1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
1U5TC 3HOSA 1FYMA 1KQ8A 3E3VA 1W7PB 1DUXC 4U0VA 5H6QA 1IW7F 3ABUA 4AVPA 1S7AA 3BY6A 5LHIA 3OOPA 3FF5A 3KEQA 2A07F 3O6BB 4EGYA 4GYIA 2VC1A 1RZ4A 1IN5A 1FSHA 2PMHA 1SMTA 4L5JA 4M73A 3VODA 5HS7A 1KGSA 2IA2A 3ABTA 1R5GA 4OIRF 3FX3A 5HLGA 1Z6RA 2EK5A 4BH9A 5F1RA 2K27A 4P9FA 1ZLJA 4Q48A 1HW5A 2NS0A 3JW4A 2E7WA 2O3FA 2H09A 2O8XA 5CYVA 1BIBA 4CDGA 2K5LA 2Y75A 2UZKA 3KZZA 5E18F 1QW1A 2MBFA 4I0AA 4O3MA 1K78B 1KA8A 5J8CA 3L09A 5LGTA 4LGWA 5FFXA 3E6MA 1L0OC 3ISPA 4KIBA 2H6BA 3HSFA 3IWFA 1XSVA 4UUVA 2DPUA 1FC3A 5E1ZB 3C7JA 1SMYF 2YX4A 1J9IA 1BIAA 3BWGA 1R1TA 3KCCA 2GZWA 3R0AA 3V8KA 2W57A 2WC2A 4KUMA 3BDDA 1W5TA 4KN7X 1XCVA 2OZUA 5DCFA 1EH7A 1LEBA 5J8FA 1QNTA 2VOOA 2XGXA 5IT9Z 1R5HA 2HGCA 3HTUA 1P4AA 3RKWA 1J0RA 4HX8A 1JHFA 1I5ZA 3I0TA 2Z9OA 2LDUA 3K69A 3E5QA 2LKPA 4PGGA 2YU3A 1SAXA 1MJ9A 1YIOA 2HKXA 3WE3A 3GUDA 2HTSA 3ZMUA 4F7ZA 3DF8A 4OOIA 2JT1A 5ICGA 1OKRA 3J80Z 4UVCA 2EV0A 3M7GA 3WTWC 1O57A 1QZYA 2K86A 2M8EA 2RGVA 3JSPA 2ACJA 4I2OA 2QQ9A 4M72A 3L9FA 2P6SA 4ENMA 4BXUA 2ETHA 3EYIA 4FX4A 1ZREA 3HRMA 2RC4A 1YO5C 4YFNF 3K1PA 1BBYA 2D45A 2DK5A 1L3LA 3F6OA 1AWCA 4HAMA 2ZJ2A 2PMUA 3T0YA 4OINF 1I1SA 3LA3A 4I98B 3GEZA 4A0ZA 4HZFA 2OU2A 5E8GA 3HHHA 4A6EA 3PQJA 2GA2A 3U1DA 2W24A 2JZYA 1Z1DA 1DDNA 1ZRDA 1UB9A 5L3CA 2VOPA 2LSOA 4A0YA 2QENA 3JTGA 1BJAA 2FE3A 5JR3A 1CF7A 5CLSA 3P9IA 2QQBA 1OR7A 1SFEA 4ON0A 1LNWA 2XKOA 4XSXF 1BI0A 1PDNC 1ZH5A 4ZZDA 1T98A 2STWA 1FZPB 2PQ8A 2Y0MA 2KIUA 5DDGA 1U6GA 4M9XA 3M9AA 3P7NA 1J59A 1O3RA 4RGUA 3M8FA 1MZBA 4UV9A 5FGMA 4Y15A 2VC0A 4MQ9F 1IRFA 3QAHA 4P9UA 3CUQC 1TW2A 3U2RA 2K4YA 3EUHA 4IPAA 1SD4A 3MFKA 4WCGA 3F23A 4EJWA 1F9NA 2GA1A 4KICA 1QVPA 1TW3A 4L0YB 5L3FA 4G7ZF 2RNJA 3BJ6A 2KJCA 1IF1A 3KLOA 2OZ6A 1JXSA 1GVJA 4LD5A 4A0XA 3HYIA 4KA4A 4BYYA 4LB6B 2YPRA 3K0LA 2IT0A 4MEYF 2QWWA 5HS8A 4WXHA 5TJJA 3EQLF 4P55A 2XUBA 1FT9A 3HRTA 3O2PE 4KIFA 3WTYC 1NHAA 3V8LA 3TKYA 1FYLA 3WE2A 4L0ZB 3R0JA 2L3DA 3DEUA 1P4WA 1MJAA 3E6DA 1BYMA 3MWMA 4YFKF 1V4RA 2GCXA 5E1WA 1ZN2A 2F2EA 1I1GA 1K79A 3I59A 3CUQA 3RPUA 4G6DA 1YW7A 2IA0A 1DPUA 2XAFA 2Z33A 1PP8F 5HOOA 4ZZLA 1UCRA 2PFBA 2VE9A 2BBYA 3P9KA 3GFIA 3H92A 1J2XA 3Q9VA 3ZMTA 5F64A 4B09A 2F5EA 4U0WA 3HTSB 3WTTC 2W25A 1WQ2A 4EJOA 5CVVA 4Z2YA 1U78A 3RI4A 2CO5A 5H6RA 5D5WB 1F4KA 4LMYA 2XAQA 4I02A 4IRGA 1C0WA 4I01A 4LLLA 2ZNYA 4ZYGA 1S29A 2F5DA 1FBUA 1LEAA 1USSA 5ICFA 1FY7A 4HF0A 2PG4A 1G3YA 2HKOA 4KN4X 2A61A 2XRNA 5HDGA 3MEXA 1SD6A 3LQQA 2XROA 3L00A 2GXBA 1IRGA 1S6LA 1ON2A 1P6RA 5ERIA 1ZLKA 1FWZA 5H20A 3IKVA 2HTJA 4ENJA 2VBWA 1T0FA 5JFRA 1T39A 3JAMZ 3OV8A 1O7LA 1R7JA 2M30A 1YFHA 3E5XA 2RDPA 1JHHA 2DPDA 4I0BA 1ZGAA 5L3DA 3N4MA 2LF7A 1R36A 4A6DA 3DXJF 1B9MA 5LHGA 2EFNA 1BOAA 4BNCA 1RNLA 2NNYA 2DQRA 1IN6A 1UHWA 2X0LA 2IP2A 3V8JA 4ENNA 5JI6A 4RB0A 2A6HF 2NYXA 3FM5A 3F6VA 1XMKA 2MH9A 3G73A 5K1YA 5E20A 4UHTA 2UXXA 1UFMA 4HBLA 1IN8A 5HLHA 1FSEA 3MZHA 1BC7C 3LA7A 3U9GA 4MQVA 3IL2A 3MZYA 4DQ2A 1CGPA 4I7HA 3RJPA 3T8TA 1T2KA 2MLKA 2CQKA 4IXAA 4KMUX 1KU9A 2FF4A 3HUGA 2H6CA 3MQ0A 4D0PA 3L7WA 1S8NA 1LDDA 5HS9A 3NRVA 1OMIA 1B6AA 3PQKA 1T6SA 3CTAA 2P8TA 3M8EA 2M45A 1DP7P 5HVQC 4G6QA 2MA3A 3W6KB 3KFWX 4HQMA 4R79A 3DPLC 3V7RA 3GXOA 3KEOA 2D1VA 3HSEA 5EEGA 2A5YB 2K7LA 4EVIA 3DKWA 2ESHA 3KP2A 5CVJA 2GIVA 2LX9A 1O3SA 4P96A 4UNOA 3MHXA 3RPQA 3CDHA 3GLXA 2GQQA 4KIGA 2K02A 2VT3A 3I53A 2ISZA 3K1NA 2DU9A 2IW5A 2R3SA 4CYDA 4AD9A 1MDMA 2AS5F 1TQMA 2HS5A 1R1VA 2O6GE 3EETA 4EM0B 1JE8A 2A68F 2W85A 5DCMA 2V1DA 1MDMB 2MH2A 1XGSA 1XGNA 3LAJA 2E1CA 5IT3A 2V6CA 4LFUA 2KJBA 3QU6A 1KU7A 1QPMA 1ZAOA 3CJNA 5LEKA 3I4PA 2CG4A 3VFZA 5HDKA 2HZTA 4Q5SF 3REOA 4ASNA 1EV7A 4G7HF 1TTYA 4RGRA 2J5PA 4S05A 5K5RA 1PUEE 5FLXK 4MNUA 4OIOF 4L9TA 4U0YA 3KP7A 4I09A 1B1BA 2EB7A 1HKQA 2JRTA 2WV0A 1QQIA 2K5FA 2VBYA 4Y13A 2Z5UA 2RKHA 1QO0D 5JHUA 1G3WA 1D8JA 1MD0A 2G9WA 2UXNA 2EFWA 3BJAA 5D4RA 4EM1A 1MKMA 2EFQA 4GYGA 1HKTA 1Z91A 5D5VB 4ZYEA 3D0SA 2KIMA 3BZ6A 2QBYB 2LNBA 1XMAA 2OAZA 2FNAA 5LEJA 1U5TB 2VN2A 1KQ0A 1TNTA 1Z7UA 2VXZA 3T1BA 2D2WA 3GFJA 1XSDA 3PFIA 2CSOA 2MC3A 1HSTA 1F1ZA 2XIGA 1RIOH 4AWXB 4U7DA 5A2QZ 1LDKB 3LQRA 4MTDA 2LF8A 1PP7U 1ON1A 4U7BA 1J7KA 5ICEA 4XSZF 4LB5A 3JSOA 3BROA 3WU1B 4EV0A 3BJOA 4G7OF 1IUYA 2ZBKA 3V7SA 2FU4A 3GZ6A 5LRSA 4CZZA 2H94A 4M6XA 3B02A 4OIPF 4HDVA 2P5KA 3B73A 4EJTA 4M6YA 1HQCA 2E7XA 1K7AA 3I58A 2A3SA 3TDUC 3IHUA 1HW1A 5LRRA 3E6BA 2BV6A 2EWNA 4RB1A 2FMLA 3IKTA 4QLCU 2Q0OA 2DI3A 5D6FA 3LSTA 4WX9A 1GXQA 3ZPLA 1S7OA 4YFXF 1OPCA 3ROUA 1KU3A 1XCBA 3CLOA 1H9GA 4FHTA 1EH6A 3HHGA 1SFXA 2ELHA 4BHCA 3CUOA 2MD5A 3L2CA 2GXGA 2L4MA 2XAGA 3FZVA 3J80K 3TO7A 1Z6TA 3TOAA 3VB2A 1STZA 2M87A 3DPTA 3RDIA 1WRJA 5DUKA 3ZMSA 2P5VA 4UVBA 1W7PA 4PDKA 4NQWA 2DO7A 3FMSA 1XN7A 3FXQA 1HSJA 2W84A 4JQFA 3LWFA 3I59B 1O3TA 2FA5A 1A04A 3CO6C 3GX4X 2C6YA 2ZO4A 1FBQA 2KKOA 3RTRA 1ZG5A 1G4DA 3ZMDA 4CXFA 4EJVA 5K5QA 3FWEA 2WWYA 3I54A 2AXLA 1YW9A 2P4WA 3F8MA 1D3YA 4NHJA 1R58A 2EFOA 4N0BA 4A12A 3D5LA 5DCMB 1R00A 4U88A 3WTXC 2GWRA 2DAOA 1WSUA 1ONVA 