1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
3HYIA 4M74A 3WU1B 4KIGA 1USTA 1U8RA 3HTUA 2V9VA 2XAJA 1SD4A 1G3WA 3R6SA 4HW0A 4EJUA 5FFXA 1W7PB 2YSRA 5HOOA 1ZG1A 4KICA 2LSOA 2W24A 4DQ2A 2Q8KA 3QOPA 1J59A 2V79A 1I27A 3ZN0A 2VC1A 2DTRA 3G3ZA 5HLGA 4LLNA 1ZYRF 3JSOA 5CVUA 4KN4X 3J80Z 3DKWA 5JHUA 3TOAA 2ZNZA 5J6XA 1YIOA 2F2EA 5JR3A 1XCVA 3I5UA 3CUQA 1XSDA 3J7AO 4L18B 2UZKA 3CJNA 1MJ9A 2EV0A 4HDUA 4UV9A 1KQ8A 5D4SA 1HXDA 2A5YB 1BM9A 1YLFA 1QO0D 4XSXF 4OIQF 3HOSA 1ULYA 3MWMA 1H9TA 1E2XA 2XV4S 1ODDA 5EEHA 5BPIA 1TNTA 5F6FA 2NNNA 5LEJA 4RGUA 2HOEA 2VXZA 4K2EA 1FBSA 2PG4A 3BZ6A 2RC4A 3PFIA 4B8XA 2QZ8A 4HX8A 3J81Z 4IPAA 3KZYA 4P5OA 3KEQA 2QBYB 2O3FA 2DPDA 1FBQA 3RI4A 4HAMA 3RKYA 1OR7A 3QPTA 5LGNA 1OYIA 2ISZA 1R00A 4IHTA 3KLNA 4WCGA 3CDHA 5LHIA 4AWXB 3GFIA 1W5SA 3REOA 3BJOA 4ESBA 4G7HF 5DYMA 1HQCA 2XASA 2EV5A 1D8KA 2OBPA 2CWEA 2ZMEB 2H6BA 1S29A 2K5IA 2V1UA 2DBBA 1XSXA 4F7ZA 2M5WA 4FHTA 2M8EA 5HVQC 3F22A 4EJVA 4AD9A 3KZZA 4A0YA 1BC8C 2W25A 5CVVA 1Z6RA 3WTWC 4R8HA 5JFRA 4GCVA 1YW8A 1GVJA 4GXOA 2EFWA 4M9XA 3I58A 4YIIA 4A6EA 1DP7P 1FP1D 1S3JA 3BROA 4GGGA 3VFZA 2P8TA 3P9CA 1Z05A 5LHGA 2FSWA 4HA8A 2VODA 3BPVA 1IAWA 1U2WA 2PJPA 4PGHA 3GFMA 1Z9CA 4RAZA 4ZYHA 3QP5A 4G94A 4ENNA 5J8CA 2EWNA 3O6BB 4ZH4F 2VOPA 1G3SA 3ELKA 1S8NA 2GWRA 3N4MA 1IN8A 2QQBA 2Z99A 2QM3A 4MTEA 2YPRA 3D5LA 3DV8A 5D5VB 2FA5A 3T0YA 4Z2YA 5BMZA 4P55A 3U9GA 3ZQ7A 2NNYA 5TRDA 2L54A 5E1ZB 3MAJA 3TGNA 1IN7A 2A69F 5DCMB 4A2UA 3BJAA 4S05A 1MDMB 4Q4ZF 2M87A 4KUMA 4EJTA 1AOYA 1OKRA 3H3UA 4EM1A 2WWYA 1ZAOA 3TQNA 1SFEA 4Q47A 2M45A 4IF4A 4HLXA 3K1PA 3DFGA 3WTZA 3LQQA 2RVCA 4MHGA 2OAZA 4I0BA 2CFXA 5D5WB 2D1VA 2RKHA 5LRSA 2L4MA 1FPQA 5ILSA 3LQRA 1WKMA 2HTSA 2OZ6A 5EEGA 2F5DA 1MJBA 5HLHA 3J80K 1QZYA 2A6EF 1HKQA 1J7KA 5HS8A 3EETA 2GA1A 3GO5A 1E17A 5CYVA 2HQNA 3V7CA 5KK1A 5DUIA 1X3UA 2P6SA 2FBKA 4CHUA 4KNYA 1YYVA 2PQ8A 1BI1A 4PDKA 3TOBA 3I59A 1O7FA 3BY6A 4RB3C 3TDUC 2MLKA 3SXYA 4UUVA 4WF2A 1USSA 2P6TA 3M9AA 2DT5A 3C3WA 3CO6C 1F9NA 1UCRA 4P96A 5E1XA 2HKXA 2O8XA 3EQLF 1JGSA 4KMUX 1STZA 4KDPA 2RGVA 2GXGA 4I7HA 1P4XA 4IRHA 3WGIA 4XSZF 1IZ1A 1MZBA 2QQAA 1KU3A 4OINF 1XDUA 3F8BA 1YO5C 2HZTA 5L3EA 4HDVA 4CO8A 5E18F 3QAHA 2OU2A 4EGZA 4HV6A 2DQLA 2XAFA 1D3YA 3COAC 3E5XA 2DW4A 3L2CA 1HBXG 3EUHA 1PDNC 1T6SA 1L3LA 3NQOA 1ONVA 3HRMA 2W84A 3PQKA 2MLGA 2L4AA 5F64A 4FX4A 4UVCA 3Q5FA 4I2OA 3N97A 4NB5A 2R7DA 5CLSA 3GEZA 5A2QZ 4Q5SF 2CW0F 4EM0B 3GZ5A 2ISYA 3C7JA 2E7WA 2CQKA 2VT2A 4ZYDA 1Z7UA 2BEOA 2FNAA 4O5VA 3F8FA 3MQ0A 1HKTA 4KYWA 3E6CC 2OQGA 3LSTA 2H6CA 4XRFA 4GYGA 5FFZA 2K5FA 1LQ1A 4RS8A 3RIRA 3ECOA 4HQMA 1FT9A 3QU6A 1QBJA 1ZRDA 1G3YA 5CJ9A 1MKMA 2O0YA 2G7HA 2XKPA 1FZPB 2FOKA 3KP3A 2L01A 4WXCA 4G9YA 4UVBA 2JZYA 2XAQA 1P4WA 4P9FA 2XHKA 1GXPA 4AVPA 3RYPA 5ILUA 2J5PA 4BH9A 5HDGA 3JW4A 3HSFA 1XGMA 5D6FA 5L3BA 4ENMA 3GXOA 5K5OA 3I4PA 5L3FA 2LF7A 3C18A 2K7LA 2HYFA 1DDNA 1O57A 3FXQA 2K4YA 5D6EA 3GFLA 2M1BA 4KIBA 4BAYA 3SZPA 4XBFA 3WODF 1SMYF 2DQRA 4HX4A 4A5NA 1IW7F 1Q1HA 4Q48A 2E1CA 4KIFA 3WTVC 2PMUA 3CUQB 5DUKA 3WE2A 3GX4X 1HKSA 2KIFA 2V1XA 4BNCA 1ON1A 2NS0A 4BXUA 3QU3A 1F1ZA 5LEKA 2PEXA 4JBAA 2EV6A 1Z6TA 1FC3A 1L0OC 3I71A 1MGTA 5D8KB 2CYYA 2QUFA 5ED4A 4AIJA 5TJJA 4JQFA 5AIPA 5L3CA 4CZZA 2FU4A 3RPQA 4RGSA 3K1MA 2LX9A 2HYGD 1TTYA 3IC7A 3F8CA 1UB9A 4I09A 1PP7U 3E5QA 5HS9A 2NYXA 1R5GA 2K4BA 1U6GA 2IVMA 3U1DA 2M30A 4ZYEA 2W57A 1R58A 4OIPF 4N9HA 2V6CA 4U0VA 4EGYA 1ZHFA 2E1NA 1IRGA 4Y17A 4WK8F 3HRTA 2PFBA 1U5TC 2ESHA 2EFOA 1TQMA 2NAZA 3HRUA 1R22A 1RUOA 4YFXF 4L9JA 3KLOA 5L3DA 1QPMA 3WTYC 4LG0A 2WC2A 1ON2A 3R0JA 1B1BA 4D0PA 5KVRA 3WTUC 1XMAA 2TDXA 1CF7A 3O3KA 2H3JA 4NQWA 1I6XA 1J0RA 1FSHA 3MZHA 2A61A 2DFIA 3FMRA 2HR3A 1ZG3A 3JSPA 2EFNA 1KU7A 1P2FA 2GIVA 3I64A 1S7OA 5HDKA 4LMYA 4O6JA 3S2WA 4OU0A 1W7PA 3P7NA 3I0TA 1J9IA 1Y0UA 4BQAA 3GWZA 4ZYGA 4YFKF 1XDSA 3O2PE 5LBQA 2K4JA 2H94A 1BI3A 4PZJA 3M7GA 4UV8A 3ML6A 4ENJA 1H9GA 3GFJA 4L9VA 4RGRA 3IWZA 3V8JA 3ZMDA 4L5IA 1KYZA 4IRGA 5D4RA 1O3SA 2PBIA 1OYWA 3GUDA 1YW7A 4YG2F 2JT1A 1WI9A 3DPLC 3SHFA 5DDGA 5F1RA 2ZO4A 1ZG5A 2HTJA 3HTSB 2HGCA 4L9NA 3EYYA 2Y48A 4MQVA 1SD5A 3T8RA 1R7JA 1ZN2A 4FX0A 1DPRA 2GA2A 1T2KA 2OD5A 5LHHA 1IN4A 2JTVA 1XN7A 2CSOA 4M9ZA 2VE8A 1LB2A 4Y15A 3HRSA 1LDDA 1YQAA 2ZJ2A 2YU3A 2FNPA 3H92A 2Y0MA 1LDJA 2L02A 4I98B 4CDGA 3LAPA 3T5XA 3V8LA 4CGZA 3K9TA 1QQIA 2STTA 2QENA 2ACJA 2WV0A 5K1YA 2VONA 3I59B 2P5VA 2FXAA 3ZN1A 4N0BA 3KE2A 5ICCA 3JAMZ 4WXDA 3GW2A 1YS6A 2Z5UA 1EH6A 4M6YA 2BV6A 3NRVA 1FY7A 1LVAA 4A0XA 2F5EA 3VOEA 5FLXZ 4U0WA 1P4AA 1WQ2A 4WWCA 1B9NA 1I1SA 5HDNA 3KFWX 2IP2A 1GXQA 4OMZA 2A6HF 2LNBA 4AIKA 1ZH5A 3TO6A 4KA4A 5BS6A 1BJAA 4I01A 2K86A 3L09A 1I1GA 2PI0A 4HV5A 1ZRCA 3E19A 3QP6A 2MBFA 2PMHA 2UXNA 3DPTA 2FMYA 2CO5A 1SFXA 3IL2A 4G6DA 1K78A 3GLXA 3V7RA 2IA2A 5ICFA 1FOKA 3ZMUA 3RDIA 4I0AA 1MD0A 4L5JA 4EQQA 5CVJA 3QRFF 1SFUA 2D2WA 2RN7A 4CICA 4U0YA 4HX7A 1BYMA 5ERIA 2B0LA 1HW2A 3SFZA 2OZUA 3DP7A 3C1DA 3R0AA 5DEQA 1C0WA 3U2RA 3E97A 2VC0A 5JVTA 4L9TA 2FMLA 2K02A 2HFHA 4OIOF 1G6NA 1R1UA 2IPQX 4KT5C 