2EV5A

Bacillus subtilis manganese transport regulator (mntr) bound to calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
136
structure length
132
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 54
structure length 132
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev5A02
2OAZA 2PN6A 3FF5A 1KU2A 1TLHB 2A3SA 3I54A 1PP8F 4CGZA 1DP7P 1SMYF 2NS0A 4YFNF 3TO6A 2XAQA 1FYKA 5DUIA 4I0BA 4OINF 3QRFF 3H3UA 4LLLA 3WTWC 4AIHA 3FWEA 2FNAA 1S6LA 3RIRA 3K2ZA 4RS8A 4G7OF 2H94A 1F4KA 3PQKA 3IKTA 4EM2A 3IWFA 2K4JA 2P5KA 1HKQA 5ICGA 1UCRA 1B59A 4JQFA 5LHHA 3OOPA 2IRFG 2DBBA 3ECOA 2KIFA 2UWMA 3GO5A 1ZN2A 1F1ZA 2FSWA 2XAHA 2HYFA 1F9NA 4IVNA 4EJOA 4EGZA 3FXRA 3GF2A 3HSRA 4MQVA 2ZCWA 3TOBA 1P4XA 2YPRA 5FD5A 3DPLC 1R58A 2MH2A 4FX0A 3Q9SA 4UVAA 2O6GE 4LLGF 3T5XA 3WE3A 2P7VB 5BMZA 1ZRDA 2M45A 2VBXA 4KIFA 4EJVA 4O6JA 5FFZA 4ETSA 1JGSA 1I27A 2ISYA 1QNTA 5LGTA 2XAFA 5E8IA 2GA1A 4HF2A 1Z6TA 3IC7A 3V7SA 2ACJA 3FM5A 4G7HF 4L0YB 3IHUA 3COAC 2VT2A 4CDGA 3HTSB 1JHHA 2Z3YA 3REOA 3GFIA 2F5CA 1S7OA 4G94A 4KMUX 2FBIA 2EA4A 2PG4A 3LSTA 5E1WA 4PZJA 1W5TA 5D6EA 3E6CC 4ZZDA 1IRGA 4S05A 3IRRA 1HW5A 4EQQA 4BXUA 1JXSA 5K5RA 3VFZA 5FD6A 2PMHA 3EDPA 3CO6C 2DO7A 1DPUA 1WWXA 4WXCA 3GVAA 4O5VA 4RGUA 4KNYA 4A6DA 2IA2A 4XSZF 4G6DA 4L9JA 2HDCA 4IRIA 1XCBA 2RDPA 3I53A 4N9IA 4Z2YA 2HGCA 3P7NA 1O7LA 4YFXF 3H3ZA 5CLSA 5E8GA 1U2WA 1S3JA 3NEUA 2F5DA 5L3FA 1FLIA 2O3FA 3B73A 1U5TB 1SD4A 1EV7A 2FRHA 3R0JA 3CJNA 4KUMA 2VE9A 1MDMB 2QZ8A 1V3FA 5L3BA 2LKPA 1KQ9A 1TW3A 4RAYA 3KFWX 2V1XA 2OU2A 1QBJA 3ISPA 5TJJA 1BI1A 3DPTA 5DCFA 1R23A 2JPBA 2XROA 5L3GA 2ZJ2A 2YX7A 2OZUA 3RYRA 4G8XA 5FGMA 1XB4A 3EQLF 4BHBA 3HSFA 1KU9A 2F5FA 2FF4A 2H09A 3RDIA 3I5UA 4IRHA 2DFIA 1XD7A 3N4MA 2G7HA 4A0XA 2B0LA 4HAMA 2WV0A 1R36A 4A2UA 4LK1F 1CF7B 2CYYA 1OPCA 4MGRA 5LHGA 1TBXA 4M6XA 2JZYA 3FZVA 4YIFA 5D5WB 4G9YA 3RI4A 5IT9Z 1E2XA 4CHUA 3E97A 3KP3A 2KJBA 2FBKA 1S29A 5BS6A 2DK8A 5E20A 1C0WA 5DCMB 5LEKA 4L5IA 4UHTA 1L3LA 2PFBA 3HHGA 5E18F 1BJAA 3F8CA 1F5TA 2EWNA 2XKOA 3HOTA 4U7BA 1R5HA 1FC3A 4CO8A 3QU3A 2ZFWA 1LEBA 2FA5A 2HZTA 3LA2A 2F2EA 5CVUA 4Y17A 1VTNC 2EFWA 4M72A 2XHKA 4PGGA 3P9CA 2FMLA 4O3MA 5DYMA 2CW0F 2K27A 2BV6A 4FX4A 2A69F 4ZH4F 1I1GA 2BEOA 5HLGA 4QLCU 4K2EA 1IXSB 4MQ9F 2XVCA 3RKWA 1HSJA 3TDUC 2A6EF 1KU7A 5CVJA 2GXBA 4XLPF 2V6CA 3CUQB 1TQPA 1IAWA 2ZMEB 2A5YB 3LQQA 3HUGA 4WWCA 1YW8A 4EGYA 4E70A 4EVIA 2XIGA 1BIAA 1STZA 3KP2A 1FY7A 1BIBA 4XBFA 3EYYA 1LDKB 4JK1X 2IVMA 2GZWA 4LJZF 3BROA 2GAUA 3KZZA 1B9NA 5F1RA 3LAJA 1OYIA 3GUDA 2BYVE 3TO7A 1ON1A 1RNLA 3BY6A 1GXPA 5LLQA 5D5VB 1LEAA 3GFJA 4IXAA 3M9AA 3O3KA 5LRSA 1G3TA 4HA8A 1J59A 5J8CA 4A6EA 1XMAA 3MQ0A 2QQ9A 2CFXA 2AS5F 3ML6A 4ESFA 2PJPA 3V7CA 2XV4S 3I71A 4BAYA 3J7AO 2DTRA 1IRFA 1TNSA 4BH9A 1OMIA 3E5XA 3K1NA 2QQBA 2NAZA 1USTA 4HDUA 3RKYA 3WGGA 1RIOH 1BC8C 3EUHA 3WU1B 4UV9A 2VE8A 4I2OA 2L54A 5ED4A 3T8RA 3MEXA 5E1ZB 5D4SA 2J5PA 3BJOA 3RKXA 1HKSA 1QGPA 5HDNA 4LB5A 2P6SA 1QZYA 5L3EA 3ABTA 4MNUA 1GVJA 2Y48A 1K7AA 3WTVC 1YW9A 5J6XA 3H92A 4P5OA 3GXOA 4UVCA 1FP1D 3TOAA 3IWZA 1P4AA 2K7LA 1IXRC 2QM3A 1CF7A 3LFKA 1FBQA 1XDSA 1Z91A 4MTEA 1ZG3A 3NRVA 2VOPA 4ON0A 3CLOA 2GXGA 1OYYA 2PLYA 2L3DA 2NNNA 4Y13A 4KN7X 1H0MA 2Y75A 3JAMK 1J5YA 3CTAA 5KK1A 3FM3A 2IW5A 2HEOA 1IN5A 3KZYA 2EFPA 3DEUA 2KIMA 5ILSA 1ONVA 1FPQA 3DKWA 3ZP5A 3J81K 1IZ1A 3U9GA 1IF1A 2HKXA 1PUEE 2E7XA 4OU0A 5LBQA 1HKTA 4LMYA 2V1UA 4M9ZA 2DQRA 4GYGA 2IT0A 3QPHA 4I98B 1O3TA 2GQQA 1YS7A 2E1CA 3P9IA 1MKMA 2K4BA 5HLIA 4I01A 3F23A 4B09A 4EMSA 2QENA 3LA3A 4KMFA 3WTZA 2EV5A 5F64A 2HYGD 3BPVA 4JBAA 3ZMSA 4KICA 3MAJA 3F8FA 1UHWA 5HS9A 5FB2A 4NB5A 1KYZA 3WE2A 1KQ8A 2DQLA 5LRRA 2YR2A 3JAMZ 5LGUA 1T6SA 4B8XA 2W25A 3FXQA 3HTUA 3ZMUA 3RJPA 4LG0B 2WC2A 2KJCA 5F6FA 1SD5A 3T8TA 4CYDA 4AWXB 3J80K 2XRNA 1K78B 4HQEA 3MFKA 3NQOA 3LAPA 5DUKA 2COMA 1ZRCA 3Q9VA 2RVCA 4UXNA 4HZFA 1LNWA 3WGHA 1RUNA 1OYWA 2L4MA 4M9SA 3BJ6A 4LB6B 1YLFA 1A04A 2D2WA 2FU4A 2DT5A 2V79A 1LJ9A 5BPDA 5D5XB 4AIJA 3N97A 1H9GA 5E1XA 1YYVA 2Q8KA 2RN7A 1YFHA 2E1NA 2RKHA 4M9XA 1R1TA 5JHUA 3KEQA 2MBFA 4KFCA 2W24A 3SHFA 2YU3A 3U1DA 3V8JA 2DLLA 4WCGA 5D8LB 1T2KA 3WU0A 2O0YA 1R00A 4EM1A 2XAGA 2LDUA 4CICA 2OBPA 4P55A 3L7WA 5ICCA 1D3YA 2KRFA 4M74A 2HR3A 4M71A 1UB9A 4L18B 4A12A 1YTYA 1HBXG 5D5UB 3R60A 5FLXK 2JRTA 5CYVA 2EV0A 3S2WA 1MJAA 1IN7A 1G3YA 1REPC 4HF1A 3DQVC 1DUXC 3BDDA 3GW2A 4U0YA 1JHFA 5LEJA 3L9FA 1Z05A 1ZREA 4TV7A 2QYOA 4UUVA 3G73A 3ABUA 1G3WA 3RPUA 3TGNA 3BWGA 1EH7A 2ZKZA 1FT9A 3WTTC 4GGGA 5HDGA 1T39A 2Z5UA 3BP8A 3BJAA 2VXZA 4RGRA 1RUOA 3KCCA 4RB2C 4MTDA 3I59B 1WKMA 3M1EA 2P7CB 5HS8A 1R7JA 5AIPA 1HSTA 2WWYA 3VB2A 5DEQA 2R3SA 3DF8A 1FX7A 4MEYF 2YSRA 3O2PE 1J7KA 3ZMDA 4R8HA 3T1BA 4LLNA 3ZMVA 1HW1A 1GHCA 1BBYA 1G3SA 5CVIA 2LNBA 4Y15A 1W7PB 2ESHA 1WSUA 2KIUA 1L0OC 2W85A 1RI7A 3GZ6A 4ASNA 6PAXA 5HLHA 1BI3A 4L9NA 2L02A 2H6CA 2ELHA 3HRMA 5DDGA 1BM9A 1J0RA 4N9HA 1TTYA 1ODDA 2TDXA 1O3SA 3R6SA 1R22A 4LK0F 3ZPLA 1WQ2A 2V9VA 1DDNA 2JT1A 3M8EA 3KLOA 3R0AA 1XSVA 3HSEA 1J9IA 4GCVA 1P92A 1SD6A 3ZQ7A 3O6BB 3SXYA 3FMRA 3R61A 1FWZA 3ZMZA 3L2CA 1Z1DA 2FOKA 1XSXA 2ZNZA 2QBYB 3ZMTA 1D5VA 4IHSA 4OMYA 2OQRA 3GEZA 3SFZA 3FXUA 3QP5A 4A5NA 5DD4A 1MGTA 2XKPA 4HX4A 3K69A 2QWWA 4KIBA 2KKOA 4M73A 5FFXA 1HXDA 2JTVA 3W6KB 2X0LA 3WTYC 5LGNA 2FXAA 4Q4ZF 3LA7A 2D1VA 3WG9A 2PEXA 3ECHA 4KDPA 4RB1A 1ZLKA 2H6BA 3LWFA 2WTEA 1QPMA 4HW0A 1ZRFA 4EV0A 3J81Z 4HV5A 3EYIA 2Y0MA 3CUQA 2RNJA 3AAFA 2Z9OA 5HDKA 4ENJA 1E17A 1UFMA 3I58A 2MD5A 4GXOA 5JR3A 1SD7A 1O3QA 1KYWA 1IN8A 2O03A 3RTRA 2VBZA 1W4MA 2HQRA 3BZ6A 1ZG1A 3CDHA 3E5QA 1FBSA 2EFNA 3HOSA 4YG2F 4WK8F 4HBLA 1ZYRF 2UZKA 2M5WA 2FE3A 1BC7C 1U5TA 1R1UA 3GFMA 2LF8A 3KE2A 2EV6A 2MH9A 4ENKA 1FP2A 3KEOA 5A2QZ 4Q48A 3W6JB 3MCZA 5ICEA 2VC1A 5CJ9A 4MHGA 2VODA 2RQPA 1FYMA 5ILUA 1R5GA 1JE8A 2HKOA 4WXHA 2R7FA 3B02A 4P96A 4DQ2A 2FQ3A 5JI6A 3HRUA 2IP2A 1TW2A 5D4RA 2CG4A 2MC3A 1MJBA 1YS6A 5FLXZ 3E3VA 4S04A 2QQAA 3QU6A 2QUFA 3CUOA 4FT8A 2M30A 3V8KA 2QBYA 2D45A 3F3XA 5ILVA 1BN5A 2IJLA 1O3RA 4ZYDA 1OR7A 4L9VA 2XGXA 4QWQA 2MA3A 4OOIA 2JPCA 2GWRA 4ESBA 2HWVA 4EJTA 4HLYA 2C6YA 2P5VA 3TDZC 5AIQA 2EJRA 1HQCA 2HS5A 1YW7A 4RGSA 1XGSA 3JW4A 3ZN0A 3GZ5A 1R1VA 1FBUA 2E7WA 1B4AA 2UXXA 2ZO4A 3JTHA 4WX9A 2ESNA 4FHTA 1EH6A 1FYLA 5EEGA 5FO5A 1XGMA 1ZGJA 1SFUA 4CZZA 1T98A 2RV8A 5K5QA 1P6RA 5HVQC 2GA2A 4D0PA 3F8NA 3GWZA 3L00A 2DW4A 2ZNYA 1XDUA 2FEZA 1ON2A 3ERED 3BPXA 4HV6A 4IF4A 5CVVA 4ENNA 3JSPA 3DXJF 1D8JA 1LDJA 4NQWA 4HF0A 1SFEA 2PI0A 1DPRA 3HHHA 1AOYA 3F72A 2PMUA 1YQAA 1MDMA 5HS7A 1Z6RA 2BE5F 3FX3A 1S7AA 3I64A 2DU9A 1ZLJA 4G6QA 3F22A 5IT9K 3M8FA 3MWMA 5BQTA 4U88A 1UHMA 3WTXC 2A6HF 2VT3A 4IPAA 1PP7U 3WODF 2K86A 5D8KB 3E6MA 1IUYA 5ICFA 4RAZA 4LG0A 2Q0OA 4LGWA 4L0ZB 4KA4A 2CQKA 5H6QA 1J2XA 1ULYA 4WF2A 1G4DA 2F5EA 1ZGAA 2A68F 2XAJA 4OIQF 1LDDA 1MD0A 2A07F 4KT5C 2ZBKA 2OA4A 3I4PA 1T38A 2IA1A 4BNCA 2HTJA 3BOQA 4ZZLA 3WGIA 2ETHA 2Q2EA 5DCMA 2BBYA 3G3ZA 5DV5A 1GXQA 2O8XA 3QOPA 4A5MA 3HIFA 2H27A 4U0WA 1P2FA 2OZ6A 1IN6A 3PFIA 4PGHA 3FMSA 4ZYEA 3F21A 3VOEA 3TQNA 1V4RA 3RYPA 3C1DA 1LVAA 4A0ZA 1T0FA 2VC0A 4AD9A 3WTUC 1YO5C 1KA8A 4GO1A 3F6VA 2EFOA 4MEXF 2W84A 3DP7A 3SQNA 1U6GA 1ZARA 1YG2A 3GX4X 2HOEA 2GIVA 4ZYHA 5ERIA 2QVOA 2P5LC 5H20A 2HTSA 3C3WA 4HX7A 1KGSA 4AVPA 2RC4A 5BPIA 2ZXJA 5H6RA 3VODA 3Q5FA 1FOKA 4HOBA 1ZHFA 3WTSC 4Q5SF 3E6BA 2M8EA 4KN4X 1D8KA 4NHJA 4L9TA 5LHIA 2VBWA 4ENMA 3KP7A 3MZHA 1OKRA 1XMKA 1BI2A 4RGXA 4XRFA 2XASA 3SZPA 2MLKA 4YIIA 3K1PA 2RGVA 1FNNA 4YFKF 1WRJA 4I09A 2A61A 2CO5A 5IT3A 3E6DA 1AWCA 2EFQA 4A0YA 2K02A 4P9FA 5KVRA 5EEHA 3TO9A 2M87A 4N0BA 1W7PA 1K78A 3F8MA 4L5JA 3K0LA 4EJWA 2OD5A 4HQMA 2STTA 2M1BA 4RB3C 3IRQA 3M7GA 2XUBA 2UXNA 4KYWA 4HLXA 1TNTA 5AONA 5HOOA 1WI9A 4UNOA 3LQRA 1Z7UA 4OIPF 2STWA 5K5OA 2NRAC 3P9KA 1BI0A 2OQGA 4R79A 3D0SA 2VN2A 1X3UA 1YIOA 2NNYA 3T0YA 2R7DA 2DI3A 3K1MA 4ZYGA 3GYHX 1W5SA 1NHAA 1K6OA 1XSDA 2L01A 3ELKA 1Y0UA 2P4WA 2FBHA 4I0AA 4P9UA 3QP6A 2P8TA 3KP5A 4I02A 4U7DA 4WXDA 1KU3A 2YX4A 2VONA 3TKYA 1LB2A 4PDKA 4EM0B 1MZBA 4PCQA 4KIGA 2ISZA 4IJAA 3U2RA 3D5LA 1B9MA 5A2QK 1EH8A 1QQIA 2MLGA 3F6OA 3ULQB 1I6XA 3K9TA 5CVRA 4EJUA 3VEPA 4IHTA 1XN7A 3KLNA 2J5OA 2CWEA 2HFHA 3GLXA 3V4GA 1USSA 2G7UA 1U3EM 4I7HA 3IKVA 3IL2A 2PQ8A 2DPUA 4UVBA 5E17F 3EETA 3JTGA 2ZMEA 1SFXA 5BOXA 3GFLA 2V1DA 3F8BA 3L09A 3V8LA 4BQAA 2DK5A 4HYEA 1FZPB 1BOAA 4BHCA 2CGPA 3DV8A 1J75A 2VOOA 3PQJA 1LQ1A 3KP6A 4F7ZA 1FSEA 3OV8A 5DD8A 4H0EA 1U5TC 1U78A 4U0VA 4M6YA 4DNCA 1RZ4A 2G9WA 1PDNC 2Z33A 3FHZA 1CGPA 3HYIA 4UV8A 2FNPA 1ZH5A 4AIKA 3E5UA 2LF7A 2BGCA 1ZAOA 1B1BA 1XGOA 1U8RA 1H9TA 3I59A 1XGNA 3C7JA 4OMZA 2HQNA 3HRSA 4OIRF 2CSOA 2L4AA 5J8FA 1ZG5A 4G7ZF 2NYXA 5JFRA 4XLNF 4GYIA 3QAHA 1IXCA 3MZYA 2JSCA 3KETA 1XCVA 5D6FA 2Z99A 1Z9CA 2PBIA 1TQIA 1QZZA 4HX8A 2P6TA 3V7RA 1SMTA 2DPDA 4LD5A 4IRGA 4HDVA 3HRTA 2O61A 5K1YA 1QO0D 2W57A 4R1HA 3ZN1A 1I1SA 2IA0A 2EB7A 1I5ZA 4XSXF 1TQMA 2VBYA 4Q47A 3ROUA 4RB0A 4ESJA 2FMYA 3QPTA 1O7FA 1IN4A 5TRDA 3CO7C 2LSOA 3C18A 2D1HA 1Q1HA 1W7PD 3FMQA 2QLZA 4CXFA 4OIOF 1FSHA 3RPQA 1SAXA 2EK5A 2X4HA 3JSOA 1S8NA 5L3DA 4LFUA 1MJ9A 3DFGA 1P4WA 3KP4A 5L3CA 3J80Z 1K79A 1IW7F 3I0TA 5JVTA 1G6NA 2DAOA 4BHPA 1O57A 4BYYA 1KQ0A 3SZTA 2IPQX 1B6AA 2ADUA 2AXLA 2EA2A 1HW2A 3R4KA 3CUQC
chains in the Genus database with same CATH superfamily
1G2HA 1Z3XA 2HOSA 4GFBA 2OAZA 3GTPJ 2PN6A 1WHUA 2XC7A 4LIVA 3FF5A 1KU2A 1Z21A 3IUOA 3H0DA 1VQ8I 1TLHB 4C30A 1B8IB 3QPLA 5M3MJ 3OYBA 2A3SA 3I54A 2LY9A 1PP8F 4CGZA 1DP7P 3OYMA 1SMYF 2NS0A 2PMZA 4B44A 4YFNF 5J1YA 2MZ4A 3TO6A 4HSRA 2XF6A 3CMMA 2EZLA 3UR3C 2XAQA 3G1OA 2R7UA 1FYKA 5DUIA 4I0BA 1JKQC 4OINF 2TCTA 3QRFF 5TISC 3H3UA 4LLLA 4XLEA 3WTWC 2E2HJ 4AIHA 3FWEA 2FNAA 3Q3SA 4BDYA 3C2HA 1S6LA 2Y31A 2H1KA 3RIRA 4F55A 3K2ZA 3WHBA 3K2AA 2V26A 4RS8A 4CCOA 4G7OF 2H94A 1F4KA 1Z7LA 1OCPA 3W2AA 4YEJA 3BG9A 4J00A 3MKZA 3PQKA 4IHVA 3IKTA 4EM2A 3IWFA 2V4JC 1ETWA 2K4JA 4G12A 2P5KA 1HKQA 4XKCA 1ZGWA 5ICGA 1UCRA 1UG0A 1B59A 1POGA 4JQFA 5LHHA 3OOPA 4ZDPA 3WHCA 2IRFG 2DBBA 3ECOA 2KIFA 2UWMA 3GO5A 2BY0A 1ZN2A 4GDFA 1FTZA 2VQHA 1F1ZA 2FSWA 2XAHA 3JRBA 4PFPA 3K4KA 4F92B 2HYFA 1TT5B 4B43A 1F9NA 2IS6A 4IVNA 4EJOA 3S1RJ 4EGZA 3FXRA 4IX7A 3SEQA 3GF2A 3S3MA 3HSRA 1D0ZA 4MQVA 2ZCWA 3JCUC 4PJMA 3AL0C 2JA5J 2Y69H 3C2BA 3TOBA 1P4XA 3W2VA 2YPRA 2DOFA 3A01B 5FD5A 2EPFA 2O9LA 3DPLC 2DA3A 3OIOA 1R58A 3OS1A 3KX2A 2YU9J 2MH2A 4FX0A 3K4CA 3Q9SA 4UVAA 4CH7A 5M5XJ 4LLGF 4FASD 4B48A 2O6GE 3T5XA 3WE3A 2BY3A 2P7VB 5KAFC 1WFXA 2OV7A 1LKXA 5BMZA 1ZRDA 3FDYA 4IQJA 2Y0SN 2M45A 2O5RA 2VBXA 4KIFA 4EJVA 3C2GA 1QVTA 2MG4A 4O6JA 1Z67A 3CCQI 2I10A 5FFZA 1JT0A 4G6TB 1YJNI 4ETSA 1JGSA 1I27A 2ISYA 1QNTA 5LGTA 2XAFA 2LBFB 5E8IA 3O8GA 4BL0B 2GA1A 5EGOA 3CCVI 4HF2A 1Z6TA 3IC7A 3V7SA 3CCLI 2ACJA 1MH3A 3LL7A 4C2UA 4PJJA 3FM5A 1AKHB 1NK2P 4G7HF 4L0YB 3IHUA 3COAC 2VT2A 2VQLA 1HOMA 4CDGA 2MC4A 2F5VA 3K4MA 3HTSB 1F43A 1JHHA 1VQ5I 2Z3YA 3REOA 1R5ID 1LFPA 3GFIA 2L9SA 1BW5A 2F5CA 1S7OA 5TGTA 4G94A 5EG0B 2EZKA 4KMUX 3ZQFA 3CC2I 2FBIA 4E7IA 2EA4A 2PG4A 3LSTA 5E1WA 2W82A 4D5CA 4PZJA 2I8DA 1HDPA 1W5TA 5D6EA 3E6CC 3LSKA 4ZZDA 4D7MA 3CESA 1IRGA 4S05A 3IRRA 2OF7A 1HW5A 3D5SC 4EQQA 4BXUA 1JXSA 2DA6A 5K5RA 3CCMI 3S2HJ 1ITYA 3VFZA 5FD6A 4V19K 1GV2A 5HLTA 2PMHA 5DM7F 3EDPA 3CO6C 2DO7A 1DPUA 1WWXA 1ETYA 4WXCA 3GVAA 2IAIA 2LREA 3K70D 4O5VA 1LPQA 4RGUA 4KNYA 4A6DA 2IA2A 3G2BA 1DQUA 4XSZF 3IH4A 4G6DA 2HVSA 5JLXA 1MMDA 5J4VA 3OY9A 4L9JA 2HDCA 4IRIA 1XCBA 3TBIA 4E7SA 3S2DJ 2RDPA 1U9OA 3I53A 4N9IA 4Z2YA 2HGCA 3P7NA 1O7LA 4YFXF 3H3ZA 3MN2A 5CLSA 3L2VA 5E8GA 1U2WA 1S3JA 3NEUA 2F5DA 5L3FA 1FLIA 3W3CA 1LE8B 2O3FA 5E3OA 3A2KA 3B73A 1U5TB 3FXKA 5FJ8J 1SD4A 4CCNA 3A4CA 1RKWA 1EV7A 3H5RA 2FRHA 3R0JA 3CJNA 