1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
1BBYA 3N97A 4KFCA 4M74A 3WE3A 4L0YB 2RNJA 3QPTA 1F9NA 3K1PA 1LEBA 4S05A 5JI6A 2O6GE 4BAYA 4A12A 4LLNA 4HV6A 1S6LA 3ZPLA 3L7WA 5FB2A 3CLOA 4A2UA 3KP3A 3LA7A 2DW4A 4EJOA 2ELHA 3WGGA 4AIJA 3F8CA 2XAGA 2KKOA 5HVQC 1W7PA 4LMYA 3F8FA 4LK1F 4ZYDA 1T0FA 4XBFA 2K02A 2ISYA 4B8XA 5DCFA 4BHCA 5D5UB 3RYRA 3E6DA 4RAYA 2VE8A 5D5WB 1YW7A 3GFMA 2V1UA 2CWEA 1R5GA 3GXOA 3C7JA 2WTEA 4LB6B 1YYVA 5FO5A 1XGOA 5AIPA 3QP5A 5LHGA 2HTSA 1J59A 1FSHA 1UFMA 2GAUA 2CGPA 3C1DA 3SQNA 1IZ1A 4HAMA 3HOTA 1HBXG 2H6CA 3NEUA 1YS7A 5FGMA 1ZARA 1B6AA 1KU9A 4N9HA 3F23A 3BZ6A 3HTSB 2QQAA 4HDUA 1IXRC 3FMRA 5D4SA 2FF4A 2MC3A 2LX9A 3HRUA 1T39A 1R23A 1OMIA 2A07F 2A6EF 4P55A 2IVMA 2R3SA 1XGMA 3E6MA 2XVCA 2ESHA 3MZYA 1FSEA 2VBZA 4G9YA 1FYLA 5E8IA 3U2RA 4HZFA 5F64A 2XAQA 2K7LA 2GXGA 2X4HA 2EA4A 3CUQB 2W85A 3E19A 2Q0OA 2FMYA 1Z1DA 2HS5A 1IUYA 4IXAA 3QRFF 2CSOA 4PGGA 2BGCA 1FP1D 2MBFA 3CUQA 4ASNA 3ZN0A 4YFXF 2Z5UA 4LFUA 5D6FA 2NYXA 4BNCA 2ADUA 3I0TA 3REOA 5TRDA 2QZ8A 3BJ6A 2STWA 4UXNA 5D6EA 2AXLA 2VT3A 5BOXA 2FBHA 1R36A 2Z9OA 3F3XA 5E1WA 2L3DA 2IP2A 5J8CA 3MFKA 1YQAA 1S8NA 1BM9A 3J81K 1Z6TA 3ZMUA 1S3JA 2ZNYA 3IKTA 5BPDA 4ESBA 3WTTC 1I6XA 2CO5A 1I5ZA 4MNUA 3IWFA 2HKXA 2NNYA 1KGSA 2R7FA 3E5XA 4KYWA 1QZYA 3COAC 4IVNA 1U3EM 3H3ZA 1AOYA 3GF2A 1IN6A 2Z99A 4HOBA 3RKYA 4P9UA 4WXCA 2KIFA 2D1HA 3HOSA 1BYMA 2GXBA 1YG2A 3BDDA 1JXSA 1W7PB 3IWZA 2MH2A 1XSVA 5L3GA 3HIFA 1R00A 4A6DA 3FWEA 1AWCA 1I27A 5F1RA 3V7CA 4L9JA 1T98A 3EDPA 3R0AA 2GZWA 5L3EA 2W24A 3WU0A 2FOKA 1JHFA 1Y0UA 5FD6A 3HYIA 4YG2F 1K6OA 4Q4ZF 2FNAA 4WXDA 2P7VB 4OMYA 5DD4A 3WGIA 4ZH4F 1EH8A 1KU3A 5BQTA 1HW1A 3TOBA 2W57A 3H92A 1IRFA 3QOPA 4KNYA 1VTNC 1USSA 2VT2A 1SFUA 1X3UA 4PZJA 2F5FA 2XGXA 2M45A 3E5QA 4G7HF 3DF8A 1KU2A 5E8GA 3TO7A 4P5OA 3LA3A 5HS8A 3JTGA 1Z6RA 1ZRCA 4B09A 3KFWX 1EV7A 2K4BA 1GVJA 3WTSC 3LA2A 3JAMZ 2EK5A 3JAMK 5H6RA 1QVPA 1SD7A 3BROA 3CO6C 3I53A 3K9TA 1I1SA 4A0ZA 5E18F 2DK5A 1J2XA 3BWGA 4IHTA 4L0ZB 5LGTA 4HX8A 2TDXA 3F8NA 3HRMA 1ZYRF 2P4WA 1LEAA 2PEXA 2YX4A 2HGCA 4ESJA 2K4JA 1BC7C 1LDDA 4HF1A 2OBPA 3F21A 2ETHA 3HRTA 3P9CA 2RV8A 3DP7A 5E1XA 2HOEA 3DV8A 4U0VA 3KLNA 4ZZDA 4AIHA 2FA5A 1G3YA 4EM1A 2WC2A 4P96A 2VODA 4L5JA 4I98B 3IKVA 1U78A 3HSRA 1MDMB 4LLGF 5HS7A 1OYWA 4Y17A 1Z9CA 3R0JA 1G6NA 3T8RA 3BP8A 4RGXA 4HF2A 4ETSA 1WRJA 4LD5A 3FX3A 1ZGJA 3D0SA 5EEGA 1DDNA 2A5YB 2EFWA 4G7ZF 2YU3A 5ILSA 3F6OA 3RPUA 3MHXA 1F5TA 4EJUA 1SD6A 4HA8A 2RN7A 2X0LA 1E2XA 3FF5A 4BH9A 1FT9A 1H0MA 3T5XA 1YW9A 4D0PA 1R1TA 4RGRA 2MD5A 5ICGA 5DD8A 3GO5A 1Z91A 4LG0A 2B0LA 1J0RA 4BXUA 1MDMA 2GWRA 5D5VB 2QQBA 3CUQC 2L4MA 3GWZA 4MGRA 2PQ8A 1OR7A 4N9IA 1U5TC 1PDNC 3BPXA 3T8TA 2RDPA 2UWMA 2HDCA 5CVRA 3KP2A 4OU0A 3RI4A 1XMKA 2VONA 1XMAA 2K86A 1WI9A 3V4GA 2KJCA 4EGZA 4WK8F 3GYHX 2DPDA 4NHJA 4KDPA 3V8JA 1ON1A 2P8TA 4GYIA 1HW2A 5LGNA 1YW8A 3M8FA 1DPUA 4MHGA 4MEXF 1C0WA 4ZYHA 2O8XA 1ZHFA 2Y0MA 3MZHA 2G7UA 3SXYA 1BI0A 1V4RA 3VEPA 4P9FA 3TKYA 4YFNF 1OKRA 2XAJA 3FM3A 1J75A 3L2CA 1RUNA 4O3MA 2OZUA 4XSZF 3TO9A 4G7OF 3RYPA 4ON0A 4MQ9F 3MAJA 3CDHA 4L18B 2OU2A 3KETA 1U5TB 1QNTA 4O5VA 3R60A 2A61A 5AIQA 2OAZA 2FEZA 1R22A 4M9ZA 1B9MA 2DLLA 1FYKA 2QQ9A 4EM0B 1XDUA 2XIGA 2PLYA 4UVAA 2V1DA 2M1BA 3OV8A 3FMQA 2MH9A 1HSTA 2UXNA 5D8KB 4AIKA 3CO7C 3KEQA 2FMLA 2H94A 2M8EA 3TDZC 5DCMA 4HBLA 1ONVA 3F8BA 1O3QA 1DPRA 2ZCWA 4PGHA 2COMA 3RKXA 5KK1A 2DQLA 2HWVA 1B1BA 2DFIA 3NQOA 4TV7A 2FNPA 3LFKA 1XB4A 3RKWA 2PFBA 1T38A 3QP6A 2P5VA 5E20A 3RPQA 5KVRA 3BOQA 3O6BB 3O3KA 2BV6A 3F22A 2LF7A 3WTWC 4O6JA 5D4RA 1XSDA 4MEYF 3L00A 4LK0F 2P7CB 3ERED 5JVTA 2XAFA 1ZGAA 2R7DA 4EVIA 1TQIA 1D3YA 5EEHA 1HKTA 3TGNA 1WKMA 2QYOA 3S2WA 5K5OA 3LAJA 1USTA 4ENKA 5HDNA 4XLPF 4KUMA 2UXXA 1L3LA 5LRRA 4LLLA 1D5VA 1TW3A 2P5LC 2F5EA 2GA2A 2PBIA 4HQEA 3V8KA 3QU6A 4LB5A 5DV5A 2GQQA 2P6TA 3KEOA 2XASA 1ON2A 5DEQA 2QBYB 2PJPA 4H0EA 2MA3A 2FBIA 4M9SA 3LQQA 1JGSA 2C6YA 4CXFA 2LF8A 4CZZA 3ZMSA 2WV0A 3RJPA 1QPMA 1UCRA 3KZYA 4DNCA 3B73A 3HHGA 4N0BA 5D5XB 4FT8A 1R1UA 3EETA 3KE2A 1XDSA 3SZPA 2DO7A 2EFQA 1LQ1A 3EQLF 3R6SA 4UHTA 2FU4A 4U88A 2MLKA 4OIPF 4RB3C 1PP8F 3W6JB 1LB2A 4UNOA 4ESFA 1O3TA 2GA1A 1J7KA 1FWZA 2XKPA 1U2WA 2XAHA 1XCBA 4HYEA 5H6QA 5ICCA 2H27A 5K1YA 1GXQA 3RTRA 4Y13A 5BMZA 2QLZA 4DQ2A 1ZN2A 3HSEA 3JW4A 1QW1A 3L09A 2JTVA 2UZKA 5ED4A 5JHUA 2CW0F 2HTJA 2J5PA 2ZBKA 3AAFA 1MJBA 1K7AA 2FXAA 2DI3A 4NQWA 1S7AA 4IF4A 4OOIA 2IA0A 2L01A 4G6DA 1REPC 2K27A 4EMSA 3GFIA 1FX7A 2FSWA 3HUGA 3F6VA 2GCXA 2QWWA 1SD4A 3J81Z 4EJWA 1O3SA 2HYFA 1B9NA 2YSRA 4MQVA 2RC4A 3DPTA 4I02A 3KP5A 3BY6A 1IXCA 5DUKA 2VBXA 4RGUA 2ACJA 4BQAA 2HZTA 3QU3A 3ECHA 4A0XA 1O57A 4CGZA 1RZ4A 3K2ZA 3ZN1A 2IJLA 3FHZA 3E3VA 5JR3A 3OOPA 2NAZA 1BJAA 1MD0A 1ODDA 4WWCA 1FBQA 2PN6A 2DU9A 2NRAC 3M9AA 1XCVA 1SFXA 3GFJA 4EJTA 4JBAA 4L9TA 2LKPA 3HRSA 2VC0A 4U0YA 2Y48A 1W5TA 1BI1A 3N4MA 2XRNA 3GUDA 3MQ0A 1XGNA 2G7HA 2WWYA 1SD5A 2E7XA 3C3WA 1IXSB 1T2KA 1STZA 1KA8A 4ENJA 3PQJA 5A2QK 4I0BA 1B4AA 2Y75A 2JSCA 4CHUA 1R5HA 1ZH5A 2EFPA 2HQNA 1B59A 5IT9K 3FM5A 1QGPA 