2EV5A

Bacillus subtilis manganese transport regulator (mntr) bound to calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
136
structure length
132
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 54
structure length 132
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev5A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev5A02
3BJ6A 3MZHA 1SFUA 3EETA 5LLQA 1OR7A 2PI0A 1SD4A 3QAHA 1RNLA 4WXCA 4EVIA 1EH8A 1BJAA 4WWCA 4NQWA 3V7CA 3REOA 5L3FA 5FLXZ 2D2WA 5FD5A 4JQFA 1KA8A 1FOKA 3ZP5A 1IRGA 3I4PA 2OQGA 6PAXA 3WTXC 1SD7A 2KJBA 4OOIA 2PLYA 1YW7A 1RUOA 2IT0A 3DKWA 2GQQA 4GXOA 3WTSC 2IW5A 3N4MA 1H0MA 2JT1A 3WTZA 5FFXA 4UHTA 3U2RA 4LLGF 1AOYA 1TBXA 3JAMK 2YU3A 1F4KA 2GIVA 3ZQ7A 4YFKF 1CF7B 1ULYA 1PUEE 4N9HA 2WV0A 1T38A 4PZJA 3WGHA 2HKXA 3DQVC 2QZ8A 3WGGA 2DT5A 1S7AA 3JTHA 3ECOA 4LJZF 4M6YA 3ZN0A 4ENKA 4RGRA 3WGIA 5FGMA 2VBXA 3ZPLA 2EV6A 2Z99A 4B8XA 2YSRA 2FQ3A 1FT9A 2DK8A 2H94A 5FB2A 4L9NA 1TNTA 3K1PA 2LSOA 4HF2A 2MD5A 3C7JA 1YO5C 1YW8A 3TDUC 3K2ZA 3TGNA 2TDXA 4AIJA 3IC7A 2XHKA 5HS8A 3KP3A 1LEBA 4A0YA 2MH2A 2BGCA 3R0AA 1P92A 3BJOA 5ICFA 4M71A 1FX7A 2ZKZA 3KE2A 2EFNA 4RGXA 4ZYDA 3GEZA 3ABUA 2FMLA 1ZN2A 5CVUA 3BROA 3NRVA 3BDDA 2RQPA 2DPDA 4DNCA 4O5VA 2QLZA 1FSHA 4P96A 1QNTA 3B02A 5FO5A 5ILVA 2OZUA 3LWFA 4WF2A 2XAFA 1BN5A 2V9VA 1SAXA 1HBXG 2WWYA 3R0JA 5K5QA 2MC3A 3KZZA 2D1VA 1EH6A 2P5KA 3RKXA 1YQAA 4HQMA 3LAPA 4BYYA 1YYVA 1TLHB 3GFMA 2H6BA 2FE3A 4U0VA 3GWZA 2K4JA 3K1MA 2K86A 1KYZA 2RN7A 4ENJA 1HW5A 4ESBA 1LDKB 1D5VA 2STTA 4I01A 1HSTA 4I2OA 1OYIA 3LSTA 1Z1DA 2EA4A 2M30A 4AVPA 3H3ZA 3ZMTA 2QQ9A 3RKWA 3J7AO 1IRFA 3RYPA 1ONVA 3I64A 2Z5UA 3QU6A 1IN5A 5DEQA 1XSVA 3F23A 5DUKA 4ESFA 1UB9A 3PQKA 3T8RA 1IN6A 1USSA 2Q0OA 1HSJA 1USTA 4P9FA 1OKRA 1B9MA 1JXSA 1OMIA 3CUQC 1BC7C 3C3WA 5JHUA 3FMRA 4A5NA 1DP7P 3I5UA 3P7NA 4A2UA 2DQLA 2ADUA 1SFXA 4I7HA 4YIIA 1JGSA 1LJ9A 2FSWA 4UVBA 4B09A 5HS9A 2PBIA 4ZZLA 4UXNA 3RTRA 1EH7A 4ENNA 2JTVA 3M9AA 2NRAC 4A6DA 3BP8A 4CYDA 3O6BB 1J5YA 5HDGA 2F2EA 2O0YA 3CLOA 4FX4A 4EJTA 4MHGA 1UCRA 3TQNA 4MEYF 2OZ6A 5H6QA 3V7RA 2HQRA 2H27A 4KA4A 4ZYHA 2F5EA 3EYIA 1IZ1A 4HLXA 5D4SA 2UXXA 1K78A 5ED4A 1FBQA 4FT8A 1XDUA 2CSOA 3HHGA 4M9SA 2EJRA 4G7OF 1ZGJA 5DV5A 4XLPF 3F8FA 2FBHA 4Q4ZF 1BI0A 1YW9A 3LAJA 2O3FA 4U88A 2E7WA 4AWXB 1BM9A 4AIHA 1TW2A 1KU7A 2A69F 3WE3A 5D5WB 2Y0MA 4KT5C 1FC3A 1U2WA 4HF0A 2GXBA 1G3WA 3K1NA 2FRHA 1U5TC 3ZN1A 1FBUA 5ILSA 2O03A 1WWXA 1KQ0A 4KICA 2RNJA 1D8KA 1J9IA 3ZMDA 2ELHA 4L5JA 1K79A 4A5MA 1FYLA 3R4KA 2QUFA 4JK1X 4S05A 2EFQA 4HQEA 3GFLA 2PJPA 2W25A 4UVAA 3FHZA 4GCVA 1STZA 2IPQX 4JBAA 1S29A 3G3ZA 1PP8F 4OINF 4M6XA 2CYYA 2PN6A 2FNAA 1QQIA 2RVCA 1FWZA 2EWNA 2PEXA 4R1HA 4XRFA 3KLOA 1FSEA 3E6MA 3DFGA 2L3DA 1XCBA 3JSPA 4P5OA 4QWQA 2UWMA 3BPVA 4P55A 4RB0A 3T5XA 2OD5A 1BI2A 3JSOA 2CW0F 1FP1D 1H9GA 4HX8A 3EQLF 1FYMA 2NS0A 3M1EA 3EUHA 2V79A 3HOTA 4KUMA 1YFHA 4ZH4F 3GF2A 4OMYA 3IRQA 5ICGA 3ML6A 1WKMA 4G6QA 2QBYB 3GFIA 2PG4A 3HOSA 2PMHA 4IRGA 1FY7A 1G3TA 2KIFA 3HRMA 1IW7F 3V8JA 3U9GA 2RV8A 4BNCA 2M1BA 1F1ZA 2FXAA 4L18B 3F6OA 3DEUA 1WSUA 4CZZA 4HAMA 2JPCA 3NQOA 2Y75A 3SHFA 1RZ4A 2FF4A 1T0FA 1LDJA 4L5IA 3GZ5A 2KIUA 5LHIA 1SMTA 1TTYA 4LB5A 5BQTA 2FBKA 2K4BA 2VBWA 2RDPA 1J2XA 3QPHA 2DK5A 3F21A 3B73A 3I53A 5F6FA 1RI7A 3R61A 4EJOA 1QO0D 2IJLA 1IF1A 1XB4A 3FM5A 2LF8A 1B6AA 4EQQA 2HYFA 4U0YA 3FXQA 5E8IA 2AXLA 5CVJA 3F8BA 1REPC 4KYWA 1Z91A 1OPCA 3KEOA 3TOBA 5LGTA 1I6XA 4EM0B 4G94A 3P9KA 2VE8A 4N0BA 2DU9A 4OIOF 4EMSA 4IHTA 5DCMA 2NNYA 4MQVA 5IT9K 1T2KA 1SD6A 3QU3A 4KN4X 3F6VA 4U7DA 1TQPA 3E5QA 1HKSA 1ZG3A 4R79A 3TDZC 3WG9A 4MTDA 1R00A 2LDUA 3ABTA 5HLHA 1TQMA 1B4AA 5LHGA 3LA7A 2NAZA 3QRFF 3DPLC 4EJVA 4UNOA 2Q2EA 1ZHFA 2HTSA 2OQRA 1Y0UA 2HOEA 3T8TA 1T39A 2XAJA 1KGSA 2EA2A 3W6KB 3IHUA 3J80K 3G73A 1U6GA 3FWEA 3COAC 4LGWA 3LA2A 3GZ6A 4RGSA 3IL2A 4AD9A 3K0LA 3FZVA 5H6RA 3Q9VA 2CFXA 3WE2A 4BHPA 1KQ9A 2IA2A 3BY6A 2FU4A 3GXOA 1MD0A 4HX7A 3T0YA 1D3YA 2XROA 2P5VA 2L01A 1SD5A 5CVIA 1HQCA 2QQAA 4I0AA 2ISZA 5AIQA 2UZKA 3FMSA 4IJAA 4YG2F 5DDGA 2V1UA 4CDGA 3ELKA 1XD7A 1MJ9A 1I27A 2XAQA 2IA1A 2XIGA 3LQQA 3QPTA 3C18A 4RAZA 3BZ6A 2DPUA 2A68F 5E1WA 2P4WA 4XSZF 1R22A 4PDKA 5LGUA 4IRIA 1HKTA 5E18F 2LF7A 2CGPA 3JAMZ 3ZMSA 2GXGA 2ISYA 3AAFA 2A6EF 1XCVA 4G6DA 3MFKA 4ETSA 4IXAA 4HA8A 1KU2A 4U0WA 2R3SA 2VBZA 2CQKA 4NB5A 4PGHA 2VT3A 5E1XA 2ZO4A 3KEQA 2A3SA 4YIFA 2XV4S 4E70A 4Q47A 3P9CA 4HV5A 3RIRA 2GA2A 4WXDA 3W6JB 2FEZA 1R5GA 4XLNF 1QBJA 3U1DA 1ZH5A 3HRUA 3IWZA 3VB2A 2HYGD 1X3UA 3JW4A 1P2FA 1HW1A 1O3RA 4CHUA 5HVQC 5A2QK 4LD5A 1GVJA 2BV6A 1K78B 1ZLJA 1HW2A 4M72A 4R8HA 4IPAA 1O3TA 5E20A 2J5PA 1XDSA 5FFZA 3KP5A 4RAYA 1JHHA 2F5CA 3V4GA 1GXPA 5E8GA 1R1TA 2E1NA 2Y48A 4L9TA 2VOOA 3E6BA 2EK5A 1ZRCA 1F5TA 5D8LB 4TV7A 3ROUA 2VONA 4MNUA 1UHMA 2JZYA 3DPTA 1ZRFA 1ZYRF 1FLIA 1ZLKA 4Z2YA 1T6SA 5LEJA 2ZNYA 3PQJA 2W57A 2P5LC 4MEXF 3J81K 2E1CA 2WC2A 4MGRA 1R1VA 3FXRA 5LBQA 4OMZA 2IA0A 5D8KB 1KU3A 1BIBA 1NHAA 1V3FA 3PFIA 3V8KA 2HR3A 1LB2A 2Z9OA 2PFBA 2V6CA 2ZNZA 4ZYGA 4A12A 3QP6A 2A07F 1G6NA 4NHJA 1C0WA 3M8EA 1Z7UA 2IRFG 4OIPF 5F64A 2ESNA 1IUYA 4I02A 5DD8A 1WQ2A 4O3MA 3F8NA 2NYXA 3F8CA 4N9IA 3R6SA 1ON1A 1MKMA 1XSXA 3P9IA 3CUQA 1QZYA 1VTNC 4BXUA 5ILUA 3R60A 5BPIA 2L02A 1BIAA 1LDDA 1BC8C 1G3YA 5DD4A 4HYEA 1IXSB 1P4AA 1PDNC 4CXFA 4IHSA 2D45A 5EEHA 5IT3A 1MDMA 1P6RA 4M74A 4M9XA 4WK8F 2MH9A 5J6XA 2MA3A 2D1HA 4CGZA 4RB1A 4FX0A 4HW0A 1YTYA 2R7FA 2IVMA 3ERED 1UFMA 3CJNA 1W5TA 4Q5SF 3HHHA 3I59A 2M45A 3GLXA 3O2PE 3F72A 3ZMUA 2R7DA 1XGMA 3MQ0A 4G9YA 4ZYEA 1KU9A 5LRRA 1F9NA 2FOKA 4Q48A 2DFIA 1H9TA 3TKYA 1Z9CA 4HLYA 3HTSB 3FMQA 5ICCA 5TJJA 4L0ZB 3EYYA 5BS6A 1FPQA 1RUNA 5HDNA 4KIGA 3M8FA 2VE9A 1LVAA 2L4MA 3CUOA 1JHFA 3HRTA 2QVOA 3KZYA 1ZG1A 1L3LA 2X4HA 3HTUA 3CO6C 3DF8A 3FX3A 5AIPA 3Q9SA 2LKPA 2KRFA 5CJ9A 4KNYA 1UHWA 3C1DA 1Z05A 1J7KA 2O8XA 3GFJA 2RC4A 1CGPA 2GWRA 1U3EM 1DDNA 3HSEA 1IN8A 2DI3A 4LLLA 2XKOA 5HOOA 2ESHA 5H20A 4PCQA 5DCMB 1BBYA 4LK0F 3RDIA 1IXRC 2OAZA 5HLGA 2W84A 2MBFA 2HQNA 5BPDA 5FLXK 2DO7A 1YIOA 5E1ZB 1V4RA 4UUVA 1R23A 1TNSA 3I54A 4XSXF 1SMYF 4EGZA 3GX4X 1R7JA 2LNBA 5HDKA 5K1YA 2G7UA 2QQBA 2XRNA 1ZREA 1ZG5A 3HIFA 2QM3A 3SXYA 4YFXF 1S8NA 5BMZA 2EB7A 5LGNA 1FNNA 4RGUA 4HOBA 2L4AA 3GVAA 4G8XA 4GYIA 1WI9A 3CTAA 2WTEA 3KCCA 1YS6A 4EGYA 3KP2A 2Z33A 4XBFA 5L3CA 4U7BA 3GW2A 2CWEA 2JPBA 3N97A 3ISPA 2K02A 1ZRDA 4EJWA 4ON0A 1W7PB 3ULQB 2UXNA 1K6OA 4G7ZF 2FNPA 3I71A 3DV8A 5E17F 3KLNA 3MZYA 3WTTC 1P4WA 1XGSA 3MEXA 4EM1A 5D5UB 2F5FA 2DBBA 4Y17A 3QP5A 4KMUX 2BEOA 2CG4A 2IP2A 3WTVC 4AIKA 1U78A 4HDUA 4I0BA 2ZJ2A 2P7VB 3IKTA 2W85A 4KN7X 2XVCA 1PP7U 4WX9A 4IRHA 1R36A 2PQ8A 2Q8KA 2GA1A 5CLSA 3WU1B 1LEAA 2ACJA 1HXDA 4GGGA 3H3UA 1QZZA 4HDVA 3F22A 2K7LA 3V8LA 2EFWA 1O7FA 2VC0A 2BE5F 2EV0A 3M7GA 4OIRF 1DPRA 3SZPA 2EV5A 2XGXA 2HKOA 3FF5A 5J8CA 2O61A 1W7PA 2A61A 2XASA 2G7HA 3K9TA 3LA3A 1BI1A 1ZARA 3RPQA 3WTWC 3IRRA 1E2XA 5IT9Z 1IXCA 1MJBA 1O3QA 3V7SA 5D6EA 4BHBA 3RYRA 4HV6A 3L7WA 2BYVE 3OV8A 3CO7C 5DUIA 4Y15A 5JI6A 2QWWA 3KFWX 4LFUA 5F1RA 3NEUA 4A0ZA 3ZMZA 5LEKA 2W24A 5JR3A 4UV8A 3HUGA 2C6YA 4L0YB 5ERIA 1ZAOA 4ZZDA 1CF7A 2KIMA 1A04A 1MZBA 1XGNA 5L3GA 3J80Z 4MTEA 1FYKA 5BOXA 4LK1F 4S04A 1OYWA 2H09A 1XMAA 3GYHX 5D5VB 2VBYA 3RI4A 1T98A 2HDCA 1G3SA 3MCZA 2P8TA 2EFPA 4M9ZA 1TW3A 3E5XA 3L00A 1W4MA 2FMYA 3ECHA 1FZPB 3F8MA 3QOPA 1I1GA 4ESJA 5D5XB 3EDPA 4IVNA 1O3SA 3ZMVA 3HYIA 4BAYA 1L0OC 4GYGA 4EM2A 2M87A 4QLCU 4GO1A 3D5LA 3BPXA 4Y13A 3SQNA 3IWFA 5CVRA 4WXHA 2XKPA 2DW4A 3FXUA 2M5WA 2HTJA 2QYOA 1S3JA 3KP6A 3CUQB 4LB6B 2XAHA 5KK1A 2FA5A 3VOEA 2KJCA 3TO7A 3S2WA 1EV7A 2OA4A 2RGVA 4D0PA 1GHCA 5L3BA 2MLKA 1XGOA 2AS5F 4LG0B 3K69A 5LRSA 2GZWA 3FM3A 2XAGA 4PGGA 1MDMB 2O6GE 1KQ8A 4RB2C 5DCFA 5AONA 2FBIA 1BOAA 1Z6RA 1S7OA 4KIFA 2JSCA 2OBPA 2YX7A 2ZCWA 1R1UA 4BQAA 3L9FA 2V1DA 4UV9A 3E6DA 5CVVA 3VEPA 3I59B 3HRSA 5A2QZ 3WU0A 2HEOA 2OU2A 5L3DA 3HSFA 5LHHA 1HKQA 1WRJA 2G9WA 4KMFA 2V1XA 1S6LA 1TQIA 1MJAA 5K5RA 2ZXJA 1B1BA 4I09A 2B0LA 4IF4A 2BBYA 1B9NA 3BJAA 4K2EA 4HF1A 3WODF 1BI3A 1ON2A 3RJPA 5J8FA 2PMUA 1E17A 2JRTA 3WTUC 1FBSA 4LG0A 5D4RA 3Q5FA 1W7PD 2KKOA 2X0LA 4LLNA 1QGPA 4F7ZA 1QPMA 3E5UA 1U5TB 2ZBKA 2EFOA 3WTYC 4BHCA 2A5YB 4UVCA 2GAUA 2QENA 3DP7A 1W5SA 3MWMA 3T1BA 1JE8A 1IN4A 2VT2A 4ASNA 4KIBA 4HZFA 3J81Z 1U8RA 4KDPA 1J0RA 2XUBA 3O3KA 1D8JA 2L54A 4CICA 4L9VA 5FD6A 1SFEA 1ODDA 1GXQA 1FP2A 2P6TA 2HZTA 3KP4A 3I58A 2P6SA 4HX4A 3SZTA 1MGTA 2P7CB 3BWGA 5DYMA 2VODA 1YLFA 3TOAA 1LQ1A 3MAJA 4EJUA 1DPUA 1P4XA 2VC1A 5TRDA 4P9UA 3VODA 4YFNF 3KP7A 3RKYA 4RS8A 4OU0A 1O57A 1B59A 2DLLA 3E97A 4H0EA 4O6JA 4I98B 5D6FA 2YPRA 2ZMEB 2CO5A 2VN2A 2ETHA 4CO8A 5K5OA 1U5TA 3IKVA 4L9JA 2F5DA 2NNNA 4OIQF 3LFKA 3TO6A 5ICEA 3D0SA 5KVRA 1XN7A 1I5ZA 2HFHA 1IN7A 2Z3YA 2H6CA 1Z6TA 5CYVA 3LQRA 1IAWA 2YR2A 1R58A 4ENMA 3BOQA 4KFCA 1R5HA 2YX4A 2DQRA 4BH9A 1K7AA 2VOPA 3L2CA 2HWVA 4FHTA 2MLGA 1O7LA 2K27A 3L09A 3DXJF 3CDHA 3E6CC 1I1SA 3F3XA 5HS7A 4A0XA 5JFRA 1LNWA 2HGCA 4G7HF 2STWA 2VXZA 3OOPA 3TO9A 3I0TA 5EEGA 2RKHA 3GO5A 1KYWA 3VFZA 3SFZA 2ZFWA 4RB3C 4HBLA 4M73A 3KETA 5L3EA 2ZMEA 3E3VA 1XMKA 1XSDA 3HSRA 1J75A 4A6EA 3H92A 5JVTA 4LMYA 2DTRA 5HLIA 3JTGA 1YG2A 3GUDA 1OYYA 4MQ9F 2HS5A 1YS7A 2E7XA 1J59A 1ZGAA 2DAOA 2M8EA 2A6HF 1Q1HA 1RIOH 4WCGA 1DUXC 2QBYA 3RPUA 2COMA 1G4DA 4EV0A 4DQ2A 1AWCA 2J5OA
chains in the Genus database with same CATH superfamily
3BJ6A 4N4NB 3MZHA 2AO9A 1SFUA 1EF4A 1WCMJ 3HL2A 3EETA 3K4CA 5LLQA 2R5YB 3GTOJ 3RCOA 1OR7A 2PI0A 1SD4A 4J19A 3K7AJ 3I56I 3QAHA 3DU5A 1RNLA 2XPWA 4WXCA 4EVIA 3E0JB 3IV5A 2JA2A 4BQQA 4XR6A 2QSFX 1TWHJ 1EH8A 1BJAA 2O7OA 4WWCA 3CP2A 3FXMA 4NQWA 3V7CA 3REOA 1BR2A 4Z6YA 3A2KA 2DYRH 4A3DJ 1K6YA 3D5SC 5L3FA 5FLXZ 2D2WA 4C30A 3BR2A 5FD5A 4JQFA 5DM7F 1KA8A 1FOKA 5A2QR 3ZP5A 1IRGA 3I4PA 2OQGA 6PAXA 3GTKJ 4HRIA 4L5EA 3WTXC 1SD7A 3B6AA 2KJBA 2B9SA 4OOIA 3C2BA 1MBFA 2PLYA 1YW7A 1BJZA 4E7LA 3I55I 1RUOA 2IT0A 3DKWA 4E6KG 2GQQA 2E36A 4GXOA 3WTSC 2IW5A 3N4MA 3PO3J 1H0MA 2JT1A 2DA5A 3WTZA 5FFXA 4UHTA 3OYJA 3U2RA 4LLGF 4DIQA 1AOYA 2KHMA 5GTHC 3VWBA 2O9LA 1TBXA 3ABKH 3JAMK 3S1MJ 3MKWB 2XC7A 2YU3A 1F4KA 3HUGB 4D5FA 4AIDA 3PSIA 2GIVA 1F36A 3ZQ7A 4YFKF 1CF7B 1ZELA 2DA3A 1MNMC 2R7XA 3PNVA 1ULYA 1PUEE 2KLOA 2WV0A 4N9HA 1T38A 2Z2SB 2PMZA 4PZJA 3ZXSA 3WGHA 2HKXA 3DQVC 2QZ8A 3J7AW 3WGGA 2DT5A 1QU3A 1S7AA 4IHVA 3JTHA 4C3IJ 2L7KA 4YEJA 3ECOA 4LJZF 4M6YA 1IDYA 2R5YA 1LPQA 2CQQA 3ZN0A 3MKZA 4ENKA 2L9NA 4RGRA 4DW6A 3WGIA 5FGMA 4DZJA 2VBXA 2DA7A 3CCYA 3ZPLA 2EV6A 3J81R 2Z99A 4MFEA 4B8XA 2YSRA 2FQ3A 1FT9A 2DK8A 2H94A 2LBFA 5FB2A 4IO9F 4L9NA 1TNTA 2LP0A 3K1PA 1SAUA 2LSOA 1MH4A 2WB1N 5FKMA 4YELA 2IAIA 2E1MB 2MABA 4HF2A 2RREA 1OISA 2VJJA 3D5RC 2MD5A 3C7JA 2W48A 1YO5C 3M3YJ 1YW8A 3TDUC 3K2ZA 2EZLA 3TGNA 2TDXA 4AIJA 3IC7A 2I5UA 4I6ZA 2ID3A 2XHKA 4M3EA 3G1LA 5HS8A 3KP3A 3LNQA 1LEBA 4A0YA 1WH5A 1OCRH 1PUFB 3QYBA 2MH2A 2JQ7A 1ETQA 3V42A 2XF7A 2BGCA 3R0AA 1P92A 3BJOA 1Z77A 3A1YA 3BR5A 4Y3OA 5ICFA 4M71A 1FX7A 5IYCJ 1LFUP 4D9JA 2ZKZA 4BJTA 2M0MA 3KE2A 2EFNA 4RGXA 4ZYDA 3GEZA 3ABUA 2K9NA 2FMLA 1ZN2A 2LREA 3OL3A 4CCKA 3L1PA 5CVUA 5TISC 3DBRB 3L2QA 3UR3C 3FXOA 1ETKA 3CC7I 5F0FA 2BXYA 4UUSB 3BROA 4JX6A 3NRVA 3BDDA 1XX5A 4JP0A 2RQPA 2DPDA 1WJBA 3AG2H 2UV1A 3HEFA 4DNCA 4O5VA 2QLZA 4Y4RA 1FSHA 4P96A 4AUXA 3S3MA 1QNTA 3B02A 5FO5A 5B3SH 5ILVA 1YOVB 4F3QA 2OZUA 5KCMA 2X6XA 3LWFA 4WF2A 1Y1WJ 2XAFA 1BN5A 2UUZA 2V9VA 1JKPC 3CDIA 1SAXA 3HOWJ 1HBXG 2WWYA 3R0JA 4E7IA 3KYCB 5K5QA 2MC3A 3KZZA 3M4OJ 2IXSA 1ENHA 2D1VA 4E7ZA 1EH6A 2P5KA 2A05A 3RKXA 1QPIA 1YQAA 4HQMA 4I76A 3LAPA 3HGYA 1YYVA 4BYYA 2M3AA 1TLHB 1U9OA 3GFMA 2H6BA 2FE3A 4U0VA 3GWZA 3CMEI 4ZJZA 2XF6A 2MGQA 4J00A 2K4JA 3K1MA 2K86A 3W6VA 3ZQGA 1KYZA 2RN7A 4ENJA 3BT9A 1HW5A 