1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
b'DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
4B8XA 2XHKA 3I59B 2VN2A 2RDPA 3CLOA 5IT3A 2ACJA 5D5XB 1OYWA 1PUEE 2L01A 3GW2A 1SFEA 4G6DA 1EH8A 2K86A 2XROA 3M8FA 3ERED 4IPAA 3NRVA 2PN6A 2NNYA 1H9TA 5DDGA 5ILVA 2D45A 4NHJA 2EWNA 1ZH5A 1FLIA 4R1HA 1TNTA 2HR3A 2H94A 1V3FA 2COMA 2DK8A 1YW9A 4EV0A 4WCGA 1GVJA 3H3ZA 3LQRA 2GWRA 2J5OA 3W6KB 2HYFA 2A61A 2XKPA 3PQJA 1U6GA 3RPUA 1K79A 2K4YA 2OAZA 2Y75A 3RJPA 4WF2A 1K78B 3K1MA 2Y0MA 1IN8A 1SFXA 3RI4A 2HWVA 1Z91A 2WTEA 5DCMA 5D6EA 1XGSA 1FT9A 3ROUA 1U2WA 1I6XA 5D5VB 2HKOA 3FF5A 2RN7A 3GZ5A 5F6FA 4JQFA 1J5YA 1XMKA 2A5YB 5DEQA 2WV0A 3DFGA 3K9TA 3O3KA 3H92A 3LAPA 1HSJA 3U9GA 4KT5C 2XKOA 2ZXJA 1J0RA 3F72A 1FWZA 3P9KA 2LSOA 1USSA 4RB2C 2K4BA 3TDUC 1PDNC 2XAHA 2XAQA 2QBYB 3R4KA 3KEQA 1HW5A 1R1UA 2W24A 3V7CA 2JRTA 1TW3A 1GXQA 4Y17A 4GGGA 3CO7C 3EUHA 3ZN1A 2P5KA 1OYYA 2F5FA 1ZG1A 4KMFA 3BZ6A 2FNPA 2KKOA 2ADUA 5D5UB 2HTSA 4OIQF 3HRSA 4OU0A 1SD4A 1DDNA 1IN6A 2K27A 2PMHA 1J9IA 2V79A 4HA8A 2JZYA 1AWCA 1LEAA 5JHUA 2E7WA 4IVNA 3WTZA 4LMYA 2QENA 3KZYA 2X0LA 1SAXA 2R7DA 3BJAA 2PQ8A 5E1WA 4WXHA 5E18F 5JI6A 4G6QA 1UFMA 1R36A 3E6MA 3C7JA 1WWXA 3RIRA 3HRUA 2Q2EA 2QM3A 5E17F 1O7LA 2CW0F 1X3UA 1FC3A 1HKTA 2M1BA 1FBUA 2P5VA 4EGZA 1KU3A 4EJVA 3HRTA 4EJWA 3ABTA 1GHCA 3FMRA 1FNNA 3WU1B 1KU7A 1WKMA 4U88A 2MH9A 3DXJF 1U78A 2F5CA 3KZZA 1KGSA 2KJBA 3RTRA 2RV8A 4YIIA 1EH7A 1R22A 2OU2A 3MWMA 2RQPA 2H27A 2IA2A 1ZG3A 2OZ6A 3SQNA 4RB0A 1LJ9A 2Z3YA 4B09A 2O3FA 2FSWA 3GFIA 3FHZA 1KA8A 2B0LA 3GF2A 4L9JA 4ENMA 4BQAA 5K5RA 4LB5A 5LGNA 4KMUX 3WGHA 2G7UA 4UUVA 3LAJA 3FMQA 3KP2A 4ENNA 3WG9A 3E6DA 2ISZA 1IF1A 4R8HA 3HTUA 1ZREA 5ICFA 1A04A 4LFUA 2O03A 3Q9SA 4RB1A 2RVCA 3Q5FA 2V1XA 1ZN2A 4HX7A 5H6QA 3IWZA 3KETA 3DPTA 1YYVA 1O3SA 2YU3A 1LDJA 4L0YB 4XSXF 5BS6A 2FMYA 3VODA 2QYOA 5JVTA 1DUXC 3CUQA 3SZPA 2GAUA 3GZ6A 2LF8A 1W5TA 5L3BA 2HKXA 1LEBA 1B4AA 5CVUA 3BROA 3SHFA 5BQTA 5LHIA 2Z99A 1XD7A 3S2WA 2JT1A 5HDKA 5JFRA 2EV6A 2ZJ2A 1YS7A 4L9NA 4KFCA 1IN4A 4TV7A 1XDSA 2P6TA 4LJZF 4H0EA 3DF8A 1ZHFA 3JW4A 4CHUA 4GYIA 4KICA 5HS8A 2KIMA 2FRHA 5LLQA 3WTSC 2RC4A 3RYPA 4L9VA 2XGXA 3GO5A 2Q8KA 1C0WA 1Z7UA 2IW5A 1QZYA 2HZTA 1J2XA 1ON2A 3ZMVA 2DPDA 2MLGA 5CYVA 1FYMA 2H6CA 3BP8A 4A0XA 1J59A 2HYGD 3EYIA 1F1ZA 2QWWA 1TQPA 1YO5C 4ENJA 1LDDA 4EMSA 3TO6A 3I58A 2MBFA 2VC0A 2L3DA 1KQ9A 4HX8A 2M5WA 1ULYA 1K6OA 5ICCA 4CZZA 3VB2A 2ESNA 1BJAA 4Q47A 2RNJA 2H3JA 3GFLA 5EEGA 1O7FA 1LNWA 3GEZA 2CO5A 4UVBA 5A2QZ 4NQWA 2HEOA 1YW7A 1W7PA 2CGPA 2V6CA 3LA7A 4M74A 2JTVA 4UHTA 1RI7A 4ZYEA 1R5HA 2G9WA 2PFBA 3HHGA 2F5DA 2E1CA 2L02A 1RZ4A 4AVPA 2EFNA 1L0OC 1OR7A 3HRMA 2IPQX 2VONA 4UNOA 3B73A 4OOIA 4OIPF 5ICGA 4CGZA 5D4RA 2PMUA 3N4MA 4MQVA 3HHHA 4O5VA 1U5TB 1ZLJA 3WTUC 1OMIA 3SZTA 2YX7A 2KJCA 3HSRA 4I01A 3FZVA 3K69A 1BC7C 1YLFA 3GFMA 1S29A 5AONA 4I0AA 4CXFA 4XSZF 1CF7A 4ZYDA 5D4SA 4QLCU 3KCCA 1ZGJA 1Z6TA 1P6RA 2ELHA 2MD5A 1HBXG 4GYGA 3QU3A 3JAMZ 4OIRF 4Q48A 3WTXC 2L4MA 3I53A 4HZFA 1XMAA 1HQCA 3F8FA 2G7HA 4BH9A 3E6CC 5IT9K 4XLPF 3L2CA 3P7NA 4YIFA 3KP3A 1RUOA 3MZHA 4HOBA 5FO5A 4BHCA 2R7FA 2HGCA 3HSEA 2M87A 1IW7F 2W25A 2Y48A 4GO1A 4MEYF 4F7ZA 5F64A 3R6SA 4KIFA 1XSDA 2M8EA 2KIUA 2XIGA 3KP5A 1XSXA 4EM1A 2E1NA 1SFUA 1ODDA 2ZBKA 2IT0A 3ZMUA 1HKQA 2DQLA 3T8TA 2GZWA 2VOOA 2KRFA 4P9UA 2DLLA 3R0JA 4PGGA 1FBQA 1F4KA 2GA2A 4M6YA 3R61A 1PP7U 3IL2A 2BYVE 5EEHA 2V9VA 5E20A 4EVIA 2ZMEB 4IRGA 3F6VA 1R7JA 3F6OA 3F21A 5BPDA 3F22A 3MZYA 1Z6RA 4IRHA 3RKYA 4RS8A 1EH6A 3R0AA 1FZPB 3NEUA 5FFZA 5LRRA 2H09A 3H3UA 1MDMB 4IRIA 2K5IA 4UV8A 5E1XA 2QUFA 4MHGA 1J7KA 2CYYA 3ISPA 1ZAOA 2QVOA 2IA0A 3EDPA 1QGPA 3T8RA 2MLKA 3DEUA 3BOQA 5ERIA 4D0PA 3AAFA 1OYIA 4HQMA 1G6NA 3HOSA 3TGNA 5A2QK 5D5WB 2JPCA 3IC7A 4U7BA 1XB4A 2WC2A 2EFWA 4EQQA 4LG0A 4ESFA 2V1DA 3TO7A 3BDDA 2FXAA 1IAWA 1F9NA 5BPIA 3OV8A 2A3SA 2HQRA 3FMSA 2PBIA 3GXOA 1G3TA 1YIOA 2XAJA 1R5GA 3I0TA 4S04A 4G94A 1BM9A 4IHSA 3WE3A 3EQLF 5LRSA 3E5XA 4HAMA 5HS7A 2HFHA 5E8GA 3JTHA 1D8JA 2R3SA 3T1BA 1P92A 4UXNA 1U5TC 2QQAA 3U1DA 5HLIA 4S05A 1B9MA 2ESHA 1REPC 3WU0A 4LK0F 4M71A 4BXUA 4ENKA 1K7AA 3DV8A 1G3WA 2DT5A 5CVVA 4ETSA 3F23A 3JAMK 3F8BA 3VEPA 1IRGA 4MEXF 3C18A 4O3MA 2BEOA 3ML6A 1FSEA 2DU9A 4WXDA 1XGNA 2O61A 3DP7A 1QO0D 1FYKA 1O3RA 5LGTA 3KP6A 1S7OA 4N9HA 4EJOA 5BOXA 1ZG5A 1FBSA 3FX3A 4Y13A 3F3XA 1ZRDA 3ECOA 5HVQC 1QPMA 2IA1A 1AOYA 4RAYA 1XN7A 2EJRA 5D6FA 3FWEA 1KYWA 1CGPA 2H6BA 3I4PA 4A0ZA 3LFKA 5FB2A 1OPCA 2OQRA 3I54A 2ZCWA 5LEKA 1SD7A 1G3SA 1V4RA 2DBBA 1S3JA 2FQ3A 2D1VA 1RIOH 3CUOA 5FLXZ 3TKYA 5E1ZB 3MHXA 2HTJA 3L7WA 1ZRCA 4YG2F 3D0SA 5HLGA 5DCMB 2DTRA 3BJOA 1KYZA 2A6EF 1WRJA 1TBXA 3ZMSA 4ZH4F 5HDGA 1R58A 2DFIA 1HXDA 2LF7A 4CICA 3ELKA 4IJAA 1BI0A 5IT9Z 1KU9A 2Z5UA 2CQKA 3F8MA 1IN5A 4I09A 4A5MA 4U7DA 2FBKA 3T5XA 2P4WA 3K0LA 1HW2A 1O57A 4IXAA 1RUNA 3FXRA 2MA3A 4A6DA 5CVIA 3BWGA 1G4DA 3PQKA 1STZA 2XUBA 1WI9A 4M6XA 3E6BA 5H6RA 3WODF 3F8CA 2X4HA 3G3ZA 1B9NA 1SD5A 2VBYA 3L09A 1ZGAA 2NAZA 2XASA 1H0MA 2FF4A 2V1UA 4PCQA 2D2WA 4DQ2A 1FP1D 4ON0A 4E70A 4RB3C 