2EV0A

Bacillus subtilis manganese transport regulator (mntr) bound to cadmium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 51
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev0A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev0A02
4KMFA 4BNCA 3KZYA 4QLCU 5F64A 1T2KA 4M72A 5CVRA 1G3TA 3CO6C 1IAWA 1XMAA 3PQKA 2RDPA 3FM3A 3U9GA 4I02A 4IRIA 3F3XA 1SMYF 2MA3A 1QPMA 1B9NA 2DQLA 3WGHA 2X0LA 1K78A 1UCRA 1SD6A 3J81Z 2VT3A 3IKTA 2NAZA 2KIFA 3BOQA 3TO9A 2DQRA 2BE5F 3ERED 1P4XA 3ZMZA 4P5OA 2IVMA 1FNNA 1R5GA 3Q9SA 1J75A 2PI0A 3E5UA 5FD6A 2DW4A 2OZUA 1LB2A 5K5OA 2FNPA 4JQFA 4KN7X 3ISPA 1J7KA 1XSXA 5DYMA 1FSHA 1MKMA 2YU3A 1ON2A 4NQWA 4RS8A 4KIGA 3LFKA 5ED4A 1Z6RA 2F2EA 4A0ZA 4M6XA 2J5OA 3ZPLA 2FSWA 3K0LA 1J5YA 5IT9Z 4G7OF 1BI0A 3K1PA 3RYRA 3ZMTA 2QQBA 3S2WA 3F21A 4Y15A 4LK0F 4CZZA 1YQAA 2IT0A 2L02A 2W24A 4DQ2A 3HIFA 3I5UA 4MHGA 5BQTA 4A0XA 2XKOA 2QUFA 2EK5A 2ADUA 1WWXA 1ONVA 1IXCA 3RIRA 2BYVE 2NNYA 3ML6A 2EJRA 2PMUA 4XLPF 4HLYA 3FF5A 3VB2A 2EFOA 2V1XA 1YO5C 2RQPA 5LEJA 2D45A 3U2RA 2MLKA 1PDNC 4EM0B 2MH2A 1T38A 2BEOA 3T1BA 1IF1A 2YR2A 3F8MA 3QRFF 1ZRCA 4A6EA 3F22A 1XD7A 1IRFA 1H9TA 5LHHA 4OIRF 4OIQF 4KFCA 1Z05A 3DXJF 3NRVA 1R1UA 2B0LA 2Z3YA 4RB1A 1JGSA 1HXDA 4TV7A 1YTYA 1RZ4A 5JHUA 1AOYA 2EV0A 5L3FA 5AIQA 4BQAA 4L18B 2Y75A 2BBYA 4Q4ZF 4OINF 1X3UA 4EJOA 5JFRA 4I0BA 3ROUA 3G73A 3JAMZ 4H0EA 1Z91A 2VOPA 2M8EA 4ZYEA 1EH6A 5HDNA 5BOXA 3CDHA 2JPBA 4MQVA 4G94A 2GXBA 4IPAA 3QPHA 3K2ZA 3QPTA 3E6MA 1JHHA 1Z6TA 5FLXK 2HTJA 1LDDA 2K86A 3ABUA 1J9IA 4HYEA 1REPC 1BOAA 1BI1A 1BC8C 1LNWA 2OQGA 4KN4X 2PLYA 1YS7A 4BYYA 3I53A 1F1ZA 2L54A 1S6LA 3ZMDA 1J0RA 1ZGAA 1MZBA 4A5NA 2QBYA 2Y48A 5ICCA 1FYLA 1HKSA 3LA3A 5DEQA 3ZP5A 2QBYB 4ZZLA 2HWVA 2IW5A 1JE8A 1OYIA 4RGUA 1IUYA 5BPDA 2YSRA 1SD4A 3FXRA 5KVRA 2F5FA 1ON1A 3F8FA 3BWGA 4KMUX 3HHGA 3FWEA 4IRGA 3LAJA 3SQNA 2XV4S 5KK1A 4ENMA 4RGSA 1WRJA 2OA4A 4AD9A 4ETSA 2P5LC 1W4MA 3ABTA 4EM1A 4YFXF 4BH9A 2P5KA 2LNBA 2STTA 2HOEA 3MWMA 4O5VA 3BZ6A 3KEOA 1HW1A 1GXPA 3KLOA 3C3WA 5HS9A 2YX7A 3SXYA 3GX4X 1BC7C 1O7FA 5J8CA 1U6GA 5FGMA 1GVJA 4KYWA 1MJ9A 2HYFA 5DUKA 2VBYA 4UNOA 1FBQA 4OIPF 2HKXA 2VE8A 2DFIA 1YFHA 1JHFA 3DV8A 3E5QA 1YG2A 3O3KA 3DFGA 2H94A 4GGGA 1S3JA 5HLHA 2OQRA 5DD4A 5BMZA 2E1NA 3L00A 3WU1B 2PMHA 3AAFA 1C0WA 5LEKA 2EB7A 2WTEA 2D2WA 3I71A 2PN6A 2R3SA 3E6DA 2IRFG 2VE9A 4HX8A 1IN7A 1L3LA 4BHCA 3DF8A 2DT5A 3R60A 2V1UA 1EH7A 5ICFA 3V7RA 4HZFA 1HBXG 4O6JA 5LGNA 2NS0A 3GEZA 3P9KA 3J80K 2MD5A 1WSUA 3V8JA 4R8HA 1BIBA 2DK8A 3CUQA 5D4SA 1IN4A 1ZG1A 4HDUA 4HF2A 1KA8A 4KA4A 3MAJA 5FO5A 2ZXJA 3JSOA 2W57A 3KCCA 1EV7A 3M1EA 4IXAA 4CGZA 3HYIA 3HRSA 3V7CA 3MQ0A 3JW4A 2QENA 4LFUA 3V4GA 2W85A 1LEBA 4OMZA 3H3ZA 3HOTA 4PDKA 5JR3A 4U7BA 2UXNA 4HOBA 2ZCWA 2FBHA 1OR7A 2V6CA 4OOIA 2ZJ2A 4WWCA 3IWZA 4M9ZA 5J8FA 1ZAOA 2H27A 2QZ8A 5E1ZB 2RV8A 1CF7A 3IRRA 2VODA 4M74A 3E3VA 1FP1D 3ULQB 1G3YA 3Q5FA 3FXQA 1CF7B 3T8TA 1KYZA 1ZHFA 1Y0UA 4PGHA 4ZZDA 3V8LA 2P6SA 1T39A 2VN2A 5FD5A 4KDPA 1HW2A 3GLXA 1B59A 2CWEA 3REOA 5DCMA 4HX7A 2PBIA 1ZG3A 4Q5SF 2OD5A 3FM5A 3JTGA 1I1SA 2HR3A 1KU3A 4D0PA 1BJAA 4IVNA 5LLQA 3RKXA 1IN8A 1FYMA 1WQ2A 5E1XA 2FMYA 4PGGA 4F7ZA 1XDUA 1LJ9A 2JSCA 1V3FA 2HTSA 4UHTA 5HDGA 2EFWA 5FLXZ 2NRAC 4UVBA 1ZGJA 3DPTA 1W5SA 4ZYGA 5E8GA 4MQ9F 1O3TA 1I1GA 2A5YB 5TRDA 1FWZA 2KJBA 4ENNA 3RPQA 4Y17A 2A07F 2IA2A 4HAMA 1VTNC 1XGMA 5LHIA 3DP7A 1U78A 2ZFWA 2A69F 3VFZA 2CQKA 3OV8A 4CHUA 4LGWA 2VBZA 4LB5A 3IRQA 1K6OA 1PP8F 4P9UA 1TW2A 3IWFA 3I0TA 1P92A 2STWA 3KP4A 1BIAA 5ERIA 1XCVA 4XSXF 2PJPA 3F23A 3FMQA 3PFIA 4LJZF 3T8RA 2E7WA 5K5RA 3KZZA 2GAUA 2HKOA 1OMIA 2G7UA 3VEPA 4EV0A 5ICGA 2HQNA 3F6VA 5FFXA 3GW2A 1P4AA 1QNTA 4FT8A 3SHFA 4GO1A 3ZQ7A 4L5IA 1TQMA 2XAJA 2D1HA 2VT2A 2O61A 1ZLKA 2Z9OA 2KIUA 2VC0A 2H6BA 3KETA 1I27A 3TOAA 5D4RA 2YX4A 5DV5A 1MD0A 4WXHA 5EEHA 2KKOA 2JT1A 1FYKA 3J7AO 3RDIA 1PP7U 3BDDA 2WC2A 5CVUA 2ZNZA 4N0BA 2DBBA 1SFEA 4L0ZB 1ODDA 4P55A 3OOPA 4JK1X 3HTSB 3ZMUA 3GFMA 4PCQA 1AWCA 3O6BB 4Z2YA 1TQIA 3WU0A 3GFLA 1FBUA 4KIFA 5ILUA 3H3UA 2QM3A 5D5XB 2P7VB 3J80Z 1HKQA 4IJAA 2C6YA 4KIBA 5AONA 4AWXB 1K79A 2PG4A 3VODA 5ILVA 2J5PA 2GQQA 4PZJA 3GUDA 3WE2A 2M5WA 1R23A 2FEZA 1G4DA 3L2CA 5D6EA 1Z7UA 3E97A 4YFKF 1USTA 2XUBA 1KYWA 4N9HA 3RTRA 1G3SA 4QWQA 2FRHA 4LG0A 1R1VA 3R0JA 3R4KA 1MJAA 4LG0B 3WTUC 3N4MA 1XGOA 1FT9A 4UVAA 4I2OA 4ON0A 1BI2A 1FY7A 3MFKA 3GZ5A 4A12A 4LLLA 4JBAA 1I5ZA 3EQLF 4CXFA 2CYYA 4I98B 2HDCA 3WTVC 3DQVC 4G9YA 4U0VA 3E6BA 2PFBA 1FP2A 2DI3A 1FX7A 3IHUA 5EEGA 1P2FA 3BPVA 2GA2A 2M45A 2PEXA 4ASNA 4ESBA 1U5TA 3LQQA 2KJCA 1RI7A 1U5TB 2XROA 4B8XA 1STZA 2XHKA 3V7SA 2A61A 1XB4A 3SFZA 3KP5A 4LK1F 3B73A 2FF4A 3RYPA 1U2WA 5K5QA 1LQ1A 1HKTA 5H6RA 2KRFA 3L09A 2O6GE 5D5UB 3TDUC 1ZARA 1K7AA 1XGNA 3C7JA 2WWYA 3U1DA 1U3EM 4KNYA 4RGRA 2XAHA 4M9SA 3TGNA 3R0AA 2LF7A 1LVAA 2EFNA 5FB2A 1GHCA 2FXAA 3QOPA 3EYIA 4MNUA 5IT9K 5CVVA 2YPRA 1CGPA 4WCGA 4EJWA 5LBQA 1FC3A 1MJBA 3WTXC 2QQAA 3DPLC 3CJNA 4RB0A 1W7PD 4ZYHA 4U0YA 3CUQC 2EV6A 3M7GA 1B6AA 1S7OA 3GVAA 2CGPA 1W7PB 2VC1A 5DD8A 2CW0F 4P9FA 3L7WA 4DNCA 4M9XA 5A2QK 1IW7F 2HYGD 2OAZA 1O7LA 2M1BA 5DUIA 1YS6A 2QWWA 4AIKA 2HEOA 4HA8A 2HZTA 5BPIA 1H9GA 2GXGA 3WTTC 1OPCA 1J2XA 3RKYA 1HW5A 3LQRA 4P96A 4NB5A 1RUNA 5HLGA 1R1TA 5E18F 2HS5A 1F4KA 3COAC 1XMKA 2P5VA 5L3CA 4K2EA 4YIIA 4Q48A 4I09A 5CJ9A 2RVCA 5DDGA 3HRUA 2FA5A 5FFZA 2R7FA 4LLNA 2ETHA 3GYHX 2O3FA 1PUEE 2ZKZA 2M30A 5L3GA 4I01A 1IRGA 3FZVA 3ELKA 4GYGA 3RJPA 1YW7A 4RB2C 1QZZA 1P6RA 4M73A 4XSZF 5LRSA 3TKYA 4A0YA 3LWFA 3KEQA 3M8EA 1TTYA 2RNJA 4AVPA 5LHGA 4L9JA 2GA1A 3HRMA 3BJ6A 1SD7A 4Q47A 3PQJA 2E1CA 1ZG5A 3EETA 3QU3A 4UXNA 4S05A 3JSPA 3WTWC 2ISZA 2FBKA 1IXRC 1O57A 2XAFA 1QZYA 2R7DA 2ZMEB 4LD5A 2ESHA 5E20A 4NHJA 2P6TA 4HLXA 2A6EF 1Z9CA 3L9FA 1DP7P 4Y13A 2K4JA 3C1DA 3GO5A 2Z5UA 3E5XA 1TW3A 5D5WB 2V9VA 3Q9VA 1OYWA 2TDXA 2XGXA 2P4WA 4R79A 1TQPA 5LGUA 1MDMB 2EWNA 4G6QA 4G6DA 3LA7A 1SAXA 3P7NA 2FQ3A 5F6FA 2UZKA 1R5HA 5CLSA 5HS7A 2L4AA 3GWZA 5D6FA 3EYYA 1SMTA 2M87A 2QLZA 2K02A 3T5XA 1FSEA 3TO6A 1B4AA 1S7AA 3F6OA 4KICA 3I59B 1B1BA 1RIOH 4MGRA 5JI6A 1BN5A 1HSTA 1O3SA 3I58A 1R7JA 2G7HA 3EDPA 3ZMSA 2LF8A 2W25A 4YFNF 1KQ8A 1FLIA 1XGSA 4XLNF 2UWMA 2QVOA 2X4HA 2COMA 4ZH4F 5DCFA 1XN7A 2GZWA 3MEXA 2VBWA 4L9TA 3GFIA 4EGZA 3VOEA 4IRHA 4A6DA 5CVIA 2Z33A 1SFXA 4A2UA 3NEUA 2EFPA 1K78B 2XASA 3CLOA 4GYIA 2W84A 2EFQA 3C18A 5D5VB 2VONA 5E8IA 1WKMA 2MC3A 1YYVA 1RUOA 4IF4A 1YW9A 4AIJA 3ZMVA 1Q1HA 4MTDA 2IPQX 3RKWA 2ZO4A 1USSA 2DK5A 2NYXA 4U7DA 3I4PA 3P9CA 2JZYA 4L5JA 2DPDA 1ZREA 4WXCA 1R58A 1LEAA 2Q0OA 3KP6A 2G9WA 4ENKA 3R6SA 1L0OC 1ULYA 3MZHA 1KQ0A 1T98A 4G7ZF 3RPUA 3FHZA 3FMSA 1QQIA 3WTYC 1T0FA 3JTHA 2PQ8A 2Z99A 2KIMA 2XIGA 2CFXA 2EV5A 1G3WA 3GXOA 1MGTA 1YW8A 4YG2F 3TQNA 1UHWA 2QQ9A 3IKVA 1TLHB 3QU6A 5J6XA 1RNLA 2XKPA 1JXSA 2O03A 1O3RA 5A2QZ 2IJLA 2BV6A 5TJJA 4L9NA 4HV6A 1DDNA 5CVJA 1OYYA 5ILSA 3WE3A 3LSTA 2FOKA 2DU9A 1V4RA 1XSVA 1XCBA 3W6KB 2LSOA 3MCZA 2XRNA 4UVCA 2ZBKA 1O3QA 5E17F 2ESNA 5HOOA 3K1NA 3GF2A 4UV9A 2O0YA 2AXLA 2ZNYA 3BROA 2ACJA 4EJUA 3WTZA 1ZN2A 1QBJA 3MZYA 3HSEA 4GXOA 3KLNA 3BP8A 2JPCA 1U5TC 4EGYA 1BBYA 3HSRA 1R36A 4B09A 4M71A 2EA4A 4WXDA 3WGGA 2ISYA 2K27A 1ZYRF 3I54A 2H09A 3EUHA 1U8RA 2A3SA 4OU0A 2VBXA 5H20A 3TOBA 2DLLA 3I64A 4CYDA 1YIOA 4G8XA 3KFWX 5HLIA 3QP5A 1J59A 2MH9A 3TO7A 2OBPA 2E7XA 3SZTA 2DAOA 1DUXC 1KU9A 3HOSA 5HS8A 2L01A 1IN5A 2DO7A 4LB6B 4M6YA 4FX4A 3BJAA 4HW0A 3FMRA 1ZH5A 2A68F 1KU2A 2FBIA 3H92A 3RI4A 2CSOA 4KUMA 4RGXA 3O2PE 3FXUA 1S29A 1R00A 4ZYDA 2Y0MA 1QGPA 1D8KA 1T6SA 2RGVA 1FPQA 1KQ9A 4OMYA 3J81K 1ZRDA 2UXXA 2Q2EA 4I7HA 5CYVA 3BPXA 1UFMA 5F1RA 1UHMA 3KP7A 4AIHA 4CO8A 2DTRA 5H6QA 3WGIA 3HHHA 2H6CA 2DPUA 4YIFA 3F72A 2P7CB 1DPUA 1ZRFA 3F8BA 2AS5F 1E2XA 4L0YB 2RC4A 4HQEA 2JTVA 2MLGA 2CO5A 1G6NA 1XDSA 2HFHA 3TDZC 1Z1DA 3CTAA 4U88A 3IC7A 5K1YA 3N97A 3HSFA 1SD5A 2XVCA 4GCVA 3QP6A 1LDJA 1F5TA 4LMYA 4HV5A 4EM2A 4BAYA 3HUGA 5L3EA 4S04A 2L4MA 5HDKA 2FU4A 1W7PA 2EA2A 4UUVA 3K69A 4MEXF 5BS6A 3W6JB 1BM9A 3DEUA 2F5CA 3NQOA 2FNAA 4U0WA 5D8LB 1DPRA 4BXUA 1D3YA 3WG9A 1E17A 4FX0A 3M8FA 6PAXA 1YLFA 3V8KA 3WODF 2GWRA 1WI9A 1S8NA 1F9NA 1TNTA 2IA1A 4RB3C 5AIPA 2ELHA 1D5VA 2IP2A 5LGTA 1IZ1A 1IN6A 3D5LA 1I6XA 1XSDA 3HRTA 4HDVA 4XBFA 4A5MA 1TBXA 4KT5C 2L3DA 4EQQA 3GZ6A 4CDGA 1UB9A 4L9VA 5L3DA 4ENJA 1FOKA 3F8NA 1W5TA 2V1DA 4R1HA 4N9IA 3DKWA 1NHAA 3JAMK 3KP3A 4EJTA 3LAPA 4IHTA 5IT3A 1R22A 3CUOA 1OKRA 3CUQB 5D8KB 3QAHA 4BHBA 2O8XA 4LLGF 4MEYF 4WK8F 3G3ZA 3F8CA 4WF2A 2IA0A 2K4BA 2ZMEA 5HVQC 3B02A 1A04A 1BI3A 4E70A 1P4WA 2NNNA 3KE2A 3HTUA 3ZN0A 2RN7A 3K9TA 1EH8A 2VOOA 4OIOF 2XAQA 3CO7C 2HQRA 1IXSB 1HSJA 1GXQA 4RAYA 1HQCA 4FHTA 2MBFA 1FBSA 2Q8KA 2GIVA 4UV8A 2BGCA 3FX3A 4HQMA 2XAGA 1D8JA 1ZLJA 3P9IA 1TNSA 3ECHA 4ESFA 2V79A 4ESJA 4EMSA 4EJVA 2A6HF 5E1WA 1MDMA 1FZPB 3WTSC 2WV0A 4BHPA 2QYOA 4HF1A 4I0AA 2VXZA 2CG4A 4O3MA 1H0MA 4HF0A 4RAZA 2HGCA 2JRTA 2FE3A 2F5DA 3BY6A 3ECOA 3D0SA 2K7LA 2F5EA 3ZN1A 3GFJA 2RKHA 5JVTA 2FMLA 3T0YA 1QO0D 4CICA 3LA2A 2P8TA 3IL2A 2OU2A 3I59A 5L3BA 2D1VA 4IHSA 5DCMB 4G7HF 1KGSA 1KU7A 4MTEA 5ICEA 3KP2A 3M9AA 3BJOA 3E6CC 1LDKB 3SZPA 2OZ6A 4EVIA 4XRFA 3R61A 1B9MA 2LKPA 4HBLA 4WX9A 5LRRA 3K1MA 4HX4A 1SFUA 2LDUA
chains in the Genus database with same CATH superfamily
4KMFA 4BNCA 2E5NA 4Z6YA 3KZYA 3OYHA 4QLCU 5F64A 2Y30A 3MVPA 3OIPA 1T2KA 4RM3A 4XICA 4M72A 5CVRA 1W0TA 1G3TA 3CO6C 2AQFA 3ZOBA 5C3EJ 1IAWA 1XMAA 2WY7Q 3PQKA 2RDPA 3FM3A 2Y2ZA 3U9GA 2FJ1A 1XTAA 4I02A 4B3XA 4IRIA 3F3XA 1D5YA 1SMYF 1U9OA 2MA3A 1QPMA 2LKXA 3FK6A 1GV2A 4DYRA 1T0FC 1B9NA 3GTLJ 3QQAA 2DQLA 4XOTA 3WGHA 3FISA 2X0LA 1K78A 3BTCA 2JUGA 1UCRA 2HQAA 4UB6C 2EZLA 1IC8A 1SD6A 2EQRA 3J81Z 2VT3A 3IKTA 2E5ZA 2NAZA 2KIFA 3BOQA 2L5QA 1JTXA 3TO9A 2DQRA 2VIXA 2BE5F 1MW7A 2M4GA 5LD2C 3ERED 1P4XA 3CMYA 2AHQA 4X6AJ 1UELB 2DA6A 3ZMZA 3SYTA 1ZTRA 3DPUA 1XX5A 4P5OA 3CC4I 2VKEA 2IVMA 3K4CA 1FNNA 1R5GA 3Q9SA 1J75A 3WG7H 3G6EI 2PI0A 2KRHA 5GAGJ 4MLOA 4A3JJ 3E5UA 5FD6A 3PSIA 2DW4A 4YIRX 2OZUA 4NDLA 1LB2A 5K5OA 2FNPA 4IOAF 3FKJA 4JQFA 4KN7X 4PJ0C 3ISPA 1J7KA 2IGKA 1Z3XA 1AKHA 3CCEI 5IT9R 1XSXA 5DYMA 1FSHA 4NNJA 1MKMA 2YU3A 1AKHB 1ON2A 1ZELA 4NQWA 4RS8A 4KIGA 2O9LA 1MIJA 3LFKA 5ED4A 1H8AC 1Z6RA 2F2EA 3E1SA 4M6XA 2IGMA 4A0ZA 1IGNA 1WI3A 4NQWB 3ABLH 1T95A 2J5OA 3ZPLA 2FSWA 1YHQI 3K0LA 5CPRB 1J5YA 1R9TJ 5IT9Z 4BQNA 4E7JA 4G7OF 2LBFB 1BI0A 3K1PA 1OCZH 3RYRA 3VYSB 3ZMTA 4NC7A 3S1MJ 4E7KA 3SFIA 1X19A 1DQUA 2QQBA 4NBQA 4PJJA 3S2WA 3F21A 4Y15A 4LK0F 4CZZA 1YQAA 2IT0A 2L02A 2W24A 4OAZA 4B1RA 3A52A 4M3DA 4DQ2A 3HIFA 5A2QR 3I5UA 4MHGA 5BQTA 5EG0B 3H35A 2ID6A 4A0XA 3OYDA 2MW8A 2XKOA 2CFOA 2QUFA 1WJCA 3RSNA 5FKKA 2EK5A 2ADUA 1WWXA 2HVQA 3EUHC 1ONVA 1IXCA 3RIRA 2BYVE 3S17J 3RQ4A 2NNYA 3ML6A 2PX9A 2EJRA 2MFZA 1MH3A 1EJ9A 2PMUA 4DW6A 4XLPF 4HLYA 3FF5A 2HOAA 3VB2A 2EFOA 2OTJI 3LFUA 2V1XA 1YO5C 2RQPA 2KDOA 4BL0B 5LEJA 2D45A 1W36C 3CD6I 3U2RA 2MLKA 2WY8Q 1WZ2A 1PDNC 4EM0B 2CMPA 5HNHA 2MH2A 1T38A 3CP2A 5EZGA 2BEOA 1UAAA 3T1BA 1IF1A 2YR2A 3F8MA 1X2NA 3ZQCA 2XDVA 3QRFF 1ZRCA 4A6EA 4B47A 2K9SA 3F22A 1XD7A 1HDPA 1IV8A 1IRFA 1H9TA 2V26A 5LHHA 4OIRF 5LFAA 2O8KA 4OIQF 3JRBA 3HOUJ 3G1LA 1SEUA 4KFCA 1Z05A 4XLCA 4F93B 3BR2A 4RAFA 1IUFA 3DXJF 3NRVA 4BACA 1R1UA 2B0LA 3BCAA 2Z3YA 4RB1A 5GTHC 1JGSA 1HXDA 4TV7A 1YTYA 2K9NA 2CH0A 1RZ4A 5JHUA 3ERMA 1AOYA 2EV0A 3HGYA 3HPHA 5AIQA 5L3FA 4BQAA 4L18B 1Z7LA 2Y75A 3OS1A 2BBYA 4Q4ZF 5J1RA 4YELA 1WPKA 4OINF 4LOCA 1GUUA 1X3UA 4CH7A 4EJOA 2EPFA 2W82A 5JFRA 1PUFA 3E7LA 3HGGA 1Y8QB 1R4NB 3H1CA 1PUFB 4RAGA 4I0BA 3ROUA 3G73A 3JAMZ 4ZDOA 1LPQA 4H0EA 1Z91A 2VOPA 2M8EA 4ZYAA 2BXZA 4ZYEA 1EH6A 5HDNA 4XQFA 3HKZN 4HNVA 5BOXA 1WVRA 3CDHA 2LOOA 2MGQA 4G12A 2JPBA 3Q0UA 4MQVA 