1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
b'LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
molecule tags Gene regulation
source organism Corynebacterium diphtheriae
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
2YU3A 2DBBA 1HSJA 4BH9A 2IA2A 4OIRF 5KK1A 2OAZA 3ZN1A 2X4HA 2RGVA 3TKYA 3E6BA 4RAZA 3WU1B 1FP1D 1MJ9A 1KQ9A 2HOEA 1OKRA 1YS6A 1IZ1A 3IKVA 1ZRFA 2BV6A 2CW0F 3KCCA 2NNNA 2P5VA 3DQVC 2MC3A 2UXNA 4RGRA 4RGXA 4M6YA 2FU4A 5JI6A 5D6EA 1FNNA 5H20A 1ODDA 3MZYA 3T8TA 2D1VA 2HZTA 5CJ9A 3TQNA 1FPQA 4HF2A 4FX0A 2B0LA 1P4AA 1V3FA 3H92A 5DUIA 5ICEA 2P7CB 3FZVA 1BN5A 3JW4A 1BC8C 3T1BA 1LDJA 1KU2A 1GVJA 2QQAA 1RUOA 2GZWA 4KMFA 3MZHA 1O7LA 2YX4A 3I59A 2VE9A 2FE3A 4WCGA 1HW1A 4O5VA 3S2WA 4B8XA 2BYVE 2IRFG 5HDKA 3GFJA 1U8RA 3VODA 4XBFA 1XCVA 3K1PA 1WKMA 1B9MA 2XUBA 4G7ZF 4U7DA 4UNOA 1U6GA 4ZYEA 2ETHA 3H3ZA 4IXAA 3FWEA 3KP7A 5HS8A 2STWA 5F1RA 1E17A 1ON2A 1A04A 2O03A 4NB5A 5CYVA 3LWFA 3M8FA 3FMSA 4FHTA 1YFHA 5BOXA 2QM3A 3H3UA 1F5TA 1R58A 2X0LA 2K86A 5JHUA 2VC0A 1G3SA 1U2WA 2GXBA 3BY6A 4ZZLA 3DKWA 2QUFA 4M72A 1PP7U 3FHZA 3RKYA 1YW9A 2VT2A 1TQIA 3JAMK 5LHHA 3HSEA 3ABTA 3RKXA 5L3GA 5AONA 3ZMVA 4OMYA 1O3SA 1MDMA 4A2UA 4EJTA 3DPLC 4RS8A 2CGPA 4ENMA 4KNYA 4WXDA 3T0YA 3RJPA 2KIMA 3TO7A 3GX4X 1O3QA 3LAJA 4M74A 2O6GE 3NQOA 4ESFA 4LLGF 2EK5A 4IF4A 5FB2A 4YFNF 1VTNC 1SD5A 2W85A 1LQ1A 3HSRA 4HA8A 1DP7P 1JGSA 2E1NA 1STZA 5L3CA 4KIGA 1S6LA 4MTDA 1TNSA 2VXZA 3HRTA 3IC7A 2QZ8A 2DQLA 3KFWX 3E5UA 3SZPA 4EM1A 2GA2A 1S8NA 2FQ3A 4CGZA 1HQCA 5HDGA 3GUDA 2XAHA 1J9IA 1I27A 2VODA 2MLGA 2VBZA 4UVAA 4WXCA 1TNTA 1HXDA 5CVVA 1FOKA 2ZBKA 4WX9A 3V8KA 4KN7X 4N9IA 2A68F 5DV5A 3VFZA 4R1HA 1OR7A 4G9YA 4O6JA 1BI1A 2FBHA 2W57A 3P9KA 1SFUA 2A6HF 1U78A 1B59A 2QQ9A 3GXOA 2E1CA 1E2XA 2A5YB 4KYWA 1WI9A 3M8EA 1RNLA 1QO0D 1NHAA 1IN5A 1FSEA 1S3JA 1K78A 1R36A 3RDIA 4ESJA 1B6AA 4CDGA 3JSPA 3TOAA 2M45A 1T0FA 4RB3C 4LB5A 1SAXA 5LHGA 4Y17A 4A0XA 4MTEA 1D5VA 1ZRCA 3R6SA 1ZARA 1GXPA 2OBPA 3I58A 1LDDA 3IRRA 4CZZA 3RPQA 2L01A 3GZ5A 5ILUA 2RV8A 3JAMZ 1P4XA 2Q2EA 3CO6C 4EM2A 3MWMA 4ENJA 1W7PB 3ERED 3DV8A 1UB9A 2CG4A 4HLXA 1HW5A 2KKOA 5DCMA 2K5FA 2PG4A 5FLXZ 4I01A 1MKMA 3BJAA 2DK5A 3GEZA 3TO9A 2E7WA 5HOOA 4MEYF 4JK1X 2KIFA 3L2CA 4M9SA 2AS5F 1G3TA 1K6OA 4OINF 4HOBA 3WTYC 2GXGA 2HFHA 3J80K 3J7AO 4P5OA 4D0PA 3EDPA 3KETA 3EUHA 2FNAA 1R23A 4L9NA 1FBSA 5ICFA 1XSXA 3ZP5A 1FWZA 3HRSA 1C0WA 4MGRA 2L3DA 4EM0B 5BS6A 3NRVA 1P4WA 2H6BA 4ZH4F 4HQEA 4R79A 1SD7A 2OQRA 1JXSA 2VC1A 3EQLF 1EH7A 2EFPA 4P96A 2K4YA 1ZYRF 3HRMA 2QBYA 2ZMEA 1SD4A 3WTXC 1Z6TA 5BPDA 1ZG3A 4EJVA 5BQTA 2Z5UA 4G7HF 4ZZDA 2CYYA 4KICA 1R1VA 1FBQA 4PCQA 2XAQA 4NQWA 4L5IA 2BE5F 4AIJA 4FX4A 3KLOA 5LHIA 5BMZA 4BXUA 2CO5A 5LEJA 2GWRA 2P5LC 2YR2A 3HOTA 3ZMZA 4EJUA 2KJCA 2LSOA 2M8EA 2EV6A 4LLLA 4L9VA 3V7RA 4EGZA 1QZYA 4P55A 4B09A 1DPUA 2RDPA 3W6KB 4LG0A 1RZ4A 4Q4ZF 3FX3A 4CHUA 4RGSA 3V8JA 2VBXA 3KP6A 3O3KA 4GGGA 5LRSA 2VBYA 1TW3A 5F6FA 2FRHA 1Z1DA 4M6XA 2IW5A 3L7WA 3BWGA 3KE2A 5E1WA 2HDCA 2FA5A 1G3YA 1YIOA 3NEUA 2CQKA 4QWQA 3WODF 2FF4A 5LRRA 3Q9SA 1TLHB 4L9JA 2E7XA 4OIQF 3MEXA 2XROA 4YIIA 4LK0F 2CSOA 1YQAA 3JSOA 5ICGA 5AIPA 5H6QA 1J7KA 5K5OA 2V79A 2ZCWA 2EFWA 2TDXA 1W4MA 4G6DA 1EH6A 2DT5A 4HF0A 4K2EA 3HHGA 2GIVA 2F2EA 4KT5C 3LFKA 3RKWA 1IAWA 4M71A 4ZYGA 3GYHX 5LGTA 5K5QA 4U7BA 2P6TA 2DO7A 4IRHA 3E3VA 2FBIA 1S7OA 2P7VB 5A2QK 4L0YB 4PGGA 4ZYDA 4M9ZA 3L00A 3EETA 1YS7A 1SD6A 1JHFA 3BJOA 4AD9A 3F72A 2L54A 1AWCA 4A6EA 4YFXF 5ILSA 1W7PD 5L3FA 1F4KA 1XGMA 2XKOA 3DFGA 1QPMA 3WG9A 1J2XA 5JR3A 1HKQA 3Q5FA 3CLOA 4BHCA 4WWCA 1L3LA 2K27A 2FBKA 2KIUA 1BOAA 2VT3A 3U1DA 1MJBA 2A61A 2FXAA 1HSTA 3Q9VA 3VEPA 3FMRA 2DPUA 2DQRA 1R7JA 4Q5SF 4PZJA 1CF7B 4TV7A 4U0YA 1K78B 2P8TA 1WQ2A 1QW1A 3KP3A 5LBQA 4G94A 3ZMTA 4I09A 1XDSA 2HS5A 1FYLA 3F6VA 2XIGA 3KZZA 3P9CA 2EA4A 3V8LA 3N97A 1FC3A 5D8LB 2F5DA 3RI4A 1XGSA 3BDDA 3GWZA 1CF7A 2WC2A 2GAUA 1D8KA 2O8XA 4HDUA 2M5WA 2LX9A 1FSHA 1R5GA 2D45A 2YPRA 1H0MA 5E8GA 4HX4A 1WWXA 1QZZA 1X3UA 5BPIA 2EV5A 3HOSA 4GO1A 2W25A 4WK8F 2QYOA 5A2QZ 1Z6RA 2H6CA 2QLZA 5LEKA 2R7FA 2O3FA 2OU2A 1SMYF 3DXJF 3F23A 4BHBA 4MQ9F 3CTAA 1J75A 4LK1F 1TTYA 4ENKA 2A07F 1ZGAA 1ZAOA 4Q48A 5HVQC 4KFCA 1YLFA 1F9NA 1XGNA 4RB0A 3PQKA 2OZUA 1KU3A 3D0SA 2MBFA 1PUEE 4A6DA 3T5XA 5J8CA 3ML6A 4I0AA 2BGCA 2H27A 1IN8A 2HYFA 4JBAA 3F8MA 1LVAA 3R60A 1Z9CA 4AWXB 2V9VA 4Z2YA 4EGYA 3BZ6A 3CJNA 1LJ9A 4DQ2A 1YW8A 2PN6A 3WGHA 2XAJA 2EWNA 4KUMA 2RNJA 3LQRA 2EV0A 1I1GA 3JTHA 5DEQA 3F8CA 2VBWA 1TW2A 3MQ0A 1SFXA 5HS9A 1IXRC 2RQPA 2XHKA 5E1XA 1IRFA 5DD4A 3PFIA 1OYYA 4AIKA 2NS0A 4XSXF 1IXSB 1WSUA 5LGNA 1T39A 2A6EF 3WE3A 3HTUA 2MA3A 1S29A 4ESBA 2H09A 5TJJA 4UVBA 2ZNYA 4LG0B 2ZJ2A 5E8IA 1USTA 3QAHA 1UHMA 1TQMA 4XLNF 2FMLA 4Y15A 3B02A 3RPUA 1K79A 1QBJA 4HBLA 4ENNA 3QOPA 4EQQA 2M30A 4BYYA 2OD5A 3TDZC 5HLIA 4A5MA 1LEAA 2XASA 1YO5C 3G73A 1FYKA 2K5IA 2MH2A 1K7AA 2A69F 3K69A 2ESNA 3RYPA 5IT9Z 5FD6A 4IVNA 3ZN0A 2JPBA 1W5TA 2IPQX 2Q8KA 3E5XA 2KJBA 5IT9K 1O7FA 2GQQA 3WTSC 3L09A 5EEHA 2EFQA 2H94A 2K4BA 5J8FA 1LNWA 1XN7A 3ZMDA 3MFKA 4IJAA 