1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
3ZMTA 1I6XA 2F5CA 4CXFA 1I1SA 4TV7A 1UHWA 5JFRA 1MGTA 4OMYA 1ZRDA 2E1NA 3QU6A 4ON0A 3KP6A 4G9YA 1QGPA 2X0LA 2XHKA 1XCBA 1YYVA 3CDHA 1W7PA 1ZG1A 2UZKA 2W84A 2ZMEB 4PZJA 2ELHA 1LNWA 2LKPA 3EYIA 3LAPA 5D8KB 3JSPA 5DDGA 1G3YA 5EEGA 4WK8F 4WX9A 4BAYA 1EV7A 2M1BA 5D5VB 3V8KA 4LG0B 4WXCA 1LDJA 4M74A 2Z33A 2LSOA 1QZYA 2XV4S 2D45A 3GZ6A 1GVJA 2R3SA 3KFWX 1R36A 1FWZA 4KFCA 2GXGA 3MFKA 3TOBA 1XMAA 1KYWA 4LB6B 1XSDA 2RKHA 3V7CA 3MZHA 2F5FA 2M87A 3HUGA 5E1WA 4EJTA 4U88A 3GFIA 2IT0A 4OINF 1YW9A 3T1BA 1MDMB 1BIBA 1YW8A 2H6BA 4G7HF 2CQKA 2PBIA 4N9IA 3ZP5A 1T39A 2L54A 3JW4A 2A07F 1P4AA 2HTSA 2J5OA 3GFJA 2XASA 2OQRA 2QZ8A 2E7XA 1CF7B 1YG2A 3K2ZA 4LLGF 2RC4A 1A04A 3N97A 3V8LA 1LDKB 3CUQC 2Q8KA 2JPCA 1FY7A 2CW0F 3ULQB 4BHCA 4MQ9F 4IRGA 2OAZA 1ZLJA 1IAWA 4EGZA 5CYVA 1SFUA 1BIAA 3MAJA 5HDGA 3FM5A 4HLXA 5TRDA 3DKWA 2DI3A 3CLOA 2M8EA 2IRFG 2NYXA 5HLGA 4ENNA 3WG9A 4M72A 1U2WA 5JI6A 3ZMUA 1YQAA 3VODA 2W25A 3JSOA 5HOOA 1GXQA 1QZZA 2O3FA 1KU7A 1B9MA 1JHHA 1YS7A 2QQBA 3G73A 3R0AA 3LA7A 2EB7A 4WF2A 2VBZA 2A69F 4A12A 4UUVA 1W5TA 2JZYA 1USTA 4ETSA 5CVJA 4HX7A 2XAJA 3MWMA 1FLIA 1RUOA 5ILUA 3M8FA 1GHCA 1R5GA 2VODA 1U5TA 1IF1A 3E3VA 4CZZA 1V4RA 2YX7A 2DW4A 3ZMVA 1E2XA 3E97A 4UHTA 2W85A 3E6CC 3LQQA 3CJNA 1H0MA 3K0LA 5HS8A 3EYYA 1L0OC 5DUIA 3L09A 5JHUA 2IA2A 1L3LA 2MA3A 1D3YA 2DO7A 4RGUA 3MCZA 5ILVA 3DP7A 1R1VA 3C3WA 3C7JA 4U7DA 4R8HA 3C1DA 5JR3A 2QWWA 1JXSA 4KIBA 2GQQA 1BJAA 5LGTA 4YIIA 5L3BA 5CJ9A 2P5VA 2E7WA 2LF8A 2IVMA 1PP8F 5BPDA 3CTAA 4UNOA 1XGNA 2STWA 2KIUA 1MJ9A 2IPQX 1OYWA 2M5WA 2XKOA 4HDUA 2VN2A 3RIRA 2C6YA 2Y75A 4NHJA 3MQ0A 3HRTA 1EH6A 3RKYA 3GX4X 2M45A 2XROA 4I98B 2GWRA 4XRFA 3HRSA 2H09A 4JQFA 4M9ZA 1E17A 3I53A 1QW1A 1FYMA 1FC3A 1XGOA 2YSRA 4Q47A 3RKXA 3EETA 3KEOA 3RPQA 1RI7A 5K5RA 1DPUA 3RJPA 3GZ5A 2MH9A 2OBPA 2ACJA 3VEPA 1IW7F 2A61A 1FYLA 1O3SA 3DPLC 3HSRA 4ESFA 1OPCA 1WSUA 4IHTA 1J75A 2G7HA 3GUDA 2FXAA 2RGVA 1HBXG 4CICA 3D5LA 3I58A 4G8XA 5TJJA 3NEUA 3HHGA 1G3WA 2L4AA 1OR7A 2STTA 5KVRA 4BHBA 2ISZA 5BMZA 1O57A 1G4DA 5IT9Z 2P5LC 1STZA 2WV0A 5LHHA 4Q48A 1GXPA 2HQRA 1TQPA 3HIFA 1OMIA 2LF7A 2G7UA 4S04A 4L18B 3FHZA 2XAQA 1SD7A 3P9IA 5D8LB 2MLKA 1SAXA 2XAGA 5DCMB 4ZZLA 4EJOA 2NRAC 1LJ9A 1CF7A 5BPIA 3BP8A 2W57A 2DPDA 2O03A 1DPRA 5HVQC 2DBBA 4L9TA 2NNYA 4LGWA 3ZN0A 1ZARA 5J6XA 3GXOA 4HV6A 3W6JB 3WU0A 2OZUA 4FX0A 2AXLA 3ZQ7A 4KN4X 4I0BA 4FT8A 2BEOA 4F7ZA 4HF2A 3KP4A 2PI0A 1USSA 4RGSA 1R1UA 3R4KA 1S3JA 4I0AA 4HBLA 2QYOA 2W24A 3LA3A 3J81Z 1XN7A 4KIFA 3TQNA 5ERIA 3DF8A 3T8RA 2VONA 3H3UA 3HRUA 2ZJ2A 3LFKA 1RUNA 4CHUA 5JVTA 4AIKA 2Y0MA 1BI0A 1O7FA 3TKYA 2PG4A 3F21A 4MTDA 1P92A 4OIQF 3KLNA 2Z5UA 4ENJA 3MEXA 2PFBA 2JRTA 2V9VA 1P6RA 3WGHA 4K2EA 3KE2A 1HW1A 2FBKA 1B1BA 3IRRA 2QBYB 1MKMA 1OKRA 3FM3A 1QO0D 1J5YA 3Q9VA 3ECOA 5D5UB 4HQEA 4YG2F 4L9VA 4XSZF 3J81K 3ZMDA 5CVVA 5K1YA 4UV9A 1B4AA 4LLNA 1B9NA 1J7KA 1IN5A 3L00A 2HTJA 4G7OF 3WTXC 5AIQA 1R7JA 4XLPF 4RAZA 1F9NA 4GGGA 5KK1A 4ENMA 1P4XA 1FSEA 1ON2A 3OOPA 2MBFA 4G6QA 5H6QA 2PMHA 2IP2A 2D1VA 1XGMA 1S7OA 4U0VA 3KP2A 4IVNA 3HOSA 2P4WA 3RPUA 4BH9A 3JAMZ 2IW5A 4Z2YA 4R79A 3JTHA 1QPMA 5HS7A 2OD5A 2ZO4A 1UFMA 3BJOA 2QUFA 4IRIA 3BJAA 2HGCA 2K27A 5D4RA 2XRNA 3BOQA 1QBJA 4GCVA 4I7HA 2K86A 2EA4A 5LHIA 4ZYDA 3QP6A 2E1CA 4ENKA 4KIGA 2YPRA 1IXCA 5D6FA 4G94A 5LEJA 3GVAA 2NS0A 4WCGA 2BBYA 3F23A 3FXQA 1RNLA 5D6EA 3QPHA 3KZZA 3SHFA 2UXXA 3RYPA 2QM3A 1SD5A 1K78B 1S6LA 4KUMA 4M6YA 3L9FA 1FNNA 4YFXF 3QAHA 2EFPA 2JTVA 4ASNA 5HS9A 4P5OA 3ROUA 2J5PA 2HWVA 1T98A 3JAMK 3V8JA 2DU9A 5E1XA 1BBYA 2CGPA 3SXYA 1HKSA 1R1TA 3N4MA 4CO8A 3WU1B 4RAYA 3KP5A 2XAFA 1P2FA 3GFLA 2EK5A 4EM0B 2X4HA 3KZYA 4BYYA 2QENA 5DD8A 4FHTA 3U9GA 1B59A 4RGXA 2ESNA 5K5OA 1I27A 5EEHA 2P7VB 2PN6A 4CYDA 4EJUA 4BNCA 2DQRA 4HX4A 1UCRA 2FA5A 5ICEA 1SD4A 3MHXA 1LEAA 4L9NA 3F8BA 2HOEA 6PAXA 4YFNF 1BI1A 2VC0A 3C18A 3M1EA 1FP2A 2ESHA 3F6OA 3IKTA 2XKPA 3NRVA 2WC2A 2DLLA 5F1RA 2KKOA 4ZYGA 1FZPB 1LB2A 3O6BB 1YO5C 3IKVA 1V3FA 1FYKA 1QVPA 1TTYA 3LAJA 4ESBA 3QPTA 2K5IA 1TNTA 3IWZA 3BPVA 3ZMZA 3WTYC 1SFEA 5LGUA 2PMUA 3WODF 2TDXA 3Q5FA 3ECHA 1MJBA 2A3SA 3BROA 4G7ZF 4CGZA 4L0YB 2P7CB 4KA4A 4I02A 3R0JA 3FMSA 3ZN1A 5LLQA 3PQKA 2GCXA 3EQLF 3REOA 2EV0A 3GF2A 1Q1HA 3J80Z 4NQWA 3QU3A 1G3SA 4KMFA 5E8IA 2CYYA 2BE5F 4B09A 1KQ0A 4A0YA 3R61A 1ON1A 2G9WA 1HKTA 4A6EA 4XBFA 2FBIA 4O5VA 3WGIA 2ISYA 1R58A 2EFWA 5H6RA 5K5QA 1ZGAA 1AOYA 2ZMEA 4LB5A 4HF1A 3RYRA 2QVOA 5DD4A 1R00A 2RVCA 4PCQA 1KGSA 1KQ8A 2A5YB 1TLHB 5J8FA 3F8CA 1EH7A 3TO6A 2VOOA 3ABUA 4LG0A 3IL2A 2L3DA 3LWFA 3ZPLA 1TQMA 5BQTA 1FPQA 2MH2A 4R1HA 3R60A 5F64A 1O3QA 4JK1X 2F5DA 1T6SA 1JHFA 5LRSA 3IRQA 4MGRA 2YU3A 4DQ2A 2EWNA 2L01A 3P9CA 3ZMSA 5D4SA 4M6XA 1FOKA 2VOPA 3J80K 4A0XA 2RNJA 4OU0A 1F1ZA 4IF4A 2IJLA 4AIHA 3WTUC 2VBXA 1AWCA 4ZZDA 1PDNC 2OQGA 4O3MA 3HSEA 1MDMA 1J59A 4U7BA 1FSHA 5DYMA 1H9TA 1WRJA 1UB9A 1T38A 2KRFA 1KU2A 3ABTA 3CO7C 4YIFA 5E17F 2VT3A 4UXNA 2QQAA 2DK8A 1XSVA 1HW2A 5FLXZ 5ICGA 3EUHA 2H6CA 1BI3A 3BY6A 1YFHA 1IRGA 4HYEA 