1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
2VT3A 1S7AA 3BJAA 3EYIA 4HQEA 2XV4S 1QPMA 2NNYA 3LA7A 3R61A 1HW1A 3V7SA 1EH7A 3GO5A 2BE5F 4XBFA 4N9HA 1UHWA 4UUVA 3K0LA 3K1MA 4A5MA 1QW1A 5DYMA 4PGHA 4FHTA 2QUFA 1XSXA 2HTJA 3WTVC 4MHGA 4KYWA 2OD5A 3WTWC 1S7OA 1YW9A 1IN6A 2QM3A 2HTSA 2EB7A 2QENA 5CVJA 1FBSA 1QQIA 3KEOA 2OZUA 2VONA 4LK1F 3H3UA 2RV8A 4LMYA 2XROA 1U6GA 3S2WA 1QO0D 4RGXA 2LX9A 3SXYA 1BBYA 1KQ8A 3R6SA 4ZZLA 2HR3A 3GFJA 2H6CA 3KP4A 3J80Z 2LSOA 2YX7A 3LWFA 3KE2A 2ZMEB 2HYFA 3HTSB 1MJAA 1SD5A 2AS5F 2JPBA 1U5TC 1T39A 2CO5A 2K27A 4IRHA 3TQNA 2PBIA 3EQLF 4K2EA 4H0EA 1D3YA 4LJZF 2IA2A 3K2ZA 3DP7A 2FF4A 2P5VA 4AIHA 5L3BA 3RJPA 3GFMA 1BI3A 2LF7A 2LNBA 4ENNA 2HQRA 2LKPA 2PMUA 3ZN0A 2VXZA 1H9TA 5KVRA 5HDNA 4MEXF 2RNJA 1R1VA 1R5HA 2EFNA 1B9NA 3HOSA 4KUMA 3FXRA 2FBHA 2A61A 4OMYA 4M9SA 4M74A 3I5UA 5BOXA 2W84A 3KFWX 4LGWA 5LHGA 2DQRA 2ZJ2A 1HW2A 1FBUA 2YU3A 5LEJA 2TDXA 2Z9OA 3T8TA 3O6BB 2A69F 2KIFA 5E1ZB 5CYVA 4KIGA 5LRRA 1WI9A 4L9TA 1UFMA 3WE3A 3DF8A 4HF2A 3PQJA 5D8KB 5ED4A 2IP2A 2IA0A 3RYRA 4EJWA 2Q8KA 5DDGA 1FNNA 1ON2A 3KLNA 4G6QA 3MFKA 3KETA 2J5OA 1R23A 4U7DA 5E8GA 5TJJA 2DW4A 3KLOA 1Z6RA 2XAFA 3KP7A 4DNCA 5KK1A 4IXAA 1BN5A 3L9FA 1V4RA 4KMUX 2NRAC 3LFKA 2L4AA 2EFOA 2G7HA 3B73A 3ML6A 3CUQB 2ADUA 1JGSA 3RKWA 1B9MA 1XGMA 3K1PA 2PLYA 4L5IA 3GUDA 5HLGA 1XMKA 3KEQA 1HSTA 2A68F 5D5XB 4I09A 1FYLA 5JVTA 2MC3A 2RVCA 2HWVA 1SFXA 3IHUA 3E5UA 3VODA 2RDPA 4HX8A 5JHUA 2YR2A 4L9JA 1CGPA 2UXNA 1REPC 1XGNA 3ZPLA 4M72A 1YW8A 1USSA 2E1NA 4I0AA 3JTGA 1BIAA 3ABUA 4G7HF 1X3UA 1IXSB 3QPHA 4LFUA 3NRVA 1A04A 3I53A 4WXCA 4MTDA 2IA1A 1FP1D 1ZARA 2RC4A 2D1VA 2HKOA 2DTRA 5BPDA 1YQAA 2NAZA 4EQQA 3I71A 4B8XA 2CGPA 4HZFA 2JTVA 5A2QZ 2PQ8A 2KKOA 2WWYA 2FE3A 3DFGA 1F1ZA 5E1WA 4AIKA 1D8JA 2R7DA 2H3JA 1QBJA 4M73A 2K86A 2Y48A 3DKWA 3CJNA 4LG0A 1IW7F 5CJ9A 2CWEA 1IXRC 2OQGA 3IRRA 1OPCA 5LBQA 4PZJA 5ILVA 2ELHA 2F5EA 2Z99A 3FHZA 3G73A 3MCZA 4HYEA 3GWZA 2KJCA 4A0YA 4S05A 1ZGJA 5E18F 2V1XA 3HRTA 1L3LA 2UXXA 4CZZA 3LAJA 3JAMK 2GZWA 1SFUA 3T5XA 5E8IA 2QBYB 3DPTA 3V4GA 3F8FA 2D2WA 3F6OA 3N97A 3KP2A 4MGRA 5AIQA 1TNSA 2ISYA 3CO7C 1KA8A 3BOQA 1BC8C 3P9CA 2QQAA 1L0OC 4ZYEA 1ULYA 2E7XA 1LEBA 4WF2A 4LLGF 2V1UA 3RKXA 2XVCA 1WWXA 2ZFWA 4YIIA 4UV9A 4ZYGA 1DDNA 4EV0A 5L3FA 2FSWA 4M9ZA 1WKMA 1JHFA 4FX4A 2Z5UA 1RUNA 4OOIA 5K5QA 3BP8A 1U2WA 1SAXA 3D5LA 4BHPA 2FEZA 3VFZA 2HGCA 3HHHA 3K9TA 3QRFF 1BJAA 2ETHA 5FO5A 1O3SA 2VC0A 5LRSA 2DI3A 2VC1A 2RQPA 4I2OA 5CVRA 5DEQA 3F8NA 1VTNC 2BEOA 3KP3A 1RI7A 2GA1A 4PCQA 1FPQA 5BPIA 1F5TA 2EV0A 4RB3C 1Y0UA 3GXOA 2NNNA 3COAC 4LLNA 2A6HF 5FB2A 4XSZF 3FX3A 5D4RA 2P5LC 5DD8A 3ZMVA 1K78A 1XGSA 5BMZA 2ZO4A 4HQMA 3I4PA 3MQ0A 2PG4A 5D6EA 3AAFA 4ENJA 5J8FA 2DAOA 4HV5A 3K1NA 1HKQA 1GHCA 3HRSA 3ZMSA 2LDUA 2GXGA 5IT9Z 3RPUA 4ZYHA 3IWFA 1G3SA 1Z05A 3EUHA 1GXPA 3EYYA 1MJ9A 2FMLA 1ZAOA 1XMAA 2Q2EA 3NEUA 2LF8A 2MA3A 3CTAA 3B02A 1FYMA 2R7FA 1BI2A 1XB4A 3W6JB 3I54A 1JHHA 3MWMA 5FFZA 1J59A 5H6QA 3E19A 2IPQX 1S29A 1EH6A 1U8RA 2YSRA 2ISZA 4RS8A 1U78A 1Z6TA 2JPCA 1XCVA 4BXUA 4DQ2A 1NHAA 3DPLC 2DPUA 4MNUA 4F7ZA 3J81K 1R7JA 1RNLA 2MLGA 3Q9VA 1V3FA 2FRHA 5LGNA 5AONA 2EV5A 2PJPA 3R0JA 1MKMA 3T0YA 3ISPA 3ROUA 3IRQA 1OR7A 1YW7A 2HEOA 2JRTA 4NHJA 1QZYA 3BDDA 1RZ4A 4KICA 2OA4A 4MQ9F 3QP6A 5ICFA 3TO9A 3M9AA 1ZN2A 2HFHA 2V1DA 1SD4A 2V79A 4UVCA 4AIJA 2K5LA 2EV6A 4RB1A 1KU7A 2DFIA 4LD5A 3FZVA 1IF1A 1UB9A 4ZZDA 4KDPA 5CVIA 2O61A 5ICEA 3GEZA 2XAQA 3P9IA 1I5ZA 3IC7A 1MJBA 3ECHA 4OIOF 4HDVA 3WTTC 2MH2A 3F6VA 4EM0B 1SD6A 4M9XA 3RDIA 1P92A 2K4JA 2H27A 3ELKA 2L3DA 4RAZA 2HQNA 1YTYA 1S3JA 3F3XA 1IN8A 2GQQA 2PMHA 1IZ1A 2PEXA 2NS0A 4OINF 1H9GA 3LQQA 1BIBA 2OZ6A 4U0WA 2L54A 4BYYA 2RGVA 3BY6A 3HIFA 5LGTA 1U3EM 5LHIA 1PP8F 4A0ZA 2K02A 3WGHA 4GO1A 3U9GA 3MAJA 3I59B 4EM1A 3C7JA 2XIGA 1OYYA 1ZH5A 2DPDA 2DBBA 4P5OA 4M71A 1W7PD 3DEUA 2MH9A 4U0VA 3BJ6A 2V9VA 1SMTA 2BYVE 4WCGA 3WGIA 1KU2A 2KIMA 2XRNA 5HLHA 2Y75A 2DU9A 3E6BA 2F5CA 2XKOA 1U5TB 4FX0A 3E5XA 5ERIA 4EM2A 1XSDA 1TQIA 1JE8A 2GXBA 3QU3A 1MGTA 1G6NA 4Q4ZF 2QZ8A 1GVJA 4WWCA 1D8KA 2XKPA 3J7AO 1LJ9A 4L0YB 2X4HA 2BV6A 4O6JA 1YFHA 3ZP5A 4P55A 1XN7A 1G3TA 2MBFA 3FM5A 3F21A 2ZMEA 2ESHA 1J7KA 4RGUA 2ZXJA 1D5VA 1WQ2A 3DQVC 2Z33A 1ON1A 1I1GA 2VOOA 2O03A 3V8KA 4I98B 4HDUA 2M8EA 4WX9A 3M8FA 3U2RA 1GXQA 3BJOA 1T38A 5ICCA 5ILSA 1LB2A 2OBPA 4A6EA 1P4XA 3F72A 2R3SA 5DD4A 4AWXB 2P7CB 3QAHA 2HOEA 2H94A 3FWEA 1BI1A 4OMZA 3OV8A 5HOOA 1FX7A 2MD5A 5E1XA 4ZYDA 4M6XA 2FXAA 1Z7UA 1E17A 1ZLJA 2C6YA 3CLOA 4AD9A 3JSOA 2P6SA 1R1UA 1ZLKA 3R60A 4EJUA 4JK1X 1W7PB 2DQLA 4R8HA 2XAHA 1B59A 1FOKA 4IPAA 1BI0A 4CXFA 5H6RA 3M7GA 3E3VA 1LQ1A 5DUIA 5HS9A 4IJAA 1TBXA 4Q47A 4BAYA 3LA2A 2GAUA 4ETSA 1T6SA 3I64A 2F2EA 3SHFA 1J9IA 3WU0A 1R00A 1ZREA 4IVNA 1I6XA 3F22A 5K5RA 3GZ5A 3M1EA 2ZCWA 4UHTA 1FSHA 1TNTA 3VOEA 3ZMUA 1RIOH 1ZRCA 4KIBA 4CO8A 3E6CC 1HXDA 1B1BA 3CDHA 1TLHB 2IVMA 1YIOA 1MDMB 3GX4X 2NYXA 2KRFA 4L5JA 1P2FA 1LVAA 2VBZA 3ZQ7A 1XSVA 1KU9A 2IJLA 4CYDA 2ESNA 1ZYRF 4NB5A 1KGSA 4WXDA 3CUQA 4R79A 4RGSA 4HBLA 4A2UA 3LA3A 