1G3WA

Cd-cys102ser dtxr
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3wA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3wA03
4I7HA 2IJLA 4HYEA 3SZTA 2FBKA 2KJBA 4M9SA 1YO5C 1BC8C 1I6XA 1TQIA 5ED4A 1I1SA 2D45A 4MHGA 6PAXA 1W4MA 2PFBA 1LEAA 4HA8A 2FOKA 2DK8A 3WTWC 3WTXC 4LD5A 1PDNC 3V4GA 3EUHA 1U5TA 2ISZA 2QQBA 2NAZA 4A2UA 3MZHA 4R1HA 2VBYA 1B9MA 2XGXA 2EB7A 1K7AA 2LF7A 5L3DA 3JTGA 2VONA 2A5YB 4IRGA 3VODA 4HOBA 3TO7A 1U5TB 1O7LA 5D8KB 2Q2EA 4EGZA 3ECOA 2DBBA 5ILVA 4AIHA 2AXLA 4ESJA 3ML6A 1UHMA 2O61A 3CO6C 3FM5A 1G3YA 2DPUA 2J5OA 1U78A 2DI3A 2XAJA 3MHXA 3M9AA 5JR3A 1J2XA 2PEXA 1OR7A 2A6EF 2UXXA 2CW0F 2EA4A 5D6EA 1J9IA 3RTRA 4S04A 1U8RA 3ULQB 4B09A 1E2XA 3KETA 4I98B 1WKMA 4HLYA 2VC1A 2DFIA 3WTUC 5LGNA 1ZG5A 4EJTA 3ZMZA 2LX9A 5CJ9A 4HLXA 2QUFA 2HKOA 2YPRA 5LRRA 1TQPA 1TW3A 4KA4A 4WXHA 3RKYA 3SXYA 1P92A 1I5ZA 3TOBA 2QZ8A 3K1MA 4YIIA 3BJ6A 4HDVA 1BM9A 2BYVE 1O3TA 4NHJA 4GGGA 2FF4A 3MZYA 1LDJA 3C18A 2V1DA 5LHHA 4UVCA 3GXOA 1YQAA 1B1BA 3BWGA 5BQTA 1K78A 3ZMUA 1O57A 3BJAA 2XRNA 1LEBA 3KP2A 1RUOA 2E1NA 2HWVA 3BROA 1GHCA 5AIPA 3P9IA 3C3WA 5L3CA 2E7XA 3MCZA 1IXCA 4KDPA 1ZGJA 1FT9A 4KIFA 1IRFA 3JTHA 3D0SA 4A5NA 3I0TA 3I5UA 3F22A 2L02A 3QP6A 5DCFA 1IXSB 2QBYB 3KZZA 1MD0A 3FXRA 2O8XA 1PP8F 2MD5A 3IL2A 1U6GA 1H9TA 2M30A 3CLOA 2Z5UA 4Q5SF 4A0ZA 1LDDA 2HYFA 1Z6RA 3PQKA 1CGPA 2MH9A 1DP7P 3AAFA 2A68F 4IHSA 3B73A 2VOPA 5FB2A 3WTZA 3E6BA 3RIRA 4XBFA 4EV0A 2K27A 4HF2A 4G94A 3H3ZA 1MKMA 2E1CA 1FP2A 2FSWA 3OOPA 3J81Z 1XGNA 4EJOA 1T6SA 3E5UA 2G9WA 2R3SA 2ZNYA 2R7DA 2K4BA 1BIAA 4CYDA 3F3XA 2D1HA 3RDIA 3BOQA 3G73A 1F1ZA 1HBXG 3FF5A 3HRSA 2VBZA 4BQAA 3EQLF 3R61A 4RB1A 2DO7A 4AWXB 2BBYA 5CYVA 2JSCA 3MEXA 1R7JA 4FHTA 1QW1A 1XMAA 3K1NA 1W7PB 1TQMA 2G7UA 2WTEA 3H3UA 4RB2C 4E70A 5F6FA 3P9KA 4I0BA 5K5OA 3HRUA 5L3FA 2DU9A 1STZA 2PMHA 4UUVA 1YIOA 1OYYA 3HTUA 3WTVC 3KLOA 2YSRA 2ZXJA 1R22A 5CLSA 2P6SA 2F5FA 3DEUA 1MJAA 1HQCA 1UB9A 1J59A 2ADUA 5D5VB 3GF2A 3KP4A 3M8FA 5LBQA 2H94A 3WE2A 2L4MA 4NB5A 3CUQC 4KUMA 5ILSA 4RAZA 4L9TA 4WXDA 4KN7X 2IT0A 4LLNA 3IWZA 3N4MA 1XCVA 4P5OA 5LHGA 4N0BA 1KU3A 3J80Z 1ZRFA 4CZZA 1TLHB 3FM3A 1O3SA 3GWZA 1XN7A 3JW4A 1ONVA 3TOAA 2M87A 1Z05A 3MWMA 1XSXA 3KCCA 5FD6A 3TDZC 2F5CA 5H6RA 1BI0A 3DF8A 4A12A 3NQOA 1HW5A 1QBJA 3GUDA 4R8HA 4UV9A 1S7OA 2A6HF 1DUXC 2W84A 2RV8A 2FE3A 4D0PA 3V8KA 1WI9A 3F8NA 1OPCA 2BE5F 3L09A 2IPQX 4G6QA 5JHUA 2V1UA 1QNTA 1Z6TA 5E8GA 4BAYA 1F9NA 1RIOH 4Y17A 3FMQA 4A0XA 1WQ2A 2XASA 4G7ZF 4XLPF 3R0JA 3NEUA 3F6OA 4JBAA 3F8BA 1JHHA 3TO6A 2HTSA 5HS7A 1HW1A 2L54A 5KK1A 5LEKA 2V1XA 5E17F 4HZFA 2STTA 4JQFA 4ESBA 4I2OA 2F5DA 3TGNA 1IAWA 1KGSA 2GAUA 1VTNC 3P7NA 3TO9A 2GXBA 3V7RA 2HKXA 1BJAA 4MEXF 4O6JA 2BV6A 2B0LA 2GA2A 2RC4A 1QZYA 3I64A 2DAOA 4RS8A 2RVCA 4IVNA 5CVVA 1QO0D 5FLXZ 2ZBKA 4GYGA 2WWYA 4P9FA 2G7HA 3WTYC 1I27A 3P9CA 4YFXF 3TKYA 2VBWA 3VFZA 2DW4A 1R1TA 4OMZA 3I58A 3O2PE 1BC7C 2UZKA 1BBYA 3CTAA 3KE2A 3TDUC 3IKTA 1HSTA 4M6XA 2CFXA 3ELKA 4Y15A 5HDGA 1BOAA 1IW7F 2V79A 1ODDA 1AOYA 2V9VA 1E17A 1H9GA 2JT1A 5DUIA 4F7ZA 4GCVA 3QOPA 3ISPA 4PDKA 4KN4X 2LSOA 1XCBA 1SD6A 2VOOA 4KIGA 3ZPLA 4A0YA 4XSXF 4WCGA 3RKWA 1RI7A 1GVJA 3O3KA 4ON0A 2XAHA 3LA7A 1SMTA 3MAJA 3IWFA 4U0WA 3ZP5A 5FO5A 4XLNF 2GCXA 1T38A 1WWXA 3M1EA 3GFLA 1ZARA 4Z2YA 3DP7A 3BPXA 4BHPA 1SMYF 5F64A 2D2WA 4L18B 1T98A 3DV8A 2EFWA 4YFKF 3V8JA 4BHCA 1YG2A 4QLCU 2OU2A 1BI3A 2LDUA 4XSZF 3HRTA 5ICCA 1HXDA 4Q4ZF 3L2CA 4KMFA 2QVOA 3WU1B 2O0YA 1C0WA 4EM2A 2YX4A 2Y75A 4HX7A 1R1VA 3FZVA 4LMYA 2K5FA 4GXOA 1XSVA 2H6BA 2O3FA 5ICGA 2YR2A 2PLYA 4Q48A 4HF1A 2MLGA 5CVJA 2OZ6A 4YIFA 3O6BB 4R79A 2HZTA 4HDUA 1LB2A 1G6NA 2VXZA 3GFMA 1ZG1A 3T8TA 1IN6A 4OMYA 2COMA 2DQRA 3BZ6A 4K2EA 2IA1A 3JAMK 1B4AA 1EH8A 2XAQA 3KZYA 2K5IA 2EV5A 2QQ9A 1S29A 1XSDA 1XGSA 2LKPA 4RGSA 3GFJA 3EYIA 1G3TA 2VE9A 4M74A 2HDCA 4PGGA 2RKHA 3GZ5A 1FBUA 4BXUA 1OKRA 2NYXA 1D5VA 1HW2A 1UHWA 2EK5A 2HR3A 1Z91A 1BI1A 5ICEA 1IN7A 1IN5A 2PMUA 5DD4A 1U3EM 3FX3A 3BPVA 2FMYA 1SD7A 5L3EA 2CG4A 1T39A 5K5RA 5FD5A 5HS9A 5BS6A 4LLLA 4AD9A 5LGUA 2CGPA 5LGTA 1NHAA 3ABTA 3SHFA 3I71A 3K9TA 2F5EA 2QQAA 3WE3A 1S3JA 2XROA 2VT2A 1D8JA 1YLFA 3C7JA 2GZWA 1KYWA 2M45A 5CVIA 2O6GE 2Q0OA 3IKVA 2E7WA 5F1RA 1TTYA 3F6VA 3SFZA 3L00A 1YS6A 1FWZA 4RGUA 5DYMA 3ZN1A 1OYWA 3GVAA 5JFRA 5DCMB 4AIJA 1ULYA 3IRQA 3S2WA 3QU6A 4L5JA 3FWEA 1HKQA 4P9UA 3ECHA 4L5IA 3LSTA 2FBIA 2EV0A 1SFEA 2DLLA 2WV0A 4MGRA 5DCMA 2W25A 1U2WA 2W24A 2XHKA 4O5VA 3DKWA 1L0OC 5J8FA 1IRGA 5HS8A 5D5WB 5LEJA 4U0YA 4CGZA 2HQNA 4UVBA 3GO5A 2NNYA 4NQWA 3F23A 2ETHA 4LFUA 2XUBA 2XV4S 1GXQA 5BOXA 4ETSA 2DPDA 4HV5A 4ZYDA 1XDSA 2OAZA 1CF7B 2IRFG 1J75A 3ABUA 2Q8KA 1P2FA 1KQ0A 4BHBA 4O3MA 5TJJA 3HUGA 4EM0B 2VC0A 2CSOA 4KIBA 4M71A 5H6QA 2OD5A 2Y48A 2FMLA 1O7FA 4LG0B 1XB4A 3IRRA 2HGCA 1S6LA 2RGVA 5J8CA 4ESFA 3CUOA 3ROUA 2L4AA 2ZNZA 4IHTA 1KU2A 1JXSA 3NRVA 2HOEA 2EFNA 4HAMA 1W7PD 4ENJA 2LF8A 4UVAA 3KP5A 2FU4A 4EQQA 3E97A 3EYYA 5EEHA 2OQGA 3CJNA 2EV6A 3K69A 1YS7A 4L9NA 2JRTA 3I59B 1FBSA 3HHGA 2FNAA 1UFMA 2QYOA 3GZ6A 2P5LC 2QBYA 4EGYA 5L3GA 3RPUA 5LLQA 