2HYFA

The structure of apo-mntr from bacillus subtilis, selenomethionine derivative
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 42
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hyfA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hyfA02
3BP8A 2FRHA 3ECHA 4AIHA 3EQLF 2HKOA 3HRSA 2EFOA 1HBXG 2J5OA 2FMYA 2AS5F 1FOKA 1P6RA 4I0AA 3DQVC 3QP6A 1ZG3A 1YFHA 3TDZC 3ZMDA 4B09A 2A61A 3HSRA 4YFXF 3K1PA 2A68F 4UVBA 1T0FA 3JAMZ 3Q9VA 3ZPLA 4NQWA 1T38A 3MAJA 4GYGA 4N0BA 1TW2A 5DCFA 1GXPA 3DKWA 4K2EA 4QLCU 2K4JA 1FBQA 3KLOA 1QQIA 3MWMA 3IL2A 1IN7A 5K1YA 1Z1DA 2CQKA 4HLXA 5LHIA 1B1BA 3I64A 3JSOA 3E5UA 4ESJA 4MQ9F 4ENKA 3B02A 3PQKA 3RYPA 3FX3A 3MZYA 5L3BA 1ON2A 4KNYA 3ABUA 5EEGA 2LSOA 1IN6A 5CVJA 4O5VA 2PJPA 3RKYA 3P9CA 5ILSA 2DLLA 1W4MA 1Z9CA 3MFKA 5HS9A 1J59A 5H20A 1OMIA 4G94A 5L3DA 2K27A 3HHGA 3SHFA 1F1ZA 4M71A 4I02A 3QP5A 4CGZA 2E1CA 1Z6TA 2M1BA 3E3VA 1SD4A 4A0ZA 1YW8A 2ESHA 4PCQA 3GFIA 4D0PA 3E6BA 3WGIA 1WWXA 2VT2A 3DPTA 1R5HA 4GGGA 3LA3A 1XDUA 4WF2A 1YO5C 2EK5A 4AIJA 4I7HA 5LHGA 3K9TA 3IKTA 4G8XA 5E8GA 1HW1A 3WTSC 5JR3A 5E8IA 1LDKB 3EYYA 4WWCA 3F6OA 3GFMA 1U5TC 3TDUC 3KETA 3O2PE 3WTYC 3KP5A 5HS7A 2HKXA 1XGMA 4IVNA 4LJZF 1V4RA 3G3ZA 4ON0A 4AVPA 2KKOA 4M6YA 1TNSA 4IRGA 1RI7A 1MJ9A 2A3SA 5IT9Z 1PP7U 2DI3A 3CUQC 1I27A 2EFNA 5IT3A 5L3EA 1QZYA 3H3ZA 4HOBA 5FLXK 2A6HF 2ZBKA 3O6BB 1KQ8A 4B8XA 3F21A 2OD5A 2Z9OA 2BEOA 2HEOA 3BOQA 2PN6A 4U0WA 3T1BA 4HV6A 2IVMA 3U9GA 2L02A 2ISZA 2IJLA 2MLKA 1TW3A 1XSVA 3IRRA 4I09A 4A0XA 4HA8A 4HQEA 2DK5A 3WG9A 1IF1A 4MTDA 2HOEA 4WXHA 2QVOA 2L4MA 3ML6A 1TBXA 2PFBA 4ENMA 5HLGA 5AIPA 3Q5FA 3V7RA 4YIFA 2CG4A 2RGVA 2P4WA 2FNAA 1HSJA 2Y75A 2HQRA 1B59A 1ZGAA 1IXCA 4G7OF 3TOAA 2FBHA 4XRFA 5CLSA 1MDMA 2NNNA 5J8FA 2YR2A 1STZA 3FMQA 3FHZA 5D8LB 1BJAA 3U2RA 3LAJA 3KP6A 1LJ9A 2DBBA 2V9VA 4U7BA 4MNUA 4G7HF 1ZGJA 2YX4A 2O6GE 1KU9A 5D6EA 3BZ6A 1HQCA 4M9SA 1TQIA 1IZ1A 5CVUA 4EVIA 1OPCA 5ERIA 4O3MA 2QWWA 1KU3A 3GUDA 5KVRA 1I1SA 2F2EA 2R7DA 3BJ6A 1SFUA 1QGPA 3F3XA 4XBFA 3F8CA 3ZMSA 2EV0A 3MEXA 3R6SA 4CO8A 4UNOA 1L0OC 4M72A 1ZRFA 3IRQA 2ZKZA 1ZYRF 5JVTA 2VT3A 2FA5A 1JHFA 1P92A 5BMZA 3BROA 4L9TA 1I1GA 3V8KA 4FX0A 3IHUA 4L0YB 4LLGF 5E1WA 2DT5A 3ZQ7A 5LGUA 4EM1A 4UHTA 4LG0A 5D4SA 1IXSB 4WX9A 2GZWA 1I5ZA 2F5CA 3GX4X 2A6EF 3I0TA 3R0AA 2RNJA 4GCVA 4OOIA 4QWQA 5DCMB 1U5TA 4KIFA 5D5VB 1HW5A 4Y15A 1HKTA 1CF7A 3V4GA 2Q0OA 3GF2A 2XAGA 2A69F 2V79A 2FEZA 4NB5A 2PQ8A 3FXUA 5CYVA 2G7UA 3MZHA 3FF5A 4UXNA 4ZYGA 2FBIA 2IA2A 4HZFA 2H6BA 1S7AA 4MEYF 4OIQF 2ETHA 2YPRA 3N97A 1IAWA 2BBYA 3QPTA 1T2KA 3K1NA 1W7PD 2QENA 2GQQA 2AXLA 3HSFA 2XVCA 1YYVA 5BPDA 1FPQA 2QQBA 2OU2A 2PI0A 4LK1F 3CDHA 3GW2A 3NRVA 4Y17A 4PGGA 1MZBA 4LGWA 2MLGA 4U88A 2W85A 4EGYA 4DNCA 2OZUA 5LEKA 2K7LA 3KEQA 4RGUA 4IPAA 3ERED 4AIKA 2L54A 3ZN1A 1V3FA 1BIBA 3O3KA 2NAZA 3KE2A 1OYWA 3M8EA 3M8FA 5BOXA 3VFZA 2RKHA 5K5OA 4M74A 1WSUA 3RDIA 3E5QA 1O3SA 3NEUA 5HDNA 4A5NA 5A2QK 1JXSA 3T5XA 1H9TA 3L2CA 3VODA 2K86A 5ICFA 4HQMA 1FYKA 4BHBA 4KMUX 5L3CA 3GO5A 1XSDA 3KZYA 3QPHA 3I5UA 3KLNA 2YU3A 2KRFA 3WE2A 5E17F 2PEXA 5J8CA 3HRTA 3IC7A 1BBYA 2VONA 1XSXA 3ZMZA 2FSWA 3RJPA 3B73A 2WWYA 4BNCA 4HF2A 3DEUA 1BI0A 1R1UA 3WODF 4KMFA 3TO7A 1RNLA 1CF7B 3WTUC 4R8HA 4RB1A 1YW9A 3R0JA 2RV8A 4L9NA 3GYHX 5D5WB 2XROA 1UB9A 3FMRA 2JT1A 2HDCA 3CLOA 2DQLA 3BPVA 2ZMEB 3GEZA 2IA0A 3ZMUA 2HTSA 2VOOA 3F8FA 2MBFA 4GO1A 1XGNA 3W6JB 1S6LA 2XAHA 2BE5F 3LQRA 3BPXA 3HOSA 1SMYF 4L5JA 1IRGA 4WXCA 4YFKF 1TQMA 3JTHA 2VXZA 5HDKA 4EGZA 1ULYA 2VC0A 4UVAA 3ROUA 3J80K 2IA1A 4HYEA 1ZAOA 1ZG1A 5LGTA 3R60A 4L5IA 2WC2A 2YX7A 5BQTA 5HLHA 4RGSA 5K5QA 2D1HA 4XLPF 1PP8F 2GXGA 4KDPA 2VE9A 3C18A 3CTAA 2EA4A 2NNYA 3P7NA 1FNNA 3F8NA 1O7LA 5FFZA 1VTNC 2UXNA 4AD9A 4BAYA 1FP1D 2MH2A 2JPBA 3I71A 1R58A 2A07F 2X0LA 3IKVA 2PLYA 5HVQC 4LLNA 5D6FA 1O3RA 2VBZA 1REPC 3RPQA 1PDNC 2Z99A 1QO0D 1Z6RA 5DYMA 4HDUA 3ZMTA 3HTSB 4HDVA 5A2QZ 1XMKA 3OV8A 4EQQA 4KUMA 3CUQB 1BC8C 5F64A 2P5LC 1B4AA 1ZLJA 2QBYA 3ZN0A 2M45A 2HYGD 1FX7A 2DO7A 4EM2A 2P5KA 4BHCA 2P7CB 4BYYA 1XGOA 2NRAC 2Z5UA 5LLQA 2ESNA 3VOEA 4KIGA 2COMA 2BYVE 1R00A 3T8TA 2Y48A 3E5XA 3F23A 3CO6C 1KA8A 4M73A 1FC3A 2XRNA 3R4KA 1FYLA 1IN8A 3KEOA 1MD0A 5DD4A 1B9NA 1ZN2A 3K0LA 5KK1A 1YLFA 1J9IA 2WV0A 2VOPA 2LNBA 1D8KA 2D1VA 1L3LA 2ISYA 2O8XA 2RDPA 4OIPF 4EM0B 2H27A 2PMUA 2XGXA 3L00A 3WTXC 1B9MA 1T6SA 1ZARA 3P9KA 2EFQA 2QZ8A 1FBUA 1UHMA 2M87A 3WU0A 4A12A 4YIIA 5D5UB 4RAZA 4S04A 2G7HA 2Q2EA 1R23A 2V6CA 3CUQA 5DCMA 5TJJA 2C6YA 4ETSA 1F9NA 1XGSA 2Z3YA 4WK8F 1BN5A 3E97A 2DQRA 2CO5A 2QLZA 5FFXA 4KN4X 1MGTA 3HOTA 4EJUA 3LFKA 1G4DA 4CXFA 3KP3A 4LG0B 2QM3A 2ACJA 4HBLA 4LB5A 1ZG5A 3DPLC 3BJOA 1LVAA 2NS0A 4RAYA 1BI1A 3SXYA 2BGCA 1HKQA 3DXJF 4S05A 4YG2F 2QUFA 4L0ZB 3RI4A 2HWVA 3LSTA 5BS6A 2EWNA 2P5VA 1BI2A 3WTZA 5FLXZ 1R1VA 2VBYA 3REOA 4A6DA 5FO5A 2JPCA 1R7JA 3H3UA 2MH9A 2XAJA 2L01A 1XCBA 4G6QA 4XSZF 2GA1A 1BM9A 1EH8A 5J6XA 3PFIA 1G3YA 1P4WA 1KYWA 4IF4A 2W57A 2XHKA 4KYWA 2EFPA 4G6DA 3KZZA 4OU0A 2JRTA 4ZYDA 4U7DA 1T98A 1UFMA 3HTUA 2MA3A 1O3TA 1ZLKA 2EA2A 4R1HA 3TO9A 4JBAA 4RB0A 3BWGA 4RB3C 2YSRA 2A5YB 2CW0F 2M30A 2E7WA 2PG4A 2CFXA 3FXQA 2IW5A 4UVCA 4I2OA 1LNWA 1TLHB 5BPIA 4IRHA 1AOYA 2XASA 2FU4A 1SFXA 2DPUA 3RPUA 3LA2A 5L3GA 3RKXA 1S7OA 4HX8A 1XB4A 1JGSA 5HOOA 4ASNA 1DDNA 5CVVA 4LLLA 3HIFA 4P9UA 1F5TA 3RKWA 3FXRA 1FSHA 2O3FA 4HAMA 2XKPA 3JSPA 4ZYHA 1I6XA 2VODA 1MDMB 1AWCA 1J0RA 4CHUA 3DV8A 1LEAA 1LDJA 2DTRA 4RGRA 1P2FA 4MHGA 1WQ2A 4Z2YA 4WCGA 1MJBA 3F8MA 4IHTA 3L09A 2IP2A 2P7VB 3D0SA 1S29A 3GVAA 1IRFA 1YIOA 2OQGA 3ZMVA 1J75A 3TOBA 1X3UA 2JTVA 4L9JA 2ADUA 3EETA 1R22A 5CVIA 4L18B 3I53A 4P96A 5FD5A 1ON1A 3GLXA 1DP7P 2TDXA 4CZZA 2W25A 5TRDA 3ELKA 4UV9A 4Q47A 2R3SA 2M5WA 4MQVA 3IWFA 4HF1A 2FNPA 3JTGA 1K78B 1KU2A 2STWA 5LBQA 1FY7A 4I01A 2WTEA 1KU7A 5FB2A 2HS5A 4KT5C 1SAXA 2XIGA 3N4MA 2EV6A 2KIUA 3T8RA 1YW7A 1A04A 3GFJA 5ICGA 4LB6B 1DUXC 3ECOA 2GXBA 2VBXA 3I59A 5AIQA 3MQ0A 2XAQA 3BY6A 4O6JA 5H6QA 3J81Z 4EJTA 4UUVA 1YS6A 5LRSA 4M9ZA 1UHWA 3LQQA 2QBYB 4P55A 1FYMA 1EV7A 2RQPA 3AAFA 4EV0A 1TQPA 1ZREA 2W84A 3E6CC 5HDGA 3C3WA 1RZ4A 1LDDA 3NQOA 1KQ0A 1T39A 1RUOA 2LF7A 3C1DA 4ENJA 1U3EM 2V1DA 5DUIA 5LGNA 1E2XA 2IRFG 1HSTA 2QQ9A 3M9AA 1FZPB 2JSCA 2R7FA 3F6VA 4Q5SF 3V8LA 1G3SA 4TV7A 3V7SA 3H92A 5DV5A 2ZFWA 1D5VA 4KN7X 4RS8A 3R61A 3WTWC 2O0YA 1FLIA 4EJOA 1Q1HA 2DU9A 2P6TA 4XLNF 1Z91A 2K02A 3QU6A 1OYIA 1P4AA 1SD5A 1H9GA 3E6MA 4OIOF 3TKYA 4A2UA 1D3YA 4HV5A 2OBPA 4H0EA 2HR3A 4EJVA 4LD5A 5HLIA 2O61A 4OMZA 2GA2A 3BJAA 4OMYA 2LF8A 1DPRA 1W7PB 1USTA 1Z7UA 4KICA 3FM5A 1Z05A 2P6SA 1K78A 1R5GA 4HF0A 1OR7A 1OKRA 3DFGA 1GXQA 2M8EA 2DK8A 2GIVA 3EYIA 3WGGA 1W7PA 1FP2A 3SZTA 1W5TA 3WU1B 1XDSA 3HSEA 2FE3A 3W6KB 1TTYA 1YTYA 1IUYA 4ZZLA 2NYXA 1XN7A 2VN2A 5HS8A 4Y13A 2FMLA 1B6AA 1FT9A 2ZO4A 2F5DA 1YS7A 3I58A 4F7ZA 1SD7A 5DDGA 4BH9A 2L4AA 3FMSA 4JK1X 2VE8A 4PZJA 5LHHA 3BDDA 2FOKA 2HZTA 4HX4A 2BV6A 4FX4A 1QBJA 3ZP5A 2GAUA 3F72A 3J7AO 4UV8A 1ZHFA 1XD7A 3GZ6A 3LA7A 5D5XB 2DW4A 3L9FA 2QYOA 2V1UA 5ICCA 3K2ZA 2LKPA 1G3WA 1SMTA 2FF4A 4Q4ZF 4OIRF 4M6XA 4A6EA 2XKOA 4ZZDA 3WGHA 5CVRA 1U5TB 4BQAA 3KP7A 4JQFA 1LB2A 2ZCWA 1R1TA 2J5PA 2IPQX 1YQAA 4N9IA 5DEQA 2MC3A 3I59B 4BHPA 2HYFA 1O7FA 5DD8A 2HQNA 1W5SA 4CDGA 3HHHA 1XCVA 1WRJA 1J5YA 2E7XA 2XV4S 4M9XA 4Q48A 2CSOA 2ZNZA 2Y0MA 3GXOA 3JAMK 1J7KA 3TGNA 3I54A 4RGXA 1C0WA 5H6RA 3WE3A 1BIAA 1UCRA 2DAOA 3D5LA 3OOPA 1G6NA 1K6OA 3QOPA 3LWFA 2KIFA 1FSEA 3GFLA 2LDUA 5JFRA 5E18F 2K4BA 5AONA 5ICEA 2CYYA 1USSA 5LEJA 3KCCA 5L3FA 1IN4A 3M1EA 1RIOH 2ZNYA 2E1NA 1MKMA 5ILVA 3QRFF 3EUHA 4ZH4F 1KGSA 5E1XA 6PAXA 3HRUA 2EJRA 2X4HA 1Y0UA 1O3QA 2D2WA 1MJAA 1S8NA 4ENNA 1E17A 3FM3A 4KA4A 5F6FA 3L7WA 4G9YA 2P8TA 2ZMEA 4N9HA 1WI9A 3ULQB 4RB2C 1QNTA 2FXAA 1GVJA 2HTJA 2KJBA 1LQ1A 1BOAA 4FT8A 5CJ9A 2H09A 2OQRA 2VC1A 1CGPA 4EMSA 2DPDA 5JHUA 3C7JA 2F5EA 2UZKA 2EV5A 1S3JA 3HUGA 3I4PA 1ZH5A 4KIBA 2OAZA 4XSXF 3FZVA 4CICA 2HFHA 2Q8KA 1ZRCA 4IJAA 4P5OA 1KYZA 3HYIA 2ZXJA 2GWRA 1WKMA 2H6CA 4HW0A 3GWZA 1BI3A 3RTRA 3K69A 2MD5A 5IT9K 3MCZA 3Q9SA 2XUBA 4GYIA 4LMYA 3J81K 4HLYA 4CYDA 1FWZA 2ZJ2A 4EJWA 2OZ6A 4OINF 5JI6A 1ZRDA 4R79A 1R36A 4L9VA 3E6DA 1LEBA 3ABTA 4KFCA 1TNTA 3COAC 1JE8A 2D45A 3QAHA 5D8KB 2RN7A 2HGCA 4E70A 1U78A 1HXDA 1J2XA 3J80Z 4IRIA 4IXAA 2CWEA 3CJNA 1O57A 3WTTC 3F8BA 3U1DA 3RYRA 3G73A 3P9IA 1K79A 1H0MA 1SFEA 4MTEA 4PDKA 3IWZA 3M7GA 3WTVC 5E1ZB 4AWXB 5DUKA 2KJCA 1ONVA 2PBIA 1QPMA 1JHHA 2FQ3A 4A5MA 3SFZA 5FD6A 4IHSA 4I98B 3JW4A 1DPUA 5LRRA 1ODDA 1GHCA 2F5FA 4U0VA 4G7ZF 4MGRA 3S2WA 2STTA 3KP2A 1IN5A 4MEXF 3K1MA 1QZZA 1FBSA 3SQNA 1XMAA 1F4KA 4LFUA 5FGMA 3QU3A 3GZ5A 1K7AA 2UXXA 2B0LA 4PGHA 2VBWA 1D8JA 4GXOA 2O03A 2H94A 3EDPA 3V7CA 4NHJA 2XAFA 1U8RA 2IT0A 1U6GA 5F1RA 1G3TA 2Z33A 2QQAA 3PQJA 2DFIA 2V1XA 1SD6A 4WXDA 4ESBA 5EEHA 2G9WA 4YFNF 4ZYEA 4FHTA 3T0YA 1HKSA 2CGPA 2L3DA 2EB7A 3RIRA 3SZPA 4DQ2A 2EFWA 1P4XA 5ED4A 1NHAA 3CUOA 4BXUA 3F22A 4ESFA 1RUNA 5K5RA 2RVCA 4P9FA 4I0BA 3HRMA 4HX7A 5ILUA 1EH7A 2OA4A 1EH6A 3DF8A 1YG2A 1BC7C 1HW2A 3FWEA 4LK0F 3CO7C 2JZYA 3DP7A 1PUEE 3VB2A 2PMHA 3V8JA 3TQNA 4U0YA 3VEPA 1IXRC 5D4RA 1OYYA 4A0YA 2KIMA 3ISPA 3LAPA 2RC4A 3KP4A 1KQ9A 2FBKA 3TO6A 2ELHA 2UWMA 5E20A 1IW7F 2W24A 1U2WA 3KFWX
chains in the Genus database with same CATH superfamily
1Y1WJ 3BP8A 2Y2ZA 2FRHA 3MKZA 1BL0A 5EG0A 3ECHA 4A3GJ 4RAFA 2P0TA 3L2QA 4AIHA 3EQLF 2HKOA 2K9MA 3S3NA 3A1YA 1JT6A 3HRSA 2EFOA 1HBXG 2J5OA 3AG2H 2FMYA 2R7WA 2AS5F 3VYRB 3W2VA 1FMVA 2X98A 1FOKA 4XORA 1P6RA 4I0AA 3DQVC 3QP6A 3K10A 1ZG3A 1GV2A 1S9HA 2AQFA 1YFHA 2HNHA 4X1EA 3ZQHA 5DS9A 3TDZC 1E3HA 3ZMDA 4B09A 2A61A 3B6CA 3HSRA 4YFXF 2DMPA 3HPHA 3K1PA 3OYDA 4DIQA 1V5GA 1OLTA 1WJCA 2A68F 3GTOJ 1G2HA 4UVBA 1T0FA 5FKLA 3JAMZ 3Q9VA 5F08A 4BJTA 3ZPLA 4NQWA 1T38A 3MAJA 3C2GA 4GYGA 4N0BA 3OYCA 4J01A 3RZDJ 2NVQJ 2EQRA 2MFZA 3Q0WA 2AO9A 1TW2A 5DCFA 1GXPA 1D0YA 3DKWA 3OYBA 2ICWG 3W6VA 1Z77A 4K2EA 4PJLA 4QLCU 1IV8A 2K4JA 1FBQA 2WV1A 1R4NB 1Z0XA 2CS3A 3KLOA 1QQIA 3MWMA 2OTJI 4BQNA 3IL2A 1IN7A 5K1YA 2LD5A 3G71I 1Z1DA 2CQKA 4HLXA 5LHIA 1S7EA 1B1BA 3I64A 3JSOA 4Y33A 2QKMB 3CCLI 3DBLB 3PFYA 3E5UA 2L7KA 3O8GA 4ESJA 4MQ9F 4ENKA 3B02A 2WAQN 3PQKA 3RYPA 1W36C 3FX3A 3MZYA 4RM3A 3W3CA 5L3BA 1ON2A 4KNYA 2V9KA 3ABUA 5EEGA 2LSOA 1IN6A 5CVJA 1ERDA 4O5VA 1K4TA 2PJPA 1POGA 2MSYA 4B48A 3RKYA 3P9CA 1BR2A 3DEEA 5ILSA 4X6AJ 2DLLA 5B5EC 5JHFA 1W4MA 1Z9CA 5GTIC 3MFKA 1S72I 5HS9A 9ANTA 1J59A 1MW7A 3M3YJ 5H20A 5F1JA 1OMIA 4G94A 3HOWJ 1YOVB 1WJBA 5L3DA 2HXOA 2K27A 3HHGA 3SHFA 5K7FA 4XLEA 2WADA 1F1ZA 4M71A 4U87A 2VASA 3FBIB 4I02A 3QP5A 4CGZA 2K3PA 2E1CA 1Z6TA 2M1BA 2XGDA 3E3VA 3RCOA 4A3KJ 1SD4A 4A0ZA 3JRIA 1YW8A 1QZEA 2ESHA 3BZCA 5B1BH 3MKYB 4PCQA 3GFIA 2BXYA 4D0PA 3CMAI 3E6BA 3WGIA 1WWXA 2VT2A 3BC8A 3DPTA 2IGOA 1R5HA 3K4KA 4GGGA 4RDUA 3LA3A 1XDUA 1YX3A 3LSJA 4WF2A 2EK5A 1YO5C 2BY1A 3KYLA 4ZDPA 4CA0A 4BGDA 4XKVA 4I7HA 4XNFA 4AIJA 4KISA 4F93B 5LHGA 3K9TA 1W1WE 1EF4A 4G6TB 3IKTA 1DGRM 4G8XA 5E8GA 1HW1A 3WTSC 3KIOA 5JR3A 5E8IA 5IP7J 1FTZA 1HOMA 1LDKB 3OYEA 3EYYA 4WWCA 3HBLA 2DODA 2ZMEC 5EGOA 2HOSA 3F6OA 3GFMA 3GBGA 1RKTA 1U5TC 3TDUC 3KETA 3O2PE 3VYUB 3H35A 3ZQCA 3WTYC 1LFPA 3KP5A 5HS7A 2HKXA 4NC6A 1XGMA 1LE8B 4IVNA 4LJZF 3WU2C 3S3OA 1V4RA 5C4XJ 3LMMA 2IGNA 3PNYA 3CCUI 3G3ZA 4ON0A 4AVPA 2KKOA 4M6YA 1ZR2A 4MO7A 4E7SA 2LOOA 1TNSA 1X3ZB 2H1LA 4IRGA 1RI7A 3BR5A 2QA4I 3BR2A 1MJ9A 2A3SA 2CUJA 4A3FJ 3D5RC 5IT9Z 2UV1A 1PP7U 2PJRB 3ZQGA 2DI3A 3CUQC 1I27A 2TCTA 4XM3A 2EFNA 5FLXR 1NK3P 4IKFA 3DBHB 5IT3A 5L3EA 1B72B 1QZYA 3H3ZA 2K9SA 3BG6A 4HOBA 3KX2A 1E3OC 3MKLA 1AKHB 4AYBN 5FLXK 2A6HF 2DT7B 2LY9A 2ZBKA 2JA6J 3O6BB 1KQ8A 4B8XA 3F21A 2OD5A 2Z9OA 2BEOA 2E71A 1X4OA 2HEOA 2VKDA 4OAZA 3BOQA 2PN6A 2JSPA 