3HRSA 2P7CB 5ILVA 3LAPA 3IRQA 2B0LA 1FLIA 2O03A 3HOTA 1Q1HA 3P9CA 5BS6A 1HXDA 1QZZA 5KK1A 3IWZA 3DFGA 1FNNA 2OA4A 5BPIA 1IAWA 1P4XA 3EYYA 2J5OA 2HEOA 4IF4A 4IVNA 1B59A 3GYHX 2DW4A 2JSCA 4L9NA 3ZN0A 1XSXA 4LLNA 4MTEA 2CYYA 5HLIA 4P5OA 4KMFA 2F5CA 5FD5A 1TBXA 3G3ZA 2OBPA 3C1DA 3TO9A 2JPCA 4BAYA 1LDJA 4B8XA 3ZN1A 3LA2A 5HDNA 3JTHA 2O0YA 3F3XA 1LVAA 3ERED 3GZ5A 4MGRA 2ISYA 1G3TA 1BC8C 1ODDA 1J5YA 2ZMEB 5AIPA 4XLPF 4ETSA 3AAFA 4IHSA 4M9ZA 4ZYHA 2RQPA 3KZYA 4OU0A 3BPXA 1U3EM 2DLLA 3FXRA 3RKYA 5CVUA 5IT9K 2KRFA 1Z9CA 2X4HA 3RKXA 4AIHA 2EV5A 3C3WA 4OMYA 2XAJA 1YYVA 3DP7A 5L3BA 3F21A 3TGNA 5L3EA 4YIFA 2FBHA 3KP5A 1DPRA 2XVCA 2VBZA 1RUOA 4WXDA 1XDSA 2FOKA 2ZNZA 2EV6A 2QYOA 1BN5A 3F8CA 3QOPA 2V1XA 3TQNA 4IRIA 2IA1A 3IC7A 4L18B 2HR3A 4AIJA 1S3JA 3T8RA 4Q47A 1R22A 4KT5C 4YG2F 3DV8A 2VT2A 4H0EA 1BM9A 4A2UA 2BE5F 4LK1F 4RAZA 2QUFA 1SD5A 2XASA 3DQVC 3GWZA 3GFMA 3F22A 5DV5A 4GXOA 4RGSA 3HIFA 2A6EF 4Q4ZF 1V3FA 3IRRA 3ULQB 3EDPA 3LFKA 2OQRA 3J81K 5LGNA 2PBIA 5CVIA 5ILUA 3H3ZA 3S2WA 5DD4A 3SFZA 3WODF 4LK0F 2V1UA 3NEUA 1H0MA 2ZXJA 3F8NA 2PLYA 1IXSB 2K4BA 1G6NA 3HSRA 3I71A 6PAXA 5ICCA 5J6XA 1ZHFA 5ED4A 2IVMA 1Z05A 4PCQA 3COAC 2G7UA 4S04A 4EQQA 2L01A 2V79A 1WKMA 4XRFA 1D8KA 1U2WA 1EH8A 4YIIA 2QBYA 1J75A 4GGGA 1D5VA 2NNNA 4ZYDA 1HW2A 1Y0UA 2HYFA 4ENKA 2Q2EA 1K78A 4CO8A 3KE2A 4OIQF 1AOYA 1FX7A 3QPHA 3F8FA 1KQ9A 3HRUA 3ML6A 4O6JA 3TOBA 2QM3A 5BMZA 1YS7A 2F5FA 2VE8A 5FO5A 3WG9A 2VODA 3QU3A 5FD6A 4N9IA 1TLHB 4M9SA 3SXYA 3ZMZA 2DT5A 1QGPA 4GO1A 3ZMVA 1ZG3A 4WK8F 1WI9A 4BQAA 1XD7A 1IXCA 1TQIA 4R8HA 2R7DA 4MEXF 3E19A 1TNSA 3E6CC 2OD5A 1OYIA 2QVOA 3GW2A 5DYMA 3VEPA 1LQ1A 3WTUC 1HKSA 4QWQA 5LLQA 5D4SA 1E17A 1ULYA 3BPVA 2H3JA 2MLGA 1FP2A 3ZQ7A 2DBBA 3RIRA 5DEQA 2Z3YA 2VBXA 4M71A 2NAZA 5E1XA 1BI2A 3GFLA 3FMRA 4G8XA 5LBQA 2K4JA 2IPQX 4EM2A 3TO6A 4ZH4F 4EMSA 2Y48A 3F72A 3FHZA 5E17F 3CUQB 3R6SA 1JGSA 1X3UA 4UXNA 4ESFA 2HQRA 4O5VA 3WTVC 2JPBA 4WWCA 2ADUA 3I64A 4GCVA 2COMA 2WTEA 1YLFA 4DNCA 4BHPA 1T38A 3WGIA 2EA2A 3KP6A 4E70A 1IZ1A 2L02A 2FBKA 4IRHA 4TV7A 3SQNA 4JK1X 1YG2A 2PI0A 2FEZA 3SHFA 4LLGF 1R1UA 2HQNA 1P92A 2VONA 1LJ9A 2IJLA 2XHKA 4A5NA 5FLXZ 2EFPA 4RAYA 5AIQA 1FOKA 3GVAA 2L54A 5KVRA 2PEXA 4FX0A 4LG0B 1USTA 1O3QA 2EA4A 4KYWA 4L9VA 4HQEA 3KP4A 3FM3A 2YR2A 4HV6A 4FT8A 1IN4A 3R4KA 1XDUA 2QLZA 1TQPA 2H27A 1YTYA 4HV5A 1K6OA 3WGHA 3NQOA 1MJBA 1SFUA 2PJPA 4HDUA 3C18A 3M1EA 2HWVA 2BGCA 3ZP5A 5DUIA 2GAUA 1YQAA 5FB2A 1OYWA 2EJRA 2HOEA 5CJ9A 2ZKZA 1U8RA 1RI7A 2FBIA 2KIFA 4N9HA 4UV8A 2DFIA 5CVRA 3GF2A 4KDPA 3QP5A 2Z99A 2R7FA 2HFHA 3O3KA 3SZPA 1ZRCA 2CWEA 1E2XA 2V9VA 1YW8A 2BYVE 2QZ8A 1ZRFA 4ESJA 4OMZA 3MAJA 2P6TA 4RS8A 2Q8KA 3WTZA 4PZJA 3ELKA 3MCZA 2FNPA 4L9JA 1P2FA 1XGOA 5D8LB 1QBJA 1SD7A 2DTRA 3FMQA 5DD8A 1FP1D 1IXRC 1FBSA 2ZCWA 3WGGA 4LG0A 2RV8A 2STTA 1GXPA 4HX7A 2K5IA 2CGPA 5FFZA 5LHHA 2FXAA 1HBXG 1H9TA 4L5IA 4MHGA 3WTSC 3BOQA 1REPC 2JTVA 2FMYA 3N97A 3QPTA 5JVTA 4RGXA 4HF1A 2M5WA 2ZFWA 2G7HA 1R23A 3I5UA 3R60A 3JAMK 2QQAA 2FRHA 2YX7A 1LB2A 4EGZA 3V7CA 2TDXA 4JBAA 4EJUA 3K2ZA 1OYYA 5BPDA 1B9NA 3QP6A 1ZARA 1I6XA 4WF2A 2CFXA 1RUNA 3Q9SA 5D5XB 1VTNC 2IRFG 4HX4A 1FPQA 1CF7B 2XAHA 3E5UA 2PN6A 4HA8A 1BI1A 5BQTA 3GO5A 2P5LC 1W7PD 3V4GA 1F5TA 2OQGA 5EEHA 5D8KB 4KNYA 4XBFA 3VOEA 5BOXA 1ZYRF 1IN7A 2E1NA 4NB5A 4AIKA 4WXCA 2BEOA 2D1HA 4HLYA 5D5UB 3J81Z 5K5OA 3KP3A 4A5MA 4K2EA 3E97A 2UWMA 2CW0F 4G94A 5AONA 4RB2C 2P7VB 4HF2A 4PGHA 4HYEA 2HYGD 1O7FA 4HW0A 3W6JB 4R1HA 1ZGJA 4G9YA 4Y17A 1FYKA 2ESNA 3FXUA 5ILSA 4HOBA 4KFCA 1GHCA 3TDZC 4UVAA 1WWXA 1W5SA 3H3UA 1YS6A 2XKPA 2M1BA 1KU2A 4CICA 1MGTA 3F8BA 3BP8A 5D6EA 4RB3C 2O61A 3T5XA 2HDCA 5F6FA 4BHBA 3J7AO 3K1MA 3WU0A 2RVCA 1KYZA 2DQLA 3K9TA 1XB4A 2RN7A 4LJZF 1G3SA 3ECOA 5A2QK 1ZG1A 2DK8A 4ESBA 1UHMA 3R61A 3RYRA 4IHTA 5E8IA 4CHUA 2FSWA 3CO7C 4HLXA 2FQ3A 4IJAA 3KLNA 3QRFF 1U5TA 1B4AA 3ECHA 2A69F 4M74A 5TRDA 1BI3A 1KYWA 1XGMA 3SZTA 3Q5FA 5LGUA 1W4MA 2ZMEA 3KETA 3RYPA 4CGZA 2L4AA 1I27A 5L3GA 2YSRA 4XLNF 2XV4S 2NRAC
chains in the Genus database with same CATH superfamily
4XONA 2E1OA 2LVMA 1Y96A 2RAEA 3AHUA 4QT7A 1U0JA 2KROA 4ZTJA 1M2VB 2JT4A 1U5TC 5EDNA 4PJJA 4NNJA 5GJWB 2PUOB 2Y90A 5GAOr 3HOSA 1R6RA 1FYMA 1M9SA 4N0AC 3CEYA 1KQ8A 3S32A 5EYRA 2E10A 1MW7A 6AT1B 1H8AC 1U8BA 3CJTB 3E3VA 1W7PB 1DUXC 3JRZA 2A08A 1KQ2A 3VYTB 1RAEB 2L9RA 1A0NB 1YHQQ 2XI9A 3DKMA 1Z0XA 4U0VA 5H6QA 3OYLA 2CT4A 3NTHA 5CKHA 4OGEA 3G6EA 1IW7F 1JQQA 3ABUA 4AVPA 1S7AA 3BY6A 5LHIA 3OOPA 1K9MR 3FF5A 2WAQN 4F14A 3BR5A 2MWPA 3KEQA 2A07F 3S15J 1MNMC 3O6BB 4A3BJ 3OMYA 4EGYA 1WX6A 2CZ6B 4M78C 2RQWA 3D5RC 3LGFA 5F04A 2IPOB 4GYIA 1VQPA 4XK4A 2VC1A 3PO2J 1RZ4A 1IN5A 4IHXA 1FSHA 1WNLA 1JTXA 2PMHA 5C4XJ 2XMFA 2D0QB 1SMTA 4L5JA 4M73A 2BW3A 3GTPJ 2WB1A 2KRHA 4XKCA 1OCZH 3VODA 1X27A 1VFCA 5HS7A 4B3XA 1RPWA 3D1NI 1I8FA 1WXBA 1KGSA 4XQ3A 4MLOA 2IA2A 2EILH 1UHSA 3OYAA 2FPEA 3ABTA 1R5GA 4ZC3A 2GTOA 3J81E 5C6SA 5F0CA 4OIRF 3FX3A 2LX7A 3IH4A 2WAQA 2RHZA 3OIOA 5HLGA 1Z6RA 3QG1A 2X35A 2EK5A 4BH9A 5FLXR 2Q2EB 9ANTA 5F1RA 1JXMA 4RMNA 2K27A 