1XGSA 2NNNA 4A0YA 3I54A 1D8JA 4AWXB 4GO1A 4LJZF 3U1DA 4FX0A 1IN7A 4UVBA 5CVJA 3ZMVA 1Z7UA 1H9GA 4XRFA 4I2OA 4EGYA 4ENMA 2DPUA 3VOEA 2STTA 2FRHA 3O2PE 4OINF 1MJAA 3WTZA 2KRFA 4I01A 4IPAA 1R7JA 3F8MA 4EM2A 2VOPA 2YX7A 4OIOF 2FE3A 1UHWA 2HFHA 4CO8A 2XROA 3M7GA 5AONA 1IRGA 2EFOA 1IN5A 2H3JA 3IRRA 1T6SA 2VE9A 4CICA 2A3SA 3BJAA 2JRTA 5HLGA 2BEOA 1J9IA 4CYDA 2MLGA 2QBYA 2OZ6A 2D45A 3I64A 1KYWA 1FY7A 1O3RA 4BHPA 4S04A 3DEUA 5CLSA 2W25A 2ZMEB 4AD9A 3HHHA 3ABTA 1BN5A 1KU7A 5TJJA 1HW5A 2HKOA 1FLIA 2LNBA 2BYVE 1YTYA 1ZG5A 4G8XA 3ZMZA 1ZAOA 3HSFA 4FHTA 1BC8C 3E6BA 4ZZLA 1PP7U 1FC3A 2ZO4A 3BPVA 1FP2A 4E70A 2D2WA 2V79A 3RIRA 2DT5A 4HLXA 2A6HF 5LEKA 3MWMA 1ZLJA 2VXZA 1ZG3A 4CDGA 1DP7P 4I0AA 3DXJF 4WCGA 3CTAA 4PCQA 2QUFA 3WU1B 5BS6A 1W7PD 1TW2A 2BBYA 2IA2A 4RS8A 4HLYA 1K79A 1Q1HA 2OD5A 4UV9A 4L5IA 2E1CA 2EFNA 2O3FA 4Q48A 4EJVA 1TNTA 3DPLC 1UB9A 2ISZA 2CYYA 1GHCA 4QWQA 2OQRA 3K69A 1CF7A 3GZ5A 1OYIA 5HS9A 3BJOA 4ZYGA 4KIBA 1G3WA 4KN4X 1L0OC 2RGVA 3SZTA 3Q9VA 1WQ2A 3ZP5A 3KP4A 2RQPA 1BI2A 4IRGA 4KMUX 4JK1X 1OYYA 4BHBA 1ZG1A 1CF7B 4MTDA 5LEJA 4BYYA 3P9KA 3KLOA 5ILVA 1WWXA 2P5KA 5DDGA 4OIQF 1O7LA 3ZMDA 5BPIA 1FZPB 1HKQA 3RDIA 3V7RA 1YFHA 3ABUA 2G9WA 2VC1A 2HYGD 2K5FA 2OA4A 4YFKF 3M8EA 1P4XA 4KICA 2VBWA 3KP6A 2QENA 4R79A 1ZRDA 2CQKA 1TQMA 4OIRF 4XSXF 2K4YA 4HX4A 5D8LB 2Z33A 1CGPA 3LWFA 2P6SA 4RB0A 4KN7X 3QAHA 3TO6A 1G3SA 1QZZA 1SAXA 1FOKA 5FFZA 2XKOA 1FBSA 3J80Z 4PDKA 5CVIA 5LLQA 1BOAA 1RI7A 3I4PA 3CJNA 2XHKA 2A69F 2RKHA 1WSUA 1TBXA 3E5UA 5LHIA 1SMTA 2J5OA 1S29A 2E7WA 2GIVA 2HEOA 4XLNF 1IAWA 1IN4A 5LHHA 1ZLKA 2A68F 4U7BA 3T1BA 5FD5A 5CJ9A 2YR2A 2V6CA 1KQ9A 3TDUC 3MEXA 1UHMA 1XD7A 2ZKZA 3EUHA 2E1NA 5FLXK 3QPHA 2L54A 1YLFA 1PUEE 3LQRA 3WODF 2EJRA 3PQKA 1RIOH 4EQQA 4HDVA 1ZRFA 2L4AA 3D5LA 4ZYEA 3R4KA 5L3CA 5L3BA 4M9XA 3TQNA 2EB7A 1FPQA 5CVVA 4G6QA 3FXQA 1GXPA 2M30A 2Q8KA 1YIOA 4ENNA 1RNLA 3K1MA 1EH7A 1DUXC 1BI3A 2XV4S 3E97A 4OMZA 4IRHA 4Y15A 4IJAA 2L02A 1IN8A 2KIUA 3Q5FA 3WTXC 3IC7A 3ULQB 3WTYC 2ZJ2A 5JFRA 1K78B 3HTUA 1XN7A 3JTHA 2BE5F 1RUOA 2DTRA 5A2QZ 3I71A 2M5WA 3EYYA 3ELKA 2O61A 1IF1A 3P9IA 2D1VA 1J5YA 3GVAA 1MJ9A 4UV8A 5HDKA 5LBQA 3E6CC 3GLXA 4F7ZA 3J7AO 3L9FA 4AVPA 3KCCA 3GZ6A 2YPRA 5H20A 2DAOA 1FNNA 3FZVA 4HW0A 4HV5A 4IHSA 3MCZA 1P2FA 4WXHA 2IPQX 2K5IA 1G4DA 1W4MA 2K5LA 3I59B 2EV5A 3W6KB 2RVCA 4KT5C 1R1VA 4GCVA 4HF0A 3GEZA 2DBBA 2HQRA 4M6YA 1A04A 1LNWA 3WTUC 1IW7F 5E17F 2ZMEA 1H9TA 5K5RA 1FYMA 1MKMA 3U9GA 5J6XA 1NHAA 1LDKB 1BIAA 4M71A 3TOAA 3KZZA 3GX4X 5HLHA 5CYVA 2QVOA 5L3DA 3VB2A 1BIBA 4NB5A 5IT3A 2PG4A 1O7FA 3VODA 2EV6A 3V7SA 4A5NA 3ZQ7A 3WGHA 2JT1A 1MZBA 2F2EA 4R8HA 3VFZA 4LGWA 3FMSA 2HR3A 2PI0A 3NRVA 2KIMA 1QQIA 5HDGA 5LRSA 4WF2A 3ZMTA 2Z3YA 2QM3A 4LG0B 2F5DA 3I5UA 2EA2A 1KQ8A 3LAPA 3ML6A 4EV0A 5E1ZB 4KIFA 3JSOA 3DKWA 2PMHA 3SFZA 4YIIA 1U8RA 2ZXJA 4RAZA 4IRIA 3T0YA 3Q9SA 3K0LA 2NS0A 4RB2C 2O0YA 3GFLA 2VN2A 4I7HA 2M87A 3IRQA 4K2EA 1TNSA 4KA4A 3C18A 4Q47A 2FQ3A 1G3TA 2LSOA 5FFXA 2EV0A 3FXUA 3ISPA 5ICFA 4L9NA 4R1HA 3ROUA 4A6EA 5FLXZ 1TTYA 2JZYA 5K5QA 4L9VA 3ECOA 1QBJA 2OQGA 1KQ0A 5ICEA 2H09A 4RB1A 1D8KA 3F72A 4M72A 3WG9A 4JQFA 4I09A 4U7DA 1W5SA 4M6XA 5CVUA 1HSJA 1LJ9A 5DYMA 3P7NA 1F4KA 1OPCA 3PFIA 3DQVC 1YS6A 2DQRA 2Q2EA 3SHFA 3V8LA 2O03A 4HQMA 5ILUA 3CUOA 2JPBA 2FBKA 3K1NA 4U0WA 5F6FA 1TLHB 5L3FA 2KJBA 2V9VA 2VOOA 5DUIA 3EYIA 1V3FA 2XUBA 1MGTA 3I58A 1P4WA 4Q5SF 2W84A 4RGSA 3FXRA 2CFXA 1P6RA 1SFEA 5HLIA 2AS5F 1HQCA 5ERIA 4M73A 1JHHA 2H6BA 1XSXA 2DK8A 5LGUA 2VBYA 1ZREA 1K78A 2IA1A 4WX9A 1Z05A 3G3ZA 3IL2A 1QO0D 4KMFA 6PAXA 3I59A 4UVCA 4GGGA 1TQPA 1U5TA 4HX7A 1HKSA 3M1EA 4G94A 1FBUA 4FX4A 4GXOA 5J8FA 2EWNA 2V1XA 3G73A 1S7OA 2IRFG 1U6GA 1F1ZA 3KP7A 4MTEA 4A5MA 4UUVA 5DCMB 3IHUA 1HXDA 1KYZA 1YO5C 1E17A 2ZNZA 3WTVC 3DFGA 1ULYA 1LDJA 4Z2YA 3H3UA 2ESNA 1LVAA 2LDUA 1P4AA 3R61A 2F5CA 4KIGA 2PMUA 5IT9Z 1EH6A 1R58A 4GYGA 3GW2A 3WE2A 2ZFWA 1I1GA 2JPCA 2CG4A 3LSTA 1P92A 3JSPA 1SMYF 3J80K 2IW5A 3B02A 2IT0A 5HOOA 4QLCU 1JE8A 4YIFA
chains in the Genus database with same CATH superfamily
1BBYA 3N97A 4KFCA 2Y30A 5GMKe 2HQEA 4CSWA 4JUVA 3MVPA 4M74A 3JCMh 3WE3A 2R0QC 4L0YB 4ZDOA 2DTHA 3UATA 3I56Q 4MFEA 2CP2A 2RNJA 3CZ6A 3I3LA 3QPTA 1NJIU 2DFUA 1F9NA 3K1PA 1LEBA 2DTZA 1WQ7A 1TSFA 4DEXA 4D8KA 3DEEA 2QGGA 3F9KA 1JJ6C 1RR8C 2MYSA 4S05A 2DETA 5JI6A 4IIOA 1ARKA 2O6GE 2ECZA 4I76A 3JAMR 4X0GA 1BB9A 1GBRA 2XRLA 1K1ZA 4BAYA 4A12A 4LLNA 1JT0A 4HV6A 1S6LA 4CH7A 3ZPLA 1YIJT 1K76A 3L7WA 5FB2A 1FIAA 5I2SA 4MMKA 4X9CA 3CLOA 3U21A 3FDYA 1HA8A 4A2UA 4NS5A 4KUDK 3KP3A 5IYDJ 2O01E 4HT8A 3LA7A 3BG6A 2DBKA 2DW4A 3CPFA 1KQ1A 4EJOA 2ELHA 1FTZA 3EAEA 3WGGA 2A0FB 4X34A 4AIJA 2KLOA 4X6AJ 1Y0NA 3F8CA 1Q81R 3GTQJ 4HNVA 3M07A 1H8AC 2XAGA 2E4HA 4BE1A 1M1KU 1VQ9Q 1VIFA 3ABKH 3GBGA 5FU7C 2MC4A 3H5RA 2C0OA 3UPUA 2ELKA 2KKOA 5HVQC 1W7PA 1MNMC 4C8QF 4LMYA 2JQ7A 3F8FA 1VQOI 3VUBA 3CMEQ 2OF7A 2X1DA 2RHUA 1NEBA 2X6XA 4LK1F 4ZYDA 1T0FA 4C30A 5M5YJ 1WLPB 4XBFA 3LGFA 5GJWB 1UJYA 2K02A 2ISYA 2W82A 4B8XA 1YIJI 1FXXA 2BW3A 1KK7A 3EFOB 2L9RA 5DCFA 