3LSHA 4G94A 2GXBA 5M3FJ 3MN2A 3AG2H 4IPAA 2LREA 3QPHA 1R49A 3K2ZA 3QPTA 2ELJA 5F08A 3BG5A 3E6MA 1D1CA 3OYIA 2K9QA 2CV2A 1JHHA 1Z6TA 3DBRB 3MKLA 5M5XJ 5FLXK 2HTJA 1LDDA 2K86A 3ABUA 3H36A 2BZTA 4NC8A 1J9IA 1EKEA 2ZSHB 2KRCA 3HPGA 3MMYB 3CESA 3FXMA 5M5YJ 2VPLA 2X9DA 4HYEA 1PYVA 1REPC 1BOAA 4DGWB 1Y0NA 1BI1A 1BC8C 4AIDA 3VYTB 1LNWA 2XAUA 2UV1A 3HKZA 2OQGA 4XLAA 4BS9A 4KN4X 2PLYA 1YS7A 2LFBA 1I3QJ 3PUBA 4BYYA 3BC8A 3I53A 1F1ZA 5F04A 3PNYA 4XRSG 2L54A 1S6LA 3W2WA 4A3FJ 4U87A 3ZMDA 1J0RA 1LKXA 1ZGAA 1MZBA 4A5NA 3CCSI 2QBYA 3GTJJ 2Y48A 1MMAA 5ICCA 3H0GJ 1FYLA 4CA0A 1HKSA 3LA3A 5DEQA 3ZP5A 2QBYB 1JKPC 4ZZLA 2L9NA 3P5JA 5CKTA 2HWVA 1BW6A 2IW5A 1JE8A 1OYIA 3RCOA 4RGUA 4ZTJA 5BPDA 1IUYA 2YSRA 1SD4A 2RAEA 2VQHA 1VQ6I 1MMSA 3PNTA 4F92B 4J01A 3FXRA 2CV1A 2LD5A 3PO3J 5KVRA 2F5FA 1ON1A 3F8FA 3OYBA 2EINH 1H88C 3BWGA 4KMUX 2DA1A 2HXOA 3HHGA 3FWEA 4LG3A 4IRGA 3LAJA 3SQNA 1Q1VA 2QKMB 2XV4S 3CQZJ 5KK1A 4ENMA 2AQEA 4RGSA 2V4JC 3VDXA 1WRJA 2DXIA 2OA4A 4AD9A 1V5EA 4ETSA 2P5LC 5IP6A 2CUFA 1W4MA 3ABTA 4EM1A 2DTZA 1JKRC 1VQ9I 4YFXF 4BH9A 2P5KA 1XS9A 4JX5A 1SVMA 5E3OA 3OSFA 1P9QC 2LNBA 2STTA 2HOEA 3MWMA 4O5VA 3OL4A 2E2HJ 3RZDJ 5F27A 3PIPF 2KQRA 3BZ6A 3KEOA 4F91B 1HW1A 4Y33A 3RQIA 2DA3A 3A01A 1GXPA 3KLOA 4V2FA 2KL4A 3C3WA 2N8GA 2HDDA 3OYMA 5HS9A 2YX7A 3SXYA 3GX4X 1BC7C 1U9NA 2H1KA 1O7FA 2EILH 3OIQA 2ZJRF 5J8CA 3JRIA 1U6GA 1Z3YA 5FGMA 3GTPJ 2JJ7A 1GVJA 2NOJB 4KYWA 1FOYA 1MJ9A 1T8IA 2HYFA 5DUKA 2VBYA 2R7WA 4UNOA 1FBQA 4OIPF 5K7HA 4XKCA 2HKXA 2XPVA 2W1OA 2VE8A 2ELKA 2DFIA 1YFHA 3K4KA 5GP9A 1JT6A 1JHFA 3BR3A 4A93J 3DV8A 3E5QA 1OCTC 3ZQIA 2HPMA 3ZQQA 1YG2A 2ZMEC 3O3KA 3DFGA 2V6EA 4CCOA 2H94A 2Z2SB 3CJRB 1FOWA 4GGGA 3FXKA 1S3JA 1W1WE 5HLHA 2DCEA 4W1UA 3GTKJ 2OQRA 4MFDA 5DD4A 3BG3A 2NS8A 1WJFA 4PK4A 5BMZA 2DMNA 1MBJA 2E1NA 3L00A 3WU1B 2PMHA 3AAFA 1C0WA 5LEKA 2EB7A 2WTEA 1IJWC 3OYCA 3ZGKA 2D2WA 3W3CA 3I71A 1MMDA 2PN6A 2R3SA 3E6DA 1AA7A 2DA5A 3L2WA 1CQTA 1R71A 2IRFG 3ABMH 4MIMA 1OQYA 2VE9A 1UG2A 4GFBA 2HPIA 4HX8A 2B63J 1IN7A 3QODA 1L3LA 4BHCA 3DF8A 2M4KA 2DT5A 3R60A 2V1UA 1EH7A 5ICFA 4XONA 3V7RA 1X3ZB 4HZFA 4BUPA 1HBXG 3FXOA 1RKWA 2OUMA 1HA8A 4O6JA 2JA5J 2NS0A 3GEZA 3P9KA 5LGNA 3J80K 2MD5A 2E1MB 2QEXI 1WSUA 3V8JA 1MBEA 4R8HA 2NVXJ 3ONQA 2CW8A 1BIBA 2BOLA 2DK8A 4BGDA 2R7OA 3CUQA 5TGTA 5F0FA 5D4SA 1IN4A 5FKOA 2KZGA 4B43A 1ZG1A 4HDUA 2NVQJ 4HF2A 1KA8A 4KA4A 1N75A 3DEWA 1O4XA 3MAJA 5FO5A 2R7ZJ 4ZTFA 2ZXJA 3AG3H 3LMMA 9ANTA 3JSOA 2A05A 2VASA 1MH4A 2CUEA 2W57A 1EV7A 3KCCA 3M1EA 4IXAA 4CGZA 3HYIA 2MYSA 3HRSA 3NWTA 2F4MB 1Z0XA 3V7CA 3M4OJ 2IS4A 3MQ0A 3JW4A 2QENA 4LFUA 3HDDA 3V42A 5FRMA 3V4GA 2W85A 3G1OA 1LEBA 4OMZA 3H3ZA 3HOTA 1YJNI 3NAUA 4PDKA 1MBGA 3HOYJ 5KNLA 5JR3A 4U7BA 2UXNA 4AVZA 4HOBA 4C2TA 2ZCWA 1FJLA 2FBHA 4FISA 1JJ8C 1OR7A 2V6CA 1V54H 1X3WB 3CJQB 4OOIA 4DBRA 2ZJ2A 2MVTA 3K4NA 2K85A 5EZHA 4WWCA 2P81A 3IWZA 4M9ZA 5J8FA 1ZAOA 1K61A 1TC3C 2H27A 1T33A 3OSGA 2QZ8A 1DGRM 3K4JA 5E1ZB 2RV8A 1CF7A 3IRRA 2VODA 1QU3A 4M74A 3E3VA 1FP1D 1ETXA 3ULQB 1G3YA 3Q5FA 3FXQA 1CF7B 3T8TA 1KYZA 1ZHFA 3A1YA 4XN3A 2HZDA 1Y0UA 2L7FP 4PGHA 4ZZDA 3H9GA 3V8LA 2P6SA 1T39A 3UKGA 2VN2A 1WHUA 2V9PA 2ZC2A 1VQNI 1OLTA 3S14J 5FD5A 1BL0A 4KDPA 1HW2A 3BLYA 3GLXA 2R5ZA 3KYLA 1OCOH 2XPWA 3OY9A 1B59A 2JA6J 2R5ZB 2CWEA 1JGGA 3REOA 5DCMA 4HX7A 2PBIA 1ZG3A 1QHGA 4Q5SF 2OD5A 3FM5A 4QTRA 2BY3A 3FIWA 3JTGA 1I1SA 4XL9A 4C9YA 4A69C 2HR3A 2X98A 1KU3A 4D0PA 3AFHA 3JRDA 4J00A 1BJAA 4E4HA 1T56A 4IVNA 4XLEA 2XF7A 5LLQA 2BHZA 3RKXA 4X0GA 1IN8A 1FYMA 1WQ2A 3ZCOA 3W2AA 5E1XA 3BTLA 4UY8I 4CCJA 4BKXA 4A3IJ 2FMYA 3B6CA 2E2JJ 4PGGA 4F7ZA 1XDUA 1XG1A 2LK2A 1LJ9A 2JSCA 1V3FA 4OAYA 3OIOA 2HTSA 4UHTA 2QSGX 5HDGA 2EFWA 1D0YA 5FLXZ 3SZGA 3BZKA 5EGOB 2NRAC 3WHCA 4UVBA 3G71I 2EIJH 5M3MJ 3HOVJ 2BY1A 1ZGJA 3DPTA 1W5CC 1W5SA 3GLLA 4ZYGA 5E8GA 4MQ9F 1O3TA 2DA2A 2EZIA 1I1GA 2A5YB 5TRDA 2R4GA 4AM3A 2AO9A 3J81R 2LKSA 1KONA 2MC4A 2VQLA 4JOMA 2VI6A 2M0CA 2WAFA 1FWZA 2XGCA 2KJBA 4ENNA 3RPQA 4Y17A 2CQ7A 2A07F 5J47A 2TRTA 2IA2A 4HAMA 1VTNC 1XGMA 5LHIA 4KISA 3DP7A 4AYBN 1I39A 2KIQA 2ZFWA 4QIWN 1U78A 1A35A 2BY2A 5J4VA 1B72A 2A69F 1R5ID 3HC7A 3D1NI 3VFZA 2GOMA 1B72B 4XM3A 3AKZA 2CQKA 1Y1VJ 2LTPA 3K70C 1BOBA 3OV8A 4CHUA 4LGWA 3OL3A 2LY9A 4RBOA 2VBZA 4LB5A 3IRQA 1K6OA 1PP8F 2L7KA 4JP0A 2HOSA 4UUTA 1WGXA 2O5RA 4P9UA 1TW2A 3S3MA 3IWFA 3CCMI 3TEDA 3I0TA 3H0DA 1P92A 1Z67A 1FMVA 2STWA 3KP4A 4IHXA 1BIAA 5F0CA 3VPRA 2WB1N 3HBLA 4RDUA 5ERIA 1XCVA 4BJ5C 1H89C 4XSXF 2R7TA 2PJPA 3QYBA 2QQ8A 3F23A 2IS2A 3VSLA 1B8IB 3FMQA 3PFIA 3WU2C 4LJZF 4XLFA 3T8RA 1ETQA 3JRAA 2PJRA 2LBFA 2E7WA 5K5RA 3CCQI 3KZZA 2XC7A 3X2QH 1HC8A 3DEEA 5C4XJ 2DOFA 2PJRB 2GAUA 1RQ6A 2GIZA 1JT0A 4ZJZA 1WJ5A 4F55A 2HKOA 1OMIA 2G7UA 1LFUP 2EH3A 3VEPA 4EV0A 5ICGA 2GM4A 2HQNA 2OCEA 3F6VA 5GPAA 5EG0A 3LOCA 5FFXA 3TW6A 3AG4H 3RPUD 2R0QC 1RR8C 1LE8B 3GW2A 3OYGA 1P4AA 2VJ4A 1QNTA 3M1CA 4FT8A 3SHFA 3L2VA 1ZQ3P 3O8HA 5FLMJ 4GO1A 2IBDA 2CRGA 3ZQ7A 4L5IA 3S2HJ 1TQMA 3UR3C 2XAJA 2D1HA 2VT2A 2JRMA 1VZ0A 4M6VA 3JRHA 5DTDA 2O61A 4MFEA 1ZLKA 2Z9OA 2KIUA 2LC2A 2R7SA 3IUOA 2KLOA 4D9JA 2VC0A 2H6BA 3KETA 1IG7A 1I27A 3TOAA 5D4RA 2YX4A 5DV5A 1MD0A 4WXHA 2HNHA 5EEHA 2KKOA 2JWTA 2JT1A 1FYKA 2OTLI 3J7AO 3RDIA 1Z77A 2WAEA 2FD5A 2GLOA 5KCMA 3K4LA 1PP7U 1JI8A 3BDDA 3HG9A 2BVLA 2WC2A 2Z16A 4PJLA 5EEAA 1MBKA 5CVUA 3F0CA 1VFCA 4A3GJ 3LSPA 4XN0A 2ZNZA 4N0BA 2HVRA 2DBBA 4BDYA 1SFEA 4L0ZB 2KFDA 3G1MA 3IH4A 5H2FC 3PL8A 2MABA 2QA4I 3J7ZI 4E7LA 4FASD 1ODDA 2E35A 1JJ6C 4BDZA 4OWRB 4P55A 2NVYJ 4BE0A 5J1UA 3OOPA 4JK1X 3HTSB 2DT7B 4PCQA 3GFMA 3ZMUA 1AWCA 3O6BB 4Z2YA 4M3BA 3CCYA 1QPIA 1MSFC 3JAMR 2M7BA 2M3AA 4V19K 2HYJA 1TQIA 2IXSA 3WU0A 3GFLA 5E3LA 1MNMC 4IHYA 1DP3A 1FBUA 4KIFA 2CW7A 5ILUA 3H3UA 2L0KA 2DDBA 2QM3A 1FIPA 5D5XB 2NVTJ 2BXYA 2P7VB 3J80Z 3A4CA 1HKQA 3U1KA 1WJBA 4IJAA 3LSRA 2C6YA 4KIBA 5AONA 1E3HA 1NK3P 4AWXB 1JUSA 1K79A 2RNGA 2PG4A 3VODA 2DYRH 5ILVA 3CJTB 1E3PA 2R7UA 4RM2A 2J5PA 3SDBA 2GQQA 1X1AA 1BR2A 3BCBA 4FETA 2YU9J 4PZJA 3GUDA 4UB8C 3WE2A 2M5WA 1R23A 3L2RA 2FEZA 4XR6A 3CCVI 1G4DA 4DJAA 2WAQN 1QHHD 4IEJA 5D6EA 3L2CA 1Z7UA 3E97A 4YFKF 4RMNA 4D1QA 1USTA 4B3AA 4IX7A 2XUBA 1KYWA 4N9HA 3RTRA 1W36D 1YI2I 1G3SA 4QWQA 3TW7A 2FRHA 3FXJA 4LG0A 1R1VA 3R0JA 3R4KA 1ZK8A 2Y0SN 3CC2I 1MJAA 4LG0B 4QPOA 1X58A 2CUZA 3WTUC 3N4MA 5J4YA 1XGOA 1FT9A 3RZOJ 4UVAA 1BR4A 4I2OA 4ON0A 1BI2A 1FY7A 3MFKA 2V9KA 1V55H 1TWGJ 3KYDB 3GZ5A 2L7MP 4QSHA 3QPSA 4UUSA 3TP0A 2ZXIA 4A12A 4HPQA 1BR1A 4AUXA 1QVUA 3HZJA 4LLLA 3DLAA 4UUSB 3M8JA 2P0WA 4JBAA 1I5ZA 3EQLF 4CXFA 1GDTA 3PO2J 3S16J 2CYYA 4I98B 2HDCA 3WTVC 2IAIA 3DQVC 3PIOF 4G9YA 4U0VA 2WAQA 3TBIA 3E6BA 1QVTA 2PFBA 1FP2A 2DI3A 2CV0A 1FX7A 1MSEC 3IHUA 5EEGA 2WADA 3DLLF 1P2FA 5B3SH 4XRSA 3BPVA 2GA2A 2DMTA 3TP3A 2M45A 2PEXA 4ASNA 4ZDPA 1U5TA 3LQQA 4ESBA 3GBGA 2KJCA 1FEXA 3ZQFA 1RI7A 1U5TB 5K7ZA 2Y0SA 2COBA 4S0HB 2XROA 2DMPA 4B8XA 1STZA 2M0MA 2XHKA 4M3EA 3V7SA 2A61A 5JVGF 1XB4A 3SFZA 2XB0X 2ME0A 3KP5A 4LK1F 2IS6A 2VPRA 3B73A 2FF4A 3RYPA 1U2WA 4A3CJ 1XC5A 4PSXA 1VQ4I 5K5QA 2NOGA 3FK7A 1LQ1A 3KIOA 5H6RA 1HKTA 2ZJPF 4BY1J 1D1AA 2GOXB 2KRFA 3L09A 2O6GE 5D5UB 1DU6A 3TDUC 4DBQA 1JUPA 3G4SI 4XOPA 1ZARA 2HXIA 1K7AA 1XGNA 1IO2A 5FKNA 1DU0A 2ECCA 2A6TA 2CU7A 3MKZA 3C7JA 2WWYA 3U1DA 2GBYA 1U3EM 4KNYA 2NXNB 4NUBA 4RGRA 2XAHA 4M9SA 3H3VK 1EF4A 4J19A 3TGNA 3R0AA 1A36A 4C3JJ 2LF7A 1LVAA 4IQ4A 1X4OA 1UHSA 2EFNA 1F43A 2E34A 5FB2A 3DTIA 3ZQLA 1ETOA 2D5VA 4EATA 1K4SA 1N77A 3AL0C 1GHCA 4KITB 3PFYA 4JYKA 3JRCA 4MO7A 2FXAA 3QOPA 3ZQGA 3EYIA 2K3FA 4ANJA 1NG7A 4MNUA 4DYCA 4ZDLA 5CVVA 4HSRA 5IT9K 1A6QA 2X48A 2YPRA 3BG6A 1CGPA 1POGA 4WCGA 4EJWA 5LBQA 3CCUI 2E36A 1GT0C 1FC3A 1MJBA 3WTXC 2QQAA 3DPLC 3CJNA 4RB0A 1U0JA 3LSIA 3BZCA 4CZCA 3S3NA 2X6WA 1GV5A 3HUGB 1W7PD 1R4MB 4ZYHA 5IPAA 4U0YA 5HLTA 3CUQC 2EV6A 1LUJB 2R92J 1ETYA 1NG6A 3M7GA 4Y7NJ 1B6AA 1S7OA 3GVAA 2CGPA 1W7PB 2VC1A 5DD8A 2CW0F 4P9FA 4B44A 3I4MJ 3L7WA 3IH2A 4DNCA 4M9XA 2CJJA 3CDIA 5A2QK 1IW7F 1WJEA 4DYQA 2HYGD 4FE4A 4C3IJ 2OJED 2OAZA 1O7LA 2M1BA 1K6YA 5DUIA 2VL8A 4DZPA 1YS6A 2QWWA 4PFPA 4BEHA 1WH5A 3OYEA 4AIKA 2HEOA 3KEYA 2OC6A 4HA8A 2HZTA 5BPIA 1H9GA 2GXGA 4BEHB 4RLQA 3WTTC 3TMOA 1UMQA 1OPCA 1J2XA 3SDGA 5IYBJ 3RKYA 5CQEA 1HW5A 3CCLI 3LQRA 2XSDC 4P96A 4A3MJ 4NB5A 1RUNA 5HLGA 1R1TA 3KX2A 1I6HJ 5JLWA 2L9VA 5E18F 2HS5A 5CQGA 2QSHX 1F4KA 3ZXSA 3COAC 1XMKA 2P5VA 2XF5A 5L3CA 3OOUA 1OR7C 4K2EA 4YIIA 4CCNA 2F4OB 4Q48A 4I09A 5CJ9A 5B1BH 2RVCA 2Y9YA 5DDGA 2L2OA 2FQ4A 5DS9A 1YE9A 3HRUA 3QPLA 2MUNA 3ZR8X 1OFCX 2FA5A 5FFZA 2Z1DA 1WJDA 2JN6A 3BG7A 3JCUC 1MMNA 2DFEA 2R7FA 3QWLA 2ETHA 3GYHX 4LLNA 2O3FA 1PUEE 2CS3A 2VQGA 1AU7A 2ZKZA 2M30A 4RLFA 2NS7A 5L3GA 4I01A 3KZIC 1IRGA 3A0BC 3FZVA 2EIMH 3M3YJ 3ELKA 4GYGA 2XGDA 3RJPA 1YW7A 4RB2C 3A2KA 1QZZA 1P6RA 4M73A 1ETVA 2ZXHA 2OF7A 4XSZF 5LRSA 2CQNA 3TKYA 4A0YA 3LWFA 3KEQA 3M8EA 1QRYA 1TTYA 2X6YA 2RNJA 2W7NA 4AVPA 4Y3OA 5LHGA 2V7FA 3JRFA 4L9JA 2GA1A 3HRMA 4HNUA 1F36A 1ORKA 3BJ6A 1SD7A 4Q47A 3PQJA 3OYNA 4E7IA 5EDNA 2E1CA 1VQ8I 1ZG5A 3A0HC 3EETA 2ECBA 3QU3A 4UXNA 3OYFA 2PMZN 3DU5A 4S05A 3JSPA 3WTWC 4F3QA 2YUSA 2IGNA 1TL8A 2ISZA 2FBKA 1IXRC 1O57A 2XAFA 3OR2C 1LFBA 1QZYA 2R7DA 3H5AA 2ZMEB 4LD5A 4A3EJ 2ESHA 3N05A 1Z21A 3S32A 2EIKH 2JA2A 5E20A 4NHJA 1VNDA 2P6TA 2I10A 4DZJA 4HLXA 3ZRGA 1AHDP 3U21A 1D1BA 2R7QA 2A6EF 1OCRH 2G0EA 3I56I 3L9FA 1Z9CA 4BJTA 4QPQA 5EYRA 1DP7P 2VQCA 1RESA 4Y13A 5JLXA 2K4JA 3C1DA 2R7RA 3GO5A 2Z5UA 3HOWJ 2LP0A 3E5XA 1MMGA 1TW3A 3AG1H 5C4JJ 2E1OA 5EF6A 5D5WB 1SFKA 2V9VA 4D7MA 3Q9VA 1OYWA 2TDXA 2YS9A 2PMZA 5GADJ 4FQGA 2DYSH 2E2IJ 2XGXA 5FLVA 1IV6A 3L2UA 4BXXJ 1ITYA 2P4WA 3PUFA 4R79A 1TZLA 3ZQHA 4Y4RA 1TWCJ 1TQPA 5IP7J 5LGUA 1MDMB 4IKFA 2EWNA 4G6QA 5HNFA 1ZR4A 4G6DA 3S1QJ 3LA7A 1SAXA 3RKQA 3P7NA 4DIQA 4A3LJ 2FQ3A 5F6FA 1TWAJ 4I6ZA 2UZKA 1R5HA 3FHNA 5CLSA 4PUSA 3GTOJ 5HS7A 2R7VA 1ERDA 2L4AA 4E7HA 3GWZA 1VI0A 5D6FA 2DJNA 1TP4A 3EYYA 4N4OB 1SMTA 1VQ5I 2M87A 2B7EA 2QLZA 2K02A 3ESWB 3T5XA 1FSEA 3TO6A 2MZ4A 1NK2P 3DTKA 4EEFG 1B4AA 5FLXR 1P7JA 4N4NB 1S7AA 3BR0A 5F1JA 3F6OA 4KICA 1MNEA 2L7ZA 5IP9J 2F4IA 2M34A 3I59B 1B1BA 1RIOH 1JTYA 4MGRA 5JI6A 2R93J 1BN5A 5EGOA 2CQQA 1HSTA 1O3SA 3I58A 1LFPA 3J7AY 1R7JA 2G7HA 3I55I 1S7EA 3EDPA 4C30A 3OS0A 3ZMSA 2LR8A 2LF8A 1SANA 2W25A 4YFNF 2MG4A 1KQ8A 1ZKGA 3SEQA 1FLIA 1XGSA 4XLNF 1IDYA 3PM1A 2HI3A 3GZNB 2UWMA 4CYCB 2QVOA 2KZVA 1A5JA 2X4HA 2COMA 3K4MA 1Y8RB 1VQOI 1OISA 3S93A 4ZH4F 1X1CA 5DCFA 1D0XA 3H5RA 3VYUB 1ETWA 1XN7A 2P0TA 4BQOA 2GZWA 4XRMA 3MEXA 2H8WA 2VBWA 5K7FA 3S1RJ 4L9TA 4B4CA 2DFFA 3GFIA 3L1PA 4EGZA 3VOEA 2CQXA 5B66C 4IRHA 3CMEI 4A6DA 2FX0A 3S3OA 2DA4A 2KP6A 3D5SC 5CVIA 4X1EA 2W4SA 5GAHJ 2Y69H 2Z33A 5EJCA 3EPZA 1SFXA 4A3BJ 4A2UA 3NEUA 2EFPA 1K78B 2XASA 3OYAA 2JMWA 3C2BA 1VF9A 1RR7A 3EUAA 3CLOA 3DWLE 4GYIA 1VQKI 2F5VA 4XLHA 2KISA 2W84A 4D5FA 3CC7I 2E71A 4E6KG 2EFQA 3C18A 3C2HA 1B8IA 3DKXA 5D5VB 4XIDA 1G2HA 2VONA 5E8IA 3OYKA 1WKMA 4AYBA 2W48A 4KJZA 2MC3A 1YYVA 1RUOA 1GVDA 3OS2A 3ABKH 3LSJA 1SVOA 1FIAA 4IF4A 1YW9A 2V1NA 3OYLA 3HXLA 4AIJA 3ZMVA 1Q1HA 4MTDA 2LRDA 3BR6A 2IPQX 3RKWA 2ZO4A 1YIJI 2QKLB 4BBSJ 1USSA 2DK5A 2NYXA 4U7DA 3I4PA 4BU2A 4KT6A 3P9CA 2JZYA 4L5JA 4IO9F 2DPDA 4BXFA 4PFOA 1ZREA 4WXCA 4PJMA 1R58A 1LEAA 2DJIA 2Q0OA 3KP6A 2G9WA 2DDAA 4Y52J 4ENKA 4PJNA 1HOMA 1LE8A 3R6SA 1L0OC 2DN0A 1ULYA 3MZHA 3H5NA 1KQ0A 1T98A 4G7ZF 2WV1A 3EUKL 4BQQA 4D5CA 1EA3A 3RPUA 1PJRA 2WB1A 2JUCA 3FHZA 3FMSA 1QQIA 3WTYC 4FTHA 1T0FA 3JTHA 2IS1A 3FBNB 2ZXWH 2PQ8A 2Z99A 1QA6A 1VQ7I 3VYRB 2KIMA 3KYCB 5KHDA 2XIGA 3O8GA 2CFXA 2EV5A 1G3WA 3GXOA 3FXLA 1MGTA 1YW8A 4F52A 3K70D 4YG2F 2E19A 3TQNA 1UHWA 2QQ9A 4RA2A 3IKVA 1TLHB 3QU6A 2I8DA 5J6XA 1R6RA 5J1YA 1RNLA 2XKPA 5FKLA 1JXSA 3HOXJ 