2EV0A

Bacillus subtilis manganese transport regulator (mntr) bound to cadmium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
135
structure length
131
Chain Sequence
TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 51
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev0A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev0A02
4BQAA 5E1ZB 3BPVA 2L02A 5DEQA 2ZMEB 3GFMA 3BPXA 4KIBA 4EMSA 3R0JA 2PI0A 4JK1X 1FBUA 4NQWA 2EJRA 5FD6A 5BS6A 1JHHA 1CF7B 3CUOA 3EYYA 2NNNA 3FXQA 4EV0A 3Q9SA 1RIOH 4P9UA 4HX4A 3I4PA 2VBZA 2O61A 4OU0A 2OZUA 2QQAA 2M5WA 2D1VA 3L9FA 4KICA 4ZYHA 3DP7A 1BI1A 3RKXA 1ONVA 4MNUA 5HS9A 2ZBKA 3ZQ7A 1BIBA 1ZRCA 2BBYA 2M8EA 3K1NA 5CVUA 2BGCA 4WCGA 2HFHA 2PEXA 2Z33A 3DQVC 5L3DA 1HBXG 1P2FA 3LFKA 2P6TA 1KQ8A 3IRRA 3T8RA 2OA4A 2RGVA 2HDCA 3FXUA 1WWXA 3KP6A 3N97A 1FSHA 2MA3A 4M74A 4M9ZA 4UNOA 1IXSB 4LB5A 3M1EA 2FNPA 4YG2F 3JAMZ 3SZTA 1FC3A 2XVCA 3V8JA 2K86A 4L5JA 2C6YA 5ILSA 4OINF 2D2WA 3MCZA 1FYLA 1HSTA 3WTSC 3KP3A 1K79A 1G3WA 1S8NA 1BC7C 5EEGA 3IWZA 1BIAA 4IHSA 3HYIA 1XDSA 1ZAOA 3SZPA 1P92A 1ODDA 3P9IA 2OQRA 3I5UA 3IWFA 4BHPA 2DW4A 2GA2A 5F6FA 1LVAA 3CUQC 5HS8A 4Y15A 2VC0A 1KU7A 4I0AA 2FE3A 1RUOA 4YIIA 2A07F 4R8HA 1DPRA 1GXPA 1Y0UA 2PMHA 4UVBA 1SD4A 2EFOA 5H6RA 1KQ9A 2VT3A 2L01A 3Q9VA 4Q47A 2UXNA 3GUDA 3H92A 4I0BA 2CWEA 5DV5A 4HQEA 2ISZA 3V7SA 2K7LA 3QU6A 1BOAA 1G4DA 5JVTA 1U6GA 3L00A 3OV8A 4HYEA 2Q0OA 2HYFA 2QVOA 3CJNA 5A2QZ 1FZPB 1O7FA 3RYPA 5D6EA 4PDKA 5CJ9A 4EQQA 5J6XA 3ZPLA 1W5TA 1E2XA 2KIMA 2WV0A 3NRVA 4HDUA 1UHWA 4S05A 2FA5A 2H6BA 4WXDA 4AWXB 4F7ZA 4Y13A 1P4WA 3HOTA 4RB2C 3S2WA 3BROA 2QBYB 2OZ6A 2STTA 3G73A 2K4JA 2COMA 1U2WA 3GEZA 2A68F 5LRRA 2PQ8A 1YFHA 1DPUA 2EFWA 5D5VB 1IN7A 3F21A 4O3MA 1UHMA 4AD9A 3CUQA 3DPTA 4B8XA 4IF4A 3I0TA 5D6FA 2P5LC 2XKOA 4M6YA 2QENA 4A5MA 1JE8A 2W84A 1IW7F 1WI9A 3WTZA 1MD0A 2VT2A 3KETA 3ZMSA 5DDGA 3WTXC 2DQLA 3GLXA 1AWCA 4MQ9F 4L9JA 3K1PA 5CLSA 3QP6A 4CGZA 4L18B 2H09A 3MZYA 2PLYA 4MEXF 2X0LA 3DPLC 3FMSA 3LQRA 3HHHA 3F72A 1S29A 3C1DA 2BEOA 3RKWA 3FZVA 1E17A 3CUQB 3IKVA 1T39A 5CVVA 4DQ2A 1K78B 2FU4A 1NHAA 2JRTA 2O6GE 2FMYA 3IL2A 2ZNYA 4OMZA 2H6CA 4I01A 1UB9A 3T5XA 3K9TA 4HLXA 4ENKA 4D0PA 1HW5A 1D3YA 5LLQA 1IZ1A 3RIRA 3WGHA 1YW8A 3Q5FA 1L3LA 2ZNZA 1SMTA 3J80K 3LA2A 3E5XA 1ZYRF 4UV9A 4NHJA 4IRIA 2DK8A 2GXBA 3QAHA 3WTYC 3FX3A 1G3TA 1LNWA 5LGNA 3ECHA 1FSEA 4RGRA 1MJBA 2L3DA 5KK1A 4JQFA 3O3KA 2A3SA 4Y17A 4Q4ZF 2XAGA 5CYVA 1JGSA 3HOSA 1SMYF 4BYYA 2LDUA 4RAZA 2F5DA 4A5NA 4G7ZF 2ZJ2A 3HSRA 2M45A 1S6LA 4RB0A 1MDMA 3HRMA 2OAZA 5TRDA 5L3CA 3IKTA 2QQ9A 4EM2A 2KJCA 1RI7A 3C18A 1YW7A 4OIRF 4LFUA 5L3FA 4U7BA 4M6XA 5TJJA 3ABTA 4LG0B 5BMZA 4BAYA 1IXRC 2MLGA 4IPAA 1SFEA 2CG4A 3WE2A 4ZYEA 4KMFA 1SD5A 3K0LA 4L9VA 5FO5A 3F8MA 4QLCU 1LJ9A 3RKYA 1P4AA 4EJTA 3JSOA 4M73A 3MWMA 2FF4A 1XMAA 2OU2A 4M9SA 1ULYA 1IXCA 2IA2A 2VOPA 1X3UA 3E5QA 1XDUA 4ZH4F 1B9MA 1ON1A 5E1WA 1MZBA 2XGXA 2R7DA 1XGMA 3ELKA 4RGSA 4IRGA 2EFQA 2YU3A 2DAOA 1Z6RA 2VXZA 5LGUA 4GYIA 1R36A 3FMQA 2IRFG 3V7RA 2CW0F 5HOOA 2PN6A 3JW4A 2IA0A 5HDKA 1TNTA 1IRFA 3ISPA 3RTRA 3LA3A 3L2CA 1HKTA 2LKPA 3EQLF 4QWQA 3I58A 2ESNA 1QPMA 4M71A 5E18F 2QWWA 2P5KA 1HQCA 2RN7A 1G6NA 4P55A 2A6HF 1DP7P 1UFMA 2HGCA 4EVIA 3TO7A 5JI6A 1J7KA 4CO8A 5HDGA 1OYWA 1U78A 3KE2A 3VEPA 2CO5A 4UXNA 1IUYA 4KN4X 1I1SA 1YTYA 3U2RA 4ZYDA 1ZG3A 5JR3A 4BH9A 2OBPA 3GF2A 2Z99A 2DPUA 2R7FA 4EGYA 2XAJA 4MHGA 1R5HA 1YQAA 3I71A 2EV5A 3M8EA 1TTYA 5D8LB 5ERIA 3J81Z 1U8RA 1F4KA 1XGSA 3QPHA 2HWVA 2KIUA 3IC7A 1O3TA 4TV7A 1RZ4A 3B02A 4KIFA 3CDHA 4MQVA 4KFCA 3MZHA 3R61A 4O6JA 1LDDA 3LAPA 2IW5A 3WTUC 2XASA 3IHUA 4CXFA 1XSVA 3O6BB 1OMIA 5J8CA 3ZMTA 1PP8F 1ZREA 1SD6A 3F6OA 1SFUA 4CHUA 4HV5A 1XCVA 2P6SA 1I5ZA 5LHGA 2MLKA 1MJ9A 3F8NA 3F8BA 3REOA 2PBIA 1TQPA 3IRQA 4MTEA 5DYMA 1XMKA 4WXHA 2DK5A 1H0MA 2H94A 1JHFA 2GA1A 5DD4A 4KNYA 1XCBA 1PP7U 1KQ0A 4A0XA 2FNAA 2KKOA 4FT8A 2CFXA 4MTDA 2MBFA 1JXSA 4S04A 2LSOA 2M87A 1YS7A 5D8KB 1FNNA 4FX4A 3WE3A 2A5YB 3HRUA 2VC1A 2ESHA 4PZJA 3F23A 1BN5A 2P7VB 2IP2A 2QUFA 4RS8A 2R3SA 4P96A 2IT0A 2Z5UA 3HTUA 3KZZA 4L0ZB 1R1VA 3E6BA 4E70A 2EV6A 2DI3A 2DT5A 5ICCA 5K5RA 3WG9A 2DTRA 1DDNA 1P4XA 4ZYGA 3WTTC 4A0YA 2FMLA 4IXAA 1K78A 2M1BA 4HOBA 2DPDA 5ICFA 2P4WA 1P6RA 3FM5A 4HA8A 1YO5C 4RB3C 1XSDA 1KYWA 3MQ0A 1W4MA 5ILVA 1R7JA 1K7AA 2VOOA 3SHFA 2H27A 2Z3YA 3V8KA 3BOQA 1USSA 4ESJA 1F1ZA 3DV8A 1FWZA 3OOPA 4GXOA 1MGTA 5IT9K 5LHHA 1IAWA 2HZTA 3KLNA 3H3ZA 3SQNA 3ROUA 5DCMB 3RDIA 2FRHA 1Z1DA 5K5OA 4HQMA 1F5TA 2VODA 4I7HA 3GFLA 1T98A 3BJ6A 3RPUA 2YX4A 3DEUA 4OIQF 1ZGAA 5D5UB 1ZRDA 2LF8A 4HV6A 1EH8A 3W6JB 1KGSA 4XSXF 2HOEA 3R0AA 4P9FA 5E20A 2CGPA 2HEOA 2P8TA 5HDNA 5LGTA 3KP2A 3LWFA 3V8LA 2IPQX 2HKXA 2ACJA 1YW9A 2BV6A 2ZCWA 3HRTA 3I59A 2VN2A 2VBXA 1FPQA 1OKRA 3RPQA 3DFGA 3BZ6A 1XN7A 1KA8A 2EA2A 4L9TA 4HX8A 1O3QA 2IJLA 2Q2EA 3W6KB 5ED4A 2BE5F 2CSOA 4L9NA 3ZMDA 1ZH5A 2HKOA 1OYIA 1Z05A 5LEJA 5AIPA 4ESBA 5E8GA 2PMUA 2UXXA 3TDZC 1XD7A 3M8FA 4LD5A 2V6CA 2ELHA 2OD5A 1ZN2A 3TO9A 4FX0A 1FLIA 3WGIA 1ZRFA 3ZMZA 3DF8A 2XHKA 4EM0B 4XLNF 1J75A 1B9NA 3MFKA 3KP7A 4UVAA 2RC4A 1EH6A 2TDXA 1O3RA 3ZN0A 2JTVA 2VBWA 1Z91A 2Y75A 4WF2A 3KCCA 3BJOA 4LLGF 4LGWA 4L0YB 2W57A 4WWCA 4AVPA 1FOKA 3PFIA 2W25A 2FXAA 4M72A 3ECOA 4ENMA 2F5CA 1USTA 2A69F 1G3YA 1RUNA 1IN5A 5HLGA 4EM1A 2CYYA 1LEAA 2O3FA 5BQTA 3RYRA 1XGOA 2RV8A 2MH2A 4ZZLA 4KYWA 4HW0A 5FGMA 1SFXA 2D1HA 1UCRA 4PGGA 5E8IA 1T2KA 3ABUA 2KIFA 2ZFWA 1R00A 2IVMA 4N9HA 2OQGA 2QQBA 4XSZF 1WQ2A 2G7HA 1B1BA 4ENJA 1KU3A 5CVJA 3JAMK 5KVRA 1LB2A 3GZ5A 4KMUX 4KDPA 4HF1A 3KP5A 4H0EA 2IA1A 2V1DA 5IT9Z 3EUHA 4I02A 2NNYA 3BP8A 1KU2A 1QBJA 1T38A 1HKSA 1Z9CA 4AIJA 3P9KA 1ZG1A 3R6SA 2F2EA 2HTJA 2YR2A 2V79A 4ON0A 3E3VA 2WC2A 2W24A 3M9AA 5L3GA 4HDVA 4YIFA 3J80Z 1HSJA 5FB2A 2FSWA 1H9TA 5L3BA 2KJBA 4YFXF 5FD5A 1ZHFA 5K1YA 3L09A 1FYMA 2DQRA 4YFNF 3F3XA 1R58A 1B4AA 1H9GA 2JSCA 4AIKA 3NQOA 1FBQA 4B09A 2JT1A 5HS7A 1GXQA 2Y48A 1XB4A 5HVQC 1W7PD 2XRNA 3C3WA 5L3EA 3TGNA 2W85A 1R22A 1B6AA 1QZYA 4LK0F 3TOAA 1EV7A 1U5TB 2XROA 3JTGA 3DXJF 2EFPA 3SXYA 3CTAA 1XSXA 3GXOA 2QYOA 1FT9A 3GFIA 3L7WA 5ICEA 2M30A 2ZKZA 2QLZA 3WTWC 4N0BA 1HXDA 2JZYA 1MDMB 3ERED 4LLLA 1Z7UA 1J5YA 3HSEA 4RB1A 1FX7A 2K27A 5E1XA 3I59B 3RI4A 2A6EF 5H20A 3F8FA 3KZYA 2RVCA 1IN6A 3QP5A 4U0VA 1FP2A 5J8FA 4O5VA 1XGNA 1T6SA 1FBSA 1YIOA 3M7GA 5BOXA 5LRSA 4BNCA 4KUMA 4LMYA 4A12A 1ZGJA 2J5OA 2L4MA 1K6OA 3T8TA 2WTEA 3G3ZA 2DLLA 4N9IA 4HF0A 4I09A 3HHGA 2UZKA 2YPRA 5DCFA 1TLHB 4EJVA 2EB7A 4Q48A 1U5TC 5EEHA 2MC3A 2VE8A 5FLXZ 3HUGA 2XAHA 4UV8A 1BM9A 2FOKA 1IRGA 5DCMA 5FLXK 2EFNA 2ADUA 2YSRA 4I98B 4KN7X 2VE9A 1QZZA 1S3JA 1PUEE 2EK5A 4ASNA 5IT3A 4CYDA 1O57A 5AONA 4IVNA 4BXUA 3LA7A 1FYKA 2QM3A 5CVIA 3ULQB 5BPIA 5JFRA 4UUVA 2EA4A 4WXCA 4K2EA 4GYGA 3E6MA 4UHTA 2EV0A 3GWZA 4KT5C 4HBLA 2GZWA 2NYXA 2F5EA 5CVRA 2NS0A 2XKPA 1GHCA 2FBIA 1D8KA 1GVJA 1FY7A 2DU9A 2XV4S 2HR3A 4CZZA 3TQNA 3E97A 1QNTA 1V3FA 3K2ZA 2DO7A 3B73A 2AS5F 4ETSA 3NEUA 5HLHA 5F64A 2RKHA 3ZN1A 1REPC 1LEBA 2ZMEA 3JSPA 4OOIA 5FFXA 2E7XA 2PJPA 1KU9A 4MGRA 3HIFA 2B0LA 1TNSA 4A6DA 3J7AO 1U5TA 3KP4A 3F6VA 2V1XA 5D5XB 4GO1A 1S7AA 5FFZA 5LHIA 4LLNA 2DFIA 2VONA 5E17F 3F22A 3HTSB 2PG4A 3V4GA 2JPBA 1I27A 2Q8KA 1D8JA 3BWGA 1IF1A 1Z6TA 3F8CA 5ICGA 1BI0A 3CO7C 1BI3A 1R23A 4U0YA 4FHTA 3KFWX 4Q5SF 4CDGA 2STWA 3U9GA 1V4RA 1TW2A 2MD5A 4G9YA 4IJAA 4CICA 5LEKA 1CGPA 3VODA 3HSFA 2O0YA 5H6QA 3U1DA 3E6DA 1HW1A 3CLOA 3MEXA 5HLIA 2RDPA 1LDJA 4EJUA 3GZ6A 2X4HA 5D4RA 1R5GA 3KEOA 1DUXC 1R1UA 1QO0D 3D0SA 1SAXA 3E5UA 5D5WB 3EYIA 3RJPA 4EGZA 3T1BA 3D5LA 2D45A 2JPCA 1MKMA 4EJWA 4UVCA 1VTNC 1RNLA 2NRAC 3P9CA 2K02A 2WWYA 2ZXJA 2HYGD 4A2UA 3ZP5A 2J5PA 3R4KA 1W5SA 5DUIA 4Z2YA 2RNJA 2HS5A 4G7HF 1IN4A 4HX7A 4HAMA 4RGUA 4BHCA 4NB5A 3LSTA 2FQ3A 1TW3A 1S7OA 3ML6A 3BDDA 3SFZA 2F5FA 2V1UA 4RGXA 3N4MA 2GAUA 4HZFA 1LQ1A 4KA4A 3QPTA 4DNCA 4GGGA 5JHUA 3EETA 2GIVA 1O7LA 1FP1D 4OIPF 4R1HA 1Q1HA 1YG2A 4XLPF 2Z9OA 1ZARA 2LF7A 3DKWA 1ZLKA 3V7CA 1IN8A 1WKMA 2HQNA 3FHZA 5DD8A 5D4SA 4GCVA 1YS6A 1TQIA 3EDPA 3TO6A 4A0ZA 2XUBA 3GO5A 5BPDA 1BBYA 1A04A 3CO6C 2P7CB 1SD7A 2P5VA 4R79A 1YLFA 2GQQA 4WK8F 4MEYF 3MAJA 4U0WA 1KYZA 4OIOF 4P5OA 2MH9A 4PCQA 3J81K 3VB2A 3I53A 3H3UA 1TQMA 1L0OC 3JTHA 3GYHX 3K1MA 1G3SA 1D5VA 4IHTA 1J2XA 1J59A 3WU0A 5AIQA 4U7DA 2LNBA 2O03A 2K4BA 1I6XA 1J9IA 1W7PA 2VBYA 2UWMA 2G9WA 2BYVE 5F1RA 1TBXA 3FWEA 1R1TA 4G8XA 2YX7A 3TKYA 2V9VA 4RAYA 2GXGA 3LAJA 1F9NA 3BY6A 1HW2A 2ZO4A 3E6CC 1OR7A 5DUKA 4AIHA 3BJAA 4WX9A 4HF2A 2NAZA 4LB6B 1QQIA 1HKQA 1ON2A 3FM3A 2XAFA 4JBAA 4XBFA 3VOEA 1B59A 4BHBA 4LJZF 1WSUA 2L4AA 3QOPA 1OPCA 2XIGA 3KLOA 1BI2A 1OYYA 3GFJA 4XRFA 4LG0A 1T0FA 5LBQA 1STZA 2CQKA 3TOBA 2GWRA 4L5IA 2ETHA 2HTSA 1CF7A 4PGHA 3GVAA 3PQKA 4YFKF 2A61A 2QZ8A 1ZLJA 3COAC 3TDUC 3WU1B 2E1NA 1W7PB 3R60A 2O8XA 4LK1F 3C7JA 3ZMUA 1LDKB 3FF5A 1MJAA 1WRJA 4ESFA 4G6QA 2HQRA 4HLYA 1QGPA 1BC8C 3QU3A 2ISYA 3I64A 3GX4X 5ILUA 3QRFF 2XAQA 3FXRA 2E7WA 4ENNA 2FBHA 2FEZA 3ZMVA 2Y0MA 1I1GA 1PDNC 4OMYA 4M9XA 3P7NA 3LQQA 2RQPA 1O3SA 5K5QA 1YYVA 3WGGA 4KIGA 1AOYA 3K69A 1J0RA 4ZZDA 2PFBA 4I2OA 3AAFA 1U3EM 4U88A 2E1CA 3I54A 2FBKA 3KEQA 3PQJA 3WTVC 3GW2A 2G7UA 1C0WA 2DBBA 1EH7A 2EWNA 1BJAA 4G7OF 2AXLA 3WODF 4A6EA 4IRHA 2KRFA 3FMRA 4G94A 6PAXA 5A2QK 2L54A 3O2PE 3VFZA 4G6DA 1ZG5A 3T0YA 3HRSA 4EJOA 2QBYA
chains in the Genus database with same CATH superfamily
4BQAA 5E1ZB 3UR3C 4PFPA 3BPVA 2L02A 4Y52J 5DEQA 3OYNA 2ZMEB 2DA3A 4BDZA 3GFMA 2WADA 3BPXA 4HSRA 3CCVI 4KIBA 4DOZA 1H88C 3HKZA 4EMSA 3R0JA 2EZIA 2PI0A 4JK1X 1FBUA 1QZEA 2EINH 4NQWA 1J09A 1S9HA 2EJRA 5GPAA 4XQFA 5FD6A 5BS6A 5B3SH 1JHHA 1CF7B 3CUOA 1ETOA 3EYYA 1WJDA 1IGNA 2EH3A 2NNNA 3FXQA 4EV0A 3Q9SA 4FETA 1RIOH 3ZOBA 4P9UA 4HX4A 3I4PA 4GDFA 2VBZA 2O61A 4OU0A 2CUFA 2OZUA 5EF6A 2Y9ZA 5EDNA 2LTPA 2QQAA 4LOCA 3GTGJ 2M5WA 5EGOA 3L2RA 2DXIA 1R6RA 3OY9A 2D1VA 4C2UA 3JAMR 3L9FA 4KICA 4ZYHA 3DP7A 1BI1A 3FKIJ 4DZPA 3RKXA 1ONVA 2BXYA 3V42A 3CCSI 4MNUA 5HS9A 2VKEA 4IKFA 5J4YA 4CCJA 1WJEA 3BG5A 1PYVA 2ZBKA 4UUSB 3ZQ7A 3PO2J 5JLXA 1BIBA 1X1PA 4IHWA 4ZC3A 4CCLA 4A3FJ 2GOMA 1ZRCA 1YIJI 5B1AH 3BR0A 3LL7A 4HRIA 2BBYA 2M8EA 3K1NA 5CVUA 2BGCA 4WCGA 4BJTA 2VJJA 2HFHA 2PEXA 1ACIA 5E79C 2Z33A 4JOMA 3DQVC 5L3DA 1HBXG 1P2FA 2KT0A 3LFKA 2P6TA 1KQ8A 4ZDPA 3IRRA 3T8RA 2NXNB 2OA4A 2RGVA 4BS9A 2M3AA 1SEUA 1XS9A 2X48A 1UHSA 2HDCA 4IL6C 3F0CA 4A93J 4BEHB 3FXUA 4XKVA 1WWXA 3KP6A 3N97A 1FSHA 3A0HC 3HKZN 2E2HJ 2K3FA 2MA3A 4M74A 4M9ZA 4BQOA 4UNOA 1IXSB 3PNVA 4LB5A 3M1EA 5J1YA 2R7OA 2FNPA 5M5YJ 1YX5A 4YG2F 3JAMZ 4HNUA 3SZTA 2ICWG 1FC3A 2DA4A 1MBKA 2XVCA 1DP3A 3I3LA 2KDOA 3VPRA 3K6GA 3V8JA 3DTEA 2OTLI 2K86A 1X1DA 4L5JA 5ILSA 2C6YA 2HYJA 2V7FA 4OINF 3GTPJ 1AKHA 2D2WA 4M3FA 4CCKA 5B5EC 1VFCA 2BVMA 4BY1J 3MCZA 1FYLA 3CCMI 1UG2A 3CZ6A 1HSTA 1Y1VJ 3D5SC 3WTSC 3KP3A 1K79A 1G3WA 1X1BA 2CQQA 4V2GA 1S8NA 1BC7C 2LFBA 5EEGA 5FLMJ 2MD0A 3IWZA 3H5NA 1VQ5I 5EGOB 1BIAA 3W2AA 3HYIA 4IHSA 3TL4X 1XDSA 1RC9A 1ZAOA 3SZPA 1P92A 1ODDA 3P9IA 2OQRA 3I5UA 3IWFA 2KDZA 2KMUA 1Z3XA 4BHPA 2DW4A 2GA2A 5F6FA 1LVAA 1SVLA 2KZGA 3CUQC 5HS8A 1T0FC 2X98A 3J7ZI 4Y15A 2WBMA 2VC0A 4BEHA 2KLOA 4CUGA 1ZELA 1KU7A 4I0AA 4J19A 2FE3A 2JA7J 1RUOA 2JQ7A 1A5JA 1I3AA 3GTLJ 2WA0A 4YIIA 2A07F 4PFOA 4R8HA 1DPRA 1GXPA 1Y0UA 1V54H 5FRNA 2PMHA 4UY8I 4W1UA 4UVBA 2MUNA 3CCRI 4ZJZA 4XRMA 1GDTA 3J7YJ 1SD4A 2K40A 1AU7A 2EFOA 5H6RA 2VUMJ 3K7AJ 1KQ9A 2MSYA 1ERDA 2RAEA 2RQQA 2VT3A 1P9QC 2L01A 2EZLA 3Q9VA 4Q47A 2UXNA 1EA3A 4F93B 3GUDA 3H92A 4RM2A 3IUOA 4JYKA 1XTAA 3KYCB 4I0BA 2CWEA 3S1NJ 3H0GJ 1SAUA 5DV5A 2R5ZB 3FXJA 1QA6A 4DW6A 2DTZA 4HQEA 2ISZA 2CQXA 3V7SA 2K7LA 2DA2A 2P81A 1KZHA 1RKTA 3QU6A 1BOAA 1XG1A 1G4DA 5JVTA 1U6GA 3Q3SA 3CC4I 3L00A 1P7JA 3PUBA 3OV8A 4HYEA 