4I02A 3VFZA 3I59A 2LX9A 4RGSA 3CO6C 1Z1DA 4PZJA 4R79A 2L54A 5J8CA 4HF1A 4ESBA 2ZNYA 3MQ0A 4AD9A 2JSCA 1XCVA 2EA4A 1H9GA 2GXBA 1OKRA 3GFJA 4MGRA 3MCZA 3E19A 1P4AA 2XRNA 2DPUA 2OZUA 2K02A 1BC8C 2DI3A 4AWXB 4FX4A 1IN7A 4AIHA 1IXSB 2DK5A 3VOEA 1FP2A 4KDPA 1R23A 1MJBA 3QOPA 3PFIA 3IWFA 3KFWX 2VE9A 2VC1A 1TTYA 4N0BA 1BI1A 3J80Z 2GA1A 2VBXA 4YFKF 3B02A 2FMLA 4L18B 2A69F 1G3YA 1JHHA 3QPHA 2Q0OA 4OINF 5LBQA 2NRAC 2STWA 3GLXA 4HDVA 1K78A 1S8NA 4RAZA 3DQVC 5F1RA 2EFQA 4M9XA 2NS0A 3QU6A 3QP6A 1W4MA 4L5JA 3ECHA 1TQMA 4EM0B 3ABUA 4IHTA 2EV5A 1TLHB 2FOKA 2P7CB 1UHMA 1R00A 2EFOA 3IHUA 1I27A 5HLHA 1QQIA 4HLYA 1SD6A 2QQBA 2TDXA 5LHHA 4EJUA 2VXZA 1MJAA 3V4GA 3ZPLA 5LHGA 1E2XA 3RKXA 5DV5A 4A5NA 5FLXK 3C3WA 3JSPA 4HW0A 2L4AA 4WXCA 5HDNA 1ZLKA 4Y15A 3HOTA 4HV5A 4Q5SF 4PDKA 1KU2A 1LDKB 1W5SA 2PLYA 1YQAA 2OQGA 2P8TA 5BMZA 3J81Z 4EGYA 4KA4A 1BIBA 3TOAA 3CUQB 3W6JB 4U0YA 3ZMDA 2UXNA 2MC3A 2W57A 4M73A 1BN5A 1RNLA 5ILSA 1GXPA 4MQ9F 3BPXA 3WTTC 4P5OA 2VBZA 5DCFA 3ZMTA 1BOAA 1FSHA 3RYRA 3KEOA 4CO8A 4ASNA 5DUIA 1Q1HA 3WE2A 1JHFA 3KE2A 1BI3A 2FEZA 1F5TA 5TJJA 2J5PA 2GQQA 2CG4A 3G73A 3L00A 1B6AA 4N9IA 2HS5A 2HQNA 3J7AO 4MNUA 4ZYGA 2RGVA 4G7HF 5K5OA 1BIAA 3BPVA 4KNYA 4KN7X 1IXRC 2LNBA 3CDHA 3O2PE 4LLNA 2OA4A 4ZYHA 3E5UA 4PGHA 3KLOA 1UHWA 5CJ9A 2W84A 2F2EA 1HKSA 1DPUA 5E8IA 1T38A 3GVAA 3LSTA 1FX7A 1IZ1A 5LEJA 1D3YA 1ZYRF 3MAJA 3HYIA 4L9TA 5CVRA 3REOA 1U3EM 3K1NA 1Y0UA 1DPRA 3IRRA 4KIGA 3LA2A 3C1DA 4FHTA 4QWQA 4I2OA 3LWFA 5J8FA 2W85A 2FBHA 4M72A 1ON1A 3J80K 2HDCA 1W7PB 2Z9OA 3I5UA 1S7AA 3GYHX 2QZ8A 4AIKA 1TNSA 4HYEA 1YTYA 5CLSA 5CVJA 2DW4A 1KQ0A 2EV0A 4BYYA 4OMYA 2EK5A 2M45A 1JGSA 1XDUA 1MD0A 4KYWA 4WX9A 3V8KA 4G7ZF 2DAOA 3N97A 4BNCA 1PP8F 4A12A 1IUYA 4U0VA 4UV9A 4LGWA 2YPRA 1YG2A 2WWYA 1TQIA 3E5QA 1P2FA 4BHPA 1VTNC 1BBYA 1BI2A 2XAGA 3FM3A 4Q4ZF 3L9FA 1W7PD 3O6BB 3QPTA 2MH2A 4LB6B 4OIOF 1P4XA 4MTDA 3CTAA 1P4WA 2OD5A 2K5LA 4JBAA 1CF7B 1B1BA 3U2RA 4BAYA 4GXOA 2XAFA 3QP5A 1O3QA 1QBJA 1QNTA 4LK1F 3V8LA 2PI0A 3M7GA 2UZKA 4HLXA 4BHBA 2M30A 1JE8A 5L3GA 1S6LA 3J81K 1Z05A 3MEXA 4HF2A 4Z2YA 2FE3A 3WTVC 1D5VA 3KP7A 2QQ9A 3CUQC 3COAC 2VOPA 3D5LA 4HF0A 1LB2A 2YSRA 4XLNF 2K7LA 5DD4A 3FXQA 3TOBA 1JXSA 1XCBA 3QAHA 1U8RA 5H20A 1L3LA 2ZO4A 1NHAA 4UVAA 4KN4X 2ISYA 2D1HA 2K5FA 3M8EA 1FPQA 3HTSB 4WWCA 1I1GA 3CJNA 4HV6A 5FGMA 1J75A 1T0FA 3V8JA 2FNAA 1ONVA 5FD6A 3WGIA 4LLLA 1YW8A 2A6HF 4HX4A 2EA2A 3EETA 2C6YA 4YFNF 4OMZA 1MGTA 5D8KB 1SMTA 5AIPA 1E17A 5FD5A 2A68F 1KQ8A 2LDUA 2IJLA 3WTYC 2NYXA 2EFPA 4HQEA 1FYLA 4IF4A 1T2KA 2NNNA 4MTEA 3V7RA 3IRQA 5L3EA 3E3VA 1MZBA 1U5TA 3I64A 4FX0A 1XGMA 2FBIA 1WQ2A 4RGUA 2A07F 4HDUA 2RKHA 5L3CA 5AIQA 1D8KA 3KLNA 4LG0B 2ZKZA 5D8LB 4YFXF 2UXXA 3V7SA 5K1YA 1UB9A 1USTA 2JPBA 3M1EA 4ZZLA 4U0WA 3ZMZA 2ETHA 4HBLA 2F5EA 3RPQA 1HW1A 4LD5A 5K5QA 1ZRFA 5FFXA 3K2ZA 5DD8A 5DYMA 5J6XA 2PG4A 3OOPA 3TDZC 4KIBA 2GXGA 3FXUA 4P9FA 2GCXA 1Z9CA 2LKPA 1QW1A 5DUKA 4CDGA 5TRDA 2EB7A 3RDIA 3TO9A 2GIVA 5ILUA 2IP2A 2YR2A 4A0YA 4G8XA 3M9AA 4DNCA 4XRFA 2ZNZA 5HOOA 2VT3A 3DPLC 3ZQ7A 4ZZDA 4AIJA 2BBYA 2ZFWA 2E7XA 1MJ9A 1LQ1A 5L3DA 1IRFA 1FOKA 3QRFF 1SMYF 1LVAA 1T6SA 3HIFA 3P9IA 3HUGA 3LQQA 4M9SA 4G7OF 3JSOA 2P6SA 4XBFA 3GX4X 3LA3A 1T39A 1ZARA 1UCRA 2ZMEA 3WGGA 1MKMA 1FY7A 4A6EA 2AS5F 4WK8F 3E97A 2VODA 1MDMA 4NB5A 2O8XA 3P9CA 4L5IA 2UWMA 2FU4A 4I7HA 2XV4S 2STTA 3F8NA 4RGXA 4CYDA 2P5LC 2O6GE 3RKWA 3ZN0A 2CFXA 5HS9A 5ED4A 1WSUA 1QZZA 4ESJA 2K4JA 3ZP5A 2Z33A 1YFHA 5ICEA 5JR3A 1TW2A 3I71A 1BYMA 2DO7A 4GCVA 4O6JA 1DP7P 3BJ6A 2DQRA 4UVCA 1R1VA 2PEXA 4M9ZA 3MFKA 2P7VB 3Q9VA 2VBWA 4G9YA 1XSVA 1QVPA 1XGOA 3HSFA 5KVRA 2QBYA 2O0YA 1YS6A 2KIFA 1HSTA 2YX4A 3K1PA 4I98B 5KK1A 2VT2A 2CSOA 4KUMA 4A2UA 4L0ZB 2OBPA 3TQNA 2VE8A 2IVMA 3NQOA 1I1SA 1I5ZA 1O3TA 4P96A 4LLGF 4EJTA 1EV7A 3SXYA 4K2EA 3DKWA 3GWZA 2PJPA 3T0YA 3FM5A 4I0BA 3ULQB 3JTGA 6PAXA 4RGRA 4FT8A 4JK1X 4P55A 3KP4A 1T98A 2HOEA 3R60A 2CWEA 3WTWC 2BE5F 5L3FA 2FA5A 3SFZA 2BGCA 3IKTA 2QLZA 2XVCA 3EYYA 2AXLA 3IKVA 1R1TA 4EM2A 1IXCA 1B59A 2IRFG 3BY6A 3GUDA 5LGUA 2BV6A
chains in the Genus database with same CATH superfamily
2DPPB 2WB1N 1ZLMA 4FU6A 1H88C 3WVEB 2LH9A 2AXTC 2LY1A 1NPPA 4B8XA 3H8ZA 2XHKA 3C2HA 1EKEA 2O9LA 5C4XJ 5J4YA 3I59B 1ETKA 3IP4B 1H92A 4LIVA 1NEGA 2VN2A 3CJRB 2RDPA 3CLOA 2ME6A 5IT3A 2ACJA 1ZBJA 2AQFA 5D5XB 2ELKA 3GTOJ 5HY6A 4ELZC 4AC0A 1IGUA 3NAUA 1PKTA 4XLFA 1OYWA 3QIIA 1PUEE 1IRZA 2XI9A 5EDNA 4M75D 2L01A 3GW2A 1SFEA 2E12A 4G6DA 3IV5A 1VQMQ 1PM3A 5FW9A 4PJOC 2GNCA 1EH8A 4DGWB 1MW7A 2LQNA 2MIOA 2K86A 5FU6B 4XN3A 2XROA 3M8FA 3ERED 2CH4A 4IPAA 3UF4A 3NRVA 2DXCA 2PN6A 4N4NB 2NNYA 1H9TA 5DDGA 3L2UA 1W1WE 3L2VA 4B47A 2EYQA 2X9HA 1IJWC 2E41A 5ILVA 2ABLA 4C92F 1SSHA 2D45A 2W00A 2KDZA 4NHJA 2R5ZA 1PRLC 1OU8A 2EWNA 2K2MA 1ZH5A 1KONA 1DGRM 1TWFJ 1FLIA 1CKBA 4R1HA 1DQUA 2LCCA 2GTOA 3RERA 2BOLA 2EIMH 1HSQA 1TNTA 2HR3A 4PUSA 2E10A 2ZZDA 2J05A 3EFSA 5DM7R 2H94A 4RTWA 1N8RU 1V3FA 3PMTA 3QXEB 2COMA 2DK8A 4BXFA 1YW9A 1K8AR 5JLWA 4EV0A 3BG6A 2BY1A 3G71I 2VKEA 4KGVB 3KYLA 4WCGA 2K40A 1GVJA 5IPAA 