2VB6A 2O03A 1O3RA 5A2QZ 1BW5A 2IJLA 2BV6A 2W00A 2CUJA 5TJJA 2KMUA 3MKWB 3CP8A 2MSYA 2XF6A 4L9NA 1YOVB 2QGUA 4HV6A 3OMYA 3CF2A 1DDNA 2M35A 5CVJA 2X1CA 1OYYA 5ILSA 2DODA 3WE3A 1FOXA 2LLKA 1Y6IA 1QZEA 3LSTA 2FOKA 2DU9A 2KHMA 1V4RA 1XSVA 3UNGC 3VSKA 1XCBA 3BG9A 3H9QA 4LITA 2M8GX 3W6KB 2LSOA 4A3KJ 3MCZA 2XRNA 4UVCA 2ZBKA 1O3QA 2BVMA 2LH9A 5TISC 3QYFA 4CCMA 5E17F 2ESNA 5HOOA 3K1NA 4XKWA 3DTEA 5FROA 3GF2A 3J80R 1RPWA 4UV9A 2O0YA 2AXLA 2ZNYA 3CCRI 3BROA 3MZ8A 2ACJA 3WHBA 4EJUA 3FKIJ 2X51A 3WTZA 2F48A 5IY5H 1M1EB 2VKDA 2KDZA 3MKYB 3DU6A 1TT5B 3GMEA 1ZN2A 1QBJA 3MZYA 3HSEA 4GXOA 1IRXA 3DKYA 3KLNA 3BP8A 2JPCA 1U5TC 4EGYA 4D7NA 3GTGJ 1BBYA 3HSRA 1R36A 3JREA 4B09A 3DBHB 4M71A 2EA4A 4WXDA 3WGGA 2DT6A 2HU9A 2ISYA 2K27A 2RQQA 1ZYRF 2QCOA 3I54A 5JHFA 2H09A 3EUHA 4YEJA 2A3SA 1U8RA 4A3DJ 1V5GA 4H4KC 4OU0A 2VBXA 5H20A 1I3AA 1I50J 3TOBA 2DLLA 3I64A 4CYDA 2KT0A 4IHWA 2HOTA 4AC0A 4JX6A 1YIOA 4G8XA 3KFWX 1WH7A 5E3MA 3BR5A 5HLIA 2OPTA 3QP5A 1S5LC 2MH9A 3TO7A 1J59A 2OBPA 2E7XA 3QOEA 3SZTA 2DAOA 1DUXC 3E0JB 1KU9A 3HOSA 5HS8A 1UZCA 2L01A 1IN5A 2DO7A 1X2MA 1MNDA 4LB6B 4M6YA 4FX4A 3BJAA 4XMYA 4HW0A 2UUZA 3FMRA 1ZH5A 4M3FA 2A68F 1VQMI 1KU2A 2QF7A 5IYCJ 4L5EA 4V2GA 2VJIA 2ZFUA 2FBIA 2VKHA 3H92A 3RI4A 3S1NJ 1SC7A 2CSOA 1OJLA 4KUMA 4RGXA 3VWBA 3O2PE 5F0HA 3FXUA 2K9MA 1S29A 3PNVA 4II3A 4CCLA 1R00A 4ZYDA 1TWHJ 4LIVA 3GCMA 2BY0A 4W97A 1A31A 4C3HJ 4CUGA 2MD0A 2Y0MA 2BHYA 3BTIA 1QGPA 5BNGA 1D8KA 2Q1ZB 1T6SA 1E0EA 1HLVA 5FKMA 2A5WA 2RGVA 1FPQA 1KQ9A 4OMYA 2I5UA 3CDLA 1WCMJ 3J81K 1RKTA 4XKVA 3CCJI 1ZRDA 2UXXA 4BE1A 3K10A 2B9SA 1X1PA 4BY7J 3LNQA 1E3OC 2Q2EA 2QSFX 3BTJA 4ZC3A 3J7AW 4I7HA 2L9RA 5CYVA 1APLC 3BPXA 1UFMA 5F1RA 2LYCA 4CCKA 2Q2EB 2LY2A 1UHMA 1J09A 3IP4B 2K5CA 3KP7A 2DMUA 4AIHA 4CO8A 2XB5A 4AU7A 1BJZA 2DTRA 5H6QA 2VUMJ 3WGIA 3HHHA 2H6CA 4P1WA 2DPUA 4YIFA 3F72A 2BW3A 2P7CB 1DPUA 1ZRFA 3F8BA 2AS5F 1E2XA 1VQPI 4L0YB 1FTZA 2RC4A 2BW3B 4HQEA 1YITI 2JTVA 2MLGA 2CO5A 1KZHA 1G6NA 3HM5A 1XDSA 2K9LA 2JA8J 5GTIC 2HFHA 3TDZC 1S9HA 1PVEA 1Z1DA 3PJRA 4IL6C 3CTAA 3IH3A 4U88A 3IC7A 5K1YA 3N97A 3JRGA 3HSFA 1TWFJ 4FCYA 1SD5A 2M7AA 2XVCA 2X6OA 3QP6A 4GCVA 2XPUA 1NTCA 1T08B 3ASNH 4DOZA 2Y31A 5DM7F 1XPXA 1LDJA 1F5TA 4LMYA 4HV5A 2DOEA 1MBFA 2E1MC 4BJ6C 4EM2A 4BAYA 3HUGA 1NH3A 3IAS2 5L3EA 5J40A 3K6GA 3Q3SA 4S04A 3BR1A 2L4MA 3IV5A 2X85A 3BT9A 3HB9A 3MD2A 3LL7A 5HDKA 1UJ8A 2FU4A 3F9KA 1W7PA 2EA2A 4UUVA 4HRIA 2GXAA 2O7OA 3DBLB 1YX3A 3K69A 3A01B 2DA7A 3QYEA 4XKBA 4MEXF 5BS6A 3W6JB 3H9JA 1BM9A 3DEUA 2Y9ZA 4II2A 5FJ8J 3A03A 2VLAA 2F6CA 2F5CA 2TCTA 3K7AJ 4C2MJ 2OV7A 3NQOA 2FNAA 4U0WA 5D8LB 3CMMA 1RETA 1DPRA 4BXUA 1D3YA 3WG9A 3M07A 5B5EC 2M9HA 4HG2A 1E17A 4LIUA 3HJEA 2K3PA 3M8FA 4FX0A 4XORA 6PAXA 1A6IA 5HODA 5IOZA 2R5YA 1YLFA 4YRVA 3V8KA 3WODF 2GWRA 4C2UA 1WI9A 1S8NA 3K4BA 3BQYA 2R5YB 2JK3A 1F9NA 1TNTA 3G2BA 3C2GA 1JUMA 2IA1A 4IOCF 2M2EA 1IRZA 4RB3C 5AIPA 5DM6F 2ELHA 3L2QA 1D5VA 2H8RA 2DMQA 2IP2A 1YJ9I 1IDZA 3CF5F 2XSJC 3GTMJ 1ZGWA 3CLQA 2ICWG 5LGTA 2HVSA 5GAEJ 1OCCH 2EZKA 3DCFA 1IZ1A 1IN6A 2X1EA 4XNFA 3S15J 1V5FA 2HDWA 5E3NA 3D5LA 1FMWA 1I6XA 3NWSA 5M5WJ 1XSDA 3HRTA 4HDVA 4XBFA 1ETKA 3LSKA 1N25A 4A5MA 1TBXA 1RC9A 4KT5C 2L3DA 1RRJA 4EQQA 3S8PA 3AL0B 1SVLA 2VKVA 2FUG2 3GZ6A 1LVKA 3LSMA 2EBIA 1UB9A 4CDGA 1N78A 4L9VA 4HNTA 1Y39A 3FBIB 3CMAI 3OR1C 5L3DA 3TL4X 4ENJA 1HCRA 1FOKA 3F8NA 1W5TA 4BE2A 2V1DA 4R1HA 4N9IA 4IHVA 4I76A 1X4PA 3DKWA 1NHAA 3JAMK 3KP3A 4EJTA 3LAPA 1FTTA 3A02A 3ASOH 1VQLI 5KAFC 4IHTA 2VJJA 5IT3A 5E79C 2DOAA 4IZZA 1R22A 3HOZJ 3CUOA 1OKRA 3CUQB 5D8KB 3QAHA 4BHBA 1S72I 1W0UA 5FRNA 2R7XA 1SFOJ 3LSGA 2O8XA 4LLGF 4MEYF 4WK8F 2WBMA 3G3ZA 3F8CA 1WFXA 4WF2A 2AXTC 1JKQC 2IA0A 3OYJA 2K4BA 2ZMEA 4E7ZA 5HVQC 1HDDC 4HSTA 2RREA 3KPHA 4GRIA 3B02A 3GTQJ 1A04A 1BI3A 2JQ7A 4E70A 1P4WA 2NNNA 2ME6A 2LY1A 3KE2A 3I3LA 3CZ6A 2JA7J 1X1DA 3HTUA 3ZN0A 2LVSA 2RN7A 1DGWY 3K9TA 1EH8A 4E7SA 2VOOA 4OIOF 4B48A 1K83J 2KPMA 1MBHA 2JVHA 2XAQA 3CO7C 5IOYA 2HQRA 1OCPA 4M3GA 2NVUB 2EZHA 4PSWA 2L9SA 1IXSB 1YRNA 1HSJA 1GXQA 4RAYA 1HF0A 1HQCA 4FHTA 2MBFA 4FE7A 3Q0WA 2VXDA 4IQJA 1FBSA 1YRNB 2Q8KA 3J7YJ 5C44J 3SJMA 2GIVA 4UV8A 2BGCA 3FX3A 4HQMA 2XAGA 1D8JA 1ZLJA 3P9IA 3I9V2 4XK4A 5GPCA 1TNSA 3NARA 3ECHA 4ESFA 4BBRJ 2V79A 4ESJA 2XRLA 4EMSA 1K4TA 2FOWA 1Y56A 2A6HF 1TT0A 4EJVA 5E1WA 1Y1WJ 1MDMA 4G6TB 3IAM2 3JR9A 3WTSC 1G59A 2WV0A 1FZPB 4BHPA 2QYOA 4GDFA 2JVGA 4HF1A 4I0AA 2VXZA 2CG4A 4O3MA 2LG4A 3SEZA 1H0MA 4HF0A 3PSFA 4RAZA 2HGCA 2JRTA 1XMXA 2F5DA 2FE3A 3BY6A 3ECOA 1BA5A 3D0SA 2K7LA 4NC6A 2F5EA 3ZN1A 3GFJA 3Q0VA 1JKOC 3OWTA 3S2DJ 3I4NJ 2H1LA 2RKHA 3HEFA 5IYDJ 5JVTA 4JX4A 1GLNA 2FMLA 1WJAA 1ACIA 4ITVA 3T0YA 1SAUA 1QO0D 2ZSIB 4CICA 1G8XA 1U8BA 3FDYA 2HQ5A 2X6XA 3LA2A 4I99C 2P8TA 3IL2A 2OU2A 3I59A 5L3BA 4CSWA 2D1VA 5J3LA 4IHSA 3HL2A 5DCMB 1KGSA 1YX5A 4G7HF 3K2AA 1KU7A 4HEA2 2IGOA 2X1DA 1P7IA 2OCCH 2WA0A 4MTEA 1YJWI 4ABZA 5ICEA 3KP2A 2XGEA 3BJOA 3M9AA 3SZPA 1LDKB 4EVIA 2OZ6A 3E6CC 2DFHA 2ID3A 5B1AH 1ZR2A 3D5RC 2ZB9A 2IEKA 4XRFA 1ENHA 3R61A 1B9MA 1X1BA 2LKPA 4CYCA 2JSPA 4HBLA 4WX9A 2E60A 2LMDA 2ZJQF 3W6VA 3BQZA 3W2VA 2K40A 5LRRA 1UG0A 3K1MA 4HX4A 5KAIC 1SFUA 1D0ZA 2LDUA 2VJ5A 3B6AA
chains in the Genus database with same CATH topology
4KMFA 4BNCA 3KZYA 4QLCU 5F64A 1T2KA 4M72A 5CVRA 1G3TA 3CO6C 1IAWA 1XMAA 3PQKA 2RDPA 3FM3A 3U9GA 4I02A 4IRIA 3F3XA 1SMYF 2MA3A 1QPMA 1B9NA 2DQLA 3WGHA 2X0LA 1K78A 1UCRA 1SD6A 3J81Z 2VT3A 3IKTA 2NAZA 2KIFA 3BOQA 3TO9A 2DQRA 2BE5F 3ERED 1P4XA 3ZMZA 4P5OA 2IVMA 1FNNA 1R5GA 3Q9SA 1J75A 2PI0A 3E5UA 5FD6A 2DW4A 2OZUA 1LB2A 5K5OA 2FNPA 4JQFA 4KN7X 3ISPA 1J7KA 1XSXA 5DYMA 1FSHA 1MKMA 2YU3A 1ON2A 4NQWA 4RS8A 4KIGA 3LFKA 5ED4A 1Z6RA 2F2EA 4A0ZA 4M6XA 2J5OA 3ZPLA 2FSWA 3K0LA 1J5YA 5IT9Z 4G7OF 1BI0A 3K1PA 3RYRA 3ZMTA 2QQBA 3S2WA 3F21A 4Y15A 4LK0F 4CZZA 1YQAA 2IT0A 2L02A 2W24A 4DQ2A 3HIFA 3I5UA 4MHGA 5BQTA 4A0XA 2XKOA 2QUFA 2EK5A 2ADUA 1WWXA 1ONVA 1IXCA 3RIRA 2BYVE 2NNYA 3ML6A 2EJRA 2PMUA 4XLPF 4HLYA 3FF5A 3VB2A 2EFOA 2V1XA 1YO5C 2RQPA 5LEJA 2D45A 3U2RA 2MLKA 1PDNC 4EM0B 2MH2A 1T38A 2BEOA 3T1BA 1IF1A 2YR2A 3F8MA 3QRFF 1ZRCA 4A6EA 3F22A 1XD7A 1IRFA 1H9TA 5LHHA 4OIRF 4OIQF 4KFCA 1Z05A 3DXJF 3NRVA 1R1UA 2B0LA 2Z3YA 4RB1A 1JGSA 1HXDA 4TV7A 1YTYA 1RZ4A 5JHUA 1AOYA 2EV0A 5L3FA 5AIQA 4BQAA 4L18B 2Y75A 2BBYA 4Q4ZF 4OINF 1X3UA 4EJOA 5JFRA 4I0BA 3ROUA 3G73A 3JAMZ 4H0EA 1Z91A 2VOPA 2M8EA 4ZYEA 1EH6A 5HDNA 5BOXA 3CDHA 2JPBA 4MQVA 4G94A 2GXBA 4IPAA 3QPHA 3K2ZA 3QPTA 3E6MA 1JHHA 1Z6TA 5FLXK 2HTJA 1LDDA 2K86A 3ABUA 1J9IA 4HYEA 1REPC 1BOAA 1BI1A 1BC8C 1LNWA 2OQGA 4KN4X 2PLYA 1YS7A 4BYYA 3I53A 1F1ZA 2L54A 1S6LA 3ZMDA 1J0RA 1ZGAA 1MZBA 4A5NA 2QBYA 2Y48A 5ICCA 1FYLA 1HKSA 3LA3A 5DEQA 3ZP5A 2QBYB 4ZZLA 2HWVA 2IW5A 1JE8A 1OYIA 4RGUA 1IUYA 5BPDA 2YSRA 1SD4A 3FXRA 5KVRA 2F5FA 1ON1A 3F8FA 3BWGA 4KMUX 3HHGA 3FWEA 4IRGA 3LAJA 3SQNA 2XV4S 5KK1A 4ENMA 4RGSA 1WRJA 2OA4A 4AD9A 4ETSA 2P5LC 1W4MA 3ABTA 4EM1A 4YFXF 4BH9A 2P5KA 2LNBA 2STTA 2HOEA 3MWMA 4O5VA 3BZ6A 3KEOA 1HW1A 1GXPA 3KLOA 3C3WA 5HS9A 2YX7A 3SXYA 3GX4X 1BC7C 1O7FA 5J8CA 1U6GA 5FGMA 1GVJA 4KYWA 1MJ9A 2HYFA 5DUKA 2VBYA 4UNOA 1FBQA 4OIPF 2HKXA 2VE8A 2DFIA 1YFHA 1JHFA 3DV8A 3E5QA 1YG2A 3O3KA 3DFGA 2H94A 4GGGA 1S3JA 5HLHA 2OQRA 5DD4A 5BMZA 2E1NA 3L00A 3WU1B 2PMHA 3AAFA 1C0WA 5LEKA 2EB7A 2WTEA 2D2WA 3I71A 2PN6A 2R3SA 3E6DA 2IRFG 2VE9A 4HX8A 1IN7A 1L3LA 4BHCA 3DF8A 2DT5A 3R60A 2V1UA 1EH7A 5ICFA 3V7RA 4HZFA 1HBXG 4O6JA 5LGNA 2NS0A 3GEZA 3P9KA 3J80K 2MD5A 1WSUA 3V8JA 4R8HA 1BIBA 2DK8A 3CUQA 5D4SA 1IN4A 1ZG1A 4HDUA 4HF2A 1KA8A 4KA4A 3MAJA 5FO5A 2ZXJA 3JSOA 2W57A 3KCCA 1EV7A 3M1EA 4IXAA 4CGZA 3HYIA 3HRSA 3V7CA 3MQ0A 3JW4A 2QENA 4LFUA 3V4GA 2W85A 1LEBA 4OMZA 3H3ZA 3HOTA 4PDKA 5JR3A 4U7BA 2UXNA 4HOBA 2ZCWA 2FBHA 1OR7A 2V6CA 4OOIA 2ZJ2A 4WWCA 3IWZA 4M9ZA 5J8FA 1ZAOA 2H27A 2QZ8A 5E1ZB 2RV8A 1CF7A 3IRRA 2VODA 4M74A 3E3VA 1FP1D 3ULQB 1G3YA 3Q5FA 3FXQA 1CF7B 3T8TA 1KYZA 1ZHFA 1Y0UA 4PGHA 4ZZDA 3V8LA 2P6SA 1T39A 2VN2A 5FD5A 4KDPA 1HW2A 3GLXA 1B59A 2CWEA 3REOA 5DCMA 4HX7A 2PBIA 1ZG3A 4Q5SF 2OD5A 3FM5A 3JTGA 1I1SA 2HR3A 1KU3A 4D0PA 1BJAA 4IVNA 5LLQA 3RKXA 1IN8A 1FYMA 1WQ2A 5E1XA 2FMYA 4PGGA 4F7ZA 1XDUA 1LJ9A 2JSCA 1V3FA 2HTSA 4UHTA 5HDGA 2EFWA 5FLXZ 2NRAC 4UVBA 1ZGJA 3DPTA 1W5SA 4ZYGA 5E8GA 4MQ9F 1O3TA 1I1GA 2A5YB 5TRDA 1FWZA 2KJBA 4ENNA 3RPQA 4Y17A 2A07F 2IA2A 4HAMA 1VTNC 1XGMA 5LHIA 3DP7A 1U78A 2ZFWA 2A69F 3VFZA 2CQKA 3OV8A 4CHUA 4LGWA 2VBZA 4LB5A 3IRQA 1K6OA 1PP8F 4P9UA 1TW2A 3IWFA 3I0TA 1P92A 2STWA 3KP4A 1BIAA 5ERIA 1XCVA 4XSXF 2PJPA 3F23A 3FMQA 3PFIA 4LJZF 3T8RA 2E7WA 5K5RA 3KZZA 2GAUA 2HKOA 1OMIA 2G7UA 3VEPA 4EV0A 5ICGA 2HQNA 3F6VA 5FFXA 3GW2A 1P4AA 1QNTA 4FT8A 3SHFA 4GO1A 3ZQ7A 4L5IA 1TQMA 2XAJA 2D1HA 2VT2A 2O61A 1ZLKA 2Z9OA 2KIUA 2VC0A 2H6BA 3KETA 1I27A 3TOAA 5D4RA 2YX4A 5DV5A 1MD0A 4WXHA 5EEHA 2KKOA 2JT1A 1FYKA 3J7AO 3RDIA 1PP7U 3BDDA 2WC2A 5CVUA 2ZNZA 4N0BA 2DBBA 1SFEA 4L0ZB 1ODDA 4P55A 3OOPA 4JK1X 3HTSB 3ZMUA 3GFMA 4PCQA 1AWCA 3O6BB 4Z2YA 1TQIA 3WU0A 3GFLA 1FBUA 4KIFA 5ILUA 3H3UA 2QM3A 5D5XB 2P7VB 3J80Z 1HKQA 4IJAA 2C6YA 4KIBA 5AONA 4AWXB 1K79A 2PG4A 3VODA 5ILVA 2J5PA 2GQQA 4PZJA 3GUDA 3WE2A 2M5WA 1R23A 2FEZA 1G4DA 3L2CA 5D6EA 1Z7UA 3E97A 4YFKF 1USTA 2XUBA 1KYWA 4N9HA 3RTRA 1G3SA 4QWQA 2FRHA 4LG0A 1R1VA 3R0JA 3R4KA 1MJAA 4LG0B 3WTUC 3N4MA 1XGOA 1FT9A 4UVAA 4I2OA 4ON0A 1BI2A 1FY7A 3MFKA 3GZ5A 4A12A 4LLLA 4JBAA 1I5ZA 3EQLF 4CXFA 2CYYA 4I98B 2HDCA 3WTVC 3DQVC 4G9YA 4U0VA 3E6BA 2PFBA 1FP2A 2DI3A 1FX7A 3IHUA 5EEGA 1P2FA 3BPVA 2GA2A 2M45A 2PEXA 4ASNA 4ESBA 1U5TA 3LQQA 2KJCA 1RI7A 1U5TB 2XROA 4B8XA 1STZA 2XHKA 3V7SA 2A61A 1XB4A 3SFZA 3KP5A 4LK1F 3B73A 2FF4A 3RYPA 1U2WA 5K5QA 1LQ1A 1HKTA 5H6RA 2KRFA 3L09A 2O6GE 5D5UB 3TDUC 1ZARA 1K7AA 1XGNA 3C7JA 2WWYA 3U1DA 1U3EM 4KNYA 4RGRA 2XAHA 4M9SA 3TGNA 3R0AA 2LF7A 1LVAA 2EFNA 5FB2A 1GHCA 2FXAA 3QOPA 3EYIA 4MNUA 5IT9K 5CVVA 2YPRA 1CGPA 4WCGA 4EJWA 5LBQA 1FC3A 1MJBA 3WTXC 2QQAA 3DPLC 3CJNA 4RB0A 1W7PD 4ZYHA 4U0YA 3CUQC 2EV6A 3M7GA 1B6AA 1S7OA 3GVAA 2CGPA 1W7PB 2VC1A 5DD8A 2CW0F 4P9FA 3L7WA 4DNCA 4M9XA 5A2QK 1IW7F 2HYGD 2OAZA 1O7LA 2M1BA 5DUIA 1YS6A 2QWWA 4AIKA 2HEOA 4HA8A 2HZTA 5BPIA 1H9GA 2GXGA 3WTTC 1OPCA 1J2XA 3RKYA 1HW5A 3LQRA 4P96A 4NB5A 1RUNA 5HLGA 1R1TA 5E18F 2HS5A 1F4KA 3COAC 1XMKA 2P5VA 5L3CA 4K2EA 4YIIA 4Q48A 4I09A 5CJ9A 2RVCA 5DDGA 3HRUA 2FA5A 5FFZA 2R7FA 4LLNA 2ETHA 3GYHX 2O3FA 1PUEE 2ZKZA 2M30A 5L3GA 4I01A 1IRGA 3FZVA 3ELKA 4GYGA 3RJPA 1YW7A 4RB2C 1QZZA 1P6RA 4M73A 4XSZF 5LRSA 3TKYA 4A0YA 3LWFA 3KEQA 3M8EA 1TTYA 2RNJA 4AVPA 5LHGA 4L9JA 2GA1A 3HRMA 3BJ6A 1SD7A 4Q47A 3PQJA 2E1CA 1ZG5A 3EETA 3QU3A 4UXNA 4S05A 3JSPA 3WTWC 2ISZA 2FBKA 1IXRC 1O57A 2XAFA 1QZYA 2R7DA 2ZMEB 4LD5A 2ESHA 5E20A 4NHJA 2P6TA 4HLXA 2A6EF 1Z9CA 3L9FA 1DP7P 4Y13A 2K4JA 3C1DA 3GO5A 2Z5UA 3E5XA 1TW3A 5D5WB 2V9VA 3Q9VA 1OYWA 2TDXA 2XGXA 2P4WA 4R79A 1TQPA 5LGUA 1MDMB 2EWNA 4G6QA 4G6DA 3LA7A 1SAXA 3P7NA 2FQ3A 5F6FA 2UZKA 1R5HA 5CLSA 5HS7A 2L4AA 3GWZA 5D6FA 3EYYA 1SMTA 2M87A 2QLZA 2K02A 3T5XA 1FSEA 3TO6A 1B4AA 1S7AA 3F6OA 4KICA 3I59B 1B1BA 1RIOH 4MGRA 5JI6A 1BN5A 1HSTA 1O3SA 3I58A 1R7JA 2G7HA 3EDPA 3ZMSA 2LF8A 2W25A 4YFNF 1KQ8A 1FLIA 1XGSA 4XLNF 2UWMA 2QVOA 2X4HA 2COMA 4ZH4F 5DCFA 1XN7A 2GZWA 3MEXA 2VBWA 4L9TA 3GFIA 4EGZA 3VOEA 4IRHA 4A6DA 5CVIA 2Z33A 1SFXA 4A2UA 3NEUA 2EFPA 1K78B 2XASA 3CLOA 4GYIA 2W84A 2EFQA 3C18A 5D5VB 2VONA 5E8IA 1WKMA 2MC3A 1YYVA 1RUOA 4IF4A 1YW9A 4AIJA 3ZMVA 1Q1HA 4MTDA 2IPQX 3RKWA 2ZO4A 1USSA 2DK5A 2NYXA 4U7DA 3I4PA 3P9CA 2JZYA 4L5JA 2DPDA 1ZREA 4WXCA 1R58A 1LEAA 2Q0OA 3KP6A 2G9WA 4ENKA 3R6SA 1L0OC 1ULYA 3MZHA 1KQ0A 1T98A 4G7ZF 3RPUA 3FHZA 3FMSA 1QQIA 3WTYC 1T0FA 3JTHA 2PQ8A 2Z99A 2KIMA 2XIGA 2CFXA 2EV5A 1G3WA 3GXOA 