2F5DA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ac conformation, ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
134
structure length
130
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 130
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5dA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5dA02
3BJOA 3FM5A 4IPAA 5FFXA 3ZQ7A 2OQGA 1GHCA 4G9YA 2XAQA 2IA2A 1OYWA 1WRJA 2LDUA 3L7WA 2PQ8A 5JR3A 4L18B 5FLXZ 2M30A 3GWZA 5K5QA 1O7FA 3WE2A 2K27A 4G7HF 5DDGA 1IZ1A 3ML6A 1O3QA 1C0WA 1AWCA 3KETA 2FMYA 3MZYA 4EJTA 1IN8A 5DV5A 3ABTA 3LWFA 1FPQA 4CO8A 1W7PD 3EUHA 4A6DA 4BH9A 2G9WA 2A69F 4H0EA 2XAGA 3AAFA 2A6EF 2JPBA 5DUKA 5LHHA 1HQCA 2Z9OA 4EJVA 1R5GA 3F23A 2HDCA 4HX7A 3KE2A 3ERED 3P9IA 3E97A 4UHTA 2OZ6A 2XIGA 5DCFA 2W85A 4ASNA 1FYKA 1IN7A 1BBYA 4ON0A 1GXQA 1Z7UA 5BOXA 1G3YA 2HTSA 2UZKA 1KQ8A 1MDMB 5D8KB 2E7XA 1T6SA 4HAMA 1W7PA 2D1VA 4L5IA 2VN2A 2OD5A 3JAMZ 1ZRCA 3V7SA 3GO5A 3DPLC 2XRNA 1KU3A 4WX9A 1R00A 3I59A 1YW7A 3HSRA 1IUYA 1LVAA 2TDXA 4HZFA 3TOBA 3QPHA 3BJ6A 3DF8A 1CF7B 4FT8A 2DU9A 2P4WA 4M9ZA 4G7ZF 5HDNA 3FXQA 1HKSA 4ZYHA 1KQ0A 3R0AA 1WQ2A 2PN6A 1FZPB 1DUXC 1BJAA 1B9NA 1U5TA 2DQRA 4OMYA 5K5RA 1BI3A 5JVTA 4OINF 2XGXA 5E1ZB 1U8RA 2YSRA 2A5YB 2GIVA 3TO6A 4BQAA 4JQFA 2O61A 1D8JA 4WXCA 1FY7A 2MBFA 5LLQA 3F3XA 4UV8A 5DCMB 3CTAA 1Z91A 4Y15A 1IAWA 4HDVA 1S6LA 1YYVA 1R5HA 3GFJA 5EEGA 3J81K 4P9UA 4ENKA 3QOPA 1J9IA 5L3CA 1MDMA 5HS7A 4HLYA 1B9MA 5IT9Z 1O7LA 5J6XA 2VT3A 3N97A 4ETSA 3IWZA 4A5NA 2NNNA 2DW4A 2DFIA 3H3ZA 1F5TA 5HVQC 2HOEA 1FSEA 1ZYRF 3ZMSA 2H6CA 2RNJA 5D5WB 2HFHA 3TKYA 3DEUA 2IRFG 1NHAA 1CF7A 2HKOA 2NAZA 2A6HF 3TOAA 2VC0A 1SFUA 1ZARA 2F2EA 5KVRA 3RYPA 2FBHA 4UVBA 3WU1B 4Q48A 2FNAA 2FXAA 3ZMVA 3WTVC 2DAOA 1BN5A 3HSEA 2OBPA 4KFCA 5JFRA 4YFNF 4Q47A 3DKWA 4XLPF 3V8LA 4Q5SF 3MZHA 4TV7A 1XGMA 2HR3A 5DCMA 1QO0D 3WTTC 5JI6A 4D0PA 4U7DA 2ACJA 1K79A 3GFLA 4BYYA 2QLZA 3VEPA 5BMZA 2NRAC 1FX7A 2FE3A 3LQRA 3E5XA 1QNTA 3M7GA 2EFNA 1OMIA 2ISZA 3WODF 1YW9A 2VT2A 2V79A 1XSVA 4B8XA 3EYIA 1U78A 4MQVA 2E7WA 3NRVA 4LB6B 1BM9A 5FGMA 1Z1DA 3DXJF 3F22A 1AOYA 3MWMA 2KRFA 3R61A 2ZNZA 4BHCA 4HX4A 5H20A 2HGCA 3M1EA 5L3FA 4RGSA 2WV0A 1IF1A 2YX7A 3CUQB 3IC7A 3E6DA 4EM2A 3LA7A 2EFPA 1B6AA 4S04A 5IT3A 2PLYA 4A0YA 5KK1A 1R22A 1SD4A 1P4XA 1YS7A 2QYOA 1SFXA 5LEKA 2E1NA 2C6YA 1MD0A 3R6SA 4IRIA 2HKXA 1W5TA 2XAJA 4HF0A 1K78B 2STWA 2HQNA 4P9FA 1ZREA 2Y0MA 3LA2A 3F6VA 1FBUA 1S8NA 2MH2A 4RGRA 5D4SA 1RUOA 2BEOA 1T2KA 2RV8A 1IXRC 1PP7U 1KU2A 2BV6A 2HYGD 2ZXJA 3GFMA 1E17A 2DK5A 2DBBA 3CUOA 2A07F 5A2QZ 4UNOA 3FHZA 3U9GA 4OOIA 1LEAA 3G3ZA 4M71A 1YS6A 4HW0A 3ISPA 2H94A 3SXYA 4CHUA 2DK8A 2HYFA 1G3SA 1Z6TA 3SZTA 2L3DA 2P7CB 2NS0A 5E20A 2WTEA 1A04A 2XAFA 3K1MA 2GXGA 3P9KA 4MTDA 2R3SA 4G8XA 3CUQA 3T8RA 3IWFA 2J5OA 3NEUA 1ZH5A 2G7HA 1H9GA 4GGGA 5D4RA 1FWZA 4HYEA 4P55A 4O3MA 2E1CA 2XKOA 2D45A 2DO7A 4K2EA 2O8XA 4GYIA 4WXDA 2KIMA 3C3WA 6PAXA 4O6JA 1JHFA 1K78A 2JZYA 1P92A 2J5PA 4YIFA 3K1NA 2V1UA 2HZTA 2PMHA 5J8CA 1SD6A 4WF2A 3QU6A 1G3WA 5CVIA 2L54A 3IKTA 4EQQA 5AIPA 3EQLF 2RGVA 5BQTA 3ZN1A 1KGSA 4DNCA 3QPTA 4MTEA 3ULQB 3PQJA 1KQ9A 3FXUA 4RGXA 1YIOA 3RI4A 5ILSA 4NHJA 4ZYDA 3RIRA 2IPQX 3FMQA 4GXOA 4IJAA 5DEQA 3M9AA 4EJOA 4OU0A 2PG4A 2L4MA 3QRFF 4PZJA 1V4RA 2ZO4A 3JTGA 4AD9A 4Z2YA 4CDGA 1GXPA 4KUMA 2PEXA 3GZ6A 3HRMA 2STTA 3F8MA 3GZ5A 2OAZA 2A3SA 4KMFA 1IN4A 1U6GA 5HOOA 2HWVA 1XGSA 5BS6A 3HIFA 3GX4X 4L9TA 3HOTA 1FNNA 4U0WA 1FYMA 1JHHA 3I0TA 4RB1A 2Z33A 3WTZA 4CXFA 4FX4A 3LQQA 1XMKA 3GEZA 1UHWA 4ZZLA 4N9HA 4IRGA 1BI2A 2IVMA 1WSUA 2EV5A 1I5ZA 1SD7A 4WXHA 1F4KA 2W57A 2P5VA 4UVCA 3DV8A 3NQOA 3CO6C 1OYYA 2ZNYA 3J80K 1LDJA 1DP7P 2VE8A 3L9FA 4EM1A 2BGCA 3HYIA 1J2XA 1P6RA 1P4WA 5FB2A 2YPRA 4HA8A 3GW2A 1PDNC 2K02A 2IA1A 3V8JA 4ESFA 1XB4A 4ENJA 2MH9A 3GVAA 4PDKA 3KLOA 1YW8A 1OR7A 4WCGA 3IRRA 3VB2A 4PGGA 3KZZA 4N0BA 2B0LA 1TQMA 2JRTA 3ECOA 2HEOA 4KIGA 4UXNA 1UHMA 3DFGA 5ICGA 3ZMTA 4I0BA 5E1XA 3GUDA 1ULYA 3N4MA 1XGNA 1RUNA 4CZZA 2DTRA 3I71A 3WTSC 3VFZA 1MJBA 4N9IA 4AWXB 3JSPA 2GAUA 3B73A 3TO9A 3J81Z 1B1BA 1S7OA 4MGRA 4EM0B 5HS9A 2DPUA 2Z99A 2CYYA 3HRUA 4RB2C 1QQIA 5DD8A 3KP6A 4HF2A 2KIFA 2OA4A 1D5VA 1HKQA 4RGUA 3H3UA 2FQ3A 2K4BA 4ENNA 1MKMA 1TQIA 2PJPA 1W5SA 5CYVA 5CVRA 5K5OA 3KFWX 3MAJA 1OPCA 4GCVA 5LEJA 3ROUA 1I27A 4HQEA 1ODDA 4KMUX 3JSOA 1J7KA 2EWNA 1I6XA 3T5XA 1Z6RA 3FWEA 5CLSA 1YFHA 1TNSA 1IN6A 4U0VA 4HV6A 2IW5A 3FF5A 1BI1A 4XRFA 2YX4A 4S05A 3VOEA 4I0AA 1ZRFA 1U3EM 2RQPA 5LHIA 2FRHA 1BIAA 4HOBA 2M87A 2FOKA 4IHTA 3OV8A 1R1TA 3ECHA 1RZ4A 4MEYF 4L0YB 3V4GA 3KP3A 2EK5A 2LKPA 1XN7A 4NQWA 3MEXA 1IXSB 1BIBA 4LG0B 4FHTA 1SFEA 1MJ9A 3I5UA 2P7VB 4G94A 2O03A 3T1BA 3KP4A 3WTXC 2PMUA 4AIKA 2VBWA 3KEOA 2Y48A 2RDPA 2L4AA 1ON2A 2FBKA 1G4DA 4A0ZA 4Y13A 2EA4A 4KN4X 4L5JA 2GA1A 2GZWA 4M9SA 1UB9A 5E8GA 4OIRF 4ZYEA 5E8IA 4LD5A 5ILUA 4HDUA 1R7JA 3ZPLA 3V8KA 4BNCA 1HW1A 4JBAA 1R1VA 3SHFA 2MLKA 1BC8C 3RPUA 4KT5C 4LLNA 1TBXA 2IJLA 3BP8A 3WTWC 4M9XA 3I53A 4BXUA 4UV9A 4PCQA 3EDPA 3MCZA 1FYLA 2MLGA 1XDUA 4XLNF 3TDZC 3IL2A 2QQBA 3K0LA 3IKVA 3FMRA 3D5LA 4UVAA 1L3LA 4YFKF 3HHGA 1YG2A 5ERIA 4M74A 1STZA 1HXDA 4BHPA 1QBJA 1T0FA 4GYGA 2KKOA 1OYIA 3E6BA 2V1DA 1BI0A 3WGGA 2XUBA 1XCBA 2GXBA 1KA8A 1Z9CA 1U2WA 4I7HA 4RAYA 1JXSA 5LRSA 4KICA 3V7RA 3BOQA 3RYRA 2IT0A 2V1XA 3G73A 1ZLJA 5J8FA 5ED4A 1S3JA 4HF1A 2QQ9A 1Y0UA 5TJJA 5ICFA 1IRFA 3LFKA 1FSHA 2GWRA 1IXCA 3KCCA 3P9CA 3M8FA 2RKHA 3LA3A 5L3GA 2KJCA 4IXAA 3T0YA 1FP2A 4U7BA 2ESNA 4L0ZB 3Q9SA 1I1SA 3F21A 2XKPA 2ZMEB 3RPQA 3WTYC 1XGOA 2LF7A 1DPUA 3BROA 2RC4A 2QZ8A 2QM3A 4KDPA 2CFXA 2Z5UA 2VBZA 2CGPA 1JGSA 2R7FA 1L0OC 2PBIA 5D5VB 1Z05A 3B02A 1R23A 1O3SA 4IF4A 1LB2A 3KP2A 3GYHX 1HSTA 2P6TA 3WU0A 4I09A 5HDGA 3HRSA 4A2UA 3GXOA 2X0LA 3KP7A 3ZN0A 1ZG3A 2QENA 4U88A 2Y75A 1H0MA 1WKMA 4ENMA 2QWWA 3EYYA 2QBYB 1SMYF 1LNWA 5D6FA 1RI7A 2W25A 2XAHA 3HHHA 4IHSA 2VONA 4EJWA 3BWGA 5L3EA 1J75A 3BY6A 2EFOA 2EFWA 2WC2A 4I98B 4PGHA 1TNTA 1USSA 4MHGA 1XMAA 5JHUA 3CO7C 1IW7F 1B59A 2ZMEA 1R36A 4HV5A 3RKXA 1SAXA 1FT9A 3JTHA 5L3BA 2AS5F 4OIPF 2H27A 2MC3A 3K1PA 3QAHA 5BPIA 2PI0A 2M8EA 2UWMA 2VC1A 1EH6A 3PFIA 2NYXA 3WGIA 3GFIA 2ZFWA 3U2RA 2K86A 2Q0OA 3MQ0A 3GLXA 3WE3A 4RS8A 4EVIA 3SQNA 5HLHA 2LSOA 3K2ZA 3OOPA 1F1ZA 2OQRA 1J5YA 2CWEA 2WWYA 3CLOA 1FBQA 2F5FA 3J80Z 1W7PB 2G7UA 3FMSA 5E1WA 2HS5A 2Q8KA 1ON1A 3I64A 2F5EA 1E2XA 2UXNA 4NB5A 2QBYA 1RNLA 4RB0A 3I59B 2L02A 1HBXG 3ZMZA 3E5UA 2ISYA 5E17F 1D8KA 2XV4S 2JT1A 4P96A 4HQMA 2VODA 2VBYA 2ZKZA 2VE9A 3RTRA 1XDSA 4M6YA 4LMYA 4LLGF 5ICEA 4U0YA 1PUEE 1HSJA 1DPRA 1QGPA 3HOSA 4WWCA 2ZCWA 3U1DA 1U5TB 3O6BB 2FBIA 4LJZF 4ESBA 1ZN2A 2OZUA 1ZRDA 3RKYA 1SMTA 3I58A 5BPDA 5FLXK 1TLHB 5H6RA 1F9NA 1ZLKA 3I4PA 2ELHA 2ADUA 3KP5A 3RJPA 4LK0F 5CVJA 5D8LB 1GVJA 4EMSA 4LFUA 1XSXA 2A61A 4L9VA 4CICA 4RAZA 1P4AA 4F7ZA 1K7AA 3S2WA 1YTYA 1ZGAA 4OMZA 3IRQA 1LDDA 1SD5A 4M73A 1UFMA 4L9JA 2H6BA 3C18A 4IRHA 4MNUA 3W6JB 1FOKA 4AIHA 2VOOA 1KU7A 3WGHA 2FF4A 1W4MA 1O57A 2Z3YA 2CG4A 1ZGJA 2DI3A 3R4KA 1T98A 3C1DA 3P7NA 4QLCU 4YFXF 3M8EA 2CSOA 2EJRA 4LB5A 2P5KA 1FC3A 3D0SA 4O5VA 4KIBA 2CQKA 1EH7A 4I01A 3JAMK 4ZYGA 2BBYA 1ONVA 3ABUA 2O6GE 2IA0A 3ZMUA 1RIOH 5TRDA 1FP1D 2CW0F 2W84A 1CGPA 3F6OA 2EV6A 4XBFA 4WK8F 2LNBA 2FA5A 3TO7A 1U5TC 2MA3A 1PP8F 5D6EA 1IN5A 3FZVA 3W6KB 4LGWA 2VOPA 1EH8A 3F8NA 3R60A 1O3TA 3KZYA 3SFZA 2M5WA 5D5XB 4R79A 3DP7A 3DQVC 4E70A 4A12A 3L09A 3Q5FA 1YO5C 5CVUA 5F64A 3MFKA 2LF8A 3O3KA 4I02A 3ZP5A 2ZJ2A 4KNYA 4A0XA 5AONA 1HKTA 2W24A 5LRRA 2MD5A 2KJBA 2YU3A 4I2OA 5HLGA 5ILVA 2EFQA 3BPXA 2IP2A 2ZBKA 5LGUA 2VXZA 1HW5A 1MGTA 4XSXF 3FX3A 1XCVA 2RN7A 2V9VA 2XVCA 5IT9K 3H92A 3I54A 1XD7A 1XSDA 2ESHA 1TTYA 3BJAA 3L2CA 3L00A 4AIJA 3GF2A 2FNPA 3DPTA 5FO5A 2O0YA 4IVNA 3WTUC 5D5UB 4LK1F 3T8TA 1S7AA 4MQ9F 5F6FA 3K69A 3HTSB 3COAC 2X4HA 5E18F 1ZAOA 3ZMDA 3VODA 4KYWA 2QUFA 2FU4A 1KYWA 3FM3A 1O3RA 1P2FA 4M6XA 4HLXA 3HSFA 5LGNA 1KYZA 2D1HA 3V7CA 5CJ9A 4XSZF 4ESJA 1QZZA 2QQAA 1QPMA 3KLNA 4P5OA 4CYDA 4Y17A 3WG9A 4A6EA 2P8TA 2DPDA 4Q4ZF 3TDUC 5LGTA 2QVOA 3SZPA 4LG0A 4RB3C 2ETHA 3RDIA 4MEXF 5AIQA 1LQ1A 5FFZA 2P6SA 2O3FA 3O2PE 2V6CA 4HX8A 1T38A 5DYMA 3TQNA 1LJ9A 3R0JA 1R1UA 4B09A 1USTA 1OKRA 1ZG5A 4R1HA 4G6QA 2P5LC 2XASA 1HW2A 1YQAA 2D2WA 5DD4A 1QZYA 3J7AO 2OU2A 3HRTA 4YG2F 1H9TA 3IHUA 4DQ2A 1TW3A 2K4JA 2DLLA 5EEHA 2CO5A 5LHGA 2FSWA 2GA2A 1BC7C 2XROA 1ZG1A 2L01A 1FLIA 2M1BA 1WI9A 2A68F 5ICCA 1G3TA 2AXLA 1V3FA 2HQRA 2FMLA 4AVPA 5F1RA 1BOAA 3BDDA 1EV7A 2RVCA 5LBQA 1KU9A 3F8FA 1YLFA 1LEBA 2BYVE 2NNYA 1MJAA 4EGZA 2K7LA 4HBLA 5CVVA 3QU3A 4JK1X 2JSCA 3E6CC 1K6OA 1FBSA 2FEZA 4A5MA 1Q1HA 3PQKA 2PFBA 1D3YA 2XHKA 4OIQF 4G6DA 1WWXA 4EJUA 2VBXA 4YIIA 2M45A 3E5QA 4ZH4F 1I1GA 1R58A 2EV0A 4CGZA 3C7JA 1IRGA 3CDHA 5A2QK 2R7DA 2UXXA 2EA2A 1TQPA 2F5CA 2JTVA 2KIUA 4KIFA 2BE5F 1G6NA 2H09A 4KN7X 5FD5A 3HUGA 5L3DA 4EGYA 3ELKA 3E6MA 3CUQC 4L9NA 3QP6A 3EETA 3F8BA 2DT5A 2YR2A 3HTUA 4FX0A 1ZHFA 3RKWA 2COMA 3LSTA 1LDKB 3CJNA 3TGNA 1DDNA 5HLIA 1J59A 4G7OF 5K1YA 3KEQA 1X3UA 2GQQA 3JW4A 2HTJA 1REPC 3BPVA 2F5DA 3F8CA 3Q9VA 4ZZDA 2DQLA 2Q2EA 3REOA 1T39A 1J0RA 4BAYA 4GO1A 1MZBA 4M72A 5HS8A 4R8HA 4KA4A 3E3VA 3K9TA 1S29A 3QP5A 4EV0A 5H6QA 1VTNC 4QWQA 5DUIA 2JPCA 4BHBA 3FXRA 1B4AA 3LAPA 5HDKA 3F72A 1UCRA 4UUVA 5FD6A 3LAJA 1JE8A 4OIOF 1TW2A 2EB7A 3BZ6A 4LLLA
chains in the Genus database with same CATH superfamily
3BJOA 2DMNA 4DIQA 3FM5A 2IGMA 4IPAA 3KYLA 2JVHA 3OYJA 5FFXA 2UV1A 4BBSJ 3ZQ7A 3VYRB 2DDAA 2OQGA 2P0WA 2HI3A 4W1UA 1MH4A 3AG1H 1GHCA 1IUFA 1P7JA 1LE8A 2DN0A 2B7EA 5LD2C 1VQKI 4G9YA 3RQ4A 2XAQA 2IA2A 1I50J 4XRMA 1OYWA 1WRJA 2LDUA 1ETXA 3L7WA 1SAUA 2PQ8A 5JR3A 4L18B 4AC0A 5FLXZ 3OYCA 2M30A 3GWZA 5K5QA 1OCRH 1O7FA 4YEJA 2MW8A 2QSHX 3WE2A 2JMWA 2K27A 3PIPF 4G7HF 5DDGA 3FXOA 4DYRA 1IZ1A 3GTGJ 3ML6A 1B8IA 3OS1A 4XLFA 1O3QA 1C0WA 1NH3A 4Y7NJ 4IOCF 1AWCA 1TZLA 2EIKH 3KETA 2FMYA 3MZYA 4EJTA 4V2FA 1IN8A 5DV5A 5F27A 3ABTA 3S3MA 3LWFA 1FPQA 1K4TA 2HDDA 3RCOA 4CO8A 1W7PD 1RKWA 1OCCH 3EUHA 3HGYA 1DU0A 4A6DA 4BH9A 4DYQA 2G9WA 2A69F 3Q0VA 3A01A 5B3SH 1S5LC 4H0EA 2XAGA 3AAFA 2A6EF 2F48A 3GTMJ 2JPBA 5DUKA 2ECCA 5LHHA 1RETA 1HQCA 2Z9OA 4XL9A 4EJVA 1R5GA 3NWSA 3F23A 1A6IA 2DODA 4M6VA 2HDCA 3FXKA 4HX7A 3KE2A 3ERED 3P9IA 3E97A 3ZQFA 3G1LA 3JRHA 2LKSA 2KZGA 1X4PA 4UHTA 4CYCB 2OZ6A 2XIGA 5DCFA 2X48A 5M5XJ 2OTJI 2W85A 4ASNA 1FYKA 1IN7A 1BBYA 1U9NA 4ON0A 1GXQA 2XAUA 3BR3A 1Z7UA 3BR1A 5FKNA 1WVRA 1G3YA 2HTSA 2UZKA 2UUZA 5BOXA 1FJLA 1MDMB 2LY9A 1KQ8A 5D8KB 1ZR2A 4LITA 5GPCA 2E7XA 4M3FA 3OL3A 1T6SA 4HAMA 1K4SA 1W7PA 2ZXWH 1X3WB 3LSGA 2D1VA 4L5IA 2VN2A 1EF4A 4XOTA 2OD5A 1AKHA 2I8DA 2VLAA 1YITI 2VJ5A 1HDDC 3JAMZ 3DBHB 1ZRCA 3V7SA 3OYMA 5CPRB 3GO5A 1VFCA 4QPQA 4FCYA 1NG7A 3DPLC 2XRNA 1KU3A 4WX9A 2V7FA 1R00A 4JYKA 2Y69H 3I59A 1YW7A 3HSRA 2EIJH 1QVTA 3KPHA 1IUYA 4PSWA 1LVAA 2TDXA 4HZFA 4NDLA 3TOBA 3QPHA 3BJ6A 2HVRA 2GM4A 3DF8A 1CF7B 4FT8A 4NQWB 2DU9A 2P4WA 4M9ZA 2P81A 1WJCA 4XLAA 4AUXA 4G7ZF 2YUSA 5HDNA 3FXQA 1HKSA 4KISA 4ZYHA 1W36C 2E19A 3HGGA 1KQ0A 2L9RA 3R0AA 1WQ2A 2PN6A 1FZPB 1X1PA 3ZQIA 3CJQB 1P9QC 1DUXC 1BJAA 2M35A 1B9NA 4B47A 1NK3P 2DTZA 1IG7A 1U5TA 1FMVA 1JT6A 2DQRA 4OMYA 2WADA 5K5RA 1BI3A 5FROA 3HDDA 3ZCOA 1OCZH 5JVTA 4OINF 2XGXA 5E1ZB 1U8RA 2YSRA 2A5YB 3SFIA 1YJWI 1GT0C 2GIVA 3RQIA 3TO6A 3PO2J 4BQAA 1WJEA 3DKXA 2LC2A 2FJ1A 4JQFA 2R7XA 2O61A 1D8JA 4WXCA 1FY7A 2MBFA 2DT6A 5LLQA 3F3XA 4UV8A 5DCMB 3K2AA 1H88C 2V1NA 1LKXA 1MMAA 2VKVA 4UUTA 4CCOA 3CTAA 1YRNB 1Z91A 4Y15A 1IAWA 4CYCA 4HDVA 1MW7A 1S6LA 4ZJZA 2E60A 1YYVA 3TW7A 1R5HA 3GFJA 5EEGA 3J81K 4P9UA 4ENKA 1POGA 4A3FJ 2K9SA 3QOPA 2R7TA 1J9IA 5L3CA 4IOAF 1MDMA 5HS7A 4HLYA 1B9MA 2B63J 5IT9Z 2CUFA 3I9V2 1O7LA 2BHYA 2JVGA 2WB1A 5J6XA 2MC4A 3UNGC 4C2UA 2VT3A 3OS2A 