1BI2A

Structure of apo-and holo-diphtheria toxin repressor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
214
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
total genus 61
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bi2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1bi2A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bi2A03
1BC8C 3F8FA 3EETA 3NQOA 1W7PB 3V8LA 2JSCA 1FC3A 3GFMA 2PFBA 1Q1HA 2WV0A 3I58A 4KNYA 2D1HA 2VXZA 3BOQA 1LDDA 1SFUA 3KP3A 3HHHA 4ESBA 1ZRFA 4Q47A 1J75A 3O6BB 4RB2C 1MDMA 1B6AA 1XSDA 5K5QA 2JRTA 1UHWA 4Z2YA 2QZ8A 4CHUA 2K7LA 1BOAA 5LHHA 4G8XA 4OU0A 3J80K 4ETSA 2F5DA 1BI3A 2DW4A 4LK0F 1BI0A 2QM3A 1VTNC 1BBYA 2VE8A 2L4AA 3ZP5A 2FE3A 3DPLC 3WTVC 1BC7C 1LEAA 2XAFA 3TQNA 1X3UA 3RYPA 3BPVA 1FBUA 2KJBA 4B09A 4EJOA 3ZN0A 3K1PA 4HV6A 3ZPLA 4RAZA 4Q4ZF 3HSFA 1QGPA 4HOBA 3WU1B 2RKHA 2VONA 3JSOA 5HS7A 5BS6A 1Z6TA 3I4PA 5H6QA 3GEZA 1FOKA 5D4RA 1YS7A 3K1NA 2PEXA 4CO8A 3QAHA 4RB1A 2OQRA 2FA5A 1WRJA 1B4AA 4KYWA 3ELKA 3SZTA 4QWQA 5HS8A 2J5OA 2A6HF 5LEKA 4ENKA 3C7JA 5LRRA 1ZG5A 2V1DA 1MJAA 1S29A 2Z99A 2QQBA 5A2QK 1AWCA 3FX3A 1KQ8A 1KYWA 5DCFA 2K5IA 4PGHA 1TQPA 4HBLA 1T98A 1FPQA 1ZH5A 1FNNA 5ILUA 2VT2A 3O3KA 1R58A 1TNSA 3BWGA 1F1ZA 4WCGA 1PUEE 3GVAA 4U0VA 1XDUA 3R61A 1CGPA 4OMYA 5BPDA 2VBZA 2VBYA 4K2EA 1LDJA 1KU2A 5ED4A 3LQRA 3G73A 4A6EA 2E1NA 2DQLA 1SFEA 4GGGA 2F5CA 2TDXA 4Y15A 2X4HA 3KP6A 2LX9A 3FMQA 4KMFA 2VE9A 4UVAA 4XLPF 2XAGA 1RUOA 2L3DA 3RKXA 3HOTA 5LEJA 4LMYA 2Z33A 2EFOA 4WF2A 4A2UA 1K78B 1HW2A 2ETHA 3J80Z 3ECOA 5E8GA 2DK8A 3RYRA 3K9TA 2YX4A 4YFXF 3J7AO 2A07F 4FT8A 3BJAA 2XHKA 2ZCWA 3TKYA 2NRAC 4M74A 4LB6B 2ISYA 2R7DA 1G6NA 3WGHA 5HDGA 2AS5F 4FX4A 3QPTA 2ESNA 4R1HA 3T0YA 2YPRA 4KIBA 2O6GE 3WGGA 4ZYDA 4I0BA 3G3ZA 4BNCA 2BGCA 2VODA 4OIOF 4KUMA 3HSEA 2DI3A 5E18F 4AWXB 2QUFA 3CO6C 3F8NA 1IXRC 1V4RA 4L9NA 1EH8A 3B02A 3QP5A 4RGXA 3V4GA 2FBHA 2BE5F 3WTZA 3MZYA 1T2KA 3BJOA 3FMSA 3DP7A 2XAJA 2C6YA 4AIJA 4WXDA 3I64A 2DTRA 4IRHA 5H20A 2FOKA 1ZLKA 1UHMA 1YG2A 5A2QZ 2FSWA 1J2XA 1C0WA 1XMAA 1I27A 1UFMA 1I1GA 3ZMVA 1IRGA 4MGRA 2P5VA 1P4AA 1W5SA 4HF0A 2O03A 1XB4A 3SQNA 3EQLF 1BYMA 4KN4X 3IKTA 2H94A 4MEYF 5E8IA 2MC3A 4I0AA 3L9FA 3CUQA 4XLNF 3E6MA 4EJWA 5JI6A 5FFZA 5DCMA 1ON2A 3K0LA 3AAFA 4R8HA 1QVPA 4UVBA 4IXAA 1IZ1A 1U5TA 1ZN2A 2NAZA 1F5TA 5DUIA 2OBPA 4GCVA 3M7GA 1FP2A 1MJBA 2E7XA 1RUNA 3MQ0A 3FF5A 3WGIA 1YTYA 5D5UB 4N9HA 2CWEA 2BYVE 1RZ4A 5CLSA 1U2WA 2V1UA 2R3SA 5CVJA 3ZN1A 3HUGA 1PDNC 2WTEA 5DD4A 5LBQA 3KP5A 1A04A 2E7WA 1TQMA 1WWXA 2VC0A 4DQ2A 1OYWA 4LLNA 1L0OC 2F5EA 4ZH4F 1YW9A 4KDPA 3K2ZA 4IJAA 1BI2A 3K69A 1O7LA 2NYXA 4G7HF 3QU6A 2CSOA 1ZLJA 2QBYA 4Y13A 3Q5FA 1U3EM 2COMA 4PGGA 1FZPB 2EK5A 4HA8A 3E19A 4ZYGA 1I1SA 1J9IA 2XIGA 3GUDA 1SD6A 1EH7A 3U2RA 1B9MA 4HQEA 1E17A 2ELHA 5FGMA 3W6KB 3BPXA 3F8MA 3KCCA 4MNUA 3T8TA 3GZ6A 3NEUA 2YU3A 1FYKA 4E70A 2HTJA 1ZGAA 3L00A 2BV6A 2LF7A 3L7WA 4A5NA 4BHBA 4UNOA 1MDMB 3RPUA 4H0EA 4HYEA 2DAOA 3KZZA 2KIMA 3R60A 2HYGD 5IT9K 4WX9A 1S7OA 3ISPA 2VC1A 4MQ9F 3N4MA 2GCXA 1XGSA 2HGCA 3VB2A 3R0JA 2JPCA 2MD5A 1KU9A 1ODDA 2NS0A 1TW3A 5CVRA 1J59A 3DQVC 5FFXA 3REOA 2V79A 4N0BA 5HDNA 2W24A 4HDUA 2HQNA 3F3XA 4IPAA 4OIRF 1R1VA 1XGNA 3E3VA 4L9VA 2ISZA 3F6OA 3E6BA 1REPC 1TNTA 4UHTA 1ONVA 1K79A 3L09A 4HDVA 1CF7A 1ZG3A 2KIUA 3SXYA 4UXNA 5L3DA 4LLGF 2YSRA 1T6SA 3ABTA 1EV7A 4I2OA 2IP2A 1IN4A 3WTTC 1S7AA 2EV0A 4I02A 1ZG1A 2B0LA 5CVUA 2XKOA 1F4KA 4MEXF 1Z91A 2HQRA 2HR3A 2M30A 2VBWA 3ECHA 2GZWA 3M9AA 2GIVA 3FM3A 5EEGA 2VN2A 4BAYA 2QENA 1IN8A 3I53A 1H9GA 3VOEA 1SD5A 2KIFA 1O3RA 2LSOA 1TLHB 2M8EA 3DXJF 3FXQA 3C18A 2ZJ2A 1EH6A 1W5TA 4EV0A 2VT3A 1DPUA 1ZRDA 5JVTA 4ZYEA 4EMSA 1F9NA 2IA1A 1SMTA 3CJNA 3E6DA 3WU0A 2EV6A 2NNNA 2A5YB 2G7UA 2QWWA 3D5LA 1FSEA 4UVCA 2OA4A 2A3SA 2K5FA 2XV4S 3C1DA 1R1UA 5AIPA 2A6EF 3FMRA 3CLOA 1OKRA 2FF4A 3RTRA 3ERED 4O3MA 3F8CA 5TJJA 4R79A 4KT5C 2PQ8A 4G94A 4JBAA 3DV8A 1HXDA 4KFCA 1D3YA 2RVCA 5KK1A 1QQIA 2MLGA 4DNCA 2YR2A 1IN7A 5LGTA 3T1BA 3JAMK 4U0WA 4HF1A 2DBBA 4LLLA 1UB9A 3KZYA 4NHJA 3P7NA 4TV7A 5IT9Z 1BIAA 2Y0MA 2K86A 1GXQA 4HLYA 4I98B 4IHTA 1P4WA 1R23A 2RGVA 4CZZA 1YYVA 2HWVA 3P9CA 1B1BA 4UV9A 3TO7A 1LQ1A 2D2WA 2MH2A 4BYYA 1HBXG 4QLCU 1S8NA 3S2WA 2DT5A 2P4WA 2VOPA 3VODA 3RKYA 2HZTA 2W84A 3M8EA 1FP1D 5LLQA 1WSUA 1ZHFA 4LG0A 3FZVA 3DPTA 5DYMA 3IHUA 4A0ZA 3I5UA 5IT3A 4L5IA 1TBXA 3JTGA 5H6RA 2EJRA 1W7PA 5LHGA 2Q0OA 2OZUA 5ILSA 1R00A 1O3SA 4P9FA 1TW2A 4M72A 1IRFA 3OOPA 2FMLA 1TQIA 3V7CA 3QOPA 2EFPA 1YQAA 1Z6RA 2FBIA 3SHFA 4BHPA 1JXSA 2CFXA 4IVNA 1BJAA 1NHAA 4CGZA 1P6RA 2A61A 5HS9A 1QNTA 3GF2A 4ZZDA 3MCZA 4RS8A 5JHUA 1GVJA 1O7FA 3K1MA 3HTUA 1SMYF 3LSTA 3JSPA 4XSXF 2VBXA 2DU9A 5D6FA 4U7DA 2L01A 1KU3A 3TO6A 2RNJA 2H6BA 4OMZA 2ESHA 4A12A 3CUQB 1USTA 2QQ9A 1G4DA 5DCMB 1G3WA 1U78A 5DD8A 4P5OA 4RB0A 2HKXA 4D0PA 4OIQF 3WTXC 2GXBA 5ERIA 1DDNA 3TOAA 2O3FA 1JHHA 3WTWC 2RQPA 1U5TB 4BHCA 2J5PA 5J6XA 4L9TA 2Q8KA 3FXRA 2V9VA 2IW5A 2RV8A 2LNBA 4I01A 4L0ZB 4MTEA 1G3TA 3GFIA 4EM1A 4EM2A 2K02A 1ZYRF 3P9IA 5L3BA 5D6EA 4RGRA 3JAMZ 4LJZF 3IRQA 5HLHA 2DK5A 1FY7A 2XROA 