1MGTA 1YW8A 4YG2F 3TQNA 1UHWA 2QQ9A 3IKVA 1TLHB 3QU6A 5J6XA 1RNLA 2XKPA 1JXSA 2O03A 1O3RA 5A2QZ 2IJLA 2BV6A 5TJJA 4L9NA 4HV6A 1DDNA 5CVJA 1OYYA 5ILSA 3WE3A 3LSTA 2FOKA 2DU9A 1V4RA 1XSVA 1XCBA 3W6KB 2LSOA 3MCZA 2XRNA 4UVCA 2ZBKA 1O3QA 5E17F 2ESNA 5HOOA 3K1NA 3GF2A 4UV9A 2O0YA 2AXLA 2ZNYA 3BROA 2ACJA 4EJUA 3WTZA 1ZN2A 1QBJA 3MZYA 3HSEA 4GXOA 3KLNA 3BP8A 2JPCA 1U5TC 4EGYA 1BBYA 3HSRA 1R36A 4B09A 4M71A 2EA4A 4WXDA 3WGGA 2ISYA 2K27A 1ZYRF 3I54A 2H09A 3EUHA 1U8RA 2A3SA 4OU0A 2VBXA 5H20A 3TOBA 2DLLA 3I64A 4CYDA 1YIOA 4G8XA 3KFWX 5HLIA 3QP5A 1J59A 2MH9A 3TO7A 2OBPA 2E7XA 3SZTA 2DAOA 1DUXC 1KU9A 3HOSA 5HS8A 2L01A 1IN5A 2DO7A 4LB6B 4M6YA 4FX4A 3BJAA 4HW0A 3FMRA 1ZH5A 2A68F 1KU2A 2FBIA 3H92A 3RI4A 2CSOA 4KUMA 4RGXA 3O2PE 3FXUA 1S29A 1R00A 4ZYDA 2Y0MA 1QGPA 1D8KA 1T6SA 2RGVA 1FPQA 1KQ9A 4OMYA 3J81K 1ZRDA 2UXXA 2Q2EA 4I7HA 5CYVA 3BPXA 1UFMA 5F1RA 1UHMA 3KP7A 4AIHA 4CO8A 2DTRA 5H6QA 3WGIA 3HHHA 2H6CA 2DPUA 4YIFA 3F72A 2P7CB 1DPUA 1ZRFA 3F8BA 2AS5F 1E2XA 4L0YB 2RC4A 4HQEA 2JTVA 2MLGA 2CO5A 1G6NA 1XDSA 2HFHA 3TDZC 1Z1DA 3CTAA 4U88A 3IC7A 5K1YA 3N97A 3HSFA 1SD5A 2XVCA 4GCVA 3QP6A 1LDJA 1F5TA 4LMYA 4HV5A 4EM2A 4BAYA 3HUGA 5L3EA 4S04A 2L4MA 5HDKA 2FU4A 1W7PA 2EA2A 4UUVA 3K69A 4MEXF 5BS6A 3W6JB 1BM9A 3DEUA 2F5CA 3NQOA 2FNAA 4U0WA 5D8LB 1DPRA 4BXUA 1D3YA 3WG9A 1E17A 4FX0A 3M8FA 6PAXA 1YLFA 3V8KA 3WODF 2GWRA 1WI9A 1S8NA 1F9NA 1TNTA 2IA1A 4RB3C 5AIPA 2ELHA 1D5VA 2IP2A 5LGTA 1IZ1A 1IN6A 3D5LA 1I6XA 1XSDA 3HRTA 4HDVA 4XBFA 4A5MA 1TBXA 4KT5C 2L3DA 4EQQA 3GZ6A 4CDGA 1UB9A 4L9VA 5L3DA 4ENJA 1FOKA 3F8NA 1W5TA 2V1DA 4R1HA 4N9IA 3DKWA 1NHAA 3JAMK 3KP3A 4EJTA 3LAPA 4IHTA 5IT3A 1R22A 3CUOA 1OKRA 3CUQB 5D8KB 3QAHA 4BHBA 2O8XA 4LLGF 4MEYF 4WK8F 3G3ZA 3F8CA 4WF2A 2IA0A 2K4BA 2ZMEA 5HVQC 3B02A 1A04A 1BI3A 4E70A 1P4WA 2NNNA 3KE2A 3HTUA 3ZN0A 2RN7A 3K9TA 1EH8A 2VOOA 4OIOF 2XAQA 3CO7C 2HQRA 1IXSB 1HSJA 1GXQA 4RAYA 1HQCA 4FHTA 2MBFA 1FBSA 2Q8KA 2GIVA 4UV8A 2BGCA 3FX3A 4HQMA 2XAGA 1D8JA 1ZLJA 3P9IA 1TNSA 3ECHA 4ESFA 2V79A 4ESJA 4EMSA 4EJVA 2A6HF 5E1WA 1MDMA 1FZPB 3WTSC 2WV0A 4BHPA 2QYOA 4HF1A 4I0AA 2VXZA 2CG4A 4O3MA 1H0MA 4HF0A 4RAZA 2HGCA 2JRTA 2FE3A 2F5DA 3BY6A 3ECOA 3D0SA 2K7LA 2F5EA 3ZN1A 3GFJA 2RKHA 5JVTA 2FMLA 3T0YA 1QO0D 4CICA 3LA2A 2P8TA 3IL2A 2OU2A 3I59A 5L3BA 2D1VA 4IHSA 5DCMB 4G7HF 1KGSA 1KU7A 4MTEA 5ICEA 3KP2A 3M9AA 3BJOA 3E6CC 1LDKB 3SZPA 2OZ6A 4EVIA 4XRFA 3R61A 1B9MA 2LKPA 4HBLA 4WX9A 5LRRA 3K1MA 4HX4A 1SFUA 2LDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMF A;  4BNC A;  3KZY A;  4QLC U;  5F64 A;  1T2K A;  4M72 A;  5CVR A;  1G3T A;  3CO6 C;  1IAW A;  1XMA A;  3PQK A;  2RDP A;  3FM3 A;  3U9G A;  4I02 A;  4IRI A;  3F3X A;  1SMY F;  2MA3 A;  1QPM A;  1B9N A;  2DQL A;  3WGH A;  2X0L A;  1K78 A;  1UCR A;  1SD6 A;  3J81 Z;  2VT3 A;  3IKT A;  2NAZ A;  2KIF A;  3BOQ A;  3TO9 A;  2DQR A;  2BE5 F;  3ERE D;  1P4X A;  3ZMZ A;  4P5O A;  2IVM A;  1FNN A;  1R5G A;  3Q9S A;  1J75 A;  2PI0 A;  3E5U A;  5FD6 A;  2DW4 A;  2OZU A;  1LB2 A;  5K5O A;  2FNP A;  4JQF A;  4KN7 X;  3ISP A;  1J7K A;  1XSX A;  5DYM A;  1FSH A;  1MKM A;  2YU3 A;  1ON2 A;  4NQW A;  4RS8 A;  4KIG A;  3LFK A;  5ED4 A;  1Z6R A;  2F2E A;  4A0Z A;  4M6X A;  2J5O A;  3ZPL A;  2FSW A;  3K0L A;  1J5Y A;  5IT9 Z;  4G7O F;  1BI0 A;  3K1P A;  3RYR A;  3ZMT A;  2QQB A;  3S2W A;  3F21 A;  4Y15 A;  4LK0 F;  4CZZ A;  1YQA A;  2IT0 A;  2L02 A;  2W24 A;  4DQ2 A;  3HIF A;  3I5U A;  4MHG A;  5BQT A;  4A0X A;  2XKO A;  2QUF A;  2EK5 A;  2ADU A;  1WWX A;  1ONV A;  1IXC A;  3RIR A;  2BYV E;  2NNY A;  3ML6 A;  2EJR A;  2PMU A;  4XLP F;  4HLY A;  3FF5 A;  3VB2 A;  2EFO A;  2V1X A;  1YO5 C;  2RQP A;  5LEJ A;  2D45 A;  3U2R A;  2MLK A;  1PDN C;  4EM0 B;  2MH2 A;  1T38 A;  2BEO A;  3T1B A;  1IF1 A;  2YR2 A;  3F8M A;  3QRF F;  1ZRC A;  4A6E A;  3F22 A;  1XD7 A;  1IRF A;  1H9T A;  5LHH A;  4OIR F;  4OIQ F;  4KFC A;  1Z05 A;  3DXJ F;  3NRV A;  1R1U A;  2B0L A;  2Z3Y A;  4RB1 A;  1JGS A;  1HXD A;  4TV7 A;  1YTY A;  1RZ4 A;  5JHU A;  1AOY A;  2EV0 A;  5L3F A;  5AIQ A;  4BQA A;  4L18 B;  2Y75 A;  2BBY A;  4Q4Z F;  4OIN F;  1X3U A;  4EJO A;  5JFR A;  4I0B A;  3ROU A;  3G73 A;  3JAM Z;  4H0E A;  1Z91 A;  2VOP A;  2M8E A;  4ZYE A;  1EH6 A;  5HDN A;  5BOX A;  3CDH A;  2JPB A;  4MQV A;  4G94 A;  2GXB A;  4IPA A;  3QPH A;  3K2Z A;  3QPT A;  3E6M A;  1JHH A;  1Z6T A;  5FLX K;  2HTJ A;  1LDD A;  2K86 A;  3ABU A;  1J9I A;  4HYE A;  1REP C;  1BOA A;  1BI1 A;  1BC8 C;  1LNW A;  2OQG A;  4KN4 X;  2PLY A;  1YS7 A;  4BYY A;  3I53 A;  1F1Z A;  2L54 A;  1S6L A;  3ZMD A;  1J0R A;  1ZGA A;  1MZB A;  4A5N A;  2QBY A;  2Y48 A;  5ICC A;  1FYL A;  1HKS A;  3LA3 A;  5DEQ A;  3ZP5 A;  2QBY B;  4ZZL A;  2HWV A;  2IW5 A;  1JE8 A;  1OYI A;  4RGU A;  1IUY A;  5BPD A;  2YSR A;  1SD4 A;  3FXR A;  5KVR A;  2F5F A;  1ON1 A;  3F8F A;  3BWG A;  4KMU X;  3HHG A;  3FWE A;  4IRG A;  3LAJ A;  3SQN A;  2XV4 S;  5KK1 A;  4ENM A;  4RGS A;  1WRJ A;  2OA4 A;  4AD9 A;  4ETS A;  2P5L C;  1W4M A;  3ABT A;  4EM1 A;  4YFX F;  4BH9 A;  2P5K A;  2LNB A;  2STT A;  2HOE A;  3MWM A;  4O5V A;  3BZ6 A;  3KEO A;  1HW1 A;  1GXP A;  3KLO A;  3C3W A;  5HS9 A;  2YX7 A;  3SXY A;  3GX4 X;  1BC7 C;  1O7F A;  5J8C A;  1U6G A;  5FGM A;  1GVJ A;  4KYW A;  1MJ9 A;  2HYF A;  5DUK A;  2VBY A;  4UNO A;  1FBQ A;  4OIP F;  2HKX A;  2VE8 A;  2DFI A;  1YFH A;  1JHF A;  3DV8 A;  3E5Q A;  1YG2 A;  3O3K A;  3DFG A;  2H94 A;  4GGG A;  1S3J A;  5HLH A;  2OQR A;  5DD4 A;  5BMZ A;  2E1N A;  3L00 A;  3WU1 B;  2PMH A;  3AAF A;  1C0W A;  5LEK A;  2EB7 A;  2WTE A;  2D2W A;  3I71 A;  2PN6 A;  2R3S A;  3E6D A;  2IRF G;  2VE9 A;  4HX8 A;  1IN7 A;  1L3L A;  4BHC A;  3DF8 A;  2DT5 A;  3R60 A;  2V1U A;  1EH7 A;  5ICF A;  3V7R A;  4HZF A;  1HBX G;  4O6J A;  5LGN A;  2NS0 A;  3GEZ A;  3P9K A;  3J80 K;  2MD5 A;  1WSU A;  3V8J A;  4R8H A;  1BIB A;  2DK8 A;  3CUQ A;  5D4S A;  1IN4 A;  1ZG1 A;  4HDU A;  4HF2 A;  1KA8 A;  4KA4 A;  3MAJ A;  5FO5 A;  2ZXJ A;  3JSO A;  2W57 A;  3KCC A;  1EV7 A;  3M1E A;  4IXA A;  4CGZ A;  3HYI A;  3HRS A;  3V7C A;  3MQ0 A;  3JW4 A;  2QEN A;  4LFU A;  3V4G A;  2W85 A;  1LEB A;  4OMZ A;  3H3Z A;  3HOT A;  4PDK A;  5JR3 A;  4U7B A;  2UXN A;  4HOB A;  2ZCW A;  2FBH A;  1OR7 A;  2V6C A;  4OOI A;  2ZJ2 A;  4WWC A;  3IWZ A;  4M9Z A;  5J8F A;  1ZAO A;  2H27 A;  2QZ8 A;  5E1Z B;  2RV8 A;  1CF7 A;  3IRR A;  2VOD A;  4M74 A;  3E3V A;  1FP1 D;  3ULQ B;  1G3Y A;  3Q5F A;  3FXQ A;  1CF7 B;  3T8T A;  1KYZ A;  1ZHF A;  1Y0U A;  4PGH A;  4ZZD A;  3V8L A;  2P6S A;  1T39 A;  2VN2 A;  5FD5 A;  4KDP A;  1HW2 A;  3GLX A;  1B59 A;  2CWE A;  3REO A;  5DCM A;  4HX7 A;  2PBI A;  1ZG3 A;  4Q5S F;  2OD5 A;  3FM5 A;  3JTG A;  1I1S A;  2HR3 A;  1KU3 A;  4D0P A;  1BJA A;  4IVN A;  5LLQ A;  3RKX A;  1IN8 A;  1FYM A;  1WQ2 A;  5E1X A;  2FMY A;  4PGG A;  4F7Z A;  1XDU A;  1LJ9 A;  2JSC A;  1V3F A;  2HTS A;  4UHT A;  5HDG A;  2EFW A;  5FLX Z;  2NRA C;  4UVB A;  1ZGJ A;  3DPT A;  1W5S A;  4ZYG A;  5E8G A;  4MQ9 F;  1O3T A;  1I1G A;  2A5Y B;  5TRD A;  1FWZ A;  2KJB A;  4ENN A;  3RPQ A;  4Y17 A;  2A07 F;  2IA2 A;  4HAM A;  1VTN C;  1XGM A;  5LHI A;  3DP7 A;  1U78 A;  2ZFW A;  2A69 F;  3VFZ A;  2CQK A;  3OV8 A;  4CHU A;  4LGW A;  2VBZ A;  4LB5 A;  3IRQ A;  1K6O A;  1PP8 F;  4P9U A;  1TW2 A;  3IWF A;  3I0T A;  1P92 A;  2STW A;  3KP4 A;  1BIA A;  5ERI A;  1XCV A;  4XSX F;  2PJP A;  3F23 A;  3FMQ A;  3PFI A;  4LJZ F;  3T8R A;  2E7W A;  5K5R A;  3KZZ A;  2GAU A;  2HKO A;  1OMI A;  2G7U A;  3VEP A;  4EV0 A;  5ICG A;  2HQN A;  3F6V A;  5FFX A;  3GW2 A;  1P4A A;  1QNT A;  4FT8 A;  3SHF A;  4GO1 A;  3ZQ7 A;  4L5I A;  1TQM A;  2XAJ A;  2D1H A;  2VT2 A;  2O61 A;  1ZLK A;  2Z9O A;  2KIU A;  2VC0 A;  2H6B A;  3KET A;  1I27 A;  3TOA A;  5D4R A;  2YX4 A;  5DV5 A;  1MD0 A;  4WXH A;  5EEH A;  2KKO A;  2JT1 A;  1FYK A;  3J7A O;  3RDI A;  1PP7 U;  3BDD A;  2WC2 A;  5CVU A;  2ZNZ A;  4N0B A;  2DBB A;  1SFE A;  4L0Z B;  1ODD A;  4P55 A;  3OOP A;  4JK1 X;  3HTS B;  3ZMU A;  3GFM A;  4PCQ A;  1AWC A;  3O6B B;  4Z2Y A;  1TQI A;  3WU0 A;  3GFL A;  1FBU A;  4KIF A;  5ILU A;  3H3U A;  2QM3 A;  5D5X B;  2P7V B;  3J80 Z;  1HKQ A;  4IJA A;  2C6Y A;  4KIB A;  5AON A;  4AWX B;  1K79 A;  2PG4 A;  3VOD A;  5ILV A;  2J5P A;  2GQQ A;  4PZJ A;  3GUD A;  3WE2 A;  2M5W A;  1R23 A;  2FEZ A;  1G4D A;  3L2C A;  5D6E A;  1Z7U A;  3E97 A;  4YFK F;  1UST A;  2XUB A;  1KYW A;  4N9H A;  3RTR A;  1G3S A;  4QWQ A;  2FRH A;  4LG0 A;  1R1V A;  3R0J A;  3R4K A;  1MJA A;  4LG0 B;  3WTU C;  3N4M A;  1XGO A;  1FT9 A;  4UVA A;  4I2O A;  4ON0 A;  1BI2 A;  1FY7 A;  3MFK A;  3GZ5 A;  4A12 A;  4LLL A;  4JBA A;  1I5Z A;  3EQL F;  4CXF A;  2CYY A;  4I98 B;  2HDC A;  3WTV C;  3DQV C;  4G9Y A;  4U0V A;  3E6B A;  2PFB A;  1FP2 A;  2DI3 A;  1FX7 A;  3IHU A;  5EEG A;  1P2F A;  3BPV A;  2GA2 A;  2M45 A;  2PEX A;  4ASN A;  4ESB A;  1U5T A;  3LQQ A;  2KJC A;  1RI7 A;  1U5T B;  2XRO A;  4B8X A;  1STZ A;  2XHK A;  3V7S A;  2A61 A;  1XB4 A;  3SFZ A;  3KP5 A;  4LK1 F;  3B73 A;  2FF4 A;  3RYP A;  1U2W A;  5K5Q A;  1LQ1 A;  1HKT A;  5H6R A;  2KRF A;  3L09 A;  2O6G E;  5D5U B;  3TDU C;  1ZAR A;  1K7A A;  1XGN A;  3C7J A;  2WWY A;  3U1D A;  1U3E M;  4KNY A;  4RGR A;  2XAH A;  4M9S A;  3TGN A;  3R0A A;  2LF7 A;  1LVA A;  2EFN A;  5FB2 A;  1GHC A;  2FXA A;  3QOP A;  3EYI A;  4MNU A;  5IT9 K;  5CVV A;  2YPR A;  1CGP A;  4WCG A;  4EJW A;  5LBQ A;  1FC3 A;  1MJB A;  3WTX C;  2QQA A;  3DPL C;  3CJN A;  4RB0 A;  1W7P D;  4ZYH A;  4U0Y A;  3CUQ C;  2EV6 A;  3M7G A;  1B6A A;  1S7O A;  3GVA A;  2CGP A;  1W7P B;  2VC1 A;  5DD8 A;  2CW0 F;  4P9F A;  3L7W A;  4DNC A;  4M9X A;  5A2Q K;  1IW7 F;  2HYG D;  2OAZ A;  1O7L A;  2M1B A;  5DUI A;  1YS6 A;  2QWW A;  4AIK A;  2HEO A;  4HA8 A;  2HZT A;  5BPI A;  1H9G A;  2GXG A;  3WTT C;  1OPC A;  1J2X A;  3RKY A;  1HW5 A;  3LQR A;  4P96 A;  4NB5 A;  1RUN A;  5HLG A;  1R1T A;  5E18 F;  2HS5 A;  1F4K A;  3COA C;  1XMK A;  2P5V A;  5L3C A;  4K2E A;  4YII A;  4Q48 A;  4I09 A;  5CJ9 A;  2RVC A;  5DDG A;  3HRU A;  2FA5 A;  5FFZ A;  2R7F A;  4LLN A;  2ETH A;  3GYH X;  2O3F A;  1PUE E;  2ZKZ A;  2M30 A;  5L3G A;  4I01 A;  1IRG A;  3FZV A;  3ELK A;  4GYG A;  3RJP A;  1YW7 A;  4RB2 C;  1QZZ A;  1P6R A;  4M73 A;  4XSZ F;  5LRS A;  3TKY A;  4A0Y A;  3LWF A;  3KEQ A;  3M8E A;  1TTY A;  2RNJ A;  4AVP A;  5LHG A;  4L9J A;  2GA1 A;  3HRM A;  3BJ6 A;  1SD7 A;  4Q47 A;  3PQJ A;  2E1C A;  1ZG5 A;  3EET A;  3QU3 A;  4UXN A;  4S05 A;  3JSP A;  3WTW C;  2ISZ A;  2FBK A;  1IXR C;  1O57 A;  2XAF A;  1QZY A;  2R7D A;  2ZME B;  4LD5 A;  2ESH A;  5E20 A;  4NHJ A;  2P6T A;  4HLX A;  2A6E F;  1Z9C A;  3L9F A;  1DP7 P;  4Y13 A;  2K4J A;  3C1D A;  3GO5 A;  2Z5U A;  3E5X A;  1TW3 A;  5D5W B;  2V9V A;  3Q9V A;  1OYW A;  2TDX A;  2XGX A;  2P4W A;  4R79 A;  1TQP A;  5LGU A;  1MDM B;  2EWN A;  4G6Q A;  4G6D A;  3LA7 A;  1SAX A;  3P7N A;  2FQ3 A;  5F6F A;  2UZK A;  1R5H A;  5CLS A;  5HS7 A;  2L4A A;  3GWZ A;  5D6F A;  3EYY A;  1SMT A;  2M87 A;  2QLZ A;  2K02 A;  3T5X A;  1FSE A;  3TO6 A;  1B4A A;  1S7A A;  3F6O A;  4KIC A;  3I59 B;  1B1B A;  1RIO H;  4MGR A;  5JI6 A;  1BN5 A;  1HST A;  1O3S A;  3I58 A;  1R7J A;  2G7H A;  3EDP A;  3ZMS A;  2LF8 A;  2W25 A;  4YFN F;  1KQ8 A;  1FLI A;  1XGS A;  4XLN F;  2UWM A;  2QVO A;  2X4H A;  2COM A;  4ZH4 F;  5DCF A;  1XN7 A;  2GZW A;  3MEX A;  2VBW A;  4L9T A;  3GFI A;  4EGZ A;  3VOE A;  4IRH A;  4A6D A;  5CVI A;  2Z33 A;  1SFX A;  4A2U A;  3NEU A;  2EFP A;  1K78 B;  2XAS A;  3CLO A;  4GYI A;  2W84 A;  2EFQ A;  3C18 A;  5D5V