4KUMA 2VE9A 1BOBA 1MDMB 2CS3A 3CCUI 2QZ8A 3BT9A 4RM3A 3JR9A 1V3FA 5L3BA 2VJ4A 2LKPA 2P0WA 1KQ9A 3G6EI 1TW3A 2ELJA 2K9MA 4RAYA 5GP9A 2BVMA 5EJCA 3KFWX 4A3BJ 2V1XA 5M3FJ 2EIMH 2IBDA 2OU2A 2XB0X 1XS9A 1QBJA 3FXMA 4RLFA 3ISPA 2DCEA 3DPUA 5TJJA 1GVDA 1T0FC 1BI1A 3DPTA 5DCFA 3A0HC 1R23A 4C3JJ 3BCBA 4A3KJ 2JPBA 1A6IA 2LKXA 2A05A 5K7FA 4X6AJ 2XROA 3MVPA 3D5RC 5L3GA 2ZJ2A 1RR8C 5EGOB 2YX7A 3DKYA 2OZUA 3HPHA 3EPZA 2B9SA 1NK3P 3RYRA 2CUFA 2R7RA 4G8XA 5FGMA 1XB4A 3EQLF 3FXLA 4BHBA 3OYEA 4ANJA 1UMQA 3HSFA 1KU9A 2MW8A 1YI2I 2KQRA 2DMPA 2F5FA 4IL6C 2FF4A 4A3IJ 2OTJI 2H09A 3G4SI 4UB8C 3RDIA 3I5UA 5GAGJ 3ZR8X 4IRHA 1TWGJ 3M4OJ 3VWBA 2O7OA 3I9V2 1UZCA 1FOXA 2DFIA 1XD7A 3IP4B 1VI0A 3N4MA 2G7HA 4A0XA 1MSFC 1RPWA 2NOGA 2B0LA 4HAMA 1Q1VA 2QGUA 3JRGA 3VSLA 2WV0A 1R36A 4A2UA 3LNQA 4LK1F 2VKVA 1CF7B 3OWTA 2CYYA 1OPCA 4MGRA 3RQ4A 3DTKA 5LHGA 2NVXJ 3HL2A 1TBXA 4M6XA 5A2QR 1K61A 2CMPA 2RAEA 1UELB 1Y39A 2JZYA 3OIPA 4KISA 2KLOA 2LKSA 2R7TA 3FZVA 4YIFA 5D5WB 1JUMA 1YIJI 4XK4A 4G9YA 1FOYA 3RI4A 2JVGA 1I3QJ 5IT9Z 4P1WA 1G8XA 1E2XA 2BHYA 2QSGX 4U87A 4CHUA 3E97A 3KP3A 2KJBA 3RCOA 2FBKA 1S29A 5BS6A 3LFUA 2DK8A 5E20A 1C0WA 1FEXA 2Q2EB 5DCMB 3IH3A 2Z1DA 4QPQA 2L7MP 3CZ6A 4AIDA 5LEKA 4L5IA 1BR1A 4UHTA 3A0BC 1L3LA 3GTQJ 2E1OA 2PFBA 3HHGA 5E18F 1BJAA 2HQAA 3I56I 2R92J 1JGGA 3F8CA 4J19A 4RDUA 2MABA 3HBLA 1F5TA 2EWNA 2XKOA 2V1NA 3HOTA 4PJLA 1SEUA 1LFUP 5FROA 2V6EA 4U7BA 1R5HA 3BTIA 2R7ZJ 3FKJA 1WJ5A 2DA4A 1FC3A 1X1CA 3QU3A 4CO8A 2ZFWA 2HDWA 3E7LA 3MKLA 1JJ6C 2N8GA 3LOCA 1LEBA 2FA5A 3BTLA 5J1RA 3K4JA 2A5WA 3H5AA 4BEHB 2HZTA 3LA2A 3ABLH 2F2EA 2L9NA 5CVUA 4Y17A 3DLLF 2NS8A 1VTNC 2EFWA 1SC7A 1ZELA 4M72A 1E3OC 2XHKA 3CC7I 3F9KA 4FE4A 4PGGA 3P9CA 2FMLA 1UAAA 4O3MA 5DYMA 2CW0F 3QODA 2V9KA 4UUSA 1Z3YA 1VQKI 2K27A 1IO2A 1VQMI 5IP7J 2BV6A 2M3AA 3A03A 4B4CA 4FX4A 2A69F 4ZH4F 3FBNB 2AO9A 2E19A 3OYCA 3BTJA 2Y30A 1I1GA 2BEOA 5HLGA 4KT6A 4QLCU 4K2EA 5F0HA 1IXSB 4MQ9F 3HOUJ 2P0TA 2XVCA 3RKWA 1HSJA 2ICWG 3TDUC 2F6CA 2XAUA 2A6EF 2WY8Q 1KU7A 4NC6A 5CVJA 4CA0A 1I39A 2GXBA 2HOAA 4II2A 2CW7A 5GAHJ 4XLPF 3HOVJ 2KMUA 2V6CA 3CUQB 1TQPA 2HZDA 1IAWA 2R7XA 2WBMA 1Y1WJ 1B72B 2ZMEB 1NG7A 2A5YB 3HGYA 2EIJH 3IH2A 3LQQA 3W2WA 3OS0A 4BY7J 1Y1VJ 2COBA 3HUGA 4WWCA 3AL0B 1YW8A 3BG7A 5GTIC 3JRFA 4EGYA 1MSEC 1JI8A 4QTRA 2EINH 4E70A 4EVIA 2Q1ZB 1BIAA 2XIGA 1STZA 1ETOA 3KP2A 3JAMR 1FY7A 1BIBA 4XBFA 3EYYA 4IHWA 1LDKB 4FISA 5E79C 3CJQB 2VASA 2IVMA 2GZWA 4JK1X 4LJZF 4E7JA 4IHXA 1VNDA 2KIQA 3TW7A 3K7AJ 3BROA 4A69C 5FKKA 4F52A 2GAUA 3KZZA 3H35A 1B9NA 5F1RA 5CQGA 3LAJA 2B7EA 3BG6A 2ID6A 4QPOA 3OS2A 1OYIA 3GUDA 3VYRB 2BYVE 1OFCX 2DA7A 1DU6A 2MGQA 4JYKA 1T56A 3TO7A 1MIJA 5GPCA 3OYDA 1ON1A 1RNLA 5E3LA 2CUEA 1LUJB 3RQIA 3BY6A 4I6ZA 1GXPA 3MKWB 5LLQA 5D5VB 1BR4A 2Y9ZA 1LEAA 3GFJA 4IXAA 3WU2C 1R4NB 2M4GA 3M9AA 3O3KA 2RREA 5LRSA 1G3TA 1MBGA 4HA8A 2F48A 3DTEA 2CW8A 4HSTA 5J8CA 1J59A 4LG3A 4A6EA 1ETQA 1XMAA 4XM3A 1R4MB 3ABMH 3MQ0A 2QQ9A 2CFXA 1MBFA 1OCZH 2AS5F 1T8IA 3AG1H 3ML6A 1W36C 4ESFA 1WVRA 2A6TA 2PJPA 3V7CA 2XV4S 3UKGA 4E4HA 3I71A 4F93B 4BAYA 2KFDA 1P7JA 3J7AO 2OPTA 2JRMA 1BA5A 2DTRA 4BJ5C 1IRFA 4GRIA 1TNSA 3EUAA 4BH9A 1YITI 2X98A 4XONA 3G71I 5EYRA 1OMIA 3E5XA 4AUXA 3OYIA 3K1NA 4DZPA 2QQBA 2NAZA 1USTA 2XPUA 4HDUA 1V55H 2L2OA 3RKYA 3WGGA 1RIOH 5EDNA 1BC8C 3EUHA 3WU1B 4NC8A 4UV9A 2VE8A 4Y33A 4I2OA 2VKHA 2L54A 5ED4A 2K3PA 2HOTA 3T8RA 3MEXA 4XICA 5E1ZB 2R0QC 5D4SA 1E3HA 2J5PA 1FMVA 3CDIA 3GBGA 3BJOA 3RKXA 4Z6YA 3BLYA 1B8IA 1HKSA 1QGPA 5HDNA 4UB6C 4LB5A 2LK2A 2P6SA 1QZYA 2VJ5A 2YUSA 5L3EA 2DJNA 3ABTA 4MNUA 1GVJA 2Y48A 1K7AA 3H9JA 1YW9A 5J6XA 2X6XA 3HKZN 3WTVC 2DMTA 4OAZA 4D7NA 1RESA 3H92A 2DFEA 4P5OA 3GXOA 4UVCA 1FP1D 3TOAA 3IWZA 1P4AA 3VYUB 1T95A 2K7LA 1IXRC 1N25A 1TC3C 1XX5A 5EG0A 3JREA 2QM3A 4CCMA 1JKPC 1CF7A 3LFKA 1FBQA 1XDSA 1Z91A 1ZK8A 4MTEA 1OCCH 3WG7H 1ZG3A 4RA2A 3NRVA 3ONQA 2VOPA 4ON0A 4ZTJA 3CLOA 2GXGA 1OYYA 2PLYA 2L3DA 3RZOJ 2XPVA 2NNNA 1VZ0A 4IHYA 2DDAA 3BR0A 1DP3A 2DXIA 4Y13A 2M2EA 4QIWN 1VQ9I 4KN7X 1H0MA 2L9RA 2M7BA 2Y75A 3JAMK 2WY7Q 4IZZA 4XLCA 2PX9A 2M0CA 1J5YA 3BR5A 3CTAA 5KK1A 2EZIA 2IW5A 3FM3A 2HEOA 2ZXIA 2X1EA 1ETVA 1IN5A 3BG3A 1VQPI 3KZYA 4CUGA 1X3WB 2EFPA 3A1YA 2L0KA 3DEUA 2KIMA 5ILSA 1ONVA 1FPQA 3H1CA 2KP6A 2LH9A 1DGWY 3DKWA 3ZP5A 3J81K 4ZDOA 1IZ1A 3U9GA 2KZVA 3X2QH 1N77A 1IF1A 2HKXA 2BZTA 5LFAA 2BXYA 3DWLE 1RC9A 2E7XA 4OU0A 5LBQA 1PUEE 2KPMA 1HKTA 4LMYA 2V1UA 2NOJB 3HC7A 4M9ZA 5IP6A 3J80R 2DQRA 2HPMA 4RLQA 4GYGA 4BJTA 2IT0A 3QPHA 4I98B 1O3TA 4A3MJ 4FCYA 4LIUA 2GQQA 1YS7A 2QSFX 2E1CA 1SVMA 2KT0A 1MKMA 3P9IA 2K4BA 1K6YA 2W48A 5HLIA 4I01A 4CCLA 1PYVA 3F23A 2KISA 2KL4A 4B09A 4EMSA 3GTGJ 2QENA 3LA3A 4KMFA 5EEAA 2EBIA 2XPWA 2EV5A 3WTZA 4BY1J 5F64A 2GIZA 2HYGD 3BPVA 3PM1A 1GDTA 2XF7A 4JBAA 1YE9A 3ZMSA 4KICA 1DGRM 3MAJA 5J1UA 3F8FA 5M5YJ 1YRNB 1UHWA 5EF6A 1XG1A 2L9VA 5HS9A 5FB2A 4NB5A 2KDZA 5GAEJ 1KYZA 3WE2A 2LOOA 2OCCH 1KQ8A 1IDYA 2KZGA 2ZMEC 2DQLA 2L7FP 1ZKGA 5LRRA 1T33A 2YR2A 2JK3A 2CJJA 2VQGA 3JAMZ 5LGUA 5IP9J 1T6SA 4B8XA 2W25A 3FXQA 3HTUA 3QQAA 3ZMUA 3RJPA 4RMNA 4LG0B 4PJNA 2W4SA 3OYLA 2VI6A 2LYCA 2WC2A 2CUZA 2JWTA 5B3SH 2KJCA 5F6FA 4W97A 1SD5A 1BW6A 2Z2SB 3T8TA 4CYDA 4XR6A 4AWXB 1ACIA 3J80K 2XRNA 3EUKL 2R7OA 1YRNA 2WB1A 2DMNA 1K78B 4HQEA 5IOYA 3MFKA 4X1EA 2MSYA 3NQOA 3LAPA 1BR2A 4I99C 5DUKA 1NH3A 2COMA 2DA5A 2NVUB 2Y2ZA 1ZRCA 3Q9VA 2RVCA 4UXNA 2DN0A 3LSMA 4HZFA 1YX3A 1LNWA 3WGHA 1RUNA 1OYWA 2L4MA 4YRVA 2ZFUA 4M9SA 3BJ6A 4LB6B 2PJRB 1YLFA 3BZKA 5HNFA 1A04A 2D2WA 2FU4A 4AVZA 3BCAA 2DT5A 2V79A 2F4IA 3J7YJ 1LJ9A 4HNTA 5BPDA 4I76A 5D5XB 3E1SA 1EKEA 4AIJA 3N97A 1H9GA 1AKHA 5E1XA 1YYVA 2Q8KA 1ZR4A 2RN7A 3K4NA 3Q0UA 1YFHA 1X4OA 4H4KC 2E1NA 2Y9YA 2WADA 2RKHA 3AKZA 4M9XA 1R1TA 3CD6I 5JHUA 2X1DA 4AYBA 2W1OA 3KEQA 1H88C 3I4NJ 2MBFA 2LBFA 4KFCA 4NUBA 2W24A 3HGGA 3SHFA 2JVHA 3SYTA 2YU3A 3VYSB 4DIQA 3U1DA 1TT0A 1S72I 1VQNI 4XLHA 3DTIA 3V8JA 2DLLA 4WCGA 2MYSA 3S3NA 5D8LB 1T2KA 1Y8QB 3WU0A 5B1AH 2O0YA 5IYBJ 3OYKA 1R00A 4EM1A 2XAGA 3HPGA 1MBJA 1VF9A 4JX5A 2LDUA 4CICA 1QPIA 2OBPA 4P55A 3PSFA 3DLAA 3L7WA 2F4OB 3CCYA 5ICCA 1D3YA 2KRFA 3OSFA 5JLWA 4M74A 2HR3A 4M71A 1X4PA 4YELA 1JJ8C 1FJLA 4E7ZA 1UB9A 4L18B 4DYQA 4XIDA 4A12A 1ERDA 3PNYA 1GLNA 1KZHA 1YTYA 3B6AA 1HBXG 3NWSA 5D5UB 3LSIA 2KHMA 3R60A 4XN0A 5FLXK 3N05A 1QA6A 1P7IA 2JRTA 5CYVA 2EV0A 3S2WA 5JHFA 1MJAA 1APLC 2DFFA 3M1CA 1IN7A 4PSXA 1G3YA 3FBIB 1REPC 4HF1A 2BY2A 3DQVC 3DEWA 2E1MB 3PFYA 2ME6A 1DUXC 3BDDA 3GW2A 3OR2C 4U0YA 1LE8A 1JHFA 5LEJA 3L9FA 4AM3A 1Z05A 1ZREA 4TV7A 4A3FJ 2QYOA 4UUVA 3G73A 3ABUA 2YS9A 1TWHJ 3GTKJ 1G3WA 1A6QA 3RPUA 1TWCJ 3TGNA 4DGWB 1N75A 4DJAA 5DM6F 3AG4H 3BWGA 5J4YA 1EH7A 2QKMB 2ZKZA 1FT9A 2X1CA 4GGGA 5HDGA 3WTTC 3M07A 2XSJC 3SFIA 1T39A 2Z5UA 3BP8A 3BJAA 2VXZA 4RGRA 1RUOA 3KCCA 1W0UA 4RB2C 1OLTA 2AHQA 4MTDA 2DMQA 3FXJA 4OWRB 2K9SA 3HM5A 3I59B 1FOWA 4F3QA 5C4XJ 2QCOA 3ZCOA 4V2GA 1WKMA 2OUMA 3M1EA 5CKTA 1VQLI 3OYNA 2P7CB 4Y4RA 4IOAF 5HS8A 1R7JA 2IXSA 4QSHA 2ECCA 4HPQA 3BQZA 3ZOBA 5AIPA 1HSTA 2WWYA 3VB2A 2K9LA 5DEQA 2R3SA 3HZJA 3DF8A 3M8JA 1FX7A 4MEYF 2YSRA 3O2PE 1J7KA 3ZMDA 4BXXJ 4B3XA 2G0EA 4DOZA 4R8HA 3T1BA 4LLNA 3ZMVA 4XMYA 3TEDA 1HW1A 5K7HA 4N4NB 1GHCA 2NS7A 1IGNA 5F27A 4YIRX 4A93J 4D5FA 3PUFA 1BBYA 1W0TA 3M3YJ 1G3SA 5CVIA 2R7VA 2BXZA 2LNBA 4Y15A 1W7PB 4NC7A 1MH4A 4XKVA 1EJ9A 1WJFA 2ESHA 5DTDA 1WSUA 2KIUA 1L0OC 2FUG2 2KRHA 2W85A 1PUFB 1ORKA 2DA2A 2GBYA 1RI7A 3KYLA 3GZ6A 1GV5A 4ASNA 2MVTA 1TZLA 1VFCA 6PAXA 5HLHA 2JA8J 1IRZA 2GXAA 1BI3A 3TMOA 4L9NA 2L02A 2H6CA 2OCEA 5B66C 4NBQA 2ELHA 3HRMA 3OMYA 5DDGA 4KJZA 2M35A 1BM9A 1J0RA 4N9HA 1TTYA 1ODDA 2TDXA 1O3SA 3R6SA 2DOEA 1R22A 4MO7A 3LMMA 4LK0F 4BKXA 3ZPLA 1WQ2A 2V9VA 2GOXB 1DDNA 2JT1A 3M8EA 2LP0A 3P5JA 3W6VA 1EF4A 3KLOA 2DTZA 3R0AA 3S93A 1XSVA 1Y56A 3HSEA 3GLLA 1R6RA 1QHHD 1K83J 4A3EJ 3S1MJ 1J9IA 4GCVA 5IYCJ 4B1RA 2B63J 1P92A 2JUCA 1SD6A 1A35A 2FX0A 3ZQ7A 4BGDA 3O6BB 3VDXA 2VPLA 3B6CA 3HOXJ 1HC8A 3VSKA 2QF7A 3PNTA 3FMRA 4PFOA 3SXYA 2ZC2A 1XPXA 1PJRA 3R61A 2ZJQF 1FWZA 5C44J 3ZMZA 2D5VA 3KIOA 4DBQA 4BQNA 3MKYB 2X85A 1YJWI 2LFBA 4HNVA 1YX5A 2MFZA 3L2CA 5M5WJ 1Z1DA 2FOKA 2L5QA 1XSXA 2K9NA 2LG4A 2BY1A 2F4MB 1MW7A 4C3IJ 1WH7A 2ZNZA 4BBSJ 2QBYB 3ESWB 4M3DA 3ZMTA 3O8HA 1D5VA 4IHSA 4OMYA 3BR2A 2OQRA 3GEZA 3SFZA 1HDDC 3IAS2 3OYGA 1CQTA 1E3PA 2VKDA 4L5EA 4LITA 3L2WA 3FXUA 3I4MJ 3QP5A 1ZR2A 1OCRH 4A5NA 5DD4A 1MGTA 2X9DA 2XKPA 2L7KA 4HX4A 3K69A 3CC4I 2QWWA 4KIBA 2KKOA 2VKEA 3HDDA 4ZJZA 4M73A 5FFXA 4BE2A 2BW3A 1MMGA 1HXDA 2JTVA 2R5ZB 3W6KB 2X0LA 2XRLA 3Q0WA 3GTJJ 2ZXWH 2M0MA 1NG6A 3WTYC 3K6GA 1IDZA 3QOEA 3K4LA 3PIOF 2HNHA 2DFHA 2DOAA 5LGNA 2FXAA 3CP8A 1R71A 5C4JJ 2ID3A 4Q4ZF 2CU7A 3HXLA 3LA7A 3LSPA 2D1VA 4EEFG 2CQ7A 2IGNA 2PEXA 3ECHA 3WG9A 1K4TA 4KDPA 4RB1A 3DKXA 1ZLKA 4IO9F 2H6BA 3CCSI 3H3VK 3FK6A 5FKOA 3JRDA 3LWFA 2X48A 2WTEA 4DZJA 3J7ZI 1QPMA 4HW0A 4JP0A 3I3LA 1ZRFA 2E5ZA 3HUGB 4EV0A 3J81Z 4HV5A 3EYIA 2Y0MA 2EQRA 3CUQA 2RNJA 3AAFA 2Z9OA 5HDKA 4ENJA 1E17A 4PSWA 1D0YA 1KONA 1UFMA 1ZTRA 1ENHA 1X2MA 1QZEA 4II3A 3I58A 2MD5A 2NXNB 3OIQA 4GXOA 2CUJA 5JR3A 3TL4X 1SD7A 2R5YB 4FTHA 1KYWA 1O3QA 1FMWA 1IN8A 3CMEI 2O03A 3RTRA 1SVLA 2VBZA 1IV6A 1W4MA 3J7AW 2HQRA 2H8RA 3BZ6A 1M1EB 2HXOA 4CCKA 3FHNA 3AG2H 2O8KA 2JJ7A 1ZG1A 3CDHA 5GADJ 2NVQJ 5IPAA 3SJMA 3E5QA 4V2FA 1FBSA 2EFNA 3HOSA 1PUFA 2E34A 3ZQIA 4YG2F 4ABZA 4WK8F 4HBLA 4BQQA 1ZYRF 4FE7A 2UZKA 2M5WA 2FE3A 1BC7C 2CV2A 1U5TA 2DODA 4BEHA 5FRMA 4LOCA 1R1UA 3GFMA 3FKIJ 3BTCA 2LF8A 3KE2A 2EV6A 4JX4A 2MH9A 4ENKA 1FP2A 3KEOA 5A2QZ 4Q48A 3W6JB 3MCZA 3HG9A 1X2NA 5GPAA 2VC1A 5CJ9A 4MHGA 2XDVA 5ICEA 2VODA 2ZJRF 3HEFA 2TRTA 2RQPA 5FLMJ 1FYMA 3PO3J 3QYEA 5ILUA 1R5GA 1OJLA 3HJEA 1JE8A 2HKOA 3OOUA 4WXHA 1PVEA 3QWLA 4E7LA 2R7FA 2CV0A 4OAYA 3B02A 4P96A 3JRAA 1O4XA 4DQ2A 4AU7A 2FQ3A 5JI6A 3HOWJ 3L2UA 3HOZJ 4XLAA 2CQXA 3HRUA 2IP2A 1TW2A 2VJIA 4PJ0C 2WB1N 1JKOC 5D4RA 2CG4A 2IGKA 2MC3A 4FQGA 1H89C 3CQZJ 1MJBA 1YS6A 1QVUA 4IKFA 5FLXZ 2VUMJ 3E3VA 1MNMC 4S04A 2QQAA 1X19A 2M4KA 3QU6A 2QUFA 2VL8A 1S5LC 3CUOA 1R9TJ 4CSWA 4FT8A 2M30A 2X6WA 3LSHA 3V8KA 2QSHX 2QBYA 2D45A 3NAUA 1WJCA 3F3XA 5ILVA 2EILH 4XQFA 5JVGF 4A3LJ 4DW6A 1BN5A 2IJLA 1O3RA 4ZYDA 1V5GA 3I55I 1OR7A 4L9VA 2XGXA 4QWQA 2MA3A 4OOIA 2JPCA 1TWAJ 2KDOA 3LSGA 2GWRA 4ESBA 2HWVA 2M34A 3H0GJ 3D1NI 4EJTA 4HLYA 3PUBA 4C3HJ 4XRSG 3FIWA 1Z77A 3HKZA 4BQOA 2XGCA 2C6YA 2RQQA 4BUPA 2JMWA 2P5VA 4IQ4A 3TDZC 5AIQA 1OISA 4Y7NJ 2EJRA 2QKLB 1HQCA 2HS5A 2IS1A 1YW7A 2HI3A 2ZSIB 1XGSA 4RGSA 3JW4A 3KZIC 3ZN0A 3GZ5A 2CQNA 2HVQA 4N4OB 1R1VA 3VPRA 1FBUA 2E7WA 3S1NJ 1B4AA 2LMDA 2UXXA 1S9HA 2ZO4A 3JTHA 4WX9A 4Y3OA 2ESNA 2E2JJ 1Y0NA 2WAQN 4FHTA 1LVKA 1EH6A 3CF5F 3A02A 1FYLA 5EEGA 5FO5A 3SDBA 1AU7A 1X1AA 1XGMA 1ZGJA 5EZGA 2DJIA 1SFUA 4CZZA 1T98A 2RV8A 5K5QA 1P6RA 3CMAI 5HVQC 2VLAA 2GA2A 4D0PA 3F8NA 3GWZA 3L00A 2DW4A 2V9PA 2ZNYA 1XDUA 4HEA2 2FEZA 2LY2A 1B72A 4A3JJ 1ON2A 4MFEA 3V42A 1WJAA 2CV1A 3ERED 1OCOH 3BPXA 1VQ6I 4HV6A 2Y0SA 2OTLI 1WH5A 1WGXA 4IF4A 5CVVA 4DYRA 4ENNA 4IEJA 3JSPA 2DYRH 2QEXI 4DBRA 3DXJF 1D8JA 1LDJA 4NNJA 1V54H 3GMEA 4HF0A 4M3GA 4NQWA 1SFEA 3CMYA 2PI0A 2E36A 1DPRA 3HHHA 1AOYA 4C2MJ 3F72A 2PMUA 3OSGA 1YQAA 2X6OA 1MDMA 1Z6RA 5HS7A 3FX3A 2BE5F 5KCMA 1F36A 4CZCA 1S7AA 2JSPA 1A5JA 3ZQHA 3I64A 2DU9A 2IEKA 2WA0A 1ZLJA 2DT6A 4G6QA 1MNEA 2E71A 3F22A 5IT9K 4XKBA 3M8FA 4PK4A 3MWMA 5BQTA 4A3GJ 4U88A 3OL3A 3SDGA 3OYFA 1UHMA 2PJRA 4ZYAA 2EZHA 3WTXC 1K4SA 2A6HF 3CCEI 2R5YA 2VT3A 4IPAA 1PP7U 2LY1A 1U9NA 2K86A 3WODF 2JA6J 5D8KB 3E6MA 4B3AA 4C2TA 3CDLA 1U8BA 1IUYA 5ICFA 3G1MA 4HRIA 4RAZA 4Y52J 4LG0A 1X3ZB 2Q0OA 2M7AA 4LGWA 2AQFA 4L0ZB 3HOYJ 1WJEA 4KA4A 2CQKA 3S17J 5H6QA 3BG5A 2LVSA 1J2XA 3H9GA 3IAM2 1I6HJ 1MMNA 5IYDJ 1ULYA 4UY8I 