4ETSA 3N97A 2OCCH 3F0CA 3IWZA 3S2HJ 4A5NA 2WAFA 2NNNA 2DW4A 3H3ZA 1F5TA 5HVQC 2HOEA 3SEQA 1BR2A 4FISA 2PJRB 2LP0A 1FSEA 1VNDA 1ZYRF 1V5EA 4XORA 3ZMSA 2H6CA 2RNJA 3FISA 3CMYA 3VYTB 1X19A 5D5WB 4AIDA 2BW3B 5HNHA 2HFHA 2ZJPF 3TKYA 2CQQA 2CW8A 2EZIA 2NS7A 1FIAA 4DYCA 3CCEI 4AM3A 3DEUA 1WGXA 2IRFG 4A3EJ 2LH9A 1A31A 2KL4A 1XG1A 1NHAA 1CF7A 2H1KA 1ERDA 1JI8A 2HKOA 2W48A 2NAZA 2Y0SN 2A6HF 4ZYAA 3TOAA 3BG3A 2VC0A 1KZHA 1SFUA 1ZARA 2XF6A 3Q0WA 2F2EA 5KVRA 2ZSIB 3RYPA 2FBHA 2DA5A 4UVBA 2LTPA 1ETVA 3WU1B 1IDYA 4Q48A 1X1CA 2FNAA 2FXAA 2L9VA 3S8PA 2X1EA 3ZMVA 3WTVC 2DAOA 1ETYA 1BN5A 5J1RA 3VSKA 3G1MA 1Y56A 3HSEA 4BEHB 2OBPA 4KFCA 5JFRA 4YFNF 4Q47A 1OCTC 2BHZA 3DKWA 4ABZA 4BUPA 4XLPF 1NTCA 3LSMA 3V8LA 4PJNA 4Q5SF 1DGRM 3MZHA 4TV7A 1XGMA 4BJ6C 4C3JJ 3KIOA 1TWAJ 1ETWA 2JUCA 1HC8A 2IAIA 2HR3A 5DCMA 2W1OA 1QO0D 3S2DJ 4D5CA 1V55H 4A3LJ 3WTTC 3CP2A 1YRNA 5JI6A 4D0PA 4U7DA 4B44A 2ACJA 1K79A 3GFLA 2FX0A 2HU9A 4BYYA 2QLZA 5EZHA 3VEPA 4C2TA 5BMZA 1ACIA 4ZDPA 1FX7A 2NRAC 2FE3A 3LQRA 3E5XA 3Q0UA 4JX5A 1QNTA 3M7GA 2EFNA 2XRLA 1OMIA 4II2A 4FE4A 1A36A 2CS3A 3OIOA 2ISZA 2IS4A 3BR2A 2CFOA 3PJRA 4A3GJ 3FXLA 2ZSHB 5GPAA 3WODF 2CRGA 3CMAI 1YW9A 5DTDA 2VT2A 5J3LA 5JLXA 2V79A 1XSVA 2Z1DA 4B8XA 4H4KC 3EYIA 1U78A 4MQVA 3HOWJ 2E7WA 3IH3A 3NRVA 4LB6B 2VJIA 1BM9A 3ESWB 5FGMA 1T95A 3OS0A 1Z1DA 1OISA 2BW3A 3OYBA 3DXJF 3F22A 4E7IA 1K61A 2M7AA 1AOYA 2O8KA 3MWMA 2KRFA 3R61A 2ZNZA 3H0DA 4BHCA 4HX4A 5H20A 2EZHA 4HSRA 2HGCA 3A4CA 2M2EA 3K4KA 3M1EA 5HODA 2MUNA 2VUMJ 5L3FA 2I10A 3NWTA 4RGSA 2WV0A 2OC6A 1IF1A 2YX7A 3CUQB 3IC7A 3DTEA 3BZKA 2M7BA 3E6DA 3H1CA 4EM2A 4X0GA 3LA7A 3S1NJ 2EFPA 1B6AA 4X6AJ 1UG2A 4S04A 2WBMA 1OCPA 1TWFJ 1X58A 4A0YA 5IT3A 2PLYA 3A2KA 5KK1A 5IY5H 1R22A 3PSIA 1SD4A 4DBRA 1P4XA 1PYVA 4E4HA 2ELKA 1YS7A 2CJJA 2QYOA 2DFEA 4E7HA 1SFXA 5LEKA 4BEHA 3H35A 2E1NA 2C6YA 5C44J 1MD0A 3R6SA 1VQ7I 1DGWY 4IRIA 1VQLI 2QGUA 2HKXA 1BA5A 1N25A 2NXNB 1IRZA 1W5TA 3QPSA 2XAJA 4HF0A 1K78B 2STWA 2HQNA 3FIWA 1QRYA 4P9FA 1ZREA 3BCAA 2IBDA 3EPZA 2F4IA 2R7OA 2Y0MA 3J7ZI 3LA2A 4BXXJ 1JJ8C 3F6VA 1FBUA 5DS9A 1S8NA 2MH2A 5E3OA 2BVMA 4RGRA 5D4SA 2GXAA 1T0FC 3RSNA 1RUOA 1UZCA 2BEOA 4XKWA 1T2KA 4JX6A 2XSJC 2RV8A 1VQ8I 2BY1A 2KT0A 2X6OA 1IXRC 1PP7U 1WPKA 5DM6F 1KU2A 1SEUA 2BV6A 2HYGD 2ZXJA 4ZDOA 1QU3A 3GFMA 1E17A 5EZGA 2XF7A 3C2GA 2NOGA 2DK5A 2DBBA 3CUOA 3OYNA 2A07F 3H5NA 3MMYB 4C2MJ 2W82A 5A2QZ 3U9GA 1QZEA 3FHZA 2Z16A 4UNOA 4OOIA 1LEAA 3G3ZA 4M71A 1YS6A 2K5CA 3TEDA 3ASOH 4HW0A 4S0HB 3ISPA 2YU9J 2L7ZA 2H94A 3SXYA 4CHUA 2DK8A 1GVDA 2NVQJ 2HYFA 1G3SA 5FKKA 1Z6TA 4PJLA 3SZTA 4XONA 2L3DA 1I3QJ 2P7CB 1D1CA 1WJBA 2V26A 5EGOB 2LFBA 4JP0A 2NS0A 5E20A 1MMDA 2WTEA 1FTTA 1A04A 2XAFA 3K1MA 2GXGA 3P9KA 5GAGJ 4MTDA 1MNMC 2R3SA 3FKIJ 4BL0B 4CCKA 4G8XA 3CUQA 4XKVA 3T8RA 3IWFA 5IPAA 2J5OA 3NEUA 1ZH5A 4XQFA 2G7HA 1JT0A 4F3QA 1H9GA 4GGGA 5D4RA 1FWZA 1QHHD 4HYEA 3BG5A 3S1QJ 1WH5A 2DMTA 4P55A 4O3MA 2DA7A 2E1CA 1VQNI 2FD5A 2XKOA 2K9QA 5CQGA 2D45A 2DO7A 4K2EA 2O8XA 4GYIA 4M3DA 2KQRA 4WXDA 2KIMA 3C3WA 6PAXA 3A02A 4YELA 4O6JA 1JHFA 1K78A 2NS8A 3SDGA 2XPVA 2JZYA 3PNVA 1P92A 2H1LA 2J5PA 3K1NA 4YIFA 3TMOA 2V1UA 2HZTA 2PMHA 1GV5A 5J8CA 1SD6A 4WF2A 2IS1A 3QU6A 1G3WA 2WAQA 5JVGF 5CVIA 2L54A 3IKTA 1I6HJ 3FHNA 1X1AA 4EQQA 3S3NA 2OTLI 5AIPA 4D7NA 3TW6A 3AL0B 1F43A 2DA6A 3EQLF 1CQTA 2RGVA 4BE1A 3H9GA 5BQTA 2HOTA 3CJRB 3ZN1A 2DOFA 2KRHA 2LOOA 4XKCA 1KGSA 4DNCA 3QPTA 4MTEA 3SZGA 3ULQB 4IHWA 2F5VA 3PQJA 1KQ9A 3FXUA 4RGXA 3HL2A 1YIOA 3FK7A 3RI4A 4BY1J 5ILSA 4NHJA 4XICA 4ZYDA 3RIRA 1NK2P 2IPQX 1Y1WJ 3FMQA 2KHMA 4GXOA 1WHUA 4IJAA 5DEQA 1D5YA 2DJNA 5EGOA 4BJ5C 3OL4A 2H8RA 3M9AA 4EJOA 4OU0A 2PG4A 2L4MA 2JA5J 3QRFF 2E2HJ 4PZJA 5B1AH 4RLFA 2X98A 2Z2SB 1V4RA 2E1OA 2ZO4A 1PVEA 4OAYA 3VPRA 3JTGA 4IQ4A 1W0TA 4AD9A 1ZGWA 3HOYJ 2LYCA 4Z2YA 4CDGA 1GXPA 4M3GA 1A6QA 2EPFA 1BJZA 4KUMA 4NBQA 5DM7F 4BGDA 2PEXA 1DQUA 3GZ6A 2A5WA 4FQGA 2ZMEC 4DOZA 3CMEI 3HRMA 2STTA 3F8MA 1SANA 2JA2A 2OAZA 3GZ5A 2A3SA 1JUPA 4KMFA 1IN4A 1U6GA 5HOOA 3JRFA 2HWVA 2XGDA 3H0GJ 5CKTA 1M1EB 1XGSA 2KISA 5BS6A 3HIFA 3IP4B 3GX4X 1EA3A 1DU6A 4L9TA 4DZPA 3ABLH 1WJAA 3HOTA 1FNNA 4DBQA 1YJNI 4U0WA 4IKFA 1FYMA 1JHHA 1W5CC 3I0TA 4B3XA 4RB1A 2Z33A 4IEJA 3WTZA 3RZOJ 3OIPA 4CXFA 1PUFB 4FX4A 2HQ5A 4PJ0C 3LQQA 1XS9A 1XMKA 3GEZA 1UHWA 4ZZLA 5IYCJ 1W0UA 4N9HA 1K6YA 1BI2A 4IRGA 2IVMA 3IAM2 1WSUA 1JKPC 2CQ7A 4N4NB 2EV5A 1I5ZA 3HXLA 4NC8A 2GBYA 1SD7A 4WXHA 1S9HA 3L2UA 4OWRB 1F4KA 2W57A 2P5VA 3JAMR 4UVCA 3DV8A 3NQOA 3CO6C 2X51A 1B72B 1OYYA 2ZNYA 1H89C 2E5NA 3CCMI 2V9PA 3GCMA 3J80K 1LDJA 3CCYA 1DP7P 2VE8A 3L9FA 2VKDA 4EM1A 1W36D 2BGCA 3HYIA 1J2XA 2ELJA 3QYBA 1P6RA 1P4WA 4MO7A 5FB2A 1T33A 2VKHA 2YPRA 1I3AA 2MABA 2R5YB 1V54H 3GW2A 4HA8A 1PDNC 3AL0C 1GUUA 2K02A 2Y9YA 2IA1A 2K9NA 3V8JA 1OLTA 3SYTA 4ESFA 3S1RJ 1XB4A 4MIMA 4PUSA 3CESA 4ENJA 3NAUA 1SFOJ 1G2HA 2MH9A 2BZTA 3GVAA 1HCRA 4PDKA 3ZQLA 3KLOA 1YW8A 1LFUP 1OR7A 4WCGA 3IRRA 2CQNA 2CUEA 3VB2A 4PGGA 3KZZA 4N0BA 2B0LA 4LIUA 1TQMA 3OYFA 5M5WJ 4UB6C 1ORKA 2JRTA 3ECOA 3JRIA 2HEOA 2QA4I 4KIGA 3ZGKA 2R93J 3PO3J 2K3PA 4UXNA 3OY9A 1HF0A 1FIPA 1UHMA 4XLHA 2B9SA 3DFGA 5ICGA 3ZMTA 4BKXA 4I0BA 2DMQA 2X1CA 3MKLA 4C3HJ 1D0XA 2RAEA 5E1XA 4FETA 3GUDA 1ULYA 3DCFA 3OIQA 3N4MA 1OR7C 2OV7A 1XGNA 1RUNA 2DMPA 5KAIC 2JA7J 3CF5F 3CCJI 3HEFA 5FKMA 4CZZA 2CV0A 2DTRA 3BTIA 2IGKA 3I71A 3GZNB 4D5FA 5LFAA 3WTSC 3VFZA 2DA1A 1Z3XA 2M9HA 4XN3A 4BQNA 1PUFA 1MJBA 3OR1C 4N9IA 4AWXB 2X6YA 2HXOA 5J4VA 2LBFB 3OYAA 2GAUA 3B73A 3JSPA 2CQXA 3TO9A 3J81Z 5IT9R 3DEWA 1B1BA 1S7OA 4MGRA 4EM0B 5HS9A 2DPUA 3BQYA 2Z99A 4BBRJ 1ZTRA 1VQ4I 1OCOH 2CYYA 2OJED 3HRUA 4RB2C 3UKGA 2PMZA 3FKJA 1QQIA 5DD8A 3PFYA 4BDZA 3O8HA 2QQ8A 1B72A 1OQYA 3KP6A 3L1PA 4HF2A 3DLLF 2KIFA 2OA4A 1D5VA 2XB5A 1HKQA 2VIXA 4RGUA 1WI3A 2TCTA 3H3UA 2FQ3A 2K4BA 4ENNA 1MKMA 1TQIA 3A0HC 2PJPA 1W5SA 3JRGA 5CYVA 4BACA 5CVRA 5K5OA 2R5YA 3KFWX 3MAJA 1OPCA 4GCVA 5LEJA 4NC6A 3WHBA 5IYDJ 2N8GA 2O9LA 3J7AW 3ROUA 2DYRH 4AYBA 1I27A 3JRDA 4HQEA 1ODDA 4XM3A 4KMUX 3JSOA 1J7KA 2EWNA 1I6XA 4CCLA 3T5XA 1VI0A 1Z6RA 3FWEA 3FXMA 5CLSA 5KHDA 1Z77A 1YFHA 1TNSA 1ZKGA 1IN6A 3OYKA 3HOZJ 4U0VA 4YIRX 1AHDP 2KDZA 4HV6A 2IW5A 5B5EC 3FF5A 1BI1A 1TL8A 4XRFA 2YX4A 2HQAA 4S05A 3VOEA 4I0AA 5IP7J 2DDBA 3A1YA 1ZRFA 3S17J 3M8JA 1U3EM 4BDYA 2R7SA 2RQPA 5LHIA 2FRHA 3AG3H 3HPHA 1BIAA 1P7IA 4HOBA 2M87A 3H9JA 2FOKA 4IHTA 3OV8A 2VI6A 4ZDLA 1E3HA 3JRAA 1R1TA 3ECHA 2HOSA 4J00A 1RZ4A 3VYSB 3K4NA 5J47A 4MEYF 5IYBJ 4B1RA 3C2BA 4L0YB 3V4GA 3KP3A 4E6KG 2EK5A 2EQRA 5C3EJ 2LKPA 4PSXA 1XN7A 4NQWA 4HNVA 3MEXA 4BE0A 1IXSB 3QOEA 1BIBA 3KZIC 2VKEA 4LG0B 4FHTA 2LBFA 1SFEA 3W2VA 1MJ9A 4OAZA 2XGEA 3I5UA 2ZXHA 2P7VB 4G94A 2O03A 3QQAA 3T1BA 3CCQI 3KP4A 1HOMA 3WTXC 2PMUA 4JOMA 1F36A 2ID6A 5FLMJ 3HOXJ 4AIKA 2VBWA 3KEOA 2Y48A 2RDPA 2L4AA 1ON2A 1UG0A 2FBKA 4A0ZA 4Y13A 4ZTJA 1G4DA 2EA4A 4KN4X 4L5JA 3E0JB 2GA1A 1IO2A 2GZWA 1A5JA 4M9SA 1UB9A 5E8GA 5E3LA 1YE9A 1MMSA 2MZ4A 4OIRF 4ZYEA 4EATA 3GTOJ 4MFDA 1RPWA 2E35A 5E8IA 4LD5A 2MYSA 5ILUA 2O7OA 4HDUA 1R7JA 2NVUB 3U1KA 3ZPLA 1V5FA 3V8KA 4QPOA 4Y4RA 1XMXA 4BNCA 3TP3A 1HW1A 4JBAA 1R1VA 3SHFA 2MLKA 1UELB 1BC8C 4HNUA 2AO9A 4DZJA 3RPUA 4KT5C 1RR8C 5EJCA 4XRSG 1TBXA 4LLNA 2IJLA 3BP8A 3WTWC 1XC5A 3OWTA 4M9XA 4XNFA 3I53A 3BG7A 2PJRA 4BXUA 4UV9A 4PCQA 2WAEA 3EDPA 1QVUA 3MCZA 1FYLA 5IP9J 2MLGA 2LY2A 4Y3OA 3A03A 1XDUA 4XLNF 3IUOA 3QPLA 4D7MA 4E7SA 2EZLA 1Y6IA 3MKYB 3TDZC 2K9LA 3ASNH 4F55A 3IL2A 2QQBA 3CCSI 1Y39A 1S72I 1R9TJ 3K0LA 3IKVA 2GOXB 1T56A 2HXIA 3IAS2 3FMRA 2W00A 3D5LA 4UVAA 3CP8A 1VQMI 2M0MA 2BOLA 3C2HA 4A69C 1L3LA 1XPXA 3M3YJ 3WHCA 4YFKF 4HEA2 3HHGA 3PUBA 2EZKA 1YG2A 5ERIA 5KAFC 4CCNA 4M74A 2XSDC 1STZA 2DOEA 1HXDA 4BHPA 3OMYA 4C3IJ 1QBJA 1FEXA 3D1NI 5FJ8J 1R5ID 1T0FA 1UHSA 4GYGA 2KKOA 1RQ6A 1OYIA 1WJFA 3ZQCA 2XF5A 3ZXSA 2ZXIA 3E6BA 4PFPA 2V1DA 1MIJA 3CC4I 2E2IJ 1BI0A 3WGGA 2XUBA 1XCBA 2GXBA 3E1SA 1KA8A 1Z9CA 3S93A 1U2WA 1Z21A 4I7HA 3G1OA 2K40A 4RAYA 2X85A 1JXSA 5LRSA 3W2WA 2LG4A 4KICA 3V7RA 4HG2A 2NVXJ 3BOQA 3F9KA 1U8BA 1ETOA 3HOVJ 3RYRA 3KX2A 1R4MB 4AVZA 2ECBA 2IT0A 2V1XA 3G73A 3LFUA 1ZLJA 5J8FA 2A6TA 4RM3A 5ED4A 2KMUA 3S32A 4HRIA 2VQGA 3FDYA 3FK6A 2KFDA 2X9DA 4MFEA 1FOXA 1S3JA 4D9JA 4HF1A 2HVSA 2QQ9A 1Y0UA 2BY2A 4C30A 5TJJA 5E3NA 1ETQA 3OYGA 3H9QA 1N78A 5ICFA 1IRFA 5FRMA 3LFKA 1FSHA 4GFBA 2HNHA 2GWRA 4RM2A 3GTJJ 3HPGA 5FKOA 3H3VK 1IXCA 2DCEA 4UB8C 1BL0A 3KCCA 1FTZA 2KRCA 3QYFA 3AKZA 3P9CA 3M8FA 1TWGJ 3PUFA 1D1AA 2RKHA 2VPRA 2VQCA 3LA3A 5L3GA 2KJCA 4IXAA 3T0YA 1WH7A 1FP2A 2R92J 1X1DA 4U7BA 2F4OB 2R7RA 2ESNA 4L0ZB 3Q9SA 3HM5A 5C4XJ 3F21A 1I1SA 2XKPA 1H8AC 2ZMEB 3RPQA 4XRSA 3WTYC 3GBGA 1XGOA 4KT6A 2R7QA 3CZ6A 5KCMA 2LF7A 1DPUA 2ZFUA 3BROA 2RC4A 3ZRGA 2QZ8A 2QM3A 4KDPA 2WV1A 2RNGA 4CUGA 2CFXA 2MSYA 3G6EI 4RMNA 1JUSA 3MD2A 1AA7A 2Z5UA 1LFPA 3OYEA 2VBZA 2CGPA 4XKBA 1JGSA 2R7FA 1L0OC 3DU5A 2PBIA 2CV2A 5D5VB 1Z05A 4EEFG 3B02A 1MH3A 1R23A 1O3SA 3CF2A 5M3MJ 2CUZA 4IF4A 2KPMA 1X2NA 4RLQA 1LB2A 3KP2A 2VL8A 4KITB 3GYHX 1GV2A 1HSTA 3LSHA 5IP6A 4Y52J 1VQ6I 1GDTA 4B3AA 3GTKJ 2OCEA 2P6TA 3HC7A 3WU0A 4I09A 3SEZA 3BR5A 3KYDB 5HDGA 1ZR4A 3V42A 3AG4H 2WA0A 2PMZN 2R0QC 4IHVA 3LNQA 2LY1A 3I4NJ 1IC8A 4N4OB 2LR8A 3HRSA 4A2UA 3KEYA 3ZQGA 4IX7A 3GXOA 2X0LA 3CDIA 4NUBA 3KP7A 3ZN0A 2L5QA 1ZG3A 3I3LA 2QENA 4NC7A 1BR4A 3BZCA 4LOCA 2VXDA 4U88A 2Y75A 1H0MA 1BR1A 1WKMA 4ENMA 2QWWA 3EYYA 2QBYB 3M1CA 4A3DJ 2RREA 1SMYF 1LNWA 5D6FA 1RI7A 2QF7A 5M5YJ 2W25A 2TRTA 2XAHA 2KDOA 2A05A 3HHHA 3ABKH 4IHSA 2R5ZB 2QSFX 2VONA 2Y0SA 1QA6A 4EJWA 2VJJA 3BWGA 2JA8J 3BLYA 3JR9A 5L3EA 5J1YA 1J75A 3PM1A 3BY6A 1W1WE 2HDWA 3K6GA 2EFOA 2EFWA 2WC2A 4I98B 5F0HA 2WB1N 3H5RA 3CC2I 4PGHA 1YI2I 2FQ4A 3ERMA 1MMGA 2L7KA 1TNTA 1USSA 3ZQHA 2X6XA 4DW6A 4MHGA 1XMAA 5JHUA 3CO7C 1IW7F 1B59A 2ZMEA 3K4MA 1R36A 5FLXR 4HV5A 2XB0X 3RKXA 1WZ2A 3K70C 1SAXA 5GTIC 2QCOA 1FT9A 3JTHA 2DYSH 5L3BA 4IQJA 2K3FA 5HNFA 1MBFA 2AS5F 1TT0A 4OIPF 3S1MJ 2H27A 2MC3A 3K1PA 3QAHA 5BPIA 4L5EA 2PI0A 5LGUA 2M8EA 2UWMA 1N75A 1VF9A 2VC1A 1EH6A 3PFIA 2NYXA 1D0YA 4UUSB 4CZCA 3WGIA 2R7WA 2M34A 2HPMA 3GFIA 1R6RA 5CQEA 2ZFWA 3U2RA 2K86A 4XLEA 1ZK8A 2Q0OA 3MN2A 3MQ0A 2JK3A 1MBGA 3GLXA 3WE3A 4RS8A 3VSLA 4EVIA 3SQNA 2CUJA 2LSOA 3ABMH 1SVOA 3K2ZA 3OOPA 5HLHA 5FRNA 2PX9A 1F1ZA 3FBNB 2OQRA 1J5YA 4QTRA 2CWEA 2WWYA 2JN6A 3CLOA 1FBQA 2AXTC 3DLAA 2F5FA 3DBLB 3J80Z 1W7PB 2G7UA 5F0FA 1MSEC 3S15J 3FMSA 2FOWA 3LMMA 5E1WA 3ZR8X 1RESA 4B48A 2HS5A 2JSPA 3OYLA 2Q8KA 1ON1A 1T08B 2F5EA 3I64A 3W3CA 3MKWB 3L2QA 3OYIA 1E2XA 2QKMB 2UXNA 4NB5A 2QBYA 4E7ZA 2DA4A 1RNLA 3VDXA 4IHYA 4RB0A 5H2FC 3I59B 2L02A 2R5ZA 3TL4X 1HBXG 3K4JA 1EKEA 3ZMZA 3E5UA 1HA8A 2ISYA 1J09A 5E17F 4DGWB 1D8KA 2XV4S 4BS9A 2JT1A 5F0CA 2GOMA 4P96A 4HQMA 4CSWA 2VODA 2VBYA 4PK4A 2ZKZA 2VE9A 3RTRA 2XGCA 5TGTA 3I4MJ 3RZDJ 1XDSA 2OUMA 2P0TA 4M6YA 1TT5B 4LMYA 4LLGF 5ICEA 1APLC 4U0YA 1PUEE 4RA2A 1HSJA 1DPRA 2L2OA 1QGPA 1X4OA 3HOSA 4IO9F 4WWCA 1SVLA 4FTHA 2ZCWA 3J7YJ 3U1DA 1RRJA 1JKQC 2HYJA 1U5TB 2Y2ZA 1G8XA 3A0BC 3O6BB 2KIQA 2M4KA 2FBIA 2ICWG 4LJZF 4BXFA 4ESBA 1ZN2A 2OZUA 2L9SA 1ZRDA 3RKYA 4BE2A 1SMTA 3CC7I 3I58A 5BPDA 3J81R 2NOJB 5FLXK 1TLHB 5H6RA 1KONA 1F9NA 4CCJA 1ZLKA 3HJEA 1IRXA 5E3MA 1VQ5I 3I4PA 2ELHA 4UUSA 3ZQQA 2ADUA 3KP5A 2RQQA 3RJPA 5GTHC 1E3OC 4KJZA 4LK0F 5CVJA 2X1DA 1IDZA 5D8LB 3EUHC 2F4MB 1GVJA 1Y8RB 4EMSA 4LFUA 1XSXA 2A61A 2W4SA 4ITVA 4L9VA 4CICA 4RAZA 3OOUA 1P4AA 4F7ZA 1K7AA 2XC7A 2BXZA 2BY3A 3S2WA 1YTYA 1MNDA 1E3PA 1ZGAA 1WFXA 5F08A 2M4GA 4OMZA 4F92B 3IRQA 1LDDA 1SD5A 4E7KA 3UR3C 4M73A 3HKZA 1UFMA 4A3JJ 4L9JA 2H6BA 3B6AA 3C18A 3IH4A 4IRHA 4MNUA 4JX4A 1NG6A 1MNEA 3W6JB 3VWBA 3CDLA 3CQZJ 2MGQA 4GRIA 5GADJ 1FOKA 4AIHA 4LG3A 2VOOA 1KU7A 1N77A 3PIOF 3OYHA 3WGHA 2FF4A 1W4MA 4HSTA 