2EV5A

Bacillus subtilis manganese transport regulator (mntr) bound to calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
136
structure length
132
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 54
structure length 132
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev5A02
4A5MA 1F1ZA 2ZNYA 4HF2A 2EFNA 4A6DA 1RNLA 1R5HA 4R79A 1LEBA 3V7SA 3K1PA 4CZZA 3FWEA 5L3DA 3L00A 1IN6A 4M6YA 1HKQA 1KGSA 5HDNA 2FMYA 1HW2A 2XV4S 5ICGA 4WCGA 2GA1A 3SHFA 5FLXZ 1U5TC 1HKTA 3J7AO 2IA1A 1HBXG 4NQWA 2TDXA 3F23A 4G6DA 2VBWA 3IC7A 3WTTC 2ESHA 3D5LA 5D6EA 4L9JA 1I6XA 1R00A 2FBKA 3BY6A 3BROA 1Z7UA 3E6BA 2HGCA 2VE9A 1PP7U 1YS6A 2FU4A 3JAMZ 3SFZA 1E2XA 2EB7A 5L3FA 3I0TA 1R22A 3I58A 4ESBA 3HYIA 3VOEA 3CUOA 5HDGA 4FHTA 4RAZA 4LG0B 2FNPA 4I98B 2CW0F 1IZ1A 4HF0A 1OPCA 1S3JA 2YPRA 1JGSA 3HIFA 1W5SA 1J75A 4UVBA 4FX4A 1OYWA 2BBYA 3Q9VA 2E7XA 2VBXA 2HQRA 1DPUA 2ZKZA 3QP5A 5FO5A 2XAFA 3WU0A 3BPVA 3R6SA 2K4JA 3K0LA 3W6KB 4EJTA 3VODA 4UHTA 2FOKA 5LHIA 2GIVA 3SQNA 3KP6A 3MZYA 3NEUA 4ENMA 4FX0A 1ZRFA 1EH7A 3CUQB 2KJBA 2PQ8A 3TOBA 1RI7A 2EJRA 1QO0D 5ERIA 3ZMSA 1XMAA 1YW9A 1KU2A 2P5VA 1XDUA 1Z1DA 2IJLA 1GVJA 3WGHA 5DV5A 3TO9A 2NS0A 3RIRA 4EJOA 2DTRA 4RS8A 3QPHA 3RYRA 3COAC 2VN2A 2A3SA 4LGWA 1GHCA 1G4DA 3DP7A 4OMYA 3DFGA 3SZPA 3FZVA 2STWA 2BGCA 5H6QA 1USTA 1BIAA 2MH2A 2HZTA 1KQ8A 1V3FA 2P5LC 2VONA 3KLNA 2XAJA 5LEKA 3WTSC 3WU1B 4M73A 3DQVC 5AONA 2E1CA 4YIIA 5E18F 2L01A 3OV8A 2X4HA 2IW5A 5BOXA 1QPMA 2M8EA 5F64A 1L0OC 1U5TA 3HRUA 2DQRA 1IN8A 2EFPA 2FBHA 2FSWA 2XHKA 2NRAC 2PLYA 4L18B 4WXDA 2Y0MA 2P7CB 1B6AA 2AS5F 4WK8F 4EMSA 4KMFA 4KICA 4L9VA 4XRFA 4KDPA 4AIJA 1XGMA 2MD5A 4KIGA 2O3FA 3MZHA 2HWVA 4GGGA 3CUQC 4MQ9F 3MAJA 3ZMVA 3ZMZA 3E5UA 2XROA 1K6OA 4BHBA 5DCMA 5L3CA 5LGNA 4EJVA 1RZ4A 3HSRA 3VFZA 2A07F 1KU3A 5KVRA 2EV5A 3E6CC 3FM5A 1Z91A 3IWZA 2RDPA 3TGNA 1R58A 4HYEA 3F6OA 5E8GA 3T0YA 1YTYA 3W6JB 2M45A 4ZZDA 1OMIA 1FP2A 3WTYC 4HV6A 5HVQC 2P5KA 2W57A 2QZ8A 2EA2A 3JSOA 4I01A 3HTSB 4GXOA 1JHHA 1IXCA 5TJJA 2BEOA 1IAWA 3Q5FA 5HS9A 5ICCA 4BHCA 4OIRF 3EYIA 1K78B 3LSTA 2QQAA 3GFMA 2XGXA 4XSXF 1U3EM 2PI0A 1UB9A 1R23A 3K1MA 4AVPA 4Q47A 4EM1A 5L3EA 2CYYA 1IN4A 3WTXC 3DEUA 3M1EA 1DDNA 5CLSA 2HDCA 4Y17A 2RGVA 5LRSA 4IHTA 3TO6A 3LA7A 4I2OA 5HLIA 1PUEE 3F8BA 2O03A 3E6DA 1XN7A 5D5UB 1BI0A 1J0RA 5D6FA 2A6HF 2EFWA 3I64A 1B1BA 2V6CA 4HLYA 2F2EA 1FP1D 2NNNA 2JPCA 1Z05A 1K79A 4ZYEA 1FBUA 5K5OA 2ISZA 2DT5A 3E6MA 2FEZA 1W7PD 5JI6A 4D0PA 3EQLF 1T38A 2L4AA 2ISYA 5LBQA 5JVTA 4EGZA 2OBPA 3M9AA 4LFUA 1BOAA 4RGUA 1HSJA 1V4RA 2FQ3A 1P92A 3KEQA 3TOAA 2R7DA 4HBLA 2COMA 1WQ2A 4JBAA 4U0YA 3QU3A 1BC8C 2RNJA 4G9YA 1F9NA 4P9FA 4TV7A 4EV0A 5CVIA 3L7WA 2K7LA 2HOEA 5LRRA 4P9UA 4BQAA 3F8CA 1TLHB 1AWCA 2CQKA 1SMTA 3GYHX 5DEQA 1ZN2A 2MBFA 1JXSA 3DXJF 5JR3A 2ETHA 3P9IA 1FBQA 5D5XB 5EEHA 2FNAA 4QLCU 2EK5A 1U6GA 5E1ZB 3CDHA 3ERED 4MNUA 3ISPA 1O3RA 3BPXA 3CUQA 2R7FA 4HX8A 4XLNF 2LKPA 4CYDA 2QVOA 1SAXA 5DCFA 4HZFA 3H92A 4ESFA 4RAYA 1FY7A 4EM0B 1U5TB 3TDZC 2OQRA 3TO7A 2VC0A 2DI3A 4RGXA 2GWRA 1TNTA 2DO7A 3F3XA 4EQQA 3GVAA 3FXUA 3VEPA 4ENJA 1RUOA 3RYPA 1OKRA 2YSRA 2OA4A 2ELHA 2W85A 2H27A 2FRHA 1XSVA 4LLLA 5L3GA 1G3YA 2K02A 5IT3A 1XSXA 3ULQB 1KU9A 5DCMB 1O3QA 1T6SA 1S6LA 3FHZA 2XAQA 3BZ6A 4EM2A 2FBIA 1H9GA 2VOOA 3HRSA 2OZ6A 1YW7A 2GZWA 1I5ZA 3E97A 4L9TA 4G7ZF 4HQMA 2O0YA 2FMLA 3BJAA 2RV8A 1JE8A 3R60A 4P96A 3GX4X 3HHHA 2F5DA 3B73A 4S05A 1B59A 3PQJA 2XAGA 1FBSA 4EJWA 2WWYA 4ZH4F 3KP4A 2CO5A 3C7JA 1W4MA 5CVUA 2IP2A 1ZREA 2Y48A 2A69F 1FC3A 5HS8A 1FYMA 1J5YA 3E3VA 2GAUA 3DV8A 4LB5A 1UHMA 4L9NA 5LGUA 5DD8A 1WWXA 2L02A 2HFHA 4ESJA 3ELKA 4AD9A 3AAFA 3HTUA 2ZCWA 2J5OA 3SZTA 4RB3C 5LGTA 5FB2A 5HS7A 1W5TA 4G6QA 1UFMA 5HOOA 3E5XA 1ZG3A 1K78A 2MH9A 1O57A 3TQNA 1J2XA 4ENNA 4LK0F 1PDNC 4IRGA 4MEYF 2QBYA 4UVAA 3IRRA 4A12A 4H0EA 2H6CA 2VC1A 5K5QA 2HYFA 1R5GA 2XRNA 3ZP5A 2JRTA 1ZARA 2P7VB 1ZLKA 2ACJA 4L0ZB 2VOPA 4YG2F 3T8TA 2Z5UA 5E20A 1IXSB 4ZZLA 4U0WA 1BN5A 2CFXA 5ILVA 3GO5A 4UV8A 2QWWA 3U2RA 2F5CA 3LQRA 2DK8A 5KK1A 3FM3A 3WTWC 1EH8A 1SD7A 2JZYA 5FD6A 4RGSA 2OD5A 3JSPA 4LK1F 1AOYA 4HAMA 5ILUA 2LSOA 1SFEA 3GW2A 4IVNA 3ZPLA 2IRFG 2EWNA 1LB2A 2DU9A 1KQ9A 3RTRA 3V7RA 2M5WA 2EFQA 1FYLA 1ULYA 3FX3A 2M87A 1R1TA 2A6EF 2Q8KA 5F6FA 2STTA 1O3TA 1I1GA 5J8FA 5D8LB 2IA0A 2R3SA 4M6XA 3J81K 3KP2A 3ZMTA 2RQPA 1YYVA 3TKYA 3GFJA 1XD7A 4KNYA 4KYWA 5D4SA 4WXCA 1MGTA 5BPIA 2Z9OA 3ZN1A 3GFLA 2KRFA 3T1BA 1EV7A 3QPTA 3GXOA 1SMYF 1TW3A 1UCRA 2ZJ2A 1KQ0A 5CVRA 5D5VB 1IRGA 1T0FA 5F1RA 1YG2A 1K7AA 3C1DA 1P4WA 4DNCA 2KIUA 3WE3A 3LA2A 2XASA 2PMUA 3EYYA 2XAHA 1WSUA 3LA3A 3RPUA 1BIBA 3ZQ7A 3LFKA 2GXGA 3ABTA 2LDUA 1FNNA 3WG9A 3QOPA 3QAHA 4KN7X 2HKOA 2VBYA 4AWXB 1KYZA 3CO6C 5AIPA 2ZXJA 3HUGA 3RKYA 2KJCA 1IF1A 4AIKA 3V8KA 4HW0A 4OIPF 4ZYHA 2GA2A 1T39A 1E17A 4P55A 1IRFA 3R0JA 3IWFA 4P5OA 5JHUA 1Z6RA 5BPDA 3DKWA 4L5JA 5BS6A 2ZBKA 4CICA 2P4WA 4ENKA 1YW8A 2OAZA 2ZMEB 3M7GA 5D4RA 1T2KA 3PQKA 4HF1A 1F4KA 5LLQA 4LD5A 2L54A 3QU6A 2AXLA 1XGOA 3ML6A 3WGGA 2CG4A 1I27A 1FWZA 4Y15A 2IPQX 3VB2A 3E5QA 2QBYB 3WTUC 2BV6A 4XSZF 4L0YB 1HXDA 4ON0A 1D8KA 4M9XA 4KN4X 2HYGD 1MJAA 1LEAA 4KT5C 2OZUA 2GQQA 1QQIA 4MTDA 5K1YA 2NAZA 5DYMA 3ECHA 1QZZA 1QZYA 2P8TA 4R8HA 1C0WA 1BI1A 1EH6A 3LQQA 2EA4A 3F22A 4GCVA 3HSEA 4UXNA 3J80Z 2QQBA 3GFIA 4RB0A 4LLNA 3SXYA 4M71A 2WC2A 3JW4A 1D3YA 3K9TA 2FA5A 5LHGA 3I59A 4Z2YA 3G73A 5FD5A 4IXAA 4OOIA 4O6JA 4B09A 4HX7A 2G7HA 4M72A 1STZA 3JTHA 3HSFA 2D1HA 2VT3A 1SD4A 4Q4ZF 1A04A 1TQMA 2FF4A 2QLZA 1YS7A 5J8CA 1IW7F 3OOPA 3GF2A 3FF5A 1XB4A 5IT9Z 5A2QK 2K86A 5CVVA 3KCCA 1J59A 3M8EA 4WX9A 4YFKF 2J5PA 2Q0OA 2MC3A 4G8XA 3KEOA 1MKMA 2YU3A 2NNYA 3MQ0A 4ASNA 4BYYA 1KA8A 2D2WA 1MDMB 3ZMUA 2PN6A 1XCVA 3WTVC 3GWZA 2ESNA 2DPUA 2DFIA 4MGRA 4I02A 1P4AA 4HV5A 3T5XA 2P6SA 1IUYA 1FSHA 4HQEA 1YO5C 4HDVA 2PG4A 3V4GA 1XGSA 3I4PA 4A0ZA 1LJ9A 5CJ9A 3HOTA 3DPLC 5K5RA 1MJBA 4BNCA 4CO8A 3PFIA 5FGMA 1CGPA 2ADUA 1BI2A 3WE2A 1R7JA 1P2FA 2X0LA 2XVCA 3R4KA 3NRVA 2H09A 2D1VA 4QWQA 3F8FA 1ON2A 3MEXA 1H0MA 3RJPA 4JQFA 3Q9SA 4I0AA 3P7NA 3ZN0A 2ZNZA 3CTAA 4N0BA 4PZJA 2PBIA 1YFHA 1Z6TA 1FYKA 1FT9A 2LNBA 4LLGF 1ONVA 5DDGA 3KLOA 4GO1A 1QGPA 3F8NA 3HHGA 3DF8A 4BXUA 3DPTA 3CLOA 4G7HF 2XUBA 2VT2A 1ZHFA 1YQAA 4A5NA 2YX4A 1D5VA 4OINF 2RN7A 4KMUX 3BOQA 5CYVA 2HTSA 4RB2C 4IRIA 1FPQA 3I5UA 4B8XA 1LQ1A 4MTEA 3I54A 1S29A 2FE3A 4HLXA 1VTNC 2PFBA 2LF7A 3L2CA 3CO7C 2DK5A 2G7UA 2DQLA 5L3BA 2GXBA 1HSTA 1U8RA 2A5YB 2BE5F 5FLXK 1USSA 4FT8A 3MWMA 1O3SA 3V8JA 1SD6A 1RUNA 4PGGA 4MQVA 2UXXA 5TRDA 1FLIA 3KETA 2QQ9A 2M30A 3ROUA 1CF7A 1O7FA 2EV0A 3D0SA 1GXPA 1P4XA 3H3UA 3C3WA 3M8FA 4CGZA 3JAMK 5BMZA 2RVCA 2A68F 2Y75A 1BJAA 2UWMA 1LDDA 2L3DA 2V1XA 5HLGA 2V1DA 3I59B 1G3WA 2HEOA 2ZMEA 4E70A 3IKTA 1XCBA 2IT0A 1WI9A 5E8IA 1ZRCA 1BI3A 4WXHA 5H20A 3WODF 5E1WA 1S7AA 2RC4A 1HW1A 1GXQA 3R0AA 1S8NA 4OIOF 3BDDA 4L5IA 2JPBA 5CVJA 3IKVA 2W25A 3HOSA 4A2UA 4GYGA 4CXFA 4U7DA 4RB1A 5J6XA 2HS5A 1FSEA 5ICFA 3MFKA 2JT1A 4LMYA 4OMZA 3EUHA 2H94A 1D8JA 2ZO4A 4KIBA 1Y0UA 1LVAA 2F5EA 3LAPA 4M9SA 3G3ZA 3V8LA 3ZMDA 1S7OA 2DAOA 2NYXA 1HW5A 5FFXA 2DLLA 5D8KB 2UXNA 3BP8A 3IHUA 2JSCA 2PMHA 5D5WB 4BH9A 2VODA 4R1HA 1IXRC 4G94A 1RIOH 1YLFA 1ODDA 3P9KA 2EV6A 6PAXA 1ZGAA 1MJ9A 4A0YA 2HTJA 4OIQF 2MA3A 2YX7A 3O3KA 3WTZA 4MHGA 1W7PB 2Q2EA 2H6BA 3B02A 3GZ5A 3FXRA 2QYOA 4ZYDA 2IVMA 3L09A 1L3LA 3REOA 2QM3A 4EGYA 5E1XA 1O7LA 4KA4A 1FZPB 4Y13A 4S04A 4HX4A 4UVCA 3CJNA 4UV9A 1MDMA 2RKHA 1B9NA 3QP6A 5BQTA 3RKWA 2XIGA 4LJZF 2W24A 3I71A 3KZZA 2O6GE 4EVIA 4I7HA 5HDKA 2Z3YA 2G9WA 1ZG1A 4UUVA 3ECOA 3J81Z 1OYIA 3ABUA 2E7WA 1TTYA 1BBYA 2UZKA 5E17F 2V79A 4A6EA 1ZLJA 1OR7A 2Z33A 4O5VA 1BM9A 3N4MA 3GLXA 1ZH5A 5DUKA 1XMKA 3GUDA 1MD0A 4PGHA 4KFCA 2P6TA 1SFUA 4I09A 2BYVE 4O3MA 2VBZA 2CSOA 2WTEA 3KZYA 1G3TA 2KKOA 1LDKB 2CGPA 3RKXA 3T8RA 4G7OF 4IPAA 4YFXF 1KYWA 1IN5A 2QUFA 2CWEA 4WWCA 2MLKA 1QBJA 4IF4A 3F72A 4PDKA 1CF7B 3K1NA 1H9TA 4CHUA 4IHSA 1WKMA 1OYYA 3KE2A 3RPQA 3C18A 1R1UA 5ED4A 4EJUA 4XBFA 4K2EA 1QNTA 3KP3A 2OQGA 2YR2A 5H6RA 1P6RA 3FMQA 1U78A 1UHWA 3V7CA 3GEZA 1ZAOA 4HOBA 2VXZA 1FOKA 4KIFA 5LEJA 3S2WA 2QENA 4RGRA 2PJPA 4KUMA 1JHFA 2F5FA 1ZYRF 4HA8A 2FXAA 1MZBA 1NHAA 4NB5A 2XKOA 3H3ZA 2HR3A 4LB6B 4YFNF 1WRJA 2PEXA 4N9IA 2KIMA 4PCQA 2JTVA 2D45A 3MCZA 4YIFA 1HKSA 3K69A 3KP7A 1F5TA 3J80K 1B9MA 2XKPA 3BJOA 3EDPA 3KP5A 3I53A 5HLHA 4IRHA 4M9ZA 1KU7A 1XSDA 2K27A 4ZYGA 4DQ2A 4UNOA 3LAJA 2WV0A 5AIQA 1YIOA 3JTGA 4OU0A 4A0XA 1IN7A 5LHHA 1R36A 2O61A 3TDUC 3EETA 3NQOA 1TNSA 4WF2A 1DP7P 2HKXA 3BWGA 1TQPA 4XLPF 5IT9K 4LG0A 4ETSA 3L9FA 2V9VA 3O6BB 1J9IA 1ZG5A 1DUXC 1FX7A 3KFWX 4HDUA 2C6YA 4Q5SF 4BHPA 2DW4A 4CDGA 2W84A 1J7KA 1T98A 4U0VA 1LNWA 1B4AA 3F21A 3FMSA 3U1DA 3HRTA 4AIHA 1Z9CA 3RDIA 2OU2A 3F8MA 5A2QZ 1ZRDA 3F6VA 3IL2A 2A61A 2M1BA 1TW2A 1G3SA 5ICEA 2LF8A 3O2PE 4BAYA 3RI4A 2DBBA 2VE8A 3QRFF 1ON1A 3U9GA 3FMRA 4Q48A 1HQCA 5EEGA 4F7ZA 1XDSA 3GZ6A 3BJ6A 5JFRA 4MEXF 1XGNA 1R1VA 4N9HA 1W7PA 1PP8F 1I1SA 3K2ZA 5FFZA 2KIFA 1DPRA 1G6NA 4I0BA 1ZGJA 4IJAA 5DUIA 4GYIA 4M74A 1Q1HA 3FXQA 2IA2A 3LWFA 2B0LA 3N97A 2V1UA 5DD4A 1LDJA 4U88A 2E1NA 4NHJA 2Z99A 4U7BA 3R61A 2L4MA 1U2WA 2DPDA 4JK1X 1SFXA 1TQIA 1SD5A 1X3UA 2EFOA 3WGIA 1TBXA 1REPC 2HQNA 3IRQA 3HRMA 3P9CA 2ZFWA 1BC7C 2MLGA 2O8XA 5ILSA 2K4BA
chains in the Genus database with same CATH superfamily
3HPGA 2Y0SA 4A5MA 1F1ZA 4DZJA 2ZNYA 1P7IA 4HF2A 2EFNA 4A6DA 3VSLA 2QF7A 2NVUB 1IJWC 1RNLA 4XL9A 1R5HA 4R79A 4MFDA 3DBHB 2M0MA 1BA5A 1LEBA 3AFHA 3V7SA 1JKRC 1R4MB 5FJ8J 4RAFA 3PFYA 4XNFA 2P81A 3K1PA 2D5VA 4UY8I 3AG4H 3FXJA 4CZZA 3FWEA 3FXOA 5L3DA 3L00A 4A3BJ 1XG1A 2IS4A 4EATA 3PL8A 2GLOA 1IN6A 2HVSA 1NG6A 4E7KA 4Z6YA 2ZXHA 3IP4B 4M6YA 1HKQA 1KGSA 3OIPA 5HDNA 2FMYA 3IAM2 1HW2A 2XV4S 2PJRA 5ICGA 3J7ZI 4WCGA 2GA1A 3DPUA 1ACIA 2ID6A 3SHFA 4RM2A 1MH3A 5FLXZ 1U5TC 2Y9ZA 1HKTA 4GFBA 3HJEA 3J7AO 2IA1A 1ITYA 4F93B 1HBXG 1WJCA 4AYBA 2IS6A 3DLLF 1R6RA 4NQWA 2TDXA 1ETQA 2CQ7A 3F23A 4G6DA 2VBWA 3IC7A 3WTTC 2ESHA 2K9NA 2ZXIA 3D5LA 4PUSA 5D6EA 4L9JA 3SDGA 3PJRA 2E1MC 3WU2C 4IQJA 1OCZH 2W7NA 1I6XA 1R00A 2FBKA 3BY6A 2FD5A 3TL4X 3BROA 2W82A 4V2FA 1Z7UA 3E6BA 2HGCA 2VE9A 1PP7U 1YS6A 2FU4A 1D5YA 3JAMZ 3HM5A 3SFZA 2DA6A 1MMSA 1E2XA 2KZGA 2EB7A 3G2BA 4F3QA 1APLC 3C2GA 2PMZA 5L3FA 3I0TA 1R22A 3I58A 4ESBA 3HYIA 3VOEA 1S7EA 4HNTA 3CUOA 1WJFA 5HDGA 1OCTC 3QQAA 4FHTA 2YS9A 4E7HA 4RAZA 4LG0B 2FNPA 4I98B 2R5ZB 4UUSA 1K4TA 2CW0F 1IZ1A 1RKTA 4HF0A 1OPCA 3A01B 4B3AA 4AIDA 1S3JA 3JCUC 2YPRA 1JGSA 3HIFA 1W5SA 2HOTA 1YJNI 1J75A 4UVBA 5GAEJ 4FX4A 1OYWA 4A3FJ 2E35A 2BBYA 3DKXA 3Q9VA 1T56A 2DA1A 3I3LA 4KT6A 2IXSA 4BQQA 2E7XA 5IP6A 2VBXA 3BR1A 3CJTB 1S5LC 5J47A 2HQRA 1DPUA 1Y0NA 3H9QA 2ZKZA 3QP5A 3S2DJ 5FO5A 2K85A 2VPLA 2XAFA 2BVMA 4IQ4A 4M3FA 3WU0A 2JA8J 2HZDA 2NOJB 2M4KA 3DEWA 3BPVA 3R6SA 3BCBA 2K4JA 1V5EA 2XSJC 3Q0UA 1WJDA 3QWLA 3SEQA 2QQ8A 1MBFA 3K0LA 1VQNI 3QYFA 2VKVA 1JT0A 3W6KB 4EJTA 3VODA 4UHTA 4RDUA 2FOKA 5LHIA 2GIVA 3SQNA 3KP6A 3MZYA 3NEUA 4E7SA 4ENMA 4FX0A 1ZGWA 3I4MJ 2E19A 3D5RC 1ZRFA 1EH7A 3CUQB 2KJBA 2PQ8A 3I56I 3TOBA 4QPOA 1R71A 1RI7A 2EJRA 1QO0D 4C2TA 1OFCX 1UJ8A 2MC4A 5ERIA 3ZMSA 1XMAA 1YW9A 2DDBA 1KU2A 2P5VA 4M3GA 3ABKH 1XDUA 1Z1DA 2IJLA 1X2NA 4XLHA 1GVJA 3VYUB 3WGHA 5DV5A 3BG6A 2HU9A 4PJMA 1ETVA 5JLWA 4S0HB 3TO9A 2NS0A 1MH4A 1PJRA 4IHVA 2LY2A 3QPSA 3RIRA 4EJOA 2DTRA 4RS8A 1NH3A 1MW7A 4CCJA 1YIJI 2EIJH 1VNDA 3QPHA 3RYRA 3COAC 2K3FA 2VN2A 2A3SA 4LGWA 1A6IA 1GHCA 3CCYA 1MMNA 2KPMA 1G4DA 4DOZA 3DP7A 4E7JA 3H5RA 4OMYA 3DFGA 3QYEA 3ZXSA 3SZPA 1JTXA 1WJEA 2MSYA 2OCCH 3FZVA 2STWA 1WH7A 4XMYA 2BGCA 5H6QA 1USTA 1BIAA 1HF0A 2M4GA 2MH2A 2I10A 2HZTA 2JSPA 4FASD 1KQ8A 2ECBA 1V3FA 3N05A 2P5LC 4AUXA 3KLNA 2XAJA 5LEKA 2VONA 5B1AH 3WTSC 3WU1B 4M73A 