3H3ZA 5F04A 3S2HJ 3CCLQ 3LQRA 3BY7A 2GWRA 2J5OA 3DTEA 3W6KB 2R57A 2HYFA 4JX6A 2A61A 2XKPA 3RESA 4F7UG 5IXBA 3MMYB 1MMAA 3PQJA 1U6GA 2L9VA 1D09B 2A5WA 3VJPA 2E5QA 2GIZA 2DAQA 2DMQA 2DILA 3H0HA 1X58A 3RPUA 2JA5J 1K79A 2E34A 4IEJA 3K4NA 4XAXB 2K4YA 2CZ7B 2OAZA 2Y75A 4F93B 2RREA 3RJPA 4WF2A 3OYBA 2M51A 5FU7C 2EIKH 1K78B 2ROTA 1MMGA 3K1MA 2Y0MA 2VLAA 1IN8A 2PJRB 2X1EA 1SFXA 3RI4A 4M7DG 2CQQA 1P7IA 1Z91A 2HWVA 2WTEA 3KX2A 5DCMA 1ARKA 4FM4B 2P0KA 4I76A 4PL6A 3VS6A 3PIOF 4M7AA 5D6EA 1XGSA 2LCSA 1IXDA 2HPIA 2LQWA 5GAMh 2CRGA 1FT9A 3ROUA 3VYGA 4BD3A 1U2WA 1I6XA 2QSFX 1V55H 3H9QA 2PQWA 3GTGJ 4M75F 1VQNQ 1AWOA 3QO3A 5D5VB 2HKOA 4J01A 3FF5A 1GCQA 1VQPI 2JVVA 2RN7A 3M58A 2JS0A 3GZ5A 1J09A 2X6OA 5F6FA 3PFYA 1QPIA 2KDSA 2M4GA 2CW8A 4JQFA 2DZCA 1J5YA 1XMKA 1WGSA 4HVVA 2A5YB 1YN8A 5DEQA 2V7FA 2WV0A 3DFGA 4IUUA 4PK4A 3K9TA 3O3KA 3H92A 4HNUA 2H8RA 2XIDA 2GF7A 3LAPA 1HSJA 4II3A 2X6YA 3U9GA 1M90R 4B3XA 4KT5C 1WI3A 2XKOA 2ZXJA 1X01A 4M6VA 4XICA 1EFNA 4FTHA 1WZ2A 1J0RA 1RRJA 3JB9H 2FHDA 1VQ4T 2QEXI 3F72A 3VS5A 1FWZA 3P9KA 2LSOA 2H1LA 1USSA 4RB2C 4BY1J 2K4BA 3O8GA 1Z7LA 3TDUC 1PDNC 2XAHA 3FDYA 3MEUA 4Y4RA 2XAQA 2QBYB 5C44J 2YSQA 3OSFA 1LFUP 3HTRA 1F43A 1A5JA 4M75G 3G71A 1AHDP 3R4KA 4DZJA 2VASA 3KEQA 2QDYB 1PKSA 4IUVA 2ICWG 1ABQA 5LJ5h 4DZPA 4PFPA 1K9MR 1M1KR 1BR4A 4E7IA 3KBGA 1HW5A 2PVDB 1YRNA 2DKGA 1ITYA 2R5MA 2MABA 4FCYA 1R1UA 1JU5C 1JXMA 2W24A 3V7CA 2RHYA 5C3EJ 1ETOA 4QPOA 2JRTA 1TW3A 1GXQA 1X1AA 4GGGA 4Y17A 1IO6A 3CO7C 2DA5A 3CBOA 1M1GA 2DA7A 3EUHA 4M7DC 3ZN1A 2NLUA 3I3LA 2P5KA 5DTDA 2LFBA 1OYYA 2F5FA 3ZOBA 1KQ1A 1ZG1A 1MGQA 4KMFA 2E19A 2FNPA 3BZ6A 3MEWA 2LQKA 1RAIB 2RN8A 3ZQIA 2VXEA 1IREB 2KKOA 2H8WA 3LMMA 3JR9A 2ADUA 3NTIA 4XQ3A 5D5UB 2DRKA 1WQWA 2LQ8A 5KH6A 1VQ7T 3CD6Q 2DL5A 4OAYA 4IIOA 2HTSA 3FHNA 2WY7Q 4RAFA 1OLTA 3EGXA 1N8RC 4Y28E 4KITB 4OIQF 3HRSA 2WBMA 4B6MA 3CQZJ 4DYQA 1MSEC 3HFNA 4OU0A 1SD4A 3PL8A 3QJ6A 5FJ8J 1IN6A 2RNGA 5IYBJ 4C3JJ 1DDNA 1NG2A 2X4YA 3LSMA 4J7IA 5B3SH 1XMXA 3Q0UA 4C92E 2K27A 3IUOA 1VQPA 1CKAA 2PMHA 4QPQA 2D5VA 1J9IA 2V79A 3OYNA 5F0FA 2CREA 4HA8A 2JZYA 3VWBA 3VS2A 1AWCA 2RHXA 3M59A 1TC3C 5D6WA 4A3KJ 1LEAA 4FE4A 5AT1B 2DETA 2KRMA 5JHUA 2E7WA 4IVNA 3WTZA 1RL2A 4ZC3A 4KT0E 4LMYA 2QENA 3KZYA 2X0LA 3F0CA 1P7JA 2TCTA 4X0GA 1SAXA 4B4CA 2GM4A 1VF9A 1RI0A 2R7DA 1OZ2A 1ZGWA 2DMOA 2WB1A 3BJAA 2BE9B 3PTAA 3G6ET 1TWAJ 4GRIA 3JAMR 2M1HA 4FIBA 2PQ8A 5E1WA 1PD0A 1HK9A 4WXHA 2ED0A 1X69A 3T9NA 2QEXA 4ATOA 2DMTA 1SEUA 2A7YA 3JCMd 1Q82R 5E18F 5JI6A 4G6QA 4M75C 1UFMA 1R36A 4ZTJA 4Y7NJ 4Q5WA 3E6MA 3C7JA 1WWXA 3RIRA 1TH7A 3HRUA 2Q2EA 2A36A 2QM3A 3DBRB 5E17F 2BZYA 2FPFA 1O7LA 2CW0F 1X3UA 2HOTA 2EAYA 5GANe 1FC3A 1HKTA 4II1A 1AWWA 1GVDA 3JCMc 2CP0A 3H0FA 2M1BA 5AYFA 5CKDA 1FBUA 3OYMA 2P5VA 4LDXA 2ZXWH 2DNUA 4EGZA 1KU3A 3BCBA 4EJVA 2F1LA 3BDLA 3HRTA 3KFVA 3NTHA 5GANf 1K4SA 5A0DA 4EJWA 3H41A 4XKVA 2P4RA 3ABTA 3CCJI 1UGSB 1GHCA 2NUZA 5GAN3 3FMRA 1FNNA 3WU1B 1KU7A 1M2VB 2ME0A 4RG8A 1WKMA 4U88A 5I22A 1TWCJ 3ASKA 2AKKA 2DDBA 2BW3A 2MH9A 3MZ8A 3DXJF 2R5AA 4VUBA 1U78A 2Y31A 2F5CA 3KZZA 1KGSA 5GAGJ 2J06A 3MPUB 1ENHA 2KJBA 2DJZA 1IHWA 3CF5F 3RTRA 2RV8A 4XTXA 4YIIA 5J3LA 4XU0A 4M4ZA 2DFFA 3H5RA 4A54A 4HCBA 3CJTB 2FPEA 2M8GX 2DRMA 5CQGA 3CCSA 5M3MJ 4QKUA 1QP2A 2LTPA 1EH7A 1R22A 2YLCA 2OU2A 3MWMA 1YJNA 2RQPA 1SFKA 3HP9A 4BUPA 1LE8A 3I5RA 4F3QA 5KCHA 1X1BA 5J26A 4E7LA 2CMPA 2H27A 5GAMe 2IA2A 2QCOA 4IOCF 1TUCA 5IHNA 3M57A 4BY7J 1B7TA 1ZG3A 3MJXA 4X1VA 1LPQA 2C06A 2OZ6A 3SQNA 4RB0A 1LJ9A 2Z3YA 4B09A 2FD5A 3S2DJ 1VFCA 2OTJI 4EMKB 2O3FA 5GAMf 3UA7A 2FSWA 3GFIA 1PRMC 3I9V2 5M3FJ 4IUTA 1KD1R 1Z67A 3B6CA 2E4HA 5J1YA 3MKWB 2E2IJ 2KGTA 2KYBA 4N4HA 3FHZA 5A0LA 1KA8A 2B0LA 2CW7A 3GF5A 3GF2A 2XPUA 4L9JA 4ENMA 5GAEJ 1NK2P 4BQAA 4ESRA 4PJMA 1NG7A 4J9HA 4QVDA 2BE7D 2RMOA 1TUGB 5K5RA 1GV2A 2JT4A 2QTXA 1SVLA 1XTAA 3B6AA 3CCMI 4ITVA 3VDXA 5LGNA 2NVXJ 4LB5A 3DKYA 1ETWA 4LNPA 3CCRA 4KMUX 3WGHA 2G7UA 3A0HC 1VQ8I 3G1LA 2FEIA 2XDPA 4UUVA 3LAJA 3HPHA 4FT4A 4C92A 3FMQA 1HYOA 4J9DA 3PMIA 3KP2A 1UG1A 4ENNA 2FOWA 3WG9A 1D1CA 3E6DA 2ISZA 4J9FA 3SYTA 4L6V5 1IF1A 4R8HA 3SFIA 2KQWA 4DOWA 2IVWA 4ZJZA 3HTUA 3CCEQ 2E64A 1ZREA 5ICFA 2GQIA 1UB4A 3BQYA 4CI0C 2M02A 1RLQC 1T3LA 5LJ5e 3QSUA 1T08B 1ZBXA 1A04A 4LFUA 2O03A 3Q9SA 4RB1A 3HOUJ 2DK3A 3SDGA 2JWTA 2RVCA 1DU0A 3ZGKA 2KT1A 1ETVA 3Q5FA 2MF2A 2VV5A 2V1XA 3EH1A 2FX0A 2JRMA 1ZN2A 4YTLA 1LJOA 3K4LA 4HX7A 1N27A 5H6QA 3IWZA 2FO0A 3I5SA 5GANg 1A36A 1VQPQ 3KETA 3DPTA 1YYVA 1M30A 1O3SA 2YU3A 2K3BA 4OGEA 3PO2J 3CC4T 3M8JA 4Y3OA 1LDJA 1KHIA 4L0YB 1Y71A 1GV5A 2WY8Q 2COWA 4XSXF 1JKRC 5BS6A 5GANj 4L59A 5KNLA 3ZL7C 2FMYA 5CQEA 3VODA 3MP8A 4IHYA 2QYOA 1FIAA 4ZYAA 1R77A 5GMKh 1YITA 1RKTA 5JVTA 1DUXC 2F2WA 3CUQA 3SZPA 2GAUA 1TTHB 1RESA 5FLMJ 3GZ6A 2LF8A 4AU7A 1VQ6I 4CUGA 3NPFA 1W5TA 3BG9A 5L3BA 2N8GA 4X9DA 2HKXA 1LEBA 2X98A 2ENMA 5GMKi 3DBHB 3M55A 4C3IJ 1B4AA 2ZSIB 1ETYA 3IH4A 3BROA 5CVUA 3SHFA 5BQTA 4PFOA 3EGUA 1YWPA 3PIOA 5LHIA 2ECCA 2COZA 2RNAA 2OTJA 3A1YA 1QLYA 4KUIA 2A05A 1Y96A 4A53A 1W36D 1WXBA 3QYHB 