2Q0OA 2HYFA 2QVOA 3CJNA 5A2QZ 1FZPB 1O7FA 2EIMH 2DCEA 3RYPA 4CYCA 5D6EA 4PDKA 2XGEA 2HQAA 1NG6A 2LKXA 2P0TA 4XM3A 2HQ5A 5CJ9A 1D1CA 4IOCF 3OR1C 1A36A 1N78A 2IS2A 2CW7A 4EQQA 3AG4H 5J6XA 2TRTA 4QSHA 2JMWA 3K70C 3ZPLA 4XLEA 1W5TA 1OCPA 1E2XA 2CW8A 2KIMA 2LKSA 3BCBA 2WV0A 3JCUC 3NRVA 4HDUA 4B4CA 1UHWA 4S05A 2FA5A 1QHHD 2LP0A 4IHXA 1SANA 2H6BA 4ANJA 4WXDA 2I5UA 3DPUA 4AWXB 4F7ZA 4Y13A 1P4WA 2L7ZA 3HOTA 4RB2C 2CQNA 2O8KA 3S2WA 3BROA 2QBYB 4PK4A 3ERMA 2OZ6A 2STTA 3G73A 2ME6A 2K4JA 2COMA 3CCJI 3W6VA 3H1CA 1U2WA 3GEZA 4BE1A 2A68F 3E0JB 2PQ8A 5LRRA 1YFHA 2JVHA 1W5CC 3A03A 1JKPC 1DPUA 2EFWA 5D5VB 1IN7A 1WVRA 3F21A 4O3MA 1UHMA 2Q2EB 4AD9A 3W3CA 3CUQA 3ASNH 3DPTA 4B8XA 4HNTA 4G12A 4IF4A 3C2BA 3CCLI 1NH3A 1WJAA 2E36A 3I0TA 5D6FA 3S3NA 2P5LC 2XKOA 2M35A 1QRYA 1ENHA 4M6YA 4M3DA 2QENA 2Y2ZA 4A5MA 4BUPA 3DU5A 2MC4A 1Z7LA 1JE8A 2F4MB 2W84A 1VQ4I 5BNGA 1IW7F 1WI9A 3WTZA 5H2FC 2R0QC 4OWRB 1XPXA 1MD0A 3O8HA 3NWTA 2ZFUA 2L7MP 2VT2A 4PJ0C 3DU6A 2WB1N 2X6XA 3KETA 2VJ5A 1MSEC 2E2IJ 3ZMSA 5DDGA 2R7UA 3WTXC 2DQLA 3LSGA 3GLXA 3A01B 1EKEA 1AWCA 3GTJJ 4MQ9F 4L9JA 2V1NA 3GLLA 1MMNA 3K1PA 5CLSA 3RZDJ 1Z21A 3QP6A 4RLFA 4L18B 4CGZA 2H09A 3MZYA 2PLYA 3K4BA 2CUZA 4MEXF 4ABZA 3BG7A 2MYSA 2X0LA 3L2QA 3DPLC 3FMSA 3LQRA 3LSHA 4XNFA 3CMEI 2R5YA 4QTRA 3HHHA 3ZQIA 3EUKL 4D1QA 3MKLA 1H8AC 2IS6A 3HM5A 3F72A 1FEXA 3S2DJ 1S29A 1HC8A 4RLQA 2Y0SA 4F55A 3HOUJ 2Y30A 3H9GA 3C1DA 4A3KJ 3H5RA 2BEOA 3RKWA 5DTDA 3DBHB 3FZVA 3U21A 2L7FP 1YJWI 4II2A 1E17A 5IP7J 3CUQB 3IKVA 2FUG2 2JJ7A 1T39A 5GAHJ 1U9OA 5CVVA 1ETVA 4DQ2A 1OCZH 3CMYA 2FU4A 1K78B 3GCMA 1NHAA 2JRTA 2O6GE 2FMYA 3IL2A 2ZNYA 1RESA 4OMZA 2X1DA 2H6CA 2DJNA 4I01A 1ZQ3P 1UB9A 2CU7A 3PM1A 3T5XA 1K6YA 4F52A 4XRSA 4IHVA 1TT5B 3K9TA 4HLXA 4ENKA 1VQLI 1X4OA 4D0PA 1HW5A 1D3YA 2F6CA 2K85A 4NUBA 5LLQA 5C4XJ 1IZ1A 2LR8A 3RIRA 4GFBA 3WGHA 3IH4A 1XMXA 1YW8A 3MKWB 3Q5FA 3LFUA 4JX4A 3K10A 1L3LA 2ZNZA 1SMTA 2BW3B 3LSPA 5GTIC 3J80K 5LD2C 4IQJA 3LA2A 2MVTA 3E5XA 1ZYRF 4UV9A 4NHJA 5JHFA 4BE0A 1QVUA 4IRIA 4Z6YA 2QKMB 4XL9A 2DK8A 2DMNA 4C2MJ 4A3LJ 4IEJA 2GXBA 4LITA 2HI3A 3DEEA 4BJ5C 3QAHA 4XICA 3WTYC 3FX3A 1BR2A 4ZTJA 1G3TA 1LNWA 1Y56A 5LGNA 1S72I 3ECHA 1FSEA 4RGRA 1W36C 2I10A 2OTJI 3CDIA 3K4NA 2FOWA 2RREA 1MJBA 3JRCA 2L3DA 3LSIA 5TISC 5KK1A 3HL2A 1NTCA 4JQFA 1F43A 3O3KA 4XLFA 2A3SA 4Y17A 2IGNA 4E6KG 4Q4ZF 3G71I 2XAGA 1FIPA 3FBIB 4Y3OA 1Z77A 5CYVA 1JGSA 1W0TA 3J7AY 3HOSA 1SMYF 4BYYA 3QOEA 3LSRA 2HVRA 2QA4I 2Q1ZB 4C9YA 2LDUA 4RAZA 3LSJA 2F5DA 4A5NA 4G7ZF 2ZJ2A 3HSRA 3NARA 2M45A 1Q1VA 1WJFA 1S6LA 4RB0A 3U1KA 1MDMA 4A3EJ 2F48A 5J40A 3HRMA 1X19A 4J01A 3FKJA 2DOEA 2OAZA 5TRDA 5F1JA 5L3CA 3S1MJ 3IKTA 3M4OJ 2QQ9A 4EM2A 2KJCA 2LYCA 1RI7A 3C18A 1YW7A 4OIRF 2R93J 4LFUA 1G8XA 5L3FA 2GOXB 4U7BA 4M6XA 5TJJA 3H36A 3ABTA 1PVEA 4LG0B 5BMZA 4BAYA 2KQRA 1IXRC 1T33A 2MLGA 1BA5A 4IPAA 1SFEA 2CG4A 1GV2A 3WE2A 4ZYEA 4AC0A 4KMFA 1SD5A 3K0LA 4L9VA 3IP4B 5FO5A 1HCRA 3F8MA 4QLCU 2DJIA 3OMYA 1LJ9A 3BT9A 4L5EA 1P4AA 3RKYA 4B47A 1UELB 1YI2I 4NDLA 4EJTA 1MNMC 3JSOA 2L9RA 4FASD 3FK6A 2MG4A 4M3BA 3MWMA 4M73A 3TBIA 1HA8A 2FF4A 3QQAA 3CP8A 4XKBA 4NC8A 1XMAA 2OU2A 3K2AA 2ZB9A 4M9SA 1ULYA 1IXCA 2IA2A 2VOPA 4JP0A 3A2KA 5CPRB 5IYCJ 1X3UA 3E5QA 1Y6IA 2E5NA 2XF7A 3LMMA 5EJCA 4A3DJ 1P7IA 2VASA 1XDUA 2JA2A 4ZH4F 1B9MA 5IYBJ 3HC7A 1ON1A 5E1WA 1MZBA 2XGXA 2R7DA 1DGRM 1XGMA 3BR6A 4YEJA 3ELKA 4RGSA 4IRGA 2EFQA 2O9LA 1PUFB 3MN2A 2YU3A 2DFEA 4II3A 1YJ9I 2DAOA 4LG3A 3SFIA 1MH3A 3DBRB 4C2TA 4DIQA 1Z6RA 2CJJA 2VXZA 2V26A 5LGUA 4GYIA 4LIVA 1R36A 3FMQA 2IRFG 1TWCJ 2CS3A 3V7RA 4PJJA 3LNQA 2W4SA 2NVXJ 2CW0F 3DBLB 5HOOA 1RRJA 1BL0A 2PN6A 3JW4A 2BW3A 2IA0A 1DGWY 5HDKA 1TNTA 1Y0NA 1IRFA 3JREA 3Q0UA 2EILH 3ISPA 5FLVA 3RTRA 2V9KA 3LA3A 4FCYA 3L2CA 1VQNI 2K9SA 2LKPA 1HKTA 3EQLF 4QWQA 2VQHA 4FISA 5GPCA 3I58A 3OL4A 2ESNA 5GP9A 1QPMA 4M71A 5E18F 2QWWA 2P5KA 3VDXA 1HQCA 3FBNB 1IJWC 2RN7A 1G6NA 4I76A 4P55A 2A6HF 1DP7P 1UFMA 2HGCA 2F4OB 2DYRH 3TO7A 3WHCA 4D7NA 4EVIA 3MKZA 5JI6A 2Z2SB 1MNDA 1VQKI 1J7KA 4CO8A 5HDGA 5C4JJ 4FE4A 4XN3A 3OYJA 2VPRA 4YRVA 4A69C 1OYWA 2WY8Q 1U78A 1FOYA 3L2WA 4DZJA 1TT0A 3KE2A 3VEPA 3QYEA 1X1AA 2CO5A 4UXNA 1IUYA 5GAGJ 4KN4X 3WHBA 1I1SA 1YTYA 3U2RA 4ZYDA 1ZG3A 4AU7A 5JR3A 4BH9A 2OBPA 3GF2A 5TGTA 2XSJC 2LBFA 2DOFA 2Z99A 4BQNA 2DPUA 3QPLA 2R7FA 4B1RA 4S0HB 3OS0A 4EGYA 2XAJA 3HGYA 4MHGA 2KFDA 1CQTA 1A35A 1R5HA 4CYCB 1OR7C 2DDAA 4RBOA 1YQAA 1IDZA 3I71A 2QSFX 1ZR2A 2EV5A 3M8EA 1QPIA 1SVMA 2FD5A 3GMEA 1TTYA 2JRMA 5D8LB 4C3IJ 2L7KA 5ERIA 3J81Z 3HBLA 1U8RA 1F4KA 4AYBN 1XGSA 2VXDA 2LK2A 3QPHA 2HWVA 3CP2A 2KIUA 3IC7A 1O3TA 4TV7A 1RZ4A 3RPUD 3B02A 2W00A 3S93A 4KIFA 3P5JA 1FJLA 3CDHA 1ZTRA 4MQVA 4KFCA 3MZHA 3R61A 2AXTC 4O6JA 1LDDA 3K4KA 2IW5A 5KCMA 3LAPA 4QIWN 1I50J 3WTUC 3PIOF 2XASA 1RR8C 3IHUA 4CXFA 3NWSA 2LD5A 2AHQA 1BW6A 4I99C 3WU2C 1XSVA 3O6BB 1OMIA 1MSFC 5J8CA 3ZMTA 1PP8F 1ZREA 4JX6A 1SD6A 3F6OA 1SFUA 4CHUA 1YITI 2R7ZJ 3M07A 4UUSA 4ZDOA 4BXFA 4HV5A 3C2GA 1XCVA 4XRSG 2P6SA 1I5ZA 5LHGA 2MLKA 4A3BJ 4AYBA 3EUAA 3KYDB 1MJ9A 3F8NA 3IV5A 3F8BA 3ZGKA 3REOA 2PBIA 1WGXA 1TQPA 2KPMA 2DFFA 3CLQA 5F04A 3IRQA 3S16J 2ZMEC 1ZK8A 3FK7A 4MTEA 5HNHA 2ECBA 4XN0A 5DYMA 1XMKA 3MMYB 4WXHA 2KIQA 2DK5A 1H0MA 2H94A 1JHFA 2GA1A 5DD4A 3KIOA 4KNYA 1XCBA 2JUGA 1VI0A 3OWTA 1PP7U 1KQ0A 4A0XA 2FNAA 2KKOA 2VL8A 1TWFJ 3FISA 4FT8A 2CFXA 2AO9A 4XORA 5EEAA 2DT7B 1H89C 4MTDA 2MBFA 1JXSA 4RM3A 4S04A 2LSOA 1AKHB 2BXZA 2M87A 1YS7A 2M7AA 4XKWA 5D8KB 1FNNA 3BG3A 3CF5F 4FX4A 2DMTA 3KZIC 3BZKA 3WE3A 2A5YB 4XKCA 1IV6A 3HRUA 3BG9A 2VC1A 1WHUA 3PL8A 2ESHA 2LVSA 4PZJA 2HVSA 1Z0XA 1Z3YA 5DS9A 3F23A 1BN5A 2P7VB 2IP2A 2QUFA 3G2BA 4D5FA 5FLXR 4RS8A 2R3SA 3FXKA 1GV5A 2R5YB 4P96A 2IT0A 1IV8A 3QYBA 2GIZA 2Z5UA 1Z67A 3HTUA 3KZZA 3A01A 2FJ1A 4XONA 4X1EA 4L0ZB 1R1VA 2BY2A 3E6BA 1Y39A 4AM3A 4E70A 4QPOA 2EV6A 2DI3A 1XC5A 2DT5A 5ICCA 1D5YA 5K5RA 3WG9A 2DTRA 3H0DA 2M9HA 1DDNA 3CDLA 5EG0B 1UJ8A 3ONQA 1P4XA 3ZQLA 4ZYGA 1GT0C 4NC7A 3DLLF 3WTTC 1LFPA 4A0YA 2FMLA 4IXAA 1K78A 2L9NA 2M1BA 1MBJA 2XGCA 2IXSA 3QODA 4HOBA 4E7SA 2JVGA 2DPDA 2EZHA 3DTKA 3MKYB 4BXXJ 1TWGJ 5ICFA 1TWAJ 2ECCA 2P4WA 1P6RA 3FM5A 4HA8A 1XX5A 1YO5C 4RB3C 1F36A 1V5FA 2IS1A 4W97A 1XSDA 4RDUA 1KYWA 3MQ0A 3I9V2 3HOZJ 1W4MA 1DU0A 5ILVA 2JWTA 1R7JA 1GVDA 1K7AA 2XB0X 2VOOA 1ETWA 3SDBA 1B72B 3G6EI 3SHFA 3OSGA 2M0MA 2H27A 2Z3YA 3V8KA 3BOQA 3SDGA 1USSA 2HU9A 3EUHC 4ESJA 3AG1H 1F1ZA 3DV8A 1FWZA 3OOPA 2LBFB 4GXOA 2VB6A 4A3JJ 1MGTA 1G2HA 5IT9K 5LHHA 1IAWA 3LSMA 2H8WA 1VF9A 2HZTA 4MO7A 2ZSIB 3KLNA 3H3ZA 3SQNA 3ROUA 2LY1A 1PJRA 5DCMB 3RDIA 2E60A 2FRHA 2Y31A 2N8GA 2R7TA 1Z1DA 1WH7A 1AA7A 1TL8A 5K5OA 3A02A 4HQMA 1F5TA 4PJNA 2DA7A 2NVUB 4BKXA 4J00A 2Y69H 2VODA 4I7HA 3HOVJ 3GFLA 4BDYA 1T98A 3BJ6A 3OOUA 3RPUA 2YX4A 3DEUA 4OIQF 2HXIA 4HNVA 1W36D 1ZGAA 5D5UB 2X6WA 4N4OB 1ZRDA 3J81R 5KNLA 2LF8A 2VKDA 2R4GA 4HV6A 2VI6A 1EH8A 3K4LA 3W6JB 5IOYA 1KGSA 4XSXF 2HOEA 3R0AA 4P9FA 1KONA 3S32A 3H5AA 2KL4A 5E20A 2CGPA 2HEOA 2P8TA 5HDNA 1OJLA 5LGTA 3DCFA 5KAIC 3KP2A 3LWFA 3V8LA 1YRNB 2IPQX 5FKMA 3VYSB 2HKXA 2GM4A 2ACJA 4C3JJ 1YW9A 5FKOA 2BV6A 2ZCWA 3I4MJ 3HRTA 3J80R 3I59A 2VN2A 3OSFA 5J47A 4HG2A 4AIDA 2VBXA 1FPQA 2EPFA 2EQRA 4U87A 4KITB 2W48A 1OKRA 3RPQA 3DFGA 1PUFA 3BZ6A 2DMPA 3NAUA 1T08B 3OYFA 1XN7A 1KA8A 2EA2A 4IX7A 4X0GA 4L9TA 4HX8A 1O3QA 2IJLA 2Q2EA 3W6KB 3HZJA 1EJ9A 1D1BA 5JLWA 5ED4A 9ANTA 2BE5F 1QU3A 2KISA 2ZXIA 2XAUA 2CSOA 4L9NA 3CCUI 2YUSA 3ZMDA 1ZH5A 2HKOA 1OYIA 3Q0VA 2XPUA 1Z05A 1VQ9I 5LEJA 1LVKA 5AIPA 4ESBA 2V9PA 3PO3J 1RPWA 5E8GA 2PMUA 2UXXA 1VZ0A 3TDZC 1XD7A 3M8FA 4LD5A 2R7RA 3SEZA 2V6CA 2ELHA 2OD5A 3C2HA 3OL3A 1ZN2A 3FXOA 3JRFA 3TO9A 4FX0A 2DMUA 1FLIA 4XIDA 3WGIA 3QYFA 1T8IA 3HDDA 1X1CA 1ZRFA 3ZMZA 3OYAA 1ZGWA 2KP6A 3DF8A 1MBGA 2BZTA 2KHMA 2XHKA 4EM0B 4XLNF 1J75A 1B9NA 3H3VK 4E4HA 2HPMA 3MFKA 3KP7A 3O8GA 4UVAA 2RC4A 2CV2A 2DMQA 1EH6A 2TDXA 1O3RA 2WAQA 3ZN0A 2JTVA 2VBWA 1Z91A 2Y75A 4CCNA 4WF2A 3BG6A 3KCCA 3BJOA 3OYBA 1TWHJ 4LLGF 4LGWA 2IGKA 2LREA 2CRGA 4L0YB 4ITVA 2IGMA 4KT6A 1HLVA 2OCEA 2W57A 1M1EB 4AVPA 4WWCA 1FOKA 5FROA 3PFIA 2W25A 2FXAA 3W2WA 4M72A 3ECOA 3ZXSA 4BQQA 4YIRX 4ENMA 1X4PA 2O7OA 3CCYA 2NVQJ 2A05A 1X3ZB 4MLOA 2F5CA 1USTA 2A69F 1G3YA 1RUNA 1IN5A 1ETQA 2OPTA 3S15J 2LG4A 1YX3A 5HLGA 4EM1A 2NS7A 2WV1A 2CYYA 1LEAA 3ZQQA 3HPGA 2O3FA 5BQTA 3RYRA 1XGOA 2RV8A 3PJRA 2MH2A 4ZZLA 3JRGA 4KYWA 4HW0A 4XK4A 5FGMA 1SFXA 2D1HA 4CSWA 1UCRA 5GTHC 4PGGA 1YOVB 2BY3A 5E8IA 1T2KA 2PJRB 3ABUA 3RSNA 1I3QJ 4MFEA 2KIFA 2ZFWA 1R00A 1U0JA 2GLOA 3K4JA 2IVMA 4N9HA 2OQGA 2K9NA 1Y8RB 2E35A 2QQBA 4XSZF 1WQ2A 2G7HA 1B1BA 3OYCA 4ENJA 1SFOJ 4HPQA 1KU3A 5CVJA 3JAMK 2ID3A 2CV0A 5KVRA 2MABA 1LB2A 3GZ5A 4KMUX 2HDDA 4KDPA 4HF1A 2A5WA 3KP5A 2IA1A 3PFYA 3OYDA 2VLAA 4H0EA 1MMSA 3S1QJ 3S14J 2V1DA 4F92B 5IT9Z 5IY5H 3EUHA 3BQZA 2BY0A 4I02A 2NNYA 3BP8A 1KU2A 4EATA 3QPSA 2EZKA 1QBJA 1T38A 3CMMA 4NBQA 1HKSA 1Z9CA 5CKTA 4ZYAA 4AIJA 3P9KA 2XRLA 4IQ4A 4V2FA 1ZG1A 3R6SA 2F2EA 5IP9J 2HTJA 2YR2A 2V79A 2ZJQF 2K5CA 4IZZA 4ON0A 3E3VA 2WC2A 2VKVA 5CQGA 4KJZA 2E71A 1IRZA 2W24A 1UZCA 3M9AA 2XSDC 5EYRA 5L3GA 2V6EA 2QCOA 3MD2A 4HDVA 4CCOA 4YIFA 2HDWA 3J80Z 3GTMJ 1HSJA 5FB2A 1JKQC 2FSWA 1H9TA 1EF4A 2M2EA 3B6CA 5DM7F 2X85A 5HODA 3S17J 1U8BA 5L3BA 4NQWB 2KJBA 4YFXF 5FD5A 2AQFA 1ZHFA 5FKNA 3L09A 2EBIA 5K1YA 1FYMA 2DQRA 4YFNF 3F3XA 2HVQA 4HEA2 1R58A 5K7FA 1B4AA 1H9GA 1MBHA 3S1RJ 1AHDP 2JSCA 4BGDA 4ZDLA 4E7HA 4AIKA 3NQOA 1FBQA 4B43A 4B09A 1WI3A 2X1CA 1MMAA 2JT1A 3FIWA 1GXQA 5HS7A 2Y48A 3JRHA 1XB4A 5HVQC 5M3MJ 1W7PD 2MZ4A 4RAGA 2JA8J 2XRNA 3C3WA 4UB6C 5L3EA 3AKZA 3TGNA 3OIPA 4XOTA 2W85A 1R22A 3BCAA 2NS8A 1NK2P 1B6AA 3IH2A 1QZYA 4LK0F 1X3WB 3TOAA 1WH5A 4BY7J 1EV7A 1U5TB 2QF7A 2XROA 3JTGA 1A31A 3DXJF 5KHDA 2EFPA 3SXYA 3CTAA 4FTHA 1XSXA 3BQYA 3GXOA 2BY1A 1R4NB 3SYTA 2QYOA 1FT9A 3OYIA 3GFIA 1R4MB 3L7WA 2M30A 2P0WA 2ZKZA 4XMYA 5ICEA 2QLZA 3WTWC 2DODA 3BLYA 1HXDA 3BC8A 4N0BA 4DYQA 2JZYA 1MDMB 5F0CA 5EZHA 3ERED 2NVTJ 4LLLA 4A3MJ 1Z7UA 1J5YA 4MFDA 3VSLA 3HB9A 2K9QA 3HSEA 4RB1A 1FX7A 2K27A 5E1XA 1RR7A 3I59B 2A6EF 3RI4A 5H20A 3F8FA 1S5LC 3K70D 3S3MA 3CD6I 1OCCH 3KYLA 3KZYA 2RVCA 1IN6A 3QP5A 3ZQGA 2CV1A 5HNFA 4U0VA 4A3GJ 1FP2A 5J8FA 4O5VA 2WAEA 1XGNA 1WJ5A 1T6SA 2PX9A 1FBSA 1YIOA 3M7GA 3ZQHA 5BOXA 5LRSA 4BNCA 4N4NB 4KUMA 2E2JJ 1IRXA 2JN6A 2L9SA 4LMYA 1LKXA 4M3GA 1TP4A 2X6OA 4A12A 1ZGJA 1MH4A 2J5OA 2L4MA 1K6OA 2GXAA 2K9MA 2Z1DA 4D5CA 3ABMH 2LY9A 3T8TA 1JUPA 2WTEA 3G3ZA 2DLLA 4N9IA 4HF0A 4I09A 4LIUA 2X1EA 3HHGA 3EPZA 2UZKA 2IS4A 3BR5A 2HZDA 3QWLA 2W82A 2YPRA 1FTZA 5DCFA 1K61A 4V19K 1K83J 1TLHB 4EJVA 2EB7A 4Q48A 1U5TC 5EEHA 1X2NA 2MC3A 2VE8A 5FKKA 5FLXZ 3HUGA 2XAHA 3JR9A 3PNTA 4UV8A 4B48A 1BM9A 2B7EA 2FOKA 1HOMA 2IBDA 1IRGA 4B44A 2W1OA 4YELA 5DCMA 3AL0C 1Y8QB 2EFNA 5FLXK 3BTCA 2ADUA 2LOOA 1UAAA 2YSRA 2NOGA 1OCOH 4DBQA 4I98B 4KN7X 1OCRH 3FHNA 3PSFA 1JUMA 2VE9A 3OYEA 4IOAF 1NK3P 1QZZA 1S3JA 4BBRJ 1PUEE 4IHYA 2XF5A 2EK5A 2OV7A 5LFAA 2BHYA 1JI8A 3PSIA 3K4MA 5FJ8J 4ASNA 2MFZA 2VIXA 5IT3A 1RKWA 4CYDA 1O57A 3HGGA 4OAZA 5AONA 3K4CA 1MBFA 4IVNA 1S7EA 4BXUA 3OS2A 1R5ID 1D1AA 3LA7A 2HPIA 1FYKA 3CQZJ 4RA2A 4KISA 2HOTA 5KAFC 2L5QA 2QM3A 5CVIA 4UB8C 3CCQI 2ZXWH 3KX2A 4OAYA 1B72A 3ULQB 5BPIA 3RCOA 4CCMA 4AVZA 5JFRA 3HOXJ 2YS9A 4UUVA 1APLC 2EA4A 1WZ2A 1Y1WJ 1VQMI 1K4TA 4WXCA 3S2HJ 4K2EA 4GYGA 1JTYA 3E6MA 3VWBA 4D9JA 2VQGA 4UHTA 2EV0A 3GWZA 1LE8A 2H1KA 2CMPA 4KT5C 4HBLA 3JRBA 3I4NJ 2GZWA 2NYXA 2F5EA 3DKYA 5CVRA 3DLAA 2NS0A 2XKPA 5IYDJ 3L2UA 3FXLA 1GHCA 2ZXHA 2R7VA 2FBIA 1D8KA 1GVJA 2M0CA 3VYUB 1FY7A 2DU9A 2XV4S 2HR3A 4B3XA 4A3CJ 4CZZA 3JRIA 4DYCA 3TQNA 5E3OA 4E7LA 2JUCA 3E97A 4DYRA 1QNTA 3A4CA 4ZTFA 3BR3A 3OYGA 4CH7A 1V3FA 5M3FJ 3K2ZA 2VPLA 2DO7A 3B73A 2AS5F 3F9KA 