1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
3ZN1A 3V7SA 3WU0A 3EYIA 2L02A 4EMSA 4L5IA 1I27A 2QYOA 1PP8F 3E19A 2IA0A 5L3DA 3U2RA 2HGCA 3RKXA 3ECHA 3NEUA 2WTEA 1UB9A 3J81Z 3KP4A 5D5WB 4YFKF 1G3YA 3KE2A 3GX4X 3EUHA 5JFRA 3NQOA 5LGNA 2O03A 2B0LA 2GA2A 1S3JA 2H09A 3ML6A 2HWVA 3FM3A 2CQKA 3L7WA 5E20A 2GCXA 3EETA 1TQIA 1OYWA 3H92A 1F4KA 3BOQA 1R7JA 2F5EA 1K6OA 3KLNA 3ZMVA 3MWMA 2O8XA 5TJJA 5J8CA 1KYWA 2EFNA 2HEOA 2NRAC 4M73A 4I7HA 3ZMUA 3KZYA 1JHHA 3E5QA 4GO1A 4HAMA 4HZFA 1YQAA 1KU2A 4KICA 5DD8A 1LNWA 3F8CA 1J75A 2C6YA 3DEUA 2VT3A 5H20A 4BHPA 2QVOA 2E7WA 4G7ZF 4WX9A 3HRSA 2X0LA 5JVTA 2NYXA 4YIIA 2H94A 2A6HF 4A6DA 2LX9A 1TNTA 1R1TA 4L9VA 4KIGA 2PMUA 4EJWA 4RGSA 2ESNA 1D8KA 3F6VA 1ZGJA 2RKHA 2V79A 5FGMA 2K7LA 2EFPA 4OIOF 2PJPA 1P4XA 1MD0A 1K78B 1T2KA 2JT1A 2OA4A 2DK5A 2HR3A 4KYWA 1MZBA 4ZYGA 2VC0A 2JSCA 4MQVA 3U9GA 1BIAA 3F3XA 1IN6A 3LA7A 4UHTA 3RKWA 4KUMA 5JHUA 1F9NA 3WTVC 1PDNC 3CTAA 3HIFA 1XDSA 2ESHA 1YW9A 1L0OC 3WTUC 5AONA 1C0WA 3I54A 4Q4ZF 4PGHA 5D8LB 2EV5A 2A07F 3D5LA 3LQRA 5D8KB 1XGNA 1DP7P 4MQ9F 1H9GA 2YPRA 2GQQA 4XLPF 1WSUA 1U5TB 4ASNA 1UHWA 2K4JA 3E6MA 3C7JA 3DP7A 3M9AA 1P92A 3DPLC 2AS5F 4L9JA 2Y75A 4IHSA 4CHUA 3QAHA 2QQAA 2UZKA 2EWNA 1P4WA 2J5PA 3I71A 2KIFA 1J7KA 1SD6A 1CGPA 4M9XA 2VBZA 4AD9A 3VB2A 2XAHA 4RS8A 1BI0A 1P2FA 5E1WA 5HS9A 3LFKA 2IRFG 4ZYEA 1B1BA 4WCGA 2GA1A 3E6BA 1OPCA 1WWXA 3ISPA 4OIPF 3HTSB 2W25A 2FMLA 5BOXA 5EEHA 3J80Z 1G3TA 1P4AA 4FT8A 2LF8A 2OAZA 4ON0A 4G8XA 3RIRA 2RGVA 5E8IA 1ZARA 2UWMA 4BQAA 2CWEA 2K4BA 4ZYDA 1ZGAA 3J81K 1MJBA 2PI0A 1FBSA 1IN5A 2FSWA 3JW4A 2J5OA 4IRHA 1LB2A 4WXHA 4A5MA 3O2PE 1F5TA 2EFOA 2P5VA 3ERED 1IAWA 5H6QA 3J7AO 3NRVA 3W6KB 4HQEA 4ESFA 1TBXA 3SXYA 5LGUA 1T39A 4L9TA 4IRIA 3DFGA 3P7NA 3CO6C 4GYGA 3KZZA 2QZ8A 4OINF 3FF5A 3R0JA 4PDKA 4G9YA 3T8TA 2GZWA 3KLOA 3GEZA 4HV5A 4A0ZA 2L4AA 5LHGA 5ICGA 2BGCA 2ZFWA 4E70A 4YG2F 4MEXF 1T6SA 2Q2EA 3GVAA 3OOPA 3HSFA 2CG4A 2ZMEA 2D2WA 4LB6B 1BOAA 1Q1HA 4O6JA 1LDKB 3P9CA 5DUIA 3WGIA 4UVCA 2YX7A 2F5CA 1MJ9A 2HKXA 3MEXA 2EA4A 3QPHA 3FWEA 2Z33A 3FX3A 2VE9A 1V4RA 1B59A 1XGMA 1D5VA 3Q9VA 4P96A 5L3GA 2FNAA 4I2OA 2V6CA 1IXRC 3MZHA 3GUDA 5HOOA 3CUQC 4EM2A 4U0WA 5DCMB 4WXDA 1FLIA 1S7OA 3COAC 4HQMA 5IT9Z 4AWXB 4KT5C 2KIUA 4L0YB 3GWZA 3Q5FA 4I0AA 2UXNA 3EYYA 2O61A 1ZG5A 5AIQA 2RNJA 3ZP5A 4M71A 5F1RA 1IXCA 1B6AA 1FYKA 3Q9SA 4O5VA 5A2QZ 2IA2A 3P9KA 2H6BA 3DF8A 1I1GA 3P9IA 2IA1A 1O7FA 3VFZA 3JTGA 3QU3A 1KQ9A 2OD5A 5ILSA 3ECOA 1P6RA 2E1NA 5BPIA 1XSVA 3OV8A 3WGGA 3O3KA 3E3VA 3RJPA 4HF2A 4A2UA 1DPRA 3SFZA 3RKYA 2ACJA 1QZYA 4PCQA 2STWA 1R36A 2ZNYA 2L4MA 3QPTA 3HOTA 1XMKA 1J5YA 3ULQB 5LEKA 4CO8A 1USSA 3V8LA 3CDHA 3I58A 4KN4X 4HA8A 1R5HA 2P6SA 1FBUA 2JPCA 2FA5A 1T38A 2HTJA 2IT0A 1LEBA 2EV0A 1K78A 1KA8A 4G94A 3FXUA 4OU0A 4G7HF 1H0MA 4YFNF 2DT5A 2IW5A 1Z7UA 4PZJA 3CJNA 2V9VA 3LA3A 1XMAA 3F23A 2MC3A 1IZ1A 3GW2A 4UUVA 4Y15A 5BPDA 1SD4A 3I59A 4ZH4F 3ELKA 2EB7A 2PBIA 1ZHFA 2PFBA 3IWFA 3KEOA 1FX7A 1L3LA 5H6RA 2PG4A 2VBYA 3L9FA 4ENMA 2E1CA 5ERIA 2ZMEB 1NHAA 4M9ZA 4BHCA 2ETHA 3E5UA 3WTXC 2CYYA 2XAJA 2DU9A 4UNOA 2VC1A 4LMYA 2R7FA 4U88A 5HDNA 2XIGA 2IP2A 3LQQA 4LGWA 2R7DA 4ENNA 1T98A 1SFUA 3KP6A 1LDDA 4I09A 2RN7A 4UXNA 2VOOA 3JAMK 3W6JB 3C1DA 4KNYA 4EJOA 5LRSA 1HBXG 1FP2A 3BDDA 5D4SA 2VONA 3SZPA 1O3TA 4P55A 1FT9A 3RTRA 1O3SA 2P7CB 3DKWA 1UFMA 3WTWC 4UVBA 3WTTC 2DLLA 1XGOA 1YG2A 5FFXA 1BIBA 2FBHA 3DPTA 5D6FA 4R79A 4MEYF 1PP7U 3QP6A 2K86A 3FMSA 4A5NA 1G3SA 4LB5A 1RI7A 3IWZA 1RNLA 1ONVA 4MGRA 1YIOA 4GCVA 3GZ6A 2XUBA 2NS0A 3HTUA 2WWYA 4KA4A 1IW7F 3K9TA 1QPMA 3HOSA 1BC7C 3BROA 2EA2A 5LEJA 2YU3A 2W24A 1DPUA 4EV0A 1KGSA 5HS8A 2PQ8A 3BPVA 2H3JA 4ZZLA 1FC3A 2QLZA 3T8RA 5HLHA 3TOBA 3RPUA 3U1DA 1YLFA 4EVIA 2CGPA 4FX0A 3WODF 2M87A 1Z05A 3ABTA 3I0TA 2VBWA 3B73A 2JRTA 3M8EA 3G3ZA 1GVJA 1EH7A 2CW0F 4BHBA 2XHKA 5BS6A 2DPUA 3TQNA 5FD5A 1QO0D 1HQCA 3HRUA 5FFZA 2QBYA 3GYHX 4H0EA 2A5YB 1HKSA 2BE5F 3GFLA 4JK1X 1MGTA 3FMRA 2VOPA 2HYFA 3VODA 2HDCA 1CF7A 4WXCA 4XLNF 1KQ0A 4Y13A 1ZAOA 1J2XA 1I5ZA 3JSOA 3QRFF 2W85A 1QZZA 3F8BA 4CDGA 2A69F 3V8JA 3WG9A 2MH9A 1FSHA 4U7BA 4HW0A 4RB2C 3GF2A 4IRGA 4IPAA 5DDGA 2D45A 1BI2A 4I01A 2QWWA 4TV7A 4F7ZA 2P8TA 3ZMDA 4EJVA 3TDZC 3WTYC 2XAGA 1TQPA 3C3WA 1W7PD 3FHZA 3MQ0A 4FX4A 4QWQA 3F8FA 5E1ZB 1YW8A 2FE3A 2IPQX 2XRNA 4DNCA 4HDVA 1OR7A 2OQGA 3V8KA 5K5QA 3IRQA 1WRJA 5K5OA 3I5UA 3N97A 2DTRA 3GFMA 1W4MA 2M5WA 1HW5A 1FBQA 4Q47A 5FB2A 5HLIA 1IN8A 4IHTA 4RGUA 1ON1A 2MLGA 4A6EA 1IN7A 2HZTA 5J8FA 5LGTA 4BAYA 1KU7A 1XB4A 1STZA 2CO5A 2OU2A 4MHGA 3J80K 1BI1A 2A61A 3R0AA 2ISZA 1W7PA 1W7PB 2IJLA 5KVRA 5E8GA 4HX8A 5ICCA 2DW4A 4O3MA 2STTA 3R6SA 4AIJA 2KIMA 1KQ8A 3WTSC 2QBYB 2XAFA 2FBIA 3FZVA 3K1NA 3ZPLA 1TW2A 3HRMA 2OZ6A 1ZG1A 1XD7A 3I59B 1H9TA 3RDIA 4YIFA 2HQRA 3BJAA 2MD5A 2MLKA 3QOPA 2M45A 2ZXJA 4B09A 3WGHA 3BJOA 4EGZA 2QQBA 2M30A 5K5RA 2DQLA 1T0FA 5DD4A 5BMZA 2FBKA 1TW3A 2NNNA 1U2WA 4KIBA 3ZMSA 4XRFA 4A12A 5HS7A 3SQNA 2P5KA 1FNNA 3IRRA 1YYVA 1R58A 2NAZA 4KFCA 2FRHA 3F8NA 1LDJA 5JR3A 2FF4A 5HLGA 3C18A 2GXBA 2OBPA 3MZYA 