1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
1W7PB 3RJPA 5D8LB 1LJ9A 4IXAA 3LFKA 3E5XA 5D5VB 1RUOA 1MD0A 2DAOA 1ZG5A 2MC3A 2NRAC 3SZTA 3GX4X 1PDNC 3WTWC 2L4AA 2PQ8A 2BE5F 5FFZA 5TRDA 2RNJA 1HKSA 1P4WA 2QBYB 1BI0A 1LDJA 4A0ZA 5D6FA 2F2EA 5L3DA 4Q5SF 2IW5A 2OAZA 1ONVA 5D6EA 3RI4A 2PG4A 5L3BA 2NAZA 2K4JA 2UWMA 1IN4A 2CGPA 2ZNZA 5H20A 1YTYA 3WGIA 4Q48A 4YFNF 2VXZA 4RGSA 3R0AA 4KNYA 1KYZA 3KEQA 3D0SA 4ESFA 3WU0A 2PI0A 2A3SA 1XB4A 4BH9A 4IVNA 3Q9SA 4HLXA 2J5OA 4MNUA 3WGHA 2DTRA 4YFXF 3JSOA 1YO5C 2X4HA 2FMYA 2P5LC 2M30A 3BZ6A 5HOOA 2IRFG 2OZ6A 3V7RA 5HS8A 5ICCA 5CVRA 4ZYGA 4HV5A 1I1GA 3MQ0A 2IT0A 3I4PA 2HYGD 2A6EF 5E8IA 2TDXA 2Y48A 1L3LA 3JW4A 2HQRA 1I27A 3KE2A 2BV6A 2OU2A 3ZQ7A 3U2RA 2IJLA 1FYKA 2M1BA 4UXNA 1LEBA 4XLPF 4EMSA 2E7WA 1FP2A 3C7JA 4U88A 3CJNA 3REOA 1IN7A 2GCXA 5IT9Z 1U2WA 2ZMEA 1D5VA 1T38A 4UVCA 2O3FA 1ZARA 4KMFA 1JHHA 2LX9A 2LF8A 4I0AA 2UZKA 3J7AO 2KKOA 3MEXA 2J5PA 1LNWA 1XD7A 5KK1A 2DQLA 2DFIA 1FSHA 5DD4A 4N9HA 1W7PD 1REPC 1HSJA 4N9IA 2PMUA 3HSFA 2ADUA 1XGOA 4AIJA 4EJOA 2LSOA 3I59B 5CVJA 3O6BB 3R0JA 3MZHA 2QQAA 2KJCA 4ON0A 3DXJF 3TKYA 4BXUA 3DF8A 3K1PA 1XMKA 3E5UA 3HYIA 1H9TA 2F5EA 1ZN2A 2VBYA 3V7SA 3FXUA 5J8FA 3E6DA 4KIBA 4A2UA 5DV5A 4U0WA 2STTA 3V7CA 1SD7A 5KVRA 3TGNA 3P7NA 4OIPF 1T98A 2HQNA 4UUVA 1YS7A 4OMYA 1R23A 4HV6A 1BIBA 1UHMA 1ODDA 1FLIA 2BBYA 3M1EA 3TDUC 1LB2A 1IXRC 1F9NA 1RI7A 2P5VA 4M9ZA 4P96A 4G7HF 1IN8A 4GO1A 2CW0F 2JPCA 4BNCA 2XGXA 3BOQA 4M71A 1U6GA 5IT9K 2H27A 1PUEE 1BI3A 5LRSA 4WXDA 2D45A 4WXHA 2EA2A 4S05A 2FNAA 2HFHA 2F5DA 4LLNA 4XRFA 3F6OA 1J7KA 5ICEA 5FB2A 4LG0B 4FHTA 2DPDA 2FNPA 1O3RA 5L3EA 2RVCA 4RAYA 1H9GA 2STWA 2B0LA 1KA8A 4Y13A 5AIPA 2KRFA 2Y0MA 3HRUA 3P9KA 5J8CA 4BYYA 4S04A 1S8NA 3TOAA 1TW3A 3O3KA 3GFLA 5LGUA 4HAMA 4MQ9F 2CWEA 4Q47A 4IRHA 3SFZA 1OPCA 2DPUA 2KIMA 4YFKF 3KZZA 2MA3A 3PQJA 1ZLKA 2PLYA 2XAFA 3WTTC 5F64A 3L2CA 1O3TA 2O0YA 4IJAA 4EM0B 2ZKZA 4ZH4F 5CLSA 1IW7F 4BHCA 2QZ8A 2X0LA 3M7GA 2XKPA 1I1SA 3M9AA 1ZRCA 2ETHA 1W5SA 2ISYA 1SFEA 3ERED 4MGRA 1USSA 4M9XA 3HRMA 1UHWA 3F8MA 2DT5A 1B4AA 3GLXA 3N4MA 3E5QA 4A6EA 3K0LA 2OQRA 3J80Z 2IA2A 3DEUA 3EUHA 4NB5A 2RKHA 4KA4A 1B1BA 4JQFA 3R6SA 1SAXA 1ZH5A 5L3GA 1QO0D 1ZG1A 4NHJA 2YX7A 1K78A 2VONA 3V8KA 1OYIA 1GVJA 4MTDA 3GYHX 4WX9A 1RNLA 3WE3A 3HOTA 2K5LA 5D5XB 3AAFA 4KMUX 1XDSA 3IWFA 1C0WA 1YS6A 4HZFA 4PGGA 2KIFA 1GXPA 1RZ4A 2Q2EA 2HYFA 3IRRA 1D8JA 3E3VA 4A5NA 1S3JA 1LEAA 1XSXA 3F23A 3RKYA 3EETA 2W25A 2F5FA 3RKXA 5D4RA 2DK5A 4KIFA 4JBAA 5H6QA 2H94A 1FC3A 1JE8A 1YW7A 1HKQA 1O57A 3HTSB 4A0XA 2FEZA 3G73A 4GCVA 4CO8A 1XCBA 2XAQA 1OYYA 4OOIA 1AOYA 4L18B 5DYMA 3HOSA 5FGMA 2UXNA 3WE2A 4A12A 3LQRA 3L7WA 1J0RA 1STZA 5K1YA 3Q5FA 3DV8A 3QAHA 4I02A 3ZMTA 3J80K 2VC0A 4ZYDA 1XSVA 2H09A 2Y75A 5EEHA 4EM2A 2EJRA 5FD5A 4HOBA 1MZBA 1ULYA 3FMSA 1ZRDA 1R1UA 4P55A 1XN7A 5ILSA 2P4WA 1Z91A 2Z3YA 3O2PE 5BMZA 4PCQA 2XRNA 1E2XA 1FP1D 2V6CA 4IHTA 5CJ9A 5A2QK 3BP8A 2RC4A 3L00A 5E18F 1ON2A 1TTYA 1IF1A 3EQLF 2NNNA 3LSTA 4F7ZA 1X3UA 4EJTA 4YG2F 2XIGA 2CQKA 4L9TA 4E70A 3F8CA 3GF2A 5L3CA 2V1DA 4LFUA 1A04A 1RIOH 3F3XA 2R7DA 4G6DA 5FFXA 1ZG3A 2EV0A 5HVQC 3CLOA 4TV7A 2K5FA 3KP5A 2D1VA 1FX7A 2ISZA 4CXFA 1HXDA 3GEZA 1UFMA 4HW0A 4Q4ZF 2FOKA 4ETSA 4KDPA 5E8GA 1K7AA 2EA4A 2ZMEB 4UV8A 4M6XA 1QW1A 3ZMVA 2JT1A 3V8LA 4LB6B 5ILUA 2AXLA 5JFRA 4FX4A 3RIRA 2G9WA 4RB1A 2IVMA 1CF7A 2HDCA 2LDUA 3QPTA 3EYIA 1G3WA 3G3ZA 2CSOA 1YG2A 2P7VB 3E97A 3TO9A 5LRRA 1LVAA 5CVVA 1OYWA 2EB7A 4ZZLA 2HTJA 3BDDA 3HHHA 5F1RA 5DCMA 3F6VA 4MQVA 3BWGA 3MCZA 2Z9OA 2DQRA 3WG9A 2DLLA 4ENKA 2FXAA 2YPRA 2CYYA 1JGSA 4KIGA 1MKMA 4O6JA 2O8XA 3KP2A 3I53A 2G7UA 1XDUA 1R22A 1I5ZA 5LLQA 1T39A 4DNCA 2JTVA 2EV5A 2OA4A 2C6YA 3OV8A 3FF5A 3MZYA 5H6RA 3ZMZA 4XLNF 4M73A 2H3JA 3T8RA 5DDGA 3SXYA 5DUKA 3QU6A 4BAYA 1P4XA 1EH7A 3EYYA 3R4KA 2GXBA 1QNTA 3QPHA 5K5QA 1YW9A 1KU9A 1D8KA 2L54A 1IN5A 1WI9A 2XHKA 1R1VA 2DBBA 2ZBKA 2ZFWA 3GFMA 1SFUA 2JRTA 1MGTA 1ZAOA 3D5LA 3IKTA 3PQKA 3TQNA 2R3SA 1FYLA 3GVAA 1H0MA 3KEOA 4L0YB 2P6SA 3SZPA 1F5TA 2VE9A 1QZYA 2DI3A 2GAUA 1IXCA 1W4MA 5CVIA 4RB2C 4A6DA 3H3UA 2DW4A 4HF1A 2CG4A 4LLLA 2EV6A 2P5KA 2DO7A 1WRJA 4GXOA 4OMZA 1DP7P 1QVPA 1DPUA 5LHHA 3I54A 3E6BA 4OU0A 3WGGA 4JK1X 1J5YA 4R79A 2BGCA 2W24A 3WTXC 2ACJA 4IRGA 2HR3A 2Q8KA 3K9TA 1HBXG 3I58A 2K5IA 2HEOA 3LA7A 1S7OA 3GXOA 1TNTA 2G7HA 3CO6C 1SD5A 2L01A 3I64A 3C3WA 4A0YA 1KQ8A 5FO5A 4LK1F 4HDVA 1CGPA 3R61A 2VOPA 2EFOA 1AWCA 4LJZF 3V8JA 4ASNA 2XROA 1W5TA 3MHXA 5JVTA 3NQOA 3M8FA 5TJJA 1O3QA 3DFGA 2CO5A 1K78B 4I09A 1FY7A 2Q0OA 3T5XA 2CFXA 2DK8A 3COAC 2WWYA 2D2WA 3VEPA 1XGSA 1QGPA 4ZYEA 3IKVA 4WXCA 1U5TC 2K86A 2FE3A 1F4KA 2M45A 1ZHFA 2YU3A 3TO7A 3I0TA 4U7BA 1BI2A 3ZMUA 2O03A 1J75A 5E1ZB 4I98B 4FX0A 1R58A 3RPUA 3F72A 5HDKA 3ECHA 2E1CA 1S6LA 3KP7A 5E17F 4U7DA 5ED4A 1ZLJA 2JPBA 1NHAA 2MH2A 2IA1A 1HSTA 2DU9A 5E1XA 2W57A 4EGYA 4ESBA 1FSEA 5FLXZ 5K5OA 1UCRA 5ERIA 2FMLA 5K5RA 1DUXC 1ZGJA 5HS7A 2RN7A 1SD6A 3KLOA 2YSRA 2FF4A 1YLFA 2MD5A 4R1HA 2P7CB 3WU1B 2VODA 1KGSA 1FBSA 2XKOA 2FBHA 2V1XA 1J9IA 3BPVA 2BYVE 