2Z99A 1TSFA 2F5TX 4DA4A 1YITQ 2HD0A 1XD7A 2X6XA 2JM8A 2GBYA 3S2WA 5F0HA 3PUFA 2JT1A 5HDKA 2I2LA 2RQRA 1VQ5I 4HSTA 5F0CA 4XRSG 2A3LA 2EV6A 5JFRA 2ZJ2A 1NYGA 1UELB 2P0PA 1YS7A 4L9NA 4KFCA 1IN4A 4TV7A 2XAUA 1YHQI 1LUJB 4E7JA 1XDSA 2P6TA 2WAQA 4LJZF 1JB0E 1RAFB 2HCKA 3LW5E 3ERMA 4RLQA 3CCMA 4H0EA 3CCVT 3DF8A 2X4XA 5FKLA 1ZHFA 3JW4A 2KROA 3A8LB 4CHUA 4HNVA 1VQ8A 2YUQA 5GAMg 3GBQA 3DB3A 1YRNB 3VRYA 1QA6A 2K57A 2EJGA 5M5XJ 4M77B 3TU4K 4GYIA 4KICA 5HS8A 1MBEA 2KIMA 2KZGA 1RR8C 2FRHA 3FLGA 2LP5A 3PM1A 1BBZA 5LLQA 5GAMj 3WTSC 2RC4A 3RYPA 4L9VA 3LSKA 1ZUYA 5GMKm 4B48A 2XGXA 3GO5A 4CSWA 2M0YA 4BBRJ 1OYXA 4ZTFA 3H35A 2Q8KA 4RTVA 1C0WA 1Z7UA 2IW5A 1IV6A 1QZYA 1T95A 4DBQA 3CCSQ 2HZTA 3EGXB 3HKSA 2EZLA 3VKIA 1J2XA 1DU6A 2OJ2A 4EMHA 3LFUA 1YJNQ 1ON2A 2CQXA 1WGXA 4W1UA 3ZMVA 2DPDA 2MLGA 5CYVA 4QT7A 2QA4A 2BIVA 2J6KA 1UTIA 3OYJA 2O88A 2LMDA 2VKDA 2R7SA 1N25A 1MNEA 4EEFG 1FYMA 2H6CA 2QQRA 1ZR4A 2NWMA 3BP8A 2CQNA 3ZQFA 2JNGA 3C2GA 2DJNA 4A0XA 1KC8R 2DMUA 1J59A 2LOOA 2HYGD 2VJ5A 3EYIA 1F1ZA 2JW4A 2ZPBB 4GLKA 4YEJA 3JRBA 1VQ6A 2QWWA 1TQPA 4A3GJ 2X48A 3DB4A 1V5EA 4HVWA 4Z02A 1YO5C 1MBFA 1LDDA 2HI3A 4ENJA 5A0GA 1TL8A 4A3MJ 1YIJA 2KVQG 4JZ3A 4EMSA 3QYGB 2DL3A 4PJNA 1WHGA 2CKKA 1N75A 3QZ9B 3TEEA 1GL5A 1JJ2A 3TO6A 1X4PA 1MMNA 4M77D 1X6GA 3CCRQ 3I58A 2MBFA 2EW3A 4CC2A 2EPDA 4S0HB 4IOAF 4CCMA 2VC0A 3ZXSA 4UC4A 5CKFA 4DYRA 2Q2EB 4I99C 1JJ2P 2L3DA 1KQ9A 2F48A 4HX8A 1B8IA 2F5VA 2OTLI 1KG1A 3S1MJ 2M5WA 1M3AA 1ULYA 1K6OA 5ICCA 3U21A 4CZZA 3VB2A 2ESNA 1BJAA 4Q47A 4D5CA 1JGGA 4J9CA 3CCJT 1K83J 2RNJA 3QYFA 4OB2B 3FK6A 3QDRB 2K3XA 2ECBA 1QRYA 2RK1A 3OW2S 2LKSA 2L7MP 2X9DA 4IHVA 2XGEA 2H3JA 3JSCA 5M5WJ 3CMYA 1VQ9T 1PUFA 3IH2A 3GFLA 2L3SA 5EEGA 1S1NA 2XU8A 1O7FA 2OJED 2CFOA 1W2BA 1LNWA 3K7AJ 3JRIA 1HD3A 2YUPA 4NBQA 3HPWA 3GEZA 3LGFA 2BW3B 1BL0A 2CO5A 1A6QA 4FYXB 2ESWA 3S32A 4UVBA 5A2QZ 2ZJPF 3JRDA 2E70A 1W2BP 4NQWA 3DTKA 3LLRA 4XTUA 3CMEI 2HEOA 1E6HA 4RM2A 3CJQB 1YW7A 1W7PA 1U1TA 2CGPA 3CMAT 3RKQA 5FRNA 2V6CA 1NYFA 2LJ1A 1TS9A 4AM3A 3CBMA 3LA7A 4M74A 1UFFA 1QVGS 2JTVA 1EJ9A 3PT9A 3X20B 5GJVB 1MNMC 2K9SA 4UHTA 1RI7A 1WLPB 4ZYEA 2YU9J 4LUDA 1R5HA 2G9WA 2PFBA 3HHGA 3UNGC 3VPRA 1I4K1 2JXBA 2F5DA 2ZXHA 2E1CA 2L02A 1W0UA 1RZ4A 1WJBA 5J1UA 3S1NJ 4HVUA 2K9GA 3S6WA 1S72Q 1TXQA 3EG9A 1DP3A 4AVPA 2DBKA 2MWPA 1JEGA 2EFNA 2IS6A 3SWNA 1L0OC 4QSHA 1YI2Q 1ZR2A 2BHYA 4DOZA 1OR7A 4LITA 3HRMA 3O8VA 4XNFA 1YCSB 4BBSJ 5IN1A 2JJ9A 1RADB 1RAAB 2IPQX 3UR3C 1Z0XA 4X1EA 4M78F 2VONA 4UNOA 4CA0A 3RR6A 3S1RJ 3B73A 2HNIA 3CCMQ 3BLYA 3KEYA 4PJOF 4FETA 4XR6A 4OOIA 4OIPF 1VQ8Q 3VV0A 5ICGA 5EGOB 4CGZA 3S16J 5D4RA 1UECA 4LDWA 4EMKC 1F36A 2PMUA 3N4MA 1LKXA 3OL3A 3H1CA 4P1WA 4NC7A 2J6FA 1C1AA 3FJPA 4MQVA 3JCMW 3HHHA 1C0MA 3VSKA 4O5VA 3S17J 1U5TB 1ZLJA 3WTUC 3H3VK 1RACB 4J6WA 3TQ7P 2F6CA 1OMIA 3SZTA 2DOEA 1PHTA 2YX7A 1KIKA 3CDLA 1I07A 2KJCA 5E3NA 3O5ZA 4AMCA 3D5RC 5FLXR 3HSRA 2KIQA 4D7MA 4I01A 3FZVA 3K69A 2Y2ZA 1QU3A 1BC7C 2DXUA 2V1NA 1YLFA 2L0KA 1S29A 3GFMA 5AONA 1UJ0A 1E3PA 5HK3A 3JREA 2CGHA 4I0AA 4CXFA 4XSZF 1WXUA 4F55A 1QP3A 2CP5A 2DVJA 2JTEA 2LMJA 4M78G 1CF7A 5GADJ 4ZYDA 2C0TA 4OMMA 1M8VA 2HVSA 4M77G 5D4SA 2QA4Q 1A6IA 1UEBA 4C0DB 4QLCU 3KCCA 5K7HA 1ZGJA 1UUEA 1Z6TA 2G3RA 1P6RA 4JRKA 3CMEA 2JA6J 2ELHA 1WHLA 2M9UA 5FWBA 2K3PA 4KGXB 2MD5A 1HBXG 4GYGA 2R7VA 2HVQA 1VOMA 3CP2A 3QU3A 2O4XB 3CXCP 3J80E 1Y0MA 3JAMZ 4OIRF 1JXOA 5EEAA 4Z6YA 4Q48A 3WTXC 1YIJQ 3S93A 2L4MA 3I53A 5KYNA 4HZFA 1XMAA 2K85A 4KULA 3LGLA 1HQCA 3F8FA 4OMFB 3EFOA 4KGZB 2G7HA 4BH9A 2R92J 3E6CC 1M1EB 3G6EI 3GTJJ 5IT9K 2QGUA 4XLPF 3BR0A 4QQDA 2KHMA 1VQ4A 4A3CJ 1IDZA 1FXXA 4EIKA 2IGNA 3L2CA 3P7NA 2KXCA 4YIFA 1BCMA 2LZ6B 3KP3A 1WHUA 2QSGX 1RUOA 3MZHA 3KYCB 1PSFA 1X2QA 2GFAA 3MP6A 1W5CC 1VQ5T 1GBRA 4D6WA 2Y69H 4HOBA 4F7UF 4NC6A 5FO5A 2AO9A 4BHCA 1HCRA 1YHQT 2R7FA 3GLLA 3EPZA 1RC9A 1SFOJ 2HGCA 3HSEA 4ZDPA 2M87A 2EKHA 5GANd 1IW7F 2W25A 2Y48A 3K70D 1RI9A 4Z89A 2LD5A 3PVQA 3GIBA 2LR8A 4GO1A 4MEYF 4F7ZA 1E0EA 3A98A 4MDXA 3G1MA 2VL8A 5F64A 3R6SA 3FXJA 3RQIA 4KIFA 3HXLA 5FKOA 2EFIA 1XSDA 5GAN5 2M8EA 2KIUA 2XIGA 4LDVA 3LSPA 2WSFE 3KP5A 5KE3A 1XSXA 4EM1A 2E1NA 1SFUA 1ODDA 2ZBKA 5BNGA 3CC7T 2E3HA 2IT0A 3LSRA 3U23A 4J6XA 3X26B 1OCRH 3AG2H 5I2SA 2B7EA 3QQAA 1WJSA 2EYYA 1SVMA 3LOCA 1V1CA 3ZMUA 1HKQA 2DQLA 3T8TA 2P4TA 4CYCA 1MV3A 3N5BB 2JJ7A 2GZWA 1W0TA 3P8DA 4M78C 1GFDA 1BKBA 4I6ZA 2VOOA 2VJJA 4M77C 1D1AA 2KRFA 4UY8I 4P9UA 1HC8A 5KCMA 5GAN8 1JUPA 2DLLA 3H5NA 3R0JA 4E7KA 3OIQA 1K9AA 1V29B 2AZVA 4PGGA 1FBQA 1F4KA 2M4KA 3H6ZA 3MCAB 2CUJA 2GA2A 3I55I 4BE2A 4M6YA 3HUGB 2GLOA 3VUBA 1VYVA 3H9JA 3R61A 1GT0C 1PP7U 3I35A 4XKBA 2E65A 3IL2A 2BYVE 5EEHA 1I0CA 1RAGB 3EG0A 5CIUA 5KCOA 3M54A 1JJ6C 2VQHA 2V9VA 5E20A 1Y7XA 3FBNB 2UV1A 2DYBA 5GPAA 4EVIA 2QKMB 1C6VX 5GAMd 2EYXA 3KYDB 4M7DF 4PSXA 2EBIA 2ZMEB 3S3NA 4IRGA 1VQ7I 3F6VA 5GAOp 3R6OA 1D0XA 1R7JA 4BDYA 4UUTA 1N5ZA 2KL4A 3F6OA 2NUTB 3F21A 2RK2A 2F4MB 5BPDA 3F22A 2HQAA 3MZYA 4RTZA 1KZHA 1Y1VJ 1JKOC 4M78E 1VA7A 3G6EA 1Q7YR 1B34A 2XSJC 1Z6RA 2VKVA 4IRHA 4JX4A 2E6ZA 