3BZ6A 4LG0A 4A0XA 2DFIA 4L18B 1U6GA 5LRRA 1MDMB 1OYIA 4LFUA 2R3SA 4ETSA 3R60A 4JQFA 3LAPA 3DV8A 2RQPA 1R1UA 5CVVA 5L3FA 1MJAA 3S2WA 2LNBA 4RAZA 2VBXA 3IKTA 1ODDA 5DCMA 4UV8A 2QQ9A 3SHFA 2P6TA 5IT9K 2L54A 3IKVA 4MTEA 1F1ZA 1FPQA 2JPBA 4YFXF 2K5IA 1S29A 2DPDA 1X3UA 2QM3A 2BEOA 4B8XA 5TRDA 3L00A 1SMYF 4OMYA 2LKPA 1U5TC 1YS7A 1R1VA 5LHIA 1W5SA 1HKQA 4I0BA 1J59A 1IRGA 2RDPA 3V4GA 2XAQA 2XASA 1MKMA 1ZYRF 5CVRA 1BM9A 5FLXZ 4M6XA 3F22A 2K5FA 2XV4S 1S6LA 4NHJA 1XDUA 3ZN0A 1ZG3A 3KEQA 2K27A 1DUXC 1BYMA 4U7DA 2ZO4A 4EM0B 2K5LA 1WQ2A 1ZN2A 1Z1DA 4K2EA 4LJZF 2ZJ2A 3EDPA 1HW2A 1QQIA 5DV5A 4AIKA 6PAXA 3IC7A 2GIVA 1O57A 5D5UB 1IUYA 5CJ9A 3CUQB 3WE2A 1YO5C 3M1EA 1G6NA 2DBBA 1ZLKA 5HDKA 1SD7A 3H3UA 4Y17A 4AVPA 2HTSA 1ZLJA 4AIHA 4ZYHA 2L01A 2PMHA 5E18F 2OZUA 4XSZF 1EH6A 5HVQC 1XGSA 2LSOA 2QUFA 2V1DA 3LA2A 2XKPA 3F8MA 2DQRA 2PEXA 2O0YA 1Z9CA 3HHHA 2K02A 1S8NA 4KIFA 2H27A 3G73A 1R23A 2W57A 3FXQA 4CYDA 2QENA 2XROA 5LHHA 2VT2A 4ZZDA 1TLHB 4M9SA 4EJTA 3BP8A 2KKOA 3KP3A 4L5JA 3I4PA 4LLNA 1LVAA 1IXSB 1B4AA 3KETA 2VE8A 1S7AA 3F72A 1YFHA 2ZCWA 3K69A 3H3ZA 3BWGA 4I02A 4A0YA 3IHUA 1JHFA 1O7LA 2PN6A 1FYLA 2CFXA 2Q8KA 3PFIA 3M7GA 2CSOA 5D5XB 4Q5SF 4HBLA 2FU4A 4U0YA 4HYEA 1HW1A 3O6BB 2JZYA 2G9WA 3GXOA 3JAMZ 1FY7A 1SMTA 3HYIA 2RC4A 4M72A 1U5TA 2P7VB 3V7CA 4EM1A 2UXXA 5LLQA 4S05A 4ENJA 3LAJA 4HF0A 1HSTA 2V1XA 5F64A 4EJUA 5D5VB 1D8JA 1BC8C 5CYVA 4IJAA 3I64A 2FQ3A 4MTDA 3V7RA 4WWCA 2EJRA 3FM5A 4P9FA 1YW7A 4IVNA 1BI3A 2MH2A 1CF7B 1YTYA 2F5DA 1LQ1A 4L9NA 3REOA 2COMA 1XN7A 2GAUA 1G3WA 2KJBA 4IXAA 1RUOA 3ROUA 3HSEA 3E5XA 3WE3A 1RIOH 3TOAA 4G6DA 1A04A 2YX4A 1G4DA 1ZREA 4HV6A 4DQ2A 4D0PA 3KFWX 5CVJA 1U8RA 5CVUA 1OYYA 1Z91A 1MDMA 4RB3C 3TO6A 2FEZA 3K0LA 2ELHA 3HHGA 3E6CC 1ZRCA 1HSJA 4S04A 5ILUA 3K1PA 2H6CA 2XGXA 2NNYA 4OIRF 1EV7A 1ULYA 3WU1B 2PLYA 3PQJA 3RYPA 2ZBKA 3FXRA 4OMZA 4XBFA 3F21A 3BPXA 5D4RA 5IT3A 4M74A 1O3QA 2D1VA 1B9MA 4KMUX 4FHTA 1XCBA 2E7XA 3CO7C 5ILVA 2P5LC 4HX7A 1VTNC 1WI9A 2EV6A 1R22A 2ZKZA 1J9IA 4WK8F 1IN4A 2A68F 2OQRA 4R8HA 3MFKA 2ADUA 4R1HA 1XCVA 2F5FA 3HRTA 2JTVA 1BN5A 3N4MA 3R61A 3FMQA 5ICFA 3MAJA 4ESBA 4GYIA 5AIPA 4EQQA 1R00A 3VEPA 3F6OA 4QLCU 1SD5A 2HYGD 2AXLA 3HUGA 4KMFA 4BNCA 1FP1D 4L0ZB 3ZMZA 3RI4A 2BV6A 5LBQA 2M1BA 4XSXF 3ABUA 2XVCA 5D6EA 5L3CA 2EK5A 2KJCA 1QNTA 1YS6A 4U0VA 1U3EM 2TDXA 3GO5A 3LSTA 3PQKA 1K79A 5FD6A 4ENKA 1SFEA 4RAYA 4KDPA 3K2ZA 1SAXA 2Y48A 2YR2A 2IVMA 3QU6A 4LK0F 3EQLF 4HOBA 3ZQ7A 3LWFA 3MHXA 2M8EA 2DO7A 1FYMA 5J6XA 2Z99A 2F2EA 3VOEA 2BYVE 4Q48A 5L3EA 1TQMA 3ZMTA 5KK1A 4NQWA 5DEQA 1QGPA 3T0YA 3GFIA 2FOKA 2LDUA 3TO9A 1FZPB 4RB1A 1IRFA 5F6FA 3B02A 5DCFA 2EFQA 3RYRA 5L3BA 2VODA 2Q0OA 5ED4A 4RGRA 1RUNA 3GZ5A 4N9HA 2FNPA 4ESJA 1R5GA 2V1UA 2G7UA 1J0RA 1E2XA 1TNSA 5DUKA 4Z2YA 4G6QA 2HS5A 3KCCA 2HOEA 2RVCA 2K4YA 3M8FA 1IF1A 1LJ9A 3CLOA 4NB5A 4IF4A 1HXDA 1HKTA 3QP5A 2DAOA 5CLSA 1QW1A 4LD5A 1QBJA 2RV8A 2VXZA 3CUQA 5FO5A 2Z3YA 1UCRA 1Z6TA 2X4HA 2HKOA 4RGXA 4CGZA 2LF7A 2MBFA 2P4WA 1ZRFA 1WKMA 1ON2A 1EH8A 2FMYA 1GXPA 3BJ6A 5E17F 2O3FA 4OOIA 4OIQF 4HDUA 3RPQA 1FOKA 3IL2A 5EEGA 4GXOA 4BYYA 2HFHA 5K1YA 3TO7A 3WTZA 1E17A 1RZ4A 1B9NA 3HSRA 3KP5A 2FXAA 3KP2A 4WF2A 1TTYA 2DK8A 1BJAA 3L09A 3TKYA 1JE8A 4LG0B 1I6XA 5A2QK 4EGYA 3MCZA 4PGGA 4UV9A 5JI6A 3GLXA 1I1SA 1SFXA 5HDGA 2BBYA 2EFWA 1Y0UA 4UVAA 1K7AA 2VN2A 3I53A 4LLLA 1GHCA 3AAFA 3SZTA 4P5OA 3T5XA 3E6DA 1XSXA 2GXGA 4BH9A 4CZZA 1U78A 2MA3A 3CUOA 5BQTA 3TDUC 4HF1A 1PUEE 1QVPA 3JSPA 2L3DA 2Y0MA 1Z6RA 1AWCA 2W84A 4CXFA 4N9IA 2D1HA 2ISYA 1ZRDA 4P9UA 4M6YA 5ICEA 3BY6A 4N0BA 2DI3A 2GWRA 2G7HA 3DQVC 5FLXK 3D0SA 1JXSA 4HLYA 1DDNA 3TGNA 5E1XA 5DYMA 2KRFA 3DXJF 1OKRA 4BXUA 1V3FA 2WV0A 1ZH5A 4LLGF 1D3YA 1FSEA 2A6EF 1KU9A 3R4KA 4I98B 1REPC 1KU3A 4HLXA 1AOYA 3E97A 4MNUA 3GFJA 1FWZA 4GGGA 2ZNZA 2O6GE 2Z9OA 3JTHA 4KN7X 3T1BA 2A3SA 2YSRA 2XKOA 1BBYA 2Z5UA 2WC2A 3L2CA 2HQNA 4G7OF 1O3RA 1W5TA 4RB0A 4JBAA 4CICA 5CVIA 4LK1F 3KP7A 1GXQA 1XSDA 1OMIA 1KYZA 1LEAA 3K1MA 1JGSA 4HX4A 1UHMA 1USTA
chains in the Genus database with same CATH superfamily
3ZN1A 1ZQ3P 2JTMA 3V7SA 2LRDA 2XB5A 2L02A 3WU0A 4EMSA 3EYIA 4L5IA 2JMAA 2QK0A 1I27A 2YSQA 4C8QC 2QDLA 3RMSA 1VQMQ 2K3FA 2QYOA 1JKOC 4HCBA 3DLLF 4RUGA 4DYRA 1PP8F 1WI3A 5BNGA 3E19A 3NHNA 5HODA 2IA0A 4MFEA 2E1MB 2O4XB 1YIJT 1ETXA 4FSXA 3JCMd 5GAOl 3PL8A 5L3DA 2JZ2A 2E6ZA 1VIEA 2ZPIB 3U2RA 5GAN7 2AHJB 2HGCA 1ENHA 3RKXA 3ECHA 2E1HA 3NEUA 2WTEA 4XKVA 1UB9A 1B07A 2CV2A 3J81Z 3CC4I 3KP4A 5D5WB 4YFKF 3EH1A 2RQTA 5KE3A 1G3YA 4BJTA 3KBGA 1BK2A 4JRIA 3KE2A 4D9JA 2JXBA 3GX4X 3EUHA 1K9MU 2X4YA 3OR2C 5JFRA 3NQOA 1PSFA 5LGNA 4QQGA 3CCVQ 1X2MA 2K85A 2P0QA 1BL0A 4C8QB 2O03A 4B9XA 3K2AA 1PKTA 1B72B 5CKHA 5FLVA 3EH2A 2B0LA 2GA2A 1YI2I 5KYUB 2RQVA 2EJFA 1S3JA 2H09A 4LUDA 4M75B 1OZ2A 4RA2A 3ML6A 2HWVA 1X1BA 3FM3A 2R92J 1XX5A 2CQKA 1JI8A 4EPCA 1VQLQ 5LJ5j 1R0BG 1WH5A 4Z02A 4RCBA 3L7WA 1QVFP 5ECAA 2R57A 3H9NA 5E20A 2D0NA 2GCXA 3EETA 2BKDN 1TQIA 3HL8A 1S72Q 4M7AC 3CJTB 4KT0E 1OYWA 3H92A 1UGRB 4M75G 1F4KA 1XC5A 2X9DA 1DQUA 2M7BA 3BOQA 1IO6A 2HEQA 