2EFNA 3FHZA 3IC7A 4GGGA 4HQEA 2IA0A 2UXXA 5BS6A 1OMIA 2QUFA 4I01A 2COMA 5D4SA 2LKPA 1U5TA 5ILVA 1SMTA 3DKWA 3L9FA 3IHUA 2V9VA 4O3MA 5LHIA 4WCGA 1ZGAA 5HLHA 4HLYA 2P8TA 3ZP5A 3GZ6A 4PDKA 3H3ZA 4WWCA 1QPMA 3V4GA 1O7FA 3RYPA 2ELHA 2W85A 2GWRA 1FOKA 2FSWA 4NQWA 3ZMSA 4RGUA 4EV0A 2K02A 5DUIA 1TNSA 1BC8C 4L9JA 5BOXA 2VN2A 4Y15A 2L4MA 4G6QA 3WTZA 1YIOA 2K4BA 3P9IA 4EJVA 4KFCA 4LLGF 3HIFA 1WSUA 1ON1A 1FT9A 5DCFA 2H6BA 3ULQB 5JR3A 4Z2YA 1BIAA 4BQAA 2FA5A 1V3FA 3ZN1A 1ZREA 5FLXK 4MTEA 2PEXA 3C1DA 1B9MA 3FM3A 1OR7A 1TQIA 5ICGA 5DEQA 1P4AA 1VTNC 2VBXA 3ROUA 2MH9A 3U1DA 2QLZA 3KP6A 4UHTA 4WK8F 1O3SA 3TOBA 1CF7B 3BJAA 3RKWA 3CUQC 4HX7A 3N97A 5HDNA 4L9VA 2GXGA 4L9NA 2ZO4A 1SD4A 2YR2A 3MFKA 1R00A 3CTAA 2HGCA 3VB2A 2QWWA 4OIOF 1MDMA 1FYMA 1IN6A 3C18A 3QP5A 2A5YB 1BOAA 4RGXA 3DQVC 5HLIA 5E20A 1G4DA 1U3EM 5DCMB 5LEJA 5LHGA 3WTUC 2K7LA 1FNNA 1S29A 4M9SA 5LEKA 4OIQF 1R36A 1HKTA 4LMYA 2A68F 4UV9A 3LA3A 1USTA 3IRQA 2RQPA 3KCCA 4KN7X 1F1ZA 1YQAA 4EJUA 1IRFA 2Z33A 3BROA 4HDUA 1XMAA 1L0OC 3JSPA 3GFIA 1FBQA 3B73A 1J2XA 4CHUA 3KFWX 2OBPA 2A07F 3FMRA 3OOPA 5F6FA 3GZ5A 2A69F 4HF0A 2GA2A 3HTUA 1Z7UA 3MAJA 1GXQA 1MJAA 3CUQA 4CYDA 3TO6A 2HKOA 1GHCA 1DDNA 5LGNA 3ZMDA 4G7ZF 4P9FA 1YW8A 3R60A 2PJPA 3CO7C 1LDDA 1Z9CA 1JHFA 5HDGA 3ZPLA 1O7LA 2ESNA 1Y0UA 1B59A 2FQ3A 2EFPA 2KIUA 3VFZA 4ZZDA 4AVPA 3CUOA 2VE8A 1IAWA 4XSXF 1QZZA 2QQ9A 3BJ6A 3T1BA 4AIHA 4B8XA 1LQ1A 3F22A 1ZRFA 4LD5A 5HS9A 1K79A 5BQTA 3MWMA 2FBIA 2WTEA 1S7AA 1W7PA 3W6KB 3DP7A 3H92A 5E1WA 2IPQX 4LK0F 3L09A 1IXSB 2O61A 4RS8A 1XGMA 3F8NA 1HW1A 1BJAA 4XBFA 1Z6RA 3KZYA 4H0EA 3JAMZ 4KICA 1WQ2A 3K69A 3FWEA 2QBYA 3DPTA 4G7OF 2AS5F 4I0BA 3HRSA 3P9CA 2E7XA 3ABUA 2IP2A 3DPLC 4DQ2A 1T0FA 4KN4X 4G9YA 2YX4A 2EFWA 2MBFA 2XAJA 4I7HA 1V4RA 4ENMA 2XUBA 1PP8F 3M8EA 1IRGA 5IT3A 3HSEA 2XAGA 2WV0A 3K1NA 3KP4A 2FRHA 2RV8A 1FWZA 5LBQA 4RAZA 5D8KB 3B02A 4XSZF 1R5HA 1R5GA 2PBIA 3RDIA 1BC7C 3E6MA 2MLGA 4U0YA 1FZPB 2QVOA 6PAXA 5DD8A 3BJOA 2OZUA 3WTSC 1LDKB 5AONA 4ENJA 1WWXA 5D5UB 1G3TA 3ECOA 5ICFA 3GUDA 3KLNA 3TDZC 3ISPA 3BY6A 2VBZA 5D5WB 1IUYA 4AD9A 4CDGA 2EK5A 2O6GE 3HSRA 1BN5A 5JHUA 1XSDA 1R7JA 3WTYC 3LA2A 2FU4A 4P5OA 2ESHA 2PFBA 3HUGA 2L02A 4EGZA 1FBUA 4HX8A 1TW2A 2OD5A 2Z99A 3F8BA 3T8TA 1KQ0A 3JAMK 5HLGA 1R1TA 1U8RA 2RGVA 3Q9VA 2A61A 4N0BA 3ZN0A 1Q1HA 3K1MA 1G3YA 1P2FA 2OQGA 4CGZA 4HQMA 3F8FA 3JTHA 4B09A 4MEXF 4ESJA 2E1NA 2K4YA 2HZTA 4RB0A 4EM1A 3BPXA 2BEOA 3FZVA 4EVIA 2XASA 4R8HA 1U5TB 1MJBA 2HWVA 1FPQA 3EDPA 4K2EA 2NYXA 3FXRA 2ZNYA 3FM5A 4L5IA 3E19A 4OIRF 3VOEA 4WF2A 4RGRA 1MJ9A 1IZ1A 1P6RA 3RTRA 2V79A 2EFQA 3J81Z 3NRVA 5AIQA 1XCVA 4ZYHA 4BHPA 4AIKA 4HYEA 3IWZA 3KP3A 1EV7A 3I59A 4MHGA 1HQCA 1YFHA 1SMYF 2HOEA 2D1HA 3F21A 5JI6A 4PZJA 1Z1DA 3QP6A 4I2OA 1Z05A 1BI1A 1PP7U 3I5UA 4LB5A 1HW2A 3QRFF 3WODF 3W6JB 4KT5C 3WTVC 3KETA 2L3DA 3QU3A 2K27A 4UVAA 2P6TA 3ML6A 2LNBA 2V1UA 4G94A 3FMQA 2VOOA 2ZXJA 5CYVA 4PGHA 2QENA 1B9NA 4HBLA 4YIIA 1B6AA 1UB9A 4P9UA 4IRIA 4UVBA 5LGTA 4L0ZB 4ENNA 4OINF 1T2KA 4CZZA 4EJWA 2NNYA 3HRTA 2GIVA 4L5JA 1P92A 5BPIA 4FT8A 1EH6A 4M6YA 3SQNA 4CICA 1KU2A 3RYRA 2M8EA 2M5WA 3E6CC 4EQQA 2W84A 1TLHB 2FBKA 2KJBA 4O5VA 1U78A 5EEGA 1JXSA 3FX3A 1EH8A 2VT2A 3LQQA 2NS0A 2HTSA 3GFJA 4MEYF 4LG0A 2XAHA 4HX4A 2WC2A 1Z6TA 2F5CA 4M72A 4GYGA 5A2QZ 2JZYA 4U0VA 2XVCA 1KQ9A 1ZYRF 1MDMB 5J6XA 2JSCA 1K6OA 3HHGA 1TQPA 3LWFA 3J81K 4BHBA 2VBWA 4QLCU 2M87A 3PFIA 3RPQA 3K2ZA 4D0PA 1I6XA 2VT3A 1BBYA 2ZJ2A 4UNOA 1KYWA 1T6SA 5BPDA 4G8XA 2XV4S 4KYWA 4HA8A 5CVUA 1E17A 4IF4A 3VODA 2ZCWA 1DPRA 3CDHA 3GWZA 2QYOA 4M74A 3ABTA 3NEUA 2QM3A 4AWXB 4HF2A 1G6NA 4IPAA 4A5MA 1QBJA 1BYMA 3JTGA 1SFXA 3T0YA 2PMHA 4LGWA 3IL2A 1OKRA 4YIFA 1RUNA 1YYVA 3CUQB 5L3FA 3S2WA 2GQQA 4RB3C 2H6CA 4KUMA 2VC1A 2LF7A 4GYIA 1XGNA 1TBXA 5FD6A 2RDPA 1D3YA 2MLKA 3GW2A 1KU3A 2Z5UA 1TQMA 2QQBA 3SHFA 1G3SA 4IHSA 1BM9A 3GO5A 3LAPA 2PN6A 2R7FA 4Y17A 3U9GA 2GZWA 2GA1A 2HS5A 3QOPA 3LAJA 3I71A 4QWQA 2EWNA 1WKMA 2A6HF 1HW5A 1KU7A 3ELKA 3FXQA 1QQIA 1J59A 2HKXA
chains in the Genus database with same CATH superfamily
1W7PB 4IL6C 3RJPA 4EMKB 1BR2A 2ZSHB 1GDTA 2LQKA 1NZ9A 2X6OA 4X9DA 5D8LB 1LJ9A 1WPKA 2BW3B 4IXAA 3H9GA 2X4XA 1OCRH 2VPLA 4M77A 3LFKA 2D0QB 3R6OA 2D0NA 4Z02A 1NYGA 3CPWA 2HD0A 2LCLA 2M51A 1RAIB 1HJDA 3MZ8A 3E5XA 3I5RA 5D5VB 1WJDA 4XMYA 1RUOA 1G8XA 1MD0A 1VI0A 5B3SH 3S16J 2DAOA 1AD5A 1UMQA 1ZG5A 3MKLA 2MC3A 2NRAC 2NVQJ 4XL9A 2A6TA 3B6CA 2BE9B 1W0UA 2MW8A 3SZTA 3AL0C 4D9JA 3GX4X 1PDNC 3WTWC 2CH4A 2ZJPF 2L4AA 2PQ8A 4DYCA 4QT7A 1T95A 2AXTC 2LMDA 3GNFB 2W7NA 2JMWA 1N77A 2BE5F 5FFZA 5TRDA 4OMMA 2BZTA 3J80E 2RNJA 2OTJI 1HKSA 1P4WA 2QBYB 1BI0A 1LDJA 3H41A 1QWEA 4A0ZA 3CLQA 1RRJA 5D6FA 2F2EA 1VQNQ 3LWHA 5L3DA 1EJ9A 1JB0E 3CMAQ 4Q5SF 4C0ZA 1P7IA 3CCRI 4ZN1A 2CQXA 4XTVA 2GIZA 1XX5A 2KRCA 2EZKA 2W1OA 2FL7A 2O5RA 2IW5A 4BQNA 3MMYB 4DZJA 2OAZA 1OOTA 1ONVA 4IOAF 3ZXSA 1SFKA 2RHXA 2LREA 5D6EA 2MWOA 3RI4A 5GANj 2GFUA 2PG4A 4OB1B 2Y0SN 5L3BA 1JJ6C 2JT4A 2VKHA 4A4HA 2NAZA 1O9SA 2CQNA 2FEIA 5A2QE 2V9PA 2K4JA 1JO8A 2CP6A 3I55T 2UWMA 1WIEA 3I56T 