2HYFA

The structure of apo-mntr from bacillus subtilis, selenomethionine derivative
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
134
structure length
134
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title The conformations of the manganese transport regulator of Bacillus subtilis in its metal-free state.
pubmed doi rcsb
molecule tags Transcription
total genus 42
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hyfA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2hyfA02
3HIFA 5D5XB 5HS7A 5K5RA 4RS8A 4ZZLA 1PP8F 5E1WA 3WU1B 4HF2A 1LEBA 2FBIA 2IA2A 2BE5F 2HEOA 5DD8A 1GVJA 3SZPA 2OQGA 3KP2A 4BYYA 5HS9A 2YX4A 3F72A 6PAXA 3CDHA 4LGWA 1FX7A 3V8KA 4I2OA 2X4HA 1BI3A 2EA2A 3REOA 2MA3A 2XAQA 3GUDA 3RKWA 1BIBA 4P5OA 4NQWA 1T0FA 3L00A 3FMRA 1KU9A 2W85A 3FZVA 1T6SA 4R8HA 2STTA 1WKMA 5LHIA 1I1SA 4M9SA 4BXUA 4EM2A 2Z33A 1IUYA 3M1EA 1LJ9A 2ZBKA 4UV8A 3GZ5A 4KFCA 2NNNA 4AD9A 2ESNA 2Q8KA 4ESJA 2A6HF 1Z05A 2PQ8A 2ZJ2A 4MNUA 2VOOA 2COMA 2HQNA 4WXHA 2K86A 5LBQA 2P7VB 2J5OA 2LDUA 5AONA 5E20A 2ZO4A 4UUVA 3TKYA 1TQMA 3EUHA 2VC1A 4KNYA 3HOTA 5TRDA 2L54A 2OA4A 1YO5C 1I5ZA 4U7BA 5D8LB 2JT1A 4LFUA 3HRSA 3V7SA 4OIOF 2FBKA 2H27A 1KGSA 1RIOH 1YW8A 1YW7A 5HVQC 3P9IA 5E17F 4EQQA 3JW4A 2RNJA 3F6VA 1ON1A 4MTEA 3G3ZA 2BYVE 1U6GA 2DFIA 4KDPA 3LFKA 2YPRA 1R1UA 2GA1A 2EFWA 2UWMA 3SZTA 1D3YA 4L9TA 1W5SA 2DQLA 1G3WA 2XROA 4KUMA 1U5TB 1IXCA 3CJNA 1I1GA 5CVIA 2HR3A 2RDPA 3KLOA 5FD5A 2QQBA 5FLXZ 1J75A 2MC3A 1ZAOA 4G8XA 5J8FA 4BHCA 3TQNA 1B1BA 3TO7A 5A2QZ 4ZH4F 1LB2A 4M73A 3Q9SA 2FNPA 2XUBA 3LA7A 2RQPA 3F22A 4IHTA 2EFNA 4G94A 3KLNA 1LEAA 3WTVC 4MEYF 5DEQA 2DTRA 4GO1A 4MTDA 3RKXA 3DF8A 3ECHA 1O7LA 4HDVA 4A2UA 2FOKA 1P4XA 3I4PA 2FU4A 3DPTA 4HQEA 3QPTA 4M6XA 2EV0A 3BWGA 3NRVA 1IW7F 5HLIA 4P55A 3KZZA 2DT5A 2GZWA 3TOAA 2LNBA 4UVCA 3U9GA 4H0EA 3F21A 3BJAA 1YG2A 3D0SA 4HF0A 3DEUA 3FXRA 3ULQB 2M8EA 3Q5FA 4RB3C 2O6GE 2MH9A 4HDUA 2UXXA 3CUQA 1KYWA 3WE3A 5ERIA 4L5JA 4UXNA 1USSA 2IVMA 2ZNYA 4IVNA 3SQNA 2E1CA 4ZZDA 1MKMA 4RAZA 4KT5C 5L3CA 1F5TA 4UVAA 3RPQA 4WWCA 4U0YA 2CWEA 3F8CA 4I01A 1ZH5A 1KU3A 4Z2YA 1FP1D 2D1HA 3GO5A 3WTYC 3TO9A 1CF7B 5JR3A 2HDCA 5LGUA 3V8JA 1MGTA 2PG4A 4JQFA 4BAYA 4HW0A 1K78A 1Z1DA 4KA4A 3ZP5A 4HOBA 1SMTA 1O57A 1GXPA 2V1XA 3GZ6A 2O3FA 5CLSA 4D0PA 2A69F 2K4JA 4U7DA 2ZXJA 2ZFWA 1OYYA 2MH2A 1ZYRF 2PJPA 5LEKA 1ZGAA 3VOEA 4IPAA 2CQKA 5H6RA 2GAUA 2FRHA 4O6JA 3H3ZA 4K2EA 5DCMB 4HYEA 1R7JA 4I0BA 1K78B 2XHKA 3L2CA 2KKOA 3I53A 4G6QA 3QAHA 2D2WA 2QYOA 4GGGA 5TJJA 4XBFA 2P5KA 1FP2A 5LGNA 1IRGA 4A0XA 3KP3A 1UB9A 2W24A 4WXDA 2CFXA 4G9YA 2F5CA 1TLHB 3JAMK 4BHPA 4CO8A 3NEUA 3DV8A 3FWEA 2EA4A 3QOPA 4Y15A 5FFZA 4XLNF 2Z99A 5ICEA 4RB0A 1RI7A 1BI0A 1IN8A 4EJUA 2PBIA 2HTJA 2IA1A 2M1BA 1B4AA 3J7AO 5IT9Z 5LRRA 5L3GA 1U8RA 2L3DA 4ZYEA 4EV0A 4P9UA 2BBYA 3DQVC 4UVBA 2HGCA 4Y17A 2O61A 2V79A 1U5TC 1QZZA 4JK1X 5D5VB 2EK5A 5LRSA 1ZRCA 4I02A 3LWFA 5DDGA 3V7CA 4YIFA 1LQ1A 1K6OA 4HX4A 4KMFA 5BS6A 1E2XA 3T8RA 3KE2A 3K1PA 1FNNA 5K1YA 4A12A 3VFZA 3MCZA 1TBXA 2Q0OA 3R4KA 3HTSB 2KRFA 4LK1F 2OD5A 1XGOA 2EFQA 3BJOA 4PGHA 3GW2A 5DV5A 5D4SA 2WV0A 2XRNA 2YU3A 3E5QA 3H3UA 1QGPA 1T98A 3BOQA 4P96A 4RB1A 3IWFA 2ETHA 5HLGA 4HA8A 3KP4A 3K0LA 4ETSA 4MGRA 2ZNZA 5E1XA 4E70A 2F5FA 1LDKB 1FSEA 2VONA 2Y48A 4AWXB 1WI9A 3O3KA 1T38A 1IRFA 1WWXA 5HDKA 2VT2A 4PCQA 1FLIA 3GFIA 2AS5F 4WK8F 1SD6A 5H6QA 2WTEA 4HLYA 5D6EA 3F8FA 3L9FA 3R0AA 3BPVA 2VOPA 2DAOA 3C3WA 3BP8A 1R36A 1HW1A 4KICA 1J9IA 2BGCA 2RKHA 2IRFG 1JE8A 2PN6A 5J8CA 4B09A 4KYWA 2HZTA 2ELHA 3K2ZA 5KK1A 1FY7A 4I09A 1XSDA 2QLZA 1J5YA 1BN5A 4M6YA 2L02A 4L5IA 2OZUA 4Q4ZF 2JTVA 1SAXA 5BOXA 3KP7A 3R6SA 4ENKA 1R1VA 1RNLA 3P9CA 1CGPA 4O5VA 2FA5A 3ZMZA 3T1BA 2KIMA 3ZMDA 1BI1A 2PMHA 5H20A 4YIIA 4BQAA 5JVTA 4EMSA 1Q1HA 4I98B 5LHGA 2RVCA 3GFLA 1BBYA 3DP7A 1SD5A 1TQIA 1G3TA 3HSRA 3U1DA 3GVAA 3IHUA 2A3SA 4MHGA 2HQRA 2V6CA 4Q47A 3SXYA 4O3MA 3IKTA 4XSZF 2NRAC 2RN7A 3HTUA 1U5TA 1KYZA 2FQ3A 4UNOA 2Z5UA 5DCFA 1ZLKA 3T5XA 3ZMUA 1ONVA 2CSOA 3WTXC 4UV9A 3COAC 2CO5A 4M71A 1ZGJA 1DPRA 1HBXG 2VODA 3DPLC 4HLXA 3JSOA 1FC3A 2EFPA 3WTTC 1KU7A 3C18A 2IW5A 3WODF 3FM5A 2R7DA 1IXRC 1B59A 3U2RA 1OYIA 1ULYA 1KQ8A 3EDPA 3E6DA 1LDJA 1QQIA 1ZHFA 3K1NA 1ZG1A 2K27A 1QNTA 1NHAA 2D45A 4PGGA 4G7HF 2B0LA 2J5PA 2EB7A 3ZMVA 4OOIA 3BPXA 3VODA 3F8MA 3LQRA 2Y0MA 4LB5A 5F64A 2XV4S 4CICA 1B9MA 1FOKA 3PFIA 1S8NA 3TGNA 3IWZA 2XASA 4KIGA 1ON2A 1PUEE 1V4RA 2GA2A 4ENJA 4HV6A 2GWRA 1MZBA 3PQJA 4PZJA 4L0YB 3KCCA 4YFKF 4GCVA 1R1TA 1PP7U 5FD6A 2HKXA 2QWWA 4IJAA 3ZMTA 4BH9A 3GFMA 2H6BA 4R79A 3IKVA 3PQKA 1GXQA 1H9GA 3K9TA 4IF4A 2Q2EA 4HV5A 5ILUA 2DPDA 2VXZA 5DUKA 3C7JA 1T39A 3VB2A 1VTNC 1IN7A 1BOAA 1SD4A 5DUIA 5FGMA 2E7XA 4HBLA 2NYXA 4U88A 3G73A 5LHHA 3F8NA 5ED4A 5JHUA 2VT3A 2FEZA 5D8KB 1XCVA 3E6MA 4S04A 2JPCA 2P4WA 3CO6C 1CF7A 3B02A 4Q48A 4NHJA 4PDKA 2K7LA 1IN4A 1D8JA 3ERED 2JZYA 4YFXF 2CYYA 3FMQA 4KMUX 2VE9A 4CDGA 5FFXA 1QPMA 3RYRA 3V4GA 3FF5A 2CGPA 4AIHA 1I6XA 4EJOA 1WSUA 2HWVA 3JAMZ 1BJAA 1FWZA 3HSEA 3GEZA 3K69A 3HRTA 4N9IA 1KQ9A 4DQ2A 2MBFA 4CZZA 1IAWA 3OOPA 2XAJA 2YR2A 3QP5A 4EM0B 1YFHA 3P7NA 5DCMA 2P5LC 5D4RA 4GXOA 2PEXA 3FXUA 1WRJA 2XKOA 3ABUA 1AOYA 3HHHA 5IT3A 4MQVA 4EGZA 5ICGA 3I5UA 2HOEA 4N0BA 2FXAA 1U2WA 1EH7A 2QQAA 5BMZA 2ISZA 3BJ6A 4HAMA 3SFZA 2TDXA 1MJBA 4IHSA 3RYPA 2EFOA 3T8TA 5L3BA 4LLGF 3J81K 1WQ2A 4R1HA 3EYYA 1YS6A 2G7HA 2E7WA 5E8GA 2HS5A 4ON0A 2HKOA 2M45A 3F3XA 3FMSA 3KP6A 3MZYA 2OBPA 3OV8A 5BPDA 1FT9A 2P5VA 1V3FA 1BI2A 1O3TA 5HDGA 1P92A 2E1NA 1HKSA 4GYIA 1KA8A 2H6CA 5BQTA 1XMKA 1FZPB 2L4MA 3J80Z 3KEOA 1IN5A 4FT8A 1D8KA 4L9VA 4OMYA 1ZARA 2F5DA 3TOBA 4ZYGA 5KVRA 2XVCA 5ICFA 1G6NA 4LG0B 1JGSA 3FXQA 4RGSA 5HLHA 3R0JA 2V9VA 1YW9A 4LJZF 5JFRA 1Z6RA 3Q9VA 1QBJA 1ZN2A 1K79A 1HSTA 3GYHX 1YTYA 3EQLF 1FBSA 2H09A 5HS8A 4LB6B 1R5GA 2F2EA 2XIGA 2NAZA 3EYIA 2FMLA 2XKPA 3WTSC 2GQQA 2G9WA 4WF2A 3BY6A 1HW2A 3WGIA 2XAHA 1SFXA 4HZFA 4CXFA 2OZ6A 1UHMA 1P2FA 5K5OA 4TV7A 3FM3A 1Z91A 4QWQA 5ILSA 1DUXC 1A04A 1J59A 2V1UA 1PDNC 1XGNA 5L3EA 1STZA 4CGZA 2FSWA 3LQQA 2DI3A 2DPUA 4OIQF 5ILVA 1OR7A 3V8LA 4F7ZA 2O8XA 1FSHA 1J0RA 5HOOA 1W4MA 1KU2A 1P4WA 1IXSB 2FE3A 2VBWA 3M8FA 3E5UA 3TO6A 3WE2A 1R5HA 2NNYA 1FYLA 3HRUA 3HRMA 3J80K 1QZYA 3O6BB 3E6CC 4IXAA 2FMYA 1BC8C 5CVJA 4P9FA 2ESHA 4I0AA 1HKTA 4EJWA 1C0WA 3QRFF 1RUOA 1JXSA 3CO7C 2DO7A 3CLOA 3C1DA 2KJBA 2VE8A 5CVVA 2EJRA 4G6DA 3O2PE 2QUFA 5D5UB 2IA0A 3R61A 3I59B 4LLLA 2WWYA 1MDMB 2PMUA 1USTA 1P6RA 4A5MA 3N97A 4M9XA 1FBQA 2D1VA 1D5VA 2MLKA 3H92A 2K4BA 5EEHA 2DW4A 3ABTA 3GXOA 2MD5A 3TDUC 1H0MA 3WTUC 1J2XA 3DXJF 2QZ8A 3LSTA 4OU0A 2R7FA 4FX0A 3DKWA 3KEQA 1XGSA 4EGYA 2P7CB 4LK0F 1EH6A 1TQPA 1MD0A 3MQ0A 3MFKA 3ZPLA 3ZN0A 4Q5SF 4IRHA 2JSCA 1SFUA 2A61A 4M74A 2JRTA 3RPUA 2Z3YA 3DFGA 3KETA 3T0YA 2VBZA 3WG9A 2ZMEA 4M9ZA 1L0OC 4WCGA 3SHFA 4A0YA 3CUQC 2V1DA 4BHBA 4GYGA 4YG2F 3S2WA 3N4MA 5LLQA 1MJ9A 1ZREA 2ADUA 5LGTA 2QBYA 5E8IA 4RGRA 1XSVA 4KIBA 1R23A 5LEJA 1S7AA 2RC4A 3ZQ7A 4QLCU 1HKQA 1W5TA 4WXCA 5DD4A 2L01A 2PLYA 4RGUA 4KN7X 5CJ9A 2ZMEB 3RTRA 1JHHA 4ASNA 2STWA 4G7ZF 4LMYA 2YX7A 2PFBA 1REPC 3MEXA 1XGMA 2RGVA 3RKYA 3LAPA 3HYIA 4U0WA 3KFWX 4ESBA 5L3FA 2NS0A 2FNAA 2LF8A 3FHZA 2EWNA 1OKRA 1TW3A 2QBYB 1MJAA 3HHGA 1B6AA 4ENNA 4MEXF 2F5EA 4L0ZB 3GLXA 2A6EF 3IRRA 3KZYA 3IL2A 2IT0A 2FBHA 2P6TA 3JTHA 3P9KA 2KJCA 1E17A 3LAJA 1R22A 3ELKA 3IRQA 3WTZA 4OIRF 2L4AA 2W57A 1O3SA 5EEGA 5K5QA 1B9NA 1ODDA 4CHUA 2M87A 1LNWA 2KIFA 3MWMA 3HSFA 1K7AA 1BIAA 3GF2A 3B73A 1YIOA 2XGXA 3W6KB 4AIJA 4BNCA 2M5WA 4DNCA 1YLFA 5HDNA 1DP7P 2KIUA 1DDNA 4JBAA 2QQ9A 3ZN1A 2OU2A 1RZ4A 1LVAA 2JPBA 2CW0F 2G7UA 5DYMA 3D5LA 3ML6A 5FO5A 5E1ZB 2W84A 2QM3A 3E97A 2CG4A 2BV6A 1S6LA 3JTGA 2GXBA 3I71A 4L9JA 2AXLA 3J81Z 3L7WA 1W7PD 3L09A 3W6JB 5J6XA 3WU0A 4LLNA 1Z7UA 4RAYA 1SMYF 2H94A 2P8TA 2IPQX 1UCRA 4ZYHA 1IF1A 1Z9CA 2RV8A 2HFHA 2QVOA 2GIVA 4EJVA 3IC7A 2K02A 2BEOA 4OINF 1IZ1A 3VEPA 3E6BA 2VBXA 3K1MA 5F1RA 1O3QA 2XAGA 3I64A 3E3VA 4B8XA 1EH8A 4Y13A 1SD7A 3KP5A 1G3YA 1ZRFA 4IRIA 2W25A 1EV7A 1FYKA 2EV5A 3R60A 2DU9A 2HYGD 1P4AA 1X3UA 5FLXK 1LDDA 3QU3A 4ZYDA 2A68F 5FB2A 2M30A 4I7HA 5A2QK 3WGHA 5JI6A 2YSRA 2VN2A 1OYWA 2HTSA 3E5XA 2O0YA 4HX7A 1FBUA 1ZG5A 5CVUA 5AIPA 2LSOA 1HSJA 1G3SA 3HOSA 3MZHA 5AIQA 2A07F 4M72A 1Z6TA 3CUQB 2C6YA 1U78A 3I54A 1ZLJA 2O03A 1O7FA 3FX3A 2ZKZA 1GHCA 1XB4A 3WGGA 2R3SA 3BDDA 3AAFA 2OQRA 2DQRA 1J7KA 4N9HA 2A5YB 4LG0A 1HQCA 1RUNA 4CYDA 3QP6A 3JSPA 2UXNA 5E18F 4XRFA 1Y0UA 2OAZA 4YFNF 4LD5A 4KN4X 5L3DA 1R00A 1AWCA 2Z9OA 2DBBA 4ESFA 3GFJA 4L18B 1OPCA 4HX8A 4WX9A 1L3LA 1IN6A 3F6OA 2EV6A 3ZMSA 2UZKA 1T2KA 2VC0A 4G7OF 4EVIA 3M9AA 3TDZC 2HYFA 3F8BA 1R58A 1F1ZA 1F4KA 1DPUA 1XDUA 2DK8A 5BPIA 4OMZA 3RIRA 1U3EM 1YYVA 1FYMA 3BROA 2VBYA 4RGXA 1S29A 2X0LA 3EETA 3LA3A 1TNTA 1UHWA 1HW5A 1H9TA 4FX4A 1I27A 1ZG3A 3QPHA 1XN7A 4L9NA 1XD7A 4UHTA 4HQMA 2ZCWA 1XSXA 4ENMA 4A5NA 2LF7A 1XCBA 1G4DA 1BC7C 2IJLA 2GXGA 3RI4A 1F9NA 4A6DA 3NQOA 5D6FA 1S7OA 4IRGA 3RDIA 2ACJA 3BZ6A 4MQ9F 1TW2A 2FF4A 4AVPA 1S3JA 4EJTA 4XSXF 4HF1A 1FPQA 4FHTA 3CTAA 4RB2C 2MLGA 2Y75A 4KIFA 4U0VA 5ICCA 1W7PA 5F6FA 3MAJA 3I59A 1XMAA 1ZRDA 2WC2A 1MDMA 1JHFA 2QENA 3QU6A 3M7GA 2DLLA 3HUGA 3LA2A 3V7RA 1QO0D 3GWZA 1XDSA 2PI0A 5D5WB 1O3RA 4NB5A 1KQ0A 1OMIA 3F23A 3RJPA 3CUOA 1YQAA 3I0TA 3ROUA 4OIPF 5CYVA 2XAFA 4EM1A 1SFEA 3I58A 2DK5A 1YS7A 3M8EA 1HXDA 4S05A 3WTWC 1UFMA 1W7PB 2IP2A 3GX4X 4A0ZA 4XLPF 4A6EA 1TTYA 1BM9A 2P6SA 3ISPA 1TNSA 5IT9K 3ECOA 4AIKA 2LKPA 2ISYA 5CVRA
chains in the Genus database with same CATH superfamily
3L2VA 3GTPJ 3HIFA 4FETA 4FISA 5D5XB 2E2IJ 5FJ8J 5HS7A 5K5RA 2X98A 4RS8A 1D0ZA 4ZZLA 1PP8F 5E1WA 3WU1B 4HF2A 4BEHA 1LEBA 2FBIA 2M0CA 2IA2A 4W97A 2BE5F 2HEOA 5DD8A 1GVJA 1WI3A 2NVXJ 4B4CA 3SZPA 2OQGA 3KP2A 4BYYA 3QPSA 2E2HJ 1SEUA 1DGWY 2YX4A 5HS9A 3F72A 6PAXA 5LD2C 1W1WE 3GMEA 3CDHA 2ECCA 4LGWA 3OL3A 4BY1J 1FX7A 3V8KA 4I2OA 2X4HA 1BI3A 3H5NA 4CSWA 4JX5A 2EA2A 3REOA 1WFXA 2MA3A 2XAQA 3GUDA 3RKWA 1BIBA 4F55A 2WB1A 4P5OA 4AYBN 3W6VA 3DLLF 4NQWA 1T0FA 3L00A 3W3CA 3FMRA 1KU9A 2W85A 3MKZA 3FZVA 2L7KA 1T6SA 4R8HA 2STTA 1WKMA 5LHIA 1I1SA 4M9SA 2BVMA 4BXUA 4EM2A 2Z33A 1IUYA 3SEQA 1SVLA 3M1EA 1LJ9A 3C2BA 4DZJA 2ZBKA 4UV8A 2E1MC 2R93J 2V1NA 3GZ5A 5GAEJ 4KFCA 2NNNA 4PK4A 3FISA 2QSFX 4AD9A 4FCYA 1RR7A 2QKMB 3MKLA 2EH3A 5EYRA 1NH3A 5IP9J 2ESNA 2Q8KA 4ESJA 2A6HF 1Z05A 2PQ8A 2KFDA 2NXNB 1YRNB 2ZJ2A 3DU6A 4MNUA 1PVEA 3JRCA 1A35A 2VOOA 3OYGA 2K9LA 2KP6A 4UB6C 1FOWA 4YRVA 3GBGA 1AA7A 2COMA 2HQNA 4WXHA 2K86A 5LBQA 2P7VB 5FLXR 2J5OA 2LDUA 5AONA 3S32A 2LH9A 5E20A 2ZO4A 4UUVA 2FUG2 5FKOA 3TKYA 1TQMA 3EUHA 2VC1A 4KNYA 3HOTA 5TRDA 3BR2A 1FEXA 3ABKH 2GOXB 3LSMA 3TP3A 2KZGA 2L54A 2OA4A 4UUTA 1YO5C 1NK2P 1I5ZA 5D8LB 4BQNA 4U7BA 5A2QR 2JT1A 4LFUA 3HRSA 4NNJA 3V7SA 4OIOF 5JVGF 2ZSHB 4MO7A 1R5ID 5FKLA 3OYEA 2FBKA 2H27A 4S0HB 1KGSA 1RIOH 4YELA 5F04A 1YW8A 1YW7A 5HVQC 2MYSA 3S2DJ 3P9IA 5E17F 4EQQA 3JW4A 2RNJA 3F6VA 2VB6A 4XL9A 1ON1A 4MTEA 1QVTA 3G3ZA 2BYVE 4DBQA 1U6GA 2DFIA 3JCUC 3P5JA 4KDPA 1RKWA 3MN2A 2CV1A 3LFKA 2YPRA 1R1UA 3NWSA 4DJAA 2E60A 4BGDA 3CCSI 2GA1A 2Y9ZA 2L9RA 2EFWA 1I6HJ 2UWMA 3SZTA 3AL0C 1D3YA 3ZCOA 4L9TA 4ABZA 3IP4B 1TWCJ 1W5SA 2DCEA 3BR6A 2DQLA 1G3WA 2EZLA 2JRMA 2DYSH 2XROA 1A36A 1EKEA 1U5TB 4KUMA 2JA8J 1IXCA 1YJ9I 2V9KA 3CJNA 3KIOA 3AKZA 1I1GA 5CVIA 1WPKA 2HR3A 2LR8A 5M3FJ 2RDPA 4V19K 2IS4A 3KLOA 5FD5A 2QQBA 5FLXZ 1VQMI 4ZC3A 1J75A 2MC3A 3DLAA 1RPWA 1ZAOA 4G8XA 2EIKH 2DA4A 4CCNA 1IJWC 2BVLA 2WADA 5J8FA 4BHCA 3TQNA 1B1BA 4B3AA 1OCTC 3TO7A 2CW7A 2QA4I 4XICA 4ZH4F 5A2QZ 1LB2A 4M73A 3Q9SA 4BE2A 2MGQA 2FNPA 2XUBA 3LA7A 5EZHA 3U1KA 2RQPA 3F22A 1MSEC 2YUSA 2KMUA 4PJLA 4CCOA 5C4XJ 4IHTA 2L5QA 2EFNA 4G94A 3KLNA 3V42A 2LBFA 1LEAA 4XKWA 3WTVC 1DGRM 4MEYF 4D7MA 