2RQPA 5BMZA 3M7GA 2ISYA 4TV7A 3GW2A 1G3SA 5DEQA 5CVUA 4KT5C 2V6CA 2NS0A 2Z3YA 1R5GA 3VEPA 4B8XA 1ZLJA 3LA2A 4DQ2A 2PN6A 3DFGA 4OIQF 1XGOA 2Y0MA 1D3YA 1Z1DA 1Z7UA 2IP2A 5H20A 2ESNA 1QGPA 3QPHA 2X4HA 2YX7A 1TBXA 4CO8A 4LLGF 1W5TA 2CWEA 2MC3A 1PP7U 2XAFA 3FHZA 3QPTA 3I54A 5IT9Z 2FXAA 3GFIA 4ENMA 5D8LB 3U1DA 3WGIA 4ENKA 2EFPA 3E5QA 2K4JA 2XVCA 3T0YA 2IW5A 1USTA 4KFCA 3ZN0A 1IUYA 4MQ9F 1K6OA 1O3QA 1K79A 4IXAA 2DTRA 1MGTA 2CQKA 3J7AO 2EWNA 4PGHA 4RAYA 1ZREA 3WTTC 1XDUA 5K1YA 1JGSA 1EH6A 2YU3A 3R4KA 1V3FA 2ZKZA 4ZYHA 4WK8F 3FXQA 4QWQA 1FSHA 1FP1D 3BP8A 2C6YA 4KNYA 1ON1A 3U2RA 4U88A 1J0RA 1FYMA 1SFUA 1O3RA 5A2QZ 3LWFA 2W85A 3KP3A 1YW9A 2GWRA 4A6EA 2XIGA 1ZGAA 2X0LA 3COAC 4ZH4F 3I53A 3E6MA 4OU0A 3LQRA 4M6YA 3KLNA 1HKSA 1J5YA 2OA4A 5JI6A 3E6CC 1TW2A 4A6DA 4I0AA 2JZYA 4PZJA 2ELHA 2HYGD 2K7LA 2KIUA 1SD4A 2K5LA 3IC7A 1ZAOA 2FEZA 3RYRA 1YYVA 2VN2A 5HVQC 4UV8A 4EJVA 3QU3A 1WRJA 1IF1A 1L3LA 4CICA 3DXJF 1B6AA 4HF0A 2PG4A 4N9HA 1KU7A 3DQVC 1W5SA 4HW0A 5LHIA 1YFHA 3RJPA 2VE8A 3HRMA 1PUEE 2P5KA 2VT3A 2O03A 2HQRA 4M9ZA 3MQ0A 3W6KB 1FNNA 2Z33A 5J6XA 3ZMDA 5ILUA 1S7AA 2HEOA 4IF4A 1FBQA 2P6TA 4G9YA 4HV6A 4CHUA 2MBFA 1DPUA 1KU9A 4P55A 3J81K 4L0ZB 2ZFWA 4OOIA 5E8IA 2QLZA 1R5HA 4YFNF 1R36A 3KFWX 2QWWA 1ZN2A 1USSA 1ZYRF 3V8LA 2P5VA 4S05A 1YW7A 2OBPA 1T0FA 1IZ1A 2P8TA 3SQNA 3VB2A 1BIBA 2A3SA 2A07F 3WGHA 3F8CA 2PI0A 1QZZA 4L0YB 1REPC 3H92A 4WWCA 2H3JA 1P4XA 2Z99A 2VODA 3EDPA 1FZPB 1OYIA 3SZPA 3PFIA 2JPCA 3JSPA 3REOA 4WX9A 1QVPA 4L9VA 2EJRA 4RB0A 1YW8A 5D4RA 1BI2A 1FSEA 3I59A 4LGWA 5D5XB 2H6CA 3FXUA 1BYMA 4G8XA 3K1PA 4CDGA 1J7KA 1V4RA 1QPMA 4OINF 1MDMA 3HSFA 3OV8A 2FQ3A 1MJBA 2HFHA 2K02A 1B59A 2DK5A 1AWCA 2M8EA 3PQJA 5CVRA 4LB5A 1FOKA 3DPLC 3M8EA 4P96A 2EA2A 3TQNA 1KA8A 1OMIA 5D5UB 4HX4A 1H0MA 1R00A 1RZ4A 2NRAC 2KRFA 2DQLA 4LG0A 5D4SA 1FX7A 3T1BA 2H27A 3B02A 3RPQA 2UXNA 3ERED 2ZMEA 3R60A 4ZZLA 1ZLKA 4RB3C 3KP6A 4I02A 3HYIA 1F4KA 2W57A 2K86A 5HDKA 3RI4A 3L9FA 4GYIA 1W7PA 4IRIA 3I4PA 4AVPA 3HSEA 1JE8A 1CF7A 3WTSC 5DV5A 2R7FA 1Y0UA 1LNWA 2FRHA 5JVTA 4G6DA 5E1ZB 4M72A 2H09A 3Q9SA 3R6SA 2L01A 3JSOA 2D1VA 1X3UA 4HQMA 1IN4A 1FLIA 4H0EA 5FGMA 1P6RA 3ZQ7A 5LRSA 4UXNA 4GO1A 1EV7A 5E18F 5KVRA 5HLGA 2LNBA 3G3ZA 2GXGA 2ZJ2A 2ESHA 4DNCA 3ZMTA 2CO5A 5E1XA 1HSJA 1QQIA 2MLKA 4YG2F 4MQVA 2P4WA 2KJCA 4I09A 4ZYEA 1ZHFA 1BN5A 2XKPA 3E6DA 3LAPA 2DT5A 2CYYA 1S8NA 5E1WA 3HSRA 3KP7A 3C1DA 2VBXA 2K4YA 1ON2A 2JTVA 2Z9OA 1LQ1A 4U0VA 5AIQA 3EETA 2OQRA 2ZO4A 5D6FA 3F8MA 1JHFA 1SD5A 2KIFA 3KEQA 1F5TA 3HIFA 2ZCWA 4RGXA 3E5XA 1RUNA 5EEGA 3CUQB 4MNUA 5HLHA 1KYZA 3BDDA 2RN7A 1R23A 4HBLA 4G7HF 4HX8A 1MJ9A 1FPQA 4UHTA 4ZYGA 5FLXK 5ERIA 1B9NA 4WF2A 3U9GA 2UWMA 4LK0F 1R58A 2RDPA 1ZRCA 5BPIA 3Q5FA 1RNLA 3FMSA 3F21A 1DPRA 4EJWA 4ENNA 3ZMSA 4JK1X 2HS5A 5E20A 4ZZDA 4IJAA 1ZH5A 2P7VB 2MH2A 1XGMA 1TNSA 5AONA 1FC3A 4L9JA 2FBHA 2IVMA 5DDGA 5FFZA 3E19A 2JPBA 3BY6A 3F72A 3V7SA 3QP5A 1U5TC 4I01A 3QAHA 1FY7A 2QM3A 4LK1F 2EFOA 3WU0A 1FYKA 3GEZA 3LAJA 3Q9VA 1A04A 3D5LA 2GA1A 2QENA 4PCQA 2A61A 3K2ZA 4EMSA 2TDXA 3BJOA 3R0AA 4MTEA 2WC2A 3RKXA 3HOSA 1LVAA 3L7WA 3HOTA 1UCRA 5TRDA 5HLIA 5L3BA 1TNTA 4BH9A 1KQ8A 3K0LA 3T8RA 5BPDA 2STWA 1XMKA 3QRFF 1P4WA 1KQ9A 2FA5A 2MA3A 1MDMB 4U7BA 1IXRC 5A2QK 3CUQA 4FX0A 3WGGA 4A5MA 3LA3A 1EH7A 4G7OF 4M73A 5DUKA 1G4DA 1MZBA 5FFXA 3HTSB 3E3VA 2HTJA 1Q1HA 1SAXA 2GIVA 1XD7A 3RYPA 4OIOF 3CO7C 2PBIA 4Y13A 2BGCA 3GYHX 1DDNA 1Z9CA 2FNPA 4AIKA 4BNCA 4LJZF 2IA2A 3VOEA 3LQQA 2XAGA 3J80K 3V7CA 5IT9K 5HOOA 1IN8A 3LFKA 2EFQA 4HQEA 3HHHA 5HDNA 2AS5F 3WG9A 3W6JB 1I1GA 3N97A 4FT8A 4KICA 4CXFA 1P4AA 2L3DA 2BEOA 4OIRF 1YTYA 4BYYA 1ZRDA 1GXPA 1WSUA 2GQQA 1G3WA 2F2EA 4KYWA 4M9XA 4N9IA 3FMRA 1K78B 3IHUA 2A69F 4WXCA 3F8FA 4IPAA 2OZUA 3CDHA 4XRFA 1D8KA 3JAMZ 1FYLA 2XKOA 4EJUA 2KKOA 3MFKA 4EM1A 2KIMA 3KEOA 3T5XA 4MTDA 4OIPF 5K5QA 1T2KA 4FX4A 2M1BA 2ZMEB 2PJPA 4ASNA 4EVIA 1R1UA 1HKTA 1LDKB 2IA0A 4Q47A 1ZG3A 1SFXA 4UNOA 3GLXA 5DD8A 3GX4X 2P7CB 2NNNA 2M5WA 2ACJA 3DPTA 4U7DA 2PQ8A 5ICFA 3ZMVA 1LJ9A 3WODF 2J5PA 4KMUX 4IRHA 5IT3A 4MEYF 2RNJA 4LB6B 4RGRA
chains in the Genus database with same CATH superfamily
2OTJI 2E2JJ 4I7HA 3J81E 1R0CB 2IJLA 1RAHB 3SB2A 4HYEA 3HSBA 4XTZA 4J9GA 3SZTA 2RD1A 3NHNA 2FBKA 2KMUA 2KJBA 1MMNA 4M9SA 4QTRA 1YO5C 2F2XA 1Q81R 2EKHA 2BY3A 5K7FA 1R4NB 2MFZA 1BC8C 1I6XA 5CQXA 4E2FB 1TQIA 3BR3A 5ED4A 2R93J 2H8RA 1IUFA 1Y07A 1QQJA 1I1SA 1WNLA 3THKA 2PUOB 4IL6C 2D45A 2HXOA 1YITA 2EILH 4MHGA 1W4MA 6PAXA 1KONA 2PFBA 2I0NA 1LEAA 4ZDLA 3EFSA 3CCUQ 4IHWA 1SAUA 4HA8A 2GF7A 2QK0A 2FOKA 5KCHA 1YITQ 1MBGA 1M4ZA 2OTJA 2DK8A 1OI1A 3WTWC 3JRFA 4FE4A 3WTXC 4LD5A 2VLAA 1BBZA 1DJ7B 4ME7A 2YSQA 1PDNC 3NFCA 3V4GA 4N4GA 1Q7YU 4F91B 3R6OA 3EUHA 2EQJA 3OOUA 1U5TA 2CP2A 2EAYA 2ISZA 2QQBA 2O9VA 2NAZA 4A2UA 3MZHA 1X1AA 4R1HA 4CCKA 1OZ3A 1YX5A 1UG0A 1BW6A 1B9MA 2VBYA 4CCMA 2XGXA 2I8DA 4CZCA 1GCPA 2DPPB 3H0HA 3G4SA 1CSKA 4M75D 1ENHA 2EB7A 3CCJQ 3DLAA 2LF7A 1K7AA 5L3DA 2QSHX 1I50J 3JTGA 2VONA 1X4PA 4PLIA 2A5YB 4IRGA 3TW7A 2E4HA 3VODA 4HOBA 2BZXA 1UJYA 3TO7A 1U5TB 2IGNA 