5F64A 1UCRA 3F23A 2F5DA 4HAMA 4UXNA 1FP2A 4YG2F 3E6DA 4BNCA 3ABTA 2X0LA 1ZRFA 3SFZA 1R5GA 1TQMA 2G9WA 2VN2A 4RB2C 2FNPA 5J8CA 3ERED 5JFRA 3WG9A 2CQKA 1FWZA 1FBQA 3K69A 4KMFA 2A5YB 2L02A 1E2XA 3JW4A 3F8CA 4MTEA 2WTEA 1W7PA 6PAXA 1DPRA 1PP7U 2W25A 2FU4A 1SD7A 3GZ6A 3BPXA 1HBXG 5HS8A 5D5UB 3GFLA 1IRFA 2FBIA 1ODDA 2M45A 2VE8A 5F6FA 3IKVA 2EFPA 4XLNF 3G3ZA 2P4WA 1XCBA 1R1TA 3FMRA 4GYIA 5TRDA 4WK8F 3NQOA 4IHTA 2FMYA 1EH8A 3C1DA 5D6FA 1ZRDA 2DK5A 2EJRA 3ZN1A 3KP5A 2FQ3A 3JAMZ 1STZA 3BWGA 2YX4A 3TKYA 4OIRF 4A6DA 4G7ZF 2ZNYA 2EA4A 2P6TA 4HLXA 3VEPA 4MEYF 3WTSC 2QBYA 2HS5A 1JXSA 2VT2A 4P9UA 5JI6A 5FLXK 4EJOA 1ZGAA 5HS7A 3CO6C 3WTZA 1FT9A 4WXHA 1AOYA 2VOPA 3L00A 2L01A 1SFEA 1F4KA 5D5WB 1ZG3A 1QVPA 3KZYA 4ESBA 5FD6A 1W5TA 1YG2A 1KQ0A 2W85A 4ENKA 4QLCU 4RGRA 4IRIA 2VBYA 5IT3A 4GGGA 3FMQA 4S04A 4EMSA 4BHBA 5EEHA 2IW5A 1R36A 2QQBA 1J0RA 1W5SA 2GA2A 1O7LA 4L9NA 3SZTA 2CYYA 1OYWA 3RYPA 1KQ9A 2BBYA 3HHGA 5LGUA 5ICGA 1I27A 4HOBA 2JT1A 3GLXA 3R4KA 3REOA 1O7FA 2P8TA 1FYKA 2M1BA 1IN5A 4CDGA 1O3RA 4G7OF 5LEKA 2HYGD 3BPVA 2Q0OA 2QYOA 2KJBA 2EFQA 3ZMZA 4GYGA 4BQAA 1TTYA 3RTRA 2G7UA 4JBAA 1QNTA 2QQ9A 4KNYA 4HV6A 1LNWA 2O3FA 1MD0A 5JR3A 5L3DA 4U88A 4HA8A 4IRGA 1Z9CA 3LSTA 5CLSA 4Y13A 3EETA 3V7RA 5DCFA 4A12A 2H6BA 2RN7A 2EK5A 1ZG5A 3E97A 4UNOA 1OYIA 3HSFA 5E20A 1LDJA 5FLXZ 2COMA 2FA5A 4UV8A 4OU0A 2CW0F 2QLZA 5D5VB 3HUGA 1KYWA 4D0PA 5HDKA 1K6OA 4L9VA 1MZBA 3D0SA 3ZMDA 4KFCA 3U1DA 1FLIA 4LK0F 3WE2A 2OU2A 1FC3A 5BS6A 3L2CA 1XGOA 4YIFA 3ZMTA 3J81Z 1F9NA 4MQVA 2DK8A 4Y15A 3TDZC 3V8LA 2YPRA 4HLYA 1LDKB 2MLKA 3BZ6A 2UWMA 4UVAA 1HW5A 4N9IA 4KN7X 4GXOA 3WTXC 2FNAA 2D1HA 1WSUA 2JSCA 1OMIA 3O3KA 1TQPA 1Z91A 4EVIA 2PN6A 2CFXA 4ENMA 3SZPA 1FSEA 4AVPA 2P5KA 2W57A 1YYVA 1WRJA 4O3MA 4BH9A 4Q5SF 3DXJF 2EFWA 2IT0A 3QPTA 3MZYA 3FXQA 4I02A 1IUYA 5LHHA 2E7WA 3CUQC 1O3QA 1AWCA 5FD5A 4LB5A 1Z1DA 4G9YA 1RUOA 1IAWA 1LDDA 4U0YA 1BM9A 4ESJA 4LLLA 2XUBA 2HKXA 2CG4A 2DT5A 4HX4A 4E70A 1YS6A 4TV7A 4ON0A 2K5FA 4LG0B 1YO5C 5BQTA 5A2QK 2M87A 1K79A 1KYZA 2V6CA 1ZG1A 3GFIA 2O0YA 2JZYA 4M6YA 1QGPA 2IRFG 4YFNF 3HTUA 4EJTA 4OIPF 5FFXA 3BROA 4XLPF 1QZZA 1SMYF 3H92A 3GF2A 4A0XA 2ZNZA 3WTYC 2XAJA 2UZKA 2STWA 2KIUA 3E6MA 4O5VA 3E5QA 2EA2A 3DV8A 3IL2A 3R0AA 5CVUA 3MHXA 1BOAA 1TW3A 3FM3A 4L0ZB 4NQWA 4KIFA 3OOPA 3I59A 2A6EF 3RKYA 1LEAA 3T1BA 2FOKA 2M30A 4N0BA 3N4MA 5K5OA 2WC2A 2BGCA 3JSPA 3F8BA 1HKTA 2VE9A 1J75A 2VODA 2K7LA 4EGZA 3C3WA 1J2XA 3LAPA 2E1CA 1S8NA 2K5IA 1B4AA 3FMSA 4KN4X 2A07F 3Q5FA 5K1YA 4B09A 2HZTA 4U7BA 1U5TA 4R1HA 1G3YA 1G4DA 2OQRA 3PQKA 2ZKZA 4HW0A 5H20A 2DLLA 3L7WA 4YFXF 4CICA 2A3SA 2QVOA 5DCMB 5HLIA 2M5WA 4I01A 2K4YA 2XGXA 4UVBA 4EJVA 2ACJA 2GWRA 2EWNA 2XASA 2PFBA 2L4MA 3T8RA 1O3TA 4Z2YA 4JQFA 5D4SA 1K78B 3M8EA 3TDUC 1R22A 1XDUA 4P96A 3FXUA 2DO7A 2P7VB 3QOPA 3H3ZA 1EV7A 5J6XA 3V7CA 1H0MA 3SQNA 3F8MA 3EDPA 5CVVA 4CHUA 3Q9SA 2O8XA 1C0WA 3TOBA 1DP7P 3JTHA 1P6RA 1YS7A 1J5YA 1KU3A 2OAZA 4ESFA 4I0BA 2PI0A 1G3WA 1XD7A 2XHKA 1HSJA 1CF7B 2VBWA 2XAGA 3TO6A 4PDKA 5L3CA 3P7NA 5IT9K 2GIVA 5F1RA 2K4BA 1XDSA 4XSXF 5AIPA 5DV5A 1O57A 3KZZA 3TO7A 4A5NA 1IXCA 4XRFA 1T2KA 1IN7A 4P9FA 4G6DA 1FY7A 3WU1B 2Z3YA 4I7HA 4IHSA 3HSRA 4HF0A 4G8XA 3GW2A 3W6KB 5HVQC 3P9KA 1T98A 4LB6B 5FGMA 1FZPB 2QWWA 4G94A 4ASNA 1I1SA 3WGGA 3CUOA 2ZBKA 3FF5A 4KT5C 2D45A 3VB2A 1HKSA 4HX7A 3MEXA 4L18B 1YLFA 3C18A 5DCMA 4RB0A 3ECOA 2VBXA 3TOAA 1OKRA 2O6GE 2B0LA 1P4AA 2W24A 1TW2A 3RI4A 1ONVA 4RAYA 1PDNC 2Y0MA 2STTA 3I58A 4CGZA 4BHCA 3LQRA 3HOTA 3HRUA 3ULQB 1MDMA 4HF1A 1UHMA 2WV0A 4Y17A 4Q48A 2GCXA 1Q1HA 5EEGA 1DPUA 1S6LA 4ZH4F 5DUKA 4EGYA 2RKHA 3TGNA 1W4MA 1ZHFA 3V8JA 1HQCA 3IWZA 5ILUA 1R58A 1IRGA 1K7AA 3KP6A 3HRMA 5D8LB 4QWQA 4KA4A 4YFKF 3GVAA 3PFIA 3RIRA 4FT8A 1B6AA 4GCVA 3QU6A 1BC7C 3I0TA 3RPQA 1CF7A 3WTUC 3J80K 2H09A 3MZHA 5LLQA 1BYMA 3HSEA 3O2PE 4PGGA 1PUEE 2J5PA 4IF4A 3L09A 4OIQF 5HDGA 5E17F 2FBKA 3KCCA 5L3GA 1P4WA 3WODF 1IN4A 3GYHX 5L3EA 3HYIA 2F5FA 2HDCA 2CSOA 1DUXC 2AXLA 1T0FA 3IKTA 3QP5A 1USTA
chains in the Genus database with same CATH superfamily
4A3MJ 2VT3A 2EGAA 2R5AA 1NJIC 1S7AA 1SG5A 4RLFA 3ESWB 3HPHA 3ZQFA 1YWOA 3BJAA 3MD2A 4B1RA 2JM9A 1X3ZB 3EYIA 4HQEA 2XV4S 1QPMA 2NNYA 4LD9K 3LA7A 1P7JA 3R61A 1HW1A 1S72I 2L8DA 3V7SA 1EH7A 4K11A 5LJ3f 3GO5A 3H0DA 2BE5F 4XBFA 2OJ2A 4N9HA 1N78A 2O4XB 1UHWA 1IGNA 2EAYA 1K8AR 3PFYA 4UUVA 3K0LA 2VKEA 3K1MA 4A5MA 1QW1A 2QTXA 3S93A 4EMGA 2ZPIB 3MKWB 1TU0B 4CC7A 2V9KA 5DYMA 1IO6A 2LC4A 4RG2A 3CCUT 2MC4A 4PGHA 2EQIA 4FHTA 2QUFA 4R0KA 1XSXA 2CQNA 2HTJA 2D9TA 4DA4A 3WTVC 3GTPJ 1QKXA 4M75E 5AYFA 4KBMB 4MHGA 3ZXSA 2X4XA 4KYWA 2QG9B 3B6AA 5KAFC 2DT6A 1NK2P 1X69A 4AIDA 3M9QA 4Y4RA 2OD5A 1VQLI 3EG0A 2Z1DA 3WTWC 2K6DA 1UDLA 3A0BC 1S7OA 1YW9A 3I56Q 1YIJQ 5GADJ 1IN6A 1T95A 4IO9F 2DXIA 1PUFA 2QM3A 2JMWA 1MBKA 2HTSA 2WSFE 2OTJA 2EB7A 4F7UG 2FOWA 3JCMV 2QENA 4IUPA 5CVJA 1FBSA 2HSPA 2HL5C 1QQIA 4ZYAA 3KEOA 2OZUA 4F93B 1VQ7I 4LK1F 2VONA 3H3UA 2RV8A 4LMYA 4Y28E 4LITA 3CZ6A 2XROA 2IBDA 1U6GA 4RTWA 3PNTA 3C2GA 4OAYA 3S2WA 3NHNA 1QO0D 4RGXA 2LX9A 3OMGA 