1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Repressor
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
1LDKB 2YX7A 3QU6A 4EJVA 1ZREA 3GZ5A 4EM0B 5D5WB 1WSUA 1BYMA 2W57A 1F1ZA 1P4XA 1LJ9A 3GF2A 5D8LB 1K6OA 2Q0OA 1STZA 3LWFA 2EA4A 4KMUX 5KK1A 4EMSA 2K5IA 2MH9A 4KDPA 5LRRA 2J5OA 5HS8A 5FO5A 1TBXA 1QZYA 1FSEA 3WTTC 3HSEA 4KNYA 5D6EA 2M8EA 5KVRA 1LB2A 4NHJA 3I59B 4LG0B 2K27A 2VT2A 2JPCA 1RUOA 4IVNA 4DNCA 3FMRA 2ZNZA 1GVJA 3TDZC 1BI0A 3BROA 2HQRA 1W7PA 2MBFA 4ENJA 3EUHA 4LB6B 1XMAA 3FXUA 5CVJA 2WTEA 3W6JB 1Z9CA 1T39A 4FX0A 4KYWA 4GXOA 1XCVA 1ZG3A 3ABTA 2HZTA 2A61A 3J80Z 1JXSA 4P96A 3KP2A 4RB2C 3JW4A 3ZMDA 5FFXA 3P9IA 3EETA 1X3UA 1YFHA 4UHTA 1ON1A 1SMTA 1U5TA 2BYVE 1UHWA 4AIHA 1O3TA 2LF7A 2PMUA 2YSRA 3IC7A 2LF8A 2VE8A 4AD9A 3TQNA 2ISZA 1W7PD 3KE2A 3ABUA 1FY7A 4BNCA 1QPMA 3RDIA 4XSXF 1IN6A 1R7JA 1SMYF 2QZ8A 1S8NA 3F72A 2VN2A 2AXLA 3IHUA 3DPTA 3GXOA 2IP2A 4P9FA 3T5XA 2BV6A 4KFCA 5LGNA 3IKVA 4Y15A 3BDDA 1BC8C 2Y0MA 2Z9OA 3F6OA 2ESHA 5E1ZB 3E97A 4S04A 1RI7A 4CYDA 3LA3A 4LGWA 2CSOA 2K86A 4CHUA 2UWMA 1ZH5A 4MQVA 3TO6A 2EFOA 5J8CA 2FA5A 5ED4A 1J59A 4BAYA 2OA4A 4ZH4F 3IL2A 4R79A 1USTA 3KEQA 1TW3A 2O8XA 1P2FA 5LLQA 1FBUA 3WTVC 1RIOH 4CZZA 3FMSA 3FF5A 2FBHA 3ML6A 2EWNA 4BH9A 1O57A 3HRTA 2W85A 4BHPA 3S2WA 4YFXF 4KN7X 2MLGA 2VOPA 2NAZA 1ZRDA 4LFUA 2MD5A 3LSTA 2TDXA 1E2XA 2P8TA 4M72A 1IXSB 3F8CA 5ICCA 1MJBA 1IN5A 4GCVA 1L3LA 4HF2A 2FBIA 1HSJA 2HOEA 2VOOA 3FX3A 5FLXZ 4G7ZF 2OZ6A 4AVPA 5BS6A 4I01A 4I02A 1Y0UA 5D6FA 3WTXC 5DD4A 3GFLA 4ASNA 2DQRA 4UV9A 3DEUA 4HX7A 1MGTA 1BM9A 1FWZA 2CYYA 3MZHA 1RZ4A 4OMZA 2GQQA 5L3BA 1S7OA 2MLKA 4EM2A 5DCMB 4G7HF 2VBXA 1QGPA 5D5VB 4HLYA 5H6RA 3LAPA 3J7AO 2DPUA 3EYYA 2HEOA 1BI1A 2CW0F 3R4KA 2ZO4A 3MQ0A 3NQOA 2Z3YA 1MDMB 3D0SA 1RNLA 2HQNA 2QVOA 1W5TA 4RAYA 3QRFF 3L2CA 3T8TA 4LB5A 4CO8A 2F5EA 1CGPA 2PBIA 4OIRF 2EFWA 2LX9A 4G6DA 4PGGA 2EFPA 4BQAA 1IXCA 3KP7A 5CVIA 1G4DA 1G3TA 4HF0A 2DK5A 1EH6A 2D1HA 5LGUA 2O6GE 4RAZA 1CF7A 2VT3A 5HS7A 1TQIA 3HRSA 3KETA 4U7DA 3ZMUA 2XGXA 2DU9A 2FSWA 1FZPB 2QWWA 3J81Z 2VXZA 2KIUA 3T0YA 2M1BA 2XAQA 2OAZA 2PN6A 3LA2A 2EV0A 3E6BA 1XGSA 2C6YA 2E1NA 2G7UA 2O03A 1S29A 1R5GA 2QQAA 1XMKA 4R8HA 2HYFA 5CVVA 1S3JA 2XIGA 3FM5A 4IXAA 4Q47A 4RGXA 3WTYC 1ODDA 2CG4A 4U0YA 1ZRCA 1LEAA 4IHSA 2XROA 4Q4ZF 3U9GA 2YU3A 2CFXA 3H3UA 5D5UB 3CTAA 2JT1A 2QM3A 4L5IA 3SHFA 1P92A 1R1VA 2IVMA 1FNNA 1XGNA 2NRAC 2YX4A 5BMZA 3MEXA 4ESFA 2XASA 4EJTA 1XN7A 4OIOF 2DPDA 5L3FA 3MHXA 1MD0A 5BPDA 3QPTA 1E17A 1HW2A 3CJNA 2IA2A 1A04A 1BIBA 1KU2A 1ZGJA 1ZLJA 1J5YA 2NYXA 5D4SA 1IF1A 4XRFA 2WC2A 1KA8A 3CUQC 2ISYA 3TDUC 2QLZA 4EGZA 1B6AA 2R7FA 1IXRC 2HKOA 1FYLA 5ILSA 2RVCA 3WGIA 1RUNA 1JHFA 1H9GA 1V4RA 4XLPF 4Y13A 3DP7A 4JBAA 1KGSA 1T6SA 3KZZA 1K78B 2M30A 3HTSB 1IRGA 4XLNF 2L02A 1JGSA 2MH2A 3BJ6A 1USSA 5DD8A 4IPAA 1WQ2A 2HKXA 5EEHA 2XUBA 2YPRA 1FOKA 2MA3A 4JQFA 3SXYA 3VODA 3E6CC 2QYOA 3L9FA 2VE9A 2XAHA 4Y17A 1HW1A 5JFRA 3GWZA 4M74A 4EV0A 3GW2A 4MGRA 3WGHA 2M87A 4I0AA 5D4RA 1ULYA 2DBBA 3WTUC 1HXDA 1J75A 5ICGA 4CDGA 3ELKA 4R1HA 4MTDA 3I54A 4P9UA 3M8EA 1ZHFA 1ZYRF 1G6NA 2PFBA 4L18B 4CGZA 3L00A 1Z1DA 4EJOA 1R58A 5HOOA 1K7AA 1SFEA 3JSPA 4KA4A 2F2EA 4ETSA 2FRHA 3EYIA 1MZBA 1YTYA 3K69A 3MFKA 1LDJA 2H94A 3EQLF 3SZPA 3K1PA 4YG2F 4WWCA 5F64A 3DV8A 2V1DA 3HHGA 3V8LA 1ZLKA 3F8MA 5DUIA 2OQRA 1UB9A 3CLOA 3KLOA 2FBKA 4A6EA 4A2UA 1SFUA 3H92A 2JSCA 1YS6A 1TW2A 5DDGA 4Q5SF 3I59A 4CICA 4LG0A 1GXPA 5JVTA 4L0ZB 2P5VA 5HDNA 1L0OC 3QAHA 3W6KB 3QU3A 2EB7A 2EFQA 4UUVA 3IKTA 1U5TC 3KP3A 2K5FA 1HW5A 1KYWA 5FD5A 3OV8A 3AAFA 2KIMA 1IN8A 4I7HA 1G3WA 1YO5C 4ZZLA 3C1DA 4A0XA 1XCBA 1QVPA 1YS7A 1QZZA 4KN4X 4M6YA 4ZYEA 2FQ3A 2GA1A 2EJRA 2AS5F 4MQ9F 1YW7A 4RB3C 2FMLA 4BHBA 3TOAA 1D8JA 2JTVA 5HLHA 4UNOA 5BPIA 2L54A 1DUXC 3GFIA 4M73A 3ZQ7A 3QP5A 3RPQA 4ENNA 5L3GA 3V7RA 4LMYA 4MEYF 1EH8A 4EGYA 3J80K 2H6CA 3E3VA 2IA1A 1XGOA 5J6XA 4WCGA 3U1DA 4Z2YA 3KP4A 6PAXA 3TO7A 5HS9A 1TQMA 2F5DA 4G8XA 3ZMZA 5BOXA 2KKOA 1FBQA 3ULQB 1YQAA 1SD5A 1Z05A 1R5HA 5D8KB 1IN4A 2F5CA 1TLHB 1F5TA 2M45A 2LNBA 1QBJA 1C0WA 1SFXA 4O6JA 2FXAA 3G73A 5AIQA 1F9NA 2FF4A 3LQRA 3M1EA 1I27A 1JHHA 3V4GA 4OU0A 1GHCA 3WTWC 3DXJF 2M5WA 3ZMVA 3GYHX 3HRUA 4ESBA 2ZMEB 2ETHA 3CUOA 2O0YA 5LBQA 3R6SA 2J5PA 4I09A 4HQEA 2P5KA 4YFNF 1SD4A 5H20A 3WGGA 3LAJA 2COMA 4CXFA 1R36A 2GAUA 2RV8A 3KEOA 2OBPA 3KZYA 1OKRA 1TNSA 4HW0A 2B0LA 3BY6A 1ZRFA 3MWMA 1KU7A 4LLLA 2ZCWA 1ONVA 2QENA 4AIKA 1XDUA 1J9IA 1P6RA 1BJAA 2BEOA 3FXRA 2XAFA 2IW5A 2DI3A 4IJAA 2JZYA 4NB5A 3ZMSA 3VOEA 4B8XA 2QQ9A 3R0AA 2RC4A 3I0TA 4RGRA 2GCXA 3L7WA 4GO1A 3E6DA 2XKOA 5E1WA 5JHUA 1KQ0A 1Z7UA 2ADUA 4PDKA 1Z91A 2DW4A 5HDGA 4EM1A 5LHIA 2STTA 1R1TA 4LK1F 1UHMA 2DT5A 1IAWA 3P9CA 3CO7C 5LRSA 4AWXB 3BOQA 2HFHA 5FLXK 2EV6A 3EDPA 2DLLA 4ON0A 3WTSC 2LKPA 5DCMA 2P4WA 4HX8A 3GFMA 3IWZA 3I4PA 5K5QA 5DEQA 1T38A 4YFKF 1OYWA 2PLYA 1G3YA 4QWQA 5L3EA 3MCZA 4XBFA 2DAOA 2E7WA 1MDMA 1J2XA 2HWVA 3D5LA 1YYVA 1TQPA 3I5UA 2P5LC 4OIPF 1BI2A 2QBYB 3GFJA 2K4BA 1HBXG 4F7ZA 3ZN0A 1U6GA 3KCCA 5F6FA 1FPQA 4OINF 1K79A 3WODF 1F4KA 