3X20B 1R7JA 2F5EA 2MC4A 3ER0A 1K6OA 4NC7A 1I4K1 2WA0A 3KLNA 3ZMVA 3MWMA 2F5VA 3THKA 2K9LA 2O8XA 2DMOA 4XU2A 3E7LA 2I5UA 4BDZA 2KSSA 5TJJA 2E34A 3CEYA 5J8CA 1RKTA 4JX4A 1LPQA 1KYWA 1JEGA 1QKWA 3UA6A 1R4NB 2PUOB 2EFNA 3X2QH 2HEOA 2NRAC 2ESWA 4KGXB 3RMQA 3UWNA 1YE9A 3CCSQ 2ZFUA 4M7DC 4M73A 2J05A 2QAZA 3GOXA 4I7HA 3ZMUA 4M6VA 4BQQA 2Y90A 3OYYA 3KZYA 1PRMC 3ABKH 2E2HJ 3GNGA 1JHHA 5C0MA 3E5QA 4GO1A 4F92B 2P84A 2OTJQ 1OU8A 2FUG2 4HAMA 3PFSA 1MMNA 1PUFA 3UKGA 1JXMA 1AEYA 1OCCH 1YCYA 2VV5A 4J9BA 1SG5A 4HZFA 3FDRA 3I56T 4BY6C 1YQAA 1OULA 4Z8AA 1KU2A 3M3YJ 2LNHB 2DOEA 2YS9A 4B4CA 1N5ZA 1BR1A 1GT0C 4II1A 1M30A 4KICA 5DD8A 1LNWA 3F8CA 1WCMJ 2WBMA 2DMNA 1J75A 2C6YA 3Q0WA 3DEUA 4G6TB 1TWBA 1VQKI 1UE9A 2O8KA 1EJ9A 2VT3A 2CV0A 2GTOA 5H20A 4BHPA 2QVOA 2E7WA 4QTRA 4AVZA 4G7ZF 1YNZA 4PJOG 3L2ZA 4WX9A 2OJ2A 1VQ7A 4XIDA 4XORA 3DLAA 2X0LA 3HRSA 1G8XA 5JVTA 1XJWB 1B7TA 3SZGA 2E2IJ 3GTLJ 2NYXA 1M90C 4YIIA 2BY1A 2H94A 4XLCA 2HL3A 4K11A 1IXDA 3FEOA 1MNMC 1Z3XA 1R4MB 2A6HF 1F1BB 4A6DA 4RM2A 1K73U 2LX9A 1TNTA 1R1TA 4L9VA 2CP6A 3TCJA 2LQWA 1VQLA 4KIGA 2PMUA 2WSFE 5GAN6 5DY9A 3NMZC 5J39A 3HGYA 3CLQA 4EJWA 1W6XA 4RGSA 2ZZDA 2ESNA 2EPFA 1VQMI 1D8KA 3F6VA 4IQ4A 3HJEA 4ELYC 1M9SA 4HVWA 4PJLA 1ZGJA 5FRMA 3S14J 1KD1U 3G7ZA 2RKHA 5GANf 4PJOA 6AT1B 2LVSA 4R0KA 2V79A 2VASA 2ZGWA 5FGMA 5CKEA 5CCAA 2XK0A 2K7LA 1EZZB 2EFPA 4OIOF 2RQQA 3ZOBA 2PJPA 4DZJA 3MJXA 1P4XA 1MD0A 5A0DA 5GAHJ 3HM5A 2KZGA 1K78B 1T2KA 1W1WE 2JT1A 2OA4A 3ASNH 5GMKe 2DK5A 4JP0A 1UDLA 4NDLA 4BKXA 2HR3A 2LC4A 2P4RA 1U1SA 3MP8A 4KYWA 1QHHD 2O7OA 3ZQFA 4JLGA 1MZBA 2BIVA 2L5QA 1X2NA 4ZYGA 3PTAA 2CMPA 4J5YA 2PVDB 1ETOA 5GMKl 2VC0A 2JSCA 2JMCA 1QVGS 4MQVA 4MZTA 3U9GA 2CZ6B 2ELKA 4RTWA 1BIAA 3F3XA 4ZDOA 1WI7A 4OWRB 2CSIA 2VKNA 3CP8A 2IVWA 1ARKA 5JLXA 1IN6A 3LA7A 1TH7A 1OCOH 4UHTA 1GVDA 1YX3A 2A36A 3RKWA 3CCSA 1YI2Q 4IHYA 2OTJT 3OYDA 3BG3A 3VYGA 4KUMA 5JHUA 4N0AC 1F9NA 3BQYA 2PX9A 4CYCA 3WTVC 1H641 2FB7A 2RM4A 3TVTA 2HBPA 2VJIA 1SHGA 2E60A 1D0YA 1PDNC 1VQLI 1NG2A 1X6GA 2KGTA 3CTAA 3PIPA 3S16J 4A3LJ 3Q1JA 4XTWA 3HIFA 4XMYA 2EQKA 2BE7D 3A1YA 1XDSA 4F16A 1E6HA 4XAXB 3TEDA 2ESHA 1YW9A 3ZXSA 4YTLA 1L0OC 3WTUC 2O88A 5AONA 1C0WA 4J01A 3I54A 2R7ZJ 4Q4ZF 1RAIB 2L0AA 2DJNA 1JB0E 4JDSA 4PGHA 5D8LB 4XU3A 2K3XA 2EV5A 2JJ9A 1FYNA 1AU7A 2A07F 3D5LA 4BACA 5FU7B 3LQRA 5D8KB 2KEAA 5FU6B 1Y96A 1XGNA 1Z9QA 2JUCA 2L9VA 4MQ9F 1H9GA 2YPRA 2GQQA 1J09A 4XLPF 1YIJI 1DP7P 2E64A 4RTYA 1JKPC 3BC8A 1FTZA 3H0HA 4XU1A 4F7UA 2LKSA 1WSUA 1EFNA 1U5TB 4ASNA 3CCMT 1UHWA 2K4JA 3BQZA 5GPAA 3VYTB 1R6RA 3E6MA 4V2GA 2ZSHB 3C7JA 3H8ZA 3M0TA 4RG2A 4BE2A 3DP7A 3OL4A 4MLOA 3TU4K 2KYBA 3M9AA 4W97A 1P92A 1SANA 3N05A 2Y4XA 3DPLC 2AS5F 2BHYA 2BXYA 1I5LA 2KROA 2GBYA 1X6OA 4L9JA 1D1AA 2Y75A 4IHSA 4IHWA 4CHUA 2FL7A 2V8KA 5F04A 3QAHA 2QQAA 2UZKA 1MNDA 2EWNA 4FW2A 1UTIA 5KYWB 1N8RR 1N78A 1PG5B 3DEWA 1JBMA 1P4WA 2J5PA 2MWPA 1IREB 4M7DF 2QKMB 2YXYA 4J7IA 2DL4A 3I71A 3FK7A 1O9SA 2XAUA 3CCJA 2D8HA 5GMKh 2M0CA 2KIFA 1VQKQ 2KQWA 4AFQC 4EMKB 1NK2P 2VJ4A 5K7FA 3H3VK 1YRNB 2DD5A 1GUUA 3SYTA 1J7KA 1SD6A 1CGPA 1ZLMA 4M9XA 3OS1A 4C0FA 4IOCF 1VIFA 3A01A 2VBZA 4AD9A 2KMUA 3VB2A 2FHDA 3EGUA 2XAHA 4XTXA 4PJOE 3OSVA 3G6EI 3BFMA 4F7UF 3J80E 3MMYB 4RS8A 3H0FA 3BDLA 3J7AY 2JW4A 1JJ8C 5I11A 1KQSS 3A0HC 1WHJA 3EGDB 4JJCA 3VSKA 1BI0A 4A3MJ 2MK5A 4IIMA 4LDVA 4M75A 1P2FA 2MIOA 5E1WA 3A2KA 2Q2EB 1GBQA 2KYMA 5HS9A 4BY7J 3CC2I 1VQ6I 2JA6J 5FWCA 1MW7A 3LFKA 1E3OC 4F52A 3RNJA 2IRFG 3IAS2 4ZYEA 2VQGA 4ZNXA 4M7AD 4PSWA 1B1BA 2E1MC 5FKNA 4AG2C 5E3LA 4WCGA 1T95A 1PNJA 2GA1A 2W82A 2DL7A 1YWOA 3E6BA 1OPCA 1A36A 1GCQC 1WWXA 3ISPA 4J9HA 3CCLA 5B66C 4OIPF 3HTSB 2EW3A 2W25A 2KT0A 2FMLA 3BCAA 4ZC3A 2RH2A 5BOXA 5EEHA 3J80Z 1VQ8T 1GRIA 2R7TA 2EZLA 3UDCA 1G3TA 1P4AA 4FT8A 1I3QJ 1UGPB 3ZCOA 2LF8A 4B44A 5LFAA 2MW8A 4M78B 2KK4A 3M57A 2IPOB 2OAZA 3CCRT 4ZDLA 1A5JA 4GRIA 4XRMA 3VYHB 3PSIA 1Q82U 3DPUA 3M54A 3BG7A 4C2UA 4MDWA 2AIRB 4PLLA 4ON0A 3DCFA 4G8XA 4J9EA 3RIRA 3SDZA 2JN0A 1MH3A 2RGVA 5E8IA 1ZARA 2EKHA 4M75F 4CRIA 4BB7A 2UWMA 2J7IA 4BQAA 1Q1VA 3S1QJ 3CMMA 1Q7YR 2CWEA 3TL4X 2QGUA 1Y6IA 2K4BA 4M3BA 4ZYDA 1ZBXA 3L1AA 2YU9J 4ZGJB 3QZ5B 1ZGAA 1OFCX 3J81K 2RI2A 1MJBA 4CA0A 1TWFJ 3HOXJ 2ZPFB 2PI0A 2M9UA 3NTHA 4C92A 1FBSA 2OV7A 4CSWA 1IN5A 2FSWA 2R0QC 5EGOA 4PJ0C 3QOEA 2O5RA 3UR3C 3JW4A 4Z89A 3VS6A 1EF4A 2J5OA 1HD3A 4F7UG 2EAYA 2P0WA 4IRHA 3ZQLA 1LB2A 5LJ5g 4WXHA 4ZDPA 3JCMQ 2MABA 2W10A 4A5MA 1RACB 4UB8C 1QP3A 2G3RA 1X2QA 4PLIA 3JB9D 3O2PE 3ULRB 2CS7A 5KYYA 1F5TA 2EFOA 1V29B 2P5VA 3ERED 5CQEA 1IAWA 3QJ6A 5H6QA 3K70D 3J7AO 2QSGX 3IAM2 4EEFG 2KMTA 3QYHB 4OMFB 3L2VA 1SF9A 2RJCA 3NRVA 3BZKA 3W6KB 2GOMA 1MBJA 1SKUB 1VQ9T 1YIJQ 2Y9YA 2EIFA 4HQEA 2HNIA 1Y8QB 4A4KA 3CDIA 1TBXA 3SXYA 1IDYA 4BJ5C 4ESFA 1U1TA 1XS9A 1HDDC 1C6VX 3OYFA 2FOWA 3GF5A 2CJJA 4ABZA 5LGUA 1T39A 4L9TA 9ATCB 1RPWA 1N6AA 4RAFA 2DD4A 3HFNA 2NVQJ 5C44J 4GDFA 5D6WA 3CC2T 1D1BA 2HD0A 4IRIA 1X4OA 3A8MB 2DA6A 4XLEA 2WSEE 1B34A 3DFGA 1FMWA 3P7NA 1X3WB 4GYGA 3D1NI 3CO6C 2SRCA 3CJQB 4E7ZA 3A5ZB 3KEYA 