5A2Q K;  2XAF A;  3WTY C;  5ERI A;  2HGC A;  2O6G E;  4RB0 A;  3SFZ A;  1PP8 F;  3O2P E;  4UV9 A;  3RJP A;  3F6O A;  3QP6 A;  4KYW A;  3QRF F;  5L3F A;  4BHP A;  4YFK F;  1SD6 A;  3COA C;  4AWX B;  2QQ9 A;  5H20 A;  3IKT A;  1HKT A;  3HSE A;  2A69 F;  3BJA A;  1SFU A;  1MKM A;  1BIB A;  4PCQ A;  3DXJ F;  2JZY A;  2A5Y B;  2Q8K A;  4P9F A;  3RTR A;  3ZQ7 A;  3BWG A;  4BH9 A;  2LSO A;  1S6L A;  1TQM A;  3L7W A;  3P7N A;  1WSU A;  1HXD A;  4B09 A;  2EFN A;  3F3X A;  3SZT A;  3ABT A;  4LB6 B;  4RS8 A;  3SQN A;  4UVA A;  5DCM A;  2P8T A;  4LLN A;  1DDN A;  3CJN A;  4AD9 A;  4I2O A;  4YIF A;  5LGU A;  2OBP A;  3C7J A;  2YPR A;  4XSZ F;  4HF1 A;  1I1S A;  1O3T A;  4UNO A;  2MLK A;  5K1Y A;  2YU3 A;  5L3E A;  3K1N A;  3QOP A;  2P6T A;  4G7O F;  2V1X A;  3Q9V A;  1ON2 A;  4MEX F;  1MDM B;  1LQ1 A;  1SD7 A;  2UZK A;  2IVM A;  3GZ5 A;  2FRH A;  2VE8 A;  2GA1 A;  1RNL A;  3L09 A;  4G7H F;  3GFL A;  1ZRE A;  2RVC A;  2K4J A;  4CO8 A;  4MEY F;  3N97 A;  5D5V B;  3WTV C;  3N4M A;  1D8K A;  1WI9 A;  1HW2 A;  4AIJ A;  1TTY A;  2VC1 A;  2QEN A;  3W6K B;  4Q48 A;  4M72 A;  2BGC A;  3R6S A;  1QQI A;  2QWW A;  5LLQ A;  1BI3 A;  2H94 A;  4Z2Y A;  3I71 A;  2Z5U A;  3B73 A;  3KP4 A;  2VT3 A;  4LB5 A;  5E8I A;  1K6O A;  3KLO A;  1FWZ A;  2MC3 A;  1XSV A;  3J80 Z;  3GEZ A;  3VEP A;  3W6J B;  2KIU A;  1IN5 A;  5FB2 A;  1FPQ A;  2DK8 A;  4O5V A;  2VOD A;  4IRI A;  1B6A A;  2MA3 A;  1R22 A;  2GZW A;  4PDK A;  1SFE A;  1BM9 A;  5D6F A;  2J5O A;  1BJA A;  2HS5 A;  4KDP A;  2KKO A;  5CVU A;  4ZYH A;  4HZF A;  5J6X A;  2CG4 A;  1Y0U A;  4IXA A;  1GXP A;  2EV0 A;  1G3T A;  1J0R A;  3H3Z A;  1B1B A;  1KA8 A;  4S05 A;  5H6R A;  3K2Z A;  4RB1 A;  2PN6 A;  3RYP A;  2IA1 A;  5FD5 A;  3TQN A;  4L5I A;  4OIQ F;  1MJA A;  2FEZ A;  4EGY A;  4OOI A;  2HEO A;  5HLI A;  5CYV A;  1SD4 A;  2ZKZ A;  2FU4 A;  3JSO A;  3JAM K;  3E6C C;  2L01 A;  3DFG A;  1GHC A;  1S29 A;  1IRG A;  3E3V A;  5E18 F;  4YG2 F;  3NEU A;  1JGS A;  4LG0 A;  3SHF A;  1F1Z A;  2PI0 A;  1OPC A;  4LK1 F;  1YW9 A;  3GYH X;  1FYK A;  4I7H A;  4M9S A;  4I01 A;  4HA8 A;  5FGM A;  2ISZ A;  1O7F A;  2QYO A;  5JHU A;  2VON A;  2BE5 F;  5L3G A;  2PG4 A;  2PQ8 A;  4OMY A;  1FOK A;  4MQ9 F;  2K7L A;  1HW1 A;  2VOO A;  2IJL A;  1HKQ A;  3V8J A;  4I0B A;  3GW2 A;  1MD0 A;  1BI2 A;  4A0Z A;  1RZ4 A;  3IRQ A;  4RB3 C;  2D1H A;  5F6F A;  3R4K A;  4I98 B;  3BP8 A;  3LAP A;  2QM3 A;  1WKM A;  4H0E A;  2VBY A;  2XIG A;  1HQC A;  3EYY A;  1KU7 A;  1YYV A;  4XBF A;  1IXC A;  3ULQ B;  1T38 A;  2P7C B;  3J81 Z;  2RN7 A;  1R1U A;  3LST A;  5BMZ A;  2O03 A;  2Z33 A;  1REP C;  4CGZ A;  1LEA A;  5D4S A;  1W7P A;  5D4R A;  3QAH A;  5E20 A;  1GVJ A;  3G73 A;  1LB2 A;  2JTV A;  3BY6 A;  5HVQ C;  2EWN A;  2W25 A;  3FMS A;  1E17 A;  1CGP A;  1ZAR A;  4EGZ A;  1ZRF A;  3F8M A;  3GFI A;  4P9U A;  2EA2 A;  2FNA A;  1F5T A;  2DLL A;  2IP2 A;  1U78 A;  3IC7 A;  1P6R A;  2X4H A;  4KNY A;  1YS7 A;  1J2X A;  4YII A;  1G4D A;  4PGH A;  4GYG A;  2XAG A;  3WU0 A;  4HLY A;  3RDI A;  2Q0O A;  1JHH A;  5LRR A;  4L9T A;  3U9G A;  3G3Z A;  1AWC A;  1BIA A;  2PJP A;  3ZN0 A;  4BXU A;  3HHG A;  5J8C A;  4I0A A;  3P9K A;  3M8F A;  1QPM A;  3M1E A;  1O57 A;  2RNJ A;  2GA2 A;  1STZ A;  1D8J A;  1HST A;  4A6D A;  2FNP A;  1FY7 A;  5DD4 A;  4M6X A;  2H09 A;  5L3C A;  3QPH A;  3TO9 A;  4GCV A;  1U6G A;  1HBX G;  3PFI A;  4R8H A;  5L3D A;  3U2R A;  5DYM A;  2BYV E;  2HYF A;  5F64 A;  1UHW A;  3WTZ A;  3EDP A;  4U0V A;  3FF5 A;  4BAY A;  2PEX A;  2JPB A;  3TDU C;  3HYI A;  2FQ3 A;  2D1V A;  4KIF A;  3T5X A;  4KA4 A;  2EB7 A;  2A07 F;  1TLH B;  1FP1 D;  3VFZ A;  2ZME A;  3GLX A;  2CW0 F;  4ESJ A;  3ZP5 A;  2RC4 A;  1P4X A;  4QWQ A;  3RYR A;  3F6V A;  3ZMU A;  1XCB A;  3RIR A;  5E1Z B;  1R23 A;  3U1D A;  3IRR A;  5A2Q Z;  1ZYR F;  2G7H A;  2M5W A;  3WE2 A;  4ZYG A;  2ACJ A;  2KIM A;  4IPA A;  2VBX A;  1UHM A;  1B59 A;  1G6N A;  3V8L A;  1OKR A;  4ON0 A;  1YFH A;  2LKP A;  4JK1 X;  4MTD A;  1ZH5 A;  3L00 A;  2NYX A;  2A3S A;  2JPC A;  2DI3 A;  4HOB A;  1K7A A;  5BPD A;  1G3W A;  2DQL A;  3QP5 A;  1KQ9 A;  5D5X B;  4Y15 A;  2W84 A;  4HDU A;  5D6E A;  1YTY A;  1EH6 A;  1LJ9 A;  4JQF A;  4RGX A;  1Z05 A;  5EEG A;  4U88 A;  3ROU A;  2NNY A;  4D0P A;  4HF0 A;  4FX4 A;  2D45 A;  3T8R A;  5ILS A;  1ZRC A;  2CO5 A;  2EFP A;  2AS5 F;  4Y17 A;  1MJ9 A;  5E17 F;  5E8G A;  1R1V A;  3KZY A;  2EFO A;  2DK5 A;  4ZH4 F;  1VTN C;  3BJ6 A;  2EFW A;  5K5Q A;  5ICC A;  1SD5 A;  1FC3 A;  2CWE A;  4LLG F;  5D8L B;  4N0B A;  2MH9 A;  1B4A A;  1UCR A;  2HYG D;  4CYD A;  5AON A;  1QZZ A;  4G94 A;  3RPQ A;  4LFU A;  5CVI A;  5LHI A;  2XRN A;  3BDD A;  3DKW A;  2QZ8 A;  3J7A O;  1D5V A;  5L3B A;  4U7D A;  1I1G A;  1K78 A;  3TGN A;  2M30 A;  2H27 A;  2Z3Y A;  1YW7 A;  3Q9S A;  2BEO A;  3PQK A;  3WE3 A;  1ZG3 A;  2UXX A;  4EVI A;  2G9W A;  1S7A A;  4M71 A;  2QUF A;  4BHB A;  2GWR A;  3O6B B;  3H3U A;  3F72 A;  4AIH A;  1AOY A;  1FZP B;  1Z9C A;  3F21 A;  2B0L A;  5LRS A;  2OQG A;  2JT1 A;  2TDX A;  3I0T A;  4KT5 C;  6PAX A;  1Z1D A;  3WTW C;  4WWC A;  3ERE D;  4Y13 A;  2XAS A;  1FBS A;  1YLF A;  2ZNZ A;  3ZMZ A;  1KYW A;  4MHG A;  4KN7 X;  4RAY A;  5CLS A;  3GFM A;  2WC2 A;  2J5P A;  1LEB A;  1OR7 A;  3WOD F;  4BQA A;  1TQP A;  1U8R A;  3ABU A;  1WRJ A;  1IN6 A;  4RGS A;  5D8K B;  2ESH A;  3T0Y A;  4S04 A;  2P4W A;  1S7O A;  3K0L A;  1RI7 A;  2HTJ A;  2FMY A;  3IWF A;  2Y48 A;  4R1H A;  3FZV A;  2FBH A;  4MTE A;  1U2W A;  2DTR A;  2PMH A;  3FMR A;  2DFI A;  3I5U A;  4G6D A;  3O3K A;  4LJZ F;  5FLX Z;  2DU9 A;  4DQ2 A;  2JSC A;  4WF2 A;  1G3Y A;  1K79 A;  1IRF A;  5ILU A;  1LDK B;  4WXC A;  4HLX A;  1T2K A;  3KEQ A;  3JTH A;  4Q5S F;  1SFX A;  1U3E M;  2ZME B;  5HLG A;  3K1M A;  3OOP A;  2PLY A;  2IA2 A;  4Q47 A;  1FSH A;  4XLN F;  2EV6 A;  1BI1 A;  2PBI A;  1ULY A;  4L0Z B;  1X3U A;  5ICE A;  4FX0 A;  1KQ0 A;  3EYI A;  1U5T B;  3KE2 A;  5CVJ A;  2ZBK A;  3VB2 A;  4AVP A;  4A0X A;  1K78 B;  1FNN A;  3FMQ A;  5TRD A;  5DCF A;  1IW7 F;  1TBX A;  2WV0 A;  2NS0 A;  1XDS A;  1KQ8 A;  3LWF A;  3CUQ B;  4M9Z A;  4NHJ A;  1YO5 C;  4G9Y A;  3GWZ A;  3KP6 A;  4KUM A;  1BN5 A;  1ZG5 A;  1WQ2 A;  5JFR A;  2XRO A;  3KFW X;  3C1D A;  1XD7 A;  2ETH A;  4RAZ A;  3LQR A;  3KEO A;  1PP7 U;  