3H0GJ 4ESBA 1LDKB 1D5VA 2STTA 4I01A 1HSTA 1ZR2A 4I2OA 4U87A 2ICWG 1OYIA 3LSTA 1Z1DA 2KDZA 4IEJA 2EA4A 2M30A 1OFCX 4AVPA 2E34A 3H3ZA 3BR3A 3ZMTA 4B4CA 4EATA 2QQ9A 2WBMA 2VUMJ 3RKWA 4C2UA 3J7AO 1IRFA 1MBHA 3RYPA 3FIWA 1ONVA 3I64A 2Z5UA 3H1CA 1D5YA 3QU6A 3DTKA 1DGWY 1N25A 1VF9A 3H5RA 4NDLA 4BY7J 1IN5A 1YE9A 5DEQA 1XSVA 4UB6C 3F23A 5DUKA 4ESFA 3HXLA 1SVOA 1UB9A 3PQKA 4OAZA 4UUSA 2VLAA 2QEXI 2K40A 4BS9A 4MIMA 3T8RA 5J40A 1IN6A 1A6IA 1USSA 1HSJA 1USTA 2KIQA 2Q0OA 1OCZH 4P9FA 1OKRA 2VQCA 1B9MA 3VSKA 1X1AA 1JXSA 2BZTA 1P7JA 1OMIA 3JCUC 3RPUD 3J7YJ 3CUQC 2BHZA 2LMDA 5GAHJ 1BC7C 3C3WA 3K4KA 5JHUA 3TP0A 3FMRA 4A5NA 1DP7P 2BW3B 2IGKA 3I5UA 3P7NA 1ZGWA 2JN6A 4A2UA 2DQLA 3DKXA 3RZOJ 4RAGA 3CCRI 2ADUA 1SFXA 4I7HA 5B5EC 4YIIA 3S2DJ 2VKHA 1JGSA 1LJ9A 2FSWA 1I39A 1BW6A 4UVBA 4UY8I 1DU6A 2LKXA 3OR1C 4B09A 5HS9A 2PBIA 2DJIA 2OTLI 2GOXB 4UXNA 3RTRA 1EH7A 4ZZLA 1RPWA 4ENNA 2JTVA 2OC6A 1YHQI 3M9AA 1VQNI 1IO2A 2JMWA 2GBYA 2NRAC 4A6DA 5K7ZA 3BP8A 4CYDA 3O6BB 1J5YA 5HDGA 2PX9A 4F55A 1PYVA 2F2EA 2JVGA 2O0YA 4RAFA 3VYSB 3CLOA 2PMZN 3TMOA 4XKBA 1VQPI 4FX4A 1YX5A 1MMNA 2X51A 2DMTA 2AQFA 3HG9A 4EJTA 2CW7A 3OYMA 4MHGA 1UCRA 1LKXA 3GLLA 1BR4A 2COBA 1GV2A 2JSPA 3TQNA 4MEYF 1OCCH 1E0EA 2FD5A 2OZ6A 2VPLA 2WA0A 1OCOH 3Q0UA 5H6QA 2AXTC 5FLXR 3V7RA 1I6HJ 1LFBA 2HQRA 2H27A 4KA4A 4BACA 5DTDA 4ZYHA 2F5EA 4HSTA 3WU2C 3ZQFA 3EYIA 4NBQA 4RDUA 1OCTC 3IUOA 1IZ1A 4HLXA 4A3FJ 5D4SA 2UXXA 1K78A 1FBQA 2NVYJ 4FT8A 1XDUA 2CSOA 4D7NA 5ED4A 1R49A 3HHGA 3HPGA 4M9SA 1D0ZA 2NXNB 2EJRA 3A0BC 4B1RA 2L9RA 3O8GA 4XNFA 4G7OF 2LOOA 1N75A 1ZGJA 3PNYA 1LUJB 3NAUA 5DV5A 4XLPF 2H1KA 2X48A 2CW8A 4NC8A 3F8FA 2FBHA 3ZR8X 2W4SA 4Q4ZF 1BI0A 1YW9A 5E3NA 1D1BA 1G8XA 2R0QC 3LAJA 2O3FA 4U88A 2E7WA 1QHHD 4AWXB 1BM9A 4AIHA 2OCEA 1TW2A 4BE2A 1KU7A 2A69F 4A3JJ 3WE3A 5D5WB 2Y0MA 1TWGJ 1TZLA 4KT5C 2L7ZA 2V1NA 2MC4A 3OYFA 1FC3A 4CSWA 1SEUA 4E7SA 2OF7A 4ZYAA 1U2WA 4HF0A 2F4IA 2GXBA 1B8IA 2EBIA 1G3WA 1NK2P 3K1NA 2FRHA 1U5TC 2ECCA 3E7LA 3IH3A 3ZN1A 1FBUA 5ILSA 5FRNA 3CCLI 2O03A 1WWXA 1KQ0A 4LIVA 4KICA 2RNJA 2ZXHA 4H4KC 3CF5F 4IHXA 1D8KA 1J9IA 2IGNA 5IT9R 1GLNA 4IHYA 1MMDA 3DEWA 3ZMDA 2ELHA 4L5JA 1K79A 1E3OC 2WAEA 1DGRM 4A5MA 1WVRA 3QQAA 1FYLA 3R4KA 2X9DA 2QUFA 3SDBA 4JK1X 4S05A 3U1KA 2EFQA 4HQEA 3GFLA 2PJPA 2W25A 4UVAA 3FHZA 2R5ZB 4GCVA 4JX4A 4LITA 4OWRB 1STZA 2QSGX 2IPQX 3LL7A 2NVXJ 3W2WA 4JBAA 1S29A 5FROA 4A3KJ 3G3ZA 1PP8F 4OINF 4M6XA 3JRCA 1JT0A 2LK2A 2R7SA 4XONA 2CYYA 1HA8A 2PN6A 2DCEA 2FNAA 1QQIA 2RVCA 5C4JJ 1FWZA 2EWNA 2PEXA 4R1HA 5JLWA 4XRFA 4W97A 2M0CA 2CU7A 4RBOA 3KLOA 4B48A 1FSEA 2L9SA 3E6MA 3DFGA 3HOZJ 2L3DA 2V26A 2X6YA 3CESA 1XCBA 3BTJA 2VB6A 3JSPA 3JRBA 1LE8B 4P5OA 4QWQA 5F04A 2UWMA 1MBGA 3BPVA 3IAS2 4P55A 4RB0A 4BBRJ 1VQ8I 5HNHA 5LFAA 2Y9YA 3T5XA 2MUNA 2MZ4A 3OS1A 2ZMEC 2OD5A 3DBHB 4MO7A 5F0CA 1BI2A 2G0EA 3JSOA 2CW0F 1FP1D 1H9GA 2LY1A 4II3A 4HX8A 3EQLF 1MBJA 2WB1A 1FYMA 1OJLA 2NS0A 3M1EA 4XRSA 3EUHA 2V79A 2JA6J 3CJTB 2JK3A 3HOTA 4KUMA 1YFHA 3S1QJ 3C2GA 4ZH4F 3GF2A 4OMYA 2LC2A 5FKLA 3IRQA 2HOSA 3FKIJ 2PJRA 5ICGA 3ML6A 1WKMA 2CV1A 2QA4I 4G6QA 2QBYB 3GFIA 1ZTRA 2PG4A 1WI3A 3HOSA 2WAQN 3ERMA 2PMHA 2VQHA 1WFXA 2H8WA 5IOZA 4IRGA 1R4MB 1FY7A 3PUBA 4PFOA 3M1CA 1G3TA 1NTCA 2KIFA 1S72I 5CKTA 3HRMA 3LMMA 5TGTA 1IW7F 1JUSA 3V8JA 1JKRC 3LOCA 1OLTA 2ZJPF 3U9GA 4C2TA 4XLEA 2RV8A 3NWTA 3I4MJ 2VKVA 4BNCA 3JRDA 1OR7C 2M1BA 1F1ZA 4KJZA 2FXAA 4L18B 2HYJA 3F6OA 2XF5A 3G2BA 4IKFA 3DEUA 4BJ5C 4JX5A 3H0DA 3ZQLA 1WSUA 2XGDA 5H2FC 2QF7A 3W2VA 4CZZA 4HAMA 2JPCA 3NQOA 2Y75A 3SHFA 1E3HA 1RZ4A 2FF4A 3BQYA 4BUPA 1T0FA 1LDJA 4L5IA 3GZ5A 3KYLA 4XKCA 2KIUA 2XRLA 5LHIA 1A31A 1SMTA 3JRGA 2M4GA 3OSFA 4CCNA 1FOXA 1LE8A 3NARA 1TTYA 4LB5A 5BQTA 2FBKA 2K4BA 2VBWA 2RDPA 1J2XA 3QPHA 2HI3A 2DK5A 3F21A 3B73A 2Y31A 3I53A 4A93J 3H5AA 5F6FA 3LFUA 1RI7A 2Q2EB 3FK7A 4BY1J 3R61A 4EJOA 1FMVA 1QO0D 2XAUA 1U0JA 2IJLA 1IF1A 2EQRA 1XB4A 3FM5A 2LF8A 1B6AA 4EQQA 3BTIA 1X3WB 4XQFA 2HYFA 3K2AA 1JJ8C 1HF0A 3S3OA 2Z1DA 4U0YA 3FXQA 5E8IA 2AXLA 5CVJA 4QPQA 4DYCA 3F8BA 1REPC 2KDOA 4KYWA 1QVTA 1GUUA 2NVUB 2W7NA 1Z91A 1OPCA 2L0KA 1W36C 2M8GX 3FXLA 1DU0A 2E35A 2CFOA 2DOEA 3KEOA 3TOBA 5LGTA 1I6XA 2M4KA 2R7ZJ 4FE7A 2DMUA 4EM0B 4G94A 2VJ4A 3P9KA 3A01B 2VE8A 4N0BA 3H35A 2DU9A 4OIOF 2RNGA 3LSGA 4EMSA 4GFBA 3K4BA 4IHTA 1ORKA 1QZEA 1TT5B 5DCMA 2DDAA 3CJQB 2NNYA 2LBFB 4MQVA 3H9GA 5IT9K 1T2KA 1SD6A 1A6QA 4F91B 4DYRA 4HG2A 2D5VA 3QU3A 3AL0B 3S2HJ 2VJ5A 1TWFJ 3JRAA 2DDBA 2R7QA 4KN4X 3F6VA 4U7DA 1TQPA 3DCFA 3E5QA 4BE1A 1DP3A 4PJLA 5EYRA 1HKSA 2QGUA 1XG1A 1ZG3A 4R79A 3TDZC 3WG9A 2V9KA 4MTDA 1F43A 1R00A 2LDUA 4XN0A 1X3ZB 3ABTA 1SFOJ 2NS7A 1EKEA 2LRDA 3HJEA 5HLHA 1TQMA 1B4AA 3PIOF 2Z16A 5LHGA 4E7JA 3LA7A 2NAZA 2HXOA 3WG7H 1AA7A 1G59A 3QRFF 5C44J 4I99C 3DPLC 4EJVA 4UNOA 1FJLA 2Q2EA 4XRSG 1JUPA 1ZHFA 2HTSA 4XOTA 2OQRA 5GADJ 3ESWB 2W82A 1MNDA 3HOXJ 1Y0UA 2VQGA 1IRXA 2HOEA 4QTRA 3CMAI 1YJWI 4MFDA 3K10A 1WZ2A 2FX0A 3T8TA 1T39A 2XAJA 1P9QC 5EGOA 3BC8A 2WAFA 3GMEA 1KGSA 1GDTA 2EA2A 2L5QA 3W6KB 3IHUA 3J80K 4RM2A 3G73A 4MLOA 1U6GA 3FWEA 4PSWA 3COAC 4BGDA 1WJDA 5HODA 2KISA 4LGWA 5CQEA 2BY2A 3CCJI 3LA2A 3S15J 3GZ6A 4IOCF 4RGSA 1YRNA 1N78A 3A01A 3IL2A 1QA6A 3PO2J 4AD9A 3K0LA 2YS9A 3FZVA 5H6RA 3Q9VA 1WGXA 2CFXA 4RM3A 3CC2I 3WE2A 4BQOA 1JTYA 3CDLA 4BHPA 4A3MJ 1KQ9A 2IA2A 2HVQA 3BY6A 2FU4A 3GXOA 4BDYA 1MD0A 3MMYB 4CCOA 5F0HA 2KPMA 4HX7A 2KFDA 3T0YA 1ZR4A 1D3YA 2XROA 3CCEI 2P5VA 4AC0A 3GTPJ 2IS6A 2L01A 1Z3XA 1SD5A 1MW7A 2CS3A 4UB8C 2E1MC 1SFKA 5CVIA 1HQCA 3Q0WA 2QQAA 4I0AA 3TP3A 2ISZA 5AIQA 2FQ4A 2UZKA 3FMSA 3N05A 4IJAA 1CQTA 1WJEA 5CQGA 5DDGA 4YG2F 2V1UA 3CCQI 4PFPA 3MKYB 2FOWA 4CDGA 1ETYA 3ELKA 1BA5A 2WV1A 1XD7A 2M2EA 2DFHA 1MJ9A 1I27A 3A03A 2XAQA 1X2NA 1WJ5A 4X0GA 5IOYA 3L2UA 3BTLA 2IA1A 2XIGA 3LQQA 3QPTA 1ITYA 1A35A 1X58A 2QCOA 3C18A 4RAZA 1IV8A 3BZ6A 2DPUA 4XORA 1B72A 2KMUA 2A68F 2VL8A 5M3FJ 2CUZA 5E1WA 2P4WA 2E19A 2VPRA 4XSZF 3I9V2 1R22A 4PDKA 2VASA 5FRMA 5LGUA 3CCSI 2HQAA 3CQZJ 2K9SA 3HKZA 3VPRA 1P7IA 4IRIA 1HKTA 5E18F 2VJIA 5J3LA 1WHUA 2LF7A 2CGPA 3JAMZ 3BCAA 3ZMSA 2GXGA 2HU9A 2ISYA 3CF2A 3KZIC 3AAFA 2A6EF 3TW7A 1XCVA 4G6DA 4LOCA 2KL4A 4YRVA 1UAAA 1RETA 3MFKA 2L2OA 4ETSA 4V2FA 1QVUA 4IXAA 5EDNA 4AYBN 3OYKA 4IL6C 1IC8A 4HA8A 3TEDA 3VYUB 3GTMJ 1KU2A 4U0WA 2R3SA 2VBZA 3BG3A 5J1UA 2KZVA 3LSIA 2CQKA 4NB5A 4PGHA 5DM6F 2VT3A 5E1XA 2ZO4A 3A52A 4X6AJ 3KEQA 3VYTB 2A3SA 2F48A 3DEEA 2M35A 4YIFA 2XV4S 4E70A 4Q47A 2NOGA 3JR9A 2Y30A 4UUTA 1APLC 3ASNH 2V7FA 2E5ZA 1AKHB 4RLQA 3P9CA 1D0XA 4HV5A 4M3GA 2Y0SA 3BTCA 3RIRA 4LG3A 1IGNA 2GA2A 4LIUA 4WXDA 3MD2A 2LFBA 3W6JB 4YIRX 2FEZA 1R5GA 4XLNF 4KT6A 1QBJA 1V55H 2AHQA 3U1DA 3P5JA 1YJ9I 3K4NA 1ZH5A 3HRUA 3IWZA 3VB2A 3JREA 2HYGD 4CYCA 2ZXIA 1TWAJ 1X3UA 3FBIB 3JW4A 1P2FA 1HW1A 1O3RA 4M6VA 2LD5A 4CH7A 4CHUA 5HVQC 2R7VA 5A2QK 4LD5A 1GVJA 2BV6A 3OS2A 2JWTA 1K78B 1ZLJA 1HW2A 3HDDA 4M72A 2HZDA 4R8HA 4B43A 4B3XA 2DT6A 4IPAA 5M5XJ 1O3TA 5E20A 2J5PA 1XDSA 1UG2A 5FFZA 3KP5A 1R9TJ 5DS9A 2DJNA 4RAYA 2WAQA 2LR8A 2JJ7A 1JHHA 4NNJA 4CCJA 3S1NJ 2F5CA 3V4GA 2MVTA 4XIDA 1GXPA 1G2HA 5E8GA 1R1TA 3EPZA 4RLFA 2E1NA 2Y48A 4M3BA 1X19A 4PJJA 3PUFA 4L9TA 2VOOA 3E6BA 1U9NA 2EK5A 4OAYA 2JUGA 1WPKA 1ZRCA 1F5TA 2VQLA 5D8LB 4TV7A 2X6OA 3ROUA 2VONA 3OIOA 3OYHA 1RR7A 4MNUA 1UHMA 5BNGA 3BLYA 4Y52J 1IDZA 4IX7A 4Y33A 4PSXA 3ZGKA 1K4TA 1T08B 1B8IB 5HLTA 1AKHA 2JZYA 3DPTA 1ZRFA 1ZYRF 1H8AC 1ZLKA 4Z2YA 1FLIA 1T6SA 4DOZA 5LEJA 3E1SA 9ANTA 1VZ0A 2ZNYA 3UNGC 1NK3P 3PQJA 4AM3A 4F52A 3AG4H 3FXJA 2W57A 2P5LC 4MEXF 2IS4A 3S93A 3J81K 2E1CA 2LLKA 2WC2A 4MGRA 1R1VA 3FXRA 5LBQA 4OMZA 1X4OA 2IA0A 3GCMA 5D8KB 1UJ8A 2JA7J 1KU3A 1BIBA 4II2A 4S0HB 1NHAA 3GTJJ 1V3FA 2H1LA 2DOFA 3PFIA 4FTHA 3V8KA 3DKYA 2DT7B 1R71A 2HR3A 1LB2A 2Z9OA 2PFBA 3KYDB 2V6CA 2ZNZA 4ZYGA 5EG0B 3ONQA 4BE0A 4A12A 2X1EA 4B44A 1IG7A 4AVZA 3QP6A 1VQMI 2A07F 1G6NA 5B66C 4ANJA 4NHJA 1C0WA 3M8EA 4QIWN 2CV2A 1Z7UA 1ETXA 2YU9J 2IRFG 4OIPF 5F64A 3TW6A 2IS2A 2ESNA 2HPMA 1IUYA 4I02A 5DD8A 1WQ2A 4O3MA 3F8NA 2BOLA 2XB0X 2NYXA 3F8CA 4N9IA 3R6SA 5F1JA 1ON1A 1MKMA 1XSXA 3M07A 3PFYA 3P9IA 3VSLA 1ZKGA 2X6WA 3CUQA 1QZYA 1VTNC 4HNVA 4BXUA 5ILUA 3WHCA 3R60A 3K70D 5BPIA 2L02A 4CCMA 1BIAA 3FISA 1TP4A 1XMXA 2HPIA 2OTJI 2K9QA 1LDDA 3HB9A 1BC8C 3QOEA 2ID6A 1T56A 1I50J 2OUMA 2P0TA 1G3YA 5DD4A 2MSYA 3HKZN 1PVEA 1T8IA 4HYEA 1IXSB 3EUHC 1P4AA 3BZCA 2PJRB 1PDNC 5JLXA 4CXFA 4IHSA 2D45A 5EEHA 4D1QA 5IT3A 2R92J 2JVHA 1MDMA 1JGGA 1P6RA 2OCCH 3SYTA 1HC8A 2V9PA 3K6GA 1XC5A 4M74A 4M9XA 1X1BA 2FUG2 2E1OA 4WK8F 2MH9A 5J6XA 2MA3A 2D1HA 3H3VK 4CGZA 5EZGA 4RB1A 4FX0A 4HW0A 4XRMA 3RZDJ 3ASOH 1A36A 1YTYA 3KIOA 2R7FA 1K61A 2V4JC 2KRHA 5EG0A 2H8RA 2IVMA 3OYLA 3ERED 4CA0A 1UFMA 3CJNA 1KONA 1W5TA 4Q5SF 1KZHA 3GBGA 3HHHA 3I59A 2M45A 4AU7A 3GLXA 3O2PE 3F72A 5GPAA 3ZMUA 2Y0SN 2R7DA 1XGMA 3LSHA 5M5WJ 1GT0C 3MQ0A 3L2RA 2EINH 4G9YA 2LKSA 1BL0A 1MBEA 3LSRA 4ZYEA 3S17J 1KU9A 5LRRA 1F9NA 2FOKA 1JT6A 2DA6A 1FIPA 5KAIC 2LG4A 2KT0A 4DJAA 4XMYA 4Q48A 3OYEA 2DFIA 1H9TA 3TKYA 2A6TA 3ZQIA 1Z9CA 4HLYA 3HTSB 3FMQA 5ICCA 5TJJA 4Y7NJ 3EYYA 5GTIC 4L0ZB 5BS6A 1FPQA 1MSFC 1RUNA 3PJRA 4FETA 3JAMR 3BZKA 4F93B 3PM1A 5HDNA 4KIGA 3M8FA 4XM3A 1LVAA 2VE9A 2L4MA 3CUOA 1JHFA 4JOMA 3HRTA 2QVOA 3KZYA 1ZG1A 1L3LA 2X4HA 1H89C 3HTUA 3CO6C 4PJNA 3DF8A 3FX3A 1VQLI 2ME6A 5AIPA 3Q9SA 4JYKA 4X1EA 2LKPA 2KRFA 5CJ9A 2GM4A 5E79C 3M8JA 4KNYA 5M5YJ 2DA2A 1UHWA 3C1DA 1Z05A 1J7KA 2O8XA 1ACIA 2DMQA 4E7KA 3GFJA 2RC4A 1CGPA 2VXDA 2GWRA 1U3EM 2HVSA 1DDNA 1SVMA 1TT0A 3CMYA 3HSEA 2F4OB 1D1AA 3AG1H 1IN8A 2DI3A 1UG0A 3OR2C 1DQUA 4DZPA 3ZRGA 3I3LA 3BCBA 2ZB9A 1M1EB 2X1DA 5B1BH 4LLLA 1FEXA 2XKOA 5HOOA 3FXKA 2ESHA 5H20A 1FTZA 4PCQA 5DCMB 1BBYA 2VI6A 3KEYA 5IP9J 4KISA 1Y0NA 4LK0F 2V6EA 3RDIA 1IXRC 4A69C 2NOJB 2OAZA 3W3CA 5HLGA 2W84A 2EZKA 4QPOA 2MBFA 2HQNA 3MZ8A 4XLHA 5BPDA 5FLXK 1GVDA 2DO7A 2QKLB 2QKMB 1FOYA 1GV5A 3S8PA 3F0CA 1YIOA 1YX3A 5E1ZB 5GP9A 4FCYA 3G1OA 2CUFA 1V4RA 2WY8Q 4AYBA 4BEHB 4UUVA 1R23A 2X85A 1TNSA 1W0UA 1NG6A 3I54A 4XSXF 2ZXWH 3IAM2 3DWLE 2CUJA 1SMYF 1V5GA 4EGZA 1IRZA 2MW8A 2R7OA 3GX4X 1BR1A 1R7JA 2EPFA 2LNBA 3QODA 5HDKA 2NS8A 5K1YA 2G7UA 4NC7A 2QQBA 2XRNA 1ZREA 1ZG5A 3HIFA 2QM3A 1S7EA 2BY3A 5EGOB 4HEA2 2E71A 3K4LA 3SXYA 4YFXF 4FE4A 2B7EA 3BR1A 2BVMA 1S8NA 5BMZA 1FOWA 2EB7A 3QPLA 4V2GA 5IP7J 3F9KA 5LGNA 1FNNA 4RGUA 1PJRA 2L4AA 4HOBA 5FLMJ 1BW5A 4HNTA 3GVAA 4G8XA 4GYIA 1WI9A 3CTAA 2WTEA 3KCCA 3ABLH 3S16J 1YRNB 1O4XA 1YS6A 2XGCA 4EGYA 2HOTA 1JTXA 4PK4A 3KP2A 4BXFA 2Z33A 4XBFA 5L3CA 3K70C 4U7BA 3FBNB 3GW2A 4A3IJ 2CWEA 2JPBA 3H36A 4ABZA 2Y2ZA 4C3JJ 1X4PA 3N97A 3ISPA 2K02A 1ZRDA 3CCMI 4EJWA 4ON0A 3AL0C 1W7PB 3ULQB 1MMSA 2UXNA 2R7WA 1X1CA 3HOYJ 1K6OA 4G7ZF 2E5NA 3L2WA 1UMQA 2Q1ZB 1V5FA 2FNPA 2P81A 3I71A 4A3CJ 4M3FA 3DV8A 3PNTA 5E17F 3KLNA 3MZYA 3WTTC 1P4WA 3H5NA 2LH9A 3MVPA 4BEHA 4C9YA 1XGSA 3BR6A 4BJ6C 3MEXA 5GPCA 1JKQC 2ZFUA 4EM1A 5D5UB 1V54H 2F5FA 2DBBA 1VQKI 2XGEA 2EIKH 4Y17A 3QP5A 3GTLJ 4KMUX 2BEOA 2CG4A 2IP2A 3WTVC 1ETWA 4AIKA 3A4CA 3UKGA 3O8HA 1U78A 3ZQHA 3ZOBA 4HDUA 3VYRB 1U8BA 1B72B 4I0BA 2ZJ2A 4GDFA 2P7VB 1JJ6C 1VQ5I 3IKTA 4XOPA 5FLVA 2L9VA 3HPHA 3RQ4A 2W85A 4KN7X 4XLCA 4PJMA 5JHFA 1UELB 2XVCA 3CP8A 1Y8QB 2Y9ZA 3DPUA 2EH3A 1PP7U 2B63J 4WX9A 3ZQCA 4IRHA 1R36A 3BQZA 3MKLA 2PQ8A 2Q8KA 2GA1A 3OYNA 3OIQA 3OYIA 4CCLA 5CLSA 3C2HA 3OOUA 3ZCOA 4FQGA 3WU1B 3CC4I 1A5JA 1LEAA 2ACJA 1HXDA 2MD0A 4GGGA 1Z67A 3H3UA 1QZZA 4HDVA 3F22A 4XK4A 2K7LA 3V8LA 5K7FA 2EFWA 2XPVA 5FJ8J 1O7FA 1LVKA 2E2HJ 2L7MP 2VC0A 2ZSHB 2BE5F 1MH3A 2EV0A 3M7GA 1JKOC 4ZC3A 4OIRF 2LTPA 1DPRA 2DXIA 4RMNA 3SZPA 2EV5A 1D0YA 3X2QH 2XGXA 2HOAA 2HKOA 3FF5A 5B1AH 5J1YA 5J8CA 1VQ7I 2O61A 1VQ6I 1W7PA 2KRCA 2A61A 2XASA 2G7HA 3MN2A 3K9TA 1OCPA 3LA3A 