2E2HJ 1IUFA 3DQVC 5AONA 1X3WB 2E1CA 4YIIA 5FRNA 5E18F 2L01A 3OV8A 2LOOA 2ZFUA 4CCNA 2X4HA 1UHSA 2IW5A 1X2MA 3OYMA 5BOXA 1QPMA 3CLQA 1AKHA 4M3DA 2M8EA 1JJ8C 5F64A 1L0OC 1U5TA 2COBA 4BS9A 3HRUA 2MABA 3UR3C 3M3YJ 2DFFA 2DQRA 1TP4A 4D1QA 1IN8A 3BZKA 3HOZJ 2EFPA 2FBHA 2FSWA 2XHKA 2NRAC 2PLYA 4L18B 1GV5A 4WXDA 2Y0MA 2P7CB 1B6AA 4BBRJ 2AS5F 3A03A 4WK8F 4EMSA 2H8RA 4KMFA 3JRBA 4KICA 4L9VA 4CSWA 4XRFA 2V9KA 3CCQI 4KDPA 1H89C 3CP2A 4JOMA 4AIJA 4ZDPA 1XGMA 2MD5A 4KIGA 4NDLA 2O3FA 3MZHA 3DLAA 2HWVA 3C2BA 1GV2A 4GGGA 3CUQC 1CQTA 4MQ9F 1FOYA 3MAJA 5F1JA 2LVSA 3ZMVA 5F0HA 1X3ZB 4F52A 3ZMZA 3E5UA 4CCLA 2O9LA 2Z2SB 3OMYA 4XONA 1ZKGA 2XROA 1Y1WJ 1K6OA 1X1DA 4BHBA 1K61A 5DCMA 2DJIA 5L3CA 5LGNA 2M3AA 4EJVA 1RZ4A 3HPHA 3HSRA 3VFZA 1U9NA 3LL7A 5B1BH 1JKPC 2A07F 1KU3A 2LBFA 5KVRA 2EV5A 2E2JJ 3A4CA 3E6CC 2NVYJ 3FM5A 1Z91A 3IWZA 3K4CA 2RDPA 1I6HJ 2X1EA 2K40A 5JVGF 1T95A 4NQWB 2JQ7A 5EG0B 3HGYA 3TGNA 3KPHA 1R58A 4HYEA 3J81R 2VJIA 3F6OA 5E8GA 3T0YA 4D7MA 1YTYA 1OLTA 2CFOA 1FTZA 3W6JB 2M45A 4ZZDA 1OMIA 1FP2A 5E3MA 2HOSA 3WTYC 4C2UA 3M4OJ 4HV6A 5HVQC 3CCEI 2P5KA 3FBIB 3K10A 2W57A 1NTCA 1I3QJ 2QZ8A 2YUSA 4JX6A 2EA2A 3JSOA 2XAUA 1NG7A 3BTCA 4XLFA 4QSHA 4I01A 3GTGJ 2HPMA 3HTSB 4GXOA 1JHHA 1IXCA 4IL6C 5TJJA 2BEOA 1ENHA 1ETYA 1IAWA 1MBKA 3Q5FA 5HS9A 5ICCA 2IBDA 4BHCA 4OIRF 3EYIA 3GTOJ 1K78B 1X1AA 2JK3A 3LSTA 2QQAA 2WAFA 3GFMA 2XGXA 3VPRA 3TEDA 4XSXF 1MBGA 1U3EM 1RRJA 2PI0A 1UB9A 1P7JA 1R23A 3K1MA 4LIVA 2R7RA 4AVPA 3L1PA 2R7TA 4UUSB 2KDZA 2R93J 4Q47A 4EM1A 2CYYA 1IN4A 5L3EA 3WTXC 3DEUA 3M1EA 1DDNA 3OYDA 3ZR8X 1JUPA 5CLSA 2HDCA 3QPLA 4D5CA 4Y17A 3I4NJ 1UMQA 2RGVA 4ZDOA 5LRSA 4IHTA 4DYCA 3ESWB 3TO6A 3LA7A 1MBJA 2WADA 4I2OA 5HLIA 1PUEE 3DBRB 1W36D 3F8BA 2OV7A 2O03A 2E5NA 2CUJA 1UAAA 3E6DA 1XN7A 4UB8C 5D5UB 2V26A 1BI0A 1J0RA 2CW8A 5D6FA 2ME6A 2A6HF 2EFWA 3I64A 1B1BA 1FJLA 1LE8B 3MKWB 2DYSH 2V6CA 3IH3A 4HLYA 2F2EA 3OYNA 4A3JJ 1SC7A 2AHQA 4C30A 1FP1D 2NNNA 2JPCA 1T8IA 4CCOA 1Z05A 3AKZA 1K79A 4ZYEA 3PIOF 1FBUA 2FOWA 5K5OA 2ISZA 4XOPA 1F36A 2PX9A 2DT5A 1BL0A 4GDFA 1J09A 1H88C 1WVRA 2A5WA 3E6MA 2FEZA 1W7PD 5JI6A 3JRGA 4D0PA 2F48A 3K6GA 3EQLF 1IC8A 1T38A 2XF5A 2L4AA 2ISYA 5LBQA 2EZLA 1VI0A 5JVTA 4EGZA 5IP7J 2OBPA 3M9AA 4LFUA 1TT5B 1BOAA 4RGUA 1HSJA 1V4RA 3LSRA 2FQ3A 3CCLI 4LITA 1P92A 4J19A 3KEQA 4C3HJ 3TOAA 1OJLA 2R7DA 4HBLA 5F27A 2COMA 1WQ2A 2VQLA 2ECCA 4JBAA 4U0YA 3CJRB 3QU3A 1BC8C 2RNJA 4G9YA 1F9NA 4P9FA 1AA7A 4TV7A 4EV0A 3ERMA 3ZQCA 4AYBN 5CVIA 3K70C 3H0GJ 1P9QC 3L7WA 5LFAA 2XDVA 2K7LA 2XF6A 4B4CA 5M5XJ 2HOEA 2IAIA 4FE7A 5LRRA 3RQIA 4P9UA 4BQAA 3F8CA 3K4BA 3MKZA 1TLHB 5EZGA 1AWCA 1SFKA 2R0QC 3KX2A 2CQKA 2GOXB 1HOMA 1SMTA 4M3EA 3GYHX 3JRHA 5DEQA 3S3NA 1YJ9I 3S2HJ 2CRGA 1ZN2A 2MBFA 4RMNA 3DXJF 1JXSA 3DTIA 1VZ0A 1HDPA 5JR3A 2ETHA 3P9IA 3PUBA 4QPQA 1FBQA 3FDYA 5D5XB 2IGMA 5J4VA 5EEHA 2FNAA 2Y69H 3CCJI 4QLCU 2BOLA 2HXOA 1Q1VA 2EK5A 2L7ZA 4CYCA 5J1YA 1U6GA 3O8GA 5E1ZB 3CDHA 3MVPA 3ERED 4MNUA 2LTPA 3LSIA 3ISPA 1O3RA 3BPXA 3CUQA 1JJ6C 2R7FA 4HX8A 4XLNF 2N8GA 3LSJA 2LKPA 4CYDA 1LFUP 1XX5A 1WCMJ 2QVOA 3CC4I 2WA0A 1SAXA 2MD0A 5DCFA 4HZFA 4D5FA 4IHXA 1DGRM 1AKHB 3P5JA 1RESA 3H92A 5IOYA 4ESFA 4RAYA 1FY7A 4II2A 4EM0B 1U5TB 3TDZC 2OQRA 2R7OA 2LKXA 3TO7A 2VC0A 2DI3A 3S15J 2XGEA 4RGXA 2GWRA 1TNTA 2DO7A 2LYCA 3F3XA 4X1EA 4EQQA 5HNHA 3GVAA 3G1LA 2LC2A 1MMAA 3FXUA 3FHNA 4N4NB 3VEPA 4ENJA 1RUOA 2XF7A 3RYPA 1YOVB 4BL0B 2E1MB 3VYSB 1OKRA 2YSRA 2OA4A 2Y30A 2ELJA 1RKWA 2X1DA 4IEJA 2ELHA 2DT7B 1WGXA 3A1YA 2W85A 1X1PA 2GBYA 5HODA 4V2GA 2H27A 2FRHA 2X85A 3CF2A 1XSVA 4LLLA 2ME0A 2DJNA 3H5AA 2FUG2 4P1WA 1Y8QB 1WJ5A 5L3GA 3FIWA 3WHBA 2ZJQF 2Q1ZB 2WAEA 1G3YA 2K02A 5IT3A 1XSXA 3ULQB 3ZQGA 1KU9A 2X98A 5DCMB 5A2QR 2X6WA 1O3QA 2XRLA 5KAIC 5HNFA 2CS3A 1T6SA 4PSWA 4BDZA 1S6LA 3HXLA 2HVQA 2LBFB 3FHZA 2JA2A 2XAQA 2Z16A 3LSPA 3BZ6A 3NAUA 2WY7Q 4EM2A 2L5QA 2FBIA 2VQCA 1YJWI 3IV5A 2OPTA 3HDDA 2QGUA 1H9GA 3B6AA 2VOOA 1ZR2A 1EJ9A 3HRSA 2OZ6A 3AG3H 1YW7A 2GZWA 2V6EA 2HI3A 1I5ZA 3E97A 4L9TA 4G7ZF 1ETKA 2O0YA 4HQMA 2FMLA 3HOYJ 3LOCA 3U21A 1DU0A 3BJAA 2RV8A 1WHUA 3E0JB 3OYHA 1JE8A 2M0CA 3R60A 4P96A 3Q0WA 4I76A 3HHHA 5GAHJ 3GX4X 5BNGA 2F5DA 3B73A 4S05A 1X1BA 2DDAA 2XGCA 1PVEA 3JRFA 1B59A 3PQJA 3ZCOA 2XAGA 1FBSA 2ZC2A 4EJWA 2WWYA 2E36A 4ZH4F 2LD5A 2CV1A 1POGA 1XS9A 3E1SA 4G6TB 4GRIA 3TP3A 3KP4A 5M3FJ 2CO5A 1X19A 3C7JA 1W4MA 5CVUA 3OS1A 2IP2A 4FE4A 1ZREA 2MFZA 2Y48A 2A69F 2B63J 3JREA 1FC3A 1Z77A 5HS8A 1FYMA 3HKZN 1J5YA 2CMPA 1T0FC 3E3VA 3PSFA 5EG0A 1LUJB 2GAUA 4A3GJ 3DV8A 2ICWG 2L9VA 1QPIA 3BR5A 4LB5A 1UHMA 4L9NA 5LGUA 3BG7A 1PUFA 5J3LA 2GIZA 3GTMJ 2VJ5A 5DD8A 2HVRA 1ETOA 4H4KC 1G2HA 4BACA 1WWXA 2L02A 1GT0C 2HFHA 3BR3A 4ESJA 3ELKA 4AD9A 3AAFA 4Y33A 2OTLI 4DBRA 3HTUA 2LK2A 2ZCWA 4HSTA 1S72I 3ZQQA 2NVXJ 2J5OA 3SZTA 4RB3C 2M8GX 5LGTA 3PNYA 5FB2A 2OUMA 5HS7A 1W5TA 4G6QA 4XKVA 3ZGKA 5EJCA 5C44J 4NC6A 1UFMA 5HOOA 1MBHA 3E5XA 2W48A 1ZG3A 1K78A 2MH9A 1O57A 3AL0C 3IH2A 2E5ZA 3TQNA 1J2XA 3ZOBA 2K9LA 2P0TA 1N25A 4ENNA 3LFUA 3IUOA 2Y31A 1U8BA 2I8DA 2EPFA 5M5WJ 2CUFA 4RLQA 2L9RA 1W5CC 1IDZA 4LK0F 1UG0A 3S17J 2L7KA 3PUFA 1UZCA 1PDNC 3HBLA 4IRGA 4MEYF 5J40A 2QBYA 4XR6A 4UVAA 3IAS2 2KFDA 3FKJA 3IRRA 1DU6A 3F0CA 4A12A 3OL3A 1YI2I 4H0EA 2GM4A 2H6CA 2VC1A 5K5QA 2HYFA 1R5GA 2XRNA 1Z21A 3ZP5A 3DEEA 2JRTA 1ZARA 2P7VB 1ZLKA 1D0XA 4JX5A 2ACJA 3IH4A 3S3OA 4L0ZB 2VOPA 2W00A 4A3CJ 4YG2F 2EBIA 3T8TA 5FLXR 1LE8A 2Z5UA 5E20A 1IXSB 3VYRB 4ZZLA 2BHZA 4U0WA 3HOVJ 3S3MA 2XB0X 1BN5A 2CFXA 3MKLA 5KCMA 2OF7A 5ILVA 5E3OA 2VPRA 3GO5A 2IGKA 4UV8A 4CYCB 3JRCA 2QWWA 1TWGJ 2BY3A 3H35A 3U2RA 2F5CA 3LQRA 4ZYAA 1VQPI 3OIOA 2DK8A 4A93J 1YRNA 1IGNA 5KK1A 2K3PA 5EGOB 3FM3A 2VKEA 3WTWC 1EH8A 3OYLA 1NK3P 3OYBA 1SD7A 2JZYA 5FD6A 4IOAF 2OCEA 1OCOH 3TW6A 1DQUA 2OD5A 4RGSA 3JSPA 2E60A 4LK1F 1I3AA 3CMAI 5EDNA 1AOYA 4HAMA 3JAMR 4N4OB 2L9NA 5ILUA 4YRVA 2LSOA 2AXTC 2VJ4A 1SFEA 3GW2A 2CV0A 4IVNA 3ZPLA 3DTEA 3EUKL 2IRFG 2RNGA 2EWNA 1LB2A 5C3EJ 1A31A 2DU9A 1KQ9A 4RLFA 3RTRA 3V7RA 2M5WA 2KRHA 2M2EA 4C2MJ 2EFQA 3BR6A 1SAUA 3K7AJ 4A3MJ 1FYLA 1GVDA 1ULYA 2AO9A 3FX3A 2M87A 2XB5A 4PJNA 1R1TA 4E4HA 2L2OA 2A6EF 2L0KA 2DFEA 2Q8KA 1QU3A 5F6FA 2STTA 1RR8C 1O3TA 1I1GA 1U9OA 4E7IA 1VFCA 5J8FA 3UKGA 3SDBA 1XTAA 2DMPA 5D8LB 2IA0A 2R3SA 2VIXA 1GDTA 1HCRA 1LVKA 2NXNB 2MG4A 4M6XA 3CC7I 3J7YJ 3J81K 4RM3A 3KP2A 3ZMTA 1R5ID 2TCTA 3H9GA 2RQPA 2VXDA 5M5YJ 5TISC 4IO9F 3K4MA 2DA2A 4BJ6C 3ABMH 4E7LA 1YYVA 4ZTFA 3TKYA 1YHQI 2KISA 4E7ZA 3GFJA 1BR2A 1XD7A 4KNYA 3A0BC 4KYWA 5D4SA 2KQRA 3FXKA 4WXCA 1MGTA 3BG9A 5BPIA 3L2WA 2Z9OA 2VKHA 3GTKJ 2BXZA 3BR2A 3HKZA 3ZN1A 3NWSA 3GFLA 4DYRA 2KRFA 1WZ2A 3BQYA 1V55H 3T1BA 1EV7A 3QPTA 4J00A 3GXOA 1SMYF 5EF6A 3EUAA 1V5GA 1TW3A 5TGTA 1UCRA 4Y7NJ 2K9SA 2OJED 2ZJ2A 1G59A 1KQ0A 3UNGC 5CVRA 5D5VB 1X4OA 2VJJA 1IRGA 1T0FA 4KJZA 1VQ4I 5F1RA 1YG2A 1K7AA 3C1DA 1P4WA 3OY9A 2JWTA 4DNCA 1Y56A 2KIUA 3WE3A 1GLNA 3OYAA 3LA2A 3OWTA 5F08A 2R7VA 2XASA 2L7MP 3CJQB 2PMUA 5C4XJ 3EYYA 2XAHA 3KYDB 4XLAA 1WSUA 2IS2A 2EIMH 3LA3A 2ID3A 1SVOA 3RPUA 1BIBA 3ZQ7A 3DBLB 2QA4I 2LMDA 5GTHC 3LFKA 3OSGA 1FEXA 2GXGA 3ABTA 2R7UA 2LDUA 2LY1A 2QKMB 1FNNA 2F6CA 3WG9A 3QOPA 2XPVA 3QAHA 1I50J 4KN7X 2HKOA 1R9TJ 2JVHA 2VBYA 3PNVA 5H2FC 4AWXB 3ZQIA 1KYZA 3CO6C 5AIPA 2ZXJA 3Q3SA 3TP0A 2X48A 3HUGA 3RKYA 1BW5A 2KJCA 5EYRA 5B5EC 1IF1A 1TWFJ 3V8KA 4AIKA 4HRIA 4HW0A 4ABZA 2B9SA 4OIPF 2BY0A 1VQOI 1SANA 4ZYHA 4BUPA 2GA2A 1T39A 1E17A 2FJ1A 2WB1N 2DYRH 2ZSIB 4P55A 1IRFA 1PUFB 3R0JA 3BG5A 3IWFA 4P5OA 4OAZA 3OYGA 5JHUA 3ONQA 1Z6RA 1A6QA 2FX0A 1VF9A 5BPDA 3DKWA 4L5JA 2B7EA 3ZQFA 4Y3OA 5BS6A 2ZBKA 4HNVA 3GTQJ 4CICA 4IKFA 2P4WA 4ENKA 1Y1VJ 2MYSA 1YW8A 2OAZA 2ZMEB 3RZDJ 1LKXA 3M7GA 4DYQA 5D4RA 1T2KA 1BJZA 3PQKA 4HF1A 1F4KA 5LLQA 4LD5A 2L54A 3QU6A 5ILSA 3RSNA 5KAFC 4BU2A 2AQEA 2AXLA 1TWAJ 2JA5J 1XGOA 3ML6A 3WGGA 2CG4A 1I27A 1FWZA 2CQNA 2BW3A 4Y15A 3OOUA 5IY5H 2IPQX 3VB2A 3A52A 4I6ZA 2O7OA 1VQLI 4OAYA 3A2KA 3E5QA 5E3NA 1B8IA 1VQ5I 2QBYB 3WTUC 3OL4A 1ETWA 2BV6A 1MMDA 3GTLJ 4XSZF 2OTJI 4L0YB 1HXDA 2DA4A 4X0GA 4KISA 2NOGA 4ON0A 3S1RJ 1D8KA 4M9XA 4KN4X 2HYGD 1MJAA 1LEAA 3KZIC 1WI3A 2OZUA 4KT5C 1D1CA 2EH3A 3CCSI 4PFOA 2LREA 2GQQA 1FOWA 1QQIA 2DOAA 2DA7A 4MTDA 5K1YA 4XQFA 2NAZA 5DYMA 3ECHA 2DFHA 4A3EJ 1QZZA 1QZYA 2P8TA 4R8HA 4FTHA 1C0WA 2P0WA 2E2IJ 1RC9A 2XPUA 1BI1A 1EH6A 2GOMA 3LQQA 4NNJA 2X6YA 2M35A 2EA4A 4HEA2 1A5JA 5FKOA 2X6XA 3HSEA 4GCVA 4UXNA 3J80Z 2QQBA 3F22A 3GFIA 1AU7A 4PJJA 4RB0A 4LLNA 1IRZA 3SXYA 4M71A 2WC2A 3JW4A 3OS2A 1D3YA 3K9TA 2FA5A 1YRNB 5LHGA 1V5FA 3I59A 3PSIA 4Z2YA 2IGNA 2WY8Q 1WJBA 3G73A 5FD5A 5IYBJ 4IXAA 3BC8A 2KIQA 4EEFG 4OOIA 4DBQA 4O6JA 4B09A 2JUCA 4HX7A 2G7HA 4M72A 1STZA 3JTHA 5GAGJ 3MN2A 3H9JA 2ZB9A 4C3JJ 1SVMA 1D0ZA 3HSFA 4RA2A 2D1HA 5F04A 1B72A 4JYKA 2VT3A 2QKLB 4QIWN 3SEZA 1SD4A 4Q4ZF 3X2QH 3LMMA 1A04A 1TQMA 2FF4A 2QLZA 2JUGA 1YS7A 1WJAA 3G1OA 5J8CA 3FK6A 1IW7F 2GXAA 3OOPA 3F9KA 3TMOA 2VQGA 2Q2EB 2M34A 3PIPF 3GF2A 3FF5A 1XB4A 3K4NA 5IT9Z 4V19K 5A2QK 1H8AC 2Y2ZA 2K86A 1KZHA 4IOCF 5CVVA 3D5SC 3KCCA 3NARA 1J59A 5DM6F 2JRMA 2F5VA 3M8EA 2ZMEC 2DCEA 4II3A 4WX9A 1TT0A 4W97A 1WFXA 2J5PA 4YFKF 2Q0OA 1E3OC 3DU6A 2MC3A 4DW6A 4G8XA 3KEOA 1S9HA 5IYDJ 4BE2A 1MKMA 2DTZA 5FKMA 2YU3A 2NNYA 2HOAA 3MQ0A 1EKEA 2DOEA 4ASNA 4BYYA 2H1KA 1HA8A 1KA8A 3E7LA 2D2WA 4BY7J 1MDMB 3ZMUA 2PN6A 1X4PA 1XCVA 1TC3C 3W2AA 3WTVC 3GWZA 3AG2H 2ESNA 2DPUA 2DFIA 4XICA 4MGRA 5EGOA 1Y6IA 3DWLE 4I02A 3WHCA 1P4AA 4PK4A 3DCFA 2H8WA 1LPQA 4HV5A 3T5XA 2P6SA 1RPWA 4MIMA 4XK4A 3L2VA 1IUYA 1FSHA 4HQEA 1VQ9I 1QA6A 1YO5C 4HDVA 1U0JA 2PG4A 3V4GA 5FKKA 1NK2P 4IHWA 2DMNA 2KMUA 1XGSA 3EUHC 3HGGA 3I4PA 2WB1A 4A0ZA 3Q0VA 2F4MB 2KDOA 3PNTA 1LJ9A 1ETXA 2BXYA 1N78A 5CJ9A 1LFPA 2W4SA 3HOTA 3DPLC 2L7FP 5K5RA 4J01A 2ZXWH 1SEUA 1MJBA 3PO3J 4FQGA 2R7XA 4BNCA 4CO8A 2M7AA 3PFIA 5FGMA 1CGPA 2DXIA 2ADUA 4BEHB 5HLTA 1BI2A 3HOUJ 3WE2A 2ZJPF 4F55A 1R7JA 3CCUI 2IEKA 1P2FA 2X0LA 2XVCA 3OIQA 3R4KA 3NRVA 2H09A 4KITB 4A69C 2D1VA 4XLCA 4E6KG 1XC5A 2LP0A 4BBSJ 4QWQA 3F8FA 1ON2A 1YX5A 2TRTA 1GUUA 3FKIJ 3MEXA 1BR1A 5GTIC 1H0MA 2Z1DA 3RJPA 3ZRGA 5K7FA 4JQFA 3Q9SA 4I0AA 3P7NA 3ZN0A 5DS9A 2LKSA 3GMEA 2ZNZA 3C2HA 1OQYA 3ASOH 2BVLA 3CTAA 4N0BA 4PZJA 5DM7F 3AL0B 2CU7A 2PBIA 2CJJA 3L2QA 1YFHA 3OR1C 1K4SA 3AG1H 4D9JA 3HUGB 1Z6TA 1FYKA 1VQMI 3W6VA 1FT9A 2X1CA 2LNBA 4LLGF 1ONVA 3CDIA 4PJLA 4XM3A 5DDGA 1EA3A 3KLOA 4GO1A 2DA3A 3H3VK 1QGPA 3K70D 3MKYB 3F8NA 3HHGA 1MBEA 4M6VA 3CQZJ 3DF8A 4BXUA 2BHYA 3DPTA 2EQRA 3CLOA 4G7HF 2XUBA 2VT2A 1ZHFA 2XPWA 4MLOA 1YQAA 4A5NA 2YX4A 1D5VA 4OINF 2RN7A 2VKDA 4KMUX 4L5EA 1RETA 3BOQA 3FISA 5KNLA 3M1CA 5CYVA 2DMUA 2HTSA 4RB2C 4IRIA 1FPQA 1OISA 3I5UA 3ZQLA 4A3KJ 1ORKA 4B8XA 3U1KA 5JHFA 4A3IJ 3G1MA 1SFOJ 3BTLA 1LQ1A 2M9HA 4MTEA 3I54A 1Z7LA 2DN0A 1S29A 2FE3A 4HLXA 2R5YB 1MNDA 2ZSHB 1VTNC 1VQ6I 2QSFX 2PFBA 2LF7A 4RAGA 3M8JA 1RR7A 2BW3B 3ASNH 2G0EA 4YEJA 1UG2A 3L2CA 3CO7C 2DK5A 2XGDA 2MUNA 2G7UA 2DQLA 5L3BA 1B8IB 1HSTA 1U8RA 2GXBA 2A5YB 2BE5F 5K7HA 1ERDA 3S16J 1JTYA 5EZHA 1USSA 5FLXK 4BJTA 3KEYA 1W1WE 2EILH 4FT8A 1HDDC 3HZJA 3MWMA 3RCOA 2QSGX 1OR7C 1O3SA 2A6TA 2HXIA 2KT0A 3OYCA 3V8JA 2ELKA 2RREA 3JRDA 5C4JJ 1SD6A 1RUNA 4PGGA 4MQVA 2UXXA 5E79C 3JRAA 5TRDA 4BDYA 2WAQN 3SZGA 1FLIA 2QQ9A 3ROUA 2M30A 3KETA 1JGGA 5FLMJ 1CF7A 1O7FA 1R4NB 2EV0A 4X6AJ 2JN6A 3D0SA 3H0DA 1GXPA 1P4XA 3H3UA 3C3WA 3M8FA 4CGZA 3CP8A 2KRCA 3W3CA 3JAMK 1I39A 5BMZA 2RVCA 2A68F 2Y75A 4XORA 1BJAA 1K6YA 2IGOA 4F92B 2UWMA 1LDDA 2L3DA 2V1XA 1LFBA 4Y52J 4BGDA 5HLGA 3SYTA 2V1DA 3J7AY 3I59B 1G3WA 2HEOA 2MW8A 3GCMA 1HLVA 2ZMEA 4E70A 3IKTA 2VLAA 1XCBA 3GBGA 2IT0A 1WI9A 3KYCB 5E8IA 3I55I 1ZRCA 1BI3A 2ZJRF 1PYVA 2CH0A 2R7WA 4WXHA 3OYIA 5H20A 3NWTA 2O5RA 3WODF 5E1WA 1S7AA 2RC4A 1HW1A 