4U0WA 1JUPA 2E19A 5FRNA 2FOWA 4PSXA 1TP4A 3T1BA 3J7AW 1WJ5A 4HV6A 2IVMA 1JKPC 1VNDA 3U9GA 2L02A 4Y3OA 2ISZA 2JN6A 2IJLA 2CH0A 2MLKA 1XG1A 1TW3A 1XSVA 3IRRA 4UY8I 4JX4A 3VPRA 4I09A 4A0XA 2NOGA 4HA8A 1XX5A 3I56I 4HQEA 2NVYJ 2DK5A 3WG9A 1IF1A 2H8WA 2IS4A 1HF0A 2DA4A 4XICA 1VI0A 2DOAA 4MTDA 1JKQC 2WBMA 2HOEA 2TRTA 4WXHA 2QVOA 2L4MA 3DTIA 4A3IJ 3ML6A 2KL4A 3A52A 1D1BA 1TBXA 4XL9A 4DZPA 1VQKI 5GTHC 2XGCA 2PFBA 1BJZA 1OCPA 3BR0A 5HLGA 4ENMA 2IS6A 1K6YA 5AIPA 3Q5FA 4XMYA 3V7RA 4YIFA 1GLNA 2KQRA 2CG4A 2RGVA 4Z6YA 1VQ9I 2DN0A 2P4WA 2GM4A 3ZR8X 1IDZA 3PSFA 3LNQA 4BXXJ 5FLMJ 2FNAA 2PMZA 1BR4A 4BS9A 5M5WJ 1HSJA 2A6TA 2Y75A 2HQRA 4M3BA 1B59A 1ZGAA 1IXCA 2E60A 1SFOJ 4G7OF 1GDTA 3TOAA 2FBHA 2VQHA 2XF7A 4XRFA 5CLSA 1RR8C 1MDMA 2DFEA 2V1NA 2CU7A 2KT0A 2I10A 2NNNA 3TW7A 5J8FA 3PJRA 4LOCA 2YR2A 3PNTA 1STZA 2V9PA 3FMQA 3FHZA 2XB5A 1LPQA 3BT9A 2N8GA 3OR1C 4M3DA 5C3EJ 5D8LB 1BJAA 3OWTA 3U2RA 3LAJA 2EH3A 2XF6A 3KP6A 1LJ9A 3F0CA 4FISA 1U8BA 2DBBA 4HNUA 2ZJRF 1H88C 5H2FC 2V9VA 2LYCA 1ZTRA 4U7BA 4MNUA 5KAIC 4G7HF 2M7AA 1ZGJA 3ZQFA 4IL6C 4E7JA 2NXNB 2XPWA 2MVTA 2YX4A 3BR6A 2DA2A 1UG0A 3LL7A 2O6GE 1WCMJ 2DCEA 1KU9A 5D6EA 2ZSIB 3BZ6A 2JK3A 1I3AA 2DYSH 2L9VA 1HQCA 4KITB 4M9SA 1TQIA 1IZ1A 4PJ0C 5CVUA 4EVIA 1OPCA 5ERIA 1NG7A 1GVDA 1U9NA 4LG3A 5M5XJ 4O3MA 1MSFC 1UAAA 1ETKA 3IP4B 2Z16A 2QWWA 4BY7J 1KU3A 3GUDA 2Y9ZA 4BUPA 1VQ4I 2R7UA 5GAGJ 5KVRA 1I1SA 2F2EA 2R7DA 3S16J 3BJ6A 3JREA 3A0HC 1SFUA 1QGPA 3F3XA 3GTPJ 2AXTC 4XBFA 3DKYA 2NS7A 3BQYA 3F8CA 3ZMSA 3A01B 4M3EA 4ANJA 2EV0A 3MEXA 3R6SA 4CO8A 4XQFA 4XKBA 4PJJA 4V2FA 3JCUC 4UNOA 1L0OC 4M72A 3JRCA 4BDYA 5F0HA 1ZRFA 3FIWA 3IRQA 2ZKZA 1ZYRF 2L2OA 3KYCB 5JVTA 2VT3A 1ZQ3P 4CUGA 1JT0A 4CZCA 2FA5A 1JHFA 1P92A 2ELKA 3BROA 2HOAA 4L9TA 5BMZA 1I1GA 4I99C 3V8KA 1FOXA 4FX0A 5J47A 3IHUA 1MBKA 4L0YB 1P7IA 1R71A 4LLGF 5E1WA 2DT5A 3ZQ7A 5LGUA 4EM1A 4UHTA 2NVXJ 3H1CA 4LG0A 5D4SA 1IXSB 5KHDA 1R49A 4WX9A 2DYRH 3CCEI 3OYIA 2GZWA 1I5ZA 2F5CA 4B1RA 3GX4X 2A6EF 3I0TA 3R0AA 2RNJA 4GCVA 4OOIA 1E3PA 3S8PA 4QWQA 1SEUA 5DCMB 4CCNA 2CFOA 1U5TA 2CW7A 4KIFA 5D5VB 2R7RA 1HW5A 4Y15A 4I6ZA 1HKTA 1CF7A 3V4GA 2Q0OA 3PM1A 3GF2A 2XAGA 2A69F 1TWGJ 1IGNA 2E34A 2V79A 2DXIA 3S2DJ 2FEZA 4NB5A 2PQ8A 3FXUA 1X1CA 5CYVA 2G7UA 4PFOA 2K9LA 3MZHA 3FF5A 4UXNA 1WPKA 4ZYGA 2FBIA 2W48A 3D5SC 2IA2A 2B7EA 3UNGC 3H0GJ 3RPUD 2H1KA 4HZFA 4YEJA 2H6BA 1S7AA 4MEYF 4OIQF 2ETHA 3A4CA 2YPRA 3N97A 1SVOA 2HDDA 1IAWA 2BBYA 1P7JA 3QPTA 1D0ZA 1T2KA 4XKWA 1P9QC 2P0WA 3K1NA 3K4LA 4Y4RA 1W7PD 1X4PA 2QENA 2GQQA 2AXLA 1FIPA 3HSFA 2XVCA 3EUHC 1X1PA 1YYVA 1G59A 2JMWA 3K2AA 4B47A 5BPDA 1FPQA 2M34A 2QQBA 2OU2A 4PUSA 4NBQA 2PI0A 2CJJA 3ZQIA 1DP3A 4DGWB 4LK1F 3CDHA 3CDIA 3GW2A 3NRVA 4Y17A 4PGGA 4A3DJ 1MZBA 4LGWA 2UUZA 2MLGA 4U88A 2W85A 4AYBA 3VWBA 1ETOA 4EGYA 2F4IA 1Y56A 2VKEA 4DNCA 2OZUA 5LEKA 2K7LA 3KEQA 3X2QH 4XLFA 4RGUA 4IPAA 3ERED 4AIKA 1MIJA 3ZXSA 2L54A 5JLWA 3C2BA 2KHMA 3ZN1A 2Y0SA 2XC7A 1IRZA 1V3FA 5GADJ 1BIBA 2MW8A 1SVMA 2JA2A 3HM5A 3O3KA 2NAZA 5K7HA 4QTRA 3KE2A 1OYWA 1VQ8I 3M8EA 4P1WA 3ABLH 3IUOA 3M8FA 5BOXA 3VFZA 2RKHA 2L9NA 5K5OA 2X85A 4DOZA 1E0EA 4M74A 1WSUA 3RDIA 4XIDA 3E5QA 1O3SA 4D1QA 3NEUA 5HDNA 4A5NA 2IXSA 2Y9YA 5DTDA 5A2QK 1JXSA 3T5XA 3U1KA 4DJAA 4QPQA 1WJEA 4XOPA 5EYRA 1H9TA 3L2CA 3VODA 5CQEA 2K86A 1R6RA 5ICFA 4HQMA 3JRFA 1FYKA 4BHBA 4XLHA 2OPTA 2CUEA 4KMUX 5L3CA 5M5YJ 3GO5A 1XSDA 3BTLA 2HVQA 3SYTA 3KZYA 3MD2A 2OC6A 3I5UA 3QPHA 3KLNA 2YU3A 1HC8A 3GTMJ 2KRFA 3WE2A 3S32A 5E17F 3KFWX 2PEXA 5J8CA 3OMYA 4BDZA 3VYTB 3HRTA 5FKKA 3J80R 2EIKH 4BE1A 3IC7A 2HYJA 1BBYA 2B63J 1HA8A 3OYFA 2VONA 1XSXA 3ZMZA 2FSWA 3RJPA 2ZJPF 3B73A 4BQOA 2WWYA 2QF7A 4BNCA 2OJED 4HF2A 1XPXA 4ABZA 3DEUA 1BI0A 1R1UA 2K5CA 1YRNA 3WODF 2JUCA 3MVPA 2NVUB 4KMFA 3TO7A 4V2GA 1RNLA 2VJ4A 1CF7B 3WTUC 4R8HA 3ZCOA 4RB1A 2QKLB 1JTXA 1YW9A 3R0JA 2RV8A 1UHSA 4L9NA 3GYHX 3BQZA 5D5WB 2XROA 2LY2A 1YJ9I 1UB9A 3BG3A 2BHZA 2VJIA 3FMRA 5E3LA 2JT1A 2MC4A 2HDCA 1W0TA 3A03A 3CLOA 2E1MB 5CQGA 2DQLA 2V6EA 3SEZA 3BPVA 2ZMEB 3GEZA 2IA0A 2OUMA 3ZMUA 3OYLA 2HTSA 2MD0A 2VOOA 2F4OB 3PNVA 3F8FA 2MBFA 1ETXA 2IBDA 2CQQA 4GO1A 3SFIA 1XGNA 2OF7A 3W6JB 1FMWA 1S6LA 2XAHA 5IP9J 2BE5F 3NARA 3LQRA 3BPXA 1DU6A 1VQ7I 2KP6A 3HOSA 1SMYF 4L5JA 5E79C 5J1UA 2EZHA 1QHHD 1IRGA 1N75A 4WXCA 4YFKF 1IC8A 1TQMA 5EG0B 3HXLA 3K7AJ 3JTHA 2VXZA 3M07A 4HSTA 4CCMA 1ENHA 5HDKA 1MMSA 2KZVA 4EGZA 5IYBJ 1JKOC 1ULYA 2VC0A 4KT6A 4UVAA 1YITI 3ROUA 2I8DA 3J80K 2IA1A 4HYEA 1ZAOA 1XS9A 3OIQA 1ZG1A 3AFHA 2HDWA 1I3QJ 5LGTA 2EBIA 3CC2I 3O8HA 3R60A 4L5IA 1RKWA 2L7ZA 1BW6A 2WC2A 4DYCA 3DTEA 2YX7A 1IDYA 5BQTA 4JX6A 2F6CA 5HLHA 5LFAA 4RGSA 4XRSG 5K5QA 3PO3J 4DW6A 3J7YJ 4N4NB 4GRIA 2D1HA 4XLPF 2X1EA 3A01A 4PJMA 3OYMA 1PP8F 2GXGA 4KDPA 3S2HJ 2O8KA 2VE9A 4MFEA 3WG7H 4IHYA 5HODA 3CTAA 3C18A 2EA4A 3BTJA 3LSHA 1OISA 3G4SI 2NNYA 4RLQA 3P7NA 4IOAF 1FNNA 2DFHA 3F8NA 2ID6A 1O7LA 5CPRB 5FFZA 1VTNC 3BCBA 2UXNA 2XAUA 2VLAA 4AD9A 4BAYA 5E3OA 1FP1D 2MH2A 3K6GA 2JPBA 2QCOA 3I71A 3GLLA 3PIPF 2EILH 1VQPI 2HQ5A 1UG2A 1R58A 4C2MJ 2E2JJ 2ID3A 3ZOBA 3VDXA 2ZC2A 1N77A 3SJMA 2A07F 2X0LA 3BTCA 3QYBA 1Y39A 3CCMI 5FJ8J 3CCJI 3IKVA 5F04A 3KPHA 3IV5A 2PLYA 3DEWA 4AC0A 2KIQA 1WJFA 5HVQC 2K3FA 3K70C 3LSGA 4LLNA 3CMYA 5D6FA 4F52A 1O3RA 2VBZA 3S93A 1REPC 3RPQA 1PDNC 2Z99A 1X3WB 2FX0A 2FJ1A 1QO0D 1Z6RA 5DYMA 3DTKA 2JA7J 1BOBA 2VKVA 4HDUA 3IH3A 3HOVJ 3ZMTA 3CP2A 4HDVA 3HTSB 5A2QZ 1XMKA 1W5CC 3OV8A 4EQQA 1TWFJ 4KUMA 3CUQB 3A2KA 1BC8C 1JTYA 5F64A 2PX9A 3HOZJ 1OCZH 1ORKA 1B4AA 2M9HA 2P5LC 3HZJA 1ZLJA 2H8RA 3HJEA 3HUGB 2QBYA 2E35A 4YIRX 3E0JB 3BTIA 2L0KA 3ZN0A 3CP8A 2XDVA 2BXZA 2IS1A 3LSKA 4ZTFA 2M45A 4CSWA 2HYGD 4F91B 1FX7A 4HPQA 4NC8A 2LKSA 2DO7A 2CQXA 4EM2A 3UR3C 2P5KA 4BHCA 2P7CB 4E7HA 1LKXA 4PJNA 4BYYA 3S15J 5FKOA 3S14J 1XGOA 5DM7F 3G6EI 2XRLA 2NRAC 1JGGA 2VUMJ 2V26A 4L5EA 2Z5UA 5LLQA 2ESNA 3VOEA 4KIGA 2ZXIA 3SZGA 1D5YA 2COMA 2BYVE 1OCOH 1R00A 5EEAA 3T8TA 4J19A 2Y48A 3E5XA 4XLCA 3F23A 3CO6C 1HLVA 3JR9A 1KA8A 2ZFUA 5IPAA 4ZJZA 4M73A 1FC3A 2XRNA 3R4KA 4C3HJ 3I55I 1IN8A 1FYLA 3KEOA 1MD0A 5DD4A 1B9NA 1ZN2A 3K0LA 3H36A 2K9NA 3QYFA 5KK1A 4EATA 3CJQB 1YLFA 1J9IA 3VYSB 2WV0A 2VOPA 2LNBA 3S1QJ 1D8KA 2E2IJ 3ESWB 2WAQA 4GFBA 1QA6A 3PUFA 2D5VA 4B3XA 3L2WA 3SDGA 2D1VA 1ACIA 2GLOA 1L3LA 2ISYA 2O8XA 2RDPA 5KCMA 4OIPF 4EM0B 2H27A 2PMUA 4OAYA 2A5WA 2XGXA 3L00A 3WTXC 1B9MA 1A6IA 2W82A 1T6SA 3CF2A 1ZARA 1X2MA 3ZRGA 3P9KA 3BZKA 2EFQA 2QZ8A 1FBUA 1UHMA 2M87A 1T0FC 3WU0A 4A12A 4YIIA 1X19A 2Y69H 5D5UB 2QSFX 3BG9A 4RAZA 2LBFA 3HGGA 4D9JA 4S04A 2G7HA 2Q2EA 1R23A 2V6CA 3FK7A 3CUQA 1LUJB 4AVZA 2KDOA 4XLAA 2IGKA 5DCMA 5TJJA 2C6YA 1JUMA 2AHQA 5TISC 4ETSA 1F9NA 1PYVA 1XGSA 2EZKA 1X1DA 3WHCA 3OYGA 2EIMH 2Z3YA 1R4MB 4WK8F 1BN5A 3AL0C 1PUFB 2Q1ZB 2VJJA 5EZHA 4IZZA 3E97A 2DQRA 2CO5A 2QLZA 3Q0UA 2HI3A 5FFXA 2R93J 4KN4X 1MGTA 5IY5H 3HOTA 4EJUA 2BVLA 3LFKA 1RPWA 1G4DA 4CXFA 1EJ9A 3KP3A 4LG0B 2QM3A 4ITVA 2EINH 2ACJA 4HBLA 4BJ5C 4HEA2 3S1MJ 4LB5A 1V54H 1ZG5A 4UUSA 2O7OA 1IV6A 3DPLC 3BJOA 1B8IB 1LVAA 2MZ4A 2NS0A 4RAYA 1BI1A 1FOWA 3SXYA 2Y30A 2BGCA 1HKQA 3DXJF 4C2UA 3HPGA 4S05A 2Q2EB 4YG2F 2QEXI 1GT0C 2HXIA 1W0UA 2QUFA 3AG1H 4L0ZB 1RRJA 3GTQJ 2IAIA 3RI4A 1VQNI 5GAHJ 2WY7Q 4JP0A 2VQGA 1MBFA 2KFDA 2HWVA 2I5UA 4Y7NJ 3GTGJ 3LSTA 4XOTA 2EWNA 5BS6A 1VQ6I 2P5VA 1BI2A 3WTZA 5FLXZ 1R1VA 2VBYA 3REOA 4A6DA 5FO5A 2YU9J 1S5LC 2JPCA 1R7JA 4A3JJ 4PFPA 3H3UA 3H5RA 2MH9A 1QVTA 2XAJA 5GPAA 2L01A 1XCBA 4G6QA 1MH4A 4XSZF 2GA1A 2OCCH 1BM9A 1TZLA 1EH8A 2M0CA 5J6XA 2JWTA 3PFIA 1G3YA 1P4WA 5B66C 1HDPA 1KYWA 2GOMA 4IF4A 4IQ4A 1ETWA 2W57A 2XHKA 4KYWA 4G6DA 1VF9A 3KZZA 4OU0A 5J1YA 2W1OA 3QWLA 2JRTA 3TP0A 3VSKA 4IX7A 4ZYDA 4U7DA 1T98A 1UFMA 3HTUA 2MA3A 5FROA 1O3TA 1ZLKA 4B3AA 2EA2A 4R1HA 2DJIA 4RB0A 4JBAA 3TO9A 3BWGA 3HOXJ 4RB3C 3OS0A 2YSRA 3MZ8A 3K4MA 2CMPA 2F48A 3F9KA 2EZLA 2BY0A 1N78A 2HPMA 4C3JJ 1Y0NA 2A5YB 2CW8A 4J00A 1GV5A 1WVRA 2CW0F 2M30A 2VPLA 2E7WA 2PG4A 2M35A 1IG7A 2CFXA 3FXQA 2IW5A 4UVCA 4B43A 4I2OA 1LNWA 2HZDA 1TLHB 5BPIA 4IRHA 3WHBA 4F55A 1MBEA 1AOYA 2XASA 3IAM2 2DMTA 1Z67A 3BG7A 2FU4A 1SFXA 2DPUA 3HGYA 4FE4A 3RPUA 3LA2A 4BEHA 5IOZA 5L3GA 3CCQI 2X6OA 3RKXA 1S7OA 4HX8A 1XB4A 4KJZA 2COBA 4RMNA 1JGSA 1NK2P 4IQJA 1MBJA 3ABMH 5HOOA 4ASNA 3HB9A 3JRDA 1DDNA 4NC7A 1J09A 2HVRA 5CVVA 4LLLA 2JQ7A 2VJ5A 3HIFA 3ZGKA 4P9UA 5EJCA 4CCJA 1F5TA 3RKWA 1YI2I 3FXRA 4ZDLA 1F36A 2O3FA 4HAMA 2GXAA 1FSHA 2XKPA 3JSPA 3TBIA 4A3CJ 4XK4A 2LTPA 2DDBA 4ZYHA 1I6XA 1DGWY 5F27A 2X51A 1JKRC 2MYSA 2VODA 1MDMB 4ZYAA 2ZXHA 2W7NA 1AWCA 3G2BA 1J0RA 4CHUA 2MABA 3DV8A 1FEXA 1LEAA 1LDJA 2DTRA 3CCRI 4RGRA 2R7TA 1LFBA 2BY2A 2Y31A 1P2FA 4MHGA 3RQIA 2E36A 5EF6A 1WQ2A 4Z2YA 5J1RA 4WCGA 1MJBA 3EPZA 1R9TJ 3F8MA 1B8IA 4IHTA 3L09A 2IP2A 2P7VB 3D0SA 3TW6A 3GTKJ 1S29A 1MNDA 3GVAA 1IRFA 1TT5B 2R7OA 1YIOA 2OQGA 2BHYA 1Z3YA 3ZMVA 1JJ6C 1J75A 4GDFA 3J7ZI 3TOBA 1X3UA 2JTVA 3H5NA 4L9JA 2ADUA 3EETA 1R22A 5CVIA 4L18B 3I53A 4P96A 2ZJQF 5FD5A 1ON1A 3GLXA 3OS1A 1DP7P 2TDXA 1CQTA 4CZZA 1IRXA 2W25A 1R5ID 2M4KA 5TRDA 3ELKA 3DCFA 4UV9A 4Q47A 2XSJC 2R3SA 2WY8Q 2P81A 3H9GA 5EGOB 3OYJA 2ZB9A 2M5WA 4A93J 4MQVA 3IWFA 4HF1A 2FNPA 4XONA 3ASOH 3PIOF 3JTGA 4AM3A 1K78B 3MKWB 3KZIC 2B9SA 3OR2C 3RQ4A 4MLOA 1KU2A 2STWA 2LVSA 5LBQA 2W4SA 3E1SA 1FY7A 1TWAJ 4I01A 1FJLA 2WTEA 1OJLA 1KU7A 3EUKL 2NVTJ 5FB2A 3AKZA 2K40A 3CMEI 2HS5A 2LG4A 3BCAA 4KT5C 4BKXA 1XMXA 1SAXA 1PVEA 2JUGA 2XIGA 3N4MA 2LFBA 4HNTA 5IOYA 2EV6A 3K4CA 1MNEA 5B1AH 3OSGA 4C2TA 5IT9R 2KIUA 3T8RA 1YW7A 1A04A 3FXOA 3L2UA 1ZGWA 5GP9A 3CC7I 3GFJA 4FASD 4HNVA 1H8AC 3LOCA 5ICGA 2XSDC 4LB6B 1DUXC 3A0BC 3ECOA 5LD2C 2GXBA 3KEYA 2R7QA 2VBXA 3FBNB 3I59A 5AIQA 4HRIA 3K4JA 3MQ0A 2XAQA 1T33A 3BY6A 2X1DA 5GPCA 1O4XA 2IS2A 4O6JA 2M4GA 4QPOA 5H6QA 3J81Z 4EJTA 4UUVA 3OL3A 1JUSA 3J7AY 2O9LA 1YS6A 5LRSA 4M9ZA 1IJWC 1UHWA 2K9QA 3LQQA 2KRHA 1SAUA 2GIZA 2OCEA 2QBYB 4P55A 1YRNB 4I76A 1FYMA 2R0QC 3M4OJ 1EV7A 2RQPA 2ZXWH 3AAFA 4EV0A 1TQPA 1W36D 3NAUA 3FK6A 4N4OB 1BA5A 2FQ4A 4LIVA 3UKGA 1ZREA 2W84A 4H4KC 3E6CC 5HDGA 3C3WA 1U0JA 1RZ4A 1LDDA 3NQOA 2L9RA 1KQ0A 1YE9A 3DU5A 2VI6A 2NOJB 3HKZA 1T39A 1RUOA 3Q0VA 2LF7A 4IOCF 3C1DA 3CF5F 3LSRA 3RKQA 1ETVA 4FCYA 3CC4I 4ENJA 2DT6A 1U3EM 2V1DA 4BU2A 5DUIA 5LGNA 1E2XA 3E7LA 2IRFG 1HSTA 2DDAA 2F5VA 3ERMA 5TGTA 4NDLA 4ZTJA 3Q3SA 2QQ9A 3M9AA 5FRMA 3OYKA 3CDLA 1VQLI 5F0CA 1FZPB 2JSCA 2R7FA 3F6VA 4Q5SF 3V8LA 1G3SA 2DA7A 3CCYA 3MN2A 4TV7A 4XN3A 2Z1DA 3V7SA 1FTTA 3H92A 5DV5A 2RREA 4M6VA 2ZFWA 4IO9F 1IUFA 1D5VA 4KN7X 4QSHA 3CCVI 4RS8A 1N25A 2CUFA 1SVLA 3R61A 4UUSB 1V5FA 3WTWC 2O0YA 1FLIA 3GZNB 3FXLA 4EJOA 1VQ5I 1Q1HA 1RC9A 2DU9A 2P6TA 3H9QA 1X1AA 4XLNF 5KAFC 2JA8J 1MMDA 1TWCJ 4JX5A 4JYKA 1Z91A 2K02A 1X1BA 3FDYA 1OYIA 1P4AA 3QU6A 3FKIJ 1SD5A 1H9GA 3E6MA 1PJRA 3TKYA 1LE8A 2HOTA 4OIOF 4A2UA 1AKHA 1D3YA 1YX5A 1T8IA 3NWTA 4HV5A 3K70D 2OBPA 4H0EA 3ZQLA 2R7VA 2DA1A 2HR3A 4LITA 5M3MJ 4EJVA 3L2RA 4LD5A 5HLIA 4UB6C 2O61A 5FKNA 3V42A 2VQLA 1ETQA 3JAMR 4D7NA 3I4NJ 4OMZA 2GA2A 2VL8A 2HU9A 3M8JA 1A35A 3BJAA 2DA5A 3H9JA 3LSPA 4V19K 4OMYA 3OYAA 2LF8A 3ZQQA 3I4MJ 3OS2A 2R5ZB 3FKJA 1DPRA 1W7PB 1USTA 1Z7UA 2KLOA 4DYQA 4KICA 3FM5A 4CYCB 4BBSJ 1Z05A 1WH7A 2P6SA 1K78A 3QYEA 1R5GA 2Y0SN 4HF0A 1D0XA 2ME6A 1QU3A 1AA7A 1OR7A 1OKRA 2DTZA 3DFGA 1GXQA 2M8EA 2DK8A 2GIVA 3H5AA 3TP3A 3EYIA 2WAEA 3WGGA 1W7PA 3M1CA 1FP2A 3SZTA 1AU7A 1W5TA 3P5JA 3WU1B 1IO2A 1XDSA 5C44J 3HSEA 4BL0B 2FE3A 3W6KB 1T95A 1TTYA 3G1MA 2LLKA 3QPLA 1Z21A 3CLQA 1YTYA 1IUYA 2M0MA 4ZZLA 5J40A 2NYXA 3W2AA 1XN7A 2VN2A 4FE7A 4PK4A 2Z2SB 5HS8A 3PO2J 3KYDB 1WI3A 4Y13A 2FMLA 1RETA 3H0DA 1FOYA 2EZIA 1B6AA 1WZ2A 3CMMA 1FT9A 2ZO4A 2F5DA 1YS7A 3I58A 4F7ZA 1SD7A 4CCKA 5DDGA 4BH9A 2PJRA 2L4AA 3OL4A 3CD6I 3FMSA 3QODA 