4WF2A 1D1CA 1G4DA 2F5EA 1ZGAA 2A68F 4MFDA 1WJDA 2XAJA 1FTTA 3K10A 1SAUA 3J81R 4OIQF 1LDDA 1MD0A 3PIPF 2A07F 4KT5C 2ZBKA 3K70C 1YJ9I 2QA4I 2OA4A 3I4PA 3PJRA 4M3EA 2Z16A 2DDBA 4BS9A 4NDLA 2IA1A 4XOTA 1T38A 4BNCA 2HTJA 3OYHA 1NTCA 3A01A 3BOQA 4ZZLA 2ETHA 3WGIA 2Q2EA 5DCMA 4AYBN 2BBYA 1IC8A 4J01A 1MBEA 3G3ZA 3G1LA 5DV5A 1IV8A 3RSNA 1GXQA 2MUNA 2O8XA 2HVRA 3QOPA 1D5YA 5B1BH 4A5MA 1UHSA 2VQCA 3HIFA 2R5ZA 3LSRA 5FKMA 5KHDA 3CCJI 2H27A 4U0WA 2NVTJ 1P2FA 2OZ6A 4W1UA 1IN6A 3PFIA 4PGHA 3FMSA 4ZYEA 3F21A 3S32A 1VQOI 1J09A 1MBHA 1W36D 1E0EA 2W00A 5HNHA 3VOEA 3TQNA 1SANA 1V4RA 2LRDA 5J47A 3RYPA 3C1DA 1LVAA 1HF0A 4A0ZA 1T0FA 2VC0A 1TP4A 1H8AC 4AD9A 3WTUC 1YO5C 1YOVB 3HB9A 1VQ7I 1KA8A 2XGDA 4GO1A 3L1PA 1SVOA 4BDZA 1D0XA 3F6VA 2EFOA 4MEXF 2W84A 3DP7A 4XOPA 3SQNA 1U6GA 2HXIA 1MMAA 1ZARA 1YG2A 3S14J 1LFBA 3GX4X 3L2RA 2E5NA 2XGEA 2HQ5A 2HOEA 2GIVA 2VPRA 2K3FA 4ZYHA 3ZQLA 1V5FA 2K9QA 5KAIC 5ERIA 2QVOA 1ETKA 4M6VA 2P5LC 2QQ8A 5H20A 5C3EJ 2HTSA 3C3WA 4HX7A 2M9HA 1AA7A 1KGSA 1RETA 3CJRB 1MMSA 4AVPA 2RNGA 2RC4A 5BPIA 2ZXJA 5H6RA 3CLQA 3VODA 3Q5FA 1FOKA 4HOBA 1T08B 1ZHFA 3WTSC 4JX6A 1XTAA 4Q5SF 3E6BA 2M8EA 4KN4X 1JTXA 4F91B 1D8KA 4NHJA 4L9TA 5LHIA 2VBWA 4ENMA 3KP7A 3MZHA 2L7ZA 1OKRA 2PMZN 4ZTFA 1XMKA 2WAQA 3AG3H 4IOCF 1BI2A 4RGXA 4XRFA 1P9QC 1HLVA 2V7FA 2XASA 4XNFA 3SZPA 2MLKA 4YIIA 4A3DJ 3K1PA 2RGVA 1FNNA 4YFKF 4RAFA 3AFHA 1WRJA 4I09A 4C9YA 2A61A 2IGOA 2HPIA 2CO5A 5IT3A 4ITVA 1MNDA 3E6DA 2FJ1A 1X1BA 4RAGA 1AWCA 4CYCA 2VJJA 2EFQA 2P81A 4A0YA 2K02A 4P9FA 4B47A 5KVRA 3DBLB 5EEHA 3TO9A 1SFOJ 3GCMA 2M87A 4XKWA 4MIMA 4CYCB 4N0BA 1W7PA 1K78A 1FIPA 2WV1A 2GOMA 3F8MA 2LR8A 1QHGA 2ZSHB 4NQWB 4KITB 2VB6A 4XRMA 2ZJPF 3Q0VA 4L5JA 1FIAA 1RKTA 1D1BA 1IRXA 3GTLJ 2HU9A 2JUGA 2HYJA 5K7ZA 5FLVA 1IJWC 3K0LA 3OYJA 4EJWA 2OD5A 4HQMA 3U21A 2STTA 1ETXA 3DBRB 2M1BA 4RB3C 3IRQA 3M7GA 2XUBA 3K4BA 3TP0A 2LD5A 3KYCB 5IT9R 1D1AA 2R93J 1VQ4I 2UXNA 4BE1A 4KYWA 5B5EC 4XRSA 4HLXA 3JRCA 3CCRI 3BR3A 2FD5A 3DCFA 1TNTA 3FISA 2DMUA 5AONA 5HOOA 1WI9A 4UNOA 3LQRA 1Z7UA 1HCRA 4OIPF 2STWA 5K5OA 1YHQI 2NRAC 4RM2A 3P9KA 2HDDA 1BI0A 2OQGA 4E7KA 3GTMJ 1R49A 4R79A 3D0SA 2VN2A 1X3UA 1YIOA 2NNYA 3RKQA 3T0YA 2R7DA 5CQEA 2DI3A 3J7AY 3K1MA 2BW3B 4ZYGA 2JQ7A 5F04A 3GYHX 1W5SA 3KPHA 1NHAA 5FKNA 3H9QA 2IS4A 2AQEA 2CH0A 1OQYA 1K6OA 1A36A 1N78A 3S1QJ 1OR7C 1XSDA 2L01A 3ELKA 1Y0UA 2ME0A 3CJTB 2P4WA 2FBHA 4I0AA 4P9UA 2UV1A 3QP6A 1A31A 2P8TA 3KP5A 2BHZA 3BR1A 4I02A 4U7DA 3ZQQA 4WXDA 5EZHA 4M3BA 1KU3A 4E6KG 2YX4A 2VONA 3TKYA 1I3AA 1XMXA 3SZGA 1LB2A 1ZQ3P 4PDKA 3KEYA 4EM0B 2M8GX 1MZBA 4PCQA 3ZQGA 1X58A 2DA1A 3ABKH 2R7WA 2GLOA 4KIGA 2ISZA 1XC5A 3ZRGA 4IJAA 3U2RA 3ERMA 5FKLA 3JRIA 1QRYA 1TWFJ 3D5LA 1B9MA 5A2QK 1EH8A 2AXTC 3MD2A 1I50J 1QQIA 2MLGA 3F6OA 2MD0A 2GM4A 4UUTA 3PO2J 3ULQB 9ANTA 2OJED 1I6XA 3K9TA 5CVRA 2X51A 4CCJA 3OYAA 3E0JB 4EJUA 4A3CJ 4FETA 3BR6A 3F0CA 3VEPA 4IHTA 1XN7A 1BL0A 5KNLA 3KLNA 3RPUD 2J5OA 2CWEA 2HFHA 3GLXA 3V4GA 1USSA 2G7UA 1U3EM 3ZGKA 3H36A 4I7HA 3ASNH 3IKVA 2W7NA 3IL2A 1V5EA 3UNGC 4E7HA 1X1PA 2E2IJ 3RZDJ 2PQ8A 4BJ6C 2DPUA 1DU0A 4UVBA 5E17F 1RQ6A 3EETA 1Z0XA 4MLOA 1W1WE 3JTGA 2UUZA 2ZMEA 1SFXA 5BOXA 2DYSH 3BZCA 5F0CA 5E3NA 1Y6IA 3JRHA 2WAEA 3GFLA 3OR1C 2V1DA 3F8BA 2H8WA 3FK7A 3TW6A 1SFKA 3L09A 3V8LA 4BQAA 2DK5A 4HYEA 1FZPB 1BOAA 4BHCA 2K40A 3A52A 1IUFA 2CGPA 3DV8A 3MZ8A 2OC6A 5DS9A 1J75A 2K5CA 2EIKH 2ELKA 4XN3A 3TP3A 2VOOA 1BJZA 3PQJA 1S7EA 1LQ1A 3DU5A 3IV5A 1TL8A 4ZDLA 3KP6A 4F7ZA 1FSEA 3OV8A 4X0GA 5DD8A 2EH3A 4H0EA 1U5TC 1U78A 4U0VA 4AC0A 4M3FA 4M6YA 4DNCA 2CRGA 1WJBA 2VXDA 1RZ4A 5H2FC 1MBKA 1GUUA 2G9WA 1PDNC 2R4GA 3SEZA 1JUPA 2Z33A 5J40A 3FHZA 1CGPA 3BC8A 3HYIA 4D1QA 4UV8A 2FNPA 1ZH5A 4AIKA 3E5UA 4XORA 2LF7A 4XL9A 1JKRC 2BGCA 1HA8A 1X1DA 1ZAOA 1B1BA 1XGOA 1OCTC 4HNUA 1U8RA 1H9TA 3I59A 1GT0C 1XGNA 4S0HB 3C7JA 4OMZA 5LD2C 2ZB9A 2HQNA 2XB5A 5J3LA 5CPRB 3HRSA 4OIRF 3OL4A 1JT6A 1EA3A 2CSOA 2L4AA 3FXOA 5J8FA 1ZG5A 5BNGA 5IOZA 5E3MA 4G7ZF 2E35A 3S16J 2NYXA 5JFRA 2XF5A 3BQYA 4BACA 4XLNF 4GYIA 2LTPA 1Y8RB 3QAHA 1IXCA 1W5CC 3LSJA 3NWTA 3MZYA 2JSCA 4XLFA 3PL8A 3KETA 1XCVA 2VIXA 5D6FA 2Z99A 2BVLA 1Z9CA 2JA7J 2PBIA 1TQIA 3ASOH 1QZZA 2IGMA 2LC2A 3H5NA 2LLKA 2E1MC 4RBOA 1WCMJ 4HX8A 2JA2A 2P6TA 3V7RA 1SMTA 5F0FA 1RR7A 1WPKA 2DPDA 4LD5A 4IRGA 4HDVA 3HRTA 2O61A 5K1YA 1QO0D 3S15J 1WZ2A 4HG2A 3GZNB 2W57A 2R7SA 2E60A 4R1HA 2CQQA 1UG2A 5IY5H 4EATA 3S3OA 5HODA 3ZN1A 1U0JA 1I1SA 1AHDP 2CFOA 2IA0A 3QYFA 2EB7A 1RRJA 1I5ZA 3GTOJ 4XSXF 1TQMA 3S8PA 2VBYA 1WI3A 2BOLA 4Q47A 4BXFA 3ROUA 2X6YA 4JOMA 4DYCA 4RB0A 4ESJA 2FMYA 3DBHB 3QPTA 1O7FA 1IN4A 2H1LA 3ZXSA 3VYTB 2FQ4A 3CO7C 5TRDA 2LSOA 3DEEA 3CP2A 3PNVA 1IG7A 3C18A 2D1HA 2K85A 2NVYJ 4BU2A 5FLXR 5GTHC 3NARA 1UJ8A 1Q1HA 2I5UA 4BE0A 2DT7B 1W7PD 3QPSA 3FMQA 2JN6A 1JUSA 4D9JA 2QLZA 4CXFA 4OIOF 2XSDC 1FSHA 3RPQA 1SAXA 3L2QA 2WAFA 2EK5A 2X4HA 1G59A 3U1KA 2R7QA 3JSOA 3MMYB 1QU3A 1S8NA 5L3DA 5FRNA 4LFUA 1MJ9A 3ZQCA 5F08A 4PUSA 3DFGA 1P4WA 1JTYA 3KP4A 3DU6A 3KYDB 2IS2A 5L3CA 2KRCA 2FOWA 3J80Z 1K79A 1IW7F 3I0TA 3PSIA 5JVTA 1G6NA 2DAOA 2ECBA 2ZXHA 4BHPA 3EUHC 1O57A 4BYYA 3QYBA 1KQ0A 3SZTA 2IPQX 1B6AA 2ADUA 4UUSB 2AXLA 5F1JA 2EA2A 4BBRJ 1HW2A 3R4KA 3CUQC 3CF2A 4ZC3A
chains in the Genus database with same CATH topology
2OAZA 2PN6A 3FF5A 1KU2A 1TLHB 2A3SA 3I54A 1PP8F 4CGZA 1DP7P 1SMYF 2NS0A 4YFNF 3TO6A 2XAQA 1FYKA 5DUIA 4I0BA 4OINF 3QRFF 3H3UA 4LLLA 3WTWC 4AIHA 3FWEA 2FNAA 1S6LA 3RIRA 3K2ZA 4RS8A 4G7OF 2H94A 1F4KA 3PQKA 3IKTA 4EM2A 3IWFA 2K4JA 2P5KA 1HKQA 5ICGA 1UCRA 1B59A 4JQFA 5LHHA 3OOPA 2IRFG 2DBBA 3ECOA 2KIFA 2UWMA 3GO5A 1ZN2A 1F1ZA 2FSWA 2XAHA 2HYFA 1F9NA 4IVNA 4EJOA 4EGZA 3FXRA 3GF2A 3HSRA 4MQVA 2ZCWA 3TOBA 1P4XA 2YPRA 5FD5A 3DPLC 1R58A 2MH2A 4FX0A 3Q9SA 4UVAA 2O6GE 4LLGF 3T5XA 3WE3A 2P7VB 5BMZA 1ZRDA 2M45A 2VBXA 4KIFA 4EJVA 4O6JA 5FFZA 4ETSA 1JGSA 1I27A 2ISYA 1QNTA 5LGTA 2XAFA 5E8IA 2GA1A 4HF2A 1Z6TA 3IC7A 3V7SA 2ACJA 3FM5A 4G7HF 4L0YB 3IHUA 3COAC 2VT2A 4CDGA 3HTSB 1JHHA 2Z3YA 3REOA 3GFIA 2F5CA 1S7OA 4G94A 4KMUX 2FBIA 2EA4A 2PG4A 3LSTA 5E1WA 4PZJA 1W5TA 5D6EA 3E6CC 4ZZDA 1IRGA 4S05A 3IRRA 1HW5A 4EQQA 4BXUA 1JXSA 5K5RA 3VFZA 5FD6A 2PMHA 3EDPA 3CO6C 2DO7A 1DPUA 1WWXA 4WXCA 3GVAA 4O5VA 4RGUA 4KNYA 4A6DA 2IA2A 4XSZF 4G6DA 4L9JA 2HDCA 4IRIA 1XCBA 2RDPA 3I53A 4N9IA 4Z2YA 2HGCA 3P7NA 1O7LA 4YFXF 3H3ZA 5CLSA 5E8GA 1U2WA 1S3JA 3NEUA 2F5DA 5L3FA 1FLIA 2O3FA 3B73A 1U5TB 1SD4A 1EV7A 2FRHA 3R0JA 3CJNA 4KUMA 2VE9A 1MDMB 2QZ8A 1V3FA 5L3BA 2LKPA 1KQ9A 1TW3A 4RAYA 3KFWX 2V1XA 2OU2A 1QBJA 3ISPA 5TJJA 1BI1A 3DPTA 5DCFA 1R23A 2JPBA 2XROA 5L3GA 2ZJ2A 2YX7A 2OZUA 3RYRA 4G8XA 5FGMA 1XB4A 3EQLF 4BHBA 3HSFA 1KU9A 2F5FA 2FF4A 2H09A 3RDIA 3I5UA 4IRHA 2DFIA 1XD7A 3N4MA 2G7HA 4A0XA 2B0LA 4HAMA 2WV0A 1R36A 4A2UA 4LK1F 1CF7B 2CYYA 1OPCA 4MGRA 5LHGA 1TBXA 4M6XA 2JZYA 3FZVA 4YIFA 5D5WB 4G9YA 3RI4A 5IT9Z 1E2XA 4CHUA 3E97A 3KP3A 2KJBA 2FBKA 1S29A 5BS6A 2DK8A 5E20A 1C0WA 5DCMB 5LEKA 4L5IA 4UHTA 1L3LA 2PFBA 3HHGA 5E18F 1BJAA 3F8CA 1F5TA 2EWNA 2XKOA 3HOTA 4U7BA 1R5HA 1FC3A 4CO8A 3QU3A 2ZFWA 1LEBA 2FA5A 2HZTA 3LA2A 2F2EA 5CVUA 4Y17A 1VTNC 2EFWA 4M72A 2XHKA 4PGGA 3P9CA 2FMLA 4O3MA 5DYMA 2CW0F 2K27A 2BV6A 4FX4A 2A69F 4ZH4F 1I1GA 2BEOA 5HLGA 4QLCU 4K2EA 1IXSB 4MQ9F 2XVCA 3RKWA 1HSJA 3TDUC 2A6EF 1KU7A 5CVJA 2GXBA 4XLPF 2V6CA 3CUQB 1TQPA 1IAWA 2ZMEB 2A5YB 3LQQA 3HUGA 4WWCA 1YW8A 4EGYA 4E70A 4EVIA 2XIGA 1BIAA 1STZA 3KP2A 1FY7A 1BIBA 4XBFA 3EYYA 1LDKB 4JK1X 2IVMA 2GZWA 4LJZF 3BROA 2GAUA 3KZZA 1B9NA 5F1RA 3LAJA 1OYIA 3GUDA 2BYVE 3TO7A 1ON1A 1RNLA 3BY6A 1GXPA 5LLQA 5D5VB 1LEAA 3GFJA 4IXAA 3M9AA 3O3KA 5LRSA 1G3TA 4HA8A 1J59A 5J8CA 4A6EA 1XMAA 3MQ0A 2QQ9A 2CFXA 2AS5F 3ML6A 4ESFA 2PJPA 3V7CA 2XV4S 3I71A 4BAYA 3J7AO 2DTRA 1IRFA 1TNSA 4BH9A 1OMIA 3E5XA 3K1NA 2QQBA 2NAZA 1USTA 4HDUA 3RKYA 3WGGA 1RIOH 1BC8C 3EUHA 3WU1B 4UV9A 2VE8A 4I2OA 2L54A 5ED4A 3T8RA 3MEXA 5E1ZB 5D4SA 2J5PA 3BJOA 3RKXA 1HKSA 1QGPA 5HDNA 4LB5A 2P6SA 1QZYA 5L3EA 3ABTA 4MNUA 1GVJA 2Y48A 1K7AA 3WTVC 1YW9A 5J6XA 3H92A 4P5OA 3GXOA 4UVCA 1FP1D 3TOAA 3IWZA 1P4AA 2K7LA 1IXRC 2QM3A 1CF7A 3LFKA 1FBQA 1XDSA 1Z91A 4MTEA 1ZG3A 3NRVA 2VOPA 4ON0A 3CLOA 2GXGA 1OYYA 2PLYA 2L3DA 2NNNA 4Y13A 4KN7X 1H0MA 2Y75A 3JAMK 1J5YA 3CTAA 5KK1A 3FM3A 2IW5A 2HEOA 1IN5A 3KZYA 2EFPA 3DEUA 2KIMA 5ILSA 1ONVA 1FPQA 3DKWA 3ZP5A 3J81K 1IZ1A 3U9GA 1IF1A 2HKXA 1PUEE 2E7XA 4OU0A 5LBQA 1HKTA 4LMYA 2V1UA 4M9ZA 2DQRA 4GYGA 2IT0A 3QPHA 4I98B 1O3TA 2GQQA 1YS7A 2E1CA 3P9IA 1MKMA 2K4BA 5HLIA 4I01A 3F23A 4B09A 4EMSA 2QENA 3LA3A 4KMFA 3WTZA 2EV5A 5F64A 2HYGD 3BPVA 4JBAA 3ZMSA 4KICA 3MAJA 3F8FA 1UHWA 5HS9A 5FB2A 4NB5A 1KYZA 3WE2A 1KQ8A 2DQLA 5LRRA 2YR2A 3JAMZ 5LGUA 1T6SA 4B8XA 2W25A 3FXQA 3HTUA 3ZMUA 3RJPA 4LG0B 2WC2A 2KJCA 5F6FA 1SD5A 3T8TA 4CYDA 4AWXB 3J80K 2XRNA 1K78B 4HQEA 3MFKA 3NQOA 3LAPA 5DUKA 2COMA 1ZRCA 3Q9VA 2RVCA 4UXNA 4HZFA 1LNWA 3WGHA 1RUNA 1OYWA 2L4MA 4M9SA 3BJ6A 4LB6B 1YLFA 1A04A 2D2WA 2FU4A 2DT5A 2V79A 1LJ9A 5BPDA 5D5XB 4AIJA 3N97A 1H9GA 5E1XA 1YYVA 2Q8KA 2RN7A 1YFHA 2E1NA 2RKHA 4M9XA 1R1TA 5JHUA 3KEQA 2MBFA 4KFCA 2W24A 3SHFA 2YU3A 3U1DA 3V8JA 2DLLA 4WCGA 5D8LB 1T2KA 3WU0A 2O0YA 1R00A 4EM1A 2XAGA 2LDUA 4CICA 2OBPA 4P55A 3L7WA 5ICCA 1D3YA 2KRFA 4M74A 2HR3A 4M71A 1UB9A 4L18B 4A12A 1YTYA 1HBXG 5D5UB 3R60A 5FLXK 2JRTA 5CYVA 2EV0A 3S2WA 1MJAA 1IN7A 1G3YA 1REPC 4HF1A 3DQVC 1DUXC 3BDDA 3GW2A 4U0YA 1JHFA 5LEJA 3L9FA 1Z05A 1ZREA 4TV7A 2QYOA 4UUVA 3G73A 3ABUA 1G3WA 3RPUA 3TGNA 3BWGA 1EH7A 2ZKZA 1FT9A 3WTTC 4GGGA 5HDGA 1T39A 2Z5UA 3BP8A 3BJAA 2VXZA 4RGRA 1RUOA 3KCCA 4RB2C 4MTDA 3I59B 1WKMA 3M1EA 2P7CB 5HS8A 1R7JA 5AIPA 1HSTA 2WWYA 3VB2A 5DEQA 2R3SA 3DF8A 1FX7A 4MEYF 2YSRA 3O2PE 1J7KA 3ZMDA 4R8HA 3T1BA 4LLNA 3ZMVA 1HW1A 1GHCA 1BBYA 1G3SA 5CVIA 2LNBA 4Y15A 1W7PB 2ESHA 1WSUA 2KIUA 1L0OC 2W85A 1RI7A 3GZ6A 4ASNA 6PAXA 5HLHA 1BI3A 4L9NA 2L02A 2H6CA 2ELHA 3HRMA 5DDGA 1BM9A 1J0RA 4N9HA 1TTYA 1ODDA 2TDXA 1O3SA 3R6SA 1R22A 4LK0F 3ZPLA 1WQ2A 2V9VA 1DDNA 2JT1A 3M8EA 3KLOA 3R0AA 1XSVA 3HSEA 1J9IA 4GCVA 1P92A 1SD6A 3ZQ7A 3O6BB 3SXYA 3FMRA 3R61A 1FWZA 3ZMZA 3L2CA 1Z1DA 2FOKA 1XSXA 2ZNZA 2QBYB 3ZMTA 1D5VA 4IHSA 4OMYA 2OQRA 3GEZA 3SFZA 3FXUA 3QP5A 4A5NA 5DD4A 1MGTA 2XKPA 4HX4A 3K69A 2QWWA 4KIBA 2KKOA 4M73A 5FFXA 1HXDA 2JTVA 3W6KB 2X0LA 3WTYC 5LGNA 2FXAA 4Q4ZF 3LA7A 2D1VA 3WG9A 2PEXA 3ECHA 4KDPA 4RB1A 1ZLKA 2H6BA 3LWFA 2WTEA 1QPMA 4HW0A 1ZRFA 4EV0A 3J81Z 4HV5A 3EYIA 2Y0MA 3CUQA 2RNJA 3AAFA 2Z9OA 5HDKA 4ENJA 1E17A 1UFMA 3I58A 2MD5A 4GXOA 5JR3A 1SD7A 1O3QA 1KYWA 1IN8A 2O03A 3RTRA 2VBZA 1W4MA 2HQRA 3BZ6A 1ZG1A 3CDHA 3E5QA 1FBSA 2EFNA 3HOSA 4YG2F 4WK8F 4HBLA 1ZYRF 2UZKA 2M5WA 2FE3A 1BC7C 1U5TA 1R1UA 3GFMA 2LF8A 3KE2A 2EV6A 2MH9A 4ENKA 1FP2A 3KEOA 5A2QZ 4Q48A 3W6JB 3MCZA 5ICEA 2VC1A 5CJ9A 4MHGA 2VODA 2RQPA 1FYMA 5ILUA 1R5GA 1JE8A 2HKOA 4WXHA 2R7FA 3B02A 4P96A 4DQ2A 2FQ3A 5JI6A 3HRUA 2IP2A 1TW2A 5D4RA 2CG4A 2MC3A 1MJBA 1YS6A 5FLXZ 3E3VA 4S04A 2QQAA 3QU6A 2QUFA 3CUOA 4FT8A 2M30A 3V8KA 2QBYA 2D45A 3F3XA 5ILVA 1BN5A 2IJLA 1O3RA 4ZYDA 1OR7A 4L9VA 2XGXA 4QWQA 2MA3A 4OOIA 2JPCA 2GWRA 4ESBA 2HWVA 4EJTA 4HLYA 2C6YA 2P5VA 3TDZC 5AIQA 2EJRA 1HQCA 2HS5A 1YW7A 4RGSA 1XGSA 3JW4A 3ZN0A 3GZ5A 1R1VA 1FBUA 2E7WA 1B4AA 2UXXA 2ZO4A 3JTHA 4WX9A 2ESNA 4FHTA 1EH6A 1FYLA 5EEGA 5FO5A 1XGMA 1ZGJA 1SFUA 4CZZA 1T98A 2RV8A 5K5QA 1P6RA 5HVQC 2GA2A 4D0PA 3F8NA 3GWZA 3L00A 2DW4A 2ZNYA 1XDUA 2FEZA 1ON2A 3ERED 3BPXA 4HV6A 4IF4A 5CVVA 4ENNA 3JSPA 3DXJF 1D8JA 1LDJA 4NQWA 4HF0A 1SFEA 2PI0A 1DPRA 3HHHA 1AOYA 3F72A 2PMUA 1YQAA 1MDMA 5HS7A 1Z6RA 2BE5F 3FX3A 1S7AA 3I64A 2DU9A 1ZLJA 4G6QA 3F22A 5IT9K 3M8FA 3MWMA 5BQTA 4U88A 1UHMA 3WTXC 2A6HF 2VT3A 4IPAA 1PP7U 3WODF 2K86A 5D8KB 3E6MA 1IUYA 5ICFA 4RAZA 4LG0A 2Q0OA 4LGWA 4L0ZB 4KA4A 