2EV0A

Bacillus subtilis manganese transport regulator (mntr) bound to cadmium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 51
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev0A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev0A02
1J2XA 4HQMA 1IRGA 2OD5A 3NQOA 5HDKA 4M74A 3DQVC 4OU0A 3ZMTA 2IJLA 4GGGA 3VEPA 3E6DA 2FU4A 5ILUA 4LMYA 1XD7A 3DKWA 2MLGA 1P4AA 1BI1A 6PAXA 4MEYF 1KU7A 4EM2A 1XMAA 5K5OA 1L0OC 5HS9A 4AIKA 4KN4X 3LSTA 1FYLA 5K5QA 5CVUA 3QAHA 2O03A 1G6NA 5JR3A 3G3ZA 2YU3A 4D0PA 1RNLA 3KETA 1ZH5A 1MZBA 2XHKA 1U6GA 1B1BA 3RKYA 3VB2A 1FY7A 1ULYA 1MKMA 2QQBA 2HS5A 3LQQA 4KFCA 3KP6A 5K5RA 3H92A 1PP7U 1HXDA 1PDNC 4ENMA 2WC2A 2DAOA 2RKHA 3GLXA 3M1EA 4EGYA 2FOKA 1FC3A 4H0EA 1KQ8A 3C7JA 4EJWA 4M9XA 1TW3A 2ACJA 1RIOH 2LNBA 5EEGA 4WWCA 2VC1A 5L3BA 1FT9A 1MJBA 3JSOA 2NAZA 2D1HA 5L3EA 1S8NA 5ICFA 1E2XA 3F8FA 3ISPA 4ENNA 1JGSA 3GEZA 1F9NA 3K1PA 3P9IA 4WK8F 4G6DA 3HOSA 2XAQA 1ON1A 3J7AO 2XKPA 1HSTA 3I54A 3G73A 4N9HA 4MQVA 4M72A 2EWNA 3I71A 5E20A 1R00A 3R0AA 4G9YA 4RS8A 1J59A 3MQ0A 2MD5A 1LDDA 1S6LA 2EFWA 3WU1B 4UVBA 4CYDA 4QLCU 2FXAA 1YYVA 4CXFA 2F5FA 2ZKZA 2XAFA 4U0YA 3E6MA 1G3YA 4L5JA 2Y48A 5D5XB 3ZMZA 4Q4ZF 2VOOA 3GO5A 3F8CA 4LLNA 3VODA 1P2FA 2VOPA 2GIVA 4KIBA 2QWWA 2XRNA 4O6JA 2H09A 1L3LA 4I2OA 3MEXA 5LGTA 4O5VA 4M6XA 2QQAA 4CICA 3ZMUA 4OMZA 5F6FA 2K27A 1LDKB 3BPVA 3ZQ7A 4XSXF 4EJOA 1T98A 5HLIA 3TKYA 5HDNA 2Z9OA 2LF8A 4ENJA 4R79A 4EGZA 5DEQA 2FSWA 5BMZA 5DD4A 3HYIA 2D2WA 2LDUA 4WF2A 1U5TC 4EQQA 3B73A 1RUOA 2PEXA 2ZJ2A 3D0SA 1OYIA 4HBLA 1ZG5A 2HFHA 3IKTA 5CVRA 1XCBA 2XKOA 2F2EA 5HLGA 4KT5C 4XLNF 3KLOA 4RB2C 2JPBA 3BWGA 3RIRA 1I27A 4HF0A 1T39A 3F8BA 1LJ9A 2RNJA 1XMKA 5ICGA 1SD5A 1HKSA 4LLLA 1W4MA 1KQ9A 3DEUA 4LLGF 1UFMA 2D1VA 2Q0OA 4ZYGA 2AS5F 4HYEA 3O3KA 3HRUA 4GYIA 3HSEA 5LBQA 1FOKA 1O57A 2IW5A 2VXZA 3IWZA 4U0WA 2JT1A 3BDDA 3K2ZA 4JBAA 5DV5A 1YO5C 3KEQA 3RI4A 1OYYA 3BP8A 2O8XA 1T38A 2ISZA 1TNSA 4WCGA 4OIQF 4A6DA 3MZYA 3E3VA 1XGOA 4GYGA 3WTTC 5KK1A 3RYPA 1BI3A 5J6XA 2M45A 5LGUA 3HUGA 2V1DA 3JAMZ 2FMLA 3M7GA 2QYOA 3JAMK 1MD0A 4B8XA 2RN7A 1QBJA 3C18A 3HSFA 3V7SA 2X0LA 4HDUA 1Y0UA 1Z91A 1BI0A 4RGSA 5ILVA 2VT3A 3HRTA 5FD6A 3KP2A 3GFJA 2GXBA 3FF5A 2XVCA 2RQPA 4YFNF 4AD9A 4Y15A 2VONA 3ML6A 1ZHFA 4LB6B 3ROUA 1FSEA 3V7RA 1ZGJA 4HX8A 5F64A 4ZZLA 5LHGA 1MJAA 3E5QA 4G7ZF 2WWYA 3EUHA 4IVNA 3I59A 2L3DA 1D8KA 1Z6TA 2XIGA 2EV5A 3T5XA 4XSZF 3CDHA 3WODF 1HW1A 1D5VA 4HA8A 1ODDA 3K0LA 5JFRA 1SAXA 2MBFA 4PZJA 2A5YB 3WU0A 2LKPA 1QPMA 2CYYA 3CUOA 1P4WA 3BJOA 4ETSA 2QQ9A 1IUYA 1FBUA 2FEZA 1IN7A 2YPRA 4U7BA 1W7PB 2IVMA 2P7CB 2P4WA 2DK5A 4HZFA 3I4PA 4RGXA 3V8JA 2HKXA 4I09A 4GO1A 3GF2A 3SFZA 1SFXA 1RI7A 5TRDA 3BJ6A 5BQTA 1KU3A 5FD5A 4ON0A 3I53A 1PUEE 1SD6A 4Q5SF 3F6VA 5D6EA 1BOAA 4TV7A 2BV6A 3RKWA 4EJTA 3L7WA 2K4JA 3WE2A 1CGPA 2ESNA 1R22A 3LAJA 5IT9Z 5E8GA 2QENA 4YIIA 5IT9K 3F23A 2ADUA 4KNYA 2HQRA 1G3WA 2A07F 3D5LA 1BBYA 4HF2A 1IZ1A 1BJAA 2RC4A 2KIFA 3GZ6A 3QP6A 1T0FA 4HLYA 3QP5A 1YG2A 3NRVA 1E17A 2FRHA 5DD8A 5JI6A 1STZA 1BN5A 3TQNA 4L9NA 2BEOA 1BC8C 1IF1A 2AXLA 2CQKA 3EDPA 1QZYA 2M5WA 1GXQA 3RYRA 4HF1A 2K02A 2PMUA 5D5VB 2F5CA 2HDCA 1O3SA 4BHBA 4MEXF 4ZYHA 2R3SA 3U1DA 4WXHA 4U88A 4HV5A 5DYMA 2OZUA 3N97A 2ZMEB 1F1ZA 4FT8A 2A6HF 3MCZA 3HHHA 4YFXF 1OR7A 2FF4A 2HR3A 2L01A 2HGCA 3JW4A 3FXUA 3QPHA 1QGPA 2IRFG 2DW4A 3K9TA 3C3WA 2CW0F 2XV4S 5AIQA 4EVIA 4ESFA 3TGNA 2VN2A 5F1RA 1YW9A 5HOOA 2A68F 4QWQA 5CVVA 1YTYA 1SMYF 5J8CA 3LA7A 3CJNA 4LG0A 3LWFA 1J0RA 4LK1F 3CLOA 4O3MA 4CO8A 4P9FA 4L0ZB 5CLSA 4R1HA 1U2WA 2ZMEA 2ESHA 3ZN0A 1HKQA 3F72A 3BROA 1FBQA 1USTA 5HS8A 2W85A 4A0ZA 2KKOA 5LLQA 2QZ8A 2P5VA 3COAC 2PFBA 4RGRA 2J5PA 4AVPA 2OAZA 2YX4A 2PN6A 2VE9A 4M6YA 4L5IA 1WWXA 1HBXG 3T1BA 4HOBA 1FBSA 3W6JB 5BPDA 4HLXA 5LGNA 2H6CA 2PMHA 3H3UA 2FNAA 2E1CA 4KN7X 4UVAA 1F5TA 1YW7A 3FM3A 4WX9A 3EYYA 4YG2F 4P5OA 3P9CA 3WTUC 1DPUA 1U8RA 3IC7A 4FHTA 5D4RA 2ZXJA 1USSA 1R5GA 1FLIA 2CO5A 2IA0A 3RTRA 2HOEA 2VC0A 3P9KA 2EFOA 1LEBA 2DTRA 4UV9A 1VTNC 1Z6RA 2ELHA 5L3FA 2EK5A 2P8TA 3MAJA 1JE8A 5L3DA 1KYWA 1K78A 4LGWA 2IT0A 2E7XA 2W25A 5LHHA 2A3SA 1XCVA 3HHGA 2M8EA 4U0VA 4ZH4F 3GFLA 5ILSA 4IRIA 4G8XA 3VFZA 2VBYA 2W24A 2EV0A 2W57A 1BM9A 1XDSA 3FX3A 1WI9A 2P7VB 1XB4A 3FXRA 1KU2A 3FZVA 2E7WA 1ZYRF 3SZPA 1MJ9A 4XRFA 1ZRCA 3B02A 2H94A 5E1WA 3RDIA 4A6EA 5D5WB 1YLFA 3QU6A 1MDMB 2H6BA 1LDJA 1ZLKA 3KP3A 1ZARA 3L9FA 4RB1A 4CGZA 5HDGA 4IRHA 1O7LA 4DNCA 2QUFA 4LD5A 4YFKF 1QO0D 2CG4A 4Y13A 2DI3A 2MLKA 2DK8A 3ULQB 3BPXA 4I01A 1WKMA 2P5KA 4GCVA 4WXDA 2BYVE 3OV8A 2W84A 4FX0A 3FWEA 4G7OF 1IAWA 3KFWX 1UB9A 3JSPA 3C1DA 2M1BA 3GYHX 2IPQX 2STTA 1P92A 1O3QA 4M9SA 1SD7A 3M8EA 1KYZA 4NHJA 2BGCA 2YR2A 3CUQB 3J80Z 3F21A 1MDMA 1IXCA 3O2PE 5BS6A 3J80K 1SFUA 1WQ2A 3WGHA 4A2UA 3E5XA 2HQNA 3TDZC 2YSRA 3KEOA 3ABUA 2C6YA 1KQ0A 3GW2A 4ZZDA 3FMRA 1IN4A 4KMFA 4OOIA 3L00A 1HKTA 3I64A 3NEUA 4AWXB 3R4KA 5E18F 1DDNA 2XROA 4A5NA 5FB2A 2QVOA 2EFQA 2RV8A 2CSOA 1K7AA 4XBFA 4PDKA 3BZ6A 2Q2EA 3EQLF 5D5UB 3HTUA 2HYFA 3IWFA 1FYKA 2D45A 2FBHA 4PGGA 2X4HA 4RAZA 4YIFA 3I59B 3CUQA 1TW2A 3DP7A 4IF4A 4LK0F 4S05A 3GUDA 3KLNA 1TQMA 1UHWA 1ZREA 1OMIA 3DXJF 2KIUA 4PCQA 2TDXA 2HTJA 2CFXA 2GAUA 3IRQA 1W5SA 5ERIA 1XDUA 4P9UA 1FNNA 3RJPA 4OIOF 4OMYA 2H27A 1DP7P 2J5OA 1FP1D 2O61A 1NHAA 2VBZA 1CF7A 3DFGA 1DUXC 3Q9VA 1SMTA 5ICCA 2M87A 3FMQA 5TJJA 3FHZA 1B59A 1EV7A 1FX7A 1G3SA 3IHUA 4BXUA 2HKOA 4RB0A 2GXGA 3KP7A 1ZAOA 1FP2A 4L18B 1T2KA 2NS0A 5H6QA 2L4MA 3REOA 2XASA 3F8NA 4DQ2A 5H20A 1R36A 1Z7UA 2Y0MA 4LJZF 4XLPF 4R8HA 4P55A 3ZMSA 4BYYA 2EFNA 4G94A 1S3JA 4ASNA 2JZYA 1FWZA 1KGSA 3FXQA 2VE8A 2QBYB 3SQNA 5D8LB 2PJPA 1R58A 4NB5A 4HQEA 4EJVA 2DFIA 1R1TA 1MGTA 3KE2A 2OA4A 2XAHA 3MFKA 1ZGAA 4OINF 1WRJA 2XAJA 3KZYA 4KICA 2P6SA 3GVAA 1SFEA 1H0MA 4UUVA 2ZNZA 3TO7A 1KU9A 3LAPA 4G7HF 1B6AA 4RGUA 1S29A 5LRRA 1ZRFA 2DPUA 1I5ZA 2CGPA 3GXOA 4KUMA 4CHUA 3WTWC 3S2WA 1IN6A 1LVAA 2NNNA 2V79A 1J9IA 2O0YA 4HX7A 1R7JA 3ZMVA 4IHTA 2O6GE 2LSOA 2O3FA 4L9VA 3HTSB 2QBYA 3F8MA 1H9TA 3WTZA 4E70A 4OIPF 3WE3A 2NNYA 2FMYA 1I6XA 5L3CA 3K1MA 2VBXA 4HDVA 3F22A 4LG0B 2ZO4A 2XGXA 2ZNYA 5HS7A 1T6SA 1X3UA 1TNTA 3PFIA 3WTSC 2QM3A 1EH8A 2V1XA 5LEJA 4HAMA 2A61A 2Z3YA 3DPLC 1Z9CA 1JXSA 2DBBA 5DUKA 3IRRA 1D8JA 3HRSA 1IRFA 1U3EM 3WGGA 1HW5A 5D8KB 5CVIA 4U7DA 4KIGA 2STWA 1YQAA 5D4SA 3DV8A 1BC7C 1B9NA 4N9IA 3WTVC 2MH2A 3IKVA 1SD4A 3FMSA 4IJAA 1ZG1A 1YIOA 2EB7A 1GHCA 3Q9SA 2G7UA 2JTVA 2R7DA 5LHIA 2OBPA 4MTEA 2LF7A 3CUQC 3I58A 3ECOA 1O3RA 4UXNA 1YS6A 3BOQA 3SHFA 1HW2A 3GZ5A 4M71A 5CVJA 2EFPA 2HZTA 2DU9A 2UXXA 2P5LC 5IT3A 2WV0A 4RB3C 1BIBA 1TQPA 4A0XA 4GXOA 3KZZA 2GA1A 1TLHB 3HRMA 4L9TA 2QLZA 4OIRF 1XSVA 2EV6A 2DLLA 4BHPA 2B0LA 3CO6C 3WTYC 4M73A 4A5MA 1OKRA 5JHUA 2HWVA 2PLYA 2VBWA 1K78B 2R7FA 1IW7F 2K4BA 4EM0B 3V7CA 4A12A 3WGIA 3FM5A 3IL2A 4L9JA 2FBKA 3W6KB 3GWZA 3QPTA 1TQIA 1YS7A 4HX4A 3T8TA 2DO7A 4RAYA 2Z5UA 5HVQC 3R6SA 5BOXA 3TO9A 2E1NA 1IXSB 2JPCA 4I02A 2HYGD 4I0AA 2BBYA 3K69A 4K2EA 4I7HA 1XGNA 2XAGA 2L02A 5BPIA 3ERED 3VOEA 2K7LA 2A69F 3BJAA 3ZP5A 4I98B 3MZHA 5D6FA 1C0WA 3Q5FA 1I1SA 4KA4A 5DCMB 4HV6A 1XGMA 1W7PD 4CZZA 2UWMA 1J75A 2PBIA 4Y17A 2Q8KA 4UNOA 4IRGA 4B09A 4HW0A 2HEOA 5AONA 3WTXC 2Y75A 2WTEA 4S04A 4P96A 4BNCA 2V9VA 3ECHA 4AIHA 1R23A 2NYXA 4A0YA 5J8FA 2OZ6A 5A2QZ 3PQKA 1Z05A 3F6OA 3EETA 2ZFWA 5A2QK 1ZLJA 3KP4A 1P6RA 2FA5A 1O3TA 3JTHA 1HQCA 3TOAA 3MWMA 2Z99A 1B9MA 4UV8A 4L0YB 2F5EA 2IA1A 2JRTA 5DCMA 3HSRA 3KCCA 1EH6A 1K6OA 2DQLA 1RZ4A 4WXCA 2UZKA 1FYMA 1BI2A 2ZBKA 3LA3A 4KYWA 4BHCA 3R61A 1P4XA 4CDGA 3R0JA 1F4KA 1IXRC 3E5UA 5JVTA 4AIJA 2PQ8A 2GQQA 4F7ZA 3LA2A 1H9GA 4LB5A 2BE5F 3CTAA 4KDPA 1JHHA 2OU2A 2PG4A 2GWRA 3V8KA 2L4AA 2MA3A 2IA2A 3PQJA 3I5UA 2ZCWA 4LFUA 1REPC 4BAYA 3N4MA 2EA2A 1R5HA 4ESBA 1S7AA 1OPCA 2EA4A 2RVCA 4ESJA 2ETHA 1S7OA 3QOPA 2FQ3A 4MGRA 1IN8A 1ZRDA 4Z2YA 5ED4A 3T0YA 3E6CC 1G3TA 2V6CA 2MH9A 3I0TA 4EMSA 3QRFF 5FFZA 2M30A 1LQ1A 1CF7B 1YFHA 2KJBA 1Z1DA 1J5YA 3O6BB 4JK1X 4Q48A 1XSDA 1HSJA 5E1ZB 4IPAA 1AWCA 2A6EF 1EH7A 3WG9A 2GZWA 4BH9A 2FE3A 1GVJA 1ONVA 2MC3A 1QQIA 1QZZA 3TDUC 4EM1A 2VODA 5FO5A 3GFIA 2COMA 1LB2A 5LRSA 3DPTA 5E8IA 5AIPA 5DDGA 3TOBA 3AAFA 4BQAA 4KMUX 3RKXA 2XUBA 1FSHA 2FNPA 2P6TA 3LFKA 3U9GA 4MQ9F 4FX4A 5FLXZ 5DUIA 2G9WA 2OQRA 4NQWA 5HLHA 5L3GA 1JHFA 2DT5A 5FLXK 3HOTA 1FPQA 4MTDA 1AOYA 5LEKA 1B4AA 4MHGA 4I0BA 5K1YA 1XN7A 3L09A 2VT2A 4IHSA 4MNUA 1DPRA 1R1VA 1V4RA 1G4DA 4Q47A 4UHTA 1QNTA 3DF8A 3SXYA 3BY6A 3K1NA 1BIAA 1ON2A 1KA8A 1O7FA 1ZN2A 3RPQA 3QU3A 3SZTA 3TO6A 3E97A 1W5TA 2KIMA 2V1UA 1OYWA 2EJRA 5DCFA 3LQRA 1IN5A 5EEHA 3M9AA 5H6RA 4KIFA 2K86A 1I1GA 1K79A 1V3FA 4EV0A 1WSUA 3H3ZA 3ABTA 3ELKA 1U5TB 1UCRA 5E17F 4JQFA 1UHMA 2KJCA 3HIFA 3EYIA 4IXAA 3L2CA 5E1XA 2IP2A 2KRFA 3F3XA 2FBIA 5ICEA 3V8LA 1PP8F 1J7KA 1GXPA 2HTSA 3P7NA 3GX4X 1D3YA 2DPDA 3KP5A 2RGVA 1R1UA 2JSCA 5FGMA 5FFXA 3J81Z 4M9ZA 4PGHA 4EJUA 3M8FA 1TBXA 4N0BA 2F5DA 3J81K 3CO7C 4ENKA 3ZPLA 1RUNA 3ZMDA 1YW8A 2UXNA 1TTYA 2DQRA 3ZN1A 2L54A 4G6QA 4ZYEA 1A04A 3GFMA 5CJ9A 1U5TA 3OOPA 3V4GA 2G7HA 3U2RA 2RDPA 2GA2A 2Z33A 1W7PA 5KVRA 1ZG3A 2PI0A 3RPUA 3T8RA 1XGSA 2OQGA 1LNWA 1LEAA 3JTGA 1Q1HA 3E6BA 3R60A 1U78A 4UVCA 4ZYDA 2CWEA 2YX7A 1XSXA 1FZPB 5CYVA 2NRAC 2ISYA
chains in the Genus database with same CATH superfamily
1J2XA 4HQMA 1IRGA 2OD5A 3NQOA 2BVMA 3CMMA 2XGEA 3CJTB 3OR2C 3FISA 1RC9A 5HDKA 4M74A 5H2FC 5J1UA 3DQVC 4OU0A 3ZMTA 2IJLA 4GGGA 1ZR4A 4HEA2 1AKHB 3VEPA 4PJJA 3E6DA 2FU4A 1WCMJ 1WFXA 2RQQA 5ILUA 4LMYA 1XD7A 3DKWA 4BY1J 5GAGJ 2ZXHA 2MLGA 4UB6C 2LVSA 1P4AA 1BI1A 6PAXA 3D5RC 4MEYF 4XLFA 4E7SA 4EM2A 1R9TJ 1KU7A 4RMNA 3H5NA 2TCTA 1XMAA 2K9QA 4NC7A 3ZQHA 5K5OA 1ZK8A 1L0OC 3ASNH 2FOWA 5HS9A 4AIKA 4KN4X 3LSTA 1DGRM 1FYLA 5K5QA 4CCLA 5CVUA 3QAHA 2O03A 1G6NA 5JR3A 1VQLI 2GLOA 4X6AJ 4KISA 3G3ZA 3OYKA 4OWRB 2YU3A 4D0PA 4UUTA 1RNLA 4II3A 3KETA 1ZH5A 1MZBA 2XHKA 1U6GA 1B1BA 1TP4A 2H1KA 4CCNA 1Y0NA 1MMDA 2KPMA 4BU2A 3IV5A 2QSFX 5F08A 4G6TB 1F43A 2ZJRF 3O8GA 3M8JA 2HOTA 2CUJA 3OIPA 3RKYA 3VB2A 1CQTA 1FY7A 1ULYA 2M3AA 1MKMA 2QQBA 4BGDA 3BG9A 2HS5A 5CQGA 1AKHA 2QSHX 2I8DA 3M07A 4BACA 3HG9A 4QSHA 5EZHA 3LQQA 4KFCA 5KCMA 3KP6A 2L9VA 3AG2H 5K5RA 1ZQ3P 1GUUA 3H92A 1PP7U 1HXDA 1PDNC 3J81R 5J4YA 4ENMA 5F27A 1WJFA 2WC2A 2DAOA 2EPFA 2RKHA 3GLXA 1VZ0A 3M1EA 4EGYA 1ETWA 2FOKA 2EBIA 2WY7Q 1FC3A 1QHHD 4B3XA 4H0EA 1D0ZA 3CCQI 1N77A 1KQ8A 5KNLA 3C7JA 2AXTC 2CW7A 4EJWA 4M9XA 1TW3A 2ACJA 3A01B 1RIOH 2LNBA 1VNDA 4B4CA 5EEGA 3K6GA 5CKTA 2EIJH 4WWCA 2VC1A 5LFAA 5L3BA 1Z67A 1FT9A 1K4TA 1MJBA 2XB0X 3C2GA 3JSOA 2NAZA 2D1HA 3QPSA 2COBA 5L3EA 4BQNA 1DQUA 1S8NA 1WH7A 5ICFA 2DTZA 1E2XA 2ZC2A 3ZQCA 3F8FA 3ISPA 3CCUI 5EG0B 5JVGF 4LIUA 3PL8A 4ENNA 4W1UA 2KRHA 1JGSA 3GEZA 2NVTJ 1F9NA 3K1PA 1RPWA 1DP3A 2R7SA 3P9IA 4WK8F 4G6DA 1MSFC 5KAIC 3HOSA 2G0EA 2XAQA 1ETOA 1ON1A 3J7AO 2DODA 2ZXWH 2XKPA 1HSTA 3I54A 3G73A 1HOMA 4A3CJ 4N9HA 4MQVA 4M72A 2EWNA 3I71A 5E20A 2H1LA 1R00A 3R0AA 4G9YA 4RS8A 1J59A 3MQ0A 2HVRA 4C3IJ 3A2KA 2MD5A 1LDDA 1S6LA 1W36D 3GBGA 4D5FA 1EKEA 4KT6A 3C2BA 2EFWA 3WU1B 1FOWA 1ZTRA 4NDLA 1WJAA 4UVBA 2OCEA 4CYDA 4I99C 4IHXA 4QLCU 1Q1VA 2FXAA 4A3DJ 4EEFG 3A01A 2MFZA 1NH3A 1U0JA 1YYVA 2R7UA 4IHVA 4CXFA 2F5FA 2ZKZA 3S8PA 1HA8A 2XAFA 4U0YA 1ORKA 2L9SA 3E6MA 3MN2A 1G3YA 4L5JA 4ZYAA 2Y48A 5D5XB 3TP3A 1X58A 3ZMZA 3HKZA 4BEHA 4Q4ZF 2VOOA 1Y39A 3GO5A 1U8BA 2QKLB 3F8CA 4LLNA 3IP4B 1WJCA 3VODA 1P2FA 3CCEI 2VOPA 2GIVA 4KIBA 2QWWA 2XRNA 2CW8A 2H09A 4O6JA 2XDVA 4C9YA 2HQ5A 1L3LA 1E0EA 3VDXA 4I2OA 3MEXA 5LGTA 1UG0A 4O5VA 3BR5A 4DYRA 4M6XA 1SFOJ 2E34A 4E7ZA 2QQAA 2UUZA 4CICA 2WADA 3ZMUA 2JA8J 1YRNB 3GTOJ 4OMZA 5F6FA 2K27A 1LFPA 1LDKB 3QYFA 1VQ6I 3BPVA 3ZQ7A 4XSXF 4EJOA 1T98A 2WV1A 1WJDA 5HLIA 3TKYA 5B66C 