5M5XJ 2YT6A 2WV1A 3SXYA 2ENMA 4BGDA 1PVEA 1U9NA 1W0TA 3OW2P 1BBYA 3TMOA 2NVQJ 2DIQA 2O9LA 3R6SA 1KQ8A 2KVQG 4ZZLA 2RJDA 2HR3A 1WJEA 3GFJA 5K7FA 2IXSA 2H6CA 3KP4A 1G59A 3J80Z 2DL8A 2IG0A 2LSOA 1TWCJ 4LDWA 2YX7A 1VQKA 2XHCA 3LWFA 3KE2A 1GV2A 2Y4YA 2ZMEB 2HYFA 3HTSB 1I07A 3VYUB 1IHVA 3JCMf 1YCYA 3MVPA 3LL7A 2CFOA 1X1BA 2RAEA 3SDBA 3PO3J 2N8GA 3LGFA 3PSIA 4XAXB 1YJWA 4BY1J 3FC3A 4XRSA 4M7DD 2WAFA 2HXIA 2DFUA 2P81A 1MJAA 2V4JC 1PSFA 3RZOJ 3MMYB 4EEFG 3CCQI 2KRHA 3M3YJ 3EG9A 3JCMP 1SD5A 1WZOA 1K8AU 3ZQIA 4Y33A 4QSHA 2AS5F 3G2BA 2JPBA 1U5TC 4E7KA 1T39A 2CO5A 2K27A 3QQAA 4IRHA 3HTRA 4M78G 5EG2A 3TQNA 1G83A 2PBIA 3EQLF 4XTYA 4FSXA 3UA6A 1J09A 4K2EA 4H0EA 2KDSA 3EG3A 5CO7A 5C6SA 3CC2Q 1VQKQ 1D3YA 5GANh 4LJZF 5GAMe 2OUMA 4X9DA 2IA2A 2DMPA 3BR2A 4BS9A 3K2ZA 1ZQ3P 1MV3A 3DP7A 2LJ0A 2FF4A 2P5VA 3E0JB 4AIHA 5L3BA 3J81E 2QA4Q 1N9RA 4Z88A 1IHWA 4JRKA 3RJPA 1YJWQ 2JRMA 2M7BA 3FKJA 3GFMA 2QEXI 3NTKA 1QVFS 1BI3A 2LF7A 2LNBA 4ENNA 1EX4A 2K3FA 3BG9A 2KRNA 2OI3A 2HQRA 2HQHA 2EJ9A 3GIBA 1BW6A 3GCMA 2LKPA 2PMUA 3ZN0A 2VXZA 1D3BA 1YNZA 4C3HJ 1G2HA 2AZSA 1H9TA 2LQNA 3VU3C 1AWXA 5F27A 2EJGA 1VQ9I 5KVRA 2E5KA 4NC7A 5HDNA 2FPDA 4MEXF 5CKEA 5CQYA 3SEQA 5FU6B 2RNJA 1Z3YA 2RQQA 1KD1R 2ELKA 1B72A 2V8IA 1R1VA 2Y0SN 1WGSA 4QQDA 4M75F 5GANd 1R5HA 1WPKA 2EFNA 1QVTA 2OJED 2MI6A 1WNLA 1ACIA 3QJYA 3OYIA 3SDZA 1B9NA 1WYXA 3HOSA 2XIDA 4KUMA 3FXRA 3MEVA 4HCBA 1M5Q1 2FBHA 3H3VK 2DCEA 1RI9A 5KYUA 2A61A 3CCUQ 4OMYA 3VRYA 2VKHA 1UHCA 1X1DA 2DETA 4B4CA 1IDZA 3C4SA 4M9SA 4OMLA 4M74A 1K6YA 3RKQA 3G6EI 1D5YA 2AKLA 3I5UA 5BOXA 2W84A 2CH0A 4D1QA 1H641 3KFWX 4LGWA 5LHGA 1OYXA 2RK1A 2DQRA 2ZJ2A 3A8GB 3JCMb 2VQGA 1HW2A 1UGRB 3S17J 3DBRB 4MO7A 4CCKA 1FMWA 3CF2A 2X1CA 4BXXJ 1FBUA 1ZR2A 1BA5A 1ABQA 3L2RA 1VFCA 2DTHA 3NTHA 4AFQC 2YU3A 1Q82U 5LEJA 1KQSA 2TDXA 3RBBB 2O4XA 3U1KA 2Z9OA 3T8TA 2JVHA 4ZTJA 3PO2J 3WVDB 3C94A 3JSCA 1UGSB 4M3FA 3PMIA 3O6BB 1Q82R 2A69F 2DDBA 2E1MC 2KIFA 5C3EJ 2K5CA 2P0TA 3L2WA 4C8QE 5E1ZB 2PJRB 2V8JA 2DOAA 2V9PA 4OF1A 2GLOA 2CUZA 3MP1A 3JRCA 3HJEA 1DGWY 5CYVA 2DDAA 4TVRA 4IHXA 2W82A 5CAIA 2OX7A 4KIGA 5LRRA 9ANTA 5KE3A 2F4IA 1WI9A 4L9TA 2FHDA 1UFMA 3WE3A 4FYYB 3DF8A 2BW3A 3ZOBA 4HF2A 3PQJA 3MEWA 3A52A 3PVLA 3CCET 5D8KB 3CCRI 2IGOA 1SC7A 1SANA 1IXDA 2XB5A 5ED4A 2LVSA 4BE1A 2IP2A 2IA0A 4V19K 3RYRA 3OYHA 1LE8B 2EH3A 3LOCA 3PIPA 4EJWA 2Q8KA 5DDGA 1FNNA 3TSZA 1ON2A 3KLNA 2XMFA 1HSQA 2NS8A 4A93J 4G6QA 3S3NA 1ZSZC 3MFKA 5IPAA 3CCMI 2DBKA 1MMGA 2HD0A 3KETA 1B3QA 3G1JA 2J5OA 3VWBA 3HPWA 3I35A 4HCKA 4RMNA 4HG2A 1WXUA 1QPIA 3UPUA 1R23A 3WU2C 2WB1A 3OR1C 2KZVA 4U7DA 3FK6A 3JRDA 5E8GA 3OYEA 5TJJA 2KQWA 1A31A 2F4MB 4RTUA 2DW4A 2L3SA 1OQYA 2BVLA 3FRNA 1YOVB 5GAN2 2IVWA 2QEXT 2O9VA 1GCQC 2NS7A 2X35A 2Y30A 4ZN1A 1VIEA 3EFRA 2IAIA 1K4US 3CCLA 2HPIA 3KLOA 1MBFA 1Z6RA 2X9HA 3FXJA 1S72A 1ENHA 2XAFA 2D8HA 4M7DB 1VQ4T 4PJOC 4HSRA 1YJNT 3KP7A 4DNCA 5KK1A 1YHQI 2CW8A 4IXAA 2R5ZA 1BN5A 1ARKA 3L9FA 3PNWC 1V4RA 1BCMA 3OIOA 3RPUD 3CCSI 2DF6A 3VRZA 3SZGA 2DT7B 2DL7A 2XSDC 4KMUX 2CREA 2NRAC 1MH3A 2R7ZJ 1JXOA 3LFKA 2L4AA 4EDUA 3RERA 1XC5A 2EFOA 2G7HA 3B73A 4NUBA 3BZCA 3MKZA 3ML6A 3S3MA 3CUQB 3CDIA 3LW5E 1YX5A 2RQWA 3VUZA 2ADUA 3CMEQ 1JGSA 1MMDA 4YEJA 1B9MA 3RKWA 4E7ZA 2AIRB 3G4SI 3O8VA 3L42A 4GBQA 4M75G 2YLCA 1XGMA 2HOTA 3K1PA 2PLYA 2X98A 1VQLA 3FJPA 2RJFA 3T9NA 1HCRA 2NOJB 3HKZA 4L5IA 1SHGA 3GUDA 2JT4A 3G6ET 3CCLQ 3H35A 4DBQA 5HLGA 1XMKA 4NDLA 2KROA 4JDSA 2CSIA 4V2SA 3ZFJA 1E3HA 3KEQA 1HSTA 5GAMd 4BI3A 1JBMA 2A68F 3ZQHA 3ZBDA 5D5XB 3OW2A 1SFKA 3BR3A 4W1UA 4EMKB 4I09A 1FYLA 1N8RC 5JVTA 2MC3A 2L0KA 2RVCA 2HWVA 4F17A 1SFXA 3IHUA 4RAGA 3OIPA 1VQ8T 1VQ7A 3E5UA 3VODA 2RDPA 1SHFA 4JS4A 5H2FC 4HX8A 3H5NA 1YN8A 5JHUA 3TP3A 4KH0B 3VDXA 1PYVA 4PFPA 2XGCA 5J3BA 4XOPA 3JCMe 2JJ7A 2YR2A 4L9JA 3W3CA 1CGPA 2CV1A 2UXNA 1Z67A 1REPC 2LX7A 1XGNA 3BY7A 1MSFC 1OPLA 2MAMA 3ZPLA 1AZEA 4M72A 1JKQC 4BUGA 2GQVA 2V26A 4M3GA 4P1WA 4BEHA 4A3KJ 2JUFA 1JJ2P 2X1EA 2RI5A 5L23A 3FISA 2BZXA 2LP5A 4E7IA 4GLKA 1YW8A 3Q0WA 3OIQA 1USSA 2E1NA 3TBIA 1QVFP 4I0AA 1T08B 3QWLA 3CEYA 3KUFA 3JTGA 1BIAA 1GCPA 2FPFA 3ABUA 4G7HF 4M7AD 2DRKA 1X3UA 3ABKH 1IXSB 3QPHA 4LFUA 2ATCB 3BG7A 3NRVA 3BR0A 3I55T 1A04A 3I53A 4XK8E 2I0NA 3CCQA 4WXCA 4JP0A 4MTDA 1E6GA 3QYGB 2KI7A 1RR7A 4FW2A 3CCMT 1R9TJ 1NJIU 2IA1A 1MIJA 4D7NA 4D8DA 2EIJH 1FP1D 5A2QR 4J19A 3H5AA 1ZARA 4C0GA 2RC4A 2D1VA 2HKOA 2DTRA 5BPDA 2LH9A 2E3IA 3IP4B 1I5OB 1YQAA 3JCMQ 1BOBA 2NAZA 4EQQA 3VKIA 1N77A 2NUZA 3I71A 4B44A 4B8XA 5DM6F 2CUFA 2CGPA 4C8QD 4HZFA 2JZ2A 4Q5WA 2JTVA 1R0CB 1LNXA 3AG2H 2K3PA 5A2QZ 2PQ8A 2HDDA 1M1GA 2GFUA 2QXFA 2ZPBB 2KKOA 2DJNA 2FE3A 2W1OA 1F1ZA 3DFGA 5E1WA 2WWYA 4J9EA 2EILH 3OL4A 2E70A 2CU7A 3LSMA 4HKEA 5C44J 5GP9A 4Z8AA 4DYQA 4AIKA 1D8JA 4DZJA 2L0AA 3ASKA 3AFHA 2RHUA 2LK2A 4C92D 2WA0A 2E5NA 3OYAA 4ELZC 2GTOA 1QZEA 2R7DA 2VIXA 1VQ9A 1LUJB 2H3JA 1QBJA 4XKWA 2RREA 1YITT 4HNTA 4M73A 1UE9A 2K86A 2Y48A 1X2QA 3HZJA 5B66C 1I3AA 2EW3A 3A8HB 3DKWA 3CJNA 4LG0A 1WJAA 4ZNXA 2F4OB 3OYLA 3D7SB 1IW7F 4FYWB 5CJ9A 4E7LA 4FT4A 