4ETSA 3NEUA 5HLHA 5F64A 2RKHA 2Y0SN 3ZR8X 3ZN1A 2VKHA 1REPC 3SJMA 1LEBA 1I6HJ 1V5EA 2ZMEA 3JSPA 4OOIA 4I6ZA 1JT0A 2A6TA 5FFXA 2ZC2A 2E7XA 2XF6A 2PJPA 1BJZA 1DQUA 1KU9A 2XGDA 4MGRA 3HIFA 4P1WA 2H8RA 2B0LA 4UUTA 2D5VA 4EEFG 2KRHA 1TNSA 4A6DA 3RZOJ 3J7AO 1U5TA 3UKGA 1GLNA 3S8PA 3OIOA 3KP4A 3F6VA 1N77A 2V1XA 4XR6A 5D5XB 4GO1A 1QVTA 4CZCA 1S7AA 5FFZA 3IH3A 5LHIA 2B63J 1WJBA 4LLNA 3VYRB 2DFIA 5K7HA 4H4KC 2VONA 5E17F 3F22A 2LH9A 1BR4A 3D1NI 3HOWJ 3HTSB 2PG4A 2FX0A 5F27A 3V4GA 3L2VA 2JPBA 1I27A 2Q8KA 1D8JA 3BWGA 3DEWA 3SEQA 1IF1A 1SC7A 1Z6TA 3F8CA 3I55I 3OIQA 4BE2A 3OS1A 2ZJPF 5ICGA 3CMAI 1BI0A 3CO7C 2JA5J 1BI3A 2BOLA 2E5ZA 5HLTA 1JKRC 4M6VA 2R7WA 1A6QA 2K3PA 4X6AJ 3HG9A 1R23A 4F91B 4FHTA 4U0YA 1ZR4A 3KFWX 4Q5SF 4CDGA 2STWA 5GAEJ 3PUFA 1MBEA 3U9GA 1V4RA 1E3OC 1TW2A 2R5ZA 2MD5A 3M8JA 4G9YA 1FOXA 4CA0A 4IJAA 2K9LA 2X6YA 2IGOA 4CICA 5LEKA 1CGPA 3VODA 3HSFA 2O0YA 5H6QA 1IDYA 4BL0B 1VQPI 1LPQA 2LLKA 3U1DA 2UV1A 3M1CA 3E6DA 1HDPA 2R92J 3IAS2 1HW1A 1TZLA 3CLOA 2VJIA 3CCEI 1MW7A 3MEXA 5HLIA 2RDPA 1LDJA 4EJUA 1LE8B 2V4JC 3GZ6A 2QKLB 2CFOA 2ME0A 3LOCA 2X4HA 5D4RA 1W0UA 1R5GA 3KEOA 4XLAA 1TC3C 4B3AA 2JSPA 2M34A 2QGUA 1YHQI 2VQLA 3AL0B 1D0ZA 3BZCA 3I56I 1DUXC 2ZJRF 1R1UA 2O5RA 1QO0D 3D0SA 2E1MC 1SAXA 3E5UA 5D5WB 5IP6A 3RJPA 3EYIA 4EGZA 3CJQB 2HXOA 2RNGA 2AQEA 3H9JA 4MIMA 3T1BA 1YJNI 2XPWA 3MVPA 3AG3H 3D5LA 2D45A 2JPCA 3L1PA 2BVLA 1MKMA 1WPKA 4EJWA 2OC6A 2E34A 4UVCA 4BU2A 4Y7NJ 5FRMA 1D0XA 4F3QA 3OYLA 1VTNC 4AUXA 2PJRA 5J1RA 4NC6A 1RNLA 4DJAA 2NRAC 3P9CA 1N25A 2X51A 3PNYA 2K02A 3S3OA 2WWYA 2IEKA 1E0EA 3ZCOA 2ZXJA 2R7QA 2HYGD 2UUZA 4A2UA 5DM6F 2HNHA 3ZP5A 2J5PA 3TMOA 3Q0WA 3R4KA 1W5SA 4RAFA 1SVOA 5DUIA 3BR2A 1SFKA 4Z2YA 2RNJA 2HOAA 2Z16A 2HS5A 4G7HF 1G59A 1IUFA 4A3IJ 5JVGF 3CF2A 4FQGA 1IN4A 4HX7A 1HDDC 1IG7A 3B6AA 4Y33A 4HAMA 4RGUA 4BHCA 2L2OA 1ETKA 4NB5A 4IO9F 2DYSH 3VSKA 1IC8A 3LSTA 2FQ3A 1TW3A 1S7OA 2E1MB 3BDDA 3ML6A 2F5FA 3SFZA 3ZQFA 2V1UA 1MMGA 2WY7Q 3DWLE 4RGXA 3CJTB 3N4MA 2GAUA 3BR1A 4HZFA 2LC2A 1LQ1A 1JUSA 4KA4A 2PMZA 1R71A 3QPTA 2DN0A 2DA6A 3TW6A 1E3PA 4DNCA 5EG0A 1FMVA 4GGGA 1VQOI 5JHUA 3EETA 2GIVA 1O7LA 1FP1D 1HF0A 2W7NA 4C30A 3UNGC 3N05A 4OIPF 4R1HA 1Q1HA 1YG2A 2WAQN 4XLPF 1JJ8C 2Z9OA 1ZARA 3KPHA 2LF7A 3DKWA 1ZLKA 2LRDA 3V7CA 1JGGA 4M3EA 3RQIA 1IN8A 2DFHA 3WG7H 1WKMA 3GTQJ 2HQNA 4PJMA 2M8GX 3OYKA 3FHZA 5DD8A 5D4SA 4GCVA 1YS6A 1TQIA 3HPHA 3EDPA 1R9TJ 3TO6A 2MW8A 4A0ZA 1V5GA 1WJCA 2XUBA 3GO5A 4Y4RA 3OYHA 1K4SA 5BPDA 1BBYA 3G1LA 1N75A 3KEYA 5CQEA 2HOSA 1A04A 3CO6C 2P7CB 1SD7A 1WCMJ 2P5VA 4R79A 1YLFA 2GQQA 2VJ4A 4GRIA 4WK8F 4MEYF 3MAJA 4NNJA 5IOZA 4U0WA 1KYZA 2JK3A 1D0YA 4OIOF 4P5OA 2MH9A 4PCQA 2M4KA 3J81K 2OF7A 3VB2A 4PSXA 3I53A 4BBSJ 3HUGB 2CUJA 3MZ8A 3H3UA 3A0BC 2GBYA 1T95A 1VNDA 2IAIA 1TQMA 2OJED 1UG0A 2M7BA 5C3EJ 1L0OC 1OISA 3JTHA 3GYHX 4C3HJ 5A2QR 2ELKA 3K1MA 3ASOH 3X2QH 1G3SA 2FQ4A 3CESA 1O4XA 1RQ6A 1D5VA 3J7AW 4FE7A 1FTTA 2B9SA 1BOBA 1J2XA 4IHTA 1J59A 3WU0A 5AIQA 3GBGA 5M5WJ 3AFHA 1B8IB 4U7DA 1YE9A 2LNBA 2COBA 2O03A 2BHZA 5IT9R 3LSKA 2K4BA 3A1YA 1I6XA 1J9IA 5F08A 2X9DA 1DU6A 5K7ZA 1UMQA 1W7PA 1BW5A 2VBYA 2UWMA 2XC7A 2YU9J 2G9WA 2BYVE 1U9NA 3ZRGA 5F1RA 1TBXA 3FWEA 1BR1A 2VQCA 1FMWA 1R1TA 4G8XA 5E3NA 3RKQA 3TW7A 4HSTA 3GTKJ 2H1LA 2YX7A 3ABKH 3TKYA 2V9VA 3TEDA 4RAYA 2F5VA 2GXGA 5E3LA 2DOAA 3E1SA 3LAJA 2TCTA 3HJEA 1F9NA 3BY6A 1HW2A 2ZO4A 3RQ4A 1VQ7I 1IO2A 2LMDA 5FKLA 3E6CC 1OR7A 2NOJB 5DUKA 4AIHA 1OFCX 3BJAA 4WX9A 2WB1A 4HF2A 2NAZA 3G1OA 5J3LA 4DBRA 2QSGX 4LB6B 1ITYA 1QQIA 4PSWA 1HKQA 1ON2A 3TP3A 3FM3A 1JTXA 2R7XA 2XAFA 2EIJH 3H9QA 4JBAA 3SZGA 4XBFA 3VOEA 1B59A 4BHBA 2QSHX 3ABLH 4LJZF 1WSUA 2L4AA 3QOPA 1OPCA 2ELJA 1E3HA 2XIGA 2JA6J 1MMDA 3KLOA 1BI2A 1OYYA 3GFJA 1FOWA 5J1UA 4DGWB 3AG2H 3HOYJ 1LFUP 4XRFA 4PJLA 2CQ7A 4LG0A 3JRDA 3TP0A 3W2VA 1T56A 1T0FA 5LBQA 1OQYA 1STZA 2CQKA 3TOBA 1LUJB 2GWRA 4L5IA 2ETHA 1ZKGA 1YRNA 2G0EA 2HTSA 1CF7A 5E3MA 5M5XJ 4PUSA 2EIKH 3GVAA 4PGHA 1WFXA 3PQKA 4YFKF 3CC2I 2A61A 2QZ8A 1ETXA 1ZLJA 2QEXI 3COAC 1R49A 3TDUC 3WU1B 4E7KA 2E1NA 1W7PB 3R60A 4RMNA 2OUMA 2O8XA 3DTIA 2WAFA 4LK1F 3VYTB 3C7JA 1LFBA 3H35A 1VQ6I 1B8IA 2L0KA 3ZMUA 5B1BH 1I39A 1LDKB 4XOPA 5GADJ 4G6TB 4E7JA 3FF5A 3BTLA 1JT6A 1MJAA 1WRJA 2I8DA 4XLHA 1QHGA 5B66C 4ESFA 2M4GA 4G6QA 2HQRA 3OYMA 1QGPA 3G4SI 1ORKA 4HLYA 3JRAA 2ZSHB 1BC8C 1ETYA 1V55H 3QU3A 3ZQCA 2ISYA 2PMZN 2CUEA 3BTJA 3I64A 3GX4X 3PIPF 4D7MA 1OCTC 5ILUA 2OCCH 3QRFF 1MIJA 2DA1A 2XAQA 4XLCA 3E7LA 2E7WA 3FXRA 4ENNA 2FBHA 2FEZA 3CC7I 5EZGA 3ZMVA 1NG7A 1MNEA 2Y0MA 1I1GA 5C44J 1PDNC 3BTIA 3HXLA 1GUUA 4M9XA 4OMYA 3P7NA 1X58A 3LQQA 2RQPA 3D5RC 1FIAA 3GTOJ 1O3SA 2XDVA 5K5QA 3OR2C 4JX5A 2QQ8A 4QPQA 1YYVA 3WGGA 4BACA 2Y9YA 4KIGA 2KZVA 2LY2A 1AOYA 3HEFA 1X2MA 2DDBA 4BJ6C 2E1OA 1JJ6C 3K69A 1VQ8I 3GZNB 1J0RA 2XPVA 4ZZDA 2PFBA 4I2OA 3AAFA 1U3EM 4U88A 2E1CA 1OLTA 3I54A 4E7IA 2FBKA 3KEQA 2KRCA 1A6IA 2ID6A 3A52A 3PQJA 5F0FA 2R7SA 3CJRB 3WTVC 2CH0A 2G7UA 2NVYJ 3GW2A 1C0WA 2DBBA 1JKOC 1EH7A 3DKXA 2EWNA 1BJAA 2XB5A 4G7OF 2AXLA 3WODF 4A6EA 4E7ZA 4IRHA 2F4IA 2KRFA 3FMRA 4G94A 6PAXA 1RETA 5A2QK 3IAM2 2L54A 3O2PE 3VFZA 2E19A 5F0HA 3M3YJ 5IPAA 5J4VA 4G6DA 3G1MA 3FXMA 1ZG5A 3T0YA 3FDYA 2MGQA 3HRSA 2L9VA 1POGA 1W1WE 2DA5A 4EJOA 2QBYA 2DT6A 3ESWB
chains in the Genus database with same CATH topology
4BQAA 5E1ZB 3BPVA 2L02A 5DEQA 2ZMEB 3GFMA 3BPXA 4KIBA 4EMSA 3R0JA 2PI0A 4JK1X 1FBUA 4NQWA 2EJRA 5FD6A 5BS6A 1JHHA 1CF7B 3CUOA 3EYYA 2NNNA 3FXQA 4EV0A 3Q9SA 1RIOH 4P9UA 4HX4A 3I4PA 2VBZA 2O61A 4OU0A 2OZUA 2QQAA 2M5WA 2D1VA 3L9FA 4KICA 4ZYHA 3DP7A 1BI1A 3RKXA 1ONVA 4MNUA 5HS9A 2ZBKA 3ZQ7A 1BIBA 1ZRCA 2BBYA 2M8EA 3K1NA 5CVUA 2BGCA 4WCGA 2HFHA 2PEXA 2Z33A 3DQVC 5L3DA 1HBXG 1P2FA 3LFKA 2P6TA 1KQ8A 3IRRA 3T8RA 2OA4A 2RGVA 2HDCA 3FXUA 1WWXA 3KP6A 3N97A 1FSHA 2MA3A 4M74A 4M9ZA 4UNOA 1IXSB 4LB5A 3M1EA 2FNPA 4YG2F 3JAMZ 3SZTA 1FC3A 2XVCA 3V8JA 2K86A 4L5JA 2C6YA 5ILSA 4OINF 2D2WA 3MCZA 1FYLA 1HSTA 3WTSC 3KP3A 1K79A 1G3WA 1S8NA 1BC7C 5EEGA 3IWZA 1BIAA 4IHSA 3HYIA 1XDSA 1ZAOA 3SZPA 1P92A 1ODDA 3P9IA 2OQRA 3I5UA 3IWFA 4BHPA 2DW4A 2GA2A 5F6FA 1LVAA 3CUQC 5HS8A 4Y15A 2VC0A 1KU7A 4I0AA 2FE3A 1RUOA 4YIIA 2A07F 4R8HA 1DPRA 1GXPA 1Y0UA 2PMHA 4UVBA 1SD4A 2EFOA 5H6RA 1KQ9A 2VT3A 2L01A 3Q9VA 4Q47A 2UXNA 3GUDA 3H92A 4I0BA 2CWEA 5DV5A 4HQEA 2ISZA 3V7SA 2K7LA 3QU6A 1BOAA 1G4DA 5JVTA 1U6GA 3L00A 3OV8A 4HYEA 2Q0OA 2HYFA 2QVOA 3CJNA 5A2QZ 1FZPB 1O7FA 3RYPA 5D6EA 4PDKA 5CJ9A 4EQQA 5J6XA 3ZPLA 1W5TA 1E2XA 2KIMA 2WV0A 3NRVA 4HDUA 1UHWA 4S05A 2FA5A 2H6BA 4WXDA 4AWXB 4F7ZA 4Y13A 1P4WA 3HOTA 4RB2C 3S2WA 3BROA 2QBYB 2OZ6A 2STTA 3G73A 2K4JA 2COMA 1U2WA 3GEZA 2A68F 5LRRA 2PQ8A 1YFHA 1DPUA 2EFWA 5D5VB 1IN7A 3F21A 4O3MA 1UHMA 4AD9A 3CUQA 3DPTA 4B8XA 4IF4A 3I0TA 5D6FA 2P5LC 2XKOA 4M6YA 2QENA 4A5MA 1JE8A 2W84A 1IW7F 1WI9A 3WTZA 1MD0A 2VT2A 3KETA 3ZMSA 5DDGA 3WTXC 2DQLA 3GLXA 1AWCA 4MQ9F 4L9JA 3K1PA 5CLSA 3QP6A 4CGZA 4L18B 2H09A 3MZYA 2PLYA 4MEXF 2X0LA 3DPLC 3FMSA 3LQRA 3HHHA 3F72A 1S29A 3C1DA 2BEOA 3RKWA 3FZVA 1E17A 3CUQB 3IKVA 1T39A 5CVVA 4DQ2A 1K78B 2FU4A 1NHAA 2JRTA 2O6GE 2FMYA 3IL2A 2ZNYA 4OMZA 2H6CA 4I01A 1UB9A 3T5XA 3K9TA 4HLXA 4ENKA 4D0PA 1HW5A 1D3YA 5LLQA 1IZ1A 3RIRA 3WGHA 1YW8A 3Q5FA 1L3LA 2ZNZA 1SMTA 3J80K 3LA2A 3E5XA 1ZYRF 4UV9A 4NHJA 4IRIA 2DK8A 2GXBA 3QAHA 3WTYC 3FX3A 1G3TA 1LNWA 5LGNA 3ECHA 1FSEA 4RGRA 1MJBA 2L3DA 5KK1A 4JQFA 3O3KA 2A3SA 4Y17A 4Q4ZF 2XAGA 5CYVA 1JGSA 3HOSA 1SMYF 4BYYA 2LDUA 4RAZA 2F5DA 4A5NA 4G7ZF 2ZJ2A 3HSRA 2M45A 1S6LA 4RB0A 1MDMA 3HRMA 2OAZA 5TRDA 5L3CA 3IKTA 2QQ9A 4EM2A 2KJCA 1RI7A 3C18A 1YW7A 4OIRF 4LFUA 5L3FA 4U7BA 4M6XA 5TJJA 3ABTA 4LG0B 5BMZA 4BAYA 1IXRC 2MLGA 4IPAA 1SFEA 2CG4A 3WE2A 4ZYEA 4KMFA 1SD5A 3K0LA 4L9VA 5FO5A 3F8MA 4QLCU 1LJ9A 3RKYA 1P4AA 4EJTA 3JSOA 4M73A 3MWMA 2FF4A 1XMAA 2OU2A 4M9SA 1ULYA 1IXCA 2IA2A 2VOPA 1X3UA 3E5QA 1XDUA 4ZH4F 1B9MA 1ON1A 5E1WA 1MZBA 2XGXA 2R7DA 1XGMA 3ELKA 4RGSA 4IRGA 2EFQA 2YU3A 2DAOA 1Z6RA 2VXZA 5LGUA 4GYIA 1R36A 3FMQA 2IRFG 3V7RA 2CW0F 5HOOA 2PN6A 3JW4A 2IA0A 5HDKA 1TNTA 1IRFA 3ISPA 3RTRA 3LA3A 3L2CA 1HKTA 2LKPA 3EQLF 4QWQA 3I58A 2ESNA 1QPMA 4M71A 5E18F 2QWWA 2P5KA 1HQCA 2RN7A 1G6NA 4P55A 2A6HF 1DP7P 1UFMA 2HGCA 4EVIA 3TO7A 5JI6A 1J7KA 4CO8A 5HDGA 1OYWA 1U78A 3KE2A 3VEPA 2CO5A 4UXNA 1IUYA 4KN4X 1I1SA 1YTYA 3U2RA 4ZYDA 1ZG3A 5JR3A 4BH9A 2OBPA 3GF2A 2Z99A 2DPUA 2R7FA 4EGYA 2XAJA 4MHGA 1R5HA 1YQAA 3I71A 2EV5A 3M8EA 1TTYA 5D8LB 5ERIA 3J81Z 1U8RA 1F4KA 1XGSA 3QPHA 2HWVA 2KIUA 3IC7A 1O3TA 4TV7A 1RZ4A 3B02A 4KIFA 3CDHA 4MQVA 4KFCA 3MZHA 3R61A 4O6JA 1LDDA 3LAPA 2IW5A 3WTUC 2XASA 3IHUA 4CXFA 1XSVA 3O6BB 1OMIA 5J8CA 3ZMTA 1PP8F 1ZREA 1SD6A 3F6OA 1SFUA 4CHUA 4HV5A 1XCVA 2P6SA 1I5ZA 5LHGA 2MLKA 1MJ9A 3F8NA 3F8BA 3REOA 2PBIA 1TQPA 3IRQA 4MTEA 5DYMA 1XMKA 4WXHA 2DK5A 1H0MA 2H94A 1JHFA 2GA1A 5DD4A 4KNYA 1XCBA 1PP7U 1KQ0A 4A0XA 2FNAA 2KKOA 4FT8A 2CFXA 4MTDA 2MBFA 1JXSA 4S04A 2LSOA 2M87A 1YS7A 5D8KB 1FNNA 4FX4A 3WE3A 2A5YB 3HRUA 2VC1A 2ESHA 4PZJA 3F23A 1BN5A 2P7VB 2IP2A 2QUFA 4RS8A 2R3SA 4P96A 2IT0A 2Z5UA 3HTUA 3KZZA 4L0ZB 1R1VA 3E6BA 4E70A 2EV6A 2DI3A 2DT5A 5ICCA 5K5RA 3WG9A 2DTRA 1DDNA 1P4XA 4ZYGA 3WTTC 4A0YA 2FMLA 4IXAA 1K78A 2M1BA 4HOBA 2DPDA 5ICFA 2P4WA 1P6RA 3FM5A 4HA8A 1YO5C 4RB3C 1XSDA 1KYWA 3MQ0A 1W4MA 5ILVA 1R7JA 1K7AA 2VOOA 3SHFA 2H27A 2Z3YA 3V8KA 3BOQA 1USSA 4ESJA 1F1ZA 3DV8A 1FWZA 3OOPA 4GXOA 1MGTA 5IT9K 5LHHA 1IAWA 2HZTA 3KLNA 3H3ZA 3SQNA 3ROUA 5DCMB 3RDIA 2FRHA 1Z1DA 5K5OA 4HQMA 1F5TA 2VODA 4I7HA 3GFLA 1T98A 3BJ6A 3RPUA 2YX4A 3DEUA 4OIQF 1ZGAA 5D5UB 1ZRDA 2LF8A 4HV6A 1EH8A 3W6JB 1KGSA 4XSXF 2HOEA 3R0AA 4P9FA 5E20A 2CGPA 2HEOA 2P8TA 5HDNA 5LGTA 3KP2A 3LWFA 3V8LA 2IPQX 2HKXA 2ACJA 1YW9A 2BV6A 2ZCWA 3HRTA 3I59A 2VN2A 2VBXA 1FPQA 1OKRA 3RPQA 3DFGA 3BZ6A 1XN7A 1KA8A 2EA2A 4L9TA 4HX8A 1O3QA 2IJLA 2Q2EA 3W6KB 5ED4A 2BE5F 2CSOA 4L9NA 3ZMDA 1ZH5A 2HKOA 1OYIA 1Z05A 5LEJA 5AIPA 4ESBA 5E8GA 2PMUA 2UXXA 3TDZC 1XD7A 3M8FA 4LD5A 2V6CA 2ELHA 2OD5A 1ZN2A 3TO9A 4FX0A 1FLIA 3WGIA 1ZRFA 3ZMZA 3DF8A 2XHKA 4EM0B 4XLNF 1J75A 1B9NA 3MFKA 3KP7A 4UVAA 2RC4A 1EH6A 2TDXA 1O3RA 3ZN0A 2JTVA 2VBWA 1Z91A 2Y75A 4WF2A 3KCCA 3BJOA 4LLGF 4LGWA 4L0YB 2W57A 4WWCA 4AVPA 1FOKA 3PFIA 2W25A 2FXAA 4M72A 3ECOA 4ENMA 2F5CA 1USTA 2A69F 1G3YA 1RUNA 1IN5A 5HLGA 4EM1A 2CYYA 1LEAA 2O3FA 5BQTA 3RYRA 1XGOA 2RV8A 2MH2A 4ZZLA 4KYWA 4HW0A 5FGMA 1SFXA 2D1HA 1UCRA 4PGGA 5E8IA 1T2KA 3ABUA 2KIFA 2ZFWA 1R00A 2IVMA 4N9HA 2OQGA 2QQBA 4XSZF 1WQ2A 2G7HA 1B1BA 4ENJA 1KU3A 5CVJA 3JAMK 5KVRA 1LB2A 3GZ5A 4KMUX 4KDPA 4HF1A 3KP5A 4H0EA 2IA1A 2V1DA 5IT9Z 3EUHA 4I02A 2NNYA 3BP8A 1KU2A 1QBJA 1T38A 1HKSA 1Z9CA 4AIJA 3P9KA 1ZG1A 3R6SA 2F2EA 2HTJA 2YR2A 2V79A 4ON0A 3E3VA 2WC2A 2W24A 3M9AA 5L3GA 4HDVA 4YIFA 3J80Z 1HSJA 5FB2A 2FSWA 1H9TA 5L3BA 2KJBA 4YFXF 5FD5A 1ZHFA 5K1YA 3L09A 1FYMA 2DQRA 4YFNF 3F3XA 1R58A 1B4AA 1H9GA 2JSCA 4AIKA 3NQOA 1FBQA 4B09A 2JT1A 5HS7A 1GXQA 2Y48A 1XB4A 5HVQC 1W7PD 2XRNA 3C3WA 5L3EA 3TGNA 2W85A 1R22A 1B6AA 1QZYA 4LK0F 3TOAA 1EV7A 1U5TB 2XROA 3JTGA 3DXJF 2EFPA 3SXYA 3CTAA 1XSXA 3GXOA 2QYOA 1FT9A 3GFIA 3L7WA 5ICEA 2M30A 2ZKZA 2QLZA 3WTWC 4N0BA 1HXDA 2JZYA 1MDMB 3ERED 4LLLA 1Z7UA 1J5YA 3HSEA 4RB1A 1FX7A 2K27A 5E1XA 3I59B 3RI4A 2A6EF 5H20A 3F8FA 3KZYA 2RVCA 1IN6A 3QP5A 4U0VA 1FP2A 5J8FA 4O5VA 1XGNA 1T6SA 1FBSA 1YIOA 3M7GA 5BOXA 5LRSA 4BNCA 4KUMA 4LMYA 4A12A 1ZGJA 2J5OA 2L4MA 1K6OA 3T8TA 2WTEA 3G3ZA 2DLLA 4N9IA 4HF0A 4I09A 3HHGA 2UZKA 2YPRA 5DCFA 1TLHB 4EJVA 2EB7A 4Q48A 1U5TC 5EEHA 2MC3A 2VE8A 5FLXZ 3HUGA 2XAHA 4UV8A 1BM9A 2FOKA 1IRGA 5DCMA 5FLXK 2EFNA 2ADUA 2YSRA 4I98B 4KN7X 2VE9A 1QZZA 1S3JA 1PUEE 2EK5A 4ASNA 5IT3A 4CYDA 1O57A 5AONA 4IVNA 4BXUA 3LA7A 1FYKA 2QM3A 5CVIA 3ULQB 5BPIA 5JFRA 4UUVA 2EA4A 4WXCA 4K2EA 4GYGA 