3V7C A;  1Z91 A;  3IKV A;  1WWX A;  1T6S A;  2H6B A;  3I4P A;  4FT8 A;  3IHU A;  1LVA A;  1O3S A;  1IN7 A;  4QLC U;  1HKS A;  4EQQ A;  1YIO A;  3R0A A;  3I59 A;  1IXS B;  3GUD A;  1TQI A;  1UB9 A;  1YW8 A;  2XVC A;  3MZH A;  1IAW A;  1IXR C;  2LNB A;  4E70 A;  3T1B A;  3F8C A;  2R3S A;  3V8K A;  4ESB A;  4RGR A;  4MQV A;  3E6M A;  3TOB A;  2VBW A;  3KP5 A;  4F7Z A;  2F2E A;  1YS6 A;  1H9T A;  1UST A;  3JTG A;  2ZFW A;  1V3F A;  2HQN A;  4EV0 A;  2F5E A;  4HX8 A;  1JHF A;  1R00 A;  1SMY F;  4BYY A;  4BNC A;  3F8B A;  1W4M A;  3MWM A;  2X0L A;  4U0Y A;  3HHH A;  2VC0 A;  4IRG A;  5IT3 A;  2STT A;  1XGS A;  2Q2E A;  1XB4 A;  4TV7 A;  4HV6 A;  1F9N A;  2L54 A;  5ED4 A;  1XGM A;  1IN4 A;  2NNN A;  3EUH A;  5E1W A;  3REO A;  3KP7 A;  2GQQ A;  4YFX F;  3MFK A;  2M1B A;  4GYI A;  3CUQ A;  2A61 A;  4ENM A;  2RDP A;  4XSX F;  3MQ0 A;  3GXO A;  5FLX K;  1DUX C;  2ZXJ A;  3RKW A;  5LEK A;  3LA7 A;  1MJB A;  5DV5 A;  4P55 A;  3WTU C;  3RPU A;  1ZN2 A;  3MAJ A;  2HDC A;  4ENJ A;  3R0J A;  4XRF A;  1XDU A;  3HSR A;  2XAH A;  5FD6 A;  5LBQ A;  4G7Z F;  2E1N A;  3L2C A;  1TW2 A;  4CDG A;  1KGS A;  1D3Y A;  2YSR A;  1EH7 A;  1QNT A;  4BHC A;  2OZU A;  2VT2 A;  3VOD A;  1BC8 C;  4M73 A;  1ZGJ A;  2HR3 A;  5BQT A;  2KRF A;  4KIC A;  4CHU A;  2A6E F;  5DD8 A;  1QGP A;  2NRA C;  1P2F A;  4M6Y A;  2DT5 A;  3D5L A;  3CDH A;  3DPL C;  2F5C A;  5DUI A;  2OA4 A;  1J59 A;  2UXN A;  1I6X A;  4LG0 B;  5HS9 A;  2XKO A;  2GIV A;  1RUN A;  4KMU X;  3E5U A;  5FFX A;  3ZPL A;  5HDG A;  2F5D A;  3FXU A;  1HSJ A;  5FFZ A;  4ZZD A;  5BS6 A;  4O6J A;  1C0W A;  4N9H A;  4Q4Z F;  3TO6 A;  2GXB A;  4IJA A;  2P5K A;  3HRM A;  4RGU A;  4OIR F;  3JAM Z;  2FSW A;  1J75 A;  2EJR A;  4L0Y B;  3K1P A;  3BPX A;  4EM0 B;  4KFC A;  2FML A;  3LA3 A;  3ISP A;  2W24 A;  4HV5 A;  5EEH A;  2CGP A;  2ZNY A;  2E1C A;  2V6C A;  1ZLK A;  2EV5 A;  4JBA A;  4U7B A;  2L4A A;  4DNC A;  2P5V A;  3WTX C;  4LGW A;  1W5S A;  3KET A;  4HF2 A;  1XGO A;  3GZ6 A;  3GVA A;  2DW4 A;  2FOK A;  1XSD A;  5TJJ A;  2QVO A;  1CF7 A;  3ZN1 A;  5LGN A;  4HAM A;  2QLZ A;  5D5W B;  2ESN A;  2XGX A;  3R61 A;  4L9J A;  1R5H A;  4I09 A;  3Q5F A;  1OYY A;  3EQL F;  4M74 A;  3ZMV A;  5AIQ A;  2EK5 A;  2LF7 A;  1XMK A;  3WG9 A;  4ESF A;  4ZYD A; 
#chains in the Genus database with same CATH topology
 3E7L A;  3DF8 A;  3GX4 X;  2LKX A;  5F0C A;  1P7I A;  3S2W A;  3OSG A;  3SDB A;  1NK3 P;  3AG2 H;  4L5J A;  1UG0 A;  1KU3 A;  3ECH A;  1HLV A;  4UVC A;  1ZRD A;  2ZJ2 A;  1USS A;  1Q1H A;  5IYC J;  1DPR A;  4G6Q A;  1E3O C;  5HLT A;  4EM2 A;  1ETY A;  3SEQ A;  1IDY A;  4IOA F;  1J7K A;  1Z77 A;  2GBY A;  3PSF A;  3MEX A;  1MBH A;  4IHT A;  3FXQ A;  4P5O A;  1MH4 A;  2RQP A;  3SXY A;  3CCR I;  2LDU A;  2EZH A;  3OL3 A;  5HLH A;  5IT9 K;  4ENN A;  5C3E J;  4EJV A;  2VUM J;  4B44 A;  3DCF A;  3R60 A;  1OQY A;  5GPA A;  5J1Y A;  2YX4 A;  3VOE A;  3HUG A;  1PVE A;  2E19 A;  1MDM A;  3HOV J;  3HXL A;  3Q0W A;  1SAN A;  2LYC A;  4HQM A;  1SC7 A;  3IL2 A;  2R92 J;  5FKO A;  3BG7 A;  2QBY A;  3DP7 A;  3IWZ A;  2CUZ A;  5J4Y A;  2JA8 J;  1U0J A;  2A68 F;  3C2H A;  1YX5 A;  5HS8 A;  4CXF A;  1YX3 A;  4IQ4 A;  5ICG A;  1R36 A;  4IKF A;  2VKV A;  5E79 C;  2YU9 J;  3L9F A;  1J5Y A;  1ETX A;  3GO5 A;  3V7R A;  3CUO A;  5FKN A;  3S3M A;  2BY2 A;  1X1C A;  2HFH A;  2O8X A;  1SFK A;  1A04 A;  3I54 A;  3KP3 A;  2EFQ A;  2R5Y A;  1MGT A;  5TIS C;  1Z6R A;  1PUF B;  3BLY A;  2FE3 A;  2KRC A;  2DPD A;  1VND A;  5BNG A;  4AU7 A;  2V79 A;  4EJT A;  2FA5 A;  4OMZ A;  1ETV A;  2BV6 A;  1BBY A;  2K27 A;  2P7V B;  1ZLJ A;  1QVU A;  2K02 A;  3WGG A;  3T8T A;  4BE2 A;  2VQG A;  4ZTF A;  3I64 A;  2DMP A;  3C18 A;  2K4B A;  4LIU A;  2H8W A;  4AM3 A;  1D0Y A;  3CZ6 A;  2DPU A;  3OY9 A;  3MVP A;  4B48 A;  1ZHF A;  3OWT A;  3BC8 A;  1CQT A;  4KIG A;  2H6C A;  2HVS A;  3H5N A;  3SZP A;  1J9I A;  4HDV A;  2YX7 A;  5JVT A;  3HTU A;  1E2X A;  1PUF A;  1GLN A;  3GTJ J;  4UVB A;  4OIO F;  2FOW A;  3G71 I;  4GGG A;  2LRE A;  2OCE A;  2KT0 A;  5LEJ A;  5KVR A;  3GLL A;  1L3L A;  4CCL A;  1TT0 A;  3P9I A;  4B8X A;  3E97 A;  1ACI A;  2ZCW A;  3EUK L;  1XCV A;  2KDO A;  2VBZ A;  3JW4 A;  2IS4 A;  5DEQ A;  1ZAO A;  3BTI A;  2WAQ A;  1IV8 A;  2ELH A;  3KP2 A;  3TW7 A;  5IYB J;  2W1O A;  1H9G A;  5EZH A;  2VXZ A;  2KPM A;  1U9N A;  2DBB A;  4EJW A;  3JCU C;  4RDU A;  4BJ5 C;  2KJC A;  1LDJ A;  2C6Y A;  4KMF A;  3BOQ A;  2V1U A;  2ZXW H;  4G8X A;  3FXR A;  3JR9 A;  1IF1 A;  4DGW B;  2AXL A;  2Z16 A;  1XMA A;  3WTS C;  2LF8 A;  3EPZ A;  1W5T A;  2IBD A;  3O8H A;  3F8N A;  1L0O C;  2NS8 A;  2X1D A;  3F0C A;  1WJF A;  1FP2 A;  1RKT A;  2VB6 A;  3WGI A;  2AXT C;  2R7F A;  4MFD A;  4ASN A;  5B66 C;  3LFK A;  1N77 A;  1U8B A;  3GFJ A;  5LD2 C;  3JSP A;  3ZMD A;  3OR1 C;  3K69 A;  1IZ1 A;  3ZRG A;  3QWL A;  1ETW A;  3OOU A;  2HTS A;  3W6V A;  4O3M A;  2L3D A;  3BJO A;  4RB2 C;  1F43 A;  1JJ6 C;  1RIO H;  1HC8 A;  2WWY A;  2UWM A;  5DUK A;  4CCO A;  2CSO A;  3FM5 A;  2Y75 A;  2HQR A;  2Y0M A;  4A5N A;  3PIP F;  1GV2 A;  2E7X A;  3FK6 A;  3HTS B;  2TCT A;  3CTA A;  3RPU D;  4KN4 X;  2EA4 A;  2MLG A;  2V9V A;  2V1N A;  2V9K A;  3B02 A;  4R79 A;  1ON1 A;  1JXS A;  3E5X A;  3FXM A;  4BXF A;  1DU0 A;  5FKL A;  1VQ4 I;  1IUY A;  1RQ6 A;  4OIN F;  1PUE E;  2L02 A;  4A3E J;  5ILV A;  1X4P A;  2IS1 A;  1JT0 A;  3ELK A;  3P5J A;  4HPQ A;  2PMU A;  2WY8 Q;  2MW8 A;  3AL0 B;  1T39 A;  2CUJ A;  1WJE A;  3KCC A;  3QYB A;  3RCO A;  1D1B A;  3J7Z I;  3HOS A;  2M87 A;  3HRU A;  4Y3O A;  2CQK A;  3RI4 A;  4HX4 A;  4HRI A;  1IN8 A;  1TZL A;  1EKE A;  4WXD A;  1ERD A;  2G7U A;  1LNW A;  1X1B A;  3J81 K;  4KJZ A;  1BA5 A;  2H1L A;  4XNF A;  1I39 A;  3EUA A;  4C9Y A;  2Y9Y A;  3K9T A;  4UHT A;  1SVO A;  2E7W A;  4BE0 A;  2ME6 A;  3GF2 A;  3LSM A;  5K7Z A;  4D1Q A;  2IEK A;  5E3M A;  4IRH A;  3IV5 A;  1NHA A;  2DCE A;  4GO1 A;  1Z7U A;  2HKO A;  2ME0 A;  2JRT A;  3G1O A;  5HS7 A;  2K9Q A;  5LHH A;  2VE9 A;  4YFN F;  2JUC A;  4ZYE A;  3QOE A;  2RAE A;  2STW A;  5J8F A;  4M9X A;  5E1X A;  3NQO A;  3L1P A;  1KYZ A;  2Z99 A;  2DA1 A;  1BC7 C;  2MD5 A;  1ZR4 A;  2MUN A;  1IC8 A;  2CYY A;  1TW3 A;  2BY0 A;  3SFI A;  3AG4 H;  3HIF A;  3DQV C;  3HOT A;  5IOZ A;  3DKY A;  2WBM A;  4LD5 A;  1YQA