1OYYA 1FBQA 3I4PA 5IT3A 3BPXA 3HSFA 3RTRA 2EA2A 2FEZA 2XIGA 4HW0A 4KYWA 5AIPA 1O3TA 2ZBKA 1D8KA 2K7LA 2P6TA 3CUOA 5L3EA 1XDSA 4M9XA 1TQIA 1XCVA 2ZKZA 2RDPA 4P55A 1IUYA 1K6OA 1K7AA 1HSTA 3VOEA 2HDCA 4N9HA 3E5UA 3F22A 3JTGA 1X3UA 2LDUA 2R7DA 3LA2A 3GFMA 5IT9K 1J9IA 4L5IA 5BS6A 4XLNF 1G6NA 1YIOA 2GIVA 3GEZA 5DCFA 4PGHA 2ADUA 4LJZF 5FO5A 4IHSA 4OOIA 4MEYF 1DP7P 2O0YA 4HX8A 5FFXA 2NAZA 1TBXA 3P7NA 3KP3A 3DPTA 3WTSC 2DQLA 4EM2A 2CWEA 3TGNA 2CO5A 5FLXK 1O7LA 3T8TA 4NB5A 1H9GA 3VFZA 2HZTA 1U5TB 3TDZC 4AWXB 5ILSA 3MZYA 4OIPF 3M8EA 1SD6A 3FWEA 4UVCA 4EJVA 1C0WA 1T2KA 1RZ4A 1SMYF 1K79A 5FB2A 3P9KA 3R6SA 4A5NA 1O3RA 2YX4A 2FNAA 5CVRA 3TOAA 3HOTA 3TO9A 3G3ZA 5CVIA 4ZYHA 2VXZA 2CG4A 1S29A 3IHUA 4M71A 3T0YA 4IXAA 1KYZA 4GYIA 2MD5A 3CO6C 3E6MA 1Z7UA 5L3DA 2Q2EA 2O61A 3F8FA 4EQQA 4UVAA 5FD6A 2HQNA 5E20A 1ZGJA 2EFQA 3F8MA 1ZG5A 4GXOA 1R22A 4KMUX 1BYMA 1TNSA 2FE3A 4U0YA 2KIMA 3WE3A 3HHHA 4OIOF 5L3GA 4MEXF 1W4MA 4I2OA 3IC7A 4PGGA 1KU3A 3TO7A 3GLXA 5LGNA 3U1DA 4LFUA 4N0BA 1XDUA 1KA8A 2FNPA 2XVCA 2O8XA 4MTEA 4RB3C 1TW3A 4WWCA 3PFIA 3BZ6A 2P8TA 2Y48A 3Q9SA 1TW2A 1D5VA 2H3JA 5FGMA 4CDGA 2EFOA 1PP7U 2OZ6A 3M7GA 1BN5A 2FF4A 4KNYA 4Y13A 5A2QZ 1WKMA 5FD5A 3I54A 1HW5A 3QP5A 3O2PE 1HQCA 2LNBA 2Z99A 3F3XA 5E1ZB 3E5XA 3TDUC 5LHGA 4A0ZA 2KIFA 4LLLA 2Z3YA 4ZYEA 2P5KA 1QNTA 1Z91A 2D2WA 5HLIA 4M73A 2K02A 5FFZA 4O6JA 1YW7A 2HKXA 3B73A 1WQ2A 3FZVA 2RN7A 3H92A 3VB2A 1BM9A 3FF5A 3SFZA 1JGSA 1HXDA 1SFXA 3F8NA 2PQ8A 2R7FA 2WTEA 1WI9A 2OU2A 4WXDA 4YFKF 2M30A 4LK1F 2VE9A 3FMQA 4HLYA 2DAOA 4WXHA 2DK5A 4HA8A 2CFXA 5DCMA 3I64A 3V7SA 5D5WB 2FOKA 2K5LA 4UV8A 2FMYA 2HYGD 5F6FA 2BYVE 2V1XA 2F5EA 2EJRA 4BHPA 5DUKA 2K4YA 4UVBA 5A2QK 1FP1D 5H20A 1G3TA 2FBHA 4P9FA 2BGCA 3WTWC 4EJWA 3WGGA 4JBAA 4A6DA 2DPUA 4L5JA 1Z6TA 3I59B 1ZN2A 3HYIA 5J8CA 2ZXJA 5DEQA 2PJPA 3WTZA 3K1PA 2O6GE 4P9UA 3K69A 2HS5A 1U8RA 4KDPA 1NHAA 1I1GA 2L02A 1BC7C 3F6VA 2Z9OA 3L2CA 1LDDA 3F72A 4L0ZB 1IXRC 1LQ1A 4OMZA 4L9JA 2ETHA 4XSXF 2P6SA 1BC8C 4MHGA 2IA1A 2V6CA 3AAFA 3E19A 3HTSB 1YLFA 4EMSA 2GA2A 2B0LA 4LD5A 4IPAA 4RB0A 1U3EM 2V79A 2V1UA 5ED4A 2PEXA 3SZPA 2YR2A 2XAHA 3K1NA 3H3ZA 1Y0UA 3PQJA 1YS6A 1ZLKA 2GA1A 2UXNA 4B8XA 5L3CA 4HF0A 1Z6RA 1I5ZA 2GAUA 4G6DA 3S2WA 4GO1A 4HQMA 1BOAA 4KT5C 1P4WA 2QLZA 2EV5A 1REPC 4Y17A 3I71A 2QBYA 3SZTA 3ERED 1XSXA 2A68F 2KJCA 3SQNA 3CUQB 1DDNA 3BDDA 1ZYRF 1F5TA 1KU9A 2DTRA 1U78A 5LRRA 3V4GA 3IWFA 4GYGA 4I09A 3OV8A 4AVPA 1EH8A 1CGPA 1IRFA 4RB2C 1UHMA 4DNCA 2VC1A 3DV8A 3DEUA 2RQPA 2ZCWA 2Q0OA 2WWYA 3RI4A 1W7PB 3T5XA 3L7WA 1XMKA 4A2UA 1MJAA 4S05A 1RIOH 2HFHA 2XUBA 4Q5SF 4ZH4F 2GXBA 1Z1DA 2MC3A 4Q4ZF 4H0EA 3DXJF 1IZ1A 2BV6A 3ISPA 1S7AA 3QOPA 1T0FA 1J2XA 2JT1A 4D0PA 4KN7X 3KP7A 4LK0F 3V7RA 4LMYA 1W5SA 3HTUA 3EDPA 4HZFA 2FRHA 2IA0A 5DV5A 1FBSA 2EV6A 4OIRF 1WWXA 4BQAA 1FT9A 3E5QA 1QQIA 5ICCA 2LX9A 3FX3A 3WTTC 1ZREA 1IN4A 2A6EF 1KQ9A 2ZFWA 4P96A 2NNNA 1ZRFA 1LEBA 2OA4A 4U0WA 1ZHFA 1U5TC 2HKOA 1IN7A 1Z9CA 3K9TA 5L3FA 1J0RA 2V1DA 2FMLA 3FMRA 4EGYA 2MLGA 3GO5A 5BOXA 1ZG3A 4KICA 2FSWA 3FXRA 3GYHX 1MD0A 1K78A 3ML6A 4EM1A 5AONA 4E70A 5HLHA 1OYIA 1Z05A 2FQ3A 2JPBA 1HSJA 1W7PD 1BI2A 2K4BA 2FU4A 2ZNZA 3LSTA 4IJAA 1B6AA 1LVAA 1PUEE 4RB1A 2HYFA 5D5XB 4ESJA 1SMTA 5LEKA 5ICFA 3B02A 4RS8A 5E18F 3I0TA 2K4JA 1XGSA 3K1MA 3COAC 4HAMA 1ZAOA 2KJBA 2D1HA 2AS5F 4QLCU 1ZH5A 3I59A 3RKWA 1ODDA 3GWZA 4A5MA 4PDKA 2EFNA 3D0SA 2COMA 3QRFF 3DFGA 4HDVA 1XD7A 4FX4A 4I01A 2H27A 2VBWA 1ULYA 2XGXA 5HDKA 3ELKA 4RGRA 2HEOA 1MZBA 1XB4A 4EVIA 1VTNC 3GW2A 4IRHA 1S8NA 2PLYA 2F2EA 1IN8A 4BXUA 3W6KB 1YTYA 1R5HA 4Y15A 2DFIA 1HKQA 2RV8A 2H94A 3E6DA 5E8GA 4M9SA 1FX7A 2JSCA 3WE2A 3J7AO 5HDNA 3U2RA 1FBUA 3KCCA 5CLSA 4AD9A 1R23A 4EV0A 3O3KA 4MNUA 3HRMA 4HV5A 3M9AA 1F4KA 2GZWA 3NQOA 1U6GA 2VE8A 3WTVC 2L4MA 2VT2A 4QWQA 2QQ9A 3RDIA 1ONVA 1IXSB 2A6HF 5CVUA 1JE8A 3KEQA 1IN6A 3BWGA 4HOBA 5LBQA 2UWMA 1D8JA 2HR3A 3LQRA 3KETA 3CUQA 2CSOA 2VBYA 3BJ6A 3FXUA 3I5UA 2ZNYA 3DQVC 4MQVA 1ZRCA 3E6BA 4AIJA 3KLOA 2DT5A 2K5FA 1DUXC
chains in the Genus database with same CATH superfamily
3QYBA 3ZMTA 4P5NA 1I6XA 4HEA2 2F5CA 4CXFA 3VS7A 1DGRM 5KCMA 2DXCA 1I1SA 4XTUA 4TV7A 3J7AF 4HVVA 2JWTA 1D3BA 3VUZA 1UHWA 2HDAA 2V8IA 4XOPA 3H9NA 2NOGA 3CZ6A 5JFRA 1GCQA 1MGTA 4OMYA 1ZRDA 4CSWA 2E1NA 1ETWA 3QU6A 4ON0A 4ZDOA 3KP6A 4G9YA 2CP3A 4HCZA 1PD0A 5GAMg 4LUDA 2EJGA 4IHVA 3FKJA 2Y2ZA 5HODA 2NXNB 1YNZA 1QGPA 3CCJQ 2X0LA 2XHKA 3HOUJ 5LL6S 1XCBA 5IT9R 2YLBA 1YYVA 3CDHA 3MZ8A 3EAEA 5GANd 4HSTA 2J6OA 3EG3A 1W7PA 1X2NA 1ZG1A 4IHXA 1KQ1A 2PU9B 5DM7F 2W84A 3ERMA 4DYRA 2UZKA 1E6HA 3PIPA 1NEGA 1GBRA 2ZMEB 1RAEB 4PZJA 3WHBA 2DL4A 1WJSA 1I0CA 3OYKA 2ELHA 4FYYB 5C0MA 1LNWA 2LKPA 3OS5A 3L2VA 3F9KA 3U21A 4XQFA 3S14J 2M51A 3BG3A 4ZN1A 3VS3A 4C8QD 5HNHA 2DFFA 1M30A 3F70A 4J9EA 4A54A 4M7DC 2OCEA 3OY9A 3EYIA 3LAPA 3FC3A 5D8KB 3JSPA 2PVGB 3M56A 5DDGA 1CQTA 3LWHA 1G3YA 5EEGA 4WK8F 4ITVA 4WX9A 1VI0A 4BJTA 3GTKJ 1T08B 3CCMT 4C3HJ 4A69C 4BAYA 1EV7A 2M1BA 3IUOA 3ZBDA 1RKTA 4XTVA 5GMKj 3PNYA 1VOMA 3CJRB 1G8XA 4W97A 3GTMJ 5D5VB 3V8KA 4LG0B 3ABMH 