2EV0A

Bacillus subtilis manganese transport regulator (mntr) bound to cadmium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
135
structure length
131
Chain Sequence
b'TTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 51
structure length 131
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev0A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev0A02
1B59A 1W7PD 1XGOA 3M8EA 2G7HA 5A2QK 1SD7A 1HBXG 4A12A 1H0MA 3GO5A 3O6BB 2XAFA 1U5TB 1XB4A 3BJ6A 5JI6A 2ZO4A 1UHWA 2Z3YA 1MJAA 2RNJA 4Q4ZF 1XDSA 5CVUA 2PN6A 4M73A 2IW5A 2GA1A 4LK0F 4G6DA 4WCGA 3KCCA 4XSZF 5DEQA 3MCZA 1R5GA 1X3UA 2VXZA 1W5TA 3HRUA 2DW4A 3I4PA 3IHUA 3J80K 3JSPA 2V1UA 2MBFA 4R8HA 1Z91A 4IVNA 2HTSA 4S04A 4NQWA 4I98B 2QZ8A 2L3DA 2UXXA 3RTRA 3KP3A 1D8JA 4P9UA 1ONVA 5BQTA 4IF4A 5AONA 1R36A 3QU3A 2PG4A 4I7HA 2V1DA 5KK1A 5LLQA 5FFZA 1XSXA 3GFLA 1G6NA 1DPRA 4BH9A 1TLHB 3U2RA 3KP4A 1LB2A 3ZMUA 1KQ0A 1QO0D 3O3KA 5D5WB 2RVCA 4GO1A 4I2OA 2V9VA 3WTSC 1FY7A 3M8FA 1BI3A 2RN7A 2G9WA 2HS5A 2DQLA 4L9TA 2IT0A 2W85A 4EM1A 3FHZA 3MWMA 5LHGA 2VBZA 3LA7A 4Q5SF 1RI7A 2QQAA 4L9NA 1T38A 3C3WA 4WF2A 3RDIA 2O6GE 4N0BA 2K02A 4LLNA 4U0VA 4UVCA 2Z5UA 3V7CA 3GUDA 2GAUA 1P4AA 4MHGA 2A69F 3RKWA 4RB2C 1KGSA 4PGGA 5ICEA 1U5TC 2FMYA 4LB6B 1U3EM 1IAWA 4IRIA 1LJ9A 3V4GA 4LK1F 3G3ZA 2HR3A 3KE2A 1T39A 3C1DA 1V4RA 4OIQF 5FLXK 3CUQA 2WV0A 4ESJA 3L00A 3WU0A 4JQFA 2FA5A 3IKVA 2IRFG 5E8GA 1XMAA 2MC3A 2P5VA 3W6KB 2Z9OA 2D1VA 2GZWA 1ZGJA 2WWYA 3VOEA 1XCVA 1ZYRF 1Z6TA 5HLIA 5TRDA 3DPLC 2ETHA 3F8BA 2BYVE 2KIUA 2W84A 4MQVA 1G4DA 5IT9Z 2PLYA 1RUNA 3EUHA 1ZGAA 5DCMA 1J9IA 2CO5A 1WKMA 3HUGA 1T0FA 4M72A 3EYYA 1IUYA 1TQMA 2EV6A 3Q9SA 2BBYA 