4AG2C 4AUXA 4I6ZA 5FRNA 1O7LA 1QRYA 1QVTA 5D8KB 2Q2EA 4EGZA 2QA4T 3CCET 2RJDA 2XPVA 2DK3A 3L2ZA 3ECOA 1JI8A 5GMKi 1DGWY 3DU6A 3H5NA 2DBBA 2K9QA 1A5JA 3A8LB 5FU7B 2WAEA 4V19K 1K9MR 3CF2A 2Z1DA 3RQIA 4FL6A 5IOYA 5ILVA 1JUMA 4AIHA 4FYYB 1YJWA 2AXLA 4CCOA 3B6CA 4ESJA 1AKHA 2RJCA 1UG1A 1X6BA 3ML6A 3A98A 1UHMA 2L9SA 5KYYA 2KMTA 4D1QA 1MH4A 2O61A 3CO6C 3FM5A 5EEAA 1WA7A 1NE8A 2LBFB 3CMAT 1VA7A 1G3YA 2HPMA 2J5OA 1U78A 2DPUA 2DI3A 1YCYA 2L2PA 4AFZC 2XAJA 4BUPA 3MHXA 1PWTA 1KZHA 4NOYA 5LJ5f 2L3PA 3M9AA 4CA0A 5JR3A 2LREA 1J2XA 3CMAI 2PEXA 1IV6A 1ZSGA 2C0OA 2JMAA 1UMQA 2XF6A 2HQ5A 2MW8A 1OR7A 2A6EF 1NEBA 2ENMA 1TP4A 2UXXA 2DZCA 3AL0B 1DP3A 2CW0F 2DODA 2O4XB 4U87A 2LVMA 2EA4A 3HOWJ 3G4ST 2DA2A 2OPTA 2AXTC 1BCOA 2EFIA 2GGRA 3BE3A 5D6EA 1ORKA 1J9IA 3RTRA 4S04A 3WHBA 4XLEA 1B3QA 1TUDA 2M4GA 1U8RA 1UB4A 2BY1A 3Q0WA 2P0KA 3LSPA 1W5CC 2DL8A 3CC2Q 3ULQB 4B09A 2FHDA 3PT9A 1E2XA 3KETA 2D9TA 4I98B 3CC7T 1WKMA 2EBIA 3L2VA 4HLYA 4A53A 3OW2A 1ERDA 9ANTA 2VC1A 2WA0A 2FO0A 4BY1J 1OCZH 2DFIA 2H1KA 5GAN8 3KFVA 2KLOA 2JTEA 4AYBA 8ATCB 2EZLA 3WTUC 3BR5A 2W00A 2YUSA 5LGNA 3HKSA 2CS7A 3VS0A 1ZG5A 4EJTA 3ZMZA 2LX9A 4TVRA 3KXTA 5CJ9A 3FHNA 2QUFA 4HLXA 4OGEA 3SD4A 1YI2Q 1Z3YA 1BU1A 2LG4A 3LSMA 3JCMf 3HDDA 5KYNA 2HKOA 2YPRA 4XK4A 5LRRA 1TQPA 1TW3A 4KA4A 3DCFA 5H2FC 3CD6I 4BBRJ 4WXHA 1HDPA 3RKYA 3SXYA 2K3BA 3MO8A 4J9EA 4M75G 5D6YA 1T8IA 4DYRA 1P92A 1D0YA 1I5ZA 3TOBA 2QZ8A 3K1MA 3OR1C 3QYEA 1VQPA 1QVFA 4YIIA 2GQVA 1OX8A 3BJ6A 2DEQA 1JKQC 3M0QA 2TRTA 4HDVA 1M3BA 4DIQA 1LOJA 5C4XJ 1BM9A 2BYVE 2QTVA 2O5RA 3OYBA 4FTHA 3JR9A 1O3TA 3WVEB 4NHJA 4GGGA 2FF4A 3MZYA 3QWXX 2CJJA 1LDJA 1YWOA 3C18A 3S1QJ 2V1DA 5LHHA 1BKBA 4FT2A 3ULRB 4II2A 4UVCA 3OS5A 4XTWA 4NL3A 2V6EA 3GXOA 2NUZA 1VQOI 4EMKB 1X1CA 1YQAA 2KDZA 2NLUA 3M0RA 1FJLA 1B1BA 1NG2A 3BWGA 2LT1A 3DLLA 3L2UA 1N8RC 3QDFA 2DO3A 5BQTA 1K78A 5EGOA 4FW1A 3ZMUA 1O57A 3BJAA 2VKEA 2XRNA 1T0HA 4F7UB 3I56T 2A6TA 3AL0C 1LUJB 1LEBA 3KP2A 3O8VA 3VS6A 2E34A 1QA6A 2DF6A 1RUOA 1QCFA 4W1UA 2ZB9A 2E1NA 2HWVA 1W0TA 2X1DA 1Q1VA 1OEBA 2R58A 2VJIA 2DT6A 4E7ZA 3BROA 1GHCA 5FKNA 2FPEA 1ZSZA 4ORZA 5AIPA 4II1A 5FU6C 5CKHA 3P9IA 3C3WA 5L3CA 2E7XA 1M2VB 3MCZA 1IXCA 2CUFA 4YRVA 5A2QR 2EQUA 4B47A 5F0HA 1ZGJA 4KDPA 4J6WA 1FT9A 4BJ5C 1X2KA 2DMPA 3Q0VA 2JOYA 4KIFA 1IRFA 2V26A 2L0KA 3D0SA 3I0TA 3JTHA 2DYSH 3HXLA 3O8HA 4M78G 4C8QF 1H92A 1SFOJ 3ER0A 1OV3A 3I5UA 5FU6B 1MBFA 2ECCA 1JEGA 1KC8R 2CSQA 3HZJA 3F22A 2L02A 4FIBA 3VS1A 4E47A 4FT4A 2VYTA 3CBPA 3QP6A 2PVGB 2HNHA 4IIOA 2I2LA 4RTWA 2JK3A 5DCFA 4C5HA 3CXCS 2Z2SB 5K7HA 1IXSB 5FKLA 3KZZA 1MD0A 3FXRA 2QBYB 2O8XA 2XD0A 1PP8F 1MNMC 3HFNA 2MD5A 3OYAA 4RM2A 4OWRB 4BKXA 4Y7NJ 1U6GA 1MBEA 3IL2A 2DA7A 1H9TA 1ETXA 2M30A 3CLOA 4PSWA 5IYDJ 1KHIA 2Z5UA 4Q5SF 1QP3A 1XC5A 2IGKA 2G3RA 2RQTA 2H8WA 3AG1H 1VQLT 4A0ZA 4G12A 3PFSA 1LDDA 3FK7A 4ABZA 2EZKA 4ZN3A 4KUDK 2X35A 2HYFA 1Z6RA 3PQKA 1CGPA 1OYXA 2MH9A 3LNQA 1PG5B 1DP7P 3M0UA 5EC7A 3AAFA 3F0CA 3KZIC 2A68F 4IHSA 3PFYA 3A8GB 3B73A 3BG7A 5FB2A 2VOPA 1M90R 3L1PA 1EFNA 3WTZA 4XRMA 4Z02A 5IYCJ 1M8VA 2K3XA 2JSPA 3E6BA 2R7ZJ 4XOPA 3M53A 5LJ3g 1IZ6A 3RIRA 2OAWA 2PMZA 4XBFA 3DKMA 1M1GA 4EV0A 2M9UA 2K27A 4HF2A 1Y56A 1WCMJ 1J3TA 4G94A 4QVZA 3K4BA 4DYCA 3OYFA 5HY6A 1JGGA 2NVTJ 3S1MJ 4CRIA 2LP0A 2VQCA 3H3ZA 1MV3A 2RB6A 3M57A 1MKMA 2E1CA 2OUMA 1FP2A 2FSWA 2HOSA 3QYHB 2RAEA 3OOPA 2M0MA 1V5GA 2R5YB 2LQNA 4JLIA 3H0FA 1P7IA 3J81Z 2JA5J 2CH4A 2NOGA 4B6MA 1NEGA 1QVGP 1XGNA 4J83A 4EJOA 2MABA 3I9V2 1T6SA 4XU2A 2P81A 2XF5A 3E5UA 5FW9A 2G9WA 2R3SA 2KRSA 4ZGJB 2E70A 3FBNB 1IDZA 1A6IA 4A63B 2F2WA 5JLXA 2ZNYA 4YELA 2R7DA 1YX3A 2K4BA 1EX4A 1BIAA 4CYDA 4ZDOA 2DYRH 1DQUA 2BHZA 3BZCA 5KYWB 1NLPC 1M27C 2KK4A 5KYXB 2MSYA 2DA5A 2IG0A 2QF7A 1NH3A 3F3XA 2D1HA 3RDIA 1QU3A 2LQ8A 5J26A 2FZCB 2DILA 3CMAA 2DJIA 3BOQA 4E4HA 3OS1A 1F1ZA 3G73A 1HBXG 1I8FA 2CGHA 1RLQC 1UJ8A 3SWNB 3FDYA 2OJED 1MUZA 3BC8A 3VJPA 3FF5A 4JP0A 1VQMI 3HRSA 2VBZA 2FPFA 2SRCA 4BQAA 4B9XA 4DOVA 3RERA 3TSZA 3EQLF 3R61A 4RB1A 1G2BA 5C0MA 3CC4I 2DO7A 3OIQA 4PJLA 4J9HA 3EPZA 4C2MJ 4PJOD 1UGPB 4OMPA 4AWXB 2OX7A 1LFUP 2HQAA 1SPKA 2BBYA 1HD3A 3CMET 2OV7A 5CYVA 3CC4T 2JSCA 3MEXA 2WSEE 1OCCH 1U1SA 1R7JA 4QVDA 2AT1B 3CCSA 4EIKA 4FHTA 2RK1A 5KAFC 3M54A 3DBRB 1QW1A 4N4HA 3HKZA 1WJBA 1XMAA 3FXOA 1IGQA 3FLGA 4CUGA 3C12A 1W1WE 2BZTA 3K1NA 2XPUA 1W7PB 3BQYA 2R5ZA 5CAIA 1MV0B 3CCUA 3HOYJ 4HT8A 2RMOA 4A3BJ 1TQMA 3I5RA 3OYCA 2G7UA 4FQGA 1VQNQ 2LNVA 4JX4A 2WTEA 3ZR8X 1Q82C 2Y69H 2LQWA 5GMKl 3H3UA 3GBGA 3BTJA 4RB2C 1TT0A 2AO9A 1Y0NA 1SFKA 4E70A 2R7UA 5F6FA 1YP5A 4A54A 2QEXI 3E1SA 4Z89A 3P9KA 4I0BA 4M78D 2RQUA 5K5OA 3HRUA 3FXJA 2XGCA 2DU9A 1STZA 2PMHA 5L3FA 4QT7A 4UUVA 1YIOA 3N05A 4KJZA 1RADB 3G6EQ 3PSIA 2ZPGB 3EGDA 2GTJA 1OYYA 1UE9A 3HP9A 4NQWB 2NVXJ 3ZQIA 4XAXB 1WXUA 2NUTB 3HTUA 3WTVC 3LW5E 3KLOA 2YSRA 2ZSIB 2ZXJA 1R22A 1VQMQ 5CLSA 2P6SA 2F5FA 1D09B 3DEUA 3Q1JA 1MJAA 3DKYA 3MEVA 1IGNA 1HQCA 1UB9A 4KH1B 1J59A 2ADUA 2CV1A 3RCOA 5D5VB 2FUG2 3JRDA 3GF2A 3RSNA 1JBMA 2HI3A 1EIFA 3EUKL 3KP4A 1TH7A 2VJ5A 1IXDA 4RMNA 3JCMh 3M8FA 