2ZJ2A 3DKWA 1XSXA 3SZTA 1OYIA 1W4MA 2FEZA 3K2ZA 3KP6A 4L5JA 1J0RA 5DV5A 4WXDA 2DO7A 5ICEA 3RKXA 4WXCA 2KJCA 4ENMA 5E1XA 2V9VA 5LEJA 1R00A 3CDHA 2QUFA 1D8KA 1B9NA 1FYKA 2IPQX 2L4AA 1ON2A 5HLGA 2HTSA 4HDVA 2X4HA 1IZ1A 4PZJA 3LFKA 4O3MA 3KP5A 4RGSA 3J81K 3B02A 4HX4A 1GXQA 1YW9A 1FC3A 2W25A 1KU9A 4EJWA 4BHCA 1Q1HA 2R7DA 2P6SA 4IHTA 2VONA 1IRFA 2XRNA 1QO0D 4G7OF 2E1CA 2OQGA 4KICA 4A5NA 3DPLC 1KYZA 1YIOA 5LHGA 2K5LA 3R61A 4N9HA 4P55A 2HS5A 3FWEA 1O3SA 3K0LA 2OZUA 4UVBA 2HGCA 2A6EF 1XSDA 3CUQB 4MHGA 1FP2A 5JR3A 1JE8A 1B59A 2XVCA 1LNWA 4HOBA 2UZKA 3L09A 4HZFA 1DPUA 3F21A 3E6MA 4UXNA 5DUKA 4KIBA 3I71A 3TGNA 4DQ2A 2VC1A 1Z6TA 1OYYA 3RI4A 1ZG5A 1B4AA 3KFWX 3MZYA 4IF4A 3F23A 1XD7A 5LEKA 1R22A 2GWRA 1WWXA 5HLIA 4MTEA 4Q48A 3ZMTA 2PQ8A 4LD5A 3HHHA 3ZN1A 5LHHA 4AIJA 4I2OA 3ISPA 3HTUA 4U0WA 3E5UA 3MAJA 1BBYA 5L3CA 1K78A 2DFIA 1IUYA 1YW8A 1KU3A 3K1NA 4G94A 1Z6RA 2BGCA 4ZYDA 4A12A 2NNNA 4PGHA 2XAJA 3BZ6A 3BP8A 1ZARA 4WK8F 5K1YA 3V8JA 3ERED 4WXHA 5H6QA 3OOPA 3ZP5A 3RYPA 3DQVC 2KRFA 1FSHA 4HQMA 1FBSA 3F6VA 5E20A 3F3XA 4M9XA 3BPXA 3T1BA 2P7CB 1HKSA 2V6CA 2O3FA 5CYVA 3WE3A 3E19A 2P6TA 3JTHA 4IRIA 5CVUA 1FYMA 4RB0A 4OIQF 5CJ9A 3Q9VA 3RTRA 1I1GA 3B73A 3PQJA 1W7PB 4I98B 1ZN2A 4HAMA 3GVAA 2Q8KA 4HLXA 2PMHA 3QPHA 1PP7U 2VC0A 1KQ9A 4U88A 5K5OA 2ZXJA 1H9TA 3HRMA 3M7GA 4OMYA 3R0JA 4KMFA 3TKYA 3IRRA 3WTZA 3F22A 3IWFA 5J8FA 1O7FA 4HA8A 3HOTA 4PCQA 3ZPLA 4O5VA 4LJZF 1U5TB 3RPUA 2FNAA 1BI3A 2L01A 1UFMA 1IW7F 3ROUA 2E7XA 4L9VA 1XB4A 3SQNA 2R3SA 4ZZDA 3F8FA 2OU2A 3I53A 1FLIA 1VTNC 3O3KA 2STWA 2IRFG 3K1MA 3IRQA 3RKWA 3QOPA 1T98A 5AIPA 2RNJA 4L9NA 2FNPA 2HTJA 4N0BA 3SFZA 2JPBA 1HKTA 3GEZA 2JRTA 4G9YA 1XGMA 2WV0A 1AOYA 2ESNA 5ILVA 2EA2A 1HSTA 4LK0F 2CQKA 5IT3A 1AWCA 3E5QA 3V7SA 1EV7A 3RJPA 2A3SA 3HYIA 1SAXA 1DDNA 4OOIA 5ERIA 3DFGA 2A07F 2QQBA 1QW1A 2H3JA 2Q2EA 3M9AA 1PDNC 3M8FA 2PJPA 1FT9A 2VBYA 3JAMZ 2D1VA 3PFIA 1P4WA 3C18A 4KT5C 4G6QA 1HKQA 2RN7A 5E8IA 3P9KA 2D45A 3BJOA 4JK1X 4KUMA 5EEGA 4A6DA 2GIVA 1OPCA 4N9IA 3RKYA 2W24A 1LDDA 4BXUA 3I58A 2PEXA 4E70A 4S05A 4TV7A 1TTYA 2FMYA 4A5MA 3RYRA 1I1SA 4XSZF 5FFZA 2Y48A 2WWYA 2RKHA 3F8NA 4UV8A 4FHTA 4NQWA 2LSOA 3BJAA 3CO6C 2ZBKA 2ZKZA 2EK5A 1R1UA 1QNTA 5JI6A 2GXGA 3LA7A 1ZG1A 1KQ8A 3GUDA 3GZ6A 3JAMK 2ZNYA 4YIIA 5CVRA 2FOKA 4ENKA 2A69F 3NEUA 3ECOA 1BIAA 1MKMA 2ZMEA 4L9JA 2D2WA 2FE3A 5LGTA 1XSVA 4FT8A 3ECHA 3GLXA 3VB2A 5FB2A 3V8KA 2VBZA 2LDUA 2H27A 3QP6A 5ICFA 4RS8A 5DYMA 2NNYA 2CWEA 4P5OA 1DP7P 1D5VA 2K4JA 1LVAA 3H3ZA 2W84A 2O61A 1SD7A 4M9ZA 4BYYA 3C3WA 5TJJA 2PG4A 3BWGA 3JSOA 1PUEE 2GZWA 3P7NA 1FX7A 4UVCA 5HDKA 5E8GA 2KJBA 1MJ9A 4HV5A 1EH7A 4B09A 4ESJA 4GYIA 3LQQA 3HSFA 5F1RA 2K7LA 1NHAA 4L0YB 4D0PA 5CLSA 2H6BA 2UXXA 3WU1B 2L3DA 4A0YA 3NRVA 4WF2A 2F5FA 2XV4S 4KIGA 1LEBA 2X0LA 4M6XA 3RIRA 1U78A 3TO9A 1WI9A 1WRJA 2FU4A 2XAGA 1CF7B 4MEXF 1PP8F 4K2EA 2HDCA 2G9WA 1YLFA 1MJAA 3REOA 2Z99A 5AONA 4HBLA 1D3YA 3V7CA 3FXQA 5A2QZ 3R60A 4H0EA 3F8BA 2EV5A 1S6LA 2MC3A 1DPRA 1B9MA 3COAC 4A0ZA 4HF1A 1O3QA 2IA0A 4HV6A 4I0BA 1LQ1A 1BOAA 1QQIA 4HDUA 2KIFA 5FGMA 2K02A 3O6BB 1BC7C 3TOBA 3HOSA 5L3DA 3FMQA 3N97A 2ACJA 2IT0A 3KLNA 2IJLA 4FX4A 1IN7A 5ILUA 4M9SA 2G7HA 3VEPA 1HQCA 5E17F 2QBYA 1B1BA 2K4YA 4QLCU 3WG9A 3I64A 2GXBA 2V1XA 2RGVA 3HSRA 2Z5UA 2OD5A 3DF8A 3FM3A 1BN5A 2A6HF 2HR3A 5A2QK 3N4MA 5D5XB 3PQKA 4HYEA 1OMIA 4IRGA 1I6XA 5IT9Z 3HUGA 1YG2A 1I5ZA 2RDPA 2A5YB 3FZVA 5HVQC 3FHZA 1H0MA 3GX4X 2XKPA 2RQPA 1FP1D 1WKMA 2ELHA 4IRHA 3HIFA 4EJUA 3VFZA 1UCRA 4ZYGA 4MNUA 1V3FA 4M71A 2PI0A 4WX9A 3G3ZA 2DK8A 3O2PE 3K9TA 2V79A 1T0FA 1TNTA 1U2WA 3BPVA 2Y75A 1W5SA 3Q5FA 4EVIA 4LLNA 1P4AA 5FD6A 5E18F 1XDSA 3Q9SA 2Z33A 5IT9K 2CGPA 1REPC 4UVAA 4U7BA 4L9TA 4YIFA 2EFNA 2VBWA 3JTGA 2DQLA 1U8RA 2GA2A 4EQQA 3GO5A 5BQTA 1U3EM 5DCFA 3T8RA 3CUQA 4RGUA 3WE2A 1T2KA 3WU0A 2P7VB 1OR7A 4KIFA 1S7AA 1ZAOA 2L4MA 2ZFWA 3E5XA 3C7JA 2V1UA 3U2RA 4RB1A 2CO5A 4LLGF 4GGGA 2XHKA 2BE5F 1SD6A 1ZGAA 4ZYHA 1O7LA 2NS0A 1R23A 2YR2A 1O3RA 1J7KA 2HYGD 1G3SA 5K5RA 5TRDA 2A68F 2DTRA 2BBYA 2VODA 4U0VA 2UXNA 4GYGA 2H09A
chains in the Genus database with same CATH superfamily
3U23A 4MZPA 4RTTA 2O5RA 1NG2A 1LDKB 4I99C 2EYYA 3VSKA 1LE8B 2YX7A 4GFBA 1X69A 2EQKA 3QU6A 4EJVA 1UEBA 2KRNA 2OJED 4F7UG 2OTLT 2XPWA 1ZREA 1VIEA 4R0KA 3GZ5A 5DS9A 1I4K1 4EM0B 5D5WB 5LL6S 1RESA 2V6EA 1VF9A 3QWLA 1WSUA 1N9RA 1UGQB 1BYMA 1AKHB 5D6YA 2W57A 1F1ZA 4Z02A 1P4XA 1X43A 1LJ9A 3GF2A 5D8LB 1RLPC 4CC4B 1K6OA 1RAGB 2KE9A 2Q0OA 2X9HA 1STZA 3LWFA 3M8JA 2EA4A 1WI3A 3O8HA 3Q0UA 4KMUX 5KK1A 1MH4A 2A5WA 4EMSA 3CF5F 2K5IA 3OL4A 4OMMA 1YITQ 2MH9A 3TBIA 2XAUA 4KDPA 1Y1VJ 5LRRA 3HKZA 2J5OA 1NLOC 5HS8A 5FO5A 2JA6J 1TBXA 1WJ5A 1QZYA 1LNXA 3M0QA 5HKCA 1FSEA 1V5FA 3WTTC 3HSEA 2D0NA 4OB0B 1MMSA 1IHWA 1ZSZC 3VU3C 4KULA 4KNYA 4S0HB 5D6EA 2GTJA 1ACMB 2AQEA 2M8EA 2E5NA 1OX9A 2NLUA 3ABMH 3CCUQ 1YHQQ 4Y52J 5KVRA 4C2UA 4B44A 2K2VA 1ZSZB 1LB2A 1HJDA 5FJ8J 2DODA 4NHJA 1RUWA 3ZQLA 3I59B 2LR8A 1AHJB 2YSQA 4LG0B 5HLTA 2K27A 2VT2A 2CV1A 4B43A 4KH0B 4IL6C 2DXBA 3CDIA 2ENMA 2BZTA 2O9VA 2PQWA 1X19A 