5J8FA 3HTSB 2A5YB 3CUQB 1FBSA 2XKOA 3RKXA 3WTVC 2WC2A 4WXCA 2VC0A 2P7VB 1DDNA 3V8LA 4P55A 1ZRFA 3V7RA 5J8CA 4CZZA 2HQNA 2X0LA 3ZMVA 5HVQC 2LKPA 2IA2A 1Z7UA 1TBXA 3SHFA 3GFIA 3S2WA 3DKWA 4AD9A 1KQ9A 2D1HA 4BNCA 3SXYA 4BHBA 2XAGA 5E1XA 2L01A 1VTNC 1UHMA 4A6EA 5HLHA 3ZMDA 1I5ZA 1K6OA 3T0YA 3CJNA 1FT9A 3F3XA 1EH8A 5D4SA 3F6VA 1H9GA 3ZN0A 1L0OC 1S29A 3F8FA 3K9TA 2FE3A 3KETA 2H6BA 3IWZA 4RGUA 3V7SA 1S6LA 4D0PA 2CFXA 3FX3A 1GXPA 2HEOA 1WQ2A 2A68F 2EJRA 2QENA 3F8NA 3Q9VA 4IHSA 1L3LA 4G9YA 2LSOA 1OMIA 2OZUA 1BOAA 4ASNA 2FF4A 3HIFA 4AWXB 1Q1HA 1FP1D 2OZ6A 5DD8A 2GXGA 1ON2A 2YU3A 2XVCA 3JSOA 4KFCA 1YS6A 3WGHA 3K1MA 1ZRCA 3F72A 2QUFA 1SFUA 1ZLKA 1JGSA 4L9JA 4WX9A 5F1RA 3I64A 4HLXA 3L09A 5ICGA 4QWQA 4FT8A 5KVRA 2DK5A 4HF2A 1U8RA 1Z1DA 5HDNA 3K1PA 4KMFA 2ESHA 1V3FA 4FX4A 3HRSA 4F7ZA 3TQNA 1R1UA 3GFJA 5LGUA 1RNLA 4MTEA 5D5VB 4S05A 4LMYA 1O7LA 5E8IA 1TQPA 2L54A 1DP7P 3L2CA 3U1DA 5BMZA 2PJPA 5D8LB 4G7HF 4NHJA 1JXSA 2O0YA 1RZ4A 2JSCA 2JPBA 4ENNA 1U78A 3F22A 2E1CA 5A2QZ 2QQBA 1ZN2A 2F5CA 2A3SA 3GZ5A 2M30A 4AVPA 2FXAA 3ELKA 1NHAA 4HDUA 1USSA 4M6YA 3WTTC 3B02A 4RB0A 5E20A 2ZMEA 2M8EA 4G6QA 3IL2A 1KU9A 3F21A 3HHHA 5K5QA 4U7DA 2K4BA 3BJAA 1MDMA 3COAC 3I59A 1CF7B 3J80Z 4L0YB 4ZH4F 3LFKA 2P4WA 1T98A 3T1BA 4EJTA 3WGIA 5ERIA 1ZHFA 2IA1A 2X4HA 1LQ1A 3K2ZA 1J59A 1IN7A 4A0ZA 5ILUA 2HGCA 4PDKA 3F8CA 3ISPA 3HOSA 4IHTA 5HDKA 2XIGA 1K7AA 1PUEE 2MD5A 2ESNA 5FO5A 4H0EA 2AXLA 3IWFA 1A04A 1FP2A 2HWVA 2PQ8A 1IRFA 2V6CA 3GVAA 1J5YA 4OMZA 3TDZC 5J6XA 4O5VA 2DT5A 2XUBA 1UCRA 2PI0A 1JHFA 5DYMA 1IF1A 3H92A 3FMQA 4GYGA 3ZP5A 1PP8F 1F1ZA 1XCBA 4Z2YA 3T8TA 1QZZA 5L3DA 4A0XA 1YTYA 1FBQA 3G73A 5TJJA 4KIBA 5IT3A 