2NNYA 2JT1A 4BQAA 5ICGA 4KIFA 1XCBA 3MAJA 3PQJA 1LDKB 1R1TA 3ML6A 2HDCA 2QBYB 2OU2A 4BXUA 1MKMA 1XGMA 1MD0A 4RGUA 1YIOA 1TTYA 2QYOA 5BPIA 4OIPF 4HF2A 1XCVA 4HV5A 2L4MA 3M8FA 5D8KB 2HEOA 2ZXJA 4KIGA 5DDGA 4ESFA 1P2FA 3DF8A 3E97A 3J81Z 1STZA 4U0YA 2ZKZA 2MH9A 2X0LA 1FYMA 1HW5A 4L9JA 3L2CA 4F7ZA 2ACJA 3GLXA 1AOYA 4NB5A 4EQQA 2ZMEB 1V3FA 5FLXZ 4ON0A 2PLYA 4M9ZA 5CYVA 2Y75A 3CO7C 5ICCA 5LHIA 2EFQA 4BH9A 2IPQX 4XBFA 3HRUA 3H3ZA 3R6SA 3FHZA 3CDHA 5E17F 2M87A 1HKQA 1FT9A 1HSJA 1QW1A 1SD4A 2Z9OA 2PMHA 1LB2A 1G3SA 1T0FA 1R5GA 3H92A 3BJ6A 2GAUA 2W85A 3LA3A 1DP7P 5D5WB 2FNPA 1CF7B 5D4SA 2DPUA 1L3LA 2Z3YA 2W57A 3NRVA 1QZYA 5ICFA 4XSZF 3D0SA 4FX0A 1ZGJA 2FXAA 2V6CA 3KP2A 3HHGA 1P92A 3I59A 4PCQA 1Z1DA 3Q9SA 1BIBA 1PP7U 4LD5A 4RGSA 3GX4X 1FLIA 3MEXA 3F22A 4O6JA 2EWNA 1PP8F 4G9YA 3WE2A 4HLXA 3DKWA 3V7SA 2BEOA 5BOXA 4G7ZF 2HFHA 3GFJA 5F6FA 2P7VB 3HSRA 2H09A 4JK1X 1RIOH 3IWFA 2ADUA 3KLOA 2WC2A 5EEHA 1R22A 3OV8A 2CG4A 3GYHX 3HRSA 2HYFA 1S3JA 1S6LA 4GYIA 1UCRA 2FBKA 5E1WA 3BROA 4L18B 4M6YA 1JHFA 2YX7A 4FHTA 3LAPA 1USSA 4U7BA 4S05A 2QVOA 3EUHA 2GWRA 5JFRA 1YLFA 1GXPA 2XKPA 1Z9CA 4LGWA 3BDDA 2FMYA 2QQAA 2GQQA 2IRFG 4EJTA 1KQ9A 4XRFA 3TDZC 1U8RA 1BN5A 3GWZA 4IF4A 1WKMA 3ROUA 3HTSB 1U6GA 2FRHA 5FB2A 3KEQA 1I5ZA 1XSXA 1HSTA 4MQVA 4YIIA 4HX4A 2L02A 4Y17A 1IXSB 2ZFWA 1ZARA 1QZZA 4AIHA 5L3GA 1OMIA 1YO5C 5CJ9A 2KRFA 5E1XA 2CO5A 3WE3A 5AIQA 3U9GA 2IA2A 2MA3A 2HOEA 2IVMA 4LG0B 3CTAA 5J8FA 2EV5A 3LQQA 2Z5UA 1W4MA 1B59A 4IRGA 1YW7A 4EJVA 2M45A 4IHSA 5LRSA 2H27A 1IW7F 1ULYA 2JTVA 3IC7A 2XUBA 2K4YA 2H3JA 2F2EA 1OYIA 2V1XA 4CYDA 5K5RA 3VFZA 1IXCA 2A69F 4MHGA 4YFKF 3I0TA 1K6OA 3T5XA 2IT0A 4KMUX 1Y0UA 5D8LB 3KP4A 4LB5A 3CUQC 3QRFF 2PN6A 1HW1A 3QP6A 1YFHA 1XN7A 4UUVA 4M9SA 1IF1A 4A5MA 4KICA 3ABUA 1U5TC 1XD7A 4YG2F 1IAWA 1IN6A 3KETA 2AXLA 2P6SA 3F8BA 4OOIA 4GYGA 1HQCA 1KQ0A 3P9KA 4YIFA 1ON1A 2M5WA 1K7AA 3FM5A 2DO7A 1B9NA 1GHCA 2PI0A 2XVCA 2UXNA 4RAYA 3ZMUA 3GO5A 4PZJA 4EM0B 5HVQC 1ZREA 2STWA 4MTDA 5HDKA 2FEZA 3R0AA 1XSVA 3M1EA 3WODF 3WTSC 2LKPA 2FU4A 1FX7A 2ZNYA 4N9IA 1MGTA 3MWMA 1FYLA 3IRRA 2A68F 1J7KA 5E20A 3F72A 1JE8A 4GO1A 4CXFA 4OINF 4HX8A 2G7HA 3GZ5A 2P7CB 3RI4A 2O8XA 3W6JB 4I09A 1IN5A 3JTHA 4S04A 3J81K 2ZBKA 4NQWA 2IJLA 5TRDA 2D1VA 3C3WA 1D5VA 3FWEA 2XGXA 2KKOA 4ZYHA 4IRIA 5J8CA 4AD9A 3I54A 1P4XA 5FLXK 3LA7A 5FD5A 1H0MA 3F23A 4HQMA 1QO0D 3BY6A 1T39A 3EYIA 4RB3C 3F21A 4M73A 1LEBA 2P8TA 4O5VA 3GFLA 4G6DA 3WTUC 3HRTA 2OQGA 2ZNZA 3LA2A 3O2PE 1LNWA 3SZPA 1BI1A 2RN7A 3WG9A 1YS6A 3BP8A 1OR7A 1W7PD 3IL2A 3HOSA 4L0YB 3MHXA 2EFNA 3ULQB 2LDUA 1YW8A 4P96A 4JQFA 3RJPA 1Z7UA 3IKVA 3JW4A 4ENMA 1OYYA 1ZAOA 3TO9A 5FO5A 1DUXC 1KYZA 3MFKA 1J0RA 2EB7A 1I6XA 3E5XA 2GA2A 2RC4A 5DV5A 1R7JA 3QU3A 4U88A 2W25A 1KGSA 2CW0F 5ILVA 2XASA 1XDSA 4ZZLA 3IWZA 3DFGA 5E1ZB 2D45A 1LJ9A 1MJ9A 1QPMA 2O0YA 3KEOA 2JZYA 2XAQA 3E6CC 1SAXA 3PQKA 2EFWA 1T38A 2GA1A 4B8XA 2EA4A 4GXOA 3E5UA 1JGSA 3I59B 5ICEA 5HOOA 1ZRCA 4CICA 2K5LA 3ZMTA 2MBFA 3VEPA 5L3EA 2DPDA 4EJUA 4LK1F 1Z05A 1FBQA 2JPBA 1J5YA 3TOBA 5CVVA 2E1CA 1RI7A 2Q2EA 2ZO4A 3V7RA 3H3UA 3I71A 3LFKA 2F5FA 2EA2A 2FQ3A 5BMZA 3HIFA 4HW0A 4I7HA 3ZQ7A 5HLIA 2WWYA 3TDUC 4M6XA 2CYYA 3RDIA 5L3FA 3KE2A 1K78A 5LGUA 4LFUA 2OZ6A 4A0XA 3QPHA 5AONA 4KN7X 4EGYA 5HLGA 1O3TA 1KU7A 4WXHA 3KP7A 5LGNA 2HTSA 4WWCA 2K27A 3B73A 3T8RA 2PG4A 5K5OA 4WK8F 5D5XB 4Q5SF 2DQRA 4YFNF 3HRMA 2R7FA 2P6TA 2L54A 1BM9A 4M9XA 3DEUA 3RKWA 2CGPA 3COAC 5D5VB 2HKOA 5F1RA 1HKSA 1FSHA 4L5JA 4KA4A 2VOOA 3MZHA 2BBYA 2QLZA 1WQ2A 4AIKA 2P5LC 4G6QA 3SFZA 4A0YA 3RIRA 1QBJA 2K4JA 1D8JA 5JR3A 4ENJA 1R36A 2PMUA 1O3QA 6PAXA 2UZKA 1O57A 2OAZA 4EVIA 4P9UA 3HYIA 2K4BA 1G3YA 1D8KA 4HX7A 1DPRA 5BQTA 3LAJA 2O61A 3U1DA 3F6VA 3V8KA 2HS5A 3E5QA 1IUYA 3KFWX 5KVRA 1FBSA 2UWMA 3EYYA 4G7OF 4UV8A 2STTA 2ZMEA 2MLKA 2XRNA 3RPQA 1RNLA 4AVPA 1HKTA 2G9WA 1E2XA 2OD5A 4M71A 1XGOA 5CVIA 5K1YA 4A6DA 1H9TA 2FNAA 1SFXA 3TGNA 4ESJA 2UXXA 5FD6A 4PDKA 1FWZA 1WI9A 3ZMZA 4Q48A 3FXUA 3ZMSA 3LWFA 1LVAA 4HAMA 3PFIA 3GW2A 3N97A 1R5HA 2PBIA 3V8JA 4P55A 4EGZA 2Y48A 1MZBA 5DUKA 2DFIA 1KA8A 3KLNA 3WTYC 2KJCA 3ZMDA 4HZFA 2PJPA 1XMKA 4ASNA 1OPCA 3GXOA 3R4KA 2CQKA 2LF8A 2XAHA 5F64A 3CUOA 3Q9VA 4CDGA 4ENNA 2P5KA 4WXCA 5L3CA 2H6CA 5DEQA 1SD7A 2IA0A 3BZ6A 2RDPA 2M1BA 2GXGA 2DLLA 3EDPA
chains in the Genus database with same CATH superfamily