1B72B 1GXQA 3R0AA 1S8NA 4OIOF 2CQXA 3BDDA 4L5IA 2JPBA 5CVJA 2BZTA 3G4SI 4AVZA 3IKVA 2W25A 3HOSA 3O8HA 2DT6A 4A2UA 4BQNA 4GYGA 3OR2C 2HPIA 3FK7A 4CXFA 1Z3XA 4U7DA 1JUSA 4RB1A 5J6XA 1XMXA 2BY1A 2HS5A 1FSEA 5ICFA 3MFKA 1BW6A 2JT1A 2E71A 1BOBA 4LMYA 4OMZA 5CQGA 3EUHA 2H94A 3H5NA 4CCMA 1D8JA 2ZO4A 3S93A 4KIBA 3B6CA 1Y0UA 1LVAA 3FXLA 2UUZA 4XN0A 4NC8A 4ANJA 2F5EA 3LAPA 4M9SA 3G3ZA 3TW7A 1QRYA 3V8LA 4ZJZA 2LY9A 3CMYA 3OYJA 3S14J 4A3DJ 2R7SA 1JKOC 3MZ8A 2MVTA 3ZMDA 1QVUA 1S7OA 3KIOA 2DAOA 2NYXA 4W1UA 2DMQA 2V9PA 1HW5A 5FFXA 2X6OA 3PO2J 2DLLA 5D8KB 3GZNB 3CD6I 2UXNA 1TWHJ 5LD2C 3LSMA 3RZOJ 3BP8A 3IHUA 3FBNB 2JSCA 4BJ5C 2PMHA 3H36A 5D5WB 4BH9A 3D1NI 2VODA 4R1HA 1IXRC 2L9SA 3CMMA 3V42A 1O4XA 1N77A 2R7ZJ 4G94A 1RIOH 1YLFA 1ODDA 3P9KA 2HDWA 2EV6A 2KHMA 3RKQA 6PAXA 1ZGAA 1MJ9A 4IZZA 4AC0A 4B47A 4B3XA 1VQ7I 2XC7A 2KZVA 4UB6C 5CPRB 4A0YA 2HTJA 4OIQF 3RPUD 2MA3A 2YX7A 3VYTB 3O3KA 2X9DA 3WTZA 4MHGA 4BXFA 3LNQA 1W7PB 2Q2EA 1ZK8A 3BR0A 4BE1A 2LRDA 2H6BA 3B02A 4HNUA 3GZ5A 4M3BA 3FXRA 2HQ5A 2QYOA 4ZYDA 2IVMA 2LLKA 1JI8A 3L09A 2JA7J 5GPCA 4B44A 1L3LA 2CW7A 4AM3A 3REOA 2QM3A 4EGYA 5E1XA 4HSRA 3OYFA 1O7LA 4KA4A 1FZPB 1D0YA 1A36A 4Y13A 4S04A 4HX4A 4UVCA 3CJNA 4UV9A 4A3LJ 1K83J 1MDMA 2RKHA 2VQHA 1B9NA 1IDYA 3QP6A 2BY2A 3RKWA 5BQTA 2XIGA 5KHDA 4LJZF 3A0HC 2W24A 3I71A 3KZZA 1Z3YA 2O6GE 2EZKA 2DOFA 4EVIA 4I7HA 5HDKA 2X51A 2Z3YA 2G9WA 1FIPA 1ZG1A 4UUVA 2WV1A 3JR9A 3M07A 2R92J 3ECOA 3HC7A 3OS0A 3J81Z 1OYIA 3ABUA 2E7WA 1TTYA 1BBYA 2UZKA 3CCVI 5E17F 2V79A 4A6EA 2WAQA 4HG2A 1ZLJA 2HNHA 1MNEA 1OR7A 4CA0A 2Z33A 4XKCA 2LG4A 3SJMA 5FRMA 4LG3A 4O5VA 1BM9A 3KYLA 3N4MA 3VSKA 2NVTJ 1FMVA 1FOXA 5IYCJ 2HDDA 4CZCA 3QYBA 4YELA 4ZC3A 4RBOA 1Z0XA 3GLXA 4BEHA 1R49A 4XOTA 2M7BA 5DUKA 1XMKA 1ZH5A 3GUDA 2RAEA 5CQEA 4ZDLA 4XRSG 1MD0A 1E3HA 1W36C 3CC2I 4PGHA 4KFCA 2P6TA 1SFUA 4I09A 2QEXI 2BYVE 4XRSA 4O3MA 2VBZA 2CSOA 5GADJ 2WTEA 3KZYA 2EINH 2I5UA 2QCOA 4BXXJ 1G3TA 1ZTRA 3S32A 2KKOA 3CZ6A 1LDKB 2F4IA 2CGPA 5F0CA 3RKXA 1N75A 3T8RA 4G7OF 4IPAA 4YFXF 1KYWA 4BE0A 1IN5A 2KLOA 2DMTA 1YE9A 2QUFA 1E3PA 1V54H 2CWEA 4CCKA 2PJRB 1FTTA 4WWCA 1VQKI 2YU9J 1QHGA 2AQFA 2MLKA 1QBJA 1Y8RB 1IV8A 1D1BA 4IF4A 3F72A 4PDKA 1CF7B 2K9MA 4F91B 3K1NA 1H9TA 2QSHX 4CHUA 1UELB 4IHSA 1WKMA 4I99C 3BLYA 1OYYA 2E34A 3KE2A 3ZQHA 3J7AW 3RPQA 3C18A 1FMWA 1R1UA 1IO2A 5ED4A 4EJUA 4XBFA 4K2EA 1QNTA 2CV2A 3KP3A 2OQGA 2YR2A 3BT9A 4DGWB 3CESA 5H6RA 1P6RA 3FXMA 3FMQA 1HC8A 1U78A 1G8XA 1UHWA 2KP6A 3V7CA 2DA5A 1SVLA 3GEZA 5M3MJ 4JP0A 1VQ8I 2JVGA 3L2UA 4XKBA 1ZAOA 4HOBA 2R5YA 2VXZA 5K7ZA 1MNMC 1FOKA 4KIFA 1W0UA 5LEJA 4IX7A 4C3IJ 3GLLA 2EZHA 3HEFA 3S2WA 3I9V2 2QENA 4RGRA 2PJPA 4KUMA 1JHFA 2F5FA 4U87A 1ZYRF 4HA8A 2NS8A 5FROA 2FXAA 2VI6A 1MZBA 1NHAA 4NB5A 1IG7A 2V7FA 2NVQJ 2XKOA 4PFPA 1Y39A 5IPAA 3H3ZA 3CF5F 2HR3A 4LB6B 1YX3A 3BQZA 1OCRH 4YFNF 2R4GA 2R7QA 1D1AA 1WRJA 2PEXA 4BKXA 4N9IA 2KIMA 1XPXA 1ZELA 2WBMA 4PCQA 2JTVA 4XLEA 2MGQA 2D45A 1TZLA 3MCZA 1FIAA 4YIFA 1HKSA 3K69A 4FCYA 3S1QJ 3KP7A 2JMWA 3J80K 1AHDP 1F5TA 1B9MA 1IV6A 4DJAA 1ZQ3P 3CDLA 2XKPA 3BJOA 3EDPA 3KP5A 4NUBA 4YIRX 3I53A 2MZ4A 2HYJA 2Y9YA 5HLHA 3H1CA 2Y0SN 2VUMJ 1T33A 3DKYA 4IRHA 4M9ZA 1KU7A 1XSDA 3MD2A 2K27A 3LSKA 4ZYGA 3K4JA 3LSHA 4DQ2A 3HOXJ 3S1MJ 3TBIA 4UNOA 5E3LA 2DODA 2WV0A 4PSXA 5AIQA 4XIDA 3LAJA 4ITVA 1YIOA 3OYKA 1IRXA 5F0FA 1DGWY 3S8PA 3JTGA 1W0TA 4OU0A 3LSGA 4A0XA 3K4KA 1IN7A 5LHHA 1R36A 1MMGA 2O61A 5B66C 3TDUC 3EETA 3K2AA 1KONA 4NC7A 3NQOA 5J1UA 1TNSA 3S1NJ 1MIJA 3G6EI 1A35A 4WF2A 4PJ0C 3A02A 1DP7P 2HKXA 2VL8A 1RQ6A 3BWGA 1TQPA 4D7NA 3BG3A 4XLPF 5IT9K 3ABLH 4C9YA 4LG0A 2R5ZA 4ETSA 3L9FA 2V9VA 3O6BB 1J9IA 3CMEI 1T08B 1ZG5A 1DUXC 1FX7A 3KFWX 3A01A 4QTRA 4HDUA 4BQOA 4B1RA 2C6YA 4Q5SF 4BHPA 2CQQA 4OWRB 4UUTA 2DW4A 4CDGA 2W84A 1J7KA 1T98A 1OCPA 4U0VA 1LNWA 1QHHD 4LIUA 2FQ4A 1B4AA 2VASA 3F21A 3FMSA 4MFEA 3L2RA 2JA6J 3U1DA 1E0EA 3HRTA 3QODA 4AIHA 4LOCA 1Z9CA 2EIKH 3RDIA 1QZEA 2OU2A 3F8MA 5FKLA 2V4JC 1WH5A 3VWBA 5A2QZ 3CCRI 3W2VA 1ZRDA 1TWCJ 5B3SH 3F6VA 3IL2A 2A61A 2M1BA 4FETA 4DIQA 3J80R 1TW2A 1F43A 1G3SA 4CUGA 1M1EB 5ICEA 2LF8A 3O2PE 4BAYA 3RI4A 2PMZN 2OC6A 2DBBA 3HG9A 4G12A 1JT6A 2VE8A 5JLXA 3QRFF 2CUEA 3SFIA 5DTDA 4Y4RA 1ON1A 4JX4A 3U9GA 1X58A 3MMYB 2IS1A 3FMRA 4Q48A 5GP9A 1OCCH 1HQCA 3DTKA 1MSEC 2E1OA 1DP3A 2KL4A 5EEGA 3CCMI 2UV1A 2K5CA 3GTJJ 4F7ZA 2JJ7A 3PM1A 4BY1J 3JRIA 1XDSA 2RQQA 3BJ6A 5JFRA 2K9QA 3OYEA 3GZ6A 4MEXF 1XGNA 4XKWA 4IHYA 1R1VA 2H1LA 3QOEA 4N9HA 1W7PA 2W1OA 3DU5A 3GTPJ 1MSFC 4B43A 2V1NA 4XN3A 4XRMA 1PP8F 1I1SA 3G71I 1YITI 4DZPA 2LH9A 3K2ZA 5FFZA 2EZIA 2LR8A 1JKQC 2KIFA 3VDXA 1EF4A 4CH7A 1DPRA 1G6NA 1Z67A 3HL2A 4I0BA 5IT9R 1ZGJA 3BCAA 4IJAA 5DUIA 4GYIA 4HPQA 1BR4A 2NS7A 4M74A 3OSFA 1Q1HA 4MO7A 5FKNA 2XSDC 3FXQA 2IA2A 3LWFA 9ANTA 2B0LA 5FLVA 4ZTJA 3BTIA 3N97A 2V1UA 2LFBA 5DD4A 5EEAA 3HOWJ 1LDJA 4U88A 2E1NA 4NHJA 2VB6A 2Z99A 4U7BA 4FISA 3R61A 4NBQA 2CUZA 1U2WA 2L4MA 5GPAA 2O8KA 3BTJA 2HQAA 4JK1X 1SFXA 2DPDA 3BZCA 3WG7H 1TQIA 5J4YA 1SD5A 5J1RA 1X3UA 2EFOA 3WGIA 1TBXA 2A05A 5IOZA 5IP9J 1REPC 2HQNA 4B48A 3K4LA 1QVTA 3IRQA 3W2WA 3HRMA 3P9CA 3RQ4A 2F4OB 1X1CA 2ZFWA 1TL8A 1WPKA 5CKTA 1ZR4A 4AU7A 1BC7C 1JUMA 2MLGA 2O8XA 3HB9A 2K4BA 3EPZA
chains in the Genus database with same CATH topology
4A5MA 1F1ZA 2ZNYA 4HF2A 2EFNA 4A6DA 1RNLA 1R5HA 4R79A 1LEBA 3V7SA 3K1PA 4CZZA 3FWEA 5L3DA 3L00A 1IN6A 4M6YA 1HKQA 1KGSA 5HDNA 2FMYA 1HW2A 2XV4S 5ICGA 4WCGA 2GA1A 3SHFA 5FLXZ 1U5TC 1HKTA 3J7AO 2IA1A 1HBXG 4NQWA 2TDXA 3F23A 4G6DA 2VBWA 3IC7A 3WTTC 2ESHA 3D5LA 5D6EA 4L9JA 1I6XA 1R00A 2FBKA 3BY6A 3BROA 1Z7UA 3E6BA 2HGCA 2VE9A 1PP7U 1YS6A 2FU4A 3JAMZ 3SFZA 1E2XA 2EB7A 5L3FA 3I0TA 1R22A 3I58A 4ESBA 3HYIA 3VOEA 3CUOA 5HDGA 4FHTA 4RAZA 4LG0B 2FNPA 4I98B 2CW0F 1IZ1A 4HF0A 1OPCA 1S3JA 2YPRA 1JGSA 3HIFA 1W5SA 1J75A 4UVBA 4FX4A 1OYWA 2BBYA 3Q9VA 2E7XA 2VBXA 2HQRA 1DPUA 2ZKZA 3QP5A 5FO5A 2XAFA 3WU0A 3BPVA 3R6SA 2K4JA 3K0LA 3W6KB 4EJTA 3VODA 4UHTA 2FOKA 5LHIA 2GIVA 3SQNA 3KP6A 3MZYA 3NEUA 4ENMA 4FX0A 1ZRFA 1EH7A 3CUQB 2KJBA 2PQ8A 3TOBA 1RI7A 2EJRA 1QO0D 5ERIA 3ZMSA 1XMAA 1YW9A 1KU2A 2P5VA 1XDUA 1Z1DA 2IJLA 1GVJA 3WGHA 5DV5A 3TO9A 2NS0A 3RIRA 4EJOA 2DTRA 4RS8A 3QPHA 3RYRA 3COAC 2VN2A 2A3SA 4LGWA 1GHCA 1G4DA 3DP7A 4OMYA 3DFGA 3SZPA 3FZVA 2STWA 2BGCA 5H6QA 1USTA 1BIAA 2MH2A 2HZTA 1KQ8A 1V3FA 2P5LC 2VONA 3KLNA 2XAJA 5LEKA 3WTSC 3WU1B 4M73A 3DQVC 5AONA 2E1CA 4YIIA 5E18F 2L01A 3OV8A 2X4HA 2IW5A 5BOXA 1QPMA 2M8EA 5F64A 1L0OC 1U5TA 3HRUA 2DQRA 1IN8A 2EFPA 2FBHA 2FSWA 2XHKA 2NRAC 2PLYA 4L18B 4WXDA 2Y0MA 2P7CB 1B6AA 2AS5F 4WK8F 4EMSA 4KMFA 4KICA 4L9VA 4XRFA 4KDPA 4AIJA 1XGMA 2MD5A 4KIGA 2O3FA 3MZHA 2HWVA 4GGGA 3CUQC 4MQ9F 3MAJA 3ZMVA 3ZMZA 3E5UA 2XROA 1K6OA 4BHBA 5DCMA 5L3CA 5LGNA 4EJVA 1RZ4A 3HSRA 3VFZA 2A07F 1KU3A 5KVRA 2EV5A 3E6CC 3FM5A 1Z91A 3IWZA 2RDPA 3TGNA 1R58A 4HYEA 3F6OA 5E8GA 3T0YA 1YTYA 3W6JB 2M45A 4ZZDA 1OMIA 1FP2A 3WTYC 4HV6A 5HVQC 2P5KA 2W57A 2QZ8A 2EA2A 3JSOA 4I01A 3HTSB 4GXOA 1JHHA 1IXCA 5TJJA 2BEOA 1IAWA 3Q5FA 5HS9A 5ICCA 4BHCA 4OIRF 3EYIA 1K78B 3LSTA 2QQAA 3GFMA 2XGXA 4XSXF 1U3EM 2PI0A 1UB9A 1R23A 3K1MA 4AVPA 4Q47A 4EM1A 5L3EA 2CYYA 1IN4A 3WTXC 3DEUA 3M1EA 1DDNA 5CLSA 2HDCA 4Y17A 2RGVA 5LRSA 4IHTA 3TO6A 3LA7A 4I2OA 5HLIA 1PUEE 3F8BA 2O03A 3E6DA 1XN7A 5D5UB 1BI0A 1J0RA 5D6FA 2A6HF 2EFWA 3I64A 1B1BA 2V6CA 4HLYA 2F2EA 1FP1D 2NNNA 2JPCA 1Z05A 1K79A 4ZYEA 1FBUA 5K5OA 2ISZA 2DT5A 3E6MA 2FEZA 1W7PD 5JI6A 4D0PA 3EQLF 1T38A 2L4AA 2ISYA 5LBQA 5JVTA 4EGZA 2OBPA 3M9AA 4LFUA 1BOAA 4RGUA 1HSJA 1V4RA 2FQ3A 1P92A 3KEQA 3TOAA 2R7DA 4HBLA 2COMA 1WQ2A 4JBAA 4U0YA 3QU3A 1BC8C 2RNJA 4G9YA 1F9NA 4P9FA 4TV7A 4EV0A 5CVIA 3L7WA 2K7LA 2HOEA 5LRRA 4P9UA 4BQAA 3F8CA 1TLHB 1AWCA 2CQKA 1SMTA 3GYHX 5DEQA 1ZN2A 2MBFA 1JXSA 3DXJF 5JR3A 2ETHA 3P9IA 1FBQA 5D5XB 5EEHA 2FNAA 4QLCU 2EK5A 1U6GA 5E1ZB 3CDHA 3ERED 4MNUA 3ISPA 1O3RA 3BPXA 3CUQA 2R7FA 4HX8A 4XLNF 2LKPA 4CYDA 2QVOA 1SAXA 5DCFA 4HZFA 3H92A 4ESFA 4RAYA 1FY7A 4EM0B 1U5TB 3TDZC 2OQRA 3TO7A 2VC0A 2DI3A 4RGXA 2GWRA 1TNTA 2DO7A 3F3XA 4EQQA 3GVAA 3FXUA 3VEPA 4ENJA 1RUOA 3RYPA 1OKRA 2YSRA 2OA4A 2ELHA 2W85A 2H27A 2FRHA 1XSVA 4LLLA 5L3GA 1G3YA 2K02A 5IT3A 1XSXA 3ULQB 1KU9A 5DCMB 1O3QA 1T6SA 1S6LA 3FHZA 2XAQA 3BZ6A 4EM2A 2FBIA 1H9GA 2VOOA 3HRSA 2OZ6A 1YW7A 2GZWA 1I5ZA 3E97A 4L9TA 4G7ZF 4HQMA 2O0YA 2FMLA 3BJAA 2RV8A 1JE8A 3R60A 4P96A 3GX4X 3HHHA 2F5DA 3B73A 4S05A 1B59A 3PQJA 2XAGA 1FBSA 4EJWA 2WWYA 4ZH4F 3KP4A 2CO5A 3C7JA 1W4MA 5CVUA 2IP2A 1ZREA 2Y48A 2A69F 1FC3A 5HS8A 1FYMA 1J5YA 3E3VA 2GAUA 3DV8A 4LB5A 1UHMA 4L9NA 5LGUA 5DD8A 1WWXA 2L02A 2HFHA 4ESJA 3ELKA 4AD9A 3AAFA 3HTUA 2ZCWA 2J5OA 3SZTA 4RB3C 5LGTA 5FB2A 5HS7A 1W5TA 4G6QA 1UFMA 5HOOA 3E5XA 1ZG3A 1K78A 2MH9A 1O57A 3TQNA 1J2XA 4ENNA 4LK0F 1PDNC 4IRGA 4MEYF 2QBYA 4UVAA 3IRRA 4A12A 4H0EA 2H6CA 2VC1A 5K5QA 2HYFA 1R5GA 2XRNA 3ZP5A 2JRTA 1ZARA 2P7VB 1ZLKA 2ACJA 4L0ZB 2VOPA 4YG2F 3T8TA 2Z5UA 5E20A 1IXSB 4ZZLA 4U0WA 1BN5A 2CFXA 5ILVA 3GO5A 4UV8A 2QWWA 3U2RA 2F5CA 3LQRA 2DK8A 5KK1A 3FM3A 3WTWC 1EH8A 1SD7A 2JZYA 5FD6A 4RGSA 2OD5A 3JSPA 4LK1F 1AOYA 4HAMA 5ILUA 2LSOA 1SFEA 3GW2A 4IVNA 3ZPLA 2IRFG 2EWNA 1LB2A 2DU9A 1KQ9A 3RTRA 3V7RA 2M5WA 2EFQA 1FYLA 1ULYA 3FX3A 2M87A 1R1TA 2A6EF 2Q8KA 5F6FA 2STTA 1O3TA 1I1GA 5J8FA 5D8LB 2IA0A 2R3SA 4M6XA 3J81K 3KP2A 3ZMTA 2RQPA 1YYVA 3TKYA 3GFJA 1XD7A 4KNYA 4KYWA 5D4SA 4WXCA 1MGTA 5BPIA 2Z9OA 3ZN1A 3GFLA 2KRFA 3T1BA 1EV7A 3QPTA 3GXOA 1SMYF 1TW3A 1UCRA 2ZJ2A 1KQ0A 5CVRA 5D5VB 1IRGA 1T0FA 5F1RA 1YG2A 1K7AA 3C1DA 1P4WA 4DNCA 2KIUA 3WE3A 3LA2A 2XASA 2PMUA 3EYYA 2XAHA 1WSUA 3LA3A 3RPUA 1BIBA 3ZQ7A 3LFKA 2GXGA 3ABTA 2LDUA 1FNNA 3WG9A 3QOPA 3QAHA 4KN7X 2HKOA 2VBYA 4AWXB 1KYZA 3CO6C 5AIPA 2ZXJA 3HUGA 3RKYA 2KJCA 1IF1A 4AIKA 3V8KA 4HW0A 4OIPF 4ZYHA 2GA2A 1T39A 1E17A 4P55A 1IRFA 3R0JA 3IWFA 4P5OA 5JHUA 1Z6RA 5BPDA 3DKWA 4L5JA 5BS6A 2ZBKA 4CICA 2P4WA 4ENKA 1YW8A 2OAZA 2ZMEB 3M7GA 5D4RA 1T2KA 3PQKA 4HF1A 1F4KA 5LLQA 4LD5A 2L54A 3QU6A 2AXLA 1XGOA 3ML6A 3WGGA 2CG4A 1I27A 1FWZA 4Y15A 2IPQX 3VB2A 3E5QA 2QBYB 3WTUC 2BV6A 4XSZF 4L0YB 1HXDA 4ON0A 1D8KA 4M9XA 4KN4X 2HYGD 1MJAA 1LEAA 4KT5C 2OZUA 2GQQA 1QQIA 4MTDA 5K1YA 2NAZA 5DYMA 3ECHA 1QZZA 1QZYA 2P8TA 4R8HA 1C0WA 1BI1A 1EH6A 3LQQA 2EA4A 3F22A 4GCVA 3HSEA 4UXNA 3J80Z 2QQBA 3GFIA 4RB0A 4LLNA 3SXYA 4M71A 2WC2A 3JW4A 1D3YA 3K9TA 2FA5A 5LHGA 3I59A 4Z2YA 3G73A 5FD5A 4IXAA 4OOIA 4O6JA 4B09A 4HX7A 2G7HA 4M72A 1STZA 3JTHA 3HSFA 2D1HA 2VT3A 1SD4A 4Q4ZF 1A04A 1TQMA 2FF4A 2QLZA 1YS7A 5J8CA 1IW7F 3OOPA 3GF2A 3FF5A 1XB4A 5IT9Z 5A2QK 2K86A 5CVVA 3KCCA 1J59A 3M8EA 4WX9A 4YFKF 2J5PA 2Q0OA 2MC3A 4G8XA 3KEOA 1MKMA 2YU3A 2NNYA 3MQ0A 4ASNA 4BYYA 1KA8A 2D2WA 1MDMB 3ZMUA 2PN6A 1XCVA 3WTVC 3GWZA 2ESNA 2DPUA 2DFIA 4MGRA 4I02A 1P4AA 4HV5A 3T5XA 2P6SA 1IUYA 1FSHA 4HQEA 1YO5C 4HDVA 2PG4A 3V4GA 1XGSA 3I4PA 4A0ZA 1LJ9A 5CJ9A 3HOTA 3DPLC 5K5RA 1MJBA 4BNCA 4CO8A 3PFIA 5FGMA 1CGPA 2ADUA 1BI2A 3WE2A 1R7JA 1P2FA 2X0LA 2XVCA 3R4KA 3NRVA 2H09A 2D1VA 4QWQA 3F8FA 1ON2A 3MEXA 1H0MA 3RJPA 4JQFA 3Q9SA 4I0AA 3P7NA 3ZN0A 2ZNZA 3CTAA 4N0BA 4PZJA 2PBIA 1YFHA 1Z6TA 1FYKA 1FT9A 2LNBA 4LLGF 1ONVA 5DDGA 3KLOA 4GO1A 1QGPA 3F8NA 3HHGA 3DF8A 4BXUA 3DPTA 3CLOA 4G7HF 2XUBA 2VT2A 1ZHFA 1YQAA 4A5NA 2YX4A 1D5VA 4OINF 2RN7A 4KMUX 3BOQA 5CYVA 2HTSA 4RB2C 4IRIA 1FPQA 3I5UA 4B8XA 1LQ1A 4MTEA 3I54A 1S29A 2FE3A 4HLXA 1VTNC 2PFBA 2LF7A 3L2CA 3CO7C 2DK5A 2G7UA 2DQLA 5L3BA 2GXBA 1HSTA 1U8RA 2A5YB 2BE5F 5FLXK 1USSA 4FT8A 3MWMA 1O3SA 3V8JA 1SD6A 1RUNA 4PGGA 4MQVA 2UXXA 5TRDA 1FLIA 3KETA 2QQ9A 2M30A 3ROUA 1CF7A 1O7FA 2EV0A 3D0SA 1GXPA 1P4XA 3H3UA 3C3WA 3M8FA 4CGZA 3JAMK 5BMZA 2RVCA 2A68F 2Y75A 1BJAA 2UWMA 1LDDA 2L3DA 2V1XA 5HLGA 2V1DA 3I59B 1G3WA 2HEOA 2ZMEA 4E70A 3IKTA 1XCBA 