4P9FA 1ZLJA 4Q48A 4V2SA 3TL4X 3MMYB 1HW5A 1VQ6I 1WQ7A 2NS0A 2DL5A 3CCRQ 1LNXA 3JW4A 1X19A 2ENMA 1PC0A 2K57A 3CF5F 2CDTA 3CD6Q 1K4SA 3H9QA 1HJDA 2E7WA 2O3FA 2LBFA 2YS9A 2M0OA 2H09A 2GIZA 2O8XA 1RC9A 3KEYA 1Y96B 2LNVA 3E2UA 2FG0A 1S7EA 1SFKA 2AIRB 5CYVA 1CKAA 4B1RA 3GCMA 2JA8J 1BIBA 2MYSA 4CDGA 2K5LA 1NLPC 2Y75A 2UZKA 2HPIA 3KZZA 1K9MC 1YRNA 2G0EA 5E18F 4J00A 1QW1A 2MBFA 1YJ9A 4I0AA 2DFUA 2J7IA 4O3MA 2ZZDA 3I56Q 4LN2A 1K78B 2RB6A 2HSPA 2DMQA 1GDTA 1H641 1Z9QA 1KA8A 3QZ9B 5J8CA 5GAEJ 1KIKA 3L09A 5LGTA 4LGWA 2WSCE 1M90C 2VJJA 3CCLA 2LT1A 1Y0MA 1UJ8A 2MPXC 1VQPQ 1YCYA 3BQYA 2PJRA 5FFXA 3CCEA 3JCMg 3E6MA 4DOWA 1L0OC 2D5VA 3ISPA 2JVHA 4KIBA 1NK2P 2M8GX 5FROA 3VKIA 4RKUE 2VGNA 5LJ3j 2H6BA 3KBGA 4E7KA 2K6DA 3HSFA 1IZ6A 3IWFA 1MSEC 1XSVA 4UUVA 2DPUA 1E0EA 2J6FA 2GNCA 1IV8A 2HZDA 1A5JA 1FC3A 3MJXA 4NDLA 1AWOA 5E1ZB 2M7BA 1SMYF 2VASA 2YX4A 3CDLA 3C7JA 4BEHB 1J9IA 2OX7A 2XD0A 1NG6A 4XLEA 1K8AU 2BY3A 1BIAA 2DO3A 3BWGA 2O88A 4JOMA 2BZ8A 4E7ZA 1R77A 1R1TA 3KCCA 3SDZA 2GZWA 2VB6A 3R0AA 3V8KA 1ZUYA 2D9TA 3M3YJ 2W57A 3CCYA 2FPFA 3GNGA 1RAAB 2HU9A 2E65A 2WC2A 4KUMA 1VQOI 3BDDA 3CCQT 3TQ7P 2X6XA 1W5TA 3G4SQ 4KN7X 1XCVA 1JTYA 1M8VA 2OZUA 3H36A 3H5NA 4C8QG 2PX9A 5GAN4 4I6ZA 5DCFA 1EH7A 4EATA 1VQPI 4C2UA 1LEBA 2O31A 2L3PA 2R7XA 4CC3A 1K73C 2DDAA 5J8FA 4WCIA 1IB8A 5D7UA 3F9KA 2CZ7B 3SWNC 5FRNA 1QNTA 2ECCA 2XGXA 4XRSA 2VOOA 5IT9Z 1M30A 2P4TA 1ZUUA 1R5HA 3QIIA 2HGCA 3HTUA 1QZEA 1P4AA 1QVTA 4UB6C 3RKWA 3IQLA 2LVSA 4BDYA 3WVEB 2CH0A 1J0RA 5FLVA 2Z2SB 1X75C 4J9DA 1VQLT 3CCVQ 2VL8A 2P0TA 1VQ6T 4HX8A 1CKBA 3EGDA 2QA4I 1JHFA 4EMHA 1TP4A 3S3OA 4LE9A 3HGYA 3IH3A 1I5ZA 2AQEA 1MMSA 5TISC 2VXFA 3QJYA 3H5AA 3I0TA 3M1CA 2Z9OA 2ZXWH 2LDUA 3K69A 1I4K1 2HSEB 3P8HA 3JB9I 3LWIA 3E5QA 2LKPA 4PGGA 4D7MA 2E1MC 1OYXA 2EIMH 4M7DC 2YU3A 4A3JJ 1SAXA 1MJ9A 1YIOA 2HKXA 3K10A 2JUCA 4KITB 3K70C 2R5ZB 1I6HJ 2BW3B 4XLCA 3WE3A 1PHTA 3BG6A 3GUDA 1ZQ1A 4P5NA 4M77D 2KMTA 1WFXA 2CUEA 2HTSA 1KHCA 1PNJA 3HG9A 1YWPA 3ZMUA 2DVEA 1M1KR 2E2IJ 3CCUA 4F7ZA 2KDSA 2QXFA 5CKDA 4OB0B 1XG1A 1SF9A 2NVQJ 3A8OB 3DF8A 4OOIA 5KH6A 2JT1A 1OU8A 1KC8R 5ICGA 3M07A 1OKRA 3J80Z 4UVCA 2FZCB 1Y0NA 2EV0A 4RLQA 3CCVA 3M7GA 3WTWC 2XPUA 1O57A 1QZYA 3HL2A 1JI8A 1NEGA 2JN0A 2K86A 2YT6A 4FISA 2M8EA 2RGVA 3MKLA 3TREA 4DBHA 2BHZA 3M56A 4D6WA 3JSPA 1VQPT 4ITVA 3A8LB 2ACJA 4I2OA 2DL4A 2FD5A 4HVWA 3K70D 1VQ8I 1N8RC 1UGQB 3OYFA 1QU3A 2QQ9A 2WAEA 3BLYA 2KZGA 4M72A 3L9FA 1SHGA 2P6SA 4ENMA 1IGUA 1B07A 1IHWA 1LUJB 4BXUA 2ETHA 3EYIA 1UE9A 1ETYA 3UA6A 3EGUA 2O4XB 5IHNA 4ELZC 2QKLB 4FX4A 1ZREA 3HRMA 2RC4A 1YO5C 4YFNF 4GFBA 1VIEA 2YDLA 1AU7A 5H2FC 3K1PA 1BBYA 2D45A 3QYGB 5EC7A 2KRNA 3AG1H 2DK5A 1KZHA 1L3LA 2ZPGB 3F6OA 1TUGB 4RLFA 1AWCA 4C5GA 2KISA 1W6XA 4HAMA 2ZJ2A 3DCFA 2HKQB 1XS9A 2PMUA 3BT9A 3T0YA 3MPUB 4OINF 2OTJI 3K7AJ 3C2HA 1I1SA 3LA3A 4I98B 3W3CA 3RQIA 2NRAC 2QA4Q 2EZKA 3GEZA 3KIOA 4A0ZA 2C06A 2GBQA 1QVFS 4HZFA 1I39A 2OU2A 5E8GA 4UUSB 3HHHA 4A6EA 2MG4A 4PL6A 1I5OB 3JCMV 3PQJA 3E9FA 1JUMA 4M3DA 1TG0A 2M35A 2EINH 3CCLI 2GA2A 3EG2A 1OFCX 1VQ7T 5IN1A 4FYWB 3CCJQ 3U1DA 2W24A 1VQ9T 2JZYA 1BR1A 3ER0A 3LOCA 3M4GA 1Z1DA 3ABLH 1DDNA 1ZRDA 2LRQA 4CCJA 4FYVB 1PM3A 1UB9A 2MF2A 4OWRB 4CCLA 2BZXA 5L3CA 4BE1A 3HB9A 1QWFA 2EYXA 5J3LA 4PUSA 1FIPA 2XKOC 3NGPA 2VOPA 2LSOA 1WH5A 5DM7F 1A36A 3GNFB 5FU7B 4V2GA 3HOWJ 4A0YA 2EPDA 2MFZA 4F93B 2QENA 1M1KC 4FT4A 1R0BG 2JM9A 2KY9A 3JTGA 2QA4A 1BJAA 2FE3A 5JR3A 4XU1A 1CF7A 4E7HA 5CLSA 3MEAA 4MMKA 2R4GA 3K6GA 2KRMA 2L3SA 5EJCA 4OB3B 4Z88A 5DY9A 3A0HC 2DNUA 5GAN7 1LPLA 2CH4W 3SJMA 2ZSHB 4UY8I 3P9IA 2QQBA 4OF1A 3CCRA 1OR7A 2BOLA 1OCTC 2WSEE 2DD5A 3M55A 4MDXA 1VQ6Q 2O8KA 1SFEA 1ETWA 4ON0A 5LJ3d 1LNWA 2XKOA 4XSXF 1BI0A 1PDNC 4M78E 4XTXA 3VYHB 4NL3A 1YJNQ 5E3LA 3DBLB 3U1KA 1WHHA 3JRIA 2DIQA 3K4MA 1ZH5A 1YJWT 1BR4A 2RREA 4ZZDA 1ZSZC 2M7AA 3DWLE 2L0AA 1T98A 3I55T 3TSZA 4C92C 1TWCJ 2PMZA 4FW1A 2E60A 2STWA 4DYQA 1KC8U 1FZPB 2V6EA 2EJGA 2PQ8A 2Y0MA 3KFVA 4OP0A 2KIUA 5DDGA 1U6GA 5EG0B 2VLAA 5F08A 5J4YA 1Y39A 2KNBB 4M9XA 4DJAA 2JM8A 3M53A 2JXBA 2NXNB 3M4YA 4CRIA 3M9AA 3P7NA 4OAYA 4C92B 4F7UE 2QEXQ 4M75G 3ZOBA 1J59A 3GTQJ 2HBWA 3FXLA 1O3RA 4RGUA 2I0NA 3DLLA 3M8FA 2W4SA 1MZBA 2EZHA 1WI7A 3S1RJ 2DOEA 4UV9A 2GTJA 1VQ4Q 3MD2A 2COYA 5FGMA 1ABQA 1YCSB 1S72T 2LT4A 3M0SA 3CD6I 1D0ZA 1ZKGA 2KEAA 4Y15A 4B3AA 1ZSZA 3ZR8X 2PNIA 4LUEA 2PQWA 2EGAA 2VC0A 3ZL7C 4MQ9F 1IRFA 4X9DA 3QBYA 2LBFB 1W0UA 3QAHA 3VS5A 4P9UA 4BGDA 2IS2A 4EIKA 3CUQC 3EAEA 3JB9F 1TW2A 2H1LA 4JX4A 3U2RA 1S9HA 2P4RA 1Q82U 1YWOA 2K4YA 2R7ZJ 2OTJQ 1OLTA 3EUHA 2Z0WA 3CCSQ 2HXIA 4IUUA 3TCJA 4IPAA 2I5UA 1SD4A 3MFKA 4CA0A 4WCGA 4EJWA 3F23A 1OX8A 2XGEA 3MEUA 5GANf 1F9NA 1KHIA 3J80R 1YJ9T 5CKFA 2GA1A 4KICA 1WVRA 4JJBA 1QVPA 1OV3A 1ZUKA 2RMOA 1UDLA 1TW3A 4L0YB 5L3FA 4G7ZF 1YJNA 2RNJA 3BJ6A 2KJCA 4J9BA 4AM3A 2DL7A 3EG9B 4BI3A 4XTZA 1IF1A 3KLOA 2OZ6A 5GP9A 1GVJA 1JXSA 4LD5A 2EKHA 4A0XA 3HYIA 4KA4A 2QTXA 3H0HA 3J80E 2BVLA 4BYYA 4PSWA 3GTJJ 3A8HB 3CXCP 4LB6B 4Q5WA 5J3BA 2JNGA 3ZXSA 3L2RA 2QYZA 2YPRA 3K0LA 3C95A 1SVMA 