3LAJA 1SMTA 4EVIA 1U5TA 1PP8F 1S6LA 1FX7A 3CUOA 1MDMA 2YX4A 3LWFA 3J81K 3RJPA 3ABTA 2HKOA 4A5MA 2BGCA 2BE5F 1ZRFA 2XVCA 3KP4A 4KFCA 1J2XA 2L3DA 1XB4A 3FX3A 3E6MA 3B73A 1FSEA 2DLLA 2FRHA 3V8KA 3FZVA 2XKOA 2MA3A 4ESFA 1F5TA 3WU0A 2F5FA 2ZXJA 2VOOA 2EFPA 2EA2A 3KP5A 1QGPA 1XCBA 5DV5A 3F23A 5H6QA 3K2ZA 4ENKA 2EFQA 1K79A 3MEXA 3EYIA 2MH9A 4RB0A 4UNOA 1WSUA 2OA4A 4L0YB 2G7UA 3WGGA 3M8EA 1A04A 3LA7A 1RNLA 4QLCU 3ULQB 2JPCA 3E5UA 2J5OA 1P6RA 3P9KA 3R60A 2ZNYA 2VN2A 1O3TA 1SD6A 4B09A 1R1VA 2C6YA 2PLYA 2AXLA 1R5HA 4I02A 2DO7A 1UHMA 3SZTA 3WG9A 3IRRA 4XLNF 1W5TA 1FWZA 1IXSB 1ZREA 3CO7C 3FWEA 3WGHA 3TDZC 2H09A 4PCQA 4N9IA 2FEZA 1KGSA 1IN6A 3FF5A 3ZMVA 3F72A 3KP7A 3KEOA 4A6DA 4HQEA 1RZ4A 2COMA 2K5LA 4M73A 1XD7A 4JK1X 3TO9A 3R4KA 3WTSC 2YX7A 2UWMA 2O6GE 5E8IA 3JTGA 3GYHX 3PQJA 3RPUA 3M1EA 1QNTA 3FXUA 2GZWA 1U78A 4BYYA 4LFUA 4WXHA 1DPUA 2QQ9A 2FE3A 3HOTA 3QPHA 1WWXA 1P92A 5BQTA 4MGRA 1G4DA 2AS5F 2GXBA 4R79A 2EA4A 3RTRA 3KETA 4M6XA 1SAXA 2ZBKA 1YG2A 5DD8A 3IHUA 4G7OF 1IF1A 4HOBA 1VTNC 4LGWA 3BJ6A 2Y75A 5LLQA 1RUNA 1OMIA 4LG0B 4KMFA 2MD5A 3VB2A 1IN5A 3CTAA 5FD6A 3ISPA 3I53A 2RQPA 3VEPA 4EJWA 2GAUA 3RKXA 1BIAA 3V7SA 2JRTA 2P4WA 2UXXA 3E6DA 1YFHA 2GQQA 4MEYF 4PGGA 5HLIA 3T1BA 3TO7A 1B59A 2QYOA 1BN5A 4ESJA 5CVRA 2ZFWA 3ZMSA 2HQRA 3F8NA 4M9SA 2Z3YA 1J75A 2IA0A 5CVIA 1SD7A 4ON0A 2VBYA 2RV8A 1FYLA 1ZLJA 3RYRA 5LGTA 1QVPA 4LLLA 2V1DA 2ELHA 2W85A 2DPUA 5IT9Z 3ZMZA 5K5RA 1BC7C 1BBYA 4IVNA 2CG4A 5D5XB 2QWWA 4M72A 4A12A 1G3TA 2KJBA 2QLZA 4MEXF 4U7BA 3ZPLA 1UHWA 4UHTA 1XSVA 4UXNA 1FLIA 3HIFA 5BOXA 2FQ3A 3LA2A 3FMQA 2JSCA 2RNJA 3M8FA 3CLOA 1XMKA 3F8MA 3IRQA 5ICEA 1K7AA 1MJAA 3MHXA 2R7FA 1YS7A 2VBZA 1HW5A 5L3GA 1UFMA 3BDDA 5DD4A 3GZ6A 4HBLA 2KIUA 2QVOA 2H27A 1QW1A 2STWA 1BOAA 1OPCA 1O3QA 3L9FA 3VODA 3DEUA 3BWGA 5A2QK 1TNSA 2E7XA 4G7ZF 1D8JA 5J8FA 3TKYA 5BPDA 4HLYA 3WTXC 1ZARA 1B9MA 3KCCA 4BHPA 2VT3A 5E8GA 2ZCWA 2R3SA 2VBXA 3KP2A 1BIBA 2EK5A 4M71A 1Z91A 1REPC 5AIQA 1T98A 3JTHA 4HF0A 2DAOA 2KRFA 2FBHA 3FMSA 2IW5A 2HWVA 4KN7X 2X4HA 2P7VB 5DCFA 1DUXC 4LB5A 1Z1DA 4IJAA 4EM2A 1FYMA 4CYDA 5FO5A 2XROA 3F6OA 4IXAA 2A68F 2VE9A 2QBYA 1XGNA 1LNWA 3FHZA 1FYKA 1K6OA 3DQVC 4QWQA 3G73A 1TQPA 2XRNA 2Z9OA 2CGPA 1K78B 2ZKZA 2P5LC 1FP2A 5K5QA 4G8XA 2Q0OA 3FXRA 2MH2A 3ZP5A 3ROUA 3F6VA 2XUBA 3DF8A 5IT3A 3Q9VA 1LEAA 1R36A 3P9IA 4AIHA 3IKTA 3K1NA 2DI3A 4BHCA 2ZMEA 5E20A 3GF2A 1TW3A 2IRFG 1QZZA 5ICGA 3WTTC 3FM3A 1LJ9A 3BP8A 1V4RA 1OYYA 2BBYA 1U5TB 5HS7A 1XGOA 3L00A 4Y13A 1EH8A 3R61A 4IRIA 4HYEA 1KQ0A 2IJLA 5H6RA 3AAFA 1F4KA 4GO1A 3W6JB 1V3FA 4LJZF 1O7LA 1AWCA 2EJRA 1JHFA 1IRFA 4ZZDA 2RDPA 4LB6B 2BYVE 4RGXA 2XAGA 4RB2C 1ZLKA 4MQ9F 2KKOA 3ABUA 4NHJA 3I54A 1HSJA 4HF1A 2IA1A 1HSTA 4L0ZB 2ETHA 5IT9K 1TQIA 4RB1A 3ERED 3CUQC 1JHHA 5FB2A 1KU9A 4GYIA 2YR2A 2FBIA 4LLGF 4LK1F 1RIOH 4BHBA 1T38A 1LEBA 2XAHA 2LKPA 6PAXA 4U88A 2IT0A 2P5KA 3NEUA 2G9WA 1KU2A 1J5YA 5DCMA 4R1HA 4MTDA 1H0MA 2Z33A 2D45A 5E1WA 3HHHA 5LRRA 4HF2A 2KIMA 1GHCA 2LF8A 2EB7A 5D8LB 1NHAA 2F5CA 1YW9A 4S04A 3K0LA 1D5VA 4CXFA 1T39A 3OV8A 1KQ9A 3HSEA 2LDUA 1EV7A 2WTEA 5ILVA 2X0LA 2O61A 2ADUA 3F21A 2A07F 1I5ZA 1TW2A 1R23A 4OMYA 3E3VA 2K27A 5E17F 3OOPA 4OOIA 3SQNA 3E6BA 1PUEE 3GVAA 1CGPA 2XGXA 4ZZLA 2JPBA 2DK5A 2HDCA 1WRJA 2P7CB 4TV7A 3B02A 1FNNA 3RKWA 1KYWA 3DXJF 4O3MA 4E70A 2D1HA 4UVAA 5H20A 5FGMA 3H3ZA 4XLPF 5JI6A 3MCZA 1W7PD 5LGUA 4LK0F 1JXSA 3LA3A 3KP6A 4HZFA 4RAYA 3Q9SA 3HHGA 2VBWA 3WE3A 1FBUA 3L7WA 5AONA 2HEOA 3LFKA 3ECHA 2MC3A 1KA8A 1YTYA 2FF4A 4YFNF 4U7DA 1HW1A 1LDKB 3MFKA 4EMSA 5D5UB 4DNCA 2HS5A 2NRAC 1EH7A 1B6AA 1S7AA 1BI2A 2GCXA 1R1TA 2XIGA 3EDPA 1ZGJA 3IKVA 1JE8A 4LD5A 1XGSA 1T0FA 4MNUA 3V4GA 3T8TA 3F3XA 4WX9A 3ZMTA 2O03A 3HSRA 2ESNA 1U3EM 3BPXA 4EV0A 4IHSA 3D0SA 3K69A 3FM5A 3JAMK 4H0EA 1W4MA 3BOQA 5FD5A 3HUGA 2PN6A 2A3SA 4OIRF 1RI7A 1TLHB 1ZGAA 5FLXK 4ASNA 1O3RA 1BI0A 4G6QA 1IXRC 2OQRA 4P9UA 4A0ZA 2DK8A 4YIFA 2KJCA 4ETSA 4FT8A 3IWFA 3W6KB 1IUYA 1CF7B 2Q2EA 1B4AA 3MZYA 4EJOA 2DU9A 1IXCA 1TBXA
chains in the Genus database with same CATH superfamily
3BLYA 3HYIA 3CD6I 1WX6A 4M74A 4PSXA 5EG0B 5M3FJ 4XTUA 3WU1B 4C0DB 4KIGA 2VLAA 1USTA 1A5JA 2WY8Q 1U8RA 1VZ0A 1GFDA 3HTUA 2V9VA 2DTZA 2XF6A 1KONA 3WXMB 1WZ2A 2XAJA 1SD4A 1JUPA 1G3WA 1VQ9Q 3R6SA 4HW0A 1U0JA 2XRLA 1BKBA 3HKZN 1YJNI 2L3RA 5CKEA 4J7IA 3M07A 4EJUA 2IGMA 2VL8A 5FFXA 2L3SA 2L8DA 1W7PB 2YSRA 4M3FA 4E7SA 5J47A 2WY7Q 5HOOA 2I5UA 1IGUA 3BDUA 2Z2SB 1ZG1A 4KICA 4HNVA 1V1CA 2FJ1A 3I56A 2LSOA 3FISA 3GLLA 2W24A 3G71I 1SAUA 4DQ2A 3M4OJ 2JUFA 3HSBA 2V26A 2Q8KA 3QOPA 3GTPJ 4XKCA 1J59A 2V79A 1LCKA 2LY9A 2COWA 1W36C 2DMOA 2GFUA 2YSQA 1OX9A 1I27A 4UB6C 5EZHA 2O01E 4NC6A 2KPMA 2PU9B 3ZN0A 1QA6A 3VUBA 2VC1A 4HXJA 3GIBA 2DTRA 1XNIA 3G3ZA 1GCQA 4PJLA 2E71A 2DD5A 5HLGA 1G2HA 2IS2A 3SB2A 1W0TA 1DQUA 4LLNA 1RETA 1ZYRF 5KE3A 1RQ6A 3JSOA 5LJ3f 2HZDA 1M2VA 4JDSA 2RI2A 5CVUA 4KN4X 3HC7A 1HF0A 3J80Z 4CI0C 2EYQA 3DKWA 5JHUA 1SFOJ 3OQ5A 5HY6A 3TOAA 4YTLA 3JCMg 1X01A 2JSPA 1WH7A 2VJIA 2ZNZA 3X26B 2DA4A 4XU2A 3IH4A 4KGXB 4PJOG 2HOAA 5J6XA 