2HYFA

The structure of apo-mntr from bacillus subtilis, selenomethionine derivative
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
total genus 42
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hyfA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hyfA02
3QRFF 1U2WA 5J6XA 2K27A 4ETSA 3I58A 1O3TA 1TQMA 3J80K 2MH2A 4M9SA 3CUQB 5L3DA 1W5SA 1S8NA 1IN7A 4M74A 5K5OA 3TDZC 4MNUA 4Q48A 2PLYA 2CGPA 3GLXA 3JTGA 3F8CA 3GO5A 3ZP5A 3E5XA 3BOQA 5EEHA 5ILVA 1IRFA 1O57A 2M5WA 1YTYA 1I27A 3L9FA 5LGUA 1P6RA 1XGSA 4CGZA 3F21A 2Z3YA 3HTUA 1DUXC 3F22A 2LKPA 3U9GA 3RPUA 2V79A 2LSOA 4LG0B 3FMQA 3BP8A 4OINF 3O6BB 1SD4A 3LWFA 3RKYA 3VOEA 4YFXF 2VE8A 5ED4A 2Q0OA 1HKQA 3U1DA 2Z33A 2FNAA 1XCBA 2H6CA 3Q9SA 3WGHA 5BOXA 3G3ZA 4S04A 3L00A 3FXUA 2HWVA 3ZMSA 3HTSB 1U8RA 4GO1A 3HSRA 2W24A 2P4WA 2M1BA 5HOOA 1CGPA 3PFIA 3TO9A 1IN6A 3K1NA 4HV5A 4XRFA 1OKRA 4UNOA 5E20A 2PBIA 1FY7A 1C0WA 4WXDA 1KU2A 2STWA 3T5XA 2EA4A 3NQOA 1ZG1A 2ZFWA 1F4KA 2PJPA 1J2XA 4M6YA 2FBHA 2A6HF 2VOOA 3QAHA 4PGHA 1BIBA 3IRQA 3MEXA 1BI0A 4LLGF 2CW0F 2MLKA 4UHTA 1REPC 3F8BA 5DD4A 4BHBA 4HF1A 4NQWA 3V8KA 3FMRA 1D8JA 3I0TA 3CTAA 1LJ9A 4O5VA 5L3BA 1K79A 3L7WA 1XGOA 1RUOA 1T6SA 1XD7A 2ZNZA 5E8GA 3F8FA 2P6TA 3E6CC 5KK1A 1R1VA 2IA2A 4CXFA 4L5JA 3AAFA 1Z91A 2FMLA 4HW0A 4G94A 2O8XA 2VT2A 1U5TB 2Y48A 2ZCWA 3KEQA 4EGYA 1KA8A 2KRFA 3IKVA 4AIHA 3I5UA 5D8KB 2JT1A 5L3EA 1MDMB 2FMYA 4WWCA 3PQJA 4HLYA 1ZGAA 1XMKA 5ICFA 3HRUA 2A61A 1YQAA 3V8LA 2EFOA 3ELKA 4NB5A 1YO5C 1BN5A 3DPLC 4HX7A 1B4AA 2ACJA 2DQLA 1J59A 1USSA 2DLLA 1HQCA 2ZMEB 2L4AA 1XDSA 1HKSA 3RIRA 4LMYA 3REOA 2DPUA 3EQLF 3WTVC 1P2FA 5HLHA 3GFIA 3K69A 3FMSA 4HA8A 4EJVA 3D5LA 3FWEA 3HUGA 4UVCA 2XV4S 3KP5A 1FLIA 2E7XA 2KIUA 3J7AO 1GXQA 1HW1A 2A6EF 3CUQA 4U7BA 5LRSA 2OZ6A 2NNNA 2FE3A 3K2ZA 4L9NA 1ULYA 2P5VA 3SXYA 1S7OA 1E2XA 4A6DA 3R61A 1R5HA 1L0OC 4EQQA 2YSRA 3J80Z 1ZYRF 2D45A 4PDKA 2HDCA 3ZMTA 4RAYA 1W7PB 4BAYA 1S6LA 3E5UA 1IZ1A 3HRSA 2OZUA 4WF2A 3K1PA 2FEZA 1ZG5A 5DCFA 1P4WA 1BI3A 1SMYF 4LG0A 2HKOA 2QZ8A 4Y13A 1HXDA 1T38A 2JPCA 2Z9OA 4OIPF 5DD8A 3U2RA 2ZBKA 4HX8A 3RKWA 3QP6A 2GA2A 2O0YA 5CVVA 1K78B 1ONVA 1P92A 4G7HF 4UUVA 4FHTA 2OA4A 2XUBA 3KLOA 4GGGA 3TGNA 2HKXA 5K5QA 4Z2YA 1MJBA 5ILUA 5D4SA 4M73A 3DV8A 4I0BA 1WI9A 5LHHA 3F6OA 3P9CA 1JHHA 1SD5A 4BH9A 2QENA 4CYDA 1EH7A 1X3UA 1MJAA 3KP7A 3V7CA 2A3SA 3D0SA 5IT9Z 4IRIA 1BI1A 2VBYA 3O2PE 5TJJA 5DCMA 2K4BA 3WE3A 1HKTA 2PMUA 4EM0B 1V4RA 1UFMA 1OYYA 5LEKA 4JK1X 2IW5A 1P4AA 2HOEA 2OBPA 4RB0A 1ZRFA 2P5KA 4U0YA 3CJNA 2L3DA 4ZYDA 1KQ0A 1XGMA 3BDDA 3SZPA 4EGZA 3M8EA 4MEYF 2VOPA 2QYOA 1Z7UA 2HGCA 3T8RA 4LGWA 4MHGA 1HSTA 3HSEA 2QWWA 2ZNYA 4A5MA 3EYYA 1U5TA 4WXHA 5J8FA 1WRJA 4RB3C 3KLNA 3KZYA 4GYGA 1MDMA 1WQ2A 2M30A 3IWZA 2DTRA 1RNLA 3F6VA 3IWFA 3WTTC 4LLLA 2VBZA 3KP3A 3WODF 3ZPLA 2RKHA 2H6BA 1O7LA 3SZTA 4BYYA 1Q1HA 3KE2A 2JSCA 2DW4A 1MGTA 2JTVA 2UZKA 2ZMEA 3DKWA 1SD6A 3TQNA 5HLGA 4YIFA 1USTA 5ILSA 3V4GA 4I98B 1FBQA 5D5WB 3F72A 2GQQA 4XBFA 1F5TA 1Z1DA 1AWCA 2QQBA 3MWMA 4P5OA 5TRDA 1G3TA 1EH8A 4L18B 3FM3A 1XSVA 1XMAA 4QWQA 5BMZA 3DXJF 5FFXA 4HBLA 1V3FA 1OR7A 3GYHX 3BPVA 2ELHA 1QZYA 3F3XA 3IKTA 2ETHA 2PG4A 2FQ3A 2DPDA 2OU2A 3GFLA 1I1GA 5F6FA 3TDUC 5JHUA 2QLZA 2L54A 3I59B 2L02A 2NNYA 3ZMZA 2DK5A 2CO5A 1J9IA 2WTEA 5LEJA 1ZRDA 5AIPA 2PN6A 2QBYA 2EFQA 4KIBA 3I4PA 4ON0A 4I2OA 1JE8A 3GFMA 5CLSA 4G8XA 1TNTA 5J8CA 1R1UA 4DQ2A 2Y75A 2L4MA 2VBXA 1IF1A 2XAFA 4ESFA 2W57A 3K0LA 3WTXC 4U7DA 1QZZA 1TW3A 4O3MA 4RGRA 3VFZA 2MLGA 1P4XA 2GWRA 4MTDA 3SHFA 1S29A 1FWZA 1K78A 4YFNF 2CYYA 2P5LC 1O3SA 5DYMA 3LA7A 5L3FA 3HOTA 1D8KA 4M9XA 3R0AA 1QBJA 2E1CA 2CFXA 2Z5UA 4LB6B 1F9NA 4KMFA 3T8TA 4WXCA 5ERIA 3RPQA 5CVJA 1WWXA 1IXRC 4ZYHA 4N9HA 5E1WA 1BC7C 1ODDA 1ZGJA 2RGVA 1RUNA 3NEUA 3E6MA 4ASNA 2VC0A 1T2KA 3QPTA 1FZPB 4LK1F 5IT9K 2XHKA 5A2QK 5IT3A 3T0YA 5CJ9A 3RYRA 4CHUA 4OMZA 2XIGA 3VEPA 3RDIA 2GIVA 3GFJA 4A2UA 5HDGA 3FM5A 3ISPA 4XLNF 3CUQC 1KYWA 2DK8A 5CVRA 1H9GA 1U78A 4ESBA 4YFKF 4EMSA 1JHFA 4EJOA 3BWGA 2KIFA 2DBBA 3LSTA 3ZMVA 2A5YB 1LDKB 5E17F 3ABTA 1UB9A 2OQRA 5JVTA 1IXSB 1R1TA 5HLIA 3HHGA 2MC3A 1WSUA 3FHZA 3W6JB 4IJAA 2VT3A 2D2WA 3WE2A 3MCZA 1Z05A 5FLXK 1FPQA 1XDUA 3P9IA 1FBUA 2VXZA 2UXXA 1FYMA 3DF8A 3KP4A 4JBAA 2F5DA 4BHPA 2NYXA 5HS8A 2H94A 3V7RA 1B9MA 1LVAA 4EJTA 3G73A 3I71A 3M1EA 1J7KA 1DPRA 2LDUA 5D6FA 4ZH4F 3MZYA 5FD6A 4AWXB 2EFNA 5ICGA 2EK5A 4IRGA 2E1NA 4KIFA 5LHGA 2EA2A 1E17A 4G9YA 5E8IA 1YS7A 4EVIA 3B02A 2HYFA 4WCGA 1QQIA 3ABUA 4ESJA 2GA1A 3VODA 1CF7B 2K7LA 1QO0D 1XN7A 4HAMA 2CSOA 3KP6A 4JQFA 4QLCU 4AIJA 4U88A 1YYVA 2R7FA 4Q4ZF 1OYWA 5D4RA 4OIRF 2IRFG 4MGRA 2FNPA 5EEGA 2EV6A 2O3FA 4Y17A 4R1HA 3BROA 3HRTA 1FC3A 2JRTA 4IRHA 4F7ZA 5CYVA 1H9TA 4GXOA 1U6GA 3TKYA 3BPXA 2YPRA 4KIGA 1HSJA 4N0BA 2XAQA 4FX4A 2DU9A 3GZ6A 1UHMA 2P6SA 4KDPA 4RS8A 1YS6A 3KETA 4ZYGA 3WGGA 3I59A 3EYIA 3GUDA 3RTRA 4AIKA 2HEOA 1FYKA 1B1BA 3Q5FA 3F8MA 3LA2A 2P8TA 3P9KA 5LLQA 2IA0A 2GXGA 3HRMA 2BYVE 4CO8A 2BBYA 4P9FA 3QOPA 3H92A 3M7GA 4L0YB 5E1ZB 3ERED 5CVUA 4ZZDA 4U0WA 3T1BA 1U5TC 2D1HA 4H0EA 2YR2A 2A07F 3IL2A 2EV0A 4KN4X 2A69F 5LHIA 1JXSA 1UHWA 4HDVA 4CICA 1DDNA 1FP2A 1MJ9A 4CDGA 4B8XA 1Z9CA 1HW2A 2ZKZA 2ESNA 1ON1A 5D5VB 3MAJA 4IHSA 5FO5A 2IVMA 3ROUA 1I1SA 3GXOA 1MKMA 3WTSC 1YW7A 2ZXJA 2OD5A 4LFUA 3QPHA 3QP5A 4U0VA 5AIQA 2IT0A 1MZBA 3WTWC 3KCCA 3PQKA 4PCQA 2EFWA 1BOAA 1NHAA 4CZZA 3E6DA 3GW2A 2FU4A 2E7WA 1DPUA 2W25A 3CO6C 3ZMDA 4KT5C 3CLOA 2DI3A 2LNBA 3EETA 2FXAA 1VTNC 1KQ9A 5K1YA 4YG2F 1B9NA 2PEXA 4KNYA 5L3GA 4I02A 2L01A 2K86A 3H3ZA 2ZO4A 2RQPA 2O61A 3RYPA 2RN7A 1G3YA 1BM9A 2O6GE 2FSWA 3SFZA 1IN5A 4A0YA 5LBQA 2PMHA 3ML6A 2BGCA 5A2QZ 1O3RA 5FGMA 2EFPA 4UXNA 2F5CA 1ZAOA 3GVAA 1MD0A 3WTUC 3WU1B 2ISZA 1BIAA 3DFGA 1KU7A 1IUYA 1U3EM 3DP7A 1LB2A 1KYZA 2FBIA 4K2EA 1AOYA 2FOKA 2BE5F 1IAWA 4ENJA 6PAXA 1GVJA 3ECHA 1LNWA 3CDHA 1XB4A 5HDKA 2KKOA 2CG4A 4ZZLA 3QU6A 4ENKA 2M8EA 2ISYA 1SFEA 4LK0F 1TQIA 1YW9A 4P96A 2KJBA 5FLXZ 2VE9A 2GZWA 3WG9A 4UVAA 1S7AA 1T0FA 5BS6A 1Y0UA 3O3KA 5KVRA 3JAMZ 2O03A 4OIQF 1G3WA 4A0XA 3IHUA 1CF7A 4WK8F 1LQ1A 3RJPA 3E97A 1ZHFA 4HYEA 3ZQ7A 5E1XA 3F23A 3IRRA 2X0LA 5F64A 4L9JA 1F1ZA 3FZVA 2FF4A 2COMA 2HQNA 4Q5SF 2D1VA 4M9ZA 2WC2A 5HS7A 3C18A 2K4JA 1EH6A 1RIOH 2DAOA 1BI2A 2CWEA 2HTJA 2EWNA 4ENMA 3TO6A 4R8HA 1KQ8A 2RC4A 2DFIA 4KFCA 3LAJA 4NHJA 1ON2A 4A6EA 4S05A 4IF4A 5BQTA 3KEOA 2KIMA 4A5NA 3TO7A 1FYLA 1FBSA 2MBFA 1IXCA 2J5OA 3I64A 4Q47A 1XSDA 1OPCA 3WU0A 2F5FA 5FB2A 4I01A 3BJAA 4G6QA 2HS5A 5DEQA 3ZN0A 3BY6A 4BQAA 3R4KA 4KMUX 1GHCA 1YLFA 1W7PD 1W7PA 4YIIA 2GAUA 4LB5A 3NRVA 2DQRA 3R0JA 2MD5A 2WWYA 5ICEA 4L0ZB 4OIOF 2XASA 1Z6TA 3C3WA 4L9TA 2IA1A 2XAJA 3E5QA 1STZA 2HZTA 4E70A 4I7HA 2VN2A 3OOPA 2F2EA 4HV6A 4BNCA 2X4HA 2BEOA 5L3CA 2HQRA 2C6YA 4OOIA 3TOAA 1TW2A 2JPBA 3OV8A 3FXQA 2V1XA 1KU3A 2V6CA 1FSHA 4HQEA 4L9VA 1KU9A 4A0ZA 3KP2A 4EM1A 1QGPA 4RB2C 1FNNA 1ZARA 1A04A 2XAHA 1OYIA 1HW5A 5D6EA 2PQ8A 2QVOA 3L09A 3R60A 2EV5A 4P9UA 1PP7U 4UVBA 4KICA 2P7VB 4KA4A 4G7OF 2AXLA 1W4MA 3DQVC 3TOBA 2XROA 4ZYEA 2XRNA 5JI6A 1FOKA 1ZH5A 3DPTA 1FT9A 3FX3A 3C7JA 4L5IA 1SD7A 2XKPA 1T39A 3EUHA 3WGIA 2IP2A 4GCVA 2Q8KA 2M87A 2TDXA 1YFHA 5HS9A 2QM3A 4WX9A 4MEXF 2JZYA 3K9TA 2UXNA 2FBKA 3GF2A 3FXRA 5H20A 3E3VA 1FSEA 4FX0A 2CQKA 1R36A 3LA3A 4AVPA 5H6QA 2RNJA 3GEZA 4M6XA 1I5ZA 1OMIA 2IPQX 4M71A 1R23A 2P7CB 1J0RA 4LJZF 3IC7A 5FFZA 5DCMB 2OAZA 1D3YA 3VB2A 3DEUA 2YU3A 2Y0MA 1RI7A 3BZ6A 4I0AA 1BBYA 1O7FA 2NAZA 3RKXA 3JAMK 1ZG3A 2M45A 3QU3A 2J5PA 2XAGA 4D0PA 1SMTA 1R22A 4MQVA 4TV7A 1ZRCA 4UV8A 4XSZF 2PI0A 4HZFA 2W84A 3ECOA 2PFBA 3HIFA 2G9WA 3W6KB 1UCRA 4HX4A 1S3JA 1TTYA 2H27A 1PDNC 1PP8F 4HF2A 2HTSA 1ZLJA 4EJWA 3J81K 5BPIA 2HYGD 3B73A 5JFRA 3LAPA 1J5YA 4N9IA 1R5GA 1G4DA 4RGXA 2H09A 5LGTA 1G3SA 1R7JA 2V1UA 3JSPA 4Y15A 1ZN2A 3BJOA 1B6AA 3HHHA 4MTEA 3EDPA 3K1MA 3HYIA 4G6DA 3SQNA 2VONA 5ICCA 5K5RA 1LDDA 5D5UB 4PGGA 4R79A 4IHTA 1G6NA 2W85A 4I09A 5HDNA 2RVCA 4O6JA 1DP7P 3MFKA 4KN7X 1TNSA 3I53A 1R58A 4FT8A 3WTZA 4OMYA 3P7NA 1EV7A 2XKOA 3F8NA 3JTHA 2R3SA 5LRRA 4B09A 4DNCA 3COAC 4ENNA 3R6SA 3JSOA 2VC1A 2ADUA 2F5EA 1W5TA 4KYWA 2NS0A 1I6XA 3ULQB 4M72A 2WV0A 3FF5A 2QBYB 4XLPF 5H6RA 3WTYC 2DT5A 2OQGA 2LF7A 2ZJ2A 4UV9A 5AONA 1R00A 5CVIA 2STTA 1TBXA 2QUFA 4PZJA 3S2WA 2AS5F 2RDPA 4HLXA 3M8FA 5DUIA 3N4MA 2K02A 5E18F 3CO7C 4EM2A 2QQAA 4HF0A 4RGSA 4HQMA 2HR3A 1Z6RA 5FD5A 2HFHA 1JGSA 1YIOA 3V7SA 3KZZA 2LF8A 2R7DA 1BC8C 2RV8A 3Q9VA 1YG2A 3I54A 1PUEE 5LGNA 1T98A 5BPDA 2EJRA 5F1RA 1K6OA 2Q2EA 5D5XB 3LFKA 2A68F 2FA5A 1D5VA 1IW7F 4BHCA 1TQPA 3HOSA 3GZ5A 1H0MA 4EV0A 1GXPA 1HBXG 2VODA 1QPMA 3MQ0A 4IVNA 3M9AA 1XCVA 3HSFA 2ESHA 3LQQA 3GX4X 1XGNA 1SFXA 5DUKA 4AD9A 1SFUA 5DV5A 4LLNA 2EB7A 4A12A 2DO7A 3LQRA 4OU0A 2FRHA 4KUMA 3GWZA 4HOBA 1ZLKA 3JW4A 2NRAC 1IRGA 2BV6A 3E6BA 1ZREA 4RGUA 1KGSA 1FP1D 3C1DA 1LDJA 1O3QA 1WKMA 1J75A 2IJLA 3N97A 3CUOA 4XSXF 3L2CA 2G7HA 1LEBA 2MH9A 1IN8A 2V9VA 2VBWA 4G7ZF 4LD5A 4RAZA 2V1DA 5D8LB 2GXBA 4IPAA 1BJAA 1YW8A 1SAXA 3BJ6A 1K7AA 1RZ4A 2G7UA 3V8JA 2XVCA 5DDGA 1TLHB 4IXAA 1LEAA 4BXUA 1L3LA 2YX7A 3H3UA 3J81Z 3ZN1A 4EJUA 4MQ9F 3RI4A 2Z99A 4RB1A 3MZHA 4HDUA 2XGXA 3KFWX 1FX7A 1IN4A 4GYIA 2YX4A 2QQ9A 2B0LA 4P55A 5HVQC 5JR3A 1QNTA 2MA3A 2UWMA 1XSXA 1B59A 3ZMUA 2KJCA
chains in the Genus database with same CATH superfamily
1GVDA 4A3DJ 1LKXA 3QRFF 3JREA 3WG7H 3Q0UA 1U2WA 4BBRJ 2KISA 5J6XA 3AL0C 2K27A 2HPMA 3D5RC 4JOMA 4ETSA 5C3EJ 3I58A 1O3TA 4CCKA 1TQMA 3HG9A 1A6IA 3J80K 2MH2A 5FROA 3CCMI 5F0HA 1D0XA 3QYEA 4W97A 4YRVA 4M9SA 3CUQB 3BTIA 2DA3A 5L3DA 3OYAA 1K83J 1JUMA 1W5SA 1S8NA 1IN7A 4M74A 1R4MB 5K5OA 2KRHA 1BA5A 2EQRA 3TDZC 1XPXA 3Q0VA 2VKHA 2KLOA 3KEYA 4MNUA 1ETVA 2KZGA 3LOCA 2W4SA 1JT0A 3IH3A 4Q48A 4KITB 2PLYA 2CGPA 2DMPA 3GLXA 1DGRM 3JTGA 1QU3A 1BR2A 3F8CA 1X1AA 3TBIA 5DM7F 1X1PA 3QODA 3GO5A 5F0FA 3ZP5A 4E7IA 3E5XA 4HPQA 3K4BA 1PUFA 3BOQA 5EEHA 5ILVA 1FJLA 1IRFA 1O57A 2CRGA 2M5WA 1YTYA 3IUOA 1I27A 3H0GJ 2CUFA 3S1MJ 1QHHD 2GOMA 3MKZA 3L9FA 4V19K 3PIOF 3OMYA 5LGUA 3PJRA 1P6RA 1XGSA 4CGZA 3F21A 1N75A 4FISA 2Z3YA 3LSGA 3HTUA 1DUXC 3CF5F 4M3FA 3F22A 2LKPA 4ZDLA 3W2AA 5GAEJ 3U9GA 3RPUA 2V79A 2LSOA 3MKWB 1MBFA 1T08B 2DJNA 3TP3A 2X6WA 4LG0B 2TRTA 2VQGA 3FMQA 3OYDA 5B1BH 1H89C 4ZYAA 3LL7A 3JRAA 1U9NA 3BP8A 2VJ4A 4OINF 3O6BB 2RAEA 4D5FA 4FCYA 2R7OA 1MMNA 1SD4A 3LWFA 2CQNA 4PJNA 3RKYA 3VOEA 4GFBA 4YFXF 4KT6A 2VE8A 5ED4A 2Q0OA 1R6RA 3HGGA 1HKQA 1N25A 3U1DA 4YIRX 2Z33A 2FNAA 1XCBA 2H6CA 1YJNI 1V5GA 4M3EA 3Q9SA 3WGHA 5BOXA 2XPVA 1VQMI 3G3ZA 3Q0WA 4S04A 2NVTJ 3L00A 3FXUA 2HWVA 1Y6IA 3ZMSA 1H8AC 3HTSB 1U8RA 4GO1A 1WCMJ 2R5ZA 1Q1VA 2ZXHA 3HSRA 4RBOA 5EG0A 1BJZA 2W24A 3FXKA 2P4WA 1HCRA 2M1BA 5HOOA 2M2EA 3GTGJ 2JVGA 1CGPA 3PFIA 1R49A 5CKTA 4IL6C 3TO9A 2MSYA 1IN6A 3K1NA 4HV5A 4XRFA 1OKRA 4UNOA 5E20A 2PBIA 1FY7A 3OYCA 4PJ0C 1C0WA 4WXDA 1KU2A 2STWA 3T5XA 1MBKA 2CV1A 2EA4A 3NQOA 1EJ9A 4Z6YA 1ZG1A 2ZFWA 1F4KA 2PJPA 1J2XA 4XLEA 3DKYA 4M6YA 2FBHA 2A6HF 2VOOA 3FXLA 3QAHA 1BIBA 4PGHA 3IRQA 3GZNB 3MEXA 1BI0A 4LLGF 2CW0F 2MLKA 4UHTA 1REPC 4NBQA 3F8BA 5DD4A 4BHBA 2GBYA 4HF1A 4L5EA 4NQWA 3V8KA 1IDZA 3BC8A 3FMRA 2TCTA 1D8JA 3I0TA 4X6AJ 2LG4A 3CTAA 3VDXA 1LJ9A 2DOAA 4XL9A 4O5VA 1AU7A 5L3BA 1K79A 4YELA 3PSFA 3L7WA 1JKRC 1XGOA 2WB1A 1RUOA 1D0YA 3SYTA 1T6SA 1XD7A 2ZNZA 3ZQFA 1Z67A 2L9NA 2JRMA 4B1RA 1IC8A 1WVRA 1ETQA 5E8GA 4JX4A 2X6XA 3F8FA 2X6YA 5A2QR 2P6TA 2QGUA 3DU6A 2L9SA 3E6CC 4CZCA 2L7KA 5TGTA 5KK1A 1FIPA 1R1VA 2IA2A 4CXFA 4L5JA 2R7QA 2V9KA 3AAFA 1Z91A 2FMLA 4HW0A 4G94A 2O8XA 2VT2A 1U5TB 1X2NA 2Y48A 3BG9A 2BOLA 2ZCWA 3KEQA 2LLKA 4EGYA 4E7KA 1JJ6C 4IHVA 1KA8A 2O7OA 4AIDA 1QHGA 2KRFA 3IKVA 4A3IJ 4AIHA 3I5UA 3LSJA 5D8KB 2JT1A 5L3EA 1MDMB 3OYJA 2FMYA 4WWCA 3PQJA 4HLYA 3CCJI 1ZGAA 