3X24B 4F3QA 4CRIA 1BC8C 3F8FA 1M8VA 3EETA 2DA1A 3NQOA 1W7PB 3V8LA 2GIZA 4PK4A 5EGOB 4HKEA 1NK2P 2JSCA 1FC3A 3GFMA 1D5YA 1WPKA 2LREA 2PFBA 3OYYA 3OYGA 1Q1HA 5J40A 4GFBA 3DKYA 1Y7XA 2DD5A 3HTRA 2WV0A 3I58A 2Y69H 4NQWB 4KNYA 2D1HA 2VXZA 2QSHX 2M7BA 3BOQA 1U0JA 1UELB 4F04B 2CMPA 3ONQA 2YU9J 3MPUB 1LDDA 1Q82C 1SFUA 4C8QD 1UHSA 3KP3A 4XLAA 3K70D 4FYYB 3HHHA 4EEFG 5A0GA 4M78B 2DTOA 1P7IA 4ESBA 1ZRFA 1FTZA 4M75D 4HNTA 2QEXQ 1A0NB 2YS9A 2VVKA 1E3HA 2L5QA 4Q47A 1J75A 3O6BB 2RQRA 5GAOm 2QTVA 1PJRA 4RB2C 2EQRA 4B44A 1MDMA 1B6AA 1XSDA 2CJJA 4XK4A 1SFOJ 4AUXA 5K5QA 2C0OA 3N5BB 4BY6B 2ID3A 2JRTA 1UHWA 4NNJA 4Z2YA 1QWFA 3UA6A 2QZ8A 1GRIA 2MVTA 2EW3A 2AQFA 3P8DA 2WSFE 2EPDA 4CHUA 2Y4XA 2GTOA 3LL7A 4Y52J 2K7LA 1BOAA 2RA2A 1JJ2P 2EVRA 3IUOA 3W2WA 4IHXA 3LNQA 5LHHA 4G8XA 2D9TA 4OU0A 2IGOA 1MUZA 3J80K 4ETSA 4J9EA 2F5DA 1BI3A 2KT0A 2DW4A 2ZPIB 4LK0F 4M7DC 1BI0A 2QM3A 4RAFA 5CQEA 2VJ5A 1BBYA 2VE8A 2L4AA 2XRLA 3BZKA 3ZP5A 1VTNC 4IKFA 5M5WJ 1IO6A 2RK2A 1XC5A 3GP8A 2JN0A 2FE3A 1QPIA 1EKEA 2R0QC 3QSUA 2EPFA 3VYGA 4XU1A 1WGSA 1KHCA 5GTIC 1OCZH 1RKWA 2KDOA 3DPLC 5C4XJ 2F1LA 4KJZA 1FMVA 3G6EA 4PJOE 2HBPA 3WTVC 3A8GB 1BC7C 5KH6A 1LEAA 5M5YJ 3RDVA 1IREB 3RR6A 4ZGDB 1M90R 1VQ7A 2W4SA 3MN2A 2XAFA 3IH2A 1YJWT 3QO3A 1V5FA 1OLTA 3TQNA 2DOFA 2HOTA 4U87A 1X3UA 3RYPA 3CCUA 3CC7A 3SYTA 3PIOF 4XLHA 3BPVA 2B7EA 4PJ0C 2K57A 2ZPGB 1FBUA 3L2ZA 2KJBA 4B09A 1JU5C 5FJ8J 1K73C 2VLAA 4EJOA 1XMXA 3ZN0A 1IV8A 2JRMA 1IUFA 1R9TJ 4OF1A 4OMPA 4D5CA 3I9QA 2E34A 1PC0A 4BY7J 3TP3A 3K1PA 3SEZA 2DA2A 2QQ8A 5KHDA 5FU7B 4PJOG 3OW2S 2BW3A 4HV6A 3L2VA 2KIQA 1Y1VJ 1H641 3ZPLA 4RAZA 3G71T 2BY1A 3GPLA 1T0FC 4Q4ZF 3TEDA 1K4TA 3S1NJ 3A8MB 4J19A 3HSFA 4EMGA 1QGPA 3I4NJ 1IDYA 4HOBA 3WU1B 2RKHA 1N75A 3E7LA 4E7LA 2VONA 2QA4A 3JSOA 1VQ8Q 3C2HA 1DGRM 5HS7A 1Z6TA 5BS6A 3L2UA 3I4PA 2BZYA 2LQ8A 1KC8R 2M0OA 4MO7A 5H6QA 5HKCA 3GEZA 1OX8A 1YHQQ 3DLAA 1FOKA 5D4RA 1YS7A 3K1NA 5F27A 3KYCB 3KIOA 3ME9A 4LXCA 4J83A 4C2MJ 1NEGA 2MWOA 2E36A 1R0BG 3H0IA 1D0XA 2PEXA 1Q95G 4M4ZA 1M1KR 5LL6S 2XDPA 4M7DE 4ZNXA 4CO8A 3QAHA 4BACA 1RAAB 3CBOA 4RB1A 2EGAA 2OQRA 1NG7A 4ZC3A 2OI3A 2FA5A 3QOEA 1D3BA 2YUQA 1WRJA 4OP0A 2V4JC 2CV1A 1B4AA 3RZOJ 1IGQA 2LCCA 5GMKj 4KYWA 3ELKA 3SZTA 4QWQA 3U1KA 1IGNA 1I50J 3GNFB 5HS8A 2J5OA 2A6HF 2DT7B 3CP2A 5JVGF 5LEKA 3CCMQ 4ENKA 2IPOB 3C7JA 4AC0A 5LRRA 3VUZA 1V54H 2JMCA 3LFUA 3PIOA 2X6YA 3OL3A 1FOXA 1ITYA 2XMFA 1ZG5A 2V1DA 4IHYA 3O8HA 4M7DG 1MJAA 1S29A 2Z99A 4X1EA 3ZXSA 2K9GA 3OR1C 3CCRA 2QQBA 5A2QK 5D6WA 1AWCA 2AHJB 1X6BA 2RPNA 3OQ5A 4LD6A 3FX3A 1KQ8A 3VS5A 3J81E 1KYWA 1BW6A 1X19A 4JX5A 4M3FA 4DYQA 5DCFA 2K5IA 2L89A 4CH7A 5GANe 4XQFA 2XDBA 4PGHA 1TQPA 4HBLA 1EA3A 1T98A 5IOZA 4E7HA 1FPQA 3HOWJ 1LNXA 1M5Q1 2LJ0A 4L6V5 1ZH5A 1FNNA 5ILUA 1A36A 2QDLA 2ZZDA 2VT2A 2VGNA 2PUKB 3CXCP 2QAZA 5FKLA 1XS9A 3O3KA 1M1GA 2LVSA 3FLGA 4D1QA 4ZYAA 4FT4A 2BHZA 1R58A 3CP8A 5BNGA 2K2MA 5DLOA 1TNSA 3NFCA 2OTJI 1O4XA 4X9CA 1VQNQ 3M0SA 5FLXE 3BWGA 2Q1ZB 1F1ZA 3DBLB 4WCGA 2RN8A 4F7UE 2K9QA 1PUEE 3SDZA 3DBRB 1FIPA 3GVAA 4U0VA 4XN3A 4CA0A 5ECAA 2YRDA 2Z2SB 2ZB9A 1XDUA 2FPFA 3J7AY 3H5RA 3R61A 1QKWA 1CGPA 4AVZA 5BPDA 2VBZA 3CC2I 4OMYA 1W1FA 4IUTA 1NJIC 2VBYA 4K2EA 1QVFP 1UGSB 2FOWA 1LDJA 1PNJA 1W0TA 4M77F 3OYFA 3JRZA 3AHUA 4GDFA 1UFFA 1IZ6A 2HDDA 1KU2A 2K40A 1PWTA 3UWNA 2CH0A 5ED4A 3JCMQ 2OCEA 3OYAA 3LQRA 4F7UG 4DZJA 1R4NB 3G73A 1E6GA 4A6EA 3WVEB 2X51A 1AKHB 3QZ5B 1KQSS 2E1NA 1ZHIA 2NVQJ 2XD0A 2DQLA 5M3FJ 4QQDA 4OAYA 3AG2H 1K8AC 1SFEA 2VQHA 2Q2EB 4JDSA 2A5WA 4GGGA 1N8RC 1T95A 2F5CA 3K4NA 4KGXB 2DTHA 2TDXA 1I3AA 4Y15A 1Z21A 3PO3J 4C92B 3QDRB 4BEHA 2LD5A 1RI9A 2X4HA 3KP6A 2LX9A 3FMQA 4PJJA 1M1FA 4KMFA 1PRMC 3OSVA 2VE9A 4UVAA 4RKUE 4ZGJB 4XLPF 2DRMA 1HCRA 3ZQIA 1QRYA 2EGCA 2L9RA 2P4RA 5EJCA 2MZ4A 2CUBA 2XAGA 3A1YA 3EUHC 4C2UA 5FRNA 1S72A 3JCMP 3L1AA 1Q86C 2RQTA 2RQWA 2COYA 1VQ9A 1RUOA 1G5VA 1IDZA 1WJ5A 5CKDA 2DXCA 2L3DA 1TP4A 3RKXA 3SEQA 3HOTA 1GCQC 1YWPA 2A05A 3B6AA 3M58A 4M7AG 4YEJA 3M4YA 1QVGP 5LEJA 2NUPB 1W4SA 3G2BA 4LMYA 2EKHA 2Z33A 3LYIA 2EFOA 3JCMJ 2L9NA 4WF2A 3CF2A 4A2UA 4C5HA 1SF9A 1K78B 2LRDA 4J5YA 1HW2A 4LIUA 2E19A 4M75C 5JLWA 1AZEA 2ETHA 5E8GA 3ECOA 3J80Z 1X43A 2DK8A 3RYRA 3EHQA 4M78D 3K9TA 2F4OB 2IG0A 2YX4A 4YFXF 3J7AO 4PJOF 2A07F 2DCEA 2YXYA 3NTIA 3CC4I 4FT8A 4GBQA 3BLYA 3BJAA 2XHKA 2PMZA 2ZCWA 2K9NA 4XU0A 2L0KA 4M77A 2DT6A 3TKYA 5LJ3f 2NRAC 1VQ4A 1VQKT 1Q81U 4M74A 4LB6B 1QA6A 1SEMA 2QG9B 2XKOC 3X20B 2LNVA 3H5NA 4JRQA 4KRTA 2V8KA 3FHNA 5KCMA 2ISYA 2R7DA 1JKOC 2MI6A 1G6NA 3WGHA 5HDGA 4E7SA 3IAS2 3RZDJ 2AS5F 5CKBA 2DKGA 4FX4A 3MEVA 3UDCA 1NYGA 2YDLA 3I55T 3I35A 3QPTA 4JJBA 4XTUA 2ESNA 4PSWA 3G4SI 4NL3A 4R1HA 3T0YA 2YPRA 4KIBA 2O6GE 3WGGA 2E10A 4ZYDA 1X1AA 4I0BA 5I11A 3G3ZA 4CYCA 4BNCA 2BHYA 3FDRA 2QF7A 3U23A 2BGCA 1ETKA 4XKVA 3OYNA 1DGWY 2VODA 3MO8A 4OIOF 1JT6A 4KUMA 3GCMA 4IO9F 3CCJA 1SPKA 3HSEA 2VJ4A 2DI3A 2QDYB 5E18F 3PJRA 4AWXB 1ABQA 1VIFA 1QCNA 2LRQA 2AHQA 2QUFA 3CO6C 2VXFA 2E5ZA 3ZGKA 2P4TA 3F8NA 4S0HB 5GPAA 1IXRC 1V4RA 1PUFB 3JAMR 4L9NA 1EH8A 3B02A 3ERMA 3FK6A 1KSWA 3QP5A 4IUUA 5J4YA 1KC8U 1MGQA 3ZCOA 5J3LA 1TC3C 4RGXA 1KZHA 2WAQN 2R92J 2WY8Q 3V4GA 2FBHA 4N4OB 1HDDC 5LD2C 3RNJA 1RAHB 2IXSA 2C0IA 1LE8A 3AG4H 1YI2T 4M75E 3RBBB 3CJTB 3CCEA 3AKZA 2BE5F 2E70A 1M1KU 3CCQT 4RLQA 1QHGA 2H8RA 3HOUJ 3WTZA 5E3NA 1WH5A 2X6OA 1A6QA 5LJ5h 3MZYA 2DA9A 1CQTA 1U5SA 2E41A 1YX5A 2A6TA 1T2KA 4ZDLA 3BJOA 2XIDA 3FMSA 4A3CJ 3DP7A 4CCJA 4PJOA 3FXMA 5B5EC 2XAJA 2C6YA 4JX4A 4AIJA 4WXDA 3I64A 5GANj 5H2FC 3GTJJ 2DTRA 3URGA 1VQPA 4IRHA 5H20A 4Q5WA 2FOKA 4M75G 5FKKA 4OMLA 1ZLKA 1UHMA 2F5KA 5LJ3g 1H8AC 1OU9A 1PHTA 5GANd 3QWLA 1YG2A 2DZCA 4E6KG 5A2QZ 4RTYA 3HGYA 5IHKA 1UZCA 2SEMA 1JQQA 5GMKl 1KHIA 1RR8C 2FSWA 2VJIA 1J2XA 1C0WA 1XMAA 2MYSA 5C44J 2CZ6B 1I27A 1K9MU 1VQ7Q 3AT1B 1UFMA 2MPXC 2X3WD 2O9VA 1MIJA 