4HQMA 2NS0A 2FEZA 4MNUA 2LF8A 3ZQ7A 2E7XA 4XRFA 4EVIA 4HV5A 3FXRA 6PAXA 5JHUA 4WXHA 3TO7A 5FLXZ 4AIJA 2W24A 4EJOA 2MA3A 4U7BA 2CW0F 3FXUA 5HS8A 4OIOF 5D6FA 2Q8KA 1USTA 3TGNA 1J7KA 1YFHA 1XSDA 3V8KA 2DI3A 3GLXA 2PBIA 3OOPA 2FU4A 3VFZA 3HHGA 1BBYA 5E1WA 1EH6A 1HW1A 3F6OA 2ZNYA 1KU3A 2UWMA 4ZZLA 2FMLA 2OU2A 3ROUA 4ENKA 3R6SA 1S7OA 1D3YA 2Z33A 2EFOA 2FQ3A 3E6MA 4KUMA 3EYIA 4LB5A 3HOTA 2MLGA 1XGMA 1IXSB 3CLOA 2LF7A 2XROA 4CXFA 5HDGA 2JTVA 2DK8A 2PFBA 4XLPF 4DQ2A 2CGPA 1ODDA 4WK8F 4EM0B 4OMYA 4WXDA 2O3FA 2GIVA 2VBWA 5DV5A 2UZKA 4Y17A 1FSHA 1DUXC 2EV0A 1FPQA 3R4KA 2STWA 4HOBA 1IN5A 3E6CC 5AIQA 1G3SA 2IVMA 3LSTA 1IW7F 5BPDA 3RJPA 2PMHA 1WWXA 2R7FA 1RUOA 2EFQA 2OQRA 5FD6A 3SQNA 2DU9A 4MEXF 5L3EA 1BI2A 4OIPF 1XGSA 1Z05A 5DUKA 2R3SA 3QPTA 5CVJA 4BHCA 3N97A 5DD4A 1JE8A 2Y75A 3M7GA 1ON1A 4HF0A 2RKHA 4YIFA 3B73A 2EFWA 4A0YA 2XAJA 1O3SA 2YR2A 4HLYA 3BPXA 3QAHA 4QLCU 2P5LC 4HQEA 1UFMA 4RB3C 4OINF 4UVBA 1OPCA 4BAYA 3KEOA 1FSEA 5JVTA 4ENMA 3KP7A 5ILVA 4YFKF 2QWWA 4JBAA 2GA2A 2STTA 4KNYA 2JZYA 1HSTA 5FB2A 2R7DA 3E5QA 5D6EA 3GW2A 1QZYA 3R61A 5ED4A 1TNSA 1TNTA 1BI1A 1TW2A 3JW4A 1P6RA 1R1TA 3ABUA 4IJAA 3H3UA 5CJ9A 2OBPA 4TV7A 2DLLA 5CVIA 1TQIA 1T2KA 1R23A 4LJZF 3C7JA 3WTUC 3ZMSA 2OQGA 5E18F 2FOKA 2IP2A 2A61A 1I1SA 1IN8A 1CGPA 2YX7A 1O3TA 1F9NA 1LNWA 5HS9A 2CG4A 3D5LA 2ELHA 1FBUA 2OA4A 1MZBA 3WTWC 2XHKA 4CDGA 3HRMA 4R79A 2HKXA 3DFGA 1EH7A 1E2XA 5D8KB 2P7CB 2L4AA 1GXQA 2P6TA 1FOKA 2H94A 1YLFA 2F5DA 4AIKA 2ISZA 4HX7A 4KN7X 4ON0A 4HZFA 2ISYA 2QYOA 3HTUA 2M87A 5DCMB 1G3WA 4UV8A 2RV8A 2L02A 3IC7A 2OD5A 4RGSA 2KJCA 1IXCA 3C18A 1MD0A 1PDNC 2EB7A 3J81K 1TTYA 2EFPA 4IXAA 5LEKA 4I0BA 3F23A 