2F5DA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ac conformation, ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
134
structure length
130
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 52
structure length 130
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5dA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5dA02
1TW3A 4CICA 1T2KA 2CG4A 1SD6A 4PDKA 3KP3A 4S04A 4IVNA 3D5LA 5DD4A 3F22A 1Z05A 2F5CA 2L3DA 4HX8A 1ZHFA 1JE8A 1QZZA 4ZYDA 2H94A 2Q2EA 2OAZA 5KVRA 2Y0MA 1CF7B 1TW2A 3BY6A 1IUYA 3GWZA 2HOEA 2XGXA 3TDZC 1J0RA 1H0MA 2PMHA 2HEOA 4PCQA 5HLHA 4UHTA 4JQFA 1IN4A 3RYPA 1SMTA 4M72A 5HLGA 2EFPA 1Y0UA 4EGZA 2V1XA 1G6NA 2DT5A 2FBIA 4GCVA 2HZTA 2EFQA 1ZRCA 2IJLA 5BOXA 4KMUX 3R0JA 4GYGA 3EYYA 3WGGA 3MCZA 2P7VB 3RI4A 3QOPA 2ISZA 1MGTA 4OMZA 3Q9VA 5DYMA 2A6HF 1MJBA 2YX7A 3IKTA 2XKOA 2Q0OA 1QQIA 4AD9A 1AOYA 1R1UA 2TDXA 1BI2A 5BPDA 4GO1A 3LAPA 3GXOA 3GZ5A 4UVCA 5EEHA 1XGSA 4RB1A 2GA1A 3PFIA 1YW7A 1YW9A 3M8FA 4A0YA 5ICEA 4YFKF 3V8JA 4LB5A 2KJCA 4G8XA 2OD5A 3FHZA 3KP7A 2IPQX 2XAGA 1U5TC 4L9TA 4A6DA 2KIFA 3TO6A 5E8GA 3E5XA 5LRSA 3R4KA 1XGMA 2V9VA 3LA7A 4CHUA 3QU6A 5BQTA 5HOOA 2FXAA 3VEPA 3F6VA 2HGCA 4ZZDA 3E6DA 1K78A 4HA8A 1TQIA 3GFIA 2QZ8A 4WK8F 1FP1D 3F3XA 1ZLKA 2PI0A 2VT3A 5D6EA 1V3FA 4EVIA 4IF4A 5K1YA 4HX7A 1TTYA 3T1BA 4HDUA 3FXQA 4N9IA 3WU0A 2XUBA 4KT5C 3I4PA 1QGPA 3KZZA 4P9UA 3WGHA 3IL2A 1XD7A 3VB2A 2NS0A 3L09A 3K0LA 2FA5A 4O5VA 4IXAA 3HTUA 1BI0A 3KETA 3U1DA 3CO7C 4Q4ZF 1T98A 2M30A 2ZO4A 3GUDA 4LG0B 3CDHA 2ACJA 2ZKZA 4A2UA 3M9AA 4LK0F 5TRDA 2G9WA 2C6YA 3RTRA 1BM9A 2OQRA 3Q5FA 5HDNA 1ZG1A 2COMA 3GO5A 1TNSA 2HQNA 2ZMEA 1OYWA 1P4XA 3CUQC 3FMQA 3ERED 5FFZA 5D8KB 3I58A 3EETA 2CYYA 1I1GA 3WTUC 4HF2A 1Z91A 3HRSA 2ZCWA 1IF1A 3GVAA 3RPUA 3GW2A 4HX4A 4BH9A 3J7AO 1J59A 3ML6A 2E7XA 2IRFG 4WF2A 2M87A 2BGCA 4R8HA 3BOQA 4MTDA 3BZ6A 4OOIA 4NB5A 1FYMA 3U9GA 1YS6A 3QP5A 1J9IA 3I64A 5L3BA 2BBYA 3WTXC 1HW2A 4U0YA 5D6FA 3V4GA 1T0FA 1R7JA 4F7ZA 2P6TA 5JI6A 1WQ2A 2STWA 4FT8A 4EM2A 4OMYA 4WXDA 1U2WA 5IT9K 4Y15A 3K1NA 4G9YA 3CO6C 1J7KA 4MQVA 4HW0A 3IHUA 2QYOA 3VODA 3KE2A 1U6GA 3ZQ7A 4Y13A 4RGSA 1FSEA 3GFMA 4BHBA 4GGGA 5D8LB 2LF8A 1KU2A 4WWCA 4L9VA 1MJ9A 2D2WA 3V8LA 4XSZF 3IKVA 1STZA 2K7LA 5AONA 3U2RA 5CVIA 4OIRF 4EJTA 4N9HA 5AIPA 3P9CA 1HW1A 3RKXA 1U5TA 1L0OC 2EWNA 5FGMA 5ILVA 2X0LA 4BHPA 3GFJA 4JK1X 4MEYF 3DFGA 2OBPA 5BPIA 1ZG5A 5E20A 4RAYA 3ULQB 3G73A 4I09A 2LNBA 4HF0A 1F1ZA 4L0YB 4EJUA 2EV5A 4KN4X 3RIRA 5CYVA 1HBXG 2Z99A 3C18A 3BP8A 3HSFA 3ZMZA 2W57A 3TKYA 2ZNYA 4EQQA 5ICFA 1S6LA 3I59B 2WTEA 2PJPA 1KU3A 2JT1A 2QBYA 4ZYEA 5E17F 2ZMEB 3HOTA 5DDGA 1IN7A 5F64A 1ULYA 1B59A 4XLNF 2W85A 2B0LA 2JZYA 2IP2A 2JPBA 2K27A 4HF1A 3M8EA 1YTYA 1JXSA 1LVAA 1FY7A 4LLNA 5FFXA 5HDGA 1SFEA 1PP8F 1Z6TA 1G3TA 4A6EA 1U3EM 4TV7A 1KYWA 1IRFA 2MD5A 2EB7A 1USSA 5DUIA 3F8NA 1BI3A 4R1HA 2DI3A 3ISPA 2ZBKA 1GXQA 2DPUA 4MHGA 1R22A 1DP7P 1DPRA 2OZUA 5H6RA 3H3ZA 2RGVA 4GYIA 4L5JA 4L18B 1YIOA 2GXGA 1YO5C 1PDNC 2H6CA 2DW4A 2K4BA 2MC3A 2FRHA 3DEUA 4OIPF 1P6RA 2Z33A 3V7CA 5HDKA 3OV8A 3SQNA 4M74A 4CDGA 3TO7A 2GQQA 4O3MA 3ZMTA 2UXNA 3EQLF 1SD4A 3L9FA 4KYWA 2CGPA 2NNNA 1LJ9A 2PG4A 4O6JA 2VE9A 4B8XA 3K2ZA 2IVMA 3ZN0A 3I0TA 5ILSA 4YG2F 2VOOA 1OR7A 2HTJA 4UVAA 3EYIA 1I27A 4KMFA 4U7DA 1R5HA 3V7RA 2OQGA 5J8FA 1OMIA 4BQAA 3HRMA 3FXRA 4ETSA 4BYYA 1R36A 4L0ZB 2PEXA 4Y17A 4G6DA 3SFZA 3GYHX 3FWEA 3DP7A 1UCRA 2DQLA 1B1BA 3MFKA 4B09A 4UUVA 5HLIA 5LHIA 3ECOA 1JHHA 2ELHA 3I5UA 4EM0B 1P4WA 1B6AA 2O0YA 3DQVC 3LQQA 4I2OA 5IT9Z 1XB4A 3BJAA 3RKYA 2O8XA 1U78A 1O7LA 1J5YA 2VBXA 3T8TA 2L4AA 4EJOA 4UVBA 2P4WA 1TBXA 3T8RA 2RKHA 1MDMB 1XGOA 3V7SA 3L00A 1WWXA 1KYZA 4M9ZA 2GXBA 3HIFA 2STTA 2XAHA 1HQCA 2X4HA 4CXFA 3TO9A 3LA3A 1BIAA 1S29A 5TJJA 1G3WA 2FMLA 4UXNA 2M1BA 1E2XA 1I6XA 2DPDA 1WKMA 2A3SA 4A12A 3CTAA 2VODA 3O2PE 4NHJA 3E6BA 5DCMB 4MTEA 3BJOA 4IRHA 1YG2A 3CUQB 5CJ9A 1ZH5A 2FNAA 2XVCA 2XAQA 2E7WA 2JSCA 4LGWA 4XLPF 1FYKA 2KRFA 4PZJA 5E18F 2IA0A 4HV6A 4HAMA 2RVCA 3FX3A 3GZ6A 3TGNA 4KDPA 5CLSA 5FLXZ 2R7FA 4P9FA 3LFKA 3ZMUA 4EGYA 1I5ZA 3VOEA 4U88A 2LKPA 1RZ4A 2VT2A 2QQ9A 2EA2A 3HOSA 2XRNA 4PGHA 1ZRDA 3N97A 5LBQA 4IPAA 1IN5A 1WSUA 2JPCA 1UFMA 3F8FA 4ESFA 1F9NA 2VONA 3WU1B 3E6MA 4M9SA 2VC1A 3JTGA 5LRRA 1SD7A 1YS7A 2XV4S 1IN6A 3WTWC 1V4RA 3E6CC 2WV0A 1BOAA 4UV9A 5LGUA 2XIGA 2XHKA 1IXSB 5JR3A 4BAYA 2JTVA 4RS8A 4RGRA 2HDCA 4RGUA 4AIJA 4A5MA 3P7NA 1W5TA 1P92A 5A2QK 4G94A 2UWMA 4KIGA 1K79A 2L02A 3FZVA 4FX4A 2QUFA 3KP4A 1EH7A 4Z2YA 5BS6A 1RIOH 1FPQA 1EH8A 3DKWA 1LEAA 2PLYA 4CO8A 4HLXA 3JAMK 3D0SA 2HFHA 3HSEA 2M8EA 4M73A 3BJ6A 4L9JA 3F23A 2CFXA 1YQAA 3SXYA 1O3SA 3E5UA 1P4AA 3GEZA 4I0AA 1FC3A 1O3TA 1OKRA 3CJNA 2YR2A 1O57A 4M6XA 2D1HA 5J6XA 3DPLC 3AAFA 3EDPA 2ZXJA 1XMAA 1BJAA 3IWFA 1P2FA 2OA4A 1KQ0A 1TLHB 3PQJA 3N4MA 3JW4A 2XASA 2FMYA 2QM3A 1RI7A 2DK8A 3DV8A 3MWMA 4ZYGA 3FF5A 2K86A 4UNOA 4N0BA 4HQEA 2EFNA 1HXDA 2F5EA 2AS5F 3DF8A 3KFWX 1ODDA 3HHHA 1ZYRF 3BDDA 5HS9A 2A68F 1Z9CA 3MEXA 4L9NA 3K1PA 4LFUA 1I1SA 2FU4A 1HW5A 3IRRA 3R6SA 5DD8A 5ICCA 1K78B 3KP6A 1ON1A 2FOKA 2VE8A 2A5YB 3COAC 4MQ9F 1W7PA 3GF2A 1XGNA 4YFNF 1QZYA 5HS8A 3W6KB 1R1TA 5D5UB 1FX7A 5L3EA 5FD5A 1FP2A 2IA2A 1WRJA 2P7CB 3F8MA 2RC4A 2P5VA 5H20A 1FSHA 3WG9A 2QWWA 1R5GA 1IW7F 2HKXA 5LHHA 4M71A 1F4KA 1UHMA 2A61A 1KU9A 5F1RA 1ZREA 2M45A 3FM5A 2HYGD 3O3KA 5LLQA 3ABUA 3LWFA 2O6GE 1U8RA 2DLLA 2NAZA 4H0EA 1O3RA 1ONVA 3KCCA 2BE5F 3KEQA 5CVUA 5HS7A 3LAJA 2UZKA 4KFCA 1B9NA 4YFXF 4ESBA 3L7WA 1XMKA 4CGZA 2WC2A 4OIOF 5FLXK 2EK5A 4YIFA 5EEGA 1KQ9A 2DU9A 1CF7A 1FZPB 2VC0A 4HYEA 4NQWA 2F5FA 4AVPA 3QU3A 3HHGA 1R58A 3WTTC 1HKQA 2HKOA 2VBZA 2MA3A 3F6OA 3K69A 1T6SA 3IC7A 3W6JB 5FD6A 3TOAA 4HV5A 5K5OA 1BN5A 4M9XA 2DFIA 5J8CA 1QO0D 2VBYA 1MZBA 1FLIA 1SFXA 2GA2A 4ENJA 2D45A 4ZZLA 4I7HA 1KGSA 4FX0A 1FOKA 1TNTA 5A2QZ 4KIBA 4S05A 3MZYA 5D4RA 2XKPA 5D4SA 5K5QA 4RAZA 5H6QA 3K9TA 2CSOA 2PN6A 4BNCA 3JAMZ 1VTNC 2E1NA 3C1DA 4KICA 4WX9A 2GWRA 2FSWA 1YFHA 1ZGJA 4KN7X 4BHCA 1FYLA 2DBBA 3SZTA 1S7AA 2ETHA 2WWYA 1W7PB 1C0WA 1HSJA 3HUGA 3SZPA 4E70A 4IHTA 3BPVA 1RUNA 4HLYA 3NRVA 4I01A 2OU2A 1BI1A 3CUOA 3M1EA 1U5TB 3NEUA 5FO5A 2EV0A 2FE3A 1QNTA 4K2EA 1DUXC 3LSTA 2VXZA 3TQNA 3JSPA 2CQKA 5LEJA 3F72A 2H27A 1QBJA 5DUKA 3F8CA 2Q8KA 1ZLJA 1IXRC 1LDDA 3KP5A 2HQRA 4RGXA 1RUOA 4IHSA 3TDUC 1YW8A 2QQAA 3QRFF 4WXHA 3OOPA 2J5OA 2QBYB 3WE2A 4WCGA 1O7FA 2L54A 3ZMVA 1T38A 5CVRA 1LNWA 1XDSA 2P6SA 1OYYA 2XAFA 4ENKA 1D3YA 1G3YA 1R1VA 2O3FA 2H6BA 4A0XA 4LG0A 3G3ZA 2RNJA 3ZMSA 2PMUA 4RB0A 2W84A 4EMSA 4U0VA 2RQPA 2OZ6A 4LJZF 2W25A 2D1VA 1HKSA 3J81Z 1IZ1A 1OPCA 3H92A 3I54A 3KLOA 1GHCA 1TQMA 4IJAA 5DEQA 3J80K 3R61A 1NHAA 3NQOA 2F5DA 3RPQA 3O6BB 1QPMA 4G7HF 2EFWA 3FXUA 4HZFA 3RJPA 4LMYA 4A0ZA 4LLGF 4EJVA 4M6YA 1SFUA 5AIQA 4ESJA 5DCFA 3HRTA 3R60A 1AWCA 4HDVA 2NNYA 2YX4A 2QVOA 1YYVA 5LGNA 3M7GA 5JHUA 2XAJA 2RDPA 3WODF 3GLXA 2HTSA 5CVVA 4XRFA 3C7JA 2Y48A 3CLOA 3ELKA 3SHFA 3ZP5A 2ADUA 1KA8A 3QPTA 4MNUA 1MD0A 3C3WA 3E3VA 1XSXA 2E1CA 2O61A 1HKTA 1LEBA 2Z3YA 5LGTA 1GXPA 1KQ8A 2DAOA 2FF4A 2CO5A 3WE3A 1SMYF 1FWZA 3I71A 2A69F 1JGSA 2J5PA 3V8KA 4P96A 3MQ0A 2L01A 2YU3A 4AWXB 4ZH4F 4LLLA 3HSRA 2IA1A 1HSTA 4G6QA 4QWQA 6PAXA 2FEZA 3I53A 3FM3A 2JRTA 4Q47A 4RB2C 5D5WB 2PFBA 2ZJ2A 4WXCA 3L2CA 1LDKB 2QENA 3KP2A 2V1UA 2IT0A 1S7OA 5L3FA 1Z7UA 2P5LC 1J2XA 2ZFWA 1XCBA 3GX4X 4JBAA 5LEKA 4G7ZF 4DQ2A 4L5IA 2RV8A 4ZYHA 4KUMA 2KJBA 2LDUA 4I02A 2Y75A 4Q48A 4D0PA 4EV0A 2ISYA 2MBFA 3F8BA 1L3LA 3IRQA 3KZYA 1DDNA 4ON0A 3I59A 1Z6RA 3RDIA 4HOBA 2MLKA 1K7AA 1ZARA 3DXJF 3KLNA 5D5VB 3K1MA 5ED4A 2KIUA 3MZHA 5F6FA 2GAUA 1YLFA 1XCVA 2K02A 4MGRA 5E1WA 3QAHA 3LQRA 2PBIA 2G7UA 1R23A 2BYVE 3MAJA 1E17A 1ZAOA 2FBKA 2ZNZA 1SAXA 1BIBA 1IXCA 4U7BA 3IWZA 1B9MA 2YSRA 5ILUA 4XBFA 2P5KA 2CWEA 3F21A 4HBLA 4I98B 3QPHA 3H3UA 3TOBA 1XSDA 2HYFA 3FMRA 4YIIA 2EV6A 3VFZA 5E8IA 1B4AA 1REPC 2R3SA 4P5OA 1FNNA 4DNCA 3BPXA 4RB3C 3EUHA 2NYXA 3KEOA 4G7OF 2IW5A 5IT3A 1UB9A 5BMZA 3P9KA 1PUEE 5L3CA 4HQMA 2P8TA 1S8NA 4LD5A 1R00A 1SD5A 5E1ZB 1UHWA 1BC8C 1GVJA 5K5RA 2DTRA 1BC7C 1XSVA 1D5VA 3ZMDA 4LK1F 3JSOA 1FT9A 2HR3A 2QLZA 1WI9A 3J80Z 2EA4A 4FHTA 3S2WA 3WTYC 2FBHA 3J81K 1LDJA 3ZPLA 1USTA 5CVJA 3Q9SA 1G4DA 1J75A 1X3UA 5HVQC 1K6OA 1EV7A 5D5XB 4BXUA 1W5SA 1PP7U 2BV6A 4PGGA 3B73A 1MJAA 4OINF 5L3GA 3FMSA 2KIMA 2V1DA 3WTVC 4U0WA 2G7HA 2DK5A 1DPUA 4Q5SF 2MH9A 3ABTA 5E1XA 3HYIA 2Z9OA 1FBUA 2MH2A 2QQBA 2DO7A 2FNPA 2VOPA 2NRAC 1W4MA 3RYRA 3DPTA 2BEOA 5LHGA 4LB6B 2R7DA 1KU7A 4P55A 5KK1A 2FQ3A 2VN2A 1T39A 2A6EF 1O3QA 4OU0A 4UV8A 5DV5A 3BWGA 3WTSC 1IN8A 4AIHA 3WTZA 1EH6A 2EJRA 2K4JA 5L3DA 2V79A 2W24A 4KA4A 1ZRFA 2EFOA 1MDMA 1LQ1A 3WGIA 4GXOA 2UXXA 4ENNA 1XDUA 2GIVA 2LSOA 2ESHA 2AXLA 2GZWA 1D8JA 3ROUA 1W7PD 2VBWA 1OYIA 3HRUA 2V6CA 2XROA 2HS5A 4MEXF 4ENMA 3ECHA 4CYDA 1FBQA 5JVTA 1F5TA 2YPRA 3T0YA 4A5NA 1TQPA 3PQKA 1XN7A 2F2EA 2H09A 1A04A 1JHFA 5DCMA 3B02A 1RNLA 5JFRA 1Q1HA 2MLGA 3E5QA 1MKMA 1H9GA 3CUQA 2A07F 3LA2A 4EM1A 2ESNA 2M5WA 1ZGAA 2LF7A 1FBSA 4EJWA 1Z1DA 3GFLA 3E97A 1ZG3A 4KNYA 3P9IA 2L4MA 1H9TA 4QLCU 2KKOA 3REOA 1G3SA 4IRIA 2Z5UA 1BBYA 3QP6A 4CZZA 1IRGA 1S3JA 5FB2A 2PQ8A 4AIKA 2RN7A 5ICGA 3HTSB 2HWVA 1ON2A 3BROA 4OIQF 1D8KA 4XSXF 4ASNA 3R0AA 1LB2A 3T5XA 2O03A 4I0BA 4R79A 3JTHA 5ERIA 4KIFA 2DQRA 4IRGA 1CGPA 3RKWA 1IAWA 3ZN1A 2CW0F 1ZN2A
chains in the Genus database with same CATH superfamily
2V7FA 3FXOA 1TW3A 2BXZA 4CICA 3A52A 1T2KA 3KX2A 2ZMEC 2CG4A 5JLXA 1SD6A 3OYGA 4PDKA 3KP3A 3OOUA 3SDBA 4S04A 4IVNA 2NVXJ 3KYLA 3D5LA 5DD4A 4XN3A 3F22A 1Z05A 4CCNA 2QGUA 2F5CA 2L3DA 4HX8A 4I76A 4XKCA 1ZHFA 1JE8A 1QZZA 3NARA 2JSPA 2VI6A 3V42A 4ZYDA 2H94A 2Q2EA 2MVTA 2OAZA 2OCEA 5KVRA 3HOYJ 2BZTA 1MBFA 2LVSA 2X48A 2KIQA 1WZ2A 3PSIA 4IL6C 2Y0MA 1CF7B 1TW2A 3BY6A 2ECCA 1IUYA 4AYBN 3GWZA 4AM3A 1ZR2A 4Y4RA 1XX5A 2HOEA 2XGXA 2DN0A 4BU2A 3GTLJ 1IRXA 3TDZC 4E7ZA 1J0RA 4NQWB 2WY7Q 1H0MA 2PMHA 2HEOA 4PCQA 5HLHA 3TBIA 4UHTA 3ZQQA 2KQRA 4JQFA 1IN4A 3RYPA 3HOVJ 2VJ4A 1SMTA 4M72A 5HLGA 3HPHA 5F08A 2EFPA 1Y0UA 1X1PA 4EGZA 2V1XA 3AL0B 1G6NA 2DT5A 2FBIA 5KAIC 3JRBA 4GCVA 1W0TA 2HZTA 2EFQA 4G6TB 3OYBA 2IJLA 1ZRCA 5BOXA 2K9NA 3S93A 3LMMA 4KMUX 3R0JA 4GYGA 4M3EA 3EYYA 3WGGA 1D1AA 3MCZA 3RSNA 2BY1A 2MFZA 2P7VB 4MO7A 3RI4A 3QOPA 3G2BA 2ISZA 1WPKA 2F6CA 1MGTA 3FIWA 1BR2A 2L7FP 4OMZA 3Q9VA 5DYMA 2W7NA 1VQ4I 2A6HF 1MJBA 4V2GA 3ESWB 4HG2A 3MKZA 2YX7A 2DT7B 4NC8A 3HGYA 3IKTA 5C44J 2CJJA 2XKOA 2Q0OA 1QQIA 4AD9A 2M7BA 1AOYA 1R1UA 1WJFA 1BI2A 2TDXA 4DYQA 5BPDA 2X9DA 4GO1A 3LAPA 3GXOA 3GZ5A 4PUSA 4UVCA 5EEHA 1XGSA 3A4CA 4RB1A 2GA1A 3PFIA 1Y6IA 4D1QA 1YW7A 1YW9A 3M8FA 1Z21A 4A0YA 2L5QA 4RM3A 4KJZA 5ICEA 4YFKF 4LIVA 2M8GX 3V8JA 1JKRC 4LB5A 3CP2A 2KJCA 4DBQA 5HNHA 4G8XA 1X3ZB 2R4GA 1X2MA 2OD5A 2VPRA 2Y31A 3FHZA 2DA1A 1Z77A 1W0UA 3KP7A 3KYCB 2IPQX 1K6YA 2XAGA 5B1AH 3MKWB 2X98A 1U5TC 4L9TA 3S1QJ 2H8WA 4A6DA 2IBDA 2KIFA 3ZXSA 4S0HB 2DCEA 3A01B 3S3NA 5TGTA 1DGRM 2E35A 3TO6A 3HUGB 3E5XA 5E8GA 1ETWA 5LRSA 3R4KA 1XGMA 3HOUJ 5KNLA 2V9VA 3LA7A 4CHUA 3QU6A 5BQTA 5HOOA 4F91B 2FXAA 3A03A 3DLLF 2LYCA 1R71A 3VEPA 1MBJA 3LFUA 4NUBA 1FTZA 3F6VA 2HGCA 4XR6A 4ZZDA 3E6DA 4II2A 1K78A 4HA8A 3PIPF 1TQIA 3GFIA 2QZ8A 4WK8F 1E0EA 1FP1D 3F3XA 3ZQIA 1ZLKA 1MH4A 4DYRA 2PI0A 2VT3A 5D6EA 2M2EA 1V3FA 4EVIA 4IF4A 5K1YA 4HX7A 1TTYA 3T1BA 4A69C 2CV0A 5IOYA 4HDUA 3FXQA 3S3MA 2IGNA 1VNDA 4N9IA 3WU0A 2XUBA 1NH3A 1W36C 1WI3A 2W4SA 4KT5C 4DIQA 2DA3A 3I4PA 2HNHA 1QGPA 4JOMA 1R49A 5BNGA 3KZZA 2GOMA 2ID6A 4FQGA 2QF7A 4P9UA 2W48A 3WGHA 3IL2A 1UMQA 3SZGA 1XD7A 1FOXA 3VB2A 4XLEA 2KDOA 3JRHA 2NS0A 1NTCA 4XMYA 3CMEI 3L09A 3K0LA 5LFAA 4XRSA 1WJ5A 1SC7A 2FA5A 3BCAA 3JAMR 2GM4A 4O5VA 4DW6A 1S72I 3BG9A 2KPMA 2ZXHA 1BOBA 4IXAA 3HTUA 1BI0A 1IDYA 2EZKA 