3M4YA 2BE9B 4JJBA 4WXCA 1QHGA 3KBGA 1TT0A 4M7AD 4EMGA 1KSWA 1LDJA 2CQ7A 4B47A 2E36A 5IP6A 4XOTA 4M74A 2RNAA 3MP8A 1QVFA 1UHSA 2Z33A 3DWLE 2LSOA 1VQNI 2MVTA 2X98A 1QZYA 1WHJA 2HQEA 2XV4S 2D45A 3GZ6A 1WVRA 1GVJA 5EG0B 3LOCA 1QPIA 1X43A 2QQ8A 2RI5A 2R3SA 2P4RA 1TUDA 1H92A 3KFWX 1MSFC 2IXSA 3AL0C 1R36A 5L8RE 1FWZA 4KFCA 2GXGA 2XSJC 2X6XA 3MFKA 3NGPA 1LVKA 1N5ZA 4C5EA 3K4CA 3TOBA 1XMAA 4OGCA 4XU2A 3CCMA 1KYWA 3LSHA 2DBKA 4LB6B 3TQ7P 2DA9A 4P1WA 2VIXA 1JT6A 2JK3A 4LDWA 1PNJA 1XSDA 2KVQG 2RKHA 1VQ9Q 2ABLA 3V7CA 3MZHA 1Z9ZA 4M75D 3A8OB 4AC0A 5FRNA 1IB8A 2H3EB 2F5FA 1ZLMA 4JJCA 4JLGA 2F1LA 1YP5A 2M87A 5IYCJ 4M77B 3HUGA 5E1WA 3HBLA 3LMMA 4EJTA 1C0MA 4U88A 2LQNA 2L9RA 5DM6F 3GFIA 1B07A 2DMOA 4XAXB 2L7ZA 5CQEA 4OINF 2IT0A 3JCMJ 1YW9A 3S3NA 2JVVA 2KDSA 3T1BA 1MDMB 1SVLA 5DLQE 3P5JA 2LC4A 4M78D 5B1BH 2FX0A 2YS9A 2M9HA 3GCMA 3OR1C 1BIBA 3J81R 2LREA 1YW8A 2ESWA 1WLPB 1K9MC 1K1ZA 2DDAA 2LVMA 2H6BA 5F04A 4A3JJ 4G7HF 1B34A 1TUGB 1X58A 2CQKA 2PBIA 4KUIA 4N9IA 4JRIA 4BU2A 5GANe 1FEXA 3ZP5A 3AFHA 5FLMJ 1T39A 3I4NJ 2L54A 3GPLA 3JW4A 2XRLA 2A07F 3FXKA 1P4AA 3EH2A 4R55A 3D1NI 2EZIA 1WDXA 2X9HA 2HTSA 2RJEA 2BY0A 2J5OA 2NS7A 3GFJA 5IOZA 4IIOA 3CXCP 1T0JA 2XASA 1AU7A 1I39A 2OQRA 2QZ8A 3ZRGA 5M5WJ 1IXDA 2E7XA 2MWOA 4FCYA 4BEHB 3S1MJ 1CF7B 1YG2A 2ZPGB 1H3HA 2G6FX 1NZ9A 1YJWT 5H2FC 3K2ZA 4LLGF 1JJ2S 1NG7A 1KONA 2RC4A 1A04A 2K2MA 1RAHB 3CCRQ 1ZTRA 3N97A 3Q0WA 3V8LA 1SEUA 2JA6J 1OPKA 4XQ3A 1LDKB 1EX4A 5FU6C 3CUQC 2CUJA 2IS6A 5D6WA 2Q8KA 2JPCA 1FY7A 3A0HC 4Y7NJ 1GCPA 1R4NB 4CCMA 1VQ7Q 3J7AW 2AIRB 2R5AA 2B8AA 2CW0F 2VKHA 2ZZDA 2C06A 3ULQB 1G2BA 1QA6A 2A28A 4BHCA 4UC4A 3VYGA 2XC7A 4E7IA 1NJIC 4MQ9F 2L8DA 2KMUA 2WY7Q 4XLCA 1PG5B 4IRGA 2OAZA 2D6FA 1RAAB 2LJ0A 1ZLJA 3VRYA 1IAWA 4EGZA 5CYVA 5D7UA 2DNUA 1SFUA 1YI2T 1BIAA 1QVTA 3MAJA 5HDGA 1Y96B 4HKEA 1YJWA 3GTOJ 2YUOA 3MEUA 4L59A 3FM5A 4HLXA 5TRDA 4PFOA 3DKWA 2QASA 4OMQA 2DI3A 1OQKA 3ESWB 3CLOA 2M8EA 4BXXJ 1Y71A 4QVZA 1WJEA 2IRFG 2NYXA 4HRIA 3S16J 3E9FA 1U9OA 5HLGA 4ENNA 2A7YA 2YDLA 3TCJA 2F5VA 4JZ4A 4JOMA 3WG9A 1E3PA 2MW8A 4M72A 4MIMA 5FROA 1U2WA 5JI6A 3SWNC 2X3XD 1MW7A 1QRYA 3GF5A 3ZMUA 1PUFB 1RLQC 3M0UA 1PJRA 2O9SA 3C95A 4QQ6A 1IC8A 1YQAA 3KX2A 3VODA 3CMAT 3MJXA 3A01B 5E3OA 3VRZA 3OYDA 2W25A 3JSOA 2DTIA 5HOOA 1GXQA 1QZZA 3BW1A 4FE4A 2O3FA 1KU7A 1S72A 3CC4I 2FRYA 1B9MA 3EFRA 1JHHA 2OTJT 3LLRA 2DOEA 5FKLA 2YUNA 1YI2A 3L42A 1YS7A 2QQBA 4W1UA 3G73A 5EGOB 3R0AA 3M59A 3LA7A 2EB7A 4WF2A 2VBZA 3A0BC 5EYRA 3I4MJ 2A69F 4XTXA 5GAGJ 5GAN2 3BR5A 4A12A 1I3AA 2JN6A 2JNGA 3EG9A 4R56A 1N8RC 3FIFA 4UUVA 1W5TA 2JZYA 1G2HA 1KJWA 2CS7A 2CUDA 5IOYA 2HL3A 1USTA 3H41A 4M77D 3JCMh 4ETSA 5K7ZA 3ASNH 5LJ5d 3D5RC 1QCFA 3TEDA 2WBMA 1LE8A 5CVJA 3CCJI 2J6FA 3CCRT 2D9TA 1KD1R 4HX7A 3CMAA 5GAMd 2XAJA 3MWMA 2RNGA 1M1KC 1OULA 3ULRB 1OI1A 1Q81U 1MBEA 1TTHB 1M5Q1 2M16A 2F4IA 2OTJA 3DBLB 1FLIA 3VS4A 1RUOA 4ESRA 5ILUA 2LBFA 1TWHJ 3M8FA 3K70D 3RMSA 1FJLA 1GHCA 5GAN7 2LP0A 3SD4A 1R5GA 2R0QC 2KP6A 1YITT 1WPYA 2VODA 4PLIA 2LY9A 2WY8Q 1U5TA 1IF1A 3E3VA 4CZZA 3BQYA 1V4RA 3OBYA 5KCOA 2YX7A 2DW4A 3I56I 3ZMVA 4I6ZA 1E2XA 2RQTA 1KC8C 3E97A 2OTLI 1YWPA 4UHTA 4FE7A 4LG3A 4D8DA 1GLNA 4RM3A 1VQMI 1JXMA 2RQRA 4M7AA 2W85A 3RZDJ 4RAFA 1UGPB 3E6CC 5LD2C 2KR3A 3SFIA 3LQQA 1W70A 3CJNA 1QCNA 1H0MA 1D5YA 3K0LA 4J9GA 3JB9D 5F08A 2RAEA 3HG9A 3JAMR 3EGDA 5HS8A 1GUUA 3EYYA 3LNQA 1L0OC 1B72B 8ATCB 1W36C 1QVGA 5DUIA 3JRBA 2OI3A 1YOVB 4LOCA 3TEEA 2MSYA 3BTLA 3L09A 3JCMX 1YIJQ 1YHQQ 5JHUA 2IA2A 1L3LA 4FYVB 2MA3A 3URGA 2LCSA 3FB9A 1I50J 1D3YA 1YITA 2EIMH 1K0SA 2BXYA 3LGLA 1U3OA 2FUG2 2VUBA 2DO7A 4RGUA 3ER0A 3MKLA 4M75A 2JW4A 3VUBA 1PRLC 4RA2A 4KT0E 3MCZA 5ILVA 4A3CJ 4NBQA 3DP7A 2Y69H 2COWA 3M53A 1R1VA 2ECZA 2Q2EB 3C3WA 5FKOA 2OX7A 5GJWB 3C7JA 1K76A 4R8HA 4U7DA 3C1DA 1UGRB 1IO6A 1PRMC 1VQ9I 2X35A 4BY6B 5JR3A 1H641 3LGFA 2KBTA 2EH3A 4IZZA 2QWWA 3FXOA 1JXSA 4M78A 1BR2A 1ARKA 2CH4W 4KIBA 3OMGA 2EZHA 2GQQA 1G83A 1BJAA 4A53A 3SDGA 3C12A 5LGTA 4YIIA 2KT1A 3HPHA 3OSFA 4M7DE 1KQSP 3O8HA 3TW6A 3ABKH 5L3BA 5CJ9A 2P5VA 2E7WA 3U1KA 2PVOB 2LF8A 3BG9A 2IVMA 2WADA 1PP8F 5BPDA 3MO8A 1A6QA 4AT1B 2DA3A 3CTAA 1WGSA 2HOAA 2I5UA 3SYTA 4UNOA 1X69A 1OLTA 2ROLA 2VGNA 5LJ5e 3EFSA 2FD5A 1XGNA 4M3FA 1JEGA 4DBQA 3SHWA 2STWA 4CC3A 2HZDA 2JOYA 4Z02A 2KIUA 5GAMe 1MJ9A 2IPQX 5HK3A 3G2BA 5GAMf 1OYWA 1X1DA 2M5WA 2K2VA 1JT0A 3OMCA 2XKOA 2RO0A 4HDUA 1ZSZC 1OCZH 2VN2A 3KYDB 3QWLA 3RIRA 4IL6C 2P0TA 1VYTA 3OL3A 1X2KA 4F92B 1I07A 2J06A 2DO3A 4NOYA 3BR3A 1X6GA 2C6YA 3OYGA 2Y75A 1NBEB 2HXOA 4ZDLA 4LD6A 1IO2A 3MQ0A 4NHJA 1WJQA 1K9MR 3HRTA 4I99C 1X01A 2X4WA 1EH6A 1TWAJ 3RKYA 3GX4X 2CREA 2M45A 2XROA 4I98B 4XNFA 2CP6A 2ED0A 4DA4A 3DBRB 4JDSA 2GWRA 4XRFA 2KNBB 2QEXQ 3E0JB 1AWOA 3CCJA 2NVTJ 3HRSA 2H09A 1HLVA 4JQFA 3FJPA 3FJ5A 4M9ZA 1E17A 2LH9A 5C4JJ 1RR8C 3I53A 2COZA 1X6BA 1QW1A 1FYMA 5HY6A 1UB4A 1FC3A 1XGOA 3UATA 2YSRA 3H5AA 4Q47A 3RKXA 3EETA 5C44J 2KT8A 3KEOA 4NC8A 3RPQA 1RI7A 1X75C 2KXCA 4QW2A 1EF4A 3CCQI 4DOZA 2CRGA 1ENHA 2M4GA 4C2MJ 1G59A 4FW2A 2PMZN 5K5RA 1DPUA 