2EV5A

Bacillus subtilis manganese transport regulator (mntr) bound to calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
136
structure length
132
Chain Sequence
b'TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 54
structure length 132
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev5A02
2ETHA 4WCGA 3K0LA 1R1VA 4G7HF 4HQMA 3CJNA 3R60A 2GA2A 3GO5A 2A5YB 2BYVE 4IHTA 1ZARA 3IL2A 4CGZA 1FC3A 1USSA 1ON2A 1XGSA 4AIHA 4UUVA 2XV4S 1BIAA 2FNPA 5DD8A 1MDMB 3FXUA 2IRFG 5E8IA 4PDKA 4I0AA 4BHCA 3K1NA 1I6XA 5E1XA 1FP2A 3TDZC 3K1MA 3K2ZA 4HDUA 4LK1F 4KN7X 4KIBA 1XGNA 2PMUA 4BH9A 3JSOA 4AD9A 3GUDA 1J75A 2ZNZA 2EFPA 4B8XA 1WSUA 3F8MA 1H0MA 1FPQA 2K4JA 2A6EF 3L7WA 2FEZA 2P6TA 1MZBA 2DT5A 1Z05A 2Y0MA 5H6QA 4L5IA 1UHWA 4HOBA 2HDCA 1XCBA 5D8KB 5D4RA 3G73A 5JHUA 1R23A 2H6CA 3V8LA 4ESBA 3HRTA 3IC7A 4XSXF 4H0EA 2FMYA 5K1YA 4KA4A 1W7PB 2Z5UA 5ILSA 4I01A 5E17F 3TOBA 4HQEA 1D3YA 4GYGA 3V7CA 2EV0A 3EDPA 4P9UA 4TV7A 4BXUA 4MTEA 1F5TA 4QLCU 1RUOA 5D5XB 3WTTC 5KK1A 3DF8A 5ICCA 1RUNA 2HGCA 5LBQA 3ML6A 4KICA 2P4WA 2VBZA 1R36A 5E20A 5LEKA 1YIOA 2QM3A 2QQAA 3RYRA 4F7ZA 4OOIA 1L3LA 3IWZA 1UCRA 1XMKA 3SQNA 4ZYDA 4EJUA 2FNAA 4A2UA 1KU9A 3WGGA 3TGNA 2EFOA 4CYDA 2VN2A 1ZG5A 1CF7B 3FHZA 1XSDA 4OMYA 3KEOA 4KIFA 1YG2A 4I09A 1HSJA 2LKPA 1B4AA 3ZN1A 1G4DA 5BS6A 4JQFA 5LHGA 2H94A 2NYXA 3ECHA 5L3FA 3ZMTA 2E7XA 5LRSA 3QPHA 3N4MA 1OYYA 4UVBA 2QBYB 3V7SA 1U2WA 4ETSA 5BQTA 3JAMZ 4P55A 2L54A 2A69F 2IJLA 1GXPA 3DKWA 3RDIA 4A5NA 2IW5A 2O03A 4N9IA 4UHTA 4L9VA 1FBSA 2LF7A 4HZFA 2M87A 2L3DA 3MZHA 4MEYF 3PFIA 2HQRA 1ZYRF 3R0AA 3DV8A 3F72A 4XLNF 2XAFA 2PBIA 6PAXA 1OMIA 1ZG1A 1Y0UA 5HS7A 3DQVC 5DUIA 3I54A 2CW0F 3BZ6A 4CHUA 3VEPA 5EEGA 1MDMA 3MWMA 5LEJA 4IRHA 4LB5A 4P5OA 4EM0B 1BM9A 3CUQC 2HEOA 1FYKA 4D0PA 3V7RA 3ZMVA 3EUHA 1YQAA 3L00A 3ULQB 2IVMA 2L01A 2PMHA 1LEAA 1J5YA 5EEHA 3R6SA 2P7CB 3H3UA 4I2OA 3BJAA 3WTXC 4MQVA 2HYFA 4WX9A 4RAZA 5CVIA 1RI7A 1XGOA 3HOSA 2XASA 5CVUA 4UVCA 3I59B 4NQWA 1IXSB 2K02A 3T5XA 1D8KA 3HRSA 1H9GA 1QNTA 2STWA 4S04A 3WGIA 3I71A 2UWMA 4WWCA 4IXAA 2V79A 2OD5A 1FZPB 4CO8A 2D2WA 3WTSC 3WTUC 3V8KA 1SD6A 3SZPA 1W7PA 3K9TA 5K5OA 2W25A 1FYMA 4I7HA 3TO7A 4EJTA 3D5LA 3LSTA 4JBAA 1SFEA 4OMZA 2KKOA 3Q5FA 2P5VA 4DQ2A 3E6DA 4LG0A 3T0YA 4ZH4F 4YIFA 2PLYA 2D1VA 3B02A 1GVJA 1KU2A 5F6FA 1BOAA 4A6DA 2RKHA 3HYIA 5LGNA 4ENKA 1WRJA 5E1WA 3O2PE 1YS7A 1IXRC 2FA5A 1R5HA 4AIKA 1ZHFA 3TQNA 1ONVA 4G9YA 2VXZA 1LJ9A 3LA2A 1CF7A 5HDGA 3HUGA 2FBIA 3SXYA 3VFZA 3LQQA 4UV9A 4U0WA 2O0YA 2ESNA 5LHIA 1G3YA 2ELHA 4YG2F 3TKYA 5AIPA 1XSXA 2CG4A 2XVCA 4KMUX 1ZREA 3FXRA 1R7JA 3ABTA 5LRRA 3KZYA 4G7ZF 2XUBA 2QBYA 2A3SA 1DPUA 1XDSA 3D0SA 2FBHA 1HKQA 4EJVA 2A61A 1AOYA 3ECOA 4ON0A 1BC7C 1YO5C 1FLIA 3BP8A 1E2XA 4A0ZA 1KYWA 2HS5A 1YYVA 3HHHA 2RGVA 1T2KA 2ZMEB 1FT9A 5L3GA 2WV0A 4GXOA 3GLXA 3GZ6A 3F8BA 5D5VB 1U78A 3RPUA 4NB5A 3FM5A 3W6JB 5HLIA 2LF8A 1LB2A 5K5QA 1ZGJA 2VE9A 1R58A 2PJPA 2HKOA 5ICEA 3FWEA 2W85A 5CVVA 1XN7A 3CLOA 2GXGA 3U1DA 4KFCA 1T98A 1KQ9A 1SD4A 2OZUA 4HX7A 4HF2A 4G6DA 5L3BA 2F5EA 3GZ5A 4AVPA 1Z6TA 5DYMA 3KLNA 2B0LA 1I27A 4BAYA 3C18A 1LDJA 2JT1A 3QPTA 2K7LA 3ZQ7A 4L5JA 2ZCWA 3I59A 1O3TA 3WODF 1XD7A 3SFZA 3J81Z 4R1HA 4YFNF 3B73A 1FNNA 2P5LC 2HWVA 2X0LA 4WF2A 2GZWA 3HRMA 1OYWA 5L3DA 4CICA 2ZO4A 2PI0A 3COAC 5A2QK 2NRAC 1A04A 5D4SA 2RNJA 4G8XA 2EWNA 2W57A 5IT9K 2FE3A 1FSHA 2IP2A 3KP5A 3J80Z 3U2RA 2Q8KA 1HW1A 5ILVA 4Q4ZF 2F5FA 3ZMDA 2XGXA 3DFGA 4N0BA 5CJ9A 4ESFA 1FSEA 1S7AA 3F21A 1J0RA 4I0BA 2ACJA 3BDDA 1ON1A 4EVIA 1UFMA 1IRGA 1TQIA 3FF5A 1TTYA 2YPRA 1OR7A 3N97A 3DP7A 4LD5A 4U7DA 4M9XA 2MLKA 4R8HA 2FQ3A 3QOPA 4N9HA 2XKOA 2HOEA 2FXAA 2OQGA 1FX7A 3K69A 3O6BB 4ZYGA 1PP7U 1BC8C 1D5VA 5DEQA 3KP4A 1SFXA 2OU2A 4UNOA 4AWXB 2QQ9A 3EETA 2KJBA 2DPDA 2BV6A 2GXBA 2W24A 3DXJF 3SZTA 4KMFA 2HTSA 5FB2A 3GF2A 3IHUA 1BI2A 2Q0OA 2Y75A 1T6SA 2HKXA 3H92A 1SFUA 1QZZA 1MKMA 2ZNYA 3LA7A 1REPC 1E17A 4XSZF 1IN4A 3KLOA 1YW7A 2Z3YA 3BROA 2DBBA 2K4BA 1SMYF 3V4GA 4LG0B 1S6LA 5FFXA 4PCQA 4CDGA 2CGPA 4FX0A 1TLHB 2XAGA 2ZMEA 3CUOA 3LWFA 2ZJ2A 2BBYA 2E7WA 4K2EA 3M7GA 2P6SA 4IVNA 3FZVA 4L9JA 3RI4A 3T8TA 3IKVA 4BNCA 2D1HA 3G3ZA 4B09A 4ENNA 2WWYA 2JPCA 2CFXA 2C6YA 3RYPA 1O3QA 3KEQA 3TOAA 3DEUA 4U0YA 1C0WA 2WC2A 4A6EA 5J8FA 4HDVA 1LDKB 5CVRA 1USTA 3WTVC 2PN6A 4EMSA 4MEXF 4HA8A 2XRNA 3F8CA 3BPXA 2XAQA 4OIRF 2RVCA 1VTNC 1YLFA 4U88A 3M1EA 2CSOA 2XHKA 3U9GA 2MC3A 2V1DA 3P7NA 2IA2A 4EJOA 2IT0A 4EGYA 2HYGD 4RGRA 5DD4A 5HLGA 3QU6A 3WE3A 3E3VA 4NHJA 4O3MA 2DFIA 2EV5A 1O57A 3GFMA 5LGUA 1O7LA 2GAUA 1RIOH 1P2FA 2F2EA 2CO5A 2O6GE 1U5TB 1FBUA 3CTAA 4EM2A 2OBPA 5AIQA 3I4PA 2LDUA 3IRQA 5FLXZ 2IPQX 2AS5F 3TO6A 5IT3A 3IKTA 1NHAA 2DQLA 2GA1A 2VOPA 2FU4A 1LVAA 3RTRA 2EFNA 4P96A 1L0OC 5E1ZB 1T38A 3FMQA 1ULYA 3KP3A 2QUFA 1J7KA 2MBFA 1WKMA 4U7BA 3LA3A 1PDNC 3CO7C 4HF0A 4IRIA 4O6JA 5ICFA 2EB7A 3FX3A 1IW7F 5AONA 5BPIA 3T1BA 1U6GA 2L4AA 1P4XA 3L2CA 2W84A 2RN7A 3HSFA 1LNWA 1P6RA 3E6BA 4GGGA 1HKTA 1ODDA 1HW2A 2OZ6A 2VODA 1S29A 1U5TC 2FRHA 3P9KA 4ZYHA 1BBYA 2KIUA 4JK1X 2QQBA 1JHFA 4RGUA 3FMSA 1BI1A 3KP2A 4EM1A 2VE8A 3JAMK 3AAFA 2EFQA 4XBFA 3VB2A 1PP8F 4MQ9F 3WE2A 4M71A 4DNCA 3GX4X 2O3FA 1F1ZA 2DLLA 1TBXA 4G94A 4M6XA 1FBQA 3OOPA 2F5CA 4M9SA 1IN8A 4Z2YA 1UHMA 2WTEA 3WTZA 5JR3A 2VONA 3F22A 2NAZA 5HOOA 2PEXA 2OA4A 1YW9A 2EJRA 1EH8A 2DW4A 2R7FA 4FX4A 2EA2A 3OV8A 1HBXG 3EQLF 3QAHA 2JZYA 4GYIA 2RC4A 4KIGA 3E6CC 3QP5A 4WXCA 3FMRA 1P92A 5D6FA 1KU7A 1K79A 2IA0A 4ENJA 3L09A 2HFHA 1PUEE 1RZ4A 1OYIA 3ABUA 3V8JA 4BHBA 1KGSA 1D8JA 4HX4A 1ZLKA 5ILUA 1BIBA 1XCVA 4M72A 3I64A 2XROA 2UZKA 2YX7A 2X4HA 2CWEA 1UB9A 2R3SA 1P4AA 1DUXC 1LEBA 5HLHA 3BPVA 1ZH5A 2ZXJA 5HS8A 3WU0A 4RB3C 4MTDA 1TW3A 1W7PD 1SAXA 1U5TA 2OAZA 3M8EA 4GCVA 2QYOA 2ZFWA 5J8CA 1IXCA 3KP7A 2BE5F 2HTJA 4OIQF 3PQKA 5K5RA 1YW8A 2PG4A 4HYEA 3IRRA 1MJ9A 2KRFA 3QP6A 3WU1B 2VC1A 3HSRA 3LFKA 4EV0A 4HF1A 1FWZA 1K6OA 1ZRFA 1H9TA 3LQRA 1WWXA 2M45A 5D5UB 4HX8A 1IZ1A 3I5UA 1IRFA 1KU3A 4PGGA 2D45A 3E5UA 3BOQA 4RS8A 1V4RA 1R00A 1BJAA 1DPRA 1QPMA 1W5TA 2M30A 1Q1HA 4L9TA 2YU3A 2ESHA 5DCFA 2IA1A 1LDDA 2CYYA 4RAYA 1G3TA 2G9WA 2QENA 1K7AA 1O3RA 1Z7UA 2ISYA 5D8LB 2STTA 5LHHA 1U3EM 3TDUC 2ADUA 1TQPA 2OQRA 2P8TA 2KIFA 3JTGA 1MD0A 2AXLA 1XMAA 2K86A 1FYLA 1QGPA 5JI6A 3JSPA 4UV8A 3H3ZA 1BI0A 2PFBA 4MHGA 3GFJA 1MJAA 4L9NA 5FO5A 1G6NA 1IN6A 2DK8A 3CDHA 4BHPA 1JGSA 5HS9A 3BWGA 1WQ2A 3GEZA 5H6RA 3QRFF 2L02A 1HXDA 5HDNA 1ZN2A 4Y17A 3E6MA 2VT3A 2G7UA 3JW4A 1I1GA 1GHCA 2QLZA 5FGMA 3WTYC 4HLYA 1ZG3A 2P7VB 2LSOA 4EQQA 2FOKA 4Y13A 3GWZA 3C1DA 1Z9CA 2L4MA 1U8RA 2QZ8A 5BOXA 5H20A 1S7OA 4FT8A 4XLPF 3KE2A 2XAHA 5JVTA 4MGRA 2EK5A 2M1BA 2NNYA 2NNNA 1WI9A 2VBWA 1XSVA 1BN5A 2MH2A 3F6OA 1G3WA 1TW2A 4LLNA 2HZTA 4L0YB 4LJZF 3HOTA 4KYWA 5KVRA 2J5PA 4FHTA 5LGTA 3E5QA 3QU3A 4QWQA 1EV7A 3WG9A 3J81K 1F9NA 3K1PA 4RGXA 2MH9A 5FD6A 4I02A 1G3SA 3ZPLA 3ROUA 4L0ZB 1IN5A 2ZKZA 3J7AO 2F5DA 4E70A 4G6QA 3R61A 2BEOA 5BMZA 1O7FA 2TDXA 3KETA 4LK0F 4ZZLA 2JTVA 3J80K 5LLQA 4A0XA 4YFKF 2XIGA 1AWCA 2JRTA 2P5KA 1IAWA 2G7HA 2CQKA 1K78B 4Q48A 1B9MA 3E97A 1YFHA 3GXOA 4M6YA 2DTRA 3R0JA 4HW0A 1STZA 1GXQA 2JSCA 3L9FA 2J5OA 3HSEA 3KCCA 2MA3A 5J6XA 1TNSA 3IWFA 3HRUA 3MCZA 5ICGA 4IF4A 1SMTA 1ZRDA 3ISPA 1BI3A 3TO9A 2YSRA 4KUMA 2Z9OA 1ZGAA 2COMA 4IRGA 3P9IA 3WTWC 3JTHA 4HLXA 2FBKA 4ZZDA 2JPBA 4MNUA 5F64A 2HQNA 3CUQB 2DI3A 4UVAA 1Z1DA 2KIMA 2UXNA 2RDPA 5ERIA 4P9FA 3REOA 4IJAA 4LGWA 1QBJA 5DCMB 1B6AA 3HTSB 3KFWX 2VBXA 4KDPA 5DV5A 5CVJA 1J2XA 2V6CA 5L3EA 3F3XA 2K27A 3O3KA 2Q2EA 5JFRA 4LB6B 1KYZA 5FFZA 1Z6RA 2V1XA 2FF4A 2EV6A 5TJJA 2YR2A 2V9VA 3Q9VA 1IN7A 3ZMSA 3R4KA 2RQPA 4I98B 3I58A 4HAMA 1B9NA 1ZAOA 3I53A 1EH6A 1W5SA 4S05A 4LMYA 1R1UA 4KT5C 2Z33A 2EA4A 4Q47A 1O3SA 2DK5A 1ZRCA 1EH7A 5E8GA 4YIIA 2FMLA 1XGMA 2FSWA 3MQ0A 3NRVA 4RB2C 3GFIA 4KNYA 4L18B 3M9AA 4A12A 5CLSA 4M73A 1X3UA 4XRFA 3F8NA 4Y15A 3BJ6A 5L3CA 4PZJA 1FOKA 4RGSA 4OINF 2GIVA 3C3WA 3I0TA 3ZP5A 1I1SA 3NQOA 4G7OF 1SD7A 1S8NA 1DP7P 2BGCA 4YFXF 5E18F 3LAPA 3BJOA 2QWWA 4BYYA 3Q9SA 2KJCA 4LFUA 4OIPF 2Y48A 2XKPA 1W4MA 4GO1A 1MGTA 1T39A 2EFWA 1TQMA 1HW5A 3F8FA 1B59A 3F6VA 3KP6A 1XDUA 4EGZA 4U0VA 4A0YA 4Q5SF 5HVQC 3CO6C 1FY7A 3ZMUA 2O61A 3MFKA 1XB4A 4A5MA 4M9ZA 2VC0A 1HKSA 4ZYEA 3C7JA 1FP1D 2H6BA 2QVOA 1RNLA 2DPUA 5DUKA 1T0FA 5TRDA 3HHGA 5BPDA 3RKWA 5HDKA 2E1CA 4BQAA 1K78A 1KA8A 5FLXK 4WK8F 3MAJA 1JXSA 2M8EA 1P4WA 3VODA 4CZZA 4WXDA 4O5VA 1R1TA 3LAJA 4UXNA 4IHSA 1IUYA 4HV6A 3HIFA 2PQ8A 3ELKA 4RB1A 1ZLJA 4HV5A 2ISZA 3ZMZA 1R5GA 2A6HF 3RJPA 2DQRA 1B1BA 1QQIA 4ENMA 2A07F 3GVAA 5A2QZ 1HSTA 2XAJA 2O8XA 4WXHA 3GFLA 1YS6A 2RV8A 3GYHX 5FD5A 2DAOA 2GWRA 3CUQA 1R22A 5IT9Z 2VOOA 4M74A 5CYVA 2NS0A 1SD5A 3KZZA 3E5XA 3GW2A 4R79A 3ERED 3RKXA 5DDGA 3DPLC 1OPCA 5DCMA 3BY6A 3SHFA 2E1NA 2VT2A 3EYIA 1JHHA 3WGHA 2ZBKA 1I5ZA 4OU0A 4ESJA 1V3FA 2DO7A 3VOEA 1HQCA 1QO0D 3F23A 2A68F 1CGPA 5F1RA 2V1UA 3MEXA 4RB0A 2GQQA 2HR3A 3W6KB 3P9CA 2YX4A 2M5WA 1S3JA 2MD5A 4PGHA 1JE8A 1Z91A 1J59A 1MJBA 3FXQA 3T8RA 4LLGF 4EJWA 1TNTA 2H09A 1QZYA 4CXFA 3EYYA 5D5WB 5ED4A 3RIRA 2Z99A 4IPAA 1KQ8A 3HTUA 2UXXA 1LQ1A 4ASNA 2VBYA 2MLGA 4HBLA 4AIJA 4KN4X 1DDNA 1IF1A 1OKRA 2LNBA 3RKYA 2DU9A 3M8FA 2R7DA 1YTYA 1J9IA 2H27A 1KQ0A 3S2WA 3FM3A 3ZN0A 3NEUA 3RPQA 3MZYA 4LLLA 5D6EA 3DPTA 3PQJA 1F4KA 4OIOF
chains in the Genus database with same CATH superfamily
4IOAF 2ETHA 4BQNA 1BW6A 4WCGA 1YITI 1VQMI 3K0LA 3Q3SA 1R1VA 2PJRA 3BG6A 2PMZN 1JUPA 4G7HF 3LFUA 4A3FJ 1YJNI 4QPOA 4HQMA 3CJNA 4XL9A 1VI0A 3R60A 2LH9A 4RM2A 4UUSB 2GA2A 3GO5A 1X1CA 2IGMA 2A5YB 2XPWA 2EILH 2K3FA 2BYVE 4IHTA 1ZARA 2WBMA 4D1QA 3S8PA 3IL2A 4J19A 4CGZA 2QCOA 3ABMH 2HVRA 4IQJA 2XC7A 1FC3A 4HRIA 4IHXA 1USSA 1ON2A 1XGSA 4AIHA 2KL4A 4UUVA 2XV4S 3F0CA 3CZ6A 1BIAA 2FNPA 3BR0A 5DD8A 4HSTA 1MDMB 3FXUA 3ZGKA 2IRFG 1ETKA 2CQQA 5E8IA 5J1UA 3SYTA 2QA4I 4PDKA 2F4IA 1VQ7I 3O8HA 4I0AA 1MNMC 3GTLJ 4BHCA 2F4MB 3OIPA 1ZQ3P 2XSJC 3K1NA 4DJAA 1I6XA 5E1XA 2E60A 1FP2A 3TDZC 3K1MA 3K2ZA 4HDUA 2DA1A 3DTIA 4LK1F 4KN7X 4KIBA 4YEJA 3PSIA 1K6YA 1DGRM 1XGNA 2JSPA 2PMUA 4BH9A 3JSOA 1OCPA 2LR8A 4AD9A 3GUDA 1J75A 3S1QJ 2ZNZA 3TMOA 2EFPA 2ECBA 4B8XA 1WSUA 1ZTRA 3F8MA 2QSGX 1H0MA 1FPQA 2K4JA 2A6EF 3L7WA 2FEZA 2P6TA 1MZBA 2DT5A 4LIUA 3OYCA 3WU2C 2JN6A 1Z05A 2HDDA 2Y0MA 2KRCA 1TWFJ 5H6QA 4L5IA 1H88C 3OIOA 1UHWA 4HOBA 2HDCA 1XCBA 5D8KB 1G8XA 1XG1A 5D4RA 3ZQHA 4NQWB 4JX5A 3AG1H 5F04A 2OTJI 3OYDA 4A3BJ 3G73A 2O8KA 3BCAA 5JHUA 2ZFUA 3H5RA 2EIMH 1R23A 2H6CA 4M3FA 2AQFA 2ECCA 2EQRA 3BR6A 3JR9A 3V8LA 4ESBA 4KISA 1BA5A 3HRTA 3IC7A 3F9KA 3HZJA 2LYCA 2LY9A 3PUBA 2EIJH 4ZJZA 4XSXF 2FMYA 4XLEA 5K1YA 4H0EA 4FTHA 4KA4A 1W7PB 2NOGA 2Z5UA 5ILSA 2AXTC 4I01A 1FMWA 5E17F 3WHCA 1ERDA 3TOBA 4HQEA 1BR1A 1D3YA 4GYGA 3V7CA 2EV0A 3EDPA 4P9UA 5GTHC 2X6YA 4TV7A 4BXUA 3U1KA 1S5LC 1R5ID 4MTEA 1F5TA 4QLCU 1RUOA 1MNDA 3BC8A 2JA2A 1SANA 2WY8Q 4AYBN 1HA8A 5D5XB 3OYLA 2KQRA 5KK1A 3WTTC 3DF8A 4ZC3A 2LLKA 1PUFA 2BY2A 5ICCA 1RUNA 3M8JA 5JLXA 3CCEI 4QIWN 2HGCA 5LBQA 1X1DA 3ML6A 4KICA 4BKXA 3S16J 2P4WA 3CCJI 2VBZA 1R36A 3K4JA 2XAUA 5E20A 1WJ5A 5EG0A 5LEKA 1YIOA 2QM3A 2QQAA 3RYRA 5E3LA 4F7ZA 4OOIA 1L3LA 3IWZA 3BR1A 1WH7A 1UCRA 1XMKA 1ETXA 3SQNA 1RPWA 4ZYDA 4EJUA 2FNAA 3NWTA 3DKYA 4A2UA 1KU9A 3UR3C 3ZCOA 3WGGA 3TGNA 3QPLA 2EFOA 4CYDA 2VN2A 1S7EA 1MIJA 3W2WA 4BJ5C 1ZG5A 1FTTA 2PX9A 3CC7I 3BZCA 1CF7B 5K7FA 3FHZA 5IT9R 3HUGB 4NDLA 2L0KA 2JJ7A 1XSDA 4OMYA 3KEOA 1LUJB 3OR1C 3PSFA 4KIFA 2R5ZB 3OYEA 2E35A 1YG2A 4I09A 1HSJA 2LKPA 4OAZA 2VPRA 2X6WA 1B4AA 3ZN1A 1EA3A 5BS6A 1G4DA 1SEUA 2I5UA 3H3VK 5IP7J 4JQFA 5LHGA 5GTIC 2H94A 4XIDA 2NYXA 3ECHA 3ZMTA 5L3FA 2E7XA 4HG2A 3QPHA 5LRSA 3N4MA 1LE8A 1OYYA 4UVBA 2DYRH 2QBYB 3V7SA 2B63J 1U2WA 2R7XA 4ETSA 5BQTA 5E3MA 3OS0A 1Y39A 3JAMZ 