2WBMA 5CQGA 2BHZA 3S32A 4DYCA 3KETA 3U1DA 2JA8J 3CO7C 2JUGA 4Q4ZF 2Q2EB 5TISC 1AA7A 1T98A 2M30A 2R5ZA 4F92B 2VQGA 5K7HA 5GTIC 1Y0NA 2ZO4A 3GUDA 3HOZJ 4LG0B 3CDHA 2ACJA 1MBKA 2ZKZA 4A2UA 1SFKA 3M9AA 4LK0F 5TRDA 2G9WA 4IO9F 3C2BA 1RESA 3LSMA 1JKPC 2C6YA 1JJ6C 3RTRA 3I4NJ 1BM9A 2XGDA 5E3LA 2KISA 2OQRA 4UUTA 3OYFA 2E34A 3G4SI 3Q5FA 5HDNA 1ZG1A 2COMA 2Y0SN 1B8IA 3ONQA 1MSFC 3CF5F 3GO5A 5FKKA 1YX5A 3LNQA 3K4KA 1TNSA 2OCCH 2HQNA 2ZMEA 3CF2A 1OYWA 3PM1A 3HG9A 1P4XA 1IC8A 3H36A 3CUQC 3FMQA 3ERED 1ZGWA 5FFZA 5D8KB 2V6EA 4IOCF 3I58A 3EETA 2CYYA 3IV5A 1I1GA 3WTUC 1TWCJ 4HF2A 2CFOA 2Z1DA 2CRGA 4KISA 1Z91A 2WAQA 4HPQA 2KL4A 3HRSA 1HC8A 2ZCWA 3BTLA 4KT6A 4JX5A 2VQCA 1IF1A 3GVAA 3RPUA 3GW2A 3IP4B 1VF9A 2WB1A 4H4KC 4HX4A 4BH9A 5GAEJ 3J7AO 1G2HA 3K6GA 2JQ7A 2HXIA 1J59A 3LOCA 3ML6A 2VIXA 2E7XA 2IGMA 2IRFG 4WF2A 4BJ6C 2M87A 1BR4A 4M3DA 1RETA 2BGCA 4R8HA 5EF6A 1TWGJ 2I8DA 2LK2A 3S3OA 5IT9R 3BOQA 3LL7A 1EA3A 4MTDA 4Y52J 1B72A 3BZ6A 3GLLA 3DTIA 3LSGA 4OOIA 5F0HA 2R93J 2DA4A 4NB5A 1FYMA 3U9GA 1YS6A 1X58A 3QP5A 1J9IA 2XAUA 1LFUP 2BOLA 1OFCX 3I64A 4NC7A 5L3BA 1OJLA 2BBYA 4D7MA 3WTXC 1HW2A 1OR7C 4U0YA 2K9LA 5D6FA 3V4GA 1T0FA 1R7JA 4B43A 1X4PA 2JUCA 3FK7A 3J7AY 3RQIA 4F7ZA 4EEFG 4JX6A 2P6TA 5GADJ 5JI6A 1WQ2A 2STWA 1A5JA 1RC9A 2R5YA 4FT8A 1OQYA 5EGOA 4EM2A 4OMYA 1FJLA 4UUSA 4WXDA 1U2WA 5IT9K 4Y15A 3L2WA 3K1NA 4PFOA 4G9YA 3CO6C 1ZELA 3L1PA 1J7KA 1SANA 3H5RA 4DJAA 5KHDA 4MQVA 4HW0A 1PUFA 3K4CA 1ETXA 2JVGA 2EINH 3IHUA 2QYOA 3JRCA 2X1DA 3VODA 3KE2A 1U6GA 3ZQ7A 4Y13A 2HOTA 4RGSA 3DBRB 2HXOA 2EQRA 4C3HJ 1FSEA 5C4JJ 3GFMA 4BHBA 4GGGA 5D8LB 3G71I 2LF8A 2JN6A 2E1MB 1PJRA 4A93J 4BXFA 4RM2A 1KU2A 4XOTA 3ZQHA 4WWCA 4L9VA 5IYBJ 1IRZA 1MJ9A 2D2WA 3V8LA 3RZDJ 5CPRB 2K9QA 4XSZF 3IKVA 1STZA 3S1MJ 2K7LA 4FISA 1HA8A 5AONA 5DTDA 3U2RA 5CVIA 2DMPA 4OIRF 4EJTA 4N9HA 4XKBA 1SEUA 5AIPA 5F0CA 3ABMH 3P9CA 1HW1A 2VUMJ 3B6AA 3RKXA 1U5TA 1L0OC 2EWNA 3FDYA 2H8RA 1V5EA 5FGMA 5ILVA 2X0LA 1JGGA 3M4OJ 4BHPA 3CESA 3H3VK 3GFJA 4JK1X 4MEYF 3DFGA 2OBPA 1SFOJ 5BPIA 1ZG5A 5E20A 2VQHA 4RAYA 3ULQB 3G73A 4I09A 2R7QA 5FLXR 2DMUA 3L2VA 2LNBA 2UV1A 4HF0A 1F1ZA 2P0WA 4L0YB 2YS9A 4EJUA 4CCKA 1VQLI 1MNMC 1AHDP 2EV5A 2CW8A 4KN4X 3RIRA 5CYVA 3A1YA 1HBXG 2Z99A 4D5CA 2CUZA 4N4OB 3IH4A 3C18A 3MD2A 2HVSA 4GDFA 3CLQA 3BP8A 3IH2A 2IS2A 3HSFA 3ZMZA 2LKXA 2X85A 2W57A 3TKYA 3BG6A 2V9PA 3LSIA 2ZNYA 4IHXA 3O8GA 4EQQA 2DA2A 5ICFA 1S6LA 3I59B 2WTEA 1XS9A 1KU3A 3BTIA 4B47A 3ASNH 2PJPA 2E2JJ 2JT1A 4BQQA 2HDDA 2QBYA 1JUSA 4ZYEA 5B3SH 5E17F 2KT0A 3FISA 1LPQA 1G59A 3D5RC 2ZMEB 3HOTA 5DDGA 2M4GA 3OYEA 1IN7A 3BT9A 5F64A 2EH3A 3QYBA 1T95A 1ULYA 1B59A 4XLNF 2E2IJ 2W85A 2B0LA 2JZYA 2IP2A 2JPBA 2K27A 4HF1A 2IS6A 3BG5A 3M8EA 1YTYA 2Z16A 2R7SA 3H0GJ 2XB0X 1JXSA 1LVAA 1FY7A 4LLNA 1A36A 1F36A 1RPWA 3OYCA 5FFXA 5HDGA 5M5YJ 3W6VA 1GV5A 1SFEA 2TCTA 3U1KA 2LY9A 1PP8F 3S1RJ 1Z6TA 1G3TA 4A6EA 2L0KA 4M6VA 5EG0B 1U3EM 4TV7A 4AYBA 3K4NA 1KYWA 1Y56A 4E7HA 1RR8C 1HLVA 3OL4A 2XSJC 1IRFA 2MD5A 2EB7A 1USSA 2LRDA 1ZK8A 5DUIA 2M7AA 3F8NA 4FE7A 1FOYA 4C2MJ 3FKJA 2EZHA 1BI3A 3CCVI 3H1CA 2DI3A 3ISPA 3MVPA 4R1HA 2M34A 1IO2A 2ZBKA 2DA5A 1GXQA 2DPUA 1X1CA 4MHGA 2R7RA 3ABKH 4CSWA 3GTGJ 3G1MA 3BQYA 1R22A 1A31A 1DP7P 1DPRA 2OZUA 5H6RA 2XF6A 5GAGJ 3H3ZA 2RGVA 4GYIA 1JT0A 4L5JA 4L18B 2BY3A 1YIOA 2OC6A 2GXGA 1YO5C 1PDNC 2H6CA 2DW4A 1HOMA 4PFPA 2K4BA 2MC3A 4RMNA 2FRHA 3DEUA 4OIPF 1P6RA 4CCLA 2H1LA 2Z33A 5EGOB 1JUMA 3CCJI 3BLYA 3V7CA 5HDKA 2MSYA 3OV8A 3SQNA 4M74A 4CDGA 3DLAA 2LR8A 2PMZN 2GQQA 3TO7A 4O3MA 3ABLH 4XL9A 1LFPA 1QVTA 4XRSG 3ZMTA 2UXNA 3EQLF 2DMQA 4BDZA 1SD4A 1YJWI 3UR3C 3L9FA 4KYWA 2X6OA 2CGPA 2NNNA 1LJ9A 2PG4A 3A0BC 2GBYA 4O6JA 5GPAA 5KAFC 2VE9A 4B8XA 5IP7J 4XM3A 3K2ZA 3GTPJ 3JRIA 2IVMA 3ZN0A 3I0TA 5ILSA 4YG2F 2VOOA 1OR7A 4XN0A 2HTJA 3L2QA 4UVAA 2F5VA 3EYIA 1I27A 2B63J 4KMFA 4U7DA 1R5HA 2VKDA 1SVLA 3V7RA 2OQGA 5J8FA 1OMIA 5CQEA 3ASOH 3VWBA 3LSKA 1P9QC 5M3FJ 1ZKGA 4BQAA 3HRMA 2DOFA 3OYDA 1MSEC 3FXRA 4ETSA 1LUJB 4BYYA 3U21A 1UG0A 3FHNA 1BW5A 1UELB 1LVKA 1IGNA 1WCMJ 1MBGA 5K7ZA 1R36A 4L0ZB 3AG1H 3OIPA 2PEXA 1I39A 5DM7F 4Y17A 1W5CC 4G6DA 4XLCA 1V5FA 2WA0A 3BTJA 5FKNA 1FTTA 3SFZA 3GYHX 3FWEA 1H88C 1VQNI 2R92J 3DP7A 3ZOBA 2R7OA 1UJ8A 2F4MB 1NK2P 1UCRA 2DQLA 1B1BA 2DJIA 4B09A 3MFKA 4UUVA 3GCMA 2EIJH 5HLIA 1DGWY 1VQ9I 3GZNB 2DXIA 3DCFA 3QYEA 5LHIA 3ECOA 2VJJA 4XLFA 4XOPA 1JHHA 2ELHA 3I5UA 4EM0B 1P4WA 1B6AA 3SJMA 4JYKA 2O0YA 3DQVC 3LQQA 4XIDA 4I2OA 2X1EA 5IT9Z 1XB4A 2VJ5A 1AKHA 3BJAA 3AFHA 4BL0B 2EIKH 3RKYA 1OCOH 2O8XA 3L2UA 1WH7A 3QQAA 1U78A 1OLTA 3BR2A 4B4CA 3DKXA 1O7LA 1VQMI 3GTQJ 1J5YA 2NVYJ 4RBOA 1I50J 4V2FA 2ZB9A 2VBXA 3T8TA 2L4AA 4EJOA 2Y30A 4UVBA 3ZRGA 2P4WA 4A3BJ 1TBXA 3IH3A 3T8RA 2L7ZA 3HBLA 1LE8B 2AO9A 2RKHA 1MDMB 2DJNA 1XGOA 1T0FC 3V7SA 3L00A 1WWXA 1KYZA 3Q0WA 2BW3A 4M9ZA 2K5CA 2GXBA 3HIFA 1M1EB 2STTA 2XAHA 1Q1VA 1HQCA 3H5NA 5IOZA 2X4HA 4CXFA 1JI8A 3TO9A 3LA3A 1BIAA 1S29A 1IG7A 5FKMA 5TJJA 1G3WA 3CCEI 1A6IA 2FMLA 2MYSA 4UXNA 2M1BA 2M9HA 1E2XA 1I6XA 1WJCA 3H35A 1UAAA 2DPDA 1WKMA 2P81A 2A3SA 4A12A 1G8XA 3CTAA 1GVDA 1SAUA 2A5WA 3MKLA 2BXYA 1K83J 2VODA 3S14J 5FRNA 4Z6YA 3HOXJ 3DEEA 2QSHX 3O2PE 2Y0SA 4NHJA 3E6BA 5DCMB 2DTZA 3K4MA 3OYJA 2V4JC 3CC7I 4MTEA 3BJOA 2Y9ZA 2AXTC 3FBNB 1JTXA 3BZKA 4IRHA 1YG2A 4HSTA 3CUQB 5CJ9A 2K9MA 1FEXA 4G12A 1ZH5A 2FNAA 2XVCA 2XAQA 1GUUA 2E7WA 2JSCA 4LGWA 2XF7A 4XLPF 2WAEA 1FYKA 2KRFA 4PZJA 3LSRA 5E18F 2IA0A 4HV6A 3QOEA 1NG7A 4HAMA 2E2HJ 4HRIA 2RVCA 3FX3A 3GZ6A 3TGNA 2WY8Q 4IOAF 5J1YA 3PNYA 4YIRX 4KDPA 5CLSA 5FLXZ 3H0DA 1P7IA 1DU6A 3HPGA 3CC2I 2ELKA 4D5FA 1E3OC 2R7FA 1TZLA 4P9FA 4EATA 1HDPA 3LSJA 3LFKA 2E71A 3ZMUA 4EGYA 1I5ZA 3VOEA 2QCOA 4U88A 2LKPA 1GV2A 4I6ZA 2FD5A 1RZ4A 3CZ6A 2VT2A 2JJ7A 2QQ9A 2EA2A 2YU9J 3HOSA 2XRNA 3CC4I 3L2RA 4PGHA 1ZRDA 4HNTA 3N97A 5LBQA 4IPAA 4CH7A 1OCCH 1IN5A 9ANTA 1YI2I 1WVRA 1WSUA 1W1WE 4F3QA 2JPCA 1UFMA 5LD2C 3PUBA 2HQ5A 2HVQA 3BC8A 4J00A 4D9JA 2XC7A 3F8FA 4ESFA 1F9NA 2VONA 3WU1B 1X4OA 2DDBA 4PJMA 3E6MA 1BW6A 2ZSHB 4CCOA 3WG7H 1Y1VJ 4AC0A 4M9SA 2VC1A 3JTGA 4PJJA 5LRRA 5A2QR 1SD7A 1YS7A 1HF0A 2XV4S 1IN6A 1TL8A 3WTWC 5GAHJ 2P0TA 1V4RA 3E6CC 1LKXA 3AG3H 2WV0A 1R9TJ 1BOAA 2OPTA 4UV9A 5LGUA 2XIGA 1YJNI 1QU3A 2XHKA 2HVRA 1F43A 1IUFA 3OIOA 1IXSB 2Q1ZB 4XLHA 1XC5A 5JR3A 4E4HA 2N8GA 4BAYA 2JTVA 4MIMA 4W97A 3ERMA 2VJIA 2K9SA 5J40A 2JK3A 2ZJQF 4RS8A 1T33A 4RGRA 2HDCA 4RGUA 4AIJA 1Z3YA 1ENHA 4A5MA 3P7NA 1W5TA 2CH0A 5B5EC 4YRVA 1AU7A 1P92A 5FROA 5A2QK 4G94A 2UWMA 1Z0XA 4KIGA 1K79A 2L02A 3FZVA 3DPUA 5KCMA 4FX4A 2QUFA 3KP4A 1A35A 4B48A 1EH7A 3AL0C 4Z2YA 5BS6A 2OF7A 2R7WA 1RIOH 3TW6A 1FPQA 1EH8A 5IY5H 3I56I 3DKWA 1LEAA 2PLYA 4CO8A 4HLXA 4HNVA 3H5AA 2FOWA 3D0SA 3JAMK 2CUEA 2HFHA 2KRCA 2NS8A 3HSEA 5F1JA 2M8EA 4M73A 5IYDJ 2LFBA 2W82A 3OYAA 3BR3A 4ZDOA 2BW3B 3N05A 5M5XJ 1QHHD 2DMNA 1TC3C 3BJ6A 4L9JA 3F23A 2CFXA 1BL0A 1YQAA 2W1OA 4A3GJ 3SXYA 1O3SA 3E5UA 1P4AA 3GEZA 1R4NB 4Y7NJ 4I0AA 1QVUA 1IV6A 1FC3A 2HPIA 3BR5A 3E7LA 5EEAA 1O3TA 1OKRA 3CJNA 4BACA 1CQTA 2YR2A 1JT6A 1O57A 1S5LC 2MD0A 4M6XA 1LFBA 1EKEA 1T08B 2D1HA 3AKZA 5J6XA 3DPLC 3AAFA 3EDPA 3CCMI 4RAFA 2ZXJA 3OSFA 4C3IJ 1XMAA 4A3FJ 3F0CA 5E3OA 4C3JJ 1X1AA 1BJAA 5EJCA 2YUSA 3IWFA 3SFIA 1MIJA 1P2FA 2OA4A 1KQ0A 1TLHB 3PQJA 1S7EA 3N4MA 2XASA 2QM3A 2FMYA 3JW4A 3PO3J 2R7TA 4M3GA 4HNUA 4E7KA 1RI7A 2DK8A 3CQZJ 3DV8A 3MWMA 1X3WB 4ZYGA 2KHMA 3HZJA 3G1LA 3FF5A 2K86A 4UNOA 1V54H 4N0BA 4DZJA 4HQEA 2VASA 2EFNA 1HXDA 1I3AA 3FXMA 4RDUA 3VYTB 2F5EA 2AS5F 3DF8A 3KFWX 1ODDA 3HHHA 4C2TA 1ZYRF 2VXDA 2DA7A 3BDDA 4MFEA 5HS9A 2A68F 5K7FA 1Z9CA 3HL2A 3MEXA 1DP3A 4L9NA 1Z7LA 5FKOA 4B1RA 2K40A 4X0GA 4ZC3A 2HYJA 4OAYA 4M3FA 3K1PA 3CJTB 4LFUA 3J81R 3K10A 1I1SA 3CDLA 2FU4A 4FTHA 1HW5A 2BY2A 2IEKA 2BVMA 5E3NA 3IRRA 3R6SA 2LBFA 5DD8A 5ICCA 1TWAJ 1JKOC 1K78B 2MABA 1V55H 3KP6A 5EDNA 1ON1A 1D0ZA 2FOKA 2VE8A 2A5YB 3CCLI 3COAC 4MQ9F 1ITYA 5FKLA 1W7PA 1YE9A 2VKVA 3GF2A 1XGNA 2XPWA 3VDXA 4YFNF 1QZYA 5HS8A 3W6KB 2L9VA 4MLOA 3H9JA 2DYSH 1R1TA 4RA2A 3G6EI 5D5UB 1FX7A 1A6QA 5L3EA 2HU9A 1FP2A 2IA2A 5FD5A 3ZQLA 1WRJA 2ECBA 2P7CB 3S2DJ 3DBHB 3DEWA 4AUXA 3F8MA 4UY8I 2RC4A 2QKMB 3CJRB 1R6RA 2P5VA 5H20A 2CQXA 2B9SA 1FSHA 4BQOA 1ORKA 3WG9A 2K3FA 1WJBA 2MG4A 2VKHA 4ZDPA 4BKXA 5IP9J 2QWWA 1R5GA 2EPFA 1IW7F 2HKXA 2PMZA 5LHHA 2COBA 2AHQA 2CMPA 1UHMA 3D5SC 4M71A 1JJ8C 4IX7A 1F4KA 3MZ8A 2A61A 1KU9A 4ZJZA 5F1RA 2X1CA 1ZREA 1TWHJ 4IHWA 2ID3A 3PO2J 2M45A 3FM5A 2HYGD 1RQ6A 3O3KA 5LLQA 3AG4H 2CQQA 2NVQJ 2R5ZB 1K61A 2W00A 1WJAA 2DOEA 3ABUA 3LWFA 2O6GE 1U8RA 1Z3XA 4XK4A 2DLLA 1VZ0A 2NAZA 4H0EA 1O3RA 2FQ4A 3OYMA 3OR1C 1ONVA 3TMOA 3KCCA 2I5UA 2BE5F 3Q3SA 2X6YA 3KEQA 4DBRA 2EZIA 5CVUA 5HS7A 1SVMA 1DQUA 3LAJA 2UZKA 4KFCA 2GLOA 1B8IB 1B9NA 4A3EJ 3K4LA 4YFXF 4U87A 2KZGA 3EUAA 4Y33A 4ESBA 3L7WA 1XMKA 3BG3A 4CGZA 2WC2A 3BZCA 4OIOF 5FLXK 2EK5A 2DA6A 4MFDA 2L9RA 4YIFA 5EEGA 3M8JA 1KQ9A 2FUG2 3CMAI 3IUOA 3JRFA 2DU9A 1FIPA 1CF7A 1FZPB 4QIWN 3RKQA 2NS7A 3NWSA 2X6XA 2VC0A 2LKSA 4HYEA 1UZCA 4NQWA 2F5FA 4AVPA 3QU3A 3KPHA 4LOCA 3HHGA 1R58A 4IHYA 1S9HA 4PK4A 3WTTC 1QZEA 1XTAA 1HKQA 3TEDA 3QPSA 4A3IJ 2JVHA 1VQKI 2HKOA 2XRLA 2VBZA 3DU5A 1FIAA 2MA3A 2XDVA 5F0FA 3GTKJ 3F6OA 3K69A 1T6SA 3IC7A 1RKTA 3W6JB 3JRDA 1WHUA 1B72B 5FD6A 4LIUA 3KYDB 1WJEA 2RNGA 1Y8QB 3HJEA 3TOAA 4HV5A 5K5OA 1HCRA 1BN5A 4M9XA 2DFIA 3F9KA 4W1UA 1D1CA 3DTKA 5J8CA 3CD6I 1QO0D 2VBYA 1MZBA 1EJ9A 1FLIA 1SFXA 3CCYA 2GA2A 4ENJA 2LMDA 2D45A 4M3BA 1X1BA 4ZZLA 4I7HA 1KGSA 2K3PA 2VL8A 4FX0A 1FOKA 1TNTA 3H9GA 5A2QZ 4KIBA 2H1KA 4CA0A 4S05A 2R5YB 3MZYA 5D4RA 2LTPA 2XKPA 5D4SA 4ZDLA 5K5QA 4RAZA 4UUSB 2Z2SB 5H6QA 4ZTJA 2R7UA 3W2VA 2RAEA 3K9TA 2CSOA 2PN6A 1PUFB 4BNCA 3CJQB 3JAMZ 2HZDA 3AG2H 2E1NA 3E0JB 1VTNC 3C1DA 4KICA 2L7KA 1ZR4A 4WX9A 3OY9A 4BE0A 2GWRA 2HPMA 1TP4A 2DFEA 2FSWA 1YFHA 1D1BA 2DYRH 1ZGJA 2DFFA 5E79C 2O9LA 1MNEA 4KN7X 5E3MA 4E7LA 1BA5A 1KONA 3FXLA 2M3AA 3VPRA 4BHCA 4BDYA 1FYLA 4A3CJ 2DBBA 3OS0A 2OTJI 2IGOA 2F48A 3SZTA 1S7AA 3ZQGA 3W2AA 2ETHA 4F55A 2ME0A 3TP0A 2WWYA 1W7PB 3S1NJ 3BQZA 3A01A 2Y9YA 1C0WA 1D5YA 4V19K 3QYFA 3S16J 1HSJA 3HUGA 3SZPA 4E70A 3GTJJ 2CS3A 2VLAA 3FXJA 4IHTA 3MKYB 2VPLA 3BPVA 1ETQA 3HC7A 1RUNA 4HLYA 2KZVA 3NRVA 4I01A 4IHVA 2KFDA 2OU2A 4AU7A 1BI1A 3CUOA 3M1EA 1U5TB 3NEUA 5FO5A 1ERDA 4ANJA 1XG1A 2EV0A 2FE3A 3FBIB 1GT0C 1OCTC 3RZOJ 1IV8A 2BY0A 3I4MJ 1QNTA 4CUGA 4K2EA 1DUXC 2QQ8A 3LSTA 4BJTA 2VXZA 3TQNA 4BXXJ 3JSPA 2CQKA 5LEJA 3HDDA 3F72A 2M35A 2E5ZA 2X6WA 3PFYA 5FLMJ 3OYNA 2H27A 3HKZA 1QBJA 5DUKA 1YRNA 3QODA 3F8CA 4X6AJ 2Q8KA 2A05A 1ZLJA 2O5RA 1IXRC 4E7IA 2JA7J 3A02A 4PSWA 1LDDA 3KP5A 2HQRA 4RGXA 1RUOA 2OUMA 4IHSA 5HODA 2QEXI 3TDUC 2NVUB 4GRIA 2CV1A 3PL8A 1YW8A 4B44A 5HNFA 2QQAA 3QRFF 4WXHA 3OOPA 3P5JA 2J5OA 4FE4A 3QPLA 2QBYB 4XKVA 3WE2A 5EZGA 4WCGA 1O7FA 2L54A 2K85A 3ZMVA 1T38A 5CVRA 1LNWA 1XDSA 1VI0A 1MH3A 2L9NA 2P6SA 2QSFX 3OYIA 3J80R 1OYYA 2XAFA 4ENKA 1OCPA 1D3YA 3WHBA 1G3YA 1R1VA 3CCUI 1K4TA 2TRTA 1QHGA 1XMXA 3A0HC 2O3FA 3GMEA 2H6BA 4A0XA 4LG0A 5F27A 2XB5A 3G3ZA 1POGA 1VQOI 2RNJA 2NOGA 3ZMSA 2FX0A 4E7JA 2PMUA 4RB0A 1FMWA 3LSPA 3H9QA 2W84A 1VQ7I 4EMSA 4U0VA 2RQPA 2OZ6A 4LJZF 2W25A 2D1VA 2XGCA 2XPVA 4PJ0C 1BR1A 1HKSA 1IZ1A 1OPCA 3H92A 3I54A 3J81Z 3KLOA 1GHCA 1TQMA 2L9SA 4IJAA 1N77A 3OMYA 1K4SA 3O8HA 4CCMA 5DEQA 3EUHC 3J80K 3HXLA 3R61A 1VFCA 1H8AC 3BCBA 3K7AJ 1NHAA 3NQOA 1ACIA 2F5DA 3G1OA 1EF4A 2EILH 4XICA 3RPQA 3O6BB 5FLVA 1QPMA 4G7HF 2EFWA 1YIJI 3FXUA 3FK6A 3ZQFA 2IGKA 3CMMA 2LOOA 4HZFA 3RJPA 5JHFA 4LMYA 4A0ZA 4LLGF 4EJVA 1VQPI 4C2UA 4M6YA 5EYRA 3SEZA 3K4JA 3JCUC 2Y69H 3I55I 1SFUA 1J09A 2CU7A 5AIQA 3J7AW 4ESJA 5DCFA 2O7OA 3HRTA 2MW8A 3R60A 1AWCA 2GXAA 2LC2A 1QA6A 2ZC2A 3M07A 4HDVA 3A2KA 1MBEA 2NNYA 1MBHA 3QWLA 2YX4A 4BJ5C 