3G71I 2KZVA 1O57A 2LRDA 2Z3YA 3SJMA 1T8IA 4J19A 3J7AY 2CG4A 1ZGJA 1D0ZA 2DI3A 1QHGA 3R4KA 4BU2A 1T98A 3C1DA 3P7NA 4QLCU 3HOUJ 1ENHA 4YFXF 1YX3A 3M8EA 4PJJA 3NARA 2MG4A 2CSOA 1TC3C 1Y0NA 2EJRA 1IV6A 4LB5A 1YX5A 2QKLB 2BY0A 1FC3A 2P5KA 4NNJA 4IHXA 4IL6C 3D0SA 4O5VA 4FASD 1Z7LA 4KIBA 3BR0A 4RBOA 3IV5A 3LSRA 4IZZA 3P5JA 2AHQA 1U0JA 2DT7B 2ME6A 2CQKA 1EH7A 1U9OA 2CW7A 2GIZA 2JQ7A 4I01A 3JAMK 4ZYGA 2BBYA 1E0EA 1ONVA 1RR7A 3DWLE 2ID3A 1Y1VJ 3ABUA 1X3ZB 2O6GE 3AG2H 2IA0A 4G12A 3ZMUA 3PSFA 1RIOH 5TRDA 2V6EA 1FP1D 3G2BA 2CW0F 1LUJB 2EIMH 1O4XA 2W84A 2XDVA 1CGPA 3BG6A 3RKQA 3F6OA 2EV6A 3LOCA 3CCUI 2E36A 4M3EA 1MBKA 1TP4A 4XBFA 3A52A 5J1UA 1JTYA 2Y31A 3LSKA 4AU7A 1YIJI 3IH2A 2BVLA 4WK8F 4I76A 3CLQA 5BNGA 3O8GA 2LNBA 4BY7J 2DXIA 2FA5A 3TO7A 1U5TC 2MA3A 1PP8F 5D6EA 4B4CA 1IN5A 3FZVA 3W6KB 4LGWA 2VOPA 1EH8A 3F8NA 3R60A 1O3TA 3DKYA 2EH3A 2L7MP 3KZYA 3OR2C 3SFZA 3TP0A 2M5WA 5D5XB 2R4GA 2HVQA 4R79A 4ZC3A 4C9YA 3DP7A 3DQVC 4E70A 4A12A 1BW6A 4II3A 3L09A 3Q5FA 2CH0A 1YO5C 1VQOI 2VJ4A 5CVUA 2JRMA 2XPUA 5F64A 4CA0A 3PNTA 4W97A 3JRCA 3JCUC 4BQQA 3MFKA 4ANJA 2LF8A 3O3KA 3M4OJ 5EG0B 4I02A 2Q1ZB 4Z6YA 3ZP5A 2ZJ2A 1UMQA 3MVPA 3S3OA 4KNYA 4A0XA 1QPIA 3BQZA 5AONA 1EJ9A 4B43A 3WG7H 2LD5A 2W24A 1VQPI 1HKTA 5LRRA 3L2VA 2MD5A 2KJBA 4A3KJ 1XTAA 2YU3A 3DTIA 4CH7A 2IS2A 2Y9ZA 3GTPJ 4I2OA 5HLGA 5ILVA 2IXSA 4V2GA 2EFQA 2IEKA 2WAQN 4Y33A 3BPXA 2IP2A 2ME0A 2ZBKA 2VXZA 1HW5A 1MGTA 4XSXF 3FX3A 3RPUD 1GLNA 4A93J 3K4LA 1XCVA 2RN7A 2V9VA 2XVCA 3M07A 5IT9K 3QWLA 2NVTJ 4XOPA 2ZB9A 2COBA 3W6VA 3VYUB 2VQHA 3H92A 4A3IJ 3I54A 1XD7A 1XSDA 2ESHA 3L2WA 2LVSA 4F93B 3HG9A 1TTYA 2LMDA 3BJAA 5IOZA 3L2CA 3L00A 4XK4A 4AIJA 1JJ6C 3GF2A 2FNPA 2ZJRF 3DPTA 5FO5A 2IGOA 2O0YA 4IVNA 3WTUC 5D5UB 3DTKA 2EINH 1SFKA 4P1WA 3GTLJ 4LK1F 4F52A 3T8TA 1S7AA 4MQ9F 5F6FA 3FXJA 3K69A 3HTSB 2MVTA 3BTJA 2CMPA 1IJWC 3COAC 3GLLA 1R71A 2X4HA 1ZAOA 3ZMDA 5E18F 3VODA 4KYWA 2E1MB 1ETKA 5J40A 2QUFA 2FU4A 1KYWA 3FM3A 1O3RA 9ANTA 2LLKA 1P2FA 2DFHA 4M6XA 4RAFA 4HLXA 4BQOA 3HSFA 5LGNA 4V19K 1KYZA 2D1HA 2NVYJ 3V7CA 1JTXA 5CJ9A 4XSZF 3EUKL 4ESJA 2QSGX 2I5UA 1QZZA 2QQAA 1QPMA 3D5RC 5C4JJ 2V4JC 4G6TB 3KLNA 4P5OA 3MKZA 1JKOC 4CYDA 2HZDA 4DJAA 4Y17A 2CU7A 3WG9A 4A6EA 1OFCX 2P8TA 3H36A 5E79C 3WU2C 2DPDA 2L0KA 1JUMA 4Q4ZF 1ZQ3P 4D1QA 3TDUC 5EG0A 2LKXA 2H8WA 5LGTA 4XMYA 2QVOA 3SZPA 4LG0A 4RB3C 2AQFA 2VQLA 1LFBA 2ETHA 2K9MA 2MD0A 3RDIA 4MEXF 4ZTFA 5AIQA 1YOVB 1LQ1A 1WJDA 5FFZA 4HNTA 1SVMA 2P6SA 3BT9A 2FUG2 3BCBA 5A2QR 1YJ9I 1G59A 2DMUA 1HLVA 2O3FA 1YHQI 2W7NA 3O2PE 1BOBA 2V6CA 3FBIB 4HX8A 1T38A 2XPWA 2V9KA 5DYMA 4LLLA 1S7EA 3TQNA 4E7JA 1LJ9A 4BJTA 2IGNA 3R0JA 4XIDA 5K7ZA 1R1UA 4B09A 2R7ZJ 1R4NB 2OF7A 1USTA 3D5SC 1OKRA 1ZG5A 4R1HA 3ZOBA 1V5GA 2QEXI 2O5RA 4G6QA 3KYCB 2P5LC 2JUGA 2F6CA 2XASA 1HW2A 1YQAA 4I6ZA 2D2WA 2YS9A 5DD4A 1QZYA 3HUGB 3J7AO 3JRBA 4GDFA 4U87A 2OU2A 1HDPA 5EYRA 5GP9A 3E7LA 3HRTA 4YG2F 1H9TA 3IHUA 4DQ2A 1VQ9I 3SDBA 1TW3A 2K4JA 4E7LA 2DLLA 3MZ8A 5EEHA 5B1BH 1AU7A 3DPUA 2CO5A 3HZJA 5LHGA 2FSWA 3QYEA 2GA2A 1TWCJ 4PFOA 3LSJA 1BC7C 2XROA 2HOAA 3TBIA 2X6WA 1UJ8A 3BG9A 5EEAA 2L7FP 1ZG1A 3H5AA 1Z67A 2L01A 1LPQA 1FLIA 1LVKA 2M1BA 5F1JA 1WI9A 5B66C 2A68F 5ICCA 1G3TA 2AXLA 1V3FA 2HQRA 3GTQJ 2FMLA 3QODA 4AVPA 1RC9A 5F1RA 1BOAA 3BDDA 1EV7A 3CCRI 3Q3SA 2JJ7A 2RVCA 5LBQA 3OSGA 3L2RA 4J01A 1KU9A 2E1MC 2Q2EB 3F8FA 1YLFA 5K7FA 1LEBA 4RDUA 2VPLA 2M3AA 4A3BJ 2BYVE 2VASA 2NNYA 3K4BA 5J4YA 2DA3A 1JGGA 1MJAA 2EBIA 4EGZA 3S14J 2K7LA 1FOYA 4HBLA 5CVVA 3QU3A 3HKZN 3CJTB 3CCLI 4MLOA 3W2AA 4JK1X 1MBEA 2JSCA 4YRVA 3E6CC 1FBSA 1FOWA 2FEZA 1Q1HA 4A5MA 1K6OA 3PQKA 2E2JJ 2E5ZA 2DJIA 1OJLA 5GAEJ 2BXYA 2PFBA 1A35A 3K70D 2R7VA 1D3YA 3DEEA 2XHKA 4OIQF 4G6DA 1WWXA 4EJUA 4PJMA 2KLOA 4X1EA 1JKRC 5TISC 3EUAA 4RAGA 1Q1VA 2VBXA 5GAHJ 1Z0XA 2LK2A 1RKTA 4YIIA 2K85A 2M45A 3E5QA 3K7AJ 4ZH4F 3CCVI 1I1GA 1R58A 2EV0A 1SC7A 3C7JA 4CGZA 1IRGA 2Y30A 2WY8Q 3CDHA 5A2QK 3JREA 2R7DA 2MFZA 5K7HA 5KNLA 2UXXA 2EA2A 5FLVA 1TQPA 2F5CA 2JTVA 2M8GX 2WY7Q 3BTCA 2KIUA 3K10A 3U21A 4KIFA 1UAAA 2BE5F 3PL8A 1G6NA 2H09A 4KN7X 3G4SI 3K4CA 4CCMA 4M3BA 3I55I 2AQEA 5F04A 5FD5A 3GMEA 3HUGA 2R7UA 1LE8B 3CD6I 5L3DA 4EGYA 3ELKA 3E6MA 1X1BA 3CUQC 4XN0A 4L9NA 4FE7A 2E34A 3QP6A 5JLWA 3EETA 2GLOA 4AYBN 2HPIA 3F8BA 3X2QH 2DT5A 2YR2A 3HTUA 4FX0A 1ZHFA 3BC8A 1IV8A 5IOYA 3HBLA 1ITYA 1K83J 2M0CA 3RKWA 2COMA 5JHFA 1WJ5A 1TWHJ 2EILH 3LSTA 1B8IB 1LDKB 1D1BA 2L9NA 3CJNA 3LSIA 3TGNA 5HLIA 1DDNA 1BW5A 1I39A 1J59A 4G7OF 2ZJQF 3OYDA 5FKLA 3I56I 2OPTA 5K1YA 2LREA 5HLTA 4A3MJ 3J80R 2VB6A 2DA2A 1X3UA 3KEQA 1MBJA 2GQQA 3JW4A 5M3FJ 3OSFA 3B6CA 2HTJA 1REPC 3LSPA 2IS6A 3AFHA 3BPVA 3N05A 3CMMA 3DBRB 2F5DA 3F8CA 3Q9VA 4ZZDA 2DQLA 2Q2EA 3A01B 3REOA 1IGNA 4A3CJ 4QIWN 1T39A 1J0RA 2KP6A 4BAYA 1MMNA 1MSFC 4GO1A 4LIVA 1MZBA 4M72A 5HS8A 4R8HA 5EF6A 5EDNA 4KA4A 1DP3A 1VZ0A 1MBHA 1Z3YA 3E3VA 3K9TA 4HPQA 1X2MA 1S29A 3DU6A 1PJRA 3QP5A 3HB9A 1WCMJ 2D5VA 4F91B 4EV0A 5H6QA 2JA6J 3S16J 1VTNC 2E71A 4QWQA 5DUIA 2JPCA 4UY8I 1XX5A 4BHBA 3LL7A 3FXRA 1B4AA 1Y8QB 3LAPA 3PNYA 5HDKA 4I99C 2CV1A 3BTLA 3F72A 4XLCA 2JWTA 3ONQA 1UCRA 4UUVA 2DFFA 5FD6A 1FMWA 1ZELA 3LAJA 2DOAA 1JE8A 2ZC2A 4QSHA 1R49A 1TW2A 2EB7A 3BR6A 4OIOF 3BZ6A 4XR6A 2DFIA 1AKHB 2G0EA
chains in the Genus database with same CATH topology
3BJOA 3FM5A 4IPAA 5FFXA 3ZQ7A 2OQGA 1GHCA 4G9YA 2XAQA 2IA2A 1OYWA 1WRJA 2LDUA 3L7WA 2PQ8A 5JR3A 4L18B 5FLXZ 2M30A 3GWZA 5K5QA 1O7FA 3WE2A 2K27A 4G7HF 5DDGA 1IZ1A 3ML6A 1O3QA 1C0WA 1AWCA 3KETA 2FMYA 3MZYA 4EJTA 1IN8A 5DV5A 3ABTA 3LWFA 1FPQA 4CO8A 1W7PD 3EUHA 4A6DA 4BH9A 2G9WA 2A69F 4H0EA 2XAGA 3AAFA 2A6EF 2JPBA 5DUKA 5LHHA 1HQCA 2Z9OA 4EJVA 1R5GA 3F23A 2HDCA 4HX7A 3KE2A 3ERED 3P9IA 3E97A 4UHTA 2OZ6A 2XIGA 5DCFA 2W85A 4ASNA 1FYKA 1IN7A 1BBYA 4ON0A 1GXQA 1Z7UA 5BOXA 1G3YA 2HTSA 2UZKA 1KQ8A 1MDMB 5D8KB 2E7XA 1T6SA 4HAMA 1W7PA 2D1VA 4L5IA 2VN2A 2OD5A 3JAMZ 1ZRCA 3V7SA 3GO5A 3DPLC 2XRNA 1KU3A 4WX9A 1R00A 3I59A 1YW7A 3HSRA 1IUYA 1LVAA 2TDXA 4HZFA 3TOBA 3QPHA 3BJ6A 3DF8A 1CF7B 4FT8A 2DU9A 2P4WA 4M9ZA 4G7ZF 5HDNA 3FXQA 1HKSA 4ZYHA 1KQ0A 3R0AA 1WQ2A 2PN6A 1FZPB 1DUXC 1BJAA 1B9NA 1U5TA 2DQRA 4OMYA 5K5RA 1BI3A 5JVTA 4OINF 2XGXA 5E1ZB 1U8RA 2YSRA 2A5YB 2GIVA 3TO6A 4BQAA 4JQFA 2O61A 1D8JA 4WXCA 1FY7A 2MBFA 5LLQA 3F3XA 4UV8A 5DCMB 3CTAA 1Z91A 4Y15A 1IAWA 4HDVA 1S6LA 1YYVA 1R5HA 3GFJA 5EEGA 3J81K 4P9UA 4ENKA 3QOPA 1J9IA 5L3CA 1MDMA 5HS7A 4HLYA 1B9MA 5IT9Z 1O7LA 5J6XA 2VT3A 3N97A 4ETSA 3IWZA 4A5NA 2NNNA 2DW4A 2DFIA 3H3ZA 1F5TA 5HVQC 2HOEA 1FSEA 1ZYRF 3ZMSA 2H6CA 2RNJA 5D5WB 2HFHA 3TKYA 3DEUA 2IRFG 1NHAA 1CF7A 2HKOA 2NAZA 2A6HF 3TOAA 2VC0A 1SFUA 1ZARA 2F2EA 5KVRA 3RYPA 2FBHA 4UVBA 3WU1B 4Q48A 2FNAA 2FXAA 3ZMVA 3WTVC 2DAOA 1BN5A 3HSEA 2OBPA 4KFCA 5JFRA 4YFNF 4Q47A 3DKWA 4XLPF 3V8LA 4Q5SF 3MZHA 4TV7A 1XGMA 2HR3A 5DCMA 1QO0D 3WTTC 5JI6A 4D0PA 4U7DA 2ACJA 1K79A 3GFLA 4BYYA 2QLZA 3VEPA 5BMZA 2NRAC 1FX7A 2FE3A 3LQRA 3E5XA 1QNTA 3M7GA 2EFNA 1OMIA 2ISZA 3WODF 1YW9A 2VT2A 2V79A 1XSVA 4B8XA 3EYIA 1U78A 4MQVA 2E7WA 3NRVA 4LB6B 1BM9A 5FGMA 1Z1DA 3DXJF 3F22A 1AOYA 3MWMA 2KRFA 3R61A 2ZNZA 4BHCA 4HX4A 5H20A 2HGCA 3M1EA 5L3FA 4RGSA 2WV0A 1IF1A 2YX7A 3CUQB 3IC7A 3E6DA 4EM2A 3LA7A 2EFPA 1B6AA 4S04A 5IT3A 2PLYA 4A0YA 5KK1A 1R22A 1SD4A 1P4XA 1YS7A 2QYOA 1SFXA 5LEKA 2E1NA 2C6YA 1MD0A 3R6SA 4IRIA 2HKXA 1W5TA 2XAJA 4HF0A 1K78B 2STWA 2HQNA 4P9FA 1ZREA 2Y0MA 3LA2A 3F6VA 1FBUA 1S8NA 2MH2A 4RGRA 5D4SA 1RUOA 2BEOA 1T2KA 2RV8A 1IXRC 1PP7U 1KU2A 2BV6A 2HYGD 2ZXJA 3GFMA 1E17A 2DK5A 2DBBA 3CUOA 2A07F 5A2QZ 4UNOA 3FHZA 3U9GA 4OOIA 1LEAA 3G3ZA 4M71A 1YS6A 4HW0A 3ISPA 2H94A 3SXYA 4CHUA 2DK8A 2HYFA 1G3SA 1Z6TA 3SZTA 2L3DA 2P7CB 2NS0A 5E20A 2WTEA 1A04A 2XAFA 3K1MA 2GXGA 3P9KA 4MTDA 2R3SA 4G8XA 3CUQA 3T8RA 3IWFA 2J5OA 3NEUA 1ZH5A 2G7HA 1H9GA 4GGGA 5D4RA 1FWZA 4HYEA 4P55A 4O3MA 2E1CA 2XKOA 2D45A 2DO7A 4K2EA 2O8XA 4GYIA 4WXDA 2KIMA 3C3WA 6PAXA 4O6JA 1JHFA 1K78A 2JZYA 1P92A 2J5PA 4YIFA 3K1NA 2V1UA 2HZTA 2PMHA 5J8CA 1SD6A 4WF2A 3QU6A 1G3WA 5CVIA 2L54A 3IKTA 4EQQA 5AIPA 3EQLF 2RGVA 5BQTA 3ZN1A 1KGSA 4DNCA 3QPTA 4MTEA 3ULQB 3PQJA 1KQ9A 3FXUA 4RGXA 1YIOA 3RI4A 5ILSA 4NHJA 4ZYDA 3RIRA 2IPQX 3FMQA 4GXOA 4IJAA 5DEQA 3M9AA 4EJOA 4OU0A 2PG4A 2L4MA 3QRFF 4PZJA 1V4RA 2ZO4A 3JTGA 4AD9A 4Z2YA 4CDGA 1GXPA 4KUMA 2PEXA 3GZ6A 3HRMA 2STTA 3F8MA 3GZ5A 2OAZA 2A3SA 4KMFA 1IN4A 1U6GA 5HOOA 2HWVA 1XGSA 5BS6A 3HIFA 3GX4X 4L9TA 3HOTA 1FNNA 4U0WA 1FYMA 1JHHA 3I0TA 4RB1A 2Z33A 3WTZA 4CXFA 4FX4A 3LQQA 1XMKA 3GEZA 1UHWA 4ZZLA 4N9HA 4IRGA 1BI2A 2IVMA 1WSUA 2EV5A 1I5ZA 1SD7A 4WXHA 1F4KA 2W57A 2P5VA 4UVCA 3DV8A 3NQOA 3CO6C 1OYYA 2ZNYA 3J80K 1LDJA 1DP7P 2VE8A 3L9FA 4EM1A 2BGCA 3HYIA 1J2XA 1P6RA 1P4WA 5FB2A 2YPRA 4HA8A 3GW2A 1PDNC 2K02A 2IA1A 3V8JA 4ESFA 1XB4A 4ENJA 2MH9A 3GVAA 4PDKA 3KLOA 1YW8A 1OR7A 4WCGA 3IRRA 3VB2A 4PGGA 3KZZA 4N0BA 2B0LA 1TQMA 2JRTA 3ECOA 2HEOA 4KIGA 4UXNA 1UHMA 3DFGA 5ICGA 3ZMTA 4I0BA 5E1XA 3GUDA 1ULYA 3N4MA 1XGNA 1RUNA 4CZZA 2DTRA 3I71A 3WTSC 3VFZA 1MJBA 4N9IA 4AWXB 3JSPA 2GAUA 3B73A 3TO9A 3J81Z 1B1BA 1S7OA 4MGRA 4EM0B 5HS9A 2DPUA 2Z99A 2CYYA 3HRUA 4RB2C 1QQIA 5DD8A 3KP6A 4HF2A 2KIFA 2OA4A 1D5VA 1HKQA 4RGUA 3H3UA 2FQ3A 2K4BA 4ENNA 1MKMA 1TQIA 2PJPA 1W5SA 5CYVA 5CVRA 5K5OA 3KFWX 3MAJA 1OPCA 4GCVA 5LEJA 3ROUA 1I27A 4HQEA 1ODDA 4KMUX 3JSOA 1J7KA 2EWNA 1I6XA 3T5XA 1Z6RA 3FWEA 5CLSA 1YFHA 1TNSA 1IN6A 4U0VA 4HV6A 2IW5A 3FF5A 1BI1A 4XRFA 2YX4A 4S05A 3VOEA 4I0AA 1ZRFA 1U3EM 2RQPA 5LHIA 2FRHA 1BIAA 4HOBA 2M87A 2FOKA 4IHTA 3OV8A 1R1TA 3ECHA 1RZ4A 4MEYF 4L0YB 3V4GA 3KP3A 2EK5A 2LKPA 1XN7A 4NQWA 3MEXA 1IXSB 1BIBA 4LG0B 4FHTA 1SFEA 1MJ9A 3I5UA 2P7VB 4G94A 2O03A 3T1BA 3KP4A 3WTXC 2PMUA 4AIKA 2VBWA 3KEOA 2Y48A 2RDPA 2L4AA 1ON2A 2FBKA 1G4DA 4A0ZA 4Y13A 2EA4A 4KN4X 4L5JA 2GA1A 2GZWA 4M9SA 1UB9A 5E8GA 4OIRF 4ZYEA 5E8IA 4LD5A 5ILUA 4HDUA 1R7JA 3ZPLA 3V8KA 4BNCA 1HW1A 4JBAA 1R1VA 3SHFA 2MLKA 1BC8C 3RPUA 4KT5C 4LLNA 1TBXA 2IJLA 3BP8A 3WTWC 4M9XA 3I53A 4BXUA 4UV9A 4PCQA 3EDPA 3MCZA 1FYLA 2MLGA 1XDUA 4XLNF 3TDZC 3IL2A 2QQBA 3K0LA 3IKVA 3FMRA 3D5LA 4UVAA 1L3LA 4YFKF 3HHGA 1YG2A 5ERIA 4M74A 1STZA 1HXDA 4BHPA 1QBJA 1T0FA 4GYGA 2KKOA 1OYIA 3E6BA 2V1DA 1BI0A 3WGGA 2XUBA 1XCBA 2GXBA 1KA8A 1Z9CA 1U2WA 4I7HA 4RAYA 1JXSA 5LRSA 4KICA 3V7RA 3BOQA 3RYRA 2IT0A 2V1XA 3G73A 1ZLJA 5J8FA 5ED4A 1S3JA 4HF1A 2QQ9A 1Y0UA 5TJJA 5ICFA 1IRFA 3LFKA 1FSHA 2GWRA 1IXCA 3KCCA 3P9CA 3M8FA 2RKHA 3LA3A 5L3GA 2KJCA 4IXAA 3T0YA 1FP2A 4U7BA 2ESNA 4L0ZB 3Q9SA 1I1SA 3F21A 2XKPA 2ZMEB 3RPQA 3WTYC 1XGOA 2LF7A 1DPUA 3BROA 2RC4A 2QZ8A 2QM3A 4KDPA 2CFXA 2Z5UA 2VBZA 2CGPA 1JGSA 2R7FA 1L0OC 2PBIA 5D5VB 1Z05A 3B02A 1R23A 1O3SA 4IF4A 1LB2A 3KP2A 3GYHX 1HSTA 2P6TA 3WU0A 4I09A 5HDGA 3HRSA 4A2UA 3GXOA 2X0LA 3KP7A 3ZN0A 1ZG3A 2QENA 4U88A 2Y75A 1H0MA 1WKMA 4ENMA 2QWWA 3EYYA 2QBYB 1SMYF 1LNWA 5D6FA 1RI7A 2W25A 2XAHA 3HHHA 4IHSA 2VONA 4EJWA 3BWGA 5L3EA 1J75A 3BY6A 2EFOA 2EFWA 2WC2A 4I98B 4PGHA 1TNTA 1USSA 4MHGA 1XMAA 5JHUA 3CO7C 1IW7F 1B59A 2ZMEA 1R36A 4HV5A 3RKXA 1SAXA 1FT9A 3JTHA 5L3BA 2AS5F 4OIPF 2H27A 2MC3A 3K1PA 3QAHA 5BPIA 2PI0A 2M8EA 2UWMA 2VC1A 1EH6A 3PFIA 2NYXA 3WGIA 3GFIA 2ZFWA 3U2RA 2K86A 2Q0OA 3MQ0A 3GLXA 3WE3A 4RS8A 4EVIA 3SQNA 5HLHA 2LSOA 3K2ZA 3OOPA 1F1ZA 2OQRA 1J5YA 2CWEA 2WWYA 3CLOA 1FBQA 2F5FA 3J80Z 1W7PB 2G7UA 3FMSA 5E1WA 2HS5A 2Q8KA 1ON1A 3I64A 2F5EA 1E2XA 2UXNA 4NB5A 2QBYA 1RNLA 4RB0A 3I59B 2L02A 1HBXG 3ZMZA 3E5UA 2ISYA 5E17F 1D8KA 2XV4S 2JT1A 4P96A 4HQMA 2VODA 2VBYA 2ZKZA 2VE9A 3RTRA 1XDSA 4M6YA 4LMYA 4LLGF 5ICEA 4U0YA 1PUEE 1HSJA 1DPRA 1QGPA 3HOSA 4WWCA 2ZCWA 3U1DA 1U5TB 3O6BB 2FBIA 4LJZF 4ESBA 1ZN2A 2OZUA 1ZRDA 3RKYA 1SMTA 3I58A 5BPDA 5FLXK 1TLHB 5H6RA 1F9NA 1ZLKA 3I4PA 2ELHA 2ADUA 3KP5A 3RJPA 4LK0F 5CVJA 5D8LB 1GVJA 4EMSA 