2WAFA 4I76A 4XRMA 1IO2A 1XMKA 1IV8A 5ICFA 3HRUA 4DYRA 2IGMA 4FE7A 4XICA 2A61A 4JX6A 2K9LA 3JRDA 1YQAA 5B3SH 1Z0XA 3V8LA 2HDWA 4BACA 3J7AY 2RREA 2F4IA 2XC7A 2EFOA 1VQ4I 3BT9A 3ELKA 4NB5A 2DXIA 2H1LA 1YO5C 3GTMJ 5IYCJ 1BN5A 2WBMA 3DPLC 1FOYA 4XQFA 2H1KA 4HX7A 1B4AA 4BEHB 2ACJA 3LSPA 2DQLA 2KHMA 1Y56A 1J59A 3HC7A 1HF0A 4DZPA 1QA6A 1USSA 3GTQJ 1FTZA 2DA4A 2DLLA 1Z3XA 1HQCA 2ZMEB 2L4AA 1XDSA 1HKSA 4DJAA 1PVEA 3CCQI 5CQEA 3RIRA 3D1NI 1HDPA 4LMYA 1MBJA 3REOA 1JGGA 2DPUA 3EQLF 3WTVC 1T95A 2HPIA 1P2FA 5HLHA 3GFIA 1X19A 3K69A 3FMSA 2BVLA 2LOOA 3JAMR 1MMGA 2BHZA 3S3MA 4HA8A 1RETA 2DN0A 2DFHA 4EJVA 3D5LA 3FWEA 3HUGA 4XORA 5HLTA 2K9QA 2GM4A 4UVCA 4UB6C 2XV4S 3KP5A 1VZ0A 2EIJH 1VQLI 1FLIA 2E7XA 2KIUA 2WB1N 2R7UA 3J7AO 1GXQA 2IGOA 5IYDJ 1HW1A 2A6EF 4GDFA 2DCEA 4LIUA 5CQGA 2K9MA 1LVKA 3CUQA 2OC6A 4U7BA 5LRSA 1N78A 2BY2A 3KYLA 1SEUA 1MNDA 4AC0A 2OZ6A 2NNNA 4F52A 2FE3A 3K2ZA 4L9NA 1ULYA 2P5VA 3SXYA 3G71I 1S7OA 4PFOA 1E2XA 4ZJZA 4A6DA 1VQ6I 1RQ6A 4A69C 3R61A 1R5HA 2DDBA 3AFHA 3K4LA 1OQYA 1JKQC 1L0OC 4N4NB 4EQQA 2YSRA 3G6EI 3J80Z 1WH5A 1ZYRF 4GRIA 3GTKJ 4J19A 1WJCA 3BR5A 2D45A 4PDKA 2HDCA 2MFZA 4A3KJ 3ZMTA 1ERDA 2WA0A 4CCNA 4RAYA 5FKOA 3FK7A 1W7PB 1MIJA 5DM6F 2KDOA 1FIAA 4UUSB 2Q1ZB 4BAYA 1S6LA 3E5UA 2VKDA 1IZ1A 3HRSA 2OZUA 3CF2A 3FHNA 4WF2A 4HNVA 1NG7A 1D0ZA 3K1PA 5J4VA 2FEZA 1ZG5A 2NVXJ 5DCFA 1I39A 4XLHA 4Y7NJ 1P4WA 1BI3A 2CW7A 1SMYF 4LG0A 2HKOA 2QF7A 3OY9A 2QZ8A 4XMYA 3ESWB 3OIQA 4CCMA 4Y13A 3S15J 4NC6A 3KIOA 1GHCA 1HXDA 2DA2A 1T38A 2JPCA 2IEKA 2L9VA 2Z9OA 1POGA 3OR1C 2Z2SB 4LOCA 1IRZA 2HZDA 4OIPF 5DD8A 3OYBA 3U2RA 4PJJA 3GTOJ 1Y39A 2ZBKA 4HX8A 4BE2A 1QVTA 1WH7A 2KIQA 3RKWA 3QP6A 1I3QJ 2GA2A 2O0YA 1S9HA 3ASNH 2AQEA 2MGQA 5CVVA 3SDGA 1K78B 1M1EB 1TT5B 1ONVA 1P92A 1VQKI 3HM5A 4G7HF 2K9SA 4UUVA 4M3DA 4FHTA 2OA4A 3P5JA 5M3FJ 4BBSJ 2XUBA 3O8HA 3ZXSA 4C3HJ 3KLOA 4GGGA 2PJRB 3TGNA 4BY7J 2HKXA 2R7WA 2VPRA 5K5QA 4Z2YA 1MJBA 1W5CC 3ABKH 2E36A 5ILUA 4CYCB 5D4SA 2L7MP 4M73A 3DV8A 4I0BA 1U8BA 4B4CA 3S1RJ 1WI9A 3ONQA 2MZ4A 5LHHA 2HVSA 3F6OA 3P9CA 1JHHA 1SD5A 4BH9A 2K40A 2QENA 4CYDA 5E3MA 1EH7A 1X3UA 1MJAA 2DYSH 3KP7A 4PSXA 3CCEI 1QPIA 1OCTC 4F91B 3V7CA 2A3SA 3GTPJ 3DEWA 3AG3H 4ZDOA 2XRLA 4FE4A 3D0SA 1OR7C 1UELB 2Y69H 2LBFB 5IT9Z 4IRIA 1R5ID 3IP4B 1BI1A 2VBYA 3O2PE 1SFKA 5TJJA 2JA8J 4NC8A 3LFUA 5DCMA 2K4BA 2R7ZJ 2CW8A 1RRJA 2KFDA 4QPOA 3WE3A 2HU9A 4XIDA 1HKTA 2A5WA 2PMUA 3FDYA 3NWSA 4EM0B 2DTZA 1V4RA 4XK4A 1UFMA 1UMQA 2KMUA 4BQNA 1OYYA 1ETKA 4JK1X 5LEKA 2IW5A 1P4AA 2HOEA 2OBPA 4RB0A 1ZRFA 2P5KA 4U0YA 3CJNA 2L3DA 4ZYDA 2JA6J 1KQ0A 4MFEA 1XGMA 3BDDA 2YU9J 2ID6A 3SZPA 4EGZA 1BL0A 1G2HA 3M8EA 4MEYF 5C44J 5E79C 2VOPA 2PX9A 2QYOA 1Z7UA 5F1JA 2R93J 2HGCA 3T8RA 3NAUA 4LGWA 5FRNA 4MHGA 1HSTA 5M5WJ 4DYQA 1VFCA 3CCYA 2RQQA 1W36C 5BNGA 3HSEA 2QWWA 2ZNYA 2LP0A 4A5MA 2NVQJ 3EYYA 1U5TA 1K6YA 3OYEA 4WXHA 5J8FA 1WRJA 2KZVA 4RB3C 3KLNA 4BU2A 3KZYA 2XF6A 4D7MA 4GYGA 2E1MB 4PK4A 4LIVA 1MDMA 1WQ2A 2K85A 2M30A 3BR6A 4C3IJ 2XGEA 3MKYB 3IWZA 2DTRA 2E34A 4BGDA 2FUG2 1RNLA 3F6VA 2ME6A 3J7AW 3CQZJ 1NG6A 2HQ5A 1D1AA 4OWRB 2DYRH 2FX0A 3IWFA 3K7AJ 3WTTC 3EUAA 3KYDB 3F0CA 2CUEA 4IEJA 4LLLA 3OS2A 5EYRA 2CJJA 2IAIA 2VBZA 3VYUB 3KP3A 2VASA 5FJ8J 3WODF 1AKHA 3ZQCA 2M35A 3A02A 3ZPLA 2ME0A 2BVMA 2VKVA 2F4OB 2RKHA 2H6BA 1O7LA 4BEHA 3SZTA 4BQAA 3ERMA 4BYYA 2E1OA 1Q1HA 1MMDA 4A3EJ 4RLQA 4CA0A 4DIQA 1JI8A 3KE2A 2JSCA 1X3WB 3S93A 2DW4A 5FLMJ 2R0QC 1MGTA 2JTVA 3MD2A 1YRNB 1OJLA 2UZKA 2ZMEA 1ZGWA 3DKWA 3H1CA 1SD6A 3TQNA 5HLGA 1E3HA 4YIFA 1USTA 4QTRA 5ILSA 3A01B 3V4GA 4I98B 3G1LA 1FBQA 5D5WB 1WZ2A 3OL4A 3F72A 2GQQA 4XBFA 1F5TA 1Z1DA 2XAUA 1W0UA 1AWCA 2QQBA 3MWMA 4P5OA 5TRDA 2QSHX 2ZSHB 3L2RA 3LSMA 1RKTA 1G3TA 2MD0A 4BS9A 1EH8A 4H4KC 4L18B 3FM3A 3TW6A 1XSVA 3RCOA 1WJBA 1XMAA 1BOBA 4OAYA 4QWQA 3OWTA 5B5EC 3DXJF 3LSRA 5BMZA 5FFXA 3JR9A 4HBLA 1V3FA 2LRDA 1LPQA 4II3A 2WADA 1CQTA 1OR7A 3SEZA 3GYHX 1FTTA 3BPVA 3DTKA 2ELHA 1QZYA 2BHYA 2GXAA 3F3XA 3IKTA 2ETHA 2HQAA 2PG4A 5F27A 1G8XA 2FQ3A 5EJCA 4XONA 2DPDA 1HC8A 2OU2A 3GFLA 1I1GA 2KP6A 2ZFUA 1Z77A 5F6FA 5M5XJ 2KT0A 4XN3A 3TDUC 5JHUA 2CH0A 5K7HA 2QLZA 4BXFA 2YUSA 2L54A 5IP7J 2EIMH 4PJLA 2CUZA 3I59B 5J3LA 4C30A 2L02A 2NNYA 3S14J 4MFDA 1BR4A 1MH4A 2DK5A 3ZMZA 4EATA 2CO5A 4UUSA 2BY1A 1UG0A 1J9IA 1WJDA 2WTEA 1PYVA 5LEJA 1ZRDA 1MH3A 5AIPA 2PN6A 5KAIC 1X1DA 3H5AA 2DT7B 2QBYA 3DPUA 2EFQA 4KIBA 3UNGC 3JRGA 3I4PA 3FXMA 5HNFA 4ON0A 4I2OA 1MMSA 1JE8A 3GFMA 1W36D 5CLSA 1VNDA 4G8XA 1TNTA 5J8CA 1R1UA 4HG2A 4DQ2A 1NK3P 2Y75A 5JLWA 2L4MA 2VBXA 1IF1A 2XAFA 2NOJB 2W57A 4XOTA 3K0LA 4ESFA 3WTXC 4U7DA 1JUSA 1QZZA 1TW3A 5GTHC 2IS1A 4O3MA 4RGRA 2M8GX 1BR1A 3VFZA 2JUCA 5C4JJ 3RPUD 2MLGA 1P4XA 2GWRA 4MTDA 3SHFA 1S29A 1FWZA 1K78A 2LMDA 2CYYA 2OF7A 2QQ8A 1XX5A 4YFNF 3ZGKA 2P5LC 1O3SA 3F9KA 5DYMA 3LA7A 4M3BA 2K5CA 5L3FA 3HOTA 1D8KA 2DMQA 4M9XA 3R0AA 3JRFA 1QBJA 2E1CA 3JRCA 3A52A 2L0KA 4RDUA 4FQGA 4DGWB 5KNLA 2CFXA 2Z5UA 4LB6B 1F9NA 2VLAA 2Y0SA 1ETWA 3T8TA 4WXCA 4KMFA 1DGWY 5ERIA 3RPQA 5CVJA 1WWXA 1UAAA 4CYCA 2V6EA 1IXRC 4ZYHA 4N9HA 5GP9A 2LY9A 1MSFC 5EZGA 3HXLA 5GAGJ 5E1WA 1BC7C 3VWBA 3CC7I 1ODDA 1MSEC 2ECCA 2ZC2A 1ZGJA 2RGVA 3OYNA 1RUNA 3NEUA 3GBGA 3E6MA 4ASNA 1I6HJ 2VC0A 1T2KA 3QPTA 2R7VA 2OCCH 1FZPB 2VJ5A 4LK1F 5IT9K 2XHKA 3H9QA 4Y3OA 2K9NA 5GPCA 3S3OA 2LREA 2EILH 5J47A 5A2QK 5IT3A 3T0YA 5CJ9A 3RYRA 2HYJA 4CHUA 3OIPA 4OMZA 2XIGA 3VEPA 3RDIA 2MW8A 2GIVA 3GFJA 4A2UA 3KPHA 4DW6A 5GPAA 1RR7A 5HDGA 5TISC 3FM5A 3ISPA 2EZIA 4XLNF 2VKEA 3SFIA 2VJJA 3CUQC 1KYWA 2HNHA 2DK8A 5CVRA 2X1EA 1H9GA 3DU5A 3L2QA 1U78A 2H8RA 4ESBA 2QCOA 4YFKF 4EMSA 1YX3A 2V1NA 1JHFA 1D1CA 3WU2C 4EJOA 3BWGA 2KIFA 2DBBA 2E19A 2IGKA 3LSTA 2HI3A 3ZMVA 2A5YB 1S72I 1LDKB 2Q2EB 2JK3A 2JA2A 2L7FP 1IJWC 3ABTA 3W2VA 5E17F 5E3OA 2DMTA 1MBEA 1UB9A 3BR2A 3LMMA 2W7NA 5LFAA 2OQRA 3E7LA 3NARA 5JVTA 3PFYA 5E3LA 1LUJB 1IXSB 1IRXA 1R1TA 1Y0NA 5HLIA 3TW7A 1BW5A 3HHGA 1P7IA 2MC3A 1WSUA 2VJIA 3CP8A 3FHZA 3W6JB 1O4XA 3KZIC 5JHFA 3JRBA 4IJAA 1V55H 2VT3A 2ICWG 2D2WA 3WE2A 3MCZA 3MZ8A 3ZQHA 1Z05A 2Y0SN 3HZJA 5FLXK 1FPQA 3LSKA 1LE8A 1XDUA 3P9IA 2A05A 2COBA 1FBUA 4D1QA 2VXZA 1EA3A 2JN6A 2UXXA 1FYMA 3DF8A 3KP4A 4JBAA 3B6CA 2F5DA 4BHPA 2NYXA 5HS8A 3KYCB 2H94A 3V7RA 4IHXA 4IOAF 1YJ9I 3CCSI 2KL4A 5GAHJ 1B9MA 4B44A 2I10A 1ZR2A 1LVAA 1Y8QB 4EJTA 3G73A 3M8JA 3I71A 4HEA2 3M1EA 1J7KA 1DPRA 2LDUA 3A4CA 3EUKL 4C2UA 2YS9A 5D6FA 4ZH4F 3MZYA 1VQPI 5FD6A 4E7ZA 4AWXB 2L2OA 2LC2A 2EFNA 3TMOA 5ICGA 1AHDP 2EK5A 1YRNA 5F0CA 4IRGA 4FASD 2E1NA 4KIFA 5LHGA 3IH4A 2EA2A 1E17A 4G9YA 2LKSA 5E8IA 1YS7A 4EVIA 1X4OA 3B02A 2W00A 5KAFC 3HOXJ 2HYFA 3A01A 4WCGA 1QQIA 3ABUA 2V4JC 4ESJA 3CZ6A 2GA1A 3VODA 1CF7B 2K7LA 1QO0D 1TWCJ 1XN7A 2CSOA 4HAMA 3RZDJ 3HDDA 3KP6A 4EEFG 4JQFA 2I5UA 3HOYJ 2BY3A 4XLFA 4BJTA 2EIKH 4QLCU 4AIJA 4U88A 1IUFA 1YYVA 2QSGX 5DS9A 2R7FA 4Q4ZF 1OYWA 5D4RA 4Y4RA 4M3GA 4OIRF 2IRFG 3GLLA 4MGRA 3DEEA 2FNPA 5EEGA 1TZLA 2IXSA 2EV6A 2O3FA 4Y17A 2XB0X 1TWFJ 4R1HA 1X2MA 1WJFA 3FBNB 1SVOA 3BROA 3HRTA 1FC3A 3OS1A 2JRTA 4IRHA 4XRSG 3M07A 4F7ZA 2DFFA 5CYVA 1H9TA 4GXOA 1A31A 1U6GA 3TKYA 1KONA 2F5VA 5JVGF 2X85A 3BPXA 3S3NA 1IG7A 3OOUA 2VQHA 2YPRA 2W82A 4P1WA 4PJMA 4KIGA 1HSJA 4N0BA 2XAQA 3GMEA 4FX4A 1EKEA 2DU9A 2RNGA 1OFCX 3MVPA 3GZ6A 1UHMA 2P6SA 2L9RA 4KDPA 4RS8A 2M0CA 3BQZA 1TWHJ 1YS6A 3S32A 3KETA 4ZYGA 3HOZJ 3WGGA 3I59A 3EYIA 3GUDA 3RTRA 4AIKA 1JKOC 1FYKA 3VSKA 2HEOA 4Y52J 4XKVA 5M5YJ 1B1BA 3Q5FA 3K2AA 5J1YA 3F8MA 1QZEA 3VYTB 3S1NJ 2XPUA 3LA2A 2P8TA 4RM3A 3P9KA 4NDLA 4FTHA 1NK2P 3ZQQA 5KCMA 3BCAA 5LLQA 3RZOJ 3J81R 2IA0A 2GXGA 3HRMA 3BZKA 4C9YA 2KDZA 2BYVE 4CO8A 2BBYA 4P9FA 3OSGA 3QOPA 5J40A 1GV2A 3H92A 3M7GA 4L0YB 5E1ZB 2UV1A 3ERED 5CVUA 4ZZDA 4U0WA 3T1BA 1U5TC 2D1HA 2QKLB 4H0EA 1UJ8A 1XMXA 2YR2A 1JTYA 2A07F 3MMYB 1OCOH 2HOTA 2IBDA 3IL2A 2EV0A 3BR3A 1ETOA 2A69F 4KN4X 5LHIA 1JXSA 1PJRA 2D5VA 1UHWA 4HDVA 3C2HA 4CICA 2OCEA 1ZQ3P 3WHBA 1DDNA 3S17J 1FP2A 1R9TJ 1LFUP 1MJ9A 4CDGA 2LR8A 4B8XA 2X1DA 2WAQA 1Z9CA 1HW2A 4JYKA 2ZKZA 2ESNA 1ON1A 5D5VB 2IS4A 3CDIA 3MAJA 5EGOB 5FRMA 3HJEA 3U21A 4IHSA 5FO5A 2IVMA 2WY8Q 3ROUA 1I1SA 3GXOA 3I56I 4A3MJ 2JMWA 1MKMA 2VPLA 3WTSC 1YW7A 2ZXJA 2OD5A 4LFUA 4B47A 4BQQA 3QPHA 3QP5A 4BKXA 4U0VA 3X2QH 5AIQA 2XB5A 4RA2A 2IT0A 1MZBA 3WTWC 2I8DA 5EZHA 3KCCA 3IV5A 2FOWA 3AG1H 4RMNA 4DOZA 3PQKA 2ZMEC 4PCQA 3DBHB 2EFWA 1BOAA 5F08A 1NHAA 3EPZA 4CZZA 1S5LC 3E6DA 3CC4I 3GW2A 2FU4A 4QIWN 2E7WA 2VI6A 2DT6A 3QYBA 1DPUA 2M0MA 2W25A 5IP6A 3FKIJ 3CO6C 2CU7A 3ZMDA 1MNMC 5FKKA 4KT5C 3CLOA 4G6TB 1B8IB 2DI3A 2LNBA 3EETA 3QPLA 1TT0A 3W2WA 2FXAA 1VTNC 1KQ9A 5K1YA 1MMAA 4YG2F 1B9NA 1MBHA 3BG3A 2PEXA 4KNYA 5L3GA 1HA8A 4I02A 4BE1A 2E60A 3QYFA 2L01A 3PM1A 3QWLA 2K86A 3H3ZA 2ZO4A 2RQPA 2O61A 3RYPA 4IOCF 1JUPA 2RN7A 1G3YA 3C2GA 1BM9A 1LFBA 4CCLA 2R4GA 2O6GE 2FSWA 4J00A 4KISA 2JA7J 3SFZA 4BUPA 3Q3SA 1ACIA 3A1YA 1IN5A 1I3AA 3CP2A 2PMHA 3ML6A 2BGCA 4RLFA 4A0YA 5LBQA 2R7XA 4N4OB 5A2QZ 2CV0A 1O3RA 1GUUA 2EFPA 5FGMA 2Y2ZA 3RQ4A 4UXNA 2F5CA 5IOZA 1ZAOA 5B66C 3RKQA 4M6VA 2R5ZB 3GVAA 1MD0A 3WTUC 3HOVJ 2QEXI 3WU1B 1VQOI 2AXTC 2ISZA 3OYKA 1BIAA 1TWGJ 3DFGA 3CCRI 1X3ZB 1YHQI 1XS9A 5H2FC 1KU7A 1IUYA 1U3EM 2WAQN 4XNFA 1V5FA 2CUJA 2DDAA 3HB9A 4IZZA 3DP7A 1LB2A 1JTXA 3TP0A 4BJ5C 1KYZA 2FBIA 4K2EA 1HLVA 1AOYA 5KHDA 2Z1DA 1WGXA 2FOKA 2BE5F 4V2FA 4XKWA 1IAWA 4ENJA 6PAXA 3K10A 1GVJA 3ECHA 1LNWA 4XLCA 2XSJC 1XG1A 2NS7A 4BY1J 3CDHA 4BE0A 1XB4A 4HSTA 3AL0B 1JT6A 2X1CA 2ID3A 5HDKA 1T8IA 2B63J 2KKOA 4AUXA 3CJQB 2CG4A 1DU6A 2M3AA 3M1CA 1F43A 2DA5A 4ZZLA 3QOEA 3QU6A 4ENKA 4E4HA 2M8EA 2ZJQF 3DLLF 2ELJA 2ISYA 2M9HA 1SFEA 4LK0F 1TQIA 3ZQGA 3OSFA 1YW9A 2AQFA 4U87A 4P96A 2KJBA 2L7ZA 5FLXZ 2DMNA 2VE9A 2GZWA 1MW7A 3WG9A 1SFOJ 1FOXA 1QRYA 4UVAA 1S7AA 1T0FA 1E0EA 2EINH 4A3LJ 5BS6A 2A6TA 1Y0UA 2V7FA 4I99C 2L5QA 3O3KA 5KVRA 3JAMZ 2M34A 1HOMA 4XLAA 2O03A 2HOSA 4OIQF 4B43A 1G3WA 4A0XA 3IHUA 1CF7A 2NVYJ 4WK8F 3OYLA 1LQ1A 2ZXWH 3RJPA 3E97A 1X1CA 1ZHFA 4HYEA 3L1PA 2JQ7A 3H5NA 4NUBA 1VQ7I 3ZQ7A 4B3AA 3K4MA 5E1XA 3F23A 3IRRA 5GADJ 2X0LA 5F64A 4L9JA 3JRHA 2HXIA 1X1BA 4IQJA 1B72B 1F1ZA 9ANTA 2BXZA 3FZVA 2FF4A 2COMA 3OR2C 2HQNA 3K4NA 4Q5SF 2D1VA 4AM3A 2WY7Q 4PSWA 4M9ZA 2WC2A 3QPSA 3WHCA 5HS7A 3C18A 3S16J 2ECBA 2K4JA 2M4KA 1EH6A 2B7EA 1RIOH 3I9V2 2X6OA 1U9OA 4J01A 3PNYA 2DAOA 3VYSB 4IO9F 3BTJA 1BI2A 3BR0A 2CWEA 2EZLA 2HTJA 2EWNA 4ENMA 3J7ZI 3TO6A 3TL4X 4NC7A 2LVSA 4R8HA 3FK6A 4F93B 1KQ8A 2LTPA 2W48A 2DA1A 3IAS2 3PSIA 3ZQLA 4F55A 2RC4A 2DFIA 4KFCA 2XF7A 3LAJA 2KRCA 3E0JB 4NHJA 1ON2A 1SVMA 4A6EA 5HODA 4S05A 3HPHA 4IF4A 2NVUB 5BQTA 3KEOA 2KIMA 2BW3B 3MKLA 4A5NA 4XM3A 3TO7A 1K61A 1FYLA 2CQ7A 3JRIA 4HNTA 1FBSA 2MBFA 3NWTA 1IXCA 3G1OA 4X1EA 2AHQA 1YOVB 2J5OA 4JX5A 3I64A 4Q47A 2GOXB 3CCVI 1XSDA 1OPCA 4KJZA 3WU0A 3H9JA 4CH7A 2F5FA 5FB2A 4I01A 3BJAA 4G6QA 2HS5A 1MBGA 1AA7A 5DEQA 1WHUA 3M3YJ 4UB8C 3ZN0A 3BY6A 1RESA 3R4KA 2M4GA 2VIXA 4KMUX 1YLFA 4DBQA 3L2VA 1W7PD 3HUGB 1OCCH 1W7PA 4CSWA 4YIIA 3DKXA 2GAUA 4LB5A 1SANA 2JA5J 3SEQA 3NRVA 2DQRA 3R0JA 1UZCA 2Y9ZA 2E1MC 2BXYA 3K4JA 3HOWJ 2MD5A 2MG4A 2WWYA 2DJIA 4LG3A 5ICEA 4L0ZB 4OIOF 2XASA 5J1RA 1Z6TA 3C3WA 1E3OC 4L9TA 2IA1A 2IGNA 2XAJA 1WJAA 3E5QA 1X4PA 1STZA 2FJ1A 2HZTA 4I7HA 2OUMA 2VN2A 2F2EA 3OOPA 4HV6A 4E70A 3OYMA 4BNCA 2X4HA 3GTLJ 2BEOA 5L3CA 2MABA 1R4NB 5EGOA 2HQRA 3UR3C 1IGNA 2C6YA 1WFXA 4OOIA 2DOFA 3TOAA 1TW2A 3PNVA 3K70C 3M4OJ 4XKCA 2JPBA 2VXDA 1RPWA 5DTDA 3OV8A 2B9SA 3FXQA 2V1XA 1KU3A 3IAM2 2V6CA 1ZELA 2CQXA 1FSHA 4HQEA 1WI3A 4L9VA 1KU9A 4A0ZA 3SJMA 3KP2A 5M3MJ 1K4TA 4EM1A 1QGPA 4RB2C 1FNNA 2OV7A 2PJRA 1ZARA 1A04A 2XAHA 1OYIA 1HW5A 5D6EA 2PQ8A 3H5RA 2QVOA 2E5ZA 3D5SC 3L09A 3R60A 1APLC 4DBRA 4QSHA 1Z21A 2EV5A 1B8IA 4MLOA 4P9UA 3J80R 1PP7U 4UVBA 