5GMKl 1IN4A 2RD1A 2XF7A 4A69C 2CGPA 1T0FC 1RUWA 2NXNB 2ZNZA 4BXXJ 4GY5A 2NYSA 5GANd 5H20A 2ZMEC 1YTYA 4IEJA 2VXDA 5KE3A 4DBRA 1VQNA 2K79A 3WGIA 4Q48A 1DJ7B 1LE8B 2F2VA 1VQ8Q 2DYIA 1XOVA 3M4GA 1M9SA 1A31A 3E2UA 4YFNF 4C92E 3X26B 2DFFA 2VXZA 2OJED 4QQ6A 1K9MR 4EEFG 4RGSA 4XLAA 3R0AA 3HP9A 4KNYA 1KYZA 4I76A 3KEQA 5F0CA 4RTWA 2J6OA 4PKCC 3M0SA 5GAMj 3D0SA 2HSEB 2F5VA 1I3AA 2XMFA 3VS6A 1YIJQ 2RN8A 3P8DA 2OC6A 2UUZA 3WU0A 4ESFA 2PI0A 1SKUB 2CUBA 1M3BA 2D8JA 2K9GA 2A3SA 1XB4A 4BH9A 4W1UA 1KZHA 3QG1A 4IVNA 3Q9SA 4M75G 5CKFA 5GAN8 1VQ7Q 4HLXA 2K3XA 2MGQA 2O2OA 2P0KA 2J5OA 2XDVA 4MNUA 3WGHA 5C3EJ 4FTHA 2DTRA 1BCMA 2R7RA 4BBRJ 4YFXF 1PKSA 3PMIA 7AT1B 5GAMd 3JSOA 1YO5C 1VQKT 3QWLA 2Y4XA 2QA4Q 2X4HA 3CJTB 2FMYA 4J6YA 3I9V2 2P5LC 1ZBJA 2DXUA 2KT8A 2M9HA 3GPLA 3KPHA 2M30A 1Z9QA 2XI9A 3BZ6A 4M77G 4PJ0C 3C0CA 1FOXA 5HOOA 2IRFG 4FE4A 1UGVA 2OZ6A 3V7RA 2L3PA 1NG7A 3BZCA 5HS8A 2DL8A 4CRIA 1GT0C 3QWYA 4HEA2 5ICCA 4LITA 2QKLB 1KQ1A 1XJWB 2DOAA 5CVRA 4ZYGA 2DM1A 4J8OA 3L2WA 3EG2A 1RR8C 1ETWA 2JA8J 1DP3A 2LT4A 2BTTA 4HV5A 1LPLA 1I1GA 4OMQA 3MQ0A 2IT0A 2VKDA 2IGOA 5LJ5g 3I4PA 1QP3A 2HYGD 1YHQI 2A6EF 5E8IA 2TDXA 3JCMh 2Y48A 1L3LA 5CQXA 3JW4A 1D3BB 2HQRA 4RTVA 1M90R 4D8DA 1ZQ3P 3BTJA 2VC8A 3VUZA 5KCOA 1I27A 3KE2A 2LBFB 1X6BA 2QA4A 1Q82R 2BV6A 2OU2A 4A4FA 3FEOA 4KT0E 4PLLA 4J00A 2DJQA 5KCMA 2WB1A 2QEXI 3PO2J 3ZQ7A 3U2RA 2OJ2A 2IJLA 1WI7A 3A8GB 3OW2A 3HUGB 4BL0B 1U06A 1FYKA 2RHZA 1HC8A 1N6AA 3VRZA 1B34B 1Q81R 2M1BA 4UXNA 4FYXB 4JLIA 1V76A 1LEBA 4F52A 4XLPF 1HOMA 3QODA 1QMCA 4EMSA 2E7WA 2IS1A 3VUBA 1AKHB 4ORZA 4FCYA 2EKHA 1FP2A 3URGA 1UTIA 2JUFA 3EGXB 1VQ5Q 5CKBA 3C7JA 4U88A 3CJNA 3REOA 3JCMX 1IN7A 5IHIA 2JQ7A 1JU5C 2GCXA 3TP3A 1IC8A 5IT9Z 5EG0B 2RH2A 3VYTB 2ZPGB 2WAQA 1SC7A 4AU7A 2JMAA 4XK8E 2LC2A 2VJ4A 4B3XA 4CSWA 1VNDA 1U2WA 4C3HJ 3A98A 2ZMEA 2ABLA 1D5VA 2FYKA 8ATCB 1YJWQ 1XG1A 3GMEA 4UVCA 2O3FA 3OYAA 1T38A 1ZARA 2Z0WA 3EG9B 2GF7A 2GTJA 3QDFA 4KMFA 4LUDA 3NTIA 5KYNA 3PIOA 1JHHA 2FPEA 4BKXA 4AT1B 1VQ6I 2LX9A 4IKFA 5L8RE 2LF8A 1R4NB 2HPIA 4I0AA 2UZKA 2ELJA 2VB6A 3J7AO 3G1JA 1VQ5A 2KKOA 3MEXA 2J5PA 4NC6A 4A3BJ 4IUTA 2VQGA 3G6EI 2NUTA 1LNWA 1XD7A 2EZLA 4L5EA 5KK1A 3CCEI 1C0MA 5CQYA 2DQLA 2DFIA 1FSHA 3M0QA 3E7LA 3DBRB 5EGOB 5DD4A 2R93J 1PSFA 4N9HA 1I4K1 1RKWA 1W7PD 3IQLA 1M1KR 4M7AB 1REPC 2WSEE 3CJRB 2K5CA 1YJWA 1HSJA 3HL8A 3EHQA 2FX0A 3MP8A 2ZFUA 2MK5A 2MABA 5A0GA 3CCQQ 5FKKA 2DXCA 4ZGJB 1E7OA 4KULA 3GIBA 2JOYA 1M3AA 2K3YA 4N9IA 2KSSA 2PMUA 3HSFA 2E5QA 1IV8A 2NUPA 3ZQCA 3O8HA 2ADUA 1XGOA 3CC7I 4AIJA 3HZJA 5LJ5f 2E65A 1N9SA 4EJOA 4P5NA 4IOCF 2LSOA 3M59A 2VLAA 1M5Q1 3I59B 2GLOA 2JUCA 4DZPA 2PUKB 2VV5A 5A0DA 4ITVA 5CVJA 3O6BB 1PRLC 4XTYA 3R0JA 3MZHA 2CP3A 3CCVQ 2QQAA 2KJCA 4ON0A 3D5RC 3DXJF 1NYFA 2ZPEB 3TKYA 4BXUA 3CCLI 3DF8A 3OIOA 2ZCFB 1NE8A 3K1PA 1XMKA 3E5UA 4QW2A 3HYIA 5CKEA 1H9TA 2HOSA 3AT1B 3CCQA 2F5EA 2F2WA 4C8QB 5IXFA 3NARA 3UWNA 1ZN2A 2VBYA 3V7SA 4OB3B 3FXUA 4DOZA 3OYEA 1VQOI 2BKDN 1H8KA 1JRIA 5J8FA 3E6DA 3KYDB 4KIBA 4A2UA 5DV5A 1UGRB 2ED1A 3K4MA 2KGTA 2LYCA 4U0WA 3PNTA 4S0HB 4OMOA 1A5JA 4BY7J 2STTA 3V7CA 1SD7A 1TWBA 5KVRA 4IURA 1OEBA 3ZFJA 4RLFA 3TGNA 3P7NA 3JCMd 4HVVA 3CCVA 4MIMA 4OIPF 5KYXA 2C06A 1M8MA 1T98A 2HQNA 1B8IA 2DNUA 1MBFA 4UUVA 1PWTA 3DLLF 1YS7A 1NEBA 1RC9A 2R7WA 2DKGA 3DLMA 1YWPA 1SF9A 2CS3A 4OMYA 2H8HA 2BZXA 2FOWA 2AO9A 5F0HA 3M4YA 4GLMA 1R23A 4HV6A 3DKYA 5J1YA 3EFRA 2CZ0B 1BIBA 1UHMA 1ODDA 3PL8A 4UB6C 2BBYA 1FLIA 2CUEA 3HFOA 3M1EA 1CQTA 4LDUA 4B6MA 5IOZA 4F7UB 2A08A 3CD6T 2BIVA 3TDUC 2HEQA 1JXOA 1SEUA 1LB2A 1IXRC 1PRMC 1U3OA 1F9NA 1QVFS 2E12A 1RI7A 2HXIA 2EIMH 1RETA 2VPRA 2P5VA 4M9ZA 4P96A 3H9JA 3BR6A 2KMTA 1Q86R 4G7HF 1VQPI 2E60A 2VJIA 2QYZA 3JCMV 1IN8A 5KYUB 2BOLA 4GO1A 2CW0F 1UZCA 2JPCA 2RNAA 1E3OC 3C2BA 4BNCA 2XGXA 4AIDA 4AYBN 1Y7XA 1M1KC 3BOQA 4M71A 1S72I 1CKBA 2AT1B 1U6GA 5IT9K 2H27A 1HSQA 2BZYA 3JCMb 1K73U 5CQEA 1PUEE 2B8AA 1BI3A 5IOYA 2DYSH 5LRSA 2EQJA 2LVMA 4WXDA 4XLCA 4WXHA 2EA2A 4H4KC 2D45A 4QVCA 3CMEA 1MV0B 1ETYA 3Q3SA 3PUFA 2FNAA 4S05A 2HFHA 2C0OA 2LKSA 3DB3A 3NTHA 1W2BA 1AEYA 4HVUA 5JLXA 1V29B 3LSMA 4M7DB 4DJAA 3TP0A 4BY6B 4Z88A 5KE2A 1MBJA 3CC4Q 1WVRA 2F5DA 2VQCA 4XKBA 4F92B 3JRHA 4LLNA 3QUIA 5DY9A 3EUHC 4XRFA 3F6OA 1J7KA 1NTCA 5ICEA 2O9VA 1YX3A 3SFIA 5FB2A 4LG0B 4FHTA 3TEDA 2DPDA 4RAGA 1VOMA 4RCCA 3MVPA 5M5WJ 4BB7A 4M7DC 4PFPA 2FNPA 4JPBW 1A35A 4OMPA 5KNLA 1O3RA 2COZA 3OB9A 3LSHA 5L3EA 2RVCA 2EGCA 1V5FA 4RAYA 4C8QE 1H9GA 3X2QH 4PJOF 2V26A 2STWA 2F1LA 2B0LA 2HSPA 5FU6B 2JZ2A 1KA8A 4Y13A 3BQZA 2QK0A 2EYWA 5AIPA 2DETA 2F4OB 2KRFA 1RI9A 5K7FA 2Y0MA 3HRUA 3P9KA 5J8CA 3OYYA 4BYYA 4FW2A 4S04A 4MDXA 2FO0A 2M2EA 1K61A 1S8NA 1Y1WJ 4BACA 3TOAA 4KITB 1TW3A 3O3KA 1HF0A 2JN0A 2MI6A 4R0KA 2JXBA 3GFLA 5LGUA 1OJLA 3QOEA 4HAMA 4MQ9F 3MKZA 3I4MJ 2OTJT 2CWEA 4IZZA 4Q47A 1IG7A 3A01B 4BEHA 1D1CA 3KXTA 1Y71A 4J9HA 4IRHA 4M78D 2WAEA 4IHVA 4AFUC 3OYFA 3SFZA 1OPCA 5FKMA 4P1WA 1KQSA 2DPUA 2KIMA 1NEGA 4YFKF 3KZZA 3RESA 4JYKA 4BU2A 4XTUA 3VS0A 2FJ1A 4F7UE 2AZSA 3CCRT 3FISA 4F3QA 2MA3A 