3FKIJ 4P55A 2E2JJ 3JRFA 2L54A 2ZXWH 2A69F 2IJLA 1S9HA 1GXPA 5KAFC 3DKWA 3RDIA 4A5NA 2IW5A 2ELKA 2O03A 4N9IA 1T0FC 3M3YJ 4UHTA 4L9VA 1FBSA 1W36D 5EZGA 2LF7A 1XTAA 2BY3A 2R93J 3OYHA 1RKTA 4HZFA 2FUG2 3EPZA 2M87A 3IP4B 5LD2C 1UZCA 2L3DA 3ABKH 2DN0A 3C2GA 3BQZA 3MZHA 3ERMA 4MEYF 2R4GA 3PFIA 5E3NA 3QYEA 2HQRA 1ZYRF 3R0AA 3MKLA 1HC8A 3DV8A 1V55H 3F72A 4XLNF 2AHQA 3I4MJ 2XAFA 2CV2A 2BW3B 2PBIA 6PAXA 1OMIA 3KPHA 4XK4A 1ZG1A 2CV0A 1Y0UA 5HS7A 4Y3OA 2LC2A 3DQVC 5CQGA 1A5JA 5GP9A 5DUIA 4AM3A 3I54A 2CW0F 3BZ6A 2CQNA 4CHUA 3VEPA 3OIQA 5EEGA 3CMYA 1MDMA 4AUXA 3MWMA 5LEJA 4IRHA 3EUKL 2K9NA 4LB5A 2KISA 4P5OA 2OV7A 4EM0B 2NVXJ 1Z0XA 4XLCA 1BM9A 3LSPA 3CUQC 3CCRI 2HEOA 4B1RA 3LSKA 1FYKA 4XNFA 2LBFB 1LFPA 4D0PA 3FISA 2QKMB 3HOXJ 3V7RA 3ZMVA 3EUHA 4C2MJ 1YQAA 2KDOA 3L00A 2DFHA 3ULQB 2IVMA 1O4XA 4A3IJ 2L01A 2PMHA 3H1CA 1RR8C 3FK7A 1LEAA 1J5YA 2KZVA 3AG4H 2EINH 3KEYA 5EEHA 3R6SA 5H2FC 2P7CB 3OS2A 3OYKA 2VLAA 2HOTA 3H3UA 4I2OA 3K10A 3M07A 3BJAA 3CCMI 4FCYA 4XKBA 3HJEA 3WTXC 1V5GA 2DA3A 4MQVA 3S1RJ 2HYFA 4WX9A 1RESA 4IHYA 1DQUA 4RAZA 4BBRJ 1WI3A 5CVIA 1RI7A 1XGOA 3HOSA 2ZSIB 2XASA 4J00A 5CVUA 4UVCA 2OF7A 5KHDA 3I59B 2LY2A 3FK6A 2L9SA 4NQWA 1IXSB 2K02A 3T5XA 3BTJA 3D1NI 1D8KA 5J4VA 3HRSA 2DMUA 1H9GA 5M5XJ 1QNTA 2STWA 3J80R 4S04A 2Z1DA 3WGIA 3I71A 2P0WA 3LSIA 2UWMA 4II2A 2CFOA 4WWCA 4OAYA 4IXAA 2V79A 2NVUB 5JHFA 2UUZA 1OCRH 2X51A 2OD5A 3LNQA 1FZPB 4CO8A 1VQLI 2D2WA 3WTSC 2JRMA 3V8KA 3WTUC 1SD6A 3RCOA 3SZPA 1W7PA 3CCVI 2NS7A 3K9TA 4MO7A 1GV2A 3PIPF 2CQXA 5K5OA 2B7EA 2VL8A 2W25A 1FYMA 4I7HA 3TO7A 4E4HA 4EJTA 2LVSA 3FHNA 3D5LA 3LSTA 2R0QC 1TWCJ 1Y0NA 1JKRC 4XLAA 2LFBA 4JBAA 2VJ4A 1SFEA 4OMZA 2KKOA 2CUFA 3Q5FA 2P5VA 1MBKA 4DQ2A 1N77A 3E6DA 4LG0A 3T0YA 1SFOJ 4ZH4F 3CCLI 4YIFA 4QPQA 2PLYA 2COBA 2D1VA 2X9DA 3B02A 4JX6A 4CCLA 2ME6A 4CSWA 1OCTC 3DWLE 3OYJA 1GVJA 1KU2A 5F6FA 1BOAA 1MBHA 1S72I 4A6DA 5IOYA 4E7JA 2Y69H 2RKHA 3HYIA 2WB1A 5LGNA 4ENKA 1TWAJ 4ZDPA 1WRJA 1P9QC 3DEWA 5E1WA 1F43A 2DYSH 3O2PE 1YS7A 1IXRC 2DOFA 4F92B 3QYBA 2FA5A 1R5HA 4D7NA 4AIKA 4C2UA 1TWHJ 2JUCA 1ZHFA 1U9OA 3TQNA 1ONVA 2CU7A 4G9YA 2VXZA 1LJ9A 3LA2A 3A0HC 2MC4A 1CF7A 4Y52J 3BG5A 1GDTA 5HDGA 3I55I 2XGEA 3HUGA 2FBIA 3IAM2 3SXYA 3V42A 3VFZA 3LQQA 4UV9A 1RQ6A 4U0WA 2O0YA 2ESNA 4AVZA 2DA2A 5LHIA 2R5ZA 3LSHA 3SDGA 4U87A 1G3YA 2HOSA 1EF4A 1GLNA 2ELHA 4YG2F 5E79C 4I99C 3TKYA 1MNEA 5AIPA 1XSXA 1PVEA 2CG4A 2XVCA 2K9SA 4KMUX 1ZREA 5EJCA 3FXRA 1R7JA 3ABTA 5LRRA 3KZYA 4G7ZF 4LITA 3MN2A 1JGGA 2XUBA 2QBYA 3OYMA 2A3SA 4IZZA 2BHZA 1ACIA 4D5FA 3KYDB 2HOAA 4XOPA 3VYUB 3AL0B 3GTJJ 1DPUA 2MABA 3UKGA 3Q0WA 3PNYA 3K6GA 1XDSA 3D0SA 4EATA 2FBHA 2E2HJ 1HKQA 3FXJA 4E6KG 2A61A 4EJVA 1AOYA 3LSJA 4M3BA 3ECOA 4ON0A 4EEFG 1BC7C 1YO5C 4GDFA 3BLYA 3D5RC 1FLIA 2HPMA 3BR2A 2MUNA 4ZYAA 3BP8A 4MFDA 3S3OA 1E2XA 4A0ZA 1KYWA 2HS5A 1YYVA 4ZTJA 1D1CA 3HHHA 1OR7C 3I4NJ 2RGVA 1R9TJ 1T2KA 2ZMEB 2K40A 2HI3A 1FT9A 3JRHA 1Y8RB 2WV0A 5L3GA 2K9MA 4GXOA 3GLXA 3GZ6A 3F8BA 5D5VB 3SEZA 1ORKA 2M0CA 5FKLA 1X58A 1U78A 3L2UA 3DBLB 4XORA 3RPUA 2BW3A 4NB5A 2VKVA 1JKQC 4BY7J 3FM5A 2DDAA 3W6JB 5HLIA 2L9NA 2LF8A 1LB2A 5K5QA 1ZGJA 2VE9A 1MMNA 2X98A 1K4TA 1R58A 2PJPA 2HKOA 5ICEA 3DTEA 1X3ZB 3FWEA 4F55A 2W85A 1DGWY 2DXIA 3HGYA 2XGDA 4G12A 5FKOA 5CVVA 3L2QA 1XN7A 3GCMA 2LMDA 2P0TA 3GLLA 3CLOA 2GXGA 3U1DA 3G6EI 4KFCA 4IHWA 1T98A 1ITYA 3C2HA 3JAMR 3K4NA 1YJ9I 1KQ9A 3W2AA 1SD4A 1D0ZA 3K4BA 2OZUA 2DFFA 4A69C 2IS4A 1UELB 2VIXA 3VDXA 2LBFA 3HC7A 2FOWA 4HX7A 4II3A 4HF2A 3AG2H 3AL0C 1MMSA 1AKHB 1E3HA 4G6DA 5L3BA 1X1AA 2F5EA 2HXOA 4XICA 4CCMA 3VPRA 3GZ5A 3CDIA 4AVPA 4B3AA 5KNLA 3LSRA 1Z6TA 5DYMA 3KLNA 2XGCA 1VF9A 2B0LA 1LE8B 2E36A 5IOZA 1B72B 1I27A 2XB5A 4BAYA 2H8RA 3C18A 2F48A 4M3GA 1LDJA 2JT1A 3QPTA 2K7LA 3ZQ7A 4RMNA 1T95A 1V5EA 1QZEA 4L5JA 3KIOA 2L7KA 2DA4A 2ZCWA 3I59A 1O3TA 3WHBA 2H1KA 3IAS2 3WODF 1XD7A 5EF6A 1IDZA 1IJWC 3SFZA 1WJEA 3J81Z 2X1CA 4R1HA 4CH7A 4YFNF 2ICWG 3M4OJ 3B73A 3UNGC 1FNNA 4N4NB 2P5LC 2HWVA 2X0LA 4WF2A 2M4KA 2GZWA 1IO2A 1OYWA 3HRMA 3MD2A 3J7ZI 5L3DA 3I56I 4CICA 3OR2C 2ZO4A 3DTKA 2OTLI 1FOWA 2PI0A 3COAC 5A2QK 2NRAC 4JP0A 1FMVA 2VJIA 1VZ0A 2V1NA 1TT0A 1MMDA 4NC6A 4DZJA 1BR2A 4ZDLA 5C44J 1A04A 5D4SA 3CMEI 2BVMA 1JUMA 2WB1N 5F1JA 5FKMA 2RNJA 3CD6I 4G8XA 2EWNA 2W57A 5IT9K 2FE3A 3OYIA 2NS8A 1FSHA 2K85A 2IP2A 3KP5A 4FETA 4BJTA 3J80Z 3U2RA 5EDNA 1LPQA 3HGGA 2Q8KA 1HW1A 5ILVA 4Q4ZF 2F5FA 3ZMDA 2HQ5A 2XGXA 3DFGA 4N0BA 1WJFA 5B3SH 2CQ7A 2KDZA 2CRGA 5CJ9A 3OSGA 2E19A 4KITB 1RR7A 3I9V2 2Y0SA 3A1YA 4XN3A 2QSFX 4ESFA 1FSEA 3L2VA 1S7AA 3F21A 4CZCA 1J0RA 4I0BA 4HNVA 2ACJA 3S3NA 1YHQI 3BDDA 1ON1A 2YU9J 1A6IA 3BTLA 4RAGA 4EVIA 1W0UA 2W48A 4X1EA 1UFMA 1Q1VA 4F52A 1IRGA 1TQIA 2KFDA 3FF5A 1TTYA 2YPRA 4LOCA 1OR7A 3N97A 3DP7A 4KT6A 2JWTA 4LD5A 2ZSHB 4U7DA 3DCFA 4M9XA 4XLHA 2MLKA 2VQLA 4R8HA 2FQ3A 1R4MB 4A93J 1K4SA 4QTRA 3QOPA 4N9HA 2XKOA 2HOEA 1IGNA 2FXAA 5GADJ 2OQGA 1FX7A 3K69A 3G1MA 4D5CA 3OMYA 3O6BB 4ZYGA 2JA6J 1PP7U 3MVPA 1QRYA 5FROA 1BC8C 1D5VA 4CA0A 2KPMA 5DEQA 5FLVA 3KP4A 1SFXA 2OU2A 2XB0X 3E1SA 4UNOA 4AWXB 2DFEA 2QQ9A 3EETA 1ZK8A 2KJBA 2MZ4A 2DPDA 4Z6YA 3FXLA 2BV6A 2GXBA 1OCCH 4FASD 2TRTA 2W24A 2HXIA 3DXJF 1VQPI 3SZTA 4FE4A 4KMFA 2HTSA 4B48A 1R49A 1I6HJ 2WADA 3GF2A 3IHUA 5FB2A 2R7RA 2IGKA 1BI2A 2X48A 2Q0OA 4DYRA 2Y75A 2R5YB 2CS3A 3D5SC 3H36A 1T6SA 2HKXA 4BDYA 3H92A 4C30A 1HF0A 1U0JA 1SFUA 2M2EA 2QSHX 2KHMA 1QZZA 1MKMA 2ZNYA 3LA7A 1REPC 4A3LJ 1E17A 4XSZF 2MFZA 1IN4A 2JK3A 3CCYA 3KLOA 1YW7A 2Z3YA 3BROA 1PYVA 2M34A 2DBBA 2K4BA 4PSWA 2N8GA 3E0JB 3JRDA 1SMYF 3V4GA 4LG0B 2L9RA 1S6LA 3QOEA 2DA5A 5FFXA 4PCQA 4CDGA 3CJRB 4PJLA 4A3MJ 2CGPA 4FX0A 2MSYA 3HXLA 1TLHB 2XAGA 3BR5A 3LSGA 3CJTB 2ZMEA 4UUTA 5K7ZA 2GM4A 4DBRA 3CUOA 3LWFA 4RM3A 3EUHC 4RLQA 5FJ8J 2XRLA 2ZJ2A 2BBYA 2DA7A 3TW7A 2E7WA 4K2EA 3M7GA 2WV1A 1T08B 2EZKA 3LOCA 2P6SA 1QHGA 3FXKA 4IVNA 3FZVA 1YX3A 1ZELA 4L9JA 1VQ6I 3RI4A 4RAFA 3G1OA 3T8TA 3IKVA 3G2BA 4BNCA 2D1HA 3G3ZA 4B09A 4ENNA 2WWYA 3ASOH 2JPCA 2CFXA 4Y33A 5M5YJ 2C6YA 3RYPA 1O3QA 3KEQA 3TOAA 3DEUA 4U0YA 3GTQJ 2MG4A 3MMYB 1C0WA 3A01B 1N78A 2WC2A 4A6EA 5J8FA 4HDVA 1LDKB 5CVRA 1Y1WJ 5C4XJ 3X2QH 1HOMA 3E7LA 3SDBA 2IXSA 3K70D 1USTA 4AU7A 3WTVC 2PN6A 3S14J 1A35A 2HZDA 4EMSA 3J7YJ 1AKHA 1D5YA 1Z67A 4MEXF 2EBIA 4XKCA 4HA8A 2XRNA 3F8CA 4CUGA 3BPXA 2M3AA 2XAQA 2DOEA 1X2MA 4DYCA 4OIRF 1B72A 2RVCA 1VTNC 1YLFA 4U88A 4PFPA 3KYLA 2JVGA 3M1EA 1TC3C 5FLMJ 2WAFA 2CSOA 4GFBA 2CUZA 2XHKA 3U9GA 2MC3A 5TGTA 2GXAA 1ETWA 1OLTA 1HCRA 2V1DA 3P7NA 1JTXA 2IA2A 3BZKA 4EJOA 2IT0A 4EGYA 5EGOB 2HYGD 4RGRA 1UAAA 1QHHD 5DD4A 5HODA 3A02A 5FKKA 5J47A 5HLGA 1MBFA 1UJ8A 3QU6A 1A31A 3WE3A 4BUPA 3E3VA 5C4JJ 4NHJA 3J7AW 4E7IA 3HBLA 4O3MA 1FJLA 3ZQFA 2DFIA 3JRIA 2EV5A 3L1PA 3CP8A 1O57A 2Y0SN 3GFMA 5LGUA 1O7LA 1JT6A 2OJED 3IV5A 2GAUA 1RIOH 1P2FA 2G0EA 3VSLA 3OS1A 3N05A 4JOMA 3ZOBA 2F2EA 2DMTA 2EPFA 2CO5A 2O6GE 1U5TB 1W5CC 5F08A 1FBUA 3CTAA 3HPGA 3CLQA 4DGWB 2HYJA 5HNHA 4EM2A 2MW8A 2OBPA 2R7OA 2I8DA 1IRXA 4HSRA 2XDVA 4BE1A 1K83J 3S2DJ 5AIQA 2HVSA 3I4PA 2LDUA 3H0GJ 2BVLA 2Y31A 3IRQA 5FLXZ 1ZGWA 5B1AH 2IPQX 2AS5F 3TO6A 5IT3A 3IKTA 1NHAA 4MFEA 2DQLA 3EUAA 2GA1A 2VOPA 2FU4A 2VJJA 1LVAA 2LK2A 3RTRA 2EH3A 2EFNA 3DU5A 3PL8A 4P96A 3GTMJ 1L0OC 5E1ZB 1T38A 5BNGA 1XPXA 1LVKA 1XX5A 1VQ8I 3FMQA 1ULYA 3KP3A 4HPQA 2IBDA 2QUFA 1J7KA 2GIZA 2MBFA 3PNTA 2I10A 2YUSA 1WKMA 3J81R 2O7OA 4U7BA 3LA3A 1PDNC 4ANJA 3CO7C 4HF0A 1Z7LA 3ZQIA 4IRIA 4O6JA 5ICFA 4NC7A 2EB7A 1POGA 3FX3A 2H1LA 1IW7F 2DOAA 5AONA 5BPIA 3T1BA 3CCUI 1U6GA 2L4AA 3TP3A 3CDLA 1P4XA 5IP6A 3L2CA 3HPHA 2W84A 2RN7A 4YIRX 3HSFA 2M35A 2DMNA 3HEFA 2JVHA 1LNWA 1P6RA 3E6BA 4GGGA 1HKTA 1ODDA 1HW2A 1D0YA 2OZ6A 2VODA 1S29A 2RQQA 3GTKJ 3K4CA 1U5TC 2FRHA 3P9KA 5J4YA 2NVTJ 3HOUJ 4ZYHA 1BBYA 2KIUA 2BHYA 4JK1X 2QQBA 3HOWJ 1YE9A 1JHFA 4RGUA 1R4NB 3FMSA 2HPIA 2LG4A 2VXDA 5IYBJ 1BI1A 2R5YA 3A52A 4IL6C 4I76A 1FOXA 4CCOA 1V5FA 3H0DA 1N25A 2FX0A 2WY7Q 3KP2A 4EM1A 2VE8A 3JAMK 3K7AJ 3AAFA 3IH3A 2EFQA 1LFUP 3A0BC 4XBFA 3ZQQA 1OFCX 3VB2A 3H9GA 1PP8F 2IEKA 2WAQA 1YOVB 2ZXHA 4MQ9F 3WE2A 2MVTA 4M71A 4DNCA 4GRIA 2DMPA 3GX4X 1R6RA 2O3FA 1F1ZA 3VSKA 3A4CA 3SZGA 1N75A 2DLLA 4IEJA 1TBXA 5IYDJ 4G94A 3WG7H 3Q0UA 1VQKI 4M6XA 1VQ5I 1FBQA 3JRBA 4G6TB 2ZJRF 3OOPA 1K61A 3A2KA 5K7HA 2F5CA 4M9SA 3DBRB 1IN8A 1QVUA 2F6CA 4Z2YA 1UHMA 2WTEA 1OQYA 1FIPA 3WTZA 5JR3A 4X0GA 4H4KC 2VONA 1ETYA 3F22A 2NAZA 1P7JA 3ZRGA 5HOOA 2PEXA 3ZQLA 2OA4A 1YW9A 2ZB9A 3Q0VA 1Z21A 2EJRA 1EH8A 2DW4A 3SFIA 2R7FA 2R7ZJ 1F36A 4PUSA 4DBQA 2EA2A 4FX4A 2L7MP 1E3OC 3P5JA 3A01A 4PJ0C 4XN0A 3OV8A 5GAHJ 4F91B 3ZXSA 2BZTA 2Q1ZB 3CCQI 1HBXG 3EQLF 3QAHA 4E7SA 2XF7A 2JZYA 4GYIA 2EZHA 2RC4A 4KIGA 3E6CC 2DDBA 2D5VA 1UG0A 3ZR8X 5KCMA 2F5VA 5F0CA 3QP5A 1U8BA 2E5ZA 2LKSA 4WXCA 3FMRA 2FQ4A 1P92A 5DS9A 5D6FA 1JJ8C 1KU7A 3PM1A 5EYRA 1K79A 3GTOJ 3QODA 2IA0A 2JMWA 2VKEA 4UB8C 4ENJA 3FXOA 2R92J 3L09A 3RQIA 2HFHA 3H35A 1PUEE 1RZ4A 1OYIA 4V2FA 3ABUA 3V8JA 4BHBA 1KGSA 1D8JA 4HX4A 3J7AY 5TISC 1ZLKA 1APLC 2R7VA 3TP0A 1A6QA 4QSHA 1CQTA 2W7NA 2E1MB 1AHDP 5ILUA 1BIBA 1XCVA 1M1EB 4M72A 3I64A 2ZXIA 3GMEA 2XROA 5EGOA 2UZKA 2YX7A 4ZDOA 4ZTFA 3AFHA 1GT0C 2X4HA 3A03A 2CWEA 4BGDA 2BY0A 5B5EC 1UB9A 2R3SA 1P4AA 1DUXC 2XPVA 2QGUA 1LEBA 5J1YA 1A36A 5HLHA 2K9LA 3BPVA 1UMQA 2X1DA 2ZC2A 3PO2J 1ZH5A 2ZXJA 5HS8A 3WU0A 3AG3H 5CPRB 4RB3C 4BBSJ 4MTDA 1TW3A 3VYRB 1W7PD 2QEXI 1U5TA 1SAXA 1ETOA 2OAZA 3M8EA 4AIDA 4GCVA 1WZ2A 2IS2A 1IC8A 2QYOA 2XF6A 1I50J 2ZFWA 2O9LA 4XM3A 5J8CA 1IXCA 1GVDA 3KP7A 2BE5F 2HTJA 3OYBA 4OIQF 3PQKA 3DU6A 5K5RA 3TW6A 2BXYA 3GTGJ 1YW8A 2L9VA 3FBNB 2PG4A 1OJLA 1VQNI 4XRSA 2NVQJ 2ZJPF 3OYNA 4HYEA 4Y4RA 2L7FP 3H5AA 4DYQA 1WVRA 3CESA 3HOVJ 3JRGA 4UB6C 3IRRA 1MJ9A 2KRFA 3OOUA 4PK4A 3QP6A 3WU1B 1MBJA 4YELA 2VC1A 4NNJA 2X6XA 3HSRA 3C2BA 3LFKA 4EV0A 1RKWA 1E0EA 1Y56A 4HF1A 1FWZA 1K6OA 1ZRFA 3OYFA 3JRCA 1H9TA 3LQRA 1WWXA 4BJ6C 1MW7A 2M45A 3TBIA 4HX8A 5D5UB 1SFKA 1IG7A 2R7TA 2E1MC 1GV5A 1W36C 1IZ1A 4J01A 3I5UA 3BG9A 1IRFA 1KU3A 4PGGA 3AKZA 5JLWA 3KZIC 2D45A 3E5UA 3BOQA 1XC5A 4RS8A 1V4RA 4A3CJ 1R00A 2VQCA 2XSDC 2TCTA 2HNHA 1BJAA 1DPRA 1QPMA 2DT7B 1DP3A 1W5TA 1WCMJ 2M30A 3CC2I 1Q1HA 4DOZA 3BR3A 4BDZA 4L9TA 2M4GA 2YU3A 2FD5A 2ESHA 5DCFA 4XR6A 4E7LA 2ZMEC 1X3WB 1GUUA 1SC7A 2IA1A 1LDDA 3ASNH 3RKQA 2CYYA 4RAYA 1G3TA 2WAQN 3TEDA 1T33A 2G9WA 5J1RA 2QENA 4YRVA 1K7AA 5FLXR 4F93B 1O3RA 3S15J 2E2IJ 1Z7UA 2ISYA 5D8LB 2STTA 5LHHA 1U3EM 4A3JJ 3FKJA 1BW5A 2L7ZA 3S1NJ 3JREA 4LIVA 2W1OA 3TDUC 2ADUA 3SEQA 3U21A 1TQPA 3M1CA 2OQRA 2P8TA 2KIFA 3JTGA 4FE7A 1MD0A 2AXLA 2ELJA 1T8IA 3HOZJ 1XMAA 2K86A 1FYLA 1QGPA 4C3JJ 2Q2EB 1UHSA 5JI6A 3JSPA 2VKHA 2B9SA 2JA5J 3ESWB 4DIQA 1WFXA 2W82A 3KYCB 4UV8A 3H3ZA 1BI0A 2PFBA 4NBQA 2RAEA 1IUFA 1OCOH 3HB9A 4MHGA 4D9JA 5JVGF 3GFJA 3QYFA 4BXFA 3DBHB 1VFCA 3W3CA 3NAUA 3DLLF 1KONA 1MJAA 1I3QJ 1MBGA 4L9NA 5FO5A 1G6NA 2E5NA 1IN6A 2DK8A 3CDHA 4BHPA 1JGSA 5HS9A 2M7AA 2GOXB 3RPUD 4PFOA 3QQAA 4HNUA 4DZPA 2JQ7A 3PJRA 3BWGA 1WQ2A 2ME0A 3GEZA 3K4MA 3S2HJ 1QPIA 4FISA 5H6RA 3S93A 3QRFF 2L02A 3VWBA 2DCEA 1HXDA 2CUJA 3JCUC 5HDNA 1ZN2A 4Y17A 1JUSA 5DM7F 3E6MA 2VT3A 2G7UA 3JW4A 1I1GA 1IV6A 1WPKA 1GHCA 2HQAA 2QLZA 2R7UA 1WJDA 5FGMA 2P81A 3DLAA 3WTYC 1DU6A 4HLYA 1ZG3A 4ABZA 2P7VB 4CYCA 4P1WA 2LSOA 4EQQA 2FOKA 4Y13A 1HDPA 1Y1VJ 4XKWA 4IKFA 3GWZA 3C1DA 1Z9CA 4A3DJ 1NH3A 1LKXA 2L4MA 4M3DA 1U8RA 2GBYA 2QZ8A 5HNFA 3CC4I 5BOXA 1RC9A 5H20A 3GZNB 1S7OA 4FT8A 4XLPF 3KE2A 2XAHA 1Y6IA 5JVTA 4MGRA 2XF5A 2EK5A 5GPCA 2M1BA 2NNYA 2NNNA 1WI9A 1I3AA 3DPUA 3G4SI 2GLOA 3NARA 2VBWA 2Y30A 2CW8A 1XSVA 1BN5A 3K2AA 4E7KA 2EIKH 4BXXJ 2MH2A 3F6OA 4C9YA 1G3WA 1TW2A 2WAEA 5EEAA 2HZTA 4LLNA 4L0YB 4LJZF 3GBGA 3HOTA 4KYWA 5KVRA 4S0HB 2J5PA 4FHTA 5LGTA 3E5QA 4NUBA 