4KICA 2P7VB 2ELKA 2HXOA 1WPKA 4KA4A 1R71A 4G7OF 4UY8I 2AXLA 1W4MA 1SVLA 2EZHA 2KQRA 2XF5A 3DQVC 3S8PA 3C2BA 2FQ4A 3TOBA 4AYBA 2E2JJ 1TC3C 2XROA 4ZYEA 2ZJRF 2O8KA 4DZJA 2WAEA 2LBFA 2XRNA 5JI6A 2GIZA 1FOKA 1ZH5A 3DPTA 1YE9A 1FT9A 4RAGA 5HNHA 1TL8A 3I4MJ 2X98A 3ZQIA 3FX3A 3C7JA 4L5IA 1SD7A 2XKPA 1T39A 3EUHA 3FIWA 4XR6A 3WGIA 2IP2A 2BZTA 4GCVA 2Q8KA 2DODA 1FEXA 5K7FA 2HVQA 2M87A 2TDXA 1X58A 1YFHA 4BQOA 2IS2A 5HS9A 3OYGA 3DTIA 2QM3A 4WX9A 2LKXA 3W6VA 4MEXF 2JZYA 3ABMH 3K9TA 2E71A 2UXNA 2FBKA 4ABZA 3CMEI 3GF2A 2E2HJ 3U1KA 2NXNB 1SC7A 4C2MJ 3FXRA 5GTIC 5H20A 3E3VA 1FSEA 4FX0A 2CQKA 1R36A 3LA3A 1ITYA 2K3PA 4AVPA 5H6QA 2RNJA 2ZXIA 3GEZA 4M6XA 4XN0A 1I5ZA 1OMIA 1SAUA 3GTJJ 2IPQX 4M71A 4CCJA 1R23A 4E7JA 1J0RA 2P7CB 1ENHA 4LJZF 3IC7A 2QSFX 5C4XJ 4LITA 3PL8A 5FFZA 3DWLE 4BJ6C 4ZTFA 5DCMB 2VQLA 2P0TA 1VQNI 2QKMB 2OAZA 2M7BA 1D3YA 3CMYA 4IQ4A 2DOEA 3VB2A 2R5YB 4F92B 1JKPC 3DEUA 2YU3A 1Y8RB 2Y0MA 1RI7A 2E5NA 3BZ6A 4V2GA 4I0AA 1BBYA 2G0EA 3K6GA 3V42A 4A93J 4A3JJ 5IPAA 1YI2I 1O7FA 4E6KG 5IY5H 3PIPF 1OCRH 2LK2A 2NAZA 3RKXA 3JAMK 1ZG3A 2M45A 3QU3A 5IT9R 3S2DJ 2J5PA 2BY0A 2XAGA 4D0PA 1SMTA 5E3NA 3CJRB 1R22A 3K70D 2F48A 4MQVA 4XKBA 4B48A 4TV7A 1ZRCA 2PMZA 4UV8A 4XSZF 5K7ZA 2DFEA 2MVTA 4AYBN 2PI0A 2R7SA 4I6ZA 4HZFA 2W84A 3DTEA 1VF9A 3ECOA 2ZJPF 2PFBA 4ANJA 2R92J 3CC2I 1YITI 3AG2H 3HIFA 1ZKGA 1B72A 3UKGA 3DLAA 2G9WA 3W6KB 1UCRA 2HDDA 1ZK8A 5FKMA 4HX4A 1S3JA 1TTYA 2XPWA 2H27A 4CCOA 1PDNC 1J09A 3BG6A 1PP8F 4HF2A 2HTSA 1ZLJA 3HEFA 4EJWA 4E7HA 1WJ5A 3J81K 5IOYA 5BPIA 2HYGD 3KX2A 1IDYA 3B73A 2F4MB 5JFRA 3LAPA 3OS0A 1J5YA 2NS8A 3CD6I 5CPRB 2LH9A 1AKHB 4N9IA 1R5GA 1G4DA 4RGXA 2LYCA 3CJTB 2H09A 1OCZH 5LGTA 1G3SA 1R7JA 3PUFA 2V1UA 3JSPA 3BTLA 4II2A 3CDLA 3A2KA 1FMWA 4Y15A 3OYHA 2BW3A 2O9LA 4IHWA 2OJED 1ZN2A 3BJOA 1D1BA 1B6AA 3BLYA 5FLXR 1V5EA 2VQCA 1DQUA 4JP0A 1W1WE 1GV5A 3H36A 3HHHA 4MTEA 3EDPA 3K1MA 1ORKA 4ITVA 3HYIA 4G6DA 1LFPA 4YEJA 1A36A 5FKLA 4NNJA 3SQNA 2VONA 5ICCA 5K5RA 1LDDA 5D5UB 4PGGA 5LD2C 1Y1VJ 3BTCA 4R79A 4C2TA 3FBIB 3J7YJ 4IHTA 3SZGA 1G6NA 5JLXA 3MN2A 2W85A 1Z7LA 4I09A 4HRIA 5HDNA 2RVCA 1QVUA 4O6JA 1DP7P 3MFKA 1GLNA 4KN7X 3PUBA 1TNSA 2EH3A 3I4NJ 3I53A 1R58A 3FXJA 4D5CA 1NTCA 2CS3A 2PMZN 4BDYA 1Y1WJ 2EBIA 4FT8A 3WTZA 3CMMA 3BCBA 3DBLB 4OMYA 1UHSA 3P7NA 1VQ9I 1EV7A 1T33A 2XKOA 1TP4A 3F8NA 3JTHA 2R3SA 5LRRA 4B09A 1JJ8C 4DNCA 3COAC 4ENNA 3R6SA 2XGCA 3LSIA 1RC9A 2Z16A 3JSOA 1WJEA 3OYIA 4AU7A 2JJ7A 1XTAA 3VSLA 4UUTA 3BQYA 2VC1A 4BL0B 2EZKA 2XDVA 2ADUA 2F5EA 2LD5A 3HKZA 4IHYA 1W5TA 2ZSIB 3K4KA 2AO9A 1T0FC 5FLVA 5B1AH 4KYWA 2DA6A 3RSNA 2NS0A 4HSRA 5J1UA 1I6XA 3ULQB 4M72A 4ZC3A 2WV0A 3FF5A 1YX5A 3N05A 2QBYB 4XLPF 5H6RA 3WTYC 2DT5A 2LFBA 2OQGA 2LF7A 2ZJ2A 3ZCOA 4UV9A 2JVHA 1OCPA 5AONA 1R00A 3L2UA 1H88C 3G1MA 2NOGA 5CVIA 2STTA 1PUFB 5IP9J 1TBXA 2QUFA 1I50J 4MO7A 4PZJA 4RM2A 3S2WA 5EEAA 2RDPA 2AS5F 1A6QA 3CLQA 3ZR8X 1DU0A 1IV6A 3HL2A 4HLXA 2R7RA 1UG2A 3M8FA 5DUIA 3N4MA 2R7TA 2K02A 4D9JA 5E18F 3G4SI 3CO7C 1OLTA 4EM2A 2QQAA 2UUZA 3QQAA 4HF0A 2CV2A 2M7AA 4RGSA 4HQMA 3RQIA 3BR1A 2HR3A 1Z6RA 2XSDC 2Y9YA 4AVZA 5FD5A 5IYBJ 2JWTA 1F36A 2VB6A 1U0JA 1YIJI 2HFHA 2LY2A 1JGSA 1YIOA 2CMPA 4PFPA 4E7SA 2HVRA 3ZRGA 3HBLA 3OL3A 3FISA 1GT0C 3A0HC 1W0TA 2XGDA 3V7SA 3KZZA 2X9DA 2LF8A 3K4CA 3AKZA 2R7DA 1BC8C 2RV8A 3Q9VA 1YG2A 5EDNA 3O8GA 3I55I 3GCMA 3AG4H 2JUGA 3I54A 1D5YA 1PUEE 5LGNA 4QPQA 4S0HB 3CCLI 1T98A 3A0BC 5BPDA 2EJRA 5F1RA 2LY1A 1K6OA 1XC5A 1TWAJ 2MYSA 5F04A 2Q2EA 3W3CA 5D5XB 4A3BJ 2EPFA 1GDTA 2CQQA 3LFKA 2A68F 5EF6A 2FA5A 3VYRB 1ETYA 2P0WA 3LSHA 1VI0A 1D5VA 4G12A 3DCFA 4X0GA 5EG0B 1IW7F 4RAFA 4BHCA 2E35A 2MUNA 1TQPA 1G59A 2DMUA 3PO2J 3OYFA 4Y33A 3HKZN 1P9QC 3PNTA 4MIMA 3HOSA 3GZ5A 1H0MA 3G2BA 4EV0A 1GXPA 1HBXG 2VODA 2N8GA 1QPMA 3JCUC 3MQ0A 3L2WA 2VUMJ 4IVNA 3M9AA 1XCVA 1A5JA 1ETXA 3HSFA 1MNEA 2ESHA 3LQQA 3GX4X 3PO3J 1XGNA 4BXXJ 2R5YA 1YJWI 1SFXA 2V26A 3S1QJ 2Y31A 5DUKA 2CFOA 4AD9A 1SFUA 3HPGA 5DV5A 1EF4A 3TEDA 4LLNA 1DP3A 2EB7A 2KPMA 4A12A 2DO7A 3LQRA 1T56A 1RR8C 4OU0A 2FRHA 2W1OA 1A35A 4KUMA 1VQ5I 3CESA 3ZOBA 2X51A 4FETA 3GWZA 4HOBA 1ZLKA 4F3QA 3JW4A 5J4YA 2E2IJ 1HDDC 2IS6A 4NQWB 2NRAC 1IRGA 2BV6A 3E6BA 1V54H 1ZREA 4RGUA 1KGSA 1FP1D 3C1DA 1LDJA 1O3QA 1WKMA 1J75A 3OIOA 2IJLA 2X48A 3LNQA 2GLOA 3N97A 3FKJA 2H8WA 3CUOA 3H35A 4XOPA 2F6CA 1FOWA 2Y30A 4XSXF 2OTLI 3I3LA 4A3FJ 3L2CA 3CMAI 2G7HA 4DYCA 4ZDPA 3BG5A 1LE8B 1LEBA 2MH9A 1IN8A 2V9VA 2VBWA 2WV1A 3IH2A 4PUSA 3BZCA 2OPTA 4G7ZF 3VPRA 2V9PA 4HNUA 1K4SA 1Z3YA 4W1UA 5FKNA 4LD5A 3CCUI 1S7EA 4RAZA 2V1DA 5D8LB 4A3GJ 4IX7A 2GXBA 4IPAA 3A03A 1BJAA 1VQ8I 3H3VK 1YW8A 1SAXA 3BJ6A 1K7AA 1RZ4A 2MC4A 1E3PA 2G7UA 4XRSA 3V8JA 3S2HJ 1ZR4A 3BG7A 3ABLH 2DA7A 2XVCA 5DDGA 1TLHB 4IXAA 1LEAA 3DBRB 2K3FA 1ZTRA 2O5RA 4BXUA 4CUGA 2QA4I 1L3LA 4A3CJ 2YX7A 3H9GA 3H0DA 1RKWA 3H3UA 4OAZA 3J81Z 1P7JA 3ZN1A 1OISA 4D7NA 2FD5A 4EJUA 2ZB9A 3EUHC 4MQ9F 3RI4A 3B6AA 3E1SA 2Z99A 4RB1A 3MZHA 2OTJI 2HOAA 4HDUA 2VL8A 2XGXA 4B3XA 1NH3A 1KZHA 3KFWX 4E7LA 1FX7A 1IN4A 4GYIA 2YX4A 2QQ9A 3SDBA 2B0LA 4P55A 1FMVA 3FXOA 1N77A 1BW6A 3HOUJ 5HVQC 5JR3A 1QNTA 4ZTJA 2MA3A 2P81A 3HGYA 3ASOH 2UWMA 1XSXA 4BDZA 1B59A 4IKFA 3ZMUA 2JSPA 2KJCA 4C3JJ
chains in the Genus database with same CATH topology
3QRFF 1U2WA 5J6XA 2K27A 4ETSA 3I58A 1O3TA 1TQMA 3J80K 2MH2A 4M9SA 3CUQB 5L3DA 1W5SA 1S8NA 1IN7A 4M74A 5K5OA 3TDZC 4MNUA 4Q48A 2PLYA 2CGPA 3GLXA 3JTGA 3F8CA 3GO5A 3ZP5A 3E5XA 3BOQA 5EEHA 5ILVA 1IRFA 1O57A 2M5WA 1YTYA 1I27A 3L9FA 5LGUA 1P6RA 1XGSA 4CGZA 3F21A 2Z3YA 3HTUA 1DUXC 3F22A 2LKPA 3U9GA 3RPUA 2V79A 2LSOA 4LG0B 3FMQA 3BP8A 4OINF 3O6BB 1SD4A 3LWFA 3RKYA 3VOEA 4YFXF 2VE8A 5ED4A 2Q0OA 1HKQA 3U1DA 2Z33A 2FNAA 1XCBA 2H6CA 3Q9SA 3WGHA 5BOXA 3G3ZA 4S04A 3L00A 3FXUA 2HWVA 3ZMSA 3HTSB 1U8RA 4GO1A 3HSRA 2W24A 2P4WA 2M1BA 5HOOA 1CGPA 3PFIA 3TO9A 1IN6A 3K1NA 4HV5A 4XRFA 1OKRA 4UNOA 5E20A 2PBIA 1FY7A 1C0WA 4WXDA 1KU2A 2STWA 3T5XA 2EA4A 3NQOA 1ZG1A 2ZFWA 1F4KA 2PJPA 1J2XA 4M6YA 2FBHA 2A6HF 2VOOA 3QAHA 4PGHA 1BIBA 3IRQA 3MEXA 1BI0A 4LLGF 2CW0F 2MLKA 4UHTA 1REPC 3F8BA 5DD4A 4BHBA 4HF1A 4NQWA 3V8KA 3FMRA 1D8JA 3I0TA 3CTAA 1LJ9A 4O5VA 5L3BA 1K79A 3L7WA 1XGOA 1RUOA 1T6SA 1XD7A 2ZNZA 5E8GA 3F8FA 2P6TA 3E6CC 5KK1A 1R1VA 2IA2A 4CXFA 4L5JA 3AAFA 1Z91A 2FMLA 4HW0A 4G94A 2O8XA 2VT2A 1U5TB 2Y48A 2ZCWA 3KEQA 4EGYA 1KA8A 2KRFA 3IKVA 4AIHA 3I5UA 5D8KB 2JT1A 5L3EA 1MDMB 2FMYA 4WWCA 3PQJA 4HLYA 1ZGAA 1XMKA 5ICFA 3HRUA 2A61A 1YQAA 3V8LA 2EFOA 3ELKA 4NB5A 1YO5C 1BN5A 3DPLC 4HX7A 1B4AA 2ACJA 2DQLA 1J59A 1USSA 2DLLA 1HQCA 2ZMEB 2L4AA 1XDSA 1HKSA 3RIRA 4LMYA 3REOA 2DPUA 3EQLF 3WTVC 1P2FA 5HLHA 3GFIA 3K69A 3FMSA 4HA8A 4EJVA 3D5LA 3FWEA 3HUGA 4UVCA 2XV4S 3KP5A 1FLIA 2E7XA 2KIUA 3J7AO 1GXQA 1HW1A 2A6EF 3CUQA 4U7BA 5LRSA 2OZ6A 2NNNA 2FE3A 3K2ZA 4L9NA 1ULYA 2P5VA 3SXYA 1S7OA 1E2XA 4A6DA 3R61A 1R5HA 1L0OC 4EQQA 2YSRA 3J80Z 1ZYRF 2D45A 4PDKA 2HDCA 3ZMTA 4RAYA 1W7PB 4BAYA 1S6LA 3E5UA 1IZ1A 3HRSA 2OZUA 4WF2A 3K1PA 2FEZA 1ZG5A 5DCFA 1P4WA 1BI3A 1SMYF 4LG0A 2HKOA 2QZ8A 4Y13A 1HXDA 1T38A 2JPCA 2Z9OA 4OIPF 5DD8A 3U2RA 2ZBKA 4HX8A 3RKWA 3QP6A 2GA2A 2O0YA 5CVVA 1K78B 1ONVA 1P92A 4G7HF 4UUVA 4FHTA 2OA4A 2XUBA 3KLOA 4GGGA 3TGNA 2HKXA 5K5QA 4Z2YA 1MJBA 5ILUA 5D4SA 4M73A 3DV8A 4I0BA 1WI9A 5LHHA 3F6OA 3P9CA 1JHHA 1SD5A 4BH9A 2QENA 4CYDA 1EH7A 1X3UA 1MJAA 3KP7A 3V7CA 2A3SA 3D0SA 5IT9Z 4IRIA 1BI1A 2VBYA 3O2PE 5TJJA 5DCMA 2K4BA 3WE3A 1HKTA 2PMUA 4EM0B 1V4RA 1UFMA 1OYYA 5LEKA 4JK1X 2IW5A 1P4AA 2HOEA 2OBPA 4RB0A 1ZRFA 2P5KA 4U0YA 3CJNA 2L3DA 4ZYDA 1KQ0A 1XGMA 3BDDA 3SZPA 4EGZA 3M8EA 4MEYF 2VOPA 2QYOA 1Z7UA 2HGCA 3T8RA 4LGWA 4MHGA 1HSTA 3HSEA 2QWWA 2ZNYA 4A5MA 3EYYA 1U5TA 4WXHA 5J8FA 1WRJA 4RB3C 3KLNA 3KZYA 4GYGA 1MDMA 1WQ2A 2M30A 3IWZA 2DTRA 1RNLA 3F6VA 3IWFA 3WTTC 4LLLA 2VBZA 3KP3A 3WODF 3ZPLA 2RKHA 2H6BA 1O7LA 3SZTA 4BYYA 1Q1HA 3KE2A 2JSCA 2DW4A 1MGTA 2JTVA 2UZKA 2ZMEA 3DKWA 1SD6A 3TQNA 5HLGA 4YIFA 1USTA 5ILSA 3V4GA 4I98B 1FBQA 5D5WB 3F72A 2GQQA 4XBFA 1F5TA 1Z1DA 1AWCA 2QQBA 3MWMA 4P5OA 5TRDA 1G3TA 1EH8A 4L18B 3FM3A 1XSVA 1XMAA 4QWQA 5BMZA 3DXJF 5FFXA 4HBLA 1V3FA 1OR7A 3GYHX 3BPVA 2ELHA 1QZYA 3F3XA 3IKTA 2ETHA 2PG4A 2FQ3A 2DPDA 2OU2A 3GFLA 1I1GA 5F6FA 3TDUC 5JHUA 2QLZA 2L54A 3I59B 2L02A 2NNYA 3ZMZA 2DK5A 2CO5A 1J9IA 2WTEA 5LEJA 1ZRDA 5AIPA 2PN6A 2QBYA 2EFQA 4KIBA 3I4PA 4ON0A 4I2OA 1JE8A 3GFMA 5CLSA 4G8XA 1TNTA 5J8CA 1R1UA 4DQ2A 2Y75A 2L4MA 2VBXA 1IF1A 2XAFA 4ESFA 2W57A 3K0LA 3WTXC 4U7DA 1QZZA 1TW3A 4O3MA 4RGRA 3VFZA 2MLGA 1P4XA 2GWRA 4MTDA 3SHFA 1S29A 1FWZA 1K78A 4YFNF 2CYYA 2P5LC 1O3SA 5DYMA 3LA7A 5L3FA 3HOTA 1D8KA 4M9XA 3R0AA 1QBJA 2E1CA 2CFXA 2Z5UA 4LB6B 1F9NA 4KMFA 3T8TA 4WXCA 5ERIA 3RPQA 5CVJA 1WWXA 1IXRC 4ZYHA 4N9HA 5E1WA 1BC7C 1ODDA 1ZGJA 2RGVA 1RUNA 3NEUA 3E6MA 4ASNA 2VC0A 1T2KA 3QPTA 1FZPB 4LK1F 5IT9K 2XHKA 5A2QK 5IT3A 3T0YA 5CJ9A 3RYRA 4CHUA 4OMZA 2XIGA 3VEPA 3RDIA 2GIVA 3GFJA 4A2UA 5HDGA 3FM5A 3ISPA 4XLNF 3CUQC 1KYWA 2DK8A 5CVRA 1H9GA 1U78A 4ESBA 4YFKF 4EMSA 1JHFA 4EJOA 3BWGA 2KIFA 2DBBA 3LSTA 3ZMVA 2A5YB 1LDKB 5E17F 3ABTA 1UB9A 2OQRA 5JVTA 1IXSB 1R1TA 5HLIA 3HHGA 2MC3A 1WSUA 3FHZA 3W6JB 4IJAA 2VT3A 2D2WA 3WE2A 3MCZA 1Z05A 5FLXK 1FPQA 1XDUA 3P9IA 1FBUA 2VXZA 2UXXA 1FYMA 3DF8A 3KP4A 4JBAA 2F5DA 4BHPA 2NYXA 5HS8A 2H94A 3V7RA 1B9MA 1LVAA 4EJTA 3G73A 3I71A 3M1EA 1J7KA 1DPRA 2LDUA 5D6FA 4ZH4F 3MZYA 5FD6A 4AWXB 2EFNA 5ICGA 2EK5A 4IRGA 2E1NA 4KIFA 5LHGA 2EA2A 1E17A 4G9YA 5E8IA 1YS7A 4EVIA 3B02A 2HYFA 4WCGA 1QQIA 3ABUA 4ESJA 2GA1A 3VODA 1CF7B 2K7LA 1QO0D 1XN7A 4HAMA 2CSOA 3KP6A 4JQFA 4QLCU 4AIJA 4U88A 1YYVA 2R7FA 4Q4ZF 1OYWA 5D4RA 4OIRF 2IRFG 4MGRA 2FNPA 5EEGA 2EV6A 2O3FA 4Y17A 4R1HA 3BROA 3HRTA 1FC3A 2JRTA 4IRHA 4F7ZA 5CYVA 1H9TA 4GXOA 1U6GA 3TKYA 3BPXA 2YPRA 4KIGA 1HSJA 4N0BA 2XAQA 4FX4A 2DU9A 3GZ6A 1UHMA 2P6SA 4KDPA 4RS8A 1YS6A 3KETA 4ZYGA 3WGGA 3I59A 3EYIA 3GUDA 3RTRA 4AIKA 2HEOA 1FYKA 1B1BA 3Q5FA 3F8MA 3LA2A 2P8TA 3P9KA 5LLQA 2IA0A 2GXGA 3HRMA 2BYVE 4CO8A 2BBYA 4P9FA 3QOPA 3H92A 3M7GA 4L0YB 5E1ZB 3ERED 5CVUA 4ZZDA 4U0WA 3T1BA 1U5TC 2D1HA 4H0EA 2YR2A 2A07F 3IL2A 2EV0A 4KN4X 2A69F 5LHIA 1JXSA 1UHWA 4HDVA 4CICA 1DDNA 1FP2A 1MJ9A 4CDGA 4B8XA 1Z9CA 1HW2A 2ZKZA 2ESNA 1ON1A 5D5VB 3MAJA 4IHSA 5FO5A 2IVMA 3ROUA 1I1SA 3GXOA 1MKMA 3WTSC 1YW7A 2ZXJA 2OD5A 4LFUA 3QPHA 3QP5A 4U0VA 5AIQA 2IT0A 1MZBA 3WTWC 3KCCA 3PQKA 4PCQA 2EFWA 1BOAA 1NHAA 4CZZA 3E6DA 3GW2A 2FU4A 2E7WA 1DPUA 2W25A 3CO6C 3ZMDA 4KT5C 3CLOA 2DI3A 2LNBA 3EETA 2FXAA 1VTNC 1KQ9A 5K1YA 4YG2F 1B9NA 2PEXA 4KNYA 5L3GA 4I02A 2L01A 2K86A 3H3ZA 2ZO4A 2RQPA 2O61A 3RYPA 2RN7A 1G3YA 1BM9A 2O6GE 2FSWA 3SFZA 1IN5A 4A0YA 5LBQA 2PMHA 3ML6A 2BGCA 5A2QZ 1O3RA 5FGMA 2EFPA 4UXNA 2F5CA 1ZAOA 3GVAA 1MD0A 3WTUC 3WU1B 2ISZA 1BIAA 3DFGA 1KU7A 1IUYA 1U3EM 3DP7A 1LB2A 1KYZA 2FBIA 4K2EA 1AOYA 2FOKA 2BE5F 1IAWA 4ENJA 6PAXA 1GVJA 3ECHA 1LNWA 3CDHA 1XB4A 5HDKA 2KKOA 2CG4A 4ZZLA 3QU6A 4ENKA 2M8EA 2ISYA 1SFEA 4LK0F 1TQIA 1YW9A 4P96A 2KJBA 5FLXZ 2VE9A 2GZWA 3WG9A 4UVAA 1S7AA 1T0FA 5BS6A 1Y0UA 3O3KA 5KVRA 3JAMZ 2O03A 4OIQF 1G3WA 4A0XA 3IHUA 1CF7A 4WK8F 1LQ1A 3RJPA 3E97A 1ZHFA 4HYEA 3ZQ7A 5E1XA 3F23A 3IRRA 2X0LA 5F64A 4L9JA 1F1ZA 3FZVA 2FF4A 2COMA 2HQNA 4Q5SF 2D1VA 4M9ZA 2WC2A 5HS7A 3C18A 2K4JA 1EH6A 1RIOH 2DAOA 1BI2A 2CWEA 2HTJA 2EWNA 4ENMA 3TO6A 4R8HA 1KQ8A 2RC4A 2DFIA 4KFCA 3LAJA 4NHJA 1ON2A 4A6EA 4S05A 4IF4A 5BQTA 3KEOA 2KIMA 4A5NA 3TO7A 1FYLA 1FBSA 2MBFA 1IXCA 2J5OA 3I64A 4Q47A 1XSDA 1OPCA 3WU0A 2F5FA 5FB2A 4I01A 3BJAA 4G6QA 2HS5A 5DEQA 3ZN0A 3BY6A 4BQAA 3R4KA 4KMUX 1GHCA 1YLFA 1W7PD 1W7PA 4YIIA 2GAUA 4LB5A 3NRVA 2DQRA 3R0JA 2MD5A 2WWYA 5ICEA 4L0ZB 4OIOF 2XASA 1Z6TA 3C3WA 4L9TA 2IA1A 2XAJA 3E5QA 1STZA 2HZTA 4E70A 4I7HA 2VN2A 3OOPA 2F2EA 4HV6A 4BNCA 2X4HA 2BEOA 5L3CA 