4J9DA 3K4JA 1I1GA 4M77D 4RTWA 4BI4A 3CCUQ 2O4XA 1LKXA 3ZMVA 3CC7Q 1IRGA 1YIJA 4F7UF 4MGRA 4XL9A 2P5VA 1P4AA 1W5SA 4HF0A 2O03A 1Y96B 4ANJA 1FJLA 3EFRA 3L2RA 4A4GA 1XB4A 4IHVA 2BOLA 4JX6A 3SQNA 1VQLT 4KGZB 4QPQA 3EQLF 2RNGA 4ZN1A 3GTGJ 4CC4B 1BYMA 3BR3A 3J7YJ 1FYNA 1YBYA 4KN4X 2JK3A 2D6FA 3IKTA 3HFOA 4A4KA 1HDPA 2H94A 4Y7NJ 1WJSA 3ZQHA 4KUDK 4MEYF 5E8IA 3S15J 3UT1A 3MP8A 2MC3A 4I0AA 3PT9A 3L9FA 2WSCE 4M7DA 4B9XA 2QA4Q 3NWSA 3S93A 5GAN3 3CUQA 4XLNF 4CCNA 5EEAA 5HLTA 3E6MA 2IS1A 3HBLA 1SHFA 3C95A 3FKIJ 3AG1H 4EJWA 5JI6A 1VYUA 2KEAA 5FFZA 5DCMA 1ON2A 3UNGC 1OCCH 1ZSGA 3PVLA 3K0LA 2K9LA 3AAFA 1HK9A 1RI0A 2WACA 1AWOA 2RJFA 4R8HA 2ZJRF 1QVPA 4GLKA 4RMOA 4UVBA 4IXAA 5EG0B 3G71A 5CKTA 2AZSA 1UECA 2KHMA 2DMNA 4A3IJ 4A3JJ 1QQJA 1IZ1A 1U5TA 2W1OA 1ZN2A 4F91B 2NAZA 1YRNB 1F5TA 2R5YA 3QODA 2O8KA 2LBFA 2FYKA 3MEAA 4M7AF 2QYZA 5DUIA 2OF7A 2OBPA 2F2XA 3CMAA 1VQ5I 1MHNA 2HPMA 2CRGA 1B7TA 1Y0NA 2G0EA 4FTHA 4A3KJ 2V1RA 3KYDB 4GCVA 4IOAF 7AT1B 1R71A 4J9GA 3M7GA 1FP2A 1MJBA 4B47A 2DAQA 4C8QB 2P0WA 2E7XA 1RR7A 1PVEA 1APLC 1RUNA 4AM3A 4OB3B 4ESRA 3MQ0A 3FF5A 5J47A 1SHGA 3JRCA 4QVCA 3WGIA 1YTYA 1VQMI 3MCAB 2BXYA 5D5UB 3AL0C 1OU8A 4N9HA 3HHTB 2IAIA 5KYYA 3KXTA 4LDXA 3E1SA 3K7AJ 1X27A 2CWEA 4A69C 2BYVE 1VOMA 1RZ4A 3ER0A 4L5EA 5CLSA 1U2WA 2O9SA 5FWCA 2V1UA 1MBFA 1M90C 1QKXA 3VS0A 2WAFA 3VYTB 2R3SA 5CVJA 2KNBB 4F7UA 3ZN1A 5GAOl 3PO2J 3HUGA 2CUZA 1PDNC 1NZ9A 2LMJA 2CP3A 2RB6A 1EZZB 2WTEA 4IQ4A 5DD4A 3ULRB 4DOVA 5LBQA 5KE2A 3KP5A 1A04A 2JVVA 2E7WA 1TQMA 3MD2A 1WWXA 2VC0A 4XKBA 4JRKA 5LJ3e 3K4CA 4DQ2A 1OYWA 2Z16A 1VQ8A 2Z1DA 1L0OC 4LLNA 2HBWA 2KROA 2JNGA 2F5EA 5IP7J 5CR2A 2PVDB 5FU6C 4B48A 1RUWA 4ZGEB 4ZH4F 4BE1A 3TEEA 1YW9A 5FKNA 2ZJQF 3K2ZA 3N05A 4IJAA 1JKQC 4KDPA 1BI2A 3OMGA 1V29B 1TUCA 2CS3A 3DTEA 3K69A 4QVZA 1O7LA 1BOBA 2NYXA 4G7HF 2KT1A 5A0LA 3QU6A 2CSOA 5DTDA 2FO0A 2HZDA 1JJ2S 1ZLJA 2QBYA 4Y13A 2VUMJ 3QKJA 3Q5FA 2AKKA 1W6XA 1U3EM 1W36C 3QZ9B 1XTAA 4V2SA 3F9KA 1IG7A 3OSSC 5K7HA 3QG1A 2CUFA 2KRMA 1Y6IA 2COMA 5KYUB 3IH4A 4PGGA 1FZPB 4RTVA 1ZUUA 4M78C 1YITI 2YWWA 1E3PA 2EK5A 4HA8A 1DU6A 3E19A 1LFPA 4ZYGA 2PJRB 1OX9A 2E6NA 4M7AA 2OTLI 1I1SA 1J9IA 4N4NB 2XIGA 3HOVJ 1NG6A 2I2LA 2JSPA 2MABA 3LX7A 3PTAA 4BI3A 2MSYA 4BY6C 3BQZA 3R6OA 3GUDA 1SD6A 2CQNA 2XPVA 1EH7A 3U2RA 1B9MA 1V55H 2JM8A 4HQEA 3A8OB 4KBMB 3LSJA 1E17A 3QDFA 3S1QJ 2RI2A 2ELHA 3LGLA 4E7KA 1J3TA 1E0EA 5FGMA 3MKDA 4GLMA 3W6KB 2KQRA 3BPXA 2NUTA 3F8MA 3CCST 2DA7A 3KCCA 4MNUA 4J7IA 3T8TA 2DYBA 5L8RE 3T9NA 2ZXIA 3GZ6A 3CC2T 4P1WA 1GVDA 3NEUA 2NVUB 2YU3A 1WIEA 1S72Q 1FYKA 3MEWA 2CQXA 4E70A 4LUDA 2HTJA 4RTXA 5HCKA 1ZGAA 3REAB 1D1BA 4A4EA 3LW5E 1W2BS 5B1BH 2V7FA 3ESWB 3L00A 2BV6A 2LF7A 4HCZA 3L7WA 4AT1B 1RLPC 3CD6I 1MMSA 2HCKA 1D0YA 4A5NA 2KR3A 1SVLA 3JCMe 4BHBA 4UNOA 4JZ3A 1T3LA 1MDMB 3VJPA 2DMUA 3HPWA 1F43A 3UATA 3RPUA 1UUEA 2DL5A 4H0EA 4HYEA 1EF4A 2DAOA 2ZXHA 2AO9A 3KZZA 3Q0UA 5EZGA 4IQJA 1OQYA 2KIMA 3R60A 2DL8A 3DLMA 2HYGD 5B3SH 5IT9K 2R58A 4WX9A 2QGFB 2DZ9A 1S7OA 3ISPA 2X35A 4JYKA 2VC1A 4MQ9F 3SJMA 3CPWA 3IQLA 4X9DA 3N4MA 2GCXA 3ZRGA 2AQEA 1XGSA 2HGCA 3VB2A 4R56A 3R0JA 2CYZB 2Y90A 5FW9A 2JPCA 2LY9A 2MD5A 1KU9A 1IC8A 1VQ4Q 1ODDA 2NS0A 1TW3A 4LNPA 2DDAA 5CVRA 5FU7C 1J59A 2RHIA 4UUSA 5GAN5 4PJLA 1OR7C 3DQVC 3JRFA 1M3BA 1LUJB 5FFXA 2MUNA 3REOA 3EHRA 4A4FA 2V79A 2HZYA 4N0BA 2E64A 5HDNA 2W24A 4HDUA 2HQNA 1WXUA 4PL6A 2QKMB 5GJVB 3F3XA 4IPAA 4BBRJ 4BDYA 3GIBA 2RHUA 3KFVA 3TL4X 1VUBA 4C0GA 3EG3A 3VV0A 4OIRF 1R1VA 2J6KA 1UGVA 1XGNA 3E3VA 1MH3A 1M8MA 2L3SA 2HNIA 2E1MB 1SANA 4L9VA 4OMFB 3JCMX 4A3GJ 2ISZA 2H8WA 4E7JA 1SVOA 3E6BA 3F6OA 1REPC 2RHZA 1VQKA 2LTPA 1TNTA 4J8OA 4UHTA 1ONVA 1K79A 3L09A 4HDVA 1CF7A 1IHVA 3CCJQ 1ZG3A 2KIUA 3M57A 2AK5A 3O5ZA 3SXYA 3UF4A 4UXNA 1RADB 2DA6A 2L3PA 2VKVA 5L3DA 4RUGA 4LLGF 3FJPA 2XDDA 3CC4T 3CXCS 5C0MA 2YSRA 1T6SA 2L7KA 3ABTA 2R7WA 2ZSHB 2IGNA 1EV7A 2BW3B 2EZHA 4X0GA 1PSFA 4I2OA 5FU6B 2IP2A 1IN4A 2VQGA 4XLCA 1K4US 3H9QA 2RQQA 3WTTC 1S7AA 1JTYA 1UGQB 3MVPA 2EV0A 4N0AC 2R7TA 5L23A 4I02A 1NK3P 1ZG1A 4B9WA 2B0LA 5CVUA 3QUIA 2XKOA 1F4KA 3CCEQ 4MEXF 1Z91A 2KQWA 4RM2A 3CDIA 3QPSA 2HQRA 2XB5A 2ENMA 2HR3A 2QKLB 3D7SB 2M30A 2R4GA 1POGA 3CPFA 4IEJA 2VBWA 3OYJA 3LSPA 4JLIA 3S2DJ 2YUNA 3ECHA 2GZWA 2CV2A 2MF2A 2HXIA 3C2GA 4D7MA 2DFEA 3M9AA 2GIVA 3FM3A 5EEGA 2VUBA 3H9NA 4M3GA 1D3BB 2RF0A 2VN2A 2DXUA 4E7IA 4BAYA 2QENA 3O8GA 1B8IA 2DNUA 3A8HB 1UGRB 2E5QA 3KPHA 2VPLA 2O31A 1IN8A 3I53A 1H9GA 2EZLA 3VOEA 3CCQA 2DMTA 1ZR4A 2E6ZA 1SD5A 5CK9A 5LJ5f 2KIFA 2DL4A 3S3MA 1O3RA 2DEUA 2LSOA 2A3LA 2D1XA 1YJNI 1TLHB 2M8EA 2KAFA 2PVOB 1KD1R 3MP6A 3OW2A 3DXJF 1EIFA 2RD1A 2M0YA 3FXQA 1IRXA 3C18A 2ZJ2A 2GTJA 1T33A 1EH6A 1BW5A 1X01A 1VQKQ 1W5TA 4Z8AA 3S6WA 3W2AA 1YIJQ 1VI0A 4EV0A 2VT3A 1DPUA 1ZRDA 1A6IA 5JVTA 2E1HA 2XF5A 4ZYEA 2QGGA 4EMSA 2LP5A 1F9NA 2IA1A 5GAOn 1SMTA 5C3EJ 3C12A 4H4KC 3UR3C 1JB0E 3H6ZA 3CJNA 1ZSZA 3WHBA 4CCMA 1R6RA 1R49A 3E6DA 3WU0A 1UDLA 4XRSG 1X2KA 4FT2A 4BXFA 4XTZA 2WSEE 1XPXA 4DOWA 1QVGS 2EV6A 2NNNA 2A5YB 2G7UA 2XB0X 4JJNK 5D7UA 3M1CA 5I21A 1YN8A 1H3HA 2QWWA 2OPTA 1FSEA 1S7EA 