4XLNF 1EV7A 4JK1X 2VC1A 3IKTA 4HF1A 3O2PE 2HZTA 3FM3A 3PQJA 3QPHA 3BP8A 1YYVA 3BDDA 3ZPLA 2KJBA 4P9FA 3KP5A 4KA4A 1GVJA 2NYXA 2RC4A 1I6XA 1I1GA 4ETSA 4O3MA 2CQKA 3FM5A 1LDKB 2QBYA 2Y48A 3OV8A 4ESFA 1ZG5A 3MEXA 3CUQC 4FX0A 1K78A 3FWEA 3WG9A 3GF2A 4HX4A 4UUVA 5H6QA 1KYZA 4G94A 1R1VA 3JTHA 1BN5A 2M5WA 1IN4A 4M9ZA 3LWFA 4A5NA 3JAMK 2JRTA 4UVAA 3RPQA 5LBQA 1FWZA 4HYEA 1SFEA 2DO7A 5F6FA 1K78B 3DPTA 5FGMA 4KICA 1LDDA 4KDPA 3F8MA 3BOQA 2O03A 1C0WA 3BWGA 1SMTA 1KU2A 3L9FA 1IN6A 3V8JA 2E1NA 3QP6A 1LEBA 2FNPA 3LAPA 2F5FA 4HX8A 2P8TA 4UV9A 1WRJA 3E5XA 4L18B 1XN7A 5LGTA 1E17A 1W4MA 2BEOA 4IPAA 1SFXA 1FYKA 4OU0A 4HBLA 4K2EA 2YSRA 3I58A 2HDCA 3ZMZA 4CICA 2KKOA 3J7AO 3NEUA 3FF5A 1W7PA 2PEXA 3KP2A 3RYRA 3WU1B 2D2WA 3H3ZA 5ICCA 2VOPA 1B6AA 1P4XA 5FFXA 3LQRA 5BPIA 4KMUX 1LDJA 3KP6A 1QGPA 1UB9A 1S8NA 2YPRA 4Q47A 2ZMEB 5CLSA 2RDPA 1RIOH 1SD4A 4HV6A 4RB1A 1FZPB 3M1EA 2Z99A 2ZJ2A 1OYWA 4LD5A 2E7WA 2NNYA 2OAZA 5DCFA 2UXNA 1MDMB 3I59B 4I0AA 1YIOA 2HFHA 2J5PA 4M9SA 1IRGA 1FYMA 3CO6C 4P5OA 4CYDA 4I01A 1DPUA 1BIBA 5L3BA 1YW7A 2GQQA 3SZTA 2ZNZA 2FSWA 5CVRA 1ZARA 2ACJA 3WGGA 1HKQA 1BC7C 3ERED 1O7FA 3TO6A 2EA2A 2H6CA 3BY6A 4O6JA 2YX4A 3HSFA 3QOPA 2QVOA 1AOYA 4LGWA 1ZRDA 4YIIA 3AAFA 1S7AA 4CGZA 1TW3A 2CSOA 1OYIA 4DNCA 3ABTA 4EQQA 3LAJA 4IRGA 3BZ6A 4L5JA 3TDUC 1OYYA 1HKTA 2NRAC 3DEUA 1ZAOA 1P2FA 4LFUA 3HSEA 1QNTA 1U5TA 4GXOA 1BIAA 4OIRF 4EV0A 1QQIA 1SMYF 3FXQA 1FX7A 1IXRC 5K5RA 5AIPA 3I54A 2JPCA 2HQRA 4PZJA 2K4JA 3BROA 3GYHX 2IPQX 3ZMTA 4M6XA 3FMRA 2ZXJA 3KLOA 4Y13A 1S3JA 4PCQA 2XRNA 5D5XB 3I53A 1R7JA 2QQ9A 4R1HA 2DPDA 3N4MA 5BOXA 3WE2A 4BYYA 3IRRA 4L5IA 2M1BA 4MGRA 1XGNA 2VBYA 4BXUA 5CYVA 4A6DA 