5HDNA 5B1AH 2Z9OA 2LF8A 1N75A 4ENJA 4BQOA 2M0MA 4R79A 4EGZA 3OWTA 5DEQA 2FSWA 5BMZA 2OCCH 5DD4A 2F6CA 2VKDA 3HYIA 3V42A 2D2WA 2LDUA 2PMZN 4WF2A 4AIDA 1U5TC 4EQQA 2GIZA 3B73A 4BL0B 1RUOA 2PEXA 1D1AA 2ZJ2A 3D0SA 3HB9A 3DCFA 1OYIA 2ELJA 1MMSA 1MH4A 1VQ9I 2GOXB 4HBLA 3TBIA 1ZG5A 2HFHA 3OIQA 3IKTA 5CVRA 1XCBA 1TL8A 2XKOA 2VJIA 1X1PA 2F2EA 2LK2A 2BY3A 4XNFA 2KZVA 5HLGA 4KT5C 4C2MJ 4AM3A 4XLNF 3KLOA 4RB2C 2E2JJ 1LKXA 4BXXJ 4C3HJ 4RBOA 2JPBA 3LSIA 3BWGA 4V19K 4JOMA 3RIRA 1I27A 3QQAA 2KP6A 3F8BA 4HF0A 1T39A 4XRSA 1MW7A 1LJ9A 1JJ6C 1MBHA 2XSJC 3K4BA 2RNJA 1B8IA 3S1MJ 1XMKA 2CQQA 4CCMA 5ICGA 1P7IA 1SD5A 1HKSA 4LLLA 1W4MA 1KQ9A 3DEUA 3HPGA 4LLGF 1UFMA 1V5FA 1OQYA 3H35A 2DDAA 2D1VA 3ZQIA 2Q0OA 1MNDA 4ZYGA 2AS5F 4HYEA 3O3KA 3HRUA 1G2HA 3HXLA 4GYIA 5KAFC 3HSEA 1PJRA 3LSKA 1FIAA 3BZKA 5LBQA 5HLTA 4GRIA 1FOKA 1O57A 2IW5A 2VXZA 2X6OA 2JUCA 3H5AA 4OAZA 3OS1A 3IWZA 4U0WA 2JT1A 3BDDA 3K2ZA 4JBAA 5DV5A 3AL0C 1YO5C 1JUSA 1X3ZB 3KEQA 3DKYA 2IGNA 3RI4A 1OYYA 2HZDA 3P5JA 3D1NI 4M3FA 3BP8A 1G8XA 3IAS2 2O8XA 2DA1A 4F91B 1T38A 2H8RA 2ISZA 1X1AA 1TNSA 4WCGA 1K4SA 4OIQF 4A6DA 1YHQI 3L2VA 3MZYA 4RDUA 2RNGA 1HF0A 4KITB 2QQ8A 3E3VA 3AFHA 3H0GJ 1XGOA 2HPMA 4GYGA 2QF7A 3WTTC 2OTLI 5KK1A 1ETYA 3RYPA 1BI3A 5J6XA 4F3QA 2M45A 2BXZA 5LGUA 3HUGA 2V1DA 2MYSA 3OYMA 4RM2A 2NS8A 2QKMB 4BDZA 4P1WA 2WAFA 3JAMZ 2FMLA 3M7GA 2QYOA 3JAMK 1WJEA 1WJBA 4HG2A 5IOZA 4IHYA 1MD0A 2X9DA 4ZDLA 5J3LA 5M3FJ 2BXYA 1RKWA 4B8XA 1AA7A 2RN7A 1Y8RB 1QBJA 3F9KA 3C18A 3HSFA 1FOYA 1ZKGA 3V7SA 1GV2A 1JTXA 2X0LA 4HDUA 1WH5A 3DTKA 1Y0UA 2BHZA 1Z91A 2DMQA 3FK7A 3PUFA 1BI0A 2LREA 4MIMA 4RGSA 2LY1A 2KFDA 1PUFB 4NC6A 1JT6A 2VT3A 3SYTA 5ILVA 3HRTA 4BE2A 1YI2I 1YX3A 5B5EC 4JX4A 1BR2A 2QEXI 1SC7A 5FD6A 5IPAA 3KP2A 1RETA 3GFJA 3A52A 2GXBA 3FF5A 1Z0XA 2XVCA 3DU6A 3QYBA 2RQPA 3C2HA 1IDYA 3CC4I 3PJRA 4A3IJ 4YFNF 4AD9A 1WI3A 4Y15A 3CDIA 2VONA 3ML6A 3DWLE 3FIWA 3UNGC 2KHMA 3BTCA 3EUAA 4A3EJ 1ZHFA 4LB6B 4DW6A 2YU9J 3ROUA 2EH3A 1FSEA 3V7RA 1ZGJA 4HX8A 1RR8C 1I3QJ 1RQ6A 5F64A 1XS9A 4ZZLA 1Z3YA 5LHGA 1LVKA 1MJAA 3E5QA 5F1JA 2V1NA 3OYBA 1A6QA 2KMUA 4G7ZF 2NVQJ 1ETVA 3NARA 3EUHA 4IVNA 3PSIA 2WWYA 3I59A 2L3DA 1D8KA 4QIWN 1Z6TA 1ZGWA 2XIGA 4XL9A 4E4HA 2EV5A 3PO3J 2NS7A 4FISA 3T5XA 4Z6YA 3LSGA 4XSZF 3CDHA 3WODF 1HW1A 1D5VA 2HVQA 4HA8A 4XRSG 1WZ2A 2R4GA 4JX5A 4A3LJ 2R5YB 1TC3C 1ODDA 2D5VA 1IG7A 2F4IA 1I50J 3K0LA 2CUEA 5JFRA 2CV1A 3GZNB 1SAXA 4J19A 3QWLA 1QVTA 2MBFA 2ZSIB 4PZJA 3BR6A 4J01A 2A5YB 3WU0A 2LKPA 1QPMA 2CYYA 3CUOA 2K3FA 4FE7A 3FKJA 1P4WA 2Y69H 3BJOA 3DPUA 4HSTA 4ETSA 2QQ9A 3OS0A 4N4OB 1IUYA 3VPRA 1FBUA 2FEZA 2E35A 1IN7A 2YPRA 4U7BA 5FLVA 5FKMA 3BTLA 3MKWB 2PJRB 1W7PB 1YITI 1XG1A 2IVMA 4XRMA 5JLWA 2HOAA 5IYCJ 4E7JA 2P7CB 1UELB 2P4WA 2DK5A 3SEQA 4HZFA 1OLTA 3I4PA 2MG4A 4RGXA 2HKXA 3V8JA 4I09A 4GO1A 2E1OA 3VYUB 1FTZA 3GF2A 3SFZA 1SFXA 1RI7A 1UHSA 5TRDA 3LL7A 2BW3B 3BJ6A 5BQTA 5HNFA 1KU3A 5FD5A 4ON0A 2MD0A 3I53A 2R5YA 1LE8B 1LFUP 1PUEE 4LOCA 2BY1A 1SD6A 2IS4A 3H9JA 4Q5SF 1TT0A 3F6VA 5D6EA 1QRYA 2L2OA 3OMYA 3OYIA 4QPOA 3CCVI 1BOAA 2M8GX 4TV7A 3JRIA 2BV6A 3RKWA 1JGGA 3E7LA 3H0DA 4EJTA 3L7WA 2K4JA 3WE2A 4DZJA 4AYBN 4PJLA 1CGPA 2ESNA 2NXNB 3PNYA 2LRDA 4FTHA 1R22A 3PIPF 3LAJA 5IT9Z 5E8GA 2QENA 1S72I 4IQ4A 4YIIA 3F0CA 1VF9A 1DU0A 3HEFA 2OUMA 5M3MJ 5IT9K 2L7MP 2PJRA 3F23A 2ADUA 1A31A 2O7OA 4KNYA 2HQRA 1G3WA 3OY9A 2E2HJ 2ICWG 1JKPC 3AL0B 3SJMA 1H88C 1O4XA 2A07F 3D5LA 1BBYA 4HF2A 1IZ1A 1BJAA 2RC4A 2KIFA 3GZ6A 4B43A 3K70D 3QP6A 1T0FA 4HLYA 4RA2A 3QP5A 1YG2A 4II2A 3NRVA 3S32A 3S3NA 4LIVA 1E17A 4H4KC 2FRHA 2ZSHB 3VYTB 2PMZA 5DD8A 3MKYB 1QU3A 2EIKH 4XKCA 5JI6A 4IO9F 2BW3A 2XF6A 3Q0UA 1GT0C 2K85A 3SZGA 4RLFA 1Z77A 1STZA 1X1DA 1BN5A 3TQNA 4L9NA 1YIJI 2BEOA 1BC8C 1IF1A 2AXLA 2CQKA 4KJZA 1J09A 3EDPA 5F04A 2V6EA 3E0JB 1QZYA 2VJJA 2W4SA 2M5WA 1GXQA 3RYRA 1MIJA 2F5VA 1HC8A 4HF1A 2K02A 4BS9A 2PMUA 4S0HB 5D5VB 5FRNA 2F5CA 2WB1N 3BQZA 2HDCA 1O3SA 3A4CA 4BHBA 4MO7A 2DOAA 4MEXF 4ZYHA 3LSPA 1RKTA 2R3SA 3U1DA 2ECBA 2JRMA 4WXHA 2EZIA 4U88A 4HV5A 5EEAA 5DYMA 2OZUA 3N97A 2ZMEB 1F1ZA 1APLC 4FT8A 2A6HF 3J7ZI 3MCZA 3KPHA 3HHHA 4YFXF 1OR7A 3BZCA 4JP0A 2FF4A 4PJNA 2HR3A 2L01A 1N78A 2HGCA 1JTYA 5M5YJ 3W2AA 2W1OA 2V26A 1TWAJ 3K4NA 1NG6A 1OFCX 3JW4A 3FXUA 3QPHA 4HNTA 1QGPA 4D1QA 2IRFG 3K70C 2DW4A 1UJ8A 1P7JA 3K9TA 1NK3P 3C3WA 4LG3A 1SANA 1MNEA 2CW0F 2XV4S 5AIQA 1B72A 4XN0A 3SDGA 4EVIA 4ESFA 5M5XJ 1XPXA 3M1CA 3HDDA 3TGNA 2VN2A 5F1RA 2N8GA 1VQ5I 1YW9A 4HRIA 5FKLA 2Y31A 5HOOA 2ECCA 2A68F 1M1EB 1S9HA 4QWQA 5CVVA 1YTYA 1IGNA 1SMYF 5J8CA 3LA7A 3CJNA 4LG0A 1BR4A 1XX5A 1ITYA 3LWFA 4XIDA 1BOBA 1J0RA 4LK1F 1PVEA 1QHGA 3GTGJ 3BG3A 3CLOA 4O3MA 4CO8A 2NVYJ 4P9FA 4E7LA 1MMAA 2KDOA 4L0ZB 5CLSA 4R1HA 1U2WA 5EDNA 4Y3OA 1WGXA 2ZMEA 2ESHA 3CQZJ 3ZN0A 2W48A 1HKQA 1OCCH 3F72A 3BROA 1FBQA 3GTKJ 2E2IJ 1USTA 5HS8A 2W85A 4A0ZA 3KEYA 4DYCA 1DU6A 3MZ8A 2KKOA 5LLQA 2EIMH 4L5EA 2QZ8A 2P5VA 3VSLA 3JRGA 3COAC 2PFBA 3GTMJ 3CCSI 4RGRA 2J5PA 4AVPA 2OAZA 2X6XA 1MBFA 5IT9R 2MVTA 2YX4A 2QA4I 2PN6A 4YEJA 1FMVA 2GOMA 2XGDA 4M6YA 2VE9A 2LY9A 3IH4A 4BEHB 4L5IA 1X19A 4IOAF 2DYRH 1WWXA 1HBXG 3T1BA 4HOBA 4B3AA 2NOGA 1FBSA 3W6JB 5BPDA 3LOCA 3FXJA 1MBJA 3EUHC 1VQPI 4HLXA 5LGNA 1TWCJ 2H6CA 3BG7A 2PMHA 3H3UA 2CQXA 4CZCA 2JA2A 3H36A 2FNAA 3H9QA 4CCJA 2E1CA 4KN7X 2BZTA 3FXLA 3OS2A 3G71I 3M3YJ 4UVAA 4RAGA 1F5TA 3CD6I 3LSRA 1ETKA 1YW7A 3FM3A 4BE1A 4WX9A 3EYYA 3MD2A 4BQQA 3DKXA 5C4XJ 4YG2F 4P5OA 5B3SH 5BNGA 1R6RA 3P9CA 3WTUC 1DPUA 2X6WA 1SAUA 3CCMI 3IC7A 4XOTA 1VQOI 1U8RA 4FHTA 5D4RA 2ZXJA 3CESA 1USSA 1R5GA 2IXSA 2E60A 1IV6A 1GDTA 1FLIA 4ZTJA 1S7EA 2CO5A 2IA0A 3RTRA 2HOEA 2VC0A 3P9KA 2EFOA 4Y52J 1LEBA 2DTRA 4UV9A 1VTNC 1BJZA 2X48A 4PJ0C 1Z6RA 1MSEC 1FIPA 2ELHA 2LR8A 5L3FA 4PK4A 2EK5A 2P8TA 3MAJA 1JE8A 2X98A 4NC8A 5L3DA 2M7AA 1KYWA 2X85A 1K78A 4LGWA 4XLEA 5TISC 2IT0A 5LD2C 3S3MA 2LLKA 4AVZA 2E7XA 2DYSH 1A6IA 2W25A 5LHHA 2A3SA 1XCVA 3HHGA 2M8EA 4U0VA 4ZH4F 4A93J 5IYDJ 4QPQA 4Y33A 2ZJQF 4XKWA 3GFLA 5ILSA 4IRIA 4G8XA 3VFZA 2VBYA 2W24A 2M35A 2EV0A 2W57A 1BM9A 3CC2I 1XDSA 3FX3A 1WI9A 3S3OA 4DOZA 2P7VB 2VQHA 1OJLA 1XB4A 3FXRA 1KU2A 3FXKA 3FZVA 2ZJPF 1T95A 2E7WA 1MBGA 1B8IB 1S5LC 1ZYRF 4A3JJ 2K9SA 3ZQGA 1AU7A 3S1RJ 3SZPA 3H3VK 2DMNA 1MJ9A 4XRFA 5J1YA 3K4KA 3S17J 3K7AJ 2L7ZA 2WAQN 3K4CA 2CFOA 1ZRCA 3BR3A 1Z3XA 2H94A 3B02A 2PX9A 5E1WA 1MBEA 3RDIA 1W36C 5DM7F 4A6EA 5D5WB 2HI3A 1YLFA 3QU6A 1OCPA 1LUJB 1MMGA 2HXIA 1MDMB 2F48A 2H6BA 1W1WE 1LDJA 2MSYA 3KP3A 1ZLKA 3ZOBA 1ZARA 4N4NB 3L9FA 2HXOA 2WA0A 2KT0A 4RB1A 4CGZA 2XPUA 3OYAA 4AC0A 4BDYA 4A3FJ 2L5QA 5HDGA 4IRHA 4IOCF 4CUGA 1O7LA 4DNCA 2QUFA 4BJ5C 3OSFA 3K4JA 4LD5A 4RLQA 4YFKF 2DFFA 3DEEA 1T0FC 4C30A 1QO0D 1YE9A 1ETQA 3OIOA 4PFPA 2CG4A 4F55A 4Y13A 2DI3A 2MLKA 1NK2P 4F92B 2DK8A 2NVUB 3ULQB 3JR9A 3BPXA 3ZXSA 4I01A 1WKMA 2P5KA 4GCVA 4WXDA 1X1BA 2BYVE 2RAEA 2CV2A 3OV8A 3HOXJ 2W84A 3RQIA 4FX0A 2LKXA 3HOZJ 3FWEA 3AG3H 4G7OF 2Q2EB 3HUGB 3Q3SA 1QA6A 1IAWA 5FRMA 2VPRA 1UB9A 3KFWX 3JSPA 2VI6A 3C1DA 1OCRH 5DS9A 1DGWY 2M1BA 3GYHX 2A6TA 3U21A 2IPQX 2STTA 1P92A 1O3QA 1MBKA 4M9SA 4B44A 1SD7A 3M8EA 1KYZA 2B9SA 2Y0SN 4NHJA 2BGCA 2YR2A 2VKEA 3CUQB 4D9JA 3J80Z 3F21A 1MDMA 3ONQA 1IXCA 3O2PE 4XLCA 5BS6A 3PFYA 3J80K 1SFUA 3I9V2 1WQ2A 3WGHA 4A2UA 3E5XA 3JREA 2HQNA 3TDZC 2YSRA 3KEOA 3S2HJ 1OR7C 3ABUA 2C6YA 3OYNA 1KQ0A 2ID3A 3GW2A 4ZTFA 3UR3C 4CYCB 4V2GA 5EF6A 4BBSJ 4ZZDA 3FMRA 1IN4A 3HPHA 4KMFA 4OOIA 3L00A 1HKTA 3I64A 3NEUA 4FQGA 3E1SA 4AWXB 3R4KA 5E18F 5K7ZA 2YUSA 2IAIA 2BHYA 1DDNA 2WB1A 2XROA 4A5NA 1FOXA 5FB2A 2IGMA 3BT9A 1RRJA 2QVOA 2HPIA 3TMOA 2EFQA 2RV8A 2CSOA 1K7AA 4XBFA 4PDKA 3BZ6A 5TGTA 2Q2EA 1IDZA 3EQLF 5D5UB 3HTUA 2HYFA 3IWFA 4YRVA 1Z7LA 1FYKA 5JHFA 2D45A 2FBHA 4PGGA 2VJ4A 4BY7J 2K9MA 3HBLA 2OTJI 2X4HA 4RAZA 4YIFA 1UMQA 1D0XA 3I59B 3WHBA 3CUQA 1TW2A 3DP7A 4IF4A 4LK0F 1ENHA 4S05A 3GUDA 3KLNA 3TEDA 2MABA 1TQMA 4E7HA 1U9OA 1UHWA 3FBIB 4DIQA 1ZREA 3N05A 2R93J 2ZMEC 1VQKI 1OMIA 2EZKA 3AKZA 3GTJJ 3DXJF 2KIUA 4PCQA 2GXAA 2LYCA 1MH3A 1MNMC 4CYCA 4A69C 1G59A 2TDXA 2HTJA 2CFXA 2QCOA 5GTHC 2GAUA 1UZCA 4X1EA 3RQ4A 4DYQA 3S15J 4AUXA 3DBLB 3IRQA 1W5SA 5ERIA 4UUSA 1VI0A 1XDUA 4F52A 3A0HC 3CDLA 4W97A 4P9UA 3I4NJ 1YJ9I 1FNNA 1T8IA 3RJPA 3TP0A 2VASA 4OIOF 1I39A 3HOVJ 2Z16A 4OMYA 3ZCOA 2H27A 5GTIC 1DP7P 3EPZA 1ZELA 4DJAA 1ERDA 2J5OA 1FP1D 2O61A 2EINH 1NHAA 2VBZA 2BY2A 3DTEA 1JUPA 3G4SI 1CF7A 1TT5B 2E1MB 3DFGA 1YOVB 3BTJA 3SFIA 1DUXC 3Q9VA 1SMTA 5J40A 4ZC3A 5ICCA 2M87A 3FMQA 2R5ZB 2DMPA 1SVLA 1U9NA 5TJJA 3LFUA 2X51A 4A3MJ 3RSNA 3FHZA 3CCLI 1EV7A 1B59A 4UY8I 1FX7A 2LH9A 1G3SA 4BUPA 3IHUA 2IEKA 2HKOA 2MC4A 2ZB9A 4RB0A 4BXUA 4CCOA 3L2RA 1EF4A 2GXGA 3ASOH 3KP7A 1ZAOA 4A3BJ 5FROA 5IYBJ 4BKXA 2OC6A 1FP2A 4L18B 2IS2A 3AG4H 3J80R 4NUBA 1T2KA 2NS0A 5H6QA 2L4MA 3REOA 2EQRA 2KIQA 2XASA 3F8NA 1UG2A 4PJMA 4HPQA 3EUKL 3G1LA 4ANJA 2JK3A 4FETA 4DQ2A 5IP7J 4CSWA 3CC7I 3DLLF 5H20A 1R36A 2VPLA 3W2VA 1Z7UA 2K9LA 2L7KA 2Y0MA 4LJZF 4XLPF 2HQAA 2FQ4A 4R8HA 4XLHA 2GBYA 4P55A 3DEWA 3ZMSA 1IV8A 4BYYA 2EFNA 3CMYA 4G94A 4JX6A 1S3JA 3CF2A 4ASNA 2JZYA 4Y7NJ 2TRTA 3S16J 1FWZA 1KGSA 3FXQA 4G12A 2VE8A 5DTDA 2JN6A 1D0YA 2QBYB 2R5ZA 3SQNA 2WAEA 5D8LB 3S93A 2PJPA 1R58A 4NB5A 4HQEA 2DMTA 4EJVA 2DFIA 1R1TA 2QSGX 1MGTA 3KE2A 2JVGA 4C3JJ 2OA4A 2XAHA 3MFKA 1ZGAA 2XF7A 4ZDOA 4GDFA 3JAMR 4OINF 3B6CA 1WRJA 2XAJA 3KZYA 4KICA 2P6SA 3GVAA 1SFEA 2KDZA 1H0MA 2ME0A 5K7FA 3W6VA 4XKBA 4UUVA 2ZNZA 2VQGA 3TO7A 1KU9A 1ETXA 4DZPA 2E19A 2Z2SB 2R0QC 3LAPA 4G7HF 1B6AA 4RGUA 4D7MA 2IS6A 4RAFA 1S29A 5F0HA 5LRRA 1ZRFA 2DPUA 3G1MA 3PO2J 2CU7A 2FJ1A 3O8HA 1I5ZA 4EATA 2CGPA 1F36A 5HODA 1AHDP 1HCRA 3GXOA 2HVSA 4KUMA 4NBQA 2JVHA 2ZFUA 4CHUA 4MFEA 3WTWC 1D5YA 3S2WA 1IN6A 1LVAA 2WAQA 1E3HA 1RR7A 1V55H 2NNNA 2V79A 4IKFA 4B47A 1J9IA 2O0YA 3JRAA 4HX7A 1R7JA 2CJJA 3ZMVA 3JCUC 2W00A 4IHTA 2O6GE 2CMPA 5FKKA 2LSOA 2O3FA 2P0WA 4L9VA 3HTSB 2QBYA 3F8MA 5IY5H 2X1DA 1H9TA 3WTZA 4ABZA 4XKVA 4E70A 5JLXA 1B72B 4OIPF 1BA5A 3WE3A 2NNYA 2FMYA 1I6XA 4FASD 5L3CA 3K1MA 4E7IA 3L2QA 1JJ8C 2VBXA 3A1YA 2DT6A 1FMWA 5FLMJ 2RREA 1XC5A 4HDVA 3F22A 2F4MB 4LG0B 2ZO4A 2XGXA 3FK6A 2E36A 2ZNYA 4QTRA 3JRDA 5HS7A 1T6SA 1X3UA 2JWTA 2VL8A 3W3CA 1TNTA 3PFIA 2XPVA 5IOYA 3WTSC 2QM3A 1EH8A 2V1XA 3BLYA 5LEJA 4HAMA 2R7ZJ 2A61A 2Z3YA 2LBFB 2M4GA 2IGKA 3DPLC 1Z9CA 2OPTA 1FEXA 3NAUA 1JXSA 1R5ID 2JSPA 2DBBA 2LG4A 2E5NA 5DUKA 2GM4A 2XAUA 3VWBA 3IRRA 2LOOA 4CA0A 1BL0A 1D8JA 2LY2A 3FDYA 4DBQA 2I5UA 3B6AA 4B1RA 5J1RA 3HRSA 1IRFA 2Y0SA 1U3EM 3WGGA 2OV7A 1HW5A 5D8KB 5CVIA 3CCRI 2ID6A 4U7DA 1E3OC 4KIGA 2STWA 3L2WA 1YQAA 5D4SA 3DV8A 3ESWB 4CH7A 1B9NA 4N9IA 4RM3A 3WTVC 2MH2A 3IKVA 1BC7C 1SD4A 3FMSA 1X1CA 4IJAA 1ZG1A 3IUOA 4XM3A 3DBRB 1YIOA 4C2UA 1YX5A 2EB7A 4D7NA 3I55I 1GHCA 3Q9SA 2G7UA 2JTVA 2R7DA 3CJQB 2DA2A 3JRHA 3OYJA 2VLAA 3CMAI 3SEZA 1TZLA 5LHIA 2OBPA 4MTEA 4XR6A 2LF7A 3PIOF 2CUFA 3CUQC 1A36A 3I58A 3G1OA 4XLAA 3ECOA 2LMDA 1O3RA 2HU9A 4UXNA 1YS6A 2WY8Q 3BOQA 3SHFA 1HW2A 2KQRA 3U1KA 1QVUA 3GZ5A 1BR1A 4M71A 1OISA 1XTAA 5CVJA 2LBFA 5E79C 2EFPA 3BCBA 2HZTA 2DU9A 3NWSA 2UXXA 3RZDJ 2HOSA 2P5LC 1N25A 5IT3A 3H1CA 2L9RA 2WV0A 3WHCA 4RB3C 3KYDB 1BIBA 1P9QC 3BQYA 3Q0WA 4XORA 4A3KJ 3BR0A 3L2UA 1TQPA 4A0XA 4GXOA 3LSMA 3KZZA 2GA1A 4I6ZA 1TLHB 1PYVA 2Y9ZA 3HRMA 4L9TA 2QLZA 2E71A 1XSVA 2EV6A 5CPRB 4OIRF 2DLLA 2AQFA 5K7HA 1W0UA 4BHPA 1GV5A 1POGA 2B0LA 3CO6C 1E3PA 3DU5A 3WTYC 4M73A 4A5MA 3IAM2 1KONA 1OKRA 3OL3A 5JHUA 4M3EA 2HWVA 4JYKA 2PLYA 1Y1WJ 1JKRC 3G6EI 2VBWA 1K78B 2R7FA 1IW7F 4XONA 2R7VA 2K4BA 2KL4A 4EM0B 2AHQA 3OL4A 3V7CA 1SVOA 2QGUA 4A12A 3WGIA 3K10A 1TWFJ 3FM5A 3IL2A 2DFHA 4L9JA 2FBKA 3BTIA 2VUMJ 4XN3A 3VSKA 3K4MA 3CF5F 3W6KB 3GWZA 3QPTA 2XB5A 1TQIA 1YS7A 4HX4A 3T8TA 2DOEA 5C3EJ 