3GTOJ 5DEQA 2PJRA 1MIJA 4IL6C 4B1RA 4X6AJ 3OWTA 2DTRA 5F1JA 3DU5A 4GO1A 2B63J 3PFYA 4MTDA 3WHCA 4I99C 1T08B 3RKXA 3DF8A 3PSIA 3ECHA 2XSDC 1O7LA 2XF5A 4HDVA 3CZ6A 2CRGA 4A2UA 2FOKA 1P4XA 3I4PA 1Z3XA 4L5EA 2FU4A 2ME0A 3DPTA 4HQEA 1VQNI 3QPTA 3H3VK 4M6XA 4A3DJ 2TCTA 2EV0A 4ZDLA 3BWGA 3ZRGA 4E7SA 2Q1ZB 3NRVA 1IW7F 3PUBA 5HLIA 2ECBA 4P55A 3KZZA 1SFOJ 3OYCA 2E5ZA 3JRDA 2MFZA 4PSWA 1KONA 2LBFB 1MBHA 1JJ8C 1XC5A 2W82A 1NK3P 1H89C 4XR6A 4F91B 4UY8I 4RAGA 2DT5A 2GZWA 3TOAA 2LNBA 2M0MA 4NBQA 3CC2I 4UVCA 3U9GA 4H0EA 3F21A 1U8BA 3BJAA 1HLVA 1D0YA 1YG2A 3D0SA 4HF0A 3DEUA 3FXRA 4CCLA 3ULQB 2M8EA 3Q5FA 4RB3C 2O6GE 2O8KA 2Y30A 2F4IA 4DOZA 2MH9A 3SFIA 3K4MA 4HDUA 2FJ1A 2UXXA 4NUBA 3J7AY 2RAEA 3CUQA 1VQ5I 2E5NA 1KYWA 4XRMA 3WE3A 3O8GA 5ERIA 4L5JA 4UXNA 1WJCA 1ETOA 1VNDA 3CMEI 1USSA 1TL8A 2IVMA 2Q2EB 2ZNYA 1K61A 4E7ZA 4IVNA 2M7AA 3SQNA 3OYNA 2E1CA 4ZZDA 3CF2A 3Q0WA 4IOAF 3CCRI 5KAIC 1MKMA 2FX0A 1OCRH 4LG3A 4RAZA 4KT5C 3A0HC 3CC4I 2JA6J 5L3CA 1F5TA 4H4KC 4CCMA 4UVAA 3RPQA 2KL4A 4WWCA 2L9SA 2CMPA 4FTHA 4U0YA 3S15J 2CWEA 3F8CA 4IZZA 4I01A 1ZH5A 2DYRH 1KU3A 4E7HA 3VSLA 4Z2YA 1FP1D 2D1HA 4D1QA 3GO5A 3WTYC 1Y1VJ 3C2HA 1MBJA 3TO9A 1CF7B 5JR3A 2R7UA 3KX2A 2HDCA 4LITA 3TW7A 4BJ6C 4C3IJ 5LGUA 3V8JA 1MGTA 5F27A 2JN6A 2PG4A 5GAGJ 3OYFA 4JQFA 1S5LC 4BAYA 2E1MB 4HW0A 3OYKA 1GT0C 1K78A 1MMDA 1Z1DA 1XX5A 4KA4A 3HDDA 3ZP5A 2HVQA 2IBDA 4NDLA 5IPAA 4HOBA 3G6EI 4II2A 1SMTA 3DEWA 1O57A 2M34A 5IP7J 1GXPA 2V1XA 1DU0A 3GZ6A 3G1MA 2O3FA 2V9PA 5CLSA 3PNYA 4D0PA 2A69F 2K4JA 4D5CA 4U7DA 2ZXJA 2ZFWA 1OYYA 2MH2A 4OWRB 3D1NI 1ZYRF 2JA5J 2PJPA 1TZLA 3CCLI 5LEKA 2HQ5A 1ZGAA 3VOEA 4IPAA 2XB0X 1YIJI 2CQKA 5H6RA 3VYRB 1JUMA 1VF9A 4XLEA 1QPIA 2GAUA 2FRHA 4O6JA 4ITVA 5IT9R 3H3ZA 4K2EA 4DZPA 5DCMB 3CDIA 2HQAA 1D1AA 2A5WA 3HOYJ 4BXXJ 3S16J 4CUGA 3RPUD 3ZQQA 4IHWA 4HYEA 1K4TA 1TP4A 1R7JA 1ZKGA 1ETWA 4I0BA 3CMAI 5E3LA 1B72A 3D5RC 1K78B 4BKXA 2XHKA 3L2CA 2KKOA 3I53A 4G6QA 1N25A 2E34A 9ANTA 3QAHA 2D2WA 2QYOA 3A1YA 4GGGA 5TJJA 4XBFA 1BJZA 3JREA 2P5KA 1FP2A 2BZTA 5LGNA 3OR1C 4M3EA 4A3KJ 1H88C 1IRGA 2CQNA 3KP3A 2X9DA 4A0XA 2BY3A 1UB9A 3CCYA 2W24A 4WXDA 3QYEA 4Y7NJ 2CFXA 2VQLA 4G9YA 2F5CA 3H0DA 4FE7A 1TLHB 3OR2C 3HJEA 3AL0B 3FXLA 3JAMK 4BHPA 2KISA 4CO8A 3NEUA 3DV8A 4BBSJ 3GTMJ 3FWEA 2X6WA 2EA4A 3QOPA 3CQZJ 2IS2A 4XOTA 2EBIA 4Y15A 2VKVA 4E7IA 5J1RA 2I8DA 1ETVA 1WJFA 4Y3OA 5FFZA 4XLNF 3VWBA 2JVHA 2Z99A 2XPWA 5ICEA 4RB0A 1RI7A 2W4SA 1BI0A 1FTTA 1IN8A 1JUPA 4HPQA 4QTRA 4EJUA 3OY9A 2PBIA 2HTJA 2IA1A 2M1BA 1B4AA 3J7AO 5IT9Z 5LRRA 2DDBA 1DQUA 2LREA 5L3GA 1U8RA 2L3DA 5J40A 2CQXA 2VXDA 4ZYEA 4EV0A 4P9UA 2BBYA 2ELKA 3DQVC 1UZCA 4UVBA 2HGCA 1N77A 4Z6YA 5KCMA 4Y17A 4RDUA 4E7LA 2O61A 4UUSB 5K7ZA 3H1CA 2ZC2A 1ZR4A 2V79A 1P7IA 2IS1A 1U5TC 1QZZA 1JGGA 4JK1X 1X1BA 2WY7Q 5D5VB 2EK5A 4BE1A 1MH3A 5LRSA 1ZRCA 1M1EB 4I02A 3LWFA 4HSRA 2IGKA 4E7JA 5DDGA 4BJTA 4JP0A 3V7CA 1JKRC 4YIFA 1LQ1A 1K6OA 3LSIA 2VUMJ 2OUMA 2YS9A 4HX4A 4KMFA 3K4NA 4BUPA 5BS6A 2MC4A 2F6CA 2E35A 1E2XA 1IC8A 3AG2H 3M1CA 3T8RA 3KE2A 3L2WA 4PFOA 3BG3A 2EZKA 3K1PA 3K7AJ 5J3LA 1FNNA 4A69C 5K1YA 4A12A 3VFZA 3HKZA 3MCZA 1A31A 1I3AA 3DTIA 2DOAA 1BR1A 1TBXA 3TW6A 4DYRA 2R7VA 5EZGA 1FMWA 3TMOA 5J4YA 2Q0OA 3R4KA 2P0TA 4XLFA 4A3GJ 2L0KA 2ZJRF 3QYFA 5DTDA 2KRFA 3HTSB 3A4CA 2NVYJ 4LK1F 2OD5A 4W1UA 2QSHX 1XGOA 2EFQA 2NOJB 3BJOA 1Z0XA 2E71A 1B8IB 4PGHA 3GW2A 5DV5A 5D4SA 4A3LJ 2VQGA 4Y33A 2WV0A 1A6IA 3A01B 2XRNA 3NARA 4YEJA 3GTJJ 4GDFA 2YU3A 3E5QA 3H3UA 3SJMA 1JI8A 1QGPA 2V7FA 1T98A 3BOQA 4P96A 4RB1A 3IWFA 4DW6A 4NC7A 2M9HA 2ETHA 5HLGA 4HA8A 3KP4A 3K0LA 2HPIA 4ETSA 4MGRA 3OYIA 2GIZA 4JYKA 2ZNZA 5E1XA 1S72I 4E70A 2F5FA 1LDKB 1PUFB 1FSEA 3H5AA 3VYUB 3MMYB 1EJ9A 3QOEA 2VONA 3HB9A 2Y48A 4AWXB 1MNDA 1WI9A 3O3KA 1H8AC 1T38A 1RESA 5FKMA 2GM4A 2LVSA 1IRFA 1WWXA 4II3A 2VT2A 3EUKL 4PCQA 5HDKA 1MMNA 2RREA 2XB5A 2IAIA 4PJ0C 3BCBA 1Z21A 2BW3B 2HOAA 1FLIA 2DMQA 3GFIA 2DODA 2AS5F 1EF4A 4WK8F 1SD6A 5H6QA 2VQHA 2WTEA 4HLYA 5D6EA 3F8FA 3IAS2 3L9FA 3R0AA 4IHXA 3RQ4A 1I39A 3MKYB 3BPVA 2VOPA 2XC7A 1TWGJ 2DAOA 3WU2C 1QA6A 3C3WA 3BP8A 3RKQA 1R36A 4OAYA 5FRNA 1GVDA 1HW1A 1LVKA 4KICA 1J9IA 3LSRA 1LE8A 2BGCA 4BQQA 2IS6A 2RKHA 2E19A 2IRFG 2KRCA 2V26A 3K4LA 3JRAA 4CZCA 3PL8A 3NAUA 2PN6A 3DBRB 4D5FA 5J8CA 1JE8A 5HNFA 1YRNA 4B09A 3K4BA 4KYWA 2HZTA 2ELHA 3K2ZA 2ME6A 5KK1A 1FY7A 3ZQFA 4I09A 1XSDA 2QLZA 1J5YA 1BN5A 4M6YA 2L02A 4L5IA 2OZUA 1E3HA 2JK3A 5B1BH 3RCOA 1LFBA 4Q4ZF 1U0JA 2JTVA 1SAXA 4RBOA 2L9NA 1X19A 5BOXA 3KP7A 3R6SA 4ENKA 1JJ6C 4M3BA 1R1VA 1RNLA 3ZQCA 3P9CA 3S14J 3AG4H 1CGPA 1BOBA 1IDYA 4O5VA 1TWFJ 2FA5A 1YX3A 3H9QA 3ZMZA 3CP8A 3T1BA 2NVTJ 5CQGA 2DFHA 2KIMA 3ZMDA 1BI1A 5DM6F 2PMHA 4LIVA 2X1DA 5H20A 1LE8B 2KQRA 4YIIA 4BQAA 4ZTFA 1N75A 5JVTA 4XN3A 3KYCB 4EMSA 3AG1H 1VQ6I 3ZQHA 1Q1HA 1V5FA 4I98B 5F0HA 5LHGA 1IGNA 1R4NB 2XGEA 2RVCA 2Y0SN 3GFLA 2CW8A 1BBYA 3IH4A 4XOPA 1VQKI 5KHDA 2WAQA 3QQAA 3DP7A 1SD5A 1MMAA 1TQIA 1G3TA 3OS1A 3HSRA 3U1DA 3GVAA 3IHUA 1MNEA 2A3SA 3HGYA 4MHGA 3TEDA 1R9TJ 2HQRA 2V6CA 3HGGA 2Y2ZA 4Q47A 2O5RA 3BG7A 3SXYA 3J7YJ 4O3MA 4BJ5C 5GADJ 3QYBA 3IKTA 3DKXA 4XSZF 2NRAC 1HDDC 2RN7A 3HTUA 1U5TA 1KYZA 1MBKA 2R7QA 5J1YA 2FQ3A 3ABLH 1LUJB 2Z5UA 5DCFA 4UNOA 1ZLKA 3T5XA 4N4OB 3ZMUA 4A3FJ 1ONVA 3S17J 2CSOA 3WTXC 4UV9A 3COAC 3H35A 2CO5A 2XF7A 4M71A 2QGUA 4PSXA 1ZGJA 1HF0A 1DPRA 2K3PA 3S3NA 4F52A 1HBXG 4RA2A 2VODA 2ZSIB 1G8XA 1Z7LA 4A3EJ 2VKDA 1U9NA 3DPLC 1IRXA 4QSHA 4ANJA 3RZOJ 3N05A 2IEKA 4HLXA 2CQ7A 1JTXA 3GTGJ 1S7EA 4C3HJ 3OS2A 3A2KA 1MBFA 1EA3A 3JSOA 1FC3A 2KRHA 3H9GA 4A3IJ 2EFPA 2P81A 3WTTC 1JT6A 2CU7A 1HCRA 1GV2A 1KU7A 2CUFA 3C18A 2IW5A 2LY2A 3WODF 2CUJA 3FM5A 2R7DA 1IXRC 3K4CA 3FIWA 1B59A 3U2RA 1OYIA 1ULYA 1KQ8A 3EDPA 2K3FA 1QRYA 3E6DA 1LDJA 4NC8A 3AG3H 1QQIA 2AQEA 5J1UA 1ZHFA 2L7ZA 5J4VA 4CYCA 2DA6A 3K1NA 1ZG1A 2K27A 1QNTA 5CPRB 1I3QJ 1NHAA 2Y69H 2D45A 4PGGA 4G7HF 4C30A 1WJDA 1T33A 2B0LA 2WV1A 2J5PA 2EB7A 3HG9A 3ZMVA 3JRGA 3MD2A 4OOIA 3BPXA 3VODA 2LLKA 1GLNA 3F8MA 2MW8A 3LQRA 2Y0MA 4LB5A 5F64A 2XV4S 4CICA 3BR5A 3GTLJ 2K85A 3GTKJ 2DMUA 1OFCX 2LC2A 2COBA 4HNVA 1B9MA 1FOKA 3PFIA 2H1LA 1S8NA 2AHQA 3TGNA 3IWZA 3KYLA 3HOUJ 2XASA 4KIGA 4ZTJA 1ON2A 2CJJA 1PUEE 1V4RA 2H1KA 2GA2A 4C9YA 2GLOA 4ENJA 4HV6A 2X1EA 1Y8QB 3ONQA 2GWRA 2VQCA 1MZBA 3PQJA 4PZJA 2F5VA 4L0YB 1SFKA 3KCCA 2OPTA 4YFKF 4GCVA 1R1TA 1PP7U 2PMZN 5FD6A 2HKXA 2QWWA 2F48A 3CP2A 4IJAA 3ZMTA 4BH9A 3GFMA 3H9JA 2H6BA 4CYCB 4R79A 3JAMR 3IKVA 3PQKA 4XORA 1IUFA 2LOOA 1GXQA 1H9GA 3K9TA 2OV7A 1HDPA 2Q2EA 4IF4A 3K4JA 3I4MJ 1WVRA 4HV5A 2ZXIA 3ZQLA 5ILUA 2DPDA 2EPFA 2VXZA 5DUKA 1AKHB 3C7JA 4AM3A 3UKGA 1VFCA 2B9SA 1T39A 3VB2A 1V5EA 1IN7A 1VTNC 1BOAA 1JKOC 1MBEA 2EQRA 1SD4A 5DUIA 5FGMA 2E7XA 4OAZA 2JA7J 3BR1A 4HBLA 2A6TA 1Z3YA 2ELJA 3OIQA 2NYXA 2XSJC 4U88A 3G73A 4XKBA 3Q0VA 5LHHA 3OSGA 2XGCA 1YJNI 3F8NA 5ED4A 5JHUA 2VT3A 2FEZA 5KAFC 4XIDA 4XMYA 5D8KB 1XCVA 3E6MA 4S04A 2JPCA 5IYBJ 1NG6A 2P4WA 5TGTA 3CO6C 1CF7A 3B02A 4Q48A 3EPZA 5GTIC 1GUUA 2O9LA 4NHJA 1YE9A 2QCOA 4PDKA 4QIWN 2K7LA 1IN4A 5EDNA 3ERED 3VYTB 1D8JA 2PX9A 2JZYA 4YFXF 1W0TA 2CYYA 4JOMA 3FMQA 4KMUX 2VE9A 2VJ4A 2ZFUA 4CDGA 2KZVA 5KNLA 4B3XA 5FFXA 2EZIA 3CF5F 1QPMA 2HNHA 3RYRA 2UUZA 3V4GA 2BY2A 3FF5A 2CGPA 1X4PA 1OR7C 1QVUA 2NS8A 4BS9A 4G12A 4AIHA 1I6XA 1OCPA 4EJOA 2FQ4A 4NC6A 1WSUA 1X3WB 2HWVA 1S9HA 3JAMZ 1BJAA 1FWZA 2VKHA 5IOYA 3HSEA 3J7ZI 3JRHA 4C2UA 3GEZA 2DJIA 1PYVA 3CJTB 3HRTA 3K69A 4N9IA 2P0WA 2R4GA 1KQ9A 2R7SA 4M6VA 2MBFA 4AYBA 4DQ2A 1T95A 2R7ZJ 2X51A 4CZZA 3RQIA 1E0EA 1PJRA 1IAWA 1WHUA 4JX6A 4ZJZA 3OOPA 5B5EC 2XAJA 1X1AA 3D5SC 4E7KA 2YR2A 3QP5A 4EM0B 1YFHA 1N78A 1DU6A 2L7MP 3S1NJ 3P7NA 1YHQI 5DCMA 2P5LC 3BG5A 5D4RA 4KISA 4GXOA 3MKWB 2PEXA 4HEA2 3FXUA 1WRJA 4BDZA 2XKOA 3ABUA 3OIOA 3PO2J 3HHHA 1AOYA 3S2HJ 5IT3A 4MQVA 4EGZA 5ICGA 1JT0A 5DM7F 3I5UA 2HOEA 2L2OA 4N0BA 3SEZA 2FXAA 1U2WA 1GV5A 3CLQA 1MNMC 4RM3A 1EH7A 1KZHA 2QQAA 2EZHA 3A03A 3H5RA 4KITB 2MABA 1Y1WJ 5BMZA 2ISZA 3BJ6A 4HAMA 3SFZA 2TDXA 1MJBA 1UG0A 4IHSA 3RYPA 5M5WJ 2EFOA 2GBYA 2XF6A 3T8TA 5L3BA 2OTLI 4IHYA 2AO9A 5IYDJ 4LLGF 3J81K 1WQ2A 4R1HA 3EYYA 1YS6A 2G7HA 2E7WA 1FIPA 5E8GA 3BQZA 2HS5A 4ON0A 1XMXA 3H36A 2HKOA 2WB1N 4HNTA 1ZQ3P 2M45A 3F3XA 1MMGA 3SYTA 4IQJA 3EUAA 2KT0A 3FMSA 3KP6A 3MZYA 1G2HA 2OBPA 3A52A 3OV8A 5BPDA 1FT9A 2MVTA 1VI0A 2P5VA 1RRJA 1K83J 3HL2A 1V3FA 1BI2A 1O3TA 4I76A 1Z67A 1P92A 5HDGA 2E1NA 1HKSA 2V4JC 3M4OJ 2KDZA 3HOVJ 1WZ2A 4GYIA 1KA8A 2H6CA 4B48A 1BA5A 3HBLA 5BQTA 1XMKA 2HOTA 2GOMA 1FZPB 1LKXA 2L4MA 1LPQA 3J80Z 3KZIC 4UUSA 3KEOA 3RZDJ 1IN5A 4FT8A 4C2TA 4J01A 1D8KA 5JLWA 4L9VA 4I6ZA 4OMYA 1ZARA 2F5DA 3FK7A 3TOBA 4ZYGA 5KVRA 3PIOF 2XVCA 5ICFA 1G6NA 2MUNA 2WAQN 3CD6I 3HOXJ 1W0UA 1ZK8A 4LG0B 1JGSA 4MIMA 3FXQA 3I4NJ 4RGSA 5HLHA 3R0JA 2V9VA 3Q3SA 1YW9A 1MBGA 3B6AA 4LJZF 2JSPA 1FOXA 5JFRA 1Z6RA 3Q9VA 1T0FC 2Y31A 2D5VA 3OYDA 1VQ8I 2WBMA 1QBJA 2EILH 1ZN2A 2ZMEC 5GPCA 4V2GA 1WCMJ 1K79A 4XLHA 1HSTA 3GYHX 2RNGA 1YTYA 3EQLF 1FBSA 1SVMA 2H09A 5HS8A 2DFEA 4LB6B 5E3NA 3MVPA 5EGOB 1R5GA 2OJED 2R7TA 2F2EA 5M3MJ 2XIGA 4AUXA 1ERDA 3ASNH 5J47A 2W1OA 1X4OA 2NAZA 3EYIA 2NOGA 2FMLA 3SDGA 2XKPA 3BG6A 4P1WA 3WTSC 4FQGA 4U87A 2GQQA 2G9WA 4WF2A 3DBLB 3BY6A 1HW2A 1Z77A 3G1LA 1BR2A 3WGIA 1OQYA 1VQ9I 4QPQA 2XAHA 2R0QC 2VJIA 1B8IA 3OOUA 4AU7A 3O8HA 3A01A 1SFXA 5M5XJ 3GZNB 4HZFA 4CXFA 2OZ6A 1IRZA 2DTZA 1IO2A 4PJNA 1UHMA 1P2FA 5K5OA 4TV7A 2X85A 3FM3A 1Z91A 2A05A 4QWQA 5ILSA 3S3OA 3C2GA 4GRIA 1DUXC 1A04A 1VQPI 3EUHC 1J59A 2V1UA 1PDNC 1XGNA 4DYQA 1STZA 5L3EA 1QHGA 4CGZA 2VI6A 2FSWA 2XPVA 3LQQA 2DI3A 1PUFA 2DPUA 4OIQF 5ILVA 3I9V2 2N8GA 1OR7A 1D1BA 5EG0B 1RC9A 4D9JA 3V8LA 4F7ZA 2O8XA 3CCQI 1FSHA 1J0RA 2BW3A 1WH5A 1W4MA 4QPOA 5HOOA 1KU2A 1P4WA 2BY0A 2X6YA 3LL7A 1IXSB 4AVZA 2CV2A 2FE3A 2R5ZB 2VBWA 3M8FA 4FASD 3E5UA 3OYHA 2DA1A 3TO6A 3WE2A 1R5HA 3HC7A 3JR9A 2NNYA 1FYLA 1V54H 3HRUA 3HRMA 1YX5A 2BY1A 3J80K 1DP3A 1QZYA 3O6BB 2M4GA 2Z2SB 3UNGC 3E6CC 1X1CA 5FROA 4IXAA 2FMYA 1BC8C 1ORKA 5CVJA 4P9FA 4IEJA 2ESHA 4Y52J 4I0AA 1AU7A 1HKTA 4EJWA 4IOCF 1V5GA 2DA5A 1SAUA 2EIMH 2F4OB 1C0WA 4HG2A 5C3EJ 2JUGA 3QRFF 3OYBA 1RUOA 1GDTA 3F0CA 3BLYA 2LTPA 1JXSA 1QHHD 1UMQA 1WJAA 3ZXSA 3CO7C 2DO7A 3CLOA 3BTCA 1X1DA 2XGDA 3C1DA 2VPRA 2HOSA 3MZ8A 2KJBA 4J19A 1UG2A 3FXMA 3X2QH 2VE8A 5CVVA 3PJRA 2EJRA 1RETA 2OC6A 3OSFA 4G6DA 3OL4A 3O2PE 1V55H 2QUFA 3LSJA 5D5UB 2IA0A 4RLFA 3R61A 3I59B 4LIUA 4LLLA 4KT6A 2WWYA 2K9QA 2R5YB 4ZDOA 2OF7A 2KLOA 1MDMB 2PMUA 3CMYA 4A3MJ 1R4MB 2IGMA 1USTA 2X48A 1P6RA 4A5MA 3N97A 5GPAA 4M9XA 1FBQA 2D1VA 3L2UA 3CCMI 1D5VA 3HUGB 5FKKA 3LMMA 1XS9A 2MLKA 3H92A 2EINH 2K4BA 5EEHA 2DW4A 2TRTA 2DOEA 4MFDA 3ABTA 1SANA 1ACIA 3GXOA 1K4SA 4XLCA 2MD5A 3K10A 5C4JJ 2AXTC 1JKQC 1X3ZB 3CJQB 3VPRA 2R7OA 1VQLI 3TDUC 1H0MA 3WTUC 1J2XA 3ABMH 3DXJF 3CESA 1FTZA 2QZ8A 5IOZA 3FXKA 1MW7A 3LSTA 4OU0A 4DYCA 3M3YJ 4LOCA 2DA7A 2R7FA 3CMMA 5B3SH 4FX0A 3DKWA 3IV5A 3KEQA 1XGSA 2DMPA 1QU3A 4EGYA 3ZOBA 2P7CB 4XLAA 2FOWA 5E79C 4LK0F 2QEXI 1ETXA 3W2VA 1EH6A 1TQPA 1MD0A 2KDOA 1APLC 3MQ0A 3MFKA 1ZELA 2HYJA 3ZPLA 2XPUA 3ZN0A 2R7XA 4BDYA 4Q5SF 3BCAA 4IRHA 2W00A 3QPLA 2JSCA 1SFUA 2A61A 4M74A 2JRTA 3RSNA 2R7RA 1RQ6A 3RPUA 4XQFA 2Z3YA 4M3GA 3DFGA 3KETA 3T0YA 2VBZA 3IH2A 5F0CA 2GXAA 3WG9A 3WHBA 3KYDB 1ETQA 2ZMEA 4MLOA 4M9ZA 3WG7H 3I56I 5C44J 1L0OC 2M7BA 3E0JB 4WCGA 3SHFA 4A0YA 3L2RA 2QKLB 3CUQC 4C3JJ 3S1MJ 3QODA 2V1DA 4BHBA 4YIRX 4GYGA 4YG2F 2VIXA 3F9KA 1ZTRA 3S2WA 5HNHA 4BE0A 2VASA 4BEHB 3N4MA 2LYCA 4M3DA 4CCJA 5LLQA 2VL8A 1MJ9A 3U21A 4HRIA 1ZREA 2ADUA 5LGTA 3S3MA 4V2FA 1MMSA 2QBYA 5E8IA 3IUOA 4RGRA 2VKEA 5HLTA 5K7HA 1Y6IA 1XSVA 4KIBA 1R23A 2F4MB 3CCEI 3FXJA 2ID6A 1MH4A 1S7AA 1FOYA 5LEJA 3W2AA 4HSTA 3BR3A 2RC4A 3ZQ7A 4BL0B 4C2MJ 1HKQA 4QLCU 1VQ7I 1W5TA 5TISC 5E3MA 