1YIOA 2KQWA 2F2EA 5JR3A 1OPKA 1XCVA 1KHIA 1VQ9I 5KCMA 1X2MA 4E7KA 4ITVA 4AG2C 4C5HA 3I5UA 3CUQA 1DGRM 3BTIA 2COYA 3REBB 2KZVA 1XSDA 1SVMA 3J7AO 1HSQA 3CCQT 4QPOA 1K9MR 4L18B 2RQTA 2UZKA 3CJNA 4UUTA 1MJ9A 2EV0A 3OS1A 3BQYA 4IIOA 2DRKA 5GP9A 4HDUA 4UV9A 1KQ8A 1PJRA 4B3AA 1BB9A 4QVZA 5D4SA 1HXDA 4XRSG 2WAQN 1HLVA 2LNHB 2EQRA 5C3EJ 1M3BA 2DYIA 5J26A 4BUGA 4E2FB 1LFBA 2A5YB 1BM9A 1YLFA 4CC3A 1NG6A 2JW4A 1QO0D 4XSXF 3HP9A 2XPUA 4OIQF 5CKDA 3HOSA 1Z3YA 1ULYA 2HSEB 2R4GA 3EG1A 3MWMA 3HXLA 3OMGA 3ULRB 1H9TA 4ELZC 3QJYA 1A36A 1E2XA 1VQKQ 2XV4S 1ODDA 5EEHA 5BPIA 3ASKA 3HTRA 2VPRA 1TNTA 3AG4H 4E7LA 4NL2A 3H35A 5F6FA 3FXJA 1M8MA 4C92F 1APLC 2GM4A 2DZCA 4M75G 2DILA 3HHTB 2VKHA 1FOWA 2NNNA 1AHDP 3LH5A 2LCSA 5LEJA 1HOMA 2YLCA 5LJ5d 4RGUA 2EYZA 2HOEA 4RTUA 5LJ3j 2VXZA 2Y2ZA 4K2EA 1T8IA 2QGFB 1FBSA 2PG4A 2VASA 4N4GA 5FWBA 3K6GA 3BZ6A 1POGA 5I21A 2RC4A 3CCRT 1Z67A 3PFIA 3GP8A 4B8XA 3TREA 2HBPA 2QZ8A 4M3BA 4HX8A 1Q86R 2DYSH 3BC8A 3J81Z 4AG1C 5IHNA 1GLNA 4IPAA 3KZYA 4P5OA 1TUDA 2CKKA 3KEQA 1DU0A 1LE8B 2QBYB 4C92C 2O3FA 2HSPA 1ETWA 2DPDA 4LDUA 3SYTA 1WJRA 2D6FA 1FBQA 1QP3A 2P0PA 1WJSA 3RI4A 4HAMA 1SEUA 3RKYA 2ZPHB 4PFZA 3ZQQA 1DJ7B 5AT1B 1FIPA 3K70D 4AMCA 1VQLT 2DOFA 3ZR8X 3JAME 1OR7A 2DNUA 3QPTA 5LGNA 3CQTA 3C2HA 1MBFA 1OYIA 1NE8A 2ISZA 3EUHC 4CYCA 1JQQA 2E6ZA 1N5ZA 1E3OC 2RQUA 1R00A 3BY7A 1TUCA 2KXDA 3P5JA 4X1VA 4NOYA 1RKTA 5GAGJ 3K10A 4ANJA 2NVUB 4IHTA 2KP6A 4C8QF 3KLNA 4WCGA 3CDHA 4KJZA 5LHIA 1QHGA 3D7SB 1XG1A 2IGOA 4AWXB 1VQNI 3I3LA 4UUSA 1VQKI 1NG2A 3GFIA 3RESA 5FLXE 2R7OA 4BE2A 2MW8A 4RTWA 1ERDA 4A4HA 4CC2A 1W5SA 3ABLH 4RTZA 3REOA 2V9PA 3BJOA 4ESBA 4G7HF 5DYMA 4RG8A 1MMAA 1VQ5Q 3CF5F 1OJLA 4P5NA 1HQCA 1JJ8C 4JRPA 3GOXA 3RKQA 2DAQA 2VKNA 2XASA 1TWGJ 3H36A 4BUPA 1WZOA 4C8QC 2EV5A 4PJOD 1D8KA 3QXEB 1AHJB 3JRCA 1MV3A 2OBPA 2K85A 3X2QH 2CWEA 2ZMEB 5KE2A 5KYWB 1Q81R 2CGHA 3M3YJ 4JS4A 2H6BA 2AZSA 3PMTA 1NJIR 1S29A 1TWAJ 2K5IA 2CFOA 1OQYA 4HG2A 1SKUB 2M02A 1PNJA 5GPCA 2DBBA 3JRGA 2V1UA 1XSXA 4F7ZA 2M5WA 3OYMA 2RQRA 5D6XA 1PD0A 3CBOA 3CQZJ 3G2BA 2K9GA 2HVRA 4FHTA 2M8EA 4CCNA 5HVQC 1YJ9Q 3F22A 4QW2A 1U5SA 1RADB 4QKUA 4EJVA 3J81E 1N27A 3A1PA 3H5NA 4C2UA 2V7FA 1YJ9A 4AD9A 3KZZA 4S0HB 2B7EA 4A0YA 1BC8C 2W25A 2R7XA 5CVVA 1Z6RA 2GTOA 4TVRA 1ZELA 3WTWC 3CC7Q 1AZEA 4RMNA 3OYNA 1KSWA 1Y0NA 4KGZB 2HCKA 5GANd 2YDLA 1J09A 3OSVA 3VS4A 4R8HA 3JREA 2MC4A 2LQWA 1X2NA 1NEBA 5JFRA 4M75D 4GCVA 1YW8A 1GVJA 1TWHJ 3CLQA 4GXOA 1RR8C 1P9QC 2EFWA 4M9XA 1M1FA 1X43A 3I58A 2M1HA 2XB0X 4YIIA 3ME9A 2OCEA 4A6EA 3F9KA 1DP7P 1FP1D 2M4KA 1S3JA 1VQ5I 3BROA 4GGGA 3VFZA 3LGFA 1SVOA 1JKQC 3QYHB 1MW7A 2P8TA 2EBIA 2X85A 2O9VA 3J7ZI 3JRFA 1A35A 3H0FA 3P9CA 3CCJQ 1Z05A 1OX8A 2JJ9A 5LHGA 2FSWA 1RAEB 4IOAF 4HA8A 2CS3A 3BPVA 2VODA 1KK7A 1IAWA 1QKWA 1O9SA 2EIMH 1U2WA 2DA1A 4J6XA 4WCIA 2A28A 3CJTB 2PJPA 5FROA 1UJYA 4PGHA 1BJZA 3GFMA 1Z9CA 2QA4Q 2DDAA 4RAZA 1NEGA 2D8JA 3K4MA 2RK2A 4ZYHA 2LK2A 4RA2A 2XK0A 4M7AC 2DA3A 3QP5A 3LSMA 4G94A 4ENNA 4X34A 3CCLT 3N05A 5J8CA 3DLLF 2EWNA 3TP3A 4M78F 1TP4A 3O6BB 4ZH4F 2VOPA 3FC3A 1YJ9I 3RUXA 1G3SA 2JUGA 3ELKA 3M4YA 1S8NA 2EQMA 2GWRA 3RZDJ 3N4MA 2R7SA 1IN8A 3NAUA 3R6NA 1D1AA 2QQBA 2Z99A 1N25A 1AKHB 2RJDA 1VQOQ 2HL5C 4A3LJ 1K9AA 3BDLA 4F3QA 4GDFA 1UHFA 4FL6A 2QM3A 4MTEA 1OU9A 5IYCJ 4A3DJ 2YPRA 1UGQB 2YHTA 3D5LA 3CC7I 2R5AA 1UJ8A 2CREA 3DV8A 4L5GA 3FHNA 4A3GJ 1YJWT 1VQOA 5D5VB 3JCMc 2BY3A 3DB4A 3UR3C 4AYBA 3JB9H 3PUFA 3UNGC 4M78C 1X4OA 2JA7J 2M0CA 1MSFC 5GMKe 2FA5A 2H8WA 3T0YA 5K7ZA 2SRCA 4BI3A 1G2BA 1Y56A 4Z2YA 4KISA 5BMZA 4P55A 2HDAA 4XN0A 4VUBA 1TC3C 3U9GA 3ZQ7A 2PMZN 2D8HA 3CCJI 2NNYA 5FKLA 3WVDB 5TRDA 2VIXA 2L9SA 3ZXSA 4FE4A 1LPQA 2OAUA 2RD1A 5DY9A 4EDUA 1YHQA 4BBSJ 1M90U 1U8BA 1X6OA 5DM6F 1G8XA 2L54A 5E1ZB 2KT1A 1RC9A 3OYGA 1E0EA 5I22A 3MAJA 2BZYA 2F2XA 3KFVA 2QA4I 3TGNA 1PSEA 2DJQA 1IN7A 2A69F 3JCMb 1PKSA 2DL7A 5DCMB 1VQMT 4A2UA 1I4K1 3BJAA 3K4CA 1HJDA 1IDZA 1X3WB 3GTMJ 3P8DA 2DJNA 3OWTA 4S05A 1MDMB 4Q4ZF 4R0KA 1SHGA 2VUMJ 2M87A 3OL3A 2FQ4A 4KUMA 2KDZA 4A3FJ 1UGVA 3DTKA 4AVZA 4EJTA 5EG2A 1AOYA 1OKRA 3H3UA 4EM1A 2WWYA 3AL0C 3NARA 4A3CJ 1ZAOA 2ELJA 5EJCA 1MGQA 2DXBA 3TQNA 4CH7A 5KYXB 4YRVA 1JBMA 3CCET 3FEOA 4BGDA 1SFEA 1BBZA 4IUPA 4Q47A 4IQ4A 2M45A 4OGCA 2LRQA 4M7DF 1Y0MA 4J9BA 4IF4A 3PFYA 2OJED 4PJMA 1Y1VJ 3K4LA 3O8HA 1HDDC 1IRXA 3ONQA 1QQJA 5CO7A 3L2UA 4HLXA 1VQ4A 4XIDA 2OC6A 4G12A 3K1PA 1AEYA 1MBHA 2HVSA 2QXFA 2MG4A 3DFGA 1YRNB 4HKEA 1UG1A 5IYBJ 3WTZA 3LQQA 1OISA 4F55A 1Z7LA 5A0LA 3S3NA 2BZ8A 3DLMA 4J9GA 2CRGA 2RVCA 4PJOB 4MHGA 3OYDA 2OAZA 2FHDA 1VQ6I 1I39A 4I0BA 2ATCB 2CFXA 5D5WB 1OZ3A 2D1VA 2RKHA 5LRSA 4J9HA 1Q82C 2PVGB 4FCYA 3QYEA 1KQ2A 2Z1DA 5IP6A 4IEJA 2L4MA 4LIUA 2C0TA 4XONA 3JCMd 4BKXA 1FPQA 3A01B 2YRDA 2YUOA 1QP2A 1BK2A 5ILSA 2RQVA 3LQRA 3OOUA 5LJ5e 1WKMA 2HTSA 2OZ6A 5EEGA 1JI8A 2F5DA 2K9SA 2LC4A 1MJBA 1WHKA 2VJ5A 2E6NA 5LJ3g 1OFCX 5E79C 2MYSA 1KQSA 1Q1VA 5HLHA 3UWNA 3J80K 3M0RA 3HKZA 4M77F 4XTVA 1QZYA 3SDGA 1AA7A 1UGPB 2A6EF 4EATA 1HKQA 1E6GA 1PUFB 1UHCA 2QEXA 1J7KA 1SANA 3MKWB 4BY6C 