4PJOE 2W82A 3DU5A 5EG2A 3FXOA 4N4IA 2XPVA 3LWIA 1G2HA 3RKYA 4RS8A 3NWSA 2P0TA 2VQCA 2JTFA 3J81E 1EH6A 3CMMA 3R0AA 3FISA 4RKUE 4IHXA 2CS3A 2OTLT 1FZPB 3NEUA 3FXLA 2V8IA 3EH2A 5FFZA 3CP8A 5LRRA 3SB2A 3JB9F 2H09A 3H3UA 1MDMB 1B8IB 4IRIA 2DJQA 1S7EA 5EZGA 4UV8A 5E1XA 2LYCA 2JM9A 3VYSB 2K5IA 2KEAA 3IQLA 3OA6A 2QUFA 4MHGA 1J7KA 2K3YA 3DKXA 2CYYA 1WCMJ 1R49A 3D7SB 1SRMA 3E1SA 2XDBA 3ISPA 2ED1A 1ZSZA 2FRWA 1NH3A 1YJ9T 1ZAOA 2QVOA 3ZQGA 2KRSA 1ZELA 2IA0A 2DCEA 5HNHA 5EG0B 1K0SA 3EDPA 2RQVA 1QGPA 5JLXA 3K4KA 2VUBA 3HHTB 3T8RA 3D1NI 4BUGA 2MLKA 5IY5H 2OAWA 1MMSA 1K6YA 3QUIA 3DEUA 4HPQA 3JCUC 3BOQA 1TUDA 4C8QB 5ERIA 4D0PA 1ZHIA 4LE9A 1M2OA 3HGGA 3M07A 3AAFA 2MMPA 3CC4I 4J8OA 2XF5A 1Y6IA 1Y8RB 1O9SA 1OYIA 1B72A 3J80R 2LDMA 4HQMA 3GTKJ 1G6NA 4M3BA 3KUFA 4FT2A 3JCMP 4E6RA 3F70A 1CSKA 3HOSA 4V2FA 4ORZA 3JB9G 2HOSA 3TGNA 3M0TA 3L2QA 2RI3A 1QVFS 2CP3A 5A2QK 5D5WB 2COBA 2JPCA 2CT3A 1W6XA 3IC7A 2Z1DA 4U7BA 1XB4A 4XRMA 3S3OA 2WC2A 1W1FA 2HKNA 2GOXB 2EFWA 4FYVB 1VQLT 4EQQA 4LG0A 3EGDB 2ZAEA 2YS9A 5CQXA 4ESFA 2V1DA 3P8BB 3TO7A 1VQ4Q 3W2AA 1AEYA 1T0FC 2V26A 1LVKA 2EQUA 3BDDA 1TWGJ 2FXAA 3KZIC 1IAWA 1FMWA 1F9NA 5BPIA 1Y56A 3M53A 3SWNB 3ZFJA 4HKEA 1VQ7A 3PFSA 3OV8A 2A3SA 5FKMA 4LIUA 3VS4A 2XD0A 2COYA 2HQRA 4RTXA 2EQMA 5B5EC 3FMSA 4M3GA 2B86A 2PBIA 4F7UE 2O9SA 3JCMb 2EH3A 3X24B 3GXOA 2O7OA 1G3TA 5CKEA 4RA2A 4BGDA 2WAFA 2HZDA 1YIOA 2XAJA 1JRIA 2EGCA 4KRTA 1M1KU 1OQKA 3WU2C 2R0QC 1RAHB 1R5GA 3CCVI 4XIDA 3I4NJ 2OI3A 4JRIA 2R5YA 3DLLF 3I0TA 4S04A 3OB9A 1AKHB 4G94A 3M3YJ 2DYRH 3OYHA 1ACMB 2K7AA 2VGNA 1OEBA 1QHGA 3HDDA 3OYDA 1BM9A 1IGNA 4IHSA 3C95A 3WE3A 3EQLF 3OS1A 3LX7A 4C8QD 4OMOA 5LRSA 5GPCA 2A6TA 3LYIA 3E5XA 4HAMA 2VWFA 3K10A 1LCKA 2FZKB 5HS7A 3UT1A 1M4ZA 1GUUA 2I10A 2LREA 3HEFA 2HFHA 1WH7A 5E8GA 3JTHA 1D8JA 2O5RA 2LJ0A 3FXMA 1K73R 5GAHJ 1WXTA 4N0AC 2WAQN 2R3SA 1GLNA 2LVMA 3UATA 4OMLA 3T1BA 2GQVA 3CCUT 1T33A 5CKHA 1P92A 4IZZA 4UXNA 2MZ4A 1YFNA 5HK0A 1KQSS 4PJOA 1U5TC 4B44A 1ZQ1A 2LK2A 2QQAA 4BB7A 1TG0A 2L9NA 3A01B 4BE1A 2Y0SA 3X28B 3CC4A 3LNQA 2EGEA 4AIDA 2R7XA 2JVGA 1VQKI 3ABMH 2DXTA 3U1DA 2ZPHB 5HLIA 3A52A 1GFCA 3G2BA 4S05A 3K70C 3M5AA 3GPLA 3BFMA 2NYSA 2HKQB 2ZPIB 2G0EA 1NJIU 4BS9A 4PJJA 1B9MA 2ESHA 2RPNA 4A4EA 1REPC 2LRDA 3WU0A 1D0ZA 4LK0F 4MFDA 4M71A 5EJCA 3CC2T 3OMYA 3HOYJ 4BXUA 5D6YA 4M7DE 4ENKA 1K61A 1JKQC 5D6XA 2DTOA 3CD6T 4BACA 3DV8A 1K7AA 2RQQA 1G3WA 2E1HA 2DT5A 3G6EQ 2ZJRF 2JA2A 2ZCFB 5CVVA 4QVCA 2DERA 1U9NA 4ETSA 3F23A 3Q0VA 4NDLA 5IP6A 3F8BA 3VEPA 3JAMK 3J81R 4DW6A 2DT6A 1ZKGA 1IRGA 4TVRA 4DEXA 3VS3A 3NHNA 3DKMA 1QCFA 3VYTB 4MEXF 3C18A 4O3MA 5CO7A 2ZPEB 1NK3P 4PFZA 2BEOA 2XHCA 3VS1A 1K4US 3ML6A 1FSEA 2IBDA 5LL6S 4RCBA 3HM5A 1PVEA 3OR1C 1VNDA 2DU9A 4A3EJ 4IIMA 3JCMV 4WXDA 1XGNA 1E7OA 2O61A 3DP7A 1QO0D 1FYKA 1O3RA 1ACIA 5LGTA 5KYWA 2LBFB 4Y52J 5HCKA 4GDFA 3KP6A 4Y33A 5CCAA 3HL8A 1JJ8C 3CCVA 2DEUA 1S7OA 2ZC2A 2BY0A 4N9HA 1G8XA 3A5ZB 4EJOA 3LSGA 5BOXA 2DBMA 1ZG5A 3CQTA 3UKGA 4DBRA 2MSYA 4FSXA 4C8QF 3C94A 3PSIA 1FBSA 2M35A 1AT1B 4HCZA 1VQ9I 3M0PA 5IYDJ 4OF1A 3RBBB 4A93J 1QZEA 2F2XA 3FX3A 1JKPC 2LC2A 3HOVJ 3JCMQ 3AG3H 2JUGA 4Y13A 4MDWA 1AWJA 2E71A 1M1FA 2CZ0B 2R7OA 4M75E 3F3XA 3W2VA 1NEBA 2QAZA 1ZRDA 2AHJB 1Z77A 3RSNA 4FISA 3ECOA 4XKCA 5HVQC 4A3BJ 3META 1I6HJ 5TISC 4BEHA 1QPMA 2IA1A 4FYYB 4DEYA 3JB9I 1BR2A 3ABKH 4YIRX 1AOYA 1NZ9A 3O8HA 2M0MA 3CMAI 4JDSA 2EJ9A 4RAYA 1OQYA 4OMPA 3I55T 1XN7A 3MEAA 1ABOA 1WQ7A 4IUPA 4BJ5C 1QCNA 1G59A 1KFZA 1QKWA 2EJRA 1N6AA 1SSFA 5D6FA 3FWEA 2RA2A 4ME7A 5GMKl 1X3ZB 3E2UA 3GP8A 1KYWA 2DFHA 2RQTA 3BE3A 2KE9A 1G83A 1CGPA 3A8MB 1NLOC 2VC8A 4C8QG 3K4BA 4EMGA 4UUSA 2R5ZB 1Q81U 4E7ZA 5FU6C 2H6BA 3I4PA 3PIPF 4A0ZA 3EG2A 5KYXA 3CCQI 1SANA 3TL4X 2ID6A 3LFKA 4XLHA 5FB2A 2XB0X 1UGPB 1FMVA 1OPCA 4HCKA 3G71Q 2OQRA 3DLMA 4RG2A 3I54A 3JCMh 1FIPA 2ZCWA 4ZGDB 5LEKA 1M8MA 1MNDA 1WNLA 1SD7A 1G3SA 1V4RA 2DBBA 1S3JA 1WHKA 2L7KA 2EZHA 2LY9A 4NL2A 5GAN7 4MMKA 3OS5A 1S9HA 1ORKA 2FQ3A 2LVSA 4FE7A 1BCOA 2AQEA 2D1VA 2ZMEC 1RIOH 3CUOA 2UUZA 2DODA 5FLXZ 3RUXA 2ROLA 1N77A 3H0GJ 3PSFA 3PNTA 3TKYA 5E1ZB 4A3FJ 1YOVB 3AFHA 4E47A 2M34A 4C3HJ 2A37A 3MHXA 2HTJA 3L7WA 2BZXA 1ZRCA 5GAOm 2E5KA 1XOVA 2EZIA 3CCJA 1AD5A 4M7DA 3FJ5A 2FJ1A 3H5AA 1NJIC 5E3MA 2XC7A 2PMZN 4XK4A 4YG2F 3BQZA 2XG8D 3D0SA 4BQOA 1VQ9A 2R7QA 5HLGA 5DCMB 2RJFA 3C0CA 4KH1B 1WFXA 2DTRA 2IAIA 3X2QH 3BJOA 5HLTA 1KYZA 1TZLA 2A6EF 2R4GA 1WRJA 1VIEA 2V1QA 4M7AB 2GGRA 1MIJA 2FRYA 1TBXA 3ZMSA 4XOPA 4ZH4F 2FZGB 2WACA 5LJ5f 3C2BA 5HDGA 1EZZB 3W3CA 1WX6A 1R58A 4B1RA 2CUBA 3RQ4A 1MSFC 2DFIA 1HXDA 1B72B 2R7TA 2LF7A 4CICA 3G4SI 3PE0A 5I2MA 2QTVA 4XORA 3ELKA 3CMAA 2HQHA 3J7AF 4IKFA 4IJAA 1BI0A 5IT9Z 1KU9A 3OS0A 3VS0A 2Z5UA 2CQKA 3F8MA 2NVQJ 4XLAA 2E36A 1X75C 3L1AA 1IN5A 4I09A 2HBWA 2ATCB 4A5MA 4U7DA 2Q1ZB 2VPLA 4C8QC 4M3EA 2FBKA 2VXDA 3T5XA 4GFBA 2P4WA 3A2KA 3K0LA 1HW2A 1YP5A 1O57A 3FEOA 2QEXQ 1WJCA 2MGQA 5B1AH 4BY6B 1N8RR 3FIFA 4IXAA 2VIXA 1RUNA 1FTTA 5EC7A 2GXAA 1WPKA 3FXRA 3QODA 2E1MB 3CLQA 2CSQA 2CZ6B 1I5LA 2JN6A 1RPWA 2MA3A 4AVZA 3W2WA 2FB7A 3L42A 