A;  1FSE A;  5ICF A;  3W3C A;  4NB5 A;  4QPQ A;  1YJ9 I;  3JAM R;  2LKS A;  2KIF A;  2XUB A;  2XF6 A;  1DPU A;  4P96 A;  4I02 A;  1WH5 A;  2LR8 A;  4A12 A;  3KEY A;  4FE7 A;  3A02 A;  3CC2 I;  2K86 A;  2L7F P;  2WAD A;  4WX9 A;  2IGK A;  1QBJ A;  3PUB A;  2BXY A;  3K2A A;  2CRG A;  5BPI A;  4UXN A;  1WJ5 A;  3TW6 A;  2R5Z A;  3OS2 A;  5FRM A;  2R7D A;  4XOT A;  1P4A A;  3HOW J;  4MNU A;  3S1Q J;  2BHZ A;  3H0D A;  2IA0 A;  4E7K A;  3FXO A;  1LVK A;  1T56 A;  3I3L A;  1ODD A;  1FMV A;  3ZXS A;  4OU0 A;  4CYC B;  3CLO A;  5K5O A;  3F23 A;  4XMY A;  4ANJ A;  2HOE A;  2DO7 A;  4BJT A;  5FLV A;  1JE8 A;  2Y69 H;  2XAJ A;  3H5A A;  1FBU A;  3KYC B;  2LVS A;  4E4H A;  3JRI A;  1Y1V J;  3QPT A;  3OYJ A;  3CF5 F;  3AKZ A;  1FTT A;  2ZXI A;  2OD5 A;  4HW0 A;  5DTD A;  4AYB N;  3DV8 A;  9ANT A;  4RM2 A;  4HYE A;  3O8G A;  4A3D J;  1B9M A;  3S2D J;  1I6H J;  5HNF A;  3V42 A;  3KYD B;  4JX6 A;  4W97 A;  2HWV A;  1ZG1 A;  4EM1 A;  2D2W A;  5H6Q A;  4DOZ A;  1VF9 A;  1XC5 A;  4IF4 A;  5DM7 F;  3H9J A;  1WGX A;  3PQJ A;  2F4O B;  2FJ1 A;  1UFM A;  3FM3 A;  4DYQ A;  1W7P D;  5CJ9 A;  2X1E A;  3NWS A;  3QOD A;  2M4G A;  4Y4R A;  3F8F A;  1SMT A;  3MZY A;  3SYT A;  1LFU P;  2HKX A;  2VOP A;  4UUV A;  1FEX A;  4QSH A;  2GXG A;  3FHN A;  4EJU A;  5GAE J;  4KIS A;  5IT9 R;  2QQA A;  5J1R A;  3CO6 C;  2XPU A;  1R5G A;  1P4W A;  5LGT A;  4HQE A;  4BQQ A;  1G3S A;  2KMU A;  1MMG A;  1O3Q A;  1QZY A;  1EV7 A;  1OYW A;  3E6D A;  4FHT A;  3M8J A;  4BU2 A;  3S17 J;  1FTZ A;  3FWE A;  4BL0 B;  2FBI A;  1WI3 A;  1OYI A;  1U5T A;  5D5U B;  2OUM A;  3KZI C;  1HOM A;  4JX4 A;  3RKX A;  2DOD A;  2PMZ N;  3DEU A;  4XLH A;  1SVM A;  2A6H F;  3A4C A;  5EGO B;  3AG1 H;  4LG3 A;  3ZQL A;  3CD6 I;  4LIT A;  3DPT A;  4CCN A;  1XS9 A;  3V4G A;  1MBK A;  2Y30 A;  2ZO4 A;  1GXQ A;  1OLT A;  5IT9 Z;  1I27 A;  1IUF A;  1PDN C;  1X3W B;  2LC2 A;  2DA4 A;  5JR3 A;  3C2B A;  3LSR A;  3L2U A;  2OV7 A;  4HX7 A;  1SAX A;  3H92 A;  2M45 A;  1LFP A;  4CH7 A;  3CUQ C;  1EF4 A;  4UV8 A;  1S3J A;  2V1D A;  1K4S A;  1YG2 A;  2YR2 A;  3PNT A;  3QU3 A;  1RUO A;  3AL0 C;  3HGG A;  2EIN H;  5HOO A;  3ECO A;  1OMI A;  5CVV A;  4ENK A;  3RKQ A;  2Y31 A;  3P9C A;  3S15 J;  2IRF G;  5LHG A;  4CCK A;  2JA2 A;  2Q2E B;  4DZP A;  1E3P A;  3IH2 A;  3ZMT A;  5IOY A;  2DA3 A;  1MMD A;  3QYE A;  3SEZ A;  4MEX F;  2GXA A;  1QO0 D;  2M35 A;  2VKD A;  4IVN A;  4IHW A;  3GZN B;  1XSX A;  4L9V A;  2K3F A;  2OPT A;  3TO7 A;  4F93 B;  3WU1 B;  3J7A W;  2ELK A;  3BG6 A;  2L0K A;  2ZSI B;  3I9V 2;  1ZGA A;  3LA2 A;  2LBF B;  1R58 A;  3MMY B;  3HRS A;  3CC4 I;  2OQR A;  1HW5 A;  2O61 A;  1F4K A;  1R7J A;  4BQN A;  3CO7 C;  1R1T A;  4U0W A;  2HPM A;  5AIP A;  1KU9 A;  3PL8 A;  5F04 A;  2KDZ A;  3Q0U A;  2IS2 A;  4HBL A;  2F5V A;  2MBF A;  4OIP F;  2XAQ A;  1FYM A;  3M3Y J;  3TKY A;  3GTP J;  4A6E A;  4KIB A;  4K2E A;  1O3R A;  5HDK A;  2IAI A;  3ML6 A;  4A5M A;  1T0F A;  5BOX A;  1P92 A;  5GAG J;  2LLK A;  3KLN A;  5HDN A;  2F48 A;  3JRA A;  1BI0 A;  1X1P A;  3NRV A;  2DOE A;  5EGO A;  2VQH A;  1LDD A;  2K9L A;  1FBQ A;  4G12 A;  1BR4 A;  4CIC A;  2WTE A;  4Y33 A;  3ABL H;  3OYE A;  4HG2 A;  4LK0 F;  4LOC A;  4ETS A;  5KK1 A;  2X6W A;  3ZQG A;  2M7B A;  2EPF A;  4WK8 F;  3M8E A;  1MBE A;  3K4B A;  4OWR B;  3I53 A;  1TNT A;  1XGN A;  2XF7 A;  1I5Z A;  1SEU A;  2DQR A;  2WB1 A;  2CQQ A;  1TC3 C;  3OS0 A;  3EET A;  2AHQ A;  2VN2 A;  3HJE A;  2W57 A;  3OV8 A;  2KJB A;  3CF2 A;  4I99 C;  3K10 A;  3WGH A;  4AIK A;  2LG4 A;  1V4R A;  5K5R A;  4DYR A;  2L4M A;  2XV4 S;  1B9N A;  2MH2 A;  3I58 A;  5CVR A;  3RKY A;  1ORK A;  1CF7 B;  1H0M A;  2P5L C;  2RKH A;  3BPV A;  4PJL A;  1TP4 A;  3AAF A;  5LFA A;  1FLI A;  3FHZ A;  4XLC A;  3L2W A;  2A05 A;  1R4N B;  3ABM H;  2RV8 A;  4GXO A;  3VYR B;  3FK7 A;  4EAT A;  3LNQ A;  4Z6Y A;  2GAU A;  3H9G A;  2R5Y B;  3ZMS A;  1BOA A;  2XKP A;  4IHS A;  4AVZ A;  3TED A;  4LLL A;  2B7E A;  2HZT A;  3ZQI A;  2P6S A;  3HOY J;  2FF4 A;  2W85 A;  2IPQ X;  3LQQ A;  3J80 K;  3CCE I;  3MCZ A;  3A52 A;  4BGD A;  2OZ6 A;  4CZZ A;  3M9A A;  3C2G A;  4A3M J;  3CCJ I;  1JKQ C;  2NAZ A;  3CCV I;  4MGR A;  4D9J A;  3M7G A;  3DU5 A;  2BBY A;  2RGV A;  4GFB A;  5GTI C;  2DAO A;  1EH8 A;  1Z6T A;  3GTG J;  2JQ7 A;  4PZJ A;  3E5Q A;  4DBQ A;  1G8X A;  3VYS B;  4MLO A;  3LSP A;  2M7A A;  2AO9 A;  4L9N A;  5DCM B;  2EZL A;  5JHF A;  2NXN B;  2M0C A;  3HG9 A;  5H2F C;  1DU6 A;  4A3B J;  3MKY B;  2VJ5 A;  4LMY A;  4CUG A;  2COM A;  1MMA A;  1ONV A;  3PSI A;  1F36 A;  1BR2 A;  3KZZ A;  5GP9 A;  2IW5 A;  1W0U A;  4N9I A;  5EZG A;  4NQW A;  4EJO A;  3MKL A;  4FIS A;  1T98 A;  3D5R C;  2QBY B;  2FXA A;  4XRS G;  2KFD A;  5FO5 A;  4XON A;  3S32 A;  4XOP A;  3KYL A;  4C30 A;  4NC6 A;  2V26 A;  2PFB A;  2X9D A;  3BTJ A;  2OAZ A;  5JI6 A;  2XHK A;  3GTK J;  2W7N A;  2HDW A;  3HSF A;  2IT0 A;  4CA0 A;  3G6E I;  1HCR A;  2ZSH B;  2LRD A;  5DS9 A;  4J01 A;  1VQO I;  2E60 A;  3VYT B;  5DDG A;  1ZTR A;  2XGC A;  2IXS A;  1T33 A;  2O0Y A;  1P9Q C;  2IS6 A;  3BZ6 A;  3TDZ C;  2PJR A;  3BRO A;  3QU6 A;  3HRT A;  3TOA A;  1TNS A;  2F4M B;  5F1R A;  4L18 B;  1ITY A;  4YIR X;  1FYL A;  4FE4 A;  3HKZ N;  2CFX A;  2LK2 A;  2QQB A;  4A93 J;  3C3W A;  2MFZ A;  1O7L A;  2OU2 A;  3CME I;  2K9S A;  2JA6 J;  1VQL I;  3FX3 A;  2ADU A;  2VLA A;  1HDD C;  4A3J J;  4ZZL A;  2F5F A;  2O3F A;  3LAJ A;  4WCG A;  1X58 A;  1V5E A;  3HM5 A;  5M5X J;  1XN7 A;  2ZJP F;  1KU2 A;  4E7S A;  3V7S A;  1S8N A;  3CP8 A;  1HA8 A;  2M8E A;  1DP7 P;  3CCY A;  4E7J A;  1YHQ I;  5J3L A;  3JRG A;  1A35 A;  1K6Y A;  4PGG A;  3I59 B;  3BZK A;  3TBI A;  2NVX J;  4E7I A;  2Z9O A;  1MZB A;  3HB9 A;  1A31 A;  1FX7 A;  4WXH A;  3CES A;  2DFE A;  1Y1W J;  4ZDP A;  2LY2 A;  1JKP C;  4Y52 J;  1Z67 A;  2FBK A;  4CCM A;  4D7N A;  1MSF C;  2JWT A;  2XSJ C;  3HPG A;  1IGN A;  1FOY A;  1ZQ3 P;  1R9T J;  3F22 A;  1IRZ A;  3ZGK A;  4EMS A;  1FJL A;  1U5T C;  1FT9 A;  3E6B A;  3D0S A;  5KNL A;  2EBI A;  3WTT C;  4A2U A;  2ISY A;  1Z3X A;  4XLP F;  3A01 B;  1W7P B;  3TP3 A;  4C3H J;  4A0Y A;  5A2Q K;  2XAF A;  3JRH A;  3WTY C;  2LTP A;  1TWF J;  3CLQ A;  4CZC A;  5ERI A;  1Y0N A;  3QPL A;  2EIL H;  2HGC A;  3W2A A;  2O6G E;  3K70 C;  2HPI A;  1T0F C;  2E1M