2PMUA 1JHHA 2ZFWA 2GXBA 1MJ9A 3GEZA 2O61A 3NRVA 2VODA 3D0SA 4UNOA 3ZN1A 1K79A 5H20A 2IJLA 3SZPA 5K5OA 5L3FA 2MH9A 2D45A 2A07F 2VT2A 4LLGF 1HKSA 1SD6A 4B09A 4BHPA 3HSRA 3P9IA 3MAJA 4WWCA 1LEAA 3J81Z 2KIFA 3GX4X 1STZA 3CDHA 1OKRA 4Y15A 3BPVA 4E70A 3W6JB 4RAZA 2NNNA 5LRRA 4HDVA 1O3QA 2VBXA 2P5KA 1FYLA 1D8KA 4B8XA 2K27A 2HYGD 3CUOA 5LGNA 3TO9A 2RQPA 1Z6RA 3TOAA 3MFKA 2H09A 3DP7A 5L3GA 2DTRA 3WE3A 3WODF 5E1ZB 2FBIA 3MZHA 2DAOA 2XGXA 2K86A 3LA3A 1J2XA 2O8XA 5DDGA 3I71A 2VT3A 4G8XA 3WTXC 2W57A 4I02A 2GWRA 3HYIA 4YG2F 1HW5A 3JAMZ 1BM9A 1O57A 4EGZA 3KEQA 1XSVA 3R0JA 2LNBA 2TDXA 4L9VA 5HLGA 2VE9A 1XMKA 3E97A 3KFWX 3NQOA 2JT1A 4GYIA 4CHUA 1XD7A 4XSXF 2ZKZA 3M9AA 1R58A 2XAHA 2VOOA 4UXNA 4RGXA 3E6DA 2VONA 3SFZA 4G7OF 3Q5FA 2ZCWA 3VB2A 2NAZA 3JTGA 3IRQA 3DF8A 3PFIA 4M71A 4CO8A 2F2EA 5E17F 2C6YA 4RGRA 1T6SA 1P4WA 3WTYC 1YW9A 1YS7A 5BS6A 1ZREA 3T5XA 2IA0A 2J5OA 4XBFA 2LDUA 2BGCA 3R0AA 2H27A 5ICFA 4HA8A 2DQRA 3K69A 3T8RA 1FC3A 1U6GA 3FZVA 3VEPA 4YFNF 2HKOA 3I0TA 2EK5A 1ZH5A 1XDUA 1MKMA 4OOIA 1YQAA 2EA4A 5D5UB 1PP7U 4U0YA 5DUIA 4HAMA 3CTAA 2ZBKA 4EM2A 4ZYEA 4N9HA 2B0LA 4FHTA 4MEYF 3K0LA 2FRHA 1J0RA 1FLIA 1D5VA 1ZG1A 2EV5A 3GZ6A 1HXDA 4EJWA 1ZG3A 3WTZA 1G3TA 4ENJA 5HOOA 3HRTA 4BQAA 1R22A 2DPUA 1O3RA 5LEJA 1B4AA 4EJUA 4ZYDA 2DFIA 2KRFA 2VE8A 3LQQA 3ML6A 4G7ZF 1YO5C 4ZYHA 1GHCA 1P92A 2Q2EA 4HW0A 2QM3A 1HSJA 4GCVA 3RKYA 1Y0UA 3P9KA 3QU6A 2BV6A 1KYWA 4AIHA 3K1NA 2XASA 3FMSA 1KQ8A 3ECHA 3RYPA 3DXJF 3U9GA 1YW8A 3E3VA 3PQKA 2QBYB 4U0WA 1R00A 2COMA 5K1YA 2A6EF 1HW2A 3KZZA 2MH2A 3ULQB 4P96A 1B9MA 4YFXF 4M74A 4KIGA 5IT9K 1Z9CA 1WI9A 3P7NA 4NB5A 1B9NA 4ESBA 3L7WA 3P9CA 1CF7A 1IZ1A 3LA2A 3EDPA 