3D5LA 1HF0A 3JSCA 3M8JA 3SWNA 4RCCA 4C92C 1Z3XA 1BR2A 1WJFA 2OA4A 4UVCA 4OMNA 2A3SA 2K5FA 2R5MA 4QQGA 2XV4S 1VQLA 1NTCA 1Q7YU 1RKTA 3C1DA 1R1UA 5AIPA 4PLLA 2A6EF 2BZTA 3CLOA 3FMRA 3VYRB 2LC2A 1OKRA 1ZKGA 2NXNB 2FF4A 2OJ2A 5GAMh 3G71Q 2G6FX 4PKCC 3K4MA 3GTKJ 3J80E 2LR8A 3B6CA 1ZGWA 3ZOBA 5FROA 4OB1B 4IIOA 3RTRA 2F4MB 1TT0A 3ERED 1VQ6I 2B9SA 4AYBN 4O3MA 1WYXA 2RQVA 2BVMA 3M56A 3CMAQ 1Q81R 1RETA 3F8CA 5TJJA 1PKSA 1AU7A 4R79A 4KT5C 2PQ8A 3ASOH 2I8DA 1K83J 1MH4A 1OEBA 3TVTA 4XN0A 2DILA 3PUFA 1EX4A 4G94A 2LY1A 4JBAA 2AT1B 1UE9A 1SKUB 2ICWG 3DV8A 3LMMA 5IPAA 2KDZA 2DMOA 3TMOA 2KE9A 2D5VA 2FPDA 2ME6A 4LG3A 1WJBA 2FEIA 5LJ5g 2MCNA 1I6HJ 2GBYA 1KONA 4BEHB 2L2PA 1HXDA 2UV1A 3SFMA 4KFCA 1D3YA 2KYMA 1QU3A 2K3XA 3JCMd 3HP9A 2VXEA 2M2EA 1N9RA 3OB9A 1HOMA 4K11A 3JB9F 2RVCA 5KK1A 3G6EI 1JUSA 1QQIA 3HM5A 2JA5J 3S32A 2MLGA 4HRIA 4DNCA 3PMTA 4LIVA 2R93J 2YR2A 1SSFA 2IS4A 1VQ7I 1TWFJ 4G12A 1IN7A 2M34A 3FXOA 1ZLMA 4BD3A 2P81A 3H0HA 5LGTA 4BDZA 3T1BA 1I3QJ 4U0WA 3JAMK 3CCUI 4HF1A 1H8KA 2DBBA 5DY9A 4LLLA 3M9QA 3CCVT 1UB9A 2KMUA 3DPUA 3KZYA 1N6AA 1VQ5T 4E2FB 4NHJA 3P7NA 4TV7A 2WB1N 5IT9Z 1VF9A 4C92E 1BIAA 4FW1A 2M0MA 5IT9R 2HI3A 2K86A 1GXQA 2Y0MA 2EFIA 2YRVA 3EG1A 4ME7A 4WTOB 2NS7A 5GMKh 4NC6A 3CQTA 2FB7A 1KQSA 4HLYA 4I98B 4IHTA 1P4WA 1R23A 4ELYC 2RGVA 3BG3A 4CZZA 1GV2A 4ZTFA 2EYYA 3A1PA 1YYVA 3A2KA 1VQMT 3TREA 2HWVA 3P9CA 3RMSA 2QQRA 1QP3A 5KAFC 1S5LC 1B1BA 1UHFA 4ELZC 2QA4I 5HY6A 1SAUA 4UV9A 5FKMA 3H3VK 3TO7A 1LQ1A 4M77B 2LJ1A 2D2WA 2MH2A 3LSRA 4C92G 2RM4A 5DM7F 1U1SA 4BYYA 3S1RJ 3CQZJ 5CPRB 1GFCA 1JTXA 1HBXG 4V2GA 4EATA 4QLCU 1S8NA 3S2WA 3RMQA 2DT5A 2LH9A 2P4WA 2GLOA 2VOPA 2HSPA 3VODA 3H41A 3RKYA 2HZTA 2COWA 2W84A 3M8EA 1FP1D 3RQ4A 5LLQA 1WSUA 2EJFA 4XU2A 1ZHFA 4LG0A 2IIMA 4YELA 2DE0X 3FZVA 3WG7H 3DPTA 5DYMA 3GTOJ 1PD1A 2OAWA 2LT1A 3IHUA 2P0PA 2DN0A 4EPCA 3MKLA 1K9MR 2E3IA 4A0ZA 3MKWB 5A2QE 5D6YA 2JVGA 3OBYA 3L1PA 1KQ2A 3ZL7C 3CEYA 2ZSIB 1HSQA 2LQWA 1M4ZA 3I5UA 5IT3A 4L5IA 1X6OA 1OJLA 1T0HA 1TBXA 3FDYA 1AOJA 3JTGA 5H6RA 3R6NA 2EJRA 1W7PA 2CREA 5LHGA 1T56A 5EGOA 1ZUKA 2L0AA 2XI9A 2Y0SN 2FJ1A 2Q0OA 2OZUA 3CCRI 4I6ZA 5ILSA 4KUIA 3JCMV 1R00A 1HYOA 1AHDP 4GY5A 1S1NA 1O3SA 4P9FA 3FIFA 4AFUC 1TW2A 5I2MA 2EH3A 2LZ6B 1YITT 3BTJA 4M72A 1IRFA 3BR6A 3S8PA 2E60A 2YUSA 3OOPA 4A63B 2OTLT 2FMLA 1TQIA 3OS1A 1SVMA 2M1HA 2IGMA 1YX3A 3GTMJ 1TH7A 3CCSA 1LE8B 3ASKA 1MMDA 3O8VA 4HT8A 4MIMA 3BTIA 5LJ5e 1QHHD 3V7CA 1SRMA 3QOPA 2EFPA 3G1MA 2FD5A 1BBZA 3VS1A 1YQAA 2ZPHB 3M0QA 1Z6RA 3UPUA 4ZTJA 5KYXA 2CT3A 3I56A 1YJ9A 2FBIA 2XICA 4DJAA 5F1JA 2DMQA 3SHFA 3CMEI 2XU8A 5EC7A 2CP2A 1JGGA 2K9MA 3CJRB 2ZJPF 4YTLA 4BHPA 4PJOB 1JXSA 2CFXA 4IVNA 1BJAA 1NHAA 4XOTA 5M5XJ 2BY2A 4CGZA 1BCOA 3E9FA 4ORZA 1P6RA 2A61A 5HS9A 1B72A 1QNTA 4PJMA 4Z89A 4V2FA 3VKIA 1CKAA 1PKTA 3GF2A 1KD1U 3QYHB 1DP3A 4C30A 1I1JA 2Y31A 1XOVA 2JWTA 1DU0A 3JCMc 5GAN2 4ZZDA 1VQOT 3CD6T 3MCZA 3EH2A 1GDTA 2RI3A 1F1BB 4LDVA 4RS8A 4B4CA 2CU7A 2QTXA 4KGVB 2JA7J 1OYXA 2ZPBB 2MOXA 1ETXA 4J9CA 1MSFC 5JHUA 1GVJA 1O7FA 3K1MA 3W3CA 3HTUA 2QSGX 2EBPA 1T0JA 1SMYF 2LQKA 2OX7A 3LSTA 4D5FA 3CCLI 1FEXA 3JSPA 2O4XB 1FMKA 2BIVA 3CPWP 3BCAA 4XSXF 2ELJA 4C3JJ 1OI1A 4LUEA 2E2JJ 5IHIA 1OCRH 2DBMA 2VBXA 2W7NA 2DU9A 2DJQA 2LT4A 5D6FA 4N4GA 4Y92A 3I55Q 4LDYA 1AA7A 2CW7A 4U7DA 2L01A 3OR2C 1KU3A 3GMEA 2ED0A 4AMCA 3CBPA 2ZXWH 3OY9A 4BBSJ 3TO6A 2RNJA 3S17J 3J7AW 2R7UA 1JXMA 2H6BA 4C8QC 2XGEA 3K70C 1WHMA 3TSWA 4OMZA 1X1DA 2ESHA 3J7ZI 4ZJZA 2BUDA 2RHYA 4A12A 1TUGB 3WHCA 3CUQB 1A35A 3SD4A 2JXBA 2HMAA 2E3HA 1USTA 2OJED 2QQ9A 1G4DA 2KMTA 2HOSA 2NWMA 5DCMB 1G3WA 1U78A 5DD8A 4IL6C 2DA3A 1UMQA 4PFPA 2RAEA 4HPQA 4P5OA 2M02A 4RB0A 3CBMA 2HKXA 3H1CA 4D0PA 2ED1A 3LSIA 4OIQF 5GAN6 1MNEA 3WTXC 2GXBA 2BTTA 4GRIA 5ERIA 1DDNA 3TOAA 2O3FA 2VPRA 1XG1A 1XQHA 3M55A 5GJWB 1JHHA 3WTWC 2R5ZB 4F14A 2R7XA 2RQPA 1ABOA 1U5TB 2HKQB 2CZ7B 2HPIA 2JTMA 1G2HA 4XRSA 2LBFB 4DIQA 4BHCA 2J5PA 9ATCB 2E5NA 5JHFA 1YI2Q 5J6XA 2VV5A 2HDAA 4C3IJ 3G1OA 4L9TA 3L2WA 3CCQQ 2Q8KA 3FXRA 2V9VA 2IW5A 5J1YA 1T08B 2ECBA 2LNBA 2RV8A 2CP7A 2DFFA 1O9SA 2R7SA 4FQGA 4I01A 2PQWA 2Z0WA 4B1RA 4L0ZB 2XF7A 4MTEA 1G3TA 5FLMJ 3GFIA 4BKXA 1D1CA 4I76A 4EM1A 4EMKB 4E4HA 2DOEA 2CT4A 5KYYB 2VIXA 2K02A 4EM2A 1NE8A 1ZYRF 2HQAA 1JJ6C 4XNFA 3P9IA 2CZ0B 3S2HJ 2HVQA 2CUJA 3PNVA 8ATCB 5L3BA 2WAEA 5D6EA 4RGRA 3SEMA 2UUZA 3JAMZ 1U3OA 3H8ZA 2C06A 2FQ4A 4F7UB 4LJZF 4HCCA 2F2VA 4MZPA 1Q82R 3IRQA 5HLHA 4M7DF 2W0ZA 2ZPFB 2DK5A 3MZ8A 2RREA 4C8QE 2JVHA 2GQVA 1X58A 3VPRA 1FY7A 2XROA 3RQIA 1RESA 3HG9A 4JOMA 2NNYA 2HQXA 2JT1A 3QIIA 3CCJI 3NTKA 2VWFA 3ABKH 4BQAA 4II2A 5GAEJ 4DBHA 5ICGA 1U06A 4KIFA 1XCBA 3MAJA 2K3YA 1ENHA 4FU6A 2MG4A 1V5GA 3PQJA 2J7IA 3C4SA 4XU3A 1LDKB 4I99C 4AU7A 2O7OA 1YJNT 1VQLQ 3RKQA 4BE0A 3JCUC 1R1TA 3ML6A 2HDCA 2E5KA 4F17A 2QBYB 4C8QG 4AFZC 4JZ4A 2OU2A 4BXUA 2FZKB 1MKMA 2L2OA 2H8HA 2VQCA 1I81A 2BZXA 1BL0A 1IV6A 1XGMA 3HOXJ 4LDUA 1IXDA 1SFKA 1ZBJA 3CCEI 1K4SA 1MD0A 3DB3A 4RGUA 1YIOA 1GBQA 1TTYA 1ETOA 3PL8A 2QYOA 3OS0A 1ACIA 5BPIA 2KRNA 5CQYA 4OIPF 4HF2A 4M7AB 4AFQC 5GAN7 1XCVA 4HV5A 3OYCA 