C;  1W1W E;  5CQG A;  4IHX A;  4RB0 A;  3OYK A;  3G2B A;  1VQ7 I;  1J09 A;  3SFZ A;  1PP8 F;  2W82 A;  3O2P E;  4OAZ A;  5E3L A;  4BY1 J;  4UV9 A;  3RJP A;  3H35 A;  2E5Z A;  3F6O A;  3QP6 A;  2HVR A;  4KYW A;  3QRF F;  4FTH A;  1D5Y A;  2Q1Z B;  5L3F A;  5M3F J;  4XIC A;  4BHP A;  4YFK F;  1SD6 A;  2DYR H;  3COA C;  3BG3 A;  4YEJ A;  4AWX B;  2QQ9 A;  4V2G A;  5H20 A;  4E7L A;  4OAY A;  4HNU A;  2XF5 A;  3IKT A;  1HKT A;  2P0T A;  1YJW I;  3HSE A;  2A69 F;  3BJA A;  1SFU A;  1MKM A;  1BIB A;  4PCQ A;  3DXJ F;  2JZY A;  2A5Y B;  2Q8K A;  3M1C A;  4P9F A;  3NAR A;  3RTR A;  2RRE A;  1A5J A;  3ZQ7 A;  3GCM A;  3JRC A;  2E1O A;  3BWG A;  4BH9 A;  2LSO A;  5EJC A;  3ASN H;  1S6L A;  2QKL B;  2OF7 A;  5M5W J;  3OYB A;  3UNG C;  1TQM A;  1S72 I;  1G59 A;  3ONQ A;  3HZJ A;  1NTC A;  3L7W A;  3P7N A;  1HXD A;  2KQR A;  1WSU A;  4B09 A;  2EFN A;  3F3X A;  4F91 B;  2HXI A;  3SZT A;  3ABT A;  3CJT B;  4LB6 B;  2KHM A;  4FQG A;  2JRM A;  4RS8 A;  2JJ7 A;  2ZB9 A;  3SQN A;  4QTR A;  4UVA A;  4QPO A;  5DCM A;  5KAF C;  2P8T A;  4LLN A;  1DDN A;  3CJN A;  4AD9 A;  2ID6 A;  2GM4 A;  3S14 J;  3KIO A;  4I2O A;  2R7R A;  2LY1 A;  3GBG A;  4YIF A;  1ZEL A;  3DBL B;  5LGU A;  1IO2 A;  4BE1 A;  3IAM 2;  2OBP A;  2M9H A;  3C7J A;  2QQ8 A;  2YPR A;  3ERM A;  4XSZ F;  4HF1 A;  1I1S A;  1X1A A;  3FXJ A;  1O3T A;  1UEL B;  2K3P A;  4UNO A;  4BEH B;  2VQC A;  2R7O A;  2MLK A;  2MD0 A;  3WG7 H;  2YU3 A;  5K1Y A;  2JUG A;  3VSK A;  1JKO C;  5L3E A;  1X4O A;  3K1N A;  3QOP A;  1RKW A;  3PO2 J;  2P6T A;  4B3X A;  4G7O F;  2V1X A;  3ZCO A;  2IGN A;  3Q9V A;  1ON2 A;  4BJ6 C;  2TRT A;  1JUP A;  2CQN A;  5HNH A;  1MDM B;  1X2M A;  2VKH A;  4BKX A;  1SD7 A;  1LQ1 A;  2UZK A;  2L7K A;  2P0W A;  3LL7 A;  5B5E C;  3K4L A;  2X6Y A;  2IVM A;  3BR6 A;  3GZ5 A;  3ZR8 X;  2FRH A;  2VE8 A;  3TP0 A;  2P81 A;  2GA1 A;  1RNL A;  3L09 A;  1OFC X;  4G7H F;  3GFL A;  2RVC A;  4X0G A;  1ZRE A;  2K4J A;  4C2M J;  1UG2 A;  2EQR A;  3H36 A;  1OCR H;  4CO8 A;  3JRD A;  4BDZ A;  1QZE A;  4MEY F;  3N97 A;  5D5V B;  3WTV C;  3N4M A;  1D8K A;  1WI9 A;  1HW2 A;  1VFC A;  4ZYA A;  4C2U A;  3U21 A;  2OC6 A;  4AIJ A;  1TTY A;  3G1M A;  2VC1 A;  2QEN A;  4Q48 A;  1TWG J;  4W1U A;  3W6K B;  2KIS A;  3VSL A;  4M72 A;  2BGC A;  1T8I A;  2BW3 B;  2L9V A;  3R6S A;  4IL6 C;  4JYK A;  3X2Q H;  1QQI A;  3G4S I;  2QWW A;  3CCM I;  5LLQ A;  1BI3 A;  5J40 A;  2H94 A;  1QRY A;  2M3A A;  2MC4 A;  4Z2Y A;  3I71 A;  2Z5U A;  3B73 A;  3KP4 A;  2NVT J;  1E3H A;  1AKH A;  3BG9 A;  4H4K C;  2VT3 A;  3S93 A;  1WPK A;  3BR5 A;  2F4I A;  4B47 A;  4LB5 A;  5FRO A;  5E8I A;  3IH4 A;  1K6O A;  3KLO A;  5F08 A;  4ZDL A;  1MIJ A;  1PJR A;  2NVY J;  1S5L C;  2WAE A;  3ZQH A;  1FWZ A;  4V2F A;  2MC3 A;  4F92 B;  3BR0 A;  1XSV A;  3J80 Z;  3GEZ A;  4HNV A;  1POG A;  4XKC A;  3VEP A;  2OCC H;  3W6J B;  2KIU A;  1IN5 A;  5FB2 A;  1FPQ A;  1XG1 A;  1JGG A;  1IDZ A;  2DK8 A;  4O5V A;  2ZJR F;  4XK4 A;  4UUS B;  2K5C A;  2E2J J;  1OCP A;  2VOD A;  4IRI A;  4RMN A;  1B6A A;  2MA3 A;  1R22 A;  1Q1V A;  2GZW A;  4XN3 A;  5GAH J;  2DDA A;  1XMX A;  3A03 A;  3TL4 X;  4PDK A;  1SFE A;  2DA5 A;  1BM9 A;  2WV1 A;  4M3G A;  1D1C A;  5D6F A;  5K7F A;  2CUF A;  2J5O A;  3H0G J;  1QA6 A;  3SZG A;  2KP6 A;  3RZO J;  1BJA A;  2BZT A;  2HS5 A;  4KDP A;  2M0M A;  1LUJ B;  2KKO A;  5CVU A;  4ZYH A;  4XRM A;  4HZF A;  5J6X A;  2R7T A;  2CG4 A;  3S1M J;  1Y0U A;  4IXA A;  1GXP A;  2EV0 A;  2FUG 2;  3U1K A;  1YIJ I;  2DMU A;  5EDN A;  1G3T A;  5CQE A;  1J0R A;  1FOW A;  1O4X A;  3H3Z A;  1B1B A;  4ZDO A;  1KA8 A;  1LE8 A;  4S05 A;  5H6R A;  3K2Z A;  1Y39 A;  5FLM J;  3FKJ A;  2DN0 A;  3GTQ J;  3HUG B;  4RB1 A;  2PN6 A;  5B1B H;  2VXD A;  3RYP A;  2IA1 A;  1BR1 A;  5FD5 A;  4RLF A;  3TQN A;  4L5I A;  3FDY A;  3BR3 A;  4OIQ F;  1MJA A;  2FEZ A;  4EGY A;  5IPA A;  4E7Z A;  2AQF A;  3DBR B;  4OOI A;  2HEO A;  2IGM A;  4XLF A;  5HLI A;  4B3A A;  5CYV A;  1BOB A;  1Y6I A;  3WU2 C;  1JKR C;  4JP0 A;  4FAS D;  1SD4 A;  1BL0 A;  2ZKZ A;  2FU4 A;  3JSO A;  3JAM K;  2DT6 A;  5EG0 B;  1QU3 A;  3TMO A;  3E6C C;  2L01 A;  2LH9 A;  3BG5 A;  3DFG A;  2X98 A;  1GHC A;  1S29 A;  1OJL A;  4F3Q A;  1IRG A;  3E3V A;  1FIA A;  4XOR A;  2BOL A;  5F0H A;  4YG2 F;  5E18 F;  4RM3 A;  2M2E A;  4DIQ A;  4PUS A;  5F1J A;  3NEU A;  1JGS A;  4LG0 A;  3SHF A;  1F1Z A;  2R7Z J;  2PI0 A;  1OPC A;  2DA7 A;  1YW9 A;  3DU6 A;  4LK1 F;  3GYH X;  3H5R A;  4E7H A;  1FYK A;  4I7H A;  4M9S A;  4I01 A;  4HA8 A;  5FGM A;  1AKH B;  2ISZ A;  1O7F A;  2R7S A;  4GRI A;  2QYO A;  2R4G A;  2VKE A;  5JHU A;  2BE5 F;  2VON A;  5L3G A;  2PG4 A;  2D5V A;  2PQ8 A;  3K4M A;  4OMY A;  1FOK A;  4BBS J;  2E1M B;  2LP0 A;  4IHV A;  4XL9 A;  4MQ9 F;  2K7L A;  1HW1 A;  2VOO A;  2IJL A;  3PNV A;  3M4O J;  1HKQ A;  4ZTJ A;  1XX5 A;  2E5N A;  4M3D A;  2E2I J;  3V8J A;  2EIJ H;  4I0B A;  3GW2 A;  2QSH X;  1VQ8 I;  1MD0 A;  2L7M P;  2QSF X;  1BI2 A;  4A0Z A;  1FIP A;  1RZ4 A;  3IRQ A;  4LIV A;  4II3 A;  3IAS 2;  4RB3 C;  3OL4 A;  4RAF A;  1LFB A;  2D1H A;  5F6F A;  2LBF A;  3S1R J;  3R4K A;  5IY5 H;  4I98 B;  1D1A A;  3BP8 A;  3K7A J;  3LAP A;  2QM3 A;  1WKM A;  5FKK A;  2DJN A;  4H0E A;  2VBY A;  2VQL A;  2XIG A;  1HQC A;  3EYY A;  2AQE A;  4PSW A;  1KU7 A;  1YOV B;  1YYV A;  4XBF A;  1BJZ A;  1IXC A;  4NQW B;  4A69 C;  1EJ9 A;  3ULQ B;  2V4J C;  4KT6 A;  5FKM A;  2CV0 A;  1T38 A;  2NVQ J;  2P7C B;  4GDF A;  3S3O A;  5IP6 A;  1WH7 A;  3J81 Z;  4YRV A;  2RN7 A;  1R1U A;  3RZD J;  3A0B C;  3LST A;  3CQZ J;  1KZH A;  2O03 A;  2Z33 A;  5BMZ A;  3ESW B;  3HL2 A;  1REP C;  3OIQ A;  4CGZ A;  1LEA A;  4QIW N;  5D4S A;  1W7P A;  5D4R A;  1VQK I;  4MO7 A;  3JRE A;  2O8K A;  3QAH A;  3WHB A;  4M3B A;  5E20 A;  3ZQC A;  1GVJ A;  2V7F A;  1RR7 A;  2GIZ A;  3G73 A;  2DA2 A;  4IOC F;  1LB2 A;  2JTV A;  3BY6 A;  3PO3 J;  5HVQ C;  4XN0 A;  2EWN A;  1I50 J;  1S9H A;  2W25 A;  3DEW A;  1UMQ A;  2VJ4 A;  3FMS A;  5CPR B;  1E17 A;  1IV6 A;  1CGP A;  1ZKG A;  1ZAR A;  3ZQQ A;  4EGZ A;  1ZRF A;  3F8M A;  1ZGW A;  3GFI A;  4P9U A;  2OTJ I;  2EA2 A;  2FNA A;  2K9N A;  5FRN A;  2DTZ A;  1F5T A;  2DLL A;  2IP2 A;  2XC7 A;  3BT9 A;  1U78 A;  4XKB A;  3IC7 A;  1HDP A;  1P6R A;  3JRB A;  2A6T A;  1KON A;  3FIW A;  2X4H