3KEYA 4J6XA 2OV7A 2CWEA 1IXRC 4FIBA 5D7UA 2EKHA 2DA4A 1LVKA 3JCMX 2O5RA 2QGFB 4AMCA 3H9QA 2OQGA 4C2UA 1OQKA 1WJRA 2JMAA 3M54A 1DU0A 3IRRA 1OPCA 4A3EJ 1M1EB 3M0PA 5LBQA 4LG3A 3M07A 4PZJA 5ILVA 2ELHA 2R7WA 2EJFA 2MK5A 3CC4T 2VGNA 4KISA 1ZTRA 2F5EA 1X6BA 2K85A 2Z99A 3M4YA 2XDVA 1SPKA 2YS9A 3FHZA 3G73A 3MCZA 1K8AC 4HYEA 1VYTA 4M7DA 4A69C 2GIZA 5GAHJ 4GY5A 4IEJA 4DIQA 3JB9D 3GWZA 2E65A 2OTLQ 2KJCA 4XRMA 3OSGA 1XMXA 4A0YA 4S05A 2M02A 5GANf 2FB7A 1ZGJA 5E18F 1R49A 1IDYA 4A3DJ 1QWFA 2LRQA 2V1XA 3HRTA 2IS1A 1PD0A 3M57A 4XQ3A 1T0FC 2DAQA 1L3LA 2UXXA 2EFIA 2E3HA 4CZZA 1QMCA 2Q2EB 3LAJA 2D0QB 3JAMK 2PVOB 3CC7A 2GZWA 2FUG2 1SFUA 3CMMA 3T5XA 1MMNA 5IT9R 3LWIA 2BKDN 3CCJA 4JJBA 3CC7T 1VQNQ 1NPPA 1PNJA 1G2BA 5E8IA 1RUWA 2QBYB 1U9OA 3DPTA 1TXQA 5EDNA 4CA0A 3V4GA 3F8FA 1WHLA 2KRMA 2D2WA 3F6OA 1Q7YR 3N97A 3EGDB 3KP2A 4MGRA 5AIQA 1TNSA 2ISYA 2PTKA 3CO7C 1KA8A 3BOQA 4XL9A 3SWNA 2LLKA 3CMAQ 2X51A 1BC8C 3P9CA 2CT3A 2GNCA 2QQAA 4F91B 4JRPA 4MMKA 3DKMA 1L0OC 3MKDA 4ZYEA 1HJDA 4ZGDB 1ULYA 5KCOA 1NK3P 1K0SA 3UDCA 1PG5B 1QVUA 5HK0A 1IB8A 2E7XA 3BR5A 1LEBA 3FB9A 1VUBA 4XLCA 1XJWB 4WF2A 2DA7A 2FQ4A 2NUTB 4LLGF 2V1UA 1MGQA 4BQNA 2X6OA 3ABLH 3RKXA 2EQUA 1VQMI 2XVCA 4KT0E 1WWXA 1P7IA 2A08A 2CV0A 2ZFWA 4YIIA 4UV9A 3K4JA 4AYBN 3A0HC 2JQ7A 4ZYGA 1DDNA 1IREB 1SSHA 3VJPA 4BY7J 1U8BA 1K61A 4X34A 4EV0A 5L3FA 2FSWA 4N4NB 2LNHB 3FEOA 3QXEB 4M9ZA 5IY5H 1NLOC 1C0MA 4HXJA 1WKMA 1JHFA 4FX4A 2DPPB 2Z5UA 2DEQA 5CKDA 3JRAA 1RUNA 4OOIA 5K5QA 3K4CA 3PIOF 2G3RA 4QTRA 3CD6I 2CUJA 1VIFA 3ULRB 3BP8A 1U2WA 1HA8A 3ZGKA 3W2VA 3D5LA 1MBJA 2M9HA 1SAXA 1FIPA 3OS0A 2JA8J 2VXEA 1UELB 1MBHA 4BHPA 2FEZA 2CQQA 5KNLA 4M7AB 3VFZA 4KGXB 5KYWB 5HLTA 1VQPI 5GAOl 1H3ZA 2HGCA 2K3YA 3HHHA 3K9TA 1YHQA 3QRFF 1BJAA 2ETHA 2HZDA 5FO5A 3I4NJ 1Y57A 1O3SA 2VC0A 1XS9A 3CCSA 4A4KA 3JB9I 5LRSA 2DI3A 2VC1A 1Y39A 1I1JA 4XRSG 3PIPF 2RQPA 2IS2A 2DA3A 4I2OA 5CVRA 4RTTA 3VS0A 3NPFA 3G71I 1KQ1A 1X27A 2P0KA 2F69A 5DEQA 3GP8A 3F8NA 1X6OA 1VTNC 4XQFA 5IP9J 2O31A 3R6OA 2BEOA 2JK3A 3KP3A 2RN8A 2EQKA 2BIVA 4N4HA 3K4BA 1RI7A 4JJCA 4C8QB 1WGXA 3NAUA 2GA1A 1Y96A 4PCQA 3TL4X 1FPQA 5GPCA 1ABOA 2CP5A 3CBMA 5BPIA 1Q7YU 2WY8Q 4AFUC 1F5TA 1WLPB 2QAZA 4M75A 2EV0A 3H5RA 4RB3C 3CC2I 2DO3A 3JCMW 1Y0UA 1GRIA 3GXOA 1QWEA 2NNNA 1FMKA 3JRZA 1JT0A 3COAC 4LLNA 4C92B 3QYBA 4ZGJB 2A6HF 1K73R 5FB2A 2CJJA 4XSZF 3FX3A 3F0CA 5D4RA 1OCOH 2P5LC 2VQCA 2KNBB 2M0OA 5DD8A 3ZMVA 1RI0A 1Q81R 1KD1C 3UR3C 1K78A 3GTKJ 1Y56A 1QVFA 1XGSA 3Q1JA 2IGNA 4XLFA 2LJ1A 3KFVA 4C0DB 1M3BA 4XTUA 4A3JJ 2ZO4A 5BMZA 2DJQA 3CPFA 2V1QA 4HQMA 2QQRA 1ZR4A 3I4PA 3MQ0A 2PG4A 4OMNA 1X4OA 4XLEA 5D6EA 3SYTA 1NLPC 3BDLA 3AAFA 1E3PA 1N8RR 1IG7A 4ENJA 3HFOA 3J7AY 5GAMf 3GPLA 4CUGA 4NL3A 2E19A 1GBQA 5J8FA 1F1BB 3P8DA 2DAOA 2RM4A 2HBWA 1VQOQ 1WH5A 4HV5A 1B8IA 3K1NA 2B7EA 2NVTJ 2Q1ZB 1HKQA 5FKNA 2JXBA 3OL3A 8AT1B 1BB9A 4ATOA 1GHCA 1UEBA 2WBMA 3CCUI 3JV3A 1YIJT 3HRSA 5JHFA 3ZMSA 4ZN3A 3H8ZA 4KH1B 3RESA 4CYCB 2LDUA 2E6ZA 4AU7A 2GXGA 3DBHB 1ZK8A 3RPUA 4ZYHA 5IT9Z 2FEIA 1UUEA 3IWFA 1G3SA 2IIMA 1Q82C 4M7DE 2JN6A 4BKXA 3MKYB 3AG4H 1Z05A 3EUHA 1GXPA 1V55H 3EYYA 1MNMC 5J40A 4KUIA 1ETYA 1MJ9A 2FMLA 4RBOA 4PKCC 3Q0VA 4A3BJ 5EYRA 2M1HA 1ZAOA 1Y07A 4LE9A 2MWOA 2VI6A 2VLAA 4A4GA 1XMAA 2Q2EA 2EZKA 3VS2A 3VYGA 3NEUA 3WVEB 3BE3A 5GMKm 2PVGB 2LF8A 2MA3A 3CTAA 4BACA 1HC8A 3HUGB 3U23A 3B02A 1MNEA 1FYMA 1UG0A 4OB0B 3S6WA 1ZQ1A 2ZSHB 3GTLJ 1MV0B 1GFCA 3G7ZA 2HBPA 5KYXB 2CYZB 2DA1A 1D1BA 2R7FA 4FETA 1NM7A 3ME9A 3OYDA 1BI2A 3RUXA 2EYZA 2WAQN 1XB4A 5CKTA 1UGPB 2P0QA 3W6JB 2K9SA 1ZUUA 1I39A 2MG4A 3I54A 4DYCA 3QZ9B 3EG2A 5LJ5j 2R7VA 4C3JJ 2JVGA 2ROLA 1BJZA 2DRMA 1WQWA 1KC8R 1TSFA 3E7LA 4KUDK 1JHHA 3L2VA 1T56A 3MWMA 1HF0A 2HZYA 2YWWA 5FFZA 1TWHJ 3EPZA 1J59A 5H6QA 2XICA 3E19A 4U87A 1IRZA 4MFDA 2IPQX 4JX6A 3WXMB 1S29A 1EH6A 2I5UA 1N8RU 2L9NA 2CKKA 2CUBA 5GANe 2LRDA 3X28B 2R5YB 1KSWA 1U8RA 2YSRA 1VQKT 2ISZA 4S0HB 4RS8A 3M8JA 1U78A 3HSBA 2RI3A 2BY3A 1B7TA 2QTVA 5HKCA 1Z6TA 3U21A 2L2PA 2QA4T 2DOFA 3PJRA 3AL0B 1M2VB 2JPCA 3LSPA 2WACA 1XCVA 2OC6A 1FOYA 4BXUA 4DQ2A 1YRNB 1NHAA 1C1AA 2COWA 3EHRA 1YJWT 1M3CA 4M7AA 3DPLC 3SEMA 4EMHA 2DPUA 5KYWA 2XAUA 3HGYA 4M77C 4MNUA 4GFBA 2KIQA 4F7ZA 2LBFB 3J81K 3S1QJ 1R7JA 1RNLA 1VI0A 5CKFA 2MLGA 5DS9A 3QKJA 3Q9VA 3DCFA 4C5GA 4RAFA 1OX9A 2DTOA 2V1RA 4HVVA 1V3FA 2FRHA 1R5ID 5LGNA 5LJ5g 5AONA 3BT9A 1UTIA 3TVTA 2VJIA 2ZC2A 2VUBA 3UA7A 4RM3A 3BC8A 4BBRJ 3I4MJ 2OAUA 4RM2A 1U5SA 4IOAF 3LMMA 3M1CA 2H1LA 2VQHA 3VYRB 2JN0A 5I2SA 2LTOA 2XF6A 3TW7A 2HQ5A 3EGUA 4MDXA 2EV5A 2PJPA 3R0JA 1UJYA 3EH2A 1MKMA 1Q95G 3T0YA 1XTAA 1W1WE 4X1EA 3CMEI 2GXAA 3HXLA 3ISPA 3ROUA 3H36A 4C8QA 3IRQA 1OR7A 1YW7A 2HNHA 1V5EA 3BQYA 4MFEA 2HEOA 2JRTA 5M5WJ 4NHJA 4Y52J 1QQJA 4N0AC 2AZVA 5CKBA 1NBEB 1QZYA 4OMOA 3BDDA 1TT0A 4XN0A 2E41A 4RUGA 2RI2A 1OISA 1RZ4A 4KICA 1U06A 2OA4A 4MQ9F 2ZZDA 3PTAA 3QP6A 5ICFA 3SFIA 3JRIA 1RQ6A 1X2KA 5FU7C 3TO9A 4M7DF 3M9AA 1RLQC 1ZN2A 1VQMA 2MGQA 5FWBA 3S32A 2HFHA 3OYJA 5C0MA 2KL4A 2XPUA 4JJDA 2V1DA 2XDDA 1SD4A 1N25A 2KY9A 2V79A 4MZTA 1YFNA 