1CSKA 5HS8A 3PIPA 2Y9YA 2DTHA 2L3PA 3EETA 3ZEHA 2GA1A 3GO5A 5EGOA 1ZA2B 1VQ8T 1O4XA 1E17A 5CYVA 2HQNA 4BI4A 2R0QC 1WHHA 1MSEC 3V7CA 1FIAA 5KK1A 5DUIA 1OCCH 1X3UA 2P6SA 3QWYA 2FBKA 1GBRA 4E4HA 4CHUA 4M75B 4KNYA 4IUTA 3CZ6A 1YYVA 2E1MB 2PQ8A 4C9YA 2CP5A 1BI1A 2L7FP 2PVOB 2M34A 4DYQA 2YUNA 4PDKA 3QZ9B 4M77C 5CKHA 5J39A 1JEGA 3TOBA 3QDRB 3I59A 4A3BJ 1UTIA 5L23A 1O7FA 3BY6A 2QAZA 5GAOl 4RB3C 4A3KJ 2KT8A 3TDUC 4CC4B 3CCQQ 2MLKA 2KHMA 1VI0A 2EIJH 2C0IA 1M90C 1D0XA 1UAAA 3SXYA 1MH4A 2AXTC 3H3VK 3S1QJ 4UUVA 1I6HJ 1PD1A 1X1PA 3QQAA 4WF2A 1T0HA 5M5WJ 2WA0A 4M7DD 4M3GA 4Y52J 5GAOr 1USSA 4BB7A 1TT5B 3QHSA 4F14A 2P6TA 3M9AA 2DT5A 4FETA 3C3WA 2GIZA 2CV0A 2ICWG 1K73R 3CO6C 4JX6A 2EH3A 1F9NA 1UCRA 4P96A 5E1XA 3G6ET 4C3HJ 2V1QA 3H8ZA 2HKXA 1FTTA 4FYXB 2NOJB 3M9QA 1SPKA 4RTYA 2O8XA 5D7UA 1IHWA 1PRMC 2E5QA 1VA7A 3EQLF 1JGSA 4KMUX 5IH2A 1FTZA 1RAFB 1IGNA 1SSFA 2JRMA 1O75A 2HVQA 1STZA 4KDPA 3J80R 3ER0A 2RGVA 3CMMA 2GXGA 2ME0A 3L2ZA 3NGPA 1K0SA 2DIGA 1FMWA 2WAQA 4I7HA 1P4XA 4DW6A 2WBMA 2VUBA 1WJAA 2O9LA 4CUGA 4Y7NJ 1OR7C 2KISA 4IRHA 5CPRB 5L8RE 3WGIA 4XSZF 3CCRQ 4OWRB 3QYGB 1IZ1A 1MZBA 2QQAA 2MMPA 3IH2A 3M5AA 2O7OA 4XL9A 3ZQIA 4IX7A 2DMPA 3HOZJ 1KU3A 3RERA 5TISC 1XDUA 4OINF 5FLVA 2BIVA 3A8MB 2JNGA 3OYHA 3F8BA 3CCRA 1LJOA 4MO7A 1YO5C 3CCQI 2HZTA 3G1JA 1VYTA 3PMIA 1SG5A 4E6RA 5L3EA 4HDVA 1D0YA 4PL6A 3FKJA 4W97A 2JTMA 2RHIA 2BY1A 4BQOA 1VQLQ 2DODA 4CO8A 5GANe 4K11A 1D0ZA 1IB8A 2QK0A 3UDCA 2ZJRF 5E18F 2CJJA 3QAHA 2IAIA 2OU2A 1I5OB 3QG1A 1ARKA 3M0TA 3M53A 2LYCA 2A3LA 4EGZA 2HPMA 2O2OA 3EGDB 3VYHB 4C92A 1M1KR 4HV6A 2RHYA 2DQLA 2WSEE 3FJPA 3G7ZA 4HCCA 3LMMA 2XAFA 1N8RR 1MHNA 1D3YA 1VQ7I 3H41A 1I5LA 4DOZA 2HQHA 1WDXA 1H8AC 2DN0A 3COAC 1KQ1A 3RMSA 3E5XA 2DW4A 3L2CA 1HBXG 3EUHA 4HVUA 4L6V5 4F7UG 5GAMf 2IS1A 1PDNC 2Z0WA 1T6SA 3QJ6A 4GLKA 4JLGA 1L3LA 2BW3A 3NQOA 3I35A 1ONVA 1Z77A 2AQEA 2MCNA 4QQGA 2ME6A 3HRMA 2W84A 4DBFA 2CW7A 3PQKA 2MLGA 3E0JB 4X1EA 1IV6A 5LFAA 2H1KA 1JB0E 1EZZB 2L4AA 1KHCA 1VIFA 2VI6A 5F64A 1OCRH 3J81R 1YCSB 3FK6A 2DBMA 4FX4A 4UVCA 2LRDA 2OF7A 3N97A 3Q5FA 4I2OA 1ACIA 2V8IA 1UHSA 4NB5A 2V1RA 3A1YA 2R7DA 4AFSC 5CLSA 4XM3A 5E3OA 1KQSP 3OIQA 4PJ0C 3I55I 3GEZA 2R7UA 3PVLA 5A2QZ 4Q5SF 2QKLB 1UG0A 5BNGA 3S2DJ 1D5YA 3C12A 2EIKH 4C8QA 1VQLI 1NJIU 2CW0F 4EM0B 3GZ5A 2ISYA 2XHCA 3GTGJ 2FVUA 3C7JA 2E7WA 2CQKA 4XQ3A 3VRYA 4N0AC 4ZYAA 3V42A 3DKYA 2VT2A 4ZYDA 1Z7UA 2BEOA 2FNAA 2MFZA 4M3DA 4O5VA 3F8FA 1MBJA 3MQ0A 4AIDA 1HKTA 2HYJA 1R0CB 1WHMA 4OMOA 5KYYA 3DBRB 4KYWA 3E6CC 3OS0A 2OQGA 3LSTA 2X4XA 2H6CA 1W1FA 4XRFA 3KUFA 2JVHA 4GYGA 2X6OA 5FFZA 1N78A 1OEBA 1WXUA 2K5FA 1LQ1A 2E1OA 3FDYA 3CESA 4RS8A 3RIRA 3I4MJ 3S1NJ 2JXBA 3MEAA 2CYZB 3ECOA 4HQMA 1FT9A 3QU6A 4HSTA 1QBJA 3W2VA 1ZRDA 2I0NA 3L1AA 1G3YA 5CJ9A 4R56A 1MKMA 1MNDA 3OYCA 3OMCA 1U3OA 2KBTA 1ZHIA 3O8VA 2EYYA 4MLOA 2O0YA 4P1WA 3H0IA 2FO0A 4ZDPA 2G7HA 2XKPA 4HNUA 3AG2H 1FZPB 2A7YA 3VS0A 1K6YA 3CCUA 2FOKA 1V5GA 3QBYA 4J83A 3BCAA 2ZJQF 5GMKh 3KP3A 2L01A 4WXCA 1B3QA 5IT9E 4G9YA 3LYIA 3DU5A 4UVBA 1KJWA 2JZYA 2CZ0B 3SDZA 3JCMQ 2XAQA 4BBRJ 1P4WA 1RI9A 2X35A 3HPGA 4E7IA 1SFKA 3A02A 4P9FA 2CUJA 2XHKA 4N4OB 1GXPA 3G1MA 1W6XA 1TTHB 4B4CA 4AVPA 4F17A 8AT1B 2LOOA 4E6KG 4IHYA 1MMGA 1DP3A 3E9GA 4FYWB 3RYPA 3TL4X 3VDXA 2J5PA 5ILUA 3CCLQ 2DTOA 2EQIA 1I3QJ 4BH9A 3C95A 4M4ZA 5HDGA 2MGQA 5GAOn 1YBYA 3SWNB 3JW4A 4M7DB 2M7AA 3HSFA 1OPLA 1NM7A 3MEWA 2RJEA 1XGMA 1RLPC 2Q1ZB 4KH1B 3CJQB 5D6FA 4XNFA 3WU2C 5L3BA 1DU6A 1R77A 2AHJB 4ENMA 5C0MA 2ECZA 1KD1R 3GXOA 5K5OA 3FBIB 3EUKL 3IQLA 3BG9A 3DLAA 3L2RA 1LOJA 2CS7A 2EKHA 3HOXJ 2HNIA 2OCCH 1JTXA 3I4PA 3FK7A 5L3FA 1Y07A 2CUDA 5IP7J 3FB9A 1FJLA 1YJWQ 4JLIA 2LF7A 3C18A 4J8OA 3DPUA 1B7TA 2K7LA 2AT1B 2NYSA 2HYFA 3ZCOA 1DDNA 1UFFA 4BJTA 1O57A 3FXQA 2K4YA 5D6EA 3CD6A 3GFLA 2M1BA 2EZIA 4KIBA 1Q82U 4BAYA 3SZPA 5J40A 3A8GB 2RQQA 4YELA 3L1PA 3NTIA 2AK5A 3ASNH 3JCMe 3LWHA 2QDLA 1T3SA 3META 4XBFA 2XGCA 4QT7A 2FPDA 2JS0A 3WODF 1YWPA 1M8VA 1SMYF 2DQRA 4HX4A 4A5NA 2LT4A 3TCJA 1IW7F 1Q1HA 3G71Q 2ESWA 4Q48A 2CDTA 4M78A 3DLLA 1V5FA 2E1CA 3LWIA 4KIFA 2P81A 3WTVC 2PMUA 2Y0SA 3CUQB 4D5FA 3ERMA 2LCLA 2O9SA 2E3HA 1S72T 1V54H 1VQMQ 2E70A 2YLBA 3G71A 2E5NA 5DUKA 1CQTA 3WE2A 1NJIC 5EDNA 1Y7XA 3SEMA 3GX4X 1HKSA 2KIFA 2V1XA 4CCMA 3CCLI 2MSYA 2F4MB 4BNCA 5JHFA 4LOCA 4IQJA 2DO3A 2NUZA 3JB9G 2EINH 1H3HA 2LBFA 2DKGA 1XJWB 5FU7B 3ZQHA 2RJFA 1ON1A 1NK3P 1KQSS 2R7QA 2DXTA 4JJBA 5LJ5h 2DJIA 2NS0A 2WB1N 2W00A 1IZ6A 2VV5A 3VRZA 4BXUA 3QU3A 2KI7A 1H89C 4II1A 5IP9J 5GAHJ 3CCEQ 1F1ZA 5LEKA 1PKTA 2PEXA 4JBAA 2EV6A 1Z6TA 4DGWB 1FC3A 1L0OC 1QKXA 3I71A 2DD4A 1MGTA 4Q5WA 2QSGX 1YJWI 5D8KB 1NPPA 2DFUA 2CYYA 2QUFA 4M6VA 2RREA 3PIOF 5ED4A 1D09B 1S9HA 4AIJA 1OYXA 4D8DA 2YT6A 4J6WA 3SEQA 5TJJA 2K3FA 4JQFA 3PIPF 2DE0X 3H9NA 2MF2A 3H6ZA 2JVVA 4FU6A 1QHHD 5AIPA 5L3CA 4CZZA 2FU4A 1KG1A 1TWCJ 2GOMA 2MVTA 3RPQA 2OTLQ 1VQ9A 4RGSA 3K1MA 1WGXA 2YUSA 4V19K 2LX9A 2HYGD 4C30A 2DL5A 2FZKB 2DYRH 2I10A 3BTJA 5FKOA 3EG0A 3QZ5B 1IREB 5KYUB 2YWWA 2HMAA 3OYEA 2KGTA 1TTYA 1E6HA 3IC7A 4BQNA 1MBKA 