3EUAA 2DFFA 4JK1X 2DMNA 2DOEA 2VE8A 3OOUA 4PZJA 4AUXA 4EEFG 5LHHA 1Z3XA 2FOKA 2HZTA 2M2EA 3BDDA 3NWSA 5M3FJ 4HX4A 4B44A 2BV6A 4FX4A 1KZHA 3MMYB 3ZP5A 1QBJA 2GAUA 1UELB 5B3SH 3F72A 3J7AO 4QIWN 5J4VA 4UV8A 1ZHFA 3A02A 4BJ6C 1XD7A 1TC3C 4MIMA 2GBYA 3GZ6A 3LA7A 5D5XB 4B4CA 3OIPA 5HLTA 3HG9A 3RSNA 2DW4A 1WJAA 2L5QA 3L9FA 3BR1A 3HL2A 2QYOA 4E7LA 3IH2A 2V1UA 5ICCA 3K2ZA 4BE2A 2LKPA 3AG4H 1G3WA 1SMTA 2FF4A 4Q4ZF 4OIRF 2ECBA 4M6XA 4A6EA 2XKOA 4ZZDA 2L7FP 3WGHA 5CVRA 3GTJJ 1U5TB 4BQAA 4NQWB 3KP7A 4JQFA 4XKCA 1NH3A 1LB2A 3FISA 2ZCWA 1R1TA 3K4NA 2J5PA 2HVSA 2IPQX 1OR7C 5KNLA 1YQAA 4N9IA 2EIJH 4NUBA 5DEQA 3JRBA 2MC3A 3I59B 4BHPA 2HYFA 2QQ8A 4S0HB 1O7FA 5DD8A 2HQNA 1W5SA 2RQQA 4CDGA 3JRGA 2M8GX 3HHHA 1LVKA 1XCVA 1X2NA 1WRJA 2W00A 3DLAA 1J5YA 3VSLA 2ECCA 4CH7A 1RR7A 2E7XA 1YJWI 1K83J 2M7BA 2ELJA 2XV4S 3GMEA 4M9XA 1DQUA 4UB8C 4NNJA 4Q48A 5CKTA 1LFUP 3S17J 3ABKH 4XN0A 2FUG2 1Y6IA 2CSOA 2ZNZA 2Y0MA 3GXOA 3JAMK 1J7KA 1WFXA 2OV7A 2R7XA 2EPFA 3TGNA 1OQYA 3I54A 2WA0A 4RGXA 1C0WA 2QSHX 5H6RA 3WE3A 1BIAA 1JJ8C 3RZOJ 1QPIA 1UCRA 1AHDP 3N05A 4C9YA 1K4SA 2DAOA 3D5LA 2ME0A 4D5FA 5E3MA 3DPUA 3OOPA 4AU7A 2X6WA 1G6NA 3OSFA 1K6OA 3QOPA 2E1OA 1MMGA 3LWFA 2E5ZA 2KIFA 3PSIA 4AIDA 4FQGA 1FSEA 3GFLA 4DZJA 5A2QR 2LDUA 2WB1A 1TL8A 5JFRA 1XTAA 1OFCX 5BNGA 5E18F 2IGMA 2K4BA 5AONA 1Y1VJ 3SDBA 5ICEA 2CYYA 1USSA 2LBFB 5C4JJ 5LEJA 4E7KA 2LREA 3KCCA 5L3FA 3HOYJ 1ZR4A 3GCMA 1IN4A 3M1EA 1RIOH 1WH5A 2ZNYA 2YS9A 3TL4X 1GUUA 2DA6A 2E1NA 1HCRA 1MKMA 2L9SA 5ILVA 3HC7A 3QRFF 3EUHA 4UUTA 2X9DA 4ZH4F 1KGSA 4RLFA 2E1MC 5E1XA 6PAXA 3HRUA 1ZKGA 2EJRA 2X4HA 2F4MB 2KPMA 1Y0UA 3AG3H 1O3QA 2D2WA 1MJAA 1S8NA 4ENNA 1E17A 4C30A 2PMZN 3FM3A 4KA4A 2R92J 4RA2A 3DU6A 5F6FA 3BLYA 3L7WA 4G9YA 2P8TA 2KMUA 2ZMEA 4N9HA 4A3EJ 1WI9A 4II2A 3ULQB 2R4GA 4RB2C 1OCRH 1QNTA 2MG4A 3IH4A 4ZC3A 3DWLE 2FXAA 1GVJA 2HTJA 3G1LA 1T56A 3OYHA 2KZGA 1ETYA 2KJBA 3I3LA 1LQ1A 1BOAA 1MBGA 4FT8A 1G8XA 5CJ9A 2H09A 1A36A 2M3AA 2E5NA 2JRMA 2AQEA 2OQRA 4BQQA 3CCSI 4E7IA 2CRGA 2XGEA 1UJ8A 1ZK8A 4IHVA 1K61A 1Y8RB 2X6YA 4RM2A 2VC1A 1CGPA 3BG5A 4EMSA 1XC5A 1TWHJ 2DPDA 5JHUA 3C7JA 1YHQI 2F5EA 2UZKA 4BY1J 1X58A 3PUBA 2EV5A 4E7ZA 4JOMA 4A3MJ 3HOUJ 2X6XA 5JLXA 2XF5A 1S3JA 3HUGA 3I4PA 4MFDA 1MSEC 1ZH5A 4KIBA 2OAZA 3OY9A 2CQNA 4FETA 4XSXF 3FZVA 4CICA 4DYRA 1FIAA 2HFHA 2Q8KA 2R5YB 1ZRCA 4IJAA 4P5OA 1KYZA 1EKEA 3HYIA 1DU0A 1JI8A 2R7ZJ 2KDZA 2ZSHB 1I39A 2ZXJA 1WJDA 4D5CA 1VQOI 2GWRA 1B72A 4HG2A 4IHWA 1WKMA 2H6CA 4HW0A 3GWZA 1YIJI 2DOFA 1Y8QB 1BI3A 3DKXA 2CV1A 4CCOA 5J3LA 3RTRA 3U21A 3S1NJ 1UMQA 3K69A 2MD5A 5IT9K 2NS8A 3MCZA 3Q9SA 2XUBA 4F92B 4GYIA 4LMYA 3J81K 4HLYA 4CYDA 1FWZA 2ZJ2A 4EJWA 2OZ6A 1NTCA 4OINF 3H3VK 1VQMI 4DBQA 2V4JC 3QPSA 5JI6A 1ZRDA 4R79A 1R36A 4L9VA 3E6DA 1LEBA 3ABTA 5EZGA 4KFCA 3HEFA 1TNTA 3COAC 2DA3A 2LMDA 1JE8A 2D45A 3QAHA 5D8KB 1UZCA 3HKZN 3LFUA 3FXMA 2RN7A 5E3NA 2R5YA 4BE0A 2HGCA 2IEKA 4XR6A 4E70A 1U78A 1HXDA 1J2XA 3K4BA 3J80Z 1HDDC 4IRIA 3HDDA 4IXAA 4ZDOA 2R7SA 1SFKA 2LKXA 3J81R 1F43A 2CWEA 4LIUA 2E2HJ 1V55H 5EDNA 3B6AA 3CJNA 2JA5J 1O57A 3QOEA 1RQ6A 3WTTC 2LR8A 3F8BA 1KONA 3OIOA 3FXKA 2VKHA 3U1DA 1OCCH 3RYRA 4E4HA 4E6KG 3P9IA 3G73A 5J4YA 1K79A 1MNMC 1SANA 1H0MA 1SFEA 2BW3B 4MTEA 4PDKA 3IWZA 5FKMA 1D1AA 1V5EA 3CZ6A 1I50J 3M7GA 3WTVC 3G1OA 5E1ZB 3S1RJ 4AWXB 2X1CA 5DUKA 1U9OA 2CV0A 5F0FA 2KJCA 1ONVA 1VZ0A 1NG6A 3ONQA 1VFCA 1H89C 2PBIA 1QPMA 2VQCA 3TMOA 1JHHA 2FQ3A 4A5MA 3SFZA 5FD6A 5FLVA 2DJNA 4D7MA 2LC2A 2JJ7A 4IHSA 4I98B 2DMUA 3JW4A 1OCTC 1DPUA 4DBRA 2LP0A 3L1PA 1APLC 5LRRA 1MMAA 1ODDA 3BR3A 4Y52J 2MGQA 2BVMA 3CJRB 1GHCA 2VPRA 2F5FA 2YUSA 4U0VA 3W2WA 2G0EA 4BXFA 4G7ZF 3FXJA 4MGRA 3S3MA 3S2WA 2BY3A 2RNGA 4YELA 2STTA 1SC7A 3KP2A 1WHUA 4BBRJ 1IN5A 5HNFA 3SEQA 2QSGX 4OWRB 2HQAA 3LSMA 4MEXF 3K1MA 4PSWA 4M3FA 1RESA 1MMNA 1QZZA 1FBSA 3SQNA 2KISA 1XMAA 1MH3A 1F4KA 4LFUA 5FGMA 3QU3A 3GZ5A 1K7AA 3TEDA 2UXXA 2B0LA 2VB6A 3D1NI 4A3BJ 4PGHA 4CYCA 4II3A 1WGXA 2O5RA 2VBWA 4CCLA 1PUFA 3PL8A 1D8JA 2JVGA 2BOLA 3C2HA 4GXOA 4W1UA 2O03A 1D1CA 2RAEA 1A6QA 1QHGA 2H94A 1EA3A 3EDPA 3DBRB 4W97A 3V7CA 4NHJA 1A5JA 2GOXB 2XAFA 3I9V2 1U8RA 2XPVA 2KRCA 4YRVA 2IT0A 1U6GA 5F1RA 2FD5A 1YJNI 1BR1A 2CQ7A 2BW3A 1G3TA 3LSIA 4XRSA 2Z33A 2HPIA 2QQAA 3PQJA 2DFIA 4G12A 2LY1A 2V1XA 2X48A 1SD6A 4WXDA 2A05A 4ESBA 2XB0X 5EEHA 2G9WA 3ASNH 4YFNF 2CUZA 2LRDA 4ZYEA 4FHTA 3CESA 3T0YA 1HKSA 3L2VA 2VIXA 3CQZJ 5IYDJ 4A69C 2CGPA 2L3DA 2EB7A 3RIRA 3SZPA 3JRHA 4DQ2A 2EFWA 1P4XA 2V7FA 4RAGA 5ED4A 1NHAA 3CUOA 4BXUA 3F22A 4ESFA 1Q1VA 4IEJA 1RUNA 5JVGF 5K5RA 2RVCA 4P9FA 4I0BA 5IP6A 3HRMA 4HX7A 1EH7A 5ILUA 2OA4A 1EH6A 4BEHB 4FTHA 3DF8A 1YG2A 5K7ZA 4BACA 1Z7LA 5DM6F 1BC7C 2L7MP 1HW2A 3OYNA 4A3LJ 3FWEA 4LK0F 3CO7C 1ITYA 2JZYA 1ZELA 3DP7A 2LK2A 1M1EB 4IHXA 1PUEE 4RBOA 2K85A 4XRMA 3VB2A 2PMHA 2CV2A 1I6HJ 2WAFA 1TT0A 2MUNA 3V8JA 2QGUA 3CJTB 4C3IJ 1A31A 2BZTA 3TQNA 3QQAA 4U0YA 2VXDA 3VEPA 2OTLI 1IXRC 1T08B 5D4RA 5GAEJ 1OYYA 4A0YA 3DLLF 2KIMA 4F3QA 3ISPA 1QRYA 2R5ZA 2JVHA 5HNHA 3LAPA 2RC4A 3KP4A 1KQ9A 2LH9A 2FBKA 2DMQA 3TO6A 2ELHA 4X0GA 3JRAA 2UWMA 4M3GA 2XPUA 5E20A 5IYCJ 3IAS2 1BW5A 3AL0B 1IW7F 2W24A 2WB1N 1MBHA 4HSRA 1U2WA 1QVUA 3GTLJ 2EFPA 3FHNA
chains in the Genus database with same CATH topology
3BP8A 2FRHA 3ECHA 4AIHA 3EQLF 2HKOA 3HRSA 2EFOA 1HBXG 2J5OA 2FMYA 2AS5F 1FOKA 1P6RA 4I0AA 3DQVC 3QP6A 1ZG3A 1YFHA 3TDZC 3ZMDA 4B09A 2A61A 3HSRA 4YFXF 3K1PA 2A68F 4UVBA 1T0FA 3JAMZ 3Q9VA 3ZPLA 4NQWA 1T38A 3MAJA 4GYGA 4N0BA 1TW2A 5DCFA 1GXPA 3DKWA 4K2EA 4QLCU 2K4JA 1FBQA 3KLOA 1QQIA 3MWMA 3IL2A 1IN7A 5K1YA 1Z1DA 2CQKA 4HLXA 5LHIA 1B1BA 3I64A 3JSOA 3E5UA 4ESJA 4MQ9F 4ENKA 3B02A 3PQKA 3RYPA 3FX3A 3MZYA 5L3BA 1ON2A 4KNYA 3ABUA 5EEGA 2LSOA 1IN6A 5CVJA 4O5VA 2PJPA 3RKYA 3P9CA 5ILSA 2DLLA 1W4MA 1Z9CA 3MFKA 5HS9A 1J59A 5H20A 1OMIA 4G94A 5L3DA 2K27A 3HHGA 3SHFA 1F1ZA 4M71A 4I02A 3QP5A 4CGZA 2E1CA 1Z6TA 2M1BA 3E3VA 1SD4A 4A0ZA 1YW8A 2ESHA 4PCQA 3GFIA 4D0PA 3E6BA 3WGIA 1WWXA 2VT2A 3DPTA 1R5HA 4GGGA 3LA3A 1XDUA 4WF2A 1YO5C 2EK5A 4AIJA 4I7HA 5LHGA 3K9TA 3IKTA 4G8XA 5E8GA 1HW1A 3WTSC 5JR3A 5E8IA 1LDKB 3EYYA 4WWCA 3F6OA 3GFMA 1U5TC 3TDUC 3KETA 3O2PE 3WTYC 3KP5A 5HS7A 2HKXA 1XGMA 4IVNA 4LJZF 1V4RA 3G3ZA 4ON0A 4AVPA 2KKOA 4M6YA 1TNSA 4IRGA 1RI7A 1MJ9A 2A3SA 5IT9Z 1PP7U 2DI3A 3CUQC 1I27A 2EFNA 5IT3A 5L3EA 1QZYA 3H3ZA 4HOBA 5FLXK 2A6HF 2ZBKA 3O6BB 1KQ8A 4B8XA 3F21A 2OD5A 2Z9OA 2BEOA 2HEOA 3BOQA 2PN6A 4U0WA 3T1BA 4HV6A 2IVMA 3U9GA 2L02A 2ISZA 2IJLA 2MLKA 1TW3A 1XSVA 3IRRA 4I09A 4A0XA 4HA8A 4HQEA 2DK5A 3WG9A 1IF1A 4MTDA 2HOEA 4WXHA 2QVOA 2L4MA 3ML6A 1TBXA 2PFBA 4ENMA 5HLGA 5AIPA 3Q5FA 3V7RA 4YIFA 2CG4A 2RGVA 2P4WA 2FNAA 1HSJA 2Y75A 2HQRA 1B59A 1ZGAA 1IXCA 4G7OF 3TOAA 2FBHA 4XRFA 5CLSA 1MDMA 2NNNA 5J8FA 2YR2A 1STZA 3FMQA 3FHZA 5D8LB 1BJAA 3U2RA 3LAJA 3KP6A 1LJ9A 2DBBA 2V9VA 4U7BA 4MNUA 4G7HF 1ZGJA 2YX4A 2O6GE 1KU9A 5D6EA 3BZ6A 1HQCA 4M9SA 1TQIA 1IZ1A 5CVUA 4EVIA 1OPCA 5ERIA 4O3MA 2QWWA 1KU3A 3GUDA 5KVRA 1I1SA 2F2EA 2R7DA 3BJ6A 1SFUA 1QGPA 3F3XA 4XBFA 3F8CA 3ZMSA 2EV0A 3MEXA 3R6SA 4CO8A 4UNOA 1L0OC 4M72A 1ZRFA 3IRQA 2ZKZA 1ZYRF 5JVTA 2VT3A 2FA5A 1JHFA 1P92A 5BMZA 3BROA 4L9TA 1I1GA 3V8KA 4FX0A 3IHUA 4L0YB 4LLGF 5E1WA 2DT5A 3ZQ7A 5LGUA 4EM1A 4UHTA 4LG0A 5D4SA 1IXSB 4WX9A 2GZWA 1I5ZA 2F5CA 3GX4X 2A6EF 3I0TA 3R0AA 2RNJA 4GCVA 4OOIA 4QWQA 5DCMB 1U5TA 4KIFA 5D5VB 1HW5A 4Y15A 1HKTA 1CF7A 3V4GA 2Q0OA 3GF2A 2XAGA 2A69F 2V79A 2FEZA 4NB5A 2PQ8A 3FXUA 5CYVA 2G7UA 3MZHA 3FF5A 4UXNA 4ZYGA 2FBIA 2IA2A 4HZFA 2H6BA 1S7AA 4MEYF 4OIQF 2ETHA 2YPRA 3N97A 1IAWA 2BBYA 3QPTA 1T2KA 3K1NA 1W7PD 2QENA 2GQQA 2AXLA 3HSFA 2XVCA 1YYVA 5BPDA 1FPQA 2QQBA 2OU2A 2PI0A 4LK1F 3CDHA 3GW2A 3NRVA 4Y17A 4PGGA 1MZBA 4LGWA 2MLGA 4U88A 2W85A 4EGYA 4DNCA 2OZUA 5LEKA 2K7LA 3KEQA 4RGUA 4IPAA 3ERED 4AIKA 2L54A 3ZN1A 1V3FA 1BIBA 3O3KA 2NAZA 3KE2A 1OYWA 3M8EA 3M8FA 5BOXA 3VFZA 2RKHA 5K5OA 4M74A 1WSUA 3RDIA 3E5QA 1O3SA 3NEUA 5HDNA 4A5NA 5A2QK 1JXSA 3T5XA 1H9TA 3L2CA 3VODA 2K86A 5ICFA 4HQMA 1FYKA 4BHBA 4KMUX 5L3CA 3GO5A 1XSDA 3KZYA 3QPHA 3I5UA 3KLNA 2YU3A 2KRFA 3WE2A 5E17F 2PEXA 5J8CA 3HRTA 3IC7A 1BBYA 2VONA 1XSXA 3ZMZA 2FSWA 3RJPA 3B73A 2WWYA 4BNCA 4HF2A 3DEUA 1BI0A 1R1UA 3WODF 4KMFA 3TO7A 1RNLA 1CF7B 3WTUC 4R8HA 4RB1A 1YW9A 3R0JA 2RV8A 4L9NA 3GYHX 5D5WB 2XROA 1UB9A 3FMRA 2JT1A 2HDCA 3CLOA 2DQLA 3BPVA 2ZMEB 3GEZA 2IA0A 3ZMUA 2HTSA 2VOOA 3F8FA 2MBFA 4GO1A 1XGNA 3W6JB 1S6LA 2XAHA 2BE5F 3LQRA 3BPXA 3HOSA 1SMYF 4L5JA 1IRGA 4WXCA 4YFKF 1TQMA 3JTHA 2VXZA 5HDKA 4EGZA 1ULYA 2VC0A 4UVAA 3ROUA 3J80K 2IA1A 4HYEA 1ZAOA 1ZG1A 5LGTA 3R60A 4L5IA 2WC2A 2YX7A 5BQTA 5HLHA 4RGSA 5K5QA 2D1HA 4XLPF 1PP8F 2GXGA 4KDPA 2VE9A 3C18A 3CTAA 2EA4A 2NNYA 3P7NA 1FNNA 3F8NA 1O7LA 5FFZA 1VTNC 2UXNA 4AD9A 4BAYA 1FP1D 2MH2A 2JPBA 3I71A 1R58A 2A07F 2X0LA 3IKVA 2PLYA 5HVQC 4LLNA 5D6FA 1O3RA 2VBZA 1REPC 3RPQA 1PDNC 2Z99A 1QO0D 1Z6RA 5DYMA 4HDUA 3ZMTA 3HTSB 4HDVA 5A2QZ 1XMKA 3OV8A 4EQQA 4KUMA 3CUQB 1BC8C 5F64A 2P5LC 1B4AA 1ZLJA 2QBYA 3ZN0A 2M45A 2HYGD 1FX7A 2DO7A 4EM2A 2P5KA 4BHCA 2P7CB 4BYYA 1XGOA 2NRAC 2Z5UA 5LLQA 2ESNA 3VOEA 4KIGA 2COMA 2BYVE 1R00A 3T8TA 2Y48A 3E5XA 3F23A 3CO6C 1KA8A 4M73A 1FC3A 2XRNA 3R4KA 1FYLA 1IN8A 3KEOA 1MD0A 5DD4A 1B9NA 1ZN2A 3K0LA 5KK1A 1YLFA 1J9IA 2WV0A 2VOPA 2LNBA 1D8KA 2D1VA 1L3LA 2ISYA 2O8XA 2RDPA 4OIPF 4EM0B 2H27A 2PMUA 2XGXA 3L00A 3WTXC 1B9MA 1T6SA 1ZARA 3P9KA 2EFQA 2QZ8A 1FBUA 1UHMA 2M87A 3WU0A 4A12A 4YIIA 5D5UB 4RAZA 4S04A 2G7HA 2Q2EA 1R23A 2V6CA 3CUQA 5DCMA 5TJJA 2C6YA 4ETSA 1F9NA 1XGSA 2Z3YA 4WK8F 1BN5A 3E97A 2DQRA 2CO5A 2QLZA 5FFXA 4KN4X 1MGTA 3HOTA 4EJUA 3LFKA 1G4DA 4CXFA 3KP3A 4LG0B 2QM3A 2ACJA 4HBLA 4LB5A 1ZG5A 3DPLC 3BJOA 1LVAA 2NS0A 4RAYA 1BI1A 3SXYA 2BGCA 1HKQA 3DXJF 4S05A 4YG2F 2QUFA 4L0ZB 3RI4A 2HWVA 3LSTA 5BS6A 2EWNA 2P5VA 1BI2A 3WTZA 5FLXZ 1R1VA 2VBYA 3REOA 4A6DA 5FO5A 2JPCA 1R7JA 3H3UA 2MH9A 2XAJA 2L01A 1XCBA 4G6QA 4XSZF 2GA1A 1BM9A 1EH8A 5J6XA 3PFIA 1G3YA 1P4WA 1KYWA 4IF4A 2W57A 2XHKA 4KYWA 2EFPA 4G6DA 3KZZA 4OU0A 2JRTA 4ZYDA 4U7DA 1T98A 1UFMA 3HTUA 2MA3A 1O3TA 1ZLKA 2EA2A 4R1HA 3TO9A 4JBAA 4RB0A 3BWGA 4RB3C 2YSRA 2A5YB 2CW0F 2M30A 2E7WA 2PG4A 2CFXA 3FXQA 2IW5A 4UVCA 4I2OA 1LNWA 1TLHB 5BPIA 4IRHA 1AOYA 2XASA 2FU4A 1SFXA 2DPUA 3RPUA 3LA2A 5L3GA 3RKXA 1S7OA 4HX8A 1XB4A 1JGSA 5HOOA 4ASNA 1DDNA 5CVVA 4LLLA 3HIFA 4P9UA 1F5TA 3RKWA 3FXRA 1FSHA 2O3FA 4HAMA 2XKPA 3JSPA 4ZYHA 1I6XA 2VODA 1MDMB 1AWCA 1J0RA 4CHUA 3DV8A 1LEAA 1LDJA 2DTRA 4RGRA 1P2FA 4MHGA 1WQ2A 4Z2YA 4WCGA 1MJBA 3F8MA 4IHTA 3L09A 2IP2A 2P7VB 3D0SA 1S29A 3GVAA 1IRFA 1YIOA 2OQGA 3ZMVA 1J75A 3TOBA 1X3UA 2JTVA 4L9JA 2ADUA 3EETA 1R22A 5CVIA 4L18B 3I53A 4P96A 5FD5A 1ON1A 3GLXA 1DP7P 2TDXA 4CZZA 2W25A 5TRDA 3ELKA 4UV9A 4Q47A 2R3SA 2M5WA 4MQVA 3IWFA 4HF1A 2FNPA 3JTGA 1K78B 1KU2A 2STWA 5LBQA 1FY7A 4I01A 2WTEA 1KU7A 5FB2A 2HS5A 4KT5C 1SAXA 2XIGA 3N4MA 2EV6A 2KIUA 3T8RA 1YW7A 1A04A 3GFJA 5ICGA 4LB6B 1DUXC 3ECOA 2GXBA 2VBXA 3I59A 5AIQA 3MQ0A 2XAQA 3BY6A 4O6JA 5H6QA 3J81Z 4EJTA 4UUVA 1YS6A 5LRSA 4M9ZA 1UHWA 3LQQA 2QBYB 4P55A 1FYMA 1EV7A 2RQPA 3AAFA 4EV0A 1TQPA 1ZREA 2W84A 3E6CC 5HDGA 3C3WA 1RZ4A 1LDDA 3NQOA 1KQ0A 1T39A 1RUOA 2LF7A 3C1DA 4ENJA 1U3EM 2V1DA 5DUIA 5LGNA 1E2XA 2IRFG 1HSTA 2QQ9A 3M9AA 1FZPB 2JSCA 2R7FA 3F6VA 4Q5SF 3V8LA 1G3SA 4TV7A 3V7SA 3H92A 5DV5A 2ZFWA 1D5VA 4KN7X 4RS8A 3R61A 3WTWC 2O0YA 1FLIA 4EJOA 1Q1HA 2DU9A 2P6TA 4XLNF 1Z91A 2K02A 3QU6A 1OYIA 1P4AA 1SD5A 1H9GA 3E6MA 4OIOF 3TKYA 4A2UA 1D3YA 4HV5A 2OBPA 4H0EA 2HR3A 4EJVA 4LD5A 5HLIA 2O61A 4OMZA 2GA2A 3BJAA 4OMYA 2LF8A 1DPRA 1W7PB 1USTA 1Z7UA 4KICA 3FM5A 1Z05A 2P6SA 1K78A 1R5GA 4HF0A 1OR7A 1OKRA 3DFGA 1GXQA 2M8EA 2DK8A 2GIVA 3EYIA 3WGGA 1W7PA 1FP2A 3SZTA 1W5TA 3WU1B 1XDSA 3HSEA 2FE3A 3W6KB 1TTYA 