3MAJA 4ON0A 2FNPA 2OQGA 3J80Z 3SZTA 3QP6A 3QPTA 1EV7A 3GO5A 5ICCA 3I4PA 4LGWA 1QQIA 5CVUA 5E18F 1AOYA 2PI0A 2JSCA 1P2FA 3I59B 1IXCA 4HX7A 2H3JA 3MCZA 3LAPA 1KQ0A 2F5CA 2DLLA 4KA4A 2RC4A 1XMAA 1XSDA 3IL2A 1IN6A 2LDUA 3HRUA 4IPAA 3QRFF 2DK8A 1ONVA 5F64A 3ELKA 3GLXA 2DI3A 2D2WA 3WU0A 3WTTC 5HDNA 1ZLJA 3T8RA 4OMZA 1XDUA 5D6FA 1P92A 3M7GA 3F8FA 1ZG5A 5J6XA 1FYMA 4A12A 1GXQA 3W6JB 3GZ6A 2ZO4A 3REOA 3FXUA 1BI3A 1ZG1A 3G3ZA 2P4WA 1JHHA 2ZMEB 2OA4A 2NAZA 5L3BA 2PQ8A 4LJZF 1ON1A 2Y75A 3P9IA 4MNUA 3C7JA 2XKPA 4HLYA 3SXYA 3BJ6A 1O3TA 3CO7C 4ASNA 2P6SA 3K1NA 3JTGA 2FMYA 3HIFA 3WE2A 4EVIA 4CO8A 2JRTA 1R00A 5CVRA 1UFMA 4G7OF 4BAYA 4CYDA 3OOPA 3ISPA 2K4JA 2QWWA 2JZYA 1FY7A 3RIRA 1BC7C 5FD5A 3ZPLA 4S04A 1I1SA 1D3YA 3TGNA 3QP5A 1XD7A 4A5NA 1WRJA 1PDNC 4Q47A 4YFKF 3GW2A 4H0EA 4RB2C 2GA1A 5E1ZB 2KRFA 4A0YA 3FXQA 2NRAC 1IRGA 4IHSA 1W5SA 5LLQA 2HR3A 1XSVA 2VE8A 3GF2A 4MQVA 3KZYA 4MHGA 3OV8A 4IRIA 1RIOH 1OPCA 2QENA 4HV6A 3I54A 5L3DA 4KDPA 4Y13A 3R0AA 2IA0A 3RTRA 1UCRA 3ZMUA 4R8HA 1DPRA 2HKOA 3DF8A 1F1ZA 3FMQA 3WTWC 2Z33A 3HTSB 4LB6B 2L4AA 4UVCA 1KA8A 4P9UA 2AXLA 3CDHA 1P6RA 1OYWA 1HKSA 4EJOA 2Z9OA 1LDKB 4N9HA 1Y0UA 3ECOA 1HW2A 1S7AA 2EFNA 5FLXK 2IP2A 4KN4X 3VB2A 1ZLKA 2UWMA 4BNCA 3R61A 3E6DA 1R1UA 5FFXA 3C18A 2M87A 3WTZA 3QPHA 3GFLA 2PEXA 1FP2A 1IF1A 1J59A 1H9GA 3FM3A 2EA2A 2ZNZA 5D5WB 1B1BA 3LA3A 3FF5A 4ZYHA 1EH8A 1MD0A 2JPCA 3HHHA 1H9TA 1XMKA 3P7NA 3U2RA 4OOIA 4I2OA 1O57A 5DCMB 4YIFA 1HBXG 3PQJA 2ACJA 2LF7A 3LA2A 3KP2A 1QNTA 1CGPA 5D8KB 4BHPA 1T38A 4UUVA 1O3RA 1ZHFA 3B73A 4JQFA 4ETSA 1XGOA 2HWVA 1J0RA 3WTVC 4G8XA 2W84A 1ZREA 5ILVA 3GFIA 4UV9A 3M9AA 4AIHA 2IT0A 1I6XA 3C3WA 2JTVA 3ULQB 2QVOA 4OIPF 4LMYA 2F5EA 4I02A 5FFZA 4NHJA 3DPTA 5EEGA 1U5TB 3BOQA 4CICA 1BIAA 1QVPA 2FSWA 3SHFA 5D4RA 1OMIA 2RVCA 2DTRA 5D5UB 2HTSA 2PMUA 4F7ZA 4XLPF 1IN7A 1BYMA 3CUQB 5D5XB 5JFRA 4FT8A 1Z7UA 2V1XA 2XV4S 3SFZA 3WGGA 1MDMB 3KEOA 4RGUA 1UHWA 5DDGA 4I7HA 3ABUA 1BJAA 4AVPA 2Y48A 1J5YA 4N0BA 4GYGA 3IRQA 2VN2A 4L9TA 1BBYA 2HKXA 1R5HA 4GYIA 3LA7A 2HEOA 3K1MA 2MH9A 2FEZA 3VOEA 2G9WA 1SMTA 4HDVA 2UZKA 3QU3A 3EYIA 1BIBA 1KYZA 3HUGA 1FX7A 2K02A 3BPVA 1OYIA 3E5QA 3TOBA 6PAXA 2COMA 3LQQA 2BBYA 2V1UA 3GFMA 3QU6A 5HS7A 2ISYA 2ESHA 3ZMSA 2VONA 2LF8A 5TRDA 3D5LA 5FO5A 4I0BA 1GHCA 1V4RA 5E20A 2M1BA 3KEQA 3CUQA 3E6CC 3WTUC 5KVRA 4L5JA 1ZH5A 1B4AA 1Q1HA 2IVMA 2ISZA 1DDNA 1KU7A 2WTEA 1G3WA 2ZFWA 1ZN2A 5CVJA 3ROUA 2IA1A 5JVTA 3O6BB 2Y0MA 2R7DA 2ZKZA 4WF2A 3E97A 2J5OA 2LNBA 1LEBA 1U3EM 4EJWA 4MEXF 2XVCA 3I0TA 1U5TC 1XB4A 2L4MA 3R0JA 2XAGA 2DU9A 3FM5A 4L18B 2Z3YA 1HKTA 2CFXA 2RN7A 4O3MA 2V6CA 1I5ZA 3L9FA 1MGTA 5DCFA 5D4SA 2NNYA 5K1YA 3EYYA 4L0ZB 1YG2A 4WXHA 2D1HA 2A3SA 4HV5A 5IT3A 5CVIA 1B9NA 2EB7A 3MHXA 2UXXA 1FT9A 3DEUA 4HAMA 1W7PA 3LSTA 4UV8A 1MJAA 4BQAA 2OZ6A 1ZGJA 4LD5A 3HSFA 4KIFA 1LB2A 2HQRA 4RAYA 3IHUA 2V1DA 2HTJA 2HGCA 4IRGA 1XCBA 5HLGA 4OU0A 3I5UA 4IHTA 3V4GA 1Z91A 2PBIA 2PMHA 3F6OA 3DP7A 1Z05A 2WWYA 4U0WA 2HYGD 3E19A 3IWFA 1R1TA 2J5PA 5AIQA 4M73A 2XAFA 3COAC 2L02A 4PGHA 5DUKA 4XRFA 4KMUX 1IW7F 1MZBA 2C6YA 3F22A 1FZPB 4RB1A 3ECHA 1QGPA 2G7UA 4GXOA 3BP8A 1R22A 3TO6A 4HQMA 2ZXJA 3HYIA 1ZRDA 5E17F 4LLNA 2HQNA 1D8JA 4UHTA 3RYRA 5ED4A 4EMSA 2VOOA 2VOPA 3BROA 4HW0A 1T98A 2Q0OA 4GCVA 1IN4A 4QLCU 3J81K 2QBYB 1USSA 3F8NA 3ZQ7A 2QQBA 1YYVA 2Z99A 2XRNA 1BM9A 5ERIA 3CUQC 2DAOA 1FBUA 4E70A 2YX7A 3M1EA 4LFUA 4M9XA 2G7HA 3SQNA 3F8BA 2K7LA 3IWZA 1JE8A 3CUOA 2NYXA 4HYEA 2R3SA 2PFBA 4OIOF 1KYWA 1BI0A 4PDKA 3N4MA 2PLYA 4HZFA 1TBXA 2F5FA 3KP4A 1FLIA 3I64A 4U0VA 2GCXA 3I53A 3I71A 5LGUA 3V7CA 2ELHA 1U5TA 1SFEA 5H6RA 2ADUA 2W24A 1RI7A 4DNCA 4HX8A 5FGMA 1REPC 1TQPA 5L3EA 2RKHA 2DFIA 2PJPA 3O2PE 5D5VB 2YSRA 2MD5A 2LKPA 5DYMA 1T2KA 1L0OC 4YG2F 4U88A 3J81Z 1IUYA 3U9GA 2STTA 3BPXA 3R4KA 2XGXA 1KQ8A 3K0LA 3TDUC 4A0ZA 1T6SA 3V7SA 4P9FA 3IKTA 2DPDA 2EJRA 3KP5A 2K5LA 5HLHA 2WV0A 4UXNA 3E6MA 5DD8A 2P5KA 1ULYA 1PP8F 2JT1A 4CXFA 2EFOA 3K2ZA 1YTYA 4EV0A 2IJLA 5K5RA 2FOKA 2O0YA 1BI2A 5CLSA 1RUNA 2O61A 2MLKA 3KLNA 1KU9A 2CWEA 4HF1A 1YW7A 4S05A 3WGIA 3F21A 1DUXC 2DW4A 4G6QA 1G4DA 3FXRA 1G6NA 3K9TA 1KGSA 2BEOA 4I98B 4KIBA 3C1DA 3GVAA 4XSZF 3AAFA 3F3XA
chains in the Genus database with same CATH superfamily
1TWGJ 3HKZN 1K0XA 3FDYA 2YU3A 2CUZA 2NS7A 2A0FB 2DT7B 2KROA 1VQLT 1KIKA 3VYSB 2DBBA 4M77E 3OWTA 1HSJA 1JKRC 1W2BA 2LT4A 3FK7A 1SHGA 4BH9A 2IA2A 3OMGA 4OGEA 4OIRF 2OJ2A 5GTIC 1HLVA 5KK1A 3NARA 3BG3A 1FEXA 1VQ6T 3OBYA 3FBNB 2X6OA 4B43A 1BB9A 1KSWA 4JJDA 4LDUA 5IP6A 1OPLA 2OAZA 1ZSZB 1M2VB 1E6HA 1WDXA 5KCOA 3ZN1A 2EGCA 3KXTA 1Q81R 2X4HA 2RGVA 2DETA 4IIMA 4PNOA 5EGOA 2XD0A 3AL0B 5J1UA 3FBIB 3BR6A 2R7VA 1BK2A 2VKDA 3GCMA 2LRDA 3TKYA 3BT9A 2CYZB 4C92B 3E6BA 2D0QB 5C4JJ 2VQGA 4Z88A 3VDXA 2LH9A 3DEEA 5IY5H 4RAZA 1M3AA 3WU1B 1FP1D 1MJ9A 1KQ9A 1WJSA 2HOEA 4FE4A 1OKRA 1YS6A 1IZ1A 2ME0A 3IKVA 2NUPA 4J7IA 4F7UA 4M78B 3LSMA 3CMEQ 1V5EA 1ZRFA 2LQWA 3WVDB 1PKTA 4A4FA 1U06A 2BV6A 2CW0F 2FX0A 3KCCA 2QSHX 2V8KA 2RNAA 2NNNA 5FKMA 1R49A 1LE8B 4J9GA 1OCPA 1R6RA 2P5VA 3DQVC 3K4NA 4II2A 4JRPA 1WHGA 2WAEA 