3OBWA 3RPUD 3OQ5A 4GY5A 4A6DA 1ZX6A 5CVIA 5LFAA 3H0DA 2NUPA 4M75A 1RQ6A 4H4KC 3HOXJ 2J7IA 3H36A 3BWGA 4F92B 1QVUA 2K2VA 1JQQA 1G4DA 3PQKA 1EA3A 1STZA 2XUBA 2EYWA 2DOAA 1WI9A 3RZOJ 5DS9A 4BI8B 1BA5A 1HDPA 1DJ7B 4M6XA 1NBEB 2VKNA 5GAN4 3E6BA 5H6RA 3WODF 3F8CA 4M7AD 5EYRA 5DY9A 2X4HA 1MH4A 3G3ZA 5J4VA 1B9NA 2XK0A 7AT1B 1K8AU 4X34A 1WHHA 1SD5A 3DBLB 1FOYA 2VBYA 3Q0WA 4FQGA 2BTTA 5GJWB 4OAZA 1TT0A 1RKWA 3L09A 3TBIA 5IOZA 4OWRB 1ZGAA 1YJWI 2CYZB 2NAZA 2XASA 2KRCA 2PTKA 1A0NB 2IEKA 3CC7I 2ID3A 1JUSA 5K7ZA 1H0MA 2D8JA 4QW2A 1Q81C 4CCNA 2QYZA 4C2MJ 1VQOI 2FF4A 2V1UA 4NOYA 4PCQA 2D2WA 4MLOA 4MIMA 1FP1D 4DQ2A 1VZ0A 2P84A 4ON0A 4E70A 2XMFA 4RB3C 3LSHA 4I02A 4D8KA 3VFZA 4V19K 3LWHA 2HXIA 4CRIA 1PJRA 1SKUB 3I59A 1N78A 1WIEA 2RI5A 1VQKT 1WJEA 2LX9A 4RGSA 3CO6C 1UHFA 2KT8A 1Z1DA 1H3HA 4PZJA 4R79A 1UGQB 2JS2A 2L54A 5GP9A 2CP2A 1OCZH 2BZTA 2EINH 2XGCA 5J8CA 4ESBA 2ZNYA 3K6GA 3MQ0A 3H9GA 4HF1A 2AK5A 4KJZA 4AD9A 1FTZA 5DLOA 2JSCA 2DA9A 2O2OA 3GMEA 3A0BC 2FG0A 2KISA 2LRQA 3TREA 2O31A 2RB6A 1XCVA 4F04B 5LJ5g 4HXJA 3VYHB 1VQMI 2EA4A 1H9GA 2GXBA 1OKRA 2E5NA 3GFJA 4W97A 5FRMA 2M16A 4MGRA 4F91B 3MCZA 2WADA 3QKJA 5LJ5j 3E19A 3DU6A 1TWHJ 3HGYA 1P4AA 3S3MA 2JMWA 4J7FA 2XRNA 2VB6A 4JRQA 4AFSC 5GAN2 4RTYA 2DPUA 2YT6A 4E7HA 1VQ5A 2OZUA 4XOTA 2K02A 1H8AC 2L8DA 2E5ZA 2DI3A 1BC8C 9ANTA 1BW5A 2AKLA 4AWXB 4FX4A 1IN7A 2KLOA 4AIHA 5CAIA 4OGCA 1IXSB 2DK5A 3VOEA 2VVKA 4JP0A 1YHQA 2IPOB 5GTHC 1M90U 1FP2A 4KDPA 1XG1A 3GNGA 1R23A 3CCJQ 1KSWA 1MJBA 3QOPA 1IV8A 3PFIA 3EUAA 3IWFA 2X1DA 2K9NA 2KNBB 2LKXA 5IXFA 4M7AF 2M7AA 5KYUA 1M27C 3KFWX 4UB6C 3GTQJ 4A4GA 1YJ9I 2VE9A 5FU7B 3I56T 2KP6A 3OS2A 2VC1A 1TTYA 4N0BA 1BI1A 3J80Z 3TEDA 2GA1A 2Z16A 4BL0B 4RAGA 2F69A 2VBXA 2DD5A 4RUGA 4YFKF 1NE8A 9ATCB 1K9MU 3B02A 2DA4A 2L9SA 3CCLI 3JRAA 1WYXA 4C5EA 3MKZA 1NLPC 3CC7A 2FMLA 4L18B 2BXZA 2A69F 1G3YA 1JHHA 3QPHA 1U06A 2HPMA 4F52A 3AL0B 2Q0OA 4JJNK 4OINF 5LBQA 2NRAC 3CPFA 4GBQA 2STWA 3GLXA 3QYEA 4HDVA 1VQOA 2DLPA 1K78A 3C12A 1S8NA 4QTRA 5CKBA 4E2FB 1GXIE 1X2NA 4RAZA 2PJRA 3MN2A 5JVGF 3MP1A 3QZ5B 4C5IA 3DQVC 4BU2A 1X43A 2QK0A 4OB0B 5F1RA 1IDYA 1I50J 4XMYA 2A28A 2EFQA 4M9XA 2NS0A 4JRPA 1LE8B 2F5KA 3QU6A 4M7AG 3QP6A 1W4MA 2HEQA 1OCTC 1VQLI 4L5JA 2OTJQ 3ECHA 3AKZA 2NVTJ 4LOCA 5D7UA 2DTHA 3I4MJ 5DM6F 3CCQT 1VQNI 3OMGA 2KZVA 4WCIA 4JJCA 1TQMA 4EM0B 3ABUA 4IHTA 2EV5A 5GAOq 1K8AC 3OW2A 3ONQA 4E7SA 3SJMA 2EYZA 1I3QJ 1TLHB 2FOKA 3K4CA 2BVLA 4MZPA 2P7CB 1UHMA 5GMKe 1RETA 1R00A 2PMZA 4MO7A 2FVUA 3E9GA 2WA0A 4C5HA 2CQ7A 2EFOA 3IHUA 3DCFA 4BQQA 4CH7A 1NPRA 4M77F 4RCCA 3OW2P 2BY2A 2MPXC 1I27A 3K4JA 2WSEE 4PJ0C 2J6OA 4PNOA 2D0QB 3H9NA 5HLHA 2DO3A 3SDZA 2L0AA 3OYEA 2LT1A 1QQIA 2YUSA 2HQEA 4HLYA 2MI6A 1RAEB 1SD6A 1APLC 2QQBA 2L3QA 4C0GA 2OTLA 2TDXA 5LHHA 4EJUA 4CCOA 4C5GA 4C92B 1ZTRA 1H641 1TOVA 2VXZA 1MJAA 3BC8A 4YRVA 3OSSC 3V4GA 1IUFA 2E2JJ 1YI2T 1JT6A 1I81A 4N4GA 3ZPLA 1EF4A 1I3AA 3LH0A 5LHGA 2RD1A 1E2XA 1Q82U 1U5SA 2LLKA 3RKXA 4LDUA 3PIPA 2DFEA 3J7YJ 2YRCA 1QMCA 3CPWS 5DV5A 3BTLA 5J39A 4A5NA 3JV3A 5FLXK 1YJ9A 4FASD 3C3WA 4M3DA 3JSPA 3J7AY 4XTYA 2CJJA 4HW0A 1OCPA 2L4AA 3GNFB 1IGQA 3EG3A 4C2UA 4WXCA 1W36C 4LN2A 2K9MA 1SAUA 2KAFA 3THKA 5HDNA 1ZLKA 1D1BA 4II2A 3CCUI 1AWXA 4Y15A 2CT4A 4J5YA 4JOMA 4R0KA 3CXCA 1WH5A 4HSRA 4HV5A 3HOTA 4Q5SF 4PDKA 1VUBA 1I5OB 4IO9F 2JQ7A 1ZSGA 4OVAA 2C0OA 3G1JA 4JZ4A 1KU2A 3E0JB 4P5NA 1LDKB 3G4ST 1W5SA 1WJ5A 2KSSA 2PLYA 3G7ZA 1MHNA 1YQAA 2FPDA 1OV3A 2GTJA 1NTCA 1HDDC 2JMAA 2LCLA 2OQGA 2X35A 2P8TA 5BMZA 3OYLA 4XKWA 4M7AC 3SEZA 1VQ6Q 4KH0B 3J81Z 4EGYA 4KA4A 1BIBA 3TOAA 1Q95G 3CUQB 3CC2I 2LP0A 5KYYA 5LJ3h 1M90C 3W6JB 4ZNXA 1UE9A 4U0YA 2HVRA 3ZMDA 5B66C 1T8IA 5ECAA 4ELYC 3CD6I 2MAMA 1VQLA 2UXNA 3TCJA 2MC3A 1W4SA 2W57A 1GCQC 2Y90A 1R5ID 3FRNA 1E3HA 4M73A 3SDBA 3HPGA 4CZCA 4K11A 2EILH 2Y0SN 2VJIA 1M3CA 4XM3A 4C92D 1K0XA 1Y96B 1VQ5Q 5TGTA 3TW6A 2HDWA 4XRSA 3OYFA 1I39A 2LJ3A 3CCYA 4ANJA 3M0SA 2A0FB 1BN5A 4M75B 1YHQQ 1RNLA 5ILSA 1AZGB 1VIFA 4AFZC 1M1KC 1K9MC 5FKNA 4D8DA 3ZQLA 3BTJA 4BQNA 1X19A 1GXPA 1G2BA 4XLEA 2R7RA 4MQ9F 3BPXA 1PCXA 2EZKA 3SEQA 3OYGA 2DFUA 3WTTC 2HBPA 4BY6C 5A2QE 3WXMB 2NS8A 4P5OA 4XL9A 1LNXA 2DYIA 1YX3A 2E1MC 2VBZA 2EIJH 3MVPA 2CUEA 2L7ZA 5DCFA 3BT9A 3ZMTA 2Y9ZA 2DD4A 3M0QA 3BZKA 4OB1B 4A4HA 4IHWA 1BOAA 1FSHA 1KD1U 1Q1VA 3RYRA 3KEOA 3A4CA 2M0OA 1Q86C 2JZ2A 4DJAA 3SFMA 1HOMA 4CO8A 4ASNA 5DUIA 2G6FX 3HFOA 2MFZA 1OPKA 1Q1HA 1YJWT 3D5SC 2IG0A 3WE2A 3CC7Q 3OYKA 4BI4A 1JHFA 3KE2A 1BI3A 2FEZA 1F5TA 3TSWA 5TJJA 1PC0A 2J5PA 2GQQA 2CG4A 1PD1A 4PKCC 3QG1A 1VQOT 3G73A 3L00A 4CCLA 1WJFA 1B6AA 3BR2A 4N9IA 2HS5A 3EG1A 2HQNA 3J7AO 1WFWA 1I8FA 2OUMA 1V5FA 4MNUA 4ZYGA 4NS5A 2MC4A 5JHFA 5C4JJ 2CUZA 5GMKj 3CCUA 5KHDA 4JJDA 2RGVA 1M2VA 4G7HF 5K5OA 5KAFC 3GTLJ 3ULRB 3UWNA 3EUHC 4AYBN 3C4SA 1FOXA 3BG5A 1BIAA 3BPVA 2HU9A 1JI8A 4KNYA 3MKLA 4KN7X 3FK7A 1U9OA 4B43A 3VRZA 1IXRC 2LNBA 1X6OA 1XTDA 2MCNA 3CDHA 3O2PE 2L3RA 4LLNA 2OA4A 2XICA 2LNHB 2LT4A 4ZYHA 1ZUUA 4XK8E 4DBFA 2GOMA 1KJWA 2RM4A 3V42A 3E5UA 2L5QA 1HLVA 4PGHA 3KLOA 3JCMJ 3CC2A 