2EV0A

Bacillus subtilis manganese transport regulator (mntr) bound to cadmium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 51
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev0A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev0A02
1HBXG 1OPCA 5LEJA 2ZMEB 4IHSA 1WWXA 4R1HA 3ABUA 4EQQA 1KU3A 1MJ9A 3BWGA 3I71A 2XRNA 3GEZA 2FSWA 3JSPA 4KUMA 3GVAA 4MGRA 2LSOA 1VTNC 2KRFA 4ZH4F 3F3XA 4Q5SF 3I0TA 3BP8A 4LFUA 3PQJA 3KP7A 4B09A 3WTVC 3HOSA 5DEQA 3KP5A 2ZBKA 4XRFA 2GQQA 3E5QA 3QPHA 3ZMDA 2L02A 4HX4A 3VOEA 3U2RA 1G3SA 2CSOA 4KIBA 2HEOA 3IKTA 5DDGA 1BC8C 3J80K 1FC3A 4UNOA 1DPRA 5L3FA 3WTXC 1L3LA 4EGZA 4A5MA 3P9CA 4EJOA 1SMTA 3GWZA 1MJBA 2A3SA 3U9GA 4FX4A 3E5UA 4UVBA 3GYHX 5ILSA 2Q8KA 1ODDA 3D0SA 2DTRA 2HS5A 1WQ2A 5ICCA 1V3FA 2CG4A 3N97A 4F7ZA 1LDKB 1WSUA 1F5TA 1O57A 2ZKZA 4EV0A 2VOPA 3SFZA 1BBYA 2G9WA 4ENKA 4I0BA 4LK1F 3EYYA 2VOOA 4L9VA 1SFXA 4IRHA 3WGIA 3SZTA 5CVIA 4U7DA 1REPC 2Y0MA 4BH9A 3I4PA 1HW2A 4RGRA 1XDUA 1QBJA 2P5LC 2K4JA 3SQNA 4HQEA 1QPMA 4CO8A 1UFMA 3I5UA 3FZVA 3ECHA 3P9IA 4HF2A 4O6JA 4ON0A 2MA3A 4O5VA 4ZYHA 3DKWA 1T6SA 4KIGA 5HS8A 5F1RA 5E18F 1O7LA 2GA1A 5CVRA 2Y48A 5E20A 5AIPA 5LGUA 1Z9CA 3Q5FA 4FX0A 2HZTA 2VC1A 2QWWA 3F6VA 5IT3A 4HDUA 4PGHA 2K86A 2UXXA 2HYGD 1TNSA 5IT9Z 5FFXA 5FFZA 1G6NA 5DCMA 4RB0A 2AS5F 5E17F 3RPQA 2IT0A 2VBXA 5ERIA 1MDMB 3GZ5A 4L5IA 2D45A 2M5WA 3FMRA 4LG0A 3IWZA 4CICA 3HSRA 1R1TA 3DXJF 1O3QA 3E97A 4HX8A 1IXSB 1P4AA 3VB2A 1QZYA 1P92A 1FZPB 2IA0A 2E1NA 3L2CA 1IN5A 4HDVA 4BHCA 2XROA 1ZGJA 5FGMA 2VONA 3RDIA 1MZBA 2Z99A 4M9XA 4CGZA 2NNYA 2VXZA 3F8CA 2XHKA 1YIOA 2NNNA 3KP4A 2IP2A 3ISPA 1FY7A 1JHHA 4K2EA 2EA4A 5H6QA 1USTA 1S8NA 3TQNA 3QPTA 1BI0A 1IUYA 4BHPA 4M72A 1X3UA 1RZ4A 1PDNC 1TQPA 2EK5A 3W6KB 1JXSA 5DYMA 1HKTA 4MTDA 3F8BA 2JT1A 5LHHA 1U2WA 1SD6A 2WTEA 3EYIA 4M71A 1R58A 2KJBA 3RJPA 3QU3A 5H6RA 1U78A 3ZMUA 2ZFWA 4UHTA 4YG2F 1TTYA 5ICFA 3V7CA 1ZGAA 4HF1A 3WGGA 5L3BA 1Q1HA 2FEZA 2BBYA 1K78A 2CWEA 3Q9SA 2IJLA 3KP6A 2JTVA 1DP7P 3MZHA 4L9TA 3CJNA 5HDNA 3WU1B 2JSCA 3RI4A 4MQ9F 3RYRA 1HKSA 4BNCA 2P4WA 2ESHA 4JQFA 2WV0A 4WXHA 5L3GA 2FBKA 4A0YA 1YW9A 5HLGA 2Z3YA 3GW2A 1EH8A 3V8KA 1H9TA 2HGCA 1D3YA 4G6DA 2V1UA 1DDNA 1KA8A 1R1VA 2QLZA 4RB2C 1TBXA 2HWVA 3DV8A 5D8KB 1OKRA 2FBHA 1PP8F 2STWA 1UB9A 3MZYA 5LGTA 1HQCA 5BQTA 1CF7B 3MFKA 3QP6A 1DUXC 4H0EA 3T1BA 3DF8A 3I54A 2QQBA 4WXCA 4AIKA 4I02A 1SFUA 4IRIA 1Z05A 2ZO4A 2V79A 2UXNA 3G73A 1FBQA 1XSVA 5TJJA 3MAJA 4B8XA 2XAGA 1SD4A 2H27A 4G7ZF 3IHUA 3WG9A 4EJTA 3KCCA 5E8IA 2DT5A 1K7AA 4HLYA 4LB6B 4G94A 3V8LA 2EFOA 2XIGA 3E5XA 2W84A 1FSHA 4RGSA 3HUGA 1LB2A 2RV8A 4IF4A 2XGXA 2EV5A 3KZYA 1HKQA 4AD9A 1RIOH 1BI2A 3PFIA 1U8RA 5D6EA 4LGWA 4KT5C 1G3YA 2QYOA 2R3SA 2W85A 1OR7A 4LK0F 4L5JA 4E70A 1IXCA 5FO5A 3O2PE 4HV5A 1KQ8A 1FYKA 1D5VA 2EFPA 2XAHA 2G7UA 2H6CA 3ZN0A 4CXFA 3E6BA 4OU0A 5CYVA 2E7XA 1HSJA 3RTRA 3ZN1A 1Z6TA 1YW7A 3CUQC 3ML6A 2MBFA 3LA3A 4CZZA 4NQWA 2P6TA 2VBZA 1W7PD 3QP5A 3JTHA 4RAZA 4P5OA 2QVOA 1ONVA 4KA4A 4Y17A 3CUQB 3BROA 3I58A 5J8FA 2F5DA 5JI6A 2OA4A 2ZJ2A 3HTSB 4Y15A 1J7KA 1T2KA 2OD5A 1GHCA 1A04A 2FXAA 4L9NA 3P9KA 5FD5A 1O7FA 2IA2A 4OMYA 1KU2A 3TDZC 2FRHA 2A69F 2A6EF 3V8JA 3VEPA 3IWFA 2CQKA 3RYPA 1W4MA 2PFBA 4UV8A 5LHGA 4MNUA 4LLNA 3KFWX 2LF8A 1XB4A 3VFZA 1ON2A 4MEYF 2RNJA 5E8GA 2EFWA 2CYYA 2DU9A 2R7DA 5DCFA 4ESBA 5F6FA 4IXAA 4UVAA 2O6GE 4U88A 2IW5A 3C18A 4G7OF 5ICGA 4HOBA 4N9IA 5ILVA 3TO7A 1ZARA 3BZ6A 4PDKA 4A12A 4A6DA 3LA2A 4LLGF 2RGVA 2ADUA 1KGSA 3FXUA 5J6XA 4M9ZA 2J5OA 3E6DA 2CW0F 3NEUA 4BXUA 2X0LA 3SXYA 3KP3A 5LLQA 3KLOA 2ELHA 3AAFA 3GZ6A 1GVJA 3HRTA 5LBQA 5D5UB 2MLGA 1D8KA 2F2EA 4YIIA 3NRVA 1IN6A 1Z1DA 4ENJA 2EV6A 1T38A 3QAHA 2DK5A 2PN6A 3F8MA 1O3SA 1B9NA 2PEXA 1J5YA 3IC7A 2DAOA 2OQRA 1QNTA 1B59A 1ZAOA 2HDCA 2L4AA 3ZMSA 2XUBA 4XBFA 2VBYA 2YX7A 2XAQA 3FMSA 2WC2A 1YW8A 3KEQA 2Z5UA 2DW4A 1PUEE 2FU4A 5CVVA 4KFCA 3ECOA 1HW5A 3R6SA 2ISYA 2DPDA 4ENMA 5JHUA 1KYZA 1YO5C 2PG4A 5HDGA 1XMKA 5HS9A 1YS6A 3HSEA 3FXQA 3HRMA 2XAJA 4R8HA 1WKMA 1T39A 1FSEA 2P7VB 3IKVA 2RQPA 3LFKA 1MD0A 1STZA 3IL2A 1XN7A 4MEXF 4G9YA 4NB5A 3L09A 2M87A 2BEOA 1FYLA 3M9AA 4KDPA 4KN4X 5D4RA 1K79A 4CHUA 3KE2A 1GXQA 3J7AO 1IW7F 5L3CA 2FOKA 3N4MA 1RI7A 3WGHA 2CFXA 3WTZA 3M1EA 4I09A 2L3DA 1OMIA 4KIFA 3V4GA 2NS0A 2GXGA 4L0ZB 2LNBA 2ESNA 2GAUA 4FT8A 4HV6A 2FQ3A 3FX3A 4BQAA 2ISZA 3WE2A 3DPTA 4WCGA 2OZ6A 5K5OA 3B73A 3O6BB 1TW2A 1ZG3A 1HW1A 4LLLA 2EB7A 2XVCA 2MLKA 5K5RA 1F1ZA 1LNWA 5EEGA 2YR2A 1XD7A 2D1HA 2XAFA 4N0BA 3K1NA 3ROUA 1R5GA 1R00A 1RUOA 2DQLA 3S2WA 1U5TA 2L54A 2GXBA 4FHTA 3K9TA 4HA8A 5CVUA 3R60A 5A2QZ 2ETHA 1USSA 3KZZA 1J59A 4XLNF 3IRRA 2UWMA 5BMZA 2V6CA 1J0RA 2V1DA 4MQVA 4YFKF 1G3TA 5IT9K 3EQLF 2QENA 5CVJA 2HKOA 4U0YA 1FPQA 5BS6A 1TLHB 2IA1A 3LSTA 2HQRA 5H20A 3HTUA 5JFRA 1IZ1A 5K1YA 4R79A 5HLHA 3ZMVA 4LB5A 4WK8F 1FLIA 1FBUA 4WX9A 5DUKA 3V7RA 2EJRA 3BPVA 1LDDA 1P4XA 2H94A 1KU9A 4AWXB 2L01A 1E2XA 5K5QA 4L9JA 2F5CA 4LMYA 3ZQ7A 5LHIA 1W5SA 1W5TA 4OMZA 1KYWA 3RKYA 5DD8A 5KK1A 3FM3A 2KIFA 2RVCA 2M30A 2K27A 5AIQA 1DPUA 2L4MA 3IRQA 4HF0A 4O3MA 4N9HA 1FOKA 3T5XA 1I5ZA 3BJ6A 1ZHFA 1W7PA 2F5FA 3REOA 1OYIA 6PAXA 4U0WA 2DPUA 4KICA 1H9GA 4XLPF 1H0MA 1IF1A 1BN5A 3W6JB 1OYYA 2RKHA 2ZMEA 2XKPA 2QQAA 2LF7A 3R4KA 3T8RA 4M9SA 3RIRA 1E17A 1Y0UA 3MQ0A 2DI3A 1EH6A 1XGOA 1YS7A 2RDPA 4AIJA 1YTYA 4IRGA 5DCMB 2QZ8A 3D5LA 2LKPA 3GX4X 4OOIA 2WWYA 2VT3A 5HOOA 4LG0B 4EJUA 1IN8A 3K1MA 1T98A 2M1BA 1UHWA 4RB1A 2OU2A 1ZN2A 2EFQA 1LVAA 4GCVA 2VODA 2W57A 1ZREA 4Q48A 3JSOA 1O3RA 2XKOA 3ULQB 2PLYA 3J81Z 4IHTA 1ZG1A 4A5NA 2HR3A 2YPRA 4OIOF 3QOPA 2D2WA 4L18B 2KKOA 4KMFA 1UHMA 4BYYA 2EFNA 3L9FA 4CDGA 5D4SA 4PZJA 5JR3A 2ZCWA 4AVPA 3C1DA 4JBAA 3ZMZA 1J2XA 5HVQC 3TDUC 2D1VA 3SHFA 3LAJA 1U3EM 1O3TA 2STTA 4G7HF 1R7JA 4RGUA 2HKXA 2VE9A 3CUOA 2DFIA 2GA2A 1BM9A 3E6MA 5L3EA 4WF2A 2HOEA 1MGTA 4LD5A 3TOBA 1Z6RA 3KP2A 3LAPA 1TNTA 4HW0A 3Q9VA 3ZMTA 3I59A 1FNNA 3C7JA 5CJ9A 3FF5A 4EMSA 3BDDA 2QBYA 4ZZDA 1K78B 3C3WA 1ZH5A 5ED4A 3HHHA 3JTGA 1IXRC 2O8XA 4P96A 2Z9OA 2A07F 2TDXA 3DEUA 1RUNA 2BYVE 3F8NA 3FM5A 3KEOA 4P55A 1SFEA 5LGNA 4ZZLA 2JZYA 2OQGA 1LEBA 3WTYC 5E1WA 2PQ8A 1FX7A 4I7HA 1P2FA 5TRDA 1BC7C 5CLSA 4UV9A 2BE5F 2H6BA 2XV4S 1YG2A 3TO9A 4HQMA 5DV5A 2HQNA 3ELKA 1Z91A 2IPQX 3ZPLA 2A61A 2FBIA 1ZRFA 2E1CA 1FP1D 2YU3A 3COAC 1LDJA 3H92A 3M8FA 1WRJA 3R0JA 3G3ZA 1S6LA 3TKYA 3H3UA 3QU6A 1LQ1A 3I53A 2Z33A 1WI9A 2VC0A 1L0OC 1MDMA 4ZYGA 1ZLKA 1FT9A 1F4KA 3FHZA 1R36A 1SD5A 2PJPA 1BIAA 1F9NA 1IRFA 1TQIA 1XDSA 5HLIA 3BJAA 1JE8A 3K0LA 2BGCA 3M7GA 2OZUA 1KQ9A 1K6OA 2NYXA 3LQQA 1FP2A 1EV7A 1XGNA 4U0VA 5FLXZ 5BPIA 3CO6C 2IVMA 3WE3A 4RAYA 4GGGA 4P9FA 3O3KA 4UXNA 3H3ZA 4KMUX 4UVCA 2COMA 2DK8A 5F64A 5EEHA 5E1XA 2MC3A 5BOXA 3WTWC 2QUFA 1YFHA 4RS8A 2ZNYA 3TO6A 3R0AA 2GZWA 1ON1A 2P8TA 1XCVA 2MH9A 2EV0A 4G8XA 4HAMA 2MH2A 5ICEA 2P5KA 5JVTA 4IPAA 3DPLC 1UCRA 4KYWA 3LWFA 3F21A 1LJ9A 1ZRDA 3EUHA 1RNLA 1R1UA 5D5VB 3GFIA 3JAMZ 3F23A 4OIRF 3I59B 3L00A 3HHGA 5FLXK 3HOTA 2QBYB 1XGMA 1KU7A 2Q2EA 1PP7U 3R61A 2IRFG 4M74A 2YX4A 1QO0D 3K1PA 4MTEA 3WTTC 1ZRCA 1V4RA 3QRFF 1YLFA 4YIFA 1ULYA 1U6GA 1BOAA 2K4BA 5ILUA 4RGXA 2RN7A 3LA7A 4ESJA 4I2OA 3WTUC 4WXDA 1G4DA 4Q4ZF 5E1ZB 3PQKA 3DFGA 1S29A 1QQIA 2OBPA 1XGSA 4Q47A 2M45A 3BPXA 3F22A 4TV7A 1I27A 4QWQA 4A0XA 1GXPA 2O3FA 3F8FA 5AONA 4A0ZA 2VBWA 2DO7A 1QZZA 2FMLA 3CDHA 4P9UA 2VE8A 3VODA 5KVRA 3T8TA 3LQRA 4AIHA 1CF7A 1XMAA 2J5PA 3WU0A 2KIMA 4EM0B 2LDUA 4GO1A 3JAMK 3MWMA 4XSXF 4G6QA 4EM1A 3OV8A 2E7WA 1FYMA 1OYWA 3F6OA 1R5HA 2HYFA 3M8EA 4IVNA 1BIBA 3B02A 3K69A 3CO7C 1IRGA 2A5YB 2JPCA 2V1XA 3TOAA 3DP7A 2V9VA 1BI3A 3RKXA 1P6RA 1J9IA 1R23A 1D8JA 2O61A 1KQ0A 2AXLA 3HIFA 2O0YA 1B1BA 3K2ZA 1B6AA 3RPUA 3RKWA 4ETSA 2PMHA 4OIQF 4KN7X 1MKMA 5D5XB 4BAYA 3HYIA 2FE3A 2F5EA 1C0WA 1AWCA 3GFLA 3GFMA 3GLXA 1XCBA 1ZYRF 3U1DA 5LRRA 2P5VA 4YFNF 3V7SA 2O03A 2FA5A 3HSFA 4JK1X 4EVIA 5D5WB 2CGPA 4ASNA 4I0AA 3TGNA 4HYEA 1QGPA 2H09A 2DBBA 2JPBA 2DQRA 3ABTA 3HRUA 4NHJA 4MHGA 1JGSA 2ZNZA 5J8CA 1ZLJA 5D6FA 5A2QK 1S7OA 5LEKA 1G3WA 4XSZF 2C6YA 2FNPA 3WTSC 3CUQA 1NHAA 4ZYDA 4OIPF 3GUDA 2UZKA 5HS7A 4EJWA 4D0PA 3MEXA 2Q0OA 3FWEA 4Z2YA 1EH7A 3NQOA 1Z7UA 4ZYEA 4U7BA 2P7CB 3KLNA 1ZG5A 3GO5A 1IAWA 3I64A 4GYGA 1JHFA 5DD4A 2A6HF 4CYDA 4OINF 4WWCA 4M6XA 1R22A 5DUIA 4GXOA 5LRSA 1HXDA 1I1SA 3E6CC 4A2UA 2VN2A 1T0FA 2X4HA 2GWRA 1LEAA 2BV6A 4UUVA 2QM3A 1B9MA 4QLCU 4S05A 2P6SA 4HBLA 1I1GA 4L0YB 4EGYA 1TQMA 2B0LA 4Y13A 3GF2A 1U5TC 1AOYA 3L7WA 5D8LB 1IN7A 1FWZA 2OAZA 1J75A 2KIUA 2Y75A 2MD5A 2EA2A 2JRTA 4S04A 3KETA 1U5TB 2K02A 3ZP5A 2PBIA 3CTAA 2W25A 3EETA 4HLXA 3WODF 1S7AA 1BI1A 1YQAA 2A68F 2ZXJA 3OOPA 1SAXA 1S3JA 2W24A 4GYIA 4M73A 2RC4A 3FMQA 1YYVA 3SZPA 1XSXA 2HFHA 4HZFA 2QQ9A 4YFXF 4PGGA 2FF4A 3P7NA 3EDPA 2CO5A 2EWNA 2ACJA 2YSRA 3GFJA 4IJAA 3FXRA 4HX7A 4BHBA 1IN4A 2FMYA 4PCQA 4EJVA 3BOQA 4EM2A 2VT2A 4M6YA 2K7LA 4I98B 3JW4A 2XASA 5HDKA 5L3DA 2R7FA 1MJAA 2NAZA 5FB2A 2PMUA 3T0YA 2NRAC 3MCZA 3J81K 2DLLA 1TW3A 2HTJA 3DQVC 2GIVA 4LJZF 5BPDA 4DQ2A 4DNCA 3J80Z 1FBSA 2HTSA 3BJOA 4RB3C 1XSDA 2M8EA 3E3VA 4KNYA 1B4AA 3HRSA 1HSTA 1SMYF 1BJAA 1SD7A 2G7HA 1CGPA 1I6XA 4ESFA 4I01A 3F72A 2KJCA 3CLOA 2FNAA 3GXOA 1W7PB 3BY6A 3ERED 4ENNA 1P4WA 5FD6A 2PI0A 4A6EA
chains in the Genus database with same CATH superfamily
1HBXG 1OPCA 2X1DA 5LEJA 5F08A 3W2WA 3I56I 2ZMEB 1SVLA 3OWTA 4XRSG 3K4BA 4IHSA 2DMPA 1BJZA 2M7AA 1WWXA 4R1HA 1Z0XA 3ABUA 3S3OA 3OS1A 3V42A 4EQQA 1AU7A 1KU3A 2MSYA 2FJ1A 1MJ9A 3BWGA 2LY1A 3I71A 3PO3J 2XRNA 9ANTA 3GEZA 2FSWA 4CYCB 1Z77A 1HA8A 3JSPA 1K61A 4KUMA 3GVAA 4CCLA 3PSIA 4MGRA 3HOXJ 1ZELA 3FXKA 1T0FC 2LSOA 1MSEC 1VTNC 2KRFA 2F48A 4ZH4F 3F3XA 3RZOJ 1R9TJ 4Q5SF 2WAFA 3I0TA 3BP8A 2Q1ZB 4LFUA 3PQJA 2JUCA 3IUOA 3WU2C 3KP7A 2CQXA 4B09A 3WTVC 3HOSA 2VI6A 5DEQA 3KP5A 2ZBKA 4XRFA 2GQQA 2LP0A 3E5QA 3QPHA 3A02A 3ZMDA 4A3KJ 4DYQA 2L02A 4HX4A 5CPRB 3VOEA 3U2RA 1CQTA 1G3SA 2K9NA 2CSOA 1WGXA 4KIBA 2HEOA 5B5EC 3IKTA 2E71A 1QVUA 1OCCH 5DDGA 3LSPA 1BC8C 3J80K 1FC3A 1MBJA 4LOCA 4UNOA 2V9PA 1SFKA 1DPRA 5L3FA 3WTXC 4KJZA 2B7EA 3K70D 1L3LA 2DA6A 3RCOA 4EGZA 2JA5J 2E1MC 4A5MA 3P9CA 4EJOA 1LUJB 4BJ6C 3S32A 3FXJA 1SMTA 2YS9A 2WAQN 3GWZA 3J7AW 4BJTA 2VKEA 2MUNA 1MJBA 2A3SA 2M9HA 3U9GA 4PJMA 4FX4A 3QPLA 3E5UA 4HEA2 2IGKA 2X6WA 2M34A 2E1MB 5M3FJ 4UVBA 1PVEA 3GYHX 1X1CA 3CESA 1W0UA 3CMAI 4IOCF 5ILSA 2QA4I 2Q8KA 2V7FA 3J80R 2K85A 4Y33A 1ODDA 3D0SA 2DTRA 2HS5A 1WQ2A 5ICCA 1V3FA 5M5YJ 2FD5A 1GVDA 2QQ8A 2CG4A 2M2EA 2IGOA 2A05A 3N97A 1YIJI 2CUZA 3UR3C 4F7ZA 4G12A 3OSGA 3BR5A 4J19A 1JKQC 5IPAA 1LDKB 1WSUA 2R7VA 1F5TA 3HOZJ 3HL2A 1ZQ3P 1O57A 2ZKZA 3OYJA 3JCUC 5F0CA 1X3ZB 4EV0A 3MKYB 2VOPA 1OCRH 3SFZA 4XN3A 2KHMA 4GFBA 1BBYA 2R5YA 2KFDA 4XKWA 2H8RA 2VLAA 4ANJA 1WCMJ 1DP3A 2G9WA 2EIMH 4ENKA 4I0BA 4LK1F 3EYYA 3HGGA 4ZDPA 2OTJI 2VOOA 1VQNI 3JRGA 4L9VA 1SFXA 1X1PA 3LSGA 4BL0B 4IRHA 3OL3A 3WGIA 4E7HA 2LYCA 3AFHA 2QSFX 4I76A 2B9SA 3PJRA 3ZGKA 2CV0A 3SZTA 5CVIA 3OYGA 4XK4A 5HNFA 2KQRA 4U7DA 3OL4A 2VL8A 1REPC 1MNDA 2AO9A 3LSRA 2Y0MA 4BH9A 1QVTA 3I4PA 5EZGA 1HW2A 3H3VK 4RGRA 2WV1A 1XDUA 2V6EA 1QBJA 1V5GA 2P5LC 1ETWA 2K4JA 4FISA 1H8AC 3SQNA 4HQEA 1QPMA 4CO8A 1UFMA 3I5UA 3HZJA 4MO7A 1Z21A 3ESWB 2WAQA 3FZVA 5GTHC 2HU9A 3ECHA 1F43A 3P9IA 4HF2A 4FE7A 4O6JA 5KNLA 4ON0A 4IQJA 4S0HB 2MA3A 1JGGA 3K4JA 4BQQA 5IYBJ 3QODA 4O5VA 4ZYHA 1IV6A 3DKWA 4XMYA 1RPWA 3VSLA 1T6SA 4KIGA 5HS8A 5F1RA 3GTPJ 5E18F 1O7LA 1DGWY 2L2OA 2GA1A 1SANA 5CVRA 1RQ6A 2Y48A 5M5XJ 5E20A 5AIPA 5LGUA 1Z9CA 1I3QJ 4JX4A 4FX0A 2HZTA 1OISA 3KPHA 3Q5FA 3S16J 2VC1A 1BOBA 2QWWA 3F6VA 5IT3A 4HDUA 1BR1A 1P7IA 2K3FA 2K86A 2UXXA 4PGHA 3OYKA 2YUSA 4MIMA 3OYMA 2HYGD 1TNSA 1LE8A 5IT9Z 2EPFA 5FKNA 2LY9A 4AIDA 1UG0A 3B6AA 3L1PA 4IHVA 1XC5A 5FFXA 