2OJED 3EUKL 2KRHA 2QVOA 1YYVA 4BEHA 4DOZA 3M7GA 1TT5B 5JHUA 5LGNA 1MMDA 3UKGA 1OCZH 1PYVA 2BVLA 1YJ9I 2XAJA 3VYSB 2KMUA 2RDPA 2X51A 3WODF 3JRAA 3GLXA 4J19A 2HTSA 5CVVA 4XRFA 2AQFA 4IKFA 3C7JA 2JMWA 2ZSIB 2IS1A 3PJRA 5JLWA 2AQEA 2Y48A 3FXKA 3CLOA 2R7ZJ 3ELKA 2JA5J 2XPUA 3M3YJ 3SHFA 3ZP5A 2A6TA 1KA8A 2ADUA 3QPTA 4MNUA 1YX3A 4QPOA 4C9YA 1MD0A 2RREA 3PNTA 2M4KA 3C3WA 3E3VA 2ICWG 2HQAA 1XSXA 3HKZN 2RQQA 3DU6A 2E1CA 2CQNA 2O61A 4C30A 1HKTA 1FMVA 1LEBA 2HDWA 1ETKA 2Z3YA 3CDIA 5LGTA 1GXPA 1KQ8A 1VQ5I 4HSRA 2DAOA 4A3DJ 2FF4A 3VSLA 4CZCA 2CO5A 2DFHA 1MMNA 3WE3A 1SMYF 4NBQA 1FWZA 4NDLA 4IQ4A 4X1EA 3KEYA 3I71A 2A69F 4BY7J 1JGSA 1MMGA 2J5PA 2R7VA 1ETVA 5EZHA 1X2NA 3V8KA 3VYUB 4FASD 2FJ1A 2HOSA 4P96A 1PVEA 3OWTA 2IXSA 2OV7A 2LY2A 1E3PA 3MQ0A 2M0CA 4E6KG 2L01A 2I10A 2YU3A 4AWXB 1MNDA 5GP9A 1MMSA 4ZYAA 3BR6A 4ZH4F 5J47A 4LLLA 3HSRA 4HEA2 4YEJA 2V1NA 2IA1A 2GIZA 1YRNB 1HSTA 4XORA 3LSHA 4G6QA 4QWQA 1ZQ3P 6PAXA 2FEZA 1ETYA 3K2AA 3I53A 2Y2ZA 3FM3A 3BR0A 2JRTA 4Q47A 2B7EA 3PSFA 4RB2C 5D5WB 2PFBA 5FJ8J 2ZJ2A 4OAZA 4WXCA 5JVGF 1V5GA 5B66C 1LDKB 3L2CA 2QENA 3RCOA 3KP2A 1AKHB 2V1UA 2UUZA 3I3LA 2IT0A 4A3KJ 5IP6A 1S7OA 5F04A 3PNVA 1BJZA 2NXNB 5L3FA 1Z7UA 2P5LC 1J2XA 3HM5A 2ZFWA 1XCBA 3IAM2 3KZIC 4XQFA 4IQJA 2OTLI 2G0EA 3GX4X 1H89C 4BGDA 1YITI 2VB6A 1N25A 4JBAA 5LEKA 4G7ZF 1I3QJ 3K70D 1JTYA 2E5NA 5DS9A 4LG3A 4DQ2A 1VQ6I 4N4NB 2D5VA 4L5IA 2RV8A 4ZYHA 4KUMA 2KJBA 3J7ZI 2LDUA 4I02A 2Y75A 2E19A 3X2QH 3K4BA 4Q48A 2LG4A 4D0PA 4EV0A 2XGEA 2ISYA 2MBFA 3F8BA 1P7JA 1RKWA 3IRQA 3KZYA 1L3LA 1DDNA 1UHSA 4ITVA 1X1DA 2HI3A 4ON0A 3I59A 4PJNA 1Z6RA 3RDIA 4HOBA 5J4VA 1U8BA 2MLKA 4Y3OA 1WGXA 1K7AA 1ZARA 4F93B 3WHCA 1Z67A 4I99C 3C2GA 3DXJF 3KLNA 3B6CA 4FETA 5D5VB 4XONA 5IYCJ 3K1MA 5ED4A 2KIUA 3MZHA 5F6FA 2GAUA 2IAIA 2NOJB 3OYKA 1YLFA 1UG2A 2KP6A 2F4IA 1XCVA 2K02A 4MGRA 2WADA 2PJRA 5E1WA 1N78A 3QAHA 3LQRA 2PBIA 2G7UA 1R23A 2BYVE 3MAJA 1E17A 1ZAOA 4UB8C 1MMAA 2FBKA 2ZNZA 4BQNA 1SAXA 2MC4A 2XSDC 1WH5A 1BIBA 3PIOF 1IXCA 4U7BA 2NVTJ 3IWZA 1B9MA 2YSRA 2ME6A 5ILUA 4XBFA 4IZZA 2P5KA 2CWEA 3OYLA 3F21A 4HBLA 5EG0A 4I98B 2JRMA 3KIOA 4BEHB 1Y8RB 3QPHA 3H3UA 3TOBA 5J4YA 1XSDA 1YOVB 2HYFA 3FMRA 4YIIA 2EV6A 1RR7A 3VFZA 5E8IA 3CCRI 1IJWC 1B4AA 3I9V2 1REPC 2R3SA 4P5OA 3HB9A 5C3EJ 1KZHA 1FNNA 4DNCA 3BPXA 2DT6A 4RB3C 3EUHA 2NYXA 1Y1WJ 3KEOA 4G7OF 2IW5A 3S17J 5IT3A 1UB9A 3OIQA 1VQ8I 4B3AA 4BE2A 5BMZA 3P9KA 3CP8A 1PUEE 4PJLA 5L3CA 1U9OA 1FOWA 4PSXA 2M0MA 4HQMA 2WV1A 2P8TA 4XKWA 3FKIJ 1S8NA 4JP0A 4LD5A 1R00A 1SD5A 5E1ZB 1UHWA 1YHQI 1BC8C 4GFBA 2V9KA 1GVJA 5K5RA 2DTRA 3NAUA 4OWRB 1BC7C 1XSVA 4B3XA 1D5VA 3ZMDA 1QPIA 4LK1F 2F4OB 3BR1A 3J7YJ 3JSOA 1FT9A 2HR3A 2KLOA 2QLZA 5CKTA 2ZXWH 1NK3P 3MMYB 4BBRJ 1WI9A 2DDAA 4RAGA 3J80Z 1R4MB 4KITB 3ZCOA 2EA4A 4FHTA 3SDGA 4P1WA 3S2WA 1OCRH 3SEQA 3WTYC 1JKQC 4E7SA 2FBHA 3J81K 3Q0UA 1LDJA 2V26A 3ZPLA 1TWFJ 3SYTA 1USTA 2CV2A 5H2FC 5CVJA 1Y39A 2HOAA 1NG6A 3Q9SA 5J1RA 1U0JA 3TW7A 2JWTA 4A3MJ 3DBLB 1I6HJ 2R7XA 1G4DA 2EIMH 1X3UA 1J75A 2O8KA 5HVQC 3CMYA 1K6OA 1WJDA 1N75A 1EV7A 5D5XB 4BXUA 3JRGA 1WFXA 2CQ7A 4FCYA 4A3JJ 1W5SA 1PP7U 4BBSJ 3OS1A 5GPCA 2BV6A 1ZTRA 5DM6F 4PGGA 4NC6A 1E3HA 2ELJA 3B73A 1MJAA 3RPUD 4OINF 4CYCA 3OR2C 2GOXB 2R0QC 5L3GA 3FMSA 2KIMA 2V1DA 4F52A 2L2OA 3WTVC 3CCSI 4U0WA 2DODA 2G7HA 2DK5A 1DPUA 4Q5SF 2MH9A 1JUPA 3ABTA 2ZXIA 5E1XA 4RLQA 3HYIA 2Z9OA 1FBUA 2MH2A 3OS2A 4RLFA 1U9NA 2QQBA 3Q0VA 4NNJA 2DO7A 2FNPA 2VOPA 2NRAC 1W4MA 3RYRA 3DPTA 2BEOA 3VYRB 2LD5A 2WAQN 3HOWJ 5LHGA 3MN2A 3UNGC 4LB6B 3S8PA 3GBGA 4ABZA 2R7DA 2ZFUA 3TP3A 3JREA 1KU7A 4L5EA 4P55A 1R5ID 5KK1A 2FQ3A 2WB1N 2VN2A 2ZJPF 1T39A 2A6EF 2L7MP 1O3QA 2BHYA 3TL4X 4OU0A 1D0YA 4UV8A 5DV5A 3BWGA 3WTSC 4J01A 1IN8A 5GTHC 3WU2C 4AIHA 2XF5A 1HDDC 3GTOJ 3WTZA 1EH6A 3DKYA 2DMTA 2EJRA 2K4JA 1SVOA 5L3DA 4BY1J 3D1NI 2CW7A 2V79A 2W24A 5HLTA 4KA4A 3W2WA 3K70C 3PUFA 1ZRFA 2LLKA 1X19A 3ZGKA 1LE8A 2PJRB 2JA6J 3EPZA 2E60A 2EFOA 1MDMA 1LQ1A 3WGIA 4GXOA 3IAS2 2UXXA 2EZLA 5B1BH 2MZ4A 4ENNA 1XDUA 4LITA 2GIVA 1XPXA 2LSOA 3W3CA 2ESHA 2AXLA 2DOAA 3CCQI 2GZWA 2LH9A 4AVZA 1D8JA 3ROUA 1W7PD 2VBWA 1OYIA 3HRUA 2V6CA 2QA4I 2XROA 4IEJA 2HS5A 3M1CA 3HGGA 4MEXF 1OISA 2ZJRF 4QTRA 3DWLE 4ENMA 3ECHA 4CYDA 1TT0A 3BTCA 1DU0A 1FBQA 5JVTA 1F5TA 4JX4A 2VKEA 2YPRA 4QSHA 3T0YA 4A5NA 1APLC 1TQPA 4D7NA 3GTMJ 2LREA 3PQKA 1XN7A 2F2EA 2H09A 4BE1A 1A04A 3JR9A 1JHFA 5FRMA 5DCMA 3B02A 1RNLA 3S15J 3ZR8X 4QPQA 1Q1HA 2MLGA 2E1MC 3E5QA 2E1OA 1MKMA 5JFRA 1H9GA 1O4XA 3CUQA 2A07F 3LA2A 4EM1A 2LY1A 1T8IA 2ESNA 2M5WA 4UB6C 1ZGAA 3S2HJ 2LF7A 5IPAA 1GLNA 2LBFB 2MGQA 1FBSA 1T56A 4EJWA 1Z1DA 3GFLA 4XNFA 3E97A 1ZG3A 2QSGX 4KNYA 3P9IA 2L4MA 4DZPA 1H9TA 4QLCU 2LP0A 2KKOA 5C4XJ 4AIDA 3BG7A 3REOA 1G3SA 4ZTFA 4IRIA 2Z5UA 4II3A 4CCJA 1D0XA 1BBYA 2JA2A 4A3LJ 3OSGA 3QP6A 1MW7A 4CZZA 1W36D 2CUJA 2QKLB 5J3LA 2KDZA 1IRGA 2IS4A 1S3JA 3OL3A 5FB2A 2PX9A 2PQ8A 1QRYA 3NWTA 3C2HA 4DGWB 4AIKA 2RN7A 5ICGA 1GDTA 3HTSB 3OYHA 3E1SA 2HWVA 1ON2A 1RRJA 3BROA 2MUNA 4OIQF 1D8KA 4XSXF 4ASNA 3R0AA 2WAFA 2VQLA 1LB2A 4BS9A 2EBIA 1IDZA 5M5WJ 3T5XA 3DTEA 3VSKA 2O03A 4I0BA 4R79A 1ETOA 3JTHA 5ERIA 4KIFA 4BUPA 3RQ4A 4XRMA 2CUFA 2DQRA 3HEFA 2E36A 4IRGA 5M3MJ 4CYCB 4YELA 1CGPA 3RKWA 1IAWA 5J1UA 4XLAA 3ZN1A 2CW0F 1ZN2A 3ZQCA
chains in the Genus database with same CATH topology
1TW3A 4CICA 1T2KA 2CG4A 1SD6A 4PDKA 3KP3A 4S04A 4IVNA 3D5LA 5DD4A 3F22A 1Z05A 2F5CA 2L3DA 4HX8A 1ZHFA 1JE8A 1QZZA 4ZYDA 2H94A 2Q2EA 2OAZA 5KVRA 2Y0MA 1CF7B 1TW2A 3BY6A 1IUYA 3GWZA 2HOEA 2XGXA 3TDZC 1J0RA 1H0MA 2PMHA 2HEOA 4PCQA 5HLHA 4UHTA 4JQFA 1IN4A 3RYPA 1SMTA 4M72A 5HLGA 2EFPA 1Y0UA 4EGZA 2V1XA 1G6NA 2DT5A 2FBIA 4GCVA 2HZTA 2EFQA 1ZRCA 2IJLA 5BOXA 4KMUX 3R0JA 4GYGA 3EYYA 3WGGA 3MCZA 2P7VB 3RI4A 3QOPA 2ISZA 1MGTA 4OMZA 3Q9VA 5DYMA 2A6HF 1MJBA 2YX7A 3IKTA 2XKOA 2Q0OA 1QQIA 4AD9A 1AOYA 1R1UA 2TDXA 1BI2A 5BPDA 4GO1A 3LAPA 3GXOA 3GZ5A 4UVCA 5EEHA 1XGSA 4RB1A 2GA1A 3PFIA 1YW7A 1YW9A 3M8FA 4A0YA 5ICEA 4YFKF 3V8JA 4LB5A 2KJCA 4G8XA 2OD5A 3FHZA 3KP7A 2IPQX 2XAGA 1U5TC 4L9TA 4A6DA 2KIFA 3TO6A 5E8GA 3E5XA 5LRSA 3R4KA 1XGMA 2V9VA 3LA7A 4CHUA 3QU6A 5BQTA 5HOOA 2FXAA 3VEPA 3F6VA 2HGCA 4ZZDA 3E6DA 1K78A 4HA8A 1TQIA 3GFIA 2QZ8A 4WK8F 1FP1D 3F3XA 1ZLKA 2PI0A 2VT3A 5D6EA 1V3FA 4EVIA 4IF4A 5K1YA 4HX7A 1TTYA 3T1BA 4HDUA 3FXQA 4N9IA 3WU0A 2XUBA 4KT5C 3I4PA 1QGPA 3KZZA 4P9UA 3WGHA 3IL2A 1XD7A 3VB2A 2NS0A 3L09A 3K0LA 2FA5A 4O5VA 4IXAA 3HTUA 1BI0A 3KETA 3U1DA 3CO7C 4Q4ZF 1T98A 2M30A 2ZO4A 3GUDA 4LG0B 3CDHA 2ACJA 2ZKZA 4A2UA 3M9AA 4LK0F 5TRDA 2G9WA 2C6YA 3RTRA 1BM9A 2OQRA 3Q5FA 5HDNA 1ZG1A 2COMA 3GO5A 1TNSA 2HQNA 2ZMEA 1OYWA 1P4XA 3CUQC 3FMQA 3ERED 5FFZA 5D8KB 3I58A 3EETA 2CYYA 1I1GA 3WTUC 4HF2A 1Z91A 3HRSA 2ZCWA 1IF1A 3GVAA 3RPUA 3GW2A 4HX4A 4BH9A 3J7AO 1J59A 3ML6A 2E7XA 2IRFG 4WF2A 2M87A 2BGCA 4R8HA 3BOQA 4MTDA 3BZ6A 4OOIA 4NB5A 1FYMA 3U9GA 1YS6A 3QP5A 1J9IA 3I64A 5L3BA 2BBYA 3WTXC 1HW2A 4U0YA 5D6FA 3V4GA 1T0FA 1R7JA 4F7ZA 2P6TA 5JI6A 1WQ2A 2STWA 4FT8A 4EM2A 4OMYA 4WXDA 1U2WA 5IT9K 4Y15A 3K1NA 4G9YA 3CO6C 1J7KA 4MQVA 4HW0A 3IHUA 2QYOA 3VODA 3KE2A 1U6GA 3ZQ7A 4Y13A 4RGSA 1FSEA 3GFMA 4BHBA 4GGGA 5D8LB 2LF8A 1KU2A 4WWCA 4L9VA 1MJ9A 2D2WA 3V8LA 4XSZF 3IKVA 1STZA 2K7LA 5AONA 3U2RA 5CVIA 4OIRF 4EJTA 4N9HA 5AIPA 3P9CA 1HW1A 3RKXA 1U5TA 1L0OC 2EWNA 5FGMA 5ILVA 2X0LA 4BHPA 3GFJA 4JK1X 4MEYF 3DFGA 2OBPA 5BPIA 1ZG5A 5E20A 4RAYA 3ULQB 3G73A 4I09A 2LNBA 4HF0A 1F1ZA 4L0YB 4EJUA 2EV5A 4KN4X 3RIRA 5CYVA 1HBXG 2Z99A 3C18A 3BP8A 3HSFA 3ZMZA 2W57A 3TKYA 2ZNYA 4EQQA 5ICFA 1S6LA 3I59B 2WTEA 2PJPA 1KU3A 2JT1A 2QBYA 4ZYEA 5E17F 2ZMEB 3HOTA 5DDGA 1IN7A 5F64A 1ULYA 1B59A 4XLNF 2W85A 2B0LA 2JZYA 2IP2A 2JPBA 2K27A 4HF1A 3M8EA 1YTYA 1JXSA 1LVAA 1FY7A 4LLNA 5FFXA 5HDGA 1SFEA 1PP8F 1Z6TA 1G3TA 4A6EA 1U3EM 4TV7A 1KYWA 1IRFA 2MD5A 2EB7A 1USSA 5DUIA 3F8NA 1BI3A 4R1HA 2DI3A 3ISPA 2ZBKA 1GXQA 2DPUA 4MHGA 1R22A 1DP7P 1DPRA 2OZUA 5H6RA 3H3ZA 2RGVA 4GYIA 4L5JA 4L18B 1YIOA 2GXGA 1YO5C 1PDNC 2H6CA 2DW4A 2K4BA 2MC3A 2FRHA 3DEUA 4OIPF 1P6RA 2Z33A 3V7CA 5HDKA 3OV8A 3SQNA 4M74A 4CDGA 3TO7A 2GQQA 4O3MA 3ZMTA 2UXNA 3EQLF 1SD4A 3L9FA 4KYWA 2CGPA 2NNNA 1LJ9A 2PG4A 4O6JA 2VE9A 4B8XA 3K2ZA 2IVMA 3ZN0A 3I0TA 5ILSA 4YG2F 2VOOA 1OR7A 2HTJA 4UVAA 3EYIA 1I27A 4KMFA 4U7DA 1R5HA 3V7RA 2OQGA 5J8FA 1OMIA 4BQAA 3HRMA 3FXRA 4ETSA 4BYYA 1R36A 4L0ZB 2PEXA 4Y17A 4G6DA 3SFZA 3GYHX 3FWEA 3DP7A 1UCRA 2DQLA 1B1BA 3MFKA 4B09A 4UUVA 5HLIA 5LHIA 3ECOA 1JHHA 2ELHA 3I5UA 4EM0B 1P4WA 1B6AA 2O0YA 3DQVC 3LQQA 4I2OA 5IT9Z 1XB4A 3BJAA 3RKYA 2O8XA 1U78A 1O7LA 1J5YA 2VBXA 3T8TA 2L4AA 4EJOA 4UVBA 2P4WA 1TBXA 3T8RA 2RKHA 1MDMB 1XGOA 3V7SA 3L00A 1WWXA 1KYZA 4M9ZA 2GXBA 3HIFA 2STTA 2XAHA 1HQCA 2X4HA 4CXFA 3TO9A 3LA3A 1BIAA 1S29A 5TJJA 1G3WA 2FMLA 4UXNA 2M1BA 1E2XA 1I6XA 2DPDA 1WKMA 2A3SA 4A12A 3CTAA 2VODA 3O2PE 4NHJA 3E6BA 5DCMB 4MTEA 3BJOA 4IRHA 1YG2A 3CUQB 5CJ9A 1ZH5A 2FNAA 2XVCA 2XAQA 2E7WA 2JSCA 4LGWA 4XLPF 1FYKA 2KRFA 4PZJA 5E18F 2IA0A 4HV6A 4HAMA 2RVCA 3FX3A 3GZ6A 3TGNA 4KDPA 5CLSA 5FLXZ 2R7FA 4P9FA 3LFKA 3ZMUA 4EGYA 1I5ZA 3VOEA 4U88A 2LKPA 1RZ4A 2VT2A 2QQ9A 2EA2A 3HOSA 2XRNA 4PGHA 1ZRDA 3N97A 5LBQA 4IPAA 1IN5A 1WSUA 2JPCA 1UFMA 3F8FA 4ESFA 1F9NA 2VONA 3WU1B 3E6MA 4M9SA 2VC1A 3JTGA 5LRRA 1SD7A 1YS7A 2XV4S 1IN6A 3WTWC 1V4RA 3E6CC 2WV0A 1BOAA 4UV9A 5LGUA 2XIGA 2XHKA 1IXSB 5JR3A 4BAYA 2JTVA 4RS8A 4RGRA 2HDCA 4RGUA 4AIJA 4A5MA 3P7NA 1W5TA 1P92A 5A2QK 4G94A 2UWMA 4KIGA 1K79A 2L02A 3FZVA 4FX4A 2QUFA 3KP4A 1EH7A 4Z2YA 5BS6A 1RIOH 1FPQA 1EH8A 3DKWA 1LEAA 2PLYA 4CO8A 4HLXA 3JAMK 3D0SA 2HFHA 3HSEA 2M8EA 4M73A 3BJ6A 4L9JA 3F23A 2CFXA 1YQAA 3SXYA 1O3SA 3E5UA 1P4AA 3GEZA 4I0AA 1FC3A 1O3TA 1OKRA 3CJNA 2YR2A 1O57A 4M6XA 2D1HA 5J6XA 3DPLC 3AAFA 3EDPA 2ZXJA 1XMAA 1BJAA 3IWFA 1P2FA 2OA4A 1KQ0A 1TLHB 3PQJA 3N4MA 3JW4A 2XASA 2FMYA 2QM3A 1RI7A 2DK8A 3DV8A 3MWMA 4ZYGA 3FF5A 2K86A 4UNOA 4N0BA 4HQEA 2EFNA 1HXDA 2F5EA 2AS5F 3DF8A 3KFWX 1ODDA 3HHHA 1ZYRF 3BDDA 5HS9A 2A68F 1Z9CA 3MEXA 4L9NA 3K1PA 4LFUA 1I1SA 2FU4A 1HW5A 3IRRA 3R6SA 5DD8A 5ICCA 1K78B 3KP6A 1ON1A 2FOKA 2VE8A 2A5YB 3COAC 4MQ9F 1W7PA 3GF2A 1XGNA 4YFNF 1QZYA 5HS8A 3W6KB 1R1TA 5D5UB 1FX7A 5L3EA 5FD5A 1FP2A 2IA2A 1WRJA 2P7CB 3F8MA 2RC4A 2P5VA 5H20A 1FSHA 3WG9A 2QWWA 1R5GA 1IW7F 2HKXA 5LHHA 4M71A 1F4KA 1UHMA 2A61A 1KU9A 5F1RA 1ZREA 2M45A 3FM5A 2HYGD 3O3KA 5LLQA 3ABUA 3LWFA 2O6GE 1U8RA 2DLLA 2NAZA 4H0EA 1O3RA 1ONVA 3KCCA 2BE5F 3KEQA 5CVUA 5HS7A 3LAJA 2UZKA 4KFCA 1B9NA 4YFXF 4ESBA 3L7WA 1XMKA 4CGZA 2WC2A 4OIOF 5FLXK 2EK5A 4YIFA 5EEGA 1KQ9A 2DU9A 1CF7A 1FZPB 2VC0A 4HYEA 4NQWA 2F5FA 4AVPA 3QU3A 3HHGA 1R58A 3WTTC 1HKQA 2HKOA 2VBZA 2MA3A 3F6OA 3K69A 1T6SA 3IC7A 3W6JB 5FD6A 3TOAA 4HV5A 5K5OA 1BN5A 4M9XA 2DFIA 5J8CA 1QO0D 2VBYA 1MZBA 1FLIA 1SFXA 2GA2A 4ENJA 2D45A 4ZZLA 4I7HA 1KGSA 4FX0A 1FOKA 1TNTA 5A2QZ 4KIBA 4S05A 3MZYA 5D4RA 2XKPA 5D4SA 5K5QA 4RAZA 5H6QA 3K9TA 2CSOA 2PN6A 4BNCA 3JAMZ 1VTNC 2E1NA 3C1DA 4KICA 4WX9A 2GWRA 2FSWA 1YFHA 1ZGJA 4KN7X 4BHCA 1FYLA 2DBBA 3SZTA 1S7AA 2ETHA 2WWYA 1W7PB 1C0WA 1HSJA 3HUGA 3SZPA 4E70A 4IHTA 3BPVA 1RUNA 4HLYA 3NRVA 4I01A 2OU2A 1BI1A 3CUOA 3M1EA 1U5TB 3NEUA 5FO5A 2EV0A 2FE3A 1QNTA 4K2EA 1DUXC 3LSTA 2VXZA 3TQNA 3JSPA 2CQKA 5LEJA 3F72A 2H27A 1QBJA 5DUKA 3F8CA 2Q8KA 1ZLJA 1IXRC 1LDDA 3KP5A 2HQRA 4RGXA 1RUOA 4IHSA 3TDUC 1YW8A 2QQAA 3QRFF 4WXHA 3OOPA 2J5OA 2QBYB 3WE2A 4WCGA 1O7FA 2L54A 3ZMVA 1T38A 5CVRA 1LNWA 1XDSA 2P6SA 1OYYA 2XAFA 4ENKA 1D3YA 1G3YA 1R1VA 2O3FA 2H6BA 4A0XA 4LG0A 3G3ZA 2RNJA 3ZMSA 2PMUA 4RB0A 2W84A 4EMSA 4U0VA 2RQPA 2OZ6A 4LJZF 2W25A 2D1VA 1HKSA 3J81Z 1IZ1A 1OPCA 3H92A 3I54A 3KLOA 1GHCA 1TQMA 4IJAA 5DEQA 3J80K 3R61A 1NHAA 3NQOA 2F5DA 3RPQA 3O6BB 1QPMA 4G7HF 2EFWA 3FXUA 4HZFA 3RJPA 4LMYA 4A0ZA 4LLGF 4EJVA 4M6YA 1SFUA 