2MC3A 3DBHB 3VUBA 2UXNA 1ETWA 4A4KA 2G3RA 2K2VA 2O5RA 4RGRA 4RGXA 1TT5B 3VRZA 4M6YA 2FU4A 1YI2A 5JI6A 1IC8A 2DCEA 2RQUA 3LH0A 2LY1A 5B1AH 5D6EA 1YITI 3BW1A 4RTZA 1FNNA 1GL5A 2OCEA 2RQTA 5H20A 2GQIA 4MFDA 3OIOA 1ODDA 2EPFA 1M8VA 1GLNA 3DU6A 2HOAA 4D7MA 1MMSA 3QJYA 1Y57A 1ETVA 2DNUA 3MZYA 2LNHB 2CFOA 3T8TA 4OAYA 5F0CA 5EG0B 2ID6A 2HPIA 5CQGA 2D1VA 2HZTA 3C2BA 5CJ9A 2DO3A 4PJOC 2K5CA 2FQ4A 2P0QA 1E0EA 3PTAA 3TQNA 2QDLA 2WACA 3KEYA 3TP3A 2OX7A 1FPQA 5CCAA 3CF5F 2M2EA 4HF2A 1RI9A 2CSQA 4WTOB 4XK4A 2DA2A 4FX0A 2BTTA 2ED1A 2XKOC 1WHLA 2B0LA 1P4AA 1V3FA 3EGUA 3H92A 5DUIA 3CCSA 3M0QA 3SWNA 1FTTA 2GLOA 1MH3A 2Y31A 1X27A 4RLQA 5ICEA 2P7CB 3FZVA 5HNFA 1E7OA 1B7TA 1BN5A 1ORKA 3JW4A 1X3WB 2E41A 3K10A 2I10A 2DIGA 3FIFA 5C44J 1VQKI 3TL4X 2MGQA 2WB1A 2BHYA 3S32A 1BC8C 1RAIB 1I5LA 2OTJA 3CCMQ 2RO0A 3T1BA 1LDJA 1NK3P 4MDWA 1KU2A 1GVJA 2QQAA 1A5JA 1Q7YR 1YITQ 2LD5A 3D5SC 1RUOA 2ED0A 2KHMA 3JCMg 2ZZDA 2GZWA 3CC4A 1VI0A 3PVLA 3VS7A 1DQUA 4KMFA 4PLLA 3A4CA 4N0AA 3J7YJ 3MZHA 3QUIA 1O7LA 5J4VA 4QVZA 5GAN7 2YX4A 3I59A 2NLUA 1VQNA 2FRWA 2OTJQ 1AWXA 4NQWB 2VE9A 1I6HJ 2FE3A 1TP4A 4WCGA 1TUCA 2MF2A 1HW1A 4KRTA 1ACIA 4O5VA 3S2WA 4B44A 1AHJB 4NC6A 5EZGA 4IO9F 4M7DD 5GANg 4B8XA 2BYVE 3U21A 2AZSA 4E7JA 2HDWA 1SSHA 3D1NI 2IRFG 3FK6A 3A1YA 4CCNA 3K4LA 1VQKA 1QVFP 2ZJRF 5KYXA 5HDKA 4OGCA 4E47A 3GFJA 3NTKA 1U8RA 3VODA 2XG8D 2EQMA 4CI0C 2QG9B 1XCVA 3K1PA 3LSGA 4QPQA 4XBFA 1WKMA 2E2IJ 1VQ4T 4RCCA 1PD1A 1B9MA 2XUBA 3ZQHA 3VYUB 3G7ZA 4G7ZF 2KE9A 1MBJA 1VQKT 4U7DA 4DBHA 3BQZA 4UNOA 3MEUA 3CCMT 1U6GA 4ZYEA 2ETHA 1H92A 3A02A 4GFBA 3H3ZA 4IXAA 4J19A 1RQ6A 3SHWA 3G6EI 4FX4A 3FWEA 3KP7A 1I4K1 5HS8A 5D6YA 4IL6C 3K4MA 5FWBA 3FRNA 3G4ST 3E2UA 4PFZA 4DYRA 1WLPB 4IIOA 2QEXT 3H9GA 2WAQN 2STWA 1Y8QB 5F1RA 1E17A 4BXXJ 1ON2A 1A04A 2O03A 2M02A 2Z0WA 2B9SA 4NB5A 5CYVA 2R5ZB 2MAMA 5FU7B 3LWFA 1UJ0A 4ITVA 3QYBA 3M8FA 5FLXE 1OCZH 3FMSA 4FHTA 1YFHA 4M7DE 3CMAI 2R7RA 5BOXA 1MGQA 2QM3A 4BL0B 2DTZA 1EIFA 3KYLA 9ATCB 3H3UA 1F5TA 3I35A 3NPFA 1R58A 4G12A 2ZJQF 1BOBA 1K4TA 2X98A 5IT9R 2X0LA 2JNGA 2JTMA 3EG0A 4C5EA 2K86A 5JHUA 3CBPA 2VC0A 1G3SA 1U2WA 1XC5A 4LG3A 3P8BB 3EFOB 2GXBA 1QVUA 1X2MA 1WH7A 3BY6A 4ZZLA 3DKWA 2QUFA 5A0GA 3VJPA 5GAN4 4M72A 1PP7U 4M77D 2ZB9A 2CV1A 3FHZA 4I6ZA 3RKYA 1YW9A 2VT2A 3TW7A 3EAEA 1NG6A 4MZMA 1TQIA 2E3IA 3G1MA 3M1CA 1U8BA 3IAM2 2R93J 1JO8A 1WX6A 4KULA 2XPVA 2F5VA 3JAMK 4OAZA 3W3CA 5E3MA 5LHHA 1HSQA 3HSEA 3GTQJ 3OIQA 4RM2A 2PVDB 3BE3A 2LVSA 1ZUKA 3JRZA 3LWIA 2RD1A 3ABTA 3RKXA 5L3GA 5AONA 1P7IA 1WJBA 3ZMVA 2F4IA 3QZ9B 5IAYA 3CCMI 3JB9D 5M3MJ 4OMYA 2KBTA 1O3SA 4D8KA 3ZCOA 2VKHA 4AG1C 2HBWA 1BW5A 4AIJA 4EPCA 1VQOQ 2E35A 1D3BA 3X28B 4M7AB 1MDMA 4A2UA 4EJTA 2XF6A 1H8KA 1D09B 3DPLC 2I0NA 4HSTA 3O5ZA 4RS8A 3DU5A 1AKHA 1X19A 1QVGA 4EMKA 2CGPA 1UGQB 3EFOA 2JW4A 3LOCA 5DM6F 2HPMA 4ENMA 2VGNA 3C4SA 3J81E 1VQ9I 4KNYA 4F91B 2E64A 3GF5A 4WXDA 4D8DA 1X1CA 5D7UA 1S72T 3T0YA 1U5SA 4JZ4A 3RJPA 3H9JA 2KIMA 3TO7A 3GX4X 4CCKA 4XICA 2KI7A 1DJ7B 2DJNA 1QCNA 3LMMA 1W1FA 1O3QA 4C92A 3LAJA 4M74A 2O6GE 3NQOA 3ZQIA 4ESFA 2YRCA 4LLGF 3A8GB 4PLIA 3PJRA 2H8RA 4IHYA 1M3CA 2O9SA 4X9DA 2EK5A 4IF4A 5FB2A 2LFBA 2E12A 3BTIA 2CW8A 5KHDA 1LOJA 4FT2A 4YFNF 1VTNC 1I39A 1SD5A 2FD5A 2W85A 2M16A 2XK0A 1JJ2S 2KFDA 1LQ1A 2DDBA 2DVEA 3HSRA 4HA8A 1GBRA 1DP7P 4FL6A 1JGSA 2E1NA 1STZA 5L3CA 2RHZA 4KIGA 3JAMR 1S6LA 1XX5A 1TNSA 4MTDA 2VXZA 3HRTA 3IC7A 1A35A 2QZ8A 2DQLA 2V26A 2WAFA 1WXTA 3KFWX 3E5UA 4PJJA 4DZPA 2M0OA 4Q5WA 2EKHA 1QA6A 2YUPA 4LN2A 3G6EA 2IGKA 3EG9B 3HOXJ 3UA7A 2FOWA 3SZPA 1Y96B 3BTJA 4EM1A 2GA2A 2O01E 3C2GA 1S8NA 1YOVB 2FQ3A 5FW9A 2VJIA 2JVGA 1WPYA 4CGZA 3BTLA 1HQCA 5HDGA 3W2AA 1K83J 5GAMj 1NJIC 3JCMJ 1NTCA 3GUDA 3J81R 1AZGB 3CXCS 1SF9A 4FT4A 2XAHA 1BW6A 1ZSZC 5KYYA 1J9IA 3A52A 3Q0UA 2L5QA 1I27A 3T9NA 2VODA 1MNEA 2K9GA 2MLGA 2LNVA 2VBZA 2LTPA 4UVAA 3MZ8A 1TC3C 1TWBA 2XAUA 4WXCA 3G71I 3M59A 3VS3A 2XDDA 2JMAA 2KT8A 1TNTA 1HXDA 3A03A 2MIOA 1MNDA 5CVVA 1FOKA 2DXUA 3EGDA 3S16J 5DS9A 2ZBKA 2H1KA 1G2HA 2ABLA 4WX9A 3BR5A 5GAN5 2IGNA 4N4HA 2KLOA 3V8KA 4KN7X 4N9IA 2A68F 4E7HA 1WZ2A 1U3OA 5DV5A 3JRGA 3VFZA 1OQKA 4R1HA 1OR7A 4G9YA 2YLCA 2JM8A 4O6JA 5IYCJ 5GAOl 1BI1A 2CH4W 4UUTA 5FU7C 1VQMI 2LMDA 3I4MJ 2FBHA 2W57A 2W0ZA 2ZPHB 3P9KA 1SFUA 2E1HA 3A0HC 4RAFA 2A6HF 5CQYA 1U78A 2YU9J 2RHUA 1B59A 2QQ9A 3GXOA 2E1CA 1MV3A 2CUFA 4C0ZA 2Z16A 1YWOA 1E2XA 2VPRA 4F7UE 3LSRA 3PSIA 2A5YB 2DFFA 2R5YA 4KYWA 1OULA 4HNUA 3WVEB 1WI9A 2BXZA 3Q0WA 3M8EA 1RNLA 1QO0D 2OV7A 1NHAA 1IZ6A 4XQFA 3Q0VA 3WHBA 3BC8A 5CKBA 4XIDA 4C0GA 1AWOA 1TWHJ 3NWTA 3GLLA 1OI1A 2LQNA 1IN5A 1K8AU 1MIJA 2A5WA 2L3PA 1FSEA 1S3JA 1K78A 1R36A 1QP2A 3RDIA 3L2RA 4ESJA 1S5LC 2OTLI 2LJ0A 3VS2A 1N75A 5EYRA 4UUSB 3INZA 1N8RC 3CPWP 3OYGA 1B6AA 3ONQA 1RC9A 4CDGA 3G4SQ 3JSPA 3TOAA 2QEXQ 4M3BA 3OYDA 3NFCA 1JKOC 2M45A 3EUHC 1T0FA 4RB3C 4BY6B 2K3FA 2FO0A 4BI4A 4FYVB 1H89C 4LB5A 1SAXA 1YP5A 3TW6A 2R5MA 5J3BA 5GMKl 2PVOB 2DA9A 2LKXA 4D5FA 2E34A 2DMQA 3FHNA 2EAYA 1Z3YA 5LHGA 2MMPA 4Y17A 2BXYA 2FJ1A 5CQEA 4A0XA 3D7SB 4MTEA 1D5VA 3FKJA 1ZRCA 3FXLA 1I81A 