3PQJA 1ZLKA 1VQNI 2O9SA 1QPIA 1D0ZA 1TZLA 2PLYA 2OX7A 2XAFA 2O7OA 3WTTC 5F64A 3CDIA 4XONA 2X48A 3L2CA 1A6IA 2L5QA 2Z1DA 5J1UA 3OYMA 1O3TA 2O0YA 4HG2A 4IJAA 4EM0B 5DM7F 3GP8A 3NTKA 2ZKZA 4J83A 1UDLA 2JSPA 4ZH4F 5CKTA 5CLSA 2CUDA 2FRWA 4FU6A 1V54H 4IO9F 3SEMA 1IW7F 4BHCA 4II2A 2QZ8A 2X0LA 1V5EA 3M7GA 3IH2A 2XKPA 1I1SA 3M9AA 1ZRCA 2ETHA 1FOWA 2L9SA 2YXYA 2RI2A 1C6VX 2E2JJ 1W5SA 3I3LA 2ISYA 1SFEA 3ERED 1SHFA 2ME6A 4MGRA 3JCMP 2M35A 3OYDA 4M7AD 1USSA 4M9XA 3DU5A 3HRMA 1UHWA 3F8MA 1VQ8I 4M7DE 3BG7A 2DT5A 3LNQA 4YRVA 2VKEA 1G59A 3HC7A 3PNYA 1B4AA 1JJ8C 3REAB 3GLXA 1MW7A 4AMCA 3N4MA 3JSCA 3E5QA 4A6EA 1NM7A 4XIDA 5D7UA 1Y96B 3K0LA 4J7IA 5EDNA 2OQRA 3H9QA 4XQFA 3F9KA 1OX8A 1TUGB 3RPUD 3CDLA 2IA2A 3J80Z 2WSCE 3DEUA 3EUHA 3OYGA 4NB5A 4D7MA 2RKHA 3ASKA 3CBPA 2DMPA 2OAWA 3M9QA 3K70C 4KA4A 1JKQC 1H3ZA 1Y07A 2DRMA 2CP0A 2J6FA 1WJ5A 1PUFA 2L9NA 3D7SB 4UC4A 1B1BA 4JQFA 3R6SA 3BR1A 1SAXA 1ZH5A 2X4WA 2QA4I 5FLXR 5L3GA 1ZHIA 5GAOp 2K9LA 4A3CJ 1QO0D 3JCMg 1J3TA 1ZG1A 4NHJA 4C8QD 3OS2A 2YX7A 2XF6A 1K78A 4C0DB 2WY8Q 2KZVA 2VONA 3V8KA 1OYIA 4XN3A 2D5VA 2GBYA 4HNVA 1YCYA 3A1PA 3PNWC 4M78F 1GVJA 3SDGA 4MTDA 3GYHX 2DMQA 4WX9A 2L8DA 2X4YA 1RNLA 2H1KA 1QVUA 3WE3A 1YHQT 2EPDA 2DMNA 3DKXA 3HOTA 1R6RA 2K5LA 3BLYA 2Q1ZB 4KJZA 3LX7A 5I11A 1YI2A 5IHNA 2BUDA 3M55A 5JVGF 5LJ3h 2LCCA 2DOFA 2QEXT 2DO3A 1NBEB 1EF4A 5D5XB 3OBYA 2OV7A 3AAFA 2VUMJ 2JA5J 4KMUX 1ERDA 2DTZA 2RQRA 1XDSA 1QLYA 2EZHA 4B43A 3VS4A 3IWFA 3HB9A 3NWSA 4OB0B 3L2RA 1C0WA 1YS6A 3Q0WA 5F04A 4HZFA 1JKOC 4PGGA 1DGRM 4NC8A 4RDUA 2GBQA 1TWFJ 2CW7A 3CPWP 2K9NA 2KIFA 1GXPA 1RZ4A 1VF9A 3BG9A 4RLQA 3TEEA 4A3LJ 2RQWA 1HDDC 1WLPB 2Q2EA 2HYFA 4M75B 1Z9ZA 3BQYA 1QU3A 4PK4A 2NLUA 3IRRA 1D8JA 3A8HB 3E3VA 4OF1A 1VQ5I 4A5NA 1S3JA 4EDUA 1KD1R 1LEAA 3CCYA 1XSXA 4GRIA 2KY9A 3F23A 1VYVA 3RKYA 3IP4B 4C5GA 1WJRA 1M4ZA 3EETA 2A28A 1KC8R 2GTOA 3A8LB 4JP0A 2W25A 4M77B 2F5FA 1VQLQ 5GAOr 3RKXA 4XOTA 2CGHA 5D4RA 2DK5A 3D5SC 5FROA 2PUOB 1XS9A 4XU3A 4NL3A 2CUZA 1VQ6T 4C2UA 4KIFA 3NMZC 4JBAA 1YJWI 2IPOB 4PSXA 2HQAA 2BE7D 2KRNA 4LIUA 5M5XJ 5H6QA 1NK3P 1VA7A 4M77C 2H94A 1FC3A 1JE8A 1YW7A 3G6ET 3KZIC 2L9VA 2DRKA 1HKQA 2E4HA 3QHSA 1O57A 1Y8RB 4BDYA 3HTSB 1EZZB 4A0XA 1K6YA 2LG4A 4E47A 2FEZA 2LD5A 2OUMA 4JRIA 3TBIA 2J7IA 3CXCA 3G73A 1Y57A 4DOWA 4GCVA 1NPRA 4CO8A 4ZTJA 1XCBA 2XAQA 2MVTA 2CT4A 2DPPB 1UGQB 3EG3A 4NL2A 4F7UA 1OYYA 2E71A 4OOIA 4C5HA 1AOYA 2NWMA 1VQLA 4M3BA 4L18B 5DYMA 4HCZA 3JCMf 5KCHA 3HOSA 1RKTA 4C3IJ 3SHWA 5FGMA 3JRZA 2KIQA 1I07A 2BXZA 4ELYC 5CR2A 2A37A 2VL8A 5EZGA 2EIFA 2UXNA 3CCQI 3WE2A 4A3MJ 4A12A 1Z67A 4YEJA 3LQRA 1PD0A 2F5KA 3L7WA 1Z7LA 4E7JA 1J0RA 2RO0A 3CCSQ 1K8AR 1Z3YA 4ZDOA 3DCFA 5GANh 1VQ9T 1STZA 2KFDA 5K1YA 3Q5FA 2JUGA 3DV8A 4ME7A 3G71Q 3QAHA 1PYVA 1D1BA 2HNIA 3KFVA 4I02A 3PNVA 4ZYAA 3GOXA 2EYYA 3VYHB 1MGQA 3JV3A 3ZMTA 3CCLT 3QJ6A 4JS4A 1OU9A 2K9QA 3J80K 2VC0A 3CCVI 4ZYDA 1CSKA 2CZ1B 2RJCA 1YJNQ 4DYQA 2R5MA 2X9HA 4RCBA 2JN6A 4BUPA 5JLWA 5FLMJ 1N78A 4BE2A 1NLPC 4C2MJ 1TT0A 4E7IA 3HOZJ 2AKKA 1XSVA 4RG2A 2H09A 2Y75A 3HM5A 5EEHA 2MZ4A 1Z21A 3GTPJ 4IIOA 2EBIA 4EM2A 2M02A 2BXYA 4JZ4A 1VQOT 3JB9D 2EJRA 1VQ4Q 5FD5A 4HOBA 1MZBA 4M77D 1ULYA 3FMSA 3CCSA 3OY9A 1ZRDA 3OQ5A 2LH9A 5DM6F 4OMNA 5LJ3j 1SSFA 1R1UA 4P55A 2O4XA 4GBQA 1MMAA 1XN7A 3INZA 5EG2A 5ILSA 4M75E 1TP4A 1IGNA 2P4WA 1Z91A 2Z3YA 3O2PE 2PTKA 3G71A 5BMZA 2VQHA 4PCQA 2XRNA 1B07A 5GAMh 1KD1C 1E2XA 1FP1D 2V6CA 3OYNA 4IHTA 3CCUQ 5CJ9A 2VI6A 5A2QK 2DK3A 1SVMA 4K11A 4OMFB 3BP8A 2RC4A 3L00A 1M30A 1WHLA 2D9TA 3VS3A 1YJNA 4FYYB 3SEQA 5E18F 1DQUA 1ON2A 2F69A 1PM3A 1TTYA 1IF1A 1MNDA 1DGWY 2FZGB 2ZPBB 4AUXA 4JX4A 4M77E 4CZCA 3EQLF 2HPMA 4QQGA 2QDLA 3ZQQA 2KI7A 4PJNA 3PO3J 1MBKA 3M07A 2NNNA 3DU6A 3EGDA 3OSSC 3LSTA 4DBHA 5GMKm 4F7ZA 1X3UA 2MFZA 3A2KA 3DTEA 1WZ2A 2QQSA 4EJTA 4JRQA 4YG2F 1GUUA 2XIGA 3CMEI 1MUZA 2RQUA 3OW2P 3Q0VA 4A54A 3HKZN 2DDBA 2GOMA 4D1QA 2HBWA 2CQKA 4L9TA 4E70A 3F8CA 3GF2A 4CUGA 3ER0A 4A63B 5FLXE 5L3CA 1WFXA 2CUJA 5GAHJ 1VQPT 3AL0B 3LYIA 2I5UA 2DFUA 2FPFA 3CCUA 2JA2A 2O31A 4RTZA 2V1DA 4LFUA 1OCOH 1A04A 1Y1VJ 2Z16A 2KZGA 5HODA 2NUZA 2BHYA 1RIOH 3ZCOA 2M0OA 5FKOA 1S72T 2MSYA 1XNIA 3F3XA 2R7DA 4G6DA 3BDUA 3S2HJ 2RHYA 3BE3A 4Y7NJ 4ABZA 2F48A 5FFXA 2DL4A 1ZG3A 2EV0A 1S7EA 5HVQC 4E7LA 5KH6A 3CLOA 4FIBA 3TW6A 3MO8A 4J01A 1JJ2A 2DERA 2RAEA 2WACA 2W0ZA 4TV7A 3UPUA 2JWTA 3MPUB 3CCUT 2K5FA 3UATA 1K8AC 4V2GA 2HZDA 3W6VA 4PLIA 3GBQA 3KP5A 2D1VA 2JA7J 3X28B 1Y0MA 3BDLA 4J9FA 3TQ7P 1FX7A 1ZK8A 2ISZA 2XSDC 5EF6A 4B47A 2VWFA 4CXFA 4AG2C 1HXDA 2HYJA 1WHJA 4NBQA 3GEZA 3BR3A 2KK4A 4XQ3A 1UFMA 4HW0A 3LSKA 4Q4ZF 2FOKA 1UHCA 2M0MA 4ETSA 4A4EA 4KDPA 3EFOA 1W5CC 3JB9F 2EJ9A 1UG2A 5E8GA 3EG0A 1K7AA 1RR7A 1GV5A 2DCEA 2EA4A 2ZMEB 2EBPA 3EH2A 3OBWA 2XRLA 4FW1A 4UV8A 4BGDA 4M6XA 3DBHB 4J6XA 1YBYA 5GAN5 3ZQIA 1QW1A 2M34A 1X2MA 1WGSA 4F04B 3OMGA 3ZMVA 4ATOA 1MH3A 1MBHA 2JT1A 3J7AY 1OISA 2EH3A 1TWAJ 2CRGA 3V8LA 3C12A 1RPWA 5D6XA 1KSWA 4Z89A 4LB6B 5ILUA 1RESA 2AXLA 1SVLA 5JFRA 4CYCA 4FX4A 1FEXA 3RIRA 5C4JJ 2G6FX 2P0PA 3J7ZI 2G9WA 2EGEA 