5FFZA 1G6NA 5DCMA 4RB0A 2AS5F 3JRBA 1NK3P 5E17F 3RPQA 2IT0A 2VBXA 5ERIA 1MDMB 2DODA 4XKVA 3GZ5A 4L5IA 5EGOB 2D45A 1YHQI 2KZVA 1P9QC 2MD0A 5JHFA 2M5WA 3FMRA 4LG0A 4XLCA 3IWZA 4CICA 3HSRA 1R1TA 3DXJF 3MN2A 1O3QA 1IG7A 1WJFA 3E97A 1JT0A 4HX8A 1IXSB 3VSKA 1P4AA 1S5LC 2HI3A 2M35A 4NBQA 3VB2A 1QZYA 2COBA 1P92A 1FZPB 1GLNA 2IA0A 3S14J 2FUG2 2R4GA 3M8JA 2E1NA 1FMWA 1ORKA 5J3LA 1DU0A 3L2CA 1IN5A 4IL6C 3DWLE 1VQKI 5F1JA 4HDVA 3EUKL 1APLC 3SEZA 4BBRJ 3A52A 4BHCA 2I8DA 2XROA 1ZGJA 5B3SH 2L9VA 4LITA 5FGMA 2VONA 3RDIA 2RAEA 3GTLJ 1MZBA 2Z99A 4M9XA 4CGZA 2NNYA 2VXZA 3K4LA 3F8CA 2XHKA 1YIOA 1K83J 2NNNA 2KL4A 3KP4A 2IP2A 3ISPA 1FY7A 4PK4A 1JHHA 4K2EA 4PJ0C 2EA4A 3S93A 2XB5A 5H6QA 1USTA 2JA6J 3HB9A 1S8NA 1JJ6C 3TQNA 3QPTA 1BI0A 4UB8C 4XLEA 1IUYA 1FTZA 4BHPA 5DS9A 4M72A 3WHBA 3L2QA 1X3UA 1RZ4A 2XB0X 1PDNC 4M3GA 1TQPA 2EK5A 4A3IJ 2W00A 3FBIB 2OJED 2KIQA 1LFPA 3W6KB 2L7MP 3PUFA 2GLOA 1KONA 1WVRA 1JXSA 1I50J 5DYMA 2DA5A 1HKTA 2LG4A 4MTDA 3F8BA 1FMVA 2JT1A 1LKXA 2NVXJ 2VJ5A 5LHHA 1X1BA 2KPMA 1JKOC 1U2WA 1ZR2A 1RKTA 2IS4A 1SD6A 3SZGA 2WTEA 5JLXA 3EYIA 4M71A 3FKIJ 2R7WA 1R58A 2KJBA 4N4NB 3QU3A 3RJPA 3S15J 5E3NA 1MBKA 2L7KA 3S3NA 4XKBA 5H6RA 4U87A 1U78A 5HNHA 3ZMUA 1IRXA 2ZFWA 4UHTA 4YG2F 1X4OA 3B6CA 1TTYA 1BW6A 5ICFA 2Y31A 2XSJC 4AM3A 4C2TA 3V7CA 1MNMC 3DKYA 1R4NB 4PSXA 2OC6A 2R93J 4B4CA 1TL8A 1ZGAA 1G59A 4BKXA 4HF1A 3WGGA 5L3BA 2BXZA 5FLVA 1Q1HA 2FEZA 3OSFA 2QCOA 2BBYA 1K78A 2CWEA 3Q9SA 2IJLA 4XORA 3OY9A 3KP6A 1B8IA 3S2HJ 2JTVA 1DP7P 3MZHA 2R7XA 4L9TA 2HQAA 1HDDC 1QU3A 1IV8A 3CJNA 3MKWB 3CD6I 3Q0VA 5HDNA 3CJRB 3WU1B 3TBIA 2O9LA 2KP6A 3ZQIA 3K4MA 3OIQA 4IZZA 2JSCA 3RI4A 4MQ9F 3MMYB 1ITYA 1S9HA 3RYRA 4DYCA 1HKSA 4QTRA 1AA7A 3EUAA 3M3YJ 4BNCA 1MMAA 3F9KA 1TZLA 2P4WA 4RLQA 2ESHA 2JWTA 4JQFA 3JR9A 1TWGJ 2WV0A 4WXHA 3HPGA 5L3GA 2FBKA 4A0YA 1ZGWA 1YW9A 2ELKA 2KISA 2Z3YA 5HLGA 3GW2A 1EH8A 3V8KA 1H9TA 4N4OB 2HYJA 3DKXA 2HGCA 4GRIA 1D3YA 4G6DA 2EZKA 5F04A 1IGNA 2V1UA 1DDNA 1KA8A 1R1VA 2DCEA 2QLZA 3H36A 4JYKA 4RB2C 1ACIA 4QIWN 4RA2A 3FDYA 4A3DJ 1TBXA 2HWVA 5EYRA 2WAEA 3DV8A 4Y52J 4FTHA 3BTLA 1WJCA 1E0EA 5D8KB 3GBGA 2FX0A 1OKRA 3W2VA 3ZRGA 2E60A 2UV1A 2FBHA 2JVGA 1T8IA 1PP8F 2STWA 1UB9A 3MZYA 5LGTA 5GTIC 2GOMA 1HQCA 2CW7A 5BQTA 2X6OA 4E7JA 1CF7B 3MFKA 3QP6A 1A35A 5E79C 1DUXC 3ZCOA 4H0EA 3OS2A 3T1BA 2JRMA 1G8XA 2CUEA 3DF8A 3I54A 2QQBA 4WXCA 4A93J 1U0JA 4AIKA 4I02A 2MW8A 1SFUA 1AKHB 4IRIA 4UUSA 5KHDA 3BG9A 3FXLA 1Z05A 2ZO4A 4BEHA 2V79A 2UXNA 3G73A 1FBQA 1XSVA 5TJJA 3ONQA 3MAJA 4BXFA 1D0ZA 4B8XA 2XAGA 2JA7J 1SD4A 2H27A 4G7ZF 3IHUA 1YRNA 3WG9A 4EJTA 1WH7A 3KCCA 5E8IA 3OMYA 2DT5A 1K7AA 4HLYA 1MMDA 3LNQA 4LB6B 2R5ZB 3M4OJ 4BS9A 2E5NA 3ZQFA 3VYSB 4G94A 4LIVA 2DA2A 3LL7A 3V8LA 2EFOA 2XIGA 3E5XA 2W84A 1FSHA 4RGSA 3C2HA 3H5AA 3HUGA 1FJLA 1LB2A 2RV8A 4IF4A 2XGXA 2W4SA 4CSWA 2EV5A 2PJRB 2DA3A 3KZYA 1HKQA 4AD9A 1RIOH 1BI2A 3PFIA 3I55I 2VQCA 1U8RA 1K6YA 5D6EA 4A3FJ 2CS3A 3PUBA 3CJQB 4LGWA 3LSMA 5J40A 2XAUA 4KT5C 3SEQA 1G3YA 2QYOA 4IQ4A 2R3SA 4HNUA 2W85A 3BTCA 1OR7A 4LK0F 2BW3A 1OQYA 4L5JA 3C2BA 2DMNA 4E70A 1IXCA 5FO5A 3O2PE 2A6TA 4HV5A 1FTTA 2R7RA 1KQ8A 1FYKA 4FCYA 2XF6A 1D5VA 2W1OA 2EFPA 2DFFA 3OYFA 2XAHA 1MW7A 2G7UA 2H6CA 3ZN0A 3BTIA 3VYUB 4CXFA 3CCEI 3HKZN 2MABA 1HC8A 3RZDJ 2IS1A 3ZQHA 3LOCA 1RKWA 2Z1DA 3E6BA 4XQFA 2ECBA 4OU0A 1ZKGA 1D0XA 5CYVA 4Y3OA 5FKLA 2E7XA 1BA5A 5B66C 2R92J 1HSJA 3ERMA 4QPQA 3RTRA 3ZN1A 4RAGA 1Z6TA 1YW7A 3SJMA 2G0EA 1YX5A 2BHYA 3A0HC 3KYCB 3E7LA 4YIRX 3CCVI 2NOGA 1PJRA 3CUQC 3ML6A 5EG0B 2MBFA 3LA3A 2DFEA 3K2AA 4CZZA 2XC7A 4NQWA 4KISA 5EDNA 2P6TA 3N05A 2VBZA 3CC7I 2WA0A 1W7PD 2CUFA 2ME0A 1B8IB 2X51A 3QP5A 3JTHA 5C44J 2OV7A 3H9JA 4RAZA 4P5OA 1MNEA 2QVOA 1ONVA 4KA4A 2L9SA 4Y17A 4M6VA 3CUQB 3BROA 2WADA 3I58A 3IAM2 5J8FA 2F5DA 5JI6A 2EZIA 2OA4A 2ZJ2A 1PUFB 3GLLA 2HDDA 1B72B 3HTSB 1J09A 4Y15A 1VNDA 1J7KA 1OLTA 4FQGA 1OFCX 1XS9A 4M3DA 2O7OA 2GM4A 2F6CA 3J7ZI 2R7SA 4FASD 1T2KA 2OD5A 4DW6A 4ZDOA 4IHWA 2CH0A 3H0DA 4HSTA 4F93B 1GHCA 1A04A 2HDWA 2FXAA 4L9NA 2NVQJ 3ZQQA 3P9KA 1NG7A 5FD5A 1O7FA 2IA2A 4OMYA 1YOVB 1KU2A 4EEFG 5K7ZA 3TDZC 3MKZA 1ETYA 2A69F 2A6EF 2FRHA 3V8JA 2WB1N 3VEPA 3A01A 1YJNI 1D5YA 1V55H 3IWFA 2CQKA 1X58A 1W4MA 4MLOA 3RYPA 1MMSA 1D1BA 2PFBA 4UV8A 4CH7A 1D1AA 3DU6A 5J47A 1XTAA 5LHGA 4MNUA 1DGRM 2N8GA 3OR1C 4LLNA 2LC2A 3KFWX 3DBRB 2LF8A 1XB4A 3VFZA 1ON2A 4MEYF 2RNJA 5E8GA 4CUGA 5F27A 2EFWA 3HKZA 2CYYA 2DU9A 2R7DA 3H5RA 5DCFA 1X4PA 4ESBA 4YELA 5F6FA 4A3CJ 4YRVA 4IXAA 4UVAA 2O6GE 4U88A 4CCNA 5GAGJ 1W5CC 2IW5A 3C18A 5J1YA 4G7OF 4M3EA 3VWBA 5ICGA 4HOBA 2LRDA 2P0TA 4UUTA 2PMZN 4FE4A 4N9IA 5ILVA 3TO7A 2MC4A 4LIUA 2JSPA 1MBEA 1ZARA 3BZ6A 5GADJ 1ETQA 3ASNH 1LPQA 2W82A 4PDKA 1WJ5A 2HXIA 4C3JJ 2TCTA 4A12A 2E2IJ 4A6DA 3H5NA 3LA2A 3KX2A 2VIXA 1TC3C 1H89C 1RR8C 4LLGF 3DEWA 2JQ7A 1EF4A 2RGVA 2ADUA 3HUGB 4XR6A 1HCRA 1KGSA 3FXUA 3HGYA 5J6XA 4M9ZA 2KDZA 2J5OA 2FQ4A 3E6DA 3DPUA 2CW0F 2F4MB 3E0JB 3NEUA 4BXUA 2X0LA 4XICA 2X6YA 3A4CA 3DBHB 3SXYA 3H35A 2XSDC 4BDYA 2X48A 3KP3A 2E36A 3MZ8A 5LLQA 2ZJQF 3KLOA 2ELHA 3AAFA 2EZHA 3GZ6A 1UZCA 3F0CA 2GBYA 1GVJA 3HRTA 2DOEA 5LBQA 5D5UB 2MLGA 1D8KA 2F2EA 2PX9A 4YIIA 3NRVA 2BW3B 3OYEA 1IN6A 1Z1DA 3G71I 3PO2J 2DXIA 2Y30A 3JRFA 4IEJA 2EV6A 4XLFA 4ENJA 1T38A 3QAHA 4I99C 2DK5A 4XLHA 2PN6A 3F8MA 2WB1A 1O3SA 1B9NA 1K4SA 1Y6IA 3QOEA 1ENHA 2PEXA 1J5YA 3Q0WA 3IC7A 2HOSA 2DAOA 4P1WA 2OQRA 1SFOJ 2HQ5A 1QNTA 1B59A 2IS2A 2QSGX 3DTIA 1ZAOA 2Y2ZA 2HDCA 5GAEJ 2L4AA 3ZMSA 4E7LA 2XUBA 3LFUA 2VBYA 3BQZA 4XBFA 4Y7NJ 2YX7A 3IH2A 2XAQA 3FMSA 2OCEA 4X1EA 2ZXHA 2WC2A 1YW8A 1BL0A 2L9NA 3KEQA 4D1QA 3JRAA 2QKLB 2HOTA 2Z5UA 2DW4A 5KAFC 1PUEE 2FU4A 3OYDA 5CVVA 1RESA 4KFCA 3ECOA 3S3MA 1VQMI 1HW5A 1R71A 3R6SA 4BQNA 1JKRC 2ISYA 2DPDA 1VQ6I 5DM6F 2KMUA 4ENMA 5JHUA 1UAAA 2DDBA 1WFXA 2HPIA 1KYZA 2PMZA 1YO5C 2PG4A 5HDGA 1XMKA 5HS9A 1YS6A 3HSEA 2M8GX 3FXQA 1HF0A 3HRMA 2XAJA 1OJLA 4IKFA 4PUSA 4R8HA 2BY3A 1WKMA 4CZCA 4ZDLA 1T39A 1FSEA 2P7VB 1MBFA 3IKVA 2LREA 2RQPA 2IEKA 3BC8A 3LFKA 1MD0A 3MD2A 1VF9A 1QPIA 4CCJA 1STZA 2HXOA 3IL2A 1XN7A 4MEXF 4G9YA 4NB5A 3L09A 4E7KA 1X3WB 2M87A 2BEOA 4JOMA 1FYLA 3L2RA 3M9AA 5GPCA 4A3EJ 4KDPA 4CCKA 4KN4X 5TISC 2GOXB 5D4RA 1K79A 4CHUA 3GCMA 3KE2A 1GXQA 2NVTJ 4AUXA 3CCQI 3J7AO 1IW7F 3IAS2 2JMWA 1TWCJ 5L3CA 2DA7A 2FOKA 1W36C 3N4MA 1RI7A 1Y8QB 3WGHA 2CFXA 2KRHA 2LKSA 3WTZA 3M1EA 4I09A 2L3DA 2E2JJ 1OMIA 3GTKJ 1V5FA 4XOTA 4B1RA 3KYDB 3BG7A 4KIFA 3ZQCA 3V4GA 2NS0A 2GXGA 4L0ZB 3CF5F 2LNBA 2ESNA 2GAUA 4FT8A 4HV6A 5FROA 2LH9A 2FQ3A 4E7ZA 5FRMA 1Z3XA 5J1RA 3FX3A 3U1KA 1RR7A 4PJJA 4BQAA 2ISZA 3WE2A 3DPTA 1Z7LA 4WCGA 2OZ6A 1DU6A 2ZSHB 5K5OA 2O5RA 3B73A 3O6BB 3ZOBA 4BJ5C 1TW2A 2LOOA 1ZG3A 4CCMA 3CLQA 3ABMH 2AQFA 1HW1A 4LLLA 2EB7A 3JRHA 1P7JA 2XRLA 2XVCA 2MLKA 5K5RA 1F1ZA 1LNWA 5EEGA 4MFEA 2YR2A 1XD7A 2D1HA 2XAFA 2LBFA 2DFHA 2NXNB 3GTMJ 4N0BA 4BBSJ 3K4NA 3K1NA 3OIOA 3ROUA 5C3EJ 1R5GA 1R00A 1UELB 1RUOA 1TP4A 2VXDA 2DQLA 3S2WA 3JRIA 1U5TA 2L54A 2GXBA 4FHTA 3K9TA 1TT5B 4G6TB 4HA8A 5CVUA 3OYLA 3R60A 5A2QZ 4DOZA 1FEXA 2VASA 2ETHA 2Y69H 2V1NA 1USSA 3KZZA 2TRTA 2DN0A 1VQ9I 1J59A 4XLNF 5DTDA 3IRRA 1WJEA 1JI8A 1POGA 2XGDA 1Z3YA 2UWMA 5BMZA 2CMPA 2V6CA 1FOWA 1J0RA 3L2VA 3S1RJ 1SAUA 2V1DA 3BG6A 4C3HJ 4MQVA 4YFKF 3K4KA 1G3TA 5IT9K 4BUPA 2LKXA 3EQLF 2OUMA 2QENA 2X6XA 5CVJA 2HKOA 4JX5A 4U0YA 1FPQA 5BS6A 3W3CA 1ZR4A 1TLHB 2IA1A 2L7ZA 3LSTA 2HQRA 4UB6C 5H20A 3HDDA 5E3OA 3HTUA 1X2NA 3LMMA 4DBQA 5JFRA 1YJ9I 1IZ1A 3QYBA 3ZQLA 5K1YA 4R79A 2DA4A 3BCAA 3OR2C 3U21A 3ZMVA 5HLHA 4HPQA 4WK8F 4LB5A 3OYAA 1FLIA 1FBUA 1JT6A 3CJTB 2DT7B 2KRCA 3TW6A 1SVOA 5DUKA 4WX9A 3V7RA 1G2HA 2EJRA 4NC6A 3BPVA 2R5YB 1LDDA 1YJWI 1P4XA 2H94A 1KU9A 4AWXB 3BZCA 2L01A 4BE0A 4XIDA 1E2XA 5K5QA 1W0TA 3GZNB 3NWTA 3FKJA 5IT9R 2I10A 4L9JA 4E7IA 1VQLI 3PM1A 2XPVA 2VB6A 2F5CA 4LMYA 1SEUA 3ZQ7A 5LHIA 1W5SA 1MH4A 5JVGF 2HVSA 3MVPA 1W5TA 2DMQA 1VQ4I 3GMEA 4OMZA 5DM7F 1UJ8A 1KYWA 4D7NA 1S72I 4HNTA 3RKYA 2VPRA 5DD8A 5KK1A 3O8GA 3FM3A 2KIFA 2LTPA 2RVCA 2M30A 2K27A 3PL8A 5AIQA 1N78A 1DPUA 2FOWA 3OYNA 5FLMJ 2L4MA 1KZHA 3IRQA 4HF0A 4XNFA 3W2AA 2ZXWH 4XRSA 4C2UA 1Y1VJ 3RQIA 4O3MA 4II3A 4N9HA 1FOKA 3T5XA 1I5ZA 3FIWA 3BJ6A 1ZHFA 1NG6A 1W7PA 2F5FA 3REOA 1OYIA 1FOYA 1TWFJ 2D5VA 6PAXA 4U0WA 2DPUA 4KICA 4RLFA 1H9GA 4XLPF 4PFPA 1VQOI 1MIJA 2XDVA 1H0MA 1N77A 2LY2A 1BN5A 1IF1A 3I4NJ 3W6JB 1OYYA 2RKHA 5HLTA 2ZMEA 2XKPA 2QQAA 2LF7A 3R4KA 3T8RA 4M9SA 3RIRA 3PNYA 3FBNB 3FISA 3OS0A 1E17A 4IOAF 2MYSA 1Y0UA 3MQ0A 4UY8I 2LVSA 3ZR8X 2DI3A 4ZJZA 1EH6A 1XGOA 5JLWA 1LE8B 1YS7A 2RDPA 5E3LA 2XF5A 4C9YA 4AIJA 2NVYJ 1E3OC 4RBOA 1V54H 5IYDJ 1YTYA 3PFYA 5FRNA 3BG3A 3UKGA 4IRGA 2V4JC 5DCMB 2QZ8A 1EJ9A 3UNGC 3D5LA 1JJ8C 2LKPA 3GX4X 4OOIA 2WWYA 4DJAA 2VT3A 1R5ID 3BR1A 5HOOA 1SC7A 3BQYA 4AC0A 4LG0B 1QHHD 4EJUA 2KDOA 4NUBA 1IN8A 3K1MA 1ETOA 1T98A 5HODA 2M1BA 1OCPA 3A1YA 3NAUA 1UHWA 2Y9ZA 3DTEA 2OU2A 1ZN2A 4RB1A 1Y39A 2E5ZA 5IYCJ 2EFQA 1U9OA 3CC4I 1LVAA 1R6RA 4GCVA 3S1QJ 2M0MA 2VODA 4D7MA 3QYFA 2OF7A 2QKMB 2W57A 3CZ6A 1ZREA 4Q48A 3JSOA 2BOLA 1O3RA 3S8PA 2XKOA 3ULQB 2PLYA 3J81Z 2XGEA 4IHTA 2AQEA 1ZG1A 2DMTA 4IHXA 4A5NA 3LSKA 2HR3A 2XPWA 2YPRA 2BHZA 4E7SA 4OIOF 3RPUD 2LLKA 3QOPA 2D2WA 1WHUA 4L18B 1ZTRA 2KKOA 4KMFA 3ABKH 1UHMA 4BYYA 2EFNA 1XG1A 3I9V2 3L9FA 4CDGA 4HNVA 2R7TA 5D4SA 3G1OA 2EIJH 1FOXA 1UMQA 4PZJA 4DIQA 5JR3A 5C4JJ 2L9RA 2ZCWA 4AVPA 1ZK8A 1SVMA 3S2DJ 1FIPA 2CU7A 3C1DA 4JBAA 3CCMI 3ZMZA 4F52A 1J2XA 3TEDA 5HVQC 4IHYA 2IGMA 3TDUC 5IOYA 2D1VA 1H88C 4XONA 3SHFA 2K5CA 1IUFA 3LAJA 1U3EM 3ZXSA 1O3TA 4G7HF 1R7JA 2STTA 2VJ4A 3BZKA 3TW7A 2NVUB 3G4SI 1VQPI 1UHSA 2AHQA 3PSFA 4RGUA 2MZ4A 1YX3A 4JX6A 1I3AA 2QSHX 2HKXA 5J4YA 2VE9A 2E1OA 1Y0NA 3CUOA 4AVZA 4XOPA 2CW8A 3C2GA 3IV5A 2DFIA 3CCRI 2BZTA 2QEXI 2GA2A 1BM9A 5K7FA 3E6MA 4II2A 5L3EA 2ECCA 4PFOA 4WF2A 5EF6A 2HOEA 2M4KA 4IO9F 1MGTA 3OYCA 4LD5A 4A3LJ 3TOBA 1Z6RA 3WHCA 3KP2A 3LAPA 1TNTA 4HW0A 4BY7J 2WY8Q 3CDLA 3Q9VA 3ZMTA 4HRIA 3BLYA 3I59A 1FNNA 3C7JA 5CJ9A 3FF5A 1OCOH 4BU2A 3CCUI 2E2HJ 3HPHA 1I39A 4EMSA 3BDDA 1HDPA 2IXSA 3FK6A 2QBYA 4ZZDA 2DT6A 1K78B 4M3BA 3QPSA 3C3WA 1ZH5A 4NNJA 5ED4A 4YEJA 3HHHA 2IBDA 2M3AA 3JTGA 1IXRC 2O8XA 4P96A 2F4OB 3H0GJ 2Z9OA 2A07F 2X98A 2TDXA 3DEUA 1RUNA 2BYVE 3F8NA 3FM5A 3KEOA 1JUPA 4P55A 1A6IA 1SFEA 5LGNA 2ZJRF 4DZPA 4XL9A 1QHGA 4ZZLA 2JZYA 2OQGA 1LEBA 5J4VA 2H8WA 2YU9J 3WTYC 4EATA 5E1WA 2PQ8A 1YI2I 4F3QA 1FX7A 2MVTA 4I7HA 3SDGA 1P2FA 5TRDA 5EZHA 1BC7C 4JP0A 5GPAA 4BQOA 4OAYA 5CLSA 3RSNA 4UV9A 4Y4RA 2BE5F 2H6BA 2XV4S 3JREA 1YG2A 4L5EA 3IH4A 1JTYA 3TO9A 1M1EB 4HQMA 2RREA 2VKVA 5DV5A 2HQNA 3ELKA 2ZXIA 1Z91A 2DYSH 2IPQX 3ZPLA 2A61A 2FBIA 1ZRFA 2E1CA 1ERDA 1FP1D 2YU3A 2H1KA 3COAC 3CC2I 1LDJA 3H92A 3M8FA 1WRJA 3K7AJ 3R0JA 1BR4A 1D0YA 3DEEA 1EKEA 1LFUP 3G3ZA 1S6LA 4NDLA 2HOAA 2O8KA 1F36A 3A2KA 2X85A 5F0FA 1Z67A 3H9GA 3TKYA 3G6EI 3H3UA 3Q0UA 3QU6A 1LQ1A 5FKKA 3I53A 3FK7A 2Z33A 1WI9A 2R7QA 3DCFA 3VDXA 5TGTA 2VC0A 1L0OC 2XF7A 1MMNA 1MDMA 4ZYGA 3VYTB 3HEFA 1MBHA 5EGOA 1FT9A 4E4HA 1ZLKA 3CMMA 4RAFA 1F4KA 3HJEA 3FHZA 1R36A 1SD5A 2ID6A 4V2FA 2PJPA 4A3BJ 1BIAA 3RKQA 2EZLA 1F9NA 1IRFA 4XRMA 4UUSB 3BR0A 1RRJA 1TQIA 2L7FP 4BEHB 1XDSA 3I3LA 1A6QA 3BJAA 4FETA 3K0LA 5HLIA 1JE8A 2BGCA 3M7GA 3DBLB 2OZUA 1KQ9A 1K6OA 2NYXA 2LR8A 3K70C 3LQQA 2ME6A 4J00A 1FP2A 1EV7A 2HVRA 1XGNA 1YRNB 2DJIA 3HXLA 4HSRA 4U0VA 5FLXZ 5BPIA 3CO6C 1IDYA 2LFBA 4B44A 2IVMA 4QSHA 3WE3A 4V19K 4RAYA 2Y0SN 3RQ4A 1N25A 4GGGA 4P9FA 1MH3A 3CP8A 2CV1A 3BR2A 2DDAA 1MMGA 3O3KA 4UXNA 4IX7A 3H3ZA 4KMUX 4UVCA 2COMA 2VQHA 2AXTC 3SDBA 3EPZA 3GTQJ 2DK8A 2VQGA 5F64A 3TP0A 5EEHA 5E1XA 2MC3A 1OR7C 5BOXA 1YE9A 3WTWC 2JN6A 2QUFA 3DLLF 2EQRA 4B3AA 1YFHA 4RS8A 5IOZA 2ZNYA 1NH3A 3CQZJ 2BY1A 3R0AA 2BVLA 