A;  4KNY A;  1YS7 A;  1J2X A;  4YII A;  1G4D A;  1Y8R B;  2ZFU A;  4PGH A;  1E0E A;  1W5C C;  2I5U A;  2CU7 A;  4GYG A;  3HDD A;  3OYC A;  2XAG A;  3WU0 A;  4DW6 A;  1V55 H;  4HLY A;  3JRF A;  2VPR A;  1R6R A;  2CV1 A;  3N05 A;  4V19 K;  3RDI A;  2Q0O A;  4KIT B;  1B8I B;  3PIO F;  1APL C;  1JHH A;  2G0E A;  5LRR A;  3MD2 A;  4L9T A;  3U9G A;  3A1Y A;  3G3Z A;  1AWC A;  2CJJ A;  1BIA A;  1OIS A;  2A5W A;  2VAS A;  2PJP A;  3ZN0 A;  4BXU A;  3HHG A;  2COB A;  2XB0 X;  2CS3 A;  5J8C A;  1IRX A;  2DMQ A;  3LSJ A;  4I0A A;  3P9K A;  3M8F A;  1QPM A;  4XQF A;  4B1R A;  4XM3 A;  1MH3 A;  3M1E A;  3NWT A;  4XKV A;  5FLX R;  4D5F A;  1O57 A;  2RNJ A;  1X19 A;  2GA2 A;  3OR2 C;  1W36 D;  1STZ A;  2Y0S N;  1D8J A;  4UB6 C;  3CJQ B;  1DP3 A;  2KLO A;  1DGW Y;  3PNY A;  3RSN A;  1HST A;  3OYM A;  1ETO A;  4A6D A;  3OS1 A;  2FNP A;  1FY7 A;  5DD4 A;  4M6X A;  2H09 A;  4EEF G;  5L3C A;  2WAF A;  2BHY A;  5F27 A;  3QPH A;  3TO9 A;  4GCV A;  3FKI J;  1U6G A;  4A3G J;  5KCM A;  1HBX G;  3PFI A;  2QCO A;  4R8H A;  5L3D A;  3U2R A;  2OJE D;  2WA0 A;  5DYM A;  2BYV E;  2HYF A;  5F64 A;  2X6X A;  1UHW A;  1WFX A;  2JMW A;  3WTZ A;  3EDP A;  4U0V A;  3HKZ A;  1SFO J;  2FD5 A;  3FF5 A;  4BAY A;  2PEX A;  2JPB A;  3TDU C;  1WVR A;  3CCU I;  3HYI A;  2FQ3 A;  3K70 D;  2D1V A;  4KIF A;  3T5X A;  4KA4 A;  2MAB A;  2EB7 A;  1V54 H;  2A07 F;  5EF6 A;  1TLH B;  3F9K A;  1FP1 D;  3VFZ A;  2XSD C;  5J47 A;  2ICW G;  2ZME A;  3GLX A;  3CMA I;  4FET A;  2CW0 F;  4ESJ A;  3HPH A;  2MG4 A;  3B6A A;  3ZP5 A;  4C2T A;  5CKT A;  2RC4 A;  1P4X A;  4QWQ A;  4UY8 I;  3RYR A;  3F6V A;  3B6C A;  1XCB A;  3ZMU A;  3RIR A;  1OR7 C;  2GOX B;  5E1Z B;  1R23 A;  3U1D A;  3IRR A;  3CP2 A;  2Y0S A;  5M3M J;  1ZYR F;  2BXZ A;  2G7H A;  2M5W A;  3WHC A;  5A2Q Z;  2CQX A;  3WE2 A;  4ZYG A;  2HOA A;  1WHU A;  4HSR A;  3HOX J;  2ACJ A;  2ZC2 A;  2KIM A;  2L9R A;  3LOC A;  4PSX A;  4IPA A;  2VBX A;  4BUP A;  1UHM A;  1B59 A;  1G6N A;  3V8L A;  5JVG F;  1OKR A;  3BCB A;  3OIP A;  4ON0 A;  1YFH A;  3OYD A;  3A0H C;  1A36 A;  2LKP A;  4JK1 X;  4MTD A;  1ZH5 A;  3L00 A;  2NYX A;  2A3S A;  2JPC A;  3S3N A;  2DI3 A;  4PK4 A;  2R7X A;  3CDI A;  4HOB A;  4IEJ A;  2V6E A;  1K7A A;  3E1S A;  2QF7 A;  1G3W A;  5BPD A;  1VQM I;  2DQL A;  4BS9 A;  1MBJ A;  2JVG A;  2DMN A;  3QP5 A;  1BW6 A;  3DWL E;  1KQ9 A;  3HBL A;  5D5X B;  1JT6 A;  4Y15 A;  1RC9 A;  2W84 A;  2DDB A;  4HDU A;  4UB8 C;  5D6E A;  1YTY A;  3GTM J;  3ZOB A;  1EH6 A;  3BZC A;  3FBN B;  2VPL A;  1LJ9 A;  1G2H A;  4JQF A;  4RGX A;  1Z05 A;  3H1C A;  4B4C A;  5EEG A;  1RES A;  1W0T A;  1YJN I;  2MZ4 A;  3J81 R;  5J4V A;  3S2H J;  4U88 A;  3FXK A;  3ROU A;  2NNY A;  4D0P A;  4HF0 A;  4FX4 A;  2L7Z A;  2YS9 A;  2D45 A;  2WY7 Q;  3T8R A;  1X2N A;  5ILS A;  1B72 A;  1ZRC A;  2CO5 A;  2EFP A;  2AS5 F;  4Y17 A;  1MJ9 A;  2B63 J;  4A3C J;  4AC0 A;  3VPR A;  5E17 F;  2JVH A;  2ECB A;  2HVQ A;  5E8G A;  1R1V A;  3I4M J;  2HU9 A;  5FJ8 J;  3ASO H;  3KZY A;  1N75 A;  2PJR B;  2ZJQ F;  2EFO A;  4XRS A;  2DK5 A;  4ZH4 F;  2CMP A;  1VTN C;  1TWH J;  1WJD A;  3BJ6 A;  1NK2 P;  4N4O B;  2EFW A;  5K5Q A;  5ICC A;  5B3S H;  1SD5 A;  1FC3 A;  2CWE A;  4LLG F;  2E36 A;  1RRJ A;  5D8L B;  4N0B A;  2MH9 A;  1DGR M;  1B4A A;  1UCR A;  2HYG D;  3AFH A;  5GPC A;  2DT7 B;  4CYD A;  5AON A;  1QZZ A;  2JK3 A;  5B1A H;  4XLE A;  1MSE C;  4G94 A;  4G6T B;  2K9M A;  3DKX A;  3RPQ A;  4BBR J;  4LFU A;  3S1N J;  5CVI A;  4Y7N J;  2R0Q C;  2H1K A;  4XKW A;  3LSH A;  5LHI A;  2XRN A;  2DOF A;  1MBG A;  2UV1 A;  3BDD A;  3DKW A;  2QZ8 A;  3J7A O;  1D5V A;  5L3B A;  4U7D A;  1I1G A;  2Y9Z A;  1K78 A;  3TGN A;  2M30 A;  4HST A;  3I4N J;  5C4J J;  2H27 A;  1N78 A;  5EEA A;  1ETK A;  2Z3Y A;  5KAI C;  1YW7 A;  2PMZ A;  3Q9S A;  5IYD J;  5K7H A;  2BEO A;  2X85 A;  3SJM A;  3VDX A;  2JN6 A;  2LD5 A;  3PQK A;  3WE3 A;  2XPV A;  2HXO A;  2E71 A;  4YEL A;  1ZG3 A;  1WCM J;  3S16 J;  3DEE A;  5TGT A;  2UXX A;  4NDL A;  3FIS A;  2HI3 A;  1I3A A;  3BR2 A;  1T08 B;  4EVI A;  1A6I A;  4PJM A;  2G9W A;  2R7W A;  2E35 A;  2HYJ A;  1S7A A;  4MFE A;  4RLQ A;  2HQ5 A;  3AG3 H;  3PJR A;  4M71 A;  4M6V A;  4UUT A;  2QUF A;  4BHB A;  2FX0 A;  2DFF A;  2GWR A;  3O6B B;  2N8G A;  3RQ4 A;  3H3U A;  2HQA A;  1OCZ H;  2XDV A;  4DBR A;  3CDL A;  2K40 A;  3F72 A;  4AIH A;  1AOY A;  1FZP B;  5C4X J;  1Z9C A;  5HOD A;  3F21 A;  2B0L A;  3PFY A;  5LRS A;  2LOO A;  2OQG A;  2KZV A;  2JT1 A;  2TDX A;  3I0T A;  4KT5 C;  6PAX A;  1Z1D A;  3WTW C;  4WWC A;  3ERE D;  1HF0 A;  4Y13 A;  3L2R A;  4BXX J;  2XAS A;  1FBS A;  1YLF A;  2ZNZ A;  3ZMZ A;  3PUF A;  4DZJ A;  1KYW A;  4MHG A;  4KN7 X;  1SVL A;  4RAY A;  4NC7 A;  5CLS A;  4I76 A;  2HDD A;  1XPX A;  3GFM A;  1UJ8 A;  2JSP A;  3CCL I;  5DM6 F;  1I3Q J;  3NAU A;  1BW5 A;  3KX2 A;  2WC2 A;  2J5P A;  1VQ5 I;  1D0Z A;  4XLA A;  2XGD A;  1QHH D;  1JI8 A;  1LEB A;  1OR7 A;  3OYF A;  2HOS A;  3WOD F;  2EIM H;  4BQA A;  4RBO A;  1TQP A;  2KZG A;  4RA2 A;  2R93 J;  3OMY A;  5GAD J;  1VQN I;  1WJA A;  2XGE A;  3ABU A;  4NC8 A;  5M5Y J;  1U8R A;  2ELJ A;  3D5S C;  1WRJ A;  2HOT A;  1UHS A;  4HNT A;  1IN6 A;  4RGS A;  5D8K B;  3E0J B;  2GLO A;  2ESH A;  3T0Y A;  1K61 A;  4S04 A;  2P4W A;  3A01 A;  2VIX A;  3KPH A;  1S7O A;  3BQY A;  3K0L A;  1RI7 A;  4BAC A;  2HTJ A;  1NH3 A;  2FMY A;  3K4C A;  3IWF A;  2Y48 A;  4R1H A;  2VJI A;  1RR8 C;  2WB1 N;  2L9S A;  3FZV A;  1YRN A;  3CJR B;  2FBH A;  2XRL A;  4MTE A;  1U2W A;  2DTR A;  2PMH A;  3FMR A;  2DFI A;  2W00 A;  3HC7 A;  2XB5 A;  3I5U A;  4G6D A;  3O3K A;  4LJZ F;  2F6C A;  4S0H B;  3CMM A;  5FLX Z;  2DU9 A;  4DQ2 A;  1LKX A;  1MW7 A;  2JSC A;  4WF2 A;  1G3Y A;  1MND A;  1K79 A;  1IRF A;  3M07 A;  5ILU A;  4CSW A;  1LDK B;  4WXC A;  4HLX A;  1T2K A;  1D0X A;  3KEQ A;  1R5I D;  3JTH A;  3Q3S A;  4Q5S F;  2CFO A;  3OSF A;  2HZD A;  1QPI A;  1SFX A;  1U3E M;  2ZME B;  5HLG A;  1V5G A;  2HNH A;  3K1M A;  1IG7 A;  2EZK A;  3OOP A;  2PLY A;  2IA2 A;  1JTY A;  4Q47 A;  1YE9 A;  5F0F A;  4BY7 J;  1K4T A;  1FSH A;  4F55 A;  4XLN F;  2EV6 A;  1AHD P;  1BI1 A;  4CYC A;  2PBI A;  1ULY A;  4L0Z B;  2R7V A;  1X3U A;  4AID A;  3DBH B;  3PM1 A;  5ICE A;  1TT5 B;  3BTC A;  4FX0 A;  3VYU B;  1KQ0 A;  3EYI A;  1U5T B;  