1YTYA 1IUYA 4ZZLA 2NYXA 1XN7A 2VN2A 5HS8A 4Y13A 2FMLA 1B6AA 1FT9A 2ZO4A 2F5DA 1YS7A 3I58A 4F7ZA 1SD7A 5DDGA 4BH9A 2L4AA 3FMSA 4JK1X 2VE8A 4PZJA 5LHHA 3BDDA 2FOKA 2HZTA 4HX4A 2BV6A 4FX4A 1QBJA 3ZP5A 2GAUA 3F72A 3J7AO 4UV8A 1ZHFA 1XD7A 3GZ6A 3LA7A 5D5XB 2DW4A 3L9FA 2QYOA 2V1UA 5ICCA 3K2ZA 2LKPA 1G3WA 1SMTA 2FF4A 4Q4ZF 4OIRF 4M6XA 4A6EA 2XKOA 4ZZDA 3WGHA 5CVRA 1U5TB 4BQAA 3KP7A 4JQFA 1LB2A 2ZCWA 1R1TA 2J5PA 2IPQX 1YQAA 4N9IA 5DEQA 2MC3A 3I59B 4BHPA 2HYFA 1O7FA 5DD8A 2HQNA 1W5SA 4CDGA 3HHHA 1XCVA 1WRJA 1J5YA 2E7XA 2XV4S 4M9XA 4Q48A 2CSOA 2ZNZA 2Y0MA 3GXOA 3JAMK 1J7KA 3TGNA 3I54A 4RGXA 1C0WA 5H6RA 3WE3A 1BIAA 1UCRA 2DAOA 3D5LA 3OOPA 1G6NA 1K6OA 3QOPA 3LWFA 2KIFA 1FSEA 3GFLA 2LDUA 5JFRA 5E18F 2K4BA 5AONA 5ICEA 2CYYA 1USSA 5LEJA 3KCCA 5L3FA 1IN4A 3M1EA 1RIOH 2ZNYA 2E1NA 1MKMA 5ILVA 3QRFF 3EUHA 4ZH4F 1KGSA 5E1XA 6PAXA 3HRUA 2EJRA 2X4HA 1Y0UA 1O3QA 2D2WA 1MJAA 1S8NA 4ENNA 1E17A 3FM3A 4KA4A 5F6FA 3L7WA 4G9YA 2P8TA 2ZMEA 4N9HA 1WI9A 3ULQB 4RB2C 1QNTA 2FXAA 1GVJA 2HTJA 2KJBA 1LQ1A 1BOAA 4FT8A 5CJ9A 2H09A 2OQRA 2VC1A 1CGPA 4EMSA 2DPDA 5JHUA 3C7JA 2F5EA 2UZKA 2EV5A 1S3JA 3HUGA 3I4PA 1ZH5A 4KIBA 2OAZA 4XSXF 3FZVA 4CICA 2HFHA 2Q8KA 1ZRCA 4IJAA 4P5OA 1KYZA 3HYIA 2ZXJA 2GWRA 1WKMA 2H6CA 4HW0A 3GWZA 1BI3A 3RTRA 3K69A 2MD5A 5IT9K 3MCZA 3Q9SA 2XUBA 4GYIA 4LMYA 3J81K 4HLYA 4CYDA 1FWZA 2ZJ2A 4EJWA 2OZ6A 4OINF 5JI6A 1ZRDA 4R79A 1R36A 4L9VA 3E6DA 1LEBA 3ABTA 4KFCA 1TNTA 3COAC 1JE8A 2D45A 3QAHA 5D8KB 2RN7A 2HGCA 4E70A 1U78A 1HXDA 1J2XA 3J80Z 4IRIA 4IXAA 2CWEA 3CJNA 1O57A 3WTTC 3F8BA 3U1DA 3RYRA 3G73A 3P9IA 1K79A 1H0MA 1SFEA 4MTEA 4PDKA 3IWZA 3M7GA 3WTVC 5E1ZB 4AWXB 5DUKA 2KJCA 1ONVA 2PBIA 1QPMA 1JHHA 2FQ3A 4A5MA 3SFZA 5FD6A 4IHSA 4I98B 3JW4A 1DPUA 5LRRA 1ODDA 1GHCA 2F5FA 4U0VA 4G7ZF 4MGRA 3S2WA 2STTA 3KP2A 1IN5A 4MEXF 3K1MA 1QZZA 1FBSA 3SQNA 1XMAA 1F4KA 4LFUA 5FGMA 3QU3A 3GZ5A 1K7AA 2UXXA 2B0LA 4PGHA 2VBWA 1D8JA 4GXOA 2O03A 2H94A 3EDPA 3V7CA 4NHJA 2XAFA 1U8RA 2IT0A 1U6GA 5F1RA 1G3TA 2Z33A 2QQAA 3PQJA 2DFIA 2V1XA 1SD6A 4WXDA 4ESBA 5EEHA 2G9WA 4YFNF 4ZYEA 4FHTA 3T0YA 1HKSA 2CGPA 2L3DA 2EB7A 3RIRA 3SZPA 4DQ2A 2EFWA 1P4XA 5ED4A 1NHAA 3CUOA 4BXUA 3F22A 4ESFA 1RUNA 5K5RA 2RVCA 4P9FA 4I0BA 3HRMA 4HX7A 5ILUA 1EH7A 2OA4A 1EH6A 3DF8A 1YG2A 1BC7C 1HW2A 3FWEA 4LK0F 3CO7C 2JZYA 3DP7A 1PUEE 3VB2A 2PMHA 3V8JA 3TQNA 4U0YA 3VEPA 1IXRC 5D4RA 1OYYA 4A0YA 2KIMA 3ISPA 3LAPA 2RC4A 3KP4A 1KQ9A 2FBKA 3TO6A 2ELHA 2UWMA 5E20A 1IW7F 2W24A 1U2WA 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 A;  2FRH A;  3ECH A;  4AIH A;  3EQL F;  2HKO A;  3HRS A;  2EFO A;  1HBX G;  2J5O A;  2FMY A;  2AS5 F;  1FOK A;  1P6R A;  4I0A A;  3DQV C;  3QP6 A;  1ZG3 A;  1YFH A;  3TDZ C;  3ZMD A;  4B09 A;  2A61 A;  3HSR A;  4YFX F;  3K1P A;  2A68 F;  4UVB A;  1T0F A;  3JAM Z;  3Q9V A;  3ZPL A;  4NQW A;  1T38 A;  3MAJ A;  4GYG A;  4N0B A;  1TW2 A;  5DCF A;  1GXP A;  3DKW A;  4K2E A;  4QLC U;  2K4J A;  1FBQ A;  3KLO A;  1QQI A;  3MWM A;  3IL2 A;  1IN7 A;  5K1Y A;  1Z1D A;  2CQK A;  4HLX A;  5LHI A;  1B1B A;  3I64 A;  3JSO A;  3E5U A;  4ESJ A;  4MQ9 F;  4ENK A;  3B02 A;  3PQK A;  3RYP A;  3FX3 A;  3MZY A;  5L3B A;  1ON2 A;  4KNY A;  3ABU A;  5EEG A;  2LSO A;  1IN6 A;  5CVJ A;  4O5V A;  2PJP A;  3RKY A;  3P9C A;  5ILS A;  2DLL A;  1W4M A;  1Z9C A;  3MFK A;  5HS9 A;  1J59 A;  5H20 A;  1OMI A;  4G94 A;  5L3D A;  2K27 A;  3HHG A;  3SHF A;  1F1Z A;  4M71 A;  4I02 A;  3QP5 A;  4CGZ A;  2E1C A;  1Z6T A;  2M1B A;  3E3V A;  1SD4 A;  4A0Z A;  1YW8 A;  2ESH A;  4PCQ A;  3GFI A;  4D0P A;  3E6B A;  3WGI A;  1WWX A;  2VT2 A;  3DPT A;  1R5H A;  4GGG A;  3LA3 A;  1XDU A;  4WF2 A;  1YO5 C;  2EK5 A;  4AIJ A;  4I7H A;  5LHG A;  3K9T A;  3IKT A;  4G8X A;  5E8G A;  1HW1 A;  3WTS C;  5JR3 A;  5E8I A;  1LDK B;  3EYY A;  4WWC A;  3F6O A;  3GFM A;  1U5T C;  3TDU C;  3KET A;  3O2P E;  3WTY C;  3KP5 A;  5HS7 A;  2HKX A;  1XGM A;  4IVN A;  4LJZ F;  1V4R A;  3G3Z A;  4ON0 A;  4AVP A;  2KKO A;  4M6Y A;  1TNS A;  4IRG A;  1RI7 A;  1MJ9 A;  2A3S A;  5IT9 Z;  1PP7 U;  2DI3 A;  3CUQ C;  1I27 A;  2EFN A;  5IT3 A;  5L3E A;  1QZY A;  3H3Z A;  4HOB A;  5FLX K;  2A6H F;  2ZBK A;  3O6B B;  1KQ8 A;  4B8X A;  3F21 A;  2OD5 A;  2Z9O A;  2BEO A;  2HEO A;  3BOQ A;  2PN6 A;  4U0W A;  3T1B A;  4HV6 A;  2IVM A;  3U9G A;  2L02 A;  2ISZ A;  2IJL A;  2MLK A;  1TW3 A;  1XSV A;  3IRR A;  4I09 A;  4A0X A;  4HA8 A;  4HQE A;  2DK5 A;  3WG9 A;  1IF1 A;  4MTD A;  2HOE A;  4WXH A;  2QVO A;  2L4M A;  3ML6 A;  1TBX A;  2PFB A;  4ENM A;  5HLG A;  5AIP A;  3Q5F A;  3V7R A;  4YIF A;  2CG4 A;  2RGV A;  2P4W A;  2FNA A;  1HSJ A;  2Y75 A;  2HQR A;  1B59 A;  1ZGA A;  1IXC A;  4G7O F;  3TOA A;  2FBH A;  4XRF A;  5CLS A;  1MDM A;  2NNN A;  5J8F A;  2YR2 A;  1STZ A;  3FMQ A;  3FHZ A;  5D8L B;  1BJA A;  3U2R A;  3LAJ A;  3KP6 A;  1LJ9 A;  2DBB A;  2V9V A;  4U7B A;  4MNU A;  4G7H F;  1ZGJ A;  2YX4 A;  2O6G E;  1KU9 A;  5D6E A;  3BZ6 A;  1HQC A;  4M9S A;  1TQI A;  1IZ1 A;  5CVU A;  4EVI A;  1OPC A;  5ERI A;  4O3M A;  2QWW A;  1KU3 A;  3GUD A;  5KVR A;  1I1S A;  2F2E A;  2R7D A;  3BJ6 A;  1SFU A;  1QGP A;  3F3X A;  4XBF A;  3F8C A;  3ZMS A;  2EV0 A;  3MEX A;  3R6S A;  4CO8 A;  4UNO A;  1L0O C;  4M72 A;  1ZRF A;  3IRQ A;  2ZKZ A;  1ZYR F;  5JVT A;  2VT3 A;  2FA5 A;  1JHF A;  1P92 A;  5BMZ A;  3BRO A;  4L9T A;  1I1G A;  3V8K A;  4FX0 A;  3IHU A;  4L0Y B;  4LLG F;  5E1W A;  2DT5 A;  3ZQ7 A;  5LGU A;  4EM1 A;  4UHT A;  4LG0 A;  5D4S A;  1IXS B;  4WX9 A;  2GZW A;  1I5Z A;  2F5C A;  3GX4 X;  2A6E F;  3I0T A;  3R0A A;  2RNJ A;  4GCV A;  4OOI A;  4QWQ A;  5DCM B;  1U5T A;  4KIF A;  5D5V B;  1HW5 A;  4Y15 A;  1HKT A;  1CF7 A;  3V4G A;  2Q0O A;  3GF2 A;  2XAG A;  2A69 F;  2V79 A;  2FEZ A;  4NB5 A;  2PQ8 A;  3FXU A;  5CYV A;  2G7U A;  3MZH A;  3FF5 A;  4UXN A;  4ZYG A;  2FBI A;  2IA2 A;  4HZF A;  2H6B A;  1S7A A;  4MEY F;  4OIQ F;  2ETH A;  2YPR A;  3N97 A;  1IAW A;  2BBY A;  3QPT A;  1T2K A;  3K1N A;  1W7P D;  2QEN A;  2GQQ A;  2AXL A;  3HSF A;  2XVC A;  1YYV A;  5BPD A;  1FPQ A;  2QQB A;  2OU2 A;  2PI0 A;  4LK1 F;  3CDH A;  3GW2 A;  3NRV A;  4Y17 A;  4PGG A;  1MZB A;  4LGW A;  2MLG A;  4U88 A;  2W85 A;  4EGY A;  4DNC A;  2OZU A;  5LEK A;  2K7L A;  3KEQ A;  4RGU A;  4IPA A;  3ERE D;  4AIK A;  2L54 A;  3ZN1 A;  1V3F A;  1BIB A;  3O3K A;  2NAZ A;  3KE2 A;  1OYW A;  3M8E A;  3M8F A;  5BOX A;  3VFZ A;  2RKH A;  5K5O A;  4M74 A;  1WSU A;  3RDI A;  3E5Q A;  1O3S A;  3NEU A;  5HDN A;  4A5N A;  5A2Q K;  1JXS A;  3T5X A;  1H9T A;  3L2C A;  3VOD A;  2K86 A;  5ICF A;  4HQM A;  1FYK A;  4BHB A;  4KMU X;  5L3C A;  3GO5 A;  1XSD A;  3KZY A;  3QPH A;  3I5U A;  3KLN A;  2YU3 A;  2KRF A;  3WE2 A;  5E17 F;  2PEX A;  5J8C A;  3HRT A;  3IC7 A;  1BBY A;  2VON A;  1XSX A;  3ZMZ A;  2FSW A;  3RJP A;  3B73 A;  2WWY A;  4BNC A;  4HF2 A;  3DEU A;  1BI0 A;  1R1U A;  3WOD F;  4KMF A;  3TO7 A;  1RNL A;  1CF7 B;  3WTU C;  4R8H A;  4RB1 A;  1YW9 A;  3R0J A;  2RV8 A;  4L9N A;  3GYH X;  5D5W B;  2XRO A;  1UB9 A;  3FMR A;  2JT1 A;  2HDC A;  3CLO A;  2DQL A;  3BPV A;  2ZME B;  3GEZ A;  2IA0 A;  3ZMU A;  2HTS A;  2VOO A;  3F8F A;  2MBF A;  4GO1 A;  1XGN A;  3W6J B;  1S6L A;  2XAH A;  2BE5 F;  3LQR A;  3BPX A;  3HOS A;  1SMY F;  4L5J A;  1IRG A;  4WXC A;  4YFK F;  1TQM A;  3JTH A;  2VXZ A;  5HDK A;  4EGZ A;  1ULY A;  2VC0 A;  4UVA A;  3ROU A;  3J80 K;  2IA1 A;  4HYE A;  1ZAO A;  1ZG1 A;  5LGT A;  3R60 A;  4L5I A;  2WC2 A;  2YX7 A;  5BQT A;  5HLH A;  4RGS A;  5K5Q A;  2D1H A;  4XLP F;  1PP8 F;  2GXG A;  4KDP A;  2VE9 A;  3C18 A;  3CTA A;  2EA4 A;  2NNY A;  3P7N A;  1FNN A;  3F8N A;  1O7L A;  5FFZ A;  1VTN C;  2UXN A;  4AD9 A;  4BAY A;  1FP1 D;  2MH2 A;  2JPB A;  3I71 A;  1R58 A;  2A07 F;  2X0L A;  3IKV A;  2PLY A;  5HVQ C;  4LLN A;  5D6F A;  1O3R A;  2VBZ A;  1REP C;  3RPQ A;  1PDN C;  2Z99 A;  1QO0 D;  1Z6R A;  5DYM A;  4HDU A;  3ZMT A;  3HTS B;  4HDV A;  5A2Q Z;  1XMK A;  3OV8 A;  4EQQ A;  4KUM A;  3CUQ B;  1BC8 C;  5F64 A;  2P5L C;  1B4A A;  1ZLJ A;  2QBY A;  3ZN0 A;  2M45 A;  2HYG D;  1FX7 A;  2DO7 A;  4EM2 A;  2P5K A;  4BHC A;  2P7C B;  4BYY A;  1XGO A;  2NRA C;  2Z5U A;  5LLQ A;  2ESN A;  3VOE A;  4KIG A;  2COM A;  2BYV E;  1R00 A;  3T8T A;  2Y48 A;  3E5X A;  3F23 A;  3CO6 C;  1KA8 A;  4M73 A;  1FC3 A;  2XRN A;  3R4K A;  1FYL A;  1IN8 A;  3KEO A;  1MD0 A;  5DD4 A;  1B9N A;  1ZN2 A;  3K0L A;  5KK1 A;  1YLF A;  1J9I A;  2WV0 A;  2VOP A;  2LNB A;  1D8K A;  2D1V A;  1L3L A;  2ISY A;  2O8X A;  2RDP A;  4OIP F;  4EM0 B;  2H27 A;  2PMU A;  2XGX A;  3L00 A;  3WTX C;  1B9M A;  1T6S A;  1ZAR A;  3P9K A;  2EFQ A;  2QZ8 A;  1FBU A;  1UHM A;  2M87 A;  3WU0 A;  4A12 A;  4YII A;  5D5U B;  4RAZ A;  4S04 A;  2G7H A;  2Q2E A;  1R23 A;  2V6C A;  3CUQ A;  5DCM A;  5TJJ A;  2C6Y A;  4ETS A;  1F9N A;  1XGS A;  2Z3Y A;  4WK8 F;  1BN5 A;  3E97 A;  2DQR A;  2CO5 A;  2QLZ A;  5FFX A;  4KN4 X;  1MGT A;  3HOT A;  4EJU A;  3LFK A;  1G4D A;  4CXF A;  3KP3 A;  4LG0 B;  2QM3 A;  2ACJ A;  4HBL A;  4LB5 A;  1ZG5 A;  3DPL C;  3BJO A;  1LVA A;  2NS0 A;  4RAY A;  1BI1 A;  3SXY A;  2BGC A;  1HKQ A;  3DXJ F;  4S05 A;  4YG2 F;  2QUF A;  4L0Z B;  3RI4 A;  2HWV A;  3LST A;  5BS6 A;  2EWN A;  2P5V A;  1BI2 A;  3WTZ A;  5FLX Z;  1R1V A;  2VBY A;  3REO A;  4A6D A;  5FO5 A;  2JPC A;  1R7J A;  3H3U A;  2MH9 A;  2XAJ A;  2L01 A;  1XCB A;  4G6Q A;  4XSZ F;  2GA1 A;  1BM9 A;  1EH8 A;  5J6X A;  3PFI A;  1G3Y A;  1P4W A;  1KYW A;  4IF4 A;  2W57 A;  2XHK A;  4KYW A;  2EFP A;  4G6D A;  3KZZ A;  4OU0 A;  2JRT A;  4ZYD A;  4U7D A;  1T98 A;  1UFM A;  3HTU A;  2MA3 A;  1O3T A;  1ZLK A;  2EA2 A;  4R1H A;  3TO9 A;  4JBA A;  4RB0 A;  3BWG A;  4RB3 C;  2YSR A;  2A5Y B;  2CW0 F;  2M30 A;  2E7W A;  2PG4 A;  2CFX A;  3FXQ A;  2IW5 A;  4UVC A;  4I2O A;  1LNW A;  1TLH B;  5BPI A;  4IRH A;  1AOY A;  2XAS A;  2FU4 A;  1SFX A;  2DPU A;  3RPU A;  3LA2 A;  5L3G A;  3RKX A;  1S7O A;  4HX8 A;  1XB4 A;  1JGS A;  5HOO A;  4ASN A;  1DDN A;  5CVV A;  4LLL A;  3HIF A;  4P9U A;  1F5T A;  3RKW A;  3FXR A;  1FSH A;  2O3F A;  4HAM A;  2XKP A;  3JSP A;  4ZYH A;  1I6X A;  2VOD A;  1MDM B;  1AWC A;  1J0R A;  4CHU A;  3DV8 A;  1LEA A;  1LDJ A;  2DTR A;  4RGR A;  1P2F A;  4MHG A;  1WQ2 A;  4Z2Y A;  4WCG A;  1MJB A;  3F8M A;  4IHT A;  3L09 A;  2IP2 A;  2P7V B;  3D0S A;  1S29 A;  3GVA A;  1IRF A;  1YIO A;  2OQG A;  3ZMV A;  1J75 A;  3TOB A;  1X3U A;  2JTV A;  4L9J A;  2ADU A;  3EET A;  1R22 A;  5CVI A;  4L18 B;  3I53 A;  4P96 A;  5FD5 A;  1ON1 A;  3GLX A;  1DP7 P;  2TDX A;  4CZZ A;  2W25 A;  5TRD A;  3ELK A;  4UV9 A;  4Q47 A;  2R3S A;  2M5W A;  4MQV A;  3IWF A;  4HF1 A;  2FNP A;  3JTG A;  1K78 B;  1KU2 A;  2STW A;  5LBQ A;  1FY7 A;  4I01 A;  2WTE A;  1KU7 A;  5FB2 A;  2HS5 A;  4KT5 C;  1SAX A;  2XIG A;  3N4M A;  2EV6 A;  2KIU A;  3T8R A;  1YW7 A;  1A04 A;  3GFJ A;  5ICG A;  4LB6 B;  1DUX C;  3ECO A;  2GXB A;  2VBX A;  3I59 A;  5AIQ A;  3MQ0 A;  2XAQ A;  3BY6 A;  4O6J A;  5H6Q A;  3J81 Z;  4EJT A;  4UUV A;  1YS6 A;  5LRS A;  4M9Z A;  1UHW A;  3LQQ A;  2QBY B;  4P55 A;  1FYM A;  1EV7 A;  2RQP A;  3AAF A;  4EV0 A;  1TQP A;  1ZRE A;  2W84 A;  3E6C C;  5HDG A;  3C3W A;  1RZ4 A;  1LDD A;  3NQO A;  1KQ0 A;  1T39 A;  1RUO A;  2LF7 A;  3C1D A;  4ENJ A;  1U3E M;  2V1D A;  5DUI A;  5LGN A;  1E2X A;  2IRF G;  1HST A;  2QQ9 A;  3M9A A;  1FZP B;  2JSC A;  2R7F A;  3F6V A;  4Q5S F;  3V8L A;  1G3S A;  4TV7 A;  3V7S A;  3H92 A;  5DV5 A;  2ZFW A;  1D5V A;  4KN7 X;  4RS8 A;  3R61 A;  3WTW C;  2O0Y A;  1FLI A;  4EJO A;  1Q1H A;  2DU9 A;  2P6T A;  4XLN F;  1Z91 A;  2K02 A;  