1JXOA 3R6SA 2DXIA 1BCMA 3RESA 2E19A 4Y3OA 1S72I 5J1RA 4IHVA 3MEVA 3CCQI 1ZARA 1V54H 1XTAA 1GXPA 2OBPA 3I58A 1TUGB 2FRYA 1JJ2A 1LDDA 3IRRA 1PUFA 3LSPA 4F93B 1P7JA 1YHQT 2BY0A 2Y2ZA 3GZNB 4CZZA 3RPQA 3P8DA 3MP6A 3FJ5A 2L01A 5FU6B 2VJ5A 3S2DJ 3MCAB 1H3ZA 1NYGA 3GZ5A 5ILUA 1WPKA 2XIDA 2MI6A 2VL8A 2LP0A 4JLGA 2RV8A 3JAMZ 3BFMA 2IVWA 1P4XA 2Q2EA 4C30A 4CZCA 3CO6C 3IH3A 1VQOA 2OAUA 1E3HA 1VQ4I 3LGLA 4EM2A 3MWMA 4ENJA 2SRCA 1MHNA 1WI7A 1K0SA 3B6CA 4Z02A 3X2QH 3EGDB 5GAOm 4BY1J 3CXCA 2BOLA 1TSFA 3HKSA 2HSEB 1M1GA 1W7PB 3ERED 2QTXA 3DV8A 4EIKA 5GJVB 1VQOT 2V1NA 1UB9A 2CG4A 4HLXA 1HW5A 2KKOA 5DCMA 3S1QJ 2IS1A 1PSEA 1I0CA 2K5FA 1WCMJ 2PG4A 5FLXZ 1VFCA 1RRJA 2E71A 1OYXA 4I01A 2DTIA 1N25A 2MUNA 1MKMA 3M5AA 2EPDA 3BJAA 4OMOA 2DK5A 4G6TB 2WAQA 1F43A 2DA3A 3GEZA 4JX4A 2E7WA 2IXSA 3KPHA 3TO9A 5HOOA 2XC7A 4MEYF 1B34A 1ETKA 1S72Q 4JK1X 1MH4A 4FSXA 1S1NA 4XAXB 2KIFA 4L6V5 3L2CA 4M9SA 4KGVB 3G71Q 1VQ4A 2AS5F 1G3TA 4OMPA 1K6OA 3CBOA 5C6SA 2JTEA 4OINF 2DFHA 3RQ4A 2RI2A 2XDVA 3REBB 4HOBA 3WTYC 2RAEA 4OB3B 2GXGA 4V19K 2XGEA 5J39A 2LMJA 2HFHA 3TCJA 3J80K 1JTYA 2Y30A 4P5OA 4D0PA 3J7AO 2DMUA 2MZ4A 3QKJA 3EDPA 4JPBW 3KETA 3EUHA 2FNAA 1R23A 4L9NA 4XLHA 1FBSA 4I76A 5ICFA 1DP3A 2VLAA 2HI3A 4XU0A 1XSXA 2K9SA 4XU3A 3BZCA 1RADB 3ZP5A 4ZDOA 1FWZA 1ZSGA 3HRSA 1C0WA 2QI2A 3PGGA 2JK3A 3R6NA 2VKVA 4QVDA 1K9MR 2M7AA 2ZXWH 5IYBJ 3S1MJ 4MGRA 3JRBA 2W1OA 4PJOD 4C92C 2RQWA 1B72B 4OWRB 5D6WA 3JCMf 3H5NA 2XF7A 5D6XA 3OS0A 2L3DA 4EM0B 1RAAB 3CXCP 1KC8R 5BS6A 3HOWJ 1AZEA 3NRVA 4M7DA 1P4WA 2DA5A 2GTOA 2H6BA 4JP0A 4ZH4F 1VYTA 4HQEA 3HOZJ 3AKZA 5IYDJ 2VWFA 4M75F 4R79A 1SD7A 1X2NA 2OQRA 1QMCA 2I2LA 3TQ7P 1JXSA 2JJ9A 1JUMA 2VC1A 2LREA 4ZJZA 3EQLF 3G4SI 1EH7A 1WJDA 5I2MA 2EFPA 3OYIA 5KYUA 4IX7A 2YXYA 1QVGS 1VQNT 4P96A 3VYRB 4RM3A 2ECZA 2K4YA 1XPXA 1WXBA 2VVKA 2K3PA 3G1LA 1ZYRF 2R7ZJ 3J7AW 3HRMA 3DBLB 3OYFA 2QBYA 3KYDB 2DILA 2MD0A 2EIFA 4LE9A 2EINH 3M4OJ 1S9HA 2ZMEA 4UB6C 2RH2A 2HMAA 2HNIA 3M53A 4F7UG 1SD4A 2JUCA 3WTXC 1Z6TA 1WXUA 2DD5A 2GGRA 1ZG3A 3OYCA 1UZCA 4EJVA 5BQTA 5BPDA 2JOYA 3CPFA 1Q86C 2Z5UA 4G7HF 1GDTA 2KT1A 3HL8A 4ZZDA 1UTIA 2DOFA 3FEOA 2L7KA 3DTKA 4XTUA 1KD1U 5LD2C 3DKYA 2KPMA 1W6XA 3LH5A 2QSFX 3DEWA 4A3EJ 2BW3A 2CYYA 3OYAA 1M1EB 4KICA 1R1VA 3CCJT 4Y52J 1FBQA 4PCQA 1ZGWA 2HQXA 3GNFB 3MEAA 2HVQA 2XAQA 4L5IA 2BE5F 4NQWA 3OYMA 1UMQA 3KLOA 5LHIA 4BXUA 2CO5A 5LEJA 2CP5A 1HK9A 2GWRA 2P5LC 1Q81U 2YR2A 2MCNA 3ZQGA 1ENHA 1V1CA 2EIMH 3HOTA 3S3MA 2O9LA 2QQRA 3ZMZA 1MMNA 4EJUA 2KJCA 2LSOA 2H8WA 2M8EA 2EV6A 1Z9QA 2LVMA 2DRKA 5HK0A 5KYXB 4LLLA 4L9VA 2F5TX 4RTUA 3V7RA 2WA0A 3VSLA 4KH1B 2EQIA 4LDXA 3GIBA 1PRMC 2RHXA 1ZA2B 5TGTA 1TG0A 4E7LA 4EGZA 4ZDPA 1SG5A 1QZYA 3BG6A 1CQTA 4P55A 4B09A 1IRZA 1DPUA 2OCCH 1U1TA 2RDPA 2YUNA 3BQYA 3K6GA 3PNVA 3W6KB 1PCXA 4LG0A 1RZ4A 5IXFA 4Q4ZF 3CPWA 3URGA 4PJOA 3FX3A 1FMWA 4CHUA 3EHRA 4MMLA 4XK8E 4RGSA 3V8JA 1HF0A 5CIUA 2V1QA 2VBXA 3KP6A 5K7FA 4BE2A 1NK2P 5GMKi 1YHQQ 3H0IA 3JAME 3O3KA 4GGGA 5LRSA 2LJ3A 2VBYA 1TW3A 4C2MJ 5F6FA 1VYVA 3CLQA 4UY8I 3CC7Q 2FRHA 1Z1DA 2HNHA 4M6XA 2IW5A 4AM3A 4QKUA 4QQ6A 4MDXA 3L7WA 3BWGA 3KE2A 5E1WA 5EF6A 2HDCA 2FA5A 1G3YA 3MN2A 3TEDA 1BR4A 2O4XA 2K3XA 4D9JA 3J80R 2HQ5A 3L2QA 1YIOA 2JA8J 1OR7C 3NEUA 1AHDP 1AEYA 3IUOA 2CQKA 2R7XA 4QWQA 3WODF 2H8HA 2DJQA 4AFUC 2FF4A 5LRRA 1BU1A 3Q9SA 4XLEA 1WA7A 5GAMd 1JT0A 2AT1B 1WQWA 1TLHB 4L9JA 4XN0A 3ZL7C 1MBEA 4NBQA 5IOYA 2DXTA 1MV0B 5GANj 4UC4A 1N9SA 2E7XA 1KHIA 2MFZA 1JB0E 2L9SA 1GCQC 3LGFA 4JRKA 5GTHC 1WHUA 4OIQF 5J26A 1PWTA 5GAN3 1FOXA 3MEXA 2XROA 4YIIA 4LK0F 1OISA 3JREA 4PJMA 2E5QA 1N78A 2CSOA 1YQAA 3KIOA 3JSOA 5FKLA 5GAGJ 5ICGA 2KSSA 3HSBA 2DM1A 3PL8A 3G71T 2LKSA 2RM4A 2O88A 5AIPA 5H6QA 1J7KA 1XOVA 3I5SA 3LSIA 5K5OA 5J40A 2V79A 1NEBA 1IJWC 1I5OB 2PQWA 3PMIA 1PC0A 2WSEE 4X1EA 2ZCWA 2EFWA 2DXBA 2F69A 3GBQA 1AWJA 2TDXA 3FIWA 1X2QA 2A08A 1IO6A 4PSXA 1W4MA 4G6DA 1RLQC 2FG0A 3TU4K 1I3AA 1EH6A 4CCMA 4LUEA 2DT5A 4BGDA 3BG9A 4OMFB 2BE9B 4KGXB 1RKWA 4HF0A 1YJWA 5KYYB 4K2EA 2B86A 3HHGA 2EGEA 2GFUA 2GIVA 2F2EA 4KT5C 1IG7A 2R4GA 4W97A 3CCVA 5GAOr 2X1DA 3DKXA 1SPKA 3LFKA 2CJJA 4S0HB 3I56A 2QKMB 1ABQA 3RKWA 2NVXJ 2DJIA 4RUGA 2RQQA 4M71A 4ZYGA 3GYHX 4ZC3A 1IAWA 1B34B 3L42A 5LGTA 3P5JA 2EQRA 4BJTA 2K79A 1IRXA 2Y69H 4Y92A 5K5QA 4BXFA 4J9BA 4U7BA 3QSUA 2P6TA 1QLYA 2DO7A 1PRLC 4IRHA 2BZYA 4RDUA 1BBZA 4JRIA 3SEZA 1RL2A 2ECCA 6AT1B 3E3VA 2A6TA 3HG9A 2FBIA 4P1WA 4M4ZA 1S7OA 2VQCA 5GAN2 1M1KU 2P7VB 2M35A 2KR3A 2KXCA 2HQEA 5A2QK 4L0YB 1WJ5A 4UB8C 2E1OA 5J3LA 1VQNQ 4PGGA 1HJDA 3K7AJ 1T08B 4MO7A 4ZYDA 1IGUA 3FDRA 4M9ZA 4BQOA 2JS0A 3L00A 2KYBA 2OPTA 3EETA 3CCVI 4J6YA 2NVTJ 1YS7A 2DYRH 1EJ9A 2COYA 1SD6A 1JHFA 2JA2A 3BJOA 4BKXA 4AD9A 4XMYA 4IKFA 3PFYA 3F72A 2DVJA 3BCBA 3HGGA 2KXDA 5KYNA 1N77A 1ZQ1A 4IUPA 2DL3A 2L54A 1AWCA 4A6EA 3H1CA 5L8RE 5CR2A 1QQJA 4K11A 2Y0SA 4YFXF 5HNHA 2GOMA 5ILSA 2FZCB 1IV6A 3QIIA 3QXEB 3ABKH 4E6KG 1UGRB 4JS5A 4ELZC 2RJDA 2QYZA 1W7PD 5L3FA 2ELKA 2NVQJ 1F4KA 1XGMA 2XKOA 3DFGA 1YNZA 1QPMA 4FASD 3M0UA 5IHKA 3CCJQ 2O2OA 3RZDJ 2RB6A 3WG9A 2NUPB 4AFQC 4CC2A 