4BHCA 5D5UB 2L89A 4GBQA 3WXMB 3RYRA 4IEJA 2VKHA 3MP6A 2F48A 1WIEA 4C92B 3CC7T 3OIOA 4XU3A 2EBPA 2QKLB 3E6DA 4RAYA 3A8HB 2UUZA 4CCJA 4ATOA 2VE8A 2HSPA 1YJ9T 4FW2A 1X19A 3BFMA 5D5WB 4KH0B 4Y92A 1VQKA 1K6YA 5J39A 1YW7A 2KPMA 3GFMA 5F0CA 5KAIC 2E1OA 1KZHA 2BY0A 2V1UA 2CWEA 4FM4B 3RUXA 1N75A 1R5GA 3GXOA 4NC7A 4BJ6C 1YCYA 3C95A 3ZEHA 1I3QJ 4E7JA 5JVGF 3C7JA 2WTEA 4BE0A 3CP8A 4LB6B 1YYVA 2L2OA 5FO5A 5D7UA 1XGOA 1RI9A 1UGVA 1AD5A 2OC6A 4JJBA 4BD3A 3CQZJ 5GMKi 3UNGC 3TEDA 3G6ET 1C1AA 4C5HA 5I21A 5AIPA 3QP5A 3NWSA 3H36A 5LHGA 1OJLA 2HTSA 4E7ZA 3JRDA 2Y90A 4FW1A 1VQ6T 1NPPA 2DL8A 2RI3A 2HL5C 3JB9I 1PSEA 1J59A 1FSHA 3OSFA 2D1XA 1UFMA 2GAUA 2JNGA 2CGPA 5CIUA 3C1DA 1KQSP 4PJOD 4F7UE 1BW6A 3JRBA 3VS5A 4CC2A 1Q7YU 3SQNA 1IZ1A 4HAMA 3HOTA 3MD2A 2FRWA 1HBXG 3W2VA 2H6CA 3NEUA 1TS9A 2XHCA 1SC7A 2K3FA 2EILH 2V1NA 1VI0A 2IG0A 1YS7A 3M4GA 2XSDC 3NPFA 1ENHA 5FGMA 1ZARA 1N8RC 4M3GA 1WJBA 3BZCA 3OYMA 3H1CA 2QG9B 1B6AA 1KU9A 4N9HA 5B1BH 1NK2P 2OTJI 1IHVA 1WQWA 3H0HA 3PNWC 3VU3C 4JX6A 2BY3A 2JA6J 1YITA 1UAAA 3OY9A 3FXMA 1IGQA 2HQXA 1QP2A 3F23A 2CU7A 2IEKA 2FUG2 3BZ6A 3HTSB 2MFZA 2PJRB 2EGAA 4XKCA 1M27C 3HPGA 1OULA 2EAYA 2O4XA 5LL6S 2QQAA 5GAMh 3K6GA 3CCLT 1Y57A 2L7ZA 2C0IA 3OMYA 2NUTB 4HDUA 2WACA 5GAOp 2K7AA 1IXRC 2ABLA 4B44A 3FMRA 2HOSA 1W0TA 5JHFA 5D4SA 3HC7A 2FF4A 2MC3A 2PU9B 3C94A 4C0DC 1YHQT 2M0OA 2LX9A 2OI3A 3HRUA 5HNFA 1R4MB 3J7AW 4YTLA 1T39A 1R23A 4HNUA 1C0MA 1OMIA 2LC4A 2A07F 4A4KA 2HU9A 2WAEA 2A6EF 1Q86C 3FISA 5EG2A 3CXCP 4P55A 2E6NA 2IVMA 5TISC 1PRLC 4ZGEB 1JO8A 2R3SA 1ZLMA 1H89C 3OSSC 2V9PA 5M5XJ 5HK0A 2M4GA 4J19A 1XGMA 3E6MA 1WGSA 3BR6A 1G2HA 2XVCA 1HD3A 2ECBA 2ESHA 1NLOC 3MZYA 4G6TB 3E7LA 1ACIA 3CEYA 3H6ZA 2XG8D 3PFYA 1FSEA 1WFXA 1GV2A 2VBZA 4G9YA 5E8IA 1FYLA 2MOXA 2YUPA 1MMGA 1VQNA 1FMVA 1J09A 4ITVA 2DA1A 3U2RA 4HZFA 2DD4A 4Y52J 3EHRA 1X58A 5F64A 4HPQA 2PMZN 2XAQA 3EG3A 3R6OA 2K7LA 3P8DA 3JCMb 1WYXA 2GXGA 1W36D 3U23A 4CCKA 2X4HA 4DJAA 1MNDA 2NS7A 3K4BA 1ZBXA 2EA4A 5HKCA 4C5GA 3CMEA 4JZ3A 1V1CA 3CUQB 3L1PA 2LD5A 2W85A 1W1WE 3E19A 1D1BA 2RK1A 3CCVA 1CKAA 2F5TX 2YLBA 3REBB 4C0GA 2Q0OA 4AUXA 1R0CB 3OW2A 4HNTA 2CV2A 2FMYA 1Z1DA 3PJRA 3H9NA 1BJZA 2K3YA 2HKQB 5KCOA 1BKBA 1OR7C 2HS5A 4HRIA 1W2BP 5A0GA 5EJCA 4IXAA 5CQEA 3QRFF 1IUYA 1RL2A 4A53A 1U1SA 3JAME 2CSOA 3VYUB 2CZ0B 2E36A 5GAHJ 2RJDA 4PFOA 3ZXSA 2VUBA 1IRZA 2NVYJ 2BGCA 4PGGA 1FP1D 2MBFA 3CUQA 3HTRA 4DOVA 5FU6C 4ASNA 2E12A 3IP4B 1MH3A 2MF2A 3ZN0A 1X1PA 1H641 4YFXF 2Z5UA 2RA2A 4LFUA 1Q95G 1IREB 1WH5A 2K85A 3PSFA 3WVDB 1M1KC 1Y39A 3S17J 1YITT 2MWPA 2CQNA 2DCEA 5D6FA 2RI2A 1LFPA 2CW8A 1VQ4T 5L8RE 2NYXA 4BNCA 2EIKH 4ZDLA 1QCNA 4M77G 2ADUA 4KITB 3GF5A 1PNJA 3X24B 3I0TA 2NOGA 2OCEA 2XPWA 3QYBA 3REOA 1H3ZA 2VQHA 1QZEA 1X2KA 5J3BA 5TRDA 3BCBA 2QZ8A 3BJ6A 1I8FA 2HCKA 4L6V5 3RBBB 1Z67A 4UXNA 2STWA 5D6EA 1I6HJ 2DBMA 2K40A 2AXLA 2VT3A 5IOYA 2B63J 3ZCOA 5BOXA 2FBHA 1R36A 3GMEA 1XJWB 2LG4A 4PJLA 3M54A 4QSHA 4R56A 3M56A 5LD2C 2MUNA 5E79C 3HKZA 3H35A 1A31A 3F3XA 2KZGA 5E1WA 1EKEA 2Z9OA 2WY7Q 2L3DA 2LR8A 4JYKA 4W97A 4BQOA 2EYXA 4EPCA 3SB2A 3QUIA 5FLXE 2P81A 1UG2A 2IP2A 1X3ZB 4LG3A 5J8CA 1YQAA 3MFKA 3CCQQ 2BY2A 2COZA 5GAMd 1VQNQ 4BUPA 2E2JJ 1S8NA 1BM9A 3J81K 1EA3A 1Z6TA 2LQ8A 2KRNA 3FJ5A 3ZMUA 4LE9A 3JRIA 5GMKm 1MW7A 5LJ3g 3SYTA 4A54A 4DBRA 4IHWA 1A0NB 1S3JA 3H9JA 2EJ9A 2I10A 9ANTA 2Y9ZA 2ZNYA 1WFWA 3DBRB 3IKTA 2NVXJ 1LPLA 3QYHB 4FYXB 4JJCA 5BPDA 4ESBA 3WTTC 2KT8A 4XU0A 4A3DJ 1ZQ3P 4B9WA 2M7AA 1I6XA 2CO5A 3OYLA 1I5ZA 3CC4T 3K2AA 1ZSGA 4FYVB 3CCUT 5GTHC 2DL7A 5GAOl 3E9FA 1ACMB 4MNUA 5IP6A 3IWFA 1V5EA 2HKXA 2NNYA 3I5SA 4M77F 3K70D 4KGVB 4UUSB 4DOWA 2EYZA 2YUQA 3FKIJ 4X1EA 3OIPA 3FXJA 1QRYA 4N4HA 3E5XA 1KGSA 2R7FA 2M1HA 2F6CA 4JZ4A 1Y0MA 4KYWA 2DFHA 4FQGA 1SANA 4FASD 1QZYA 1N27A 3COAC 2E6ZA 4E6RA 2ZJPF 5LFAA 4IVNA 2XICA 2CZ6B 4QQGA 2LCCA 3BTCA 4C3IJ 3H3ZA 1U3EM 1YI2Q 1AOYA 1HF0A 1TXQA 3CCEI 3GF2A 5FKOA 2YUSA 1IN6A 1O4XA 1TH7A 1TUDA 2Z99A 1QWEA 2E64A 4HOBA 2KRSA 1KSWA 3ZFJA 3CD6Q 2ZXIA 5E3LA 2V6EA 3RKYA 2DMTA 4ZJZA 4P9UA 4WXCA 3AKZA 2KIFA 2DL4A 2CZ7B 2EQIA 1XTAA 3VS6A 1YIJA 1F36A 3I5RA 4CCNA 4LXCA 2XPVA 2D1HA 3Q3SA 3HOSA 5GAN8 2GXBA 2ZXHA 1YG2A 3BDDA 1YOVB 3IH4A 1WJCA 3K70C 1JXSA 3A03A 1W7PB 2Y9YA 3RR6A 1Y96B 2QA4T 3IWZA 3HPWA 2MH2A 1SSHA 1XSVA 5L3GA 2KSSA 3HIFA 4BACA 1R00A 2BZTA 1SEUA 3VYGA 4A6DA 4DBHA 3BR1A 3FWEA 1AWCA 5CKEA 2DXUA 5GAOn 2HPIA 3CPWP 1I27A 1K73C 5F1RA 2VWFA 4LIVA 3V7CA 3CMYA 4MZMA 4L9JA 2CH0A 2M0MA 3M57A 1T98A 3CMEI 3S1NJ 2L9VA 3EDPA 3R0AA 3SEZA 1G59A 1YJNI 2GZWA 5L3EA 2DKGA 2XI9A 1W5CC 3M0QA 2W24A 2BZYA 4UB8C 3WU0A 1VQ8T 2FOKA 3S1RJ 3UDCA 2JN6A 3OS5A 1JHFA 1Y0UA 5FD6A 4RKUE 3VKIA 3HYIA 4M7DG 1DQUA 4YG2F 3HL8A 3OYJA 3OB9A 4KGZB 1K6OA 4Q4ZF 1GVDA 3X2QH 2FNAA 2JM9A 1UECA 3M0TA 3K4LA 2F2VA 2KY9A 4RTVA 4WXDA 2P7VB 1C6VX 2QQ8A 4OB2B 4ANJA 5DD4A 4OMYA 3GCMA 3WGIA 4ZH4F 3GTMJ 2XC7A 1B34B 3CCRI 2IGMA 2DXIA 1EH8A 3QYFA 1KU3A 4ZC3A 2VUMJ 1ZGWA 5BQTA 4BY1J 2AXTC 1HW1A 2ATCB 2FD5A 3TOBA 2CSIA 2QEXQ 2W57A 3LSPA 3H92A 3CMAA 1IRFA 3QOPA 4KNYA 1OZ3A 