4XKBA 1VQMI 1MNMC 2X4YA 5KH6A 4YEJA 1WYXA 2DT6A 3CCVT 2TCTA 3F8CA 3HPWA 1UB9A 4OVAA 5ECAA 4I09A 3QUIA 2K40A 3TMOA 3CDIA 5KCOA 2LD5A 2R7VA 1EA3A 1PP7U 1IG7A 1BR2A 2X6WA 3E5QA 2VYTA 2JTEA 2KZGA 1XOVA 4F93B 1FOXA 1J3TA 2L7ZA 3MKLA 5HS9A 4E7JA 1ZUYA 2DF6A 2D9TA 2NYXA 4RTTA 3CCEI 2OTLT 1MNEA 1R5GA 3EH2A 2K4BA 2DEUA 1U6GA 1VQ8Q 2IVMA 1R4MB 3A8LB 3ZQFA 4UUSB 3U1DA 2FUG2 2M30A 4ZYEA 4X6AJ 2KY9A 2W57A 4FT2A 1YITT 1R58A 1TS9A 2CZ6B 1WXTA 2JMCA 5CQYA 4OIPF 3RSNA 1K8AR 4N9HA 1OI1A 1VQ8A 2NUPA 4J5YA 2Y4YA 3B6AA 1D3BA 3VU3C 1UGRB 4MZPA 1QVFS 2V6CA 4U0VA 3JCMP 3CCMT 4EGYA 1GRIA 2LY1A 4M77E 1QRYA 4C5IA 1ZHFA 4CCOA 4LUEA 3I9V2 1KC8R 3PM1A 3BG7A 1S5LC 2ZPEB 2E1NA 2ZB9A 4XN3A 1IRGA 1M3AA 4Y17A 3CPWA 1NTCA 4A3EJ 4FIBA 3JCMV 5GTIC 1ZQ1A 4WK8F 1RR7A 1SRMA 2ROTA 3HRTA 2PFBA 1U5TC 2R5ZA 3LH0A 2ESHA 5JVGF 2EFOA 4M77A 1TQMA 2BVLA 1YWOA 1WHGA 2NAZA 1T95A 4JX4A 2E60A 3HRUA 1R22A 2KRSA 1YE9A 4MZMA 1RUOA 5FRNA 1VQ7T 2FRYA 4JRQA 2ED1A 4YFXF 2HZYA 1AD5A 1H88C 2M3AA 1UDLA 2IG0A 3JB9D 1IJWC 3G6EQ 3S14J 4PJOF 1VQNQ 4L9JA 2V1NA 3KLOA 5L3DA 1UELB 4EMGA 1QPMA 1UMQA 3H9QA 4LG0A 3WTYC 2WC2A 1WJQA 2F2WA 2KYMA 1QVGA 1K73U 1BL0A 1ON2A 1I50J 3G6EA 1VQNA 1MMSA 3R0JA 1VQKA 1B1BA 4D0PA 4HRIA 5KVRA 4E7HA 3WTUC 1XMAA 1VQ8I 2TDXA 1CF7A 2LTOA 4CSWA 4PUSA 2XGEA 3ZL7C 3O3KA 2H3JA 4NQWA 3MJXA 2JWTA 2K2MA 4A4GA 4NDLA 1I6XA 3ZQGA 2K6DA 1J0RA 4F7UB 3BG6A 1FSHA 2ENMA 3MZHA 2HD0A 4FW2A 2A61A 1HDPA 2DFIA 3FMRA 1Y96A 2HR3A 2RNAA 3JSCA 2LY2A 5EG0A 4J9FA 4RTVA 3SHWA 1AWOA 2XIDA 2XKOC 3BTLA 4J00A 2I8DA 2WSFE 5IXFA 1ZG3A 3JSPA 1T3LA 3I55T 2EFNA 3A0BC 1X1DA 2ID6A 2RHXA 2W7NA 4GLMA 1KU7A 1LPLA 1P2FA 3UA7A 2GIVA 3I64A 2W10A 1S7OA 5HDKA 4LMYA 1YNZA 4O6JA 2LLKA 3P8HA 3S2WA 4OU0A 3MVPA 3BR1A 4RAGA 3JCUC 4M75F 1D1BA 1W7PA 3QYFA 3P7NA 2YU9J 2YRVA 3I0TA 2EZLA 1J9IA 5CIUA 4BQQA 2DA2A 4FASD 1I0CA 1Y0UA 2LQKA 1W0UA 2X4WA 4X9CA 4RCCA 1WGSA 1VF9A 4BQAA 2X3XD 3GWZA 2F2VA 2DXUA 3LW5E 3CEYA 2A37A 5GMKj 4HCBA 3G6EI 4ZYGA 5I2MA 2KROA 4YFKF 5GAMd 1M1EB 1XDSA 2DMNA 3AFHA 3O2PE 5E3LA 5LBQA 4QVDA 3E2UA 2K4JA 5HK3A 3QPSA 1JGGA 2H94A 1BI3A 1N8RU 4PZJA 4XU1A 1BW6A 2NVXJ 1Q7YR 3EFRA 3HGYA 1ZUKA 3HB9A 3M7GA 4UV8A 3EFOA 3HGGA 3ML6A 4ENJA 2E1MC 1TZLA 1H9GA 3DCFA 2E1HA 3AG1H 1MBEA 1BR4A 3RDVA 1NBEB 4J9CA 2EJGA 3GFJA 3W2WA 4BU2A 1FMVA 1VQ5A 3G1LA 4L9VA 4Y4RA 4RGRA 2KDSA 5IPAA 1ZR2A 3IWZA 3V8JA 3ZMDA 1ZX6A 2KNBB 2F4OB 4L5IA 5HNFA 2H3EB 2FOWA 4I6ZA 2E5ZA 1KYZA 2LH9A 4IRGA 4A93J 1LFPA 3QDFA 5D4RA 2CH0A 4EEFG 4E7ZA 1O3SA 5FWCA 1QZEA 5AYFA 4DOWA 2KVQG 2XU8A 1QU3A 2EZHA 2PBIA 3T9NA 2XSDC 4F91B 1ACMB 1OYWA 4AC0A 2BY0A 1I1JA 3GUDA 1YW7A 2BXYA 3CCYA 2JT1A 3LSJA 4YG2F 1WI9A 1BOBA 3DPLC 3SHFA 5DDGA 5F1RA 2FYKA 2ZO4A 2GGRA 4C92D 4CC7A 5H2FC 4M7AG 2XMFA 2DT7B 3KPHA 5F0FA 1ZG5A 2OAWA 1JT0A 1WFWA 1K73C 2HTJA 1CKAA 1Z3XA 1ZBXA 3VYSB 2WADA 3HTSB 3CC4T 2HGCA 2CUBA 3CMAT 4N0AA 4L9NA 3EYYA 2Y48A 2VXFA 6AT1B 5HODA 1R5ID 4ZNXA 3CPWP 2PUKB 4NBQA 2NLUA 2KRMA 1WNLA 3GMEA 3PO3J 1YX5A 2P0WA 3SJMA 4MQVA 1SD5A 3T8RA 5GAEJ 1R7JA 4RM3A 1X27A 3TEEA 1ZN2A 4FX0A 1DPRA 3M8JA 2A0FB 2AIRB 3GBGA 5LJ5j 3BR5A 2GA2A 4BEHB 3S93A 1PG5B 4JOMA 1T2KA 4OAZA 1PWTA 3JCMh 2OD5A 5LHHA 4M78G 4EMKC 3CCJA 1NK2P 1A31A 4JX5A 3OR2C 4OAYA 1IN4A 2JTVA 3DU6A 1QPIA 5A2QR 1XN7A 2EVRA 2W82A 2ZAEA 5CQEA 4ZTFA 1VQPT 2OTJT 2CSOA 4M9ZA 4C8QD 2VE8A 1LKXA 2QA4A 3C0CA 1QVGP 1LE8A 5FU6C 2Y31A 3OW2P 1LB2A 4Y15A 3HRSA 1LDDA 1YQAA 2ZJ2A 2AO9A 3CCLA 2GOXB 1I81A 2C0OA 1JJ2P 4JJCA 1RPWA 2ED0A 4MFEA 3MZ8A 4PJNA 3CJRB 4FYVB 2YU3A 2ZZDA 2FNPA 2XI9A 3BG3A 2DMQA 2J6OA 3H0DA 1PCXA 3H92A 2M2EA 4C0ZA 2Y0MA 3X28B 5M3MJ 1A0NB 1N8RC 4BACA 3MEUA 1IO2A 1HYOA 1Z9QA 1LDJA 2L02A 4I98B 4CDGA 2HQXA 5KAFC 3LAPA 1YP5A 2QQ8A 3THKA 5M9OA 3T5XA 3V8LA 4JPBW 3S1MJ 1FOYA 3H9JA 1U1TA 1YI2T 4D9JA 1D1CA 4CGZA 3QYBA 3VS6A 3K9TA 1WJFA 1QQIA 2DFEA 2STTA 2O88A 3KX2A 1VQ6Q 2QENA 2ACJA 5GJVB 4XAXB 5EF6A 4LDXA 2ZXWH 2DYBA 3EGXB 2YXYA 3U21A 2WV0A 3FXLA 3IAS2 1PHTA 3TP0A 1WFXA 2LP0A 4LIVA 1PC0A 2PUOB 2XDVA 5K1YA 2EGEA 1VQ6A 2VONA 3I59B 4M7DG 2P5VA 2FXAA 2CV1A 3ZN1A 2FRWA 1S72Q 4N0BA 1ZGWA 5C6SA 3KE2A 2EIFA 3CC2T 5ICCA 2PNIA 2QQSA 1G83A 4LNPA 3JAMZ 2K9QA 1H641 1GBQA 1ZKGA 1U1SA 5FRMA 4WXDA 4HCZA 4HNTA 2K9MA 2M9HA 4AU7A 1BA5A 2LP5A 3GW2A 1YS6A 2DLPA 2OTJI 2CH4W 2Z5UA 1EH6A 2G0EA 4M6YA 2BV6A 3NRVA 2DFHA 2ZGWA 4M7AD 2D5VA 4ATOA 1FY7A 1LVAA 3VYTB 4DEYA 5I11A 1ETKA 4A0XA 2JA6J 5JLWA 3A98A 2F5EA 3VOEA 5FLXZ 1F43A 5CR2A 4RTXA 4U0WA 1P4AA 4DBHA 1WQ2A 4WWCA 1B9NA 5GADJ 4D1QA 1TUGB 3PNYA 1I1SA 3K4BA 3JR9A 4KBMB 5HDNA 4OMQA 2Y69H 3KFWX 2CU7A 4Y33A 2IP2A 2BXZA 1GXQA 3OSGA 2OJ2A 2VJJA 4OMZA 2A6HF 3LFUA 2LNBA 2JA8J 2JZ2A 4AIKA 1ZH5A 4XTXA 3TO6A 3LSRA 3GPLA 1S7EA 2JN6A 4KA4A 2WB1A 5CQGA 2LC2A 5FKKA 1BJAA 5BS6A 1BCMA 4BL0B 1NH3A 2E5KA 3DKMA 2RH2A 2XGDA 4I01A 2K86A 4A3MJ 2M0MA 3L09A 3CBPA 5IAYA 1I1GA 2PI0A 3CPWS 4M78D 2KXCA 4HV5A 1ZRCA 2HOSA 1N9RA 1W70A 3E19A 3QP6A 3HDDA 1ZLMA 2MBFA 2PMHA 1S72I 2UXNA 3DPTA 3WHBA 2FG0A 5HLTA 4HT8A 3RR6A 3CDLA 2FMYA 2J6KA 3CCVQ 3I56T 2CO5A 1SFXA 1ZSZC 1JTYA 