3A01B 1WHUA 4PJOC 1D1BA 2V4JC 1ZELA 5LBQA 1VQLI 1SVOA 4C8QE 2DD4A 2H94A 3GTGJ 1AOJA 4HVWA 2E3IA 2DMNA 2CKKA 4HNTA 3WE2A 4PK4A 2L4MA 4NB5A 4LE9A 3CUQC 3PNTA 4KUMA 5ILSA 4RAZA 4L9TA 4WXDA 1W36D 4KN7X 4AMCA 2IT0A 2DFFA 1YJ9I 2O9SA 2OJ2A 4AVZA 5E3NA 4J5YA 5M9OA 1IRXA 3MEUA 1C6VX 3NTKA 1FMVA 1OR7C 3IWZA 2EIJH 1XCVA 5GADJ 4P5OA 3N4MA 4LLNA 2A28A 3A2KA 5KH6A 3CD6T 3CCVT 4XRSA 5LHGA 5IHIA 5J1RA 2ZPEB 4N0BA 2CMPA 3EGDB 5LL6S 1KU3A 2JA2A 2LKSA 1QWEA 3QBYA 1ZUKA 4M77C 3NGPA 4IUQA 4UUSA 2M0CA 2OC6A 4C30A 4JZ4A 2AHJB 3VSLA 2GOMA 1K4TA 3J80Z 3BFMA 3M4YA 1ZRFA 4XKVA 2JTMA 5IXBA 4CZZA 3H36A 4KULA 5F1JA 4BU2A 5B5EC 1TLHB 3BG5A 3FM3A 5CKBA 4AC0A 1O3SA 1AWWA 3I55Q 3S14J 3GWZA 1XN7A 1LCKA 1NG7A 4AFUC 3JW4A 2M51A 1HJDA 2WB1A 3CP8A 1ONVA 2A37A 3TOAA 2M87A 2KBTA 2V8IA 3M07A 1H89C 2P4RA 2X9HA 1HDDC 1Z05A 2E1HA 3QJ6A 3X26B 1F36A 3MWMA 1XSXA 3EH2A 4A4FA 5GAOm 3GMEA 1E6GA 2QA4Q 3KCCA 1TWFJ 5FD6A 1TUCA 4ZDPA 4FE7A 3TDZC 1ACIA 4J6YA 1VQ7A 2F5CA 1XS9A 2FQ4A 5H6RA 2E2HJ 2DKGA 3MP8A 4ZJZA 4F52A 1BI0A 1VNDA 3DF8A 2K9LA 4A12A 1PUFB 5DLOA 3NQOA 1WHGA 1YJ9Q 4XOTA 2V7FA 1HW5A 1KHCA 2QEXT 1K73U 5J1UA 2W48A 2EIFA 3WXMB 2MWOA 1Q86R 3OYLA 1WQWA 2DL3A 3PE0A 2AIRB 3JRAA 4J9FA 4XK8E 1T0FC 3HKZN 3OYHA 3L2QA 1QBJA 2EQIA 2DE0X 5JLWA 5HK3A 1QVGS 1X1PA 2FOWA 4C92F 2VQGA 3ZQHA 2KXDA 4LDXA 3VS3A 5GAEJ 3FKIJ 5GAOl 3GUDA 4R8HA 4UV9A 4YIRX 1UEBA 1S7OA 5DLQE 1D0ZA 1SC7A 4AG1C 2V1QA 3DU5A 2M8GX 4B3XA 3PIOF 2QDLA 2BHYA 3LX7A 2A6HF 4M7AB 3ZXSA 4C92C 1E3PA 1DUXC 3DTEA 1BL0A 3NWSA 3BTLA 5LJ3e 1LFPA 5LJ3h 3ABLH 3J7AY 3CC2T 2W84A 1VYVA 1I39A 2R7QA 2RV8A 2HOTA 1OULA 2LC4A 1VQKI 2FE3A 4X1EA 5J3LA 3V8KA 1WI9A 4D0PA 3CCSI 1X69A 1X6OA 1OCPA 3F8NA 3REBB 1KFZA 1GBRA 3TCJA 3CLQA 3H0DA 4IUPA 2LJ0A 1S1NA 1VQ6A 3HOVJ 1OPCA 3CCRT 2RJFA 3CCUI 1NZ9A 3VS4A 5KE2A 3CCMA 3A0HC 2M16A 3I9QA 2BE5F 1OX9A 3L09A 2QYZA 2IPQX 2D8JA 4RA2A 3K70D 3QKJA 3R6NA 1AKHB 1TOVA 1YITT 3H0GJ 2NUPA 1JT6A 2KP6A 3HFOA 4G6QA 5JHUA 2V1UA 5J3BA 1BR4A 1QNTA 1ETKA 2VKVA 5CCAA 3JB9J 1Z6TA 3QYFA 2KRMA 1MNEA 2KY9A 2E1OA 5E8GA 4BAYA 1F9NA 5J4YA 4C8QA 2ZC2A 2ZMEC 1XOVA 2XIDA 3CMAQ 2OTLI 1AWXA 3G1MA 2MUNA 3ZBDA 2KT1A 1B8IB 1RIOH 4Y17A 5KYUA 2LRDA 2JXBA 3BW1A 3FMQA 3ABMH 4A0XA 2K6DA 3VKIA 4F16A 1WQ2A 2XASA 4RTZA 3J80E 4BI8B 3CCQI 1WXTA 1VQOT 4G7ZF 2TCTA 2ZXIA 3DEWA 3R0JA 4XRSG 4XLPF 3FB9A 4JJCA 3P8BB 2WSFE 3NEUA 1YI2T 3CCMI 3F6OA 4JBAA 3F8BA 1M3CA 4AT1B 3JCMe 1JHHA 1WGXA 3TO6A 2HTSA 5HS7A 1HW1A 2X6OA 4XR6A 3PIPF 2GXAA 1ITYA 2COYA 2L54A 2IS1A 3W3CA 5C4JJ 5KK1A 5LEKA 1NK2P 5LJ5d 1A0NB 1M3AA 3CPFA 2VWFA 4MLOA 3UKGA 2V1XA 2KFDA 3ZEHA 5E17F 2ECBA 3I56A 2DMUA 2FRWA 4P5NA 1CQTA 2QA4A 4BUGA 4HZFA 2RQVA 2STTA 4GDFA 2LOOA 1VIFA 4JQFA 2H8HA 4L59A 3H1CA 2P4TA 4ESBA 3OYMA 4I2OA 3OB9A 3RQ4A 2JMCA 2F5DA 1Y96B 3TGNA 1T08B 2XAUA 1ZQ1A 1IAWA 3AG4H 1KGSA 2GAUA 1VTNC 3QJYA 2BVLA 2E65A 1P7JA 3P7NA 4RKUE 3TO9A 2GXBA 2CP6A 1M1KR 2ZXHA 1WI7A 2HVQA 1UGQB 3V7RA 2HKXA 1KD1U 2V9KA 3FIWA 1UECA 1BJAA 1TWGJ 2M7BA 2JN6A 3CCEI 4MEXF 1E6HA 2Q1ZB 4XIDA 3X24B 3K4LA 2ZFUA 2COWA 2GBQA 4O6JA 4D8KA 4NL2A 3L2WA 2BV6A 2B0LA 2GA2A 3MZ8A 1OU8A 3BDLA 2W10A 3H41A 3MKDA 4EPCA 2RC4A 1PJRA 1A6QA 3JCMX 2VKNA 1QZYA 3I64A 2DAOA 4RS8A 4MO7A 2RVCA 1TS9A 1TXQA 2LMJA 3ASNH 5GANd 4IVNA 3FEOA 2GIZA 5CVVA 2GNCA 2RQRA 4D6WA 1W4SA 3BY7A 4ZGEB 1QO0D 5FLXZ 1K76A 5D6XA 4D5CA 4C9YA 2ZBKA 1W70A 3HL2A 4GYGA 2WWYA 3PNWC 4FU6A 1R6RA 4P9FA 2ED1A 5HNFA 3CCJA 3VS7A 2G7HA 1BCMA 1X2QA 4M7DA 3BCAA 1JT0A 3WTYC 2KNBB 3LWIA 1I27A 3P9CA 2L8DA 4YFXF 3TKYA 2EZHA 2VBWA 2DW4A 1R1TA 2CQNA 2Y31A 3H9GA 3KEYA 4N4NB 4OMZA 2O9LA 3I58A 5GJVB 4JYKA 4E7LA 2JQ7A 2ID3A 1WJQA 1MIJA 2JWTA 2DMQA 1JJ6C 2NWMA 3CCLQ 3ZL7C 3O2PE 1YJNT 2HVRA 5GMKm 1BC7C 2YU9J 2UZKA 1QZEA 1BBYA 1PSFA 1K8AC 3CTAA 2CUBA 3KE2A 4J9IA 3TDUC 3IKTA 4UC4A 1HSTA 2QGFB 4XN3A 2XKOC 4M6XA 4RCBA 1U06A 5HNHA 2OTLT 1N25A 2CFXA 4IUUA 3ELKA 2RI3A 3K70C 3CCJI 4BE0A 4LDVA 5CKFA 3CCQQ 4Y15A 4XKWA 5HDGA 3LYIA 3IH3A 3JRBA 1UDLA 3PO2J 2ESWA 4RTTA 2MF2A 2VB6A 3A0BC 1K1ZA 2IAIA 1BOAA 2HYJA 2FG0A 3CPWA 3QPLA 2MZ4A 1YJ9T 1IW7F 2V79A 4Y91A 1ODDA 1B8IA 1AOYA 1YHQA 4LDUA 1QHGA 3CCRI 4XU0A 4C92A 3HM5A 2YDLA 2ICWG 3S2DJ 5IAYA 3CCUT 4RG8A 5CKEA 2V9VA 1E17A 1H9GA 3MPUB 3I56Q 2JT1A 1YITI 5DUIA 4F7ZA 2FVUA 3NMZC 1YJWT 2YRDA 4GCVA 1OCTC 2J7IA 2LKXA 1OCOH 2LQKA 3I3LA 5IY5H 3CMEA 3S17J 2RQWA 5GAMj 4X0GA 2XICA 3QOPA 5EG0B 3ISPA 2ROTA 2VXEA 4V2SA 1TWCJ 4GLKA 2DA1A 2HXIA 3HPHA 4PDKA 2EZIA 4KN4X 2LSOA 2WSCE 2X6WA 4H4KC 1QVFS 1XCBA 3OYEA 1I07A 3NTIA 1SD6A 2VOOA 4KIGA 3ZPLA 1XG1A 4A0YA 5EG0A 2A7YA 2HDAA 4XSXF 4WCGA 4B9WA 2CFOA 5GANh 1TUGB 2HBWA 2DOFA 2OTLA 3RKWA 4A3EJ 2LMDA 1XPXA 2R7XA 1U1TA 1M30A 2KQRA 4QPQA 4DEXA 3ZGKA 4M3DA 3VV0A 2E1MB 2LBFA 1RI7A 2PQWA 4J00A 4F17A 1JJ2A 1WH5A 1GVJA 3O3KA 4ON0A 4BS9A 5GAHJ 3OYJA 3OR2C 2WAFA 4C92B 2XAHA 3LA7A 5FLXE 2CU7A 2PJRA 3JB9D 1HSQA 4M3FA 2KPMA 1SMTA 3MAJA 2CV2A 4C0DB 4PFOA 3IWFA 4U0WA 2L7MP 3ZP5A 1W36C 1WJSA 2E36A 2XDDA 2VPRA 3HPGA 2VGMA 5FO5A 1Y1WJ 1B72A 3E9GA 4XLNF 2GCXA 1S72Q 1T38A 2BE7D 4M77A 1N75A 2XU8A 