4BY7J 3LX7A 2HQHA 2XIDA 2ZPBB 5GAN8 1S7EA 2JPCA 4A3EJ 1RUOA 5IAYA 2NVYJ 1QU3A 1E0EA 3G6ET 4B4CA 1NEBA 3G71I 1IRZA 2E6NA 2WACA 2VKHA 2CJJA 3CCEA 4IVNA 2G0EA 3NPFA 5J4VA 1ETQA 5GAN5 4DNCA 2RB6A 1RAIB 1TSFA 3AL0C 1WJSA 2VGNA 3FMRA 2DN0A 3VV0A 2ZNZA 1M1FA 3EG9A 3PMIA 2DFFA 4LUEA 5J26A 4FIBA 4H4KC 2ELKA 2DT7B 3ZFJA 1E6HA 1MMAA 1GVJA 1PUFB 3TDZC 3L1AA 3JCMd 1BI0A 3BROA 4DEYA 4FU6A 3CCMA 1S72T 2HQRA 4C92E 1VQMQ 1WQWA 1TTHB 2MGQA 1W7PA 1YJNA 2MBFA 4ENJA 3S15J 2JT4A 3EUHA 4LB6B 1XMAA 3FXUA 2HU9A 5CVJA 2WTEA 2DA1A 2GQVA 1OCPA 2X9DA 2GFUA 4DA4A 2KZVA 1QWFA 4M77F 3CMAA 3EUKL 3W6JB 2LTOA 4A3IJ 1Z9CA 1T39A 1JJ8C 4FX0A 1A0NB 4XKWA 4KYWA 4EMHA 2SRCA 4GXOA 1XCVA 1ZG3A 1K73U 5M5YJ 1SAUA 1JB0E 4ELZC 3PNYA 3ABTA 3GTOJ 4DYCA 4BACA 1UECA 3C4SA 4ZTJA 2X4YA 4M7DB 5GAOp 2X48A 2HZTA 4B48A 2E4HA 4EIKA 2A61A 3J80Z 4BQQA 4HNUA 3N5BB 1D3BB 2LY2A 2R4GA 2RQWA 4BI3A 3M4YA 1JXSA 4P96A 2KP6A 1H88C 3KP2A 2HL3A 1Y56A 4RB2C 3JW4A 1DP3A 3ZMDA 4FASD 1VQ8A 3HC7A 4XU2A 3O8GA 2QG9B 3RDVA 5FFXA 3KXTA 3P9IA 4M77D 1QVGP 2PTKA 4AMCA 3KFVA 4MDWA 3EETA 1X3UA 1OLTA 1YFHA 4E6RA 3CXCP 4UHTA 4JZ3A 1ON1A 5M5XJ 1K0XA 1R5ID 2E3IA 1SMTA 3AG1H 1U5TA 1VQLA 2JRMA 1U9OA 2BYVE 2LTPA 3OYGA 1IV6A 1UHWA 2O7OA 4AIHA 2ED0A 1GDTA 1O3TA 2LF7A 2XF5A 2DMOA 1GV2A 4J8OA 1XJWB 2PMUA 2YSRA 3IAS2 3IC7A 1IZ6A 4M7AG 2KR3A 4LD9K 2DYRH 2LF8A 1IHVA 5EYRA 2RQUA 2VE8A 4CC7A 4HCCA 4AD9A 3GTPJ 2FB7A 4OB2B 3I56Q 1YIJI 4IOAF 3TQNA 2OCCH 1AWXA 2C0TA 4OB3B 2ISZA 4LIVA 1W7PD 1PRMC 1I39A 1OCZH 3KE2A 5KAFC 3OOUA 1AEYA 1WJQA 3ABUA 2VWFA 3RPUD 1FY7A 3OS1A 2ROTA 4L5EA 3HOWJ 1V55H 4F93B 1MSEC 4BNCA 4Y91A 1BW6A 3CJRB 1QPMA 1QP3A 2QDLA 2VQLA 2DD5A 3RDIA 4XSXF 2FUG2 4KBMB 1IN6A 1R7JA 4NC6A 1BCOA 1SMYF 2QZ8A 1WCMJ 1C1AA 1S8NA 4IIMA 2L7FP 4F7UB 2KNBB 1TWBA 3F72A 3CCVA 2VN2A 2JN6A 2AXLA 3IHUA 5IN1A 3DPTA 3GXOA 2QA4I 1MHNA 2IP2A 2R57A 3ZBDA 2AZSA 4P9FA 3T5XA 2BV6A 1B72B 1Y96B 2ZXIA 4KFCA 3SWNC 1K73C 3KYCB 3GTMJ 5LGNA 1PWTA 3IKVA 1VQ7Q 5FKMA 5GAN2 4Y15A 3BDDA 1BC8C 2ID6A 1M3BA 2ZCFB 2Y0MA 4ZDLA 3J7AY 2Z9OA 3TMOA 3F6OA 2E5KA 1SHFA 4C92A 3VRYA 1SKUB 2ESHA 3QODA 3FDYA 3DKYA 4IUVA 1MBEA 1ZHIA 2DXCA 2EINH 2A28A 5E1ZB 3E97A 1OULA 2RNGA 1U8BA 3TP0A 4S04A 3BG3A 1RI7A 1QVGS 1VQNA 1OU9A 1YWPA 5KH6A 3DWLE 4CYDA 5A0LA 3CXCS 2XK0A 3LA3A 4LGWA 2CSOA 2K86A 4JOMA 5IP6A 4CHUA 2UWMA 2Y4XA 2CMPA 1Q1VA 1PJRA 1VQ5I 3SZGA 2LREA 1ZH5A 4I6ZA 2CS7A 5KYXA 4Y4RA 4BE1A 4MQVA 2QYZA 3QYEA 3OYCA 4C8QG 2DCEA 3TO6A 2Y9ZA 1V29B 3RQ4A 3M5AA 4E7LA 1IDYA 5LJ3e 4KH1B 5GAEJ 5CIUA 4LITA 2DOFA 2VXDA 2DJIA 2IIMA 3LYIA 1BA5A 3FK6A 2EFOA 3ZQGA 2NVQJ 2GBQA 2RO0A 3CCQT 2FO0A 5GMKe 4GBQA 1TWCJ 5J8CA 2IGOA 2FA5A 5ED4A 2F6CA 4XLAA 1J59A 4BAYA 1NBEB 2P81A 3ZL7C 4HVUA 2LCSA 2OA4A 4ZH4F 3IL2A 5GANg 3JCUC 2XC7A 3OSVA 3VKIA 1F36A 5KCHA 3JB9G 2N8GA 1PKTA 4JS5A 1QVFA 4R79A 2KDOA 1USTA 3KEQA 2FPEA 1TW3A 2O8XA 1XTDA 3M0RA 1P2FA 3JRIA 2VKEA 1FBUA 2ZMEC 3A1YA 4OAYA 5LLQA 2R93J 3WTVC 1RIOH 3GF5A 3OR1C 3J7YJ 2SEMA 3EGDB 4CZZA 3FMSA 4RLQA 3M58A 5LJ5h 2E19A 2DA7A 3FF5A 1X75C 4CC2A 2FBHA 4XICA 3ML6A 2EWNA 4BH9A 1JT0A 2QA4T 1O57A 4M78A 3UDCA 3WU2C 2COBA 1Q82U 3W6VA 3BCBA 3HRTA 3S1QJ 4BD3A 1YP5A 2PJRB 2W85A 2R7QA 1F1BB 4BHPA 3S2WA 4YFXF 3F70A 4KN7X 5FWCA 2M2EA 2MLGA 3F0CA 5DM7R 4ZJZA 2VOPA 2NAZA 1ZRDA 4LFUA 2MD5A 3LSTA 3FKIJ 3ME9A 1YHQA 2E1MB 1MV3A 2TDXA 2JVVA 1E2XA 3FRNA 2P8TA 2HQEA 5LD2C 4J9BA 3IH3A 1FIPA 4M72A 2LJ1A 5IYBJ 1IXSB 3F8CA 1KZHA 5ICCA 3MD2A 1D1BA 1MJBA 2GBYA 3OYLA 1G83A 1PHTA 1UG0A 1IN5A 2X4WA 3G7ZA 3SEZA 4IUTA 3CCLQ 4GCVA 1ZK8A 2HMAA 1L3LA 1WDXA 1WJBA 3Q0WA 4M3GA 1ERDA 2OAUA 4IUPA 4HF2A 2HYJA 2FBIA 3UATA 4M78F 3JCMe 2FOWA 1HSJA 3FXOA 4XNFA 4XIDA 2HOEA 2LD5A 2VOOA 4NS5A 3FX3A 4QVZA 2DK3A 2RA2A 5FLXZ 3VUZA 1VQ5T 3LL7A 4C2MJ 2QQSA 2VI6A 4G7ZF 3PT9A 2JJ7A 1R0BG 2OZ6A 4AVPA 4M7AC 2D6FA 1BKBA 3RNJA 4FYYB 1TUDA 1OFCX 3K6GA 2DIGA 3BG7A 2F69A 1ENHA 5BS6A 4RUGA 2HOSA 4BY6B 1QVGA 4I01A 4I02A 1ORKA 1Y0UA 3CC4Q 5D6FA 3WTXC 3JR9A 1SSHA 5DD4A 5GANf 1CSKA 3GFLA 2RN8A 4RG2A 3BTIA 4ASNA 2DQRA 2DNUA 4UV9A 3DEUA 4HX7A 2XU8A 3UWNA 2RK2A 2QQRA 1J3TA 1MGTA 1M2OA 3P8BB 4M78D 3MEUA 1BM9A 4HG2A 1FWZA 1P9QC 3VYSB 2CYYA 5CKEA 4HCBA 2NUTB 1NEGA 3MZHA 3FHNA 2HDAA 2B63J 1RZ4A 1KQ1A 4OMZA 3CC7Q 2MW8A 4CCMA 2GQQA 3LSJA 5L3BA 2CKKA 3K4LA 2K9QA 1S7OA 2MLKA 3RCOA 1KONA 3MKDA 2RAEA 4EM2A 2R7OA 2LT1A 5DCMB 2M0YA 4AM3A 2PU9B 4C0ZA 5IT9R 4G7HF 1R9TJ 2D9TA 2VBXA 4I76A 1QGPA 5D5VB 5FKOA 1QQJA 4JP0A 4HLYA 3VS4A 5H6RA 1CQTA 3LAPA 1SG5A 1YJWI 1IG7A 3J7AO 2A3LA 3BR1A 3EYYA 2DPUA 4MFDA 2HEOA 4J5YA 4AFQC 1BI1A 5J1UA 4PJOG 2CW0F 2PMZN 2OF7A 3DTKA 3AG4H 3R4KA 2ZO4A 5KYYB 3LSRA 3CD6I 4BJTA 4Y7NJ 3MQ0A 3J7AW 4M7AF 3NQOA 2J05A 1X2QA 1N8RC 3RQIA 1HD3A 2Z3YA 2DXTA 4M6VA 2JA5J 3JSCA 2AHJB 4GY5A 1MDMB 4X34A 2CFOA 2JTEA 1OCCH 3ESWB 3OA6A 1KD1U 3D0SA 3CQTA 1RNLA 2OTJT 3RR6A 2HQNA 1OOTA 4C8QC 5IT9E 3SEQA 3SJMA 4C3HJ 2QVOA 3E2UA 2MVTA 5DLOA 3I56A 2EH3A 5C4JJ 2LQNA 1W5TA 3M4OJ 2I5UA 3H6ZA 4RAYA 4HNTA 3L2CA 1Y8QB 3T8TA 5IP9J 3QRFF 2CQXA 4RM3A 4LB5A 1W6XA 4CO8A 1WPYA 1ZUUA 3O8VA 4FYXB 