3TO6A 2GZWA 3OOUA 3HC7A 3Q3SA 2E35A 5CQGA 1ON1A 4CA0A 2P8TA 1WI3A 1IC8A 4W97A 3AKZA 1XCVA 3AG2H 2MH9A 2EV0A 4AU7A 4G8XA 4HAMA 3IH3A 3CCJI 2MH2A 1TWAJ 2GXAA 3CP2A 2MG4A 5ICEA 4QPOA 2P5KA 5JVTA 4IPAA 4ZTJA 2R7ZJ 3DPLC 1IRZA 2VPLA 3LSHA 4B47A 4PJNA 1UCRA 2BVMA 4KYWA 3LWFA 3F21A 2LD5A 1LJ9A 1ZRDA 3HOVJ 2JK3A 1GV5A 3EUHA 2KT0A 5H2FC 1N75A 1RNLA 1WJBA 1R1UA 5D5VB 3GFIA 3JAMZ 4XLAA 5FJ8J 3GTJJ 2K9MA 1I6HJ 3F23A 4OIRF 3I59B 1LFBA 1HOMA 3L2UA 3L00A 4NQWB 3HHGA 2IAIA 5FLXK 3K10A 3HOTA 2QBYB 1XGMA 1KU7A 2Q2EA 2ZB9A 1PP7U 1ETKA 1XPXA 2A5WA 2HVQA 5CKTA 3HOUJ 5GAHJ 3R61A 4ZYAA 2IRFG 4BXXJ 1IJWC 4M74A 2YX4A 1QO0D 3K1PA 3LSIA 2VKDA 4MTEA 2M7BA 3WTTC 1ZRCA 2DOAA 1V4RA 3QRFF 2Y0SA 1YLFA 4YIFA 1ULYA 1U6GA 2K40A 1BOAA 4KITB 2R7UA 2K4BA 2DTZA 2KLOA 4ABZA 5ILUA 2OPTA 2P0WA 3QWLA 4RGXA 2RN7A 3LA7A 4ESJA 4I2OA 2W48A 5E3MA 3WTUC 5IP6A 1R49A 4WXDA 1E3PA 1G4DA 4Q4ZF 5FLXR 5E1ZB 3AL0C 2L0KA 3PQKA 3DFGA 4J01A 1S29A 1QQIA 2OBPA 1VQ7I 2VQLA 1XGSA 4Q47A 2M45A 3BPXA 4B48A 5FKMA 4TV7A 3F22A 3CCSI 1NTCA 1I27A 4QWQA 1R4MB 4A0XA 3CMYA 2HZDA 1GXPA 3ABLH 1ETXA 1X1AA 2O3FA 3F8FA 1XMXA 3TL4X 4AYBN 4F92B 5AONA 2ZSIB 1W36D 3IP4B 3A01B 3AL0B 4E6KG 3J7YJ 4A0ZA 4Z6YA 2VBWA 3H1CA 2DO7A 3CCLI 1QZZA 2FMLA 3CDHA 3CDIA 4P9UA 2VE8A 4ZC3A 3VODA 3G1LA 5KVRA 3T8TA 3LQRA 4AIHA 1CF7A 3DTKA 2HNHA 1XMAA 3K6GA 5EJCA 2J5PA 1JTXA 3WU0A 3FXMA 2KIMA 2X1EA 2JUGA 4EM0B 2LDUA 4GO1A 3AG3H 5IY5H 3JAMK 3MWMA 4XSXF 1BR2A 4G6QA 3CMEI 1AKHA 4EM1A 4XN0A 5KCMA 3OV8A 2XPUA 3KYLA 3JRCA 2E7WA 2CQQA 1FYMA 1OYWA 1WH5A 4I6ZA 4BACA 3F6OA 2I5UA 4RM2A 1R5HA 2HYFA 4PSWA 5LFAA 3M8EA 3HOWJ 4IVNA 1BIBA 3B02A 3K69A 3CO7C 1IRGA 2ELJA 5GP9A 2A5YB 2JPCA 3HM5A 3LSJA 2V1XA 2P81A 3TOAA 3DP7A 2V9VA 1BI3A 2R5ZA 3RKXA 2VJJA 1P6RA 4NC8A 1J9IA 4B43A 2CJJA 1R23A 1D8JA 3HG9A 3SFIA 2O61A 1KQ0A 2AXLA 3HIFA 3M07A 2O0YA 5CQEA 3JAMR 1WPKA 1B1BA 2DOFA 1D1CA 2JJ7A 2ZFUA 4XKCA 3K2ZA 3OIPA 1B6AA 2BY2A 4HG2A 3RPUA 2R0QC 3D5RC 3RKWA 3SYTA 2NOJB 4ETSA 2PMHA 1E3HA 1VI0A 1EA3A 4OIQF 2HPMA 2PJRA 4F91B 2L5QA 4KN7X 2X1CA 2VJIA 4KT6A 1MKMA 5D5XB 4BAYA 3HYIA 3BCBA 3BTJA 4A3MJ 2CQ7A 2VUMJ 2FE3A 2F5EA 4DZJA 1C0WA 1AWCA 2M0CA 3GFLA 3GFMA 4OWRB 3W6VA 4X0GA 3GLXA 2IGNA 1XCBA 1ZYRF 3M1CA 4RDUA 3U1DA 2LK2A 3OYIA 3AG1H 5LRRA 2P5VA 3TP3A 4YFNF 2X9DA 1FIAA 4DBRA 2EILH 3A0BC 4AYBA 3V7SA 4ZTFA 4D5CA 2O03A 2FA5A 3EUHC 3HSFA 2ICWG 4X6AJ 4JK1X 3KZIC 2CQNA 3PIOF 5M5WJ 2UUZA 1VQ8I 4EVIA 5D5WB 2CGPA 4ASNA 2VKHA 1GDTA 4I0AA 3TGNA 5F0HA 4HYEA 1A5JA 2OTLI 1QGPA 2JA8J 1Y1WJ 1WZ2A 2W7NA 2H09A 2DBBA 2JPBA 3CF2A 2DQRA 3ABTA 3HRUA 4NHJA 4DGWB 1HLVA 4MHGA 5IP7J 2DYRH 5EG0A 3BT9A 3X2QH 1JGSA 2ZNZA 5J8CA 3ZQGA 1ZLJA 3L2WA 2IS6A 5D6FA 4H4KC 5A2QK 1S7OA 1JUSA 2EBIA 2Q2EB 5LEKA 2V9KA 1G3WA 1T33A 4XSZF 4D9JA 2C6YA 2FNPA 3WTSC 3CUQA 2JVHA 3ASOH 1NHAA 2EIKH 4ZYDA 3K4CA 3HBLA 1OCTC 4OIPF 3DU5A 2OCCH 3DLAA 1PUFA 3GUDA 5EEAA 1B72A 2UZKA 5HS7A 4EJWA 4D0PA 3MEXA 2Q0OA 1QA6A 3FWEA 4Z2YA 4D5FA 1EH7A 3OYHA 3NQOA 4BE2A 1Z7UA 2V26A 4ITVA 4ZYEA 3P5JA 4DYRA 1JUMA 4U7BA 2P7CB 3KLNA 1ZG5A 3GO5A 1XX5A 1IAWA 1UG2A 3I64A 3A03A 4GYGA 4CYCA 1JHFA 5DD4A 2A6HF 3GTOJ 5KAIC 5A2QR 1V5EA 2CFOA 3FXOA 2XGCA 3PIPF 4CYDA 1O4XA 4OINF 3KEYA 4WWCA 4M6XA 1S7EA 1R22A 2DA1A 2RQQA 5DUIA 4GXOA 5LRSA 3S1MJ 2MGQA 2F5VA 1RC9A 4C3IJ 1HXDA 5FKOA 1QZEA 1DQUA 2KZGA 3BG5A 1I1SA 2E19A 1K4TA 4CCOA 3E6CC 1X1DA 4A2UA 5IP9J 2VN2A 1T0FA 2X4HA 2GWRA 4B3XA 1LEAA 1Y8RB 2K9SA 2JA2A 2BV6A 4UUVA 2QM3A 1B9MA 3WG7H 4QLCU 3QYEA 1X19A 2ZC2A 3O8HA 4S05A 1U8BA 2P6SA 1PYVA 3S1NJ 2F4IA 1NK2P 4HBLA 1I1GA 1U9NA 4L0YB 4EGYA 4M3FA 1TQMA 1WJDA 2B0LA 3VYRB 4Y13A 3GF2A 1U5TC 5B1BH 1AOYA 2EINH 3L7WA 5J1UA 5D8LB 1IN7A 1FWZA 2OAZA 5LD2C 2K9QA 1J75A 2CRGA 2LBFB 4C2MJ 2Z2SB 2KIUA 4GDFA 2Y75A 4A3JJ 2Y9YA 4W1UA 2MD5A 2MFZA 1X2MA 3GTGJ 2WBMA 2EA2A 3QQAA 2JRTA 4S04A 4PJLA 1TWHJ 3KETA 1U5TB 2K02A 3ZP5A 3G2BA 3H9QA 2PBIA 3CTAA 2W25A 3J7AY 5BNGA 3EETA 4C30A 1LVKA 3E1SA 1VZ0A 4HLXA 1WJAA 3WODF 1S7AA 1BI1A 1YQAA 1YITI 3FHNA 2GIZA 2A68F 2ZXJA 3OOPA 5K7HA 1SAXA 1S3JA 2W24A 2R7OA 4GYIA 4M73A 2CUJA 2RC4A 1AHDP 3FMQA 1YYVA 1VFCA 3SZPA 4RMNA 1XSXA 3JRDA 1JKPC 2HFHA 1RETA 4HZFA 4V2GA 2QQ9A 1GUUA 4YFXF 4BDZA 4PGGA 2FF4A 3P7NA 4LG3A 5M3MJ 3OYBA 3EDPA 1ETVA 2CO5A 2EWNA 3CCYA 4BY1J 2ACJA 4MFDA 1BW5A 2YSRA 3GFJA 4IJAA 3FXRA 2NS7A 4HX7A 1GV2A 1QRYA 4BHBA 2ID3A 1IN4A 3VPRA 1GT0C 2FMYA 4PCQA 2RNGA 4EJVA 3BOQA 1IO2A 4EM2A 4RM3A 1T56A 2VT2A 2BY0A 4F55A 4M6YA 3PNVA 2K7LA 4I98B 3JW4A 2XASA 1A36A 4BGDA 5HDKA 5L3DA 1Q1VA 1VQ5I 4BE1A 1MBGA 1W1WE 2B63J 2M4GA 2EH3A 1MJAA 2R7FA 3NARA 4A69C 2NAZA 2ZJPF 2QF7A 2DJNA 1IDZA 5FB2A 2PMUA 3T0YA 2NRAC 2LMDA 2BXYA 3MCZA 3KIOA 2K9LA 3J81K 4OAZA 2DLLA 1TW3A 2HTJA 1T95A 3DQVC 2GIVA 4LJZF 5BPDA 4DQ2A 4DNCA 3NWSA 1A31A 2NS8A 3J80Z 3MKLA 1FBSA 2Z16A 5B1AH 2DMUA 2HTSA 3BJOA 4RB3C 3TMOA 1XSDA 2M8EA 3E3VA 4KNYA 1B4AA 2CV2A 3D1NI 3HRSA 2QGUA 1HSTA 1SMYF 1BJAA 1SD7A 2G7HA 3G1MA 1CGPA 1I6XA 4NC7A 4ESFA 1OCZH 3D5SC 3PNTA 4I01A 3F72A 3I4MJ 2H1LA 4A3GJ 1TT0A 1T08B 2KJCA 3BR3A 1Y56A 2WY7Q 3CLOA 2ZMEC 1MSFC 2FNAA 3GXOA 3HOYJ 3AG4H 1W7PB 3BY6A 3ERED 4ENNA 2E34A 1P4WA 5C4XJ 3J81R 5FD6A 2PI0A 3BR6A 4A6EA 2K3PA 3S17J 4XM3A
chains in the Genus database with same CATH topology
1HBXG 1OPCA 5LEJA 2ZMEB 4IHSA 1WWXA 4R1HA 3ABUA 4EQQA 1KU3A 1MJ9A 3BWGA 3I71A 2XRNA 3GEZA 2FSWA 3JSPA 4KUMA 3GVAA 4MGRA 2LSOA 1VTNC 2KRFA 4ZH4F 3F3XA 4Q5SF 3I0TA 3BP8A 4LFUA 3PQJA 3KP7A 4B09A 3WTVC 3HOSA 5DEQA 3KP5A 2ZBKA 4XRFA 2GQQA 3E5QA 3QPHA 3ZMDA 2L02A 4HX4A 3VOEA 3U2RA 1G3SA 2CSOA 4KIBA 2HEOA 3IKTA 5DDGA 1BC8C 3J80K 1FC3A 4UNOA 1DPRA 5L3FA 3WTXC 1L3LA 4EGZA 4A5MA 3P9CA 4EJOA 1SMTA 3GWZA 1MJBA 2A3SA 3U9GA 4FX4A 3E5UA 4UVBA 3GYHX 5ILSA 2Q8KA 1ODDA 3D0SA 2DTRA 2HS5A 1WQ2A 5ICCA 1V3FA 2CG4A 3N97A 4F7ZA 1LDKB 1WSUA 1F5TA 1O57A 2ZKZA 4EV0A 2VOPA 3SFZA 1BBYA 2G9WA 4ENKA 4I0BA 4LK1F 3EYYA 2VOOA 4L9VA 1SFXA 4IRHA 3WGIA 3SZTA 5CVIA 4U7DA 1REPC 2Y0MA 4BH9A 3I4PA 1HW2A 4RGRA 1XDUA 1QBJA 2P5LC 2K4JA 3SQNA 4HQEA 1QPMA 4CO8A 1UFMA 3I5UA 3FZVA 3ECHA 3P9IA 4HF2A 4O6JA 4ON0A 2MA3A 4O5VA 4ZYHA 3DKWA 1T6SA 4KIGA 5HS8A 5F1RA 5E18F 1O7LA 2GA1A 5CVRA 2Y48A 5E20A 5AIPA 5LGUA 1Z9CA 3Q5FA 4FX0A 2HZTA 2VC1A 2QWWA 3F6VA 5IT3A 4HDUA 4PGHA 2K86A 2UXXA 2HYGD 1TNSA 5IT9Z 5FFXA 5FFZA 1G6NA 5DCMA 4RB0A 2AS5F 5E17F 3RPQA 2IT0A 2VBXA 5ERIA 1MDMB 3GZ5A 4L5IA 2D45A 2M5WA 3FMRA 4LG0A 3IWZA 4CICA 3HSRA 1R1TA 3DXJF 1O3QA 3E97A 4HX8A 1IXSB 1P4AA 3VB2A 1QZYA 1P92A 1FZPB 2IA0A 2E1NA 3L2CA 1IN5A 4HDVA 4BHCA 2XROA 1ZGJA 5FGMA 2VONA 3RDIA 1MZBA 2Z99A 4M9XA 4CGZA 2NNYA 2VXZA 3F8CA 2XHKA 1YIOA 2NNNA 3KP4A 2IP2A 3ISPA 1FY7A 1JHHA 4K2EA 2EA4A 5H6QA 1USTA 1S8NA 3TQNA 3QPTA 1BI0A 1IUYA 4BHPA 4M72A 1X3UA 1RZ4A 1PDNC 1TQPA 2EK5A 3W6KB 1JXSA 5DYMA 1HKTA 4MTDA 3F8BA 2JT1A 5LHHA 1U2WA 1SD6A 2WTEA 3EYIA 4M71A 1R58A 2KJBA 3RJPA 3QU3A 5H6RA 1U78A 3ZMUA 2ZFWA 4UHTA 4YG2F 1TTYA 5ICFA 3V7CA 1ZGAA 4HF1A 3WGGA 5L3BA 1Q1HA 2FEZA 2BBYA 1K78A 2CWEA 3Q9SA 2IJLA 3KP6A 2JTVA 1DP7P 3MZHA 4L9TA 3CJNA 5HDNA 3WU1B 2JSCA 3RI4A 4MQ9F 3RYRA 1HKSA 4BNCA 2P4WA 2ESHA 4JQFA 2WV0A 4WXHA 5L3GA 2FBKA 4A0YA 1YW9A 5HLGA 2Z3YA 3GW2A 1EH8A 3V8KA 1H9TA 2HGCA 1D3YA 4G6DA 2V1UA 1DDNA 1KA8A 1R1VA 2QLZA 4RB2C 1TBXA 2HWVA 3DV8A 5D8KB 1OKRA 2FBHA 1PP8F 2STWA 1UB9A 3MZYA 5LGTA 1HQCA 5BQTA 1CF7B 3MFKA 3QP6A 1DUXC 4H0EA 3T1BA 3DF8A 3I54A 2QQBA 4WXCA 4AIKA 4I02A 1SFUA 4IRIA 1Z05A 2ZO4A 2V79A 2UXNA 3G73A 1FBQA 1XSVA 5TJJA 3MAJA 4B8XA 2XAGA 1SD4A 2H27A 4G7ZF 3IHUA 3WG9A 4EJTA 3KCCA 5E8IA 2DT5A 1K7AA 4HLYA 4LB6B 4G94A 3V8LA 2EFOA 2XIGA 3E5XA 2W84A 1FSHA 4RGSA 3HUGA 1LB2A 2RV8A 4IF4A 2XGXA 2EV5A 3KZYA 1HKQA 4AD9A 1RIOH 1BI2A 3PFIA 1U8RA 5D6EA 4LGWA 4KT5C 1G3YA 2QYOA 2R3SA 2W85A 1OR7A 4LK0F 4L5JA 4E70A 1IXCA 5FO5A 3O2PE 4HV5A 1KQ8A 1FYKA 1D5VA 2EFPA 2XAHA 2G7UA 2H6CA 3ZN0A 4CXFA 3E6BA 4OU0A 5CYVA 2E7XA 1HSJA 3RTRA 3ZN1A 1Z6TA 1YW7A 3CUQC 3ML6A 2MBFA 3LA3A 4CZZA 4NQWA 2P6TA 2VBZA 1W7PD 3QP5A 3JTHA 4RAZA 4P5OA 2QVOA 1ONVA 4KA4A 4Y17A 3CUQB 3BROA 3I58A 5J8FA 2F5DA 5JI6A 2OA4A 2ZJ2A 3HTSB 4Y15A 1J7KA 1T2KA 2OD5A 1GHCA 1A04A 2FXAA 4L9NA 3P9KA 5FD5A 1O7FA 2IA2A 4OMYA 1KU2A 3TDZC 2FRHA 2A69F 2A6EF 3V8JA 3VEPA 3IWFA 2CQKA 3RYPA 1W4MA 2PFBA 4UV8A 5LHGA 4MNUA 4LLNA 3KFWX 2LF8A 1XB4A 3VFZA 1ON2A 4MEYF 2RNJA 5E8GA 2EFWA 2CYYA 2DU9A 2R7DA 5DCFA 4ESBA 5F6FA 4IXAA 4UVAA 2O6GE 4U88A 2IW5A 3C18A 4G7OF 5ICGA 4HOBA 4N9IA 5ILVA 3TO7A 1ZARA 3BZ6A 4PDKA 4A12A 4A6DA 3LA2A 4LLGF 2RGVA 2ADUA 1KGSA 3FXUA 5J6XA 4M9ZA 2J5OA 3E6DA 2CW0F 3NEUA 4BXUA 2X0LA 3SXYA 3KP3A 5LLQA 3KLOA 2ELHA 3AAFA 3GZ6A 1GVJA 3HRTA 5LBQA 5D5UB 2MLGA 1D8KA 2F2EA 4YIIA 3NRVA 1IN6A 1Z1DA 4ENJA 2EV6A 1T38A 3QAHA 2DK5A 2PN6A 3F8MA 1O3SA 1B9NA 2PEXA 1J5YA 3IC7A 2DAOA 2OQRA 1QNTA 1B59A 1ZAOA 2HDCA 2L4AA 3ZMSA 2XUBA 4XBFA 2VBYA 2YX7A 2XAQA 3FMSA 2WC2A 1YW8A 3KEQA 2Z5UA 2DW4A 1PUEE 2FU4A 5CVVA 4KFCA 3ECOA 1HW5A 3R6SA 2ISYA 2DPDA 4ENMA 5JHUA 1KYZA 1YO5C 2PG4A 5HDGA 1XMKA 5HS9A 1YS6A 3HSEA 3FXQA 3HRMA 2XAJA 4R8HA 1WKMA 1T39A 1FSEA 2P7VB 3IKVA 2RQPA 3LFKA 1MD0A 1STZA 3IL2A 1XN7A 4MEXF 4G9YA 4NB5A 3L09A 2M87A 2BEOA 1FYLA 3M9AA 4KDPA 4KN4X 5D4RA 1K79A 4CHUA 3KE2A 1GXQA 3J7AO 1IW7F 5L3CA 2FOKA 3N4MA 1RI7A 3WGHA 2CFXA 3WTZA 3M1EA 4I09A 2L3DA 1OMIA 4KIFA 3V4GA 2NS0A 2GXGA 4L0ZB 2LNBA 2ESNA 2GAUA 4FT8A 4HV6A 2FQ3A 3FX3A 4BQAA 2ISZA 3WE2A 3DPTA 4WCGA 2OZ6A 5K5OA 3B73A 3O6BB 1TW2A 1ZG3A 1HW1A 4LLLA 2EB7A 2XVCA 2MLKA 5K5RA 1F1ZA 1LNWA 5EEGA 2YR2A 1XD7A 2D1HA 2XAFA 4N0BA 3K1NA 3ROUA 1R5GA 1R00A 1RUOA 2DQLA 3S2WA 1U5TA 2L54A 2GXBA 4FHTA 3K9TA 4HA8A 5CVUA 3R60A 5A2QZ 2ETHA 1USSA 3KZZA 1J59A 4XLNF 3IRRA 2UWMA 5BMZA 2V6CA 1J0RA 2V1DA 4MQVA 4YFKF 1G3TA 5IT9K 3EQLF 2QENA 5CVJA 2HKOA 4U0YA 1FPQA 5BS6A 1TLHB 2IA1A 3LSTA 2HQRA 5H20A 3HTUA 5JFRA 1IZ1A 5K1YA 4R79A 5HLHA 3ZMVA 4LB5A 4WK8F 1FLIA 1FBUA 4WX9A 5DUKA 3V7RA 2EJRA 3BPVA 1LDDA 1P4XA 2H94A 1KU9A 4AWXB 2L01A 1E2XA 5K5QA 4L9JA 2F5CA 4LMYA 3ZQ7A 5LHIA 1W5SA 1W5TA 4OMZA 1KYWA 3RKYA 5DD8A 5KK1A 3FM3A 2KIFA 2RVCA 2M30A 2K27A 5AIQA 1DPUA 2L4MA 3IRQA 4HF0A 4O3MA 4N9HA 1FOKA 3T5XA 1I5ZA 3BJ6A 1ZHFA 1W7PA 2F5FA 3REOA 1OYIA 6PAXA 4U0WA 2DPUA 4KICA 1H9GA 4XLPF 1H0MA 1IF1A 1BN5A 3W6JB 1OYYA 2RKHA 2ZMEA 2XKPA 2QQAA 2LF7A 3R4KA 3T8RA 4M9SA 3RIRA 1E17A 1Y0UA 3MQ0A 2DI3A 1EH6A 1XGOA 1YS7A 2RDPA 4AIJA 1YTYA 4IRGA 5DCMB 2QZ8A 3D5LA 2LKPA 3GX4X 4OOIA 2WWYA 2VT3A 5HOOA 4LG0B 4EJUA 1IN8A 3K1MA 1T98A 2M1BA 1UHWA 4RB1A 2OU2A 1ZN2A 2EFQA 1LVAA 4GCVA 2VODA 2W57A 1ZREA 4Q48A 3JSOA 1O3RA 2XKOA 3ULQB 2PLYA 3J81Z 4IHTA 1ZG1A 4A5NA 2HR3A 2YPRA 4OIOF 3QOPA 2D2WA 4L18B 2KKOA 4KMFA 1UHMA 4BYYA 2EFNA 3L9FA 4CDGA 5D4SA 4PZJA 5JR3A 2ZCWA 4AVPA 3C1DA 4JBAA 3ZMZA 1J2XA 5HVQC 3TDUC 2D1VA 3SHFA 3LAJA 1U3EM 1O3TA 2STTA 4G7HF 1R7JA 4RGUA 2HKXA 2VE9A 3CUOA 2DFIA 2GA2A 1BM9A 3E6MA 5L3EA 4WF2A 2HOEA 1MGTA 4LD5A 3TOBA 1Z6RA 3KP2A 3LAPA 1TNTA 4HW0A 3Q9VA 3ZMTA 3I59A 1FNNA 3C7JA 5CJ9A 3FF5A 4EMSA 3BDDA 2QBYA 4ZZDA 1K78B 3C3WA 1ZH5A 5ED4A 3HHHA 3JTGA 1IXRC 2O8XA 4P96A 2Z9OA 2A07F 2TDXA 3DEUA 1RUNA 2BYVE 3F8NA 3FM5A 3KEOA 4P55A 1SFEA 5LGNA 4ZZLA 2JZYA 2OQGA 1LEBA 3WTYC 5E1WA 2PQ8A 1FX7A 4I7HA 1P2FA 5TRDA 1BC7C 5CLSA 4UV9A 2BE5F 2H6BA 2XV4S 1YG2A 3TO9A 4HQMA 5DV5A 2HQNA 3ELKA 1Z91A 2IPQX 3ZPLA 2A61A 2FBIA 1ZRFA 2E1CA 1FP1D 2YU3A 3COAC 1LDJA 3H92A 3M8FA 1WRJA 3R0JA 3G3ZA 1S6LA 3TKYA 3H3UA 3QU6A 1LQ1A 3I53A 2Z33A 1WI9A 2VC0A 1L0OC 1MDMA 4ZYGA 1ZLKA 1FT9A 1F4KA 3FHZA 1R36A 1SD5A 2PJPA 1BIAA 1F9NA 1IRFA 1TQIA 1XDSA 5HLIA 3BJAA 1JE8A 3K0LA 2BGCA 3M7GA 2OZUA 1KQ9A 1K6OA 2NYXA 3LQQA 1FP2A 1EV7A 1XGNA 4U0VA 5FLXZ 5BPIA 3CO6C 2IVMA 3WE3A 4RAYA 4GGGA 4P9FA 3O3KA 4UXNA 3H3ZA 4KMUX 4UVCA 2COMA 2DK8A 5F64A 5EEHA 5E1XA 2MC3A 5BOXA 3WTWC 