2IT0A 2YRCA 4CI0C 4MEYF 2QWWA 1BR2A 5HS8A 1ZGWA 1G5VA 4OMPA 4WXHA 5CQGA 3VYUB 1K0SA 5TJJA 1UECA 3EQLF 2CKKA 3OW2A 2RJCA 1FMVA 4BE2A 3M59A 4AC0A 3CD6T 3DTIA 1X1PA 2XF6A 4P55A 2D8JA 4N4NB 4C2TA 2KIQA 2XUBA 1QHHD 1FT9A 3LGLA 2W10A 3HRTA 2H3EB 3I9V2 4XMYA 3O2PE 2E2JJ 4KIFA 4AYBN 3ZQCA 1CQTA 1W1WE 2LQ8A 3WTYC 4QIWN 2W7NA 2FOWA 4IZZA 2HOSA 4NS5A 3MP6A 5J39A 5GMKi 1NHAA 2YSQA 1K4TA 2HL5C 1SKUB 4Z02A 3V8LA 3TKYA 5LJ3h 2FJ1A 3WE2A 1FYLA 4L0ZB 5KYYA 3R0JA 2JUFA 2L3DA 4RTUA 3PSFA 3CCEQ 5KYUA 4E47A 3I55Q 3DEUA 1P4WA 3H35A 4D1QA 1MJAA 1U9OA 3E6DA 1O75A 1ZBXA 1YJWI 1BYMA 3MWMA 3FJ5A 2XB0X 4AMCA 4YFKF 1V4RA 2GCXA 5E1WA 3TBIA 1YJ9Q 5KAIC 1ZN2A 4J7FA 1VQ9A 3S2DJ 4MZMA 1D5YA 2F2EA 2ZGWA 1I1GA 2R7QA 1M8MA 1JGGA 4ZDOA 1K79A 3I59A 1K83J 4E4HA 3CUQA 4WTOB 4FM4B 3RPUA 3K4CA 3DB4A 1WIEA 2DYIA 4G6DA 1YW7A 1BKBA 3HOXJ 1W2BP 2K9LA 2JJ9A 4MO7A 1LJOA 1Q1VA 2IA0A 1DPUA 3A98A 3I5RA 3JCMc 1PSFA 2XAFA 2OJ2A 2Z33A 4W1UA 1PP8F 1VQ7I 3M54A 2X1EA 2RHXA 4LDYA 2MVTA 1AOJA 4FETA 5HOOA 3AL0B 3ZEHA 1HD3A 4QVDA 3FIWA 1Y1WJ 3OYBA 4ZZLA 1UCRA 2E5ZA 3SDGA 4ABZA 2PFBA 1X6GA 4HSTA 2CSIA 2E64A 3NWTA 2A7YA 1AZGB 2VE9A 2L3RA 3OBYA 3THKA 5GAN5 2BBYA 1ABOA 3G6EQ 2YUNA 3QDRB 3P9KA 4IO9F 3M8JA 1Z3XA 4I99C 3HZJA 2KQRA 3CCUI 3I4NJ 3TEDA 4KULA 3H92A 3VPRA 1E3HA 1J2XA 3Q9VA 3ZMTA 3OS2A 1AA7A 3GFIA 2FVUA 1MNEA 1SFOJ 3GBGA 2KYBA 3M4OJ 5F64A 3JCMd 2K79A 2H8WA 2ESWA 3OL4A 4B09A 1WGSA 2GF7A 1M3BA 2F5EA 1I07A 4XL9A 4U0WA 3HTSB 3WTTC 2X3WD 3BY7A 4Y92A 2DX1A 4C9YA 1TS9A 2RH2A 2W25A 4FSSA 5A0GA 3SWNB 5GAMf 4NQWB 1WQ2A 3Q0VA 4EJOA 3S1NJ 2IGOA 5CVVA 4Z2YA 1U78A 2KI7A 3RI4A 4M7DF 1RQ6A 2CO5A 5H6RA 5D5WB 4MZTA 1F4KA 3BTIA 4LMYA 4KT0E 5GAMh 3I55I 2DYSH 5M5XJ 2KQWA 4BQNA 1LKXA 2XAQA 2IVWA 1QVGA 3PMIA 1NYFA 2DETA 4I02A 2KFDA 2Y0SN 3JR9A 3E9GA 5CK9A 4QPOA 4IRGA 1C0WA 3O8VA 3PNWC 4XTWA 4XKVA 1MMAA 3N05A 2LTOA 1IO6A 4F7UA 4I01A 1B72A 3BTLA 2ZPHB 3PO3J 2OTLT 3IAS2 2V8KA 2QTVA 1YHQT 4LLLA 2XDBA 3OYEA 2ZNYA 4C0DB 1TU0B 4Z8AA 2JVGA 2AHQA 4ZYGA 1S29A 3Q1JA 2V9KA 2FO0A 1TZLA 3CP8A 4IOCF 2DJIA 2F5DA 2M4KA 3FLGA 1H3ZA 2OUMA 3HOZJ 1FBUA 2DA1A 1BCOA 1LEAA 2BXZA 1USSA 2DFFA 5C3EJ 5ICFA 2X4JA 4FYYB 1FY7A 2ZC2A 4AUXA 4HF0A 1YFNA 5KHDA 3JCMX 4PJLA 2PG4A 1G3YA 5B3SH 4JPBW 3CXCA 2M4GA 2VKEA 3A01B 4BACA 2C0IA 5B66C 4HRIA 2DYBA 2HKOA 2IEKA 3CQTA 3C2GA 2JUGA 4KN4X 3CBMA 2EIJH 2DPPB 2A61A 2XRNA 2COZA 4QQ6A 2ED0A 2CYZB 5HDGA 1Z21A 4G6TB 3M0UA 2LK2A 4R55A 1KG1A 3MEXA 3MKWB 1SD6A 3LQQA 2V1RA 1PKSA 2LFBA 4LDUA 2LJ1A 4AFZC 2CSQA 2F2WA 5AYFA 2XROA 4RTZA 1IUFA 3L00A 3OS1A 2GXBA 1HOMA 1YP5A 1IRGA 2O9SA 2R57A 5DS9A 4N4HA 5KCOA 1S6LA 1ON2A 1P6RA 2OC6A 3CBOA 3UATA 4PJOB 5EG0A 2XGCA 4NC8A 1G8XA 4ANJA 4U87A 1Y56A 5ERIA 2DJQA 4A4HA 5KYNA 1RAHB 3P8DA 3CCRT 1ZLKA 3X25B 2LQWA 2DMUA 1FWZA 5H20A 5LJ3f 3IKVA 1VQOT 1GFDA 2XSJC 2HTJA 4ENJA 2VBWA 1T0FA 4CYCB 2VJIA 5JFRA 2LYCA 2OTLI 2K9GA 3GBQA 1D0XA 4ZYAA 3JAMZ 1T39A 4RG8A 3HXLA 4Y4RA 1WXTA 2P84A 3FRNA 4NBQA 3OV8A 3CCQQ 1OZ2A 4RBOA 2CQXA 1O7LA 4HXJA 3EFOB 4M7AB 3EHQA 2L89A 2MI6A 1R7JA 1LFUP 2HEQA 3CC7I 2M30A 1YFHA 2VJ5A 1N9RA 2X9HA 3M0QA 4C92F 3E5XA 3H0DA 3HBLA 2RO0A 1PVEA 1I5LA 5M5YJ 2RDPA 1JHHA 2DPDA 2LTPA 3HKSA 4HVUA 2HDWA 4ZTFA 1H8KA 1Q7YR 1SSFA 4I0BA 3OB9A 1ZGAA 5L3DA 3N4MA 1RAGB 4B47A 2WY8Q 3EFOA 3ERMA 2LF7A 1R36A 3PUBA 3V42A 4A6DA 1BU1A 3R6OA 3AG3H 1FMWA 1B9MA 3DXJF 2R93J 1NPRA 3UPUA 2YWWA 5LHGA 1LVKA 2EFNA 1N27A 1BOAA 1NH3A 2HPMA 4A3DJ 1QKXA 1R0CB 4BNCA 3OW2S 1RNLA 2NNYA 3H8ZA 5LJ5f 2OTLQ 2DQRA 3DU5A 1IN6A 1UHWA 2L3QA 1IDYA 2X0LA 3EFRA 3OS0A 4OMLA 3CCUT 2IP2A 3V8JA 4ENNA 3ABMH 4XNFA 5JI6A 1V5FA 4RB0A 4JJNK 4QTRA 2A6HF 4RAGA 2W48A 3PSIA 2CJJA 2NYXA 2N8GA 5L8RE 2Y0SA 1GVDA 2BY1A 2L9SA 2QGUA 3FM5A 3VYRB 3WU2C 3F6VA 3J7ZI 1XMKA 1TSFA 5IH2A 2EQRA 2MH9A 3G73A 1KD1R 5K1YA 1YX5A 2V4JC 1MUZA 5E20A 4M7DE 4UHTA 2UXXA 1CSKA 1UFMA 1QHGA 1IN8A 1Z3YA 4HBLA 5HLHA 4PJNA 4PJ0C 1FSEA 1YRNB 2IG0A 3MZHA 1BC7C 2W0ZA 3GTKJ 3QWYA 5GAOn 4M7DG 3KYLA 3LA7A 3RERA 2M9HA 3DKXA 4XAXB 3U9GA 2HDDA 3RZDJ 2LMJA 2EVRA 3LSKA 3Q3SA 5GANg 5GAN2 2K40A 1PD0A 5GAMj 3BR0A 4MQVA 3M5AA 2EYWA 1ZSGA 1EKEA 3IL2A 3MZYA 2DL3A 1Y8RB 4J01A 4A69C 2BE9B 4DQ2A 2ZB9A 4JS5A 1CGPA 4A3LJ 2H8HA 3H41A 5IT9E 1VQ5Q 4I7HA 4MFEA 1VIFA 4A93J 3G1LA 2XF7A 2EZLA 3RJPA 1W70A 2RPNA 3ABKH 3T8TA 2MLKA 1T2KA 2CQKA 2EQKA 1YITA 1OJLA 4IXAA 1KU9A 2FF4A 4KMUX 4BDZA 3KYCB 2LCSA 2E70A 3K2AA 3HUGA 2H6CA 3MQ0A 2NUPB 2JTFA 4D0PA 3VS6A 3CCST 2HKNA 1OISA 1WJAA 2LLKA 3BQZA 3L7WA 4KT6A 4A4FA 1S8NA 1LDDA 5HS9A 4ZDLA 2HL3A 3C12A 3NRVA 1OMIA 4HEA2 1N77A 1B6AA 2OJED 5GAGJ 3GTGJ 1MMNA 3PQKA 4LIVA 3FXJA 1IGNA 1T6SA 2CFOA 2P8TA 3CTAA 2ZFUA 3M8EA 3LSRA 2E2HJ 2EAYA 1UMQA 2MABA 5CQXA 2B63J 4UB8C 1H89C 2FHDA 3L2UA 1T3LA 2JS0A 2M45A 4XORA 1DP7P 5HVQC 2B8AA 2FRWA 4G6QA 2MA3A 4RTTA 2OPTA 4M7DB 3A5ZB 3W6KB 4B48A 1RRJA 2F4MB 1YHQI 3KFWX 4HQMA 2XSDC 2DK3A 4M75B 2QSHX 2CUJA 3DBHB 3DPLC 4R79A 2YHTA 3V7RA 3JAME 1Q86U 1JJ2P 3GXOA 2Z1DA 2DERA 1JO8A 3AT1B 2OAWA 5DLOA 3ASKA 1PYVA 3PJRA 1AT1B 5CKEA 3KEOA 5GANd 1OULA 4KH0B 5GAOp 5I2MA 