3E6MA 4UHTA 2EV0A 3GWZA 4KT5C 4HBLA 2GZWA 2NYXA 2F5EA 5CVRA 2NS0A 2XKPA 1GHCA 2FBIA 1D8KA 1GVJA 1FY7A 2DU9A 2XV4S 2HR3A 4CZZA 3TQNA 3E97A 1QNTA 1V3FA 3K2ZA 2DO7A 3B73A 2AS5F 4ETSA 3NEUA 5HLHA 5F64A 2RKHA 3ZN1A 1REPC 1LEBA 2ZMEA 3JSPA 4OOIA 5FFXA 2E7XA 2PJPA 1KU9A 4MGRA 3HIFA 2B0LA 1TNSA 4A6DA 3J7AO 1U5TA 3KP4A 3F6VA 2V1XA 5D5XB 4GO1A 1S7AA 5FFZA 5LHIA 4LLNA 2DFIA 2VONA 5E17F 3F22A 3HTSB 2PG4A 3V4GA 2JPBA 1I27A 2Q8KA 1D8JA 3BWGA 1IF1A 1Z6TA 3F8CA 5ICGA 1BI0A 3CO7C 1BI3A 1R23A 4U0YA 4FHTA 3KFWX 4Q5SF 4CDGA 2STWA 3U9GA 1V4RA 1TW2A 2MD5A 4G9YA 4IJAA 4CICA 5LEKA 1CGPA 3VODA 3HSFA 2O0YA 5H6QA 3U1DA 3E6DA 1HW1A 3CLOA 3MEXA 5HLIA 2RDPA 1LDJA 4EJUA 3GZ6A 2X4HA 5D4RA 1R5GA 3KEOA 1DUXC 1R1UA 1QO0D 3D0SA 1SAXA 3E5UA 5D5WB 3EYIA 3RJPA 4EGZA 3T1BA 3D5LA 2D45A 2JPCA 1MKMA 4EJWA 4UVCA 1VTNC 1RNLA 2NRAC 3P9CA 2K02A 2WWYA 2ZXJA 2HYGD 4A2UA 3ZP5A 2J5PA 3R4KA 1W5SA 5DUIA 4Z2YA 2RNJA 2HS5A 4G7HF 1IN4A 4HX7A 4HAMA 4RGUA 4BHCA 4NB5A 3LSTA 2FQ3A 1TW3A 1S7OA 3ML6A 3BDDA 3SFZA 2F5FA 2V1UA 4RGXA 3N4MA 2GAUA 4HZFA 1LQ1A 4KA4A 3QPTA 4DNCA 4GGGA 5JHUA 3EETA 2GIVA 1O7LA 1FP1D 4OIPF 4R1HA 1Q1HA 1YG2A 4XLPF 2Z9OA 1ZARA 2LF7A 3DKWA 1ZLKA 3V7CA 1IN8A 1WKMA 2HQNA 3FHZA 5DD8A 5D4SA 4GCVA 1YS6A 1TQIA 3EDPA 3TO6A 4A0ZA 2XUBA 3GO5A 5BPDA 1BBYA 1A04A 3CO6C 2P7CB 1SD7A 2P5VA 4R79A 1YLFA 2GQQA 4WK8F 4MEYF 3MAJA 4U0WA 1KYZA 4OIOF 4P5OA 2MH9A 4PCQA 3J81K 3VB2A 3I53A 3H3UA 1TQMA 1L0OC 3JTHA 3GYHX 3K1MA 1G3SA 1D5VA 4IHTA 1J2XA 1J59A 3WU0A 5AIQA 4U7DA 2LNBA 2O03A 2K4BA 1I6XA 1J9IA 1W7PA 2VBYA 2UWMA 2G9WA 2BYVE 5F1RA 1TBXA 3FWEA 1R1TA 4G8XA 2YX7A 3TKYA 2V9VA 4RAYA 2GXGA 3LAJA 1F9NA 3BY6A 1HW2A 2ZO4A 3E6CC 1OR7A 5DUKA 4AIHA 3BJAA 4WX9A 4HF2A 2NAZA 4LB6B 1QQIA 1HKQA 1ON2A 3FM3A 2XAFA 4JBAA 4XBFA 3VOEA 1B59A 4BHBA 4LJZF 1WSUA 2L4AA 3QOPA 1OPCA 2XIGA 3KLOA 1BI2A 1OYYA 3GFJA 4XRFA 4LG0A 1T0FA 5LBQA 1STZA 2CQKA 3TOBA 2GWRA 4L5IA 2ETHA 2HTSA 1CF7A 4PGHA 3GVAA 3PQKA 4YFKF 2A61A 2QZ8A 1ZLJA 3COAC 3TDUC 3WU1B 2E1NA 1W7PB 3R60A 2O8XA 4LK1F 3C7JA 3ZMUA 1LDKB 3FF5A 1MJAA 1WRJA 4ESFA 4G6QA 2HQRA 4HLYA 1QGPA 1BC8C 3QU3A 2ISYA 3I64A 3GX4X 5ILUA 3QRFF 2XAQA 3FXRA 2E7WA 4ENNA 2FBHA 2FEZA 3ZMVA 2Y0MA 1I1GA 1PDNC 4OMYA 4M9XA 3P7NA 3LQQA 2RQPA 1O3SA 5K5QA 1YYVA 3WGGA 4KIGA 1AOYA 3K69A 1J0RA 4ZZDA 2PFBA 4I2OA 3AAFA 1U3EM 4U88A 2E1CA 3I54A 2FBKA 3KEQA 3PQJA 3WTVC 3GW2A 2G7UA 1C0WA 2DBBA 1EH7A 2EWNA 1BJAA 4G7OF 2AXLA 3WODF 4A6EA 4IRHA 2KRFA 3FMRA 4G94A 6PAXA 5A2QK 2L54A 3O2PE 3VFZA 4G6DA 1ZG5A 3T0YA 3HRSA 4EJOA 2QBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQA A;  5E1Z B;  3BPV A;  2L02 A;  5DEQ A;  2ZME B;  3GFM A;  3BPX A;  4KIB A;  4EMS A;  3R0J A;  2PI0 A;  4JK1 X;  1FBU A;  4NQW A;  2EJR A;  5FD6 A;  5BS6 A;  1JHH A;  1CF7 B;  3CUO A;  3EYY A;  2NNN A;  3FXQ A;  4EV0 A;  3Q9S A;  1RIO H;  4P9U A;  4HX4 A;  3I4P A;  2VBZ A;  2O61 A;  4OU0 A;  2OZU A;  2QQA A;  2M5W A;  2D1V A;  3L9F A;  4KIC A;  4ZYH A;  3DP7 A;  1BI1 A;  3RKX A;  1ONV A;  4MNU A;  5HS9 A;  2ZBK A;  3ZQ7 A;  1BIB A;  1ZRC A;  2BBY A;  2M8E A;  3K1N A;  5CVU A;  2BGC A;  4WCG A;  2HFH A;  2PEX A;  2Z33 A;  3DQV C;  5L3D A;  1HBX G;  1P2F A;  3LFK A;  2P6T A;  1KQ8 A;  3IRR A;  3T8R A;  2OA4 A;  2RGV A;  2HDC A;  3FXU A;  1WWX A;  3KP6 A;  3N97 A;  1FSH A;  2MA3 A;  4M74 A;  4M9Z A;  4UNO A;  1IXS B;  4LB5 A;  3M1E A;  2FNP A;  4YG2 F;  3JAM Z;  3SZT A;  1FC3 A;  2XVC A;  3V8J A;  2K86 A;  4L5J A;  2C6Y A;  5ILS A;  4OIN F;  2D2W A;  3MCZ A;  1FYL A;  1HST A;  3WTS C;  3KP3 A;  1K79 A;  1G3W A;  1S8N A;  1BC7 C;  5EEG A;  3IWZ A;  1BIA A;  4IHS A;  3HYI A;  1XDS A;  1ZAO A;  3SZP A;  1P92 A;  1ODD A;  3P9I A;  2OQR A;  3I5U A;  3IWF A;  4BHP A;  2DW4 A;  2GA2 A;  5F6F A;  1LVA A;  3CUQ C;  5HS8 A;  4Y15 A;  2VC0 A;  1KU7 A;  4I0A A;  2FE3 A;  1RUO A;  4YII A;  2A07 F;  4R8H A;  1DPR A;  1GXP A;  1Y0U A;  2PMH A;  4UVB A;  1SD4 A;  2EFO A;  5H6R A;  1KQ9 A;  2VT3 A;  2L01 A;  3Q9V A;  4Q47 A;  2UXN A;  3GUD A;  3H92 A;  4I0B A;  2CWE A;  5DV5 A;  4HQE A;  2ISZ A;  3V7S A;  2K7L A;  3QU6 A;  1BOA A;  1G4D A;  5JVT A;  1U6G A;  3L00 A;  3OV8 A;  4HYE A;  2Q0O A;  2HYF A;  2QVO A;  3CJN A;  5A2Q Z;  1FZP B;  1O7F A;  3RYP A;  5D6E A;  4PDK A;  5CJ9 A;  4EQQ A;  5J6X A;  3ZPL A;  1W5T A;  1E2X A;  2KIM A;  2WV0 A;  3NRV A;  4HDU A;  1UHW A;  4S05 A;  2FA5 A;  2H6B A;  4WXD A;  4AWX B;  4F7Z A;  4Y13 A;  1P4W A;  3HOT A;  4RB2 C;  3S2W A;  3BRO A;  2QBY B;  2OZ6 A;  2STT A;  3G73 A;  2K4J A;  2COM A;  1U2W A;  3GEZ A;  2A68 F;  5LRR A;  2PQ8 A;  1YFH A;  1DPU A;  2EFW A;  5D5V B;  1IN7 A;  3F21 A;  4O3M A;  1UHM A;  4AD9 A;  3CUQ A;  3DPT A;  4B8X A;  4IF4 A;  3I0T A;  5D6F A;  2P5L C;  2XKO A;  4M6Y A;  2QEN A;  4A5M A;  1JE8 A;  2W84 A;  1IW7 F;  1WI9 A;  3WTZ A;  1MD0 A;  2VT2 A;  3KET A;  3ZMS A;  5DDG A;  3WTX C;  2DQL A;  3GLX A;  1AWC A;  4MQ9 F;  4L9J A;  3K1P A;  5CLS A;  3QP6 A;  4CGZ A;  4L18 B;  2H09 A;  3MZY A;  2PLY A;  4MEX F;  2X0L A;  3DPL C;  3FMS A;  3LQR A;  3HHH A;  3F72 A;  1S29 A;  3C1D A;  2BEO A;  3RKW A;  3FZV A;  1E17 A;  3CUQ B;  3IKV A;  1T39 A;  5CVV A;  4DQ2 A;  1K78 B;  2FU4 A;  1NHA A;  2JRT A;  2O6G E;  2FMY A;  3IL2 A;  2ZNY A;  4OMZ A;  2H6C A;  4I01 A;  1UB9 A;  3T5X A;  3K9T A;  4HLX A;  4ENK A;  4D0P A;  1HW5 A;  1D3Y A;  5LLQ A;  1IZ1 A;  3RIR A;  3WGH A;  1YW8 A;  3Q5F A;  1L3L A;  2ZNZ A;  1SMT A;  3J80 K;  3LA2 A;  3E5X A;  1ZYR F;  4UV9 A;  4NHJ A;  4IRI A;  2DK8 A;  2GXB A;  3QAH A;  3WTY C;  3FX3 A;  1G3T A;  1LNW A;  5LGN A;  3ECH A;  1FSE A;  4RGR A;  1MJB A;  2L3D A;  5KK1 A;  4JQF A;  3O3K A;  2A3S A;  4Y17 A;  4Q4Z F;  2XAG A;  5CYV A;  1JGS A;  3HOS A;  1SMY F;  4BYY A;  2LDU A;  4RAZ A;  2F5D A;  4A5N A;  4G7Z F;  2ZJ2 A;  3HSR A;  2M45 A;  1S6L A;  4RB0 A;  1MDM A;  3HRM A;  2OAZ A;  5TRD A;  5L3C A;  3IKT A;  2QQ9 A;  4EM2 A;  2KJC A;  1RI7 A;  3C18 A;  1YW7 A;  4OIR F;  4LFU A;  5L3F A;  4U7B A;  4M6X A;  5TJJ A;  3ABT A;  4LG0 B;  5BMZ A;  4BAY A;  1IXR C;  2MLG A;  4IPA A;  1SFE A;  2CG4 A;  3WE2 A;  4ZYE A;  4KMF A;  1SD5 A;  3K0L A;  4L9V A;  5FO5 A;  3F8M A;  4QLC U;  1LJ9 A;  3RKY A;  1P4A A;  4EJT A;  3JSO A;  4M73 A;  3MWM A;  2FF4 A;  1XMA A;  2OU2 A;  4M9S A;  1ULY A;  1IXC A;  2IA2 A;  2VOP A;  1X3U A;  3E5Q A;  1XDU A;  4ZH4 F;  1B9M A;  1ON1 A;  5E1W A;  1MZB A;  2XGX A;  2R7D A;  1XGM A;  3ELK A;  4RGS A;  4IRG A;  2EFQ A;  2YU3 A;  2DAO A;  1Z6R A;  2VXZ A;  5LGU A;  4GYI A;  1R36 A;  3FMQ A;  2IRF G;  3V7R A;  2CW0 F;  5HOO A;  2PN6 A;  3JW4 A;  2IA0 A;  5HDK A;  1TNT A;  1IRF A;  3ISP A;  3RTR A;  3LA3 A;  3L2C A;  1HKT A;  2LKP A;  3EQL F;  4QWQ A;  3I58 A;  2ESN A;  1QPM A;  4M71 A;  5E18 F;  2QWW A;  2P5K A;  1HQC A;  2RN7 A;  1G6N A;  4P55 A;  2A6H F;  1DP7 P;  1UFM A;  2HGC A;  4EVI A;  3TO7 A;  5JI6 A;  1J7K A;  4CO8 A;  5HDG A;  1OYW A;  1U78 A;  3KE2 A;  3VEP A;  2CO5 A;  4UXN A;  1IUY A;  4KN4 X;  1I1S A;  1YTY A;  3U2R A;  4ZYD A;  1ZG3 A;  5JR3 A;  4BH9 A;  2OBP A;  3GF2 A;  2Z99 A;  2DPU A;  2R7F A;  4EGY A;  2XAJ A;  4MHG A;  1R5H A;  1YQA A;  3I71 A;  2EV5 A;  3M8E A;  1TTY A;  5D8L B;  5ERI A;  3J81 Z;  1U8R A;  1F4K A;  1XGS A;  3QPH A;  2HWV A;  2KIU A;  3IC7 A;  1O3T A;  4TV7 A;  1RZ4 A;  3B02 A;  4KIF A;  3CDH A;  4MQV A;  4KFC A;  3MZH A;  3R61 A;  4O6J A;  1LDD A;  3LAP A;  2IW5 A;  3WTU C;  2XAS A;  3IHU A;  4CXF A;  1XSV A;  3O6B B;  1OMI A;  5J8C A;  3ZMT A;  1PP8 F;  1ZRE A;  1SD6 A;  3F6O A;  1SFU A;  4CHU A;  4HV5 A;  1XCV A;  2P6S A;  1I5Z A;  5LHG A;  2MLK A;  1MJ9 A;  3F8N A;  3F8B A;  3REO A;  2PBI A;  1TQP A;  3IRQ A;  4MTE A;  5DYM A;  1XMK A;  4WXH A;  2DK5 A;  1H0M A;  2H94 A;  1JHF A;  2GA1 A;  5DD4 A;  4KNY A;  1XCB A;  1PP7 U;  1KQ0 A;  4A0X A;  2FNA A;  2KKO A;  4FT8 A;  2CFX A;  4MTD A;  2MBF A;  1JXS A;  4S04 A;  2LSO A;  2M87 A;  1YS7 A;  5D8K B;  1FNN A;  4FX4 A;  3WE3 A;  2A5Y B;  3HRU A;  2VC1 A;  2ESH A;  4PZJ A;  3F23 A;  1BN5 A;  2P7V B;  2IP2 A;  2QUF A;  4RS8 A;  2R3S A;  4P96 A;  2IT0 A;  2Z5U A;  3HTU A;  3KZZ A;  4L0Z B;  1R1V A;  3E6B A;  4E70 A;  2EV6 A;  2DI3 A;  2DT5 A;  5ICC A;  5K5R A;  3WG9 A;  2DTR A;  1DDN A;  1P4X A;  4ZYG A;  3WTT C;  4A0Y A;  2FML A;  4IXA A;  1K78 A;  2M1B A;  4HOB A;  2DPD A;  5ICF A;  2P4W A;  1P6R A;  3FM5 A;  4HA8 A;  1YO5 C;  4RB3 C;  1XSD A;  1KYW A;  3MQ0 A;  1W4M A;  5ILV A;  1R7J A;  1K7A A;  2VOO A;  3SHF A;  2H27 A;  2Z3Y A;  3V8K A;  3BOQ A;  1USS A;  4ESJ A;  1F1Z A;  3DV8 A;  1FWZ A;  3OOP A;  4GXO A;  1MGT A;  5IT9 K;  5LHH A;  1IAW A;  2HZT A;  3KLN A;  3H3Z A;  3SQN A;  3ROU A;  5DCM B;  3RDI A;  2FRH A;  1Z1D A;  5K5O A;  4HQM A;  1F5T A;  2VOD A;  4I7H A;  3GFL A;  1T98 A;  3BJ6 A;  3RPU A;  2YX4 A;  3DEU A;  4OIQ F;  1ZGA A;  5D5U B;  1ZRD A;  2LF8 A;  4HV6 A;  1EH8 A;  3W6J B;  1KGS A;  4XSX F;  2HOE A;  3R0A A;  4P9F A;  5E20 A;  2CGP A;  2HEO A;  2P8T A;  5HDN A;  5LGT A;  3KP2 A;  3LWF A;  3V8L A;  2IPQ X;  2HKX A;  2ACJ A;  1YW9 A;  2BV6 A;  2ZCW A;  3HRT A;  3I59 A;  2VN2 A;  2VBX A;  1FPQ A;  1OKR A;  3RPQ A;  3DFG A;  3BZ6 A;  1XN7 A;  1KA8 A;  2EA2 A;  4L9T A;  4HX8 A;  1O3Q A;  2IJL A;  2Q2E A;  3W6K B;  5ED4 A;  2BE5 F;  2CSO A;  4L9N A;  3ZMD A;  1ZH5 A;  2HKO A;  1OYI A;  1Z05 A;  5LEJ A;  5AIP A;  4ESB A;  5E8G A;  2PMU A;  2UXX A;  3TDZ C;  1XD7 A;  3M8F A;  4LD5 A;  2V6C A;  2ELH A;  2OD5 A;  1ZN2 A;  3TO9 A;  4FX0 A;  1FLI A;  3WGI A;  1ZRF A;  3ZMZ A;  3DF8 A;  2XHK A;  4EM0 B;  4XLN F;  1J75 A;  1B9N A;  3MFK A;  3KP7 A;  4UVA A;  2RC4 A;  1EH6 A;  2TDX A;  1O3R A;  3ZN0 A;  2JTV A;  2VBW A;  1Z91 A;  2Y75 A;  4WF2 A;  3KCC A;  3BJO A;  4LLG F;  4LGW A;  4L0Y B;  2W57 A;  4WWC A;  4AVP A;  1FOK A;  3PFI A;  2W25 A;  2FXA A;  4M72 A;  3ECO A;  4ENM A;  2F5C A;  1UST A;  2A69 F;  1G3Y A;  1RUN A;  1IN5 A;  5HLG A;  4EM1 A;  2CYY A;  1LEA A;  2O3F A;  5BQT A;  3RYR A;  1XGO A;  2RV8 A;  2MH2 A;  4ZZL A;  4KYW A;  4HW0 A;  5FGM A;  1SFX A;  2D1H A;  1UCR A;  4PGG A;  5E8I A;  1T2K A;  3ABU A;  2KIF A;  2ZFW A;  1R00 A;  2IVM A;  4N9H A;  2OQG A;  2QQB A;  4XSZ F;  1WQ2 A;  2G7H A;  1B1B A;  4ENJ A;  1KU3 A;  5CVJ A;  3JAM K;  5KVR A;  1LB2 A;  3GZ5 A;  4KMU X;  4KDP A;  4HF1 A;  3KP5 A;  4H0E A;  2IA1 A;  2V1D A;  5IT9 Z;  3EUH A;  4I02 A;  2NNY A;  3BP8 A;  1KU2 A;  1QBJ A;  1T38 A;  1HKS A;  1Z9C A;  4AIJ A;  3P9K A;  1ZG1 A;  3R6S A;  2F2E A;  2HTJ A;  2YR2 A;  2V79 A;  4ON0 A;  3E3V A;  2WC2 A;  2W24 A;  3M9A A;  5L3G A;  4HDV A;  4YIF A;  3J80 Z;  1HSJ A;  5FB2 A;  2FSW A;  1H9T A;  5L3B A;  2KJB A;  4YFX F;  5FD5 A;  1ZHF A;  5K1Y A;  3L09 A;  1FYM A;  2DQR A;  4YFN F;  3F3X A;  1R58 A;  1B4A A;  1H9G A;  2JSC A;  4AIK A;  3NQO A;  1FBQ A;  4B09 A;  2JT1 A;  5HS7 A;  1GXQ A;  2Y48 A;  1XB4 A;  5HVQ C;  1W7P D;  2XRN A;  3C3W A;  5L3E A;  3TGN A;  2W85 A;  1R22 A;  1B6A A;  1QZY A;  4LK0 F;  3TOA A;  1EV7 A;  1U5T B;  2XRO A;  3JTG A;  3DXJ F;  2EFP A;  3SXY A;  3CTA A;  1XSX A;  3GXO A;  2QYO A;  1FT9 A;  3GFI A;  3L7W A;  5ICE A;  2M30 A;  2ZKZ A;  2QLZ A;  3WTW C;  4N0B A;  1HXD A;  2JZY A;  1MDM B;  3ERE D;  4LLL A;  1Z7U A;  1J5Y A;  3HSE A;  4RB1 A;  1FX7 A;  2K27 A;  5E1X A;  3I59 B;  3RI4 A;  2A6E F;  5H20 A;  3F8F A;  3KZY A;  2RVC A;  1IN6 A;  3QP5 A;  4U0V A;  1FP2 A;  5J8F A;  4O5V A;  1XGN A;  1T6S A;  1FBS A;  1YIO A;  3M7G A;  5BOX A;  5LRS A;  4BNC A;  4KUM A;  4LMY A;  4A12 A;  1ZGJ A;  2J5O A;  2L4M A;  1K6O A;  3T8T A;  2WTE A;  3G3Z A;  2DLL A;  4N9I A;  4HF0 A;  4I09 A;  