2QUFA 1YFHA 4RS8A 2ZNYA 3TO6A 3R0AA 2GZWA 1ON1A 2P8TA 1XCVA 2MH9A 2EV0A 4G8XA 4HAMA 2MH2A 5ICEA 2P5KA 5JVTA 4IPAA 3DPLC 1UCRA 4KYWA 3LWFA 3F21A 1LJ9A 1ZRDA 3EUHA 1RNLA 1R1UA 5D5VB 3GFIA 3JAMZ 3F23A 4OIRF 3I59B 3L00A 3HHGA 5FLXK 3HOTA 2QBYB 1XGMA 1KU7A 2Q2EA 1PP7U 3R61A 2IRFG 4M74A 2YX4A 1QO0D 3K1PA 4MTEA 3WTTC 1ZRCA 1V4RA 3QRFF 1YLFA 4YIFA 1ULYA 1U6GA 1BOAA 2K4BA 5ILUA 4RGXA 2RN7A 3LA7A 4ESJA 4I2OA 3WTUC 4WXDA 1G4DA 4Q4ZF 5E1ZB 3PQKA 3DFGA 1S29A 1QQIA 2OBPA 1XGSA 4Q47A 2M45A 3BPXA 3F22A 4TV7A 1I27A 4QWQA 4A0XA 1GXPA 2O3FA 3F8FA 5AONA 4A0ZA 2VBWA 2DO7A 1QZZA 2FMLA 3CDHA 4P9UA 2VE8A 3VODA 5KVRA 3T8TA 3LQRA 4AIHA 1CF7A 1XMAA 2J5PA 3WU0A 2KIMA 4EM0B 2LDUA 4GO1A 3JAMK 3MWMA 4XSXF 4G6QA 4EM1A 3OV8A 2E7WA 1FYMA 1OYWA 3F6OA 1R5HA 2HYFA 3M8EA 4IVNA 1BIBA 3B02A 3K69A 3CO7C 1IRGA 2A5YB 2JPCA 2V1XA 3TOAA 3DP7A 2V9VA 1BI3A 3RKXA 1P6RA 1J9IA 1R23A 1D8JA 2O61A 1KQ0A 2AXLA 3HIFA 2O0YA 1B1BA 3K2ZA 1B6AA 3RPUA 3RKWA 4ETSA 2PMHA 4OIQF 4KN7X 1MKMA 5D5XB 4BAYA 3HYIA 2FE3A 2F5EA 1C0WA 1AWCA 3GFLA 3GFMA 3GLXA 1XCBA 1ZYRF 3U1DA 5LRRA 2P5VA 4YFNF 3V7SA 2O03A 2FA5A 3HSFA 4JK1X 4EVIA 5D5WB 2CGPA 4ASNA 4I0AA 3TGNA 4HYEA 1QGPA 2H09A 2DBBA 2JPBA 2DQRA 3ABTA 3HRUA 4NHJA 4MHGA 1JGSA 2ZNZA 5J8CA 1ZLJA 5D6FA 5A2QK 1S7OA 5LEKA 1G3WA 4XSZF 2C6YA 2FNPA 3WTSC 3CUQA 1NHAA 4ZYDA 4OIPF 3GUDA 2UZKA 5HS7A 4EJWA 4D0PA 3MEXA 2Q0OA 3FWEA 4Z2YA 1EH7A 3NQOA 1Z7UA 4ZYEA 4U7BA 2P7CB 3KLNA 1ZG5A 3GO5A 1IAWA 3I64A 4GYGA 1JHFA 5DD4A 2A6HF 4CYDA 4OINF 4WWCA 4M6XA 1R22A 5DUIA 4GXOA 5LRSA 1HXDA 1I1SA 3E6CC 4A2UA 2VN2A 1T0FA 2X4HA 2GWRA 1LEAA 2BV6A 4UUVA 2QM3A 1B9MA 4QLCU 4S05A 2P6SA 4HBLA 1I1GA 4L0YB 4EGYA 1TQMA 2B0LA 4Y13A 3GF2A 1U5TC 1AOYA 3L7WA 5D8LB 1IN7A 1FWZA 2OAZA 1J75A 2KIUA 2Y75A 2MD5A 2EA2A 2JRTA 4S04A 3KETA 1U5TB 2K02A 3ZP5A 2PBIA 3CTAA 2W25A 3EETA 4HLXA 3WODF 1S7AA 1BI1A 1YQAA 2A68F 2ZXJA 3OOPA 1SAXA 1S3JA 2W24A 4GYIA 4M73A 2RC4A 3FMQA 1YYVA 3SZPA 1XSXA 2HFHA 4HZFA 2QQ9A 4YFXF 4PGGA 2FF4A 3P7NA 3EDPA 2CO5A 2EWNA 2ACJA 2YSRA 3GFJA 4IJAA 3FXRA 4HX7A 4BHBA 1IN4A 2FMYA 4PCQA 4EJVA 3BOQA 4EM2A 2VT2A 4M6YA 2K7LA 4I98B 3JW4A 2XASA 5HDKA 5L3DA 2R7FA 1MJAA 2NAZA 5FB2A 2PMUA 3T0YA 2NRAC 3MCZA 3J81K 2DLLA 1TW3A 2HTJA 3DQVC 2GIVA 4LJZF 5BPDA 4DQ2A 4DNCA 3J80Z 1FBSA 2HTSA 3BJOA 4RB3C 1XSDA 2M8EA 3E3VA 4KNYA 1B4AA 3HRSA 1HSTA 1SMYF 1BJAA 1SD7A 2G7HA 1CGPA 1I6XA 4ESFA 4I01A 3F72A 2KJCA 3CLOA 2FNAA 3GXOA 1W7PB 3BY6A 3ERED 4ENNA 1P4WA 5FD6A 2PI0A 4A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HBX G;  1OPC A;  5LEJ A;  2ZME B;  4IHS A;  1WWX A;  4R1H A;  3ABU A;  4EQQ A;  1KU3 A;  1MJ9 A;  3BWG A;  3I71 A;  2XRN A;  3GEZ A;  2FSW A;  3JSP A;  4KUM A;  3GVA A;  4MGR A;  2LSO A;  1VTN C;  2KRF A;  4ZH4 F;  3F3X A;  4Q5S F;  3I0T A;  3BP8 A;  4LFU A;  3PQJ A;  3KP7 A;  4B09 A;  3WTV C;  3HOS A;  5DEQ A;  3KP5 A;  2ZBK A;  4XRF A;  2GQQ A;  3E5Q A;  3QPH A;  3ZMD A;  2L02 A;  4HX4 A;  3VOE A;  3U2R A;  1G3S A;  2CSO A;  4KIB A;  2HEO A;  3IKT A;  5DDG A;  1BC8 C;  3J80 K;  1FC3 A;  4UNO A;  1DPR A;  5L3F A;  3WTX C;  1L3L A;  4EGZ A;  4A5M A;  3P9C A;  4EJO A;  1SMT A;  3GWZ A;  1MJB A;  2A3S A;  3U9G A;  4FX4 A;  3E5U A;  4UVB A;  3GYH X;  5ILS A;  2Q8K A;  1ODD A;  3D0S A;  2DTR A;  2HS5 A;  1WQ2 A;  5ICC A;  1V3F A;  2CG4 A;  3N97 A;  4F7Z A;  1LDK B;  1WSU A;  1F5T A;  1O57 A;  2ZKZ A;  4EV0 A;  2VOP A;  3SFZ A;  1BBY A;  2G9W A;  4ENK A;  4I0B A;  4LK1 F;  3EYY A;  2VOO A;  4L9V A;  1SFX A;  4IRH A;  3WGI A;  3SZT A;  5CVI A;  4U7D A;  1REP C;  2Y0M A;  4BH9 A;  3I4P A;  1HW2 A;  4RGR A;  1XDU A;  1QBJ A;  2P5L C;  2K4J A;  3SQN A;  4HQE A;  1QPM A;  4CO8 A;  1UFM A;  3I5U A;  3FZV A;  3ECH A;  3P9I A;  4HF2 A;  4O6J A;  4ON0 A;  2MA3 A;  4O5V A;  4ZYH A;  3DKW A;  1T6S A;  4KIG A;  5HS8 A;  5F1R A;  5E18 F;  1O7L A;  2GA1 A;  5CVR A;  2Y48 A;  5E20 A;  5AIP A;  5LGU A;  1Z9C A;  3Q5F A;  4FX0 A;  2HZT A;  2VC1 A;  2QWW A;  3F6V A;  5IT3 A;  4HDU A;  4PGH A;  2K86 A;  2UXX A;  2HYG D;  1TNS A;  5IT9 Z;  5FFX A;  5FFZ A;  1G6N A;  5DCM A;  4RB0 A;  2AS5 F;  5E17 F;  3RPQ A;  2IT0 A;  2VBX A;  5ERI A;  1MDM B;  3GZ5 A;  4L5I A;  2D45 A;  2M5W A;  3FMR A;  4LG0 A;  3IWZ A;  4CIC A;  3HSR A;  1R1T A;  3DXJ F;  1O3Q A;  3E97 A;  4HX8 A;  1IXS B;  1P4A A;  3VB2 A;  1QZY A;  1P92 A;  1FZP B;  2IA0 A;  2E1N A;  3L2C A;  1IN5 A;  4HDV A;  4BHC A;  2XRO A;  1ZGJ A;  5FGM A;  2VON A;  3RDI A;  1MZB A;  2Z99 A;  4M9X A;  4CGZ A;  2NNY A;  2VXZ A;  3F8C A;  2XHK A;  1YIO A;  2NNN A;  3KP4 A;  2IP2 A;  3ISP A;  1FY7 A;  1JHH A;  4K2E A;  2EA4 A;  5H6Q A;  1UST A;  1S8N A;  3TQN A;  3QPT A;  1BI0 A;  1IUY A;  4BHP A;  4M72 A;  1X3U A;  1RZ4 A;  1PDN C;  1TQP A;  2EK5 A;  3W6K B;  1JXS A;  5DYM A;  1HKT A;  4MTD A;  3F8B A;  2JT1 A;  5LHH A;  1U2W A;  1SD6 A;  2WTE A;  3EYI A;  4M71 A;  1R58 A;  2KJB A;  3RJP A;  3QU3 A;  5H6R A;  1U78 A;  3ZMU A;  2ZFW A;  4UHT A;  4YG2 F;  1TTY A;  5ICF A;  3V7C A;  1ZGA A;  4HF1 A;  3WGG A;  5L3B A;  1Q1H A;  2FEZ A;  2BBY A;  1K78 A;  2CWE A;  3Q9S A;  2IJL A;  3KP6 A;  2JTV A;  1DP7 P;  3MZH A;  4L9T A;  3CJN A;  5HDN A;  3WU1 B;  2JSC A;  3RI4 A;  4MQ9 F;  3RYR A;  1HKS A;  4BNC A;  2P4W A;  2ESH A;  4JQF A;  2WV0 A;  4WXH A;  5L3G A;  2FBK A;  4A0Y A;  1YW9 A;  5HLG A;  2Z3Y A;  3GW2 A;  1EH8 A;  3V8K A;  1H9T A;  2HGC A;  1D3Y A;  4G6D A;  2V1U A;  1DDN A;  1KA8 A;  1R1V A;  2QLZ A;  4RB2 C;  1TBX A;  2HWV A;  3DV8 A;  5D8K B;  1OKR A;  2FBH A;  1PP8 F;  2STW A;  1UB9 A;  3MZY A;  5LGT A;  1HQC A;  5BQT A;  1CF7 B;  3MFK A;  3QP6 A;  1DUX C;  4H0E A;  3T1B A;  3DF8 A;  3I54 A;  2QQB A;  4WXC A;  4AIK A;  4I02 A;  1SFU A;  4IRI A;  1Z05 A;  2ZO4 A;  2V79 A;  2UXN A;  3G73 A;  1FBQ A;  1XSV A;  5TJJ A;  3MAJ A;  4B8X A;  2XAG A;  1SD4 A;  2H27 A;  4G7Z F;  3IHU A;  3WG9 A;  4EJT A;  3KCC A;  5E8I A;  2DT5 A;  1K7A A;  4HLY A;  4LB6 B;  4G94 A;  3V8L A;  2EFO A;  2XIG A;  3E5X A;  2W84 A;  1FSH A;  4RGS A;  3HUG A;  1LB2 A;  2RV8 A;  4IF4 A;  2XGX A;  2EV5 A;  3KZY A;  1HKQ A;  4AD9 A;  1RIO H;  1BI2 A;  3PFI A;  1U8R A;  5D6E A;  4LGW A;  4KT5 C;  1G3Y A;  2QYO A;  2R3S A;  2W85 A;  1OR7 A;  4LK0 F;  4L5J A;  4E70 A;  1IXC A;  5FO5 A;  3O2P E;  4HV5 A;  1KQ8 A;  1FYK A;  1D5V A;  2EFP A;  2XAH A;  2G7U A;  2H6C A;  3ZN0 A;  4CXF A;  3E6B A;  4OU0 A;  5CYV A;  2E7X A;  1HSJ A;  3RTR A;  3ZN1 A;  1Z6T A;  1YW7 A;  3CUQ C;  3ML6 A;  2MBF A;  3LA3 A;  4CZZ A;  4NQW A;  2P6T A;  2VBZ A;  1W7P D;  3QP5 A;  3JTH A;  4RAZ A;  4P5O A;  2QVO A;  1ONV A;  4KA4 A;  4Y17 A;  3CUQ B;  3BRO A;  3I58 A;  5J8F A;  2F5D A;  5JI6 A;  2OA4 A;  2ZJ2 A;  3HTS B;  4Y15 A;  1J7K A;  1T2K A;  2OD5 A;  1GHC A;  1A04 A;  2FXA A;  4L9N A;  3P9K A;  5FD5 A;  1O7F A;  2IA2 A;  4OMY A;  1KU2 A;  3TDZ C;  2FRH A;  2A69 F;  2A6E F;  3V8J A;  3VEP A;  3IWF A;  2CQK A;  3RYP A;  1W4M A;  2PFB A;  4UV8 A;  5LHG A;  4MNU A;  4LLN A;  3KFW X;  2LF8 A;  1XB4 A;  3VFZ A;  1ON2 A;  4MEY F;  2RNJ A;  5E8G A;  2EFW A;  2CYY A;  2DU9 A;  2R7D A;  5DCF A;  4ESB A;  5F6F A;  4IXA A;  4UVA A;  2O6G E;  4U88 A;  2IW5 A;  3C18 A;  4G7O F;  5ICG A;  4HOB A;  4N9I A;  5ILV A;  3TO7 A;  1ZAR A;  3BZ6 A;  4PDK A;  4A12 A;  4A6D A;  3LA2 A;  4LLG F;  2RGV A;  2ADU A;  1KGS A;  3FXU A;  5J6X A;  4M9Z A;  2J5O A;  3E6D A;  2CW0 F;  3NEU A;  4BXU A;  2X0L A;  3SXY A;  3KP3 A;  5LLQ A;  3KLO A;  2ELH A;  3AAF A;  3GZ6 A;  1GVJ A;  3HRT A;  5LBQ A;  5D5U B;  2MLG A;  1D8K A;  2F2E A;  4YII A;  3NRV A;  1IN6 A;  1Z1D A;  4ENJ A;  2EV6 A;  1T38 A;  3QAH A;  2DK5 A;  2PN6 A;  3F8M A;  1O3S A;  1B9N A;  2PEX A;  1J5Y A;  3IC7 A;  2DAO A;  2OQR A;  1QNT A;  1B59 A;  1ZAO A;  2HDC A;  2L4A A;  3ZMS A;  2XUB A;  4XBF A;  2VBY A;  2YX7 A;  2XAQ A;  3FMS A;  2WC2 A;  1YW8 A;  3KEQ A;  2Z5U A;  2DW4 A;  1PUE E;  2FU4 A;  5CVV A;  4KFC A;  3ECO A;  1HW5 A;  3R6S A;  2ISY A;  2DPD A;  4ENM A;  5JHU A;  1KYZ A;  1YO5 C;  2PG4 A;  5HDG A;  1XMK A;  5HS9 A;  1YS6 A;  3HSE A;  3FXQ A;  3HRM A;  2XAJ A;  4R8H A;  1WKM A;  1T39 A;  1FSE A;  2P7V B;  3IKV A;  2RQP A;  3LFK A;  1MD0 A;  1STZ A;  3IL2 A;  1XN7 A;  4MEX F;  4G9Y A;  4NB5 A;  3L09 A;  2M87 A;  2BEO A;  1FYL A;  3M9A A;  4KDP A;  4KN4 X;  5D4R A;  1K79 A;  4CHU A;  3KE2 A;  1GXQ A;  3J7A O;  1IW7 F;  5L3C A;  2FOK A;  3N4M A;  1RI7 A;  3WGH A;  2CFX A;  3WTZ A;  3M1E A;  4I09 A;  2L3D A;  1OMI A;  4KIF A;  3V4G A;  2NS0 A;  2GXG A;  4L0Z B;  2LNB A;  2ESN A;  2GAU A;  4FT8 A;  4HV6 A;  2FQ3 A;  3FX3 A;  4BQA A;  2ISZ A;  3WE2 A;  3DPT A;  4WCG A;  2OZ6 A;  5K5O A;  3B73 A;  3O6B B;  1TW2 A;  1ZG3 A;  1HW1 A;  4LLL A;  2EB7 A;  2XVC A;  2MLK A;  5K5R A;  1F1Z A;  1LNW A;  5EEG A;  2YR2 A;  1XD7 A;  2D1H A;  2XAF A;  4N0B A;  3K1N A;  3ROU A;  1R5G A;  1R00 A;  1RUO A;  2DQL A;  3S2W A;  1U5T A;  2L54 A;  2GXB A;  4FHT A;  3K9T A;  4HA8 A;  5CVU A;  3R60 A;  5A2Q Z;  2ETH A;  1USS A;  3KZZ A;  1J59 A;  4XLN F;  3IRR A;  2UWM A;  5BMZ A;  2V6C A;  1J0R A;  2V1D A;  4MQV A;  4YFK F;  1G3T A;  5IT9 K;  3EQL F;  2QEN A;  5CVJ A;  2HKO A;  4U0Y A;  1FPQ A;  5BS6 A;  1TLH B;  2IA1 A;  3LST A;  2HQR A;  5H20 A;  3HTU A;  5JFR A;  1IZ1 A;  5K1Y A;  4R79 A;  5HLH A;  3ZMV A;  4LB5 A;  4WK8 F;  1FLI A;  1FBU A;  4WX9 A;  5DUK A;  3V7R A;  2EJR A;  3BPV A;  1LDD A;  1P4X A;  2H94 A;  1KU9 A;  4AWX B;  2L01 A;  1E2X A;  5K5Q A;  4L9J A;  2F5C A;  4LMY A;  3ZQ7 A;  5LHI A;  1W5S A;  1W5T A;  4OMZ A;  1KYW A;  3RKY A;  5DD8 A;  5KK1 A;  3FM3 A;  2KIF A;  2RVC A;  2M30 A;  2K27 A;  5AIQ A;  1DPU A;  2L4M A;  3IRQ A;  4HF0 A;  4O3M A;  4N9H A;  1FOK A;  3T5X A;  1I5Z A;  3BJ6 A;  1ZHF A;  1W7P A;  2F5F A;  3REO A;  1OYI A;  6PAX A;  4U0W A;  2DPU A;  4KIC A;  1H9G A;  4XLP F;  1H0M A;  1IF1 A;  1BN5 A;  3W6J B;  1OYY A;  2RKH A;  2ZME A;  2XKP A;  2QQA A;  2LF7 A;  3R4K A;  3T8R A;  4M9S A;  3RIR A;  1E17 A;  1Y0U A;  3MQ0 A;  2DI3 A;  1EH6 A;  1XGO A;  1YS7 A;  2RDP A;  4AIJ A;  1YTY A;  4IRG A;  5DCM B;  2QZ8 A;  3D5L A;  2LKP A;  3GX4 X;  4OOI A;  2WWY A;  2VT3 A;  5HOO A;  4LG0 B;  4EJU A;  1IN8 A;  3K1M A;  1T98 A;  2M1B A;  1UHW A;  4RB1 A;  2OU2 A;  1ZN2 A;  2EFQ A;  1LVA A;  4GCV A;  2VOD A;  2W57 A;  1ZRE A;  4Q48 A;  3JSO A;  1O3R A;  2XKO A;  3ULQ B;  2PLY A;  3J81 Z;  4IHT A;  1ZG1 A;  4A5N A;  2HR3 A;  2YPR A;  4OIO F;  3QOP A;  2D2W A;  4L18 B;  2KKO A;  4KMF A;  1UHM A;  4BYY A;  2EFN A;  3L9F A;  4CDG A;  5D4S A;  4PZJ A;  5JR3 A;  2ZCW A;  4AVP A;  3C1D A;  4JBA A;  3ZMZ A;  1J2X A;  5HVQ C;  3TDU C;  2D1V A;  3SHF A;  3LAJ A;  1U3E M;  1O3T A;  2STT A;  4G7H F;  1R7J A;  4RGU A;  2HKX A;  2VE9 A;  3CUO A;  2DFI A;  2GA2 A;  1BM9 A;  3E6M A;  5L3E A;  4WF2 A;  2HOE A;  1MGT A;  4LD5 A;  3TOB A;  1Z6R A;  3KP2 A;  3LAP A;  1TNT A;  4HW0 A;  3Q9V A;  3ZMT A;  3I59 A;  1FNN A;  3C7J A;  5CJ9 A;  3FF5 A;  4EMS A;  3BDD A;  2QBY A;  4ZZD A;  1K78 B;  3C3W A;  1ZH5 A;  5ED4 A;  3HHH A;  3JTG A;  1IXR C;  2O8X A;  4P96 A;  2Z9O A;  2A07 F;  2TDX A;  3DEU A;  1RUN A;  2BYV E;  3F8N A;  3FM5 A;  3KEO A;  4P55 A;  1SFE A;  5LGN A;  4ZZL A;  2JZY A;  2OQG A;  1LEB A;  3WTY C;  5E1W A;  2PQ8 A;  1FX7 A;  4I7H A;  1P2F A;  5TRD A;  1BC7 C;  5CLS A;  4UV9 A;  2BE5 F;  2H6B A;  2XV4 S;  1YG2 A;  3TO9 A;  4HQM A;  5DV5 A;  2HQN A;  3ELK A;  1Z91 A;  2IPQ X;  3ZPL A;  2A61 A;  2FBI A;  1ZRF A;  2E1C A;  1FP1 D;  2YU3 A;  3COA C;  1LDJ A;  3H92 A;  3M8F A;  1WRJ A;  3R0J A;  3G3Z A;  1S6L A;  3TKY A;  3H3U A;  3QU6 A;  1LQ1 A;  3I53 A;  2Z33 