1J2XA 1RUWA 3N5BB 1MBFA 2D0NA 5JR3A 1HKQA 2XSJC 3Q5FA 3CLOA 3PNYA 3GTMJ 1Z3XA 2JN6A 4AUXA 2EZKA 2GM4A 8ATCB 4BHCA 4WWCA 2P0TA 3TSZA 3DCFA 1L3LA 4M78F 5LL6S 2K27A 1XG1A 2FBKA 5EGOB 5GANh 2VJ4A 2P0KA 2COWA 3OSSC 4M75G 4M75D 3ZFJA 2KIUA 1BOAA 2VT3A 3U1DA 4J5YA 1MJBA 3S6WA 2A61A 1XJWB 5LJ3d 1N8RU 4ZGJB 5GANd 1VQ6A 2FXAA 2ZPEB 1HSTA 3Q9VA 3VEPA 3FMRA 2DPUA 2QCOA 1B72A 2Q1ZB 2HVSA 2HL5C 3I55A 2DQRA 4ZYAA 2IIMA 1G5VA 1C1AA 1R7JA 4Q5SF 4M77B 1YJWT 4PZJA 1BR2A 4TV7A 2WB1N 1CF7B 2XPWA 2E5KA 1FMKA 2O9VA 3RKQA 2LYCA 4U0YA 2YS9A 3VU3C 1K78B 3HB9A 4AC0A 4J6WA 2X6XA 2CP0A 3FXJA 1B3QA 1RKTA 1X6OA 2P8TA 3HFOA 3BDLA 5E79C 1WQ2A 1QW1A 3KP3A 2CH0A 4EMHA 4AFZC 1RABB 1X01A 1MBKA 5LBQA 2CP7A 4Y7NJ 4G94A 2XICA 3P8HA 3ZMTA 2D9TA 2VYTA 2H1LA 2CU7A 3LSKA 2L0AA 4I09A 1XDSA 2HS5A 1FYLA 3F6VA 2JQ7A 3HXLA 2XIGA 3S1NJ 2K9LA 1JT6A 3KZZA 1JU5C 1NE8A 3OSFA 4HVUA 3P9CA 2EA4A 4IZZA 3V8LA 2LR8A 3N97A 2DODA 3JCMP 3CC7T 1WH5A 1FC3A 5FROA 4AG2C 3QODA 3M9QA 1YJ9Q 5D8LB 4HCKA 1AD5A 2F5DA 1EZZB 3RI4A 2KAFA 2F6CA 1XGSA 3OMYA 5FJ8J 3BDDA 5F08A 5KAIC 2O8KA 1AOJA 3GWZA 4ZTJA 4A3DJ 2LQKA 1CF7A 3ABMH 5KH6A 3GTGJ 2WC2A 2DOAA 2DEUA 2HDDA 2E70A 2GAUA 1XS9A 2XU8A 4XKCA 1D8KA 2O8XA 3ASOH 2QGFB 2YDLA 4M3GA 5FLXR 2GBQA 4HDUA 2M5WA 2LX9A 4HCCA 2F2XA 3CC4T 2K85A 4RLFA 1FSHA 1PD0A 3KZIC 4BQNA 1LUJB 1RAGB 2D8HA 2LZ6B 2DTHA 1D3BB 1RACB 1A0NB 1R5GA 3CMMA 3TBIA 3I9QA 1OCTC 2J7IA 2RJEA 2D45A 2YPRA 3IAS2 4RTYA 1H0MA 5E8GA 3L2VA 2KEAA 3QDFA 4HX4A 1JKPC 1WFXA 1W4SA 1XTDA 2ZPBB 1WWXA 2ZFUA 4BI8B 2I5UA 1AA7A 4ZNXA 2J05A 1VQ8I 4M75A 1QZZA 1X3UA 4V2FA 3VV0A 3PNWC 2WBMA 5BPIA 2OTLA 2DRMA 2EV5A 2K9MA 3HOSA 5IT9E 2DLPA 4GO1A 4GRIA 2J06A 4FW1A 2W25A 1Q86R 2DEQA 3CCRQ 3ER0A 1A6IA 2O4XB 4WK8F 2A28A 2QYOA 2R7OA 5A2QZ 3MKYB 3NAUA 4XLCA 4QQGA 3A5ZB 3H41A 1Z6RA 5I21A 1PHTA 4F7UF 3OL3A 3K4BA 4X6AJ 4WCIA 3PSFA 3CBMA 3M4GA 4OVAA 1C6VX 1LPLA 2H6CA 1IDZA 2QLZA 2EYXA 2YUOA 1Q82R 2LDMA 1X43A 1W0UA 5LEKA 1R0BG 5CKFA 2R7FA 1ETOA 4PUSA 2O3FA 3A01B 2EJ9A 1UGSB 2CZ7B 2OU2A 1O4XA 1SMYF 3EH2A 2DMPA 3DXJF 3F23A 4BHBA 1DGWY 3VPRA 4MQ9F 5E3OA 3MKLA 3BR3A 4XTXA 4GDFA 3CTAA 3VKIA 3QOEA 2RK1A 1WVRA 4DBRA 2DE0X 1J75A 3FXOA 4LK1F 3H0HA 2R57A 1KC8C 3S8PA 1TTYA 3CMYA 1RLPC 3ZBDA 4ENKA 2A07F 1ZGAA 2DMTA 4B48A 4GLMA 1SHFA 4NS5A 4QVCA 5FLMJ 4M78G 1KQ1A 3DB3A 1ZAOA 1K1ZA 4Q48A 5HVQC 4KFCA 3CC7A 1YLFA 1F9NA 1XGNA 3Q3SA 4RB0A 3C2HA 2HAXA 3PQKA 2Y9ZA 1M4ZA 2OZUA 4BU2A 1KU3A 1P9QC 1VQ8Q 3D0SA 5LJ3g 5M3FJ 5M9OA 1XMXA 1KQSS 1ZELA 2P4RA 2M34A 1MBHA 2MBFA 2EQUA 3HP9A 1OPKA 2IGOA 3IH2A 2ZJPF 4M3DA 1Q95G 5GAN6 1PUEE 4XN3A 2UV1A 2IGMA 3T5XA 1QZEA 4A6DA 3W2VA 4BEHA 4A3JJ 3C95A 3HGYA 1WNLA 3G4SA 3JSCA 5J8CA 4FE7A 5J4YA 3VSKA 3LLRA 5HCKA 1Q86U 4IUUA 2R7TA 3ML6A 1CSKA 1JRIA 2MYSA 4I0AA 2QSGX 2BGCA 4BQQA 1SEUA 2H27A 4J7FA 1IN8A 2HYFA 5TISC 1K61A 2QTVA 4CYCB 4C92F 3OW2S 4JBAA 1OU9A 3DKMA 1KD1C 3F8MA 3OQ5A 3JRIA 2KIQA 2KY9A 5KNLA 1LVAA 2DYSH 3R60A 5GAHJ 1FXXA 2Y90A 1Z9CA 4AWXB 2V9VA 4Z2YA 2VV5A 2QGUA 5F0FA 3LX7A 4EGYA 3BZ6A 2CP2A 1ZBXA 1WHMA 4LDWA 2W82A 3VS5A 4FTHA 3CJNA 1MMAA 1R5ID 2L89A 1FIPA 1LJ9A 2L9VA 3B6AA 1NEGA 4DQ2A 1YW8A 4NOYA 2PN6A 3WGHA 2XAJA 5CPRB 2GNCA 1YHQA 4FISA 2EWNA 2M8GX 4KUMA 1VQLA 2RNJA 2A3LA 3LQRA 1RR8C 2W4SA 1EKEA 3G1JA 2OTLQ 4M7AE 1JUSA 2IG0A 3M4YA 1UUEA 2AHJB 2EV0A 5H2FC 1FOYA 2K9NA 5CKHA 3LYIA 2JN0A 3U23A 1AKHB 4J9HA 2B63J 1I1GA 3JTHA 5DEQA 3F8CA 2DYIA 2VBWA 1TW2A 4UUSA 4C8QG 2Z1DA 3OW2A 1PSFA 3MQ0A 2CUBA 3UA6A 4KJZA 2NUTB 4RMNA 2NWMA 2B7EA 3QWXX 1JJ6C 5KE3A 5AT1B 1VYUA 1YJWQ 1VQ7T 1SFXA 4J9CA 5HS9A 1IXRC 2RQPA 2XHKA 4II3A 1IRFA 5E1XA 1QCOA 2NYSA 1OCOH 2JSPA 2QAZA 3NTIA 5DD4A 3PFIA 1AT1B 1VIEA 3AT1B 3DTEA 2K57A 2L2PA 1OYYA 4AIKA 1ZQ3P 3CCVT 2NS0A 4XSXF 3EFSA 4J9IA 2LY2A 5DLQE 2KRNA 1OJLA 1IXSB 1WSUA 2VIXA 3QO3A 5LGNA 1T39A 3KYCB 1MW7A 1QKXA 2A6EF 3WE3A 4BY7J 1R77A 2SEMA 4J9EA 3RBBB 1IDYA 1ZHIA 3CD6A 3HTUA 2DBMA 4IUTA 4A3FJ 2FEIA 3CQZJ 1T0JA 5CQXA 2MA3A 1S29A 2L7FP 4ESBA 1JQQA 3BCAA 2H09A 2ZSIB 5TJJA 3GTJJ 2MC4A 4UVBA 2PJRA 1YJ9T 2L3SA 2ZNYA 1OCCH 2W00A 3IV5A 2ZJ2A 4LG0B 5E8IA 1USTA 3SYTA 2R58A 1HA8A 2X4YA 2M51A 1YX3A 1UGVA 2WSFE 5GAN8 2CQXA 5GPCA 4QW2A 4YELA 3QAHA 2K7AA 1UHMA 4HNTA 1TQMA 4QIWN 4FM4B 2NUTA 5IH2A 3VS0A 4XLNF 1D0YA 4M7DC 4XU2A 3TEEA 1LNXA 4LUDA 1N8RR 2FMLA 2DL5A 4XKWA 1YJNT 3CC4Q 1ETQA 2LBFB 3UR3C 1JI8A 3SFMA 4Y15A 1T3LA 3B02A 3ESWB 1FJLA 2R7QA 2OJED 3RPUA 3UWNA 5EJCA 4LDYA 1X75C 1LFUP 1K79A 1QBJA 4HBLA 2CDTA 2GIZA 4ENNA 1Y8RB 2HDAA 3CCQA 3QOPA 1OOTA 5GAMg 4XKBA 4RMOA 3CCJA 4EQQA 2M30A 3ASNH 2BKDN 1UEBA 2L3RA 4ZN1A 1M9SA 4OF1A 3L1AA 5A2QE 4BYYA 4GBQA 3CCRT 2OD5A 3CCEA 4ZGDB 2ZSHB 3REAB 2V1RA 1U9NA 3TDZC 4CC3A 5HLIA 2KP6A 5AYFA 4A5MA 4DA4A 2M3AA 1LEAA 1KONA 3PMTA 2XASA 1WHHA 3ZRGA 2HU9A 3G73A 1YO5C 2EQKA 2DMNA 2R5YB 1FYKA 2K5IA 4F3QA 1X3ZB 3UATA 2MH2A 1LE8A 1K7AA 2BZTA 1NZ9A 2DT6A 3L1PA 2A69F 3K69A 2ESNA 3THKA 3RYPA 3CESA 2D1XA 3F70A 2TRTA 3PM1A 1W36D 1LVKA 5FD6A 1VF9A 5IT9Z 1IREB 4M3FA 2MOXA 3HM5A 4HCZA 3VRYA 2COZA 4NC7A 2NVUB 5I22A 2O7OA 2OF7A 4IVNA 1W2BS 3ZN0A 1KD1R 2JPBA 2M0CA 