2HQRA 2C6YA 4OOIA 3TOAA 1TW2A 2JPBA 3OV8A 3FXQA 2V1XA 1KU3A 2V6CA 1FSHA 4HQEA 4L9VA 1KU9A 4A0ZA 3KP2A 4EM1A 1QGPA 4RB2C 1FNNA 1ZARA 1A04A 2XAHA 1OYIA 1HW5A 5D6EA 2PQ8A 2QVOA 3L09A 3R60A 2EV5A 4P9UA 1PP7U 4UVBA 4KICA 2P7VB 4KA4A 4G7OF 2AXLA 1W4MA 3DQVC 3TOBA 2XROA 4ZYEA 2XRNA 5JI6A 1FOKA 1ZH5A 3DPTA 1FT9A 3FX3A 3C7JA 4L5IA 1SD7A 2XKPA 1T39A 3EUHA 3WGIA 2IP2A 4GCVA 2Q8KA 2M87A 2TDXA 1YFHA 5HS9A 2QM3A 4WX9A 4MEXF 2JZYA 3K9TA 2UXNA 2FBKA 3GF2A 3FXRA 5H20A 3E3VA 1FSEA 4FX0A 2CQKA 1R36A 3LA3A 4AVPA 5H6QA 2RNJA 3GEZA 4M6XA 1I5ZA 1OMIA 2IPQX 4M71A 1R23A 2P7CB 1J0RA 4LJZF 3IC7A 5FFZA 5DCMB 2OAZA 1D3YA 3VB2A 3DEUA 2YU3A 2Y0MA 1RI7A 3BZ6A 4I0AA 1BBYA 1O7FA 2NAZA 3RKXA 3JAMK 1ZG3A 2M45A 3QU3A 2J5PA 2XAGA 4D0PA 1SMTA 1R22A 4MQVA 4TV7A 1ZRCA 4UV8A 4XSZF 2PI0A 4HZFA 2W84A 3ECOA 2PFBA 3HIFA 2G9WA 3W6KB 1UCRA 4HX4A 1S3JA 1TTYA 2H27A 1PDNC 1PP8F 4HF2A 2HTSA 1ZLJA 4EJWA 3J81K 5BPIA 2HYGD 3B73A 5JFRA 3LAPA 1J5YA 4N9IA 1R5GA 1G4DA 4RGXA 2H09A 5LGTA 1G3SA 1R7JA 2V1UA 3JSPA 4Y15A 1ZN2A 3BJOA 1B6AA 3HHHA 4MTEA 3EDPA 3K1MA 3HYIA 4G6DA 3SQNA 2VONA 5ICCA 5K5RA 1LDDA 5D5UB 4PGGA 4R79A 4IHTA 1G6NA 2W85A 4I09A 5HDNA 2RVCA 4O6JA 1DP7P 3MFKA 4KN7X 1TNSA 3I53A 1R58A 4FT8A 3WTZA 4OMYA 3P7NA 1EV7A 2XKOA 3F8NA 3JTHA 2R3SA 5LRRA 4B09A 4DNCA 3COAC 4ENNA 3R6SA 3JSOA 2VC1A 2ADUA 2F5EA 1W5TA 4KYWA 2NS0A 1I6XA 3ULQB 4M72A 2WV0A 3FF5A 2QBYB 4XLPF 5H6RA 3WTYC 2DT5A 2OQGA 2LF7A 2ZJ2A 4UV9A 5AONA 1R00A 5CVIA 2STTA 1TBXA 2QUFA 4PZJA 3S2WA 2AS5F 2RDPA 4HLXA 3M8FA 5DUIA 3N4MA 2K02A 5E18F 3CO7C 4EM2A 2QQAA 4HF0A 4RGSA 4HQMA 2HR3A 1Z6RA 5FD5A 2HFHA 1JGSA 1YIOA 3V7SA 3KZZA 2LF8A 2R7DA 1BC8C 2RV8A 3Q9VA 1YG2A 3I54A 1PUEE 5LGNA 1T98A 5BPDA 2EJRA 5F1RA 1K6OA 2Q2EA 5D5XB 3LFKA 2A68F 2FA5A 1D5VA 1IW7F 4BHCA 1TQPA 3HOSA 3GZ5A 1H0MA 4EV0A 1GXPA 1HBXG 2VODA 1QPMA 3MQ0A 4IVNA 3M9AA 1XCVA 3HSFA 2ESHA 3LQQA 3GX4X 1XGNA 1SFXA 5DUKA 4AD9A 1SFUA 5DV5A 4LLNA 2EB7A 4A12A 2DO7A 3LQRA 4OU0A 2FRHA 4KUMA 3GWZA 4HOBA 1ZLKA 3JW4A 2NRAC 1IRGA 2BV6A 3E6BA 1ZREA 4RGUA 1KGSA 1FP1D 3C1DA 1LDJA 1O3QA 1WKMA 1J75A 2IJLA 3N97A 3CUOA 4XSXF 3L2CA 2G7HA 1LEBA 2MH9A 1IN8A 2V9VA 2VBWA 4G7ZF 4LD5A 4RAZA 2V1DA 5D8LB 2GXBA 4IPAA 1BJAA 1YW8A 1SAXA 3BJ6A 1K7AA 1RZ4A 2G7UA 3V8JA 2XVCA 5DDGA 1TLHB 4IXAA 1LEAA 4BXUA 1L3LA 2YX7A 3H3UA 3J81Z 3ZN1A 4EJUA 4MQ9F 3RI4A 2Z99A 4RB1A 3MZHA 4HDUA 2XGXA 3KFWX 1FX7A 1IN4A 4GYIA 2YX4A 2QQ9A 2B0LA 4P55A 5HVQC 5JR3A 1QNTA 2MA3A 2UWMA 1XSXA 1B59A 3ZMUA 2KJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRF F;  1U2W A;  5J6X A;  2K27 A;  4ETS A;  3I58 A;  1O3T A;  1TQM A;  3J80 K;  2MH2 A;  4M9S A;  3CUQ B;  5L3D A;  1W5S A;  1S8N A;  1IN7 A;  4M74 A;  5K5O A;  3TDZ C;  4MNU A;  4Q48 A;  2PLY A;  2CGP A;  3GLX A;  3JTG A;  3F8C A;  3GO5 A;  3ZP5 A;  3E5X A;  3BOQ A;  5EEH A;  5ILV A;  1IRF A;  1O57 A;  2M5W A;  1YTY A;  1I27 A;  3L9F A;  5LGU A;  1P6R A;  1XGS A;  4CGZ A;  3F21 A;  2Z3Y A;  3HTU A;  1DUX C;  3F22 A;  2LKP A;  3U9G A;  3RPU A;  2V79 A;  2LSO A;  4LG0 B;  3FMQ A;  3BP8 A;  4OIN F;  3O6B B;  1SD4 A;  3LWF A;  3RKY A;  3VOE A;  4YFX F;  2VE8 A;  5ED4 A;  2Q0O A;  1HKQ A;  3U1D A;  2Z33 A;  2FNA A;  1XCB A;  2H6C A;  3Q9S A;  3WGH A;  5BOX A;  3G3Z A;  4S04 A;  3L00 A;  3FXU A;  2HWV A;  3ZMS A;  3HTS B;  1U8R A;  4GO1 A;  3HSR A;  2W24 A;  2P4W A;  2M1B A;  5HOO A;  1CGP A;  3PFI A;  3TO9 A;  1IN6 A;  3K1N A;  4HV5 A;  4XRF A;  1OKR A;  4UNO A;  5E20 A;  2PBI A;  1FY7 A;  1C0W A;  4WXD A;  1KU2 A;  2STW A;  3T5X A;  2EA4 A;  3NQO A;  1ZG1 A;  2ZFW A;  1F4K A;  2PJP A;  1J2X A;  4M6Y A;  2FBH A;  2A6H F;  2VOO A;  3QAH A;  4PGH A;  1BIB A;  3IRQ A;  3MEX A;  1BI0 A;  4LLG F;  2CW0 F;  2MLK A;  4UHT A;  1REP C;  3F8B A;  5DD4 A;  4BHB A;  4HF1 A;  4NQW A;  3V8K A;  3FMR A;  1D8J A;  3I0T A;  3CTA A;  1LJ9 A;  4O5V A;  5L3B A;  1K79 A;  3L7W A;  1XGO A;  1RUO A;  1T6S A;  1XD7 A;  2ZNZ A;  5E8G A;  3F8F A;  2P6T A;  3E6C C;  5KK1 A;  1R1V A;  2IA2 A;  4CXF A;  4L5J A;  3AAF A;  1Z91 A;  2FML A;  4HW0 A;  4G94 A;  2O8X A;  2VT2 A;  1U5T B;  2Y48 A;  2ZCW A;  3KEQ A;  4EGY A;  1KA8 A;  2KRF A;  3IKV A;  4AIH A;  3I5U A;  5D8K B;  2JT1 A;  5L3E A;  1MDM B;  2FMY A;  4WWC A;  3PQJ A;  4HLY A;  1ZGA A;  1XMK A;  5ICF A;  3HRU A;  2A61 A;  1YQA A;  3V8L A;  2EFO A;  3ELK A;  4NB5 A;  1YO5 C;  1BN5 A;  3DPL C;  4HX7 A;  1B4A A;  2ACJ A;  2DQL A;  1J59 A;  1USS A;  2DLL A;  1HQC A;  2ZME B;  2L4A A;  1XDS A;  1HKS A;  3RIR A;  4LMY A;  3REO A;  2DPU A;  3EQL F;  3WTV C;  1P2F A;  5HLH A;  3GFI A;  3K69 A;  3FMS A;  4HA8 A;  4EJV A;  3D5L A;  3FWE A;  3HUG A;  4UVC A;  2XV4 S;  3KP5 A;  1FLI A;  2E7X A;  2KIU A;  3J7A O;  1GXQ A;  1HW1 A;  2A6E F;  3CUQ A;  4U7B A;  5LRS A;  2OZ6 A;  2NNN A;  2FE3 A;  3K2Z A;  4L9N A;  1ULY A;  2P5V A;  3SXY A;  1S7O A;  1E2X A;  4A6D A;  3R61 A;  1R5H A;  1L0O C;  4EQQ A;  2YSR A;  3J80 Z;  1ZYR F;  2D45 A;  4PDK A;  2HDC A;  3ZMT A;  4RAY A;  1W7P B;  4BAY A;  1S6L A;  3E5U A;  1IZ1 A;  3HRS A;  2OZU A;  4WF2 A;  3K1P A;  2FEZ A;  1ZG5 A;  5DCF A;  1P4W A;  1BI3 A;  1SMY F;  4LG0 A;  2HKO A;  2QZ8 A;  4Y13 A;  1HXD A;  1T38 A;  2JPC A;  2Z9O A;  4OIP F;  5DD8 A;  3U2R A;  2ZBK A;  4HX8 A;  3RKW A;  3QP6 A;  2GA2 A;  2O0Y A;  5CVV A;  1K78 B;  1ONV A;  1P92 A;  4G7H F;  4UUV A;  4FHT A;  2OA4 A;  2XUB A;  3KLO A;  4GGG A;  3TGN A;  2HKX A;  5K5Q A;  4Z2Y A;  1MJB A;  5ILU A;  5D4S A;  4M73 A;  3DV8 A;  4I0B A;  1WI9 A;  5LHH A;  3F6O A;  3P9C A;  1JHH A;  1SD5 A;  4BH9 A;  2QEN A;  4CYD A;  1EH7 A;  1X3U A;  1MJA A;  3KP7 A;  3V7C A;  2A3S A;  3D0S A;  5IT9 Z;  4IRI A;  1BI1 A;  2VBY A;  3O2P E;  5TJJ A;  5DCM A;  2K4B A;  3WE3 A;  1HKT A;  2PMU A;  4EM0 B;  1V4R A;  1UFM A;  1OYY A;  5LEK A;  4JK1 X;  2IW5 A;  1P4A A;  2HOE A;  2OBP A;  4RB0 A;  1ZRF A;  2P5K A;  4U0Y A;  3CJN A;  2L3D A;  4ZYD A;  1KQ0 A;  1XGM A;  3BDD A;  3SZP A;  4EGZ A;  3M8E A;  4MEY F;  2VOP A;  2QYO A;  1Z7U A;  2HGC A;  3T8R A;  4LGW A;  4MHG A;  1HST A;  3HSE A;  2QWW A;  2ZNY A;  4A5M A;  3EYY A;  1U5T A;  4WXH A;  5J8F A;  1WRJ A;  4RB3 C;  3KLN A;  3KZY A;  4GYG A;  1MDM A;  1WQ2 A;  2M30 A;  3IWZ A;  2DTR A;  1RNL A;  3F6V A;  3IWF A;  3WTT C;  4LLL A;  2VBZ A;  3KP3 A;  3WOD F;  3ZPL A;  2RKH A;  2H6B A;  1O7L A;  3SZT A;  4BYY A;  1Q1H A;  3KE2 A;  2JSC A;  2DW4 A;  1MGT A;  2JTV A;  2UZK A;  2ZME A;  3DKW A;  1SD6 A;  3TQN A;  5HLG A;  4YIF A;  1UST A;  5ILS A;  3V4G A;  4I98 B;  1FBQ A;  5D5W B;  3F72 A;  2GQQ A;  4XBF A;  1F5T A;  1Z1D A;  1AWC A;  2QQB A;  3MWM A;  4P5O A;  5TRD A;  1G3T A;  1EH8 A;  4L18 B;  3FM3 A;  1XSV A;  1XMA A;  4QWQ A;  5BMZ A;  3DXJ F;  5FFX A;  4HBL A;  1V3F A;  1OR7 A;  3GYH X;  3BPV A;  2ELH A;  1QZY A;  3F3X A;  3IKT A;  2ETH A;  2PG4 A;  2FQ3 A;  2DPD A;  2OU2 A;  3GFL A;  1I1G A;  5F6F A;  3TDU C;  5JHU A;  2QLZ A;  2L54 A;  3I59 B;  2L02 A;  2NNY A;  3ZMZ A;  2DK5 A;  2CO5 A;  1J9I A;  2WTE A;  5LEJ A;  1ZRD A;  5AIP A;  2PN6 A;  2QBY A;  2EFQ A;  4KIB A;  3I4P A;  4ON0 A;  4I2O A;  1JE8 A;  3GFM A;  5CLS A;  4G8X A;  1TNT A;  5J8C A;  1R1U A;  4DQ2 A;  2Y75 A;  2L4M A;  2VBX A;  1IF1 A;  2XAF A;  4ESF A;  2W57 A;  3K0L A;  3WTX C;  4U7D A;  1QZZ A;  1TW3 A;  4O3M A;  4RGR A;  3VFZ A;  2MLG A;  1P4X A;  2GWR A;  4MTD A;  3SHF A;  1S29 A;  1FWZ A;  1K78 A;  4YFN F;  2CYY A;  2P5L C;  1O3S A;  5DYM A;  3LA7 A;  5L3F A;  3HOT A;  1D8K A;  4M9X A;  3R0A A;  1QBJ A;  2E1C A;  2CFX A;  2Z5U A;  4LB6 B;  1F9N A;  4KMF A;  3T8T A;  4WXC A;  5ERI A;  3RPQ A;  5CVJ A;  1WWX A;  1IXR C;  4ZYH A;  4N9H A;  5E1W A;  1BC7 C;  1ODD A;  1ZGJ A;  2RGV A;  1RUN A;  3NEU A;  3E6M A;  4ASN A;  2VC0 A;  1T2K A;  3QPT A;  1FZP B;  4LK1 F;  5IT9 K;  2XHK A;  5A2Q K;  5IT3 A;  3T0Y A;  5CJ9 A;  3RYR A;  4CHU A;  4OMZ A;  2XIG A;  3VEP A;  3RDI A;  2GIV A;  3GFJ A;  4A2U A;  5HDG A;  3FM5 A;  3ISP A;  4XLN F;  3CUQ C;  1KYW A;  2DK8 A;  5CVR A;  1H9G A;  1U78 A;  4ESB A;  4YFK F;  4EMS A;  1JHF A;  4EJO A;  3BWG A;  2KIF A;  2DBB A;  3LST A;  3ZMV A;  2A5Y B;  1LDK B;  5E17 F;  3ABT A;  1UB9 A;  2OQR A;  5JVT A;  1IXS B;  1R1T A;  5HLI A;  3HHG A;  2MC3 A;  1WSU A;  3FHZ A;  3W6J B;  4IJA A;  2VT3 A;  2D2W A;  3WE2 A;  3MCZ A;  1Z05 A;  5FLX K;  1FPQ A;  1XDU A;  3P9I A;  1FBU A;  2VXZ A;  2UXX A;  1FYM A;  3DF8 A;  3KP4 A;  4JBA A;  2F5D A;  4BHP A;  2NYX A;  5HS8 A;  2H94 A;  3V7R A;  1B9M A;  1LVA A;  4EJT A;  3G73 A;  3I71 A;  3M1E A;  1J7K A;  1DPR A;  2LDU A;  5D6F A;  4ZH4 F;  3MZY A;  5FD6 A;  4AWX B;  2EFN A;  5ICG A;  2EK5 A;  4IRG A;  2E1N A;  4KIF A;  5LHG A;  2EA2 A;  1E17 A;  4G9Y A;  5E8I A;  1YS7 A;  4EVI A;  3B02 A;  2HYF A;  4WCG A;  1QQI A;  3ABU A;  4ESJ A;  2GA1 A;  3VOD A;  1CF7 B;  2K7L A;  1QO0 D;  1XN7 A;  4HAM A;  2CSO A;  3KP6 A;  4JQF A;  4QLC U;  4AIJ A;  4U88 A;  1YYV A;  2R7F A;  4Q4Z F;  1OYW A;  5D4R A;  4OIR F;  2IRF G;  4MGR A;  2FNP A;  5EEG A;  2EV6 A;  2O3F A;  4Y17 A;  4R1H A;  3BRO A;  3HRT A;  1FC3 A;  2JRT A;  4IRH A;  4F7Z A;  5CYV A;  1H9T A;  4GXO A;  1U6G A;  3TKY A;  3BPX A;  2YPR A;  4KIG A;  1HSJ A;  4N0B A;  2XAQ A;  4FX4 A;  2DU9 A;  3GZ6 A;  1UHM A;  2P6S A;  4KDP A;  4RS8 A;  1YS6 A;  3KET A;  4ZYG A;  3WGG A;  3I59 A;  3EYI A;  3GUD A;  3RTR A;  4AIK A;  2HEO A;  1FYK A;  1B1B A;  3Q5F A;  3F8M A;  3LA2 A;  2P8T A;  3P9K A;  5LLQ A;  2IA0 A;  2GXG A;  3HRM A;  2BYV E;  4CO8 A;  2BBY A;  4P9F A;  3QOP A;  3H92 A;  3M7G A;  4L0Y B;  5E1Z B;  3ERE D;  5CVU A;  4ZZD A;  4U0W A;  3T1B A;  1U5T C;  2D1H A;  4H0E A;  2YR2 A;  2A07 F;  3IL2 A;  2EV0 A;  4KN4 X;  2A69 F;  5LHI A;  1JXS A;  1UHW A;  4HDV A;  4CIC A;  1DDN A;  1FP2 A;  1MJ9 A;  4CDG A;  4B8X A;  1Z9C A;  1HW2 A;  2ZKZ A;  2ESN A;  1ON1 A;  5D5V B;  3MAJ A;  4IHS A;  5FO5 A;  2IVM A;  3ROU A;  1I1S A;  3GXO A;  1MKM A;  3WTS C;  1YW7 A;  2ZXJ A;  2OD5 A;  4LFU A;  3QPH A;  3QP5 A;  4U0V A;  5AIQ A;  2IT0 A;  1MZB A;  3WTW C;  3KCC A;  3PQK A;  4PCQ A;  2EFW A;  1BOA A;  1NHA A;  4CZZ A;  3E6D A;  3GW2 A;  2FU4 A;  2E7W A;  1DPU A;  2W25 A;  3CO6 C;  3ZMD A;  4KT5 C;  3CLO A;  2DI3 A;  2LNB A;  3EET A;  2FXA A;  1VTN C;  1KQ9 A;  5K1Y A;  4YG2 F;  1B9N A;  2PEX A;  4KNY A;  5L3G A;  4I02 A;  2L01 A;  2K86 A;  3H3Z A;  2ZO4 A;  2RQP A;  2O61 A;  3RYP A;  2RN7 A;  1G3Y A;  1BM9 A;  2O6G E;  2FSW A;  3SFZ A;  1IN5 A;  4A0Y A;  5LBQ A;  2PMH A;  3ML6 A;  2BGC A;  5A2Q Z;  1O3R A;  5FGM A;  2EFP A;  4UXN A;  2F5C A;  1ZAO A;  3GVA A;  1MD0 A;  3WTU C;  3WU1 B;  2ISZ A;  1BIA A;  3DFG A;  1KU7 A;  1IUY A;  1U3E M;  3DP7 A;  1LB2 A;  1KYZ A;  2FBI A;  4K2E A;  1AOY A;  2FOK A;  2BE5 F;  1IAW A;  4ENJ A;  6PAX A;  1GVJ A;  3ECH A;  1LNW A;  3CDH A;  1XB4 A;  5HDK A;  2KKO A;  2CG4 A;  4ZZL A;  3QU6 A;  4ENK A;  2M8E A;  2ISY A;  1SFE A;  4LK0 F;  1TQI A;  1YW9 A;  4P96 A;  2KJB A;  5FLX Z;  2VE9 A;  2GZW A;  3WG9 A;  4UVA A;  1S7A A;  1T0F A;  5BS6 A;  1Y0U A;  3O3K A;  5KVR A;  3JAM Z;  2O03 A;  4OIQ F;  1G3W A;  4A0X A;  3IHU A;  1CF7 A;  4WK8 F;  1LQ1 A;  3RJP A;  3E97 A;  1ZHF A;  4HYE A;  3ZQ7 A;  5E1X A;  3F23 A;  3IRR A;  2X0L A;  5F64 A;  4L9J A;  1F1Z A;  3FZV A;  2FF4 A;  2COM A;  2HQN A;  4Q5S F;  2D1V A;  4M9Z A;  2WC2 A;  5HS7 A;  3C18 A;  2K4J A;  1EH6 A;  1RIO H;  2DAO A;  1BI2 A;  2CWE A;  2HTJ A;  2EWN A;  4ENM A;  3TO6 A;  4R8H A;  1KQ8 A;  2RC4 A;  2DFI A;  4KFC A;  3LAJ A;  4NHJ A;  1ON2 A;  4A6E A;  4S05 A;  4IF4 A;  5BQT A;  3KEO A;  2KIM A;  4A5N A;  3TO7 A;  1FYL A;  1FBS A;  2MBF