3PIPF 4WXCA 2ZXHA 5BNGA 2RQQA 2XDVA 3A0BC 3W2WA 2X6OA 3DBHB 5DD4A 4NQWB 5FKNA 2L01A 2HXOA 2PLYA 4RGUA 4KN7X 2BHYA 1X1PA 2ZMEB 5CJ9A 2W7NA 1D5YA 2ZJPF 2K9MA 3RTRA 3HPHA 1XPXA 1JHHA 1UAAA 1G59A 3ASOH 3LSGA 4ASNA 4CCKA 2STWA 4G7ZF 1F43A 1FJLA 2W48A 4LMYA 2YX7A 3A02A 5CQEA 2PFBA 1REPC 1J09A 3MEXA 1XGMA 2RGVA 4JX4A 3RKYA 3CDLA 3LAPA 3HYIA 4U0WA 2VJ5A 1WGXA 3KFWX 4ESBA 5L3FA 2NS0A 2FNAA 2LF8A 3FHZA 2DFFA 3I3LA 2HZDA 2DDAA 5HODA 3E1SA 2EWNA 4B47A 1OKRA 1MSFC 1TW3A 2QBYB 3KPHA 1MJAA 3HHGA 1B6AA 4Y4RA 4ENNA 4X0GA 4MEXF 2F5EA 4L0ZB 2ICWG 2LY9A 3GLXA 3HXLA 2OTJI 4G6TB 2LK2A 2A6EF 3IRRA 4DBRA 3KZYA 1VZ0A 3IL2A 4A93J 3OYJA 2IT0A 3JRBA 2WY8Q 2LKXA 2FBHA 2HPMA 3CCJI 2JVGA 2P6TA 3JTHA 3J81R 3P9KA 4B44A 2CUZA 4F3QA 2KJCA 1IDZA 5EF6A 1E17A 2XAUA 3LAJA 1R22A 1XTAA 3ELKA 5H2FC 3IRQA 3WTZA 1E3PA 2L4AA 2W57A 4OIRF 1AKHA 3PO3J 1UELB 1O3SA 5EEGA 1HC8A 5K5QA 1B9NA 1SC7A 4A3CJ 1ODDA 1HA8A 4CHUA 2M87A 1LNWA 2KIFA 2E36A 1WH7A 4DIQA 3MWMA 3HSFA 1K7AA 1BIAA 3GF2A 2E1OA 3BZCA 3B73A 4F92B 1TWHJ 1QZEA 1Y39A 1YIOA 2XGXA 2HXIA 2JUCA 3W6KB 4AIJA 2WAFA 3H0GJ 5FLMJ 3OS0A 2CH0A 3G71I 5IP6A 4BNCA 3BG9A 2DJNA 2NVQJ 2M5WA 4DNCA 1D0XA 1YLFA 3SZGA 5HDNA 3JRFA 2R7WA 1DP7P 2HVRA 2KIUA 4ZDPA 3K70D 1DDNA 2KHMA 1X2MA 4JBAA 2QQ9A 3S93A 3ZN1A 2OU2A 1RZ4A 1Y8RB 1AHDP 4N4NB 1LVAA 2K9NA 2JPBA 4IHVA 1FMVA 2LD5A 3G1OA 3OIPA 2CW0F 5FRMA 2G7UA 2VLAA 1FIAA 1Y0NA 5DYMA 3D5LA 3ML6A 3TP0A 5FO5A 5E1ZB 2W84A 3J7AW 3PNVA 2QM3A 3E97A 2CG4A 3GCMA 3KEYA 2KPMA 3HM5A 1NTCA 1S6LA 2BV6A 3JTGA 3I71A 4L9JA 2GXBA 1UJ8A 2AXLA 3J81Z 2V6EA 3L7WA 1W7PD 2DT6A 1U9OA 1XG1A 3L09A 3W6JB 4F93B 5J6XA 3DTEA 4IQ4A 3WU0A 4LLNA 1Z7UA 1HOMA 4RAYA 2HVSA 2O7OA 3UR3C 1SMYF 2H94A 3GLLA 2P8TA 2IPQX 5IY5H 3FDYA 1UCRA 4ZYHA 1IF1A 4AIDA 4XN0A 2RV8A 2HFHA 1Z9CA 2QVOA 2GIVA 3HKZN 2MG4A 5B1AH 4DGWB 3DWLE 3K70C 2LG4A 4BU2A 4EJVA 3IC7A 2K02A 3FKIJ 2BEOA 2LP0A 4OINF 2LRDA 3JRIA 1IZ1A 4B43A 3VEPA 5JLXA 2DMTA 3E6BA 1OJLA 3FK6A 2PJRB 2NVUB 1POGA 2VBXA 3K1MA 5F1RA 1O3QA 3BTLA 4EATA 2XAGA 3I64A 4XK4A 3E3VA 5F0FA 3TL4X 4B8XA 3BZKA 1EH8A 2UV1A 4Y13A 1SD7A 4E6KG 3KP5A 1G3YA 5GAHJ 4KJZA 1ZRFA 3LSHA 2W25A 1EV7A 3DCFA 4IRIA 1FYKA 3CCVI 2EV5A 3R60A 1YJWI 2OCCH 2DU9A 3I55I 2HYGD 1P4AA 4EEFG 2BOLA 4PJJA 1X3UA 1W36D 1LDDA 3QU3A 4ZYDA 5EJCA 5FLXK 3ZR8X 3VSKA 2M3AA 3OYMA 2HDDA 2E2JJ 2K40A 1JTYA 2A68F 5FB2A 2M30A 2CFOA 4I7HA 4RM2A 2L9VA 5A2QK 3LFUA 2K5CA 1ZGWA 4PFPA 3S1QJ 3WGHA 5JI6A 1YOVB 2YSRA 4XRSA 3FKJA 2VN2A 1OYWA 2HTSA 3J80R 2M2EA 3E5XA 2O0YA 4HX7A 1FBUA 1D1CA 3BTIA 1ZG5A 5CVUA 5AIPA 2LSOA 3SDBA 1HSJA 4PUSA 2Z16A 2Y0SA 1G3SA 3HOSA 4XONA 3MZHA 3B6CA 5AIQA 1O4XA 2A07F 3BT9A 4M72A 1Z6TA 2BXYA 2Z1DA 3CUQB 2C6YA 4XKCA 4MFEA 3ZQIA 1U78A 3I54A 4IO9F 5JHFA 2DXIA 3HZJA 1ENHA 2JMWA 4D7NA 1ZLJA 2O03A 1O7FA 3FX3A 3HOZJ 2ZKZA 1GHCA 1XB4A 3WGGA 4RMNA 1W36C 3Q0UA 2R3SA 3BDDA 1YI2I 3AAFA 2EIJH 3LSKA 2OQRA 1K6YA 3M8JA 4A3JJ 2IGNA 2FD5A 3VYSB 4BXFA 2DQRA 2KIQA 2JQ7A 1VQOI 4XM3A 1J7KA 4N9HA 2A5YB 3DEEA 4LG0A 4CA0A 3L1PA 1HQCA 2ZB9A 1RUNA 4CYDA 3QP6A 3JSPA 4J00A 2UXNA 3ZQGA 3HEFA 4RAFA 5E18F 1P7JA 3DKYA 4XRFA 2OCEA 2I10A 1Y0UA 2Y9YA 2OAZA 4YFNF 5K7FA 4LD5A 2DA2A 1IG7A 4KN4X 5L3DA 1T8IA 3K4KA 1R00A 2AQFA 1YITI 1ETKA 2L7FP 1AWCA 5GP9A 5LFAA 2Z9OA 2DBBA 1A6QA 4ESFA 5EGOA 3PNTA 3GFJA 4L18B 1OCZH 4FE4A 1ITYA 2QF7A 1OPCA 4HX8A 3NWTA 4WX9A 1L3LA 2H8RA 1X2NA 1IN6A 3F6OA 2EV6A 3G2BA 2QSGX 1F36A 3BQYA 3ZMSA 2UZKA 1T2KA 4IKFA 2VC0A 4G7OF 4EVIA 2QQ8A 2BXZA 1JUSA 2HDWA 2JA2A 4M3FA 3CC7I 1OCOH 2X1CA 3M9AA 3TDZC 4X1EA 2HYFA 2DA3A 3F8BA 3CJRB 1R58A 1F1ZA 1WJBA 3E7LA 5GTHC 2IGOA 3LNQA 1P9QC 1F4KA 1DPUA 1VQ4I 1XDUA 2BHZA 4AC0A 1A5JA 2DK8A 5BPIA 4OMZA 3RIRA 1U3EM 1YYVA 5CKTA 1FYMA 1Y56A 3FBNB 3BROA 2VBYA 2H8WA 1TWAJ 2XRLA 1S29A 2X0LA 3EETA 4RGXA 3LA3A 1TNTA 4BACA 5EG0A 2LFBA 2WAEA 1UHWA 1LFPA 2DOFA 1HW5A 2M35A 1H9TA 2G0EA 3K2AA 4FX4A 1I27A 1ZG3A 3QPHA 1LFUP 1XN7A 2ID3A 4L9NA 3L2QA 1XD7A 4UHTA 2R5ZA 4HQMA 2ZCWA 1ZR2A 1XSXA 4BY7J 4ENMA 4A5NA 5IYCJ 3ESWB 2LF7A 4E4HA 1XCBA 2DT7B 1B72B 1OCCH 1G4DA 3PUFA 5FLVA 1RKTA 1NG7A 1BC7C 2IJLA 2X6XA 3FXOA 2JJ7A 2GXGA 3RI4A 1R6RA 3LSPA 1F9NA 4A6DA 2PMZA 3NQOA 5D6FA 1JKPC 2DMNA 1S7OA 3BR0A 5B66C 3ZGKA 2WA0A 2ZXWH 4IRGA 3FBIB 2LY1A 3RDIA 3VDXA 2ZJQF 5F08A 2HU9A 2ACJA 3BZ6A 2R92J 2MZ4A 1IV8A 2VPLA 4MQ9F 2MD0A 1TW2A 2FF4A 4AVPA 1S3JA 3IH3A 4EJTA 3S8PA 3LOCA 1BW6A 3AFHA 4XSXF 3QWLA 4RLQA 4PJMA 4HF1A 1FPQA 4FHTA 3CTAA 3M07A 4RB2C 3PM1A 2MLGA 2Y75A 1SVOA 2LKSA 4KIFA 4U0VA 5DS9A 5ICCA 1I50J 1W7PA 1OISA 2I5UA 5F6FA 3MAJA 1WJEA 3I59A 1XMAA 2CS3A 3DPUA 2JWTA 2R5YA 1ZRDA 2WC2A 1MDMA 1RR8C 1JHFA 4CH7A 2MSYA 4HNUA 2QENA 3QU6A 1CQTA 3M7GA 2DLLA 5EEAA 1TT0A 1BL0A 2M4KA 4GFBA 3HUGA 3LA2A 3V7RA 1QO0D 2VJJA 3GWZA 1XDSA 2PI0A 5D5WB 1O3RA 1ETYA 3TBIA 4NB5A 4ZYAA 3OMYA 4BBRJ 1KQ0A 3ERMA 1OMIA 2YU9J 3S1RJ 3F23A 3RJPA 3CUOA 3FHNA 3DTKA 1YQAA 3I0TA 3ROUA 1TC3C 4OIPF 5CYVA 3OYLA 1OLTA 2XAFA 4EM1A 2M8GX 4XRSG 5E3OA 1SFEA 2NS7A 1IV6A 3I58A 2DK5A 2HI3A 1YS7A 3M8EA 3CCUI 1R71A 3G4SI 1HXDA 1BW5A 4S05A 2CQQA 3WTWC 1T56A 1UFMA 1W7PB 2IP2A 3GX4X 2B7EA 4A0ZA 1R49A 4XLPF 2IXSA 2LMDA 4A6EA 4A3BJ 2DN0A 1TTYA 1BM9A 3PSFA 1E3OC 4IX7A 2CV0A 3K6GA 1W5CC 4XKVA 3HOWJ 1UHSA 3GTQJ 3IAM2 1X58A 3HPGA 2P6SA 3ISPA 3BC8A 1TNSA 5IT9K 1Q1VA 4BQOA 4XNFA 3ECOA 1BR4A 3BTJA 4UB8C 1TT5B 4AIKA 2CUEA 3OYAA 5M5YJ 2K9SA 2LKPA 2ISYA 5CVRA 1WJ5A
chains in the Genus database with same CATH topology
3HIFA 5D5XB 5HS7A 5K5RA 4RS8A 4ZZLA 1PP8F 5E1WA 3WU1B 4HF2A 1LEBA 2FBIA 2IA2A 2BE5F 2HEOA 5DD8A 1GVJA 3SZPA 2OQGA 3KP2A 4BYYA 5HS9A 2YX4A 3F72A 6PAXA 3CDHA 4LGWA 1FX7A 3V8KA 4I2OA 2X4HA 1BI3A 2EA2A 3REOA 2MA3A 2XAQA 3GUDA 3RKWA 1BIBA 4P5OA 4NQWA 1T0FA 3L00A 3FMRA 1KU9A 2W85A 3FZVA 1T6SA 4R8HA 2STTA 1WKMA 5LHIA 1I1SA 4M9SA 4BXUA 4EM2A 2Z33A 1IUYA 3M1EA 1LJ9A 2ZBKA 4UV8A 3GZ5A 4KFCA 2NNNA 4AD9A 2ESNA 2Q8KA 4ESJA 2A6HF 1Z05A 2PQ8A 2ZJ2A 4MNUA 2VOOA 2COMA 2HQNA 4WXHA 2K86A 5LBQA 2P7VB 2J5OA 2LDUA 5AONA 5E20A 2ZO4A 4UUVA 3TKYA 1TQMA 3EUHA 2VC1A 4KNYA 3HOTA 5TRDA 2L54A 2OA4A 1YO5C 1I5ZA 4U7BA 5D8LB 2JT1A 4LFUA 3HRSA 3V7SA 4OIOF 2FBKA 2H27A 1KGSA 1RIOH 1YW8A 1YW7A 5HVQC 3P9IA 5E17F 4EQQA 3JW4A 2RNJA 3F6VA 1ON1A 4MTEA 3G3ZA 2BYVE 1U6GA 2DFIA 4KDPA 3LFKA 2YPRA 1R1UA 2GA1A 2EFWA 2UWMA 3SZTA 1D3YA 4L9TA 1W5SA 2DQLA 1G3WA 2XROA 4KUMA 1U5TB 1IXCA 3CJNA 1I1GA 5CVIA 2HR3A 2RDPA 3KLOA 5FD5A 2QQBA 5FLXZ 1J75A 2MC3A 1ZAOA 4G8XA 5J8FA 4BHCA 3TQNA 1B1BA 3TO7A 5A2QZ 4ZH4F 1LB2A 4M73A 3Q9SA 2FNPA 2XUBA 3LA7A 2RQPA 3F22A 4IHTA 2EFNA 4G94A 3KLNA 1LEAA 3WTVC 4MEYF 5DEQA 2DTRA 4GO1A 4MTDA 3RKXA 3DF8A 3ECHA 1O7LA 4HDVA 4A2UA 2FOKA 1P4XA 3I4PA 2FU4A 3DPTA 4HQEA 3QPTA 4M6XA 2EV0A 3BWGA 3NRVA 1IW7F 5HLIA 4P55A 3KZZA 2DT5A 2GZWA 3TOAA 2LNBA 4UVCA 3U9GA 4H0EA 3F21A 3BJAA 1YG2A 3D0SA 4HF0A 3DEUA 3FXRA 3ULQB 2M8EA 3Q5FA 4RB3C 2O6GE 2MH9A 4HDUA 2UXXA 3CUQA 1KYWA 3WE3A 5ERIA 4L5JA 4UXNA 1USSA 2IVMA 2ZNYA 4IVNA 3SQNA 2E1CA 4ZZDA 1MKMA 4RAZA 4KT5C 5L3CA 1F5TA 4UVAA 3RPQA 4WWCA 4U0YA 2CWEA 3F8CA 4I01A 1ZH5A 1KU3A 4Z2YA 1FP1D 2D1HA 3GO5A 3WTYC 3TO9A 1CF7B 5JR3A 2HDCA 5LGUA 3V8JA 1MGTA 2PG4A 4JQFA 4BAYA 4HW0A 1K78A 1Z1DA 4KA4A 3ZP5A 4HOBA 1SMTA 1O57A 1GXPA 2V1XA 3GZ6A 2O3FA 5CLSA 4D0PA 2A69F 2K4JA 4U7DA 2ZXJA 2ZFWA 1OYYA 2MH2A 1ZYRF 2PJPA 5LEKA 1ZGAA 3VOEA 4IPAA 2CQKA 5H6RA 2GAUA 2FRHA 4O6JA 3H3ZA 4K2EA 5DCMB 4HYEA 1R7JA 4I0BA 1K78B 2XHKA 3L2CA 2KKOA 3I53A 4G6QA 3QAHA 2D2WA 2QYOA 4GGGA 5TJJA 4XBFA 2P5KA 1FP2A 5LGNA 1IRGA 4A0XA 3KP3A 1UB9A 2W24A 4WXDA 2CFXA 4G9YA 2F5CA 1TLHB 3JAMK 4BHPA 4CO8A 3NEUA 3DV8A 3FWEA 2EA4A 3QOPA 4Y15A 5FFZA 4XLNF 2Z99A 5ICEA 4RB0A 1RI7A 1BI0A 1IN8A 4EJUA 2PBIA 2HTJA 2IA1A 2M1BA 1B4AA 3J7AO 5IT9Z 5LRRA 5L3GA 1U8RA 2L3DA 4ZYEA 4EV0A 4P9UA 2BBYA 3DQVC 4UVBA 2HGCA 4Y17A 2O61A 2V79A 1U5TC 1QZZA 4JK1X 5D5VB 2EK5A 5LRSA 1ZRCA 4I02A 3LWFA 5DDGA 3V7CA 4YIFA 1LQ1A 1K6OA 4HX4A 4KMFA 5BS6A 1E2XA 3T8RA 3KE2A 3K1PA 1FNNA 5K1YA 4A12A 3VFZA 3MCZA 1TBXA 2Q0OA 3R4KA 3HTSB 2KRFA 4LK1F 2OD5A 1XGOA 2EFQA 3BJOA 4PGHA 3GW2A 5DV5A 5D4SA 2WV0A 2XRNA 2YU3A 3E5QA 3H3UA 1QGPA 1T98A 3BOQA 4P96A 4RB1A 3IWFA 2ETHA 5HLGA 4HA8A 3KP4A 3K0LA 4ETSA 4MGRA 2ZNZA 5E1XA 4E70A 2F5FA 1LDKB 1FSEA 2VONA 2Y48A 4AWXB 1WI9A 3O3KA 1T38A 1IRFA 1WWXA 5HDKA 2VT2A 4PCQA 1FLIA 3GFIA 2AS5F 4WK8F 1SD6A 5H6QA 2WTEA 4HLYA 5D6EA 3F8FA 3L9FA 3R0AA 3BPVA 2VOPA 2DAOA 3C3WA 3BP8A 1R36A 1HW1A 4KICA 1J9IA 2BGCA 2RKHA 2IRFG 1JE8A 2PN6A 5J8CA 4B09A 4KYWA 2HZTA 2ELHA 3K2ZA 5KK1A 1FY7A 4I09A 1XSDA 2QLZA 1J5YA 1BN5A 4M6YA 2L02A 4L5IA 2OZUA 4Q4ZF 2JTVA 1SAXA 5BOXA 3KP7A 3R6SA 4ENKA 1R1VA 1RNLA 3P9CA 1CGPA 4O5VA 2FA5A 3ZMZA 3T1BA 2KIMA 3ZMDA 1BI1A 2PMHA 5H20A 4YIIA 4BQAA 5JVTA 4EMSA 1Q1HA 4I98B 5LHGA 2RVCA 3GFLA 1BBYA 3DP7A 1SD5A 1TQIA 1G3TA 3HSRA 3U1DA 3GVAA 3IHUA 2A3SA 4MHGA 2HQRA 2V6CA 4Q47A 3SXYA 4O3MA 3IKTA 4XSZF 2NRAC 2RN7A 3HTUA 1U5TA 1KYZA 2FQ3A 4UNOA 2Z5UA 5DCFA 1ZLKA 3T5XA 3ZMUA 1ONVA 2CSOA 3WTXC 4UV9A 3COAC 2CO5A 4M71A 1ZGJA 1DPRA 1HBXG 2VODA 3DPLC 4HLXA 3JSOA 1FC3A 2EFPA 3WTTC 1KU7A 3C18A 2IW5A 3WODF 3FM5A 2R7DA 1IXRC 1B59A 3U2RA 1OYIA 1ULYA 1KQ8A 3EDPA 3E6DA 1LDJA 1QQIA 1ZHFA 3K1NA 1ZG1A 2K27A 1QNTA 1NHAA 2D45A 4PGGA 4G7HF 2B0LA 2J5PA 2EB7A 3ZMVA 4OOIA 3BPXA 3VODA 3F8MA 3LQRA 2Y0MA 4LB5A 5F64A 2XV4S 4CICA 1B9MA 1FOKA 3PFIA 1S8NA 3TGNA 3IWZA 2XASA 4KIGA 1ON2A 1PUEE 1V4RA 2GA2A 4ENJA 4HV6A 2GWRA 1MZBA 3PQJA 4PZJA 4L0YB 3KCCA 4YFKF 4GCVA 1R1TA 1PP7U 5FD6A 2HKXA 2QWWA 4IJAA 3ZMTA 4BH9A 3GFMA 2H6BA 4R79A 3IKVA 3PQKA 1GXQA 1H9GA 3K9TA 4IF4A 2Q2EA 4HV5A 5ILUA 2DPDA 2VXZA 5DUKA 3C7JA 1T39A 3VB2A 1VTNC 1IN7A 1BOAA 1SD4A 5DUIA 5FGMA 2E7XA 4HBLA 2NYXA 4U88A 3G73A 5LHHA 3F8NA 5ED4A 5JHUA 2VT3A 2FEZA 5D8KB 1XCVA 3E6MA 4S04A 2JPCA 2P4WA 3CO6C 1CF7A 3B02A 4Q48A 4NHJA 4PDKA 2K7LA 1IN4A 1D8JA 3ERED 2JZYA 4YFXF 2CYYA 3FMQA 4KMUX 2VE9A 4CDGA 5FFXA 1QPMA 3RYRA 3V4GA 3FF5A 2CGPA 4AIHA 1I6XA 4EJOA 1WSUA 2HWVA 3JAMZ 1BJAA 1FWZA 3HSEA 3GEZA 3K69A 3HRTA 4N9IA 1KQ9A 4DQ2A 2MBFA 4CZZA 1IAWA 3OOPA 2XAJA 2YR2A 3QP5A 4EM0B 1YFHA 3P7NA 5DCMA 2P5LC 5D4RA 4GXOA 2PEXA 3FXUA 1WRJA 2XKOA 3ABUA 1AOYA 3HHHA 5IT3A 4MQVA 4EGZA 5ICGA 3I5UA 2HOEA 4N0BA 2FXAA 1U2WA 1EH7A 2QQAA 5BMZA 2ISZA 3BJ6A 4HAMA 3SFZA 2TDXA 1MJBA 4IHSA 3RYPA 2EFOA 3T8TA 5L3BA 4LLGF 3J81K 1WQ2A 4R1HA 3EYYA 1YS6A 2G7HA 2E7WA 5E8GA 2HS5A 4ON0A 2HKOA 2M45A 3F3XA 3FMSA 3KP6A 3MZYA 2OBPA 3OV8A 5BPDA 1FT9A 2P5VA 1V3FA 1BI2A 1O3TA 5HDGA 1P92A 2E1NA 1HKSA 4GYIA 1KA8A 2H6CA 5BQTA 1XMKA 1FZPB 2L4MA 3J80Z 3KEOA 1IN5A 4FT8A 1D8KA 4L9VA 4OMYA 1ZARA 2F5DA 3TOBA 4ZYGA 5KVRA 2XVCA 5ICFA 1G6NA 4LG0B 1JGSA 3FXQA 4RGSA 5HLHA 3R0JA 2V9VA 1YW9A 4LJZF 5JFRA 1Z6RA 3Q9VA 1QBJA 1ZN2A 1K79A 1HSTA 3GYHX 1YTYA 3EQLF 1FBSA 2H09A 5HS8A 4LB6B 1R5GA 2F2EA 2XIGA 2NAZA 3EYIA 2FMLA 2XKPA 3WTSC 2GQQA 2G9WA 4WF2A 3BY6A 1HW2A 3WGIA 2XAHA 1SFXA 4HZFA 4CXFA 2OZ6A 1UHMA 1P2FA 5K5OA 4TV7A 3FM3A 1Z91A 4QWQA 5ILSA 1DUXC 1A04A 1J59A 2V1UA 1PDNC 1XGNA 5L3EA 1STZA 4CGZA 2FSWA 3LQQA 2DI3A 2DPUA 4OIQF 5ILVA 1OR7A 3V8LA 4F7ZA 2O8XA 1FSHA 1J0RA 5HOOA 1W4MA 1KU2A 1P4WA 1IXSB 2FE3A 2VBWA 3M8FA 3E5UA 3TO6A 3WE2A 1R5HA 2NNYA 1FYLA 3HRUA 3HRMA 3J80K 1QZYA 3O6BB 3E6CC 4IXAA 2FMYA 1BC8C 5CVJA 4P9FA 2ESHA 4I0AA 1HKTA 4EJWA 1C0WA 3QRFF 1RUOA 1JXSA 3CO7C 2DO7A 3CLOA 3C1DA 2KJBA 2VE8A 5CVVA 2EJRA 4G6DA 3O2PE 2QUFA 5D5UB 2IA0A 3R61A 3I59B 4LLLA 2WWYA 1MDMB 2PMUA 1USTA 1P6RA 4A5MA 3N97A 4M9XA 1FBQA 2D1VA 1D5VA 2MLKA 3H92A 2K4BA 5EEHA 2DW4A 3ABTA 3GXOA 2MD5A 3TDUC 1H0MA 3WTUC 1J2XA 3DXJF 2QZ8A 3LSTA 4OU0A 2R7FA 4FX0A 3DKWA 3KEQA 1XGSA 4EGYA 2P7CB 4LK0F 1EH6A 1TQPA 1MD0A 3MQ0A 3MFKA 3ZPLA 3ZN0A 4Q5SF 4IRHA 2JSCA 1SFUA 2A61A 4M74A 2JRTA 3RPUA 2Z3YA 3DFGA 3KETA 3T0YA 2VBZA 3WG9A 2ZMEA 4M9ZA 1L0OC 4WCGA 