3HHG A;  2UZK A;  2YPR A;  5DCF A;  1TLH B;  4EJV A;  2EB7 A;  4Q48 A;  1U5T C;  5EEH A;  2MC3 A;  2VE8 A;  5FLX Z;  3HUG A;  2XAH A;  4UV8 A;  1BM9 A;  2FOK A;  1IRG A;  5DCM A;  5FLX K;  2EFN A;  2ADU A;  2YSR A;  4I98 B;  4KN7 X;  2VE9 A;  1QZZ A;  1S3J A;  1PUE E;  2EK5 A;  4ASN A;  5IT3 A;  4CYD A;  1O57 A;  5AON A;  4IVN A;  4BXU A;  3LA7 A;  1FYK A;  2QM3 A;  5CVI A;  3ULQ B;  5BPI A;  5JFR A;  4UUV A;  2EA4 A;  4WXC A;  4K2E A;  4GYG A;  3E6M A;  4UHT A;  2EV0 A;  3GWZ A;  4KT5 C;  4HBL A;  2GZW A;  2NYX A;  2F5E A;  5CVR A;  2NS0 A;  2XKP A;  1GHC A;  2FBI A;  1D8K A;  1GVJ A;  1FY7 A;  2DU9 A;  2XV4 S;  2HR3 A;  4CZZ A;  3TQN A;  3E97 A;  1QNT A;  1V3F A;  3K2Z A;  2DO7 A;  3B73 A;  2AS5 F;  4ETS A;  3NEU A;  5HLH A;  5F64 A;  2RKH A;  3ZN1 A;  1REP C;  1LEB A;  2ZME A;  3JSP A;  4OOI A;  5FFX A;  2E7X A;  2PJP A;  1KU9 A;  4MGR A;  3HIF A;  2B0L A;  1TNS A;  4A6D A;  3J7A O;  1U5T A;  3KP4 A;  3F6V A;  2V1X A;  5D5X B;  4GO1 A;  1S7A A;  5FFZ A;  5LHI A;  4LLN A;  2DFI A;  2VON A;  5E17 F;  3F22 A;  3HTS B;  2PG4 A;  3V4G A;  2JPB A;  1I27 A;  2Q8K A;  1D8J A;  3BWG A;  1IF1 A;  1Z6T A;  3F8C A;  5ICG A;  1BI0 A;  3CO7 C;  1BI3 A;  1R23 A;  4U0Y A;  4FHT A;  3KFW X;  4Q5S F;  4CDG A;  2STW A;  3U9G A;  1V4R A;  1TW2 A;  2MD5 A;  4G9Y A;  4IJA A;  4CIC A;  5LEK A;  1CGP A;  3VOD A;  3HSF A;  2O0Y A;  5H6Q A;  3U1D A;  3E6D A;  1HW1 A;  3CLO A;  3MEX A;  5HLI A;  2RDP A;  1LDJ A;  4EJU A;  3GZ6 A;  2X4H A;  5D4R A;  1R5G A;  3KEO A;  1DUX C;  1R1U A;  1QO0 D;  3D0S A;  1SAX A;  3E5U A;  5D5W B;  3EYI A;  3RJP A;  4EGZ A;  3T1B A;  3D5L A;  2D45 A;  2JPC A;  1MKM A;  4EJW A;  4UVC A;  1VTN C;  1RNL A;  2NRA C;  3P9C A;  2K02 A;  2WWY A;  2ZXJ A;  2HYG D;  4A2U A;  3ZP5 A;  2J5P A;  3R4K A;  1W5S A;  5DUI A;  4Z2Y A;  2RNJ A;  2HS5 A;  4G7H F;  1IN4 A;  4HX7 A;  4HAM A;  4RGU A;  4BHC A;  4NB5 A;  3LST A;  2FQ3 A;  1TW3 A;  1S7O A;  3ML6 A;  3BDD A;  3SFZ A;  2F5F A;  2V1U A;  4RGX A;  3N4M A;  2GAU A;  4HZF A;  1LQ1 A;  4KA4 A;  3QPT A;  4DNC A;  4GGG A;  5JHU A;  3EET A;  2GIV A;  1O7L A;  1FP1 D;  4OIP F;  4R1H A;  1Q1H A;  1YG2 A;  4XLP F;  2Z9O A;  1ZAR A;  2LF7 A;  3DKW A;  1ZLK A;  3V7C A;  1IN8 A;  1WKM A;  2HQN A;  3FHZ A;  5DD8 A;  5D4S A;  4GCV A;  1YS6 A;  1TQI A;  3EDP A;  3TO6 A;  4A0Z A;  2XUB A;  3GO5 A;  5BPD A;  1BBY A;  1A04 A;  3CO6 C;  2P7C B;  1SD7 A;  2P5V A;  4R79 A;  1YLF A;  2GQQ A;  4WK8 F;  4MEY F;  3MAJ A;  4U0W A;  1KYZ A;  4OIO F;  4P5O A;  2MH9 A;  4PCQ A;  3J81 K;  3VB2 A;  3I53 A;  3H3U A;  1TQM A;  1L0O C;  3JTH A;  3GYH X;  3K1M A;  1G3S A;  1D5V A;  4IHT A;  1J2X A;  1J59 A;  3WU0 A;  5AIQ A;  4U7D A;  2LNB A;  2O03 A;  2K4B A;  1I6X A;  1J9I A;  1W7P A;  2VBY A;  2UWM A;  2G9W A;  2BYV E;  5F1R A;  1TBX A;  3FWE A;  1R1T A;  4G8X A;  2YX7 A;  3TKY A;  2V9V A;  4RAY A;  2GXG A;  3LAJ A;  1F9N A;  3BY6 A;  1HW2 A;  2ZO4 A;  3E6C C;  1OR7 A;  5DUK A;  4AIH A;  3BJA A;  4WX9 A;  4HF2 A;  2NAZ A;  4LB6 B;  1QQI A;  1HKQ A;  1ON2 A;  3FM3 A;  2XAF A;  4JBA A;  4XBF A;  3VOE A;  1B59 A;  4BHB A;  4LJZ F;  1WSU A;  2L4A A;  3QOP A;  1OPC A;  2XIG A;  3KLO A;  1BI2 A;  1OYY A;  3GFJ A;  4XRF A;  4LG0 A;  1T0F A;  5LBQ A;  1STZ A;  2CQK A;  3TOB A;  2GWR A;  4L5I A;  2ETH A;  2HTS A;  1CF7 A;  4PGH A;  3GVA A;  3PQK A;  4YFK F;  2A61 A;  2QZ8 A;  1ZLJ A;  3COA C;  3TDU C;  3WU1 B;  2E1N A;  1W7P B;  3R60 A;  2O8X A;  4LK1 F;  3C7J A;  3ZMU A;  1LDK B;  3FF5 A;  1MJA A;  1WRJ A;  4ESF A;  4G6Q A;  2HQR A;  4HLY A;  1QGP A;  1BC8 C;  3QU3 A;  2ISY A;  3I64 A;  3GX4 X;  5ILU A;  3QRF F;  2XAQ A;  3FXR A;  2E7W A;  4ENN A;  2FBH A;  2FEZ A;  3ZMV A;  2Y0M A;  1I1G A;  1PDN C;  4OMY A;  4M9X A;  3P7N A;  3LQQ A;  2RQP A;  1O3S A;  5K5Q A;  1YYV A;  3WGG A;  4KIG A;  1AOY A;  3K69 A;  1J0R A;  4ZZD A;  2PFB A;  4I2O A;  3AAF A;  1U3E M;  4U88 A;  2E1C A;  3I54 A;  2FBK A;  3KEQ A;  3PQJ A;  3WTV C;  3GW2 A;  2G7U A;  1C0W A;  2DBB A;  1EH7 A;  2EWN A;  1BJA A;  4G7O F;  2AXL A;  3WOD F;  4A6E A;  4IRH A;  2KRF A;  3FMR A;  4G94 A;  6PAX A;  5A2Q K;  2L54 A;  3O2P E;  3VFZ A;  4G6D A;  1ZG5 A;  3T0Y A;  3HRS A;  4EJO A;  2QBY A; 
#chains in the Genus database with same CATH topology
 4BQA A;  5E1Z B;  3UR3 C;  4PFP A;  3BPV A;  2L02 A;  4Y52 J;  5DEQ A;  3OYN A;  2ZME B;  2DA3 A;  4BDZ A;  3GFM A;  2WAD A;  3BPX A;  4HSR A;  3CCV I;  4KIB A;  4DOZ A;  1H88 C;  3HKZ A;  4EMS A;  3R0J A;  2EZI A;  2PI0 A;  4JK1 X;  1FBU A;  1QZE A;  2EIN H;  4NQW A;  1J09 A;  1S9H A;  2EJR A;  5GPA A;  4XQF A;  5FD6 A;  5BS6 A;  5B3S H;  1JHH A;  1CF7 B;  3CUO A;  1ETO A;  3EYY A;  1WJD A;  1IGN A;  2EH3 A;  2NNN A;  3FXQ A;  4EV0 A;  3Q9S A;  4FET A;  1RIO H;  3ZOB A;  4P9U A;  4HX4 A;  3I4P A;  4GDF A;  2VBZ A;  2O61 A;  4OU0 A;  2CUF A;  2OZU A;  5EF6 A;  2Y9Z A;  5EDN A;  2LTP A;  2QQA A;  4LOC A;  3GTG J;  2M5W A;  5EGO A;  3L2R A;  2DXI A;  1R6R A;  3OY9 A;  2D1V A;  4C2U A;  3JAM R;  3L9F A;  4KIC A;  4ZYH A;  3DP7 A;  1BI1 A;  3FKI J;  4DZP A;  3RKX A;  1ONV A;  2BXY A;  3V42 A;  3CCS I;  4MNU A;  5HS9 A;  2VKE A;  4IKF A;  5J4Y A;  4CCJ A;  1WJE A;  3BG5 A;  1PYV A;  2ZBK A;  4UUS B;  3ZQ7 A;  3PO2 J;  5JLX A;  1BIB A;  1X1P A;  4IHW A;  4ZC3 A;  4CCL A;  4A3F J;  2GOM A;  1ZRC A;  1YIJ I;  5B1A H;  3BR0 A;  3LL7 A;  4HRI A;  2BBY A;  2M8E A;  3K1N A;  5CVU A;  2BGC A;  4WCG A;  4BJT A;  2VJJ A;  2HFH A;  2PEX A;  1ACI A;  5E79 C;  2Z33 A;  4JOM A;  3DQV C;  5L3D A;  1HBX G;  1P2F A;  2KT0 A;  3LFK A;  2P6T A;  1KQ8 A;  4ZDP A;  3IRR A;  3T8R A;  2NXN B;  2OA4 A;  2RGV A;  4BS9 A;  2M3A A;  1SEU A;  1XS9 A;  2X48 A;  1UHS A;  2HDC A;  4IL6 C;  3F0C A;  4A93 J;  4BEH B;  3FXU A;  4XKV A;  1WWX A;  3KP6 A;  3N97 A;  1FSH A;  3A0H C;  3HKZ N;  2E2H J;  2K3F A;  2MA3 A;  4M74 A;  4M9Z A;  4BQO A;  4UNO A;  1IXS B;  3PNV A;  4LB5 A;  3M1E A;  5J1Y A;  2R7O A;  2FNP A;  5M5Y J;  1YX5 A;  4YG2 F;  3JAM Z;  4HNU A;  3SZT A;  2ICW G;  1FC3 A;  2DA4 A;  1MBK A;  2XVC A;  1DP3 A;  3I3L A;  2KDO A;  3VPR A;  3K6G A;  3V8J A;  3DTE A;  2OTL I;  2K86 A;  1X1D A;  4L5J A;  5ILS A;  2C6Y A;  2HYJ A;  2V7F A;  4OIN F;  3GTP J;  1AKH A;  2D2W A;  4M3F A;  4CCK A;  5B5E C;  1VFC A;  2BVM A;  4BY1 J;  3MCZ A;  1FYL A;  3CCM I;  1UG2 A;  3CZ6 A;  1HST A;  1Y1V J;  3D5S C;  3WTS C;  3KP3 A;  1K79 A;  1G3W A;  1X1B A;  2CQQ A;  4V2G A;  1S8N A;  1BC7 C;  2LFB A;  5EEG A;  5FLM J;  2MD0 A;  3IWZ A;  3H5N A;  1VQ5 I;  5EGO B;  1BIA A;  3W2A A;  3HYI A;  4IHS A;  3TL4 X;  1XDS A;  1RC9 A;  1ZAO A;  3SZP A;  1P92 A;  1ODD A;  3P9I A;  2OQR A;  3I5U A;  3IWF A;  2KDZ A;  2KMU A;  1Z3X A;  4BHP A;  2DW4 A;  2GA2 A;  5F6F A;  1LVA A;  1SVL A;  2KZG A;  3CUQ C;  5HS8 A;  1T0F C;  2X98 A;  3J7Z I;  4Y15 A;  2WBM A;  2VC0 A;  4BEH A;  2KLO A;  4CUG A;  1ZEL A;  1KU7 A;  4I0A A;  4J19 A;  2FE3 A;  2JA7 J;  1RUO A;  2JQ7 A;  1A5J A;  1I3A A;  3GTL J;  2WA0 A;  4YII A;  2A07 F;  4PFO A;  4R8H A;  1DPR A;  1GXP A;  1Y0U A;  1V54 H;  5FRN A;  2PMH A;  4UY8 I;  4W1U A;  4UVB A;  2MUN A;  3CCR I;  4ZJZ A;  4XRM A;  1GDT A;  3J7Y J;  1SD4 A;  2K40 A;  1AU7 A;  2EFO A;  5H6R A;  2VUM J;  3K7A J;  1KQ9 A;  2MSY A;  1ERD A;  2RAE A;  2RQQ A;  2VT3 A;  1P9Q C;  2L01 A;  2EZL A;  3Q9V A;  4Q47 A;  2UXN A;  1EA3 A;  4F93 B;  3GUD A;  3H92 A;  4RM2 A;  3IUO A;  4JYK A;  1XTA A;  3KYC B;  4I0B A;  2CWE A;  3S1N J;  3H0G J;  1SAU A;  5DV5 A;  2R5Z B;  3FXJ A;  1QA6 A;  4DW6 A;  2DTZ A;  4HQE A;  2ISZ A;  2CQX A;  3V7S A;  2K7L A;  2DA2 A;  2P81 A;  1KZH A;  1RKT A;  3QU6 A;  1BOA A;  1XG1 A;  1G4D A;  5JVT A;  1U6G A;  3Q3S A;  3CC4 I;  3L00 A;  1P7J A;  3PUB A;  3OV8 A;  4HYE A;  2Q0O A;  2HYF A;  2QVO A;  3CJN A;  5A2Q Z;  1FZP B;  1O7F A;  2EIM H;  2DCE A;  3RYP A;  4CYC A;  5D6E A;  4PDK A;  2XGE A;  2HQA A;  1NG6 A;  2LKX A;  2P0T A;  4XM3 A;  2HQ5 A;  5CJ9 A;  1D1C A;  4IOC F;  3OR1 C;  1A36 A;  1N78 A;  2IS2 A;  2CW7 A;  4EQQ A;  3AG4 H;  5J6X A;  2TRT A;  4QSH A;  2JMW A;  3K70 C;  3ZPL A;  4XLE A;  1W5T A;  1OCP A;  1E2X A;  2CW8 A;  2KIM A;  2LKS A;  3BCB A;  2WV0 A;  3JCU C;  3NRV A;  4HDU A;  4B4C A;  1UHW A;  4S05 A;  2FA5 A;  1QHH D;  2LP0 A;  4IHX A;  1SAN A;  2H6B A;  4ANJ A;  4WXD A;  2I5U A;  3DPU A;  4AWX B;  4F7Z A;  4Y13 A;  1P4W A;  2L7Z A;  3HOT A;  4RB2 C;  2CQN A;  2O8K A;  3S2W A;  3BRO A;  2QBY B;  4PK4 A;  3ERM A;  2OZ6 A;  2STT A;  3G73 A;  2ME6 A;  2K4J A;  2COM A;  3CCJ I;  3W6V A;  3H1C A;  1U2W A;  3GEZ A;  4BE1 A;  2A68 F;  3E0J B;  2PQ8 A;  5LRR A;  1YFH A;  2JVH A;  1W5C C;  3A03 A;  1JKP C;  1DPU A;  2EFW A;  5D5V B;  1IN7 A;  1WVR A;  3F21 A;  4O3M A;  1UHM A;  2Q2E B;  4AD9 A;  3W3C A;  3CUQ A;  3ASN H;  3DPT A;  4B8X A;  4HNT A;  4G12 A;  4IF4 A;  3C2B A;  3CCL I;  1NH3 A;  1WJA A;  2E36 A;  3I0T A;  5D6F A;  3S3N A;  2P5L C;  2XKO A;  2M35 A;  1QRY A;  1ENH A;  4M6Y A;  4M3D A;  2QEN A;  2Y2Z A;  4A5M A;  4BUP A;  3DU5 A;  2MC4 A;  1Z7L A;  1JE8 A;  2F4M B;  2W84 A;  1VQ4 I;  5BNG A;  1IW7 F;  1WI9 A;  3WTZ A;  5H2F C;  2R0Q C;  4OWR B;  1XPX A;  1MD0 A;  3O8H A;  3NWT A;  2ZFU A;  2L7M P;  2VT2 A;  4PJ0 C;  3DU6 A;  2WB1 N;  2X6X A;  3KET A;  2VJ5 A;  1MSE C;  2E2I J;  3ZMS A;  5DDG A;  2R7U A;  3WTX C;  2DQL A;  3LSG A;  3GLX A;  3A01 B;  1EKE A;  1AWC A;  3GTJ J;  4MQ9 F;  4L9J A;  2V1N A;  3GLL A;  1MMN A;  3K1P A;  5CLS A;  3RZD J;  1Z21 A;  3QP6 A;  4RLF A;  4L18 B;  4CGZ A;  2H09 A;  3MZY A;  2PLY A;  3K4B A;  2CUZ A;  4MEX F;  4ABZ A;  3BG7 A;  2MYS A;  2X0L A;  3L2Q A;  3DPL C;  3FMS A;  3LQR A;  3LSH A;  4XNF A;  3CME I;  2R5Y A;  4QTR A;  3HHH A;  3ZQI A;  3EUK L;  4D1Q A;  3MKL A;  1H8A C;  2IS6 A;  3HM5 A;  3F72 A;  1FEX A;  3S2D J;  1S29 A;  1HC8 A;  4RLQ A;  2Y0S A;  4F55 A;  3HOU J;  2Y30 A;  3H9G A;  3C1D A;  4A3K J;  3H5R A;  2BEO A;  3RKW A;  5DTD A;  3DBH B;  3FZV A;  3U21 A;  2L7F P;  1YJW I;  4II2 A;  1E17 A;  5IP7 J;  3CUQ B;  3IKV A;  2FUG 2;  2JJ7 A;  1T39 A;  5GAH J;  1U9O A;  5CVV A;  1ETV A;  4DQ2 A;  1OCZ H;  3CMY A;  2FU4 A;  1K78 B;  3GCM A;  1NHA A;  2JRT A;  2O6G E;  2FMY A;  3IL2 A;  2ZNY A;  1RES A;  4OMZ A;  2X1D A;  2H6C A;  2DJN A;  4I01 A;  1ZQ3 P;  1UB9 A;  2CU7 A;  3PM1 A;  3T5X A;  1K6Y A;  4F52 A;  4XRS A;  4IHV A;  1TT5 B;  3K9T A;  4HLX A;  4ENK A;  1VQL I;  1X4O A;  4D0P A;  1HW5 A;  1D3Y A;  2F6C A;  2K85 A;  4NUB A;  5LLQ A;  5C4X J;  1IZ1 A;  2LR8 A;  3RIR A;  4GFB A;  3WGH A;  3IH4 A;  1XMX A;  1YW8 A;  3MKW B;  3Q5F A;  3LFU A;  4JX4 A;  3K10 A;  1L3L A;  2ZNZ A;  1SMT A;  2BW3 B;  3LSP A;  5GTI C;  3J80 K;  5LD2 C;  4IQJ A;  3LA2 A;  2MVT A;  3E5X A;  1ZYR F;  4UV9 A;  4NHJ A;  5JHF A;  4BE0 A;  1QVU A;  4IRI A;  4Z6Y A;  2QKM B;  4XL9 A;  2DK8 A;  2DMN A;  4C2M J;  4A3L J;  4IEJ A;  2GXB A;  4LIT A;  2HI3 A;  3DEE A;  4BJ5 C;  3QAH A;  4XIC A;  3WTY C;  3FX3 A;  1BR2 A;  4ZTJ A;  1G3T A;  1LNW A;  1Y56 A;  5LGN A;  1S72 I;  3ECH A;  1FSE A;  4RGR A;  1W36 C;  2I10 A;  2OTJ I;  3CDI A;  3K4N A;  2FOW A;  2RRE A;  1MJB A;  3JRC A;  2L3D A;  3LSI A;  5TIS C;  5KK1 A;  3HL2 A;  1NTC A;  4JQF A;  1F43 A;  3O3K A;  4XLF A;  2A3S A;  4Y17 A;  2IGN A;  4E6K G;  4Q4Z F;  3G71 I;  2XAG A;  1FIP A;  3FBI B;  4Y3O A;  1Z77 A;  5CYV A;  1JGS A;  1W0T A;  3J7A Y;  3HOS A;  1SMY F;  4BYY A;  3QOE A;  3LSR A;  2HVR A;  2QA4 I;  2Q1Z B;  4C9Y A;  2LDU A;  4RAZ A;  3LSJ A;  2F5D A;  4A5N A;  4G7Z F;  2ZJ2 A;  3HSR A;  3NAR A;  2M45 A;  1Q1V A;  