3QU3A 4QWQA 1EV7A 3S1MJ 2KP6A 1QVTA 3WG9A 2V26A 1Z3YA 3J81K 2KLOA 1F9NA 2HDWA 2HVQA 4B47A 3K1PA 2M0MA 4RGXA 3BTCA 2MH9A 5FD6A 4I02A 1G3SA 3ZPLA 4W1UA 3G1LA 3ROUA 3CF5F 2RREA 4L0ZB 2OCEA 1IN5A 2IAIA 3BCBA 2ZKZA 3J7AO 2F5DA 5M5WJ 3DEEA 2UV1A 4E70A 3ZQCA 2K9QA 2H8WA 4G6QA 1OISA 3QWLA 4BEHB 3R61A 2BEOA 5BMZA 1O7FA 3MZ8A 2TDXA 3KETA 1P7IA 1V54H 2K5CA 1DU0A 4LK0F 1JT0A 4ZZLA 2JTVA 3J80K 5LLQA 4A0XA 2KMUA 1TP4A 4YFKF 1NK3P 2XIGA 1RETA 2JRTA 1AWCA 2P5KA 1IAWA 2KZGA 2KRHA 3OL4A 2LKXA 2G7HA 1SVMA 2CQKA 3H9JA 1K78B 3CF2A 2A05A 4Q48A 2OC6A 1MH4A 1B9MA 1VNDA 1JTYA 3E97A 4ITVA 4HEA2 5EZHA 1YFHA 3GXOA 4M6YA 4BY1J 2DTRA 2X1EA 1YRNB 5A2QR 3ABLH 4UY8I 3R0JA 1X1PA 4B44A 1ZR4A 1TZLA 4HW0A 1STZA 1GXQA 2JSCA 3L9FA 1Z77A 2J5OA 1IRZA 3HSEA 3KCCA 1HDDC 1QU3A 2MA3A 5DTDA 5GAEJ 5J6XA 4E7ZA 2K3PA 1TNSA 4OWRB 3IWFA 3HRUA 3MCZA 5ICGA 5GAGJ 4IF4A 1SMTA 1ZRDA 3ISPA 1BI3A 3TO9A 2VUMJ 2IS6A 2YSRA 4KUMA 2Z9OA 1ZGAA 2COMA 4IRGA 4D7MA 3P9IA 4MIMA 2DT6A 1YI2I 3WTWC 3JTHA 1UG2A 1YX5A 2DMQA 4HLXA 2OCCH 2FBKA 3VYSB 4LG3A 2JPBA 4ZZDA 4MNUA 1TT5B 5IYCJ 3G71I 5F64A 2HQNA 1X4OA 3OSFA 1D1AA 3FBIB 1MH3A 1IV8A 3BQYA 3CUQB 2DI3A 1MMAA 4UVAA 1JJ6C 1Z1DA 3S32A 3CQZJ 2KIMA 2UXNA 4BE0A 2RDPA 5ERIA 3IUOA 3CP2A 4P9FA 3REOA 1LFBA 4IJAA 4M6VA 3ZQGA 4LGWA 3KX2A 1D0XA 2LTPA 1QBJA 5DCMB 4BACA 1B6AA 3HTSB 4IHVA 3KFWX 3OY9A 2VBXA 4KDPA 2KT0A 1ENHA 5DV5A 5CVJA 4IO9F 4CCNA 3CMMA 5LFAA 1J2XA 2V6CA 5L3EA 2LREA 3F3XA 3FXMA 2W4SA 3GTPJ 2CH0A 4XKVA 2K27A 3O3KA 1B8IB 3JRAA 2Q2EA 5JFRA 4LB6B 4PJNA 1HLVA 1KYZA 3W2VA 1NK2P 4UUSA 3TL4X 2MGQA 5FFZA 1Z6RA 2LRDA 4XRMA 2V1XA 2FF4A 2EV6A 5TJJA 5F0FA 2YR2A 2V9VA 2GOMA 4PJJA 1X2NA 3CMAI 1X4PA 3Q9VA 1IN7A 1BJZA 1FOYA 3ZMSA 4BE2A 4Y7NJ 3R4KA 4XRSG 1W0TA 3LMMA 2RQPA 4I98B 3I58A 4HAMA 1B9NA 2KIQA 1ZAOA 2R7WA 3I53A 3SJMA 1EH6A 1W5SA 4S05A 2V7FA 4LMYA 4F3QA 1R1UA 1WJAA 1ETQA 4KT5C 2Z33A 2EA4A 1D1BA 4Q47A 1O3SA 2VB6A 3IH2A 2LOOA 2DK5A 2VQHA 1ZRCA 1EH7A 5E8GA 4YIIA 2ZJQF 2FMLA 1XGMA 4BL0B 2FSWA 3MQ0A 3NRVA 4RB2C 3GFIA 1AA7A 4KNYA 4L18B 3H9QA 3M9AA 3OL3A 4XOTA 4A12A 5CLSA 1Y8QB 4M73A 1WH5A 1X19A 2CMPA 3BT9A 1X3UA 4XRFA 1MSEC 4A3GJ 1BL0A 3PFYA 3K4LA 2R7QA 3F8NA 4Y15A 2DA6A 1Z3XA 3BJ6A 5L3CA 1JI8A 2V6EA 4PZJA 3IH4A 1FOKA 4RGSA 2BXZA 2JUGA 4OINF 4FQGA 5CKTA 5IPAA 2GIVA 2MD0A 2OUMA 3C3WA 3I0TA 1SAUA 3ZP5A 3K4KA 1I1SA 2V4JC 3NQOA 4G7OF 1SD7A 4KJZA 1S8NA 3PUFA 2DTZA 4RA2A 3BG7A 4L5EA 1DP7P 5F27A 2BGCA 3I3LA 4JYKA 4JX4A 4YFXF 3HG9A 5E18F 4MLOA 5E3OA 3LAPA 1WHUA 4BS9A 2LY1A 3BJOA 2QWWA 3DKXA 1YJWI 2PJRB 1H89C 4BYYA 3Q9SA 2KJCA 4LFUA 2NVYJ 1AU7A 4OIPF 2Y48A 2XKPA 1PJRA 1W4MA 4GO1A 5IP9J 3HDDA 3RZDJ 1MGTA 1T39A 2EFWA 1TQMA 1HW5A 2Y9YA 3HKZA 3F8FA 1B59A 2ID3A 5B66C 1MMGA 3F6VA 3RZOJ 3KP6A 1XDUA 4EGZA 4RBOA 2VASA 4U0VA 1EJ9A 4A0YA 4Q5SF 5HVQC 1JKOC 3CO6C 3PNVA 1FY7A 3ONQA 2VKDA 3ZMUA 2O61A 3MFKA 1XB4A 4A5MA 2NOJB 3OYAA 4M9ZA 3OYGA 5FKNA 2NXNB 4BEHA 2VC0A 1HKSA 4ZYEA 2PMZA 3C7JA 1FP1D 2H6BA 2QVOA 1RNLA 3HOYJ 2DPUA 5DUKA 3BG3A 1KZHA 2IGOA 3PIOF 1T0FA 5TRDA 3HHGA 5BPDA 2VJ5A 3RKWA 5HDKA 2E1CA 1H8AC 4BQAA 4AC0A 1TWGJ 1G59A 1K78A 1KA8A 5FLXK 4B43A 1R71A 4XMYA 4WK8F 3L2RA 3MAJA 4N4OB 1JXSA 4HNTA 2M8EA 1P4WA 3VODA 4CYCB 3L2WA 4CCJA 4CZZA 4WXDA 4O5VA 1R1TA 5M3MJ 1YRNA 1VQOI 3LAJA 4BQOA 4UXNA 4E7HA 1NG6A 4IHSA 2Y2ZA 1IUYA 4HV6A 3CJQB 2CJJA 1BR4A 4A3EJ 3HIFA 2DJNA 4W97A 2PQ8A 2L5QA 3ELKA 4V19K 4RB1A 1ZLJA 1BOBA 4HV5A 1VQ9I 1SVLA 2ISZA 2X6OA 3ZMZA 1R5GA 3FDYA 1NG7A 2A6HF 3MKYB 2M7BA 3RJPA 2LD5A 4IQ4A 2AQEA 4V2GA 1RRJA 2DQRA 2RNGA 1B1BA 1SVOA 1QQIA 2QQ8A 4ENMA 1J09A 2A07F 3GVAA 2O5RA 4IOCF 4X6AJ 5A2QZ 1HSTA 2XAJA 2O8XA 4WXHA 3GFLA 4C3HJ 3S17J 1YS6A 3RQ4A 5C3EJ 2RV8A 5HLTA 3GYHX 1ZR2A 5FD5A 2DAOA 2QKLB 1EKEA 2GWRA 3CUQA 4B4CA 1R22A 5IT9Z 1FEXA 5B1BH 4A3KJ 2VOOA 4M74A 5CYVA 2NS0A 1SD5A 3KZZA 2L2OA 3E5XA 3GW2A 4IX7A 2EZLA 4R79A 1MSFC 2Z2SB 3ERED 2W00A 3RKXA 1E3PA 5DDGA 1YIJI 3DPLC 1OPCA 1MBEA 4M3EA 5J40A 5DCMA 1IDYA 3BY6A 5J3LA 3SHFA 2VI6A 4PSXA 4BU2A 2E1NA 2OPTA 2VT2A 3LSMA 1FTZA 4RLFA 3OWTA 3EYIA 1JHHA 1OCZH 1PUFB 3WGHA 2M9HA 3QPSA 2AO9A 2ZBKA 1I5ZA 4OU0A 4ESJA 1V3FA 2M8GX 5IY5H 1B8IA 2A5WA 1X1BA 3K70C 2YS9A 9ANTA 2DO7A 3VOEA 1HQCA 2EZIA 3B6CA 1QO0D 3F23A 2FJ1A 2E34A 2A68F 2BY1A 1WJBA 1XMXA 5EG0B 1CGPA 5F1RA 2V1UA 2V9KA 3MEXA 4RB0A 2GQQA 2HR3A 2DODA 3W6KB 3P9CA 1JKPC 2YX4A 2M5WA 1S3JA 2MD5A 2VPLA 4C3IJ 3BTIA 4PGHA 2JA8J 2JA7J 1JE8A 1Z91A 2MYSA 1J59A 2A6TA 3RSNA 4C2TA 5GPAA 4AYBA 2IGNA 2Y9ZA 2VQGA 1MJBA 2ID6A 3FXQA 3T8RA 4LLGF 4EJWA 1TNTA 3CCSI 4XLFA 3FIWA 2Z16A 1NTCA 2H09A 1WJCA 4XONA 1QZYA 4CXFA 3EYYA 2F4OB 4NC8A 5D5WB 5ED4A 3RIRA 2Z99A 4IPAA 3HL2A 2CV1A 1FIAA 4B3XA 4PJMA 1KQ8A 3LL7A 3HTUA 2QF7A 4XQFA 2V9PA 2HU9A 4DW6A 1U9NA 3O8GA 5F0HA 2UXXA 5M3FJ 1LQ1A 3B6AA 4ASNA 2LP0A 2VBYA 2MLGA 3VYTB 5FRNA 4HBLA 1QA6A 4AIJA 4KN4X 1DDNA 2E71A 1I39A 3MKZA 1VQ4I 1ETVA 5CQEA 1IF1A 3H5NA 1OKRA 1W1WE 2LNBA 3RKYA 3S3MA 2X85A 3HM5A 2DU9A 2XPUA 3M8FA 4I6ZA 3W6VA 2R7DA 2CW7A 1G2HA 1YTYA 1J9IA 3NWSA 4RDUA 2H27A 1KQ0A 3S2WA 5DM6F 2CUEA 3HKZN 2E1OA 3FM3A 2WA0A 1TL8A 1ZKGA 3ZN0A 3NEUA 2BOLA 4CCKA 5FRMA 1T56A 3RPQA 3MKWB 2R7SA 4BQQA 3MZYA 1XS9A 2IS1A 4LLLA 5D6EA 3DPTA 3PQJA 1F4KA 2DJIA 3PO3J 4OIOF 5KAIC 1WGXA
chains in the Genus database with same CATH topology
2ETHA 4WCGA 3K0LA 1R1VA 4G7HF 4HQMA 3CJNA 3R60A 2GA2A 3GO5A 2A5YB 2BYVE 4IHTA 1ZARA 3IL2A 4CGZA 1FC3A 1USSA 1ON2A 1XGSA 4AIHA 4UUVA 2XV4S 1BIAA 2FNPA 5DD8A 1MDMB 3FXUA 2IRFG 5E8IA 4PDKA 4I0AA 4BHCA 3K1NA 1I6XA 5E1XA 1FP2A 3TDZC 3K1MA 3K2ZA 4HDUA 4LK1F 4KN7X 4KIBA 1XGNA 2PMUA 4BH9A 3JSOA 4AD9A 3GUDA 1J75A 2ZNZA 2EFPA 4B8XA 1WSUA 3F8MA 1H0MA 1FPQA 2K4JA 2A6EF 3L7WA 2FEZA 2P6TA 1MZBA 2DT5A 1Z05A 2Y0MA 5H6QA 4L5IA 1UHWA 4HOBA 2HDCA 1XCBA 5D8KB 5D4RA 3G73A 5JHUA 1R23A 2H6CA 3V8LA 4ESBA 3HRTA 3IC7A 4XSXF 4H0EA 2FMYA 5K1YA 4KA4A 1W7PB 2Z5UA 5ILSA 4I01A 5E17F 3TOBA 4HQEA 1D3YA 4GYGA 3V7CA 2EV0A 3EDPA 4P9UA 4TV7A 4BXUA 4MTEA 1F5TA 4QLCU 1RUOA 5D5XB 3WTTC 5KK1A 3DF8A 5ICCA 1RUNA 2HGCA 5LBQA 3ML6A 4KICA 2P4WA 2VBZA 1R36A 5E20A 5LEKA 1YIOA 2QM3A 2QQAA 3RYRA 4F7ZA 4OOIA 1L3LA 3IWZA 1UCRA 1XMKA 3SQNA 4ZYDA 4EJUA 2FNAA 4A2UA 1KU9A 3WGGA 3TGNA 2EFOA 4CYDA 2VN2A 1ZG5A 1CF7B 3FHZA 1XSDA 4OMYA 3KEOA 4KIFA 1YG2A 4I09A 1HSJA 2LKPA 1B4AA 3ZN1A 1G4DA 5BS6A 4JQFA 5LHGA 2H94A 2NYXA 3ECHA 5L3FA 3ZMTA 2E7XA 5LRSA 3QPHA 3N4MA 1OYYA 4UVBA 2QBYB 3V7SA 1U2WA 4ETSA 5BQTA 3JAMZ 4P55A 2L54A 2A69F 2IJLA 1GXPA 3DKWA 3RDIA 4A5NA 2IW5A 2O03A 4N9IA 4UHTA 4L9VA 1FBSA 2LF7A 4HZFA 2M87A 2L3DA 3MZHA 4MEYF 3PFIA 2HQRA 1ZYRF 3R0AA 3DV8A 3F72A 4XLNF 2XAFA 2PBIA 6PAXA 1OMIA 1ZG1A 1Y0UA 5HS7A 3DQVC 5DUIA 3I54A 2CW0F 3BZ6A 4CHUA 3VEPA 5EEGA 1MDMA 3MWMA 5LEJA 4IRHA 4LB5A 4P5OA 4EM0B 1BM9A 3CUQC 2HEOA 1FYKA 4D0PA 3V7RA 3ZMVA 3EUHA 1YQAA 3L00A 3ULQB 2IVMA 2L01A 2PMHA 1LEAA 1J5YA 5EEHA 3R6SA 2P7CB 3H3UA 4I2OA 3BJAA 3WTXC 4MQVA 2HYFA 4WX9A 4RAZA 5CVIA 1RI7A 1XGOA 3HOSA 2XASA 5CVUA 4UVCA 3I59B 4NQWA 1IXSB 2K02A 3T5XA 1D8KA 3HRSA 1H9GA 1QNTA 2STWA 4S04A 3WGIA 3I71A 2UWMA 4WWCA 4IXAA 2V79A 2OD5A 1FZPB 4CO8A 2D2WA 3WTSC 3WTUC 3V8KA 1SD6A 3SZPA 1W7PA 3K9TA 5K5OA 2W25A 1FYMA 4I7HA 3TO7A 4EJTA 3D5LA 3LSTA 4JBAA 1SFEA 4OMZA 2KKOA 3Q5FA 2P5VA 4DQ2A 3E6DA 4LG0A 3T0YA 4ZH4F 4YIFA 2PLYA 2D1VA 3B02A 1GVJA 1KU2A 5F6FA 1BOAA 4A6DA 2RKHA 3HYIA 5LGNA 4ENKA 1WRJA 5E1WA 3O2PE 1YS7A 1IXRC 2FA5A 1R5HA 4AIKA 1ZHFA 3TQNA 1ONVA 4G9YA 2VXZA 1LJ9A 3LA2A 1CF7A 5HDGA 3HUGA 2FBIA 3SXYA 3VFZA 3LQQA 4UV9A 4U0WA 2O0YA 2ESNA 5LHIA 1G3YA 2ELHA 4YG2F 3TKYA 5AIPA 1XSXA 2CG4A 2XVCA 4KMUX 1ZREA 3FXRA 1R7JA 3ABTA 5LRRA 3KZYA 4G7ZF 2XUBA 2QBYA 2A3SA 1DPUA 1XDSA 3D0SA 2FBHA 1HKQA 4EJVA 2A61A 1AOYA 3ECOA 4ON0A 1BC7C 1YO5C 1FLIA 3BP8A 1E2XA 4A0ZA 1KYWA 2HS5A 1YYVA 3HHHA 2RGVA 1T2KA 2ZMEB 1FT9A 5L3GA 2WV0A 4GXOA 3GLXA 3GZ6A 3F8BA 5D5VB 1U78A 3RPUA 4NB5A 3FM5A 3W6JB 5HLIA 2LF8A 1LB2A 5K5QA 1ZGJA 2VE9A 1R58A 2PJPA 2HKOA 5ICEA 3FWEA 2W85A 5CVVA 1XN7A 3CLOA 2GXGA 3U1DA 4KFCA 1T98A 1KQ9A 1SD4A 2OZUA 4HX7A 4HF2A 4G6DA 5L3BA 2F5EA 3GZ5A 4AVPA 1Z6TA 5DYMA 3KLNA 2B0LA 1I27A 4BAYA 3C18A 1LDJA 2JT1A 3QPTA 2K7LA 3ZQ7A 4L5JA 2ZCWA 3I59A 1O3TA 3WODF 1XD7A 3SFZA 3J81Z 4R1HA 4YFNF 3B73A 1FNNA 2P5LC 2HWVA 2X0LA 4WF2A 2GZWA 3HRMA 1OYWA 5L3DA 4CICA 2ZO4A 2PI0A 3COAC 5A2QK 2NRAC 1A04A 5D4SA 2RNJA 4G8XA 2EWNA 2W57A 5IT9K 2FE3A 1FSHA 2IP2A 3KP5A 3J80Z 3U2RA 2Q8KA 1HW1A 5ILVA 4Q4ZF 2F5FA 3ZMDA 2XGXA 3DFGA 4N0BA 5CJ9A 4ESFA 1FSEA 1S7AA 3F21A 1J0RA 4I0BA 2ACJA 3BDDA 1ON1A 4EVIA 1UFMA 1IRGA 1TQIA 3FF5A 1TTYA 2YPRA 1OR7A 3N97A 3DP7A 4LD5A 4U7DA 4M9XA 2MLKA 4R8HA 2FQ3A 3QOPA 4N9HA 2XKOA 2HOEA 2FXAA 2OQGA 1FX7A 3K69A 3O6BB 4ZYGA 1PP7U 1BC8C 1D5VA 5DEQA 3KP4A 1SFXA 2OU2A 4UNOA 4AWXB 2QQ9A 3EETA 2KJBA 2DPDA 2BV6A 2GXBA 2W24A 3DXJF 3SZTA 4KMFA 2HTSA 5FB2A 3GF2A 3IHUA 1BI2A 2Q0OA 2Y75A 1T6SA 2HKXA 3H92A 1SFUA 1QZZA 1MKMA 2ZNYA 3LA7A 1REPC 1E17A 4XSZF 1IN4A 3KLOA 1YW7A 2Z3YA 3BROA 2DBBA 2K4BA 1SMYF 3V4GA 4LG0B 1S6LA 5FFXA 4PCQA 4CDGA 2CGPA 4FX0A 1TLHB 2XAGA 2ZMEA 3CUOA 3LWFA 2ZJ2A 2BBYA 2E7WA 4K2EA 3M7GA 2P6SA 4IVNA 3FZVA 4L9JA 3RI4A 3T8TA 3IKVA 4BNCA 2D1HA 3G3ZA 4B09A 4ENNA 2WWYA 2JPCA 2CFXA 2C6YA 3RYPA 1O3QA 3KEQA 3TOAA 3DEUA 4U0YA 1C0WA 2WC2A 4A6EA 5J8FA 4HDVA 1LDKB 5CVRA 1USTA 3WTVC 2PN6A 4EMSA 4MEXF 4HA8A 2XRNA 3F8CA 3BPXA 2XAQA 4OIRF 2RVCA 1VTNC 1YLFA 4U88A 3M1EA 2CSOA 2XHKA 3U9GA 2MC3A 2V1DA 3P7NA 2IA2A 4EJOA 2IT0A 4EGYA 2HYGD 4RGRA 5DD4A 5HLGA 3QU6A 3WE3A 3E3VA 4NHJA 4O3MA 2DFIA 2EV5A 1O57A 3GFMA 5LGUA 1O7LA 2GAUA 1RIOH 1P2FA 2F2EA 2CO5A 2O6GE 1U5TB 1FBUA 3CTAA 4EM2A 2OBPA 5AIQA 3I4PA 2LDUA 3IRQA 5FLXZ 2IPQX 2AS5F 3TO6A 5IT3A 3IKTA 1NHAA 2DQLA 2GA1A 2VOPA 2FU4A 1LVAA 3RTRA 2EFNA 4P96A 1L0OC 5E1ZB 1T38A 3FMQA 1ULYA 3KP3A 2QUFA 1J7KA 2MBFA 1WKMA 4U7BA 3LA3A 1PDNC 3CO7C 4HF0A 4IRIA 4O6JA 5ICFA 2EB7A 3FX3A 1IW7F 5AONA 5BPIA 3T1BA 1U6GA 2L4AA 1P4XA 3L2CA 2W84A 2RN7A 3HSFA 1LNWA 1P6RA 3E6BA 4GGGA 1HKTA 1ODDA 1HW2A 2OZ6A 2VODA 1S29A 1U5TC 2FRHA 3P9KA 4ZYHA 1BBYA 2KIUA 4JK1X 2QQBA 1JHFA 4RGUA 3FMSA 1BI1A 3KP2A 4EM1A 2VE8A 3JAMK 3AAFA 2EFQA 4XBFA 3VB2A 1PP8F 4MQ9F 3WE2A 4M71A 4DNCA 3GX4X 2O3FA 1F1ZA 2DLLA 1TBXA 4G94A 4M6XA 1FBQA 3OOPA 2F5CA 4M9SA 1IN8A 4Z2YA 1UHMA 2WTEA 3WTZA 5JR3A 2VONA 3F22A 2NAZA 5HOOA 2PEXA 2OA4A 1YW9A 2EJRA 1EH8A 2DW4A 2R7FA 4FX4A 2EA2A 3OV8A 1HBXG 3EQLF 3QAHA 2JZYA 4GYIA 2RC4A 4KIGA 3E6CC 3QP5A 4WXCA 3FMRA 1P92A 5D6FA 1KU7A 1K79A 2IA0A 4ENJA 3L09A 2HFHA 1PUEE 1RZ4A 1OYIA 3ABUA 3V8JA 4BHBA 1KGSA 1D8JA 4HX4A 1ZLKA 5ILUA 1BIBA 1XCVA 4M72A 3I64A 2XROA 2UZKA 2YX7A 2X4HA 2CWEA 1UB9A 2R3SA 1P4AA 1DUXC 1LEBA 5HLHA 3BPVA 1ZH5A 2ZXJA 5HS8A 3WU0A 4RB3C 4MTDA 1TW3A 1W7PD 1SAXA 1U5TA 2OAZA 3M8EA 4GCVA 2QYOA 2ZFWA 5J8CA 1IXCA 3KP7A 2BE5F 2HTJA 4OIQF 3PQKA 5K5RA 1YW8A 2PG4A 4HYEA 3IRRA 1MJ9A 2KRFA 3QP6A 3WU1B 2VC1A 3HSRA 3LFKA 4EV0A 4HF1A 1FWZA 1K6OA 1ZRFA 1H9TA 3LQRA 1WWXA 2M45A 5D5UB 4HX8A 1IZ1A 3I5UA 1IRFA 1KU3A 4PGGA 2D45A 3E5UA 3BOQA 4RS8A 1V4RA 1R00A 1BJAA 1DPRA 1QPMA 1W5TA 2M30A 1Q1HA 4L9TA 2YU3A 2ESHA 5DCFA 2IA1A 1LDDA 2CYYA 4RAYA 1G3TA 2G9WA 2QENA 1K7AA 1O3RA 1Z7UA 2ISYA 5D8LB 2STTA 5LHHA 1U3EM 3TDUC 2ADUA 1TQPA 2OQRA 2P8TA 2KIFA 3JTGA 1MD0A 2AXLA 1XMAA 2K86A 1FYLA 1QGPA 5JI6A 3JSPA 4UV8A 3H3ZA 1BI0A 2PFBA 4MHGA 3GFJA 1MJAA 4L9NA 5FO5A 1G6NA 1IN6A 2DK8A 3CDHA 4BHPA 1JGSA 5HS9A 3BWGA 1WQ2A 3GEZA 5H6RA 3QRFF 2L02A 1HXDA 5HDNA 1ZN2A 4Y17A 3E6MA 2VT3A 2G7UA 3JW4A 1I1GA 1GHCA 2QLZA 5FGMA 3WTYC 4HLYA 1ZG3A 2P7VB 2LSOA 4EQQA 2FOKA 4Y13A 3GWZA 3C1DA 1Z9CA 2L4MA 1U8RA 2QZ8A 5BOXA 5H20A 1S7OA 4FT8A 4XLPF 3KE2A 2XAHA 5JVTA 4MGRA 2EK5A 2M1BA 2NNYA 2NNNA 1WI9A 2VBWA 1XSVA 1BN5A 2MH2A 3F6OA 1G3WA 1TW2A 4LLNA 2HZTA 4L0YB 4LJZF 3HOTA 4KYWA 5KVRA 