3SHFA 4A0YA 3CUQC 2V1DA 4BHBA 4GYGA 4YG2F 3S2WA 3N4MA 5LLQA 1MJ9A 1ZREA 2ADUA 5LGTA 2QBYA 5E8IA 4RGRA 1XSVA 4KIBA 1R23A 5LEJA 1S7AA 2RC4A 3ZQ7A 4QLCU 1HKQA 1W5TA 4WXCA 5DD4A 2L01A 2PLYA 4RGUA 4KN7X 5CJ9A 2ZMEB 3RTRA 1JHHA 4ASNA 2STWA 4G7ZF 4LMYA 2YX7A 2PFBA 1REPC 3MEXA 1XGMA 2RGVA 3RKYA 3LAPA 3HYIA 4U0WA 3KFWX 4ESBA 5L3FA 2NS0A 2FNAA 2LF8A 3FHZA 2EWNA 1OKRA 1TW3A 2QBYB 1MJAA 3HHGA 1B6AA 4ENNA 4MEXF 2F5EA 4L0ZB 3GLXA 2A6EF 3IRRA 3KZYA 3IL2A 2IT0A 2FBHA 2P6TA 3JTHA 3P9KA 2KJCA 1E17A 3LAJA 1R22A 3ELKA 3IRQA 3WTZA 4OIRF 2L4AA 2W57A 1O3SA 5EEGA 5K5QA 1B9NA 1ODDA 4CHUA 2M87A 1LNWA 2KIFA 3MWMA 3HSFA 1K7AA 1BIAA 3GF2A 3B73A 1YIOA 2XGXA 3W6KB 4AIJA 4BNCA 2M5WA 4DNCA 1YLFA 5HDNA 1DP7P 2KIUA 1DDNA 4JBAA 2QQ9A 3ZN1A 2OU2A 1RZ4A 1LVAA 2JPBA 2CW0F 2G7UA 5DYMA 3D5LA 3ML6A 5FO5A 5E1ZB 2W84A 2QM3A 3E97A 2CG4A 2BV6A 1S6LA 3JTGA 2GXBA 3I71A 4L9JA 2AXLA 3J81Z 3L7WA 1W7PD 3L09A 3W6JB 5J6XA 3WU0A 4LLNA 1Z7UA 4RAYA 1SMYF 2H94A 2P8TA 2IPQX 1UCRA 4ZYHA 1IF1A 1Z9CA 2RV8A 2HFHA 2QVOA 2GIVA 4EJVA 3IC7A 2K02A 2BEOA 4OINF 1IZ1A 3VEPA 3E6BA 2VBXA 3K1MA 5F1RA 1O3QA 2XAGA 3I64A 3E3VA 4B8XA 1EH8A 4Y13A 1SD7A 3KP5A 1G3YA 1ZRFA 4IRIA 2W25A 1EV7A 1FYKA 2EV5A 3R60A 2DU9A 2HYGD 1P4AA 1X3UA 5FLXK 1LDDA 3QU3A 4ZYDA 2A68F 5FB2A 2M30A 4I7HA 5A2QK 3WGHA 5JI6A 2YSRA 2VN2A 1OYWA 2HTSA 3E5XA 2O0YA 4HX7A 1FBUA 1ZG5A 5CVUA 5AIPA 2LSOA 1HSJA 1G3SA 3HOSA 3MZHA 5AIQA 2A07F 4M72A 1Z6TA 3CUQB 2C6YA 1U78A 3I54A 1ZLJA 2O03A 1O7FA 3FX3A 2ZKZA 1GHCA 1XB4A 3WGGA 2R3SA 3BDDA 3AAFA 2OQRA 2DQRA 1J7KA 4N9HA 2A5YB 4LG0A 1HQCA 1RUNA 4CYDA 3QP6A 3JSPA 2UXNA 5E18F 4XRFA 1Y0UA 2OAZA 4YFNF 4LD5A 4KN4X 5L3DA 1R00A 1AWCA 2Z9OA 2DBBA 4ESFA 3GFJA 4L18B 1OPCA 4HX8A 4WX9A 1L3LA 1IN6A 3F6OA 2EV6A 3ZMSA 2UZKA 1T2KA 2VC0A 4G7OF 4EVIA 3M9AA 3TDZC 2HYFA 3F8BA 1R58A 1F1ZA 1F4KA 1DPUA 1XDUA 2DK8A 5BPIA 4OMZA 3RIRA 1U3EM 1YYVA 1FYMA 3BROA 2VBYA 4RGXA 1S29A 2X0LA 3EETA 3LA3A 1TNTA 1UHWA 1HW5A 1H9TA 4FX4A 1I27A 1ZG3A 3QPHA 1XN7A 4L9NA 1XD7A 4UHTA 4HQMA 2ZCWA 1XSXA 4ENMA 4A5NA 2LF7A 1XCBA 1G4DA 1BC7C 2IJLA 2GXGA 3RI4A 1F9NA 4A6DA 3NQOA 5D6FA 1S7OA 4IRGA 3RDIA 2ACJA 3BZ6A 4MQ9F 1TW2A 2FF4A 4AVPA 1S3JA 4EJTA 4XSXF 4HF1A 1FPQA 4FHTA 3CTAA 4RB2C 2MLGA 2Y75A 4KIFA 4U0VA 5ICCA 1W7PA 5F6FA 3MAJA 3I59A 1XMAA 1ZRDA 2WC2A 1MDMA 1JHFA 2QENA 3QU6A 3M7GA 2DLLA 3HUGA 3LA2A 3V7RA 1QO0D 3GWZA 1XDSA 2PI0A 5D5WB 1O3RA 4NB5A 1KQ0A 1OMIA 3F23A 3RJPA 3CUOA 1YQAA 3I0TA 3ROUA 4OIPF 5CYVA 2XAFA 4EM1A 1SFEA 3I58A 2DK5A 1YS7A 3M8EA 1HXDA 4S05A 3WTWC 1UFMA 1W7PB 2IP2A 3GX4X 4A0ZA 4XLPF 4A6EA 1TTYA 1BM9A 2P6SA 3ISPA 1TNSA 5IT9K 3ECOA 4AIKA 2LKPA 2ISYA 5CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIF A;  5D5X B;  5HS7 A;  5K5R A;  4RS8 A;  4ZZL A;  1PP8 F;  5E1W A;  3WU1 B;  4HF2 A;  1LEB A;  2FBI A;  2IA2 A;  2BE5 F;  2HEO A;  5DD8 A;  1GVJ A;  3SZP A;  2OQG A;  3KP2 A;  4BYY A;  5HS9 A;  2YX4 A;  3F72 A;  6PAX A;  3CDH A;  4LGW A;  1FX7 A;  3V8K A;  4I2O A;  2X4H A;  1BI3 A;  2EA2 A;  3REO A;  2MA3 A;  2XAQ A;  3GUD A;  3RKW A;  1BIB A;  4P5O A;  4NQW A;  1T0F A;  3L00 A;  3FMR A;  1KU9 A;  2W85 A;  3FZV A;  1T6S A;  4R8H A;  2STT A;  1WKM A;  5LHI A;  1I1S A;  4M9S A;  4BXU A;  4EM2 A;  2Z33 A;  1IUY A;  3M1E A;  1LJ9 A;  2ZBK A;  4UV8 A;  3GZ5 A;  4KFC A;  2NNN A;  4AD9 A;  2ESN A;  2Q8K A;  4ESJ A;  2A6H F;  1Z05 A;  2PQ8 A;  2ZJ2 A;  4MNU A;  2VOO A;  2COM A;  2HQN A;  4WXH A;  2K86 A;  5LBQ A;  2P7V B;  2J5O A;  2LDU A;  5AON A;  5E20 A;  2ZO4 A;  4UUV A;  3TKY A;  1TQM A;  3EUH A;  2VC1 A;  4KNY A;  3HOT A;  5TRD A;  2L54 A;  2OA4 A;  1YO5 C;  1I5Z A;  4U7B A;  5D8L B;  2JT1 A;  4LFU A;  3HRS A;  3V7S A;  4OIO F;  2FBK A;  2H27 A;  1KGS A;  1RIO H;  1YW8 A;  1YW7 A;  5HVQ C;  3P9I A;  5E17 F;  4EQQ A;  3JW4 A;  2RNJ A;  3F6V A;  1ON1 A;  4MTE A;  3G3Z A;  2BYV E;  1U6G A;  2DFI A;  4KDP A;  3LFK A;  2YPR A;  1R1U A;  2GA1 A;  2EFW A;  2UWM A;  3SZT A;  1D3Y A;  4L9T A;  1W5S A;  2DQL A;  1G3W A;  2XRO A;  4KUM A;  1U5T B;  1IXC A;  3CJN A;  1I1G A;  5CVI A;  2HR3 A;  2RDP A;  3KLO A;  5FD5 A;  2QQB A;  5FLX Z;  1J75 A;  2MC3 A;  1ZAO A;  4G8X A;  5J8F A;  4BHC A;  3TQN A;  1B1B A;  3TO7 A;  5A2Q Z;  4ZH4 F;  1LB2 A;  4M73 A;  3Q9S A;  2FNP A;  2XUB A;  3LA7 A;  2RQP A;  3F22 A;  4IHT A;  2EFN A;  4G94 A;  3KLN A;  1LEA A;  3WTV C;  4MEY F;  5DEQ A;  2DTR A;  4GO1 A;  4MTD A;  3RKX A;  3DF8 A;  3ECH A;  1O7L A;  4HDV A;  4A2U A;  2FOK A;  1P4X A;  3I4P A;  2FU4 A;  3DPT A;  4HQE A;  3QPT A;  4M6X A;  2EV0 A;  3BWG A;  3NRV A;  1IW7 F;  5HLI A;  4P55 A;  3KZZ A;  2DT5 A;  2GZW A;  3TOA A;  2LNB A;  4UVC A;  3U9G A;  4H0E A;  3F21 A;  3BJA A;  1YG2 A;  3D0S A;  4HF0 A;  3DEU A;  3FXR A;  3ULQ B;  2M8E A;  3Q5F A;  4RB3 C;  2O6G E;  2MH9 A;  4HDU A;  2UXX A;  3CUQ A;  1KYW A;  3WE3 A;  5ERI A;  4L5J A;  4UXN A;  1USS A;  2IVM A;  2ZNY A;  4IVN A;  3SQN A;  2E1C A;  4ZZD A;  1MKM A;  4RAZ A;  4KT5 C;  5L3C A;  1F5T A;  4UVA A;  3RPQ A;  4WWC A;  4U0Y A;  2CWE A;  3F8C A;  4I01 A;  1ZH5 A;  1KU3 A;  4Z2Y A;  1FP1 D;  2D1H A;  3GO5 A;  3WTY C;  3TO9 A;  1CF7 B;  5JR3 A;  2HDC A;  5LGU A;  3V8J A;  1MGT A;  2PG4 A;  4JQF A;  4BAY A;  4HW0 A;  1K78 A;  1Z1D A;  4KA4 A;  3ZP5 A;  4HOB A;  1SMT A;  1O57 A;  1GXP A;  2V1X A;  3GZ6 A;  2O3F A;  5CLS A;  4D0P A;  2A69 F;  2K4J A;  4U7D A;  2ZXJ A;  2ZFW A;  1OYY A;  2MH2 A;  1ZYR F;  2PJP A;  5LEK A;  1ZGA A;  3VOE A;  4IPA A;  2CQK A;  5H6R A;  2GAU A;  2FRH A;  4O6J A;  3H3Z A;  4K2E A;  5DCM B;  4HYE A;  1R7J A;  4I0B A;  1K78 B;  2XHK A;  3L2C A;  2KKO A;  3I53 A;  4G6Q A;  3QAH A;  2D2W A;  2QYO A;  4GGG A;  5TJJ A;  4XBF A;  2P5K A;  1FP2 A;  5LGN A;  1IRG A;  4A0X A;  3KP3 A;  1UB9 A;  2W24 A;  4WXD A;  2CFX A;  4G9Y A;  2F5C A;  1TLH B;  3JAM K;  4BHP A;  4CO8 A;  3NEU A;  3DV8 A;  3FWE A;  2EA4 A;  3QOP A;  4Y15 A;  5FFZ A;  4XLN F;  2Z99 A;  5ICE A;  4RB0 A;  1RI7 A;  1BI0 A;  1IN8 A;  4EJU A;  2PBI A;  2HTJ A;  2IA1 A;  2M1B A;  1B4A A;  3J7A O;  5IT9 Z;  5LRR A;  5L3G A;  1U8R A;  2L3D A;  4ZYE A;  4EV0 A;  4P9U A;  2BBY A;  3DQV C;  4UVB A;  2HGC A;  4Y17 A;  2O61 A;  2V79 A;  1U5T C;  1QZZ A;  4JK1 X;  5D5V B;  2EK5 A;  5LRS A;  1ZRC A;  4I02 A;  3LWF A;  5DDG A;  3V7C A;  4YIF A;  1LQ1 A;  1K6O A;  4HX4 A;  4KMF A;  5BS6 A;  1E2X A;  3T8R A;  3KE2 A;  3K1P A;  1FNN A;  5K1Y A;  4A12 A;  3VFZ A;  3MCZ A;  1TBX A;  2Q0O A;  3R4K A;  3HTS B;  2KRF A;  4LK1 F;  2OD5 A;  1XGO A;  2EFQ A;  3BJO A;  4PGH A;  3GW2 A;  5DV5 A;  5D4S A;  2WV0 A;  2XRN A;  2YU3 A;  3E5Q A;  3H3U A;  1QGP A;  1T98 A;  3BOQ A;  4P96 A;  4RB1 A;  3IWF A;  2ETH A;  5HLG A;  4HA8 A;  3KP4 A;  3K0L A;  4ETS A;  4MGR A;  2ZNZ A;  5E1X A;  4E70 A;  2F5F A;  1LDK B;  1FSE A;  2VON A;  2Y48 A;  4AWX B;  1WI9 A;  3O3K A;  1T38 A;  1IRF A;  1WWX A;  5HDK A;  2VT2 A;  4PCQ A;  1FLI A;  3GFI A;  2AS5 F;  4WK8 F;  1SD6 A;  5H6Q A;  2WTE A;  4HLY A;  5D6E A;  3F8F A;  3L9F A;  3R0A A;  3BPV A;  2VOP A;  2DAO A;  3C3W A;  3BP8 A;  1R36 A;  1HW1 A;  4KIC A;  1J9I A;  2BGC A;  2RKH A;  2IRF G;  1JE8 A;  2PN6 A;  5J8C A;  4B09 A;  4KYW A;  2HZT A;  2ELH A;  3K2Z A;  5KK1 A;  1FY7 A;  4I09 A;  1XSD A;  2QLZ A;  1J5Y A;  1BN5 A;  4M6Y A;  2L02 A;  4L5I A;  2OZU A;  4Q4Z F;  2JTV A;  1SAX A;  5BOX A;  3KP7 A;  3R6S A;  4ENK A;  1R1V A;  1RNL A;  3P9C A;  1CGP A;  4O5V A;  2FA5 A;  3ZMZ A;  3T1B A;  2KIM A;  3ZMD A;  1BI1 A;  2PMH A;  5H20 A;  4YII A;  4BQA A;  5JVT A;  4EMS A;  1Q1H A;  4I98 B;  5LHG A;  2RVC A;  3GFL A;  1BBY A;  3DP7 A;  1SD5 A;  1TQI A;  1G3T A;  3HSR A;  3U1D A;  3GVA A;  3IHU A;  2A3S A;  4MHG A;  2HQR A;  2V6C A;  4Q47 A;  3SXY A;  4O3M A;  3IKT A;  4XSZ F;  2NRA C;  2RN7 A;  3HTU A;  1U5T A;  1KYZ A;  2FQ3 A;  4UNO A;  2Z5U A;  5DCF A;  1ZLK A;  3T5X A;  3ZMU A;  1ONV A;  2CSO A;  3WTX C;  4UV9 A;  3COA C;  2CO5 A;  4M71 A;  1ZGJ A;  1DPR A;  1HBX G;  2VOD A;  3DPL C;  4HLX A;  3JSO A;  1FC3 A;  2EFP A;  3WTT C;  1KU7 A;  3C18 A;  2IW5 A;  3WOD F;  3FM5 A;  2R7D A;  1IXR C;  1B59 A;  3U2R A;  1OYI A;  1ULY A;  1KQ8 A;  3EDP A;  3E6D A;  1LDJ A;  1QQI A;  1ZHF A;  3K1N A;  1ZG1 A;  2K27 A;  1QNT A;  1NHA A;  2D45 A;  4PGG A;  4G7H F;  2B0L A;  2J5P A;  2EB7 A;  3ZMV A;  4OOI A;  3BPX A;  3VOD A;  3F8M A;  3LQR A;  2Y0M A;  4LB5 A;  5F64 A;  2XV4 S;  4CIC A;  1B9M A;  1FOK A;  3PFI A;  1S8N A;  3TGN A;  3IWZ A;  2XAS A;  4KIG A;  1ON2 A;  1PUE E;  1V4R A;  2GA2 A;  4ENJ A;  4HV6 A;  2GWR A;  1MZB A;  3PQJ A;  4PZJ A;  4L0Y B;  3KCC A;  4YFK F;  4GCV A;  1R1T A;  1PP7 U;  5FD6 A;  2HKX A;  2QWW A;  4IJA A;  3ZMT A;  4BH9 A;  3GFM A;  2H6B A;  4R79 A;  3IKV A;  3PQK A;  1GXQ A;  1H9G A;  3K9T A;  4IF4 A;  2Q2E A;  4HV5 A;  5ILU A;  2DPD A;  2VXZ A;  5DUK A;  3C7J A;  1T39 A;  3VB2 A;  1VTN C;  1IN7 A;  1BOA A;  1SD4 A;  5DUI A;  5FGM A;  2E7X A;  4HBL A;  2NYX A;  4U88 A;  3G73 A;  5LHH A;  3F8N A;  5ED4 A;  5JHU A;  2VT3 A;  2FEZ A;  5D8K B;  1XCV A;  3E6M A;  4S04 A;  2JPC A;  2P4W A;  3CO6 C;  1CF7 A;  3B02 A;  4Q48 A;  4NHJ A;  4PDK A;  2K7L A;  1IN4 A;  1D8J A;  3ERE D;  2JZY A;  4YFX F;  2CYY A;  3FMQ A;  4KMU X;  2VE9 A;  4CDG A;  5FFX A;  1QPM A;  3RYR A;  3V4G A;  3FF5 A;  2CGP A;  4AIH A;  1I6X A;  4EJO A;  1WSU A;  2HWV A;  3JAM Z;  1BJA A;  1FWZ A;  3HSE A;  3GEZ A;  3K69 A;  3HRT A;  4N9I A;  1KQ9 A;  4DQ2 A;  2MBF A;  4CZZ A;  1IAW A;  3OOP A;  2XAJ A;  2YR2 A;  3QP5 A;  4EM0 B;  1YFH A;  3P7N A;  5DCM A;  2P5L C;  5D4R A;  4GXO A;  2PEX A;  3FXU A;  1WRJ A;  2XKO A;  3ABU A;  1AOY A;  3HHH A;  5IT3 A;  4MQV A;  4EGZ A;  5ICG A;  3I5U A;  2HOE A;  4N0B A;  2FXA A;  1U2W A;  1EH7 A;  2QQA A;  5BMZ A;  2ISZ A;  3BJ6 A;  4HAM A;  3SFZ A;  2TDX A;  1MJB A;  4IHS A;  3RYP A;  2EFO A;  3T8T A;  5L3B A;  4LLG F;  3J81 K;  1WQ2 A;  4R1H A;  3EYY A;  1YS6 A;  2G7H A;  2E7W A;  5E8G A;  2HS5 A;  4ON0 A;  2HKO A;  2M45 A;  3F3X A;  3FMS A;  3KP6 A;  3MZY A;  2OBP A;  3OV8 A;  5BPD A;  1FT9 A;  2P5V A;  1V3F A;  1BI2 A;  1O3T A;  5HDG A;  1P92 A;  2E1N A;  1HKS A;  4GYI A;  1KA8 A;  2H6C A;  5BQT A;  1XMK A;  1FZP B;  2L4M A;  3J80 Z;  3KEO A;  1IN5 A;  4FT8 A;  1D8K A;  4L9V A;  4OMY A;  1ZAR A;  2F5D A;  3TOB A;  4ZYG A;  5KVR A;  2XVC A;  5ICF A;  1G6N A;  4LG0 B;  1JGS A;  3FXQ A;  4RGS A;  5HLH A;  3R0J A;  2V9V A;  1YW9 A;  4LJZ F;  5JFR A;  1Z6R A;  3Q9V A;  1QBJ A;  1ZN2 A;  1K79 A;  1HST A;  3GYH X;  1YTY A;  3EQL F;  1FBS A;  2H09 A;  5HS8 A;  4LB6 B;  1R5G A;  2F2E A;  2XIG A;  2NAZ A;  3EYI A;  2FML A;  2XKP A;  3WTS C;  2GQQ A;  2G9W A;  4WF2 A;  3BY6 A;  1HW2 A;  3WGI A;  2XAH A;  1SFX A;  4HZF A;  4CXF A;  2OZ6 A;  1UHM A;  1P2F A;  5K5O A;  4TV7 A;  3FM3 A;  1Z91 A;  4QWQ A;  5ILS A;  1DUX C;  1A04 A;  1J59 A;  2V1U A;  1PDN C;  1XGN A;  5L3E A;  1STZ A;  4CGZ A;  2FSW A;  3LQQ A;  2DI3 A;  2DPU A;  4OIQ F;  5ILV A;  1OR7 A;  3V8L A;  4F7Z A;  2O8X A;  1FSH A;  1J0R A;  5HOO A;  1W4M A;  1KU2 A;  1P4W A;  1IXS B;  2FE3 A;  2VBW A;  3M8F A;  3E5U A;  3TO6 A;  3WE2 A;  1R5H A;  2NNY A;  1FYL A;  3HRU A;  3HRM A;  3J80 K;  1QZY A;  3O6B B;  3E6C C;  4IXA A;  2FMY A;  1BC8 C;  5CVJ A;  4P9F A;  2ESH A;  4I0A A;  1HKT A;  4EJW A;  1C0W A;  3QRF F;  1RUO A;  1JXS A;  3CO7 C;  2DO7 A;  3CLO A;  3C1D A;  2KJB A;  2VE8 A;  5CVV A;  2EJR A;  4G6D A;  3O2P E;  2QUF A;  5D5U B;  2IA0 A;  3R61 A;  3I59 B;  4LLL A;  2WWY A;  1MDM B;  2PMU A;  1UST A;  1P6R A;  4A5M A;  3N97 A;  4M9X A;  1FBQ A;  2D1V A;  1D5V A;  2MLK A;  3H92 A;  2K4B A;  5EEH A;  2DW4 A;  3ABT A;  3GXO A;  2MD5 