4KYWA 4ZYGA 3REOA 5LHHA 3QP5A 1I27A 2L4MA 2M45A 1R5HA 3R60A 1B1BA 1SAXA 2RGVA 2VN2A 5EEGA 3RIRA 1OR7A 2FBHA 4L0ZB 2CWEA 5F64A 2HOEA 5JR3A 3VODA 4KIFA 3DQVC 3GXOA 1QPMA 5EEHA 4IRHA 4N9IA 2CYYA 3KZYA 3DV8A 4U88A 4MQ9F 3EQLF 3MZYA 1YG2A 3TOBA 1F5TA 3RPUA 4Q48A 3EETA 3GWZA 1U2WA 1ZLJA 4EJVA 5CVVA 2F5EA 2BE5F 4EMSA 1AWCA 2Q0OA 2KIMA 3GFMA 3ECOA 3BJOA 1J75A 1BI0A 4A5MA 3I5UA 4UHTA 1REPC 4KN4X 2WTEA 1G3YA 1W7PB 2K7LA 1FNNA 3MQ0A 5LRSA 3CO7C 2FBKA 4I09A 4LG0A 5JFRA 4A2UA 1ULYA 3RI4A 2G7UA 2XAQA 2AS5F 1MJBA 2V79A 5LHIA 4RAYA 4M9XA 2EWNA 5FD5A 1LVAA 1WSUA 5HS7A 4MTDA 2DBBA 2FNAA 2MLKA 5D4RA 1SD5A 2EFNA 2HTJA 5L3CA 2W25A 2XV4S 2V1XA 3QRFF 4ZZDA 2HYFA 2P6SA 3KLNA 1W5SA 4PGHA 1KU7A 2ADUA 1HQCA 4RS8A 3E5UA 4LG0B 4EGYA 1BC8C 3TKYA 4KT5C 2Y0MA 3E6BA 1MGTA 4LLLA 2XKPA 1F4KA 2A6HF 1QBJA 1KA8A 1BJAA 2QLZA 4GGGA 5H6RA 5ILSA 1H9TA
chains in the Genus database with same CATH superfamily
4M3EA 4HNTA 1B59A 4B44A 1Y0NA 1W7PD 1XGOA 3M8EA 4W1UA 2G7HA 4PJJA 3BG6A 5M5YJ 1SD7A 5A2QK 2KDZA 1HBXG 4A12A 3VYTB 1H0MA 1Q1VA 2CW8A 2X9DA 3GO5A 2OTJI 2BOLA 3BR2A 3W2WA 2IGNA 3KPHA 4C3JJ 3O6BB 2XAFA 3CQZJ 4PJMA 2W7NA 1U5TB 3KYCB 1QPIA 1XB4A 3BJ6A 5JI6A 2ZO4A 4N4NB 2VQGA 1UHWA 2Z3YA 1MJAA 2DDAA 2RNJA 4Q4ZF 1XDSA 3PFYA 5CVUA 4C2MJ 2PN6A 4M73A 2IW5A 2GA1A 5F0FA 2RQQA 4G6DA 4LK0F 4IZZA 4WCGA 1HC8A 3KCCA 3S3NA 5GPAA 2K3PA 4XSZF 2VJJA 3MCZA 5DEQA 1R5GA 1X3UA 2VXZA 4OAZA 3ZQIA 3G6EI 2K9QA 1A35A 1W5TA 2Y0SA 3HRUA 3HGYA 2DW4A 3I4PA 3ZCOA 2XB5A 2LY2A 3MMYB 2O9LA 3IHUA 3J80K 4BXFA 4HSTA 3SDBA 3JSPA 2V1UA 2MBFA 4R8HA 1Z91A 4IVNA 3TW6A 2HTSA 3QWLA 4I99C 4NQWA 4S04A 4I98B 2QZ8A 2L3DA 2UXXA 3RTRA 3KP3A 1D8JA 4P9UA 