2J5PA 4FHTA 5LGTA 3E5QA 3QU3A 4QWQA 1EV7A 3WG9A 3J81K 1F9NA 3K1PA 4RGXA 2MH9A 5FD6A 4I02A 1G3SA 3ZPLA 3ROUA 4L0ZB 1IN5A 2ZKZA 3J7AO 2F5DA 4E70A 4G6QA 3R61A 2BEOA 5BMZA 1O7FA 2TDXA 3KETA 4LK0F 4ZZLA 2JTVA 3J80K 5LLQA 4A0XA 4YFKF 2XIGA 1AWCA 2JRTA 2P5KA 1IAWA 2G7HA 2CQKA 1K78B 4Q48A 1B9MA 3E97A 1YFHA 3GXOA 4M6YA 2DTRA 3R0JA 4HW0A 1STZA 1GXQA 2JSCA 3L9FA 2J5OA 3HSEA 3KCCA 2MA3A 5J6XA 1TNSA 3IWFA 3HRUA 3MCZA 5ICGA 4IF4A 1SMTA 1ZRDA 3ISPA 1BI3A 3TO9A 2YSRA 4KUMA 2Z9OA 1ZGAA 2COMA 4IRGA 3P9IA 3WTWC 3JTHA 4HLXA 2FBKA 4ZZDA 2JPBA 4MNUA 5F64A 2HQNA 3CUQB 2DI3A 4UVAA 1Z1DA 2KIMA 2UXNA 2RDPA 5ERIA 4P9FA 3REOA 4IJAA 4LGWA 1QBJA 5DCMB 1B6AA 3HTSB 3KFWX 2VBXA 4KDPA 5DV5A 5CVJA 1J2XA 2V6CA 5L3EA 3F3XA 2K27A 3O3KA 2Q2EA 5JFRA 4LB6B 1KYZA 5FFZA 1Z6RA 2V1XA 2FF4A 2EV6A 5TJJA 2YR2A 2V9VA 3Q9VA 1IN7A 3ZMSA 3R4KA 2RQPA 4I98B 3I58A 4HAMA 1B9NA 1ZAOA 3I53A 1EH6A 1W5SA 4S05A 4LMYA 1R1UA 4KT5C 2Z33A 2EA4A 4Q47A 1O3SA 2DK5A 1ZRCA 1EH7A 5E8GA 4YIIA 2FMLA 1XGMA 2FSWA 3MQ0A 3NRVA 4RB2C 3GFIA 4KNYA 4L18B 3M9AA 4A12A 5CLSA 4M73A 1X3UA 4XRFA 3F8NA 4Y15A 3BJ6A 5L3CA 4PZJA 1FOKA 4RGSA 4OINF 2GIVA 3C3WA 3I0TA 3ZP5A 1I1SA 3NQOA 4G7OF 1SD7A 1S8NA 1DP7P 2BGCA 4YFXF 5E18F 3LAPA 3BJOA 2QWWA 4BYYA 3Q9SA 2KJCA 4LFUA 4OIPF 2Y48A 2XKPA 1W4MA 4GO1A 1MGTA 1T39A 2EFWA 1TQMA 1HW5A 3F8FA 1B59A 3F6VA 3KP6A 1XDUA 4EGZA 4U0VA 4A0YA 4Q5SF 5HVQC 3CO6C 1FY7A 3ZMUA 2O61A 3MFKA 1XB4A 4A5MA 4M9ZA 2VC0A 1HKSA 4ZYEA 3C7JA 1FP1D 2H6BA 2QVOA 1RNLA 2DPUA 5DUKA 1T0FA 5TRDA 3HHGA 5BPDA 3RKWA 5HDKA 2E1CA 4BQAA 1K78A 1KA8A 5FLXK 4WK8F 3MAJA 1JXSA 2M8EA 1P4WA 3VODA 4CZZA 4WXDA 4O5VA 1R1TA 3LAJA 4UXNA 4IHSA 1IUYA 4HV6A 3HIFA 2PQ8A 3ELKA 4RB1A 1ZLJA 4HV5A 2ISZA 3ZMZA 1R5GA 2A6HF 3RJPA 2DQRA 1B1BA 1QQIA 4ENMA 2A07F 3GVAA 5A2QZ 1HSTA 2XAJA 2O8XA 4WXHA 3GFLA 1YS6A 2RV8A 3GYHX 5FD5A 2DAOA 2GWRA 3CUQA 1R22A 5IT9Z 2VOOA 4M74A 5CYVA 2NS0A 1SD5A 3KZZA 3E5XA 3GW2A 4R79A 3ERED 3RKXA 5DDGA 3DPLC 1OPCA 5DCMA 3BY6A 3SHFA 2E1NA 2VT2A 3EYIA 1JHHA 3WGHA 2ZBKA 1I5ZA 4OU0A 4ESJA 1V3FA 2DO7A 3VOEA 1HQCA 1QO0D 3F23A 2A68F 1CGPA 5F1RA 2V1UA 3MEXA 4RB0A 2GQQA 2HR3A 3W6KB 3P9CA 2YX4A 2M5WA 1S3JA 2MD5A 4PGHA 1JE8A 1Z91A 1J59A 1MJBA 3FXQA 3T8RA 4LLGF 4EJWA 1TNTA 2H09A 1QZYA 4CXFA 3EYYA 5D5WB 5ED4A 3RIRA 2Z99A 4IPAA 1KQ8A 3HTUA 2UXXA 1LQ1A 4ASNA 2VBYA 2MLGA 4HBLA 4AIJA 4KN4X 1DDNA 1IF1A 1OKRA 2LNBA 3RKYA 2DU9A 3M8FA 2R7DA 1YTYA 1J9IA 2H27A 1KQ0A 3S2WA 3FM3A 3ZN0A 3NEUA 3RPQA 3MZYA 4LLLA 5D6EA 3DPTA 3PQJA 1F4KA 4OIOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETH A;  4WCG A;  3K0L A;  1R1V A;  4G7H F;  4HQM A;  3CJN A;  3R60 A;  2GA2 A;  3GO5 A;  2A5Y B;  2BYV E;  4IHT A;  1ZAR A;  3IL2 A;  4CGZ A;  1FC3 A;  1USS A;  1ON2 A;  1XGS A;  4AIH A;  4UUV A;  2XV4 S;  1BIA A;  2FNP A;  5DD8 A;  1MDM B;  3FXU A;  2IRF G;  5E8I A;  4PDK A;  4I0A A;  4BHC A;  3K1N A;  1I6X A;  5E1X A;  1FP2 A;  3TDZ C;  3K1M A;  3K2Z A;  4HDU A;  4LK1 F;  4KN7 X;  4KIB A;  1XGN A;  2PMU A;  4BH9 A;  3JSO A;  4AD9 A;  3GUD A;  1J75 A;  2ZNZ A;  2EFP A;  4B8X A;  1WSU A;  3F8M A;  1H0M A;  1FPQ A;  2K4J A;  2A6E F;  3L7W A;  2FEZ A;  2P6T A;  1MZB A;  2DT5 A;  1Z05 A;  2Y0M A;  5H6Q A;  4L5I A;  1UHW A;  4HOB A;  2HDC A;  1XCB A;  5D8K B;  5D4R A;  3G73 A;  5JHU A;  1R23 A;  2H6C A;  3V8L A;  4ESB A;  3HRT A;  3IC7 A;  4XSX F;  4H0E A;  2FMY A;  5K1Y A;  4KA4 A;  1W7P B;  2Z5U A;  5ILS A;  4I01 A;  5E17 F;  3TOB A;  4HQE A;  1D3Y A;  4GYG A;  3V7C A;  2EV0 A;  3EDP A;  4P9U A;  4TV7 A;  4BXU A;  4MTE A;  1F5T A;  4QLC U;  1RUO A;  5D5X B;  3WTT C;  5KK1 A;  3DF8 A;  5ICC A;  1RUN A;  2HGC A;  5LBQ A;  3ML6 A;  4KIC A;  2P4W A;  2VBZ A;  1R36 A;  5E20 A;  5LEK A;  1YIO A;  2QM3 A;  2QQA A;  3RYR A;  4F7Z A;  4OOI A;  1L3L A;  3IWZ A;  1UCR A;  1XMK A;  3SQN A;  4ZYD A;  4EJU A;  2FNA A;  4A2U A;  1KU9 A;  3WGG A;  3TGN A;  2EFO A;  4CYD A;  2VN2 A;  1ZG5 A;  1CF7 B;  3FHZ A;  1XSD A;  4OMY A;  3KEO A;  4KIF A;  1YG2 A;  4I09 A;  1HSJ A;  2LKP A;  1B4A A;  3ZN1 A;  1G4D A;  5BS6 A;  4JQF A;  5LHG A;  2H94 A;  2NYX A;  3ECH A;  5L3F A;  3ZMT A;  2E7X A;  5LRS A;  3QPH A;  3N4M A;  1OYY A;  4UVB A;  2QBY B;  3V7S A;  1U2W A;  4ETS A;  5BQT A;  3JAM Z;  4P55 A;  2L54 A;  2A69 F;  2IJL A;  1GXP A;  3DKW A;  3RDI A;  4A5N A;  2IW5 A;  2O03 A;  4N9I A;  4UHT A;  4L9V A;  1FBS A;  2LF7 A;  4HZF A;  2M87 A;  2L3D A;  3MZH A;  4MEY F;  3PFI A;  2HQR A;  1ZYR F;  3R0A A;  3DV8 A;  3F72 A;  4XLN F;  2XAF A;  2PBI A;  6PAX A;  1OMI A;  1ZG1 A;  1Y0U A;  5HS7 A;  3DQV C;  5DUI A;  3I54 A;  2CW0 F;  3BZ6 A;  4CHU A;  3VEP A;  5EEG A;  1MDM A;  3MWM A;  5LEJ A;  4IRH A;  4LB5 A;  4P5O A;  4EM0 B;  1BM9 A;  3CUQ C;  2HEO A;  1FYK A;  4D0P A;  3V7R A;  3ZMV A;  3EUH A;  1YQA A;  3L00 A;  3ULQ B;  2IVM A;  2L01 A;  2PMH A;  1LEA A;  1J5Y A;  5EEH A;  3R6S A;  2P7C B;  3H3U A;  4I2O A;  3BJA A;  3WTX C;  4MQV A;  2HYF A;  4WX9 A;  4RAZ A;  5CVI A;  1RI7 A;  1XGO A;  3HOS A;  2XAS A;  5CVU A;  4UVC A;  3I59 B;  4NQW A;  1IXS B;  2K02 A;  3T5X A;  1D8K A;  3HRS A;  1H9G A;  1QNT A;  2STW A;  4S04 A;  3WGI A;  3I71 A;  2UWM A;  4WWC A;  4IXA A;  2V79 A;  2OD5 A;  1FZP B;  4CO8 A;  2D2W A;  3WTS C;  3WTU C;  3V8K A;  1SD6 A;  3SZP A;  1W7P A;  3K9T A;  5K5O A;  2W25 A;  1FYM A;  4I7H A;  3TO7 A;  4EJT A;  3D5L A;  3LST A;  4JBA A;  1SFE A;  4OMZ A;  2KKO A;  3Q5F A;  2P5V A;  4DQ2 A;  3E6D A;  4LG0 A;  3T0Y A;  4ZH4 F;  4YIF A;  2PLY A;  2D1V A;  3B02 A;  1GVJ A;  1KU2 A;  5F6F A;  1BOA A;  4A6D A;  2RKH A;  3HYI A;  5LGN A;  4ENK A;  1WRJ A;  5E1W A;  3O2P E;  1YS7 A;  1IXR C;  2FA5 A;  1R5H A;  4AIK A;  1ZHF A;  3TQN A;  1ONV A;  4G9Y A;  2VXZ A;  1LJ9 A;  3LA2 A;  1CF7 A;  5HDG A;  3HUG A;  2FBI A;  3SXY A;  3VFZ A;  3LQQ A;  4UV9 A;  4U0W A;  2O0Y A;  2ESN A;  5LHI A;  1G3Y A;  2ELH A;  4YG2 F;  3TKY A;  5AIP A;  1XSX A;  2CG4 A;  2XVC A;  4KMU X;  1ZRE A;  3FXR A;  1R7J A;  3ABT A;  5LRR A;  3KZY A;  4G7Z F;  2XUB A;  2QBY A;  2A3S A;  1DPU A;  1XDS A;  3D0S A;  2FBH A;  1HKQ A;  4EJV A;  2A61 A;  1AOY A;  3ECO A;  4ON0 A;  1BC7 C;  1YO5 C;  1FLI A;  3BP8 A;  1E2X A;  4A0Z A;  1KYW A;  2HS5 A;  1YYV A;  3HHH A;  2RGV A;  1T2K A;  2ZME B;  1FT9 A;  5L3G A;  2WV0 A;  4GXO A;  3GLX A;  3GZ6 A;  3F8B A;  5D5V B;  1U78 A;  3RPU A;  4NB5 A;  3FM5 A;  3W6J B;  5HLI A;  2LF8 A;  1LB2 A;  5K5Q A;  1ZGJ A;  2VE9 A;  1R58 A;  2PJP A;  2HKO A;  5ICE A;  3FWE A;  2W85 A;  5CVV A;  1XN7 A;  3CLO A;  2GXG A;  3U1D A;  4KFC A;  1T98 A;  1KQ9 A;  1SD4 A;  2OZU A;  4HX7 A;  4HF2 A;  4G6D A;  5L3B A;  2F5E A;  3GZ5 A;  4AVP A;  1Z6T A;  5DYM A;  3KLN A;  2B0L A;  1I27 A;  4BAY A;  3C18 A;  1LDJ A;  2JT1 A;  3QPT A;  2K7L A;  3ZQ7 A;  4L5J A;  2ZCW A;  3I59 A;  1O3T A;  3WOD F;  1XD7 A;  3SFZ A;  3J81 Z;  4R1H A;  4YFN F;  3B73 A;  1FNN A;  2P5L C;  2HWV A;  2X0L A;  4WF2 A;  2GZW A;  3HRM A;  1OYW A;  5L3D A;  4CIC A;  2ZO4 A;  2PI0 A;  3COA C;  5A2Q K;  2NRA C;  1A04 A;  5D4S A;  2RNJ A;  4G8X A;  2EWN A;  2W57 A;  5IT9 K;  2FE3 A;  1FSH A;  2IP2 A;  3KP5 A;  3J80 Z;  3U2R A;  2Q8K A;  1HW1 A;  5ILV A;  4Q4Z F;  2F5F A;  3ZMD A;  2XGX A;  3DFG A;  4N0B A;  5CJ9 A;  4ESF A;  1FSE A;  1S7A A;  3F21 A;  1J0R A;  4I0B A;  2ACJ A;  3BDD A;  1ON1 A;  4EVI A;  1UFM A;  1IRG A;  1TQI A;  3FF5 A;  1TTY A;  2YPR A;  1OR7 A;  3N97 A;  3DP7 A;  4LD5 A;  4U7D A;  4M9X A;  2MLK A;  4R8H A;  2FQ3 A;  3QOP A;  4N9H A;  2XKO A;  2HOE A;  2FXA A;  2OQG A;  1FX7 A;  3K69 A;  3O6B B;  4ZYG A;  1PP7 U;  1BC8 C;  1D5V A;  5DEQ A;  3KP4 A;  1SFX A;  2OU2 A;  4UNO A;  4AWX B;  2QQ9 A;  3EET A;  2KJB A;  2DPD A;  2BV6 A;  2GXB A;  2W24 A;  3DXJ F;  3SZT A;  4KMF A;  2HTS A;  5FB2 A;  3GF2 A;  3IHU A;  1BI2 A;  2Q0O A;  2Y75 A;  1T6S A;  2HKX A;  3H92 A;  1SFU A;  1QZZ A;  1MKM A;  2ZNY A;  3LA7 A;  1REP C;  1E17 A;  4XSZ F;  1IN4 A;  3KLO A;  1YW7 A;  2Z3Y A;  3BRO A;  2DBB A;  2K4B A;  1SMY F;  3V4G A;  4LG0 B;  1S6L A;  5FFX A;  4PCQ A;  4CDG A;  2CGP A;  4FX0 A;  1TLH B;  2XAG A;  2ZME A;  3CUO A;  3LWF A;  2ZJ2 A;  2BBY A;  2E7W A;  4K2E A;  3M7G A;  2P6S A;  4IVN A;  3FZV A;  4L9J A;  3RI4 A;  3T8T A;  3IKV A;  4BNC A;  2D1H A;  3G3Z A;  4B09 A;  4ENN A;  2WWY A;  2JPC A;  2CFX A;  2C6Y A;  3RYP A;  1O3Q A;  3KEQ A;  3TOA A;  3DEU A;  4U0Y A;  1C0W A;  2WC2 A;  4A6E A;  5J8F A;  4HDV A;  1LDK B;  5CVR A;  1UST A;  3WTV C;  2PN6 A;  4EMS A;  4MEX F;  4HA8 A;  2XRN A;  3F8C A;  3BPX A;  2XAQ A;  4OIR F;  2RVC A;  1VTN C;  1YLF A;  4U88 A;  3M1E A;  2CSO A;  2XHK A;  3U9G A;  2MC3 A;  2V1D A;  3P7N A;  2IA2 A;  4EJO A;  2IT0 A;  4EGY A;  2HYG D;  4RGR A;  5DD4 A;  5HLG A;  3QU6 A;  3WE3 A;  3E3V A;  4NHJ A;  4O3M A;  2DFI A;  2EV5 A;  1O57 A;  3GFM A;  5LGU A;  1O7L A;  2GAU A;  1RIO H;  1P2F A;  2F2E A;  2CO5 A;  2O6G E;  1U5T B;  1FBU A;  3CTA A;  4EM2 A;  2OBP A;  5AIQ A;  3I4P A;  2LDU A;  3IRQ A;  5FLX Z;  2IPQ X;  2AS5 F;  3TO6 A;  5IT3 A;  3IKT A;  1NHA A;  2DQL A;  2GA1 A;  2VOP A;  2FU4 A;  1LVA A;  3RTR A;  2EFN A;  4P96 A;  1L0O C;  5E1Z B;  1T38 A;  3FMQ A;  1ULY A;  3KP3 A;  2QUF A;  1J7K A;  2MBF A;  1WKM A;  4U7B A;  3LA3 A;  1PDN C;  3CO7 C;  4HF0 A;  4IRI A;  4O6J A;  5ICF A;  2EB7 A;  3FX3 A;  1IW7 F;  5AON A;  5BPI A;  3T1B A;  1U6G A;  2L4A A;  1P4X A;  3L2C A;  2W84 A;  2RN7 A;  3HSF A;  1LNW A;  1P6R A;  3E6B A;  4GGG A;  1HKT A;  1ODD A;  1HW2 A;  2OZ6 A;  2VOD A;  1S29 A;  1U5T C;  2FRH A;  3P9K A;  4ZYH A;  1BBY A;  2KIU A;  4JK1 X;  2QQB A;  1JHF A;  4RGU A;  3FMS A;  1BI1 A;  3KP2 A;  4EM1 A;  2VE8 A;  3JAM K;  3AAF A;  2EFQ A;  4XBF A;  3VB2 A;  1PP8 F;  4MQ9 F;  3WE2 A;  4M71 A;  4DNC A;  3GX4 X;  2O3F A;  1F1Z A;  2DLL A;  1TBX A;  4G94 A;  4M6X A;  1FBQ A;  3OOP A;  2F5C A;  4M9S A;  1IN8 A;  4Z2Y A;  1UHM A;  2WTE A;  3WTZ A;  5JR3 A;  2VON A;  3F22 A;  2NAZ A;  5HOO A;  2PEX A;  2OA4 A;  1YW9 A;  2EJR A;  1EH8 A;  2DW4 A;  2R7F A;  4FX4 A;  2EA2 A;  3OV8 A;  1HBX G;  3EQL F;  3QAH A;  2JZY A;  4GYI A;  2RC4 A;  4KIG A;  3E6C C;  3QP5 A;  4WXC A;  3FMR A;  1P92 A;  5D6F A;  1KU7 A;  1K79 A;  2IA0 A;  4ENJ A;  3L09 A;  2HFH A;  1PUE E;  1RZ4 A;  1OYI A;  3ABU A;  3V8J A;  4BHB A;  1KGS A;  1D8J A;  4HX4 A;  1ZLK A;  5ILU A;  1BIB A;  1XCV A;  4M72 A;  3I64 A;  2XRO A;  2UZK A;  2YX7 A;  2X4H A;  2CWE A;  1UB9 A;  2R3S A;  1P4A A;  1DUX C;  1LEB A;  5HLH A;  3BPV A;  1ZH5 A;  2ZXJ A;  5HS8 A;  3WU0 A;  4RB3 C;  4MTD A;  1TW3 A;  1W7P D;  1SAX A;  1U5T A;  2OAZ A;  3M8E A;  4GCV A;  2QYO A;  2ZFW A;  5J8C A;  1IXC A;  3KP7 A;  2BE5 F;  2HTJ A;  4OIQ F;  3PQK A;  5K5R A;  1YW8 A;  2PG4 A;  4HYE A;  3IRR A;  1MJ9 A;  2KRF A;  3QP6 A;  3WU1 B;  2VC1 A;  3HSR A;  3LFK A;  4EV0 A;  4HF1 A;  1FWZ A;  1K6O A;  1ZRF A;  1H9T A;  3LQR A;  1WWX A;  2M45 A;  5D5U B;  4HX8 A;  1IZ1 A;  3I5U A;  1IRF A;  1KU3 A;  4PGG A;  2D45 A;  3E5U A;  3BOQ A;  4RS8 A;  1V4R A;  1R00 A;  1BJA A;  1DPR A;  1QPM A;  1W5T A;  2M30 A;  1Q1H A;  4L9T A;  2YU3 A;  2ESH A;  5DCF A;  2IA1 A;  1LDD A;  2CYY A;  4RAY A;  1G3T A;  2G9W A;  2QEN A;  1K7A A;  1O3R A;  1Z7U A;  2ISY A;  5D8L B;  2STT A;  5LHH A;  1U3E M;  3TDU C;  2ADU A;  1TQP A;  2OQR A;  2P8T A;  2KIF A;  3JTG A;  1MD0 A;  2AXL A;  1XMA A;  2K86 A;  1FYL A;  1QGP A;  5JI6 A;  3JSP A;  4UV8 A;  3H3Z A;  1BI0 A;  2PFB A;  4MHG A;  3GFJ A;  1MJA A;  4L9N A;  5FO5 A;  1G6N A;  1IN6 A;  2DK8 A;  3CDH A;  4BHP A;  1JGS A;  5HS9 A;  3BWG A;  1WQ2 A;  3GEZ A;  5H6R A;  3QRF F;  2L02 A;  1HXD A;  5HDN A;  