A;  3TDU C;  1H0M A;  3WTU C;  1J2X A;  3DXJ F;  2QZ8 A;  3LST A;  4OU0 A;  2R7F A;  4FX0 A;  3DKW A;  3KEQ A;  1XGS A;  4EGY A;  2P7C B;  4LK0 F;  1EH6 A;  1TQP A;  1MD0 A;  3MQ0 A;  3MFK A;  3ZPL A;  3ZN0 A;  4Q5S F;  4IRH A;  2JSC A;  1SFU A;  2A61 A;  4M74 A;  2JRT A;  3RPU A;  2Z3Y A;  3DFG A;  3KET A;  3T0Y A;  2VBZ A;  3WG9 A;  2ZME A;  4M9Z A;  1L0O C;  4WCG A;  3SHF A;  4A0Y A;  3CUQ C;  2V1D A;  4BHB A;  4GYG A;  4YG2 F;  3S2W A;  3N4M A;  5LLQ A;  1MJ9 A;  1ZRE A;  2ADU A;  5LGT A;  2QBY A;  5E8I A;  4RGR A;  1XSV A;  4KIB A;  1R23 A;  5LEJ A;  1S7A A;  2RC4 A;  3ZQ7 A;  4QLC U;  1HKQ A;  1W5T A;  4WXC A;  5DD4 A;  2L01 A;  2PLY A;  4RGU A;  4KN7 X;  5CJ9 A;  2ZME B;  3RTR A;  1JHH A;  4ASN A;  2STW A;  4G7Z F;  4LMY A;  2YX7 A;  2PFB A;  1REP C;  3MEX A;  1XGM A;  2RGV A;  3RKY A;  3LAP A;  3HYI A;  4U0W A;  3KFW X;  4ESB A;  5L3F A;  2NS0 A;  2FNA A;  2LF8 A;  3FHZ A;  2EWN A;  1OKR A;  1TW3 A;  2QBY B;  1MJA A;  3HHG A;  1B6A A;  4ENN A;  4MEX F;  2F5E A;  4L0Z B;  3GLX A;  2A6E F;  3IRR A;  3KZY A;  3IL2 A;  2IT0 A;  2FBH A;  2P6T A;  3JTH A;  3P9K A;  2KJC A;  1E17 A;  3LAJ A;  1R22 A;  3ELK A;  3IRQ A;  3WTZ A;  4OIR F;  2L4A A;  2W57 A;  1O3S A;  5EEG A;  5K5Q A;  1B9N A;  1ODD A;  4CHU A;  2M87 A;  1LNW A;  2KIF A;  3MWM A;  3HSF A;  1K7A A;  1BIA A;  3GF2 A;  3B73 A;  1YIO A;  2XGX A;  3W6K B;  4AIJ A;  4BNC A;  2M5W A;  4DNC A;  1YLF A;  5HDN A;  1DP7 P;  2KIU A;  1DDN A;  4JBA A;  2QQ9 A;  3ZN1 A;  2OU2 A;  1RZ4 A;  1LVA A;  2JPB A;  2CW0 F;  2G7U A;  5DYM A;  3D5L A;  3ML6 A;  5FO5 A;  5E1Z B;  2W84 A;  2QM3 A;  3E97 A;  2CG4 A;  2BV6 A;  1S6L A;  3JTG A;  2GXB A;  3I71 A;  4L9J A;  2AXL A;  3J81 Z;  3L7W A;  1W7P D;  3L09 A;  3W6J B;  5J6X A;  3WU0 A;  4LLN A;  1Z7U A;  4RAY A;  1SMY F;  2H94 A;  2P8T A;  2IPQ X;  1UCR A;  4ZYH A;  1IF1 A;  1Z9C A;  2RV8 A;  2HFH A;  2QVO A;  2GIV A;  4EJV A;  3IC7 A;  2K02 A;  2BEO A;  4OIN F;  1IZ1 A;  3VEP A;  3E6B A;  2VBX A;  3K1M A;  5F1R A;  1O3Q A;  2XAG A;  3I64 A;  3E3V A;  4B8X A;  1EH8 A;  4Y13 A;  1SD7 A;  3KP5 A;  1G3Y A;  1ZRF A;  4IRI A;  2W25 A;  1EV7 A;  1FYK A;  2EV5 A;  3R60 A;  2DU9 A;  2HYG D;  1P4A A;  1X3U A;  5FLX K;  1LDD A;  3QU3 A;  4ZYD A;  2A68 F;  5FB2 A;  2M30 A;  4I7H A;  5A2Q K;  3WGH A;  5JI6 A;  2YSR A;  2VN2 A;  1OYW A;  2HTS A;  3E5X A;  2O0Y A;  4HX7 A;  1FBU A;  1ZG5 A;  5CVU A;  5AIP A;  2LSO A;  1HSJ A;  1G3S A;  3HOS A;  3MZH A;  5AIQ A;  2A07 F;  4M72 A;  1Z6T A;  3CUQ B;  2C6Y A;  1U78 A;  3I54 A;  1ZLJ A;  2O03 A;  1O7F A;  3FX3 A;  2ZKZ A;  1GHC A;  1XB4 A;  3WGG A;  2R3S A;  3BDD A;  3AAF A;  2OQR A;  2DQR A;  1J7K A;  4N9H A;  2A5Y B;  4LG0 A;  1HQC A;  1RUN A;  4CYD A;  3QP6 A;  3JSP A;  2UXN A;  5E18 F;  4XRF A;  1Y0U A;  2OAZ A;  4YFN F;  4LD5 A;  4KN4 X;  5L3D A;  1R00 A;  1AWC A;  2Z9O A;  2DBB A;  4ESF A;  3GFJ A;  4L18 B;  1OPC A;  4HX8 A;  4WX9 A;  1L3L A;  1IN6 A;  3F6O A;  2EV6 A;  3ZMS A;  2UZK A;  1T2K A;  2VC0 A;  4G7O F;  4EVI A;  3M9A A;  3TDZ C;  2HYF A;  3F8B A;  1R58 A;  1F1Z A;  1F4K A;  1DPU A;  1XDU A;  2DK8 A;  5BPI A;  4OMZ A;  3RIR A;  1U3E M;  1YYV A;  1FYM A;  3BRO A;  2VBY A;  4RGX A;  1S29 A;  2X0L A;  3EET A;  3LA3 A;  1TNT A;  1UHW A;  1HW5 A;  1H9T A;  4FX4 A;  1I27 A;  1ZG3 A;  3QPH A;  1XN7 A;  4L9N A;  1XD7 A;  4UHT A;  4HQM A;  2ZCW A;  1XSX A;  4ENM A;  4A5N A;  2LF7 A;  1XCB A;  1G4D A;  1BC7 C;  2IJL A;  2GXG A;  3RI4 A;  1F9N A;  4A6D A;  3NQO A;  5D6F A;  1S7O A;  4IRG A;  3RDI A;  2ACJ A;  3BZ6 A;  4MQ9 F;  1TW2 A;  2FF4 A;  4AVP A;  1S3J A;  4EJT A;  4XSX F;  4HF1 A;  1FPQ A;  4FHT A;  3CTA A;  4RB2 C;  2MLG A;  2Y75 A;  4KIF A;  4U0V A;  5ICC A;  1W7P A;  5F6F A;  3MAJ A;  3I59 A;  1XMA A;  1ZRD A;  2WC2 A;  1MDM A;  1JHF A;  2QEN A;  3QU6 A;  3M7G A;  2DLL A;  3HUG A;  3LA2 A;  3V7R A;  1QO0 D;  3GWZ A;  1XDS A;  2PI0 A;  5D5W B;  1O3R A;  4NB5 A;  1KQ0 A;  1OMI A;  3F23 A;  3RJP A;  3CUO A;  1YQA A;  3I0T A;  3ROU A;  4OIP F;  5CYV A;  2XAF A;  4EM1 A;  1SFE A;  3I58 A;  2DK5 A;  1YS7 A;  3M8E A;  1HXD A;  4S05 A;  3WTW C;  1UFM A;  1W7P B;  2IP2 A;  3GX4 X;  4A0Z A;  4XLP F;  4A6E A;  1TTY A;  1BM9 A;  2P6S A;  3ISP A;  1TNS A;  5IT9 K;  3ECO A;  4AIK A;  2LKP A;  2ISY A;  5CVR A; 
#chains in the Genus database with same CATH topology
 3L2V A;  3GTP J;  3HIF A;  4FET A;  4FIS A;  5D5X B;  2E2I J;  5FJ8 J;  5HS7 A;  5K5R A;  2X98 A;  4RS8 A;  1D0Z A;  4ZZL A;  1PP8 F;  5E1W A;  3WU1 B;  4HF2 A;  4BEH A;  1LEB A;  2FBI A;  2M0C A;  2IA2 A;  4W97 A;  2BE5 F;  2HEO A;  5DD8 A;  1GVJ A;  1WI3 A;  2NVX J;  4B4C A;  3SZP A;  2OQG A;  3KP2 A;  4BYY A;  3QPS A;  2E2H J;  1SEU A;  1DGW Y;  2YX4 A;  5HS9 A;  3F72 A;  6PAX A;  5LD2 C;  1W1W E;  3GME A;  3CDH A;  2ECC A;  4LGW A;  3OL3 A;  4BY1 J;  1FX7 A;  3V8K A;  4I2O A;  2X4H A;  1BI3 A;  3H5N A;  4CSW A;  4JX5 A;  2EA2 A;  3REO A;  1WFX A;  2MA3 A;  2XAQ A;  3GUD A;  3RKW A;  1BIB A;  4F55 A;  2WB1 A;  4P5O A;  4AYB N;  3W6V A;  3DLL F;  4NQW A;  1T0F A;  3L00 A;  3W3C A;  3FMR A;  1KU9 A;  2W85 A;  3MKZ A;  3FZV A;  2L7K A;  1T6S A;  4R8H A;  2STT A;  1WKM A;  5LHI A;  1I1S A;  4M9S A;  2BVM A;  4BXU A;  4EM2 A;  2Z33 A;  1IUY A;  3SEQ A;  1SVL A;  3M1E A;  1LJ9 A;  3C2B A;  4DZJ A;  2ZBK A;  4UV8 A;  2E1M C;  2R93 J;  2V1N A;  3GZ5 A;  5GAE J;  4KFC A;  2NNN A;  4PK4 A;  3FIS A;  2QSF X;  4AD9 A;  4FCY A;  1RR7 A;  2QKM B;  3MKL A;  2EH3 A;  5EYR A;  1NH3 A;  5IP9 J;  2ESN A;  2Q8K A;  4ESJ A;  2A6H F;  1Z05 A;  2PQ8 A;  2KFD A;  2NXN B;  1YRN B;  2ZJ2 A;  3DU6 A;  4MNU A;  1PVE A;  3JRC A;  1A35 A;  2VOO A;  3OYG A;  2K9L A;  2KP6 A;  4UB6 C;  1FOW A;  4YRV A;  3GBG A;  1AA7 A;  2COM A;  2HQN A;  4WXH A;  2K86 A;  5LBQ A;  2P7V B;  5FLX R;  2J5O A;  2LDU A;  5AON A;  3S32 A;  2LH9 A;  5E20 A;  2ZO4 A;  4UUV A;  2FUG 2;  5FKO A;  3TKY A;  1TQM A;  3EUH A;  2VC1 A;  4KNY A;  3HOT A;  5TRD A;  3BR2 A;  1FEX A;  3ABK H;  2GOX B;  3LSM A;  3TP3 A;  2KZG A;  2L54 A;  2OA4 A;  4UUT A;  1YO5 C;  1NK2 P;  1I5Z A;  5D8L B;  4BQN A;  4U7B A;  5A2Q R;  2JT1 A;  4LFU A;  3HRS A;  4NNJ A;  3V7S A;  4OIO F;  5JVG F;  2ZSH B;  4MO7 A;  1R5I D;  5FKL A;  3OYE A;  2FBK A;  2H27 A;  4S0H B;  1KGS A;  1RIO H;  4YEL A;  5F04 A;  1YW8 A;  1YW7 A;  5HVQ C;  2MYS A;  3S2D J;  3P9I A;  5E17 F;  4EQQ A;  3JW4 A;  2RNJ A;  3F6V A;  2VB6 A;  4XL9 A;  1ON1 A;  4MTE A;  1QVT A;  3G3Z A;  2BYV E;  4DBQ A;  1U6G A;  2DFI A;  3JCU C;  3P5J A;  4KDP A;  1RKW A;  3MN2 A;  2CV1 A;  3LFK A;  2YPR A;  1R1U A;  3NWS A;  4DJA A;  2E60 A;  4BGD A;  3CCS I;  2GA1 A;  2Y9Z A;  2L9R A;  2EFW A;  1I6H J;  2UWM A;  3SZT A;  3AL0 C;  1D3Y A;  3ZCO A;  4L9T A;  4ABZ A;  3IP4 B;  1TWC J;  1W5S A;  2DCE A;  3BR6 A;  2DQL A;  1G3W A;  2EZL A;  2JRM A;  2DYS H;  2XRO A;  1A36 A;  1EKE A;  1U5T B;  4KUM A;  2JA8 J;  1IXC A;  1YJ9 I;  2V9K A;  3CJN A;  3KIO A;  3AKZ A;  1I1G A;  5CVI A;  1WPK A;  2HR3 A;  2LR8 A;  5M3F J;  2RDP A;  4V19 K;  2IS4 A;  3KLO A;  5FD5 A;  2QQB A;  5FLX Z;  1VQM I;  4ZC3 A;  1J75 A;  2MC3 A;  3DLA A;  1RPW A;  1ZAO A;  4G8X A;  2EIK H;  2DA4 A;  4CCN A;  1IJW C;  2BVL A;  2WAD A;  5J8F A;  4BHC A;  3TQN A;  1B1B A;  4B3A A;  1OCT C;  3TO7 A;  2CW7 A;  2QA4 I;  4XIC A;  4ZH4 F;  5A2Q Z;  1LB2 A;  4M73 A;  3Q9S A;  4BE2 A;  2MGQ A;  2FNP A;  2XUB A;  3LA7 A;  5EZH A;  3U1K A;  2RQP A;  3F22 A;  1MSE C;  2YUS A;  2KMU A;  4PJL A;  4CCO A;  5C4X J;  4IHT A;  2L5Q A;  2EFN A;  4G94 A;  3KLN A;  3V42 A;  2LBF A;  1LEA A;  4XKW A;  3WTV C;  1DGR M;  4MEY F;  4D7M A;  3GTO J;  5DEQ A;  2PJR A;  1MIJ A;  4IL6 C;  4B1R A;  4X6A J;  3OWT A;  2DTR A;  5F1J A;  3DU5 A;  4GO1 A;  2B63 J;  3PFY A;  4MTD A;  3WHC A;  4I99 C;  1T08 B;  3RKX A;  3DF8 A;  3PSI A;  3ECH A;  2XSD C;  1O7L A;  2XF5 A;  4HDV A;  3CZ6 A;  2CRG A;  4A2U A;  2FOK A;  1P4X A;  3I4P A;  1Z3X A;  4L5E A;  2FU4 A;  2ME0 A;  3DPT A;  4HQE A;  1VQN I;  3QPT A;  3H3V K;  4M6X A;  4A3D J;  2TCT A;  2EV0 A;  4ZDL A;  3BWG A;  3ZRG A;  4E7S A;  2Q1Z B;  3NRV A;  1IW7 F;  3PUB A;  5HLI A;  2ECB A;  4P55 A;  3KZZ A;  1SFO J;  3OYC A;  2E5Z A;  3JRD A;  2MFZ A;  4PSW A;  1KON A;  2LBF B;  1MBH A;  1JJ8 C;  1XC5 A;  2W82 A;  1NK3 P;  1H89 C;  4XR6 A;  4F91 B;  4UY8 I;  4RAG A;  2DT5 A;  2GZW A;  3TOA A;  2LNB A;  2M0M A;  4NBQ A;  3CC2 I;  4UVC A;  3U9G A;  4H0E A;  3F21 A;  1U8B A;  3BJA A;  1HLV A;  1D0Y A;  1YG2 A;  3D0S A;  4HF0 A;  3DEU A;  3FXR A;  4CCL A;  3ULQ B;  2M8E A;  3Q5F A;  4RB3 C;  2O6G E;  2O8K A;  2Y30 A;  2F4I A;  4DOZ A;  2MH9 A;  3SFI A;  3K4M A;  4HDU A;  2FJ1 A;  2UXX A;  4NUB A;  3J7A Y;  2RAE A;  3CUQ A;  1VQ5 I;  2E5N A;  1KYW A;  4XRM A;  3WE3 A;  3O8G A;  5ERI A;  4L5J A;  4UXN A;  1WJC A;  1ETO A;  1VND A;  3CME I;  1USS A;  1TL8 A;  2IVM A;  2Q2E B;  2ZNY A;  1K61 A;  4E7Z A;  4IVN A;  2M7A A;  3SQN A;  3OYN A;  2E1C A;  4ZZD A;  3CF2 A;  3Q0W A;  4IOA F;  3CCR I;  5KAI C;  1MKM A;  2FX0 A;  1OCR H;  4LG3 A;  4RAZ A;  4KT5 C;  3A0H C;  3CC4 I;  2JA6 J;  5L3C A;  1F5T A;  4H4K C;  4CCM A;  4UVA A;  3RPQ A;  2KL4 A;  4WWC A;  2L9S A;  2CMP A;  4FTH A;  4U0Y A;  3S15 J;  2CWE A;  3F8C A;  4IZZ A;  4I01 A;  1ZH5 A;  2DYR H;  1KU3 A;  4E7H A;  3VSL A;  4Z2Y A;  1FP1 D;  2D1H A;  4D1Q A;  3GO5 A;  3WTY C;  1Y1V J;  3C2H A;  1MBJ A;  3TO9 A;  1CF7 B;  5JR3 A;  2R7U A;  3KX2 A;  2HDC A;  4LIT A;  3TW7 A;  4BJ6 C;  4C3I J;  5LGU A;  3V8J A;  1MGT A;  5F27 A;  2JN6 A;  2PG4 A;  5GAG J;  3OYF A;  4JQF A;  1S5L C;  4BAY A;  2E1M B;  4HW0 A;  3OYK A;  1GT0 C;  1K78 A;  1MMD A;  1Z1D A;  1XX5 A;  4KA4 A;  3HDD A;  3ZP5 A;  2HVQ A;  2IBD A;  4NDL A;  5IPA A;  4HOB A;  3G6E I;  4II2 A;  1SMT A;  3DEW A;  1O57 A;  2M34 A;  5IP7 J;  1GXP A;  2V1X A;  1DU0 A;  3GZ6 A;  3G1M A;  2O3F A;  2V9P A;  5CLS A;  3PNY A;  4D0P A;  2A69 F;  2K4J A;  4D5C A;  4U7D A;  2ZXJ A;  2ZFW A;  1OYY A;  2MH2 A;  4OWR B;  3D1N I;  1ZYR F;  2JA5 J;  2PJP A;  1TZL A;  3CCL I;  5LEK A;  2HQ5 A;  1ZGA A;  3VOE A;  4IPA A;  2XB0 X;  1YIJ I;  2CQK A;  5H6R A;  3VYR B;  1JUM A;  1VF9 A;  4XLE A;  1QPI A;  2GAU A;  2FRH A;  4O6J A;  4ITV A;  5IT9 R;  3H3Z A;  4K2E A;  4DZP A;  5DCM B;  3CDI A;  2HQA A;  1D1A A;  2A5W A;  3HOY J;  4BXX J;  3S16 J;  4CUG A;  3RPU D;  3ZQQ A;  4IHW A;  4HYE A;  1K4T A;  1TP4 A;  1R7J A;  1ZKG A;  1ETW A;  4I0B A;  3CMA I;  5E3L A;  1B72 A;  3D5R C;  1K78 B;  4BKX A;  2XHK A;  3L2C A;  2KKO A;  3I53 A;  4G6Q A;  1N25 A;  2E34 A;  9ANT A;  3QAH A;  2D2W A;  2QYO A;  3A1Y A;  4GGG A;  5TJJ A;  4XBF A;  1BJZ A;  3JRE A;  2P5K A;  1FP2 A;  2BZT A;  5LGN A;  3OR1 C;  4M3E A;  4A3K J;  1H88 C;  1IRG A;  2CQN A;  3KP3 A;  2X9D A;  4A0X A;  2BY3 A;  1UB9 A;  3CCY A;  2W24 A;  4WXD A;  3QYE A;  4Y7N J;  2CFX A;  2VQL A;  4G9Y A;  2F5C A;  3H0D A;  4FE7 A;  1TLH B;  3OR2 C;  3HJE A;  3AL0 B;  3FXL A;  3JAM K;  4BHP A;  2KIS A;  4CO8 A;  3NEU A;  3DV8 A;  4BBS J;  3GTM J;  3FWE A;  2X6W A;  2EA4 A;  3QOP A;  3CQZ J;  2IS2 A;  4XOT A;  2EBI A;  4Y15 A;  2VKV A;  4E7I A;  5J1R A;  2I8D A;  1ETV A;  1WJF A;  4Y3O A;  5FFZ A;  4XLN F;  3VWB A;  2JVH A;  2Z99 A;  2XPW A;  5ICE A;  4RB0 A;  1RI7 A;  2W4S A;  1BI0 A;  1FTT A;  1IN8 A;  1JUP A;  4HPQ A;  4QTR A;  4EJU A;  3OY9 A;  2PBI A;  2HTJ A;  2IA1 A;  2M1B A;  1B4A A;  3J7A O;  5IT9 Z;  5LRR A;  2DDB A;  1DQU A;  2LRE A;  5L3G A;  1U8R A;  2L3D A;  5J40 A;  2CQX A;  2VXD A;  4ZYE A;  4EV0 A;  4P9U A;  2BBY A;  2ELK A;  3DQV C;  1UZC A;  4UVB A;  