1WJF A;  1S6L A;  4RB0 A;  3U1K A;  1MDM A;  4A3E J;  2F48 A;  5J40 A;  3HRM A;  1X19 A;  4J01 A;  3FKJ A;  2DOE A;  2OAZ A;  5TRD A;  5F1J A;  5L3C A;  3S1M J;  3IKT A;  3M4O J;  2QQ9 A;  4EM2 A;  2KJC A;  2LYC A;  1RI7 A;  3C18 A;  1YW7 A;  4OIR F;  2R93 J;  4LFU A;  1G8X A;  5L3F A;  2GOX B;  4U7B A;  4M6X A;  5TJJ A;  3H36 A;  3ABT A;  1PVE A;  4LG0 B;  5BMZ A;  4BAY A;  2KQR A;  1IXR C;  1T33 A;  2MLG A;  1BA5 A;  4IPA A;  1SFE A;  2CG4 A;  1GV2 A;  3WE2 A;  4ZYE A;  4AC0 A;  4KMF A;  1SD5 A;  3K0L A;  4L9V A;  3IP4 B;  5FO5 A;  1HCR A;  3F8M A;  4QLC U;  2DJI A;  3OMY A;  1LJ9 A;  3BT9 A;  4L5E A;  1P4A A;  3RKY A;  4B47 A;  1UEL B;  1YI2 I;  4NDL A;  4EJT A;  1MNM C;  3JSO A;  2L9R A;  4FAS D;  3FK6 A;  2MG4 A;  4M3B A;  3MWM A;  4M73 A;  3TBI A;  1HA8 A;  2FF4 A;  3QQA A;  3CP8 A;  4XKB A;  4NC8 A;  1XMA A;  2OU2 A;  3K2A A;  2ZB9 A;  4M9S A;  1ULY A;  1IXC A;  2IA2 A;  2VOP A;  4JP0 A;  3A2K A;  5CPR B;  5IYC J;  1X3U A;  3E5Q A;  1Y6I A;  2E5N A;  2XF7 A;  3LMM A;  5EJC A;  4A3D J;  1P7I A;  2VAS A;  1XDU A;  2JA2 A;  4ZH4 F;  1B9M A;  5IYB J;  3HC7 A;  1ON1 A;  5E1W A;  1MZB A;  2XGX A;  2R7D A;  1DGR M;  1XGM A;  3BR6 A;  4YEJ A;  3ELK A;  4RGS A;  4IRG A;  2EFQ A;  2O9L A;  1PUF B;  3MN2 A;  2YU3 A;  2DFE A;  4II3 A;  1YJ9 I;  2DAO A;  4LG3 A;  3SFI A;  1MH3 A;  3DBR B;  4C2T A;  4DIQ A;  1Z6R A;  2CJJ A;  2VXZ A;  2V26 A;  5LGU A;  4GYI A;  4LIV A;  1R36 A;  3FMQ A;  2IRF G;  1TWC J;  2CS3 A;  3V7R A;  4PJJ A;  3LNQ A;  2W4S A;  2NVX J;  2CW0 F;  3DBL B;  5HOO A;  1RRJ A;  1BL0 A;  2PN6 A;  3JW4 A;  2BW3 A;  2IA0 A;  1DGW Y;  5HDK A;  1TNT A;  1Y0N A;  1IRF A;  3JRE A;  3Q0U A;  2EIL H;  3ISP A;  5FLV A;  3RTR A;  2V9K A;  3LA3 A;  4FCY A;  3L2C A;  1VQN I;  2K9S A;  2LKP A;  1HKT A;  3EQL F;  4QWQ A;  2VQH A;  4FIS A;  5GPC A;  3I58 A;  3OL4 A;  2ESN A;  5GP9 A;  1QPM A;  4M71 A;  5E18 F;  2QWW A;  2P5K A;  3VDX A;  1HQC A;  3FBN B;  1IJW C;  2RN7 A;  1G6N A;  4I76 A;  4P55 A;  2A6H F;  1DP7 P;  1UFM A;  2HGC A;  2F4O B;  2DYR H;  3TO7 A;  3WHC A;  4D7N A;  4EVI A;  3MKZ A;  5JI6 A;  2Z2S B;  1MND A;  1VQK I;  1J7K A;  4CO8 A;  5HDG A;  5C4J J;  4FE4 A;  4XN3 A;  3OYJ A;  2VPR A;  4YRV A;  4A69 C;  1OYW A;  2WY8 Q;  1U78 A;  1FOY A;  3L2W A;  4DZJ A;  1TT0 A;  3KE2 A;  3VEP A;  3QYE A;  1X1A A;  2CO5 A;  4UXN A;  1IUY A;  5GAG J;  4KN4 X;  3WHB A;  1I1S A;  1YTY A;  3U2R A;  4ZYD A;  1ZG3 A;  4AU7 A;  5JR3 A;  4BH9 A;  2OBP A;  3GF2 A;  5TGT A;  2XSJ C;  2LBF A;  2DOF A;  2Z99 A;  4BQN A;  2DPU A;  3QPL A;  2R7F A;  4B1R A;  4S0H B;  3OS0 A;  4EGY A;  2XAJ A;  3HGY A;  4MHG A;  2KFD A;  1CQT A;  1A35 A;  1R5H A;  4CYC B;  1OR7 C;  2DDA A;  4RBO A;  1YQA A;  1IDZ A;  3I71 A;  2QSF X;  1ZR2 A;  2EV5 A;  3M8E A;  1QPI A;  1SVM A;  2FD5 A;  3GME A;  1TTY A;  2JRM A;  5D8L B;  4C3I J;  2L7K A;  5ERI A;  3J81 Z;  3HBL A;  1U8R A;  1F4K A;  4AYB N;  1XGS A;  2VXD A;  2LK2 A;  3QPH A;  2HWV A;  3CP2 A;  2KIU A;  3IC7 A;  1O3T A;  4TV7 A;  1RZ4 A;  3RPU D;  3B02 A;  2W00 A;  3S93 A;  4KIF A;  3P5J A;  1FJL A;  3CDH A;  1ZTR A;  4MQV A;  4KFC A;  3MZH A;  3R61 A;  2AXT C;  4O6J A;  1LDD A;  3K4K A;  2IW5 A;  5KCM A;  3LAP A;  4QIW N;  1I50 J;  3WTU C;  3PIO F;  2XAS A;  1RR8 C;  3IHU A;  4CXF A;  3NWS A;  2LD5 A;  2AHQ A;  1BW6 A;  4I99 C;  3WU2 C;  1XSV A;  3O6B B;  1OMI A;  1MSF C;  5J8C A;  3ZMT A;  1PP8 F;  1ZRE A;  4JX6 A;  1SD6 A;  3F6O A;  1SFU A;  4CHU A;  1YIT I;  2R7Z J;  3M07 A;  4UUS A;  4ZDO A;  4BXF A;  4HV5 A;  3C2G A;  1XCV A;  4XRS G;  2P6S A;  1I5Z A;  5LHG A;  2MLK A;  4A3B J;  4AYB A;  3EUA A;  3KYD B;  1MJ9 A;  3F8N A;  3IV5 A;  3F8B A;  3ZGK A;  3REO A;  2PBI A;  1WGX A;  1TQP A;  2KPM A;  2DFF A;  3CLQ A;  5F04 A;  3IRQ A;  3S16 J;  2ZME C;  1ZK8 A;  3FK7 A;  4MTE A;  5HNH A;  2ECB A;  4XN0 A;  5DYM A;  1XMK A;  3MMY B;  4WXH A;  2KIQ A;  2DK5 A;  1H0M A;  2H94 A;  1JHF A;  2GA1 A;  5DD4 A;  3KIO A;  4KNY A;  1XCB A;  2JUG A;  1VI0 A;  3OWT A;  1PP7 U;  1KQ0 A;  4A0X A;  2FNA A;  2KKO A;  2VL8 A;  1TWF J;  3FIS A;  4FT8 A;  2CFX A;  2AO9 A;  4XOR A;  5EEA A;  2DT7 B;  1H89 C;  4MTD A;  2MBF A;  1JXS A;  4RM3 A;  4S04 A;  2LSO A;  1AKH B;  2BXZ A;  2M87 A;  1YS7 A;  2M7A A;  4XKW A;  5D8K B;  1FNN A;  3BG3 A;  3CF5 F;  4FX4 A;  2DMT A;  3KZI C;  3BZK A;  3WE3 A;  2A5Y B;  4XKC A;  1IV6 A;  3HRU A;  3BG9 A;  2VC1 A;  1WHU A;  3PL8 A;  2ESH A;  2LVS A;  4PZJ A;  2HVS A;  1Z0X A;  1Z3Y A;  5DS9 A;  3F23 A;  1BN5 A;  2P7V B;  2IP2 A;  2QUF A;  3G2B A;  4D5F A;  5FLX R;  4RS8 A;  2R3S A;  3FXK A;  1GV5 A;  2R5Y B;  4P96 A;  2IT0 A;  1IV8 A;  3QYB A;  2GIZ A;  2Z5U A;  1Z67 A;  3HTU A;  3KZZ A;  3A01 A;  2FJ1 A;  4XON A;  4X1E A;  4L0Z B;  1R1V A;  2BY2 A;  3E6B A;  1Y39 A;  4AM3 A;  4E70 A;  4QPO A;  2EV6 A;  2DI3 A;  1XC5 A;  2DT5 A;  5ICC A;  1D5Y A;  5K5R A;  3WG9 A;  2DTR A;  3H0D A;  2M9H A;  1DDN A;  3CDL A;  5EG0 B;  1UJ8 A;  3ONQ A;  1P4X A;  3ZQL A;  4ZYG A;  1GT0 C;  4NC7 A;  3DLL F;  3WTT C;  1LFP A;  4A0Y A;  2FML A;  4IXA A;  1K78 A;  2L9N A;  2M1B A;  1MBJ A;  2XGC A;  2IXS A;  3QOD A;  4HOB A;  4E7S A;  2JVG A;  2DPD A;  2EZH A;  3DTK A;  3MKY B;  4BXX J;  1TWG J;  5ICF A;  1TWA J;  2ECC A;  2P4W A;  1P6R A;  3FM5 A;  4HA8 A;  1XX5 A;  1YO5 C;  4RB3 C;  1F36 A;  1V5F A;  2IS1 A;  4W97 A;  1XSD A;  4RDU A;  1KYW A;  3MQ0 A;  3I9V 2;  3HOZ J;  1W4M A;  1DU0 A;  5ILV A;  2JWT A;  1R7J A;  1GVD A;  1K7A A;  2XB0 X;  2VOO A;  1ETW A;  3SDB A;  1B72 B;  3G6E I;  3SHF A;  3OSG A;  2M0M A;  2H27 A;  2Z3Y A;  3V8K A;  3BOQ A;  3SDG A;  1USS A;  2HU9 A;  3EUH C;  4ESJ A;  3AG1 H;  1F1Z A;  3DV8 A;  1FWZ A;  3OOP A;  2LBF B;  4GXO A;  2VB6 A;  4A3J J;  1MGT A;  1G2H A;  5IT9 K;  5LHH A;  1IAW A;  3LSM A;  2H8W A;  1VF9 A;  2HZT A;  4MO7 A;  2ZSI B;  3KLN A;  3H3Z A;  3SQN A;  3ROU A;  2LY1 A;  1PJR A;  5DCM B;  3RDI A;  2E60 A;  2FRH A;  2Y31 A;  2N8G A;  2R7T A;  1Z1D A;  1WH7 A;  1AA7 A;  1TL8 A;  5K5O A;  3A02 A;  4HQM A;  1F5T A;  4PJN A;  2DA7 A;  2NVU B;  4BKX A;  4J00 A;  2Y69 H;  2VOD A;  4I7H A;  3HOV J;  3GFL A;  4BDY A;  1T98 A;  3BJ6 A;  3OOU A;  3RPU A;  2YX4 A;  3DEU A;  4OIQ F;  2HXI A;  4HNV A;  1W36 D;  1ZGA A;  5D5U B;  2X6W A;  4N4O B;  1ZRD A;  3J81 R;  5KNL A;  2LF8 A;  2VKD A;  2R4G A;  4HV6 A;  2VI6 A;  1EH8 A;  3K4L A;  3W6J B;  5IOY A;  1KGS A;  4XSX F;  2HOE A;  3R0A A;  4P9F A;  1KON A;  3S32 A;  3H5A A;  2KL4 A;  5E20 A;  2CGP A;  2HEO A;  2P8T A;  5HDN A;  1OJL A;  5LGT A;  3DCF A;  5KAI C;  3KP2 A;  3LWF A;  3V8L A;  1YRN B;  2IPQ X;  5FKM A;  3VYS B;  2HKX A;  2GM4 A;  2ACJ A;  4C3J J;  1YW9 A;  5FKO A;  2BV6 A;  2ZCW A;  3I4M J;  3HRT A;  3J80 R;  3I59 A;  2VN2 A;  3OSF A;  5J47 A;  4HG2 A;  4AID A;  2VBX A;  1FPQ A;  2EPF A;  2EQR A;  4U87 A;  4KIT B;  2W48 A;  1OKR A;  3RPQ A;  3DFG A;  1PUF A;  3BZ6 A;  2DMP A;  3NAU A;  1T08 B;  3OYF A;  1XN7 A;  1KA8 A;  2EA2 A;  4IX7 A;  4X0G A;  4L9T A;  4HX8 A;  1O3Q A;  2IJL A;  2Q2E A;  3W6K B;  3HZJ A;  1EJ9 A;  1D1B A;  5JLW A;  5ED4 A;  9ANT A;  2BE5 F;  1QU3 A;  2KIS A;  2ZXI A;  2XAU A;  2CSO A;  4L9N A;  3CCU I;  2YUS A;  3ZMD A;  1ZH5 A;  2HKO A;  1OYI A;  3Q0V A;  2XPU A;  1Z05 A;  1VQ9 I;  5LEJ A;  1LVK A;  5AIP A;  4ESB A;  2V9P A;  3PO3 J;  1RPW A;  5E8G A;  2PMU A;  2UXX A;  1VZ0 A;  3TDZ C;  1XD7 A;  3M8F A;  4LD5 A;  2R7R A;  3SEZ A;  2V6C A;  2ELH A;  2OD5 A;  3C2H A;  3OL3 A;  1ZN2 A;  3FXO A;  3JRF A;  3TO9 A;  4FX0 A;  2DMU A;  1FLI A;  4XID A;  3WGI A;  3QYF A;  1T8I A;  3HDD A;  1X1C A;  1ZRF A;  3ZMZ A;  3OYA A;  1ZGW A;  2KP6 A;  3DF8 A;  1MBG A;  2BZT A;  2KHM A;  2XHK A;  4EM0 B;  4XLN F;  1J75 A;  1B9N A;  3H3V K;  4E4H A;  2HPM A;  3MFK A;  3KP7 A;  3O8G A;  4UVA A;  2RC4 A;  2CV2 A;  2DMQ A;  1EH6 A;  2TDX A;  1O3R A;  2WAQ A;  3ZN0 A;  2JTV A;  2VBW A;  1Z91 A;  2Y75 A;  4CCN A;  4WF2 A;  3BG6 A;  3KCC A;  3BJO A;  3OYB A;  1TWH J;  4LLG F;  4LGW A;  2IGK A;  2LRE A;  2CRG A;  4L0Y B;  4ITV A;  2IGM A;  4KT6 A;  1HLV A;  2OCE A;  2W57 A;  1M1E B;  4AVP A;  4WWC A;  1FOK A;  5FRO A;  3PFI A;  2W25 A;  2FXA A;  3W2W A;  4M72 A;  3ECO A;  3ZXS A;  4BQQ A;  4YIR X;  4ENM A;  1X4P A;  2O7O A;  3CCY A;  2NVQ J;  2A05 A;  1X3Z B;  4MLO A;  2F5C A;  1UST A;  2A69 F;  1G3Y A;  1RUN A;  1IN5 A;  1ETQ A;  2OPT A;  3S15 J;  2LG4 A;  1YX3 A;  5HLG A;  4EM1 A;  2NS7 A;  2WV1 A;  2CYY A;  1LEA A;  3ZQQ A;  3HPG A;  2O3F A;  5BQT A;  3RYR A;  1XGO A;  2RV8 A;  3PJR A;  2MH2 A;  4ZZL A;  3JRG A;  4KYW A;  4HW0 A;  4XK4 A;  5FGM A;  1SFX A;  2D1H A;  4CSW A;  1UCR A;  5GTH C;  4PGG A;  1YOV B;  2BY3 A;  5E8I A;  1T2K A;  2PJR B;  3ABU A;  3RSN A;  1I3Q J;  4MFE A;  2KIF A;  2ZFW A;  1R00 A;  1U0J A;  2GLO A;  3K4J A;  2IVM A;  4N9H A;  2OQG A;  2K9N A;  1Y8R B;  2E35 A;  2QQB A;  4XSZ F;  1WQ2 A;  2G7H A;  1B1B A;  3OYC A;  4ENJ A;  1SFO J;  4HPQ A;  1KU3 A;  5CVJ A;  3JAM K;  2ID3 A;  2CV0 A;  5KVR A;  2MAB A;  1LB2 A;  3GZ5 A;  4KMU X;  2HDD A;  4KDP A;  4HF1 A;  2A5W A;  3KP5 A;  2IA1 A;  3PFY A;  3OYD A;  2VLA A;  4H0E A;  1MMS A;  3S1Q J;  3S14 J;  2V1D A;  4F92 B;  5IT9 Z;  5IY5 H;  3EUH A;  3BQZ A;  2BY0 A;  4I02 A;  2NNY A;  3BP8 A;  1KU2 A;  4EAT A;  3QPS A;  2EZK A;  1QBJ A;  1T38 A;  3CMM A;  4NBQ A;  1HKS A;  1Z9C A;  5CKT A;  4ZYA A;  4AIJ A;  3P9K A;  2XRL A;  4IQ4 A;  4V2F A;  1ZG1 A;  3R6S A;  2F2E A;  5IP9 J;  2HTJ A;  2YR2 A;  2V79 A;  2ZJQ F;  2K5C A;  4IZZ A;  4ON0 A;  3E3V A;  2WC2 A;  2VKV A;  5CQG A;  4KJZ A;  2E71 A;  1IRZ A;  2W24 A;  1UZC A;  3M9A A;  2XSD C;  5EYR A;  5L3G A;  2V6E A;  2QCO A;  3MD2 A;  4HDV A;  4CCO A;  4YIF A;  2HDW A;  3J80 Z;  3GTM J;  1HSJ A;  5FB2 A;  1JKQ C;  2FSW A;  1H9T A;  1EF4 A;  2M2E A;  3B6C A;  5DM7 F;  2X85 A;  5HOD A;  3S17 J;  1U8B A;  5L3B A;  4NQW B;  2KJB A;  4YFX F;  5FD5 A;  2AQF A;  1ZHF A;  5FKN A;  3L09 A;  2EBI A;  5K1Y A;  1FYM A;  2DQR A;  4YFN F;  3F3X A;  2HVQ A;  4HEA 2;  1R58 A;  5K7F A;  1B4A A;  1H9G A;  1MBH A;  3S1R J;  1AHD P;  2JSC A;  4BGD A;  4ZDL A;  4E7H A;  4AIK A;  3NQO A;  1FBQ A;  4B43 A;  4B09 A;  1WI3 A;  2X1C A;  1MMA A;  2JT1 A;  3FIW A;  1GXQ A;  5HS7 A;  2Y48 A;  3JRH A;  1XB4 A;  5HVQ C;  5M3M J;  1W7P D;  2MZ4 A;  4RAG A;  2JA8 J;  2XRN A;  3C3W A;  4UB6 C;  5L3E A;  3AKZ A;  3TGN A;  3OIP A;  4XOT A;  2W85 A;  1R22 A;  3BCA A;  2NS8 A;  1NK2 P;  1B6A A;  3IH2 A;  1QZY A;  4LK0 F;  1X3W B;  3TOA A;  1WH5 A;  4BY7 J;  1EV7 A;  1U5T B;  2QF7 A;  2XRO A;  3JTG A;  1A31 A;  3DXJ F;  5KHD A;  2EFP A;  3SXY A;  3CTA A;  4FTH A;  1XSX A;  3BQY A;  3GXO A;  2BY1 A;  1R4N B;  3SYT A;  2QYO A;  1FT9 A;  3OYI A;  3GFI A;  1R4M B;  3L7W A;  2M30 A;  2P0W A;  2ZKZ A;  4XMY A;  5ICE A;  2QLZ A;  3WTW C;  2DOD A;  3BLY A;  1HXD A;  3BC8 A;  4N0B A;  4DYQ A;  2JZY A;  1MDM B;  5F0C A;  5EZH A;  3ERE D;  2NVT J;  4LLL A;  4A3M J;  1Z7U A;  1J5Y A;  4MFD A;  3VSL A;  3HB9 A;  2K9Q A;  3HSE A;  4RB1 A;  1FX7 A;  2K27 A;  5E1X A;  1RR7 A;  3I59 B;  2A6E F;  3RI4 A;  5H20 A;  3F8F A;  1S5L C;  3K70 D;  3S3M A;  3CD6 I;  1OCC H;  3KYL A;  3KZY A;  2RVC A;  1IN6 A;  3QP5 A;  3ZQG A;  2CV1 A;  5HNF A;  4U0V A;  4A3G J;  1FP2 A;  5J8F A;  4O5V A;  2WAE A;  1XGN A;  1WJ5 A;  1T6S A;  2PX9 A;  1FBS A;  1YIO A;  3M7G A;  3ZQH A;  5BOX A;  5LRS A;  4BNC A;  4N4N B;  4KUM A;  2E2J J;  1IRX A;  2JN6 A;  2L9S A;  4LMY A;  1LKX A;  4M3G A;  1TP4 A;  2X6O A;  4A12 A;  1ZGJ A;  1MH4 A;  2J5O A;  2L4M A;  1K6O A;  2GXA