4C92G 3HOXJ 4UVCA 3ER0A 4AIJA 2K5LA 1VQ6Q 2EV6A 4XK4A 3BTJA 4RB1A 1KU7A 2ESWA 2DFIA 2P84A 3KPHA 4OMQA 1Q86R 4LD5A 4DBHA 3FZVA 2ZJPF 1IF1A 1ZUYA 4BE2A 1PM3A 3CPWS 2LY2A 5J3LA 3CCYA 3A01B 1UB9A 1VQPA 2YUOA 5FLXE 4JOMA 3HHTB 4ZZDA 1YI2A 3BG3A 3BCBA 4J7FA 3DLLA 2DBMA 2LY1A 3RMSA 4KDPA 3EGXB 1M9SA 1VQ5A 3HOVJ 5CVIA 2ZJRF 4L59A 1WHMA 2ECZA 4KJZA 2O61A 2BY2A 5ICEA 3GEZA 2RD1A 4ZGEB 2XAQA 3JRBA 3P9IA 1XG1A 1I5ZA 4CYCA 4HNVA 3IC7A 1MJBA 2QGUA 2JMCA 3G71A 3ECHA 4OIOF 2ROTA 2OTJQ 1OLTA 1WFXA 3WTTC 4HDVA 2MH2A 3F6VA 4XTZA 3I9QA 2Z0WA 4EM0B 1SD6A 2LTPA 4M9XA 1N9SA 5KH6A 2XK0A 3RDIA 1P92A 3CCEI 3EHQA 3EFOB 3QSUA 2R7SA 2K4JA 2H27A 4XICA 1MBEA 3ELKA 2L3DA 4RAZA 2OAWA 1X58A 2HQNA 3BDUA 1YTYA 1V29B 1S3JA 3VV0A 3JB9H 1JI8A 2VWFA 3F3XA 1VYUA 2IGKA 3JCMc 1IN8A 2GQQA 1UGQB 3GNFB 2PMHA 2AK5A 4CSWA 4JLIA 4LDXA 1IZ1A 1WJBA 2PEXA 2VXDA 2K9MA 2NS0A 1K9MR 1KQSS 2RB6A 4OINF 5KYXA 1H9GA 3LQQA 1BIBA 2OZ6A 2B9SA 4M3DA 4U0WA 2JTFA 2NYSA 4ZDOA 3I5SA 5AT1B 4XOTA 2HOAA 2A05A 2L54A 4BYYA 1YJ9A 5F1JA 3GTGJ 2QKMB 4YELA 2RGVA 4E7JA 2C0TA 3THKA 1PCXA 3CCVA 3BY6A 3QHSA 3GOXA 3HIFA 1Z3XA 4M78C 1VQ4I 4D8KA 1YJNI 5LGTA 1U3EM 2AXTC 2DD4A 4RG8A 5LHIA 2VUMJ 3CMET 1M8MA 2WAEA 3HPGA 4A0ZA 4CCJA 1PP8F 2MOXA 3M59A 2K02A 3WGHA 1OX8A 4GO1A 5J26A 3REBB 5GMKi 1Y1WJ 2DIGA 4Z02A 4G6TB 4NQWB 3U9GA 3MAJA 1SKUB 2DL3A 3MKLA 5J39A 1Q86U 2R5YA 3CCLT 3I59B 1UGVA 4FW1A 1Z9QA 3BTCA 1S5LC 1YI2Q 3ZL7C 3FXOA 3O8GA 1OI1A 2FG0A 2IPOB 4FQGA 1H8KA 1VQ5Q 4EM1A 1I8FA 1UG1A 3DEWA 4II2A 2V8KA 3C7JA 1YRNA 2XIGA 3W6VA 1YJ9Q 1OYYA 5FRMA 5GAN6 1ZH5A 4E4HA 1UZCA 2DPDA 4M7AE 5KYYB 3CCVQ 2DBBA 2KRCA 5EZHA 2VJ5A 4P5OA 4M71A 1W7PD 3DEUA 4WCIA 5GAOn 2MH9A 4M7DG 3VYSB 4U0VA 3L2ZA 3J7YJ 3BJ6A 4FASD 2V9VA 1SMTA 2BYVE 1UB4A 2JUGA 2HQAA 1Q7YC 4WCGA 3WGIA 1KU2A 2KIMA 1S9HA 2XRNA 3C2BA 4QQ6A 2JS2A 1KG1A 5HLHA 4PJOD 1WJ5A 2Y75A 2JSPA 3KZIC 4PK4A 2CMPA 4MIMA 2R7UA 2HMAA 1VQ8I 2DU9A 3E6BA 3FDYA 5GPAA 3IH3A 3P5JA 4IHWA 2F5CA 1NTCA 2PMZA 2XKOA 2YUQA 4FT2A 1JUPA 5DTDA 3HL2A 1U5TB 1DJ7B 3OB9A 2L7MP 4FX0A 3OYMA 4ORZA 3E5XA 5ERIA 5FJ8J 1AVZC 2ZPFB 4EM2A 2HKQB 1LCKA 2CZ1B 1POGA 5TISC 4KRTA 5A0GA 2LT4A 1XSDA 2M16A 4AT1B 1TQIA 1JE8A 2GXBA 1SF9A 5F0FA 2KYBA 2ID3A 4B9XA 3D5RC 2RO0A 4LNPA 3QU3A 1JB0E 4C92E 1MGTA 2D8JA 3TP0A 2HVRA 4PJLA 2L9SA 1IGQA 1G6NA 4Q4ZF 2QZ8A 3H0IA 1GVJA 4RTYA 4CCLA 4WWCA 1D8KA 2V7FA 1NYGA 2XKPA 1Y1VJ 3J7AO 1LJ9A 4E2FB 3I55I 4L0YB 5I11A 2X4HA 2BV6A 1TS9A 1M90R 1A36A 2QI2A 3F70A 1KD1U 3FIFA 3H9GA 4JX5A 3HL8A 1TG0A 3VS4A 5IN1A 3WG7H 1ITYA 2QQSA 4O6JA 1YFHA 2K3XA 1GUUA 4MDWA 3X26B 3RQIA 5M5YJ 1ZBJA 1JTXA 4OGEA 3A01A 1QCOA 3ZP5A 4P55A 2E64A 3NFCA 1OCZH 2L2OA 1XN7A 2E71A 1NEGA 1N75A 1G3TA 3VS1A 5J47A 1EZZB 2FJ1A 2DODA 2MBFA 3FM5A 3F21A 3ZQCA 5I22A 2ZMEA 3BR1A 1TP4A 2A0FB 1EA3A 3UWNA 8ATCB 1H3HA 1Y8QB 5FRNA 2VB6A 3ERMA 4XMYA 2ESHA 2H8WA 4JYKA 2KDZA 3DTKA 2DMNA 2L89A 1J7KA 2EYWA 3H0HA 4BQQA 3MJXA 3OYFA 4RGUA 1BBZA 4II1A 6AT1B 2ZXJA 1D5VA 1T0JA 1WQ2A 2QDLA 3EFOA 2RJEA 4PSXA 1YITI 2XSJC 3DQVC 3M5AA 4E47A 3CPWP 1AEYA 5KHDA 1HOMA 2Z33A 3H6ZA 1ON1A 1I1GA 3BTIA 3IH4A 2VOOA 2M35A 1K73C 1LOJA 2O03A 2RHIA 4C5IA 2E1MB 3V8KA 1NE8A 2M2EA 4I98B 1RABB 4HVWA 2DEUA 2CW7A 2KFDA 2M8EA 4HDUA 5FKMA 4WX9A 2KRSA 2VL8A 1PJRA 3M8FA 2PU9B 2VVKA 4M7AF 5JLXA 3U2RA 1GXQA 3BJOA 2E2JJ 1IGUA 1JJ8C 1T38A 1S72Q 5ICCA 5ILSA 1LB2A 1EF4A 1OULA 3VPRA 2OBPA 4A6EA 1P4XA 1KJWA 5I2MA 3F72A 2OTLT 2X85A 5HY6A 2R3SA 2NOGA 3CC4I 5DD4A 3I5RA 1T0HA 1Z21A 2VXFA 4FYXB 4AWXB 1WHGA 2CQXA 1RAFB 1O9SA 3FJ5A 3M0TA 2P7CB 3QAHA 2HOEA 3OR2C 2H94A 4J8OA 1I5LA 4A4HA 4M75C 5J4VA 3FWEA 1B34B 1QKWA 1WCMJ 1BI1A 2DXUA 3OQ5A 1V76A 1VQNT 4OMZA 3OV8A 2MFZA 5HOOA 1FX7A 5GAEJ 5B5EC 2BE9B 4KGVB 2MD5A 5E1XA 1ZSZB 4BQOA 4A4EA 2OF7A 4ZYDA 4X1VA 2JTMA 4I99C 3I9V2 4M6XA 2FXAA 4PUSA 4J7IA 4JUVA 1Z7UA 1E17A 2E2IJ 1ZLJA 1VQLQ 5D6WA 3CMAT 1RAHB 2C6YA 3CLOA 4MLOA 2Y9ZA 4AD9A 3JSOA 2CGHA 2QGGA 2P6SA 1R1UA 2M4KA 1ZLKA 3R60A 4EJUA 4JK1X 1W7PB 4NL2A 4C92F 2W10A 3JREA 2I2LA 2DQLA 1NG2A 1TUGB 3BTLA 5K7HA 2AHJB 4HT8A 4R8HA 2XAHA 1B59A 4KT6A 3L2QA 1FOKA 4IPAA 1VQ7Q 5JVGF 2MYSA 4IX7A 1AWJA 4PJOB 4XU0A 3CCJT 1BI0A 1HDPA 1OU9A 1T8IA 3FXKA 2LZ6B 1PKTA 3ZEHA 4ZJZA 5IP6A 4IL6C 5F0HA 3KXTA 4CXFA 3A02A 4BE0A 1H8AC 2GQIA 2LCLA 5H6RA 1XTDA 4XN3A 4ESRA 5CPRB 4XLAA 3M7GA 2LP0A 2RH2A 4MZPA 4HCZA 3E3VA 5GJWB 1LQ1A 2GTJA 2X6WA 1N27A 4BI8B 2ZGWA 3DTIA 2CZ6B 2VASA 1XNIA 5DUIA 2K9GA 2FRYA 4PJNA 4IJAA 5HS9A 3DLLF 2PJRA 4N4GA 1TBXA 1KC8C 2DFHA 1RETA 3EUHC 4Q47A 3S2HJ 3OBWA 4BAYA 4Y91A 3LA2A 2GAUA 4ETSA 1LJOA 2COYA 5IHNA 2QEXA 3JB9F 1W2BS 1ETWA 3HC7A 1T6SA 3E9GA 2EPFA 5C4XJ 2CV2A 4A4FA 5A2QE 3JB9J 3I64A 2Y69H 3CCQQ 2F2EA 3HGGA 4II3A 1YJNA 4LUDA 1V5GA 1G5VA 3SHFA 2VKDA 2K2MA 1J9IA 2DVEA 1IV8A 2F5KA 3WU0A 4KULA 1WHHA 1MBGA 3FXLA 2DN0A 4PFZA 3AG1H 1AOJA 4JX4A 1R00A 2H8HA 3ASNH 4CRIA 1LE8A 1ZREA 4HVUA 4IVNA 1I6XA 3F22A 5K5RA 1HK9A 3K4KA 1UFFA 1WXTA 3CXCP 1KQ2A 3GZ5A 3M1EA 2BXYA 2O01E 2BZYA 2ZCWA 4UHTA 5LJ3h 5DM7R 1FSHA 4J01A 1TNTA 3VOEA 3META 1TOVA 2X6XA 3ZQLA 2DMOA 4OVAA 