A;  1WI9 A;  2VC0 A;  1L0O C;  1MDM A;  4ZYG A;  1ZLK A;  1FT9 A;  1F4K A;  3FHZ A;  1R36 A;  1SD5 A;  2PJP A;  1BIA A;  1F9N A;  1IRF A;  1TQI A;  1XDS A;  5HLI A;  3BJA A;  1JE8 A;  3K0L A;  2BGC A;  3M7G A;  2OZU A;  1KQ9 A;  1K6O A;  2NYX A;  3LQQ A;  1FP2 A;  1EV7 A;  1XGN A;  4U0V A;  5FLX Z;  5BPI A;  3CO6 C;  2IVM A;  3WE3 A;  4RAY A;  4GGG A;  4P9F A;  3O3K A;  4UXN A;  3H3Z A;  4KMU X;  4UVC A;  2COM A;  2DK8 A;  5F64 A;  5EEH A;  5E1X A;  2MC3 A;  5BOX A;  3WTW C;  2QUF A;  1YFH A;  4RS8 A;  2ZNY A;  3TO6 A;  3R0A A;  2GZW A;  1ON1 A;  2P8T A;  1XCV A;  2MH9 A;  2EV0 A;  4G8X A;  4HAM A;  2MH2 A;  5ICE A;  2P5K A;  5JVT A;  4IPA A;  3DPL C;  1UCR A;  4KYW A;  3LWF A;  3F21 A;  1LJ9 A;  1ZRD A;  3EUH A;  1RNL A;  1R1U A;  5D5V B;  3GFI A;  3JAM Z;  3F23 A;  4OIR F;  3I59 B;  3L00 A;  3HHG A;  5FLX K;  3HOT A;  2QBY B;  1XGM A;  1KU7 A;  2Q2E A;  1PP7 U;  3R61 A;  2IRF G;  4M74 A;  2YX4 A;  1QO0 D;  3K1P A;  4MTE A;  3WTT C;  1ZRC A;  1V4R A;  3QRF F;  1YLF A;  4YIF A;  1ULY A;  1U6G A;  1BOA A;  2K4B A;  5ILU A;  4RGX A;  2RN7 A;  3LA7 A;  4ESJ A;  4I2O A;  3WTU C;  4WXD A;  1G4D A;  4Q4Z F;  5E1Z B;  3PQK A;  3DFG A;  1S29 A;  1QQI A;  2OBP A;  1XGS A;  4Q47 A;  2M45 A;  3BPX A;  3F22 A;  4TV7 A;  1I27 A;  4QWQ A;  4A0X A;  1GXP A;  2O3F A;  3F8F A;  5AON A;  4A0Z A;  2VBW A;  2DO7 A;  1QZZ A;  2FML A;  3CDH A;  4P9U A;  2VE8 A;  3VOD A;  5KVR A;  3T8T A;  3LQR A;  4AIH A;  1CF7 A;  1XMA A;  2J5P A;  3WU0 A;  2KIM A;  4EM0 B;  2LDU A;  4GO1 A;  3JAM K;  3MWM A;  4XSX F;  4G6Q A;  4EM1 A;  3OV8 A;  2E7W A;  1FYM A;  1OYW A;  3F6O A;  1R5H A;  2HYF A;  3M8E A;  4IVN A;  1BIB A;  3B02 A;  3K69 A;  3CO7 C;  1IRG A;  2A5Y B;  2JPC A;  2V1X A;  3TOA A;  3DP7 A;  2V9V A;  1BI3 A;  3RKX A;  1P6R A;  1J9I A;  1R23 A;  1D8J A;  2O61 A;  1KQ0 A;  2AXL A;  3HIF A;  2O0Y A;  1B1B A;  3K2Z A;  1B6A A;  3RPU A;  3RKW A;  4ETS A;  2PMH A;  4OIQ F;  4KN7 X;  1MKM A;  5D5X B;  4BAY A;  3HYI A;  2FE3 A;  2F5E A;  1C0W A;  1AWC A;  3GFL A;  3GFM A;  3GLX A;  1XCB A;  1ZYR F;  3U1D A;  5LRR A;  2P5V A;  4YFN F;  3V7S A;  2O03 A;  2FA5 A;  3HSF A;  4JK1 X;  4EVI A;  5D5W B;  2CGP A;  4ASN A;  4I0A A;  3TGN A;  4HYE A;  1QGP A;  2H09 A;  2DBB A;  2JPB A;  2DQR A;  3ABT A;  3HRU A;  4NHJ A;  4MHG A;  1JGS A;  2ZNZ A;  5J8C A;  1ZLJ A;  5D6F A;  5A2Q K;  1S7O A;  5LEK A;  1G3W A;  4XSZ F;  2C6Y A;  2FNP A;  3WTS C;  3CUQ A;  1NHA A;  4ZYD A;  4OIP F;  3GUD A;  2UZK A;  5HS7 A;  4EJW A;  4D0P A;  3MEX A;  2Q0O A;  3FWE A;  4Z2Y A;  1EH7 A;  3NQO A;  1Z7U A;  4ZYE A;  4U7B A;  2P7C B;  3KLN A;  1ZG5 A;  3GO5 A;  1IAW A;  3I64 A;  4GYG A;  1JHF A;  5DD4 A;  2A6H F;  4CYD A;  4OIN F;  4WWC A;  4M6X A;  1R22 A;  5DUI A;  4GXO A;  5LRS A;  1HXD A;  1I1S A;  3E6C C;  4A2U A;  2VN2 A;  1T0F A;  2X4H A;  2GWR A;  1LEA A;  2BV6 A;  4UUV A;  2QM3 A;  1B9M A;  4QLC U;  4S05 A;  2P6S A;  4HBL A;  1I1G A;  4L0Y B;  4EGY A;  1TQM A;  2B0L A;  4Y13 A;  3GF2 A;  1U5T C;  1AOY A;  3L7W A;  5D8L B;  1IN7 A;  1FWZ A;  2OAZ A;  1J75 A;  2KIU A;  2Y75 A;  2MD5 A;  2EA2 A;  2JRT A;  4S04 A;  3KET A;  1U5T B;  2K02 A;  3ZP5 A;  2PBI A;  3CTA A;  2W25 A;  3EET A;  4HLX A;  3WOD F;  1S7A A;  1BI1 A;  1YQA A;  2A68 F;  2ZXJ A;  3OOP A;  1SAX A;  1S3J A;  2W24 A;  4GYI A;  4M73 A;  2RC4 A;  3FMQ A;  1YYV A;  3SZP A;  1XSX A;  2HFH A;  4HZF A;  2QQ9 A;  4YFX F;  4PGG A;  2FF4 A;  3P7N A;  3EDP A;  2CO5 A;  2EWN A;  2ACJ A;  2YSR A;  3GFJ A;  4IJA A;  3FXR A;  4HX7 A;  4BHB A;  1IN4 A;  2FMY A;  4PCQ A;  4EJV A;  3BOQ A;  4EM2 A;  2VT2 A;  4M6Y A;  2K7L A;  4I98 B;  3JW4 A;  2XAS A;  5HDK A;  5L3D A;  2R7F A;  1MJA A;  2NAZ A;  5FB2 A;  2PMU A;  3T0Y A;  2NRA C;  3MCZ A;  3J81 K;  2DLL A;  1TW3 A;  2HTJ A;  3DQV C;  2GIV A;  4LJZ F;  5BPD A;  4DQ2 A;  4DNC A;  3J80 Z;  1FBS A;  2HTS A;  3BJO A;  4RB3 C;  1XSD A;  2M8E A;  3E3V A;  4KNY A;  1B4A A;  3HRS A;  1HST A;  1SMY F;  1BJA A;  1SD7 A;  2G7H A;  1CGP A;  1I6X A;  4ESF A;  4I01 A;  3F72 A;  2KJC A;  3CLO A;  2FNA A;  3GXO A;  1W7P B;  3BY6 A;  3ERE D;  4ENN A;  1P4W A;  5FD6 A;  2PI0 A;  4A6E A; 
#chains in the Genus database with same CATH topology
 1HBX G;  1OPC A;  2X1D A;  5LEJ A;  5F08 A;  3W2W A;  3I56 I;  2ZME B;  1SVL A;  3OWT A;  4XRS G;  3K4B A;  4IHS A;  2DMP A;  1BJZ A;  2M7A A;  1WWX A;  4R1H A;  1Z0X A;  3ABU A;  3S3O A;  3OS1 A;  3V42 A;  4EQQ A;  1AU7 A;  1KU3 A;  2MSY A;  2FJ1 A;  1MJ9 A;  3BWG A;  2LY1 A;  3I71 A;  3PO3 J;  2XRN A;  9ANT A;  3GEZ A;  2FSW A;  4CYC B;  1Z77 A;  1HA8 A;  3JSP A;  1K61 A;  4KUM A;  3GVA A;  4CCL A;  3PSI A;  4MGR A;  3HOX J;  1ZEL A;  3FXK A;  1T0F C;  2LSO A;  1MSE C;  1VTN C;  2KRF A;  2F48 A;  4ZH4 F;  3F3X A;  3RZO J;  1R9T J;  4Q5S F;  2WAF A;  3I0T A;  3BP8 A;  2Q1Z B;  4LFU A;  3PQJ A;  2JUC A;  3IUO A;  3WU2 C;  3KP7 A;  2CQX A;  4B09 A;  3WTV C;  3HOS A;  2VI6 A;  5DEQ A;  3KP5 A;  2ZBK A;  4XRF A;  2GQQ A;  2LP0 A;  3E5Q A;  3QPH A;  3A02 A;  3ZMD A;  4A3K J;  4DYQ A;  2L02 A;  4HX4 A;  5CPR B;  3VOE A;  3U2R A;  1CQT A;  1G3S A;  2K9N A;  2CSO A;  1WGX A;  4KIB A;  2HEO A;  5B5E C;  3IKT A;  2E71 A;  1QVU A;  1OCC H;  5DDG A;  3LSP A;  1BC8 C;  3J80 K;  1FC3 A;  1MBJ A;  4LOC A;  4UNO A;  2V9P A;  1SFK A;  1DPR A;  5L3F A;  3WTX C;  4KJZ A;  2B7E A;  3K70 D;  1L3L A;  2DA6 A;  3RCO A;  4EGZ A;  2JA5 J;  2E1M C;  4A5M A;  3P9C A;  4EJO A;  1LUJ B;  4BJ6 C;  3S32 A;  3FXJ A;  1SMT A;  2YS9 A;  2WAQ N;  3GWZ A;  3J7A W;  4BJT A;  2VKE A;  2MUN A;  1MJB A;  2A3S A;  2M9H A;  3U9G A;  4PJM A;  4FX4 A;  3QPL A;  3E5U A;  4HEA 2;  2IGK A;  2X6W A;  2M34 A;  2E1M B;  5M3F J;  4UVB A;  1PVE A;  3GYH X;  1X1C A;  3CES A;  1W0U A;  3CMA I;  4IOC F;  5ILS A;  2QA4 I;  2Q8K A;  2V7F A;  3J80 R;  2K85 A;  4Y33 A;  1ODD A;  3D0S A;  2DTR A;  2HS5 A;  1WQ2 A;  5ICC A;  1V3F A;  5M5Y J;  2FD5 A;  1GVD A;  2QQ8 A;  2CG4 A;  2M2E A;  2IGO A;  2A05 A;  3N97 A;  1YIJ I;  2CUZ A;  3UR3 C;  4F7Z A;  4G12 A;  3OSG A;  3BR5 A;  4J19 A;  1JKQ C;  5IPA A;  1LDK B;  1WSU A;  2R7V A;  1F5T A;  3HOZ J;  3HL2 A;  1ZQ3 P;  1O57 A;  2ZKZ A;  3OYJ A;  3JCU C;  5F0C A;  1X3Z B;  4EV0 A;  3MKY B;  2VOP A;  1OCR H;  3SFZ A;  4XN3 A;  2KHM A;  4GFB A;  1BBY A;  2R5Y A;  2KFD A;  4XKW A;  2H8R A;  2VLA A;  4ANJ A;  1WCM J;  1DP3 A;  2G9W A;  2EIM H;  4ENK A;  4I0B A;  4LK1 F;  3EYY A;  3HGG A;  4ZDP A;  2OTJ I;  2VOO A;  1VQN I;  3JRG A;  4L9V A;  1SFX A;  1X1P A;  3LSG A;  4BL0 B;  4IRH A;  3OL3 A;  3WGI A;  4E7H A;  2LYC A;  3AFH A;  2QSF X;  4I76 A;  2B9S A;  3PJR A;  3ZGK A;  2CV0 A;  3SZT A;  5CVI A;  3OYG A;  4XK4 A;  5HNF A;  2KQR A;  4U7D A;  3OL4 A;  2VL8 A;  1REP C;  1MND A;  2AO9 A;  3LSR A;  2Y0M A;  4BH9 A;  1QVT A;  3I4P A;  5EZG A;  1HW2 A;  3H3V K;  4RGR A;  2WV1 A;  1XDU A;  2V6E A;  1QBJ A;  1V5G A;  2P5L C;  1ETW A;  2K4J A;  4FIS A;  1H8A C;  3SQN A;  4HQE A;  1QPM A;  4CO8 A;  1UFM A;  3I5U A;  3HZJ A;  4MO7 A;  1Z21 A;  3ESW B;  2WAQ A;  3FZV A;  5GTH C;  2HU9 A;  3ECH A;  1F43 A;  3P9I A;  4HF2 A;  4FE7 A;  4O6J A;  5KNL A;  4ON0 A;  4IQJ A;  4S0H B;  2MA3 A;  1JGG A;  3K4J A;  4BQQ A;  5IYB J;  3QOD A;  4O5V A;  4ZYH A;  1IV6 A;  3DKW A;  4XMY A;  1RPW A;  3VSL A;  1T6S A;  4KIG A;  5HS8 A;  5F1R A;  3GTP J;  5E18 F;  1O7L A;  1DGW Y;  2L2O A;  2GA1 A;  1SAN A;  5CVR A;  1RQ6 A;  2Y48 A;  5M5X J;  5E20 A;  5AIP A;  5LGU A;  1Z9C A;  1I3Q J;  4JX4 A;  4FX0 A;  2HZT A;  1OIS A;  3KPH A;  3Q5F A;  3S16 J;  2VC1 A;  1BOB A;  2QWW A;  3F6V A;  5IT3 A;  4HDU A;  1BR1 A;  1P7I A;  2K3F A;  2K86 A;  2UXX A;  4PGH A;  3OYK A;  2YUS A;  4MIM A;  3OYM A;  2HYG D;  1TNS A;  1LE8 A;  5IT9 Z;  2EPF A;  5FKN A;  2LY9 A;  4AID A;  1UG0 A;  3B6A A;  3L1P A;  4IHV A;  1XC5 A;  5FFX A;  5FFZ A;  1G6N A;  5DCM A;  4RB0 A;  2AS5 F;  3JRB A;  1NK3 P;  5E17 F;  3RPQ A;  2IT0 A;  2VBX A;  5ERI A;  1MDM B;  2DOD A;  4XKV A;  3GZ5 A;  4L5I A;  5EGO B;  2D45 A;  1YHQ I;  2KZV A;  1P9Q C;  2MD0 A;  5JHF A;  2M5W A;  3FMR A;  4LG0 A;  4XLC A;  3IWZ A;  4CIC A;  3HSR A;  1R1T A;  3DXJ F;  3MN2 A;  1O3Q A;  1IG7 A;  1WJF A;  3E97 A;  1JT0 A;  4HX8 A;  1IXS B;  3VSK A;  1P4A A;  1S5L C;  2HI3 A;  2M35 A;  4NBQ A;  3VB2 A;  1QZY A;  2COB A;  1P92 A;  1FZP B;  1GLN A;  2IA0 A;  3S14 J;  2FUG 2;  2R4G A;  3M8J A;  2E1N A;  1FMW A;  1ORK A;  5J3L A;  1DU0 A;  3L2C A;  1IN5 A;  4IL6 C;  3DWL E;  1VQK I;  5F1J A;  4HDV A;  3EUK L;  1APL C;  3SEZ A;  4BBR J;  3A52 A;  4BHC A;  2I8D A;  2XRO A;  1ZGJ A;  5B3S H;  2L9V A;  4LIT A;  5FGM A;  2VON A;  3RDI A;  2RAE A;  3GTL J;  1MZB A;  2Z99 A;  4M9X A;  4CGZ A;  2NNY A;  2VXZ A;  3K4L A;  3F8C A;  2XHK A;  1YIO A;  1K83 J;  2NNN A;  2KL4 A;  3KP4 A;  2IP2 A;  3ISP A;  1FY7 A;  4PK4 A;  1JHH A;  4K2E A;  4PJ0 C;  2EA4 A;  3S93 A;  2XB5 A;  5H6Q A;  1UST A;  2JA6 J;  3HB9 A;  1S8N A;  1JJ6 C;  3TQN A;  3QPT A;  1BI0 A;  4UB8 C;  4XLE A;  1IUY A;  1FTZ A;  4BHP A;  5DS9 A;  4M72 A;  3WHB A;  3L2Q A;  1X3U A;  1RZ4 A;  2XB0 X;  1PDN C;  4M3G A;  1TQP A;  2EK5 A;  4A3I J;  2W00 A;  3FBI B;  2OJE D;  2KIQ A;  1LFP A;  3W6K B;  2L7M P;  3PUF A;  2GLO A;  1KON A;  1WVR A;  1JXS A;  1I50 J;  5DYM A;  2DA5 A;  1HKT A;  2LG4 A;  4MTD A;  3F8B A;  1FMV A;  2JT1 A;  1LKX A;  2NVX J;  2VJ5 A;  5LHH A;  1X1B A;  2KPM A;  1JKO C;  1U2W A;  1ZR2 A;  1RKT A;  2IS4 A;  1SD6 A;  3SZG A;  2WTE A;  5JLX A;  3EYI A;  4M71 A;  3FKI J;  2R7W A;  1R58 A;  2KJB A;  4N4N B;  3QU3 A;  3RJP A;  3S15 J;  5E3N A;  1MBK A;  2L7K A;  3S3N A;  4XKB A;  5H6R A;  4U87 A;  1U78 A;  5HNH A;  3ZMU A;  1IRX A;  2ZFW A;  4UHT A;  4YG2 F;  1X4O A;  3B6C A;  1TTY A;  1BW6 A;  5ICF A;  2Y31 A;  2XSJ C;  4AM3 A;  4C2T A;  3V7C A;  1MNM C;  3DKY A;  1R4N B;  4PSX A;  2OC6 A;  2R93 J;  4B4C A;  1TL8 A;  1ZGA A;  1G59 A;  4BKX A;  4HF1 A;  3WGG A;  5L3B A;  2BXZ A;  5FLV A;  1Q1H A;  2FEZ A;  3OSF A;  2QCO A;  2BBY A;  1K78 A;  2CWE A;  3Q9S A;  2IJL A;  4XOR A;  3OY9 A;  3KP6 A;  1B8I A;  3S2H J;  2JTV A;  1DP7 P;  3MZH A;  2R7X A;  4L9T A;  2HQA A;  1HDD C;  1QU3 A;  1IV8 A;  3CJN A;  3MKW B;  3CD6 I;  3Q0V A;  5HDN A;  3CJR B;  3WU1 B;  3TBI A;  2O9L A;  2KP6 A;  3ZQI A;  3K4M A;  3OIQ A;  4IZZ A;  2JSC A;  3RI4 A;  4MQ9 F;  3MMY B;  1ITY A;  1S9H A;  3RYR A;  4DYC A;  1HKS A;  4QTR A;  1AA7 A;  3EUA A;  3M3Y J;  4BNC A;  1MMA A;  3F9K A;  1TZL A;  2P4W A;  4RLQ A;  2ESH A;  2JWT A;  4JQF A;  3JR9 A;  1TWG J;  2WV0 A;  4WXH A;  3HPG A;  5L3G A;  2FBK A;  4A0Y A;  1ZGW A;  1YW9 A;  2ELK A;  2KIS A;  2Z3Y A;  5HLG A;  3GW2 A;  1EH8 A;  3V8K A;  1H9T A;  4N4O B;  2HYJ A;  3DKX A;  2HGC A;  4GRI A;  1D3Y A;  4G6D A;  2EZK A;  5F04 A;  1IGN A;  2V1U A;  1DDN A;  1KA8 A;  1R1V A;  2DCE A;  2QLZ A;  3H36 A;  4JYK A;  4RB2 C;  1ACI A;  4QIW N;  4RA2 A;  3FDY A;  4A3D J;  1TBX A;  2HWV A;  5EYR A;  2WAE A;  3DV8 A;  4Y52 J;  4FTH A;  3BTL A;  1WJC A;  1E0E A;  5D8K B;  3GBG A;  2FX0 A;  1OKR A;  3W2V A;  3ZRG A;  2E60 A;  2UV1 A;  2FBH A;  2JVG A;  1T8I A;  1PP8 F;  2STW A;  1UB9 A;  3MZY A;  5LGT A;  5GTI C;  2GOM A;  1HQC A;  2CW7 A;  5BQT A;  2X6O A;  4E7J A;  1CF7 B;  3MFK A;  3QP6 A;  1A35 A;  5E79 C;  1DUX C;  3ZCO A;  4H0E A;  3OS2 A;  3T1B A;  2JRM A;  1G8X A;  2CUE A;  3DF8 A;  3I54 A;  2QQB A;  4WXC A;  4A93 J;  1U0J A;  4AIK A;  4I02 A;  2MW8 A;  1SFU A;  1AKH B;  4IRI A;  4UUS A;  5KHD A;  3BG9 A;  3FXL A;  1Z05 A;  2ZO4 A;  4BEH A;  2V79 A;  2UXN A;  