2FRWA 3JCMh 3KZZA 4CCMA 2QZ8A 3P8BB 5EDNA 4OINF 2VIXA 3FF5A 3R0JA 4PDKA 4BE0A 1SEMA 4G9YA 3T8TA 1T0JA 2GZWA 4XRSA 3HUGB 2DK3A 3KLOA 1NPRA 4CCLA 3JV3A 3S15J 3GEZA 3P8DA 1K0XA 4HEA2 3EFRA 1H92A 1OEBA 1KHCA 1C1AA 4J83A 4J8OA 1QPIA 4HV5A 1K4TA 1WLPB 1ZSGA 2D1XA 4A0ZA 3P5JA 2L4AA 1PHTA 1BJZA 5LHGA 5ICGA 2BGCA 2ZFWA 4E70A 4M78C 4YG2F 4MEXF 2JOYA 5KCHA 2VQHA 3WHCA 5IPAA 2MFZA 4GBQA 3PFYA 2XMFA 1T6SA 2Q2EA 3GVAA 1JKQC 3G6EQ 2KL4A 1ZELA 2Y0SN 3OOPA 1WGXA 2CG4A 3HSFA 1IGNA 4M77F 2ZMEA 2D2WA 2MWOA 3SEQA 1RAHB 2EZHA 4R55A 4LB6B 2RREA 3E9FA 4LN2A 1BOAA 3INZA 1Q1HA 4O6JA 3ASOH 2JT4A 1Z3YA 1LDKB 1LNXA 3P9CA 1IG7A 4BI8B 5DUIA 3WGIA 2DPPB 4UVCA 2YX7A 2F5CA 2ME0A 2J6OA 2XDBA 2H8HA 1MJ9A 2JVVA 4JUVA 3SJMA 5A0LA 2W7NA 2HKXA 4BI4A 3MEXA 3RZDJ 2EA4A 3QPHA 1HSQA 1G83A 3FWEA 2Z33A 4C0DC 3FX3A 1W0TA 3PIOF 2VE9A 1K61A 3JCMP 4BQOA 4CC3A 1W2BP 2R7QA 1V4RA 1B59A 1XGMA 5GAEJ 3J7ZI 1OISA 2E70A 1TXQA 3U1KA 3IQLA 5GANh 1D5VA 1EIFA 3QODA 2XSJC 3CCST 4ZYAA 1TTHB 1YITQ 3Q9VA 2Z0WA 4P96A 3EG3A 5L3GA 1JU5C 2HQXA 2EJGA 2FNAA 3FLGA 1DGWY 4I2OA 3CCEQ 1AA7A 2WB1N 5KYWA 2V6CA 1IXRC 4NUBA 3MZHA 4AYBN 4L5GA 3LNQA 4M7AE 1D3BA 3GUDA 4UY8I 2M0MA 1WIEA 1UECA 5HOOA 3CQTA 4M78A 3CUQC 4EATA 2VLAA 1A6QA 3BZCA 3E2UA 1UHFA 4EM2A 4U0WA 2X1DA 4WXDA 3EUHC 5DCMB 1FLIA 3DWLE 4DBRA 1CQTA 3CMAT 1KQSA 1S7OA 4QSHA 3COAC 4HQMA 5IT9Z 1QKXA 3LX7A 5KYNA 2VKHA 3K4NA 5I2MA 1WJBA 4AWXB 2WAQN 4KT5C 4M7DE 2KIUA 1QMCA 4L0YB 2J6KA 3GWZA 5E3MA 3Q5FA 3M58A 4I0AA 2BZYA 2GBQA 3H9GA 1KIKA 2UXNA 4FTHA 5I22A 3EYYA 1E0EA 2V6EA 3LSPA 2O61A 1M5Q1 2CYZB 2JNGA 1ZG5A 1VQPI 4C9YA 5AIQA 2RNJA 1VQOT 3ZP5A 2EYZA 1ZSZB 4M71A 1S5LC 5F1RA 1K0SA 1IXCA 1B6AA 1OR7C 3Q9SA 1FYKA 1W1FA 4O5VA 1V5EA 3PO3J 3AG3H 2DKGA 1I6HJ 1ZQ1A 2VXEA 2BY0A 5A2QZ 3KZIC 4B1RA 3CC4A 2F48A 1AZEA 5DM7F 1F36A 2IA2A 3P9KA 4J6YA 2CRGA 2E3HA 3FJPA 2CW8A 3LSJA 1T0HA 2E71A 2KRMA 4NS5A 2H6BA 1HOMA 3DF8A 5K7ZA 4C8QA 2QGGA 3BG9A 2QQ8A 1PC0A 1JT0A 5GAOq 1I1GA 1M2VA 1FEXA 1TUGB 2DVEA 1JJ2P 2C06A 3CMYA 3OYLA 3P9IA 5GP9A 2IA1A 2EIKH 1O7FA 1LOJA 1Y8RB 2V26A 3VFZA 2NUPA 1OPLA 3JTGA 3QU3A 1MV3A 1KQ9A 1FMKA 1IGQA 1WJEA 2OD5A 5EGOB 4EDUA 1YJNQ 1RQ6A 3LMMA 1TZLA 1TWGJ 2DILA 1HJDA 3LL7A 2KR3A 2CZ7B 2LREA 5CKFA 3JCUC 3PJRA 2WSCE 5ILSA 1KG1A 3FXMA 3LFUA 3URGA 1Q81C 3ECOA 5IP6A 1P6RA 2E1NA 5CIUA 2LJ3A 2VJ5A 1NE8A 1UB4A 1Y1WJ 2K3BA 5GAMg 2HPMA 5BPIA 1XSVA 3G6EA 5IHKA 2RNAA 3OV8A 3PIPF 1V76A 2MPXC 3WGGA 2K7AA 2DX1A 2XDVA 4KULA 3O3KA 4N4OB 3E3VA 5E3OA 1LJOA 2QSFX 2GM4A 2XG8D 2FJ1A 3QXEB 4HRIA 3CCUA 3RJPA 4HF2A 3BR3A 2DAQA 8AT1B 4UUTA 4A2UA 1D3BB 4XU0A 4Y3OA 1UJYA 2M02A 2QSHX 3L42A 1VQ9A 2OAWA 5J4VA 1DPRA 3SFZA 5GAOp 2WV1A 2EIJH 3H9JA 3RKYA 1WJCA 2ACJA 3HOVJ 3HTRA 4KUIA 1QZYA 4X9CA 4KITB 4IO9F 4HCZA 3G1LA 3W2VA 1VZ0A 1QVGA 2PQWA 2K9QA 4PCQA 2STWA 1RAGB 4X34A 2VPRA 1Y1VJ 4CCJA 5EZGA 1R36A 2QEXA 1WJFA 2R7RA 2ZNYA 2SEMA 1G5VA 3SEZA 2L4MA 2R7WA 3QPTA 3QWLA 3HOTA 5CO7A 2M8GX 2M7AA 2HSEB 4YEJA 3L1PA 4B6MA 4BU2A 1XMKA 1IDZA 2ABLA 1J5YA 1R9TJ 2YUOA 3ULQB 5LEKA 5CKDA 2OAUA 1SFOJ 2DEQA 4CO8A 1USSA 2X1EA 4QQDA 3V8LA 3CDHA 3I58A 4HSTA 1AOJA 2F1LA 4KISA 4ZGDB 1JTXA 4KN4X 5EYRA 1IHWA 3CCEI 3H5NA 2HMAA 4HA8A 3I9QA 1R5HA 2XD0A 2P0TA 2P6SA 3GIBA 1FBUA 2LFBA 4RCCA 1VQ7I 3HFOA 4DYQA 4M78F 4M77G 2RMOA 2JPCA 3M0RA 2E6NA 2TCTA 2FA5A 1PCXA 2CUJA 1T38A 2QQRA 2HTJA 2IT0A 1JUSA 1LEBA 1YWPA 2CP5A 4Z88A 3CESA 3G4SQ 4PFPA 2EV0A 1W2BS 3G1OA 1IC8A 4BE1A 1K78A 1VOMA 4ATOA 2CQNA 3MP6A 1KA8A 4G94A 2RA2A 2F69A 3FXUA 3CMEA 2CW7A 3VDXA 1MSFC 4DIQA 1X2KA 4OU0A 2AK5A 3QSUA 4RTTA 4DBHA 5B1AH 4JLIA 2OX7A 4G7HF 1U9OA 1N25A 2PMZN 2W0ZA 1H0MA 1PD0A 3SHWA 3OYEA 2HXOA 4YFNF 2DT5A 3HC7A 2CP7A 2DL5A 2IW5A 1Z7UA 4LG3A 3Q3SA 3CJNA 2V9VA 4PZJA 3LA3A 2RHXA 2DA3A 1XMAA 1VQPQ 1CSKA 3F23A 3SWNB 1CKBA 2IG0A 3TW7A 2MC3A 2MGQA 2KNBB 3QYBA 5KAIC 3JRCA 2MVTA 1IZ1A 3GW2A 1NPPA 3EG9A 1ZR2A 4A3GJ 4UUVA 4IIOA 4OMQA 2HDAA 4Y15A 5BPDA 3S2DJ 2DZ9A 1U0JA 3HOUJ 4NQWB 4IZZA 5GAMj 1SD4A 3I59A 1GL5A 4ZH4F 1W36C 4FIBA 3S93A 3ELKA 2EB7A 3VYRB 2PBIA 4J9CA 3BR5A 1ZHFA 2ZXHA 3NWTA 2XSDC 1NZ9A 2PFBA 3IWFA 3KEOA 3PNVA 5IYBJ 2X98A 1FX7A 3OSFA 2QG9B 1L3LA 1TU0B 2RB6A 5GANg 3D5RC 2ZJRF 3GBGA 5H6RA 2PG4A 2YT6A 2VBYA 3L9FA 4ENMA 1SEUA 2E1CA 5A2QR 3CCUQ 4PJOC 3VS3A 1M1EB 2JVHA 4AYBA 4WCIA 1RAFB 3L2UA 5GAN2 5ERIA 1ORKA 4VUBA 4A53A 4JS4A 2A5WA 1NHAA 2ZMEB 4M9ZA 4BHCA 4LNPA 1VQ8I 3KYDB 2CQXA 4OAYA 3JR9A 4XK4A 2ETHA 3E5UA 4J00A 1YJNI 1V55H 2LMDA 3W6VA 3GTMJ 5GAOn 3WTXC 2CYYA 1Q81U 2XAJA 2E41A 5FLXR 4M78G 2DU9A 4IX7A 1LPLA 4A3DJ 4RBOA 2HCKA 4B43A 4UNOA 2JSPA 2LR8A 2VC1A 3PMIA 4LMYA 3BR1A 1FXXA 1WFWA 2YUQA 2R7FA 4U88A 5HDNA 2ROLA 3LH0A 2XIGA 2R4GA 4UC4A 2IP2A 3LQQA 2QEXQ 1OLTA 4LGWA 2R7DA 2EQRA 1UHSA 3FBNB 4ENNA 4A3KJ 4RG8A 1T98A 3JRBA 1SFUA 2DXIA 3G71Q 3KP6A 4M7DG 1D0ZA 5IY5H 1SC7A 4D7NA 1LDDA 4I09A 2KVQG 2RN7A 4NC8A 4UXNA 4X0GA 1ETKA 2VOOA 4A4GA 5LJ3j 3JAMK 3W6JB 3FKIJ 4QIWN 3OMCA 3CPWS 3C1DA 4KNYA 3GTPJ 2DYRH 4M78D 2L9RA 2W48A 3FXLA 1WJRA 2DYIA 2FD5A 5FKOA 2HU9A 5A0GA 3BLYA 2AZSA 1RR8C 4IUVA 2XI9A 2Y30A 