3RJPA 2AQEA 3GZ5A 1IGNA 1JI8A 4J7IA 3CDLA 2MH9A 2OBPA 1I5OB 3G6EQ 2ACJA 3JB9H 4BY7J 3BZCA 3VEPA 1WI3A 1U06A 2O2OA 1IW7F 5CKBA 2A61A 5KHDA 1FYLA 4X9DA 1O3SA 2HQXA 3DPLC 3HSRA 2VJIA 4ESFA 3BTJA 1OPCA 2NVQJ 1WSUA 1AOJA 2DL8A 4F3QA 2YXYA 1DQUA 4IHTA 1IV6A 5E3NA 1E3OC 3S17J 2DYRH 1J75A 3I55Q 2L2OA 2OAWA 5A0LA 2RQUA 2G7HA 1U5SA 4J9BA 1H3ZA 4C8QC 6AT1B 2BY2A 2RQWA 1ZA1B 3GUDA 2FXAA 4B9XA 2E19A 1TH7A 2XGCA 2L2PA 2RGVA 4YIRX 1HBXG 1BW6A 3IV5A 4CICA 3F0CA 3D5LA 3QYGB 3I58A 4BJ6C 4G8XA 5TJJA 2MUNA 3NEUA 2QKLB 2ID3A 5GANj 1Y39A 3JCMP 5LJ3g 4FYWB 1MMAA 3HHGA 3JRHA 1G3WA 1X1CA 2L4AA 4BJ5C 2JS0A 1OR7A 3EUAA 1VQ4T 3BZKA 2SEMA 2STTA 1VQ5T 5KVRA 2IAIA 2XAUA 3MKZA 2Y9ZA 1S1NA 2LNVA 4BHBA 2R7ZJ 3VYSB 4PK4A 2RHIA 3QZ9B 2YWWA 4QQDA 5L23A 2ISZA 3ZQFA 3I5SA 2LOOA 4J00A 3G1JA 8AT1B 5BMZA 1O57A 1G4DA 2DVJA 1H88C 1OU8A 4BY1J 5IT9Z 1AWXA 4BUPA 1SHGA 2P5LC 1STZA 2WV0A 4PJNA 5LHHA 4Q48A 5IY5H 2EYQA 1GXPA 3CCUT 1JU5C 2HQRA 3IH3A 1TQPA 2XGDA 3HIFA 4OMLA 3OW2S 1OMIA 2OJ2A 2LF7A 3TW7A 3HSBA 4F55A 4PFPA 4FSSA 1VQOQ 1SVOA 1OFCX 1UE9A 3MD2A 1CSKA 2XK0A 5KH6A 4EMKC 2G7UA 5GAEJ 2E5NA 4S04A 4L18B 3NMZC 5CAIA 3FHZA 2QEXT 1M1FA 2QXFA 3QPLA 2XAQA 1SD7A 2CQNA 2VWFA 4AFSC 5HLTA 3JR9A 3P9IA 5D8LB 2MLKA 1YBYA 2VL8A 4B3AA 5J3BA 1JO8A 3P8HA 1SAXA 3VV0A 4QIWN 4M75C 4N4IA 2R7RA 2XAGA 1OU9A 5DCMB 2QGFB 1VQ4A 3DCFA 4ZZLA 4KUDK 3AG4H 4EJOA 2BZXA 2HQ5A 3RESA 1VQ5A 2NRAC 1LJ9A 2CSQA 3DBHB 2K9NA 3H1CA 3DTIA 3M57A 2FB7A 1CF7A 5BPIA 1YN8A 3BP8A 2EGAA 2ME0A 2W57A 2MPXC 5BNGA 2DPDA 2O03A 1F1BB 1WX6A 1DPRA 2JA7J 2W4SA 2DBBA 5HVQC 1TOVA 3U23A 3CC7T 3CCUA 1F43A 4L9TA 2O88A 2BW3B 4LGWA 3ZN0A 1ZARA 2NNYA 5J6XA 3GXOA 3G71I 1VFCA 1Y07A 2EQJA 1R9TJ 1WYXA 3M5AA 4C92G 3RPUD 3BR6A 4HV6A 4QPQA 3W6JB 3WU0A 1M8VA 2BY3A 2A6TA 2DA4A 2OZUA 2HSPA 4FX0A 4FTHA 4HVUA 4QT7A 1AZEA 2AXLA 3ZQ7A 3C0CA 1BR4A 3OYFA 3Q0VA 2FPDA 4KN4X 4JRKA 3CPWP 4PJLA 4KT6A 4I0BA 3DLLF 2OAUA 4FT8A 4NUBA 2BEOA 5IXBA 3EGXA 3A5ZB 3CCST 4F7ZA 4PJ0C 1ZUKA 1YIJI 2CUEA 1YHQI 2LX7A 4HF2A 2DL5A 4HCKA 4C5IA 1K73R 3M0RA 2OUMA 3KP4A 2L9VA 2PI0A 4F7UE 1USSA 4RGSA 4ANJA 2BIVA 1O4XA 1VYVA 1R1UA 3QJ6A 4DBHA 1RAIB 2M35A 2RREA 2IS1A 4UUSB 3R4KA 2V7FA 1B8IB 2SRCA 1Z9QA 4KULA 1NG2A 1S3JA 3RCOA 3LSKA 4BS9A 1R71A 2BZ8A 4I0AA 2CW8A 1TSFA 2Y0SA 1ZQ1A 1W0TA 1WXUA 2PZ1A 2R7OA 3R6NA 2OF7A 4A3FJ 2KRSA 4HBLA 2HOTA 4B3XA 5IYBJ 2QYOA 1PKSA 3H0GJ 1MUZA 4DGWB 2R57A 1RI9A 4KH1B 2FJ1A 2W24A 2ZMEC 3LA3A 3J81Z 2CGHA 1UFFA 1XN7A 4KIFA 2CFOA 2R7TA 4FU6A 4FYXB 4JRQA 4XLAA 1Z21A 3TQNA 2DETA 1JUMA 1TWBA 5ERIA 2EIFA 2W0ZA 3DF8A 3CCSA 3A01A 4ZC3A 3T8RA 2VONA 3H3UA 3M3YJ 3HRUA 4M3DA 1AKHB 1CKAA 2WSEE 1LNXA 4D6WA 3I9V2 2EQUA 1W1WE 2K3XA 3HOVJ 1MHNA 4JX6A 2EW3A 3G1LA 2ZJ2A 3NARA 4LDUA 1K0XA 3AG1H 4DOVA 3LFKA 1RUNA 3J80R 1RACB 4CHUA 2GTOA 5C3EJ 3D7SB 2EFIA 3PFYA 2AKLA 2DTHA 5JVTA 2DJZA 2K6DA 2HBWA 1N6AA 3K4KA 3S3OA 1SEMA 4AIKA 2Y0MA 1BI0A 1O7FA 4ZN3A 3OBWA 4GLKA 3CCEI 4J19A 3LSMA 3TSWA 1TWGJ 2HVSA 2DJNA 3JCMf 3CXCA 3JRDA 1D09B 3TKYA 4RUGA 2RQQA 2ZPIB 1NLPC 2PG4A 1J09A 3IP4B 2FEIA 4RDUA 3F21A 2GBQA 2X4JA 3HKSA 4MTDA 1ZHIA 1VQNT 1IUFA 2K9LA 1P92A 2EKHA 4OIQF 1LUJB 2GOXB 2JSPA 3JRGA 3S2HJ 1VQ6A 4PJOG 3KLNA 2R7UA 1MBHA 1ACMB 2Z5UA 3A8MB 1MH4A 2BHYA 4ENJA 1W0UA 2G0EA 3MEXA 4AG1C 2PFBA 2JRTA 1YJ9I 2CT4A 2YT6A 2V9VA 1UUEA 2A08A 3DU5A 4BE2A 3BCBA 1TS9A 1P6RA 1P7IA 3GLLA 1TU0B 5KYNA 3WGHA 3M0PA 3UT1A 4K2EA 3L2UA 1EIFA 4M77C 3JRCA 2Z2SB 1HW1A 3KE2A 2VLAA 2GXAA 2EQMA 3AT1B 2FBKA 2HVQA 2HKNA 2DLPA 1B1BA 3ZXSA 4BXFA 3IRRA 2MI6A 4JYKA 3HM5A 2QBYB 5ECAA 3HPWA 2C0OA 3G6EI 2O4XB 4E2FB 1MKMA 1UGVA 2JQ7A 2DOAA 2DA1A 1OKRA 3FM3A 1SAUA 1APLC 3HTRA 4OMOA 1QO0D 1VQNA 2R5YB 1J5YA 3Q9VA 3ZQGA 3ECOA 4Y4RA 5D5UB 3AG3H 3RDVA 1K8AR 3D5SC 4HQEA 1QU3A 2BY1A 4YG2F 4L9VA 3VYUB 3HL2A 5GMKm 4QTRA 2K57A 4XSZF 3I55I 2QGGA 3L2RA 2NUTB 1K9AA 1MGQA 5HCKA 3J81K 3KYCB 1KZHA 3ZMDA 4X0GA 1EZZB 4XLEA 1UEBA 4D7NA 5EEAA 3TU4K 5CVVA 5K1YA 2MG4A 3H3VK 4UV9A 1NPPA 4MMKA 1KD1C 1M2VB 1NJIU 2E1MB 5E3LA 1B4AA 4LLNA 4E7HA 4NQWB 5GAMj 2LNHB 1B9NA 3PM1A 4CCJA 3PGGA 1J7KA 3RERA 3CPFA 3C2GA 1IN5A 1I3QJ 2AKKA 3L00A 5M9OA 2HTJA 4G7OF 3MP6A 2P81A 1V5GA 3WTXC 1PM3A 1IV8A 5AIQA 2M3AA 4ZGEB 1R7JA 5CK9A 3BDUA 4XLPF 4RAZA 2M02A 2V9PA 3EUHC 2IGOA 2Z1DA 2NVXJ 1F9NA 3A4CA 4GGGA 5KK1A 3PIOF 1X1AA 1WFWA 4IUPA 1U1TA 4ENMA 4J9FA 1P4XA 3CDIA 5J4VA 1FSEA 2LT1A 1ON2A 1PHTA 3OOPA 2RHYA 4CZCA 1VQ8I 3MPUB 4F14A 2KK4A 5GAHJ 4ATOA 4EPCA 4PUSA 2MBFA 3OS2A 3SWNA 4G6QA 1ABOA 5H6QA 2PMHA 1VQOI 2BKDN 4C92F 2IP2A 3VS6A 4C0DB 1XMXA 2D1VA 2FPEA 2VPRA 1XGMA 2XG8D 1S7OA 4J9DA 4U0VA 2QSFX 2KRNA 3JSCA 2TRTA 1H89C 4LXCA 3I56Q 3KP2A 4Y3OA 3ZQQA 4BBRJ 3HOWJ 1DU6A 1Q81R 1FOYA 2VPLA 2RJFA 2OTLQ 3HGGA 1VQMQ 2EBIA 2OV7A 1SC7A 3THKA 4IVNA 2NUPB 5DTDA 1UAAA 3HOSA 2R5ZA 2VXEA 4C8QE 2Y0SN 3QHSA 4N4HA 2P4WA 3MMYB 4F16A 4V2GA 1UGSB 3RPUA 5KE2A 1E7OA 2F4MB 2FHDA 2XSDC 3HPGA 2VXFA 4BH9A 5IT9E 1VIFA 1Y1VJ 3JAMZ 2K3YA 4F7UA 5FLXR 3QODA 1OV3A 3PVLA 3ZGKA 2WB1A 2HU9A 2UUZA 2CYZB 4C92B 3H5NA 1W2BS 2IW5A 4XRMA 4IUVA 1GRIA 2DA7A 2MD0A 