2HGC A;  1N77 A;  4Z6Y A;  5KCM A;  4Y17 A;  4RDU A;  4E7L A;  2O61 A;  4UUS B;  5K7Z A;  3H1C A;  2ZC2 A;  1ZR4 A;  2V79 A;  1P7I A;  2IS1 A;  1U5T C;  1QZZ A;  1JGG A;  4JK1 X;  1X1B A;  2WY7 Q;  5D5V B;  2EK5 A;  4BE1 A;  1MH3 A;  5LRS A;  1ZRC A;  1M1E B;  4I02 A;  3LWF A;  4HSR A;  2IGK A;  4E7J A;  5DDG A;  4BJT A;  4JP0 A;  3V7C A;  1JKR C;  4YIF A;  1LQ1 A;  1K6O A;  3LSI A;  2VUM J;  2OUM A;  2YS9 A;  4HX4 A;  4KMF A;  3K4N A;  4BUP A;  5BS6 A;  2MC4 A;  2F6C A;  2E35 A;  1E2X A;  1IC8 A;  3AG2 H;  3M1C A;  3T8R A;  3KE2 A;  3L2W A;  4PFO A;  3BG3 A;  2EZK A;  3K1P A;  3K7A J;  5J3L A;  1FNN A;  4A69 C;  5K1Y A;  4A12 A;  3VFZ A;  3HKZ A;  3MCZ A;  1A31 A;  1I3A A;  3DTI A;  2DOA A;  1BR1 A;  1TBX A;  3TW6 A;  4DYR A;  2R7V A;  5EZG A;  1FMW A;  3TMO A;  5J4Y A;  2Q0O A;  3R4K A;  2P0T A;  4XLF A;  4A3G J;  2L0K A;  2ZJR F;  3QYF A;  5DTD A;  2KRF A;  3HTS B;  3A4C A;  2NVY J;  4LK1 F;  2OD5 A;  4W1U A;  2QSH X;  1XGO A;  2EFQ A;  2NOJ B;  3BJO A;  1Z0X A;  2E71 A;  1B8I B;  4PGH A;  3GW2 A;  5DV5 A;  5D4S A;  4A3L J;  2VQG A;  4Y33 A;  2WV0 A;  1A6I A;  3A01 B;  2XRN A;  3NAR A;  4YEJ A;  3GTJ J;  4GDF A;  2YU3 A;  3E5Q A;  3H3U A;  3SJM A;  1JI8 A;  1QGP A;  2V7F A;  1T98 A;  3BOQ A;  4P96 A;  4RB1 A;  3IWF A;  4DW6 A;  4NC7 A;  2M9H A;  2ETH A;  5HLG A;  4HA8 A;  3KP4 A;  3K0L A;  2HPI A;  4ETS A;  4MGR A;  3OYI A;  2GIZ A;  4JYK A;  2ZNZ A;  5E1X A;  1S72 I;  4E70 A;  2F5F A;  1LDK B;  1PUF B;  1FSE A;  3H5A A;  3VYU B;  3MMY B;  1EJ9 A;  3QOE A;  2VON A;  3HB9 A;  2Y48 A;  4AWX B;  1MND A;  1WI9 A;  3O3K A;  1H8A C;  1T38 A;  1RES A;  5FKM A;  2GM4 A;  2LVS A;  1IRF A;  1WWX A;  4II3 A;  2VT2 A;  3EUK L;  4PCQ A;  5HDK A;  1MMN A;  2RRE A;  2XB5 A;  2IAI A;  4PJ0 C;  3BCB A;  1Z21 A;  2BW3 B;  2HOA A;  1FLI A;  2DMQ A;  3GFI A;  2DOD A;  2AS5 F;  1EF4 A;  4WK8 F;  1SD6 A;  5H6Q A;  2VQH A;  2WTE A;  4HLY A;  5D6E A;  3F8F A;  3IAS 2;  3L9F A;  3R0A A;  4IHX A;  3RQ4 A;  1I39 A;  3MKY B;  3BPV A;  2VOP A;  2XC7 A;  1TWG J;  2DAO A;  3WU2 C;  1QA6 A;  3C3W A;  3BP8 A;  3RKQ A;  1R36 A;  4OAY A;  5FRN A;  1GVD A;  1HW1 A;  1LVK A;  4KIC A;  1J9I A;  3LSR A;  1LE8 A;  2BGC A;  4BQQ A;  2IS6 A;  2RKH A;  2E19 A;  2IRF G;  2KRC A;  2V26 A;  3K4L A;  3JRA A;  4CZC A;  3PL8 A;  3NAU A;  2PN6 A;  3DBR B;  4D5F A;  5J8C A;  1JE8 A;  5HNF A;  1YRN A;  4B09 A;  3K4B A;  4KYW A;  2HZT A;  2ELH A;  3K2Z A;  2ME6 A;  5KK1 A;  1FY7 A;  3ZQF A;  4I09 A;  1XSD A;  2QLZ A;  1J5Y A;  1BN5 A;  4M6Y A;  2L02 A;  4L5I A;  2OZU A;  1E3H A;  2JK3 A;  5B1B H;  3RCO A;  1LFB A;  4Q4Z F;  1U0J A;  2JTV A;  1SAX A;  4RBO A;  2L9N A;  1X19 A;  5BOX A;  3KP7 A;  3R6S A;  4ENK A;  1JJ6 C;  4M3B A;  1R1V A;  1RNL A;  3ZQC A;  3P9C A;  3S14 J;  3AG4 H;  1CGP A;  1BOB A;  1IDY A;  4O5V A;  1TWF J;  2FA5 A;  1YX3 A;  3H9Q A;  3ZMZ A;  3CP8 A;  3T1B A;  2NVT J;  5CQG A;  2DFH A;  2KIM A;  3ZMD A;  1BI1 A;  5DM6 F;  2PMH A;  4LIV A;  2X1D A;  5H20 A;  1LE8 B;  2KQR A;  4YII A;  4BQA A;  4ZTF A;  1N75 A;  5JVT A;  4XN3 A;  3KYC B;  4EMS A;  3AG1 H;  1VQ6 I;  3ZQH A;  1Q1H A;  1V5F A;  4I98 B;  5F0H A;  5LHG A;  1IGN A;  1R4N B;  2XGE A;  2RVC A;  2Y0S N;  3GFL A;  2CW8 A;  1BBY A;  3IH4 A;  4XOP A;  1VQK I;  5KHD A;  2WAQ A;  3QQA A;  3DP7 A;  1SD5 A;  1MMA A;  1TQI A;  1G3T A;  3OS1 A;  3HSR A;  3U1D A;  3GVA A;  3IHU A;  1MNE A;  2A3S A;  3HGY A;  4MHG A;  3TED A;  1R9T J;  2HQR A;  2V6C A;  3HGG A;  2Y2Z A;  4Q47 A;  2O5R A;  3BG7 A;  3SXY A;  3J7Y J;  4O3M A;  4BJ5 C;  5GAD J;  3QYB A;  3IKT A;  3DKX A;  4XSZ F;  2NRA C;  1HDD C;  2RN7 A;  3HTU A;  1U5T A;  1KYZ A;  1MBK A;  2R7Q A;  5J1Y A;  2FQ3 A;  3ABL H;  1LUJ B;  2Z5U A;  5DCF A;  4UNO A;  1ZLK A;  3T5X A;  4N4O B;  3ZMU A;  4A3F J;  1ONV A;  3S17 J;  2CSO A;  3WTX C;  4UV9 A;  3COA C;  3H35 A;  2CO5 A;  2XF7 A;  4M71 A;  2QGU A;  4PSX A;  1ZGJ A;  1HF0 A;  1DPR A;  2K3P A;  3S3N A;  4F52 A;  1HBX G;  4RA2 A;  2VOD A;  2ZSI B;  1G8X A;  1Z7L A;  4A3E J;  2VKD A;  1U9N A;  3DPL C;  1IRX A;  4QSH A;  4ANJ A;  3RZO J;  3N05 A;  2IEK A;  4HLX A;  2CQ7 A;  1JTX A;  3GTG J;  1S7E A;  4C3H J;  3OS2 A;  3A2K A;  1MBF A;  1EA3 A;  3JSO A;  1FC3 A;  2KRH A;  3H9G A;  4A3I J;  2EFP A;  2P81 A;  3WTT C;  1JT6 A;  2CU7 A;  1HCR A;  1GV2 A;  1KU7 A;  2CUF A;  3C18 A;  2IW5 A;  2LY2 A;  3WOD F;  2CUJ A;  3FM5 A;  2R7D A;  1IXR C;  3K4C A;  3FIW A;  1B59 A;  3U2R A;  1OYI A;  1ULY A;  1KQ8 A;  3EDP A;  2K3F A;  1QRY A;  3E6D A;  1LDJ A;  4NC8 A;  3AG3 H;  1QQI A;  2AQE A;  5J1U A;  1ZHF A;  2L7Z A;  5J4V A;  4CYC A;  2DA6 A;  3K1N A;  1ZG1 A;  2K27 A;  1QNT A;  5CPR B;  1I3Q J;  1NHA A;  2Y69 H;  2D45 A;  4PGG A;  4G7H F;  4C30 A;  1WJD A;  1T33 A;  2B0L A;  2WV1 A;  2J5P A;  2EB7 A;  3HG9 A;  3ZMV A;  3JRG A;  3MD2 A;  4OOI A;  3BPX A;  3VOD A;  2LLK A;  1GLN A;  3F8M A;  2MW8 A;  3LQR A;  2Y0M A;  4LB5 A;  5F64 A;  2XV4 S;  4CIC A;  3BR5 A;  3GTL J;  2K85 A;  3GTK J;  2DMU A;  1OFC X;  2LC2 A;  2COB A;  4HNV A;  1B9M A;  1FOK A;  3PFI A;  2H1L A;  1S8N A;  2AHQ A;  3TGN A;  3IWZ A;  3KYL A;  3HOU J;  2XAS A;  4KIG A;  4ZTJ A;  1ON2 A;  2CJJ A;  1PUE E;  1V4R A;  2H1K A;  2GA2 A;  4C9Y A;  2GLO A;  4ENJ A;  4HV6 A;  2X1E A;  1Y8Q B;  3ONQ A;  2GWR A;  2VQC A;  1MZB A;  3PQJ A;  4PZJ A;  2F5V A;  4L0Y B;  1SFK A;  3KCC A;  2OPT A;  4YFK F;  4GCV A;  1R1T A;  1PP7 U;  2PMZ N;  5FD6 A;  2HKX A;  2QWW A;  2F48 A;  3CP2 A;  4IJA A;  3ZMT A;  4BH9 A;  3GFM A;  3H9J A;  2H6B A;  4CYC B;  4R79 A;  3JAM R;  3IKV A;  3PQK A;  4XOR A;  1IUF A;  2LOO A;  1GXQ A;  1H9G A;  3K9T A;  2OV7 A;  1HDP A;  2Q2E A;  4IF4 A;  3K4J A;  3I4M J;  1WVR A;  4HV5 A;  2ZXI A;  3ZQL A;  5ILU A;  2DPD A;  2EPF A;  2VXZ A;  5DUK A;  1AKH B;  3C7J A;  4AM3 A;  3UKG A;  1VFC A;  2B9S A;  1T39 A;  3VB2 A;  1V5E A;  1IN7 A;  1VTN C;  1BOA A;  1JKO C;  1MBE A;  2EQR A;  1SD4 A;  5DUI A;  5FGM A;  2E7X A;  4OAZ A;  2JA7 J;  3BR1 A;  4HBL A;  2A6T A;  1Z3Y A;  2ELJ A;  3OIQ A;  2NYX A;  2XSJ C;  4U88 A;  3G73 A;  4XKB A;  3Q0V A;  5LHH A;  3OSG A;  2XGC A;  1YJN I;  3F8N A;  5ED4 A;  5JHU A;  2VT3 A;  2FEZ A;  5KAF C;  4XID A;  4XMY A;  5D8K B;  1XCV A;  3E6M A;  4S04 A;  2JPC A;  5IYB J;  1NG6 A;  2P4W A;  5TGT A;  3CO6 C;  1CF7 A;  3B02 A;  4Q48 A;  3EPZ A;  5GTI C;  1GUU A;  2O9L A;  4NHJ A;  1YE9 A;  2QCO A;  4PDK A;  4QIW N;  2K7L A;  1IN4 A;  5EDN A;  3ERE D;  3VYT B;  1D8J A;  2PX9 A;  2JZY A;  4YFX F;  1W0T A;  2CYY A;  4JOM A;  3FMQ A;  4KMU X;  2VE9 A;  2VJ4 A;  2ZFU A;  4CDG A;  2KZV A;  5KNL A;  4B3X A;  5FFX A;  2EZI A;  3CF5 F;  1QPM A;  2HNH A;  3RYR A;  2UUZ A;  3V4G A;  2BY2 A;  3FF5 A;  2CGP A;  1X4P A;  1OR7 C;  1QVU A;  2NS8 A;  4BS9 A;  4G12 A;  4AIH A;  1I6X A;  1OCP A;  4EJO A;  2FQ4 A;  4NC6 A;  1WSU A;  1X3W B;  2HWV A;  1S9H A;  3JAM Z;  1BJA A;  1FWZ A;  2VKH A;  5IOY A;  3HSE A;  3J7Z I;  3JRH A;  4C2U A;  3GEZ A;  2DJI A;  1PYV A;  3CJT B;  3HRT A;  3K69 A;  4N9I A;  2P0W A;  2R4G A;  1KQ9 A;  2R7S A;  4M6V A;  2MBF A;  4AYB A;  4DQ2 A;  1T95 A;  2R7Z J;  2X51 A;  4CZZ A;  3RQI A;  1E0E A;  1PJR A;  1IAW A;  1WHU A;  4JX6 A;  4ZJZ A;  3OOP A;  5B5E C;  2XAJ A;  1X1A A;  3D5S C;  4E7K A;  2YR2 A;  3QP5 A;  4EM0 B;  1YFH A;  1N78 A;  1DU6 A;  2L7M P;  3S1N J;  3P7N A;  1YHQ I;  5DCM A;  2P5L C;  3BG5 A;  5D4R A;  4KIS A;  4GXO A;  3MKW B;  2PEX A;  4HEA 2;  3FXU A;  1WRJ A;  4BDZ A;  2XKO A;  3ABU A;  3OIO A;  3PO2 J;  3HHH A;  1AOY A;  3S2H J;  5IT3 A;  4MQV A;  4EGZ A;  5ICG A;  1JT0 A;  5DM7 F;  3I5U A;  2HOE A;  2L2O A;  4N0B A;  3SEZ A;  2FXA A;  1U2W A;  1GV5 A;  3CLQ A;  1MNM C;  4RM3 A;  1EH7 A;  1KZH A;  2QQA A;  2EZH A;  3A03 A;  3H5R A;  4KIT B;  2MAB A;  1Y1W J;  5BMZ A;  2ISZ A;  3BJ6 A;  4HAM A;  3SFZ A;  2TDX A;  1MJB A;  1UG0 A;  4IHS A;  3RYP A;  5M5W J;  2EFO A;  2GBY A;  2XF6 A;  3T8T A;  5L3B A;  2OTL I;  4IHY A;  2AO9 A;  5IYD J;  4LLG F;  3J81 K;  1WQ2 A;  4R1H A;  3EYY A;  1YS6 A;  2G7H A;  2E7W A;  1FIP A;  5E8G A;  3BQZ A;  2HS5 A;  4ON0 A;  1XMX A;  3H36 A;  2HKO A;  2WB1 N;  4HNT A;  1ZQ3 P;  2M45 A;  3F3X A;  1MMG A;  3SYT A;  4IQJ A;  3EUA A;  2KT0 A;  3FMS A;  3KP6 A;  3MZY A;  1G2H A;  2OBP A;  3A52 A;  3OV8 A;  5BPD A;  1FT9 A;  2MVT A;  1VI0 A;  2P5V A;  1RRJ A;  1K83 J;  3HL2 A;  1V3F A;  1BI2 A;  1O3T A;  4I76 A;  1Z67 A;  1P92 A;  5HDG A;  2E1N A;  1HKS A;  2V4J C;  3M4O J;  2KDZ A;  3HOV J;  1WZ2 A;  4GYI A;  1KA8 A;  2H6C A;  4B48 A;  1BA5 A;  3HBL A;  5BQT A;  1XMK A;  2HOT A;  2GOM A;  1FZP B;  1LKX A;  2L4M A;  1LPQ A;  3J80 Z;  3KZI C;  4UUS A;  3KEO A;  3RZD J;  1IN5 A;  4FT8 A;  4C2T A;  4J01 A;  1D8K A;  5JLW A;  4L9V A;  4I6Z A;  4OMY A;  1ZAR A;  2F5D A;  3FK7 A;  3TOB A;  4ZYG A;  5KVR A;  3PIO F;  2XVC A;  5ICF A;  1G6N A;  2MUN A;  2WAQ N;  3CD6 I;  3HOX J;  1W0U A;  1ZK8 A;  4LG0 B;  1JGS A;  4MIM A;  3FXQ A;  3I4N J;  4RGS A;  5HLH A;  3R0J A;  2V9V A;  3Q3S A;  1YW9 A;  1MBG A;  3B6A A;  4LJZ F;  2JSP A;  1FOX A;  5JFR A;  1Z6R A;  3Q9V A;  1T0F C;  2Y31 A;  2D5V A;  3OYD A;  1VQ8 I;  2WBM A;  1QBJ A;  2EIL H;  1ZN2 A;  2ZME C;  5GPC A;  4V2G A;  1WCM J;  1K79 A;  4XLH A;  1HST A;  3GYH X;  2RNG A;  1YTY A;  3EQL F;  1FBS A;  1SVM A;  2H09 A;  5HS8 A;  2DFE A;  4LB6 B;  5E3N A;  3MVP A;  5EGO B;  1R5G A;  2OJE D;  2R7T A;  2F2E A;  5M3M J;  2XIG A;  4AUX A;  1ERD A;  3ASN H;  5J47 A;  2W1O A;  1X4O A;  2NAZ A;  3EYI A;  2NOG A;  2FML A;  3SDG A;  2XKP A;  3BG6 A;  4P1W A;  3WTS C;  4FQG A;  4U87 A;  2GQQ A;  2G9W A;  4WF2 A;  3DBL B;  3BY6 A;  1HW2 A;  1Z77 A;  3G1L A;  1BR2 A;  3WGI A;  1OQY A;  1VQ9 I;  4QPQ A;  2XAH A;  2R0Q C;  2VJI A;  1B8I A;  3OOU A;  4AU7 A;  3O8H A;  3A01 A;  1SFX A;  5M5X J;  3GZN B;  4HZF A;  4CXF A;  2OZ6 A;  1IRZ A;  2DTZ A;  1IO2 A;  4PJN A;  1UHM A;  1P2F A;  5K5O A;  4TV7 A;  2X85 A;  3FM3 A;  1Z91 A;  2A05 A;  4QWQ A;  5ILS A;  3S3O A;  3C2G A;  4GRI A;  1DUX C;  1A04 A;  1VQP I;  3EUH C;  1J59 A;  2V1U A;  1PDN C;  1XGN A;  4DYQ A;  1STZ A;  5L3E A;  1QHG A;  4CGZ A;  2VI6 A;  2FSW A;  2XPV A;  3LQQ A;  2DI3 A;  1PUF A;  2DPU A;  4OIQ F;  5ILV A;  3I9V 2;  2N8G A;  1OR7 A;  1D1B A;  5EG0 B;  1RC9 A;  4D9J A;  3V8L A;  4F7Z A;  2O8X A;  3CCQ I;  1FSH A;  1J0R A;  2BW3 A;  1WH5 A;  1W4M A;  4QPO A;  5HOO A;  1KU2 A;  1P4W A;  2BY0 A;  2X6Y A;  3LL7 A;  1IXS B;  4AVZ A;  2CV2 A;  2FE3 A;  2R5Z B;  2VBW A;  3M8F A;  4FAS D;  3E5U A;  3OYH A;  2DA1 A;  3TO6 A;  3WE2 A;  1R5H A;  3HC7 A;  3JR9 A;  2NNY A;  1FYL A;  1V54 H;  3HRU A;  3HRM A;  1YX5 A;  2BY1 A;  3J80 K;  1DP3 A;  1QZY A;  3O6B B;  2M4G A;  2Z2S B;  3UNG C;  3E6C C;  1X1C A;  5FRO A;  4IXA A;  2FMY A;  1BC8 C;  1ORK A;  5CVJ A;  4P9F A;  4IEJ A;  2ESH A;  4Y52 J;  4I0A A;  1AU7 A;  1HKT A;  4EJW A;  4IOC F;  1V5G A;  2DA5 A;  1SAU A;  2EIM H;  2F4O B;  1C0W A;  4HG2 A;  5C3E J;  2JUG A;  3QRF F;  3OYB A;  1RUO A;  1GDT A;  3F0C A;  3BLY A;  2LTP A;  1JXS A;  1QHH D;  1UMQ A;  1WJA A;  3ZXS A;  3CO7 C;  2DO7 A;  3CLO A;  3BTC A;  1X1D A;  2XGD A;  3C1D A;  2VPR A;  2HOS A;  3MZ8 A;  2KJB A;  4J19 A;  1UG2 A;  3FXM A;  3X2Q H;  2VE8 A;  5CVV A;  3PJR A;  2EJR A;  1RET A;  2OC6 A;  3OSF A;  4G6D A;  3OL4 A;  3O2P E;  1V55 H;  2QUF A;  3LSJ A;  5D5U B;  2IA0 A;  4RLF A;  3R61 A;  3I59 B;  4LIU A;  4LLL A;  4KT6 A;  2WWY A;  2K9Q A;  2R5Y B;  4ZDO A;  2OF7 A;  2KLO A;  1MDM B;  2PMU A;  3CMY A;  4A3M J;  1R4M B;  2IGM A;  1UST A;  2X48 A;  1P6R A;  4A5M A;  