4ZDPA 1RAAB 2BY1A 4NBQA 4E7ZA 3JCMh 2F5EA 1QCNA 3CCJQ 1CGPA 1XQHA 2PBIA 4OIRF 1PSEA 2HVRA 2EFWA 1WXTA 2LX9A 4G6DA 1JJ2P 2XF6A 4PGGA 2LJ0A 4XL9A 1JKPC 3MEAA 2EFPA 1WJCA 4BQAA 4PSWA 4RTVA 1VQKQ 1HDPA 1IXCA 3KP7A 3H9JA 1D1CA 5CVIA 3LLRA 2P4RA 1G4DA 1G3TA 3ER0A 4LN2A 5GAGJ 1M3CA 2TRTA 2QEXI 3SFMA 4HF0A 3CMEA 3CC2Q 5LJ5f 3TU4K 5B1BH 2DL7A 4FETA 2DK5A 2ZXWH 1EH6A 1VQ9Q 3HM5A 1NPPA 3G4SQ 2D1HA 5GAMd 4AG2C 3VS1A 2MI6A 1VQ7A 2JTMA 5LGUA 4ZN1A 2O6GE 2JS0A 1JTYA 4AYBA 4RAZA 1U3OA 1I6HJ 2CW8A 1B8IB 3VYGA 4HT9A 1R8OB 1Z9ZA 1CF7A 4RTXA 2VT3A 5HS7A 1ZQ3P 2R7UA 3FIFA 1TQIA 4OMQA 3HRSA 3L42A 1V5GA 3KETA 2L7MP 3S3OA 1YJWT 2CW7A 4U7DA 2FPDA 4C8QF 4BDYA 1WPKA 2VKDA 2L9VA 1RAHB 4LXCA 3ZMUA 2WAQA 2UUZA 2XGXA 2DU9A 3HGGA 5IPAA 3UF4A 2FSWA 1FZPB 4M75B 2QWWA 3J81Z 4FTHA 3BR2A 1R4MB 2VXZA 3MEVA 1R71A 2KIUA 4II2A 2QSHX 3BR3A 2IG0A 1H89C 3T0YA 2M1BA 2XAQA 3D5SC 2OAZA 2C0IA 2PN6A 3LA2A 2EV0A 3E6BA 3OY9A 1I81A 3M59A 3JRZA 1XGSA 3RZDJ 1QHHD 2JA2A 2C6YA 2GOXB 5IYDJ 4ZGEB 1VQ6I 5KYUB 2V1RA 4JJBA 2QKLB 1GCPA 1RI9A 2J06A 1TWAJ 5CPRB 2E1NA 3JB9F 2G7UA 3M1CA 2O03A 4Y3OA 1S29A 4IEJA 1R5GA 2KMUA 1XMKA 2QQAA 4R8HA 3PSFA 2LY9A 2EW3A 2IPOB 2HYFA 4BS9A 2JA8J 5CVVA 5GAN3 1S3JA 4PJJA 2CP7A 1VUBA 3W2AA 1JJ2S 2K85A 2XIGA 3DTEA 3FM5A 3X26B 5HNHA 2YT6A 1X4OA 2K40A 2LC4A 2QTVA 1Q82R 4IXAA 1Q81U 4Q47A 4RGXA 3WTYC 1KHCA 3G6EQ 1ODDA 1JGGA 2LH9A 2EBPA 2WB1A 3EFSA 3CCST 2CG4A 4U0YA 1ZRCA 2F4OB 2LJ3A 4IUQA 4M3FA 1LEAA 4IHSA 2H8HA 2XROA 1MMNA 4Q4ZF 3U9GA 2KROA 1KC8C 3JB9D 3EG0A 2YU3A 3FXMA 4XTVA 2EZIA 2CFXA 3H3UA 3D7SB 1JBMA 2LMDA 3RZOJ 4BXXJ 4RG8A 4JJNK 2EGEA 4IHYA 5D5UB 1M30A 3JAME 1YI2A 1HSQA 4OVAA 1FTTA 1TWFJ 3CTAA 2JT1A 2QM3A 4L5IA 4XR6A 3SHFA 4A3LJ 3EH1A 4HCKA 3S2DJ 1P92A 1R1VA 1M8MA 2IVMA 1FNNA 1Z0XA 4OWRB 1MBFA 1T0FC 2L0KA 3IAM2 1OYXA 1WHKA 2BY0A 4ANJA 5KCOA 4PJOC 2X85A 1RKWA 1XGNA 3CBPA 3KX2A 2NRAC 3RKQA 2NXNB 2LG4A 2YX4A 4QKUA 2MCNA 5BMZA 1G8XA 5J1YA 3MEXA 3EG1A 5EG0B 4J7IA 2I2LA 2JUGA 3CCLA 4ESFA 1ZA1B 2XASA 1JKRC 2Y69H 2CUFA 2EVRA 4EJTA 3Q0VA 2CV0A 1YJ9I 2KGTA 3W3CA 2OX7A 2R5MA 3QWXX 4N0AA 2KXCA 1XN7A 1SRMA 2KRSA 2F1LA 5J3LA 3H5NA 4OIOF 2DPDA 5L3FA 3I55I 2COZA 1KFZA 3VYUB 2NUPA 2XRLA 1YI2T 1FIAA 5EGOA 3C95A 3MHXA 3FJ5A 3OBYA 6AT1B 4M77G 1A6IA 3EFRA 2LFBA 1MD0A 1DGWY 1X1DA 5BPDA 2E10A 3WVEB 3L2QA 1OCRH 3QIIA 2DT6A 3UR3C 1VQ4A 4LUDA 5I2SA 3AT1B 5GANj 2P0PA 5TISC 3QPTA 2HVSA 1HW2A 1E17A 4EMKC 1QHGA 3CJNA 4KGXB 5FKNA 1JUSA 1IUFA 1YRNA 2IA2A 1M1GA 1M3AA 1X6BA 2CSIA 2E2JJ 3HG9A 4E7SA 1A04A 5IHKA 1BIBA 2CRGA 1KU2A 3HHTB 1ZGJA 5F1JA 3EGXB 1ZLJA 1J5YA 1O9SA 2KIQA 2NYXA 2RJCA 5D4SA 1H92A 1XG1A 3CC2I 4A54A 1IF1A 4AFUC 3CC7A 4XRFA 5GP9A 1P7IA 2WC2A 3G71Q 4CSWA 1KA8A 2LBFA 2DA9A 3CUQC 3K4MA 4VUBA 2B9SA 3HBLA 1E3PA 1I0CA 5F0FA 4PJOF 1W2BA 1W4SA 4QW2A 2ISYA 3LSKA 1UJYA 3TDUC 2ATCB 2QLZA 4JLIA 5ECAA 4EGZA 1VQ4T 2OTLI 1B6AA 2R7FA 2EYZA 1IXRC 3OYAA 4E47A 5JLXA 1JJ2A 2FQ4A 1O4XA 3M56A 2QKMB 1X1PA 1XMXA 2DA2A 2HKOA 3ZGKA 1ZGWA 1FYLA 2Z1DA 1E7OA 4A4KA 3E0JB 5ILSA 1KD1R 1X4PA 2RVCA 1OCOH 2HNIA 3LWHA 3TW6A 1QLYA 3WGIA 1PKSA 1BL0A 5GMKm 1VQPA 4PK4A 3X25B 2LQ8A 1RUNA 1JHFA 3QYBA 1H9GA 1V4RA 2DJQA 2KQRA 4XU1A 4A3FJ 2DXIA 2KRHA 4XLPF 4Y13A 3DP7A 4JBAA 4PJOD 1KGSA 1T6SA 3KZZA 4A93J 1K78B 1SVLA 1B34A 2M30A 3HTSB 4J00A 2BTTA 2QXFA 2XPUA 2DL5A 4UC4A 1I5OB 4RTYA 2XHCA 4LG3A 1X1CA 4PJMA 4IO9F 3HDDA 4KJZA 1IRGA 4XLNF 4XTYA 2L02A 1JGSA 3DEEA 2MH2A 3BJ6A 1USSA 1SF9A 1K76A 2FG0A 3BE3A 2EPDA 1WQ7A 5DD8A 3DKMA 1XTAA 4IPAA 3VYRB 3CCJA 3C2HA 1WQ2A 3WG7H 2Z0WA 2R0QC 2HKXA 5EEHA 2XUBA 1NJIC 1JTXA 2YPRA 1FOKA 1Y7XA 2F48A 2ZAEA 3C94A 2MA3A 2NOJB 2VJ5A 4JQFA 3SXYA 1AZGB 1FOWA 1LFPA 4XKBA 4ZN3A 1VQKA 3VODA 3E6CC 2HKNA 2L89A 3E9FA 2QYOA 5HY6A 3L9FA 2VE9A 2DZCA 2FZKB 3URGA 1RETA 2JTFA 3EFOA 2XAHA 4Y17A 1HW1A 2L0AA 2D8JA 1WZOA 2CT3A 5JFRA 1M2VA 3GWZA 4M74A 3RESA 4EV0A 4QIWN 2O2OA 2GOMA 4DYQA 1VQ9A 3M55A 3GW2A 1WJAA 3G4SA 3A01B 4MGRA 3WGHA 2QK0A 4KUIA 5FKLA 2M87A 3NFCA 1YIJQ 1SEMA 3SDZA 4I0AA 2X35A 3BW1A 1FOYA 5D4RA 3QDFA 2K3YA 4XAXB 3JCMb 1IO2A 1KSWA 1ULYA 2DBBA 2O9LA 1S72I 3WTUC 2F2VA 2LX7A 2R5AA 1HXDA 1J75A 4AC0A 5ICGA 3BDLA 1GVDA 4CDGA 3DEWA 5FRNA 1OZ3A 3HFOA 1K0SA 5F0HA 3ELKA 1LFBA 4R1HA 2RNAA 4MTDA 3I54A 1VOMA 4P9UA 2JVGA 2HL5C 4E2FB 2GNCA 3OYIA 1Z67A 4XTXA 3M8EA 3CCRT 2WAFA 2YLBA 2EIFA 3O5ZA 3EH2A 2CYZB 1ZHFA 1ZYRF 1G6NA 2PFBA 4L18B 2DL3A 2JMCA 2QA4Q 4CGZA 5FRMA 3L00A 2LQKA 5I2MA 1Z1DA 2NVUB 3CESA 4RTZA 3AFHA 5EEAA 3PNVA 4EJOA 3K4BA 1RPWA 1Z3XA 1VI0A 2K9MA 3PNWC 2I0NA 4FE4A 2CUDA 4UB6C 2QAZA 2O4XA 1R58A 3CCMI 3AKZA 5HOOA 1K7AA 3JCMc 1VZ0A 2M4KA 1Q81R 4BUGA 5B66C 1SFEA 3QG1A 4RAFA 4ZC3A 3JSPA 4M77C 4KA4A 5K7FA 2F2EA 2W10A 5GMKl 5CCAA 2ICWG 2HPIA 3JAMR 4ETSA 3EUAA 1LE8A 4GDFA 2FRHA 1MBGA 1M9SA 3REAB 3ZEHA 5M9OA 2KRCA 1PSFA 2JA7J 2EKHA 1JI8A 4M77B 3EYIA 4F17A 4M7DE 2R7RA 1MZBA 1YTYA 5GAOq 2BXZA 3K69A 2R7TA 3MFKA 1LDJA 4HSRA 2YLCA 4A4HA 3QJYA 3ZQQA 2H94A 1G2BA 2YHTA 2R5YB 3JRBA 3EQLF 4NC8A 2RF0A 1VQ5Q 1AKHA 2DRMA 3SZPA 2OPTA 3K1PA 4YG2F 2COWA 1MMDA 2DA6A 2DO3A 2H1LA 