2DO7A 4RAYA 2M34A 2Z5UA 5HVQC 1EA3A 3RCOA 3KYLA 1IO2A 1HDPA 3R6SA 5BOXA 3KX2A 3TO9A 2E1NA 3HOWJ 1IXSB 2JPCA 3FBNB 4I02A 2HYGD 2K40A 4I0AA 4E7KA 4Y4RA 2BBYA 3K69A 1LFBA 4K2EA 1H8AC 1Y8QB 3QOEA 5B1BH 4I7HA 1Z21A 1XGNA 5FKOA 2CQ7A 3OR1C 2JA5J 2XAGA 2DT7B 2L02A 5BPIA 2MUNA 2CRGA 1QPIA 3ERED 3VOEA 2DA3A 3ZRGA 2K7LA 2B63J 2A69F 2DJIA 3BJAA 2VB6A 3ZP5A 4I98B 2DA4A 2M9HA 3MZHA 5D6FA 1C0WA 3Q5FA 5E3LA 1Y1VJ 2V4JC 1I1SA 4KA4A 3HZJA 5DCMB 3FXOA 2HDWA 4HV6A 4IX7A 1K6YA 2KLOA 3PM1A 3BG5A 3CZ6A 3QPLA 3MKLA 2MZ4A 1XGMA 1W7PD 4CZZA 3LNQA 3WU2C 3MVPA 2UWMA 4AU7A 1J75A 2PBIA 2E1MC 4Y17A 2Q8KA 3QODA 4UNOA 4IRGA 3LSJA 4B09A 4HW0A 2HEOA 5IP6A 5AONA 3RPUD 2Y75A 3WTXC 1X4PA 2WTEA 2ZXIA 1KZHA 4DGWB 4S04A 4P96A 4BNCA 2V9VA 1K83J 3ECHA 1VQMI 5EG0A 4AIHA 3NWTA 2UV1A 2DA7A 3CCJI 1R23A 2NYXA 1VQ8I 2K3PA 2MW8A 4A0YA 2LFBA 5J8FA 2OZ6A 5A2QZ 3PQKA 1Z05A 3VYSB 3F6OA 3CP2A 3EETA 2ZFWA 4PFOA 5A2QK 1ZLJA 2V7FA 3KP4A 1P6RA 4IQJA 1R4NB 2FA5A 4LITA 1O3TA 3J7YJ 3JTHA 2Q1ZB 1HQCA 2R7RA 2XRLA 1JKOC 3OSGA 2O9LA 3TOAA 3MWMA 2Z99A 1HDDC 1WPKA 3A03A 1SFKA 2JA7J 3FKIJ 2A5WA 4YELA 1B9MA 4IZZA 4UV8A 4L0YB 4DBRA 2R7TA 5DM6F 1ACIA 2F5EA 2DOFA 2IA1A 2JRTA 4I76A 5DCMA 3HSRA 3KCCA 3ABMH 1EH6A 1K6OA 2DQLA 3S1QJ 3GTQJ 1X3WB 1RZ4A 2AO9A 4WXCA 5CQEA 3DBHB 2UZKA 1FYMA 1BI2A 2ZBKA 3LA3A 5KHDA 3HOYJ 4UB8C 4AYBA 4KYWA 1QZEA 4BHCA 3R61A 1X2NA 2XF5A 3LMMA 2L0KA 3DTIA 1OCTC 4PSXA 1P4XA 2R7QA 4CDGA 2HDDA 2EZHA 4E6KG 1IC8A 3R0JA 1F4KA 1IXRC 3E5UA 3S1NJ 3CJRB 1MMNA 2Y30A 4V2FA 5JVTA 4AIJA 2PQ8A 2GQQA 4F7ZA 4IL6C 4BJ6C 5EJCA 4ZJZA 2DXIA 1H89C 3LA2A 2XGCA 1H9GA 3BCAA 3RKQA 2AQEA 4LB5A 2ELKA 2LP0A 3A02A 3OYDA 2DA5A 3CLQA 3WG7H 1YRNA 2BE5F 2P81A 3SDBA 4BBRJ 3AG1H 3CTAA 4KDPA 1JHHA 2OU2A 2PG4A 4XMYA 3GTLJ 3J7AW 2GWRA 3V8KA 1WJ5A 2L4AA 2JA6J 1HLVA 3M4OJ 3ZQQA 2V9PA 1I6HJ 2MA3A 2IA2A 3PQJA 3IH3A 5M5WJ 1IUFA 2ZCWA 3I5UA 4LFUA 2W7NA 1REPC 4BAYA 1JKQC 2NOJB 3N4MA 2EA2A 1NG7A 1R5HA 4ESBA 2CQNA 1S7AA 1OPCA 3G2BA 2EA4A 2BY0A 3TL4X 5E3OA 1W5CC 3JRFA 4M3GA 2VIXA 3I3LA 3CCYA 4UUSB 2RVCA 3ABLH 2YS9A 5IP9J 2ETHA 4ESJA 2H8WA 1S7OA 1V5GA 2FD5A 2Y2ZA 3GLLA 3QOPA 3ZQFA 1IJWC 1EJ9A 2FQ3A 2IBDA 4MGRA 5FKNA 5GAEJ 1IN8A 3JRCA 1ZRDA 4Z2YA 1YJWI 5ED4A 3K4LA 3T0YA 3E6CC 2CV0A 2M4KA 1G3TA 1XMXA 2LKSA 2V6CA 2MH9A 2DDBA 2DCEA 3HGGA 2FUG2 4IHWA 3I0TA 4EMSA 3QRFF 2P0TA 5J47A 3OYGA 3FHNA 5FFZA 2M30A 5GPAA 4NQWB 2VQCA 1IRZA 1LQ1A 1CF7B 1UAAA 2CS3A 2Y9YA 3PSFA 3ZQLA 1YFHA 2DA6A 3BC8A 2KJBA 1RESA 1VQ4I 2X6YA 2V9KA 1Z1DA 1J5YA 3O6BB 4JK1X 4Q48A 2W82A 1ZR2A 1XSDA 1HSJA 1V5EA 1D1CA 2IGOA 2DFEA 5E1ZB 4IPAA 4IEJA 1AWCA 5EGOB 4BE0A 3GTPJ 2A6EF 2HNHA 1EH7A 3WG9A 2A05A 4OAYA 2GZWA 4BH9A 1X2MA 2FE3A 4ZDPA 2DMUA 9ANTA 5A2QR 1GVJA 3PUBA 2IS1A 3PNVA 1FTTA 1NTCA 1ONVA 1TWGJ 2MC3A 2VJ5A 3A0BC 4U87A 3TW6A 1QQIA 1QZZA 3OYCA 3TDUC 2KZGA 3HJEA 5HNHA 2BOLA 4EM1A 3TW7A 4MLOA 4B48A 2VODA 4HNUA 2LC2A 2L9NA 5FO5A 1D1BA 3GFIA 3BG6A 2COMA 5E3MA 2I10A 1LB2A 5LRSA 3DPTA 5E8IA 3ERMA 5AIPA 5DDGA 5EZGA 1T33A 3TOBA 3AAFA 4BQAA 3HGYA 4KMUX 3RKXA 2XUBA 1FSHA 3ZR8X 2FNPA 2P6TA 3LFKA 2XSDC 3U9GA 4MQ9F 3BR2A 4FX4A 5FLXZ 5DUIA 4FCYA 2G9WA 2OQRA 4NQWA 5HLHA 5L3GA 4A3GJ 1JHFA 2DT5A 5FLXK 1WHUA 3HOTA 1FPQA 3I4MJ 4MTDA 3GCMA 1AOYA 3OYFA 5LEKA 1B4AA 2M2EA 4HSRA 3S14J 4MHGA 4I0BA 5K1YA 3DLAA 3BR1A 1XN7A 5EGOA 3L09A 2VT2A 3ZGKA 4IHSA 2KRCA 2R92J 4MNUA 3OOUA 3KZIC 1DPRA 1R1VA 1V4RA 1G4DA 4Q47A 4UHTA 3CMEI 1QNTA 3KYCB 2XPWA 2CUZA 1PUFA 5J4VA 3K2AA 3DF8A 3SXYA 3BY6A 2JQ7A 3K1NA 1BIAA 3X2QH 1ON2A 3HL2A 3HKZN 1KA8A 4ITVA 4M3BA 3OYEA 3OYLA 1O7FA 1JI8A 1ZN2A 3RPQA 3CP8A 1VQNI 3QU3A 1W0TA 2XC7A 3SZTA 1K61A 1T56A 3TO6A 3E97A 1W5TA 2KIMA 1VQ7I 2V1UA 1OYWA 2EJRA 2O8KA 4FE4A 5DCFA 1T08B 3LQRA 1IN5A 5EEHA 1R49A 3M9AA 5H6RA 4KIFA 2K86A 4C2TA 1I1GA 1K79A 3JRBA 2B7EA 1V3FA 4XK4A 4EV0A 3S2DJ 2HYJA 3Q0VA 1WSUA 1GVDA 3H3ZA 3ABTA 5GAHJ 5F0CA 1TWHJ 3ELKA 1U5TB 3IH2A 1UCRA 2CH0A 5E17F 2R7WA 2WBMA 4JQFA 2LTPA 2JUGA 1UHMA 2DN0A 2KJCA 3HIFA 3H9GA 1X4OA 3EYIA 1Y56A 4BXFA 4IXAA 3L2CA 5E1XA 4PSWA 2IP2A 2KRFA 3F3XA 1R4MB 2FBIA 5FJ8J 2ME6A 5EYRA 5ICEA 1GLNA 3V8LA 1PP8F 1J7KA 1GXPA 2HTSA 3VYRB 3PNTA 3P7NA 2MGQA 1SVMA 3GX4X 2R7OA 1Y6IA 5GPCA 1D3YA 3H5RA 2BVLA 2DPDA 1OCOH 3KP5A 1VFCA 1LPQA 2RGVA 4PUSA 1R1UA 2VQLA 3HOUJ 1BW5A 2JSCA 5FGMA 5FFXA 3J81Z 4M9ZA 4BJTA 4PGHA 4CCKA 4EJUA 4M3DA 3LSHA 3M8FA 3KIOA 5C4JJ 1TBXA 4N0BA 2F5DA 3J81K 3CO7C 3ABKH 4ENKA 1YJNI 3ZPLA 3GMEA 4XICA 2L7FP 3OYHA 3ZMDA 1BW6A 1RUNA 3W2WA 1YW8A 2OF7A 5GADJ 4GFBA 2UXNA 1TTYA 2DQRA 3ZN1A 2L54A 3MMYB 5E3NA 3QYEA 2R7XA 1IRXA 1OCZH 4G6QA 4ZYEA 1JUMA 1WVRA 2X1EA 1A04A 3D5SC 3GFMA 4XQFA 4YIRX 3L1PA 5CJ9A 2NVXJ 1U5TA 3OOPA 3V4GA 1I3AA 2G7HA 3U2RA 3UKGA 4NNJA 2VKHA 2RDPA 2GA2A 2Z33A 1W7PA 5KVRA 3J7AY 3RZOJ 4F93B 3I56I 1SEUA 4M6VA 1ZG3A 2PI0A 2FX0A 2VXDA 2Z1DA 2OJED 2E5ZA 4X0GA 3RPUA 3T8RA 2F4OB 2EZLA 1XGSA 2OQGA 1LNWA 1R71A 1LEAA 3FXMA 3JTGA 1Q1HA 5GP9A 2K5CA 3E6BA 4D5CA 2JMWA 3R60A 1FJLA 2O5RA 1U78A 5FLXR 2KISA 2X1CA 1V54H 2CWEA 2YX7A 3HC7A 4MFDA 4UVCA 4ZYDA 1JT0A 1A5JA 4J00A 2EILH 2M7BA 1A35A 1LE8A 4XOPA 2K9NA 1XSXA 2LD5A 1FZPB 5C44J 2VKVA 2JJ7A 5CYVA 2M0CA 5F0FA 2NRAC 3MKZA 2ISYA 2DJNA 3HM5A 4HNVA
chains in the Genus database with same CATH topology
1J2XA 4HQMA 1IRGA 2OD5A 3NQOA 5HDKA 4M74A 3DQVC 4OU0A 3ZMTA 2IJLA 4GGGA 3VEPA 3E6DA 2FU4A 5ILUA 4LMYA 1XD7A 3DKWA 2MLGA 1P4AA 1BI1A 6PAXA 4MEYF 1KU7A 4EM2A 1XMAA 5K5OA 1L0OC 5HS9A 4AIKA 4KN4X 3LSTA 1FYLA 5K5QA 5CVUA 3QAHA 2O03A 1G6NA 5JR3A 3G3ZA 2YU3A 4D0PA 1RNLA 3KETA 1ZH5A 1MZBA 2XHKA 1U6GA 1B1BA 3RKYA 3VB2A 1FY7A 1ULYA 1MKMA 2QQBA 2HS5A 3LQQA 4KFCA 3KP6A 5K5RA 3H92A 1PP7U 1HXDA 1PDNC 4ENMA 2WC2A 2DAOA 2RKHA 3GLXA 3M1EA 4EGYA 2FOKA 1FC3A 4H0EA 1KQ8A 3C7JA 4EJWA 4M9XA 1TW3A 2ACJA 1RIOH 2LNBA 5EEGA 4WWCA 2VC1A 5L3BA 1FT9A 1MJBA 3JSOA 2NAZA 2D1HA 5L3EA 1S8NA 5ICFA 1E2XA 3F8FA 3ISPA 4ENNA 1JGSA 3GEZA 1F9NA 3K1PA 3P9IA 4WK8F 4G6DA 3HOSA 2XAQA 1ON1A 3J7AO 2XKPA 1HSTA 3I54A 3G73A 4N9HA 4MQVA 4M72A 2EWNA 3I71A 5E20A 1R00A 3R0AA 4G9YA 4RS8A 1J59A 3MQ0A 2MD5A 1LDDA 1S6LA 2EFWA 3WU1B 4UVBA 4CYDA 4QLCU 2FXAA 1YYVA 4CXFA 2F5FA 2ZKZA 2XAFA 4U0YA 3E6MA 1G3YA 4L5JA 2Y48A 5D5XB 3ZMZA 4Q4ZF 2VOOA 3GO5A 3F8CA 4LLNA 3VODA 1P2FA 2VOPA 2GIVA 4KIBA 2QWWA 2XRNA 4O6JA 2H09A 1L3LA 4I2OA 3MEXA 5LGTA 4O5VA 4M6XA 2QQAA 4CICA 3ZMUA 4OMZA 5F6FA 2K27A 1LDKB 3BPVA 3ZQ7A 4XSXF 4EJOA 1T98A 5HLIA 3TKYA 5HDNA 2Z9OA 2LF8A 4ENJA 4R79A 4EGZA 5DEQA 2FSWA 5BMZA 5DD4A 3HYIA 2D2WA 2LDUA 4WF2A 1U5TC 4EQQA 3B73A 1RUOA 2PEXA 2ZJ2A 3D0SA 1OYIA 4HBLA 1ZG5A 2HFHA 3IKTA 5CVRA 1XCBA 2XKOA 2F2EA 5HLGA 4KT5C 4XLNF 3KLOA 4RB2C 2JPBA 3BWGA 3RIRA 1I27A 4HF0A 1T39A 3F8BA 1LJ9A 2RNJA 1XMKA 5ICGA 1SD5A 1HKSA 4LLLA 1W4MA 1KQ9A 3DEUA 4LLGF 1UFMA 2D1VA 2Q0OA 4ZYGA 2AS5F 4HYEA 3O3KA 3HRUA 4GYIA 3HSEA 5LBQA 1FOKA 1O57A 2IW5A 2VXZA 3IWZA 4U0WA 2JT1A 3BDDA 3K2ZA 4JBAA 5DV5A 1YO5C 3KEQA 3RI4A 1OYYA 3BP8A 2O8XA 1T38A 2ISZA 1TNSA 4WCGA 4OIQF 4A6DA 3MZYA 3E3VA 1XGOA 4GYGA 3WTTC 5KK1A 3RYPA 1BI3A 5J6XA 2M45A 5LGUA 3HUGA 2V1DA 3JAMZ 2FMLA 3M7GA 2QYOA 3JAMK 1MD0A 4B8XA 2RN7A 1QBJA 3C18A 3HSFA 3V7SA 2X0LA 4HDUA 1Y0UA 1Z91A 1BI0A 4RGSA 5ILVA 2VT3A 3HRTA 5FD6A 3KP2A 3GFJA 2GXBA 3FF5A 2XVCA 2RQPA 4YFNF 4AD9A 4Y15A 2VONA 3ML6A 1ZHFA 4LB6B 3ROUA 1FSEA 3V7RA 1ZGJA 4HX8A 5F64A 4ZZLA 5LHGA 1MJAA 3E5QA 4G7ZF 2WWYA 3EUHA 4IVNA 3I59A 2L3DA 1D8KA 1Z6TA 2XIGA 2EV5A 3T5XA 4XSZF 3CDHA 3WODF 1HW1A 1D5VA 4HA8A 1ODDA 3K0LA 5JFRA 1SAXA 2MBFA 4PZJA 2A5YB 3WU0A 2LKPA 1QPMA 2CYYA 3CUOA 1P4WA 3BJOA 4ETSA 2QQ9A 1IUYA 1FBUA 2FEZA 1IN7A 2YPRA 4U7BA 1W7PB 2IVMA 2P7CB 2P4WA 2DK5A 4HZFA 3I4PA 4RGXA 3V8JA 2HKXA 4I09A 4GO1A 3GF2A 3SFZA 1SFXA 1RI7A 5TRDA 3BJ6A 5BQTA 1KU3A 5FD5A 4ON0A 3I53A 1PUEE 1SD6A 4Q5SF 3F6VA 5D6EA 1BOAA 4TV7A 2BV6A 3RKWA 4EJTA 3L7WA 2K4JA 3WE2A 1CGPA 2ESNA 1R22A 3LAJA 5IT9Z 5E8GA 2QENA 4YIIA 5IT9K 3F23A 2ADUA 4KNYA 2HQRA 1G3WA 2A07F 3D5LA 1BBYA 4HF2A 1IZ1A 1BJAA 2RC4A 2KIFA 3GZ6A 3QP6A 1T0FA 4HLYA 3QP5A 1YG2A 3NRVA 1E17A 2FRHA 5DD8A 5JI6A 1STZA 1BN5A 3TQNA 4L9NA 2BEOA 1BC8C 1IF1A 2AXLA 2CQKA 3EDPA 1QZYA 2M5WA 1GXQA 3RYRA 4HF1A 2K02A 2PMUA 5D5VB 2F5CA 2HDCA 1O3SA 4BHBA 4MEXF 4ZYHA 2R3SA 3U1DA 4WXHA 4U88A 4HV5A 5DYMA 2OZUA 3N97A 2ZMEB 1F1ZA 4FT8A 2A6HF 3MCZA 3HHHA 4YFXF 1OR7A 2FF4A 2HR3A 2L01A 2HGCA 3JW4A 3FXUA 3QPHA 1QGPA 2IRFG 2DW4A 3K9TA 3C3WA 2CW0F 2XV4S 5AIQA 4EVIA 4ESFA 3TGNA 2VN2A 5F1RA 1YW9A 5HOOA 2A68F 4QWQA 5CVVA 1YTYA 1SMYF 5J8CA 3LA7A 3CJNA 4LG0A 3LWFA 1J0RA 4LK1F 3CLOA 4O3MA 4CO8A 4P9FA 4L0ZB 5CLSA 4R1HA 1U2WA 2ZMEA 2ESHA 3ZN0A 1HKQA 3F72A 3BROA 1FBQA 1USTA 5HS8A 2W85A 4A0ZA 2KKOA 5LLQA 2QZ8A 2P5VA 3COAC 2PFBA 4RGRA 2J5PA 4AVPA 2OAZA 2YX4A 2PN6A 2VE9A 4M6YA 4L5IA 1WWXA 1HBXG 3T1BA 4HOBA 1FBSA 3W6JB 5BPDA 4HLXA 5LGNA 2H6CA 2PMHA 3H3UA 2FNAA 2E1CA 4KN7X 4UVAA 1F5TA 1YW7A 3FM3A 4WX9A 3EYYA 4YG2F 4P5OA 3P9CA 3WTUC 1DPUA 1U8RA 3IC7A 4FHTA 5D4RA 2ZXJA 1USSA 1R5GA 1FLIA 2CO5A 2IA0A 3RTRA 2HOEA 2VC0A 3P9KA 2EFOA 1LEBA 2DTRA 4UV9A 1VTNC 1Z6RA 2ELHA 5L3FA 2EK5A 2P8TA 3MAJA 1JE8A 5L3DA 1KYWA 1K78A 4LGWA 2IT0A 2E7XA 2W25A 5LHHA 2A3SA 1XCVA 3HHGA 2M8EA 4U0VA 4ZH4F 3GFLA 5ILSA 4IRIA 4G8XA 3VFZA 2VBYA 2W24A 2EV0A 2W57A 1BM9A 1XDSA 3FX3A 1WI9A 2P7VB 1XB4A 3FXRA 1KU2A 3FZVA 2E7WA 1ZYRF 3SZPA 1MJ9A 4XRFA 1ZRCA 3B02A 2H94A 5E1WA 3RDIA 4A6EA 5D5WB 1YLFA 3QU6A 1MDMB 2H6BA 1LDJA 1ZLKA 3KP3A 1ZARA 3L9FA 4RB1A 4CGZA 5HDGA 4IRHA 1O7LA 4DNCA 2QUFA 4LD5A 4YFKF 1QO0D 2CG4A 4Y13A 2DI3A 2MLKA 2DK8A 3ULQB 3BPXA 4I01A 1WKMA 2P5KA 4GCVA 4WXDA 2BYVE 3OV8A 2W84A 4FX0A 3FWEA 4G7OF 1IAWA 3KFWX 1UB9A 3JSPA 3C1DA 2M1BA 3GYHX 2IPQX 2STTA 1P92A 1O3QA 4M9SA 1SD7A 3M8EA 1KYZA 4NHJA 2BGCA 2YR2A 3CUQB 3J80Z 3F21A 1MDMA 1IXCA 3O2PE 5BS6A 3J80K 1SFUA 1WQ2A 3WGHA 4A2UA 3E5XA 2HQNA 3TDZC 2YSRA 3KEOA 3ABUA 2C6YA 1KQ0A 3GW2A 4ZZDA 3FMRA 1IN4A 4KMFA 4OOIA 3L00A 1HKTA 3I64A 3NEUA 4AWXB 3R4KA 5E18F 1DDNA 2XROA 4A5NA 5FB2A 2QVOA 2EFQA 2RV8A 2CSOA 1K7AA 4XBFA 4PDKA 3BZ6A 2Q2EA 3EQLF 5D5UB 3HTUA 2HYFA 3IWFA 1FYKA 2D45A 2FBHA 4PGGA 2X4HA 4RAZA 4YIFA 3I59B 3CUQA 1TW2A 3DP7A 4IF4A 4LK0F 4S05A 3GUDA 3KLNA 1TQMA 1UHWA 1ZREA 1OMIA 3DXJF 2KIUA 4PCQA 2TDXA 2HTJA 2CFXA 2GAUA 3IRQA 1W5SA 5ERIA 1XDUA 4P9UA 1FNNA 3RJPA 4OIOF 4OMYA 2H27A 1DP7P 2J5OA 1FP1D 2O61A 1NHAA 2VBZA 1CF7A 3DFGA 1DUXC 3Q9VA 1SMTA 5ICCA 2M87A 3FMQA 5TJJA 3FHZA 1B59A 1EV7A 1FX7A 1G3SA 3IHUA 4BXUA 2HKOA 4RB0A 2GXGA 3KP7A 1ZAOA 1FP2A 4L18B 1T2KA 2NS0A 5H6QA 2L4MA 3REOA 2XASA 3F8NA 4DQ2A 5H20A 1R36A 1Z7UA 2Y0MA 4LJZF 4XLPF 4R8HA 4P55A 3ZMSA 4BYYA 2EFNA 4G94A 1S3JA 4ASNA 2JZYA 1FWZA 1KGSA 3FXQA 2VE8A 2QBYB 3SQNA 5D8LB 2PJPA 1R58A 4NB5A 4HQEA 4EJVA 2DFIA 1R1TA 1MGTA 3KE2A 2OA4A 2XAHA 3MFKA 1ZGAA 4OINF 1WRJA 2XAJA 3KZYA 4KICA 2P6SA 3GVAA 1SFEA 1H0MA 4UUVA 2ZNZA 3TO7A 1KU9A 3LAPA 4G7HF 1B6AA 4RGUA 1S29A 5LRRA 1ZRFA 2DPUA 1I5ZA 2CGPA 3GXOA 4KUMA 4CHUA 3WTWC 3S2WA 1IN6A 1LVAA 2NNNA 2V79A 1J9IA 2O0YA 4HX7A 1R7JA 3ZMVA 4IHTA 2O6GE 2LSOA 2O3FA 4L9VA 3HTSB 2QBYA 3F8MA 1H9TA 3WTZA 4E70A 4OIPF 3WE3A 2NNYA 2FMYA 1I6XA 5L3CA 3K1MA 2VBXA 4HDVA 3F22A 4LG0B 2ZO4A 2XGXA 2ZNYA 5HS7A 1T6SA 1X3UA 1TNTA 3PFIA 3WTSC 2QM3A 1EH8A 2V1XA 5LEJA 4HAMA 2A61A 2Z3YA 3DPLC 1Z9CA 1JXSA 2DBBA 5DUKA 3IRRA 1D8JA 3HRSA 1IRFA 1U3EM 3WGGA 1HW5A 5D8KB 5CVIA 4U7DA 4KIGA 2STWA 1YQAA 5D4SA 3DV8A 1BC7C 1B9NA 4N9IA 3WTVC 2MH2A 3IKVA 1SD4A 3FMSA 4IJAA 1ZG1A 1YIOA 2EB7A 1GHCA 3Q9SA 2G7UA 2JTVA 2R7DA 5LHIA 2OBPA 4MTEA 2LF7A 3CUQC 3I58A 3ECOA 1O3RA 4UXNA 1YS6A 3BOQA 3SHFA 1HW2A 3GZ5A 4M71A 5CVJA 2EFPA 2HZTA 2DU9A 2UXXA 2P5LC 5IT3A 2WV0A 4RB3C 1BIBA 1TQPA 4A0XA 4GXOA 3KZZA 2GA1A 1TLHB 3HRMA 4L9TA 2QLZA 4OIRF 1XSVA 2EV6A 2DLLA 4BHPA 2B0LA 3CO6C 3WTYC 4M73A 4A5MA 1OKRA 5JHUA 