A;  1IXC A;  2J5O A;  3I64 A;  4Q47 A;  1XSD A;  1OPC A;  3WU0 A;  2F5F A;  5FB2 A;  4I01 A;  3BJA A;  4G6Q A;  2HS5 A;  5DEQ A;  3ZN0 A;  3BY6 A;  4BQA A;  3R4K A;  4KMU X;  1GHC A;  1YLF A;  1W7P D;  1W7P A;  4YII A;  2GAU A;  4LB5 A;  3NRV A;  2DQR A;  3R0J A;  2MD5 A;  2WWY A;  5ICE A;  4L0Z B;  4OIO F;  2XAS A;  1Z6T A;  3C3W A;  4L9T A;  2IA1 A;  2XAJ A;  3E5Q A;  1STZ A;  2HZT A;  4E70 A;  4I7H A;  2VN2 A;  3OOP A;  2F2E A;  4HV6 A;  4BNC A;  2X4H A;  2BEO A;  5L3C A;  2HQR A;  2C6Y A;  4OOI A;  3TOA A;  1TW2 A;  2JPB A;  3OV8 A;  3FXQ A;  2V1X A;  1KU3 A;  2V6C A;  1FSH A;  4HQE A;  4L9V A;  1KU9 A;  4A0Z A;  3KP2 A;  4EM1 A;  1QGP A;  4RB2 C;  1FNN A;  1ZAR A;  1A04 A;  2XAH A;  1OYI A;  1HW5 A;  5D6E A;  2PQ8 A;  2QVO A;  3L09 A;  3R60 A;  2EV5 A;  4P9U A;  1PP7 U;  4UVB A;  4KIC A;  2P7V B;  4KA4 A;  4G7O F;  2AXL A;  1W4M A;  3DQV C;  3TOB A;  2XRO A;  4ZYE A;  2XRN A;  5JI6 A;  1FOK A;  1ZH5 A;  3DPT A;  1FT9 A;  3FX3 A;  3C7J A;  4L5I A;  1SD7 A;  2XKP A;  1T39 A;  3EUH A;  3WGI A;  2IP2 A;  4GCV A;  2Q8K A;  2M87 A;  2TDX A;  1YFH A;  5HS9 A;  2QM3 A;  4WX9 A;  4MEX F;  2JZY A;  3K9T A;  2UXN A;  2FBK A;  3GF2 A;  3FXR A;  5H20 A;  3E3V A;  1FSE A;  4FX0 A;  2CQK A;  1R36 A;  3LA3 A;  4AVP A;  5H6Q A;  2RNJ A;  3GEZ A;  4M6X A;  1I5Z A;  1OMI A;  2IPQ X;  4M71 A;  1R23 A;  2P7C B;  1J0R A;  4LJZ F;  3IC7 A;  5FFZ A;  5DCM B;  2OAZ A;  1D3Y A;  3VB2 A;  3DEU A;  2YU3 A;  2Y0M A;  1RI7 A;  3BZ6 A;  4I0A A;  1BBY A;  1O7F A;  2NAZ A;  3RKX A;  3JAM K;  1ZG3 A;  2M45 A;  3QU3 A;  2J5P A;  2XAG A;  4D0P A;  1SMT A;  1R22 A;  4MQV A;  4TV7 A;  1ZRC A;  4UV8 A;  4XSZ F;  2PI0 A;  4HZF A;  2W84 A;  3ECO A;  2PFB A;  3HIF A;  2G9W A;  3W6K B;  1UCR A;  4HX4 A;  1S3J A;  1TTY A;  2H27 A;  1PDN C;  1PP8 F;  4HF2 A;  2HTS A;  1ZLJ A;  4EJW A;  3J81 K;  5BPI A;  2HYG D;  3B73 A;  5JFR A;  3LAP A;  1J5Y A;  4N9I A;  1R5G A;  1G4D A;  4RGX A;  2H09 A;  5LGT A;  1G3S A;  1R7J A;  2V1U A;  3JSP A;  4Y15 A;  1ZN2 A;  3BJO A;  1B6A A;  3HHH A;  4MTE A;  3EDP A;  3K1M A;  3HYI A;  4G6D A;  3SQN A;  2VON A;  5ICC A;  5K5R A;  1LDD A;  5D5U B;  4PGG A;  4R79 A;  4IHT A;  1G6N A;  2W85 A;  4I09 A;  5HDN A;  2RVC A;  4O6J A;  1DP7 P;  3MFK A;  4KN7 X;  1TNS A;  3I53 A;  1R58 A;  4FT8 A;  3WTZ A;  4OMY A;  3P7N A;  1EV7 A;  2XKO A;  3F8N A;  3JTH A;  2R3S A;  5LRR A;  4B09 A;  4DNC A;  3COA C;  4ENN A;  3R6S A;  3JSO A;  2VC1 A;  2ADU A;  2F5E A;  1W5T A;  4KYW A;  2NS0 A;  1I6X A;  3ULQ B;  4M72 A;  2WV0 A;  3FF5 A;  2QBY B;  4XLP F;  5H6R A;  3WTY C;  2DT5 A;  2OQG A;  2LF7 A;  2ZJ2 A;  4UV9 A;  5AON A;  1R00 A;  5CVI A;  2STT A;  1TBX A;  2QUF A;  4PZJ A;  3S2W A;  2AS5 F;  2RDP A;  4HLX A;  3M8F A;  5DUI A;  3N4M A;  2K02 A;  5E18 F;  3CO7 C;  4EM2 A;  2QQA A;  4HF0 A;  4RGS A;  4HQM A;  2HR3 A;  1Z6R A;  5FD5 A;  2HFH A;  1JGS A;  1YIO A;  3V7S A;  3KZZ A;  2LF8 A;  2R7D A;  1BC8 C;  2RV8 A;  3Q9V A;  1YG2 A;  3I54 A;  1PUE E;  5LGN A;  1T98 A;  5BPD A;  2EJR A;  5F1R A;  1K6O A;  2Q2E A;  5D5X B;  3LFK A;  2A68 F;  2FA5 A;  1D5V A;  1IW7 F;  4BHC A;  1TQP A;  3HOS A;  3GZ5 A;  1H0M A;  4EV0 A;  1GXP A;  1HBX G;  2VOD A;  1QPM A;  3MQ0 A;  4IVN A;  3M9A A;  1XCV A;  3HSF A;  2ESH A;  3LQQ A;  3GX4 X;  1XGN A;  1SFX A;  5DUK A;  4AD9 A;  1SFU A;  5DV5 A;  4LLN A;  2EB7 A;  4A12 A;  2DO7 A;  3LQR A;  4OU0 A;  2FRH A;  4KUM A;  3GWZ A;  4HOB A;  1ZLK A;  3JW4 A;  2NRA C;  1IRG A;  2BV6 A;  3E6B A;  1ZRE A;  4RGU A;  1KGS A;  1FP1 D;  3C1D A;  1LDJ A;  1O3Q A;  1WKM A;  1J75 A;  2IJL A;  3N97 A;  3CUO A;  4XSX F;  3L2C A;  2G7H A;  1LEB A;  2MH9 A;  1IN8 A;  2V9V A;  2VBW A;  4G7Z F;  4LD5 A;  4RAZ A;  2V1D A;  5D8L B;  2GXB A;  4IPA A;  1BJA A;  1YW8 A;  1SAX A;  3BJ6 A;  1K7A A;  1RZ4 A;  2G7U A;  3V8J A;  2XVC A;  5DDG A;  1TLH B;  4IXA A;  1LEA A;  4BXU A;  1L3L A;  2YX7 A;  3H3U A;  3J81 Z;  3ZN1 A;  4EJU A;  4MQ9 F;  3RI4 A;  2Z99 A;  4RB1 A;  3MZH A;  4HDU A;  2XGX A;  3KFW X;  1FX7 A;  1IN4 A;  4GYI A;  2YX4 A;  2QQ9 A;  2B0L A;  4P55 A;  5HVQ C;  5JR3 A;  1QNT A;  2MA3 A;  2UWM A;  1XSX A;  1B59 A;  3ZMU A;  2KJC A; 
#chains in the Genus database with same CATH topology
 1GVD A;  4A3D J;  1LKX A;  3QRF F;  3JRE A;  3WG7 H;  3Q0U A;  1U2W A;  4BBR J;  2KIS A;  5J6X A;  3AL0 C;  2K27 A;  2HPM A;  3D5R C;  4JOM A;  4ETS A;  5C3E J;  3I58 A;  1O3T A;  4CCK A;  1TQM A;  3HG9 A;  1A6I A;  3J80 K;  2MH2 A;  5FRO A;  3CCM I;  5F0H A;  1D0X A;  3QYE A;  4W97 A;  4YRV A;  4M9S A;  3CUQ B;  3BTI A;  2DA3 A;  5L3D A;  3OYA A;  1K83 J;  1JUM A;  1W5S A;  1S8N A;  1IN7 A;  4M74 A;  1R4M B;  5K5O A;  2KRH A;  1BA5 A;  2EQR A;  3TDZ C;  1XPX A;  3Q0V A;  2VKH A;  2KLO A;  3KEY A;  4MNU A;  1ETV A;  2KZG A;  3LOC A;  2W4S A;  1JT0 A;  3IH3 A;  4Q48 A;  4KIT B;  2PLY A;  2CGP A;  2DMP A;  3GLX A;  1DGR M;  3JTG A;  1QU3 A;  1BR2 A;  3F8C A;  1X1A A;  3TBI A;  5DM7 F;  1X1P A;  3QOD A;  3GO5 A;  5F0F A;  3ZP5 A;  4E7I A;  3E5X A;  4HPQ A;  3K4B A;  1PUF A;  3BOQ A;  5EEH A;  5ILV A;  1FJL A;  1IRF A;  1O57 A;  2CRG A;  2M5W A;  1YTY A;  3IUO A;  1I27 A;  3H0G J;  2CUF A;  3S1M J;  1QHH D;  2GOM A;  3MKZ A;  3L9F A;  4V19 K;  3PIO F;  3OMY A;  5LGU A;  3PJR A;  1P6R A;  1XGS A;  4CGZ A;  3F21 A;  1N75 A;  4FIS A;  2Z3Y A;  3LSG A;  3HTU A;  1DUX C;  3CF5 F;  4M3F A;  3F22 A;  2LKP A;  4ZDL A;  3W2A A;  5GAE J;  3U9G A;  3RPU A;  2V79 A;  2LSO A;  3MKW B;  1MBF A;  1T08 B;  2DJN A;  3TP3 A;  2X6W A;  4LG0 B;  2TRT A;  2VQG A;  3FMQ A;  3OYD A;  5B1B H;  1H89 C;  4ZYA A;  3LL7 A;  3JRA A;  1U9N A;  3BP8 A;  2VJ4 A;  4OIN F;  3O6B B;  2RAE A;  4D5F A;  4FCY A;  2R7O A;  1MMN A;  1SD4 A;  3LWF A;  2CQN A;  4PJN A;  3RKY A;  3VOE A;  4GFB A;  4YFX F;  4KT6 A;  2VE8 A;  5ED4 A;  2Q0O A;  1R6R A;  3HGG A;  1HKQ A;  1N25 A;  3U1D A;  4YIR X;  2Z33 A;  2FNA A;  1XCB A;  2H6C A;  1YJN I;  1V5G A;  4M3E A;  3Q9S A;  3WGH A;  5BOX A;  2XPV A;  1VQM I;  3G3Z A;  3Q0W A;  4S04 A;  2NVT J;  3L00 A;  3FXU A;  2HWV A;  1Y6I A;  3ZMS A;  1H8A C;  3HTS B;  1U8R A;  4GO1 A;  1WCM J;  2R5Z A;  1Q1V A;  2ZXH A;  3HSR A;  4RBO A;  5EG0 A;  1BJZ A;  2W24 A;  3FXK A;  2P4W A;  1HCR A;  2M1B A;  5HOO A;  2M2E A;  3GTG J;  2JVG A;  1CGP A;  3PFI A;  1R49 A;  5CKT A;  4IL6 C;  3TO9 A;  2MSY A;  1IN6 A;  3K1N A;  4HV5 A;  4XRF A;  1OKR A;  4UNO A;  5E20 A;  2PBI A;  1FY7 A;  3OYC A;  4PJ0 C;  1C0W A;  4WXD A;  1KU2 A;  2STW A;  3T5X A;  1MBK A;  2CV1 A;  2EA4 A;  3NQO A;  1EJ9 A;  4Z6Y A;  1ZG1 A;  2ZFW A;  1F4K A;  2PJP A;  1J2X A;  4XLE A;  3DKY A;  4M6Y A;  2FBH A;  2A6H F;  2VOO A;  3FXL A;  3QAH A;  1BIB A;  4PGH A;  3IRQ A;  3GZN B;  3MEX A;  1BI0 A;  4LLG F;  2CW0 F;  2MLK A;  4UHT A;  1REP C;  4NBQ A;  3F8B A;  5DD4 A;  4BHB A;  2GBY A;  4HF1 A;  4L5E A;  4NQW A;  3V8K A;  1IDZ A;  3BC8 A;  3FMR A;  2TCT A;  1D8J A;  3I0T A;  4X6A J;  2LG4 A;  3CTA A;  3VDX A;  1LJ9 A;  2DOA A;  4XL9 A;  4O5V A;  1AU7 A;  5L3B A;  1K79 A;  4YEL A;  3PSF A;  3L7W A;  1JKR C;  1XGO A;  2WB1 A;  1RUO A;  1D0Y A;  3SYT A;  1T6S A;  1XD7 A;  2ZNZ A;  3ZQF A;  1Z67 A;  2L9N A;  2JRM A;  4B1R A;  1IC8 A;  1WVR A;  1ETQ A;  5E8G A;  4JX4 A;  2X6X A;  3F8F A;  2X6Y A;  5A2Q R;  2P6T A;  2QGU A;  3DU6 A;  2L9S A;  3E6C C;  4CZC A;  2L7K A;  5TGT A;  5KK1 A;  1FIP A;  1R1V A;  2IA2 A;  4CXF A;  4L5J A;  2R7Q A;  2V9K A;  3AAF A;  1Z91 A;  2FML A;  4HW0 A;  4G94 A;  2O8X A;  2VT2 A;  1U5T B;  1X2N A;  2Y48 A;  3BG9 A;  2BOL A;  2ZCW A;  3KEQ A;  2LLK A;  4EGY A;  4E7K A;  1JJ6 C;  4IHV A;  1KA8 A;  2O7O A;  4AID A;  1QHG A;  2KRF A;  3IKV A;  4A3I J;  4AIH A;  3I5U A;  3LSJ A;  5D8K B;  2JT1 A;  5L3E A;  1MDM B;  3OYJ A;  2FMY A;  4WWC A;  3PQJ A;  4HLY A;  3CCJ I;  1ZGA A;  2WAF A;  4I76 A;  4XRM A;  1IO2 A;  1XMK A;  1IV8 A;  5ICF A;  3HRU A;  4DYR A;  2IGM A;  4FE7 A;  4XIC A;  2A61 A;  4JX6 A;  2K9L A;  3JRD A;  1YQA A;  5B3S H;  1Z0X A;  3V8L A;  2HDW A;  4BAC A;  3J7A Y;  2RRE A;  2F4I A;  2XC7 A;  2EFO A;  1VQ4 I;  3BT9 A;  3ELK A;  4NB5 A;  2DXI A;  2H1L A;  1YO5 C;  3GTM J;  5IYC J;  1BN5 A;  2WBM A;  3DPL C;  1FOY A;  4XQF A;  2H1K A;  4HX7 A;  1B4A A;  4BEH B;  2ACJ A;  3LSP A;  2DQL A;  2KHM A;  1Y56 A;  1J59 A;  3HC7 A;  1HF0 A;  4DZP A;  1QA6 A;  1USS A;  3GTQ J;  1FTZ A;  2DA4 A;  2DLL A;  1Z3X A;  1HQC A;  2ZME B;  2L4A A;  1XDS A;  1HKS A;  4DJA A;  1PVE A;  3CCQ I;  5CQE A;  3RIR A;  3D1N I;  1HDP A;  4LMY A;  1MBJ A;  3REO A;  1JGG A;  2DPU A;  3EQL F;  3WTV C;  1T95 A;  2HPI A;  1P2F A;  5HLH A;  3GFI A;  1X19 A;  3K69 A;  3FMS A;  2BVL A;  2LOO A;  3JAM R;  1MMG A;  2BHZ A;  3S3M A;  4HA8 A;  1RET A;  2DN0 A;  2DFH A;  4EJV A;  3D5L A;  3FWE A;  3HUG A;  4XOR A;  5HLT A;  2K9Q A;  2GM4 A;  4UVC A;  4UB6 C;  2XV4 S;  3KP5 A;  1VZ0 A;  2EIJ H;  1VQL I;  1FLI A;  2E7X A;  2KIU A;  2WB1 N;  2R7U A;  3J7A O;  1GXQ A;  2IGO A;  5IYD J;  1HW1 A;  2A6E F;  4GDF A;  2DCE A;  4LIU A;  5CQG A;  2K9M A;  1LVK A;  3CUQ A;  2OC6 A;  4U7B A;  5LRS A;  1N78 A;  2BY2 A;  3KYL A;  1SEU A;  1MND A;  4AC0 A;  2OZ6 A;  2NNN A;  4F52 A;  2FE3 A;  3K2Z A;  4L9N A;  1ULY A;  2P5V A;  3SXY A;  3G71 I;  1S7O A;  4PFO A;  1E2X A;  4ZJZ A;  4A6D A;  1VQ6 I;  1RQ6 A;  4A69 C;  3R61 A;  1R5H A;  2DDB A;  3AFH A;  3K4L A;  1OQY A;  1JKQ C;  1L0O C;  4N4N B;  4EQQ A;  2YSR A;  3G6E I;  3J80 Z;  1WH5 A;  1ZYR F;  4GRI A;  3GTK J;  4J19 A;  1WJC A;  3BR5 A;  2D45 A;  4PDK A;  2HDC A;  2MFZ A;  4A3K J;  3ZMT A;  1ERD A;  2WA0 A;  4CCN A;  4RAY A;  5FKO A;  3FK7 A;  1W7P B;  1MIJ A;  5DM6 F;  2KDO A;  1FIA A;  4UUS B;  2Q1Z B;  4BAY A;  1S6L A;  3E5U A;  2VKD A;  1IZ1 A;  3HRS A;  2OZU A;  3CF2 A;  3FHN A;  4WF2 A;  4HNV A;  1NG7 A;  1D0Z A;  3K1P A;  5J4V A;  2FEZ A;  1ZG5 A;  2NVX J;  5DCF A;  1I39 A;  4XLH A;  4Y7N J;  1P4W A;  1BI3 A;  2CW7 A;  1SMY F;  4LG0 A;  2HKO A;  2QF7 A;  3OY9 A;  2QZ8 A;  4XMY A;  3ESW B;  3OIQ A;  4CCM A;  4Y13 A;  3S15 J;  4NC6 A;  3KIO A;  1GHC A;  1HXD A;  2DA2 A;  1T38 A;  2JPC A;  2IEK A;  2L9V A;  2Z9O A;  1POG A;  3OR1 C;  2Z2S B;  4LOC A;  1IRZ A;  2HZD A;  4OIP F;  5DD8 A;  3OYB A;  3U2R A;  4PJJ A;  3GTO J;  1Y39 A;  2ZBK A;  4HX8 A;  4BE2 A;  1QVT A;  1WH7 A;  2KIQ A;  3RKW A;  3QP6 A;  1I3Q J;  2GA2 A;  2O0Y A;  1S9H A;  3ASN H;  2AQE A;  2MGQ A;  5CVV A;  3SDG A;  1K78 B;  1M1E B;  1TT5 B;  1ONV A;  1P92 A;  1VQK I;  3HM5 A;  4G7H F;  2K9S A;  4UUV A;  4M3D A;  4FHT A;  2OA4 A;  3P5J A;  5M3F J;  4BBS J;  2XUB A;  3O8H A;  3ZXS A;  4C3H J;  3KLO A;  4GGG A;  2PJR B;  3TGN A;  4BY7 J;  2HKX A;  2R7W A;  2VPR A;  5K5Q A;  4Z2Y A;  1MJB A;  1W5C C;  3ABK H;  2E36 A;  5ILU A;  4CYC B;  5D4S A;  2L7M P;  4M73 A;  3DV8 A;  4I0B A;  1U8B A;  4B4C A;  3S1R J;  1WI9 A;  3ONQ A;  2MZ4 A;  5LHH A;  2HVS A;  3F6O A;  3P9C A;  1JHH A;  1SD5 A;  4BH9 A;  2K40 A;  2QEN A;  4CYD A;  5E3M A;  1EH7 A;  1X3U A;  1MJA A;  2DYS H;  3KP7 A;  4PSX A;  3CCE I;  1QPI A;  1OCT C;  4F91 B;  3V7C A;  2A3S A;  3GTP J;  3DEW A;  3AG3 H;  4ZDO A;  2XRL A;  4FE4 A;  3D0S A;  1OR7 C;  1UEL B;  2Y69 H;  2LBF B;  5IT9 Z;  4IRI A;  1R5I D;  3IP4 B;  1BI1 A;  2VBY A;  3O2P E;  1SFK A;  5TJJ A;  2JA8 J;  4NC8 A;  3LFU A;  5DCM A;  2K4B A;  2R7Z J;  2CW8 A;  1RRJ A;  2KFD A;  4QPO A;  3WE3 A;  2HU9 A;  4XID A;  1HKT A;  2A5W A;  2PMU A;  3FDY A;  3NWS A;  4EM0 B;  2DTZ A;  1V4R A;  4XK4 A;  1UFM A;  1UMQ A;  2KMU A;  4BQN A;  1OYY A;  1ETK A;  4JK1 X;  5LEK