B;  2VON A;  5E8I A;  1WKM A;  2MC3 A;  1YYV A;  1RUO A;  4IF4 A;  1YW9 A;  4AIJ A;  3ZMV A;  1Q1H A;  4MTD A;  2IPQ X;  3RKW A;  2ZO4 A;  1USS A;  2DK5 A;  2NYX A;  4U7D A;  3I4P A;  3P9C A;  2JZY A;  4L5J A;  2DPD A;  1ZRE A;  4WXC A;  1R58 A;  1LEA A;  2Q0O A;  3KP6 A;  2G9W A;  4ENK A;  3R6S A;  1L0O C;  1ULY A;  3MZH A;  1KQ0 A;  1T98 A;  4G7Z F;  3RPU A;  3FHZ A;  3FMS A;  1QQI A;  3WTY C;  1T0F A;  3JTH A;  2PQ8 A;  2Z99 A;  2KIM A;  2XIG A;  2CFX A;  2EV5 A;  1G3W A;  3GXO A;  1MGT A;  1YW8 A;  4YG2 F;  3TQN A;  1UHW A;  2QQ9 A;  3IKV A;  1TLH B;  3QU6 A;  5J6X A;  1RNL A;  2XKP A;  1JXS A;  2O03 A;  1O3R A;  5A2Q Z;  2IJL A;  2BV6 A;  5TJJ A;  4L9N A;  4HV6 A;  1DDN A;  5CVJ A;  1OYY A;  5ILS A;  3WE3 A;  3LST A;  2FOK A;  2DU9 A;  1V4R A;  1XSV A;  1XCB A;  3W6K B;  2LSO A;  3MCZ A;  2XRN A;  4UVC A;  2ZBK A;  1O3Q A;  5E17 F;  2ESN A;  5HOO A;  3K1N A;  3GF2 A;  4UV9 A;  2O0Y A;  2AXL A;  2ZNY A;  3BRO A;  2ACJ A;  4EJU A;  3WTZ A;  1ZN2 A;  1QBJ A;  3MZY A;  3HSE A;  4GXO A;  3KLN A;  3BP8 A;  2JPC A;  1U5T C;  4EGY A;  1BBY A;  3HSR A;  1R36 A;  4B09 A;  4M71 A;  2EA4 A;  4WXD A;  3WGG A;  2ISY A;  2K27 A;  1ZYR F;  3I54 A;  2H09 A;  3EUH A;  1U8R A;  2A3S A;  4OU0 A;  2VBX A;  5H20 A;  3TOB A;  2DLL A;  3I64 A;  4CYD A;  1YIO A;  4G8X A;  3KFW X;  5HLI A;  3QP5 A;  1J59 A;  2MH9 A;  3TO7 A;  2OBP A;  2E7X A;  3SZT A;  2DAO A;  1DUX C;  1KU9 A;  3HOS A;  5HS8 A;  2L01 A;  1IN5 A;  2DO7 A;  4LB6 B;  4M6Y A;  4FX4 A;  3BJA A;  4HW0 A;  3FMR A;  1ZH5 A;  2A68 F;  1KU2 A;  2FBI A;  3H92 A;  3RI4 A;  2CSO A;  4KUM A;  4RGX A;  3O2P E;  3FXU A;  1S29 A;  1R00 A;  4ZYD A;  2Y0M A;  1QGP A;  1D8K A;  1T6S A;  2RGV A;  1FPQ A;  1KQ9 A;  4OMY A;  3J81 K;  1ZRD A;  2UXX A;  2Q2E A;  4I7H A;  5CYV A;  3BPX A;  1UFM A;  5F1R A;  1UHM A;  3KP7 A;  4AIH A;  4CO8 A;  2DTR A;  5H6Q A;  3WGI A;  3HHH A;  2H6C A;  2DPU A;  4YIF A;  3F72 A;  2P7C B;  1DPU A;  1ZRF A;  3F8B A;  2AS5 F;  1E2X A;  4L0Y B;  2RC4 A;  4HQE A;  2JTV A;  2MLG A;  2CO5 A;  1G6N A;  1XDS A;  2HFH A;  3TDZ C;  1Z1D A;  3CTA A;  4U88 A;  3IC7 A;  5K1Y A;  3N97 A;  3HSF A;  1SD5 A;  2XVC A;  4GCV A;  3QP6 A;  1LDJ A;  1F5T A;  4LMY A;  4HV5 A;  4EM2 A;  4BAY A;  3HUG A;  5L3E A;  4S04 A;  2L4M A;  5HDK A;  2FU4 A;  1W7P A;  2EA2 A;  4UUV A;  3K69 A;  4MEX F;  5BS6 A;  3W6J B;  1BM9 A;  3DEU A;  2F5C A;  3NQO A;  2FNA A;  4U0W A;  5D8L B;  1DPR A;  4BXU A;  1D3Y A;  3WG9 A;  1E17 A;  4FX0 A;  3M8F A;  6PAX A;  1YLF A;  3V8K A;  3WOD F;  2GWR A;  1WI9 A;  1S8N A;  1F9N A;  1TNT A;  2IA1 A;  4RB3 C;  5AIP A;  2ELH A;  1D5V A;  2IP2 A;  5LGT A;  1IZ1 A;  1IN6 A;  3D5L A;  1I6X A;  1XSD A;  3HRT A;  4HDV A;  4XBF A;  4A5M A;  1TBX A;  4KT5 C;  2L3D A;  4EQQ A;  3GZ6 A;  4CDG A;  1UB9 A;  4L9V A;  5L3D A;  4ENJ A;  1FOK A;  3F8N A;  1W5T A;  2V1D A;  4R1H A;  4N9I A;  3DKW A;  1NHA A;  3JAM K;  3KP3 A;  4EJT A;  3LAP A;  4IHT A;  5IT3 A;  1R22 A;  3CUO A;  1OKR A;  3CUQ B;  5D8K B;  3QAH A;  4BHB A;  2O8X A;  4LLG F;  4MEY F;  4WK8 F;  3G3Z A;  3F8C A;  4WF2 A;  2IA0 A;  2K4B A;  2ZME A;  5HVQ C;  3B02 A;  1A04 A;  1BI3 A;  4E70 A;  1P4W A;  2NNN A;  3KE2 A;  3HTU A;  3ZN0 A;  2RN7 A;  3K9T A;  1EH8 A;  2VOO A;  4OIO F;  2XAQ A;  3CO7 C;  2HQR A;  1IXS B;  1HSJ A;  1GXQ A;  4RAY A;  1HQC A;  4FHT A;  2MBF A;  1FBS A;  2Q8K A;  2GIV A;  4UV8 A;  2BGC A;  3FX3 A;  4HQM A;  2XAG A;  1D8J A;  1ZLJ A;  3P9I A;  1TNS A;  3ECH A;  4ESF A;  2V79 A;  4ESJ A;  4EMS A;  4EJV A;  2A6H F;  5E1W A;  1MDM A;  1FZP B;  3WTS C;  2WV0 A;  4BHP A;  2QYO A;  4HF1 A;  4I0A A;  2VXZ A;  2CG4 A;  4O3M A;  1H0M A;  4HF0 A;  4RAZ A;  2HGC A;  2JRT A;  2FE3 A;  2F5D A;  3BY6 A;  3ECO A;  3D0S A;  2K7L A;  2F5E A;  3ZN1 A;  3GFJ A;  2RKH A;  5JVT A;  2FML A;  3T0Y A;  1QO0 D;  4CIC A;  3LA2 A;  2P8T A;  3IL2 A;  2OU2 A;  3I59 A;  5L3B A;  2D1V A;  4IHS A;  5DCM B;  4G7H F;  1KGS A;  1KU7 A;  4MTE A;  5ICE A;  3KP2 A;  3M9A A;  3BJO A;  3E6C C;  1LDK B;  3SZP A;  2OZ6 A;  4EVI A;  4XRF A;  3R61 A;  1B9M A;  2LKP A;  4HBL A;  4WX9 A;  5LRR A;  3K1M A;  4HX4 A;  1SFU A;  2LDU A; 
#chains in the Genus database with same CATH topology
 4KMF A;  4BNC A;  2E5N A;  4Z6Y A;  3KZY A;  3OYH A;  4QLC U;  5F64 A;  2Y30 A;  3MVP A;  3OIP A;  1T2K A;  4RM3 A;  4XIC A;  4M72 A;  5CVR A;  1W0T A;  1G3T A;  3CO6 C;  2AQF A;  3ZOB A;  5C3E J;  1IAW A;  1XMA A;  2WY7 Q;  3PQK A;  2RDP A;  3FM3 A;  2Y2Z A;  3U9G A;  2FJ1 A;  1XTA A;  4I02 A;  4B3X A;  4IRI A;  3F3X A;  1D5Y A;  1SMY F;  1U9O A;  2MA3 A;  1QPM A;  2LKX A;  3FK6 A;  1GV2 A;  4DYR A;  1T0F C;  1B9N A;  3GTL J;  3QQA A;  2DQL A;  4XOT A;  3WGH A;  3FIS A;  2X0L A;  1K78 A;  3BTC A;  2JUG A;  1UCR A;  2HQA A;  4UB6 C;  2EZL A;  1IC8 A;  1SD6 A;  2EQR A;  3J81 Z;  2VT3 A;  3IKT A;  2E5Z A;  2NAZ A;  2KIF A;  3BOQ A;  2L5Q A;  1JTX A;  3TO9 A;  2DQR A;  2VIX A;  2BE5 F;  1MW7 A;  2M4G A;  5LD2 C;  3ERE D;  1P4X A;  3CMY A;  2AHQ A;  4X6A J;  1UEL B;  2DA6 A;  3ZMZ A;  3SYT A;  1ZTR A;  3DPU A;  1XX5 A;  4P5O A;  3CC4 I;  2VKE A;  2IVM A;  3K4C A;  1FNN A;  1R5G A;  3Q9S A;  1J75 A;  3WG7 H;  3G6E I;  2PI0 A;  2KRH A;  5GAG J;  4MLO A;  4A3J J;  3E5U A;  5FD6 A;  3PSI A;  2DW4 A;  4YIR X;  2OZU A;  4NDL A;  1LB2 A;  5K5O A;  2FNP A;  4IOA F;  3FKJ A;  4JQF A;  4KN7 X;  4PJ0 C;  3ISP A;  1J7K A;  2IGK A;  1Z3X A;  1AKH A;  3CCE I;  5IT9 R;  1XSX A;  5DYM A;  1FSH A;  4NNJ A;  1MKM A;  2YU3 A;  1AKH B;  1ON2 A;  1ZEL A;  4NQW A;  4RS8 A;  4KIG A;  2O9L A;  1MIJ A;  3LFK A;  5ED4 A;  1H8A C;  1Z6R A;  2F2E A;  3E1S A;  4M6X A;  2IGM A;  4A0Z A;  1IGN A;  1WI3 A;  4NQW B;  3ABL H;  1T95 A;  2J5O A;  3ZPL A;  2FSW A;  1YHQ I;  3K0L A;  5CPR B;  1J5Y A;  1R9T J;  5IT9 Z;  4BQN A;  4E7J A;  4G7O F;  2LBF B;  1BI0 A;  3K1P A;  1OCZ H;  3RYR A;  3VYS B;  3ZMT A;  4NC7 A;  3S1M J;  4E7K A;  3SFI A;  1X19 A;  1DQU A;  2QQB A;  4NBQ A;  4PJJ A;  3S2W A;  3F21 A;  4Y15 A;  4LK0 F;  4CZZ A;  1YQA A;  2IT0 A;  2L02 A;  2W24 A;  4OAZ A;  4B1R A;  3A52 A;  4M3D A;  4DQ2 A;  3HIF A;  5A2Q R;  3I5U A;  4MHG A;  5BQT A;  5EG0 B;  3H35 A;  2ID6 A;  4A0X A;  3OYD A;  2MW8 A;  2XKO A;  2CFO A;  2QUF A;  1WJC A;  3RSN A;  5FKK A;  2EK5 A;  2ADU A;  1WWX A;  2HVQ A;  3EUH C;  1ONV A;  1IXC A;  3RIR A;  2BYV E;  3S17 J;  3RQ4 A;  2NNY A;  3ML6 A;  2PX9 A;  2EJR A;  2MFZ A;  1MH3 A;  1EJ9 A;  2PMU A;  4DW6 A;  4XLP F;  4HLY A;  3FF5 A;  2HOA A;  3VB2 A;  2EFO A;  2OTJ I;  3LFU A;  2V1X A;  1YO5 C;  2RQP A;  2KDO A;  4BL0 B;  5LEJ A;  2D45 A;  1W36 C;  3CD6 I;  3U2R A;  2MLK A;  2WY8 Q;  1WZ2 A;  1PDN C;  4EM0 B;  2CMP A;  5HNH A;  2MH2 A;  1T38 A;  3CP2 A;  5EZG A;  2BEO A;  1UAA A;  3T1B A;  1IF1 A;  2YR2 A;  3F8M A;  1X2N A;  3ZQC A;  2XDV A;  3QRF F;  1ZRC A;  4A6E A;  4B47 A;  2K9S A;  3F22 A;  1XD7 A;  1HDP A;  1IV8 A;  1IRF A;  1H9T A;  2V26 A;  5LHH A;  4OIR F;  5LFA A;  2O8K A;  4OIQ F;  3JRB A;  3HOU J;  3G1L A;  1SEU A;  4KFC A;  1Z05 A;  4XLC A;  4F93 B;  3BR2 A;  4RAF A;  1IUF A;  3DXJ F;  3NRV A;  4BAC A;  1R1U A;  2B0L A;  3BCA A;  2Z3Y A;  4RB1 A;  5GTH C;  1JGS A;  1HXD A;  4TV7 A;  1YTY A;  2K9N A;  2CH0 A;  1RZ4 A;  5JHU A;  3ERM A;  1AOY A;  2EV0 A;  3HGY A;  3HPH A;  5AIQ A;  5L3F A;  4BQA A;  4L18 B;  1Z7L A;  2Y75 A;  3OS1 A;  2BBY A;  4Q4Z F;  5J1R A;  4YEL A;  1WPK A;  4OIN F;  4LOC A;  1GUU A;  1X3U A;  4CH7 A;  4EJO A;  2EPF A;  2W82 A;  5JFR A;  1PUF A;  3E7L A;  3HGG A;  1Y8Q B;  1R4N B;  3H1C A;  1PUF B;  4RAG A;  4I0B A;  3ROU A;  3G73 A;  3JAM Z;  4ZDO A;  1LPQ A;  4H0E A;  1Z91 A;  2VOP A;  2M8E A;  4ZYA A;  2BXZ A;  4ZYE A;  1EH6 A;  5HDN A;  4XQF A;  3HKZ N;  4HNV A;  5BOX A;  1WVR A;  3CDH A;  2LOO A;  2MGQ A;  4G12 A;  2JPB A;  3Q0U A;  4MQV A;  3LSH A;  4G94 A;  2GXB A;  5M3F J;  3MN2 A;  3AG2 H;  4IPA A;  2LRE A;  3QPH A;  1R49 A;  3K2Z A;  3QPT A;  2ELJ A;  5F08 A;  3BG5 A;  3E6M A;  1D1C A;  3OYI A;  2K9Q A;  2CV2 A;  1JHH A;  1Z6T A;  3DBR B;  3MKL A;  5M5X J;  5FLX K;  2HTJ A;  1LDD A;  2K86 A;  3ABU A;  3H36 A;  2BZT A;  4NC8 A;  1J9I A;  1EKE A;  2ZSH B;  2KRC A;  3HPG A;  3MMY B;  3CES A;  3FXM A;  5M5Y J;  2VPL A;  2X9D A;  4HYE A;  1PYV A;  1REP C;  1BOA A;  4DGW B;  1Y0N A;  1BI1 A;  1BC8 C;  4AID A;  3VYT B;  1LNW A;  2XAU A;  2UV1 A;  3HKZ A;  2OQG A;  4XLA A;  4BS9 A;  4KN4 X;  2PLY A;  1YS7 A;  2LFB A;  1I3Q J;  3PUB A;  4BYY A;  3BC8 A;  3I53 A;  1F1Z A;  5F04 A;  3PNY A;  4XRS G;  2L54 A;  1S6L A;  3W2W A;  4A3F J;  4U87 A;  3ZMD A;  1J0R A;  1LKX A;  1ZGA A;  1MZB A;  4A5N A;  3CCS I;  2QBY A;  3GTJ J;  2Y48 A;  1MMA A;  5ICC A;  3H0G J;  1FYL A;  4CA0 A;  1HKS A;  3LA3 A;  5DEQ A;  3ZP5 A;  2QBY B;  1JKP C;  4ZZL A;  2L9N A;  3P5J A;  5CKT A;  2HWV A;  1BW6 A;  2IW5 A;  1JE8 A;  1OYI A;  3RCO A;  4RGU A;  4ZTJ A;  5BPD A;  1IUY A;  2YSR A;  1SD4 A;  2RAE A;  2VQH A;  1VQ6 I;  1MMS A;  3PNT A;  4F92 B;  4J01 A;  3FXR A;  2CV1 A;  2LD5 A;  3PO3 J;  5KVR A;  2F5F A;  1ON1 A;  3F8F A;  3OYB A;  2EIN H;  1H88 C;  3BWG A;  4KMU X;  2DA1 A;  2HXO A;  3HHG A;  3FWE A;  4LG3 A;  4IRG A;  3LAJ A;  3SQN A;  1Q1V A;  2QKM B;  2XV4 S;  3CQZ J;  5KK1 A;  4ENM A;  2AQE A;  4RGS A;  2V4J C;  3VDX A;  1WRJ A;  2DXI A;  2OA4 A;  4AD9 A;  1V5E A;  4ETS A;  2P5L C;  5IP6 A;  2CUF A;  1W4M A;  3ABT A;  4EM1 A;  2DTZ A;  1JKR C;  1VQ9 I;  4YFX F;  4BH9 A;  2P5K A;  1XS9 A;  4JX5 A;  1SVM A;  5E3O A;  3OSF A;  1P9Q C;  2LNB A;  2STT A;  2HOE A;  3MWM A;  4O5V A;  3OL4 A;  2E2H J;  3RZD J;  5F27 A;  3PIP F;  2KQR A;  3BZ6 A;  3KEO A;  4F91 B;  1HW1 A;  4Y33 A;  3RQI A;  2DA3 A;  3A01 A;  1GXP A;  3KLO A;  4V2F A;  2KL4 A;  3C3W A;  2N8G A;  2HDD A;  3OYM A;  5HS9 A;  2YX7 A;  3SXY A;  3GX4 X;  1BC7 C;  1U9N A;  2H1K A;  1O7F A;  2EIL H;  3OIQ A;  2ZJR F;  5J8C A;  3JRI A;  1U6G A;  1Z3Y A;  5FGM A;  3GTP J;  2JJ7 A;  1GVJ A;  2NOJ B;  4KYW A;  1FOY A;  1MJ9 A;  1T8I A;  2HYF A;  5DUK A;  2VBY A;  2R7W A;  4UNO A;  1FBQ A;  4OIP F;  5K7H A;  4XKC A;  2HKX A;  2XPV A;  2W1O A;  2VE8 A;  2ELK A;  2DFI A;  1YFH A;  3K4K A;  5GP9 A;  1JT6 A;  1JHF A;  3BR3 A;  4A93 J;  3DV8 A;  3E5Q A;  1OCT C;  3ZQI A;  2HPM A;  3ZQQ A;  1YG2 A;  2ZME C;  3O3K A;  3DFG A;  2V6E A;  4CCO A;  2H94 A;  2Z2S B;  3CJR B;  1FOW A;  4GGG A;  3FXK A;  1S3J A;  1W1W E;  5HLH A;  2DCE A;  4W1U A;  3GTK J;  2OQR A;  4MFD A;  5DD4 A;  3BG3 A;  2NS8 A;  1WJF A;  4PK4 A;  5BMZ A;  2DMN A;  1MBJ A;  2E1N A;  3L00 A;  3WU1 B;  2PMH A;  3AAF A;  1C0W A;  5LEK A;  2EB7 A;  2WTE A;  1IJW C;  3OYC A;  3ZGK A;  2D2W A;  3W3C A;  3I71 A;  1MMD A;  2PN6 A;  2R3S A;  3E6D A;  1AA7 A;  2DA5 A;  3L2W A;  1CQT A;  1R71 A;  2IRF G;  3ABM H;  4MIM A;  1OQY A;  2VE9 A;  1UG2 A;  4GFB A;  2HPI A;  4HX8 A;  2B63 J;  1IN7 A;  3QOD A;  1L3L A;  4BHC A;  3DF8 A;  2M4K A;  2DT5 A;  3R60 A;  2V1U A;  1EH7 A;  5ICF A;  4XON A;  3V7R A;  1X3Z B;  4HZF A;  4BUP A;  1HBX G;  3FXO A;  1RKW A;  2OUM A;  1HA8 A;  4O6J A;  2JA5 J;  2NS0 A;  3GEZ A;  3P9K A;  5LGN A;  3J80 K;  2MD5 A;  2E1M B;  2QEX I;  1WSU A;  3V8J A;  1MBE A;  4R8H A;  2NVX J;  3ONQ A;  2CW8 A;  1BIB A;  2BOL A;  2DK8 A;  4BGD A;  2R7O A;  3CUQ A;  5TGT A;  5F0F A;  5D4S A;  1IN4 A;  5FKO A;  2KZG A;  4B43 A;  1ZG1 A;  4HDU A;  2NVQ J;  4HF2 A;  1KA8 A;  4KA4 A;  1N75 A;  3DEW A;  1O4X A;  3MAJ A;  5FO5 A;  2R7Z J;  4ZTF A;  2ZXJ A;  3AG3 H;  3LMM A;  9ANT A;  3JSO A;  2A05 A;  2VAS A;  1MH4 A;  