3IL2A 4G6DA 2PJRA 1AWXA 2FPEA 3TVTA 4KRTA 3BT9A 1TT0A 1K78A 2L0KA 3CCVA 3GLXA 1M90R 1MV0B 3V7RA 4C92B 4BS9A 3A8HB 4X0GA 3PO2J 2DMUA 2NVTJ 2HU9A 2IA2A 2XAUA 2NS7A 4KITB 1QCOA 2C06A 5ICFA 1FOKA 3VSKA 3ZMUA 1WPYA 2E2HJ 1QVGS 3RDIA 4I0AA 1MD0A 3DTIA 4L5JA 2DA6A 1PM3A 2DXIA 2F5TX 2P0QA 3R6OA 4FT4A 3OW2S 4EQQA 4JS5A 5CVJA 4ZDLA 4F52A 3QRFF 1SFUA 3CXCP 1YITQ 1N77A 2R93J 2D2WA 1MBGA 2LFBA 2RN7A 4CICA 4U0YA 4HX7A 1BYMA 3SEZA 2OV7A 3GTQJ 1RAGB 2NVQJ 3CCMQ 2ECCA 5ERIA 2B0LA 2VQHA 3SFZA 1HW2A 1WI7A 2OZUA 4XK4A 3DP7A 1M27C 3C1DA 3G1OA 2W0ZA 2HKQB 4D6WA 5E3NA 3R0AA 4XR6A 5DEQA 1IDYA 1ZR4A 1C0WA 5GPAA 2CP7A 2FPFA 3PSFA 3LL7A 3U2RA 5M5YJ 2O31A 3AG3H 3HOUJ 3CCMA 1K0XA 3E97A 1U9OA 3OYIA 5GAMe 4ZDOA 3CCQA 2BHZA 2NOGA 3JRDA 3ABKH 2VC0A 3HJEA 1K9MU 5J1RA 5JVTA 1B34A 2X6XA 2VQLA 1X2QA 4L9TA 2FMLA 3EG9A 1SEMA 4JJNK 2K02A 2HFHA 3FBNB 1G6NA 4OIOF 1YN8A 4XRMA 3DB3A 5FU7C 1VUBA 2MZ4A 3FJ5A 3MKYB 1QVUA 1R1UA 2M8GX 4C8QB 1VQ7Q 2IPQX 3CCVI 1T0JA 3SWNA 4ZN3A 4KT5C 3QOEA 3LAJA 1SMTA 3OYJA 2EZKA 2EGAA 4EIKA 4EVIA 1U5TA 2E2JJ 1PP8F 1S6LA 3NMZC 1VQ7A 4LDWA 1FX7A 3CUOA 4C0GA 4DYRA 3M4GA 4XTWA 1MDMA 4C0DC 5KYYB 2YX4A 2KLOA 2OTLI 3BG5A 2CP0A 3LWFA 5IXBA 1VYVA 4D7MA 3J81K 4ZC3A 3RJPA 2KMUA 4QTRA 3ABTA 3M55A 2HKOA 2MK5A 1JU5C 4BDZA 4A5MA 5GJWB 2BGCA 1ZK8A 2BE5F 4DBRA 1ZRFA 3K7AJ 2GFAA 1QVFA 1YITI 1B8IB 4FISA 1X4PA 2J05A 2XVCA 5EYRA 3OIPA 4X9DA 3KP4A 1LFUP 3PFSA 4GY5A 5F0HA 4PJOE 5GTHC 3CCMI 4KFCA 1NPRA 1J2XA 2K3PA 3A4CA 2L3DA 2R5YB 2VC8A 3HKSA 2IIMA 1TL8A 2E41A 1OCTC 2VGNA 3I55Q 1XB4A 2H8RA 5FLMJ 3FX3A 1YRNA 3NHNA 1Q86U 4MMLA 4OB1B 3E6MA 3B73A 3SZGA 1FSEA 5IY5H 3OY9A 1XS9A 1ZQ3P 2D1XA 3I55A 2DLLA 1UZCA 2FRHA 1TWBA 3J7YJ 3V8KA 3FZVA 2B63J 2JT4A 4IUQA 2XKOA 1VQLA 4LITA 2MA3A 3LNQA 4ESFA 2IVWA 3TW7A 3A2KA 2I2LA 3ABMH 2DL3A 2LT1A 1TH7A 2PTKA 3EAEA 3A01A 4J6YA 1F5TA 3WU0A 2RN8A 4WTOB 2F5FA 5EC7A 4Z6YA 4HEA2 2XC7A 3OA6A 2DL4A 2ZXJA 2VOOA 3MCAB 3PE0A 2EFPA 4NC7A 2EW3A 2JMAA 4M7AB 2Y30A 4XRSA 2EA2A 4FM4B 3S3MA 5FKNA 2K5CA 3KP5A 8ATCB 2LREA 3OYLA 2CT3A 4M75E 1JKPC 3HL8A 1QGPA 1XCBA 1UUEA 2P84A 5DV5A 1XTAA 3Q3SA 5H6QA 3K2ZA 3F23A 2R58A 3KBGA 4ENKA 2EFQA 1K79A 3MEXA 2QQRA 3EYIA 2MH9A 3ESWB 2FZCB 1OCOH 2E35A 4RB0A 4UNOA 4MFDA 1WSUA 4RM2A 5CK9A 4UB8C 2HQAA 2OA4A 4LD6A 3RQ4A 1M2OA 4L0YB 4ZN1A 2HKNA 2G7UA 3HUGB 3WGGA 4A4EA 3C2BA 1TSFA 3M8EA 3CXCS 1A04A 2OX7A 3LA7A 5IYDJ 1Q81U 1RRJA 1RNLA 2BZXA 3GNGA 1K9MC 2EYXA 3EG3A 4QLCU 1JKRC 4GRIA 3ULQB 2JPCA 1WQWA 2P0KA 1UG2A 3E5UA 1X1BA 1WJCA 4BY7J 2J5OA 3VSLA 3DEEA 1R0BG 4F7UF 3PSIA 2KL4A 1YFNA 1P6RA 2CQXA 2TRTA 3P9KA 2ZPGB 3R60A 2ZNYA 3B6CA 3BTCA 5B3SH 2BVMA 2VN2A 3W6VA 1O3TA 4BY1J 4IURA 2KFDA 2R7WA 1SD6A 1R8OB 2BOLA 9ATCB 1W2BA 3C94A 2WV1A 1MH3A 4II3A 4IHVA 5F0CA 4B09A 2LJ1A 1R1VA 1RLQC 2C6YA 2PLYA 1X69A 5LL6S 3H0GJ 4LG3A 2AXLA 2FB7A 1R5HA 1M30A 2Q2EB 2R7TA 1ITYA 3CC4Q 3VS5A 3K4JA 3CMAQ 1BR1A 2BZTA 4I02A 2YUPA 4J9IA 2DO7A 5HK0A 2ID3A 2ZPIB 4JRIA 1UHMA 3HBLA 3SZTA 3WG9A 3IRRA 4XLAA 4F92B 2R7RA 3O5ZA 4XLNF 4IUVA 1W5TA 3CC4A 1FWZA 1U9NA 1IXSB 2IBDA 1ZREA 2HOTA 3S16J 3CO7C 3FWEA 1RI0A 1F36A 2JJ7A 3TDZC 3WGHA 2PQWA 3OYYA 2H09A 3J80E 4MMKA 4PCQA 1YOVB 4N9IA 1K4SA 1WHJA 4BI8B 3AL0B 2LTPA 1EF4A 2FEZA 3QKJA 4FE7A 4V2SA 1JUSA 1KGSA 1IN6A 4EPCA 4AFQC 1Q86C 3FF5A 2L5QA 2VXEA 1K4US 4NNJA 3ZMVA 3F72A 4PSWA 3PT9A 5KNLA 2DEQA 1ZTRA 2NUTA 2KQRA 3KP7A 2EQUA 1VQPQ 3WHCA 3KEOA 4A6DA 4HQEA 1RZ4A 2COMA 2K5LA 3IV5A 1Q82R 2CZ1B 3RCOA 3U23A 4II2A 2MIOA 4M73A 3M58A 3M0SA 4EMKA 3TW6A 2CQ7A 1XD7A 1AWJA 4JK1X 5B66C 1ETOA 1QVFP 1IRZA 3MP8A 2R92J 3D5RC 2KE9A 1JO8A 3TO9A 2JQ7A 2BE9B 3R4KA 3M56A 2IS4A 2QGGA 4AYBN 3WTSC 3H0HA 2YX7A 2ZC2A 2WAFA 1W4SA 2ZCFB 2UWMA 2O6GE 5E8IA 3JTGA 2BE7D 3WG7H 2DA9A 3CC4I 2DFFA 4BXXJ 1M2VB 3H5RA 3GYHX 2K57A 3CMAI 4DEXA 2UUZA 1K1ZA 3PQJA 4IHWA 1AT1B 3RPUA 1UECA 1VYUA 1YJWA 1QMCA 2KMTA 1AOJA 3UPUA 3M1EA 1QLYA 1QNTA 2R7ZJ 3P8BB 5A0DA 2A05A 1YI2Q 3QWXX 3FXUA 2M51A 4L59A 2ZMEC 2GZWA 1E3PA 1BCOA 2G6FX 3O8GA 2QCOA 4BYYA 4LFUA 1U78A 3VYRB 2L89A 2VVKA 1Y6IA 2NUPB 4WXHA 3VJPA 3DBHB 3BCBA 2QQ9A 1DPUA 4ZGDB 2A36A 4QIWN 2RJCA 2FE3A 3AT1B 3HOTA 4BY6B 2X98A 1R6RA 1UB4A 3QPHA 4OMFB 1WWXA 4XQFA 3L2VA 2DL8A 2XG8D 1P92A 5BQTA 1Q81C 1IC8A 2LDMA 2ZSHB 4MGRA 4D5CA 3OB9A 5EZGA 1G4DA 3MN2A 2AS5F 1QCNA 5C44J 2GXBA 2G3RA 2VGMA 3CC2Q 1GV5A 4R79A 1ENHA 2EA4A 3RTRA 1VQPI 2LVMA 4A54A 1YHQT 3KETA 3FIFA 1VQMA 3PNTA 4RLQA 4HPQA 4M6XA 3TBIA 1VNDA 1SAXA 5KYNA 1Y8QB 2ZBKA 1SRLA 4RUGA 2PMZA 3GBQA 1YG2A 4ZGJB 5DD8A 2VQGA 3IHUA 4G7OF 1IF1A 2ZJPF 4HOBA 1VTNC 2EILH 1T33A 2VB6A 4LGWA 3BJ6A 2DTIA 3Q1JA 4C5GA 4ZGEB 1YIJT 2Y75A 5LLQA 2BY2A 1RUNA 2X1CA 4JZ3A 3CCEA 4ME7A 1OMIA 1WIEA 4LG0B 4KMFA 4OMPA 1XX5A 2MD5A 1ZSGA 3H9GA 1WPKA 3VB2A 1IN5A 2M9UA 1U06A 5LJ3d 3CTAA 4R55A 5FD6A 3ISPA 2V8KA 1YI2I 4NQWB 4M7DA 3GTLJ 3I53A 2ZXHA 3HG9A 2RQPA 3VEPA 4EJWA 2GAUA 2COZA 3JB9F 1Z9ZA 2L9NA 3RKXA 4KUIA 3JB9J 1VQ4T 1BIAA 3V7SA 4V2FA 4OB0B 2LNVA 3GNFB 3OYFA 2JRTA 2X1DA 1Y96B 3VV0A 2P4WA 2UXXA 3DKXA 3E6DA 2KRNA 1W2BP 1YFHA 2GQQA 2WAEA 3A8OB 