3QU6 A;  1OYI A;  1P4A A;  1SD5 A;  1H9G A;  3E6M A;  4OIO F;  3TKY A;  4A2U A;  1D3Y A;  4HV5 A;  2OBP A;  4H0E A;  2HR3 A;  4EJV A;  4LD5 A;  5HLI A;  2O61 A;  4OMZ A;  2GA2 A;  3BJA A;  4OMY A;  2LF8 A;  1DPR A;  1W7P B;  1UST A;  1Z7U A;  4KIC A;  3FM5 A;  1Z05 A;  2P6S A;  1K78 A;  1R5G A;  4HF0 A;  1OR7 A;  1OKR A;  3DFG A;  1GXQ A;  2M8E A;  2DK8 A;  2GIV A;  3EYI A;  3WGG A;  1W7P A;  1FP2 A;  3SZT A;  1W5T A;  3WU1 B;  1XDS A;  3HSE A;  2FE3 A;  3W6K B;  1TTY A;  1YTY A;  1IUY A;  4ZZL A;  2NYX A;  1XN7 A;  2VN2 A;  5HS8 A;  4Y13 A;  2FML A;  1B6A A;  1FT9 A;  2ZO4 A;  2F5D A;  1YS7 A;  3I58 A;  4F7Z A;  1SD7 A;  5DDG A;  4BH9 A;  2L4A A;  3FMS A;  4JK1 X;  2VE8 A;  4PZJ A;  5LHH A;  3BDD A;  2FOK A;  2HZT A;  4HX4 A;  2BV6 A;  4FX4 A;  1QBJ A;  3ZP5 A;  2GAU A;  3F72 A;  3J7A O;  4UV8 A;  1ZHF A;  1XD7 A;  3GZ6 A;  3LA7 A;  5D5X B;  2DW4 A;  3L9F A;  2QYO A;  2V1U A;  5ICC A;  3K2Z A;  2LKP A;  1G3W A;  1SMT A;  2FF4 A;  4Q4Z F;  4OIR F;  4M6X A;  4A6E A;  2XKO A;  4ZZD A;  3WGH A;  5CVR A;  1U5T B;  4BQA A;  3KP7 A;  4JQF A;  1LB2 A;  2ZCW A;  1R1T A;  2J5P A;  2IPQ X;  1YQA A;  4N9I A;  5DEQ A;  2MC3 A;  3I59 B;  4BHP A;  2HYF A;  1O7F A;  5DD8 A;  2HQN A;  1W5S A;  4CDG A;  3HHH A;  1XCV A;  1WRJ A;  1J5Y A;  2E7X A;  2XV4 S;  4M9X A;  4Q48 A;  2CSO A;  2ZNZ A;  2Y0M A;  3GXO A;  3JAM K;  1J7K A;  3TGN A;  3I54 A;  4RGX A;  1C0W A;  5H6R A;  3WE3 A;  1BIA A;  1UCR A;  2DAO A;  3D5L A;  3OOP A;  1G6N A;  1K6O A;  3QOP A;  3LWF A;  2KIF A;  1FSE A;  3GFL A;  2LDU A;  5JFR A;  5E18 F;  2K4B A;  5AON A;  5ICE A;  2CYY A;  1USS A;  5LEJ A;  3KCC A;  5L3F A;  1IN4 A;  3M1E A;  1RIO H;  2ZNY A;  2E1N A;  1MKM A;  5ILV A;  3QRF F;  3EUH A;  4ZH4 F;  1KGS A;  5E1X A;  6PAX A;  3HRU A;  2EJR A;  2X4H A;  1Y0U A;  1O3Q A;  2D2W A;  1MJA A;  1S8N A;  4ENN A;  1E17 A;  3FM3 A;  4KA4 A;  5F6F A;  3L7W A;  4G9Y A;  2P8T A;  2ZME A;  4N9H A;  1WI9 A;  3ULQ B;  4RB2 C;  1QNT A;  2FXA A;  1GVJ A;  2HTJ A;  2KJB A;  1LQ1 A;  1BOA A;  4FT8 A;  5CJ9 A;  2H09 A;  2OQR A;  2VC1 A;  1CGP A;  4EMS A;  2DPD A;  5JHU A;  3C7J A;  2F5E A;  2UZK A;  2EV5 A;  1S3J A;  3HUG A;  3I4P A;  1ZH5 A;  4KIB A;  2OAZ A;  4XSX F;  3FZV A;  4CIC A;  2HFH A;  2Q8K A;  1ZRC A;  4IJA A;  4P5O A;  1KYZ A;  3HYI A;  2ZXJ A;  2GWR A;  1WKM A;  2H6C A;  4HW0 A;  3GWZ A;  1BI3 A;  3RTR A;  3K69 A;  2MD5 A;  5IT9 K;  3MCZ A;  3Q9S A;  2XUB A;  4GYI A;  4LMY A;  3J81 K;  4HLY A;  4CYD A;  1FWZ A;  2ZJ2 A;  4EJW A;  2OZ6 A;  4OIN F;  5JI6 A;  1ZRD A;  4R79 A;  1R36 A;  4L9V A;  3E6D A;  1LEB A;  3ABT A;  4KFC A;  1TNT A;  3COA C;  1JE8 A;  2D45 A;  3QAH A;  5D8K B;  2RN7 A;  2HGC A;  4E70 A;  1U78 A;  1HXD A;  1J2X A;  3J80 Z;  4IRI A;  4IXA A;  2CWE A;  3CJN A;  1O57 A;  3WTT C;  3F8B A;  3U1D A;  3RYR A;  3G73 A;  3P9I A;  1K79 A;  1H0M A;  1SFE A;  4MTE A;  4PDK A;  3IWZ A;  3M7G A;  3WTV C;  5E1Z B;  4AWX B;  5DUK A;  2KJC A;  1ONV A;  2PBI A;  1QPM A;  1JHH A;  2FQ3 A;  4A5M A;  3SFZ A;  5FD6 A;  4IHS A;  4I98 B;  3JW4 A;  1DPU A;  5LRR A;  1ODD A;  1GHC A;  2F5F A;  4U0V A;  4G7Z F;  4MGR A;  3S2W A;  2STT A;  3KP2 A;  1IN5 A;  4MEX F;  3K1M A;  1QZZ A;  1FBS A;  3SQN A;  1XMA A;  1F4K A;  4LFU A;  5FGM A;  3QU3 A;  3GZ5 A;  1K7A A;  2UXX A;  2B0L A;  4PGH A;  2VBW A;  1D8J A;  4GXO A;  2O03 A;  2H94 A;  3EDP A;  3V7C A;  4NHJ A;  2XAF A;  1U8R A;  2IT0 A;  1U6G A;  5F1R A;  1G3T A;  2Z33 A;  2QQA A;  3PQJ A;  2DFI A;  2V1X A;  1SD6 A;  4WXD A;  4ESB A;  5EEH A;  2G9W A;  4YFN F;  4ZYE A;  4FHT A;  3T0Y A;  1HKS A;  2CGP A;  2L3D A;  2EB7 A;  3RIR A;  3SZP A;  4DQ2 A;  2EFW A;  1P4X A;  5ED4 A;  1NHA A;  3CUO A;  4BXU A;  3F22 A;  4ESF A;  1RUN A;  5K5R A;  2RVC A;  4P9F A;  4I0B A;  3HRM A;  4HX7 A;  5ILU A;  1EH7 A;  2OA4 A;  1EH6 A;  3DF8 A;  1YG2 A;  1BC7 C;  1HW2 A;  3FWE A;  4LK0 F;  3CO7 C;  2JZY A;  3DP7 A;  1PUE E;  3VB2 A;  2PMH A;  3V8J A;  3TQN A;  4U0Y A;  3VEP A;  1IXR C;  5D4R A;  1OYY A;  4A0Y A;  2KIM A;  3ISP A;  3LAP A;  2RC4 A;  3KP4 A;  1KQ9 A;  2FBK A;  3TO6 A;  2ELH A;  2UWM A;  5E20 A;  1IW7 F;  2W24 A;  1U2W A;  3KFW X; 
#chains in the Genus database with same CATH topology
 1Y1W J;  3BP8 A;  2Y2Z A;  2FRH A;  3MKZ A;  1BL0 A;  5EG0 A;  3ECH A;  4A3G J;  4RAF A;  2P0T A;  3L2Q A;  4AIH A;  3EQL F;  2HKO A;  2K9M A;  3S3N A;  3A1Y A;  1JT6 A;  3HRS A;  2EFO A;  1HBX G;  2J5O A;  3AG2 H;  2FMY A;  2R7W A;  2AS5 F;  3VYR B;  3W2V A;  1FMV A;  2X98 A;  1FOK A;  4XOR A;  1P6R A;  4I0A A;  3DQV C;  3QP6 A;  3K10 A;  1ZG3 A;  1GV2 A;  1S9H A;  2AQF A;  1YFH A;  2HNH A;  4X1E A;  3ZQH A;  5DS9 A;  3TDZ C;  1E3H A;  3ZMD A;  4B09 A;  2A61 A;  3B6C A;  3HSR A;  4YFX F;  2DMP A;  3HPH A;  3K1P A;  3OYD A;  4DIQ A;  1V5G A;  1OLT A;  1WJC A;  2A68 F;  3GTO J;  1G2H A;  4UVB A;  1T0F A;  5FKL A;  3JAM Z;  3Q9V A;  5F08 A;  4BJT A;  3ZPL A;  4NQW A;  1T38 A;  3MAJ A;  3C2G A;  4GYG A;  4N0B A;  3OYC A;  4J01 A;  3RZD J;  2NVQ J;  2EQR A;  2MFZ A;  3Q0W A;  2AO9 A;  1TW2 A;  5DCF A;  1GXP A;  1D0Y A;  3DKW A;  3OYB A;  2ICW G;  3W6V A;  1Z77 A;  4K2E A;  4PJL A;  4QLC U;  1IV8 A;  2K4J A;  1FBQ A;  2WV1 A;  1R4N B;  1Z0X A;  2CS3 A;  3KLO A;  1QQI A;  3MWM A;  2OTJ I;  4BQN A;  3IL2 A;  1IN7 A;  5K1Y A;  2LD5 A;  3G71 I;  1Z1D A;  2CQK A;  4HLX A;  5LHI A;  1S7E A;  1B1B A;  3I64 A;  3JSO A;  4Y33 A;  2QKM B;  3CCL I;  3DBL B;  3PFY A;  3E5U A;  2L7K A;  3O8G A;  4ESJ A;  4MQ9 F;  4ENK A;  3B02 A;  2WAQ N;  3PQK A;  3RYP A;  1W36 C;  3FX3 A;  3MZY A;  4RM3 A;  3W3C A;  5L3B A;  1ON2 A;  4KNY A;  2V9K A;  3ABU A;  5EEG A;  2LSO A;  1IN6 A;  5CVJ A;  1ERD A;  4O5V A;  1K4T A;  2PJP A;  1POG A;  2MSY A;  4B48 A;  3RKY A;  3P9C A;  1BR2 A;  3DEE A;  5ILS A;  4X6A J;  2DLL A;  5B5E C;  5JHF A;  1W4M A;  1Z9C A;  5GTI C;  3MFK A;  1S72 I;  5HS9 A;  9ANT A;  1J59 A;  1MW7 A;  3M3Y J;  5H20 A;  5F1J A;  1OMI A;  4G94 A;  3HOW J;  1YOV B;  1WJB A;  5L3D A;  2HXO A;  2K27 A;  3HHG A;  3SHF A;  5K7F A;  4XLE A;  2WAD A;  1F1Z A;  4M71 A;  4U87 A;  2VAS A;  3FBI B;  4I02 A;  3QP5 A;  4CGZ A;  2K3P A;  2E1C A;  1Z6T A;  2M1B A;  2XGD A;  3E3V A;  3RCO A;  4A3K J;  1SD4 A;  4A0Z A;  3JRI A;  1YW8 A;  1QZE A;  2ESH A;  3BZC A;  5B1B H;  3MKY B;  4PCQ A;  3GFI A;  2BXY A;  4D0P A;  3CMA I;  3E6B A;  3WGI A;  1WWX A;  2VT2 A;  3BC8 A;  3DPT A;  2IGO A;  1R5H A;  3K4K A;  4GGG A;  4RDU A;  3LA3 A;  1XDU A;  1YX3 A;  3LSJ A;  4WF2 A;  2EK5 A;  1YO5 C;  2BY1 A;  3KYL A;  4ZDP A;  4CA0 A;  4BGD A;  4XKV A;  4I7H A;  4XNF A;  4AIJ A;  4KIS A;  4F93 B;  5LHG A;  3K9T A;  1W1W E;  1EF4 A;  4G6T B;  3IKT A;  1DGR M;  4G8X A;  5E8G A;  1HW1 A;  3WTS C;  3KIO A;  5JR3 A;  5E8I A;  5IP7 J;  1FTZ A;  1HOM A;  1LDK B;  3OYE A;  3EYY A;  4WWC A;  3HBL A;  2DOD A;  2ZME C;  5EGO A;  2HOS A;  3F6O A;  3GFM A;  3GBG A;  1RKT A;  1U5T C;  3TDU C;  3KET A;  3O2P E;  3VYU B;  3H35 A;  3ZQC A;  3WTY C;  1LFP A;  3KP5 A;  5HS7 A;  2HKX A;  4NC6 A;  1XGM A;  1LE8 B;  4IVN A;  4LJZ F;  3WU2 C;  3S3O A;  1V4R A;  5C4X J;  3LMM A;  2IGN A;  3PNY A;  3CCU I;  3G3Z A;  4ON0 A;  4AVP A;  2KKO A;  4M6Y A;  1ZR2 A;  4MO7 A;  4E7S A;  2LOO A;  1TNS A;  1X3Z B;  2H1L A;  4IRG A;  1RI7 A;  3BR5 A;  2QA4 I;  3BR2 A;  1MJ9 A;  2A3S A;  2CUJ A;  4A3F J;  3D5R C;  5IT9 Z;  2UV1 A;  1PP7 U;  2PJR B;  3ZQG A;  2DI3 A;  3CUQ C;  1I27 A;  2TCT A;  4XM3 A;  2EFN A;  5FLX R;  1NK3 P;  4IKF A;  3DBH B;  5IT3 A;  5L3E A;  1B72 B;  1QZY A;  3H3Z A;  2K9S A;  3BG6 A;  4HOB A;  3KX2 A;  1E3O C;  3MKL A;  1AKH B;  4AYB N;  5FLX K;  2A6H F;  2DT7 B;  2LY9 A;  2ZBK A;  2JA6 J;  3O6B B;  1KQ8 A;  4B8X A;  3F21 A;  2OD5 A;  2Z9O A;  2BEO A;  2E71 A;  1X4O A;  2HEO A;  2VKD A;  4OAZ A;  3BOQ A;  2PN6 A;  2JSP A;  4U0W A;  1JUP A;  2E19 A;  5FRN A;  2FOW A;  4PSX A;  1TP4 A;  3T1B A;  3J7A W;  1WJ5 A;  4HV6 A;  2IVM A;  1JKP C;  1VND A;  3U9G A;  2L02 A;  4Y3O A;  2ISZ A;  2JN6 A;  2IJL A;  2CH0 A;  2MLK A;  1XG1 A;  1TW3 A;  1XSV A;  3IRR A;  4UY8 I;  4JX4 A;  3VPR A;  4I09 A;  4A0X A;  2NOG A;  4HA8 A;  1XX5 A;  3I56 I;  4HQE A;  2NVY J;  2DK5 A;  3WG9 A;  1IF1 A;  2H8W A;  2IS4 A;  1HF0 A;  2DA4 A;  4XIC A;  1VI0 A;  2DOA A;  4MTD A;  1JKQ C;  2WBM A;  2HOE A;  2TRT A;  4WXH A;  2QVO A;  2L4M A;  3DTI A;  4A3I J;  3ML6 A;  2KL4 A;  3A52 A;  1D1B A;  1TBX A;  4XL9 A;  4DZP A;  1VQK I;  5GTH C;  2XGC A;  2PFB A;  1BJZ A;  1OCP A;  3BR0 A;  5HLG A;  4ENM A;  2IS6 A;  1K6Y A;  5AIP A;  3Q5F A;  4XMY A;  3V7R A;  4YIF A;  1GLN A;  2KQR A;  2CG4 A;  2RGV A;  4Z6Y A;  1VQ9 I;  2DN0 A;  2P4W A;  2GM4 A;  3ZR8 X;  1IDZ A;  3PSF A;  3LNQ A;  4BXX J;  5FLM J;  2FNA A;  2PMZ A;  1BR4 A;  4BS9 A;  5M5W J;  1HSJ A;  2A6T A;  2Y75 A;  2HQR A;  4M3B A;  1B59 A;  1ZGA A;  1IXC A;  2E60 A;  1SFO J;  4G7O F;  1GDT A;  3TOA A;  2FBH A;  2VQH A;  2XF7 A;  4XRF A;  5CLS A;  1RR8 C;  1MDM A;  2DFE A;  2V1N A;  2CU7 A;  2KT0 A;  2I10 A;  2NNN A;  3TW7 A;  5J8F A;  3PJR A;  4LOC A;  2YR2 A;  3PNT A;  1STZ A;  2V9P A;  3FMQ A;  3FHZ A;  2XB5 A;  1LPQ A;  3BT9 A;  2N8G A;  3OR1 C;  4M3D A;  5C3E J;  5D8L B;  1BJA A;  3OWT A;  3U2R A;  3LAJ A;  2EH3 A;  2XF6 A;  3KP6 A;  1LJ9 A;  3F0C A;  4FIS A;  1U8B A;  2DBB A;  4HNU A;  2ZJR F;  1H88 C;  5H2F C;  2V9V A;  2LYC A;  1ZTR A;  4U7B A;  4MNU A;  5KAI C;  4G7H F;  2M7A A;  1ZGJ A;  3ZQF A;  4IL6 C;  4E7J A;  2NXN B;  2XPW A;  2MVT A;  2YX4 A;  3BR6 A;  2DA2 A;  1UG0 A;  3LL7 A;  2O6G E;  1WCM J;  2DCE A;  1KU9 A;  5D6E A;  2ZSI B;  3BZ6 A;  2JK3 A;  1I3A A;  2DYS H;  2L9V A;  1HQC A;  4KIT B;  4M9S A;  1TQI A;  1IZ1 A;  4PJ0 C;  5CVU A;  4EVI A;  1OPC A;  5ERI A;  1NG7 A;  1GVD A;  1U9N A;  4LG3 A;  5M5X J;  4O3M A;  1MSF C;  1UAA A;  1ETK A;  3IP4 B;  2Z16 A;  2QWW A;  4BY7 J;  1KU3 A;  3GUD A;  2Y9Z A;  4BUP A;  1VQ4 I;  2R7U A;  5GAG J;  5KVR A;  1I1S A;  2F2E A;  2R7D A;  3S16 J;  3BJ6 A;  3JRE A;  3A0H C;  1SFU A;  1QGP A;  3F3X A;  3GTP J;  2AXT C;  4XBF A;  3DKY A;  2NS7 A;  3BQY A;  3F8C A;  3ZMS A;  3A01 B;  4M3E A;  4ANJ A;  2EV0 A;  3MEX A;  3R6S A;  4CO8 A;  4XQF A;  4XKB A;  4PJJ A;  4V2F A;  3JCU C;  4UNO A;  1L0O C;  4M72 A;  3JRC A;  4BDY A;  5F0H A;  1ZRF A;  3FIW A;  3IRQ A;  2ZKZ A;  1ZYR F;  2L2O A;  3KYC B;  5JVT A;  2VT3 A;  1ZQ3 P;  4CUG A;  1JT0 A;  4CZC A;  2FA5 A;  1JHF A;  1P92 A;  2ELK A;  3BRO A;  2HOA A;  4L9T A;  5BMZ A;  1I1G A;  4I99 C;  3V8K A;  1FOX A;  4FX0 A;  5J47 A;  3IHU A;  1MBK A;  4L0Y B;  1P7I A;  1R71 A;  4LLG F;  5E1W A;  2DT5 A;  3ZQ7 A;  5LGU A;  4EM1 A;  4UHT A;  2NVX J;  3H1C A;  4LG0 A;  5D4S A;  1IXS B;  5KHD A;  1R49 A;  4WX9 A;  2DYR H;  3CCE I;  3OYI A;  2GZW A;  1I5Z A;  2F5C A;  4B1R A;  3GX4 X;  2A6E F;  3I0T A;  3R0A A;  2RNJ A;  4GCV A;  4OOI A;  1E3P A;  3S8P A;  4QWQ A;  1SEU A;  5DCM B;  4CCN A;  2CFO A;  1U5T A;  2CW7 A;  4KIF A;  5D5V B;  2R7R A;  1HW5 A;  4Y15 A;  4I6Z A;  1HKT A;  1CF7 A;  3V4G A;  2Q0O A;  3PM1 A;  3GF2 A;  2XAG A;  2A69 F;  1TWG J;  1IGN A;  2E34 A;  2V79 A;  2DXI A;  3S2D J;  2FEZ A;  4NB5 A;  2PQ8 A;  3FXU A;  1X1C A;  5CYV A;  2G7U A;  4PFO A;  2K9L A;  3MZH A;  3FF5 A;  4UXN A;  1WPK A;  4ZYG A;  2FBI A;  2W48 A;  3D5S C;  2IA2 A;  2B7E A;  3UNG C;  3H0G J;  3RPU D;  2H1K A;  4HZF A;  4YEJ A;  2H6B A;  1S7A A;  4MEY F;  4OIQ F;  2ETH A;  3A4C A;  2YPR A;  3N97 A;  1SVO A;  2HDD A;  1IAW A;  2BBY A;  1P7J A;  3QPT A;  1D0Z A;  1T2K A;  4XKW A;  1P9Q C;  2P0W