3KE2 A;  3ABK H;  5CVJ A;  2ZBK A;  1Z7L A;  3VB2 A;  1H88 C;  2MYS A;  3OYL A;  2OTL I;  4AVP A;  4A0X A;  1K78 B;  4C3I J;  1NG6 A;  4XID A;  2MGQ A;  1FNN A;  3FMQ A;  5TRD A;  3J80 R;  4JOM A;  5DCF A;  1JJ8 C;  1OCO H;  1IW7 F;  3BCA A;  1NG7 A;  3LMM A;  4P1W A;  1TBX A;  1U9O A;  5GTH C;  2WV0 A;  2NS0 A;  1WJB A;  2R5Z B;  1XDS A;  2M4K A;  1KQ8 A;  3LWF A;  3CUQ B;  4M9Z A;  4NHJ A;  1YO5 C;  5A2Q R;  4G9Y A;  3GWZ A;  2EH3 A;  3I55 I;  3BTL A;  3HGY A;  2BW3 A;  2X48 A;  1RET A;  3KP6 A;  4KUM A;  1BN5 A;  1N25 A;  3H3V K;  1ZG5 A;  1WQ2 A;  3G1L A;  5JFR A;  2XRO A;  3KFW X;  2I8D A;  3C1D A;  1XD7 A;  4I6Z A;  2ETH A;  4RAZ A;  1GUU A;  3LQR A;  3IUO A;  3KEO A;  3V7C A;  1PP7 U;  2CW8 A;  5IP9 J;  1Z91 A;  2L5Q A;  1WWX A;  1T6S A;  2H6B A;  2W4S A;  3IKV A;  1ZK8 A;  3I4P A;  4FT8 A;  2I10 A;  3IHU A;  1LVA A;  1O3S A;  1IN7 A;  4C3J J;  4QLC U;  1HKS A;  1MNM C;  4EQQ A;  4DJA A;  1YIO A;  4J19 A;  3R0A A;  1V5F A;  3I59 A;  1IXS B;  3GUD A;  2K85 A;  1TQI A;  1QVT A;  1MMN A;  1UB9 A;  1YI2 I;  1YW8 A;  1VQP I;  2XVC A;  3MZH A;  2V9P A;  1IAW A;  1IXR C;  2LNB A;  3GTL J;  3CMY A;  3K4N A;  1WJC A;  3T1B A;  4E70 A;  3F8C A;  1MBF A;  4A3K J;  2VI6 A;  3Q0V A;  2R3S A;  4II2 A;  3CCS I;  3IH3 A;  2EZI A;  3V8K A;  4ESB A;  4RGR A;  3FXL A;  2DFH A;  4RAG A;  4A3I J;  4MQV A;  5E3O A;  1YRN B;  5C44 J;  3QPS A;  2DXI A;  3GTO J;  1OCT C;  3E6M A;  1UAA A;  3D1N I;  2LMD A;  2NS7 A;  3TOB A;  3HEF A;  2O9L A;  2VBW A;  3HOU J;  2X51 A;  3KP5 A;  4F7Z A;  2F2E A;  1YS6 A;  1M1E B;  1H9T A;  2YUS A;  1Z21 A;  3K4J A;  3DLL F;  1UST A;  3CCQ I;  1XTA A;  2LFB A;  2WAQ N;  3JTG A;  2ZFW A;  1V3F A;  2ZXH A;  2HQN A;  4EV0 A;  3QQA A;  2F5E A;  1R71 A;  1GDT A;  4HX8 A;  1JHF A;  2EIK H;  2CH0 A;  4AUX A;  1R00 A;  1SMY F;  1Y56 A;  4BYY A;  2DJI A;  4BNC A;  2CW7 A;  2X1C A;  3F8B A;  2O7O A;  1W4M A;  3MWM A;  3J7Y J;  2X0L A;  3S8P A;  4U0Y A;  3HHH A;  2VC0 A;  4M3F A;  4IX7 A;  4IRG A;  3DPU A;  5IT3 A;  4J00 A;  1XGS A;  2STT A;  2Q2E A;  1XB4 A;  4IZZ A;  4TV7 A;  4HV6 A;  1F9N A;  2L54 A;  2NOJ B;  5ED4 A;  1XGM A;  1IN4 A;  2NNN A;  3EUH A;  5E1W A;  3OYI A;  3HOZ J;  3REO A;  3KP7 A;  2GQQ A;  2H8R A;  2Z2S B;  1P7J A;  4YFX F;  1PYV A;  4A3F J;  4JX5 A;  3MFK A;  2M1B A;  4GYI A;  2UUZ A;  3CUQ A;  2VL8 A;  2QA4 I;  4DYC A;  2NVU B;  1OCC H;  1S7E A;  4XR6 A;  2B9S A;  2A61 A;  4ENM A;  2Y2Z A;  2RDP A;  3QYF A;  2ID3 A;  1ZR2 A;  4XSX F;  3MQ0 A;  2ECC A;  3GXO A;  2NOG A;  2E34 A;  3CC7 I;  4FCY A;  5FLX K;  2L2O A;  3W2W A;  2E2H J;  1DUX C;  2ZXJ A;  3RKW A;  5LEK A;  3LA7 A;  1MJB A;  5DV5 A;  1MMS A;  4ZC3 A;  3VWB A;  3OIO A;  4B43 A;  4P55 A;  3WTU C;  3RPU A;  2BY1 A;  1ZN2 A;  3MAJ A;  2JA7 J;  5EG0 A;  2IGO A;  3GME A;  1R4M B;  1UZC A;  4ENJ A;  2HDC A;  3R0J A;  3MN2 A;  4XRF A;  1ETQ A;  3K6G A;  4HEA 2;  1XDU A;  3HSR A;  5JLW A;  2XAH A;  2BVM A;  3DTK A;  5FD6 A;  5LBQ A;  1VQ6 I;  4X6A J;  2XAU A;  1JUM A;  4D5C A;  1AA7 A;  3MKZ A;  4G7Z F;  2E1N A;  5JLX A;  3L2C A;  1Y8Q B;  3J7A Y;  1QHG A;  1GVD A;  1JUS A;  1TW2 A;  2M34 A;  1VZ0 A;  4CDG A;  1KGS A;  1D3Y A;  3MZ8 A;  2YSR A;  1EH7 A;  1QNT A;  2QEX I;  2QGU A;  1SAU A;  2OZU A;  4BHC A;  2VT2 A;  2CUE A;  4PFP A;  3VOD A;  2MSY A;  2JA5 J;  4X1E A;  1BC8 C;  3UKG A;  4M73 A;  2GOM A;  1ZGJ A;  2HR3 A;  3BQZ A;  3UR3 C;  5BQT A;  3FBI B;  2KRF A;  4KIC A;  4CHU A;  1Z3Y A;  2A6E F;  5DD8 A;  1QGP A;  2QSG X;  2NRA C;  1P2F A;  4M6Y A;  2XPW A;  2DT5 A;  3D5L A;  2BY3 A;  2KIQ A;  2R7Q A;  4F52 A;  2DA6 A;  3CDH A;  3DPL C;  3SDG A;  2F5C A;  5DUI A;  1H89 C;  2OA4 A;  3L2Q A;  1J59 A;  2UXN A;  1I6X A;  4IQJ A;  2W48 A;  4D7M A;  4LG0 B;  5HS9 A;  2XKO A;  4NUB A;  2GIV A;  3K4K A;  1LE8 B;  4IO9 F;  3A2K A;  1RUN A;  2CQ7 A;  1GV5 A;  4KMU X;  3E5U A;  5FFX A;  4ZJZ A;  2VJJ A;  3ZPL A;  5HDG A;  2F5D A;  3FXU A;  1HSJ A;  2DOA A;  5FFZ A;  4ZZD A;  5BS6 A;  4O6J A;  1C0W A;  4N9H A;  4Q4Z F;  1FOX A;  3TO6 A;  2BVL A;  1IJW C;  2GXB A;  1W36 C;  1TL8 A;  4IJA A;  2P5K A;  3HRM A;  4RGU A;  3OYH A;  4OIR F;  3JAM Z;  1VI0 A;  5J1U A;  2FSW A;  1J75 A;  1JTX A;  2EJR A;  4L0Y B;  1FMW A;  4MIM A;  3K1P A;  3OYG A;  4ITV A;  2RQQ A;  4AYB A;  4PJN A;  3BPX A;  1ENH A;  3DTI A;  4PJJ A;  4BDY A;  1R49 A;  4EM0 B;  1H8A C;  2M8G X;  3DLA A;  4KFC A;  2FML A;  3LA3 A;  3ISP A;  2W24 A;  3I56 I;  2KL4 A;  5IP7 J;  1B8I A;  4HV5 A;  5E3N A;  4PJ0 C;  5EEH A;  2CGP A;  3ZQF A;  2ZME C;  2ZNY A;  3RQI A;  2E1C A;  2V6C A;  1ZLK A;  4M3E A;  3DTE A;  2EV5 A;  3IP4 B;  4JBA A;  4U7B A;  2L4A A;  4NNJ A;  1T95 A;  1TWC J;  1MNE A;  4DNC A;  4IHY A;  2P5V A;  3WTX C;  2RNG A;  1GT0 C;  4LGW A;  3BR1 A;  2X6O A;  1W5S A;  3KET A;  2PX9 A;  3MKW B;  4HF2 A;  1XGO A;  1LPQ A;  1VQ9 I;  1Z0X A;  3GZ6 A;  3GVA A;  2DW4 A;  4ABZ A;  1WZ2 A;  2FOK A;  1XSD A;  3OYN A;  4U87 A;  2QVO A;  5TJJ A;  3W2V A;  4CCJ A;  1CF7 A;  3ZN1 A;  2QKM B;  2CV2 A;  3L2V A;  3OYA A;  5LGN A;  4HAM A;  2QLZ A;  4PFO A;  4UUS A;  5D5W B;  1X1D A;  1TWA J;  2ESN A;  2XGX A;  3LSK A;  2FQ4 A;  1EA3 A;  3R61 A;  2DMT A;  4L9J A;  3EUH C;  2KRH A;  3H9Q A;  2R7U A;  2O5R A;  4A3L J;  1R5H A;  4I09 A;  5KHD A;  4NBQ A;  3Q5F A;  1OYY A;  1YIT I;  2DYS H;  3EQL F;  1AU7 A;  4M74 A;  3ZMV A;  1DQU A;  4E6K G;  2L9N A;  5AIQ A;  2EK5 A;  2LF7 A;  1A6Q A;  4BEH A;  3LSI A;  2MVT A;  4L5E A;  5EYR A;  1XMK A;  1B72 B;  3WG9 A;  1X3Z B;  1RPW A;  4ESF A;  2LY9 A;  4BQO A;  3LSG A;  1K83 J;  4ZYD A;  4N4N B;  3LFU A;  2Z1D A; 
#chains in the Genus database with same CATH homology