2CQKA 5H6QA 1J2XA 1ULYA 4WF2A 1G4DA 2F5EA 1ZGAA 2A68F 2XAJA 4OIQF 1LDDA 1MD0A 2A07F 4KT5C 2ZBKA 2OA4A 3I4PA 1T38A 2IA1A 4BNCA 2HTJA 3BOQA 4ZZLA 3WGIA 2ETHA 2Q2EA 5DCMA 2BBYA 3G3ZA 5DV5A 1GXQA 2O8XA 3QOPA 4A5MA 3HIFA 2H27A 4U0WA 1P2FA 2OZ6A 1IN6A 3PFIA 4PGHA 3FMSA 4ZYEA 3F21A 3VOEA 3TQNA 1V4RA 3RYPA 3C1DA 1LVAA 4A0ZA 1T0FA 2VC0A 4AD9A 3WTUC 1YO5C 1KA8A 4GO1A 3F6VA 2EFOA 4MEXF 2W84A 3DP7A 3SQNA 1U6GA 1ZARA 1YG2A 3GX4X 2HOEA 2GIVA 4ZYHA 5ERIA 2QVOA 2P5LC 5H20A 2HTSA 3C3WA 4HX7A 1KGSA 4AVPA 2RC4A 5BPIA 2ZXJA 5H6RA 3VODA 3Q5FA 1FOKA 4HOBA 1ZHFA 3WTSC 4Q5SF 3E6BA 2M8EA 4KN4X 1D8KA 4NHJA 4L9TA 5LHIA 2VBWA 4ENMA 3KP7A 3MZHA 1OKRA 1XMKA 1BI2A 4RGXA 4XRFA 2XASA 3SZPA 2MLKA 4YIIA 3K1PA 2RGVA 1FNNA 4YFKF 1WRJA 4I09A 2A61A 2CO5A 5IT3A 3E6DA 1AWCA 2EFQA 4A0YA 2K02A 4P9FA 5KVRA 5EEHA 3TO9A 2M87A 4N0BA 1W7PA 1K78A 3F8MA 4L5JA 3K0LA 4EJWA 2OD5A 4HQMA 2STTA 2M1BA 4RB3C 3IRQA 3M7GA 2XUBA 2UXNA 4KYWA 4HLXA 1TNTA 5AONA 5HOOA 1WI9A 4UNOA 3LQRA 1Z7UA 4OIPF 2STWA 5K5OA 2NRAC 3P9KA 1BI0A 2OQGA 4R79A 3D0SA 2VN2A 1X3UA 1YIOA 2NNYA 3T0YA 2R7DA 2DI3A 3K1MA 4ZYGA 3GYHX 1W5SA 1NHAA 1K6OA 1XSDA 2L01A 3ELKA 1Y0UA 2P4WA 2FBHA 4I0AA 4P9UA 3QP6A 2P8TA 3KP5A 4I02A 4U7DA 4WXDA 1KU3A 2YX4A 2VONA 3TKYA 1LB2A 4PDKA 4EM0B 1MZBA 4PCQA 4KIGA 2ISZA 4IJAA 3U2RA 3D5LA 1B9MA 5A2QK 1EH8A 1QQIA 2MLGA 3F6OA 3ULQB 1I6XA 3K9TA 5CVRA 4EJUA 3VEPA 4IHTA 1XN7A 3KLNA 2J5OA 2CWEA 2HFHA 3GLXA 3V4GA 1USSA 2G7UA 1U3EM 4I7HA 3IKVA 3IL2A 2PQ8A 2DPUA 4UVBA 5E17F 3EETA 3JTGA 2ZMEA 1SFXA 5BOXA 3GFLA 2V1DA 3F8BA 3L09A 3V8LA 4BQAA 2DK5A 4HYEA 1FZPB 1BOAA 4BHCA 2CGPA 3DV8A 1J75A 2VOOA 3PQJA 1LQ1A 3KP6A 4F7ZA 1FSEA 3OV8A 5DD8A 4H0EA 1U5TC 1U78A 4U0VA 4M6YA 4DNCA 1RZ4A 2G9WA 1PDNC 2Z33A 3FHZA 1CGPA 3HYIA 4UV8A 2FNPA 1ZH5A 4AIKA 3E5UA 2LF7A 2BGCA 1ZAOA 1B1BA 1XGOA 1U8RA 1H9TA 3I59A 1XGNA 3C7JA 4OMZA 2HQNA 3HRSA 4OIRF 2CSOA 2L4AA 5J8FA 1ZG5A 4G7ZF 2NYXA 5JFRA 4XLNF 4GYIA 3QAHA 1IXCA 3MZYA 2JSCA 3KETA 1XCVA 5D6FA 2Z99A 1Z9CA 2PBIA 1TQIA 1QZZA 4HX8A 2P6TA 3V7RA 1SMTA 2DPDA 4LD5A 4IRGA 4HDVA 3HRTA 2O61A 5K1YA 1QO0D 2W57A 4R1HA 3ZN1A 1I1SA 2IA0A 2EB7A 1I5ZA 4XSXF 1TQMA 2VBYA 4Q47A 3ROUA 4RB0A 4ESJA 2FMYA 3QPTA 1O7FA 1IN4A 5TRDA 3CO7C 2LSOA 3C18A 2D1HA 1Q1HA 1W7PD 3FMQA 2QLZA 4CXFA 4OIOF 1FSHA 3RPQA 1SAXA 2EK5A 2X4HA 3JSOA 1S8NA 5L3DA 4LFUA 1MJ9A 3DFGA 1P4WA 3KP4A 5L3CA 3J80Z 1K79A 1IW7F 3I0TA 5JVTA 1G6NA 2DAOA 4BHPA 1O57A 4BYYA 1KQ0A 3SZTA 2IPQX 1B6AA 2ADUA 2AXLA 2EA2A 1HW2A 3R4KA 3CUQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAZ A;  2PN6 A;  3FF5 A;  1KU2 A;  1TLH B;  2A3S A;  3I54 A;  1PP8 F;  4CGZ A;  1DP7 P;  1SMY F;  2NS0 A;  4YFN F;  3TO6 A;  2XAQ A;  1FYK A;  5DUI A;  4I0B A;  4OIN F;  3QRF F;  3H3U A;  4LLL A;  3WTW C;  4AIH A;  3FWE A;  2FNA A;  1S6L A;  3RIR A;  3K2Z A;  4RS8 A;  4G7O F;  2H94 A;  1F4K A;  3PQK A;  3IKT A;  4EM2 A;  3IWF A;  2K4J A;  2P5K A;  1HKQ A;  5ICG A;  1UCR A;  1B59 A;  4JQF A;  5LHH A;  3OOP A;  2IRF G;  2DBB A;  3ECO A;  2KIF A;  2UWM A;  3GO5 A;  1ZN2 A;  1F1Z A;  2FSW A;  2XAH A;  2HYF A;  1F9N A;  4IVN A;  4EJO A;  4EGZ A;  3FXR A;  3GF2 A;  3HSR A;  4MQV A;  2ZCW A;  3TOB A;  1P4X A;  2YPR A;  5FD5 A;  3DPL C;  1R58 A;  2MH2 A;  4FX0 A;  3Q9S A;  4UVA A;  2O6G E;  4LLG F;  3T5X A;  3WE3 A;  2P7V B;  5BMZ A;  1ZRD A;  2M45 A;  2VBX A;  4KIF A;  4EJV A;  4O6J A;  5FFZ A;  4ETS A;  1JGS A;  1I27 A;  2ISY A;  1QNT A;  5LGT A;  2XAF A;  5E8I A;  2GA1 A;  4HF2 A;  1Z6T A;  3IC7 A;  3V7S A;  2ACJ A;  3FM5 A;  4G7H F;  4L0Y B;  3IHU A;  3COA C;  2VT2 A;  4CDG A;  3HTS B;  1JHH A;  2Z3Y A;  3REO A;  3GFI A;  2F5C A;  1S7O A;  4G94 A;  4KMU X;  2FBI A;  2EA4 A;  2PG4 A;  3LST A;  5E1W A;  4PZJ A;  1W5T A;  5D6E A;  3E6C C;  4ZZD A;  1IRG A;  4S05 A;  3IRR A;  1HW5 A;  4EQQ A;  4BXU A;  1JXS A;  5K5R A;  3VFZ A;  5FD6 A;  2PMH A;  3EDP A;  3CO6 C;  2DO7 A;  1DPU A;  1WWX A;  4WXC A;  3GVA A;  4O5V A;  4RGU A;  4KNY A;  4A6D A;  2IA2 A;  4XSZ F;  4G6D A;  4L9J A;  2HDC A;  4IRI A;  1XCB A;  2RDP A;  3I53 A;  4N9I A;  4Z2Y A;  2HGC A;  3P7N A;  1O7L A;  4YFX F;  3H3Z A;  5CLS A;  5E8G A;  1U2W A;  1S3J A;  3NEU A;  2F5D A;  5L3F A;  1FLI A;  2O3F A;  3B73 A;  1U5T B;  1SD4 A;  1EV7 A;  2FRH A;  3R0J A;  3CJN A;  4KUM A;  2VE9 A;  1MDM B;  2QZ8 A;  1V3F A;  5L3B A;  2LKP A;  1KQ9 A;  1TW3 A;  4RAY A;  3KFW X;  2V1X A;  2OU2 A;  1QBJ A;  3ISP A;  5TJJ A;  1BI1 A;  3DPT A;  5DCF A;  1R23 A;  2JPB A;  2XRO A;  5L3G A;  2ZJ2 A;  2YX7 A;  2OZU A;  3RYR A;  4G8X A;  5FGM A;  1XB4 A;  3EQL F;  4BHB A;  3HSF A;  1KU9 A;  2F5F A;  2FF4 A;  2H09 A;  3RDI A;  3I5U A;  4IRH A;  2DFI A;  1XD7 A;  3N4M A;  2G7H A;  4A0X A;  2B0L A;  4HAM A;  2WV0 A;  1R36 A;  4A2U A;  4LK1 F;  1CF7 B;  2CYY A;  1OPC A;  4MGR A;  5LHG A;  1TBX A;  4M6X A;  2JZY A;  3FZV A;  4YIF A;  5D5W B;  4G9Y A;  3RI4 A;  5IT9 Z;  1E2X A;  4CHU A;  3E97 A;  3KP3 A;  2KJB A;  2FBK A;  1S29 A;  5BS6 A;  2DK8 A;  5E20 A;  1C0W A;  5DCM B;  5LEK A;  4L5I A;  4UHT A;  1L3L A;  2PFB A;  3HHG A;  5E18 F;  1BJA A;  3F8C A;  1F5T A;  2EWN A;  2XKO A;  3HOT A;  4U7B A;  1R5H A;  1FC3 A;  4CO8 A;  3QU3 A;  2ZFW A;  1LEB A;  2FA5 A;  2HZT A;  3LA2 A;  2F2E A;  5CVU A;  4Y17 A;  1VTN C;  2EFW A;  4M72 A;  2XHK A;  4PGG A;  3P9C A;  2FML A;  4O3M A;  5DYM A;  2CW0 F;  2K27 A;  2BV6 A;  4FX4 A;  2A69 F;  4ZH4 F;  1I1G A;  2BEO A;  5HLG A;  4QLC U;  4K2E A;  1IXS B;  4MQ9 F;  2XVC A;  3RKW A;  1HSJ A;  3TDU C;  2A6E F;  1KU7 A;  5CVJ A;  2GXB A;  4XLP F;  2V6C A;  3CUQ B;  1TQP A;  1IAW A;  2ZME B;  2A5Y B;  3LQQ A;  3HUG A;  4WWC A;  1YW8 A;  4EGY A;  4E70 A;  4EVI A;  2XIG A;  1BIA A;  1STZ A;  3KP2 A;  1FY7 A;  1BIB A;  4XBF A;  3EYY A;  1LDK B;  4JK1 X;  2IVM A;  2GZW A;  4LJZ F;  3BRO A;  2GAU A;  3KZZ A;  1B9N A;  5F1R A;  3LAJ A;  1OYI A;  3GUD A;  2BYV E;  3TO7 A;  1ON1 A;  1RNL A;  3BY6 A;  1GXP A;  5LLQ A;  5D5V B;  1LEA A;  3GFJ A;  4IXA A;  3M9A A;  3O3K A;  5LRS A;  1G3T A;  4HA8 A;  1J59 A;  5J8C A;  4A6E A;  1XMA A;  3MQ0 A;  2QQ9 A;  2CFX A;  2AS5 F;  3ML6 A;  4ESF A;  2PJP A;  3V7C A;  2XV4 S;  3I71 A;  4BAY A;  3J7A O;  2DTR A;  1IRF A;  1TNS A;  4BH9 A;  1OMI A;  3E5X A;  3K1N A;  2QQB A;  2NAZ A;  1UST A;  4HDU A;  3RKY A;  3WGG A;  1RIO H;  1BC8 C;  3EUH A;  3WU1 B;  4UV9 A;  2VE8 A;  4I2O A;  2L54 A;  5ED4 A;  3T8R A;  3MEX A;  5E1Z B;  5D4S A;  2J5P A;  3BJO A;  3RKX A;  1HKS A;  1QGP A;  5HDN A;  4LB5 A;  2P6S A;  1QZY A;  5L3E A;  3ABT A;  4MNU A;  1GVJ A;  2Y48 A;  1K7A A;  3WTV C;  1YW9 A;  5J6X A;  3H92 A;  4P5O A;  3GXO A;  4UVC A;  1FP1 D;  3TOA A;  3IWZ A;  1P4A A;  2K7L A;  1IXR C;  2QM3 A;  1CF7 A;  3LFK A;  1FBQ A;  1XDS A;  1Z91 A;  4MTE A;  1ZG3 A;  3NRV A;  2VOP A;  4ON0 A;  3CLO A;  2GXG A;  1OYY A;  2PLY A;  2L3D A;  2NNN A;  4Y13 A;  4KN7 X;  1H0M A;  2Y75 A;  3JAM K;  1J5Y A;  3CTA A;  5KK1 A;  3FM3 A;  2IW5 A;  2HEO A;  1IN5 A;  3KZY A;  2EFP A;  3DEU A;  2KIM A;  5ILS A;  1ONV A;  1FPQ A;  3DKW A;  3ZP5 A;  3J81 K;  1IZ1 A;  3U9G A;  1IF1 A;  2HKX A;  1PUE E;  2E7X A;  4OU0 A;  5LBQ A;  1HKT A;  4LMY A;  2V1U A;  4M9Z A;  2DQR A;  4GYG A;  2IT0 A;  3QPH A;  4I98 B;  1O3T A;  2GQQ A;  1YS7 A;  2E1C A;  3P9I A;  1MKM A;  2K4B A;  5HLI A;  4I01 A;  3F23 A;  4B09 A;  4EMS A;  2QEN A;  3LA3 A;  4KMF A;  3WTZ A;  2EV5 A;  5F64 A;  2HYG D;  3BPV A;  4JBA A;  3ZMS A;  4KIC A;  3MAJ A;  3F8F A;  1UHW A;  5HS9 A;  5FB2 A;  4NB5 A;  1KYZ A;  3WE2 A;  1KQ8 A;  2DQL A;  5LRR A;  2YR2 A;  3JAM Z;  5LGU A;  1T6S A;  4B8X A;  2W25 A;  3FXQ A;  3HTU A;  3ZMU A;  3RJP A;  4LG0 B;  2WC2 A;  2KJC A;  5F6F A;  1SD5 A;  3T8T A;  4CYD A;  4AWX B;  3J80 K;  2XRN A;  1K78 B;  4HQE A;  3MFK A;  3NQO A;  3LAP A;  5DUK A;  2COM A;  1ZRC A;  3Q9V A;  2RVC A;  4UXN A;  4HZF A;  1LNW A;  3WGH A;  1RUN A;  1OYW A;  2L4M A;  4M9S A;  3BJ6 A;  4LB6 B;  1YLF A;  1A04 A;  2D2W A;  2FU4 A;  2DT5 A;  2V79 A;  1LJ9 A;  5BPD A;  5D5X B;  4AIJ A;  3N97 A;  1H9G A;  5E1X A;  1YYV A;  2Q8K A;  2RN7 A;  1YFH A;  2E1N A;  2RKH A;  4M9X A;  1R1T A;  5JHU A;  3KEQ A;  2MBF A;  4KFC A;  2W24 A;  3SHF A;  2YU3 A;  3U1D A;  3V8J A;  2DLL A;  4WCG A;  5D8L B;  1T2K A;  3WU0 A;  2O0Y A;  1R00 A;  4EM1 A;  2XAG A;  2LDU A;  4CIC A;  2OBP A;  4P55 A;  3L7W A;  5ICC A;  1D3Y A;  2KRF A;  4M74 A;  2HR3 A;  4M71 A;  1UB9 A;  4L18 B;  4A12 A;  1YTY A;  1HBX G;  5D5U B;  3R60 A;  5FLX K;  2JRT A;  5CYV A;  2EV0 A;  3S2W A;  1MJA A;  1IN7 A;  1G3Y A;  1REP C;  4HF1 A;  3DQV C;  1DUX C;  3BDD A;  3GW2 A;  4U0Y A;  1JHF A;  5LEJ A;  3L9F A;  1Z05 A;  1ZRE A;  4TV7 A;  2QYO A;  4UUV A;  3G73 A;  3ABU A;  1G3W A;  3RPU A;  3TGN A;  3BWG A;  1EH7 A;  2ZKZ A;  1FT9 A;  3WTT C;  4GGG A;  5HDG A;  1T39 A;  2Z5U A;  3BP8 A;  3BJA A;  2VXZ A;  4RGR A;  1RUO A;  3KCC A;  4RB2 C;  4MTD A;  3I59 B;  1WKM A;  3M1E A;  2P7C B;  5HS8 A;  1R7J A;  5AIP A;  1HST A;  2WWY A;  3VB2 A;  5DEQ A;  2R3S A;  3DF8 A;  1FX7 A;  4MEY F;  2YSR A;  3O2P E;  1J7K A;  3ZMD A;  4R8H A;  3T1B A;  4LLN A;  3ZMV A;  1HW1 A;  1GHC A;  1BBY A;  1G3S A;  5CVI A;  2LNB A;  4Y15 A;  1W7P B;  2ESH A;  1WSU A;  2KIU A;  1L0O C;  2W85 A;  1RI7 A;  3GZ6 A;  4ASN A;  6PAX A;  5HLH A;  1BI3 A;  4L9N A;  2L02 A;  2H6C A;  2ELH A;  3HRM A;  5DDG A;  1BM9 A;  1J0R A;  4N9H A;  1TTY A;  1ODD A;  2TDX A;  1O3S A;  3R6S A;  1R22 A;  4LK0 F;  3ZPL A;  1WQ2 A;  2V9V A;  1DDN A;  2JT1 A;  3M8E A;  3KLO A;  3R0A A;  1XSV A;  3HSE A;  1J9I A;  4GCV A;  1P92 A;  1SD6 A;  3ZQ7 A;  3O6B B;  3SXY A;  3FMR A;  3R61 A;  1FWZ A;  3ZMZ A;  3L2C A;  1Z1D A;  2FOK A;  1XSX A;  2ZNZ A;  2QBY B;  3ZMT A;  1D5V A;  4IHS A;  4OMY A;  2OQR A;  3GEZ A;  3SFZ A;  3FXU A;  3QP5 A;  4A5N A;  5DD4 A;  1MGT A;  2XKP A;  4HX4 A;  3K69 A;  2QWW A;  4KIB A;  2KKO A;  4M73 A;  5FFX A;  1HXD A;  2JTV A;  3W6K B;  2X0L A;  3WTY C;  5LGN A;  2FXA A;  4Q4Z F;  3LA7 A;  2D1V A;  3WG9 A;  2PEX A;  3ECH A;  4KDP A;  4RB1 A;  1ZLK A;  2H6B A;  3LWF A;  2WTE A;  1QPM A;  4HW0 A;  1ZRF A;  4EV0 A;  3J81 Z;  4HV5 A;  3EYI A;  2Y0M A;  3CUQ A;  2RNJ A;  3AAF A;  2Z9O A;  5HDK A;  4ENJ A;  1E17 A;  1UFM A;  3I58 A;  2MD5 A;  4GXO A;  5JR3 A;  1SD7 A;  1O3Q A;  1KYW A;  1IN8 A;  2O03 A;  3RTR A;  2VBZ A;  1W4M A;  2HQR A;  3BZ6 A;  1ZG1 A;  3CDH A;  3E5Q A;  1FBS A;  2EFN A;  3HOS A;  4YG2 F;  4WK8 F;  4HBL A;  1ZYR F;  2UZK A;  2M5W A;  2FE3 A;  1BC7 C;  1U5T A;  1R1U A;  3GFM A;  2LF8 A;  3KE2 A;  2EV6 A;  2MH9 A;  4ENK A;  1FP2 A;  3KEO A;  5A2Q Z;  4Q48 A;  3W6J B;  3MCZ A;  5ICE A;  2VC1 A;  5CJ9 A;  4MHG A;  2VOD A;  2RQP A;  1FYM A;  5ILU A;  1R5G A;  1JE8 A;  2HKO A;  4WXH A;  2R7F A;  3B02 A;  4P96 A;  4DQ2 A;  2FQ3 A;  5JI6 A;  3HRU A;  2IP2 A;  1TW2 A;  5D4R A;  2CG4 A;  2MC3 A;  1MJB A;  1YS6 A;  5FLX Z;  3E3V A;  4S04 A;  2QQA A;  3QU6 A;  2QUF A;  3CUO A;  4FT8 A;  2M30 A;  3V8K A;  2QBY A;  2D45 A;  3F3X A;  5ILV A;  1BN5 A;  2IJL A;  1O3R A;  4ZYD A;  1OR7 A;  4L9V A;  2XGX A;  4QWQ A;  2MA3 A;  4OOI A;  2JPC A;  2GWR A;  4ESB A;  2HWV A;  4EJT A;  4HLY A;  2C6Y A;  2P5V A;  3TDZ C;  5AIQ A;  2EJR A;  1HQC A;  2HS5 A;  1YW7 A;  4RGS A;  1XGS A;  3JW4 A;  3ZN0 A;  3GZ5 A;  1R1V A;  1FBU A;  2E7W A;  1B4A A;  2UXX A;  2ZO4 A;  3JTH A;  4WX9 A;  2ESN A;  4FHT A;  1EH6 A;  1FYL A;  5EEG A;  5FO5 A;  1XGM A;  1ZGJ A;  1SFU A;  4CZZ A;  1T98 A;  2RV8 A;  5K5Q A;  1P6R A;  5HVQ C;  2GA2 A;  4D0P A;  3F8N A;  3GWZ A;  3L00 A;  2DW4 A;  2ZNY A;  1XDU A;  2FEZ A;  1ON2 A;  3ERE D;  3BPX