5F27A 1YI2T 1QCOA 1MMDA 2Y31A 4EJOA 1QA6A 5HKCA 5LRSA 5EG0B 3OBWA 2HVQA 3OYHA 1VQ5Q 3VYSB 3CMAA 3PUBA 1HBXG 1XG1A 2AO9A 2F4MB 2D5VA 3VS5A 1FP2A 3BDDA 2KI7A 3X24B 4DOVA 5DM6F 5GMKm 2DRKA 4FE7A 5D4SA 2VONA 2COWA 2DA2A 4FYXB 3SZPA 1MBEA 2R5AA 1O3TA 2NVTJ 1UG0A 4M7AB 4P55A 1XTAA 2DXCA 1FT9A 2FPDA 5AYFA 3UF4A 2IBDA 3RTRA 1O3SA 2P7CB 4AM3A 5GAMe 2N8GA 3DKWA 1UFMA 3FXKA 4UVBA 3WTWC 3WTTC 4FM4B 5KYYB 1JQQA 2RPNA 2DLLA 1XGOA 2DA1A 3S3NA 1ETWA 1N8RU 3FXJA 2EPDA 1YG2A 4C3JJ 2DA9A 1TT5B 5FFXA 2EGAA 1BIBA 5HNHA 1E3PA 2FBHA 3DPTA 4J9GA 2DMTA 5D6FA 4R79A 4MEYF 3K4MA 3WU2C 1QQJA 3PNYA 2CKKA 3EHQA 1PP7U 1OCRH 3QP6A 2VGMA 2YRVA 2K86A 4CYCB 3FMSA 4A5NA 2X6WA 1G3SA 2FZKB 4C92B 2CUDA 3CXCP 2HNHA 4LB5A 1RI7A 1MMGA 1RNLA 1ONVA 3IWZA 1YIOA 4MGRA 5CKTA 3G4SI 1AVZC 3JRFA 4GCVA 2NOJB 2FX0A 3GZ6A 2XUBA 2NS0A 3HTUA 4B9WA 2X1CA 2WWYA 4KA4A 1IW7F 3FHNA 2E2JJ 3F0CA 3K9TA 1QPMA 2JQ7A 2LP5A 2NWMA 2NVUB 3HOSA 2HKNA 1BC7C 2K5CA 1K9MR 3JCMJ 3RSNA 3DU5A 5B1BH 2AXTC 3OA6A 3BROA 1KD1C 2BZ8A 1VQ9Q 4M77B 2EA2A 4RLQA 4OB2B 1KFZA 3CP2A 3KIOA 5J47A 1TL8A 1U06A 1WFXA 2YU3A 4PJMA 5LEJA 3S17J 1RI0A 5HCKA 2W24A 3DLMA 4DZPA 1FOWA 3J7AF 1DPUA 2XHCA 2ICWG 3KXTA 2M35A 4EV0A 4C5GA 1YJWA 2CUBA 1KGSA 2M4KA 5HS8A 3RESA 2NUZA 2KBTA 2KRCA 4RAGA 2PQ8A 3TP3A 5IOYA 2LJ0A 3BPVA 2QGFB 3EFSA 5CQXA 2JTEA 2H3JA 3PT9A 4KGZB 4ZZLA 2FYKA 5DM7R 2RO0A 2RNGA 1FC3A 1BBZA 1M2VB 3L2WA 2CSQA 2JVGA 1KHIA 2MUNA 1OV3A 1RLPC 2FPEA 2AZVA 2CZ1B 3FKJA 2QLZA 3T8RA 5HLHA 3TOBA 2VB6A 1CKAA 2COYA 3RPUA 2A6TA 3ZQCA 2IEKA 3U1DA 1YLFA 3UATA 4EVIA 3S1MJ 1TUCA 2CGPA 4OB3B 2A37A 3DBHB 2DA4A 3CDLA 4FX0A 1S72I 4IKFA 1MHNA 2VGNA 4MMLA 3WODF 2M87A 3I55I 1TWAJ 1Z05A 3ABTA 3CCRI 2R5YB 3I0TA 1IV6A 2X6XA 2VBWA 2L3QA 1FTTA 1I5OB 3B73A 4RTUA 3BDUA 2LMJA 2JRTA 3M8EA 4BL0B 3G3ZA 4A54A 1GVJA 2VKEA 1EH7A 2CW0F 4BHBA 2ME6A 2XHKA 2HQ5A 2RK1A 5BS6A 2DPUA 5GAN8 2TRTA 4BXFA 2XF5A 4XN3A 5FD5A 1QO0D 3TQNA 1KD1R 4RTVA 3CQZJ 3HXLA 4BQNA 2XICA 5DLQE 2OC6A 5E79C 1U5SA 1HQCA 3LSMA 3CCMA 4JJNK 3CCQI 2K2MA 2DA7A 3TMOA 2CDTA 3M0UA 2Y4YA 1WJAA 1MIJA 2X6OA 3HRUA 1H8KA 3DKXA 1IHVA 4EMGA 1JJ2S 3BTLA 5FFZA 4UUSA 3GYHX 3OIQA 2QBYA 4H0EA 2A5YB 1UELB 1HKSA 2BE5F 1BKBA 4G12A 2ZPBB 4A3BJ 1ZSZC 3GFLA 1Z67A 3PUFA 4C0ZA 4JK1X 4D5FA 4MZMA 4XQFA 2JK3A 4AG1C 4C92C 2R58A 3BR2A 1MGTA 1I50J 3CC7Q 2I8DA 4OMOA 4AC0A 3FMRA 1K9MC 2QF7A 2LBFA 2IGOA 3P8HA 2KFDA 2VOPA 2HYFA 5TGTA 3VODA 1LFUP 2HDCA 1CF7A 2VYTA 4WXCA 4XLNF 1KQ0A 3S1NJ 1UG2A 4HG2A 1NEBA 2QDYB 4J7FA 4Y13A 1YJ9I 2ZCFB 1XNIA 1VQKT 3E0JB 2OTJA 2JA7J 1ZAOA 1HCRA 1J2XA 3EHRA 1I5ZA 3HEFA 4KBMB 3VV0A 5C4XJ 3JSOA 2CH0A 1YJWI 3OB9A 4KRTA 4NC6A 3MO8A 3QRFF 2W85A 1U9NA 1RESA 2IAIA 2LT1A 1QZZA 1ABQA 2DT7B 2CUZA 1OCZH 4XONA 5HK3A 3FISA 2PNIA 4PFOA 3OYIA 1NBEB 3F8BA 2WY7Q 4UB6C 2GOXB 4CDGA 3HOZJ 4AFZC 3FIWA 1VYUA 2A69F 4X6AJ 3V8JA 2CREA 5J4YA 3WG9A 2MH9A 1FSHA 4E7SA 4U7BA 3DBLB 4HW0A 1E6GA 2YUSA 1TC3C 4RB2C 3GF2A 4IRGA 2K79A 4IPAA 5DDGA 3T9NA 2DA5A 2D45A 3BY7A 1RL2A 3CD6Q 5M3FJ 2DOAA 2AQFA 1BI2A 4OMMA 4F14A 4MO7A 3H5AA 4GLMA 4I01A 2QWWA 1YFNA 3W2AA 1HK9A 2DBKA 4TV7A 1RADB 3QDRB 4F7ZA 4QW2A 5LJ3g 3ZQQA 5GAMh 4KT6A 2P8TA 3WG7H 2HOSA 1M90R 2EZKA 4EMKA 3ZMDA 2V8IA 4EJVA 3JCMe 4ZGEB 2OJED 2X48A 4D5CA 3BR0A 3M5AA 3ZR8X 1VQ9I 2DDBA 3ABMH 1AZGB 3EFOA 1VNDA 3TDZC 3WTYC 3O5ZA 2XAGA 2DTOA 1TQPA 3C3WA 4BY1J 4JPBW 4XTUA 1T56A 1W7PD 3FHZA 3MQ0A 1M2OA 3OMGA 4DEXA 5KAFC 4FX4A 4ELZC 4HNUA 4QWQA 3NPFA 2WAFA 3F8FA 5E1ZB 2ZSIB 1W0UA 2COBA 1YW8A 4NNJA 1SFKA 3S32A 2HVSA 3QIIA 2KRHA 2FE3A 2YLBA 2CGHA 4LE9A 2IPQX 2XRNA 4M3EA 3E1SA 4DNCA 1OR7A 2OQGA 4HDVA 1UEBA 1ACMB 4CC2A 5CKBA 2LQ8A 4FSSA 2W4SA 1BYMA 3CCRA 3OYBA 4PNOA 3V8KA 3JCMV 4M77C 3ZQGA 5K5QA 3IRQA 3BW1A 2BOLA 2DIGA 1K8AR 1WRJA 5K5OA 2R5ZB 3VKIA 3I5UA 4A3JJ 3N97A 3OSGA 2DTRA 3QDFA 5LJ3d 2LQKA 2P0KA 3DLLA 1QVFA 4M7AF 3GFMA 1W4MA 5IH2A 3CBPA 1N27A 2M5WA 1HW5A 1FBQA 4Q47A 1OOTA 5FB2A 5GJVB 5GANj 5HLIA 1IN8A 3RPUD 4IHTA 3LW5E 4RGUA 1ON1A 2MLGA 2RN8A 4AMCA 4A6EA 2DRMA 1UHCA 3MVPA 3I55Q 2RD1A 1IN7A 2CFOA 2FPFA 3LGLA 4DA4A 1NYFA 2HZTA 1OCTC 2KP6A 5J8FA 2FQ4A 5LGTA 3KUFA 4J6WA 3AL0C 4EMKC 4BAYA 5EG0A 2MI6A 4GLKA 1X1CA 1Q7YU 2M51A 2E10A 1KU7A 4LD6A 3I4MJ 2KXCA 3CPWA 2XB0X 2KZVA 3M4OJ 2I10A 2BUDA 3MEWA 1H3ZA 5H2FC 1XB4A 2IS6A 4QPOA 1VQOA 3JREA 1STZA 3AHUA 2CO5A 2OU2A 3L2RA 1ZUYA 2GTJA 3HDDA 4C8QD 1VQ8A 3CCQQ 2HDDA 4V2SA 4MHGA 3LYIA 1WZOA 2LCSA 1Q82R 3PGGA 3CD6T 3J80K 1Q81R 3ESWB 5DTDA 2RJFA 3MD2A 2H8RA 1BI1A 3FB9A 1QWFA 2A61A 2QA4Q 1YCSB 3R0AA 3HB9A 2NOGA 5I2SA 2F6CA 1PUFB 2YUNA 5M5XJ 3LSIA 1W7PA 1W7PB 3HGGA 2ISZA 4XM3A 1ETYA 2IJLA 5KVRA 3CC7I 2EYQA 3CF2A 5E8GA 3JRGA 2A3LA 5F1JA 4HX8A 2CZ0B 3PE0A 1X58A 2HOAA 3VPRA 5ICCA 2O4XA 2DW4A 3GTJJ 4O3MA 1IO2A 1VQPT 1KK7A 2STTA 2KDOA 2QYZA 1LFPA 3R6SA 4AIJA 1WDXA 2KIMA 1KQ8A 1I39A 3WTSC 2QBYB 4CUGA 2EKOA 3A1PA 2M2EA 2WAEA 2XAFA 3REAB 5GAN5 2FBIA 5C6SA 3GMEA 4E7HA 3CJRB 2DODA 2UUZA 3IP4B 2RHZA 3FZVA 2VL8A 4QPQA 1ZHIA 4OB0B 3K1NA 3ZPLA 3KFVA 3W3CA 3S6WA 1ETQA 1TW2A 3HRMA 1KC8U 2M34A 2OZ6A 2R7UA 4E7IA 1XPXA 