3N97 A;  5GPA A;  4M9X A;  1FBQ A;  2D1V A;  3L2U A;  3CCM I;  1D5V A;  3HUG B;  5FKK A;  3LMM A;  1XS9 A;  2MLK A;  3H92 A;  2EIN H;  2K4B A;  5EEH A;  2DW4 A;  2TRT A;  2DOE A;  4MFD A;  3ABT A;  1SAN A;  1ACI A;  3GXO A;  1K4S A;  4XLC A;  2MD5 A;  3K10 A;  5C4J J;  2AXT C;  1JKQ C;  1X3Z B;  3CJQ B;  3VPR A;  2R7O A;  1VQL I;  3TDU C;  1H0M A;  3WTU C;  1J2X A;  3ABM H;  3DXJ F;  3CES A;  1FTZ A;  2QZ8 A;  5IOZ A;  3FXK A;  1MW7 A;  3LST A;  4OU0 A;  4DYC A;  3M3Y J;  4LOC A;  2DA7 A;  2R7F A;  3CMM A;  5B3S H;  4FX0 A;  3DKW A;  3IV5 A;  3KEQ A;  1XGS A;  2DMP A;  1QU3 A;  4EGY A;  3ZOB A;  2P7C B;  4XLA A;  2FOW A;  5E79 C;  4LK0 F;  2QEX I;  1ETX A;  3W2V A;  1EH6 A;  1TQP A;  1MD0 A;  2KDO A;  1APL C;  3MQ0 A;  3MFK A;  1ZEL A;  2HYJ A;  3ZPL A;  2XPU A;  3ZN0 A;  2R7X A;  4BDY A;  4Q5S F;  3BCA A;  4IRH A;  2W00 A;  3QPL A;  2JSC A;  1SFU A;  2A61 A;  4M74 A;  2JRT A;  3RSN A;  2R7R A;  1RQ6 A;  3RPU A;  4XQF A;  2Z3Y A;  4M3G A;  3DFG A;  3KET A;  3T0Y A;  2VBZ A;  3IH2 A;  5F0C A;  2GXA A;  3WG9 A;  3WHB A;  3KYD B;  1ETQ A;  2ZME A;  4MLO A;  4M9Z A;  3WG7 H;  3I56 I;  5C44 J;  1L0O C;  2M7B A;  3E0J B;  4WCG A;  3SHF A;  4A0Y A;  3L2R A;  2QKL B;  3CUQ C;  4C3J J;  3S1M J;  3QOD A;  2V1D A;  4BHB A;  4YIR X;  4GYG A;  4YG2 F;  2VIX A;  3F9K A;  1ZTR A;  3S2W A;  5HNH A;  4BE0 A;  2VAS A;  4BEH B;  3N4M A;  2LYC A;  4M3D A;  4CCJ A;  5LLQ A;  2VL8 A;  1MJ9 A;  3U21 A;  4HRI A;  1ZRE A;  2ADU A;  5LGT A;  3S3M A;  4V2F A;  1MMS A;  2QBY A;  5E8I A;  3IUO A;  4RGR A;  2VKE A;  5HLT A;  5K7H A;  1Y6I A;  1XSV A;  4KIB A;  1R23 A;  2F4M B;  3CCE I;  3FXJ A;  2ID6 A;  1MH4 A;  1S7A A;  1FOY A;  5LEJ A;  3W2A A;  4HST A;  3BR3 A;  2RC4 A;  3ZQ7 A;  4BL0 B;  4C2M J;  1HKQ A;  4QLC U;  1VQ7 I;  1W5T A;  5TIS C;  5E3M A;  3PIP F;  4WXC A;  2ZXH A;  5BNG A;  2RQQ A;  2XDV A;  3A0B C;  3W2W A;  2X6O A;  3DBH B;  5DD4 A;  4NQW B;  5FKN A;  2L01 A;  2HXO A;  2PLY A;  4RGU A;  4KN7 X;  2BHY A;  1X1P A;  2ZME B;  5CJ9 A;  2W7N A;  1D5Y A;  2ZJP F;  2K9M A;  3RTR A;  3HPH A;  1XPX A;  1JHH A;  1UAA A;  1G59 A;  3ASO H;  3LSG A;  4ASN A;  4CCK A;  2STW A;  4G7Z F;  1F43 A;  1FJL A;  2W48 A;  4LMY A;  2YX7 A;  3A02 A;  5CQE A;  2PFB A;  1REP C;  1J09 A;  3MEX A;  1XGM A;  2RGV A;  4JX4 A;  3RKY A;  3CDL A;  3LAP A;  3HYI A;  4U0W A;  2VJ5 A;  1WGX A;  3KFW X;  4ESB A;  5L3F A;  2NS0 A;  2FNA A;  2LF8 A;  3FHZ A;  2DFF A;  3I3L A;  2HZD A;  2DDA A;  5HOD A;  3E1S A;  2EWN A;  4B47 A;  1OKR A;  1MSF C;  1TW3 A;  2QBY B;  3KPH A;  1MJA A;  3HHG A;  1B6A A;  4Y4R A;  4ENN A;  4X0G A;  4MEX F;  2F5E A;  4L0Z B;  2ICW G;  2LY9 A;  3GLX A;  3HXL A;  2OTJ I;  4G6T B;  2LK2 A;  2A6E F;  3IRR A;  4DBR A;  3KZY A;  1VZ0 A;  3IL2 A;  4A93 J;  3OYJ A;  2IT0 A;  3JRB A;  2WY8 Q;  2LKX A;  2FBH A;  2HPM A;  3CCJ I;  2JVG A;  2P6T A;  3JTH A;  3J81 R;  3P9K A;  4B44 A;  2CUZ A;  4F3Q A;  2KJC A;  1IDZ A;  5EF6 A;  1E17 A;  2XAU A;  3LAJ A;  1R22 A;  1XTA A;  3ELK A;  5H2F C;  3IRQ A;  3WTZ A;  1E3P A;  2L4A A;  2W57 A;  4OIR F;  1AKH A;  3PO3 J;  1UEL B;  1O3S A;  5EEG A;  1HC8 A;  5K5Q A;  1B9N A;  1SC7 A;  4A3C J;  1ODD A;  1HA8 A;  4CHU A;  2M87 A;  1LNW A;  2KIF A;  2E36 A;  1WH7 A;  4DIQ A;  3MWM A;  3HSF A;  1K7A A;  1BIA A;  3GF2 A;  2E1O A;  3BZC A;  3B73 A;  4F92 B;  1TWH J;  1QZE A;  1Y39 A;  1YIO A;  2XGX A;  2HXI A;  2JUC A;  3W6K B;  4AIJ A;  2WAF A;  3H0G J;  5FLM J;  3OS0 A;  2CH0 A;  3G71 I;  5IP6 A;  4BNC A;  3BG9 A;  2DJN A;  2NVQ J;  2M5W A;  4DNC A;  1D0X A;  1YLF A;  3SZG A;  5HDN A;  3JRF A;  2R7W A;  1DP7 P;  2HVR A;  2KIU A;  4ZDP A;  3K70 D;  1DDN A;  2KHM A;  1X2M A;  4JBA A;  2QQ9 A;  3S93 A;  3ZN1 A;  2OU2 A;  1RZ4 A;  1Y8R B;  1AHD P;  4N4N B;  1LVA A;  2K9N A;  2JPB A;  4IHV A;  1FMV A;  2LD5 A;  3G1O A;  3OIP A;  2CW0 F;  5FRM A;  2G7U A;  2VLA A;  1FIA A;  1Y0N A;  5DYM A;  3D5L A;  3ML6 A;  3TP0 A;  5FO5 A;  5E1Z B;  2W84 A;  3J7A W;  3PNV A;  2QM3 A;  3E97 A;  2CG4 A;  3GCM A;  3KEY A;  2KPM A;  3HM5 A;  1NTC A;  1S6L A;  2BV6 A;  3JTG A;  3I71 A;  4L9J A;  2GXB A;  1UJ8 A;  2AXL A;  3J81 Z;  2V6E A;  3L7W A;  1W7P D;  2DT6 A;  1U9O A;  1XG1 A;  3L09 A;  3W6J B;  4F93 B;  5J6X A;  3DTE A;  4IQ4 A;  3WU0 A;  4LLN A;  1Z7U A;  1HOM A;  4RAY A;  2HVS A;  2O7O A;  3UR3 C;  1SMY F;  2H94 A;  3GLL A;  2P8T A;  2IPQ X;  5IY5 H;  3FDY A;  1UCR A;  4ZYH A;  1IF1 A;  4AID A;  4XN0 A;  2RV8 A;  2HFH A;  1Z9C A;  2QVO A;  2GIV A;  3HKZ N;  2MG4 A;  5B1A H;  4DGW B;  3DWL E;  3K70 C;  2LG4 A;  4BU2 A;  4EJV A;  3IC7 A;  2K02 A;  3FKI J;  2BEO A;  2LP0 A;  4OIN F;  2LRD A;  3JRI A;  1IZ1 A;  4B43 A;  3VEP A;  5JLX A;  2DMT A;  3E6B A;  1OJL A;  3FK6 A;  2PJR B;  2NVU B;  1POG A;  2VBX A;  3K1M A;  5F1R A;  1O3Q A;  3BTL A;  4EAT A;  2XAG A;  3I64 A;  4XK4 A;  3E3V A;  5F0F A;  3TL4 X;  4B8X A;  3BZK A;  1EH8 A;  2UV1 A;  4Y13 A;  1SD7 A;  4E6K G;  3KP5 A;  1G3Y A;  5GAH J;  4KJZ A;  1ZRF A;  3LSH A;  2W25 A;  1EV7 A;  3DCF A;  4IRI A;  1FYK A;  3CCV I;  2EV5 A;  3R60 A;  1YJW I;  2OCC H;  2DU9 A;  3I55 I;  2HYG D;  1P4A A;  4EEF G;  2BOL A;  4PJJ A;  1X3U A;  1W36 D;  1LDD A;  3QU3 A;  4ZYD A;  5EJC A;  5FLX K;  3ZR8 X;  3VSK A;  2M3A A;  3OYM A;  2HDD A;  2E2J J;  2K40 A;  1JTY A;  2A68 F;  5FB2 A;  2M30 A;  2CFO A;  4I7H A;  4RM2 A;  2L9V A;  5A2Q K;  3LFU A;  2K5C A;  1ZGW A;  4PFP A;  3S1Q J;  3WGH A;  5JI6 A;  1YOV B;  2YSR A;  4XRS A;  3FKJ A;  2VN2 A;  1OYW A;  2HTS A;  3J80 R;  2M2E A;  3E5X A;  2O0Y A;  4HX7 A;  1FBU A;  1D1C A;  3BTI A;  1ZG5 A;  5CVU A;  5AIP A;  2LSO A;  3SDB A;  1HSJ A;  4PUS A;  2Z16 A;  2Y0S A;  1G3S A;  3HOS A;  4XON A;  3MZH A;  3B6C A;  5AIQ A;  1O4X A;  2A07 F;  3BT9 A;  4M72 A;  1Z6T A;  2BXY A;  2Z1D A;  3CUQ B;  2C6Y A;  4XKC A;  4MFE A;  3ZQI A;  1U78 A;  3I54 A;  4IO9 F;  5JHF A;  2DXI A;  3HZJ A;  1ENH A;  2JMW A;  4D7N A;  1ZLJ A;  2O03 A;  1O7F A;  3FX3 A;  3HOZ J;  2ZKZ A;  1GHC A;  1XB4 A;  3WGG A;  4RMN A;  1W36 C;  3Q0U A;  2R3S A;  3BDD A;  1YI2 I;  3AAF A;  2EIJ H;  3LSK A;  2OQR A;  1K6Y A;  3M8J A;  4A3J J;  2IGN A;  2FD5 A;  3VYS B;  4BXF A;  2DQR A;  2KIQ A;  2JQ7 A;  1VQO I;  4XM3 A;  1J7K A;  4N9H A;  2A5Y B;  3DEE A;  4LG0 A;  4CA0 A;  3L1P A;  1HQC A;  2ZB9 A;  1RUN A;  4CYD A;  3QP6 A;  3JSP A;  4J00 A;  2UXN A;  3ZQG A;  3HEF A;  4RAF A;  5E18 F;  1P7J A;  3DKY A;  4XRF A;  2OCE A;  2I10 A;  1Y0U A;  2Y9Y A;  2OAZ A;  4YFN F;  5K7F A;  4LD5 A;  2DA2 A;  1IG7 A;  4KN4 X;  5L3D A;  1T8I A;  3K4K A;  1R00 A;  2AQF A;  1YIT I;  1ETK A;  2L7F P;  1AWC A;  5GP9 A;  5LFA A;  2Z9O A;  2DBB A;  1A6Q A;  4ESF A;  5EGO A;  3PNT A;  3GFJ A;  4L18 B;  1OCZ H;  4FE4 A;  1ITY A;  2QF7 A;  1OPC A;  4HX8 A;  3NWT A;  4WX9 A;  1L3L A;  2H8R A;  1X2N A;  1IN6 A;  3F6O A;  2EV6 A;  3G2B A;  2QSG X;  1F36 A;  3BQY A;  3ZMS A;  2UZK A;  1T2K A;  4IKF A;  2VC0 A;  4G7O F;  4EVI A;  2QQ8 A;  2BXZ A;  1JUS A;  2HDW A;  2JA2 A;  4M3F A;  3CC7 I;  1OCO H;  2X1C A;  3M9A A;  3TDZ C;  4X1E A;  2HYF A;  2DA3 A;  3F8B A;  3CJR B;  1R58 A;  1F1Z A;  1WJB A;  3E7L A;  5GTH C;  2IGO A;  3LNQ A;  1P9Q C;  1F4K A;  1DPU A;  1VQ4 I;  1XDU A;  2BHZ A;  4AC0 A;  1A5J A;  2DK8 A;  5BPI A;  4OMZ A;  3RIR A;  1U3E M;  1YYV A;  5CKT A;  1FYM A;  1Y56 A;  3FBN B;  3BRO A;  2VBY A;  2H8W A;  1TWA J;  2XRL A;  1S29 A;  2X0L A;  3EET A;  4RGX A;  3LA3 A;  1TNT A;  4BAC A;  5EG0 A;  2LFB A;  2WAE A;  1UHW A;  1LFP A;  2DOF A;  1HW5 A;  2M35 A;  1H9T A;  2G0E A;  3K2A A;  4FX4 A;  1I27 A;  1ZG3 A;  3QPH A;  1LFU P;  1XN7 A;  2ID3 A;  4L9N A;  3L2Q A;  1XD7 A;  4UHT A;  2R5Z A;  4HQM A;  2ZCW A;  1ZR2 A;  1XSX A;  4BY7 J;  4ENM A;  4A5N A;  5IYC J;  3ESW B;  2LF7 A;  4E4H A;  1XCB A;  2DT7 B;  1B72 B;  1OCC H;  1G4D A;  3PUF A;  5FLV A;  1RKT A;  1NG7 A;  1BC7 C;  2IJL A;  2X6X A;  3FXO A;  2JJ7 A;  2GXG A;  3RI4 A;  1R6R A;  3LSP A;  1F9N A;  4A6D A;  2PMZ A;  3NQO A;  5D6F A;  1JKP C;  2DMN A;  1S7O A;  3BR0 A;  5B66 C;  3ZGK A;  2WA0 A;  2ZXW H;  4IRG A;  3FBI B;  2LY1 A;  3RDI A;  3VDX A;  2ZJQ F;  5F08 A;  2HU9 A;  2ACJ A;  3BZ6 A;  2R92 J;  2MZ4 A;  1IV8 A;  2VPL A;  4MQ9 F;  2MD0 A;  1TW2 A;  2FF4 A;  4AVP A;  1S3J A;  3IH3 A;  4EJT A;  3S8P A;  3LOC A;  1BW6 A;  3AFH A;  4XSX F;  3QWL A;  4RLQ A;  4PJM A;  4HF1 A;  1FPQ A;  4FHT A;  3CTA A;  3M07 A;  4RB2 C;  3PM1 A;  2MLG A;  2Y75 A;  1SVO A;  2LKS A;  4KIF A;  4U0V A;  5DS9 A;  5ICC A;  1I50 J;  1W7P A;  1OIS A;  2I5U A;  5F6F A;  3MAJ A;  1WJE A;  3I59 A;  1XMA A;  2CS3 A;  3DPU A;  2JWT A;  2R5Y A;  1ZRD A;  2WC2 A;  1MDM A;  1RR8 C;  1JHF A;  4CH7 A;  2MSY A;  4HNU A;  2QEN A;  3QU6 A;  1CQT A;  3M7G A;  2DLL A;  5EEA A;  1TT0 A;  1BL0 A;  2M4K A;  4GFB A;  3HUG A;  3LA2 A;  3V7R A;  1QO0 D;  2VJJ A;  3GWZ A;  1XDS A;  2PI0 A;  5D5W B;  1O3R A;  1ETY A;  3TBI A;  4NB5 A;  4ZYA A;  3OMY A;  4BBR J;  1KQ0 A;  3ERM A;  1OMI A;  2YU9 J;  3S1R J;  3F23 A;  3RJP A;  3CUO A;  3FHN A;  3DTK A;  1YQA A;  3I0T A;  3ROU A;  1TC3 C;  4OIP F;  5CYV A;  3OYL A;  1OLT A;  2XAF A;  4EM1 A;  2M8G X;  4XRS G;  5E3O A;  1SFE A;  2NS7 A;  1IV6 A;  3I58 A;  2DK5 A;  2HI3 A;  1YS7 A;  3M8E A;  3CCU I;  1R71 A;  3G4S I;  1HXD A;  1BW5 A;  4S05 A;  2CQQ A;  3WTW C;  1T56 A;  1UFM A;  1W7P B;  2IP2 A;  3GX4 X;  2B7E A;  4A0Z A;  1R49 A;  4XLP F;  2IXS A;  2LMD A;  4A6E A;  4A3B J;  2DN0 A;  1TTY A;  1BM9 A;  3PSF A;  1E3O C;  4IX7 A;  2CV0 A;  3K6G A;  1W5C C;  4XKV A;  3HOW J;  1UHS A;  3GTQ J;  3IAM 2;  1X58 A;  3HPG A;  2P6S A;  3ISP A;  3BC8 A;  1TNS A;  5IT9 K;  1Q1V A;  4BQO A;  4XNF A;  3ECO A;  1BR4 A;  3BTJ A;  4UB8 C;  1TT5 B;  4AIK A;  2CUE A;  3OYA A;  5M5Y J;  2K9S A;  2LKP A;  2ISY A;  5CVR A;  1WJ5 A; 
#chains in the Genus database with same CATH homology