3ZMUA 3CF5F 2YLBA 1RIOH 2Y31A 2RPNA 1ZRCA 2COZA 4KIBA 4CO8A 3E6CC 1FTTA 2VKVA 2ELJA 5D6XA 4C5HA 3G6EA 4M7AG 1AWOA 2Y2ZA 4HRIA 1HXDA 1B1BA 3CDHA 1KHCA 2KSSA 1FOWA 1TLHB 2IVMA 3QPLA 4IZZA 2X9DA 4A3FJ 2EGEA 2W0ZA 1JJ2S 1JUSA 1YIOA 3OS1A 2ECCA 1MDMB 3NWTA 3DU6A 3AG3H 2KT1A 2EINH 4W97A 1D0XA 3GX4X 2BZTA 2NYXA 1VQ9Q 2KRFA 2D1XA 3EUKL 4PLLA 4L5JA 1P2FA 1LVAA 2VBZA 2VV5A 1YWPA 3ZQ7A 2MZ4A 1XSVA 1KU9A 2IJLA 1UHSA 5KCMA 4CYDA 1LKXA 2ESNA 1ZYRF 2C0OA 2A3LA 2DZ9A 3JAMR 4IUTA 1QP3A 4NB5A 4PJJA 3GTQJ 2DMTA 1KGSA 2HXOA 3ZQQA 1MUZA 2DNUA 4CZCA 1AT1B 1ZA2B 1VQOT 4IUQA 4J83A 4WXDA 3CP2A 3FXMA 3K10A 3QIIA 4C8QG 1X1CA 3M58A 1X19A 3CUQA 2E5QA 4R79A 3C12A 4RGSA 2DD5A 3QJ6A 3OYCA 4J6WA 2GFAA 3K70C 3H9JA 4HBLA 5IHIA 4A2UA 1U0JA 3LA3A 3M53A 3REAB 5F64A 1UCRA 3F23A 3GBQA 2DERA 2BOLA 2F5DA 1D09B 2ZXWH 3IAM2 1FP2A 4HAMA 4UXNA 4YG2F 1MHNA 3E6DA 2HOSA 2FO0A 5DLQE 1FMVA 3CCRA 4BNCA 3TREA 3ABTA 2X0LA 4XKBA 1YIJI 4A3IJ 1ZRFA 2AKKA 4EMKA 2OCCH 4XORA 1Q86C 1A6QA 1OR7C 3SFZA 1R5GA 4XTVA 3I55A 3HOUJ 2DKGA 1WJSA 1W70A 3CCMA 2K9LA 5FKLA 1TQMA 2IEKA 4XKVA 2G9WA 2VN2A 3CCJQ 2ME0A 4RB2C 2WSEE 2V1NA 2FNPA 3JCMh 1JJ6C 2PZ1A 5GAN7 5J8CA 1JKOC 3ERED 5JFRA 1QCFA 1Y0MA 3WG9A 1Y71A 3OMYA 2CQKA 3DKXA 3W2WA 4B6MA 1FWZA 1KIKA 2P0WA 4IQJA 1RESA 4FL6A 5GMKh 3NWSA 4CH7A 1FBQA 2VQLA 4EATA 3K69A 2HCKA 3H0GJ 4UC4A 2M3AA 4BI4A 4KMFA 4NC6A 2A5YB 3IAS2 3CPWA 2L02A 4DZPA 1E2XA 3JW4A 4QIWN 3F8CA 2RNGA 5E3OA 1OZ3A 4MTEA 3CCRQ 4FISA 4AM3A 2WTEA 4F16A 5IOYA 1A35A 2CP6A 1W7PA 2HYJA 5HNHA 3JB9G 2DXBA 4ZTFA 2XDPA 3PVQA 3BZKA 2HNIA 4M3BA 1K0XA 1SRLA 1ACMB 6PAXA 1DPRA 2QQ8A 1W36C 1R4MB 1EJ9A 2YU9J 4ZDPA 1PP7U 4F14A 1R6RA 4PJOA 2CH4A 2XGEA 3DB4A 3I3LA 2HKNA 4NOYA 3Q3SA 5F0CA 4B9WA 3CMYA 2R7TA 5LJ3j 2W25A 3CQZJ 4GRIA 3CC7Q 2FU4A 4IOCF 4DOVA 4DJAA 5LJ5h 4CCMA 3J7ZI 1SD7A 2HL3A 4XR6A 1K9MC 2MWPA 4DEYA 4LDUA 1PRMC 3E2UA 2M0CA 2B8AA 1X4PA 3AT1B 3GZ6A 3BPXA 1HBXG 1R8OB 2K79A 2LREA 3G4SA 5EEAA 1J3TA 5IXBA 3TW6A 4MMLA 2LQWA 5HS8A 5D5UB 4H4KC 3GFLA 2BHYA 2DFEA 1IRFA 5KYNA 2FBIA 3CP8A 4BDYA 3DLMA 1ODDA 1Y6IA 4BJ6C 2PVDB 3L1AA 2R0QC 2AO9A 3QZ5B 2FRWA 1AKHB 1QP2A 1WFWA 2ICWG 2M45A 4ITVA 1GLNA 1TWFJ 2Y0SA 1VQKI 3PT9A 2VE8A 4J9FA 4WTOB 3CC4A 2ZFUA 5DLOA 5F6FA 2LKSA 4NS5A 2DL4A 3HM5A 2MCNA 3CCSQ 3H0FA 3HOWJ 3I56T 2I10A 2QA4I 3IKVA 2EFPA 4XLNF 2R7QA 4AVZA 1YJWI 3G3ZA 2WB1N 2P4WA 5LJ5d 2DA6A 2ZSIB 1PSEA 2EKOA 4NBQA 1XCBA 2H1KA 1ORKA 7AT1B 2GOMA 1R1TA 4AUXA 2F2WA 3FMRA 4GYIA 5TRDA 4BB7A 3G4SQ 4QPQA 4WK8F 3NQOA 3OY9A 1W0UA 5LJ3g 4IHTA 1OPKA 3HG9A 2HQXA 2YRDA 3NARA 2XD0A 5J1UA 1WHJA 2FMYA 1EH8A 1YHQQ 3C1DA 4PSWA 1VQ5I 5D6FA 1ZRDA 1W2BP 2J6OA 2WADA 2DK5A 3QG1A 2K3BA 2EJRA 1PUFB 2O7OA 3ZN1A 1H88C 4ELYC 3KP5A 2L5QA 3KYCB 2FQ3A 3HKSA 2A36A 3JAMZ 3MEAA 1STZA 2CQ7A 4DW6A 3D1NI 4AFSC 3BWGA 2YX4A 2L9VA 1W1FA 4AG1C 1VOMA 5CQGA 3TKYA 1F43A 1VYVA 4OIRF 2F1LA 3DBLB 3FBNB 2Z2SB 3X20B 1D0ZA 4A6DA 2CP2A 2LCSA 3PNYA 4Z89A 2EIFA 2ZPEB 4M77D 4G7ZF 2XF7A 2EA4A 2ZNYA 3HKZN 5IT9E 2P6TA 3QWXX 1VQ6T 4HLXA 5GMKj 5L8RE 3VEPA 5GMKl 1M8VA 2AQFA 4MEYF 2ABLA 3SHWA 1Y8RB 1WH7A 1AU7A 5IHKA 1LFPA 1S1NA 1WI7A 4HPQA 1N5ZA 2JS0A 4OGCA 1CKBA 4KITB 1LPLA 4RTVA 5FLXR 3WTSC 3GTJJ 2QBYA 2HS5A 3OYGA 3KYLA 2K7AA 2M0YA 1JXSA 2VT2A 2RA2A 4P9UA 4QVDA 1ZGWA 5JI6A 2DL5A 1KZHA 2K57A 3QOEA 5FKOA 3B6CA 3MN2A 4EJOA 3S1RJ 1ZGAA 5HS7A 3CO6C 5FLXK 3WTZA 4E6RA 1K83J 2EIMH 1FT9A 1NJIR 4WXHA 1AOYA 2OTJT 2DOEA 3K2AA 1K9AA 2VOPA 3L00A 1PKSA 1ZBXA 1K73U 2L01A 1SFEA 4AG2C 3EG9B 1F4KA 3IQLA 1JEGA 5D5WB 1ZG3A 1Q81U 1M90C 1QVPA 4A63B 2BY0A 2UV1A 3KZYA 1E6HA 4XTWA 2NUTA 3EFSA 2R93J 3RMQA 5CQXA 3JCMg 4E6KG 1DQUA 2COBA 4ESBA 2LQKA 2YSQA 2KP6A 3HEFA 5FD6A 3C2HA 2B86A 1W5TA 1YG2A 3QYHB 1KQ0A 4OMPA 2W85A 4YIRX 2E36A 3S8PA 4JRQA 3A2KA 4ENKA 4LOCA 1JKRC 2R7XA 2BUDA 4QLCU 4RGRA 4ANJA 1IUFA 4IRIA 2FYKA 2KGTA 3HP9A 2VBYA 3QDRB 5IT3A 1R77A 2P4TA 1UG2A 1NZ9A 2LNVA 1PC0A 1AHDP 2YRCA 1KQSP 4GGGA 3LYIA 1O75A 1DU6A 3LH5A 2F6CA 3FMQA 4C8QF 2C06A 1ETVA 4D6WA 4S04A 1T33A 4BHBA 4EMSA 3ZRGA 5F08A 2MVTA 5EEHA 4CCNA 3J81R 3JRGA 1AA7A 1O4XA 2MW8A 2IW5A 1R36A 2QQBA 1C6VX 1J0RA 1W5SA 2GA2A 4FU6A 1O7LA 4L9NA 2A37A 3MCAB 2QF7A 2PUOB 3H41A 3OYKA 3SZTA 1B72B 5J4YA 2KISA 1UHFA 2CYYA 4PJOE 1OYWA 3RYPA 1KQ9A 1ZLMA 2BBYA 3HHGA 4RTZA 2WY7Q 5LGUA 2PUKB 5E3LA 5ICGA 2W00A 1I27A 3LFUA 1YCSB 3BFMA 1MMAA 4HOBA 2JT1A 3M4GA 4J9GA 3PMTA 4QPOA 4N4IA 4XTXA 2EYYA 3GLXA 1Q81C 2KXCA 2JA2A 3R6NA 1YI2T 3OBYA 1VQ5T 3DPUA 1OFCX 3R4KA 3REOA 2E5ZA 1O7FA 4D7MA 1RRJA 2P8TA 3GF5A 2DJZA 2ZMEC 1MSEC 1YJ9T 1FYKA 1GL5A 2M1BA 3RCOA 2RK2A 1IN5A 2MABA 4CDGA 3S2DJ 3X25B 2BVMA 1O3RA 4G7OF 2QDYB 3GMEA 5LEKA 1AKHA 3CCLI 2DILA 3P8BB 3CCVT 1QLYA 2A28A 2HYGD 3RQ4A 3BPVA 5FLMJ 1YIJA 1JU5C 2Q0OA 2QYOA 3PL8A 1FIAA 2KJBA 4C92A 4JS5A 1X01A 1WX6A 3A1PA 2KK4A 3L1PA 2EFQA 3ZMZA 2MD0A 4GYGA 2MUNA 5C4JJ 4EPCA 1KC8U 2KYMA 4BQAA 2CH4W 1TTYA 4R56A 4DYRA 1P9QC 3RTRA 2QSFX 1WPYA 3QWYA 2G7UA 2BXZA 4JBAA 1WA7A 2MF2A 4J9DA 1QNTA 2R7OA 3BCAA 2RQTA 5LL6S 5CR2A 5GAN8 2QQ9A 2X3WD 2NXNB 2K9NA 5EG0B 3HDDA 1OEBA 