3GTKJ 1WWXA 3M1EA 5FKMA 3GFLA 4F93B 1ZARA 4PUSA 4Z2YA 2PNIA 3CQTA 3DP7A 1ZUUA 2JMWA 2I10A 3BPXA 2CP7A 4RG2A 5IT9E 3I55I 3H9NA 1JUPA 2FB7A 3J81R 1G83A 3G7ZA 1IV8A 1XX5A 4BHPA 1NJIU 1SMYF 5F64A 2D2WA 1SEUA 1OQKA 5LJ5j 3ASKA 4PFPA 4L18B 1JQQA 4OGCA 3ONQA 1T98A 3W6VA 3DV8A 2AHQA 2FEIA 4ZTFA 1FIPA 3H9JA 5GTIC 3UF4A 3CDLA 2EFWA 1K83J 2AZVA 2G6FX 4YFKF 1W2BP 2RNAA 3C2HA 3V8JA 4BHCA 2CYZB 4M7DF 2VQLA 4MMLA 3C95A 1WHKA 2HDDA 4EDUA 2XDBA 3K7AJ 4OVAA 1YG2A 3I55A 4QLCU 1K61A 2OU2A 1BI3A 1Z3XA 3DBHB 4D9JA 3OYDA 1AEYA 2LDUA 4XSZF 3HRTA 5ICCA 3GTLJ 3PO3J 4C8QC 1HXDA 1VQ4A 4DGWB 4Q4ZF 1UGRB 1VQ7T 3L2CA 5FLVA 3KX2A 5M3MJ 4JRKA 1EJ9A 1HF0A 4C2UA 1WLPB 2BTTA 2KXCA 3G1JA 2X3WD 4KMFA 1Q95G 2QVOA 4B44A 6AT1B 2RN8A 2KR3A 4A93J 2DZ9A 3WU1B 4IQ4A 2CREA 5IPAA 2O0YA 2E5KA 1C0WA 1MMGA 8AT1B 3PUFA 3D7SB 1R49A 4NNJA 2CSIA 4BD3A 4EM2A 4FSSA 2XI9A 3A02A 1PC0A 2DL4A 2JTFA 2X48A 4XM3A 1JRIA 2EJ9A 2YX4A 2CP5A 3NPFA 2Y75A 3K6GA 4HX7A 1R1VA 3FZVA 4LMYA 2K5FA 1M5Q1 4MZMA 1WX6A 3OW2P 1KC8C 1VQ6I 5GAMg 4GXOA 1D0XA 1XSVA 2H6BA 2O3FA 5FJ8J 3OS2A 2C0TA 5ICGA 2G0EA 4M77G 2R4GA 2HKNA 2MWPA 2O31A 2YR2A 1KD1R 2MD0A 3ZQGA 2PLYA 1LFBA 3H35A 3OWTA 3X28B 4HG2A 4Q48A 2HL5C 3HTRA 4HF1A 3QDRB 2MLGA 5CVJA 2OZ6A 4YIFA 3O6BB 4R79A 2HZTA 1Y96A 2P84A 3M5AA 1M90U 1S7EA 2EGAA 1J09A 4HDUA 2X4XA 4R56A 1FTTA 4Z88A 1LB2A 3UDCA 2JT4A 4XONA 2DBMA 1G6NA 2VXZA 4XQ3A 3D5SC 4D7NA 5J4VA 1X4OA 3GFMA 5DTDA 1U9NA 2KRCA 2E5NA 1ZG1A 3T8TA 1IN6A 3CCRA 5M5YJ 3LSRA 4OMYA 2COMA 2L3SA 1NPRA 2LZ6B 3BDUA 1TT5B 2DQRA 3BZ6A 4K2EA 2IA1A 2JS0A 4M7DC 2KROA 4F3QA 3JAMK 2HD0A 1B4AA 2MOXA 4P1WA 1ACMB 3VYRB 2V8JA 3DLLF 3G2BA 3OQ5A 1EH8A 1R77A 2L2OA 2XAQA 4PJOG 3QIIA 3KZYA 2K5IA 2EV5A 2M2EA 1UHSA 4QPOA 3CMEI 3FXMA 1R9TJ 1YHQQ 1KJWA 3UPUA 2QQ9A 1B7TA 3PIOA 2CS3A 2HNIA 1S29A 3OSSC 1XSDA 2LKPA 1XGSA 4RGSA 2DBKA 2GQIA 3GFJA 1Y6IA 1ZHIA 2KAFA 2NUPB 1KC8U 5LJ5h 2L3QA 2LRQA 3EYIA 1G3TA 3A1YA 1OZ2A 4A5NA 2VE9A 4JUVA 4C8QB 4A3LJ 2DA9A 4M74A 4BEHB 5BNGA 5HLTA 3PVLA 1SANA 2HDCA 1B34A 5FKKA 4PGGA 4A3CJ 1SKUB 2KEAA 2VV5A 4FSXA 2R7VA 2RKHA 3RR6A 2IS6A 3GZ5A 4RBOA 3OYGA 1M1FA 1FBUA 4BXUA 2AKKA 1OKRA 2F5VA 2NYXA 2KGTA 1D5VA 2HQEA 2F1LA 1MMSA 3MEAA 3CCLA 2DJQA 1WZ2A 1S5LC 3S32A 3SWNC 1HW2A 1UHWA 2DOEA 2EK5A 1AT1B 2HR3A 4XTUA 3OBWA 2H1LA 3KYDB 4RAGA 4HXJA 1Z91A 1ZK8A 1Z21A 1IO6A 1YIJA 2IXSA 2ROLA 4B4CA 3SDBA 1MHNA 3CQZJ 2ELKA 5KYWA 2RJEA 1I0CA 3V42A 4R0KA 1BI1A 5KE3A 5ICEA 3G4SQ 1YJ9A 1IN7A 3K4JA 3WU2C 1N9SA 1WQ7A 1VOMA 1IN5A 2PMUA 2QGUA 5DD4A 1LPQA 2QG9B 2E35A 1U3EM 1VQ8Q 3FX3A 3BPVA 2FMYA 2ZPIB 1RRJA 2LP5A 1SD7A 5FRMA 4OP0A 1RPWA 5L3EA 4XQFA 4ZN1A 2DXTA 3DLMA 5EDNA 3JSCA 3MEWA 1Q86C 2CG4A 3G71I 2DFEA 3LSGA 1T39A 5K5RA 4IOAF 1B07A 1Y7XA 1ZSZC 2EYWA 4J7IA 5FD5A 2CH4W 3EGUA 5I21A 5HS9A 3FRNA 3FDRA 4N0AA 1Z9QA 3JB9F 2DA6A 5BS6A 3W2AA 3RZOJ 1GLNA 4LLLA 2K85A 3SJMA 2DXIA 5EG2A 4AD9A 5LGUA 5FLMJ 2CGPA 5LGTA 1IHVA 1NHAA 3ABTA 3SHFA 2OAUA 4NS5A 3RDVA 4JRPA 2DL5A 1VQPQ 4XLFA 3BLYA 3DPUA 2PX9A 3EGXB 3I71A 1FOXA 5AYFA 4A4EA 1VQ5A 3K9TA 1I1JA 3CCQA 2X98A 1P9QC 4IO9F 2F5EA 1QP2A 2QQAA 3WE3A 1OU9A 2KHMA 1S3JA 2XROA 1VQ8T 2VT2A 1D8JA 2EQRA 3JCMQ 3QHSA 1YLFA 2JVGA 2HZYA 2LNHB 4ZTJA 1WPKA 3GBQA 2JA7J 4X34A 3C7JA 4BGDA 2GZWA 1KYWA 5GJWB 1FOWA 2M45A 5CVIA 2O6GE 2Q0OA 3IKVA 2ZZDA 4C92D 2E7WA 5F1RA 3JCMc 3QSUA 1TTYA 1X2NA 3F6VA 3ME9A 3SFZA 1WJRA 2XDVA 2R7WA 1VYUA 3G6ET 2M1HA 5KCOA 2KQWA 3L00A 2EQKA 3ERMA 3RZDJ 4X6AJ 1YS6A 4Y33A 3VSKA 4M7AG 3SDGA 2JVVA 1FWZA 2DEUA 1VQ9A 3ZQFA 4RGUA 4RTVA 1QLYA 4M78F 5DYMA 1JU5C 1UELB 3ZN1A 1OYWA 1JTXA 3GVAA 4DA4A 2CQXA 1KIKA 5JFRA 2AK5A 2MVTA 2WY8Q 2E5ZA 2DFUA 4BDZA 5DM6F 4L6V5 4GFBA 4JJDA 4OB0B 5DCMB 2MC4A 3UR3C 1ULYA 4AIJA 1TC3C 3IRQA 1N5ZA 1FXXA 3S2WA 3LMMA 3URGA 3QU6A 3TW6A 4L5JA 2Z0WA 3FWEA 5I11A 1HKQA 3IP4B 3GNGA 4P9UA 3DB3A 2D5VA 3ECHA 3H5RA 4L5IA 4BJTA 3A01A 3LSTA 1U8BA 2FBIA 3M3YJ 1YFNA 4PJOE 2EV0A 2EYZA 1SFEA 3KYLA 1K6YA 1VF9A 2VXFA 4OB2B 3H8ZA 2CW8A 2JM9A 1NK3P 2DLLA 2WV0A 2WADA 2QI2A 4MGRA 1V5EA 4UB6C 5DCMA 4JX6A 4N4IA 1O75A 2W25A 5DM7R 4JS4A 4WCIA 1U2WA 3CC2A 1V29B 2W24A 1PD0A 2XHKA 1S72A 2QTXA 1MW7A 4O5VA 3S15J 3DKWA 3QQAA 1L0OC 1RAEB 5J8FA 1IRGA 1E3HA 4QQ6A 1OPKA 5HS8A 3HB9A 5LEJA 5D5WB 2R92J 4D7MA 4J01A 5LJ3d 1YE9A 2Y2ZA 2DRMA 3CCLT 4MFDA 3OL3A 3OYYA 3BG3A 4U0YA 4J19A 4CGZA 4JJBA 2HQNA 4UVBA 3GO5A 2NNYA 4NQWA 1X01A 4JLGA 5FU7C 3PTAA 1D3BB 2DIQA 1WFWA 3F23A 2YLBA 2ETHA 2YUQA 4LFUA 3PJRA 4DZJA 3OYKA 3JRCA 2EPDA 3M56A 2XUBA 1ZKGA 2XV4S 3DEEA 3SHWA 4OMQA 3GIBA 1ETOA 2RNGA 1GXQA 3HGGA 5KYUB 4LITA 1N9RA 3O5ZA 3QYBA 5BOXA 3VYGA 4ETSA 2DPDA 4C92E 2MG4A 4HV5A 2Z16A 1NJIR 4ZYDA 1XDSA 2OAZA 4E7SA 4ZYAA 1CF7B 2IRFG 5I22A 1LE8B 1J75A 3ABUA 2Q8KA 2JUCA 3JAMR 3L2RA 1P2FA 2OTLQ 2FX0A 1RAAB 1TWBA 5GP9A 1KQ0A 1HYOA 5GAN5 1M1KC 5GAN3 4BHBA 2JRMA 2XGDA 2CUZA 3ABKH 4O3MA 5TJJA 3HUGA 2BW3A 4C8QG 1GUUA 1POGA 4EM0B 3BQZA 2J05A 1ETYA 3LOCA 1R71A 4FYXB 4RLQA 5FWBA 4PNOA 3WVDB 1NTCA 3MKZA 2VC0A 3S3NA 2CSOA 3U1KA 4KIBA 2E6ZA 2D6FA 2M3AA 4M71A 2EQMA 4RCCA 4E6KG 3P5JA 4IUVA 4DW6A 5H6QA 