2XD0A 3BCAA 4KT0E 3D5SC 1ETXA 4FSSA 4UC4A 1VTNC 1USSA 1TUGB 2VT2A 2DMOA 1F1BB 2ZZDA 2M4KA 1VNDA 4V19K 1SFUA 4QT7A 4C0FA 2LBFB 1X3UA 4BEHA 2R5YB 1V76A 2ID3A 1MBKA 4FE7A 2D8HA 2KYMA 3TU4K 3E9GA 3N05A 4FT2A 4PZJA 1V55H 2F5FA 1UFFA 5KYWB 2XGXA 1APLC 2JN0A 2M45A 5FJ8J 3E5QA 2L3RA 5EC7A 4G7HF 3DF8A 3PT9A 1KU2A 4JJDA 3P5JA 2PUOB 3SWNB 1RPWA 5E8GA 4KISA 3TO7A 3GTOJ 1ETKA 4P5OA 2L2PA 4RDUA 3LA3A 2BHZA 2PQWA 2V1QA 5HS8A 3RQ4A 2DYBA 4GFBA 2BIVA 1H92A 3JTGA 1RQ6A 1Z6RA 1ZRCA 3UF4A 5HNHA 1YE9A 4M78D 4B09A 1MH4A 2DA7A 3KFWX 2HBPA 3CCYA 5EDNA 2O7OA 3LLRA 3I55Q 2RQVA 1RRJA 1EV7A 2KL4A 2VKEA 2NVUB 1AOJA 4A69C 3M53A 3QDFA 4J7FA 1N77A 1XC5A 4QVCA 2K4BA 2X48A 4JS4A 1GVJA 3OW2P 1YIJQ 2ID6A 2KRCA 2VXEA 1VYVA 4MFDA 1JB0E 3WTSC 2E60A 4OMFB 3RMSA 3LA2A 3JAMZ 2HL3A 4HXJA 2EK5A 3JAMK 1TWGJ 5H6RA 2CYZB 5CKBA 1QVPA 2KDSA 4H4KC 1SD7A 3BROA 3PIOF 2I0NA 3CO6C 1F43A 2EGEA 5J4YA 3I53A 3K9TA 1LFUP 4WCIA 1I1SA 4A0ZA 2EJFA 4NOYA 1X1BA 5E18F 3SFIA 4JLGA 3Q1JA 2DK5A 5HLTA 1OX9A 1N8RU 4M7AC 1RUWA 1J2XA 3BWGA 2DD5A 1NZ9A 4IHTA 1KHIA 4AFQC 1X2MA 4M6VA 1RLQC 2QGUA 5LGTA 4HX8A 3A01A 2PMZA 2TDXA 4L0ZB 1ABOA 3F8NA 3HRMA 5CCAA 3S6WA 1ZYRF 2P4WA 4DOZA 1N6AA 1MBFA 4M78B 4X9DA 1EJ9A 4CA0A 2XF5A 2DDBA 1ZHIA 1I50J 1V5FA 2GFUA 1LEAA 1MHNA 2RH2A 1NYGA 3CD6I 2PEXA 4BQNA 1FJLA 1ZUUA 3GNFB 4C5EA 3OA6A 2YX4A 2HGCA 4JP0A 2JVHA 4ESJA 5HY6A 2OCCH 5GMKl 2K4JA 2FPFA 2X9HA 1HJDA 1U9OA 1VQNI 4MMLA 1IDZA 1BC7C 1WGXA 2MABA 1ERDA 1LDDA 5GANg 2M34A 1N8RR 4MO7A 4HF1A 3CCVT 5J3LA 5CPRB 3VS3A 1ZBJA 2OBPA 3F21A 2ETHA 3TSWA 1D0XA 3HRTA 2RV8A 3DP7A 3P9CA 4ORZA 1KC8C 1W6XA 5E1XA 3MEVA 1UZCA 3A2KA 3LW5E 2HOEA 3OBWA 3DV8A 2P0WA 3VS1A 2AZSA 4U0VA 3KLNA 4RAFA 4ZZDA 2R5ZB 4RUGA 2QTXA 1M30A 2DEQA 4NC6A 2RQTA 4N4NB 2DOAA 3QJYA 4AIHA 2FA5A 1G3YA 4OB0B 2JS2A 2J6KA 2Y0SA 4EM1A 1NK3P 1RAFB 2WC2A 4P96A 2VODA 2ENMA 4I98B 4L5JA 2R7TA 3IKVA 1U78A 1AHJB 1U5SA 3OYNA 3HSRA 3FB9A 2LX7A 3CCSA 1MDMB 1HOMA 4LLGF 5K7HA 4M77D 2LREA 2RQQA 5HS7A 1OYWA 2FHDA 4Y17A 1M8VA 1Z9CA 3JCMQ 3HUGB 3R0JA 4AG1C 5LJ5f 3SZGA 3ER0A 1G6NA 3LFUA 2KE9A 4PJOG 2DO3A 2E3IA 1Z0XA 1UJ8A 3T8RA 3BP8A 2CP7A 4RMOA 3CC4Q 4KT6A 1BCOA 1Q7YR 2DXBA 4RGXA 3GIBA 3HOUJ 4HF2A 4ETSA 3LSKA 3PGGA 1WRJA 2HNIA 2RK2A 2E10A 2L8DA 3EH2A 3S3OA 4C5IA 1GRIA 4LD5A 3FX3A 1ZGJA 3D0SA 5EEGA 1DDNA 4BJ5C 2LH9A 4B43A 3ME9A 1WJRA 2A5YB 2HI3A 2CP6A 4OP0A 3TP0A 1TC3C 3LNQA 2LT1A 2EFWA 4G7ZF 2FJ1A 1CSKA 2YU3A 1JXMA 3TSZA 1AA7A 2VXFA 5ILSA 3CCLI 3EUAA 4XTWA 4KRTA 3F6OA 3RPUA 3MHXA 1F5TA 4EJUA 1NH3A 3S2DJ 1YJWI 2MZ4A 4C8QG 1SD6A 2ZB9A 4M3EA 5HODA 4M7AF 1GUUA 2LP5A 8ATCB 5EG0A 4JX5A 1VUBA 4HVVA 3ZQQA 1QHHD 3OYFA 4HA8A 2HD0A 3CDIA 2A5WA 2EBIA 1IGUA 2RN7A 1QP3A 2VC8A 3MKDA 4V2GA 3QOEA 1W1FA 2X0LA 1E2XA 3FF5A 1KONA 1CKBA 4BH9A 2KDZA 1FT9A 5IPAA 1YWPA 1UE9A 1H0MA 2X51A 3T5XA 1YW9A 4D0PA 4HCBA 1R1TA 4RGRA 2MD5A 2JJ7A 3PNVA 3ZR8X 5ICGA 3GTPJ 1NBEB 4E47A 3O8HA 3DLLA 2JOYA 4JJNK 3QBYA 3FRNA 3BW1A 4OB3B 2GOMA 5DD8A 3ABLH 4M7DC 3GO5A 2FO0A 1Z91A 4LG0A 3QIIA 4PLIA 1XG1A 4II1A 5KYXB 1VQLI 2B0LA 1VQ4Q 1J0RA 1Q81C 4BXUA 4M78G 4M77E 5GAN5 1VQ6I 1MDMA 2GWRA 3CCQT 5D5VB 2QQBA 3CUQC 2L4MA 1Q82C 2LQKA 1OISA 3GWZA 4J9GA 4MGRA 5F1JA 3I4NJ 2J7IA 1ZELA 4M7AA 1SVOA 5C6SA 4XTVA 4PSWA 1ZR2A 1X2NA 1X6GA 2HQHA 2PQ8A 3EG1A 4XTZA 5DM7R 1OR7A 2KHMA 4D5FA 4N9IA 4Z8AA 2OX7A 1U5TC 1PDNC 3E1SA 3BPXA 2M0CA 3T8TA 2RDPA 2UWMA 2HDCA 2GBYA 2F69A 2V8KA 3HEFA 5CVRA 1VQ7Q 2RHIA 3KP2A 4Z02A 4OU0A 3TCJA 2D8JA 4CCLA 2MCNA 2DJQA 2CQ7A 3RI4A 3OSVA 2WSFE 1XMKA 2LMDA 2MK5A 2F4MB 4A3MJ 2VONA 1OU9A 2CUBA 4RCCA 3L2RA 3DEWA 4OVAA 3LGLA 1VQ6A 3CCJQ 5GTIC 1K4US 1XMAA 2K86A 2NS8A 1WI9A 3V4GA 1YI2I 2KJCA 4J9FA 4EGZA 4WK8F 3GYHX 1W2BA 3LOCA 2DPDA 4J9IA 4GDFA 3H41A 4B3AA 4FYWB 1M2OA 3BT9A 4XK8E 4NHJA 4A3CJ 1X1AA 4KDPA 2DZCA 2ZGWA 2JA8J 5GPAA 4QVDA 3V8JA 2JM8A 1ON1A 4M7DD 2P8TA 2JRMA 1Z7LA 2XIDA 2I2LA 2LRQA 3VUZA 3VS7A 1G5VA 4R0KA 3AHUA 1GCQC 4GYIA 1HW2A 1JEGA 5LJ3d 5LGNA 1OCOH 4FISA 3TMOA 1YW8A 3M8FA 1DPUA 1YJNA 4MHGA 4C8QB 2XPUA 2JA5J 1RI0A 4C8QC 3CCLA 4JS5A 2HZYA 3H5AA 2XGDA 2ZFUA 1NG6A 4MEXF 1C0WA 2NVTJ 2EIMH 3ZOBA 4ZYHA 2O8XA 5IHKA 1ZHFA 3JCMP 1E3OC 4AFSC 3WVEB 1VQPQ 2Y0MA 4CYCB 3MZHA 1QVUA 1YNZA 2G7UA 2VI6A 2Z2SB 1O9SA 2EKOA 1I4K1 2LCLA 3SXYA 1GL5A 1BI0A 1V4RA 4CC7A 3OSGA 2BUDA 4EMKC 3PIPF 3QG1A 3VEPA 4IHXA 2HOTA 2KRMA 2JUFA 2EINH 2HZDA 4W1UA 4P9FA 3TKYA 1K8AC 4YFNF 1OKRA 2XAJA 1SHGA 3L42A 5KNLA 3FM3A 2EIFA 2K2VA 4HVWA 3CXCS 2BVMA 1J75A 5HCKA 2IS2A 2PZ1A 2RB6A 4LNPA 3JCMX 2DN0A 3KZIC 3OYBA 3L2CA 2Y2ZA 1PVEA 2K9NA 1RUNA 1M9SA 4A4GA 2JVVA 3QODA 3CCQA 2QKMB 4O3MA 1NEGA 2QEXI 4BXXJ 2OZUA 2X3WD 1ETOA 2WA0A 4XSZF 3TO9A 4G7OF 5LJ5e 4M7AB 1PYVA 2WAQN 1K9MC 3OWTA 1X6OA 3RYPA 3QHSA 4ZTFA 1UG1A 4ON0A 2E19A 1WHGA 1MSEC 4MQ9F 5EYRA 4FCYA 1WJFA 3CDHA 3MAJA 2OU2A 3OOUA 4XRSA 4L18B 1X1CA 1OPLA 4M77C 1B07A 5ECAA 4C9YA 2QF7A 5JLWA 1JKQC 3KETA 2Y4YA 2XGCA 2QASA 3J7AY 1U5TB 1QNTA 1ABQA 2DODA 4O5VA 4M7DE 2BZ8A 4J7IA 3R60A 4JDSA 4XMYA 2A61A 4RLFA 3CPWS 3HOWJ 3I9QA 1IDYA 2EYWA 5AIQA 2B8AA 2OAZA 4II3A 