1BI1A 1ZARA 2MYSA 2TCTA 3RPQA 3WTWC 1VFCA 3IRRA 1E2XA 3FDYA 5IT9Z 5HNFA 1ZK8A 3OIPA 1IXCA 5GAGJ 1MJBA 4W1UA 5E3MA 1O3QA 3V7SA 3FKJA 3LSJA 5D6EA 4BHBA 4CYCB 1JUMA 3RYRA 1Z21A 4HV6A 1WJFA 3L7WA 2BYVE 2R7TA 3RKQA 2M34A 2NVTJ 1OQYA 2LY9A 3OV8A 3BG9A 3CO7C 5DUIA 5F27A 4V19K 4Y15A 1JI8A 5JI6A 1I3QJ 1ZQ3P 2QWWA 1VQ4I 4DBRA 1R4NB 3KFWX 2GIZA 2O8KA 3CZ6A 2DA4A 4LFUA 1HLVA 1H88C 3L2VA 5F1RA 2RAEA 3NEUA 1MBKA 4A0ZA 3ZMZA 5LEKA 2W24A 5JR3A 1NG7A 4UV8A 4BBSJ 2X98A 3FHNA 4B3AA 1K4SA 2OPTA 4M3DA 3HUGA 2C6YA 4L0YB 4IHWA 5ERIA 1LFPA 3HC7A 4BU2A 1ZAOA 4ZZDA 1CF7A 2DN0A 2EZIA 2KIMA 1A04A 1MZBA 2KQRA 1XGNA 3OY9A 2LVSA 5L3GA 1S5LC 3A02A 4IQ4A 1POGA 4MTEA 3J80Z 3GTGJ 3BR0A 1FYKA 5BOXA 4BKXA 1VQOI 2ECBA 2CMPA 3HGGA 5KNLA 4LK1F 4S04A 1OYWA 2H09A 1XMAA 1I3AA 2KP6A 2LYCA 3GYHX 1Z3YA 5D5VB 2OJED 2VBYA 3RI4A 2DOAA 1RR8C 1T98A 2HDCA 3IH4A 4EEFG 2CQXA 2OV7A 2W1OA 1G3SA 3MCZA 3SJMA 2P8TA 2EFPA 4M9ZA 4XKVA 1K83J 1TW3A 3E5XA 3CJRB 2JUCA 3L00A 3BG6A 2DFEA 1W4MA 2N8GA 3H9JA 3VDXA 3KX2A 2FMYA 2IGMA 2BXZA 3ECHA 2ELJA 1FZPB 3F8MA 3QOPA 2X1CA 1X2MA 1I1GA 4ESJA 2DMPA 2JA8J 5D5XB 3EDPA 4IVNA 3G4SI 1O3SA 3SEZA 3ZMVA 3HYIA 2QSHX 3ABMH 3OWTA 2R7RA 4BAYA 1L0OC 5IPAA 3AFHA 4GYGA 4NUBA 4ZDLA 2F4MB 4BDZA 1YIJI 1ETVA 1PUFA 4A3BJ 1SANA 3TL4X 2DFFA 4EM2A 2M87A 3QWLA 4BL0B 5EZHA 4QLCU 3J7AY 2ZSIB 4GO1A 3D5LA 2GXAA 2GOMA 3BPXA 4C3HJ 3BG5A 1ERDA 4Y13A 3QYEA 3SQNA 3IWFA 5CVRA 2HQ5A 4FASD 2EZHA 5JVGF 1IUFA 1VQ9I 4PUSA 1RKWA 4WXHA 2XKPA 2DW4A 2HVRA 1MMAA 3FXUA 4ZTJA 3KPHA 2M5WA 5J1RA 2HTJA 1MIJA 3S32A 2QYOA 1S3JA 3JRFA 3KP6A 2E60A 2WADA 3CUQB 4LB6B 2XAHA 5KK1A 2FA5A 3VOEA 2KJCA 3TO7A 2K3FA 1J09A 3S2WA 1EV7A 2RQQA 3W2AA 2OA4A 4G6TB 1Z7LA 2RGVA 3NWSA 5J4YA 2K9MA 5LD2C 4D0PA 4N4OB 1GHCA 5L3BA 2MLKA 2EILH 2MG4A 1TWCJ 1W5CC 4A3GJ 1R6RA 1XGOA 2AS5F 1TL8A 4LG0B 3K69A 3BG7A 5LRSA 2GZWA 3DTEA 3FM3A 2ZJRF 2I8DA 2XAGA 4PGGA 5E3OA 4IZZA 3IH2A 3TBIA 1MDMB 4D5CA 1FIAA 1X1PA 2QQ8A 3HBLA 2O6GE 2ME0A 1KQ8A 1UHSA 2GLOA 4E4HA 4RB2C 3CMMA 5DCFA 5AONA 5C4XJ 2FBIA 1BOAA 1Z6RA 1S7OA 4KIFA 2DMNA 5E3LA 3PL8A 2JSCA 5C3EJ 4A3LJ 2F6CA 2OBPA 3IP4B 3RQIA 2YX7A 2ZCWA 5K7HA 1R1UA 1EJ9A 4BQAA 3L9FA 2V1DA 4UV9A 3E6DA 5CVVA 3OYAA 1IJWC 3GZNB 1HDPA 3CD6I 3VEPA 3OS0A 4IQJA 3I59B 2CRGA 2R93J 5FKNA 1RKTA 3HRSA 4XN3A 1IV6A 4PJ0C 3CCVI 2E2JJ 4ZDOA 2XDVA 5A2QZ 1R5ID 4XICA 3WU0A 3WHBA 2HEOA 2OU2A 5L3DA 3HSFA 5LHHA 4XLAA 2DTZA 1HKQA 1WRJA 2K3PA 5M3MJ 2G9WA 1E3PA 4XKWA 4HSRA 4KMFA 2V1XA 5FKOA 1S6LA 1TQIA 1MJAA 5K5RA 2M9HA 1B1BA 2ZXJA 1YJNI 2K85A 4I09A 2W00A 2XSDC 5EJCA 2B0LA 2DA1A 1W36D 4B47A 1RC9A 4IF4A 3G71I 2BBYA 1B9NA 3BJAA 4K2EA 4HF1A 3WODF 5EF6A 4FISA 2XB5A 3K4MA 1BI3A 1ON2A 1NH3A 4DGWB 5J47A 3RJPA 2TRTA 5J8FA 2BW3A 2PMUA 1E17A 2JRTA 3WTUC 1FBSA 3AKZA 1MMGA 2YUSA 4LG0A 2BHYA 2R4GA 5D4RA 3Q5FA 1S9HA 1W7PD 2KKOA 2X0LA 4LLNA 3QPSA 4DYQA 1QGPA 4F7ZA 1QPMA 3E5UA 4G12A 1U5TB 5EEAA 2ZBKA 1XPXA 2EFOA 3WTYC 4BHCA 3DLAA 1WJAA 1AHDP 2JA5J 2A5YB 4UVCA 2CH0A 2GAUA 2QENA 3DP7A 4IOAF 1W5SA 3MWMA 5FKKA 2HXIA 3T1BA 3FK6A 1HDDC 1JE8A 1IN4A 2VT2A 1V5EA 4ASNA 3PSFA 4HZFA 4KIBA 4P1WA 3J81Z 1U8RA 2CV0A 5IYBJ 3SDGA 4KITB 4KDPA 4GRIA 1J0RA 2XUBA 3O3KA 1D8JA 2VKEA 1HOMA 2L54A 4CICA 4J01A 2F5VA 4F92B 2ZC2A 4L9VA 5FD6A 1T95A 2IBDA 1SFEA 1SC7A 1ODDA 2L7FP 1TC3C 1Y39A 1GXQA 3JRHA 5KHDA 1FP2A 1WJCA 2P6TA 2HZTA 3KP4A 3G1MA 3I58A 2P6SA 4HX4A 3SZTA 3LSMA 3OL4A 3DBLB 1MGTA 2IEKA 2P7CB 5J4VA 3BWGA 5DYMA 2VODA 1Q1VA 1T0FC 5IY5H 3DLLF 1YLFA 2BY0A 4BQNA 3TOAA 1LQ1A 3MAJA 4EJUA 2HDDA 1DPUA 1P4XA 1X1DA 3K4JA 4QSHA 2CQ7A 2VC1A 1D1CA 5TRDA 3B6CA 4P9UA 3VODA 1UZCA 1Y56A 3U21A 4YFNF 1XTAA 3KP7A 3RKYA 4RS8A 1W1WE 4OU0A 3SEQA 1O57A 1B59A 1VI0A 2DLLA 3E97A 1N77A 1YITI 4H0EA 4O6JA 2XSJC 4I98B 1T33A 5D6FA 2YPRA 2ZMEB 3HZJA 1EA3A 3PIPF 3J80R 1XS9A 3CCUI 1RQ6A 2CO5A 2VN2A 2ETHA 4CO8A 3DU6A 4A3EJ 5K5OA 2EIMH 1U5TA 2CJJA 3IKVA 1BOBA 4L9JA 2F5DA 2R7UA 2VKDA 2NNNA 3HOUJ 4OIQF 3LFKA 3GTQJ 3TO6A 5ICEA 3J7ZI 3D0SA 1RRJA 3LSPA 5KVRA 1XN7A 1I5ZA 1Z0XA 3SFIA 1MSEC 3Q3SA 2HFHA 1IN7A 2Z3YA 2K9LA 2K5CA 2H6CA 1Z6TA 1YI2I 5CYVA 3S1RJ 3LQRA 1IAWA 2YR2A 4CUGA 3OSGA 2EIJH 2ZJQF 1R58A 4ENMA 1ETOA 2ELKA 3BOQA 4KFCA 1R5HA 5IYDJ 2YX4A 2DQRA 4BH9A 4C2MJ 2KZGA 3OYCA 3H9QA 2O5RA 2P0WA 3EUAA 1K7AA 2VOPA 3L2CA 2HWVA 4FHTA 5KAFC 2MLGA 4E7HA 1Y1VJ 2R5ZA 1MNEA 2Y69H 1O7LA 2FJ1A 2K27A 2E2IJ 1SVLA 1RESA 3L09A 3DXJF 3LSKA 2XPUA 3CDHA 3E6CC 1QRYA 3OYDA 4RA2A 4CZCA 1I1SA 3RSNA 3F3XA 5HS7A 4A0XA 5GAEJ 5JFRA 4NC6A 2AQEA 3A0HC 3AG3H 1LNWA 2HGCA 2WY7Q 4G7HF 3D1NI 3DTIA 4NQWB 1Y6IA 2STWA 1FTTA 2VXZA 3OOPA 3TO9A 3I0TA 5EEGA 2RKHA 3HM5A 3OYBA 3GO5A 1KYWA 1WH7A 3S14J 3VFZA 3SFZA 4DBQA 3SZGA 2ZFWA 2HDWA 4RB3C 3ZQQA 4HBLA 4M73A 1FMWA 3KETA 4HNUA 5L3EA 2HNHA 4D7MA 2ZMEA 3E3VA 1XMKA 3I4NJ 1XSDA 3HSRA 2DODA 1J75A 4A6EA 2JRMA 4XLFA 2IGOA 3H92A 5JVTA 3CLQA 4LMYA 2CQNA 3EUKL 2DTRA 3Q0VA 5HLIA 4XL9A 1YG2A 3JTGA 3GUDA 2M7AA 1OYYA 2I10A 4MQ9F 2HS5A 4HPQA 5F08A 4BXXJ 1YS7A 2E7XA 5IP6A 3JRIA 3QYFA 1W0TA 1HCRA 5CPRB 1J59A 2CUEA 2IS1A 1ZGAA 2DAOA 2VIXA 2M8EA 2A6HF 4ZDPA 2DYSH 1Q1HA 3OMYA 2A5WA 1AU7A 1RIOH 4WCGA 4ZTFA 3HOVJ 2BY1A 1DUXC 2LY2A 2QBYA 3RPUA 1QHGA 4ITVA 2M7BA 2COMA 1G4DA 3OYGA 2NVQJ 4EV0A 2BVLA 2MFZA 3S3NA 4DQ2A 3G6EI 1AWCA 1VNDA 2J5OA 1Y8RB
chains in the Genus database with same CATH topology
3BJ6A 3MZHA 1SFUA 3EETA 5LLQA 1OR7A 2PI0A 1SD4A 3QAHA 1RNLA 4WXCA 4EVIA 1EH8A 1BJAA 4WWCA 4NQWA 3V7CA 3REOA 5L3FA 5FLXZ 2D2WA 5FD5A 4JQFA 1KA8A 1FOKA 3ZP5A 1IRGA 3I4PA 2OQGA 6PAXA 3WTXC 1SD7A 2KJBA 4OOIA 2PLYA 1YW7A 1RUOA 2IT0A 3DKWA 2GQQA 4GXOA 3WTSC 2IW5A 3N4MA 1H0MA 2JT1A 3WTZA 5FFXA 4UHTA 3U2RA 4LLGF 1AOYA 1TBXA 3JAMK 2YU3A 1F4KA 2GIVA 3ZQ7A 4YFKF 1CF7B 1ULYA 1PUEE 4N9HA 2WV0A 1T38A 4PZJA 3WGHA 2HKXA 3DQVC 2QZ8A 3WGGA 2DT5A 1S7AA 3JTHA 3ECOA 4LJZF 4M6YA 3ZN0A 4ENKA 4RGRA 3WGIA 5FGMA 2VBXA 3ZPLA 2EV6A 2Z99A 4B8XA 2YSRA 2FQ3A 1FT9A 2DK8A 2H94A 5FB2A 4L9NA 1TNTA 3K1PA 2LSOA 4HF2A 2MD5A 3C7JA 1YO5C 1YW8A 3TDUC 3K2ZA 3TGNA 2TDXA 4AIJA 3IC7A 2XHKA 5HS8A 3KP3A 1LEBA 4A0YA 2MH2A 2BGCA 3R0AA 1P92A 3BJOA 5ICFA 4M71A 1FX7A 2ZKZA 3KE2A 2EFNA 4RGXA 4ZYDA 3GEZA 3ABUA 2FMLA 1ZN2A 5CVUA 3BROA 3NRVA 3BDDA 2RQPA 2DPDA 4DNCA 4O5VA 2QLZA 1FSHA 4P96A 1QNTA 3B02A 5FO5A 5ILVA 2OZUA 3LWFA 4WF2A 2XAFA 1BN5A 2V9VA 1SAXA 1HBXG 2WWYA 3R0JA 5K5QA 2MC3A 3KZZA 2D1VA 1EH6A 2P5KA 3RKXA 1YQAA 4HQMA 3LAPA 4BYYA 1YYVA 1TLHB 3GFMA 2H6BA 2FE3A 4U0VA 3GWZA 2K4JA 3K1MA 2K86A 1KYZA 2RN7A 4ENJA 1HW5A 4ESBA 1LDKB 1D5VA 2STTA 4I01A 1HSTA 4I2OA 1OYIA 3LSTA 1Z1DA 2EA4A 2M30A 4AVPA 3H3ZA 3ZMTA 2QQ9A 3RKWA 3J7AO 1IRFA 3RYPA 1ONVA 3I64A 2Z5UA 3QU6A 1IN5A 5DEQA 1XSVA 3F23A 5DUKA 4ESFA 1UB9A 3PQKA 3T8RA 1IN6A 1USSA 2Q0OA 1HSJA 1USTA 4P9FA 1OKRA 1B9MA 1JXSA 1OMIA 3CUQC 1BC7C 3C3WA 5JHUA 3FMRA 4A5NA 1DP7P 3I5UA 3P7NA 4A2UA 2DQLA 2ADUA 1SFXA 4I7HA 4YIIA 1JGSA 1LJ9A 2FSWA 4UVBA 4B09A 5HS9A 2PBIA 4ZZLA 4UXNA 3RTRA 1EH7A 4ENNA 2JTVA 3M9AA 2NRAC 4A6DA 3BP8A 4CYDA 3O6BB 1J5YA 5HDGA 2F2EA 2O0YA 3CLOA 4FX4A 4EJTA 4MHGA 1UCRA 3TQNA 4MEYF 2OZ6A 5H6QA 3V7RA 2HQRA 2H27A 4KA4A 4ZYHA 2F5EA 3EYIA 1IZ1A 4HLXA 5D4SA 2UXXA 1K78A 5ED4A 1FBQA 4FT8A 1XDUA 2CSOA 3HHGA 4M9SA 2EJRA 4G7OF 1ZGJA 5DV5A 4XLPF 3F8FA 2FBHA 4Q4ZF 1BI0A 1YW9A 3LAJA 2O3FA 4U88A 2E7WA 4AWXB 1BM9A 4AIHA 1TW2A 1KU7A 2A69F 3WE3A 5D5WB 2Y0MA 4KT5C 1FC3A 1U2WA 4HF0A 2GXBA 1G3WA 3K1NA 2FRHA 1U5TC 3ZN1A 1FBUA 5ILSA 2O03A 1WWXA 1KQ0A 4KICA 2RNJA 1D8KA 1J9IA 3ZMDA 2ELHA 4L5JA 1K79A 4A5MA 1FYLA 3R4KA 2QUFA 4JK1X 4S05A 2EFQA 4HQEA 3GFLA 2PJPA 2W25A 4UVAA 3FHZA 4GCVA 1STZA 2IPQX 4JBAA 1S29A 3G3ZA 1PP8F 4OINF 4M6XA 2CYYA 2PN6A 2FNAA 1QQIA 2RVCA 1FWZA 2EWNA 2PEXA 4R1HA 4XRFA 3KLOA 1FSEA 3E6MA 3DFGA 2L3DA 1XCBA 3JSPA 4P5OA 4QWQA 2UWMA 3BPVA 4P55A 4RB0A 3T5XA 2OD5A 1BI2A 3JSOA 2CW0F 1FP1D 1H9GA 4HX8A 3EQLF 1FYMA 2NS0A 3M1EA 3EUHA 2V79A 3HOTA 4KUMA 1YFHA 4ZH4F 3GF2A 4OMYA 3IRQA 5ICGA 3ML6A 1WKMA 4G6QA 2QBYB 3GFIA 2PG4A 3HOSA 2PMHA 4IRGA 1FY7A 1G3TA 2KIFA 3HRMA 1IW7F 3V8JA 3U9GA 2RV8A 4BNCA 2M1BA 1F1ZA 2FXAA 4L18B 3F6OA 3DEUA 1WSUA 4CZZA 4HAMA 2JPCA 3NQOA 2Y75A 3SHFA 1RZ4A 2FF4A 1T0FA 1LDJA 4L5IA 3GZ5A 2KIUA 5LHIA 1SMTA 1TTYA 4LB5A 5BQTA 2FBKA 2K4BA 2VBWA 2RDPA 1J2XA 3QPHA 2DK5A 3F21A 3B73A 3I53A 5F6FA 1RI7A 3R61A 4EJOA 1QO0D 2IJLA 1IF1A 1XB4A 3FM5A 2LF8A 1B6AA 4EQQA 2HYFA 4U0YA 3FXQA 5E8IA 2AXLA 5CVJA 3F8BA 1REPC 4KYWA 1Z91A 1OPCA 3KEOA 3TOBA 5LGTA 1I6XA 4EM0B 4G94A 3P9KA 2VE8A 4N0BA 2DU9A 4OIOF 4EMSA 4IHTA 5DCMA 2NNYA 4MQVA 5IT9K 1T2KA 1SD6A 3QU3A 4KN4X 3F6VA 4U7DA 1TQPA 3E5QA 1HKSA 1ZG3A 4R79A 3TDZC 3WG9A 4MTDA 1R00A 2LDUA 3ABTA 5HLHA 1TQMA 1B4AA 5LHGA 3LA7A 2NAZA 3QRFF 3DPLC 4EJVA 4UNOA 2Q2EA 1ZHFA 2HTSA 2OQRA 1Y0UA 2HOEA 3T8TA 1T39A 2XAJA 1KGSA 2EA2A 3W6KB 3IHUA 3J80K 3G73A 1U6GA 3FWEA 3COAC 4LGWA 3LA2A 3GZ6A 4RGSA 3IL2A 4AD9A 3K0LA 3FZVA 5H6RA 3Q9VA 2CFXA 3WE2A 4BHPA 1KQ9A 2IA2A 3BY6A 2FU4A 3GXOA 1MD0A 4HX7A 3T0YA 1D3YA 2XROA 2P5VA 2L01A 1SD5A 5CVIA 1HQCA 2QQAA 4I0AA 2ISZA 5AIQA 2UZKA 3FMSA 4IJAA 4YG2F 5DDGA 2V1UA 4CDGA 3ELKA 1XD7A 1MJ9A 1I27A 2XAQA 2IA1A 2XIGA 3LQQA 3QPTA 3C18A 4RAZA 3BZ6A 2DPUA 2A68F 5E1WA 2P4WA 4XSZF 1R22A 4PDKA 5LGUA 4IRIA 1HKTA 5E18F 2LF7A 2CGPA 3JAMZ 3ZMSA 2GXGA 2ISYA 3AAFA 2A6EF 1XCVA 4G6DA 3MFKA 4ETSA 4IXAA 4HA8A 1KU2A 4U0WA 2R3SA 2VBZA 2CQKA 4NB5A 4PGHA 2VT3A 5E1XA 2ZO4A 3KEQA 2A3SA 4YIFA 2XV4S 4E70A 4Q47A 3P9CA 4HV5A 3RIRA 2GA2A 4WXDA 3W6JB 2FEZA 1R5GA 4XLNF 1QBJA 3U1DA 1ZH5A 3HRUA 3IWZA 3VB2A 2HYGD 1X3UA 3JW4A 1P2FA 1HW1A 1O3RA 4CHUA 5HVQC 5A2QK 4LD5A 1GVJA 2BV6A 1K78B 1ZLJA 1HW2A 4M72A 4R8HA 4IPAA 1O3TA 5E20A 2J5PA 1XDSA 5FFZA 3KP5A 4RAYA 1JHHA 2F5CA 3V4GA 1GXPA 5E8GA 1R1TA 2E1NA 2Y48A 4L9TA 2VOOA 3E6BA 2EK5A 1ZRCA 1F5TA 5D8LB 4TV7A 3ROUA 2VONA 4MNUA 1UHMA 2JZYA 3DPTA 1ZRFA 1ZYRF 1FLIA 1ZLKA 4Z2YA 1T6SA 5LEJA 2ZNYA 3PQJA 2W57A 2P5LC 4MEXF 3J81K 2E1CA 2WC2A 4MGRA 1R1VA 3FXRA 5LBQA 4OMZA 2IA0A 5D8KB 1KU3A 1BIBA 1NHAA 1V3FA 3PFIA 3V8KA 2HR3A 1LB2A 2Z9OA 2PFBA 2V6CA 2ZNZA 4ZYGA 4A12A 3QP6A 2A07F 1G6NA 4NHJA 1C0WA 3M8EA 1Z7UA 2IRFG 4OIPF 5F64A 2ESNA 1IUYA 4I02A 5DD8A 1WQ2A 4O3MA 3F8NA 2NYXA 3F8CA 4N9IA 3R6SA 1ON1A 1MKMA 1XSXA 3P9IA 3CUQA 1QZYA 1VTNC 4BXUA 5ILUA 3R60A 5BPIA 2L02A 1BIAA 1LDDA 1BC8C 1G3YA 5DD4A 4HYEA 1IXSB 1P4AA 1PDNC 4CXFA 4IHSA 2D45A 5EEHA 5IT3A 1MDMA 1P6RA 4M74A 4M9XA 4WK8F 2MH9A 5J6XA 2MA3A 2D1HA 4CGZA 4RB1A 4FX0A 4HW0A 1YTYA 2R7FA 2IVMA 3ERED 1UFMA 3CJNA 1W5TA 4Q5SF 3HHHA 3I59A 2M45A 3GLXA 3O2PE 3F72A 3ZMUA 2R7DA 1XGMA 3MQ0A 4G9YA 4ZYEA 1KU9A 5LRRA 1F9NA 2FOKA 4Q48A 2DFIA 1H9TA 3TKYA 1Z9CA 4HLYA 3HTSB 3FMQA 5ICCA 5TJJA 4L0ZB 3EYYA 5BS6A 1FPQA 1RUNA 5HDNA 4KIGA 3M8FA 2VE9A 1LVAA 2L4MA 3CUOA 1JHFA 3HRTA 2QVOA 3KZYA 1ZG1A 1L3LA 2X4HA 3HTUA 3CO6C 3DF8A 3FX3A 5AIPA 3Q9SA 2LKPA 2KRFA 5CJ9A 4KNYA 1UHWA 3C1DA 1Z05A 1J7KA 2O8XA 3GFJA 2RC4A 1CGPA 2GWRA 1U3EM 1DDNA 3HSEA 1IN8A 2DI3A 4LLLA 2XKOA 5HOOA 2ESHA 5H20A 4PCQA 5DCMB 1BBYA 4LK0F 3RDIA 1IXRC 2OAZA 5HLGA 2W84A 2MBFA 2HQNA 5BPDA 5FLXK 2DO7A 1YIOA 5E1ZB 1V4RA 4UUVA 1R23A 1TNSA 3I54A 4XSXF 1SMYF 4EGZA 3GX4X 1R7JA 2LNBA 5HDKA 5K1YA 2G7UA 2QQBA 2XRNA 1ZREA 1ZG5A 3HIFA 2QM3A 3SXYA 4YFXF 1S8NA 5BMZA 2EB7A 5LGNA 1FNNA 4RGUA 4HOBA 2L4AA 3GVAA 4G8XA 4GYIA 1WI9A 3CTAA 2WTEA 3KCCA 1YS6A 4EGYA 3KP2A 2Z33A 4XBFA 5L3CA 4U7BA 3GW2A 2CWEA 2JPBA 3N97A 3ISPA 2K02A 1ZRDA 4EJWA 4ON0A 1W7PB 3ULQB 2UXNA 1K6OA 4G7ZF 2FNPA 3I71A 3DV8A 5E17F 3KLNA 3MZYA 3WTTC 1P4WA 1XGSA 3MEXA 4EM1A 5D5UB 2F5FA 2DBBA 4Y17A 3QP5A 4KMUX 2BEOA 2CG4A 2IP2A 3WTVC 4AIKA 1U78A 4HDUA 4I0BA 2ZJ2A 2P7VB 3IKTA 2W85A 4KN7X 2XVCA 1PP7U 4WX9A 4IRHA 1R36A 2PQ8A 2Q8KA 2GA1A 5CLSA 3WU1B 1LEAA 2ACJA 1HXDA 4GGGA 3H3UA 1QZZA 4HDVA 3F22A 2K7LA 3V8LA 2EFWA 1O7FA 2VC0A 2BE5F 2EV0A 