1ZN2 A;  4Y17 A;  3E6M A;  2VT3 A;  2G7U A;  3JW4 A;  1I1G A;  1GHC A;  2QLZ A;  5FGM A;  3WTY C;  4HLY A;  1ZG3 A;  2P7V B;  2LSO A;  4EQQ A;  2FOK A;  4Y13 A;  3GWZ A;  3C1D A;  1Z9C A;  2L4M A;  1U8R A;  2QZ8 A;  5BOX A;  5H20 A;  1S7O A;  4FT8 A;  4XLP F;  3KE2 A;  2XAH A;  5JVT A;  4MGR A;  2EK5 A;  2M1B A;  2NNY A;  2NNN A;  1WI9 A;  2VBW A;  1XSV A;  1BN5 A;  2MH2 A;  3F6O A;  1G3W A;  1TW2 A;  4LLN A;  2HZT A;  4L0Y B;  4LJZ F;  3HOT A;  4KYW A;  5KVR A;  2J5P A;  4FHT A;  5LGT A;  3E5Q A;  3QU3 A;  4QWQ A;  1EV7 A;  3WG9 A;  3J81 K;  1F9N A;  3K1P A;  4RGX A;  2MH9 A;  5FD6 A;  4I02 A;  1G3S A;  3ZPL A;  3ROU A;  4L0Z B;  1IN5 A;  2ZKZ A;  3J7A O;  2F5D A;  4E70 A;  4G6Q A;  3R61 A;  2BEO A;  5BMZ A;  1O7F A;  2TDX A;  3KET A;  4LK0 F;  4ZZL A;  2JTV A;  3J80 K;  5LLQ A;  4A0X A;  4YFK F;  2XIG A;  1AWC A;  2JRT A;  2P5K A;  1IAW A;  2G7H A;  2CQK A;  1K78 B;  4Q48 A;  1B9M A;  3E97 A;  1YFH A;  3GXO A;  4M6Y A;  2DTR A;  3R0J A;  4HW0 A;  1STZ A;  1GXQ A;  2JSC A;  3L9F A;  2J5O A;  3HSE A;  3KCC A;  2MA3 A;  5J6X A;  1TNS A;  3IWF A;  3HRU A;  3MCZ A;  5ICG A;  4IF4 A;  1SMT A;  1ZRD A;  3ISP A;  1BI3 A;  3TO9 A;  2YSR A;  4KUM A;  2Z9O A;  1ZGA A;  2COM A;  4IRG A;  3P9I A;  3WTW C;  3JTH A;  4HLX A;  2FBK A;  4ZZD A;  2JPB A;  4MNU A;  5F64 A;  2HQN A;  3CUQ B;  2DI3 A;  4UVA A;  1Z1D A;  2KIM A;  2UXN A;  2RDP A;  5ERI A;  4P9F A;  3REO A;  4IJA A;  4LGW A;  1QBJ A;  5DCM B;  1B6A A;  3HTS B;  3KFW X;  2VBX A;  4KDP A;  5DV5 A;  5CVJ A;  1J2X A;  2V6C A;  5L3E A;  3F3X A;  2K27 A;  3O3K A;  2Q2E A;  5JFR A;  4LB6 B;  1KYZ A;  5FFZ A;  1Z6R A;  2V1X A;  2FF4 A;  2EV6 A;  5TJJ A;  2YR2 A;  2V9V A;  3Q9V A;  1IN7 A;  3ZMS A;  3R4K A;  2RQP A;  4I98 B;  3I58 A;  4HAM A;  1B9N A;  1ZAO A;  3I53 A;  1EH6 A;  1W5S A;  4S05 A;  4LMY A;  1R1U A;  4KT5 C;  2Z33 A;  2EA4 A;  4Q47 A;  1O3S A;  2DK5 A;  1ZRC A;  1EH7 A;  5E8G A;  4YII A;  2FML A;  1XGM A;  2FSW A;  3MQ0 A;  3NRV A;  4RB2 C;  3GFI A;  4KNY A;  4L18 B;  3M9A A;  4A12 A;  5CLS A;  4M73 A;  1X3U A;  4XRF A;  3F8N A;  4Y15 A;  3BJ6 A;  5L3C A;  4PZJ A;  1FOK A;  4RGS A;  4OIN F;  2GIV A;  3C3W A;  3I0T A;  3ZP5 A;  1I1S A;  3NQO A;  4G7O F;  1SD7 A;  1S8N A;  1DP7 P;  2BGC A;  4YFX F;  5E18 F;  3LAP A;  3BJO A;  2QWW A;  4BYY A;  3Q9S A;  2KJC A;  4LFU A;  4OIP F;  2Y48 A;  2XKP A;  1W4M A;  4GO1 A;  1MGT A;  1T39 A;  2EFW A;  1TQM A;  1HW5 A;  3F8F A;  1B59 A;  3F6V A;  3KP6 A;  1XDU A;  4EGZ A;  4U0V A;  4A0Y A;  4Q5S F;  5HVQ C;  3CO6 C;  1FY7 A;  3ZMU A;  2O61 A;  3MFK A;  1XB4 A;  4A5M A;  4M9Z A;  2VC0 A;  1HKS A;  4ZYE A;  3C7J A;  1FP1 D;  2H6B A;  2QVO A;  1RNL A;  2DPU A;  5DUK A;  1T0F A;  5TRD A;  3HHG A;  5BPD A;  3RKW A;  5HDK A;  2E1C A;  4BQA A;  1K78 A;  1KA8 A;  5FLX K;  4WK8 F;  3MAJ A;  1JXS A;  2M8E A;  1P4W A;  3VOD A;  4CZZ A;  4WXD A;  4O5V A;  1R1T A;  3LAJ A;  4UXN A;  4IHS A;  1IUY A;  4HV6 A;  3HIF A;  2PQ8 A;  3ELK A;  4RB1 A;  1ZLJ A;  4HV5 A;  2ISZ A;  3ZMZ A;  1R5G A;  2A6H F;  3RJP A;  2DQR A;  1B1B A;  1QQI A;  4ENM A;  2A07 F;  3GVA A;  5A2Q Z;  1HST A;  2XAJ A;  2O8X A;  4WXH A;  3GFL A;  1YS6 A;  2RV8 A;  3GYH X;  5FD5 A;  2DAO A;  2GWR A;  3CUQ A;  1R22 A;  5IT9 Z;  2VOO A;  4M74 A;  5CYV A;  2NS0 A;  1SD5 A;  3KZZ A;  3E5X A;  3GW2 A;  4R79 A;  3ERE D;  3RKX A;  5DDG A;  3DPL C;  1OPC A;  5DCM A;  3BY6 A;  3SHF A;  2E1N A;  2VT2 A;  3EYI A;  1JHH A;  3WGH A;  2ZBK A;  1I5Z A;  4OU0 A;  4ESJ A;  1V3F A;  2DO7 A;  3VOE A;  1HQC A;  1QO0 D;  3F23 A;  2A68 F;  1CGP A;  5F1R A;  2V1U A;  3MEX A;  4RB0 A;  2GQQ A;  2HR3 A;  3W6K B;  3P9C A;  2YX4 A;  2M5W A;  1S3J A;  2MD5 A;  4PGH A;  1JE8 A;  1Z91 A;  1J59 A;  1MJB A;  3FXQ A;  3T8R A;  4LLG F;  4EJW A;  1TNT A;  2H09 A;  1QZY A;  4CXF A;  3EYY A;  5D5W B;  5ED4 A;  3RIR A;  2Z99 A;  4IPA A;  1KQ8 A;  3HTU A;  2UXX A;  1LQ1 A;  4ASN A;  2VBY A;  2MLG A;  4HBL A;  4AIJ A;  4KN4 X;  1DDN A;  1IF1 A;  1OKR A;  2LNB A;  3RKY A;  2DU9 A;  3M8F A;  2R7D A;  1YTY A;  1J9I A;  2H27 A;  1KQ0 A;  3S2W A;  3FM3 A;  3ZN0 A;  3NEU A;  3RPQ A;  3MZY A;  4LLL A;  5D6E A;  3DPT A;  3PQJ A;  1F4K A;  4OIO F; 
#chains in the Genus database with same CATH topology
 4IOA F;  2ETH A;  4BQN A;  1BW6 A;  4WCG A;  1YIT I;  1VQM I;  3K0L A;  3Q3S A;  1R1V A;  2PJR A;  3BG6 A;  2PMZ N;  1JUP A;  4G7H F;  3LFU A;  4A3F J;  1YJN I;  4QPO A;  4HQM A;  3CJN A;  4XL9 A;  1VI0 A;  3R60 A;  2LH9 A;  4RM2 A;  4UUS B;  2GA2 A;  3GO5 A;  1X1C A;  2IGM A;  2A5Y B;  2XPW A;  2EIL H;  2K3F A;  2BYV E;  4IHT A;  1ZAR A;  2WBM A;  4D1Q A;  3S8P A;  3IL2 A;  4J19 A;  4CGZ A;  2QCO A;  3ABM H;  2HVR A;  4IQJ A;  2XC7 A;  1FC3 A;  4HRI A;  4IHX A;  1USS A;  1ON2 A;  1XGS A;  4AIH A;  2KL4 A;  4UUV A;  2XV4 S;  3F0C A;  3CZ6 A;  1BIA A;  2FNP A;  3BR0 A;  5DD8 A;  4HST A;  1MDM B;  3FXU A;  3ZGK A;  2IRF G;  1ETK A;  2CQQ A;  5E8I A;  5J1U A;  3SYT A;  2QA4 I;  4PDK A;  2F4I A;  1VQ7 I;  3O8H A;  4I0A A;  1MNM C;  3GTL J;  4BHC A;  2F4M B;  3OIP A;  1ZQ3 P;  2XSJ C;  3K1N A;  4DJA A;  1I6X A;  5E1X A;  2E60 A;  1FP2 A;  3TDZ C;  3K1M A;  3K2Z A;  4HDU A;  2DA1 A;  3DTI A;  4LK1 F;  4KN7 X;  4KIB A;  4YEJ A;  3PSI A;  1K6Y A;  1DGR M;  1XGN A;  2JSP A;  2PMU A;  4BH9 A;  3JSO A;  1OCP A;  2LR8 A;  4AD9 A;  3GUD A;  1J75 A;  3S1Q J;  2ZNZ A;  3TMO A;  2EFP A;  2ECB A;  4B8X A;  1WSU A;  1ZTR A;  3F8M A;  2QSG X;  1H0M A;  1FPQ A;  2K4J A;  2A6E F;  3L7W A;  2FEZ A;  2P6T A;  1MZB A;  2DT5 A;  4LIU A;  3OYC A;  3WU2 C;  2JN6 A;  1Z05 A;  2HDD A;  2Y0M A;  2KRC A;  1TWF J;  5H6Q A;  4L5I A;  1H88 C;  3OIO A;  1UHW A;  4HOB A;  2HDC A;  1XCB A;  5D8K B;  1G8X A;  1XG1 A;  5D4R A;  3ZQH A;  4NQW B;  4JX5 A;  3AG1 H;  5F04 A;  2OTJ I;  3OYD A;  4A3B J;  3G73 A;  2O8K A;  3BCA A;  5JHU A;  2ZFU A;  3H5R A;  2EIM H;  1R23 A;  2H6C A;  4M3F A;  2AQF A;  2ECC A;  2EQR A;  3BR6 A;  3JR9 A;  3V8L A;  4ESB A;  4KIS A;  1BA5 A;  3HRT A;  3IC7 A;  3F9K A;  3HZJ A;  2LYC A;  2LY9 A;  3PUB A;  2EIJ H;  4ZJZ A;  4XSX F;  2FMY A;  4XLE A;  5K1Y A;  4H0E A;  4FTH A;  4KA4 A;  1W7P B;  2NOG A;  2Z5U A;  5ILS A;  2AXT C;  4I01 A;  1FMW A;  5E17 F;  3WHC A;  1ERD A;  3TOB A;  4HQE A;  1BR1 A;  1D3Y A;  4GYG A;  3V7C A;  2EV0 A;  3EDP A;  4P9U A;  5GTH C;  2X6Y A;  4TV7 A;  4BXU A;  3U1K A;  1S5L C;  1R5I D;  4MTE A;  1F5T A;  4QLC U;  1RUO A;  1MND A;  3BC8 A;  2JA2 A;  1SAN A;  2WY8 Q;  4AYB N;  1HA8 A;  5D5X B;  3OYL A;  2KQR A;  5KK1 A;  3WTT C;  3DF8 A;  4ZC3 A;  2LLK A;  1PUF A;  2BY2 A;  5ICC A;  1RUN A;  3M8J A;  5JLX A;  3CCE I;  4QIW N;  2HGC A;  5LBQ A;  1X1D A;  3ML6 A;  4KIC A;  4BKX A;  3S16 J;  2P4W A;  3CCJ I;  2VBZ A;  1R36 A;  3K4J A;  2XAU A;  5E20 A;  1WJ5 A;  5EG0 A;  5LEK A;  1YIO A;  2QM3 A;  2QQA A;  3RYR A;  5E3L A;  4F7Z A;  4OOI A;  1L3L A;  3IWZ A;  3BR1 A;  1WH7 A;  1UCR A;  1XMK A;  1ETX A;  3SQN A;  1RPW A;  4ZYD A;  4EJU A;  2FNA A;  3NWT A;  3DKY A;  4A2U A;  1KU9 A;  3UR3 C;  3ZCO A;  3WGG A;  3TGN A;  3QPL A;  2EFO A;  4CYD A;  2VN2 A;  1S7E A;  1MIJ A;  3W2W A;  4BJ5 C;  1ZG5 A;  1FTT A;  2PX9 A;  3CC7 I;  3BZC A;  1CF7 B;  5K7F A;  3FHZ A;  5IT9 R;  3HUG B;  4NDL A;  2L0K A;  2JJ7 A;  1XSD A;  4OMY A;  3KEO A;  1LUJ B;  3OR1 C;  3PSF A;  4KIF A;  2R5Z B;  3OYE A;  2E35 A;  1YG2 A;  4I09 A;  1HSJ A;  2LKP A;  4OAZ A;  2VPR A;  2X6W A;  1B4A A;  3ZN1 A;  1EA3 A;  5BS6 A;  1G4D A;  1SEU A;  2I5U A;  3H3V K;  5IP7 J;  4JQF A;  5LHG A;  5GTI C;  2H94 A;  4XID A;  2NYX A;  3ECH A;  3ZMT A;  5L3F A;  2E7X A;  4HG2 A;  3QPH A;  5LRS A;  3N4M A;  1LE8 A;  1OYY A;  4UVB A;  2DYR H;  2QBY B;  3V7S A;  2B63 J;  1U2W A;  2R7X A;  4ETS A;  5BQT A;  5E3M A;  3OS0 A;  1Y39 A;  3JAM Z;  3FKI J;  4P55 A;  2E2J J;  3JRF A;  2L54 A;  2ZXW H;  2A69 F;  2IJL A;  1S9H A;  1GXP A;  5KAF C;  3DKW A;  3RDI A;  4A5N A;  2IW5 A;  2ELK A;  2O03 A;  4N9I A;  1T0F C;  3M3Y J;  4UHT A;  4L9V A;  1FBS A;  1W36 D;  5EZG A;  2LF7 A;  1XTA A;  2BY3 A;  2R93 J;  3OYH A;  1RKT A;  4HZF A;  2FUG 2;  3EPZ A;  2M87 A;  3IP4 B;  5LD2 C;  1UZC A;  2L3D A;  3ABK H;  2DN0 A;  3C2G A;  3BQZ A;  3MZH A;  3ERM A;  4MEY F;  2R4G A;  3PFI A;  5E3N A;  3QYE A;  2HQR A;  1ZYR F;  3R0A A;  3MKL A;  1HC8 A;  3DV8 A;  1V55 H;  3F72 A;  4XLN F;  2AHQ A;  3I4M J;  2XAF A;  2CV2 A;  2BW3 B;  2PBI A;  6PAX A;  1OMI A;  3KPH A;  4XK4 A;  1ZG1 A;  2CV0 A;  1Y0U A;  5HS7 A;  4Y3O A;  2LC2 A;  3DQV C;  5CQG A;  1A5J A;  5GP9 A;  5DUI A;  4AM3 A;  3I54 A;  2CW0 F;  3BZ6 A;  2CQN A;  4CHU A;  3VEP A;  3OIQ A;  5EEG A;  3CMY A;  1MDM A;  4AUX A;  3MWM A;  5LEJ A;  4IRH A;  3EUK L;  2K9N A;  4LB5 A;  2KIS A;  4P5O A;  2OV7 A;  4EM0 B;  2NVX J;  1Z0X A;  4XLC A;  1BM9 A;  3LSP A;  3CUQ C;  3CCR I;  2HEO A;  4B1R A;  3LSK A;  1FYK A;  4XNF A;  2LBF B;  1LFP A;  4D0P A;  3FIS A;  2QKM B;  3HOX J;  3V7R A;  3ZMV A;  3EUH A;  4C2M J;  1YQA A;  2KDO A;  3L00 A;  2DFH A;  3ULQ B;  2IVM A;  1O4X A;  4A3I J;  2L01 A;  2PMH A;  3H1C A;  1RR8 C;  3FK7 A;  1LEA A;  1J5Y A;  2KZV A;  3AG4 H;  2EIN H;  3KEY A;  5EEH A;  3R6S A;  5H2F C;  2P7C B;  3OS2 A;  3OYK A;  2VLA A;  2HOT A;  3H3U A;  4I2O A;  3K10 A;  3M07 A;  3BJA A;  3CCM I;  4FCY A;  4XKB A;  3HJE A;  3WTX C;  1V5G A;  2DA3 A;  4MQV A;  3S1R J;  2HYF A;  4WX9 A;  1RES A;  4IHY A;  1DQU A;  4RAZ A;  4BBR J;  1WI3 A;  5CVI A;  1RI7 A;  1XGO A;  3HOS A;  2ZSI B;  2XAS A;  4J00 A;  5CVU A;  4UVC A;  2OF7 A;  5KHD A;  3I59 B;  2LY2 A;  3FK6 A;  2L9S A;  4NQW A;  1IXS B;  2K02 A;  3T5X A;  3BTJ A;  3D1N I;  1D8K A;  5J4V A;  3HRS A;  2DMU A;  1H9G A;  5M5X J;  1QNT A;  2STW A;  3J80 R;  4S04 A;  2Z1D A;  3WGI A;  3I71 A;  2P0W A;  3LSI A;  2UWM A;  4II2 A;  2CFO A;  4WWC A;  4OAY A;  4IXA A;  2V79 A;  2NVU B;  5JHF A;  2UUZ A;  1OCR H;  2X51 A;  2OD5 A;  3LNQ A;  1FZP B;  4CO8 A;  1VQL I;  2D2W A;  3WTS C;  2JRM A;  3V8K A;  3WTU C;  1SD6 A;  3RCO A;  3SZP A;  1W7P A;  3CCV I;  2NS7 A;  3K9T A;  4MO7 A;  1GV2 A;  3PIP F;  2CQX A;  5K5O A;  2B7E A;  2VL8 A;  2W25 A;  1FYM A;  4I7H A;  3TO7 A;  4E4H A;  4EJT A;  2LVS A;  3FHN A;  3D5L A;  3LST A;  2R0Q C;  1TWC J;  1Y0N A;  1JKR C;  4XLA A;  2LFB A;  4JBA A;  2VJ4 A;  1SFE A;  4OMZ A;  2KKO A;  2CUF A;  3Q5F A;  2P5V A;  1MBK A;  4DQ2 A;  1N77 A;  3E6D A;  4LG0 A;  3T0Y A;  1SFO J;  4ZH4 F;  3CCL I;  4YIF A;  4QPQ A;  2PLY A;  2COB A;  2D1V A;  2X9D A;  3B02 A;  4JX6 A;  4CCL A;  2ME6 A;  4CSW A;  1OCT C;  3DWL E;  3OYJ A;  1GVJ A;  1KU2 A;  5F6F A;  1BOA A;  1MBH A;  1S72 I;  4A6D A;  5IOY A;  4E7J A;  2Y69 H;  2RKH A;  3HYI A;  2WB1 A;  5LGN A;  4ENK A;  1TWA J;  4ZDP A;  1WRJ A;  1P9Q C;  3DEW A;  5E1W A;  1F43 A;  2DYS H;  3O2P E;  1YS7 A;  1IXR C;  2DOF A;  4F92 B;  3QYB A;  2FA5 A;  1R5H A;  4D7N A;  4AIK A;  4C2U A;  1TWH J;  2JUC A;  1ZHF A;  1U9O A;  3TQN A;  1ONV A;  2CU7 A;  4G9Y A;  2VXZ A;  1LJ9 A;  3LA2 A;  3A0H C;  2MC4 A;  1CF7 A;  4Y52 J;  3BG5 A;  1GDT A;  5HDG A;  3I55 I;  2XGE A;  3HUG A;  2FBI A;  3IAM 2;  3SXY A;  3V42 A;  3VFZ A;  3LQQ A;  4UV9 A;  1RQ6 A;  4U0W A;  2O0Y A;  2ESN A;  4AVZ A;  2DA2 A;  5LHI A;  2R5Z A;  3LSH A;  3SDG A;  4U87 A;  1G3Y A;  2HOS A;  1EF4 A;  1GLN A;  2ELH A;  4YG2 F;  5E79 C;  4I99 C;  3TKY A;  1MNE A;  5AIP A;  1XSX A;  1PVE A;  2CG4 A;  2XVC A;  2K9S A;  4KMU X;  1ZRE A;  5EJC A;  3FXR A;  1R7J A;  3ABT A;  5LRR A;  3KZY A;  4G7Z F;  4LIT A;  3MN2 A;  1JGG A;  2XUB A;  2QBY A;  3OYM A;  2A3S A;  