2HWVA 2PLYA 2VBWA 1K78B 2R7FA 1IW7F 2K4BA 4EM0B 3V7CA 4A12A 3WGIA 3FM5A 3IL2A 4L9JA 2FBKA 3W6KB 3GWZA 3QPTA 1TQIA 1YS7A 4HX4A 3T8TA 2DO7A 4RAYA 2Z5UA 5HVQC 3R6SA 5BOXA 3TO9A 2E1NA 1IXSB 2JPCA 4I02A 2HYGD 4I0AA 2BBYA 3K69A 4K2EA 4I7HA 1XGNA 2XAGA 2L02A 5BPIA 3ERED 3VOEA 2K7LA 2A69F 3BJAA 3ZP5A 4I98B 3MZHA 5D6FA 1C0WA 3Q5FA 1I1SA 4KA4A 5DCMB 4HV6A 1XGMA 1W7PD 4CZZA 2UWMA 1J75A 2PBIA 4Y17A 2Q8KA 4UNOA 4IRGA 4B09A 4HW0A 2HEOA 5AONA 3WTXC 2Y75A 2WTEA 4S04A 4P96A 4BNCA 2V9VA 3ECHA 4AIHA 1R23A 2NYXA 4A0YA 5J8FA 2OZ6A 5A2QZ 3PQKA 1Z05A 3F6OA 3EETA 2ZFWA 5A2QK 1ZLJA 3KP4A 1P6RA 2FA5A 1O3TA 3JTHA 1HQCA 3TOAA 3MWMA 2Z99A 1B9MA 4UV8A 4L0YB 2F5EA 2IA1A 2JRTA 5DCMA 3HSRA 3KCCA 1EH6A 1K6OA 2DQLA 1RZ4A 4WXCA 2UZKA 1FYMA 1BI2A 2ZBKA 3LA3A 4KYWA 4BHCA 3R61A 1P4XA 4CDGA 3R0JA 1F4KA 1IXRC 3E5UA 5JVTA 4AIJA 2PQ8A 2GQQA 4F7ZA 3LA2A 1H9GA 4LB5A 2BE5F 3CTAA 4KDPA 1JHHA 2OU2A 2PG4A 2GWRA 3V8KA 2L4AA 2MA3A 2IA2A 3PQJA 3I5UA 2ZCWA 4LFUA 1REPC 4BAYA 3N4MA 2EA2A 1R5HA 4ESBA 1S7AA 1OPCA 2EA4A 2RVCA 4ESJA 2ETHA 1S7OA 3QOPA 2FQ3A 4MGRA 1IN8A 1ZRDA 4Z2YA 5ED4A 3T0YA 3E6CC 1G3TA 2V6CA 2MH9A 3I0TA 4EMSA 3QRFF 5FFZA 2M30A 1LQ1A 1CF7B 1YFHA 2KJBA 1Z1DA 1J5YA 3O6BB 4JK1X 4Q48A 1XSDA 1HSJA 5E1ZB 4IPAA 1AWCA 2A6EF 1EH7A 3WG9A 2GZWA 4BH9A 2FE3A 1GVJA 1ONVA 2MC3A 1QQIA 1QZZA 3TDUC 4EM1A 2VODA 5FO5A 3GFIA 2COMA 1LB2A 5LRSA 3DPTA 5E8IA 5AIPA 5DDGA 3TOBA 3AAFA 4BQAA 4KMUX 3RKXA 2XUBA 1FSHA 2FNPA 2P6TA 3LFKA 3U9GA 4MQ9F 4FX4A 5FLXZ 5DUIA 2G9WA 2OQRA 4NQWA 5HLHA 5L3GA 1JHFA 2DT5A 5FLXK 3HOTA 1FPQA 4MTDA 1AOYA 5LEKA 1B4AA 4MHGA 4I0BA 5K1YA 1XN7A 3L09A 2VT2A 4IHSA 4MNUA 1DPRA 1R1VA 1V4RA 1G4DA 4Q47A 4UHTA 1QNTA 3DF8A 3SXYA 3BY6A 3K1NA 1BIAA 1ON2A 1KA8A 1O7FA 1ZN2A 3RPQA 3QU3A 3SZTA 3TO6A 3E97A 1W5TA 2KIMA 2V1UA 1OYWA 2EJRA 5DCFA 3LQRA 1IN5A 5EEHA 3M9AA 5H6RA 4KIFA 2K86A 1I1GA 1K79A 1V3FA 4EV0A 1WSUA 3H3ZA 3ABTA 3ELKA 1U5TB 1UCRA 5E17F 4JQFA 1UHMA 2KJCA 3HIFA 3EYIA 4IXAA 3L2CA 5E1XA 2IP2A 2KRFA 3F3XA 2FBIA 5ICEA 3V8LA 1PP8F 1J7KA 1GXPA 2HTSA 3P7NA 3GX4X 1D3YA 2DPDA 3KP5A 2RGVA 1R1UA 2JSCA 5FGMA 5FFXA 3J81Z 4M9ZA 4PGHA 4EJUA 3M8FA 1TBXA 4N0BA 2F5DA 3J81K 3CO7C 4ENKA 3ZPLA 1RUNA 3ZMDA 1YW8A 2UXNA 1TTYA 2DQRA 3ZN1A 2L54A 4G6QA 4ZYEA 1A04A 3GFMA 5CJ9A 1U5TA 3OOPA 3V4GA 2G7HA 3U2RA 2RDPA 2GA2A 2Z33A 1W7PA 5KVRA 1ZG3A 2PI0A 3RPUA 3T8RA 1XGSA 2OQGA 1LNWA 1LEAA 3JTGA 1Q1HA 3E6BA 3R60A 1U78A 4UVCA 4ZYDA 2CWEA 2YX7A 1XSXA 1FZPB 5CYVA 2NRAC 2ISYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2X A;  4HQM A;  1IRG A;  2OD5 A;  3NQO A;  5HDK A;  4M74 A;  3DQV C;  4OU0 A;  3ZMT A;  2IJL A;  4GGG A;  3VEP A;  3E6D A;  2FU4 A;  5ILU A;  4LMY A;  1XD7 A;  3DKW A;  2MLG A;  1P4A A;  1BI1 A;  6PAX A;  4MEY F;  1KU7 A;  4EM2 A;  1XMA A;  5K5O A;  1L0O C;  5HS9 A;  4AIK A;  4KN4 X;  3LST A;  1FYL A;  5K5Q A;  5CVU A;  3QAH A;  2O03 A;  1G6N A;  5JR3 A;  3G3Z A;  2YU3 A;  4D0P A;  1RNL A;  3KET A;  1ZH5 A;  1MZB A;  2XHK A;  1U6G A;  1B1B A;  3RKY A;  3VB2 A;  1FY7 A;  1ULY A;  1MKM A;  2QQB A;  2HS5 A;  3LQQ A;  4KFC A;  3KP6 A;  5K5R A;  3H92 A;  1PP7 U;  1HXD A;  1PDN C;  4ENM A;  2WC2 A;  2DAO A;  2RKH A;  3GLX A;  3M1E A;  4EGY A;  2FOK A;  1FC3 A;  4H0E A;  1KQ8 A;  3C7J A;  4EJW A;  4M9X A;  1TW3 A;  2ACJ A;  1RIO H;  2LNB A;  5EEG A;  4WWC A;  2VC1 A;  5L3B A;  1FT9 A;  1MJB A;  3JSO A;  2NAZ A;  2D1H A;  5L3E A;  1S8N A;  5ICF A;  1E2X A;  3F8F A;  3ISP A;  4ENN A;  1JGS A;  3GEZ A;  1F9N A;  3K1P A;  3P9I A;  4WK8 F;  4G6D A;  3HOS A;  2XAQ A;  1ON1 A;  3J7A O;  2XKP A;  1HST A;  3I54 A;  3G73 A;  4N9H A;  4MQV A;  4M72 A;  2EWN A;  3I71 A;  5E20 A;  1R00 A;  3R0A A;  4G9Y A;  4RS8 A;  1J59 A;  3MQ0 A;  2MD5 A;  1LDD A;  1S6L A;  2EFW A;  3WU1 B;  4UVB A;  4CYD A;  4QLC U;  2FXA A;  1YYV A;  4CXF A;  2F5F A;  2ZKZ A;  2XAF A;  4U0Y A;  3E6M A;  1G3Y A;  4L5J A;  2Y48 A;  5D5X B;  3ZMZ A;  4Q4Z F;  2VOO A;  3GO5 A;  3F8C A;  4LLN A;  3VOD A;  1P2F A;  2VOP A;  2GIV A;  4KIB A;  2QWW A;  2XRN A;  4O6J A;  2H09 A;  1L3L A;  4I2O A;  3MEX A;  5LGT A;  4O5V A;  4M6X A;  2QQA A;  4CIC A;  3ZMU A;  4OMZ A;  5F6F A;  2K27 A;  1LDK B;  3BPV A;  3ZQ7 A;  4XSX F;  4EJO A;  1T98 A;  5HLI A;  3TKY A;  5HDN A;  2Z9O A;  2LF8 A;  4ENJ A;  4R79 A;  4EGZ A;  5DEQ A;  2FSW A;  5BMZ A;  5DD4 A;  3HYI A;  2D2W A;  2LDU A;  4WF2 A;  1U5T C;  4EQQ A;  3B73 A;  1RUO A;  2PEX A;  2ZJ2 A;  3D0S A;  1OYI A;  4HBL A;  1ZG5 A;  2HFH A;  3IKT A;  5CVR A;  1XCB A;  2XKO A;  2F2E A;  5HLG A;  4KT5 C;  4XLN F;  3KLO A;  4RB2 C;  2JPB A;  3BWG A;  3RIR A;  1I27 A;  4HF0 A;  1T39 A;  3F8B A;  1LJ9 A;  2RNJ A;  1XMK A;  5ICG A;  1SD5 A;  1HKS A;  4LLL A;  1W4M A;  1KQ9 A;  3DEU A;  4LLG F;  1UFM A;  2D1V A;  2Q0O A;  4ZYG A;  2AS5 F;  4HYE A;  3O3K A;  3HRU A;  4GYI A;  3HSE A;  5LBQ A;  1FOK A;  1O57 A;  2IW5 A;  2VXZ A;  3IWZ A;  4U0W A;  2JT1 A;  3BDD A;  3K2Z A;  4JBA A;  5DV5 A;  1YO5 C;  3KEQ A;  3RI4 A;  1OYY A;  3BP8 A;  2O8X A;  1T38 A;  2ISZ A;  1TNS A;  4WCG A;  4OIQ F;  4A6D A;  3MZY A;  3E3V A;  1XGO A;  4GYG A;  3WTT C;  5KK1 A;  3RYP A;  1BI3 A;  5J6X A;  2M45 A;  5LGU A;  3HUG A;  2V1D A;  3JAM Z;  2FML A;  3M7G A;  2QYO A;  3JAM K;  1MD0 A;  4B8X A;  2RN7 A;  1QBJ A;  3C18 A;  3HSF A;  3V7S A;  2X0L A;  4HDU A;  1Y0U A;  1Z91 A;  1BI0 A;  4RGS A;  5ILV A;  2VT3 A;  3HRT A;  5FD6 A;  3KP2 A;  3GFJ A;  2GXB A;  3FF5 A;  2XVC A;  2RQP A;  4YFN F;  4AD9 A;  4Y15 A;  2VON A;  3ML6 A;  1ZHF A;  4LB6 B;  3ROU A;  1FSE A;  3V7R A;  1ZGJ A;  4HX8 A;  5F64 A;  4ZZL A;  5LHG A;  1MJA A;  3E5Q A;  4G7Z F;  2WWY A;  3EUH A;  4IVN A;  3I59 A;  2L3D A;  1D8K A;  1Z6T A;  2XIG A;  2EV5 A;  3T5X A;  4XSZ F;  3CDH A;  3WOD F;  1HW1 A;  1D5V A;  4HA8 A;  1ODD A;  3K0L A;  5JFR A;  1SAX A;  2MBF A;  4PZJ A;  2A5Y B;  3WU0 A;  2LKP A;  1QPM A;  2CYY A;  3CUO A;  1P4W A;  3BJO A;  4ETS A;  2QQ9 A;  1IUY A;  1FBU A;  2FEZ A;  1IN7 A;  2YPR A;  4U7B A;  1W7P B;  2IVM A;  2P7C B;  2P4W A;  2DK5 A;  4HZF A;  3I4P A;  4RGX A;  3V8J A;  2HKX A;  4I09 A;  4GO1 A;  3GF2 A;  3SFZ A;  1SFX A;  1RI7 A;  5TRD A;  3BJ6 A;  5BQT A;  1KU3 A;  5FD5 A;  4ON0 A;  3I53 A;  1PUE E;  1SD6 A;  4Q5S F;  3F6V A;  5D6E A;  1BOA A;  4TV7 A;  2BV6 A;  3RKW A;  4EJT A;  3L7W A;  2K4J A;  3WE2 A;  1CGP A;  2ESN A;  1R22 A;  3LAJ A;  5IT9 Z;  5E8G A;  2QEN A;  4YII A;  5IT9 K;  3F23 A;  2ADU A;  4KNY A;  2HQR A;  1G3W A;  2A07 F;  3D5L A;  1BBY A;  4HF2 A;  1IZ1 A;  1BJA A;  2RC4 A;  2KIF A;  3GZ6 A;  3QP6 A;  1T0F A;  4HLY A;  3QP5 A;  1YG2 A;  3NRV A;  1E17 A;  2FRH A;  5DD8 A;  5JI6 A;  1STZ A;  1BN5 A;  3TQN A;  4L9N A;  2BEO A;  1BC8 C;  1IF1 A;  2AXL A;  2CQK A;  3EDP A;  1QZY A;  2M5W A;  1GXQ A;  3RYR A;  4HF1 A;  2K02 A;  2PMU A;  5D5V B;  2F5C A;  2HDC A;  1O3S A;  4BHB A;  4MEX F;  4ZYH A;  2R3S A;  3U1D A;  4WXH A;  4U88 A;  4HV5 A;  5DYM A;  2OZU A;  3N97 A;  2ZME B;  1F1Z A;  4FT8 A;  2A6H F;  3MCZ A;  3HHH A;  4YFX F;  1OR7 A;  2FF4 A;  2HR3 A;  2L01 A;  2HGC A;  3JW4 A;  3FXU A;  3QPH A;  1QGP A;  2IRF G;  2DW4 A;  3K9T A;  3C3W A;  2CW0 F;  2XV4 S;  5AIQ A;  4EVI A;  4ESF A;  3TGN A;  2VN2 A;  5F1R A;  1YW9 A;  5HOO A;  2A68 F;  4QWQ A;  5CVV A;  1YTY A;  1SMY F;  5J8C A;  3LA7 A;  3CJN A;  4LG0 A;  3LWF A;  1J0R A;  4LK1 F;  3CLO A;  4O3M A;  4CO8 A;  4P9F A;  4L0Z B;  5CLS A;  4R1H A;  1U2W A;  2ZME A;  2ESH A;  3ZN0 A;  1HKQ A;  3F72 A;  3BRO A;  1FBQ A;  1UST A;  5HS8 A;  2W85 A;  4A0Z A;  2KKO A;  5LLQ A;  2QZ8 A;  2P5V A;  3COA C;  2PFB A;  4RGR A;  2J5P A;  4AVP A;  2OAZ A;  2YX4 A;  2PN6 A;  2VE9 A;  4M6Y A;  4L5I A;  1WWX A;  1HBX G;  3T1B A;  4HOB A;  1FBS A;  3W6J B;  5BPD A;  4HLX A;  5LGN A;  2H6C A;  2PMH A;  3H3U A;  2FNA A;  2E1C A;  4KN7 X;  4UVA A;  1F5T A;  1YW7 A;  3FM3 A;  4WX9 A;  3EYY A;  4YG2 F;  4P5O A;  3P9C A;  3WTU C;  1DPU A;  1U8R A;  3IC7 A;  4FHT A;  5D4R A;  2ZXJ A;  1USS A;  1R5G A;  1FLI A;  2CO5 A;  2IA0 A;  3RTR A;  2HOE A;  2VC0 A;  3P9K A;  2EFO A;  1LEB A;  2DTR A;  4UV9 A;  1VTN C;  1Z6R A;  2ELH A;  5L3F A;  2EK5 A;  2P8T A;  3MAJ A;  1JE8 A;  5L3D A;  1KYW A;  1K78 A;  4LGW A;  2IT0 A;  2E7X A;  2W25 A;  5LHH A;  2A3S A;  1XCV A;  3HHG A;  2M8E A;  4U0V A;  4ZH4 F;  3GFL A;  5ILS A;  4IRI A;  4G8X A;  3VFZ A;  2VBY A;  2W24 A;  2EV0 A;  2W57 A;  1BM9 A;  1XDS A;  3FX3 A;  1WI9 A;  2P7V B;  1XB4 A;  3FXR A;  1KU2 A;  3FZV A;  2E7W A;  1ZYR F;  3SZP A;  1MJ9 A;  4XRF A;  1ZRC A;  3B02 A;  2H94 A;  5E1W A;  3RDI A;  4A6E A;  5D5W B;  1YLF A;  3QU6 A;  1MDM B;  2H6B A;  1LDJ A;  1ZLK A;  3KP3 A;  1ZAR A;  3L9F A;  4RB1 A;  4CGZ A;  5HDG A;  4IRH A;  1O7L A;  4DNC A;  2QUF A;  4LD5 A;  4YFK F;  1QO0 D;  2CG4 A;  4Y13 A;  2DI3 A;  2MLK A;  2DK8 A;  3ULQ B;  3BPX A;  4I01 A;  1WKM A;  2P5K A;  4GCV A;  4WXD A;  2BYV E;  3OV8 A;  2W84 A;  4FX0 A;  3FWE A;  4G7O F;  1IAW A;  3KFW X;  1UB9 A;  3JSP A;  3C1D A;  2M1B A;  3GYH X;  2IPQ X;  2STT A;  1P92 A;  1O3Q A;  4M9S A;  1SD7 A;  3M8E A;  1KYZ A;  4NHJ A;  2BGC A;  2YR2 A;  3CUQ B;  3J80 Z;  3F21 A;  1MDM A;  1IXC A;  3O2P E;  5BS6 A;  3J80 K;  1SFU A;  1WQ2 A;  3WGH A;  4A2U A;  3E5X A;  2HQN A;  3TDZ C;  2YSR A;  3KEO A;  3ABU A;  2C6Y A;  1KQ0 A;  3GW2 A;  4ZZD A;  3FMR A;  1IN4 A;  4KMF A;  4OOI A;  3L00 A;  1HKT A;  3I64 A;  3NEU A;  4AWX B;  3R4K A;  5E18 F;  1DDN A;  2XRO A;  4A5N A;  5FB2 A;  2QVO A;  2EFQ A;  2RV8 A;  2CSO A;  1K7A A;  4XBF A;  4PDK A;  3BZ6 A;  2Q2E A;  3EQL F;  5D5U B;  3HTU A;  2HYF A;  3IWF A;  1FYK A;  2D45 A;  2FBH A;  4PGG A;  2X4H A;  4RAZ A;  4YIF A;  3I59 B;  3CUQ A;  1TW2 A;  3DP7 A;  4IF4 A;  4LK0 F;  4S05 A;  3GUD A;  3KLN A;  1TQM A;  1UHW A;  1ZRE A;  1OMI A;  3DXJ F;  2KIU A;  4PCQ A;  2TDX A;  2HTJ A;  2CFX A;  2GAU A;  3IRQ A;  1W5S A;  5ERI A;  1XDU A;  4P9U A;  1FNN A;  3RJP A;  4OIO F;  4OMY A;  2H27 A;  1DP7 P;  2J5O A;  1FP1 D;  2O61 A;  1NHA A;  2VBZ A;  1CF7 A;  3DFG A;  1DUX C;  3Q9V A;  1SMT A;  5ICC A;  2M87 A;  3FMQ A;  5TJJ A;  3FHZ A;  1B59 A;  1EV7 A;  1FX7 A;  1G3S A;  3IHU A;  4BXU A;  2HKO A;  4RB0 A;  2GXG A;  3KP7 A;  1ZAO A;  1FP2 A;  4L18 B;  1T2K A;  2NS0 A;  5H6Q A;  2L4M A;  3REO A;  2XAS A;  3F8N A;  4DQ2 A;  5H20 A;  1R36 A;  1Z7U A;  2Y0M A;  4LJZ F;  4XLP F;  4R8H A;  4P55 A;  3ZMS A;  4BYY A;  2EFN A;  4G94 A;  1S3J A;  4ASN A;  2JZY A;  1FWZ A;  1KGS A;  3FXQ A;  2VE8 A;  2QBY B;  3SQN A;  5D8L B;  2PJP A;  1R58 A;  4NB5 A;  4HQE A;  4EJV A;  2DFI A;  1R1T A;  1MGT A;  3KE2 A;  2OA4 A;  2XAH A;  3MFK A;  1ZGA A;  4OIN F;  1WRJ A;  2XAJ A;  3KZY A;  4KIC A;  2P6S A;  3GVA A;  1SFE A;  1H0M A;  4UUV A;  2ZNZ A;  3TO7 A;  1KU9 A;  3LAP A;  4G7H F;  1B6A A;  4RGU A;  1S29 A;  5LRR A;  1ZRF A;  2DPU A;  1I5Z A;  2CGP A;  3GXO A;  4KUM A;  4CHU A;  3WTW C;  3S2W A;  1IN6 A;  1LVA A;  2NNN A;  2V79 A;  1J9I A;  2O0Y A;  4HX7 A;  1R7J A;  3ZMV A;  4IHT A;  2O6G E;  2LSO A;  2O3F A;  4L9V A;  3HTS B;  2QBY A;  3F8M A;  1H9T A;  3WTZ A;  4E70 A;  4OIP F;  3WE3 A;  2NNY A;  2FMY A;  1I6X A;  5L3C A;  3K1M A;  2VBX A;  4HDV A;  3F22 A;  4LG0 B;  2ZO4 A;  2XGX A;  2ZNY A;  5HS7 A;  1T6S A;  1X3U A;  1TNT A;  3PFI A;  3WTS C;  2QM3 A;  1EH8 A;  2V1X A;  5LEJ A;  4HAM A;  2A61 A;  2Z3Y A;  3DPL C;  1Z9C A;  1JXS A;  2DBB A;  5DUK A;  3IRR A;  1D8J A;  3HRS A;  1IRF A;  1U3E M;  3WGG A;  1HW5 A;  5D8K B;  5CVI A;  4U7D A;  4KIG A;  2STW A;  1YQA A;  5D4S A;  3DV8 A;  1BC7 C;  1B9N A;  4N9I A;  3WTV C;  2MH2 A;  3IKV A;  1SD4 A;  3FMS A;  4IJA