2ZXHA 3PNVA 4KNYA 3DTEA 4M78D 5EC7A 4HV6A 1LNWA 1RKTA 2O3FA 3QODA 4RTXA 3CD6A 1Y0NA 2LOOA 1MD0A 4FM4B 4XU1A 5L3DA 5JR3A 1BK2A 2YUNA 4U88A 4HA8A 4IRGA 3PGGA 1Z9CA 2BW3B 3LSTA 5CLSA 4Y13A 4CC3A 1U3OA 3EETA 2J6KA 2KMUA 1R71A 3J7AF 3V7RA 3S1MJ 3VSLA 1VQMQ 5DCFA 4A12A 2W48A 3HOZJ 4A54A 2FZCB 2H6BA 2RN7A 4M77B 2LYCA 4PJ0C 2JM8A 2X4JA 2EK5A 2ME6A 5FU6C 1ZG5A 3J80E 3E97A 4UNOA 4PJMA 1OYIA 3HSFA 2QKLB 4KGZB 5E20A 1LDJA 5FLXZ 1WJQA 1YE9A 3E1SA 2XGDA 5GAOq 1GBRA 2JA6J 2DX1A 2COMA 2FA5A 2XG8D 3CD6Q 4UV8A 3SFMA 4OU0A 1QHHD 2L9RA 2V6EA 4ME7A 1KONA 3A8LB 4IUUA 5CK9A 2CW0F 3VSKA 4FE4A 2QLZA 2LJ3A 1VQPQ 3CC2A 5D5VB 4Z6YA 2O2OA 1ZKGA 1JUMA 2RHYA 3HUGA 3LSKA 1M27C 9ATCB 1KYWA 4HSTA 4D0PA 5HDKA 2M0MA 1Z7LA 2FZGB 1K6OA 2QK0A 4L5GA 4L9VA 2R5ZB 2DYSH 5CCAA 2H8RA 4M3EA 1X6GA 3MO8A 2QA4A 3C0CA 1MZBA 3D0SA 2DJIA 2B63J 2A5WA 2JWTA 3BLYA 3ZMDA 4KFCA 1RLPC 3G71Q 4MZMA 3K4MA 1JT6A 3U1DA 5FU7B 1XX5A 2X1DA 2XI9A 1W2BA 2E4HA 4PJOF 1F36A 1FLIA 4LK0F 1RACB 5F04A 1RL2A 2VJ4A 3WE2A 1TUDA 2SEMA 2OU2A 1UECA 1FC3A 2JJ9A 1BR1A 3K4LA 3H9NA 1SVLA 5BS6A 3GNGA 3L2CA 2LDMA 2BHZA 1B07A 3DB3A 3RDVA 4I6ZA 1XGOA 4YIFA 2R92J 3ZMTA 3J81Z 4FCYA 2RQVA 1F9NA 1IC8A 4MQVA 2DK8A 4Y15A 3TDZC 3V8LA 2EQJA 2YPRA 1JXMA 3DKYA 1K76A 1ZSGA 4LD6A 4XLHA 4UUSB 2M51A 2FX0A 1W6XA 4HLYA 3CCUA 1S72T 4LIVA 3NTIA 1LDKB 5LJ5f 2Z16A 2MLKA 3BZ6A 4DGWB 2UWMA 3TU4K 1V54H 4UVAA 5ECAA 1M2VA 1QA6A 4L5EA 2HQEA 4XU2A 1HW5A 4N9IA 4F7UB 4KN7X 1EIFA 4GXOA 3WTXC 1R4NB 2FNAA 2HVSA 2J05A 2D1HA 2MPXC 2LBFA 1WSUA 3S14J 2JSCA 3NGPA 4IIOA 1JJ2A 1OMIA 3O3KA 3S3OA 1W4SA 1TQPA 1UJ8A 2DMQA 4ZC3A 1Z91A 2OTLI 2M4GA 1JO8A 4EVIA 1AD5A 2DYRH 2PN6A 2O9SA 2CFXA 3OS2A 4ENMA 3DU5A 2VPLA 3SZPA 4BEHB 1SRMA 1XOVA 2J6FA 1FSEA 1RAEB 4AVPA 3O5ZA 2ED0A 1AWWA 1VNDA 2P5KA 1A6IA 1VQLT 2Y9YA 2BY1A 2LMDA 2W57A 2LR8A 1HYOA 3LNQA 4LIUA 1VQNI 2W4SA 1TZLA 4NC8A 1YYVA 5BNGA 5KE2A 4AYBA 2O88A 1WRJA 4O3MA 2DTZA 4BH9A 3CXCS 1TTHB 4RKUE 4M7DC 4Q5SF 4GDFA 1X3WB 4YTLA 1UAAA 5IYDJ 4F04B 1K9MU 4I76A 1IZ6A 4J5YA 3CMAI 1OCRH 3DXJF 1VQ7T 1A0NB 2EFWA 2IT0A 2DE0X 4C5EA 1D1AA 2JA7J 3F9KA 3QPTA 1ERDA 3MZYA 3FXQA 2EVRA 3QYEA 4I02A 4PL6A 2E1OA 1JGGA 1IUYA 5LHHA 2YUSA 2EYQA 2KXDA 3OSFA 2E7WA 2FL7A 3CUQC 5IOZA 1O3QA 1WZ2A 3DLAA 1AWCA 5FD5A 4LB5A 4IUVA 1Z1DA 2FPEA 4G9YA 3CJTB 4B3AA 1IAWA 1RUOA 4M78B 3CC7I 1M1FA 2KPMA 4R55A 3S16J 3CCJI 1LDDA 3SWNC 2D0NA 3NMZC 2KZGA 3ZR8X 3ZCOA 2OPTA 1SVOA 2X6YA 1FXXA 5EG0A 4U0YA 5IYCJ 2F5VA 1BM9A 4M75D 4F3QA 4ESJA 4IURA 4LLLA 3OYYA 2XUBA 2DVJA 2HKXA 4NNJA 2CG4A 2KT0A 1WJFA 4V2GA 4L6V5 4EMKC 4F92B 2DT5A 3UF4A 1H89C 4HX4A 5JLWA 4E70A 4JLGA 4M4ZA 1QVGS 1YS6A 4DOWA 4TV7A 3CCQT 1BR2A 4ON0A 3A98A 3EGXA 1VA7A 3CBOA 1E7OA 2JW4A 1M1KR 2K5FA 4LG0B 2NVYJ 2LKXA 5GAN3 1MH4A 1YO5C 1WJDA 1IO2A 5BQTA 5A2QK 4M77A 3PUFA 2JTEA 2M87A 2YRVA 1K79A 4C0ZA 4PJOG 4V2FA 1TH7A 3INZA 4FYVB 1KYZA 5LJ3e 1LFBA 5GANj 5FWCA 1ZHIA 2V6CA 4N4OB 2EBPA 1X1PA 1ZG1A 3GFIA 2YXYA 1DP3A 2YUPA 5KCHA 2O0YA 2JZYA 4B43A 4QVCA 4M6YA 2PX9A 3VYHB 3CMEA 1QGPA 2IRFG 3PE0A 3LSHA 1BL0A 4XIDA 3GTOJ 1KFZA 4YFNF 3BG5A 3HTUA 4EJTA 4OIPF 2EGCA 5EZGA 5FFXA 3BROA 4XLPF 1NPRA 2EZHA 1T3SA 3K6GA 1SFOJ 2JUCA 1I3QJ 1QZZA 1SMYF 1TWBA 3LH0A 3FKIJ 4F55A 3H92A 5IP7J 5E79C 3GF2A 4A0XA 2ZNZA 4D5FA 4N0AA 5GAMh 3WTYC 1TC3C 1VQ9T 2XAJA 4J9IA 1SVMA 2UZKA 3O8HA 2STWA 2KIUA 3E6MA 2LFBA 3E5QA 4O5VA 1RC9A 5EJCA 2EA2A 2IGMA 3TCJA 2KQRA 2XB0X 3DV8A 3RSNA 3IL2A 1Z77A 3R0AA 2AT1B 5A0DA 1TUCA 5CVUA 2QASA 2H3EB 3N5BB 1I0CA 1SEUA 3MHXA 3UKGA 2R58A 5CQEA 5I21A 1BOAA 1M30A 3ZQGA 4QVZA 3A4CA 2NWMA 3SWNB 2CZ0B 4JZ4A 2R4GA 4OMFB 5GANg 2G0EA 1ETQA 1TW3A 3FM3A 1BW5A 2MMPA 1NEBA 2NUPB 1TT5B 1M90U 4RCBA 4L0ZB 4NQWA 1WJCA 4BXFA 5GAGJ 1YX3A 4KIFA 3S15J 2EQMA 3OOPA 3TEEA 3N05A 3I59A 2A6EF 3RKYA 4UUSA 1LEAA 2ZB9A 1GDTA 2RNAA 2PNIA 1VQOI 3OSVA 4QKUA 3T1BA 2HAXA 3A1YA 2FOKA 2M30A 2RQRA 2DXTA 4N0BA 3N4MA 3OYBA 4DBRA 5K5OA 2D5VA 2WC2A 2HI3A 1UMQA 1QCNA 2ZXIA 3G1MA 1M1KU 5A0LA 2BGCA 5FROA 3F8BA 3JSPA 2W7NA 1HKTA 1PHTA 4LXCA 3UATA 4F7UA 5HODA 3HOYJ 1VZ0A 5KYYA 2QSGX 3QBYA 2EBIA 3CESA 1LPQA 2RMOA 2VGMA 2VE9A 1J75A 5HNFA 2VODA 2M7AA 2K7LA 3QO3A 4QQGA 3CLQA 5CIUA 3X24B 4EGZA 2ED1A 3C3WA 3CCEA 2WAQA 4C3IJ 1J2XA 4OB1B 5TGTA 5GMKe 4D9JA 3LAPA 5M9OA 4UB6C 2YDLA 2L7FP 3IUOA 2E1CA 1T3LA 1S8NA 2X3XD 2K5IA 1HD3A 3JCUC 4XONA 1B4AA 3FMSA 4KN4X 2A07F 1EFNA 4RCCA 2GM4A 1TWGJ 4M7AC 4LUEA 1OU8A 1RAAB 4B48A 5LD2C 2P0PA 2GF7A 2L3RA 3FDRA 4EIKA 3Q5FA 3QDFA 3K7AJ 2KMTA 5K1YA 4B09A 1OCPA 2GOXB 3CCRT 2HZTA 4U7BA 1U5TA 4R1HA 1G3YA 1G4DA 2OQRA 4J9HA 4C0FA 4OAZA 3PQKA 4BL0B 2HVQA 2ZKZA 1V1CA 2L3QA 4OP0A 4HW0A 5H20A 2VPRA 2DLLA 1X1AA 3L7WA 1APLC 2NVXJ 1IRXA 4XNFA 5GTIC 1SEMA 2CUDA 4YFXF 1NYFA 2LD5A 3CQTA 4CICA 3KYDB 2A3SA 3K70D 3UT1A 5LJ5e 5EF6A 1WHKA 2QVOA 5DCMB 5HLIA 1SSFA 3CCEQ 2M5WA 4DEXA 1VQ8A 1VQ4A 2A6TA 1RR8C 5IH2A 3FBIB 5M3FJ 4C30A 2UUZA 4I01A 1Y96B 2K4YA 1XPXA 4E7HA 2XGXA 4M75B 4M78A 4UVBA 1TWAJ 1FYNA 1RAGB 2CDTA 4EJVA 2ACJA 2GWRA 4XKCA 2EWNA 4X6AJ 3VS5A 4ZDLA 2FZKB 1BU1A 1TL8A 5DM7F 4FTHA 1D1CA 4G12A 