4VUBA 3CD6Q 4B3XA 2L4MA 2EILH 3M8FA 5KCHA 4DBQA 1HD3A 5D8KB 5GAMf 2HEOA 2JS0A 1RAIB 2ZXJA 4KIGA 4Z6YA 5DDGA 4II3A 1VQPI 2DXBA 3BDUA 5CIUA 4E7ZA 1BA5A 3BG6A 2DFUA 3LWHA 4EIKA 4ESFA 2F2WA 2ATCB 2KXDA 3M0UA 2E2IJ 1P2FA 4UB8C 2OCCH 3FXJA 1LPLA 5HNHA 2BKDN 4RG2A 3HFNA 3DF8A 3E97A 3J81Z 1STZA 4U0YA 4LDWA 3J81R 1SRLA 2ZKZA 1K73R 2MH9A 2X0LA 2XDVA 4NC7A 2HVSA 2AXTC 1UG0A 1FYMA 2FL7A 3EFOB 6AT1B 3LSKA 2DFHA 1ERDA 2XAUA 1HW5A 3MJXA 4NUBA 3BTCA 4L9JA 1QZEA 3PSFA 2GM4A 2LMDA 1LFUP 1J09A 3L2CA 1HC8A 3DB4A 3I5RA 3SB2A 2O9LA 1YJWA 1JJ2A 1VQ6T 4Y28E 4F7ZA 1YIJI 2A37A 2ACJA 1TSFA 2O88A 3GLXA 3DLLF 2JN6A 1OISA 3REBB 1AOYA 3ZR8X 1BJZA 4NB5A 2F6CA 1ZQ3P 2PTKA 4X34A 3A02A 4EQQA 2ZMEB 1V3FA 5FLXZ 3RERA 1TS9A 2E1MC 5FLXR 2QEXI 1VQPQ 1UEBA 4ON0A 2K79A 2KXCA 3ZFJA 5CCAA 3Q3SA 1BKBA 2PLYA 3OYHA 3HKZA 3QYFA 4M9ZA 5CYVA 2DJZA 2Y75A 3CO7C 2V6EA 1B34A 2DJIA 5ICCA 2ZPEB 1JBMA 3OOUA 3GTPJ 5IXFA 2LVMA 4G6TB 3F70A 2W10A 3CCVA 5LHIA 2EFQA 1VQ5A 4BH9A 2IPQX 1OCPA 4XBFA 3G6ET 1QMCA 2HQ5A 3FIWA 3HRUA 4UUSB 2NLUA 3H3ZA 3R6SA 3FHZA 1AVZC 3CDHA 5E17F 4JPBW 2M87A 1HKQA 1K6YA 1FT9A 1HSJA 5J3BA 1QW1A 1SD4A 2Z9OA 3HGGA 2X4WA 2PMHA 3C0CA 1Q81C 3VS7A 1U1TA 1LB2A 2EQJA 1G3SA 1ZELA 1VQMA 1M1EB 4FYWB 1T0FA 1R5GA 3H92A 3KZIC 1IGUA 1FIAA 1TOVA 3QXEB 4PJOD 1W2BA 3BJ6A 5IH2A 3NTHA 3CMAI 2GAUA 1A5JA 2W85A 2R7ZJ 3PUBA 2KFDA 2WY7Q 3X28B 3LA3A 2ABLA 3VS3A 3EGDA 5GAMg 2NOGA 1DP7P 5D5WB 2FNPA 4X6AJ 1CF7B 1MV3A 2K3BA 1IB8A 4BJ6C 5EF6A 4MZTA 5D4SA 2DPUA 2R7OA 4JJCA 3PIPA 4XLFA 1WI3A 2F5VA 1GV5A 3A4CA 2CQQA 2KRHA 3WU2C 1L3LA 1UAAA 2Z3YA 2W57A 3LOCA 1QZYA 3NRVA 5ICFA 5JLXA 4XSZF 3TCJA 3D0SA 4AIDA 3DEEA 5B1AH 3VSLA 1X1BA 4FX0A 2MC4A 1IRZA 2EYWA 2FRYA 1ZGJA 1M3CA 2FXAA 3G7ZA 5FWBA 3W6VA 2V6CA 2XGDA 3KP2A 4ABZA 2RH2A 3HHGA 5IN1A 2X4XA 3DLLA 2JA6J 1P92A 3QYEA 3CCSQ 3P5JA 2M35A 1R4MB 1WZ2A 1KC8C 1ARKA 2JMWA 3I59A 3M4OJ 4PCQA 3SFIA 4EMHA 1W5CC 1Z1DA 3HOZJ 1Q7YR 3Q9SA 1VQ8I 1M3AA 3I56Q 2PMZN 4AFSC 1YJ9Q 1NJIR 2LG4A 2XPUA 2DTIA 1BIBA 2Y9YA 3GNGA 1YHQI 1M1KC 1PP7U 1YITA 2EJ9A 4M7DD 4Y3OA 2KVQG 3A0HC 1UHCA 3OSFA 4J7FA 3DU6A 2CSQA 3ZQCA 2OTLA 4OMQA 2COBA 1U9NA 4LD5A 4RGSA 2X1DA 4XIDA 2MD0A 1B8IB 3GX4X 1WHHA 2KRSA 1FLIA 5DLQE 3MEXA 3CCRT 3F22A 4O6JA 1K0SA 2OTJT 2EWNA 1PP8F 2DMPA 2DODA 3JB9J 4G9YA 1K8AR 4EDUA 3WE2A 3HDDA 3CXCA 2R5AA 4HLXA 2L7FP 3DKWA 4DZPA 3H36A 2BEOA 3V7SA 2V9KA 5BOXA 3CCMI 5E3LA 2FHDA 2NVXJ 4NC8A 4G7ZF 1Z9ZA 4M75F 4RTTA 5KYWA 2HFHA 5EDNA 3GFJA 3ZQGA 3CDLA 1K0XA 2HNHA 1QLYA 1RACB 5F6FA 1LCKA 5IXBA 1Q82U 1X6GA 2PUOB 1K9MC 2K7AA 2EYXA 4TVRA 1WJCA 2P7VB 4J9FA 1K1ZA 3HSRA 1WFXA 2XG8D 2EQKA 3WXMB 3CMET 2RI5A 2H09A 4BQQA 3M59A 2CP0A 1YP5A 2J6OA 2X6XA 1VQOA 1HJDA 1PRLC 2AZVA 1ZSZB 3U21A 4JK1X 1RIOH 4N4HA 3SHWA 3IWFA 3A01A 1FOWA 4KT0E 5F0FA 2ADUA 3KLOA 2WC2A 5IYCJ 1OZ3A 5EEHA 1R22A 3OV8A 2CG4A 2VJJA 5KNLA 5K7ZA 3GYHX 3HRSA 2HYFA 1S3JA 1S6LA 4GYIA 4RLFA 3TBIA 1ZR2A 1UCRA 1WNLA 2PX9A 3SWNB 1YCSB 5IT9E 1VQNI 2ROLA 2LOOA 4CCLA 4DGWB 2YUPA 3CC4Q 5GAMe 2FBKA 4E6RA 2GGRA 4QVDA 2VB6A 5E1WA 4HG2A 4ITVA 1QWEA 4M78E 1ETYA 4XKCA 2V26A 3BROA 4MDXA 4PSXA 4M6YA 4L18B 1JHFA 1JT0A 3CCLT 4PUSA 2YX7A 1BCMA 1ETVA 4FHTA 1VIEA 3Q1JA 4JUVA 3LAPA 1QCOA 3K2AA 2FG0A 4BL0B 4D9JA 4Y4RA 1USSA 4U7BA 4OMMA 5EG0A 2F69A 4S05A 2QVOA 2R7VA 3EUHA 2GWRA 5IP6A 2GBQA 2DYIA 1BB9A 3CF5F 1FMWA 1YRNA 4QSHA 5JFRA 4MMKA 4JRPA 1YLFA 3THKA 2HOAA 1AWXA 2KK4A 1GXPA 4M78G 2XKPA 3A03A 3KEYA 1Z9CA 1GCQA 3BR1A 4LGWA 2X3XD 2YHTA 5D6XA 1WCMJ 3BDDA 1JRIA 2HYJA 2JA2A 4KISA 2FMYA 1YE9A 2XSDC 2QQAA 1IJWC 4R0KA 1IHWA 4CSWA 1GXIE 4C8QA 4L59A 2GQQA 3CJQB 3HJEA 4MFDA 3QPLA 3RCOA 2L7ZA 2IRFG 1KQ9A 4XRFA 3TDZC 4EJTA 2I0NA 1QVGA 1V1CA 1K73U 4M75A 2V1QA 1Y8QB 1SC7A 1MBGA 3BW1A 3BZCA 1U8RA 3I55A 1H92A 2V8JA 3K6GA 1BN5A 3GWZA 1B3QA 4M77C 4IUVA 2XPWA 2MW8A 4HSTA 4IF4A 4RBOA 3OS2A 3UKGA 1WKMA 3ROUA 4CCKA 1LOJA 1WJAA 1S9HA 3HTSB 1AT1B 4XAXB 5GMKi 2CZ1B 1U6GA 2DXIA 1WHKA 2RJEA 2IGKA 1VQKI 2M3AA 2VQLA 3I9V2 2EYQA 5IYBJ 2FRHA 3GF5A 5FB2A 1OOTA 2DF6A 5M9OA 2LTOA 3KEQA 1WXBA 1VNDA 2HEQA 2JTFA 1I5ZA 4RDUA 3FK7A 1NBEB 3EAEA 1XSXA 2DBKA 1HSTA 3NAUA 4BE2A 1N9SA 4MQVA 1NEBA 4FE7A 2CP6A 3I5SA 1QVFS 3G4ST 3JB9H 4YIIA 2BVLA 4HX4A 1G83A 5E3MA 2GFUA 1MV0B 3VUBA 3FISA 4QIWN 2L02A 2B63J 2VC8A 1LPQA 2M51A 1RRJA 2EZIA 4Y17A 5IAYA 3OA6A 4UB6C 1MNMC 1IXSB 3LWIA 2ZFWA 4BB7A 1KFZA 2NYSA 3HL2A 1ZARA 1QZZA 3OWTA 3V42A 4AIHA 1YI2A 5C6SA 3RPUD 3VYUB 5L3GA 1AWWA 2EGEA 1H88C 4BU2A 1WVRA 3GLLA 4C5GA 5KYNA 1ZA2B 5LJ3j 5EYRA 1GCPA 2EJGA 1OMIA 2BY3A 1YO5C 2XHCA 5CJ9A 2KRFA 2A36A 5E1XA 4A93J 2DEQA 5KYUA 1X2NA 2VASA 2CO5A 3WE3A 1WHGA 1YJNA 4XONA 5AIQA 3U9GA 2IA2A 3BT9A 3LLRA 2MA3A 3BFMA 3DKMA 2HOEA 3F0CA 2DYRH 2IVMA 1PYVA 4LG0B 1WJEA 3CTAA 3E0JB 2JOYA 5LJ3d 4Y91A 4HCBA 5J8FA 1RABB 2ZC2A 3OIQA 1KJWA 1VQ9Q 2X9DA 2EV5A 4A3MJ 1WI7A 2BE7D 4D8DA 3CPWS 5IHNA 3LQQA 8AT1B 4M77E 2Z5UA 4XMYA 4B3AA 1JEGA 1W4MA 2BXZA 2IEKA 3HXLA 1B59A 4IRGA 2HL3A 4PJOC 1YW7A 4EJVA 1YWOA 2M45A 4FISA 4IHSA 5LRSA 2ECZA 3CMMA 2DK3A 2LKSA 1ZK8A 3RSNA 2L9VA 2HQEA 5J26A 3WVDB 2X48A 2DO3A 2OUMA 2H27A 1B07A 1UGPB 