4IZZ A;  2BHZ A;  1ACI A;  4D5F A;  3KYD B;  2HOA A;  4XOP A;  3VYU B;  3AL0 B;  3GTJ J;  1DPU A;  2MAB A;  3UKG A;  3Q0W A;  3PNY A;  3K6G A;  1XDS A;  3D0S A;  4EAT A;  2FBH A;  2E2H J;  1HKQ A;  3FXJ A;  4E6K G;  2A61 A;  4EJV A;  1AOY A;  3LSJ A;  4M3B A;  3ECO A;  4ON0 A;  4EEF G;  1BC7 C;  1YO5 C;  4GDF A;  3BLY A;  3D5R C;  1FLI A;  2HPM A;  3BR2 A;  2MUN A;  4ZYA A;  3BP8 A;  4MFD A;  3S3O A;  1E2X A;  4A0Z A;  1KYW A;  2HS5 A;  1YYV A;  4ZTJ A;  1D1C A;  3HHH A;  1OR7 C;  3I4N J;  2RGV A;  1R9T J;  1T2K A;  2ZME B;  2K40 A;  2HI3 A;  1FT9 A;  3JRH A;  1Y8R B;  2WV0 A;  5L3G A;  2K9M A;  4GXO A;  3GLX A;  3GZ6 A;  3F8B A;  5D5V B;  3SEZ A;  1ORK A;  2M0C A;  5FKL A;  1X58 A;  1U78 A;  3L2U A;  3DBL B;  4XOR A;  3RPU A;  2BW3 A;  4NB5 A;  2VKV A;  1JKQ C;  4BY7 J;  3FM5 A;  2DDA A;  3W6J B;  5HLI A;  2L9N A;  2LF8 A;  1LB2 A;  5K5Q A;  1ZGJ A;  2VE9 A;  1MMN A;  2X98 A;  1K4T A;  1R58 A;  2PJP A;  2HKO A;  5ICE A;  3DTE A;  1X3Z B;  3FWE A;  4F55 A;  2W85 A;  1DGW Y;  2DXI A;  3HGY A;  2XGD A;  4G12 A;  5FKO A;  5CVV A;  3L2Q A;  1XN7 A;  3GCM A;  2LMD A;  2P0T A;  3GLL A;  3CLO A;  2GXG A;  3U1D A;  3G6E I;  4KFC A;  4IHW A;  1T98 A;  1ITY A;  3C2H A;  3JAM R;  3K4N A;  1YJ9 I;  1KQ9 A;  3W2A A;  1SD4 A;  1D0Z A;  3K4B A;  2OZU A;  2DFF A;  4A69 C;  2IS4 A;  1UEL B;  2VIX A;  3VDX A;  2LBF A;  3HC7 A;  2FOW A;  4HX7 A;  4II3 A;  4HF2 A;  3AG2 H;  3AL0 C;  1MMS A;  1AKH B;  1E3H A;  4G6D A;  5L3B A;  1X1A A;  2F5E A;  2HXO A;  4XIC A;  4CCM A;  3VPR A;  3GZ5 A;  3CDI A;  4AVP A;  4B3A A;  5KNL A;  3LSR A;  1Z6T A;  5DYM A;  3KLN A;  2XGC A;  1VF9 A;  2B0L A;  1LE8 B;  2E36 A;  5IOZ A;  1B72 B;  1I27 A;  2XB5 A;  4BAY A;  2H8R A;  3C18 A;  2F48 A;  4M3G A;  1LDJ A;  2JT1 A;  3QPT A;  2K7L A;  3ZQ7 A;  4RMN A;  1T95 A;  1V5E A;  1QZE A;  4L5J A;  3KIO A;  2L7K A;  2DA4 A;  2ZCW A;  3I59 A;  1O3T A;  3WHB A;  2H1K A;  3IAS 2;  3WOD F;  1XD7 A;  5EF6 A;  1IDZ A;  1IJW C;  3SFZ A;  1WJE A;  3J81 Z;  2X1C A;  4R1H A;  4CH7 A;  4YFN F;  2ICW G;  3M4O J;  3B73 A;  3UNG C;  1FNN A;  4N4N B;  2P5L C;  2HWV A;  2X0L A;  4WF2 A;  2M4K A;  2GZW A;  1IO2 A;  1OYW A;  3HRM A;  3MD2 A;  3J7Z I;  5L3D A;  3I56 I;  4CIC A;  3OR2 C;  2ZO4 A;  3DTK A;  2OTL I;  1FOW A;  2PI0 A;  3COA C;  5A2Q K;  2NRA C;  4JP0 A;  1FMV A;  2VJI A;  1VZ0 A;  2V1N A;  1TT0 A;  1MMD A;  4NC6 A;  4DZJ A;  1BR2 A;  4ZDL A;  5C44 J;  1A04 A;  5D4S A;  3CME I;  2BVM A;  1JUM A;  2WB1 N;  5F1J A;  5FKM A;  2RNJ A;  3CD6 I;  4G8X A;  2EWN A;  2W57 A;  5IT9 K;  2FE3 A;  3OYI A;  2NS8 A;  1FSH A;  2K85 A;  2IP2 A;  3KP5 A;  4FET A;  4BJT A;  3J80 Z;  3U2R A;  5EDN A;  1LPQ A;  3HGG A;  2Q8K A;  1HW1 A;  5ILV A;  4Q4Z F;  2F5F A;  3ZMD A;  2HQ5 A;  2XGX A;  3DFG A;  4N0B A;  1WJF A;  5B3S H;  2CQ7 A;  2KDZ A;  2CRG A;  5CJ9 A;  3OSG A;  2E19 A;  4KIT B;  1RR7 A;  3I9V 2;  2Y0S A;  3A1Y A;  4XN3 A;  2QSF X;  4ESF A;  1FSE A;  3L2V A;  1S7A A;  3F21 A;  4CZC A;  1J0R A;  4I0B A;  4HNV A;  2ACJ A;  3S3N A;  1YHQ I;  3BDD A;  1ON1 A;  2YU9 J;  1A6I A;  3BTL A;  4RAG A;  4EVI A;  1W0U A;  2W48 A;  4X1E A;  1UFM A;  1Q1V A;  4F52 A;  1IRG A;  1TQI A;  2KFD A;  3FF5 A;  1TTY A;  2YPR A;  4LOC A;  1OR7 A;  3N97 A;  3DP7 A;  4KT6 A;  2JWT A;  4LD5 A;  2ZSH B;  4U7D A;  3DCF A;  4M9X A;  4XLH A;  2MLK A;  2VQL A;  4R8H A;  2FQ3 A;  1R4M B;  4A93 J;  1K4S A;  4QTR A;  3QOP A;  4N9H A;  2XKO A;  2HOE A;  1IGN A;  2FXA A;  5GAD J;  2OQG A;  1FX7 A;  3K69 A;  3G1M A;  4D5C A;  3OMY A;  3O6B B;  4ZYG A;  2JA6 J;  1PP7 U;  3MVP A;  1QRY A;  5FRO A;  1BC8 C;  1D5V A;  4CA0 A;  2KPM A;  5DEQ A;  5FLV A;  3KP4 A;  1SFX A;  2OU2 A;  2XB0 X;  3E1S A;  4UNO A;  4AWX B;  2DFE A;  2QQ9 A;  3EET A;  1ZK8 A;  2KJB A;  2MZ4 A;  2DPD A;  4Z6Y A;  3FXL A;  2BV6 A;  2GXB A;  1OCC H;  4FAS D;  2TRT A;  2W24 A;  2HXI A;  3DXJ F;  1VQP I;  3SZT A;  4FE4 A;  4KMF A;  2HTS A;  4B48 A;  1R49 A;  1I6H J;  2WAD A;  3GF2 A;  3IHU A;  5FB2 A;  2R7R A;  2IGK A;  1BI2 A;  2X48 A;  2Q0O A;  4DYR A;  2Y75 A;  2R5Y B;  2CS3 A;  3D5S C;  3H36 A;  1T6S A;  2HKX A;  4BDY A;  3H92 A;  4C30 A;  1HF0 A;  1U0J A;  1SFU A;  2M2E A;  2QSH X;  2KHM A;  1QZZ A;  1MKM A;  2ZNY A;  3LA7 A;  1REP C;  4A3L J;  1E17 A;  4XSZ F;  2MFZ A;  1IN4 A;  2JK3 A;  3CCY A;  3KLO A;  1YW7 A;  2Z3Y A;  3BRO A;  1PYV A;  2M34 A;  2DBB A;  2K4B A;  4PSW A;  2N8G A;  3E0J B;  3JRD A;  1SMY F;  3V4G A;  4LG0 B;  2L9R A;  1S6L A;  3QOE A;  2DA5 A;  5FFX A;  4PCQ A;  4CDG A;  3CJR B;  4PJL A;  4A3M J;  2CGP A;  4FX0 A;  2MSY A;  3HXL A;  1TLH B;  2XAG A;  3BR5 A;  3LSG A;  3CJT B;  2ZME A;  4UUT A;  5K7Z A;  2GM4 A;  4DBR A;  3CUO A;  3LWF A;  4RM3 A;  3EUH C;  4RLQ A;  5FJ8 J;  2XRL A;  2ZJ2 A;  2BBY A;  2DA7 A;  3TW7 A;  2E7W A;  4K2E A;  3M7G A;  2WV1 A;  1T08 B;  2EZK A;  3LOC A;  2P6S A;  1QHG A;  3FXK A;  4IVN A;  3FZV A;  1YX3 A;  1ZEL A;  4L9J A;  1VQ6 I;  3RI4 A;  4RAF A;  3G1O A;  3T8T A;  3IKV A;  3G2B A;  4BNC A;  2D1H A;  3G3Z A;  4B09 A;  4ENN A;  2WWY A;  3ASO H;  2JPC A;  2CFX A;  4Y33 A;  5M5Y J;  2C6Y A;  3RYP A;  1O3Q A;  3KEQ A;  3TOA A;  3DEU A;  4U0Y A;  3GTQ J;  2MG4 A;  3MMY B;  1C0W A;  3A01 B;  1N78 A;  2WC2 A;  4A6E A;  5J8F A;  4HDV A;  1LDK B;  5CVR A;  1Y1W J;  5C4X J;  3X2Q H;  1HOM A;  3E7L A;  3SDB A;  2IXS A;  3K70 D;  1UST A;  4AU7 A;  3WTV C;  2PN6 A;  3S14 J;  1A35 A;  2HZD A;  4EMS A;  3J7Y J;  1AKH A;  1D5Y A;  1Z67 A;  4MEX F;  2EBI A;  4XKC A;  4HA8 A;  2XRN A;  3F8C A;  4CUG A;  3BPX A;  2M3A A;  2XAQ A;  2DOE A;  1X2M A;  4DYC A;  4OIR F;  1B72 A;  2RVC A;  1VTN C;  1YLF A;  4U88 A;  4PFP A;  3KYL A;  2JVG A;  3M1E A;  1TC3 C;  5FLM J;  2WAF A;  2CSO A;  4GFB A;  2CUZ A;  2XHK A;  3U9G A;  2MC3 A;  5TGT A;  2GXA A;  1ETW A;  1OLT A;  1HCR A;  2V1D A;  3P7N A;  1JTX A;  2IA2 A;  3BZK A;  4EJO A;  2IT0 A;  4EGY A;  5EGO B;  2HYG D;  4RGR A;  1UAA A;  1QHH D;  5DD4 A;  5HOD A;  3A02 A;  5FKK A;  5J47 A;  5HLG A;  1MBF A;  1UJ8 A;  3QU6 A;  1A31 A;  3WE3 A;  4BUP A;  3E3V A;  5C4J J;  4NHJ A;  3J7A W;  4E7I A;  3HBL A;  4O3M A;  1FJL A;  3ZQF A;  2DFI A;  3JRI A;  2EV5 A;  3L1P A;  3CP8 A;  1O57 A;  2Y0S N;  3GFM A;  5LGU A;  1O7L A;  1JT6 A;  2OJE D;  3IV5 A;  2GAU A;  1RIO H;  1P2F A;  2G0E A;  3VSL A;  3OS1 A;  3N05 A;  4JOM A;  3ZOB A;  2F2E A;  2DMT A;  2EPF A;  2CO5 A;  2O6G E;  1U5T B;  1W5C C;  5F08 A;  1FBU A;  3CTA A;  3HPG A;  3CLQ A;  4DGW B;  2HYJ A;  5HNH A;  4EM2 A;  2MW8 A;  2OBP A;  2R7O A;  2I8D A;  1IRX A;  4HSR A;  2XDV A;  4BE1 A;  1K83 J;  3S2D J;  5AIQ A;  2HVS A;  3I4P A;  2LDU A;  3H0G J;  2BVL A;  2Y31 A;  3IRQ A;  5FLX Z;  1ZGW A;  5B1A H;  2IPQ X;  2AS5 F;  3TO6 A;  5IT3 A;  3IKT A;  1NHA A;  4MFE A;  2DQL A;  3EUA A;  2GA1 A;  2VOP A;  2FU4 A;  2VJJ A;  1LVA A;  2LK2 A;  3RTR A;  2EH3 A;  2EFN A;  3DU5 A;  3PL8 A;  4P96 A;  3GTM J;  1L0O C;  5E1Z B;  1T38 A;  5BNG A;  1XPX A;  1LVK A;  1XX5 A;  1VQ8 I;  3FMQ A;  1ULY A;  3KP3 A;  4HPQ A;  2IBD A;  2QUF A;  1J7K A;  2GIZ A;  2MBF A;  3PNT A;  2I10 A;  2YUS A;  1WKM A;  3J81 R;  2O7O A;  4U7B A;  3LA3 A;  1PDN C;  4ANJ A;  3CO7 C;  4HF0 A;  1Z7L A;  3ZQI A;  4IRI A;  4O6J A;  5ICF A;  4NC7 A;  2EB7 A;  1POG A;  3FX3 A;  2H1L A;  1IW7 F;  2DOA A;  5AON A;  5BPI A;  3T1B A;  3CCU I;  1U6G A;  2L4A A;  3TP3 A;  3CDL A;  1P4X A;  5IP6 A;  3L2C A;  3HPH A;  2W84 A;  2RN7 A;  4YIR X;  3HSF A;  2M35 A;  2DMN A;  3HEF A;  2JVH A;  1LNW A;  1P6R A;  3E6B A;  4GGG A;  1HKT A;  1ODD A;  1HW2 A;  1D0Y A;  2OZ6 A;  2VOD A;  1S29 A;  2RQQ A;  3GTK J;  3K4C A;  1U5T C;  2FRH A;  3P9K A;  5J4Y A;  2NVT J;  3HOU J;  4ZYH A;  1BBY A;  2KIU A;  2BHY A;  4JK1 X;  2QQB A;  3HOW J;  1YE9 A;  1JHF A;  4RGU A;  1R4N B;  3FMS A;  2HPI A;  2LG4 A;  2VXD A;  5IYB J;  1BI1 A;  2R5Y A;  3A52 A;  4IL6 C;  4I76 A;  1FOX A;  4CCO A;  1V5F A;  3H0D A;  1N25 A;  2FX0 A;  2WY7 Q;  3KP2 A;  4EM1 A;  2VE8 A;  3JAM K;  3K7A J;  3AAF A;  3IH3 A;  2EFQ A;  1LFU P;  3A0B C;  4XBF A;  3ZQQ A;  1OFC X;  3VB2 A;  3H9G A;  1PP8 F;  2IEK A;  2WAQ A;  1YOV B;  2ZXH A;  4MQ9 F;  3WE2 A;  2MVT A;  4M71 A;  4DNC A;  4GRI A;  2DMP A;  3GX4 X;  1R6R A;  2O3F A;  1F1Z A;  3VSK A;  3A4C A;  3SZG A;  1N75 A;  2DLL A;  4IEJ A;  1TBX A;  5IYD J;  4G94 A;  3WG7 H;  3Q0U A;  1VQK I;  4M6X A;  1VQ5 I;  1FBQ A;  3JRB A;  4G6T B;  2ZJR F;  3OOP A;  1K61 A;  3A2K A;  5K7H A;  2F5C A;  4M9S A;  3DBR B;  1IN8 A;  1QVU A;  2F6C A;  4Z2Y A;  1UHM A;  2WTE A;  1OQY A;  1FIP A;  3WTZ A;  5JR3 A;  4X0G A;  4H4K C;  2VON A;  1ETY A;  3F22 A;  2NAZ A;  1P7J A;  3ZRG A;  5HOO A;  2PEX A;  3ZQL A;  2OA4 A;  1YW9 A;  2ZB9 A;  3Q0V A;  1Z21 A;  2EJR A;  1EH8 A;  2DW4 A;  3SFI A;  2R7F A;  2R7Z J;  1F36 A;  4PUS A;  4DBQ A;  2EA2 A;  4FX4 A;  2L7M P;  1E3O C;  3P5J A;  3A01 A;  4PJ0 C;  4XN0 A;  3OV8 A;  5GAH J;  4F91 B;  3ZXS A;  2BZT A;  2Q1Z B;  3CCQ I;  1HBX G;  3EQL F;  3QAH A;  4E7S A;  2XF7 A;  2JZY A;  4GYI A;  2EZH A;  2RC4 A;  4KIG A;  3E6C C;  2DDB A;  2D5V A;  1UG0 A;  3ZR8 X;  5KCM A;  2F5V A;  5F0C A;  3QP5 A;  1U8B A;  2E5Z A;  2LKS A;  4WXC A;  3FMR A;  2FQ4 A;  1P92 A;  5DS9 A;  5D6F A;  1JJ8 C;  1KU7 A;  3PM1 A;  5EYR A;  1K79 A;  3GTO J;  3QOD A;  2IA0 A;  2JMW A;  2VKE A;  4UB8 C;  4ENJ A;  3FXO A;  2R92 J;  3L09 A;  3RQI A;  2HFH A;  3H35 A;  1PUE E;  1RZ4 A;  1OYI A;  4V2F A;  3ABU A;  3V8J A;  4BHB A;  1KGS A;  1D8J A;  4HX4 A;  3J7A Y;  5TIS C;  1ZLK A;  1APL C;  2R7V A;  3TP0 A;  1A6Q A;  4QSH A;  1CQT A;  2W7N A;  2E1M B;  1AHD P;  5ILU A;  1BIB A;  1XCV A;  1M1E B;  4M72 A;  3I64 A;  2ZXI A;  3GME A;  2XRO A;  5EGO A;  2UZK A;  2YX7 A;  4ZDO A;  4ZTF A;  3AFH A;  1GT0 C;  2X4H A;  3A03 A;  2CWE A;  4BGD A;  2BY0 A;  5B5E C;  1UB9 A;  2R3S A;  1P4A A;  1DUX C;  2XPV A;  2QGU A;  1LEB A;  5J1Y A;  1A36 A;  5HLH A;  2K9L A;  3BPV A;  1UMQ A;  2X1D A;  2ZC2 A;  3PO2 J;  1ZH5 A;  2ZXJ A;  5HS8 A;  3WU0 A;  3AG3 H;  5CPR B;  4RB3 C;  4BBS J;  4MTD A;  1TW3 A;  3VYR B;  1W7P D;  2QEX I;  1U5T A;  1SAX A;  1ETO A;  2OAZ A;  3M8E A;  4AID A;  4GCV A;  1WZ2 A;  2IS2 A;  1IC8 A;  2QYO A;  2XF6 A;  1I50 J;  2ZFW A;  2O9L A;  4XM3 A;  5J8C A;  1IXC A;  1GVD A;  3KP7 A;  2BE5 F;  2HTJ A;  3OYB A;  4OIQ F;  3PQK A;  3DU6 A;  5K5R A;  3TW6 A;  2BXY A;  3GTG J;  1YW8 A;  2L9V A;  3FBN B;  2PG4 A;  1OJL A;  1VQN I;  4XRS A;  2NVQ J;  2ZJP F;  3OYN A;  4HYE A;  4Y4R A;  2L7F P;  3H5A A;  4DYQ A;  1WVR A;  3CES A;  3HOV J;  3JRG A;  4UB6 C;  3IRR A;  1MJ9 A;  2KRF A;  3OOU A;  4PK4 A;  3QP6 A;  3WU1 B;  1MBJ A;  4YEL A;  2VC1 A;  4NNJ A;  2X6X A;  3HSR A;  3C2B A;  3LFK A;  4EV0 A;  1RKW A;  1E0E A;  1Y56 A;  4HF1 A;  1FWZ A;  1K6O A;  1ZRF A;  3OYF A;  3JRC A;  1H9T A;  3LQR A;  1WWX A;  4BJ6 C;  1MW7 A;  2M45 A;  3TBI A;  4HX8 A;  5D5U B;  1SFK A;  1IG7 A;  2R7T A;  2E1M C;  1GV5 A;  1W36 C;  1IZ1 A;  4J01 A;  3I5U A;  3BG9 A;  1IRF A;  1KU3 A;  4PGG A;  3AKZ A;  5JLW A;  3KZI C;  2D45 A;  3E5U A;  3BOQ A;  1XC5 A;  4RS8 A;  1V4R A;  4A3C J;  1R00 A;  2VQC A;  2XSD C;  2TCT A;  2HNH A;  1BJA A;  1DPR A;  1QPM A;  2DT7 B;  1DP3 A;  1W5T A;  1WCM J;  2M30 A;  3CC2 I;  1Q1H A;  4DOZ A;  3BR3 A;  4BDZ A;  4L9T A;  2M4G A;  2YU3 A;  2FD5 A;  2ESH A;  5DCF A;  4XR6 A;  4E7L A;  2ZME C;  1X3W B;  1GUU A;  1SC7 A;  2IA1 A;  1LDD A;  3ASN H;  3RKQ A;  2CYY A;  4RAY A;  1G3T A;  2WAQ N;  3TED A;  1T33 A;  2G9W A;  5J1R A;  2QEN A;  4YRV A;  1K7A A;  5FLX R;  4F93 