2IT0A 1WI9A 5E8IA 1ZRCA 1BI3A 4WXHA 5H20A 3WODF 5E1WA 1S7AA 2RC4A 1HW1A 1GXQA 3R0AA 1S8NA 4OIOF 3BDDA 4L5IA 2JPBA 5CVJA 3IKVA 2W25A 3HOSA 4A2UA 4GYGA 4CXFA 4U7DA 4RB1A 5J6XA 2HS5A 1FSEA 5ICFA 3MFKA 2JT1A 4LMYA 4OMZA 3EUHA 2H94A 1D8JA 2ZO4A 4KIBA 1Y0UA 1LVAA 2F5EA 3LAPA 4M9SA 3G3ZA 3V8LA 3ZMDA 1S7OA 2DAOA 2NYXA 1HW5A 5FFXA 2DLLA 5D8KB 2UXNA 3BP8A 3IHUA 2JSCA 2PMHA 5D5WB 4BH9A 2VODA 4R1HA 1IXRC 4G94A 1RIOH 1YLFA 1ODDA 3P9KA 2EV6A 6PAXA 1ZGAA 1MJ9A 4A0YA 2HTJA 4OIQF 2MA3A 2YX7A 3O3KA 3WTZA 4MHGA 1W7PB 2Q2EA 2H6BA 3B02A 3GZ5A 3FXRA 2QYOA 4ZYDA 2IVMA 3L09A 1L3LA 3REOA 2QM3A 4EGYA 5E1XA 1O7LA 4KA4A 1FZPB 4Y13A 4S04A 4HX4A 4UVCA 3CJNA 4UV9A 1MDMA 2RKHA 1B9NA 3QP6A 5BQTA 3RKWA 2XIGA 4LJZF 2W24A 3I71A 3KZZA 2O6GE 4EVIA 4I7HA 5HDKA 2Z3YA 2G9WA 1ZG1A 4UUVA 3ECOA 3J81Z 1OYIA 3ABUA 2E7WA 1TTYA 1BBYA 2UZKA 5E17F 2V79A 4A6EA 1ZLJA 1OR7A 2Z33A 4O5VA 1BM9A 3N4MA 3GLXA 1ZH5A 5DUKA 1XMKA 3GUDA 1MD0A 4PGHA 4KFCA 2P6TA 1SFUA 4I09A 2BYVE 4O3MA 2VBZA 2CSOA 2WTEA 3KZYA 1G3TA 2KKOA 1LDKB 2CGPA 3RKXA 3T8RA 4G7OF 4IPAA 4YFXF 1KYWA 1IN5A 2QUFA 2CWEA 4WWCA 2MLKA 1QBJA 4IF4A 3F72A 4PDKA 1CF7B 3K1NA 1H9TA 4CHUA 4IHSA 1WKMA 1OYYA 3KE2A 3RPQA 3C18A 1R1UA 5ED4A 4EJUA 4XBFA 4K2EA 1QNTA 3KP3A 2OQGA 2YR2A 5H6RA 1P6RA 3FMQA 1U78A 1UHWA 3V7CA 3GEZA 1ZAOA 4HOBA 2VXZA 1FOKA 4KIFA 5LEJA 3S2WA 2QENA 4RGRA 2PJPA 4KUMA 1JHFA 2F5FA 1ZYRF 4HA8A 2FXAA 1MZBA 1NHAA 4NB5A 2XKOA 3H3ZA 2HR3A 4LB6B 4YFNF 1WRJA 2PEXA 4N9IA 2KIMA 4PCQA 2JTVA 2D45A 3MCZA 4YIFA 1HKSA 3K69A 3KP7A 1F5TA 3J80K 1B9MA 2XKPA 3BJOA 3EDPA 3KP5A 3I53A 5HLHA 4IRHA 4M9ZA 1KU7A 1XSDA 2K27A 4ZYGA 4DQ2A 4UNOA 3LAJA 2WV0A 5AIQA 1YIOA 3JTGA 4OU0A 4A0XA 1IN7A 5LHHA 1R36A 2O61A 3TDUC 3EETA 3NQOA 1TNSA 4WF2A 1DP7P 2HKXA 3BWGA 1TQPA 4XLPF 5IT9K 4LG0A 4ETSA 3L9FA 2V9VA 3O6BB 1J9IA 1ZG5A 1DUXC 1FX7A 3KFWX 4HDUA 2C6YA 4Q5SF 4BHPA 2DW4A 4CDGA 2W84A 1J7KA 1T98A 4U0VA 1LNWA 1B4AA 3F21A 3FMSA 3U1DA 3HRTA 4AIHA 1Z9CA 3RDIA 2OU2A 3F8MA 5A2QZ 1ZRDA 3F6VA 3IL2A 2A61A 2M1BA 1TW2A 1G3SA 5ICEA 2LF8A 3O2PE 4BAYA 3RI4A 2DBBA 2VE8A 3QRFF 1ON1A 3U9GA 3FMRA 4Q48A 1HQCA 5EEGA 4F7ZA 1XDSA 3GZ6A 3BJ6A 5JFRA 4MEXF 1XGNA 1R1VA 4N9HA 1W7PA 1PP8F 1I1SA 3K2ZA 5FFZA 2KIFA 1DPRA 1G6NA 4I0BA 1ZGJA 4IJAA 5DUIA 4GYIA 4M74A 1Q1HA 3FXQA 2IA2A 3LWFA 2B0LA 3N97A 2V1UA 5DD4A 1LDJA 4U88A 2E1NA 4NHJA 2Z99A 4U7BA 3R61A 2L4MA 1U2WA 2DPDA 4JK1X 1SFXA 1TQIA 1SD5A 1X3UA 2EFOA 3WGIA 1TBXA 1REPC 2HQNA 3IRQA 3HRMA 3P9CA 2ZFWA 1BC7C 2MLGA 2O8XA 5ILSA 2K4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5M A;  1F1Z A;  2ZNY A;  4HF2 A;  2EFN A;  4A6D A;  1RNL A;  1R5H A;  4R79 A;  1LEB A;  3V7S A;  3K1P A;  4CZZ A;  3FWE A;  5L3D A;  3L00 A;  1IN6 A;  4M6Y A;  1HKQ A;  1KGS A;  5HDN A;  2FMY A;  1HW2 A;  2XV4 S;  5ICG A;  4WCG A;  2GA1 A;  3SHF A;  5FLX Z;  1U5T C;  1HKT A;  3J7A O;  2IA1 A;  1HBX G;  4NQW A;  2TDX A;  3F23 A;  4G6D A;  2VBW A;  3IC7 A;  3WTT C;  2ESH A;  3D5L A;  5D6E A;  4L9J A;  1I6X A;  1R00 A;  2FBK A;  3BY6 A;  3BRO A;  1Z7U A;  3E6B A;  2HGC A;  2VE9 A;  1PP7 U;  1YS6 A;  2FU4 A;  3JAM Z;  3SFZ A;  1E2X A;  2EB7 A;  5L3F A;  3I0T A;  1R22 A;  3I58 A;  4ESB A;  3HYI A;  3VOE A;  3CUO A;  5HDG A;  4FHT A;  4RAZ A;  4LG0 B;  2FNP A;  4I98 B;  2CW0 F;  1IZ1 A;  4HF0 A;  1OPC A;  1S3J A;  2YPR A;  1JGS A;  3HIF A;  1W5S A;  1J75 A;  4UVB A;  4FX4 A;  1OYW A;  2BBY A;  3Q9V A;  2E7X A;  2VBX A;  2HQR A;  1DPU A;  2ZKZ A;  3QP5 A;  5FO5 A;  2XAF A;  3WU0 A;  3BPV A;  3R6S A;  2K4J A;  3K0L A;  3W6K B;  4EJT A;  3VOD A;  4UHT A;  2FOK A;  5LHI A;  2GIV A;  3SQN A;  3KP6 A;  3MZY A;  3NEU A;  4ENM A;  4FX0 A;  1ZRF A;  1EH7 A;  3CUQ B;  2KJB A;  2PQ8 A;  3TOB A;  1RI7 A;  2EJR A;  1QO0 D;  5ERI A;  3ZMS A;  1XMA A;  1YW9 A;  1KU2 A;  2P5V A;  1XDU A;  1Z1D A;  2IJL A;  1GVJ A;  3WGH A;  5DV5 A;  3TO9 A;  2NS0 A;  3RIR A;  4EJO A;  2DTR A;  4RS8 A;  3QPH A;  3RYR A;  3COA C;  2VN2 A;  2A3S A;  4LGW A;  1GHC A;  1G4D A;  3DP7 A;  4OMY A;  3DFG A;  3SZP A;  3FZV A;  2STW A;  2BGC A;  5H6Q A;  1UST A;  1BIA A;  2MH2 A;  2HZT A;  1KQ8 A;  1V3F A;  2P5L C;  2VON A;  3KLN A;  2XAJ A;  5LEK A;  3WTS C;  3WU1 B;  4M73 A;  3DQV C;  5AON A;  2E1C A;  4YII A;  5E18 F;  2L01 A;  3OV8 A;  2X4H A;  2IW5 A;  5BOX A;  1QPM A;  2M8E A;  5F64 A;  1L0O C;  1U5T A;  3HRU A;  2DQR A;  1IN8 A;  2EFP A;  2FBH A;  2FSW A;  2XHK A;  2NRA C;  2PLY A;  4L18 B;  4WXD A;  2Y0M A;  2P7C B;  1B6A A;  2AS5 F;  4WK8 F;  4EMS A;  4KMF A;  4KIC A;  4L9V A;  4XRF A;  4KDP A;  4AIJ A;  1XGM A;  2MD5 A;  4KIG A;  2O3F A;  3MZH A;  2HWV A;  4GGG A;  3CUQ C;  4MQ9 F;  3MAJ A;  3ZMV A;  3ZMZ A;  3E5U A;  2XRO A;  1K6O A;  4BHB A;  5DCM A;  5L3C A;  5LGN A;  4EJV A;  1RZ4 A;  3HSR A;  3VFZ A;  2A07 F;  1KU3 A;  5KVR A;  2EV5 A;  3E6C C;  3FM5 A;  1Z91 A;  3IWZ A;  2RDP A;  3TGN A;  1R58 A;  4HYE A;  3F6O A;  5E8G A;  3T0Y A;  1YTY A;  3W6J B;  2M45 A;  4ZZD A;  1OMI A;  1FP2 A;  3WTY C;  4HV6 A;  5HVQ C;  2P5K A;  2W57 A;  2QZ8 A;  2EA2 A;  3JSO A;  4I01 A;  3HTS B;  4GXO A;  1JHH A;  1IXC A;  5TJJ A;  2BEO A;  1IAW A;  3Q5F A;  5HS9 A;  5ICC A;  4BHC A;  4OIR F;  3EYI A;  1K78 B;  3LST A;  2QQA A;  3GFM A;  2XGX A;  4XSX F;  1U3E M;  2PI0 A;  1UB9 A;  1R23 A;  3K1M A;  4AVP A;  4Q47 A;  4EM1 A;  5L3E A;  2CYY A;  1IN4 A;  3WTX C;  3DEU A;  3M1E A;  1DDN A;  5CLS A;  2HDC A;  4Y17 A;  2RGV A;  5LRS A;  4IHT A;  3TO6 A;  3LA7 A;  4I2O A;  5HLI A;  1PUE E;  3F8B A;  2O03 A;  3E6D A;  1XN7 A;  5D5U B;  1BI0 A;  1J0R A;  5D6F A;  2A6H F;  2EFW A;  3I64 A;  1B1B A;  2V6C A;  4HLY A;  2F2E A;  1FP1 D;  2NNN A;  2JPC A;  1Z05 A;  1K79 A;  4ZYE A;  1FBU A;  5K5O A;  2ISZ A;  2DT5 A;  3E6M A;  2FEZ A;  1W7P D;  5JI6 A;  4D0P A;  3EQL F;  1T38 A;  2L4A A;  2ISY A;  5LBQ A;  5JVT A;  4EGZ A;  2OBP A;  3M9A A;  4LFU A;  1BOA A;  4RGU A;  1HSJ A;  1V4R A;  2FQ3 A;  1P92 A;  3KEQ A;  3TOA A;  2R7D A;  4HBL A;  2COM A;  1WQ2 A;  4JBA A;  4U0Y A;  3QU3 A;  1BC8 C;  2RNJ A;  4G9Y A;  1F9N A;  4P9F A;  4TV7 A;  4EV0 A;  5CVI A;  3L7W A;  2K7L A;  2HOE A;  5LRR A;  4P9U A;  4BQA A;  3F8C A;  1TLH B;  1AWC A;  2CQK A;  1SMT A;  3GYH X;  5DEQ A;  1ZN2 A;  2MBF A;  1JXS A;  3DXJ F;  5JR3 A;  2ETH A;  3P9I A;  1FBQ A;  5D5X B;  5EEH A;  2FNA A;  4QLC U;  2EK5 A;  1U6G A;  5E1Z B;  3CDH A;  3ERE D;  4MNU A;  3ISP A;  1O3R A;  3BPX A;  3CUQ A;  2R7F A;  4HX8 A;  4XLN F;  2LKP A;  4CYD A;  2QVO A;  1SAX A;  5DCF A;  4HZF A;  3H92 A;  4ESF A;  4RAY A;  1FY7 A;  4EM0 B;  1U5T B;  3TDZ C;  2OQR A;  3TO7 A;  2VC0 A;  2DI3 A;  4RGX A;  2GWR A;  1TNT A;  2DO7 A;  3F3X A;  4EQQ A;  3GVA A;  3FXU A;  3VEP A;  4ENJ A;  1RUO A;  3RYP A;  1OKR A;  2YSR A;  2OA4 A;  2ELH A;  2W85 A;  2H27 A;  2FRH A;  1XSV A;  4LLL A;  5L3G A;  1G3Y A;  2K02 A;  5IT3 A;  1XSX A;  3ULQ B;  1KU9 A;  5DCM B;  1O3Q A;  1T6S A;  1S6L A;  3FHZ A;  2XAQ A;  3BZ6 A;  4EM2 A;  2FBI A;  1H9G A;  2VOO A;  3HRS A;  2OZ6 A;  1YW7 A;  2GZW A;  1I5Z A;  3E97 A;  4L9T A;  4G7Z F;  4HQM A;  2O0Y A;  2FML A;  3BJA A;  2RV8 A;  1JE8 A;  3R60 A;  4P96 A;  3GX4 X;  3HHH A;  2F5D A;  3B73 A;  4S05 A;  1B59 A;  3PQJ A;  2XAG A;  1FBS A;  4EJW A;  2WWY A;  4ZH4 F;  3KP4 A;  2CO5 A;  3C7J A;  1W4M A;  5CVU A;  2IP2 A;  1ZRE A;  2Y48 A;  2A69 F;  1FC3 A;  5HS8 A;  1FYM A;  1J5Y A;  3E3V A;  2GAU A;  3DV8 A;  4LB5 A;  1UHM A;  4L9N A;  5LGU A;  5DD8 A;  1WWX A;  2L02 A;  2HFH A;  4ESJ A;  3ELK A;  4AD9 A;  3AAF A;  3HTU A;  2ZCW A;  2J5O A;  3SZT A;  4RB3 C;  5LGT A;  5FB2 A;  5HS7 A;  1W5T A;  4G6Q A;  1UFM A;  5HOO A;  3E5X A;  1ZG3 A;  1K78 A;  2MH9 A;  1O57 A;  3TQN A;  1J2X A;  4ENN A;  4LK0 F;  1PDN C;  4IRG A;  4MEY F;  2QBY A;  4UVA A;  3IRR A;  4A12 A;  4H0E A;  2H6C A;  2VC1 A;  5K5Q A;  2HYF A;  1R5G A;  2XRN A;  3ZP5 A;  2JRT A;  1ZAR A;  2P7V B;  1ZLK A;  2ACJ A;  4L0Z B;  2VOP A;  4YG2 F;  3T8T A;  2Z5U A;  5E20 A;  1IXS B;  4ZZL A;  4U0W A;  1BN5 A;  2CFX A;  5ILV A;  3GO5 A;  4UV8 A;  2QWW A;  3U2R A;  2F5C A;  3LQR A;  2DK8 A;  5KK1 A;  3FM3 A;  3WTW C;  1EH8 A;  1SD7 A;  2JZY A;  5FD6 A;  4RGS A;  2OD5 A;  3JSP A;  4LK1 F;  1AOY A;  4HAM A;  5ILU A;  2LSO A;  1SFE A;  3GW2 A;  4IVN A;  3ZPL A;  2IRF G;  2EWN A;  1LB2 A;  2DU9 A;  1KQ9 A;  3RTR A;  3V7R A;  2M5W A;  2EFQ A;  1FYL A;  1ULY A;  3FX3 A;  2M87 A;  1R1T A;  2A6E F;  2Q8K A;  5F6F A;  2STT A;  1O3T A;  1I1G A;  5J8F A;  5D8L B;  2IA0 A;  2R3S A;  4M6X A;  3J81 K;  3KP2 A;  3ZMT A;  2RQP A;  1YYV A;  3TKY A;  3GFJ A;  1XD7 A;  4KNY A;  4KYW A;  5D4S A;  4WXC A;  1MGT A;  5BPI A;  2Z9O A;  3ZN1 A;  3GFL A;  2KRF A;  3T1B A;  1EV7 A;  3QPT A;  3GXO A;  1SMY F;  1TW3 A;  1UCR A;  2ZJ2 A;  1KQ0 A;  5CVR A;  5D5V B;  1IRG A;  1T0F A;  5F1R A;  1YG2 A;  1K7A A;  3C1D A;  1P4W A;  4DNC A;  2KIU A;  3WE3 A;  3LA2 A;  2XAS A;  2PMU A;  3EYY A;  2XAH A;  1WSU A;  3LA3 A;  3RPU A;  1BIB A;  3ZQ7 A;  3LFK A;  2GXG A;  3ABT A;  2LDU A;  1FNN A;  3WG9 A;  3QOP A;  3QAH A;  4KN7 X;  2HKO A;  2VBY A;  4AWX B;  1KYZ A;  3CO6 C;  5AIP A;  2ZXJ A;  3HUG A;  3RKY A;  2KJC A;  1IF1 A;  4AIK A;  3V8K A;  4HW0 A;  4OIP F;  4ZYH A;  2GA2 A;  1T39 A;  1E17 A;  4P55 A;  1IRF A;  3R0J A;  3IWF A;  4P5O A;  5JHU A;  1Z6R A;  5BPD A;  3DKW A;  4L5J A;  5BS6 A;  2ZBK A;  4CIC A;  2P4W A;  4ENK A;  1YW8 A;  2OAZ A;  2ZME B;  3M7G A;  5D4R A;  1T2K A;  3PQK A;  4HF1 A;  1F4K A;  5LLQ A;  4LD5 A;  2L54 A;  3QU6 A;  2AXL A;  1XGO A;  3ML6 A;  3WGG A;  2CG4 A;  1I27 A;  1FWZ A;  4Y15 A;  2IPQ X;  3VB2 A;  3E5Q A;  2QBY B;  3WTU C;  2BV6 A;  4XSZ F;  4L0Y B;  1HXD A;  4ON0 A;  1D8K A;  4M9X A;  4KN4 X;  2HYG D;  1MJA A;  1LEA A;  4KT5 C;  2OZU A;  2GQQ A;  1QQI A;  4MTD A;  5K1Y A;  2NAZ A;  5DYM A;  3ECH A;  1QZZ A;  1QZY A;  2P8T A;  4R8H A;  1C0W A;  1BI1 A;  1EH6 A;  3LQQ A;  2EA4 A;  3F22 A;  4GCV A;  3HSE A;  4UXN A;  3J80 Z;  2QQB A;  3GFI A;  4RB0 A;  4LLN A;  3SXY A;  4M71 A;  2WC2 A;  3JW4 A;  1D3Y A;  3K9T A;  2FA5 A;  5LHG A;  3I59 A;  4Z2Y A;  3G73 A;  5FD5 A;  4IXA A;  4OOI A;  4O6J A;  4B09 A;  4HX7 A;  2G7H A;  4M72 A;  1STZ A;  3JTH A;  3HSF A;  2D1H A;  2VT3 A;  1SD4 A;  4Q4Z F;  1A04 A;  1TQM A;  2FF4 A;  2QLZ A;  1YS7 A;  5J8C A;  1IW7 F;  3OOP A;  3GF2 A;  3FF5 A;  1XB4 A;  5IT9 Z;  5A2Q K;  2K86 A;  5CVV A;  3KCC A;  1J59 A;  3M8E A;  4WX9 A;  4YFK F;  2J5P A;  2Q0O A;  2MC3 A;  4G8X A;  3KEO A;  1MKM A;  2YU3 A;  2NNY A;  3MQ0 A;  4ASN A;  4BYY A;  1KA8 A;  2D2W A;  1MDM B;  3ZMU A;  2PN6 A;  1XCV A;  3WTV C;  3GWZ A;  2ESN A;  2DPU A;  2DFI A;  4MGR A;  4I02 A;  1P4A A;  4HV5 A;  3T5X A;  2P6S A;  1IUY A;  1FSH A;  4HQE A;  1YO5 C;  4HDV A;  2PG4 A;  3V4G A;  1XGS A;  3I4P A;  4A0Z A;  1LJ9 A;  5CJ9 A;  3HOT A;  3DPL C;  5K5R A;  1MJB A;  4BNC A;  4CO8 A;  3PFI A;  5FGM A;  1CGP A;  2ADU A;  1BI2 A;  3WE2 A;  1R7J A;  1P2F A;  2X0L A;  2XVC A;  3R4K A;  3NRV A;  2H09 A;  2D1V A;  4QWQ A;  3F8F A;  1ON2 A;  3MEX A;  1H0M A;  3RJP A;  4JQF A;  3Q9S A;  4I0A A;  3P7N A;  3ZN0 A;  2ZNZ A;  3CTA A;  4N0B A;  4PZJ A;  2PBI A;  1YFH A;  1Z6T A;  1FYK A;  1FT9 A;  2LNB A;  4LLG F;  1ONV A;  5DDG A;  3KLO A;  4GO1 A;  1QGP A;  3F8N A;  3HHG A;  3DF8 A;  4BXU A;  3DPT A;  3CLO A;  4G7H F;  2XUB A;  2VT2 A;  1ZHF A;  1YQA A;  4A5N A;  2YX4 A;  1D5V A;  4OIN F;  2RN7 A;  4KMU X;  3BOQ A;  5CYV A;  2HTS A;  4RB2 C;  4IRI A;  1FPQ A;  3I5U A;  4B8X A;  1LQ1 A;  4MTE A;  3I54 A;  1S29 A;  2FE3 A;  4HLX A;  1VTN C;  2PFB A;  2LF7 A;  3L2C A;  3CO7 C;  2DK5 A;  2G7U A;  2DQL A;  5L3B