5A2QE 1M1KU 3A2KA 2M35A 4WWCA 3CZ6A 2BUDA 5F64A 2EFIA 5GANe 3SEMA 3DLLA 1K8AC 2KSSA 1K4SA 1Q81C 2GF7A 5HK0A 2XB0X 3DV8A 2KYBA 4AUXA 4XTUA 3A98A 1ETYA 4QQGA 2IVWA 4Z88A 2V1DA 2XF7A 1GLNA 3HHGA 1IGUA 4M78G 3V8LA 2AT1B 1IXDA 2X6XA 3S32A 2YS9A 2LNHB 2KXDA 3VUBA 1ZLKA 1WHMA 3F8MA 5DUIA 2L2PA 1AZEA 2V9PA 2OQRA 4AFZC 1UB9A 4U87A 5KE3A 1I1JA 3AL0B 2E64A 3DB4A 1LKXA 1PM3A 3CLOA 3KLOA 2FBKA 4A6EA 1TC3C 1N27A 3PE0A 4CYCB 4A2UA 1SFUA 1IREB 3CEYA 3H92A 1C0MA 4JJDA 2JSCA 2MG4A 4B47A 5D7UA 2Y0SA 1YS6A 1KG1A 1D0ZA 2X4XA 2DEUA 1TW2A 3OMYA 5DDGA 2DA3A 1U1TA 3AHUA 3GPLA 1NG7A 1QVTA 4Q5SF 3I59A 2X98A 4CICA 1GFCA 4LG0A 1OV3A 2WV1A 3OSSC 1GXPA 2NS7A 1HLVA 2R92J 3MPUB 5JVTA 4L0ZB 2JUFA 2P5VA 3CCET 2LT4A 4XM3A 1L0OC 3QAHA 4JX5A 4XKVA 3W6KB 5HDNA 3A52A 3QU3A 4MDXA 2EB7A 3BG6A 1MH3A 5GAN7 2EFQA 2FL7A 4F7UE 5AT1B 2IXSA 2AKLA 3MMYB 3LSIA 4UUVA 2R58A 1MW7A 3IKTA 4KGVB 1JEGA 1U5TC 2HBWA 3KP3A 1ABQA 2K5FA 2Y4YA 1HW5A 2JWTA 4V19K 4AU7A 1N9SA 3HL8A 1NE8A 2LY1A 3BDUA 1U5SA 2CH4W 1K61A 3CCMT 3GOXA 1VYUA 3CCVI 1KYWA 3G1MA 3OYHA 2MWPA 4C0DB 5FD5A 1YJNT 3OV8A 4LDYA 1TU0B 1PUFA 2ZC2A 1QRYA 2KIMA 3AAFA 1OQYA 4NL3A 2VPRA 2RJDA 1IN8A 3CMAT 2ZB9A 3OWTA 2FVUA 2CQ7A 4I7HA 1LVKA 2XGEA 3MJXA 1G3WA 3NTIA 4J9EA 2DTZA 3GTKJ 2OTJQ 4KRTA 2V7FA 1YO5C 1M1KC 2A6TA 1TOVA 4ZZLA 1H8AC 1SRLA 3OW2P 2K79A 3C1DA 4BUPA 4A0XA 1XCBA 3G1OA 5GAMg 1QVPA 4Z89A 1YS7A 1QZZA 4KN4X 3CCQI 1LFUP 4M6YA 4ZYEA 5H2FC 2VPLA 2FQ3A 1OCTC 1OI1A 2GA1A 2EJRA 2AS5F 1TT5B 4C2TA 5IXFA 4MZMA 4MQ9F 4XQFA 3M57A 2IS6A 2FJ1A 1YW7A 4PFPA 4IOCF 1XPXA 5JHFA 4RB3C 4XRMA 1VQOA 4M7DA 3OYMA 1RR7A 2FMLA 5LJ5e 4BHBA 2QGUA 3M54A 1VQ8T 3TOAA 4DZJA 2FYKA 4XRSG 1D3BA 4ZGJB 3B6AA 4BXFA 1ETOA 4AVZA 1D8JA 1XOVA 5GANh 2JTVA 2Q2EB 4N4GA 5HLHA 4UNOA 2LKSA 5BPIA 1PD1A 5IH2A 2HZDA 3DCFA 2L54A 4C0GA 4A3KJ 1FYNA 1VQLT 1QCFA 1DUXC 4DW6A 3A5ZB 4KGZB 2L7KA 2G3RA 2ZPGB 3MP1A 3GFIA 1JUPA 4ZTFA 3UT1A 5A0DA 4M73A 3DB3A 2FD5A 3KBGA 3UNGC 3ZQ7A 3QP5A 2VYTA 4FT2A 2XGDA 3RPQA 3UKGA 5GTIC 1Y1WJ 2R7ZJ 1CKAA 1YOVB 4ENNA 4M4ZA 5L3GA 3V7RA 2DFUA 2Q1ZB 2YUOA 3R6NA 4LMYA 5IY5H 4MEYF 9ANTA 2PVOB 3QZ9B 1EH8A 3DU5A 4EGYA 1VQOT 3SWNB 3J80K 2W48A 3OS2A 2H6CA 5IXBA 3E3VA 4LDVA 2XMFA 2IA1A 3J7ZI 1XGOA 2ZPFB 4OGEA 4AYBN 5J6XA 4D8DA 2X6WA 1H3ZA 2IGNA 4WCGA 4HEA2 1RQ6A 2K9GA 3X2QH 1Y71A 2Y9YA 3U1DA 3SDBA 4Z2YA 3CD6Q 1AU7A 2BW3A 3OSFA 3GTGJ 2LOOA 3CCVT 1WNLA 1N5ZA 2BE7D 2NYSA 2KT0A 1GBQA 2CH0A 1G59A 3INZA 3KP4A 4BY1J 1ZQ1A 5J3BA 5KCMA 4XOPA 6PAXA 1WFXA 4D7NA 3TO7A 3BTJA 1W0TA 3PO3J 2A08A 4F7UA 5DM7F 4A4GA 5HS9A 2EZLA 1ZUKA 1W2BS 4C0DC 4NQWB 1WHHA 4M7DD 2CUEA 5FU7C 3OW2S 1TQMA 2F5DA 4G8XA 3ZMZA 5BOXA 4A4EA 2KKOA 1JQQA 1FBQA 3K4CA 1B72A 1Y96A 2K5CA 3FXJA 4X9DA 4C92F 1U0JA 4AIDA 2YRDA 4PL6A 3TEEA 4DEXA 3ULQB 1YQAA 2GLOA 1SD5A 1Z05A 2CP2A 4HVWA 2GIZA 1R5HA 4M3BA 4UUSB 1G5VA 5D8KB 2EQUA 1K9MC 1BK2A 4P5NA 5KYWB 4M78C 1IN4A 2F5CA 4L6V5 1TLHB 3L2WA 1F5TA 1UGRB 2M45A 2LNBA 4LDUA 2YUPA 1UG2A 1QBJA 1K83J 1WHUA 1VQNT 4JX6A 1C0WA 3LH0A 2X3XD 1SFXA 4UY8I 4YRVA 4O6JA 2FXAA 3G73A 4M78B 3CCSQ 5AIQA 1F9NA 2E60A 2R7WA 2XDVA 2FF4A 3LQRA 4M7AE 1WI7A 3M1EA 2VV5A 3WHCA 3JCMV 3LW5E 1I27A 2QEXQ 3PUFA 1JHHA 3V4GA 3CDLA 4OU0A 2D5VA 4RCCA 1GHCA 4RKUE 4B9WA 3VS7A 3WTWC 3JB9H 3DXJF 2M5WA 2M7BA 3ZMVA 3GYHX 3HRUA 1ZLMA 4ESBA 1EFNA 4C92D 1RKTA 2ZMEB 3BTLA 1IGQA 2WB1N 4HKEA 2ETHA 5A2QR 4KUDK 2LCCA 3CUOA 5E3OA 4JRIA 2WAEA 5KAIC 2O0YA 1YITA 3I4MJ 5LBQA 3R6SA 1EKEA 2J5PA 1YWOA 3K4JA 4I09A 4HQEA 1X2KA 3CMYA 5HK3A 2P5KA 2LVSA 4YFNF 1SD4A 3VWBA 4JRKA 1MGQA 4UUTA 5H20A 1LOJA 2E1HA 2F4MB 2X6OA 3CCUA 2EPFA 3S8PA 4GLKA 2VIXA 2PVDB 2VJ4A 3WGGA 3LAJA 1N77A 4J83A 3FDRA 2COMA 4CXFA 1R36A 4LDWA 2F5VA 3WHBA 2ROLA 4ZDOA 2RHZA 3QO3A 3S17J 2HCKA 3OBWA 2GAUA 2OJ2A 2OTJI 2RV8A 4CCNA 3KEOA 2OBPA 3KZYA 1N8RU 2JMWA 1OKRA 1TNSA 2DYSH 4HW0A 2B0LA 1YITT 3BY6A 2DTHA 3EGDA 1ZRFA 2VGMA 3MWMA 1KU7A 5CQXA 4QVDA 1BR2A 1H8KA 2E12A 1VQ6Q 4LLLA 1K6YA 1V54H 2E71A 2ZCWA 3HPGA 1ONVA 2QENA 3LFUA 2DJNA 3OYEA 3FISA 4CCJA 4AIKA 2VB6A 3CPFA 4IQ4A 1S9HA 4JRQA 1XDUA 3QDRB 4LE9A 4D8KA 1Q7YU 1J9IA 2PJRA 1JRIA 3KUFA 4M7AB 3CCUT 1YHQT 2HNHA 3CXCA 2RI3A 1QPIA 1UELB 1P6RA 4E7HA 2CH4A 2K3FA 2MIOA 4KT0E 1VQMA 1BJAA 2ZJRF 2GFAA 2QASA 3OYJA 2BEOA 3FXRA 4C8QE 2BKDN 3KEYA 2QGGA 4BJ5C 4BU2A 1H3HA 2XAFA 1K73R 3PM1A 2IW5A 2BVMA 4IHXA 1TUGB 2DI3A 3K4NA 4R55A 4K11A 2EIJH 4IJAA 2JZYA 1T0HA 2OAWA 3VS0A 4NB5A 3ZMSA 3M0TA 5IYCJ 1T3LA 1ETKA 4QQDA 4XK8E 3VOEA 1MBHA 4MFEA 4B8XA 2QQ9A 3R0AA 3CCYA 1WA7A 2MSYA 2RC4A 1TUCA 4OMPA 4CCKA 1AD5A 3I0TA 3DLAA 5FU6C 4RGRA 2BY2A 2GCXA 4II3A 4F52A 1S5LC 3OIPA 3L7WA 2EZKA 4GO1A 3E6DA 2KPMA 1R0CB 4A63B 1FOXA 1FTZA 2V4JC 5I21A 2OUMA 2DIQA 2XKOA 4B9XA 3JRHA 5E1WA 3PUBA 2FRYA 1BJZA 5JHUA 4XN3A 2KI7A 2CDTA 2YUQA 5J39A 1PYVA 1KQ0A 1Z7UA 2KZGA 3K7AJ 4XLCA 2ADUA 4PDKA 4J9DA 1Z91A 2DW4A 2J7IA 3LSHA 4BJ6C 2Y31A 5HDGA 5K7HA 1LJOA 2V8IA 4EM1A 5F0CA 1BOBA 2AHQA 4BKXA 3K10A 5LHIA 1IJWC 1R1TA 2STTA 4LK1F 1UHMA 2DT5A 4XOTA 5GTHC 1D1AA 3P9CA 5B1AH 1IAWA 2M9UA 1TT0A 3CO7C 2XI9A 5LRSA 2HZYA 4N4HA 