3DLLF 1W5TA 2JA7J 2IPQX 2Q8KA 1EA3A 2BIVA 1V76A 2EFIA 3JV3A 5LJ3e 3META 2BVLA 4A3GJ 4ORZA 5HK3A 4RAGA 5C3EJ 3A98A 2BY2A 3E5XA 2KJBA 2RQVA 2QASA 4KBMB 5EZHA 1TZLA 4M7AF 4DIQA 5IT9K 1O7FA 5J47A 2GQQA 2Y9YA 5LJ5j 3WTSC 3CCSI 2HZDA 3L09A 5EEHA 2EFQA 1TU0B 1HDPA 2H94A 3FB9A 1VQ8T 2W7NA 1WQ7A 2LCCA 2PUOB 2K4BA 3GMEA 4X34A 1D0XA 4RTVA 5J8FA 3TMOA 4AFSC 2CQQA 1LNWA 1W1WE 2DXCA 3S3OA 2RI3A 1XN7A 3CD6Q 1GVDA 2MWPA 3HL2A 5JHFA 2IS2A 1I8FA 4C5HA 3ZMDA 2X6WA 4XRSA 3MFKA 1ZBJA 1QCFA 1VQ7I 4ELYC 1M8MA 3RSNA 3K70C 3FKIJ 1WJQA 3JB9G 2EIJH 4IJAA 4PSWA 1MMGA 3MAJA 2E5NA 2ME6A 1KK7A 5IHNA 4AYBN 4BS9A 3EH1A 4CUGA 1GFCA 4ON0A 4N4IA 2RJFA 4CA0A 2FNPA 4L5GA 2OQGA 3CDLA 3J80Z 1WYXA 3SZTA 3QP6A 5GP9A 5A0LA 2E2JJ 3FC3A 2F2VA 3QPTA 3ZGKA 2VXEA 1EV7A 4HNVA 3GO5A 5ICCA 3I4PA 2Y4XA 1F1BB 3OB9A 4DOVA 4LGWA 3PIPA 1QQIA 4FQGA 4HRIA 4MMKA 2R7WA 4XRMA 2AKLA 5CVUA 4U87A 3BY7A 2JM9A 1Y1VJ 5E18F 4HCBA 1AOYA 2PI0A 2RMOA 2JSCA 1P2FA 2C0IA 2XMFA 3BDUA 5F04A 3X24B 3I5RA 3KBGA 1VQ5A 1VQPA 2CMPA 3L2WA 5HY6A 3I59B 4IURA 2OTLT 1QVFS 4A69C 1WFWA 1RETA 3CCUI 2R7UA 1IXCA 2E10A 2V7FA 1WZOA 4M6VA 4DBQA 2QEXI 2V8IA 4M78E 2LCSA 3TREA 4LD9K 5A0DA 1H641 4HX7A 1AWWA 4Y4RA 1GCQA 3RUXA 3G6ET 2RHYA 3CC2A 2H3JA 3MCZA 3LAPA 4L5EA 4ABZA 1JEGA 1KQ0A 2F5CA 1SANA 4F14A 1X1AA 4N0AC 3JRAA 1YJNI 2CT4A 2KL4A 3PVQA 2EILH 2DLLA 2VJJA 4C9YA 4FSSA 1VQ7Q 4Y33A 4KA4A 3SDGA 3UT1A 2RC4A 4C2TA 5KE2A 1XMAA 1N6AA 3CEYA 1XSDA 3IL2A 2X4XA 2RJCA 1IN6A 2YSQA 2LDUA 3OR2C 3CCVQ 3HRUA 4IPAA 2HOTA 2KQWA 2ZMEC 3QRFF 1GV2A 1NH3A 1YCSB 2DK8A 1ONVA 4FYXB 3SDZA 7AT1B 5F64A 1RAEB 2CUJA 3ELKA 1YFNA 3M8JA 3GLXA 4E7ZA 5E3NA 2DI3A 1WJAA 2D2WA 1A31A 2VUMJ 1X1BA 3WU0A 3WTTC 1OV3A 2LTOA 3UDCA 3FISA 5HDNA 1YWPA 1ZLJA 3T8RA 2D5VA 4MLOA 4OMZA 1XDUA 5IOZA 1OX8A 2ESWA 2LRQA 5GADJ 3HOUJ 1YX5A 4BUGA 4OMNA 4A4GA 5D6FA 1TTHB 1KHCA 3CC2I 3H3VK 1P92A 3M7GA 4C3JJ 1K4US 3F8FA 4E7KA 2L3QA 1ZG5A 5J6XA 1FYMA 4QT7A 1YJNA 2CKKA 4A12A 1GXQA 4HKEA 4JJCA 3RQIA 2V9PA 3W6JB 1OZ3A 2CW7A 3GZ6A 5GAOn 1UDLA 2ZO4A 1IB8A 2A36A 1ITYA 1X1DA 1Y6IA 1HDDC 1EF4A 5CAIA 4R55A 1YJNQ 1JJ2P 4XNFA 4GY5A 3REOA 2KRHA 3FXUA 4OMMA 2ROTA 2TCTA 1BI3A 2NXNB 1ZG1A 2L9NA 3G3ZA 2QF7A 2P4WA 4BDZA 1JHHA 2JVVA 2ZMEB 3BR0A 4F7UB 5GMKm 1YJWI 2OA4A 3PIOF 3HPHA 2NAZA 3KX2A 3DLAA 2PQ8A 5L3BA 4LJZF 1ON1A 2Y75A 3P9IA 3AG1H 1X69A 4MNUA 3C7JA 5LJ3j 2M9UA 2XKPA 4HLYA 3SXYA 4XL9A 4BJ6C 3BJ6A 4QSHA 2MG4A 4RBOA 3OS2A 1Y1WJ 1O3TA 5EEAA 1VQ5T 3CO7C 4ASNA 5LJ5e 2P6SA 3K1NA 3JTGA 2FMYA 2X9HA 4BB7A 3HIFA 3WE2A 4ATOA 2DZCA 2GFAA 4A4HA 2BW3B 4EVIA 4CO8A 3PIPF 2CV0A 2JRTA 3KFVA 3JB9F 3EUAA 1R00A 2L0KA 5M5YJ 3BZKA 5CVRA 1LPQA 2X35A 1UFMA 4J00A 4G7OF 1X1PA 4XOTA 5KYWA 2X1EA 1U0JA 2QA4I 2LJ1A 4BAYA 1R4MB 1W5CC 4CYDA 1YJ9I 3OOPA 5C0MA 5F0HA 1V29B 2V9KA 3A2KA 4JUVA 4X1VA 1K73C 3A8MB 3ISPA 4D7NA 3RDVA 1NJIR 1Q82C 3NWSA 3K4CA 1GCPA 2K4JA 2QWWA 2JZYA 2KYMA 2C0TA 3VWBA 4B4CA 1O75A 1FY7A 5LJ3f 5LJ3h 3RIRA 1R0CB 3EGXA 5LFAA 3MP1A 1BC7C 5FD5A 3ZPLA 1D1BA 5GANe 4JRQA 1T0FC 3ZQQA 1OU8A 3IQLA 4R0KA 1VQNI 1AVZC 4S04A 1I1SA 2FPDA 3HPGA 3MEWA 4BDYA 2EYWA 1D3YA 1TWFJ 2HVRA 3TGNA 1UE9A 2BZXA 5DLOA 1BJZA 3CD6T 3F0CA 1QHHD 3QP5A 4BUPA 1QVTA 2YHTA 2JJ7A 2ZC2A 4JX5A 1CKBA 2LT1A 1K8AR 1XD7A 2JUFA 2C0OA 3VYGA 3E9GA 2F1LA 1NLOC 4A5NA 3LNQA 1E3OC 3OSVA 4VUBA 3J80E 1WRJA 3EUKL 3LFUA 1PDNC 3GP8A 1RI0A 2GOXB 2K2MA 4Q47A 2PMZN 2YUQA 2X51A 2HYJA 4YFKF 3LL7A 4NNJA 1JGGA 4F55A 2CSIA 4AVZA 1T33A 3GW2A 4RTWA 4H0EA 4E7SA 3DTIA 4RB2C 2VUBA 1EX4A 3I56I 2EZIA 2GA1A 2VQHA 2BHZA 4AYBA 2ATCB 4A4EA 3CCLA 5E1ZB 2CQ7A 2KRFA 4NC8A 4XKVA 3C12A 3O8VA 4PJOB 2LX7A 4A0YA 4XONA 5E3LA 1GRIA 3FXQA 3I4NJ 2NRAC 1IRGA 2AZVA 2EJGA 3C0CA 5FKOA 4BEHB 4IHSA 2ZPFB 5IP9J 3PE0A 3OBWA 1W5SA 1SRMA 1NJIU 5LLQA 4AT1B 2HR3A 1WJRA 2XHCA 2XI9A 1YIJA 5DY9A 4M7AG 3CMEA 1XSVA 2VE8A 1ZTRA 3GF2A 3U1KA 3AL0C 5CKEA 3CCLQ 2XSDC 4MQVA 1K4SA 1UJ8A 2RI5A 4AU7A 5GAMe 3KZYA 1VQ9Q 4MHGA 3G6EQ 3BTCA 3OV8A 3MMYB 2DX1A 4Z6YA 3JCMX 2PNIA 2R7SA 3HUGB 3ASKA 2P84A 4IRIA 3LW5E 2HXOA 2RNGA 5FKNA 1TT0A 1Z67A 1RIOH 3W6VA 4J9FA 2E5ZA 1OPCA 2QENA 4HV6A 4LIUA 3SFIA 4YIRX 2DIQA 5CKDA 1KZHA 5HODA 3OW2P 1M1KR 3I54A 5L3DA 4KDPA 3CD6I 4Y13A 4F52A 1WJFA 3X25B 3R0AA 1MUZA 3X26B 5B66C 1OEBA 1A36A 2ZPGB 2IA0A 3HJEA 1NPPA 3RTRA 1UCRA 2CP3A 3ZMUA 4R8HA 2EJFA 1DPRA 2HKOA 2R5ZA 2DD4A 2LCLA 3DF8A 2QQ8A 2UUZA 1UGPB 1UG1A 1T56A 3HOYJ 2HD0A 3RCOA 3OYLA 4B9XA 2HOSA 1YJ9A 1DU6A 1F1ZA 2M4KA 1ZR4A 2RPNA 3M58A 3FMQA 3WTWC 1R8OB 3ABLH 4M7DB 4A93J 3CCYA 2Z33A 4J9DA 3HFNA 3QPSA 1D0ZA 3AG4H 3HTSB 4LB6B 3O8GA 2L4AA 2QQSA 1OLTA 1RAHB 1SVMA 2KISA 4UVCA 4M75B 1KA8A 5CKTA 4CCJA 4B3XA 3MKDA 4J8OA 4P9UA 2XDBA 2AXLA 3CDHA 4H4KC 1K8AC 2L9RA 1Y0NA 3JCMb 1GXIE 1PVEA 1P6RA 1VA7A 2RF0A 4YRVA 2DAQA 2E3HA 3IH4A 2HZYA 1OYWA 3HKZA 1A6QA 1HKSA 1LJOA 1VQ9A 1TXQA 4EJOA 3CJTB 3DBRB 1E6GA 2Z9OA 1FYNA 3VYTB 4M77C 1VQOI 1NG2A 1LDKB 1Y7XA 1KQSA 4N9HA 4CRIA 4XU1A 1Y0UA 4CH7A 4BE1A 5IN1A 3ECOA 2OC6A 2JMCA 5LJ5f 3J7AF 4FU6A 1HW2A 3S17J 1S7AA 9ANTA 2FPEA 4HSRA 4E7IA 3CP2A 4A3LJ 4OMLA 2VKEA 1VQMQ 2DMOA 2VC8A 2EFNA 