B;  1O3R A;  3S15 J;  2E2I J;  1Z7U A;  2ISY A;  5D8L B;  2STT A;  5LHH A;  1U3E M;  4A3J J;  3FKJ A;  1BW5 A;  2L7Z A;  3S1N J;  3JRE A;  4LIV A;  2W1O A;  3TDU C;  2ADU A;  3SEQ A;  3U21 A;  1TQP A;  3M1C A;  2OQR A;  2P8T A;  2KIF A;  3JTG A;  4FE7 A;  1MD0 A;  2AXL A;  2ELJ A;  1T8I A;  3HOZ J;  1XMA A;  2K86 A;  1FYL A;  1QGP A;  4C3J J;  2Q2E B;  1UHS A;  5JI6 A;  3JSP A;  2VKH A;  2B9S A;  2JA5 J;  3ESW B;  4DIQ A;  1WFX A;  2W82 A;  3KYC B;  4UV8 A;  3H3Z A;  1BI0 A;  2PFB A;  4NBQ A;  2RAE A;  1IUF A;  1OCO H;  3HB9 A;  4MHG A;  4D9J A;  5JVG F;  3GFJ A;  3QYF A;  4BXF A;  3DBH B;  1VFC A;  3W3C A;  3NAU A;  3DLL F;  1KON A;  1MJA A;  1I3Q J;  1MBG A;  4L9N A;  5FO5 A;  1G6N A;  2E5N A;  1IN6 A;  2DK8 A;  3CDH A;  4BHP A;  1JGS A;  5HS9 A;  2M7A A;  2GOX B;  3RPU D;  4PFO A;  3QQA A;  4HNU A;  4DZP A;  2JQ7 A;  3PJR A;  3BWG A;  1WQ2 A;  2ME0 A;  3GEZ A;  3K4M A;  3S2H J;  1QPI A;  4FIS A;  5H6R A;  3S93 A;  3QRF F;  2L02 A;  3VWB A;  2DCE A;  1HXD A;  2CUJ A;  3JCU C;  5HDN A;  1ZN2 A;  4Y17 A;  1JUS A;  5DM7 F;  3E6M A;  2VT3 A;  2G7U A;  3JW4 A;  1I1G A;  1IV6 A;  1WPK A;  1GHC A;  2HQA A;  2QLZ A;  2R7U A;  1WJD A;  5FGM A;  2P81 A;  3DLA A;  3WTY C;  1DU6 A;  4HLY A;  1ZG3 A;  4ABZ A;  2P7V B;  4CYC A;  4P1W A;  2LSO A;  4EQQ A;  2FOK A;  4Y13 A;  1HDP A;  1Y1V J;  4XKW A;  4IKF A;  3GWZ A;  3C1D A;  1Z9C A;  4A3D J;  1NH3 A;  1LKX A;  2L4M A;  4M3D A;  1U8R A;  2GBY A;  2QZ8 A;  5HNF A;  3CC4 I;  5BOX A;  1RC9 A;  5H20 A;  3GZN B;  1S7O A;  4FT8 A;  4XLP F;  3KE2 A;  2XAH A;  1Y6I A;  5JVT A;  4MGR A;  2XF5 A;  2EK5 A;  5GPC A;  2M1B A;  2NNY A;  2NNN A;  1WI9 A;  1I3A A;  3DPU A;  3G4S I;  2GLO A;  3NAR A;  2VBW A;  2Y30 A;  2CW8 A;  1XSV A;  1BN5 A;  3K2A A;  4E7K A;  2EIK H;  4BXX J;  2MH2 A;  3F6O A;  4C9Y A;  1G3W A;  1TW2 A;  2WAE A;  5EEA A;  2HZT A;  4LLN A;  4L0Y B;  4LJZ F;  3GBG A;  3HOT A;  4KYW A;  5KVR A;  4S0H B;  2J5P A;  4FHT A;  5LGT A;  3E5Q A;  4NUB A;  3QU3 A;  4QWQ A;  1EV7 A;  3S1M J;  2KP6 A;  1QVT A;  3WG9 A;  2V26 A;  1Z3Y A;  3J81 K;  2KLO A;  1F9N A;  2HDW A;  2HVQ A;  4B47 A;  3K1P A;  2M0M A;  4RGX A;  3BTC A;  2MH9 A;  5FD6 A;  4I02 A;  1G3S A;  3ZPL A;  4W1U A;  3G1L A;  3ROU A;  3CF5 F;  2RRE A;  4L0Z B;  2OCE A;  1IN5 A;  2IAI A;  3BCB A;  2ZKZ A;  3J7A O;  2F5D A;  5M5W J;  3DEE A;  2UV1 A;  4E70 A;  3ZQC A;  2K9Q A;  2H8W A;  4G6Q A;  1OIS A;  3QWL A;  4BEH B;  3R61 A;  2BEO A;  5BMZ A;  1O7F A;  3MZ8 A;  2TDX A;  3KET A;  1P7I A;  1V54 H;  2K5C A;  1DU0 A;  4LK0 F;  1JT0 A;  4ZZL A;  2JTV A;  3J80 K;  5LLQ A;  4A0X A;  2KMU A;  1TP4 A;  4YFK F;  1NK3 P;  2XIG A;  1RET A;  2JRT A;  1AWC A;  2P5K A;  1IAW A;  2KZG A;  2KRH A;  3OL4 A;  2LKX A;  2G7H A;  1SVM A;  2CQK A;  3H9J A;  1K78 B;  3CF2 A;  2A05 A;  4Q48 A;  2OC6 A;  1MH4 A;  1B9M A;  1VND A;  1JTY A;  3E97 A;  4ITV A;  4HEA 2;  5EZH A;  1YFH A;  3GXO A;  4M6Y A;  4BY1 J;  2DTR A;  2X1E A;  1YRN B;  5A2Q R;  3ABL H;  4UY8 I;  3R0J A;  1X1P A;  4B44 A;  1ZR4 A;  1TZL A;  4HW0 A;  1STZ A;  1GXQ A;  2JSC A;  3L9F A;  1Z77 A;  2J5O A;  1IRZ A;  3HSE A;  3KCC A;  1HDD C;  1QU3 A;  2MA3 A;  5DTD A;  5GAE J;  5J6X A;  4E7Z A;  2K3P A;  1TNS A;  4OWR B;  3IWF A;  3HRU A;  3MCZ A;  5ICG A;  5GAG J;  4IF4 A;  1SMT A;  1ZRD A;  3ISP A;  1BI3 A;  3TO9 A;  2VUM J;  2IS6 A;  2YSR A;  4KUM A;  2Z9O A;  1ZGA A;  2COM A;  4IRG A;  4D7M A;  3P9I A;  4MIM A;  2DT6 A;  1YI2 I;  3WTW C;  3JTH A;  1UG2 A;  1YX5 A;  2DMQ A;  4HLX A;  2OCC H;  2FBK A;  3VYS B;  4LG3 A;  2JPB A;  4ZZD A;  4MNU A;  1TT5 B;  5IYC J;  3G71 I;  5F64 A;  2HQN A;  1X4O A;  3OSF A;  1D1A A;  3FBI B;  1MH3 A;  1IV8 A;  3BQY A;  3CUQ B;  2DI3 A;  1MMA A;  4UVA A;  1JJ6 C;  1Z1D A;  3S32 A;  3CQZ J;  2KIM A;  2UXN A;  4BE0 A;  2RDP A;  5ERI A;  3IUO A;  3CP2 A;  4P9F A;  3REO A;  1LFB A;  4IJA A;  4M6V A;  3ZQG A;  4LGW A;  3KX2 A;  1D0X A;  2LTP A;  1QBJ A;  5DCM B;  4BAC A;  1B6A A;  3HTS B;  4IHV A;  3KFW X;  3OY9 A;  2VBX A;  4KDP A;  2KT0 A;  1ENH A;  5DV5 A;  5CVJ A;  4IO9 F;  4CCN A;  3CMM A;  5LFA A;  1J2X A;  2V6C A;  5L3E A;  2LRE A;  3F3X A;  3FXM A;  2W4S A;  3GTP J;  2CH0 A;  4XKV A;  2K27 A;  3O3K A;  1B8I B;  3JRA A;  2Q2E A;  5JFR A;  4LB6 B;  4PJN A;  1HLV A;  1KYZ A;  3W2V A;  1NK2 P;  4UUS A;  3TL4 X;  2MGQ A;  5FFZ A;  1Z6R A;  2LRD A;  4XRM A;  2V1X A;  2FF4 A;  2EV6 A;  5TJJ A;  5F0F A;  2YR2 A;  2V9V A;  2GOM A;  4PJJ A;  1X2N A;  3CMA I;  1X4P A;  3Q9V A;  1IN7 A;  1BJZ A;  1FOY A;  3ZMS A;  4BE2 A;  4Y7N J;  3R4K A;  4XRS G;  1W0T A;  3LMM A;  2RQP A;  4I98 B;  3I58 A;  4HAM A;  1B9N A;  2KIQ A;  1ZAO A;  2R7W A;  3I53 A;  3SJM A;  1EH6 A;  1W5S A;  4S05 A;  2V7F A;  4LMY A;  4F3Q A;  1R1U A;  1WJA A;  1ETQ A;  4KT5 C;  2Z33 A;  2EA4 A;  1D1B A;  4Q47 A;  1O3S A;  2VB6 A;  3IH2 A;  2LOO A;  2DK5 A;  2VQH A;  1ZRC A;  1EH7 A;  5E8G A;  4YII A;  2ZJQ F;  2FML A;  1XGM A;  4BL0 B;  2FSW A;  3MQ0 A;  3NRV A;  4RB2 C;  3GFI A;  1AA7 A;  4KNY A;  4L18 B;  3H9Q A;  3M9A A;  3OL3 A;  4XOT A;  4A12 A;  5CLS A;  1Y8Q B;  4M73 A;  1WH5 A;  1X19 A;  2CMP A;  3BT9 A;  1X3U A;  4XRF A;  1MSE C;  4A3G J;  1BL0 A;  3PFY A;  3K4L A;  2R7Q A;  3F8N A;  4Y15 A;  2DA6 A;  1Z3X A;  3BJ6 A;  5L3C A;  1JI8 A;  2V6E A;  4PZJ A;  3IH4 A;  1FOK A;  4RGS A;  2BXZ A;  2JUG A;  4OIN F;  4FQG A;  5CKT A;  5IPA A;  2GIV A;  2MD0 A;  2OUM A;  3C3W A;  3I0T A;  1SAU A;  3ZP5 A;  3K4K A;  1I1S A;  2V4J C;  3NQO A;  4G7O F;  1SD7 A;  4KJZ A;  1S8N A;  3PUF A;  2DTZ A;  4RA2 A;  3BG7 A;  4L5E A;  1DP7 P;  5F27 A;  2BGC A;  3I3L A;  4JYK A;  4JX4 A;  4YFX F;  3HG9 A;  5E18 F;  4MLO A;  5E3O A;  3LAP A;  1WHU A;  4BS9 A;  2LY1 A;  3BJO A;  2QWW A;  3DKX A;  1YJW I;  2PJR B;  1H89 C;  4BYY A;  3Q9S A;  2KJC A;  4LFU A;  2NVY J;  1AU7 A;  4OIP F;  2Y48 A;  2XKP A;  1PJR A;  1W4M A;  4GO1 A;  5IP9 J;  3HDD A;  3RZD J;  1MGT A;  1T39 A;  2EFW A;  1TQM A;  1HW5 A;  2Y9Y A;  3HKZ A;  3F8F A;  1B59 A;  2ID3 A;  5B66 C;  1MMG A;  3F6V A;  3RZO J;  3KP6 A;  1XDU A;  4EGZ A;  4RBO A;  2VAS A;  4U0V A;  1EJ9 A;  4A0Y A;  4Q5S F;  5HVQ C;  1JKO C;  3CO6 C;  3PNV A;  1FY7 A;  3ONQ A;  2VKD A;  3ZMU A;  2O61 A;  3MFK A;  1XB4 A;  4A5M A;  2NOJ B;  3OYA A;  4M9Z A;  3OYG A;  5FKN A;  2NXN B;  4BEH A;  2VC0 A;  1HKS A;  4ZYE A;  2PMZ A;  3C7J A;  1FP1 D;  2H6B A;  2QVO A;  1RNL A;  3HOY J;  2DPU A;  5DUK A;  3BG3 A;  1KZH A;  2IGO A;  3PIO F;  1T0F A;  5TRD A;  3HHG A;  5BPD A;  2VJ5 A;  3RKW A;  5HDK A;  2E1C A;  1H8A C;  4BQA A;  4AC0 A;  1TWG J;  1G59 A;  1K78 A;  1KA8 A;  5FLX K;  4B43 A;  1R71 A;  4XMY A;  4WK8 F;  3L2R A;  3MAJ A;  4N4O B;  1JXS A;  4HNT A;  2M8E A;  1P4W A;  3VOD A;  4CYC B;  3L2W A;  4CCJ A;  4CZZ A;  4WXD A;  4O5V A;  1R1T A;  5M3M J;  1YRN A;  1VQO I;  3LAJ A;  4BQO A;  4UXN A;  4E7H A;  1NG6 A;  4IHS A;  2Y2Z A;  1IUY A;  4HV6 A;  3CJQ B;  2CJJ A;  1BR4 A;  4A3E J;  3HIF A;  2DJN A;  4W97 A;  2PQ8 A;  2L5Q A;  3ELK A;  4V19 K;  4RB1 A;  1ZLJ A;  1BOB A;  4HV5 A;  1VQ9 I;  1SVL A;  2ISZ A;  2X6O A;  3ZMZ A;  1R5G A;  3FDY A;  1NG7 A;  2A6H F;  3MKY B;  2M7B A;  3RJP A;  2LD5 A;  4IQ4 A;  2AQE A;  4V2G A;  1RRJ A;  2DQR A;  2RNG A;  1B1B A;  1SVO A;  1QQI A;  2QQ8 A;  4ENM A;  1J09 A;  2A07 F;  3GVA A;  2O5R A;  4IOC F;  4X6A J;  5A2Q Z;  1HST A;  2XAJ A;  2O8X A;  4WXH A;  3GFL A;  4C3H J;  3S17 J;  1YS6 A;  3RQ4 A;  5C3E J;  2RV8 A;  5HLT A;  3GYH X;  1ZR2 A;  5FD5 A;  2DAO A;  2QKL B;  1EKE A;  2GWR A;  3CUQ A;  4B4C A;  1R22 A;  5IT9 Z;  1FEX A;  5B1B H;  4A3K J;  2VOO A;  4M74 A;  5CYV A;  2NS0 A;  1SD5 A;  3KZZ A;  2L2O A;  3E5X A;  3GW2 A;  4IX7 A;  2EZL A;  4R79 A;  1MSF C;  2Z2S B;  3ERE D;  2W00 A;  3RKX A;  1E3P A;  5DDG A;  1YIJ I;  3DPL C;  1OPC A;  1MBE A;  4M3E A;  5J40 A;  5DCM A;  1IDY A;  3BY6 A;  5J3L A;  3SHF A;  2VI6 A;  4PSX A;  4BU2 A;  2E1N A;  2OPT A;  2VT2 A;  3LSM A;  1FTZ A;  4RLF A;  3OWT A;  3EYI A;  1JHH A;  1OCZ H;  1PUF B;  3WGH A;  2M9H A;  3QPS A;  2AO9 A;  2ZBK A;  1I5Z A;  4OU0 A;  4ESJ A;  1V3F A;  2M8G X;  5IY5 H;  1B8I A;  2A5W A;  1X1B A;  3K70 C;  2YS9 A;  9ANT A;  2DO7 A;  3VOE A;  1HQC A;  2EZI A;  3B6C A;  1QO0 D;  3F23 A;  2FJ1 A;  2E34 A;  2A68 F;  2BY1 A;  1WJB A;  1XMX A;  5EG0 B;  1CGP A;  5F1R A;  2V1U A;  2V9K A;  3MEX A;  4RB0 A;  2GQQ A;  2HR3 A;  2DOD A;  3W6K B;  3P9C A;  1JKP C;  2YX4 A;  2M5W A;  1S3J A;  2MD5 A;  2VPL A;  4C3I J;  3BTI A;  4PGH A;  2JA8 J;  2JA7 J;  1JE8 A;  1Z91 A;  2MYS A;  1J59 A;  2A6T A;  3RSN A;  4C2T A;  5GPA A;  4AYB A;  2IGN A;  2Y9Z A;  2VQG A;  1MJB A;  2ID6 A;  3FXQ A;  3T8R A;  4LLG F;  4EJW A;  1TNT A;  3CCS I;  4XLF A;  3FIW A;  2Z16 A;  1NTC A;  2H09 A;  1WJC A;  4XON A;  1QZY A;  4CXF A;  3EYY A;  2F4O B;  4NC8 A;  5D5W B;  5ED4 A;  3RIR A;  2Z99 A;  4IPA A;  3HL2 A;  2CV1 A;  1FIA A;  4B3X A;  4PJM A;  1KQ8 A;  3LL7 A;  3HTU A;  2QF7 A;  4XQF A;  2V9P A;  2HU9 A;  4DW6 A;  1U9N A;  3O8G A;  5F0H A;  2UXX A;  5M3F J;  1LQ1 A;  3B6A A;  4ASN A;  2LP0 A;  2VBY A;  2MLG A;  3VYT B;  5FRN A;  4HBL A;  1QA6 A;  4AIJ A;  4KN4 X;  1DDN A;  2E71 A;  1I39 A;  3MKZ A;  1VQ4 I;  1ETV A;  5CQE A;  1IF1 A;  3H5N A;  1OKR A;  1W1W E;  2LNB A;  3RKY A;  3S3M A;  2X85 A;  3HM5 A;  2DU9 A;  2XPU A;  3M8F A;  4I6Z A;  3W6V A;  2R7D A;  2CW7 A;  1G2H A;  1YTY A;  1J9I A;  3NWS A;  4RDU A;  2H27 A;  1KQ0 A;  3S2W A;  5DM6 F;  2CUE A;  3HKZ N;  2E1O A;  3FM3 A;  2WA0 A;  1TL8 A;  1ZKG A;  3ZN0 A;  3NEU A;  2BOL A;  4CCK A;  5FRM A;  1T56 A;  3RPQ A;  3MKW B;  2R7S A;  4BQQ A;  3MZY A;  1XS9 A;  2IS1 A;  4LLL A;  5D6E A;  3DPT A;  3PQJ A;  1F4K A;  2DJI A;  3PO3 J;  4OIO F;  5KAI C;  1WGX A; 
#chains in the Genus database with same CATH homology