 3DF8 A;  3GX4 X;  3S2W A;  4L5J A;  1KU3 A;  3ECH A;  4UVC A;  1ZRD A;  2ZJ2 A;  1USS A;  1Q1H A;  1DPR A;  4G6Q A;  4EM2 A;  1J7K A;  3MEX A;  4IHT A;  3FXQ A;  4P5O A;  2RQP A;  3SXY A;  2LDU A;  5HLH A;  5IT9 K;  4ENN A;  4EJV A;  3R60 A;  2YX4 A;  3VOE A;  3HUG A;  1MDM A;  4HQM A;  3IL2 A;  2QBY A;  3DP7 A;  3IWZ A;  2A68 F;  5HS8 A;  4CXF A;  5ICG A;  1R36 A;  3L9F A;  1J5Y A;  3GO5 A;  3V7R A;  3CUO A;  2HFH A;  2O8X A;  1A04 A;  3I54 A;  3KP3 A;  2EFQ A;  1MGT A;  1Z6R A;  2FE3 A;  2DPD A;  2V79 A;  4EJT A;  2FA5 A;  4OMZ A;  2BV6 A;  1BBY A;  2K27 A;  2K02 A;  1ZLJ A;  2P7V B;  3WGG A;  3T8T A;  3I64 A;  3C18 A;  2K4B A;  2DPU A;  1ZHF A;  4KIG A;  2H6C A;  3SZP A;  1J9I A;  4HDV A;  2YX7 A;  5JVT A;  3HTU A;  1E2X A;  4UVB A;  4OIO F;  4GGG A;  5LEJ A;  5KVR A;  1L3L A;  3P9I A;  4B8X A;  3E97 A;  2ZCW A;  1XCV A;  2VBZ A;  3JW4 A;  5DEQ A;  1ZAO A;  2ELH A;  3KP2 A;  1H9G A;  2VXZ A;  2DBB A;  4EJW A;  2KJC A;  1LDJ A;  2C6Y A;  4KMF A;  3BOQ A;  2V1U A;  4G8X A;  3FXR A;  1IF1 A;  2AXL A;  1XMA A;  3WTS C;  2LF8 A;  1W5T A;  3F8N A;  1L0O C;  1FP2 A;  3WGI A;  2R7F A;  4ASN A;  3LFK A;  3GFJ A;  3JSP A;  3ZMD A;  3K69 A;  1IZ1 A;  2HTS A;  4O3M A;  2L3D A;  3BJO A;  4RB2 C;  1RIO H;  2WWY A;  2UWM A;  5DUK A;  2CSO A;  3FM5 A;  2Y75 A;  2HQR A;  2Y0M A;  4A5N A;  2E7X A;  3HTS B;  3CTA A;  4KN4 X;  2EA4 A;  2MLG A;  2V9V A;  3B02 A;  4R79 A;  1ON1 A;  1JXS A;  3E5X A;  1IUY A;  4OIN F;  1PUE E;  2L02 A;  5ILV A;  3ELK A;  2PMU A;  1T39 A;  3KCC A;  3HOS A;  2M87 A;  3HRU A;  2CQK A;  3RI4 A;  4HX4 A;  1IN8 A;  4WXD A;  2G7U A;  1LNW A;  3J81 K;  3K9T A;  4UHT A;  2E7W A;  3GF2 A;  4IRH A;  1NHA A;  4GO1 A;  5LHH A;  2VE9 A;  1Z7U A;  2HKO A;  2JRT A;  5HS7 A;  4YFN F;  4ZYE A;  2STW A;  5J8F A;  4M9X A;  5E1X A;  3NQO A;  1KYZ A;  2Z99 A;  1BC7 C;  2MD5 A;  2CYY A;  1TW3 A;  3HIF A;  3DQV C;  3HOT A;  4LD5 A;  1YQA A;  1FSE A;  5ICF A;  4NB5 A;  2KIF A;  2XUB A;  1DPU A;  4P96 A;  4I02 A;  4A12 A;  2K86 A;  4WX9 A;  1QBJ A;  5BPI A;  4UXN A;  2R7D A;  1P4A A;  4MNU A;  2IA0 A;  1ODD A;  4OU0 A;  3CLO A;  5K5O A;  3F23 A;  2HOE A;  2DO7 A;  1JE8 A;  2XAJ A;  1FBU A;  3QPT A;  2OD5 A;  4HW0 A;  3DV8 A;  4HYE A;  1B9M A;  1ZG1 A;  2HWV A;  4EM1 A;  2D2W A;  5H6Q A;  4IF4 A;  3PQJ A;  1UFM A;  3FM3 A;  1W7P D;  5CJ9 A;  3F8F A;  1SMT A;  3MZY A;  2HKX A;  2VOP A;  4UUV A;  2GXG A;  4EJU A;  2QQA A;  3CO6 C;  1R5G A;  1P4W A;  5LGT A;  4HQE A;  1G3S A;  1O3Q A;  1QZY A;  1EV7 A;  1OYW A;  3E6D A;  4FHT A;  3FWE A;  2FBI A;  1OYI A;  1U5T A;  5D5U B;  3RKX A;  3DEU A;  2A6H F;  3DPT A;  3V4G A;  2ZO4 A;  1GXQ A;  5IT9 Z;  1I27 A;  1PDN C;  5JR3 A;  4HX7 A;  1SAX A;  3H92 A;  2M45 A;  3CUQ C;  4UV8 A;  1S3J A;  2V1D A;  1YG2 A;  2YR2 A;  3QU3 A;  1RUO A;  5HOO A;  1OMI A;  3ECO A;  5CVV A;  4ENK A;  3P9C A;  2IRF G;  5LHG A;  3ZMT A;  1QO0 D;  4IVN A;  1XSX A;  4L9V A;  3TO7 A;  3WU1 B;  3LA2 A;  1ZGA A;  1R58 A;  3HRS A;  2OQR A;  1HW5 A;  2O61 A;  1F4K A;  1R7J A;  3CO7 C;  1R1T A;  4U0W A;  5AIP A;  1KU9 A;  4HBL A;  2MBF A;  4OIP F;  2XAQ A;  1FYM A;  3TKY A;  4A6E A;  4KIB A;  4K2E A;  1O3R A;  5HDK A;  3ML6 A;  4A5M A;  1T0F A;  5BOX A;  1P92 A;  3KLN A;  5HDN A;  1BI0 A;  3NRV A;  1LDD A;  1FBQ A;  4CIC A;  2WTE A;  4LK0 F;  4ETS A;  5KK1 A;  4WK8 F;  3M8E A;  3I53 A;  1TNT A;  1XGN A;  1I5Z A;  2DQR A;  3EET A;  2VN2 A;  2W57 A;  3OV8 A;  2KJB A;  3WGH A;  4AIK A;  1V4R A;  5K5R A;  2L4M A;  2XV4 S;  1B9N A;  2MH2 A;  3I58 A;  5CVR A;  3RKY A;  1CF7 B;  1H0M A;  2P5L C;  2RKH A;  3BPV A;  3AAF A;  1FLI A;  3FHZ A;  2RV8 A;  4GXO A;  2GAU A;  3ZMS A;  1BOA A;  2XKP A;  4IHS A;  4LLL A;  2HZT A;  2P6S A;  2FF4 A;  2W85 A;  2IPQ X;  3LQQ A;  3J80 K;  3MCZ A;  2OZ6 A;  4CZZ A;  3M9A A;  2NAZ A;  4MGR A;  3M7G A;  2BBY A;  2RGV A;  2DAO A;  1EH8 A;  1Z6T A;  4PZJ A;  3E5Q A;  4L9N A;  5DCM B;  4LMY A;  2COM A;  1ONV A;  3KZZ A;  2IW5 A;  4N9I A;  4NQW A;  4EJO A;  1T98 A;  2QBY B;  2FXA A;  5FO5 A;  5JI6 A;  2PFB A;  2OAZ A;  2XHK A;  3HSF A;  2IT0 A;  5DDG A;  2O0Y A;  3BZ6 A;  3TDZ C;  3BRO A;  3QU6 A;  3HRT A;  3TOA A;  1TNS A;  5F1R A;  4L18 B;  1FYL A;  2CFX A;  2QQB A;  3C3W A;  1O7L A;  2OU2 A;  3FX3 A;  2ADU A;  4ZZL A;  2F5F A;  2O3F A;  3LAJ A;  4WCG A;  1XN7 A;  1KU2 A;  3V7S A;  1S8N A;  2M8E A;  1DP7 P;  4PGG A;  3I59 B;  2Z9O A;  1MZB A;  1FX7 A;  4WXH A;  2FBK A;  3F22 A;  4EMS A;  1U5T C;  1FT9 A;  3E6B A;  3D0S A;  3WTT C;  4A2U A;  2ISY A;  4XLP F;  1W7P B;  4A0Y A;  5A2Q K;  2XAF A;  3WTY C;  5ERI A;  2HGC A;  2O6G E;  4RB0 A;  3SFZ A;  1PP8 F;  3O2P E;  4UV9 A;  3RJP A;  3F6O A;  3QP6 A;  4KYW A;  3QRF F;  5L3F A;  4BHP A;  4YFK F;  1SD6 A;  3COA C;  4AWX B;  2QQ9 A;  5H20 A;  3IKT A;  1HKT A;  3HSE A;  2A69 F;  3BJA A;  1SFU A;  1MKM A;  1BIB A;  4PCQ A;  3DXJ F;  2JZY A;  2A5Y B;  2Q8K A;  4P9F A;  3RTR A;  3ZQ7 A;  3BWG A;  4BH9 A;  2LSO A;  1S6L A;  1TQM A;  3L7W A;  3P7N A;  1WSU A;  1HXD A;  4B09 A;  2EFN A;  3F3X A;  3SZT A;  3ABT A;  4LB6 B;  4RS8 A;  3SQN A;  4UVA A;  5DCM A;  2P8T A;  4LLN A;  1DDN A;  3CJN A;  4AD9 A;  4I2O A;  4YIF A;  5LGU A;  2OBP A;  3C7J A;  2YPR A;  4XSZ F;  4HF1 A;  1I1S A;  1O3T A;  4UNO A;  2MLK A;  5K1Y A;  2YU3 A;  5L3E A;  3K1N A;  3QOP A;  2P6T A;  4G7O F;  2V1X A;  3Q9V A;  1ON2 A;  4MEX F;  1MDM B;  1LQ1 A;  1SD7 A;  2UZK A;  2IVM A;  3GZ5 A;  2FRH A;  2VE8 A;  2GA1 A;  1RNL A;  3L09 A;  4G7H F;  3GFL A;  1ZRE A;  2RVC A;  2K4J A;  4CO8 A;  4MEY F;  3N97 A;  5D5V B;  3WTV C;  3N4M A;  1D8K A;  1WI9 A;  1HW2 A;  4AIJ A;  1TTY A;  2VC1 A;  2QEN A;  3W6K B;  4Q48 A;  4M72 A;  2BGC A;  3R6S A;  1QQI A;  2QWW A;  5LLQ A;  1BI3 A;  2H94 A;  4Z2Y A;  3I71 A;  2Z5U A;  3B73 A;  3KP4 A;  2VT3 A;  4LB5 A;  5E8I A;  1K6O A;  3KLO A;  1FWZ A;  2MC3 A;  1XSV A;  3J80 Z;  3GEZ A;  3VEP A;  3W6J B;  2KIU A;  1IN5 A;  5FB2 A;  1FPQ A;  2DK8 A;  4O5V A;  2VOD A;  4IRI A;  1B6A A;  2MA3 A;  1R22 A;  2GZW A;  4PDK A;  1SFE A;  1BM9 A;  5D6F A;  2J5O A;  1BJA A;  2HS5 A;  4KDP A;  2KKO A;  5CVU A;  4ZYH A;  4HZF A;  5J6X A;  2CG4 A;  1Y0U A;  4IXA A;  1GXP A;  2EV0 A;  1G3T A;  1J0R A;  3H3Z A;  1B1B A;  1KA8 A;  4S05 A;  5H6R A;  3K2Z A;  4RB1 A;  2PN6 A;  3RYP A;  2IA1 A;  5FD5 A;  3TQN A;  4L5I A;  4OIQ F;  1MJA A;  2FEZ A;  4EGY A;  4OOI A;  2HEO A;  5HLI A;  5CYV A;  1SD4 A;  2ZKZ A;  2FU4 A;  3JSO A;  3JAM K;  3E6C C;  2L01 A;  3DFG A;  1GHC A;  1S29 A;  1IRG A;  3E3V A;  5E18 F;  4YG2 F;  3NEU A;  1JGS A;  4LG0 A;  3SHF A;  1F1Z A;  2PI0 A;  1OPC A;  4LK1 F;  1YW9 A;  3GYH X;  1FYK A;  4I7H A;  4M9S A;  4I01 A;  4HA8 A;  5FGM A;  2ISZ A;  1O7F A;  2QYO A;  5JHU A;  2VON A;  2BE5 F;  5L3G A;  2PG4 A;  2PQ8 A;  4OMY A;  1FOK A;  4MQ9 F;  2K7L A;  1HW1 A;  2VOO A;  2IJL A;  1HKQ A;  3V8J A;  4I0B A;  3GW2 A;  1MD0 A;  1BI2 A;  4A0Z A;  1RZ4 