4MLOA 4RB1A 4VUBA 2NUTB 2IVMA 3GTQJ 3CMAA 2K3BA 3ZQFA 2NS7A 1B72B 3QZ9B 3FK6A 2WB1N 2EQMA 1VZ0A 2PVDB 4BUGA 2LKXA 4M75D 1CF7A 4HT9A 5E3MA 3DEWA 4X1EA 2HDCA 2LDUA 4EATA 5LJ5e 3HOVJ 3QPTA 3EYIA 1G3WA 4PJOC 3G3ZA 2PJRA 4X34A 3JB9J 1VQNT 2CSOA 1YG2A 3AG2H 2DIQA 2O01E 1AWOA 2P7VB 4NNJA 3TSZA 1LNXA 3H8ZA 4LDWA 3E97A 3E0JB 5GPAA 1ORKA 3A03A 3TO9A 4XRMA 1EIFA 5LRRA 1SAUA 1BL0A 2AK5A 2E5KA 2KQWA 2NUPB 2XGDA 4RTUA 1E6HA 1K4TA 2OPTA 2K2MA 1EX4A 2WAQN 1LVAA 5CVVA 3A0HC 2M4KA 1VQ8A 2VKVA 3QPLA 2IGNA 3S1RJ 2YUQA 4RUGA 1OYWA 5F08A 1OI1A 3UA7A 5D6WA 2EB7A 4B9WA 1JT6A 1MMDA 1B3QA 4ZZLA 4BS9A 5KHDA 1R71A 2HBPA 4IUPA 4ELZC 3BTCA 4FE7A 5HNHA 2K3PA 2EYQA 3LSPA 2HTJA 3DLLA 2ZXIA 1YIJA 1WJCA 3BDDA 4FQGA 3HHHA 3ZQHA 2DX1A 1NPPA 1VQ8T 5GJVB 5F1RA 5DCMA 1AA7A 1ZUYA 3LWIA 2A3LA 5GAOn 3F6VA 3IH3A 3BWGA 1MNEA 4MQVA 3F0CA 1NJIC 1I6HJ 5FWBA 2R7OA 3MCZA 2O8KA 2Z9OA 1VQ9A 2DQRA 3WG9A 1VQ7A 2NVTJ 2DLLA 4FSSA 4JX5A 2M4GA 4ENKA 5CO7A 2FXAA 2YPRA 2CYYA 2BVLA 2NVYJ 2MUNA 1Y6IA 1JGSA 4KIGA 1MKMA 4O6JA 5FJ8J 5KYXB 4ESRA 1B8IB 2O8XA 3KP2A 2A0FB 4CC3A 3T9NA 2Y90A 2E34A 3QO3A 2Y0SA 1XMXA 3I53A 2XG8D 2KISA 3H0GJ 2G7UA 1U9OA 3EPZA 1XDUA 1E6GA 3K4NA 1R22A 2JVGA 2K85A 3GCMA 1I5ZA 4A53A 4E7SA 5LLQA 1T39A 2QA4T 1MNMC 4A93J 2JVVA 3FDYA 3DBLB 2JTVA 4DNCA 1YI2I 2E6NA 2HZYA 2RQVA 3HGGA 3M56A 2EV5A 2F4IA 2OA4A 2C6YA 1O75A 2CQQA 4D5CA 1X2QA 2VKNA 4BI8B 3K4KA 1R8OB 1M3CA 1FYNA 4GFBA 3AG3H 2XF5A 2KHMA 2QF7A 3OV8A 3FF5A 1LVKA 2F6CA 4XKVA 3OYJA 2DD4A 5LJ3g 2YDLA 3MZYA 4IUUA 4V2FA 2JVHA 2LZ6B 5H6RA 3ZMZA 3WVDB 4XLNF 1X01A 5KYWA 1Q7YU 1OQYA 4M73A 1BBZA 2DMTA 2H3JA 4MMLA 3T8RA 5DDGA 2RNGA 3SXYA 5DUKA 5H2FC 3M0UA 3QU6A 4BAYA 1P4XA 3OS0A 2J06A 1EH7A 3EYYA 3R4KA 1X6GA 2GXBA 1I39A 2HVQA 1DU6A 1QNTA 2KAFA 3QPHA 5K5QA 1YW9A 2EFIA 4E7ZA 4DA4A 1KU9A 2CP2A 1D8KA 2L54A 2PMZA 1OZ2A 1IN5A 1WI9A 3IH4A 4C92D 2XHKA 1R1VA 2DBBA 2ZBKA 2ZFWA 3GFMA 3SYTA 1WQ7A 3THKA 1JEGA 1SFUA 5GAN7 2JRTA 4PJOA 1MGTA 3P8HA 1ZAOA 1AT1B 2DL7A 3D5LA 1BK2A 8AT1B 2LMJA 4RTXA 3VRYA 2XPUA 3FC3A 1LFUP 3IKTA 1SG5A 2EIKH 4DOVA 3PQKA 2EVRA 4C9YA 2L89A 3TQNA 1I5LA 4Y33A 1TG0A 3RUXA 1K4SA 4N4OB 1E3PA 2V1RA 1X3WB 3K2AA 1VQ5T 1WFWA 2JTEA 1YJ9Q 1W36C 2KNBB 2R3SA 1FYLA 3GVAA 5KAIC 4KBMB 3X24B 4AFSC 4F17A 3CPWS 1H0MA 3KEOA 4L0YB 3A0BC 3G1OA 2CSQA 4JZ3A 2MCNA 3VYRB 2R4GA 1RL2A 2P6SA 3SZPA 4IHWA 2ED0A 4FL6A 4HNTA 3VPRA 2KXCA 3UT1A 1LUJB 2VJJA 1F5TA 2PU9B 5EJCA 1ZUKA 3OA6A 1KQSP 4X1VA 2GXAA 1IGUA 1PHTA 3JRIA 1VQLI 1YJWT 3O5ZA 5LD2C 2HL3A 2YUSA 2VE9A 1W1FA 1QZYA 2DI3A 2GAUA 1IXCA 4N0AA 1W4MA 4ZGEB 2CQ7A 3EUAA 1AZGB 4C5EA 5HY6A 2DVJA 4BJ6C 3ASNH 5CVIA 4RB2C 3PIPF 2ZJQF 2KYMA 4A6DA 4LD6A 2VXFA 3RDVA 3FDRA 1YJ9A 2KP6A 2ICWG 3H3UA 2HNHA 4BEHB 3L2VA 2QXFA 3FJ5A 3UF4A 2SEMA 4TVRA 4A3GJ 2RMOA 2EJFA 2DW4A 2K2VA 5TGTA 2A5WA 4FISA 4HF1A 3EG1A 1UGPB 4MO7A 2I2LA 2CG4A 1RABB 1N8RU 4LLLA 1HK9A 2EV6A 1CKAA 2P5KA 5GAGJ 5GANg 2KPMA 3ONQA 2DO7A 1WRJA 4GXOA 2HVSA 4OMZA 3Q0UA 2K9MA 1DP7P 3LOCA 1IGQA 2KYBA 2N8GA 1QVPA 3LL7A 3C4SA 2M8GX 3TMOA 1DPUA 1U8BA 1E3HA 3CCQT 2XD0A 2J05A 5LHHA 4XU0A 5LJ3f 1H641 2R7UA 2CFOA 3I54A 3EH1A 3E6BA 4OU0A 3AG4H 4IIMA 3OL4A 3VYUB 5GJWB 3WGGA 4D5FA 4JK1X 3JRDA 1J5YA 2A7YA 2AHJB 4FASD 2L0AA 3CCSI 1TUDA 1GL5A 4R79A 2BGCA 2W24A 3WTXC 2ACJA 9ANTA 2JM8A 4C92F 2XC7A 5M9OA 1F36A 4IRGA 1NG2A 1QCFA 2HR3A 1RQ6A 2Q8KA 3G71I 2XPVA 3CCVT 3LSIA 2EW3A 3K9TA 3CCMQ 1MSFC 1HBXG 2DTHA 2ZAEA 4PFOA 4NUBA 2E64A 1QVGA 1T56A 3I58A 4I6ZA 2K5IA 3SJMA 1RADB 1WHMA 1YJNI 2HEOA 3PSIA 2VASA 3LA7A 1S7OA 1ZA1B 5GAMg 3GXOA 1TNTA 2G7HA 3CO6C 2CS7A 2WAFA 3WXMB 1SD5A 5J40A 4KUIA 2DA3A 2L01A 3I64A 2OI3A 3CMYA 4PJOG 3C3WA 4A0YA 4XLEA 4II3A 4HPQA 1KQ8A 5FO5A 3VYGA 1BR1A 2ZJRF 4LK1F 2GM4A 4KUDK 2KRSA 2ZSIB 4HDVA 2LY1A 4XR6A 1CGPA 5BNGA 4IHYA 2CREA 3R61A 2VOPA 3JRAA 2EFOA 1AWCA 4M78A 4IQ4A 3G7ZA 4LJZF 1ABQA 2D1XA 3V8JA 2P0WA 3BZKA 4XRSA 1V1CA 1AU7A 1ZUUA 2EQKA 4CA0A 2ECCA 3CCMA 2CJJA 3BC8A 3CCUI 4ASNA 3HOWJ 4FYWB 2XROA 1W5TA 2EILH 1GXIE 1G5VA 3QPSA 1WXTA 1TWGJ 1AZEA 3MHXA 5IAYA 5E79C 5JVTA 1PUFB 3NQOA 1OU8A 5GMKh 2XKOC 2E6ZA 1T8IA 3M8FA 5TJJA 3HSBA 1O3QA 2AQFA 3DFGA 3M53A 2YRVA 2CO5A 3CMET 1NG6A 3U1KA 1GV2A 4I09A 3JREA 1K78B 2K3FA 1QCNA 2SRCA 3RBBB 3AG1H 1FY7A 2Q0OA 3T5XA 4RBOA 1SFOJ 4IQJA 2CFXA 4RKUE 2DK8A 3COAC 3VU3C 2WWYA 4CC2A 1UECA 2D2WA 3VEPA 1LPQA 1KG1A 1XGSA 1RAGB 1YRNA 1QGPA 2HQEA 2OTJQ 2XU8A 5GAOq 4R56A 2L9RA 4ZYEA 1VQ9Q 2QSGX 2VQLA 3IKVA 4WXCA 1U5TC 1IZ6A 4MZMA 4A4GA 3OW2S 2K86A 2ECBA 3K10A 4JLGA 2FE3A 1WH7A 3HBLA 1F4KA 4FT2A 2M45A 5GANf 1ZHFA 4ZNXA 3CC4A 1N5ZA 1K9AA 4RTTA 2IEKA 3SWNC 1OZ3A 2YU3A 4LDVA 3TO7A 1OCPA 3H0FA 3I0TA 4U7BA 1BI2A 3PMTA 4J5YA 2YUOA 1M1EB 3FKIJ 3ZMUA 1IRXA 4ZN3A 2MG4A 2V4JC 3C2HA 2O03A 4DW6A 1GCPA 4M3FA 1I8FA 2LTOA 1WGXA 2W82A 1J75A 3C94A 3FBIB 2Z2SB 4I98B 5E1ZB 4FX0A 1KJWA 2FQ4A 3VJPA 1R58A 3RCOA 5IY5H 3RPUA 2Q2EB 4B4CA 1ZSGA 2D6FA 4QTRA 4JJBA 1MBEA 3F72A 2E2IJ 4AFZC 1BW6A 1GVDA 3LFUA 4NOYA 3M54A 3RMQA 1Y0NA 2WBMA 4Y28E 2ZPFB 1R5ID 2E1OA 3CMAI 2WY7Q 5M5YJ 5HDKA 3ECHA 1O4XA 2IAIA 