3G73 A;  1FBQ A;  1XSV A;  5TJJ A;  3ONQ A;  3MAJ A;  4BXF A;  1D0Z A;  4B8X A;  2XAG A;  2JA7 J;  1SD4 A;  2H27 A;  4G7Z F;  3IHU A;  1YRN A;  3WG9 A;  4EJT A;  1WH7 A;  3KCC A;  5E8I A;  3OMY A;  2DT5 A;  1K7A A;  4HLY A;  1MMD A;  3LNQ A;  4LB6 B;  2R5Z B;  3M4O J;  4BS9 A;  2E5N A;  3ZQF A;  3VYS B;  4G94 A;  4LIV A;  2DA2 A;  3LL7 A;  3V8L A;  2EFO A;  2XIG A;  3E5X A;  2W84 A;  1FSH A;  4RGS A;  3C2H A;  3H5A A;  3HUG A;  1FJL A;  1LB2 A;  2RV8 A;  4IF4 A;  2XGX A;  2W4S A;  4CSW A;  2EV5 A;  2PJR B;  2DA3 A;  3KZY A;  1HKQ A;  4AD9 A;  1RIO H;  1BI2 A;  3PFI A;  3I55 I;  2VQC A;  1U8R A;  1K6Y A;  5D6E A;  4A3F J;  2CS3 A;  3PUB A;  3CJQ B;  4LGW A;  3LSM A;  5J40 A;  2XAU A;  4KT5 C;  3SEQ A;  1G3Y A;  2QYO A;  4IQ4 A;  2R3S A;  4HNU A;  2W85 A;  3BTC A;  1OR7 A;  4LK0 F;  2BW3 A;  1OQY A;  4L5J A;  3C2B A;  2DMN A;  4E70 A;  1IXC A;  5FO5 A;  3O2P E;  2A6T A;  4HV5 A;  1FTT A;  2R7R A;  1KQ8 A;  1FYK A;  4FCY A;  2XF6 A;  1D5V A;  2W1O A;  2EFP A;  2DFF A;  3OYF A;  2XAH A;  1MW7 A;  2G7U A;  2H6C A;  3ZN0 A;  3BTI A;  3VYU B;  4CXF A;  3CCE I;  3HKZ N;  2MAB A;  1HC8 A;  3RZD J;  2IS1 A;  3ZQH A;  3LOC A;  1RKW A;  2Z1D A;  3E6B A;  4XQF A;  2ECB A;  4OU0 A;  1ZKG A;  1D0X A;  5CYV A;  4Y3O A;  5FKL A;  2E7X A;  1BA5 A;  5B66 C;  2R92 J;  1HSJ A;  3ERM A;  4QPQ A;  3RTR A;  3ZN1 A;  4RAG A;  1Z6T A;  1YW7 A;  3SJM A;  2G0E A;  1YX5 A;  2BHY A;  3A0H C;  3KYC B;  3E7L A;  4YIR X;  3CCV I;  2NOG A;  1PJR A;  3CUQ C;  3ML6 A;  5EG0 B;  2MBF A;  3LA3 A;  2DFE A;  3K2A A;  4CZZ A;  2XC7 A;  4NQW A;  4KIS A;  5EDN A;  2P6T A;  3N05 A;  2VBZ A;  3CC7 I;  2WA0 A;  1W7P D;  2CUF A;  2ME0 A;  1B8I B;  2X51 A;  3QP5 A;  3JTH A;  5C44 J;  2OV7 A;  3H9J A;  4RAZ A;  4P5O A;  1MNE A;  2QVO A;  1ONV A;  4KA4 A;  2L9S A;  4Y17 A;  4M6V A;  3CUQ B;  3BRO A;  2WAD A;  3I58 A;  3IAM 2;  5J8F A;  2F5D A;  5JI6 A;  2EZI A;  2OA4 A;  2ZJ2 A;  1PUF B;  3GLL A;  2HDD A;  1B72 B;  3HTS B;  1J09 A;  4Y15 A;  1VND A;  1J7K A;  1OLT A;  4FQG A;  1OFC X;  1XS9 A;  4M3D A;  2O7O A;  2GM4 A;  2F6C A;  3J7Z I;  2R7S A;  4FAS D;  1T2K A;  2OD5 A;  4DW6 A;  4ZDO A;  4IHW A;  2CH0 A;  3H0D A;  4HST A;  4F93 B;  1GHC A;  1A04 A;  2HDW A;  2FXA A;  4L9N A;  2NVQ J;  3ZQQ A;  3P9K A;  1NG7 A;  5FD5 A;  1O7F A;  2IA2 A;  4OMY A;  1YOV B;  1KU2 A;  4EEF G;  5K7Z A;  3TDZ C;  3MKZ A;  1ETY A;  2A69 F;  2A6E F;  2FRH A;  3V8J A;  2WB1 N;  3VEP A;  3A01 A;  1YJN I;  1D5Y A;  1V55 H;  3IWF A;  2CQK A;  1X58 A;  1W4M A;  4MLO A;  3RYP A;  1MMS A;  1D1B A;  2PFB A;  4UV8 A;  4CH7 A;  1D1A A;  3DU6 A;  5J47 A;  1XTA A;  5LHG A;  4MNU A;  1DGR M;  2N8G A;  3OR1 C;  4LLN A;  2LC2 A;  3KFW X;  3DBR B;  2LF8 A;  1XB4 A;  3VFZ A;  1ON2 A;  4MEY F;  2RNJ A;  5E8G A;  4CUG A;  5F27 A;  2EFW A;  3HKZ A;  2CYY A;  2DU9 A;  2R7D A;  3H5R A;  5DCF A;  1X4P A;  4ESB A;  4YEL A;  5F6F A;  4A3C J;  4YRV A;  4IXA A;  4UVA A;  2O6G E;  4U88 A;  4CCN A;  5GAG J;  1W5C C;  2IW5 A;  3C18 A;  5J1Y A;  4G7O F;  4M3E A;  3VWB A;  5ICG A;  4HOB A;  2LRD A;  2P0T A;  4UUT A;  2PMZ N;  4FE4 A;  4N9I A;  5ILV A;  3TO7 A;  2MC4 A;  4LIU A;  2JSP A;  1MBE A;  1ZAR A;  3BZ6 A;  5GAD J;  1ETQ A;  3ASN H;  1LPQ A;  2W82 A;  4PDK A;  1WJ5 A;  2HXI A;  4C3J J;  2TCT A;  4A12 A;  2E2I J;  4A6D A;  3H5N A;  3LA2 A;  3KX2 A;  2VIX A;  1TC3 C;  1H89 C;  1RR8 C;  4LLG F;  3DEW A;  2JQ7 A;  1EF4 A;  2RGV A;  2ADU A;  3HUG B;  4XR6 A;  1HCR A;  1KGS A;  3FXU A;  3HGY A;  5J6X A;  4M9Z A;  2KDZ A;  2J5O A;  2FQ4 A;  3E6D A;  3DPU A;  2CW0 F;  2F4M B;  3E0J B;  3NEU A;  4BXU A;  2X0L A;  4XIC A;  2X6Y A;  3A4C A;  3DBH B;  3SXY A;  3H35 A;  2XSD C;  4BDY A;  2X48 A;  3KP3 A;  2E36 A;  3MZ8 A;  5LLQ A;  2ZJQ F;  3KLO A;  2ELH A;  3AAF A;  2EZH A;  3GZ6 A;  1UZC A;  3F0C A;  2GBY A;  1GVJ A;  3HRT A;  2DOE A;  5LBQ A;  5D5U B;  2MLG A;  1D8K A;  2F2E A;  2PX9 A;  4YII A;  3NRV A;  2BW3 B;  3OYE A;  1IN6 A;  1Z1D A;  3G71 I;  3PO2 J;  2DXI A;  2Y30 A;  3JRF A;  4IEJ A;  2EV6 A;  4XLF A;  4ENJ A;  1T38 A;  3QAH A;  4I99 C;  2DK5 A;  4XLH A;  2PN6 A;  3F8M A;  2WB1 A;  1O3S A;  1B9N A;  1K4S A;  1Y6I A;  3QOE A;  1ENH A;  2PEX A;  1J5Y A;  3Q0W A;  3IC7 A;  2HOS A;  2DAO A;  4P1W A;  2OQR A;  1SFO J;  2HQ5 A;  1QNT A;  1B59 A;  2IS2 A;  2QSG X;  3DTI A;  1ZAO A;  2Y2Z A;  2HDC A;  5GAE J;  2L4A A;  3ZMS A;  4E7L A;  2XUB A;  3LFU A;  2VBY A;  3BQZ A;  4XBF A;  4Y7N J;  2YX7 A;  3IH2 A;  2XAQ A;  3FMS A;  2OCE A;  4X1E A;  2ZXH A;  2WC2 A;  1YW8 A;  1BL0 A;  2L9N A;  3KEQ A;  4D1Q A;  3JRA A;  2QKL B;  2HOT A;  2Z5U A;  2DW4 A;  5KAF C;  1PUE E;  2FU4 A;  3OYD A;  5CVV A;  1RES A;  4KFC A;  3ECO A;  3S3M A;  1VQM I;  1HW5 A;  1R71 A;  3R6S A;  4BQN A;  1JKR C;  2ISY A;  2DPD A;  1VQ6 I;  5DM6 F;  2KMU A;  4ENM A;  5JHU A;  1UAA A;  2DDB A;  1WFX A;  2HPI A;  1KYZ A;  2PMZ A;  1YO5 C;  2PG4 A;  5HDG A;  1XMK A;  5HS9 A;  1YS6 A;  3HSE A;  2M8G X;  3FXQ A;  1HF0 A;  3HRM A;  2XAJ A;  1OJL A;  4IKF A;  4PUS A;  4R8H A;  2BY3 A;  1WKM A;  4CZC A;  4ZDL A;  1T39 A;  1FSE A;  2P7V B;  1MBF A;  3IKV A;  2LRE A;  2RQP A;  2IEK A;  3BC8 A;  3LFK A;  1MD0 A;  3MD2 A;  1VF9 A;  1QPI A;  4CCJ A;  1STZ A;  2HXO A;  3IL2 A;  1XN7 A;  4MEX F;  4G9Y A;  4NB5 A;  3L09 A;  4E7K A;  1X3W B;  2M87 A;  2BEO A;  4JOM A;  1FYL A;  3L2R A;  3M9A A;  5GPC A;  4A3E J;  4KDP A;  4CCK A;  4KN4 X;  5TIS C;  2GOX B;  5D4R A;  1K79 A;  4CHU A;  3GCM A;  3KE2 A;  1GXQ A;  2NVT J;  4AUX A;  3CCQ I;  3J7A O;  1IW7 F;  3IAS 2;  2JMW A;  1TWC J;  5L3C A;  2DA7 A;  2FOK A;  1W36 C;  3N4M A;  1RI7 A;  1Y8Q B;  3WGH A;  2CFX A;  2KRH A;  2LKS A;  3WTZ A;  3M1E A;  4I09 A;  2L3D A;  2E2J J;  1OMI A;  3GTK J;  1V5F A;  4XOT A;  4B1R A;  3KYD B;  3BG7 A;  4KIF A;  3ZQC A;  3V4G A;  2NS0 A;  2GXG A;  4L0Z B;  3CF5 F;  2LNB A;  2ESN A;  2GAU A;  4FT8 A;  4HV6 A;  5FRO A;  2LH9 A;  2FQ3 A;  4E7Z A;  5FRM A;  1Z3X A;  5J1R A;  3FX3 A;  3U1K A;  1RR7 A;  4PJJ A;  4BQA A;  2ISZ A;  3WE2 A;  3DPT A;  1Z7L A;  4WCG A;  2OZ6 A;  1DU6 A;  2ZSH B;  5K5O A;  2O5R A;  3B73 A;  3O6B B;  3ZOB A;  4BJ5 C;  1TW2 A;  2LOO A;  1ZG3 A;  4CCM A;  3CLQ A;  3ABM H;  2AQF A;  1HW1 A;  4LLL A;  2EB7 A;  3JRH A;  1P7J A;  2XRL A;  2XVC A;  2MLK A;  5K5R A;  1F1Z A;  1LNW A;  5EEG A;  4MFE A;  2YR2 A;  1XD7 A;  2D1H A;  2XAF A;  2LBF A;  2DFH A;  2NXN B;  3GTM J;  4N0B A;  4BBS J;  3K4N A;  3K1N A;  3OIO A;  3ROU A;  5C3E J;  1R5G A;  1R00 A;  1UEL B;  1RUO A;  1TP4 A;  2VXD A;  2DQL A;  3S2W A;  3JRI A;  1U5T A;  2L54 A;  2GXB A;  4FHT A;  3K9T A;  1TT5 B;  4G6T B;  4HA8 A;  5CVU A;  3OYL A;  3R60 A;  5A2Q Z;  4DOZ A;  1FEX A;  2VAS A;  2ETH A;  2Y69 H;  2V1N A;  1USS A;  3KZZ A;  2TRT A;  2DN0 A;  1VQ9 I;  1J59 A;  4XLN F;  5DTD A;  3IRR A;  1WJE A;  1JI8 A;  1POG A;  2XGD A;  1Z3Y A;  2UWM A;  5BMZ A;  2CMP A;  2V6C A;  1FOW A;  1J0R A;  3L2V A;  3S1R J;  1SAU A;  2V1D A;  3BG6 A;  4C3H J;  4MQV A;  4YFK F;  3K4K A;  1G3T A;  5IT9 K;  4BUP A;  2LKX A;  3EQL F;  2OUM A;  2QEN A;  2X6X A;  5CVJ A;  2HKO A;  4JX5 A;  4U0Y A;  1FPQ A;  5BS6 A;  3W3C A;  1ZR4 A;  1TLH B;  2IA1 A;  2L7Z A;  3LST A;  2HQR A;  4UB6 C;  5H20 A;  3HDD A;  5E3O A;  3HTU A;  1X2N A;  3LMM A;  4DBQ A;  5JFR A;  1YJ9 I;  1IZ1 A;  3QYB A;  3ZQL A;  5K1Y A;  4R79 A;  2DA4 A;  3BCA A;  3OR2 C;  3U21 A;  3ZMV A;  5HLH A;  4HPQ A;  4WK8 F;  4LB5 A;  3OYA A;  1FLI A;  1FBU A;  1JT6 A;  3CJT B;  2DT7 B;  2KRC A;  3TW6 A;  1SVO A;  5DUK A;  4WX9 A;  3V7R A;  1G2H A;  2EJR A;  4NC6 A;  3BPV A;  2R5Y B;  1LDD A;  1YJW I;  1P4X A;  2H94 A;  1KU9 A;  4AWX B;  3BZC A;  2L01 A;  4BE0 A;  4XID A;  1E2X A;  5K5Q A;  1W0T A;  3GZN B;  3NWT A;  3FKJ A;  5IT9 R;  2I10 A;  4L9J A;  4E7I A;  1VQL I;  3PM1 A;  2XPV A;  2VB6 A;  2F5C A;  4LMY A;  1SEU A;  3ZQ7 A;  5LHI A;  1W5S A;  1MH4 A;  5JVG F;  2HVS A;  3MVP A;  1W5T A;  2DMQ A;  1VQ4 I;  3GME A;  4OMZ A;  5DM7 F;  1UJ8 A;  1KYW A;  4D7N A;  1S72 I;  4HNT A;  3RKY A;  2VPR A;  5DD8 A;  5KK1 A;  3O8G A;  3FM3 A;  2KIF A;  2LTP A;  2RVC A;  2M30 A;  2K27 A;  3PL8 A;  5AIQ A;  1N78 A;  1DPU A;  2FOW A;  3OYN A;  5FLM J;  2L4M A;  1KZH A;  3IRQ A;  4HF0 A;  4XNF A;  3W2A A;  2ZXW H;  4XRS A;  4C2U A;  1Y1V J;  3RQI A;  4O3M A;  4II3 A;  4N9H A;  1FOK A;  3T5X A;  1I5Z A;  3FIW A;  3BJ6 A;  1ZHF A;  1NG6 A;  1W7P A;  2F5F A;  3REO A;  1OYI A;  1FOY A;  1TWF J;  2D5V A;  6PAX A;  4U0W A;  2DPU A;  4KIC A;  4RLF A;  1H9G A;  4XLP F;  4PFP A;  1VQO I;  1MIJ A;  2XDV A;  1H0M A;  1N77 A;  2LY2 A;  1BN5 A;  1IF1 A;  3I4N J;  3W6J B;  1OYY A;  2RKH A;  5HLT A;  2ZME A;  2XKP A;  2QQA A;  2LF7 A;  3R4K A;  3T8R A;  4M9S A;  3RIR A;  3PNY A;  3FBN B;  3FIS A;  3OS0 A;  1E17 A;  4IOA F;  2MYS A;  1Y0U A;  3MQ0 A;  4UY8 I;  2LVS A;  3ZR8 X;  2DI3 A;  4ZJZ A;  1EH6 A;  1XGO A;  5JLW A;  1LE8 B;  1YS7 A;  2RDP A;  5E3L A;  2XF5 A;  4C9Y A;  4AIJ A;  2NVY J;  1E3O C;  4RBO A;  1V54 H;  5IYD J;  1YTY A;  3PFY A;  5FRN A;  3BG3 A;  3UKG A;  4IRG A;  2V4J C;  5DCM B;  2QZ8 A;  1EJ9 A;  3UNG C;  3D5L A;  1JJ8 C;  2LKP A;  3GX4 X;  4OOI A;  2WWY A;  4DJA A;  2VT3 A;  1R5I D;  3BR1 A;  5HOO A;  1SC7 A;  3BQY A;  4AC0 A;  4LG0 B;  1QHH D;  4EJU A;  2KDO A;  4NUB A;  1IN8 A;  3K1M A;  1ETO A;  1T98 A;  5HOD A;  2M1B A;  1OCP A;  3A1Y A;  3NAU A;  1UHW A;  2Y9Z A;  3DTE A;  2OU2 A;  1ZN2 A;  4RB1 A;  1Y39 A;  2E5Z A;  5IYC J;  2EFQ A;  1U9O A;  3CC4 I;  1LVA A;  1R6R A;  4GCV A;  3S1Q J;  2M0M A;  2VOD A;  4D7M A;  3QYF A;  2OF7 A;  2QKM B;  2W57 A;  3CZ6 A;  1ZRE A;  4Q48 A;  3JSO A;  2BOL A;  1O3R A;  3S8P A;  2XKO A;  3ULQ B;  2PLY A;  3J81 Z;  2XGE A;  4IHT A;  2AQE A;  1ZG1 A;  2DMT A;  4IHX A;  4A5N A;  3LSK A;  2HR3 A;  2XPW A;  2YPR A;  2BHZ A;  4E7S A;  4OIO F;  3RPU D;  2LLK A;  3QOP A;  2D2W A;  1WHU A;  4L18 B;  1ZTR A;  2KKO A;  4KMF A;  3ABK H;  1UHM A;  4BYY A;  2EFN A;  1XG1 A;  3I9V 2;  3L9F A;  4CDG A;  4HNV A;  2R7T A;  5D4S A;  3G1O A;  2EIJ H;  1FOX A;  1UMQ A;  4PZJ A;  4DIQ A;  5JR3 A;  5C4J J;  2L9R A;  2ZCW A;  4AVP A;  1ZK8 A;  1SVM A;  3S2D J;  1FIP A;  2CU7 A;  3C1D A;  4JBA A;  3CCM I;  3ZMZ A;  4F52 A;  1J2X A;  3TED A;  5HVQ C;  4IHY A;  2IGM A;  3TDU C;  5IOY A;  2D1V A;  1H88 C;  4XON A;  3SHF A;  2K5C A;  1IUF A;  3LAJ A;  1U3E M;  3ZXS A;  1O3T A;  4G7H F;  1R7J A;  2STT A;  2VJ4 A;  3BZK A;  3TW7 A;  2NVU B;  3G4S I;  1VQP I;  1UHS A;  2AHQ A;  3PSF A;  4RGU A;  2MZ4 A;  1YX3 A;  4JX6 A;  1I3A A;  2QSH X;  2HKX A;  5J4Y A;  2VE9 A;  2E1O A;  1Y0N A;  3CUO A;  4AVZ A;  4XOP A;  2CW8 A;  3C2G A;  3IV5 A;  2DFI A;  3CCR I;  2BZT A;  2QEX I;  2GA2 A;  1BM9 A;  5K7F A;  3E6M A;  4II2 A;  5L3E A;  2ECC A;  4PFO A;  4WF2 A;  5EF6 A;  2HOE A;  2M4K A;  4IO9 F;  1MGT A;  3OYC A;  4LD5 A;  4A3L J;  3TOB A;  1Z6R A;  3WHC A;  3KP2 A;  3LAP A;  1TNT A;  4HW0 A;  4BY7 J;  2WY8 Q;  3CDL A;  3Q9V A;  3ZMT A;  4HRI A;  3BLY A;  3I59 A;  1FNN A;  3C7J A;  5CJ9 A;  3FF5 A;  1OCO H;  4BU2 A;  3CCU I;  2E2H J;  3HPH A;  1I39 A;  4EMS A;  3BDD A;  1HDP A;  2IXS A;  3FK6 A;  2QBY A;  4ZZD A;  2DT6 A;  1K78 B;  4M3B A;  3QPS A;  3C3W A;  1ZH5 A;  4NNJ A;  5ED4 A;  4YEJ A;  3HHH A;  2IBD A;  2M3A A;  3JTG A;  1IXR C;  2O8X A;  4P96 A;  2F4O B;  3H0G J;  2Z9O A;  2A07 F;  2X98 A;  2TDX A;  3DEU A;  1RUN A;  2BYV E;  3F8N A;  3FM5 A;  3KEO A;  1JUP A;  4P55 A;  1A6I A;  1SFE A;  5LGN A;  2ZJR F;  4DZP A;  4XL9 A;  1QHG A;  4ZZL A;  2JZY A;  