1YJWQ 2J05A 3CCET 1IW7F 2HXOA 5GAOp 1V5EA 1ULYA 4JP0A 1OPLA 2JTVA 5EZHA 3IC7A 4DW6A 2L8DA 4F52A 2XUBA 4L5GA 2K4YA 4M77G 2H3JA 4A3LJ 2F2EA 1OYIA 2V1XA 3M3YJ 2MMPA 4OB2B 1FOYA 4CYDA 1NJIU 3X26B 2W82A 5K5RA 1OCTC 2CUEA 2H1LA 1VQPT 3I3LA 3VFZA 1IXCA 2A69F 3JCMh 2JJ7A 2DETA 4MHGA 1WXTA 3P8HA 3RUXA 1VQ6A 3CCVQ 2GOXB 1Z3YA 2E2HJ 4YFKF 1VQ5Q 2B8AA 2HKNA 3HOYJ 3I0TA 1K6OA 4NDLA 2FVUA 1EFNA 3T5XA 2IT0A 1VQLI 1B72B 4KMUX 1I4K1 1Y0UA 3GBQA 5GAN8 3QYBA 3PFSA 1K8AU 1KIKA 2DDBA 2E35A 1TUDA 5D8LB 5GANg 3KP4A 1N8RU 2A28A 2LJ3A 4LB5A 3FKJA 4ATOA 3CUQC 2WBMA 3EUKL 1E7OA 1QCFA 3QRFF 3M54A 1VQMQ 1YIJT 3HL8A 4OMOA 1GL5A 2QCOA 2PN6A 1HW1A 2O5RA 3IV5A 3NHNA 3HSBA 3VS6A 2E65A 3QP6A 3VWBA 2QEXT 2LP0A 2DX1A 2DTZA 3EG9A 1YFHA 2ESWA 1XN7A 4UUVA 4NOYA 5GAMj 4M9SA 4LD9K 1IF1A 4A5MA 4KICA 1Q86U 3ABUA 1U5TC 1XD7A 2M0CA 4YG2F 5HODA 1IAWA 2OAUA 2CSIA 3JRHA 2KDSA 3IP4B 3ZQLA 1IN6A 1MBEA 2AXLA 2P6SA 3F8BA 4OOIA 3KETA 3CC7I 2K9SA 2LDMA 2KRCA 4GYGA 4M78F 1HQCA 4WCIA 5GAMd 3JAME 4BQNA 4FM4B 1KQ0A 3VRZA 4MMLA 2XGCA 3P9KA 4YIFA 1WHJA 2D0NA 2JTEA 3HKSA 4CC3A 3LH0A 5CAIA 2EKOA 4BY1J 1ON1A 2M5WA 4XM3A 1K7AA 3FM5A 2DO7A 3VSKA 4M6VA 3H35A 1B9NA 1GHCA 1M2VA 1WQWA 2K6DA 4JJDA 1W2BP 2PI0A 1PCXA 2Y2ZA 5CQGA 1FXXA 2XK0A 4J6WA 2XVCA 3HPGA 4EMKC 2UXNA 2WAQA 4RAYA 3ZMUA 4MLOA 3QYGB 2HU9A 3GO5A 4PZJA 4EM0B 5HVQC 1ZREA 1X1CA 2GOMA 2EZKA 4W1UA 2DL3A 3FEOA 2STWA 3EH1A 3CMAT 4MTDA 2FEZA 5HDKA 3R0AA 1W0UA 3EGXA 5HK3A 2ID6A 4HNVA 1XSVA 1F36A 4C2TA 2ECCA 3M1EA 3WODF 2G3RA 3S3NA 1YITQ 3WTSC 1PSEA 2LKPA 2FU4A 2V1NA 1TWBA 2OTLQ 1FX7A 3M0TA 1LVKA 3H0GJ 1MMGA 2ZNYA 4N9IA 1EJ9A 1BU1A 3CESA 4QT7A 5GAN4 2QK0A 4CI0C 3H0FA 2LY2A 3PGGA 1MGTA 3MWMA 3BTLA 1FYLA 3IRRA 1NLPC 2D0QB 4NS5A 2A68F 2LCSA 1QVUA 1X3WB 4A3EJ 2R57A 1J7KA 1R0CB 3IH3A 2CKKA 2DVEA 5E20A 3F72A 1JI8A 3NGPA 1JE8A 4GO1A 4C0DB 2N8GA 4CXFA 4CYCB 1TTHB 2V8IA 4M7AD 1TWHJ 2LCLA 3MEUA 4OINF 4HX8A 2G7HA 3GZ5A 3OYBA 3OBWA 2GXAA 2P7CB 3RI4A 2CW8A 2O8XA 5KAIC 3W6JB 5IOYA 2A0FB 2FUG2 1YCYA 2XC7A 4KT6A 4B6MA 4I09A 1IN5A 3JTHA 3A8LB 3BG7A 4OAZA 3JRGA 3ZQQA 4S04A 3J81K 1AZGB 1WPYA 4RTUA 1VQ8T 1RPWA 4R55A 2OTJA 1Y39A 2ZBKA 4NQWA 2JZ2A 2ELKA 2IJLA 3BY7A 1VQOQ 3UA7A 5TRDA 2RNAA 1TWGJ 2D1VA 1YHQT 4RG8A 2L3QA 1XNIA 3C3WA 1D5VA 4LN2A 3FWEA 4IHWA 1R5ID 4XTYA 3FC3A 1ZX6A 4M7AC 2JUGA 2X1EA 4J00A 1I8FA 1PD0A 4J9HA 2XGXA 3M5AA 2HAXA 4M78A 2KKOA 4ZYHA 4IRIA 1Z67A 4UY8I 3EUAA 2EQUA 2VKDA 4AD9A 5J8CA 3CC2A 3NARA 3JB9I 3I54A 4PLIA 3ZBDA 1BR4A 2K5CA 1RC9A 3AG3H 1P4XA 4HEA2 5FLXK 2KLOA 3LA7A 2FPEA 5C4JJ 3LH5A 4KH1B 2VKNA 1JKRC 2DA4A 5F0CA 5FD5A 5GP9A 1H0MA 1M2OA 3CMEA 3F23A 1CKBA 3CCMT 3EG2A 5FRMA 1G2BA 2WV1A 2X85A 4RCBA 4HQMA 1K61A 4PJNA 2E12A 1QO0D 1OFCX 2NVYJ 3BY6A 3HEFA 1T39A 3EYIA 1Z7LA 3CCSI 4RB3C 1Q7YC 2YSQA 3F21A 1H89C 3DWLE 2LYCA 1X3ZB 2RHXA 3QWYA 3FBNB 2DERA 2DXTA 1MMNA 1YJ9I 3I56I 4NL2A 1D0ZA 2X6WA 4M73A 4BGDA 1LEBA 4XQ3A 5J1UA 2E4HA 4JS5A 4RM3A 4HVVA 3A5ZB 2P8TA 4YRVA 2ZMEC 4O5VA 5HNFA 1VA7A 2FZCB 3M0RA 2NVTJ 3GFLA 2C0TA 4FYXB 5CKEA 4G6DA 3WTUC 4LE9A 2CS7A 3SZGA 4CC7A 2EIMH 1Z9QA 1JJ8C 3HRTA 1TU0B 2DIGA 3CCLA 2OQGA 2IBDA 3M4GA 3DCFA 2KL4A 3INZA 3QWXX 1I39A 1Y0MA 5CO7A 3PM1A 1VQNT 3CLQA 2ZNZA 3LA2A 5GPCA 2EIKH 1YOVB 1TL8A 1MSEC 5GAOr 2RMOA 3LSHA 3O2PE 3RESA 4HVWA 4M7AE 1LNWA 5GAOq 2EINH 1P7JA 2KISA 2ZAEA 3KYLA 3QJYA 3SZPA 2D8JA 1BI1A 1QP2A 2KBTA 2K2VA 1M30A 2RN7A 3PSIA 3WG9A 1YS6A 4YIRX 2ZFUA 4X1VA 4M7DB 1Y57A 3BP8A 1R77A 1OR7A 1JKPC 1S72I 3JRBA 4A54A 1LFBA 1ACMB 2M9HA 1VQ9I 2FRWA 1W7PD 2WADA 4BUGA 3JB9D 3CC4A 3J7AF 3KBGA 2RO0A 3SDGA 3IL2A 3HOSA 4L0YB 3MHXA 2QASA 4HCKA 3QHSA 2EIFA 1X1PA 3S16J 4FW2A 2EFNA 4RMNA 3ULQB 3H0DA 3OMCA 2LDUA 1W36D 4IIMA 2H1KA 1B34B 1Q1VA 1YW8A 4P96A 1WZOA 4JQFA 1RAEB 1X69A 3RJPA 2R5YB 1Z7UA 3H9JA 3DTKA 3HPHA 3NPFA 3IKVA 2EBIA 4FL6A 4DEYA 1Z77A 1MW7A 3JW4A 3TQ7P 4DA4A 2CFOA 2IS6A 3J80R 2CP5A 4ENMA 1OYYA 5J4VA 4BQOA 1ZAOA 3G4SA 1WGXA 3TO9A 1T3SA 5FO5A 1VQ4I 1JUPA 4DYCA 1DUXC 1KYZA 3BR5A 3MFKA 1TT5B 4D6WA 1YJNQ 1J0RA 4F55A 5FLVA 2EB7A 1OULA 2JA8J 4F93B 2QXFA 2LK2A 1I6XA 2KI7A 3E5XA 2GA2A 2RC4A 4HSRA 5DV5A 2L3RA 2PNIA 2ZCFB 4N0AA 2HL5C 1R7JA 1ZTRA 4C92F 2NUZA 3BDLA 1VZ0A 4Z02A 1VYTA 1WQ7A 3AFHA 3QU3A 4E47A 3IAM2 1U8BA 1M90U 4U88A 3TP0A 3BCBA 2W25A 2B86A 1ETWA 3EGDB 2K85A 1KGSA 2CW0F 3C2BA 5B66C 2DOAA 3JRIA 4CUGA 3HUGB 5ILVA 9ANTA 1R8OB 2QI2A 3ABLH 2XASA 1XDSA 4Y33A 4DEXA 4ZZLA 3IWZA 3DFGA 3ZQFA 1TXQA 1OV3A 1PG5B 5A0DA 5E1ZB 2R7QA 2D45A 1LJ9A 4N4IA 3OYDA 1MJ9A 1NM7A 1H3ZA 1QPMA 5GAGJ 2Y9ZA 1XJWB 1BR1A 4XTXA 2O0YA 3KEOA 5GTHC 5GANh 2P0QA 2JZYA 2PVGB 2XSJC 3OW2P 2XAQA 3E6CC 2X4YA 1SAXA 3PQKA 2AIRB 4ZN3A 2X4JA 2EFWA 1MBHA 1T38A 1C6VX 2O01E 2YT6A 2GA1A 4ZDPA 4B8XA 2KGTA 2EA4A 1RL2A 3P8BB 2CUDA 4GXOA 3E5UA 2DD4A 1JGSA 3I59B 4RTZA 5ICEA 5HOOA 1ZRCA 1OQKA 3K4LA 3EFSA 4CICA 2K5LA 3PMIA 3S14J 2GFAA 3TW7A 2MBFA 3ZMTA 3VEPA 5L3EA 4FE4A 2DPDA 2AKLA 3G1JA 1HLVA 1VQ6Q 4EJUA 1I07A 2CV0A 4D7NA 1D1AA 4LK1F 4XOPA 1ZSZC 2M9UA 2BE9B 1Z05A 1FBQA 3ABMH 4RA2A 4AG2C 5DM7R 3DEWA 1GBRA 4IX7A 1AKHA 2I10A 4DBFA 5GANf 1W1WE 2R7RA 2JPBA 