2CUE A;  2W57 A;  1EV7 A;  3KCC A;  3M1E A;  4IXA A;  4CGZ A;  3HYI A;  2MYS A;  3HRS A;  3NWT A;  2F4M B;  1Z0X A;  3V7C A;  3M4O J;  2IS4 A;  3MQ0 A;  3JW4 A;  2QEN A;  4LFU A;  3HDD A;  3V42 A;  5FRM A;  3V4G A;  2W85 A;  3G1O A;  1LEB A;  4OMZ A;  3H3Z A;  3HOT A;  1YJN I;  3NAU A;  4PDK A;  1MBG A;  3HOY J;  5KNL A;  5JR3 A;  4U7B A;  2UXN A;  4AVZ A;  4HOB A;  4C2T A;  2ZCW A;  1FJL A;  2FBH A;  4FIS A;  1JJ8 C;  1OR7 A;  2V6C A;  1V54 H;  1X3W B;  3CJQ B;  4OOI A;  4DBR A;  2ZJ2 A;  2MVT A;  3K4N A;  2K85 A;  5EZH A;  4WWC A;  2P81 A;  3IWZ A;  4M9Z A;  5J8F A;  1ZAO A;  1K61 A;  1TC3 C;  2H27 A;  1T33 A;  3OSG A;  2QZ8 A;  1DGR M;  3K4J A;  5E1Z B;  2RV8 A;  1CF7 A;  3IRR A;  2VOD A;  1QU3 A;  4M74 A;  3E3V A;  1FP1 D;  1ETX A;  3ULQ B;  1G3Y A;  3Q5F A;  3FXQ A;  1CF7 B;  3T8T A;  1KYZ A;  1ZHF A;  3A1Y A;  4XN3 A;  2HZD A;  1Y0U A;  2L7F P;  4PGH A;  4ZZD A;  3H9G A;  3V8L A;  2P6S A;  1T39 A;  3UKG A;  2VN2 A;  1WHU A;  2V9P A;  2ZC2 A;  1VQN I;  1OLT A;  3S14 J;  5FD5 A;  1BL0 A;  4KDP A;  1HW2 A;  3BLY A;  3GLX A;  2R5Z A;  3KYL A;  1OCO H;  2XPW A;  3OY9 A;  1B59 A;  2JA6 J;  2R5Z B;  2CWE A;  1JGG A;  3REO A;  5DCM A;  4HX7 A;  2PBI A;  1ZG3 A;  1QHG A;  4Q5S F;  2OD5 A;  3FM5 A;  4QTR A;  2BY3 A;  3FIW A;  3JTG A;  1I1S A;  4XL9 A;  4C9Y A;  4A69 C;  2HR3 A;  2X98 A;  1KU3 A;  4D0P A;  3AFH A;  3JRD A;  4J00 A;  1BJA A;  4E4H A;  1T56 A;  4IVN A;  4XLE A;  2XF7 A;  5LLQ A;  2BHZ A;  3RKX A;  4X0G A;  1IN8 A;  1FYM A;  1WQ2 A;  3ZCO A;  3W2A A;  5E1X A;  3BTL A;  4UY8 I;  4CCJ A;  4BKX A;  4A3I J;  2FMY A;  3B6C A;  2E2J J;  4PGG A;  4F7Z A;  1XDU A;  1XG1 A;  2LK2 A;  1LJ9 A;  2JSC A;  1V3F A;  4OAY A;  3OIO A;  2HTS A;  4UHT A;  2QSG X;  5HDG A;  2EFW A;  1D0Y A;  5FLX Z;  3SZG A;  3BZK A;  5EGO B;  2NRA C;  3WHC A;  4UVB A;  3G71 I;  2EIJ H;  5M3M J;  3HOV J;  2BY1 A;  1ZGJ A;  3DPT A;  1W5C C;  1W5S A;  3GLL A;  4ZYG A;  5E8G A;  4MQ9 F;  1O3T A;  2DA2 A;  2EZI A;  1I1G A;  2A5Y B;  5TRD A;  2R4G A;  4AM3 A;  2AO9 A;  3J81 R;  2LKS A;  1KON A;  2MC4 A;  2VQL A;  4JOM A;  2VI6 A;  2M0C A;  2WAF A;  1FWZ A;  2XGC A;  2KJB A;  4ENN A;  3RPQ A;  4Y17 A;  2CQ7 A;  2A07 F;  5J47 A;  2TRT A;  2IA2 A;  4HAM A;  1VTN C;  1XGM A;  5LHI A;  4KIS A;  3DP7 A;  4AYB N;  1I39 A;  2KIQ A;  2ZFW A;  4QIW N;  1U78 A;  1A35 A;  2BY2 A;  5J4V A;  1B72 A;  2A69 F;  1R5I D;  3HC7 A;  3D1N I;  3VFZ A;  2GOM A;  1B72 B;  4XM3 A;  3AKZ A;  2CQK A;  1Y1V J;  2LTP A;  3K70 C;  1BOB A;  3OV8 A;  4CHU A;  4LGW A;  3OL3 A;  2LY9 A;  4RBO A;  2VBZ A;  4LB5 A;  3IRQ A;  1K6O A;  1PP8 F;  2L7K A;  4JP0 A;  2HOS A;  4UUT A;  1WGX A;  2O5R A;  4P9U A;  1TW2 A;  3S3M A;  3IWF A;  3CCM I;  3TED A;  3I0T A;  3H0D A;  1P92 A;  1Z67 A;  1FMV A;  2STW A;  3KP4 A;  4IHX A;  1BIA A;  5F0C A;  3VPR A;  2WB1 N;  3HBL A;  4RDU A;  5ERI A;  1XCV A;  4BJ5 C;  1H89 C;  4XSX F;  2R7T A;  2PJP A;  3QYB A;  2QQ8 A;  3F23 A;  2IS2 A;  3VSL A;  1B8I B;  3FMQ A;  3PFI A;  3WU2 C;  4LJZ F;  4XLF A;  3T8R A;  1ETQ A;  3JRA A;  2PJR A;  2LBF A;  2E7W A;  5K5R A;  3CCQ I;  3KZZ A;  2XC7 A;  3X2Q H;  1HC8 A;  3DEE A;  5C4X J;  2DOF A;  2PJR B;  2GAU A;  1RQ6 A;  2GIZ A;  1JT0 A;  4ZJZ A;  1WJ5 A;  4F55 A;  2HKO A;  1OMI A;  2G7U A;  1LFU P;  2EH3 A;  3VEP A;  4EV0 A;  5ICG A;  2GM4 A;  2HQN A;  2OCE A;  3F6V A;  5GPA A;  5EG0 A;  3LOC A;  5FFX A;  3TW6 A;  3AG4 H;  3RPU D;  2R0Q C;  1RR8 C;  1LE8 B;  3GW2 A;  3OYG A;  1P4A A;  2VJ4 A;  1QNT A;  3M1C A;  4FT8 A;  3SHF A;  3L2V A;  1ZQ3 P;  3O8H A;  5FLM J;  4GO1 A;  2IBD A;  2CRG A;  3ZQ7 A;  4L5I A;  3S2H J;  1TQM A;  3UR3 C;  2XAJ A;  2D1H A;  2VT2 A;  2JRM A;  1VZ0 A;  4M6V A;  3JRH A;  5DTD A;  2O61 A;  4MFE A;  1ZLK A;  2Z9O A;  2KIU A;  2LC2 A;  2R7S A;  3IUO A;  2KLO A;  4D9J A;  2VC0 A;  2H6B A;  3KET A;  1IG7 A;  1I27 A;  3TOA A;  5D4R A;  2YX4 A;  5DV5 A;  1MD0 A;  4WXH A;  2HNH A;  5EEH A;  2KKO A;  2JWT A;  2JT1 A;  1FYK A;  2OTL I;  3J7A O;  3RDI A;  1Z77 A;  2WAE A;  2FD5 A;  2GLO A;  5KCM A;  3K4L A;  1PP7 U;  1JI8 A;  3BDD A;  3HG9 A;  2BVL A;  2WC2 A;  2Z16 A;  4PJL A;  5EEA A;  1MBK A;  5CVU A;  3F0C A;  1VFC A;  4A3G J;  3LSP A;  4XN0 A;  2ZNZ A;  4N0B A;  2HVR A;  2DBB A;  4BDY A;  1SFE A;  4L0Z B;  2KFD A;  3G1M A;  3IH4 A;  5H2F C;  3PL8 A;  2MAB A;  2QA4 I;  3J7Z I;  4E7L A;  4FAS D;  1ODD A;  2E35 A;  1JJ6 C;  4BDZ A;  4OWR B;  4P55 A;  2NVY J;  4BE0 A;  5J1U A;  3OOP A;  4JK1 X;  3HTS B;  2DT7 B;  4PCQ A;  3GFM A;  3ZMU A;  1AWC A;  3O6B B;  4Z2Y A;  4M3B A;  3CCY A;  1QPI A;  1MSF C;  3JAM R;  2M7B A;  2M3A A;  4V19 K;  2HYJ A;  1TQI A;  2IXS A;  3WU0 A;  3GFL A;  5E3L A;  1MNM C;  4IHY A;  1DP3 A;  1FBU A;  4KIF A;  2CW7 A;  5ILU A;  3H3U A;  2L0K A;  2DDB A;  2QM3 A;  1FIP A;  5D5X B;  2NVT J;  2BXY A;  2P7V B;  3J80 Z;  3A4C A;  1HKQ A;  3U1K A;  1WJB A;  4IJA A;  3LSR A;  2C6Y A;  4KIB A;  5AON A;  1E3H A;  1NK3 P;  4AWX B;  1JUS A;  1K79 A;  2RNG A;  2PG4 A;  3VOD A;  2DYR H;  5ILV A;  3CJT B;  1E3P A;  2R7U A;  4RM2 A;  2J5P A;  3SDB A;  2GQQ A;  1X1A A;  1BR2 A;  3BCB A;  4FET A;  2YU9 J;  4PZJ A;  3GUD A;  4UB8 C;  3WE2 A;  2M5W A;  1R23 A;  3L2R A;  2FEZ A;  4XR6 A;  3CCV I;  1G4D A;  4DJA A;  2WAQ N;  1QHH D;  4IEJ A;  5D6E A;  3L2C A;  1Z7U A;  3E97 A;  4YFK F;  4RMN A;  4D1Q A;  1UST A;  4B3A A;  4IX7 A;  2XUB A;  1KYW A;  4N9H A;  3RTR A;  1W36 D;  1YI2 I;  1G3S A;  4QWQ A;  3TW7 A;  2FRH A;  3FXJ A;  4LG0 A;  1R1V A;  3R0J A;  3R4K A;  1ZK8 A;  2Y0S N;  3CC2 I;  1MJA A;  4LG0 B;  4QPO A;  1X58 A;  2CUZ A;  3WTU C;  3N4M A;  5J4Y A;  1XGO A;  1FT9 A;  3RZO J;  4UVA A;  1BR4 A;  4I2O A;  4ON0 A;  1BI2 A;  1FY7 A;  3MFK A;  2V9K A;  1V55 H;  1TWG J;  3KYD B;  3GZ5 A;  2L7M P;  4QSH A;  3QPS A;  4UUS A;  3TP0 A;  2ZXI A;  4A12 A;  4HPQ A;  1BR1 A;  4AUX A;  1QVU A;  3HZJ A;  4LLL A;  3DLA A;  4UUS B;  3M8J A;  2P0W A;  4JBA A;  1I5Z A;  3EQL F;  4CXF A;  1GDT A;  3PO2 J;  3S16 J;  2CYY A;  4I98 B;  2HDC A;  3WTV C;  2IAI A;  3DQV C;  3PIO F;  4G9Y A;  4U0V A;  2WAQ A;  3TBI A;  3E6B A;  1QVT A;  2PFB A;  1FP2 A;  2DI3 A;  2CV0 A;  1FX7 A;  1MSE C;  3IHU A;  5EEG A;  2WAD A;  3DLL F;  1P2F A;  5B3S H;  4XRS A;  3BPV A;  2GA2 A;  2DMT A;  3TP3 A;  2M45 A;  2PEX A;  4ASN A;  4ZDP A;  1U5T A;  3LQQ A;  4ESB A;  3GBG A;  2KJC A;  1FEX A;  3ZQF A;  1RI7 A;  1U5T B;  5K7Z A;  2Y0S A;  2COB A;  4S0H B;  2XRO A;  2DMP A;  4B8X A;  1STZ A;  2M0M A;  2XHK A;  4M3E A;  3V7S A;  2A61 A;  5JVG F;  1XB4 A;  3SFZ A;  2XB0 X;  2ME0 A;  3KP5 A;  4LK1 F;  2IS6 A;  2VPR A;  3B73 A;  2FF4 A;  3RYP A;  1U2W A;  4A3C J;  1XC5 A;  4PSX A;  1VQ4 I;  5K5Q A;  2NOG A;  3FK7 A;  1LQ1 A;  3KIO A;  5H6R A;  1HKT A;  2ZJP F;  4BY1 J;  1D1A A;  2GOX B;  2KRF A;  3L09 A;  2O6G E;  5D5U B;  1DU6 A;  3TDU C;  4DBQ A;  1JUP A;  3G4S I;  4XOP A;  1ZAR A;  2HXI A;  1K7A A;  1XGN A;  1IO2 A;  5FKN A;  1DU0 A;  2ECC A;  2A6T A;  2CU7 A;  3MKZ A;  3C7J A;  2WWY A;  3U1D A;  2GBY A;  1U3E M;  4KNY A;  2NXN B;  4NUB A;  4RGR A;  2XAH A;  4M9S A;  3H3V K;  1EF4 A;  4J19 A;  3TGN A;  3R0A A;  1A36 A;  4C3J J;  2LF7 A;  1LVA A;  4IQ4 A;  1X4O A;  1UHS A;  2EFN A;  1F43 A;  2E34 A;  5FB2 A;  3DTI A;  3ZQL A;  1ETO A;  2D5V A;  4EAT A;  1K4S A;  1N77 A;  3AL0 C;  1GHC A;  4KIT B;  3PFY A;  4JYK A;  3JRC A;  4MO7 A;  2FXA A;  3QOP A;  3ZQG A;  3EYI A;  2K3F A;  4ANJ A;  1NG7 A;  4MNU A;  4DYC A;  4ZDL A;  5CVV A;  4HSR A;  5IT9 K;  1A6Q A;  2X48 A;  2YPR A;  3BG6 A;  1CGP A;  1POG A;  4WCG A;  4EJW A;  5LBQ A;  3CCU I;  2E36 A;  1GT0 C;  1FC3 A;  1MJB A;  3WTX C;  2QQA A;  3DPL C;  3CJN A;  4RB0 A;  1U0J A;  3LSI A;  3BZC A;  4CZC A;  3S3N A;  2X6W A;  1GV5 A;  3HUG B;  1W7P D;  1R4M B;  4ZYH A;  5IPA A;  4U0Y A;  5HLT A;  3CUQ C;  2EV6 A;  1LUJ B;  2R92 J;  1ETY A;  1NG6 A;  3M7G A;  4Y7N J;  1B6A A;  1S7O A;  3GVA A;  2CGP A;  1W7P B;  2VC1 A;  5DD8 A;  2CW0 F;  4P9F A;  4B44 A;  3I4M J;  3L7W A;  3IH2 A;  4DNC A;  4M9X A;  2CJJ A;  3CDI A;  5A2Q K;  1IW7 F;  1WJE A;  4DYQ A;  2HYG D;  4FE4 A;  4C3I J;  2OJE D;  2OAZ A;  1O7L A;  2M1B A;  1K6Y A;  5DUI A;  2VL8 A;  4DZP A;  1YS6 A;  2QWW A;  4PFP A;  4BEH A;  1WH5 A;  3OYE A;  4AIK A;  2HEO A;  3KEY A;  2OC6 A;  4HA8 A;  2HZT A;  5BPI A;  1H9G A;  2GXG A;  4BEH B;  4RLQ A;  3WTT C;  3TMO A;  1UMQ A;  1OPC A;  1J2X A;  3SDG A;  5IYB J;  3RKY A;  5CQE A;  1HW5 A;  3CCL I;  3LQR A;  2XSD C;  4P96 A;  4A3M J;  4NB5 A;  1RUN A;  5HLG A;  1R1T A;  3KX2 A;  1I6H J;  5JLW A;  2L9V A;  5E18 F;  2HS5 A;  5CQG A;  2QSH X;  1F4K A;  3ZXS A;  3COA C;  1XMK A;  2P5V A;  2XF5 A;  5L3C A;  3OOU A;  1OR7 C;  4K2E A;  4YII A;  4CCN A;  2F4O B;  4Q48 A;  4I09 A;  5CJ9 A;  5B1B H;  2RVC A;  2Y9Y A;  5DDG A;  2L2O A;  2FQ4 A;  5DS9 A;  1YE9 A;  3HRU A;  3QPL A;  2MUN A;  3ZR8 X;  1OFC X;  2FA5 A;  5FFZ A;  2Z1D A;  1WJD A;  2JN6 A;  3BG7 A;  3JCU C;  1MMN A;  2DFE A;  2R7F A;  3QWL A;  2ETH A;  3GYH X;  4LLN A;  2O3F A;  1PUE E;  2CS3 A;  2VQG A;  1AU7 A;  2ZKZ A;  2M30 A;  4RLF A;  2NS7 A;  5L3G A;  4I01 A;  3KZI C;  1IRG A;  3A0B C;  3FZV A;  2EIM H;  3M3Y J;  3ELK A;  4GYG A;  2XGD A;  3RJP A;  1YW7 A;  4RB2 C;  3A2K A;  1QZZ A;  1P6R A;  4M73 A;  1ETV A;  2ZXH A;  2OF7 A;  4XSZ F;  5LRS A;  2CQN A;  3TKY A;  4A0Y A;  3LWF A;  3KEQ A;  3M8E A;  1QRY A;  1TTY A;  2X6Y A;  2RNJ A;  2W7N A;  4AVP A;  4Y3O A;  5LHG A;  2V7F A;  3JRF A;  4L9J A;  2GA1 A;  3HRM A;  4HNU A;  1F36 A;  1ORK A;  3BJ6 A;  1SD7 A;  4Q47 A;  3PQJ A;  3OYN A;  4E7I A;  5EDN A;  2E1C A;  1VQ8 I;  1ZG5 A;  3A0H C;  3EET A;  2ECB A;  3QU3 A;  4UXN A;  3OYF A;  2PMZ N;  3DU5 A;  4S05 A;  3JSP A;  3WTW C;  4F3Q A;  2YUS A;  2IGN A;  1TL8 A;  2ISZ A;  2FBK A;  1IXR C;  1O57 A;  2XAF A;  3OR2 C;  1LFB A;  1QZY A;  2R7D A;  3H5A A;  2ZME B;  4LD5 A;  4A3E J;  2ESH A;  3N05 A;  1Z21 A;  3S32 A;  2EIK H;  2JA2 A;  5E20 A;  4NHJ A;  1VND A;  2P6T A;  2I10 A;  4DZJ A;  4HLX A;  3ZRG A;  1AHD P;  3U21 A;  1D1B A;  2R7Q A;  2A6E F;  1OCR H;  2G0E A;  3I56 I;  3L9F A;  1Z9C A;  4BJT A;  4QPQ A;  5EYR A;  1DP7 P;  2VQC A;  1RES A;  4Y13 A;  5JLX A;  2K4J A;  3C1D A;  2R7R A;  3GO5 A;  2Z5U A;  3HOW J;  2LP0 A;  3E5X A;  1MMG A;  1TW3 A;  3AG1 H;  5C4J J;  2E1O A;  5EF6 A;  5D5W B;  1SFK A;  2V9V A;  4D7M A;  3Q9V A;  1OYW A;  2TDX A;  2YS9 A;  2PMZ A;  5GAD J;  4FQG A;  2DYS H;  2E2I J;  2XGX A;  5FLV A;  1IV6 A;  3L2U A;  4BXX J;  1ITY A;  2P4W A;  3PUF A;  4R79 A;  1TZL A;  3ZQH A;  4Y4R A;  1TWC J;  1TQP A;  5IP7 J;  5LGU A;  1MDM B;  4IKF A;  2EWN A;  4G6Q A;  5HNF A;  1ZR4 A;  4G6D A;  3S1Q J;  3LA7 A;  1SAX A;  3RKQ A;  3P7N A;  4DIQ A;  4A3L J;  2FQ3 A;  5F6F A;  1TWA J;  4I6Z A;  2UZK A;  1R5H A;  3FHN A;  5CLS A;  4PUS A;  3GTO J;  5HS7 A;  2R7V A;  1ERD A;  2L4A A;  4E7H A;  3GWZ A;  1VI0 A;  5D6F A;  2DJN A;  1TP4 A;  3EYY A;  4N4O B;  1SMT A;  1VQ5 I;  2M87 A;  2B7E A;  2QLZ A;  2K02 A;  3ESW B;  3T5X A;  1FSE A;  3TO6 A;  2MZ4 A;  1NK2 P;  3DTK A;  4EEF G;  1B4A A;  5FLX R;  1P7J A;  4N4N B;  1S7A A;  3BR0 A;  5F1J A;  3F6O A;  4KIC A;  1MNE A;  2L7Z A;  5IP9 J;  2F4I A;  2M34 A;  3I59 B;  1B1B A;  1RIO H;  1JTY A;  4MGR A;  5JI6 A;  2R93 J;  1BN5 A;  5EGO A;  2CQQ A;  1HST A;  1O3S A;  3I58 A;  1LFP A;  3J7A Y;  1R7J A;  2G7H A;  3I55 I;  1S7E A;  3EDP A;  4C30 A;  3OS0 A;  3ZMS A;  2LR8 A;  2LF8 A;  1SAN A;  2W25 A;  4YFN F;  2MG4 A;  1KQ8 A;  1ZKG A;  3SEQ A;  1FLI A;  1XGS A;  