3PNTA 2IS2A 3FEOA 4Z2YA 2CS3A 1R4MB 2LLKA 3JTHA 1QPMA 4R79A 1OJLA 1T33A 2IVWA 2MGQA 2M34A 3OIOA 4OVAA 3X20B 2V1NA 1YJNI 5HS7A 2OD5A 3PMIA 2ZO4A 4CRIA 1UFMA 4V19K 4M7AE 3VYHB 3JRIA 5GMKh 3BJOA 3O8GA 2QUFA 2R7QA 3LSGA 1XTAA 4DBRA 1FMVA 2ECBA 4IRIA 2LT4A 3ZQHA 3CC4T 1X1PA 2KISA 2L7KA 3HJEA 3BJAA 2HGCA 1FTZA 2F5KA 4XU0A 2K27A 3KZIC 5D4RA 4BI4A 2HMAA 2DRKA 1X4OA 3QWYA 2XRNA 1MMNA 1KC8U 2M0CA 3BOQA 1QBJA 4GCVA 5CQYA 4I7HA 2K86A 2EA4A 3Q3SA 1WHLA 3HC7A 4E7SA 5LHIA 3C4SA 3M4GA 1RKWA 4ZYDA 1WH5A 1BBZA 2HSEB 4MLOA 2ZSHB 1VQLI 3QP6A 1X19A 2L0KA 1QLYA 1R8OB 3K7AJ 2XB5A 5LJ3e 2I8DA 2GF7A 4M75E 4D1QA 2E1CA 2FZGB 4ENKA 2J05A 3CCJT 5LJ3f 4KIGA 2YPRA 2L9SA 4A3IJ 2X4YA 3QYHB 1IXCA 5D6FA 3FHNA 3W3CA 4G94A 4B48A 5LEJA 3GVAA 3PMTA 4C0FA 1VQPQ 3TP3A 1KQSA 3CC4A 2NS0A 4WCGA 2BBYA 2R93J 3F23A 1X2QA 3FXQA 3MVPA 3DU6A 2COBA 4M78E 4LITA 1Y0MA 2GFUA 1RNLA 5D6EA 3QPHA 3QDFA 3L2WA 3S1NJ 1I1JA 4FT4A 4KH0B 3KZZA 4PJOF 3SHFA 1Q82U 2AO9A 2UXXA 3RYPA 2MZ4A 4HG2A 2QM3A 2LRQA 4IURA 4Z89A 1HK9A 1SD5A 1K78B 3EHRA 2DK3A 2TCTA 4DOWA 2DYBA 1S6LA 4KUMA 2FZKB 1X6OA 4M6YA 1JJ2P 3KXTA 2LRDA 4IQ4A 3L9FA 2N8GA 1FNNA 2VKDA 2QKMB 3QAHA 2EFPA 4YFXF 4J01A 1SFOJ 2JTVA 4ASNA 3A52A 5HS9A 3GOXA 4XRSG 1FOWA 4P5OA 1UG0A 3J81E 5F27A 1AZGB 2KXDA 2O5RA 3EUKL 3ROUA 2J5PA 4RTXA 2HWVA 4A3GJ 2CV2A 1T98A 4AFUC 3JAMK 2JA8J 2A0FB 3BY7A 3LYIA 2VB6A 3V8JA 2DU9A 3UPUA 2HAXA 1QCOA 5E1XA 4PJOB 1BBYA 3OYCA 1TZLA 4KRTA 3CC7A 2CGPA 1MBKA 4FSXA 3WHCA 3CQTA 3CCQQ 4D8KA 1V5FA 1Z3YA 3SXYA 3G1OA 1HKSA 2ENMA 1R1TA 3N4MA 2JM9A 2JMCA 3MCAB 5DM7R 1KHCA 5D6YA 4OB0B 4XKBA 4CO8A 4RAYA 4D7MA 3WU1B 2PJRA 2YUSA 2FOWA 1VYUA 2DZCA 2YRDA 3KP5A 3HHTB 2VXDA 2XAFA 1P2FA 3GFLA 2EK5A 4EM0B 1AD5A 1X1BA 2X4HA 1N27A 1RI0A 1UJ0A 2KGTA 2XI9A 2YSQA 3CMEQ 4BY6C 2F6CA 1W2BP 3FDRA 4XN0A 3A8GB 1ZSZA 3KZYA 2JVGA 3CCLI 2XDPA 1VQ9T 4BYYA 3GTQJ 2QENA 5GMKi 5DD8A 4B43A 1M1EB 3RBBB 3W6VA 2ZGWA 3DB3A 4FHTA 3M0QA 3OSSC 2PQWA 3EG1A 3U9GA 4IUTA 1B59A 2ELJA 1M3CA 2CQQA 4BUGA 3B6CA 1WGXA 4RGXA 1Q86R 1OX8A 4Y52J 1UG2A 2ESNA 3REAB 5K5OA 4Y92A 2PX9A 4UY8I 1I27A 3J7ZI 4C92D 5IPAA 5EEHA 2P7VB 2PN6A 3GMEA 4CYDA 1MSEC 1P9QC 4UB8C 3CCMI 3S15J 1I4K1 4A93J 4EJUA 1LCKA 3QSUA 4BNCA 2DQRA 1DGWY 3PSIA 1MNMC 2LJ1A 4A4EA 2LKXA 3O5ZA 4BACA 4E7KA 2LMDA 2DD5A 2FQ4A 3PNWC 3WVEB 5FRMA 3GZNB 2L5QA 3FKIJ 1UCRA 4HX4A 2YLCA 3OIPA 3GIBA 1HJDA 1I8FA 1LKXA 1QVUA 2FA5A 3G4SQ 2KT0A 5ICEA 4J9IA 1NK3P 1SD4A 1VQ9A 1D0ZA 4LDVA 2FRWA 3O8VA 2HL5C 3MHXA 1LEAA 1H8AC 3A02A 1IREB 4L9NA 3F8BA 2HOEA 1BJZA 6PAXA 1C6VX 1ETVA 4YFNF 3BTCA 3ZCOA 2DJQA 2MAMA 1BI1A 1T56A 2VC0A 3C18A 2AZVA 1NK2P 3M1EA 1FP2A 1Q7YR 4V2FA 2LZ6B 2ESHA 2R4GA 3F6OA 3IKTA 4EATA 2XKPA 3ONQA 4CI0C 3HGYA 1PC0A 1RPWA 3M8JA 3NRVA 2YRCA 1WHMA 2VUMJ 2Z0WA 3BFMA 2WC2A 1AKHA 2DAQA 5AT1B 2DLLA 3MKDA 4C8QA 3S1RJ 4M77E 2JTEA 5CCAA 3CJQB 1R49A 2RH2A 3JCMg 1VQ7T 5F1RA 4AU7A 2AZSA 2KKOA 4ZYGA 5GAN6 2OC6A 1FZPB 1LB2A 2RK1A 3O6BB 3TL4X 5M3MJ 1YO5C 2VYTA 4BBSJ 2D8JA 1OCOH 3L1PA 3ABLH 3QZ5B 5GMKl 3IKVA 1V3FA 2NUZA 1FYKA 4PSWA 1QVPA 4E47A 1TTYA 3LAJA 1UECA 2DL7A 1K73C 2C0IA 4ESBA 5KYXB 3QPTA 2K5IA 1TNTA 3H9GA 3X26B 1WH7A 3IWZA 2DX1A 1GXIE 3BPVA 4EEFG 4AG2C 3G71Q 3ZMZA 3WTYC 1SFEA 1WFXA 5LGUA 1A36A 1YX3A 2HOSA 3CCRA 2PMUA 4YTLA 2VQLA 2RJDA 4BGDA 2GFAA 1NM7A 4ZTJA 1PSEA 3WODF 1XOVA 1SPKA 2TDXA 1ZELA 4CC4B 4CA0A 1LFBA 2Q1ZB 1HSQA 1VQ7A 5M5XJ 3Q5FA 2E3IA 2Y90A 3ECHA 1MJBA 2A3SA 2JUCA 4JP0A 1OCTC 5FLVA 3BROA 4G7ZF 4CGZA 1GFCA 1MMGA 2DM1A 3S6WA 4EMKA 1S5LC 3JB9F 2RHZA 4PJOD 1A0NB 4BKXA 2DMNA 5JLWA 2E2HJ 4L0YB 3CPWA 1QVFS 1YJWI 1AHJB 2KHMA 2F5TX 2LVSA 4MZTA 3IQLA 4GBQA 2XF7A 3C2BA 4BB7A 1FMKA 2IEKA 2P7CB 1Z7LA 5A0DA 3CF5F 4KA4A 4IUUA 1M90U 4I02A 5EJCA 3KIOA 4FT2A 3RQ4A 1V55H 3R0JA 2XDDA 4OB1B 3FDYA 2QSGX 1OZ3A 5F0FA 5A2QR 5FW9A 2XGEA 2ZAEA 3FMSA 2DA5A 3ZN1A 5LLQA 2B63J 2V9KA 2WSFE 4A4KA 3JAME 3PQKA 2GCXA 3EQLF 1WJBA 3REOA 1T95A 3JRFA 1JTYA 4FISA 3EFOA 2EV0A 2COYA 2XPUA 4GRIA 3S3MA 2ZCFB 3BTIA 3PIPF 1S72I 3CJTB 2XDBA 1SRLA 3GF2A 1ZR4A 4B1RA 2EVRA 4FW1A 1Q1HA 4BE1A 5M3FJ 2J7IA 4EMHA 2B86A 2MOXA 3SEQA 3J80Z 1FYNA 1VQPI 2ZXIA 4NQWA 1ABQA 3UDCA 2MC4A 1MNEA 3QU3A 4MO7A 4A4GA 1Y6IA 1G3SA 4KMFA 5E8IA 2CYYA 3PO3J 2BE5F 4B09A 4BQNA 2E41A 4PKCC 1KQ0A 3CCEQ 3WG7H 5GPAA 2I2LA 4A0YA 3R61A 1ON1A 2G9WA 2QG9B 1HKTA 5KYYB 1KFZA 1P7JA 2A36A 1EFNA 1K4TA 4A6EA 2CP7A 4LUEA 2R58A 4XBFA 2FBIA 3CMAI 2L7MP 4O5VA 2ISYA 3WGIA 3KYLA 1R58A 2BOLA 4F7UF 3IH2A 2EFWA 2E2JJ 2M8GX 4BQOA 1M1KR 2DXIA 5H6RA 5K5QA 1ZGAA 2KIQA 4F17A 2YU9J 5JHFA 1IDYA 1AOYA 3VS5A 4JJDA 2RHUA 2ZMEA 4LB5A 1SSFA 2GIZA 1M3AA 5K7FA 1VIEA 4HF1A 4KGXB 1D0YA 4XMYA 2LCLA 3RYRA 2QVOA 1O9SA 2KYMA 5DD4A 1R00A 2RVCA 4PCQA 1YJ9Q 1KGSA 1POGA 1KQ8A 3GBQA 3JREA 1K8AC 1YIJT 1YHQT 2A5YB 2VV5A 1RLPC 1A6IA 4ZNXA 2A5WA 1TLHB 2MCNA 4M7AG 2VKVA 5IAYA 5J8FA 3F8CA 3SDZA 2H8HA 1EH7A 2FG0A 3MEAA 4KGVB 2ZJQF 3PNVA 5F1JA 2Y31A 3TO6A 2VOOA 2RF0A 1IGUA 3ABUA 2M0OA 1SKUB 2DPPB 2D5VA 3DLMA 1IRXA 4LG0A 3IL2A 3CMEI 1K4US 1S9HA 2L3DA 3LWFA 2VJ4A 3BG7A 3ZPLA 4NDLA 4XU1A 4AFZC 1TQMA 