1YJ9Q 4E7IA 4AWXB 2NUTA 3BOQA 4F04B 2HFHA 5FLXK 1RABB 2RJFA 1Q95G 2EV6A 3QPSA 3DBHB 4X1EA 3JB9I 3EDPA 3I55Q 4M75E 2NVXJ 4NL2A 5AYFA 2DLLA 4ON0A 5LFAA 2RHYA 3WTSC 2DYIA 1V76A 1Q7YC 3OQ5A 2LKPA 4C8QB 5DCMA 3L2VA 3ASKA 2DKGA 1GXIE 2L9RA 2HPMA 2LMJA 2PZ1A 2P4WA 2HD0A 4HX8A 2MABA 2I10A 3GFMA 3IWZA 3I4PA 5K5QA 4A3GJ 1TG0A 2ZJPF 1W70A 1ZUYA 2VKNA 2P0QA 1BCMA 4QPOA 5DEQA 4OMNA 3H36A 1T38A 4C5GA 4XLEA 3CCSI 4YFKF 2JXBA 3FB9A 3VJPA 1R49A 1JXMA 4V2SA 1OYWA 2DTIA 1ABOA 2PLYA 2EJGA 1G3YA 4QWQA 3CBOA 4MLOA 4AG1C 5L3EA 5CKBA 2LC2A 1UAAA 3BQYA 3MCZA 4XBFA 2DAOA 2W0ZA 3ZQCA 2E7WA 3S1RJ 1I07A 3DTIA 4BEHB 2DAQA 3ASOH 3I56T 3JV3A 2MPXC 1MDMA 1KC8U 1D09B 2EYXA 1J2XA 3NARA 2HWVA 2A36A 3E9GA 3D5LA 2OTLQ 2HOAA 1DU0A 1YYVA 2ZPHB 1ZBJA 1TQPA 1OJLA 2X1CA 5LJ3g 1NK3P 1WX6A 3I5UA 2DL4A 2DVEA 3CQZJ 3V42A 2C0OA 2CZ0B 2DFHA 2P5LC 2JNGA 2QI2A 3HOYJ 3S1MJ 4NOYA 4OIPF 2LVMA 1AT1B 3BR0A 1BI2A 1QCOA 2NUZA 2QBYB 1XNIA 1AWJA 1M90C 3S16J 4RMOA 4C3IJ 2HI3A 1WH7A 3CMET 2EJFA 1Q86C 1Y6IA 3GFJA 4XORA 4MZTA 1TXQA 5M3MJ 2K4BA 2MZ4A 3RSNA 2MFZA 5GAMj 1HBXG 4F7ZA 2JUCA 1YI2I 1VQ7T 3ZN0A 2PNIA 1U6GA 3KCCA 2CZ6B 4J7FA 2ZPIB 2HDDA 1NTCA 5F6FA 2W1OA 1FPQA 4OINF 1K79A 3GLLA 3WODF 4FISA 3TP3A 5DM6F 2PUKB 3PVQA 1F4KA 2ZJ2A 4DOVA 3DKWA 1HC8A 2HSPA 2CP0A 1XSXA 1GBRA 3HKZN 2RH2A 3SZTA 1OYIA 1W4MA 1B8IA 2FEZA 3K2ZA 3KP6A 3CF2A 2F4IA 3S1NJ 3HUGB 2DX1A 1KQ2A 2DMUA 3NWSA 1BR4A 4ITVA 2VVKA 1E3HA 3Q1JA 1WJEA 4OP0A 3NGPA 2ESWA 4L5JA 1J0RA 2B86A 3MKYB 1GT0C 3META 4BBRJ 4BE0A 4KISA 3OSGA 2H3EB 1D0XA 4NNJA 4PFOA 2BOLA 5DV5A 1OPKA 2DOEA 4XU0A 2CU7A 2V8JA 2QEXA 1WHJA 4WXDA 3C2BA 2DO7A 3FBNB 5ICEA 2M0OA 4M75A 3RKXA 4WXCA 1WHGA 4JJCA 2B7EA 3H0GJ 1GV5A 2KJCA 3HOXJ 4ENMA 1ZKGA 5E1XA 1VQ4I 2V9VA 5EJCA 5LEJA 1R00A 2VUMJ 1BB9A 3FC3A 3CDHA 2IGMA 2QUFA 1D8KA 5TGTA 1BW5A 1B9NA 1JO8A 1ZR4A 1HCRA 1MNMC 1FYKA 3I3LA 5KYUA 3NHNA 3H0FA 4N0AC 4HPQA 1X3ZB 2IPQX 2L4AA 3GTLJ 1ON2A 1S72Q 5HLGA 2KAFA 1ZSGA 4FYVB 9ATCB 3HOUJ 2LYCA 4GRIA 1UDLA 1M27C 2HTSA 4C9YA 4HDVA 2X4HA 1N8RR 3S3NA 1IZ1A 3EGUA 1A5JA 4WCIA 1IO6A 1NM7A 1ZTRA 2Y2ZA 3JRCA 3BZCA 2KT1A 4FM4B 1V1CA 4PZJA 3LFKA 4O3MA 2NUPB 2M1HA 3KP5A 4RGSA 2LQWA 3J81K 1PNJA 1M1EB 2A05A 3B02A 2LLKA 2HOTA 2BE9B 1QVUA 4PJOB 1TZLA 2Y0SN 3DBRB 4HX4A 1GXQA 2K7AA 1YW9A 1FC3A 5EDNA 3MKWB 1LUJB 3VS5A 1Z77A 3N05A 2W25A 3PFYA 5JVGF 1KU9A 2K6DA 3LH5A 4PLIA 3FXKA 5GADJ 8AT1B 4EJWA 4BHCA 2LRQA 3M3YJ 5L8RE 1Q1HA 2R7DA 3CCMQ 1HF0A 2MUNA 5E3LA 2LNVA 3REBB 2P6SA 1RC9A 4IHTA 1HYOA 1EF4A 5GAN6 1K4US 2VONA 2O88A 3BCAA 5D6XA 2RHIA 3SHWA 1VQPI 1GL5A 1IRFA 5J40A 2XRNA 2RK1A 1QO0D 1B7TA 4HSTA 2VQCA 3CC4A 4G7OF 2MWOA 2JS2A 1ETVA 1IDZA 3HFNA 2R5ZA 1FXXA 1NJIU 3QYGB 3CCLT 2E1CA 1QA6A 4IKFA 2OQGA 4KICA 1Z9QA 4A5NA 4EMKB 3A8GB 1M4ZA 3DPLC 1KYZA 1YIOA 2X51A 1MBJA 1SVMA 4JYKA 5LHGA 4BI8B 2K5LA 1JKQC 3R61A 2CREA 5EG0A 3HKSA 4N9HA 4P55A 2HS5A 2KK4A 3FWEA 5KE2A 1EIFA 1O3SA 1HK9A 3AG3H 1QZEA 2HXIA 3K0LA 1T08B 4A3MJ 2OZUA 3BY7A 3MP6A 1BBZA 4UVBA 1WXBA 1LCKA 1IRXA 2HQAA 3VPRA 1EZZB 1X58A 1U06A 1ZX6A 2AKKA 2HGCA 3CPWP 2EAYA 2A6EF 2V1NA 1XSDA 2J6FA 2VXEA 3CUQB 3RBBB 4MHGA 1FP2A 4CI0C 1OR7C 5JR3A 4L5GA 5CR2A 4WTOB 1O75A 4Y33A 3ABKH 2ZSHB 3U21A 3ERMA 1JE8A 2FRWA 1B59A 1ETXA 2XVCA 1LNWA 1A6QA 1VQLQ 1N78A 3LGLA 1JXOA 5GMKh 3CCRI 4HOBA 3FKJA 4BDZA 1NK2P 1A35A 1KK7A 2UZKA 3J7AF 3L09A 2GXAA 1G2HA 4HZFA 1DPUA 1FMVA 3F21A 3CC7T 3E6MA 4UXNA 3I5RA 2VL8A 3LWIA 2DZ9A 5DUKA 3BR5A 4PJ0C 1YJ9A 1RAFB 3EGXA 2H8WA 4KIBA 1FMWA 2PMZA 3CMMA 3I71A 4E6KG 2J6OA 1KJWA 2I8DA 3TGNA 4DQ2A 2KDZA 3OIQA 2YUSA 1HOMA 3I55A 2VC1A 3KZIC 1QKXA 3UA6A 1Z6TA 2HAXA 1OYYA 3RI4A 1ZG5A 5FLXE 2PUOB 4LD6A 1B4AA 3KFWX 3MZYA 1K9AA 4FW1A 4IF4A 5KNLA 3CLQA 2ELJA 1TL8A 4FT4A 2NS8A 3F23A 2H1KA 2L3SA 2C06A 1X2NA 1UGVA 1XD7A 3CCVQ 1SANA 1UMQA 5LEKA 4CRIA 1M2VB 3FJPA 1R22A 1C6VX 3H0IA 2GWRA 5GAMe 1WWXA 1IGNA 4II1A 5HLIA 4MTEA 4Q48A 2IS4A 3P8HA 1VQPT 4M7DG 3ZMTA 3J80R 3QYHB 1IV8A 3VRZA 2PQ8A 2EGAA 4LD5A 3HHHA 1KC8R 2XPVA 3ZN1A 4FQGA 5LHHA 3D1NI 2RQTA 2DFEA 4AIJA 4NDLA 4I2OA 1X2MA 2JZ2A 3I9V2 3ISPA 1GCQA 4M77E 5CO7A 3PIPA 3CC2A 2M4GA 3HTUA 1PD0A 4PKCC 4DBHA 4U0WA 2WSCE 3E5UA 3MAJA 3BFMA 3PO2J 3PFSA 4F16A 1BBYA 1K8AU 1UHSA 5L3CA 3CCQQ 1M8VA 1K78A 2DFIA 1IUYA 2E70A 1A31A 2PVGB 3T9NA 1YW8A 1KU3A 3CPWS 1MIJA 3H0DA 2A0FB 3K1NA 3PMTA 4XQ3A 2VXFA 4G94A 5CKHA 1Z3YA 3CCJT 1Z6RA 2O8KA 2BGCA 4C3JJ 5E3NA 4ZYDA 3GTJJ 4A12A 2XICA 3ULRB 1N25A 2NNNA 4A3JJ 4R56A 1EA3A 2L2OA 4F14A 4BL0B 3HPWA 1WJFA 3GZNB 2XAJA 4PGHA 2EIKH 3ZOBA 5GAOr 3BZ6A 5EZGA 1AVZC 2AIRB 3BP8A 2KBTA 2PX9A 4C92G 1VQKT 1ZARA 5CQGA 4WK8F 2X3WD 5K1YA 1QWEA 4A53A 3V8JA 2KEAA 3HPHA 4HCZA 2DYBA 4QPQA 2K3BA 4ORZA 3TQ7P 3BTCA 2KHMA 4F55A 1ZELA 3ERED 3CCEI 4WXHA 5H6QA 3OOPA 3ZP5A 1WJDA 2F2XA 3RYPA 4FYWB 5IHNA 3TCJA 1VQ9T 2E1OA 2E2HJ 3DQVC 2K3XA 2GQIA 2KRFA 3G4ST 3HOZJ 4EMGA 1FSHA 3DBLB 4HQMA 1FBSA 4QT7A 3F6VA 1LPLA 3W2WA 2LK2A 5E20A 4A3BJ 4PJLA 1I50J 3F3XA 3A01A 4M9XA 4X0GA 4OMLA 3BPXA 4BI4A 3T1BA 4MIMA 2P7CB 1HKSA 2V6CA 1MNDA 2M34A 1YJNI 2O3FA 1R6RA 4XLHA 4G12A 5LJ3d 5CYVA 