A;  3K1N A;  3K4L A;  4Y4R A;  1W7P D;  1X4P A;  2QEN A;  2GQQ A;  2AXL A;  1FIP A;  3HSF A;  2XVC A;  3EUH C;  1X1P A;  1YYV A;  1G59 A;  2JMW A;  3K2A A;  4B47 A;  5BPD A;  1FPQ A;  2M34 A;  2QQB A;  2OU2 A;  4PUS A;  4NBQ A;  2PI0 A;  2CJJ A;  3ZQI A;  1DP3 A;  4DGW B;  4LK1 F;  3CDH A;  3CDI A;  3GW2 A;  3NRV A;  4Y17 A;  4PGG A;  4A3D J;  1MZB A;  4LGW A;  2UUZ A;  2MLG A;  4U88 A;  2W85 A;  4AYB A;  3VWB A;  1ETO A;  4EGY A;  2F4I A;  1Y56 A;  2VKE A;  4DNC A;  2OZU A;  5LEK A;  2K7L A;  3KEQ A;  3X2Q H;  4XLF A;  4RGU A;  4IPA A;  3ERE D;  4AIK A;  1MIJ A;  3ZXS A;  2L54 A;  5JLW A;  3C2B A;  2KHM A;  3ZN1 A;  2Y0S A;  2XC7 A;  1IRZ A;  1V3F A;  5GAD J;  1BIB A;  2MW8 A;  1SVM A;  2JA2 A;  3HM5 A;  3O3K A;  2NAZ A;  5K7H A;  4QTR A;  3KE2 A;  1OYW A;  1VQ8 I;  3M8E A;  4P1W A;  3ABL H;  3IUO A;  3M8F A;  5BOX A;  3VFZ A;  2RKH A;  2L9N A;  5K5O A;  2X85 A;  4DOZ A;  1E0E A;  4M74 A;  1WSU A;  3RDI A;  4XID A;  3E5Q A;  1O3S A;  4D1Q A;  3NEU A;  5HDN A;  4A5N A;  2IXS A;  2Y9Y A;  5DTD A;  5A2Q K;  1JXS A;  3T5X A;  3U1K A;  4DJA A;  4QPQ A;  1WJE A;  4XOP A;  5EYR A;  1H9T A;  3L2C A;  3VOD A;  5CQE A;  2K86 A;  1R6R A;  5ICF A;  4HQM A;  3JRF A;  1FYK A;  4BHB A;  4XLH A;  2OPT A;  2CUE A;  4KMU X;  5L3C A;  5M5Y J;  3GO5 A;  1XSD A;  3BTL A;  2HVQ A;  3SYT A;  3KZY A;  3MD2 A;  2OC6 A;  3I5U A;  3QPH A;  3KLN A;  2YU3 A;  1HC8 A;  3GTM J;  2KRF A;  3WE2 A;  3S32 A;  5E17 F;  3KFW X;  2PEX A;  5J8C A;  3OMY A;  4BDZ A;  3VYT B;  3HRT A;  5FKK A;  3J80 R;  2EIK H;  4BE1 A;  3IC7 A;  2HYJ A;  1BBY A;  2B63 J;  1HA8 A;  3OYF A;  2VON A;  1XSX A;  3ZMZ A;  2FSW A;  3RJP A;  2ZJP F;  3B73 A;  4BQO A;  2WWY A;  2QF7 A;  4BNC A;  2OJE D;  4HF2 A;  1XPX A;  4ABZ A;  3DEU A;  1BI0 A;  1R1U A;  2K5C A;  1YRN A;  3WOD F;  2JUC A;  3MVP A;  2NVU B;  4KMF A;  3TO7 A;  4V2G A;  1RNL A;  2VJ4 A;  1CF7 B;  3WTU C;  4R8H A;  3ZCO A;  4RB1 A;  2QKL B;  1JTX A;  1YW9 A;  3R0J A;  2RV8 A;  1UHS A;  4L9N A;  3GYH X;  3BQZ A;  5D5W B;  2XRO A;  2LY2 A;  1YJ9 I;  1UB9 A;  3BG3 A;  2BHZ A;  2VJI A;  3FMR A;  5E3L A;  2JT1 A;  2MC4 A;  2HDC A;  1W0T A;  3A03 A;  3CLO A;  2E1M B;  5CQG A;  2DQL A;  2V6E A;  3SEZ A;  3BPV A;  2ZME B;  3GEZ A;  2IA0 A;  2OUM A;  3ZMU A;  3OYL A;  2HTS A;  2MD0 A;  2VOO A;  2F4O B;  3PNV A;  3F8F A;  2MBF A;  1ETX A;  2IBD A;  2CQQ A;  4GO1 A;  3SFI A;  1XGN A;  2OF7 A;  3W6J B;  1FMW A;  1S6L A;  2XAH A;  5IP9 J;  2BE5 F;  3NAR A;  3LQR A;  3BPX A;  1DU6 A;  1VQ7 I;  2KP6 A;  3HOS A;  1SMY F;  4L5J A;  5E79 C;  5J1U A;  2EZH A;  1QHH D;  1IRG A;  1N75 A;  4WXC A;  4YFK F;  1IC8 A;  1TQM A;  5EG0 B;  3HXL A;  3K7A J;  3JTH A;  2VXZ A;  3M07 A;  4HST A;  4CCM A;  1ENH A;  5HDK A;  1MMS A;  2KZV A;  4EGZ A;  5IYB J;  1JKO C;  1ULY A;  2VC0 A;  4KT6 A;  4UVA A;  1YIT I;  3ROU A;  2I8D A;  3J80 K;  2IA1 A;  4HYE A;  1ZAO A;  1XS9 A;  3OIQ A;  1ZG1 A;  3AFH A;  2HDW A;  1I3Q J;  5LGT A;  2EBI A;  3CC2 I;  3O8H A;  3R60 A;  4L5I A;  1RKW A;  2L7Z A;  1BW6 A;  2WC2 A;  4DYC A;  3DTE A;  2YX7 A;  1IDY A;  5BQT A;  4JX6 A;  2F6C A;  5HLH A;  5LFA A;  4RGS A;  4XRS G;  5K5Q A;  3PO3 J;  4DW6 A;  3J7Y J;  4N4N B;  4GRI A;  2D1H A;  4XLP F;  2X1E A;  3A01 A;  4PJM A;  3OYM A;  1PP8 F;  2GXG A;  4KDP A;  3S2H J;  2O8K A;  2VE9 A;  4MFE A;  3WG7 H;  4IHY A;  5HOD A;  3CTA A;  3C18 A;  2EA4 A;  3BTJ A;  3LSH A;  1OIS A;  3G4S I;  2NNY A;  4RLQ A;  3P7N A;  4IOA F;  1FNN A;  2DFH A;  3F8N A;  2ID6 A;  1O7L A;  5CPR B;  5FFZ A;  1VTN C;  3BCB A;  2UXN A;  2XAU A;  2VLA A;  4AD9 A;  4BAY A;  5E3O A;  1FP1 D;  2MH2 A;  3K6G A;  2JPB A;  2QCO A;  3I71 A;  3GLL A;  3PIP F;  2EIL H;  1VQP I;  2HQ5 A;  1UG2 A;  1R58 A;  4C2M J;  2E2J J;  2ID3 A;  3ZOB A;  3VDX A;  2ZC2 A;  1N77 A;  3SJM A;  2A07 F;  2X0L A;  3BTC A;  3QYB A;  1Y39 A;  3CCM I;  5FJ8 J;  3CCJ I;  3IKV A;  5F04 A;  3KPH A;  3IV5 A;  2PLY A;  3DEW A;  4AC0 A;  2KIQ A;  1WJF A;  5HVQ C;  2K3F A;  3K70 C;  3LSG A;  4LLN A;  3CMY A;  5D6F A;  4F52 A;  1O3R A;  2VBZ A;  3S93 A;  1REP C;  3RPQ A;  1PDN C;  2Z99 A;  1X3W B;  2FX0 A;  2FJ1 A;  1QO0 D;  1Z6R A;  5DYM A;  3DTK A;  2JA7 J;  1BOB A;  2VKV A;  4HDU A;  3IH3 A;  3HOV J;  3ZMT A;  3CP2 A;  4HDV A;  3HTS B;  5A2Q Z;  1XMK A;  1W5C C;  3OV8 A;  4EQQ A;  1TWF J;  4KUM A;  3CUQ B;  3A2K A;  1BC8 C;  1JTY A;  5F64 A;  2PX9 A;  3HOZ J;  1OCZ H;  1ORK A;  1B4A A;  2M9H A;  2P5L C;  3HZJ A;  1ZLJ A;  2H8R A;  3HJE A;  3HUG B;  2QBY A;  2E35 A;  4YIR X;  3E0J B;  3BTI A;  2L0K A;  3ZN0 A;  3CP8 A;  2XDV A;  2BXZ A;  2IS1 A;  3LSK A;  4ZTF A;  2M45 A;  4CSW A;  2HYG D;  4F91 B;  1FX7 A;  4HPQ A;  4NC8 A;  2LKS A;  2DO7 A;  2CQX A;  4EM2 A;  3UR3 C;  2P5K A;  4BHC A;  2P7C B;  4E7H A;  1LKX A;  4PJN A;  4BYY A;  3S15 J;  5FKO A;  3S14 J;  1XGO A;  5DM7 F;  3G6E I;  2XRL A;  2NRA C;  1JGG A;  2VUM J;  2V26 A;  4L5E A;  2Z5U A;  5LLQ A;  2ESN A;  3VOE A;  4KIG A;  2ZXI A;  3SZG A;  1D5Y A;  2COM A;  2BYV E;  1OCO H;  1R00 A;  5EEA A;  3T8T A;  4J19 A;  2Y48 A;  3E5X A;  4XLC A;  3F23 A;  3CO6 C;  1HLV A;  3JR9 A;  1KA8 A;  2ZFU A;  5IPA A;  4ZJZ A;  4M73 A;  1FC3 A;  2XRN A;  3R4K A;  4C3H J;  3I55 I;  1IN8 A;  1FYL A;  3KEO A;  1MD0 A;  5DD4 A;  1B9N A;  1ZN2 A;  3K0L A;  3H36 A;  2K9N A;  3QYF A;  5KK1 A;  4EAT A;  3CJQ B;  1YLF A;  1J9I A;  3VYS B;  2WV0 A;  2VOP A;  2LNB A;  3S1Q J;  1D8K A;  2E2I J;  3ESW B;  2WAQ A;  4GFB A;  1QA6 A;  3PUF A;  2D5V A;  4B3X A;  3L2W A;  3SDG A;  2D1V A;  1ACI A;  2GLO A;  1L3L A;  2ISY A;  2O8X A;  2RDP A;  5KCM A;  4OIP F;  4EM0 B;  2H27 A;  2PMU A;  4OAY A;  2A5W A;  2XGX A;  3L00 A;  3WTX C;  1B9M A;  1A6I A;  2W82 A;  1T6S A;  3CF2 A;  1ZAR A;  1X2M A;  3ZRG A;  3P9K A;  3BZK A;  2EFQ A;  2QZ8 A;  1FBU A;  1UHM A;  2M87 A;  1T0F C;  3WU0 A;  4A12 A;  4YII A;  1X19 A;  2Y69 H;  5D5U B;  2QSF X;  3BG9 A;  4RAZ A;  2LBF A;  3HGG A;  4D9J A;  4S04 A;  2G7H A;  2Q2E A;  1R23 A;  2V6C A;  3FK7 A;  3CUQ A;  1LUJ B;  4AVZ A;  2KDO A;  4XLA A;  2IGK A;  5DCM A;  5TJJ A;  2C6Y A;  1JUM A;  2AHQ A;  5TIS C;  4ETS A;  1F9N A;  1PYV A;  1XGS A;  2EZK A;  1X1D A;  3WHC A;  3OYG A;  2EIM H;  2Z3Y A;  1R4M B;  4WK8 F;  1BN5 A;  3AL0 C;  1PUF B;  2Q1Z B;  2VJJ A;  5EZH A;  4IZZ A;  3E97 A;  2DQR A;  2CO5 A;  2QLZ A;  3Q0U A;  2HI3 A;  5FFX A;  2R93 J;  4KN4 X;  1MGT A;  5IY5 H;  3HOT A;  4EJU A;  2BVL A;  3LFK A;  1RPW A;  1G4D A;  4CXF A;  1EJ9 A;  3KP3 A;  4LG0 B;  2QM3 A;  4ITV A;  2EIN H;  2ACJ A;  4HBL A;  4BJ5 C;  4HEA 2;  3S1M J;  4LB5 A;  1V54 H;  1ZG5 A;  4UUS A;  2O7O A;  1IV6 A;  3DPL C;  3BJO A;  1B8I B;  1LVA A;  2MZ4 A;  2NS0 A;  4RAY A;  1BI1 A;  1FOW A;  3SXY A;  2Y30 A;  2BGC A;  1HKQ A;  3DXJ F;  4C2U A;  3HPG A;  4S05 A;  2Q2E B;  4YG2 F;  2QEX I;  1GT0 C;  2HXI A;  1W0U A;  2QUF A;  3AG1 H;  4L0Z B;  1RRJ A;  3GTQ J;  2IAI A;  3RI4 A;  1VQN I;  5GAH J;  2WY7 Q;  4JP0 A;  2VQG A;  1MBF A;  2KFD A;  2HWV A;  2I5U A;  4Y7N J;  3GTG J;  3LST A;  4XOT A;  2EWN A;  5BS6 A;  1VQ6 I;  2P5V A;  1BI2 A;  3WTZ A;  5FLX Z;  1R1V A;  2VBY A;  3REO A;  4A6D A;  5FO5 A;  2YU9 J;  1S5L C;  2JPC A;  1R7J A;  4A3J J;  4PFP A;  3H3U A;  3H5R A;  2MH9 A;  1QVT A;  2XAJ A;  5GPA A;  2L01 A;  1XCB A;  4G6Q A;  1MH4 A;  4XSZ F;  2GA1 A;  2OCC H;  1BM9 A;  1TZL A;  1EH8 A;  2M0C A;  5J6X A;  2JWT A;  3PFI A;  1G3Y A;  1P4W A;  5B66 C;  1HDP A;  1KYW A;  2GOM A;  4IF4 A;  4IQ4 A;  1ETW A;  2W57 A;  2XHK A;  4KYW A;  4G6D A;  1VF9 A;  3KZZ A;  4OU0 A;  5J1Y A;  2W1O A;  3QWL A;  2JRT A;  3TP0 A;  3VSK A;  4IX7 A;  4ZYD A;  4U7D A;  1T98 A;  1UFM A;  3HTU A;  2MA3 A;  5FRO A;  1O3T A;  1ZLK A;  4B3A A;  2EA2 A;  4R1H A;  2DJI A;  4RB0 A;  4JBA A;  3TO9 A;  3BWG A;  3HOX J;  4RB3 C;  3OS0 A;  2YSR A;  3MZ8 A;  3K4M A;  2CMP A;  2F48 A;  3F9K A;  2EZL A;  2BY0 A;  1N78 A;  2HPM A;  4C3J J;  1Y0N A;  2A5Y B;  2CW8 A;  4J00 A;  1GV5 A;  1WVR A;  2CW0 F;  2M30 A;  2VPL A;  2E7W A;  2PG4 A;  2M35 A;  1IG7 A;  2CFX A;  3FXQ A;  2IW5 A;  4UVC A;  4B43 A;  4I2O A;  1LNW A;  2HZD A;  1TLH B;  5BPI A;  4IRH A;  3WHB A;  4F55 A;  1MBE A;  1AOY A;  2XAS A;  3IAM 2;  2DMT A;  1Z67 A;  3BG7 A;  2FU4 A;  1SFX A;  2DPU A;  3HGY A;  4FE4 A;  3RPU A;  3LA2 A;  4BEH A;  5IOZ A;  5L3G A;  3CCQ I;  2X6O A;  3RKX A;  1S7O A;  4HX8 A;  1XB4 A;  4KJZ A;  2COB A;  4RMN A;  1JGS A;  1NK2 P;  4IQJ A;  1MBJ A;  3ABM H;  5HOO A;  4ASN A;  3HB9 A;  3JRD A;  1DDN A;  4NC7 A;  1J09 A;  2HVR A;  5CVV A;  4LLL A;  2JQ7 A;  2VJ5 A;  3HIF A;  3ZGK A;  4P9U A;  5EJC A;  4CCJ A;  1F5T A;  3RKW A;  1YI2 I;  3FXR A;  4ZDL A;  1F36 A;  2O3F A;  4HAM A;  2GXA A;  1FSH A;  2XKP A;  3JSP A;  3TBI A;  4A3C J;  4XK4 A;  2LTP A;  2DDB A;  4ZYH A;  1I6X A;  1DGW Y;  5F27 A;  2X51 A;  1JKR C;  2MYS A;  2VOD A;  1MDM B;  4ZYA A;  2ZXH A;  2W7N A;  1AWC A;  3G2B A;  1J0R A;  4CHU A;  2MAB A;  3DV8 A;  1FEX A;  1LEA A;  1LDJ A;  2DTR A;  3CCR I;  4RGR A;  2R7T A;  1LFB A;  2BY2 A;  2Y31 A;  1P2F A;  4MHG A;  3RQI A;  2E36 A;  5EF6 A;  1WQ2 A;  4Z2Y A;  5J1R A;  4WCG A;  1MJB A;  3EPZ A;  1R9T J;  3F8M A;  1B8I A;  4IHT A;  3L09 A;  2IP2 A;  2P7V B;  3D0S A;  3TW6 A;  3GTK J;  1S29 A;  1MND A;  3GVA A;  1IRF A;  1TT5 B;  2R7O A;  1YIO A;  2OQG A;  2BHY A;  1Z3Y A;  3ZMV A;  1JJ6 C;  1J75 A;  4GDF A;  3J7Z I;  3TOB A;  1X3U A;  2JTV A;  3H5N A;  4L9J A;  2ADU A;  3EET A;  1R22 A;  5CVI A;  4L18 B;  3I53 A;  4P96 A;  2ZJQ F;  5FD5 A;  1ON1 A;  3GLX A;  3OS1 A;  1DP7 P;  2TDX A;  1CQT A;  4CZZ A;  1IRX A;  2W25 A;  1R5I D;  2M4K A;  5TRD A;  3ELK A;  3DCF A;  4UV9 A;  4Q47 A;  2XSJ C;  2R3S A;  2WY8 Q;  2P81 A;  3H9G A;  5EGO B;  3OYJ A;  2ZB9 A;  2M5W A;  4A93 J;  4MQV A;  3IWF A;  4HF1 A;  2FNP A;  4XON A;  3ASO H;  3PIO F;  3JTG A;  4AM3 A;  1K78 B;  3MKW B;  3KZI C;  2B9S A;  3OR2 C;  3RQ4 A;  4MLO A;  1KU2 A;  2STW A;  2LVS A;  5LBQ A;  2W4S A;  3E1S A;  1FY7 A;  1TWA J;  4I01 A;  1FJL A;  2WTE A;  1OJL A;  1KU7 A;  3EUK L;  2NVT J;  5FB2 A;  3AKZ A;  2K40 A;  3CME I;  2HS5 A;  2LG4 A;  3BCA A;  4KT5 C;  4BKX A;  1XMX A;  1SAX A;  1PVE A;  2JUG A;  2XIG A;  3N4M A;  2LFB A;  4HNT A;  5IOY A;  2EV6 A;  3K4C A;  1MNE A;  5B1A H;  3OSG A;  4C2T A;  5IT9 R;  2KIU A;  3T8R A;  1YW7 A;  1A04 A;  3FXO A;  3L2U A;  1ZGW A;  5GP9 A;  3CC7 I;  3GFJ A;  4FAS D;  4HNV A;  1H8A C;  3LOC A;  5ICG A;  2XSD C;  4LB6 B;  1DUX C;  3A0B C;  3ECO A;  5LD2 C;  2GXB A;  3KEY A;  2R7Q A;  2VBX A;  3FBN B;  3I59 A;  5AIQ A;  4HRI A;  3K4J A;  3MQ0 A;  2XAQ A;  1T33 A;  3BY6 A;  2X1D A;  5GPC A;  1O4X A;  2IS2 A;  4O6J A;  2M4G A;  4QPO A;  5H6Q A;  3J81 Z;  4EJT A;  4UUV A;  3OL3 A;  1JUS A;  3J7A Y;  2O9L A;  1YS6 A;  5LRS A;  4M9Z A;  1IJW C;  1UHW A;  2K9Q A;  3LQQ A;  2KRH A;  1SAU A;  2GIZ A;  2OCE A;  2QBY B;  4P55 A;  1YRN B;  4I76 A;  1FYM A;  2R0Q C;  3M4O J;  1EV7 A;  2RQP A;  2ZXW H;  3AAF A;  4EV0 A;  1TQP A;  1W36 D;  3NAU A;  3FK6 A;  4N4O B;  1BA5 A;  2FQ4 A;  4LIV A;  3UKG A;  1ZRE A;  2W84 A;  4H4K C;  3E6C C;  5HDG A;  3C3W A;  1U0J A;  1RZ4 A;  1LDD A;  3NQO A;  2L9R A;  1KQ0 A;  1YE9 A;  3DU5 A;  2VI6 A;  2NOJ B;  3HKZ A;  1T39 A;  1RUO A;  3Q0V A;  2LF7 A;  4IOC F;  3C1D A;  3CF5 F;  3LSR A;  3RKQ A;  1ETV A;  4FCY A;  3CC4 I;  4ENJ A;  2DT6 A;  1U3E M;  2V1D A;  4BU2 A;  5DUI A;  5LGN A;  1E2X A;  3E7L A;  2IRF G;  1HST A;  2DDA A;  2F5V A;  3ERM A;  5TGT A;  4NDL A;  4ZTJ A;  3Q3S A;  2QQ9 A;  3M9A A;  5FRM A;  3OYK