5BQTA 1FPQA 3E7LA 3G7ZA 4C3IJ 2MH2A 2ICWG 2CMPA 2DT7B 2W48A 1JRIA 1QQJA 2PUKB 4R1HA 4KISA 5HK0A 3R60A 1WHHA 4CH7A 2LG4A 5F64A 5IP7J 2DBMA 3W2AA 3BR0A 1O3QA 1J3TA 4HCBA 1C1AA 4JK1X 4PJJA 3MKYB 2F5DA 1FXXA 3GNGA 5LJ3j 3DKYA 1T6SA 5EG0A 1JHFA 4CCNA 5LRSA 1YIJA 1YHQA 2XPWA 2CW7A 3IRQA 2E1OA 3ZR8X 4XTWA 4MGRA 1OYXA 2DT6A 5EC7A 2YU3A 3K2AA 4DQ2A 5B3SH 3ASKA 2EWNA 3NAUA 3LX7A 1ZX6A 2K3BA 3META 2L01A 4HNUA 4E6KG 1TT5B 3HB9A 3P9CA 2YUQA 4MDWA 5GAN4 3ZMSA 1N75A 1WA7A 2JMWA 5D4SA 3HUGB 2KFDA 4M6XA 5KNLA 3IAS2 1FOKA 2VOPA 2DYIA 3CP8A 4M78G 1MH3A 3J80K 2WAEA 4A0XA 4HSRA 2QA4I 2R7XA 2RNJA 3NTKA 1WI7A 2JS2A 1Y0NA 1I6HJ 4OU0A 3G4SI 4M3EA 1BR1A 3H0IA 2RI3A 3CD6Q 5DS9A 1F1ZA 3MEVA 2QQSA 4C2TA 4IF4A 2LD5A 4DIQA 2VQHA 2IJLA 4UUTA 4AIHA 3WTUC 5IYDJ 2VBXA 1D1AA 1FTTA 2KZGA 2DFEA 1AWCA 4ZZDA 2ZPEB 3QBYA 5IHKA 1PDNC 2OQGA 2HVRA 4O3MA 1AA7A 1YE9A 1M8MA 1VQ8Q 3HSEA 1MDMA 1J59A 3NFCA 1B34B 2EJFA 4JRPA 4BDYA 5GANh 2DMUA 5IN1A 3OW2P 3IAM2 4XKWA 3OSGA 1UHCA 2L89A 4U7BA 1FSHA 1R5ID 1OOTA 2KAFA 5DYMA 1H9TA 1WRJA 2DODA 1NLOC 1JJ6C 1Y7XA 2D8HA 4OMFB 1R0CB 1UB9A 2H1LA 3E2UA 3EG2A 1T38A 3OYIA 3RSNA 1RQ6A 3X24B 4M77A 3A98A 2P0QA 4RM2A 4RLQA 1YJ9T 1WNLA 1Y8RB 1SANA 2KRFA 1KD1U 2X6YA 4A3EJ 1M9SA 1KU2A 3ABTA 5J26A 4H4KC 1RADB 1Y56A 1WZ2A 3CO7C 3JCMd 4YIFA 5E17F 2OJED 3ASOH 1Y57A 2VT3A 4JZ3A 4UXNA 2YRVA 1MNDA 2QQAA 1YWOA 4BEHA 2DK8A 3CC2I 4RLFA 1CKBA 2EJ9A 2I0NA 2QTVA 1IGQA 3RZOJ 4OP0A 3ZEHA 5GAOr 4A4HA 1A31A 1XSVA 1HW2A 4JX5A 3G6ET 1ERDA 2VQGA 4ZDPA 4AVZA 4DBFA 5CR2A 5FLXZ 1HF0A 2EINH 1W1FA 5ICGA 3EUHA 2H6CA 1BI3A 3EGUA 4ME7A 3BY6A 4DW6A 3I35A 4ZYAA 5EZHA 4B44A 1YFHA 4CCOA 5CO7A 2KY9A 4ELYC 1IRGA 3TREA 2DN0A 4HYEA 1U8BA 1OYYA 1UGQB 2MWPA 1JGGA 4FM4B 4BE0A 5GAOl 4N4GA 2QEXA 1YJNQ 1VQKQ 1FBQA 3I4PA 5IT3A 2RN8A 3BPXA 3H9JA 2VKEA 3HSFA 2EA2A 3K4BA 3RTRA 2FEZA 3I55T 4X9CA 3AKZA 4FIBA 2XIGA 4HW0A 5J1YA 2LFBA 2HPIA 4DZPA 2E1MC 4KYWA 5AIPA 1BOBA 1MBJA 1O3TA 3GTPJ 5IHIA 2ZBKA 4RTYA 1K4SA 2O01E 5FKKA 1D8KA 2M9UA 5GJVB 2WA0A 3ZL7C 2K7LA 2P6TA 2RQVA 4ZTFA 1QVGS 2L7FP 3CUOA 5L3EA 2JA2A 1XDSA 4M9XA 1TQIA 1XCVA 1JQQA 3SEMA 5B1AH 1Y96A 2ZPFB 2ZKZA 3REBB 2RDPA 1YCYA 3S32A 2XICA 1AWWA 3G6EA 4P55A 1HCRA 1IUYA 1K6OA 1YCSB 5K7HA 1U1SA 1K7AA 2DOFA 1HSTA 1UDLA 4LDXA 3GTJJ 3OOUA 1E3HA 4NS5A 1VQLQ 2KDOA 2KYBA 1GV2A 3E9GA 1MIJA 3VOEA 2DERA 2HDCA 2V8JA 4N9HA 4OAYA 2CH4A 3E5UA 3F22A 3JTGA 1X3UA 2LDUA 2R7DA 3I55A 3LA2A 3GFMA 1IZ6A 1PUFA 4J6WA 3K4MA 4OF1A 4JS4A 4AM3A 5IT9K 4D5FA 1J9IA 4XTYA 1WQ7A 4C0DC 1K6YA 4L5IA 1UMQA 5GADJ 4IOAF 1SHFA 2CZ6B 1VZ0A 3QOEA 3M0TA 4BD3A 2X6OA 3UR3C 5BS6A 1VQOT 2M0YA 2DA6A 4A3KJ 4XLNF 1G6NA 4OMNA 5IHNA 1YIOA 2L3RA 4J9HA 2GIVA 4RAGA 3GEZA 5DCFA 4II3A 4PGHA 5B66C 2RA2A 2CV0A 5LFAA 2DDBA 3OSVA 2IPOB 2ADUA 3MN2A 4LJZF 5FO5A 4OOIA 4IHSA 5E3MA 1TWFJ 2EIKH 4MEYF 1DP7P 5EGOA 3MP1A 2O0YA 2LQKA 5GAOp 2A05A 3K6GA 2CP0A 2KE9A 1NTCA 1T0FC 4C30A 4FETA 1LE8B 4HX8A 1PWTA 2X6WA 2HDWA 2K3PA 5FFXA 2NAZA 1N78A 4M7AF 3JCMe 1TBXA 2CUZA 9ATCB 4CC2A 3GTGJ 4C92C 3P7NA 2DD4A 3KP3A 3QWXX 3DPTA 3FXJA 5I2MA 3WTSC 2DQLA 4XN3A 4EM2A 2CWEA 1NH3A 2WACA 4B4CA 3TGNA 2CO5A 2RMOA 3NTIA 5FLXK 2LQWA 1JJ2A 2LBFB 2HD0A 4RG8A 1VQOA 1O7LA 3T8TA 3OWTA 4NB5A 1M4ZA 5J47A 4M7DF 1H9GA 3VFZA 2HZTA 5EDNA 1YJNT 1U5TB 2R7WA 1DU0A 4JJNK 1K9MU 2HNIA 3TDZC 1Q86C 1ETKA 1TP4A 1RETA 1VQ5I 4L5EA 2HDDA 4AWXB 5ILSA 3HOXJ 3UKGA 1MV3A 1ZBXA 4A3LJ 3CEYA 3J80E 3MZYA 4OIPF 4XKVA 2H1KA 1VUBA 3M8EA 1SD6A 1SRMA 4C5HA 3FWEA 2LTPA 4UVCA 3S8PA 4EJVA 2JTFA 4M75F 4M7AB 4ELZC 3LFUA 1NPRA 1HYOA 2EQRA 2KROA 3NPFA 2JJ7A 2NVUB 4ABZA 3DEEA 7AT1B 2F48A 3OA6A 3PFSA 3CC4Q 2DFUA 3CCLQ 3DB4A 3CCUI 1C0WA 3H9QA 1T2KA 2K9GA 5KYXA 3V42A 2QSHX 2RK2A 1RZ4A 3EGDB 4OWRB 1WJFA 1SMYF 1K79A 5FB2A 3P9KA 3R6SA 3BR2A 3RKQA 4KBMB 2ZJPF 4NNJA 3C94A 5TISC 4M78F 3CCYA 2CH0A 5CKTA 4A5NA 1O3RA 3HOYJ 3H0FA 2IGMA 4IUQA 2MFZA 4PL6A 2YX4A 3ZOBA 1B72A 3KEYA 2FNAA 5CVRA 3TOAA 2JA5J 1FOXA 2LDMA 2JXBA 1D0XA 3CCMQ 4ZJZA 3TO9A 3HOTA 4J7FA 4IOCF 2D1XA 3LWIA 3CF2A 3G3ZA 5CVIA 4ZYHA 1S7EA 2VXZA 2CG4A 2HI3A 1OCPA 3CMMA 4Z88A 1Q7YC 4M7DG 1UELB 1S29A 3IHUA 1Z77A 4M71A 3T0YA 4LDYA 3VSLA 4IXAA 4XR6A 1ZQ3P 2FO0A 3AHUA 2VASA 1KYZA 3RQIA 1H8KA 5FWBA 4XORA 2JZ2A 4GYIA 4J9CA 4F52A 2MD5A 4M3GA 1RRJA 2X51A 3CO6C 3E6MA 1Z7UA 5L3DA 2Q2EA 2O61A 1ZK8A 2IGKA 4C9YA 1M3BA 1ZBJA 4J8OA 4M78B 3VS1A 3I9QA 3LH5A 1OCCH 2DMTA 3K4NA 3P8DA 3F8FA 4XU3A 2XHCA 5LJ3d 1WJAA 3BG5A 4EQQA 4RTWA 4UVAA 5GAN8 3PL8A 3KPHA 5FD6A 2X4XA 2V4JC 2HQNA 3CD6I 4XICA 1UJ8A 1ZGJA 2EFQA 5E20A 5LJ5h 3F8MA 1ZG5A 3CCSI 3L2ZA 1XS9A 2X9DA 3H0DA 3FISA 1T3LA 1IJWC 2V1RA 4PJOC 1X2MA 2ECCA 4GXOA 2CKKA 5GAMh 2GBYA 3QPSA 1N77A 1R22A 4YELA 4KMUX 2AHJB 2UV1A 4G6TB 4PLLA 1BYMA 1TNSA 2P84A 2LMJA 2ZB9A 3H6ZA 2XPVA 3JCMW 2V26A 2FE3A 3A03A 4U0YA 2KIMA 2K3FA 4FQGA 3WE3A 3Q0UA 4LN2A 5IXFA 3HHHA 5LJ5g 2CUBA 4OIOF 5L3GA 4MEXF 4BI3A 4RMNA 1W4MA 4I2OA 3IC7A 3OQ5A 4OMMA 2BVMA 4B6MA 4OB3B 4RTZA 2LC2A 4PGGA 1KU3A 2VC8A 3TO7A 3GLXA 4RBOA 3WVDB 4IQJA 5LGNA 3HFOA 1RL2A 5KYYA 3U1DA 2O31A 2XU8A 4LFUA 