A;  4HV6 A;  4IF4 A;  5CVV A;  4ENN A;  3JSP A;  3DXJ F;  1D8J A;  1LDJ A;  4NQW A;  4HF0 A;  1SFE A;  2PI0 A;  1DPR A;  3HHH A;  1AOY A;  3F72 A;  2PMU A;  1YQA A;  1MDM A;  5HS7 A;  1Z6R A;  2BE5 F;  3FX3 A;  1S7A A;  3I64 A;  2DU9 A;  1ZLJ A;  4G6Q A;  3F22 A;  5IT9 K;  3M8F A;  3MWM A;  5BQT A;  4U88 A;  1UHM A;  3WTX C;  2A6H F;  2VT3 A;  4IPA A;  1PP7 U;  3WOD F;  2K86 A;  5D8K B;  3E6M A;  1IUY A;  5ICF A;  4RAZ A;  4LG0 A;  2Q0O A;  4LGW A;  4L0Z B;  4KA4 A;  2CQK A;  5H6Q A;  1J2X A;  1ULY A;  4WF2 A;  1G4D A;  2F5E A;  1ZGA A;  2A68 F;  2XAJ A;  4OIQ F;  1LDD A;  1MD0 A;  2A07 F;  4KT5 C;  2ZBK A;  2OA4 A;  3I4P A;  1T38 A;  2IA1 A;  4BNC A;  2HTJ A;  3BOQ A;  4ZZL A;  3WGI A;  2ETH A;  2Q2E A;  5DCM A;  2BBY A;  3G3Z A;  5DV5 A;  1GXQ A;  2O8X A;  3QOP A;  4A5M A;  3HIF A;  2H27 A;  4U0W A;  1P2F A;  2OZ6 A;  1IN6 A;  3PFI A;  4PGH A;  3FMS A;  4ZYE A;  3F21 A;  3VOE A;  3TQN A;  1V4R A;  3RYP A;  3C1D A;  1LVA A;  4A0Z A;  1T0F A;  2VC0 A;  4AD9 A;  3WTU C;  1YO5 C;  1KA8 A;  4GO1 A;  3F6V A;  2EFO A;  4MEX F;  2W84 A;  3DP7 A;  3SQN A;  1U6G A;  1ZAR A;  1YG2 A;  3GX4 X;  2HOE A;  2GIV A;  4ZYH A;  5ERI A;  2QVO A;  2P5L C;  5H20 A;  2HTS A;  3C3W A;  4HX7 A;  1KGS A;  4AVP A;  2RC4 A;  5BPI A;  2ZXJ A;  5H6R A;  3VOD A;  3Q5F A;  1FOK A;  4HOB A;  1ZHF A;  3WTS C;  4Q5S F;  3E6B A;  2M8E A;  4KN4 X;  1D8K A;  4NHJ A;  4L9T A;  5LHI A;  2VBW A;  4ENM A;  3KP7 A;  3MZH A;  1OKR A;  1XMK A;  1BI2 A;  4RGX A;  4XRF A;  2XAS A;  3SZP A;  2MLK A;  4YII A;  3K1P A;  2RGV A;  1FNN A;  4YFK F;  1WRJ A;  4I09 A;  2A61 A;  2CO5 A;  5IT3 A;  3E6D A;  1AWC A;  2EFQ A;  4A0Y A;  2K02 A;  4P9F A;  5KVR A;  5EEH A;  3TO9 A;  2M87 A;  4N0B A;  1W7P A;  1K78 A;  3F8M A;  4L5J A;  3K0L A;  4EJW A;  2OD5 A;  4HQM A;  2STT A;  2M1B A;  4RB3 C;  3IRQ A;  3M7G A;  2XUB A;  2UXN A;  4KYW A;  4HLX A;  1TNT A;  5AON A;  5HOO A;  1WI9 A;  4UNO A;  3LQR A;  1Z7U A;  4OIP F;  2STW A;  5K5O A;  2NRA C;  3P9K A;  1BI0 A;  2OQG A;  4R79 A;  3D0S A;  2VN2 A;  1X3U A;  1YIO A;  2NNY A;  3T0Y A;  2R7D A;  2DI3 A;  3K1M A;  4ZYG A;  3GYH X;  1W5S A;  1NHA A;  1K6O A;  1XSD A;  2L01 A;  3ELK A;  1Y0U A;  2P4W A;  2FBH A;  4I0A A;  4P9U A;  3QP6 A;  2P8T A;  3KP5 A;  4I02 A;  4U7D A;  4WXD A;  1KU3 A;  2YX4 A;  2VON A;  3TKY A;  1LB2 A;  4PDK A;  4EM0 B;  1MZB A;  4PCQ A;  4KIG A;  2ISZ A;  4IJA A;  3U2R A;  3D5L A;  1B9M A;  5A2Q K;  1EH8 A;  1QQI A;  2MLG A;  3F6O A;  3ULQ B;  1I6X A;  3K9T A;  5CVR A;  4EJU A;  3VEP A;  4IHT A;  1XN7 A;  3KLN A;  2J5O A;  2CWE A;  2HFH A;  3GLX A;  3V4G A;  1USS A;  2G7U A;  1U3E M;  4I7H A;  3IKV A;  3IL2 A;  2PQ8 A;  2DPU A;  4UVB A;  5E17 F;  3EET A;  3JTG A;  2ZME A;  1SFX A;  5BOX A;  3GFL A;  2V1D A;  3F8B A;  3L09 A;  3V8L A;  4BQA A;  2DK5 A;  4HYE A;  1FZP B;  1BOA A;  4BHC A;  2CGP A;  3DV8 A;  1J75 A;  2VOO A;  3PQJ A;  1LQ1 A;  3KP6 A;  4F7Z A;  1FSE A;  3OV8 A;  5DD8 A;  4H0E A;  1U5T C;  1U78 A;  4U0V A;  4M6Y A;  4DNC A;  1RZ4 A;  2G9W A;  1PDN C;  2Z33 A;  3FHZ A;  1CGP A;  3HYI A;  4UV8 A;  2FNP A;  1ZH5 A;  4AIK A;  3E5U A;  2LF7 A;  2BGC A;  1ZAO A;  1B1B A;  1XGO A;  1U8R A;  1H9T A;  3I59 A;  1XGN A;  3C7J A;  4OMZ A;  2HQN A;  3HRS A;  4OIR F;  2CSO A;  2L4A A;  5J8F A;  1ZG5 A;  4G7Z F;  2NYX A;  5JFR A;  4XLN F;  4GYI A;  3QAH A;  1IXC A;  3MZY A;  2JSC A;  3KET A;  1XCV A;  5D6F A;  2Z99 A;  1Z9C A;  2PBI A;  1TQI A;  1QZZ A;  4HX8 A;  2P6T A;  3V7R A;  1SMT A;  2DPD A;  4LD5 A;  4IRG A;  4HDV A;  3HRT A;  2O61 A;  5K1Y A;  1QO0 D;  2W57 A;  4R1H A;  3ZN1 A;  1I1S A;  2IA0 A;  2EB7 A;  1I5Z A;  4XSX F;  1TQM A;  2VBY A;  4Q47 A;  3ROU A;  4RB0 A;  4ESJ A;  2FMY A;  3QPT A;  1O7F A;  1IN4 A;  5TRD A;  3CO7 C;  2LSO A;  3C18 A;  2D1H A;  1Q1H A;  1W7P D;  3FMQ A;  2QLZ A;  4CXF A;  4OIO F;  1FSH A;  3RPQ A;  1SAX A;  2EK5 A;  2X4H A;  3JSO A;  1S8N A;  5L3D A;  4LFU A;  1MJ9 A;  3DFG A;  1P4W A;  3KP4 A;  5L3C A;  3J80 Z;  1K79 A;  1IW7 F;  3I0T A;  5JVT A;  1G6N A;  2DAO A;  4BHP A;  1O57 A;  4BYY A;  1KQ0 A;  3SZT A;  2IPQ X;  1B6A A;  2ADU A;  2AXL A;  2EA2 A;  1HW2 A;  3R4K A;  3CUQ C; 
#chains in the Genus database with same CATH topology
 1G2H A;  1Z3X A;  2HOS A;  4GFB A;  2OAZ A;  3GTP J;  2PN6 A;  1WHU A;  2XC7 A;  4LIV A;  3FF5 A;  1KU2 A;  1Z21 A;  3IUO A;  3H0D A;  1VQ8 I;  1TLH B;  4C30 A;  1B8I B;  3QPL A;  5M3M J;  3OYB A;  2A3S A;  3I54 A;  2LY9 A;  1PP8 F;  4CGZ A;  1DP7 P;  3OYM A;  1SMY F;  2NS0 A;  2PMZ A;  4B44 A;  4YFN F;  5J1Y A;  2MZ4 A;  3TO6 A;  4HSR A;  2XF6 A;  3CMM A;  2EZL A;  3UR3 C;  2XAQ A;  3G1O A;  2R7U A;  1FYK A;  5DUI A;  4I0B A;  1JKQ C;  4OIN F;  2TCT A;  3QRF F;  5TIS C;  3H3U A;  4LLL A;  4XLE A;  3WTW C;  2E2H J;  4AIH A;  3FWE A;  2FNA A;  3Q3S A;  4BDY A;  3C2H A;  1S6L A;  2Y31 A;  2H1K A;  3RIR A;  4F55 A;  3K2Z A;  3WHB A;  3K2A A;  2V26 A;  4RS8 A;  4CCO A;  4G7O F;  2H94 A;  1F4K A;  1Z7L A;  1OCP A;  3W2A A;  4YEJ A;  3BG9 A;  4J00 A;  3MKZ A;  3PQK A;  4IHV A;  3IKT A;  4EM2 A;  3IWF A;  2V4J C;  1ETW A;  2K4J A;  4G12 A;  2P5K A;  1HKQ A;  4XKC A;  1ZGW A;  5ICG A;  1UCR A;  1UG0 A;  1B59 A;  1POG A;  4JQF A;  5LHH A;  3OOP A;  4ZDP A;  3WHC A;  2IRF G;  2DBB A;  3ECO A;  2KIF A;  2UWM A;  3GO5 A;  2BY0 A;  1ZN2 A;  4GDF A;  1FTZ A;  2VQH A;  1F1Z A;  2FSW A;  2XAH A;  3JRB A;  4PFP A;  3K4K A;  4F92 B;  2HYF A;  1TT5 B;  4B43 A;  1F9N A;  2IS6 A;  4IVN A;  4EJO A;  3S1R J;  4EGZ A;  3FXR A;  4IX7 A;  3SEQ A;  3GF2 A;  3S3M A;  3HSR A;  1D0Z A;  4MQV A;  2ZCW A;  3JCU C;  4PJM A;  3AL0 C;  2JA5 J;  2Y69 H;  3C2B A;  3TOB A;  1P4X A;  3W2V A;  2YPR A;  2DOF A;  3A01 B;  5FD5 A;  2EPF A;  2O9L A;  3DPL C;  2DA3 A;  3OIO A;  1R58 A;  3OS1 A;  3KX2 A;  2YU9 J;  2MH2 A;  4FX0 A;  3K4C A;  3Q9S A;  4UVA A;  4CH7 A;  5M5X J;  4LLG F;  4FAS D;  4B48 A;  2O6G E;  3T5X A;  3WE3 A;  2BY3 A;  2P7V B;  5KAF C;  1WFX A;  2OV7 A;  1LKX A;  5BMZ A;  1ZRD A;  3FDY A;  4IQJ A;  2Y0S N;  2M45 A;  2O5R A;  2VBX A;  4KIF A;  4EJV A;  3C2G A;  1QVT A;  2MG4 A;  4O6J A;  1Z67 A;  3CCQ I;  2I10 A;  5FFZ A;  1JT0 A;  4G6T B;  1YJN I;  4ETS A;  1JGS A;  1I27 A;  2ISY A;  1QNT A;  5LGT A;  2XAF A;  2LBF B;  5E8I A;  3O8G A;  4BL0 B;  2GA1 A;  5EGO A;  3CCV I;  4HF2 A;  1Z6T A;  3IC7 A;  3V7S A;  3CCL I;  2ACJ A;  1MH3 A;  3LL7 A;  4C2U A;  4PJJ A;  3FM5 A;  1AKH B;  1NK2 P;  4G7H F;  4L0Y B;  3IHU A;  3COA C;  2VT2 A;  2VQL A;  1HOM A;  4CDG A;  2MC4 A;  2F5V A;  3K4M A;  3HTS B;  1F43 A;  1JHH A;  1VQ5 I;  2Z3Y A;  3REO A;  1R5I D;  1LFP A;  3GFI A;  2L9S A;  1BW5 A;  2F5C A;  1S7O A;  5TGT A;  4G94 A;  5EG0 B;  2EZK A;  4KMU X;  3ZQF A;  3CC2 I;  2FBI A;  4E7I A;  2EA4 A;  2PG4 A;  3LST A;  5E1W A;  2W82 A;  4D5C A;  4PZJ A;  2I8D A;  1HDP A;  1W5T A;  5D6E A;  3E6C C;  3LSK A;  4ZZD A;  4D7M A;  3CES A;  1IRG A;  4S05 A;  3IRR A;  2OF7 A;  1HW5 A;  3D5S C;  4EQQ A;  4BXU A;  1JXS A;  2DA6 A;  5K5R A;  3CCM I;  3S2H J;  1ITY A;  3VFZ A;  5FD6 A;  4V19 K;  1GV2 A;  5HLT A;  2PMH A;  5DM7 F;  3EDP A;  3CO6 C;  2DO7 A;  1DPU A;  1WWX A;  1ETY A;  4WXC A;  3GVA A;  2IAI A;  2LRE A;  3K70 D;  4O5V A;  1LPQ A;  4RGU A;  4KNY A;  4A6D A;  2IA2 A;  3G2B A;  1DQU A;  4XSZ F;  3IH4 A;  4G6D A;  2HVS A;  5JLX A;  1MMD A;  5J4V A;  3OY9 A;  4L9J A;  2HDC A;  4IRI A;  1XCB A;  3TBI A;  4E7S A;  3S2D J;  2RDP A;  1U9O A;  3I53 A;  4N9I A;  4Z2Y A;  2HGC A;  3P7N A;  1O7L A;  4YFX F;  3H3Z A;  3MN2 A;  5CLS A;  3L2V A;  5E8G A;  1U2W A;  1S3J A;  3NEU A;  2F5D A;  5L3F A;  1FLI A;  3W3C A;  1LE8 B;  2O3F A;  5E3O A;  3A2K A;  3B73 A;  1U5T B;  3FXK A;  5FJ8 J;  1SD4 A;  4CCN A;  3A4C A;  1RKW A;  1EV7 A;  3H5R A;  2FRH A;  3R0J A;  3CJN A;  4KUM A;  2VE9 A;  1BOB A;  1MDM B;  2CS3 A;  3CCU I;  2QZ8 A;  3BT9 A;  4RM3 A;  3JR9 A;  1V3F A;  5L3B A;  2VJ4 A;  2LKP A;  2P0W A;  1KQ9 A;  3G6E I;  1TW3 A;  2ELJ A;  2K9M A;  4RAY A;  5GP9 A;  2BVM A;  5EJC A;  3KFW X;  4A3B J;  2V1X A;  5M3F J;  2EIM H;  2IBD A;  2OU2 A;  2XB0 X;  1XS9 A;  1QBJ A;  3FXM A;  4RLF A;  3ISP A;  2DCE A;  3DPU A;  5TJJ A;  1GVD A;  1T0F C;  1BI1 A;  3DPT A;  5DCF A;  3A0H C;  1R23 A;  4C3J J;  3BCB A;  4A3K J;  2JPB A;  1A6I A;  2LKX A;  2A05 A;  5K7F A;  4X6A J;  2XRO A;  3MVP A;  3D5R C;  5L3G A;  2ZJ2 A;  1RR8 C;  5EGO B;  2YX7 A;  3DKY A;  2OZU A;  3HPH A;  3EPZ A;  2B9S A;  1NK3 P;  3RYR A;  2CUF A;  2R7R A;  4G8X A;  5FGM A;  1XB4 A;  3EQL F;  3FXL A;  4BHB A;  3OYE A;  4ANJ A;  1UMQ A;  3HSF A;  1KU9 A;  2MW8 A;  1YI2 I;  2KQR A;  2DMP A;  2F5F A;  4IL6 C;  2FF4 A;  4A3I J;  2OTJ I;  2H09 A;  3G4S I;  4UB8 C;  3RDI A;  3I5U A;  5GAG J;  3ZR8 X;  4IRH A;  1TWG J;  3M4O J;  3VWB A;  2O7O A;  3I9V 2;  1UZC A;  1FOX A;  2DFI A;  1XD7 A;  3IP4 B;  1VI0 A;  3N4M A;  2G7H A;  4A0X A;  1MSF C;  1RPW A;  2NOG A;  2B0L A;  4HAM A;  1Q1V A;  2QGU A;  3JRG A;  3VSL A;  2WV0 A;  1R36 A;  4A2U A;  3LNQ A;  4LK1 F;  2VKV A;  1CF7 B;  3OWT A;  2CYY A;  1OPC A;  4MGR A;  3RQ4 A;  3DTK A;  5LHG A;  2NVX J;  3HL2 A;  1TBX A;  4M6X A;  5A2Q R;  1K61 A;  2CMP A;  2RAE A;  1UEL B;  1Y39 A;  2JZY A;  3OIP A;  4KIS A;  2KLO A;  2LKS A;  2R7T A;  3FZV A;  4YIF A;  5D5W B;  1JUM A;  1YIJ I;  4XK4 A;  4G9Y A;  1FOY A;  3RI4 A;  2JVG A;  1I3Q J;  5IT9 Z;  4P1W A;  1G8X A;  1E2X A;  2BHY A;  2QSG X;  4U87 A;  4CHU A;  3E97 A;  3KP3 A;  2KJB A;  3RCO A;  2FBK A;  1S29 A;  5BS6 A;  3LFU A;  2DK8 A;  5E20 A;  1C0W A;  1FEX A;  2Q2E B;  5DCM B;  3IH3 A;  2Z1D A;  4QPQ A;  2L7M P;  3CZ6 A;  4AID A;  5LEK A;  4L5I A;  1BR1 A;  4UHT A;  3A0B C;  1L3L A;  3GTQ J;  2E1O A;  2PFB A;  3HHG A;  5E18 F;  1BJA A;  2HQA A;  3I56 I;  2R92 J;  1JGG A;  3F8C A;  4J19 A;  4RDU A;  2MAB A;  3HBL A;  1F5T A;  2EWN A;  2XKO A;  2V1N A;  3HOT A;  4PJL A;  1SEU A;  1LFU P;  5FRO A;  2V6E A;  4U7B A;  1R5H A;  3BTI A;  2R7Z J;  3FKJ A;  1WJ5 A;  2DA4 A;  1FC3 A;  1X1C A;  3QU3 A;  4CO8 A;  2ZFW A;  2HDW A;  3E7L A;  3MKL A;  1JJ6 C;  2N8G A;  3LOC A;  1LEB A;  2FA5 A;  3BTL A;  5J1R A;  3K4J A;  2A5W A;  3H5A A;  4BEH B;  2HZT A;  3LA2 A;  3ABL H;  2F2E A;  2L9N A;  5CVU A;  4Y17 A;  3DLL F;  2NS8 A;  1VTN C;  2EFW A;  1SC7 A;  1ZEL A;  4M72 A;  1E3O C;  2XHK A;  3CC7 I;  3F9K A;  4FE4 A;  4PGG A;  3P9C A;  2FML A;  1UAA A;  4O3M A;  5DYM A;  2CW0 F;  3QOD A;  2V9K A;  4UUS A;  1Z3Y A;  1VQK I;  2K27 A;  1IO2 A;  1VQM I;  5IP7 J;  2BV6 A;  2M3A A;  3A03 A;  4B4C A;  4FX4 A;  2A69 F;  4ZH4 F;  3FBN B;  2AO9 A;  2E19 A;  3OYC A;  3BTJ A;  2Y30 A;  1I1G A;  2BEO A;  5HLG A;  4KT6 A;  4QLC U;  4K2E A;  5F0H A;  1IXS B;  4MQ9 F;  3HOU J;  2P0T A;  2XVC A;  3RKW A;  1HSJ A;  2ICW G;  3TDU C;  2F6C A;  2XAU A;  2A6E F;  2WY8 Q;  1KU7 A;  4NC6 A;  5CVJ A;  4CA0 A;  1I39 A;  2GXB A;  2HOA A;  4II2 A;  2CW7 A;  5GAH J;  4XLP F;  3HOV J;  2KMU A;  2V6C A;  3CUQ B;  1TQP A;  2HZD A;  1IAW A;  2R7X A;  2WBM A;  1Y1W J;  1B72 B;  2ZME B;  1NG7 A;  2A5Y B;  3HGY A;  2EIJ H;  3IH2 A;  3LQQ A;  3W2W A;  3OS0 A;  4BY7 J;  1Y1V J;  2COB A;  3HUG A;  4WWC A;  3AL0 B;  1YW8 A;  3BG7 A;  5GTI C;  3JRF A;  4EGY A;  1MSE C;  1JI8 A;  4QTR A;  2EIN H;  4E70 A;  4EVI A;  2Q1Z B;  1BIA A;  2XIG A;  1STZ A;  1ETO A;  3KP2 A;  3JAM R;  1FY7 A;  1BIB A;  4XBF A;  3EYY A;  4IHW A;  1LDK B;  4FIS A;  5E79 C;  3CJQ B;  2VAS A;  2IVM A;  2GZW A;  4JK1 X;  4LJZ F;  4E7J A;  4IHX A;  1VND A;  2KIQ A;  3TW7 A;  3K7A J;  3BRO A;  4A69 C;  5FKK