A;  3CDL A;  1VQL I;  5F0C A;  1FZP B;  2JSC A;  2R7F A;  3F6V A;  4Q5S F;  3V8L A;  1G3S A;  2DA7 A;  3CCY A;  3MN2 A;  4TV7 A;  4XN3 A;  2Z1D A;  3V7S A;  1FTT A;  3H92 A;  5DV5 A;  2RRE A;  4M6V A;  2ZFW A;  4IO9 F;  1IUF A;  1D5V A;  4KN7 X;  4QSH A;  3CCV I;  4RS8 A;  1N25 A;  2CUF A;  1SVL A;  3R61 A;  4UUS B;  1V5F A;  3WTW C;  2O0Y A;  1FLI A;  3GZN B;  3FXL A;  4EJO A;  1VQ5 I;  1Q1H A;  1RC9 A;  2DU9 A;  2P6T A;  3H9Q A;  1X1A A;  4XLN F;  5KAF C;  2JA8 J;  1MMD A;  1TWC J;  4JX5 A;  4JYK A;  1Z91 A;  2K02 A;  1X1B A;  3FDY A;  1OYI A;  1P4A A;  3QU6 A;  3FKI J;  1SD5 A;  1H9G A;  3E6M A;  1PJR A;  3TKY A;  1LE8 A;  2HOT A;  4OIO F;  4A2U A;  1AKH A;  1D3Y A;  1YX5 A;  1T8I A;  3NWT A;  4HV5 A;  3K70 D;  2OBP A;  4H0E A;  3ZQL A;  2R7V A;  2DA1 A;  2HR3 A;  4LIT A;  5M3M J;  4EJV A;  3L2R A;  4LD5 A;  5HLI A;  4UB6 C;  2O61 A;  5FKN A;  3V42 A;  2VQL A;  1ETQ A;  3JAM R;  4D7N A;  3I4N J;  4OMZ A;  2GA2 A;  2VL8 A;  2HU9 A;  3M8J A;  1A35 A;  3BJA A;  2DA5 A;  3H9J A;  3LSP A;  4V19 K;  4OMY A;  3OYA A;  2LF8 A;  3ZQQ A;  3I4M J;  3OS2 A;  2R5Z B;  3FKJ A;  1DPR A;  1W7P B;  1UST A;  1Z7U A;  2KLO A;  4DYQ A;  4KIC A;  3FM5 A;  4CYC B;  4BBS J;  1Z05 A;  1WH7 A;  2P6S A;  1K78 A;  3QYE A;  1R5G A;  2Y0S N;  4HF0 A;  1D0X A;  2ME6 A;  1QU3 A;  1AA7 A;  1OR7 A;  1OKR A;  2DTZ A;  3DFG A;  1GXQ A;  2M8E A;  2DK8 A;  2GIV A;  3H5A A;  3TP3 A;  3EYI A;  2WAE A;  3WGG A;  1W7P A;  3M1C A;  1FP2 A;  3SZT A;  1AU7 A;  1W5T A;  3P5J A;  3WU1 B;  1IO2 A;  1XDS A;  5C44 J;  3HSE A;  4BL0 B;  2FE3 A;  3W6K B;  1T95 A;  1TTY A;  3G1M A;  2LLK A;  3QPL A;  1Z21 A;  3CLQ A;  1YTY A;  1IUY A;  2M0M A;  4ZZL A;  5J40 A;  2NYX A;  3W2A A;  1XN7 A;  2VN2 A;  4FE7 A;  4PK4 A;  2Z2S B;  5HS8 A;  3PO2 J;  3KYD B;  1WI3 A;  4Y13 A;  2FML A;  1RET A;  3H0D A;  1FOY A;  2EZI A;  1B6A A;  1WZ2 A;  3CMM A;  1FT9 A;  2ZO4 A;  2F5D A;  1YS7 A;  3I58 A;  4F7Z A;  1SD7 A;  4CCK A;  5DDG A;  4BH9 A;  2PJR A;  2L4A A;  3OL4 A;  3CD6 I;  3FMS A;  3QOD A;  3EUA A;  2DFF A;  4JK1 X;  2DMN A;  2DOE A;  2VE8 A;  3OOU A;  4PZJ A;  4AUX A;  4EEF G;  5LHH A;  1Z3X A;  2FOK A;  2HZT A;  2M2E A;  3BDD A;  3NWS A;  5M3F J;  4HX4 A;  4B44 A;  2BV6 A;  4FX4 A;  1KZH A;  3MMY B;  3ZP5 A;  1QBJ A;  2GAU A;  1UEL B;  5B3S H;  3F72 A;  3J7A O;  4QIW N;  5J4V A;  4UV8 A;  1ZHF A;  3A02 A;  4BJ6 C;  1XD7 A;  1TC3 C;  4MIM A;  2GBY A;  3GZ6 A;  3LA7 A;  5D5X B;  4B4C A;  3OIP A;  5HLT A;  3HG9 A;  3RSN A;  2DW4 A;  1WJA A;  2L5Q A;  3L9F A;  3BR1 A;  3HL2 A;  2QYO A;  4E7L A;  3IH2 A;  2V1U A;  5ICC A;  3K2Z A;  4BE2 A;  2LKP A;  3AG4 H;  1G3W A;  1SMT A;  2FF4 A;  4Q4Z F;  4OIR F;  2ECB A;  4M6X A;  4A6E A;  2XKO A;  4ZZD A;  2L7F P;  3WGH A;  5CVR A;  3GTJ J;  1U5T B;  4BQA A;  4NQW B;  3KP7 A;  4JQF A;  4XKC A;  1NH3 A;  1LB2 A;  3FIS A;  2ZCW A;  1R1T A;  3K4N A;  2J5P A;  2HVS A;  2IPQ X;  1OR7 C;  5KNL A;  1YQA A;  4N9I A;  2EIJ H;  4NUB A;  5DEQ A;  3JRB A;  2MC3 A;  3I59 B;  4BHP A;  2HYF A;  2QQ8 A;  4S0H B;  1O7F A;  5DD8 A;  2HQN A;  1W5S A;  2RQQ A;  4CDG A;  3JRG A;  2M8G X;  3HHH A;  1LVK A;  1XCV A;  1X2N A;  1WRJ A;  2W00 A;  3DLA A;  1J5Y A;  3VSL A;  2ECC A;  4CH7 A;  1RR7 A;  2E7X A;  1YJW I;  1K83 J;  2M7B A;  2ELJ A;  2XV4 S;  3GME A;  4M9X A;  1DQU A;  4UB8 C;  4NNJ A;  4Q48 A;  5CKT A;  1LFU P;  3S17 J;  3ABK H;  4XN0 A;  2FUG 2;  1Y6I A;  2CSO A;  2ZNZ A;  2Y0M A;  3GXO A;  3JAM K;  1J7K A;  1WFX A;  2OV7 A;  2R7X A;  2EPF A;  3TGN A;  1OQY A;  3I54 A;  2WA0 A;  4RGX A;  1C0W A;  2QSH X;  5H6R A;  3WE3 A;  1BIA A;  1JJ8 C;  3RZO J;  1QPI A;  1UCR A;  1AHD P;  3N05 A;  4C9Y A;  1K4S A;  2DAO A;  3D5L A;  2ME0 A;  4D5F A;  5E3M A;  3DPU A;  3OOP A;  4AU7 A;  2X6W A;  1G6N A;  3OSF A;  1K6O A;  3QOP A;  2E1O A;  1MMG A;  3LWF A;  2E5Z A;  2KIF A;  3PSI A;  4AID A;  4FQG A;  1FSE A;  3GFL A;  4DZJ A;  5A2Q R;  2LDU A;  2WB1 A;  1TL8 A;  5JFR A;  1XTA A;  1OFC X;  5BNG A;  5E18 F;  2IGM A;  2K4B A;  5AON A;  1Y1V J;  3SDB A;  5ICE A;  2CYY A;  1USS A;  2LBF B;  5C4J J;  5LEJ A;  4E7K A;  2LRE A;  3KCC A;  5L3F A;  3HOY J;  1ZR4 A;  3GCM A;  1IN4 A;  3M1E A;  1RIO H;  1WH5 A;  2ZNY A;  2YS9 A;  3TL4 X;  1GUU A;  2DA6 A;  2E1N A;  1HCR A;  1MKM A;  2L9S A;  5ILV A;  3HC7 A;  3QRF F;  3EUH A;  4UUT A;  2X9D A;  4ZH4 F;  1KGS A;  4RLF A;  2E1M C;  5E1X A;  6PAX A;  3HRU A;  1ZKG A;  2EJR A;  2X4H A;  2F4M B;  2KPM A;  1Y0U A;  3AG3 H;  1O3Q A;  2D2W A;  1MJA A;  1S8N A;  4ENN A;  1E17 A;  4C30 A;  2PMZ N;  3FM3 A;  4KA4 A;  2R92 J;  4RA2 A;  3DU6 A;  5F6F A;  3BLY A;  3L7W A;  4G9Y A;  2P8T A;  2KMU A;  2ZME A;  4N9H A;  4A3E J;  1WI9 A;  4II2 A;  3ULQ B;  2R4G A;  4RB2 C;  1OCR H;  1QNT A;  2MG4 A;  3IH4 A;  4ZC3 A;  3DWL E;  2FXA A;  1GVJ A;  2HTJ A;  3G1L A;  1T56 A;  3OYH A;  2KZG A;  1ETY A;  2KJB A;  3I3L A;  1LQ1 A;  1BOA A;  1MBG A;  4FT8 A;  1G8X A;  5CJ9 A;  2H09 A;  1A36 A;  2M3A A;  2E5N A;  2JRM A;  2AQE A;  2OQR A;  4BQQ A;  3CCS I;  4E7I A;  2CRG A;  2XGE A;  1UJ8 A;  1ZK8 A;  4IHV A;  1K61 A;  1Y8R B;  2X6Y A;  4RM2 A;  2VC1 A;  1CGP A;  3BG5 A;  4EMS A;  1XC5 A;  1TWH J;  2DPD A;  5JHU A;  3C7J A;  1YHQ I;  2F5E A;  2UZK A;  4BY1 J;  1X58 A;  3PUB A;  2EV5 A;  4E7Z A;  4JOM A;  4A3M J;  3HOU J;  2X6X A;  5JLX A;  2XF5 A;  1S3J A;  3HUG A;  3I4P A;  4MFD A;  1MSE C;  1ZH5 A;  4KIB A;  2OAZ A;  3OY9 A;  2CQN A;  4FET A;  4XSX F;  3FZV A;  4CIC A;  4DYR A;  1FIA A;  2HFH A;  2Q8K A;  2R5Y B;  1ZRC A;  4IJA A;  4P5O A;  1KYZ A;  1EKE A;  3HYI A;  1DU0 A;  1JI8 A;  2R7Z J;  2KDZ A;  2ZSH B;  1I39 A;  2ZXJ A;  1WJD A;  4D5C A;  1VQO I;  2GWR A;  1B72 A;  4HG2 A;  4IHW A;  1WKM A;  2H6C A;  4HW0 A;  3GWZ A;  1YIJ I;  2DOF A;  1Y8Q B;  1BI3 A;  3DKX A;  2CV1 A;  4CCO A;  5J3L A;  3RTR A;  3U21 A;  3S1N J;  1UMQ A;  3K69 A;  2MD5 A;  5IT9 K;  2NS8 A;  3MCZ A;  3Q9S A;  2XUB A;  4F92 B;  4GYI A;  4LMY A;  3J81 K;  4HLY A;  4CYD A;  1FWZ A;  2ZJ2 A;  4EJW A;  2OZ6 A;  1NTC A;  4OIN F;  3H3V K;  1VQM I;  4DBQ A;  2V4J C;  3QPS A;  5JI6 A;  1ZRD A;  4R79 A;  1R36 A;  4L9V A;  3E6D A;  1LEB A;  3ABT A;  5EZG A;  4KFC A;  3HEF A;  1TNT A;  3COA C;  2DA3 A;  2LMD A;  1JE8 A;  2D45 A;  3QAH A;  5D8K B;  1UZC A;  3HKZ N;  3LFU A;  3FXM A;  2RN7 A;  5E3N A;  2R5Y A;  4BE0 A;  2HGC A;  2IEK A;  4XR6 A;  4E70 A;  1U78 A;  1HXD A;  1J2X A;  3K4B A;  3J80 Z;  1HDD C;  4IRI A;  3HDD A;  4IXA A;  4ZDO A;  2R7S A;  1SFK A;  2LKX A;  3J81 R;  1F43 A;  2CWE A;  4LIU A;  2E2H J;  1V55 H;  5EDN A;  3B6A A;  3CJN A;  2JA5 J;  1O57 A;  3QOE A;  1RQ6 A;  3WTT C;  2LR8 A;  3F8B A;  1KON A;  3OIO A;  3FXK A;  2VKH A;  3U1D A;  1OCC H;  3RYR A;  4E4H A;  4E6K G;  3P9I A;  3G73 A;  5J4Y A;  1K79 A;  1MNM C;  1SAN A;  1H0M A;  1SFE A;  2BW3 B;  4MTE A;  4PDK A;  3IWZ A;  5FKM A;  1D1A A;  1V5E A;  3CZ6 A;  1I50 J;  3M7G A;  3WTV C;  3G1O A;  5E1Z B;  3S1R J;  4AWX B;  2X1C A;  5DUK A;  1U9O A;  2CV0 A;  5F0F A;  2KJC A;  1ONV A;  1VZ0 A;  1NG6 A;  3ONQ A;  1VFC A;  1H89 C;  2PBI A;  1QPM A;  2VQC A;  3TMO A;  1JHH A;  2FQ3 A;  4A5M A;  3SFZ A;  5FD6 A;  5FLV A;  2DJN A;  4D7M A;  2LC2 A;  2JJ7 A;  4IHS A;  4I98 B;  2DMU A;  3JW4 A;  1OCT C;  1DPU A;  4DBR A;  2LP0 A;  3L1P A;  1APL C;  5LRR A;  1MMA A;  1ODD A;  3BR3 A;  4Y52 J;  2MGQ A;  2BVM A;  3CJR B;  1GHC A;  2VPR A;  2F5F A;  2YUS A;  4U0V A;  3W2W A;  2G0E A;  4BXF A;  4G7Z F;  3FXJ A;  4MGR A;  3S3M A;  3S2W A;  2BY3 A;  2RNG A;  4YEL A;  2STT A;  1SC7 A;  3KP2 A;  1WHU A;  4BBR J;  1IN5 A;  5HNF A;  3SEQ A;  2QSG X;  4OWR B;  2HQA A;  3LSM A;  4MEX F;  3K1M A;  4PSW A;  4M3F A;  1RES A;  1MMN A;  1QZZ A;  1FBS A;  3SQN A;  2KIS A;  1XMA A;  1MH3 A;  1F4K A;  4LFU A;  5FGM A;  3QU3 A;  3GZ5 A;  1K7A A;  3TED A;  2UXX A;  2B0L A;  2VB6 A;  3D1N I;  4A3B J;  4PGH A;  4CYC A;  4II3 A;  1WGX A;  2O5R A;  2VBW A;  4CCL A;  1PUF A;  3PL8 A;  1D8J A;  2JVG A;  2BOL A;  3C2H A;  4GXO A;  4W1U A;  2O03 A;  1D1C A;  2RAE A;  1A6Q A;  1QHG A;  2H94 A;  1EA3 A;  3EDP A;  3DBR B;  4W97 A;  3V7C A;  4NHJ A;  1A5J A;  2GOX B;  2XAF A;  3I9V 2;  1U8R A;  2XPV A;  2KRC A;  4YRV A;  2IT0 A;  1U6G A;  5F1R A;  2FD5 A;  1YJN I;  1BR1 A;  2CQ7 A;  2BW3 A;  1G3T A;  3LSI A;  4XRS A;  2Z33 A;  2HPI A;  2QQA A;  3PQJ A;  2DFI A;  4G12 A;  2LY1 A;  2V1X A;  2X48 A;  1SD6 A;  4WXD A;  2A05 A;  4ESB A;  2XB0 X;  5EEH A;  2G9W A;  3ASN H;  4YFN F;  2CUZ A;  2LRD A;  4ZYE A;  4FHT A;  3CES A;  3T0Y A;  1HKS A;  3L2V A;  2VIX A;  3CQZ J;  5IYD J;  4A69 C;  2CGP A;  2L3D A;  2EB7 A;  3RIR A;  3SZP A;  3JRH A;  4DQ2 A;  2EFW A;  1P4X A;  2V7F A;  4RAG A;  5ED4 A;  1NHA A;  3CUO A;  4BXU A;  3F22 A;  4ESF A;  1Q1V A;  4IEJ A;  1RUN A;  5JVG F;  5K5R A;  2RVC A;  4P9F A;  4I0B A;  5IP6 A;  3HRM A;  4HX7 A;  1EH7 A;  5ILU A;  2OA4 A;  1EH6 A;  4BEH B;  4FTH A;  3DF8 A;  1YG2 A;  5K7Z A;  4BAC A;  1Z7L A;  5DM6 F;  1BC7 C;  2L7M P;  1HW2 A;  3OYN A;  4A3L J;  3FWE A;  4LK0 F;  3CO7 C;  1ITY A;  2JZY A;  1ZEL A;  3DP7 A;  2LK2 A;  1M1E B;  4IHX A;  1PUE E;  4RBO A;  2K85 A;  4XRM A;  3VB2 A;  2PMH A;  2CV2 A;  1I6H J;  2WAF A;  1TT0 A;  2MUN A;  3V8J A;  2QGU A;  3CJT B;  4C3I J;  1A31 A;  2BZT A;  3TQN A;  3QQA A;  4U0Y A;  2VXD A;  3VEP A;  2OTL I;  1IXR C;  1T08 B;  5D4R A;  5GAE J;  1OYY A;  4A0Y A;  3DLL F;  2KIM A;  4F3Q A;  3ISP A;  1QRY A;  2R5Z A;  2JVH A;  5HNH A;  3LAP A;  2RC4 A;  3KP4 A;  1KQ9 A;  2LH9 A;  2FBK A;  2DMQ A;  3TO6 A;  2ELH A;  4X0G A;  3JRA A;  2UWM A;  4M3G A;  2XPU A;  5E20 A;  5IYC J;  3IAS 2;  1BW5 A;  3AL0 B;  1IW7 F;  2W24 A;  2WB1 N;  1MBH A;  4HSR A;  1U2W A;  1QVU A;  3GTL J;  2EFP A;  3FHN A; 
#chains in the Genus database with same CATH homology
 3BP8 A;  2FRH A;  3ECH A;  4AIH A;  3EQL F;  2HKO A;  3HRS A;  2EFO A;  1HBX G;  2J5O A;  2FMY A;  2AS5 F;  1FOK A;  1P6R A;  4I0A A;  3DQV C;  3QP6 A;  1ZG3 A;  1YFH A;  3TDZ C;  3ZMD A;  4B09 A;  2A61 A;  3HSR A;  4YFX F;  3K1P A;  2A68 F;  4UVB A;  1T0F A;  3JAM Z;  3Q9V A;  3ZPL A;  4NQW A;  1T38 A;  3MAJ A;  4GYG A;  4N0B A;  1TW2 A;  5DCF A;  1GXP A;  3DKW A;  4K2E A;  4QLC U;  2K4J A;  1FBQ A;  3KLO A;  1QQI A;  3MWM A;  3IL2 A;  1IN7 A;  5K1Y A;  1Z1D A;  2CQK A;  4HLX A;  5LHI A;  1B1B A;  3I64 A;  3JSO A;  3E5U A;  4ESJ A;  4MQ9 F;  4ENK A;  3B02 A;  3PQK A;  3RYP A;  3FX3 A;  3MZY A;  5L3B A;  1ON2 A;  4KNY A;  3ABU A;  5EEG A;  2LSO A;  1IN6 A;  5CVJ A;  4O5V A;  2PJP A;  3RKY A;  3P9C A;  5ILS A;  2DLL A;  1W4M A;  1Z9C A;  3MFK A;  5HS9 A;  1J59 A;  5H20 A;  1OMI A;  4G94 A;  5L3D A;  2K27 A;  3HHG A;  3SHF A;  1F1Z A;  4M71 A;  4I02 A;  3QP5 A;  4CGZ A;  2E1C A;  1Z6T A;  2M1B A;  3E3V A;  1SD4 A;  4A0Z A;  1YW8 A;  2ESH A;  4PCQ A;  3GFI A;  4D0P A;  3E6B A;  3WGI A;  1WWX A;  2VT2 A;  3DPT A;  1R5H A;  4GGG A;  3LA3 A;  1XDU A;  4WF2 A;  1YO5 C;  2EK5 A;  4AIJ A;  4I7H A;  5LHG A;  3K9T A;  3IKT A;  4G8X A;  5E8G A;  1HW1 A;  3WTS C;  5JR3 A;  5E8I A;  1LDK B;  3EYY A;  4WWC A;  3F6O A;  3GFM A;  1U5T C;  3TDU C;  3KET A;  3O2P E;  3WTY C;  3KP5 A;  5HS7 A;  2HKX A;  1XGM A;  4IVN A;  4LJZ F;  1V4R A;  3G3Z A;  4ON0 A;  4AVP A;  2KKO A;  4M6Y A;  1TNS A;  4IRG A;  1RI7 A;  1MJ9 A;  2A3S A;  5IT9 Z;  1PP7 U;  2DI3 A;  3CUQ C;  1I27 A;  2EFN A;  5IT3 A;  5L3E A;  1QZY A;  3H3Z A;  4HOB A;  5FLX K;  2A6H F;  2ZBK A;  3O6B B;  1KQ8 A;  4B8X A;  3F21 A;  2OD5 A;  2Z9O A;  2BEO A;  2HEO A;  3BOQ A;  2PN6 A;  