A;  2GXB A;  1HST A;  1U8R A;  2A5Y B;  2BE5 F;  5FLX K;  1USS A;  4FT8 A;  3MWM A;  1O3S A;  3V8J A;  1SD6 A;  1RUN A;  4PGG A;  4MQV A;  2UXX A;  5TRD A;  1FLI A;  3KET A;  2QQ9 A;  2M30 A;  3ROU A;  1CF7 A;  1O7F A;  2EV0 A;  3D0S A;  1GXP A;  1P4X A;  3H3U A;  3C3W A;  3M8F A;  4CGZ A;  3JAM K;  5BMZ A;  2RVC A;  2A68 F;  2Y75 A;  1BJA A;  2UWM A;  1LDD A;  2L3D A;  2V1X A;  5HLG A;  2V1D A;  3I59 B;  1G3W A;  2HEO A;  2ZME A;  4E70 A;  3IKT A;  1XCB A;  2IT0 A;  1WI9 A;  5E8I A;  1ZRC A;  1BI3 A;  4WXH A;  5H20 A;  3WOD F;  5E1W A;  1S7A A;  2RC4 A;  1HW1 A;  1GXQ A;  3R0A A;  1S8N A;  4OIO F;  3BDD A;  4L5I A;  2JPB A;  5CVJ A;  3IKV A;  2W25 A;  3HOS A;  4A2U A;  4GYG A;  4CXF A;  4U7D A;  4RB1 A;  5J6X A;  2HS5 A;  1FSE A;  5ICF A;  3MFK A;  2JT1 A;  4LMY A;  4OMZ A;  3EUH A;  2H94 A;  1D8J A;  2ZO4 A;  4KIB A;  1Y0U A;  1LVA A;  2F5E A;  3LAP A;  4M9S A;  3G3Z A;  3V8L A;  3ZMD A;  1S7O A;  2DAO A;  2NYX A;  1HW5 A;  5FFX A;  2DLL A;  5D8K B;  2UXN A;  3BP8 A;  3IHU A;  2JSC A;  2PMH A;  5D5W B;  4BH9 A;  2VOD A;  4R1H A;  1IXR C;  4G94 A;  1RIO H;  1YLF A;  1ODD A;  3P9K A;  2EV6 A;  6PAX A;  1ZGA A;  1MJ9 A;  4A0Y A;  2HTJ A;  4OIQ F;  2MA3 A;  2YX7 A;  3O3K A;  3WTZ A;  4MHG A;  1W7P B;  2Q2E A;  2H6B A;  3B02 A;  3GZ5 A;  3FXR A;  2QYO A;  4ZYD A;  2IVM A;  3L09 A;  1L3L A;  3REO A;  2QM3 A;  4EGY A;  5E1X A;  1O7L A;  4KA4 A;  1FZP B;  4Y13 A;  4S04 A;  4HX4 A;  4UVC A;  3CJN A;  4UV9 A;  1MDM A;  2RKH A;  1B9N A;  3QP6 A;  5BQT A;  3RKW A;  2XIG A;  4LJZ F;  2W24 A;  3I71 A;  3KZZ A;  2O6G E;  4EVI A;  4I7H A;  5HDK A;  2Z3Y A;  2G9W A;  1ZG1 A;  4UUV A;  3ECO A;  3J81 Z;  1OYI A;  3ABU A;  2E7W A;  1TTY A;  1BBY A;  2UZK A;  5E17 F;  2V79 A;  4A6E A;  1ZLJ A;  1OR7 A;  2Z33 A;  4O5V A;  1BM9 A;  3N4M A;  3GLX A;  1ZH5 A;  5DUK A;  1XMK A;  3GUD A;  1MD0 A;  4PGH A;  4KFC A;  2P6T A;  1SFU A;  4I09 A;  2BYV E;  4O3M A;  2VBZ A;  2CSO A;  2WTE A;  3KZY A;  1G3T A;  2KKO A;  1LDK B;  2CGP A;  3RKX A;  3T8R A;  4G7O F;  4IPA A;  4YFX F;  1KYW A;  1IN5 A;  2QUF A;  2CWE A;  4WWC A;  2MLK A;  1QBJ A;  4IF4 A;  3F72 A;  4PDK A;  1CF7 B;  3K1N A;  1H9T A;  4CHU A;  4IHS A;  1WKM A;  1OYY A;  3KE2 A;  3RPQ A;  3C18 A;  1R1U A;  5ED4 A;  4EJU A;  4XBF A;  4K2E A;  1QNT A;  3KP3 A;  2OQG A;  2YR2 A;  5H6R A;  1P6R A;  3FMQ A;  1U78 A;  1UHW A;  3V7C A;  3GEZ A;  1ZAO A;  4HOB A;  2VXZ A;  1FOK A;  4KIF A;  5LEJ A;  3S2W A;  2QEN A;  4RGR A;  2PJP A;  4KUM A;  1JHF A;  2F5F A;  1ZYR F;  4HA8 A;  2FXA A;  1MZB A;  1NHA A;  4NB5 A;  2XKO A;  3H3Z A;  2HR3 A;  4LB6 B;  4YFN F;  1WRJ A;  2PEX A;  4N9I A;  2KIM A;  4PCQ A;  2JTV A;  2D45 A;  3MCZ A;  4YIF A;  1HKS A;  3K69 A;  3KP7 A;  1F5T A;  3J80 K;  1B9M A;  2XKP A;  3BJO A;  3EDP A;  3KP5 A;  3I53 A;  5HLH A;  4IRH A;  4M9Z A;  1KU7 A;  1XSD A;  2K27 A;  4ZYG A;  4DQ2 A;  4UNO A;  3LAJ A;  2WV0 A;  5AIQ A;  1YIO A;  3JTG A;  4OU0 A;  4A0X A;  1IN7 A;  5LHH A;  1R36 A;  2O61 A;  3TDU C;  3EET A;  3NQO A;  1TNS A;  4WF2 A;  1DP7 P;  2HKX A;  3BWG A;  1TQP A;  4XLP F;  5IT9 K;  4LG0 A;  4ETS A;  3L9F A;  2V9V A;  3O6B B;  1J9I A;  1ZG5 A;  1DUX C;  1FX7 A;  3KFW X;  4HDU A;  2C6Y A;  4Q5S F;  4BHP A;  2DW4 A;  4CDG A;  2W84 A;  1J7K A;  1T98 A;  4U0V A;  1LNW A;  1B4A A;  3F21 A;  3FMS A;  3U1D A;  3HRT A;  4AIH A;  1Z9C A;  3RDI A;  2OU2 A;  3F8M A;  5A2Q Z;  1ZRD A;  3F6V A;  3IL2 A;  2A61 A;  2M1B A;  1TW2 A;  1G3S A;  5ICE A;  2LF8 A;  3O2P E;  4BAY A;  3RI4 A;  2DBB A;  2VE8 A;  3QRF F;  1ON1 A;  3U9G A;  3FMR A;  4Q48 A;  1HQC A;  5EEG A;  4F7Z A;  1XDS A;  3GZ6 A;  3BJ6 A;  5JFR A;  4MEX F;  1XGN A;  1R1V A;  4N9H A;  1W7P A;  1PP8 F;  1I1S A;  3K2Z A;  5FFZ A;  2KIF A;  1DPR A;  1G6N A;  4I0B A;  1ZGJ A;  4IJA A;  5DUI A;  4GYI A;  4M74 A;  1Q1H A;  3FXQ A;  2IA2 A;  3LWF A;  2B0L A;  3N97 A;  2V1U A;  5DD4 A;  1LDJ A;  4U88 A;  2E1N A;  4NHJ A;  2Z99 A;  4U7B A;  3R61 A;  2L4M A;  1U2W A;  2DPD A;  4JK1 X;  1SFX A;  1TQI A;  1SD5 A;  1X3U A;  2EFO A;  3WGI A;  1TBX A;  1REP C;  2HQN A;  3IRQ A;  3HRM A;  3P9C A;  2ZFW A;  1BC7 C;  2MLG A;  2O8X A;  5ILS A;  2K4B A; 
#chains in the Genus database with same CATH topology
 3HPG A;  2Y0S A;  4A5M A;  1F1Z A;  4DZJ A;  2ZNY A;  1P7I A;  4HF2 A;  2EFN A;  4A6D A;  3VSL A;  2QF7 A;  2NVU B;  1IJW C;  1RNL A;  4XL9 A;  1R5H A;  4R79 A;  4MFD A;  3DBH B;  2M0M A;  1BA5 A;  1LEB A;  3AFH A;  3V7S A;  1JKR C;  1R4M B;  5FJ8 J;  4RAF A;  3PFY A;  4XNF A;  2P81 A;  3K1P A;  2D5V A;  4UY8 I;  3AG4 H;  3FXJ A;  4CZZ A;  3FWE A;  3FXO A;  5L3D A;  3L00 A;  4A3B J;  1XG1 A;  2IS4 A;  4EAT A;  3PL8 A;  2GLO A;  1IN6 A;  2HVS A;  1NG6 A;  4E7K A;  4Z6Y A;  2ZXH A;  3IP4 B;  4M6Y A;  1HKQ A;  1KGS A;  3OIP A;  5HDN A;  2FMY A;  3IAM 2;  1HW2 A;  2XV4 S;  2PJR A;  5ICG A;  3J7Z I;  4WCG A;  2GA1 A;  3DPU A;  1ACI A;  2ID6 A;  3SHF A;  4RM2 A;  1MH3 A;  5FLX Z;  1U5T C;  2Y9Z A;  1HKT A;  4GFB A;  3HJE A;  3J7A O;  2IA1 A;  1ITY A;  4F93 B;  1HBX G;  1WJC A;  4AYB A;  2IS6 A;  3DLL F;  1R6R A;  4NQW A;  2TDX A;  1ETQ A;  2CQ7 A;  3F23 A;  4G6D A;  2VBW A;  3IC7 A;  3WTT C;  2ESH A;  2K9N A;  2ZXI A;  3D5L A;  4PUS A;  5D6E A;  4L9J A;  3SDG A;  3PJR A;  2E1M C;  3WU2 C;  4IQJ A;  1OCZ H;  2W7N A;  1I6X A;  1R00 A;  2FBK A;  3BY6 A;  2FD5 A;  3TL4 X;  3BRO A;  2W82 A;  4V2F A;  1Z7U A;  3E6B A;  2HGC A;  2VE9 A;  1PP7 U;  1YS6 A;  2FU4 A;  1D5Y A;  3JAM Z;  3HM5 A;  3SFZ A;  2DA6 A;  1MMS A;  1E2X A;  2KZG A;  2EB7 A;  3G2B A;  4F3Q A;  1APL C;  3C2G A;  2PMZ A;  5L3F A;  3I0T A;  1R22 A;  3I58 A;  4ESB A;  3HYI A;  3VOE A;  1S7E A;  4HNT A;  3CUO A;  1WJF A;  5HDG A;  1OCT C;  3QQA A;  4FHT A;  2YS9 A;  4E7H A;  4RAZ A;  4LG0 B;  2FNP A;  4I98 B;  2R5Z B;  4UUS A;  1K4T A;  2CW0 F;  1IZ1 A;  1RKT A;  4HF0 A;  1OPC A;  3A01 B;  4B3A A;  4AID A;  1S3J A;  3JCU C;  2YPR A;  1JGS A;  3HIF A;  1W5S A;  2HOT A;  1YJN I;  1J75 A;  4UVB A;  5GAE J;  4FX4 A;  1OYW A;  4A3F J;  2E35 A;  2BBY A;  3DKX A;  3Q9V A;  1T56 A;  2DA1 A;  3I3L A;  4KT6 A;  2IXS A;  4BQQ A;  2E7X A;  5IP6 A;  2VBX A;  3BR1 A;  3CJT B;  1S5L C;  5J47 A;  2HQR A;  1DPU A;  1Y0N A;  3H9Q A;  2ZKZ A;  3QP5 A;  3S2D J;  5FO5 A;  2K85 A;  2VPL A;  2XAF A;  2BVM A;  4IQ4 A;  4M3F A;  3WU0 A;  2JA8 J;  2HZD A;  2NOJ B;  2M4K A;  3DEW A;  3BPV A;  3R6S A;  3BCB A;  2K4J A;  1V5E A;  2XSJ C;  3Q0U A;  1WJD A;  3QWL A;  3SEQ A;  2QQ8 A;  1MBF A;  3K0L A;  1VQN I;  3QYF A;  2VKV A;  1JT0 A;  3W6K B;  4EJT A;  3VOD A;  4UHT A;  4RDU A;  2FOK A;  5LHI A;  2GIV A;  3SQN A;  3KP6 A;  3MZY A;  3NEU A;  4E7S A;  4ENM A;  4FX0 A;  1ZGW A;  3I4M J;  2E19 A;  3D5R C;  1ZRF A;  1EH7 A;  3CUQ B;  2KJB A;  2PQ8 A;  3I56 I;  3TOB A;  4QPO A;  1R71 A;  1RI7 A;  2EJR A;  1QO0 D;  4C2T A;  1OFC X;  1UJ8 A;  2MC4 A;  5ERI A;  3ZMS A;  1XMA A;  1YW9 A;  2DDB A;  1KU2 A;  2P5V A;  4M3G A;  3ABK H;  1XDU A;  1Z1D A;  2IJL A;  1X2N A;  4XLH A;  1GVJ A;  3VYU B;  3WGH A;  5DV5 A;  3BG6 A;  2HU9 A;  4PJM A;  1ETV A;  5JLW A;  4S0H B;  3TO9 A;  2NS0 A;  1MH4 A;  1PJR A;  4IHV A;  2LY2 A;  3QPS A;  3RIR A;  4EJO A;  2DTR A;  4RS8 A;  1NH3 A;  1MW7 A;  4CCJ A;  1YIJ I;  2EIJ H;  1VND A;  3QPH A;  3RYR A;  3COA C;  2K3F A;  2VN2 A;  2A3S A;  4LGW A;  1A6I A;  1GHC A;  3CCY A;  1MMN A;  2KPM A;  1G4D A;  4DOZ A;  3DP7 A;  4E7J A;  3H5R A;  4OMY A;  3DFG A;  3QYE A;  3ZXS A;  3SZP A;  1JTX A;  1WJE A;  2MSY A;  2OCC H;  3FZV A;  2STW A;  1WH7 A;  4XMY A;  2BGC A;  5H6Q A;  1UST A;  1BIA A;  1HF0 A;  2M4G A;  2MH2 A;  2I10 A;  2HZT A;  2JSP A;  4FAS D;  1KQ8 A;  2ECB A;  1V3F A;  3N05 A;  2P5L C;  4AUX A;  3KLN A;  2XAJ A;  5LEK A;  2VON A;  5B1A H;  3WTS C;  3WU1 B;  4M73 A;  2E2H J;  1IUF A;  3DQV C;  5AON A;  1X3W B;  2E1C A;  4YII A;  5FRN A;  5E18 F;  2L01 A;  3OV8 A;  2LOO A;  2ZFU A;  4CCN A;  2X4H A;  1UHS A;  2IW5 A;  1X2M A;  3OYM A;  5BOX A;  1QPM A;  3CLQ A;  1AKH A;  4M3D A;  2M8E A;  1JJ8 C;  5F64 A;  1L0O C;  1U5T A;  2COB A;  4BS9 A;  3HRU A;  2MAB A;  3UR3 C;  3M3Y J;  2DFF A;  2DQR A;  1TP4 A;  4D1Q A;  1IN8 A;  3BZK A;  3HOZ J;  2EFP A;  2FBH A;  2FSW A;  2XHK A;  2NRA C;  2PLY A;  4L18 B;  1GV5 A;  4WXD A;  2Y0M A;  2P7C B;  1B6A A;  4BBR J;  2AS5 F;  3A03 A;  4WK8 F;  4EMS A;  2H8R A;  4KMF A;  3JRB A;  4KIC A;  4L9V A;  4CSW A;  4XRF A;  2V9K A;  3CCQ I;  4KDP A;  1H89 C;  3CP2 A;  4JOM A;  4AIJ A;  4ZDP A;  1XGM A;  2MD5 A;  4KIG A;  4NDL A;  2O3F A;  3MZH A;  3DLA A;  2HWV A;  3C2B A;  1GV2 A;  4GGG A;  3CUQ C;  1CQT A;  4MQ9 F;  1FOY A;  3MAJ A;  5F1J A;  2LVS A;  3ZMV A;  5F0H A;  1X3Z B;  4F52 A;  3ZMZ A;  3E5U A;  4CCL A;  2O9L A;  2Z2S B;  3OMY A;  4XON A;  1ZKG A;  2XRO A;  1Y1W J;  1K6O A;  1X1D A;  4BHB A;  1K61 A;  5DCM A;  2DJI A;  5L3C A;  5LGN A;  2M3A A;  4EJV A;  1RZ4 A;  3HPH A;  3HSR A;  3VFZ A;  1U9N A;  3LL7 A;  5B1B H;  1JKP C;  2A07 F;  1KU3 A;  2LBF A;  5KVR A;  2EV5 A;  2E2J J;  3A4C A;  3E6C C;  2NVY J;  3FM5 A;  1Z91 A;  3IWZ A;  3K4C A;  2RDP A;  1I6H J;  2X1E A;  2K40 A;  5JVG F;  1T95 A;  4NQW B;  2JQ7 A;  5EG0 B;  3HGY A;  3TGN A;  3KPH A;  1R58 A;  4HYE A;  3J81 R;  2VJI A;  3F6O A;  5E8G A;  3T0Y A;  4D7M A;  1YTY A;  1OLT A;  2CFO A;  1FTZ A;  3W6J B;  2M45 A;  4ZZD A;  1OMI A;  1FP2 A;  5E3M A;  2HOS A;  3WTY C;  4C2U A;  3M4O J;  4HV6 A;  5HVQ C;  3CCE I;  2P5K A;  3FBI B;  3K10 A;  2W57 A;  1NTC A;  1I3Q J;  2QZ8 A;  2YUS A;  4JX6 A;  2EA2 A;  3JSO A;  2XAU A;  1NG7 A;  3BTC A;  4XLF A;  4QSH A;  4I01 A;  3GTG J;  2HPM A;  3HTS B;  4GXO A;  1JHH A;  1IXC A;  4IL6 C;  5TJJ A;  2BEO A;  1ENH A;  1ETY A;  1IAW A;  1MBK A;  3Q5F A;  5HS9 A;  5ICC A;  2IBD A;  4BHC A;  4OIR F;  3EYI A;  3GTO J;  1K78 B;  1X1A A;  2JK3 A;  3LST A;  2QQA A;  2WAF A;  3GFM A;  2XGX A;  3VPR A;  3TED A;  4XSX F;  1MBG A;  1U3E M;  1RRJ A;  2PI0 A;  1UB9 A;  1P7J A;  1R23 A;  3K1M A;  4LIV A;  2R7R A;  4AVP A;  3L1P A;  2R7T A;  4UUS B;  2KDZ A;  2R93 J;  4Q47 A;  4EM1 A;  2CYY A;  1IN4 A;  5L3E A;  3WTX C;  3DEU A;  3M1E A;  1DDN A;  3OYD A;  3ZR8 X;  1JUP A;  5CLS A;  2HDC A;  3QPL A;  4D5C A;  4Y17 A;  3I4N J;  1UMQ A;  2RGV A;  4ZDO A;  5LRS A;  4IHT A;  4DYC A;  3ESW B;  3TO6 A;  3LA7 A;  1MBJ A;  2WAD A;  4I2O A;  5HLI A;  1PUE E;  3DBR B;  1W36 D;  3F8B A;  2OV7 A;  2O03 A;  2E5N A;  2CUJ A;  1UAA A;  3E6D A;  1XN7 A;  4UB8 C;  5D5U B;  2V26 A;  1BI0 A;  1J0R A;  2CW8 A;  5D6F A;  2ME6 A;  2A6H F;  2EFW A;  3I64 A;  1B1B A;  1FJL A;  1LE8 B;  3MKW B;  2DYS H;  2V6C A;  3IH3 A;  4HLY A;  2F2E A;  3OYN A;  4A3J J;  1SC7 A;  2AHQ A;  4C30 A;  1FP1 D;  2NNN A;  2JPC A;  1T8I A;  4CCO A;  1Z05 A;  3AKZ A;  1K79 A;  4ZYE A;  3PIO F;  1FBU A;  2FOW A;  5K5O A;  2ISZ A;  4XOP A;  1F36 A;  2PX9 A;  2DT5 A;  1BL0 A;  4GDF A;  1J09 A;  1H88 C;  1WVR A;  2A5W A;  3E6M A;  2FEZ A;  1W7P D;  5JI6 A;  3JRG A;  4D0P A;  2F48 A;  3K6G A;  3EQL F;  1IC8 A;  1T38 A;  2XF5 A;  2L4A A;  2ISY A;  5LBQ A;  2EZL A;  1VI0 A;  5JVT A;  4EGZ A;  5IP7 J;  2OBP A;  3M9A A;  4LFU A;  1TT5 B;  1BOA A;  4RGU A;  1HSJ A;  1V4R A;  3LSR A;  2FQ3 A;  3CCL I;  4LIT A;  1P92 A;  4J19 A;  3KEQ A;  4C3H J;  3TOA A;  1OJL A;  2R7D A;  4HBL A;  5F27 A;  2COM A;  1WQ2 A;  2VQL A;  2ECC A;  4JBA A;  4U0Y A;  3CJR B;  3QU3 A;  1BC8 C;  2RNJ A;  4G9Y A;  1F9N A;  4P9F A;  1AA7 A;  4TV7 A;  4EV0 A;  3ERM A;  3ZQC A;  4AYB N;  5CVI A;  3K70 C;  3H0G J;  1P9Q C;  3L7W A;  5LFA