4DYCA 2RD1A 4J5YA 2E5QA 3CCLT 1KHIA 2DMQA 2GLOA 1LOJA 3HDDA 3S1QJ 2KQRA 2X85A 4M3BA 4N0BA 4YEJA 1N8RU 1XDUA 2E60A 1KA8A 1Y8QB 4XRSA 4RTUA 5GP9A 2FNPA 3JV3A 2XVCA 4J83A 2O8XA 4ORZA 1VQ6I 2W82A 4MTEA 2BTTA 4OMPA 4RCBA 1RR7A 3HXLA 5CKEA 3K10A 4RB3C 1TW3A 4WWCA 3PFIA 3BZ6A 3VSKA 2P8TA 2Y48A 2F2XA 2PNIA 1BU1A 4OGEA 3VKIA 2EYYA 3Q9SA 3H8ZA 2LYCA 4R0KA 2PUOB 3FBNB 1TW2A 3B6AA 1D5VA 1VNDA 5FGMA 2H3JA 2MMPA 4CDGA 2QYZA 1M1KU 1VQKI 2EFOA 1PP7U 1HD3A 4XM3A 2E35A 2OZ6A 1YJWQ 2GNCA 1BB9A 5IH2A 1LFUP 3CP2A 3M7GA 1BN5A 2BZYA 4MFDA 3G1MA 2FF4A 4KNYA 3NWSA 3IH4A 3L1AA 2E3HA 2K9SA 3CCVI 1GVDA 2PVDB 5D6XA 3GP8A 3K4LA 2QI2A 3C2HA 4EIKA 3CCLA 4Y13A 3LSIA 5A2QZ 1WKMA 5FD5A 2ZFUA 3OL4A 3I54A 4DJAA 4M77F 2E4HA 1HW5A 2CZ7B 1V1CA 1K73U 3QP5A 3OMYA 1M27C 2CP2A 3UNGC 2EYXA 4AIDA 4RTVA 3SDBA 5HNFA 3O2PE 1JKRC 1HQCA 3M4OJ 2EGEA 2P0KA 3NHNA 5FLXE 4DEXA 5J39A 5KYUB 2LNBA 1M90R 2Z99A 4Z8AA 3F3XA 1KG1A 2R7VA 5E1ZB 1MMDA 2BZTA 3E5XA 3TDUC 3JB9G 5LHGA 1S72Q 4LIUA 2K85A 4A0ZA 4N4NB 5EZGA 2KIFA 4LLLA 2QAZA 3JB9I 2ZC2A 1YI2Q 1D1CA 2Z3YA 4ZYEA 3BR1A 3ME9A 1F36A 4UB6C 5KAFC 3L2QA 2P5KA 1QNTA 3PUFA 1Z91A 4BDZA 2D2WA 2P0PA 4TVRA 1JKOC 3UWNA 3JCMQ 5HLIA 3VYRB 1QKXA 4AMCA 4QVDA 4M73A 4A3BJ 3GBGA 5JLXA 2K02A 5FFZA 1V29B 4O6JA 2KLOA 1WXTA 2HQHA 1DP3A 1YW7A 2HKXA 3B73A 4AUXA 1WQ2A 3FZVA 3CBMA 4WTOB 3FLGA 3OYAA 2O7OA 3I56T 1PYVA 1ZSGA 2KMTA 2KSSA 2RN7A 3A1PA 2YUPA 4C2UA 2OTLT 1RC9A 4K11A 3H92A 4NL3A 1VQMT 1N9RA 3VB2A 2BUDA 3CMAQ 1BM9A 3FF5A 5KAIC 1QMCA 3SFZA 1JGSA 2WV1A 1Q81C 1HXDA 1SFXA 5DLOA 3F8NA 1XJWB 2PQ8A 2R7FA 2WTEA 2OTJQ 1WI9A 2OU2A 4WXDA 4YFKF 2AK5A 2ZXWH 2K9MA 2M30A 3LSPA 2Y30A 4LK1F 2CZ0B 5GANf 3M9QA 2VE9A 2ZPBB 5FU7B 3FMQA 1I5LA 4EDUA 1ETXA 2FL7A 2VI6A 1WJDA 2XF5A 2JM8A 4HLYA 2DAOA 3CXCS 1FIAA 5I21A 4WXHA 2HEQA 1M1GA 1U0JA 2DK5A 4HA8A 2CFXA 5CIUA 5DCMA 2LTOA 2Y4YA 5J40A 3I64A 3PUBA 5J3LA 3HZJA 3V7SA 1BCOA 1AWJA 1RUWA 3KFVA 3I56A 5D5WB 2FOKA 2GOMA 2K5LA 2OTLA 4UV8A 2IBDA 2FMYA 1VQMA 4F7UG 1QKWA 1QWEA 2HYGD 3RMQA 1E6GA 5F6FA 2BYVE 1UG1A 2V1XA 2E5KA 1SG5A 2F5EA 2EJRA 3EG0A 3A8HB 4BHPA 5DUKA 5GTHC 2BW3A 2K4YA 3MEWA 4UVBA 1OISA 5A2QK 1O75A 2F2WA 1G5VA 1FP1D 5H20A 3BE3A 1JB0E 5I2SA 1LPQA 4LIVA 2EBPA 2H8RA 1G3TA 2FBHA 3EGXB 4P9FA 1YITQ 2BGCA 1NE8A 3FIWA 5GAOq 3UA6A 4MMLA 1S72T 3WTWC 4EJWA 2XIDA 4A3MJ 3JCMV 1ACIA 4M7DB 2BXZA 4FASD 2MF2A 3WGGA 2DVEA 3QUIA 4JBAA 4E7ZA 4A6DA 1R6RA 1GCQC 2DPUA 2JN0A 4L5JA 1Z6TA 1VQPT 1K8AU 3I59B 1TC3C 1V76A 4C92E 1WIEA 2BVLA 1Q95G 4XK8E 2QA4Q 2VQCA 3QYFA 2WAFA 1W5CC 1ZN2A 3OYLA 1W6XA 3HYIA 2EAYA 5J8CA 1VA7A 4Z6YA 4UUSA 1B8IA 2ZXJA 4D9JA 2DJIA 5DEQA 1WPKA 2PJPA 1X3ZB 3WTZA 5GAOm 2FYKA 1R77A 3K4JA 3K1PA 2HKQB 3ZQCA 2O6GE 3H5RA 5GAN5 4P9UA 3K69A 2HS5A 2EPFA 1U8RA 4KDPA 2DMPA 1NHAA 3DLLA 2LY2A 1I1GA 2L02A 4QQGA 2WB1N 1YRNB 5CKHA 3SFMA 3CQZJ 3VDXA 3TSZA 2CSIA 1BC7C 3F6VA 1N25A 2Z9OA 5FJ8J 3L2CA 3AL0B 1B7TA 2LQ8A 1ZA2B 1LDDA 2K5CA 3F72A 1IXRC 4L0ZB 1LQ1A 2DYSH 2P4TA 3QYEA 3NTHA 1VQPA 4OMZA 1PKTA 2PMZA 2ETHA 4L9JA 4XSXF 4QKUA 2DXBA 3OW2A 2NOJB 2P6SA 4MHGA 5M5YJ 1BC8C 2V1QA 4XLFA 4NL2A 3TVTA 2IA1A 4V2SA 2M4KA 2V6CA 3AAFA 4QPOA 3E19A 3KUFA 3NWTA 1PCXA 3CCQT 1WCMJ 3S2DJ 4C3JJ 3HTSB 1YLFA 4XKCA 3CC2Q 1QP3A 2HYJA 2F2VA 4EMSA 2GA2A 2M7AA 3OYEA 2CT3A 5GPCA 1PD1A 2B0LA 4LD5A 1AHDP 4IPAA 1N9SA 4RB0A 1U3EM 3CMET 2V79A 3SEZA 2CQXA 4XLHA 5ED4A 3ZQLA 2V1UA 2PEXA 3N05A 3SZPA 3M54A 4LE9A 2GTJA 2YR2A 1NEBA 2XAHA 3CMYA 1Q1VA 1BCMA 5FKNA 1MBFA 3VS2A 2X3WD 3K1NA 3H3ZA 5JVGF 2IIMA 3HL8A 1K83J 1Y0UA 2JVHA 1I81A 3OB9A 3PQJA 1YS6A 3PE0A 3BC8A 2XD0A 3WU2C 1ZLKA 3PTAA 2GA1A 2UXNA 4IHYA 5E79C 5A0GA 3LW5E 3PO2J 3ZQIA 3DPUA 4B8XA 1Y1WJ 2MK5A 5AYFA 5L3CA 4HF0A 4DEYA 1Z6RA 3CCQA 1XPXA 1I5ZA 3BT9A 2GAUA 3VWBA 4G6DA 2NLUA 3S2WA 1X4PA 4GO1A 4HQMA 2EQIA 1QVFP 3VYTB 2EGCA 4GLMA 3PSFA 1BK2A 1BOAA 1XQHA 2DEUA 4KT5C 1P4WA 2QLZA 2K9QA 3CMEA 4HXJA 2EV5A 2QA4T 1Z0XA 1GL5A 4KITB 4Y17A 1REPC 1PSFA 4CYCB 4NC7A 3QG1A 1XTDA 3G4ST 3I71A 4PJOE 2QBYA 3M07A 3SZTA 3ERED 3H0HA 4C0ZA 2O4XA 1XSXA 1EA3A 1YX5A 2A68F 2H8WA 2KJCA 3QKJA 2O9LA 1WHUA 3SQNA 2JUFA 3CUQB 1ETOA 1DDNA 5FU6B 3BDDA 2EKOA 2CP5A 2EYZA 5CQXA 1ZYRF 1ZUYA 2R5YA 1F5TA 2LY1A 1KU9A 1OQYA 4OB2B 4PJMA 2DTRA 2F4OB 5KYWB 2DXUA 3GNFB 1U78A 5LRRA 3V4GA 3VS0A 2L3PA 2NUTA 3IWFA 4GYGA 4HPQA 4I09A 3OV8A 4AVPA 3OS0A 3X25B 3FRNA 1Q82C 2KRCA 1EH8A 1IRZA 1W4SA 1YI2I 2ZSIB 1CGPA 5CKFA 2KL4A 3EHQA 4M7DD 1IRFA 4RB2C 1UHMA 4XONA 2O8KA 9ANTA 3TP0A 1A5JA 3OIQA 1BKBA 2EZKA 1D3BB 2DRMA 2O9VA 4DNCA 1HA8A 2NYSA 1LFPA 3FBIB 2VC1A 3DV8A 1LJOA 2QA4A 4HNTA 3OYHA 4IEJA 3H35A 3G4SA 4KGZB 4J6XA 1QZEA 3DEUA 4PFZA 2QF7A 1HDPA 2OCCH 2RQPA 2K79A 5A2QE 5J1RA 1KQSS 3CC2T 2BE7D 1IG7A 2ZCWA 2Q0OA 4XIDA 2WWYA 3RI4A 1YFNA 1W7PB 2CDTA 4E6RA 1EKEA 1GBQA 1EJ9A 4Y28E 1TL8A 4C8QG 3M1CA 4MZPA 3SWNB 5LJ5f 1GV5A 3T5XA 2VJJA 3L7WA 3G71T 1XMKA 4A2UA 1BL0A 4II1A 1MJAA 4S05A 1ZGWA 1VF9A 1RIOH 1GDTA 2CJJA 2HFHA 2XUBA 2MYSA 4M6VA 4CCKA 2OTJI 4X6AJ 2GQVA 4JPBW 1SF9A 1VQ4Q 1KK7A 1QHHD 2ZJRF 4Q5SF 4PNOA 4ZH4F 3INZA 2XB0X 1VQ5Q 2GXBA 4HNVA 