A;  1ZG1 A;  1YIO A;  2EB7 A;  1GHC A;  3Q9S A;  2G7U A;  2JTV A;  2R7D A;  5LHI A;  2OBP A;  4MTE A;  2LF7 A;  3CUQ C;  3I58 A;  3ECO A;  1O3R A;  4UXN A;  1YS6 A;  3BOQ A;  3SHF A;  1HW2 A;  3GZ5 A;  4M71 A;  5CVJ A;  2EFP A;  2HZT A;  2DU9 A;  2UXX A;  2P5L C;  5IT3 A;  2WV0 A;  4RB3 C;  1BIB A;  1TQP A;  4A0X A;  4GXO A;  3KZZ A;  2GA1 A;  1TLH B;  3HRM A;  4L9T A;  2QLZ A;  4OIR F;  1XSV A;  2EV6 A;  2DLL A;  4BHP A;  2B0L A;  3CO6 C;  3WTY C;  4M73 A;  4A5M A;  1OKR A;  5JHU A;  2HWV A;  2PLY A;  2VBW A;  1K78 B;  2R7F A;  1IW7 F;  2K4B A;  4EM0 B;  3V7C A;  4A12 A;  3WGI A;  3FM5 A;  3IL2 A;  4L9J A;  2FBK A;  3W6K B;  3GWZ A;  3QPT A;  1TQI A;  1YS7 A;  4HX4 A;  3T8T A;  2DO7 A;  4RAY A;  2Z5U A;  5HVQ C;  3R6S A;  5BOX A;  3TO9 A;  2E1N A;  1IXS B;  2JPC A;  4I02 A;  2HYG D;  4I0A A;  2BBY A;  3K69 A;  4K2E A;  4I7H A;  1XGN A;  2XAG A;  2L02 A;  5BPI A;  3ERE D;  3VOE A;  2K7L A;  2A69 F;  3BJA A;  3ZP5 A;  4I98 B;  3MZH A;  5D6F A;  1C0W A;  3Q5F A;  1I1S A;  4KA4 A;  5DCM B;  4HV6 A;  1XGM A;  1W7P D;  4CZZ A;  2UWM A;  1J75 A;  2PBI A;  4Y17 A;  2Q8K A;  4UNO A;  4IRG A;  4B09 A;  4HW0 A;  2HEO A;  5AON A;  3WTX C;  2Y75 A;  2WTE A;  4S04 A;  4P96 A;  4BNC A;  2V9V A;  3ECH A;  4AIH A;  1R23 A;  2NYX A;  4A0Y A;  5J8F A;  2OZ6 A;  5A2Q Z;  3PQK A;  1Z05 A;  3F6O A;  3EET A;  2ZFW A;  5A2Q K;  1ZLJ A;  3KP4 A;  1P6R A;  2FA5 A;  1O3T A;  3JTH A;  1HQC A;  3TOA A;  3MWM A;  2Z99 A;  1B9M A;  4UV8 A;  4L0Y B;  2F5E A;  2IA1 A;  2JRT A;  5DCM A;  3HSR A;  3KCC A;  1EH6 A;  1K6O A;  2DQL A;  1RZ4 A;  4WXC A;  2UZK A;  1FYM A;  1BI2 A;  2ZBK A;  3LA3 A;  4KYW A;  4BHC A;  3R61 A;  1P4X A;  4CDG A;  3R0J A;  1F4K A;  1IXR C;  3E5U A;  5JVT A;  4AIJ A;  2PQ8 A;  2GQQ A;  4F7Z A;  3LA2 A;  1H9G A;  4LB5 A;  2BE5 F;  3CTA A;  4KDP A;  1JHH A;  2OU2 A;  2PG4 A;  2GWR A;  3V8K A;  2L4A A;  2MA3 A;  2IA2 A;  3PQJ A;  3I5U A;  2ZCW A;  4LFU A;  1REP C;  4BAY A;  3N4M A;  2EA2 A;  1R5H A;  4ESB A;  1S7A A;  1OPC A;  2EA4 A;  2RVC A;  4ESJ A;  2ETH A;  1S7O A;  3QOP A;  2FQ3 A;  4MGR A;  1IN8 A;  1ZRD A;  4Z2Y A;  5ED4 A;  3T0Y A;  3E6C C;  1G3T A;  2V6C A;  2MH9 A;  3I0T A;  4EMS A;  3QRF F;  5FFZ A;  2M30 A;  1LQ1 A;  1CF7 B;  1YFH A;  2KJB A;  1Z1D A;  1J5Y A;  3O6B B;  4JK1 X;  4Q48 A;  1XSD A;  1HSJ A;  5E1Z B;  4IPA A;  1AWC A;  2A6E F;  1EH7 A;  3WG9 A;  2GZW A;  4BH9 A;  2FE3 A;  1GVJ A;  1ONV A;  2MC3 A;  1QQI A;  1QZZ A;  3TDU C;  4EM1 A;  2VOD A;  5FO5 A;  3GFI A;  2COM A;  1LB2 A;  5LRS A;  3DPT A;  5E8I A;  5AIP A;  5DDG A;  3TOB A;  3AAF A;  4BQA A;  4KMU X;  3RKX A;  2XUB A;  1FSH A;  2FNP A;  2P6T A;  3LFK A;  3U9G A;  4MQ9 F;  4FX4 A;  5FLX Z;  5DUI A;  2G9W A;  2OQR A;  4NQW A;  5HLH A;  5L3G A;  1JHF A;  2DT5 A;  5FLX K;  3HOT A;  1FPQ A;  4MTD A;  1AOY A;  5LEK A;  1B4A A;  4MHG A;  4I0B A;  5K1Y A;  1XN7 A;  3L09 A;  2VT2 A;  4IHS A;  4MNU A;  1DPR A;  1R1V A;  1V4R A;  1G4D A;  4Q47 A;  4UHT A;  1QNT A;  3DF8 A;  3SXY A;  3BY6 A;  3K1N A;  1BIA A;  1ON2 A;  1KA8 A;  1O7F A;  1ZN2 A;  3RPQ A;  3QU3 A;  3SZT A;  3TO6 A;  3E97 A;  1W5T A;  2KIM A;  2V1U A;  1OYW A;  2EJR A;  5DCF A;  3LQR A;  1IN5 A;  5EEH A;  3M9A A;  5H6R A;  4KIF A;  2K86 A;  1I1G A;  1K79 A;  1V3F A;  4EV0 A;  1WSU A;  3H3Z A;  3ABT A;  3ELK A;  1U5T B;  1UCR A;  5E17 F;  4JQF A;  1UHM A;  2KJC A;  3HIF A;  3EYI A;  4IXA A;  3L2C A;  5E1X A;  2IP2 A;  2KRF A;  3F3X A;  2FBI A;  5ICE A;  3V8L A;  1PP8 F;  1J7K A;  1GXP A;  2HTS A;  3P7N A;  3GX4 X;  1D3Y A;  2DPD A;  3KP5 A;  2RGV A;  1R1U A;  2JSC A;  5FGM A;  5FFX A;  3J81 Z;  4M9Z A;  4PGH A;  4EJU A;  3M8F A;  1TBX A;  4N0B A;  2F5D A;  3J81 K;  3CO7 C;  4ENK A;  3ZPL A;  1RUN A;  3ZMD A;  1YW8 A;  2UXN A;  1TTY A;  2DQR A;  3ZN1 A;  2L54 A;  4G6Q A;  4ZYE A;  1A04 A;  3GFM A;  5CJ9 A;  1U5T A;  3OOP A;  3V4G A;  2G7H A;  3U2R A;  2RDP A;  2GA2 A;  2Z33 A;  1W7P A;  5KVR A;  1ZG3 A;  2PI0 A;  3RPU A;  3T8R A;  1XGS A;  2OQG A;  1LNW A;  1LEA A;  3JTG A;  1Q1H A;  3E6B A;  3R60 A;  1U78 A;  4UVC A;  4ZYD A;  2CWE A;  2YX7 A;  1XSX A;  1FZP B;  5CYV A;  2NRA C;  2ISY A; 
#chains in the Genus database with same CATH topology
 1J2X A;  4HQM A;  1IRG A;  2OD5 A;  3NQO A;  2BVM A;  3CMM A;  2XGE A;  3CJT B;  3OR2 C;  3FIS A;  1RC9 A;  5HDK A;  4M74 A;  5H2F C;  5J1U A;  3DQV C;  4OU0 A;  3ZMT A;  2IJL A;  4GGG A;  1ZR4 A;  4HEA 2;  1AKH B;  3VEP A;  4PJJ A;  3E6D A;  2FU4 A;  1WCM J;  1WFX A;  2RQQ A;  5ILU A;  4LMY A;  1XD7 A;  3DKW A;  4BY1 J;  5GAG J;  2ZXH A;  2MLG A;  4UB6 C;  2LVS A;  1P4A A;  1BI1 A;  6PAX A;  3D5R C;  4MEY F;  4XLF A;  4E7S A;  4EM2 A;  1R9T J;  1KU7 A;  4RMN A;  3H5N A;  2TCT A;  1XMA A;  2K9Q A;  4NC7 A;  3ZQH A;  5K5O A;  1ZK8 A;  1L0O C;  3ASN H;  2FOW A;  5HS9 A;  4AIK A;  4KN4 X;  3LST A;  1DGR M;  1FYL A;  5K5Q A;  4CCL A;  5CVU A;  3QAH A;  2O03 A;  1G6N A;  5JR3 A;  1VQL I;  2GLO A;  4X6A J;  4KIS A;  3G3Z A;  3OYK A;  4OWR B;  2YU3 A;  4D0P A;  4UUT A;  1RNL A;  4II3 A;  3KET A;  1ZH5 A;  1MZB A;  2XHK A;  1U6G A;  1B1B A;  1TP4 A;  2H1K A;  4CCN A;  1Y0N A;  1MMD A;  2KPM A;  4BU2 A;  3IV5 A;  2QSF X;  5F08 A;  4G6T B;  1F43 A;  2ZJR F;  3O8G A;  3M8J A;  2HOT A;  2CUJ A;  3OIP A;  3RKY A;  3VB2 A;  1CQT A;  1FY7 A;  1ULY A;  2M3A A;  1MKM A;  2QQB A;  4BGD A;  3BG9 A;  2HS5 A;  5CQG A;  1AKH A;  2QSH X;  2I8D A;  3M07 A;  4BAC A;  3HG9 A;  4QSH A;  5EZH A;  3LQQ A;  4KFC A;  5KCM A;  3KP6 A;  2L9V A;  3AG2 H;  5K5R A;  1ZQ3 P;  1GUU A;  3H92 A;  1PP7 U;  1HXD A;  1PDN C;  3J81 R;  5J4Y A;  4ENM A;  5F27 A;  1WJF A;  2WC2 A;  2DAO A;  2EPF A;  2RKH A;  3GLX A;  1VZ0 A;  3M1E A;  4EGY A;  1ETW A;  2FOK A;  2EBI A;  2WY7 Q;  1FC3 A;  1QHH D;  4B3X A;  4H0E A;  1D0Z A;  3CCQ I;  1N77 A;  1KQ8 A;  5KNL A;  3C7J A;  2AXT C;  2CW7 A;  4EJW A;  4M9X A;  1TW3 A;  2ACJ A;  3A01 B;  1RIO H;  2LNB A;  1VND A;  4B4C A;  5EEG A;  3K6G A;  5CKT A;  2EIJ H;  4WWC A;  2VC1 A;  5LFA A;  5L3B A;  1Z67 A;  1FT9 A;  1K4T A;  1MJB A;  2XB0 X;  3C2G A;  3JSO A;  2NAZ A;  2D1H A;  3QPS A;  2COB A;  5L3E A;  4BQN A;  1DQU A;  1S8N A;  1WH7 A;  5ICF A;  2DTZ A;  1E2X A;  2ZC2 A;  3ZQC A;  3F8F A;  3ISP A;  3CCU I;  5EG0 B;  5JVG F;  4LIU A;  3PL8 A;  4ENN A;  4W1U A;  2KRH A;  1JGS A;  3GEZ A;  2NVT J;  1F9N A;  3K1P A;  1RPW A;  1DP3 A;  2R7S A;  3P9I A;  4WK8 F;  4G6D A;  1MSF C;  5KAI C;  3HOS A;  2G0E A;  2XAQ A;  1ETO A;  1ON1 A;  3J7A O;  2DOD A;  2ZXW H;  2XKP A;  1HST A;  3I54 A;  3G73 A;  1HOM A;  4A3C J;  4N9H A;  4MQV A;  4M72 A;  2EWN A;  3I71 A;  5E20 A;  2H1L A;  1R00 A;  3R0A A;  4G9Y A;  4RS8 A;  1J59 A;  3MQ0 A;  2HVR A;  4C3I J;  3A2K A;  2MD5 A;  1LDD A;  1S6L A;  1W36 D;  3GBG A;  4D5F A;  1EKE A;  4KT6 A;  3C2B A;  2EFW A;  3WU1 B;  1FOW A;  1ZTR A;  4NDL A;  1WJA A;  4UVB A;  2OCE A;  4CYD A;  4I99 C;  4IHX A;  4QLC U;  1Q1V A;  2FXA A;  4A3D J;  4EEF G;  3A01 A;  2MFZ A;  1NH3 A;  1U0J A;  1YYV A;  2R7U A;  4IHV A;  4CXF A;  2F5F A;  2ZKZ A;  3S8P A;  1HA8 A;  2XAF A;  4U0Y A;  1ORK A;  2L9S A;  3E6M A;  3MN2 A;  1G3Y A;  4L5J A;  4ZYA A;  2Y48 A;  5D5X B;  3TP3 A;  1X58 A;  3ZMZ A;  3HKZ A;  4BEH A;  4Q4Z F;  2VOO A;  1Y39 A;  3GO5 A;  1U8B A;  2QKL B;  3F8C A;  4LLN A;  3IP4 B;  1WJC A;  3VOD A;  1P2F A;  3CCE I;  2VOP A;  2GIV A;  4KIB A;  2QWW A;  2XRN A;  2CW8 A;  2H09 A;  4O6J A;  2XDV A;  4C9Y A;  2HQ5 A;  1L3L A;  1E0E A;  3VDX A;  4I2O A;  3MEX A;  5LGT A;  1UG0 A;  4O5V A;  3BR5 A;  4DYR A;  4M6X A;  1SFO J;  2E34 A;  4E7Z A;  2QQA A;  2UUZ A;  4CIC A;  2WAD A;  3ZMU A;  2JA8 J;  1YRN B;  3GTO J;  4OMZ A;  5F6F A;  2K27 A;  1LFP A;  1LDK B;  3QYF A;  1VQ6 I;  3BPV A;  3ZQ7 A;  4XSX F;  4EJO A;  1T98 A;  2WV1 A;  1WJD A;  5HLI A;  3TKY A;  5B66 C;  5HDN A;  5B1A H;  2Z9O A;  2LF8 A;  1N75 A;  4ENJ A;  4BQO A;  2M0M A;  4R79 A;  4EGZ A;  3OWT A;  5DEQ A;  2FSW A;  5BMZ A;  2OCC H;  5DD4 A;  2F6C A;  2VKD A;  3HYI A;  3V42 A;  2D2W A;  2LDU A;  2PMZ N;  4WF2 A;  4AID A;  1U5T C;  4EQQ A;  2GIZ A;  3B73 A;  4BL0 B;  1RUO A;  2PEX A;  1D1A A;  2ZJ2 A;  3D0S A;  3HB9 A;  3DCF A;  1OYI A;  2ELJ A;  1MMS A;  1MH4 A;  1VQ9 I;  2GOX B;  4HBL A;  3TBI A;  1ZG5 A;  2HFH A;  3OIQ A;  3IKT A;  5CVR A;  1XCB A;  1TL8 A;  2XKO A;  2VJI A;  1X1P A;  2F2E A;  2LK2 A;  2BY3 A;  4XNF A;  2KZV A;  5HLG A;  4KT5 C;  4C2M J;  4AM3 A;  4XLN F;  3KLO A;  4RB2 C;  2E2J J;  1LKX A;  4BXX J;  4C3H J;  4RBO A;  2JPB A;  3LSI A;  3BWG A;  4V19 K;  4JOM A;  3RIR A;  1I27 A;  3QQA A;  2KP6 A;  3F8B A;  4HF0 A;  1T39 A;  4XRS A;  1MW7 A;  1LJ9 A;  1JJ6 C;  1MBH A;  2XSJ C;  3K4B A;  2RNJ A;  1B8I A;  3S1M J;  1XMK A;  2CQQ A;  4CCM A;  5ICG A;  1P7I A;  1SD5 A;  1HKS A;  4LLL A;  1W4M A;  1KQ9 A;  3DEU A;  3HPG A;  4LLG F;  1UFM A;  1V5F A;  1OQY A;  3H35 A;  2DDA A;  2D1V A;  3ZQI A;  2Q0O A;  1MND A;  4ZYG A;  2AS5 F;  4HYE A;  3O3K A;  3HRU A;  1G2H A;  3HXL A;  4GYI A;  5KAF C;  3HSE A;  1PJR A;  3LSK A;  1FIA A;  3BZK A;  5LBQ A;  5HLT A;  4GRI A;  1FOK A;  1O57 A;  2IW5 A;  2VXZ A;  2X6O A;  2JUC A;  3H5A A;  4OAZ A;  3OS1 A;  3IWZ A;  4U0W A;  2JT1 A;  3BDD A;  3K2Z A;  4JBA A;  5DV5 A;  3AL0 C;  1YO5 C;  1JUS A;  1X3Z B;  3KEQ A;  3DKY A;  2IGN A;  3RI4 A;  1OYY A;  2HZD A;  3P5J A;  3D1N I;  4M3F A;  3BP8 A;  1G8X A;  3IAS 2;  2O8X A;  2DA1 A;  4F91 B;  1T38 A;  2H8R A;  2ISZ A;  1X1A A;  1TNS A;  4WCG A;  1K4S A;  4OIQ F;  4A6D A;  1YHQ I;  3L2V A;  3MZY A;  4RDU A;  2RNG A;  1HF0 A;  4KIT B;  2QQ8 A;  3E3V A;  3AFH A;  3H0G J;  1XGO A;  2HPM A;  4GYG A;  2QF7 A;  3WTT C;  2OTL I;  5KK1 A;  1ETY A;  3RYP A;  1BI3 A;  5J6X A;  4F3Q A;  2M45 A;  2BXZ A;  5LGU A;  3HUG A;  2V1D A;  2MYS A;  3OYM A;  4RM2 A;  2NS8 A;  2QKM B;  4BDZ A;  4P1W A;  2WAF A;  3JAM Z;  2FML A;  3M7G A;  2QYO A;  3JAM K;  1WJE A;  1WJB A;  4HG2 A;  5IOZ A;  4IHY A;  1MD0 A;  2X9D A;  4ZDL A;  5J3L A;  5M3F J;  2BXY A;  1RKW A;  4B8X A;  1AA7 A;  2RN7 A;  1Y8R B;  1QBJ A;  3F9K A;  3C18 A;  3HSF A;  1FOY A;  1ZKG A;  3V7S A;  1GV2 A;  1JTX A;  2X0L A;  4HDU A;  1WH5 A;  3DTK A;  1Y0U A;  2BHZ A;  1Z91 A;  2DMQ A;  3FK7 A;  3PUF A;  1BI0 A;  2LRE A;  4MIM A;  4RGS A;  2LY1 A;  2KFD A;  1PUF B;  4NC6 A;  1JT6 A;  2VT3 A;  3SYT A;  5ILV A;  3HRT A;  4BE2 A;  1YI2 I;  1YX3 A;  5B5E C;  4JX4 A;  1BR2 A;  2QEX I;  1SC7 A;  5FD6 A;  5IPA A;  3KP2 A;  1RET A;  3GFJ A;  3A52 A;  2GXB A;  3FF5 A;  1Z0X A;  2XVC A;  3DU6 A;  3QYB A;  2RQP A;  3C2H A;  1IDY A;  3CC4 I;  3PJR A;  4A3I J;  4YFN F;  4AD9 A;  1WI3 A;  4Y15 A;  3CDI A;  2VON A;  3ML6 A;  3DWL E;  3FIW A;  3UNG C;  2KHM A;  3BTC A;  3EUA A;  4A3E J;  1ZHF A;  4LB6 B;  4DW6 A;  2YU9 J;  3ROU A;  2EH3 A;  1FSE A;  3V7R A;  1ZGJ A;  4HX8 A;  1RR8 C;  1I3Q J;  1RQ6 A;  5F64 A;  1XS9 A;  4ZZL A;  1Z3Y A;  5LHG A;  1LVK A;  1MJA A;  3E5Q A;  5F1J A;  2V1N A;  3OYB A;  1A6Q A;  2KMU A;  4G7Z F;  2NVQ J;  1ETV A;  3NAR A;  3EUH A;  4IVN A;  3PSI A;  2WWY A;  3I59 A;  2L3D A;  1D8K A;  4QIW N;  1Z6T A;  1ZGW A;  2XIG A;  4XL9 A;  4E4H A;  2EV5 A;  3PO3 J;  2NS7 A;  4FIS A;  3T5X A;  4Z6Y A;  3LSG A;  4XSZ F;  3CDH A;  3WOD F;  1HW1 A;  1D5V A;  2HVQ A;  4HA8 A;  4XRS G;  1WZ2 A;  2R4G A;  4JX5 A;  4A3L J;  2R5Y B;  1TC3 C;  1ODD A;  2D5V A;  1IG7 A;  2F4I A;  1I50 J;  3K0L A;  2CUE A;  5JFR A;  2CV1 A;  3GZN B;  1SAX A;  4J19 A;  3QWL A;  1QVT A;  2MBF A;  2ZSI B;  4PZJ A;  3BR6 A;  4J01 A;  2A5Y B;  3WU0 A;  