4XLN F;  1IDY A;  3PM1 A;  2HI3 A;  3GZN B;  2UWM A;  4CYC B;  2QVO A;  2KZV A;  1A5J A;  2X4H A;  2COM A;  3K4M A;  1Y8R B;  1VQO I;  1OIS A;  3S93 A;  4ZH4 F;  1X1C A;  5DCF A;  1D0X A;  3H5R A;  3VYU B;  1ETW A;  1XN7 A;  2P0T A;  4BQO A;  2GZW A;  4XRM A;  3MEX A;  2H8W A;  2VBW A;  5K7F A;  3S1R J;  4L9T A;  4B4C A;  2DFF A;  3GFI A;  3L1P A;  4EGZ A;  3VOE A;  2CQX A;  5B66 C;  4IRH A;  3CME I;  4A6D A;  2FX0 A;  3S3O A;  2DA4 A;  2KP6 A;  3D5S C;  5CVI A;  4X1E A;  2W4S A;  5GAH J;  2Y69 H;  2Z33 A;  5EJC A;  3EPZ A;  1SFX A;  4A3B J;  4A2U A;  3NEU A;  2EFP A;  1K78 B;  2XAS A;  3OYA A;  2JMW A;  3C2B A;  1VF9 A;  1RR7 A;  3EUA A;  3CLO A;  3DWL E;  4GYI A;  1VQK I;  2F5V A;  4XLH A;  2KIS A;  2W84 A;  4D5F A;  3CC7 I;  2E71 A;  4E6K G;  2EFQ A;  3C18 A;  3C2H A;  1B8I A;  3DKX A;  5D5V B;  4XID A;  1G2H A;  2VON A;  5E8I A;  3OYK A;  1WKM A;  4AYB A;  2W48 A;  4KJZ A;  2MC3 A;  1YYV A;  1RUO A;  1GVD A;  3OS2 A;  3ABK H;  3LSJ A;  1SVO A;  1FIA A;  4IF4 A;  1YW9 A;  2V1N A;  3OYL A;  3HXL A;  4AIJ A;  3ZMV A;  1Q1H A;  4MTD A;  2LRD A;  3BR6 A;  2IPQ X;  3RKW A;  2ZO4 A;  1YIJ I;  2QKL B;  4BBS J;  1USS A;  2DK5 A;  2NYX A;  4U7D A;  3I4P A;  4BU2 A;  4KT6 A;  3P9C A;  2JZY A;  4L5J A;  4IO9 F;  2DPD A;  4BXF A;  4PFO A;  1ZRE A;  4WXC A;  4PJM A;  1R58 A;  1LEA A;  2DJI A;  2Q0O A;  3KP6 A;  2G9W A;  2DDA A;  4Y52 J;  4ENK A;  4PJN A;  1HOM A;  1LE8 A;  3R6S A;  1L0O C;  2DN0 A;  1ULY A;  3MZH A;  3H5N A;  1KQ0 A;  1T98 A;  4G7Z F;  2WV1 A;  3EUK L;  4BQQ A;  4D5C A;  1EA3 A;  3RPU A;  1PJR A;  2WB1 A;  2JUC A;  3FHZ A;  3FMS A;  1QQI A;  3WTY C;  4FTH A;  1T0F A;  3JTH A;  2IS1 A;  3FBN B;  2ZXW H;  2PQ8 A;  2Z99 A;  1QA6 A;  1VQ7 I;  3VYR B;  2KIM A;  3KYC B;  5KHD A;  2XIG A;  3O8G A;  2CFX A;  2EV5 A;  1G3W A;  3GXO A;  3FXL A;  1MGT A;  1YW8 A;  4F52 A;  3K70 D;  4YG2 F;  2E19 A;  3TQN A;  1UHW A;  2QQ9 A;  4RA2 A;  3IKV A;  1TLH B;  3QU6 A;  2I8D A;  5J6X A;  1R6R A;  5J1Y A;  1RNL A;  2XKP A;  5FKL A;  1JXS A;  3HOX J;  2VB6 A;  2O03 A;  1O3R A;  5A2Q Z;  1BW5 A;  2IJL A;  2BV6 A;  2W00 A;  2CUJ A;  5TJJ A;  2KMU A;  3MKW B;  3CP8 A;  2MSY A;  2XF6 A;  4L9N A;  1YOV B;  2QGU A;  4HV6 A;  3OMY A;  3CF2 A;  1DDN A;  2M35 A;  5CVJ A;  2X1C A;  1OYY A;  5ILS A;  2DOD A;  3WE3 A;  1FOX A;  2LLK A;  1Y6I A;  1QZE A;  3LST A;  2FOK A;  2DU9 A;  2KHM A;  1V4R A;  1XSV A;  3UNG C;  3VSK A;  1XCB A;  3BG9 A;  3H9Q A;  4LIT A;  2M8G X;  3W6K B;  2LSO A;  4A3K J;  3MCZ A;  2XRN A;  4UVC A;  2ZBK A;  1O3Q A;  2BVM A;  2LH9 A;  5TIS C;  3QYF A;  4CCM A;  5E17 F;  2ESN A;  5HOO A;  3K1N A;  4XKW A;  3DTE A;  5FRO A;  3GF2 A;  3J80 R;  1RPW A;  4UV9 A;  2O0Y A;  2AXL A;  2ZNY A;  3CCR I;  3BRO A;  3MZ8 A;  2ACJ A;  3WHB A;  4EJU A;  3FKI J;  2X51 A;  3WTZ A;  2F48 A;  5IY5 H;  1M1E B;  2VKD A;  2KDZ A;  3MKY B;  3DU6 A;  1TT5 B;  3GME A;  1ZN2 A;  1QBJ A;  3MZY A;  3HSE A;  4GXO A;  1IRX A;  3DKY A;  3KLN A;  3BP8 A;  2JPC A;  1U5T C;  4EGY A;  4D7N A;  3GTG J;  1BBY A;  3HSR A;  1R36 A;  3JRE A;  4B09 A;  3DBH B;  4M71 A;  2EA4 A;  4WXD A;  3WGG A;  2DT6 A;  2HU9 A;  2ISY A;  2K27 A;  2RQQ A;  1ZYR F;  2QCO A;  3I54 A;  5JHF A;  2H09 A;  3EUH A;  4YEJ A;  2A3S A;  1U8R A;  4A3D J;  1V5G A;  4H4K C;  4OU0 A;  2VBX A;  5H20 A;  1I3A A;  1I50 J;  3TOB A;  2DLL A;  3I64 A;  4CYD A;  2KT0 A;  4IHW A;  2HOT A;  4AC0 A;  4JX6 A;  1YIO A;  4G8X A;  3KFW X;  1WH7 A;  5E3M A;  3BR5 A;  5HLI A;  2OPT A;  3QP5 A;  1S5L C;  2MH9 A;  3TO7 A;  1J59 A;  2OBP A;  2E7X A;  3QOE A;  3SZT A;  2DAO A;  1DUX C;  3E0J B;  1KU9 A;  3HOS A;  5HS8 A;  1UZC A;  2L01 A;  1IN5 A;  2DO7 A;  1X2M A;  1MND A;  4LB6 B;  4M6Y A;  4FX4 A;  3BJA A;  4XMY A;  4HW0 A;  2UUZ A;  3FMR A;  1ZH5 A;  4M3F A;  2A68 F;  1VQM I;  1KU2 A;  2QF7 A;  5IYC J;  4L5E A;  4V2G A;  2VJI A;  2ZFU A;  2FBI A;  2VKH A;  3H92 A;  3RI4 A;  3S1N J;  1SC7 A;  2CSO A;  1OJL A;  4KUM A;  4RGX A;  3VWB A;  3O2P E;  5F0H A;  3FXU A;  2K9M A;  1S29 A;  3PNV A;  4II3 A;  4CCL A;  1R00 A;  4ZYD A;  1TWH J;  4LIV A;  3GCM A;  2BY0 A;  4W97 A;  1A31 A;  4C3H J;  4CUG A;  2MD0 A;  2Y0M A;  2BHY A;  3BTI A;  1QGP A;  5BNG A;  1D8K A;  2Q1Z B;  1T6S A;  1E0E A;  1HLV A;  5FKM A;  2A5W A;  2RGV A;  1FPQ A;  1KQ9 A;  4OMY A;  2I5U A;  3CDL A;  1WCM J;  3J81 K;  1RKT A;  4XKV A;  3CCJ I;  1ZRD A;  2UXX A;  4BE1 A;  3K10 A;  2B9S A;  1X1P A;  4BY7 J;  3LNQ A;  1E3O C;  2Q2E A;  2QSF X;  3BTJ A;  4ZC3 A;  3J7A W;  4I7H A;  2L9R A;  5CYV A;  1APL C;  3BPX A;  1UFM A;  5F1R A;  2LYC A;  4CCK A;  2Q2E B;  2LY2 A;  1UHM A;  1J09 A;  3IP4 B;  2K5C A;  3KP7 A;  2DMU A;  4AIH A;  4CO8 A;  2XB5 A;  4AU7 A;  1BJZ A;  2DTR A;  5H6Q A;  2VUM J;  3WGI A;  3HHH A;  2H6C A;  4P1W A;  2DPU A;  4YIF A;  3F72 A;  2BW3 A;  2P7C B;  1DPU A;  1ZRF A;  3F8B A;  2AS5 F;  1E2X A;  1VQP I;  4L0Y B;  1FTZ A;  2RC4 A;  2BW3 B;  4HQE A;  1YIT I;  2JTV A;  2MLG A;  2CO5 A;  1KZH A;  1G6N A;  3HM5 A;  1XDS A;  2K9L A;  2JA8 J;  5GTI C;  2HFH A;  3TDZ C;  1S9H A;  1PVE A;  1Z1D A;  3PJR A;  4IL6 C;  3CTA A;  3IH3 A;  4U88 A;  3IC7 A;  5K1Y A;  3N97 A;  3JRG A;  3HSF A;  1TWF J;  4FCY A;  1SD5 A;  2M7A A;  2XVC A;  2X6O A;  3QP6 A;  4GCV A;  2XPU A;  1NTC A;  1T08 B;  3ASN H;  4DOZ A;  2Y31 A;  5DM7 F;  1XPX A;  1LDJ A;  1F5T A;  4LMY A;  4HV5 A;  2DOE A;  1MBF A;  2E1M C;  4BJ6 C;  4EM2 A;  4BAY A;  3HUG A;  1NH3 A;  3IAS 2;  5L3E A;  5J40 A;  3K6G A;  3Q3S A;  4S04 A;  3BR1 A;  2L4M A;  3IV5 A;  2X85 A;  3BT9 A;  3HB9 A;  3MD2 A;  3LL7 A;  5HDK A;  1UJ8 A;  2FU4 A;  3F9K A;  1W7P A;  2EA2 A;  4UUV A;  4HRI A;  2GXA A;  2O7O A;  3DBL B;  1YX3 A;  3K69 A;  3A01 B;  2DA7 A;  3QYE A;  4XKB A;  4MEX F;  5BS6 A;  3W6J B;  3H9J A;  1BM9 A;  3DEU A;  2Y9Z A;  4II2 A;  5FJ8 J;  3A03 A;  2VLA A;  2F6C A;  2F5C A;  2TCT A;  3K7A J;  4C2M J;  2OV7 A;  3NQO A;  2FNA A;  4U0W A;  5D8L B;  3CMM A;  1RET A;  1DPR A;  4BXU A;  1D3Y A;  3WG9 A;  3M07 A;  5B5E C;  2M9H A;  4HG2 A;  1E17 A;  4LIU A;  3HJE A;  2K3P A;  3M8F A;  4FX0 A;  4XOR A;  6PAX A;  1A6I A;  5HOD A;  5IOZ A;  2R5Y A;  1YLF A;  4YRV A;  3V8K A;  3WOD F;  2GWR A;  4C2U A;  1WI9 A;  1S8N A;  3K4B A;  3BQY A;  2R5Y B;  2JK3 A;  1F9N A;  1TNT A;  3G2B A;  3C2G A;  1JUM A;  2IA1 A;  4IOC F;  2M2E A;  1IRZ A;  4RB3 C;  5AIP A;  5DM6 F;  2ELH A;  3L2Q A;  1D5V A;  2H8R A;  2DMQ A;  2IP2 A;  1YJ9 I;  1IDZ A;  3CF5 F;  2XSJ C;  3GTM J;  1ZGW A;  3CLQ A;  2ICW G;  5LGT A;  2HVS A;  5GAE J;  1OCC H;  2EZK A;  3DCF A;  1IZ1 A;  1IN6 A;  2X1E A;  4XNF A;  3S15 J;  1V5F A;  2HDW A;  5E3N A;  3D5L A;  1FMW A;  1I6X A;  3NWS A;  5M5W J;  1XSD A;  3HRT A;  4HDV A;  4XBF A;  1ETK A;  3LSK A;  1N25 A;  4A5M A;  1TBX A;  1RC9 A;  4KT5 C;  2L3D A;  1RRJ A;  4EQQ A;  3S8P A;  3AL0 B;  1SVL A;  2VKV A;  2FUG 2;  3GZ6 A;  1LVK A;  3LSM A;  2EBI A;  1UB9 A;  4CDG A;  1N78 A;  4L9V A;  4HNT A;  1Y39 A;  3FBI B;  3CMA I;  3OR1 C;  5L3D A;  3TL4 X;  4ENJ A;  1HCR A;  1FOK A;  3F8N A;  1W5T A;  4BE2 A;  2V1D A;  4R1H A;  4N9I A;  4IHV A;  4I76 A;  1X4P A;  3DKW A;  1NHA A;  3JAM K;  3KP3 A;  4EJT A;  3LAP A;  1FTT A;  3A02 A;  3ASO H;  1VQL I;  5KAF C;  4IHT A;  2VJJ A;  5IT3 A;  5E79 C;  2DOA A;  4IZZ A;  1R22 A;  3HOZ J;  3CUO A;  1OKR A;  3CUQ B;  5D8K B;  3QAH A;  4BHB A;  1S72 I;  1W0U A;  5FRN A;  2R7X A;  1SFO J;  3LSG A;  2O8X A;  4LLG F;  4MEY F;  4WK8 F;  2WBM A;  3G3Z A;  3F8C A;  1WFX A;  4WF2 A;  2AXT C;  1JKQ C;  2IA0 A;  3OYJ A;  2K4B A;  2ZME A;  4E7Z A;  5HVQ C;  1HDD C;  4HST A;  2RRE A;  3KPH A;  4GRI A;  3B02 A;  3GTQ J;  1A04 A;  1BI3 A;  2JQ7 A;  4E70 A;  1P4W A;  2NNN A;  2ME6 A;  2LY1 A;  3KE2 A;  3I3L A;  3CZ6 A;  2JA7 J;  1X1D A;  3HTU A;  3ZN0 A;  2LVS A;  2RN7 A;  1DGW Y;  3K9T A;  1EH8 A;  4E7S A;  2VOO A;  4OIO F;  4B48 A;  1K83 J;  2KPM A;  1MBH A;  2JVH A;  2XAQ A;  3CO7 C;  5IOY A;  2HQR A;  1OCP A;  4M3G A;  2NVU B;  2EZH A;  4PSW A;  2L9S A;  1IXS B;  1YRN A;  1HSJ A;  1GXQ A;  4RAY A;  1HF0 A;  1HQC A;  4FHT A;  2MBF A;  4FE7 A;  3Q0W A;  2VXD A;  4IQJ A;  1FBS A;  1YRN B;  2Q8K A;  3J7Y J;  5C44 J;  3SJM A;  2GIV A;  4UV8 A;  2BGC A;  3FX3 A;  4HQM A;  2XAG A;  1D8J A;  1ZLJ A;  3P9I A;  3I9V 2;  4XK4 A;  5GPC A;  1TNS A;  3NAR A;  3ECH A;  4ESF A;  4BBR J;  2V79 A;  4ESJ A;  2XRL A;  4EMS A;  1K4T A;  2FOW A;  1Y56 A;  2A6H F;  1TT0 A;  4EJV A;  5E1W A;  1Y1W J;  1MDM A;  4G6T B;  3IAM 2;  3JR9 A;  3WTS C;  1G59 A;  2WV0 A;  1FZP B;  4BHP A;  2QYO A;  4GDF A;  2JVG A;  4HF1 A;  4I0A A;  2VXZ A;  2CG4 A;  4O3M A;  2LG4 A;  3SEZ A;  1H0M A;  4HF0 A;  3PSF A;  4RAZ A;  2HGC A;  2JRT A;  1XMX A;  2F5D A;  2FE3 A;  3BY6 A;  3ECO A;  1BA5 A;  3D0S A;  2K7L A;  4NC6 A;  2F5E A;  3ZN1 A;  3GFJ A;  3Q0V A;  1JKO C;  3OWT A;  3S2D J;  3I4N J;  2H1L A;  2RKH A;  3HEF A;  5IYD J;  5JVT A;  4JX4 A;  1GLN A;  2FML A;  1WJA A;  1ACI A;  4ITV A;  3T0Y A;  1SAU A;  1QO0 D;  2ZSI B;  4CIC A;  1G8X A;  1U8B A;  3FDY A;  2HQ5 A;  2X6X A;  3LA2 A;  4I99 C;  2P8T A;  3IL2 A;  2OU2 A;  3I59 A;  5L3B A;  4CSW A;  2D1V A;  5J3L A;  4IHS A;  3HL2 A;  5DCM B;  1KGS A;  1YX5 A;  4G7H F;  3K2A A;  1KU7 A;  4HEA 2;  2IGO A;  2X1D A;  1P7I A;  2OCC H;  2WA0 A;  4MTE A;  1YJW I;  4ABZ A;  5ICE A;  3KP2 A;  2XGE A;  3BJO A;  3M9A A;  3SZP A;  1LDK B;  4EVI A;  2OZ6 A;  3E6C C;  2DFH A;  2ID3 A;  5B1A H;  1ZR2 A;  3D5R C;  2ZB9 A;  2IEK A;  4XRF A;  1ENH A;  3R61 A;  1B9M A;  1X1B A;  2LKP A;  4CYC A;  2JSP A;  4HBL A;  4WX9 A;  2E60 A;  2LMD A;  2ZJQ F;  3W6V A;  3BQZ A;  3W2V A;  2K40 A;  5LRR A;  1UG0 A;  3K1M A;  4HX4 A;  5KAI C;  1SFU A;  1D0Z A;  2LDU A;  2VJ5 A;  3B6A A; 
#chains in the Genus database with same CATH homology
 4KMF A;  4BNC A;  3KZY A;  4QLC U;  5F64 A;  1T2K A;  4M72 A;  5CVR A;  1G3T A;  3CO6 C;  1IAW A;  1XMA A;  3PQK A;  2RDP A;  3FM3 A;  3U9G A;  4I02 A;  4IRI A;  3F3X A;  1SMY F;  2MA3 A;  1QPM A;  1B9N A;  2DQL A;  3WGH A;  2X0L A;  1K78 A;  1UCR A;  1SD6 A;  3J81 Z;  2VT3 A;  3IKT A;  2NAZ A;  2KIF A;  3BOQ A;  3TO9 A;  2DQR A;  2BE5 F;  3ERE D;  1P4X A;  3ZMZ A;  4P5O A;  2IVM A;  1FNN A;  1R5G A;  3Q9S A;  1J75 A;  2PI0 A;  3E5U A;  5FD6 A;  2DW4 A;  2OZU A;  1LB2 A;  5K5O A;  2FNP A;  4JQF A;  4KN7 X;  3ISP A;  1J7K A;  1XSX A;  5DYM A;  1FSH A;  1MKM A;  2YU3 A;  1ON2 A;  4NQW A;  4RS8 A;  4KIG A;  3LFK A;  5ED4 A;  1Z6R A;  2F2E A;  4A0Z A;  4M6X A;  2J5O A;  3ZPL A;  2FSW A;  3K0L A;  1J5Y A;  5IT9 Z;  4G7O F;  1BI0 A;  3K1P A;  3RYR A;  3ZMT A;  2QQB A;  3S2W A;  3F21 A;  4Y15 A;  4LK0 F;  4CZZ A;  1YQA A;  2IT0 A;  2L02 A;  2W24 A;  4DQ2 A;  3HIF A;  3I5U A;  4MHG A;  5BQT A;  4A0X A;  2XKO A;  2QUF A;  2EK5 A;  2ADU A;  1WWX A;  1ONV A;  1IXC A;  3RIR A;  2BYV E;  2NNY A;  3ML6 A;  2EJR A;  2PMU A;  4XLP F;  4HLY A;  3FF5 A;  3VB2 A;  2EFO A;  2V1X A;  1YO5 C;  2RQP A;  5LEJ A;  2D45 A;  3U2R A;  2MLK A;  1PDN C;  4EM0 B;  2MH2 A;  1T38 A;  2BEO A;  3T1B A;  1IF1 A;  2YR2 A;  3F8M A;  3QRF F;  1ZRC A;  4A6E A;  3F22 A;  1XD7 A;  1IRF A;  1H9T A;  5LHH A;  4OIR F;  4OIQ F;  4KFC A;  1Z05 A;  3DXJ F;  3NRV A;  1R1U A;  2B0L A;  2Z3Y A;  4RB1 A;  1JGS A;  1HXD A;  4TV7 A;  1YTY A;  1RZ4 A;  5JHU A;  1AOY A;  2EV0 A;  5L3F A;  5AIQ A;  4BQA A;  4L18 B;  2Y75 A;  2BBY A;  4Q4Z F;  4OIN F;  1X3U A;  4EJO A;  5JFR A;  4I0B A;  3ROU A;  3G73 A;  3JAM Z;  4H0E A;  1Z91 A;  2VOP A;  2M8E A;  4ZYE A;  1EH6 A;  5HDN A;  5BOX