A;  2K9M A;  2Z1D A;  4D5C A;  3ABM H;  2LY9 A;  3T8T A;  1JUP A;  2WTE A;  3G3Z A;  2DLL A;  4N9I A;  4HF0 A;  4I09 A;  4LIU A;  2X1E A;  3HHG A;  3EPZ A;  2UZK A;  2IS4 A;  3BR5 A;  2HZD A;  3QWL A;  2W82 A;  2YPR A;  1FTZ A;  5DCF A;  1K61 A;  4V19 K;  1K83 J;  1TLH B;  4EJV A;  2EB7 A;  4Q48 A;  1U5T C;  5EEH A;  1X2N A;  2MC3 A;  2VE8 A;  5FKK A;  5FLX Z;  3HUG A;  2XAH A;  3JR9 A;  3PNT A;  4UV8 A;  4B48 A;  1BM9 A;  2B7E A;  2FOK A;  1HOM A;  2IBD A;  1IRG A;  4B44 A;  2W1O A;  4YEL A;  5DCM A;  3AL0 C;  1Y8Q B;  2EFN A;  5FLX K;  3BTC A;  2ADU A;  2LOO A;  1UAA A;  2YSR A;  2NOG A;  1OCO H;  4DBQ A;  4I98 B;  4KN7 X;  1OCR H;  3FHN A;  3PSF A;  1JUM A;  2VE9 A;  3OYE A;  4IOA F;  1NK3 P;  1QZZ A;  1S3J A;  4BBR J;  1PUE E;  4IHY A;  2XF5 A;  2EK5 A;  2OV7 A;  5LFA A;  2BHY A;  1JI8 A;  3PSI A;  3K4M A;  5FJ8 J;  4ASN A;  2MFZ A;  2VIX A;  5IT3 A;  1RKW A;  4CYD A;  1O57 A;  3HGG A;  4OAZ A;  5AON A;  3K4C A;  1MBF A;  4IVN A;  1S7E A;  4BXU A;  3OS2 A;  1R5I D;  1D1A A;  3LA7 A;  2HPI A;  1FYK A;  3CQZ J;  4RA2 A;  4KIS A;  2HOT A;  5KAF C;  2L5Q A;  2QM3 A;  5CVI A;  4UB8 C;  3CCQ I;  2ZXW H;  3KX2 A;  4OAY A;  1B72 A;  3ULQ B;  5BPI A;  3RCO A;  4CCM A;  4AVZ A;  5JFR A;  3HOX J;  2YS9 A;  4UUV A;  1APL C;  2EA4 A;  1WZ2 A;  1Y1W J;  1VQM I;  1K4T A;  4WXC A;  3S2H J;  4K2E A;  4GYG A;  1JTY A;  3E6M A;  3VWB A;  4D9J A;  2VQG A;  4UHT A;  2EV0 A;  3GWZ A;  1LE8 A;  2H1K A;  2CMP A;  4KT5 C;  4HBL A;  3JRB A;  3I4N J;  2GZW A;  2NYX A;  2F5E A;  3DKY A;  5CVR A;  3DLA A;  2NS0 A;  2XKP A;  5IYD J;  3L2U A;  3FXL A;  1GHC A;  2ZXH A;  2R7V A;  2FBI A;  1D8K A;  1GVJ A;  2M0C A;  3VYU B;  1FY7 A;  2DU9 A;  2XV4 S;  2HR3 A;  4B3X A;  4A3C J;  4CZZ A;  3JRI A;  4DYC A;  3TQN A;  5E3O A;  4E7L A;  2JUC A;  3E97 A;  4DYR A;  1QNT A;  3A4C A;  4ZTF A;  3BR3 A;  3OYG A;  4CH7 A;  1V3F A;  5M3F J;  3K2Z A;  2VPL A;  2DO7 A;  3B73 A;  2AS5 F;  3F9K A;  4ETS A;  3NEU A;  5HLH A;  5F64 A;  2RKH A;  2Y0S N;  3ZR8 X;  3ZN1 A;  2VKH A;  1REP C;  3SJM A;  1LEB A;  1I6H J;  1V5E A;  2ZME A;  3JSP A;  4OOI A;  4I6Z A;  1JT0 A;  2A6T A;  5FFX A;  2ZC2 A;  2E7X A;  2XF6 A;  2PJP A;  1BJZ A;  1DQU A;  1KU9 A;  2XGD A;  4MGR A;  3HIF A;  4P1W A;  2H8R A;  2B0L A;  4UUT A;  2D5V A;  4EEF G;  2KRH A;  1TNS A;  4A6D A;  3RZO J;  3J7A O;  1U5T A;  3UKG A;  1GLN A;  3S8P A;  3OIO A;  3KP4 A;  3F6V A;  1N77 A;  2V1X A;  4XR6 A;  5D5X B;  4GO1 A;  1QVT A;  4CZC A;  1S7A A;  5FFZ A;  3IH3 A;  5LHI A;  2B63 J;  1WJB A;  4LLN A;  3VYR B;  2DFI A;  5K7H A;  4H4K C;  2VON A;  5E17 F;  3F22 A;  2LH9 A;  1BR4 A;  3D1N I;  3HOW J;  3HTS B;  2PG4 A;  2FX0 A;  5F27 A;  3V4G A;  3L2V A;  2JPB A;  1I27 A;  2Q8K A;  1D8J A;  3BWG A;  3DEW A;  3SEQ A;  1IF1 A;  1SC7 A;  1Z6T A;  3F8C A;  3I55 I;  3OIQ A;  4BE2 A;  3OS1 A;  2ZJP F;  5ICG A;  3CMA I;  1BI0 A;  3CO7 C;  2JA5 J;  1BI3 A;  2BOL A;  2E5Z A;  5HLT A;  1JKR C;  4M6V A;  2R7W A;  1A6Q A;  2K3P A;  4X6A J;  3HG9 A;  1R23 A;  4F91 B;  4FHT A;  4U0Y A;  1ZR4 A;  3KFW X;  4Q5S F;  4CDG A;  2STW A;  5GAE J;  3PUF A;  1MBE A;  3U9G A;  1V4R A;  1E3O C;  1TW2 A;  2R5Z A;  2MD5 A;  3M8J A;  4G9Y A;  1FOX A;  4CA0 A;  4IJA A;  2K9L A;  2X6Y A;  2IGO A;  4CIC A;  5LEK A;  1CGP A;  3VOD A;  3HSF A;  2O0Y A;  5H6Q A;  1IDY A;  4BL0 B;  1VQP I;  1LPQ A;  2LLK A;  3U1D A;  2UV1 A;  3M1C A;  3E6D A;  1HDP A;  2R92 J;  3IAS 2;  1HW1 A;  1TZL A;  3CLO A;  2VJI A;  3CCE I;  1MW7 A;  3MEX A;  5HLI A;  2RDP A;  1LDJ A;  4EJU A;  1LE8 B;  2V4J C;  3GZ6 A;  2QKL B;  2CFO A;  2ME0 A;  3LOC A;  2X4H A;  5D4R A;  1W0U A;  1R5G A;  3KEO A;  4XLA A;  1TC3 C;  4B3A A;  2JSP A;  2M34 A;  2QGU A;  1YHQ I;  2VQL A;  3AL0 B;  1D0Z A;  3BZC A;  3I56 I;  1DUX C;  2ZJR F;  1R1U A;  2O5R A;  1QO0 D;  3D0S A;  2E1M C;  1SAX A;  3E5U A;  5D5W B;  5IP6 A;  3RJP A;  3EYI A;  4EGZ A;  3CJQ B;  2HXO A;  2RNG A;  2AQE A;  3H9J A;  4MIM A;  3T1B A;  1YJN I;  2XPW A;  3MVP A;  3AG3 H;  3D5L A;  2D45 A;  2JPC A;  3L1P A;  2BVL A;  1MKM A;  1WPK A;  4EJW A;  2OC6 A;  2E34 A;  4UVC A;  4BU2 A;  4Y7N J;  5FRM A;  1D0X A;  4F3Q A;  3OYL A;  1VTN C;  4AUX A;  2PJR A;  5J1R A;  4NC6 A;  1RNL A;  4DJA A;  2NRA C;  3P9C A;  1N25 A;  2X51 A;  3PNY A;  2K02 A;  3S3O A;  2WWY A;  2IEK A;  1E0E A;  3ZCO A;  2ZXJ A;  2R7Q A;  2HYG D;  2UUZ A;  4A2U A;  5DM6 F;  2HNH A;  3ZP5 A;  2J5P A;  3TMO A;  3Q0W A;  3R4K A;  1W5S A;  4RAF A;  1SVO A;  5DUI A;  3BR2 A;  1SFK A;  4Z2Y A;  2RNJ A;  2HOA A;  2Z16 A;  2HS5 A;  4G7H F;  1G59 A;  1IUF A;  4A3I J;  5JVG F;  3CF2 A;  4FQG A;  1IN4 A;  4HX7 A;  1HDD C;  1IG7 A;  3B6A A;  4Y33 A;  4HAM A;  4RGU A;  4BHC A;  2L2O A;  1ETK A;  4NB5 A;  4IO9 F;  2DYS H;  3VSK A;  1IC8 A;  3LST A;  2FQ3 A;  1TW3 A;  1S7O A;  2E1M B;  3BDD A;  3ML6 A;  2F5F A;  3SFZ A;  3ZQF A;  2V1U A;  1MMG A;  2WY7 Q;  3DWL E;  4RGX A;  3CJT B;  3N4M A;  2GAU A;  3BR1 A;  4HZF A;  2LC2 A;  1LQ1 A;  1JUS A;  4KA4 A;  2PMZ A;  1R71 A;  3QPT A;  2DN0 A;  2DA6 A;  3TW6 A;  1E3P A;  4DNC A;  5EG0 A;  1FMV A;  4GGG A;  1VQO I;  5JHU A;  3EET A;  2GIV A;  1O7L A;  1FP1 D;  1HF0 A;  2W7N A;  4C30 A;  3UNG C;  3N05 A;  4OIP F;  4R1H A;  1Q1H A;  1YG2 A;  2WAQ N;  4XLP F;  1JJ8 C;  2Z9O A;  1ZAR A;  3KPH A;  2LF7 A;  3DKW A;  1ZLK A;  2LRD A;  3V7C A;  1JGG A;  4M3E A;  3RQI A;  1IN8 A;  2DFH A;  3WG7 H;  1WKM A;  3GTQ J;  2HQN A;  4PJM A;  2M8G X;  3OYK A;  3FHZ A;  5DD8 A;  5D4S A;  4GCV A;  1YS6 A;  1TQI A;  3HPH A;  3EDP A;  1R9T J;  3TO6 A;  2MW8 A;  4A0Z A;  1V5G A;  1WJC A;  2XUB A;  3GO5 A;  4Y4R A;  3OYH A;  1K4S A;  5BPD A;  1BBY A;  3G1L A;  1N75 A;  3KEY A;  5CQE A;  2HOS A;  1A04 A;  3CO6 C;  2P7C B;  1SD7 A;  1WCM J;  2P5V A;  4R79 A;  1YLF A;  2GQQ A;  2VJ4 A;  4GRI A;  4WK8 F;  4MEY F;  3MAJ A;  4NNJ A;  5IOZ A;  4U0W A;  1KYZ A;  2JK3 A;  1D0Y A;  4OIO F;  4P5O A;  2MH9 A;  4PCQ A;  2M4K A;  3J81 K;  2OF7 A;  3VB2 A;  4PSX A;  3I53 A;  4BBS J;  3HUG B;  2CUJ A;  3MZ8 A;  3H3U A;  3A0B C;  2GBY A;  1T95 A;  1VND A;  2IAI A;  1TQM A;  2OJE D;  1UG0 A;  2M7B A;  5C3E J;  1L0O C;  1OIS A;  3JTH A;  3GYH X;  4C3H J;  5A2Q R;  2ELK A;  3K1M A;  3ASO H;  3X2Q H;  1G3S A;  2FQ4 A;  3CES A;  1O4X A;  1RQ6 A;  1D5V A;  3J7A W;  4FE7 A;  1FTT A;  2B9S A;  1BOB A;  1J2X A;  4IHT A;  1J59 A;  3WU0 A;  5AIQ A;  3GBG A;  5M5W J;  3AFH A;  1B8I B;  4U7D A;  1YE9 A;  2LNB A;  2COB A;  2O03 A;  2BHZ A;  5IT9 R;  3LSK A;  2K4B A;  3A1Y A;  1I6X A;  1J9I A;  5F08 A;  2X9D A;  1DU6 A;  5K7Z A;  1UMQ A;  1W7P A;  1BW5 A;  2VBY A;  2UWM A;  2XC7 A;  2YU9 J;  2G9W A;  2BYV E;  1U9N A;  3ZRG A;  5F1R A;  1TBX A;  3FWE A;  1BR1 A;  2VQC A;  1FMW A;  1R1T A;  4G8X A;  5E3N A;  3RKQ A;  3TW7 A;  4HST A;  3GTK J;  2H1L A;  2YX7 A;  3ABK H;  3TKY A;  2V9V A;  3TED A;  4RAY A;  2F5V A;  2GXG A;  5E3L A;  2DOA A;  3E1S A;  3LAJ A;  2TCT A;  3HJE A;  1F9N A;  3BY6 A;  1HW2 A;  2ZO4 A;  3RQ4 A;  1VQ7 I;  1IO2 A;  2LMD A;  5FKL A;  3E6C C;  1OR7 A;  2NOJ B;  5DUK A;  4AIH A;  1OFC X;  3BJA A;  4WX9 A;  2WB1 A;  4HF2 A;  2NAZ A;  3G1O A;  5J3L A;  4DBR A;  2QSG X;  4LB6 B;  1ITY A;  1QQI A;  4PSW A;  1HKQ A;  1ON2 A;  3TP3 A;  3FM3 A;  1JTX A;  2R7X A;  2XAF A;  2EIJ H;  3H9Q A;  4JBA A;  3SZG A;  4XBF A;  3VOE A;  1B59 A;  4BHB A;  2QSH X;  3ABL H;  4LJZ F;  1WSU A;  2L4A A;  3QOP A;  1OPC A;  2ELJ A;  1E3H A;  2XIG A;  2JA6 J;  1MMD A;  3KLO A;  1BI2 A;  1OYY A;  3GFJ A;  1FOW A;  5J1U A;  4DGW B;  3AG2 H;  3HOY J;  1LFU P;  4XRF A;  4PJL A;  2CQ7 A;  4LG0 A;  3JRD A;  3TP0 A;  3W2V A;  1T56 A;  1T0F A;  5LBQ A;  1OQY A;  1STZ A;  2CQK A;  3TOB A;  1LUJ B;  2GWR A;  4L5I A;  2ETH A;  1ZKG A;  1YRN A;  2G0E A;  2HTS A;  1CF7 A;  5E3M A;  5M5X J;  4PUS A;  2EIK H;  3GVA A;  4PGH A;  1WFX A;  3PQK A;  4YFK F;  3CC2 I;  2A61 A;  2QZ8 A;  1ETX A;  1ZLJ A;  2QEX I;  3COA C;  1R49 A;  3TDU C;  3WU1 B;  4E7K A;  2E1N A;  1W7P B;  3R60 A;  4RMN A;  2OUM A;  2O8X A;  3DTI A;  2WAF A;  4LK1 F;  3VYT B;  3C7J A;  1LFB A;  3H35 A;  1VQ6 I;  1B8I A;  2L0K A;  3ZMU A;  5B1B H;  1I39 A;  1LDK B;  4XOP A;  5GAD J;  4G6T B;  4E7J A;  3FF5 A;  3BTL A;  1JT6 A;  1MJA A;  1WRJ A;  2I8D A;  4XLH A;  1QHG A;  5B66 C;  4ESF A;  2M4G A;  4G6Q A;  2HQR A;  3OYM A;  1QGP A;  3G4S I;  1ORK A;  4HLY A;  3JRA A;  2ZSH B;  1BC8 C;  1ETY A;  1V55 H;  3QU3 A;  3ZQC A;  2ISY A;  2PMZ N;  2CUE A;  3BTJ A;  3I64 A;  3GX4 X;  3PIP F;  4D7M A;  1OCT C;  5ILU A;  2OCC H;  3QRF F;  1MIJ A;  2DA1 A;  2XAQ A;  4XLC A;  3E7L A;  2E7W A;  3FXR A;  4ENN A;  2FBH A;  2FEZ A;  3CC7 I;  5EZG A;  3ZMV A;  1NG7 A;  1MNE A;  2Y0M A;  1I1G A;  5C44 J;  1PDN C;  3BTI A;  3HXL A;  1GUU A;  4M9X A;  4OMY A;  3P7N A;  1X58 A;  3LQQ A;  2RQP A;  3D5R C;  1FIA A;  3GTO J;  1O3S A;  2XDV A;  5K5Q A;  3OR2 C;  4JX5 A;  2QQ8 A;  4QPQ A;  1YYV A;  3WGG A;  4BAC A;  2Y9Y A;  4KIG A;  2KZV A;  2LY2 A;  1AOY A;  3HEF A;  1X2M A;  2DDB A;  4BJ6 C;  2E1O A;  1JJ6 C;  3K69 A;  1VQ8 I;  3GZN B;  1J0R A;  2XPV A;  4ZZD A;  2PFB A;  4I2O A;  3AAF A;  1U3E M;  4U88 A;  2E1C A;  1OLT A;  3I54 A;  4E7I A;  2FBK A;  3KEQ A;  2KRC A;  1A6I A;  2ID6 A;  3A52 A;  3PQJ A;  5F0F A;  2R7S A;  3CJR B;  3WTV C;  2CH0 A;  2G7U A;  2NVY J;  3GW2 A;  1C0W A;  2DBB A;  1JKO C;  1EH7 A;  3DKX A;  2EWN A;  1BJA A;  2XB5 A;  4G7O F;  2AXL A;  3WOD F;  4A6E A;  4E7Z A;  4IRH A;  2F4I A;  2KRF A;  3FMR A;  4G94 A;  6PAX A;  1RET A;  5A2Q K;  3IAM 2;  2L54 A;  3O2P E;  3VFZ A;  2E19 A;  5F0H A;  3M3Y J;  5IPA A;  5J4V A;  4G6D A;  3G1M A;  3FXM A;  1ZG5 A;  3T0Y A;  3FDY A;  2MGQ A;  3HRS A;  2L9V A;  1POG A;  1W1W E;  2DA5 A;  4EJO A;  2QBY A;  2DT6 A;  3ESW B; 
#chains in the Genus database with same CATH homology