3H0IA 2E1CA 1SANA 1X1DA 1YWOA 1S6LA 3KP7A 5E17F 5GAMf 2Y4YA 4U7DA 5CCAA 5ED4A 3CXCP 3OL3A 1W4SA 2M9UA 3JAME 1ZLJA 2JPBA 1NHAA 2MH2A 2IA1A 2UV1A 1TC3C 4XTXA 4Z8AA 3DLAA 4AYBA 1HSTA 2L2OA 3NAUA 2DU9A 5E1XA 3L2UA 2KBTA 4XNFA 2RK1A 2YT6A 4HKEA 2W57A 2KVQG 3PTAA 5GPCA 4EGYA 4ESBA 3HG9A 1AHJB 5GAN4 1FSEA 1R77A 3ZQGA 4M3GA 2FHDA 4HCCA 5FLXZ 4XU1A 5HNFA 5HKCA 2HCKA 2P4TA 3J81R 5K5OA 1TL8A 3M4OJ 1UCRA 2JS0A 3HTRA 1JKPC 4M6VA 5ERIA 1IDZA 1RLPC 1AWWA 2ELKA 2FMLA 2W10A 4M78G 5HCKA 2HOTA 4XRSG 5K5RA 1YE9A 2LQ8A 2ZC2A 1DUXC 4MZTA 1ZGJA 1QKXA 1T33A 4LD9K 5HS7A 2RN7A 1A6QA 1SD6A 2XSJC 1VQMQ 3KLOA 3FXMA 2YSRA 2FF4A 3M0RA 1YLFA 4JJDA 1U1SA 2XAUA 2MD5A 4OAZA 4R1HA 2P7CB 2X98A 1MHNA 1ZX6A 1M27C 3WU1B 2VODA 1KGSA 3BFMA 1T0JA 2AHQA 1FBSA 3PUBA 1WDXA 4XU2A 3SFMA 2XKOA 2FBHA 3GTJJ 2V1XA 1YIJI 3CC2Q 1J9IA 3P8BB 2DBMA 3BPVA 1ZGWA 2BYVE 2EFNA 2CH0A 3FHZA 3IC7A 4GGGA 4MMKA 5GMKj 4M7AE 4ZDPA 1HDPA 2LR8A 4HQEA 1VQ9I 3H9NA 1ZSZA 1VQ7I 2IA0A 4BXFA 3TL4X 3OYIA 2UXXA 2E70A 5GP9A 2JTFA 2X3WD 1OR7C 5BS6A 2AZVA 5F0FA 4JJCA 3KYCB 1K0SA 1OMIA 3BT9A 2QUFA 3CF5F 2ID3A 1WHHA 5KYWB 3QXEB 4I01A 2COMA 5D4SA 4E6KG 1YN8A 4MZPA 1VQMA 2X85A 5C4XJ 5GTIC 2LKPA 1U5TA 1OULA 2V1QA 3G4SQ 5ILVA 3W2WA 1SMTA 1OPKA 2IS6A 3DKWA 1KFZA 2FD5A 3VDXA 1SRLA 3SWNA 3CC2A 3L9FA 4M4ZA 3JB9H 2MF2A 3RSNA 3S17J 3IHUA 2V9VA 2DE0X 4O3MA 2O4XB 2EINH 5LHIA 4WCGA 3A52A 1ZGAA 1ZTRA 2VIXA 4YTLA 3CCJQ 5HLHA 4HLYA 4R55A 3FB9A 1JUSA 2P8TA 3ZP5A 3GZ6A 2V6EA 4PDKA 1EA3A 4OMLA 3H3ZA 4WWCA 4BY1J 3M8JA 1QPMA 1HD3A 3LH5A 3V4GA 4GDFA 1W1WE 4DEXA 4DEYA 2L3QA 1FJLA 1WX6A 3G4SA 3CMMA 1O7FA 2JS2A 2E2HJ 3LMMA 3E9FA 2BY3A 4J9IA 2M7BA 1HYOA 4BD3A 3ZL7C 3RYPA 1MMNA 2RHIA 2IIMA 1YI2T 2ELHA 2W85A 3VSKA 4X9CA 2NVUB 1XQHA 2GWRA 1FOKA 4OVAA 4NC7A 2FSWA 3EGDB 3LH0A 3LGFA 3VS1A 2JK3A 4OAYA 3KYLA 1IO6A 1TUCA 3OS5A 3K4CA 4QVZA 4J9EA 3CCJA 1F1BB 1JJ2P 4NQWA 1QHHD 4OB2B 3ZMSA 1X6OA 4RGUA 1NK2P 2K57A 2DDAA 2YUPA 4M7AF 3CQZJ 2OCEA 1TT5B 1WCMJ 4EV0A 3BTIA 2COYA 3CCEQ 2K02A 5DUIA 3NFCA 5GAOl 1TNSA 1K9MU 4C0GA 1H3HA 1BC8C 1A36A 1BKBA 3FXJA 1YFNA 5I2MA 2MD0A 4L9JA 3GLLA 3JRGA 5BOXA 5FU7B 1OCZH 2VN2A 1ETOA 4CCKA 4A3DJ 2NOJB 1YITQ 4F55A 4PUSA 2KT0A 4EIKA 4IX7A 4Y15A 2R7QA 1PKTA 2EJGA 4KH1B 2L4MA 1W2BS 4NDLA 3FXOA 4G6QA 3WTZA 1N8RR 1WJBA 1YIOA 2K4BA 3P9IA 4EJVA 1IDYA 2DJIA 4A3FJ 4LLGF 3HIFA 1WSUA 4KFCA 1ON1A 1FT9A 2DYRH 4JRKA 5FW9A 1BU1A 1K73R 5DCFA 2LCSA 4M7DD 2H6BA 3ULQB 4Y91A 5IYDJ 5FU7C 2JMCA 2CDTA 1LKXA 3CC7Q 2JRMA 3BCAA 5JR3A 3FHNA 1WZOA 1R0BG 2XGCA 4Z2YA 2KRMA 2AIRB 1BIAA 4BQAA 2FA5A 1V3FA 3A8OB 4LN2A 5IXBA 3ZN1A 3FKJA 1ZREA 4C8QF 2DA6A 2L7FP 5FLXK 4QSHA 4MTEA 3OYLA 2PEXA 5GADJ 3C1DA 3PE0A 2HMAA 1U1TA 1B9MA 3K4LA 3HOXJ 2GGRA 1YITA 4BQOA 1W0TA 3FM3A 3EFOB 1YJ9I 1OR7A 2B86A 1X19A 1TQIA 3HFNA 5ICGA 2Y2ZA 4FSXA 1TOVA 5DEQA 5LFAA 1K76A 2DYBA 2RHUA 3VS2A 1VQOQ 1P4AA 1M90U 1XPXA 3LSGA 4AM3A 1WXBA 1P7JA 2HL5C 4Y52J 3E9GA 1VQLT 4BQQA 2L7MP 3ZQLA 1Q82U 1VYUA 1VTNC 1U0JA 2VBXA 3ROUA 2MH9A 4A3KJ 2PVOB 1UHSA 2QLZA 4FETA 3U1DA 3KP6A 4UHTA 5IP7J 4CYCB 2YRDA 2DT6A 4QVDA 1K9MC 2DTIA 4N4NB 1UFFA 1Q81U 1XTDA 2XDBA 4F7UF 5LJ5j 1KQSS 4WK8F 1UHFA 5E3OA 1O3SA 2JM9A 1ENHA 2RB6A 3SB2A 4EMHA 3TOBA 3HPWA 1CF7B 1X4OA 2LFBA 3BJAA 1UELB 1GCQA 2DIGA 1S5LC 1UE9A 3J81E 3RKWA 2V1NA 1T08B 3BG6A 3CUQC 2MC4A 4BI4A 4HCBA 4HX7A 3N97A 2PJRB 1TWCJ 1IHVA 2E3IA 5LJ5d 4XKCA 5HDNA 2QGUA 1AOJA 2OTLQ 4L9VA 1ZLMA 2GXGA 4JOMA 3QQAA 2LY9A 3EGUA 4L9NA 3QBYA 2ZO4A 1FTZA 1K1ZA 3QJYA 5B66C 2JTMA 3MEWA 3PFSA 1SD4A 2YR2A 5EEAA 2R5ZA 1JGGA 2H8RA 1HA8A 2BZ8A 3A5ZB 3MFKA 1R00A 5F1JA 3CCST 2E19A 3CTAA 3AKZA 3PSFA 2HGCA 3VB2A 2QWWA 4OIOF 3WHBA 2E1HA 3JCUC 3FIFA 1MDMA 1FYMA 1IN6A 1IHWA 3G71T 4J9GA 3C18A 3QP5A 1JI8A 1RI0A 2A5YB 4XAXB 1BOAA 4CC4B 1VQ4A 4RGXA 4M7DF 3LSJA 3DQVC 2E36A 2LNHB 5HLIA 2B7EA 1X2KA 2QGGA 1UJYA 2OTLA 5C44J 1YJNT 3ERMA 2RF0A 3CCMI 1K73C 2R5AA 2ZXHA 5E20A 5IYBJ 1G4DA 3J7AW 5I21A 1U3EM 5DCMB 5LEJA 1PD1A 2E3HA 1JXMA 3JB9G 4FYVB 5LHGA 3S3MA 5CK9A 3IAS2 1M1FA 1UG1A 2DODA 3MCAB 3K70D 1S1NA 3WTUC 1M1KU 2K7LA 3S3OA 2ID6A 1OPLA 1FNNA 1VQ4T 3HHTB 2JJ9A 2L3RA 1V5GA 1PNJA 1S29A 1RACB 2PQWA 4M9SA 1ETQA 2KT1A 2X51A 1GBRA 5LEKA 1VUBA 1VIFA 4OIQF 2ATCB 2DFEA 4N4HA 1R36A 2FPDA 4XLHA 1HKTA 3MKWB 2YRCA 4LMYA 1IXDA 1TWHJ 2A68F 3QDRB 4UV9A 3LA3A 1USTA 3IRQA 2RQPA 3KCCA 1IUFA 4KN7X 4Y4RA 2X1DA 1F1ZA 5FLVA 3S1MJ 2RJEA 1YQAA 1X2NA 4EJUA 6AT1B 2MYSA 1P9QC 1IRFA 1POGA 2Z33A 1NJIR 3BROA 4HDUA 2DF6A 1XMAA 2V8IA 2WSFE 3FK7A 1NLOC 1PG5B 1WQWA 3I55Q 2QASA 3I56Q 2ROLA 1L0OC 4J9BA 5DM7R 4RM2A 3CC4I 2CSIA 2IS4A 1JKRC 5HK3A 1HCRA 4EMKC 3TU4K 3J7AF 2EGAA 3JSPA 3K7AJ 3GFIA 2XDDA 4HNUA 2LY2A 3H36A 3GTOJ 3S14J 1FBQA 3B73A 2MWPA 2I8DA 3MKDA 1RAAB 3J7YJ 2ZGWA 2HU9A 3K4BA 2DA9A 1J2XA 3VV0A 4IUVA 4CHUA 3QYHB 3KFWX 4EPCA 2OBPA 1LJOA 2CYZB 2A07F 3FMRA 3OOPA 5F6FA 5B1AH 3GZ5A 2A69F 1QHGA 4HF0A 2F2XA 2FVUA 3M1CA 2DL3A 3W2VA 2GA2A 1R49A 3HTUA 5KYYA 2E5NA 3OSGA 1Z7UA 3I4NJ 2IBDA 3HKSA 3S2DJ 4UUSA 2GQVA 3I55A 2KMUA 1GXQA 3MAJA 1MJAA 3I56A 3JCMW 3CUQA 3RZDJ 3MKYB 2RA2A 