2XASA 4QT7A 3ASOH 3CDLA 2PFBA 2L4MA 3V42A 2X4WA 5GAMj 5IYBJ 3T8RA 2BE7D 4J6YA 3IV5A 1ZELA 3FLGA 1YHQT 1O3TA 2ZAEA 2ECBA 3MP6A 3A8MB 2E6NA 4Z2YA 2BTTA 2CT4A 3PFSA 3CCST 3GBGA 1JKPC 1AZGB 4JQFA 1OCTC 5D4SA 2FVUA 1K78B 3A5ZB 3RR6A 2QEXQ 2E10A 1FTZA 3M8EA 3TDUC 1R22A 1XDUA 4P96A 5GAN5 2CS3A 3FXUA 1VQ4Q 1YJNQ 2GGRA 2DO7A 1M3AA 2K2VA 2OTLA 2P7VB 1OOTA 3BR6A 3EAEA 2ZPGB 1NG6A 3QOPA 3MZ8A 4C2TA 1JTYA 4M77E 3H3ZA 1ZA1B 3G4ST 1EV7A 5J6XA 4ABZA 4A3GJ 3I56I 2G6FX 5HCKA 3SB2A 3V7CA 3AKZA 2JVVA 5GTHC 1H0MA 3SQNA 1GT0C 4UB8C 1N6AA 3PIOA 3F8MA 4BY6C 2MSYA 2L7ZA 2DYIA 1KHIA 1EKEA 1B8IB 3EDPA 3BW1A 3OSSC 1W36D 5LJ3d 1VQNA 3EH1A 2YHTA 2LT1A 3C95A 1IJWC 5CVVA 2TRTA 4CHUA 1G8XA 3Q9SA 2O8XA 1K4TA 3M4OJ 3FK7A 3WHCA 1JRIA 1C0WA 2CS7A 2CZ7B 4RLQA 3TOBA 2C0IA 2KAFA 3EGDA 1DP7P 3OMCA 5HK3A 2E12A 3JTHA 1P6RA 1YS7A 4B47A 1QVGP 2LC2A 4BUPA 1J5YA 3CMAA 3G1OA 1FJLA 4BBSJ 3MPUB 5FW9A 3G6EQ 1KU3A 4CC2A 3UNGC 3VYTB 5GAMg 3QYFA 4P5NA 4JZ3A 5E3NA 5B1BH 4HNUA 5M3MJ 2CSQA 2OAZA 4CI0C 4ESFA 4I0BA 2PI0A 2DA9A 4FSSA 1FOXA 1G3WA 1XD7A 2TCTA 2LMJA 2RJCA 3DWLE 2XHKA 2BZ8A 1HSJA 2AHQA 1VQ8Q 3LSRA 1CF7B 3GTMJ 4C8QC 1QRYA 2VBWA 2XAGA 1XQHA 4HCCA 3ABMH 3DEEA 4PDKA 3LSJA 3TO6A 3X2QH 1UJ0A 5L3CA 3P7NA 5IT9K 3VS7A 5EGOB 1B34A 4F52A 2GIVA 4LN2A 3OA6A 2E35A 5F1RA 2K4BA 1I6HJ 1XDSA 4XSXF 2X48A 4LDYA 1VQ6I 2WSCE 1RPWA 1H92A 1GV5A 3SEZA 1ZSZA 2NUPA 4C92C 5AIPA 2E60A 1GVDA 5DV5A 1QU3A 2CP0A 1O57A 3KZZA 4FE7A 1I50J 3TO7A 4DOZA 4A3CJ 4A5NA 2P4RA 3VUBA 2HDAA 1IXCA 5FLVA 1RKWA 1V5FA 1Z0XA 2RHZA 4JRIA 3VS3A 2HDWA 2M34A 4PFOA 3JRFA 4XRFA 1ETOA 1IN7A 2EZLA 1T2KA 2LVMA 2Y4XA 4P9FA 3A03A 4C0DC 2HU9A 2XPWA 3E9FA 4VUBA 1BR4A 5J1YA 4G6DA 1FY7A 1MW7A 2KDOA 3WU1B 2Z3YA 4I7HA 2KT8A 2XF5A 1OCCH 3LSIA 4IHSA 1GCQA 2PMZN 4JPBW 3CJQB 3OOUA 4PNOA 2ZPHB 4B3XA 4F7UE 3I55Q 5B3SH 2DZCA 2OTJI 2XU8A 3CCMQ 3HSRA 1NH3A 4HF0A 3JCMd 2RQUA 2K40A 4BU2A 4XM3A 4G8XA 3GW2A 3GLLA 4D5CA 3W6KB 1YITA 5HVQC 1A5JA 1RAIB 2HSEB 2XDBA 3P9KA 3Q0UA 4BY6B 4OWRB 4OB2B 4C2MJ 3L2UA 1T98A 4X0GA 4UUTA 3URGA 2QCOA 1MMSA 4BJTA 4RMOA 4LB6B 2VYTA 5FGMA 2VJJA 1FZPB 5KAIC 2R57A 2QWWA 3OS5A 1FEXA 2KLOA 4G94A 4ASNA 1I1SA 4CCOA 3WGGA 3CUOA 1R0BG 1S7EA 5GAOm 4IKFA 2MIOA 2ZBKA 2DA5A 3FF5A 1YBYA 4KT5C 2HEQA 4DBFA 2D45A 2DM1A 3LLRA 3VB2A 3HFNA 1HKSA 4HX7A 1M4ZA 3M0SA 1OV3A 5GAOp 4M77F 2EIKH 2KR3A 3KIOA 1Q1VA 1ETXA 3MEXA 4L18B 3VS6A 4JJNK 1E0EA 3PUBA 4BJ5C 1YLFA 1E3OC 1RADB 3A8OB 3TQ7P 3C18A 2DFFA 5DCMA 2I8DA 1NG7A 4BD3A 1YITQ 4RB0A 3ECOA 5DY9A 2CRGA 4HT9A 2VBXA 1K4SA 3M56A 3MEUA 3TOAA 4Y7NJ 3EUAA 1KK7A 5CKHA 3TSWA 4IHYA 1WVRA 5E3MA 2F2VA 1OKRA 4J9CA 3M0UA 4M78E 1JQQA 5J1RA 2O6GE 3EG1A 1OZ2A 3JR9A 2B0LA 2ID6A 2KHMA 2JNGA 2VKNA 3LX7A 4XU3A 1VQOA 1X43A 2DXCA 2VC8A 1P4AA 2M9UA 3OW2S 1X2MA 2DYBA 2W24A 1CQTA 1TW2A 2LCCA 3QUIA 3CC4Q 2PQWA 3RI4A 1ONVA 1YI2I 4RAYA 1PDNC 2JA5J 3PM1A 2Y0MA 4M6VA 2STTA 2Y90A 3I58A 2QSHX 4IHVA 1YP5A 4CGZA 4BDZA 4UY8I 1WQ7A 3G1LA 1WIEA 4IQ4A 2FD5A 4BHCA 3LQRA 3TEDA 1YJ9I 2J06A 3KBGA 3LSGA 3HOTA 1BCOA 3HRUA 2R5MA 3CBPA 3CCVI 2F5TX 4AFZC 1OJLA 3ULQB 1MDMA 2A7YA 2KE9A 2M8GX 4HF1A 3OYNA 3JAME 1UHMA 2WV0A 4Y17A 2J7IA 3SD4A 3PSFA 4Q48A 1Y7XA 5FKKA 2SRCA 3W2AA 2GCXA 1Q1HA 5EEGA 1DPUA 1BKBA 3JRHA 1S6LA 4ZH4F 3BG6A 5DUKA 5LFAA 4EGYA 2RKHA 3TGNA 4GLMA 1SAUA 3AL0C 1K1ZA 1W4MA 3BQZA 1QHGA 1ZHFA 1HLVA 3MP8A 5GAN4 2DTIA 3M0QA 4OB3B 3HBLA 3V8JA 4C9YA 1HQCA 3AHUA 3OWTA 2XPVA 3GZNB 2CUEA 4HEA2 1U1TA 2XC7A 2GBQA 2LQ8A 3IWZA 4J9BA 5IXFA 5ILUA 1R58A 1IRGA 3P8HA 1VQMT 2CP3A 3CXCA 4X9CA 1K7AA 2CP7A 3KP6A 2KEAA 3LGLA 3HRMA 1GFDA 1D0YA 4QWQA 5D8LB 5B1AH 4KA4A 1PD1A 4E7SA 3M55A 4YFKF 2F48A 2DMUA 2HPMA 1WDXA 3GVAA 3PFIA 2QYZA 4F7UF 2D6FA 3RIRA 3H1CA 2EQRA 4FT8A 2R7RA 1B6AA 2X4YA 4YRVA 3J80R 4GCVA 1GXIE 5IAYA 3RNJA 3QU6A 1BC7C 2DK3A 1M2OA 3I0TA 3K4NA 3SDGA 3IH2A 3CD6T 3RPQA 1CF7A 3FIWA 2XKOC 3WTUC 1WXBA 3J80K 2H09A 2GBYA 2DA2A 2OCEA 1I81A 1Z9ZA 2DLPA 2F2XA 2XRLA 3MZHA 5LLQA 2ZCFB 2E34A 3WHBA 2JOYA 3D5SC 1VQPT 4RA2A 1HDDC 5EGOA 2NLUA 3KX2A 5K7ZA 4LDVA 2E2HJ 3JCMJ 3QPSA 4J00A 1BYMA 3HSEA 2L7KA 1ZUKA 1W5CC 2EZIA 3O2PE 4PGGA 1M1KC 1IV6A 2O8KA 1ETKA 1PUEE 4Y3OA 1VQ6A 2J5PA 1CKAA 4RDUA 3HB9A 2LY9A 2IS4A 4IF4A 1CSKA 2E1HA 3M0RA 1VF9A 3G71T 3LWHA 2EPDA 4CC4B 3L09A 4OIQF 2RHXA 2ZJQF 2KBTA 1WHUA 5HDGA 5E17F 3SJMA 1QVGA 2FBKA 4Y92A 1WI3A 1D3BB 3J7AW 3S1NJ 4AC0A 1U1SA 3RZDJ 3KCCA 2L3PA 4IIMA 4M77G 3I56A 1DGRM 5L3GA 4PLIA 4A3LJ 1P4WA 5GJVB 3WODF 2AQEA 1I4K1 2RF0A 5D6YA 2LG4A 3ONQA 1LFUP 2K9QA 2IS6A 4OMMA 1IN4A 3CC2T 3GYHX 4M78F 5L3EA 1ZX6A 3HYIA 2F5FA 2EYXA 1MNDA 2HDCA 2CSOA 3CJRB 1PWTA 1DUXC 2NVUB 5KYUB 2AXLA 1X75C 5GAOr 1X2NA 1T0FA 1PRLC 3FHNA 4A53A 3IKTA 1AHJB 3QP5A 4QW2A 1USTA
chains in the Genus database with same CATH topology
2VT3A 2R5AA 1NJIC 1S7AA 3BJAA 3EYIA 4HQEA 2XV4S 1QPMA 2NNYA 4LD9K 3LA7A 3R61A 1HW1A 2L8DA 3V7SA 1EH7A 5LJ3f 3GO5A 2BE5F 4XBFA 4N9HA 2O4XB 1UHWA 2EAYA 4UUVA 3K0LA 3K1MA 4A5MA 1QW1A 2QTXA 4EMGA 2ZPIB 5DYMA 2LC4A 4RG2A 3CCUT 1VQ6A 4PGHA 4FHTA 2QUFA 1XSXA 2HTJA 2D9TA 4DA4A 3WTVC 5AYFA