1FJLA 4AFSC 3WE3A 3M4GA 3TEDA 3H9GA 2Y30A 2BZXA 3E19A 5J47A 3C12A 3ASNH 2P6TA 2QDYB 3BG5A 3JTHA 3CMAI 1BU1A 4IRIA 1OZ2A 5CVUA 2K9SA 1FYMA 4DBRA 2ZFUA 2DDBA 3OMGA 1PVEA 4RB0A 1Y39A 4OIQF 2AO9A 2KT8A 1GFDA 2XB5A 2XGCA 4E7JA 2CGHA 3G6EA 5CJ9A 1X3WB 3EG9B 1K4TA 1X01A 4IUUA 3Q9VA 1MV0B 3Q3SA 3RTRA 4X9CA 2W7NA 1I1GA 3G1LA 2CP3A 2YXYA 3EUHC 2CSQA 3B73A 3PQJA 1SEUA 5GAMh 1AWWA 2VQHA 3K70D 2M9HA 2P4TA 1W7PB 4I98B 1ZN2A 3X20B 5LJ3j 4HAMA 2KISA 1OQKA 1VQ8I 3QXEB 3R6OA 4J9IA 3ZRGA 3GVAA 1X6GA 1S72A 4ZYAA 2Q8KA 2ME6A 1SHGA 4HLXA 1VFCA 2PMHA 2CT4A 3ZCOA 5GPAA 3QPHA 4D1QA 2DPPB 3MEWA 1PP7U 5GAOm 5GMKj 5M5WJ 1AHDP 3BQZA 2EYWA 1VQLI 3MN2A 2B8AA 1QVFP 1D0YA 4FCYA 4Y92A 4FSSA 2CUZA 2VC0A 3IUOA 2MK5A 1KQ9A 4U88A 5E79C 5K5OA 2ZXJA 2R7VA 1ZSZA 4M77A 4DZPA 4YELA 1H9TA 3HRMA 3M7GA 1WHLA 4CUGA 1QMCA 3DLLF 4OMYA 3R0JA 3VSLA 1I5LA 2R5YA 4KMFA 3TKYA 3IRRA 1TH7A 3CPWA 2AQFA 3J81E 3GP8A 5CKTA 3ZXSA 4DIQA 1VQOI 1W36D 2ID3A 3WTZA 1X27A 2CZ7B 3F22A 3IWFA 5J8FA 1GRIA 2V9KA 3NWTA 1AOJA 4IURA 1O7FA 4HA8A 2K9NA 2HEQA 4JPBW 1MNEA 2QSFX 3HOTA 1NJIR 4PCQA 3ZPLA 3EHQA 2L9NA 4D7MA 1WJRA 5C4XJ 4G6TB 4O5VA 1UGSB 1ITYA 2DBKA 2E5QA 2VKVA 4LJZF 1U5TB 4IQJA 3RPUA 2MMPA 2FNAA 5CKFA 3ZQIA 1BI3A 2BHYA 2L01A 3H35A 2VASA 3IP4B 5L23A 2M16A 4PUSA 3H1CA 3EG2A 2ZJQF 1WGSA 3K2AA 3PNTA 4HNVA 2BZYA 4M7DC 4CYCA 2X1EA 1UFMA 4BBSJ 1IW7F 1DQUA 1TP4A 3QBYA 2AXTC 2E7XA 4L9VA 3ROUA 3M0UA 1NLPC 2F2WA 2JMAA 3H5RA 1XB4A 4XKCA 3IQLA 2HQXA 3SQNA 2R3SA 4ZZDA 3G71A 3F8FA 2LDMA 2RQVA 2OU2A 3TVTA 3A0BC 3I53A 4IX7A 2GM4A 1FLIA 2L3PA 1VTNC 3CJQB 1UJ0A 1T56A 2KYMA 3O3KA 2FX0A 3QYFA 3UA7A 3A0HC 2STWA 2IRFG 3K1MA 1X6OA 3JREA 1VQNI 1RR8C 5FLXR 1YNZA 2DETA 3E7LA 1ACIA 3ZQHA 1K9MU 3IRQA 2XDBA 2LZ6B 3S93A 1SVOA 3KIOA 1TS9A 3KYLA 3RKWA 3QOPA 1T98A 5AIPA 2M3AA 1SC7A 2DM1A 4RTUA 2RNJA 2BXYA 3B6CA 3RMSA 1QVFS 3IH2A 2K9LA 1T33A 3PSIA 4L9NA 4C92C 2FNPA 2DA4A 2HTJA 1RI0A 2QTXA 4N0BA 1ARKA 3HGYA 3SFZA 1WIEA 3OYFA 3QPLA 3G71T 4C92B 2JPBA 1HKTA 3G2BA 2GTOA 3I5SA 3QWYA 5FLVA 5GAHJ 4M78E 2HDWA 2JRTA 3GEZA 1XGMA 2WV0A 4G9YA 1AOYA 4JZ4A 2ESNA 4ZNXA 3X24B 2JQ7A 5GAOl 3LNQA 4C5HA 5ILVA 3MZ8A 2BW3B 3KPHA 2DE0X 2YWWA 3VS2A 2EA2A 2LRDA 1HSTA 4M7DF 2XSJC 3MCAB 4LK0F 1R77A 2RHXA 2CQKA 5IT3A 1NYFA 3FLGA 2O9SA 1AWCA 3E5QA 3V7SA 1OEBA 2M0MA 2ZGWA 1EV7A 4D5CA 3RJPA 3MVPA 4IHWA 5KYXB 2E34A 2A3SA 3HYIA 4YTLA 3TREA 3A4CA 1T8IA 1SAXA 1DDNA 2YRVA 3CMEQ 4OOIA 2W00A 5ERIA 5F27A 4EATA 4A3CJ 2D8HA 4AT1B 3DFGA 1DU6A 2A07F 2QQBA 3PIOA 1QW1A 2H3JA 2Q2EA 2RJEA 1K8AR 3M9AA 4XLFA 1PDNC 1NG6A 3M8FA 1FT9A 4RA2A 3L1PA 2PJPA 2VBYA 3JAMZ 1YFNA 5C44J 2D1VA 3BT9A 1P4WA 3PFIA 1YITI 1RAEB 2Y90A 2VC8A 3C18A 2WAQN 2MOXA 4RM2A 4KT5C 2XDPA 4FSXA 3QJ6A 5C6SA 2KRMA 3JB9J 4G6QA 1HKQA 2RN7A 1KQSP 3TW7A 5E8IA 4BGDA 4EDUA 3CCQA 3P9KA 3LSGA 4OB1B 1JUMA 2D45A 1TWHJ 4Y28E 3BJOA 4JK1X 4KUMA 5EEGA 4A6DA 2GIVA 3CCUI 1OPCA 1YHQI 1IB8A 1Y0MA 5DLQE 5CQEA 4QTRA 5FU7B 4N9IA 5IP7J 2QSGX 2EGCA 4DGWB 3HOVJ 3RKYA 1OISA 5K7ZA 2W24A 4RTWA 3SWNA 1LDDA 4BXUA 1ZBXA 4J19A 1DGRM 3I58A 4XK4A 1PG5B 1RACB 2PEXA 3PIOF 2Z2SB 4BQOA 4E70A 4F3QA 4JX4A 2RQRA 4X1VA 3S6WA 2FHDA 3FEOA 3FIWA 4S05A 3M53A 4BB7A 2IEKA 4TV7A 4JDSA 2E36A 4J6XA 4UB8C 3QQAA 1TTYA 2FMYA 2EBIA 1A36A 4XU3A 4F7UF 1E6GA 4M3DA 1VNDA 2DJZA 4V2GA 4A5MA 1RLQC 1Y07A 3HSBA 4RBOA 3RYRA 2VQGA 1HA8A 2JM8A 2QA4A 1I1SA 4XSZF 1AA7A 3A1PA 5FFZA 2Y48A 4N4OB 2JN0A 2IGKA 3ZR8X 2O01E 1YIJT 2WWYA 1OX8A 5F04A 2RKHA 4B3AA 1P7JA 3F8NA 4UV8A 4FHTA 4NQWA 1WYXA 3M0PA 5IHIA 3C0CA 2HKQB 4HVVA 2M51A 3GBGA 2LSOA 3BJAA 1VQMI 1OPLA 4ELYC 3CO6C 3U1KA 3A8LB 1SPKA 2M7AA 2ZBKA 3OIOA 3CP2A 2E41A 2DMNA 2OV7A 4UUSA 3H5AA 3HP9A 2EILH 3BG9A 2ABLA 5KYWA 2L8DA 1M1KR 2ZKZA 2EK5A 1Z7LA 4W97A 1R1UA 1QNTA 2P0WA 3LSMA 4LIUA 5JI6A 3A8MB 4XTZA 4B3XA 2GXGA 2BIVA 3LA7A 4D5FA 1ZG1A 1KQ8A 2L7ZA 3GUDA 1EX4A 3GZ6A 3JAMK 4YIRX 3JCMX 4DOWA 2ZNYA 1UG1A 4N4IA 1VQ5A 4L59A 4YIIA 5CVRA 2FOKA 4ENKA 1JKOC 3P8DA 3VS3A 1YI2Q 3EHRA 2A69F 2E1MC 3NEUA 5GPCA 1JT6A 1T0JA 3OR2C 2DRKA 4ME7A 1UHFA 3JCMQ 3JCMJ 1UJ8A 3CP8A 1NPRA 3ECOA 3J81R 2J6KA 1KQSS 1RL2A 4M75G 1BIAA 1MKMA 2WY8Q 2ZMEA 4L9JA 3A8HB 2D2WA 3OMCA 2FE3A 4FE7A 5LGTA 1Y57A 1XSVA 2FEIA 4J9GA 4J9FA 2RD1A 4FT8A 3P5JA 3ECHA 3G1JA 3DLMA 3GLXA 3VB2A 1Y8RB 3BZKA 5FB2A 4B1RA 3V8KA 3JRAA 1W0UA 2VBZA 2X4JA 3VYHB 3FXLA 3GNFB 3OL3A 3LSPA 1HDDC 3HTRA 2LDUA 4NUBA 4OMFB 5CQYA 2XKOC 2WSEE 2DMPA 2E35A 2YDLA 2DDAA 2E5ZA 3OW2A 4E7KA 2H27A 1W1WE 3QP6A 1IC8A 2KVQG 5ICFA 3GTQJ 4RS8A 4BY6C 2Z16A 2LP5A 5DYMA 1WLPB 3VS6A 3I56I 3WVDB 2NNYA 2CWEA 3IV5A 3NAUA 1WXUA 3HB9A 4P5OA 3JCMW 1DP7P 3DU6A 2COYA 2EQMA 1VQ4Q 1D5VA 3ZQFA 3EG3A 2K4JA 2F5KA 1LVAA 3H3ZA 7AT1B 2W84A 2O61A 4Z6YA 2RPNA 1SD7A 3QOEA 4M9ZA 1WVRA 4BYYA 1YBYA 3C3WA 5TJJA 5FU6B 2PG4A 3BWGA 3JSOA 2KQWA 2JOYA 5LJ3h 2ZXHA 1PUEE 3JCMP 2GZWA 4KT6A 3L2RA 1VQMT 1I3AA 3P7NA 4RCBA 4B6MA 4M7AA 2QQ8A 1FX7A 2DL8A 4UVCA 1GUUA 1QP2A 3OB9A 5HDKA 2K57A 2LKXA 5E8GA 3CMEI 1EJ9A 2KJBA 4JUVA 1MJ9A 4HV5A 1EH7A 4A4FA 5LJ5g 2DMQA 3S2HJ 2YUNA 4B09A 2RQQA 3WXMB 1Q82C 1M90U 2TCTA 