1WHUA 2R5YA 4PJOB 1X58A 2I10A 4KT6A 4Z6YA 1ZQ1A 2GFAA 1I1JA 2O88A 5JHFA 1FXXA 2IVWA 2VGMA 4CYDA 3CQTA 4FT4A 3TO6A 2VGNA 1X43A 5C0MA 3SZGA 1VQKQ 2LT1A 3G2BA 2HKOA 4F14A 2CV0A 1PCXA 1N27A 3BR5A 1GHCA 4CC7A 1DDNA 1BCOA 2CZ7B 3OMCA 3ABLH 1QWFA 4RMOA 5E3NA 2E5ZA 5LGNA 2R0QC 3ZMDA 4G7ZF 3HKZA 2QTVA 5GMKi 1FTTA 4P9FA 1AVZC 3CPFA 3PIPA 3CMAT 4HSTA 2KDOA 1YW8A 3L42A 3R60A 2PJPA 2XPWA 3H3VK 2RK2A 1Q95G 2LQNA 4E6RA 1APLC 1T3LA 3HDDA 1Q86U 5J4VA 2QGFB 2W4SA 2HI3A 3PVQA 2HOAA 3CO7C 3H5NA 1LDDA 1Z9CA 1UUEA 3ZRGA 4D7NA 1BB9A 4II1A 4JRPA 2COWA 1JHFA 4XTWA 1OFCX 5HDGA 3QSUA 1AWXA 2E35A 2CUFA 3ZPLA 1I50J 4LOCA 1QVFA 2DD5A 1O7LA 4W97A 3C95A 1VQKA 2ESNA 2R7VA 1Y0UA 1B59A 4PNOA 5EYRA 2FQ3A 4GLKA 2IGKA 4FM4B 2EFPA 2KIUA 1BR4A 3VFZA 4ZZDA 4AVPA 1RAHB 1M2VA 3A1YA 3EFSA 3QYGB 1QVTA 2A05A 2DTOA 5GAN6 2PMZN 1OV3A 4RAFA 3CUOA 2W48A 3A4CA 4MFEA 3KX2A 2FB7A 5LJ3e 3B6AA 2VE8A 3LGLA 4N0AC 2RJFA 4PJMA 1IAWA 4XSXF 1QZZA 1U5SA 2QQ9A 4C92A 2HVRA 3EHRA 2DA1A 3BJ6A 3T1BA 4AIHA 4B8XA 1LQ1A 2P0TA 5B1BH 3F22A 1IRZA 2LK2A 1ZRFA 4LD5A 5HS9A 2FZKB 4L59A 3RKQA 3OOUA 1VQMI 2PX9A 5I22A 4B3AA 1K79A 2DA4A 5BQTA 3H5RA 3D1NI 4AVZA 1W6XA 3MWMA 1I0CA 2EAYA 2FBIA 1YIJT 1QVGP 2DJZA 2F4MB 5CAIA 1WJFA 2WTEA 1ABOA 1X3ZB 2DMOA 1S7AA 3JRBA 4ZTFA 1W7PA 3W6KB 3WG7H 3DP7A 3H92A 5E1WA 5DTDA 3KEYA 3CC2I 2LC4A 4OP0A 4EMKA 1VQ7T 1JBMA 2DEUA 2BW3A 2IPQX 4LK0F 3L09A 1IXSB 2O61A 2IS2A 4ZC3A 4XOPA 1PC0A 2DMUA 2M3AA 2CH4W 4WTOB 3M57A 4QPOA 3SEZA 4PSWA 4RS8A 1XGMA 2JW4A 3F8NA 4C3JJ 1HW1A 2OF7A 1BJAA 4XBFA 1Z6RA 4J7FA 3W2AA 1ETKA 3FXLA 3KZYA 4H0EA 1W70A 2AQEA 5GAEJ 2LX7A 5EZHA 1MMGA 3JAMZ 4KICA 5J3LA 5TISC 4M75F 4PJOE 1W2BP 1D1AA 1WQ2A 5K7ZA 3G4SI 1FIAA 1M2OA 3K69A 2ENMA 3FWEA 4CCOA 1ACMB 1KHCA 2OAUA 2L7KA 3WHCA 2MPXC 3MEAA 3ZGKA 5M3MJ 1YNZA 4N4IA 4L6V5 2EKOA 1BOBA 2QBYA 3MP1A 4DYRA 2Y69H 3DPTA 1H88C 5CQGA 3LLRA 4M77F 2HXOA 3S3NA 1R0CB 2I0NA 3K6GA 3UA6A 4M78B 4G7OF 3CCJI 2AS5F 4Q5WA 4I0BA 5HK0A 5FKNA 2EQRA 3HRSA 3P9CA 1IREB 2E7XA 3ABUA 3CESA 3I5SA 4X6AJ 2IP2A 2BY2A 3DPLC 2R57A 3DTIA 4DQ2A 1T0FA 4XICA 3S1QJ 3N05A 2P4RA 4XK4A 1FOYA 1WJAA 4KN4X 2J6KA 4G9YA 1BJZA 1Z77A 2CMPA 4M78C 1YP5A 2YX4A 2YLCA 3NGPA 4XTZA 2EFWA 4WCIA 2X6YA 2MBFA 4J9CA 2XAJA 4I7HA 2KRHA 1V4RA 4ENMA 4HCKA 2ME0A 5GANe 3JB9I 2C0IA 2LTPA 2XUBA 3Q1JA 3JCMc 5D6YA 2ZZDA 3JAMR 1PP8F 1X1AA 4XORA 1Q1VA 3M8EA 3OR2C 1IRGA 5IT3A 3HSEA 3S93A 4F16A 2XAGA 1IO2A 1XTAA 2WV0A 1YRNB 3H0HA 3K1NA 4DBQA 3SDZA 3KP4A 2FRHA 2RV8A 1JT0A 5AT1B 4E7KA 4LG3A 1LE8A 1FWZA 4CH7A 2LP0A 1B72A 2P84A 2ZPHB 1GBQA 2H1LA 4Y92A 3CXCS 2CZ6B 5LBQA 4RAZA 3U21A 3CP2A 5D8KB 3OYCA 2X9DA 1JJ2S 1ZR2A 3B02A 4B44A 4XSZF 1R5HA 4A3JJ 3LW5E 4C92G 1YITI 4JUVA 1R5GA 5IT9R 3AHUA 3MEUA 2K6DA 2YLBA 4CCLA 2PBIA 2EZIA 3CP8A 3RDIA 4UUTA 1RLQC 2TRTA 1BC7C 3E6MA 2MLGA 3CBOA 3PT9A 4U87A 4PJJA 4U0YA 1WA7A 1FZPB 2X1EA 4PJLA 2QVOA 5IH2A 6PAXA 5DD8A 3BJOA 5GAMe 4M7AC 2OZUA 3WTSC 3OIPA 1MSEC 1LDKB 5AONA 1JTXA 2LOOA 4ENJA 1VIEA 5I2SA 3LSRA 4HRIA 1WWXA 5D5UB 2HDAA 4B9XA 1M90C 1ZBXA 2YHTA 1G3TA 3ECOA 5ICFA 3GUDA 1ETXA 4C30A 3VYSB 1WJSA 3GNGA 2EQIA 1Q82C 3KLNA 3CD6Q 3TDZC 3RR6A 2M0YA 2GOXB 1YJ9T 2HDWA 3ISPA 3OSFA 3E1SA 2LJ3A 1QQJA 2L2PA 2E10A 2M16A 1LFBA 3WVEB 1EKEA 4XN0A 3BY6A 5LL6S 2BY0A 1JTYA 4JJNK 1Q81C 2V8KA 1OCTC 1WHKA 2VBZA 5D5WB 1IUYA 4AD9A 1F43A 4AG1C 4A4KA 4CDGA 1Y39A 1FMKA 2EK5A 2O6GE 1TTHB 2EYXA 2G3RA 3HSRA 3RMSA 4CI0C 1H92A 4CCNA 4CCJA 3RQ4A 1MBGA 5IYCJ 4RA2A 1UB4A 1RAEB 1BN5A 5IPAA 3F70A 4PJOD 1D3BA 5IP9J 1I5OB 5JHUA 1XSDA 1R7JA 2DOEA 3WTYC 5GTHC 3LA2A 3DKMA 4M78E 5CKHA 2LBFA 5J1RA 3GTKJ 3QZ5B 4C8QC 4BI3A 1MH4A 3K4JA 1X1CA 2FU4A 4P5OA 3AFHA 4KISA 2COBA 2ESHA 3CD6A 1TSFA 4BBSJ 3U23A 2LLKA 2PFBA 2DZ9A 3HUGA 2L02A 4JX6A 2ZB9A 2C0TA 4EGZA 1B34A 1ITYA 2X35A 1FBUA 4AFQC 1U9NA 2ZXWH 4HX8A 1TW2A 2K40A 2OD5A 4QIWN 4A3IJ 5GAN3 3DPUA 4NS5A 2ROTA 5HLTA 2Z99A 3F8BA 2O9LA 3T8TA 2R7XA 3BW1A 3OYBA 1VQ4I 3C2GA 1LOJA 4C0FA 1KD1U 2LQWA 5EC7A 1KQ0A 1GLNA 1AKHA 3CMEQ 1UJ0A 4Y3OA 1QA6A 2OTLI 3JAMK 5HLGA 3EGXA 1M8VA 1R1TA 3I9QA 2JJ7A 1U8RA 3OYKA 3FJPA 2L3SA 3MEVA 2V7FA 3REBB 2LNVA 1KC8U 2HKQB 2RGVA 3Q9VA 3V42A 2A61A 5EG0A 2YS9A 4N0BA 3ZN0A 1Q1HA 3K1MA 2LJ0A 3BY7A 1UEBA 1ZSZB 1G3YA 1P2FA 2OQGA 3JR9A 4CGZA 4HQMA 3H1CA 2RI5A 2FRYA 3F8FA 3JTHA 1TH7A 4B09A 2Y9ZA 4MEXF 2LP5A 2YUNA 4ESJA 1B7TA 1G2BA 2XHCA 2E1NA 3HGYA 2CP5A 5J26A 2K4YA 3VKIA 3MJXA 2HZTA 4RB0A 4CCMA 3EG9A 1SVOA 3BPXA 4EM1A 2BEOA 3FZVA 4EVIA 1IB8A 2QKMB 4LXCA 4OGCA 2XASA 3ESWB 4R8HA 1U5TB 1MJBA 2RREA 3ZR8X 1ZSZC 3CCMT 2NS8A 2XDPA 1JQQA 5DLQE 3HL2A 2HWVA 5FWCA 2CV1A 1FPQA 3EDPA 4K2EA 2NYXA 2VYTA 3VS5A 1AWJA 3FXRA 3ME9A 1WH5A 4BDZA 1Y8QB 4KRTA 3SWNB 5J39A 2H3EB 2ZNYA 3FM5A 4L5IA 3E19A 2R58A 3S15J 4OIRF 3VOEA 1HLVA 3HPGA 1R4MB 2DFHA 4WF2A 3DEEA 1KQ2A 4RGRA 1WPYA 1MJ9A 1IZ1A 4ANJA 3PM1A 5EGOA 1H89C 2KDSA 3CCRQ 2X6WA 1P6RA 2AKLA 4BE0A 1V55H 3ABMH 3M0PA 4M7AA 3PIOF 4AC0A 1D0YA 1IJWC 4XM3A 2LRQA 1E0EA 1QP2A 2GNCA 3ZEHA 3RTRA 2MOXA 2HQXA 2DL5A 3UDCA 2V79A 1K8AU 2TCTA 2EFQA 1JUPA 3FBNB 1UGSB 3J81Z 4JDSA 