2EGAA 2VASA 4BBRJ 5FLXK 4RG8A 1V55H 3HHTB 2IP2A 4KN4X 3VB2A 1ZLKA 4IHWA 2UWMA 1VQ5Q 4BNCA 3ZQCA 1IUFA 5LJ5h 2DL8A 3R61A 2DA1A 3E6DA 4B6MA 2CV2A 1R1UA 2KDSA 4DEYA 5FFXA 4Y28E 5CO7A 3E0JB 2CGHA 2KZVA 3C18A 3OS1A 2M87A 4P5NA 3WTZA 3CCEI 4KT6A 3QBYA 5LJ5d 4BBSJ 1I1JA 1PG5B 2JWTA 3OOUA 1KJWA 2EYQA 4DW6A 3QPHA 4KUIA 3QZ5B 3EG1A 3GFLA 2PEXA 1MSEC 2V6EA 1FP2A 2EYYA 1IF1A 4OP0A 3MKWB 1M90R 3H9QA 1J59A 1M2OA 3EPZA 1H9GA 3FM3A 5M5WJ 4ANJA 2EA2A 2F4MB 3AFHA 2ZNZA 1Z7LA 2K6DA 1SVOA 3F9KA 5D5WB 2LLKA 2O31A 4XTZA 1B1BA 2D6FA 2KGTA 3LA3A 1V5FA 4JDSA 4X9CA 3E7LA 2EZLA 3FF5A 4N4OB 4ZYHA 1B8IA 3S3NA 3G71A 1IXDA 1EH8A 3SJMA 5F27A 2AK5A 1MD0A 3MD2A 4CSWA 2D8JA 3LSHA 2JPCA 2M7BA 3HHHA 1H9TA 1XMKA 3P7NA 2EW3A 1SFOJ 4LD6A 1M1KC 1D1CA 3U2RA 1RAFB 2G6FX 2YLBA 4A53A 4OOIA 4I2OA 2MW8A 1O57A 5DCMB 1QHGA 3OYEA 2DYBA 1F36A 4JOMA 3OMCA 2F2WA 3SD4A 3JB9I 1SAUA 1NYFA 1X58A 4YIFA 2FVUA 1HBXG 3FJPA 3EG9A 1M30A 4CC7A 2FL7A 2W10A 3PQJA 1Y96A 4DOZA 4MZPA 1T0HA 2XB5A 1Y56A 1VZ0A 3JCMW 3QDRB 1FOWA 2DFEA 2ACJA 1W36C 1GT0C 1WI3A 1UHSA 2LF7A 3LA2A 3KP2A 1QNTA 4KITB 3QG1A 1CGPA 5D8KB 4BHPA 4BE0A 4KH0B 1GFDA 1T38A 1ERDA 3RR6A 2X4WA 4UUVA 5HKCA 1O3RA 2GQVA 2IAIA 1ZHFA 2BY1A 3B73A 1FMVA 4JQFA 4ETSA 5F1JA 1XGOA 2HWVA 3CCJI 4BI3A 3MJXA 2EVRA 1J0RA 2CQNA 4MIMA 4A3MJ 3WTVC 4G8XA 3H5RA 2MPXC 4CCLA 4M78C 2QA4T 2W84A 3GFIA 4UV9A 2P0WA 3M9AA 4AIHA 2X9DA 5BNGA 5ILVA 1R71A 1ZREA 2RN8A 2IT0A 1Q82U 1I6XA 4I99C 1LKXA 3WU2C 3C3WA 2JTVA 5KYWB 3ULQB 2AO9A 2QVOA 1SC7A 4OIPF 2C06A 4XRSG 3TVTA 1IV8A 3CJQB 4LMYA 3UF4A 5GAOp 1LFPA 3CCLT 5LJ5g 2ZXHA 4QPOA 2M1HA 2F5EA 4I02A 5FFZA 4NHJA 4GLKA 2DTOA 3DPTA 2Y4YA 1VQ9T 1Z0XA 4DBFA 2K9QA 2CREA 1UG0A 2N8GA 5EEGA 2KDOA 3S1RJ 3SWNC 1U5TB 4C92E 3BOQA 4CICA 1R9TJ 1BIAA 1QVPA 2FSWA 4PJOF 3CF2A 2E60A 3SHFA 1WGXA 5D4RA 2JXBA 2QKLB 4YTLA 1OMIA 3RNJA 2XB0X 2RVCA 2DTRA 3H0DA 4C5IA 5GANf 4AMCA 5D5UB 3QPLA 4X0GA 1T95A 2HTSA 2PMUA 3E1SA 2E6ZA 2ZAEA 3QYHB 3TSWA 2JRMA 2IS6A 3OR1C 1U1SA 3M07A 2KRCA 1BCOA 4F7ZA 4XLPF 2CRGA 3M0PA 3VS6A 3MKZA 1IN7A 2VKNA 4KUDK 3BR2A 3QWYA 3AHUA 1BYMA 3CUQB 2EH3A 4IOCF 5GAMf 5D5XB 1QWEA 5KYUB 5JFRA 4JX6A 4FT8A 3C94A 5I11A 1Z7UA 2V1XA 3OYYA 2XV4S 1YN8A 4OB2B 3SFZA 2FHDA 2E1MB 1YHQI 1POGA 3I56Q 3WGGA 1MDMB 2M0YA 3VS4A 3KEOA 2KK4A 4RGUA 1UHWA 4PFPA 5IHIA 3CZ6A 3I9V2 3CC7I 3H9NA 2BZ8A 3MPUB 4LXCA 4JZ3A 5DDGA 2DA4A 2Z2SB 4I7HA 1Q7YC 2VGMA 3ABUA 1VUBA 1BJAA 4AVPA 2Y48A 3BG5A 2X85A 3J7AY 2RA2A 1J5YA 3A01A 1WHJA 4N0BA 2LP5A 4GYGA 1YI2T 3RMQA 3EHQA 3IRQA 1MBGA 1WIEA 4JJBA 2VN2A 3H5AA 4L9TA 2HBPA 3CCUQ 1BBYA 2HSPA 2HKXA 2Q2EB 1R5HA 4PFOA 2J6KA 5GAMh 1IGNA 2EQJA 4GYIA 1Y39A 2P81A 3LA7A 4IOAF 1UHFA 4M77G 4PJOG 2HEOA 3RPUD 2JTFA 3JCMQ 2GBYA 4HT9A 3K1MA 4MZTA 2M4GA 4EDUA 2MH9A 2FEZA 3VOEA 3JR9A 2G9WA 1SMTA 2KVQG 4JS4A 1SSFA 4M78D 4HDVA 3OYHA 4OMQA 1HCRA 1SKUB 1QVGP 2UZKA 3QU3A 1KFZA 4A3KJ 4HPQA 2R5AA 5K7HA 5IPAA 3EYIA 3QYGB 5GAEJ 1QP3A 4IEJA 3GPLA 3CCUA 1VQMT 1H3HA 1BIBA 2WV1A 1KYZA 3HUGA 2OTJI 2PUKB 1FX7A 1QPIA 3I55Q 2K02A 3CP8A 1ZX6A 4LNPA 4M3EA 3ZEHA 3BPVA 1OYIA 3E5QA 1JBMA 4D5CA 3GTKJ 2I8DA 3D5RC 1SFKA 4A3IJ 2NUZA 4BACA 1J3TA 2JUGA 5HLTA 1K76A 2LQ8A 3LWHA 2E6NA 3TOBA 1Y0MA 5EC7A 6PAXA 3UNGC 1ZR2A 2COMA 3LQQA 4LOCA 2BBYA 1AU7A 2V1UA 1W0TA 4FETA 3GFMA 4C3IJ 1YCYA 3QU6A 2X3XD 2FZGB 1SEMA 4CYCA 5EG2A 1YI2I 4IUVA 5HS7A 4R56A 2ISYA 3HBLA 2ESHA 3PUBA 3ZMSA 2VONA 1MMDA 2LF8A 1VQKQ 4NL3A 1R4NB 3OYJA 3GBGA 5TRDA 1BL0A 1YITA 3D5LA 3H0GJ 3OYBA 1U9OA 5FO5A 2ID3A 4D1QA 4B3AA 4I0BA 2JA6J 5J1YA 4DJAA 3OA6A 1GHCA 1K73R 1YRNB 3KUFA 1V4RA 5E20A 1M2VA 2HEQA 3WHCA 1VIFA 1VOMA 2J6OA 2IBDA 1M1FA 2VXFA 4HVWA 2MABA 2M1BA 2HKNA 2J6FA 2QK0A 3SEMA 3KEQA 4DYQA 1XQHA 4KT0E 3CUQA 3E6CC 1ARKA 1BR1A 3JB9J 3S15J 2JVHA 2X4JA 4DEXA 4C8QA 5ECAA 3WTUC 4NDLA 5FRMA 1W70A 4ESRA 1EFNA 5FRNA 5KVRA 3H0FA 4C5GA 2DA6A 4L5JA 5A2QR 3AG3H 1JXMA 4XLFA 3I55I 1Y07A 2WSCE 2ZGWA 3X20B 2CP6A 4RKUE 4F92B 1ZH5A 4KGZB 4LDVA 1B4AA 1Q1HA 5DTDA 1GBQA 3H6ZA 3ZQLA 3JRHA 3NHNA 2IVMA 4FCYA 2ISZA 1M5Q1 4PJNA 5IP7J 1VQ5I 4M7DG 5B3SH 2CZ6B 1QWFA 1KU7A 1DDNA 2CS7A 2WTEA 1G3WA 2DZ9A 3JB9H 2Y0SN 2ZFWA 4C0DC 1ZN2A 4EMKC 1G2BA 1G83A 1PKSA 4Y91A 3L2UA 5CVJA 2BE7D 3CMAA 3CCEQ 3ROUA 1UAAA 2IA1A 4N4NB 4XORA 4XR6A 5JVTA 2QA4Q 1NBEB 1BKBA 1YIJT 2E65A 4PKCC 3O6BB 1D5YA 2Y0MA 2R7DA 2ZKZA 4WF2A 2RREA 3E97A 4C8QB 4HG2A 2J5OA 5GMKe 3OIPA 1TS9A 2IS4A 2CH4A 2LNBA 2RK2A 2FPFA 1LEBA 1U3EM 4EJWA 1ZSZA 4MEXF 2XVCA 3DPUA 3I0TA 1U5TC 1CKAA 1XB4A 1NLPC 3A8LB 2L4MA 2X6YA 3R0JA 1WGSA 1APLC 2LK2A 3G2BA 2XAGA 2M9HA 3QJ6A 3JRCA 2QA4A 2HL3A 2DU9A 5DM7R 3FM5A 1X4OA 4L18B 2Z3YA 1HKTA 2CFXA 3PNTA 3DB4A 2RN7A 3OL4A 4O3MA 3SEQA 2V6CA 1I5ZA 2FYKA 2NOGA 3K4JA 3O8HA 3L9FA 1VQ7A 3M0RA 2DERA 2NS8A 1I3QJ 2HQAA 3IP4B 1UECA 3CCMA 3RERA 1Z21A 1TOVA 2RQRA 1MGTA 2F48A 5DCFA 5D4SA 4M78A 1LCKA 3PUFA 4A3BJ 2EIKH 4RA2A 4XM3A 2NNYA 4RTXA 5K1YA 3EYYA 5K7ZA 2OI3A 3NMZC 2M0MA 4W1UA 4L0ZB 4M7DF 1YG2A 4WXHA 2D1HA 4JYKA 3GNGA 1ZUYA 2A3SA 1VQ8A 3J7ZI 3SDBA 2P0PA 3BLYA 4HV5A 3ZQFA 5IT3A 4OB0B 5CVIA 1NM7A 1B9NA 3EG2A 2EB7A 4A3CJ 3MHXA 1ZK8A 