1WXTA 2ECZA 2PJRB 1ZG1A 2ZB9A 3OSSC 1XD7A 1VQ6Q 3I59B 2FZCB 1H9TA 4N4GA 3EGDA 1WHMA 3RDIA 5GANe 4YIFA 2HQRA 4MFDA 1JUPA 2DMQA 4QVZA 3BJAA 2MD5A 3CD6I 4LUEA 2MLKA 3QOPA 3HOYJ 2QXFA 2M45A 1OQKA 3JCMf 2YHTA 2DMPA 3FDYA 4IEJA 2ZXJA 3J7YJ 3DEEA 2OTLI 4B09A 1BW5A 3WGHA 3BJOA 1YHQI 1DJ7B 3I5SA 3CCLT 2MAMA 1M3AA 4EGZA 2QQBA 4C0GA 3LWIA 4ANJA 2M30A 5KCOA 2L3PA 2IS1A 4CC7A 5EC7A 1VQLT 5K5RA 1A6IA 2I2LA 2M0YA 5GAN4 1S72T 1WVRA 2DQLA 3G2BA 3AG1H 1T8IA 1T0FA 5DD4A 3BTIA 2ZJQF 5BMZA 3GNFB 3KYCB 1LFBA 1N77A 1T3LA 1VQ6T 1M1KC 1PVEA 2FBKA 1SPKA 1Y7XA 4FYWB 1ZK8A 1O75A 2DJZA 1TW3A 2NNNA 2KXDA 2DN0A 2QA4A 1KC8C 1YITT 4HT9A 1U2WA 4KIBA 4BEHA 3ZMSA 4AUXA 2ENMA 1JKRC 5LJ3f 1Q86U 5GTHC 1PWTA 4PJNA 1Z0XA 4XRFA 3CCLQ 3QG1A 2NVXJ 4A12A 5HS7A 3SQNA 5LJ5e 2P5KA 1FNNA 4C0DB 3IRRA 1YYVA 2VVKA 2XF6A 4M75E 3CCVT 2DETA 4D7MA 2K6DA 1R58A 4FL6A 1W4SA 2COZA 3NGPA 2NAZA 2GNCA 4KFCA 2RHYA 3C2BA 1O4XA 4YELA 1MBFA 1PSEA 2EGEA 2EFIA 3MEUA 2FRHA 3F8NA 4BUPA 1UGQB 2LJ1A 3SDBA 2WACA 2JUGA 4M7DA 2B63J 1LDJA 1KJWA 2IXSA 2LCLA 1JT6A 5JR3A 1VQ4Q 4BBSJ 2FF4A 5HLGA 3C18A 1NM7A 3JRAA 4MIMA 3JCMX 3RKQA 1GFDA 4PK4A 4OMLA 2XC7A 2GXBA 2OBPA 2X6YA 1GLNA 3H35A 3MZYA 4HSRA 3ZFJA 3BZ6A 2HOTA 4A93J 3CCMI 3CF5F 4LG0A 4A0XA 2FG0A 3X26B 2DFIA 2DCEA 2XPWA 4L18B 1U6GA 5LRRA 1MDMB 2DFUA 4XK8E 2KDSA 1OYIA 2CT4A 2Q1ZB 3IH3A 4LFUA 1Y0MA 2R3SA 4BUGA 2DXTA 4ETSA 3PVQA 4AFUC 3R60A 4JQFA 3LAPA 1TP4A 4IUTA 2QA4I 3DV8A 2V9KA 2RQPA 2X85A 5FKMA 1R1UA 1QCNA 2PTKA 5CVVA 4C8QE 5L3FA 1MJAA 3VS0A 3S2WA 1WJDA 3IUOA 3GTKJ 3JRDA 2CUFA 2LNBA 2LQNA 5LD2C 4RAZA 4IURA 2VBXA 3IKTA 2HL5C 4ZN1A 1PYVA 1YOVB 3D5SC 1F43A 1SVMA 1K9AA 2FEIA 1ODDA 3ASKA 3OYGA 2JS0A 5DCMA 3BE3A 1T08B 3ZGKA 2EQIA 3U23A 1LUJB 4UV8A 2QQ9A 1K1ZA 3SHFA 2X4JA 2VWFA 3QUIA 3OYJA 2P6TA 5IT9K 1BCMA 1VUBA 4J9FA 2L54A 2LVMA 3IKVA 4MTEA 4ZJZA 1F1ZA 1K83J 4C3HJ 4IOAF 1Q95G 3PNWC 1FPQA 2ID6A 2ZAEA 3CBMA 3WXMB 2AKKA 3EFOB 2EH3A 2IGNA 5K7HA 2A08A 2PUKB 3CD6A 3JCMg 2JPBA 4YFXF 1R49A 1GFCA 2O9VA 2K5IA 1G2HA 3EG0A 4KH0B 2MZ4A 4FE4A 1M1FA 1KC8R 4FT4A 5FLXE 1S29A 2DFHA 3U21A 2DPDA 1X3UA 1APLC 2QM3A 2XF7A 5CPRB 4M7DD 3SD4A 2E65A 2BEOA 1NH3A 1LCKA 4B8XA 5TRDA 2DYBA 3E9GA 3L00A 2EQUA 3FJ5A 2D6FA 1SMYF 2HYJA 4OMYA 1M4ZA 2LKPA 4AFSC 1U5TC 4V19K 1YS7A 2X4WA 3EPZA 1R1VA 3AT1B 3HKSA 5LHIA 2MF2A 1XQHA 3K4KA 1N75A 1W5SA 1HKQA 1EA3A 3BG5A 4I0BA 1AD5A 1WQWA 5GMKi 1J59A 1IRGA 2RDPA 1X75C 4HCCA 3V4GA 1YHQQ 2XAQA 3K4LA 5FRNA 4A3CJ 2Z16A 1NLOC 2IIMA 4II2A 4Y28E 1UMQA 2L7FP 2M4GA 3MKYB 2MMPA 2XASA 2E36A 4KGVB 1YITI 1MKMA 1WPYA 1ZYRF 2DVJA 2ZPGB 4LDUA 1NG7A 1IJWC 5F0HA 5CVRA 1E3HA 3SFIA 1BM9A 1U8BA 5FLXZ 1ZUUA 2LKXA 4M6XA 3F22A 2K5FA 2YLCA 2XV4S 2EQMA 1S6LA 1S7EA 2ZJPF 3EAEA 1UG1A 4NHJA 1XDUA 3DB3A 2VKDA 4JYKA 3ZN0A 3LOCA 1ZG3A 3CXCA 1QCFA 1QVUA 3DTEA 3KEQA 4E6RA 2K27A 1DUXC 3HZJA 2JMWA 5J1RA 1M27C 2VKVA 4U7DA 2HQEA 2YDLA 5J40A 3PMTA 2ZO4A 4EM0B 3CPWP 2BXZA 1WQ2A 5FJ8J 1ZN2A 2BW3B 5GADJ 1Z21A 1Z1DA 5FROA 2FRYA 4K2EA 2CV1A 3OMYA 4LJZF 2FO0A 3KPHA 3CCLI 2ZJ2A 2DIQA 2R5MA 1K73R 3AG2H 2LG4A 1SVLA 3EDPA 1X01A 2KY9A 1TUDA 4XR6A 1HW2A 4F17A 3QYFA 1VA7A 3VUZA 1QQIA 1IB8A 5DV5A 4AIKA 6PAXA 1YIJA 1HYOA 3IC7A 1EKEA 1HF0A 4B3XA 5EEAA 2GIVA 1O57A 5D5UB 4A3EJ 5FKLA 1IUYA 3O8HA 2D9TA 5IHIA 5CJ9A 3CUQB 2DERA 2ZMEC 2DJIA 4H4KC 5J26A 3WE2A 4HVVA 4II3A 4QVDA 1YO5C 2L89A 3OBYA 3M1EA 3CC7T 3H9QA 4E6KG 1B8IA 1RABB 4M78E 3QYEA 1G6NA 1VQ4I 3G4SA 2DBBA 4CCKA 1J3TA 3M0SA 2H1KA 2BY3A 1ZLKA 4AU7A 2MG4A 2CT3A 2A7YA 1X3ZB 3JB9H 5HDKA 1SD7A 3I56Q 3H3UA 3EG2A 4WTOB 2G6FX 1VQMT 3J80R 3M55A 1Y0NA 4E7LA 5FU7C 2QA4T 3GCMA 1OX9A 2C0OA 1YITA 3A02A 4Y17A 4AVPA 3QZ9B 3CCMQ 2LOOA 3CCEA 2HTSA 1ZLJA 3I3LA 3ABLH 2JA2A 2WB1A 3UNGC 5IOZA 3M07A 2LTOA 4RTXA 4AIHA 3A01B 5L23A 3FC3A 4ZYHA 3VU3C 2L01A 2PMHA 1VQNT 5E18F 2JM8A 2OZUA 4XSZF 2GXAA 5D7UA 4DOWA 2HDWA 1JRIA 1EH6A 5HVQC 2ATCB 5IYCJ 1XGSA 4PJOF 2DNUA 3A8HB 4IUQA 2ECBA 2LSOA 2QUFA 2V1DA 3DBRB 3LA2A 2XKPA 3F8MA 2E5QA 1LE8A 1P7IA 2DQRA 2PEXA 3A4CA 2GQVA 2XGDA 5B5EC 1A31A 4A4HA 4A63B 5I21A 1YHQT 2O0YA 1Z9CA 4XQ3A 5EF6A 3PIOA 4M3GA 3HHHA 3EG9B 3A03A 3GLLA 2ELJA 1K8AU 3ZQIA 2K02A 3B6AA 3GTGJ 8ATCB 3J81E 1S8NA 5IP9J 4N4IA 4KIFA 2O2OA 2H27A 3A98A 1MMAA 3G73A 4RKUE 1K8AC 1R23A 3GBQA 2W57A 3MN2A 3FXQA 4CYDA 2B8AA 2QENA 1MGQA 1R0CB 2ED1A 4F93B 2GIZA 4C30A 2LTPA 4N4NB 2QASA 4PJOB 1BCOA 3H5RA 2XROA 5LHHA 3X25B 2VT2A 4ZZDA 1TLHB 4XLFA 1BOBA 3REBB 3LWHA 2D8JA 2VXFA 2DXBA 2LYCA 4BGDA 1B3QA 2ZPEB 4UUSB 1D0XA 4M9SA 3TBIA 3C94A 4LDWA 4DOZA 4U87A 1UZCA 1H88C 4EJTA 1UFFA 2JJ7A 3AKZA 3BP8A 3OYCA 2D0QB 2GQIA 2K57A 2KKOA 2IGMA 1AWJA 3C0CA 2VUMJ 3KP3A 4Y7NJ 2VQLA 2X51A 4L5JA 4HT8A 3I4PA 2L7KA 4LLNA 4JJDA 1LVAA 3A0BC 2L3RA 3RDVA 7AT1B 2L7ZA 2PMZA 4Z6YA 1IXSB 4GFBA 2DTIA 2LY9A 2K3PA 1Q86C 1B4AA 2EBIA 4M77E 4OMNA 3KETA 3QPSA 2AHQA 1QVFS 1WJ5A 2K9SA 2VE8A 1WA7A 4JRQA 1S7AA 3F72A 2XPUA 1YFHA 1MSEC 5J3BA 2ZCWA 4F04B 3M56A 1YJNA 3K69A 3H3ZA 3H41A 4XTYA 3BWGA 1NJIC 2G0EA 1HC8A 4M3FA 4I02A 4FASD 1H3HA 4A0YA 2B7EA 4XKBA 1ERDA 1Z9ZA 4Y91A 2KRNA 