 2ETH A;  4WCG A;  3K0L A;  1R1V A;  4G7H F;  4HQM A;  3CJN A;  3R60 A;  2GA2 A;  3GO5 A;  2A5Y B;  2BYV E;  4IHT A;  1ZAR A;  3IL2 A;  4CGZ A;  1FC3 A;  1USS A;  1ON2 A;  1XGS A;  4AIH A;  4UUV A;  2XV4 S;  1BIA A;  2FNP A;  5DD8 A;  1MDM B;  3FXU A;  2IRF G;  5E8I A;  4PDK A;  4I0A A;  4BHC A;  3K1N A;  1I6X A;  5E1X A;  1FP2 A;  3TDZ C;  3K1M A;  3K2Z A;  4HDU A;  4LK1 F;  4KN7 X;  4KIB A;  1XGN A;  2PMU A;  4BH9 A;  3JSO A;  4AD9 A;  3GUD A;  1J75 A;  2ZNZ A;  2EFP A;  4B8X A;  1WSU A;  3F8M A;  1H0M A;  1FPQ A;  2K4J A;  2A6E F;  3L7W A;  2FEZ A;  2P6T A;  1MZB A;  2DT5 A;  1Z05 A;  2Y0M A;  5H6Q A;  4L5I A;  1UHW A;  4HOB A;  2HDC A;  1XCB A;  5D8K B;  5D4R A;  3G73 A;  5JHU A;  1R23 A;  2H6C A;  3V8L A;  4ESB A;  3HRT A;  3IC7 A;  4XSX F;  4H0E A;  2FMY A;  5K1Y A;  4KA4 A;  1W7P B;  2Z5U A;  5ILS A;  4I01 A;  5E17 F;  3TOB A;  4HQE A;  1D3Y A;  4GYG A;  3V7C A;  2EV0 A;  3EDP A;  4P9U A;  4TV7 A;  4BXU A;  4MTE A;  1F5T A;  4QLC U;  1RUO A;  5D5X B;  3WTT C;  5KK1 A;  3DF8 A;  5ICC A;  1RUN A;  2HGC A;  5LBQ A;  3ML6 A;  4KIC A;  2P4W A;  2VBZ A;  1R36 A;  5E20 A;  5LEK A;  1YIO A;  2QM3 A;  2QQA A;  3RYR A;  4F7Z A;  4OOI A;  1L3L A;  3IWZ A;  1UCR A;  1XMK A;  3SQN A;  4ZYD A;  4EJU A;  2FNA A;  4A2U A;  1KU9 A;  3WGG A;  3TGN A;  2EFO A;  4CYD A;  2VN2 A;  1ZG5 A;  1CF7 B;  3FHZ A;  1XSD A;  4OMY A;  3KEO A;  4KIF A;  1YG2 A;  4I09 A;  1HSJ A;  2LKP A;  1B4A A;  3ZN1 A;  1G4D A;  5BS6 A;  4JQF A;  5LHG A;  2H94 A;  2NYX A;  3ECH A;  5L3F A;  3ZMT A;  2E7X A;  5LRS A;  3QPH A;  3N4M A;  1OYY A;  4UVB A;  2QBY B;  3V7S A;  1U2W A;  4ETS A;  5BQT A;  3JAM Z;  4P55 A;  2L54 A;  2A69 F;  2IJL A;  1GXP A;  3DKW A;  3RDI A;  4A5N A;  2IW5 A;  2O03 A;  4N9I A;  4UHT A;  4L9V A;  1FBS A;  2LF7 A;  4HZF A;  2M87 A;  2L3D A;  3MZH A;  4MEY F;  3PFI A;  2HQR A;  1ZYR F;  3R0A A;  3DV8 A;  3F72 A;  4XLN F;  2XAF A;  2PBI A;  6PAX A;  1OMI A;  1ZG1 A;  1Y0U A;  5HS7 A;  3DQV C;  5DUI A;  3I54 A;  2CW0 F;  3BZ6 A;  4CHU A;  3VEP A;  5EEG A;  1MDM A;  3MWM A;  5LEJ A;  4IRH A;  4LB5 A;  4P5O A;  4EM0 B;  1BM9 A;  3CUQ C;  2HEO A;  1FYK A;  4D0P A;  3V7R A;  3ZMV A;  3EUH A;  1YQA A;  3L00 A;  3ULQ B;  2IVM A;  2L01 A;  2PMH A;  1LEA A;  1J5Y A;  5EEH A;  3R6S A;  2P7C B;  3H3U A;  4I2O A;  3BJA A;  3WTX C;  4MQV A;  2HYF A;  4WX9 A;  4RAZ A;  5CVI A;  1RI7 A;  1XGO A;  3HOS A;  2XAS A;  5CVU A;  4UVC A;  3I59 B;  4NQW A;  1IXS B;  2K02 A;  3T5X A;  1D8K A;  3HRS A;  1H9G A;  1QNT A;  2STW A;  4S04 A;  3WGI A;  3I71 A;  2UWM A;  4WWC A;  4IXA A;  2V79 A;  2OD5 A;  1FZP B;  4CO8 A;  2D2W A;  3WTS C;  3WTU C;  3V8K A;  1SD6 A;  3SZP A;  1W7P A;  3K9T A;  5K5O A;  2W25 A;  1FYM A;  4I7H A;  3TO7 A;  4EJT A;  3D5L A;  3LST A;  4JBA A;  1SFE A;  4OMZ A;  2KKO A;  3Q5F A;  2P5V A;  4DQ2 A;  3E6D A;  4LG0 A;  3T0Y A;  4ZH4 F;  4YIF A;  2PLY A;  2D1V A;  3B02 A;  1GVJ A;  1KU2 A;  5F6F A;  1BOA A;  4A6D A;  2RKH A;  3HYI A;  5LGN A;  4ENK A;  1WRJ A;  5E1W A;  3O2P E;  1YS7 A;  1IXR C;  2FA5 A;  1R5H A;  4AIK A;  1ZHF A;  3TQN A;  1ONV A;  4G9Y A;  2VXZ A;  1LJ9 A;  3LA2 A;  1CF7 A;  5HDG A;  3HUG A;  2FBI A;  3SXY A;  3VFZ A;  3LQQ A;  4UV9 A;  4U0W A;  2O0Y A;  2ESN A;  5LHI A;  1G3Y A;  2ELH A;  4YG2 F;  3TKY A;  5AIP A;  1XSX A;  2CG4 A;  2XVC A;  4KMU X;  1ZRE A;  3FXR A;  1R7J A;  3ABT A;  5LRR A;  3KZY A;  4G7Z F;  2XUB A;  2QBY A;  2A3S A;  1DPU A;  1XDS A;  3D0S A;  2FBH A;  1HKQ A;  4EJV A;  2A61 A;  1AOY A;  3ECO A;  4ON0 A;  1BC7 C;  1YO5 C;  1FLI A;  3BP8 A;  1E2X A;  4A0Z A;  1KYW A;  2HS5 A;  1YYV A;  3HHH A;  2RGV A;  1T2K A;  2ZME B;  1FT9 A;  5L3G A;  2WV0 A;  4GXO A;  3GLX A;  3GZ6 A;  3F8B A;  5D5V B;  1U78 A;  3RPU A;  4NB5 A;  3FM5 A;  3W6J B;  5HLI A;  2LF8 A;  1LB2 A;  5K5Q A;  1ZGJ A;  2VE9 A;  1R58 A;  2PJP A;  2HKO A;  5ICE A;  3FWE A;  2W85 A;  5CVV A;  1XN7 A;  3CLO A;  2GXG A;  3U1D A;  4KFC A;  1T98 A;  1KQ9 A;  1SD4 A;  2OZU A;  4HX7 A;  4HF2 A;  4G6D A;  5L3B A;  2F5E A;  3GZ5 A;  4AVP A;  1Z6T A;  5DYM A;  3KLN A;  2B0L A;  1I27 A;  4BAY A;  3C18 A;  1LDJ A;  2JT1 A;  3QPT A;  2K7L A;  3ZQ7 A;  4L5J A;  2ZCW A;  3I59 A;  1O3T A;  3WOD F;  1XD7 A;  3SFZ A;  3J81 Z;  4R1H A;  4YFN F;  3B73 A;  1FNN A;  2P5L C;  2HWV A;  2X0L A;  4WF2 A;  2GZW A;  3HRM A;  1OYW A;  5L3D A;  4CIC A;  2ZO4 A;  2PI0 A;  3COA C;  5A2Q K;  2NRA C;  1A04 A;  5D4S A;  2RNJ A;  4G8X A;  2EWN A;  2W57 A;  5IT9 K;  2FE3 A;  1FSH A;  2IP2 A;  3KP5 A;  3J80 Z;  3U2R A;  2Q8K A;  1HW1 A;  5ILV A;  4Q4Z F;  2F5F A;  3ZMD A;  2XGX A;  3DFG A;  4N0B A;  5CJ9 A;  4ESF A;  1FSE A;  1S7A A;  3F21 A;  1J0R A;  4I0B A;  2ACJ A;  3BDD A;  1ON1 A;  4EVI A;  1UFM A;  1IRG A;  1TQI A;  3FF5 A;  1TTY A;  2YPR A;  1OR7 A;  3N97 A;  3DP7 A;  4LD5 A;  4U7D A;  4M9X A;  2MLK A;  4R8H A;  2FQ3 A;  3QOP A;  4N9H A;  2XKO A;  2HOE A;  2FXA A;  2OQG A;  1FX7 A;  3K69 A;  3O6B B;  4ZYG A;  1PP7 U;  1BC8 C;  1D5V A;  5DEQ A;  3KP4 A;  1SFX A;  2OU2 A;  4UNO A;  4AWX B;  2QQ9 A;  3EET A;  2KJB A;  2DPD A;  2BV6 A;  2GXB A;  2W24 A;  3DXJ F;  3SZT A;  4KMF A;  2HTS A;  5FB2 A;  3GF2 A;  3IHU A;  1BI2 A;  2Q0O A;  2Y75 A;  1T6S A;  2HKX A;  3H92 A;  1SFU A;  1QZZ A;  1MKM A;  2ZNY A;  3LA7 A;  1REP C;  1E17 A;  4XSZ F;  1IN4 A;  3KLO A;  1YW7 A;  2Z3Y A;  3BRO A;  2DBB A;  2K4B A;  1SMY F;  3V4G A;  4LG0 B;  1S6L A;  5FFX A;  4PCQ A;  4CDG A;  2CGP A;  4FX0 A;  1TLH B;  2XAG A;  2ZME A;  3CUO A;  3LWF A;  2ZJ2 A;  2BBY A;  2E7W A;  4K2E A;  3M7G A;  2P6S A;  4IVN A;  3FZV A;  4L9J A;  3RI4 A;  3T8T A;  3IKV A;  4BNC A;  2D1H A;  3G3Z A;  4B09 A;  4ENN A;  2WWY A;  2JPC A;  2CFX A;  2C6Y A;  3RYP A;  1O3Q A;  3KEQ A;  3TOA A;  3DEU A;  4U0Y A;  1C0W A;  2WC2 A;  4A6E A;  5J8F A;  4HDV A;  1LDK B;  5CVR A;  1UST A;  3WTV C;  2PN6 A;  4EMS A;  4MEX F;  4HA8 A;  2XRN A;  3F8C A;  3BPX A;  2XAQ A;  4OIR F;  2RVC A;  1VTN C;  1YLF A;  4U88 A;  3M1E A;  2CSO A;  2XHK A;  3U9G A;  2MC3 A;  2V1D A;  3P7N A;  2IA2 A;  4EJO A;  2IT0 A;  4EGY A;  2HYG D;  4RGR A;  5DD4 A;  5HLG A;  3QU6 A;  3WE3 A;  3E3V A;  4NHJ A;  4O3M A;  2DFI A;  2EV5 A;  1O57 A;  3GFM A;  5LGU A;  1O7L A;  2GAU A;  1RIO H;  1P2F A;  2F2E A;  2CO5 A;  2O6G E;  1U5T B;  1FBU A;  3CTA A;  4EM2 A;  2OBP A;  5AIQ A;  3I4P A;  2LDU A;  3IRQ A;  5FLX Z;  2IPQ X;  2AS5 F;  3TO6 A;  5IT3 A;  3IKT A;  1NHA A;  2DQL A;  2GA1 A;  2VOP A;  2FU4 A;  1LVA A;  3RTR A;  2EFN A;  4P96 A;  1L0O C;  5E1Z B;  1T38 A;  3FMQ A;  1ULY A;  3KP3 A;  2QUF A;  1J7K A;  2MBF A;  1WKM A;  4U7B A;  3LA3 A;  1PDN C;  3CO7 C;  4HF0 A;  4IRI A;  4O6J A;  5ICF A;  2EB7 A;  3FX3 A;  1IW7 F;  5AON A;  5BPI A;  3T1B A;  1U6G A;  2L4A A;  1P4X A;  3L2C A;  2W84 A;  2RN7 A;  3HSF A;  1LNW A;  1P6R A;  3E6B A;  4GGG A;  1HKT A;  1ODD A;  1HW2 A;  2OZ6 A;  2VOD A;  1S29 A;  1U5T C;  2FRH A;  3P9K A;  4ZYH A;  1BBY A;  2KIU A;  4JK1 X;  2QQB A;  1JHF A;  4RGU A;  3FMS A;  1BI1 A;  3KP2 A;  4EM1 A;  2VE8 A;  3JAM K;  3AAF A;  2EFQ A;  4XBF A;  3VB2 A;  1PP8 F;  4MQ9 F;  3WE2 A;  4M71 A;  4DNC A;  3GX4 X;  2O3F A;  1F1Z A;  2DLL A;  1TBX A;  4G94 A;  4M6X A;  1FBQ A;  3OOP A;  2F5C A;  4M9S A;  1IN8 A;  4Z2Y A;  1UHM A;  2WTE A;  3WTZ A;  5JR3 A;  2VON A;  3F22 A;  2NAZ A;  5HOO A;  2PEX A;  2OA4 A;  1YW9 A;  2EJR A;  1EH8 A;  2DW4 A;  2R7F A;  4FX4 A;  2EA2 A;  3OV8 A;  1HBX G;  3EQL F;  3QAH A;  2JZY A;  4GYI A;  2RC4 A;  4KIG A;  3E6C C;  3QP5 A;  4WXC A;  3FMR A;  1P92 A;  5D6F A;  1KU7 A;  1K79 A;  2IA0 A;  4ENJ A;  3L09 A;  2HFH A;  1PUE E;  1RZ4 A;  1OYI A;  3ABU A;  3V8J A;  4BHB A;  1KGS A;  1D8J A;  4HX4 A;  1ZLK A;  5ILU A;  1BIB A;  1XCV A;  4M72 A;  3I64 A;  2XRO A;  2UZK A;  2YX7 A;  2X4H A;  2CWE A;  1UB9 A;  2R3S A;  1P4A A;  1DUX C;  1LEB A;  5HLH A;  3BPV A;  1ZH5 A;  2ZXJ A;  5HS8 A;  3WU0 A;  4RB3 C;  4MTD A;  1TW3 A;  1W7P D;  1SAX A;  1U5T A;  2OAZ A;  3M8E A;  4GCV A;  2QYO A;  2ZFW A;  5J8C A;  1IXC A;  3KP7 A;  2BE5 F;  2HTJ A;  4OIQ F;  3PQK A;  5K5R A;  1YW8 A;  2PG4 A;  4HYE A;  3IRR A;  1MJ9 A;  2KRF A;  3QP6 A;  3WU1 B;  2VC1 A;  3HSR A;  3LFK A;  4EV0 A;  4HF1 A;  1FWZ A;  1K6O A;  1ZRF A;  1H9T A;  3LQR A;  1WWX A;  2M45 A;  5D5U B;  4HX8 A;  1IZ1 A;  3I5U A;  1IRF A;  1KU3 A;  4PGG A;  2D45 A;  3E5U A;  3BOQ A;  4RS8 A;  1V4R A;  1R00 A;  1BJA A;  1DPR A;  1QPM A;  1W5T A;  2M30 A;  1Q1H A;  4L9T A;  2YU3 A;  2ESH A;  5DCF A;  2IA1 A;  1LDD A;  2CYY A;  4RAY A;  1G3T A;  2G9W A;  2QEN A;  1K7A A;  1O3R A;  1Z7U A;  2ISY A;  5D8L B;  2STT A;  5LHH A;  1U3E M;  3TDU C;  2ADU A;  1TQP A;  2OQR A;  2P8T A;  2KIF A;  3JTG A;  1MD0 A;  2AXL A;  1XMA A;  2K86 A;  1FYL A;  1QGP A;  5JI6 A;  3JSP A;  4UV8 A;  3H3Z A;  1BI0 A;  2PFB A;  4MHG A;  3GFJ A;  1MJA A;  4L9N A;  5FO5 A;  1G6N A;  1IN6 A;  2DK8 A;  3CDH A;  4BHP A;  1JGS A;  5HS9 A;  3BWG A;  1WQ2 A;  3GEZ A;  5H6R A;  3QRF F;  2L02 A;  1HXD A;  5HDN A;  1ZN2 A;  4Y17 A;  3E6M A;  2VT3 A;  2G7U A;  3JW4 A;  1I1G A;  1GHC A;  2QLZ A;  5FGM A;  3WTY C;  4HLY A;  1ZG3 A;  2P7V B;  2LSO A;  4EQQ A;  2FOK A;  4Y13 A;  3GWZ A;  3C1D A;  1Z9C A;  2L4M A;  1U8R A;  2QZ8 A;  5BOX A;  5H20 A;  1S7O A;  4FT8 A;  4XLP F;  3KE2 A;  2XAH A;  5JVT A;  4MGR A;  2EK5 A;  2M1B A;  2NNY A;  2NNN A;  1WI9 A;  2VBW A;  1XSV A;  1BN5 A;  2MH2 A;  3F6O A;  1G3W A;  1TW2 A;  4LLN A;  2HZT A;  4L0Y B;  4LJZ F;  3HOT A;  4KYW A;  5KVR A;  2J5P A;  4FHT A;  5LGT A;  3E5Q A;  3QU3 A;  4QWQ A;  1EV7 A;  3WG9 A;  3J81 K;  1F9N A;  3K1P A;  4RGX A;  2MH9 A;  5FD6 A;  4I02 A;  1G3S A;  3ZPL A;  3ROU A;  4L0Z B;  1IN5 A;  2ZKZ A;  3J7A O;  2F5D A;  4E70 A;  4G6Q A;  3R61 A;  2BEO A;  5BMZ A;  1O7F A;  2TDX A;  3KET A;  4LK0 F;  4ZZL A;  2JTV A;  3J80 K;  5LLQ A;  4A0X A;  4YFK F;  2XIG A;  1AWC A;  2JRT A;  2P5K A;  1IAW A;  2G7H A;  2CQK A;  1K78 B;  4Q48 A;  1B9M A;  3E97 A;  1YFH A;  3GXO A;  4M6Y A;  2DTR A;  3R0J A;  4HW0 A;  1STZ A;  1GXQ A;  2JSC A;  3L9F A;  2J5O A;  3HSE A;  3KCC A;  2MA3 A;  5J6X A;  1TNS A;  3IWF A;  3HRU A;  3MCZ A;  5ICG A;  4IF4 A;  1SMT A;  1ZRD A;  3ISP A;  1BI3 A;  3TO9 A;  2YSR A;  4KUM A;  2Z9O A;  1ZGA A;  2COM A;  4IRG A;  3P9I A;  3WTW C;  3JTH A;  4HLX A;  2FBK A;  4ZZD A;  2JPB A;  4MNU A;  5F64 A;  2HQN A;  3CUQ B;  2DI3 A;  4UVA A;  1Z1D A;  2KIM A;  2UXN A;  2RDP A;  5ERI A;  4P9F A;  3REO A;  4IJA A;  4LGW A;  1QBJ A;  5DCM B;  1B6A A;  3HTS B;  3KFW X;  2VBX A;  4KDP A;  5DV5 A;  5CVJ A;  1J2X A;  2V6C A;  5L3E A;  3F3X A;  2K27 A;  3O3K A;  2Q2E A;  5JFR A;  4LB6 B;  1KYZ A;  5FFZ A;  1Z6R A;  2V1X A;  2FF4 A;  2EV6 A;  5TJJ A;  2YR2 A;  2V9V A;  3Q9V A;  1IN7 A;  3ZMS A;  3R4K A;  2RQP A;  4I98 B;  3I58 A;  4HAM A;  1B9N A;  1ZAO A;  3I53 A;  1EH6 A;  1W5S A;  4S05 A;  4LMY A;  1R1U A;  4KT5 C;  2Z33 A;  2EA4 A;  4Q47 A;  1O3S A;  2DK5 A;  1ZRC A;  1EH7 A;  5E8G A;  4YII A;  2FML A;  1XGM A;  2FSW A;  3MQ0 A;  3NRV A;  4RB2 C;  3GFI A;  4KNY A;  4L18 B;  3M9A A;  4A12 A;  5CLS A;  4M73 A;  1X3U A;  4XRF A;  3F8N A;  4Y15 A;  3BJ6 A;  5L3C A;  4PZJ A;  1FOK A;  4RGS A;  4OIN F;  2GIV A;  3C3W A;  3I0T A;  3ZP5 A;  1I1S A;  3NQO A;  4G7O F;  1SD7 A;  1S8N A;  1DP7 P;  2BGC A;  4YFX F;  5E18 F;  3LAP A;  3BJO A;  2QWW A;  4BYY A;  3Q9S A;  2KJC A;  4LFU A;  4OIP F;  2Y48 A;  2XKP A;  1W4M A;  4GO1 A;  1MGT A;  1T39 A;  2EFW A;  1TQM A;  1HW5 A;  3F8F A;  1B59 A;  3F6V A;  3KP6 A;  1XDU A;  4EGZ A;  4U0V A;  4A0Y A;  4Q5S F;  5HVQ C;  3CO6 C;  1FY7 A;  3ZMU A;  2O61 A;  3MFK A;  1XB4 A;  4A5M A;  4M9Z A;  2VC0 A;  1HKS A;  4ZYE A;  3C7J A;  1FP1 D;  2H6B A;  2QVO A;  1RNL A;  2DPU A;  5DUK A;  1T0F A;  5TRD A;  3HHG A;  5BPD A;  3RKW A;  5HDK A;  2E1C A;  4BQA A;  1K78 A;  1KA8 A;  5FLX K;  4WK8 F;  3MAJ A;  1JXS A;  2M8E A;  1P4W A;  3VOD A;  4CZZ A;  4WXD A;  4O5V A;  1R1T A;  3LAJ A;  4UXN A;  4IHS A;  1IUY A;  4HV6 A;  3HIF A;  2PQ8 A;  3ELK A;  4RB1 A;  1ZLJ A;  4HV5 A;  2ISZ A;  3ZMZ A;  1R5G A;  2A6H F;  3RJP A;  2DQR A;  1B1B A;  1QQI A;  4ENM A;  2A07 F;  3GVA A;  5A2Q Z;  1HST A;  2XAJ A;  2O8X A;  4WXH A;  3GFL A;  1YS6 A;  2RV8 A;  3GYH X;  5FD5 A;  2DAO A;  2GWR A;  3CUQ A;  1R22 A;  5IT9 Z;  2VOO A;  4M74 A;  5CYV A;  2NS0 A;  1SD5 A;  3KZZ A;  3E5X A;  3GW2 A;  4R79 A;  3ERE D;  3RKX A;  5DDG A;  3DPL C;  1OPC A;  5DCM A;  3BY6 A;  3SHF A;  2E1N A;  2VT2 A;  3EYI A;  1JHH A;  3WGH A;  2ZBK A;  1I5Z A;  4OU0 A;  4ESJ A;  1V3F A;  2DO7 A;  3VOE A;  1HQC A;  1QO0 D;  3F23 A;  2A68 F;  1CGP A;  5F1R A;  2V1U A;  3MEX A;  4RB0 A;  2GQQ A;  2HR3 A;  3W6K B;  3P9C A;  2YX4 A;  2M5W A;  1S3J A;  2MD5 A;  4PGH A;  1JE8 A;  1Z91 A;  1J59 A;  1MJB A;  3FXQ A;  3T8R A;  4LLG F;  4EJW A;  1TNT A;  2H09 A;  1QZY A;  4CXF A;  3EYY A;  5D5W B;  5ED4 A;  3RIR A;  2Z99 A;  4IPA A;  1KQ8 A;  3HTU A;  2UXX A;  1LQ1 A;  4ASN A;  2VBY A;  2MLG A;  4HBL A;  4AIJ A;  4KN4 X;  1DDN A;  1IF1 A;  1OKR A;  2LNB A;  3RKY A;  2DU9 A;  3M8F A;  2R7D A;  1YTY A;  1J9I A;  2H27 A;  1KQ0 A;  3S2W A;  3FM3 A;  3ZN0 A;  3NEU A;  3RPQ A;  3MZY A;  4LLL A;  5D6E A;  3DPT A;  3PQJ A;  1F4K A;  4OIO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...