3M7GA 4OIRF 1DPRA 3SZPA 2EV5A 2XGXA 2HKOA 3FF5A 5J8CA 2O61A 1W7PA 2A61A 2XASA 2G7HA 3K9TA 3LA3A 1BI1A 1ZARA 3RPQA 3WTWC 3IRRA 1E2XA 5IT9Z 1IXCA 1MJBA 1O3QA 3V7SA 5D6EA 4BHBA 3RYRA 4HV6A 3L7WA 2BYVE 3OV8A 3CO7C 5DUIA 4Y15A 5JI6A 2QWWA 3KFWX 4LFUA 5F1RA 3NEUA 4A0ZA 3ZMZA 5LEKA 2W24A 5JR3A 4UV8A 3HUGA 2C6YA 4L0YB 5ERIA 1ZAOA 4ZZDA 1CF7A 2KIMA 1A04A 1MZBA 1XGNA 5L3GA 3J80Z 4MTEA 1FYKA 5BOXA 4LK1F 4S04A 1OYWA 2H09A 1XMAA 3GYHX 5D5VB 2VBYA 3RI4A 1T98A 2HDCA 1G3SA 3MCZA 2P8TA 2EFPA 4M9ZA 1TW3A 3E5XA 3L00A 1W4MA 2FMYA 3ECHA 1FZPB 3F8MA 3QOPA 1I1GA 4ESJA 5D5XB 3EDPA 4IVNA 1O3SA 3ZMVA 3HYIA 4BAYA 1L0OC 4GYGA 4EM2A 2M87A 4QLCU 4GO1A 3D5LA 3BPXA 4Y13A 3SQNA 3IWFA 5CVRA 4WXHA 2XKPA 2DW4A 3FXUA 2M5WA 2HTJA 2QYOA 1S3JA 3KP6A 3CUQB 4LB6B 2XAHA 5KK1A 2FA5A 3VOEA 2KJCA 3TO7A 3S2WA 1EV7A 2OA4A 2RGVA 4D0PA 1GHCA 5L3BA 2MLKA 1XGOA 2AS5F 4LG0B 3K69A 5LRSA 2GZWA 3FM3A 2XAGA 4PGGA 1MDMB 2O6GE 1KQ8A 4RB2C 5DCFA 5AONA 2FBIA 1BOAA 1Z6RA 1S7OA 4KIFA 2JSCA 2OBPA 2YX7A 2ZCWA 1R1UA 4BQAA 3L9FA 2V1DA 4UV9A 3E6DA 5CVVA 3VEPA 3I59B 3HRSA 5A2QZ 3WU0A 2HEOA 2OU2A 5L3DA 3HSFA 5LHHA 1HKQA 1WRJA 2G9WA 4KMFA 2V1XA 1S6LA 1TQIA 1MJAA 5K5RA 2ZXJA 1B1BA 4I09A 2B0LA 4IF4A 2BBYA 1B9NA 3BJAA 4K2EA 4HF1A 3WODF 1BI3A 1ON2A 3RJPA 5J8FA 2PMUA 1E17A 2JRTA 3WTUC 1FBSA 4LG0A 5D4RA 3Q5FA 1W7PD 2KKOA 2X0LA 4LLNA 1QGPA 4F7ZA 1QPMA 3E5UA 1U5TB 2ZBKA 2EFOA 3WTYC 4BHCA 2A5YB 4UVCA 2GAUA 2QENA 3DP7A 1W5SA 3MWMA 3T1BA 1JE8A 1IN4A 2VT2A 4ASNA 4KIBA 4HZFA 3J81Z 1U8RA 4KDPA 1J0RA 2XUBA 3O3KA 1D8JA 2L54A 4CICA 4L9VA 5FD6A 1SFEA 1ODDA 1GXQA 1FP2A 2P6TA 2HZTA 3KP4A 3I58A 2P6SA 4HX4A 3SZTA 1MGTA 2P7CB 3BWGA 5DYMA 2VODA 1YLFA 3TOAA 1LQ1A 3MAJA 4EJUA 1DPUA 1P4XA 2VC1A 5TRDA 4P9UA 3VODA 4YFNF 3KP7A 3RKYA 4RS8A 4OU0A 1O57A 1B59A 2DLLA 3E97A 4H0EA 4O6JA 4I98B 5D6FA 2YPRA 2ZMEB 2CO5A 2VN2A 2ETHA 4CO8A 5K5OA 1U5TA 3IKVA 4L9JA 2F5DA 2NNNA 4OIQF 3LFKA 3TO6A 5ICEA 3D0SA 5KVRA 1XN7A 1I5ZA 2HFHA 1IN7A 2Z3YA 2H6CA 1Z6TA 5CYVA 3LQRA 1IAWA 2YR2A 1R58A 4ENMA 3BOQA 4KFCA 1R5HA 2YX4A 2DQRA 4BH9A 1K7AA 2VOPA 3L2CA 2HWVA 4FHTA 2MLGA 1O7LA 2K27A 3L09A 3DXJF 3CDHA 3E6CC 1I1SA 3F3XA 5HS7A 4A0XA 5JFRA 1LNWA 2HGCA 4G7HF 2STWA 2VXZA 3OOPA 3TO9A 3I0TA 5EEGA 2RKHA 3GO5A 1KYWA 3VFZA 3SFZA 2ZFWA 4RB3C 4HBLA 4M73A 3KETA 5L3EA 2ZMEA 3E3VA 1XMKA 1XSDA 3HSRA 1J75A 4A6EA 3H92A 5JVTA 4LMYA 2DTRA 5HLIA 3JTGA 1YG2A 3GUDA 1OYYA 4MQ9F 2HS5A 1YS7A 2E7XA 1J59A 1ZGAA 2DAOA 2M8EA 2A6HF 1Q1HA 1RIOH 4WCGA 1DUXC 2QBYA 3RPUA 2COMA 1G4DA 4EV0A 4DQ2A 1AWCA 2J5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJ6 A;  3MZH A;  1SFU A;  3EET A;  5LLQ A;  1OR7 A;  2PI0 A;  1SD4 A;  3QAH A;  1RNL A;  4WXC A;  4EVI A;  1EH8 A;  1BJA A;  4WWC A;  4NQW A;  3V7C A;  3REO A;  5L3F A;  5FLX Z;  2D2W A;  5FD5 A;  4JQF A;  1KA8 A;  1FOK A;  3ZP5 A;  1IRG A;  3I4P A;  2OQG A;  6PAX A;  3WTX C;  1SD7 A;  2KJB A;  4OOI A;  2PLY A;  1YW7 A;  1RUO A;  2IT0 A;  3DKW A;  2GQQ A;  4GXO A;  3WTS C;  2IW5 A;  3N4M A;  1H0M A;  2JT1 A;  3WTZ A;  5FFX A;  4UHT A;  3U2R A;  4LLG F;  1AOY A;  1TBX A;  3JAM K;  2YU3 A;  1F4K A;  2GIV A;  3ZQ7 A;  4YFK F;  1CF7 B;  1ULY A;  1PUE E;  4N9H A;  2WV0 A;  1T38 A;  4PZJ A;  3WGH A;  2HKX A;  3DQV C;  2QZ8 A;  3WGG A;  2DT5 A;  1S7A A;  3JTH A;  3ECO A;  4LJZ F;  4M6Y A;  3ZN0 A;  4ENK A;  4RGR A;  3WGI A;  5FGM A;  2VBX A;  3ZPL A;  2EV6 A;  2Z99 A;  4B8X A;  2YSR A;  2FQ3 A;  1FT9 A;  2DK8 A;  2H94 A;  5FB2 A;  4L9N A;  1TNT A;  3K1P A;  2LSO A;  4HF2 A;  2MD5 A;  3C7J A;  1YO5 C;  1YW8 A;  3TDU C;  3K2Z A;  3TGN A;  2TDX A;  4AIJ A;  3IC7 A;  2XHK A;  5HS8 A;  3KP3 A;  1LEB A;  4A0Y A;  2MH2 A;  2BGC A;  3R0A A;  1P92 A;  3BJO A;  5ICF A;  4M71 A;  1FX7 A;  2ZKZ A;  3KE2 A;  2EFN A;  4RGX A;  4ZYD A;  3GEZ A;  3ABU A;  2FML A;  1ZN2 A;  5CVU A;  3BRO A;  3NRV A;  3BDD A;  2RQP A;  2DPD A;  4DNC A;  4O5V A;  2QLZ A;  1FSH A;  4P96 A;  1QNT A;  3B02 A;  5FO5 A;  5ILV A;  2OZU A;  3LWF A;  4WF2 A;  2XAF A;  1BN5 A;  2V9V A;  1SAX A;  1HBX G;  2WWY A;  3R0J A;  5K5Q A;  2MC3 A;  3KZZ A;  2D1V A;  1EH6 A;  2P5K A;  3RKX A;  1YQA A;  4HQM A;  3LAP A;  4BYY A;  1YYV A;  1TLH B;  3GFM A;  2H6B A;  2FE3 A;  4U0V A;  3GWZ A;  2K4J A;  3K1M A;  2K86 A;  1KYZ A;  2RN7 A;  4ENJ A;  1HW5 A;  4ESB A;  1LDK B;  1D5V A;  2STT A;  4I01 A;  1HST A;  4I2O A;  1OYI A;  3LST A;  1Z1D A;  2EA4 A;  2M30 A;  4AVP A;  3H3Z A;  3ZMT A;  2QQ9 A;  3RKW A;  3J7A O;  1IRF A;  3RYP A;  1ONV A;  3I64 A;  2Z5U A;  3QU6 A;  1IN5 A;  5DEQ A;  1XSV A;  3F23 A;  5DUK A;  4ESF A;  1UB9 A;  3PQK A;  3T8R A;  1IN6 A;  1USS A;  2Q0O A;  1HSJ A;  1UST A;  4P9F A;  1OKR A;  1B9M A;  1JXS A;  1OMI A;  3CUQ C;  1BC7 C;  3C3W A;  5JHU A;  3FMR A;  4A5N A;  1DP7 P;  3I5U A;  3P7N A;  4A2U A;  2DQL A;  2ADU A;  1SFX A;  4I7H A;  4YII A;  1JGS A;  1LJ9 A;  2FSW A;  4UVB A;  4B09 A;  5HS9 A;  2PBI A;  4ZZL A;  4UXN A;  3RTR A;  1EH7 A;  4ENN A;  2JTV A;  3M9A A;  2NRA C;  4A6D A;  3BP8 A;  4CYD A;  3O6B B;  1J5Y A;  5HDG A;  2F2E A;  2O0Y A;  3CLO A;  4FX4 A;  4EJT A;  4MHG A;  1UCR A;  3TQN A;  4MEY F;  2OZ6 A;  5H6Q A;  3V7R A;  2HQR A;  2H27 A;  4KA4 A;  4ZYH A;  2F5E A;  3EYI A;  1IZ1 A;  4HLX A;  5D4S A;  2UXX A;  1K78 A;  5ED4 A;  1FBQ A;  4FT8 A;  1XDU A;  2CSO A;  3HHG A;  4M9S A;  2EJR A;  4G7O F;  1ZGJ A;  5DV5 A;  4XLP F;  3F8F A;  2FBH A;  4Q4Z F;  1BI0 A;  1YW9 A;  3LAJ A;  2O3F A;  4U88 A;  2E7W A;  4AWX B;  1BM9 A;  4AIH A;  1TW2 A;  1KU7 A;  2A69 F;  3WE3 A;  5D5W B;  2Y0M A;  4KT5 C;  1FC3 A;  1U2W A;  4HF0 A;  2GXB A;  1G3W A;  3K1N A;  2FRH A;  1U5T C;  3ZN1 A;  1FBU A;  5ILS A;  2O03 A;  1WWX A;  1KQ0 A;  4KIC A;  2RNJ A;  1D8K A;  1J9I A;  3ZMD A;  2ELH A;  4L5J A;  1K79 A;  4A5M A;  1FYL A;  3R4K A;  2QUF A;  4JK1 X;  4S05 A;  2EFQ A;  4HQE A;  3GFL A;  2PJP A;  2W25 A;  4UVA A;  3FHZ A;  4GCV A;  1STZ A;  2IPQ X;  4JBA A;  1S29 A;  3G3Z A;  1PP8 F;  4OIN F;  4M6X A;  2CYY A;  2PN6 A;  2FNA A;  1QQI A;  2RVC A;  1FWZ A;  2EWN A;  2PEX A;  4R1H A;  4XRF A;  3KLO A;  1FSE A;  3E6M A;  3DFG A;  2L3D A;  1XCB A;  3JSP A;  4P5O A;  4QWQ A;  2UWM A;  3BPV A;  4P55 A;  4RB0 A;  3T5X A;  2OD5 A;  1BI2 A;  3JSO A;  2CW0 F;  1FP1 D;  1H9G A;  4HX8 A;  3EQL F;  1FYM A;  2NS0 A;  3M1E A;  3EUH A;  2V79 A;  3HOT A;  4KUM A;  1YFH A;  4ZH4 F;  3GF2 A;  4OMY A;  3IRQ A;  5ICG A;  3ML6 A;  1WKM A;  4G6Q A;  2QBY B;  3GFI A;  2PG4 A;  3HOS A;  2PMH A;  4IRG A;  1FY7 A;  1G3T A;  2KIF A;  3HRM A;  1IW7 F;  3V8J A;  3U9G A;  2RV8 A;  4BNC A;  2M1B A;  1F1Z A;  2FXA A;  4L18 B;  3F6O A;  3DEU A;  1WSU A;  4CZZ A;  4HAM A;  2JPC A;  3NQO A;  2Y75 A;  3SHF A;  1RZ4 A;  2FF4 A;  1T0F A;  1LDJ A;  4L5I A;  3GZ5 A;  2KIU A;  5LHI A;  1SMT A;  1TTY A;  4LB5 A;  5BQT A;  2FBK A;  2K4B A;  2VBW A;  2RDP A;  1J2X A;  3QPH A;  2DK5 A;  3F21 A;  3B73 A;  3I53 A;  5F6F A;  1RI7 A;  3R61 A;  4EJO A;  1QO0 D;  2IJL A;  1IF1 A;  1XB4 A;  3FM5 A;  2LF8 A;  1B6A A;  4EQQ A;  2HYF A;  4U0Y A;  3FXQ A;  5E8I A;  2AXL A;  5CVJ A;  3F8B A;  1REP C;  4KYW A;  1Z91 A;  1OPC A;  3KEO A;  3TOB A;  5LGT A;  1I6X A;  4EM0 B;  4G94 A;  3P9K A;  2VE8 A;  4N0B A;  2DU9 A;  4OIO F;  4EMS A;  4IHT A;  5DCM A;  2NNY A;  4MQV A;  5IT9 K;  1T2K A;  1SD6 A;  3QU3 A;  4KN4 X;  3F6V A;  4U7D A;  1TQP A;  3E5Q A;  1HKS A;  1ZG3 A;  4R79 A;  3TDZ C;  3WG9 A;  4MTD A;  1R00 A;  2LDU A;  3ABT A;  5HLH A;  1TQM A;  1B4A A;  5LHG A;  3LA7 A;  2NAZ A;  3QRF F;  3DPL C;  4EJV A;  4UNO A;  2Q2E A;  1ZHF A;  2HTS A;  2OQR A;  1Y0U A;  2HOE A;  3T8T A;  1T39 A;  2XAJ A;  1KGS A;  2EA2 A;  3W6K B;  3IHU A;  3J80 K;  3G73 A;  1U6G A;  3FWE A;  3COA C;  4LGW A;  3LA2 A;  3GZ6 A;  4RGS A;  3IL2 A;  4AD9 A;  3K0L A;  3FZV A;  5H6R A;  3Q9V A;  2CFX A;  3WE2 A;  4BHP A;  1KQ9 A;  2IA2 A;  3BY6 A;  2FU4 A;  3GXO A;  1MD0 A;  4HX7 A;  3T0Y A;  1D3Y A;  2XRO A;  2P5V A;  2L01 A;  1SD5 A;  5CVI A;  1HQC A;  2QQA A;  4I0A A;  2ISZ A;  5AIQ A;  2UZK A;  3FMS A;  4IJA A;  4YG2 F;  5DDG A;  2V1U A;  4CDG A;  3ELK A;  1XD7 A;  1MJ9 A;  1I27 A;  2XAQ A;  2IA1 A;  2XIG A;  3LQQ A;  3QPT A;  3C18 A;  4RAZ A;  3BZ6 A;  2DPU A;  2A68 F;  5E1W A;  2P4W A;  4XSZ F;  1R22 A;  4PDK A;  5LGU A;  4IRI A;  1HKT A;  5E18 F;  2LF7 A;  2CGP A;  3JAM Z;  3ZMS A;  2GXG A;  2ISY A;  3AAF A;  2A6E F;  1XCV A;  4G6D A;  3MFK A;  4ETS A;  4IXA A;  4HA8 A;  1KU2 A;  4U0W A;  2R3S A;  2VBZ A;  2CQK A;  4NB5 A;  4PGH A;  2VT3 A;  5E1X A;  2ZO4 A;  3KEQ A;  2A3S A;  4YIF A;  2XV4 S;  4E70 A;  4Q47 A;  3P9C A;  4HV5 A;  3RIR A;  2GA2 A;  4WXD A;  3W6J B;  2FEZ A;  1R5G A;  4XLN F;  1QBJ A;  3U1D A;  1ZH5 A;  3HRU A;  3IWZ A;  3VB2 A;  2HYG D;  1X3U A;  3JW4 A;  1P2F A;  1HW1 A;  1O3R A;  4CHU A;  5HVQ C;  5A2Q K;  4LD5 A;  1GVJ A;  2BV6 A;  1K78 B;  1ZLJ A;  1HW2 A;  4M72 A;  4R8H A;  4IPA A;  1O3T A;  5E20 A;  2J5P A;  1XDS A;  5FFZ A;  3KP5 A;  4RAY A;  1JHH A;  2F5C A;  3V4G A;  1GXP A;  5E8G A;  1R1T A;  2E1N A;  2Y48 A;  4L9T A;  2VOO A;  3E6B A;  2EK5 A;  1ZRC A;  1F5T A;  5D8L B;  4TV7 A;  3ROU A;  2VON A;  4MNU A;  1UHM A;  2JZY A;  3DPT A;  1ZRF A;  1ZYR F;  1FLI A;  1ZLK A;  4Z2Y A;  1T6S A;  5LEJ A;  2ZNY A;  3PQJ A;  2W57 A;  2P5L C;  4MEX F;  3J81 K;  2E1C A;  2WC2 A;  4MGR A;  1R1V A;  3FXR A;  5LBQ A;  4OMZ A;  2IA0 A;  5D8K B;  1KU3 A;  1BIB A;  1NHA A;  1V3F A;  3PFI A;  3V8K A;  2HR3 A;  1LB2 A;  2Z9O A;  2PFB A;  2V6C A;  2ZNZ A;  4ZYG A;  4A12 A;  3QP6 A;  2A07 F;  1G6N A;  4NHJ A;  1C0W A;  3M8E A;  1Z7U A;  2IRF G;  4OIP F;  5F64 A;  2ESN A;  1IUY A;  4I02 A;  5DD8 A;  1WQ2 A;  4O3M A;  3F8N A;  2NYX A;  3F8C A;  4N9I A;  3R6S A;  1ON1 A;  1MKM A;  1XSX A;  3P9I A;  3CUQ A;  1QZY A;  1VTN C;  4BXU A;  5ILU A;  3R60 A;  5BPI A;  2L02 A;  1BIA A;  1LDD A;  1BC8 C;  1G3Y A;  5DD4 A;  4HYE A;  1IXS B;  1P4A A;  1PDN C;  4CXF A;  4IHS A;  2D45 A;  5EEH A;  5IT3 A;  1MDM A;  1P6R A;  4M74 A;  4M9X A;  4WK8 F;  2MH9 A;  5J6X A;  2MA3 A;  2D1H A;  4CGZ A;  4RB1 A;  4FX0 A;  4HW0 A;  1YTY A;  2R7F A;  2IVM A;  3ERE D;  1UFM A;  3CJN A;  1W5T A;  4Q5S F;  3HHH A;  3I59 A;  2M45 A;  3GLX A;  3O2P E;  3F72 A;  3ZMU A;  2R7D A;  1XGM A;  3MQ0 A;  4G9Y A;  4ZYE A;  1KU9 A;  5LRR A;  1F9N A;  2FOK A;  4Q48 A;  2DFI A;  1H9T A;  3TKY A;  1Z9C A;  4HLY A;  3HTS B;  3FMQ A;  5ICC A;  5TJJ A;  4L0Z B;  3EYY A;  5BS6 A;  1FPQ A;  1RUN A;  5HDN A;  4KIG A;  3M8F A;  2VE9 A;  1LVA A;  2L4M A;  3CUO A;  1JHF A;  3HRT A;  2QVO A;  3KZY A;  1ZG1 A;  1L3L A;  2X4H A;  3HTU A;  3CO6 C;  3DF8 A;  3FX3 A;  5AIP A;  3Q9S A;  2LKP A;  2KRF A;  5CJ9 A;  4KNY A;  1UHW A;  3C1D A;  1Z05 A;  1J7K A;  2O8X A;  3GFJ A;  2RC4 A;  1CGP A;  2GWR A;  1U3E M;  1DDN A;  3HSE A;  1IN8 A;  2DI3 A;  4LLL A;  2XKO A;  5HOO A;  2ESH A;  5H20 A;  4PCQ A;  5DCM B;  1BBY A;  4LK0 F;  3RDI A;  1IXR C;  2OAZ A;  5HLG A;  2W84 A;  2MBF A;  2HQN A;  5BPD A;  5FLX K;  2DO7 A;  1YIO A;  5E1Z B;  1V4R A;  4UUV A;  1R23 A;  1TNS A;  3I54 A;  4XSX F;  1SMY F;  4EGZ A;  3GX4 X;  1R7J A;  2LNB A;  5HDK A;  5K1Y A;  2G7U A;  2QQB A;  2XRN A;  1ZRE A;  1ZG5 A;  3HIF A;  2QM3 A;  3SXY A;  4YFX F;  1S8N A;  5BMZ A;  2EB7 A;  5LGN A;  1FNN A;  4RGU A;  4HOB A;  2L4A A;  3GVA A;  4G8X A;  4GYI A;  1WI9 A;  3CTA A;  2WTE A;  3KCC A;  1YS6 A;  4EGY A;  3KP2 A;  2Z33 A;  4XBF A;  5L3C A;  4U7B A;  3GW2 A;  2CWE A;  2JPB A;  3N97 A;  3ISP A;  2K02 A;  1ZRD A;  4EJW A;  4ON0 A;  1W7P B;  3ULQ B;  2UXN A;  1K6O A;  4G7Z F;  2FNP A;  3I71 A;  3DV8 A;  5E17 F;  3KLN A;  