5AIQA 4ESJA 5DCFA 3HRTA 3R60A 1AWCA 4HDVA 2NNYA 2YX4A 2QVOA 1YYVA 5LGNA 3M7GA 5JHUA 2XAJA 2RDPA 3WODF 3GLXA 2HTSA 5CVVA 4XRFA 3C7JA 2Y48A 3CLOA 3ELKA 3SHFA 3ZP5A 2ADUA 1KA8A 3QPTA 4MNUA 1MD0A 3C3WA 3E3VA 1XSXA 2E1CA 2O61A 1HKTA 1LEBA 2Z3YA 5LGTA 1GXPA 1KQ8A 2DAOA 2FF4A 2CO5A 3WE3A 1SMYF 1FWZA 3I71A 2A69F 1JGSA 2J5PA 3V8KA 4P96A 3MQ0A 2L01A 2YU3A 4AWXB 4ZH4F 4LLLA 3HSRA 2IA1A 1HSTA 4G6QA 4QWQA 6PAXA 2FEZA 3I53A 3FM3A 2JRTA 4Q47A 4RB2C 5D5WB 2PFBA 2ZJ2A 4WXCA 3L2CA 1LDKB 2QENA 3KP2A 2V1UA 2IT0A 1S7OA 5L3FA 1Z7UA 2P5LC 1J2XA 2ZFWA 1XCBA 3GX4X 4JBAA 5LEKA 4G7ZF 4DQ2A 4L5IA 2RV8A 4ZYHA 4KUMA 2KJBA 2LDUA 4I02A 2Y75A 4Q48A 4D0PA 4EV0A 2ISYA 2MBFA 3F8BA 1L3LA 3IRQA 3KZYA 1DDNA 4ON0A 3I59A 1Z6RA 3RDIA 4HOBA 2MLKA 1K7AA 1ZARA 3DXJF 3KLNA 5D5VB 3K1MA 5ED4A 2KIUA 3MZHA 5F6FA 2GAUA 1YLFA 1XCVA 2K02A 4MGRA 5E1WA 3QAHA 3LQRA 2PBIA 2G7UA 1R23A 2BYVE 3MAJA 1E17A 1ZAOA 2FBKA 2ZNZA 1SAXA 1BIBA 1IXCA 4U7BA 3IWZA 1B9MA 2YSRA 5ILUA 4XBFA 2P5KA 2CWEA 3F21A 4HBLA 4I98B 3QPHA 3H3UA 3TOBA 1XSDA 2HYFA 3FMRA 4YIIA 2EV6A 3VFZA 5E8IA 1B4AA 1REPC 2R3SA 4P5OA 1FNNA 4DNCA 3BPXA 4RB3C 3EUHA 2NYXA 3KEOA 4G7OF 2IW5A 5IT3A 1UB9A 5BMZA 3P9KA 1PUEE 5L3CA 4HQMA 2P8TA 1S8NA 4LD5A 1R00A 1SD5A 5E1ZB 1UHWA 1BC8C 1GVJA 5K5RA 2DTRA 1BC7C 1XSVA 1D5VA 3ZMDA 4LK1F 3JSOA 1FT9A 2HR3A 2QLZA 1WI9A 3J80Z 2EA4A 4FHTA 3S2WA 3WTYC 2FBHA 3J81K 1LDJA 3ZPLA 1USTA 5CVJA 3Q9SA 1G4DA 1J75A 1X3UA 5HVQC 1K6OA 1EV7A 5D5XB 4BXUA 1W5SA 1PP7U 2BV6A 4PGGA 3B73A 1MJAA 4OINF 5L3GA 3FMSA 2KIMA 2V1DA 3WTVC 4U0WA 2G7HA 2DK5A 1DPUA 4Q5SF 2MH9A 3ABTA 5E1XA 3HYIA 2Z9OA 1FBUA 2MH2A 2QQBA 2DO7A 2FNPA 2VOPA 2NRAC 1W4MA 3RYRA 3DPTA 2BEOA 5LHGA 4LB6B 2R7DA 1KU7A 4P55A 5KK1A 2FQ3A 2VN2A 1T39A 2A6EF 1O3QA 4OU0A 4UV8A 5DV5A 3BWGA 3WTSC 1IN8A 4AIHA 3WTZA 1EH6A 2EJRA 2K4JA 5L3DA 2V79A 2W24A 4KA4A 1ZRFA 2EFOA 1MDMA 1LQ1A 3WGIA 4GXOA 2UXXA 4ENNA 1XDUA 2GIVA 2LSOA 2ESHA 2AXLA 2GZWA 1D8JA 3ROUA 1W7PD 2VBWA 1OYIA 3HRUA 2V6CA 2XROA 2HS5A 4MEXF 4ENMA 3ECHA 4CYDA 1FBQA 5JVTA 1F5TA 2YPRA 3T0YA 4A5NA 1TQPA 3PQKA 1XN7A 2F2EA 2H09A 1A04A 1JHFA 5DCMA 3B02A 1RNLA 5JFRA 1Q1HA 2MLGA 3E5QA 1MKMA 1H9GA 3CUQA 2A07F 3LA2A 4EM1A 2ESNA 2M5WA 1ZGAA 2LF7A 1FBSA 4EJWA 1Z1DA 3GFLA 3E97A 1ZG3A 4KNYA 3P9IA 2L4MA 1H9TA 4QLCU 2KKOA 3REOA 1G3SA 4IRIA 2Z5UA 1BBYA 3QP6A 4CZZA 1IRGA 1S3JA 5FB2A 2PQ8A 4AIKA 2RN7A 5ICGA 3HTSB 2HWVA 1ON2A 3BROA 4OIQF 1D8KA 4XSXF 4ASNA 3R0AA 1LB2A 3T5XA 2O03A 4I0BA 4R79A 3JTHA 5ERIA 4KIFA 2DQRA 4IRGA 1CGPA 3RKWA 1IAWA 3ZN1A 2CW0F 1ZN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW3 A;  4CIC A;  1T2K A;  2CG4 A;  1SD6 A;  4PDK A;  3KP3 A;  4S04 A;  4IVN A;  3D5L A;  5DD4 A;  3F22 A;  1Z05 A;  2F5C A;  2L3D A;  4HX8 A;  1ZHF A;  1JE8 A;  1QZZ A;  4ZYD A;  2H94 A;  2Q2E A;  2OAZ A;  5KVR A;  2Y0M A;  1CF7 B;  1TW2 A;  3BY6 A;  1IUY A;  3GWZ A;  2HOE A;  2XGX A;  3TDZ C;  1J0R A;  1H0M A;  2PMH A;  2HEO A;  4PCQ A;  5HLH A;  4UHT A;  4JQF A;  1IN4 A;  3RYP A;  1SMT A;  4M72 A;  5HLG A;  2EFP A;  1Y0U A;  4EGZ A;  2V1X A;  1G6N A;  2DT5 A;  2FBI A;  4GCV A;  2HZT A;  2EFQ A;  1ZRC A;  2IJL A;  5BOX A;  4KMU X;  3R0J A;  4GYG A;  3EYY A;  3WGG A;  3MCZ A;  2P7V B;  3RI4 A;  3QOP A;  2ISZ A;  1MGT A;  4OMZ A;  3Q9V A;  5DYM A;  2A6H F;  1MJB A;  2YX7 A;  3IKT A;  2XKO A;  2Q0O A;  1QQI A;  4AD9 A;  1AOY A;  1R1U A;  2TDX A;  1BI2 A;  5BPD A;  4GO1 A;  3LAP A;  3GXO A;  3GZ5 A;  4UVC A;  5EEH A;  1XGS A;  4RB1 A;  2GA1 A;  3PFI A;  1YW7 A;  1YW9 A;  3M8F A;  4A0Y A;  5ICE A;  4YFK F;  3V8J A;  4LB5 A;  2KJC A;  4G8X A;  2OD5 A;  3FHZ A;  3KP7 A;  2IPQ X;  2XAG A;  1U5T C;  4L9T A;  4A6D A;  2KIF A;  3TO6 A;  5E8G A;  3E5X A;  5LRS A;  3R4K A;  1XGM A;  2V9V A;  3LA7 A;  4CHU A;  3QU6 A;  5BQT A;  5HOO A;  2FXA A;  3VEP A;  3F6V A;  2HGC A;  4ZZD A;  3E6D A;  1K78 A;  4HA8 A;  1TQI A;  3GFI A;  2QZ8 A;  4WK8 F;  1FP1 D;  3F3X A;  1ZLK A;  2PI0 A;  2VT3 A;  5D6E A;  1V3F A;  4EVI A;  4IF4 A;  5K1Y A;  4HX7 A;  1TTY A;  3T1B A;  4HDU A;  3FXQ A;  4N9I A;  3WU0 A;  2XUB A;  4KT5 C;  3I4P A;  1QGP A;  3KZZ A;  4P9U A;  3WGH A;  3IL2 A;  1XD7 A;  3VB2 A;  2NS0 A;  3L09 A;  3K0L A;  2FA5 A;  4O5V A;  4IXA A;  3HTU A;  1BI0 A;  3KET A;  3U1D A;  3CO7 C;  4Q4Z F;  1T98 A;  2M30 A;  2ZO4 A;  3GUD A;  4LG0 B;  3CDH A;  2ACJ A;  2ZKZ A;  4A2U A;  3M9A A;  4LK0 F;  5TRD A;  2G9W A;  2C6Y A;  3RTR A;  1BM9 A;  2OQR A;  3Q5F A;  5HDN A;  1ZG1 A;  2COM A;  3GO5 A;  1TNS A;  2HQN A;  2ZME A;  1OYW A;  1P4X A;  3CUQ C;  3FMQ A;  3ERE D;  5FFZ A;  5D8K B;  3I58 A;  3EET A;  2CYY A;  1I1G A;  3WTU C;  4HF2 A;  1Z91 A;  3HRS A;  2ZCW A;  1IF1 A;  3GVA A;  3RPU A;  3GW2 A;  4HX4 A;  4BH9 A;  3J7A O;  1J59 A;  3ML6 A;  2E7X A;  2IRF G;  4WF2 A;  2M87 A;  2BGC A;  4R8H A;  3BOQ A;  4MTD A;  3BZ6 A;  4OOI A;  4NB5 A;  1FYM A;  3U9G A;  1YS6 A;  3QP5 A;  1J9I A;  3I64 A;  5L3B A;  2BBY A;  3WTX C;  1HW2 A;  4U0Y A;  5D6F A;  3V4G A;  1T0F A;  1R7J A;  4F7Z A;  2P6T A;  5JI6 A;  1WQ2 A;  2STW A;  4FT8 A;  4EM2 A;  4OMY A;  4WXD A;  1U2W A;  5IT9 K;  4Y15 A;  3K1N A;  4G9Y A;  3CO6 C;  1J7K A;  4MQV A;  4HW0 A;  3IHU A;  2QYO A;  3VOD A;  3KE2 A;  1U6G A;  3ZQ7 A;  4Y13 A;  4RGS A;  1FSE A;  3GFM A;  4BHB A;  4GGG A;  5D8L B;  2LF8 A;  1KU2 A;  4WWC A;  4L9V A;  1MJ9 A;  2D2W A;  3V8L A;  4XSZ F;  3IKV A;  1STZ A;  2K7L A;  5AON A;  3U2R A;  5CVI A;  4OIR F;  4EJT A;  4N9H A;  5AIP A;  3P9C A;  1HW1 A;  3RKX A;  1U5T A;  1L0O C;  2EWN A;  5FGM A;  5ILV A;  2X0L A;  4BHP A;  3GFJ A;  4JK1 X;  4MEY F;  3DFG A;  2OBP A;  5BPI A;  1ZG5 A;  5E20 A;  4RAY A;  3ULQ B;  3G73 A;  4I09 A;  2LNB A;  4HF0 A;  1F1Z A;  4L0Y B;  4EJU A;  2EV5 A;  4KN4 X;  3RIR A;  5CYV A;  1HBX G;  2Z99 A;  3C18 A;  3BP8 A;  3HSF A;  3ZMZ A;  2W57 A;  3TKY A;  2ZNY A;  4EQQ A;  5ICF A;  1S6L A;  3I59 B;  2WTE A;  2PJP A;  1KU3 A;  2JT1 A;  2QBY A;  4ZYE A;  5E17 F;  2ZME B;  3HOT A;  5DDG A;  1IN7 A;  5F64 A;  1ULY A;  1B59 A;  4XLN F;  2W85 A;  2B0L A;  2JZY A;  2IP2 A;  2JPB A;  2K27 A;  4HF1 A;  3M8E A;  1YTY A;  1JXS A;  1LVA A;  1FY7 A;  4LLN A;  5FFX A;  5HDG A;  1SFE A;  1PP8 F;  1Z6T A;  1G3T A;  4A6E A;  1U3E M;  4TV7 A;  1KYW A;  1IRF A;  2MD5 A;  2EB7 A;  1USS A;  5DUI A;  3F8N A;  1BI3 A;  4R1H A;  2DI3 A;  3ISP A;  2ZBK A;  1GXQ A;  2DPU A;  4MHG A;  1R22 A;  1DP7 P;  1DPR A;  2OZU A;  5H6R A;  3H3Z A;  2RGV A;  4GYI A;  4L5J A;  4L18 B;  1YIO A;  2GXG A;  1YO5 C;  1PDN C;  2H6C A;  2DW4 A;  2K4B A;  2MC3 A;  2FRH A;  3DEU A;  4OIP F;  1P6R A;  2Z33 A;  3V7C A;  5HDK A;  3OV8 A;  3SQN A;  4M74 A;  4CDG A;  3TO7 A;  2GQQ A;  4O3M A;  3ZMT A;  2UXN A;  3EQL F;  1SD4 A;  3L9F A;  4KYW A;  2CGP A;  2NNN A;  1LJ9 A;  2PG4 A;  4O6J A;  2VE9 A;  4B8X A;  3K2Z A;  2IVM A;  3ZN0 A;  3I0T A;  5ILS A;  4YG2 F;  2VOO A;  1OR7 A;  2HTJ A;  4UVA A;  3EYI A;  1I27 A;  4KMF A;  4U7D A;  1R5H A;  3V7R A;  2OQG A;  5J8F A;  1OMI A;  4BQA A;  3HRM A;  3FXR A;  4ETS A;  4BYY A;  1R36 A;  4L0Z B;  2PEX A;  4Y17 A;  4G6D A;  3SFZ A;  3GYH X;  3FWE A;  3DP7 A;  1UCR A;  2DQL A;  1B1B A;  3MFK A;  4B09 A;  4UUV A;  5HLI A;  5LHI A;  3ECO A;  1JHH A;  2ELH A;  3I5U A;  4EM0 B;  1P4W A;  1B6A A;  2O0Y A;  3DQV C;  3LQQ A;  4I2O A;  5IT9 Z;  1XB4 A;  3BJA A;  3RKY A;  2O8X A;  1U78 A;  1O7L A;  1J5Y A;  2VBX A;  3T8T A;  2L4A A;  4EJO A;  4UVB A;  2P4W A;  1TBX A;  3T8R A;  2RKH A;  1MDM B;  1XGO A;  3V7S A;  3L00 A;  1WWX A;  1KYZ A;  4M9Z A;  2GXB A;  3HIF A;  2STT A;  2XAH A;  1HQC A;  2X4H A;  4CXF A;  3TO9 A;  3LA3 A;  1BIA A;  1S29 A;  5TJJ A;  1G3W A;  2FML A;  4UXN A;  2M1B A;  1E2X A;  1I6X A;  2DPD A;  1WKM A;  2A3S A;  4A12 A;  3CTA A;  2VOD A;  3O2P E;  4NHJ A;  3E6B A;  5DCM B;  4MTE A;  3BJO A;  4IRH A;  1YG2 A;  3CUQ B;  5CJ9 A;  1ZH5 A;  2FNA A;  2XVC A;  2XAQ A;  2E7W A;  2JSC A;  4LGW A;  4XLP F;  1FYK A;  2KRF A;  4PZJ A;  5E18 F;  2IA0 A;  4HV6 A;  4HAM A;  2RVC A;  3FX3 A;  3GZ6 A;  3TGN A;  4KDP A;  5CLS A;  5FLX Z;  2R7F A;  4P9F A;  3LFK A;  3ZMU A;  4EGY A;  1I5Z A;  3VOE A;  4U88 A;  2LKP A;  1RZ4 A;  2VT2 A;  2QQ9 A;  2EA2 A;  3HOS A;  2XRN A;  4PGH A;  1ZRD A;  3N97 A;  5LBQ A;  4IPA A;  1IN5 A;  1WSU A;  2JPC A;  1UFM A;  3F8F A;  4ESF A;  1F9N A;  2VON A;  3WU1 B;  3E6M A;  4M9S A;  2VC1 A;  3JTG A;  5LRR A;  1SD7 A;  1YS7 A;  2XV4 S;  1IN6 A;  3WTW C;  1V4R A;  3E6C C;  2WV0 A;  1BOA A;  4UV9 A;  5LGU A;  2XIG A;  2XHK A;  1IXS B;  5JR3 A;  4BAY A;  2JTV A;  4RS8 A;  4RGR A;  2HDC A;  4RGU A;  4AIJ A;  4A5M A;  3P7N A;  1W5T A;  1P92 A;  5A2Q K;  4G94 A;  2UWM A;  4KIG A;  1K79 A;  2L02 A;  3FZV A;  4FX4 A;  2QUF A;  3KP4 A;  1EH7 A;  4Z2Y A;  5BS6 A;  1RIO H;  1FPQ A;  1EH8 A;  3DKW A;  1LEA A;  2PLY A;  4CO8 A;  4HLX A;  3JAM K;  3D0S A;  2HFH A;  3HSE A;  2M8E A;  4M73 A;  3BJ6 A;  4L9J A;  3F23 A;  2CFX A;  1YQA A;  3SXY A;  1O3S A;  3E5U A;  1P4A A;  3GEZ A;  4I0A A;  1FC3 A;  1O3T A;  1OKR A;  3CJN A;  2YR2 A;  1O57 A;  4M6X A;  2D1H A;  5J6X A;  3DPL C;  3AAF A;  3EDP A;  2ZXJ A;  1XMA A;  1BJA A;  3IWF A;  1P2F A;  2OA4 A;  1KQ0 A;  1TLH B;  3PQJ A;  3N4M A;  3JW4 A;  2XAS A;  2FMY A;  2QM3 A;  1RI7 A;  2DK8 A;  3DV8 A;  3MWM A;  4ZYG A;  3FF5 A;  2K86 A;  4UNO A;  4N0B A;  4HQE A;  2EFN A;  1HXD A;  2F5E A;  2AS5 F;  3DF8 A;  3KFW X;  1ODD A;  3HHH A;  1ZYR F;  3BDD A;  5HS9 A;  2A68 F;  1Z9C A;  3MEX A;  4L9N A;  3K1P A;  4LFU A;  1I1S A;  2FU4 A;  1HW5 A;  3IRR A;  3R6S A;  5DD8 A;  5ICC A;  1K78 B;  3KP6 A;  1ON1 A;  2FOK A;  2VE8 A;  2A5Y B;  3COA C;  4MQ9 F;  1W7P A;  3GF2 A;  1XGN A;  4YFN F;  1QZY A;  5HS8 A;  3W6K B;  1R1T A;  5D5U B;  1FX7 A;  5L3E A;  5FD5 A;  1FP2 A;  2IA2 A;  1WRJ A;  2P7C B;  3F8M A;  2RC4 A;  2P5V A;  5H20 A;  1FSH A;  3WG9 A;  2QWW A;  1R5G A;  1IW7 F;  2HKX A;  5LHH A;  4M71 A;  1F4K A;  1UHM A;  2A61 A;  1KU9 A;  5F1R A;  1ZRE A;  2M45 A;  3FM5 A;  2HYG D;  3O3K A;  5LLQ A;  3ABU A;  3LWF A;  2O6G E;  1U8R A;  2DLL A;  2NAZ A;  4H0E A;  1O3R A;  1ONV A;  3KCC A;  2BE5 F;  3KEQ A;  5CVU A;  5HS7 A;  3LAJ A;  2UZK A;  4KFC A;  1B9N A;  4YFX F;  4ESB A;  3L7W A;  1XMK A;  4CGZ A;  2WC2 A;  4OIO F;  5FLX K;  2EK5 A;  4YIF A;  5EEG A;  1KQ9 A;  2DU9 A;  1CF7 A;  1FZP B;  2VC0 A;  4HYE A;  4NQW A;  2F5F A;  4AVP A;  3QU3 A;  3HHG A;  1R58 A;  3WTT C;  1HKQ A;  2HKO A;  2VBZ A;  2MA3 A;  3F6O A;  3K69 A;  1T6S A;  3IC7 A;  3W6J B;  5FD6 A;  3TOA A;  4HV5 A;  5K5O A;  1BN5 A;  4M9X A;  2DFI A;  5J8C A;  1QO0 D;  2VBY A;  1MZB A;  1FLI A;  1SFX A;  2GA2 A;  4ENJ A;  2D45 A;  4ZZL A;  4I7H A;  1KGS A;  4FX0 A;  1FOK A;  1TNT A;  5A2Q Z;  4KIB A;  4S05 A;  3MZY A;  5D4R A;  2XKP A;  5D4S A;  5K5Q A;  4RAZ A;  5H6Q A;  3K9T A;  2CSO A;  2PN6 A;  4BNC A;  3JAM Z;  1VTN C;  2E1N A;  3C1D A;  4KIC A;  4WX9 A;  2GWR A;  2FSW A;  1YFH A;  1ZGJ A;  4KN7 X;  4BHC A;  1FYL A;  2DBB A;  3SZT A;  1S7A A;  2ETH A;  2WWY A;  1W7P B;  1C0W A;  1HSJ A;  3HUG A;  3SZP A;  4E70 A;  4IHT A;  3BPV A;  1RUN A;  4HLY A;  3NRV A;  4I01 A;  2OU2 A;  1BI1 A;  3CUO A;  3M1E A;  1U5T B;  3NEU A;  5FO5 A;  2EV0 A;  2FE3 A;  1QNT A;  4K2E A;  1DUX C;  3LST A;  2VXZ A;  3TQN A;  3JSP A;  2CQK A;  5LEJ A;  3F72 A;  2H27 A;  1QBJ A;  5DUK A;  3F8C A;  2Q8K A;  1ZLJ A;  1IXR C;  1LDD A;  3KP5 A;  2HQR A;  4RGX A;  1RUO A;  4IHS A;  3TDU C;  1YW8 A;  2QQA A;  3QRF F;  4WXH A;  3OOP A;  2J5O A;  2QBY B;  3WE2 A;  4WCG A;  1O7F A;  2L54 A;  3ZMV A;  1T38 A;  5CVR A;  1LNW A;  1XDS A;  2P6S A;  1OYY A;  2XAF A;  4ENK A;  