A;  2IW5 A;  1P4A A;  2HOE A;  2OBP A;  4RB0 A;  1ZRF A;  2P5K A;  4U0Y A;  3CJN A;  2L3D A;  4ZYD A;  2JA6 J;  1KQ0 A;  4MFE A;  1XGM A;  3BDD A;  2YU9 J;  2ID6 A;  3SZP A;  4EGZ A;  1BL0 A;  1G2H A;  3M8E A;  4MEY F;  5C44 J;  5E79 C;  2VOP A;  2PX9 A;  2QYO A;  1Z7U A;  5F1J A;  2R93 J;  2HGC A;  3T8R A;  3NAU A;  4LGW A;  5FRN A;  4MHG A;  1HST A;  5M5W J;  4DYQ A;  1VFC A;  3CCY A;  2RQQ A;  1W36 C;  5BNG A;  3HSE A;  2QWW A;  2ZNY A;  2LP0 A;  4A5M A;  2NVQ J;  3EYY A;  1U5T A;  1K6Y A;  3OYE A;  4WXH A;  5J8F A;  1WRJ A;  2KZV A;  4RB3 C;  3KLN A;  4BU2 A;  3KZY A;  2XF6 A;  4D7M A;  4GYG A;  2E1M B;  4PK4 A;  4LIV A;  1MDM A;  1WQ2 A;  2K85 A;  2M30 A;  3BR6 A;  4C3I J;  2XGE A;  3MKY B;  3IWZ A;  2DTR A;  2E34 A;  4BGD A;  2FUG 2;  1RNL A;  3F6V A;  2ME6 A;  3J7A W;  3CQZ J;  1NG6 A;  2HQ5 A;  1D1A A;  4OWR B;  2DYR H;  2FX0 A;  3IWF A;  3K7A J;  3WTT C;  3EUA A;  3KYD B;  3F0C A;  2CUE A;  4IEJ A;  4LLL A;  3OS2 A;  5EYR A;  2CJJ A;  2IAI A;  2VBZ A;  3VYU B;  3KP3 A;  2VAS A;  5FJ8 J;  3WOD F;  1AKH A;  3ZQC A;  2M35 A;  3A02 A;  3ZPL A;  2ME0 A;  2BVM A;  2VKV A;  2F4O B;  2RKH A;  2H6B A;  1O7L A;  4BEH A;  3SZT A;  4BQA A;  3ERM A;  4BYY A;  2E1O A;  1Q1H A;  1MMD A;  4A3E J;  4RLQ A;  4CA0 A;  4DIQ A;  1JI8 A;  3KE2 A;  2JSC A;  1X3W B;  3S93 A;  2DW4 A;  5FLM J;  2R0Q C;  1MGT A;  2JTV A;  3MD2 A;  1YRN B;  1OJL A;  2UZK A;  2ZME A;  1ZGW A;  3DKW A;  3H1C A;  1SD6 A;  3TQN A;  5HLG A;  1E3H A;  4YIF A;  1UST A;  4QTR A;  5ILS A;  3A01 B;  3V4G A;  4I98 B;  3G1L A;  1FBQ A;  5D5W B;  1WZ2 A;  3OL4 A;  3F72 A;  2GQQ A;  4XBF A;  1F5T A;  1Z1D A;  2XAU A;  1W0U A;  1AWC A;  2QQB A;  3MWM A;  4P5O A;  5TRD A;  2QSH X;  2ZSH B;  3L2R A;  3LSM A;  1RKT A;  1G3T A;  2MD0 A;  4BS9 A;  1EH8 A;  4H4K C;  4L18 B;  3FM3 A;  3TW6 A;  1XSV A;  3RCO A;  1WJB A;  1XMA A;  1BOB A;  4OAY A;  4QWQ A;  3OWT A;  5B5E C;  3DXJ F;  3LSR A;  5BMZ A;  5FFX A;  3JR9 A;  4HBL A;  1V3F A;  2LRD A;  1LPQ A;  4II3 A;  2WAD A;  1CQT A;  1OR7 A;  3SEZ A;  3GYH X;  1FTT A;  3BPV A;  3DTK A;  2ELH A;  1QZY A;  2BHY A;  2GXA A;  3F3X A;  3IKT A;  2ETH A;  2HQA A;  2PG4 A;  5F27 A;  1G8X A;  2FQ3 A;  5EJC A;  4XON A;  2DPD A;  1HC8 A;  2OU2 A;  3GFL A;  1I1G A;  2KP6 A;  2ZFU A;  1Z77 A;  5F6F A;  5M5X J;  2KT0 A;  4XN3 A;  3TDU C;  5JHU A;  2CH0 A;  5K7H A;  2QLZ A;  4BXF A;  2YUS A;  2L54 A;  5IP7 J;  2EIM H;  4PJL A;  2CUZ A;  3I59 B;  5J3L A;  4C30 A;  2L02 A;  2NNY A;  3S14 J;  4MFD A;  1BR4 A;  1MH4 A;  2DK5 A;  3ZMZ A;  4EAT A;  2CO5 A;  4UUS A;  2BY1 A;  1UG0 A;  1J9I A;  1WJD A;  2WTE A;  1PYV A;  5LEJ A;  1ZRD A;  1MH3 A;  5AIP A;  2PN6 A;  5KAI C;  1X1D A;  3H5A A;  2DT7 B;  2QBY A;  3DPU A;  2EFQ A;  4KIB A;  3UNG C;  3JRG A;  3I4P A;  3FXM A;  5HNF A;  4ON0 A;  4I2O A;  1MMS A;  1JE8 A;  3GFM A;  1W36 D;  5CLS A;  1VND A;  4G8X A;  1TNT A;  5J8C A;  1R1U A;  4HG2 A;  4DQ2 A;  1NK3 P;  2Y75 A;  5JLW A;  2L4M A;  2VBX A;  1IF1 A;  2XAF A;  2NOJ B;  2W57 A;  4XOT A;  3K0L A;  4ESF A;  3WTX C;  4U7D A;  1JUS A;  1QZZ A;  1TW3 A;  5GTH C;  2IS1 A;  4O3M A;  4RGR A;  2M8G X;  1BR1 A;  3VFZ A;  2JUC A;  5C4J J;  3RPU D;  2MLG A;  1P4X A;  2GWR A;  4MTD A;  3SHF A;  1S29 A;  1FWZ A;  1K78 A;  2LMD A;  2CYY A;  2OF7 A;  2QQ8 A;  1XX5 A;  4YFN F;  3ZGK A;  2P5L C;  1O3S A;  3F9K A;  5DYM A;  3LA7 A;  4M3B A;  2K5C A;  5L3F A;  3HOT A;  1D8K A;  2DMQ A;  4M9X A;  3R0A A;  3JRF A;  1QBJ A;  2E1C A;  3JRC A;  3A52 A;  2L0K A;  4RDU A;  4FQG A;  4DGW B;  5KNL A;  2CFX A;  2Z5U A;  4LB6 B;  1F9N A;  2VLA A;  2Y0S A;  1ETW A;  3T8T A;  4WXC A;  4KMF A;  1DGW Y;  5ERI A;  3RPQ A;  5CVJ A;  1WWX A;  1UAA A;  4CYC A;  2V6E A;  1IXR C;  4ZYH A;  4N9H A;  5GP9 A;  2LY9 A;  1MSF C;  5EZG A;  3HXL A;  5GAG J;  5E1W A;  1BC7 C;  3VWB A;  3CC7 I;  1ODD A;  1MSE C;  2ECC A;  2ZC2 A;  1ZGJ A;  2RGV A;  3OYN A;  1RUN A;  3NEU A;  3GBG A;  3E6M A;  4ASN A;  1I6H J;  2VC0 A;  1T2K A;  3QPT A;  2R7V A;  2OCC H;  1FZP B;  2VJ5 A;  4LK1 F;  5IT9 K;  2XHK A;  3H9Q A;  4Y3O A;  2K9N A;  5GPC A;  3S3O A;  2LRE A;  2EIL H;  5J47 A;  5A2Q K;  5IT3 A;  3T0Y A;  5CJ9 A;  3RYR A;  2HYJ A;  4CHU A;  3OIP A;  4OMZ A;  2XIG A;  3VEP A;  3RDI A;  2MW8 A;  2GIV A;  3GFJ A;  4A2U A;  3KPH A;  4DW6 A;  5GPA A;  1RR7 A;  5HDG A;  5TIS C;  3FM5 A;  3ISP A;  2EZI A;  4XLN F;  2VKE A;  3SFI A;  2VJJ A;  3CUQ C;  1KYW A;  2HNH A;  2DK8 A;  5CVR A;  2X1E A;  1H9G A;  3DU5 A;  3L2Q A;  1U78 A;  2H8R A;  4ESB A;  2QCO A;  4YFK F;  4EMS A;  1YX3 A;  2V1N A;  1JHF A;  1D1C A;  3WU2 C;  4EJO A;  3BWG A;  2KIF A;  2DBB A;  2E19 A;  2IGK A;  3LST A;  2HI3 A;  3ZMV A;  2A5Y B;  1S72 I;  1LDK B;  2Q2E B;  2JK3 A;  2JA2 A;  2L7F P;  1IJW C;  3ABT A;  3W2V A;  5E17 F;  5E3O A;  2DMT A;  1MBE A;  1UB9 A;  3BR2 A;  3LMM A;  2W7N A;  5LFA A;  2OQR A;  3E7L A;  3NAR A;  5JVT A;  3PFY A;  5E3L A;  1LUJ B;  1IXS B;  1IRX A;  1R1T A;  1Y0N A;  5HLI A;  3TW7 A;  1BW5 A;  3HHG A;  1P7I A;  2MC3 A;  1WSU A;  2VJI A;  3CP8 A;  3FHZ A;  3W6J B;  1O4X A;  3KZI C;  5JHF A;  3JRB A;  4IJA A;  1V55 H;  2VT3 A;  2ICW G;  2D2W A;  3WE2 A;  3MCZ A;  3MZ8 A;  3ZQH A;  1Z05 A;  2Y0S N;  3HZJ A;  5FLX K;  1FPQ A;  3LSK A;  1LE8 A;  1XDU A;  3P9I A;  2A05 A;  2COB A;  1FBU A;  4D1Q A;  2VXZ A;  1EA3 A;  2JN6 A;  2UXX A;  1FYM A;  3DF8 A;  3KP4 A;  4JBA A;  3B6C A;  2F5D A;  4BHP A;  2NYX A;  5HS8 A;  3KYC B;  2H94 A;  3V7R A;  4IHX A;  4IOA F;  1YJ9 I;  3CCS I;  2KL4 A;  5GAH J;  1B9M A;  4B44 A;  2I10 A;  1ZR2 A;  1LVA A;  1Y8Q B;  4EJT A;  3G73 A;  3M8J A;  3I71 A;  4HEA 2;  3M1E A;  1J7K A;  1DPR A;  2LDU A;  3A4C A;  3EUK L;  4C2U A;  2YS9 A;  5D6F A;  4ZH4 F;  3MZY A;  1VQP I;  5FD6 A;  4E7Z A;  4AWX B;  2L2O A;  2LC2 A;  2EFN A;  3TMO A;  5ICG A;  1AHD P;  2EK5 A;  1YRN A;  5F0C A;  4IRG A;  4FAS D;  2E1N A;  4KIF A;  5LHG A;  3IH4 A;  2EA2 A;  1E17 A;  4G9Y A;  2LKS A;  5E8I A;  1YS7 A;  4EVI A;  1X4O A;  3B02 A;  2W00 A;  5KAF C;  3HOX J;  2HYF A;  3A01 A;  4WCG A;  1QQI A;  3ABU A;  2V4J C;  4ESJ A;  3CZ6 A;  2GA1 A;  3VOD A;  1CF7 B;  2K7L A;  1QO0 D;  1TWC J;  1XN7 A;  2CSO A;  4HAM A;  3RZD J;  3HDD A;  3KP6 A;  4EEF G;  4JQF A;  2I5U A;  3HOY J;  2BY3 A;  4XLF A;  4BJT A;  2EIK H;  4QLC U;  4AIJ A;  4U88 A;  1IUF A;  1YYV A;  2QSG X;  5DS9 A;  2R7F A;  4Q4Z F;  1OYW A;  5D4R A;  4Y4R A;  4M3G A;  4OIR F;  2IRF G;  3GLL A;  4MGR A;  3DEE A;  2FNP A;  5EEG A;  1TZL A;  2IXS A;  2EV6 A;  2O3F A;  4Y17 A;  2XB0 X;  1TWF J;  4R1H A;  1X2M A;  1WJF A;  3FBN B;  1SVO A;  3BRO A;  3HRT A;  1FC3 A;  3OS1 A;  2JRT A;  4IRH A;  4XRS G;  3M07 A;  4F7Z A;  2DFF A;  5CYV A;  1H9T A;  4GXO A;  1A31 A;  1U6G A;  3TKY A;  1KON A;  2F5V A;  5JVG F;  2X85 A;  3BPX A;  3S3N A;  1IG7 A;  3OOU A;  2VQH A;  2YPR A;  2W82 A;  4P1W A;  4PJM A;  4KIG A;  1HSJ A;  4N0B A;  2XAQ A;  3GME A;  4FX4 A;  1EKE A;  2DU9 A;  2RNG A;  1OFC X;  3MVP A;  3GZ6 A;  1UHM A;  2P6S A;  2L9R A;  4KDP A;  4RS8 A;  2M0C A;  3BQZ A;  1TWH J;  1YS6 A;  3S32 A;  3KET A;  4ZYG A;  3HOZ J;  3WGG A;  3I59 A;  3EYI A;  3GUD A;  3RTR A;  4AIK A;  1JKO C;  1FYK A;  3VSK A;  2HEO A;  4Y52 J;  4XKV A;  5M5Y J;  1B1B A;  3Q5F A;  3K2A A;  5J1Y A;  3F8M A;  1QZE A;  3VYT B;  3S1N J;  2XPU A;  3LA2 A;  2P8T A;  4RM3 A;  3P9K A;  4NDL A;  4FTH A;  1NK2 P;  3ZQQ A;  5KCM A;  3BCA A;  5LLQ A;  3RZO J;  3J81 R;  2IA0 A;  2GXG A;  3HRM A;  3BZK A;  4C9Y A;  2KDZ A;  2BYV E;  4CO8 A;  2BBY A;  4P9F A;  3OSG A;  3QOP A;  5J40 A;  1GV2 A;  3H92 A;  3M7G A;  4L0Y B;  5E1Z B;  2UV1 A;  3ERE D;  5CVU A;  4ZZD A;  4U0W A;  3T1B A;  1U5T C;  2D1H A;  2QKL B;  4H0E A;  1UJ8 A;  1XMX A;  2YR2 A;  1JTY A;  2A07 F;  3MMY B;  1OCO H;  2HOT A;  2IBD A;  3IL2 A;  2EV0 A;  3BR3 A;  1ETO A;  2A69 F;  4KN4 X;  5LHI A;  1JXS A;  1PJR A;  2D5V A;  1UHW A;  4HDV A;  3C2H A;  4CIC A;  2OCE A;  1ZQ3 P;  3WHB A;  1DDN A;  3S17 J;  1FP2 A;  1R9T J;  1LFU P;  1MJ9 A;  4CDG A;  2LR8 A;  4B8X A;  2X1D A;  2WAQ A;  1Z9C A;  1HW2 A;  4JYK A;  2ZKZ A;  2ESN A;  1ON1 A;  5D5V B;  2IS4 A;  3CDI A;  3MAJ A;  5EGO B;  5FRM A;  3HJE A;  3U21 A;  4IHS A;  5FO5 A;  2IVM A;  2WY8 Q;  3ROU A;  1I1S A;  3GXO A;  3I56 I;  4A3M J;  2JMW A;  1MKM A;  2VPL A;  3WTS C;  1YW7 A;  2ZXJ A;  2OD5 A;  4LFU A;  4B47 A;  4BQQ A;  3QPH A;  3QP5 A;  4BKX A;  4U0V A;  3X2Q H;  5AIQ A;  2XB5 A;  4RA2 A;  2IT0 A;  1MZB A;  3WTW C;  2I8D A;  5EZH A;  3KCC A;  3IV5 A;  2FOW A;  3AG1 H;  4RMN A;  4DOZ A;  3PQK A;  2ZME C;  4PCQ A;  3DBH B;  2EFW A;  1BOA A;  5F08 A;  1NHA A;  3EPZ A;  4CZZ A;  1S5L C;  3E6D A;  3CC4 I;  3GW2 A;  2FU4 A;  4QIW N;  2E7W A;  2VI6 A;  2DT6 A;  3QYB A;  1DPU A;  2M0M A;  2W25 A;  5IP6 A;  3FKI J;  3CO6 C;  2CU7 A;  3ZMD A;  1MNM C;  5FKK A;  4KT5 C;  3CLO A;  4G6T B;  1B8I B;  2DI3 A;  2LNB A;  3EET A;  3QPL A;  1TT0 A;  3W2W A;  2FXA A;  1VTN C;  1KQ9 A;  5K1Y A;  1MMA A;  4YG2 F;  1B9N A;  1MBH A;  3BG3 A;  2PEX A;  4KNY A;  5L3G A;  1HA8 A;  4I02 A;  4BE1 A;  2E60 A;  3QYF A;  2L01 A;  3PM1 A;  3QWL A;  2K86 A;  3H3Z A;  2ZO4 A;  2RQP A;  2O61 A;  3RYP A;  4IOC F;  1JUP A;  2RN7 A;  1G3Y A;  3C2G A;  1BM9 A;  1LFB A;  4CCL A;  2R4G A;  2O6G E;  2FSW A;  4J00 A;  4KIS A;  2JA7 J;  3SFZ A;  4BUP A;  3Q3S A;  1ACI A;  3A1Y A;  1IN5 A;  1I3A A;  3CP2 A;  2PMH A;  3ML6 A;  2BGC A;  4RLF A;  4A0Y A;  5LBQ A;  2R7X A;  4N4O B;  5A2Q Z;  2CV0 A;  1O3R A;  1GUU A;  2EFP A;  5FGM A;  2Y2Z A;  3RQ4 A;  4UXN A;  2F5C A;  5IOZ A;  1ZAO A;  5B66 C;  3RKQ A;  4M6V A;  2R5Z B;  3GVA A;  1MD0 A;  3WTU C;  3HOV J;  2QEX I;  3WU1 B;  1VQO I;  2AXT C;  2ISZ A;  3OYK A;  1BIA A;  1TWG J;  3DFG A;  3CCR I;  1X3Z B;  1YHQ I;  1XS9 A;  5H2F C;  1KU7 A;  1IUY A;  1U3E M;  2WAQ N;  4XNF A;  1V5F A;  2CUJ A;  2DDA A;  3HB9 A;  4IZZ A;  3DP7 A;  1LB2 A;  1JTX A;  3TP0 A;  4BJ5 C;  1KYZ A;  2FBI A;  4K2E A;  1HLV A;  1AOY A;  5KHD A;  2Z1D A;  1WGX A;  2FOK A;  2BE5 F;  4V2F A;  4XKW A;  1IAW A;  4ENJ A;  6PAX A;  3K10 A;  1GVJ A;  3ECH A;  1LNW A;  4XLC A;  2XSJ C;  1XG1 A;  2NS7 A;  4BY1 J;  3CDH A;  4BE0 A;  1XB4 A;  4HST A;  3AL0 B;  1JT6 A;  2X1C A;  2ID3 A;  5HDK A;  1T8I A;  2B63 J;  2KKO A;  4AUX A;  3CJQ B;  2CG4 A;  1DU6 A;  2M3A A;  3M1C A;  1F43 A;  2DA5 A;  4ZZL A;  3QOE A;  3QU6 A;  4ENK A;  4E4H A;  2M8E A;  2ZJQ F;  3DLL F;  2ELJ A;  2ISY A;  2M9H A;  1SFE A;  4LK0 F;  1TQI A;  3ZQG A;  3OSF A;  1YW9 A;  2AQF A;  4U87 A;  4P96 A;  2KJB A;  2L7Z A;  5FLX Z;  2DMN A;  2VE9 A;  2GZW A;  1MW7 A;  3WG9 A;  1SFO J;  1FOX A;  1QRY A;  4UVA A;  1S7A A;  1T0F A;  1E0E A;  2EIN H;  4A3L J;  5BS6 A;  2A6T A;  1Y0U A;  2V7F A;  4I99 C;  2L5Q A;  3O3K A;  5KVR A;  3JAM Z;  2M34 A;  1HOM A;  4XLA A;  2O03 A;  2HOS A;  4OIQ F;  4B43 A;  1G3W A;  4A0X A;  3IHU A;  1CF7 A;  2NVY J;  4WK8 F;  3OYL A;  1LQ1 A;  2ZXW H;  3RJP A;  3E97 A;  1X1C A;  1ZHF A;  4HYE A;  3L1P A;  2JQ7 A;  3H5N A;  4NUB A;  1VQ7 I;  3ZQ7 A;  4B3A A;  3K4M A;  5E1X A;  3F23 A;  3IRR A;  5GAD J;  2X0L A;  5F64 A;  4L9J A;  3JRH A;  2HXI A;  1X1B A;  4IQJ A;  1B72 B;  1F1Z A;  9ANT A;  2BXZ A;  3FZV A;  2FF4 A;  2COM A;  3OR2 C;  2HQN A;  3K4N A;  4Q5S F;  2D1V A;  4AM3 A;  2WY7 Q;  4PSW A;  4M9Z A;  2WC2 A;  3QPS A;  3WHC A;  5HS7 A;  3C18 A;  3S16 J;  2ECB A;  2K4J A;  2M4K A;  1EH6 A;  2B7E A;  1RIO H;  3I9V 2;  2X6O A;  1U9O A;  4J01 A;  3PNY A;  2DAO A;  3VYS B;  4IO9 F;  3BTJ A;  1BI2 A;  3BR0 A;  2CWE