4D1QA 1VQMT 2PNIA 2JTMA 3A8GB 1UHWA 5CJ9A 3QBYA 2JSPA 1FJLA 1TWBA 3CD6A 4J00A 3QPSA 2O9VA 1Q82C 2K3FA 3FC3A 2W84A 4G12A 4M77E 1Y57A 2F2EA 1HKSA 1DPUA 5E8IA 1T38A 3GVAA 4D9JA 4ZN3A 1JTXA 3LSTA 4J19A 3EHQA 2OTLQ 1MMDA 5GANh 2DIQA 1FX7A 1IZ1A 5LEJA 1OZ3A 4EMKA 5CPRB 1D3YA 1ZYRF 1R4MB 2H3EB 3BR5A 3MAJA 2R93J 3HYIA 5IP9J 3S14J 4L9TA 2DOFA 4JLGA 5CVRA 2ZJQF 3REOA 4JX5A 3LSIA 2DEQA 3PUBA 3ZRGA 1U3EM 3K1NA 4XTZA 3ESWB 1Y0UA 1AZEA 2JUCA 4A3IJ 1M5Q1 1YJ9Q 4NNJA 4HT9A 1DPRA 2IIMA 3IRRA 2EKOA 2DDAA 1BB9A 2E6NA 2X85A 4KIGA 2TRTA 1TU0B 5KYUB 3HL2A 4ABZA 3JRZA 3AG1H 4B9WA 1OCOH 2VQGA 2QSHX 5IHIA 4MZMA 3REAB 3JAME 1SHGA 3LA2A 3C1DA 1R8OB 1WVRA 2E35A 1PUFB 1TP4A 1X4OA 4Z8AA 5LJ5d 4A69C 3EHRA 4FHTA 3CCLT 3QOEA 2DA3A 4QWQA 4I2OA 3LWFA 5EZHA 5L8RE 4C92G 5J8FA 3CMEQ 2W85A 4HEA2 3OR2C 1FEXA 1Z3XA 2FBHA 4M72A 1I1JA 1ON1A 4NQWB 3J80K 2HDCA 2RO0A 1W7PB 2Z9OA 2QKLB 1V54H 1BOBA 2DVEA 2DN0A 4CC7A 1BW6A 3EAEA 3I5UA 1S7AA 1YX5A 3GYHX 3CCEI 2QZ8A 4AIKA 3TP3A 1TNSA 3I55A 1OISA 3E7LA 3DEWA 4HYEA 1YTYA 2HL3A 5CLSA 2L2PA 1VQLQ 3OY9A 3KIOA 5CVJA 2DW4A 1KQ0A 3FKJA 2B63J 2VKHA 2RHUA 3OWTA 2QASA 4B9XA 4DOVA 2EV0A 3FBIB 3AL0C 4BYYA 4OMYA 1X2MA 2HSPA 2EK5A 2M45A 1VQNT 2W10A 1JGSA 1KD1C 1XDUA 3EG9B 5FLVA 1HA8A 1MD0A 4KYWA 2VUMJ 2KRNA 2PZ1A 4X6AJ 1WPYA 4EDUA 4AFUC 2H1KA 2VXFA 3QHSA 1K76A 1MBJA 4WX9A 3V8KA 4G7ZF 2OX7A 2DAOA 3OYCA 3QWYA 4XQFA 2VI6A 3N97A 1YWOA 2KBTA 4BNCA 3HJEA 5A2QR 1OI1A 2CV1A 1KQ2A 1JT0A 4WTOB 2HAXA 1PP8F 4IURA 5LJ3e 4A12A 2P81A 5B1BH 1IUYA 2IS4A 4U0VA 4UV9A 3QPLA 1KC8U 2JMCA 3GZNB 1X3WB 4LGWA 2YPRA 1YG2A 2WWYA 8AT1B 2ECZA 4L5GA 2X4JA 2ZGWA 2L9RA 5LJ3f 3LSJA 4CC3A 1TQIA 4J9EA 2SEMA 3E5QA 1LPLA 1P2FA 1WJRA 4BHPA 2DX1A 3M4GA 4FW2A 3A8HB 1VTNC 4AG2C 2DA6A 1Y1WJ 2HSEB 3UA6A 3ZBDA 1BBYA 2OCCH 2V4JC 2WAEA 1BI2A 4RMNA 1QVFA 2K5CA 2XAGA 1VI0A 2KMUA 3EUKL 3FM3A 4Q4ZF 2DE0X 3L9FA 1W7PD 1EX4A 3JRGA 4F16A 3O6BB 3QPTA 2MH2A 4LB6B 5FKKA 2EQRA 3CF2A 4OIOF 1P4XA 4MTDA 4PLLA 3CCUQ 5IYCJ 1XPXA 1AOJA 2QGGA 1LFPA 1X1CA 1IHVA 4M78A 4C92C 2NXNB 1R71A 1UHCA 1XQHA 3CTAA 1BK2A 3QWXX 4M77A 1P4WA 2OD5A 1Y39A 2V8KA 3PVLA 2K5LA 2K9QA 3L2RA 1ZUKA 2DIGA 4JBAA 1CF7B 1B1BA 3U2RA 4AT1B 1RR7A 2IGKA 1S72A 3PJRA 4BAYA 5GAOl 4GXOA 3ASNH 2JOYA 2QQ8A 2RF0A 1UDLA 3PNWC 4PLIA 2JVHA 2Y9YA 1PSEA 1U8BA 2XAFA 3ME9A 4E4HA 5IOYA 2DZ9A 4FSSA 3QP5A 4J6YA 4A63B 4ZN1A 3CC2Q 3BG3A 3CCEA 1O3QA 4R55A 3U1KA 1QBJA 1TT5B 5H2FC 1QNTA 2XPWA 4C0FA 4PJLA 2NOJB 4LK1F 4HG2A 5KYYB 3V8LA 4ZDOA 5CR2A 4A3JJ 4C0DC 2PI0A 3M7GA 3WHBA 4HLXA 2UZKA 2BXYA 4C2TA 3ZQQA 2AHQA 2M30A 4BHBA 3CCSI 3CEYA 1JE8A 2AZSA 3EFOB 2OF7A 5L3GA 2PVOB 2VQLA 2HZYA 1WA7A 2KT0A 1S6LA 1YJNI 2KXDA 2LX7A 2HQXA 2CP6A 5GAOn 3J81K 1Z05A 3MEXA 1R6RA 4QIWN 5FROA 4HF2A 1D3BA 3VYUB 1S5LC 4Z2YA 2FE3A 2FQ4A 3WTVC 3KP7A 4KISA 1D5VA 1ETQA 2QQ9A 3CUQC 1IRXA 3COAC 1QKXA 2JK3A 2KI7A 2VOPA 2FL7A 3D5LA 2DJIA 4HF0A 2EQIA 3RNJA 1KQSA 4F14A 1E6GA 4NL3A 3HKZN 3LH5A 1LB2A 2YSRA 3M0UA 4XLNF 2KPMA 2K7LA 3QYBA 2BVMA 4ZGJB 2AT1B 2HYJA 4NUBA 3P5JA 2CV0A 1KQSP 1BJZA 5DD4A 4AYBA 3FXQA 3TOBA 2P0WA 1JXSA 2O01E 1H89C 1XCBA 5HNFA 3QAHA 2YLBA 3I56I 2QF7A 4HRIA 3CCRI 3M4YA 5CK9A 3JRFA 1U8RA 5H20A 5IHKA 2R7UA 3BTCA 1L3LA 2ZO4A 3ZCOA 2QDLA 1GCPA 2CUDA 1PWTA 3VYRB 1Q86R 4CYCB 1NHAA 4UVAA 2I8DA 1SRLA 4JYKA 3WVDB 4F7UA 5LJ3g 5GAOr 3OSVA 1UG0A 2ZFUA 4BKXA 4KN4X 4CCKA 1X2KA 4LUEA 2ISYA 3I55Q 2D1HA 1R0CB 3W6VA 2K5FA 5LJ3j 3M1CA 1JTYA 4DIQA 2RJEA 2GFUA 3NFCA 4MFEA 3FDRA 3OOUA 4JLIA 3M8EA 1FPQA 1VQKA 5J3BA 2FZCB 5L23A 3HTSB 4U87A 3CESA 1YNZA 1KHCA 4JUVA 1KC8C 3SZGA 2JUFA 2RQWA 2Y4XA 3GBGA 3LL7A 4WWCA 3I9QA 3IAS2 1B07A 2DXBA 1VQ7Q 1I1GA 1QQJA 3CJNA 4HV6A 5FGMA 1J75A 2ZB9A 2M7BA 3PO3J 3WG7H 1T0FA 5K7FA 4EATA 1PYVA 1LFBA 2DL4A 3V8JA 2FNAA 1ONVA 5FD6A 1GBQA 3WGIA 4LLLA 1YW8A 4G6TB 2A6HF 2IS1A 1T3SA 1UMQA 4HX4A 2EA2A 2EIFA 2OAUA 3EETA 1YITI 5IH2A 3JB9J 2C6YA 4KT6A 2CU7A 4YFNF 4OMZA 3CZ6A 1B34B 4X9CA 3SEMA 2EJFA 1UJYA 3L2WA 2NS7A 6AT1B 4FW1A 5KE2A 1UHSA 1MGTA 4AG1C 3WHCA 5D8KB 2R7WA 3PGGA 1SMTA 5AIPA 1E17A 5FD5A 4JS5A 2A68F 1S72I 1UAAA 1KQ8A 1PNJA 4FYWB 2BKDN 2SRCA 2LDUA 2IJLA 2OPTA 1JBMA 1JO8A 3WTYC 3DTIA 4RDUA 2NYXA 1YI2I 2GBQA 3G71T 2EFPA 1U0JA 2PVGB 2LC4A 3ZR8X 1ZSZB 4XONA 1T56A 4HQEA 3NTKA 2YRDA 2MK5A 1FYLA 1WHJA 3PNVA 3MKDA 5EGOA 3I56A 2D1XA 3HOWJ 2LTOA 4LD6A 2BUDA 4IF4A 1T2KA 2NNNA 4N0AA 4MTEA 1VYTA 1MBKA 3V7RA 3IRQA 3BW1A 5L3EA 5I21A 2V9KA 3M4OJ 3S8PA 4RBOA 3E3VA 3E9FA 2K6DA 5F27A 5HODA 2CV2A 2QG9B 1MZBA 3CC4Q 2DTIA 1Z21A 1U5TA 1UZCA 1MV0B 2LG4A 3DEEA 8ATCB 3OBYA 3I64A 1O75A 4FX0A 1XGMA 2ZSHB 2F4OB 1R9TJ 3TW7A 1OU9A 4A4FA 2PX9A 2FBIA 1WQ2A 4RGUA 3TMOA 2A07F 2CZ1B 2FYKA 3VS7A 5C0MA 3BG7A 2KYMA 2D9TA 2CDTA 2MOXA 2DMPA 3REBB 1UG2A 2Y30A 2YHTA 4XTWA 4C9YA 3BR3A 1RUWA 2V8JA 2LY2A 4NC8A 4HDUA 2RKHA 2XDVA 5L3CA 2LNVA 5M9OA 5AIQA 1D8KA 3VSLA 1H8KA 1XNIA 3KLNA 1WJAA 4N4OB 2RJCA 2E3IA 4LG0B 2ZKZA 1QWEA 2Y4YA 2X3WD 5D8LB 1VQPT 2CH0A 1IO2A 3BR1A 4YFXF 1D0YA 2UXXA 1ETXA 4M3FA 3V7SA 2QA4I 2RAEA 1Z3YA 5K1YA 3CCQA 2O4XA 3K4MA 4XU3A 2PU9B 2HDDA 3OMCA 