2LKP A;  1QPM A;  2CYY A;  3CUO A;  2K3F A;  4FE7 A;  3FKJ A;  1P4W A;  2Y69 H;  3BJO A;  3DPU A;  4HST A;  4ETS A;  2QQ9 A;  3OS0 A;  4N4O B;  1IUY A;  3VPR A;  1FBU A;  2FEZ A;  2E35 A;  1IN7 A;  2YPR A;  4U7B A;  5FLV A;  5FKM A;  3BTL A;  3MKW B;  2PJR B;  1W7P B;  1YIT I;  1XG1 A;  2IVM A;  4XRM A;  5JLW A;  2HOA A;  5IYC J;  4E7J A;  2P7C B;  1UEL B;  2P4W A;  2DK5 A;  3SEQ A;  4HZF A;  1OLT A;  3I4P A;  2MG4 A;  4RGX A;  2HKX A;  3V8J A;  4I09 A;  4GO1 A;  2E1O A;  3VYU B;  1FTZ A;  3GF2 A;  3SFZ A;  1SFX A;  1RI7 A;  1UHS A;  5TRD A;  3LL7 A;  2BW3 B;  3BJ6 A;  5BQT A;  5HNF A;  1KU3 A;  5FD5 A;  4ON0 A;  2MD0 A;  3I53 A;  2R5Y A;  1LE8 B;  1LFU P;  1PUE E;  4LOC A;  2BY1 A;  1SD6 A;  2IS4 A;  3H9J A;  4Q5S F;  1TT0 A;  3F6V A;  5D6E A;  1QRY A;  2L2O A;  3OMY A;  3OYI A;  4QPO A;  3CCV I;  1BOA A;  2M8G X;  4TV7 A;  3JRI A;  2BV6 A;  3RKW A;  1JGG A;  3E7L A;  3H0D A;  4EJT A;  3L7W A;  2K4J A;  3WE2 A;  4DZJ A;  4AYB N;  4PJL A;  1CGP A;  2ESN A;  2NXN B;  3PNY A;  2LRD A;  4FTH A;  1R22 A;  3PIP F;  3LAJ A;  5IT9 Z;  5E8G A;  2QEN A;  1S72 I;  4IQ4 A;  4YII A;  3F0C A;  1VF9 A;  1DU0 A;  3HEF A;  2OUM A;  5M3M J;  5IT9 K;  2L7M P;  2PJR A;  3F23 A;  2ADU A;  1A31 A;  2O7O A;  4KNY A;  2HQR A;  1G3W A;  3OY9 A;  2E2H J;  2ICW G;  1JKP C;  3AL0 B;  3SJM A;  1H88 C;  1O4X A;  2A07 F;  3D5L A;  1BBY A;  4HF2 A;  1IZ1 A;  1BJA A;  2RC4 A;  2KIF A;  3GZ6 A;  4B43 A;  3K70 D;  3QP6 A;  1T0F A;  4HLY A;  4RA2 A;  3QP5 A;  1YG2 A;  4II2 A;  3NRV A;  3S32 A;  3S3N A;  4LIV A;  1E17 A;  4H4K C;  2FRH A;  2ZSH B;  3VYT B;  2PMZ A;  5DD8 A;  3MKY B;  1QU3 A;  2EIK H;  4XKC A;  5JI6 A;  4IO9 F;  2BW3 A;  2XF6 A;  3Q0U A;  1GT0 C;  2K85 A;  3SZG A;  4RLF A;  1Z77 A;  1STZ A;  1X1D A;  1BN5 A;  3TQN A;  4L9N A;  1YIJ I;  2BEO A;  1BC8 C;  1IF1 A;  2AXL A;  2CQK A;  4KJZ A;  1J09 A;  3EDP A;  5F04 A;  2V6E A;  3E0J B;  1QZY A;  2VJJ A;  2W4S A;  2M5W A;  1GXQ A;  3RYR A;  1MIJ A;  2F5V A;  1HC8 A;  4HF1 A;  2K02 A;  4BS9 A;  2PMU A;  4S0H B;  5D5V B;  5FRN A;  2F5C A;  2WB1 N;  3BQZ A;  2HDC A;  1O3S A;  3A4C A;  4BHB A;  4MO7 A;  2DOA A;  4MEX F;  4ZYH A;  3LSP A;  1RKT A;  2R3S A;  3U1D A;  2ECB A;  2JRM A;  4WXH A;  2EZI A;  4U88 A;  4HV5 A;  5EEA A;  5DYM A;  2OZU A;  3N97 A;  2ZME B;  1F1Z A;  1APL C;  4FT8 A;  2A6H F;  3J7Z I;  3MCZ A;  3KPH A;  3HHH A;  4YFX F;  1OR7 A;  3BZC A;  4JP0 A;  2FF4 A;  4PJN A;  2HR3 A;  2L01 A;  1N78 A;  2HGC A;  1JTY A;  5M5Y J;  3W2A A;  2W1O A;  2V26 A;  1TWA J;  3K4N A;  1NG6 A;  1OFC X;  3JW4 A;  3FXU A;  3QPH A;  4HNT A;  1QGP A;  4D1Q A;  2IRF G;  3K70 C;  2DW4 A;  1UJ8 A;  1P7J A;  3K9T A;  1NK3 P;  3C3W A;  4LG3 A;  1SAN A;  1MNE A;  2CW0 F;  2XV4 S;  5AIQ A;  1B72 A;  4XN0 A;  3SDG A;  4EVI A;  4ESF A;  5M5X J;  1XPX A;  3M1C A;  3HDD A;  3TGN A;  2VN2 A;  5F1R A;  2N8G A;  1VQ5 I;  1YW9 A;  4HRI A;  5FKL A;  2Y31 A;  5HOO A;  2ECC A;  2A68 F;  1M1E B;  1S9H A;  4QWQ A;  5CVV A;  1YTY A;  1IGN A;  1SMY F;  5J8C A;  3LA7 A;  3CJN A;  4LG0 A;  1BR4 A;  1XX5 A;  1ITY A;  3LWF A;  4XID A;  1BOB A;  1J0R A;  4LK1 F;  1PVE A;  1QHG A;  3GTG J;  3BG3 A;  3CLO A;  4O3M A;  4CO8 A;  2NVY J;  4P9F A;  4E7L A;  1MMA A;  2KDO A;  4L0Z B;  5CLS A;  4R1H A;  1U2W A;  5EDN A;  4Y3O A;  1WGX A;  2ZME A;  2ESH A;  3CQZ J;  3ZN0 A;  2W48 A;  1HKQ A;  1OCC H;  3F72 A;  3BRO A;  1FBQ A;  3GTK J;  2E2I J;  1UST A;  5HS8 A;  2W85 A;  4A0Z A;  3KEY A;  4DYC A;  1DU6 A;  3MZ8 A;  2KKO A;  5LLQ A;  2EIM H;  4L5E A;  2QZ8 A;  2P5V A;  3VSL A;  3JRG A;  3COA C;  2PFB A;  3GTM J;  3CCS I;  4RGR A;  2J5P A;  4AVP A;  2OAZ A;  2X6X A;  1MBF A;  5IT9 R;  2MVT A;  2YX4 A;  2QA4 I;  2PN6 A;  4YEJ A;  1FMV A;  2GOM A;  2XGD A;  4M6Y A;  2VE9 A;  2LY9 A;  3IH4 A;  4BEH B;  4L5I A;  1X19 A;  4IOA F;  2DYR H;  1WWX A;  1HBX G;  3T1B A;  4HOB A;  4B3A A;  2NOG A;  1FBS A;  3W6J B;  5BPD A;  3LOC A;  3FXJ A;  1MBJ A;  3EUH C;  1VQP I;  4HLX A;  5LGN A;  1TWC J;  2H6C A;  3BG7 A;  2PMH A;  3H3U A;  2CQX A;  4CZC A;  2JA2 A;  3H36 A;  2FNA A;  3H9Q A;  4CCJ A;  2E1C A;  4KN7 X;  2BZT A;  3FXL A;  3OS2 A;  3G71 I;  3M3Y J;  4UVA A;  4RAG A;  1F5T A;  3CD6 I;  3LSR A;  1ETK A;  1YW7 A;  3FM3 A;  4BE1 A;  4WX9 A;  3EYY A;  3MD2 A;  4BQQ A;  3DKX A;  5C4X J;  4YG2 F;  4P5O A;  5B3S H;  5BNG A;  1R6R A;  3P9C A;  3WTU C;  1DPU A;  2X6W A;  1SAU A;  3CCM I;  3IC7 A;  4XOT A;  1VQO I;  1U8R A;  4FHT A;  5D4R A;  2ZXJ A;  3CES A;  1USS A;  1R5G A;  2IXS A;  2E60 A;  1IV6 A;  1GDT A;  1FLI A;  4ZTJ A;  1S7E A;  2CO5 A;  2IA0 A;  3RTR A;  2HOE A;  2VC0 A;  3P9K A;  2EFO A;  4Y52 J;  1LEB A;  2DTR A;  4UV9 A;  1VTN C;  1BJZ A;  2X48 A;  4PJ0 C;  1Z6R A;  1MSE C;  1FIP A;  2ELH A;  2LR8 A;  5L3F A;  4PK4 A;  2EK5 A;  2P8T A;  3MAJ A;  1JE8 A;  2X98 A;  4NC8 A;  5L3D A;  2M7A A;  1KYW A;  2X85 A;  1K78 A;  4LGW A;  4XLE A;  5TIS C;  2IT0 A;  5LD2 C;  3S3M A;  2LLK A;  4AVZ A;  2E7X A;  2DYS H;  1A6I A;  2W25 A;  5LHH A;  2A3S A;  1XCV A;  3HHG A;  2M8E A;  4U0V A;  4ZH4 F;  4A93 J;  5IYD J;  4QPQ A;  4Y33 A;  2ZJQ F;  4XKW A;  3GFL A;  5ILS A;  4IRI A;  4G8X A;  3VFZ A;  2VBY A;  2W24 A;  2M35 A;  2EV0 A;  2W57 A;  1BM9 A;  3CC2 I;  1XDS A;  3FX3 A;  1WI9 A;  3S3O A;  4DOZ A;  2P7V B;  2VQH A;  1OJL A;  1XB4 A;  3FXR A;  1KU2 A;  3FXK A;  3FZV A;  2ZJP F;  1T95 A;  2E7W A;  1MBG A;  1B8I B;  1S5L C;  1ZYR F;  4A3J J;  2K9S A;  3ZQG A;  1AU7 A;  3S1R J;  3SZP A;  3H3V K;  2DMN A;  1MJ9 A;  4XRF A;  5J1Y A;  3K4K A;  3S17 J;  3K7A J;  2L7Z A;  2WAQ N;  3K4C A;  2CFO A;  1ZRC A;  3BR3 A;  1Z3X A;  2H94 A;  3B02 A;  2PX9 A;  5E1W A;  1MBE A;  3RDI A;  1W36 C;  5DM7 F;  4A6E A;  5D5W B;  2HI3 A;  1YLF A;  3QU6 A;  1OCP A;  1LUJ B;  1MMG A;  2HXI A;  1MDM B;  2F48 A;  2H6B A;  1W1W E;  1LDJ A;  2MSY A;  3KP3 A;  1ZLK A;  3ZOB A;  1ZAR A;  4N4N B;  3L9F A;  2HXO A;  2WA0 A;  2KT0 A;  4RB1 A;  4CGZ A;  2XPU A;  3OYA A;  4AC0 A;  4BDY A;  4A3F J;  2L5Q A;  5HDG A;  4IRH A;  4IOC F;  4CUG A;  1O7L A;  4DNC A;  2QUF A;  4BJ5 C;  3OSF A;  3K4J A;  4LD5 A;  4RLQ A;  4YFK F;  2DFF A;  3DEE A;  1T0F C;  4C30 A;  1QO0 D;  1YE9 A;  1ETQ A;  3OIO A;  4PFP A;  2CG4 A;  4F55 A;  4Y13 A;  2DI3 A;  2MLK A;  1NK2 P;  4F92 B;  2DK8 A;  2NVU B;  3ULQ B;  3JR9 A;  3BPX A;  3ZXS A;  4I01 A;  1WKM A;  2P5K A;  4GCV A;  4WXD A;  1X1B A;  2BYV E;  2RAE A;  2CV2 A;  3OV8 A;  3HOX J;  2W84 A;  3RQI A;  4FX0 A;  2LKX A;  3HOZ J;  3FWE A;  3AG3 H;  4G7O F;  2Q2E B;  3HUG B;  3Q3S A;  1QA6 A;  1IAW A;  5FRM A;  2VPR A;  1UB9 A;  3KFW X;  3JSP A;  2VI6 A;  3C1D A;  1OCR H;  5DS9 A;  1DGW Y;  2M1B A;  3GYH X;  2A6T A;  3U21 A;  2IPQ X;  2STT A;  1P92 A;  1O3Q A;  1MBK A;  4M9S A;  4B44 A;  1SD7 A;  3M8E A;  1KYZ A;  2B9S A;  2Y0S N;  4NHJ A;  2BGC A;  2YR2 A;  2VKE A;  3CUQ B;  4D9J A;  3J80 Z;  3F21 A;  1MDM A;  3ONQ A;  1IXC A;  3O2P E;  4XLC A;  5BS6 A;  3PFY A;  3J80 K;  1SFU A;  3I9V 2;  1WQ2 A;  3WGH A;  4A2U A;  3E5X A;  3JRE A;  2HQN A;  3TDZ C;  2YSR A;  3KEO A;  3S2H J;  1OR7 C;  3ABU A;  2C6Y A;  3OYN A;  1KQ0 A;  2ID3 A;  3GW2 A;  4ZTF A;  3UR3 C;  4CYC B;  4V2G A;  5EF6 A;  4BBS J;  4ZZD A;  3FMR A;  1IN4 A;  3HPH A;  4KMF A;  4OOI A;  3L00 A;  1HKT A;  3I64 A;  3NEU A;  4FQG A;  3E1S A;  4AWX B;  3R4K A;  5E18 F;  5K7Z A;  2YUS A;  2IAI A;  2BHY A;  1DDN A;  2WB1 A;  2XRO A;  4A5N A;  1FOX A;  5FB2 A;  2IGM A;  3BT9 A;  1RRJ A;  2QVO A;  2HPI A;  3TMO A;  2EFQ A;  2RV8 A;  2CSO A;  1K7A A;  4XBF A;  4PDK A;  3BZ6 A;  5TGT A;  2Q2E A;  1IDZ A;  3EQL F;  5D5U B;  3HTU A;  2HYF A;  3IWF A;  4YRV A;  1Z7L A;  1FYK A;  5JHF A;  2D45 A;  2FBH A;  4PGG A;  2VJ4 A;  4BY7 J;  2K9M A;  3HBL A;  2OTJ I;  2X4H A;  4RAZ A;  4YIF A;  1UMQ A;  1D0X A;  3I59 B;  3WHB A;  3CUQ A;  1TW2 A;  3DP7 A;  4IF4 A;  4LK0 F;  1ENH A;  4S05 A;  3GUD A;  3KLN A;  3TED A;  2MAB A;  1TQM A;  4E7H A;  1U9O A;  1UHW A;  3FBI B;  4DIQ A;  1ZRE A;  3N05 A;  2R93 J;  2ZME C;  1VQK I;  1OMI A;  2EZK A;  3AKZ A;  3GTJ J;  3DXJ F;  2KIU A;  4PCQ A;  2GXA A;  2LYC A;  1MH3 A;  1MNM C;  4CYC A;  4A69 C;  1G59 A;  2TDX A;  2HTJ A;  2CFX A;  2QCO A;  5GTH C;  2GAU A;  1UZC A;  4X1E A;  3RQ4 A;  4DYQ A;  3S15 J;  4AUX A;  3DBL B;  3IRQ A;  1W5S A;  5ERI A;  4UUS A;  1VI0 A;  1XDU A;  4F52 A;  3A0H C;  3CDL A;  4W97 A;  4P9U A;  3I4N J;  1YJ9 I;  1FNN A;  1T8I A;  3RJP A;  3TP0 A;  2VAS A;  4OIO F;  1I39 A;  3HOV J;  2Z16 A;  4OMY A;  3ZCO A;  2H27 A;  5GTI C;  1DP7 P;  3EPZ A;  1ZEL A;  4DJA A;  1ERD A;  2J5O A;  1FP1 D;  2O61 A;  2EIN H;  1NHA A;  2VBZ A;  2BY2 A;  3DTE A;  1JUP A;  3G4S I;  1CF7 A;  1TT5 B;  2E1M B;  3DFG A;  1YOV B;  3BTJ A;  3SFI A;  1DUX C;  3Q9V A;  1SMT A;  5J40 A;  4ZC3 A;  5ICC A;  2M87 A;  3FMQ A;  2R5Z B;  2DMP A;  1SVL A;  1U9N A;  5TJJ A;  3LFU A;  2X51 A;  4A3M J;  3RSN A;  3FHZ A;  3CCL I;  1EV7 A;  1B59 A;  4UY8 I;  1FX7 A;  2LH9 A;  1G3S A;  4BUP A;  3IHU A;  2IEK A;  2HKO A;  2MC4 A;  2ZB9 A;  4RB0 A;  4BXU A;  4CCO A;  3L2R A;  1EF4 A;  2GXG A;  3ASO H;  3KP7 A;  1ZAO A;  4A3B J;  5FRO A;  5IYB J;  4BKX A;  2OC6 A;  1FP2 A;  4L18 B;  2IS2 A;  3AG4 H;  3J80 R;  4NUB A;  1T2K A;  2NS0 A;  5H6Q A;  2L4M A;  3REO A;  2EQR A;  2KIQ A;  2XAS A;  3F8N A;  1UG2 A;  4PJM A;  4HPQ A;  3EUK L;  3G1L A;  4ANJ A;  2JK3 A;  4FET A;  4DQ2 A;  5IP7 J;  4CSW A;  3CC7 I;  3DLL F;  5H20 A;  1R36 A;  2VPL A;  3W2V A;  1Z7U A;  2K9L A;  2L7K A;  2Y0M A;  4LJZ F;  4XLP F;  2HQA A;  2FQ4 A;  4R8H A;  4XLH A;  2GBY A;  4P55 A;  3DEW A;  3ZMS A;  1IV8 A;  4BYY A;  2EFN A;  3CMY A;  4G94 A;  4JX6 A;  1S3J A;  3CF2 A;  4ASN A;  2JZY A;  4Y7N J;  2TRT A;  3S16 J;  1FWZ A;  1KGS A;  3FXQ A;  4G12 A;  2VE8 A;  5DTD A;  2JN6 A;  1D0Y A;  2QBY B;  2R5Z A;  3SQN A;  2WAE A;  5D8L B;  3S93 A;  2PJP A;  1R58 A;  4NB5 A;  4HQE A;  2DMT A;  4EJV A;  2DFI A;  1R1T A;  2QSG X;  1MGT A;  3KE2 A;  2JVG A;  4C3J J;  2OA4 A;  2XAH A;  3MFK A;  1ZGA A;  2XF7 A;  4ZDO A;  4GDF A;  3JAM R;  4OIN F;  3B6C A;  1WRJ A;  2XAJ A;  3KZY A;  4KIC A;  2P6S A;  3GVA A;  1SFE A;  2KDZ A;  1H0M A;  2ME0 A;  5K7F A;  3W6V A;  4XKB A;  4UUV A;  2ZNZ A;  2VQG A;  3TO7 A;  1KU9 A;  1ETX A;  4DZP A;  2E19 A;  2Z2S B;  2R0Q C;  3LAP A;  4G7H F;  1B6A A;  4RGU A;  4D7M A;  2IS6 A;  4RAF A;  1S29 A;  5F0H A;  5LRR A;  1ZRF A;  2DPU A;  3G1M A;  3PO2 J;  2CU7 A;  2FJ1 A;  3O8H A;  1I5Z A;  4EAT A;  2CGP A;  1F36 A;  5HOD A;  1AHD P;  1HCR A;  3GXO A;  2HVS A;  4KUM A;  4NBQ A;  2JVH A;  2ZFU A;  4CHU A;  4MFE A;  3WTW C;  1D5Y A;  3S2W A;  1IN6 A;  1LVA A;  2WAQ A;  1E3H A;  1RR7 A;  1V55 H;  2NNN A;  2V79 A;  4IKF A;  4B47 A;  1J9I A;  2O0Y A;  3JRA A;  4HX7 A;  1R7J A;  2CJJ A;  3ZMV A;  3JCU C;  2W00 A;  4IHT A;  2O6G E;  2CMP A;  5FKK A;  2LSO A;  2O3F A;  2P0W A;  4L9V A;  3HTS B;  2QBY A;  3F8M A;  5IY5 H;  2X1D A;  1H9T A;  3WTZ A;  4ABZ A;  4XKV A;  4E70 A;  5JLX A;  1B72 B;  4OIP F;  1BA5 A;  3WE3 A;  2NNY A;  2FMY A;  1I6X A;  4FAS D;  5L3C A;  3K1M A;  4E7I A;  3L2Q A;  1JJ8 C;  2VBX A;  3A1Y A;  2DT6 A;  1FMW A;  5FLM J;  2RRE A;  1XC5 A;  4HDV A;  3F22 A;  2F4M B;  4LG0 B;  2ZO4 A;  2XGX A;  3FK6 A;  2E36 A;  2ZNY A;  4QTR A;  3JRD A;  5HS7 A;  1T6S A;  1X3U A;  2JWT A;  2VL8 A;  3W3C A;  1TNT A;  3PFI A;  2XPV A;  5IOY A;  3WTS C;  2QM3 A;  1EH8 A;  2V1X A;  3BLY A;  5LEJ A;  4HAM A;  2R7Z J;  2A61 A;  2Z3Y A;  2LBF B;  2M4G A;  2IGK A;  3DPL C;  1Z9C A;  2OPT A;  1FEX A;  