3MZY A;  3WTT C;  1P4W A;  1XGS A;  3MEX A;  4EM1 A;  5D5U B;  2F5F A;  2DBB A;  4Y17 A;  3QP5 A;  4KMU X;  2BEO A;  2CG4 A;  2IP2 A;  3WTV C;  4AIK A;  1U78 A;  4HDU A;  4I0B A;  2ZJ2 A;  2P7V B;  3IKT A;  2W85 A;  4KN7 X;  2XVC A;  1PP7 U;  4WX9 A;  4IRH A;  1R36 A;  2PQ8 A;  2Q8K A;  2GA1 A;  5CLS A;  3WU1 B;  1LEA A;  2ACJ A;  1HXD A;  4GGG A;  3H3U A;  1QZZ A;  4HDV A;  3F22 A;  2K7L A;  3V8L A;  2EFW A;  1O7F A;  2VC0 A;  2BE5 F;  2EV0 A;  3M7G A;  4OIR F;  1DPR A;  3SZP A;  2EV5 A;  2XGX A;  2HKO A;  3FF5 A;  5J8C A;  2O61 A;  1W7P A;  2A61 A;  2XAS A;  2G7H A;  3K9T A;  3LA3 A;  1BI1 A;  1ZAR A;  3RPQ A;  3WTW C;  3IRR A;  1E2X A;  5IT9 Z;  1IXC A;  1MJB A;  1O3Q A;  3V7S A;  5D6E A;  4BHB A;  3RYR A;  4HV6 A;  3L7W A;  2BYV E;  3OV8 A;  3CO7 C;  5DUI A;  4Y15 A;  5JI6 A;  2QWW A;  3KFW X;  4LFU A;  5F1R A;  3NEU A;  4A0Z A;  3ZMZ A;  5LEK A;  2W24 A;  5JR3 A;  4UV8 A;  3HUG A;  2C6Y A;  4L0Y B;  5ERI A;  1ZAO A;  4ZZD A;  1CF7 A;  2KIM A;  1A04 A;  1MZB A;  1XGN A;  5L3G A;  3J80 Z;  4MTE A;  1FYK A;  5BOX A;  4LK1 F;  4S04 A;  1OYW A;  2H09 A;  1XMA A;  3GYH X;  5D5V B;  2VBY A;  3RI4 A;  1T98 A;  2HDC A;  1G3S A;  3MCZ A;  2P8T A;  2EFP A;  4M9Z A;  1TW3 A;  3E5X A;  3L00 A;  1W4M A;  2FMY A;  3ECH A;  1FZP B;  3F8M A;  3QOP A;  1I1G A;  4ESJ A;  5D5X B;  3EDP A;  4IVN A;  1O3S A;  3ZMV A;  3HYI A;  4BAY A;  1L0O C;  4GYG A;  4EM2 A;  2M87 A;  4QLC U;  4GO1 A;  3D5L A;  3BPX A;  4Y13 A;  3SQN A;  3IWF A;  5CVR A;  4WXH A;  2XKP A;  2DW4 A;  3FXU A;  2M5W A;  2HTJ A;  2QYO A;  1S3J A;  3KP6 A;  3CUQ B;  4LB6 B;  2XAH A;  5KK1 A;  2FA5 A;  3VOE A;  2KJC A;  3TO7 A;  3S2W A;  1EV7 A;  2OA4 A;  2RGV A;  4D0P A;  1GHC A;  5L3B A;  2MLK A;  1XGO A;  2AS5 F;  4LG0 B;  3K69 A;  5LRS A;  2GZW A;  3FM3 A;  2XAG A;  4PGG A;  1MDM B;  2O6G E;  1KQ8 A;  4RB2 C;  5DCF A;  5AON A;  2FBI A;  1BOA A;  1Z6R A;  1S7O A;  4KIF A;  2JSC A;  2OBP A;  2YX7 A;  2ZCW A;  1R1U A;  4BQA A;  3L9F A;  2V1D A;  4UV9 A;  3E6D A;  5CVV A;  3VEP A;  3I59 B;  3HRS A;  5A2Q Z;  3WU0 A;  2HEO A;  2OU2 A;  5L3D A;  3HSF A;  5LHH A;  1HKQ A;  1WRJ A;  2G9W A;  4KMF A;  2V1X A;  1S6L A;  1TQI A;  1MJA A;  5K5R A;  2ZXJ A;  1B1B A;  4I09 A;  2B0L A;  4IF4 A;  2BBY A;  1B9N A;  3BJA A;  4K2E A;  4HF1 A;  3WOD F;  1BI3 A;  1ON2 A;  3RJP A;  5J8F A;  2PMU A;  1E17 A;  2JRT A;  3WTU C;  1FBS A;  4LG0 A;  5D4R A;  3Q5F A;  1W7P D;  2KKO A;  2X0L A;  4LLN A;  1QGP A;  4F7Z A;  1QPM A;  3E5U A;  1U5T B;  2ZBK A;  2EFO A;  3WTY C;  4BHC A;  2A5Y B;  4UVC A;  2GAU A;  2QEN A;  3DP7 A;  1W5S A;  3MWM A;  3T1B A;  1JE8 A;  1IN4 A;  2VT2 A;  4ASN A;  4KIB A;  4HZF A;  3J81 Z;  1U8R A;  4KDP A;  1J0R A;  2XUB A;  3O3K A;  1D8J A;  2L54 A;  4CIC A;  4L9V A;  5FD6 A;  1SFE A;  1ODD A;  1GXQ A;  1FP2 A;  2P6T A;  2HZT A;  3KP4 A;  3I58 A;  2P6S A;  4HX4 A;  3SZT A;  1MGT A;  2P7C B;  3BWG A;  5DYM A;  2VOD A;  1YLF A;  3TOA A;  1LQ1 A;  3MAJ A;  4EJU A;  1DPU A;  1P4X A;  2VC1 A;  5TRD A;  4P9U A;  3VOD A;  4YFN F;  3KP7 A;  3RKY A;  4RS8 A;  4OU0 A;  1O57 A;  1B59 A;  2DLL A;  3E97 A;  4H0E A;  4O6J A;  4I98 B;  5D6F A;  2YPR A;  2ZME B;  2CO5 A;  2VN2 A;  2ETH A;  4CO8 A;  5K5O A;  1U5T A;  3IKV A;  4L9J A;  2F5D A;  2NNN A;  4OIQ F;  3LFK A;  3TO6 A;  5ICE A;  3D0S A;  5KVR A;  1XN7 A;  1I5Z A;  2HFH A;  1IN7 A;  2Z3Y A;  2H6C A;  1Z6T A;  5CYV A;  3LQR A;  1IAW A;  2YR2 A;  1R58 A;  4ENM A;  3BOQ A;  4KFC A;  1R5H A;  2YX4 A;  2DQR A;  4BH9 A;  1K7A A;  2VOP A;  3L2C A;  2HWV A;  4FHT A;  2MLG A;  1O7L A;  2K27 A;  3L09 A;  3DXJ F;  3CDH A;  3E6C C;  1I1S A;  3F3X A;  5HS7 A;  4A0X A;  5JFR A;  1LNW A;  2HGC A;  4G7H F;  2STW A;  2VXZ A;  3OOP A;  3TO9 A;  3I0T A;  5EEG A;  2RKH A;  3GO5 A;  1KYW A;  3VFZ A;  3SFZ A;  2ZFW A;  4RB3 C;  4HBL A;  4M73 A;  3KET A;  5L3E A;  2ZME A;  3E3V A;  1XMK A;  1XSD A;  3HSR A;  1J75 A;  4A6E A;  3H92 A;  5JVT A;  4LMY A;  2DTR A;  5HLI A;  3JTG A;  1YG2 A;  3GUD A;  1OYY A;  4MQ9 F;  2HS5 A;  1YS7 A;  2E7X A;  1J59 A;  1ZGA A;  2DAO A;  2M8E A;  2A6H F;  1Q1H A;  1RIO H;  4WCG A;  1DUX C;  2QBY A;  3RPU A;  2COM A;  1G4D A;  4EV0 A;  4DQ2 A;  1AWC A;  2J5O A; 
#chains in the Genus database with same CATH topology
 3BJ6 A;  4N4N B;  3MZH A;  2AO9 A;  1SFU A;  1EF4 A;  1WCM J;  3HL2 A;  3EET A;  3K4C A;  5LLQ A;  2R5Y B;  3GTO J;  3RCO A;  1OR7 A;  2PI0 A;  1SD4 A;  4J19 A;  3K7A J;  3I56 I;  3QAH A;  3DU5 A;  1RNL A;  2XPW A;  4WXC A;  4EVI A;  3E0J B;  3IV5 A;  2JA2 A;  4BQQ A;  4XR6 A;  2QSF X;  1TWH J;  1EH8 A;  1BJA A;  2O7O A;  4WWC A;  3CP2 A;  3FXM A;  4NQW A;  3V7C A;  3REO A;  1BR2 A;  4Z6Y A;  3A2K A;  2DYR H;  4A3D J;  1K6Y A;  3D5S C;  5L3F A;  5FLX Z;  2D2W A;  4C30 A;  3BR2 A;  5FD5 A;  4JQF A;  5DM7 F;  1KA8 A;  1FOK A;  5A2Q R;  3ZP5 A;  1IRG A;  3I4P A;  2OQG A;  6PAX A;  3GTK J;  4HRI A;  4L5E A;  3WTX C;  1SD7 A;  3B6A A;  2KJB A;  2B9S A;  4OOI A;  3C2B A;  1MBF A;  2PLY A;  1YW7 A;  1BJZ A;  4E7L A;  3I55 I;  1RUO A;  2IT0 A;  3DKW A;  4E6K G;  2GQQ A;  2E36 A;  4GXO A;  3WTS C;  2IW5 A;  3N4M A;  3PO3 J;  1H0M A;  2JT1 A;  2DA5 A;  3WTZ A;  5FFX A;  4UHT A;  3OYJ A;  3U2R A;  4LLG F;  4DIQ A;  1AOY A;  2KHM A;  5GTH C;  3VWB A;  2O9L A;  1TBX A;  3ABK H;  3JAM K;  3S1M J;  3MKW B;  2XC7 A;  2YU3 A;  1F4K A;  3HUG B;  4D5F A;  4AID A;  3PSI A;  2GIV A;  1F36 A;  3ZQ7 A;  4YFK F;  1CF7 B;  1ZEL A;  2DA3 A;  1MNM C;  2R7X A;  3PNV A;  1ULY A;  1PUE E;  2KLO A;  2WV0 A;  4N9H A;  1T38 A;  2Z2S B;  2PMZ A;  4PZJ A;  3ZXS A;  3WGH A;  2HKX A;  3DQV C;  2QZ8 A;  3J7A W;  3WGG A;  2DT5 A;  1QU3 A;  1S7A A;  4IHV A;  3JTH A;  4C3I J;  2L7K A;  4YEJ A;  3ECO A;  4LJZ F;  4M6Y A;  1IDY A;  2R5Y A;  1LPQ A;  2CQQ A;  3ZN0 A;  3MKZ A;  4ENK A;  2L9N A;  4RGR A;  4DW6 A;  3WGI A;  5FGM A;  4DZJ A;  2VBX A;  2DA7 A;  3CCY A;  3ZPL A;  2EV6 A;  3J81 R;  2Z99 A;  4MFE A;  4B8X A;  2YSR A;  2FQ3 A;  1FT9 A;  2DK8 A;  2H94 A;  2LBF A;  5FB2 A;  4IO9 F;  4L9N A;  1TNT A;  2LP0 A;  3K1P A;  1SAU A;  2LSO A;  1MH4 A;  2WB1 N;  5FKM A;  4YEL A;  2IAI A;  2E1M B;  2MAB A;  4HF2 A;  2RRE A;  1OIS A;  2VJJ A;  3D5R C;  2MD5 A;  3C7J A;  2W48 A;  1YO5 C;  3M3Y J;  1YW8 A;  3TDU C;  3K2Z A;  2EZL A;  3TGN A;  2TDX A;  4AIJ A;  3IC7 A;  2I5U A;  4I6Z A;  2ID3 A;  2XHK A;  4M3E A;  3G1L A;  5HS8 A;  3KP3 A;  3LNQ A;  1LEB A;  4A0Y A;  1WH5 A;  1OCR H;  1PUF B;  3QYB A;  2MH2 A;  2JQ7 A;  1ETQ A;  3V42 A;  2XF7 A;  2BGC A;  3R0A A;  1P92 A;  3BJO A;  1Z77 A;  3A1Y A;  3BR5 A;  4Y3O A;  5ICF A;  4M71 A;  1FX7 A;  5IYC J;  1LFU P;  4D9J A;  2ZKZ A;  4BJT A;  2M0M A;  3KE2 A;  2EFN A;  4RGX A;  4ZYD A;  3GEZ A;  3ABU A;  2K9N A;  2FML A;  1ZN2 A;  2LRE A;  3OL3 A;  4CCK A;  3L1P A;  5CVU A;  5TIS C;  3DBR B;  3L2Q A;  3UR3 C;  3FXO A;  1ETK A;  3CC7 I;  5F0F A;  2BXY A;  4UUS B;  3BRO A;  4JX6 A;  3NRV A;  3BDD A;  1XX5 A;  4JP0 A;  2RQP A;  2DPD A;  1WJB A;  3AG2 H;  2UV1 A;  3HEF A;  4DNC A;  4O5V A;  2QLZ A;  4Y4R A;  1FSH A;  4P96 A;  4AUX A;  3S3M A;  1QNT A;  3B02 A;  5FO5 A;  5B3S H;  5ILV A;  1YOV B;  4F3Q A;  2OZU A;  5KCM A;  2X6X A;  3LWF A;  4WF2 A;  1Y1W J;  2XAF A;  1BN5 A;  2UUZ A;  2V9V A;  1JKP C;  3CDI A;  1SAX A;  3HOW J;  1HBX G;  2WWY A;  3R0J A;  4E7I A;  3KYC B;  5K5Q A;  2MC3 A;  3KZZ A;  3M4O J;  2IXS A;  1ENH A;  2D1V A;  4E7Z A;  1EH6 A;  2P5K A;  2A05 A;  3RKX A;  1QPI A;  1YQA A;  4HQM A;  4I76 A;  3LAP A;  3HGY A;  1YYV A;  4BYY A;  2M3A A;  1TLH B;  1U9O A;  3GFM A;  2H6B A;  2FE3 A;  4U0V A;  3GWZ A;  3CME I;  4ZJZ A;  2XF6 A;  2MGQ A;  4J00 A;  2K4J A;  3K1M A;  2K86 A;  3W6V A;  3ZQG A;  1KYZ A;  2RN7 A;  4ENJ A;  3BT9 A;  1HW5 A;  3H0G J;  4ESB A;  1LDK B;  1D5V A;  2STT A;  4I01 A;  1HST A;  1ZR2 A;  4I2O A;  4U87 A;  2ICW G;  1OYI A;  3LST A;  1Z1D A;  2KDZ A;  4IEJ A;  2EA4 A;  2M30 A;  1OFC X;  4AVP A;  2E34 A;  3H3Z A;  3BR3 A;  3ZMT A;  4B4C A;  4EAT A;  2QQ9 A;  2WBM A;  2VUM J;  3RKW A;  4C2U A;  3J7A O;  1IRF A;  1MBH A;  3RYP A;  3FIW A;  1ONV A;  3I64 A;  2Z5U A;  3H1C A;  1D5Y A;  3QU6 A;  3DTK A;  1DGW Y;  1N25 A;  1VF9 A;  3H5R A;  4NDL A;  4BY7 J;  1IN5 A;  1YE9 A;  5DEQ A;  1XSV A;  4UB6 C;  3F23 A;  5DUK A;  4ESF A;  3HXL A;  1SVO A;  1UB9 A;  3PQK A;  4OAZ A;  4UUS A;  2VLA A;  2QEX I;  2K40 A;  4BS9 A;  4MIM A;  3T8R A;  5J40 A;  1IN6 A;  1A6I A;  1USS A;  1HSJ A;  1UST A;  2KIQ A;  2Q0O A;  1OCZ H;  4P9F A;  1OKR A;  2VQC A;  1B9M A;  3VSK A;  1X1A A;  1JXS A;  2BZT A;  1P7J A;  1OMI A;  3JCU C;  3RPU D;  3J7Y J;  3CUQ C;  2BHZ A;  2LMD A;  5GAH J;  1BC7 C;  3C3W A;  3K4K A;  5JHU A;  3TP0 A;  3FMR A;  4A5N A;  1DP7 P;  2BW3 B;  2IGK A;  3I5U A;  3P7N A;  1ZGW A;  2JN6 A;  4A2U A;  2DQL A;  3DKX A;  3RZO J;  4RAG A;  3CCR I;  2ADU A;  1SFX A;  4I7H A;  5B5E C;  4YII A;  3S2D J;  2VKH A;  1JGS A;  1LJ9 A;  2FSW A;  1I39 A;  1BW6 A;  4UVB A;  4UY8 I;  1DU6 A;  2LKX A;  3OR1 C;  4B09 A;  5HS9 A;  2PBI A;  2DJI A;  2OTL I;  2GOX B;  4UXN A;  3RTR A;  1EH7 A;  4ZZL A;  1RPW A;  4ENN A;  2JTV A;  2OC6 A;  1YHQ I;  3M9A A;  1VQN I;  1IO2 A;  2JMW A;  2GBY A;  2NRA C;  4A6D A;  5K7Z A;  3BP8 A;  4CYD A;  3O6B B;  1J5Y A;  5HDG A;  2PX9 A;  4F55 A;  1PYV A;  2F2E A;  2JVG A;  2O0Y A;  4RAF A;  3VYS B;  3CLO A;  2PMZ N;  3TMO A;  4XKB A;  1VQP I;  4FX4 A;  1YX5 A;  1MMN A;  2X51 A;  2DMT A;  2AQF A;  3HG9 A;  4EJT A;  2CW7 A;  3OYM A;  4MHG A;  1UCR A;  1LKX A;  3GLL A;  1BR4 A;  2COB A;  1GV2 A;  2JSP A;  3TQN A;  4MEY F;  1OCC H;  1E0E A;  2FD5 A;  2OZ6 A;  2VPL A;  2WA0 A;  1OCO H;  3Q0U A;  5H6Q A;  2AXT C;  5FLX R;  3V7R A;  1I6H J;  1LFB A;  2HQR A;  2H27 A;  4KA4 A;  4BAC A;  5DTD A;  4ZYH A;  2F5E A;  4HST A;  3WU2 C;  3ZQF A;  3EYI A;  4NBQ A;  4RDU A;  1OCT C;  3IUO A;  1IZ1 A;  4HLX A;  4A3F J;  5D4S A;  2UXX A;  1K78 A;  1FBQ A;  2NVY J;  4FT8 A;  1XDU A;  2CSO A;  4D7N A;  5ED4 A;  1R49 A;  3HHG A;  3HPG A;  4M9S A;  1D0Z A;  2NXN B;  2EJR A;  3A0B C;  4B1R A;  2L9R A;  3O8G A;  4XNF A;  4G7O F;  2LOO A;  1N75 A;  1ZGJ A;  3PNY A;  1LUJ B;  3NAU A;  5DV5 A;  4XLP F;  2H1K A;  2X48 A;  2CW8 A;  4NC8 A;  3F8F A;  2FBH A;  3ZR8 X;  2W4S A;  4Q4Z F;  1BI0 A;  1YW9 A;  5E3N A;  1D1B A;  1G8X A;  2R0Q C;  3LAJ A;  2O3F A;  4U88 A;  2E7W A;  1QHH D;  4AWX B;  1BM9 A;  4AIH A;  2OCE A;  1TW2 A;  4BE2 A;  1KU7 A;  2A69 F;  4A3J J;  3WE3 A;  5D5W B;  2Y0M A;  1TWG J;  1TZL A;  4KT5 C;  2L7Z A;  2V1N A;  2MC4 A;  3OYF A;  1FC3 A;  4CSW A;  1SEU A;  4E7S A;  2OF7 A;  4ZYA A;  1U2W A;  4HF0 A;  2F4I A;  2GXB A;  1B8I A;  2EBI A;  1G3W A;  1NK2 P;  3K1N A;  2FRH A;  1U5T C;  2ECC A;  3E7L A;  3IH3 A;  3ZN1 A;  1FBU A;  5ILS A;  5FRN A;  3CCL I;  2O03 A;  1WWX A;  1KQ0 A;  4LIV A;  4KIC A;  2RNJ A;  2ZXH A;  4H4K C;  3CF5 F;  4IHX A;  1D8K A;  1J9I A;  2IGN A;  5IT9 R;  1GLN A;  4IHY A;  1MMD A;  3DEW A;  3ZMD A;  2ELH A;  4L5J A;  1K79 A;  1E3O C;  2WAE A;  1DGR M;  4A5M A;  1WVR A;  3QQA A;  1FYL A;  3R4K A;  2X9D A;  2QUF A;  3SDB A;  4JK1 X;  4S05 A;  3U1K A;  2EFQ A;  4HQE A;  3GFL A;  2PJP A;  2W25 A;  4UVA A;  3FHZ A;  2R5Z B;  4GCV A;  4JX4 A;  4LIT A;  4OWR B;  1STZ A;  2QSG X;  2IPQ X;  3LL7 A;  2NVX J;  3W2W A;  4JBA A;  1S29 A;  5FRO A;  4A3K J;  3G3Z A;  1PP8 F;  4OIN F;  4M6X A;  3JRC A;  1JT0 A;  2LK2 A;  2R7S A;  4XON A;  2CYY A;  1HA8 A;  2PN6 A;  2DCE A;  2FNA A;  1QQI A;  2RVC A;  5C4J J;  1FWZ A;  2EWN A;  2PEX A;  4R1H A;  5JLW A;  4XRF A;  