5FLXR 1ABOA 3C4SA 5C6SA 5CIUA 2O88A 1NYGA 2OD5A 2Y48A 1VI0A 2GOXB 1U0JA 2B9SA 2DAQA 2FMLA 1O7FA 2EYXA 3SWNA 4LG0B 4RLFA 3S1RJ 1XB4A 3CCEA 3IRRA 1GCQC 2HGCA 5HCKA 3INZA 1S6LA 1SHFA 3UA7A 2VKHA 2BXZA 3BR6A 1EKEA 2RGVA 2KE9A 4D8DA 1VQOA 5J8CA 4A3DJ 1T3LA 4ESFA 4M75C 3OSVA 3CUOA 3ROUA 2L4AA 1LPLA 1MMDA 2ZNZA 2BZYA 1VQOQ 4IHTA 2K7AA 1KU2A 3S1NJ 1XNIA 3QG1A 1JXSA 4R55A 1I81A 4M7AE 2X6YA 5GANg 3NRVA 2HL3A 2OF7A 1H3ZA 2HOEA 4NC8A 3M1CA 4XLAA 1I4K1 3CBMA 2EFNA 4PLLA 4HAMA 2QQSA 4FM4B 4BY6C 1MNDA 4ESRA 1TZLA 1W7PD 4GBQA 3CCVQ 3H5AA 1UZCA 2R5YA 2ZJRF 1I6HJ 4ENJA 3I5SA 3VRZA 3IUOA 3KIOA 4DOWA 2LF8A 4IURA 4XTYA 4UVAA 2FYKA 3CCVA 3KP5A 3X2QH 3JAME 1ZLMA 2LJ3A 5IP7J 2FU4A 4EQQA 2A0FB 3TSWA 3E97A 3EYYA 3OL4A 1PNJA 1WHMA 5EEHA 2QKMB 2OQGA 3CJNA 2JUGA 2EV6A 3K69A 1VQ7Q 4HNUA 2X3XD 3MP6A 3LSIA 1FIAA 1YS7A 4L9NA 2JA8J 2JRTA 4CC2A 2RK2A 3SFMA 3I59B 1FBSA 3A52A 2HBPA 2PVOB 3HHGA 1CKAA 2W82A 2FNAA 1JJ2P 3I4MJ 2VC8A 3G6EA 3M4OJ 2K9NA 1VQ9Q 2KSSA 3N5BB 3WG7H 4CCLA 4QKUA 3K10A 5EJCA 2F4OB 1UHFA 2HKQB 4L5GA 4Y28E 4BJ6C 1RAGB 4ATOA 2XSDC 2A3LA 3CCEQ 3A4CA 2LDMA 3VS2A 4K11A 4OAZA 1UFMA 2QYOA 4MZTA 2B7EA 2RHYA 3GZ6A 2P5LC 3A1PA 3CCYA 1MSEC 1X1DA 1QPIA 1YIJT 2J06A 3QPSA 4G6TB 3FJPA 4J9DA 1K0SA 1VQKQ 1SHGA 1WGSA 2QBYA 2YLCA 2XG8D 4EGYA 4UB8C 5L3GA 1ZR2A 3RPUA 5LLQA 2RQPA 3OSGA 3RKQA 5BMZA 2C0IA 2F69A 3M7GA 3OMCA 5GMKh 2R7TA 3PM1A 2BY2A 2ISYA 2X9DA 2NOJB 1GCQA 3JRGA 1WVRA 4TV7A 2LTOA 3GW2A 2LT4A 1G3SA 5DEQA 3LFUA 2K5CA 5CVUA 2EPFA 4KT5C 4BXFA 5GAOq 1PKTA 4M75E 3H3VK 1GFCA 1LJOA 5KCMA 2EH3A 2V6CA 1K4SA 3PIPA 4KITB 2ME6A 3JV3A 2NS0A 2CT3A 2ZGWA 2L7FP 2M0OA 2ZSHB 2XB5A 3T9NA 3JCMW 1C1AA 1M2VA 3BG6A 4GLMA 2Z3YA 2LVSA 4KUIA 3FBIB 2OTJT 1R5GA 3VEPA 3JCUC 4B8XA 3BZKA 1ZGWA 3M0SA 3GTJJ 4ZNXA 4F7UF 1M9SA 5EGOB 4HT9A 4KGXB 3JCMJ 3MMYB 1X3WB 1ZLJA 3A03A 3LA2A 4DQ2A 4UY8I 1U5SA 2RF0A 2RHUA 4RUGA 2PN6A 2CZ0B 2DXUA 2HMAA 1VQ4Q 4EMKA 2V1RA 2MYSA 3FJ5A 3DFGA 1Q81U 1D1CA 4OIQF 2RHIA 4FETA 1XGOA 3UA6A 3SDZA 2Y0MA 1D3YA 1Z1DA 2RREA 1Z7UA 2VKDA 3DKXA 2Y4YA 3WHCA 2VL8A 4FYVB 5E79C 2IP2A 3A8MB 3BG9A 4NDLA 5H20A 4BDYA 2B8AA 2ESNA 3HEFA 3CXCA 5F27A 1QGPA 3QPHA 1TSFA 2X4HA 3OS0A 2YX7A 2M7AA 3VYTB 2D0QB 2MI6A 3IAM2 2IGOA 5B66C 4V2GA 2COZA 5KNLA 5GANj 1TBXA 4CO8A 1DU6A 4LLGF 2XB0X 1I3AA 2WAQA 1W5TA 5JHFA 3AG3H 2QKLB 5CQGA 2CWEA 1AA7A 3C94A 4IZZA 1K9MU 2MC3A 2V9PA 4IX7A 1O4XA 1YRNA 2DTHA 4RM3A 4XORA 4DZPA 1PP7U 2A08A 4PJNA 2BE9B 2YXYA 2XAFA 3VRYA 4BL0B 3FHZA 1G2HA 1KQSA 3QPTA 2A05A 3I54A 5IT9Z 2FXAA 3PNVA 1VIEA 1YIJQ 3GFIA 1X19A 4E6RA 3EGXA 2DFHA 4ENMA 5D8LB 4BBSJ 2K9SA 2ZJQF 4KBMB 3DTKA 3U1DA 3WGIA 4IHXA 2HCKA 2RH2A 2GTOA 4ENKA 4A3MJ 2JA6J 2EFPA 2K40A 5JVGF 3E5QA 2K4JA 2VPLA 1PSEA 2RO0A 1RR8C 2XVCA 3T0YA 3UATA 2Y0SA 3CCSQ 2IIMA 2CUJA 3CBOA 2M9HA 4HKEA 3JCMP 3PL8A 2EW3A 1Z0XA 2IW5A 3SZGA 3DBLB 1RKTA 1USTA 2IGMA 4KFCA 4EMHA 2PJRB 4E7KA 1DU0A 2PZ1A 3ZN0A 1IUYA 2XSJC 5K7ZA 4A3JJ 4MQ9F 1VQ4I 5KYXA 4PJMA 1K6OA 5LJ5g 1O3QA 4KGVB 2P0WA 1K79A 4IXAA 3X20B 1M90C 4GRIA 2DTRA 1F43A 2R57A 1MGTA 2CQKA 3J7AO 2EWNA 1ETWA 2MCNA 5CQEA 1YI2A 2HDWA 4PGHA 4M4ZA 4L5EA 5HODA 4LDWA 3FXLA 3C0CA 1RLPC 5F08A 2X4JA 2B63J 5GMKj 2QEXQ 4ANJA 4MZPA 3CCJT 4RAYA 5I2MA 3FC3A 5J1YA 4C3JJ 1ZREA 3K2AA 3WTTC 5LFAA 2OCCH 2VUMJ 1TTHB 3H0IA 1NLOC 1OCRH 1GV5A 2PTKA 1XDUA 1UAAA 3LGFA 4LUEA 3OMYA 2HSPA 4HCCA 5K1YA 1R0BG 1JGSA 2K3PA 2FRYA 2HQHA 3AHUA 1EH6A 2QDYB 3FXKA 1IG7A 1KK7A 2EKOA 1YWPA 2YU3A 3CCST 1AWOA 3L42A 4IHYA 2CDTA 3REAB 3R4KA 1V54H 2LY1A 2PVDB 3D1NI 4Y52J 1Z67A 4AYBN 1V3FA 5GANe 3S2HJ 2ZKZA 3S6WA 4PFZA 4ZYHA 3EFOB 4DOZA 4WK8F 2DXBA 2NYSA 4JRIA 2KI7A 1X27A 2Y9ZA 5D7UA 4BEHA 1QCNA 2HPIA 3FXQA 4PJOF 1VQLA 4QWQA 1FSHA 3TU4K 1FP1D 4M75A 5IH2A 1VQNI 3BP8A 2C6YA 4KNYA 4MIMA 4BXXJ 4JPBW 2H3EB 1ON1A 5EF6A 2O7OA 2Q2EB 4MFEA 3U2RA 4U88A 1A31A 2DETA 1J0RA 1MBJA 1FYMA 1EA3A 3CD6A 2VUBA 3RNJA 3CCMT 1HCRA 3GTQJ 4FASD 2UUZA 1N6AA 1SFUA 2IS2A 1GDTA 1H8KA 2WBMA 2LH9A 1O3RA 1WZOA 3JB9H 5A2QZ 1ZA2B 3VUZA 3LWFA 4C0GA 2W85A 4JX5A 3KP3A 1FOYA 1YW9A 2GWRA 2ABLA 2DIGA 1D1AA 4OMLA 4A6EA 2XIGA 2L89A 1ZGAA 1M2OA 1TU0B 2SEMA 2K9GA 4MMKA 2X0LA 4E7IA 5GMKe 4LD6A 3COAC 3ESWB 4ZH4F 2FZKB 1JB0E 1V5FA 3H9QA 2F5TX 3I53A 3E6MA 4NUBA 4OU0A 2NVQJ 3LQRA 1JO8A 1W6XA 4M6YA 2OI3A 1MMAA 4I76A 3KLNA 4BQNA 1HOMA 1PRMC 3K4CA 4KT0E 4M6VA 1HKSA 1W2BS 2L7KA 1J5YA 2OA4A 1BR1A 1RETA 1AHDP 5E3MA 5JI6A 3E6CC 1TW2A 5IT9R 4A6DA 2K79A 4I0AA 3F9KA 1UGVA 1Q82R 2Y90A 3CCMQ 3I4NJ 3P8HA 2JZYA 1GXIE 2GBYA 3G6EI 4PZJA 2ELHA 2HYGD 3MD2A 2Y4XA 1G5VA 1RACB 3A8OB 4QW2A 2K7LA 1SEMA 2KIUA 1SD4A 2V1NA 5C44J 1ZA1B 1VQPT 5GAOp 2K5LA 1NPPA 3A5ZB 3IC7A 1A35A 1ZAOA 2FEZA 3RYRA 3GOXA 1YYVA 3VFZA 2VN2A 1VZ0A 1IHWA 1QCOA 3OYNA 5HVQC 1RI9A 3EH1A 1MGQA 2DTOA 3CPWS 1RKWA 4CC7A 4UV8A 4EJVA 3QU3A 3J7YJ 1K73C 1WRJA 5GANf 3TL4X 1IF1A 3G71Q 2CZ1B 3GLLA 4M78E 1Z9ZA 2N8GA 3GP8A 1OQYA 5B3SH 3LWHA 2R7RA 4CICA 1L3LA 1IC8A 1AZEA 3PNYA 5J40A 3DXJF 4A3FJ 2DL7A 1B6AA 3BR1A 4XU1A 4HF0A 4XNFA 5M3FJ 2PG4A 4N9HA 1G59A 3G4SI 4C2TA 1O9SA 1KU7A 4NC7A 1TWAJ 4CI0C 3LH5A 3DQVC 