4GY5A 3UT1A 2D1VA 3HSEA 5EEGA 3JRBA 4KISA 3EG0A 2A5YB 3KXTA 2K7LA 4EVIA 2RM4A 3DKWA 2AHJB 2ESHA 3KP2A 4J9CA 5CVJA 2GIVA 5M5WJ 3A0BC 4G12A 2LX9A 1X2MA 2R0QC 1O3SA 2X1CA 4P96A 3E0JB 3UR3C 5F1JA 1PWTA 4UNOA 2PVDB 4NOYA 5CCAA 3MHXA 3RPQA 5KE3A 3U21A 2XRLA 1G59A 3BDLA 2HQ5A 3JCUC 3CDHA 3GLXA 5J1RA 2KXCA 3PL8A 4PJOD 1D09B 2GQQA 3RKQA 4KIGA 3LH0A 4RTXA 3SB2A 2B7EA 3LSIA 2KYMA 4B9XA 4NC6A 2K02A 3VSKA 3CLQA 4IHVA 3A8MB 2VT3A 3QWLA 3FKIJ 3ZQGA 2JA7J 4XLFA 3I53A 1SVLA 3BG3A 2ISZA 3K1NA 2DU9A 1GV5A 2IW5A 3DKYA 4M3FA 2R3SA 1JUSA 1FIAA 2CREA 5CR2A 3WHCA 4CYDA 4HCCA 3X2QH 4AD9A 4XN3A 1MDMA 2AS5F 1TQMA 3TW6A 2LCLA 2HS5A 2K3PA 5B1BH 1R1VA 2O6GE 3GOXA 1E3PA 5GMKl 3EETA 3GMEA 5LJ3g 2VUMJ 4OAZA 4EM0B 1M1GA 1O9SA 1JE8A 4QKUA 2A68F 2L7KA 4V2FA 4GDFA 2W85A 1X43A 2DXCA 1RACB 3VS0A 1W2BA 3QYFA 2NOJB 1WJQA 5DCMA 2EYZA 3CPWS 2V1DA 3SYTA 4RG2A 5GAHJ 1ZX6A 1MDMB 2MH2A 2E34A 2ELJA 1XGSA 3O8GA 1XGNA 2VJ4A 3LAJA 4XN0A 2E1CA 5IT3A 2K7AA 3CPWA 3JRDA 4Z6YA 5GANj 5DLQE 2V6CA 4D7NA 4LFUA 2KJBA 3QU6A 4EPCA 1UGRB 4AYBA 2LZ6B 2F4IA 2LC4A 1KU7A 3C0CA 1QPMA 1ZAOA 2MWOA 4X1EA 3UDCA 3CJNA 1IGQA 2G6FX 5LEKA 3I4PA 2CG4A 3LLRA 1SEUA 3VFZA 5HDKA 4DA4A 4M77C 2E36A 2HZTA 2VKHA 4Q5SF 2RF0A 1UG2A 4CC2A 1VQMA 1AZEA 4C5HA 3REOA 1ZELA 4ASNA 5EEAA 1Z67A 1EV7A 4C8QA 1BBZA 3M57A 1QMCA 4G7HF 1TTYA 2LJ0A 4RGRA 2EQUA 3WVDB 2J5PA 4C8QF 1LPQA 4XKBA 2KHMA 4DOZA 4S05A 3BG9A 4D9JA 5K5RA 3JV3A 3I55A 3EG9A 1PUEE 3PIPF 1X4OA 3ZQHA 5C4JJ 5FLXK 1QP2A 2K2VA 4JDSA 2ZMEC 2DA5A 2JTMA 1LE8A 1BK2A 4MNUA 4OIOF 1QKWA 2E3HA 2NS7A 4L9TA 3MKDA 5IXFA 5J26A 4U0YA 2M9UA 3QKJA 3KP7A 3KZIC 1SVOA 3HUGB 3DEEA 3HOUJ 1NTCA 4I09A 3CCMI 5IHKA 1B1BA 2CP5A 1QVGP 2DOFA 2EB7A 2F48A 4MDWA 3CC7Q 3MP8A 1HKQA 2DA7A 2JRTA 2WV0A 1QQIA 1W2BS 2QQRA 2ZPEB 5IP9J 2K5FA 2L0KA 2VBYA 1BOBA 3JB9H 2KR3A 4Y7NJ 3S6WA 4Y13A 1T95A 2Z5UA 4N0AA 2RKHA 2HBPA 1QO0D 5JHUA 1C1AA 1G3WA 1D8JA 5FU6B 5J4VA 2GLOA 2ZCFB 4B44A 1MD0A 2G9WA 1BA5A 1YIJQ 2UXNA 2EFWA 1EIFA 5GAMd 3BJAA 5D4RA 1Q95G 4EM1A 2GXAA 2X3XD 5GANe 1MBFA 3PNTA 1MKMA 1YI2Q 2R92J 2E5KA 1TL8A 2EFQA 4GYGA 1X6BA 1HKTA 3OMGA 1Z91A 2AKKA 2OTJT 1X4PA 2M0CA 4L5GA 3OW2P 2FUG2 5D5VB 4ZYEA 2KDOA 3HL8A 5F0FA 2CU7A 4XOPA 1K9MU 3D0SA 1XC5A 1PCXA 2KIMA 3BZ6A 2RN8A 1F43A 4ORZA 2R7OA 2QBYB 3LMMA 3MKZA 2LNBA 1FOWA 1XMAA 2XGDA 2OAZA 3C2BA 3S1QJ 2FNAA 5KNLA 2SRCA 3LSGA 1K0XA 5LEJA 1RKTA 3HFNA 3CMET 3L42A 5IHIA 1U5TB 2VN2A 4C3JJ 4OMOA 1KQ0A 1TNTA 1Z7UA 2VXZA 5FKLA 3T1BA 4XR6A 2HOTA 3L2ZA 5D6YA 2D2WA 3A2KA 1JRIA 1UZCA 4L5EA 4PKCC 4KJZA 4A3KJ 3GFJA 1KQSA 1VQ8T 3CC7T 2YUPA 1XSDA 1PRMC 3PFIA 1X58A 1RLQC 3LNQA 4M3EA 2CV0A 2CSOA 1M4ZA 2ABLA 4II1A 2MC3A 1A35A 1HSTA 4RTYA 1Q86C 2B86A 1F1ZA 1P7JA 4IUVA 2P0KA 1YI2I 2XIGA 3RZOJ 4VUBA 2ECBA 3EPZA 1YJWA 1RAIB 2IS4A 1RIOH 1U1SA 1WFWA 3HC7A 4AWXB 4U7DA 5A2QZ 4UC4A 4GBQA 1LDKB 3KYDB 3LQRA 2Y4YA 1MBKA 2Y2ZA 5JVGF 4MTDA 4JRQA 5DTDA 2LF8A 1PP7U 2XPVA 3RCOA 1YNZA 4GLMA 3CQZJ 4PJOG 4B9WA 3RNJA 1ON1A 5CQEA 4U7BA 2CP7A 1J7KA 5ICEA 1Q81U 2M51A 3TU4K 3IP4B 2RJEA 3OA6A 4XSZF 4LB5A 3H6ZA 3JSOA 3BG7A 3BROA 4IUTA 5KYWA 2VQCA 3WU1B 4EV0A 4DGWB 3BJOA 2ED1A 3KUFA 2LQKA 2X51A 4EEFG 4G7OF 1IUYA 2E41A 1FOXA 2RNGA 2ZBKA 3FK7A 3MVPA 3PIOF 3AKZA 3V7SA 1AKHB 2FX0A 4C3IJ 2FU4A 2CUBA 4QQGA 1RI0A 4OB1B 1Y6IA 3GZ6A 5J1YA 4KUIA 5FKNA 5LRSA 4YIRX 4CZZA 3T9NA 2H94A 4ZJZA 1W0TA 2JN6A 4M6XA 3CCJA 3B02A 5GMKe 1Q82C 4LXCA 3ASOH 4RDUA 4OIPF 4HDVA 2DFHA 2P5KA 3I56I 1Z77A 3HPHA 3B73A 4EJTA 4M6YA 2O01E 3S17J 2KL4A 1HQCA 2E7XA 1QWEA 3JCMP 1OQYA 4M7AE 2HCKA 1K7AA 2ZSIB 3I58A 2A3SA 3TDUC 2XHCA 3IHUA 1FTZA 3X28B 4M78D 1HW1A 5LRRA 1M1FA 4OMNA 1MBJA 5I22A 3E6BA 2BV6A 3J7AF 3OL3A 3REAB 1YE9A 2EWNA 5IOYA 4RB1A 4X0GA 2EBIA 2FMLA 3IKTA 4QLCU 2Q0OA 3CJQB 1KSWA 2CT3A 2E6NA 3LYIA 1R5ID 1VYVA 2LKXA 3NAUA 3G71A 2WACA 2UV1A 4J5YA 2DI3A 2X85A 5D6FA 1QA6A 2KXDA 4FU6A 3LSTA 2PMZN 3D5SC 4WX9A 1GXQA 2WY7Q 1VYUA 2M0YA 3ZPLA 1S7OA 4YFXF 1QVFP 1T8IA 1OPCA 3ROUA 2CV1A 1KU3A 1J09A 2DDBA 2DOAA 1RADB 2HNHA 3N5BB 2JK3A 2RJFA 1XCBA 3CLOA 1UHCA 2DRKA 4ME7A 1H9GA 4BS9A 4M77G 2CP2A 4FHTA 3F70A 1EH6A 3HHGA 3HJEA 4C2MJ 2QCOA 1MSFC 4XTUA 1YI2T 4DBQA 2F5TX 1JKPC 1ZTRA 3I35A 3CBPA 1SFXA 2R5ZA 3J7AY 2ELHA 1WI3A 4BHCA 2DVJA 2C0TA 3L2VA 3HOYJ 3CUOA 5M9OA 2OCCH 5GJVB 1U9NA 1YN8A 2MD5A 2X6WA 4JUVA 3L2CA 1OCPA 2GXGA 2L4MA 2XAGA 3FZVA 2ZJQF 2ROTA 3J80K 3BDUA 5A0DA 3TO7A 3QPSA 1Z6TA 2HZYA 1JB0E 1HSQA 4IUPA 2D1XA 3S16J 3TOAA 3VB2A 3TEEA 5IT9R 1X1AA 2M87A 3DPTA 3RDIA 4F04B 4C8QB 1WRJA 5DUKA 3ZMSA 4M7DD 2P5VA 4UVBA 1W7PA 2DZCA 2MC4A 3VDXA 1BB9A 4IIMA 4KUDK 1ENHA 1TUDA 4PDKA 4ZGEB 4NQWA 2CRGA 5CIUA 5LD2C 2DO7A 5M3MJ 3RDVA 5LFAA 2JMCA 3FMSA 2RQTA 4JZ3A 1XN7A 2AQFA 2XPWA 1WJ5A 2RK1A 2K85A 1HSJA 3FXQA 2L2PA 2Y30A 4KGXB 5GTHC 2W84A 5IP7J 4N4GA 2PTKA 4JQFA 3OOUA 2K3XA 3X24B 1E6GA 3LWFA 3WHBA 2EJ9A 4CC4B 5A2QE 3I59B 1FEXA 5A0LA 1TXQA 1O3TA 4LG3A 1BW6A 1EF4A 2P0QA 1Q86R 2E71A 2FA5A 1A04A 3K4KA 4AU7A 2EQJA 2DCEA 3CCRI 2YUQA 3CO6C 3GX4X 3CCEI 2C6YA 1E7OA 2MW8A 2A6TA 2ZO4A 1FBQA 2KKOA 1WH7A 4UUTA 3RTRA 3VSLA 