A;  2XDV A;  2K7L A;  2XF6 A;  4B4C A;  5M5X J;  2HOE A;  2IAI A;  4FE7 A;  5LRR A;  3RQI A;  4P9U A;  4BQA A;  3F8C A;  3K4B A;  3MKZ A;  1TLH B;  5EZG A;  1AWC A;  1SFK A;  2R0Q C;  3KX2 A;  2CQK A;  2GOX B;  1HOM A;  1SMT A;  4M3E A;  3GYH X;  3JRH A;  5DEQ A;  3S3N A;  1YJ9 I;  3S2H J;  2CRG A;  1ZN2 A;  2MBF A;  4RMN A;  3DXJ F;  1JXS A;  3DTI A;  1VZ0 A;  1HDP A;  5JR3 A;  2ETH A;  3P9I A;  3PUB A;  4QPQ A;  1FBQ A;  3FDY A;  5D5X B;  2IGM A;  5J4V A;  5EEH A;  2FNA A;  2Y69 H;  3CCJ I;  4QLC U;  2BOL A;  2HXO A;  1Q1V A;  2EK5 A;  2L7Z A;  4CYC A;  5J1Y A;  1U6G A;  3O8G A;  5E1Z B;  3CDH A;  3MVP A;  3ERE D;  4MNU A;  2LTP A;  3LSI A;  3ISP A;  1O3R A;  3BPX A;  3CUQ A;  1JJ6 C;  2R7F A;  4HX8 A;  4XLN F;  2N8G A;  3LSJ A;  2LKP A;  4CYD A;  1LFU P;  1XX5 A;  1WCM J;  2QVO A;  3CC4 I;  2WA0 A;  1SAX A;  2MD0 A;  5DCF A;  4HZF A;  4D5F A;  4IHX A;  1DGR M;  1AKH B;  3P5J A;  1RES A;  3H92 A;  5IOY A;  4ESF A;  4RAY A;  1FY7 A;  4II2 A;  4EM0 B;  1U5T B;  3TDZ C;  2OQR A;  2R7O A;  2LKX A;  3TO7 A;  2VC0 A;  2DI3 A;  3S15 J;  2XGE A;  4RGX A;  2GWR A;  1TNT A;  2DO7 A;  2LYC A;  3F3X A;  4X1E A;  4EQQ A;  5HNH A;  3GVA A;  3G1L A;  2LC2 A;  1MMA A;  3FXU A;  3FHN A;  4N4N B;  3VEP A;  4ENJ A;  1RUO A;  2XF7 A;  3RYP A;  1YOV B;  4BL0 B;  2E1M B;  3VYS B;  1OKR A;  2YSR A;  2OA4 A;  2Y30 A;  2ELJ A;  1RKW A;  2X1D A;  4IEJ A;  2ELH A;  2DT7 B;  1WGX A;  3A1Y A;  2W85 A;  1X1P A;  2GBY A;  5HOD A;  4V2G A;  2H27 A;  2FRH A;  2X85 A;  3CF2 A;  1XSV A;  4LLL A;  2ME0 A;  2DJN A;  3H5A A;  2FUG 2;  4P1W A;  1Y8Q B;  1WJ5 A;  5L3G A;  3FIW A;  3WHB A;  2ZJQ F;  2Q1Z B;  2WAE A;  1G3Y A;  2K02 A;  5IT3 A;  1XSX A;  3ULQ B;  3ZQG A;  1KU9 A;  2X98 A;  5DCM B;  5A2Q R;  2X6W A;  1O3Q A;  2XRL A;  5KAI C;  5HNF A;  2CS3 A;  1T6S A;  4PSW A;  4BDZ A;  1S6L A;  3HXL A;  2HVQ A;  2LBF B;  3FHZ A;  2JA2 A;  2XAQ A;  2Z16 A;  3LSP A;  3BZ6 A;  3NAU A;  2WY7 Q;  4EM2 A;  2L5Q A;  2FBI A;  2VQC A;  1YJW I;  3IV5 A;  2OPT A;  3HDD A;  2QGU A;  1H9G A;  3B6A A;  2VOO A;  1ZR2 A;  1EJ9 A;  3HRS A;  2OZ6 A;  3AG3 H;  1YW7 A;  2GZW A;  2V6E A;  2HI3 A;  1I5Z A;  3E97 A;  4L9T A;  4G7Z F;  1ETK A;  2O0Y A;  4HQM A;  2FML A;  3HOY J;  3LOC A;  3U21 A;  1DU0 A;  3BJA A;  2RV8 A;  1WHU A;  3E0J B;  3OYH A;  1JE8 A;  2M0C A;  3R60 A;  4P96 A;  3Q0W A;  4I76 A;  3HHH A;  5GAH J;  3GX4 X;  5BNG A;  2F5D A;  3B73 A;  4S05 A;  1X1B A;  2DDA A;  2XGC A;  1PVE A;  3JRF A;  1B59 A;  3PQJ A;  3ZCO A;  2XAG A;  1FBS A;  2ZC2 A;  4EJW A;  2WWY A;  2E36 A;  4ZH4 F;  2LD5 A;  2CV1 A;  1POG A;  1XS9 A;  3E1S A;  4G6T B;  4GRI A;  3TP3 A;  3KP4 A;  5M3F J;  2CO5 A;  1X19 A;  3C7J A;  1W4M A;  5CVU A;  3OS1 A;  2IP2 A;  4FE4 A;  1ZRE A;  2MFZ A;  2Y48 A;  2A69 F;  2B63 J;  3JRE A;  1FC3 A;  1Z77 A;  5HS8 A;  1FYM A;  3HKZ N;  1J5Y A;  2CMP A;  1T0F C;  3E3V A;  3PSF A;  5EG0 A;  1LUJ B;  2GAU A;  4A3G J;  3DV8 A;  2ICW G;  2L9V A;  1QPI A;  3BR5 A;  4LB5 A;  1UHM A;  4L9N A;  5LGU A;  3BG7 A;  1PUF A;  5J3L A;  2GIZ A;  3GTM J;  2VJ5 A;  5DD8 A;  2HVR A;  1ETO A;  4H4K C;  1G2H A;  4BAC A;  1WWX A;  2L02 A;  1GT0 C;  2HFH A;  3BR3 A;  4ESJ A;  3ELK A;  4AD9 A;  3AAF A;  4Y33 A;  2OTL I;  4DBR A;  3HTU A;  2LK2 A;  2ZCW A;  4HST A;  1S72 I;  3ZQQ A;  2NVX J;  2J5O A;  3SZT A;  4RB3 C;  2M8G X;  5LGT A;  3PNY A;  5FB2 A;  2OUM A;  5HS7 A;  1W5T A;  4G6Q A;  4XKV A;  3ZGK A;  5EJC A;  5C44 J;  4NC6 A;  1UFM A;  5HOO A;  1MBH A;  3E5X A;  2W48 A;  1ZG3 A;  1K78 A;  2MH9 A;  1O57 A;  3AL0 C;  3IH2 A;  2E5Z A;  3TQN A;  1J2X A;  3ZOB A;  2K9L A;  2P0T A;  1N25 A;  4ENN A;  3LFU A;  3IUO A;  2Y31 A;  1U8B A;  2I8D A;  2EPF A;  5M5W J;  2CUF A;  4RLQ A;  2L9R A;  1W5C C;  1IDZ A;  4LK0 F;  1UG0 A;  3S17 J;  2L7K A;  3PUF A;  1UZC A;  1PDN C;  3HBL A;  4IRG A;  4MEY F;  5J40 A;  2QBY A;  4XR6 A;  4UVA A;  3IAS 2;  2KFD A;  3FKJ A;  3IRR A;  1DU6 A;  3F0C A;  4A12 A;  3OL3 A;  1YI2 I;  4H0E A;  2GM4 A;  2H6C A;  2VC1 A;  5K5Q A;  2HYF A;  1R5G A;  2XRN A;  1Z21 A;  3ZP5 A;  3DEE A;  2JRT A;  1ZAR A;  2P7V B;  1ZLK A;  1D0X A;  4JX5 A;  2ACJ A;  3IH4 A;  3S3O A;  4L0Z B;  2VOP A;  2W00 A;  4A3C J;  4YG2 F;  2EBI A;  3T8T A;  5FLX R;  1LE8 A;  2Z5U A;  5E20 A;  1IXS B;  3VYR B;  4ZZL A;  2BHZ A;  4U0W A;  3HOV J;  3S3M A;  2XB0 X;  1BN5 A;  2CFX A;  3MKL A;  5KCM A;  2OF7 A;  5ILV A;  5E3O A;  2VPR A;  3GO5 A;  2IGK A;  4UV8 A;  4CYC B;  3JRC A;  2QWW A;  1TWG J;  2BY3 A;  3H35 A;  3U2R A;  2F5C A;  3LQR A;  4ZYA A;  1VQP I;  3OIO A;  2DK8 A;  4A93 J;  1YRN A;  1IGN A;  5KK1 A;  2K3P A;  5EGO B;  3FM3 A;  2VKE A;  3WTW C;  1EH8 A;  3OYL A;  1NK3 P;  3OYB A;  1SD7 A;  2JZY A;  5FD6 A;  4IOA F;  2OCE A;  1OCO H;  3TW6 A;  1DQU A;  2OD5 A;  4RGS A;  3JSP A;  2E60 A;  4LK1 F;  1I3A A;  3CMA I;  5EDN A;  1AOY A;  4HAM A;  3JAM R;  4N4O B;  2L9N A;  5ILU A;  4YRV A;  2LSO A;  2AXT C;  2VJ4 A;  1SFE A;  3GW2 A;  2CV0 A;  4IVN A;  3ZPL A;  3DTE A;  3EUK L;  2IRF G;  2RNG A;  2EWN A;  1LB2 A;  5C3E J;  1A31 A;  2DU9 A;  1KQ9 A;  4RLF A;  3RTR A;  3V7R A;  2M5W A;  2KRH A;  2M2E A;  4C2M J;  2EFQ A;  3BR6 A;  1SAU A;  3K7A J;  4A3M J;  1FYL A;  1GVD A;  1ULY A;  2AO9 A;  3FX3 A;  2M87 A;  2XB5 A;  4PJN A;  1R1T A;  4E4H A;  2L2O A;  2A6E F;  2L0K A;  2DFE A;  2Q8K A;  1QU3 A;  5F6F A;  2STT A;  1RR8 C;  1O3T A;  1I1G A;  1U9O A;  4E7I A;  1VFC A;  5J8F A;  3UKG A;  3SDB A;  1XTA A;  2DMP A;  5D8L B;  2IA0 A;  2R3S A;  2VIX A;  1GDT A;  1HCR A;  1LVK A;  2NXN B;  2MG4 A;  4M6X A;  3CC7 I;  3J7Y J;  3J81 K;  4RM3 A;  3KP2 A;  3ZMT A;  1R5I D;  2TCT A;  3H9G A;  2RQP A;  2VXD A;  5M5Y J;  5TIS C;  4IO9 F;  3K4M A;  2DA2 A;  4BJ6 C;  3ABM H;  4E7L A;  1YYV A;  4ZTF A;  3TKY A;  1YHQ I;  2KIS A;  4E7Z A;  3GFJ A;  1BR2 A;  1XD7 A;  4KNY A;  3A0B C;  4KYW A;  5D4S A;  2KQR A;  3FXK A;  4WXC A;  1MGT A;  3BG9 A;  5BPI A;  3L2W A;  2Z9O A;  2VKH A;  3GTK J;  2BXZ A;  3BR2 A;  3HKZ A;  3ZN1 A;  3NWS A;  3GFL A;  4DYR A;  2KRF A;  1WZ2 A;  3BQY A;  1V55 H;  3T1B A;  1EV7 A;  3QPT A;  4J00 A;  3GXO A;  1SMY F;  5EF6 A;  3EUA A;  1V5G A;  1TW3 A;  5TGT A;  1UCR A;  4Y7N J;  2K9S A;  2OJE D;  2ZJ2 A;  1G59 A;  1KQ0 A;  3UNG C;  5CVR A;  5D5V B;  1X4O A;  2VJJ A;  1IRG A;  1T0F A;  4KJZ A;  1VQ4 I;  5F1R A;  1YG2 A;  1K7A A;  3C1D A;  1P4W A;  3OY9 A;  2JWT A;  4DNC A;  1Y56 A;  2KIU A;  3WE3 A;  1GLN A;  3OYA A;  3LA2 A;  3OWT A;  5F08 A;  2R7V A;  2XAS A;  2L7M P;  3CJQ B;  2PMU A;  5C4X J;  3EYY A;  2XAH A;  3KYD B;  4XLA A;  1WSU A;  2IS2 A;  2EIM H;  3LA3 A;  2ID3 A;  1SVO A;  3RPU A;  1BIB A;  3ZQ7 A;  3DBL B;  2QA4 I;  2LMD A;  5GTH C;  3LFK A;  3OSG A;  1FEX A;  2GXG A;  3ABT A;  2R7U A;  2LDU A;  2LY1 A;  2QKM B;  1FNN A;  2F6C A;  3WG9 A;  3QOP A;  2XPV A;  3QAH A;  1I50 J;  4KN7 X;  2HKO A;  1R9T J;  2JVH A;  2VBY A;  3PNV A;  5H2F C;  4AWX B;  3ZQI A;  1KYZ A;  3CO6 C;  5AIP A;  2ZXJ A;  3Q3S A;  3TP0 A;  2X48 A;  3HUG A;  3RKY A;  1BW5 A;  2KJC A;  5EYR A;  5B5E C;  1IF1 A;  1TWF J;  3V8K A;  4AIK A;  4HRI A;  4HW0 A;  4ABZ A;  2B9S A;  4OIP F;  2BY0 A;  1VQO I;  1SAN A;  4ZYH A;  4BUP A;  2GA2 A;  1T39 A;  1E17 A;  2FJ1 A;  2WB1 N;  2DYR H;  2ZSI B;  4P55 A;  1IRF A;  1PUF B;  3R0J A;  3BG5 A;  3IWF A;  4P5O A;  4OAZ A;  3OYG A;  5JHU A;  3ONQ A;  1Z6R A;  1A6Q A;  2FX0 A;  1VF9 A;  5BPD A;  3DKW A;  4L5J A;  2B7E A;  3ZQF A;  4Y3O A;  5BS6 A;  2ZBK A;  4HNV A;  3GTQ J;  4CIC A;  4IKF A;  2P4W A;  4ENK A;  1Y1V J;  2MYS A;  1YW8 A;  2OAZ A;  2ZME B;  3RZD J;  1LKX A;  3M7G A;  4DYQ A;  5D4R A;  1T2K A;  1BJZ A;  3PQK A;  4HF1 A;  1F4K A;  5LLQ A;  4LD5 A;  2L54 A;  3QU6 A;  5ILS A;  3RSN A;  5KAF C;  4BU2 A;  2AQE A;  2AXL A;  1TWA J;  2JA5 J;  1XGO A;  3ML6 A;  3WGG A;  2CG4 A;  1I27 A;  1FWZ A;  2CQN A;  2BW3 A;  4Y15 A;  3OOU A;  5IY5 H;  2IPQ X;  3VB2 A;  3A52 A;  4I6Z A;  2O7O A;  1VQL I;  4OAY A;  3A2K A;  3E5Q A;  5E3N A;  1B8I A;  1VQ5 I;  2QBY B;  3WTU C;  3OL4 A;  1ETW A;  2BV6 A;  1MMD A;  3GTL J;  4XSZ F;  2OTJ I;  4L0Y B;  1HXD A;  2DA4 A;  4X0G A;  4KIS A;  2NOG A;  4ON0 A;  3S1R J;  1D8K A;  4M9X A;  4KN4 X;  2HYG D;  1MJA A;  1LEA A;  3KZI C;  1WI3 A;  2OZU A;  4KT5 C;  1D1C A;  2EH3 A;  3CCS I;  4PFO A;  2LRE A;  2GQQ A;  1FOW A;  1QQI A;  2DOA A;  2DA7 A;  4MTD A;  5K1Y A;  4XQF A;  2NAZ A;  5DYM A;  3ECH A;  2DFH A;  4A3E J;  1QZZ A;  1QZY A;  2P8T A;  4R8H A;  4FTH A;  1C0W A;  2P0W A;  2E2I J;  1RC9 A;  2XPU A;  1BI1 A;  1EH6 A;  2GOM A;  3LQQ A;  4NNJ A;  2X6Y A;  2M35 A;  2EA4 A;  4HEA 2;  1A5J A;  5FKO A;  2X6X A;  3HSE A;  4GCV A;  4UXN A;  3J80 Z;  2QQB A;  3F22 A;  3GFI A;  1AU7 A;  4PJJ A;  4RB0 A;  4LLN A;  1IRZ A;  3SXY A;  4M71 A;  2WC2 A;  3JW4 A;  3OS2 A;  1D3Y A;  3K9T A;  2FA5 A;  1YRN B;  5LHG A;  1V5F A;  3I59 A;  3PSI A;  4Z2Y A;  2IGN A;  2WY8 Q;  1WJB A;  3G73 A;  5FD5 A;  5IYB J;  4IXA A;  3BC8 A;  2KIQ A;  4EEF G;  4OOI A;  4DBQ A;  4O6J A;  4B09 A;  2JUC A;  4HX7 A;  2G7H A;  4M72 A;  1STZ A;  3JTH A;  5GAG J;  3MN2 A;  3H9J A;  2ZB9 A;  4C3J J;  1SVM A;  1D0Z A;  3HSF A;  4RA2 A;  2D1H A;  5F04 A;  1B72 A;  4JYK A;  2VT3 A;  2QKL B;  4QIW N;  3SEZ A;  1SD4 A;  4Q4Z F;  3X2Q H;  3LMM A;  1A04 A;  1TQM A;  2FF4 A;  2QLZ A;  2JUG A;  1YS7 A;  1WJA A;  3G1O A;  5J8C A;  3FK6 A;  1IW7 F;  2GXA A;  3OOP A;  3F9K A;  3TMO A;  2VQG A;  2Q2E B;  2M34 A;  3PIP F;  3GF2 A;  3FF5 A;  1XB4 A;  3K4N A;  5IT9 Z;  4V19 K;  5A2Q K;  1H8A C;  2Y2Z A;  2K86 A;  1KZH A;  4IOC F;  5CVV A;  3D5S C;  3KCC A;  3NAR A;  1J59 A;  5DM6 F;  2JRM A;  2F5V A;  3M8E A;  2ZME C;  2DCE A;  4II3 A;  4WX9 A;  1TT0 A;  4W97 A;  1WFX A;  2J5P A;  4YFK F;  2Q0O A;  1E3O C;  3DU6 A;  2MC3 A;  4DW6 A;  4G8X A;  3KEO A;  1S9H A;  5IYD J;  4BE2 A;  1MKM A;  2DTZ A;  5FKM A;  2YU3 A;  2NNY A;  2HOA A;  3MQ0 A;  1EKE A;  2DOE A;  4ASN A;  4BYY A;  2H1K A;  1HA8 A;  1KA8 A;  3E7L A;  2D2W A;  4BY7 J;  1MDM B;  3ZMU A;  2PN6 A;  1X4P A;  1XCV A;  1TC3 C;  3W2A A;  3WTV C;  3GWZ A;  3AG2 H;  2ESN A;  2DPU A;  2DFI A;  4XIC A;  4MGR A;  5EGO A;  1Y6I A;  3DWL E;  4I02 A;  3WHC A;  1P4A A;  4PK4 A;  3DCF A;  2H8W A;  1LPQ A;  4HV5 A;  3T5X A;  2P6S A;  1RPW A;  4MIM A;  4XK4 A;  3L2V A;  1IUY A;  1FSH A;  4HQE A;  1VQ9 I;  1QA6 A;  1YO5 C;  4HDV A;  1U0J A;  2PG4 A;  3V4G A;  5FKK A;  1NK2 P;  4IHW A;  2DMN A;  2KMU A;  1XGS A;  3EUH C;  3HGG A;  3I4P A;  2WB1 A;  4A0Z A;  3Q0V A;  2F4M B;  2KDO A;  3PNT A;  1LJ9 A;  1ETX A;  2BXY A;  1N78 A;  5CJ9 A;  1LFP A;  2W4S A;  3HOT A;  3DPL C;  2L7F P;  5K5R A;  4J01 A;  2ZXW H;  1SEU A;  1MJB A;  3PO3 J;  4FQG A;  2R7X A;  4BNC A;  4CO8 A;  2M7A A;  3PFI A;  5FGM A;  1CGP A;  2DXI A;  2ADU A;  4BEH B;  5HLT A;  1BI2 A;  3HOU J;  3WE2 A;  2ZJP F;  4F55 A;  1R7J A;  3CCU I;  2IEK A;  1P2F A;  2X0L A;  2XVC A;  3OIQ A;  3R4K A;  3NRV A;  2H09 A;  4KIT B;  4A69 C;  2D1V A;  4XLC A;  4E6K G;  1XC5 A;  2LP0 A;  4BBS J;  4QWQ A;  3F8F A;  1ON2 A;  1YX5 A;  2TRT A;  1GUU A;  3FKI J;  3MEX A;  1BR1 A;  5GTI C;  1H0M A;  2Z1D A;  3RJP A;  3ZRG A;  5K7F A;  4JQF A;  3Q9S A;  4I0A A;  3P7N A;  3ZN0 A;  5DS9 A;  2LKS A;  3GME A;  2ZNZ A;  3C2H A;  1OQY A;  3ASO H;  2BVL A;  3CTA A;  4N0B A;  4PZJ A;  5DM7 F;  3AL0 B;  2CU7 A;  2PBI A;  2CJJ A;  3L2Q A;  1YFH A;  3OR1 C;  1K4S A;  3AG1 H;  4D9J A;  3HUG B;  1Z6T A;  1FYK A;  1VQM I;  3W6V A;  1FT9 A;  2X1C A;  2LNB A;  4LLG F;  1ONV A;  3CDI A;  4PJL A;  4XM3 A;  