2OQG A;  1LEB A;  5J4V A;  2H8W A;  2YU9 J;  3WTY C;  4EAT A;  5E1W A;  2PQ8 A;  1YI2 I;  4F3Q A;  1FX7 A;  2MVT A;  4I7H A;  3SDG A;  1P2F A;  5TRD A;  5EZH A;  1BC7 C;  4JP0 A;  5GPA A;  4BQO A;  4OAY A;  5CLS A;  3RSN A;  4UV9 A;  4Y4R A;  2BE5 F;  2H6B A;  2XV4 S;  3JRE A;  1YG2 A;  4L5E A;  3IH4 A;  1JTY A;  3TO9 A;  1M1E B;  4HQM A;  2RRE A;  2VKV A;  5DV5 A;  2HQN A;  3ELK A;  2ZXI A;  1Z91 A;  2DYS H;  2IPQ X;  3ZPL A;  2A61 A;  2FBI A;  1ZRF A;  2E1C A;  1ERD A;  1FP1 D;  2YU3 A;  2H1K A;  3COA C;  3CC2 I;  1LDJ A;  3H92 A;  3M8F A;  1WRJ A;  3K7A J;  3R0J A;  1BR4 A;  1D0Y A;  3DEE A;  1EKE A;  1LFU P;  3G3Z A;  1S6L A;  4NDL A;  2HOA A;  2O8K A;  1F36 A;  3A2K A;  2X85 A;  5F0F A;  1Z67 A;  3H9G A;  3TKY A;  3G6E I;  3H3U A;  3Q0U A;  3QU6 A;  1LQ1 A;  5FKK A;  3I53 A;  3FK7 A;  2Z33 A;  1WI9 A;  2R7Q A;  3DCF A;  3VDX A;  5TGT A;  2VC0 A;  1L0O C;  2XF7 A;  1MMN A;  1MDM A;  4ZYG A;  3VYT B;  3HEF A;  1MBH A;  5EGO A;  1FT9 A;  4E4H A;  1ZLK A;  3CMM A;  4RAF A;  1F4K A;  3HJE A;  3FHZ A;  1R36 A;  1SD5 A;  2ID6 A;  4V2F A;  2PJP A;  4A3B J;  1BIA A;  3RKQ A;  2EZL A;  1F9N A;  1IRF A;  4XRM A;  4UUS B;  3BR0 A;  1RRJ A;  1TQI A;  2L7F P;  4BEH B;  1XDS A;  3I3L A;  1A6Q A;  3BJA A;  4FET A;  3K0L A;  5HLI A;  1JE8 A;  2BGC A;  3M7G A;  3DBL B;  2OZU A;  1KQ9 A;  1K6O A;  2NYX A;  2LR8 A;  3K70 C;  3LQQ A;  2ME6 A;  4J00 A;  1FP2 A;  1EV7 A;  2HVR A;  1XGN A;  1YRN B;  2DJI A;  3HXL A;  4HSR A;  4U0V A;  5FLX Z;  5BPI A;  3CO6 C;  1IDY A;  2LFB A;  4B44 A;  2IVM A;  4QSH A;  3WE3 A;  4V19 K;  4RAY A;  2Y0S N;  3RQ4 A;  1N25 A;  4GGG A;  4P9F A;  1MH3 A;  3CP8 A;  2CV1 A;  3BR2 A;  2DDA A;  1MMG A;  3O3K A;  4UXN A;  4IX7 A;  3H3Z A;  4KMU X;  4UVC A;  2COM A;  2VQH A;  2AXT C;  3SDB A;  3EPZ A;  3GTQ J;  2DK8 A;  2VQG A;  5F64 A;  3TP0 A;  5EEH A;  5E1X A;  2MC3 A;  1OR7 C;  5BOX A;  1YE9 A;  3WTW C;  2JN6 A;  2QUF A;  3DLL F;  2EQR A;  4B3A A;  1YFH A;  4RS8 A;  5IOZ A;  2ZNY A;  1NH3 A;  3CQZ J;  2BY1 A;  3R0A A;  2BVL A;  3TO6 A;  2GZW A;  3OOU A;  3HC7 A;  3Q3S A;  2E35 A;  5CQG A;  1ON1 A;  4CA0 A;  2P8T A;  1WI3 A;  1IC8 A;  4W97 A;  3AKZ A;  1XCV A;  3AG2 H;  2MH9 A;  2EV0 A;  4AU7 A;  4G8X A;  4HAM A;  3IH3 A;  3CCJ I;  2MH2 A;  1TWA J;  2GXA A;  3CP2 A;  2MG4 A;  5ICE A;  4QPO A;  2P5K A;  5JVT A;  4IPA A;  4ZTJ A;  2R7Z J;  3DPL C;  1IRZ A;  2VPL A;  3LSH A;  4B47 A;  4PJN A;  1UCR A;  2BVM A;  4KYW A;  3LWF A;  3F21 A;  2LD5 A;  1LJ9 A;  1ZRD A;  3HOV J;  2JK3 A;  1GV5 A;  3EUH A;  2KT0 A;  5H2F C;  1N75 A;  1RNL A;  1WJB A;  1R1U A;  5D5V B;  3GFI A;  3JAM Z;  4XLA A;  5FJ8 J;  3GTJ J;  2K9M A;  1I6H J;  3F23 A;  4OIR F;  3I59 B;  1LFB A;  1HOM A;  3L2U A;  3L00 A;  4NQW B;  3HHG A;  2IAI A;  5FLX K;  3K10 A;  3HOT A;  2QBY B;  1XGM A;  1KU7 A;  2Q2E A;  2ZB9 A;  1PP7 U;  1ETK A;  1XPX A;  2A5W A;  2HVQ A;  5CKT A;  3HOU J;  5GAH J;  3R61 A;  4ZYA A;  2IRF G;  4BXX J;  1IJW C;  4M74 A;  2YX4 A;  1QO0 D;  3K1P A;  3LSI A;  2VKD A;  4MTE A;  2M7B A;  3WTT C;  1ZRC A;  2DOA A;  1V4R A;  3QRF F;  2Y0S A;  1YLF A;  4YIF A;  1ULY A;  1U6G A;  2K40 A;  1BOA A;  4KIT B;  2R7U A;  2K4B A;  2DTZ A;  2KLO A;  4ABZ A;  5ILU A;  2OPT A;  2P0W A;  3QWL A;  4RGX A;  2RN7 A;  3LA7 A;  4ESJ A;  4I2O A;  2W48 A;  5E3M A;  3WTU C;  5IP6 A;  1R49 A;  4WXD A;  1E3P A;  1G4D A;  4Q4Z F;  5FLX R;  5E1Z B;  3AL0 C;  2L0K A;  3PQK A;  3DFG A;  4J01 A;  1S29 A;  1QQI A;  2OBP A;  1VQ7 I;  2VQL A;  1XGS A;  4Q47 A;  2M45 A;  3BPX A;  4B48 A;  5FKM A;  4TV7 A;  3F22 A;  3CCS I;  1NTC A;  1I27 A;  4QWQ A;  1R4M B;  4A0X A;  3CMY A;  2HZD A;  1GXP A;  3ABL H;  1ETX A;  1X1A A;  2O3F A;  3F8F A;  1XMX A;  3TL4 X;  4AYB N;  4F92 B;  5AON A;  2ZSI B;  1W36 D;  3IP4 B;  3A01 B;  3AL0 B;  4E6K G;  3J7Y J;  4A0Z A;  4Z6Y A;  2VBW A;  3H1C A;  2DO7 A;  3CCL I;  1QZZ A;  2FML A;  3CDH A;  3CDI A;  4P9U A;  2VE8 A;  4ZC3 A;  3VOD A;  3G1L A;  5KVR A;  3T8T A;  3LQR A;  4AIH A;  1CF7 A;  3DTK A;  2HNH A;  1XMA A;  3K6G A;  5EJC A;  2J5P A;  1JTX A;  3WU0 A;  3FXM A;  2KIM A;  2X1E A;  2JUG A;  4EM0 B;  2LDU A;  4GO1 A;  3AG3 H;  5IY5 H;  3JAM K;  3MWM A;  4XSX F;  1BR2 A;  4G6Q A;  3CME I;  1AKH A;  4EM1 A;  4XN0 A;  5KCM A;  3OV8 A;  2XPU A;  3KYL A;  3JRC A;  2E7W A;  2CQQ A;  1FYM A;  1OYW A;  1WH5 A;  4I6Z A;  4BAC A;  3F6O A;  2I5U A;  4RM2 A;  1R5H A;  2HYF A;  4PSW A;  5LFA A;  3M8E A;  3HOW J;  4IVN A;  1BIB A;  3B02 A;  3K69 A;  3CO7 C;  1IRG A;  2ELJ A;  5GP9 A;  2A5Y B;  2JPC A;  3HM5 A;  3LSJ A;  2V1X A;  2P81 A;  3TOA A;  3DP7 A;  2V9V A;  1BI3 A;  2R5Z A;  3RKX A;  2VJJ A;  1P6R A;  4NC8 A;  1J9I A;  4B43 A;  2CJJ A;  1R23 A;  1D8J A;  3HG9 A;  3SFI A;  2O61 A;  1KQ0 A;  2AXL A;  3HIF A;  3M07 A;  2O0Y A;  5CQE A;  3JAM R;  1WPK A;  1B1B A;  2DOF A;  1D1C A;  2JJ7 A;  2ZFU A;  4XKC A;  3K2Z A;  3OIP A;  1B6A A;  2BY2 A;  4HG2 A;  3RPU A;  2R0Q C;  3D5R C;  3RKW A;  3SYT A;  2NOJ B;  4ETS A;  2PMH A;  1E3H A;  1VI0 A;  1EA3 A;  4OIQ F;  2HPM A;  2PJR A;  4F91 B;  2L5Q A;  4KN7 X;  2X1C A;  2VJI A;  4KT6 A;  1MKM A;  5D5X B;  4BAY A;  3HYI A;  3BCB A;  3BTJ A;  4A3M J;  2CQ7 A;  2VUM J;  2FE3 A;  2F5E A;  4DZJ A;  1C0W A;  1AWC A;  2M0C A;  3GFL A;  3GFM A;  4OWR B;  3W6V A;  4X0G A;  3GLX A;  2IGN A;  1XCB A;  1ZYR F;  3M1C A;  4RDU A;  3U1D A;  2LK2 A;  3OYI A;  3AG1 H;  5LRR A;  2P5V A;  3TP3 A;  4YFN F;  2X9D A;  1FIA A;  4DBR A;  2EIL H;  3A0B C;  4AYB A;  3V7S A;  4ZTF A;  4D5C A;  2O03 A;  2FA5 A;  3EUH C;  3HSF A;  2ICW G;  4X6A J;  4JK1 X;  3KZI C;  2CQN A;  3PIO F;  5M5W J;  2UUZ A;  1VQ8 I;  4EVI A;  5D5W B;  2CGP A;  4ASN A;  2VKH A;  1GDT A;  4I0A A;  3TGN A;  5F0H A;  4HYE A;  1A5J A;  2OTL I;  1QGP A;  2JA8 J;  1Y1W J;  1WZ2 A;  2W7N A;  2H09 A;  2DBB A;  2JPB A;  3CF2 A;  2DQR A;  3ABT A;  3HRU A;  4NHJ A;  4DGW B;  1HLV A;  4MHG A;  5IP7 J;  2DYR H;  5EG0 A;  3BT9 A;  3X2Q H;  1JGS A;  2ZNZ A;  5J8C A;  3ZQG A;  1ZLJ A;  3L2W A;  2IS6 A;  5D6F A;  4H4K C;  5A2Q K;  1S7O A;  1JUS A;  2EBI A;  2Q2E B;  5LEK A;  2V9K A;  1G3W A;  1T33 A;  4XSZ F;  4D9J A;  2C6Y A;  2FNP A;  3WTS C;  3CUQ A;  2JVH A;  3ASO H;  1NHA A;  2EIK H;  4ZYD A;  3K4C A;  3HBL A;  1OCT C;  4OIP F;  3DU5 A;  2OCC H;  3DLA A;  1PUF A;  3GUD A;  5EEA A;  1B72 A;  2UZK A;  5HS7 A;  4EJW A;  4D0P A;  3MEX A;  2Q0O A;  1QA6 A;  3FWE A;  4Z2Y A;  4D5F A;  1EH7 A;  3OYH A;  3NQO A;  4BE2 A;  1Z7U A;  2V26 A;  4ITV A;  4ZYE A;  3P5J A;  4DYR A;  1JUM A;  4U7B A;  2P7C B;  3KLN A;  1ZG5 A;  3GO5 A;  1XX5 A;  1IAW A;  1UG2 A;  3I64 A;  3A03 A;  4GYG A;  4CYC A;  1JHF A;  5DD4 A;  2A6H F;  3GTO J;  5KAI C;  5A2Q R;  1V5E A;  2CFO A;  3FXO A;  2XGC A;  3PIP F;  4CYD A;  1O4X A;  4OIN F;  3KEY A;  4WWC A;  4M6X A;  1S7E A;  1R22 A;  2DA1 A;  2RQQ A;  5DUI A;  4GXO A;  5LRS A;  3S1M J;  2MGQ A;  2F5V A;  1RC9 A;  4C3I J;  1HXD A;  5FKO A;  1QZE A;  1DQU A;  2KZG A;  3BG5 A;  1I1S A;  2E19 A;  1K4T A;  4CCO A;  3E6C C;  1X1D A;  4A2U A;  5IP9 J;  2VN2 A;  1T0F A;  2X4H A;  2GWR A;  4B3X A;  1LEA A;  1Y8R B;  2K9S A;  2JA2 A;  2BV6 A;  4UUV A;  2QM3 A;  1B9M A;  3WG7 H;  4QLC U;  3QYE A;  1X19 A;  2ZC2 A;  3O8H A;  4S05 A;  1U8B A;  2P6S A;  1PYV A;  3S1N J;  2F4I A;  1NK2 P;  4HBL A;  1I1G A;  1U9N A;  4L0Y B;  4EGY A;  4M3F A;  1TQM A;  1WJD A;  2B0L A;  3VYR B;  4Y13 A;  3GF2 A;  1U5T C;  5B1B H;  1AOY A;  2EIN H;  3L7W A;  5J1U A;  5D8L B;  1IN7 A;  1FWZ A;  2OAZ A;  5LD2 C;  2K9Q A;  1J75 A;  2CRG A;  2LBF B;  4C2M J;  2Z2S B;  2KIU A;  4GDF A;  2Y75 A;  4A3J J;  2Y9Y A;  4W1U A;  2MD5 A;  2MFZ A;  1X2M A;  3GTG J;  2WBM A;  2EA2 A;  3QQA A;  2JRT A;  4S04 A;  4PJL A;  1TWH J;  3KET A;  1U5T B;  2K02 A;  3ZP5 A;  3G2B A;  3H9Q A;  2PBI A;  3CTA A;  2W25 A;  3J7A Y;  5BNG A;  3EET A;  4C30 A;  1LVK A;  3E1S A;  1VZ0 A;  4HLX A;  1WJA A;  3WOD F;  1S7A A;  1BI1 A;  1YQA A;  1YIT I;  3FHN A;  2GIZ A;  2A68 F;  2ZXJ A;  3OOP A;  5K7H A;  1SAX A;  1S3J A;  2W24 A;  2R7O A;  4GYI A;  4M73 A;  2CUJ A;  2RC4 A;  1AHD P;  3FMQ A;  1YYV A;  1VFC A;  3SZP A;  4RMN A;  1XSX A;  3JRD A;  1JKP C;  2HFH A;  1RET A;  4HZF A;  4V2G A;  2QQ9 A;  1GUU A;  4YFX F;  4BDZ A;  4PGG A;  2FF4 A;  3P7N A;  4LG3 A;  5M3M J;  3OYB A;  3EDP A;  1ETV A;  2CO5 A;  2EWN A;  3CCY A;  4BY1 J;  2ACJ A;  4MFD A;  1BW5 A;  2YSR A;  3GFJ A;  4IJA A;  3FXR A;  2NS7 A;  4HX7 A;  1GV2 A;  1QRY A;  4BHB A;  2ID3 A;  1IN4 A;  3VPR A;  1GT0 C;  2FMY A;  4PCQ A;  2RNG A;  4EJV A;  3BOQ A;  1IO2 A;  4EM2 A;  4RM3 A;  1T56 A;  2VT2 A;  2BY0 A;  4F55 A;  4M6Y A;  3PNV A;  2K7L A;  4I98 B;  3JW4 A;  2XAS A;  1A36 A;  4BGD A;  5HDK A;  5L3D A;  1Q1V A;  1VQ5 I;  4BE1 A;  1MBG A;  1W1W E;  2B63 J;  2M4G A;  2EH3 A;  1MJA A;  2R7F A;  3NAR A;  4A69 C;  2NAZ A;  2ZJP F;  2QF7 A;  2DJN A;  1IDZ A;  5FB2 A;  2PMU A;  3T0Y A;  2NRA C;  2LMD A;  2BXY A;  3MCZ A;  3KIO A;  2K9L A;  3J81 K;  4OAZ A;  2DLL A;  1TW3 A;  2HTJ A;  1T95 A;  3DQV C;  2GIV A;  4LJZ F;  5BPD A;  4DQ2 A;  4DNC A;  3NWS A;  1A31 A;  2NS8 A;  3J80 Z;  3MKL A;  1FBS A;  2Z16 A;  5B1A H;  2DMU A;  2HTS A;  3BJO A;  4RB3 C;  3TMO A;  1XSD A;  2M8E A;  3E3V A;  4KNY A;  1B4A A;  2CV2 A;  3D1N I;  3HRS A;  2QGU A;  1HST A;  1SMY F;  1BJA A;  1SD7 A;  2G7H A;  3G1M A;  1CGP A;  1I6X A;  4NC7 A;  4ESF A;  1OCZ H;  3D5S C;  3PNT A;  4I01 A;  3F72 A;  3I4M J;  2H1L A;  4A3G J;  1TT0 A;  1T08 B;  2KJC A;  3BR3 A;  1Y56 A;  2WY7 Q;  3CLO A;  2ZME C;  1MSF C;  2FNA A;  3GXO A;  3HOY J;  3AG4 H;  1W7P B;  3BY6 A;  3ERE D;  4ENN A;  2E34 A;  1P4W A;  5C4X J;  3J81 R;  5FD6 A;  2PI0 A;  3BR6 A;  4A6E A;  2K3P A;  3S17 J;  4XM3 A; 
#chains in the Genus database with same CATH homology
 1HBX G;  1OPC A;  5LEJ A;  2ZME B;  4IHS A;  1WWX A;  4R1H A;  3ABU A;  4EQQ A;  1KU3 A;  1MJ9 A;  3BWG A;  3I71 A;  2XRN A;  3GEZ A;  2FSW A;  3JSP A;  4KUM A;  3GVA A;  4MGR A;  2LSO A;  1VTN C;  2KRF A;  4ZH4 F;  3F3X A;  4Q5S F;  3I0T A;  3BP8 A;  4LFU A;  3PQJ A;  3KP7 A;  4B09 A;  3WTV C;  3HOS A;  5DEQ A;  3KP5 A;  2ZBK A;  4XRF A;  2GQQ A;  3E5Q A;  3QPH A;  3ZMD A;  2L02 A;  4HX4 A;  3VOE A;  3U2R A;  1G3S A;  2CSO A;  4KIB A;  2HEO A;  3IKT A;  5DDG A;  1BC8 C;  3J80 K;  1FC3 A;  4UNO A;  1DPR A;  5L3F A;  3WTX C;  1L3L A;  4EGZ A;  4A5M A;  3P9C A;  4EJO A;  1SMT A;  3GWZ A;  1MJB A;  2A3S A;  3U9G A;  4FX4 A;  3E5U A;  4UVB A;  3GYH X;  5ILS A;  2Q8K A;  1ODD A;  3D0S A;  2DTR A;  2HS5 A;  1WQ2 A;  5ICC A;  1V3F A;  2CG4 A;  3N97 A;  4F7Z A;  1LDK B;  1WSU A;  1F5T A;  1O57 A;  2ZKZ A;  4EV0 A;  2VOP A;  3SFZ A;  1BBY A;  2G9W A;  4ENK A;  4I0B A;  4LK1 F;  3EYY A;  2VOO A;  4L9V A;  1SFX A;  4IRH A;  3WGI A;  3SZT A;  5CVI A;  4U7D A;  1REP C;  2Y0M A;  4BH9 A;  3I4P A;  1HW2 A;  4RGR A;  1XDU A;  1QBJ A;  2P5L C;  2K4J A;  3SQN A;  4HQE A;  1QPM A;  4CO8 A;  1UFM A;  3I5U A;  3FZV A;  3ECH A;  3P9I A;  4HF2 A;  4O6J A;  4ON0 A;  2MA3 A;  4O5V A;  4ZYH A;  3DKW A;  1T6S A;  4KIG A;  5HS8 A;  5F1R A;  5E18 F;  1O7L A;  2GA1 A;  5CVR A;  2Y48 A;  5E20 A;  5AIP A;  5LGU A;  1Z9C A;  3Q5F A;  4FX0 A;  2HZT A;  2VC1 A;  2QWW A;  3F6V A;  5IT3 A;  4HDU A;  4PGH A;  2K86 A;  2UXX A;  2HYG D;  1TNS A;  5IT9 Z;  5FFX A;  5FFZ A;  1G6N A;  5DCM A;  4RB0 A;  2AS5 F;  5E17 F;  3RPQ A;  2IT0 A;  2VBX A;  5ERI A;  1MDM B;  3GZ5 A;  4L5I A;  2D45 A;  2M5W A;  3FMR A;  4LG0 A;  3IWZ A;  4CIC A;  3HSR A;  1R1T A;  3DXJ F;  1O3Q