1W5SA 4PJ0C 4CSWA 4A4KA 2VVKA 4HW0A 5LHIA 1YFHA 4XU3A 5B1BH 3RJPA 3PMTA 2VE8A 2ZXWH 3HRMA 3IAS2 2YUOA 1PUEE 4ITVA 2P5KA 2GFAA 1T95A 3CCLI 2VT3A 1APLC 3U23A 4C8QD 2BUDA 3CC4Q 5CR2A 2R0QC 1MH3A 2O03A 2HQRA 4M9ZA 3MQ0A 3ZQQA 2L9NA 3W6KB 4KISA 1FNNA 4W97A 2Z33A 2DMOA 5GAN7 2PUKB 3FISA 5J6XA 3S16J 3ZMDA 5ILUA 1NYFA 1YI2I 3M58A 1S7AA 2HEOA 3ZFJA 2E71A 3M4GA 4IF4A 2J6FA 4AFSC 1FBQA 1BR2A 2E60A 3J7AF 1I3QJ 1LNXA 1Y71A 1HK9A 1FYNA 2DJNA 2P6TA 4DBFA 3MKLA 1KQ1A 2KZGA 4G9YA 2O2OA 4HV6A 4C0ZA 5ECAA 2DNUA 4CHUA 3M8JA 2MBFA 3SEQA 3JCMV 3OSFA 3EFRA 1DPUA 2R5MA 4A69C 5D6WA 1KU9A 1IRZA 4P55A 3J81K 4E7HA 4L0ZB 1TL8A 4OMNA 2ZFWA 4OOIA 5E8IA 2K9MA 2QLZA 4BQOA 3JCMg 2JVHA 5FKOA 3VPRA 1ZBXA 2E2IJ 1EF4A 1R5HA 2XMFA 4YFNF 4LDYA 1R36A 3KFWX 1I5LA 2QWWA 3G1LA 2XGEA 1ZN2A 1YN8A 1USSA 1ZYRF 4F14A 3CXCP 3GF5A 3V8LA 2P5VA 1JXOA 2E12A 4YTLA 3S8PA 1Y1VJ 2YRCA 1VQMT 2QEXA 3RESA 4S05A 1YW7A 2OCEA 2OBPA 2QQ8A 1T0FA 2W4SA 3I56I 3DTIA 1IZ1A 2YRVA 2P8TA 3SQNA 3VB2A 2JJ9A 3EG0A 2F6CA 2EIKH 4LOCA 1BIBA 2P0TA 2A36A 4Y92A 4M7AA 1WJ5A 1RQ6A 2JW4A 2A3SA 2DERA 3CP2A 2A07F 4N4OB 3KPHA 2YWWA 3WGHA 2X85A 3F8CA 2PI0A 3C2GA 2LTPA 1QZZA 4L0YB 3RUXA 1REPC 1T33A 1I5OB 3H92A 1SRLA 3TP3A 4M7DD 2RI5A 4WWCA 3GTPJ 3LLRA 4DYQA 1K8AR 1JJ8C 2WB1N 3QWLA 2H3JA 1Q7YR 1P4XA 1IJWC 1AZGB 5CKDA 2DCEA 2Z99A 2LLKA 2ECZA 2LX7A 3HGYA 2E19A 2YHTA 3L1AA 4M7AF 2VODA 2FJ1A 4ZGDB 3EDPA 3HBLA 1FZPB 1WXBA 2JN0A 1OYIA 2XRLA 2L9RA 3SZPA 1PUFA 4ELZC 2KYBA 1F1BB 3M9QA 1M1EB 4DJAA 3PFIA 1ETQA 4PSXA 1YCSB 2M0YA 4C3IJ 2YT6A 4C5IA 3OA6A 2VI6A 5IN1A 4Y4RA 2JPCA 3VS5A 2IBDA 4C0FA 3JSPA 3CZ6A 3REOA 5HK0A 4WX9A 1QVPA 4JJNK 3ZOBA 2AKLA 5A0LA 3GTOJ 1WHHA 1V55H 2EJRA 4L9VA 4RB0A 2VGNA 1YW8A 2KT8A 5D4RA 2HVSA 2WV1A 4RTUA 4IUTA 1AU7A 1Y0MA 4AIDA 2X4WA 1BI2A 2NVYJ 1FSEA 3I59A 4LGWA 5D5XB 3MJXA 1V1CA 1WDXA 2H6CA 3FXUA 1PRLC 3NAUA 1WPYA 3EHQA 1WH7A 2LR8A 3MCAB 2J6KA 3TREA 1BYMA 3CC2I 4RAFA 4ZC3A 2WACA 4HPQA 5GAMd 1TWHJ 3CJQB 4G8XA 3K1PA 2R7OA 4CDGA 1J7KA 2M4KA 3PGGA 2HEQA 3B6AA 4AU7A 1X3ZB 1V4RA 1QPMA 4M75B 4HEA2 1YJWQ 3J80R 4OINF 1MDMA 1M8MA 2P0QA 5F04A 1YHQT 2DRKA 2CV0A 2K3YA 4B48A 3ASOH 3HSFA 4DBHA 3OV8A 2FQ3A 1GRIA 2K2VA 1MJBA 2QQRA 2J6OA 3EFOA 1VYTA 1SVLA 2HFHA 1ETVA 2DDAA 1N78A 2KYMA 2K02A 3MVPA 2QSGX 2DMTA 1BW5A 1B59A 2DK5A 5CK9A 3CCQT 1AWCA 4C92G 2OTJQ 5LJ5e 3CDIA 2M8EA 3PQJA 2LC2A 5CVRA 3Q0UA 4BACA 1JXMA 3VUBA 4LB5A 4IHVA 5IHNA 2E5QA 2FZGB 1FOKA 3G1OA 3DPLC 3M8EA 4XKBA 2AQEA 2D1XA 1WFXA 4P96A 3PMIA 1OFCX 2EA2A 3TQNA 2EYQA 1KA8A 1RUWA 2EBPA 2CZ6B 1OMIA 1R5ID 1YBYA 2RPNA 5D5UB 4HX4A 1H0MA 3OMGA 4M75F 1VQ6T 1R00A 1RZ4A 2DVEA 4OMMA 4F7UG 2NRAC 3DWLE 4CYCB 3E0JB 2KRFA 2DQLA 4LG0A 3QO3A 1RC9A 5D4SA 1IO2A 2X51A 3NWTA 1FX7A 4QQDA 3T1BA 2NUTA 1KSWA 2H27A 3B02A 3RPQA 2GM4A 3QOEA 2UXNA 2YS9A 3EUAA 3OY9A 3ERED 4F7UE 1XTDA 2JUFA 1XMXA 4MDXA 2IS4A 1QMCA 3IQLA 3D5RC 3CCRQ 1VQKA 4BI4A 2ZMEA 3R60A 4XKCA 4ZZLA 4RDUA 1ZLKA 4RB3C 1SG5A 3HUGB 3KP6A 2ED0A 4I02A 5KAIC 1GBQA 3HYIA 3BR0A 1F4KA 2LCCA 2W57A 2K86A 5HDKA 1PHTA 2BOLA 2CUEA 3RI4A 3L9FA 1XJWB 3EG1A 3EUHC 3BCBA 2V8KA 3PUBA 3UT1A 3NTHA 4LD9K 2BIVA 4GYIA 1W7PA 1LE8A 4IRIA 1V76A 3I4PA 2CT4A 2LCSA 4AVPA 3HSEA 1JE8A 1CF7A 2M34A 3VWBA 1HA8A 3LGLA 3K4MA 2X1CA 1WHLA 3WTSC 2GFUA 5DV5A 4EATA 4XICA 4JDSA 3CJRB 2DLPA 2R7FA 1Y0UA 1LNWA 1N8RR 3TQ7P 1VQ5Q 4OB1B 2FRHA 4LXCA 5JVTA 4RMOA 1RR7A 2RQQA 4G6DA 4LG3A 4B1RA 1K9AA 2F4MB 1X2MA 5E1ZB 1OISA 4QSHA 4M72A 4PJOB 2H09A 3HOXJ 4BY7J 2DT7B 2L7ZA 1WHJA 1Q81C 3Q9SA 2RHXA 3R6SA 2L01A 4F92B 2LD5A 1D3BA 2ID6A 3JSOA 1AD5A 2D1VA 1X3UA 5GPAA 3META 2DXCA 3LSJA 4HQMA 2ATCB 4BE1A 1IN4A 1IGUA 1FLIA 4H0EA 2ME0A 5FGMA 1Q7YC 4IQJA 2GLOA 1TG0A 1P6RA 1X75C 2LCLA 3NARA 1UFFA 3ZQ7A 5LRSA 4UXNA 1U9OA 4GO1A 3CC7I 5HKCA 1EV7A 4B43A 3HHTB 5GTHC 5E18F 1K9MC 1PM3A 3JREA 2QSFX 5KVRA 3QUIA 3J7AW 1XTAA 4JRQA 4CYCA 3J7ZI 2F2VA 3RMSA 1X58A 5IYBJ 5HLGA 2LNBA 3G71T 1VQNT 4N0AC 3G3ZA 2PMZN 5I2SA 1SRMA 2GXGA 2ZJ2A 3CF5F 1NG6A 1AVZC 2ESHA 3ZRGA 1OLTA 4DNCA 3ZMTA 3CMMA 2CO5A 5E1XA 1HSJA 3EG9B 3O8GA 3GZNB 2VXDA 1QQIA 2MLKA 3LSHA 3QODA 3TMOA 2ZPHB 3JCMb 1M1KU 3VYUB 4YG2F 4IIMA 3CC7A 3PVQA 1OPLA 3IV5A 4MQVA 1WJDA 2P4WA 1D5YA 2KJCA 3JB9G 1ARKA 4I09A 3SYTA 1WYXA 3EHRA 4ZYEA 2XF7A 1ZHFA 2KDOA 2KT0A 1X43A 1BN5A 2XKPA 3E6DA 3FIFA 4M7AC 2AZSA 3UWNA 2RM4A 3LAPA 1OOTA 3QYGB 1GT0C 2DT5A 2W7NA 2CYYA 3BR2A 1VQ8I 1S8NA 4OB3B 1PCXA 5E1WA 4C3HJ 1JKRC 3ZQCA 3BT9A 5FROA 5GAOn 4AM3A 3HSRA 3KP7A 2DA4A 3I35A 3C1DA 2VBXA 4JOMA 2K4YA 1ON2A 1Z77A 3JB9I 2KRHA 1W2BA 2JTVA 3HJEA 2Z9OA 1VQKT 5FWCA 2JZ2A 1LQ1A 2HAXA 4FW2A 4U0VA 1N27A 4KH0B 2QXFA 5AIQA 3EETA 2OQRA 1BK2A 2ZO4A 5D6FA 5CQYA 2Y0SN 3E2UA 3QWYA 3QXEB 3F8MA 4XTVA 1JHFA 2YUPA 1SD5A 2KIFA 4UUSB 1VQ6Q 3KEQA 2EGEA 1F5TA 3HIFA 5A2QE 1RESA 3U21A 3CD6Q 4CCJA 2M35A 2ZCWA 1VQMA 4RGXA 3E5XA 2BY0A 2DDBA 5TISC 1AHJB 3AG2H 1RUNA 5EEGA 4DBRA 3E7LA 1KQSP 3CUQB 1KQSS 2BZ8A 2KISA 4M3BA 4MNUA 3VYSB 5HLHA 1KYZA 3BDDA 1CKBA 4LIUA 2RN7A 2R7SA 1R23A 1U3OA 3H6ZA 1UUEA 1G8XA 4HBLA 4G7HF 1QKXA 4HX8A 3FKJA 4BQQA 1HC8A 3CMEQ 2F4IA 