A;  2EZL A;  2HTJ A;  2EWN A;  4ENM A;  3J7Z I;  3TO6 A;  3TL4 X;  4NC7 A;  2LVS A;  4R8H A;  3FK6 A;  4F93 B;  1KQ8 A;  2LTP A;  2W48 A;  2DA1 A;  3IAS 2;  3PSI A;  3ZQL A;  4F55 A;  2RC4 A;  2DFI A;  4KFC A;  2XF7 A;  3LAJ A;  2KRC A;  3E0J B;  4NHJ A;  1ON2 A;  1SVM A;  4A6E A;  5HOD A;  4S05 A;  3HPH A;  4IF4 A;  2NVU B;  5BQT A;  3KEO A;  2KIM A;  2BW3 B;  3MKL A;  4A5N A;  4XM3 A;  3TO7 A;  1K61 A;  1FYL A;  2CQ7 A;  3JRI A;  4HNT A;  1FBS A;  2MBF A;  3NWT A;  1IXC A;  3G1O A;  4X1E A;  2AHQ A;  1YOV B;  2J5O A;  4JX5 A;  3I64 A;  4Q47 A;  2GOX B;  3CCV I;  1XSD A;  1OPC A;  4KJZ A;  3WU0 A;  3H9J A;  4CH7 A;  2F5F A;  5FB2 A;  4I01 A;  3BJA A;  4G6Q A;  2HS5 A;  1MBG A;  1AA7 A;  5DEQ A;  1WHU A;  3M3Y J;  4UB8 C;  3ZN0 A;  3BY6 A;  1RES A;  3R4K A;  2M4G A;  2VIX A;  4KMU X;  1YLF A;  4DBQ A;  3L2V A;  1W7P D;  3HUG B;  1OCC H;  1W7P A;  4CSW A;  4YII A;  3DKX A;  2GAU A;  4LB5 A;  1SAN A;  2JA5 J;  3SEQ A;  3NRV A;  2DQR A;  3R0J A;  1UZC A;  2Y9Z A;  2E1M C;  2BXY A;  3K4J A;  3HOW J;  2MD5 A;  2MG4 A;  2WWY A;  2DJI A;  4LG3 A;  5ICE A;  4L0Z B;  4OIO F;  2XAS A;  5J1R A;  1Z6T A;  3C3W A;  1E3O C;  4L9T A;  2IA1 A;  2IGN A;  2XAJ A;  1WJA A;  3E5Q A;  1X4P A;  1STZ A;  2FJ1 A;  2HZT A;  4I7H A;  2OUM A;  2VN2 A;  2F2E A;  3OOP A;  4HV6 A;  4E70 A;  3OYM A;  4BNC A;  2X4H A;  3GTL J;  2BEO A;  5L3C A;  2MAB A;  1R4N B;  5EGO A;  2HQR A;  3UR3 C;  1IGN A;  2C6Y A;  1WFX A;  4OOI A;  2DOF A;  3TOA A;  1TW2 A;  3PNV A;  3K70 C;  3M4O J;  4XKC A;  2JPB A;  2VXD A;  1RPW A;  5DTD A;  3OV8 A;  2B9S A;  3FXQ A;  2V1X A;  1KU3 A;  3IAM 2;  2V6C A;  1ZEL A;  2CQX A;  1FSH A;  4HQE A;  1WI3 A;  4L9V A;  1KU9 A;  4A0Z A;  3SJM A;  3KP2 A;  5M3M J;  1K4T A;  4EM1 A;  1QGP A;  4RB2 C;  1FNN A;  2OV7 A;  2PJR A;  1ZAR A;  1A04 A;  2XAH A;  1OYI A;  1HW5 A;  5D6E A;  2PQ8 A;  3H5R A;  2QVO A;  2E5Z A;  3D5S C;  3L09 A;  3R60 A;  1APL C;  4DBR A;  4QSH A;  1Z21 A;  2EV5 A;  1B8I A;  4MLO A;  4P9U A;  3J80 R;  1PP7 U;  4UVB A;  4KIC A;  2P7V B;  2ELK A;  2HXO A;  1WPK A;  4KA4 A;  1R71 A;  4G7O F;  4UY8 I;  2AXL A;  1W4M A;  1SVL A;  2EZH A;  2KQR A;  2XF5 A;  3DQV C;  3S8P A;  3C2B A;  2FQ4 A;  3TOB A;  4AYB A;  2E2J J;  1TC3 C;  2XRO A;  4ZYE A;  2ZJR F;  2O8K A;  4DZJ A;  2WAE A;  2LBF A;  2XRN A;  5JI6 A;  2GIZ A;  1FOK A;  1ZH5 A;  3DPT A;  1YE9 A;  1FT9 A;  4RAG A;  5HNH A;  1TL8 A;  3I4M J;  2X98 A;  3ZQI A;  3FX3 A;  3C7J A;  4L5I A;  1SD7 A;  2XKP A;  1T39 A;  3EUH A;  3FIW A;  4XR6 A;  3WGI A;  2IP2 A;  2BZT A;  4GCV A;  2Q8K A;  2DOD A;  1FEX A;  5K7F A;  2HVQ A;  2M87 A;  2TDX A;  1X58 A;  1YFH A;  4BQO A;  2IS2 A;  5HS9 A;  3OYG A;  3DTI A;  2QM3 A;  4WX9 A;  2LKX A;  3W6V A;  4MEX F;  2JZY A;  3ABM H;  3K9T A;  2E71 A;  2UXN A;  2FBK A;  4ABZ A;  3CME I;  3GF2 A;  2E2H J;  3U1K A;  2NXN B;  1SC7 A;  4C2M J;  3FXR A;  5GTI C;  5H20 A;  3E3V A;  1FSE A;  4FX0 A;  2CQK A;  1R36 A;  3LA3 A;  1ITY A;  2K3P A;  4AVP A;  5H6Q A;  2RNJ A;  2ZXI A;  3GEZ A;  4M6X A;  4XN0 A;  1I5Z A;  1OMI A;  1SAU A;  3GTJ J;  2IPQ X;  4M71 A;  4CCJ A;  1R23 A;  4E7J A;  1J0R A;  2P7C B;  1ENH A;  4LJZ F;  3IC7 A;  2QSF X;  5C4X J;  4LIT A;  3PL8 A;  5FFZ A;  3DWL E;  4BJ6 C;  4ZTF A;  5DCM B;  2VQL A;  2P0T A;  1VQN I;  2QKM B;  2OAZ A;  2M7B A;  1D3Y A;  3CMY A;  4IQ4 A;  2DOE A;  3VB2 A;  2R5Y B;  4F92 B;  1JKP C;  3DEU A;  2YU3 A;  1Y8R B;  2Y0M A;  1RI7 A;  2E5N A;  3BZ6 A;  4V2G A;  4I0A A;  1BBY A;  2G0E A;  3K6G A;  3V42 A;  4A93 J;  4A3J J;  5IPA A;  1YI2 I;  1O7F A;  4E6K G;  5IY5 H;  3PIP F;  1OCR H;  2LK2 A;  2NAZ A;  3RKX A;  3JAM K;  1ZG3 A;  2M45 A;  3QU3 A;  5IT9 R;  3S2D J;  2J5P A;  2BY0 A;  2XAG A;  4D0P A;  1SMT A;  5E3N A;  3CJR B;  1R22 A;  3K70 D;  2F48 A;  4MQV A;  4XKB A;  4B48 A;  4TV7 A;  1ZRC A;  2PMZ A;  4UV8 A;  4XSZ F;  5K7Z A;  2DFE A;  2MVT A;  4AYB N;  2PI0 A;  2R7S A;  4I6Z A;  4HZF A;  2W84 A;  3DTE A;  1VF9 A;  3ECO A;  2ZJP F;  2PFB A;  4ANJ A;  2R92 J;  3CC2 I;  1YIT I;  3AG2 H;  3HIF A;  1ZKG A;  1B72 A;  3UKG A;  3DLA A;  2G9W A;  3W6K B;  1UCR A;  2HDD A;  1ZK8 A;  5FKM A;  4HX4 A;  1S3J A;  1TTY A;  2XPW A;  2H27 A;  4CCO A;  1PDN C;  1J09 A;  3BG6 A;  1PP8 F;  4HF2 A;  2HTS A;  1ZLJ A;  3HEF A;  4EJW A;  4E7H A;  1WJ5 A;  3J81 K;  5IOY A;  5BPI A;  2HYG D;  3KX2 A;  1IDY A;  3B73 A;  2F4M B;  5JFR A;  3LAP A;  3OS0 A;  1J5Y A;  2NS8 A;  3CD6 I;  5CPR B;  2LH9 A;  1AKH B;  4N9I A;  1R5G A;  1G4D A;  4RGX A;  2LYC A;  3CJT B;  2H09 A;  1OCZ H;  5LGT A;  1G3S A;  1R7J A;  3PUF A;  2V1U A;  3JSP A;  3BTL A;  4II2 A;  3CDL A;  3A2K A;  1FMW A;  4Y15 A;  3OYH A;  2BW3 A;  2O9L A;  4IHW A;  2OJE D;  1ZN2 A;  3BJO A;  1D1B A;  1B6A A;  3BLY A;  5FLX R;  1V5E A;  2VQC A;  1DQU A;  4JP0 A;  1W1W E;  1GV5 A;  3H36 A;  3HHH A;  4MTE A;  3EDP A;  3K1M A;  1ORK A;  4ITV A;  3HYI A;  4G6D A;  1LFP A;  4YEJ A;  1A36 A;  5FKL A;  4NNJ A;  3SQN A;  2VON A;  5ICC A;  5K5R A;  1LDD A;  5D5U B;  4PGG A;  5LD2 C;  1Y1V J;  3BTC A;  4R79 A;  4C2T A;  3FBI B;  3J7Y J;  4IHT A;  3SZG A;  1G6N A;  5JLX A;  3MN2 A;  2W85 A;  1Z7L A;  4I09 A;  4HRI A;  5HDN A;  2RVC A;  1QVU A;  4O6J A;  1DP7 P;  3MFK A;  1GLN A;  4KN7 X;  3PUB A;  1TNS A;  2EH3 A;  3I4N J;  3I53 A;  1R58 A;  3FXJ A;  4D5C A;  1NTC A;  2CS3 A;  2PMZ N;  4BDY A;  1Y1W J;  2EBI A;  4FT8 A;  3WTZ A;  3CMM A;  3BCB A;  3DBL B;  4OMY A;  1UHS A;  3P7N A;  1VQ9 I;  1EV7 A;  1T33 A;  2XKO A;  1TP4 A;  3F8N A;  3JTH A;  2R3S A;  5LRR A;  4B09 A;  1JJ8 C;  4DNC A;  3COA C;  4ENN A;  3R6S A;  2XGC A;  3LSI A;  1RC9 A;  2Z16 A;  3JSO A;  1WJE A;  3OYI A;  4AU7 A;  2JJ7 A;  1XTA A;  3VSL A;  4UUT A;  3BQY A;  2VC1 A;  4BL0 B;  2EZK A;  2XDV A;  2ADU A;  2F5E A;  2LD5 A;  3HKZ A;  4IHY A;  1W5T A;  2ZSI B;  3K4K A;  2AO9 A;  1T0F C;  5FLV A;  5B1A H;  4KYW A;  2DA6 A;  3RSN A;  2NS0 A;  4HSR A;  5J1U A;  1I6X A;  3ULQ B;  4M72 A;  4ZC3 A;  2WV0 A;  3FF5 A;  1YX5 A;  3N05 A;  2QBY B;  4XLP F;  5H6R A;  3WTY C;  2DT5 A;  2LFB A;  2OQG A;  2LF7 A;  2ZJ2 A;  3ZCO A;  4UV9 A;  2JVH A;  1OCP A;  5AON A;  1R00 A;  3L2U A;  1H88 C;  3G1M A;  2NOG A;  5CVI A;  2STT A;  1PUF B;  5IP9 J;  1TBX A;  2QUF A;  1I50 J;  4MO7 A;  4PZJ A;  4RM2 A;  3S2W A;  5EEA A;  2RDP A;  2AS5 F;  1A6Q A;  3CLQ A;  3ZR8 X;  1DU0 A;  1IV6 A;  3HL2 A;  4HLX A;  2R7R A;  1UG2 A;  3M8F A;  5DUI A;  3N4M A;  2R7T A;  2K02 A;  4D9J A;  5E18 F;  3G4S I;  3CO7 C;  1OLT A;  4EM2 A;  2QQA A;  2UUZ A;  3QQA A;  4HF0 A;  2CV2 A;  2M7A A;  4RGS A;  4HQM A;  3RQI A;  3BR1 A;  2HR3 A;  1Z6R A;  2XSD C;  2Y9Y A;  4AVZ A;  5FD5 A;  5IYB J;  2JWT A;  1F36 A;  2VB6 A;  1U0J A;  1YIJ I;  2HFH A;  2LY2 A;  1JGS A;  1YIO A;  2CMP A;  4PFP A;  4E7S A;  2HVR A;  3ZRG A;  3HBL A;  3OL3 A;  3FIS A;  1GT0 C;  3A0H C;  1W0T A;  2XGD A;  3V7S A;  3KZZ A;  2X9D A;  2LF8 A;  3K4C A;  3AKZ A;  2R7D A;  1BC8 C;  2RV8 A;  3Q9V A;  1YG2 A;  5EDN A;  3O8G A;  3I55 I;  3GCM A;  3AG4 H;  2JUG A;  3I54 A;  1D5Y A;  1PUE E;  5LGN A;  4QPQ A;  4S0H B;  3CCL I;  1T98 A;  3A0B C;  5BPD A;  2EJR A;  5F1R A;  2LY1 A;  1K6O A;  1XC5 A;  1TWA J;  2MYS A;  5F04 A;  2Q2E A;  3W3C A;  5D5X B;  4A3B J;  2EPF A;  1GDT A;  2CQQ A;  3LFK A;  2A68 F;  5EF6 A;  2FA5 A;  3VYR B;  1ETY A;  2P0W A;  3LSH A;  1VI0 A;  1D5V A;  4G12 A;  3DCF A;  4X0G A;  5EG0 B;  1IW7 F;  4RAF A;  4BHC A;  2E35 A;  2MUN A;  1TQP A;  1G59 A;  2DMU A;  3PO2 J;  3OYF A;  4Y33 A;  3HKZ N;  1P9Q C;  3PNT A;  4MIM A;  3HOS A;  3GZ5 A;  1H0M A;  3G2B A;  4EV0 A;  1GXP A;  1HBX G;  2VOD A;  2N8G A;  1QPM A;  3JCU C;  3MQ0 A;  3L2W A;  2VUM J;  4IVN A;  3M9A A;  1XCV A;  1A5J A;  1ETX A;  3HSF A;  1MNE A;  2ESH A;  3LQQ A;  3GX4 X;  3PO3 J;  1XGN A;  4BXX J;  2R5Y A;  1YJW I;  1SFX A;  2V26 A;  3S1Q J;  2Y31 A;  5DUK A;  2CFO A;  4AD9 A;  1SFU A;  3HPG A;  5DV5 A;  1EF4 A;  3TED A;  4LLN A;  1DP3 A;  2EB7 A;  2KPM A;  4A12 A;  2DO7 A;  3LQR A;  1T56 A;  1RR8 C;  4OU0 A;  2FRH A;  2W1O A;  1A35 A;  4KUM A;  1VQ5 I;  3CES A;  3ZOB A;  2X51 A;  4FET A;  3GWZ A;  4HOB A;  1ZLK A;  4F3Q A;  3JW4 A;  5J4Y A;  2E2I J;  1HDD C;  2IS6 A;  4NQW B;  2NRA C;  1IRG A;  2BV6 A;  3E6B A;  1V54 H;  1ZRE A;  4RGU A;  1KGS A;  1FP1 D;  3C1D A;  1LDJ A;  1O3Q A;  1WKM A;  1J75 A;  3OIO A;  2IJL A;  2X48 A;  3LNQ A;  2GLO A;  3N97 A;  3FKJ A;  2H8W A;  3CUO A;  3H35 A;  4XOP A;  2F6C A;  1FOW A;  2Y30 A;  4XSX F;  2OTL I;  3I3L A;  4A3F J;  3L2C A;  3CMA I;  2G7H A;  4DYC A;  4ZDP A;  3BG5 A;  1LE8 B;  1LEB A;  2MH9 A;  1IN8 A;  2V9V A;  2VBW A;  2WV1 A;  3IH2 A;  4PUS A;  3BZC A;  2OPT A;  4G7Z F;  3VPR A;  2V9P A;  4HNU A;  1K4S A;  1Z3Y A;  4W1U A;  5FKN A;  4LD5 A;  3CCU I;  1S7E A;  4RAZ A;  2V1D A;  5D8L B;  4A3G J;  4IX7 A;  2GXB A;  4IPA A;  3A03 A;  1BJA A;  1VQ8 I;  3H3V K;  1YW8 A;  1SAX A;  3BJ6 A;  1K7A A;  1RZ4 A;  2MC4 A;  1E3P A;  2G7U A;  4XRS A;  3V8J A;  3S2H J;  1ZR4 A;  3BG7 A;  3ABL H;  2DA7 A;  2XVC A;  5DDG A;  1TLH B;  4IXA A;  1LEA A;  3DBR B;  2K3F A;  1ZTR A;  2O5R A;  4BXU A;  4CUG A;  2QA4 I;  1L3L A;  4A3C J;  2YX7 A;  3H9G A;  3H0D A;  1RKW A;  3H3U A;  4OAZ A;  3J81 Z;  1P7J A;  3ZN1 A;  1OIS A;  4D7N A;  2FD5 A;  4EJU A;  2ZB9 A;  3EUH C;  4MQ9 F;  3RI4 A;  3B6A A;  3E1S A;  2Z99 A;  4RB1 A;  3MZH A;  2OTJ I;  2HOA A;  4HDU A;  2VL8 A;  2XGX A;  4B3X A;  1NH3 A;  1KZH A;  3KFW X;  4E7L A;  1FX7 A;  1IN4 A;  4GYI A;  2YX4 A;  2QQ9 A;  3SDB A;  2B0L A;  4P55 A;  1FMV A;  3FXO A;  1N77 A;  1BW6 A;  3HOU J;  5HVQ C;  5JR3 A;  1QNT A;  4ZTJ A;  2MA3 A;  2P81 A;  3HGY A;  3ASO H;  2UWM A;  1XSX A;  4BDZ A;  1B59 A;  4IKF A;  3ZMU A;  2JSP A;  2KJC A;  4C3J J; 
#chains in the Genus database with same CATH homology
 3QRF F;  1U2W A;  5J6X A;  2K27 A;  4ETS A;  3I58 A;  1O3T A;  1TQM A;  3J80 K;  2MH2 A;  4M9S A;  3CUQ B;  5L3D A;  1W5S A;  1S8N A;  1IN7 A;  4M74 A;  5K5O A;  3TDZ C;  4MNU A;  4Q48 A;  2PLY A;  2CGP A;  3GLX A;  3JTG A;  3F8C A;  3GO5 A;  3ZP5 A;  3E5X A;  3BOQ A;  5EEH A;  5ILV A;  1IRF A;  1O57 A;  2M5W A;  1YTY A;  1I27 A;  3L9F A;  5LGU A;  1P6R A;  1XGS A;  4CGZ A;  3F21 A;  2Z3Y A;  3HTU A;  1DUX C;  3F22 A;  2LKP A;  3U9G A;  3RPU A;  2V79 A;  2LSO A;  4LG0 B;  3FMQ A;  3BP8 A;  4OIN F;  3O6B B;  1SD4 A;  3LWF A;  3RKY A;  3VOE A;  4YFX F;  2VE8 A;  5ED4 A;  2Q0O A;  1HKQ A;  3U1D A;  2Z33 A;  2FNA A;  1XCB A;  2H6C A;  3Q9S A;  3WGH A;  5BOX A;  3G3Z A;  4S04 A;  3L00 A;  3FXU A;  2HWV A;  3ZMS A;  3HTS B;  1U8R A;  4GO1 A;  3HSR A;  2W24 A;  2P4W A;  2M1B A;  5HOO A;  1CGP A;  3PFI A;  3TO9 A;  1IN6 A;  3K1N A;  4HV5 A;  4XRF A;  1OKR A;  4UNO A;  5E20 A;  2PBI A;  1FY7 A;  1C0W A;  4WXD A;  1KU2 A;  2STW A;  3T5X A;  2EA4 A;  3NQO A;  1ZG1 A;  2ZFW A;  1F4K A;  2PJP A;  1J2X A;  4M6Y A;  2FBH A;  2A6H F;  2VOO A;  3QAH A;  4PGH A;  1BIB A;  3IRQ A;  3MEX A;  1BI0 A;  4LLG F;  2CW0 F;  2MLK A;  4UHT A;  1REP C;  3F8B A;  5DD4 A;  4BHB A;  4HF1 A;  4NQW A;  3V8K A;  3FMR A;  1D8J A;  3I0T A;  3CTA A;  1LJ9 A;  4O5V A;  5L3B A;  1K79 A;  3L7W A;  1XGO A;  1RUO A;  1T6S A;  1XD7 A;  2ZNZ A;  5E8G A;  3F8F A;  2P6T A;  3E6C C;  5KK1 A;  1R1V A;  2IA2 A;  4CXF A;  4L5J A;  3AAF A;  1Z91 A;  2FML A;  4HW0 A;  4G94 A;  2O8X A;  2VT2 A;  1U5T B;  2Y48 A;  2ZCW A;  3KEQ A;  4EGY A;  1KA8 A;  2KRF A;  3IKV A;  4AIH A;  3I5U A;  5D8K B;  2JT1 A;  5L3E A;  1MDM B;  2FMY A;  4WWC A;  3PQJ A;  4HLY A;  1ZGA A;  1XMK A;  5ICF