1D3Y A;  1G3Y A;  1R1V A;  2O3F A;  2H6B A;  4A0X A;  4LG0 A;  3G3Z A;  2RNJ A;  3ZMS A;  2PMU A;  4RB0 A;  2W84 A;  4EMS A;  4U0V A;  2RQP A;  2OZ6 A;  4LJZ F;  2W25 A;  2D1V A;  1HKS A;  3J81 Z;  1IZ1 A;  1OPC A;  3H92 A;  3I54 A;  3KLO A;  1GHC A;  1TQM A;  4IJA A;  5DEQ A;  3J80 K;  3R61 A;  1NHA A;  3NQO A;  2F5D A;  3RPQ A;  3O6B B;  1QPM A;  4G7H F;  2EFW A;  3FXU A;  4HZF A;  3RJP A;  4LMY A;  4A0Z A;  4LLG F;  4EJV A;  4M6Y A;  1SFU A;  5AIQ A;  4ESJ A;  5DCF A;  3HRT A;  3R60 A;  1AWC A;  4HDV A;  2NNY A;  2YX4 A;  2QVO A;  1YYV A;  5LGN A;  3M7G A;  5JHU A;  2XAJ A;  2RDP A;  3WOD F;  3GLX A;  2HTS A;  5CVV A;  4XRF A;  3C7J A;  2Y48 A;  3CLO A;  3ELK A;  3SHF A;  3ZP5 A;  2ADU A;  1KA8 A;  3QPT A;  4MNU A;  1MD0 A;  3C3W A;  3E3V A;  1XSX A;  2E1C A;  2O61 A;  1HKT A;  1LEB A;  2Z3Y A;  5LGT A;  1GXP A;  1KQ8 A;  2DAO A;  2FF4 A;  2CO5 A;  3WE3 A;  1SMY F;  1FWZ A;  3I71 A;  2A69 F;  1JGS A;  2J5P A;  3V8K A;  4P96 A;  3MQ0 A;  2L01 A;  2YU3 A;  4AWX B;  4ZH4 F;  4LLL A;  3HSR A;  2IA1 A;  1HST A;  4G6Q A;  4QWQ A;  6PAX A;  2FEZ A;  3I53 A;  3FM3 A;  2JRT A;  4Q47 A;  4RB2 C;  5D5W B;  2PFB A;  2ZJ2 A;  4WXC A;  3L2C A;  1LDK B;  2QEN A;  3KP2 A;  2V1U A;  2IT0 A;  1S7O A;  5L3F A;  1Z7U A;  2P5L C;  1J2X A;  2ZFW A;  1XCB A;  3GX4 X;  4JBA A;  5LEK A;  4G7Z F;  4DQ2 A;  4L5I A;  2RV8 A;  4ZYH A;  4KUM A;  2KJB A;  2LDU A;  4I02 A;  2Y75 A;  4Q48 A;  4D0P A;  4EV0 A;  2ISY A;  2MBF A;  3F8B A;  1L3L A;  3IRQ A;  3KZY A;  1DDN A;  4ON0 A;  3I59 A;  1Z6R A;  3RDI A;  4HOB A;  2MLK A;  1K7A A;  1ZAR A;  3DXJ F;  3KLN A;  5D5V B;  3K1M A;  5ED4 A;  2KIU A;  3MZH A;  5F6F A;  2GAU A;  1YLF A;  1XCV A;  2K02 A;  4MGR A;  5E1W A;  3QAH A;  3LQR A;  2PBI A;  2G7U A;  1R23 A;  2BYV E;  3MAJ A;  1E17 A;  1ZAO A;  2FBK A;  2ZNZ A;  1SAX A;  1BIB A;  1IXC A;  4U7B A;  3IWZ A;  1B9M A;  2YSR A;  5ILU A;  4XBF A;  2P5K A;  2CWE A;  3F21 A;  4HBL A;  4I98 B;  3QPH A;  3H3U A;  3TOB A;  1XSD A;  2HYF A;  3FMR A;  4YII A;  2EV6 A;  3VFZ A;  5E8I A;  1B4A A;  1REP C;  2R3S A;  4P5O A;  1FNN A;  4DNC A;  3BPX A;  4RB3 C;  3EUH A;  2NYX A;  3KEO A;  4G7O F;  2IW5 A;  5IT3 A;  1UB9 A;  5BMZ A;  3P9K A;  1PUE E;  5L3C A;  4HQM A;  2P8T A;  1S8N A;  4LD5 A;  1R00 A;  1SD5 A;  5E1Z B;  1UHW A;  1BC8 C;  1GVJ A;  5K5R A;  2DTR A;  1BC7 C;  1XSV A;  1D5V A;  3ZMD A;  4LK1 F;  3JSO A;  1FT9 A;  2HR3 A;  2QLZ A;  1WI9 A;  3J80 Z;  2EA4 A;  4FHT A;  3S2W A;  3WTY C;  2FBH A;  3J81 K;  1LDJ A;  3ZPL A;  1UST A;  5CVJ A;  3Q9S A;  1G4D A;  1J75 A;  1X3U A;  5HVQ C;  1K6O A;  1EV7 A;  5D5X B;  4BXU A;  1W5S A;  1PP7 U;  2BV6 A;  4PGG A;  3B73 A;  1MJA A;  4OIN F;  5L3G A;  3FMS A;  2KIM A;  2V1D A;  3WTV C;  4U0W A;  2G7H A;  2DK5 A;  1DPU A;  4Q5S F;  2MH9 A;  3ABT A;  5E1X A;  3HYI A;  2Z9O A;  1FBU A;  2MH2 A;  2QQB A;  2DO7 A;  2FNP A;  2VOP A;  2NRA C;  1W4M A;  3RYR A;  3DPT A;  2BEO A;  5LHG A;  4LB6 B;  2R7D A;  1KU7 A;  4P55 A;  5KK1 A;  2FQ3 A;  2VN2 A;  1T39 A;  2A6E F;  1O3Q A;  4OU0 A;  4UV8 A;  5DV5 A;  3BWG A;  3WTS C;  1IN8 A;  4AIH A;  3WTZ A;  1EH6 A;  2EJR A;  2K4J A;  5L3D A;  2V79 A;  2W24 A;  4KA4 A;  1ZRF A;  2EFO A;  1MDM A;  1LQ1 A;  3WGI A;  4GXO A;  2UXX A;  4ENN A;  1XDU A;  2GIV A;  2LSO A;  2ESH A;  2AXL A;  2GZW A;  1D8J A;  3ROU A;  1W7P D;  2VBW A;  1OYI A;  3HRU A;  2V6C A;  2XRO A;  2HS5 A;  4MEX F;  4ENM A;  3ECH A;  4CYD A;  1FBQ A;  5JVT A;  1F5T A;  2YPR A;  3T0Y A;  4A5N A;  1TQP A;  3PQK A;  1XN7 A;  2F2E A;  2H09 A;  1A04 A;  1JHF A;  5DCM A;  3B02 A;  1RNL A;  5JFR A;  1Q1H A;  2MLG A;  3E5Q A;  1MKM A;  1H9G A;  3CUQ A;  2A07 F;  3LA2 A;  4EM1 A;  2ESN A;  2M5W A;  1ZGA A;  2LF7 A;  1FBS A;  4EJW A;  1Z1D A;  3GFL A;  3E97 A;  1ZG3 A;  4KNY A;  3P9I A;  2L4M A;  1H9T A;  4QLC U;  2KKO A;  3REO A;  1G3S A;  4IRI A;  2Z5U A;  1BBY A;  3QP6 A;  4CZZ A;  1IRG A;  1S3J A;  5FB2 A;  2PQ8 A;  4AIK A;  2RN7 A;  5ICG A;  3HTS B;  2HWV A;  1ON2 A;  3BRO A;  4OIQ F;  1D8K A;  4XSX F;  4ASN A;  3R0A A;  1LB2 A;  3T5X A;  2O03 A;  4I0B A;  4R79 A;  3JTH A;  5ERI A;  4KIF A;  2DQR A;  4IRG A;  1CGP A;  3RKW A;  1IAW A;  3ZN1 A;  2CW0 F;  1ZN2 A; 
#chains in the Genus database with same CATH topology
 2V7F A;  3FXO A;  1TW3 A;  2BXZ A;  4CIC A;  3A52 A;  1T2K A;  3KX2 A;  2ZME C;  2CG4 A;  5JLX A;  1SD6 A;  3OYG A;  4PDK A;  3KP3 A;  3OOU A;  3SDB A;  4S04 A;  4IVN A;  2NVX J;  3KYL A;  3D5L A;  5DD4 A;  4XN3 A;  3F22 A;  1Z05 A;  4CCN A;  2QGU A;  2F5C A;  2L3D A;  4HX8 A;  4I76 A;  4XKC A;  1ZHF A;  1JE8 A;  1QZZ A;  3NAR A;  2JSP A;  2VI6 A;  3V42 A;  4ZYD A;  2H94 A;  2Q2E A;  2MVT A;  2OAZ A;  2OCE A;  5KVR A;  3HOY J;  2BZT A;  1MBF A;  2LVS A;  2X48 A;  2KIQ A;  1WZ2 A;  3PSI A;  4IL6 C;  2Y0M A;  1CF7 B;  1TW2 A;  3BY6 A;  2ECC A;  1IUY A;  4AYB N;  3GWZ A;  4AM3 A;  1ZR2 A;  4Y4R A;  1XX5 A;  2HOE A;  2XGX A;  2DN0 A;  4BU2 A;  3GTL J;  1IRX A;  3TDZ C;  4E7Z A;  1J0R A;  4NQW B;  2WY7 Q;  1H0M A;  2PMH A;  2HEO A;  4PCQ A;  5HLH A;  3TBI A;  4UHT A;  3ZQQ A;  2KQR A;  4JQF A;  1IN4 A;  3RYP A;  3HOV J;  2VJ4 A;  1SMT A;  4M72 A;  5HLG A;  3HPH A;  5F08 A;  2EFP A;  1Y0U A;  1X1P A;  4EGZ A;  2V1X A;  3AL0 B;  1G6N A;  2DT5 A;  2FBI A;  5KAI C;  3JRB A;  4GCV A;  1W0T A;  2HZT A;  2EFQ A;  4G6T B;  3OYB A;  2IJL A;  1ZRC A;  5BOX A;  2K9N A;  3S93 A;  3LMM A;  4KMU X;  3R0J A;  4GYG A;  4M3E A;  3EYY A;  3WGG A;  1D1A A;  3MCZ A;  3RSN A;  2BY1 A;  2MFZ A;  2P7V B;  4MO7 A;  3RI4 A;  3QOP A;  3G2B A;  2ISZ A;  1WPK A;  2F6C A;  1MGT A;  3FIW A;  1BR2 A;  2L7F P;  4OMZ A;  3Q9V A;  5DYM A;  2W7N A;  1VQ4 I;  2A6H F;  1MJB A;  4V2G A;  3ESW B;  4HG2 A;  3MKZ A;  2YX7 A;  2DT7 B;  4NC8 A;  3HGY A;  3IKT A;  5C44 J;  2CJJ A;  2XKO A;  2Q0O A;  1QQI A;  4AD9 A;  2M7B A;  1AOY A;  1R1U A;  1WJF A;  1BI2 A;  2TDX A;  4DYQ A;  5BPD A;  2X9D A;  4GO1 A;  3LAP A;  3GXO A;  3GZ5 A;  4PUS A;  4UVC A;  5EEH A;  1XGS A;  3A4C A;  4RB1 A;  2GA1 A;  3PFI A;  1Y6I A;  4D1Q A;  1YW7 A;  1YW9 A;  3M8F A;  1Z21 A;  4A0Y A;  2L5Q A;  4RM3 A;  4KJZ A;  5ICE A;  4YFK F;  4LIV A;  2M8G X;  3V8J A;  1JKR C;  4LB5 A;  3CP2 A;  2KJC A;  4DBQ A;  5HNH A;  4G8X A;  1X3Z B;  2R4G A;  1X2M A;  2OD5 A;  2VPR A;  2Y31 A;  3FHZ A;  2DA1 A;  1Z77 A;  1W0U A;  3KP7 A;  3KYC B;  2IPQ X;  1K6Y A;  2XAG A;  5B1A H;  3MKW B;  2X98 A;  1U5T C;  4L9T A;  3S1Q J;  2H8W A;  4A6D A;  2IBD A;  2KIF A;  3ZXS A;  4S0H B;  2DCE A;  3A01 B;  3S3N A;  5TGT A;  1DGR M;  2E35 A;  3TO6 A;  3HUG B;  3E5X A;  5E8G A;  1ETW A;  5LRS A;  3R4K A;  1XGM A;  3HOU J;  5KNL A;  2V9V A;  3LA7 A;  4CHU A;  3QU6 A;  5BQT A;  5HOO A;  4F91 B;  2FXA A;  3A03 A;  3DLL F;  2LYC A;  1R71 A;  3VEP A;  1MBJ A;  3LFU A;  4NUB A;  1FTZ A;  3F6V A;  2HGC A;  4XR6 A;  4ZZD A;  3E6D A;  4II2 A;  1K78 A;  4HA8 A;  3PIP F;  1TQI A;  3GFI A;  2QZ8 A;  4WK8 F;  1E0E A;  1FP1 D;  3F3X A;  3ZQI A;  1ZLK A;  1MH4 A;  4DYR A;  2PI0 A;  2VT3 A;  5D6E A;  2M2E A;  1V3F A;  4EVI A;  4IF4 A;  5K1Y A;  4HX7 A;  1TTY A;  3T1B A;  4A69 C;  2CV0 A;  5IOY A;  4HDU A;  3FXQ A;  3S3M A;  2IGN A;  1VND A;  4N9I A;  3WU0 A;  2XUB A;  1NH3 A;  1W36 C;  1WI3 A;  2W4S A;  4KT5 C;  4DIQ A;  2DA3 A;  3I4P A;  2HNH A;  1QGP A;  4JOM A;  1R49 A;  5BNG A;  3KZZ A;  2GOM A;  2ID6 A;  4FQG A;  2QF7 A;  4P9U A;  2W48 A;  3WGH A;  3IL2 A;  1UMQ A;  3SZG A;  1XD7 A;  1FOX A;  3VB2 A;  4XLE A;  2KDO A;  3JRH A;  2NS0 A;  1NTC A;  4XMY A;  3CME I;  3L09 A;  3K0L A;  5LFA A;  4XRS A;  1WJ5 A;  1SC7 A;  2FA5 A;  3BCA A;  3JAM R;  2GM4 A;  4O5V A;  4DW6 A;  1S72 I;  3BG9 A;  2KPM A;  2ZXH A;  1BOB A;  4IXA A;  3HTU A;  1BI0 A;  1IDY A;  2EZK A;  2WBM A;  5CQG A;  2BHZ A;  3S32 A;  4DYC A;  3KET A;  3U1D A;  2JA8 J;  3CO7 C;  2JUG A;  4Q4Z F;  2Q2E B;  5TIS C;  1AA7 A;  1T98 A;  2M30 A;  2R5Z A;  4F92 B;  2VQG A;  5K7H A;  5GTI C;  1Y0N A;  2ZO4 A;  3GUD A;  3HOZ J;  4LG0 B;  3CDH A;  2ACJ A;  1MBK A;  2ZKZ A;  4A2U A;  1SFK A;  3M9A A;  4LK0 F;  5TRD A;  2G9W A;  4IO9 F;  3C2B A;  1RES A;  3LSM A;  1JKP C;  2C6Y A;  1JJ6 C;  3RTR A;  3I4N J;  1BM9 A;  2XGD A;  5E3L A;  2KIS A;  2OQR A;  4UUT A;  3OYF A;  2E34 A;  3G4S I;  3Q5F A;  5HDN A;  1ZG1 A;  2COM A;  2Y0S N;  1B8I A;  3ONQ A;  1MSF C;  3CF5 F;  3GO5 A;  5FKK A;  1YX5 A;  3LNQ A;  3K4K A;  1TNS A;  2OCC H;  2HQN A;  2ZME A;  3CF2 A;  1OYW A;  3PM1 A;  3HG9 A;  1P4X A;  1IC8 A;  3H36 A;  3CUQ C;  3FMQ A;  3ERE D;  1ZGW A;  5FFZ A;  5D8K B;  2V6E A;  4IOC F;  3I58 A;  3EET A;  2CYY A;  3IV5 A;  1I1G A;  3WTU C;  1TWC J;  4HF2 A;  2CFO A;  2Z1D A;  2CRG A;  4KIS A;  1Z91 A;  2WAQ A;  4HPQ A;  2KL4 A;  3HRS A;  1HC8 A;  2ZCW A;  3BTL A;  4KT6 A;  4JX5 A;  2VQC A;  1IF1 A;  3GVA A;  3RPU A;  3GW2 A;  3IP4 B;  1VF9 A;  2WB1 A;  4H4K C;  4HX4 A;  4BH9 A;  5GAE J;  3J7A O;  1G2H A;  3K6G A;  2JQ7 A;  2HXI A;  1J59 A;  3LOC A;  3ML6 A;  2VIX A;  2E7X A;  2IGM A;  2IRF G;  4WF2 A;  4BJ6 C;  2M87 A;  1BR4 A;  4M3D A;  1RET A;  2BGC A;  4R8H A;  5EF6 A;  1TWG J;  2I8D A;  2LK2 A;  3S3O A;  5IT9 R;  3BOQ A;  3LL7 A;  1EA3 A;  4MTD A;  4Y52 J;  1B72 A;  3BZ6 A;  3GLL A;  3DTI A;  3LSG A;  4OOI A;  5F0H A;  2R93 J;  2DA4 A;  4NB5 A;  1FYM A;  3U9G A;  1YS6 A;  1X58 A;  3QP5 A;  1J9I A;  2XAU A;  1LFU P;  2BOL A;  1OFC X;  3I64 A;  4NC7 A;  5L3B A;  1OJL A;  2BBY A;  4D7M A;  3WTX C;  1HW2 A;  1OR7 C;  4U0Y A;  2K9L A;  5D6F A;  3V4G A;  1T0F A;  1R7J A;  4B43 A;  1X4P A;  2JUC A;  3FK7 A;  3J7A Y;  3RQI A;  4F7Z A;  4EEF G;  4JX6 A;  2P6T A;  5GAD J;  5JI6 A;  1WQ2 A;  2STW A;  1A5J A;  1RC9 A;  2R5Y A;  4FT8 A;  1OQY A;  5EGO A;  4EM2 A;  4OMY A;  1FJL A;  4UUS A;  4WXD A;  1U2W A;  5IT9 K;  4Y15 A;  3L2W A;  3K1N A;  4PFO A;  4G9Y A;  3CO6 C;  1ZEL A;  3L1P A;  1J7K A;  1SAN A;  3H5R A;  4DJA A;  5KHD A;  4MQV A;  4HW0 A;  1PUF A;  3K4C A;  1ETX A;  2JVG A;  2EIN H;  3IHU A;  2QYO A;  3JRC A;  2X1D A;  3VOD A;  3KE2 A;  1U6G A;  3ZQ7 A;  4Y13 A;  2HOT A;  4RGS A;  3DBR B;  2HXO A;  2EQR A;  4C3H J;  1FSE A;  5C4J J;  3GFM A;  4BHB A;  4GGG A;  5D8L B;  3G71 I;  2LF8 A;  2JN6 A;  2E1M B;  1PJR A;  4A93 J;  4BXF A;  4RM2 A;  1KU2 A;  4XOT A;  3ZQH A;  4WWC A;  4L9V A;  5IYB J;  1IRZ A;  1MJ9 A;  2D2W A;  3V8L A;  3RZD J;  5CPR B;  2K9Q A;  4XSZ F;  3IKV A;  1STZ A;  3S1M J;  2K7L A;  4FIS A;  1HA8 A;  5AON A;  5DTD A;  3U2R A;  5CVI A;  2DMP A;  4OIR F;  4EJT A;  4N9H A;  4XKB A;  1SEU A;  5AIP A;  5F0C A;  3ABM H;  3P9C A;  1HW1 A;  2VUM J;  3B6A A;  3RKX A;  1U5T A;  1L0O C;  2EWN A;  3FDY A;  2H8R A;  1V5E A;  5FGM A;  5ILV A;  2X0L A;  1JGG A;  3M4O J;  4BHP A;  3CES A;  3H3V K;  3GFJ A;  4JK1 X;  4MEY F;  3DFG A;  2OBP A;  1SFO J;  5BPI A;  1ZG5 A;  5E20 A;  2VQH A;  4RAY A;  3ULQ B;  3G73 A;  4I09 A;  2R7Q A;  5FLX R;  2DMU A;  3L2V A;  2LNB A;  2UV1 A;  4HF0 A;  1F1Z A;  2P0W A;  4L0Y B;  2YS9 A;  4EJU A;  4CCK A;  1VQL I;  1MNM C;  1AHD P;  2EV5 A;  2CW8 A;  4KN4 X;  3RIR A;  5CYV A;  3A1Y A;  1HBX G;  2Z99 A;  4D5C A;  2CUZ A;  4N4O B;  3IH4 A;  3C18 A;  3MD2 A;  2HVS A;  4GDF A;  3CLQ A;  3BP8 A;  3IH2 A;  2IS2 A;  3HSF A;  3ZMZ A;  2LKX A;  2X85 A;  2W57 A;  3TKY A;  3BG6 A;  2V9P A;  3LSI A;  2ZNY A;  4IHX A;  3O8G A;  4EQQ A;  2DA2 A;  5ICF A;  1S6L A;  3I59 B;  2WTE A;  1XS9 A;  1KU3 A;  3BTI A;  4B47 A;  3ASN H;  2PJP A;  2E2J J;  2JT1 A;  4BQQ A;  2HDD A;  2QBY A;  1JUS A;  4ZYE A;  5B3S H;  5E17 F;  2KT0 A;  3FIS A;  1LPQ A;  