4LFUA 1XSXA 2A61A 4L9VA 4CICA 4RAZA 1P4AA 4F7ZA 1K7AA 3S2WA 1YTYA 1ZGAA 4OMZA 3IRQA 1LDDA 1SD5A 4M73A 1UFMA 4L9JA 2H6BA 3C18A 4IRHA 4MNUA 3W6JB 1FOKA 4AIHA 2VOOA 1KU7A 3WGHA 2FF4A 1W4MA 1O57A 2Z3YA 2CG4A 1ZGJA 2DI3A 3R4KA 1T98A 3C1DA 3P7NA 4QLCU 4YFXF 3M8EA 2CSOA 2EJRA 4LB5A 2P5KA 1FC3A 3D0SA 4O5VA 4KIBA 2CQKA 1EH7A 4I01A 3JAMK 4ZYGA 2BBYA 1ONVA 3ABUA 2O6GE 2IA0A 3ZMUA 1RIOH 5TRDA 1FP1D 2CW0F 2W84A 1CGPA 3F6OA 2EV6A 4XBFA 4WK8F 2LNBA 2FA5A 3TO7A 1U5TC 2MA3A 1PP8F 5D6EA 1IN5A 3FZVA 3W6KB 4LGWA 2VOPA 1EH8A 3F8NA 3R60A 1O3TA 3KZYA 3SFZA 2M5WA 5D5XB 4R79A 3DP7A 3DQVC 4E70A 4A12A 3L09A 3Q5FA 1YO5C 5CVUA 5F64A 3MFKA 2LF8A 3O3KA 4I02A 3ZP5A 2ZJ2A 4KNYA 4A0XA 5AONA 1HKTA 2W24A 5LRRA 2MD5A 2KJBA 2YU3A 4I2OA 5HLGA 5ILVA 2EFQA 3BPXA 2IP2A 2ZBKA 5LGUA 2VXZA 1HW5A 1MGTA 4XSXF 3FX3A 1XCVA 2RN7A 2V9VA 2XVCA 5IT9K 3H92A 3I54A 1XD7A 1XSDA 2ESHA 1TTYA 3BJAA 3L2CA 3L00A 4AIJA 3GF2A 2FNPA 3DPTA 5FO5A 2O0YA 4IVNA 3WTUC 5D5UB 4LK1F 3T8TA 1S7AA 4MQ9F 5F6FA 3K69A 3HTSB 3COAC 2X4HA 5E18F 1ZAOA 3ZMDA 3VODA 4KYWA 2QUFA 2FU4A 1KYWA 3FM3A 1O3RA 1P2FA 4M6XA 4HLXA 3HSFA 5LGNA 1KYZA 2D1HA 3V7CA 5CJ9A 4XSZF 4ESJA 1QZZA 2QQAA 1QPMA 3KLNA 4P5OA 4CYDA 4Y17A 3WG9A 4A6EA 2P8TA 2DPDA 4Q4ZF 3TDUC 5LGTA 2QVOA 3SZPA 4LG0A 4RB3C 2ETHA 3RDIA 4MEXF 5AIQA 1LQ1A 5FFZA 2P6SA 2O3FA 3O2PE 2V6CA 4HX8A 1T38A 5DYMA 3TQNA 1LJ9A 3R0JA 1R1UA 4B09A 1USTA 1OKRA 1ZG5A 4R1HA 4G6QA 2P5LC 2XASA 1HW2A 1YQAA 2D2WA 5DD4A 1QZYA 3J7AO 2OU2A 3HRTA 4YG2F 1H9TA 3IHUA 4DQ2A 1TW3A 2K4JA 2DLLA 5EEHA 2CO5A 5LHGA 2FSWA 2GA2A 1BC7C 2XROA 1ZG1A 2L01A 1FLIA 2M1BA 1WI9A 2A68F 5ICCA 1G3TA 2AXLA 1V3FA 2HQRA 2FMLA 4AVPA 5F1RA 1BOAA 3BDDA 1EV7A 2RVCA 5LBQA 1KU9A 3F8FA 1YLFA 1LEBA 2BYVE 2NNYA 1MJAA 4EGZA 2K7LA 4HBLA 5CVVA 3QU3A 4JK1X 2JSCA 3E6CC 1K6OA 1FBSA 2FEZA 4A5MA 1Q1HA 3PQKA 2PFBA 1D3YA 2XHKA 4OIQF 4G6DA 1WWXA 4EJUA 2VBXA 4YIIA 2M45A 3E5QA 4ZH4F 1I1GA 1R58A 2EV0A 4CGZA 3C7JA 1IRGA 3CDHA 5A2QK 2R7DA 2UXXA 2EA2A 1TQPA 2F5CA 2JTVA 2KIUA 4KIFA 2BE5F 1G6NA 2H09A 4KN7X 5FD5A 3HUGA 5L3DA 4EGYA 3ELKA 3E6MA 3CUQC 4L9NA 3QP6A 3EETA 3F8BA 2DT5A 2YR2A 3HTUA 4FX0A 1ZHFA 3RKWA 2COMA 3LSTA 1LDKB 3CJNA 3TGNA 1DDNA 5HLIA 1J59A 4G7OF 5K1YA 3KEQA 1X3UA 2GQQA 3JW4A 2HTJA 1REPC 3BPVA 2F5DA 3F8CA 3Q9VA 4ZZDA 2DQLA 2Q2EA 3REOA 1T39A 1J0RA 4BAYA 4GO1A 1MZBA 4M72A 5HS8A 4R8HA 4KA4A 3E3VA 3K9TA 1S29A 3QP5A 4EV0A 5H6QA 1VTNC 4QWQA 5DUIA 2JPCA 4BHBA 3FXRA 1B4AA 3LAPA 5HDKA 3F72A 1UCRA 4UUVA 5FD6A 3LAJA 1JE8A 4OIOF 1TW2A 2EB7A 3BZ6A 4LLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJO A;  3FM5 A;  4IPA A;  5FFX A;  3ZQ7 A;  2OQG A;  1GHC A;  4G9Y A;  2XAQ A;  2IA2 A;  1OYW A;  1WRJ A;  2LDU A;  3L7W A;  2PQ8 A;  5JR3 A;  4L18 B;  5FLX Z;  2M30 A;  3GWZ A;  5K5Q A;  1O7F A;  3WE2 A;  2K27 A;  4G7H F;  5DDG A;  1IZ1 A;  3ML6 A;  1O3Q A;  1C0W A;  1AWC A;  3KET A;  2FMY A;  3MZY A;  4EJT A;  1IN8 A;  5DV5 A;  3ABT A;  3LWF A;  1FPQ A;  4CO8 A;  1W7P D;  3EUH A;  4A6D A;  4BH9 A;  2G9W A;  2A69 F;  4H0E A;  2XAG A;  3AAF A;  2A6E F;  2JPB A;  5DUK A;  5LHH A;  1HQC A;  2Z9O A;  4EJV A;  1R5G A;  3F23 A;  2HDC A;  4HX7 A;  3KE2 A;  3ERE D;  3P9I A;  3E97 A;  4UHT A;  2OZ6 A;  2XIG A;  5DCF A;  2W85 A;  4ASN A;  1FYK A;  1IN7 A;  1BBY A;  4ON0 A;  1GXQ A;  1Z7U A;  5BOX A;  1G3Y A;  2HTS A;  2UZK A;  1KQ8 A;  1MDM B;  5D8K B;  2E7X A;  1T6S A;  4HAM A;  1W7P A;  2D1V A;  4L5I A;  2VN2 A;  2OD5 A;  3JAM Z;  1ZRC A;  3V7S A;  3GO5 A;  3DPL C;  2XRN A;  1KU3 A;  4WX9 A;  1R00 A;  3I59 A;  1YW7 A;  3HSR A;  1IUY A;  1LVA A;  2TDX A;  4HZF A;  3TOB A;  3QPH A;  3BJ6 A;  3DF8 A;  1CF7 B;  4FT8 A;  2DU9 A;  2P4W A;  4M9Z A;  4G7Z F;  5HDN A;  3FXQ A;  1HKS A;  4ZYH A;  1KQ0 A;  3R0A A;  1WQ2 A;  2PN6 A;  1FZP B;  1DUX C;  1BJA A;  1B9N A;  1U5T A;  2DQR A;  4OMY A;  5K5R A;  1BI3 A;  5JVT A;  4OIN F;  2XGX A;  5E1Z B;  1U8R A;  2YSR A;  2A5Y B;  2GIV A;  3TO6 A;  4BQA A;  4JQF A;  2O61 A;  1D8J A;  4WXC A;  1FY7 A;  2MBF A;  5LLQ A;  3F3X A;  4UV8 A;  5DCM B;  3CTA A;  1Z91 A;  4Y15 A;  1IAW A;  4HDV A;  1S6L A;  1YYV A;  1R5H A;  3GFJ A;  5EEG A;  3J81 K;  4P9U A;  4ENK A;  3QOP A;  1J9I A;  5L3C A;  1MDM A;  5HS7 A;  4HLY A;  1B9M A;  5IT9 Z;  1O7L A;  5J6X A;  2VT3 A;  3N97 A;  4ETS A;  3IWZ A;  4A5N A;  2NNN A;  2DW4 A;  2DFI A;  3H3Z A;  1F5T A;  5HVQ C;  2HOE A;  1FSE A;  1ZYR F;  3ZMS A;  2H6C A;  2RNJ A;  5D5W B;  2HFH A;  3TKY A;  3DEU A;  2IRF G;  1NHA A;  1CF7 A;  2HKO A;  2NAZ A;  2A6H F;  3TOA A;  2VC0 A;  1SFU A;  1ZAR A;  2F2E A;  5KVR A;  3RYP A;  2FBH A;  4UVB A;  3WU1 B;  4Q48 A;  2FNA A;  2FXA A;  3ZMV A;  3WTV C;  2DAO A;  1BN5 A;  3HSE A;  2OBP A;  4KFC A;  5JFR A;  4YFN F;  4Q47 A;  3DKW A;  4XLP F;  3V8L A;  4Q5S F;  3MZH A;  4TV7 A;  1XGM A;  2HR3 A;  5DCM A;  1QO0 D;  3WTT C;  5JI6 A;  4D0P A;  4U7D A;  2ACJ A;  1K79 A;  3GFL A;  4BYY A;  2QLZ A;  3VEP A;  5BMZ A;  2NRA C;  1FX7 A;  2FE3 A;  3LQR A;  3E5X A;  1QNT A;  3M7G A;  2EFN A;  1OMI A;  2ISZ A;  3WOD F;  1YW9 A;  2VT2 A;  2V79 A;  1XSV A;  4B8X A;  3EYI A;  1U78 A;  4MQV A;  2E7W A;  3NRV A;  4LB6 B;  1BM9 A;  5FGM A;  1Z1D A;  3DXJ F;  3F22 A;  1AOY A;  3MWM A;  2KRF A;  3R61 A;  2ZNZ A;  4BHC A;  4HX4 A;  5H20 A;  2HGC A;  3M1E A;  5L3F A;  4RGS A;  2WV0 A;  1IF1 A;  2YX7 A;  3CUQ B;  3IC7 A;  3E6D A;  4EM2 A;  3LA7 A;  2EFP A;  1B6A A;  4S04 A;  5IT3 A;  2PLY A;  4A0Y A;  5KK1 A;  1R22 A;  1SD4 A;  1P4X A;  1YS7 A;  2QYO A;  1SFX A;  5LEK A;  2E1N A;  2C6Y A;  1MD0 A;  3R6S A;  4IRI A;  2HKX A;  1W5T A;  2XAJ A;  4HF0 A;  1K78 B;  2STW A;  2HQN A;  4P9F A;  1ZRE A;  2Y0M A;  3LA2 A;  3F6V A;  1FBU A;  1S8N A;  2MH2 A;  4RGR A;  5D4S A;  1RUO A;  2BEO A;  1T2K A;  2RV8 A;  1IXR C;  1PP7 U;  1KU2 A;  2BV6 A;  2HYG D;  2ZXJ A;  3GFM A;  1E17 A;  2DK5 A;  2DBB A;  3CUO A;  2A07 F;  5A2Q Z;  4UNO A;  3FHZ A;  3U9G A;  4OOI A;  1LEA A;  3G3Z A;  4M71 A;  1YS6 A;  4HW0 A;  3ISP A;  2H94 A;  3SXY A;  4CHU A;  2DK8 A;  2HYF A;  1G3S A;  1Z6T A;  3SZT A;  2L3D A;  2P7C B;  2NS0 A;  5E20 A;  2WTE A;  1A04 A;  2XAF A;  3K1M A;  2GXG A;  3P9K A;  4MTD A;  2R3S A;  4G8X A;  3CUQ A;  3T8R A;  3IWF A;  2J5O A;  3NEU A;  1ZH5 A;  2G7H A;  1H9G A;  4GGG A;  5D4R A;  1FWZ A;  4HYE A;  4P55 A;  4O3M A;  2E1C A;  2XKO A;  2D45 A;  2DO7 A;  4K2E A;  2O8X A;  4GYI A;  4WXD A;  2KIM A;  3C3W A;  6PAX A;  4O6J A;  1JHF A;  1K78 A;  2JZY A;  1P92 A;  2J5P A;  4YIF A;  3K1N A;  2V1U A;  2HZT A;  2PMH A;  5J8C A;  1SD6 A;  4WF2 A;  3QU6 A;  1G3W A;  5CVI A;  2L54 A;  3IKT A;  4EQQ A;  5AIP A;  3EQL F;  2RGV A;  5BQT A;  3ZN1 A;  1KGS A;  4DNC A;  3QPT A;  4MTE A;  3ULQ B;  3PQJ A;  1KQ9 A;  3FXU A;  4RGX A;  1YIO A;  3RI4 A;  5ILS A;  4NHJ A;  4ZYD A;  3RIR A;  2IPQ X;  3FMQ A;  4GXO A;  4IJA A;  5DEQ A;  3M9A A;  4EJO A;  4OU0 A;  2PG4 A;  2L4M A;  3QRF F;  4PZJ A;  1V4R A;  2ZO4 A;  3JTG A;  4AD9 A;  4Z2Y A;  4CDG A;  1GXP A;  4KUM A;  2PEX A;  3GZ6 A;  3HRM A;  2STT A;  3F8M A;  3GZ5 A;  2OAZ A;  2A3S A;  4KMF A;  1IN4 A;  1U6G A;  5HOO A;  2HWV A;  1XGS A;  5BS6 A;  3HIF A;  3GX4 X;  4L9T A;  3HOT A;  1FNN A;  4U0W A;  1FYM A;  1JHH A;  3I0T A;  4RB1 A;  2Z33 A;  3WTZ A;  4CXF A;  4FX4 A;  3LQQ A;  1XMK A;  3GEZ A;  1UHW A;  4ZZL A;  4N9H A;  4IRG A;  1BI2 A;  2IVM A;  1WSU A;  2EV5 A;  1I5Z A;  1SD7 A;  4WXH A;  1F4K A;  2W57 A;  2P5V A;  4UVC A;  3DV8 A;  3NQO A;  3CO6 C;  1OYY A;  2ZNY A;  3J80 K;  1LDJ A;  1DP7 P;  2VE8 A;  3L9F A;  4EM1 A;  2BGC A;  3HYI A;  1J2X A;  1P6R A;  1P4W A;  5FB2 A;  2YPR A;  4HA8 A;  3GW2 A;  1PDN C;  2K02 A;  2IA1 A;  3V8J A;  4ESF A;  1XB4 A;  4ENJ A;  2MH9 A;  3GVA A;  4PDK A;  3KLO A;  1YW8 A;  1OR7 A;  4WCG A;  3IRR A;  3VB2 A;  4PGG A;  3KZZ A;  4N0B A;  2B0L A;  1TQM A;  2JRT A;  3ECO A;  2HEO A;  4KIG A;  4UXN A;  1UHM A;  3DFG A;  5ICG A;  3ZMT A;  4I0B A;  5E1X A;  3GUD A;  1ULY A;  3N4M A;  1XGN A;  1RUN A;  4CZZ A;  2DTR A;  3I71 A;  3WTS C;  3VFZ A;  1MJB A;  4N9I A;  4AWX B;  3JSP A;  2GAU A;  3B73 A;  3TO9 A;  3J81 Z;  1B1B A;  1S7O A;  4MGR A;  4EM0 B;  5HS9 A;  2DPU A;  2Z99 A;  2CYY A;  3HRU A;  4RB2 C;  1QQI A;  5DD8 A;  3KP6 A;  4HF2 A;  2KIF A;  2OA4 A;  1D5V A;  1HKQ A;  4RGU A;  3H3U A;  2FQ3 A;  2K4B A;  4ENN A;  1MKM A;  1TQI A;  2PJP A;  1W5S A;  5CYV A;  5CVR A;  5K5O A;  3KFW X;  3MAJ A;  1OPC A;  4GCV A;  5LEJ A;  3ROU A;  1I27 A;  4HQE A;  1ODD A;  4KMU X;  3JSO A;  1J7K A;  2EWN A;  1I6X A;  3T5X A;  1Z6R A;  3FWE A;  5CLS A;  1YFH A;  1TNS A;  1IN6 A;  4U0V A;  4HV6 A;  2IW5 A;  3FF5 A;  1BI1 A;  4XRF A;  2YX4 A;  4S05 A;  3VOE A;  4I0A A;  1ZRF A;  1U3E M;  2RQP A;  5LHI A;  2FRH A;  1BIA A;  4HOB A;  2M87 A;  2FOK A;  4IHT A;  3OV8 A;  1R1T A;  3ECH A;  1RZ4 A;  4MEY F;  4L0Y B;  3V4G A;  3KP3 A;  2EK5 A;  2LKP A;  1XN7 A;  4NQW A;  3MEX A;  1IXS B;  1BIB A;  4LG0 B;  4FHT A;  1SFE A;  1MJ9 A;  3I5U A;  2P7V B;  4G94 A;  2O03 A;  3T1B A;  3KP4 A;  3WTX C;  2PMU A;  4AIK A;  2VBW A;  3KEO A;  2Y48 A;  2RDP A;  2L4A A;  1ON2 A;  2FBK A;  1G4D A;  4A0Z A;  4Y13 A;  2EA4 A;  4KN4 X;  4L5J A;  2GA1 A;  2GZW A;  4M9S A;  1UB9 A;  5E8G A;  4OIR F;  4ZYE A;  5E8I A;  4LD5 A;  5ILU A;  4HDU A;  1R7J A;  3ZPL A;  3V8K A;  4BNC A;  1HW1 A;  4JBA A;  1R1V A;  3SHF A;  2MLK A;  1BC8 C;  3RPU A;  4KT5 C;  4LLN A;  1TBX A;  2IJL A;  3BP8 A;  3WTW C;  4M9X A;  3I53 A;  4BXU A;  4UV9 A;  4PCQ A;  3EDP A;  3MCZ A;  1FYL A;  2MLG A;  1XDU A;  4XLN F;  3TDZ C;  3IL2 A;  2QQB A;  3K0L A;  3IKV A;  3FMR A;  3D5L A;  4UVA A;  1L3L A;  4YFK F;  3HHG A;  1YG2 A;  5ERI A;  4M74 A;  1STZ A;  1HXD A;  4BHP A;  1QBJ A;  1T0F A;  4GYG A;  2KKO A;  1OYI A;  3E6B A;  2V1D A;  1BI0 A;  3WGG A;  2XUB A;  1XCB A;  2GXB A;  1KA8 A;  1Z9C A;  1U2W A;  4I7H A;  4RAY A;  1JXS A;  5LRS A;  4KIC A;  3V7R A;  3BOQ A;  3RYR A;  2IT0 A;  2V1X A;  3G73 A;  1ZLJ A;  5J8F A;  5ED4 A;  1S3J A;  4HF1 A;  2QQ9 A;  1Y0U A;  5TJJ A;  5ICF A;  1IRF A;  3LFK A;  1FSH A;  2GWR A;  1IXC A;  3KCC A;  3P9C A;  3M8F A;  2RKH A;  3LA3 A;  5L3G A;  2KJC A;  4IXA A;  3T0Y A;  1FP2 A;  4U7B A;  2ESN A;  4L0Z B;  3Q9S A;  1I1S A;  3F21 A;  2XKP A;  2ZME B;  3RPQ A;  3WTY C;  1XGO A;  2LF7 A;  1DPU A;  3BRO A;  2RC4 A;  2QZ8 A;  2QM3 A;  4KDP A;  2CFX A;  2Z5U A;  2VBZ A;  2CGP A;  1JGS A;  2R7F A;  1L0O C;  2PBI A;  5D5V B;  1Z05 A;  3B02 A;  1R23 A;  1O3S A;  4IF4 A;  1LB2 A;  3KP2 A;  3GYH X;  1HST A;  2P6T A;  3WU0 A;  4I09 A;  5HDG A;  3HRS A;  4A2U A;  3GXO A;  2X0L A;  3KP7 A;  3ZN0 A;  1ZG3 A;  2QEN A;  4U88 A;  2Y75 A;  1H0M A;  1WKM A;  4ENM A;  2QWW A;  3EYY A;  2QBY B;  1SMY F;  1LNW A;  5D6F A;  1RI7 A;  2W25 A;  2XAH A;  3HHH A;  4IHS A;  2VON A;  4EJW A;  3BWG A;  5L3E A;  1J75 A;  3BY6 A;  2EFO A;  2EFW A;  2WC2 A;  4I98 B;  4PGH A;  1TNT A;  1USS A;  4MHG A;  1XMA A;  5JHU A;  3CO7 C;  1IW7 F;  1B59 A;  2ZME A;  1R36 A;  4HV5 A;  3RKX A;  1SAX A;  1FT9 A;  3JTH A;  5L3B A;  2AS5 F;  4OIP F;  2H27 A;  2MC3 A;  3K1P A;  3QAH A;  5BPI A;  2PI0 A;  2M8E A;  2UWM A;  2VC1 A;  1EH6 A;  3PFI A;  2NYX A;  3WGI A;  3GFI A;  2ZFW A;  3U2R A;  2K86 A;  2Q0O A;  3MQ0 A;  3GLX A;  3WE3 A;  4RS8 A;  4EVI A;  3SQN A;  5HLH A;  2LSO A;  3K2Z A;  3OOP A;  1F1Z A;  2OQR A;  1J5Y A;  2CWE A;  2WWY A;  3CLO A;  1FBQ A;  2F5F A;  3J80 Z;  1W7P B;  2G7U A;  3FMS A;  5E1W A;  2HS5 A;  2Q8K A;  1ON1 A;  3I64 A;  2F5E A;  1E2X A;  2UXN A;  4NB5 A;  2QBY A;  1RNL A;  4RB0 A;  3I59 B;  2L02 A;  1HBX G;  3ZMZ A;  3E5U A;  2ISY A;  5E17 F;  1D8K