4D8KA 4MEYF 4PGGA 5HLIA 3T1BA 1FEXA 5IOYA 2E4HA 1W1WE 3TO7A 3RZOJ 4M7DE 2KT0A 1B59A 3CC2I 5GAMh 5J1UA 1V5EA 4ORZA 2QYOA 4XU0A 3JAMR 2E10A 3I56Q 1GV2A 2HL3A 1PRLC 2MABA 4CYCB 1BN5A 4ESJA 5CVRA 3JRHA 2DJZA 2ZFWA 2XF7A 3ZMSA 3N5BB 2HQRA 3F8NA 5J3LA 2FEIA 3M57A 3KEYA 4M9SA 2Z3YA 3QPLA 4AM3A 3CC7A 1J75A 3DTEA 3MMYB 2IA0A 2DPPB 4KULA 1X3ZB 5CVIA 2KAFA 2NWMA 1ZSZA 1SD7A 4ON0A 5FLXR 2VBYA 2KEAA 1P7JA 2RV8A 1X6GA 1FYLA 2QEXT 3DWLE 2LCCA 2MUNA 1WJ5A 1ZLJA 2XDDA 3EFOB 1X1AA 2NVYJ 5GAN7 2IEKA 3S6WA 3RYRA 3KZIC 5LGTA 1QVPA 1Y57A 2ZPFB 4FSXA 2DERA 4LLLA 2DCEA 2RK1A 3J7AF 2V1DA 2ELHA 2W85A 3CMYA 2DPUA 2MOXA 5IT9Z 3UKGA 4IL6C 2BKDN 2R57A 5CKTA 3L42A 3ZMZA 1B72A 2KYBA 4LE9A 2CW8A 4RAFA 4QPQA 3FXOA 5F1JA 5K5RA 3K70C 3LGLA 1BC7C 5GAN2 1BBYA 1Q95G 3EH1A 4C5EA 4F04B 4LDYA 4IVNA 4C0FA 3QWLA 2LQNA 3IAM2 2CG4A 3OIOA 2QWWA 3PL8A 3W3CA 5D5XB 4M72A 1N6AA 5GANh 4C92G 4A12A 3M1CA 4KT6A 1MUZA 1G3TA 2KJBA 2QLZA 3AKZA 3EFSA 4CZCA 3I56I 3MD2A 4B44A 3GTJJ 2A6TA 3KIOA 4MEXF 3IP4B 3MKDA 5J4VA 4U7BA 3ZPLA 2RM4A 4GFBA 1W36D 4CCJA 3OW2A 1UHWA 4UHTA 3LX7A 3GTOJ 1XSVA 4QQDA 5HNHA 2HNHA 3REAB 3W2AA 5B1AH 4UXNA 1FLIA 2JVGA 3NFCA 3A03A 3TEDA 3LSPA 4JJDA 2M4GA 3CBMA 3E7LA 3HIFA 5BOXA 3E1SA 2JM8A 2FQ3A 3LA2A 4XOPA 3FMQA 2JSCA 3MKZA 4MDWA 1X1CA 5B1BH 2LVSA 2O4XB 1TU0B 2RNJA 1JRIA 3M54A 3M8FA 2ROLA 3HFOA 4IUUA 1DGWY 3U1KA 2CSQA 4PJOC 3CLOA 2DRMA 1XMKA 1EX4A 1PYVA 2FL7A 1XMXA 4XORA 5F04A 3WVEB 3F8MA 2VKEA 3TQ7P 3IRQA 2HQ5A 5ICEA 3GTKJ 4UY8I 3VS2A 4G6TB 3NTHA 2AZVA 3BE3A 1V29B 4C8QG 4PK4A 1K7AA 1T08B 2Y90A 1GUUA 3L2QA 1JJ6C 5GAOq 2VQCA 1IHVA 2MI6A 2CMPA 1MJAA 3MHXA 2R7FA 3J7AW 4HVVA 1YS7A 2VBZA 4XK8E 1HW5A 4OB3B 5KYUA 5L3GA 1SSHA 3OS5A 3CMET 1UFMA 2KK4A 3GCMA 1W5CC 4EMHA 3BDDA 5DD4A 4L5EA 3GZ6A 4HBLA 2CQQA 2KIUA 4XU3A 1W2BS 2QVOA 2GQVA 3KYCB 1OV3A 2WACA 4B9WA 4QVCA 1M1KU 2VPLA 2SEMA 3PUBA 2H27A 1QW1A 2E3IA 4BJ5C 3RQIA 2STWA 1RUWA 2JOYA 4IIMA 4M75C 1BOAA 1OPCA 1O3QA 4J9EA 2RB6A 3LSIA 4BE1A 4PJJA 5CKBA 3L9FA 4NL3A 2JTFA 3VS1A 5LJ5f 2MAMA 3VODA 3DEUA 2CSIA 1K61A 4RDUA 3BWGA 3S15J 2KRCA 3MP6A 4HSRA 3EUAA 5A2QK 2VKVA 1KFZA 4Y92A 1AVZC 2W4SA 1TNSA 2E7XA 1GDTA 4G7ZF 2GBYA 4LN2A 2M16A 4Y28E 1D8JA 4B47A 5J8FA 3TKYA 5BPDA 4HLYA 1JJ2S 1N9SA 3WTXC 2HEQA 1ZARA 1OOTA 1B9MA 3OMYA 3FXMA 3ZRGA 3OS2A 2RAEA 3KCCA 1V55H 1X75C 1P7IA 4BHPA 2VT3A 4J19A 3HEFA 1LNXA 1WJEA 2L2OA 5E8GA 1C0MA 2ZCWA 4RCBA 2R3SA 4IOCF 2LMJA 4GBQA 5GAOp 2VBXA 2X9DA 3KP2A 3G4ST 1BIBA 3NTKA 2EK5A 4M71A 1Z91A 3Q0VA 4B48A 2QTXA 2DETA 5DM7R 1YX3A 2RNGA 1REPC 3BW1A 2E34A 5AIQA 1TXQA 4AT1B 3S3OA 1ZBJA 4XLHA 3MEVA 2DOEA 1T98A 4XKVA 3PTAA 3JTHA 5DS9A 2A08A 3S1RJ 5C4XJ 1OU8A 5GAN3 4HF0A 4NC8A 2DAOA 2KRFA 2FBHA 1ETQA 3FMSA 2IW5A 2M35A 1H8KA 2E64A 3HPHA 2CP3A 2QKMB 1I3AA 4I76A 2HWVA 2XDPA 4MDXA 2MWPA 5EEAA 1M3CA 1FXXA 2QG9B 1JUMA 4F7UE 4KN7X 1OULA 1NZ9A 2X4HA 1HD3A 1XTDA 4NUBA 4Z88A 3JCMJ 2FD5A 3A0HC 2P7VB 2R5MA 2K79A 2MPXC 4RMOA 4Z02A 1R9TJ 2H8HA 3VS7A 3CCST 5DCFA 1H92A 3QIIA 1N75A 1DUXC 4LB5A 1BW5A 1Z1DA 3GZNB 4IJAA 2KSSA 3OBYA 4V2GA 4EM2A 1FYMA 1C6VX 5CCAA 4IO9F 2L9RA 4A69C 3CXCA 4PKCC 4CYDA 1XQHA 2V4JC 4F7UA 4M7AF 3CCUT 2VXDA 3K4KA 5FO5A 2XROA 2E12A 3F6OA 3H5AA 4IXAA 4OB2B 2A68F 2VE9A 2LZ6B 1NLPC 1T0FC 2PX9A 3Q0WA 2QBYA 1XGNA 1X2KA 3M0QA 2RI3A 2JA5J 2XSJC 5GANg 1JJ2A 1LNWA 3FHZA 4BXFA 1FYKA 1K6OA 1WA7A 2AHQA 5K7HA 2OTJQ 3DQVC 1RESA 1VFCA 3FRNA 2RHUA 4QWQA 5KHDA 3G73A 1RACB 3JV3A 5LJ3e 2ZFUA 1TQPA 2E2IJ 2XRNA 1RL2A 5HCKA 1M1KC 2OTJA 1YCYA 2Z9OA 2PJRB 3S2HJ 3SFIA 1KD1U 2CGPA 1K78B 2JN0A 2ZKZA 2RPNA 2K9LA 2RMOA 4B9XA 5GANf 2EPFA 3EGUA 3ZFJA 4ABZA 5DLOA 2P5LC 1FP2A 2B8AA 4CRIA 5K5QA 4G8XA 2Q0OA 3FXRA 2MH2A 2XPVA 5EGOB 4IZZA 3ZP5A 3ZQLA 5J3BA 4PFOA 3ROUA 1T56A 1RABB 2O5RA 3GF5A 5GAMj 3F6VA 3BZKA 2XUBA 3DF8A 2K2VA 2QDYB 5IT3A 2GF7A 3Q9VA 2X4JA 5IHKA 1LEAA 2IXSA 4C3IJ 3CF2A 1R36A 3P9IA 4HCKA 4ELYC 3CD6T 2RF0A 4KH0B 2Y0SN 1R71A 3RMQA 4AIHA 3IKTA 3K1NA 3JCMW 2DI3A 2L9VA 2EYWA 4BHCA 2H1LA 3BQZA 3BR3A 2ZMEA 5E20A 2RQWA 5KYWA 2DVEA 4F16A 4N4NB 1YJNT 3GF2A 4C2TA 5DTDA 1TW3A 1YHQQ 3AHUA 4Z8AA 2J06A 2IRFG 1S72A 3OL4A 3D1NI 2V9KA 1B34B 2L3QA 4B3XA 2Y4XA 1RAAB 1Z21A 3EG9B 2LG4A 1QZZA 1EIFA 2HBWA 2K3XA 2DBKA 3URGA 5ICGA 3G71T 3WTTC 5GAOm 1WH5A 2ECBA 2NS8A 3FM3A 1G59A 4AUXA 4IHXA 2CUEA 5IOZA 2V8JA 1LJ9A 3BP8A 3TU4K 1V4RA 1OYYA 7AT1B 2QF7A 2OPTA 1YIJQ 2BBYA 4B6MA 2MD0A 2QTVA 2Z16A 1U5TB 5HS7A 1XGOA 2KR3A 4LXCA 2EGCA 1ETYA 3L00A 2A5WA 2LX7A 2GLOA 4Y13A 1EH8A 1HC8A 5FJ8J 3HOVJ 4QQ6A 3R61A 4IRIA 5IN1A 1YIJA 4HYEA 3RPUD 2F1LA 1KQ0A 2IJLA 3LSKA 5GANj 5H6RA 5D6YA 3FDRA 5HKCA 3VPRA 3AAFA 2L7MP 1VQOI 1F4KA 2X6YA 1VQ4Q 1HK9A 2NXNB 1TWFJ 4A3IJ 1MIJA 4GO1A 3C2GA 1IUFA 3W6JB 4B1RA 3E9FA 4DZPA 1V3FA 3A5ZB 5CQXA 4C3JJ 3BR2A 1XC5A 3QSUA 4LJZF 4DJAA 2QSFX 1O7LA 2CT4A 1AWCA 2EJRA 1JHFA 3BFMA 4M77G 1IRFA 4CA0A 4D7NA 3VKIA 3SWNC 4H4KC 4A53A 2HXIA 4ZZDA 1VQ9T 4M7DC 4BEHA 3FLGA 1NYGA 3M0UA 1EJ9A 2RDPA 1LVKA 3FIWA 2BYVE 2IGNA 2XAGA 4RGXA 4XLEA 4XKWA 4LB6B 1YHQI 3A52A 1E7OA 1PSFA 3NPFA 2UV1A 2J7IA 5A2QE 2YS9A 1GCQC 