3NRVA 5AIQA 1EFNA 4BY6C 3BG5A 1PSEA 1JUMA 1XCVA 4ZYHA 4HXJA 3RNJA 4BHPA 1X27A 2L0KA 2M0CA 4AIKA 3QYEA 3UR3C 4HYEA 3IWZA 3KP3A 2OTJA 3M5AA 3CC4T 1EV7A 3S1NJ 1WJEA 4I99C 1KK7A 4DBFA 5DS9A 1TS9A 2XGEA 5AYFA 3I59A 4MHGA 1HQCA 3I55I 1UAAA 2X6XA 3I56I 3NPFA 2MIOA 1YFHA 4NQWB 4QPQA 5FRMA 3CEYA 3CCRA 1ZELA 5FU6C 1X4PA 2A36A 1WHGA 1SMYF 4D8KA 3GTLJ 2DILA 2FZCB 2HOEA 1UG0A 2WA0A 3GTMJ 1OX9A 2PZ1A 3NHNA 2D1HA 3F21A 4C8QA 5JI6A 4PZJA 2DLPA 3G1LA 2XB5A 1Q7YR 2DA2A 1Z1DA 3OYHA 1X1BA 1R9TJ 3QP6A 4I2OA 3A02A 1Z05A 1BI1A 1PP7U 2QG9B 3I5UA 4LB5A 3S8PA 1HW2A 2KLOA 1W36D 3QRFF 2EIJH 3CZ6A 3JCMe 3WODF 3HJEA 3TW7A 3W6JB 3O8VA 1SSHA 4KT5C 1SHGA 4KGZB 2VJ5A 3WTVC 3KETA 2YU9J 2XK0A 1M1GA 2DXBA 2RPNA 2X3XD 2YSQA 2L3DA 4MDWA 3BR0A 3QU3A 2EQUA 3L2ZA 2K27A 5F27A 5IT9E 4UVAA 2P6TA 3HEFA 3ML6A 1OCCH 3BCBA 3QYFA 3SDBA 3A8MB 2DXIA 1Q86C 2LNBA 4V2SA 4E4HA 2R92J 2V1UA 1QRYA 4G94A 3FMQA 3WU2C 2ZXJA 2VOOA 5E3LA 3H35A 1VQKI 5CYVA 2KL4A 5J3BA 1KONA 4J19A 3VS7A 4PGHA 4RM3A 2QENA 4J6WA 4LDYA 1B9NA 4HBLA 2DAQA 4YIIA 1B6AA 1UB9A 4P9UA 4IRIA 1WJQA 3FIWA 1BA5A 1PJRA 2VXEA 2DN0A 4UVBA 5LGTA 2RQQA 4F93B 4L0ZB 4ENNA 3META 1A0NB 1TXQA 2DVEA 2VUBA 2HDDA 2QAZA 2XB0X 3HXLA 4OINF 1T2KA 4CZZA 1YOVB 3DWLE 4EJWA 2NNYA 2QI2A 2R7ZJ 5KAFC 2QQRA 3HRTA 2V8JA 5J4YA 2GIVA 1YHQQ 5GAOm 2L7ZA 2M7AA 1RAFB 4L5JA 5M3FJ 3I35A 2QSHX 5KYUA 2DBKA 1P92A 4E7HA 5BPIA 5K7HA 2B63J 4FT8A 5IN1A 1EH6A 4M6YA 2NOGA 3SQNA 4CICA 5B5EC 2E1MB 2NVXJ 2QEXQ 2DT7B 1KU2A 1QZEA 3CF2A 3RYRA 5FRNA 3X20B 2IG0A 2X4JA 2M8EA 2M5WA 4IUQA 3DB4A 3OS1A 3GTGJ 5ECAA 3E6CC 1WI3A 4EQQA 2LJ1A 3TREA 2W84A 1NJIU 2YWWA 5LJ5h 1ACIA 4M7AG 2HAXA 1TLHB 2FBKA 3OWTA 2R7SA 4M3DA 3FLGA 3KBGA 2KJBA 2RI3A 3UKGA 1G83A 2E1MC 5CKDA 4ZJZA 1YI2Q 3QKJA 2B9SA 4O5VA 2VVKA 1I3QJ 1T0HA 4M7DA 3EAEA 1U78A 5EEGA 2FUG2 1QKWA 3N5BB 1VQMT 1YHQA 1JXSA 3FX3A 3OR1C 1EH8A 2VT2A 3LQQA 2K9SA 2NS0A 2HTSA 3GFJA 4MEYF 3PJRA 4LG0A 1GCQC 2LDMA 4QQDA 2CW8A 3CJQB 3KIOA 2XAHA 2JA6J 1J09A 1K4US 4HX4A 2R5ZB 1WNLA 3BG3A 2WC2A 4IHXA 1G2HA 4RG8A 4D6WA 3CC2T 2QEXA 3DTKA 1Z6TA 1K0XA 4KGVB 2F5CA 4M72A 4GYGA 5A2QZ 2JZYA 4U0VA 2XVCA 1KQ9A 1DU0A 1ZYRF 4M3EA 4OGEA 1MDMB 5J6XA 1Q7YC 1QVGS 2JSCA 1XC5A 2DEQA 1WYXA 1K6OA 1VQ6Q 2QCOA 3G1MA 4B1RA 2MMPA 4YELA 3GF5A 4C0DC 2BHZA 1YX5A 4C5IA 3HHGA 3BR2A 3OIQA 1TQPA 4OWRB 4C8QG 3ABKH 9ATCB 3HOUJ 2R7TA 5A0LA 2DA7A 3LWFA 4G12A 3IAM2 3J80R 3J81K 4UY8I 1OQKA 2KEAA 2CKKA 4BHBA 2IGMA 3G4ST 3G6EQ 4HSRA 4L5GA 2VBWA 4QLCU 2M87A 3PFIA 3JRFA 1K83J 2QDYB 1PVEA 3RPQA 1OYXA 4LUEA 3VWBA 2IXSA 5L23A 3RERA 2OCCH 3W3CA 3K2ZA 4HVWA 4D0PA 3A01A 2M1HA 1C1AA 1SEMA 1ZR4A 1I6XA 3H6ZA 1MV3A 2VT3A 1BBYA 1H8AC 4HT8A 4ZDLA 2ZJ2A 5J47A 4UNOA 3KUFA 1KYWA 4KGXB 1T6SA 5BPDA 3PFYA 2LRDA 4G8XA 2XV4S 3L1PA 2WADA 4KYWA 3HPHA 3S32A 4HA8A 3CCJT 4X0GA 2KR3A 3FRNA 1VQ6A 5CPRB 5CVUA 1E17A 4XLFA 2RM4A 1X75C 4IF4A 1GRIA 5A2QR 1LFPA 2BY1A 4LNPA 3ZBDA 4F7UG 4BJ5C 3VODA 1MIJA 1GFDA 2ZCWA 3M3YJ 1DPRA 3G6EA 2LVSA 3CDHA 3GWZA 1I81A 2MAMA 4M75C 3CCEA 2QYOA 2W00A 4M74A 4A3EJ 3ABTA 3NEUA 4ZGDB 2XIDA 4LE9A 4DIQA 3SD4A 4E2FB 2QM3A 3QWXX 1ZKGA 3EUKL 5DLOA 3PVLA 3CCLQ 1TU0B 1D0XA 3OMYA 2EYZA 3H5AA 2KE9A 4AWXB 1NH3A 2GQIA 1SRMA 3JCMQ 2KQRA 3IV5A 4HF2A 1G6NA 3TSWA 3S6WA 4IPAA 3CCET 4A5MA 3L2QA 1QCOA 1X1PA 5IP6A 1QBJA 1N9RA 2PVGB 3ASOH 1D09B 5KYYB 3JTGA 1BYMA 1SFXA 3T0YA 2PMHA 1ZA2B 3CC7A 4QKUA 1N75A 2WV1A 2CP7A 3QYBA 4LGWA 3MD2A 3IL2A 1YITT 1OKRA 4UUSB 4YIFA 1RUNA 2D8HA 1AHDP 1YYVA 3CUQB 3L1AA 4M7DG 1MMSA 5L3FA 4RMNA 3S2WA 2R5YB 1Y96A 2GQQA 1N8RC 1OLTA 2G0EA 1IV6A 3FXKA 4RB3C 3HOYJ 2KROA 5CIUA 2H6CA 3JCMJ 3H0DA 3CCLA 1KHIA 2HQ5A 4KUMA 2DZCA 2VC1A 2RJDA 3CC7T 1GFCA 1N25A 1YCSB 3OSVA 2LF7A 1ARKA 3M58A 2BVMA 4GYIA 2QTXA 1QVFP 2CU7A 4G6TB 2HKNA 1XGNA 2ECZA 1VQOA 1KIKA 1TBXA 2ZPIB 5FD6A 2RDPA 4LDXA 3MN2A 5GAN2 1D3YA 2MLKA 4N4GA 2H8WA 3GW2A 3TVTA 2DA5A 5GMKe 2FG0A 2KDZA 1KU3A 2Z5UA 2QQ8A 3IUOA 3CD6I 3RZOJ 5FKLA 1TQMA 1VFCA 3GBGA 4UB8C 4C2TA 2E41A 3TCJA 4PFZA 2XICA 3ZOBA 1VQPQ 2QQBA 3R6NA 2ESWA 2P81A 3SHFA 4B48A 3GZNB 3VSLA 4J9DA 1G3SA 3P5JA 4IHSA 5C6SA 4BE1A 1BM9A 1BW5A 3UNGC 3GO5A 2EPFA 2PN6A 3LAPA 2DXTA 1ETVA 1S72Q 3MP6A 1S9HA 2R7FA 4YIRX 2Y31A 4Y17A 3U9GA 1WXUA 2CT3A 2HQHA 2PNIA 4JS5A 1M2VB 2V9KA 2GZWA 1Z3XA 1T3SA 3X25B 4F91B 1FMVA 1X69A 2GA1A 3CBMA 1LCKA 2HS5A 1VYTA 2K7AA 2RQTA 4PL6A 1Z0XA 3O8GA 2CV2A 2KXDA 4KH0B 3QOPA 2P0QA 5IHKA 3NWTA 3ULRB 4MFDA 5LJ3d 3M0TA 3RQIA 3I71A 4DGWB 3LAJA 1SPKA 4C92B 1KC8C 4XKWA 4EMGA 1UJ8A 4QWQA 3QIIA 2QSFX 1FMWA 4BJTA 1VQPA 1FIPA 1WKMA 2EWNA 2A6HF 2Y30A 4RTYA 2Y9YA 1Y56A 2F5TX 4LIVA 2OTLT 2DJNA 1HW5A 4V19K 2JNGA 3JRCA 1KU7A 4M75A 1S72A 3ELKA 3FXQA 3BTLA 1D5YA 4C92C 1QQIA 1J59A 3PGGA 2HKXA 2X1CA
chains in the Genus database with same CATH topology
1W7PB 3RJPA 4EMKB 2LQKA 1NZ9A 4X9DA 5D8LB 1LJ9A 4IXAA 2X4XA 4M77A 3LFKA 2D0QB 3R6OA 4Z02A 3CPWA 2HD0A 2LCLA 3E5XA 5D5VB 1RUOA 1MD0A 5C0MA 2DAOA 1ZG5A 2MC3A 2NRAC 3SZTA 3GX4X 1PDNC 3WTWC 2L4AA 2PQ8A 3GNFB 2BE5F 5FFZA 5TRDA 3J80E 2RNJA 1HKSA 1P4WA 2QBYB 1BI0A 1LDJA 4A0ZA 5D6FA