A;  3HRU A;  2A61 A;  1YQA A;  3V8L A;  2EFO A;  3ELK A;  4NB5 A;  1YO5 C;  1BN5 A;  3DPL C;  4HX7 A;  1B4A A;  2ACJ A;  2DQL A;  1J59 A;  1USS A;  2DLL A;  1HQC A;  2ZME B;  2L4A A;  1XDS A;  1HKS A;  3RIR A;  4LMY A;  3REO A;  2DPU A;  3EQL F;  3WTV C;  1P2F A;  5HLH A;  3GFI A;  3K69 A;  3FMS A;  4HA8 A;  4EJV A;  3D5L A;  3FWE A;  3HUG A;  4UVC A;  2XV4 S;  3KP5 A;  1FLI A;  2E7X A;  2KIU A;  3J7A O;  1GXQ A;  1HW1 A;  2A6E F;  3CUQ A;  4U7B A;  5LRS A;  2OZ6 A;  2NNN A;  2FE3 A;  3K2Z A;  4L9N A;  1ULY A;  2P5V A;  3SXY A;  1S7O A;  1E2X A;  4A6D A;  3R61 A;  1R5H A;  1L0O C;  4EQQ A;  2YSR A;  3J80 Z;  1ZYR F;  2D45 A;  4PDK A;  2HDC A;  3ZMT A;  4RAY A;  1W7P B;  4BAY A;  1S6L A;  3E5U A;  1IZ1 A;  3HRS A;  2OZU A;  4WF2 A;  3K1P A;  2FEZ A;  1ZG5 A;  5DCF A;  1P4W A;  1BI3 A;  1SMY F;  4LG0 A;  2HKO A;  2QZ8 A;  4Y13 A;  1HXD A;  1T38 A;  2JPC A;  2Z9O A;  4OIP F;  5DD8 A;  3U2R A;  2ZBK A;  4HX8 A;  3RKW A;  3QP6 A;  2GA2 A;  2O0Y A;  5CVV A;  1K78 B;  1ONV A;  1P92 A;  4G7H F;  4UUV A;  4FHT A;  2OA4 A;  2XUB A;  3KLO A;  4GGG A;  3TGN A;  2HKX A;  5K5Q A;  4Z2Y A;  1MJB A;  5ILU A;  5D4S A;  4M73 A;  3DV8 A;  4I0B A;  1WI9 A;  5LHH A;  3F6O A;  3P9C A;  1JHH A;  1SD5 A;  4BH9 A;  2QEN A;  4CYD A;  1EH7 A;  1X3U A;  1MJA A;  3KP7 A;  3V7C A;  2A3S A;  3D0S A;  5IT9 Z;  4IRI A;  1BI1 A;  2VBY A;  3O2P E;  5TJJ A;  5DCM A;  2K4B A;  3WE3 A;  1HKT A;  2PMU A;  4EM0 B;  1V4R A;  1UFM A;  1OYY A;  5LEK A;  4JK1 X;  2IW5 A;  1P4A A;  2HOE A;  2OBP A;  4RB0 A;  1ZRF A;  2P5K A;  4U0Y A;  3CJN A;  2L3D A;  4ZYD A;  1KQ0 A;  1XGM A;  3BDD A;  3SZP A;  4EGZ A;  3M8E A;  4MEY F;  2VOP A;  2QYO A;  1Z7U A;  2HGC A;  3T8R A;  4LGW A;  4MHG A;  1HST A;  3HSE A;  2QWW A;  2ZNY A;  4A5M A;  3EYY A;  1U5T A;  4WXH A;  5J8F A;  1WRJ A;  4RB3 C;  3KLN A;  3KZY A;  4GYG A;  1MDM A;  1WQ2 A;  2M30 A;  3IWZ A;  2DTR A;  1RNL A;  3F6V A;  3IWF A;  3WTT C;  4LLL A;  2VBZ A;  3KP3 A;  3WOD F;  3ZPL A;  2RKH A;  2H6B A;  1O7L A;  3SZT A;  4BYY A;  1Q1H A;  3KE2 A;  2JSC A;  2DW4 A;  1MGT A;  2JTV A;  2UZK A;  2ZME A;  3DKW A;  1SD6 A;  3TQN A;  5HLG A;  4YIF A;  1UST A;  5ILS A;  3V4G A;  4I98 B;  1FBQ A;  5D5W B;  3F72 A;  2GQQ A;  4XBF A;  1F5T A;  1Z1D A;  1AWC A;  2QQB A;  3MWM A;  4P5O A;  5TRD A;  1G3T A;  1EH8 A;  4L18 B;  3FM3 A;  1XSV A;  1XMA A;  4QWQ A;  5BMZ A;  3DXJ F;  5FFX A;  4HBL A;  1V3F A;  1OR7 A;  3GYH X;  3BPV A;  2ELH A;  1QZY A;  3F3X A;  3IKT A;  2ETH A;  2PG4 A;  2FQ3 A;  2DPD A;  2OU2 A;  3GFL A;  1I1G A;  5F6F A;  3TDU C;  5JHU A;  2QLZ A;  2L54 A;  3I59 B;  2L02 A;  2NNY A;  3ZMZ A;  2DK5 A;  2CO5 A;  1J9I A;  2WTE A;  5LEJ A;  1ZRD A;  5AIP A;  2PN6 A;  2QBY A;  2EFQ A;  4KIB A;  3I4P A;  4ON0 A;  4I2O A;  1JE8 A;  3GFM A;  5CLS A;  4G8X A;  1TNT A;  5J8C A;  1R1U A;  4DQ2 A;  2Y75 A;  2L4M A;  2VBX A;  1IF1 A;  2XAF A;  4ESF A;  2W57 A;  3K0L A;  3WTX C;  4U7D A;  1QZZ A;  1TW3 A;  4O3M A;  4RGR A;  3VFZ A;  2MLG A;  1P4X A;  2GWR A;  4MTD A;  3SHF A;  1S29 A;  1FWZ A;  1K78 A;  4YFN F;  2CYY A;  2P5L C;  1O3S A;  5DYM A;  3LA7 A;  5L3F A;  3HOT A;  1D8K A;  4M9X A;  3R0A A;  1QBJ A;  2E1C A;  2CFX A;  2Z5U A;  4LB6 B;  1F9N A;  4KMF A;  3T8T A;  4WXC A;  5ERI A;  3RPQ A;  5CVJ A;  1WWX A;  1IXR C;  4ZYH A;  4N9H A;  5E1W A;  1BC7 C;  1ODD A;  1ZGJ A;  2RGV A;  1RUN A;  3NEU A;  3E6M A;  4ASN A;  2VC0 A;  1T2K A;  3QPT A;  1FZP B;  4LK1 F;  5IT9 K;  2XHK A;  5A2Q K;  5IT3 A;  3T0Y A;  5CJ9 A;  3RYR A;  4CHU A;  4OMZ A;  2XIG A;  3VEP A;  3RDI A;  2GIV A;  3GFJ A;  4A2U A;  5HDG A;  3FM5 A;  3ISP A;  4XLN F;  3CUQ C;  1KYW A;  2DK8 A;  5CVR A;  1H9G A;  1U78 A;  4ESB A;  4YFK F;  4EMS A;  1JHF A;  4EJO A;  3BWG A;  2KIF A;  2DBB A;  3LST A;  3ZMV A;  2A5Y B;  1LDK B;  5E17 F;  3ABT A;  1UB9 A;  2OQR A;  5JVT A;  1IXS B;  1R1T A;  5HLI A;  3HHG A;  2MC3 A;  1WSU A;  3FHZ A;  3W6J B;  4IJA A;  2VT3 A;  2D2W A;  3WE2 A;  3MCZ A;  1Z05 A;  5FLX K;  1FPQ A;  1XDU A;  3P9I A;  1FBU A;  2VXZ A;  2UXX A;  1FYM A;  3DF8 A;  3KP4 A;  4JBA A;  2F5D A;  4BHP A;  2NYX A;  5HS8 A;  2H94 A;  3V7R A;  1B9M A;  1LVA A;  4EJT A;  3G73 A;  3I71 A;  3M1E A;  1J7K A;  1DPR A;  2LDU A;  5D6F A;  4ZH4 F;  3MZY A;  5FD6 A;  4AWX B;  2EFN A;  5ICG A;  2EK5 A;  4IRG A;  2E1N A;  4KIF A;  5LHG A;  2EA2 A;  1E17 A;  4G9Y A;  5E8I A;  1YS7 A;  4EVI A;  3B02 A;  2HYF A;  4WCG A;  1QQI A;  3ABU A;  4ESJ A;  2GA1 A;  3VOD A;  1CF7 B;  2K7L A;  1QO0 D;  1XN7 A;  4HAM A;  2CSO A;  3KP6 A;  4JQF A;  4QLC U;  4AIJ A;  4U88 A;  1YYV A;  2R7F A;  4Q4Z F;  1OYW A;  5D4R A;  4OIR F;  2IRF G;  4MGR A;  2FNP A;  5EEG A;  2EV6 A;  2O3F A;  4Y17 A;  4R1H A;  3BRO A;  3HRT A;  1FC3 A;  2JRT A;  4IRH A;  4F7Z A;  5CYV A;  1H9T A;  4GXO A;  1U6G A;  3TKY A;  3BPX A;  2YPR A;  4KIG A;  1HSJ A;  4N0B A;  2XAQ A;  4FX4 A;  2DU9 A;  3GZ6 A;  1UHM A;  2P6S A;  4KDP A;  4RS8 A;  1YS6 A;  3KET A;  4ZYG A;  3WGG A;  3I59 A;  3EYI A;  3GUD A;  3RTR A;  4AIK A;  2HEO A;  1FYK A;  1B1B A;  3Q5F A;  3F8M A;  3LA2 A;  2P8T A;  3P9K A;  5LLQ A;  2IA0 A;  2GXG A;  3HRM A;  2BYV E;  4CO8 A;  2BBY A;  4P9F A;  3QOP A;  3H92 A;  3M7G A;  4L0Y B;  5E1Z B;  3ERE D;  5CVU A;  4ZZD A;  4U0W A;  3T1B A;  1U5T C;  2D1H A;  4H0E A;  2YR2 A;  2A07 F;  3IL2 A;  2EV0 A;  4KN4 X;  2A69 F;  5LHI A;  1JXS A;  1UHW A;  4HDV A;  4CIC A;  1DDN A;  1FP2 A;  1MJ9 A;  4CDG A;  4B8X A;  1Z9C A;  1HW2 A;  2ZKZ A;  2ESN A;  1ON1 A;  5D5V B;  3MAJ A;  4IHS A;  5FO5 A;  2IVM A;  3ROU A;  1I1S A;  3GXO A;  1MKM A;  3WTS C;  1YW7 A;  2ZXJ A;  2OD5 A;  4LFU A;  3QPH A;  3QP5 A;  4U0V A;  5AIQ A;  2IT0 A;  1MZB A;  3WTW C;  3KCC A;  3PQK A;  4PCQ A;  2EFW A;  1BOA A;  1NHA A;  4CZZ A;  3E6D A;  3GW2 A;  2FU4 A;  2E7W A;  1DPU A;  2W25 A;  3CO6 C;  3ZMD A;  4KT5 C;  3CLO A;  2DI3 A;  2LNB A;  3EET A;  2FXA A;  1VTN C;  1KQ9 A;  5K1Y A;  4YG2 F;  1B9N A;  2PEX A;  4KNY A;  5L3G A;  4I02 A;  2L01 A;  2K86 A;  3H3Z A;  2ZO4 A;  2RQP A;  2O61 A;  3RYP A;  2RN7 A;  1G3Y A;  1BM9 A;  2O6G E;  2FSW A;  3SFZ A;  1IN5 A;  4A0Y A;  5LBQ A;  2PMH A;  3ML6 A;  2BGC A;  5A2Q Z;  1O3R A;  5FGM A;  2EFP A;  4UXN A;  2F5C A;  1ZAO A;  3GVA A;  1MD0 A;  3WTU C;  3WU1 B;  2ISZ A;  1BIA A;  3DFG A;  1KU7 A;  1IUY A;  1U3E M;  3DP7 A;  1LB2 A;  1KYZ A;  2FBI A;  4K2E A;  1AOY A;  2FOK A;  2BE5 F;  1IAW A;  4ENJ A;  6PAX A;  1GVJ A;  3ECH A;  1LNW A;  3CDH A;  1XB4 A;  5HDK A;  2KKO A;  2CG4 A;  4ZZL A;  3QU6 A;  4ENK A;  2M8E A;  2ISY A;  1SFE A;  4LK0 F;  1TQI A;  1YW9 A;  4P96 A;  2KJB A;  5FLX Z;  2VE9 A;  2GZW A;  3WG9 A;  4UVA A;  1S7A A;  1T0F A;  5BS6 A;  1Y0U A;  3O3K A;  5KVR A;  3JAM Z;  2O03 A;  4OIQ F;  1G3W A;  4A0X A;  3IHU A;  1CF7 A;  4WK8 F;  1LQ1 A;  3RJP A;  3E97 A;  1ZHF A;  4HYE A;  3ZQ7 A;  5E1X A;  3F23 A;  3IRR A;  2X0L A;  5F64 A;  4L9J A;  1F1Z A;  3FZV A;  2FF4 A;  2COM A;  2HQN A;  4Q5S F;  2D1V A;  4M9Z A;  2WC2 A;  5HS7 A;  3C18 A;  2K4J A;  1EH6 A;  1RIO H;  2DAO A;  1BI2 A;  2CWE A;  2HTJ A;  2EWN A;  4ENM A;  3TO6 A;  4R8H A;  1KQ8 A;  2RC4 A;  2DFI A;  4KFC A;  3LAJ A;  4NHJ A;  1ON2 A;  4A6E A;  4S05 A;  4IF4 A;  5BQT A;  3KEO A;  2KIM A;  4A5N A;  3TO7 A;  1FYL A;  1FBS A;  2MBF A;  1IXC A;  2J5O A;  3I64 A;  4Q47 A;  1XSD A;  1OPC A;  3WU0 A;  2F5F A;  5FB2 A;  4I01 A;  3BJA A;  4G6Q A;  2HS5 A;  5DEQ A;  3ZN0 A;  3BY6 A;  4BQA A;  3R4K A;  4KMU X;  1GHC A;  1YLF A;  1W7P D;  1W7P A;  4YII A;  2GAU A;  4LB5 A;  3NRV A;  2DQR A;  3R0J A;  2MD5 A;  2WWY A;  5ICE A;  4L0Z B;  4OIO F;  2XAS A;  1Z6T A;  3C3W A;  4L9T A;  2IA1 A;  2XAJ A;  3E5Q A;  1STZ A;  2HZT A;  4E70 A;  4I7H A;  2VN2 A;  3OOP A;  2F2E A;  4HV6 A;  4BNC A;  2X4H A;  2BEO A;  5L3C A;  2HQR A;  2C6Y A;  4OOI A;  3TOA A;  1TW2 A;  2JPB A;  3OV8 A;  3FXQ A;  2V1X A;  1KU3 A;  2V6C A;  1FSH A;  4HQE A;  4L9V A;  1KU9 A;  4A0Z A;  3KP2 A;  4EM1 A;  1QGP A;  4RB2 C;  1FNN A;  1ZAR A;  1A04 A;  2XAH A;  1OYI A;  1HW5 A;  5D6E A;  2PQ8 A;  2QVO A;  3L09 A;  3R60 A;  2EV5 A;  4P9U A;  1PP7 U;  4UVB A;  4KIC A;  2P7V B;  4KA4 A;  4G7O F;  2AXL A;  1W4M A;  3DQV C;  3TOB A;  2XRO A;  4ZYE A;  2XRN A;  5JI6 A;  1FOK A;  1ZH5 A;  3DPT A;  1FT9 A;  3FX3 A;  3C7J A;  4L5I A;  1SD7 A;  2XKP A;  1T39 A;  3EUH A;  3WGI A;  2IP2 A;  4GCV A;  2Q8K A;  2M87 A;  2TDX A;  1YFH A;  5HS9 A;  2QM3 A;  4WX9 A;  4MEX F;  2JZY A;  3K9T A;  2UXN A;  2FBK A;  3GF2 A;  3FXR A;  5H20 A;  3E3V A;  1FSE A;  4FX0 A;  2CQK A;  1R36 A;  3LA3 A;  4AVP A;  5H6Q A;  2RNJ A;  3GEZ A;  4M6X A;  1I5Z A;  1OMI A;  2IPQ X;  4M71 A;  1R23 A;  2P7C B;  1J0R A;  4LJZ F;  3IC7 A;  5FFZ A;  5DCM B;  2OAZ A;  1D3Y A;  3VB2 A;  3DEU A;  2YU3 A;  2Y0M A;  1RI7 A;  3BZ6 A;  4I0A A;  1BBY A;  1O7F A;  2NAZ A;  3RKX A;  3JAM K;  1ZG3 A;  2M45 A;  3QU3 A;  2J5P A;  2XAG A;  4D0P A;  1SMT A;  1R22 A;  4MQV A;  4TV7 A;  1ZRC A;  4UV8 A;  4XSZ F;  2PI0 A;  4HZF A;  2W84 A;  3ECO A;  2PFB A;  3HIF A;  2G9W A;  3W6K B;  1UCR A;  4HX4 A;  1S3J A;  1TTY A;  2H27 A;  1PDN C;  1PP8 F;  4HF2 A;  2HTS A;  1ZLJ A;  4EJW A;  3J81 K;  5BPI A;  2HYG D;  3B73 A;  5JFR A;  3LAP A;  1J5Y A;  4N9I A;  1R5G A;  1G4D A;  4RGX A;  2H09 A;  5LGT A;  1G3S A;  1R7J A;  2V1U A;  3JSP A;  4Y15 A;  1ZN2 A;  3BJO A;  1B6A A;  3HHH A;  4MTE A;  3EDP A;  3K1M A;  3HYI A;  4G6D A;  3SQN A;  2VON A;  5ICC A;  5K5R A;  1LDD A;  5D5U B;  4PGG A;  4R79 A;  4IHT A;  1G6N A;  2W85 A;  4I09 A;  5HDN A;  2RVC A;  4O6J A;  1DP7 P;  3MFK A;  4KN7 X;  1TNS A;  3I53 A;  1R58 A;  4FT8 A;  3WTZ A;  4OMY A;  3P7N A;  1EV7 A;  2XKO A;  3F8N A;  3JTH A;  2R3S A;  5LRR A;  4B09 A;  4DNC A;  3COA C;  4ENN A;  3R6S A;  3JSO A;  2VC1 A;  2ADU A;  2F5E A;  1W5T A;  4KYW A;  2NS0 A;  1I6X A;  3ULQ B;  4M72 A;  2WV0 A;  3FF5 A;  2QBY B;  4XLP F;  5H6R A;  3WTY C;  2DT5 A;  2OQG A;  2LF7 A;  2ZJ2 A;  4UV9 A;  5AON A;  1R00 A;  5CVI A;  2STT A;  1TBX A;  2QUF A;  4PZJ A;  3S2W A;  2AS5 F;  2RDP A;  4HLX A;  3M8F A;  5DUI A;  3N4M A;  2K02 A;  5E18 F;  3CO7 C;  4EM2 A;  2QQA A;  4HF0 A;  4RGS A;  4HQM A;  2HR3 A;  1Z6R A;  5FD5 A;  2HFH A;  1JGS A;  1YIO A;  3V7S A;  3KZZ A;  2LF8 A;  2R7D A;  1BC8 C;  2RV8 A;  3Q9V A;  1YG2 A;  3I54 A;  1PUE E;  5LGN A;  1T98 A;  5BPD A;  2EJR A;  5F1R A;  1K6O A;  2Q2E A;  5D5X B;  3LFK A;  2A68 F;  2FA5 A;  1D5V A;  1IW7 F;  4BHC A;  1TQP A;  3HOS A;  3GZ5 A;  1H0M A;  4EV0 A;  1GXP A;  1HBX G;  2VOD A;  1QPM A;  3MQ0 A;  4IVN A;  3M9A A;  1XCV A;  3HSF A;  2ESH A;  3LQQ A;  3GX4 X;  1XGN A;  1SFX A;  5DUK A;  4AD9 A;  1SFU A;  5DV5 A;  4LLN A;  2EB7 A;  4A12 A;  2DO7 A;  3LQR A;  4OU0 A;  2FRH A;  4KUM A;  3GWZ A;  4HOB A;  1ZLK A;  3JW4 A;  2NRA C;  1IRG A;  2BV6 A;  3E6B A;  1ZRE A;  4RGU A;  1KGS A;  1FP1 D;  3C1D A;  1LDJ A;  1O3Q A;  1WKM A;  1J75 A;  2IJL A;  3N97 A;  3CUO A;  4XSX F;  3L2C A;  2G7H A;  1LEB A;  2MH9 A;  1IN8 A;  2V9V A;  2VBW A;  4G7Z F;  4LD5 A;  4RAZ A;  2V1D A;  5D8L B;  2GXB A;  4IPA A;  1BJA A;  1YW8 A;  1SAX A;  3BJ6 A;  1K7A A;  1RZ4 A;  2G7U A;  3V8J A;  2XVC A;  5DDG A;  1TLH B;  4IXA A;  1LEA A;  4BXU A;  1L3L A;  2YX7 A;  3H3U A;  3J81 Z;  3ZN1 A;  4EJU A;  4MQ9 F;  3RI4 A;  2Z99 A;  4RB1 A;  3MZH A;  4HDU A;  2XGX A;  3KFW X;  1FX7 A;  1IN4 A;  4GYI A;  2YX4 A;  2QQ9 A;  2B0L A;  4P55 A;  5HVQ C;  5JR3 A;  1QNT A;  2MA3 A;  2UWM A;  1XSX A;  1B59 A;  3ZMU A;  2KJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...