4GYIA 4ESJA 3LQQA 2MAMA 3HSFA 1VQ7I 5F1RA 1YX3A 1R4NB 3PGGA 2JVHA 2RI5A 2OTJA 2V8KA 1FEXA 3SD4A 4XRSA 2XDDA 2K7LA 1NHAA 5F08A 2YU9J 4L0YB 3F9KA 2EQRA 1K9MR 3RMQA 5EZHA 4D0PA 3LGFA 2IAIA 5CLSA 2WADA 5J4YA 2H6BA 2UXXA 2RM4A 4KITB 2WY7Q 3WU1B 2L3DA 3L2ZA 4A0YA 1W5CC 3NRVA 4WF2A 2F5FA 2D1XA 3THKA 2XV4S 4KIGA 1H641 1VQPQ 3EPZA 1N6AA 1LEBA 2X0LA 4M6XA 1BR1A 2NVTJ 1T3SA 2MF2A 1YX5A 2L3RA 5DTDA 2DOAA 3RIRA 3VYTB 4OF1A 1YIJA 3UPUA 3PJRA 2XSDC 1TWGJ 2ECCA 4P1WA 1U78A 2DILA 3TO9A 1UTIA 5KYYA 1PRLC 1WI9A 1KQSA 2DXUA 1WRJA 4DBFA 1MMGA 2FU4A 2XAGA 1CF7B 4MEXF 3FK7A 2D0QB 1B07A 5HCKA 3FBIB 1PP8F 4D6WA 2XD0A 2VLAA 1SSFA 3LOCA 4K2EA 4BQNA 4E4HA 2HDCA 1W2BP 1YN8A 1X1AA 2G9WA 1WZ2A 4OGCA 4M7AD 1X1BA 3H0HA 1YLFA 4XMYA 1MJAA 3BLYA 1LPQA 2JM9A 3I9QA 3REOA 2Z99A 4RAGA 5AONA 2A37A 3QHSA 4J9HA 4HBLA 4LNPA 1D3YA 4Z8AA 5GAOn 2RMOA 5CAIA 3V7CA 2CZ1B 1YJWA 4C8QA 3FXQA 5A2QZ 4J9CA 4J6WA 3R60A 2HSEB 5CK9A 3J80E 4H0EA 2DERA 3F8BA 5J1RA 2EV5A 3CCRQ 1AWOA 1S6LA 1NH3A 3CD6A 2MC3A 5KHDA 1DPRA 2DEQA 1B9MA 3COAC 2M8GX 1UZCA 2HVQA 4A0ZA 4HF1A 2E3HA 2GGRA 2ZPEB 1O3QA 3TL4X 1PC0A 2IA0A 4HV6A 4I0BA 1LQ1A 3K4KA 2JJ9A 1BOAA 1UHCA 5I22A 2EYQA 2NWMA 1POGA 1QQIA 3SDGA 4HDUA 2KIFA 5FGMA 2K02A 3O6BB 5FWBA 1BC7C 5GAN4 3TOBA 3HOSA 2EIMH 2KFDA 4N4NB 4MMLA 1MBKA 5D6WA 2KLOA 1RRJA 3X28B 5L3DA 2ED1A 3FMQA 4BEHA 3OYYA 3N97A 4PJOE 2ACJA 2IT0A 3KLNA 3E1SA 2OCEA 4F91B 4A3DJ 4C30A 1SFKA 2JSPA 4M75C 2IS1A 2IJLA 4CZCA 4J6YA 4FX4A 4ZGDB 3ONQA 1FMKA 3MO8A 3H41A 1CKBA 3CBMA 1IN7A 4CCLA 4D9JA 5ILUA 3OYDA 3CD6T 4M9SA 2BY3A 1I3QJ 3CCLI 5GJWB 2RHUA 1KD1C 2G7HA 2V26A 3LMMA 3VEPA 4F92B 1HQCA 5E17F 5EG2A 5BNGA 3CCSA 2DA5A 1RADB 4TVRA 5IOYA 4CA0A 1F43A 2QBYA 5C3EJ 3L2UA 1W1FA 2OI3A 1B1BA 2EJ9A 2K4YA 4XONA 4QLCU 3DKXA 2EQJA 2CQNA 3WG9A 1ZR2A 4ABZA 3I64A 2A7YA 1UFFA 2GXBA 3M07A 3KYDB 2ZZDA 2V1XA 1NYGA 3MKZA 3HXLA 5HNFA 1VA7A 2DMTA 2RGVA 3HEFA 2Z5UA 3HSRA 3M0SA 3I35A 4C8QD 3BR6A 4QVCA 4NC7A 3AG2H 1WH5A 1U9NA 2VJIA 3CC4I 2E6ZA 4DYRA 3JCMg 1U1SA 2OD5A 3DF8A 3FM3A 3GMEA 2JW4A 1BN5A 2W4SA 4RDUA 2KMTA 5LJ3f 5GJVB 2R7XA 2A6HF 3RERA 1K1ZA 5GAMf 2XG8D 2HR3A 2EKOA 5A2QK 3OYNA 3N4MA 5IOZA 1WGXA 5D5XB 3PQKA 3GBQA 4HYEA 4XTWA 2AK5A 4CC3A 1OMIA 1YCYA 5HODA 1VYTA 4PJNA 3NTHA 4IRGA 1I6XA 3DPUA 2DLPA 2FZCB 4W1UA 5IT9Z 3A02A 3HUGA 4PSXA 1YCSB 3CC7I 4MO7A 2QGFB 3H8ZA 2DVJA 1YG2A 2DTOA 2VUBA 1I5ZA 1JU5C 3EAEA 4GLMA 2QEXT 3GIBA 5EGOB 2M0CA 4FL6A 3CCEQ 2RDPA 2RI2A 4M75F 2A5YB 3FZVA 5HVQC 4J01A 1PCXA 5E3MA 3FHZA 1H0MA 3GX4X 1ETWA 1QKWA 2XKPA 5EF6A 1I8FA 2CV2A 4QQ6A 4PFZA 5DY9A 1Q7YR 4DBQA 2L9SA 3GCMA 3PL8A 2RQPA 2L5QA 2E65A 1Z21A 3H9QA 2R5ZB 1FP1D 1WKMA 2WBMA 2DBMA 5CKDA 3PTAA 1VQ6A 2ELHA 2JK3A 4IRHA 1UUEA 2DF6A 4YEJA 1YRNB 5B3SH 3HIFA 4EJUA 3OYKA 2CUBA 3NTKA 4JLGA 5GANd 2WSFE 1YJNQ 3MKLA 4PLLA 2HXOA 4C5IA 2LP0A 1NZ9A 4CH7A 2K3PA 2EZHA 3VFZA 1UE9A 2G6FX 3ABLH 2MC4A 5B5EC 3CMAQ 3H3VK 1UCRA 4M75D 3OYBA 4ZYGA 2LBFB 3JRDA 4MNUA 1V3FA 2WA0A 2ECBA 2KL4A 2CQQA 3D5RC 4M71A 4A69C 1E3OC 2PI0A 3QZ5B 3TSZA 5I11A 1YJWQ 4WX9A 2L3QA 2OC6A 3G3ZA 1N75A 2K2MA 3A8OB 4RLFA 2DK8A 3O2PE 3K9TA 3SYTA 2V79A 3OS0A 2ME0A 1XX5A 1T0FA 2AZVA 1TNTA 4PJOA 1U2WA 1VQ6T 3BPVA 4PNOA 4JRPA 2EQIA 2IBDA 3JRGA 1V5EA 2BVLA 2Y75A 1W5SA 3JCMf 3CCJI 2FPFA 3OS5A 3Q5FA 2HBPA 4EVIA 2IS2A 1VQ8Q 4LLNA 4BE2A 1UB4A 2CP6A 1SFOJ 2KY9A 2O31A 1P4AA 3CC4T 3HL2A 1M90R 1VYVA 5FD6A 1VQKI 3C2GA 5M3FJ 5E18F 3I4NJ 1Y0NA 1Q86R 1XDSA 3A03A 3Q9SA 2Z33A 3VDXA 5IT9K 2P0TA 1B34B 5KYNA 4HRIA 4DOZA 4C5EA 2CGPA 1REPC 2NOGA 1APLC 2DD4A 1VQ9I 4UVAA 5C0MA 4U7BA 4L9TA 3G4SI 3IH4A 3RUXA 4YIFA 2EFNA 2VBWA 2E2IJ 4HXJA 3JTGA 4EEFG 2DQLA 4M3EA 2P84A 3W2VA 3QUIA 2MD0A 4EMKA 4ATOA 1VQOQ 2FZGB 2P0KA 2R7SA 5FKKA 1MSFC 1U8RA 3BC8A 2GA2A 2QCOA 1M5Q1 2BZ8A 2X1DA 4OMOA 3SB2A 2V1QA 1GCQC 3HJEA 2KDSA 1Q86U 5JLWA 2M02A 3H9NA 2LCLA 2UV1A 4EQQA 3GO5A 5BQTA 2BHZA 4DJAA 1U3EM 1KHIA 3SFIA 4Q5WA 3EFOB 5DCFA 3T8RA 1MUZA 1ZA2B 3GNGA 3CUQA 1XC5A 4ESRA 4RMNA 5GMKi 4RGUA 3WE2A 1T2KA 1B3QA 3WU0A 1DJ7B 5LJ5d 1UGPB 3QKJA 4OAZA 2P7VB 4XN0A 4IIOA 4CCOA 1OR7A 4KIFA 1S7AA 5A0GA 3NMZC 5FW9A 4EPCA 1YJ9T 3K70C 4FW2A 4JS4A 1ZAOA 2RREA 2L4MA 1J09A 2ZFWA 3E5XA 2F5TX 3C7JA 3CJTB 4V2FA 1OU8A 3I55T 2V1UA 3S14J 3JRFA 3U2RA 4RB1A 1S1NA 2ECZA 4HT8A 3MP8A 4C0FA 4LDXA 4X6AJ 2CO5A 4MMKA 2HQ5A 4LLGF 4GGGA 2ZSIB 3HZJA 2XHKA 3PVLA 1JJ6C 2OTLA 1SD6A 2BE5F 4IHVA 2YRCA 4LOCA 1ZGAA 4QSHA 1VQNQ 1VIFA 1KIKA 4IZZA 2MYSA 4ZYHA 1O7LA 3M9QA 1T95A 1D5YA 2NS0A 1XS9A 3G6EI 5LJ5j 1R23A 2YR2A 1O3RA 3TSWA 8ATCB 1J7KA 3CCRA 2X6YA 2CP5A 2W82A 2HYGD 1WFWA 1G3SA 3QSUA 5K5RA 5FLMJ 5TRDA 2A68F 2H8RA 2CUJA 2DTRA 1YE9A 2BBYA 1W36C 4U0VA 2VODA 2O4XB 2VJJA 3PIPF 2UXNA 3CC2T 3S3MA 5EC7A 2QF7A 4GYGA 5FROA 2H09A 2CS3A
chains in the Genus database with same CATH topology
4MZPA 1LDKB 2YX7A 2EQKA 3QU6A 4EJVA 1UEBA 4F7UG 2OTLT 1ZREA 1VIEA 3GZ5A 1I4K1 4EM0B 5D5WB 5LL6S 1WSUA 1N9RA 1UGQB 1BYMA 5D6YA 2W57A 1F1ZA 4Z02A 1P4XA 1LJ9A 3GF2A 5D8LB 1K6OA 2Q0OA 1STZA 3LWFA 2EA4A 4KMUX 5KK1A 4EMSA 2K5IA 2MH9A 4KDPA 5LRRA 2J5OA 5HS8A 5FO5A