3NAU A;  1JXS A;  1R5I D;  2JSP A;  2DBB A;  2LG4 A;  2E5N A;  5DUK A;  2GM4 A;  2XAU A;  3VWB A;  3IRR A;  2LOO A;  4CA0 A;  1BL0 A;  1D8J A;  2LY2 A;  3FDY A;  4DBQ A;  2I5U A;  3B6A A;  4B1R A;  5J1R A;  3HRS A;  1IRF A;  2Y0S A;  1U3E M;  3WGG A;  2OV7 A;  1HW5 A;  5D8K B;  5CVI A;  3CCR I;  2ID6 A;  4U7D A;  1E3O C;  4KIG A;  2STW A;  3L2W A;  1YQA A;  5D4S A;  3DV8 A;  3ESW B;  4CH7 A;  1B9N A;  4N9I A;  4RM3 A;  3WTV C;  2MH2 A;  3IKV A;  1BC7 C;  1SD4 A;  3FMS A;  1X1C A;  4IJA A;  1ZG1 A;  3IUO A;  4XM3 A;  3DBR B;  1YIO A;  4C2U A;  1YX5 A;  2EB7 A;  4D7N A;  3I55 I;  1GHC A;  3Q9S A;  2G7U A;  2JTV A;  2R7D A;  3CJQ B;  2DA2 A;  3JRH A;  3OYJ A;  2VLA A;  3CMA I;  3SEZ A;  1TZL A;  5LHI A;  2OBP A;  4MTE A;  4XR6 A;  2LF7 A;  3PIO F;  2CUF A;  3CUQ C;  1A36 A;  3I58 A;  3G1O A;  4XLA A;  3ECO A;  2LMD A;  1O3R A;  2HU9 A;  4UXN A;  1YS6 A;  2WY8 Q;  3BOQ A;  3SHF A;  1HW2 A;  2KQR A;  3U1K A;  1QVU A;  3GZ5 A;  1BR1 A;  4M71 A;  1OIS A;  1XTA A;  5CVJ A;  2LBF A;  5E79 C;  2EFP A;  3BCB A;  2HZT A;  2DU9 A;  3NWS A;  2UXX A;  3RZD J;  2HOS A;  2P5L C;  1N25 A;  5IT3 A;  3H1C A;  2L9R A;  2WV0 A;  3WHC A;  4RB3 C;  3KYD B;  1BIB A;  1P9Q C;  3BQY A;  3Q0W A;  4XOR A;  4A3K J;  3BR0 A;  3L2U A;  1TQP A;  4A0X A;  4GXO A;  3LSM A;  3KZZ A;  2GA1 A;  4I6Z A;  1TLH B;  1PYV A;  2Y9Z A;  3HRM A;  4L9T A;  2QLZ A;  2E71 A;  1XSV A;  2EV6 A;  5CPR B;  4OIR F;  2DLL A;  2AQF A;  5K7H A;  1W0U A;  4BHP A;  1GV5 A;  1POG A;  2B0L A;  3CO6 C;  1E3P A;  3DU5 A;  3WTY C;  4M73 A;  4A5M A;  3IAM 2;  1KON A;  1OKR A;  3OL3 A;  5JHU A;  4M3E A;  2HWV A;  4JYK A;  2PLY A;  1Y1W J;  1JKR C;  3G6E I;  2VBW A;  1K78 B;  2R7F A;  1IW7 F;  4XON A;  2R7V A;  2K4B A;  2KL4 A;  4EM0 B;  2AHQ A;  3OL4 A;  3V7C A;  1SVO A;  2QGU A;  4A12 A;  3WGI A;  3K10 A;  1TWF J;  3FM5 A;  3IL2 A;  2DFH A;  4L9J A;  2FBK A;  3BTI A;  2VUM J;  4XN3 A;  3VSK A;  3K4M A;  3CF5 F;  3W6K B;  3GWZ A;  3QPT A;  2XB5 A;  1TQI A;  1YS7 A;  4HX4 A;  3T8T A;  2DOE A;  5C3E J;  2DO7 A;  4RAY A;  2M34 A;  2Z5U A;  5HVQ C;  1EA3 A;  3RCO A;  3KYL A;  1IO2 A;  1HDP A;  3R6S A;  5BOX A;  3KX2 A;  3TO9 A;  2E1N A;  3HOW J;  1IXS B;  2JPC A;  3FBN B;  4I02 A;  2HYG D;  2K40 A;  4I0A A;  4E7K A;  4Y4R A;  2BBY A;  3K69 A;  1LFB A;  4K2E A;  1H8A C;  1Y8Q B;  3QOE A;  5B1B H;  4I7H A;  1Z21 A;  1XGN A;  5FKO A;  2CQ7 A;  3OR1 C;  2JA5 J;  2XAG A;  2DT7 B;  2L02 A;  5BPI A;  2MUN A;  2CRG A;  1QPI A;  3ERE D;  3VOE A;  2DA3 A;  3ZRG A;  2K7L A;  2B63 J;  2A69 F;  2DJI A;  3BJA A;  2VB6 A;  3ZP5 A;  4I98 B;  2DA4 A;  2M9H A;  3MZH A;  5D6F A;  1C0W A;  3Q5F A;  5E3L A;  1Y1V J;  2V4J C;  1I1S A;  4KA4 A;  3HZJ A;  5DCM B;  3FXO A;  2HDW A;  4HV6 A;  4IX7 A;  1K6Y A;  2KLO A;  3PM1 A;  3BG5 A;  3CZ6 A;  3QPL A;  3MKL A;  2MZ4 A;  1XGM A;  1W7P D;  4CZZ A;  3LNQ A;  3WU2 C;  3MVP A;  2UWM A;  4AU7 A;  1J75 A;  2PBI A;  2E1M C;  4Y17 A;  2Q8K A;  3QOD A;  4UNO A;  4IRG A;  3LSJ A;  4B09 A;  4HW0 A;  2HEO A;  5IP6 A;  5AON A;  3RPU D;  2Y75 A;  3WTX C;  1X4P A;  2WTE A;  2ZXI A;  1KZH A;  4DGW B;  4S04 A;  4P96 A;  4BNC A;  2V9V A;  1K83 J;  3ECH A;  1VQM I;  5EG0 A;  4AIH A;  3NWT A;  2UV1 A;  2DA7 A;  3CCJ I;  1R23 A;  2NYX A;  1VQ8 I;  2K3P A;  2MW8 A;  4A0Y A;  2LFB A;  5J8F A;  2OZ6 A;  5A2Q Z;  3PQK A;  1Z05 A;  3VYS B;  3F6O A;  3CP2 A;  3EET A;  2ZFW A;  4PFO A;  5A2Q K;  1ZLJ A;  2V7F A;  3KP4 A;  1P6R A;  4IQJ A;  1R4N B;  2FA5 A;  4LIT A;  1O3T A;  3J7Y J;  3JTH A;  2Q1Z B;  1HQC A;  2R7R A;  2XRL A;  1JKO C;  3OSG A;  2O9L A;  3TOA A;  3MWM A;  2Z99 A;  1HDD C;  1WPK A;  3A03 A;  1SFK A;  2JA7 J;  3FKI J;  2A5W A;  4YEL A;  1B9M A;  4IZZ A;  4UV8 A;  4L0Y B;  4DBR A;  2R7T A;  5DM6 F;  1ACI A;  2F5E A;  2DOF A;  2IA1 A;  2JRT A;  4I76 A;  5DCM A;  3HSR A;  3KCC A;  3ABM H;  1EH6 A;  1K6O A;  2DQL A;  3S1Q J;  3GTQ J;  1X3W B;  1RZ4 A;  2AO9 A;  4WXC A;  5CQE A;  3DBH B;  2UZK A;  1FYM A;  1BI2 A;  2ZBK A;  3LA3 A;  5KHD A;  3HOY J;  4UB8 C;  4AYB A;  4KYW A;  1QZE A;  4BHC A;  3R61 A;  1X2N A;  2XF5 A;  3LMM A;  2L0K A;  3DTI A;  1OCT C;  4PSX A;  1P4X A;  2R7Q A;  4CDG A;  2HDD A;  2EZH A;  4E6K G;  1IC8 A;  3R0J A;  1F4K A;  1IXR C;  3E5U A;  3S1N J;  3CJR B;  1MMN A;  2Y30 A;  4V2F A;  5JVT A;  4AIJ A;  2PQ8 A;  2GQQ A;  4F7Z A;  4IL6 C;  4BJ6 C;  5EJC A;  4ZJZ A;  2DXI A;  1H89 C;  3LA2 A;  2XGC A;  1H9G A;  3BCA A;  3RKQ A;  2AQE A;  4LB5 A;  2ELK A;  2LP0 A;  3A02 A;  3OYD A;  2DA5 A;  3CLQ A;  3WG7 H;  1YRN A;  2BE5 F;  2P81 A;  3SDB A;  4BBR J;  3AG1 H;  3CTA A;  4KDP A;  1JHH A;  2OU2 A;  2PG4 A;  4XMY A;  3GTL J;  3J7A W;  2GWR A;  3V8K A;  1WJ5 A;  2L4A A;  2JA6 J;  1HLV A;  3M4O J;  3ZQQ A;  2V9P A;  1I6H J;  2MA3 A;  2IA2 A;  3PQJ A;  3IH3 A;  5M5W J;  1IUF A;  2ZCW A;  3I5U A;  4LFU A;  2W7N A;  1REP C;  4BAY A;  1JKQ C;  2NOJ B;  3N4M A;  2EA2 A;  1NG7 A;  1R5H A;  4ESB A;  2CQN A;  1S7A A;  1OPC A;  3G2B A;  2EA4 A;  2BY0 A;  3TL4 X;  5E3O A;  1W5C C;  3JRF A;  4M3G A;  2VIX A;  3I3L A;  3CCY A;  4UUS B;  2RVC A;  3ABL H;  2YS9 A;  5IP9 J;  2ETH A;  4ESJ A;  2H8W A;  1S7O A;  1V5G A;  2FD5 A;  2Y2Z A;  3GLL A;  3QOP A;  3ZQF A;  1IJW C;  1EJ9 A;  2FQ3 A;  2IBD A;  4MGR A;  5FKN A;  5GAE J;  1IN8 A;  3JRC A;  1ZRD A;  4Z2Y A;  1YJW I;  5ED4 A;  3K4L A;  3T0Y A;  3E6C C;  2CV0 A;  2M4K A;  1G3T A;  1XMX A;  2LKS A;  2V6C A;  2MH9 A;  2DDB A;  2DCE A;  3HGG A;  2FUG 2;  4IHW A;  3I0T A;  4EMS A;  3QRF F;  2P0T A;  5J47 A;  3OYG A;  3FHN A;  5FFZ A;  2M30 A;  5GPA A;  4NQW B;  2VQC A;  1IRZ A;  1LQ1 A;  1CF7 B;  1UAA A;  2CS3 A;  2Y9Y A;  3PSF A;  3ZQL A;  1YFH A;  2DA6 A;  3BC8 A;  2KJB A;  1RES A;  1VQ4 I;  2X6Y A;  2V9K A;  1Z1D A;  1J5Y A;  3O6B B;  4JK1 X;  4Q48 A;  2W82 A;  1ZR2 A;  1XSD A;  1HSJ A;  1V5E A;  1D1C A;  2IGO A;  2DFE A;  5E1Z B;  4IPA A;  4IEJ A;  1AWC A;  5EGO B;  4BE0 A;  3GTP J;  2A6E F;  2HNH A;  1EH7 A;  3WG9 A;  2A05 A;  4OAY A;  2GZW A;  4BH9 A;  1X2M A;  2FE3 A;  4ZDP A;  2DMU A;  9ANT A;  5A2Q R;  1GVJ A;  3PUB A;  2IS1 A;  3PNV A;  1FTT A;  1NTC A;  1ONV A;  1TWG J;  2MC3 A;  2VJ5 A;  3A0B C;  4U87 A;  3TW6 A;  1QQI A;  1QZZ A;  3OYC A;  3TDU C;  2KZG A;  3HJE A;  5HNH A;  2BOL A;  4EM1 A;  3TW7 A;  4MLO A;  4B48 A;  2VOD A;  4HNU A;  2LC2 A;  2L9N A;  5FO5 A;  1D1B A;  3GFI A;  3BG6 A;  2COM A;  5E3M A;  2I10 A;  1LB2 A;  5LRS A;  3DPT A;  5E8I A;  3ERM A;  5AIP A;  5DDG A;  5EZG A;  1T33 A;  3TOB A;  3AAF A;  4BQA A;  3HGY A;  4KMU X;  3RKX A;  2XUB A;  1FSH A;  3ZR8 X;  2FNP A;  2P6T A;  3LFK A;  2XSD C;  3U9G A;  4MQ9 F;  3BR2 A;  4FX4 A;  5FLX Z;  5DUI A;  4FCY A;  2G9W A;  2OQR A;  4NQW A;  5HLH A;  5L3G A;  4A3G J;  1JHF A;  2DT5 A;  5FLX K;  1WHU A;  3HOT A;  1FPQ A;  3I4M J;  4MTD A;  3GCM A;  1AOY A;  3OYF A;  5LEK A;  1B4A A;  2M2E A;  4HSR A;  3S14 J;  4MHG A;  4I0B A;  5K1Y A;  3DLA A;  3BR1 A;  1XN7 A;  5EGO A;  3L09 A;  2VT2 A;  3ZGK A;  4IHS A;  2KRC A;  2R92 J;  4MNU A;  3OOU A;  3KZI C;  1DPR A;  1R1V A;  1V4R A;  1G4D A;  4Q47 A;  4UHT A;  3CME I;  1QNT A;  3KYC B;  2XPW A;  2CUZ A;  1PUF A;  5J4V A;  3K2A A;  3DF8 A;  3SXY A;  3BY6 A;  2JQ7 A;  3K1N A;  1BIA A;  3X2Q H;  1ON2 A;  3HL2 A;  3HKZ N;  1KA8 A;  4ITV A;  4M3B A;  3OYE A;  3OYL A;  1O7F A;  1JI8 A;  1ZN2 A;  3RPQ A;  3CP8 A;  1VQN I;  3QU3 A;  1W0T A;  2XC7 A;  3SZT A;  1K61 A;  1T56 A;  3TO6 A;  3E97 A;  1W5T A;  2KIM A;  1VQ7 I;  2V1U A;  1OYW A;  2EJR A;  2O8K A;  4FE4 A;  5DCF A;  1T08 B;  3LQR A;  1IN5 A;  5EEH A;  1R49 A;  3M9A A;  5H6R A;  4KIF A;  2K86 A;  4C2T A;  1I1G A;  1K79 A;  3JRB A;  2B7E A;  1V3F A;  4XK4 A;  4EV0 A;  3S2D J;  2HYJ A;  3Q0V A;  1WSU A;  1GVD A;  3H3Z A;  3ABT A;  5GAH J;  5F0C A;  1TWH J;  3ELK A;  1U5T B;  3IH2 A;  1UCR A;  2CH0 A;  5E17 F;  2R7W A;  2WBM A;  4JQF A;  2LTP A;  2JUG A;  1UHM A;  2DN0 A;  2KJC A;  3HIF A;  3H9G A;  1X4O A;  3EYI A;  1Y56 A;  4BXF A;  4IXA A;  3L2C A;  5E1X A;  4PSW A;  2IP2 A;  2KRF A;  3F3X A;  1R4M B;  2FBI A;  5FJ8 J;  2ME6 A;  5EYR A;  5ICE A;  1GLN A;  3V8L A;  1PP8 F;  1J7K A;  1GXP A;  2HTS A;  3VYR B;  3PNT A;  3P7N A;  2MGQ A;  1SVM A;  3GX4 X;  2R7O A;  1Y6I A;  5GPC A;  1D3Y A;  3H5R A;  2BVL A;  2DPD A;  1OCO H;  3KP5 A;  1VFC A;  1LPQ A;  2RGV A;  4PUS A;  1R1U A;  2VQL A;  3HOU J;  1BW5 A;  2JSC A;  5FGM A;  5FFX A;  3J81 Z;  4M9Z A;  4BJT A;  4PGH A;  4CCK A;  4EJU A;  4M3D A;  3LSH A;  3M8F A;  3KIO A;  5C4J J;  1TBX A;  4N0B A;  2F5D A;  3J81 K;  3CO7 C;  3ABK H;  4ENK A;  1YJN I;  3ZPL A;  3GME A;  4XIC A;  2L7F P;  3OYH A;  3ZMD A;  1BW6 A;  1RUN A;  3W2W A;  1YW8 A;  2OF7 A;  5GAD J;  4GFB A;  2UXN A;  1TTY A;  2DQR A;  3ZN1 A;  2L54 A;  3MMY B;  5E3N A;  3QYE A;  2R7X A;  1IRX A;  1OCZ H;  4G6Q A;  4ZYE A;  1JUM A;  1WVR A;  2X1E A;  1A04 A;  3D5S C;  3GFM A;  4XQF A;  4YIR X;  3L1P A;  5CJ9 A;  2NVX J;  1U5T A;  3OOP A;  3V4G A;  1I3A A;  2G7H A;  3U2R A;  3UKG A;  4NNJ A;  2VKH A;  2RDP A;  2GA2 A;  2Z33 A;  1W7P A;  5KVR A;  3J7A Y;  3RZO J;  4F93 B;  3I56 I;  1SEU A;  4M6V A;  1ZG3 A;  2PI0 A;  2FX0 A;  2VXD A;  2Z1D A;  2OJE D;  2E5Z A;  4X0G A;  3RPU A;  3T8R A;  2F4O B;  2EZL A;  1XGS A;  2OQG A;  1LNW A;  1R71 A;  1LEA A;  3FXM A;  3JTG A;  1Q1H A;  5GP9 A;  2K5C A;  3E6B A;  4D5C A;  2JMW A;  3R60 A;  1FJL A;  2O5R A;  1U78 A;  5FLX R;  2KIS A;  2X1C A;  1V54 H;  2CWE A;  2YX7 A;  3HC7 A;  4MFD A;  4UVC A;  4ZYD A;  1JT0 A;  1A5J A;  4J00 A;  2EIL H;  2M7B A;  1A35 A;  1LE8 A;  4XOP A;  2K9N A;  1XSX A;  2LD5 A;  1FZP B;  5C44 J;  2VKV A;  2JJ7 A;  5CYV A;  2M0C A;  5F0F A;  2NRA C;  3MKZ A;  2ISY A;  2DJN A;  3HM5 A;  4HNV A; 
#chains in the Genus database with same CATH homology
 1J2X A;  4HQM A;  1IRG A;  2OD5 A;  3NQO A;  5HDK A;  4M74 A;  3DQV C;  4OU0 A;  3ZMT A;  2IJL A;  4GGG A;  3VEP A;  3E6D A;  2FU4 A;  5ILU A;  4LMY A;  1XD7 A;  3DKW A;  2MLG A;  1P4A A;  1BI1 A;  6PAX A;  4MEY F;  1KU7 A;  4EM2 A;  1XMA A;  5K5O A;  1L0O C;  5HS9 A;  4AIK A;  4KN4 X;  3LST A;  1FYL A;  5K5Q A;  5CVU A;  3QAH A;  2O03 A;  1G6N A;  5JR3 A;  3G3Z A;  2YU3 A;  4D0P A;  1RNL A;  3KET A;  1ZH5 A;  1MZB A;  2XHK A;  1U6G A;  1B1B A;  3RKY A;  3VB2 A;  1FY7 A;  1ULY A;  1MKM A;  2QQB A;  2HS5 A;  3LQQ A;  4KFC A;  3KP6 A;  5K5R A;  3H92 A;  1PP7 U;  1HXD A;  1PDN C;  4ENM A;  2WC2 A;  2DAO A;  2RKH A;  3GLX A;  3M1E A;  4EGY A;  2FOK A;  1FC3 A;  4H0E A;  1KQ8 A;  3C7J A;  4EJW A;  4M9X A;  1TW3 A;  2ACJ A;  1RIO H;  2LNB A;  5EEG A;  4WWC A;  2VC1 A;  5L3B A;  1FT9 A;  1MJB A;  3JSO A;  2NAZ A;  2D1H A;  5L3E A;  1S8N A;  5ICF A;  1E2X A;  3F8F A;  3ISP A;  4ENN A;  1JGS A;  3GEZ A;  1F9N A;  3K1P A;  3P9I A;  4WK8 F;  4G6D A;  3HOS A;  2XAQ A;  1ON1 A;  3J7A O;  2XKP A;  1HST A;  3I54 A;  3G73 A;  4N9H A;  4MQV A;  4M72 A;  2EWN A;  3I71 A;  5E20 A;  1R00 A;  3R0A A;  4G9Y A;  4RS8 A;  1J59 A;  3MQ0 A;  2MD5 A;  1LDD A;  1S6L A;  2EFW A;  3WU1 B;  4UVB A;  4CYD A;  4QLC U;  2FXA A;  1YYV A;  4CXF A;  2F5F A;  2ZKZ A;  2XAF A;  4U0Y A;  3E6M A;  1G3Y A;  4L5J A;  2Y48 A;  5D5X B;  3ZMZ A;  4Q4Z F;  2VOO A;  3GO5 A;  3F8C A;  4LLN A;  3VOD A;  1P2F A;  2VOP A;  2GIV A;  4KIB A;  2QWW A;  2XRN A;  4O6J A;  2H09 A;  1L3L A;  4I2O A;  3MEX A;  5LGT A;  4O5V A;  4M6X A;  2QQA A;  4CIC A;  3ZMU A;  4OMZ A;  5F6F A;  2K27 A;  1LDK B;  3BPV A;  3ZQ7 A;  4XSX F;  4EJO A;  1T98 A;  5HLI A;  3TKY A;  5HDN A;  2Z9O A;  2LF8 A;  