2UXXA 3NTHA 1FTZA 1FT9A 1G59A 2DA7A 4F17A 3DEUA 4C0DB 4EMKB 2QGGA 3SB2A 1OCRH 3S14J 1VQMA 3CC2T 4E2FB 4HAMA 1W7PA 3LSTA 3QWLA 4PK4A 4UV8A 2DKGA 2PU9B 3MP8A 4ZGEB 3I56T 1MJAA 4BQAA 2OZ6A 2KMTA 1Z77A 1ZGJA 4LD5A 2XRLA 2ENMA 5I2SA 2DF6A 2MK5A 3UKGA 2JT4A 1H88C 3HSFA 4KIFA 3ZOBA 2F5KA 3H8ZA 2EZHA 3JCMV 2L7ZA 2EBIA 1LB2A 3HTRA 1QKWA 3HZJA 2HQRA 4RAYA 3K70D 1YI2Q 3IHUA 2V1DA 2HTJA 4B47A 2HQHA 3CQTA 2YUSA 4YEJA 2DFUA 2ZCFB 2EBPA 2HGCA 4IRGA 3CCUT 1XCBA 3CC4I 3CCLI 2DPPB 3M3YJ 2AXTC 3WG7H 1PJRA 5EDNA 1TL8A 1OX9A 2KMUA 5HLGA 2KNBB 2OAWA 4OU0A 5B1BH 3GOXA 1HD3A 4TVRA 3I5UA 4JJNK 1H8AC 4IHTA 2L7MP 4A63B 3OS5A 1IHWA 3V4GA 3VYHB 1Z91A 3R6OA 1HYOA 4KISA 1VQPT 2FUG2 3CMAT 5KAFC 4JLIA 3RZOJ 5FWCA 1K6YA 3HEFA 2AIRB 2PBIA 2PMHA 2IPOB 3F6OA 3JCMc 4XLAA 1UFFA 2BY3A 1QVFA 3CCQT 4Z89A 5FKKA 3DP7A 1OZ2A 3E9FA 2FZKB 2H3EB 2X48A 1Z05A 3G1OA 2WWYA 3SZGA 3I55T 2ICWG 2KQRA 4U0WA 2HYGD 3A0BC 3E19A 3IWFA 1R1TA 2XF5A 3K4KA 4LIVA 3PO2J 2J5PA 5AIQA 4M73A 2XAFA 1KQ2A 2EKOA 3MVPA 2BUDA 3AG2H 3COAC 2L02A 3JCUC 4J6XA 3DLLA 4PGHA 1TWCJ 5DUKA 4BJ5C 2DBKA 2KDZA 3VUZA 5JVGF 4XRFA 4FIBA 4A54A 3CJRB 4KMUX 4ZTFA 3QYEA 4ZN3A 1VQ6I 1IW7F 1MZBA 2XGDA 2YWWA 4IHXA 1Z9ZA 1X4PA 2C6YA 4ZDLA 1BA5A 3ZXSA 3F22A 1FZPB 2V4JC 8AT1B 2YT6A 4RB1A 3ECHA 4BD3A 1Q1VA 2EYZA 4FYWB 2PZ1A 1QGPA 4IQJA 2G7UA 4GXOA 2ROLA 4N4GA 3BP8A 2NVYJ 3EG3A 2WY8Q 1S7EA 1R22A 2CZ1B 2RHIA 3JCMe 1PYVA 3DWLE 3TO6A 4HQMA 2OUMA 1W2BP 2ZXJA 1I50J 3HYIA 1E3PA 2ZPIB 3CCSQ 3A8HB 1ZRDA 5E17F 4LLNA 1M3BA 2LC2A 4M75E 2HQNA 1PM3A 1ACMB 1D8JA 2CUDA 2V8JA 3M55A 2DL4A 3HOVJ 2E36A 4UHTA 3RYRA 5GJWB 1K9AA 3K2AA 4EMSA 5ED4A 2VOOA 2VOPA 1IO2A 2PX9A 2ZXIA 4HVVA 1YBYA 3GTLJ 3BROA 1HC8A 1N9RA 1UELB 1C0MA 3OSGA 1MSFC 3CDIA 1ZA1B 2HCKA 1HOMA 1IHVA 4HW0A 1T98A 3A1PA 3VS1A 2DDAA 3JRDA 3M0SA 5GMKj 4EMGA 2JA5J 2Q0OA 1VQLQ 4GCVA 1MNMC 1GV5A 1IN4A 2NOJB 4QLCU 2PJRB 3FLGA 4M75C 1Y71A 1ZLMA 4OB1B 3J81K 2QBYB 2MVTA 1USSA 3F8NA 2HKQB 2VB6A 3ZQ7A 2QQBA 2E2HJ 3SWNB 2LBFA 1UHCA 3MO8A 1FIAA 2MWOA 3HPWA 4ME7A 1WJCA 1VQ6Q 4AIDA 4XTWA 2AKKA 2E4HA 2HXIA 4M7AA 1G8XA 3CCET 4IUQA 1YYVA 2Z99A 2XRNA 1BM9A 3BG7A 3CUQC 5ERIA 2X1CA 2R0QC 1ABOA 3EFRA 3M57A 4NL2A 3CCRA 2WADA 4C8QC 2DAOA 1KC8U 1FBUA 5GPAA 4E70A 1JJ8C 1TH7A 4FW2A 2YX7A 3M1EA 3PO3J 3M56A 1YIJQ 5JLXA 3OYKA 1X6BA 4V2GA 4LFUA 2PTKA 5KCHA 5L23A 4M9XA 1DGRM 2MSYA 4C3HJ 2G7HA 3S93A 2AHQA 3SQNA 5DM7F 3CMET 1K73U 2K40A 2XGCA 3QYFA 3F8BA 2K7LA 3IWZA 4RG2A 3HDDA 1ETYA 1JE8A 2L8DA 2PVGB 3CUOA 4HEA2 3I3LA 1NPRA 4QQDA 4C8QE 2NYXA 2KRMA 3CPWS 1KG1A 4XQ3A 4XTVA 4HYEA 2G0EA 2R3SA 2GF7A 2PFBA 3UPUA 4OIOF 1KYWA 1V5GA 1JTXA 4C92D 1BI0A 4PDKA 3N4MA 2PLYA 2X3WD 4C92G 1J09A 4HZFA 4PJOE 2KZGA 1TBXA 2AQFA 1QU3A 1YRNA 4XTYA 1TWAJ 1RPWA 2F5FA 3GTPJ 3KP4A 4M77F 4B1RA 2F4OB 1FLIA 2KRSA 2BVMA 4FYYB 2JZ2A 3I64A 4DGWB 1GUUA 4U0VA 4D6WA 1I07A 2IEKA 1XNIA 2GCXA 3I53A 2JMWA 1DU0A 3I71A 1ZKGA 1IGQA 3V42A 5LGUA 3M54A 1WHKA 2DJZA 2VXDA 2CS3A 3V7CA 4DZJA 4B9WA 2K3BA 2ELHA 4RCBA 3NGPA 1U5TA 1VNDA 5B5EC 3BR1A 4DOWA 4HT8A 1SFEA 5H6RA 2ADUA 4F04B 4PJLA 2W24A 4DYCA 3CC2Q 2W48A 3RMSA 2KT0A 1RI7A 4DNCA 2QXFA 2GTJA 2DL7A 3DLMA 4C2UA 4M7AD 3TP0A 1Q81C 4IQ4A 3CMEI 1Q7YU 4HX8A 1X2KA 5FGMA 1REPC 1TQPA 3Q1JA 5L3EA 2P4TA 1SRLA 3JRFA 4PJ0C 2RKHA 2DFIA 2PJPA 3O2PE 5D5VB 2JS2A 4NUBA 2A37A 2YSRA 2MD5A 1X6GA 2LKPA 5DYMA 1T2KA 1M27C 1L0OC 2FB7A 4Z8AA 5GMKh 2R92J 4YG2F 2VQLA 3PIOA 1S72A 1M90U 1LFBA 1ETXA 4U88A 5FLVA 1ZUUA 4HXJA 5FU6C 1M90C 3J81Z 1IUYA 3U9GA 1YITT 4MFEA 4E4HA 3QHSA 2L2OA 3BPXA 3R4KA 2XGXA 2STTA 3ERMA 1N5ZA 1TUDA 3N05A 3FXMA 1KQ8A 4M7AC 1OFCX 1VQPQ 3CMAQ 2LOOA 2AQEA 4C8QD 5M5XJ 3K0LA 4PL6A 1KQSP 2XPUA 3TDUC 3EGXB 2LY9A 3H36A 5IXBA 4A0ZA 4LITA 1T6SA 1B07A 5JLWA 1UJYA 3V7SA 2OTJT 3CCQQ 1T8IA 2A7YA 4P9FA 3ME9A 3IKTA 3PT9A 3S2HJ 3H35A 4C8QF 2DPDA 3OY9A 2EJRA 1JKQC 5GAOq 4CCOA 3KP5A 2A05A 4L59A 1O9SA 3W2WA 5HLHA 2K5LA 2ELJA 2WV0A 1VQLI 2VI6A 3HC7A 4UXNA 1T3SA 2CZ0B 1K9MC 3E6MA 2ECBA 3CCRI 2K3YA 1B8IB 2XDPA 4XOPA 4J83A 1YE9A 5DD8A 2WY7Q 4II1A 2DN0A 2P5KA 1ULYA 1K9MU 5CK9A 1PP8F 2JT1A 3OYNA 2YRDA 1RESA 4EATA 2PMZA 1RR7A 4CXFA 4RTTA 2EFOA 4C0FA 1VQ4Q 3K2ZA 1YTYA 1WJEA 2COBA 1N27A 4EV0A 2IJLA 5EG0A 1JUPA 2FOKA 3LSJA 5K5RA 2O0YA 4QTRA 2VPLA 3PFSA 3FXKA 1BI2A 3QQAA 5CLSA 1RUNA 2O61A 4EEFG 5C4XJ 1PNJA 2LG4A 2MLKA 3M0TA 4E6RA 3KLNA 4CC4B 1KU9A 1QRYA 1SVLA 4F16A 2B8AA 2CWEA 4HF1A 1YW7A 1YIJI 4S05A 2CT3A 2YRVA 3JCMh 2LC4A 2CUEA 2E1MC 3WGIA 5BMZA 3ULRB 2GXAA 3L2ZA 3F21A 1D1AA 4J01A 1DUXC 2DW4A 3CCST 1NG7A 4G6QA 1G4DA 1VQPI 3A8OB 4BY6C 3JCMd 3WXMB 1PUFB 1OQYA 5KCMA 3FXRA 1G6NA 2DOEA 4V2SA 3K9TA 1KGSA 3GTOJ 2BEOA 4I98B 1UB4A 1UG2A 2QEXA 4M77A 4KIBA 3ZR8X 3C1DA 3GVAA 4XSZF 3AAFA 2DK3A 2QDYB 3F3XA
chains in the Genus database with same CATH topology
2YU3A 1VQLT 2DBBA 4M77E 1W2BA 1HSJA 2LT4A 4BH9A 2IA2A 3OMGA 4OGEA 4OIRF 5KK1A 1VQ6T 3OBYA 4LDUA 5KCOA 2OAZA 3KXTA 3ZN1A 2X4HA 2RGVA 4PNOA 2XD0A 3TKYA 2CYZB 4C92B 3E6BA 2D0QB 4RAZA 3WU1B 1FP1D 1MJ9A 1KQ9A 1WJSA 2HOEA 1OKRA 1YS6A 1IZ1A 3IKVA 4J7IA 4F7UA 4M78B 1ZRFA 3WVDB 4A4FA 2