1IRXA 4OGCA 4DYCA 3IHUA 3C12A 1B72A 3AFHA 5GANd 1JHFA 2L9NA 3S3MA 2OTLA 2V9PA 1O7LA 3SDGA 2E1OA 5F08A 3Q0UA 3ZL7C 2E5KA 1FIPA 2R5ZA 5LJ3e 2HPIA 2PN6A 5M5WJ 1WNLA 1FYLA 2CFXA 2EJ9A 2Q8KA 1SVOA 3EGXA 3HHTB 5LL6S 4DBFA 4XN0A 3JB9I 1ZX6A 1WYXA 5LJ5f 5TISC 2KIQA 2OUMA 1WHGA 3PFIA 5FKKA 3ZQHA 3M7GA 2DOFA 2CSOA 5D5XB 4Q5SF 1WGSA 5EG2A 2HKQB 3DTIA 4HBLA 4MDXA 3VS1A 2OI3A 2FU4A 1ZKGA 2KQRA 2Y9ZA 2E5NA 4U0YA 1QU3A 4HYEA 2HAXA 2A0FB 1HW1A 1T33A 3O6BB 4FW1A 2MD0A 3CC2A 2JZYA 2G9WA 3GXOA 2KDZA 3JAMZ 1ZA1B 1ZUKA 4NOYA 2OPTA 3ZRGA 4ORZA 1FY7A 1SMTA 3JCMW 3JRZA 1GV2A 3HYIA 2RC4A 1MMSA 4M72A 4I76A 4NBQA 1AWXA 1HLVA 1U5TA 2P7VB 2NLUA 2UV1A 3DKMA 1TWHJ 5IP7J 3M59A 4XICA 3V7CA 4IHVA 4EM1A 2UXXA 1M1KU 2ECCA 2H8WA 1P9QC 5LLQA 2RK2A 4S05A 2YRCA 1Y96B 2DFFA 2F2XA 3OW2S 1X4PA 3HG9A 1QVGP 3MPUB 4ENJA 2F5TX 3LAJA 5GAMf 3I56I 2RF0A 4PUSA 3PM1A 4HF0A 2AQEA 5CAIA 1WJQA 1ZGWA 3F70A 1HSTA 2V1XA 2ZXWH 3VYUB 4C5IA 1WH7A 1AKHA 1AT1B 1JO8A 3K4BA 1N9SA 4JOMA 2H1LA 2V7FA 1D09B 5CR2A 5F64A 4EJUA 3CCUI 4CI0C 4JX6A 1OX8A 5M9OA 1XTDA 3IH4A 3OOUA 5D5VB 1D8JA 1BC8C 3HL2A 3ZEHA 1VQ7T 3QO3A 2KISA 3CPFA 5CYVA 4M4ZA 2JRMA 2EQJA 4IJAA 3I64A 1VQ8Q 2FQ3A 4FETA 4HPQA 2EVRA 4XOPA 4MTDA 2B9SA 1JGGA 2MYSA 2X4XA 4PKCC 2RQUA 4FT2A 1G59A 4XKWA 3BT9A 2HXIA 2MCNA 3OS2A 2XRLA 3V7RA 4WWCA 5E3NA 4C2TA 2LY1A 2QEXI 2QTVA 3C2HA 2O9LA 2EJRA 3FM5A 4P9FA 4OMPA 1YW7A 3TSZA 3S1RJ 4IVNA 1BI3A 4PFZA 1RKWA 4CH7A 2MH2A 1CF7B 1M1GA 1EX4A 4R56A 3O8GA 1TG0A 3RR6A 1YTYA 2Y69H 5IHNA 3K70C 1NK3P 1VYTA 4LIVA 2JS2A 1VI0A 2F5DA 2X9HA 3CCJT 3JCMb 1LQ1A 5GAOm 4BS9A 4L9NA 1K76A 5KNLA 3H36A 2COMA 4I99C 3REOA 4ZTJA 2PVGB 4M77A 5HY6A 4C8QF 1XN7A 2GAUA 1LVKA 1G3WA 2KJBA 2LT4A 4IXAA 1RUOA 4RDUA 2VQCA 4N0AA 3HP9A 1I1JA 3B6CA 2M3AA 4I6ZA 2GFAA 4C92F 2IGKA 3ROUA 3TEEA 4D6WA 5KYXA 3HSEA 1BU1A 1QWEA 2LZ6B 3HBLA 1B34B 3ONQA 3H0GJ 1VQ5I 3E5XA 3WE3A 1RIOH 1R77A 2CUEA 1VQOI 2YRDA 4ME7A 3TOAA 4G6DA 2E3IA 1A04A 3JAMR 5GAOr 2YX4A 1G4DA 1ZREA 2LP0A 4HV6A 4DQ2A 1QLYA 4D0PA 3KFWX 1K73C 3VSLA 5CVJA 2NUPB 1U8RA 2CH4A 3O8VA 5CVUA 3OS5A 4M75C 2E19A 1Z91A 1OYYA 3TW6A 1MDMA 3CMEI 4RB3C 4E47A 4FU6A 4L6V5 3TO6A 2FEZA 3K0LA 2HBWA 5J1UA 2ELHA 5GMKj 3HHGA 4D8KA 1S9HA 3E6CC 1ZRCA 3LGFA 2C0IA 1KONA 1HSJA 1K4US 3KYLA 4S04A 3X28B 1M3BA 2E5ZA 2K40A 5ILUA 1KQSP 3K1PA 4N4HA 3RERA 3EUKL 3OL3A 2XPVA 3SB2A 1WHUA 1VYVA 1N9RA 2LRQA 4DEYA 2H6CA 2XGXA 3CC7A 2NNYA 4LOCA 2ZXIA 3NAUA 4OIRF 1EV7A 3DTKA 3CC2Q 1GV5A 3DU6A 5IT9E 1H8AC 1ZTRA 1HA8A 1ULYA 3WU1B 1SAUA 1SSHA 2PLYA 4F3QA 3PQJA 1BR2A 3RYPA 4LD9K 2ZBKA 4DBQA 3FXRA 4M7DB 4Y4RA 4FYVB 4LXCA 3OIOA 2BVLA 4CCOA 4OMZA 4XBFA 1IV8A 3CCET 3F21A 3BPXA 2R7VA 2F2VA 5D4RA 1W5CC 2HVRA 2NYSA 5CK9A 1OYXA 1MNEA 2CS3A 1Y39A 2DXUA 2QTXA 5LJ3h 4M3DA 5IT3A 4M74A 2BTTA 1E7OA 1W70A 9ANTA 2RJDA 1O3QA 4RLFA 2YUPA 4KJZA 2D1VA 4OAZA 1VQ5A 2BVMA 4S0HB 2X35A 2CU7A 3MP1A 1B9MA 1RLQC 4KMUX 3A52A 4HCKA 4F7UB 4FHTA 1XCBA 2E7XA 3C4SA 1YJ9A 3CO7C 5ILVA 1S72A 2RHUA 2P5LC 3VRZA 4HX7A 1H89C 1VTNC 5IAYA 5D6XA 1WI9A 4Y52J 3LSHA 1AHDP 2EV6A 1R22A 2HSPA 1BA5A 1WXBA 2ZKZA 3R6OA 2L9SA 3WVDB 3HPHA 1J9IA 3LSKA 2RI3A 3FRNA 4WK8F 1QVTA 1Y71A 3G71T 1WPKA 3GZNB 1IN4A 2A05A 2A68F 1W36D 1PRLC 5DLOA 2MOXA 2OQRA 4R8HA 1V1CA 5C3EJ 5GPCA 3MFKA 3M1CA 2PVOB 5KH6A 2ADUA 4R1HA 4HNVA 3FXOA 2EBPA 4M75D 2V8JA 2EYXA 2LLKA 1R5ID 1XCVA 1UAAA 2F5FA 3HRTA 1X43A 5IYDJ 2LX7A 2JTVA 1BN5A 2YWWA 3N4MA 5KE2A 3CCRQ 3R61A 3FMQA 3CCVA 2JM9A 1Z7LA 2I0NA 4HVUA 5ICFA 3MAJA 4ESBA 5HNFA 4J19A 3M9QA 5IXBA 4GYIA 4Q5WA 2K9MA 2KE9A 2ZC2A 3OYNA 2E4HA 4RMNA 1K4SA 2O31A 3LLRA 4ITVA 4XTVA 3VRYA 4F7UE 5EJCA 1ZBJA 2DDAA 5AIPA 2CP0A 3LH5A 4EQQA 3QJYA 3SFMA 1R00A 4IL6C 3SEMA 2DYSH 2Z2SB 3VEPA 3F6OA 4QLCU 5KYUA 3EG1A 1SD5A 2HYGD 2ED0A 4A4EA 4FISA 4JZ4A 2AXLA 3JB9F 3HUGA 4KMFA 1YHQA 4BNCA 2KRSA 1FP1D 4L0ZB 3NFCA 2KHMA 2DZCA 4BXXJ 3ZMZA 3RI4A 2M16A 4OB1B 2VC8A 1X1DA 4DJAA 3H6ZA 3N5BB 2NS8A 2H3EB 2BV6A 5LBQA 1YJNT 1Q7YC 1HDPA 2V1NA 3UA7A 2M1BA 4DGWB 5KYXB 3QKJA 1DGRM 4XSXF 2VXDA 2XU8A 3ABUA 2XVCA 1Y56A 1R71A 5D6EA 5L3CA 1VF9A 2EK5A 2KJCA 3W2WA 1QNTA 5B3SH 3PVLA 4FCYA 1YN8A 1YS6A 4U0VA 5FWBA 1U3EM 4GY5A 1YJ9Q 2TDXA 3GO5A 3LSTA 3QWYA 1U3OA 1Y07A 1X69A 4L5EA 1VQPA 2A28A 2J06A 1VQOQ 3D7SB 2HQHA 3PQKA 1K79A 5FD6A 1JXOA 2R7XA 3ZBDA 1UGSB 3VWBA 1YJWQ 1GDTA 1M3CA 4ENKA 1SFEA 2EILH 2BW3A 4RAYA 2K3YA 1MH4A 1QRYA 2QI2A 4FYYB 2DEUA 4KDPA 3CBOA 2KPMA 2RAEA 2K9GA 1KZHA 3CMEQ 5F0CA 3K2ZA 3I4NJ 3CMAQ 2EINH 1FMVA 2Y48A 4CZCA 4E7JA 1SAXA 2BE9B 2LDMA 3CC4T 4QKUA 2YR2A 2R5YA 2IVMA 3QU6A 4LK0F 1RAAB 4JRKA 2K5LA 3EQLF 4HOBA 3ZQ7A 3OIPA 3LWFA 4ESRA 3FBIB 4Y92A 2P4TA 1QZEA 2DO3A 1AHJB 4CCNA 3RQ4A 3MHXA 2ZPHB 2M8EA 2L0KA 2L2OA 2NS7A 3MZ8A 5FLMJ 3H1CA 2DO7A 4HNTA 1FYMA 1GXIE 1ITYA 1RETA 2BZTA 4J6XA 5CQGA 4C5EA 2BY2A 2HQAA 2NVYJ 2Z99A 5J6XA 4MMKA 3TREA 2F2EA 3VOEA 5L8RE 2BYVE 4Q48A 5L3EA 3HPWA 1TQMA 3ZMTA 5DS9A 3CCQT 5KK1A 2LK2A 4NQWA 5DEQA 3CCJI 3A8GB 1QGPA 1IUFA 1ZR4A 4ZN3A 4PJOD 1AWOA 2M9HA 3GP8A 3T0YA 3GFIA 2FOKA 2LDUA 3BR6A 3TO9A 3IH2A 3HKZN 2CP2A 1FZPB 1ZA2B 1FJLA 