A;  4F52 A;  2GAU A;  3KZZ A;  3H35 A;  1B9N A;  5F1R A;  5CQG A;  3LAJ A;  2B7E A;  3BG6 A;  2ID6 A;  4QPO A;  3OS2 A;  1OYI A;  3GUD A;  3VYR B;  2BYV E;  1OFC X;  2DA7 A;  1DU6 A;  2MGQ A;  4JYK A;  1T56 A;  3TO7 A;  1MIJ A;  5GPC A;  3OYD A;  1ON1 A;  1RNL A;  5E3L A;  2CUE A;  1LUJ B;  3RQI A;  3BY6 A;  4I6Z A;  1GXP A;  3MKW B;  5LLQ A;  5D5V B;  1BR4 A;  2Y9Z A;  1LEA A;  3GFJ A;  4IXA A;  3WU2 C;  1R4N B;  2M4G A;  3M9A A;  3O3K A;  2RRE A;  5LRS A;  1G3T A;  1MBG A;  4HA8 A;  2F48 A;  3DTE A;  2CW8 A;  4HST A;  5J8C A;  1J59 A;  4LG3 A;  4A6E A;  1ETQ A;  1XMA A;  4XM3 A;  1R4M B;  3ABM H;  3MQ0 A;  2QQ9 A;  2CFX A;  1MBF A;  1OCZ H;  2AS5 F;  1T8I A;  3AG1 H;  3ML6 A;  1W36 C;  4ESF A;  1WVR A;  2A6T A;  2PJP A;  3V7C A;  2XV4 S;  3UKG A;  4E4H A;  3I71 A;  4F93 B;  4BAY A;  2KFD A;  1P7J A;  3J7A O;  2OPT A;  2JRM A;  1BA5 A;  2DTR A;  4BJ5 C;  1IRF A;  4GRI A;  1TNS A;  3EUA A;  4BH9 A;  1YIT I;  2X98 A;  4XON A;  3G71 I;  5EYR A;  1OMI A;  3E5X A;  4AUX A;  3OYI A;  3K1N A;  4DZP A;  2QQB A;  2NAZ A;  1UST A;  2XPU A;  4HDU A;  1V55 H;  2L2O A;  3RKY A;  3WGG A;  1RIO H;  5EDN A;  1BC8 C;  3EUH A;  3WU1 B;  4NC8 A;  4UV9 A;  2VE8 A;  4Y33 A;  4I2O A;  2VKH A;  2L54 A;  5ED4 A;  2K3P A;  2HOT A;  3T8R A;  3MEX A;  4XIC A;  5E1Z B;  2R0Q C;  5D4S A;  1E3H A;  2J5P A;  1FMV A;  3CDI A;  3GBG A;  3BJO A;  3RKX A;  4Z6Y A;  3BLY A;  1B8I A;  1HKS A;  1QGP A;  5HDN A;  4UB6 C;  4LB5 A;  2LK2 A;  2P6S A;  1QZY A;  2VJ5 A;  2YUS A;  5L3E A;  2DJN A;  3ABT A;  4MNU A;  1GVJ A;  2Y48 A;  1K7A A;  3H9J A;  1YW9 A;  5J6X A;  2X6X A;  3HKZ N;  3WTV C;  2DMT A;  4OAZ A;  4D7N A;  1RES A;  3H92 A;  2DFE A;  4P5O A;  3GXO A;  4UVC A;  1FP1 D;  3TOA A;  3IWZ A;  1P4A A;  3VYU B;  1T95 A;  2K7L A;  1IXR C;  1N25 A;  1TC3 C;  1XX5 A;  5EG0 A;  3JRE A;  2QM3 A;  4CCM A;  1JKP C;  1CF7 A;  3LFK A;  1FBQ A;  1XDS A;  1Z91 A;  1ZK8 A;  4MTE A;  1OCC H;  3WG7 H;  1ZG3 A;  4RA2 A;  3NRV A;  3ONQ A;  2VOP A;  4ON0 A;  4ZTJ A;  3CLO A;  2GXG A;  1OYY A;  2PLY A;  2L3D A;  3RZO J;  2XPV A;  2NNN A;  1VZ0 A;  4IHY A;  2DDA A;  3BR0 A;  1DP3 A;  2DXI A;  4Y13 A;  2M2E A;  4QIW N;  1VQ9 I;  4KN7 X;  1H0M A;  2L9R A;  2M7B A;  2Y75 A;  3JAM K;  2WY7 Q;  4IZZ A;  4XLC A;  2PX9 A;  2M0C A;  1J5Y A;  3BR5 A;  3CTA A;  5KK1 A;  2EZI A;  2IW5 A;  3FM3 A;  2HEO A;  2ZXI A;  2X1E A;  1ETV A;  1IN5 A;  3BG3 A;  1VQP I;  3KZY A;  4CUG A;  1X3W B;  2EFP A;  3A1Y A;  2L0K A;  3DEU A;  2KIM A;  5ILS A;  1ONV A;  1FPQ A;  3H1C A;  2KP6 A;  2LH9 A;  1DGW Y;  3DKW A;  3ZP5 A;  3J81 K;  4ZDO A;  1IZ1 A;  3U9G A;  2KZV A;  3X2Q H;  1N77 A;  1IF1 A;  2HKX A;  2BZT A;  5LFA A;  2BXY A;  3DWL E;  1RC9 A;  2E7X A;  4OU0 A;  5LBQ A;  1PUE E;  2KPM A;  1HKT A;  4LMY A;  2V1U A;  2NOJ B;  3HC7 A;  4M9Z A;  5IP6 A;  3J80 R;  2DQR A;  2HPM A;  4RLQ A;  4GYG A;  4BJT A;  2IT0 A;  3QPH A;  4I98 B;  1O3T A;  4A3M J;  4FCY A;  4LIU A;  2GQQ A;  1YS7 A;  2QSF X;  2E1C A;  1SVM A;  2KT0 A;  1MKM A;  3P9I A;  2K4B A;  1K6Y A;  2W48 A;  5HLI A;  4I01 A;  4CCL A;  1PYV A;  3F23 A;  2KIS A;  2KL4 A;  4B09 A;  4EMS A;  3GTG J;  2QEN A;  3LA3 A;  4KMF A;  5EEA A;  2EBI A;  2XPW A;  2EV5 A;  3WTZ A;  4BY1 J;  5F64 A;  2GIZ A;  2HYG D;  3BPV A;  3PM1 A;  1GDT A;  2XF7 A;  4JBA A;  1YE9 A;  3ZMS A;  4KIC A;  1DGR M;  3MAJ A;  5J1U A;  3F8F A;  5M5Y J;  1YRN B;  1UHW A;  5EF6 A;  1XG1 A;  2L9V A;  5HS9 A;  5FB2 A;  4NB5 A;  2KDZ A;  5GAE J;  1KYZ A;  3WE2 A;  2LOO A;  2OCC H;  1KQ8 A;  1IDY A;  2KZG A;  2ZME C;  2DQL A;  2L7F P;  1ZKG A;  5LRR A;  1T33 A;  2YR2 A;  2JK3 A;  2CJJ A;  2VQG A;  3JAM Z;  5LGU A;  5IP9 J;  1T6S A;  4B8X A;  2W25 A;  3FXQ A;  3HTU A;  3QQA A;  3ZMU A;  3RJP A;  4RMN A;  4LG0 B;  4PJN A;  2W4S A;  3OYL A;  2VI6 A;  2LYC A;  2WC2 A;  2CUZ A;  2JWT A;  5B3S H;  2KJC A;  5F6F A;  4W97 A;  1SD5 A;  1BW6 A;  2Z2S B;  3T8T A;  4CYD A;  4XR6 A;  4AWX B;  1ACI A;  3J80 K;  2XRN A;  3EUK L;  2R7O A;  1YRN A;  2WB1 A;  2DMN A;  1K78 B;  4HQE A;  5IOY A;  3MFK A;  4X1E A;  2MSY A;  3NQO A;  3LAP A;  1BR2 A;  4I99 C;  5DUK A;  1NH3 A;  2COM A;  2DA5 A;  2NVU B;  2Y2Z A;  1ZRC A;  3Q9V A;  2RVC A;  4UXN A;  2DN0 A;  3LSM A;  4HZF A;  1YX3 A;  1LNW A;  3WGH A;  1RUN A;  1OYW A;  2L4M A;  4YRV A;  2ZFU A;  4M9S A;  3BJ6 A;  4LB6 B;  2PJR B;  1YLF A;  3BZK A;  5HNF A;  1A04 A;  2D2W A;  2FU4 A;  4AVZ A;  3BCA A;  2DT5 A;  2V79 A;  2F4I A;  3J7Y J;  1LJ9 A;  4HNT A;  5BPD A;  4I76 A;  5D5X B;  3E1S A;  1EKE A;  4AIJ A;  3N97 A;  1H9G A;  1AKH A;  5E1X A;  1YYV A;  2Q8K A;  1ZR4 A;  2RN7 A;  3K4N A;  3Q0U A;  1YFH A;  1X4O A;  4H4K C;  2E1N A;  2Y9Y A;  2WAD A;  2RKH A;  3AKZ A;  4M9X A;  1R1T A;  3CD6 I;  5JHU A;  2X1D A;  4AYB A;  2W1O A;  3KEQ A;  1H88 C;  3I4N J;  2MBF A;  2LBF A;  4KFC A;  4NUB A;  2W24 A;  3HGG A;  3SHF A;  2JVH A;  3SYT A;  2YU3 A;  3VYS B;  4DIQ A;  3U1D A;  1TT0 A;  1S72 I;  1VQN I;  4XLH A;  3DTI A;  3V8J A;  2DLL A;  4WCG A;  2MYS A;  3S3N A;  5D8L B;  1T2K A;  1Y8Q B;  3WU0 A;  5B1A H;  2O0Y A;  5IYB J;  3OYK A;  1R00 A;  4EM1 A;  2XAG A;  3HPG A;  1MBJ A;  1VF9 A;  4JX5 A;  2LDU A;  4CIC A;  1QPI A;  2OBP A;  4P55 A;  3PSF A;  3DLA A;  3L7W A;  2F4O B;  3CCY A;  5ICC A;  1D3Y A;  2KRF A;  3OSF A;  5JLW A;  4M74 A;  2HR3 A;  4M71 A;  1X4P A;  4YEL A;  1JJ8 C;  1FJL A;  4E7Z A;  1UB9 A;  4L18 B;  4DYQ A;  4XID A;  4A12 A;  1ERD A;  3PNY A;  1GLN A;  1KZH A;  1YTY A;  3B6A A;  1HBX G;  3NWS A;  5D5U B;  3LSI A;  2KHM A;  3R60 A;  4XN0 A;  5FLX K;  3N05 A;  1QA6 A;  1P7I A;  2JRT A;  5CYV A;  2EV0 A;  3S2W A;  5JHF A;  1MJA A;  1APL C;  2DFF A;  3M1C A;  1IN7 A;  4PSX A;  1G3Y A;  3FBI B;  1REP C;  4HF1 A;  2BY2 A;  3DQV C;  3DEW A;  2E1M B;  3PFY A;  2ME6 A;  1DUX C;  3BDD A;  3GW2 A;  3OR2 C;  4U0Y A;  1LE8 A;  1JHF A;  5LEJ A;  3L9F A;  4AM3 A;  1Z05 A;  1ZRE A;  4TV7 A;  4A3F J;  2QYO A;  4UUV A;  3G73 A;  3ABU A;  2YS9 A;  1TWH J;  3GTK J;  1G3W A;  1A6Q A;  3RPU A;  1TWC J;  3TGN A;  4DGW B;  1N75 A;  4DJA A;  5DM6 F;  3AG4 H;  3BWG A;  5J4Y A;  1EH7 A;  2QKM B;  2ZKZ A;  1FT9 A;  2X1C A;  4GGG A;  5HDG A;  3WTT C;  3M07 A;  2XSJ C;  3SFI A;  1T39 A;  2Z5U A;  3BP8 A;  3BJA A;  2VXZ A;  4RGR A;  1RUO A;  3KCC A;  1W0U A;  4RB2 C;  1OLT A;  2AHQ A;  4MTD A;  2DMQ A;  3FXJ A;  4OWR B;  2K9S A;  3HM5 A;  3I59 B;  1FOW A;  4F3Q A;  5C4X J;  2QCO A;  3ZCO A;  4V2G A;  1WKM A;  2OUM A;  3M1E A;  5CKT A;  1VQL I;  3OYN A;  2P7C B;  4Y4R A;  4IOA F;  5HS8 A;  1R7J A;  2IXS A;  4QSH A;  2ECC A;  4HPQ A;  3BQZ A;  3ZOB A;  5AIP A;  1HST A;  2WWY A;  3VB2 A;  2K9L A;  5DEQ A;  2R3S A;  3HZJ A;  3DF8 A;  3M8J A;  1FX7 A;  4MEY F;  2YSR A;  3O2P E;  1J7K A;  3ZMD A;  4BXX J;  4B3X A;  2G0E A;  4DOZ A;  4R8H A;  3T1B A;  4LLN A;  3ZMV A;  4XMY A;  3TED A;  1HW1 A;  5K7H A;  4N4N B;  1GHC A;  2NS7 A;  1IGN A;  5F27 A;  4YIR X;  4A93 J;  4D5F A;  3PUF A;  1BBY A;  1W0T A;  3M3Y J;  1G3S A;  5CVI A;  2R7V A;  2BXZ A;  2LNB A;  4Y15 A;  1W7P B;  4NC7 A;  1MH4 A;  4XKV A;  1EJ9 A;  1WJF A;  2ESH A;  5DTD A;  1WSU A;  2KIU A;  1L0O C;  2FUG 2;  2KRH A;  2W85 A;  1PUF B;  1ORK A;  2DA2 A;  2GBY A;  1RI7 A;  3KYL A;  3GZ6 A;  1GV5 A;  4ASN A;  2MVT A;  1TZL A;  1VFC A;  6PAX A;  5HLH A;  2JA8 J;  1IRZ A;  2GXA A;  1BI3 A;  3TMO A;  4L9N A;  2L02 A;  2H6C A;  2OCE A;  5B66 C;  4NBQ A;  2ELH A;  3HRM A;  3OMY A;  5DDG A;  4KJZ A;  2M35 A;  1BM9 A;  1J0R A;  4N9H A;  1TTY A;  1ODD A;  2TDX A;  1O3S A;  3R6S A;  2DOE A;  1R22 A;  4MO7 A;  3LMM A;  4LK0 F;  4BKX A;  3ZPL A;  1WQ2 A;  2V9V A;  2GOX B;  1DDN A;  2JT1 A;  3M8E A;  2LP0 A;  3P5J A;  3W6V A;  1EF4 A;  3KLO A;  2DTZ A;  3R0A A;  3S93 A;  1XSV A;  1Y56 A;  3HSE A;  3GLL A;  1R6R A;  1QHH D;  1K83 J;  4A3E J;  3S1M J;  1J9I A;  4GCV A;  5IYC J;  4B1R A;  2B63 J;  1P92 A;  2JUC A;  1SD6 A;  1A35 A;  2FX0 A;  3ZQ7 A;  4BGD A;  3O6B B;  3VDX A;  2VPL A;  3B6C A;  3HOX J;  1HC8 A;  3VSK A;  2QF7 A;  3PNT A;  3FMR A;  4PFO A;  3SXY A;  2ZC2 A;  1XPX A;  1PJR A;  3R61 A;  2ZJQ F;  1FWZ A;  5C44 J;  3ZMZ A;  2D5V A;  3KIO A;  4DBQ A;  4BQN A;  3MKY B;  2X85 A;  1YJW I;  2LFB A;  4HNV A;  1YX5 A;  2MFZ A;  3L2C A;  5M5W J;  1Z1D A;  2FOK A;  2L5Q A;  1XSX A;  2K9N A;  2LG4 A;  2BY1 A;  2F4M B;  1MW7 A;  4C3I J;  1WH7 A;  2ZNZ A;  4BBS J;  2QBY B;  3ESW B;  4M3D A;  3ZMT A;  3O8H A;  1D5V A;  4IHS A;  4OMY A;  3BR2 A;  2OQR A;  3GEZ A;  3SFZ A;  1HDD C;  3IAS 2;  3OYG A;  1CQT A;  1E3P A;  2VKD A;  4L5E A;  4LIT A;  3L2W A;  3FXU A;  3I4M J;  3QP5 A;  1ZR2 A;  1OCR H;  4A5N A;  5DD4 A;  1MGT A;  2X9D A;  2XKP A;  2L7K A;  4HX4 A;  3K69 A;  3CC4 I;  2QWW A;  4KIB A;  2KKO A;  2VKE A;  3HDD A;  4ZJZ A;  4M73 A;  5FFX A;  4BE2 A;  2BW3 A;  1MMG A;  1HXD A;  2JTV A;  2R5Z B;  3W6K B;  2X0L A;  2XRL A;  3Q0W A;  3GTJ J;  2ZXW H;  2M0M A;  1NG6 A;  3WTY C;  3K6G A;  1IDZ A;  3QOE A;  3K4L A;  3PIO F;  2HNH A;  2DFH A;  2DOA A;  5LGN A;  2FXA A;  3CP8 A;  1R71 A;  5C4J J;  2ID3 A;  4Q4Z F;  2CU7 A;  3HXL A;  3LA7 A;  3LSP A;  2D1V A;  4EEF G;  2CQ7 A;  2IGN A;  2PEX A;  3ECH A;  3WG9 A;  1K4T A;  4KDP A;  4RB1 A;  3DKX A;  1ZLK A;  4IO9 F;  2H6B A;  3CCS I;  3H3V K;  3FK6 A;  5FKO A;  3JRD A;  3LWF A;  2X48 A;  2WTE A;  4DZJ A;  3J7Z I;  1QPM A;  4HW0 A;  4JP0 A;  3I3L A;  1ZRF A;  2E5Z A;  3HUG B;  4EV0 A;  3J81 Z;  4HV5 A;  3EYI A;  2Y0M A;  2EQR A;  3CUQ A;  2RNJ A;  3AAF A;  2Z9O A;  5HDK A;  4ENJ A;  1E17 A;  4PSW A;  1D0Y A;  1KON A;  1UFM A;  1ZTR A;  1ENH A;  1X2M A;  1QZE A;  4II3 A;  3I58 A;  2MD5 A;  2NXN B;  3OIQ A;  4GXO A;  2CUJ A;  5JR3 A;  3TL4 X;  1SD7 A;  2R5Y B;  4FTH A;  1KYW A;  1O3Q A;  1FMW A;  1IN8 A;  3CME I;  2O03 A;  3RTR A;  1SVL A;  2VBZ A;  1IV6 A;  1W4M A;  3J7A W;  2HQR A;  2H8R A;  3BZ6 A;  1M1E B;  2HXO A;  4CCK A;  3FHN A;  3AG2 H;  2O8K A;  2JJ7 A;  1ZG1 A;  3CDH A;  5GAD J;  2NVQ J;  5IPA A;  3SJM A;  3E5Q A;  4V2F A;  1FBS A;  2EFN A;  3HOS A;  1PUF A;  2E34 A;  3ZQI A;  4YG2 F;  4ABZ A;  4WK8 F;  4HBL A;  4BQQ A;  1ZYR F;  4FE7 A;  2UZK A;  2M5W A;  2FE3 A;  1BC7 C;  2CV2 A;  1U5T A;  2DOD A;  4BEH A;  5FRM A;  4LOC A;  1R1U A;  3GFM A;  3FKI J;  3BTC A;  2LF8 A;  3KE2 A;  2EV6 A;  4JX4 A;  2MH9 A;  4ENK A;  1FP2 A;  3KEO A;  5A2Q Z;  4Q48 A;  3W6J B;  3MCZ A;  3HG9 A;  1X2N A;  5GPA A;  2VC1 A;  5CJ9 A;  4MHG A;  2XDV A;  5ICE A;  2VOD A;  2ZJR F;  3HEF A;  2TRT A;  2RQP A;  5FLM J;  1FYM A;  3PO3 J;  3QYE A;  5ILU A;  1R5G A;  1OJL A;  3HJE A;  1JE8 A;  2HKO A;  3OOU A;  4WXH A;  1PVE A;  3QWL A;  4E7L A;  2R7F A;  2CV0 A;  4OAY A;  3B02 A;  4P96 A;  3JRA A;  1O4X A;  4DQ2 A;  4AU7 A;  2FQ3 A;  5JI6 A;  3HOW J;  3L2U A;  3HOZ J;  4XLA A;  2CQX A;  3HRU A;  2IP2 A;  1TW2 A;  2VJI A;  4PJ0 C;  2WB1 N;  1JKO C;  5D4R A;  2CG4 A;  2IGK A;  2MC3 A;  4FQG A;  1H89 C;  3CQZ J;  1MJB A;  1YS6 A;  1QVU A;  4IKF A;  5FLX Z;  2VUM J;  3E3V A;  1MNM C;  4S04 A;  2QQA A;  1X19 A;  2M4K A;  3QU6 A;  2QUF A;  2VL8 A;  1S5L C;  3CUO A;  1R9T J;  4CSW A;  4FT8 A;  2M30 A;  2X6W A;  3LSH A;  3V8K A;  2QSH X;  2QBY A;  2D45 A;  3NAU A;  1WJC A;  3F3X A;  5ILV A;  2EIL H;  4XQF A;  5JVG F;  4A3L J;  4DW6 A;  1BN5 A;  2IJL A;  1O3R A;  4ZYD A;  1V5G A;  3I55 I;  1OR7 A;  4L9V A;  2XGX A;  4QWQ A;  2MA3 A;  4OOI A;  2JPC A;  1TWA J;  2KDO A;  3LSG A;  2GWR A;  4ESB A;  2HWV A;  2M34 A;  3H0G J;  3D1N I;  4EJT A;  4HLY A;  3PUB A;  4C3H J;  4XRS G;  3FIW A;  1Z77 A;  