3PIOA 4DOVA 4RB2C 2QGUA 2LR8A 1H3ZA 2VKDA 3ZBDA 1ZLKA 2DA5A 4MQ9F 2KKOA 3ABUA 4NHJA 1KD1C 2HAXA 3OSSC 3I54A 1HSJA 4OMLA 4HF1A 1KIKA 2IA1A 1YIJI 1AKHA 4BD3A 1CKBA 1QWEA 4N4IA 1HSTA 4KGVB 2XPWA 4L0ZB 1VIEA 2OTLA 2ETHA 2GTJA 4CCKA 2QEXQ 3M0PA 2K9NA 2ELKA 1WHLA 4E47A 2KRHA 5IT9K 1TQIA 4Y3OA 4RB1A 1WVRA 2BW3B 2VJ4A 2Y9ZA 9ANTA 3LLRA 3ERED 1YITA 2WSCE 3NWSA 4Y91A 1K8AU 1AU7A 4M78B 4PNOA 3I5SA 3CUQC 1JHHA 3EHRA 5FB2A 1I8FA 4XTZA 1KU9A 4GYIA 2DDBA 3QODA 1VQ4I 2YR2A 3HFNA 2X51A 2FBIA 4LLGF 1JT6A 5J4YA 3OBWA 4OMNA 5IHIA 1KC8U 4LK1F 4BE0A 1RIOH 2X3WD 4BHBA 4XLCA 2BTTA 5CKFA 1T38A 2RI5A 2E19A 2EJ9A 3EGXA 1LEBA 4UC4A 2HQEA 2F4IA 4DBQA 2XAHA 2LKPA 6PAXA 1BU1A 2QI2A 3JCMf 3I4NJ 4U88A 1WLPB 3OYAA 2IT0A 2P5KA 5B5EC 3NEUA 2YUQA 3EG2A 5KCHA 2HDDA 2CUZA 2G9WA 1ORKA 4DYCA 1KU2A 1J5YA 5DCMA 3D5SC 5K7FA 1GCPA 2P0TA 4BJ6C 4R1HA 3H1CA 4MTDA 2EFIA 2GBQA 2OI3A 3MP1A 2GQIA 4HT9A 1H0MA 2Z33A 2D45A 3INZA 5E1WA 2HDWA 3HHHA 4DA4A 3DEWA 5LRRA 2LKXA 4HF2A 1GL5A 4XOTA 2IGKA 3S17J 4RKUE 5FW9A 2KIMA 3JB9I 4J9DA 3PNWC 2O8KA 4M3EA 5KYXA 1IGQA 1X19A 4CCLA 1GHCA 2W1OA 2LF8A 2EB7A 2F5VA 5D8LB 1NHAA 1WQ7A 2F5CA 1YW9A 3UT1A 3FKIJ 4S04A 3CPFA 1VQNT 2QEXI 5M5XJ 1VQKT 1SVLA 3K0LA 2DZ9A 4LDVA 1D5VA 2KDOA 2EAYA 4KUDK 2LJ3A 4CXFA 1T39A 4JP0A 3VWBA 2PZ1A 3VUZA 3OV8A 1KQ9A 3S32A 5GAN5 3JRZA 3HSEA 2LDUA 4XLFA 2K3BA 1WJBA 2HXOA 2XF5A 3QO3A 1WJDA 1EV7A 4B43A 5IT9R 2WTEA 5ILVA 3UA6A 2X0LA 2EQJA 2O61A 2ADUA 3F21A 4PJOA 3CP8A 3X24B 2A07F 1I5ZA 1PVEA 1TW2A 2DXCA 3ZOBA 4M77D 1WI3A 4DIQA 2L2PA 1R23A 4MIMA 2FZGB 4OMYA 1ABOA 1NG7A 2NUTB 3E3VA 2AKLA 4RBOA 1S1NA 2DK3A 2K27A 3CMEQ 1C1AA 4JZ4A 3JCMX 4C92E 5E17F 2ZSIB 2CZ7B 4A4KA 1X58A 3OOPA 4OOIA 3SQNA 2AKKA 4OMMA 3EPZA 4EMKB 3ZQCA 4LD9K 3E6BA 1XPXA 2IS6A 5LJ5g 3CMEA 1PUEE 3GVAA 3ASOH 3PNVA 4RLFA 1CGPA 1JXMA 4PLIA 1ETVA 2XGXA 4ZZLA 2D0QB 2JUCA 2L7KA 2JPBA 3HOYJ 2XB5A 2DK5A 1ZA1B 2P4TA 2ZPBB 2P4RA 4N4HA 4FQGA 3JRBA 1PUFA 1Y8RB 1WRJA 2HDCA 5FU6B 2P7CB 4PLLA 1Q7YU 4ZJZA 1TG0A 1FMKA 4TV7A 3ZGKA 5I2SA 2JMWA 3B02A 5GAN4 2JK3A 2RO0A 3LSGA 1FNNA 1UGSB 1OLTA 3RKWA 3F0CA 5A0GA 1KYWA 1R4NB 2EKOA 1M4ZA 3PGGA 1K8AC 5GAN6 3KYLA 3DXJF 2LJ0A 4O3MA 4M75A 4E70A 2CQNA 2J6FA 2D1HA 5GMKm 2B9SA 4UVAA 3OYBA 2DX1A 1VQ5T 5H20A 1KC8C 5FGMA 1UEBA 4BDYA 3H3ZA 4XLPF 1SF9A 3I5RA 3SFMA 5JI6A 3IH3A 2EQKA 2LQ8A 2E36A 5GMKi 3MCZA 2D0NA 1W7PD 5LGUA 1HA8A 4C8QE 3CCRI 3VYGA 4J01A 4ESRA 4LK0F 1JXSA 4I99C 5E3MA 3LA3A 5CAIA 3G4SQ 3KP6A 4HZFA 3HL2A 4RAYA 1QWFA 3Q9SA 2X48A 4IKFA 5GAMg 1ABQA 4A4FA 3HHGA 3OR1C 4XMYA 4QSHA 3CMEI 2VBWA 3WE3A 2X9HA 2CV2A 3KXTA 3KYDB 2LBFB 1G5VA 1FYNA 1Z0XA 2MWOA 5D6WA 4AFUC 1FBUA 1RKWA 3G4SA 3L7WA 5J1YA 2PVDB 5LJ3h 3TSZA 2DA7A 5AONA 3NWTA 4YIRX 2F5KA 3HM5A 1YJ9T 2HEOA 3LFKA 3ECHA 1WXBA 3VS3A 2MC3A 2BHYA 1KA8A 1YTYA 3UATA 1IXDA 3M59A 3CMAA 1JXOA 2FF4A 3CP2A 1AWWA 1K76A 3HOWJ 3X20B 3HZJA 3CCSQ 3CC7T 2OUMA 1OZ2A 4YFNF 4U7DA 1HW1A 2QYZA 1LDKB 3LSHA 3MFKA 2M0YA 4EMSA 3PJRA 1I07A 2VWFA 1K83J 5D5UB 5LD2C 1GXIE 2M0OA 1GVDA 4J7FA 3K2AA 1GFCA 3CCSA 4JYKA 1B8IA 3J7AY 4DNCA 4RG2A 2XD0A 3CCUQ 1A6IA 4AFZC 2HS5A 2ZXIA 2NRAC 2EJFA 3I9QA 2HI3A 1EFNA 3X25B 1UJ0A 1A6QA 5TGTA 1NYFA 4JUVA 3BR0A 4DZJA 1EKEA 2KIQA 2R5YA 4NS5A 1EH7A 2GXAA 3CCJT 1B6AA 1S7AA 1QCFA 1R49A 2RHZA 1BI2A 5KAIC 3SDBA 5FKMA 3OYKA 2GCXA 1VQPA 4FW1A 3BZCA 2RA2A 1TOVA 3RNJA 3PVQA 2LKSA 1R1TA 5F27A 2XIGA 3G4SI 4JRKA 3EDPA 2HPIA 1ZGJA 1Y71A 4XICA 2F6CA 3OSFA 3IKVA 1AZGB 1JE8A 2IPOB 2JM9A 2QA4T 2DOAA 4LD5A 1XGSA 3FXKA 5C4JJ 4MZTA 1T0FA 4MNUA 2W48A 5F08A 2M7BA 2B86A 3EGDA 4M7AE 1KZHA 1V76A 2F48A 4LUDA 2XICA 1OCPA 2X1EA 3T8TA 3V4GA 3F3XA 3VYUB 4KT0E 4WX9A 3ZMTA 1VOMA 2N8GA 2F69A 4W1UA 1OQKA 2QASA 1MMDA 3MPUB 3BR6A 1IV8A 2O03A 3HSRA 2GNCA 4A63B 2ESNA 1GT0C 1M1GA 1VQOT 3C4SA 1Q7YC 1U3EM 2CP2A 3BPXA 4HVWA 1ZSZB 4EV0A 4M7AA 1X6BA 2L0AA 4IHSA 4OGEA 3CCSI 2CH4A 1M9SA 1OCZH 3D0SA 1D3BB 1YI2A 3SD4A 3CD6Q 3K69A 1ZUUA 2COBA 5GMKl 4XTYA 3FM5A 5DLQE 3EHQA 5JLXA 3JAMK 3L2WA 4H0EA 3F70A 3TSWA 2K3YA 3RBBB 1QVTA 1WCMJ 2JS2A 1Y1WJ 1E3HA 1W4MA 3CCUI 4M78E 5DM7F 3BOQA 4C2MJ 4U87A 1HCRA 1RAHB 1SHFA 1UE9A 2DVJA 2XDBA 3K4NA 2LMDA 5FD5A 2DM1A 1YJNQ 2FX0A 1SC7A 1B72B 3UF4A 3HUGA 2R5ZB 2PN6A 3LOCA 3Q0UA 2BUDA 4FYYB 2A3SA 1VQ6T 4OIRF 3DBLB 1B07A 1JKOC 3JRAA 4M77B 3CC2A 1RI7A 1TLHB 1ZGAA 1NLOC 1YJNA 5FLXK 4ASNA 4A3JJ 1O3RA 2JA2A 1BI0A 3IUOA 4G6QA 2CUFA 1IXRC 1Y39A 1IO6A 2OQRA 4P9UA 1LUJB 4Z89A 4A0ZA 2EBPA 2YRCA 1M5Q1 2DK8A 3MO8A 1RAIB 2CP6A 1MMNA 2V6EA 4YIFA 2KJCA 4ETSA 1ETXA 1F1BB 2K7AA 2QSHX 1K4TA 4OF1A 4FT8A 3IWFA 3S8PA 4FSSA 3W6KB 1IUYA 1CF7B 1WHUA 2Q2EA 4PFPA 3JRIA 1B4AA 2E65A 3MZYA 4EJOA 5GAN8 2DU9A 2ABLA 4FTHA 2DIQA 1IXCA 4ZTJA 2DMTA 1TBXA 2O4XA 2EPDA 4OP0A 2AQFA
chains in the Genus database with same CATH topology
3HYIA 4M74A 4XTUA 3WU1B 4C0DB 4KIGA 1USTA 1U8RA 3HTUA 2V9VA 3WXMB 2XAJA 1SD4A 1G3WA 3R6SA 4HW0A 1BKBA 2L3RA 5CKEA 4J7IA 4EJUA 5FFXA 2L8DA 1W7PB 2YSRA 3BDUA 5HOOA 1ZG1A 4KICA 3I56A 2LSOA 2W24A 3HSBA 4DQ2A 2JUFA 2Q8KA 3QOPA 3SWNA 1J59A 4M7DA 2V79A 2GFUA 1I27A