3GBGA 2Y30A 2VYTA 1J5YA 3TOBA 2M4GA 1ZBXA 3OYIA 1I0CA 3SWNC 3JCMf 3K4KA 5CVVA 5E79C 2E1CA 1RI7A 2Q2EA 3HB9A 3KX2A 5FKOA 2ZO4A 3V7RA 2A7YA 5LJ5j 4A53A 3H3UA 1KD1C 5F08A 3DTIA 5M3MJ 3PIPF 2YUOA 2XF6A 2NUTB 3I71A 3LFKA 4C92A 5KYWB 3G6EQ 1VFCA 2F5FA 2EA2A 2FQ3A 1UJ8A 5A2QR 2DA5A 4BUPA 5LJ5d 2W48A 4IUPA 5BMZA 3HIFA 5KE3A 4HW0A 3JRDA 4I7HA 3ZQ7A 3VRYA 2CQ7A 2WA0A 4XKWA 5HLIA 4OVAA 5F04A 2F48A 2WWYA 2NS8A 5GAHJ 1WDXA 3EG0A 1LJOA 2KYBA 1RAGB 3TDUC 4M6XA 2VKHA 3A01B 4XRMA 2LFBA 1A31A 4XORA 3OYEA 1NPPA 2QEXA 1I5OB 3Q0VA 2CYYA 2TRTA 2P0TA 1X4PA 2O2OA 2EQIA 2NUPA 5AT1B 3JCMb 1KG1A 1GLNA 2TCTA 3FXLA 3EGUA 3RDIA 5L3FA 1YJWI 3KE2A 1G59A 1K78A 2J06A 4BI8B 3X2QH 4C5EA 3C94A 3A52A 5LGUA 3OIPA 2OZ6A 4LFUA 1WJRA 4NBQA 2M8GX 4A0XA 2JM9A 3QPHA 5AONA 4KN7X 4EGYA 1NG2A 4FASD 5HLGA 4IOCF 1O3TA 5IP9J 2HD0A 3E9GA 4P5NA 4UC4A 5DM6F 3PNWC 2DJNA 1MNDA 3M07A 3FJ5A 1KU7A 1X2QA 4WXHA 1VQ7T 4DYRA 1AWJA 3KP7A 2CDTA 1AEYA 1XTDA 1MBKA 1TWCJ 2EAYA 2L7MP 3G71I 4QPOA 1FTTA 2JUFA 5LGNA 3CCUT 5KCOA 2HTSA 2R5ZA 3CC7T 1HA8A 4WWCA 4PFZA 2K27A 1TG0A 3GZNB 3B73A 3T8RA 3CCVI 3S3OA 2JMAA 2PG4A 1UG2A 5K5OA 4WK8F 1KQSP 5LFAA 3TSZA 2MAMA 2KZVA 4BJTA 2HQHA 5D5XB 1YNZA 3OS5A 4A3DJ 2JJ9A 1M27C 3A0BC 4Q5SF 1Y8RB 2DQRA 3BR2A 3W2VA 3PNYA 2JQ7A 3QJ6A 4YFNF 4DOZA 1WHLA 3HRMA 2J6FA 2V9PA 2R7FA 2GF7A 2P6TA 3JCMg 2BZ8A 2K3PA 1N78A 2MK5A 3NWTA 2FX0A 2VL8A 1AD5A 4M75B 3CCRQ 2QA4T 2L54A 2OTJQ 1BM9A 4JLGA 1Y07A 2F5TX 4M9XA 4J9IA 4EMKA 3DEUA 3K4BA 3RKWA 4HNUA 2CGPA 1AHJB 4A3FJ 3A98A 4OB0B 4FSXA 4DBRA 5D5VB 3FXKA 3COAC 1WA7A 2HKOA 5F1RA 1HKSA 2JS2A 2HSEB 1FSHA 2MIOA 2MWPA 2Y4YA 5AYFA 3BQYA 4L5JA 4KA4A 2VOOA 3X25B 2M4KA 2HDWA 2QQSA 3MKZA 4C3HJ 1PUFA 4V19K 2DVJA 5DS9A 3MZHA 2LKXA 2BBYA 2QLZA 3GTLJ 2CH4W 3D1NI 3L42A 3H9GA 1W70A 3CC2Q 1WQ2A 4AIKA 3M0PA 4C92D 4OWRB 3JR9A 3META 4J6YA 2KY9A 2P5LC 4KITB 4F16A 2KSSA 4G6QA 3SFZA 1E6HA 1SG5A 2JW4A 3JREA 4A0YA 3RIRA 4KULA 5EG2A 1N27A 3CMEQ 3JCMW 1QBJA 2K4JA 4XICA 1KQ1A 1YHQA 3FBIB 4QQ6A 3FB9A 2DPPB 1X4OA 2K3FA 3KUFA 4C5IA 3OYLA 3EPZA 5TISC 1E3OC 1D8JA 1K76A 5JR3A 4ENJA 1R36A 2ROTA 2JUCA 2YLCA 4AG1C 2MGQA 2PMUA 1ZUYA 1O3QA 6PAXA 1JXOA 4D8KA 3I4MJ 2UZKA 2KP6A 3LSGA 2MFZA 1WFWA 1O57A 1X2MA 1SEUA 4CC2A 4OGEA 2OAZA 4J01A 4AYBA 4BJ5C 1N8RR 1SSHA 4C8QF 4EVIA 2LQNA 4W97A 1MMAA 3CCMA 5E3OA 4P9UA 3HYIA 3CMYA 3QBYA 2K4BA 2DL7A 3CCLQ 1KK7A 5F0HA 1U9OA 4LOCA 3SDBA 1G3YA 2GQIA 2H3EB 4XTWA 3JRAA 2E1OA 3OMYA 2CGHA 1RLQC 1D8KA 3LGFA 2EQMA 4XK8E 4HX7A 4RAGA 1QVFA 4A3BJ 1DPRA 3CD6A 5BQTA 2M16A 1Q86R 1VYVA 5J1RA 3BG9A 2VKEA 2PZ1A 5IY5H 5K7FA 4A4HA 3LAJA 1JO8A 1Y96A 4JS4A 2JT4A 2ZGWA 3CCYA 2O61A 1V76A 3BR0A 4QTRA 3U1DA 3F6VA 3V8KA 2RK1A 4XTVA 5HK0A 4FYVB 2HS5A 3L2QA 4C9YA 3E5QA 2LLKA 1IUYA 3EFOA 2VI6A 2QGUA 3E2UA 3KFWX 4M3BA 5KVRA 1BK2A 1M9SA 4FIBA 1FBSA 4CZCA 1TWAJ 3I56T 2DIQA 2I5UA 3BE3A 3JV3A 2UWMA 2DLPA 1YJ9T 1VQNA 5I2SA 3EYYA 1VQOI 2OC6A 3MKYB 4PFOA 4G7OF 1NYFA 2WB1A 1JUMA 5CKHA 1XX5A 2P0KA 4UV8A 2STTA 4IZZA 2ZMEA 5IYDJ 4ZDOA 3PE0A 1WX6A 1WHUA 2X98A 2MLKA 2XRNA 4II1A 3RPQA 1N77A 2CH4A 1UJYA 1GUUA 1RNLA 1T8IA 2DRKA 1NPRA 5I22A 3LSMA 4AVPA 1HKTA 4FETA 3OYMA 3GTQJ 1OCOH 2G9WA 1E2XA 1WLPB 3G4SQ 3Q0WA 1UJ0A 5CQXA 4KH0B 3ZEHA 2OV7A 1WH7A 1N5ZA 4FSSA 4MZMA 1UG1A 3NMZC 4HT9A 1MBJA 4BS9A 2OD5A 4M71A 1ORKA 1XGOA 5CVIA 5K1YA 1K9AA 4IURA 2ME0A 4F92B 2YRCA 4MFEA 3TU4K 3JB9G 4HXJA 3DKXA 3CZ6A 3ASNH 1Y1WJ 5TGTA 1S72T 4J9BA 4XR6A 2EIJH 3PFYA 4A6DA 1C0MA 1VQ9T 2SRCA 4QW2A 1H9TA 1GFDA 1ZA1B 2FNAA 1SFXA 3TGNA 2E71A 2UXXA 4ESJA 3GOXA 1G8XA 5FD6A 4PDKA 2DYSH 3OYKA 1CSKA 3EG9B 4C0FA 2F4IA 1FWZA 4XLEA 3VYSB 1WJQA 1ZQ1A 1WI9A 4Q48A 3TW6A 3ZMZA 3MMYB 3FXUA 3ZMSA 5GMKm 2FZGB 1UB4A 3LWFA 3VDXA 2LNHB 1LVAA 1N25A 3FRNA 1TZLA 3BC8A 3DU5A 4HAMA 1RQ6A 3VU3C 3HC7A 5GMKe 3PFIA 4M3DA 3K10A 3GW2A 4LITA 5J39A 3PVQA 3N97A 1R5HA 2PBIA 2QSFX 3DBHB 4P55A 3V8JA 2LX7A 2Y0SA 2X1CA 1X75C 2KT8A 1UTIA 2YLBA 2Y48A 4EGZA 1MZBA 5DUKA 3I55I 1D09B 1GT0C 2DFIA 2RJCA 4C0DC 5CKFA 3BG5A 2NOJB 3VS4A 1KA8A 1PM3A 2M7AA 1VQ4T 3KLNA 1O75A 1RAFB 1M2VB 5LJ3h 3VS2A 4QKUA 3HKZN 2KJCA 3WTYC 3OSGA 1C1AA 4JRIA 3ZMDA 4HZFA 1DJ7B 1Y56A 2PJPA 1XMKA 4ASNA 4FCYA 2LC4A 2VGMA 1DQUA 1OPCA 2KZGA 2BY0A 3GXOA 2CQKA 2LF8A 2XAHA 1WJDA 3H5AA 3CUOA 3Q9VA 3R4KA 5F64A 4CDGA 4ENNA 3PNTA 3AL0B 2P84A 3EGXB 4OGCA 3D5RC 4J6XA 3OIOA 5GADJ 3S1MJ 2GNCA 2KPMA 3HZJA 2P5KA 4PNOA 4WXCA 1ETQA 5L3CA 4M3EA 2H6CA 2PU9B 5DEQA 1OPKA 4C0ZA 1SD7A 4UUTA 1I5LA 1NH3A 2RJDA 4HVUA 4B43A 3D5SC 2IA0A 2PJRA 3M53A 2D8HA 4Z88A 5KYXB 2IS2A 4CCOA 1OZ2A 3CCJT 3BZ6A 2DM1A 4MDWA 2X9HA 1Z0XA 3OL4A 1YFNA 1IO2A 1QVTA 2RDPA 2VXDA 2W00A 1YI2I 2L9SA 2M1BA 1Y71A 4BXXJ 2A08A 2EYZA 2IVWA 1P9QC 3MP1A 2GXGA 3QQAA 2RQUA 4IUQA 2DLLA 2HVRA 3VYHB 3CCQI 2COZA 1NLOC 3G1LA 3EDPA
chains in the Genus database with same CATH topology
3X24B 4CRIA 1BC8C 3F8FA 1M8VA 3EETA 3NQOA 1W7PB 3V8LA 4HKEA 2JSCA 1FC3A 3GFMA 2PFBA 3OYYA 3OYGA 1Q1HA 2DD5A 1Y7XA 2WV0A 3I58A 4KNYA 2D1HA 2VXZA 3BOQA 1Q82C 1LDDA 1SFUA 4C8QD 3KP3A 3HHHA 5A0GA 4M78B 2DTOA 4ESBA 1ZRFA 4M75D 4Q47A 2L5QA 1J75A 3O6BB 5GAOm 4RB2C