The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
221
|
structure length |
211
|
Chain Sequence |
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
DIPHTHERIA TOXIN REPRESSOR
|
publication title |
Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb |
source organism |
Corynebacterium diphtheriae
|
molecule tags |
Gene regulation
|
total genus |
63
|
structure length |
211
|
sequence length |
221
|
ec nomenclature | |
pdb deposition date | 2000-10-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01325 | Fe_dep_repress | Iron dependent repressor, N-terminal DNA binding domain |
A | PF02742 | Fe_dep_repr_C | Iron dependent repressor, metal binding and dimerisation domain |
A | PF18357 | DtxR | Diphteria toxin repressor SH3 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Mainly Alpha | Orthogonal Bundle | Diphtheria Toxin Repressor; domain 2 | Iron dependent repressor, metal binding and dimerisation domain | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. |