1UB9A 1USTA 2JPBA 3A03A 3M1EA 4ZZLA 1A35A 4U0WA 2IGOA 1A31A 4V2GA 1SF9A 2PUOB 1SG5A 2EQJA 3ZMZA 2ETHA 1GRIA 5CKTA 4HBLA 4ZGEB 2F5EA 5F08A 5M5YJ 2W7NA 3OIOA 3RPQA 4IL6C 1B3QA 3CCVQ 1HW1A 1Y0NA 4LD5A 5K5QA 1UGRB 1WDXA 2EGAA 1ZRFA 5FFXA 3K2ZA 5DD8A 1YIJI 5DYMA 1P9QC 2PG4A 3OOPA 3TDZC 5J6XA 2KFDA 4KIBA 1X27A 2GXGA 3FXUA 4P9FA 2F2VA 2X6WA 2YUNA 2QEXT 3SWNC 2R5YB 2GCXA 4BJTA 1BU1A 1Z9CA 3OSGA 4C8QE 2CUFA 2RHIA 2LKPA 1OR7C 4RM3A 2KMTA 1MH3A 3QJYA 4DBHA 4DYCA 1ERDA 4JPBW 1OFCX 4RMOA 1QW1A 1UGVA 1Q7YU 1YI2A 2W48A 5DM7F 4OMNA 2DT7B 5DUKA 2MG4A 5I11A 4CDGA 5GAN6 5TRDA 2RQUA 2EB7A 2Z2SB 2X4WA 1M9SA 3AT1B 3RDIA 3TO9A 1T0JA 3CBPA 4QQGA 2GIVA 3HZJA 1OX9A 2E60A 2D0NA 4PSWA 5ILUA 2IP2A 1Y07A 2YRVA 2YR2A 1SC7A 4M78B 4A0YA 4RTUA 3JRHA 2L89A 4G8XA 2M3AA 3M9AA 4DNCA 3GTPJ 2V1RA 1U1SA 1PG5B 2OC6A 2HMAA 4XRFA 4PJOB 4JJBA 3GOXA 2ZNZA 1VQKQ 5HOOA 1ZA2B 2VT3A 4J83A 2KR3A 2EBPA 2KDOA 3IH3A 3DLLA 3DPLC 4Y91A 3ZQ7A 5LD2C 1JJ2S 4V2SA 4ZZDA 4AIJA 2RHZA 5F1JA 2BBYA 3G4SA 2ZFWA 2MD0A 2E7XA 3MO8A 3G1OA 1MJ9A 1LQ1A 2XGDA 3BZCA 3KPHA 2R58A 3SD4A 5L3DA 1IRFA 4L5EA 2NVUB 4OMQA 5FLXE 2HNHA 1FOKA 1K1ZA 2RI2A 3QRFF 2O8KA 3HKZA 1XJWB 2VJ4A 1SMYF 1LVAA 2HL5C 3BCAA 5IAYA 3CCST 3J7AW 3MD2A 2E2HJ 1OX8A 1T6SA 4XLCA 1WJDA 2DA1A 2B9SA 3HIFA 3P9IA 2VGMA 1X1DA 2BHZA 1SEMA 4IQ4A 5HKCA 5E79C 1YJNT 3HUGA 3LQQA 4M9SA 4G7OF 1OPLA 3GCMA 1UJ8A 2JA7J 3S1QJ 3AG4H 2M2EA 3J7ZI 3JSOA 2M9HA 1OJLA 2RJDA 1JUMA 4CCJA 1HF0A 2P6SA 4XBFA 3GX4X 2X3XD 3VU3C 3CMET 3JRCA 3QDFA 1D3BB 1NM7A 3LA3A 2V6EA 3GTMJ 2F4IA 2EQKA 1T39A 2IS2A 1W2BS 4E6KG 1ZARA 1UCRA 3HC7A 2ZMEA 5KAIC 3WGGA 2D8HA 2P0QA 2YXYA 2FUG2 4AFQC 2CS7A 2NUTA 1FMKA 1V5GA 4UB8C 3DPUA 4Z88A 3JCMX 2QGFB 2DL7A 3A02A 5KYWB 1MBHA 1ZQ3P 1MKMA 1WI7A 4LDYA 3JCMe 2JN0A 1FY7A 4M78D 4BDZA 3X25B 4A6EA 3ZEHA 2Z0WA 3I56Q 1VQ9Q 4D5FA 3TVTA 2XF7A 4HCCA 2IGMA 4AUXA 2AS5F 4PJOD 5IT9E 1R4NB 1YCYA 2KQRA 2NVYJ 1IC8A 3EFRA 3CCRT 3HOZJ 3JCMf 2D6FA 1X1PA 1XC5A 2AIRB 3DWLE 3E97A 4WK8F 2VODA 1YJWA 1MDMA 2RH2A 4NB5A 1W70A 4BI3A 2O8XA 3P9CA 1T0HA 2VPRA 1OULA 4L5IA 2X1CA 2UWMA 4B3AA 2FU4A 4I7HA 2XV4S 3NGPA 2STTA 3F8NA 2MVTA 4F7UB 5C6SA 4IUQA 4OP0A 3CMAQ 1YE9A 4RGXA 4BEHB 4CYDA 4BE0A 2QXFA 1NG6A 1SVOA 3BDUA 3M9QA 3ZQCA 4OB3B 2L2OA 5EG0A 2P5LC 2CSIA 4Y92A 2O6GE 3RKWA 3ZN0A 2CH4W 3INZA 4J9IA 4XTVA 3HG9A 3TSZA 5FWCA 1NJIR 1D5YA 4FL6A 4MZTA 2CFXA 3OL4A 5HS9A 5ED4A 2C0IA 1WSUA 3HSBA 1QZZA 4ESJA 1K4TA 2XDDA 1K73U 4C0ZA 4C8QA 2K4JA 3DLAA 3ZP5A 3OYAA 2XSDC 2Z33A 3R6NA 1LOJA 5GTIC 3CCQQ 2DM1A 1RABB 4UUSB 1YFHA 5ICEA 2K9LA 3MEVA 5KYXB 1AA7A 4KBMB 3L1PA 5JR3A 1SPKA 2R7ZJ 1TW2A 1Q7YC 4J9GA 1VQMA 3I71A 2EPFA 1WZOA 1YITT 4HNTA 5J47A 3N05A 1BYMA 2V9PA 1AU7A 1SHFA 1FYNA 4QQ6A 4J9BA 5IP7J 2DO7A 3M56A 1QCOA 4MMLA 1ZK8A 4GCVA 2W0ZA 4O6JA 3A1PA 2XF6A 3EGDA 4LD9K 3L2ZA 3CDIA 1DP7P 1QWFA 5LJ3d 3BJ6A 2MW8A 2DQRA 2XB5A 3BTIA 4UVCA 1R1VA 2PEXA 2BY3A 2OTJT 2L7FP 1S72T 3Q9VA 2P7VB 3ABLH 1DGWY 2VBWA 4M9ZA 3MFKA 1VQ4I 4G9YA 1AVZC 2W1OA 3CXCS 1XSVA 1GDTA 1XGOA 3HSFA 3Q3SA 5KVRA 2QBYA 1QVPA 1QVGA 2HDAA 2O0YA 1YS6A 3CCET 2KIFA 3RZDJ 1HSTA 2YX4A 3K1PA 1Z9QA 2VYTA 4I98B 3VUZA 4M7DB 5KK1A 1MBGA 2VT2A 1CQTA 3CCMT 2CSOA 4KUMA 1QVGP 2IXSA 4A2UA 3FXKA 4L0ZB 3FKIJ 2H8HA 2MWOA 2OBPA 1WHMA 3BR6A 5EF6A 1U3OA 2E1OA 1VQ8T 3SHWA 1RLPC 1OCCH 2YWWA 1AKHA 3TQNA 1AHJB 3CCLA 2B8AA 1IB8A 2KRHA 4A3DJ 5DLQE 1R0BG 2ZPGB 2DXIA 4KUDK 3RDVA 2VE8A 1V76A 1IG7A 3F9KA 2ELJA 2IVMA 1QVFP 2WV1A 3NQOA 3G4SQ 1I1SA 3H0IA 1ZSZC 1I5ZA 1FOWA 1O3TA 3QWLA 5J40A 4IQJA 2I5UA 4P96A 4BJ6C 1BR1A 4CC4B 4LLGF 4EJTA 1EV7A 4ZDLA 1QHHD 3SXYA 2OV7A 2CP7A 3RMSA 3JCMg 1O4XA 4K2EA 2X51A 3DKWA 2DF6A 2XRLA 2K79A 1N9RA 2WSCE 2NOGA 1Z9ZA 2DTZA 3OYIA 2DMNA 2MYSA 3IAM2 3GWZA 3UPUA 1Q81R 1HJDA 1XX5A 3ASOH 2A08A 2PJPA 3S15J 1M3BA 1Q86U 1MUZA 3A01A 2HOAA 2BZ8A 3A8OB 1KK7A 3M0RA 4PJOG 3AHUA 1N9SA 2QA4T 5CQYA 2KK4A 3P8HA 4XN0A 3T0YA 1E3OC 4RLFA 3NARA 3FM5A 2MUNA 2YDLA 4I0BA 1VQNA 3K2AA 3CPWA 3ULQB 3URGA 1J3TA 1VYUA 3JTGA 2L3PA 6PAXA 4RGRA 3HBLA 1WJQA 2NUPB 4HT8A 4C30A 3Q1JA 2DL8A 1POGA 1QVTA 4FT8A 2ZXIA 4JK1X 4QVZA 4RTTA 3CPWP 1VQ6T 4P55A 3KP4A 3ZQHA 2M0CA 3NMZC 5E3OA 4M7DD 4YELA 1XS9A 1T98A 4JS4A 3FIWA 1OOTA 1X6BA 3HB9A 2XKOC 1EIFA 3FB9A 4R56A 2HOEA 1YIJT 3OIPA 3KXTA 2OCEA 1G5VA 2DA2A 3R60A 2CWEA 3WTWC 4A4KA 2DYSH 4M7AE 2BE5F 5IT9R 5L3FA 2ZPFB 4LXCA 3PNYA 2FA5A 5J1RA 2W4SA 3NWTA 2KY9A 1Y8QB 3SFZA 4XU2A 1F1BB 1YJWQ 2BGCA 3IKTA 5E3LA 3ER0A 4GLMA 1H3ZA 3OYYA 2YUOA 3RMQA 2QLZA 2XVCA 4F17A 2PUKB 3EYYA 1K73C 2EVRA 2I0NA 1ZA1B 2AXLA 3JB9D 2QQSA 3TP0A 3IKVA 1R1TA 2QI2A 2HQ5A 4EM2A 3MKYB 1IXCA 1B59A 1YBYA 3UDCA 4BXXJ 2LBFA 4XU1A 4LG3A 1VQOQ 2HXOA 4IX7A 3BY6A 2IRFG 1IZ6A 3GUDA 4A3LJ 3RCOA 5LGUA 2BV6A 2JA8J 4EPCA 4D7NA
chains in the Genus database with same CATH topology
2DPPB 4FU6A 3WVEB 1NPPA 4B8XA 3H8ZA 2XHKA 3I59B 2VN2A 2RDPA 3CLOA 5IT3A 2ACJA 4ELZC 5D5XB 5HY6A 1OYWA 3QIIA 1PUEE 2XI9A 4M75D 2L01A 3GW2A 1SFEA 2E12A 4G6DA 4PJOC 1EH8A 2K86A 5FU6B 2XROA 3M8FA 3ERED 4IPAA 3NRVA 2DXCA 2PN6A 2NNYA 1H9TA 5DDGA 3L2UA 3L2VA 2EYQA