4U0W A;  3T1B A;  4HV6 A;  2IVM A;  3U9G A;  2L02 A;  2ISZ A;  2IJL A;  2MLK A;  1TW3 A;  1XSV A;  3IRR A;  4I09 A;  4A0X A;  4HA8 A;  4HQE A;  2DK5 A;  3WG9 A;  1IF1 A;  4MTD A;  2HOE A;  4WXH A;  2QVO A;  2L4M A;  3ML6 A;  1TBX A;  2PFB A;  4ENM A;  5HLG A;  5AIP A;  3Q5F A;  3V7R A;  4YIF A;  2CG4 A;  2RGV A;  2P4W A;  2FNA A;  1HSJ A;  2Y75 A;  2HQR A;  1B59 A;  1ZGA A;  1IXC A;  4G7O F;  3TOA A;  2FBH A;  4XRF A;  5CLS A;  1MDM A;  2NNN A;  5J8F A;  2YR2 A;  1STZ A;  3FMQ A;  3FHZ A;  5D8L B;  1BJA A;  3U2R A;  3LAJ A;  3KP6 A;  1LJ9 A;  2DBB A;  2V9V A;  4U7B A;  4MNU A;  4G7H F;  1ZGJ A;  2YX4 A;  2O6G E;  1KU9 A;  5D6E A;  3BZ6 A;  1HQC A;  4M9S A;  1TQI A;  1IZ1 A;  5CVU A;  4EVI A;  1OPC A;  5ERI A;  4O3M A;  2QWW A;  1KU3 A;  3GUD A;  5KVR A;  1I1S A;  2F2E A;  2R7D A;  3BJ6 A;  1SFU A;  1QGP A;  3F3X A;  4XBF A;  3F8C A;  3ZMS A;  2EV0 A;  3MEX A;  3R6S A;  4CO8 A;  4UNO A;  1L0O C;  4M72 A;  1ZRF A;  3IRQ A;  2ZKZ A;  1ZYR F;  5JVT A;  2VT3 A;  2FA5 A;  1JHF A;  1P92 A;  5BMZ A;  3BRO A;  4L9T A;  1I1G A;  3V8K A;  4FX0 A;  3IHU A;  4L0Y B;  4LLG F;  5E1W A;  2DT5 A;  3ZQ7 A;  5LGU A;  4EM1 A;  4UHT A;  4LG0 A;  5D4S A;  1IXS B;  4WX9 A;  2GZW A;  1I5Z A;  2F5C A;  3GX4 X;  2A6E F;  3I0T A;  3R0A A;  2RNJ A;  4GCV A;  4OOI A;  4QWQ A;  5DCM B;  1U5T A;  4KIF A;  5D5V B;  1HW5 A;  4Y15 A;  1HKT A;  1CF7 A;  3V4G A;  2Q0O A;  3GF2 A;  2XAG A;  2A69 F;  2V79 A;  2FEZ A;  4NB5 A;  2PQ8 A;  3FXU A;  5CYV A;  2G7U A;  3MZH A;  3FF5 A;  4UXN A;  4ZYG A;  2FBI A;  2IA2 A;  4HZF A;  2H6B A;  1S7A A;  4MEY F;  4OIQ F;  2ETH A;  2YPR A;  3N97 A;  1IAW A;  2BBY A;  3QPT A;  1T2K A;  3K1N A;  1W7P D;  2QEN A;  2GQQ A;  2AXL A;  3HSF A;  2XVC A;  1YYV A;  5BPD A;  1FPQ A;  2QQB A;  2OU2 A;  2PI0 A;  4LK1 F;  3CDH A;  3GW2 A;  3NRV A;  4Y17 A;  4PGG A;  1MZB A;  4LGW A;  2MLG A;  4U88 A;  2W85 A;  4EGY A;  4DNC A;  2OZU A;  5LEK A;  2K7L A;  3KEQ A;  4RGU A;  4IPA A;  3ERE D;  4AIK A;  2L54 A;  3ZN1 A;  1V3F A;  1BIB A;  3O3K A;  2NAZ A;  3KE2 A;  1OYW A;  3M8E A;  3M8F A;  5BOX A;  3VFZ A;  2RKH A;  5K5O A;  4M74 A;  1WSU A;  3RDI A;  3E5Q A;  1O3S A;  3NEU A;  5HDN A;  4A5N A;  5A2Q K;  1JXS A;  3T5X A;  1H9T A;  3L2C A;  3VOD A;  2K86 A;  5ICF A;  4HQM A;  1FYK A;  4BHB A;  4KMU X;  5L3C A;  3GO5 A;  1XSD A;  3KZY A;  3QPH A;  3I5U A;  3KLN A;  2YU3 A;  2KRF A;  3WE2 A;  5E17 F;  2PEX A;  5J8C A;  3HRT A;  3IC7 A;  1BBY A;  2VON A;  1XSX A;  3ZMZ A;  2FSW A;  3RJP A;  3B73 A;  2WWY A;  4BNC A;  4HF2 A;  3DEU A;  1BI0 A;  1R1U A;  3WOD F;  4KMF A;  3TO7 A;  1RNL A;  1CF7 B;  3WTU C;  4R8H A;  4RB1 A;  1YW9 A;  3R0J A;  2RV8 A;  4L9N A;  3GYH X;  5D5W B;  2XRO A;  1UB9 A;  3FMR A;  2JT1 A;  2HDC A;  3CLO A;  2DQL A;  3BPV A;  2ZME B;  3GEZ A;  2IA0 A;  3ZMU A;  2HTS A;  2VOO A;  3F8F A;  2MBF A;  4GO1 A;  1XGN A;  3W6J B;  1S6L A;  2XAH A;  2BE5 F;  3LQR A;  3BPX A;  3HOS A;  1SMY F;  4L5J A;  1IRG A;  4WXC A;  4YFK F;  1TQM A;  3JTH A;  2VXZ A;  5HDK A;  4EGZ A;  1ULY A;  2VC0 A;  4UVA A;  3ROU A;  3J80 K;  2IA1 A;  4HYE A;  1ZAO A;  1ZG1 A;  5LGT A;  3R60 A;  4L5I A;  2WC2 A;  2YX7 A;  5BQT A;  5HLH A;  4RGS A;  5K5Q A;  2D1H A;  4XLP F;  1PP8 F;  2GXG A;  4KDP A;  2VE9 A;  3C18 A;  3CTA A;  2EA4 A;  2NNY A;  3P7N A;  1FNN A;  3F8N A;  1O7L A;  5FFZ A;  1VTN C;  2UXN A;  4AD9 A;  4BAY A;  1FP1 D;  2MH2 A;  2JPB A;  3I71 A;  1R58 A;  2A07 F;  2X0L A;  3IKV A;  2PLY A;  5HVQ C;  4LLN A;  5D6F A;  1O3R A;  2VBZ A;  1REP C;  3RPQ A;  1PDN C;  2Z99 A;  1QO0 D;  1Z6R A;  5DYM A;  4HDU A;  3ZMT A;  3HTS B;  4HDV A;  5A2Q Z;  1XMK A;  3OV8 A;  4EQQ A;  4KUM A;  3CUQ B;  1BC8 C;  5F64 A;  2P5L C;  1B4A A;  1ZLJ A;  2QBY A;  3ZN0 A;  2M45 A;  2HYG D;  1FX7 A;  2DO7 A;  4EM2 A;  2P5K A;  4BHC A;  2P7C B;  4BYY A;  1XGO A;  2NRA C;  2Z5U A;  5LLQ A;  2ESN A;  3VOE A;  4KIG A;  2COM A;  2BYV E;  1R00 A;  3T8T A;  2Y48 A;  3E5X A;  3F23 A;  3CO6 C;  1KA8 A;  4M73 A;  1FC3 A;  2XRN A;  3R4K A;  1FYL A;  1IN8 A;  3KEO A;  1MD0 A;  5DD4 A;  1B9N A;  1ZN2 A;  3K0L A;  5KK1 A;  1YLF A;  1J9I A;  2WV0 A;  2VOP A;  2LNB A;  1D8K A;  2D1V A;  1L3L A;  2ISY A;  2O8X A;  2RDP A;  4OIP F;  4EM0 B;  2H27 A;  2PMU A;  2XGX A;  3L00 A;  3WTX C;  1B9M A;  1T6S A;  1ZAR A;  3P9K A;  2EFQ A;  2QZ8 A;  1FBU A;  1UHM A;  2M87 A;  3WU0 A;  4A12 A;  4YII A;  5D5U B;  4RAZ A;  4S04 A;  2G7H A;  2Q2E A;  1R23 A;  2V6C A;  3CUQ A;  5DCM A;  5TJJ A;  2C6Y A;  4ETS A;  1F9N A;  1XGS A;  2Z3Y A;  4WK8 F;  1BN5 A;  3E97 A;  2DQR A;  2CO5 A;  2QLZ A;  5FFX A;  4KN4 X;  1MGT A;  3HOT A;  4EJU A;  3LFK A;  1G4D A;  4CXF A;  3KP3 A;  4LG0 B;  2QM3 A;  2ACJ A;  4HBL A;  4LB5 A;  1ZG5 A;  3DPL C;  3BJO A;  1LVA A;  2NS0 A;  4RAY A;  1BI1 A;  3SXY A;  2BGC A;  1HKQ A;  3DXJ F;  4S05 A;  4YG2 F;  2QUF A;  4L0Z B;  3RI4 A;  2HWV A;  3LST A;  5BS6 A;  2EWN A;  2P5V A;  1BI2 A;  3WTZ A;  5FLX Z;  1R1V A;  2VBY A;  3REO A;  4A6D A;  5FO5 A;  2JPC A;  1R7J A;  3H3U A;  2MH9 A;  2XAJ A;  2L01 A;  1XCB A;  4G6Q A;  4XSZ F;  2GA1 A;  1BM9 A;  1EH8 A;  5J6X A;  3PFI A;  1G3Y A;  1P4W A;  1KYW A;  4IF4 A;  2W57 A;  2XHK A;  4KYW A;  2EFP A;  4G6D A;  3KZZ A;  4OU0 A;  2JRT A;  4ZYD A;  4U7D A;  1T98 A;  1UFM A;  3HTU A;  2MA3 A;  1O3T A;  1ZLK A;  2EA2 A;  4R1H A;  3TO9 A;  4JBA A;  4RB0 A;  3BWG A;  4RB3 C;  2YSR A;  2A5Y B;  2CW0 F;  2M30 A;  2E7W A;  2PG4 A;  2CFX A;  3FXQ A;  2IW5 A;  4UVC A;  4I2O A;  1LNW A;  1TLH B;  5BPI A;  4IRH A;  1AOY A;  2XAS A;  2FU4 A;  1SFX A;  2DPU A;  3RPU A;  3LA2 A;  5L3G A;  3RKX A;  1S7O A;  4HX8 A;  1XB4 A;  1JGS A;  5HOO A;  4ASN A;  1DDN A;  5CVV A;  4LLL A;  3HIF A;  4P9U A;  1F5T A;  3RKW A;  3FXR A;  1FSH A;  2O3F A;  4HAM A;  2XKP A;  3JSP A;  4ZYH A;  1I6X A;  2VOD A;  1MDM B;  1AWC A;  1J0R A;  4CHU A;  3DV8 A;  1LEA A;  1LDJ A;  2DTR A;  4RGR A;  1P2F A;  4MHG A;  1WQ2 A;  4Z2Y A;  4WCG A;  1MJB A;  3F8M A;  4IHT A;  3L09 A;  2IP2 A;  2P7V B;  3D0S A;  1S29 A;  3GVA A;  1IRF A;  1YIO A;  2OQG A;  3ZMV A;  1J75 A;  3TOB A;  1X3U A;  2JTV A;  4L9J A;  2ADU A;  3EET A;  1R22 A;  5CVI A;  4L18 B;  3I53 A;  4P96 A;  5FD5 A;  1ON1 A;  3GLX A;  1DP7 P;  2TDX A;  4CZZ A;  2W25 A;  5TRD A;  3ELK A;  4UV9 A;  4Q47 A;  2R3S A;  2M5W A;  4MQV A;  3IWF A;  4HF1 A;  2FNP A;  3JTG A;  1K78 B;  1KU2 A;  2STW A;  5LBQ A;  1FY7 A;  4I01 A;  2WTE A;  1KU7 A;  5FB2 A;  2HS5 A;  4KT5 C;  1SAX A;  2XIG A;  3N4M A;  2EV6 A;  2KIU A;  3T8R A;  1YW7 A;  1A04 A;  3GFJ A;  5ICG A;  4LB6 B;  1DUX C;  3ECO A;  2GXB A;  2VBX A;  3I59 A;  5AIQ A;  3MQ0 A;  2XAQ A;  3BY6 A;  4O6J A;  5H6Q A;  3J81 Z;  4EJT A;  4UUV A;  1YS6 A;  5LRS A;  4M9Z A;  1UHW A;  3LQQ A;  2QBY B;  4P55 A;  1FYM A;  1EV7 A;  2RQP A;  3AAF A;  4EV0 A;  1TQP A;  1ZRE A;  2W84 A;  3E6C C;  5HDG A;  3C3W A;  1RZ4 A;  1LDD A;  3NQO A;  1KQ0 A;  1T39 A;  1RUO A;  2LF7 A;  3C1D A;  4ENJ A;  1U3E M;  2V1D A;  5DUI A;  5LGN A;  1E2X A;  2IRF G;  1HST A;  2QQ9 A;  3M9A A;  1FZP B;  2JSC A;  2R7F A;  3F6V A;  4Q5S F;  3V8L A;  1G3S A;  4TV7 A;  3V7S A;  3H92 A;  5DV5 A;  2ZFW A;  1D5V A;  4KN7 X;  4RS8 A;  3R61 A;  3WTW C;  2O0Y A;  1FLI A;  4EJO A;  1Q1H A;  2DU9 A;  2P6T A;  4XLN F;  1Z91 A;  2K02 A;  3QU6 A;  1OYI A;  1P4A A;  1SD5 A;  1H9G A;  3E6M A;  4OIO F;  3TKY A;  4A2U A;  1D3Y A;  4HV5 A;  2OBP A;  4H0E A;  2HR3 A;  4EJV A;  4LD5 A;  5HLI A;  2O61 A;  4OMZ A;  2GA2 A;  3BJA A;  4OMY A;  2LF8 A;  1DPR A;  1W7P B;  1UST A;  1Z7U A;  4KIC A;  3FM5 A;  1Z05 A;  2P6S A;  1K78 A;  1R5G A;  4HF0 A;  1OR7 A;  1OKR A;  3DFG A;  1GXQ A;  2M8E A;  2DK8 A;  2GIV A;  3EYI A;  3WGG A;  1W7P A;  1FP2 A;  3SZT A;  1W5T A;  3WU1 B;  1XDS A;  3HSE A;  2FE3 A;  3W6K B;  1TTY A;  1YTY A;  1IUY A;  4ZZL A;  2NYX A;  1XN7 A;  2VN2 A;  5HS8 A;  4Y13 A;  2FML A;  1B6A A;  1FT9 A;  2ZO4 A;  2F5D A;  1YS7 A;  3I58 A;  4F7Z A;  1SD7 A;  5DDG A;  4BH9 A;  2L4A A;  3FMS A;  4JK1 X;  2VE8 A;  4PZJ A;  5LHH A;  3BDD A;  2FOK A;  2HZT A;  4HX4 A;  2BV6 A;  4FX4 A;  1QBJ A;  3ZP5 A;  2GAU A;  3F72 A;  3J7A O;  4UV8 A;  1ZHF A;  1XD7 A;  3GZ6 A;  3LA7 A;  5D5X B;  2DW4 A;  3L9F A;  2QYO A;  2V1U A;  5ICC A;  3K2Z A;  2LKP A;  1G3W A;  1SMT A;  2FF4 A;  4Q4Z F;  4OIR F;  4M6X A;  4A6E A;  2XKO A;  4ZZD A;  3WGH A;  5CVR A;  1U5T B;  4BQA A;  3KP7 A;  4JQF A;  1LB2 A;  2ZCW A;  1R1T A;  2J5P A;  2IPQ X;  1YQA A;  4N9I A;  5DEQ A;  2MC3 A;  3I59 B;  4BHP A;  2HYF A;  1O7F A;  5DD8 A;  2HQN A;  1W5S A;  4CDG A;  3HHH A;  1XCV A;  1WRJ A;  1J5Y A;  2E7X A;  2XV4 S;  4M9X A;  4Q48 A;  2CSO A;  2ZNZ A;  2Y0M A;  3GXO A;  3JAM K;  1J7K A;  3TGN A;  3I54 A;  4RGX A;  1C0W A;  5H6R A;  3WE3 A;  1BIA A;  1UCR A;  2DAO A;  3D5L A;  3OOP A;  1G6N A;  1K6O A;  3QOP A;  3LWF A;  2KIF A;  1FSE A;  3GFL A;  2LDU A;  5JFR A;  5E18 F;  2K4B A;  5AON A;  5ICE A;  2CYY A;  1USS A;  5LEJ A;  3KCC A;  5L3F A;  1IN4 A;  3M1E A;  1RIO H;  2ZNY A;  2E1N A;  1MKM A;  5ILV A;  3QRF F;  3EUH A;  4ZH4 F;  1KGS A;  5E1X A;  6PAX A;  3HRU A;  2EJR A;  2X4H A;  1Y0U A;  1O3Q A;  2D2W A;  1MJA A;  1S8N A;  4ENN A;  1E17 A;  3FM3 A;  4KA4 A;  5F6F A;  3L7W A;  4G9Y A;  2P8T A;  2ZME A;  4N9H A;  1WI9 A;  3ULQ B;  4RB2 C;  1QNT A;  2FXA A;  1GVJ A;  2HTJ A;  2KJB A;  1LQ1 A;  1BOA A;  4FT8 A;  5CJ9 A;  2H09 A;  2OQR A;  2VC1 A;  1CGP A;  4EMS A;  2DPD A;  5JHU A;  3C7J A;  2F5E A;  2UZK A;  2EV5 A;  1S3J A;  3HUG A;  3I4P A;  1ZH5 A;  4KIB A;  2OAZ A;  4XSX F;  3FZV A;  4CIC A;  2HFH A;  2Q8K A;  1ZRC A;  4IJA A;  4P5O A;  1KYZ A;  3HYI A;  2ZXJ A;  2GWR A;  1WKM A;  2H6C A;  4HW0 A;  3GWZ A;  1BI3 A;  3RTR A;  3K69 A;  2MD5 A;  5IT9 K;  3MCZ A;  3Q9S A;  2XUB A;  4GYI A;  4LMY A;  3J81 K;  4HLY A;  4CYD A;  1FWZ A;  2ZJ2 A;  4EJW A;  2OZ6 A;  4OIN F;  5JI6 A;  1ZRD A;  4R79 A;  1R36 A;  4L9V A;  3E6D A;  1LEB A;  3ABT A;  4KFC A;  1TNT A;  3COA C;  1JE8 A;  2D45 A;  3QAH A;  5D8K B;  2RN7 A;  2HGC A;  4E70 A;  1U78 A;  1HXD A;  1J2X A;  3J80 Z;  4IRI A;  4IXA A;  2CWE A;  3CJN A;  1O57 A;  3WTT C;  3F8B A;  3U1D A;  3RYR A;  3G73 A;  3P9I A;  1K79 A;  1H0M A;  1SFE A;  4MTE A;  4PDK A;  3IWZ A;  3M7G A;  3WTV C;  5E1Z B;  4AWX B;  5DUK A;  2KJC A;  1ONV A;  2PBI A;  1QPM A;  1JHH A;  2FQ3 A;  4A5M A;  3SFZ A;  5FD6 A;  4IHS A;  4I98 B;  3JW4 A;  1DPU A;  5LRR A;  1ODD A;  1GHC A;  2F5F A;  4U0V A;  4G7Z F;  4MGR A;  3S2W A;  2STT A;  3KP2 A;  1IN5 A;  4MEX F;  3K1M A;  1QZZ A;  1FBS A;  3SQN A;  1XMA A;  1F4K A;  4LFU A;  5FGM A;  3QU3 A;  3GZ5 A;  1K7A A;  2UXX A;  2B0L A;  4PGH A;  2VBW A;  1D8J A;  4GXO A;  2O03 A;  2H94 A;  3EDP A;  3V7C A;  4NHJ A;  2XAF A;  1U8R A;  2IT0 A;  1U6G A;  5F1R A;  1G3T A;  2Z33 A;  2QQA A;  3PQJ A;  2DFI A;  2V1X A;  1SD6 A;  4WXD A;  4ESB A;  5EEH A;  2G9W A;  4YFN F;  4ZYE A;  4FHT A;  3T0Y A;  1HKS A;  2CGP A;  2L3D A;  2EB7 A;  3RIR A;  3SZP A;  4DQ2 A;  2EFW A;  1P4X A;  5ED4 A;  1NHA A;  3CUO A;  4BXU A;  3F22 A;  4ESF A;  1RUN A;  5K5R A;  2RVC A;  4P9F A;  4I0B A;  3HRM A;  4HX7 A;  5ILU A;  1EH7 A;  2OA4 A;  1EH6 A;  3DF8 A;  1YG2 A;  1BC7 C;  1HW2 A;  3FWE A;  4LK0 F;  3CO7 C;  2JZY A;  3DP7 A;  1PUE E;  3VB2 A;  2PMH A;  3V8J A;  3TQN A;  4U0Y A;  3VEP A;  1IXR C;  5D4R A;  1OYY A;  4A0Y A;  2KIM A;  3ISP A;  3LAP A;  2RC4 A;  3KP4 A;  1KQ9 A;  2FBK A;  3TO6 A;  2ELH A;  2UWM A;  5E20 A;  1IW7 F;  2W24 A;  1U2W A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...