A;  2XV4 S;  2JT1 A;  4P96 A;  4HQM A;  2VOD A;  2VBY A;  2ZKZ A;  2VE9 A;  3RTR A;  1XDS A;  4M6Y A;  4LMY A;  4LLG F;  5ICE A;  4U0Y A;  1PUE E;  1HSJ A;  1DPR A;  1QGP A;  3HOS A;  4WWC A;  2ZCW A;  3U1D A;  1U5T B;  3O6B B;  2FBI A;  4LJZ F;  4ESB A;  1ZN2 A;  2OZU A;  1ZRD A;  3RKY A;  1SMT A;  3I58 A;  5BPD A;  5FLX K;  1TLH B;  5H6R A;  1F9N A;  1ZLK A;  3I4P A;  2ELH A;  2ADU A;  3KP5 A;  3RJP A;  4LK0 F;  5CVJ A;  5D8L B;  1GVJ A;  4EMS A;  4LFU A;  1XSX A;  2A61 A;  4L9V A;  4CIC A;  4RAZ A;  1P4A A;  4F7Z A;  1K7A A;  3S2W A;  1YTY A;  1ZGA A;  4OMZ A;  3IRQ A;  1LDD A;  1SD5 A;  4M73 A;  1UFM A;  4L9J A;  2H6B A;  3C18 A;  4IRH A;  4MNU A;  3W6J B;  1FOK A;  4AIH A;  2VOO A;  1KU7 A;  3WGH A;  2FF4 A;  1W4M A;  1O57 A;  2Z3Y A;  2CG4 A;  1ZGJ A;  2DI3 A;  3R4K A;  1T98 A;  3C1D A;  3P7N A;  4QLC U;  4YFX F;  3M8E A;  2CSO A;  2EJR A;  4LB5 A;  2P5K A;  1FC3 A;  3D0S A;  4O5V A;  4KIB A;  2CQK A;  1EH7 A;  4I01 A;  3JAM K;  4ZYG A;  2BBY A;  1ONV A;  3ABU A;  2O6G E;  2IA0 A;  3ZMU A;  1RIO H;  5TRD A;  1FP1 D;  2CW0 F;  2W84 A;  1CGP A;  3F6O A;  2EV6 A;  4XBF A;  4WK8 F;  2LNB A;  2FA5 A;  3TO7 A;  1U5T C;  2MA3 A;  1PP8 F;  5D6E A;  1IN5 A;  3FZV A;  3W6K B;  4LGW A;  2VOP A;  1EH8 A;  3F8N A;  3R60 A;  1O3T A;  3KZY A;  3SFZ A;  2M5W A;  5D5X B;  4R79 A;  3DP7 A;  3DQV C;  4E70 A;  4A12 A;  3L09 A;  3Q5F A;  1YO5 C;  5CVU A;  5F64 A;  3MFK A;  2LF8 A;  3O3K A;  4I02 A;  3ZP5 A;  2ZJ2 A;  4KNY A;  4A0X A;  5AON A;  1HKT A;  2W24 A;  5LRR A;  2MD5 A;  2KJB A;  2YU3 A;  4I2O A;  5HLG A;  5ILV A;  2EFQ A;  3BPX A;  2IP2 A;  2ZBK A;  5LGU A;  2VXZ A;  1HW5 A;  1MGT A;  4XSX F;  3FX3 A;  1XCV A;  2RN7 A;  2V9V A;  2XVC A;  5IT9 K;  3H92 A;  3I54 A;  1XD7 A;  1XSD A;  2ESH A;  1TTY A;  3BJA A;  3L2C A;  3L00 A;  4AIJ A;  3GF2 A;  2FNP A;  3DPT A;  5FO5 A;  2O0Y A;  4IVN A;  3WTU C;  5D5U B;  4LK1 F;  3T8T A;  1S7A A;  4MQ9 F;  5F6F A;  3K69 A;  3HTS B;  3COA C;  2X4H A;  5E18 F;  1ZAO A;  3ZMD A;  3VOD A;  4KYW A;  2QUF A;  2FU4 A;  1KYW A;  3FM3 A;  1O3R A;  1P2F A;  4M6X A;  4HLX A;  3HSF A;  5LGN A;  1KYZ A;  2D1H A;  3V7C A;  5CJ9 A;  4XSZ F;  4ESJ A;  1QZZ A;  2QQA A;  1QPM A;  3KLN A;  4P5O A;  4CYD A;  4Y17 A;  3WG9 A;  4A6E A;  2P8T A;  2DPD A;  4Q4Z F;  3TDU C;  5LGT A;  2QVO A;  3SZP A;  4LG0 A;  4RB3 C;  2ETH A;  3RDI A;  4MEX F;  5AIQ A;  1LQ1 A;  5FFZ A;  2P6S A;  2O3F A;  3O2P E;  2V6C A;  4HX8 A;  1T38 A;  5DYM A;  3TQN A;  1LJ9 A;  3R0J A;  1R1U A;  4B09 A;  1UST A;  1OKR A;  1ZG5 A;  4R1H A;  4G6Q A;  2P5L C;  2XAS A;  1HW2 A;  1YQA A;  2D2W A;  5DD4 A;  1QZY A;  3J7A O;  2OU2 A;  3HRT A;  4YG2 F;  1H9T A;  3IHU A;  4DQ2 A;  1TW3 A;  2K4J A;  2DLL A;  5EEH A;  2CO5 A;  5LHG A;  2FSW A;  2GA2 A;  1BC7 C;  2XRO A;  1ZG1 A;  2L01 A;  1FLI A;  2M1B A;  1WI9 A;  2A68 F;  5ICC A;  1G3T A;  2AXL A;  1V3F A;  2HQR A;  2FML A;  4AVP A;  5F1R A;  1BOA A;  3BDD A;  1EV7 A;  2RVC A;  5LBQ A;  1KU9 A;  3F8F A;  1YLF A;  1LEB A;  2BYV E;  2NNY A;  1MJA A;  4EGZ A;  2K7L A;  4HBL A;  5CVV A;  3QU3 A;  4JK1 X;  2JSC A;  3E6C C;  1K6O A;  1FBS A;  2FEZ A;  4A5M A;  1Q1H A;  3PQK A;  2PFB A;  1D3Y A;  2XHK A;  4OIQ F;  4G6D A;  1WWX A;  4EJU A;  2VBX A;  4YII A;  2M45 A;  3E5Q A;  4ZH4 F;  1I1G A;  1R58 A;  2EV0 A;  4CGZ A;  3C7J A;  1IRG A;  3CDH A;  5A2Q K;  2R7D A;  2UXX A;  2EA2 A;  1TQP A;  2F5C A;  2JTV A;  2KIU A;  4KIF A;  2BE5 F;  1G6N A;  2H09 A;  4KN7 X;  5FD5 A;  3HUG A;  5L3D A;  4EGY A;  3ELK A;  3E6M A;  3CUQ C;  4L9N A;  3QP6 A;  3EET A;  3F8B A;  2DT5 A;  2YR2 A;  3HTU A;  4FX0 A;  1ZHF A;  3RKW A;  2COM A;  3LST A;  1LDK B;  3CJN A;  3TGN A;  1DDN A;  5HLI A;  1J59 A;  4G7O F;  5K1Y A;  3KEQ A;  1X3U A;  2GQQ A;  3JW4 A;  2HTJ A;  1REP C;  3BPV A;  2F5D A;  3F8C A;  3Q9V A;  4ZZD A;  2DQL A;  2Q2E A;  3REO A;  1T39 A;  1J0R A;  4BAY A;  4GO1 A;  1MZB A;  4M72 A;  5HS8 A;  4R8H A;  4KA4 A;  3E3V A;  3K9T A;  1S29 A;  3QP5 A;  4EV0 A;  5H6Q A;  1VTN C;  4QWQ A;  5DUI A;  2JPC A;  4BHB A;  3FXR A;  1B4A A;  3LAP A;  5HDK A;  3F72 A;  1UCR A;  4UUV A;  5FD6 A;  3LAJ A;  1JE8 A;  4OIO F;  1TW2 A;  2EB7 A;  3BZ6 A;  4LLL A; 
#chains in the Genus database with same CATH topology
 3BJO A;  2DMN A;  4DIQ A;  3FM5 A;  2IGM A;  4IPA A;  3KYL A;  2JVH A;  3OYJ A;  5FFX A;  2UV1 A;  4BBS J;  3ZQ7 A;  3VYR B;  2DDA A;  2OQG A;  2P0W A;  2HI3 A;  4W1U A;  1MH4 A;  3AG1 H;  1GHC A;  1IUF A;  1P7J A;  1LE8 A;  2DN0 A;  2B7E A;  5LD2 C;  1VQK I;  4G9Y A;  3RQ4 A;  2XAQ A;  2IA2 A;  1I50 J;  4XRM A;  1OYW A;  1WRJ A;  2LDU A;  1ETX A;  3L7W A;  1SAU A;  2PQ8 A;  5JR3 A;  4L18 B;  4AC0 A;  5FLX Z;  3OYC A;  2M30 A;  3GWZ A;  5K5Q A;  1OCR H;  1O7F A;  4YEJ A;  2MW8 A;  2QSH X;  3WE2 A;  2JMW A;  2K27 A;  3PIP F;  4G7H F;  5DDG A;  3FXO A;  4DYR A;  1IZ1 A;  3GTG J;  3ML6 A;  1B8I A;  3OS1 A;  4XLF A;  1O3Q A;  1C0W A;  1NH3 A;  4Y7N J;  4IOC F;  1AWC A;  1TZL A;  2EIK H;  3KET A;  2FMY A;  3MZY A;  4EJT A;  4V2F A;  1IN8 A;  5DV5 A;  5F27 A;  3ABT A;  3S3M A;  3LWF A;  1FPQ A;  1K4T A;  2HDD A;  3RCO A;  4CO8 A;  1W7P D;  1RKW A;  1OCC H;  3EUH A;  3HGY A;  1DU0 A;  4A6D A;  4BH9 A;  4DYQ A;  2G9W A;  2A69 F;  3Q0V A;  3A01 A;  5B3S H;  1S5L C;  4H0E A;  2XAG A;  3AAF A;  2A6E F;  2F48 A;  3GTM J;  2JPB A;  5DUK A;  2ECC A;  5LHH A;  1RET A;  1HQC A;  2Z9O A;  4XL9 A;  4EJV A;  1R5G A;  3NWS A;  3F23 A;  1A6I A;  2DOD A;  4M6V A;  2HDC A;  3FXK A;  4HX7 A;  3KE2 A;  3ERE D;  3P9I A;  3E97 A;  3ZQF A;  3G1L A;  3JRH A;  2LKS A;  2KZG A;  1X4P A;  4UHT A;  4CYC B;  2OZ6 A;  2XIG A;  5DCF A;  2X48 A;  5M5X J;  2OTJ I;  2W85 A;  4ASN A;  1FYK A;  1IN7 A;  1BBY A;  1U9N A;  4ON0 A;  1GXQ A;  2XAU A;  3BR3 A;  1Z7U A;  3BR1 A;  5FKN A;  1WVR A;  1G3Y A;  2HTS A;  2UZK A;  2UUZ A;  5BOX A;  1FJL A;  1MDM B;  2LY9 A;  1KQ8 A;  5D8K B;  1ZR2 A;  4LIT A;  5GPC A;  2E7X A;  4M3F A;  3OL3 A;  1T6S A;  4HAM A;  1K4S A;  1W7P A;  2ZXW H;  1X3W B;  3LSG A;  2D1V A;  4L5I A;  2VN2 A;  1EF4 A;  4XOT A;  2OD5 A;  1AKH A;  2I8D A;  2VLA A;  1YIT I;  2VJ5 A;  1HDD C;  3JAM Z;  3DBH B;  1ZRC A;  3V7S A;  3OYM A;  5CPR B;  3GO5 A;  1VFC A;  4QPQ A;  4FCY A;  1NG7 A;  3DPL C;  2XRN A;  1KU3 A;  4WX9 A;  2V7F A;  1R00 A;  4JYK A;  2Y69 H;  3I59 A;  1YW7 A;  3HSR A;  2EIJ H;  1QVT A;  3KPH A;  1IUY A;  4PSW A;  1LVA A;  2TDX A;  4HZF A;  4NDL A;  3TOB A;  3QPH A;  3BJ6 A;  2HVR A;  2GM4 A;  3DF8 A;  1CF7 B;  4FT8 A;  4NQW B;  2DU9 A;  2P4W A;  4M9Z A;  2P81 A;  1WJC A;  4XLA A;  4AUX A;  4G7Z F;  2YUS A;  5HDN A;  3FXQ A;  1HKS A;  4KIS A;  4ZYH A;  1W36 C;  2E19 A;  3HGG A;  1KQ0 A;  2L9R A;  3R0A A;  1WQ2 A;  2PN6 A;  1FZP B;  1X1P A;  3ZQI A;  3CJQ B;  1P9Q C;  1DUX C;  1BJA A;  2M35 A;  1B9N A;  4B47 A;  1NK3 P;  2DTZ A;  1IG7 A;  1U5T A;  1FMV A;  1JT6 A;  2DQR A;  4OMY A;  2WAD A;  5K5R A;  1BI3 A;  5FRO A;  3HDD A;  3ZCO A;  1OCZ H;  5JVT A;  4OIN F;  2XGX A;  5E1Z B;  1U8R A;  2YSR A;  2A5Y B;  3SFI A;  1YJW I;  1GT0 C;  2GIV A;  3RQI A;  3TO6 A;  3PO2 J;  4BQA A;  1WJE A;  3DKX A;  2LC2 A;  2FJ1 A;  4JQF A;  2R7X A;  2O61 A;  1D8J A;  4WXC A;  1FY7 A;  2MBF A;  2DT6 A;  5LLQ A;  3F3X A;  4UV8 A;  5DCM B;  3K2A A;  1H88 C;  2V1N A;  1LKX A;  1MMA A;  2VKV A;  4UUT A;  4CCO A;  3CTA A;  1YRN B;  1Z91 A;  4Y15 A;  1IAW A;  4CYC A;  4HDV A;  1MW7 A;  1S6L A;  4ZJZ A;  2E60 A;  1YYV A;  3TW7 A;  1R5H A;  3GFJ A;  5EEG A;  3J81 K;  4P9U A;  4ENK A;  1POG A;  4A3F J;  2K9S A;  3QOP A;  2R7T A;  1J9I A;  5L3C A;  4IOA F;  1MDM A;  5HS7 A;  4HLY A;  1B9M A;  2B63 J;  5IT9 Z;  2CUF A;  3I9V 2;  1O7L A;  2BHY A;  2JVG A;  2WB1 A;  5J6X A;  2MC4 A;  3UNG C;  4C2U A;  2VT3 A;  3OS2 A;  4ETS A;  3N97 A;  2OCC H;  3F0C A;  3IWZ A;  3S2H J;  4A5N A;  2WAF A;  2NNN A;  2DW4 A;  3H3Z A;  1F5T A;  5HVQ C;  2HOE A;  3SEQ A;  1BR2 A;  4FIS A;  2PJR B;  2LP0 A;  1FSE A;  1VND A;  1ZYR F;  1V5E A;  4XOR A;  3ZMS A;  2H6C A;  2RNJ A;  3FIS A;  3CMY A;  3VYT B;  1X19 A;  5D5W B;  4AID A;  2BW3 B;  5HNH A;  2HFH A;  2ZJP F;  3TKY A;  2CQQ A;  2CW8 A;  2EZI A;  2NS7 A;  1FIA A;  4DYC A;  3CCE I;  4AM3 A;  3DEU A;  1WGX A;  2IRF G;  4A3E J;  2LH9 A;  1A31 A;  2KL4 A;  1XG1 A;  1NHA A;  1CF7 A;  2H1K A;  1ERD A;  1JI8 A;  2HKO A;  2W48 A;  2NAZ A;  2Y0S N;  2A6H F;  4ZYA A;  3TOA A;  3BG3 A;  2VC0 A;  1KZH A;  1SFU A;  1ZAR A;  2XF6 A;  3Q0W A;  2F2E A;  5KVR A;  2ZSI B;  3RYP A;  2FBH A;  2DA5 A;  4UVB A;  2LTP A;  1ETV A;  3WU1 B;  1IDY A;  4Q48 A;  1X1C A;  2FNA A;  2FXA A;  2L9V A;  3S8P A;  2X1E A;  3ZMV A;  3WTV C;  2DAO A;  1ETY A;  1BN5 A;  5J1R A;  3VSK A;  3G1M A;  1Y56 A;  3HSE A;  4BEH B;  2OBP A;  4KFC A;  5JFR A;  4YFN F;  4Q47 A;  1OCT C;  2BHZ A;  3DKW A;  4ABZ A;  4BUP A;  4XLP F;  1NTC A;  3LSM A;  3V8L A;  4PJN A;  4Q5S F;  1DGR M;  3MZH A;  4TV7 A;  1XGM A;  4BJ6 C;  4C3J J;  3KIO A;  1TWA J;  1ETW A;  2JUC A;  1HC8 A;  2IAI A;  2HR3 A;  5DCM A;  2W1O A;  1QO0 D;  3S2D J;  4D5C A;  1V55 H;  4A3L J;  3WTT C;  3CP2 A;  1YRN A;  5JI6 A;  4D0P A;  4U7D A;  4B44 A;  2ACJ A;  1K79 A;  3GFL A;  2FX0 A;  2HU9 A;  4BYY A;  2QLZ A;  5EZH A;  3VEP A;  4C2T A;  5BMZ A;  1ACI A;  4ZDP A;  1FX7 A;  2NRA C;  2FE3 A;  3LQR A;  3E5X A;  3Q0U A;  4JX5 A;  1QNT A;  3M7G A;  2EFN A;  2XRL A;  1OMI A;  4II2 A;  4FE4 A;  1A36 A;  2CS3 A;  3OIO A;  2ISZ A;  2IS4 A;  3BR2 A;  2CFO A;  3PJR A;  4A3G J;  3FXL A;  2ZSH B;  5GPA A;  3WOD F;  2CRG A;  3CMA I;  1YW9 A;  5DTD A;  2VT2 A;  5J3L A;  5JLX A;  2V79 A;  1XSV A;  2Z1D A;  4B8X A;  4H4K C;  3EYI A;  1U78 A;  4MQV A;  3HOW J;  2E7W A;  3IH3 A;  3NRV A;  4LB6 B;  2VJI A;  1BM9 A;  3ESW B;  5FGM A;  1T95 A;  3OS0 A;  1Z1D A;  1OIS A;  2BW3 A;  3OYB A;  3DXJ F;  3F22 A;  4E7I A;  1K61 A;  2M7A A;  1AOY A;  2O8K A;  3MWM A;  2KRF A;  3R61 A;  2ZNZ A;  3H0D A;  4BHC A;  4HX4 A;  5H20 A;  2EZH A;  4HSR A;  2HGC A;  3A4C A;  2M2E A;  3K4K A;  3M1E A;  5HOD A;  2MUN A;  2VUM J;  5L3F A;  2I10 A;  3NWT A;  4RGS A;  2WV0 A;  2OC6 A;  1IF1 A;  2YX7 A;  3CUQ B;  3IC7 A;  3DTE A;  3BZK A;  2M7B A;  3E6D A;  3H1C A;  4EM2 A;  4X0G A;  3LA7 A;  3S1N J;  2EFP A;  1B6A A;  4X6A J;  1UG2 A;  4S04 A;  2WBM A;  1OCP A;  1TWF J;  1X58 A;  4A0Y A;  5IT3 A;  2PLY A;  3A2K A;  5KK1 A;  5IY5 H;  1R22 A;  3PSI A;  1SD4 A;  4DBR A;  1P4X A;  1PYV A;  4E4H A;  2ELK A;  1YS7 A;  2CJJ A;  2QYO A;  2DFE A;  4E7H A;  1SFX A;  5LEK A;  4BEH A;  3H35 A;  2E1N A;  2C6Y A;  5C44 J;  1MD0 A;  3R6S A;  1VQ7 I;  1DGW Y;  4IRI A;  1VQL I;  2QGU A;  2HKX A;  1BA5 A;  1N25 A;  2NXN B;  1IRZ A;  1W5T A;  3QPS A;  2XAJ A;  4HF0 A;  1K78 B;  2STW A;  2HQN A;  3FIW A;  1QRY A;  4P9F A;  1ZRE A;  3BCA A;  2IBD A;  3EPZ A;  2F4I A;  2R7O A;  2Y0M A;  3J7Z I;  3LA2 A;  4BXX J;  1JJ8 C;  3F6V A;  1FBU A;  5DS9 A;  1S8N A;  2MH2 A;  5E3O A;  2BVM A;  4RGR A;  5D4S A;  2GXA A;  1T0F C;  3RSN A;  1RUO A;  1UZC A;  2BEO A;  4XKW A;  1T2K A;  4JX6 A;  2XSJ C;  2RV8 A;  1VQ8 I;  2BY1 A;  2KT0 A;  2X6O A;  1IXR C;  1PP7 U;  1WPK A;  5DM6 F;  1KU2 A;  1SEU A;  2BV6 A;  2HYG D;  2ZXJ A;  4ZDO A;  1QU3 A;  3GFM A;  1E17 A;  5EZG A;  2XF7 A;  3C2G A;  2NOG A;  2DK5 A;  2DBB A;  3CUO A;  3OYN A;  2A07 F;  3H5N A;  3MMY B;  4C2M J;  2W82 A;  5A2Q Z;  3U9G A;  1QZE A;  3FHZ A;  2Z16 A;  4UNO A;  4OOI A;  1LEA A;  3G3Z A;  4M71 A;  1YS6 A;  2K5C A;  3TED A;  3ASO H;  4HW0 A;  4S0H B;  3ISP A;  2YU9 J;  2L7Z A;  2H94 A;  3SXY A;  4CHU A;  