4ENJ A;  4R79 A;  4EGZ A;  5DEQ A;  2FSW A;  5BMZ A;  5DD4 A;  3HYI A;  2D2W A;  2LDU A;  4WF2 A;  1U5T C;  4EQQ A;  3B73 A;  1RUO A;  2PEX A;  2ZJ2 A;  3D0S A;  1OYI A;  4HBL A;  1ZG5 A;  2HFH A;  3IKT A;  5CVR A;  1XCB A;  2XKO A;  2F2E A;  5HLG A;  4KT5 C;  4XLN F;  3KLO A;  4RB2 C;  2JPB A;  3BWG A;  3RIR A;  1I27 A;  4HF0 A;  1T39 A;  3F8B A;  1LJ9 A;  2RNJ A;  1XMK A;  5ICG A;  1SD5 A;  1HKS A;  4LLL A;  1W4M A;  1KQ9 A;  3DEU A;  4LLG F;  1UFM A;  2D1V A;  2Q0O A;  4ZYG A;  2AS5 F;  4HYE A;  3O3K A;  3HRU A;  4GYI A;  3HSE A;  5LBQ A;  1FOK A;  1O57 A;  2IW5 A;  2VXZ A;  3IWZ A;  4U0W A;  2JT1 A;  3BDD A;  3K2Z A;  4JBA A;  5DV5 A;  1YO5 C;  3KEQ A;  3RI4 A;  1OYY A;  3BP8 A;  2O8X A;  1T38 A;  2ISZ A;  1TNS A;  4WCG A;  4OIQ F;  4A6D A;  3MZY A;  3E3V A;  1XGO A;  4GYG A;  3WTT C;  5KK1 A;  3RYP A;  1BI3 A;  5J6X A;  2M45 A;  5LGU A;  3HUG A;  2V1D A;  3JAM Z;  2FML A;  3M7G A;  2QYO A;  3JAM K;  1MD0 A;  4B8X A;  2RN7 A;  1QBJ A;  3C18 A;  3HSF A;  3V7S A;  2X0L A;  4HDU A;  1Y0U A;  1Z91 A;  1BI0 A;  4RGS A;  5ILV A;  2VT3 A;  3HRT A;  5FD6 A;  3KP2 A;  3GFJ A;  2GXB A;  3FF5 A;  2XVC A;  2RQP A;  4YFN F;  4AD9 A;  4Y15 A;  2VON A;  3ML6 A;  1ZHF A;  4LB6 B;  3ROU A;  1FSE A;  3V7R A;  1ZGJ A;  4HX8 A;  5F64 A;  4ZZL A;  5LHG A;  1MJA A;  3E5Q A;  4G7Z F;  2WWY A;  3EUH A;  4IVN A;  3I59 A;  2L3D A;  1D8K A;  1Z6T A;  2XIG A;  2EV5 A;  3T5X A;  4XSZ F;  3CDH A;  3WOD F;  1HW1 A;  1D5V A;  4HA8 A;  1ODD A;  3K0L A;  5JFR A;  1SAX A;  2MBF A;  4PZJ A;  2A5Y B;  3WU0 A;  2LKP A;  1QPM A;  2CYY A;  3CUO A;  1P4W A;  3BJO A;  4ETS A;  2QQ9 A;  1IUY A;  1FBU A;  2FEZ A;  1IN7 A;  2YPR A;  4U7B A;  1W7P B;  2IVM A;  2P7C B;  2P4W A;  2DK5 A;  4HZF A;  3I4P A;  4RGX A;  3V8J A;  2HKX A;  4I09 A;  4GO1 A;  3GF2 A;  3SFZ A;  1SFX A;  1RI7 A;  5TRD A;  3BJ6 A;  5BQT A;  1KU3 A;  5FD5 A;  4ON0 A;  3I53 A;  1PUE E;  1SD6 A;  4Q5S F;  3F6V A;  5D6E A;  1BOA A;  4TV7 A;  2BV6 A;  3RKW A;  4EJT A;  3L7W A;  2K4J A;  3WE2 A;  1CGP A;  2ESN A;  1R22 A;  3LAJ A;  5IT9 Z;  5E8G A;  2QEN A;  4YII A;  5IT9 K;  3F23 A;  2ADU A;  4KNY A;  2HQR A;  1G3W A;  2A07 F;  3D5L A;  1BBY A;  4HF2 A;  1IZ1 A;  1BJA A;  2RC4 A;  2KIF A;  3GZ6 A;  3QP6 A;  1T0F A;  4HLY A;  3QP5 A;  1YG2 A;  3NRV A;  1E17 A;  2FRH A;  5DD8 A;  5JI6 A;  1STZ A;  1BN5 A;  3TQN A;  4L9N A;  2BEO A;  1BC8 C;  1IF1 A;  2AXL A;  2CQK A;  3EDP A;  1QZY A;  2M5W A;  1GXQ A;  3RYR A;  4HF1 A;  2K02 A;  2PMU A;  5D5V B;  2F5C A;  2HDC A;  1O3S A;  4BHB A;  4MEX F;  4ZYH A;  2R3S A;  3U1D A;  4WXH A;  4U88 A;  4HV5 A;  5DYM A;  2OZU A;  3N97 A;  2ZME B;  1F1Z A;  4FT8 A;  2A6H F;  3MCZ A;  3HHH A;  4YFX F;  1OR7 A;  2FF4 A;  2HR3 A;  2L01 A;  2HGC A;  3JW4 A;  3FXU A;  3QPH A;  1QGP A;  2IRF G;  2DW4 A;  3K9T A;  3C3W A;  2CW0 F;  2XV4 S;  5AIQ A;  4EVI A;  4ESF A;  3TGN A;  2VN2 A;  5F1R A;  1YW9 A;  5HOO A;  2A68 F;  4QWQ A;  5CVV A;  1YTY A;  1SMY F;  5J8C A;  3LA7 A;  3CJN A;  4LG0 A;  3LWF A;  1J0R A;  4LK1 F;  3CLO A;  4O3M A;  4CO8 A;  4P9F A;  4L0Z B;  5CLS A;  4R1H A;  1U2W A;  2ZME A;  2ESH A;  3ZN0 A;  1HKQ A;  3F72 A;  3BRO A;  1FBQ A;  1UST A;  5HS8 A;  2W85 A;  4A0Z A;  2KKO A;  5LLQ A;  2QZ8 A;  2P5V A;  3COA C;  2PFB A;  4RGR A;  2J5P A;  4AVP A;  2OAZ A;  2YX4 A;  2PN6 A;  2VE9 A;  4M6Y A;  4L5I A;  1WWX A;  1HBX G;  3T1B A;  4HOB A;  1FBS A;  3W6J B;  5BPD A;  4HLX A;  5LGN A;  2H6C A;  2PMH A;  3H3U A;  2FNA A;  2E1C A;  4KN7 X;  4UVA A;  1F5T A;  1YW7 A;  3FM3 A;  4WX9 A;  3EYY A;  4YG2 F;  4P5O A;  3P9C A;  3WTU C;  1DPU A;  1U8R A;  3IC7 A;  4FHT A;  5D4R A;  2ZXJ A;  1USS A;  1R5G A;  1FLI A;  2CO5 A;  2IA0 A;  3RTR A;  2HOE A;  2VC0 A;  3P9K A;  2EFO A;  1LEB A;  2DTR A;  4UV9 A;  1VTN C;  1Z6R A;  2ELH A;  5L3F A;  2EK5 A;  2P8T A;  3MAJ A;  1JE8 A;  5L3D A;  1KYW A;  1K78 A;  4LGW A;  2IT0 A;  2E7X A;  2W25 A;  5LHH A;  2A3S A;  1XCV A;  3HHG A;  2M8E A;  4U0V A;  4ZH4 F;  3GFL A;  5ILS A;  4IRI A;  4G8X A;  3VFZ A;  2VBY A;  2W24 A;  2EV0 A;  2W57 A;  1BM9 A;  1XDS A;  3FX3 A;  1WI9 A;  2P7V B;  1XB4 A;  3FXR A;  1KU2 A;  3FZV A;  2E7W A;  1ZYR F;  3SZP A;  1MJ9 A;  4XRF A;  1ZRC A;  3B02 A;  2H94 A;  5E1W A;  3RDI A;  4A6E A;  5D5W B;  1YLF A;  3QU6 A;  1MDM B;  2H6B A;  1LDJ A;  1ZLK A;  3KP3 A;  1ZAR A;  3L9F A;  4RB1 A;  4CGZ A;  5HDG A;  4IRH A;  1O7L A;  4DNC A;  2QUF A;  4LD5 A;  4YFK F;  1QO0 D;  2CG4 A;  4Y13 A;  2DI3 A;  2MLK A;  2DK8 A;  3ULQ B;  3BPX A;  4I01 A;  1WKM A;  2P5K A;  4GCV A;  4WXD A;  2BYV E;  3OV8 A;  2W84 A;  4FX0 A;  3FWE A;  4G7O F;  1IAW A;  3KFW X;  1UB9 A;  3JSP A;  3C1D A;  2M1B A;  3GYH X;  2IPQ X;  2STT A;  1P92 A;  1O3Q A;  4M9S A;  1SD7 A;  3M8E A;  1KYZ A;  4NHJ A;  2BGC A;  2YR2 A;  3CUQ B;  3J80 Z;  3F21 A;  1MDM A;  1IXC A;  3O2P E;  5BS6 A;  3J80 K;  1SFU A;  1WQ2 A;  3WGH A;  4A2U A;  3E5X A;  2HQN A;  3TDZ C;  2YSR A;  3KEO A;  3ABU A;  2C6Y A;  1KQ0 A;  3GW2 A;  4ZZD A;  3FMR A;  1IN4 A;  4KMF A;  4OOI A;  3L00 A;  1HKT A;  3I64 A;  3NEU A;  4AWX B;  3R4K A;  5E18 F;  1DDN A;  2XRO A;  4A5N A;  5FB2 A;  2QVO A;  2EFQ A;  2RV8 A;  2CSO A;  1K7A A;  4XBF A;  4PDK A;  3BZ6 A;  2Q2E A;  3EQL F;  5D5U B;  3HTU A;  2HYF A;  3IWF A;  1FYK A;  2D45 A;  2FBH A;  4PGG A;  2X4H A;  4RAZ A;  4YIF A;  3I59 B;  3CUQ A;  1TW2 A;  3DP7 A;  4IF4 A;  4LK0 F;  4S05 A;  3GUD A;  3KLN A;  1TQM A;  1UHW A;  1ZRE A;  1OMI A;  3DXJ F;  2KIU A;  4PCQ A;  2TDX A;  2HTJ A;  2CFX A;  2GAU A;  3IRQ A;  1W5S A;  5ERI A;  1XDU A;  4P9U A;  1FNN A;  3RJP A;  4OIO F;  4OMY A;  2H27 A;  1DP7 P;  2J5O A;  1FP1 D;  2O61 A;  1NHA A;  2VBZ A;  1CF7 A;  3DFG A;  1DUX C;  3Q9V A;  1SMT A;  5ICC A;  2M87 A;  3FMQ A;  5TJJ A;  3FHZ A;  1B59 A;  1EV7 A;  1FX7 A;  1G3S A;  3IHU A;  4BXU A;  2HKO A;  4RB0 A;  2GXG A;  3KP7 A;  1ZAO A;  1FP2 A;  4L18 B;  1T2K A;  2NS0 A;  5H6Q A;  2L4M A;  3REO A;  2XAS A;  3F8N A;  4DQ2 A;  5H20 A;  1R36 A;  1Z7U A;  2Y0M A;  4LJZ F;  4XLP F;  4R8H A;  4P55 A;  3ZMS A;  4BYY A;  2EFN A;  4G94 A;  1S3J A;  4ASN A;  2JZY A;  1FWZ A;  1KGS A;  3FXQ A;  2VE8 A;  2QBY B;  3SQN A;  5D8L B;  2PJP A;  1R58 A;  4NB5 A;  4HQE A;  4EJV A;  2DFI A;  1R1T A;  1MGT A;  3KE2 A;  2OA4 A;  2XAH A;  3MFK A;  1ZGA A;  4OIN F;  1WRJ A;  2XAJ A;  3KZY A;  4KIC A;  2P6S A;  3GVA A;  1SFE A;  1H0M A;  4UUV A;  2ZNZ A;  3TO7 A;  1KU9 A;  3LAP A;  4G7H F;  1B6A A;  4RGU A;  1S29 A;  5LRR A;  1ZRF A;  2DPU A;  1I5Z A;  2CGP A;  3GXO A;  4KUM A;  4CHU A;  3WTW C;  3S2W A;  1IN6 A;  1LVA A;  2NNN A;  2V79 A;  1J9I A;  2O0Y A;  4HX7 A;  1R7J A;  3ZMV A;  4IHT A;  2O6G E;  2LSO A;  2O3F A;  4L9V A;  3HTS B;  2QBY A;  3F8M A;  1H9T A;  3WTZ A;  4E70 A;  4OIP F;  3WE3 A;  2NNY A;  2FMY A;  1I6X A;  5L3C A;  3K1M A;  2VBX A;  4HDV A;  3F22 A;  4LG0 B;  2ZO4 A;  2XGX A;  2ZNY A;  5HS7 A;  1T6S A;  1X3U A;  1TNT A;  3PFI A;  3WTS C;  2QM3 A;  1EH8 A;  2V1X A;  5LEJ A;  4HAM A;  2A61 A;  2Z3Y A;  3DPL C;  1Z9C A;  1JXS A;  2DBB A;  5DUK A;  3IRR A;  1D8J A;  3HRS A;  1IRF A;  1U3E M;  3WGG A;  1HW5 A;  5D8K B;  5CVI A;  4U7D A;  4KIG A;  2STW A;  1YQA A;  5D4S A;  3DV8 A;  1BC7 C;  1B9N A;  4N9I A;  3WTV C;  2MH2 A;  3IKV A;  1SD4 A;  3FMS A;  4IJA A;  1ZG1 A;  1YIO A;  2EB7 A;  1GHC A;  3Q9S A;  2G7U A;  2JTV A;  2R7D A;  5LHI A;  2OBP A;  4MTE A;  2LF7 A;  3CUQ C;  3I58 A;  3ECO A;  1O3R A;  4UXN A;  1YS6 A;  3BOQ A;  3SHF A;  1HW2 A;  3GZ5 A;  4M71 A;  5CVJ A;  2EFP A;  2HZT A;  2DU9 A;  2UXX A;  2P5L C;  5IT3 A;  2WV0 A;  4RB3 C;  1BIB A;  1TQP A;  4A0X A;  4GXO A;  3KZZ A;  2GA1 A;  1TLH B;  3HRM A;  4L9T A;  2QLZ A;  4OIR F;  1XSV A;  2EV6 A;  2DLL A;  4BHP A;  2B0L A;  3CO6 C;  3WTY C;  4M73 A;  4A5M A;  1OKR A;  5JHU A;  2HWV A;  2PLY A;  2VBW A;  1K78 B;  2R7F A;  1IW7 F;  2K4B A;  4EM0 B;  3V7C A;  4A12 A;  3WGI A;  3FM5 A;  3IL2 A;  4L9J A;  2FBK A;  3W6K B;  3GWZ A;  3QPT A;  1TQI A;  1YS7 A;  4HX4 A;  3T8T A;  2DO7 A;  4RAY A;  2Z5U A;  5HVQ C;  3R6S A;  5BOX A;  3TO9 A;  2E1N A;  1IXS B;  2JPC A;  4I02 A;  2HYG D;  4I0A A;  2BBY A;  3K69 A;  4K2E A;  4I7H A;  1XGN A;  2XAG A;  2L02 A;  5BPI A;  3ERE D;  3VOE A;  2K7L A;  2A69 F;  3BJA A;  3ZP5 A;  4I98 B;  3MZH A;  5D6F A;  1C0W A;  3Q5F A;  1I1S A;  4KA4 A;  5DCM B;  4HV6 A;  1XGM A;  1W7P D;  4CZZ A;  2UWM A;  1J75 A;  2PBI A;  4Y17 A;  2Q8K A;  4UNO A;  4IRG A;  4B09 A;  4HW0 A;  2HEO A;  5AON A;  3WTX C;  2Y75 A;  2WTE A;  4S04 A;  4P96 A;  4BNC A;  2V9V A;  3ECH A;  4AIH A;  1R23 A;  2NYX A;  4A0Y A;  5J8F A;  2OZ6 A;  5A2Q Z;  3PQK A;  1Z05 A;  3F6O A;  3EET A;  2ZFW A;  5A2Q K;  1ZLJ A;  3KP4 A;  1P6R A;  2FA5 A;  1O3T A;  3JTH A;  1HQC A;  3TOA A;  3MWM A;  2Z99 A;  1B9M A;  4UV8 A;  4L0Y B;  2F5E A;  2IA1 A;  2JRT A;  5DCM A;  3HSR A;  3KCC A;  1EH6 A;  1K6O A;  2DQL A;  1RZ4 A;  4WXC A;  2UZK A;  1FYM A;  1BI2 A;  2ZBK A;  3LA3 A;  4KYW A;  4BHC A;  3R61 A;  1P4X A;  4CDG A;  3R0J A;  1F4K A;  1IXR C;  3E5U A;  5JVT A;  4AIJ A;  2PQ8 A;  2GQQ A;  4F7Z A;  3LA2 A;  1H9G A;  4LB5 A;  2BE5 F;  3CTA A;  4KDP A;  1JHH A;  2OU2 A;  2PG4 A;  2GWR A;  3V8K A;  2L4A A;  2MA3 A;  2IA2 A;  3PQJ A;  3I5U A;  2ZCW A;  4LFU A;  1REP C;  4BAY A;  3N4M A;  2EA2 A;  1R5H A;  4ESB A;  1S7A A;  1OPC A;  2EA4 A;  2RVC A;  4ESJ A;  2ETH A;  1S7O A;  3QOP A;  2FQ3 A;  4MGR A;  1IN8 A;  1ZRD A;  4Z2Y A;  5ED4 A;  3T0Y A;  3E6C C;  1G3T A;  2V6C A;  2MH9 A;  3I0T A;  4EMS A;  3QRF F;  5FFZ A;  2M30 A;  1LQ1 A;  1CF7 B;  1YFH A;  2KJB A;  1Z1D A;  1J5Y A;  3O6B B;  4JK1 X;  4Q48 A;  1XSD A;  1HSJ A;  5E1Z B;  4IPA A;  1AWC A;  2A6E F;  1EH7 A;  3WG9 A;  2GZW A;  4BH9 A;  2FE3 A;  1GVJ A;  1ONV A;  2MC3 A;  1QQI A;  1QZZ A;  3TDU C;  4EM1 A;  2VOD A;  5FO5 A;  3GFI A;  2COM A;  1LB2 A;  5LRS A;  3DPT A;  5E8I A;  5AIP A;  5DDG A;  3TOB A;  3AAF A;  4BQA A;  4KMU X;  3RKX A;  2XUB A;  1FSH A;  2FNP A;  2P6T A;  3LFK A;  3U9G A;  4MQ9 F;  4FX4 A;  5FLX Z;  5DUI A;  2G9W A;  2OQR A;  4NQW A;  5HLH A;  5L3G A;  1JHF A;  2DT5 A;  5FLX K;  3HOT A;  1FPQ A;  4MTD A;  1AOY A;  5LEK A;  1B4A A;  4MHG A;  4I0B A;  5K1Y A;  1XN7 A;  3L09 A;  2VT2 A;  4IHS A;  4MNU A;  1DPR A;  1R1V A;  1V4R A;  1G4D A;  4Q47 A;  4UHT A;  1QNT A;  3DF8 A;  3SXY A;  3BY6 A;  3K1N A;  1BIA A;  1ON2 A;  1KA8 A;  1O7F A;  1ZN2 A;  3RPQ A;  3QU3 A;  3SZT A;  3TO6 A;  3E97 A;  1W5T A;  2KIM A;  2V1U A;  1OYW A;  2EJR A;  5DCF A;  3LQR A;  1IN5 A;  5EEH A;  3M9A A;  5H6R A;  4KIF A;  2K86 A;  1I1G A;  1K79 A;  1V3F A;  4EV0 A;  1WSU A;  3H3Z A;  3ABT A;  3ELK A;  1U5T B;  1UCR A;  5E17 F;  4JQF A;  1UHM A;  2KJC A;  3HIF A;  3EYI A;  4IXA A;  3L2C A;  5E1X A;  2IP2 A;  2KRF A;  3F3X A;  2FBI A;  5ICE A;  3V8L A;  1PP8 F;  1J7K A;  1GXP A;  2HTS A;  3P7N A;  3GX4 X;  1D3Y A;  2DPD A;  3KP5 A;  2RGV A;  1R1U A;  2JSC A;  5FGM A;  5FFX A;  3J81 Z;  4M9Z A;  4PGH A;  4EJU A;  3M8F A;  1TBX A;  4N0B A;  2F5D A;  3J81 K;  3CO7 C;  4ENK A;  3ZPL A;  1RUN A;  3ZMD A;  1YW8 A;  2UXN A;  1TTY A;  2DQR A;  3ZN1 A;  2L54 A;  4G6Q A;  4ZYE A;  1A04 A;  3GFM A;  5CJ9 A;  1U5T A;  3OOP A;  3V4G A;  2G7H A;  3U2R A;  2RDP A;  2GA2 A;  2Z33 A;  1W7P A;  5KVR A;  1ZG3 A;  2PI0 A;  3RPU A;  3T8R A;  1XGS A;  2OQG A;  1LNW A;  1LEA A;  3JTG A;  1Q1H A;  3E6B A;  3R60 A;  1U78 A;  4UVC A;  4ZYD A;  2CWE A;  2YX7 A;  1XSX A;  1FZP B;  5CYV A;  2NRA C;  2ISY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...