3HKZ A;  4BQO A;  2XGC A;  2C6Y A;  2RQQ A;  4BUP A;  2JMW A;  2P5V A;  4IQ4 A;  3TDZ C;  5AIQ A;  1OIS A;  4Y7N J;  2EJR A;  2QKL B;  1HQC A;  2HS5 A;  2IS1 A;  1YW7 A;  2HI3 A;  2ZSI B;  1XGS A;  4RGS A;  3JW4 A;  3KZI C;  3ZN0 A;  3GZ5 A;  2CQN A;  2HVQ A;  4N4O B;  1R1V A;  3VPR A;  1FBU A;  2E7W A;  3S1N J;  1B4A A;  2LMD A;  2UXX A;  1S9H A;  2ZO4 A;  3JTH A;  4WX9 A;  4Y3O A;  2ESN A;  2E2J J;  1Y0N A;  2WAQ N;  4FHT A;  1LVK A;  1EH6 A;  3CF5 F;  3A02 A;  1FYL A;  5EEG A;  5FO5 A;  3SDB A;  1AU7 A;  1X1A A;  1XGM A;  1ZGJ A;  5EZG A;  2DJI A;  1SFU A;  4CZZ A;  1T98 A;  2RV8 A;  5K5Q A;  1P6R A;  3CMA I;  5HVQ C;  2VLA A;  2GA2 A;  4D0P A;  3F8N A;  3GWZ A;  3L00 A;  2DW4 A;  2V9P A;  2ZNY A;  1XDU A;  4HEA 2;  2FEZ A;  2LY2 A;  1B72 A;  4A3J J;  1ON2 A;  4MFE A;  3V42 A;  1WJA A;  2CV1 A;  3ERE D;  1OCO H;  3BPX A;  1VQ6 I;  4HV6 A;  2Y0S A;  2OTL I;  1WH5 A;  1WGX A;  4IF4 A;  5CVV A;  4DYR A;  4ENN A;  4IEJ A;  3JSP A;  2DYR H;  2QEX I;  4DBR A;  3DXJ F;  1D8J A;  1LDJ A;  4NNJ A;  1V54 H;  3GME A;  4HF0 A;  4M3G A;  4NQW A;  1SFE A;  3CMY A;  2PI0 A;  2E36 A;  1DPR A;  3HHH A;  1AOY A;  4C2M J;  3F72 A;  2PMU A;  3OSG A;  1YQA A;  2X6O A;  1MDM A;  1Z6R A;  5HS7 A;  3FX3 A;  2BE5 F;  5KCM A;  1F36 A;  4CZC A;  1S7A A;  2JSP A;  1A5J A;  3ZQH A;  3I64 A;  2DU9 A;  2IEK A;  2WA0 A;  1ZLJ A;  2DT6 A;  4G6Q A;  1MNE A;  2E71 A;  3F22 A;  5IT9 K;  4XKB A;  3M8F A;  4PK4 A;  3MWM A;  5BQT A;  4A3G J;  4U88 A;  3OL3 A;  3SDG A;  3OYF A;  1UHM A;  2PJR A;  4ZYA A;  2EZH A;  3WTX C;  1K4S A;  2A6H F;  3CCE I;  2R5Y A;  2VT3 A;  4IPA A;  1PP7 U;  2LY1 A;  1U9N A;  2K86 A;  3WOD F;  2JA6 J;  5D8K B;  3E6M A;  4B3A A;  4C2T A;  3CDL A;  1U8B A;  1IUY A;  5ICF A;  3G1M A;  4HRI A;  4RAZ A;  4Y52 J;  4LG0 A;  1X3Z B;  2Q0O A;  2M7A A;  4LGW A;  2AQF A;  4L0Z B;  3HOY J;  1WJE A;  4KA4 A;  2CQK A;  3S17 J;  5H6Q A;  3BG5 A;  2LVS A;  1J2X A;  3H9G A;  3IAM 2;  1I6H J;  1MMN A;  5IYD J;  1ULY A;  4UY8 I;  4WF2 A;  1D1C A;  1G4D A;  2F5E A;  1ZGA A;  2A68 F;  4MFD A;  1WJD A;  2XAJ A;  1FTT A;  3K10 A;  1SAU A;  3J81 R;  4OIQ F;  1LDD A;  1MD0 A;  3PIP F;  2A07 F;  4KT5 C;  2ZBK A;  3K70 C;  1YJ9 I;  2QA4 I;  2OA4 A;  3I4P A;  3PJR A;  4M3E A;  2Z16 A;  2DDB A;  4BS9 A;  4NDL A;  2IA1 A;  4XOT A;  1T38 A;  4BNC A;  2HTJ A;  3OYH A;  1NTC A;  3A01 A;  3BOQ A;  4ZZL A;  2ETH A;  3WGI A;  2Q2E A;  5DCM A;  4AYB N;  2BBY A;  1IC8 A;  4J01 A;  1MBE A;  3G3Z A;  3G1L A;  5DV5 A;  1IV8 A;  3RSN A;  1GXQ A;  2MUN A;  2O8X A;  2HVR A;  3QOP A;  1D5Y A;  5B1B H;  4A5M A;  1UHS A;  2VQC A;  3HIF A;  2R5Z A;  3LSR A;  5FKM A;  5KHD A;  3CCJ I;  2H27 A;  4U0W A;  2NVT J;  1P2F A;  2OZ6 A;  4W1U A;  1IN6 A;  3PFI A;  4PGH A;  3FMS A;  4ZYE A;  3F21 A;  3S32 A;  1VQO I;  1J09 A;  1MBH A;  1W36 D;  1E0E A;  2W00 A;  5HNH A;  3VOE A;  3TQN A;  1SAN A;  1V4R A;  2LRD A;  5J47 A;  3RYP A;  3C1D A;  1LVA A;  1HF0 A;  4A0Z A;  1T0F A;  2VC0 A;  1TP4 A;  1H8A C;  4AD9 A;  3WTU C;  1YO5 C;  1YOV B;  3HB9 A;  1VQ7 I;  1KA8 A;  2XGD A;  4GO1 A;  3L1P A;  1SVO A;  4BDZ A;  1D0X A;  3F6V A;  2EFO A;  4MEX F;  2W84 A;  3DP7 A;  4XOP A;  3SQN A;  1U6G A;  2HXI A;  1MMA A;  1ZAR A;  1YG2 A;  3S14 J;  1LFB A;  3GX4 X;  3L2R A;  2E5N A;  2XGE A;  2HQ5 A;  2HOE A;  2GIV A;  2VPR A;  2K3F A;  4ZYH A;  3ZQL A;  1V5F A;  2K9Q A;  5KAI C;  5ERI A;  2QVO A;  1ETK A;  4M6V A;  2P5L C;  2QQ8 A;  5H20 A;  5C3E J;  2HTS A;  3C3W A;  4HX7 A;  2M9H A;  1AA7 A;  1KGS A;  1RET A;  3CJR B;  1MMS A;  4AVP A;  2RNG A;  2RC4 A;  5BPI A;  2ZXJ A;  5H6R A;  3CLQ A;  3VOD A;  3Q5F A;  1FOK A;  4HOB A;  1T08 B;  1ZHF A;  3WTS C;  4JX6 A;  1XTA A;  4Q5S F;  3E6B A;  2M8E A;  4KN4 X;  1JTX A;  4F91 B;  1D8K A;  4NHJ A;  4L9T A;  5LHI A;  2VBW A;  4ENM A;  3KP7 A;  3MZH A;  2L7Z A;  1OKR A;  2PMZ N;  4ZTF A;  1XMK A;  2WAQ A;  3AG3 H;  4IOC F;  1BI2 A;  4RGX A;  4XRF A;  1P9Q C;  1HLV A;  2V7F A;  2XAS A;  4XNF A;  3SZP A;  2MLK A;  4YII A;  4A3D J;  3K1P A;  2RGV A;  1FNN A;  4YFK F;  4RAF A;  3AFH A;  1WRJ A;  4I09 A;  4C9Y A;  2A61 A;  2IGO A;  2HPI A;  2CO5 A;  5IT3 A;  4ITV A;  1MND A;  3E6D A;  2FJ1 A;  1X1B A;  4RAG A;  1AWC A;  4CYC A;  2VJJ A;  2EFQ A;  2P81 A;  4A0Y A;  2K02 A;  4P9F A;  4B47 A;  5KVR A;  3DBL B;  5EEH A;  3TO9 A;  1SFO J;  3GCM A;  2M87 A;  4XKW A;  4MIM A;  4CYC B;  4N0B A;  1W7P A;  1K78 A;  1FIP A;  2WV1 A;  2GOM A;  3F8M A;  2LR8 A;  1QHG A;  2ZSH B;  4NQW B;  4KIT B;  2VB6 A;  4XRM A;  2ZJP F;  3Q0V A;  4L5J A;  1FIA A;  1RKT A;  1D1B A;  1IRX A;  3GTL J;  2HU9 A;  2JUG A;  2HYJ A;  5K7Z A;  5FLV A;  1IJW C;  3K0L A;  3OYJ A;  4EJW A;  2OD5 A;  4HQM A;  3U21 A;  2STT A;  1ETX A;  3DBR B;  2M1B A;  4RB3 C;  3IRQ A;  3M7G A;  2XUB A;  3K4B A;  3TP0 A;  2LD5 A;  3KYC B;  5IT9 R;  1D1A A;  2R93 J;  1VQ4 I;  2UXN A;  4BE1 A;  4KYW A;  5B5E C;  4XRS A;  4HLX A;  3JRC A;  3CCR I;  3BR3 A;  2FD5 A;  3DCF A;  1TNT A;  3FIS A;  2DMU A;  5AON A;  5HOO A;  1WI9 A;  4UNO A;  3LQR A;  1Z7U A;  1HCR A;  4OIP F;  2STW A;  5K5O A;  1YHQ I;  2NRA C;  4RM2 A;  3P9K A;  2HDD A;  1BI0 A;  2OQG A;  4E7K A;  3GTM J;  1R49 A;  4R79 A;  3D0S A;  2VN2 A;  1X3U A;  1YIO A;  2NNY A;  3RKQ A;  3T0Y A;  2R7D A;  5CQE A;  2DI3 A;  3J7A Y;  3K1M A;  2BW3 B;  4ZYG A;  2JQ7 A;  5F04 A;  3GYH X;  1W5S A;  3KPH A;  1NHA A;  5FKN A;  3H9Q A;  2IS4 A;  2AQE A;  2CH0 A;  1OQY A;  1K6O A;  1A36 A;  1N78 A;  3S1Q J;  1OR7 C;  1XSD A;  2L01 A;  3ELK A;  1Y0U A;  2ME0 A;  3CJT B;  2P4W A;  2FBH A;  4I0A A;  4P9U A;  2UV1 A;  3QP6 A;  1A31 A;  2P8T A;  3KP5 A;  2BHZ A;  3BR1 A;  4I02 A;  4U7D A;  3ZQQ A;  4WXD A;  5EZH A;  4M3B A;  1KU3 A;  4E6K G;  2YX4 A;  2VON A;  3TKY A;  1I3A A;  1XMX A;  3SZG A;  1LB2 A;  1ZQ3 P;  4PDK A;  3KEY A;  4EM0 B;  2M8G X;  1MZB A;  4PCQ A;  3ZQG A;  1X58 A;  2DA1 A;  3ABK H;  2R7W A;  2GLO A;  4KIG A;  2ISZ A;  1XC5 A;  3ZRG A;  4IJA A;  3U2R A;  3ERM A;  5FKL A;  3JRI A;  1QRY A;  1TWF J;  3D5L A;  1B9M A;  5A2Q K;  1EH8 A;  2AXT C;  3MD2 A;  1I50 J;  1QQI A;  2MLG A;  3F6O A;  2MD0 A;  2GM4 A;  4UUT A;  3PO2 J;  3ULQ B;  9ANT A;  2OJE D;  1I6X A;  3K9T A;  5CVR A;  2X51 A;  4CCJ A;  3OYA A;  3E0J B;  4EJU A;  4A3C J;  4FET A;  3BR6 A;  3F0C A;  3VEP A;  4IHT A;  1XN7 A;  1BL0 A;  5KNL A;  3KLN A;  3RPU D;  2J5O A;  2CWE A;  2HFH A;  3GLX A;  3V4G A;  1USS A;  2G7U A;  1U3E M;  3ZGK A;  3H36 A;  4I7H A;  3ASN H;  3IKV A;  2W7N A;  3IL2 A;  1V5E A;  3UNG C;  4E7H A;  1X1P A;  2E2I J;  3RZD J;  2PQ8 A;  4BJ6 C;  2DPU A;  1DU0 A;  4UVB A;  5E17 F;  1RQ6 A;  3EET A;  1Z0X A;  4MLO A;  1W1W E;  3JTG A;  2UUZ A;  2ZME A;  1SFX A;  5BOX A;  2DYS H;  3BZC A;  5F0C A;  5E3N A;  1Y6I A;  3JRH A;  2WAE A;  3GFL A;  3OR1 C;  2V1D A;  3F8B A;  2H8W A;  3FK7 A;  3TW6 A;  1SFK A;  3L09 A;  3V8L A;  4BQA A;  2DK5 A;  4HYE A;  1FZP B;  1BOA A;  4BHC A;  2K40 A;  3A52 A;  1IUF A;  2CGP A;  3DV8 A;  3MZ8 A;  2OC6 A;  5DS9 A;  1J75 A;  2K5C A;  2EIK H;  2ELK A;  4XN3 A;  3TP3 A;  2VOO A;  1BJZ A;  3PQJ A;  1S7E A;  1LQ1 A;  3DU5 A;  3IV5 A;  1TL8 A;  4ZDL A;  3KP6 A;  4F7Z A;  1FSE A;  3OV8 A;  4X0G A;  5DD8 A;  2EH3 A;  4H0E A;  1U5T C;  1U78 A;  4U0V A;  4AC0 A;  4M3F A;  4M6Y A;  4DNC A;  2CRG A;  1WJB A;  2VXD A;  1RZ4 A;  5H2F C;  1MBK A;  1GUU A;  2G9W A;  1PDN C;  2R4G A;  3SEZ A;  1JUP A;  2Z33 A;  5J40 A;  3FHZ A;  1CGP A;  3BC8 A;  3HYI A;  4D1Q A;  4UV8 A;  2FNP A;  1ZH5 A;  4AIK A;  3E5U A;  4XOR A;  2LF7 A;  4XL9 A;  1JKR C;  2BGC A;  1HA8 A;  1X1D A;  1ZAO A;  1B1B A;  1XGO A;  1OCT C;  4HNU A;  1U8R A;  1H9T A;  3I59 A;  1GT0 C;  1XGN A;  4S0H B;  3C7J A;  4OMZ A;  5LD2 C;  2ZB9 A;  2HQN A;  2XB5 A;  5J3L A;  5CPR B;  3HRS A;  4OIR F;  3OL4 A;  1JT6 A;  1EA3 A;  2CSO A;  2L4A A;  3FXO A;  5J8F A;  1ZG5 A;  5BNG A;  5IOZ A;  5E3M A;  4G7Z F;  2E35 A;  3S16 J;  2NYX A;  5JFR A;  2XF5 A;  3BQY A;  4BAC A;  4XLN F;  4GYI A;  2LTP A;  1Y8R B;  3QAH A;  1IXC A;  1W5C C;  3LSJ A;  3NWT A;  3MZY A;  2JSC A;  4XLF A;  3PL8 A;  3KET A;  1XCV A;  2VIX A;  5D6F A;  2Z99 A;  2BVL A;  1Z9C A;  2JA7 J;  2PBI A;  1TQI A;  3ASO H;  1QZZ A;  2IGM A;  2LC2 A;  3H5N A;  2LLK A;  2E1M C;  4RBO A;  1WCM J;  4HX8 A;  2JA2 A;  2P6T A;  3V7R A;  1SMT A;  5F0F A;  1RR7 A;  1WPK A;  2DPD A;  4LD5 A;  4IRG A;  4HDV A;  3HRT A;  2O61 A;  5K1Y A;  1QO0 D;  3S15 J;  1WZ2 A;  4HG2 A;  3GZN B;  2W57 A;  2R7S A;  2E60 A;  4R1H A;  2CQQ A;  1UG2 A;  5IY5 H;  4EAT A;  3S3O A;  5HOD A;  3ZN1 A;  1U0J A;  1I1S A;  1AHD P;  2CFO A;  2IA0 A;  3QYF A;  2EB7 A;  1RRJ A;  1I5Z A;  3GTO J;  4XSX F;  1TQM A;  3S8P A;  2VBY A;  1WI3 A;  2BOL A;  4Q47 A;  4BXF A;  3ROU A;  2X6Y A;  4JOM A;  4DYC A;  4RB0 A;  4ESJ A;  2FMY A;  3DBH B;  3QPT A;  1O7F A;  1IN4 A;  2H1L A;  3ZXS A;  3VYT B;  2FQ4 A;  3CO7 C;  5TRD A;  2LSO A;  3DEE A;  3CP2 A;  3PNV A;  1IG7 A;  3C18 A;  2D1H A;  2K85 A;  2NVY J;  4BU2 A;  5FLX R;  5GTH C;  3NAR A;  1UJ8 A;  1Q1H A;  2I5U A;  4BE0 A;  2DT7 B;  1W7P D;  3QPS A;  3FMQ A;  2JN6 A;  1JUS A;  4D9J A;  2QLZ A;  4CXF A;  4OIO F;  2XSD C;  1FSH A;  3RPQ A;  1SAX A;  3L2Q A;  2WAF A;  2EK5 A;  2X4H A;  1G59 A;  3U1K A;  2R7Q A;  3JSO A;  3MMY B;  1QU3 A;  1S8N A;  5L3D A;  5FRN A;  4LFU A;  1MJ9 A;  3ZQC A;  5F08 A;  4PUS A;  3DFG A;  1P4W A;  1JTY A;  3KP4 A;  3DU6 A;  3KYD B;  2IS2 A;  5L3C A;  2KRC A;  2FOW A;  3J80 Z;  1K79 A;  1IW7 F;  3I0T A;  3PSI A;  5JVT A;  1G6N A;  2DAO A;  2ECB A;  2ZXH A;  4BHP A;  3EUH C;  1O57 A;  4BYY A;  3QYB A;  1KQ0 A;  3SZT A;  2IPQ X;  1B6A A;  2ADU A;  4UUS B;  2AXL A;  5F1J A;  2EA2 A;  4BBR J;  1HW2 A;  3R4K A;  3CUQ C;  3CF2 A;  4ZC3 A; 
#chains in the Genus database with same CATH homology
 2OAZ A;  2PN6 A;  3FF5 A;  1KU2 A;  1TLH B;  2A3S A;  3I54 A;  1PP8 F;  4CGZ A;  1DP7 P;  1SMY F;  2NS0 A;  4YFN F;  3TO6 A;  2XAQ A;  1FYK A;  5DUI A;  4I0B A;  4OIN F;  3QRF F;  3H3U A;  4LLL A;  3WTW C;  4AIH A;  3FWE A;  2FNA A;  1S6L A;  3RIR A;  3K2Z A;  4RS8 A;  4G7O F;  2H94 A;  1F4K A;  3PQK A;  3IKT A;  4EM2 A;  3IWF A;  2K4J A;  2P5K A;  1HKQ A;  5ICG A;  1UCR A;  1B59 A;  4JQF A;  5LHH A;  3OOP A;  2IRF G;  2DBB A;  3ECO A;  2KIF A;  2UWM A;  3GO5 A;  1ZN2 A;  1F1Z A;  2FSW A;  2XAH A;  2HYF A;  1F9N A;  4IVN A;  4EJO A;  4EGZ A;  3FXR A;  3GF2 A;  3HSR A;  4MQV A;  2ZCW A;  3TOB A;  1P4X A;  2YPR A;  5FD5 A;  3DPL C;  1R58 A;  2MH2 A;  4FX0 A;  3Q9S A;  4UVA A;  2O6G E;  4LLG F;  3T5X A;  3WE3 A;  2P7V B;  5BMZ A;  1ZRD A;  2M45 A;  2VBX A;  4KIF A;  4EJV A;  4O6J A;  5FFZ A;  4ETS A;  1JGS A;  1I27 A;  2ISY A;  1QNT A;  5LGT A;  2XAF A;  5E8I A;  2GA1 A;  4HF2 A;  1Z6T A;  3IC7 A;  3V7S A;  2ACJ A;  3FM5 A;  4G7H F;  4L0Y B;  3IHU A;  3COA C;  2VT2 A;  4CDG A;  3HTS B;  1JHH A;  2Z3Y A;  3REO A;  3GFI A;  2F5C A;  1S7O A;  4G94 A;  4KMU X;  2FBI A;  2EA4 A;  2PG4 A;  3LST A;  5E1W A;  4PZJ A;  1W5T A;  5D6E A;  3E6C C;  4ZZD A;  1IRG A;  4S05 A;  3IRR A;  1HW5 A;  4EQQ A;  4BXU A;  1JXS A;  5K5R A;  3VFZ A;  5FD6 A;  2PMH A;  3EDP A;  3CO6 C;  2DO7 A;  1DPU A;  1WWX A;  4WXC A;  3GVA A;  4O5V A;  4RGU A;  4KNY A;  4A6D A;  2IA2 A;  4XSZ F;  4G6D A;  4L9J A;  2HDC A;  4IRI A;  1XCB A;  2RDP A;  3I53 A;  4N9I A;  4Z2Y A;  2HGC A;  3P7N A;  1O7L A;  4YFX F;  3H3Z A;  5CLS A;  5E8G A;  1U2W A;  1S3J A;  3NEU A;  2F5D A;  5L3F A;  1FLI A;  2O3F A;  3B73 A;  1U5T B;  1SD4 A;  1EV7 A;  2FRH A;  3R0J A;  3CJN A;  