1ZG5A 1G4DA 3ZMDA 4CXFA 3RESA 1N8RU 3SWNA 3S1MJ 1OCOH 4EJVA 5K5QA 2XAUA 2A3LA 1PJRA 2BZYA 3FXOA 3VV0A 1U1TA 4F7UF 3FWEA 5IPAA 2WWYA 1ZQ3P 2E4HA 1QRYA 4X1VA 3I54A 1XX5A 2AXLA 2RJDA 1K4US 2M1HA 1YW9A 1B7TA 2P4WA 4HG2A 3F8MA 3ZQFA 5I11A 1D3YA 4M77B 4NHJA 4DEYA 1R58A 5IOZA 1TOVA 2HDAA 2DTIA 4PJOF 2EFOA 3CC7A 2FL7A 2BHYA 3RBBB 4RMOA 3META 1TT0A 1KD1C 4BUPA 4N0BA 4IOAF 1KQSS 2M16A 4A12A 3RR6A 3ZFJA 2DFEA 3D5LA 5E3NA 3LSMA 2MAMA 4B6MA 5DCMB 1SPKA 2JJ7A 1Q82R 3SEMA 5IYCJ 2J06A 3L1PA 2DMTA 1R00A 3REBB 4U88A 3GF5A 3CCQI 1N78A 3WTXC 2GWRA 2HVRA 4RCCA 4F3QA 1DP3A 1NLOC 1SHFA 2WSFE 3CMAQ 2DAOA 1WSUA 1ONVA 3HRSA 3S8PA 2P7CB 5ILVA 1X01A 2KGTA 1VQMQ 2QSGX 4Y28E 3BC8A 3LAPA 3IRQA 2D0NA 2B0LA 4YTLA 1FLIA 2O03A 4I76A 2NLUA 3HOTA 2E6ZA 1Q1HA 3EGXB 3P9CA 5BS6A 1HXDA 4DOVA 4ELYC 5I2SA 1NJIU 3KX2A 1UG0A 3PNYA 1QZZA 2PJRB 2ID3A 5CAIA 1XTAA 5KK1A 1U3OA 2JW4A 4PJOE 3IWZA 1N25A 1NJIC 1VQLQ 1EJ9A 3VS2A 4M78A 1WYXA 3QYBA 4M75E 3VS7A 3CCSA 3QQAA 3AG2H 2RA2A 1VQ5T 3DFGA 2GFAA 2LG4A 3FBNB 3LFUA 4DYCA 2O9LA 1FNNA 2OA4A 4E6KG 2AXTC 2JMWA 5BPIA 1IAWA 2CV2A 3HHTB 2OF7A 1P4XA 2JMAA 1Y71A 1R4NB 3G6EI 2MZ4A 3A03A 2GQIA 3EYYA 3QUIA 1B34B 1VQKT 3OYGA 2BY0A 3BG5A 2J5OA 1MGQA 2DEUA 1RKWA 1N75A 2FB7A 2HEOA 5GAOl 4IF4A 4IVNA 2X98A 3J7AW 1JXOA 3GTMJ 1B59A 1FOKA 1M3CA 4M77F 1BW5A 4CCNA 2GM4A 3QHSA 1K8AC 2H1KA 1I1JA 5IY5H 1N9SA 2QDLA 3M9QA 2LJ3A 1Q7YU 3GYHX 3PMTA 5KYXB 4M7AG 4AFQC 2NUTB 3CMAT 3G71T 4HNUA 2VQGA 3PNVA 1OI1A 2KE9A 1Y1VJ 3DBRB 2DW4A 3DTEA 1J3TA 2JSCA 4L9NA 1MIJA 3ZN0A 5FW9A 2FQ4A 2R5AA 1X1BA 2FZGB 2CP0A 1XSXA 4LLNA 2PU9B 2Y31A 2EYYA 4MTEA 3EUAA 1AEYA 2XICA 3BR3A 3SHWA 3G2BA 4BB7A 2CYYA 3OWTA 3GTLJ 1MBHA 5HLIA 1V5GA 1WLPB 1XNIA 4P5OA 4KMFA 4BJ6C 1WJBA 2F5CA 3FC3A 4RAFA 4LD6A 3EG1A 3VUZA 2WADA 5FD5A 1WHLA 3A02A 2NUPA 1TBXA 2EIFA 3G3ZA 3G4SA 2OBPA 3C1DA 3TO9A 2DXIA 2JPCA 3NTIA 2DL8A 3U23A 3K4JA 5KCMA 3NMZC 5D6XA 3VRYA 4BAYA 1LDJA 4B8XA 2XG8D 1GFCA 3ZN1A 1KJWA 2COWA 1I3AA 3IH2A 3LA2A 3W2AA 1I50J 3FJPA 5HDNA 4QSHA 3FDYA 1TWBA 4GRIA 1B3QA 2CQ7A 1OZ3A 2FEIA 2AK5A 4OMMA 2JA2A 3VU3C 3JTHA 2O0YA 2K3BA 4ZDPA 3BTJA 2VQLA 3F3XA 1LVAA 2Y9ZA 4TVRA 5LJ5g 3ERED 1D3BB 3GZ5A 4MGRA 1WJSA 2ISYA 2Z16A 3RMQA 2ELKA 2JQ7A 3OYKA 2DAQA 2JS2A 1G3TA 1BC8C 4FE7A 1IHVA 2YRVA 3MEWA 3JRCA 1ODDA 4A4EA 3G71Q 4XIDA 2P81A 1J5YA 4IEJA 1WPYA 2HYJA 3OMCA 3CC4Q 1U06A 2ZMEB 3OSVA 5HKCA 2E12A 5AIPA 4XLPF 4BY1J 4ETSA 1KQSP 3AAFA 4BY7J 3JCMJ 4IHSA 3LSHA 2I8DA 4M9ZA 1D3BA 4ZYHA 3OQ5A 2J6KA 5IP6A 3TVTA 3I3LA 2D8HA 1MMGA 2IBDA 2RQPA 2DYRH 2K9MA 3KZYA 4OU0A 3RSNA 1QCOA 2VPLA 3BPXA 3I56A 1UEBA 3NHNA 4D8DA 4J9FA 3PFYA 2LH9A 2QKMB 2E5QA 1U3EM 4E7IA 1M1KU 2A5WA 2DLLA 2VKVA 1NBEB 3FXRA 3QJ6A 3RKYA 1VQMT 4J9IA 5CVUA 2V1QA 5IT9K 2KRFA 4JRPA 1Z9CA 2X4HA 3TP3A 3RKXA 1TWFJ 1ETXA 3K4BA 4AIHA 3OSFA 2EV5A 3C3WA 4OMYA 4QVCA 4BD3A 4OVAA 4PFZA 1BL0A 2XAJA 1YYVA 3DP7A 5L3BA 3A1YA 3F21A 2LP5A 8AT1B 3TGNA 2DA9A 3EUKL 4F91B 2JSPA 5L3EA 4BE0A 1ACIA 3G71I 4YIFA 2DEQA 2FBHA 3EUHC 1OR7C 3KP5A 1MMDA 2VXDA 2KBTA 1Z9ZA 4M75D 5FRMA 1DPRA 2XVCA 3SDBA 2VBZA 1RUOA 4WXDA 1ZA2B 5LJ5j 1XDSA 2F5VA 4Y52J 2FOKA 1R4MB 2ZNZA 3JCMW 1JUPA 2DN0A 1E3OC 3CC2T 2EV6A 4JYKA 3CJRB 1BCMA 3TSWA 3JB9G 3BE3A 2QYOA 2I2LA 1KC8C 4XRMA 4OB2B 3RUXA 1BN5A 2K3FA 4BI8B 1EX4A 3F8CA 1GCQC 3QOPA 2V1XA 3TQNA 3H0GJ 1RR8C 1G2HA 4RCBA 5DM7R 4IRIA 1YJWQ 1APLC 2IA1A 4LIUA 3JREA 2PVOB 3IC7A 1ZK8A 3ONQA 4L18B 1RI9A 2RQVA 1BJZA 1I81A 2GFUA 2ROLA 4A3CJ 2HR3A 1UAAA 4ZN3A 4QW2A 4PSXA 4AIJA 1NZ9A 3M0RA 3HP9A 1S3JA 3T8RA 2VV5A 4Q47A 1IRXA 4X34A 1JJ8C 2XU8A 4QQDA 1R22A 3I4MJ 5EZGA 5IYBJ 1IRZA 4J8OA 4M6VA 2QQ8A 1MBEA 1I3QJ 1M1EB 4IURA 2GGRA 5CKBA 3CCMA 1N8RR 3B6AA 1WGXA 2Y9YA 2JA6J 5IAYA 2L8DA 4KT5C 5GADJ 4YG2F 3PIPA 3DV8A 2ICWG 3CCET 1GCQA 1XJWB 2VT2A 3ZQQA 1VQKA 4C0FA 1FTTA 2NUZA 2DRMA 3VS1A 1YJNI 1SG5A 5LJ5h 4BU2A 4H0EA 4DBRA 8ATCB 1BM9A 1T08B 2BE5F 2BY2A 4A2UA 4LK1F 3L2WA 4GLKA 4EMKA 5LJ5e 4RAZA 2QUFA 4EDUA 3GP8A 2YRDA 1SD5A 2XASA 1TWAJ 3DQVC 4E7LA 1VQ8A 3GWZA 3GFMA 3F22A 4JJDA 5DV5A 5LJ5d 4GXOA 4IQ4A 3HIFA 2E35A 2A6EF 4RGSA 4D8KA 4A63B 4Q4ZF 1V3FA 4DW6A 4CCMA 3GPLA 3IRRA 1Q7YC 2HMAA 1PKTA 2JTEA 3VUBA 2GBYA 3ULQB 4EMKB 3DU6A 2EFIA 2LRDA 1UELB 3EDPA 1MH4A 1VA7A 2CP6A 2LNHB 3F0CA 1VQ7Q 2OV7A 2EGEA 3LFKA 4XK8E 1GT0C 4A54A 1AHDP 1WCMJ 2OQRA 3J81K 1VQ4I 1B34A 3QODA 5LGNA 2PBIA 5CVIA 3CDIA 5ILUA 3H3ZA 1V5EA 3S2WA 3HKZN 1JJ6C 4FCYA 2F4OB 5DD4A 3SFZA 3WODF 1ZBJA 1ZSZB 3OS5A 4QVZA 4J19A 1GL5A 5IYDJ 4LK0F 2OTJA 2V1UA 1NEBA 3QOEA 1RETA 2EQIA 3EH1A 3LH5A 4BEHA 2X4XA 1WJFA 3ME9A 4C92D 3NEUA 1H0MA 3HGGA 2ZXJA 3F8NA 3QPLA 2PLYA 1IXSB 1IV6A 2A28A 4DEXA 2K4BA 2HQHA 3DLMA 3WXMB 3OSSC 2R7RA 2PVGB 1VQ6A 1UJ0A 1G6NA 3HSRA 2L7FP 3I71A 6PAXA 1XTDA 2KT0A 5JLXA 3OYJA 2M2EA 2XB5A 2KVQG 2DA6A 5ICCA 4A3EJ 5J6XA 4K11A 1OPKA 2EYQA 1ZHFA 3H9JA 2BTTA 2E3IA 2DKGA 5GMKh 2RHIA 1TWHJ 2L2OA 3OBWA 5ED4A 3SFMA 4M7AA 2IVMA 3L2QA 2BXYA 3INZA 1TT5B 2IAIA 4RA2A 1IREB 1Z05A 2I10A 4PCQA 1OPLA 3COAC 2NWMA 4IIOA 2G7UA 3G1OA 3LSJA 3FBIB 4S04A 5B5EC 1MH3A 2Y69H 4EQQA 