1JTYA 1MJ9A 1FPQA 4M78A 4PL6A 5CO7A 3GCMA 4UHTA 4F55A 4ZYGA 2KRNA 3TVTA 1Y39A 5FLXK 3HL8A 4HVUA 5ERIA 1B9NA 4WF2A 3U9GA 1YJNI 4LK0F 2UWMA 1ZSZB 2EYYA 2MAMA 2ZAEA 4QVCA 4HCBA 3S3MA 2K57A 1R58A 4HSTA 2EINH 3JRIA 2RDPA 1H8AC 1VQ5I 1ZRCA 5F0CA 2JM8A 2BXYA 2X1EA 5BPIA 2L3RA 3Q5FA 2K2MA 1RNLA 3FMSA 2CRGA 3F21A 3EG3A 3P8DA 2NXNB 1DPRA 4EJWA 2JJ7A 4ENNA 4EMKC 5LD2C 3ZMSA 1GV2A 3CJTB 4LNPA 4JK1X 2HS5A 5E20A 4ZZDA 4IJAA 3HC7A 2P7VB 1ZQ3P 1ZH5A 4KRTA 4F7UA 1Q82U 1T0JA 1K8AU 3OIPA 3OIOA 2MH2A 4XTXA 1IDYA 2WY7Q 1XGMA 2DA3A 1MSFC 1TNSA 2HU9A 4DBQA 4FCYA 5AONA 3OW2S 1FC3A 4Y3OA 2CP0A 4L9JA 1FTZA 3TEDA 1SSFA 1YJNA 4QQGA 2FBHA 4PJOA 1Y57A 2IVMA 5IOZA 2NS7A 5DDGA 5FFZA 2VIXA 2JS2A 3E19A 1N8RU 2JPBA 2L5QA 2BW3B 1VQ9I 2HSEB 2KVQG 3BY6A 1XQHA 3K4NA 4UUTA 4M77F 3CC4A 3RBBB 3F72A 1NM7A 2FL7A 3V7SA 5DM7F 4BB7A 4LN2A 3G71A 1KQ2A 3LL7A 3QP5A 2W0ZA 1U5TC 1SSHA 4I01A 3QAHA 2ZCFB 1S72T 1FY7A 1LVKA 2QM3A 4LK1F 4XMYA 2EFOA 1MBHA 5CKTA 4EEFG 2R5ZB 1N77A 1VQ7I 2O8KA 1ABQA 3CCVI 3WU0A 1FYKA 2VASA 5F0FA 4CH7A 1A36A 5LJ3j 3GEZA 1BOBA 3W2WA 3LH0A 4XN0A 1YOVB 3LAJA 1YHQI 2KL4A 2X4YA 2IPOB 3Q9VA 1A04A 3UNGC 3JRZA 1VQLQ 3D5LA 4C0DC 2DVJA 4XLHA 4FYWB 2DYBA 2EVRA 1W0UA 3TBIA 2GA1A 2QENA 4PCQA 5GAMe 5GAN4 2ZPBB 1JJ2S 5J39A 5GAMh 1FMWA 2A61A 1MBKA 1C0MA 3K2ZA 3HG9A 2XPWA 4EMSA 5GPCA 4J7FA 4J8OA 2TDXA 3BJOA 3ZQLA 3R0AA 4MTEA 5DY9A 1Z7LA 2XC7A 1EZZB 2B86A 2WC2A 3RKXA 3HOSA 3MN2A 1YIJI 2HQXA 1LVAA 2KZVA 2MGQA 3L7WA 1OJLA 5J47A 2DM1A 4MDWA 2UV1A 3HOTA 4M7DG 1UCRA 1YJWI 5TRDA 5HLIA 2BKDN 1K73R 5L3BA 5M5WJ 1TNTA 4X1VA 5L23A 3M55A 3HPWA 2DJZA 2RHZA 4BH9A 3S3OA 1KQ8A 2F48A 1ZTRA 3AT1B 3K0LA 3T8RA 2I5UA 1E7OA 4M7DE 5BPDA 4M3EA 5EYRA 5GAGJ 3IH2A 4M78B 3RMQA 2STWA 1PD1A 1QVGA 1FMKA 1RAFB 1XMKA 2FPDA 1E3OC 3QZ9B 3QRFF 2MPXC 2DTZA 4RTXA 1RL2A 1P4WA 1KQ9A 1QVFP 3X25B 4A3KJ 2L9VA 2FA5A 4CC3A 2MA3A 1VQ5T 2Y30A 2MIOA 1SVMA 2CP3A 1MDMB 4PKCC 3CUQA 1IXRC 1WJEA 4FX0A 5A2QK 2K3FA 4U7BA 3WGGA 4A5MA 3MP1A 5KYYB 3LA3A 4A3GJ 3DB4A 4X9DA 4M77D 1AWJA 4BE2A 4J9BA 1IREB 3ZCOA 4JS5A 4S0HB 1EH7A 2L0AA 1QWFA 1VQNA 1R4MB 1FEXA 2YUNA 3EAEA 1GFDA 5CPRB 4G7OF 3JCMd 4M73A 5DUKA 1G4DA 3CEYA 1NJIC 1MZBA 5FFXA 4QIWN 2KDSA 3GNFB 3HTSB 3E3VA 4M3GA 2HTJA 2DD5A 3E9FA 1WJCA 1PYVA 1Q1HA 1SAXA 3QZ5B 5IHKA 3F70A 2GIVA 2HOAA 4OAYA 1XD7A 2ZJPF 2F5KA 3RYPA 4Q5WA 1LKXA 2MMPA 5L8RE 4OIOF 2P0PA 4KGZB 4KT6A 4C5EA 3CO7C 4II3A 2W1OA 4F04B 2LYCA 2EJGA 2PBIA 4Y13A 1R8OB 3I55T 4IKFA 4Z6YA 5M5XJ 4IOCF 3M0PA 2BGCA 3MKYB 2RI2A 3GYHX 1Y8QB 2LK2A 2D0NA 1DDNA 3M59A 1DGRM 4D5FA 1Z9CA 1X1BA 2FNPA 4RTYA 4AIKA 4BNCA 1E0EA 4LJZF 1WJFA 2IA2A 4M77B 3VOEA 3HOZJ 3LQQA 1ZR4A 1B72B 4HRIA 1X6GA 5LJ3f 4JZ3A 2XAGA 4HNVA 3J80K 3V7CA 2EGCA 2ELJA 1KG1A 1UGSB 5IT9K 3VU3C 1T3SA 4GY5A 3PSFA 5EZHA 5HOOA 2LY2A 4FISA 5IP6A 1IN8A 3LFKA 1T56A 2EFQA 4HQEA 1JKOC 3HHHA 5HDNA 2XHCA 3EG9A 1WJAA 2CW7A 1JKPC 2AS5F 3WG9A 1UJ0A 4PJJA 3W6JB 1I1GA 3N97A 4FT8A 4M78C 4KICA 2EJFA 4CXFA 5GAN6 3HOUJ 2ZPFB 4OMOA 1P4AA 2L3DA 2BEOA 4OIRF 5KHDA 1YTYA 4NC6A 3M0TA 4BY6B 1WI3A 4BYYA 1ZRDA 1GXPA 1WSUA 2GQQA 1S72I 1G3WA 3IH4A 1IB8A 1H641 3Q3SA 2E3HA 3BTIA 2QGGA 4EMGA 4WTOB 5A0GA 2DYIA 2LY9A 2F2EA 5TGTA 4CCNA 4KYWA 5DS9A 3TP0A 4M9XA 3BTCA 3KYCB 2M02A 4V2FA 1SF9A 4OMFB 3C2BA 4NBQA 1RAIB 3CC7Q 4B3AA 4N9IA 3FMRA 2QA4I 3IHUA 1K78B 4M77E 1BB9A 3CESA 3VYHB 2A69F 4WXCA 2C06A 2R5AA 4A4HA 3F8FA 2KIQA 5IXFA 2QASA 2EIMH 2WAQN 2LFBA 1BJZA 4IPAA 2OZUA 3CDHA 4XRFA 5E3OA 4I99C 2PU9B 1ZBJA 1D8KA 1GVDA 3JAMZ 1QKWA 1FYLA 4HSRA 1B34B 4XL9A 1VQPI 2X6XA 1UHCA 2FD5A 3SEZA 2XKOA 4HCZA 3W2VA 4EJUA 2CUDA 4AFQC 4ELYC 2KKOA 4M7AD 3MFKA 5GAOr 2Y9YA 1QVUA 4X9CA 1W1FA 4EM1A 2KIMA 1NBEB 3AFHA 1H3HA 3KEOA 5GAMf 5E3LA 3AKZA 1WIEA 2O01E 3S93A 3GTMJ 3T5XA 2NS8A 2HZDA 5EZGA 4MTDA 1UG2A 4XLCA 4OIPF 1Q86U 1KD1C 5K5QA 2CQQA 2D8HA 4HCKA 1T2KA 3CPWP 2LJ1A 9ATCB 2BVMA 1PKSA 4FX4A 3OYIA 2VQHA 2M1BA 3MKWB 3SFIA 1ZUYA 1JUSA 2VJJA 1QHHD 4IEJA 2MK5A 2NVUB 1S9HA 4OF1A 3TEEA 2ZMEB 2CQ7A 2PJPA 4ASNA 2CH0A 4YEJA 2COBA 1K4US 2E64A 2AQFA 4EVIA 4CC4B 3GPLA 1R1UA 1HKTA 4LUDA 5C3EJ 2DOAA 1LDKB 3KUFA 2IVWA 2IA0A 4Q47A 3LSKA 1ZG3A 3JRHA 1YRNB 1SFXA 3GX4X 3GLXA 5DD8A 2P7CB 3K4KA 4UNOA 2CZ7B 4A3IJ 3EG2A 4J6XA 1VQ4T 1RABB 4BI3A 2NNNA 2M5WA 1Y8RB 5B1AH 5AT1B 4C5GA 7AT1B 2QAZA 1GL5A 2ACJA 1UTIA 3DPTA 2E41A 1YJNQ 2DX1A 1PVEA 4VUBA 4J9CA 4U7DA 3OBYA 1HLVA 1H88C 4M7DB 2A5WA 1BA5A 1VFCA 4A4GA 3FK6A 4LIVA 2E1MC 2PQ8A 4E7JA 2E6NA 3VDXA 4DEYA 3KBGA 1K0XA 1VUBA 3SEMA 1ZX6A 5ICFA 4Z8AA 1VQ9T 3ZMVA 2RA2A 2QCOA 5IP9J 3RPUD 1RI0A 1VQ8A 3A8HB 2IEKA 1LJ9A 2JNGA 3WODF 2O4XA 2J5PA 5A0DA 4KMUX 2E10A 2VJ4A 4IRHA 1YNZA 2XK0A 5IT3A 4MEYF 2DN0A 2RNJA 5GAN2 4LB6B 4RGRA 2DTIA 4HVVA 2XDPA 3CMYA
chains in the Genus database with same CATH topology
4I7HA 3J81E 3SB2A 2IJLA 3HSBA 4HYEA 3SZTA 2RD1A 2FBKA 2KJBA 4M9SA 1YO5C 1BC8C 1I6XA 5CQXA 1TQIA 5ED4A 1Y07A 1I1SA 1WNLA 2PUOB 1YITA 2D45A 4MHGA 6PAXA 1W4MA 3EFSA 2PFBA 3ZEHA 1LEAA 4HA8A 2GF7A 5KCHA 2FOKA 1M4ZA 2OTJA 2DK8A 1OI1A 3WTWC 4ME7A 3WTXC 4LD5A 1DJ7B 1PDNC 3NFCA 3V4GA 4N4GA