1G59 A;  3D5R C;  2ZME B;  3HOT A;  5DDG A;  2M4G A;  3OYE A;  1IN7 A;  3BT9 A;  5F64 A;  2EH3 A;  3QYB A;  1T95 A;  1ULY A;  1B59 A;  4XLN F;  2E2I J;  2W85 A;  2B0L A;  2JZY A;  2IP2 A;  2JPB A;  2K27 A;  4HF1 A;  2IS6 A;  3BG5 A;  3M8E A;  1YTY A;  2Z16 A;  2R7S A;  3H0G J;  2XB0 X;  1JXS A;  1LVA A;  1FY7 A;  4LLN A;  1A36 A;  1F36 A;  1RPW A;  3OYC A;  5FFX A;  5HDG A;  5M5Y J;  3W6V A;  1GV5 A;  1SFE A;  2TCT A;  3U1K A;  2LY9 A;  1PP8 F;  3S1R J;  1Z6T A;  1G3T A;  4A6E A;  2L0K A;  4M6V A;  5EG0 B;  1U3E M;  4TV7 A;  4AYB A;  3K4N A;  1KYW A;  1Y56 A;  4E7H A;  1RR8 C;  1HLV A;  3OL4 A;  2XSJ C;  1IRF A;  2MD5 A;  2EB7 A;  1USS A;  2LRD A;  1ZK8 A;  5DUI A;  2M7A A;  3F8N A;  4FE7 A;  1FOY A;  4C2M J;  3FKJ A;  2EZH A;  1BI3 A;  3CCV I;  3H1C A;  2DI3 A;  3ISP A;  3MVP A;  4R1H A;  2M34 A;  1IO2 A;  2ZBK A;  2DA5 A;  1GXQ A;  2DPU A;  1X1C A;  4MHG A;  2R7R A;  3ABK H;  4CSW A;  3GTG J;  3G1M A;  3BQY A;  1R22 A;  1A31 A;  1DP7 P;  1DPR A;  2OZU A;  5H6R A;  2XF6 A;  5GAG J;  3H3Z A;  2RGV A;  4GYI A;  1JT0 A;  4L5J A;  4L18 B;  2BY3 A;  1YIO A;  2OC6 A;  2GXG A;  1YO5 C;  1PDN C;  2H6C A;  2DW4 A;  1HOM A;  4PFP A;  2K4B A;  2MC3 A;  4RMN A;  2FRH A;  3DEU A;  4OIP F;  1P6R A;  4CCL A;  2H1L A;  2Z33 A;  5EGO B;  1JUM A;  3CCJ I;  3BLY A;  3V7C A;  5HDK A;  2MSY A;  3OV8 A;  3SQN A;  4M74 A;  4CDG A;  3DLA A;  2LR8 A;  2PMZ N;  2GQQ A;  3TO7 A;  4O3M A;  3ABL H;  4XL9 A;  1LFP A;  1QVT A;  4XRS G;  3ZMT A;  2UXN A;  3EQL F;  2DMQ A;  4BDZ A;  1SD4 A;  1YJW I;  3UR3 C;  3L9F A;  4KYW A;  2X6O A;  2CGP A;  2NNN A;  1LJ9 A;  2PG4 A;  3A0B C;  2GBY A;  4O6J A;  5GPA A;  5KAF C;  2VE9 A;  4B8X A;  5IP7 J;  4XM3 A;  3K2Z A;  3GTP J;  3JRI A;  2IVM A;  3ZN0 A;  3I0T A;  5ILS A;  4YG2 F;  2VOO A;  1OR7 A;  4XN0 A;  2HTJ A;  3L2Q A;  4UVA A;  2F5V A;  3EYI A;  1I27 A;  2B63 J;  4KMF A;  4U7D A;  1R5H A;  2VKD A;  1SVL A;  3V7R A;  2OQG A;  5J8F A;  1OMI A;  5CQE A;  3ASO H;  3VWB A;  3LSK A;  1P9Q C;  5M3F J;  1ZKG A;  4BQA A;  3HRM A;  2DOF A;  3OYD A;  1MSE C;  3FXR A;  4ETS A;  1LUJ B;  4BYY A;  3U21 A;  1UG0 A;  3FHN A;  1BW5 A;  1UEL B;  1LVK A;  1IGN A;  1WCM J;  1MBG A;  5K7Z A;  1R36 A;  4L0Z B;  3AG1 H;  3OIP A;  2PEX A;  1I39 A;  5DM7 F;  4Y17 A;  1W5C C;  4G6D A;  4XLC A;  1V5F A;  2WA0 A;  3BTJ A;  5FKN A;  1FTT A;  3SFZ A;  3GYH X;  3FWE A;  1H88 C;  1VQN I;  2R92 J;  3DP7 A;  3ZOB A;  2R7O A;  1UJ8 A;  2F4M B;  1NK2 P;  1UCR A;  2DQL A;  1B1B A;  2DJI A;  4B09 A;  3MFK A;  4UUV A;  3GCM A;  2EIJ H;  5HLI A;  1DGW Y;  1VQ9 I;  3GZN B;  2DXI A;  3DCF A;  3QYE A;  5LHI A;  3ECO A;  2VJJ A;  4XLF A;  4XOP A;  1JHH A;  2ELH A;  3I5U A;  4EM0 B;  1P4W A;  1B6A A;  3SJM A;  4JYK A;  2O0Y A;  3DQV C;  3LQQ A;  4XID A;  4I2O A;  2X1E A;  5IT9 Z;  1XB4 A;  2VJ5 A;  1AKH A;  3BJA A;  3AFH A;  4BL0 B;  2EIK H;  3RKY A;  1OCO H;  2O8X A;  3L2U A;  1WH7 A;  3QQA A;  1U78 A;  1OLT A;  3BR2 A;  4B4C A;  3DKX A;  1O7L A;  1VQM I;  3GTQ J;  1J5Y A;  2NVY J;  4RBO A;  1I50 J;  4V2F A;  2ZB9 A;  2VBX A;  3T8T A;  2L4A A;  4EJO A;  2Y30 A;  4UVB A;  3ZRG A;  2P4W A;  4A3B J;  1TBX A;  3IH3 A;  3T8R A;  2L7Z A;  3HBL A;  1LE8 B;  2AO9 A;  2RKH A;  1MDM B;  2DJN A;  1XGO A;  1T0F C;  3V7S A;  3L00 A;  1WWX A;  1KYZ A;  3Q0W A;  2BW3 A;  4M9Z A;  2K5C A;  2GXB A;  3HIF A;  1M1E B;  2STT A;  2XAH A;  1Q1V A;  1HQC A;  3H5N A;  5IOZ A;  2X4H A;  4CXF A;  1JI8 A;  3TO9 A;  3LA3 A;  1BIA A;  1S29 A;  1IG7 A;  5FKM A;  5TJJ A;  1G3W A;  3CCE I;  1A6I A;  2FML A;  2MYS A;  4UXN A;  2M1B A;  2M9H A;  1E2X A;  1I6X A;  1WJC A;  3H35 A;  1UAA A;  2DPD A;  1WKM A;  2P81 A;  2A3S A;  4A12 A;  1G8X A;  3CTA A;  1GVD A;  1SAU A;  2A5W A;  3MKL A;  2BXY A;  1K83 J;  2VOD A;  3S14 J;  5FRN A;  4Z6Y A;  3HOX J;  3DEE A;  2QSH X;  3O2P E;  2Y0S A;  4NHJ A;  3E6B A;  5DCM B;  2DTZ A;  3K4M A;  3OYJ A;  2V4J C;  3CC7 I;  4MTE A;  3BJO A;  2Y9Z A;  2AXT C;  3FBN B;  1JTX A;  3BZK A;  4IRH A;  1YG2 A;  4HST A;  3CUQ B;  5CJ9 A;  2K9M A;  1FEX A;  4G12 A;  1ZH5 A;  2FNA A;  2XVC A;  2XAQ A;  1GUU A;  2E7W A;  2JSC A;  4LGW A;  2XF7 A;  4XLP F;  2WAE A;  1FYK A;  2KRF A;  4PZJ A;  3LSR A;  5E18 F;  2IA0 A;  4HV6 A;  3QOE A;  1NG7 A;  4HAM A;  2E2H J;  4HRI A;  2RVC A;  3FX3 A;  3GZ6 A;  3TGN A;  2WY8 Q;  4IOA F;  5J1Y A;  3PNY A;  4YIR X;  4KDP A;  5CLS A;  5FLX Z;  3H0D A;  1P7I A;  1DU6 A;  3HPG A;  3CC2 I;  2ELK A;  4D5F A;  1E3O C;  2R7F A;  1TZL A;  4P9F A;  4EAT A;  1HDP A;  3LSJ A;  3LFK A;  2E71 A;  3ZMU A;  4EGY A;  1I5Z A;  3VOE A;  2QCO A;  4U88 A;  2LKP A;  1GV2 A;  4I6Z A;  2FD5 A;  1RZ4 A;  3CZ6 A;  2VT2 A;  2JJ7 A;  2QQ9 A;  2EA2 A;  2YU9 J;  3HOS A;  2XRN A;  3CC4 I;  3L2R A;  4PGH A;  1ZRD A;  4HNT A;  3N97 A;  5LBQ A;  4IPA A;  4CH7 A;  1OCC H;  1IN5 A;  9ANT A;  1YI2 I;  1WVR A;  1WSU A;  1W1W E;  4F3Q A;  2JPC A;  1UFM A;  5LD2 C;  3PUB A;  2HQ5 A;  2HVQ A;  3BC8 A;  4J00 A;  4D9J A;  2XC7 A;  3F8F A;  4ESF A;  1F9N A;  2VON A;  3WU1 B;  1X4O A;  2DDB A;  4PJM A;  3E6M A;  1BW6 A;  2ZSH B;  4CCO A;  3WG7 H;  1Y1V J;  4AC0 A;  4M9S A;  2VC1 A;  3JTG A;  4PJJ A;  5LRR A;  5A2Q R;  1SD7 A;  1YS7 A;  1HF0 A;  2XV4 S;  1IN6 A;  1TL8 A;  3WTW C;  5GAH J;  2P0T A;  1V4R A;  3E6C C;  1LKX A;  3AG3 H;  2WV0 A;  1R9T J;  1BOA A;  2OPT A;  4UV9 A;  5LGU A;  2XIG A;  1YJN I;  1QU3 A;  2XHK A;  2HVR A;  1F43 A;  1IUF A;  3OIO A;  1IXS B;  2Q1Z B;  4XLH A;  1XC5 A;  5JR3 A;  4E4H A;  2N8G A;  4BAY A;  2JTV A;  4MIM A;  4W97 A;  3ERM A;  2VJI A;  2K9S A;  5J40 A;  2JK3 A;  2ZJQ F;  4RS8 A;  1T33 A;  4RGR A;  2HDC A;  4RGU A;  4AIJ A;  1Z3Y A;  1ENH A;  4A5M A;  3P7N A;  1W5T A;  2CH0 A;  5B5E C;  4YRV A;  1AU7 A;  1P92 A;  5FRO A;  5A2Q K;  4G94 A;  2UWM A;  1Z0X A;  4KIG A;  1K79 A;  2L02 A;  3FZV A;  3DPU A;  5KCM A;  4FX4 A;  2QUF A;  3KP4 A;  1A35 A;  4B48 A;  1EH7 A;  3AL0 C;  4Z2Y A;  5BS6 A;  2OF7 A;  2R7W A;  1RIO H;  3TW6 A;  1FPQ A;  1EH8 A;  5IY5 H;  3I56 I;  3DKW A;  1LEA A;  2PLY A;  4CO8 A;  4HLX A;  4HNV A;  3H5A A;  2FOW A;  3D0S A;  3JAM K;  2CUE A;  2HFH A;  2KRC A;  2NS8 A;  3HSE A;  5F1J A;  2M8E A;  4M73 A;  5IYD J;  2LFB A;  2W82 A;  3OYA A;  3BR3 A;  4ZDO A;  2BW3 B;  3N05 A;  5M5X J;  1QHH D;  2DMN A;  1TC3 C;  3BJ6 A;  4L9J A;  3F23 A;  2CFX A;  1BL0 A;  1YQA A;  2W1O A;  4A3G J;  3SXY A;  1O3S A;  3E5U A;  1P4A A;  3GEZ A;  1R4N B;  4Y7N J;  4I0A A;  1QVU A;  1IV6 A;  1FC3 A;  2HPI A;  3BR5 A;  3E7L A;  5EEA A;  1O3T A;  1OKR A;  3CJN A;  4BAC A;  1CQT A;  2YR2 A;  1JT6 A;  1O57 A;  1S5L C;  2MD0 A;  4M6X A;  1LFB A;  1EKE A;  1T08 B;  2D1H A;  3AKZ A;  5J6X A;  3DPL C;  3AAF A;  3EDP A;  3CCM I;  4RAF A;  2ZXJ A;  3OSF A;  4C3I J;  1XMA A;  4A3F J;  3F0C A;  5E3O A;  4C3J J;  1X1A A;  1BJA A;  5EJC A;  2YUS A;  3IWF A;  3SFI A;  1MIJ A;  1P2F A;  2OA4 A;  1KQ0 A;  1TLH B;  3PQJ A;  1S7E A;  3N4M A;  2XAS A;  2QM3 A;  2FMY A;  3JW4 A;  3PO3 J;  2R7T A;  4M3G A;  4HNU A;  4E7K A;  1RI7 A;  2DK8 A;  3CQZ J;  3DV8 A;  3MWM A;  1X3W B;  4ZYG A;  2KHM A;  3HZJ A;  3G1L A;  3FF5 A;  2K86 A;  4UNO A;  1V54 H;  4N0B A;  4DZJ A;  4HQE A;  2VAS A;  2EFN A;  1HXD A;  1I3A A;  3FXM A;  4RDU A;  3VYT B;  2F5E A;  2AS5 F;  3DF8 A;  3KFW X;  1ODD A;  3HHH A;  4C2T A;  1ZYR F;  2VXD A;  2DA7 A;  3BDD A;  4MFE A;  5HS9 A;  2A68 F;  5K7F A;  1Z9C A;  3HL2 A;  3MEX A;  1DP3 A;  4L9N A;  1Z7L A;  5FKO A;  4B1R A;  2K40 A;  4X0G A;  4ZC3 A;  2HYJ A;  4OAY A;  4M3F A;  3K1P A;  3CJT B;  4LFU A;  3J81 R;  3K10 A;  1I1S A;  3CDL A;  2FU4 A;  4FTH A;  1HW5 A;  2BY2 A;  2IEK A;  2BVM A;  5E3N A;  3IRR A;  3R6S A;  2LBF A;  5DD8 A;  5ICC A;  1TWA J;  1JKO C;  1K78 B;  2MAB A;  1V55 H;  3KP6 A;  5EDN A;  1ON1 A;  1D0Z A;  2FOK A;  2VE8 A;  2A5Y B;  3CCL I;  3COA C;  4MQ9 F;  1ITY A;  5FKL A;  1W7P A;  1YE9 A;  2VKV A;  3GF2 A;  1XGN A;  2XPW A;  3VDX A;  4YFN F;  1QZY A;  5HS8 A;  3W6K B;  2L9V A;  4MLO A;  3H9J A;  2DYS H;  1R1T A;  4RA2 A;  3G6E I;  5D5U B;  1FX7 A;  1A6Q A;  5L3E A;  2HU9 A;  1FP2 A;  2IA2 A;  5FD5 A;  3ZQL A;  1WRJ A;  2ECB A;  2P7C B;  3S2D J;  3DBH B;  3DEW A;  4AUX A;  3F8M A;  4UY8 I;  2RC4 A;  2QKM B;  3CJR B;  1R6R A;  2P5V A;  5H20 A;  2CQX A;  2B9S A;  1FSH A;  4BQO A;  1ORK A;  3WG9 A;  2K3F A;  1WJB A;  2MG4 A;  2VKH A;  4ZDP A;  4BKX A;  5IP9 J;  2QWW A;  1R5G A;  2EPF A;  1IW7 F;  2HKX A;  2PMZ A;  5LHH A;  2COB A;  2AHQ A;  2CMP A;  1UHM A;  3D5S C;  4M71 A;  1JJ8 C;  4IX7 A;  1F4K A;  3MZ8 A;  2A61 A;  1KU9 A;  4ZJZ A;  5F1R A;  2X1C A;  1ZRE A;  1TWH J;  4IHW A;  2ID3 A;  3PO2 J;  2M45 A;  3FM5 A;  2HYG D;  1RQ6 A;  3O3K A;  5LLQ A;  3AG4 H;  2CQQ A;  2NVQ J;  2R5Z B;  1K61 A;  2W00 A;  1WJA A;  2DOE A;  3ABU A;  3LWF A;  2O6G E;  1U8R A;  1Z3X A;  4XK4 A;  2DLL A;  1VZ0 A;  2NAZ A;  4H0E A;  1O3R A;  2FQ4 A;  3OYM A;  3OR1 C;  1ONV A;  3TMO A;  3KCC A;  2I5U A;  2BE5 F;  3Q3S A;  2X6Y A;  3KEQ A;  4DBR A;  2EZI A;  5CVU A;  5HS7 A;  1SVM A;  1DQU A;  3LAJ A;  2UZK A;  4KFC A;  2GLO A;  1B8I B;  1B9N A;  4A3E J;  3K4L A;  4YFX F;  4U87 A;  2KZG A;  3EUA A;  4Y33 A;  4ESB A;  3L7W A;  1XMK A;  3BG3 A;  4CGZ A;  2WC2 A;  3BZC A;  4OIO F;  5FLX K;  2EK5 A;  2DA6 A;  4MFD A;  2L9R A;  4YIF A;  5EEG A;  3M8J A;  1KQ9 A;  2FUG 2;  3CMA I;  3IUO A;  3JRF A;  2DU9 A;  1FIP A;  1CF7 A;  1FZP B;  4QIW N;  3RKQ A;  2NS7 A;  3NWS A;  2X6X A;  2VC0 A;  2LKS A;  4HYE A;  1UZC A;  4NQW A;  2F5F A;  4AVP A;  3QU3 A;  3KPH A;  4LOC A;  3HHG A;  1R58 A;  4IHY A;  1S9H A;  4PK4 A;  3WTT C;  1QZE A;  1XTA A;  1HKQ A;  3TED A;  3QPS A;  4A3I J;  2JVH A;  1VQK I;  2HKO A;  2XRL A;  2VBZ A;  3DU5 A;  1FIA A;  2MA3 A;  2XDV A;  5F0F A;  3GTK J;  3F6O A;  3K69 A;  1T6S A;  3IC7 A;  1RKT A;  3W6J B;  3JRD A;  1WHU A;  1B72 B;  5FD6 A;  4LIU A;  3KYD B;  1WJE A;  2RNG A;  1Y8Q B;  3HJE A;  3TOA A;  4HV5 A;  5K5O A;  1HCR A;  1BN5 A;  4M9X A;  2DFI A;  3F9K A;  4W1U A;  1D1C A;  3DTK A;  5J8C A;  3CD6 I;  1QO0 D;  2VBY A;  1MZB A;  1EJ9 A;  1FLI A;  1SFX A;  3CCY A;  2GA2 A;  4ENJ A;  2LMD A;  2D45 A;  4M3B A;  1X1B A;  4ZZL A;  4I7H A;  1KGS A;  2K3P A;  2VL8 A;  4FX0 A;  1FOK A;  1TNT A;  3H9G A;  5A2Q Z;  4KIB A;  2H1K A;  4CA0 A;  4S05 A;  2R5Y B;  3MZY A;  5D4R A;  2LTP A;  2XKP A;  5D4S A;  4ZDL A;  5K5Q A;  4RAZ A;  4UUS B;  2Z2S B;  5H6Q A;  4ZTJ A;  2R7U A;  3W2V A;  2RAE A;  3K9T A;  2CSO A;  2PN6 A;  1PUF B;  4BNC A;  3CJQ B;  3JAM Z;  2HZD A;  3AG2 H;  2E1N A;  3E0J B;  1VTN C;  3C1D A;  4KIC A;  2L7K A;  1ZR4 A;  4WX9 A;  3OY9 A;  4BE0 A;  2GWR A;  2HPM A;  1TP4 A;  2DFE A;  2FSW A;  1YFH A;  1D1B A;  2DYR H;  1ZGJ A;  2DFF A;  5E79 C;  2O9L A;  1MNE A;  4KN7 X;  5E3M A;  4E7L A;  1BA5 A;  1KON A;  3FXL A;  2M3A A;  3VPR A;  4BHC A;  4BDY A;  1FYL A;  4A3C J;  2DBB A;  3OS0 A;  2OTJ I;  2IGO A;  2F48 A;  3SZT A;  1S7A A;  3ZQG A;  3W2A A;  2ETH A;  4F55 A;  2ME0 A;  3TP0 A;  2WWY A;  1W7P B;  3S1N J;  3BQZ A;  3A01 A;  2Y9Y A;  1C0W A;  1D5Y A;  4V19 K;  3QYF A;  3S16 J;  1HSJ A;  3HUG A;  3SZP A;  4E70 A;  3GTJ J;  2CS3 A;  2VLA A;  3FXJ A;  4IHT A;  3MKY B;  2VPL A;  3BPV A;  1ETQ A;  3HC7 A;  1RUN A;  4HLY A;  2KZV A;  3NRV A;  4I01 A;  4IHV A;  2KFD A;  2OU2 A;  4AU7 A;  1BI1 A;  3CUO A;  3M1E A;  1U5T B;  3NEU A;  5FO5 A;  1ERD A;  4ANJ A;  1XG1 A;  2EV0 A;  2FE3 A;  3FBI B;  1GT0 C;  1OCT C;  3RZO J;  1IV8 A;  2BY0 A;  3I4M J;  1QNT A;  4CUG A;  4K2E A;  1DUX C;  2QQ8 A;  3LST A;  4BJT A;  2VXZ A;  3TQN A;  4BXX J;  3JSP A;  2CQK A;  5LEJ A;  3HDD A;  3F72 A;  2M35 A;  2E5Z A;  2X6W A;  3PFY A;  5FLM J;  3OYN A;  2H27 A;  3HKZ A;  1QBJ A;  5DUK A;  1YRN A;  3QOD A;  3F8C A;  4X6A J;  2Q8K A;  2A05 A;  1ZLJ A;  2O5R A;  1IXR C;  4E7I A;  2JA7 J;  3A02 A;  4PSW A;  1LDD A;  3KP5 A;  2HQR A;  4RGX A;  1RUO A;  2OUM A;  4IHS A;  5HOD A;  2QEX I;  3TDU C;  2NVU B;  4GRI A;  2CV1 A;  3PL8 A;  1YW8 A;  4B44 A;  5HNF A;  2QQA A;  3QRF F;  4WXH A;  3OOP A;  3P5J A;  2J5O A;  4FE4 A;  3QPL A;  2QBY B;  4XKV A;  3WE2 A;  5EZG A;  4WCG A;  1O7F A;  2L54 A;  2K85 A;  3ZMV A;  1T38 A;  5CVR A;  1LNW A;  1XDS A;  1VI0 A;  1MH3 A;  2L9N A;  2P6S A;  2QSF X;  3OYI A;  3J80 R;  1OYY A;  2XAF A;  4ENK A;  1OCP A;  1D3Y A;  3WHB A;  1G3Y A;  1R1V A;  3CCU I;  1K4T A;  2TRT A;  1QHG A;  1XMX A;  3A0H C;  2O3F A;  3GME A;  2H6B A;  4A0X A;  4LG0 A;  5F27 A;  2XB5 A;  3G3Z A;  1POG A;  1VQO I;  2RNJ A;  2NOG A;  3ZMS A;  2FX0 A;  4E7J A;  2PMU A;  4RB0 A;  1FMW A;  3LSP A;  3H9Q A;  2W84 A;  1VQ7 I;  4EMS A;  4U0V A;  2RQP A;  2OZ6 A;  4LJZ F;  2W25 A;  2D1V A;  2XGC A;  2XPV A;  4PJ0 C;  1BR1 A;  1HKS A;  1IZ1 A;  1OPC A;  3H92 A;  3I54 A;  3J81 Z;  3KLO A;  1GHC A;  1TQM A;  2L9S A;  4IJA A;  1N77 A;  3OMY A;  1K4S A;  3O8H A;  4CCM A;  5DEQ A;  3EUH C;  3J80 K;  3HXL A;  3R61 A;  1VFC A;  1H8A C;  3BCB A;  3K7A J;  1NHA A;  3NQO A;  1ACI A;  2F5D A;  3G1O A;  1EF4 A;  2EIL H;  4XIC A;  3RPQ A;  3O6B B;  5FLV A;  1QPM A;  4G7H F;  2EFW A;  1YIJ I;  3FXU A;  3FK6 A;  3ZQF A;  2IGK A;  3CMM A;  2LOO A;  4HZF A;  3RJP A;  5JHF A;  4LMY A;  4A0Z A;  4LLG F;  4EJV A;  1VQP I;  4C2U A;  4M6Y A;  5EYR A;  3SEZ A;  3K4J A;  3JCU C;  2Y69 H;  3I55 I;  1SFU A;  1J09 A;  2CU7 A;  5AIQ A;  3J7A W;  4ESJ A;  5DCF A;  2O7O A;  3HRT A;  2MW8 A;  3R60 A;  1AWC A;  2GXA A;  2LC2 A;  1QA6 A;  2ZC2 A;  3M07 A;  4HDV A;  3A2K A;  1MBE A;  2NNY A;  1MBH A;  3QWL A;  2YX4 A;  4BJ5 C;  2OJE D;  3EUK L;  2KRH A;  2QVO A;  1YYV A;  4BEH A;  4DOZ A;  3M7G A;  1TT5 B;  5JHU A;  5LGN A;  1MMD A;  3UKG A;  1OCZ H;  1PYV A;  2BVL A;  1YJ9 I;  2XAJ A;  3VYS B;  2KMU A;  2RDP A;  2X51 A;  3WOD F;  3JRA A;  3GLX A;  4J19 A;  2HTS A;  5CVV A;  4XRF A;  2AQF A;  4IKF A;  3C7J A;  2JMW A;  2ZSI B;  2IS1 A;  3PJR A;  5JLW A;  2AQE A;  2Y48 A;  3FXK A;  3CLO A;  2R7Z J;  3ELK A;  2JA5 J;  2XPU A;  3M3Y J;  3SHF A;  3ZP5 A;  2A6T A;  1KA8 A;  2ADU A;  3QPT A;  4MNU A;  1YX3 A;  4QPO A;  4C9Y A;  1MD0 A;  2RRE A;  3PNT A;  2M4K A;  3C3W A;  3E3V A;  2ICW G;  2HQA A;  1XSX A;  3HKZ N;  2RQQ A;  3DU6 A;  2E1C A;  2CQN A;  2O61 A;  4C30 A;  1HKT A;  1FMV A;  1LEB A;  2HDW A;  1ETK A;  2Z3Y A;  3CDI A;  5LGT A;  1GXP A;  1KQ8 A;  1VQ5 I;  4HSR A;  2DAO A;  4A3D J;  2FF4 A;  3VSL A;  4CZC A;  2CO5 A;  2DFH A;  1MMN A;  3WE3 A;  1SMY F;  4NBQ A;  1FWZ A;  4NDL A;  4IQ4 A;  4X1E A;  3KEY A;  3I71 A;  2A69 F;  4BY7 J;  1JGS A;  1MMG A;  2J5P A;  2R7V A;  1ETV A;  5EZH A;  1X2N A;  3V8K A;  3VYU B;  4FAS D;  2FJ1 A;  2HOS A;  4P96 A;  1PVE A;  3OWT A;  2IXS A;  2OV7 A;  2LY2 A;  1E3P A;  3MQ0 A;  2M0C A;  4E6K G;  2L01 A;  2I10 A;  2YU3 A;  4AWX B;  1MND A;  5GP9 A;  1MMS A;  4ZYA A;  3BR6 A;  4ZH4 F;  5J47 A;  4LLL A;  3HSR A;  4HEA 2;  4YEJ A;  2V1N A;  2IA1 A;  2GIZ A;  1YRN B;  1HST A;  4XOR A;  3LSH A;  4G6Q A;  4QWQ A;  1ZQ3 P;  6PAX A;  2FEZ A;  1ETY A;  3K2A A;  3I53 A;  2Y2Z A;  3FM3 A;  3BR0 A;  2JRT A;  4Q47 A;  2B7E A;  3PSF A;  4RB2 C;  5D5W B;  2PFB A;  5FJ8 J;  2ZJ2 A;  4OAZ A;  4WXC A;  5JVG F;  1V5G A;  5B66 C;  1LDK B;  3L2C A;  2QEN A;  3RCO A;  3KP2 A;  1AKH B;  2V1U A;  2UUZ A;  3I3L A;  2IT0 A;  4A3K J;  5IP6 A;  1S7O A;  5F04 A;  3PNV A;  1BJZ A;  2NXN B;  5L3F A;  1Z7U A;  2P5L C;  1J2X A;  3HM5 A;  2ZFW A;  1XCB A;  3IAM 2;  3KZI C;  4XQF A;  4IQJ A;  2OTL I;  2G0E A;  3GX4 X;  1H89 C;  4BGD A;  1YIT I;  2VB6 A;  1N25 A;  4JBA A;  5LEK A;  4G7Z F;  1I3Q J;  3K70 D;  1JTY A;  2E5N A;  5DS9 A;  4LG3 A;  4DQ2 A;  1VQ6 I;  4N4N B;  2D5V A;  4L5I A;  2RV8 A;  4ZYH A;  4KUM A;  2KJB A;  3J7Z I;  2LDU A;  4I02 A;  2Y75 A;  2E19 A;  3X2Q H;  3K4B A;  4Q48 A;  2LG4 A;  4D0P A;  4EV0 A;  2XGE A;  2ISY A;  2MBF A;  3F8B A;  1P7J A;  1RKW A;  3IRQ A;  3KZY A;  1L3L A;  1DDN A;  1UHS A;  4ITV A;  1X1D A;  2HI3 A;  4ON0 A;  3I59 A;  4PJN A;  1Z6R A;  3RDI A;  4HOB A;  5J4V A;  1U8B A;  2MLK A;  4Y3O A;  1WGX A;  1K7A A;  1ZAR A;  4F93 B;  3WHC A;  1Z67 A;  4I99 C;  3C2G A;  3DXJ F;  3KLN A;  3B6C A;  4FET A;  5D5V B;  4XON A;  5IYC J;  3K1M A;  5ED4 A;  2KIU A;  3MZH A;  5F6F A;  2GAU A;  2IAI A;  2NOJ B;  3OYK A;  1YLF A;  1UG2 A;  2KP6 A;  2F4I A;  1XCV A;  2K02 A;  4MGR A;  2WAD A;  2PJR A;  5E1W A;  1N78 A;  3QAH A;  3LQR A;  2PBI A;  2G7U A;  1R23 A;  2BYV E;  3MAJ A;  1E17 A;  1ZAO A;  4UB8 C;  1MMA A;  2FBK A;  2ZNZ A;  4BQN A;  1SAX A;  2MC4 A;  2XSD C;  1WH5 A;  1BIB A;  3PIO F;  1IXC A;  4U7B A;  2NVT J;  3IWZ A;  1B9M A;  2YSR A;  2ME6 A;  5ILU A;  4XBF A;  4IZZ A;  2P5K A;  2CWE A;  3OYL A;  3F21 A;  4HBL A;  5EG0 A;  4I98 B;  2JRM A;  3KIO A;  4BEH B;  1Y8R B;  3QPH A;  3H3U A;  3TOB A;  5J4Y A;  1XSD A;  1YOV B;  2HYF A;  3FMR A;  4YII A;  2EV6 A;  1RR7 A;  3VFZ A;  5E8I A;  3CCR I;  1IJW C;  1B4A A;  3I9V 2;  1REP C;  2R3S A;  4P5O A;  3HB9 A;  5C3E J;  1KZH A;  1FNN A;  4DNC A;  3BPX A;  2DT6 A;  4RB3 C;  3EUH A;  2NYX A;  1Y1W J;  3KEO A;  4G7O F;  2IW5 A;  3S17 J;  5IT3 A;  1UB9 A;  3OIQ A;  1VQ8 I;  4B3A A;  4BE2 A;  5BMZ A;  3P9K A;  3CP8 A;  1PUE E;  4PJL A;  5L3C A;  1U9O A;  1FOW A;  4PSX A;  2M0M A;  4HQM A;  2WV1 A;  2P8T A;  4XKW A;  3FKI J;  1S8N A;  4JP0 A;  4LD5 A;  1R00 A;  1SD5 A;  5E1Z B;  1UHW A;  1YHQ I;  1BC8 C;  4GFB A;  2V9K A;  1GVJ A;  5K5R A;  2DTR A;  3NAU A;  4OWR B;  1BC7 C;  1XSV A;  4B3X A;  1D5V A;  3ZMD A;  1QPI A;  4LK1 F;  2F4O B;  3BR1 A;  3J7Y J;  3JSO A;  1FT9 A;  2HR3 A;  2KLO A;  2QLZ A;  5CKT A;  2ZXW H;  1NK3 P;  3MMY B;  4BBR J;  1WI9 A;  2DDA A;  4RAG A;  3J80 Z;  1R4M B;  4KIT B;  3ZCO A;  2EA4 A;  4FHT A;  3SDG A;  4P1W A;  3S2W A;  1OCR H;  3SEQ A;  3WTY C;  1JKQ C;  4E7S A;  2FBH A;  3J81 K;  3Q0U A;  1LDJ A;  2V26 A;  3ZPL A;  1TWF J;  3SYT A;  1UST A;  2CV2 A;  5H2F C;  5CVJ A;  1Y39 A;  2HOA A;  1NG6 A;  3Q9S A;  5J1R A;  1U0J A;  3TW7 A;  2JWT A;  4A3M J;  3DBL B;  1I6H J;  2R7X A;  1G4D A;  2EIM H;  1X3U A;  1J75 A;  2O8K A;  5HVQ C;  3CMY A;  1K6O A;  1WJD A;  1N75 A;  1EV7 A;  5D5X B;  4BXU A;  3JRG A;  1WFX A;  2CQ7 A;  4FCY A;  4A3J J;  1W5S A;  1PP7 U;  4BBS J;  3OS1 A;  5GPC A;  2BV6 A;  1ZTR A;  5DM6 F;  4PGG A;  4NC6 A;  1E3H A;  2ELJ A;  3B73 A;  1MJA A;  3RPU D;  4OIN F;  4CYC A;  3OR2 C;  2GOX B;  2R0Q C;  5L3G A;  3FMS A;  2KIM A;  2V1D A;  4F52 A;  2L2O A;  3WTV C;  3CCS I;  4U0W A;  2DOD A;  2G7H A;  2DK5 A;  1DPU A;  4Q5S F;  2MH9 A;  1JUP A;  3ABT A;  2ZXI A;  5E1X A;  4RLQ A;  3HYI A;  2Z9O A;  1FBU A;  2MH2 A;  3OS2 A;  4RLF A;  1U9N A;  2QQB A;  3Q0V A;  4NNJ A;  2DO7 A;  2FNP A;  2VOP A;  2NRA C;  1W4M A;  3RYR A;  3DPT A;  2BEO A;  3VYR B;  2LD5 A;  2WAQ N;  3HOW J;  5LHG A;  3MN2 A;  3UNG C;  4LB6 B;  3S8P A;  3GBG A;  4ABZ A;  2R7D A;  2ZFU A;  3TP3 A;  3JRE A;  1KU7 A;  4L5E A;  4P55 A;  1R5I D;  5KK1 A;  2FQ3 A;  2WB1 N;  2VN2 A;  2ZJP F;  1T39 A;  2A6E F;  2L7M P;  1O3Q A;  2BHY A;  3TL4 X;  4OU0 A;  1D0Y A;  4UV8 A;  5DV5 A;  3BWG A;  3WTS C;  4J01 A;  1IN8 A;  5GTH C;  3WU2 C;  4AIH A;  2XF5 A;  1HDD C;  3GTO J;  3WTZ A;  1EH6 A;  3DKY A;  2DMT A;  2EJR A;  2K4J A;  1SVO A;  5L3D A;  4BY1 J;  3D1N I;  2CW7 A;  2V79 A;  2W24 A;  5HLT A;  4KA4 A;  3W2W A;  3K70 C;  3PUF A;  1ZRF A;  2LLK A;  1X19 A;  3ZGK A;  1LE8 A;  2PJR B;  2JA6 J;  3EPZ A;  2E60 A;  2EFO A;  1MDM A;  1LQ1 A;  3WGI A;  4GXO A;  3IAS 2;  2UXX A;  2EZL A;  5B1B H;  2MZ4 A;  4ENN A;  1XDU A;  4LIT A;  2GIV A;  1XPX A;  2LSO A;  3W3C A;  2ESH A;  2AXL A;  2DOA A;  3CCQ I;  2GZW A;  2LH9 A;  4AVZ A;  1D8J A;  3ROU A;  1W7P D;  2VBW A;  1OYI A;  3HRU A;  2V6C A;  2QA4 I;  2XRO A;  4IEJ A;  2HS5 A;  3M1C A;  3HGG A;  4MEX F;  1OIS A;  2ZJR F;  4QTR A;  3DWL E;  4ENM A;  3ECH A;  4CYD A;  1TT0 A;  3BTC A;  1DU0 A;  1FBQ A;  5JVT A;  1F5T A;  4JX4 A;  2VKE A;  2YPR A;  4QSH A;  3T0Y A;  4A5N A;  1APL C;  1TQP A;  4D7N A;  3GTM J;  2LRE A;  3PQK A;  1XN7 A;  2F2E A;  2H09 A;  4BE1 A;  1A04 A;  3JR9 A;  1JHF A;  5FRM A;  5DCM A;  3B02 A;  1RNL A;  3S15 J;  3ZR8 X;  4QPQ A;  1Q1H A;  2MLG A;  2E1M C;  3E5Q A;  2E1O A;  1MKM A;  5JFR A;  1H9G A;  1O4X A;  3CUQ A;  2A07 F;  3LA2 A;  4EM1 A;  2LY1 A;  1T8I A;  2ESN A;  2M5W A;  4UB6 C;  1ZGA A;  3S2H J;  2LF7 A;  5IPA A;  1GLN A;  2LBF B;  2MGQ A;  1FBS A;  1T56 A;  4EJW A;  1Z1D A;  3GFL A;  4XNF A;  3E97 A;  1ZG3 A;  2QSG X;  4KNY A;  3P9I A;  2L4M A;  4DZP A;  1H9T A;  4QLC U;  2LP0 A;  2KKO A;  5C4X J;  4AID A;  3BG7 A;  3REO A;  1G3S A;  4ZTF A;  4IRI A;  2Z5U A;  4II3 A;  4CCJ A;  1D0X A;  1BBY A;  2JA2 A;  4A3L J;  3OSG A;  3QP6 A;  1MW7 A;  4CZZ A;  1W36 D;  2CUJ A;  2QKL B;  5J3L A;  2KDZ A;  1IRG A;  2IS4 A;  1S3J A;  3OL3 A;  5FB2 A;  2PX9 A;  2PQ8 A;  1QRY A;  3NWT A;  3C2H A;  4DGW B;  4AIK A;  2RN7 A;  5ICG A;  1GDT A;  3HTS B;  3OYH A;  3E1S A;  2HWV A;  1ON2 A;  1RRJ A;  3BRO A;  2MUN A;  4OIQ F;  1D8K A;  4XSX F;  4ASN A;  3R0A A;  2WAF A;  2VQL A;  1LB2 A;  4BS9 A;  2EBI A;  1IDZ A;  5M5W J;  3T5X A;  3DTE A;  3VSK A;  2O03 A;  4I0B A;  4R79 A;  1ETO A;  3JTH A;  5ERI A;  4KIF A;  4BUP A;  3RQ4 A;  4XRM A;  2CUF A;  2DQR A;  3HEF A;  2E36 A;  4IRG A;  5M3M J;  4CYC B;  4YEL A;  1CGP A;  3RKW A;  1IAW A;  5J1U A;  4XLA A;  3ZN1 A;  2CW0 F;  1ZN2 A;  3ZQC A; 
#chains in the Genus database with same CATH homology