4W97 A;  2M0C A;  2CU7 A;  4RBO A;  3KLO A;  4B48 A;  1FSE A;  2L9S A;  3E6M A;  3DFG A;  3HOZ J;  2L3D A;  2V26 A;  2X6Y A;  3CES A;  1XCB A;  3BTJ A;  2VB6 A;  3JSP A;  3JRB A;  1LE8 B;  4P5O A;  4QWQ A;  5F04 A;  2UWM A;  1MBG A;  3BPV A;  3IAS 2;  4P55 A;  4RB0 A;  4BBR J;  1VQ8 I;  5HNH A;  5LFA A;  2Y9Y A;  3T5X A;  2MUN A;  2MZ4 A;  3OS1 A;  2ZME C;  2OD5 A;  3DBH B;  4MO7 A;  5F0C A;  1BI2 A;  2G0E A;  3JSO A;  2CW0 F;  1FP1 D;  1H9G A;  2LY1 A;  4II3 A;  4HX8 A;  3EQL F;  1MBJ A;  2WB1 A;  1FYM A;  1OJL A;  2NS0 A;  3M1E A;  4XRS A;  3EUH A;  2V79 A;  2JA6 J;  3CJT B;  2JK3 A;  3HOT A;  4KUM A;  1YFH A;  3S1Q J;  3C2G A;  4ZH4 F;  3GF2 A;  4OMY A;  2LC2 A;  5FKL A;  3IRQ A;  2HOS A;  3FKI J;  2PJR A;  5ICG A;  3ML6 A;  1WKM A;  2CV1 A;  2QA4 I;  4G6Q A;  2QBY B;  3GFI A;  1ZTR A;  2PG4 A;  1WI3 A;  3HOS A;  2WAQ N;  3ERM A;  2PMH A;  2VQH A;  1WFX A;  2H8W A;  5IOZ A;  4IRG A;  1R4M B;  1FY7 A;  3PUB A;  4PFO A;  3M1C A;  1G3T A;  1NTC A;  2KIF A;  1S72 I;  5CKT A;  3HRM A;  3LMM A;  5TGT A;  1IW7 F;  1JUS A;  3V8J A;  1JKR C;  3LOC A;  1OLT A;  2ZJP F;  3U9G A;  4C2T A;  4XLE A;  2RV8 A;  3NWT A;  3I4M J;  2VKV A;  4BNC A;  3JRD A;  1OR7 C;  2M1B A;  1F1Z A;  4KJZ A;  2FXA A;  4L18 B;  2HYJ A;  3F6O A;  2XF5 A;  3G2B A;  4IKF A;  3DEU A;  4BJ5 C;  4JX5 A;  3H0D A;  3ZQL A;  1WSU A;  2XGD A;  5H2F C;  2QF7 A;  3W2V A;  4CZZ A;  4HAM A;  2JPC A;  3NQO A;  2Y75 A;  3SHF A;  1E3H A;  1RZ4 A;  2FF4 A;  3BQY A;  4BUP A;  1T0F A;  1LDJ A;  4L5I A;  3GZ5 A;  3KYL A;  4XKC A;  2KIU A;  2XRL A;  5LHI A;  1A31 A;  1SMT A;  3JRG A;  2M4G A;  3OSF A;  4CCN A;  1FOX A;  1LE8 A;  3NAR A;  1TTY A;  4LB5 A;  5BQT A;  2FBK A;  2K4B A;  2VBW A;  2RDP A;  1J2X A;  3QPH A;  2HI3 A;  2DK5 A;  3F21 A;  3B73 A;  2Y31 A;  3I53 A;  4A93 J;  3H5A A;  5F6F A;  3LFU A;  1RI7 A;  2Q2E B;  3FK7 A;  4BY1 J;  3R61 A;  4EJO A;  1FMV A;  1QO0 D;  2XAU A;  1U0J A;  2IJL A;  1IF1 A;  2EQR A;  1XB4 A;  3FM5 A;  2LF8 A;  1B6A A;  4EQQ A;  3BTI A;  1X3W B;  4XQF A;  2HYF A;  3K2A A;  1JJ8 C;  1HF0 A;  3S3O A;  2Z1D A;  4U0Y A;  3FXQ A;  5E8I A;  2AXL A;  5CVJ A;  4QPQ A;  4DYC A;  3F8B A;  1REP C;  2KDO A;  4KYW A;  1QVT A;  1GUU A;  2NVU B;  2W7N A;  1Z91 A;  1OPC A;  2L0K A;  1W36 C;  2M8G X;  3FXL A;  1DU0 A;  2E35 A;  2CFO A;  2DOE A;  3KEO A;  3TOB A;  5LGT A;  1I6X A;  2M4K A;  2R7Z J;  4FE7 A;  2DMU A;  4EM0 B;  4G94 A;  2VJ4 A;  3P9K A;  3A01 B;  2VE8 A;  4N0B A;  3H35 A;  2DU9 A;  4OIO F;  2RNG A;  3LSG A;  4EMS A;  4GFB A;  3K4B A;  4IHT A;  1ORK A;  1QZE A;  1TT5 B;  5DCM A;  2DDA A;  3CJQ B;  2NNY A;  2LBF B;  4MQV A;  3H9G A;  5IT9 K;  1T2K A;  1SD6 A;  1A6Q A;  4F91 B;  4DYR A;  4HG2 A;  2D5V A;  3QU3 A;  3AL0 B;  3S2H J;  2VJ5 A;  1TWF J;  3JRA A;  2DDB A;  2R7Q A;  4KN4 X;  3F6V A;  4U7D A;  1TQP A;  3DCF A;  3E5Q A;  4BE1 A;  1DP3 A;  4PJL A;  5EYR A;  1HKS A;  2QGU A;  1XG1 A;  1ZG3 A;  4R79 A;  3TDZ C;  3WG9 A;  2V9K A;  4MTD A;  1F43 A;  1R00 A;  2LDU A;  4XN0 A;  1X3Z B;  3ABT A;  1SFO J;  2NS7 A;  1EKE A;  2LRD A;  3HJE A;  5HLH A;  1TQM A;  1B4A A;  3PIO F;  2Z16 A;  5LHG A;  4E7J A;  3LA7 A;  2NAZ A;  2HXO A;  3WG7 H;  1AA7 A;  1G59 A;  3QRF F;  5C44 J;  4I99 C;  3DPL C;  4EJV A;  4UNO A;  1FJL A;  2Q2E A;  4XRS G;  1JUP A;  1ZHF A;  2HTS A;  4XOT A;  2OQR A;  5GAD J;  3ESW B;  2W82 A;  1MND A;  3HOX J;  1Y0U A;  2VQG A;  1IRX A;  2HOE A;  4QTR A;  3CMA I;  1YJW I;  4MFD A;  3K10 A;  1WZ2 A;  2FX0 A;  3T8T A;  1T39 A;  2XAJ A;  1P9Q C;  5EGO A;  3BC8 A;  2WAF A;  3GME A;  1KGS A;  1GDT A;  2EA2 A;  2L5Q A;  3W6K B;  3IHU A;  3J80 K;  4RM2 A;  3G73 A;  4MLO A;  1U6G A;  3FWE A;  4PSW A;  3COA C;  4BGD A;  1WJD A;  5HOD A;  2KIS A;  4LGW A;  5CQE A;  2BY2 A;  3CCJ I;  3LA2 A;  3S15 J;  3GZ6 A;  4IOC F;  4RGS A;  1YRN A;  1N78 A;  3A01 A;  3IL2 A;  1QA6 A;  3PO2 J;  4AD9 A;  3K0L A;  2YS9 A;  3FZV A;  5H6R A;  3Q9V A;  1WGX A;  2CFX A;  4RM3 A;  3CC2 I;  3WE2 A;  4BQO A;  1JTY A;  3CDL A;  4BHP A;  4A3M J;  1KQ9 A;  2IA2 A;  2HVQ A;  3BY6 A;  2FU4 A;  3GXO A;  4BDY A;  1MD0 A;  3MMY B;  4CCO A;  5F0H A;  2KPM A;  4HX7 A;  2KFD A;  3T0Y A;  1ZR4 A;  1D3Y A;  2XRO A;  3CCE I;  2P5V A;  4AC0 A;  3GTP J;  2IS6 A;  2L01 A;  1Z3X A;  1SD5 A;  1MW7 A;  2CS3 A;  4UB8 C;  2E1M C;  1SFK A;  5CVI A;  1HQC A;  3Q0W A;  2QQA A;  4I0A A;  3TP3 A;  2ISZ A;  5AIQ A;  2FQ4 A;  2UZK A;  3FMS A;  3N05 A;  4IJA A;  1CQT A;  1WJE A;  5CQG A;  5DDG A;  4YG2 F;  2V1U A;  3CCQ I;  4PFP A;  3MKY B;  2FOW A;  4CDG A;  1ETY A;  3ELK A;  1BA5 A;  2WV1 A;  1XD7 A;  2M2E A;  2DFH A;  1MJ9 A;  1I27 A;  3A03 A;  2XAQ A;  1X2N A;  1WJ5 A;  4X0G A;  5IOY A;  3L2U A;  3BTL A;  2IA1 A;  2XIG A;  3LQQ A;  3QPT A;  1ITY A;  1A35 A;  1X58 A;  2QCO A;  3C18 A;  4RAZ A;  1IV8 A;  3BZ6 A;  2DPU A;  4XOR A;  1B72 A;  2KMU A;  2A68 F;  2VL8 A;  5M3F J;  2CUZ A;  5E1W A;  2P4W A;  2E19 A;  2VPR A;  4XSZ F;  3I9V 2;  1R22 A;  4PDK A;  2VAS A;  5FRM A;  5LGU A;  3CCS I;  2HQA A;  3CQZ J;  2K9S A;  3HKZ A;  3VPR A;  1P7I A;  4IRI A;  1HKT A;  5E18 F;  2VJI A;  5J3L A;  1WHU A;  2LF7 A;  2CGP A;  3JAM Z;  3BCA A;  3ZMS A;  2GXG A;  2HU9 A;  2ISY A;  3CF2 A;  3KZI C;  3AAF A;  2A6E F;  3TW7 A;  1XCV A;  4G6D A;  4LOC A;  2KL4 A;  4YRV A;  1UAA A;  1RET A;  3MFK A;  2L2O A;  4ETS A;  4V2F A;  1QVU A;  4IXA A;  5EDN A;  4AYB N;  3OYK A;  4IL6 C;  1IC8 A;  4HA8 A;  3TED A;  3VYU B;  3GTM J;  1KU2 A;  4U0W A;  2R3S A;  2VBZ A;  3BG3 A;  5J1U A;  2KZV A;  3LSI A;  2CQK A;  4NB5 A;  4PGH A;  5DM6 F;  2VT3 A;  5E1X A;  2ZO4 A;  3A52 A;  4X6A J;  3KEQ A;  3VYT B;  2A3S A;  2F48 A;  3DEE A;  2M35 A;  4YIF A;  2XV4 S;  4E70 A;  4Q47 A;  2NOG A;  3JR9 A;  2Y30 A;  4UUT A;  1APL C;  3ASN H;  2V7F A;  2E5Z A;  1AKH B;  4RLQ A;  3P9C A;  1D0X A;  4HV5 A;  4M3G A;  2Y0S A;  3BTC A;  3RIR A;  4LG3 A;  1IGN A;  2GA2 A;  4LIU A;  4WXD A;  3MD2 A;  2LFB A;  3W6J B;  4YIR X;  2FEZ A;  1R5G A;  4XLN F;  4KT6 A;  1QBJ A;  1V55 H;  2AHQ A;  3U1D A;  3P5J A;  1YJ9 I;  3K4N A;  1ZH5 A;  3HRU A;  3IWZ A;  3VB2 A;  3JRE A;  2HYG D;  4CYC A;  2ZXI A;  1TWA J;  1X3U A;  3FBI B;  3JW4 A;  1P2F A;  1HW1 A;  1O3R A;  4M6V A;  2LD5 A;  4CH7 A;  4CHU A;  5HVQ C;  2R7V A;  5A2Q K;  4LD5 A;  1GVJ A;  2BV6 A;  3OS2 A;  2JWT A;  1K78 B;  1ZLJ A;  1HW2 A;  3HDD A;  4M72 A;  2HZD A;  4R8H A;  4B43 A;  4B3X A;  2DT6 A;  4IPA A;  5M5X J;  1O3T A;  5E20 A;  2J5P A;  1XDS A;  1UG2 A;  5FFZ A;  3KP5 A;  1R9T J;  5DS9 A;  2DJN A;  4RAY A;  2WAQ A;  2LR8 A;  2JJ7 A;  1JHH A;  4NNJ A;  4CCJ A;  3S1N J;  2F5C A;  3V4G A;  2MVT A;  4XID A;  1GXP A;  1G2H A;  5E8G A;  1R1T A;  3EPZ A;  4RLF A;  2E1N A;  2Y48 A;  4M3B A;  1X19 A;  4PJJ A;  3PUF A;  4L9T A;  2VOO A;  3E6B A;  1U9N A;  2EK5 A;  4OAY A;  2JUG A;  1WPK A;  1ZRC A;  1F5T A;  2VQL A;  5D8L B;  4TV7 A;  2X6O A;  3ROU A;  2VON A;  3OIO A;  3OYH A;  1RR7 A;  4MNU A;  1UHM A;  5BNG A;  3BLY A;  4Y52 J;  1IDZ A;  4IX7 A;  4Y33 A;  4PSX A;  3ZGK A;  1K4T A;  1T08 B;  1B8I B;  5HLT A;  1AKH A;  2JZY A;  3DPT A;  1ZRF A;  1ZYR F;  1H8A C;  1ZLK A;  4Z2Y A;  1FLI A;  1T6S A;  4DOZ A;  5LEJ A;  3E1S A;  9ANT A;  1VZ0 A;  2ZNY A;  3UNG C;  1NK3 P;  3PQJ A;  4AM3 A;  4F52 A;  3AG4 H;  3FXJ A;  2W57 A;  2P5L C;  4MEX F;  2IS4 A;  3S93 A;  3J81 K;  2E1C A;  2LLK A;  2WC2 A;  4MGR A;  1R1V A;  3FXR A;  5LBQ A;  4OMZ A;  1X4O A;  2IA0 A;  3GCM A;  5D8K B;  1UJ8 A;  2JA7 J;  1KU3 A;  1BIB A;  4II2 A;  4S0H B;  1NHA A;  3GTJ J;  1V3F A;  2H1L A;  2DOF A;  3PFI A;  4FTH A;  3V8K A;  3DKY A;  2DT7 B;  1R71 A;  2HR3 A;  1LB2 A;  2Z9O A;  2PFB A;  3KYD B;  2V6C A;  2ZNZ A;  4ZYG A;  5EG0 B;  3ONQ A;  4BE0 A;  4A12 A;  2X1E A;  4B44 A;  1IG7 A;  4AVZ A;  3QP6 A;  1VQM I;  2A07 F;  1G6N A;  5B66 C;  4ANJ A;  4NHJ A;  1C0W A;  3M8E A;  4QIW N;  2CV2 A;  1Z7U A;  1ETX A;  2YU9 J;  2IRF G;  4OIP F;  5F64 A;  3TW6 A;  2IS2 A;  2ESN A;  2HPM A;  1IUY A;  4I02 A;  5DD8 A;  1WQ2 A;  4O3M A;  3F8N A;  2BOL A;  2XB0 X;  2NYX A;  3F8C A;  4N9I A;  3R6S A;  5F1J A;  1ON1 A;  1MKM A;  1XSX A;  3M07 A;  3PFY A;  3P9I A;  3VSL A;  1ZKG A;  2X6W A;  3CUQ A;  1QZY A;  1VTN C;  4HNV A;  4BXU A;  5ILU A;  3WHC A;  3R60 A;  3K70 D;  5BPI A;  2L02 A;  4CCM A;  1BIA A;  3FIS A;  1TP4 A;  1XMX A;  2HPI A;  2OTJ I;  2K9Q A;  1LDD A;  3HB9 A;  1BC8 C;  3QOE A;  2ID6 A;  1T56 A;  1I50 J;  2OUM A;  2P0T A;  1G3Y A;  5DD4 A;  2MSY A;  3HKZ N;  1PVE A;  1T8I A;  4HYE A;  1IXS B;  3EUH C;  1P4A A;  3BZC A;  2PJR B;  1PDN C;  5JLX A;  4CXF A;  4IHS A;  2D45 A;  5EEH A;  4D1Q A;  5IT3 A;  2R92 J;  2JVH A;  1MDM A;  1JGG A;  1P6R A;  2OCC H;  3SYT A;  1HC8 A;  2V9P A;  3K6G A;  1XC5 A;  4M74 A;  4M9X A;  1X1B A;  2FUG 2;  2E1O A;  4WK8 F;  2MH9 A;  5J6X A;  2MA3 A;  2D1H A;  3H3V K;  4CGZ A;  5EZG A;  4RB1 A;  4FX0 A;  4HW0 A;  4XRM A;  3RZD J;  3ASO H;  1A36 A;  1YTY A;  3KIO A;  2R7F A;  1K61 A;  2V4J C;  2KRH A;  5EG0 A;  2H8R A;  2IVM A;  3OYL A;  3ERE D;  4CA0 A;  1UFM A;  3CJN A;  1KON A;  1W5T A;  4Q5S F;  1KZH A;  3GBG A;  3HHH A;  3I59 A;  2M45 A;  4AU7 A;  3GLX A;  3O2P E;  3F72 A;  5GPA A;  3ZMU A;  2Y0S N;  2R7D A;  1XGM A;  3LSH A;  5M5W J;  1GT0 C;  3MQ0 A;  3L2R A;  2EIN H;  4G9Y A;  2LKS A;  1BL0 A;  1MBE A;  3LSR A;  4ZYE A;  3S17 J;  1KU9 A;  5LRR A;  1F9N A;  2FOK A;  1JT6 A;  2DA6 A;  1FIP A;  5KAI C;  2LG4 A;  2KT0 A;  4DJA A;  4XMY A;  4Q48 A;  3OYE A;  2DFI A;  1H9T A;  3TKY A;  2A6T A;  3ZQI A;  1Z9C A;  4HLY A;  3HTS B;  3FMQ A;  5ICC A;  5TJJ A;  4Y7N J;  3EYY A;  5GTI C;  4L0Z B;  5BS6 A;  1FPQ A;  1MSF C;  1RUN A;  3PJR A;  4FET A;  3JAM R;  3BZK A;  4F93 B;  3PM1 A;  5HDN A;  4KIG A;  3M8F A;  4XM3 A;  1LVA A;  2VE9 A;  2L4M A;  3CUO A;  1JHF A;  4JOM A;  3HRT A;  2QVO A;  3KZY A;  1ZG1 A;  1L3L A;  2X4H A;  1H89 C;  3HTU A;  3CO6 C;  4PJN A;  3DF8 A;  3FX3 A;  1VQL I;  2ME6 A;  5AIP A;  3Q9S A;  4JYK A;  4X1E A;  2LKP A;  2KRF A;  5CJ9 A;  2GM4 A;  5E79 C;  3M8J A;  4KNY A;  5M5Y J;  2DA2 A;  1UHW A;  3C1D A;  1Z05 A;  1J7K A;  2O8X A;  1ACI A;  2DMQ A;  4E7K A;  3GFJ A;  2RC4 A;  1CGP A;  2VXD A;  2GWR A;  1U3E M;  2HVS A;  1DDN A;  1SVM A;  1TT0 A;  3CMY A;  3HSE A;  2F4O B;  1D1A A;  3AG1 H;  1IN8 A;  2DI3 A;  1UG0 A;  3OR2 C;  1DQU A;  4DZP A;  3ZRG A;  3I3L A;  3BCB A;  2ZB9 A;  1M1E B;  2X1D A;  5B1B H;  4LLL A;  1FEX A;  2XKO A;  5HOO A;  3FXK A;  2ESH A;  5H20 A;  1FTZ A;  4PCQ A;  5DCM B;  1BBY A;  2VI6 A;  3KEY A;  5IP9 J;  4KIS A;  1Y0N A;  4LK0 F;  2V6E A;  3RDI A;  1IXR C;  4A69 C;  2NOJ B;  2OAZ A;  3W3C A;  5HLG A;  2W84 A;  2EZK A;  4QPO A;  2MBF A;  2HQN A;  3MZ8 A;  4XLH A;  5BPD A;  5FLX K;  1GVD A;  2DO7 A;  2QKL B;  2QKM B;  1FOY A;  1GV5 A;  3S8P A;  3F0C A;  1YIO A;  1YX3 A;  5E1Z B;  5GP9 A;  4FCY A;  3G1O A;  2CUF A;  1V4R A;  2WY8 Q;  4AYB A;  4BEH B;  4UUV A;  1R23 A;  2X85 A;  1TNS A;  1W0U A;  1NG6 A;  3I54 A;  4XSX F;  2ZXW H;  3IAM 2;  3DWL E;  2CUJ A;  1SMY F;  1V5G A;  4EGZ A;  1IRZ A;  2MW8 A;  2R7O A;  3GX4 X;  1BR1 A;  1R7J A;  2EPF A;  2LNB A;  3QOD A;  5HDK A;  2NS8 A;  5K1Y A;  2G7U A;  4NC7 A;  2QQB A;  2XRN A;  1ZRE A;  1ZG5 A;  3HIF A;  2QM3 A;  1S7E A;  2BY3 A;  5EGO B;  4HEA 2;  2E71 A;  3K4L A;  3SXY A;  4YFX F;  4FE4 A;  2B7E A;  3BR1 A;  2BVM A;  1S8N A;  5BMZ A;  1FOW A;  2EB7 A;  3QPL A;  4V2G A;  5IP7 J;  3F9K A;  5LGN A;  1FNN A;  4RGU A;  1PJR A;  2L4A A;  4HOB A;  5FLM J;  1BW5 A;  4HNT A;  3GVA A;  4G8X A;  4GYI A;  1WI9 A;  3CTA A;  2WTE A;  3KCC A;  3ABL H;  3S16 J;  1YRN B;  1O4X A;  1YS6 A;  2XGC A;  4EGY A;  2HOT A;  1JTX A;  4PK4 A;  3KP2 A;  4BXF A;  2Z33 A;  4XBF A;  5L3C A;  3K70 C;  4U7B A;  3FBN B;  3GW2 A;  4A3I J;  2CWE A;  2JPB A;  3H36 A;  4ABZ A;  2Y2Z A;  4C3J J;  1X4P A;  3N97 A;  3ISP A;  2K02 A;  1ZRD A;  3CCM I;  4EJW A;  4ON0 A;  3AL0 C;  1W7P B;  3ULQ B;  1MMS A;  2UXN A;  2R7W A;  1X1C A;  3HOY J;  1K6O A;  4G7Z F;  2E5N A;  3L2W A;  1UMQ A;  2Q1Z B;  1V5F A;  2FNP A;  2P81 A;  3I71 A;  4A3C J;  4M3F A;  3DV8 A;  3PNT A;  5E17 F;  3KLN A;  3MZY A;  3WTT C;  1P4W A;  3H5N A;  2LH9 A;  3MVP A;  4BEH A;  4C9Y A;  1XGS A;  3BR6 A;  4BJ6 C;  3MEX A;  5GPC A;  1JKQ C;  2ZFU A;  4EM1 A;  5D5U B;  1V54 H;  2F5F A;  2DBB A;  1VQK I;  2XGE A;  2EIK H;  4Y17 A;  3QP5 A;  3GTL J;  4KMU X;  2BEO A;  2CG4 A;  2IP2 A;  3WTV C;  1ETW A;  4AIK A;  3A4C A;  3UKG A;  3O8H A;  1U78 A;  3ZQH A;  3ZOB A;  4HDU A;  3VYR B;  1U8B A;  1B72 B;  4I0B A;  2ZJ2 A;  4GDF A;  2P7V B;  1JJ6 C;  1VQ5 I;  3IKT A;  4XOP A;  5FLV A;  2L9V A;  3HPH A;  3RQ4 A;  2W85 A;  4KN7 X;  4XLC A;  4PJM A;  5JHF A;  1UEL B;  2XVC A;  3CP8 A;  1Y8Q B;  2Y9Z A;  3DPU A;  2EH3 A;  1PP7 U;  2B63 J;  4WX9 A;  3ZQC A;  4IRH A;  1R36 A;  3BQZ A;  3MKL A;  2PQ8 A;  2Q8K A;  2GA1 A;  3OYN A;  3OIQ A;  3OYI A;  4CCL A;  5CLS A;  3C2H A;  3OOU A;  3ZCO A;  4FQG A;  3WU1 B;  3CC4 I;  1A5J A;  1LEA A;  2ACJ A;  1HXD A;  2MD0 A;  4GGG A;  1Z67 A;  3H3U A;  1QZZ A;  4HDV A;  3F22 A;  4XK4 A;  2K7L A;  3V8L A;  5K7F A;  2EFW A;  2XPV A;  5FJ8 J;  1O7F A;  1LVK A;  2E2H J;  2L7M P;  2VC0 A;  2ZSH B;  2BE5 F;  1MH3 A;  2EV0 A;  3M7G A;  1JKO C;  4ZC3 A;  4OIR F;  2LTP A;  1DPR A;  2DXI A;  4RMN A;  3SZP A;  2EV5 A;  1D0Y A;  3X2Q H;  2XGX A;  2HOA A;  2HKO A;  3FF5 A;  5B1A H;  5J1Y A;  5J8C A;  1VQ7 I;  2O61 A;  1VQ6 I;  1W7P A;  2KRC A;  2A61 A;  2XAS A;  2G7H A;  3MN2 A;  3K9T A;  1OCP A;  3LA3 A;  1BI1 A;  1ZAR A;  2MYS A;  2TCT A;  3RPQ A;  3WTW C;  1VFC A;  3IRR A;  1E2X A;  3FDY A;  5IT9 Z;  5HNF A;  1ZK8 A;  3OIP A;  1IXC A;  5GAG J;  1MJB A;  4W1U A;  5E3M A;  1O3Q A;  3V7S A;  3FKJ A;  3LSJ A;  5D6E A;  4BHB A;  4CYC B;  1JUM A;  3RYR A;  1Z21 A;  4HV6 A;  1WJF A;  3L7W A;  2BYV E;  2R7T A;  3RKQ A;  2M34 A;  2NVT J;  1OQY A;  2LY9 A;  3OV8 A;  3BG9 A;  3CO7 C;  5DUI A;  5F27 A;  4V19 K;  4Y15 A;  1JI8 A;  5JI6 A;  1I3Q J;  1ZQ3 P;  2QWW A;  1VQ4 I;  4DBR A;  1R4N B;  3KFW X;  2GIZ A;  2O8K A;  3CZ6 A;  2DA4 A;  4LFU A;  1HLV A;  1H88 C;  3L2V A;  5F1R A;  2RAE A;  3NEU A;  1MBK A;  4A0Z A;  3ZMZ A;  5LEK A;  2W24 A;  5JR3 A;  1NG7 A;  4UV8 A;  4BBS J;  2X98 A;  3FHN A;  4B3A A;  1K4S A;  2OPT A;  4M3D A;  3HUG A;  2C6Y A;  4L0Y B;  4IHW A;  5ERI A;  1LFP A;  3HC7 A;  4BU2 A;  1ZAO A;  4ZZD A;  1CF7 A;  2DN0 A;  2EZI A;  2KIM A;  1A04 A;  1MZB A;  2KQR A;  1XGN A;  3OY9 A;  2LVS A;  5L3G A;  1S5L C;  3A02 A;  4IQ4 A;  1POG A;  4MTE A;  3J80 Z;  3GTG J;  3BR0 A;  1FYK A;  5BOX A;  4BKX A;  1VQO I;  2ECB A;  2CMP A;  3HGG A;  5KNL A;  4LK1 F;  4S04 A;  1OYW A;  2H09 A;  1XMA A;  1I3A A;  2KP6 A;  2LYC A;  3GYH X;  1Z3Y A;  5D5V B;  2OJE D;  2VBY A;  3RI4 A;  2DOA A;  1RR8 C;  1T98 A;  2HDC A;  3IH4 A;  4EEF G;  2CQX A;  2OV7 A;  2W1O A;  1G3S A;  3MCZ A;  3SJM A;  2P8T A;  2EFP A;  4M9Z A;  4XKV A;  1K83 J;  1TW3 A;  3E5X A;  3CJR B;  2JUC A;  3L00 A;  3BG6 A;  2DFE A;  1W4M A;  2N8G A;  3H9J A;  3VDX A;  3KX2 A;  2FMY A;  2IGM A;  2BXZ A;  3ECH A;  2ELJ A;  1FZP B;  3F8M A;  3QOP A;  2X1C A;  1X2M A;  1I1G A;  4ESJ A;  2DMP A;  2JA8 J;  5D5X B;  3EDP A;  4IVN A;  3G4S I;  1O3S A;  3SEZ A;  3ZMV A;  3HYI A;  2QSH X;  3ABM H;  3OWT A;  2R7R A;  4BAY A;  1L0O C;  5IPA A;  3AFH A;  4GYG A;  4NUB A;  4ZDL A;  2F4M B;  4BDZ A;  1YIJ I;  1ETV A;  1PUF A;  4A3B J;  1SAN A;  3TL4 X;  2DFF A;  4EM2 A;  2M87 A;  3QWL A;  4BL0 B;  5EZH A;  4QLC U;  3J7A Y;  2ZSI B;  4GO1 A;  3D5L A;  2GXA A;  2GOM A;  3BPX A;  4C3H J;  3BG5 A;  1ERD A;  4Y13 A;  3QYE A;  3SQN A;  3IWF A;  5CVR A;  2HQ5 A;  4FAS D;  2EZH A;  5JVG F;  1IUF A;  1VQ9 I;  4PUS A;  1RKW A;  4WXH A;  2XKP A;  2DW4 A;  2HVR A;  1MMA A;  3FXU A;  4ZTJ A;  3KPH A;  2M5W A;  5J1R A;  2HTJ A;  1MIJ A;  3S32 A;  2QYO A;  1S3J A;  3JRF A;  3KP6 A;  2E60 A;  2WAD A;  3CUQ B;  4LB6 B;  2XAH A;  5KK1 A;  2FA5 A;  3VOE A;  2KJC A;  3TO7 A;  2K3F A;  1J09 A;  3S2W A;  1EV7 A;  2RQQ A;  3W2A A;  2OA4 A;  4G6T B;  1Z7L A;  2RGV A;  3NWS A;  5J4Y A;  2K9M A;  5LD2 C;  4D0P A;  4N4O B;  1GHC A;  5L3B A;  2MLK A;  2EIL H;  2MG4 A;  1TWC J;  1W5C C;  4A3G J;  1R6R A;  1XGO A;  2AS5 F;  1TL8 A;  4LG0 B;  3K69 A;  3BG7 A;  5LRS A;  2GZW A;  3DTE A;  3FM3 A;  2ZJR F;  2I8D A;  2XAG A;  4PGG A;  5E3O A;  4IZZ A;  3IH2 A;  3TBI A;  1MDM B;  4D5C A;  1FIA A;  1X1P A;  2QQ8 A;  3HBL A;  2O6G E;  2ME0 A;  1KQ8 A;  1UHS A;  2GLO A;  4E4H A;  4RB2 C;  3CMM A;  5DCF A;  5AON A;  5C4X J;  2FBI A;  1BOA A;  1Z6R A;  1S7O A;  4KIF A;  2DMN A;  5E3L A;  3PL8 A;  2JSC A;  5C3E J;  4A3L J;  2F6C A;  2OBP A;  3IP4 B;  3RQI A;  2YX7 A;  2ZCW A;  5K7H A;  1R1U A;  1EJ9 A;  4BQA A;  3L9F A;  2V1D A;  4UV9 A;  3E6D A;  5CVV A;  3OYA A;  1IJW C;  3GZN B;  1HDP A;  3CD6 I;  3VEP A;  3OS0 A;  4IQJ A;  3I59 B;  2CRG A;  2R93 J;  5FKN A;  1RKT A;  3HRS A;  4XN3 A;  1IV6 A;  4PJ0 C;  3CCV I;  2E2J J;  4ZDO A;  2XDV A;  5A2Q Z;  1R5I D;  4XIC A;  3WU0 A;  3WHB A;  2HEO A;  2OU2 A;  5L3D A;  3HSF A;  5LHH A;  4XLA A;  2DTZ A;  1HKQ A;  1WRJ A;  2K3P A;  5M3M J;  2G9W A;  1E3P A;  4XKW A;  4HSR A;  4KMF A;  2V1X A;  5FKO A;  1S6L A;  1TQI A;  1MJA A;  5K5R A;  2M9H A;  1B1B A;  2ZXJ A;  1YJN I;  2K85 A;  4I09 A;  2W00 A;  2XSD C;  5EJC A;  2B0L A;  2DA1 A;  1W36 D;  4B47 A;  1RC9 A;  4IF4 A;  3G71 I;  2BBY A;  1B9N A;  3BJA A;  4K2E A;  4HF1 A;  3WOD F;  5EF6 A;  4FIS A;  2XB5 A;  3K4M A;  1BI3 A;  1ON2 A;  1NH3 A;  4DGW B;  5J47 A;  3RJP A;  2TRT A;  5J8F A;  2BW3 A;  2PMU A;  1E17 A;  2JRT A;  3WTU C;  1FBS A;  3AKZ A;  1MMG A;  2YUS A;  4LG0 A;  2BHY A;  2R4G A;  5D4R A;  3Q5F A;  1S9H A;  1W7P D;  2KKO A;  2X0L A;  4LLN A;  3QPS A;  4DYQ A;  1QGP A;  4F7Z A;  1QPM A;  3E5U A;  4G12 A;  1U5T B;  5EEA A;  2ZBK A;  1XPX A;  2EFO A;  3WTY C;  4BHC A;  3DLA A;  1WJA A;  1AHD P;  2JA5 J;  2A5Y B;  4UVC A;  2CH0 A;  2GAU A;  2QEN A;  3DP7 A;  4IOA F;  1W5S A;  3MWM A;  5FKK A;  2HXI A;  3T1B A;  3FK6 A;  1HDD C;  1JE8 A;  1IN4 A;  2VT2 A;  1V5E A;  4ASN A;  3PSF A;  4HZF A;  4KIB A;  4P1W A;  3J81 Z;  1U8R A;  2CV0 A;  5IYB J;  3SDG A;  4KIT B;  4KDP A;  4GRI A;  1J0R A;  2XUB A;  3O3K A;  1D8J A;  2VKE A;  1HOM A;  2L54 A;  4CIC A;  4J01 A;  2F5V A;  4F92 B;  2ZC2 A;  4L9V A;  5FD6 A;  1T95 A;  2IBD A;  1SFE A;  1SC7 A;  1ODD A;  2L7F P;  1TC3 C;  1Y39 A;  1GXQ A;  3JRH A;  5KHD A;  1FP2 A;  1WJC A;  2P6T A;  2HZT A;  3KP4 A;  3G1M A;  3I58 A;  2P6S A;  4HX4 A;  3SZT A;  3LSM A;  3OL4 A;  3DBL B;  1MGT A;  2IEK A;  2P7C B;  5J4V A;  3BWG A;  5DYM A;  2VOD A;  1Q1V A;  1T0F C;  5IY5 H;  3DLL F;  1YLF A;  2BY0 A;  4BQN A;  3TOA A;  1LQ1 A;  3MAJ A;  4EJU A;  2HDD A;  1DPU A;  1P4X A;  1X1D A;  3K4J A;  4QSH A;  2CQ7 A;  2VC1 A;  1D1C A;  5TRD A;  3B6C A;  4P9U A;  3VOD A;  1UZC A;  1Y56 A;  3U21 A;  4YFN F;  1XTA A;  3KP7 A;  3RKY A;  4RS8 A;  1W1W E;  4OU0 A;  3SEQ A;  1O57 A;  1B59 A;  1VI0 A;  2DLL A;  3E97 A;  1N77 A;  1YIT I;  4H0E A;  4O6J A;  2XSJ C;  4I98 B;  1T33 A;  5D6F A;  2YPR A;  2ZME B;  3HZJ A;  1EA3 A;  3PIP F;  3J80 R;  1XS9 A;  3CCU I;  1RQ6 A;  2CO5 A;  2VN2 A;  2ETH A;  4CO8 A;  3DU6 A;  4A3E J;  5K5O A;  2EIM H;  1U5T A;  2CJJ A;  3IKV A;  1BOB A;  4L9J A;  2F5D A;  2R7U A;  2VKD A;  2NNN A;  3HOU J;  4OIQ F;  3LFK A;  3GTQ J;  3TO6 A;  5ICE A;  3J7Z I;  3D0S A;  1RRJ A;  3LSP A;  5KVR A;  1XN7 A;  1I5Z A;  1Z0X A;  3SFI A;  1MSE C;  3Q3S A;  2HFH A;  1IN7 A;  2Z3Y A;  2K9L A;  2K5C A;  2H6C A;  1Z6T A;  1YI2 I;  5CYV A;  3S1R J;  3LQR A;  1IAW A;  2YR2 A;  4CUG A;  3OSG A;  2EIJ H;  2ZJQ F;  1R58 A;  4ENM A;  1ETO A;  2ELK A;  3BOQ A;  4KFC A;  1R5H A;  5IYD J;  2YX4 A;  2DQR A;  4BH9 A;  4C2M J;  2KZG A;  3OYC A;  3H9Q A;  2O5R A;  2P0W A;  3EUA A;  1K7A A;  2VOP A;  3L2C A;  2HWV A;  4FHT A;  5KAF C;  2MLG A;  4E7H A;  1Y1V J;  2R5Z A;  1MNE A;  2Y69 H;  1O7L A;  2FJ1 A;  2K27 A;  2E2I J;  1SVL A;  1RES A;  3L09 A;  3DXJ F;  3LSK A;  2XPU A;  3CDH A;  3E6C C;  1QRY A;  3OYD A;  4RA2 A;  4CZC A;  1I1S A;  3RSN A;  3F3X A;  5HS7 A;  4A0X A;  5GAE J;  5JFR A;  4NC6 A;  2AQE A;  3A0H C;  3AG3 H;  1LNW A;  2HGC A;  2WY7 Q;  4G7H F;  3D1N I;  3DTI A;  4NQW B;  1Y6I A;  2STW A;  1FTT A;  2VXZ A;  3OOP A;  3TO9 A;  3I0T A;  5EEG A;  2RKH A;  3HM5 A;  3OYB A;  3GO5 A;  1KYW A;  1WH7 A;  3S14 J;  3VFZ A;  3SFZ A;  4DBQ A;  3SZG A;  2ZFW A;  2HDW A;  4RB3 C;  3ZQQ A;  4HBL A;  4M73 A;  1FMW A;  3KET A;  4HNU A;  5L3E A;  2HNH A;  4D7M A;  2ZME A;  3E3V A;  1XMK A;  3I4N J;  1XSD A;  3HSR A;  2DOD A;  1J75 A;  4A6E A;  2JRM A;  4XLF A;  2IGO A;  3H92 A;  5JVT A;  3CLQ A;  4LMY A;  2CQN A;  3EUK L;  2DTR A;  3Q0V A;  5HLI A;  4XL9 A;  1YG2 A;  3JTG A;  3GUD A;  2M7A A;  1OYY A;  2I10 A;  4MQ9 F;  2HS5 A;  4HPQ A;  5F08 A;  4BXX J;  1YS7 A;  2E7X A;  5IP6 A;  3JRI A;  3QYF A;  1W0T A;  1HCR A;  5CPR B;  1J59 A;  2CUE A;  2IS1 A;  1ZGA A;  2DAO A;  2VIX A;  2M8E A;  2A6H F;  4ZDP A;  2DYS H;  1Q1H A;  3OMY A;  2A5W A;  1AU7 A;  1RIO H;  4WCG A;  4ZTF A;  3HOV J;  2BY1 A;  1DUX C;  2LY2 A;  2QBY A;  3RPU A;  1QHG A;  4ITV A;  2M7B A;  2COM A;  1G4D A;  3OYG A;  2NVQ J;  4EV0 A;  2BVL A;  2MFZ A;  3S3N A;  4DQ2 A;  3G6E I;  1AWC A;  1VND A;  2J5O A;  1Y8R B; 
#chains in the Genus database with same CATH homology