2DK8 A;  1GVD A;  2NVQ J;  2HYF A;  1G3S A;  5FKK A;  1Z6T A;  4PJL A;  3SZT A;  4XON A;  2L3D A;  1I3Q J;  2P7C B;  1D1C A;  1WJB A;  2V26 A;  5EGO B;  2LFB A;  4JP0 A;  2NS0 A;  5E20 A;  1MMD A;  2WTE A;  1FTT A;  1A04 A;  2XAF A;  3K1M A;  2GXG A;  3P9K A;  5GAG J;  4MTD A;  1MNM C;  2R3S A;  3FKI J;  4BL0 B;  4CCK A;  4G8X A;  3CUQ A;  4XKV A;  3T8R A;  3IWF A;  5IPA A;  2J5O A;  3NEU A;  1ZH5 A;  4XQF A;  2G7H A;  1JT0 A;  4F3Q A;  1H9G A;  4GGG A;  5D4R A;  1FWZ A;  1QHH D;  4HYE A;  3BG5 A;  3S1Q J;  1WH5 A;  2DMT A;  4P55 A;  4O3M A;  2DA7 A;  2E1C A;  1VQN I;  2FD5 A;  2XKO A;  2K9Q A;  5CQG A;  2D45 A;  2DO7 A;  4K2E A;  2O8X A;  4GYI A;  4M3D A;  2KQR A;  4WXD A;  2KIM A;  3C3W A;  6PAX A;  3A02 A;  4YEL A;  4O6J A;  1JHF A;  1K78 A;  2NS8 A;  3SDG A;  2XPV A;  2JZY A;  3PNV A;  1P92 A;  2H1L A;  2J5P A;  3K1N A;  4YIF A;  3TMO A;  2V1U A;  2HZT A;  2PMH A;  1GV5 A;  5J8C A;  1SD6 A;  4WF2 A;  2IS1 A;  3QU6 A;  1G3W A;  2WAQ A;  5JVG F;  5CVI A;  2L54 A;  3IKT A;  1I6H J;  3FHN A;  1X1A A;  4EQQ A;  3S3N A;  2OTL I;  5AIP A;  4D7N A;  3TW6 A;  3AL0 B;  1F43 A;  2DA6 A;  3EQL F;  1CQT A;  2RGV A;  4BE1 A;  3H9G A;  5BQT A;  2HOT A;  3CJR B;  3ZN1 A;  2DOF A;  2KRH A;  2LOO A;  4XKC A;  1KGS A;  4DNC A;  3QPT A;  4MTE A;  3SZG A;  3ULQ B;  4IHW A;  2F5V A;  3PQJ A;  1KQ9 A;  3FXU A;  4RGX A;  3HL2 A;  1YIO A;  3FK7 A;  3RI4 A;  4BY1 J;  5ILS A;  4NHJ A;  4XIC A;  4ZYD A;  3RIR A;  1NK2 P;  2IPQ X;  1Y1W J;  3FMQ A;  2KHM A;  4GXO A;  1WHU A;  4IJA A;  5DEQ A;  1D5Y A;  2DJN A;  5EGO A;  4BJ5 C;  3OL4 A;  2H8R A;  3M9A A;  4EJO A;  4OU0 A;  2PG4 A;  2L4M A;  2JA5 J;  3QRF F;  2E2H J;  4PZJ A;  5B1A H;  4RLF A;  2X98 A;  2Z2S B;  1V4R A;  2E1O A;  2ZO4 A;  1PVE A;  4OAY A;  3VPR A;  3JTG A;  4IQ4 A;  1W0T A;  4AD9 A;  1ZGW A;  3HOY J;  2LYC A;  4Z2Y A;  4CDG A;  1GXP A;  4M3G A;  1A6Q A;  2EPF A;  1BJZ A;  4KUM A;  4NBQ A;  5DM7 F;  4BGD A;  2PEX A;  1DQU A;  3GZ6 A;  2A5W A;  4FQG A;  2ZME C;  4DOZ A;  3CME I;  3HRM A;  2STT A;  3F8M A;  1SAN A;  2JA2 A;  2OAZ A;  3GZ5 A;  2A3S A;  1JUP A;  4KMF A;  1IN4 A;  1U6G A;  5HOO A;  3JRF A;  2HWV A;  2XGD A;  3H0G J;  5CKT A;  1M1E B;  1XGS A;  2KIS A;  5BS6 A;  3HIF A;  3IP4 B;  3GX4 X;  1EA3 A;  1DU6 A;  4L9T A;  4DZP A;  3ABL H;  1WJA A;  3HOT A;  1FNN A;  4DBQ A;  1YJN I;  4U0W A;  4IKF A;  1FYM A;  1JHH A;  1W5C C;  3I0T A;  4B3X A;  4RB1 A;  2Z33 A;  4IEJ A;  3WTZ A;  3RZO J;  3OIP A;  4CXF A;  1PUF B;  4FX4 A;  2HQ5 A;  4PJ0 C;  3LQQ A;  1XS9 A;  1XMK A;  3GEZ A;  1UHW A;  4ZZL A;  5IYC J;  1W0U A;  4N9H A;  1K6Y A;  1BI2 A;  4IRG A;  2IVM A;  3IAM 2;  1WSU A;  1JKP C;  2CQ7 A;  4N4N B;  2EV5 A;  1I5Z A;  3HXL A;  4NC8 A;  2GBY A;  1SD7 A;  4WXH A;  1S9H A;  3L2U A;  4OWR B;  1F4K A;  2W57 A;  2P5V A;  3JAM R;  4UVC A;  3DV8 A;  3NQO A;  3CO6 C;  2X51 A;  1B72 B;  1OYY A;  2ZNY A;  1H89 C;  2E5N A;  3CCM I;  2V9P A;  3GCM A;  3J80 K;  1LDJ A;  3CCY A;  1DP7 P;  2VE8 A;  3L9F A;  2VKD A;  4EM1 A;  1W36 D;  2BGC A;  3HYI A;  1J2X A;  2ELJ A;  3QYB A;  1P6R A;  1P4W A;  4MO7 A;  5FB2 A;  1T33 A;  2VKH A;  2YPR A;  1I3A A;  2MAB A;  2R5Y B;  1V54 H;  3GW2 A;  4HA8 A;  1PDN C;  3AL0 C;  1GUU A;  2K02 A;  2Y9Y A;  2IA1 A;  2K9N A;  3V8J A;  1OLT A;  3SYT A;  4ESF A;  3S1R J;  1XB4 A;  4MIM A;  4PUS A;  3CES A;  4ENJ A;  3NAU A;  1SFO J;  1G2H A;  2MH9 A;  2BZT A;  3GVA A;  1HCR A;  4PDK A;  3ZQL A;  3KLO A;  1YW8 A;  1LFU P;  1OR7 A;  4WCG A;  3IRR A;  2CQN A;  2CUE A;  3VB2 A;  4PGG A;  3KZZ A;  4N0B A;  2B0L A;  4LIU A;  1TQM A;  3OYF A;  5M5W J;  4UB6 C;  1ORK A;  2JRT A;  3ECO A;  3JRI A;  2HEO A;  2QA4 I;  4KIG A;  3ZGK A;  2R93 J;  3PO3 J;  2K3P A;  4UXN A;  3OY9 A;  1HF0 A;  1FIP A;  1UHM A;  4XLH A;  2B9S A;  3DFG A;  5ICG A;  3ZMT A;  4BKX A;  4I0B A;  2DMQ A;  2X1C A;  3MKL A;  4C3H J;  1D0X A;  2RAE A;  5E1X A;  4FET A;  3GUD A;  1ULY A;  3DCF A;  3OIQ A;  3N4M A;  1OR7 C;  2OV7 A;  1XGN A;  1RUN A;  2DMP A;  5KAI C;  2JA7 J;  3CF5 F;  3CCJ I;  3HEF A;  5FKM A;  4CZZ A;  2CV0 A;  2DTR A;  3BTI A;  2IGK A;  3I71 A;  3GZN B;  4D5F A;  5LFA A;  3WTS C;  3VFZ A;  2DA1 A;  1Z3X A;  2M9H A;  4XN3 A;  4BQN A;  1PUF A;  1MJB A;  3OR1 C;  4N9I A;  4AWX B;  2X6Y A;  2HXO A;  5J4V A;  2LBF B;  3OYA A;  2GAU A;  3B73 A;  3JSP A;  2CQX A;  3TO9 A;  3J81 Z;  5IT9 R;  3DEW A;  1B1B A;  1S7O A;  4MGR A;  4EM0 B;  5HS9 A;  2DPU A;  3BQY A;  2Z99 A;  4BBR J;  1ZTR A;  1VQ4 I;  1OCO H;  2CYY A;  2OJE D;  3HRU A;  4RB2 C;  3UKG A;  2PMZ A;  3FKJ A;  1QQI A;  5DD8 A;  3PFY A;  4BDZ A;  3O8H A;  2QQ8 A;  1B72 A;  1OQY A;  3KP6 A;  3L1P A;  4HF2 A;  3DLL F;  2KIF A;  2OA4 A;  1D5V A;  2XB5 A;  1HKQ A;  2VIX A;  4RGU A;  1WI3 A;  2TCT A;  3H3U A;  2FQ3 A;  2K4B A;  4ENN A;  1MKM A;  1TQI A;  3A0H C;  2PJP A;  1W5S A;  3JRG A;  5CYV A;  4BAC A;  5CVR A;  5K5O A;  2R5Y A;  3KFW X;  3MAJ A;  1OPC A;  4GCV A;  5LEJ A;  4NC6 A;  3WHB A;  5IYD J;  2N8G A;  2O9L A;  3J7A W;  3ROU A;  2DYR H;  4AYB A;  1I27 A;  3JRD A;  4HQE A;  1ODD A;  4XM3 A;  4KMU X;  3JSO A;  1J7K A;  2EWN A;  1I6X A;  4CCL A;  3T5X A;  1VI0 A;  1Z6R A;  3FWE A;  3FXM A;  5CLS A;  5KHD A;  1Z77 A;  1YFH A;  1TNS A;  1ZKG A;  1IN6 A;  3OYK A;  3HOZ J;  4U0V A;  4YIR X;  1AHD P;  2KDZ A;  4HV6 A;  2IW5 A;  5B5E C;  3FF5 A;  1BI1 A;  1TL8 A;  4XRF A;  2YX4 A;  2HQA A;  4S05 A;  3VOE A;  4I0A A;  5IP7 J;  2DDB A;  3A1Y A;  1ZRF A;  3S17 J;  3M8J A;  1U3E M;  4BDY A;  2R7S A;  2RQP A;  5LHI A;  2FRH A;  3AG3 H;  3HPH A;  1BIA A;  1P7I A;  4HOB A;  2M87 A;  3H9J A;  2FOK A;  4IHT A;  3OV8 A;  2VI6 A;  4ZDL A;  1E3H A;  3JRA A;  1R1T A;  3ECH A;  2HOS A;  4J00 A;  1RZ4 A;  3VYS B;  3K4N A;  5J47 A;  4MEY F;  5IYB J;  4B1R A;  3C2B A;  4L0Y B;  3V4G A;  3KP3 A;  4E6K G;  2EK5 A;  2EQR A;  5C3E J;  2LKP A;  4PSX A;  1XN7 A;  4NQW A;  4HNV A;  3MEX A;  4BE0 A;  1IXS B;  3QOE A;  1BIB A;  3KZI C;  2VKE A;  4LG0 B;  4FHT A;  2LBF A;  1SFE A;  3W2V A;  1MJ9 A;  4OAZ A;  2XGE A;  3I5U A;  2ZXH A;  2P7V B;  4G94 A;  2O03 A;  3QQA A;  3T1B A;  3CCQ I;  3KP4 A;  1HOM A;  3WTX C;  2PMU A;  4JOM A;  1F36 A;  2ID6 A;  5FLM J;  3HOX J;  4AIK A;  2VBW A;  3KEO A;  2Y48 A;  2RDP A;  2L4A A;  1ON2 A;  1UG0 A;  2FBK A;  4A0Z A;  4Y13 A;  4ZTJ A;  1G4D A;  2EA4 A;  4KN4 X;  4L5J A;  3E0J B;  2GA1 A;  1IO2 A;  2GZW A;  1A5J A;  4M9S A;  1UB9 A;  5E8G A;  5E3L A;  1YE9 A;  1MMS A;  2MZ4 A;  4OIR F;  4ZYE A;  4EAT A;  3GTO J;  4MFD A;  1RPW A;  2E35 A;  5E8I A;  4LD5 A;  2MYS A;  5ILU A;  2O7O A;  4HDU A;  1R7J A;  2NVU B;  3U1K A;  3ZPL A;  1V5F A;  3V8K A;  4QPO A;  4Y4R A;  1XMX A;  4BNC A;  3TP3 A;  1HW1 A;  4JBA A;  1R1V A;  3SHF A;  2MLK A;  1UEL B;  1BC8 C;  4HNU A;  2AO9 A;  4DZJ A;  3RPU A;  4KT5 C;  1RR8 C;  5EJC A;  4XRS G;  1TBX A;  4LLN A;  2IJL A;  3BP8 A;  3WTW C;  1XC5 A;  3OWT A;  4M9X A;  4XNF A;  3I53 A;  3BG7 A;  2PJR A;  4BXU A;  4UV9 A;  4PCQ A;  2WAE A;  3EDP A;  1QVU A;  3MCZ A;  1FYL A;  5IP9 J;  2MLG A;  2LY2 A;  4Y3O A;  3A03 A;  1XDU A;  4XLN F;  3IUO A;  3QPL A;  4D7M A;  4E7S A;  2EZL A;  1Y6I A;  3MKY B;  3TDZ C;  2K9L A;  3ASN H;  4F55 A;  3IL2 A;  2QQB A;  3CCS I;  1Y39 A;  1S72 I;  1R9T J;  3K0L A;  3IKV A;  2GOX B;  1T56 A;  2HXI A;  3IAS 2;  3FMR A;  2W00 A;  3D5L A;  4UVA A;  3CP8 A;  1VQM I;  2M0M A;  2BOL A;  3C2H A;  4A69 C;  1L3L A;  1XPX A;  3M3Y J;  3WHC A;  4YFK F;  4HEA 2;  3HHG A;  3PUB A;  2EZK A;  1YG2 A;  5ERI A;  5KAF C;  4CCN A;  4M74 A;  2XSD C;  1STZ A;  2DOE A;  1HXD A;  4BHP A;  3OMY A;  4C3I J;  1QBJ A;  1FEX A;  3D1N I;  5FJ8 J;  1R5I D;  1T0F A;  1UHS A;  4GYG A;  2KKO A;  1RQ6 A;  1OYI A;  1WJF A;  3ZQC A;  2XF5 A;  3ZXS A;  2ZXI A;  3E6B A;  4PFP A;  2V1D A;  1MIJ A;  3CC4 I;  2E2I J;  1BI0 A;  3WGG A;  2XUB A;  1XCB A;  2GXB A;  3E1S A;  1KA8 A;  1Z9C A;  3S93 A;  1U2W A;  1Z21 A;  4I7H A;  3G1O A;  2K40 A;  4RAY A;  2X85 A;  1JXS A;  5LRS A;  3W2W A;  2LG4 A;  4KIC A;  3V7R A;  4HG2 A;  2NVX J;  3BOQ A;  3F9K A;  1U8B A;  1ETO A;  3HOV J;  3RYR A;  3KX2 A;  1R4M B;  4AVZ A;  2ECB A;  2IT0 A;  2V1X A;  3G73 A;  3LFU A;  1ZLJ A;  5J8F A;  2A6T A;  4RM3 A;  5ED4 A;  2KMU A;  3S32 A;  4HRI A;  2VQG A;  3FDY A;  3FK6 A;  2KFD A;  2X9D A;  4MFE A;  1FOX A;  1S3J A;  4D9J A;  4HF1 A;  2HVS A;  2QQ9 A;  1Y0U A;  2BY2 A;  4C30 A;  5TJJ A;  5E3N A;  1ETQ A;  3OYG A;  3H9Q A;  1N78 A;  5ICF A;  1IRF A;  5FRM A;  3LFK A;  1FSH A;  4GFB A;  2HNH A;  2GWR A;  4RM2 A;  3GTJ J;  3HPG A;  5FKO A;  3H3V K;  1IXC A;  2DCE A;  4UB8 C;  1BL0 A;  3KCC A;  1FTZ A;  2KRC A;  3QYF A;  3AKZ A;  3P9C A;  3M8F A;  1TWG J;  3PUF A;  1D1A A;  2RKH A;  2VPR A;  2VQC A;  3LA3 A;  5L3G A;  2KJC A;  4IXA A;  3T0Y A;  1WH7 A;  1FP2 A;  2R92 J;  1X1D A;  4U7B A;  2F4O B;  2R7R A;  2ESN A;  4L0Z B;  3Q9S A;  3HM5 A;  5C4X J;  3F21 A;  1I1S A;  2XKP A;  1H8A C;  2ZME B;  3RPQ A;  4XRS A;  3WTY C;  3GBG A;  1XGO A;  4KT6 A;  2R7Q A;  3CZ6 A;  5KCM A;  2LF7 A;  1DPU A;  2ZFU A;  3BRO A;  2RC4 A;  3ZRG A;  2QZ8 A;  2QM3 A;  4KDP A;  2WV1 A;  2RNG A;  4CUG A;  2CFX A;  2MSY A;  3G6E I;  4RMN A;  1JUS A;  3MD2 A;  1AA7 A;  2Z5U A;  1LFP A;  3OYE A;  2VBZ A;  2CGP A;  4XKB A;  1JGS A;  2R7F A;  1L0O C;  3DU5 A;  2PBI A;  2CV2 A;  5D5V B;  1Z05 A;  4EEF G;  3B02 A;  1MH3 A;  1R23 A;  1O3S A;  3CF2 A;  5M3M J;  2CUZ A;  4IF4 A;  2KPM A;  1X2N A;  4RLQ A;  1LB2 A;  3KP2 A;  2VL8 A;  4KIT B;  3GYH X;  1GV2 A;  1HST A;  3LSH A;  5IP6 A;  4Y52 J;  1VQ6 I;  1GDT A;  4B3A A;  3GTK J;  2OCE A;  2P6T A;  3HC7 A;  3WU0 A;  4I09 A;  3SEZ A;  3BR5 A;  3KYD B;  5HDG A;  1ZR4 A;  3V42 A;  3AG4 H;  2WA0 A;  2PMZ N;  2R0Q C;  4IHV A;  3LNQ A;  2LY1 A;  3I4N J;  1IC8 A;  4N4O B;  2LR8 A;  3HRS A;  4A2U A;  3KEY A;  3ZQG A;  4IX7 A;  3GXO A;  2X0L A;  3CDI A;  4NUB A;  3KP7 A;  3ZN0 A;  2L5Q A;  1ZG3 A;  3I3L A;  2QEN A;  4NC7 A;  1BR4 A;  3BZC A;  4LOC A;  2VXD A;  4U88 A;  2Y75 A;  1H0M A;  1BR1 A;  1WKM A;  4ENM A;  2QWW A;  3EYY A;  2QBY B;  3M1C A;  4A3D J;  2RRE A;  1SMY F;  1LNW A;  5D6F A;  1RI7 A;  2QF7 A;  5M5Y J;  2W25 A;  2TRT A;  2XAH A;  2KDO A;  2A05 A;  3HHH A;  3ABK H;  4IHS A;  2R5Z B;  2QSF X;  2VON A;  2Y0S A;  1QA6 A;  4EJW A;  2VJJ A;  3BWG A;  2JA8 J;  3BLY A;  3JR9 A;  5L3E A;  5J1Y A;  1J75 A;  3PM1 A;  3BY6 A;  1W1W E;  2HDW A;  3K6G A;  2EFO A;  2EFW A;  2WC2 A;  4I98 B;  5F0H A;  2WB1 N;  3H5R A;  3CC2 I;  4PGH A;  1YI2 I;  2FQ4 A;  3ERM A;  1MMG A;  2L7K A;  1TNT A;  1USS A;  3ZQH A;  2X6X A;  4DW6 A;  4MHG A;  1XMA A;  5JHU A;  3CO7 C;  1IW7 F;  1B59 A;  2ZME A;  3K4M A;  1R36 A;  5FLX R;  4HV5 A;  2XB0 X;  3RKX A;  1WZ2 A;  3K70 C;  1SAX A;  5GTI C;  2QCO A;  1FT9 A;  3JTH A;  2DYS H;  5L3B A;  4IQJ A;  2K3F A;  5HNF A;  1MBF A;  2AS5 F;  1TT0 A;  4OIP F;  3S1M J;  2H27 A;  2MC3 A;  3K1P A;  3QAH A;  5BPI A;  4L5E A;  2PI0 A;  5LGU A;  2M8E A;  2UWM A;  1N75 A;  1VF9 A;  2VC1 A;  1EH6 A;  3PFI A;  2NYX A;  1D0Y A;  4UUS B;  4CZC A;  3WGI A;  2R7W A;  2M34 A;  2HPM A;  3GFI A;  1R6R A;  5CQE A;  2ZFW A;  3U2R A;  2K86 A;  4XLE A;  1ZK8 A;  2Q0O A;  3MN2 A;  3MQ0 A;  2JK3 A;  1MBG A;  3GLX A;  3WE3 A;  4RS8 A;  3VSL A;  4EVI A;  3SQN A;  2CUJ A;  2LSO A;  3ABM H;  1SVO A;  3K2Z A;  3OOP A;  5HLH A;  5FRN A;  2PX9 A;  1F1Z A;  3FBN B;  2OQR A;  1J5Y A;  4QTR A;  2CWE A;  2WWY A;  2JN6 A;  3CLO A;  1FBQ A;  2AXT C;  3DLA A;  2F5F A;  3DBL B;  3J80 Z;  1W7P B;  2G7U A;  5F0F A;  1MSE C;  