5DDG A;  1EA3 A;  3KLO A;  4GO1 A;  2DA3 A;  3H3V K;  1QGP A;  3K70 D;  3MKY B;  3F8N A;  3HHG A;  1MBE A;  4M6V A;  3CQZ J;  3DF8 A;  4BXU A;  2BHY A;  3DPT A;  2EQR A;  3CLO A;  4G7H F;  2XUB A;  2VT2 A;  1ZHF A;  2XPW A;  4MLO A;  1YQA A;  4A5N A;  2YX4 A;  1D5V A;  4OIN F;  2RN7 A;  2VKD A;  4KMU X;  4L5E A;  1RET A;  3BOQ A;  3FIS A;  5KNL A;  3M1C A;  5CYV A;  2DMU A;  2HTS A;  4RB2 C;  4IRI A;  1FPQ A;  1OIS A;  3I5U A;  3ZQL A;  4A3K J;  1ORK A;  4B8X A;  3U1K A;  5JHF A;  4A3I J;  3G1M A;  1SFO J;  3BTL A;  1LQ1 A;  2M9H A;  4MTE A;  3I54 A;  1Z7L A;  2DN0 A;  1S29 A;  2FE3 A;  4HLX A;  2R5Y B;  1MND A;  2ZSH B;  1VTN C;  1VQ6 I;  2QSF X;  2PFB A;  2LF7 A;  4RAG A;  3M8J A;  1RR7 A;  2BW3 B;  3ASN H;  2G0E A;  4YEJ A;  1UG2 A;  3L2C A;  3CO7 C;  2DK5 A;  2XGD A;  2MUN A;  2G7U A;  2DQL A;  5L3B A;  1B8I B;  1HST A;  1U8R A;  2GXB A;  2A5Y B;  2BE5 F;  5K7H A;  1ERD A;  3S16 J;  1JTY A;  5EZH A;  1USS A;  5FLX K;  4BJT A;  3KEY A;  1W1W E;  2EIL H;  4FT8 A;  1HDD C;  3HZJ A;  3MWM A;  3RCO A;  2QSG X;  1OR7 C;  1O3S A;  2A6T A;  2HXI A;  2KT0 A;  3OYC A;  3V8J A;  2ELK A;  2RRE A;  3JRD A;  5C4J J;  1SD6 A;  1RUN A;  4PGG A;  4MQV A;  2UXX A;  5E79 C;  3JRA A;  5TRD A;  4BDY A;  2WAQ N;  3SZG A;  1FLI A;  2QQ9 A;  3ROU A;  2M30 A;  3KET A;  1JGG A;  5FLM J;  1CF7 A;  1O7F A;  1R4N B;  2EV0 A;  4X6A J;  2JN6 A;  3D0S A;  3H0D A;  1GXP A;  1P4X A;  3H3U A;  3C3W A;  3M8F A;  4CGZ A;  3CP8 A;  2KRC A;  3W3C A;  3JAM K;  1I39 A;  5BMZ A;  2RVC A;  2A68 F;  2Y75 A;  4XOR A;  1BJA A;  1K6Y A;  2IGO A;  4F92 B;  2UWM A;  1LDD A;  2L3D A;  2V1X A;  1LFB A;  4Y52 J;  4BGD A;  5HLG A;  3SYT A;  2V1D A;  3J7A Y;  3I59 B;  1G3W A;  2HEO A;  2MW8 A;  3GCM A;  1HLV A;  2ZME A;  4E70 A;  3IKT A;  2VLA A;  1XCB A;  3GBG A;  2IT0 A;  1WI9 A;  3KYC B;  5E8I A;  3I55 I;  1ZRC A;  1BI3 A;  2ZJR F;  1PYV A;  2CH0 A;  2R7W A;  4WXH A;  3OYI A;  5H20 A;  3NWT A;  2O5R A;  3WOD F;  5E1W A;  1S7A A;  2RC4 A;  1HW1 A;  1B72 B;  1GXQ A;  3R0A A;  1S8N A;  4OIO F;  2CQX A;  3BDD A;  4L5I A;  2JPB A;  5CVJ A;  2BZT A;  3G4S I;  4AVZ A;  3IKV A;  2W25 A;  3HOS A;  3O8H A;  2DT6 A;  4A2U A;  4BQN A;  4GYG A;  3OR2 C;  2HPI A;  3FK7 A;  4CXF A;  1Z3X A;  4U7D A;  1JUS A;  4RB1 A;  5J6X A;  1XMX A;  2BY1 A;  2HS5 A;  1FSE A;  5ICF A;  3MFK A;  1BW6 A;  2JT1 A;  2E71 A;  1BOB A;  4LMY A;  4OMZ A;  5CQG A;  3EUH A;  2H94 A;  3H5N A;  4CCM A;  1D8J A;  2ZO4 A;  3S93 A;  4KIB A;  3B6C A;  1Y0U A;  1LVA A;  3FXL A;  2UUZ A;  4XN0 A;  4NC8 A;  4ANJ A;  2F5E A;  3LAP A;  4M9S A;  3G3Z A;  3TW7 A;  1QRY A;  3V8L A;  4ZJZ A;  2LY9 A;  3CMY A;  3OYJ A;  3S14 J;  4A3D J;  2R7S A;  1JKO C;  3MZ8 A;  2MVT A;  3ZMD A;  1QVU A;  1S7O A;  3KIO A;  2DAO A;  2NYX A;  4W1U A;  2DMQ A;  2V9P A;  1HW5 A;  5FFX A;  2X6O A;  3PO2 J;  2DLL A;  5D8K B;  3GZN B;  3CD6 I;  2UXN A;  1TWH J;  5LD2 C;  3LSM A;  3RZO J;  3BP8 A;  3IHU A;  3FBN B;  2JSC A;  4BJ5 C;  2PMH A;  3H36 A;  5D5W B;  4BH9 A;  3D1N I;  2VOD A;  4R1H A;  1IXR C;  2L9S A;  3CMM A;  3V42 A;  1O4X A;  1N77 A;  2R7Z J;  4G94 A;  1RIO H;  1YLF A;  1ODD A;  3P9K A;  2HDW A;  2EV6 A;  2KHM A;  3RKQ A;  6PAX A;  1ZGA A;  1MJ9 A;  4IZZ A;  4AC0 A;  4B47 A;  4B3X A;  1VQ7 I;  2XC7 A;  2KZV A;  4UB6 C;  5CPR B;  4A0Y A;  2HTJ A;  4OIQ F;  3RPU D;  2MA3 A;  2YX7 A;  3VYT B;  3O3K A;  2X9D A;  3WTZ A;  4MHG A;  4BXF A;  3LNQ A;  1W7P B;  2Q2E A;  1ZK8 A;  3BR0 A;  4BE1 A;  2LRD A;  2H6B A;  3B02 A;  4HNU A;  3GZ5 A;  4M3B A;  3FXR A;  2HQ5 A;  2QYO A;  4ZYD A;  2IVM A;  2LLK A;  1JI8 A;  3L09 A;  2JA7 J;  5GPC A;  4B44 A;  1L3L A;  2CW7 A;  4AM3 A;  3REO A;  2QM3 A;  4EGY A;  5E1X A;  4HSR A;  3OYF A;  1O7L A;  4KA4 A;  1FZP B;  1D0Y A;  1A36 A;  4Y13 A;  4S04 A;  4HX4 A;  4UVC A;  3CJN A;  4UV9 A;  4A3L J;  1K83 J;  1MDM A;  2RKH A;  2VQH A;  1B9N A;  1IDY A;  3QP6 A;  2BY2 A;  3RKW A;  5BQT A;  2XIG A;  5KHD A;  4LJZ F;  3A0H C;  2W24 A;  3I71 A;  3KZZ A;  1Z3Y A;  2O6G E;  2EZK A;  2DOF A;  4EVI A;  4I7H A;  5HDK A;  2X51 A;  2Z3Y A;  2G9W A;  1FIP A;  1ZG1 A;  4UUV A;  2WV1 A;  3JR9 A;  3M07 A;  2R92 J;  3ECO A;  3HC7 A;  3OS0 A;  3J81 Z;  1OYI A;  3ABU A;  2E7W A;  1TTY A;  1BBY A;  2UZK A;  3CCV I;  5E17 F;  2V79 A;  4A6E A;  2WAQ A;  4HG2 A;  1ZLJ A;  2HNH A;  1MNE A;  1OR7 A;  4CA0 A;  2Z33 A;  4XKC A;  2LG4 A;  3SJM A;  5FRM A;  4LG3 A;  4O5V A;  1BM9 A;  3KYL A;  3N4M A;  3VSK A;  2NVT J;  1FMV A;  1FOX A;  5IYC J;  2HDD A;  4CZC A;  3QYB A;  4YEL A;  4ZC3 A;  4RBO A;  1Z0X A;  3GLX A;  4BEH A;  1R49 A;  4XOT A;  2M7B A;  5DUK A;  1XMK A;  1ZH5 A;  3GUD A;  2RAE A;  5CQE A;  4ZDL A;  4XRS G;  1MD0 A;  1E3H A;  1W36 C;  3CC2 I;  4PGH A;  4KFC A;  2P6T A;  1SFU A;  4I09 A;  2QEX I;  2BYV E;  4XRS A;  4O3M A;  2VBZ A;  2CSO A;  5GAD J;  2WTE A;  3KZY A;  2EIN H;  2I5U A;  2QCO A;  4BXX J;  1G3T A;  1ZTR A;  3S32 A;  2KKO A;  3CZ6 A;  1LDK B;  2F4I A;  2CGP A;  5F0C A;  3RKX A;  1N75 A;  3T8R A;  4G7O F;  4IPA A;  4YFX F;  1KYW A;  4BE0 A;  1IN5 A;  2KLO A;  2DMT A;  1YE9 A;  2QUF A;  1E3P A;  1V54 H;  2CWE A;  4CCK A;  2PJR B;  1FTT A;  4WWC A;  1VQK I;  2YU9 J;  1QHG A;  2AQF A;  2MLK A;  1QBJ A;  1Y8R B;  1IV8 A;  1D1B A;  4IF4 A;  3F72 A;  4PDK A;  1CF7 B;  2K9M A;  4F91 B;  3K1N A;  1H9T A;  2QSH X;  4CHU A;  1UEL B;  4IHS A;  1WKM A;  4I99 C;  3BLY A;  1OYY A;  2E34 A;  3KE2 A;  3ZQH A;  3J7A W;  3RPQ A;  3C18 A;  1FMW A;  1R1U A;  1IO2 A;  5ED4 A;  4EJU A;  4XBF A;  4K2E A;  1QNT A;  2CV2 A;  3KP3 A;  2OQG A;  2YR2 A;  3BT9 A;  4DGW B;  3CES A;  5H6R A;  1P6R A;  3FXM A;  3FMQ A;  1HC8 A;  1U78 A;  1G8X A;  1UHW A;  2KP6 A;  3V7C A;  2DA5 A;  1SVL A;  3GEZ A;  5M3M J;  4JP0 A;  1VQ8 I;  2JVG A;  3L2U A;  4XKB A;  1ZAO A;  4HOB A;  2R5Y A;  2VXZ A;  5K7Z A;  1MNM C;  1FOK A;  4KIF A;  1W0U A;  5LEJ A;  4IX7 A;  4C3I J;  3GLL A;  2EZH A;  3HEF A;  3S2W A;  3I9V 2;  2QEN A;  4RGR A;  2PJP A;  4KUM A;  1JHF A;  2F5F A;  4U87 A;  1ZYR F;  4HA8 A;  2NS8 A;  5FRO A;  2FXA A;  2VI6 A;  1MZB A;  1NHA A;  4NB5 A;  1IG7 A;  2V7F A;  2NVQ J;  2XKO A;  4PFP A;  1Y39 A;  5IPA A;  3H3Z A;  3CF5 F;  2HR3 A;  4LB6 B;  1YX3 A;  3BQZ A;  1OCR H;  4YFN F;  2R4G A;  2R7Q A;  1D1A A;  1WRJ A;  2PEX A;  4BKX A;  4N9I A;  2KIM A;  1XPX A;  1ZEL A;  2WBM A;  4PCQ A;  2JTV A;  4XLE A;  2MGQ A;  2D45 A;  1TZL A;  3MCZ A;  1FIA A;  4YIF A;  1HKS A;  3K69 A;  4FCY A;  3S1Q J;  3KP7 A;  2JMW A;  3J80 K;  1AHD P;  1F5T A;  1B9M A;  1IV6 A;  4DJA A;  1ZQ3 P;  3CDL A;  2XKP A;  3BJO A;  3EDP A;  3KP5 A;  4NUB A;  4YIR X;  3I53 A;  2MZ4 A;  2HYJ A;  2Y9Y A;  5HLH A;  3H1C A;  2Y0S N;  2VUM J;  1T33 A;  3DKY A;  4IRH A;  4M9Z A;  1KU7 A;  1XSD A;  3MD2 A;  2K27 A;  3LSK A;  4ZYG A;  3K4J A;  3LSH A;  4DQ2 A;  3HOX J;  3S1M J;  3TBI A;  4UNO A;  5E3L A;  2DOD A;  2WV0 A;  4PSX A;  5AIQ A;  4XID A;  3LAJ A;  4ITV A;  1YIO A;  3OYK A;  1IRX A;  5F0F A;  1DGW Y;  3S8P A;  3JTG A;  1W0T A;  4OU0 A;  3LSG A;  4A0X A;  3K4K A;  1IN7 A;  5LHH A;  1R36 A;  1MMG A;  2O61 A;  5B66 C;  3TDU C;  3EET A;  3K2A A;  1KON A;  4NC7 A;  3NQO A;  5J1U A;  1TNS A;  3S1N J;  1MIJ A;  3G6E I;  1A35 A;  4WF2 A;  4PJ0 C;  3A02 A;  1DP7 P;  2HKX A;  2VL8 A;  1RQ6 A;  3BWG A;  1TQP A;  4D7N A;  3BG3 A;  4XLP F;  5IT9 K;  3ABL H;  4C9Y A;  4LG0 A;  2R5Z A;  4ETS A;  3L9F A;  2V9V A;  3O6B B;  1J9I A;  3CME I;  1T08 B;  1ZG5 A;  1DUX C;  1FX7 A;  3KFW X;  3A01 A;  4QTR A;  4HDU A;  4BQO A;  4B1R A;  2C6Y A;  4Q5S F;  4BHP A;  2CQQ A;  4OWR B;  4UUT A;  2DW4 A;  4CDG A;  2W84 A;  1J7K A;  1T98 A;  1OCP A;  4U0V A;  1LNW A;  1QHH D;  4LIU A;  2FQ4 A;  1B4A A;  2VAS A;  3F21 A;  3FMS A;  4MFE A;  3L2R A;  2JA6 J;  3U1D A;  1E0E A;  3HRT A;  3QOD A;  4AIH A;  4LOC A;  1Z9C A;  2EIK H;  3RDI A;  1QZE A;  2OU2 A;  3F8M A;  5FKL A;  2V4J C;  1WH5 A;  3VWB A;  5A2Q Z;  3CCR I;  3W2V A;  1ZRD A;  1TWC J;  5B3S H;  3F6V A;  3IL2 A;  2A61 A;  2M1B A;  4FET A;  4DIQ A;  3J80 R;  1TW2 A;  1F43 A;  1G3S A;  4CUG A;  1M1E B;  5ICE A;  2LF8 A;  3O2P E;  4BAY A;  3RI4 A;  2PMZ N;  2OC6 A;  2DBB A;  3HG9 A;  4G12 A;  1JT6 A;  2VE8 A;  5JLX A;  3QRF F;  2CUE A;  3SFI A;  5DTD A;  4Y4R A;  1ON1 A;  4JX4 A;  3U9G A;  1X58 A;  3MMY B;  2IS1 A;  3FMR A;  4Q48 A;  5GP9 A;  1OCC H;  1HQC A;  3DTK A;  1MSE C;  2E1O A;  1DP3 A;  2KL4 A;  5EEG A;  3CCM I;  2UV1 A;  2K5C A;  3GTJ J;  4F7Z A;  2JJ7 A;  3PM1 A;  4BY1 J;  3JRI A;  1XDS A;  2RQQ A;  3BJ6 A;  5JFR A;  2K9Q A;  3OYE A;  3GZ6 A;  4MEX F;  1XGN A;  4XKW A;  4IHY A;  1R1V A;  2H1L A;  3QOE A;  4N9H A;  1W7P A;  2W1O A;  3DU5 A;  3GTP J;  1MSF C;  4B43 A;  2V1N A;  4XN3 A;  4XRM A;  1PP8 F;  1I1S A;  3G71 I;  1YIT I;  4DZP A;  2LH9 A;  3K2Z A;  5FFZ A;  2EZI A;  2LR8 A;  1JKQ C;  2KIF A;  3VDX A;  1EF4 A;  4CH7 A;  1DPR A;  1G6N A;  1Z67 A;  3HL2 A;  4I0B A;  5IT9 R;  1ZGJ A;  3BCA A;  4IJA A;  5DUI A;  4GYI A;  4HPQ A;  1BR4 A;  2NS7 A;  4M74 A;  3OSF A;  1Q1H A;  4MO7 A;  5FKN A;  2XSD C;  3FXQ A;  2IA2 A;  3LWF A;  9ANT A;  2B0L A;  5FLV A;  4ZTJ A;  3BTI A;  3N97 A;  2V1U A;  2LFB A;  5DD4 A;  5EEA A;  3HOW J;  1LDJ A;  4U88 A;  2E1N A;  4NHJ A;  2VB6 A;  2Z99 A;  4U7B A;  4FIS A;  3R61 A;  4NBQ A;  2CUZ A;  1U2W A;  2L4M A;  5GPA A;  2O8K A;  3BTJ A;  2HQA A;  4JK1 X;  1SFX A;  2DPD A;  3BZC A;  3WG7 H;  1TQI A;  5J4Y A;  1SD5 A;  5J1R A;  1X3U A;  2EFO A;  3WGI A;  1TBX A;  2A05 A;  5IOZ A;  5IP9 J;  1REP C;  2HQN A;  4B48 A;  3K4L A;  1QVT A;  3IRQ A;  3W2W A;  3HRM A;  3P9C A;  3RQ4 A;  2F4O B;  1X1C A;  2ZFW A;  1TL8 A;  1WPK A;  5CKT A;  1ZR4 A;  4AU7 A;  1BC7 C;  1JUM A;  2MLG A;  2O8X A;  3HB9 A;  2K4B A;  3EPZ A; 
#chains in the Genus database with same CATH homology
 4A5M A;  1F1Z A;  2ZNY A;  4HF2 A;  2EFN A;  4A6D A;  1RNL A;  1R5H A;  4R79 A;  1LEB A;  3V7S A;  3K1P A;  4CZZ A;  3FWE A;  5L3D A;  3L00 A;  1IN6 A;  4M6Y A;  1HKQ A;  1KGS A;  5HDN A;  2FMY A;  1HW2 A;  2XV4 S;  5ICG A;  4WCG A;  2GA1 A;  3SHF A;  5FLX Z;  1U5T C;  1HKT A;  3J7A O;  2IA1 A;  1HBX G;  4NQW A;  2TDX A;  3F23 A;  4G6D A;  2VBW A;  3IC7 A;  3WTT C;  2ESH A;  3D5L A;  5D6E A;  4L9J A;  1I6X A;  1R00 A;  2FBK A;  3BY6 A;  3BRO A;  1Z7U A;  3E6B A;  2HGC A;  2VE9 A;  1PP7 U;  1YS6 A;  2FU4 A;  3JAM Z;  3SFZ A;  1E2X A;  2EB7 A;  5L3F A;  3I0T A;  1R22 A;  3I58 A;  4ESB A;  3HYI A;  3VOE A;  3CUO A;  5HDG A;  4FHT A;  4RAZ A;  4LG0 B;  2FNP A;  4I98 B;  2CW0 F;  1IZ1 A;  4HF0 A;  1OPC A;  1S3J A;  2YPR A;  1JGS A;  3HIF A;  1W5S A;  1J75 A;  4UVB A;  4FX4 A;  1OYW A;  2BBY A;  3Q9V A;  2E7X A;  2VBX A;  2HQR A;  1DPU A;  2ZKZ A;  3QP5 A;  5FO5 A;  2XAF A;  3WU0 A;  3BPV A;  3R6S A;  2K4J A;  3K0L A;  3W6K B;  4EJT A;  3VOD A;  4UHT A;  2FOK A;  5LHI A;  2GIV A;  3SQN A;  3KP6 A;  3MZY A;  3NEU A;  4ENM A;  4FX0 A;  1ZRF A;  1EH7 A;  3CUQ B;  2KJB A;  2PQ8 A;  3TOB A;  1RI7 A;  2EJR A;  1QO0 D;  5ERI A;  3ZMS A;  1XMA A;  1YW9 A;  1KU2 A;  2P5V A;  1XDU A;  1Z1D A;  2IJL A;  1GVJ A;  3WGH A;  5DV5 A;  3TO9 A;  2NS0 A;  3RIR A;  4EJO A;  2DTR A;  4RS8 A;  3QPH A;  3RYR A;  3COA C;  2VN2 A;  2A3S A;  4LGW A;  1GHC A;  1G4D A;  3DP7 A;  4OMY A;  3DFG A;  3SZP A;  3FZV A;  2STW A;  2BGC A;  5H6Q A;  1UST A;  1BIA A;  2MH2 A;  2HZT A;  1KQ8 A;  1V3F A;  2P5L C;  2VON A;  3KLN A;  2XAJ A;  5LEK A;  3WTS C;  3WU1 B;  4M73 A;  3DQV C;  5AON A;  2E1C A;  4YII A;  5E18 F;  2L01 A;  3OV8 A;  2X4H A;  2IW5 A;  5BOX A;  