1ONVA 5BQTA 4IQ4A 1LPQA 4IF4A 5AONA 1R36A 5DTDA 3QU3A 1E3HA 1OQYA 1WVRA 1J09A 2LTPA 2PG4A 4I7HA 5TGTA 2VKVA 4DIQA 5IYBJ 2V1DA 3I4MJ 2PMZA 5KK1A 1E3PA 5LLQA 4M6VA 5FFZA 1EA3A 1XSXA 3GFLA 1G6NA 1DPRA 4XLFA 4BH9A 1WZ2A 1TLHB 3M4OJ 3U2RA 1EJ9A 1B8IA 4MO7A 3KP4A 2OJED 5A2QR 1LB2A 3ZMUA 3J7ZI 1KQ0A 3J7AW 1QO0D 1BOBA 3O3KA 5D5WB 2RVCA 1P7IA 4JX4A 4GO1A 4I2OA 2V9VA 3WTSC 1FY7A 3M8FA 4E7IA 1BI3A 2RN7A 2G9WA 2HS5A 2V1NA 2DQLA 4L9TA 1OCOH 1A31A 2IT0A 3I9V2 2W85A 4EM1A 1YJNI 5FROA 5J3LA 3FHZA 2X6OA 5GAEJ 3IH3A 3MWMA 5LHGA 1SC7A 2VBZA 4AU7A 3LA7A 3N05A 2JWTA 4Q5SF 3GTGJ 1N78A 2Z2SB 2E5NA 4E4HA 1RI7A 2Y2ZA 2QQAA 1D1BA 4L9NA 1VQLI 1T38A 2DDBA 2BXYA 2Y9YA 4XL9A 3C3WA 4WF2A 3RDIA 2O6GE 4BE0A 1Y1VJ 2JVHA 4N0BA 3J80R 2K02A 4LLNA 2DT7B 3MN2A 1LE8A 4U0VA 4UVCA 1GT0C 2Z5UA 2VIXA 3V7CA 3GUDA 2GAUA 5FLMJ 3Q0VA 1P4AA 4MHGA 2A69F 1RC9A 3CESA 3B6CA 3RKWA 4RB2C 1KGSA 4PGGA 5ICEA 3MKWB 3E1SA 1U5TC 2FMYA 2JVGA 5J1YA 4LB6B 4CH7A 4FE7A 2KZGA 2V26A 3BG5A 4X6AJ 3W3CA 1U3EM 3K4BA 2QEXI 3K4JA 3LSHA 4BACA 1IAWA 4IRIA 1LJ9A 3V4GA 4LK1F 4EATA 3B6AA 2KHMA 2HR3A 3G3ZA 5EZHA 5FKOA 3KE2A 2FX0A 1X3ZB 1T39A 2M9HA 1V4RA 3C1DA 3PSIA 4OIQF 5FLXK 3CUQA 2WV0A 4ESJA 2LD5A 3L00A 3WU0A 2O5RA 2OUMA 4JQFA 1ZGWA 2FA5A 3IKVA 2IRFG 4CYCB 1RKTA 5E8GA 1XMAA 2MC3A 3U1KA 3OWTA 2P5VA 3W6KB 2Z9OA 1ETVA 2CW7A 2L9VA 2D1VA 2GZWA 1ZGJA 2WWYA 3AKZA 1QHHD 3VOEA 1LE8B 1XCVA 2XGCA 4LIUA 1ZYRF 1Z6TA 5HLIA 5TRDA 2R7XA 4DJAA 2X1DA 3DPLC 3NWTA 2ETHA 2LKSA 4BDZA 4GFBA 3F8BA 2BYVE 4XLCA 4RMNA 1GVDA 2KIUA 2W84A 2JSPA 2XGEA 1WH5A 4MQVA 3W2VA 1G4DA 5IT9Z 2HNHA 2PLYA 1WPKA 1RUNA 4YRVA 4BY1J 2HYJA 3K4MA 2FUG2 3EUHA 3K2AA 1ZGAA 4RA2A 5DCMA 5KHDA 