3S15 J;  3FMS A;  2FOW A;  3LMM A;  5E1W A;  3ZR8 X;  1RES A;  4B48 A;  2HS5 A;  2JSP A;  3OYL A;  2Q8K A;  1ON1 A;  1T08 B;  2F5E A;  3I64 A;  3W3C A;  3MKW B;  3L2Q A;  3OYI A;  1E2X A;  2QKM B;  2UXN A;  4NB5 A;  2QBY A;  4E7Z A;  2DA4 A;  1RNL A;  3VDX A;  4IHY A;  4RB0 A;  5H2F C;  3I59 B;  2L02 A;  2R5Z A;  3TL4 X;  1HBX G;  3K4J A;  1EKE A;  3ZMZ A;  3E5U A;  1HA8 A;  2ISY A;  1J09 A;  5E17 F;  4DGW B;  1D8K A;  2XV4 S;  4BS9 A;  2JT1 A;  5F0C A;  2GOM A;  4P96 A;  4HQM A;  4CSW A;  2VOD A;  2VBY A;  4PK4 A;  2ZKZ A;  2VE9 A;  3RTR A;  2XGC A;  5TGT A;  3I4M J;  3RZD J;  1XDS A;  2OUM A;  2P0T A;  4M6Y A;  1TT5 B;  4LMY A;  4LLG F;  5ICE A;  1APL C;  4U0Y A;  1PUE E;  4RA2 A;  1HSJ A;  1DPR A;  2L2O A;  1QGP A;  1X4O A;  3HOS A;  4IO9 F;  4WWC A;  1SVL A;  4FTH A;  2ZCW A;  3J7Y J;  3U1D A;  1RRJ A;  1JKQ C;  2HYJ A;  1U5T B;  2Y2Z A;  1G8X A;  3A0B C;  3O6B B;  2KIQ A;  2M4K A;  2FBI A;  2ICW G;  4LJZ F;  4BXF A;  4ESB A;  1ZN2 A;  2OZU A;  2L9S A;  1ZRD A;  3RKY A;  4BE2 A;  1SMT A;  3CC7 I;  3I58 A;  5BPD A;  3J81 R;  2NOJ B;  5FLX K;  1TLH B;  5H6R A;  1KON A;  1F9N A;  4CCJ A;  1ZLK A;  3HJE A;  1IRX A;  5E3M A;  1VQ5 I;  3I4P A;  2ELH A;  4UUS A;  3ZQQ A;  2ADU A;  3KP5 A;  2RQQ A;  3RJP A;  5GTH C;  1E3O C;  4KJZ A;  4LK0 F;  5CVJ A;  2X1D A;  1IDZ A;  5D8L B;  3EUH C;  2F4M B;  1GVJ A;  1Y8R B;  4EMS A;  4LFU A;  1XSX A;  2A61 A;  2W4S A;  4ITV A;  4L9V A;  4CIC A;  4RAZ A;  3OOU A;  1P4A A;  4F7Z A;  1K7A A;  2XC7 A;  2BXZ A;  2BY3 A;  3S2W A;  1YTY A;  1MND A;  1E3P A;  1ZGA A;  1WFX A;  5F08 A;  2M4G A;  4OMZ A;  4F92 B;  3IRQ A;  1LDD A;  1SD5 A;  4E7K A;  3UR3 C;  4M73 A;  3HKZ A;  1UFM A;  4A3J J;  4L9J A;  2H6B A;  3B6A A;  3C18 A;  3IH4 A;  4IRH A;  4MNU A;  4JX4 A;  1NG6 A;  1MNE A;  3W6J B;  3VWB A;  3CDL A;  3CQZ J;  2MGQ A;  4GRI A;  5GAD J;  1FOK A;  4AIH A;  4LG3 A;  2VOO A;  1KU7 A;  1N77 A;  3PIO F;  3OYH A;  3WGH A;  2FF4 A;  1W4M A;  4HST A;  3G71 I;  2KZV A;  1O57 A;  2LRD A;  2Z3Y A;  3SJM A;  1T8I A;  4J19 A;  3J7A Y;  2CG4 A;  1ZGJ A;  1D0Z A;  2DI3 A;  1QHG A;  3R4K A;  4BU2 A;  1T98 A;  3C1D A;  3P7N A;  4QLC U;  3HOU J;  1ENH A;  4YFX F;  1YX3 A;  3M8E A;  4PJJ A;  3NAR A;  2MG4 A;  2CSO A;  1TC3 C;  1Y0N A;  2EJR A;  1IV6 A;  4LB5 A;  1YX5 A;  2QKL B;  2BY0 A;  1FC3 A;  2P5K A;  4NNJ A;  4IHX A;  4IL6 C;  3D0S A;  4O5V A;  4FAS D;  1Z7L A;  4KIB A;  3BR0 A;  4RBO A;  3IV5 A;  3LSR A;  4IZZ A;  3P5J A;  2AHQ A;  1U0J A;  2DT7 B;  2ME6 A;  2CQK A;  1EH7 A;  1U9O A;  2CW7 A;  2GIZ A;  2JQ7 A;  4I01 A;  3JAM K;  4ZYG A;  2BBY A;  1E0E A;  1ONV A;  1RR7 A;  3DWL E;  2ID3 A;  1Y1V J;  3ABU A;  1X3Z B;  2O6G E;  3AG2 H;  2IA0 A;  4G12 A;  3ZMU A;  3PSF A;  1RIO H;  5TRD A;  2V6E A;  1FP1 D;  3G2B A;  2CW0 F;  1LUJ B;  2EIM H;  1O4X A;  2W84 A;  2XDV A;  1CGP A;  3BG6 A;  3RKQ A;  3F6O A;  2EV6 A;  3LOC A;  3CCU I;  2E36 A;  4M3E A;  1MBK A;  1TP4 A;  4XBF A;  3A52 A;  5J1U A;  1JTY A;  2Y31 A;  3LSK A;  4AU7 A;  1YIJ I;  3IH2 A;  2BVL A;  4WK8 F;  4I76 A;  3CLQ A;  5BNG A;  3O8G A;  2LNB A;  4BY7 J;  2DXI A;  2FA5 A;  3TO7 A;  1U5T C;  2MA3 A;  1PP8 F;  5D6E A;  4B4C A;  1IN5 A;  3FZV A;  3W6K B;  4LGW A;  2VOP A;  1EH8 A;  3F8N A;  3R60 A;  1O3T A;  3DKY A;  2EH3 A;  2L7M P;  3KZY A;  3OR2 C;  3SFZ A;  3TP0 A;  2M5W A;  5D5X B;  2R4G A;  2HVQ A;  4R79 A;  4ZC3 A;  4C9Y A;  3DP7 A;  3DQV C;  4E70 A;  4A12 A;  1BW6 A;  4II3 A;  3L09 A;  3Q5F A;  2CH0 A;  1YO5 C;  1VQO I;  2VJ4 A;  5CVU A;  2JRM A;  2XPU A;  5F64 A;  4CA0 A;  3PNT A;  4W97 A;  3JRC A;  3JCU C;  4BQQ A;  3MFK A;  4ANJ A;  2LF8 A;  3O3K A;  3M4O J;  5EG0 B;  4I02 A;  2Q1Z B;  4Z6Y A;  3ZP5 A;  2ZJ2 A;  1UMQ A;  3MVP A;  3S3O A;  4KNY A;  4A0X A;  1QPI A;  3BQZ A;  5AON A;  1EJ9 A;  4B43 A;  3WG7 H;  2LD5 A;  2W24 A;  1VQP I;  1HKT A;  5LRR A;  3L2V A;  2MD5 A;  2KJB A;  4A3K J;  1XTA A;  2YU3 A;  3DTI A;  4CH7 A;  2IS2 A;  2Y9Z A;  3GTP J;  4I2O A;  5HLG A;  5ILV A;  2IXS A;  4V2G A;  2EFQ A;  2IEK A;  2WAQ N;  4Y33 A;  3BPX A;  2IP2 A;  2ME0 A;  2ZBK A;  2VXZ A;  1HW5 A;  1MGT A;  4XSX F;  3FX3 A;  3RPU D;  1GLN A;  4A93 J;  3K4L A;  1XCV A;  2RN7 A;  2V9V A;  2XVC A;  3M07 A;  5IT9 K;  3QWL A;  2NVT J;  4XOP A;  2ZB9 A;  2COB A;  3W6V A;  3VYU B;  2VQH A;  3H92 A;  4A3I J;  3I54 A;  1XD7 A;  1XSD A;  2ESH A;  3L2W A;  2LVS A;  4F93 B;  3HG9 A;  1TTY A;  2LMD A;  3BJA A;  5IOZ A;  3L2C A;  3L00 A;  4XK4 A;  4AIJ A;  1JJ6 C;  3GF2 A;  2FNP A;  2ZJR F;  3DPT A;  5FO5 A;  2IGO A;  2O0Y A;  4IVN A;  3WTU C;  5D5U B;  3DTK A;  2EIN H;  1SFK A;  4P1W A;  3GTL J;  4LK1 F;  4F52 A;  3T8T A;  1S7A A;  4MQ9 F;  5F6F A;  3FXJ A;  3K69 A;  3HTS B;  2MVT A;  3BTJ A;  2CMP A;  1IJW C;  3COA C;  3GLL A;  1R71 A;  2X4H A;  1ZAO A;  3ZMD A;  5E18 F;  3VOD A;  4KYW A;  2E1M B;  1ETK A;  5J40 A;  2QUF A;  2FU4 A;  1KYW A;  3FM3 A;  1O3R A;  9ANT A;  2LLK A;  1P2F A;  2DFH A;  4M6X A;  4RAF A;  4HLX A;  4BQO A;  3HSF A;  5LGN A;  4V19 K;  1KYZ A;  2D1H A;  2NVY J;  3V7C A;  1JTX A;  5CJ9 A;  4XSZ F;  3EUK L;  4ESJ A;  2QSG X;  2I5U A;  1QZZ A;  2QQA A;  1QPM A;  3D5R C;  5C4J J;  2V4J C;  4G6T B;  3KLN A;  4P5O A;  3MKZ A;  1JKO C;  4CYD A;  2HZD A;  4DJA A;  4Y17 A;  2CU7 A;  3WG9 A;  4A6E A;  1OFC X;  2P8T A;  3H36 A;  5E79 C;  3WU2 C;  2DPD A;  2L0K A;  1JUM A;  4Q4Z F;  1ZQ3 P;  4D1Q A;  3TDU C;  5EG0 A;  2LKX A;  2H8W A;  5LGT A;  4XMY A;  2QVO A;  3SZP A;  4LG0 A;  4RB3 C;  2AQF A;  2VQL A;  1LFB A;  2ETH A;  2K9M A;  2MD0 A;  3RDI A;  4MEX F;  4ZTF A;  5AIQ A;  1YOV B;  1LQ1 A;  1WJD A;  5FFZ A;  4HNT A;  1SVM A;  2P6S A;  3BT9 A;  2FUG 2;  3BCB A;  5A2Q R;  1YJ9 I;  1G59 A;  2DMU A;  1HLV A;  2O3F A;  1YHQ I;  2W7N A;  3O2P E;  1BOB A;  2V6C A;  3FBI B;  4HX8 A;  1T38 A;  2XPW A;  2V9K A;  5DYM A;  4LLL A;  1S7E A;  3TQN A;  4E7J A;  1LJ9 A;  4BJT A;  2IGN A;  3R0J A;  4XID A;  5K7Z A;  1R1U A;  4B09 A;  2R7Z J;  1R4N B;  2OF7 A;  1UST A;  3D5S C;  1OKR A;  1ZG5 A;  4R1H A;  3ZOB A;  1V5G A;  2QEX I;  2O5R A;  4G6Q A;  3KYC B;  2P5L C;  2JUG A;  2F6C A;  2XAS A;  1HW2 A;  1YQA A;  4I6Z A;  2D2W A;  2YS9 A;  5DD4 A;  1QZY A;  3HUG B;  3J7A O;  3JRB A;  4GDF A;  4U87 A;  2OU2 A;  1HDP A;  5EYR A;  5GP9 A;  3E7L A;  3HRT A;  4YG2 F;  1H9T A;  3IHU A;  4DQ2 A;  1VQ9 I;  3SDB A;  1TW3 A;  2K4J A;  4E7L A;  2DLL A;  3MZ8 A;  5EEH A;  5B1B H;  1AU7 A;  3DPU A;  2CO5 A;  3HZJ A;  5LHG A;  2FSW A;  3QYE A;  2GA2 A;  1TWC J;  4PFO A;  3LSJ A;  1BC7 C;  2XRO A;  2HOA A;  3TBI A;  2X6W A;  1UJ8 A;  3BG9 A;  5EEA A;  2L7F P;  1ZG1 A;  3H5A A;  1Z67 A;  2L01 A;  1LPQ A;  1FLI A;  1LVK A;  2M1B A;  5F1J A;  1WI9 A;  5B66 C;  2A68 F;  5ICC A;  1G3T A;  2AXL A;  1V3F A;  2HQR A;  3GTQ J;  2FML A;  3QOD A;  4AVP A;  1RC9 A;  5F1R A;  1BOA A;  3BDD A;  1EV7 A;  3CCR I;  3Q3S A;  2JJ7 A;  2RVC A;  5LBQ A;  3OSG A;  3L2R A;  4J01 A;  1KU9 A;  2E1M C;  2Q2E B;  3F8F A;  1YLF A;  5K7F A;  1LEB A;  4RDU A;  2VPL A;  2M3A A;  4A3B J;  2BYV E;  2VAS A;  2NNY A;  3K4B A;  5J4Y A;  2DA3 A;  1JGG A;  1MJA A;  2EBI A;  4EGZ A;  3S14 J;  2K7L A;  1FOY A;  4HBL A;  5CVV A;  3QU3 A;  3HKZ N;  3CJT B;  3CCL I;  4MLO A;  3W2A A;  4JK1 X;  1MBE A;  2JSC A;  4YRV A;  3E6C C;  1FBS A;  1FOW A;  2FEZ A;  1Q1H A;  4A5M A;  1K6O A;  3PQK A;  2E2J J;  2E5Z A;  2DJI A;  1OJL A;  5GAE J;  2BXY A;  2PFB A;  1A35 A;  3K70 D;  2R7V A;  1D3Y A;  3DEE A;  2XHK A;  4OIQ F;  4G6D A;  1WWX A;  4EJU A;  4PJM A;  2KLO A;  4X1E A;  1JKR C;  5TIS C;  3EUA A;  4RAG A;  1Q1V A;  2VBX A;  5GAH J;  1Z0X A;  2LK2 A;  1RKT A;  4YII A;  2K85 A;  2M45 A;  3E5Q A;  3K7A J;  4ZH4 F;  3CCV I;  1I1G A;  1R58 A;  2EV0 A;  1SC7 A;  3C7J A;  4CGZ A;  1IRG A;  2Y30 A;  2WY8 Q;  3CDH A;  5A2Q K;  3JRE A;  2R7D A;  2MFZ A;  5K7H A;  5KNL A;  2UXX A;  2EA2 A;  5FLV A;  1TQP A;  2F5C A;  2JTV A;  2M8G X;  2WY7 Q;  3BTC A;  2KIU A;  3K10 A;  3U21 A;  4KIF A;  1UAA A;  2BE5 F;  3PL8 A;  1G6N A;  2H09 A;  4KN7 X;  3G4S I;  3K4C A;  4CCM A;  4M3B A;  3I55 I;  2AQE A;  5F04 A;  5FD5 A;  3GME A;  3HUG A;  2R7U A;  1LE8 B;  3CD6 I;  5L3D A;  4EGY A;  3ELK A;  3E6M A;  1X1B A;  3CUQ C;  4XN0 A;  4L9N A;  4FE7 A;  2E34 A;  3QP6 A;  5JLW A;  3EET A;  2GLO A;  4AYB N;  2HPI A;  3F8B A;  3X2Q H;  2DT5 A;  2YR2 A;  3HTU A;  4FX0 A;  1ZHF A;  3BC8 A;  1IV8 A;  5IOY A;  3HBL A;  1ITY A;  1K83 J;  2M0C A;  3RKW A;  2COM A;  5JHF A;  1WJ5 A;  1TWH J;  2EIL H;  3LST A;  1B8I B;  1LDK B;  1D1B A;  2L9N A;  3CJN A;  3LSI A;  3TGN A;  5HLI A;  1DDN A;  1BW5 A;  1I39 A;  1J59 A;  4G7O F;  2ZJQ F;  3OYD A;  5FKL A;  3I56 I;  2OPT A;  5K1Y A;  2LRE A;  5HLT A;  4A3M J;  3J80 R;  2VB6 A;  2DA2 A;  1X3U A;  3KEQ A;  1MBJ A;  2GQQ A;  3JW4 A;  5M3F J;  3OSF A;  3B6C A;  2HTJ A;  1REP C;  3LSP A;  2IS6 A;  3AFH A;  3BPV A;  3N05 A;  3CMM A;  3DBR B;  2F5D A;  3F8C A;  3Q9V A;  4ZZD A;  2DQL A;  2Q2E A;  3A01 B;  3REO A;  1IGN A;  4A3C J;  4QIW N;  1T39 A;  1J0R A;  2KP6 A;  4BAY A;  1MMN A;  1MSF C;  4GO1 A;  4LIV A;  1MZB A;  4M72 A;  5HS8 A;  4R8H A;  5EF6 A;  5EDN A;  4KA4 A;  1DP3 A;  1VZ0 A;  1MBH A;  1Z3Y A;  3E3V A;  3K9T A;  4HPQ A;  1X2M A;  1S29 A;  3DU6 A;  1PJR A;  3QP5 A;  3HB9 A;  1WCM J;  2D5V A;  4F91 B;  4EV0 A;  5H6Q A;  2JA6 J;  3S16 J;  1VTN C;  2E71 A;  4QWQ A;  5DUI A;  2JPC A;  4UY8 I;  1XX5 A;  4BHB A;  3LL7 A;  3FXR A;  1B4A A;  1Y8Q B;  3LAP A;  3PNY A;  5HDK A;  4I99 C;  2CV1 A;  3BTL A;  3F72 A;  4XLC A;  2JWT A;  3ONQ A;  1UCR A;  4UUV A;  2DFF A;  5FD6 A;  1FMW A;  1ZEL A;  3LAJ A;  2DOA A;  1JE8 A;  2ZC2 A;  4QSH A;  1R49 A;  1TW2 A;  2EB7 A;  3BR6 A;  4OIO F;  3BZ6 A;  4XR6 A;  2DFI A;  1AKH B;  2G0E A; 
#chains in the Genus database with same CATH homology