4S0HB 4IX7A 2X1EA 2FEZA 3JCUC 4N0AC 4BY6C 1R22A 4ME7A 4M9ZA 3G6EQ 2CFOA 3G4SA 3CCMI 1B9MA 2HVQA 2EZIA 2DLLA 1FYKA 4C2TA 2QQ9A 1E0EA 2DLPA 2F1LA 3OQ5A 4M77B 2VJJA 2DE0X 1AU7A 4EM0B 1K9AA 3K4KA 4GLKA 3CCET 1WHLA 1LFBA 1XDUA 3FK7A 1PKTA 1X01A 4KULA 2XIGA 2PLYA 3PIOA 2R7VA 4IZZA 2ZPHB 1JGGA 5LJ5g 2V26A 1Z3YA 3IQLA 2J05A 4UVAA 3DLMA 5FKKA 4EMKB 2V1DA 2M1BA 2CZ1B 4QIWN 3OV8A 2GGRA 1BCMA 3QDRB 2LK2A 3AG1H 3FMQA 1A36A 2MH9A 3FDRA 3J81R 3H3VK 3PMIA 1N9SA 3X25B 1AZGB 1HSTA 2L3QA 2UXNA 4Y91A 5D8KB 4AIKA 3CO7C 3FXKA 2IVWA 3KEQA 3SFMA 1M4ZA 2FVUA 2AHJB 1AZEA 3UR3C 2FMLA 5GJVB 2H94A 4ZGJB 2M8EA 3TDZC 4B47A 2RJFA 3CCMT 5DCMA 2FQ4A 3D1NI 1TL8A 3VYHB 4HBLA 1ONVA 3M0PA 2QA4A 3F8BA 2J6OA 1O3QA 9ATCB 1HK9A 1DPRA 4JX4A 3CESA 2K9LA 3MJXA 2OTJQ 2ED0A 3P8BB 2NUPA 1QVFP 2ZCWA 4PGHA 3S3MA 2X35A 2NUPB 5KHDA 2COMA 3RKXA 1UDLA 5KK1A 2DQLA 2HWVA 4HSRA 1B1BA 2DFIA 4RA2A 3NQOA 4E7SA 1XPXA 1KJWA 1RKTA 4TV7A 4AT1B 1ETVA 2JTMA 2GXAA 2FNPA 4IUTA 3LFKA 3DB4A 1OI1A 3BG9A 1V29B 4J01A 1XB4A 3S3NA 2E2IJ 3RKWA 3SEQA 2PFBA 1S1NA 1T3SA 1T38A 1DGRM 3QP6A 1IZ6A 2LDMA 2LQNA 2YHTA 4HKEA 1M1EB 1YWOA 2P5VA 1E3HA 1OYXA 5E20A 3RPQA 1AHDP 4Y33A 2EPFA 5KVRA 5KYUA 3BOQA 3O6BB 3O3KA 1RAHB 4Z89A 3A8MB 2PUKB 3M0SA 3PTAA 4NBQA 3IH3A 3K4MA 4IUQA 2BV6A 2WSCE 5J4VA 2FPEA 3F22A 1T95A 2LF7A 3WTWC 4O6JA 4PUSA 5D4RA 1XSDA 4U87A 3OS0A 3EGUA 3Q0VA 3JCMV 1Q81U 4MEYF 3L00A 5F0HA 4LK0F 3ERED 4PJNA 5JVTA 2P7CB 1KQSA 2XAFA 4HG2A 3H0GJ 1ZGAA 4M4ZA 4ZYAA 2LMJA 3PFSA 2JVGA 2LBFA 2R7DA 3VDXA 4BEHB 2R5YA 4BDZA 4EVIA 3W6VA 1X27A 2C06A 1OCRH 1OX8A 2EZLA 1TQIA 4IHYA 1YX5A 2IS4A 1D3YA 4LOCA 4IKFA 1JI8A 2BZXA 1JUMA 5EEHA 2B86A 1HKTA 3TGNA 1QU3A 5LJ3f 1WKMA 2QYOA 3S2WA 4BGDA 5K5OA 2A7YA 3LAJA 1WZ2A 3QYGB 1USTA 4ENKA 4FYYB 1VQ5A 5CR2A 5HDNA 1VQKT 2CUEA 3AG2H 4RM3A 2L9SA 1SVLA 4XLAA 4DEYA 4BE2A 3THKA 4XLPF 4KUMA 3G1LA 2UXXA 2DM1A 4FT4A 1L3LA 3CCRQ 1NJIR 3BC8A 1VQ7T 2OTJA 5LRRA 1NPRA 3PUFA 5FWBA 5CO7A 1ZUKA 4LLLA 1D5VA 3L2QA 1OCCH 1TW3A 2P5LC 3OMCA 3VYSB 2DOFA 2F5EA 2YWWA 2GA2A 2HOAA 2PBIA 4HQEA 3V8KA 4M75D 2PVDB 3QU6A 4LB5A 4BI4A 5DV5A 2GQQA 2P6TA 2R7OA 3KEOA 4MLOA 4F92B 2XASA 3D7SB 1VQ8A 2CT4A 3QWYA 2KT0A 1TWHJ 1SFKA 2COBA 1ON2A 5DEQA 4DYQA 2QBYB 2YDLA 3CXCA 2ZSIB 4PJ0C 2EW3A 4J9EA 2PJPA 3ZGKA 4H0EA 1WXBA 1XOVA 5D6XA 1R4NB 2MA3A 4X1VA 2FBIA 4M9SA 3LQQA 2I5UA 3G4ST 1JGSA 4XONA 2BOLA 2IIMA 2ZC2A 1ZR4A 2C6YA 3NGPA 2RQRA 4CXFA 1OEBA 5CQXA 2LF8A 4CZZA 3ZMSA 2D5VA 2WV0A 2X6WA 3RJPA 1IXDA 1MV0B 1QMCA 2AZVA 4OGCA 1QPMA 3MO8A 1ZTRA 1UCRA 3KZYA 1FOXA 4IIMA 2XK0A 3A8OB 1JU5C 4DNCA 4BXFA 2Y4XA 3B73A 3HHGA 3BTLA 4XN0A 1R49A 4A3BJ 1PKSA 2EQMA 2QK0A 5CKDA 4N0BA 3A02A 5D5XB 1RAAB 4FT8A 1MBJA 3TEEA 2BW3B 2DYSH 1R1UA 3EETA 3KE2A 1YITI 1NG2A 1MNEA 1CQTA 2JMAA 1WX6A 1XDSA 4N0AA 4PJOB 5M9OA 3SZPA 4ZN3A 1N9RA 3LH0A 3RDVA 2DO7A 4J9CA 2EFQA 2VL8A 3X28B 1LQ1A 2DA6A 3EQLF 1BR1A 3R6SA 4UHTA 3VRYA 3CC2T 2FU4A 4MDWA 4U88A 1RLPC 2ROTA 2MLKA 4OIPF 3G1MA 4RB3C 1VQ5I 1PP8F 4IO9F 3W6JB 2IS6A 4AC0A 2ZXWH 3QYEA 4L59A 1LB2A 2K2MA 4UNOA 1GLNA 3HGYA 4IUVA 4LUDA 4ESFA 3CCSI 1O3TA 2J06A 3JSCA 4DZPA 4F55A 1VQ9A 2CUFA 2GA1A 2NWMA 3IV5A 1Z9QA 5DLQE 1J7KA 4N4GA 2XF6A 1FWZA 5KCMA 3RPUD 1FMKA 2XKPA 1U2WA 2FEIA 4F7UB 2XAHA 3GP8A 4YEJA 1XCBA 4HYEA 3X26B 2CUZA 5H6QA 5ICCA 2CRGA 4FU6A 2H27A 3AL0C 1QCOA 5K1YA 1S7EA 5EGOB 4BDYA 2L7KA 3MEUA 2QTVA 1GXQA 4ZN1A 3RTRA 5B5EC 2QI2A 2EYYA 2OJ2A 4Y13A 5BMZA 1V5GA 1E3PA 2NUTA 4BBSJ 2LNVA 1WHUA 2JJ9A 2OAWA 2LT4A 2O4XB 1VQ8Q 3QQAA 2V8JA 1KHCA 2QLZA 1T3LA 3G71I 3O8VA 3HOXJ 2DA4A 2A05A 4RMNA 2RI5A 2YSQA 4UB6C 3NAUA 5D6YA 1QVFS 4DQ2A 4M78E 1ZN2A 4V2SA 4M78C 3HSEA 3JW4A 1QW1A 3L09A 5KE2A 5IT9E 2JTVA 1BOBA 2UZKA 1HSQA 5ED4A 4LDYA 3KYDB 3DWLE 1X2QA 1YP5A 5LJ5d 3EGXB 4I6ZA 4DA4A 3CD6A 2A28A 2LC2A 5JHUA 4XN3A 2HXOA 3GTJJ 2CW0F 2HTJA 2LY2A 2FZCB 4OMPA 3EFRA 1B34A 2OTLT 2J5PA 2VLAA 1HDPA 2CS3A 2G0EA 2ZBKA 3AAFA 1MJBA 2FXAA 1K7AA 2GBQA 2K3PA 1JKOC 2DI3A 4C92F 4CC4B 4NQWA 3BE3A 3OL3A 4D7NA 1S7AA 4IF4A 4OOIA 3SD4A 3ASKA 2IA0A 3S16J 2FG0A 3QO3A 3K10A 3CD6T 2CH4A 2L01A 2JZ2A 2CGHA 4G6DA 1KD1R 1REPC 2K27A 4DW6A 4EMSA 2PJRA 2DRKA 2XDPA 3TP3A 3EFSA 5EZGA 3DTEA 2KI7A 4FL6A 3GFIA 1FX7A 2FSWA 4RTTA 3OBYA 3HUGA 3CQTA 3F6VA 3QWLA 1YRNA 2FL7A 2GCXA 3NTHA 3C2GA 2QWWA 1SD4A 4M75F 3J81Z 4J6XA 1U1TA 2LY1A 4XR6A 4EJWA 1D0ZA 1O3SA 1MSFC 1PD0A 2IXSA 2HYFA 1B9NA 3FBNB 3FJPA 3M5AA 2YSRA 3BQYA 4MQVA 2RC4A 3CP2A 3DPTA 4I02A 5GAMf 3LSRA 1RACB 4A3EJ 1M3CA 3KP5A 4FSXA 3BY6A 1YJ9A 4XLHA 4MZTA 3DBLB 3G71A 3HJEA 2YLCA 1IXCA 5DUKA 2VBXA 5C4JJ 3AL0B 1UB4A 1R0BG 2MSYA 3DLAA 3M0UA 4RGUA 2ACJA 4PL6A 3Q0UA 3PMTA 2LOOA 4BQAA 2CQQA 4A3KJ 1OZ2A 2HZTA 3QU3A 3ECHA 3DKXA 1VFCA 4A0XA 2P0KA 3ZQLA 2MVTA 3H0IA 3CJRB 1B72A 2OJED 4FIBA 1O57A 4IQJA 4CGZA 1M1GA 3EG9B 3EG9A 1K8AU 1SKUB 5FLMJ 5GANh 5K7ZA 4YIRX 4A93J 2M51A 1RZ4A 3K2ZA 2NUZA 3QJ6A 1YJWQ 1VQNT 5IP9J 3CC2A 4CYCA 3KUFA 1XNIA 4Y4RA 1TTHB 1MMAA 3NFCA 3ZN1A 1X4PA 2IJLA 1Z77A 2V8IA 3FHZA 2VJIA 2B7EA 3E3VA 3W3CA 1SG5A 1YFNA 5JR3A 3CCJI 5IHIA 1Q82U 3OOPA 4AIDA 2MGQA 