1V54H 2L01A 2QAZA 4JJCA 2SEMA 2V79A 1WKMA 4XRFA 2UUZA 2BE7D 2LKSA 5GANh 1D8KA 1U2WA 2CUZA 4CUGA 1VQ5A 4R56A 3MKYB 2LMDA 1EH8A 2W82A 3CF2A 4D5CA 4YIIA 3JCMh 1OEBA 2QBYA 3VYGA 1RESA 3BTCA 1J75A 4IUQA 4LDVA 2EPFA 1M27C 4GGGA 2AT1B 3DEWA 2EJFA 1NG2A 2CGHA 4JX6A 1W4SA 2MGQA 3MCAB 1VQ8Q 1D5VA 4A4GA 1X1DA 3PFSA 2NNNA 1OU9A 2YUSA 4ZYDA 2R7VA 1HW2A 1XQHA 4J9HA 1Y0UA 2HYFA 1YIJT 4ENKA 4J9GA 2Q2EA 1K78A 4CO8A 5FJ8J 3PM1A 4BXXJ 2CS3A 1TWGJ 3KE2A 5FKMA 2R7UA 4OIQF 4E2FB 3JCMe 3MO8A 2VPRA 1AOYA 2IXSA 1FX7A 4R0KA 2V8JA 1OOTA 4M75A 2CW8A 3DB3A 1NE8A 1MV0B 1H3HA 1HLVA 1PG5B 1XPXA 3QPHA 4PK4A 3CCQA 4XOTA 3F8FA 3HTRA 3MEVA 1AWWA 1ZLMA 4AG2C 1FXXA 3M0PA 4CH7A 1KQ9A 2DJNA 5EGOA 1VQNA 3HRUA 3ML6A 4O6JA 3TOBA 1JT6A 2V8IA 2QM3A 2M3AA 2IGNA 2CMPA 4HT8A 2RQRA 1UTIA 5BMZA 1YS7A 1AWXA 2V7FA 4DIQA 3W6VA 5KYXA 2F5FA 2VE8A 5FO5A 3WG9A 2BUDA 2YLBA 5HNFA 2VODA 2AZSA 3QU3A 1B72B 1ERDA 3OYNA 5FD6A 4N9IA 2DF6A 1EA3A 2ZJPF 2EKOA 2VUBA 1TLHB 3MP1A 1R8OB 4M9SA 1RL2A 1VQLA 2GOMA 5L23A 1XOVA 3VRZA 3LL7A 3SXYA 3ZMZA 1X2QA 2RHYA 1WJDA 3CZ6A 2DT5A 2A0FB 2DBKA 3DLAA 3HPGA 1QGPA 4GO1A 3ZMVA 1ZG3A 2F69A 4RUGA 4WK8F 1WI9A 4BQAA 4BBRJ 3VS3A 3VS4A 2RQUA 4HCZA 5I21A 1QCFA 1XD7A 2XC7A 4IHWA 3HKZA 2K5CA 2XDDA 1ORKA 2ECZA 2KZVA 2NVUB 5K7ZA 4M7AF 1IXCA 1QLYA 1UG1A 1TQIA 3SEQA 4R8HA 2R7DA 2K2MA 3G1JA 4MEXF 3QYHB 1G2BA 9ATCB 4LDWA 3Q0WA 3E19A 5EGOB 3OSGA 3EH2A 3VJPA 4A4KA 2DODA 1TNSA 3E6CC 2OD5A 1OYIA 3J7YJ 1F1BB 3GZNB 1MHNA 2VI6A 2QVOA 3GW2A 1VQOQ 3E7LA 2MUNA 5DYMA 3C94A 3VEPA 1VQ4A 4C30A 2Y4XA 3MN2A 2CQQA 1LQ1A 3WTUC 1HKSA 4QWQA 3UNGC 4IQJA 4Y33A 5LLQA 5D4SA 1JKRC 1ULYA 3BPVA 5HLTA 1E17A 2H3JA 1M2OA 3PVQA 4PNOA 2D6FA 2CZ1B 2VGMA 4XRSG 2R7SA 2MLGA 2QDYB 2LR8A 2KRSA 4LUDA 1FP2A 2HAXA 5FU7C 4BJ5C 3ZQ7A 1NJIR 1WA7A 2QK0A 2DBBA 1T0HA 2JZ2A 1HA8A 2VVKA 2LDMA 3RIRA 2WAFA 5DEQA 4BQQA 4M75C 2KDZA 3CC4A 4IHYA 2Z3YA 2VBXA 2XF5A 4M71A 4D5FA 2WB1N 2NAZA 3BZCA 5E1XA 3ZCOA 4F92B 3G4SI 3ZBDA 4C92A 4BJTA 1BI2A 2IS6A 3DPUA 4C8QE 3H5RA 2X48A 3GFLA 2DMOA 3OY9A 1RUWA 3FMRA 1SSHA 2WA0A 3URGA 1SANA 4G8XA 1R9TJ 3M58A 5LBQA 2K4JA 1IJWC 1M5Q1 4ZNXA 2IPQX 1S72A 4EM2A 3TO6A 4J9EA 4ZH4F 4EMSA 5J47A 4LOCA 4IKFA 3GTOJ 2RI3A 2FYKA 2DXBA 2Y48A 3F72A 3FHZA 2F2VA 4J6YA 3QYEA 3RQ4A 5E17F 4CZCA 1AD5A 4LDXA 3CUQB 2DD4A 3R6SA 3OIQA 1JGSA 1B8IA 1GBQA 2VC8A 5KYYB 1X3UA 4LITA 4YEJA 4UXNA 1AKHA 3JB9J 3RMSA 4V19K 4ESFA 4KGVB 4BL0B 2HQRA 2L7MP 2A36A 4A3GJ 2R58A 1HF0A 2EGCA 1H92A 4O5VA 3I5SA 3OYCA 4CC7A 2LP0A 4HNTA 3WTVC 2JPBA 3PT9A 4MZPA 1PUFA 4WWCA 2ADUA 3I64A 3IAM2 2A05A 3J81R 2R7WA 4M78G 1WJRA 3ZGKA 2C0OA 2QEXA 4A3FJ 4C0GA 4LNPA 1K73R 2WBMA 4XQFA 4UUSA 3S14J 3QSUA 4GCVA 2BZTA 2COMA 3UA7A 1ETVA 4MIMA 3CCMT 1VYTA 3H9GA 2QASA 3BW1A 3ASNH 1R71A 2WTEA 2QGFB 1YLFA 3G7ZA 4JLIA 4DNCA 3A01A 4BHPA 4AIDA 1T38A 1Y7XA 4M7DA 3WGIA 2R5YB 4BBSJ 2KPMA 4M77E 2EA2A 4IX7A 3KP6A 4E70A 2AZVA 1IZ1A 2YUOA 4CCOA 2LD5A 1VZ0A 3QDFA 3CCSI 2DT6A 2L02A 2KT1A 2LQNA 2FBKA 4IRHA 3TMOA 1V29B 2K9QA 1X3ZB 4TV7A 3SQNA 4JK1X 1LFPA 1YG2A 2VWFA 4BY6C 1RAFB 1S1NA 4RTVA 5M3FJ 2PI0A 2FEZA 1POGA 1P7IA 1K61A 3SHFA 4LLGF 3D7SB 2OTLA 3JCMb 1VQNQ 1R1UA 3OYYA 2LY1A 4JLGA 2HQNA 1P92A 1ETQA 1DGWY 1HDDC 4BKXA 2VONA 5HODA 4C5EA 4DBFA 1LJ9A 2IJLA 1WQWA 2KLOA 3OYMA 7AT1B 3W2WA 3PUFA 3G4ST 2XHKA 4A5NA 1JKOC 2ME0A 2JA5J 1MNDA 3FK6A 5LL6S 4PJMA 2MD0A 5FLXZ 2EFPA 3IUOA 4RAYA 5AIQA 3GVAA 2L54A 3FHNA 2PEXA 4FX0A 5KVRA 4HNVA 4LG0B 2DIGA 2DTHA 2MCNA 4QPQA 1T33A 4XU2A 4XU3A 2IGMA 2P0WA 4RM2A 1USTA 1O3QA 1RR7A 2DTOA 1M90U 2EA4A 3VYSB 2R5YA 2H8RA 2LY2A 4L9VA 4KYWA 1HK9A 4HKEA 4HQEA 1LE8B 3KP4A 3NARA 3FM3A 2YR2A 3G6ET 2RQQA 4HV6A 4FT8A 3JRAA 2KRCA 4Y3OA 1IN4A 5IXBA 1JEGA 2ZXIA 3R4KA 1VOMA 2RHUA 2GQVA 3A1PA 1XDUA 3JB9D 3RPUD 5J1UA 2X1DA 1X2KA 2QLZA 4C8QC 5KCHA 1NM7A 3CCLQ 1IG7A 1N6AA 1TQPA 2H27A 4L6V5 1TTHB 4ZGJB 4M78B 1YTYA 4HV5A 1PUFB 1K6OA 1PSEA 3WGHA 2HXOA 1MV3A 1F36A 4FQGA 3L1AA 4J6WA 2K9NA 1RABB 2J6OA 3NQOA 1MJBA 1T56A 1IDZA 1C6VX 1VQKI 3LW5E 2L7ZA 4N4OB 3SEZA 1S72I 1SFUA 1WDXA 5F27A 4OMQA 5FU6C 1ZR4A 2PJPA 4Y91A 1WHJA 4HDUA 4YRVA 1OX9A 4M7AC 3C18A 5GMKm 3M1EA 1FJLA 4F17A 2HWVA 1Y57A 3I9QA 3CXCS 2BGCA 3ZP5A 5DUIA 1PRLC 2GAUA 3CP2A 1MBGA 3TP0A 1YQAA 3FXKA 1GLNA 1YOVB 5FB2A 1K9AA 1OYWA 4JZ4A 5HK0A 1UHFA 4MMLA 4PLLA 2EJRA 3LSPA 4YELA 4PFPA 2DT7B 1O4XA 2JVVA 4JX5A 1FYNA 5HK3A 2HOEA 5CJ9A 1Z7LA 2ZKZA 5C44J 2QEXI 3DTKA 3VWBA 1ACMB 3EHRA 2AO9A 2DLPA 3TW7A 4IL6C 3NTKA 2CUFA 2WV1A 3GIBA 1WZOA 1GV2A 1U8RA 2VYTA 5HY6A 4AG1C 1RI7A 2FBIA 1GRIA 2JOYA 1FMKA 1LOJA 1DGRM 1JKQC 1AVZC 4S0HB 3PVLA 3FISA 2KIFA 4N9HA 4EMGA 2MIOA 5EF6A 3CC4T 4PJOC 3UKGA 1VQKQ 4UV8A 1DU6A 3M0TA 2ZXHA 1UJYA 2DFIA 2L9VA 2DXUA 5CVRA 1FOYA 2BKDN 3PGGA 4HT9A 2DM1A 3GF2A 3CCUQ 4KDPA 2NOGA 2BVMA 3NWSA 2DMPA 4NL2A 3QP5A 3C4SA 4KBMB 3CCLT 4M3GA 3CMAI 2Z99A 3GLLA 2R7FA 1OCCH 3BZKA 1WJCA 4BY6B 2HFHA 4E6RA 4F7UG 1W5CC 4J6XA 4M78F 1K76A 5TGTA 1V1CA 3O3KA 4HSRA 3SZPA 4FASD 1ZRCA 1VQNI 1G83A 2CWEA 1E2XA 2V9VA 3CMEA 4C92G 1YW8A 2BYVE 4F52A 1V76A 5GAN8 2DA2A 1LFBA 2QZ8A 3A4CA 1OQKA 