 3BJO A;  3FM5 A;  4IPA A;  5FFX A;  3ZQ7 A;  2OQG A;  1GHC A;  4G9Y A;  2XAQ A;  2IA2 A;  1OYW A;  1WRJ A;  2LDU A;  3L7W A;  2PQ8 A;  5JR3 A;  4L18 B;  5FLX Z;  2M30 A;  3GWZ A;  5K5Q A;  1O7F A;  3WE2 A;  2K27 A;  4G7H F;  5DDG A;  1IZ1 A;  3ML6 A;  1O3Q A;  1C0W A;  1AWC A;  3KET A;  2FMY A;  3MZY A;  4EJT A;  1IN8 A;  5DV5 A;  3ABT A;  3LWF A;  1FPQ A;  4CO8 A;  1W7P D;  3EUH A;  4A6D A;  4BH9 A;  2G9W A;  2A69 F;  4H0E A;  2XAG A;  3AAF A;  2A6E F;  2JPB A;  5DUK A;  5LHH A;  1HQC A;  2Z9O A;  4EJV A;  1R5G A;  3F23 A;  2HDC A;  4HX7 A;  3KE2 A;  3ERE D;  3P9I A;  3E97 A;  4UHT A;  2OZ6 A;  2XIG A;  5DCF A;  2W85 A;  4ASN A;  1FYK A;  1IN7 A;  1BBY A;  4ON0 A;  1GXQ A;  1Z7U A;  5BOX A;  1G3Y A;  2HTS A;  2UZK A;  1KQ8 A;  1MDM B;  5D8K B;  2E7X A;  1T6S A;  4HAM A;  1W7P A;  2D1V A;  4L5I A;  2VN2 A;  2OD5 A;  3JAM Z;  1ZRC A;  3V7S A;  3GO5 A;  3DPL C;  2XRN A;  1KU3 A;  4WX9 A;  1R00 A;  3I59 A;  1YW7 A;  3HSR A;  1IUY A;  1LVA A;  2TDX A;  4HZF A;  3TOB A;  3QPH A;  3BJ6 A;  3DF8 A;  1CF7 B;  4FT8 A;  2DU9 A;  2P4W A;  4M9Z A;  4G7Z F;  5HDN A;  3FXQ A;  1HKS A;  4ZYH A;  1KQ0 A;  3R0A A;  1WQ2 A;  2PN6 A;  1FZP B;  1DUX C;  1BJA A;  1B9N A;  1U5T A;  2DQR A;  4OMY A;  5K5R A;  1BI3 A;  5JVT A;  4OIN F;  2XGX A;  5E1Z B;  1U8R A;  2YSR A;  2A5Y B;  2GIV A;  3TO6 A;  4BQA A;  4JQF A;  2O61 A;  1D8J A;  4WXC A;  1FY7 A;  2MBF A;  5LLQ A;  3F3X A;  4UV8 A;  5DCM B;  3CTA A;  1Z91 A;  4Y15 A;  1IAW A;  4HDV A;  1S6L A;  1YYV A;  1R5H A;  3GFJ A;  5EEG A;  3J81 K;  4P9U A;  4ENK A;  3QOP A;  1J9I A;  5L3C A;  1MDM A;  5HS7 A;  4HLY A;  1B9M A;  5IT9 Z;  1O7L A;  5J6X A;  2VT3 A;  3N97 A;  4ETS A;  3IWZ A;  4A5N A;  2NNN A;  2DW4 A;  2DFI A;  3H3Z A;  1F5T A;  5HVQ C;  2HOE A;  1FSE A;  1ZYR F;  3ZMS A;  2H6C A;  2RNJ A;  5D5W B;  2HFH A;  3TKY A;  3DEU A;  2IRF G;  1NHA A;  1CF7 A;  2HKO A;  2NAZ A;  2A6H F;  3TOA A;  2VC0 A;  1SFU A;  1ZAR A;  2F2E A;  5KVR A;  3RYP A;  2FBH A;  4UVB A;  3WU1 B;  4Q48 A;  2FNA A;  2FXA A;  3ZMV A;  3WTV C;  2DAO A;  1BN5 A;  3HSE A;  2OBP A;  4KFC A;  5JFR A;  4YFN F;  4Q47 A;  3DKW A;  4XLP F;  3V8L A;  4Q5S F;  3MZH A;  4TV7 A;  1XGM A;  2HR3 A;  5DCM A;  1QO0 D;  3WTT C;  5JI6 A;  4D0P A;  4U7D A;  2ACJ A;  1K79 A;  3GFL A;  4BYY A;  2QLZ A;  3VEP A;  5BMZ A;  2NRA C;  1FX7 A;  2FE3 A;  3LQR A;  3E5X A;  1QNT A;  3M7G A;  2EFN A;  1OMI A;  2ISZ A;  3WOD F;  1YW9 A;  2VT2 A;  2V79 A;  1XSV A;  4B8X A;  3EYI A;  1U78 A;  4MQV A;  2E7W A;  3NRV A;  4LB6 B;  1BM9 A;  5FGM A;  1Z1D A;  3DXJ F;  3F22 A;  1AOY A;  3MWM A;  2KRF A;  3R61 A;  2ZNZ A;  4BHC A;  4HX4 A;  5H20 A;  2HGC A;  3M1E A;  5L3F A;  4RGS A;  2WV0 A;  1IF1 A;  2YX7 A;  3CUQ B;  3IC7 A;  3E6D A;  4EM2 A;  3LA7 A;  2EFP A;  1B6A A;  4S04 A;  5IT3 A;  2PLY A;  4A0Y A;  5KK1 A;  1R22 A;  1SD4 A;  1P4X A;  1YS7 A;  2QYO A;  1SFX A;  5LEK A;  2E1N A;  2C6Y A;  1MD0 A;  3R6S A;  4IRI A;  2HKX A;  1W5T A;  2XAJ A;  4HF0 A;  1K78 B;  2STW A;  2HQN A;  4P9F A;  1ZRE A;  2Y0M A;  3LA2 A;  3F6V A;  1FBU A;  1S8N A;  2MH2 A;  4RGR A;  5D4S A;  1RUO A;  2BEO A;  1T2K A;  2RV8 A;  1IXR C;  1PP7 U;  1KU2 A;  2BV6 A;  2HYG D;  2ZXJ A;  3GFM A;  1E17 A;  2DK5 A;  2DBB A;  3CUO A;  2A07 F;  5A2Q Z;  4UNO A;  3FHZ A;  3U9G A;  4OOI A;  1LEA A;  3G3Z A;  4M71 A;  1YS6 A;  4HW0 A;  3ISP A;  2H94 A;  3SXY A;  4CHU A;  2DK8 A;  2HYF A;  1G3S A;  1Z6T A;  3SZT A;  2L3D A;  2P7C B;  2NS0 A;  5E20 A;  2WTE A;  1A04 A;  2XAF A;  3K1M A;  2GXG A;  3P9K A;  4MTD A;  2R3S A;  4G8X A;  3CUQ A;  3T8R A;  3IWF A;  2J5O A;  3NEU A;  1ZH5 A;  2G7H A;  1H9G A;  4GGG A;  5D4R A;  1FWZ A;  4HYE A;  4P55 A;  4O3M A;  2E1C A;  2XKO A;  2D45 A;  2DO7 A;  4K2E A;  2O8X A;  4GYI A;  4WXD A;  2KIM A;  3C3W A;  6PAX A;  4O6J A;  1JHF A;  1K78 A;  2JZY A;  1P92 A;  2J5P A;  4YIF A;  3K1N A;  2V1U A;  2HZT A;  2PMH A;  5J8C A;  1SD6 A;  4WF2 A;  3QU6 A;  1G3W A;  5CVI A;  2L54 A;  3IKT A;  4EQQ A;  5AIP A;  3EQL F;  2RGV A;  5BQT A;  3ZN1 A;  1KGS A;  4DNC A;  3QPT A;  4MTE A;  3ULQ B;  3PQJ A;  1KQ9 A;  3FXU A;  4RGX A;  1YIO A;  3RI4 A;  5ILS A;  4NHJ A;  4ZYD A;  3RIR A;  2IPQ X;  3FMQ A;  4GXO A;  4IJA A;  5DEQ A;  3M9A A;  4EJO A;  4OU0 A;  2PG4 A;  2L4M A;  3QRF F;  4PZJ A;  1V4R A;  2ZO4 A;  3JTG A;  4AD9 A;  4Z2Y A;  4CDG A;  1GXP A;  4KUM A;  2PEX A;  3GZ6 A;  3HRM A;  2STT A;  3F8M A;  3GZ5 A;  2OAZ A;  2A3S A;  4KMF A;  1IN4 A;  1U6G A;  5HOO A;  2HWV A;  1XGS A;  5BS6 A;  3HIF A;  3GX4 X;  4L9T A;  3HOT A;  1FNN A;  4U0W A;  1FYM A;  1JHH A;  3I0T A;  4RB1 A;  2Z33 A;  3WTZ A;  4CXF A;  4FX4 A;  3LQQ A;  1XMK A;  3GEZ A;  1UHW A;  4ZZL A;  4N9H A;  4IRG A;  1BI2 A;  2IVM A;  1WSU A;  2EV5 A;  1I5Z A;  1SD7 A;  4WXH A;  1F4K A;  2W57 A;  2P5V A;  4UVC A;  3DV8 A;  3NQO A;  3CO6 C;  1OYY A;  2ZNY A;  3J80 K;  1LDJ A;  1DP7 P;  2VE8 A;  3L9F A;  4EM1 A;  2BGC A;  3HYI A;  1J2X A;  1P6R A;  1P4W A;  5FB2 A;  2YPR A;  4HA8 A;  3GW2 A;  1PDN C;  2K02 A;  2IA1 A;  3V8J A;  4ESF A;  1XB4 A;  4ENJ A;  2MH9 A;  3GVA A;  4PDK A;  3KLO A;  1YW8 A;  1OR7 A;  4WCG A;  3IRR A;  3VB2 A;  4PGG A;  3KZZ A;  4N0B A;  2B0L A;  1TQM A;  2JRT A;  3ECO A;  2HEO A;  4KIG A;  4UXN A;  1UHM A;  3DFG A;  5ICG A;  3ZMT A;  4I0B A;  5E1X A;  3GUD A;  1ULY A;  3N4M A;  1XGN A;  1RUN A;  4CZZ A;  2DTR A;  3I71 A;  3WTS C;  3VFZ A;  1MJB A;  4N9I A;  4AWX B;  3JSP A;  2GAU A;  3B73 A;  3TO9 A;  3J81 Z;  1B1B A;  1S7O A;  4MGR A;  4EM0 B;  5HS9 A;  2DPU A;  2Z99 A;  2CYY A;  3HRU A;  4RB2 C;  1QQI A;  5DD8 A;  3KP6 A;  4HF2 A;  2KIF A;  2OA4 A;  1D5V A;  1HKQ A;  4RGU A;  3H3U A;  2FQ3 A;  2K4B A;  4ENN A;  1MKM A;  1TQI A;  2PJP A;  1W5S A;  5CYV A;  5CVR A;  5K5O A;  3KFW X;  3MAJ A;  1OPC A;  4GCV A;  5LEJ A;  3ROU A;  1I27 A;  4HQE A;  1ODD A;  4KMU X;  3JSO A;  1J7K A;  2EWN A;  1I6X A;  3T5X A;  1Z6R A;  3FWE A;  5CLS A;  1YFH A;  1TNS A;  1IN6 A;  4U0V A;  4HV6 A;  2IW5 A;  3FF5 A;  1BI1 A;  4XRF A;  2YX4 A;  4S05 A;  3VOE A;  4I0A A;  1ZRF A;  1U3E M;  2RQP A;  5LHI A;  2FRH A;  1BIA A;  4HOB A;  2M87 A;  2FOK A;  4IHT A;  3OV8 A;  1R1T A;  3ECH A;  1RZ4 A;  4MEY F;  4L0Y B;  3V4G A;  3KP3 A;  2EK5 A;  2LKP A;  1XN7 A;  4NQW A;  3MEX A;  1IXS B;  1BIB A;  4LG0 B;  4FHT A;  1SFE A;  1MJ9 A;  3I5U A;  2P7V B;  4G94 A;  2O03 A;  3T1B A;  3KP4 A;  3WTX C;  2PMU A;  4AIK A;  2VBW A;  3KEO A;  2Y48 A;  2RDP A;  2L4A A;  1ON2 A;  2FBK A;  1G4D A;  4A0Z A;  4Y13 A;  2EA4 A;  4KN4 X;  4L5J A;  2GA1 A;  2GZW A;  4M9S A;  1UB9 A;  5E8G A;  4OIR F;  4ZYE A;  5E8I A;  4LD5 A;  5ILU A;  4HDU A;  1R7J A;  3ZPL A;  3V8K A;  4BNC A;  1HW1 A;  4JBA A;  1R1V A;  3SHF A;  2MLK A;  1BC8 C;  3RPU A;  4KT5 C;  4LLN A;  1TBX A;  2IJL A;  3BP8 A;  3WTW C;  4M9X A;  3I53 A;  4BXU A;  4UV9 A;  4PCQ A;  3EDP A;  3MCZ A;  1FYL A;  2MLG A;  1XDU A;  4XLN F;  3TDZ C;  3IL2 A;  2QQB A;  3K0L A;  3IKV A;  3FMR A;  3D5L A;  4UVA A;  1L3L A;  4YFK F;  3HHG A;  1YG2 A;  5ERI A;  4M74 A;  1STZ A;  1HXD A;  4BHP A;  1QBJ A;  1T0F A;  4GYG A;  2KKO A;  1OYI A;  3E6B A;  2V1D A;  1BI0 A;  3WGG A;  2XUB A;  1XCB A;  2GXB A;  1KA8 A;  1Z9C A;  1U2W A;  4I7H A;  4RAY A;  1JXS A;  5LRS A;  4KIC A;  3V7R A;  3BOQ A;  3RYR A;  2IT0 A;  2V1X A;  3G73 A;  1ZLJ A;  5J8F A;  5ED4 A;  1S3J A;  4HF1 A;  2QQ9 A;  1Y0U A;  5TJJ A;  5ICF A;  1IRF A;  3LFK A;  1FSH A;  2GWR A;  1IXC A;  3KCC A;  3P9C A;  3M8F A;  2RKH A;  3LA3 A;  5L3G A;  2KJC A;  4IXA A;  3T0Y A;  1FP2 A;  4U7B A;  2ESN A;  4L0Z B;  3Q9S A;  1I1S A;  3F21 A;  2XKP A;  2ZME B;  3RPQ A;  3WTY C;  1XGO A;  2LF7 A;  1DPU A;  3BRO A;  2RC4 A;  2QZ8 A;  2QM3 A;  4KDP A;  2CFX A;  2Z5U A;  2VBZ A;  2CGP A;  1JGS A;  2R7F A;  1L0O C;  2PBI A;  5D5V B;  1Z05 A;  3B02 A;  1R23 A;  1O3S A;  4IF4 A;  1LB2 A;  3KP2 A;  3GYH X;  1HST A;  2P6T A;  3WU0 A;  4I09 A;  5HDG A;  3HRS A;  4A2U A;  3GXO A;  2X0L A;  3KP7 A;  3ZN0 A;  1ZG3 A;  2QEN A;  4U88 A;  2Y75 A;  1H0M A;  1WKM A;  4ENM A;  2QWW A;  3EYY A;  2QBY B;  1SMY F;  1LNW A;  5D6F A;  1RI7 A;  2W25 A;  2XAH A;  3HHH A;  4IHS A;  2VON A;  4EJW A;  3BWG A;  5L3E A;  1J75 A;  3BY6 A;  2EFO A;  2EFW A;  2WC2 A;  4I98 B;  4PGH A;  1TNT A;  1USS A;  4MHG A;  1XMA A;  5JHU A;  3CO7 C;  1IW7 F;  1B59 A;  2ZME A;  1R36 A;  4HV5 A;  3RKX A;  1SAX A;  1FT9 A;  3JTH A;  5L3B A;  2AS5 F;  4OIP F;  2H27 A;  2MC3 A;  3K1P A;  3QAH A;  5BPI A;  2PI0 A;  2M8E A;  2UWM A;  2VC1 A;  1EH6 A;  3PFI A;  2NYX A;  3WGI A;  3GFI A;  2ZFW A;  3U2R A;  2K86 A;  2Q0O A;  3MQ0 A;  3GLX A;  3WE3 A;  4RS8 A;  4EVI A;  3SQN A;  5HLH A;  2LSO A;  3K2Z A;  3OOP A;  1F1Z A;  2OQR A;  1J5Y A;  2CWE A;  2WWY A;  3CLO A;  1FBQ A;  2F5F A;  3J80 Z;  1W7P B;  2G7U A;  3FMS A;  5E1W A;  2HS5 A;  2Q8K A;  1ON1 A;  3I64 A;  2F5E A;  1E2X A;  2UXN A;  4NB5 A;  2QBY A;  1RNL A;  4RB0 A;  3I59 B;  2L02 A;  1HBX G;  3ZMZ A;  3E5U A;  2ISY A;  5E17 F;  1D8K A;  2XV4 S;  2JT1 A;  4P96 A;  4HQM A;  2VOD A;  2VBY A;  2ZKZ A;  2VE9 A;  3RTR A;  1XDS A;  4M6Y A;  4LMY A;  4LLG F;  5ICE A;  4U0Y A;  1PUE E;  1HSJ A;  1DPR A;  1QGP A;  3HOS A;  4WWC A;  2ZCW A;  3U1D A;  1U5T B;  3O6B B;  2FBI A;  4LJZ F;  4ESB A;  1ZN2 A;  2OZU A;  1ZRD A;  3RKY A;  1SMT A;  3I58 A;  5BPD A;  5FLX K;  1TLH B;  5H6R A;  1F9N A;  1ZLK A;  3I4P A;  2ELH A;  2ADU A;  3KP5 A;  3RJP A;  4LK0 F;  5CVJ A;  5D8L B;  1GVJ A;  4EMS A;  4LFU A;  1XSX A;  2A61 A;  4L9V A;  4CIC A;  4RAZ A;  1P4A A;  4F7Z A;  1K7A A;  3S2W A;  1YTY A;  1ZGA A;  4OMZ A;  3IRQ A;  1LDD A;  1SD5 A;  4M73 A;  1UFM A;  4L9J A;  2H6B A;  3C18 A;  4IRH A;  4MNU A;  3W6J B;  1FOK A;  4AIH A;  2VOO A;  1KU7 A;  3WGH A;  2FF4 A;  1W4M A;  1O57 A;  2Z3Y A;  2CG4 A;  1ZGJ A;  2DI3 A;  3R4K A;  1T98 A;  3C1D A;  3P7N A;  4QLC U;  4YFX F;  3M8E A;  2CSO A;  2EJR A;  4LB5 A;  2P5K A;  1FC3 A;  3D0S A;  4O5V A;  4KIB A;  2CQK A;  1EH7 A;  4I01 A;  3JAM K;  4ZYG A;  2BBY A;  1ONV A;  3ABU A;  2O6G E;  2IA0 A;  3ZMU A;  1RIO H;  5TRD A;  1FP1 D;  2CW0 F;  2W84 A;  1CGP A;  3F6O A;  2EV6 A;  4XBF A;  4WK8 F;  2LNB A;  2FA5 A;  3TO7 A;  1U5T C;  2MA3 A;  1PP8 F;  5D6E A;  1IN5 A;  3FZV A;  3W6K B;  4LGW A;  2VOP A;  1EH8 A;  3F8N A;  3R60 A;  1O3T A;  3KZY A;  3SFZ A;  2M5W A;  5D5X B;  4R79 A;  3DP7 A;  3DQV C;  4E70 A;  4A12 A;  3L09 A;  3Q5F A;  1YO5 C;  5CVU A;  5F64 A;  3MFK A;  2LF8 A;  3O3K A;  4I02 A;  3ZP5 A;  2ZJ2 A;  4KNY A;  4A0X A;  5AON A;  1HKT A;  2W24 A;  5LRR A;  2MD5 A;  2KJB A;  2YU3 A;  4I2O A;  5HLG A;  5ILV A;  2EFQ A;  3BPX A;  2IP2 A;  2ZBK A;  5LGU A;  2VXZ A;  1HW5 A;  1MGT A;  4XSX F;  3FX3 A;  1XCV A;  2RN7 A;  2V9V A;  2XVC A;  5IT9 K;  3H92 A;  3I54 A;  1XD7 A;  1XSD A;  2ESH A;  1TTY A;  3BJA A;  3L2C A;  3L00 A;  4AIJ A;  3GF2 A;  2FNP A;  3DPT A;  5FO5 A;  2O0Y A;  4IVN A;  3WTU C;  5D5U B;  4LK1 F;  3T8T A;  1S7A A;  4MQ9 F;  5F6F A;  3K69 A;  3HTS B;  3COA C;  2X4H A;  5E18 F;  1ZAO A;  3ZMD A;  3VOD A;  4KYW A;  2QUF A;  2FU4 A;  1KYW A;  3FM3 A;  1O3R A;  1P2F A;  4M6X A;  4HLX A;  3HSF A;  5LGN A;  1KYZ A;  2D1H A;  3V7C A;  5CJ9 A;  4XSZ F;  4ESJ A;  1QZZ A;  2QQA A;  1QPM A;  3KLN A;  4P5O A;  4CYD A;  4Y17 A;  3WG9 A;  4A6E A;  2P8T A;  2DPD A;  4Q4Z F;  3TDU C;  5LGT A;  2QVO A;  3SZP A;  4LG0 A;  4RB3 C;  2ETH A;  3RDI A;  4MEX F;  5AIQ A;  1LQ1 A;  5FFZ A;  2P6S A;  2O3F A;  3O2P E;  2V6C A;  4HX8 A;  1T38 A;  5DYM A;  3TQN A;  1LJ9 A;  3R0J A;  1R1U A;  4B09 A;  1UST A;  1OKR A;  1ZG5 A;  4R1H A;  4G6Q A;  2P5L C;  2XAS A;  1HW2 A;  1YQA A;  2D2W A;  5DD4 A;  1QZY A;  3J7A O;  2OU2 A;  3HRT A;  4YG2 F;  1H9T A;  3IHU A;  4DQ2 A;  1TW3 A;  2K4J A;  2DLL A;  5EEH A;  2CO5 A;  5LHG A;  2FSW A;  2GA2 A;  1BC7 C;  2XRO A;  1ZG1 A;  2L01 A;  1FLI A;  2M1B A;  1WI9 A;  2A68 F;  5ICC A;  1G3T A;  2AXL A;  1V3F A;  2HQR A;  2FML A;  4AVP A;  5F1R A;  1BOA A;  3BDD A;  1EV7 A;  2RVC A;  5LBQ A;  1KU9 A;  3F8F A;  1YLF A;  1LEB A;  2BYV E;  2NNY A;  1MJA A;  4EGZ A;  2K7L A;  4HBL A;  5CVV A;  3QU3 A;  4JK1 X;  2JSC A;  3E6C C;  1K6O A;  1FBS A;  2FEZ A;  4A5M A;  1Q1H A;  3PQK A;  2PFB A;  1D3Y A;  2XHK A;  4OIQ F;  4G6D A;  1WWX A;  4EJU A;  2VBX A;  4YII A;  2M45 A;  3E5Q A;  4ZH4 F;  1I1G A;  1R58 A;  2EV0 A;  4CGZ A;  3C7J A;  1IRG A;  3CDH A;  5A2Q K;  2R7D A;  2UXX A;  2EA2 A;  1TQP A;  2F5C A;  2JTV A;  2KIU A;  4KIF A;  2BE5 F;  1G6N A;  2H09 A;  4KN7 X;  5FD5 A;  3HUG A;  5L3D A;  4EGY A;  3ELK A;  3E6M A;  3CUQ C;  4L9N A;  3QP6 A;  3EET A;  3F8B A;  2DT5 A;  2YR2 A;  3HTU A;  4FX0 A;  1ZHF A;  3RKW A;  2COM A;  3LST A;  1LDK B;  3CJN A;  3TGN A;  1DDN A;  5HLI A;  1J59 A;  4G7O F;  5K1Y A;  3KEQ A;  1X3U A;  2GQQ A;  3JW4 A;  2HTJ A;  1REP C;  3BPV A;  2F5D A;  3F8C A;  3Q9V A;  4ZZD A;  2DQL A;  2Q2E A;  3REO A;  1T39 A;  1J0R A;  4BAY A;  4GO1 A;  1MZB A;  4M72 A;  5HS8 A;  4R8H A;  4KA4 A;  3E3V A;  3K9T A;  1S29 A;  3QP5 A;  4EV0 A;  5H6Q A;  1VTN C;  4QWQ A;  5DUI A;  2JPC A;  4BHB A;  3FXR A;  1B4A A;  3LAP A;  5HDK A;  3F72 A;  1UCR A;  4UUV A;  5FD6 A;  3LAJ A;  1JE8 A;  4OIO F;  1TW2 A;  2EB7 A;  3BZ6 A;  4LLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...