2NAZA 4JPBW 1MBEA 1KC8R 3VSKA 5F0FA 1SAUA 3ZQFA 2XSJC 4QTRA 2M9UA 3A8LB 2DMNA 1BJAA 1MD0A 3VWBA 1ODDA 1LJOA 2ZPFB 3TVTA 4ELZC 2O5RA 3WG7H 2FRYA 2JW4A 4F52A 2DXTA 3HPHA 3M55A 2DTOA 1SEMA 4WWCA 3JRHA 3AG3H 1FBQA 1TWFJ 5GAMj 4EDUA 4YELA 2PN6A 4HCCA 1SRLA 2DU9A 2NRAC 1T8IA 4BJTA 4HT9A 2X4JA 3G4SQ 2K9GA 4BKXA 3G6EA 3M9AA 1QWFA 1XCVA 3BZKA 1SFXA 3HP9A 3VS0A 1VQMA 2OTLA 3GFJA 1QVGS 4EJTA 4C8QD 2EZHA 5GAN6 5EEAA 4JBAA 3EG2A 1HDDC 2V4JC 3IAS2 3SDBA 4B48A 2QSHX 4L9TA 3A5ZB 1LUJB 2R5AA 2F5VA 1TZLA 2LKPA 2Y0SN 5EG0B 2M8GX 3HRSA 3CC7I 2VC0A 4DBFA 3OYKA 3H0FA 5I2MA 4A3IJ 1WJAA 4M7AG 3K4NA 3MN2A 2SEMA 4U0YA 1Q7YC 1PCXA 2H8HA 2Y48A 3GLLA 5GANe 1W5TA 2E5NA 3HG9A 2R5MA 4DBQA 2VVKA 5F27A 5M3MJ 1BI1A 3N4MA 2KK4A 4M75C 2BXYA 2XRNA 2QEXA 2DEUA 3HXLA 2XAUA 1I07A 3GUDA 1HYOA 3MQ0A 4XKVA 2CV0A 1UGQB 2HQAA 4Z88A 3ZL7C 2NYSA 2LRDA 5FLXR 2RNAA 1XGNA 2KBTA 2G7HA 3PNTA 2WWYA 5GAN7 1SD5A 2BXZA 2E7XA 3C3WA 3OS2A 4CI0C 5GANf 1I0CA 4PLLA 3T9NA 1M1FA 2BE7D 2AHQA 3HDDA 4XKBA 1IXSB 1T2KA 1STZA 4OMOA 1KA8A 2VQGA 1KD1U 4ENJA 2HYJA 2DAQA 5GANd 4PJJA 1QPIA 3MKLA 2DL3A 2YRVA 4D8DA 1B72B 1PUFA 3PQJA 5A2QK 4I0BA 3CCLQ 1Z3XA 2VKDA 3A4CA 1B4AA 2Y75A 1QLYA 2R7RA 2BE9B 4KBMB 4R55A 2KEAA 2JSCA 2W1OA 3HM5A 3AG4H 5A2QE 4CHUA 1R5HA 1YJNQ 2BY1A 2VPRA 1SHFA 1VQMT 1ZH5A 1JUSA 1R8OB 2EFPA 2HQNA 1B59A 2PX9A 3TBIA 3DKYA 2HBWA 2M0YA 3CCQI 3M9QA 4AYBA 3FM5A 2LY9A 1QGPA 5IT9K 1XGSA 3HOYJ 3G6EI 2RMOA 1WHKA 3NMZC 2NNNA 5IT9R 3UA6A 2LYCA 3M8JA 4A0YA 1VQLA 2RREA 3I54A 4AWXB 1D8JA 2KMTA 2QCOA 2F4IA 4GO1A 4LJZF 3TW6A 3U1DA 4FX0A 1UHFA 2O9LA 2E41A 2KXDA 2ZPIB 3DU6A 4KH1B 1IN7A 3SWNC 2ME0A 2V7FA 2KIQA 3E0JB 3FXLA 4UVBA 5CVJA 1S72I 3ZMVA 4DYRA 1W0UA 1Z7UA 1H9GA 1VIEA 4OMQA 3CCRA 4XRFA 2QGFB 3MCAB 4I2OA 1YI2A 2KRHA 1VQ5Q 4EGYA 2H8WA 2SRCA 2YRDA 4ENMA 3K4CA 3NHNA 1SFOJ 1VQ6Q 4J00A 2DPUA 3L2VA 2IS1A 1GV5A 3VOEA 2RPNA 1NYFA 3FEOA 3KEYA 2STTA 2P4RA 2L3PA 5A0LA 2F4OB 2COWA 2FRHA 1Y1VJ 4F7UG 1VQ7A 3SJMA 3DTIA 2B9SA 1X75C 1YI2T 3O2PE 2GM4A 4OINF 3ASNH 1D0YA 3JR9A 1LKXA 1MJAA 3WTZA 1UHSA 2KRFA 4I01A 4IPAA 1R7JA 3F8MA 2TCTA 2DYRH 4EM2A 2VOPA 5KAFC 2JTFA 2KYBA 3KYLA 2VIXA 5FLVA 3KIOA 3WHCA 1FIPA 1P7JA 5GMKh 2YX7A 1LPQA 4OIOF 1U9NA 2E70A 2FE3A 1UHWA 2GF7A 5IYBJ 3IH2A 3M4OJ 2XF7A 2O9VA 2PVOB 2HFHA 5I22A 4B6MA 4M7DF 1Y71A 2HKNA 4CO8A 2XROA 3IUOA 3CCUQ 4IL6C 3M7GA 4XQ3A 4PJOC 5AONA 3S1MJ 1IRGA 1PC0A 3QZ5B 1GXIE 2EFOA 1UTIA 1IN5A 8AT1B 2H3JA 3IRRA 1JBMA 1FTTA 1T6SA 4G12A 2VE9A 4CICA 5CKFA 4DGWB 3CDLA 3BJAA 1A6QA 2A3SA 5E3MA 1WHJA 2MPXC 4BY6B 1JJ2S 1WJ5A 2JRTA 2KVQG 1K4SA 1D09B 4BU2A 3NTKA 4ZNXA 1ETWA 5HLGA 5GAMe 2BEOA 1LVKA 2EIJH 1J9IA 4CYDA 1JRIA 2MLGA 2QBYA 3CMMA 2QA4I 1XQHA 2HDWA 1H3HA 1KFZA 2OZ6A 2D45A 3C2HA 2AIRB 5AYFA 3L2ZA 2JTEA 2EGCA 3I64A 1D3BA 1KYWA 1FY7A 1O3RA 1AEYA 5KH6A 4N4OB 3GZNB 4BHPA 3OYDA 4XRSG 3GTLJ 3OYYA 4S04A 4A4EA 1VQOT 4ELYC 3DEUA 5CLSA 5IP7J 1DGWY 5IYCJ 4M7AE 3J81E 4AVZA 2W25A 1JJ2A 3HSBA 3VYRB 2ZMEB 4AD9A 1UHCA 5AT1B 3HHHA 5JLXA 3ABTA 2E65A 1BN5A 5KYNA 1GDTA 1DP3A 3NWTA 1I3AA 3JB9H 2JSPA 1ETYA 2H8RA 2J6FA 1EFNA 3RNJA 1QVTA 1KU7A 5TJJA 1HW5A 3EFOA 4J6WA 1WJEA 2HKOA 1WJSA 1FLIA 2LNBA 4XLEA 2BYVE 1YTYA 1ZG5A 1TWBA 4XK4A 2NOJB 4G8XA 3JRFA 1TOVA 3ZMZA 2QDLA 1ZAOA 1TP4A 2WV1A 3HSFA 4FHTA 4KJZA 3ZQGA 3DLLF 1BC8C 1PSFA 4XU1A 3I56T 2XDVA 1LOJA 3JREA 2W0ZA 2OTJT 3E6BA 4ZZLA 2E2HJ 3PO2J 5HK3A 1PP7U 1FC3A 4DIQA 3ASOH 3RCOA 4J83A 3CCRT 2ZO4A 4C92E 3BPVA 2GNCA 1FP2A 2KR3A 2ICWG 2LFBA 1WHMA 4BY7J 4C2MJ 4E70A 4TVRA 5IXFA 4LD9K 2D2WA 1S5LC 3A0HC 1ZK8A 4L5EA 1LE8B 2NVQJ 3A01B 1A6IA 2V79A 3RIRA 3HOVJ 2PVGB 2DXCA 2DT5A 4HLXA 2L3SA 4NC8A 2XB0X 4OF1A 5GAN2 2A6HF 3GNGA 5LEKA 2JK3A 3MWMA 1YX3A 1ZLJA 2VXZA 1ZG3A 4HEA2 4B4CA 2MG4A 4CDGA 5J1RA 4I0AA 1I39A 1DP7P 5KYWA 3DXJF 4WCGA 1K4TA 3BDUA 1VZ0A 1W4SA 3QXEB 5D6WA 5KYUB 4NL3A 1X3WB 3CTAA 4PCQA 2DDAA 2L5QA 2QUFA 3WU1B 5FU7B 1OLTA 2VJ4A 3J80E 2E1MC 5BS6A 2MW8A 2QQSA 2K3BA 1K9MU 4IOAF 3QPLA 4PFPA 1W7PD 2G6FX 1TW2A 3G7ZA 4RTZA 5M5WJ 2MI6A 1WDXA 4PJOA 2COYA 4GY5A 2BBYA 2IA2A 3JCMe 4RS8A 2CUDA 4HLYA 1XMXA 4AFUC 1K79A 1Q1HA 2OD5A 4UV9A 4L5IA 2LKXA 3HOZJ 2E1CA 2DIGA 2HEQA 3LWHA 2L9NA 2EFNA 2O3FA 4Q48A 4M78A 1ORKA 4PJOF 2PNIA 3GPLA 2GFAA 3EPZA 4EJVA 4KUIA 3CCUA 1TNTA 3A98A 1SSFA 3BTJA 2P0PA 5DY9A 3H9QA 2LTOA 3DPLC 4M75E 1UB9A 3M58A 1FOYA 4IQ4A 2MD0A 2DYIA 1U3OA 1S72A 2ISZA 4F14A 1OCTC 3EGXA 3D5RC 2CYYA 1D5YA 2HDDA 1GHCA 3EUHC 3BDLA 3LSMA 5C3EJ 1VYTA 4IUUA 4IURA 2M2EA 3C2BA 4QWQA 5H2FC 2OQRA 3ESWB 4LN2A 3K69A 1CF7A 4OAYA 3GZ5A 1OYIA 4BS9A 5HS9A 2LP0A 3BJOA 3K4JA 4ZYGA 4KIBA 1G3WA 1SVMA 2Q1ZB 3BLYA 4KN4X 2JWTA 1L0OC 2RGVA 3SZTA 3OW2S 2WB1N 1Y1WJ 3Q9VA 5FRMA 1H8KA 2RQWA 1WQ2A 1VQ7I 1VYUA 1K73R 1WI3A 3W2AA 2YUNA 3BR0A 3ZP5A 4AU7A 3KP4A 1RAGB 2KQWA 1Q82R 2RQPA 2DL5A 1BI2A 2LJ1A 2ZJRF 2RN8A 3ULRB 1UGSB 3FBIB 4IRGA 4KMUX 2FX0A 1HCRA 5GAOr 4JK1X 1YHQQ 1OYYA 4BHBA 3NTIA 1U06A 1ZG1A 3L2UA 1QKXA 3LSHA 1WI7A 4F17A 4XIDA 1CF7B 1YRNB 4MTDA 1JQQA 2GQIA 2R7QA 2R58A 4E2FB 5LEJA 2JA7J 3CCEQ 4BYYA 3P9KA 5KYYB 3KLOA 5ILVA 1WWXA 