1LPLA 2R7SA 4XL9A 1Z1DA 2DTZA 4II2A 2E71A 3BG6A 2DE0X 2R5ZB 3DTKA 5C4XJ 2MC3A 4Q4ZF 4H0EA 3SZGA 1T3SA 1WJRA 2E65A 5HKCA 5IP9J 3CCUQ 3DXJF 3QXEB 1IZ1A 2BV6A 2EIJH 4AYBA 4DZJA 3PIOA 3CC2A 1HC8A 2L3QA 2NUPA 1T8IA 4F7UB 3ISPA 1U9NA 1S7AA 3QOPA 2L3SA 4MFEA 2ZXHA 1T0FA 1HOMA 1TXQA 1J2XA 4N0AA 3CCRI 1DJ7B 1ITYA 1QWFA 2FZCB 2B7EA 3M0SA 3T9NA 3G71A 2M2EA 3OR2C 2JT1A 1JUSA 3OYBA 1UZCA 3MKWB 1WXBA 5GTIC 1JKQC 2J6KA 3X28B 2E10A 3DTEA 1SFKA 5B5EC 4C92A 1VQ7I 4D0PA 2I10A 4KN7X 3OYMA 3KP7A 2MABA 2E2IJ 1IHVA 4LK0F 1ORKA 3V7RA 1RABB 2RB6A 2WSCE 3EH1A 1YITI 4LMYA 2GM4A 1W5SA 3DLAA 4HT8A 4M75G 3HTUA 4BI8B 4CCLA 3EDPA 4HZFA 4I76A 4XK4A 2E34A 2XDVA 2B9SA 2KEAA 1JJ8C 2QQRA 3BDLA 3I5RA 5GMKe 2FRHA 1IDZA 2QK0A 1Q86U 1D1BA 2AXTC 2IA0A 3CC7Q 3S93A 5DV5A 1FBSA 1KQ2A 4IKFA 1TUCA 2EV6A 3A2KA 4OIRF 3M55A 1WWXA 3FK6A 3DKXA 4BQAA 1AVZC 4RCCA 1KIKA 2ME6A 1FT9A 3E5QA 1QQIA 4A63B 5ICCA 4RG2A 1UTIA 1AEYA 3JRAA 3VPRA 2D0NA 1SSHA 2LCCA 2VJ5A 5J1UA 3FX3A 3WTTC 1ZREA 1IN4A 2A6EF 2LX9A 3Q1JA 3N5BB 5LJ3h 1NJIR 1KQ9A 3CCET 2VKNA 2QTXA 2ZFWA 2KDZA 2DZ9A 3R6OA 5KYUA 3CCSQ 2W1OA 4IHWA 3I3LA 4P96A 2HZYA 2NNNA 3JCUC 1TG0A 2FPFA 2DF6A 4G12A 1WHGA 3H36A 1ZRFA 1LEBA 2OA4A 3WXMB 3OYYA 4HT9A 4U0WA 1ZHFA 4C0GA 3HOZJ 1U5TC 2X48A 5TGTA 1MV0B 2KQWA 4B9WA 2HKOA 1IN7A 1FMWA 5J4YA 1Z9CA 2GQIA 2W00A 3K9TA 5L3FA 1JBMA 1J0RA 4GFBA 2A37A 2K40A 2V1DA 3QIIA 2IGNA 2FMLA 3FMRA 4EGYA 2MLGA 3GO5A 2CZ1B 1Q7YU 3CBPA 5BOXA 1X3WB 2WAQA 2IS4A 4M7AC 2HXIA 3SJMA 1ZG3A 4BQQA 3HKZA 3GTLJ 2AHQA 4KICA 2Z16A 2F69A 1ZR2A 3JCMb 2FSWA 3RNJA 2DCEA 5GANg 3FXRA 2OPTA 1WQWA 1IHWA 1BW5A 3GYHX 2RHXA 4GY5A 2E64A 2XMFA 1MD0A 5EG2A 1K78A 3ML6A 2JRMA 4F91B 4L6V5 4GDFA 3LH0A 4Y91A 4EM1A 3CCEA 2AQFA 5AONA 1GFDA 1GT0C 2A3LA 4E70A 5HLHA 1OYIA 1Z05A 5FKMA 2FQ3A 1A35A 2EYWA 2JPBA 4RTTA 1VQ6Q 4NC6A 1T0HA 4ZGDB 4D5CA 4DYQA 1HSJA 1W7PD 5CQGA 1R0BG 1BI2A 2K4BA 1UHFA 2LKSA 1PVEA 2FU4A 2ZNZA 4JX4A 2DIQA 2E1HA 3LSTA 2NWMA 1OPLA 3LL7A 3EPZA 4IX7A 4IJAA 1B6AA 1MBGA 5FWCA 1LVAA 3AG2H 1PUEE 2LP5A 1N8RR 2LJ3A 1M90C 4PJOA 4RB1A 2PJRB 2HYFA 2RM4A 4L5GA 1YJ9A 1W2BA 2RI2A 5D5XB 4ESJA 1SMTA 4E4HA 5LEKA 2QDYB 2V6EA 4U87A 1XNIA 1ZSZB 3PVQA 3CCVQ 2KI7A 2YHTA 3RR6A 4M78C 3CBOA 2JTMA 3DKMA 3FXMA 2DL3A 4F04B 1QVGP 1V54H 2KPMA 5ICFA 3BLYA 1XX5A 4A4FA 1XG1A 3B02A 2QDLA 4Y33A 1VQNQ 2PTKA 4RS8A 3A8LB 5E18F 3I0TA 3OYJA 2DILA 2K4JA 1XGSA 3K1MA 3W2WA 4N4OB 3COAC 1SVMA 1JUPA 5EF6A 4OAZA 3X2QH 2L0AA 2ZPHB 3M58A 3QDRB 3FK7A 4X34A 3CLQA 4M4ZA 2HCKA 3CPWS 4HAMA 1ZAOA 3CD6T 1NYFA 1NYGA 1ETQA 2E6ZA 1XC5A 2KJBA 3JCMc 2D1HA 4YRVA 4ZGJB 2FVUA 2K7AA 3RUXA 2JUGA 1KC8R 2E12A 2DTOA 2AS5F 1VQ8T 3E1SA 2NVYJ 4QLCU 2IG0A 4C5GA 2JJ9A 2XKOC 2DA2A 4M7DA 2BHZA 2R5MA 4C8QF 1WJ5A 2NS8A 3BQZA 2Y9YA 2RPNA 1V5EA 3JB9J 5F0CA 1ZH5A 2EILH 2KZVA 3I59A 2QGUA 3RKWA 3A1YA 1RAFB 2RJCA 2LK2A 1ODDA 1TWCJ 1X27A 3GWZA 4A5MA 2HPMA 4M77G 3QO3A 4Q5WA 4PDKA 1MMSA 2EFNA 5C6SA 3D0SA 2COMA 4AYBN 3QRFF 3EG9B 3PT9A 4FL6A 1BA5A 3DFGA 1WHKA 2AT1B 4J6YA 4JUVA 4CC7A 1ZKGA 4N0AC 4HDVA 1XD7A 4FX4A 4I01A 4E7LA 3CD6A 2HNHA 1ETYA 3HFNA 2H27A 1OX9A 2VBWA 1ULYA 3DEWA 1M2OA 2XGXA 4AFQC 2DKGA 5HDKA 1YRNA 1Q82R 4C8QB 3LSJA 1VQ8A 2E6NA 1VQ6T 1W36D 3ELKA 2MIOA 4RGRA 1E0EA 4IIMA 2W7NA 2HEOA 1MZBA 2ID6A 2KRHA 1AT1B 1XB4A 4PSXA 4EVIA 1QP2A 2JMAA 3ZFJA 5GAN3 3HEFA 2G3RA 4RMOA 1VTNC 3GW2A 1JTXA 4IRHA 2HBPA 1RAGB 3OS1A 1S8NA 2PLYA 2E70A 2F2EA 1VQKT 2LR8A 1IN8A 1VQ4I 3LSRA 1JKPC 2V8KA 4BXUA 4WCIA 3W6KB 1K61A 3TMOA 1YTYA 2D0QB 3QJYA 4IO9F 1B3QA 2C0TA 1R5HA 4Y15A 2X1CA 3P8BB 2DFIA 1HKQA 2E5ZA 3CCVT 5CKDA 3HP9A 2RV8A 2H94A 2CUFA 2VGMA 1FIPA 3E6DA 4X1VA 2ROTA 4MDXA 4F93B 3VJPA 5E8GA 2HQAA 4M9SA 2Y4XA 1FX7A 2EZLA 1RESA 2JSCA 4JS5A 2P0WA 3WE2A 2M7BA 5HDNA 3J7AO 3TBIA 2M1HA 1OZ2A 3U2RA 4CUGA 1FBUA 1OCRH 3KCCA 5CLSA 4AD9A 1R23A 3BCAA 4EV0A 3SB2A 2QEXI 2EPDA 3O3KA 4MNUA 2DEQA 5I11A 4S0HB 1VQLT 2ATCB 1Z3XA 4EMKB 3HRMA 5F0HA 4MZMA 4HV5A 3M9AA 1HDDC 1F4KA 1OEBA 1YJNA 1VQKA 2XF6A 2GZWA 1OR7C 3NQOA 1U6GA 3JRZA 2DIGA 2VE8A 3WTVC 3OYNA 2L4MA 4BL0B 4E7JA 3J7AY 1UJYA 2VT2A 4QWQA 4M75B 1WJCA 2QQ9A 2WAQN 4QVCA 2DXTA 2ELKA 2X1DA 1NG6A 3HKZN 3QQAA 2CV1A 1WZOA 3RDIA 1ONVA 2VVKA 3CCVA 5CPRB 1IXSB 3CESA 2ED1A 4LD9K 2M0MA 2A6HF 3CC7I 5CVUA 4RKUE 1JE8A 3KEQA 4VUBA 5I22A 5KE3A 3PJRA 2JT4A 4CYCA 1IN6A 4HVWA 3BWGA 4HOBA 1M2VA 4JLIA 5LBQA 2R92J 2X1EA 3FXLA 2UWMA 1D8JA 2GGRA 2HR3A 5GAOn 4HCCA 4LNPA 3LQRA 3KETA 3CUQA 2KRMA 2CSOA 5DY9A 2VBYA 3BJ6A 3FXUA 3I5UA 3J7YJ 3K70C 3EFOB 2ZNYA 2CU7A 3DQVC 1VQLA 4MQVA 1ZUUA 3UA7A 2EQKA 1ZRCA 3E6BA 5KCHA 1JXOA 2DFHA 4X1EA 3W2VA 4AIJA 4A3DJ 3KLOA 3VU3C 2W10A 5FU7C 2L9NA 2DT5A 5KYWA 1Z67A 5LJ5j 2QCOA 3UF4A 4XTZA 4KJZA 2K5FA 1DUXC 4QSHA
chains in the Genus database with same CATH topology
3ZMTA 4P5NA 1I6XA 2F5CA 4CXFA 2DXCA 1I1SA 4XTUA 4TV7A 3J7AF 1D3BA 3VUZA 1UHWA 2V8IA 5JFRA 1MGTA 4OMYA 1ZRDA 2E1NA 3QU6A 4ON0A 3KP6A 4G9YA 4HCZA 5GAMg 2EJGA 1QGPA 2X0LA 2XHKA 5LL6S 1XCBA 2YLBA 1YYVA 3CDHA 3EAEA 5GANd 1W7PA 1ZG1A 2PU9B 1KQ1A 2UZKA 2W84A 3PIPA 2ZMEB 4PZJA 1WJSA 5C0MA