A;  3CDH A;  2JPB A;  4MQV A;  4G94 A;  2GXB A;  4IPA A;  3QPH A;  3K2Z A;  3QPT A;  3E6M A;  1JHH A;  1Z6T A;  5FLX K;  2HTJ A;  1LDD A;  2K86 A;  3ABU A;  1J9I A;  4HYE A;  1REP C;  1BOA A;  1BI1 A;  1BC8 C;  1LNW A;  2OQG A;  4KN4 X;  2PLY A;  1YS7 A;  4BYY A;  3I53 A;  1F1Z A;  2L54 A;  1S6L A;  3ZMD A;  1J0R A;  1ZGA A;  1MZB A;  4A5N A;  2QBY A;  2Y48 A;  5ICC A;  1FYL A;  1HKS A;  3LA3 A;  5DEQ A;  3ZP5 A;  2QBY B;  4ZZL A;  2HWV A;  2IW5 A;  1JE8 A;  1OYI A;  4RGU A;  1IUY A;  5BPD A;  2YSR A;  1SD4 A;  3FXR A;  5KVR A;  2F5F A;  1ON1 A;  3F8F A;  3BWG A;  4KMU X;  3HHG A;  3FWE A;  4IRG A;  3LAJ A;  3SQN A;  2XV4 S;  5KK1 A;  4ENM A;  4RGS A;  1WRJ A;  2OA4 A;  4AD9 A;  4ETS A;  2P5L C;  1W4M A;  3ABT A;  4EM1 A;  4YFX F;  4BH9 A;  2P5K A;  2LNB A;  2STT A;  2HOE A;  3MWM A;  4O5V A;  3BZ6 A;  3KEO A;  1HW1 A;  1GXP A;  3KLO A;  3C3W A;  5HS9 A;  2YX7 A;  3SXY A;  3GX4 X;  1BC7 C;  1O7F A;  5J8C A;  1U6G A;  5FGM A;  1GVJ A;  4KYW A;  1MJ9 A;  2HYF A;  5DUK A;  2VBY A;  4UNO A;  1FBQ A;  4OIP F;  2HKX A;  2VE8 A;  2DFI A;  1YFH A;  1JHF A;  3DV8 A;  3E5Q A;  1YG2 A;  3O3K A;  3DFG A;  2H94 A;  4GGG A;  1S3J A;  5HLH A;  2OQR A;  5DD4 A;  5BMZ A;  2E1N A;  3L00 A;  3WU1 B;  2PMH A;  3AAF A;  1C0W A;  5LEK A;  2EB7 A;  2WTE A;  2D2W A;  3I71 A;  2PN6 A;  2R3S A;  3E6D A;  2IRF G;  2VE9 A;  4HX8 A;  1IN7 A;  1L3L A;  4BHC A;  3DF8 A;  2DT5 A;  3R60 A;  2V1U A;  1EH7 A;  5ICF A;  3V7R A;  4HZF A;  1HBX G;  4O6J A;  5LGN A;  2NS0 A;  3GEZ A;  3P9K A;  3J80 K;  2MD5 A;  1WSU A;  3V8J A;  4R8H A;  1BIB A;  2DK8 A;  3CUQ A;  5D4S A;  1IN4 A;  1ZG1 A;  4HDU A;  4HF2 A;  1KA8 A;  4KA4 A;  3MAJ A;  5FO5 A;  2ZXJ A;  3JSO A;  2W57 A;  3KCC A;  1EV7 A;  3M1E A;  4IXA A;  4CGZ A;  3HYI A;  3HRS A;  3V7C A;  3MQ0 A;  3JW4 A;  2QEN A;  4LFU A;  3V4G A;  2W85 A;  1LEB A;  4OMZ A;  3H3Z A;  3HOT A;  4PDK A;  5JR3 A;  4U7B A;  2UXN A;  4HOB A;  2ZCW A;  2FBH A;  1OR7 A;  2V6C A;  4OOI A;  2ZJ2 A;  4WWC A;  3IWZ A;  4M9Z A;  5J8F A;  1ZAO A;  2H27 A;  2QZ8 A;  5E1Z B;  2RV8 A;  1CF7 A;  3IRR A;  2VOD A;  4M74 A;  3E3V A;  1FP1 D;  3ULQ B;  1G3Y A;  3Q5F A;  3FXQ A;  1CF7 B;  3T8T A;  1KYZ A;  1ZHF A;  1Y0U A;  4PGH A;  4ZZD A;  3V8L A;  2P6S A;  1T39 A;  2VN2 A;  5FD5 A;  4KDP A;  1HW2 A;  3GLX A;  1B59 A;  2CWE A;  3REO A;  5DCM A;  4HX7 A;  2PBI A;  1ZG3 A;  4Q5S F;  2OD5 A;  3FM5 A;  3JTG A;  1I1S A;  2HR3 A;  1KU3 A;  4D0P A;  1BJA A;  4IVN A;  5LLQ A;  3RKX A;  1IN8 A;  1FYM A;  1WQ2 A;  5E1X A;  2FMY A;  4PGG A;  4F7Z A;  1XDU A;  1LJ9 A;  2JSC A;  1V3F A;  2HTS A;  4UHT A;  5HDG A;  2EFW A;  5FLX Z;  2NRA C;  4UVB A;  1ZGJ A;  3DPT A;  1W5S A;  4ZYG A;  5E8G A;  4MQ9 F;  1O3T A;  1I1G A;  2A5Y B;  5TRD A;  1FWZ A;  2KJB A;  4ENN A;  3RPQ A;  4Y17 A;  2A07 F;  2IA2 A;  4HAM A;  1VTN C;  1XGM A;  5LHI A;  3DP7 A;  1U78 A;  2ZFW A;  2A69 F;  3VFZ A;  2CQK A;  3OV8 A;  4CHU A;  4LGW A;  2VBZ A;  4LB5 A;  3IRQ A;  1K6O A;  1PP8 F;  4P9U A;  1TW2 A;  3IWF A;  3I0T A;  1P92 A;  2STW A;  3KP4 A;  1BIA A;  5ERI A;  1XCV A;  4XSX F;  2PJP A;  3F23 A;  3FMQ A;  3PFI A;  4LJZ F;  3T8R A;  2E7W A;  5K5R A;  3KZZ A;  2GAU A;  2HKO A;  1OMI A;  2G7U A;  3VEP A;  4EV0 A;  5ICG A;  2HQN A;  3F6V A;  5FFX A;  3GW2 A;  1P4A A;  1QNT A;  4FT8 A;  3SHF A;  4GO1 A;  3ZQ7 A;  4L5I A;  1TQM A;  2XAJ A;  2D1H A;  2VT2 A;  2O61 A;  1ZLK A;  2Z9O A;  2KIU A;  2VC0 A;  2H6B A;  3KET A;  1I27 A;  3TOA A;  5D4R A;  2YX4 A;  5DV5 A;  1MD0 A;  4WXH A;  5EEH A;  2KKO A;  2JT1 A;  1FYK A;  3J7A O;  3RDI A;  1PP7 U;  3BDD A;  2WC2 A;  5CVU A;  2ZNZ A;  4N0B A;  2DBB A;  1SFE A;  4L0Z B;  1ODD A;  4P55 A;  3OOP A;  4JK1 X;  3HTS B;  3ZMU A;  3GFM A;  4PCQ A;  1AWC A;  3O6B B;  4Z2Y A;  1TQI A;  3WU0 A;  3GFL A;  1FBU A;  4KIF A;  5ILU A;  3H3U A;  2QM3 A;  5D5X B;  2P7V B;  3J80 Z;  1HKQ A;  4IJA A;  2C6Y A;  4KIB A;  5AON A;  4AWX B;  1K79 A;  2PG4 A;  3VOD A;  5ILV A;  2J5P A;  2GQQ A;  4PZJ A;  3GUD A;  3WE2 A;  2M5W A;  1R23 A;  2FEZ A;  1G4D A;  3L2C A;  5D6E A;  1Z7U A;  3E97 A;  4YFK F;  1UST A;  2XUB A;  1KYW A;  4N9H A;  3RTR A;  1G3S A;  4QWQ A;  2FRH A;  4LG0 A;  1R1V A;  3R0J A;  3R4K A;  1MJA A;  4LG0 B;  3WTU C;  3N4M A;  1XGO A;  1FT9 A;  4UVA A;  4I2O A;  4ON0 A;  1BI2 A;  1FY7 A;  3MFK A;  3GZ5 A;  4A12 A;  4LLL A;  4JBA A;  1I5Z A;  3EQL F;  4CXF A;  2CYY A;  4I98 B;  2HDC A;  3WTV C;  3DQV C;  4G9Y A;  4U0V A;  3E6B A;  2PFB A;  1FP2 A;  2DI3 A;  1FX7 A;  3IHU A;  5EEG A;  1P2F A;  3BPV A;  2GA2 A;  2M45 A;  2PEX A;  4ASN A;  4ESB A;  1U5T A;  3LQQ A;  2KJC A;  1RI7 A;  1U5T B;  2XRO A;  4B8X A;  1STZ A;  2XHK A;  3V7S A;  2A61 A;  1XB4 A;  3SFZ A;  3KP5 A;  4LK1 F;  3B73 A;  2FF4 A;  3RYP A;  1U2W A;  5K5Q A;  1LQ1 A;  1HKT A;  5H6R A;  2KRF A;  3L09 A;  2O6G E;  5D5U B;  3TDU C;  1ZAR A;  1K7A A;  1XGN A;  3C7J A;  2WWY A;  3U1D A;  1U3E M;  4KNY A;  4RGR A;  2XAH A;  4M9S A;  3TGN A;  3R0A A;  2LF7 A;  1LVA A;  2EFN A;  5FB2 A;  1GHC A;  2FXA A;  3QOP A;  3EYI A;  4MNU A;  5IT9 K;  5CVV A;  2YPR A;  1CGP A;  4WCG A;  4EJW A;  5LBQ A;  1FC3 A;  1MJB A;  3WTX C;  2QQA A;  3DPL C;  3CJN A;  4RB0 A;  1W7P D;  4ZYH A;  4U0Y A;  3CUQ C;  2EV6 A;  3M7G A;  1B6A A;  1S7O A;  3GVA A;  2CGP A;  1W7P B;  2VC1 A;  5DD8 A;  2CW0 F;  4P9F A;  3L7W A;  4DNC A;  4M9X A;  5A2Q K;  1IW7 F;  2HYG D;  2OAZ A;  1O7L A;  2M1B A;  5DUI A;  1YS6 A;  2QWW A;  4AIK A;  2HEO A;  4HA8 A;  2HZT A;  5BPI A;  1H9G A;  2GXG A;  3WTT C;  1OPC A;  1J2X A;  3RKY A;  1HW5 A;  3LQR A;  4P96 A;  4NB5 A;  1RUN A;  5HLG A;  1R1T A;  5E18 F;  2HS5 A;  1F4K A;  3COA C;  1XMK A;  2P5V A;  5L3C A;  4K2E A;  4YII A;  4Q48 A;  4I09 A;  5CJ9 A;  2RVC A;  5DDG A;  3HRU A;  2FA5 A;  5FFZ A;  2R7F A;  4LLN A;  2ETH A;  3GYH X;  2O3F A;  1PUE E;  2ZKZ A;  2M30 A;  5L3G A;  4I01 A;  1IRG A;  3FZV A;  3ELK A;  4GYG A;  3RJP A;  1YW7 A;  4RB2 C;  1QZZ A;  1P6R A;  4M73 A;  4XSZ F;  5LRS A;  3TKY A;  4A0Y A;  3LWF A;  3KEQ A;  3M8E A;  1TTY A;  2RNJ A;  4AVP A;  5LHG A;  4L9J A;  2GA1 A;  3HRM A;  3BJ6 A;  1SD7 A;  4Q47 A;  3PQJ A;  2E1C A;  1ZG5 A;  3EET A;  3QU3 A;  4UXN A;  4S05 A;  3JSP A;  3WTW C;  2ISZ A;  2FBK A;  1IXR C;  1O57 A;  2XAF A;  1QZY A;  2R7D A;  2ZME B;  4LD5 A;  2ESH A;  5E20 A;  4NHJ A;  2P6T A;  4HLX A;  2A6E F;  1Z9C A;  3L9F A;  1DP7 P;  4Y13 A;  2K4J A;  3C1D A;  3GO5 A;  2Z5U A;  3E5X A;  1TW3 A;  5D5W B;  2V9V A;  3Q9V A;  1OYW A;  2TDX A;  2XGX A;  2P4W A;  4R79 A;  1TQP A;  5LGU A;  1MDM B;  2EWN A;  4G6Q A;  4G6D A;  3LA7 A;  1SAX A;  3P7N A;  2FQ3 A;  5F6F A;  2UZK A;  1R5H A;  5CLS A;  5HS7 A;  2L4A A;  3GWZ A;  5D6F A;  3EYY A;  1SMT A;  2M87 A;  2QLZ A;  2K02 A;  3T5X A;  1FSE A;  3TO6 A;  1B4A A;  1S7A A;  3F6O A;  4KIC A;  3I59 B;  1B1B A;  1RIO H;  4MGR A;  5JI6 A;  1BN5 A;  1HST A;  1O3S A;  3I58 A;  1R7J A;  2G7H A;  3EDP A;  3ZMS A;  2LF8 A;  2W25 A;  4YFN F;  1KQ8 A;  1FLI A;  1XGS A;  4XLN F;  2UWM A;  2QVO A;  2X4H A;  2COM A;  4ZH4 F;  5DCF A;  1XN7 A;  2GZW A;  3MEX A;  2VBW A;  4L9T A;  3GFI A;  4EGZ A;  3VOE A;  4IRH A;  4A6D A;  5CVI A;  2Z33 A;  1SFX A;  4A2U A;  3NEU A;  2EFP A;  1K78 B;  2XAS A;  3CLO A;  4GYI A;  2W84 A;  2EFQ A;  3C18 A;  5D5V B;  2VON A;  5E8I A;  1WKM A;  2MC3 A;  1YYV A;  1RUO A;  4IF4 A;  1YW9 A;  4AIJ A;  3ZMV A;  1Q1H A;  4MTD A;  2IPQ X;  3RKW A;  2ZO4 A;  1USS A;  2DK5 A;  2NYX A;  4U7D A;  3I4P A;  3P9C A;  2JZY A;  4L5J A;  2DPD A;  1ZRE A;  4WXC A;  1R58 A;  1LEA A;  2Q0O A;  3KP6 A;  2G9W A;  4ENK A;  3R6S A;  1L0O C;  1ULY A;  3MZH A;  1KQ0 A;  1T98 A;  4G7Z F;  3RPU A;  3FHZ A;  3FMS A;  1QQI A;  3WTY C;  1T0F A;  3JTH A;  2PQ8 A;  2Z99 A;  2KIM A;  2XIG A;  2CFX A;  2EV5 A;  1G3W A;  3GXO A;  1MGT A;  1YW8 A;  4YG2 F;  3TQN A;  1UHW A;  2QQ9 A;  3IKV A;  1TLH B;  3QU6 A;  5J6X A;  1RNL A;  2XKP A;  1JXS A;  2O03 A;  1O3R A;  5A2Q Z;  2IJL A;  2BV6 A;  5TJJ A;  4L9N A;  4HV6 A;  1DDN A;  5CVJ A;  1OYY A;  5ILS A;  3WE3 A;  3LST A;  2FOK A;  2DU9 A;  1V4R A;  1XSV A;  1XCB A;  3W6K B;  2LSO A;  3MCZ A;  2XRN A;  4UVC A;  2ZBK A;  1O3Q A;  5E17 F;  2ESN A;  5HOO A;  3K1N A;  3GF2 A;  4UV9 A;  2O0Y A;  2AXL A;  2ZNY A;  3BRO A;  2ACJ A;  4EJU A;  3WTZ A;  1ZN2 A;  1QBJ A;  3MZY A;  3HSE A;  4GXO A;  3KLN A;  3BP8 A;  2JPC A;  1U5T C;  4EGY A;  1BBY A;  3HSR A;  1R36 A;  4B09 A;  4M71 A;  2EA4 A;  4WXD A;  3WGG A;  2ISY A;  2K27 A;  1ZYR F;  3I54 A;  2H09 A;  3EUH A;  1U8R A;  2A3S A;  4OU0 A;  2VBX A;  5H20 A;  3TOB A;  2DLL A;  3I64 A;  4CYD A;  1YIO A;  4G8X A;  3KFW X;  5HLI A;  3QP5 A;  1J59 A;  2MH9 A;  3TO7 A;  2OBP A;  2E7X A;  3SZT A;  2DAO A;  1DUX C;  1KU9 A;  3HOS A;  5HS8 A;  2L01 A;  1IN5 A;  2DO7 A;  4LB6 B;  4M6Y A;  4FX4 A;  3BJA A;  4HW0 A;  3FMR A;  1ZH5 A;  2A68 F;  1KU2 A;  2FBI A;  3H92 A;  3RI4 A;  2CSO A;  4KUM A;  4RGX A;  3O2P E;  3FXU A;  1S29 A;  1R00 A;  4ZYD A;  2Y0M A;  1QGP A;  1D8K A;  1T6S A;  2RGV A;  1FPQ A;  1KQ9 A;  4OMY A;  3J81 K;  1ZRD A;  2UXX A;  2Q2E A;  4I7H A;  5CYV A;  3BPX A;  1UFM A;  5F1R A;  1UHM A;  3KP7 A;  4AIH A;  4CO8 A;  2DTR A;  5H6Q A;  3WGI A;  3HHH A;  2H6C A;  2DPU A;  4YIF A;  3F72 A;  2P7C B;  1DPU A;  1ZRF A;  3F8B A;  2AS5 F;  1E2X A;  4L0Y B;  2RC4 A;  4HQE A;  2JTV A;  2MLG A;  2CO5 A;  1G6N A;  1XDS A;  2HFH A;  3TDZ C;  1Z1D A;  3CTA A;  4U88 A;  3IC7 A;  5K1Y A;  3N97 A;  3HSF A;  1SD5 A;  2XVC A;  4GCV A;  3QP6 A;  1LDJ A;  1F5T A;  4LMY A;  4HV5 A;  4EM2 A;  4BAY A;  3HUG A;  5L3E A;  4S04 A;  2L4M A;  5HDK A;  2FU4 A;  1W7P A;  2EA2 A;  4UUV A;  3K69 A;  4MEX F;  5BS6 A;  3W6J B;  1BM9 A;  3DEU A;  2F5C A;  3NQO A;  2FNA A;  4U0W A;  5D8L B;  1DPR A;  4BXU A;  1D3Y A;  3WG9 A;  1E17 A;  4FX0 A;  3M8F A;  6PAX A;  1YLF A;  3V8K A;  3WOD F;  2GWR A;  1WI9 A;  1S8N A;  1F9N A;  1TNT A;  2IA1 A;  4RB3 C;  5AIP A;  2ELH A;  1D5V A;  2IP2 A;  5LGT A;  1IZ1 A;  1IN6 A;  3D5L A;  1I6X A;  1XSD A;  3HRT A;  4HDV A;  4XBF A;  4A5M A;  1TBX A;  4KT5 C;  2L3D A;  4EQQ A;  3GZ6 A;  4CDG A;  1UB9 A;  4L9V A;  5L3D A;  4ENJ A;  1FOK A;  3F8N A;  1W5T A;  2V1D A;  4R1H A;  4N9I A;  3DKW A;  1NHA A;  3JAM K;  3KP3 A;  4EJT A;  3LAP A;  4IHT A;  5IT3 A;  1R22 A;  3CUO A;  1OKR A;  3CUQ B;  5D8K B;  3QAH A;  4BHB A;  2O8X A;  4LLG F;  4MEY F;  4WK8 F;  3G3Z A;  3F8C A;  4WF2 A;  2IA0 A;  2K4B A;  2ZME A;  5HVQ C;  3B02 A;  1A04 A;  1BI3 A;  4E70 A;  1P4W A;  2NNN A;  3KE2 A;  3HTU A;  3ZN0 A;  2RN7 A;  3K9T A;  1EH8 A;  2VOO A;  4OIO F;  2XAQ A;  3CO7 C;  2HQR A;  1IXS B;  1HSJ A;  1GXQ A;  4RAY A;  1HQC A;  4FHT A;  2MBF A;  1FBS A;  2Q8K A;  2GIV A;  4UV8 A;  2BGC A;  3FX3 A;  4HQM A;  2XAG A;  1D8J A;  1ZLJ A;  3P9I A;  1TNS A;  3ECH A;  4ESF A;  2V79 A;  4ESJ A;  4EMS A;  4EJV A;  2A6H F;  5E1W A;  1MDM A;  1FZP B;  3WTS C;  2WV0 A;  4BHP A;  2QYO A;  4HF1 A;  4I0A A;  2VXZ A;  2CG4 A;  4O3M A;  1H0M A;  4HF0 A;  4RAZ A;  2HGC A;  2JRT A;  2FE3 A;  2F5D A;  3BY6 A;  3ECO A;  3D0S A;  2K7L A;  2F5E A;  3ZN1 A;  3GFJ A;  2RKH A;  5JVT A;  2FML A;  3T0Y A;  1QO0 D;  4CIC A;  3LA2 A;  2P8T A;  3IL2 A;  2OU2 A;  3I59 A;  5L3B A;  2D1V A;  4IHS A;  5DCM B;  4G7H F;  1KGS A;  1KU7 A;  4MTE A;  5ICE A;  3KP2 A;  3M9A A;  3BJO A;  3E6C C;  1LDK B;  3SZP A;  2OZ6 A;  4EVI A;  4XRF A;  3R61 A;  1B9M A;  2LKP A;  4HBL A;  4WX9 A;  5LRR A;  3K1M A;  4HX4 A;  1SFU A;  2LDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...