5GAEJ 1XS9A 1OOTA 2HAXA 4PFZA 2CH4W 1DU6A 1EZZB 1KQ2A 4B3XA 2HPMA 2P5KA 2R7WA 5DDGA 2YU9J 3JCMJ 3ABMH 4YRVA 1O7LA 4OIQF 1NE8A 2KDOA 2EQKA 2WB1A 3I55A 3HHTB 3G4SI 3ZMDA 1QA6A 1ZUYA 1WVRA 1TU0B 1K73U 2JA2A 2VJ5A 5BPIA 2M9HA 4BUGA 1FZPB 1HKQA 3U1KA 1KIKA 3RDIA 2R7UA 3DTKA 1YCSB 1U8BA 3V7RA 5CAIA 1QVGP 1YFHA 3ABUA 3GTGJ 3LYIA 1MMSA 1VQKI 4F16A 2G9WA 2E5KA 2FPDA 3C12A 2OTLI 2VC1A 3A1PA 2FZKB 4C92C 1NJIC 5KYYA 4AMCA 2HYGD 2K5FA 3VPRA 4F93B 2OA4A 2BHYA 3LL7A 4YFKF 2JXBA 1Y8RB 3M8EA 3HGGA 3C0CA 1P4XA 2ROLA 3CC7Q 1R9TJ 4KICA 1IB8A 3CBOA 3H8ZA 1X1DA 2EZKA 4J9HA 2WADA 3VYTB 2H3EB 2X3XD 1MMNA 2VBWA 4OMNA 1MUZA 2KFDA 3JB9G 4N4IA 2LTPA 5EZHA 2D0QB 1PRMC 2WBMA 3HB9A 2VASA 3KP6A 2QENA 3JRAA 3JRCA 4R79A 2VKVA 1ZRDA 4A3FJ 1AWJA 4C2UA 2EQJA 3CMET 3QSUA 2RNGA 2CQKA 5TGTA 1TQMA 5GADJ 2LQWA 1M8MA 1K0SA 4OIRF 4M3DA 4XSXF 3LSGA 3MP1A 3CCST 2K4YA 2ZCFB 4HX4A 5D8LB 2Z33A 1CGPA 1T56A 1WCMJ 3BTIA 3LWFA 3TL4X 2P6SA 4RB0A 2E3HA 2Z0WA 2IPOB 1X4OA 4KN7X 2JMWA 3CCUI 2CT3A 5BNGA 3QAHA 3TO6A 1G3SA 4DYCA 1QZZA 1SAXA 2V1RA 4JRQA 4M7AD 1FOKA 3PSIA 4OWRB 3JCMW 1BBZA 1KQSS 3EHQA 5FFZA 1QQJA 1WH7A 4F04B 2XKOA 2K9QA 1FBSA 1V54H 3MPUB 4PDKA 3J80Z 3I4MJ 4AFZC 5CVIA 1PWTA 3TW7A 5B1AH 5LLQA 1HC8A 2QXFA 3FKJA 4C0DB 1VQMQ 1NTCA 1BOAA 1RI7A 2KISA 3M1CA 2EYQA 3I4PA 2VGNA 3CJNA 3MKYB 3BY7A 3JRZA 2XHKA 7AT1B 5KCHA 2A69F 1R71A 2RKHA 1WSUA 1SRMA 3JB9J 1RABB 3L1AA 3FC3A 2E1MB 1TBXA 2R7XA 1WPYA 3E5UA 5LHIA 2M35A 1N5ZA 3PE0A 1SMTA 2J5OA 1S29A 2E7WA 5B3SH 2O8KA 2GTOA 3LMMA 2GIVA 1AKHA 3CCJT 3JCMc 4AM3A 2JT4A 1IHWA 4XKWA 2HEOA 4B1RA 4XLNF 1IAWA 2DX1A 2XU8A 1IN4A 3CJQB 2CV1A 1IUFA 3CC4I 5LHHA 1BYMA 3PNYA 4QQDA 3I56A 2RQUA 1KC8U 2HNHA 1QVFA 1ZLKA 2CS7A 2A68F 2KT1A 4M75A 2CQXA 3RZOJ 1Y6IA 4U7BA 4ZTJA 3GOXA 4A4FA 2DK3A 3CCSQ 3T1BA 5A0DA 2R4GA 3S2HJ 5FD5A 2CP3A 5CJ9A 1YHQA 3W2WA 2YR2A 1Q86R 2V6CA 1KQ9A 2DT7B 3TDUC 2KAFA 4J6YA 2CMPA 3REAB 3OL4A 3SWNA 3MEXA 1UHMA 2RM4A 1XD7A 4RTWA 2M7BA 5KYXA 2ZKZA 4M3BA 3EUHA 2R93J 5DTDA 2EQUA 2E1NA 3K7AJ 5FLXK 3QPSA 3QPHA 2L54A 2BVLA 1YLFA 1K0XA 1PUEE 1VQOQ 3LQRA 2A6TA 3WODF 3A52A 2ZMEC 3HBLA 2MWOA 2EJRA 4I99C 1EX4A 3PQKA 1UGPB 3I55T 4XICA 1RIOH 1H88C 3AT1B 3B6AA 4NUBA 4EQQA 2ED1A 5L23A 3I9V2 3RZDJ 4MZPA 5FWCA 4HDVA 5IHNA 2KQRA 4C8QA 1AWWA 3J7ZI 2XB5A 1FOWA 4BI3A 1ZRFA 2L4AA 1T0HA 2ZAEA 3D5LA 4ZYEA 3CPWA 3R4KA 5EGOA 3JCMf 5CKHA 4E7HA 2IAIA 3RKQA 4PKCC 5L3CA 5L3BA 3EGDA 1R5ID 4M9XA 3TQNA 2CREA 4LDVA 4ZGDB 2XGEA 4EATA 2EB7A 2P4TA 1DU0A 3NARA 3HKSA 2DILA 1KD1C 1FPQA 5CVVA 1ZSZA 3O8GA 3FXQA 4G6QA 4LIUA 1GXPA 2IBDA 3OIQA 1M5Q1 4K11A 4XORA 4HVUA 2M30A 2Q8KA 1YIOA 1RNLA 4ENNA 3UA7A 3K1MA 5J1UA 1POGA 4RLQA 4E4HA 4Z6YA 4M77A 1K61A 1EH7A 1DUXC 2AT1B 1U0JA 3VS4A 1BI3A 3DCFA 4B9XA 4L5GA 4HSTA 4CCOA 1RAEB 2CP5A 3S8PA 2D0NA 1UJ0A 2XV4S 1N78A 3E97A 1BL0A 1G8XA 4OMZA 4IRHA 1BA5A 4XTUA 1VF9A 4Y15A 4IJAA 2E5ZA 3QZ9B 2DERA 2L02A 1VQ9I 1RAIB 4Q5WA 3EUKL 3JRGA 1IN8A 1GCPA 2KZVA 4CRIA 1UGRB 4P5NA 3PVQA 2HSEB 2KIUA 1M90C 3G1OA 3Q5FA 3HKZN 3OYGA 1E6GA 1Y7XA 5IN1A 4JRPA 3WTXC 3MZ8A 2ELJA 2DOEA 2QQRA 4M78F 5GAN3 3J7AF 1ZQ1A 1VQ5T 2DT6A 3IC7A 2D6FA 3ULQB 3UT1A 3WTYC 4D1QA 5FKMA 4ZDPA 2ZJ2A 5JFRA 2RHZA 1YN8A 1K78B 2QDYB 4RG2A 4XNFA 3B6CA 2OAUA 3CCMA 2FZGB 2RJCA 1TT5B 2DFFA 3A0BC 1A35A 3HTUA 1O75A 2W48A 4XL9A 4QKUA 4C0ZA 1XN7A 1GFCA 2DA3A 3JTHA 2BE5F 2VB6A 3MMYB 1RUOA 1M2VB 4F3QA 2DTRA 2RHYA 2E35A 2VYTA 1FEXA 2DMPA 5DS9A 5A2QZ 1MV3A 3I71A 4V2FA 2M5WA 3EYYA 5F04A 4XU2A 3ZQCA 3CCVQ 1Z21A 1GCQA 2QA4Q 4MDXA 3ELKA 5CQYA 2O61A 4NL2A 1BR2A 3KXTA 1IF1A 3P9IA 3I35A 3TQ7P 1NG7A 3S1QJ 4EMHA 2D1VA 1J5YA 2KMUA 1VQPI 3CMAQ 3GVAA 1JTXA 1QVGA 3ZQIA 5FKLA 1SPKA 1ZA2B 1MGQA 3HFNA 2L7FP 3PVLA 2DRMA 1N25A 1MJ9A 2VKNA 1ZKGA 4UV8A 2OV7A 2VPLA 3URGA 5HDKA 4F91B 3MP8A 2K3XA 5LBQA 1M2VA 4GLMA 4D7MA 4JLIA 3SHWA 2P0QA 3E6CC 4E7LA 3LSIA 3DPUA 2W00A 3GLXA 4UUTA 4XM3A 2CKKA 2DJNA 3OYIA 5CKTA 4RCBA 1G2BA 4F7ZA 4C92G 2HVRA 3EG0A 1TT0A 3J7AO 3J7YJ 3L9FA 2AKKA 2QSFX 3KX2A 4AVPA 4RBOA 4CC3A 3KCCA 4JRIA 1JJ2P 5LJ5j 3OR1C 2O88A 2CW7A 1G83A 3GZ6A 4M7DB 5E3OA 5IOZA 2P84A 1VQPA 2YPRA 2P0TA 5H20A 5A2QR 1OU8A 1VQLT 2DAOA 1FNNA 1OQYA 1IO6A 2HMAA 3FZVA 3LH5A 5B66C 2LVSA 4HW0A 4NNJA 1I1JA 4HV5A 3L2WA 1TG0A 5J26A 4EMGA 1IV8A 3BG5A 1JJ8C 4IHSA 1Y07A 1S72T 3MCZA 1JTYA 3PL8A 1MBHA 2WAFA 5IAYA 1P2FA 4WXHA 2HDAA 2K9MA 2IPQX 2K5IA 1JUPA 1B8IA 1W4MA 2DJIA 1G4DA 4JOMA 4XQFA 2K5LA 3I59B 2DMUA 3M4YA 5GANj 3JB9F 2EV5A 1YHQI 2HQ5A 4FE4A 1YITQ 1M3BA 2X4YA 4RTXA 4M7DA 3FIWA 3W6KB 2RVCA 1BR4A 4OMLA 1DJ7B 4KT5C 3PM1A 1I5OB 2R7ZJ 1PD1A 3G1JA 3DU5A 3FHNA 2ECCA 5I11A 4RM2A 3GTKJ 3CCJA 1R1VA 4GCVA 4HF0A 3X20B 3VS2A 3GEZA 4Y28E 1JKPC 2KNBB 2DBBA 4XOPA 3CCMQ 4FTHA 4LDXA 2HQRA 2EH3A 3RSNA 4M6YA 1A04A 1YJWT 1LNWA 3C4SA 1B7TA 2XKOC 1GFDA 5LJ3h 4A4HA 4F7UF 3WTUC 1IW7F 5E17F 4F7UA 4BBRJ 3WHBA 2NXNB 1VQKQ 2ZMEA 1H9TA 5K5RA 1FYMA 1MKMA 3U9GA 5J6XA 1AWXA 2LCSA 2CP0A 4IUPA 2X85A 1NHAA 1LDKB 1BIAA 1WJQA 2DVJA 4M71A 3ZQHA 3RESA 3SDZA 1P9QC 1S72Q 5IXBA 1IRXA 3TOAA 1JXOA 1PUFB 3KZZA 3GX4X 2QEXT 5HLHA 1IO2A 