 3BJ6 A;  3MZH A;  1SFU A;  3EET A;  5LLQ A;  1OR7 A;  2PI0 A;  1SD4 A;  3QAH A;  1RNL A;  4WXC A;  4EVI A;  1EH8 A;  1BJA A;  4WWC A;  4NQW A;  3V7C A;  3REO A;  5L3F A;  5FLX Z;  2D2W A;  5FD5 A;  4JQF A;  1KA8 A;  1FOK A;  3ZP5 A;  1IRG A;  3I4P A;  2OQG A;  6PAX A;  3WTX C;  1SD7 A;  2KJB A;  4OOI A;  2PLY A;  1YW7 A;  1RUO A;  2IT0 A;  3DKW A;  2GQQ A;  4GXO A;  3WTS C;  2IW5 A;  3N4M A;  1H0M A;  2JT1 A;  3WTZ A;  5FFX A;  4UHT A;  3U2R A;  4LLG F;  1AOY A;  1TBX A;  3JAM K;  2YU3 A;  1F4K A;  2GIV A;  3ZQ7 A;  4YFK F;  1CF7 B;  1ULY A;  1PUE E;  4N9H A;  2WV0 A;  1T38 A;  4PZJ A;  3WGH A;  2HKX A;  3DQV C;  2QZ8 A;  3WGG A;  2DT5 A;  1S7A A;  3JTH A;  3ECO A;  4LJZ F;  4M6Y A;  3ZN0 A;  4ENK A;  4RGR A;  3WGI A;  5FGM A;  2VBX A;  3ZPL A;  2EV6 A;  2Z99 A;  4B8X A;  2YSR A;  2FQ3 A;  1FT9 A;  2DK8 A;  2H94 A;  5FB2 A;  4L9N A;  1TNT A;  3K1P A;  2LSO A;  4HF2 A;  2MD5 A;  3C7J A;  1YO5 C;  1YW8 A;  3TDU C;  3K2Z A;  3TGN A;  2TDX A;  4AIJ A;  3IC7 A;  2XHK A;  5HS8 A;  3KP3 A;  1LEB A;  4A0Y A;  2MH2 A;  2BGC A;  3R0A A;  1P92 A;  3BJO A;  5ICF A;  4M71 A;  1FX7 A;  2ZKZ A;  3KE2 A;  2EFN A;  4RGX A;  4ZYD A;  3GEZ A;  3ABU A;  2FML A;  1ZN2 A;  5CVU A;  3BRO A;  3NRV A;  3BDD A;  2RQP A;  2DPD A;  4DNC A;  4O5V A;  2QLZ A;  1FSH A;  4P96 A;  1QNT A;  3B02 A;  5FO5 A;  5ILV A;  2OZU A;  3LWF A;  4WF2 A;  2XAF A;  1BN5 A;  2V9V A;  1SAX A;  1HBX G;  2WWY A;  3R0J A;  5K5Q A;  2MC3 A;  3KZZ A;  2D1V A;  1EH6 A;  2P5K A;  3RKX A;  1YQA A;  4HQM A;  3LAP A;  4BYY A;  1YYV A;  1TLH B;  3GFM A;  2H6B A;  2FE3 A;  4U0V A;  3GWZ A;  2K4J A;  3K1M A;  2K86 A;  1KYZ A;  2RN7 A;  4ENJ A;  1HW5 A;  4ESB A;  1LDK B;  1D5V A;  2STT A;  4I01 A;  1HST A;  4I2O A;  1OYI A;  3LST A;  1Z1D A;  2EA4 A;  2M30 A;  4AVP A;  3H3Z A;  3ZMT A;  2QQ9 A;  3RKW A;  3J7A O;  1IRF A;  3RYP A;  1ONV A;  3I64 A;  2Z5U A;  3QU6 A;  1IN5 A;  5DEQ A;  1XSV A;  3F23 A;  5DUK A;  4ESF A;  1UB9 A;  3PQK A;  3T8R A;  1IN6 A;  1USS A;  2Q0O A;  1HSJ A;  1UST A;  4P9F A;  1OKR A;  1B9M A;  1JXS A;  1OMI A;  3CUQ C;  1BC7 C;  3C3W A;  5JHU A;  3FMR A;  4A5N A;  1DP7 P;  3I5U A;  3P7N A;  4A2U A;  2DQL A;  2ADU A;  1SFX A;  4I7H A;  4YII A;  1JGS A;  1LJ9 A;  2FSW A;  4UVB A;  4B09 A;  5HS9 A;  2PBI A;  4ZZL A;  4UXN A;  3RTR A;  1EH7 A;  4ENN A;  2JTV A;  3M9A A;  2NRA C;  4A6D A;  3BP8 A;  4CYD A;  3O6B B;  1J5Y A;  5HDG A;  2F2E A;  2O0Y A;  3CLO A;  4FX4 A;  4EJT A;  4MHG A;  1UCR A;  3TQN A;  4MEY F;  2OZ6 A;  5H6Q A;  3V7R A;  2HQR A;  2H27 A;  4KA4 A;  4ZYH A;  2F5E A;  3EYI A;  1IZ1 A;  4HLX A;  5D4S A;  2UXX A;  1K78 A;  5ED4 A;  1FBQ A;  4FT8 A;  1XDU A;  2CSO A;  3HHG A;  4M9S A;  2EJR A;  4G7O F;  1ZGJ A;  5DV5 A;  4XLP F;  3F8F A;  2FBH A;  4Q4Z F;  1BI0 A;  1YW9 A;  3LAJ A;  2O3F A;  4U88 A;  2E7W A;  4AWX B;  1BM9 A;  4AIH A;  1TW2 A;  1KU7 A;  2A69 F;  3WE3 A;  5D5W B;  2Y0M A;  4KT5 C;  1FC3 A;  1U2W A;  4HF0 A;  2GXB A;  1G3W A;  3K1N A;  2FRH A;  1U5T C;  3ZN1 A;  1FBU A;  5ILS A;  2O03 A;  1WWX A;  1KQ0 A;  4KIC A;  2RNJ A;  1D8K A;  1J9I A;  3ZMD A;  2ELH A;  4L5J A;  1K79 A;  4A5M A;  1FYL A;  3R4K A;  2QUF A;  4JK1 X;  4S05 A;  2EFQ A;  4HQE A;  3GFL A;  2PJP A;  2W25 A;  4UVA A;  3FHZ A;  4GCV A;  1STZ A;  2IPQ X;  4JBA A;  1S29 A;  3G3Z A;  1PP8 F;  4OIN F;  4M6X A;  2CYY A;  2PN6 A;  2FNA A;  1QQI A;  2RVC A;  1FWZ A;  2EWN A;  2PEX A;  4R1H A;  4XRF A;  3KLO A;  1FSE A;  3E6M A;  3DFG A;  2L3D A;  1XCB A;  3JSP A;  4P5O A;  4QWQ A;  2UWM A;  3BPV A;  4P55 A;  4RB0 A;  3T5X A;  2OD5 A;  1BI2 A;  3JSO A;  2CW0 F;  1FP1 D;  1H9G A;  4HX8 A;  3EQL F;  1FYM A;  2NS0 A;  3M1E A;  3EUH A;  2V79 A;  3HOT A;  4KUM A;  1YFH A;  4ZH4 F;  3GF2 A;  4OMY A;  3IRQ A;  5ICG A;  3ML6 A;  1WKM A;  4G6Q A;  2QBY B;  3GFI A;  2PG4 A;  3HOS A;  2PMH A;  4IRG A;  1FY7 A;  1G3T A;  2KIF A;  3HRM A;  1IW7 F;  3V8J A;  3U9G A;  2RV8 A;  4BNC A;  2M1B A;  1F1Z A;  2FXA A;  4L18 B;  3F6O A;  3DEU A;  1WSU A;  4CZZ A;  4HAM A;  2JPC A;  3NQO A;  2Y75 A;  3SHF A;  1RZ4 A;  2FF4 A;  1T0F A;  1LDJ A;  4L5I A;  3GZ5 A;  2KIU A;  5LHI A;  1SMT A;  1TTY A;  4LB5 A;  5BQT A;  2FBK A;  2K4B A;  2VBW A;  2RDP A;  1J2X A;  3QPH A;  2DK5 A;  3F21 A;  3B73 A;  3I53 A;  5F6F A;  1RI7 A;  3R61 A;  4EJO A;  1QO0 D;  2IJL A;  1IF1 A;  1XB4 A;  3FM5 A;  2LF8 A;  1B6A A;  4EQQ A;  2HYF A;  4U0Y A;  3FXQ A;  5E8I A;  2AXL A;  5CVJ A;  3F8B A;  1REP C;  4KYW A;  1Z91 A;  1OPC A;  3KEO A;  3TOB A;  5LGT A;  1I6X A;  4EM0 B;  4G94 A;  3P9K A;  2VE8 A;  4N0B A;  2DU9 A;  4OIO F;  4EMS A;  4IHT A;  5DCM A;  2NNY A;  4MQV A;  5IT9 K;  1T2K A;  1SD6 A;  3QU3 A;  4KN4 X;  3F6V A;  4U7D A;  1TQP A;  3E5Q A;  1HKS A;  1ZG3 A;  4R79 A;  3TDZ C;  3WG9 A;  4MTD A;  1R00 A;  2LDU A;  3ABT A;  5HLH A;  1TQM A;  1B4A A;  5LHG A;  3LA7 A;  2NAZ A;  3QRF F;  3DPL C;  4EJV A;  4UNO A;  2Q2E A;  1ZHF A;  2HTS A;  2OQR A;  1Y0U A;  2HOE A;  3T8T A;  1T39 A;  2XAJ A;  1KGS A;  2EA2 A;  3W6K B;  3IHU A;  3J80 K;  3G73 A;  1U6G A;  3FWE A;  3COA C;  4LGW A;  3LA2 A;  3GZ6 A;  4RGS A;  3IL2 A;  4AD9 A;  3K0L A;  3FZV A;  5H6R A;  3Q9V A;  2CFX A;  3WE2 A;  4BHP A;  1KQ9 A;  2IA2 A;  3BY6 A;  2FU4 A;  3GXO A;  1MD0 A;  4HX7 A;  3T0Y A;  1D3Y A;  2XRO A;  2P5V A;  2L01 A;  1SD5 A;  5CVI A;  1HQC A;  2QQA A;  4I0A A;  2ISZ A;  5AIQ A;  2UZK A;  3FMS A;  4IJA A;  4YG2 F;  5DDG A;  2V1U A;  4CDG A;  3ELK A;  1XD7 A;  1MJ9 A;  1I27 A;  2XAQ A;  2IA1 A;  2XIG A;  3LQQ A;  3QPT A;  3C18 A;  4RAZ A;  3BZ6 A;  2DPU A;  2A68 F;  5E1W A;  2P4W A;  4XSZ F;  1R22 A;  4PDK A;  5LGU A;  4IRI A;  1HKT A;  5E18 F;  2LF7 A;  2CGP A;  3JAM Z;  3ZMS A;  2GXG A;  2ISY A;  3AAF A;  2A6E F;  1XCV A;  4G6D A;  3MFK A;  4ETS A;  4IXA A;  4HA8 A;  1KU2 A;  4U0W A;  2R3S A;  2VBZ A;  2CQK A;  4NB5 A;  4PGH A;  2VT3 A;  5E1X A;  2ZO4 A;  3KEQ A;  2A3S A;  4YIF A;  2XV4 S;  4E70 A;  4Q47 A;  3P9C A;  4HV5 A;  3RIR A;  2GA2 A;  4WXD A;  3W6J B;  2FEZ A;  1R5G A;  4XLN F;  1QBJ A;  3U1D A;  1ZH5 A;  3HRU A;  3IWZ A;  3VB2 A;  2HYG D;  1X3U A;  3JW4 A;  1P2F A;  1HW1 A;  1O3R A;  4CHU A;  5HVQ C;  5A2Q K;  4LD5 A;  1GVJ A;  2BV6 A;  1K78 B;  1ZLJ A;  1HW2 A;  4M72 A;  4R8H A;  4IPA A;  1O3T A;  5E20 A;  2J5P A;  1XDS A;  5FFZ A;  3KP5 A;  4RAY A;  1JHH A;  2F5C A;  3V4G A;  1GXP A;  5E8G A;  1R1T A;  2E1N A;  2Y48 A;  4L9T A;  2VOO A;  3E6B A;  2EK5 A;  1ZRC A;  1F5T A;  5D8L B;  4TV7 A;  3ROU A;  2VON A;  4MNU A;  1UHM A;  2JZY A;  3DPT A;  1ZRF A;  1ZYR F;  1FLI A;  1ZLK A;  4Z2Y A;  1T6S A;  5LEJ A;  2ZNY A;  3PQJ A;  2W57 A;  2P5L C;  4MEX F;  3J81 K;  2E1C A;  2WC2 A;  4MGR A;  1R1V A;  3FXR A;  5LBQ A;  4OMZ A;  2IA0 A;  5D8K B;  1KU3 A;  1BIB A;  1NHA A;  1V3F A;  3PFI A;  3V8K A;  2HR3 A;  1LB2 A;  2Z9O A;  2PFB A;  2V6C A;  2ZNZ A;  4ZYG A;  4A12 A;  3QP6 A;  2A07 F;  1G6N A;  4NHJ A;  1C0W A;  3M8E A;  1Z7U A;  2IRF G;  4OIP F;  5F64 A;  2ESN A;  1IUY A;  4I02 A;  5DD8 A;  1WQ2 A;  4O3M A;  3F8N A;  2NYX A;  3F8C A;  4N9I A;  3R6S A;  1ON1 A;  1MKM A;  1XSX A;  3P9I A;  3CUQ A;  1QZY A;  1VTN C;  4BXU A;  5ILU A;  3R60 A;  5BPI A;  2L02 A;  1BIA A;  1LDD A;  1BC8 C;  1G3Y A;  5DD4 A;  4HYE A;  1IXS B;  1P4A A;  1PDN C;  4CXF A;  4IHS A;  2D45 A;  5EEH A;  5IT3 A;  1MDM A;  1P6R A;  4M74 A;  4M9X A;  4WK8 F;  2MH9 A;  5J6X A;  2MA3 A;  2D1H A;  4CGZ A;  4RB1 A;  4FX0 A;  4HW0 A;  1YTY A;  2R7F A;  2IVM A;  3ERE D;  1UFM A;  3CJN A;  1W5T A;  4Q5S F;  3HHH A;  3I59 A;  2M45 A;  3GLX A;  3O2P E;  3F72 A;  3ZMU A;  2R7D A;  1XGM A;  3MQ0 A;  4G9Y A;  4ZYE A;  1KU9 A;  5LRR A;  1F9N A;  2FOK A;  4Q48 A;  2DFI A;  1H9T A;  3TKY A;  1Z9C A;  4HLY A;  3HTS B;  3FMQ A;  5ICC A;  5TJJ A;  4L0Z B;  3EYY A;  5BS6 A;  1FPQ A;  1RUN A;  5HDN A;  4KIG A;  3M8F A;  2VE9 A;  1LVA A;  2L4M A;  3CUO A;  1JHF A;  3HRT A;  2QVO A;  3KZY A;  1ZG1 A;  1L3L A;  2X4H A;  3HTU A;  3CO6 C;  3DF8 A;  3FX3 A;  5AIP A;  3Q9S A;  2LKP A;  2KRF A;  5CJ9 A;  4KNY A;  1UHW A;  3C1D A;  1Z05 A;  1J7K A;  2O8X A;  3GFJ A;  2RC4 A;  1CGP A;  2GWR A;  1U3E M;  1DDN A;  3HSE A;  1IN8 A;  2DI3 A;  4LLL A;  2XKO A;  5HOO A;  2ESH A;  5H20 A;  4PCQ A;  5DCM B;  1BBY A;  4LK0 F;  3RDI A;  1IXR C;  2OAZ A;  5HLG A;  2W84 A;  2MBF A;  2HQN A;  5BPD A;  5FLX K;  2DO7 A;  1YIO A;  5E1Z B;  1V4R A;  4UUV A;  1R23 A;  1TNS A;  3I54 A;  4XSX F;  1SMY F;  4EGZ A;  3GX4 X;  1R7J A;  2LNB A;  5HDK A;  5K1Y A;  2G7U A;  2QQB A;  2XRN A;  1ZRE A;  1ZG5 A;  3HIF A;  2QM3 A;  3SXY A;  4YFX F;  1S8N A;  5BMZ A;  2EB7 A;  5LGN A;  1FNN A;  4RGU A;  4HOB A;  2L4A A;  3GVA A;  4G8X A;  4GYI A;  1WI9 A;  3CTA A;  2WTE A;  3KCC A;  1YS6 A;  4EGY A;  3KP2 A;  2Z33 A;  4XBF A;  5L3C A;  4U7B A;  3GW2 A;  2CWE A;  2JPB A;  3N97 A;  3ISP A;  2K02 A;  1ZRD A;  4EJW A;  4ON0 A;  1W7P B;  3ULQ B;  2UXN A;  1K6O A;  4G7Z F;  2FNP A;  3I71 A;  3DV8 A;  5E17 F;  3KLN A;  3MZY A;  3WTT C;  1P4W A;  1XGS A;  3MEX A;  4EM1 A;  5D5U B;  2F5F A;  2DBB A;  4Y17 A;  3QP5 A;  4KMU X;  2BEO A;  2CG4 A;  2IP2 A;  3WTV C;  4AIK A;  1U78 A;  4HDU A;  4I0B A;  2ZJ2 A;  2P7V B;  3IKT A;  2W85 A;  4KN7 X;  2XVC A;  1PP7 U;  4WX9 A;  4IRH A;  1R36 A;  2PQ8 A;  2Q8K A;  2GA1 A;  5CLS A;  3WU1 B;  1LEA A;  2ACJ A;  1HXD A;  4GGG A;  3H3U A;  1QZZ A;  4HDV A;  3F22 A;  2K7L A;  3V8L A;  2EFW A;  1O7F A;  2VC0 A;  2BE5 F;  2EV0 A;  3M7G A;  4OIR F;  1DPR A;  3SZP A;  2EV5 A;  2XGX A;  2HKO A;  3FF5 A;  5J8C A;  2O61 A;  1W7P A;  2A61 A;  2XAS A;  2G7H A;  3K9T A;  3LA3 A;  1BI1 A;  1ZAR A;  3RPQ A;  3WTW C;  3IRR A;  1E2X A;  5IT9 Z;  1IXC A;  1MJB A;  1O3Q A;  3V7S A;  5D6E A;  4BHB A;  3RYR A;  4HV6 A;  3L7W A;  2BYV E;  3OV8 A;  3CO7 C;  5DUI A;  4Y15 A;  5JI6 A;  2QWW A;  3KFW X;  4LFU A;  5F1R A;  3NEU A;  4A0Z A;  3ZMZ A;  5LEK A;  2W24 A;  5JR3 A;  4UV8 A;  3HUG A;  2C6Y A;  4L0Y B;  5ERI A;  1ZAO A;  4ZZD A;  1CF7 A;  2KIM A;  1A04 A;  1MZB A;  1XGN A;  5L3G A;  3J80 Z;  4MTE A;  1FYK A;  5BOX A;  4LK1 F;  4S04 A;  1OYW A;  2H09 A;  1XMA A;  3GYH X;  5D5V B;  2VBY A;  3RI4 A;  1T98 A;  2HDC A;  1G3S A;  3MCZ A;  2P8T A;  2EFP A;  4M9Z A;  1TW3 A;  3E5X A;  3L00 A;  1W4M A;  2FMY A;  3ECH A;  1FZP B;  3F8M A;  3QOP A;  1I1G A;  4ESJ A;  5D5X B;  3EDP A;  4IVN A;  1O3S A;  3ZMV A;  3HYI A;  4BAY A;  1L0O C;  4GYG A;  4EM2 A;  2M87 A;  4QLC U;  4GO1 A;  3D5L A;  3BPX A;  4Y13 A;  3SQN A;  3IWF A;  5CVR A;  4WXH A;  2XKP A;  2DW4 A;  3FXU A;  2M5W A;  2HTJ A;  2QYO A;  1S3J A;  3KP6 A;  3CUQ B;  4LB6 B;  2XAH A;  5KK1 A;  2FA5 A;  3VOE A;  2KJC A;  3TO7 A;  3S2W A;  1EV7 A;  2OA4 A;  2RGV A;  4D0P A;  1GHC A;  5L3B A;  2MLK A;  1XGO A;  2AS5 F;  4LG0 B;  3K69 A;  5LRS A;  2GZW A;  3FM3 A;  2XAG A;  4PGG A;  1MDM B;  2O6G E;  1KQ8 A;  4RB2 C;  5DCF A;  5AON A;  2FBI A;  1BOA A;  1Z6R A;  1S7O A;  4KIF A;  2JSC A;  2OBP A;  2YX7 A;  2ZCW A;  1R1U A;  4BQA A;  3L9F A;  2V1D A;  4UV9 A;  3E6D A;  5CVV A;  3VEP A;  3I59 B;  3HRS A;  5A2Q Z;  3WU0 A;  2HEO A;  2OU2 A;  5L3D A;  3HSF A;  5LHH A;  1HKQ A;  1WRJ A;  2G9W A;  4KMF A;  2V1X A;  1S6L A;  1TQI A;  1MJA A;  5K5R A;  2ZXJ A;  1B1B A;  4I09 A;  2B0L A;  4IF4 A;  2BBY A;  1B9N A;  3BJA A;  4K2E A;  4HF1 A;  3WOD F;  1BI3 A;  1ON2 A;  3RJP A;  5J8F A;  2PMU A;  1E17 A;  2JRT A;  3WTU C;  1FBS A;  4LG0 A;  5D4R A;  3Q5F A;  1W7P D;  2KKO A;  2X0L A;  4LLN A;  1QGP A;  4F7Z A;  1QPM A;  3E5U A;  1U5T B;  2ZBK A;  2EFO A;  3WTY C;  4BHC A;  2A5Y B;  4UVC A;  2GAU A;  2QEN A;  3DP7 A;  1W5S A;  3MWM A;  3T1B A;  1JE8 A;  1IN4 A;  2VT2 A;  4ASN A;  4KIB A;  4HZF A;  3J81 Z;  1U8R A;  4KDP A;  1J0R A;  2XUB A;  3O3K A;  1D8J A;  2L54 A;  4CIC A;  4L9V A;  5FD6 A;  1SFE A;  1ODD A;  1GXQ A;  1FP2 A;  2P6T A;  2HZT A;  3KP4 A;  3I58 A;  2P6S A;  4HX4 A;  3SZT A;  1MGT A;  2P7C B;  3BWG A;  5DYM A;  2VOD A;  1YLF A;  3TOA A;  1LQ1 A;  3MAJ A;  4EJU A;  1DPU A;  1P4X A;  2VC1 A;  5TRD A;  4P9U A;  3VOD A;  4YFN F;  3KP7 A;  3RKY A;  4RS8 A;  4OU0 A;  1O57 A;  1B59 A;  2DLL A;  3E97 A;  4H0E A;  4O6J A;  4I98 B;  5D6F A;  2YPR A;  2ZME B;  2CO5 A;  2VN2 A;  2ETH A;  4CO8 A;  5K5O A;  1U5T A;  3IKV A;  4L9J A;  2F5D A;  2NNN A;  4OIQ F;  3LFK A;  3TO6 A;  5ICE A;  3D0S A;  5KVR A;  1XN7 A;  1I5Z A;  2HFH A;  1IN7 A;  2Z3Y A;  2H6C A;  1Z6T A;  5CYV A;  3LQR A;  1IAW A;  2YR2 A;  1R58 A;  4ENM A;  3BOQ A;  4KFC A;  1R5H A;  2YX4 A;  2DQR A;  4BH9 A;  1K7A A;  2VOP A;  3L2C A;  2HWV A;  4FHT A;  2MLG A;  1O7L A;  2K27 A;  3L09 A;  3DXJ F;  3CDH A;  3E6C C;  1I1S A;  3F3X A;  5HS7 A;  4A0X A;  5JFR A;  1LNW A;  2HGC A;  4G7H F;  2STW A;  2VXZ A;  3OOP A;  3TO9 A;  3I0T A;  5EEG A;  2RKH A;  3GO5 A;  1KYW A;  3VFZ A;  3SFZ A;  2ZFW A;  4RB3 C;  4HBL A;  4M73 A;  3KET A;  5L3E A;  2ZME A;  3E3V A;  1XMK A;  1XSD A;  3HSR A;  1J75 A;  4A6E A;  3H92 A;  5JVT A;  4LMY A;  2DTR A;  5HLI A;  3JTG A;  1YG2 A;  3GUD A;  1OYY A;  4MQ9 F;  2HS5 A;  1YS7 A;  2E7X A;  1J59 A;  1ZGA A;  2DAO A;  2M8E A;  2A6H F;  1Q1H A;  1RIO H;  4WCG A;  1DUX C;  2QBY A;  3RPU A;  2COM A;  1G4D A;  4EV0 A;  4DQ2 A;  1AWC A;  2J5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...