3JRHA 4C92E 2V1NA 2OI3A 1DU0A 3CPWP 1ZRFA 3JCMf 2K9SA 2CH4A 3H0FA 4AFSC 5CKTA 2NYSA 1D1CA 1Y8QB 4NC7A 4XM3A 2CP3A 3JRGA 4ESJA 1GUUA 4OMZA 1T3SA 5K7FA 1VQ9I 2DJZA 1YITQ 2RNAA 5GTIC 1JT0A 4M4ZA 4XTYA 3MAJA 3S2HJ 1VQ5I 2X6OA 1QVUA 2O4XA 3NPFA 3LX7A 1WJEA 4ZN1A 3HPWA 2KP6A 2P6TA 4RS8A 2Q8KA 3WTZA 2O2OA 4PLIA 5GAMe 1KFZA 4PZJA 2X9DA 1QQJA 3OR2C 3FIFA 2M0MA 4II2A 3ELKA 1U5SA 3MCZA 5FWCA 2ID6A 1QP3A 2FNPA 4L9JA 4E7JA 1P2FA 5FKOA 1XGOA 4CCKA 3H3VK 5D8LB 3QZ5B 3CCVT 1QBJA 1K73U 4HVVA 1SD7A 4NUBA 3CC2A 2DTRA 2R7TA 2EQMA 3S3NA 2LOOA 4F55A 3FMQA 4M75F 3PTAA 1KD1U 2F5KA 5DD8A 5A2QR 1FP1D 1IXRC 1FBSA 1NG7A 4II3A 5DM6F 1DJ7B 2R5MA 1UGVA 2ZCWA 3WGGA 1EZZB 4LG0A 2RV8A 3JSCA 1N5ZA 5D6WA 2STTA 1GXPA 4HX7A 3SFIA 2K5IA 3ZRGA 2HOAA 2CGPA 1ZA1B 5AT1B 2HQEA 5FFZA 5LHHA 4MFDA 5BNGA 2F2XA 2FXAA 2K3YA 1R49A 3CMYA 1AWJA 1UB4A 1RLPC 5CO7A 2NVXJ 2O7OA 1HBXG 1H9TA 1JJ2S 1YITI 3B6CA 3CCJT 1VQ9Q 4L5IA 4MHGA 4HCKA 2X4YA 2HD0A 4AT1B 3WTSC 1P9QC 1I0CA 2MOXA 3BOQA 1T0FC 1REPC 2MMPA 2JTVA 2FMYA 2QG9B 1YX3A 3N97A 4Z89A 1QVFA 2P0PA 3QPTA 4A3MJ 5JVTA 4RGXA 1HCRA 3OYHA 3CC2Q 3HFOA 2QA4T 2EIKH 2RI5A 1X69A 2B9SA 1H88C 2W1OA 2HVQA 3W2VA 4DYRA 2L9NA 2NVYJ 1VQLI 5GAMg 5GAOq 4FE4A 1M2VA 2TCTA 1UGSB 4HF1A 2M5WA 4BQOA 2HQXA 3FB9A 3H0IA 4A53A 4F7UB 1QVGS 1TC3C 1JBMA 5FLMJ 2DA3A 2ZFWA 4LD9K 5JHFA 2G7HA 3I56T 2YU9J 3FEOA 2XIDA 4BXFA 1YHQA 3OYDA 2HVSA 3H9NA 1R23A 4M3BA 2VKNA 5CPRB 4A3IJ 3ZQLA 2TRTA 3I5UA 1TH7A 3R60A 3JAMK 2QQSA 1B8IB 1SRMA 5GAOm 5GMKj 3A8GB 5EZHA 4PFOA 3EGXA 2DZ9A 1HDPA 2IIMA 5LJ3e 5GAN6 2OAUA 2QQAA 3CC4I 2ATCB 2KAFA 4N4IA 4HPQA 2F6CA 3CMEQ 1YJNT 2VKDA 3O8HA 3JAMR 4HCBA 4M7AD 1NYGA 1YI2A 5CQYA 5KYWB 2FRHA 2LY9A 2YX7A 4EGZA 1LB2A 1KK7A 1ETOA 3V7CA 2TDXA 2V26A 4JBAA 4EJUA 4CYCA 2CS7A 3K2ZA 2ZAEA 1JJ2A 1K8AR 4XKWA 1OYYA 5BPDA 2KT8A 1ARKA 2QEXT 3OYIA 2KSSA 2DBMA 1B9NA 5KYUB 1SRLA 2E19A 3QP6A 2CUDA 1ZARA 1YIJI 1I6XA 1W36D 5FWBA 3S93A 4WF2A 3PIOA 3A52A 1OCRH 4X6AJ 4OMFB 2ZJRF 4X9CA 2CFXA 1EFNA 2EZIA 2LREA 3HOVJ 4XU0A 1RUNA 2EH3A 3K4NA 3Q9SA 5D5XB 1VTNC 1D1AA 2JRMA 1QCNA 2IRFG 4HX4A 4FIBA 1D0YA 1FPQA 4JRKA 2QGGA 1W36C 2XAHA 1CF7B 3EFSA 3QO3A 1M3AA 5J40A 3E5UA 2PN6A 4HA8A 1VQOA 1GXIE 1BI1A 3IV5A 2VIXA 3CCJI 1YITT 4H4KC 5BQTA 5JLWA 2DA4A 3GO5A 3CC2I 2P5LC 2CW7A 3OIPA 3SZGA 3CMEI 2J05A 2O9VA 3PE0A 1W7PD 3V4GA 4CSWA 1F5TA 1C0MA 2IGKA 2OQGA 3CESA 1XMXA 1VNDA 5EEHA 4BUGA 2E1MB 3BFMA 5D8KB 4B4CA 4KNYA 2FRYA 2NVTJ 2ME6A 1WXUA 1VI0A 4XBFA 3VOEA 1K1ZA 2COBA 5BOXA 1ZYRF 1S72Q 2YLCA 2HNIA 3O5ZA 5FLXE 4OGCA 1IN7A 2GOXB 1WHMA 3G1MA 4JP0A 1PD1A 2QI2A 4J83A 4BI4A 4ESRA 2E1NA 4NB5A 1VF9A 3CCVI 4XTVA 4C8QD 3S3MA 2ZPIB 3CCMQ 4AIKA 2KMUA 4WXCA 2BIVA 1KONA 2BEOA 4KRTA 1A6IA 1ITYA 2JWTA 1WPKA 1VQMI 2V9PA 3FKJA 2D1HA 4HLYA 4DZPA 5D5UB 3J81Z 2DMNA 4XLAA 1LCKA 2EBPA 2F1LA 2FPDA 3CD6A 5K5OA 5ECAA 1ZR2A 2IS1A 3KP3A 2DILA 3FDRA 2W00A 2MK5A 3R6NA 4ATOA 4A5MA 1WHKA 3WG7H 4K2EA 2AKLA 1V55H 4FT2A 3AG4H 3E97A 4PJOA 1Q81R 3BCAA 2UWMA 5K7HA 3X26B 1AHJB 1A6QA 3E1SA 3H1CA 2CW0F 1GCPA 4F16A 4G94A 1A31A 5AONA 4ZGDB 3SD4A 1VQ4T 3BR1A 2X4WA 3KPHA 1X6OA 3JCMQ 3ZQIA 4RB2C 2P7VB 1TUCA 1VQNT 2X6YA 2ZPBB 4HF2A 4PGHA 1K6YA 4HYEA 2HYGD 1O7FA 4HW0A 3W6JB 2QSFX 4XICA 2QF7A 4R1HA 1NPPA 1ZGJA 3NFCA 2DXTA 4G9YA 3EGDB 4Y17A 3UWNA 2Q1ZB 2A37A 4FSXA 2RD1A 2DTZA 4C3HJ 2XDVA 2CQNA 3BR6A 2ESNA 3FXUA 1FYKA 1WHGA 1JU5C 5ILSA 2XK0A 4HOBA 2EW3A 4C0ZA 4KFCA 1WZ2A 2VXEA 3CPFA 3EG3A 3LWHA 1GHCA 3TDZC 4UVAA 1SEMA 5KE2A 1WWXA 3K4LA 4RM3A 4JS4A 1W5SA 3H3UA 3HEFA 2PUKB 2XDPA 4EMKC 1YS6A 2XKPA 4C5IA 1HYOA 2NUTA 1X1CA 2ZPFB 2M1BA 3P8BB 4AVZA 3MZ8A 1KU2A 5KAFC 3BCBA 1MGTA 3F8BA 4CICA 3BP8A 5D6EA 2HQAA 4RB3C 2G3RA 5EG2A 1IC8A 2NS8A 2M02A 1SC7A 5GAN3 2O61A 3T5XA 2HDCA 2O5RA 2PZ1A 5F6FA 4AFUC 4BHBA 2E5NA 2CZ0B 3J7AO 3K1MA 3WU0A 4KGZB 1X3WB 2RVCA 1VUBA 3Q0UA 5HNHA 3FXMA 5C0MA 1YJ9I 1KYZA 2DQLA 3K9TA 1XB4A 2DE0X 1S5LC 2RN7A 4LJZF 1G3SA 3P5JA 5GPAA 2LCCA 5GPCA 3ECOA 3QWXX 4KH1B 3ESWB 2L5QA 3CMMA 1HC8A 5A2QK 1ZHIA 1ETKA 3HM5A 3DLLF 1ZG1A 3CMAA 2DK8A 2FZKB 4ESBA 2RK2A 1UHMA 3AFHA 3ULRB 4L59A 3R61A 3RYRA 1NK3P 4IHTA 2M34A 1E6HA 3HSBA 5E8IA 4B43A 4CHUA 2FSWA 4DZJA 2MSYA 3BR2A 5B1AH 3QXEB 1X2NA 1UUEA 4RTWA 1M90R 1YBYA 3AL0C 3CO7C 1YIJA 4HLXA 4M77A 2FQ3A 1IXDA 4C0DC 1Y07A 1UGPB 1WHUA 4IJAA 3KLNA 2KK4A 3HDDA 1Q81C 3QRFF 4J7IA 1U5TA 1SAUA 3X20B 1B4AA 1W1FA 2YXYA 3ECHA 2A69F 2VQHA 3OR1C 1BI3A 1KYWA 4M74A 1XGMA 5E3OA 5TRDA 3SZTA 3Q5FA 2HI3A 4FW2A 3JRFA 5LGUA 4E7SA 3UF4A 5FKKA 1W4MA 4JRIA 2ZMEA 4FL6A 3KETA 3RYPA 2OCEA 1GBRA 1VQ7A 4CGZA 2L4AA 1IO2A 1I27A 1QPIA 2RI2A 5L3GA 1DQUA 2YSRA 1UFFA 5HCKA 4XLNF 2E1HA 2LC2A 4W97A 2XV4S 5E79C 4FTHA 1T0JA 4XLHA 1KQ1A 4FYXB 5F0HA 5E3MA 1D1BA 1STZA 4P1WA
chains in the Genus database with same CATH topology
2LVMA 1Y96A 3AHUA 4ZTJA 1U5TC 2PUOB 2Y90A 5GAOr 3HOSA 1FYMA 1M9SA 4N0AC 3CEYA 1KQ8A 2E10A 3E3VA 1W7PB 1DUXC 3JRZA 1KQ2A 2XI9A 3DKMA 4U0VA 3OYLA 5H6QA 3NTHA 5CKHA 4OGEA 3G6EA 1IW7F 3ABUA 4AVPA 1S7AA 3BY6A 5LHIA 3OOPA 3FF5A 2MWPA 3KEQA 2A07F 3O6BB 4M78C 4EGYA