 4BQA A;  5E1Z B;  3BPV A;  2L02 A;  5DEQ A;  2ZME B;  3GFM A;  3BPX A;  4KIB A;  4EMS A;  3R0J A;  2PI0 A;  4JK1 X;  1FBU A;  4NQW A;  2EJR A;  5FD6 A;  5BS6 A;  1JHH A;  1CF7 B;  3CUO A;  3EYY A;  2NNN A;  3FXQ A;  4EV0 A;  3Q9S A;  1RIO H;  4P9U A;  4HX4 A;  3I4P A;  2VBZ A;  2O61 A;  4OU0 A;  2OZU A;  2QQA A;  2M5W A;  2D1V A;  3L9F A;  4KIC A;  4ZYH A;  3DP7 A;  1BI1 A;  3RKX A;  1ONV A;  4MNU A;  5HS9 A;  2ZBK A;  3ZQ7 A;  1BIB A;  1ZRC A;  2BBY A;  2M8E A;  3K1N A;  5CVU A;  2BGC A;  4WCG A;  2HFH A;  2PEX A;  2Z33 A;  3DQV C;  5L3D A;  1HBX G;  1P2F A;  3LFK A;  2P6T A;  1KQ8 A;  3IRR A;  3T8R A;  2OA4 A;  2RGV A;  2HDC A;  3FXU A;  1WWX A;  3KP6 A;  3N97 A;  1FSH A;  2MA3 A;  4M74 A;  4M9Z A;  4UNO A;  1IXS B;  4LB5 A;  3M1E A;  2FNP A;  4YG2 F;  3JAM Z;  3SZT A;  1FC3 A;  2XVC A;  3V8J A;  2K86 A;  4L5J A;  2C6Y A;  5ILS A;  4OIN F;  2D2W A;  3MCZ A;  1FYL A;  1HST A;  3WTS C;  3KP3 A;  1K79 A;  1G3W A;  1S8N A;  1BC7 C;  5EEG A;  3IWZ A;  1BIA A;  4IHS A;  3HYI A;  1XDS A;  1ZAO A;  3SZP A;  1P92 A;  1ODD A;  3P9I A;  2OQR A;  3I5U A;  3IWF A;  4BHP A;  2DW4 A;  2GA2 A;  5F6F A;  1LVA A;  3CUQ C;  5HS8 A;  4Y15 A;  2VC0 A;  1KU7 A;  4I0A A;  2FE3 A;  1RUO A;  4YII A;  2A07 F;  4R8H A;  1DPR A;  1GXP A;  1Y0U A;  2PMH A;  4UVB A;  1SD4 A;  2EFO A;  5H6R A;  1KQ9 A;  2VT3 A;  2L01 A;  3Q9V A;  4Q47 A;  2UXN A;  3GUD A;  3H92 A;  4I0B A;  2CWE A;  5DV5 A;  4HQE A;  2ISZ A;  3V7S A;  2K7L A;  3QU6 A;  1BOA A;  1G4D A;  5JVT A;  1U6G A;  3L00 A;  3OV8 A;  4HYE A;  2Q0O A;  2HYF A;  2QVO A;  3CJN A;  5A2Q Z;  1FZP B;  1O7F A;  3RYP A;  5D6E A;  4PDK A;  5CJ9 A;  4EQQ A;  5J6X A;  3ZPL A;  1W5T A;  1E2X A;  2KIM A;  2WV0 A;  3NRV A;  4HDU A;  1UHW A;  4S05 A;  2FA5 A;  2H6B A;  4WXD A;  4AWX B;  4F7Z A;  4Y13 A;  1P4W A;  3HOT A;  4RB2 C;  3S2W A;  3BRO A;  2QBY B;  2OZ6 A;  2STT A;  3G73 A;  2K4J A;  2COM A;  1U2W A;  3GEZ A;  2A68 F;  5LRR A;  2PQ8 A;  1YFH A;  1DPU A;  2EFW A;  5D5V B;  1IN7 A;  3F21 A;  4O3M A;  1UHM A;  4AD9 A;  3CUQ A;  3DPT A;  4B8X A;  4IF4 A;  3I0T A;  5D6F A;  2P5L C;  2XKO A;  4M6Y A;  2QEN A;  4A5M A;  1JE8 A;  2W84 A;  1IW7 F;  1WI9 A;  3WTZ A;  1MD0 A;  2VT2 A;  3KET A;  3ZMS A;  5DDG A;  3WTX C;  2DQL A;  3GLX A;  1AWC A;  4MQ9 F;  4L9J A;  3K1P A;  5CLS A;  3QP6 A;  4CGZ A;  4L18 B;  2H09 A;  3MZY A;  2PLY A;  4MEX F;  2X0L A;  3DPL C;  3FMS A;  3LQR A;  3HHH A;  3F72 A;  1S29 A;  3C1D A;  2BEO A;  3RKW A;  3FZV A;  1E17 A;  3CUQ B;  3IKV A;  1T39 A;  5CVV A;  4DQ2 A;  1K78 B;  2FU4 A;  1NHA A;  2JRT A;  2O6G E;  2FMY A;  3IL2 A;  2ZNY A;  4OMZ A;  2H6C A;  4I01 A;  1UB9 A;  3T5X A;  3K9T A;  4HLX A;  4ENK A;  4D0P A;  1HW5 A;  1D3Y A;  5LLQ A;  1IZ1 A;  3RIR A;  3WGH A;  1YW8 A;  3Q5F A;  1L3L A;  2ZNZ A;  1SMT A;  3J80 K;  3LA2 A;  3E5X A;  1ZYR F;  4UV9 A;  4NHJ A;  4IRI A;  2DK8 A;  2GXB A;  3QAH A;  3WTY C;  3FX3 A;  1G3T A;  1LNW A;  5LGN A;  3ECH A;  1FSE A;  4RGR A;  1MJB A;  2L3D A;  5KK1 A;  4JQF A;  3O3K A;  2A3S A;  4Y17 A;  4Q4Z F;  2XAG A;  5CYV A;  1JGS A;  3HOS A;  1SMY F;  4BYY A;  2LDU A;  4RAZ A;  2F5D A;  4A5N A;  4G7Z F;  2ZJ2 A;  3HSR A;  2M45 A;  1S6L A;  4RB0 A;  1MDM A;  3HRM A;  2OAZ A;  5TRD A;  5L3C A;  3IKT A;  2QQ9 A;  4EM2 A;  2KJC A;  1RI7 A;  3C18 A;  1YW7 A;  4OIR F;  4LFU A;  5L3F A;  4U7B A;  4M6X A;  5TJJ A;  3ABT A;  4LG0 B;  5BMZ A;  4BAY A;  1IXR C;  2MLG A;  4IPA A;  1SFE A;  2CG4 A;  3WE2 A;  4ZYE A;  4KMF A;  1SD5 A;  3K0L A;  4L9V A;  5FO5 A;  3F8M A;  4QLC U;  1LJ9 A;  3RKY A;  1P4A A;  4EJT A;  3JSO A;  4M73 A;  3MWM A;  2FF4 A;  1XMA A;  2OU2 A;  4M9S A;  1ULY A;  1IXC A;  2IA2 A;  2VOP A;  1X3U A;  3E5Q A;  1XDU A;  4ZH4 F;  1B9M A;  1ON1 A;  5E1W A;  1MZB A;  2XGX A;  2R7D A;  1XGM A;  3ELK A;  4RGS A;  4IRG A;  2EFQ A;  2YU3 A;  2DAO A;  1Z6R A;  2VXZ A;  5LGU A;  4GYI A;  1R36 A;  3FMQ A;  2IRF G;  3V7R A;  2CW0 F;  5HOO A;  2PN6 A;  3JW4 A;  2IA0 A;  5HDK A;  1TNT A;  1IRF A;  3ISP A;  3RTR A;  3LA3 A;  3L2C A;  1HKT A;  2LKP A;  3EQL F;  4QWQ A;  3I58 A;  2ESN A;  1QPM A;  4M71 A;  5E18 F;  2QWW A;  2P5K A;  1HQC A;  2RN7 A;  1G6N A;  4P55 A;  2A6H F;  1DP7 P;  1UFM A;  2HGC A;  4EVI A;  3TO7 A;  5JI6 A;  1J7K A;  4CO8 A;  5HDG A;  1OYW A;  1U78 A;  3KE2 A;  3VEP A;  2CO5 A;  4UXN A;  1IUY A;  4KN4 X;  1I1S A;  1YTY A;  3U2R A;  4ZYD A;  1ZG3 A;  5JR3 A;  4BH9 A;  2OBP A;  3GF2 A;  2Z99 A;  2DPU A;  2R7F A;  4EGY A;  2XAJ A;  4MHG A;  1R5H A;  1YQA A;  3I71 A;  2EV5 A;  3M8E A;  1TTY A;  5D8L B;  5ERI A;  3J81 Z;  1U8R A;  1F4K A;  1XGS A;  3QPH A;  2HWV A;  2KIU A;  3IC7 A;  1O3T A;  4TV7 A;  1RZ4 A;  3B02 A;  4KIF A;  3CDH A;  4MQV A;  4KFC A;  3MZH A;  3R61 A;  4O6J A;  1LDD A;  3LAP A;  2IW5 A;  3WTU C;  2XAS A;  3IHU A;  4CXF A;  1XSV A;  3O6B B;  1OMI A;  5J8C A;  3ZMT A;  1PP8 F;  1ZRE A;  1SD6 A;  3F6O A;  1SFU A;  4CHU A;  4HV5 A;  1XCV A;  2P6S A;  1I5Z A;  5LHG A;  2MLK A;  1MJ9 A;  3F8N A;  3F8B A;  3REO A;  2PBI A;  1TQP A;  3IRQ A;  4MTE A;  5DYM A;  1XMK A;  4WXH A;  2DK5 A;  1H0M A;  2H94 A;  1JHF A;  2GA1 A;  5DD4 A;  4KNY A;  1XCB A;  1PP7 U;  1KQ0 A;  4A0X A;  2FNA A;  2KKO A;  4FT8 A;  2CFX A;  4MTD A;  2MBF A;  1JXS A;  4S04 A;  2LSO A;  2M87 A;  1YS7 A;  5D8K B;  1FNN A;  4FX4 A;  3WE3 A;  2A5Y B;  3HRU A;  2VC1 A;  2ESH A;  4PZJ A;  3F23 A;  1BN5 A;  2P7V B;  2IP2 A;  2QUF A;  4RS8 A;  2R3S A;  4P96 A;  2IT0 A;  2Z5U A;  3HTU A;  3KZZ A;  4L0Z B;  1R1V A;  3E6B A;  4E70 A;  2EV6 A;  2DI3 A;  2DT5 A;  5ICC A;  5K5R A;  3WG9 A;  2DTR A;  1DDN A;  1P4X A;  4ZYG A;  3WTT C;  4A0Y A;  2FML A;  4IXA A;  1K78 A;  2M1B A;  4HOB A;  2DPD A;  5ICF A;  2P4W A;  1P6R A;  3FM5 A;  4HA8 A;  1YO5 C;  4RB3 C;  1XSD A;  1KYW A;  3MQ0 A;  1W4M A;  5ILV A;  1R7J A;  1K7A A;  2VOO A;  3SHF A;  2H27 A;  2Z3Y A;  3V8K A;  3BOQ A;  1USS A;  4ESJ A;  1F1Z A;  3DV8 A;  1FWZ A;  3OOP A;  4GXO A;  1MGT A;  5IT9 K;  5LHH A;  1IAW A;  2HZT A;  3KLN A;  3H3Z A;  3SQN A;  3ROU A;  5DCM B;  3RDI A;  2FRH A;  1Z1D A;  5K5O A;  4HQM A;  1F5T A;  2VOD A;  4I7H A;  3GFL A;  1T98 A;  3BJ6 A;  3RPU A;  2YX4 A;  3DEU A;  4OIQ F;  1ZGA A;  5D5U B;  1ZRD A;  2LF8 A;  4HV6 A;  1EH8 A;  3W6J B;  1KGS A;  4XSX F;  2HOE A;  3R0A A;  4P9F A;  5E20 A;  2CGP A;  2HEO A;  2P8T A;  5HDN A;  5LGT A;  3KP2 A;  3LWF A;  3V8L A;  2IPQ X;  2HKX A;  2ACJ A;  1YW9 A;  2BV6 A;  2ZCW A;  3HRT A;  3I59 A;  2VN2 A;  2VBX A;  1FPQ A;  1OKR A;  3RPQ A;  3DFG A;  3BZ6 A;  1XN7 A;  1KA8 A;  2EA2 A;  4L9T A;  4HX8 A;  1O3Q A;  2IJL A;  2Q2E A;  3W6K B;  5ED4 A;  2BE5 F;  2CSO A;  4L9N A;  3ZMD A;  1ZH5 A;  2HKO A;  1OYI A;  1Z05 A;  5LEJ A;  5AIP A;  4ESB A;  5E8G A;  2PMU A;  2UXX A;  3TDZ C;  1XD7 A;  3M8F A;  4LD5 A;  2V6C A;  2ELH A;  2OD5 A;  1ZN2 A;  3TO9 A;  4FX0 A;  1FLI A;  3WGI A;  1ZRF A;  3ZMZ A;  3DF8 A;  2XHK A;  4EM0 B;  4XLN F;  1J75 A;  1B9N A;  3MFK A;  3KP7 A;  4UVA A;  2RC4 A;  1EH6 A;  2TDX A;  1O3R A;  3ZN0 A;  2JTV A;  2VBW A;  1Z91 A;  2Y75 A;  4WF2 A;  3KCC A;  3BJO A;  4LLG F;  4LGW A;  4L0Y B;  2W57 A;  4WWC A;  4AVP A;  1FOK A;  3PFI A;  2W25 A;  2FXA A;  4M72 A;  3ECO A;  4ENM A;  2F5C A;  1UST A;  2A69 F;  1G3Y A;  1RUN A;  1IN5 A;  5HLG A;  4EM1 A;  2CYY A;  1LEA A;  2O3F A;  5BQT A;  3RYR A;  1XGO A;  2RV8 A;  2MH2 A;  4ZZL A;  4KYW A;  4HW0 A;  5FGM A;  1SFX A;  2D1H A;  1UCR A;  4PGG A;  5E8I A;  1T2K A;  3ABU A;  2KIF A;  2ZFW A;  1R00 A;  2IVM A;  4N9H A;  2OQG A;  2QQB A;  4XSZ F;  1WQ2 A;  2G7H A;  1B1B A;  4ENJ A;  1KU3 A;  5CVJ A;  3JAM K;  5KVR A;  1LB2 A;  3GZ5 A;  4KMU X;  4KDP A;  4HF1 A;  3KP5 A;  4H0E A;  2IA1 A;  2V1D A;  5IT9 Z;  3EUH A;  4I02 A;  2NNY A;  3BP8 A;  1KU2 A;  1QBJ A;  1T38 A;  1HKS A;  1Z9C A;  4AIJ A;  3P9K A;  1ZG1 A;  3R6S A;  2F2E A;  2HTJ A;  2YR2 A;  2V79 A;  4ON0 A;  3E3V A;  2WC2 A;  2W24 A;  3M9A A;  5L3G A;  4HDV A;  4YIF A;  3J80 Z;  1HSJ A;  5FB2 A;  2FSW A;  1H9T A;  5L3B A;  2KJB A;  4YFX F;  5FD5 A;  1ZHF A;  5K1Y A;  3L09 A;  1FYM A;  2DQR A;  4YFN F;  3F3X A;  1R58 A;  1B4A A;  1H9G A;  2JSC A;  4AIK A;  3NQO A;  1FBQ A;  4B09 A;  2JT1 A;  5HS7 A;  1GXQ A;  2Y48 A;  1XB4 A;  5HVQ C;  1W7P D;  2XRN A;  3C3W A;  5L3E A;  3TGN A;  2W85 A;  1R22 A;  1B6A A;  1QZY A;  4LK0 F;  3TOA A;  1EV7 A;  1U5T B;  2XRO A;  3JTG A;  3DXJ F;  2EFP A;  3SXY A;  3CTA A;  1XSX A;  3GXO A;  2QYO A;  1FT9 A;  3GFI A;  3L7W A;  5ICE A;  2M30 A;  2ZKZ A;  2QLZ A;  3WTW C;  4N0B A;  1HXD A;  2JZY A;  1MDM B;  3ERE D;  4LLL A;  1Z7U A;  1J5Y A;  3HSE A;  4RB1 A;  1FX7 A;  2K27 A;  5E1X A;  3I59 B;  3RI4 A;  2A6E F;  5H20 A;  3F8F A;  3KZY A;  2RVC A;  1IN6 A;  3QP5 A;  4U0V A;  1FP2 A;  5J8F A;  4O5V A;  1XGN A;  1T6S A;  1FBS A;  1YIO A;  3M7G A;  5BOX A;  5LRS A;  4BNC A;  4KUM A;  4LMY A;  4A12 A;  1ZGJ A;  2J5O A;  2L4M A;  1K6O A;  3T8T A;  2WTE A;  3G3Z A;  2DLL A;  4N9I A;  4HF0 A;  4I09 A;  3HHG A;  2UZK A;  2YPR A;  5DCF A;  1TLH B;  4EJV A;  2EB7 A;  4Q48 A;  1U5T C;  5EEH A;  2MC3 A;  2VE8 A;  5FLX Z;  3HUG A;  2XAH A;  4UV8 A;  1BM9 A;  2FOK A;  1IRG A;  5DCM A;  5FLX K;  2EFN A;  2ADU A;  2YSR A;  4I98 B;  4KN7 X;  2VE9 A;  1QZZ A;  1S3J A;  1PUE E;  2EK5 A;  4ASN A;  5IT3 A;  4CYD A;  1O57 A;  5AON A;  4IVN A;  4BXU A;  3LA7 A;  1FYK A;  2QM3 A;  5CVI A;  3ULQ B;  5BPI A;  5JFR A;  4UUV A;  2EA4 A;  4WXC A;  4K2E A;  4GYG A;  3E6M A;  4UHT A;  2EV0 A;  3GWZ A;  4KT5 C;  4HBL A;  2GZW A;  2NYX A;  2F5E A;  5CVR A;  2NS0 A;  2XKP A;  1GHC A;  2FBI A;  1D8K A;  1GVJ A;  1FY7 A;  2DU9 A;  2XV4 S;  2HR3 A;  4CZZ A;  3TQN A;  3E97 A;  1QNT A;  1V3F A;  3K2Z A;  2DO7 A;  3B73 A;  2AS5 F;  4ETS A;  3NEU A;  5HLH A;  5F64 A;  2RKH A;  3ZN1 A;  1REP C;  1LEB A;  2ZME A;  3JSP A;  4OOI A;  5FFX A;  2E7X A;  2PJP A;  1KU9 A;  4MGR A;  3HIF A;  2B0L A;  1TNS A;  4A6D A;  3J7A O;  1U5T A;  3KP4 A;  3F6V A;  2V1X A;  5D5X B;  4GO1 A;  1S7A A;  5FFZ A;  5LHI A;  4LLN A;  2DFI A;  2VON A;  5E17 F;  3F22 A;  3HTS B;  2PG4 A;  3V4G A;  2JPB A;  1I27 A;  2Q8K A;  1D8J A;  3BWG A;  1IF1 A;  1Z6T A;  3F8C A;  5ICG A;  1BI0 A;  3CO7 C;  1BI3 A;  1R23 A;  4U0Y A;  4FHT A;  3KFW X;  4Q5S F;  4CDG A;  2STW A;  3U9G A;  1V4R A;  1TW2 A;  2MD5 A;  4G9Y A;  4IJA A;  4CIC A;  5LEK A;  1CGP A;  3VOD A;  3HSF A;  2O0Y A;  5H6Q A;  3U1D A;  3E6D A;  1HW1 A;  3CLO A;  3MEX A;  5HLI A;  2RDP A;  1LDJ A;  4EJU A;  3GZ6 A;  2X4H A;  5D4R A;  1R5G A;  3KEO A;  1DUX C;  1R1U A;  1QO0 D;  3D0S A;  1SAX A;  3E5U A;  5D5W B;  3EYI A;  3RJP A;  4EGZ A;  3T1B A;  3D5L A;  2D45 A;  2JPC A;  1MKM A;  4EJW A;  4UVC A;  1VTN C;  1RNL A;  2NRA C;  3P9C A;  2K02 A;  2WWY A;  2ZXJ A;  2HYG D;  4A2U A;  3ZP5 A;  2J5P A;  3R4K A;  1W5S A;  5DUI A;  4Z2Y A;  2RNJ A;  2HS5 A;  4G7H F;  1IN4 A;  4HX7 A;  4HAM A;  4RGU A;  4BHC A;  4NB5 A;  3LST A;  2FQ3 A;  1TW3 A;  1S7O A;  3ML6 A;  3BDD A;  3SFZ A;  2F5F A;  2V1U A;  4RGX A;  3N4M A;  2GAU A;  4HZF A;  1LQ1 A;  4KA4 A;  3QPT A;  4DNC A;  4GGG A;  5JHU A;  3EET A;  2GIV A;  1O7L A;  1FP1 D;  4OIP F;  4R1H A;  1Q1H A;  1YG2 A;  4XLP F;  2Z9O A;  1ZAR A;  2LF7 A;  3DKW A;  1ZLK A;  3V7C A;  1IN8 A;  1WKM A;  2HQN A;  3FHZ A;  5DD8 A;  5D4S A;  4GCV A;  1YS6 A;  1TQI A;  3EDP A;  3TO6 A;  4A0Z A;  2XUB A;  3GO5 A;  5BPD A;  1BBY A;  1A04 A;  3CO6 C;  2P7C B;  1SD7 A;  2P5V A;  4R79 A;  1YLF A;  2GQQ A;  4WK8 F;  4MEY F;  3MAJ A;  4U0W A;  1KYZ A;  4OIO F;  4P5O A;  2MH9 A;  4PCQ A;  3J81 K;  3VB2 A;  3I53 A;  3H3U A;  1TQM A;  1L0O C;  3JTH A;  3GYH X;  3K1M A;  1G3S A;  1D5V A;  4IHT A;  1J2X A;  1J59 A;  3WU0 A;  5AIQ A;  4U7D A;  2LNB A;  2O03 A;  2K4B A;  1I6X A;  1J9I A;  1W7P A;  2VBY A;  2UWM A;  2G9W A;  2BYV E;  5F1R A;  1TBX A;  3FWE A;  1R1T A;  4G8X A;  2YX7 A;  3TKY A;  2V9V A;  4RAY A;  2GXG A;  3LAJ A;  1F9N A;  3BY6 A;  1HW2 A;  2ZO4 A;  3E6C C;  1OR7 A;  5DUK A;  4AIH A;  3BJA A;  4WX9 A;  4HF2 A;  2NAZ A;  4LB6 B;  1QQI A;  1HKQ A;  1ON2 A;  3FM3 A;  2XAF A;  4JBA A;  4XBF A;  3VOE A;  1B59 A;  4BHB A;  4LJZ F;  1WSU A;  2L4A A;  3QOP A;  1OPC A;  2XIG A;  3KLO A;  1BI2 A;  1OYY A;  3GFJ A;  4XRF A;  4LG0 A;  1T0F A;  5LBQ A;  1STZ A;  2CQK A;  3TOB A;  2GWR A;  4L5I A;  2ETH A;  2HTS A;  1CF7 A;  4PGH A;  3GVA A;  3PQK A;  4YFK F;  2A61 A;  2QZ8 A;  1ZLJ A;  3COA C;  3TDU C;  3WU1 B;  2E1N A;  1W7P B;  3R60 A;  2O8X A;  4LK1 F;  3C7J A;  3ZMU A;  1LDK B;  3FF5 A;  1MJA A;  1WRJ A;  4ESF A;  4G6Q A;  2HQR A;  4HLY A;  1QGP A;  1BC8 C;  3QU3 A;  2ISY A;  3I64 A;  3GX4 X;  5ILU A;  3QRF F;  2XAQ A;  3FXR A;  2E7W A;  4ENN A;  2FBH A;  2FEZ A;  3ZMV A;  2Y0M A;  1I1G A;  1PDN C;  4OMY A;  4M9X A;  3P7N A;  3LQQ A;  2RQP A;  1O3S A;  5K5Q A;  1YYV A;  3WGG A;  4KIG A;  1AOY A;  3K69 A;  1J0R A;  4ZZD A;  2PFB A;  4I2O A;  3AAF A;  1U3E M;  4U88 A;  2E1C A;  3I54 A;  2FBK A;  3KEQ A;  3PQJ A;  3WTV C;  3GW2 A;  2G7U A;  1C0W A;  2DBB A;  1EH7 A;  2EWN A;  1BJA A;  4G7O F;  2AXL A;  3WOD F;  4A6E A;  4IRH A;  2KRF A;  3FMR A;  4G94 A;  6PAX A;  5A2Q K;  2L54 A;  3O2P E;  3VFZ A;  4G6D A;  1ZG5 A;  3T0Y A;  3HRS A;  4EJO A;  2QBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...