 3HIF A;  5D5X B;  5HS7 A;  5K5R A;  4RS8 A;  4ZZL A;  1PP8 F;  5E1W A;  3WU1 B;  4HF2 A;  1LEB A;  2FBI A;  2IA2 A;  2BE5 F;  2HEO A;  5DD8 A;  1GVJ A;  3SZP A;  2OQG A;  3KP2 A;  4BYY A;  5HS9 A;  2YX4 A;  3F72 A;  6PAX A;  3CDH A;  4LGW A;  1FX7 A;  3V8K A;  4I2O A;  2X4H A;  1BI3 A;  2EA2 A;  3REO A;  2MA3 A;  2XAQ A;  3GUD A;  3RKW A;  1BIB A;  4P5O A;  4NQW A;  1T0F A;  3L00 A;  3FMR A;  1KU9 A;  2W85 A;  3FZV A;  1T6S A;  4R8H A;  2STT A;  1WKM A;  5LHI A;  1I1S A;  4M9S A;  4BXU A;  4EM2 A;  2Z33 A;  1IUY A;  3M1E A;  1LJ9 A;  2ZBK A;  4UV8 A;  3GZ5 A;  4KFC A;  2NNN A;  4AD9 A;  2ESN A;  2Q8K A;  4ESJ A;  2A6H F;  1Z05 A;  2PQ8 A;  2ZJ2 A;  4MNU A;  2VOO A;  2COM A;  2HQN A;  4WXH A;  2K86 A;  5LBQ A;  2P7V B;  2J5O A;  2LDU A;  5AON A;  5E20 A;  2ZO4 A;  4UUV A;  3TKY A;  1TQM A;  3EUH A;  2VC1 A;  4KNY A;  3HOT A;  5TRD A;  2L54 A;  2OA4 A;  1YO5 C;  1I5Z A;  4U7B A;  5D8L B;  2JT1 A;  4LFU A;  3HRS A;  3V7S A;  4OIO F;  2FBK A;  2H27 A;  1KGS A;  1RIO H;  1YW8 A;  1YW7 A;  5HVQ C;  3P9I A;  5E17 F;  4EQQ A;  3JW4 A;  2RNJ A;  3F6V A;  1ON1 A;  4MTE A;  3G3Z A;  2BYV E;  1U6G A;  2DFI A;  4KDP A;  3LFK A;  2YPR A;  1R1U A;  2GA1 A;  2EFW A;  2UWM A;  3SZT A;  1D3Y A;  4L9T A;  1W5S A;  2DQL A;  1G3W A;  2XRO A;  4KUM A;  1U5T B;  1IXC A;  3CJN A;  1I1G A;  5CVI A;  2HR3 A;  2RDP A;  3KLO A;  5FD5 A;  2QQB A;  5FLX Z;  1J75 A;  2MC3 A;  1ZAO A;  4G8X A;  5J8F A;  4BHC A;  3TQN A;  1B1B A;  3TO7 A;  5A2Q Z;  4ZH4 F;  1LB2 A;  4M73 A;  3Q9S A;  2FNP A;  2XUB A;  3LA7 A;  2RQP A;  3F22 A;  4IHT A;  2EFN A;  4G94 A;  3KLN A;  1LEA A;  3WTV C;  4MEY F;  5DEQ A;  2DTR A;  4GO1 A;  4MTD A;  3RKX A;  3DF8 A;  3ECH A;  1O7L A;  4HDV A;  4A2U A;  2FOK A;  1P4X A;  3I4P A;  2FU4 A;  3DPT A;  4HQE A;  3QPT A;  4M6X A;  2EV0 A;  3BWG A;  3NRV A;  1IW7 F;  5HLI A;  4P55 A;  3KZZ A;  2DT5 A;  2GZW A;  3TOA A;  2LNB A;  4UVC A;  3U9G A;  4H0E A;  3F21 A;  3BJA A;  1YG2 A;  3D0S A;  4HF0 A;  3DEU A;  3FXR A;  3ULQ B;  2M8E A;  3Q5F A;  4RB3 C;  2O6G E;  2MH9 A;  4HDU A;  2UXX A;  3CUQ A;  1KYW A;  3WE3 A;  5ERI A;  4L5J A;  4UXN A;  1USS A;  2IVM A;  2ZNY A;  4IVN A;  3SQN A;  2E1C A;  4ZZD A;  1MKM A;  4RAZ A;  4KT5 C;  5L3C A;  1F5T A;  4UVA A;  3RPQ A;  4WWC A;  4U0Y A;  2CWE A;  3F8C A;  4I01 A;  1ZH5 A;  1KU3 A;  4Z2Y A;  1FP1 D;  2D1H A;  3GO5 A;  3WTY C;  3TO9 A;  1CF7 B;  5JR3 A;  2HDC A;  5LGU A;  3V8J A;  1MGT A;  2PG4 A;  4JQF A;  4BAY A;  4HW0 A;  1K78 A;  1Z1D A;  4KA4 A;  3ZP5 A;  4HOB A;  1SMT A;  1O57 A;  1GXP A;  2V1X A;  3GZ6 A;  2O3F A;  5CLS A;  4D0P A;  2A69 F;  2K4J A;  4U7D A;  2ZXJ A;  2ZFW A;  1OYY A;  2MH2 A;  1ZYR F;  2PJP A;  5LEK A;  1ZGA A;  3VOE A;  4IPA A;  2CQK A;  5H6R A;  2GAU A;  2FRH A;  4O6J A;  3H3Z A;  4K2E A;  5DCM B;  4HYE A;  1R7J A;  4I0B A;  1K78 B;  2XHK A;  3L2C A;  2KKO A;  3I53 A;  4G6Q A;  3QAH A;  2D2W A;  2QYO A;  4GGG A;  5TJJ A;  4XBF A;  2P5K A;  1FP2 A;  5LGN A;  1IRG A;  4A0X A;  3KP3 A;  1UB9 A;  2W24 A;  4WXD A;  2CFX A;  4G9Y A;  2F5C A;  1TLH B;  3JAM K;  4BHP A;  4CO8 A;  3NEU A;  3DV8 A;  3FWE A;  2EA4 A;  3QOP A;  4Y15 A;  5FFZ A;  4XLN F;  2Z99 A;  5ICE A;  4RB0 A;  1RI7 A;  1BI0 A;  1IN8 A;  4EJU A;  2PBI A;  2HTJ A;  2IA1 A;  2M1B A;  1B4A A;  3J7A O;  5IT9 Z;  5LRR A;  5L3G A;  1U8R A;  2L3D A;  4ZYE A;  4EV0 A;  4P9U A;  2BBY A;  3DQV C;  4UVB A;  2HGC A;  4Y17 A;  2O61 A;  2V79 A;  1U5T C;  1QZZ A;  4JK1 X;  5D5V B;  2EK5 A;  5LRS A;  1ZRC A;  4I02 A;  3LWF A;  5DDG A;  3V7C A;  4YIF A;  1LQ1 A;  1K6O A;  4HX4 A;  4KMF A;  5BS6 A;  1E2X A;  3T8R A;  3KE2 A;  3K1P A;  1FNN A;  5K1Y A;  4A12 A;  3VFZ A;  3MCZ A;  1TBX A;  2Q0O A;  3R4K A;  3HTS B;  2KRF A;  4LK1 F;  2OD5 A;  1XGO A;  2EFQ A;  3BJO A;  4PGH A;  3GW2 A;  5DV5 A;  5D4S A;  2WV0 A;  2XRN A;  2YU3 A;  3E5Q A;  3H3U A;  1QGP A;  1T98 A;  3BOQ A;  4P96 A;  4RB1 A;  3IWF A;  2ETH A;  5HLG A;  4HA8 A;  3KP4 A;  3K0L A;  4ETS A;  4MGR A;  2ZNZ A;  5E1X A;  4E70 A;  2F5F A;  1LDK B;  1FSE A;  2VON A;  2Y48 A;  4AWX B;  1WI9 A;  3O3K A;  1T38 A;  1IRF A;  1WWX A;  5HDK A;  2VT2 A;  4PCQ A;  1FLI A;  3GFI A;  2AS5 F;  4WK8 F;  1SD6 A;  5H6Q A;  2WTE A;  4HLY A;  5D6E A;  3F8F A;  3L9F A;  3R0A A;  3BPV A;  2VOP A;  2DAO A;  3C3W A;  3BP8 A;  1R36 A;  1HW1 A;  4KIC A;  1J9I A;  2BGC A;  2RKH A;  2IRF G;  1JE8 A;  2PN6 A;  5J8C A;  4B09 A;  4KYW A;  2HZT A;  2ELH A;  3K2Z A;  5KK1 A;  1FY7 A;  4I09 A;  1XSD A;  2QLZ A;  1J5Y A;  1BN5 A;  4M6Y A;  2L02 A;  4L5I A;  2OZU A;  4Q4Z F;  2JTV A;  1SAX A;  5BOX A;  3KP7 A;  3R6S A;  4ENK A;  1R1V A;  1RNL A;  3P9C A;  1CGP A;  4O5V A;  2FA5 A;  3ZMZ A;  3T1B A;  2KIM A;  3ZMD A;  1BI1 A;  2PMH A;  5H20 A;  4YII A;  4BQA A;  5JVT A;  4EMS A;  1Q1H A;  4I98 B;  5LHG A;  2RVC A;  3GFL A;  1BBY A;  3DP7 A;  1SD5 A;  1TQI A;  1G3T A;  3HSR A;  3U1D A;  3GVA A;  3IHU A;  2A3S A;  4MHG A;  2HQR A;  2V6C A;  4Q47 A;  3SXY A;  4O3M A;  3IKT A;  4XSZ F;  2NRA C;  2RN7 A;  3HTU A;  1U5T A;  1KYZ A;  2FQ3 A;  4UNO A;  2Z5U A;  5DCF A;  1ZLK A;  3T5X A;  3ZMU A;  1ONV A;  2CSO A;  3WTX C;  4UV9 A;  3COA C;  2CO5 A;  4M71 A;  1ZGJ A;  1DPR A;  1HBX G;  2VOD A;  3DPL C;  4HLX A;  3JSO A;  1FC3 A;  2EFP A;  3WTT C;  1KU7 A;  3C18 A;  2IW5 A;  3WOD F;  3FM5 A;  2R7D A;  1IXR C;  1B59 A;  3U2R A;  1OYI A;  1ULY A;  1KQ8 A;  3EDP A;  3E6D A;  1LDJ A;  1QQI A;  1ZHF A;  3K1N A;  1ZG1 A;  2K27 A;  1QNT A;  1NHA A;  2D45 A;  4PGG A;  4G7H F;  2B0L A;  2J5P A;  2EB7 A;  3ZMV A;  4OOI A;  3BPX A;  3VOD A;  3F8M A;  3LQR A;  2Y0M A;  4LB5 A;  5F64 A;  2XV4 S;  4CIC A;  1B9M A;  1FOK A;  3PFI A;  1S8N A;  3TGN A;  3IWZ A;  2XAS A;  4KIG A;  1ON2 A;  1PUE E;  1V4R A;  2GA2 A;  4ENJ A;  4HV6 A;  2GWR A;  1MZB A;  3PQJ A;  4PZJ A;  4L0Y B;  3KCC A;  4YFK F;  4GCV A;  1R1T A;  1PP7 U;  5FD6 A;  2HKX A;  2QWW A;  4IJA A;  3ZMT A;  4BH9 A;  3GFM A;  2H6B A;  4R79 A;  3IKV A;  3PQK A;  1GXQ A;  1H9G A;  3K9T A;  4IF4 A;  2Q2E A;  4HV5 A;  5ILU A;  2DPD A;  2VXZ A;  5DUK A;  3C7J A;  1T39 A;  3VB2 A;  1VTN C;  1IN7 A;  1BOA A;  1SD4 A;  5DUI A;  5FGM A;  2E7X A;  4HBL A;  2NYX A;  4U88 A;  3G73 A;  5LHH A;  3F8N A;  5ED4 A;  5JHU A;  2VT3 A;  2FEZ A;  5D8K B;  1XCV A;  3E6M A;  4S04 A;  2JPC A;  2P4W A;  3CO6 C;  1CF7 A;  3B02 A;  4Q48 A;  4NHJ A;  4PDK A;  2K7L A;  1IN4 A;  1D8J A;  3ERE D;  2JZY A;  4YFX F;  2CYY A;  3FMQ A;  4KMU X;  2VE9 A;  4CDG A;  5FFX A;  1QPM A;  3RYR A;  3V4G A;  3FF5 A;  2CGP A;  4AIH A;  1I6X A;  4EJO A;  1WSU A;  2HWV A;  3JAM Z;  1BJA A;  1FWZ A;  3HSE A;  3GEZ A;  3K69 A;  3HRT A;  4N9I A;  1KQ9 A;  4DQ2 A;  2MBF A;  4CZZ A;  1IAW A;  3OOP A;  2XAJ A;  2YR2 A;  3QP5 A;  4EM0 B;  1YFH A;  3P7N A;  5DCM A;  2P5L C;  5D4R A;  4GXO A;  2PEX A;  3FXU A;  1WRJ A;  2XKO A;  3ABU A;  1AOY A;  3HHH A;  5IT3 A;  4MQV A;  4EGZ A;  5ICG A;  3I5U A;  2HOE A;  4N0B A;  2FXA A;  1U2W A;  1EH7 A;  2QQA A;  5BMZ A;  2ISZ A;  3BJ6 A;  4HAM A;  3SFZ A;  2TDX A;  1MJB A;  4IHS A;  3RYP A;  2EFO A;  3T8T A;  5L3B A;  4LLG F;  3J81 K;  1WQ2 A;  4R1H A;  3EYY A;  1YS6 A;  2G7H A;  2E7W A;  5E8G A;  2HS5 A;  4ON0 A;  2HKO A;  2M45 A;  3F3X A;  3FMS A;  3KP6 A;  3MZY A;  2OBP A;  3OV8 A;  5BPD A;  1FT9 A;  2P5V A;  1V3F A;  1BI2 A;  1O3T A;  5HDG A;  1P92 A;  2E1N A;  1HKS A;  4GYI A;  1KA8 A;  2H6C A;  5BQT A;  1XMK A;  1FZP B;  2L4M A;  3J80 Z;  3KEO A;  1IN5 A;  4FT8 A;  1D8K A;  4L9V A;  4OMY A;  1ZAR A;  2F5D A;  3TOB A;  4ZYG A;  5KVR A;  2XVC A;  5ICF A;  1G6N A;  4LG0 B;  1JGS A;  3FXQ A;  4RGS A;  5HLH A;  3R0J A;  2V9V A;  1YW9 A;  4LJZ F;  5JFR A;  1Z6R A;  3Q9V A;  1QBJ A;  1ZN2 A;  1K79 A;  1HST A;  3GYH X;  1YTY A;  3EQL F;  1FBS A;  2H09 A;  5HS8 A;  4LB6 B;  1R5G A;  2F2E A;  2XIG A;  2NAZ A;  3EYI A;  2FML A;  2XKP A;  3WTS C;  2GQQ A;  2G9W A;  4WF2 A;  3BY6 A;  1HW2 A;  3WGI A;  2XAH A;  1SFX A;  4HZF A;  4CXF A;  2OZ6 A;  1UHM A;  1P2F A;  5K5O A;  4TV7 A;  3FM3 A;  1Z91 A;  4QWQ A;  5ILS A;  1DUX C;  1A04 A;  1J59 A;  2V1U A;  1PDN C;  1XGN A;  5L3E A;  1STZ A;  4CGZ A;  2FSW A;  3LQQ A;  2DI3 A;  2DPU A;  4OIQ F;  5ILV A;  1OR7 A;  3V8L A;  4F7Z A;  2O8X A;  1FSH A;  1J0R A;  5HOO A;  1W4M A;  1KU2 A;  1P4W A;  1IXS B;  2FE3 A;  2VBW A;  3M8F A;  3E5U A;  3TO6 A;  3WE2 A;  1R5H A;  2NNY A;  1FYL A;  3HRU A;  3HRM A;  3J80 K;  1QZY A;  3O6B B;  3E6C C;  4IXA A;  2FMY A;  1BC8 C;  5CVJ A;  4P9F A;  2ESH A;  4I0A A;  1HKT A;  4EJW A;  1C0W A;  3QRF F;  1RUO A;  1JXS A;  3CO7 C;  2DO7 A;  3CLO A;  3C1D A;  2KJB A;  2VE8 A;  5CVV A;  2EJR A;  4G6D A;  3O2P E;  2QUF A;  5D5U B;  2IA0 A;  3R61 A;  3I59 B;  4LLL A;  2WWY A;  1MDM B;  2PMU A;  1UST A;  1P6R A;  4A5M A;  3N97 A;  4M9X A;  1FBQ A;  2D1V A;  1D5V A;  2MLK A;  3H92 A;  2K4B A;  5EEH A;  2DW4 A;  3ABT A;  3GXO A;  2MD5 A;  3TDU C;  1H0M A;  3WTU C;  1J2X A;  3DXJ F;  2QZ8 A;  3LST A;  4OU0 A;  2R7F A;  4FX0 A;  3DKW A;  3KEQ A;  1XGS A;  4EGY A;  2P7C B;  4LK0 F;  1EH6 A;  1TQP A;  1MD0 A;  3MQ0 A;  3MFK A;  3ZPL A;  3ZN0 A;  4Q5S F;  4IRH A;  2JSC A;  1SFU A;  2A61 A;  4M74 A;  2JRT A;  3RPU A;  2Z3Y A;  3DFG A;  3KET A;  3T0Y A;  2VBZ A;  3WG9 A;  2ZME A;  4M9Z A;  1L0O C;  4WCG A;  3SHF A;  4A0Y A;  3CUQ C;  2V1D A;  4BHB A;  4GYG A;  4YG2 F;  3S2W A;  3N4M A;  5LLQ A;  1MJ9 A;  1ZRE A;  2ADU A;  5LGT A;  2QBY A;  5E8I A;  4RGR A;  1XSV A;  4KIB A;  1R23 A;  5LEJ A;  1S7A A;  2RC4 A;  3ZQ7 A;  4QLC U;  1HKQ A;  1W5T A;  4WXC A;  5DD4 A;  2L01 A;  2PLY A;  4RGU A;  4KN7 X;  5CJ9 A;  2ZME B;  3RTR A;  1JHH A;  4ASN A;  2STW A;  4G7Z F;  4LMY A;  2YX7 A;  2PFB A;  1REP C;  3MEX A;  1XGM A;  2RGV A;  3RKY A;  3LAP A;  3HYI A;  4U0W A;  3KFW X;  4ESB A;  5L3F A;  2NS0 A;  2FNA A;  2LF8 A;  3FHZ A;  2EWN A;  1OKR A;  1TW3 A;  2QBY B;  1MJA A;  3HHG A;  1B6A A;  4ENN A;  4MEX F;  2F5E A;  4L0Z B;  3GLX A;  2A6E F;  3IRR A;  3KZY A;  3IL2 A;  2IT0 A;  2FBH A;  2P6T A;  3JTH A;  3P9K A;  2KJC A;  1E17 A;  3LAJ A;  1R22 A;  3ELK A;  3IRQ A;  3WTZ A;  4OIR F;  2L4A A;  2W57 A;  1O3S A;  5EEG A;  5K5Q A;  1B9N A;  1ODD A;  4CHU A;  2M87 A;  1LNW A;  2KIF A;  3MWM A;  3HSF A;  1K7A A;  1BIA A;  3GF2 A;  3B73 A;  1YIO A;  2XGX A;  3W6K B;  4AIJ A;  4BNC A;  2M5W A;  4DNC A;  1YLF A;  5HDN A;  1DP7 P;  2KIU A;  1DDN A;  4JBA A;  2QQ9 A;  3ZN1 A;  2OU2 A;  1RZ4 A;  1LVA A;  2JPB A;  2CW0 F;  2G7U A;  5DYM A;  3D5L A;  3ML6 A;  5FO5 A;  5E1Z B;  2W84 A;  2QM3 A;  3E97 A;  2CG4 A;  2BV6 A;  1S6L A;  3JTG A;  2GXB A;  3I71 A;  4L9J A;  2AXL A;  3J81 Z;  3L7W A;  1W7P D;  3L09 A;  3W6J B;  5J6X A;  3WU0 A;  4LLN A;  1Z7U A;  4RAY A;  1SMY F;  2H94 A;  2P8T A;  2IPQ X;  1UCR A;  4ZYH A;  1IF1 A;  1Z9C A;  2RV8 A;  2HFH A;  2QVO A;  2GIV A;  4EJV A;  3IC7 A;  2K02 A;  2BEO A;  4OIN F;  1IZ1 A;  3VEP A;  3E6B A;  2VBX A;  3K1M A;  5F1R A;  1O3Q A;  2XAG A;  3I64 A;  3E3V A;  4B8X A;  1EH8 A;  4Y13 A;  1SD7 A;  3KP5 A;  1G3Y A;  1ZRF A;  4IRI A;  2W25 A;  1EV7 A;  1FYK A;  2EV5 A;  3R60 A;  2DU9 A;  2HYG D;  1P4A A;  1X3U A;  5FLX K;  1LDD A;  3QU3 A;  4ZYD A;  2A68 F;  5FB2 A;  2M30 A;  4I7H A;  5A2Q K;  3WGH A;  5JI6 A;  2YSR A;  2VN2 A;  1OYW A;  2HTS A;  3E5X A;  2O0Y A;  4HX7 A;  1FBU A;  1ZG5 A;  5CVU A;  5AIP A;  2LSO A;  1HSJ A;  1G3S A;  3HOS A;  3MZH A;  5AIQ A;  2A07 F;  4M72 A;  1Z6T A;  3CUQ B;  2C6Y A;  1U78 A;  3I54 A;  1ZLJ A;  2O03 A;  1O7F A;  3FX3 A;  2ZKZ A;  1GHC A;  1XB4 A;  3WGG A;  2R3S A;  3BDD A;  3AAF A;  2OQR A;  2DQR A;  1J7K A;  4N9H A;  2A5Y B;  4LG0 A;  1HQC A;  1RUN A;  4CYD A;  3QP6 A;  3JSP A;  2UXN A;  5E18 F;  4XRF A;  1Y0U A;  2OAZ A;  4YFN F;  4LD5 A;  4KN4 X;  5L3D A;  1R00 A;  1AWC A;  2Z9O A;  2DBB A;  4ESF A;  3GFJ A;  4L18 B;  1OPC A;  4HX8 A;  4WX9 A;  1L3L A;  1IN6 A;  3F6O A;  2EV6 A;  3ZMS A;  2UZK A;  1T2K A;  2VC0 A;  4G7O F;  4EVI A;  3M9A A;  3TDZ C;  2HYF A;  3F8B A;  1R58 A;  1F1Z A;  1F4K A;  1DPU A;  1XDU A;  2DK8 A;  5BPI A;  4OMZ A;  3RIR A;  1U3E M;  1YYV A;  1FYM A;  3BRO A;  2VBY A;  4RGX A;  1S29 A;  2X0L A;  3EET A;  3LA3 A;  1TNT A;  1UHW A;  1HW5 A;  1H9T A;  4FX4 A;  1I27 A;  1ZG3 A;  3QPH A;  1XN7 A;  4L9N A;  1XD7 A;  4UHT A;  4HQM A;  2ZCW A;  1XSX A;  4ENM A;  4A5N A;  2LF7 A;  1XCB A;  1G4D A;  1BC7 C;  2IJL A;  2GXG A;  3RI4 A;  1F9N A;  4A6D A;  3NQO A;  5D6F A;  1S7O A;  4IRG A;  3RDI A;  2ACJ A;  3BZ6 A;  4MQ9 F;  1TW2 A;  2FF4 A;  4AVP A;  1S3J A;  4EJT A;  4XSX F;  4HF1 A;  1FPQ A;  4FHT A;  3CTA A;  4RB2 C;  2MLG A;  2Y75 A;  4KIF A;  4U0V A;  5ICC A;  1W7P A;  5F6F A;  3MAJ A;  3I59 A;  1XMA A;  1ZRD A;  2WC2 A;  1MDM A;  1JHF A;  2QEN A;  3QU6 A;  3M7G A;  2DLL A;  3HUG A;  3LA2 A;  3V7R A;  1QO0 D;  3GWZ A;  1XDS A;  2PI0 A;  5D5W B;  1O3R A;  4NB5 A;  1KQ0 A;  1OMI A;  3F23 A;  3RJP A;  3CUO A;  1YQA A;  3I0T A;  3ROU A;  4OIP F;  5CYV A;  2XAF A;  4EM1 A;  1SFE A;  3I58 A;  2DK5 A;  1YS7 A;  3M8E A;  1HXD A;  4S05 A;  3WTW C;  1UFM A;  1W7P B;  2IP2 A;  3GX4 X;  4A0Z A;  4XLP F;  4A6E A;  1TTY A;  1BM9 A;  2P6S A;  3ISP A;  1TNS A;  5IT9 K;  3ECO A;  4AIK A;  2LKP A;  2ISY A;  5CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...