4A69C 1ABOA 2KLOA 3OW2P 1NJIR 4NL3A 3META 4B3AA 5LJ5d 3AL0B 2L7MP 3QQAA 1IRFA 4RB1A 1YRNA 3WVEB 4XTZA 5F6FA 1WX6A 3B02A 3I55T 1FOYA 2EFQA 1X1PA 4XLHA 5DCFA 3RYRA 3V42A 5L3BA 2VODA 4E7KA 4E2FB 4BI3A 1JJ2A 2Q0OA 2DBMA 2F5KA 1N8RC 3DB4A 1VQNI 4BEHB 5ED4A 3I35A 4RGRA 4PL6A 4J9DA 2DFEA 4LDYA 3RQIA 2DMUA 1UJ0A 1RUNA 4OGEA 1C0MA 3GZ5A 4PJJA 3HKZA 4N9HA 5FU6C 3QPLA 1OI1A 2FNPA 4ESJA 3JRIA 3QWXX 3M0PA 2NUTA 1ACIA 1AWWA 1R5GA 1R8OB 4C92E 2G7UA 1J0RA 1E2XA 1TNSA 5DUKA 4Z2YA 2V1UA 2QCOA 2CH4W 2XKOC 5IT9R 1Y57A 3A8LB 4G6QA 4BD3A 4CC4B 1Z77A 3MKLA 4Y33A 2HS5A 2V4JC 4JZ3A 3KCCA 2KT1A 1POGA 2HOEA 2RVCA 3ERMA 1SRLA 5LJ5h 3EGXB 2K4YA 3M8FA 2ID3A 1LE8B 1IF1A 3HPGA 2XIDA 1LJ9A 4B47A 3TP0A 4YRVA 3CLOA 4NB5A 3K10A 1YI2A 2Z1DA 1YJWT 2WAQA 4IF4A 2BHZA 2E35A 1TOVA 3EUAA 1BR4A 2VI6A 1X27A 5HLTA 1HXDA 4AIDA 1HKTA 2AKLA 3QP5A 4AT1B 2DAOA 5CLSA 2GLOA 1YJ9T 5J1YA 1Q82C 2K9NA 2JTFA 1QW1A 2XDPA 3VUBA 1X19A 2R7SA 2VJJA 2F4OB 4RM3A 4BY6B 4JX5A 2EZIA 4LD5A 1I0CA 1QBJA 1PD1A 1JTYA 3G4ST 2RV8A 2VXZA 3CUQA 2CP3A 5GJWB 5FO5A 2Z3YA 1G2BA 1UCRA 1Z6TA 1XOVA 2X4HA 4MZPA 2LD5A 5M5YJ 3I5RA 3ME9A 3JSCA 3OW2A 4LIUA 2GFUA 3OWTA 3TSWA 2HKOA 2LH9A 1WHLA 4RGXA 3OR1C 4CGZA 1T3SA 2LF7A 2MBFA 2P4WA 1ZRFA 3KX2A 1W2BA 1I81A 2JUFA 3LSGA 1WKMA 2VUBA 2DJQA 1ON2A 1EH8A 2IS2A 2FMYA 3VS2A 2CQ7A 4XNFA 3MKZA 1GXPA 3BJ6A 2B86A 3PNTA 5E17F 1QP2A 3BG6A 1YX5A 2K2VA 3G1MA 2O3FA 4OOIA 4OIQF 1VQ4T 1JUMA 4HDUA 1SSFA 1TT0A 2FVUA 3CCQA 2LBFB 2RHIA 1MBHA 3S8PA 3RPQA 3M0QA 4JJBA 5IXFA 4F91B 1X1AA 2DL3A 2GGRA 1FOKA 3IL2A 3M4YA 4X1VA 4C5HA 4P1WA 1I3AA 5JLWA 5EEGA 2W00A 3I9V2 4GXOA 4E4HA 4BYYA 3CMAI 1YP5A 4XOTA 3RCOA 2HFHA 3OYKA 5K1YA 2XGEA 2DLPA 2L3SA 5GAMd 5A2QE 4XKCA 1JJ6C 3OS0A 2R93J 5GAN3 2C0TA 4XRSG 2R7OA 3TO7A 3WTZA 1E17A 1RZ4A 1B9NA 1GBRA 3AG4H 1K6YA 3Q0VA 5CQYA 1FIAA 3MEAA 2LNVA 3HSRA 5HK0A 3KP5A 1I07A 1OZ3A 4M7AG 2FXAA 3KP2A 1OU9A 1V54H 4D8DA 4WF2A 3NTIA 2DM1A 1VQ5T 2RQWA 1VQKA 2BZXA 1TTYA 2DK8A 1X6BA 4QT7A 4X1EA 3OY9A 1BJAA 2DTZA 2LC2A 3M8JA 4IUPA 4M7AA 4DW6A 4HXJA 2OTLQ 3CCJQ 3L09A 3TKYA 1S1NA 4RTZA 1JE8A 2F4IA 1M8VA 1SHFA 4LG0B 3QBYA 1WHKA 1I6XA 5A2QK 4EGYA 3PO2J 1YBYA 4QQ6A 3CCYA 1MBKA 3VS7A 1Q86R 1VFCA 3MCZA 4PGGA 1ZSZA 3BTJA 4UV9A 4IHXA 5FW9A 5JI6A 3GLXA 3HSBA 1I1SA 1SFXA 5HDGA 5KHDA 2L2PA 3QYGB 4A4FA 4JRPA 2JN6A 3S2HJ 1TS9A 1FOXA 2BBYA 1ETVA 1VQ6A 1V5FA 1WZ2A 3JB9G 2EFWA 1Y0UA 1B8IB 1D5YA 1DP3A 2QQSA 4UVAA 1K7AA 3M53A 2VN2A 3I53A 4LLLA 1GHCA 1VQNQ 3MKDA 2NUTB 1UGVA 2E12A 3AAFA 3SZTA 4P5OA 3M4GA 1VQ7Q 3T5XA 4C2MJ 4BDYA 3HOWJ 1M8MA 3E6DA 3NARA 1XSXA 1RUWA 2GXGA 5D6YA 4BH9A 4A3FJ 1SRMA 1GCQA 4CZZA 1T0FC 1U78A 1WQ7A 2MA3A 3CUOA 4KH1B 4EIKA 4C3IJ 5BQTA 1I8FA 3CMET 1DU6A 3TDUC 2NXNB 4HF1A 3UT1A 3G6ET 1PUEE 5C4JJ 1OCPA 4RMOA 1GCPA 2FZGB 1QVPA 1UUEA 3RBBB 3QHSA 3JSPA 2Y0SA 4C8QG 4EMHA 2L3DA 2ROTA 4NL2A 4KUDK 2Y0MA 1Z6RA 2EYWA 2DE0X 1AWCA 2W84A 2VPLA 1RAEB 4XL9A 2DF6A 3R6NA 4W1UA 3CC4Q 1OJLA 1RR7A 4V2FA 2WADA 4CXFA 3G71A 3VJPA 4N9IA 2D1HA 2F2WA 4P5NA 1KQ2A 1OQYA 2ISYA 2AT1B 1RRJA 2X3WD 2DTHA 1ZRDA 3PSFA 4P9UA 3GTQJ 4JS5A 1NEGA 2OCEA 4M6YA 1IRZA 3C95A 1V5GA 5ICEA 3BY6A 3JB9J 1VQMA 3CCVI 1NJIU 1PJRA 4XLAA 5GTIC 4B48A 2IS4A 2DL8A 1M90U 4FQGA 4YIRX 3MCAB 4N0BA 1UJ8A 3BCBA 1RC9A 4J9IA 3K7AJ 1XMXA 2DI3A 4TVRA 1WJSA 4BBRJ 1TWCJ 1OPKA 3C2GA 5IN1A 3UPUA 2GWRA 2W1OA 2G7HA 3DQVC 2MSYA 3H0DA 3CZ6A 2HI3A 3FIFA 5FLXK 1AKHB 3D0SA 2LCCA 4IQJA 1MBGA 1JXSA 4HLYA 1BW6A 2EGCA 2XGCA 1DDNA 2HZDA 3OQ5A 3TGNA 2WY8Q 1DU0A 5E1XA 5DYMA 3SWNA 4F55A 2KRFA 3DXJF 4LDXA 3RUXA 3JCMc 1A35A 4OVAA 3I56A 1OKRA 3WHBA 1V3FA 2WV0A 4BXUA 2LY2A 1ZH5A 4LLGF 2XDDA 2CQQA 1LKXA 3K4CA 1D3YA 4D1QA 3JAME 1FSEA 2P81A 4BJ6C 5JVGF 1IZ6A 1TSFA 4HKEA 3G1JA 2OTLT 1NYGA 2Y2ZA 3BTCA 4OF1A 4C92G 4L59A 1MV0B 2A6EF 3OYAA 3J81R 1KU9A 1WXUA 3R4KA 3S3OA 4I98B 2JA8J 3FK6A 3L2QA 3CCSI 4X9DA 1M1KR 1BB9A 3H0IA 1REPC 1NG6A 4M77D 1KU3A 3G71I 1NLPC 4HLXA 3F9KA 3E97A 4MNUA 1AOYA 2PZ1A 3GFJA 1WHHA 2RI5A 1FWZA 4GGGA 1KSWA 2ZNZA 3DKYA 2O6GE 2M0OA 2Z9OA 3RZOJ 2OTJI 2V1RA 3CXCS 3JRHA 2J6FA 3I55A 3JTHA 4KN7X 1MUZA 2O9SA 4OP0A 2OCCH 2EIMH 1KQ1A 3K4JA 4ZTFA 1NTCA 3T1BA 5AT1B 2GF7A 2A3SA 3OYMA 2O01E 1P7JA 2RQRA 2OF7A 3LSRA 2M1HA 3MEVA 5F0FA 3NTKA 4IUUA 4C92D 2QKLB 2DT6A 5M3MJ 2L8DA 3NWSA 1VQ4A 1D1CA 5EZHA 2EYYA 2YSRA 4QVCA 2JA5J 2QEXT 3TQ7P 3A8OB 1QHGA 1PM3A 2XKOA 2KT8A 1BBYA 2PU9B 3SWNC 2Z5UA 5GAGJ 2WC2A 1A0NB 3L2CA 1VQNA 2HQNA 5JHFA 5J3LA 2X3XD 4G7OF 2RJEA 4LITA 1O3RA 1W5TA 4RB0A 3J7AW 4JBAA 4CICA 5CVIA 2JWTA 2PJRA 3GPLA 4A3IJ 1RI9A 2P0PA 2KAFA 4LK1F 3KP7A 4PSXA 5KCMA 1IGUA 1GXQA 3K6GA 3IV5A 2HZYA 1OMIA 1XSDA 3CCUT 1KYZA 1LEAA 2V1QA 3K1MA 1JGSA 3MKWB 4HX4A 1UHMA 1USTA 1PKSA 3GTOJ 3VS4A
chains in the Genus database with same CATH topology
3ZN1A 2JTMA 3M57A 3V7SA 3WU0A 3EYIA 2L02A 4EMSA 4C8QC 4L5IA 1I27A 3RMSA 2QYOA 4HCBA 1PP8F 3E19A 2IA0A 2O4XB 1YIJT 4FSXA 3JCMd 5GAOl 5L3DA 2JZ2A 2E6ZA 1VIEA 2ZPIB 3U2RA 2AHJB 2HGCA 3RKXA 3ECHA 2E1HA 3NEUA 2WTEA 1UB9A 3J81Z 3KP4A 5D5WB 4YFKF 5KE3A 1G3YA 3KBGA 4JRIA 3KE2A 3GX4X 3EUHA