A;  3E97 A;  4HX8 A;  1IXS B;  1P4A A;  3VB2 A;  1QZY A;  1P92 A;  1FZP B;  2IA0 A;  2E1N A;  3L2C A;  1IN5 A;  4HDV A;  4BHC A;  2XRO A;  1ZGJ A;  5FGM A;  2VON A;  3RDI A;  1MZB A;  2Z99 A;  4M9X A;  4CGZ A;  2NNY A;  2VXZ A;  3F8C A;  2XHK A;  1YIO A;  2NNN A;  3KP4 A;  2IP2 A;  3ISP A;  1FY7 A;  1JHH A;  4K2E A;  2EA4 A;  5H6Q A;  1UST A;  1S8N A;  3TQN A;  3QPT A;  1BI0 A;  1IUY A;  4BHP A;  4M72 A;  1X3U A;  1RZ4 A;  1PDN C;  1TQP A;  2EK5 A;  3W6K B;  1JXS A;  5DYM A;  1HKT A;  4MTD A;  3F8B A;  2JT1 A;  5LHH A;  1U2W A;  1SD6 A;  2WTE A;  3EYI A;  4M71 A;  1R58 A;  2KJB A;  3RJP A;  3QU3 A;  5H6R A;  1U78 A;  3ZMU A;  2ZFW A;  4UHT A;  4YG2 F;  1TTY A;  5ICF A;  3V7C A;  1ZGA A;  4HF1 A;  3WGG A;  5L3B A;  1Q1H A;  2FEZ A;  2BBY A;  1K78 A;  2CWE A;  3Q9S A;  2IJL A;  3KP6 A;  2JTV A;  1DP7 P;  3MZH A;  4L9T A;  3CJN A;  5HDN A;  3WU1 B;  2JSC A;  3RI4 A;  4MQ9 F;  3RYR A;  1HKS A;  4BNC A;  2P4W A;  2ESH A;  4JQF A;  2WV0 A;  4WXH A;  5L3G A;  2FBK A;  4A0Y A;  1YW9 A;  5HLG A;  2Z3Y A;  3GW2 A;  1EH8 A;  3V8K A;  1H9T A;  2HGC A;  1D3Y A;  4G6D A;  2V1U A;  1DDN A;  1KA8 A;  1R1V A;  2QLZ A;  4RB2 C;  1TBX A;  2HWV A;  3DV8 A;  5D8K B;  1OKR A;  2FBH A;  1PP8 F;  2STW A;  1UB9 A;  3MZY A;  5LGT A;  1HQC A;  5BQT A;  1CF7 B;  3MFK A;  3QP6 A;  1DUX C;  4H0E A;  3T1B A;  3DF8 A;  3I54 A;  2QQB A;  4WXC A;  4AIK A;  4I02 A;  1SFU A;  4IRI A;  1Z05 A;  2ZO4 A;  2V79 A;  2UXN A;  3G73 A;  1FBQ A;  1XSV A;  5TJJ A;  3MAJ A;  4B8X A;  2XAG A;  1SD4 A;  2H27 A;  4G7Z F;  3IHU A;  3WG9 A;  4EJT A;  3KCC A;  5E8I A;  2DT5 A;  1K7A A;  4HLY A;  4LB6 B;  4G94 A;  3V8L A;  2EFO A;  2XIG A;  3E5X A;  2W84 A;  1FSH A;  4RGS A;  3HUG A;  1LB2 A;  2RV8 A;  4IF4 A;  2XGX A;  2EV5 A;  3KZY A;  1HKQ A;  4AD9 A;  1RIO H;  1BI2 A;  3PFI A;  1U8R A;  5D6E A;  4LGW A;  4KT5 C;  1G3Y A;  2QYO A;  2R3S A;  2W85 A;  1OR7 A;  4LK0 F;  4L5J A;  4E70 A;  1IXC A;  5FO5 A;  3O2P E;  4HV5 A;  1KQ8 A;  1FYK A;  1D5V A;  2EFP A;  2XAH A;  2G7U A;  2H6C A;  3ZN0 A;  4CXF A;  3E6B A;  4OU0 A;  5CYV A;  2E7X A;  1HSJ A;  3RTR A;  3ZN1 A;  1Z6T A;  1YW7 A;  3CUQ C;  3ML6 A;  2MBF A;  3LA3 A;  4CZZ A;  4NQW A;  2P6T A;  2VBZ A;  1W7P D;  3QP5 A;  3JTH A;  4RAZ A;  4P5O A;  2QVO A;  1ONV A;  4KA4 A;  4Y17 A;  3CUQ B;  3BRO A;  3I58 A;  5J8F A;  2F5D A;  5JI6 A;  2OA4 A;  2ZJ2 A;  3HTS B;  4Y15 A;  1J7K A;  1T2K A;  2OD5 A;  1GHC A;  1A04 A;  2FXA A;  4L9N A;  3P9K A;  5FD5 A;  1O7F A;  2IA2 A;  4OMY A;  1KU2 A;  3TDZ C;  2FRH A;  2A69 F;  2A6E F;  3V8J A;  3VEP A;  3IWF A;  2CQK A;  3RYP A;  1W4M A;  2PFB A;  4UV8 A;  5LHG A;  4MNU A;  4LLN A;  3KFW X;  2LF8 A;  1XB4 A;  3VFZ A;  1ON2 A;  4MEY F;  2RNJ A;  5E8G A;  2EFW A;  2CYY A;  2DU9 A;  2R7D A;  5DCF A;  4ESB A;  5F6F A;  4IXA A;  4UVA A;  2O6G E;  4U88 A;  2IW5 A;  3C18 A;  4G7O F;  5ICG A;  4HOB A;  4N9I A;  5ILV A;  3TO7 A;  1ZAR A;  3BZ6 A;  4PDK A;  4A12 A;  4A6D A;  3LA2 A;  4LLG F;  2RGV A;  2ADU A;  1KGS A;  3FXU A;  5J6X A;  4M9Z A;  2J5O A;  3E6D A;  2CW0 F;  3NEU A;  4BXU A;  2X0L A;  3SXY A;  3KP3 A;  5LLQ A;  3KLO A;  2ELH A;  3AAF A;  3GZ6 A;  1GVJ A;  3HRT A;  5LBQ A;  5D5U B;  2MLG A;  1D8K A;  2F2E A;  4YII A;  3NRV A;  1IN6 A;  1Z1D A;  4ENJ A;  2EV6 A;  1T38 A;  3QAH A;  2DK5 A;  2PN6 A;  3F8M A;  1O3S A;  1B9N A;  2PEX A;  1J5Y A;  3IC7 A;  2DAO A;  2OQR A;  1QNT A;  1B59 A;  1ZAO A;  2HDC A;  2L4A A;  3ZMS A;  2XUB A;  4XBF A;  2VBY A;  2YX7 A;  2XAQ A;  3FMS A;  2WC2 A;  1YW8 A;  3KEQ A;  2Z5U A;  2DW4 A;  1PUE E;  2FU4 A;  5CVV A;  4KFC A;  3ECO A;  1HW5 A;  3R6S A;  2ISY A;  2DPD A;  4ENM A;  5JHU A;  1KYZ A;  1YO5 C;  2PG4 A;  5HDG A;  1XMK A;  5HS9 A;  1YS6 A;  3HSE A;  3FXQ A;  3HRM A;  2XAJ A;  4R8H A;  1WKM A;  1T39 A;  1FSE A;  2P7V B;  3IKV A;  2RQP A;  3LFK A;  1MD0 A;  1STZ A;  3IL2 A;  1XN7 A;  4MEX F;  4G9Y A;  4NB5 A;  3L09 A;  2M87 A;  2BEO A;  1FYL A;  3M9A A;  4KDP A;  4KN4 X;  5D4R A;  1K79 A;  4CHU A;  3KE2 A;  1GXQ A;  3J7A O;  1IW7 F;  5L3C A;  2FOK A;  3N4M A;  1RI7 A;  3WGH A;  2CFX A;  3WTZ A;  3M1E A;  4I09 A;  2L3D A;  1OMI A;  4KIF A;  3V4G A;  2NS0 A;  2GXG A;  4L0Z B;  2LNB A;  2ESN A;  2GAU A;  4FT8 A;  4HV6 A;  2FQ3 A;  3FX3 A;  4BQA A;  2ISZ A;  3WE2 A;  3DPT A;  4WCG A;  2OZ6 A;  5K5O A;  3B73 A;  3O6B B;  1TW2 A;  1ZG3 A;  1HW1 A;  4LLL A;  2EB7 A;  2XVC A;  2MLK A;  5K5R A;  1F1Z A;  1LNW A;  5EEG A;  2YR2 A;  1XD7 A;  2D1H A;  2XAF A;  4N0B A;  3K1N A;  3ROU A;  1R5G A;  1R00 A;  1RUO A;  2DQL A;  3S2W A;  1U5T A;  2L54 A;  2GXB A;  4FHT A;  3K9T A;  4HA8 A;  5CVU A;  3R60 A;  5A2Q Z;  2ETH A;  1USS A;  3KZZ A;  1J59 A;  4XLN F;  3IRR A;  2UWM A;  5BMZ A;  2V6C A;  1J0R A;  2V1D A;  4MQV A;  4YFK F;  1G3T A;  5IT9 K;  3EQL F;  2QEN A;  5CVJ A;  2HKO A;  4U0Y A;  1FPQ A;  5BS6 A;  1TLH B;  2IA1 A;  3LST A;  2HQR A;  5H20 A;  3HTU A;  5JFR A;  1IZ1 A;  5K1Y A;  4R79 A;  5HLH A;  3ZMV A;  4LB5 A;  4WK8 F;  1FLI A;  1FBU A;  4WX9 A;  5DUK A;  3V7R A;  2EJR A;  3BPV A;  1LDD A;  1P4X A;  2H94 A;  1KU9 A;  4AWX B;  2L01 A;  1E2X A;  5K5Q A;  4L9J A;  2F5C A;  4LMY A;  3ZQ7 A;  5LHI A;  1W5S A;  1W5T A;  4OMZ A;  1KYW A;  3RKY A;  5DD8 A;  5KK1 A;  3FM3 A;  2KIF A;  2RVC A;  2M30 A;  2K27 A;  5AIQ A;  1DPU A;  2L4M A;  3IRQ A;  4HF0 A;  4O3M A;  4N9H A;  1FOK A;  3T5X A;  1I5Z A;  3BJ6 A;  1ZHF A;  1W7P A;  2F5F A;  3REO A;  1OYI A;  6PAX A;  4U0W A;  2DPU A;  4KIC A;  1H9G A;  4XLP F;  1H0M A;  1IF1 A;  1BN5 A;  3W6J B;  1OYY A;  2RKH A;  2ZME A;  2XKP A;  2QQA A;  2LF7 A;  3R4K A;  3T8R A;  4M9S A;  3RIR A;  1E17 A;  1Y0U A;  3MQ0 A;  2DI3 A;  1EH6 A;  1XGO A;  1YS7 A;  2RDP A;  4AIJ A;  1YTY A;  4IRG A;  5DCM B;  2QZ8 A;  3D5L A;  2LKP A;  3GX4 X;  4OOI A;  2WWY A;  2VT3 A;  5HOO A;  4LG0 B;  4EJU A;  1IN8 A;  3K1M A;  1T98 A;  2M1B A;  1UHW A;  4RB1 A;  2OU2 A;  1ZN2 A;  2EFQ A;  1LVA A;  4GCV A;  2VOD A;  2W57 A;  1ZRE A;  4Q48 A;  3JSO A;  1O3R A;  2XKO A;  3ULQ B;  2PLY A;  3J81 Z;  4IHT A;  1ZG1 A;  4A5N A;  2HR3 A;  2YPR A;  4OIO F;  3QOP A;  2D2W A;  4L18 B;  2KKO A;  4KMF A;  1UHM A;  4BYY A;  2EFN A;  3L9F A;  4CDG A;  5D4S A;  4PZJ A;  5JR3 A;  2ZCW A;  4AVP A;  3C1D A;  4JBA A;  3ZMZ A;  1J2X A;  5HVQ C;  3TDU C;  2D1V A;  3SHF A;  3LAJ A;  1U3E M;  1O3T A;  2STT A;  4G7H F;  1R7J A;  4RGU A;  2HKX A;  2VE9 A;  3CUO A;  2DFI A;  2GA2 A;  1BM9 A;  3E6M A;  5L3E A;  4WF2 A;  2HOE A;  1MGT A;  4LD5 A;  3TOB A;  1Z6R A;  3KP2 A;  3LAP A;  1TNT A;  4HW0 A;  3Q9V A;  3ZMT A;  3I59 A;  1FNN A;  3C7J A;  5CJ9 A;  3FF5 A;  4EMS A;  3BDD A;  2QBY A;  4ZZD A;  1K78 B;  3C3W A;  1ZH5 A;  5ED4 A;  3HHH A;  3JTG A;  1IXR C;  2O8X A;  4P96 A;  2Z9O A;  2A07 F;  2TDX A;  3DEU A;  1RUN A;  2BYV E;  3F8N A;  3FM5 A;  3KEO A;  4P55 A;  1SFE A;  5LGN A;  4ZZL A;  2JZY A;  2OQG A;  1LEB A;  3WTY C;  5E1W A;  2PQ8 A;  1FX7 A;  4I7H A;  1P2F A;  5TRD A;  1BC7 C;  5CLS A;  4UV9 A;  2BE5 F;  2H6B A;  2XV4 S;  1YG2 A;  3TO9 A;  4HQM A;  5DV5 A;  2HQN A;  3ELK A;  1Z91 A;  2IPQ X;  3ZPL A;  2A61 A;  2FBI A;  1ZRF A;  2E1C A;  1FP1 D;  2YU3 A;  3COA C;  1LDJ A;  3H92 A;  3M8F A;  1WRJ A;  3R0J A;  3G3Z A;  1S6L A;  3TKY A;  3H3U A;  3QU6 A;  1LQ1 A;  3I53 A;  2Z33 A;  1WI9 A;  2VC0 A;  1L0O C;  1MDM A;  4ZYG A;  1ZLK A;  1FT9 A;  1F4K A;  3FHZ A;  1R36 A;  1SD5 A;  2PJP A;  1BIA A;  1F9N A;  1IRF A;  1TQI A;  1XDS A;  5HLI A;  3BJA A;  1JE8 A;  3K0L A;  2BGC A;  3M7G A;  2OZU A;  1KQ9 A;  1K6O A;  2NYX A;  3LQQ A;  1FP2 A;  1EV7 A;  1XGN A;  4U0V A;  5FLX Z;  5BPI A;  3CO6 C;  2IVM A;  3WE3 A;  4RAY A;  4GGG A;  4P9F A;  3O3K A;  4UXN A;  3H3Z A;  4KMU X;  4UVC A;  2COM A;  2DK8 A;  5F64 A;  5EEH A;  5E1X A;  2MC3 A;  5BOX A;  3WTW C;  2QUF A;  1YFH A;  4RS8 A;  2ZNY A;  3TO6 A;  3R0A A;  2GZW A;  1ON1 A;  2P8T A;  1XCV A;  2MH9 A;  2EV0 A;  4G8X A;  4HAM A;  2MH2 A;  5ICE A;  2P5K A;  5JVT A;  4IPA A;  3DPL C;  1UCR A;  4KYW A;  3LWF A;  3F21 A;  1LJ9 A;  1ZRD A;  3EUH A;  1RNL A;  1R1U A;  5D5V B;  3GFI A;  3JAM Z;  3F23 A;  4OIR F;  3I59 B;  3L00 A;  3HHG A;  5FLX K;  3HOT A;  2QBY B;  1XGM A;  1KU7 A;  2Q2E A;  1PP7 U;  3R61 A;  2IRF G;  4M74 A;  2YX4 A;  1QO0 D;  3K1P A;  4MTE A;  3WTT C;  1ZRC A;  1V4R A;  3QRF F;  1YLF A;  4YIF A;  1ULY A;  1U6G A;  1BOA A;  2K4B A;  5ILU A;  4RGX A;  2RN7 A;  3LA7 A;  4ESJ A;  4I2O A;  3WTU C;  4WXD A;  1G4D A;  4Q4Z F;  5E1Z B;  3PQK A;  3DFG A;  1S29 A;  1QQI A;  2OBP A;  1XGS A;  4Q47 A;  2M45 A;  3BPX A;  3F22 A;  4TV7 A;  1I27 A;  4QWQ A;  4A0X A;  1GXP A;  2O3F A;  3F8F A;  5AON A;  4A0Z A;  2VBW A;  2DO7 A;  1QZZ A;  2FML A;  3CDH A;  4P9U A;  2VE8 A;  3VOD A;  5KVR A;  3T8T A;  3LQR A;  4AIH A;  1CF7 A;  1XMA A;  2J5P A;  3WU0 A;  2KIM A;  4EM0 B;  2LDU A;  4GO1 A;  3JAM K;  3MWM A;  4XSX F;  4G6Q A;  4EM1 A;  3OV8 A;  2E7W A;  1FYM A;  1OYW A;  3F6O A;  1R5H A;  2HYF A;  3M8E A;  4IVN A;  1BIB A;  3B02 A;  3K69 A;  3CO7 C;  1IRG A;  2A5Y B;  2JPC A;  2V1X A;  3TOA A;  3DP7 A;  2V9V A;  1BI3 A;  3RKX A;  1P6R A;  1J9I A;  1R23 A;  1D8J A;  2O61 A;  1KQ0 A;  2AXL A;  3HIF A;  2O0Y A;  1B1B A;  3K2Z A;  1B6A A;  3RPU A;  3RKW A;  4ETS A;  2PMH A;  4OIQ F;  4KN7 X;  1MKM A;  5D5X B;  4BAY A;  3HYI A;  2FE3 A;  2F5E A;  1C0W A;  1AWC A;  3GFL A;  3GFM A;  3GLX A;  1XCB A;  1ZYR F;  3U1D A;  5LRR A;  2P5V A;  4YFN F;  3V7S A;  2O03 A;  2FA5 A;  3HSF A;  4JK1 X;  4EVI A;  5D5W B;  2CGP A;  4ASN A;  4I0A A;  3TGN A;  4HYE A;  1QGP A;  2H09 A;  2DBB A;  2JPB A;  2DQR A;  3ABT A;  3HRU A;  4NHJ A;  4MHG A;  1JGS A;  2ZNZ A;  5J8C A;  1ZLJ A;  5D6F A;  5A2Q K;  1S7O A;  5LEK A;  1G3W A;  4XSZ F;  2C6Y A;  2FNP A;  3WTS C;  3CUQ A;  1NHA A;  4ZYD A;  4OIP F;  3GUD A;  2UZK A;  5HS7 A;  4EJW A;  4D0P A;  3MEX A;  2Q0O A;  3FWE A;  4Z2Y A;  1EH7 A;  3NQO A;  1Z7U A;  4ZYE A;  4U7B A;  2P7C B;  3KLN A;  1ZG5 A;  3GO5 A;  1IAW A;  3I64 A;  4GYG A;  1JHF A;  5DD4 A;  2A6H F;  4CYD A;  4OIN F;  4WWC A;  4M6X A;  1R22 A;  5DUI A;  4GXO A;  5LRS A;  1HXD A;  1I1S A;  3E6C C;  4A2U A;  2VN2 A;  1T0F A;  2X4H A;  2GWR A;  1LEA A;  2BV6 A;  4UUV A;  2QM3 A;  1B9M A;  4QLC U;  4S05 A;  2P6S A;  4HBL A;  1I1G A;  4L0Y B;  4EGY A;  1TQM A;  2B0L A;  4Y13 A;  3GF2 A;  1U5T C;  1AOY A;  3L7W A;  5D8L B;  1IN7 A;  1FWZ A;  2OAZ A;  1J75 A;  2KIU A;  2Y75 A;  2MD5 A;  2EA2 A;  2JRT A;  4S04 A;  3KET A;  1U5T B;  2K02 A;  3ZP5 A;  2PBI A;  3CTA A;  2W25 A;  3EET A;  4HLX A;  3WOD F;  1S7A A;  1BI1 A;  1YQA A;  2A68 F;  2ZXJ A;  3OOP A;  1SAX A;  1S3J A;  2W24 A;  4GYI A;  4M73 A;  2RC4 A;  3FMQ A;  1YYV A;  3SZP A;  1XSX A;  2HFH A;  4HZF A;  2QQ9 A;  4YFX F;  4PGG A;  2FF4 A;  3P7N A;  3EDP A;  2CO5 A;  2EWN A;  2ACJ A;  2YSR A;  3GFJ A;  4IJA A;  3FXR A;  4HX7 A;  4BHB A;  1IN4 A;  2FMY A;  4PCQ A;  4EJV A;  3BOQ A;  4EM2 A;  2VT2 A;  4M6Y A;  2K7L A;  4I98 B;  3JW4 A;  2XAS A;  5HDK A;  5L3D A;  2R7F A;  1MJA A;  2NAZ A;  5FB2 A;  2PMU A;  3T0Y A;  2NRA C;  3MCZ A;  3J81 K;  2DLL A;  1TW3 A;  2HTJ A;  3DQV C;  2GIV A;  4LJZ F;  5BPD A;  4DQ2 A;  4DNC A;  3J80 Z;  1FBS A;  2HTS A;  3BJO A;  4RB3 C;  1XSD A;  2M8E A;  3E3V A;  4KNY A;  1B4A A;  3HRS A;  1HST A;  1SMY F;  1BJA A;  1SD7 A;  2G7H A;  1CGP A;  1I6X A;  4ESF A;  4I01 A;  3F72 A;  2KJC A;  3CLO A;  2FNA A;  3GXO A;  1W7P B;  3BY6 A;  3ERE D;  4ENN A;  1P4W A;  5FD6 A;  2PI0 A;  4A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...