A;  3IRQ A;  4RB3 C;  2D1H A;  5F6F A;  3R4K A;  4I98 B;  3BP8 A;  3LAP A;  2QM3 A;  1WKM A;  4H0E A;  2VBY A;  2XIG A;  1HQC A;  3EYY A;  1KU7 A;  1YYV A;  4XBF A;  1IXC A;  3ULQ B;  1T38 A;  2P7C B;  3J81 Z;  2RN7 A;  1R1U A;  3LST A;  5BMZ A;  2O03 A;  2Z33 A;  1REP C;  4CGZ A;  1LEA A;  5D4S A;  1W7P A;  5D4R A;  3QAH A;  5E20 A;  1GVJ A;  3G73 A;  1LB2 A;  2JTV A;  3BY6 A;  5HVQ C;  2EWN A;  2W25 A;  3FMS A;  1E17 A;  1CGP A;  1ZAR A;  4EGZ A;  1ZRF A;  3F8M A;  3GFI A;  4P9U A;  2EA2 A;  2FNA A;  1F5T A;  2DLL A;  2IP2 A;  1U78 A;  3IC7 A;  1P6R A;  2X4H A;  4KNY A;  1YS7 A;  1J2X A;  4YII A;  1G4D A;  4PGH A;  4GYG A;  2XAG A;  3WU0 A;  4HLY A;  3RDI A;  2Q0O A;  1JHH A;  5LRR A;  4L9T A;  3U9G A;  3G3Z A;  1AWC A;  1BIA A;  2PJP A;  3ZN0 A;  4BXU A;  3HHG A;  5J8C A;  4I0A A;  3P9K A;  3M8F A;  1QPM A;  3M1E A;  1O57 A;  2RNJ A;  2GA2 A;  1STZ A;  1D8J A;  1HST A;  4A6D A;  2FNP A;  1FY7 A;  5DD4 A;  4M6X A;  2H09 A;  5L3C A;  3QPH A;  3TO9 A;  4GCV A;  1U6G A;  1HBX G;  3PFI A;  4R8H A;  5L3D A;  3U2R A;  5DYM A;  2BYV E;  2HYF A;  5F64 A;  1UHW A;  3WTZ A;  3EDP A;  4U0V A;  3FF5 A;  4BAY A;  2PEX A;  2JPB A;  3TDU C;  3HYI A;  2FQ3 A;  2D1V A;  4KIF A;  3T5X A;  4KA4 A;  2EB7 A;  2A07 F;  1TLH B;  1FP1 D;  3VFZ A;  2ZME A;  3GLX A;  2CW0 F;  4ESJ A;  3ZP5 A;  2RC4 A;  1P4X A;  4QWQ A;  3RYR A;  3F6V A;  3ZMU A;  1XCB A;  3RIR A;  5E1Z B;  1R23 A;  3U1D A;  3IRR A;  5A2Q Z;  1ZYR F;  2G7H A;  2M5W A;  3WE2 A;  4ZYG A;  2ACJ A;  2KIM A;  4IPA A;  2VBX A;  1UHM A;  1B59 A;  1G6N A;  3V8L A;  1OKR A;  4ON0 A;  1YFH A;  2LKP A;  4JK1 X;  4MTD A;  1ZH5 A;  3L00 A;  2NYX A;  2A3S A;  2JPC A;  2DI3 A;  4HOB A;  1K7A A;  5BPD A;  1G3W A;  2DQL A;  3QP5 A;  1KQ9 A;  5D5X B;  4Y15 A;  2W84 A;  4HDU A;  5D6E A;  1YTY A;  1EH6 A;  1LJ9 A;  4JQF A;  4RGX A;  1Z05 A;  5EEG A;  4U88 A;  3ROU A;  2NNY A;  4D0P A;  4HF0 A;  4FX4 A;  2D45 A;  3T8R A;  5ILS A;  1ZRC A;  2CO5 A;  2EFP A;  2AS5 F;  4Y17 A;  1MJ9 A;  5E17 F;  5E8G A;  1R1V A;  3KZY A;  2EFO A;  2DK5 A;  4ZH4 F;  1VTN C;  3BJ6 A;  2EFW A;  5K5Q A;  5ICC A;  1SD5 A;  1FC3 A;  2CWE A;  4LLG F;  5D8L B;  4N0B A;  2MH9 A;  1B4A A;  1UCR A;  2HYG D;  4CYD A;  5AON A;  1QZZ A;  4G94 A;  3RPQ A;  4LFU A;  5CVI A;  5LHI A;  2XRN A;  3BDD A;  3DKW A;  2QZ8 A;  3J7A O;  1D5V A;  5L3B A;  4U7D A;  1I1G A;  1K78 A;  3TGN A;  2M30 A;  2H27 A;  2Z3Y A;  1YW7 A;  3Q9S A;  2BEO A;  3PQK A;  3WE3 A;  1ZG3 A;  2UXX A;  4EVI A;  2G9W A;  1S7A A;  4M71 A;  2QUF A;  4BHB A;  2GWR A;  3O6B B;  3H3U A;  3F72 A;  4AIH A;  1AOY A;  1FZP B;  1Z9C A;  3F21 A;  2B0L A;  5LRS A;  2OQG A;  2JT1 A;  2TDX A;  3I0T A;  4KT5 C;  6PAX A;  1Z1D A;  3WTW C;  4WWC A;  3ERE D;  4Y13 A;  2XAS A;  1FBS A;  1YLF A;  2ZNZ A;  3ZMZ A;  1KYW A;  4MHG A;  4KN7 X;  4RAY A;  5CLS A;  3GFM A;  2WC2 A;  2J5P A;  1LEB A;  1OR7 A;  3WOD F;  4BQA A;  1TQP A;  1U8R A;  3ABU A;  1WRJ A;  1IN6 A;  4RGS A;  5D8K B;  2ESH A;  3T0Y A;  4S04 A;  2P4W A;  1S7O A;  3K0L A;  1RI7 A;  2HTJ A;  2FMY A;  3IWF A;  2Y48 A;  4R1H A;  3FZV A;  2FBH A;  4MTE A;  1U2W A;  2DTR A;  2PMH A;  3FMR A;  2DFI A;  3I5U A;  4G6D A;  3O3K A;  4LJZ F;  5FLX Z;  2DU9 A;  4DQ2 A;  2JSC A;  4WF2 A;  1G3Y A;  1K79 A;  1IRF A;  5ILU A;  1LDK B;  4WXC A;  4HLX A;  1T2K A;  3KEQ A;  3JTH A;  4Q5S F;  1SFX A;  1U3E M;  2ZME B;  5HLG A;  3K1M A;  3OOP A;  2PLY A;  2IA2 A;  4Q47 A;  1FSH A;  4XLN F;  2EV6 A;  1BI1 A;  2PBI A;  1ULY A;  4L0Z B;  1X3U A;  5ICE A;  4FX0 A;  1KQ0 A;  3EYI A;  1U5T B;  3KE2 A;  5CVJ A;  2ZBK A;  3VB2 A;  4AVP A;  4A0X A;  1K78 B;  1FNN A;  3FMQ A;  5TRD A;  5DCF A;  1IW7 F;  1TBX A;  2WV0 A;  2NS0 A;  1XDS A;  1KQ8 A;  3LWF A;  3CUQ B;  4M9Z A;  4NHJ A;  1YO5 C;  4G9Y A;  3GWZ A;  3KP6 A;  4KUM A;  1BN5 A;  1ZG5 A;  1WQ2 A;  5JFR A;  2XRO A;  3KFW X;  3C1D A;  1XD7 A;  2ETH A;  4RAZ A;  3LQR A;  3KEO A;  1PP7 U;  3V7C A;  1Z91 A;  3IKV A;  1WWX A;  1T6S A;  2H6B A;  3I4P A;  4FT8 A;  3IHU A;  1LVA A;  1O3S A;  1IN7 A;  4QLC U;  1HKS A;  4EQQ A;  1YIO A;  3R0A A;  3I59 A;  1IXS B;  3GUD A;  1TQI A;  1UB9 A;  1YW8 A;  2XVC A;  3MZH A;  1IAW A;  1IXR C;  2LNB A;  4E70 A;  3T1B A;  3F8C A;  2R3S A;  3V8K A;  4ESB A;  4RGR A;  4MQV A;  3E6M A;  3TOB A;  2VBW A;  3KP5 A;  4F7Z A;  2F2E A;  1YS6 A;  1H9T A;  1UST A;  3JTG A;  2ZFW A;  1V3F A;  2HQN A;  4EV0 A;  2F5E A;  4HX8 A;  1JHF A;  1R00 A;  1SMY F;  4BYY A;  4BNC A;  3F8B A;  1W4M A;  3MWM A;  2X0L A;  4U0Y A;  3HHH A;  2VC0 A;  4IRG A;  5IT3 A;  2STT A;  1XGS A;  2Q2E A;  1XB4 A;  4TV7 A;  4HV6 A;  1F9N A;  2L54 A;  5ED4 A;  1XGM A;  1IN4 A;  2NNN A;  3EUH A;  5E1W A;  3REO A;  3KP7 A;  2GQQ A;  4YFX F;  3MFK A;  2M1B A;  4GYI A;  3CUQ A;  2A61 A;  4ENM A;  2RDP A;  4XSX F;  3MQ0 A;  3GXO A;  5FLX K;  1DUX C;  2ZXJ A;  3RKW A;  5LEK A;  3LA7 A;  1MJB A;  5DV5 A;  4P55 A;  3WTU C;  3RPU A;  1ZN2 A;  3MAJ A;  2HDC A;  4ENJ A;  3R0J A;  4XRF A;  1XDU A;  3HSR A;  2XAH A;  5FD6 A;  5LBQ A;  4G7Z F;  2E1N A;  3L2C A;  1TW2 A;  4CDG A;  1KGS A;  1D3Y A;  2YSR A;  1EH7 A;  1QNT A;  4BHC A;  2OZU A;  2VT2 A;  3VOD A;  1BC8 C;  4M73 A;  1ZGJ A;  2HR3 A;  5BQT A;  2KRF A;  4KIC A;  4CHU A;  2A6E F;  5DD8 A;  1QGP A;  2NRA C;  1P2F A;  4M6Y A;  2DT5 A;  3D5L A;  3CDH A;  3DPL C;  2F5C A;  5DUI A;  2OA4 A;  1J59 A;  2UXN A;  1I6X A;  4LG0 B;  5HS9 A;  2XKO A;  2GIV A;  1RUN A;  4KMU X;  3E5U A;  5FFX A;  3ZPL A;  5HDG A;  2F5D A;  3FXU A;  1HSJ A;  5FFZ A;  4ZZD A;  5BS6 A;  4O6J A;  1C0W A;  4N9H A;  4Q4Z F;  3TO6 A;  2GXB A;  4IJA A;  2P5K A;  3HRM A;  4RGU A;  4OIR F;  3JAM Z;  2FSW A;  1J75 A;  2EJR A;  4L0Y B;  3K1P A;  3BPX A;  4EM0 B;  4KFC A;  2FML A;  3LA3 A;  3ISP A;  2W24 A;  4HV5 A;  5EEH A;  2CGP A;  2ZNY A;  2E1C A;  2V6C A;  1ZLK A;  2EV5 A;  4JBA A;  4U7B A;  2L4A A;  4DNC A;  2P5V A;  3WTX C;  4LGW A;  1W5S A;  3KET A;  4HF2 A;  1XGO A;  3GZ6 A;  3GVA A;  2DW4 A;  2FOK A;  1XSD A;  5TJJ A;  2QVO A;  1CF7 A;  3ZN1 A;  5LGN A;  4HAM A;  2QLZ A;  5D5W B;  2ESN A;  2XGX A;  3R61 A;  4L9J A;  1R5H A;  4I09 A;  3Q5F A;  1OYY A;  3EQL F;  4M74 A;  3ZMV A;  5AIQ A;  2EK5 A;  2LF7 A;  1XMK A;  3WG9 A;  4ESF A;  4ZYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...