1QPM A;  2M8E A;  5F64 A;  1L0O C;  1U5T A;  3HRU A;  2DQR A;  1IN8 A;  2EFP A;  2FBH A;  2FSW A;  2XHK A;  2NRA C;  2PLY A;  4L18 B;  4WXD A;  2Y0M A;  2P7C B;  1B6A A;  2AS5 F;  4WK8 F;  4EMS A;  4KMF A;  4KIC A;  4L9V A;  4XRF A;  4KDP A;  4AIJ A;  1XGM A;  2MD5 A;  4KIG A;  2O3F A;  3MZH A;  2HWV A;  4GGG A;  3CUQ C;  4MQ9 F;  3MAJ A;  3ZMV A;  3ZMZ A;  3E5U A;  2XRO A;  1K6O A;  4BHB A;  5DCM A;  5L3C A;  5LGN A;  4EJV A;  1RZ4 A;  3HSR A;  3VFZ A;  2A07 F;  1KU3 A;  5KVR A;  2EV5 A;  3E6C C;  3FM5 A;  1Z91 A;  3IWZ A;  2RDP A;  3TGN A;  1R58 A;  4HYE A;  3F6O A;  5E8G A;  3T0Y A;  1YTY A;  3W6J B;  2M45 A;  4ZZD A;  1OMI A;  1FP2 A;  3WTY C;  4HV6 A;  5HVQ C;  2P5K A;  2W57 A;  2QZ8 A;  2EA2 A;  3JSO A;  4I01 A;  3HTS B;  4GXO A;  1JHH A;  1IXC A;  5TJJ A;  2BEO A;  1IAW A;  3Q5F A;  5HS9 A;  5ICC A;  4BHC A;  4OIR F;  3EYI A;  1K78 B;  3LST A;  2QQA A;  3GFM A;  2XGX A;  4XSX F;  1U3E M;  2PI0 A;  1UB9 A;  1R23 A;  3K1M A;  4AVP A;  4Q47 A;  4EM1 A;  5L3E A;  2CYY A;  1IN4 A;  3WTX C;  3DEU A;  3M1E A;  1DDN A;  5CLS A;  2HDC A;  4Y17 A;  2RGV A;  5LRS A;  4IHT A;  3TO6 A;  3LA7 A;  4I2O A;  5HLI A;  1PUE E;  3F8B A;  2O03 A;  3E6D A;  1XN7 A;  5D5U B;  1BI0 A;  1J0R A;  5D6F A;  2A6H F;  2EFW A;  3I64 A;  1B1B A;  2V6C A;  4HLY A;  2F2E A;  1FP1 D;  2NNN A;  2JPC A;  1Z05 A;  1K79 A;  4ZYE A;  1FBU A;  5K5O A;  2ISZ A;  2DT5 A;  3E6M A;  2FEZ A;  1W7P D;  5JI6 A;  4D0P A;  3EQL F;  1T38 A;  2L4A A;  2ISY A;  5LBQ A;  5JVT A;  4EGZ A;  2OBP A;  3M9A A;  4LFU A;  1BOA A;  4RGU A;  1HSJ A;  1V4R A;  2FQ3 A;  1P92 A;  3KEQ A;  3TOA A;  2R7D A;  4HBL A;  2COM A;  1WQ2 A;  4JBA A;  4U0Y A;  3QU3 A;  1BC8 C;  2RNJ A;  4G9Y A;  1F9N A;  4P9F A;  4TV7 A;  4EV0 A;  5CVI A;  3L7W A;  2K7L A;  2HOE A;  5LRR A;  4P9U A;  4BQA A;  3F8C A;  1TLH B;  1AWC A;  2CQK A;  1SMT A;  3GYH X;  5DEQ A;  1ZN2 A;  2MBF A;  1JXS A;  3DXJ F;  5JR3 A;  2ETH A;  3P9I A;  1FBQ A;  5D5X B;  5EEH A;  2FNA A;  4QLC U;  2EK5 A;  1U6G A;  5E1Z B;  3CDH A;  3ERE D;  4MNU A;  3ISP A;  1O3R A;  3BPX A;  3CUQ A;  2R7F A;  4HX8 A;  4XLN F;  2LKP A;  4CYD A;  2QVO A;  1SAX A;  5DCF A;  4HZF A;  3H92 A;  4ESF A;  4RAY A;  1FY7 A;  4EM0 B;  1U5T B;  3TDZ C;  2OQR A;  3TO7 A;  2VC0 A;  2DI3 A;  4RGX A;  2GWR A;  1TNT A;  2DO7 A;  3F3X A;  4EQQ A;  3GVA A;  3FXU A;  3VEP A;  4ENJ A;  1RUO A;  3RYP A;  1OKR A;  2YSR A;  2OA4 A;  2ELH A;  2W85 A;  2H27 A;  2FRH A;  1XSV A;  4LLL A;  5L3G A;  1G3Y A;  2K02 A;  5IT3 A;  1XSX A;  3ULQ B;  1KU9 A;  5DCM B;  1O3Q A;  1T6S A;  1S6L A;  3FHZ A;  2XAQ A;  3BZ6 A;  4EM2 A;  2FBI A;  1H9G A;  2VOO A;  3HRS A;  2OZ6 A;  1YW7 A;  2GZW A;  1I5Z A;  3E97 A;  4L9T A;  4G7Z F;  4HQM A;  2O0Y A;  2FML A;  3BJA A;  2RV8 A;  1JE8 A;  3R60 A;  4P96 A;  3GX4 X;  3HHH A;  2F5D A;  3B73 A;  4S05 A;  1B59 A;  3PQJ A;  2XAG A;  1FBS A;  4EJW A;  2WWY A;  4ZH4 F;  3KP4 A;  2CO5 A;  3C7J A;  1W4M A;  5CVU A;  2IP2 A;  1ZRE A;  2Y48 A;  2A69 F;  1FC3 A;  5HS8 A;  1FYM A;  1J5Y A;  3E3V A;  2GAU A;  3DV8 A;  4LB5 A;  1UHM A;  4L9N A;  5LGU A;  5DD8 A;  1WWX A;  2L02 A;  2HFH A;  4ESJ A;  3ELK A;  4AD9 A;  3AAF A;  3HTU A;  2ZCW A;  2J5O A;  3SZT A;  4RB3 C;  5LGT A;  5FB2 A;  5HS7 A;  1W5T A;  4G6Q A;  1UFM A;  5HOO A;  3E5X A;  1ZG3 A;  1K78 A;  2MH9 A;  1O57 A;  3TQN A;  1J2X A;  4ENN A;  4LK0 F;  1PDN C;  4IRG A;  4MEY F;  2QBY A;  4UVA A;  3IRR A;  4A12 A;  4H0E A;  2H6C A;  2VC1 A;  5K5Q A;  2HYF A;  1R5G A;  2XRN A;  3ZP5 A;  2JRT A;  1ZAR A;  2P7V B;  1ZLK A;  2ACJ A;  4L0Z B;  2VOP A;  4YG2 F;  3T8T A;  2Z5U A;  5E20 A;  1IXS B;  4ZZL A;  4U0W A;  1BN5 A;  2CFX A;  5ILV A;  3GO5 A;  4UV8 A;  2QWW A;  3U2R A;  2F5C A;  3LQR A;  2DK8 A;  5KK1 A;  3FM3 A;  3WTW C;  1EH8 A;  1SD7 A;  2JZY A;  5FD6 A;  4RGS A;  2OD5 A;  3JSP A;  4LK1 F;  1AOY A;  4HAM A;  5ILU A;  2LSO A;  1SFE A;  3GW2 A;  4IVN A;  3ZPL A;  2IRF G;  2EWN A;  1LB2 A;  2DU9 A;  1KQ9 A;  3RTR A;  3V7R A;  2M5W A;  2EFQ A;  1FYL A;  1ULY A;  3FX3 A;  2M87 A;  1R1T A;  2A6E F;  2Q8K A;  5F6F A;  2STT A;  1O3T A;  1I1G A;  5J8F A;  5D8L B;  2IA0 A;  2R3S A;  4M6X A;  3J81 K;  3KP2 A;  3ZMT A;  2RQP A;  1YYV A;  3TKY A;  3GFJ A;  1XD7 A;  4KNY A;  4KYW A;  5D4S A;  4WXC A;  1MGT A;  5BPI A;  2Z9O A;  3ZN1 A;  3GFL A;  2KRF A;  3T1B A;  1EV7 A;  3QPT A;  3GXO A;  1SMY F;  1TW3 A;  1UCR A;  2ZJ2 A;  1KQ0 A;  5CVR A;  5D5V B;  1IRG A;  1T0F A;  5F1R A;  1YG2 A;  1K7A A;  3C1D A;  1P4W A;  4DNC A;  2KIU A;  3WE3 A;  3LA2 A;  2XAS A;  2PMU A;  3EYY A;  2XAH A;  1WSU A;  3LA3 A;  3RPU A;  1BIB A;  3ZQ7 A;  3LFK A;  2GXG A;  3ABT A;  2LDU A;  1FNN A;  3WG9 A;  3QOP A;  3QAH A;  4KN7 X;  2HKO A;  2VBY A;  4AWX B;  1KYZ A;  3CO6 C;  5AIP A;  2ZXJ A;  3HUG A;  3RKY A;  2KJC A;  1IF1 A;  4AIK A;  3V8K A;  4HW0 A;  4OIP F;  4ZYH A;  2GA2 A;  1T39 A;  1E17 A;  4P55 A;  1IRF A;  3R0J A;  3IWF A;  4P5O A;  5JHU A;  1Z6R A;  5BPD A;  3DKW A;  4L5J A;  5BS6 A;  2ZBK A;  4CIC A;  2P4W A;  4ENK A;  1YW8 A;  2OAZ A;  2ZME B;  3M7G A;  5D4R A;  1T2K A;  3PQK A;  4HF1 A;  1F4K A;  5LLQ A;  4LD5 A;  2L54 A;  3QU6 A;  2AXL A;  1XGO A;  3ML6 A;  3WGG A;  2CG4 A;  1I27 A;  1FWZ A;  4Y15 A;  2IPQ X;  3VB2 A;  3E5Q A;  2QBY B;  3WTU C;  2BV6 A;  4XSZ F;  4L0Y B;  1HXD A;  4ON0 A;  1D8K A;  4M9X A;  4KN4 X;  2HYG D;  1MJA A;  1LEA A;  4KT5 C;  2OZU A;  2GQQ A;  1QQI A;  4MTD A;  5K1Y A;  2NAZ A;  5DYM A;  3ECH A;  1QZZ A;  1QZY A;  2P8T A;  4R8H A;  1C0W A;  1BI1 A;  1EH6 A;  3LQQ A;  2EA4 A;  3F22 A;  4GCV A;  3HSE A;  4UXN A;  3J80 Z;  2QQB A;  3GFI A;  4RB0 A;  4LLN A;  3SXY A;  4M71 A;  2WC2 A;  3JW4 A;  1D3Y A;  3K9T A;  2FA5 A;  5LHG A;  3I59 A;  4Z2Y A;  3G73 A;  5FD5 A;  4IXA A;  4OOI A;  4O6J A;  4B09 A;  4HX7 A;  2G7H A;  4M72 A;  1STZ A;  3JTH A;  3HSF A;  2D1H A;  2VT3 A;  1SD4 A;  4Q4Z F;  1A04 A;  1TQM A;  2FF4 A;  2QLZ A;  1YS7 A;  5J8C A;  1IW7 F;  3OOP A;  3GF2 A;  3FF5 A;  1XB4 A;  5IT9 Z;  5A2Q K;  2K86 A;  5CVV A;  3KCC A;  1J59 A;  3M8E A;  4WX9 A;  4YFK F;  2J5P A;  2Q0O A;  2MC3 A;  4G8X A;  3KEO A;  1MKM A;  2YU3 A;  2NNY A;  3MQ0 A;  4ASN A;  4BYY A;  1KA8 A;  2D2W A;  1MDM B;  3ZMU A;  2PN6 A;  1XCV A;  3WTV C;  3GWZ A;  2ESN A;  2DPU A;  2DFI A;  4MGR A;  4I02 A;  1P4A A;  4HV5 A;  3T5X A;  2P6S A;  1IUY A;  1FSH A;  4HQE A;  1YO5 C;  4HDV A;  2PG4 A;  3V4G A;  1XGS A;  3I4P A;  4A0Z A;  1LJ9 A;  5CJ9 A;  3HOT A;  3DPL C;  5K5R A;  1MJB A;  4BNC A;  4CO8 A;  3PFI A;  5FGM A;  1CGP A;  2ADU A;  1BI2 A;  3WE2 A;  1R7J A;  1P2F A;  2X0L A;  2XVC A;  3R4K A;  3NRV A;  2H09 A;  2D1V A;  4QWQ A;  3F8F A;  1ON2 A;  3MEX A;  1H0M A;  3RJP A;  4JQF A;  3Q9S A;  4I0A A;  3P7N A;  3ZN0 A;  2ZNZ A;  3CTA A;  4N0B A;  4PZJ A;  2PBI A;  1YFH A;  1Z6T A;  1FYK A;  1FT9 A;  2LNB A;  4LLG F;  1ONV A;  5DDG A;  3KLO A;  4GO1 A;  1QGP A;  3F8N A;  3HHG A;  3DF8 A;  4BXU A;  3DPT A;  3CLO A;  4G7H F;  2XUB A;  2VT2 A;  1ZHF A;  1YQA A;  4A5N A;  2YX4 A;  1D5V A;  4OIN F;  2RN7 A;  4KMU X;  3BOQ A;  5CYV A;  2HTS A;  4RB2 C;  4IRI A;  1FPQ A;  3I5U A;  4B8X A;  1LQ1 A;  4MTE A;  3I54 A;  1S29 A;  2FE3 A;  4HLX A;  1VTN C;  2PFB A;  2LF7 A;  3L2C A;  3CO7 C;  2DK5 A;  2G7U A;  2DQL A;  5L3B A;  2GXB A;  1HST A;  1U8R A;  2A5Y B;  2BE5 F;  5FLX K;  1USS A;  4FT8 A;  3MWM A;  1O3S A;  3V8J A;  1SD6 A;  1RUN A;  4PGG A;  4MQV A;  2UXX A;  5TRD A;  1FLI A;  3KET A;  2QQ9 A;  2M30 A;  3ROU A;  1CF7 A;  1O7F A;  2EV0 A;  3D0S A;  1GXP A;  1P4X A;  3H3U A;  3C3W A;  3M8F A;  4CGZ A;  3JAM K;  5BMZ A;  2RVC A;  2A68 F;  2Y75 A;  1BJA A;  2UWM A;  1LDD A;  2L3D A;  2V1X A;  5HLG A;  2V1D A;  3I59 B;  1G3W A;  2HEO A;  2ZME A;  4E70 A;  3IKT A;  1XCB A;  2IT0 A;  1WI9 A;  5E8I A;  1ZRC A;  1BI3 A;  4WXH A;  5H20 A;  3WOD F;  5E1W A;  1S7A A;  2RC4 A;  1HW1 A;  1GXQ A;  3R0A A;  1S8N A;  4OIO F;  3BDD A;  4L5I A;  2JPB A;  5CVJ A;  3IKV A;  2W25 A;  3HOS A;  4A2U A;  4GYG A;  4CXF A;  4U7D A;  4RB1 A;  5J6X A;  2HS5 A;  1FSE A;  5ICF A;  3MFK A;  2JT1 A;  4LMY A;  4OMZ A;  3EUH A;  2H94 A;  1D8J A;  2ZO4 A;  4KIB A;  1Y0U A;  1LVA A;  2F5E A;  3LAP A;  4M9S A;  3G3Z A;  3V8L A;  3ZMD A;  1S7O A;  2DAO A;  2NYX A;  1HW5 A;  5FFX A;  2DLL A;  5D8K B;  2UXN A;  3BP8 A;  3IHU A;  2JSC A;  2PMH A;  5D5W B;  4BH9 A;  2VOD A;  4R1H A;  1IXR C;  4G94 A;  1RIO H;  1YLF A;  1ODD A;  3P9K A;  2EV6 A;  6PAX A;  1ZGA A;  1MJ9 A;  4A0Y A;  2HTJ A;  4OIQ F;  2MA3 A;  2YX7 A;  3O3K A;  3WTZ A;  4MHG A;  1W7P B;  2Q2E A;  2H6B A;  3B02 A;  3GZ5 A;  3FXR A;  2QYO A;  4ZYD A;  2IVM A;  3L09 A;  1L3L A;  3REO A;  2QM3 A;  4EGY A;  5E1X A;  1O7L A;  4KA4 A;  1FZP B;  4Y13 A;  4S04 A;  4HX4 A;  4UVC A;  3CJN A;  4UV9 A;  1MDM A;  2RKH A;  1B9N A;  3QP6 A;  5BQT A;  3RKW A;  2XIG A;  4LJZ F;  2W24 A;  3I71 A;  3KZZ A;  2O6G E;  4EVI A;  4I7H A;  5HDK A;  2Z3Y A;  2G9W A;  1ZG1 A;  4UUV A;  3ECO A;  3J81 Z;  1OYI A;  3ABU A;  2E7W A;  1TTY A;  1BBY A;  2UZK A;  5E17 F;  2V79 A;  4A6E A;  1ZLJ A;  1OR7 A;  2Z33 A;  4O5V A;  1BM9 A;  3N4M A;  3GLX A;  1ZH5 A;  5DUK A;  1XMK A;  3GUD A;  1MD0 A;  4PGH A;  4KFC A;  2P6T A;  1SFU A;  4I09 A;  2BYV E;  4O3M A;  2VBZ A;  2CSO A;  2WTE A;  3KZY A;  1G3T A;  2KKO A;  1LDK B;  2CGP A;  3RKX A;  3T8R A;  4G7O F;  4IPA A;  4YFX F;  1KYW A;  1IN5 A;  2QUF A;  2CWE A;  4WWC A;  2MLK A;  1QBJ A;  4IF4 A;  3F72 A;  4PDK A;  1CF7 B;  3K1N A;  1H9T A;  4CHU A;  4IHS A;  1WKM A;  1OYY A;  3KE2 A;  3RPQ A;  3C18 A;  1R1U A;  5ED4 A;  4EJU A;  4XBF A;  4K2E A;  1QNT A;  3KP3 A;  2OQG A;  2YR2 A;  5H6R A;  1P6R A;  3FMQ A;  1U78 A;  1UHW A;  3V7C A;  3GEZ A;  1ZAO A;  4HOB A;  2VXZ A;  1FOK A;  4KIF A;  5LEJ A;  3S2W A;  2QEN A;  4RGR A;  2PJP A;  4KUM A;  1JHF A;  2F5F A;  1ZYR F;  4HA8 A;  2FXA A;  1MZB A;  1NHA A;  4NB5 A;  2XKO A;  3H3Z A;  2HR3 A;  4LB6 B;  4YFN F;  1WRJ A;  2PEX A;  4N9I A;  2KIM A;  4PCQ A;  2JTV A;  2D45 A;  3MCZ A;  4YIF A;  1HKS A;  3K69 A;  3KP7 A;  1F5T A;  3J80 K;  1B9M A;  2XKP A;  3BJO A;  3EDP A;  3KP5 A;  3I53 A;  5HLH A;  4IRH A;  4M9Z A;  1KU7 A;  1XSD A;  2K27 A;  4ZYG A;  4DQ2 A;  4UNO A;  3LAJ A;  2WV0 A;  5AIQ A;  1YIO A;  3JTG A;  4OU0 A;  4A0X A;  1IN7 A;  5LHH A;  1R36 A;  2O61 A;  3TDU C;  3EET A;  3NQO A;  1TNS A;  4WF2 A;  1DP7 P;  2HKX A;  3BWG A;  1TQP A;  4XLP F;  5IT9 K;  4LG0 A;  4ETS A;  3L9F A;  2V9V A;  3O6B B;  1J9I A;  1ZG5 A;  1DUX C;  1FX7 A;  3KFW X;  4HDU A;  2C6Y A;  4Q5S F;  4BHP A;  2DW4 A;  4CDG A;  2W84 A;  1J7K A;  1T98 A;  4U0V A;  1LNW A;  1B4A A;  3F21 A;  3FMS A;  3U1D A;  3HRT A;  4AIH A;  1Z9C A;  3RDI A;  2OU2 A;  3F8M A;  5A2Q Z;  1ZRD A;  3F6V A;  3IL2 A;  2A61 A;  2M1B A;  1TW2 A;  1G3S A;  5ICE A;  2LF8 A;  3O2P E;  4BAY A;  3RI4 A;  2DBB A;  2VE8 A;  3QRF F;  1ON1 A;  3U9G A;  3FMR A;  4Q48 A;  1HQC A;  5EEG A;  4F7Z A;  1XDS A;  3GZ6 A;  3BJ6 A;  5JFR A;  4MEX F;  1XGN A;  1R1V A;  4N9H A;  1W7P A;  1PP8 F;  1I1S A;  3K2Z A;  5FFZ A;  2KIF A;  1DPR A;  1G6N A;  4I0B A;  1ZGJ A;  4IJA A;  5DUI A;  4GYI A;  4M74 A;  1Q1H A;  3FXQ A;  2IA2 A;  3LWF A;  2B0L A;  3N97 A;  2V1U A;  5DD4 A;  1LDJ A;  4U88 A;  2E1N A;  4NHJ A;  2Z99 A;  4U7B A;  3R61 A;  2L4M A;  1U2W A;  2DPD A;  4JK1 X;  1SFX A;  1TQI A;  1SD5 A;  1X3U A;  2EFO A;  3WGI A;  1TBX A;  1REP C;  2HQN A;  3IRQ A;  3HRM A;  3P9C A;  2ZFW A;  1BC7 C;  2MLG A;  2O8X A;  5ILS A;  2K4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...