 1TW3 A;  4CIC A;  1T2K A;  2CG4 A;  1SD6 A;  4PDK A;  3KP3 A;  4S04 A;  4IVN A;  3D5L A;  5DD4 A;  3F22 A;  1Z05 A;  2F5C A;  2L3D A;  4HX8 A;  1ZHF A;  1JE8 A;  1QZZ A;  4ZYD A;  2H94 A;  2Q2E A;  2OAZ A;  5KVR A;  2Y0M A;  1CF7 B;  1TW2 A;  3BY6 A;  1IUY A;  3GWZ A;  2HOE A;  2XGX A;  3TDZ C;  1J0R A;  1H0M A;  2PMH A;  2HEO A;  4PCQ A;  5HLH A;  4UHT A;  4JQF A;  1IN4 A;  3RYP A;  1SMT A;  4M72 A;  5HLG A;  2EFP A;  1Y0U A;  4EGZ A;  2V1X A;  1G6N A;  2DT5 A;  2FBI A;  4GCV A;  2HZT A;  2EFQ A;  1ZRC A;  2IJL A;  5BOX A;  4KMU X;  3R0J A;  4GYG A;  3EYY A;  3WGG A;  3MCZ A;  2P7V B;  3RI4 A;  3QOP A;  2ISZ A;  1MGT A;  4OMZ A;  3Q9V A;  5DYM A;  2A6H F;  1MJB A;  2YX7 A;  3IKT A;  2XKO A;  2Q0O A;  1QQI A;  4AD9 A;  1AOY A;  1R1U A;  2TDX A;  1BI2 A;  5BPD A;  4GO1 A;  3LAP A;  3GXO A;  3GZ5 A;  4UVC A;  5EEH A;  1XGS A;  4RB1 A;  2GA1 A;  3PFI A;  1YW7 A;  1YW9 A;  3M8F A;  4A0Y A;  5ICE A;  4YFK F;  3V8J A;  4LB5 A;  2KJC A;  4G8X A;  2OD5 A;  3FHZ A;  3KP7 A;  2IPQ X;  2XAG A;  1U5T C;  4L9T A;  4A6D A;  2KIF A;  3TO6 A;  5E8G A;  3E5X A;  5LRS A;  3R4K A;  1XGM A;  2V9V A;  3LA7 A;  4CHU A;  3QU6 A;  5BQT A;  5HOO A;  2FXA A;  3VEP A;  3F6V A;  2HGC A;  4ZZD A;  3E6D A;  1K78 A;  4HA8 A;  1TQI A;  3GFI A;  2QZ8 A;  4WK8 F;  1FP1 D;  3F3X A;  1ZLK A;  2PI0 A;  2VT3 A;  5D6E A;  1V3F A;  4EVI A;  4IF4 A;  5K1Y A;  4HX7 A;  1TTY A;  3T1B A;  4HDU A;  3FXQ A;  4N9I A;  3WU0 A;  2XUB A;  4KT5 C;  3I4P A;  1QGP A;  3KZZ A;  4P9U A;  3WGH A;  3IL2 A;  1XD7 A;  3VB2 A;  2NS0 A;  3L09 A;  3K0L A;  2FA5 A;  4O5V A;  4IXA A;  3HTU A;  1BI0 A;  3KET A;  3U1D A;  3CO7 C;  4Q4Z F;  1T98 A;  2M30 A;  2ZO4 A;  3GUD A;  4LG0 B;  3CDH A;  2ACJ A;  2ZKZ A;  4A2U A;  3M9A A;  4LK0 F;  5TRD A;  2G9W A;  2C6Y A;  3RTR A;  1BM9 A;  2OQR A;  3Q5F A;  5HDN A;  1ZG1 A;  2COM A;  3GO5 A;  1TNS A;  2HQN A;  2ZME A;  1OYW A;  1P4X A;  3CUQ C;  3FMQ A;  3ERE D;  5FFZ A;  5D8K B;  3I58 A;  3EET A;  2CYY A;  1I1G A;  3WTU C;  4HF2 A;  1Z91 A;  3HRS A;  2ZCW A;  1IF1 A;  3GVA A;  3RPU A;  3GW2 A;  4HX4 A;  4BH9 A;  3J7A O;  1J59 A;  3ML6 A;  2E7X A;  2IRF G;  4WF2 A;  2M87 A;  2BGC A;  4R8H A;  3BOQ A;  4MTD A;  3BZ6 A;  4OOI A;  4NB5 A;  1FYM A;  3U9G A;  1YS6 A;  3QP5 A;  1J9I A;  3I64 A;  5L3B A;  2BBY A;  3WTX C;  1HW2 A;  4U0Y A;  5D6F A;  3V4G A;  1T0F A;  1R7J A;  4F7Z A;  2P6T A;  5JI6 A;  1WQ2 A;  2STW A;  4FT8 A;  4EM2 A;  4OMY A;  4WXD A;  1U2W A;  5IT9 K;  4Y15 A;  3K1N A;  4G9Y A;  3CO6 C;  1J7K A;  4MQV A;  4HW0 A;  3IHU A;  2QYO A;  3VOD A;  3KE2 A;  1U6G A;  3ZQ7 A;  4Y13 A;  4RGS A;  1FSE A;  3GFM A;  4BHB A;  4GGG A;  5D8L B;  2LF8 A;  1KU2 A;  4WWC A;  4L9V A;  1MJ9 A;  2D2W A;  3V8L A;  4XSZ F;  3IKV A;  1STZ A;  2K7L A;  5AON A;  3U2R A;  5CVI A;  4OIR F;  4EJT A;  4N9H A;  5AIP A;  3P9C A;  1HW1 A;  3RKX A;  1U5T A;  1L0O C;  2EWN A;  5FGM A;  5ILV A;  2X0L A;  4BHP A;  3GFJ A;  4JK1 X;  4MEY F;  3DFG A;  2OBP A;  5BPI A;  1ZG5 A;  5E20 A;  4RAY A;  3ULQ B;  3G73 A;  4I09 A;  2LNB A;  4HF0 A;  1F1Z A;  4L0Y B;  4EJU A;  2EV5 A;  4KN4 X;  3RIR A;  5CYV A;  1HBX G;  2Z99 A;  3C18 A;  3BP8 A;  3HSF A;  3ZMZ A;  2W57 A;  3TKY A;  2ZNY A;  4EQQ A;  5ICF A;  1S6L A;  3I59 B;  2WTE A;  2PJP A;  1KU3 A;  2JT1 A;  2QBY A;  4ZYE A;  5E17 F;  2ZME B;  3HOT A;  5DDG A;  1IN7 A;  5F64 A;  1ULY A;  1B59 A;  4XLN F;  2W85 A;  2B0L A;  2JZY A;  2IP2 A;  2JPB A;  2K27 A;  4HF1 A;  3M8E A;  1YTY A;  1JXS A;  1LVA A;  1FY7 A;  4LLN A;  5FFX A;  5HDG A;  1SFE A;  1PP8 F;  1Z6T A;  1G3T A;  4A6E A;  1U3E M;  4TV7 A;  1KYW A;  1IRF A;  2MD5 A;  2EB7 A;  1USS A;  5DUI A;  3F8N A;  1BI3 A;  4R1H A;  2DI3 A;  3ISP A;  2ZBK A;  1GXQ A;  2DPU A;  4MHG A;  1R22 A;  1DP7 P;  1DPR A;  2OZU A;  5H6R A;  3H3Z A;  2RGV A;  4GYI A;  4L5J A;  4L18 B;  1YIO A;  2GXG A;  1YO5 C;  1PDN C;  2H6C A;  2DW4 A;  2K4B A;  2MC3 A;  2FRH A;  3DEU A;  4OIP F;  1P6R A;  2Z33 A;  3V7C A;  5HDK A;  3OV8 A;  3SQN A;  4M74 A;  4CDG A;  3TO7 A;  2GQQ A;  4O3M A;  3ZMT A;  2UXN A;  3EQL F;  1SD4 A;  3L9F A;  4KYW A;  2CGP A;  2NNN A;  1LJ9 A;  2PG4 A;  4O6J A;  2VE9 A;  4B8X A;  3K2Z A;  2IVM A;  3ZN0 A;  3I0T A;  5ILS A;  4YG2 F;  2VOO A;  1OR7 A;  2HTJ A;  4UVA A;  3EYI A;  1I27 A;  4KMF A;  4U7D A;  1R5H A;  3V7R A;  2OQG A;  5J8F A;  1OMI A;  4BQA A;  3HRM A;  3FXR A;  4ETS A;  4BYY A;  1R36 A;  4L0Z B;  2PEX A;  4Y17 A;  4G6D A;  3SFZ A;  3GYH X;  3FWE A;  3DP7 A;  1UCR A;  2DQL A;  1B1B A;  3MFK A;  4B09 A;  4UUV A;  5HLI A;  5LHI A;  3ECO A;  1JHH A;  2ELH A;  3I5U A;  4EM0 B;  1P4W A;  1B6A A;  2O0Y A;  3DQV C;  3LQQ A;  4I2O A;  5IT9 Z;  1XB4 A;  3BJA A;  3RKY A;  2O8X A;  1U78 A;  1O7L A;  1J5Y A;  2VBX A;  3T8T A;  2L4A A;  4EJO A;  4UVB A;  2P4W A;  1TBX A;  3T8R A;  2RKH A;  1MDM B;  1XGO A;  3V7S A;  3L00 A;  1WWX A;  1KYZ A;  4M9Z A;  2GXB A;  3HIF A;  2STT A;  2XAH A;  1HQC A;  2X4H A;  4CXF A;  3TO9 A;  3LA3 A;  1BIA A;  1S29 A;  5TJJ A;  1G3W A;  2FML A;  4UXN A;  2M1B A;  1E2X A;  1I6X A;  2DPD A;  1WKM A;  2A3S A;  4A12 A;  3CTA A;  2VOD A;  3O2P E;  4NHJ A;  3E6B A;  5DCM B;  4MTE A;  3BJO A;  4IRH A;  1YG2 A;  3CUQ B;  5CJ9 A;  1ZH5 A;  2FNA A;  2XVC A;  2XAQ A;  2E7W A;  2JSC A;  4LGW A;  4XLP F;  1FYK A;  2KRF A;  4PZJ A;  5E18 F;  2IA0 A;  4HV6 A;  4HAM A;  2RVC A;  3FX3 A;  3GZ6 A;  3TGN A;  4KDP A;  5CLS A;  5FLX Z;  2R7F A;  4P9F A;  3LFK A;  3ZMU A;  4EGY A;  1I5Z A;  3VOE A;  4U88 A;  2LKP A;  1RZ4 A;  2VT2 A;  2QQ9 A;  2EA2 A;  3HOS A;  2XRN A;  4PGH A;  1ZRD A;  3N97 A;  5LBQ A;  4IPA A;  1IN5 A;  1WSU A;  2JPC A;  1UFM A;  3F8F A;  4ESF A;  1F9N A;  2VON A;  3WU1 B;  3E6M A;  4M9S A;  2VC1 A;  3JTG A;  5LRR A;  1SD7 A;  1YS7 A;  2XV4 S;  1IN6 A;  3WTW C;  1V4R A;  3E6C C;  2WV0 A;  1BOA A;  4UV9 A;  5LGU A;  2XIG A;  2XHK A;  1IXS B;  5JR3 A;  4BAY A;  2JTV A;  4RS8 A;  4RGR A;  2HDC A;  4RGU A;  4AIJ A;  4A5M A;  3P7N A;  1W5T A;  1P92 A;  5A2Q K;  4G94 A;  2UWM A;  4KIG A;  1K79 A;  2L02 A;  3FZV A;  4FX4 A;  2QUF A;  3KP4 A;  1EH7 A;  4Z2Y A;  5BS6 A;  1RIO H;  1FPQ A;  1EH8 A;  3DKW A;  1LEA A;  2PLY A;  4CO8 A;  4HLX A;  3JAM K;  3D0S A;  2HFH A;  3HSE A;  2M8E A;  4M73 A;  3BJ6 A;  4L9J A;  3F23 A;  2CFX A;  1YQA A;  3SXY A;  1O3S A;  3E5U A;  1P4A A;  3GEZ A;  4I0A A;  1FC3 A;  1O3T A;  1OKR A;  3CJN A;  2YR2 A;  1O57 A;  4M6X A;  2D1H A;  5J6X A;  3DPL C;  3AAF A;  3EDP A;  2ZXJ A;  1XMA A;  1BJA A;  3IWF A;  1P2F A;  2OA4 A;  1KQ0 A;  1TLH B;  3PQJ A;  3N4M A;  3JW4 A;  2XAS A;  2FMY A;  2QM3 A;  1RI7 A;  2DK8 A;  3DV8 A;  3MWM A;  4ZYG A;  3FF5 A;  2K86 A;  4UNO A;  4N0B A;  4HQE A;  2EFN A;  1HXD A;  2F5E A;  2AS5 F;  3DF8 A;  3KFW X;  1ODD A;  3HHH A;  1ZYR F;  3BDD A;  5HS9 A;  2A68 F;  1Z9C A;  3MEX A;  4L9N A;  3K1P A;  4LFU A;  1I1S A;  2FU4 A;  1HW5 A;  3IRR A;  3R6S A;  5DD8 A;  5ICC A;  1K78 B;  3KP6 A;  1ON1 A;  2FOK A;  2VE8 A;  2A5Y B;  3COA C;  4MQ9 F;  1W7P A;  3GF2 A;  1XGN A;  4YFN F;  1QZY A;  5HS8 A;  3W6K B;  1R1T A;  5D5U B;  1FX7 A;  5L3E A;  5FD5 A;  1FP2 A;  2IA2 A;  1WRJ A;  2P7C B;  3F8M A;  2RC4 A;  2P5V A;  5H20 A;  1FSH A;  3WG9 A;  2QWW A;  1R5G A;  1IW7 F;  2HKX A;  5LHH A;  4M71 A;  1F4K A;  1UHM A;  2A61 A;  1KU9 A;  5F1R A;  1ZRE A;  2M45 A;  3FM5 A;  2HYG D;  3O3K A;  5LLQ A;  3ABU A;  3LWF A;  2O6G E;  1U8R A;  2DLL A;  2NAZ A;  4H0E A;  1O3R A;  1ONV A;  3KCC A;  2BE5 F;  3KEQ A;  5CVU A;  5HS7 A;  3LAJ A;  2UZK A;  4KFC A;  1B9N A;  4YFX F;  4ESB A;  3L7W A;  1XMK A;  4CGZ A;  2WC2 A;  4OIO F;  5FLX K;  2EK5 A;  4YIF A;  5EEG A;  1KQ9 A;  2DU9 A;  1CF7 A;  1FZP B;  2VC0 A;  4HYE A;  4NQW A;  2F5F A;  4AVP A;  3QU3 A;  3HHG A;  1R58 A;  3WTT C;  1HKQ A;  2HKO A;  2VBZ A;  2MA3 A;  3F6O A;  3K69 A;  1T6S A;  3IC7 A;  3W6J B;  5FD6 A;  3TOA A;  4HV5 A;  5K5O A;  1BN5 A;  4M9X A;  2DFI A;  5J8C A;  1QO0 D;  2VBY A;  1MZB A;  1FLI A;  1SFX A;  2GA2 A;  4ENJ A;  2D45 A;  4ZZL A;  4I7H A;  1KGS A;  4FX0 A;  1FOK A;  1TNT A;  5A2Q Z;  4KIB A;  4S05 A;  3MZY A;  5D4R A;  2XKP A;  5D4S A;  5K5Q A;  4RAZ A;  5H6Q A;  3K9T A;  2CSO A;  2PN6 A;  4BNC A;  3JAM Z;  1VTN C;  2E1N A;  3C1D A;  4KIC A;  4WX9 A;  2GWR A;  2FSW A;  1YFH A;  1ZGJ A;  4KN7 X;  4BHC A;  1FYL A;  2DBB A;  3SZT A;  1S7A A;  2ETH A;  2WWY A;  1W7P B;  1C0W A;  1HSJ A;  3HUG A;  3SZP A;  4E70 A;  4IHT A;  3BPV A;  1RUN A;  4HLY A;  3NRV A;  4I01 A;  2OU2 A;  1BI1 A;  3CUO A;  3M1E A;  1U5T B;  3NEU A;  5FO5 A;  2EV0 A;  2FE3 A;  1QNT A;  4K2E A;  1DUX C;  3LST A;  2VXZ A;  3TQN A;  3JSP A;  2CQK A;  5LEJ A;  3F72 A;  2H27 A;  1QBJ A;  5DUK A;  3F8C A;  2Q8K A;  1ZLJ A;  1IXR C;  1LDD A;  3KP5 A;  2HQR A;  4RGX A;  1RUO A;  4IHS A;  3TDU C;  1YW8 A;  2QQA A;  3QRF F;  4WXH A;  3OOP A;  2J5O A;  2QBY B;  3WE2 A;  4WCG A;  1O7F A;  2L54 A;  3ZMV A;  1T38 A;  5CVR A;  1LNW A;  1XDS A;  2P6S A;  1OYY A;  2XAF A;  4ENK A;  1D3Y A;  1G3Y A;  1R1V A;  2O3F A;  2H6B A;  4A0X A;  4LG0 A;  3G3Z A;  2RNJ A;  3ZMS A;  2PMU A;  4RB0 A;  2W84 A;  4EMS A;  4U0V A;  2RQP A;  2OZ6 A;  4LJZ F;  2W25 A;  2D1V A;  1HKS A;  3J81 Z;  1IZ1 A;  1OPC A;  3H92 A;  3I54 A;  3KLO A;  1GHC A;  1TQM A;  4IJA A;  5DEQ A;  3J80 K;  3R61 A;  1NHA A;  3NQO A;  2F5D A;  3RPQ A;  3O6B B;  1QPM A;  4G7H F;  2EFW A;  3FXU A;  4HZF A;  3RJP A;  4LMY A;  4A0Z A;  4LLG F;  4EJV A;  4M6Y A;  1SFU A;  5AIQ A;  4ESJ A;  5DCF A;  3HRT A;  3R60 A;  1AWC A;  4HDV A;  2NNY A;  2YX4 A;  2QVO A;  1YYV A;  5LGN A;  3M7G A;  5JHU A;  2XAJ A;  2RDP A;  3WOD F;  3GLX A;  2HTS A;  5CVV A;  4XRF A;  3C7J A;  2Y48 A;  3CLO A;  3ELK A;  3SHF A;  3ZP5 A;  2ADU A;  1KA8 A;  3QPT A;  4MNU A;  1MD0 A;  3C3W A;  3E3V A;  1XSX A;  2E1C A;  2O61 A;  1HKT A;  1LEB A;  2Z3Y A;  5LGT A;  1GXP A;  1KQ8 A;  2DAO A;  2FF4 A;  2CO5 A;  3WE3 A;  1SMY F;  1FWZ A;  3I71 A;  2A69 F;  1JGS A;  2J5P A;  3V8K A;  4P96 A;  3MQ0 A;  2L01 A;  2YU3 A;  4AWX B;  4ZH4 F;  4LLL A;  3HSR A;  2IA1 A;  1HST A;  4G6Q A;  4QWQ A;  6PAX A;  2FEZ A;  3I53 A;  3FM3 A;  2JRT A;  4Q47 A;  4RB2 C;  5D5W B;  2PFB A;  2ZJ2 A;  4WXC A;  3L2C A;  1LDK B;  2QEN A;  3KP2 A;  2V1U A;  2IT0 A;  1S7O A;  5L3F A;  1Z7U A;  2P5L C;  1J2X A;  2ZFW A;  1XCB A;  3GX4 X;  4JBA A;  5LEK A;  4G7Z F;  4DQ2 A;  4L5I A;  2RV8 A;  4ZYH A;  4KUM A;  2KJB A;  2LDU A;  4I02 A;  2Y75 A;  4Q48 A;  4D0P A;  4EV0 A;  2ISY A;  2MBF A;  3F8B A;  1L3L A;  3IRQ A;  3KZY A;  1DDN A;  4ON0 A;  3I59 A;  1Z6R A;  3RDI A;  4HOB A;  2MLK A;  1K7A A;  1ZAR A;  3DXJ F;  3KLN A;  5D5V B;  3K1M A;  5ED4 A;  2KIU A;  3MZH A;  5F6F A;  2GAU A;  1YLF A;  1XCV A;  2K02 A;  4MGR A;  5E1W A;  3QAH A;  3LQR A;  2PBI A;  2G7U A;  1R23 A;  2BYV E;  3MAJ A;  1E17 A;  1ZAO A;  2FBK A;  2ZNZ A;  1SAX A;  1BIB A;  1IXC A;  4U7B A;  3IWZ A;  1B9M A;  2YSR A;  5ILU A;  4XBF A;  2P5K A;  2CWE A;  3F21 A;  4HBL A;  4I98 B;  3QPH A;  3H3U A;  3TOB A;  1XSD A;  2HYF A;  3FMR A;  4YII A;  2EV6 A;  3VFZ A;  5E8I A;  1B4A A;  1REP C;  2R3S A;  4P5O A;  1FNN A;  4DNC A;  3BPX A;  4RB3 C;  3EUH A;  2NYX A;  3KEO A;  4G7O F;  2IW5 A;  5IT3 A;  1UB9 A;  5BMZ A;  3P9K A;  1PUE E;  5L3C A;  4HQM A;  2P8T A;  1S8N A;  4LD5 A;  1R00 A;  1SD5 A;  5E1Z B;  1UHW A;  1BC8 C;  1GVJ A;  5K5R A;  2DTR A;  1BC7 C;  1XSV A;  1D5V A;  3ZMD A;  4LK1 F;  3JSO A;  1FT9 A;  2HR3 A;  2QLZ A;  1WI9 A;  3J80 Z;  2EA4 A;  4FHT A;  3S2W A;  3WTY C;  2FBH A;  3J81 K;  1LDJ A;  3ZPL A;  1UST A;  5CVJ A;  3Q9S A;  1G4D A;  1J75 A;  1X3U A;  5HVQ C;  1K6O A;  1EV7 A;  5D5X B;  4BXU A;  1W5S A;  1PP7 U;  2BV6 A;  4PGG A;  3B73 A;  1MJA A;  4OIN F;  5L3G A;  3FMS A;  2KIM A;  2V1D A;  3WTV C;  4U0W A;  2G7H A;  2DK5 A;  1DPU A;  4Q5S F;  2MH9 A;  3ABT A;  5E1X A;  3HYI A;  2Z9O A;  1FBU A;  2MH2 A;  2QQB A;  2DO7 A;  2FNP A;  2VOP A;  2NRA C;  1W4M A;  3RYR A;  3DPT A;  2BEO A;  5LHG A;  4LB6 B;  2R7D A;  1KU7 A;  4P55 A;  5KK1 A;  2FQ3 A;  2VN2 A;  1T39 A;  2A6E F;  1O3Q A;  4OU0 A;  4UV8 A;  5DV5 A;  3BWG A;  3WTS C;  1IN8 A;  4AIH A;  3WTZ A;  1EH6 A;  2EJR A;  2K4J A;  5L3D A;  2V79 A;  2W24 A;  4KA4 A;  1ZRF A;  2EFO A;  1MDM A;  1LQ1 A;  3WGI A;  4GXO A;  2UXX A;  4ENN A;  1XDU A;  2GIV A;  2LSO A;  2ESH A;  2AXL A;  2GZW A;  1D8J A;  3ROU A;  1W7P D;  2VBW A;  1OYI A;  3HRU A;  2V6C A;  2XRO A;  2HS5 A;  4MEX F;  4ENM A;  3ECH A;  4CYD A;  1FBQ A;  5JVT A;  1F5T A;  2YPR A;  3T0Y A;  4A5N A;  1TQP A;  3PQK A;  1XN7 A;  2F2E A;  2H09 A;  1A04 A;  1JHF A;  5DCM A;  3B02 A;  1RNL A;  5JFR A;  1Q1H A;  2MLG A;  3E5Q A;  1MKM A;  1H9G A;  3CUQ A;  2A07 F;  3LA2 A;  4EM1 A;  2ESN A;  2M5W A;  1ZGA A;  2LF7 A;  1FBS A;  4EJW A;  1Z1D A;  3GFL A;  3E97 A;  1ZG3 A;  4KNY A;  3P9I A;  2L4M A;  1H9T A;  4QLC U;  2KKO A;  3REO A;  1G3S A;  4IRI A;  2Z5U A;  1BBY A;  3QP6 A;  4CZZ A;  1IRG A;  1S3J A;  5FB2 A;  2PQ8 A;  4AIK A;  2RN7 A;  5ICG A;  3HTS B;  2HWV A;  1ON2 A;  3BRO A;  4OIQ F;  1D8K A;  4XSX F;  4ASN A;  3R0A A;  1LB2 A;  3T5X A;  2O03 A;  4I0B A;  4R79 A;  3JTH A;  5ERI A;  4KIF A;  2DQR A;  4IRG A;  1CGP A;  3RKW A;  1IAW A;  3ZN1 A;  2CW0 F;  1ZN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...