4KUM A;  2VE9 A;  1MDM B;  2QZ8 A;  1V3F A;  5L3B A;  2LKP A;  1KQ9 A;  1TW3 A;  4RAY A;  3KFW X;  2V1X A;  2OU2 A;  1QBJ A;  3ISP A;  5TJJ A;  1BI1 A;  3DPT A;  5DCF A;  1R23 A;  2JPB A;  2XRO A;  5L3G A;  2ZJ2 A;  2YX7 A;  2OZU A;  3RYR A;  4G8X A;  5FGM A;  1XB4 A;  3EQL F;  4BHB A;  3HSF A;  1KU9 A;  2F5F A;  2FF4 A;  2H09 A;  3RDI A;  3I5U A;  4IRH A;  2DFI A;  1XD7 A;  3N4M A;  2G7H A;  4A0X A;  2B0L A;  4HAM A;  2WV0 A;  1R36 A;  4A2U A;  4LK1 F;  1CF7 B;  2CYY A;  1OPC A;  4MGR A;  5LHG A;  1TBX A;  4M6X A;  2JZY A;  3FZV A;  4YIF A;  5D5W B;  4G9Y A;  3RI4 A;  5IT9 Z;  1E2X A;  4CHU A;  3E97 A;  3KP3 A;  2KJB A;  2FBK A;  1S29 A;  5BS6 A;  2DK8 A;  5E20 A;  1C0W A;  5DCM B;  5LEK A;  4L5I A;  4UHT A;  1L3L A;  2PFB A;  3HHG A;  5E18 F;  1BJA A;  3F8C A;  1F5T A;  2EWN A;  2XKO A;  3HOT A;  4U7B A;  1R5H A;  1FC3 A;  4CO8 A;  3QU3 A;  2ZFW A;  1LEB A;  2FA5 A;  2HZT A;  3LA2 A;  2F2E A;  5CVU A;  4Y17 A;  1VTN C;  2EFW A;  4M72 A;  2XHK A;  4PGG A;  3P9C A;  2FML A;  4O3M A;  5DYM A;  2CW0 F;  2K27 A;  2BV6 A;  4FX4 A;  2A69 F;  4ZH4 F;  1I1G A;  2BEO A;  5HLG A;  4QLC U;  4K2E A;  1IXS B;  4MQ9 F;  2XVC A;  3RKW A;  1HSJ A;  3TDU C;  2A6E F;  1KU7 A;  5CVJ A;  2GXB A;  4XLP F;  2V6C A;  3CUQ B;  1TQP A;  1IAW A;  2ZME B;  2A5Y B;  3LQQ A;  3HUG A;  4WWC A;  1YW8 A;  4EGY A;  4E70 A;  4EVI A;  2XIG A;  1BIA A;  1STZ A;  3KP2 A;  1FY7 A;  1BIB A;  4XBF A;  3EYY A;  1LDK B;  4JK1 X;  2IVM A;  2GZW A;  4LJZ F;  3BRO A;  2GAU A;  3KZZ A;  1B9N A;  5F1R A;  3LAJ A;  1OYI A;  3GUD A;  2BYV E;  3TO7 A;  1ON1 A;  1RNL A;  3BY6 A;  1GXP A;  5LLQ A;  5D5V B;  1LEA A;  3GFJ A;  4IXA A;  3M9A A;  3O3K A;  5LRS A;  1G3T A;  4HA8 A;  1J59 A;  5J8C A;  4A6E A;  1XMA A;  3MQ0 A;  2QQ9 A;  2CFX A;  2AS5 F;  3ML6 A;  4ESF A;  2PJP A;  3V7C A;  2XV4 S;  3I71 A;  4BAY A;  3J7A O;  2DTR A;  1IRF A;  1TNS A;  4BH9 A;  1OMI A;  3E5X A;  3K1N A;  2QQB A;  2NAZ A;  1UST A;  4HDU A;  3RKY A;  3WGG A;  1RIO H;  1BC8 C;  3EUH A;  3WU1 B;  4UV9 A;  2VE8 A;  4I2O A;  2L54 A;  5ED4 A;  3T8R A;  3MEX A;  5E1Z B;  5D4S A;  2J5P A;  3BJO A;  3RKX A;  1HKS A;  1QGP A;  5HDN A;  4LB5 A;  2P6S A;  1QZY A;  5L3E A;  3ABT A;  4MNU A;  1GVJ A;  2Y48 A;  1K7A A;  3WTV C;  1YW9 A;  5J6X A;  3H92 A;  4P5O A;  3GXO A;  4UVC A;  1FP1 D;  3TOA A;  3IWZ A;  1P4A A;  2K7L A;  1IXR C;  2QM3 A;  1CF7 A;  3LFK A;  1FBQ A;  1XDS A;  1Z91 A;  4MTE A;  1ZG3 A;  3NRV A;  2VOP A;  4ON0 A;  3CLO A;  2GXG A;  1OYY A;  2PLY A;  2L3D A;  2NNN A;  4Y13 A;  4KN7 X;  1H0M A;  2Y75 A;  3JAM K;  1J5Y A;  3CTA A;  5KK1 A;  3FM3 A;  2IW5 A;  2HEO A;  1IN5 A;  3KZY A;  2EFP A;  3DEU A;  2KIM A;  5ILS A;  1ONV A;  1FPQ A;  3DKW A;  3ZP5 A;  3J81 K;  1IZ1 A;  3U9G A;  1IF1 A;  2HKX A;  1PUE E;  2E7X A;  4OU0 A;  5LBQ A;  1HKT A;  4LMY A;  2V1U A;  4M9Z A;  2DQR A;  4GYG A;  2IT0 A;  3QPH A;  4I98 B;  1O3T A;  2GQQ A;  1YS7 A;  2E1C A;  3P9I A;  1MKM A;  2K4B A;  5HLI A;  4I01 A;  3F23 A;  4B09 A;  4EMS A;  2QEN A;  3LA3 A;  4KMF A;  3WTZ A;  2EV5 A;  5F64 A;  2HYG D;  3BPV A;  4JBA A;  3ZMS A;  4KIC A;  3MAJ A;  3F8F A;  1UHW A;  5HS9 A;  5FB2 A;  4NB5 A;  1KYZ A;  3WE2 A;  1KQ8 A;  2DQL A;  5LRR A;  2YR2 A;  3JAM Z;  5LGU A;  1T6S A;  4B8X A;  2W25 A;  3FXQ A;  3HTU A;  3ZMU A;  3RJP A;  4LG0 B;  2WC2 A;  2KJC A;  5F6F A;  1SD5 A;  3T8T A;  4CYD A;  4AWX B;  3J80 K;  2XRN A;  1K78 B;  4HQE A;  3MFK A;  3NQO A;  3LAP A;  5DUK A;  2COM A;  1ZRC A;  3Q9V A;  2RVC A;  4UXN A;  4HZF A;  1LNW A;  3WGH A;  1RUN A;  1OYW A;  2L4M A;  4M9S A;  3BJ6 A;  4LB6 B;  1YLF A;  1A04 A;  2D2W A;  2FU4 A;  2DT5 A;  2V79 A;  1LJ9 A;  5BPD A;  5D5X B;  4AIJ A;  3N97 A;  1H9G A;  5E1X A;  1YYV A;  2Q8K A;  2RN7 A;  1YFH A;  2E1N A;  2RKH A;  4M9X A;  1R1T A;  5JHU A;  3KEQ A;  2MBF A;  4KFC A;  2W24 A;  3SHF A;  2YU3 A;  3U1D A;  3V8J A;  2DLL A;  4WCG A;  5D8L B;  1T2K A;  3WU0 A;  2O0Y A;  1R00 A;  4EM1 A;  2XAG A;  2LDU A;  4CIC A;  2OBP A;  4P55 A;  3L7W A;  5ICC A;  1D3Y A;  2KRF A;  4M74 A;  2HR3 A;  4M71 A;  1UB9 A;  4L18 B;  4A12 A;  1YTY A;  1HBX G;  5D5U B;  3R60 A;  5FLX K;  2JRT A;  5CYV A;  2EV0 A;  3S2W A;  1MJA A;  1IN7 A;  1G3Y A;  1REP C;  4HF1 A;  3DQV C;  1DUX C;  3BDD A;  3GW2 A;  4U0Y A;  1JHF A;  5LEJ A;  3L9F A;  1Z05 A;  1ZRE A;  4TV7 A;  2QYO A;  4UUV A;  3G73 A;  3ABU A;  1G3W A;  3RPU A;  3TGN A;  3BWG A;  1EH7 A;  2ZKZ A;  1FT9 A;  3WTT C;  4GGG A;  5HDG A;  1T39 A;  2Z5U A;  3BP8 A;  3BJA A;  2VXZ A;  4RGR A;  1RUO A;  3KCC A;  4RB2 C;  4MTD A;  3I59 B;  1WKM A;  3M1E A;  2P7C B;  5HS8 A;  1R7J A;  5AIP A;  1HST A;  2WWY A;  3VB2 A;  5DEQ A;  2R3S A;  3DF8 A;  1FX7 A;  4MEY F;  2YSR A;  3O2P E;  1J7K A;  3ZMD A;  4R8H A;  3T1B A;  4LLN A;  3ZMV A;  1HW1 A;  1GHC A;  1BBY A;  1G3S A;  5CVI A;  2LNB A;  4Y15 A;  1W7P B;  2ESH A;  1WSU A;  2KIU A;  1L0O C;  2W85 A;  1RI7 A;  3GZ6 A;  4ASN A;  6PAX A;  5HLH A;  1BI3 A;  4L9N A;  2L02 A;  2H6C A;  2ELH A;  3HRM A;  5DDG A;  1BM9 A;  1J0R A;  4N9H A;  1TTY A;  1ODD A;  2TDX A;  1O3S A;  3R6S A;  1R22 A;  4LK0 F;  3ZPL A;  1WQ2 A;  2V9V A;  1DDN A;  2JT1 A;  3M8E A;  3KLO A;  3R0A A;  1XSV A;  3HSE A;  1J9I A;  4GCV A;  1P92 A;  1SD6 A;  3ZQ7 A;  3O6B B;  3SXY A;  3FMR A;  3R61 A;  1FWZ A;  3ZMZ A;  3L2C A;  1Z1D A;  2FOK A;  1XSX A;  2ZNZ A;  2QBY B;  3ZMT A;  1D5V A;  4IHS A;  4OMY A;  2OQR A;  3GEZ A;  3SFZ A;  3FXU A;  3QP5 A;  4A5N A;  5DD4 A;  1MGT A;  2XKP A;  4HX4 A;  3K69 A;  2QWW A;  4KIB A;  2KKO A;  4M73 A;  5FFX A;  1HXD A;  2JTV A;  3W6K B;  2X0L A;  3WTY C;  5LGN A;  2FXA A;  4Q4Z F;  3LA7 A;  2D1V A;  3WG9 A;  2PEX A;  3ECH A;  4KDP A;  4RB1 A;  1ZLK A;  2H6B A;  3LWF A;  2WTE A;  1QPM A;  4HW0 A;  1ZRF A;  4EV0 A;  3J81 Z;  4HV5 A;  3EYI A;  2Y0M A;  3CUQ A;  2RNJ A;  3AAF A;  2Z9O A;  5HDK A;  4ENJ A;  1E17 A;  1UFM A;  3I58 A;  2MD5 A;  4GXO A;  5JR3 A;  1SD7 A;  1O3Q A;  1KYW A;  1IN8 A;  2O03 A;  3RTR A;  2VBZ A;  1W4M A;  2HQR A;  3BZ6 A;  1ZG1 A;  3CDH A;  3E5Q A;  1FBS A;  2EFN A;  3HOS A;  4YG2 F;  4WK8 F;  4HBL A;  1ZYR F;  2UZK A;  2M5W A;  2FE3 A;  1BC7 C;  1U5T A;  1R1U A;  3GFM A;  2LF8 A;  3KE2 A;  2EV6 A;  2MH9 A;  4ENK A;  1FP2 A;  3KEO A;  5A2Q Z;  4Q48 A;  3W6J B;  3MCZ A;  5ICE A;  2VC1 A;  5CJ9 A;  4MHG A;  2VOD A;  2RQP A;  1FYM A;  5ILU A;  1R5G A;  1JE8 A;  2HKO A;  4WXH A;  2R7F A;  3B02 A;  4P96 A;  4DQ2 A;  2FQ3 A;  5JI6 A;  3HRU A;  2IP2 A;  1TW2 A;  5D4R A;  2CG4 A;  2MC3 A;  1MJB A;  1YS6 A;  5FLX Z;  3E3V A;  4S04 A;  2QQA A;  3QU6 A;  2QUF A;  3CUO A;  4FT8 A;  2M30 A;  3V8K A;  2QBY A;  2D45 A;  3F3X A;  5ILV A;  1BN5 A;  2IJL A;  1O3R A;  4ZYD A;  1OR7 A;  4L9V A;  2XGX A;  4QWQ A;  2MA3 A;  4OOI A;  2JPC A;  2GWR A;  4ESB A;  2HWV A;  4EJT A;  4HLY A;  2C6Y A;  2P5V A;  3TDZ C;  5AIQ A;  2EJR A;  1HQC A;  2HS5 A;  1YW7 A;  4RGS A;  1XGS A;  3JW4 A;  3ZN0 A;  3GZ5 A;  1R1V A;  1FBU A;  2E7W A;  1B4A A;  2UXX A;  2ZO4 A;  3JTH A;  4WX9 A;  2ESN A;  4FHT A;  1EH6 A;  1FYL A;  5EEG A;  5FO5 A;  1XGM A;  1ZGJ A;  1SFU A;  4CZZ A;  1T98 A;  2RV8 A;  5K5Q A;  1P6R A;  5HVQ C;  2GA2 A;  4D0P A;  3F8N A;  3GWZ A;  3L00 A;  2DW4 A;  2ZNY A;  1XDU A;  2FEZ A;  1ON2 A;  3ERE D;  3BPX A;  4HV6 A;  4IF4 A;  5CVV A;  4ENN A;  3JSP A;  3DXJ F;  1D8J A;  1LDJ A;  4NQW A;  4HF0 A;  1SFE A;  2PI0 A;  1DPR A;  3HHH A;  1AOY A;  3F72 A;  2PMU A;  1YQA A;  1MDM A;  5HS7 A;  1Z6R A;  2BE5 F;  3FX3 A;  1S7A A;  3I64 A;  2DU9 A;  1ZLJ A;  4G6Q A;  3F22 A;  5IT9 K;  3M8F A;  3MWM A;  5BQT A;  4U88 A;  1UHM A;  3WTX C;  2A6H F;  2VT3 A;  4IPA A;  1PP7 U;  3WOD F;  2K86 A;  5D8K B;  3E6M A;  1IUY A;  5ICF A;  4RAZ A;  4LG0 A;  2Q0O A;  4LGW A;  4L0Z B;  4KA4 A;  2CQK A;  5H6Q A;  1J2X A;  1ULY A;  4WF2 A;  1G4D A;  2F5E A;  1ZGA A;  2A68 F;  2XAJ A;  4OIQ F;  1LDD A;  1MD0 A;  2A07 F;  4KT5 C;  2ZBK A;  2OA4 A;  3I4P A;  1T38 A;  2IA1 A;  4BNC A;  2HTJ A;  3BOQ A;  4ZZL A;  3WGI A;  2ETH A;  2Q2E A;  5DCM A;  2BBY A;  3G3Z A;  5DV5 A;  1GXQ A;  2O8X A;  3QOP A;  4A5M A;  3HIF A;  2H27 A;  4U0W A;  1P2F A;  2OZ6 A;  1IN6 A;  3PFI A;  4PGH A;  3FMS A;  4ZYE A;  3F21 A;  3VOE A;  3TQN A;  1V4R A;  3RYP A;  3C1D A;  1LVA A;  4A0Z A;  1T0F A;  2VC0 A;  4AD9 A;  3WTU C;  1YO5 C;  1KA8 A;  4GO1 A;  3F6V A;  2EFO A;  4MEX F;  2W84 A;  3DP7 A;  3SQN A;  1U6G A;  1ZAR A;  1YG2 A;  3GX4 X;  2HOE A;  2GIV A;  4ZYH A;  5ERI A;  2QVO A;  2P5L C;  5H20 A;  2HTS A;  3C3W A;  4HX7 A;  1KGS A;  4AVP A;  2RC4 A;  5BPI A;  2ZXJ A;  5H6R A;  3VOD A;  3Q5F A;  1FOK A;  4HOB A;  1ZHF A;  3WTS C;  4Q5S F;  3E6B A;  2M8E A;  4KN4 X;  1D8K A;  4NHJ A;  4L9T A;  5LHI A;  2VBW A;  4ENM A;  3KP7 A;  3MZH A;  1OKR A;  1XMK A;  1BI2 A;  4RGX A;  4XRF A;  2XAS A;  3SZP A;  2MLK A;  4YII A;  3K1P A;  2RGV A;  1FNN A;  4YFK F;  1WRJ A;  4I09 A;  2A61 A;  2CO5 A;  5IT3 A;  3E6D A;  1AWC A;  2EFQ A;  4A0Y A;  2K02 A;  4P9F A;  5KVR A;  5EEH A;  3TO9 A;  2M87 A;  4N0B A;  1W7P A;  1K78 A;  3F8M A;  4L5J A;  3K0L A;  4EJW A;  2OD5 A;  4HQM A;  2STT A;  2M1B A;  4RB3 C;  3IRQ A;  3M7G A;  2XUB A;  2UXN A;  4KYW A;  4HLX A;  1TNT A;  5AON A;  5HOO A;  1WI9 A;  4UNO A;  3LQR A;  1Z7U A;  4OIP F;  2STW A;  5K5O A;  2NRA C;  3P9K A;  1BI0 A;  2OQG A;  4R79 A;  3D0S A;  2VN2 A;  1X3U A;  1YIO A;  2NNY A;  3T0Y A;  2R7D A;  2DI3 A;  3K1M A;  4ZYG A;  3GYH X;  1W5S A;  1NHA A;  1K6O A;  1XSD A;  2L01 A;  3ELK A;  1Y0U A;  2P4W A;  2FBH A;  4I0A A;  4P9U A;  3QP6 A;  2P8T A;  3KP5 A;  4I02 A;  4U7D A;  4WXD A;  1KU3 A;  2YX4 A;  2VON A;  3TKY A;  1LB2 A;  4PDK A;  4EM0 B;  1MZB A;  4PCQ A;  4KIG A;  2ISZ A;  4IJA A;  3U2R A;  3D5L A;  1B9M A;  5A2Q K;  1EH8 A;  1QQI A;  2MLG A;  3F6O A;  3ULQ B;  1I6X A;  3K9T A;  5CVR A;  4EJU A;  3VEP A;  4IHT A;  1XN7 A;  3KLN A;  2J5O A;  2CWE A;  2HFH A;  3GLX A;  3V4G A;  1USS A;  2G7U A;  1U3E M;  4I7H A;  3IKV A;  3IL2 A;  2PQ8 A;  2DPU A;  4UVB A;  5E17 F;  3EET A;  3JTG A;  2ZME A;  1SFX A;  5BOX A;  3GFL A;  2V1D A;  3F8B A;  3L09 A;  3V8L A;  4BQA A;  2DK5 A;  4HYE A;  1FZP B;  1BOA A;  4BHC A;  2CGP A;  3DV8 A;  1J75 A;  2VOO A;  3PQJ A;  1LQ1 A;  3KP6 A;  4F7Z A;  1FSE A;  3OV8 A;  5DD8 A;  4H0E A;  1U5T C;  1U78 A;  4U0V A;  4M6Y A;  4DNC A;  1RZ4 A;  2G9W A;  1PDN C;  2Z33 A;  3FHZ A;  1CGP A;  3HYI A;  4UV8 A;  2FNP A;  1ZH5 A;  4AIK A;  3E5U A;  2LF7 A;  2BGC A;  1ZAO A;  1B1B A;  1XGO A;  1U8R A;  1H9T A;  3I59 A;  1XGN A;  3C7J A;  4OMZ A;  2HQN A;  3HRS A;  4OIR F;  2CSO A;  2L4A A;  5J8F A;  1ZG5 A;  4G7Z F;  2NYX A;  5JFR A;  4XLN F;  4GYI A;  3QAH A;  1IXC A;  3MZY A;  2JSC A;  3KET A;  1XCV A;  5D6F A;  2Z99 A;  1Z9C A;  2PBI A;  1TQI A;  1QZZ A;  4HX8 A;  2P6T A;  3V7R A;  1SMT A;  2DPD A;  4LD5 A;  4IRG A;  4HDV A;  3HRT A;  2O61 A;  5K1Y A;  1QO0 D;  2W57 A;  4R1H A;  3ZN1 A;  1I1S A;  2IA0 A;  2EB7 A;  1I5Z A;  4XSX F;  1TQM A;  2VBY A;  4Q47 A;  3ROU A;  4RB0 A;  4ESJ A;  2FMY A;  3QPT A;  1O7F A;  1IN4 A;  5TRD A;  3CO7 C;  2LSO A;  3C18 A;  2D1H A;  1Q1H A;  1W7P D;  3FMQ A;  2QLZ A;  4CXF A;  4OIO F;  1FSH A;  3RPQ A;  1SAX A;  2EK5 A;  2X4H A;  3JSO A;  1S8N A;  5L3D A;  4LFU A;  1MJ9 A;  3DFG A;  1P4W A;  3KP4 A;  5L3C A;  3J80 Z;  1K79 A;  1IW7 F;  3I0T A;  5JVT A;  1G6N A;  2DAO A;  4BHP A;  1O57 A;  4BYY A;  1KQ0 A;  3SZT A;  2IPQ X;  1B6A A;  2ADU A;  2AXL A;  2EA2 A;  1HW2 A;  3R4K A;  3CUQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...