3Q0WA 5CYVA 2QVOA 1YJ9I 5L3DA 3VB2A 5FU6B 3HL2A 1BIBA 4NB5A 5IT3A 2PG4A 1O7FA 1RC9A 2E34A 2BTTA 1WNLA 1VQ4A 1YJWA 1JT6A 4PJMA 3VODA 2OUMA 3CLQA 2EV6A 2YT6A 4WTOB 1WJDA 5GAOq 3WU2C 2JUGA 3V7SA 3ZQ7A 3WGHA 2JT1A 4A5NA 1MZBA 5C0MA 2F2EA 1OV3A 4RAGA 3UKGA 1ITYA 4R8HA 4XTYA 3VFZA 4LGWA 3FMSA 2W10A 1OPKA 3FLGA 2HR3A 3CBPA 3M0RA 3KPHA 3LSJA 3G71T 2PI0A 3NRVA 2KP6A 4IOCF 1OCPA 2KIMA 1QQIA 4A63B 1T08B 2ESWA 2C0TA 2EJGA 3G2BA 5HDGA 5LRSA 1M1KR 1PM3A 3M59A 3P8HA 2AO9A 4C92A 1QKWA 2RF0A 3INZA 4WF2A 3VV0A 4J9DA 5FW9A 1RKWA 3ZMTA 4CZCA 2Z3YA 1EIFA 2QM3A 1AKHB 4A3GJ 1UEBA 4LG0B 3I56I 2F5DA 2MIOA 3I5UA 2EA2A 4QQ6A 1YJNT 2DZ9A 4BQQA 1KQ8A 3LX7A 2L7MP 1Q86U 2EPDA 2OTLQ 4J8OA 4BI8B 4D6WA 3LAPA 1Z9ZA 2QAZA 3ML6A 3HFOA 1IGNA 4EV0A 1HLVA 5E1ZB 4M75B 4KIFA 3JSOA 2DFEA 2UV1A 2Y69H 3DKWA 1IJWC 1BW5A 2DA9A 2A08A 2KGTA 2IGNA 2R5ZA 1AVZC 2PMHA 3SDGA 2LNHB 4NQWB 3SFZA 4YIIA 2EFIA 2RD1A 1U8RA 4IHVA 2EQRA 3H0DA 2GIZA 1ETQA 2ZXJA 2KXCA 3META 3CC4A 4NDLA 2CJJA 2ME6A 4RAZA 4IRIA 1WXTA 1W2BS 2LLKA 3T0YA 2AKLA 1OCZH 2AK5A 3Q9SA 3K0LA 2NS0A 5GPCA 4RB2C 2EVRA 3H9GA 2O0YA 1TUCA 3KBGA 3SEMA 2RHXA 2ZPGB 3O5ZA 3J80R 3CJTB 3CC2Q 4QVZA 3GFLA 4C3JJ 2VN2A 1PG5B 3V42A 4I7HA 2M87A 5J40A 4M3FA 4D9JA 3IRQA 3DB3A 3JV3A 2O2OA 3MEWA 2VQCA 2IGOA 2X98A 2LZ6B 2K5CA 4E6KG 4OB1B 4K2EA 1TNSA 4Y7NJ 1TWAJ 4CUGA 4KA4A 3C18A 2CDTA 2Z16A 2FB7A 3A8GB 1Y8QB 2DVEA 4Q47A 3MKWB 2FQ3A 3ZRGA 1G3TA 2RO0A 3EH1A 1Y96A 4DZJA 6AT1B 2TRTA 2LSOA 5FFXA 3EGDB 1MIJA 2EV0A 3FXUA 3ISPA 3RQIA 2LKSA 1D3BB 2LJ0A 3G71Q 2YS9A 5ICFA 2K6DA 1RADB 3GBQA 4L9NA 1KG1A 2G3RA 3ONQA 3MKZA 4R1HA 1T33A 1XX5A 3ROUA 4A6EA 4C3HJ 2H1LA 5FLXZ 1TTYA 2LVMA 2D9TA 4HCKA 2JS0A 2JZYA 5K5QA 1K83J 2W7NA 4MIMA 4L9VA 3DBHB 3ECOA 1QBJA 2OQGA 1KQ0A 4P1WA 1T0JA 1XTDA 2MMPA 3KFVA 2DA2A 5ICEA 2H09A 2ZSHB 4RB1A 3N5BB 2A36A 1D8KA 3OR2C 5GAN4 3F72A 3BG3A 3FXOA 3VSLA 1AT1B 1WHHA 3TREA 5CK9A 4RTUA 4M72A 4FETA 2IGKA 1BK2A 3WG9A 1PHTA 4JQFA 4I09A 4U7DA 1W5SA 2Y31A 1WXUA 1Q1VA 2EKHA 4M6XA 5M3FJ 2YUOA 5CVUA 1HSJA 1LJ9A 1IG7A 4LD6A 2YXYA 3JCMd 5DYMA 2M3AA 3P7NA 1F4KA 1OPCA 3PFIA 4QW2A 3DQVC 1YS6A 2DQRA 2Q2EA 1QHGA 1ZA1B 3IAM2 3SHFA 2HVSA 4XLCA 3V8LA 2O03A 4HQMA 4Y3OA 1VQ8I 5ILUA 3CUOA 2LJ3A 1UMQA 2JPBA 4UUSA 2FBKA 1VQ4I 4BB7A 1VQLQ 5J1YA 1W36C 3DKMA 2DA5A 5E3NA 3H5NA 1T0FC 3K1NA 4U0WA 2DTIA 3LWIA 1I5LA 5GP9A 5F6FA 1TLHB 2DMQA 2VQLA 2XDBA 5L3FA 2I8DA 1JKRC 2KJBA 1X69A 2V9VA 2VOOA 5DUIA 1X43A 5KE3A 1LCKA 3EYIA 1PJRA 3PUBA 2FYKA 4J5YA 2M02A 2F2WA 1V3FA 2XUBA 4E7IA 1WA7A 1MGTA 2JMCA 3I58A 3HZJA 1VA7A 2XMFA 1P4WA 1RR7A 2WY8Q 2Q2EB 4GRIA 5K7FA 1M90U 2KROA 4Q5SF 1X6BA 5DLOA 1BU1A 2W84A 4RGSA 2GOXB 3JB9D 3FXRA 2M16A 2X4XA 2VXDA 2CFXA 5FROA 1P6RA 5FRNA 1SFEA 1VQMI 4C92D 2WAQA 5HLIA 4LUEA 1IC8A 2R7SA 1NLPC 2AS5F 1HQCA 3ZBDA 3PO3J 2JUCA 3I55I 3RERA 3CMAI 4PJOE 5ERIA 1ZX6A 1GBQA 2NLUA 4M73A 1JHHA 2H6BA 3OYEA 1XSXA 2OPTA 3CF2A 1M90R 3FK6A 2MAMA 2DF6A 5EF6A 2DK8A 4E7KA 5LGUA 2VBYA 3BR5A 4XOTA 1ZREA 2Z1DA 2CSQA 5GAOm 2QSGX 5IY5H 1K78A 2IA1A 5LJ3e 4WX9A 1Z05A 2X9DA 2YRCA 2DIQA 3G3ZA 4OAZA 4VUBA 2X4WA 1RETA 1IV6A 3IL2A 4XLFA 3S15J 1QO0D 1WPKA 4KMFA 6PAXA 2QYZA 3PIPA 3I59A 4PK4A 2E1HA 1Y56A 2VV5A 5GAMg 1B8IB 4UVCA 4GGGA 3CC2I 5C4XJ 1R6RA 4XAXB 3VRZA 3CC7A 3CMAT 1YBYA 2ZPBB 4QPOA 2X6OA 2E5QA 1TQPA 1U5TA 4KGXB 4HX7A 4XRMA 2N8GA 1HKSA 3M1EA 3RMQA 4AG2C 3ERMA 5C44J 3OS1A 1M3AA 4G94A 1E6HA 5FKNA 3VJPA 1FBUA 4FX4A 1SF9A 5J47A 3BR2A 2GQVA 4EIKA 1E7OA 2GLOA 1I81A 4EMKA 4GXOA 3QWXX 5J8FA 1LE8A 3M3YJ 3S32A 1EF4A 2EWNA 3BQZA 2V1XA 5F08A 5GAGJ 2VGMA 3G73A 2L0AA 1S7OA 3AFHA 2IRFG 1U6GA 1F1ZA 3KP7A 4MTEA 2X6YA 2CUJA 4A5MA 4D5CA 4A3JJ 2DJZA 2RJEA 1UG0A 4II2A 4UUVA 4EEFG 1WZOA 5DCMB 3F0CA 1J3TA 3IHUA 1HXDA 3OYCA 1OQKA 2HXIA 1ZSZC 2BKDN 1KYZA 1YO5C 1FMWA 3F70A 3CCEA 1E17A 4PNOA 4M75G 4C8QE 4QPQA 2ZJQF 3KYCB 5LJ5h 3CBMA 1B3QA 1QCFA 2RAEA 3BR3A 2ZNZA 3CF5F 2GTJA 5CQGA 3FIFA 3WTVC 3S14J 2ZPEB 3OMGA 1W70A 2AQEA 3DFGA 1ULYA 1LDJA 4LDUA 4Z2YA 2A3LA 3H3UA 2L0KA 4BL0B 2V9KA 3A1YA 2DNUA 1K8AR 2R57A 3CCVI 2ESNA 4AYBN 1LVAA 2LDUA 1P4AA 3R61A 2F5CA 2DPPB 4KIGA 2PMUA 1OFCX 5IT9Z 2K79A 1YJ9Q 1EH6A 4RG8A 1ZSZB 3S93A 4HCZA 4J9BA 1P7IA 2X1CA 2F5KA 2O9SA 4RTYA 5DM7F 1R77A 1VQPT 4PSXA 4CCMA 3BG7A 4XTXA 4A3LJ 2A37A 2F2XA 2XDDA 1R58A 3JCMg 1K9MR 2K57A 4GYGA 2PTKA 5LJ3j 2O31A 3GW2A 3WE2A 3OYAA 1GT0C 2ZFWA 2AQFA 1D1CA 3UWNA 1I1GA 2JPCA 1NM7A 1VQOA 2W4SA 2E71A 4OMMA 1S9HA 3MEAA 1LNXA 3E2UA 2CG4A 3LSTA 1AWOA 2WSEE 5IH2A 1P92A 2FOWA 5DM6F 3JSPA 1TWCJ 3R6NA 1VQ9T 1A5JA 1MBGA 1SMYF 3J80K 1UELB 2IW5A 4JRKA 1MMDA 1FYNA 2R92J 4LITA 3OYHA 4ESRA 3B02A 4ABZA 2IT0A 4OGEA 1VOMA 2K9SA 5HOOA 4QLCU 2H1KA 4UY8I 3QKJA 1JE8A 1D1AA 1RESA 1UUEA 4LDWA 5GMKj 4YIFA
chains in the Genus database with same CATH topology
1BBYA 3N97A 4KFCA 5GMKe 2HQEA 4JUVA 4M74A 3JCMh 3WE3A 4L0YB 2DTHA 2RNJA 3QPTA 1NJIU 1F9NA 3K1PA 1LEBA 1WQ7A 4S05A 5JI6A 2O6GE 4BAYA 4A12A 4LLNA 4HV6A 1S6LA 3ZPLA 1YIJT 3L7WA 5FB2A 5I2SA 4X9CA 3CLOA 4NS5A 4A2UA 4KUDK 3KP3A 4HT8A 2O01E 3LA7A 3EAEA 2DW4A 3CPFA