1J9IA 2CO5A 3ZQQA 1WKMA 3HUGA 4XRSG 1MBFA 3LOCA 1T0FA 4M72A 1AHDP 2D5VA 3HOYJ 1WGXA 3OMYA 4C2UA 3EYYA 4XKBA 3OSFA 1IUYA 1TQMA 2EV6A 3PUBA 3Q9SA 2BBYA 4BGDA 1FOYA 5J8FA 3HTSB 4CCKA 2A5YB 3S3OA 3CUQB 4HNVA 3S32A 1FBSA 2XKOA 3P5JA 3CP8A 4AYBN 4CUGA 3KYLA 3RZDJ 4DGWB 1X58A 3RKXA 3WTVC 2WC2A 4WXCA 2VC0A 2P7VB 1JKRC 1DDNA 1AA7A 2Y9ZA 3V8LA 4P55A 2LOOA 3CCSI 1ZRFA 1X1DA 3HB9A 3V7RA 5J8CA 4CZZA 4E6KG 2HQNA 2A5WA 2X0LA 3ZMVA 3W6VA 5IYDJ 5HVQC 2LKPA 2IA2A 5FLXR 1WH7A 2A6TA 3WU2C 3H9JA 5KAFC 1Z7UA 3DTIA 1TBXA 2NVTJ 1JJ6C 3SHFA 3GFIA 3S2WA 3ZQFA 3O8GA 1IO2A 3AG4H 3DKWA 4BY7J 4AD9A 1NG7A 1KQ9A 2D1HA 4BNCA 4A3KJ 3JCUC 3SXYA 1AKHA 4UUTA 4HG2A 4BHBA 2HPIA 3TL4X 1SAUA 1Z7LA 4LOCA 2KL4A 4E7JA 1ORKA 1HF0A 2XAGA 5E1XA 2L01A 1YE9A 1QRYA 4QTRA 1FTZA 1VTNC 1WHUA 5GTIC 1UHMA 1PUFB 4A6EA 5HLHA 1YHQI 3ZMDA 1I5ZA 3GLLA 1K6OA 2TCTA 3T0YA 3CJNA 1FT9A 1GV2A 3F3XA 4CCJA 1EH8A 3A1YA 5D4SA 3F6VA 5EGOA 1H9GA 2LG4A 3IV5A 3PJRA 3ZN0A 5IPAA 2PJRA 2JUCA 1L0OC 1S29A 4G12A 3F8FA 4FE4A 3AG1H 2FE3A 3K9TA 3LMMA 2BHYA 3KETA 2H6BA 3IWZA 4RGUA 2MZ4A 2GOMA 1IDYA 2XSJC 3V7SA 2AXTC 2DOEA 1S6LA 2R7ZJ 4D0PA 2CFXA 3FX3A 3M3YJ 1GXPA 2KPMA 2HEOA 1S7EA 1WQ2A 2ID3A 2A68F 2EJRA 2QENA 3F8NA 3JRAA 1PVEA 1MBHA 3Q9VA 1B72B 4IHSA 1AKHB 1L3LA 4G9YA 2HZDA 5JLWA 2CMPA 2LSOA 1ZQ3P 3HL2A 1OMIA 3VDXA 2DXIA 1UMQA 1SVMA 2OZUA 2VKDA 5BNGA 1BOAA 4ASNA 2FF4A 2O8KA 3W2AA 3HIFA 4AWXB 1Q1HA 3A02A 4BJ5C 1N77A 1FP1D 4FETA 2OZ6A 5DD8A 1YRNB 2GXGA 2L7FP 1ON2A 2YU3A 2XVCA 1Z3XA 3JSOA 4KFCA 1YS6A 3WGHA 1R4NB 2EIJH 2VQHA 4NUBA 3K1MA 4PFOA 1FMWA 2E1OA 1ZRCA 5B3SH 4I76A 2PJRB 1XMXA 4RLQA 3F72A 4BQNA 1I3QJ 2QUFA 1SFUA 2KISA 2L0KA 1JGSA 4L9JA 1ZLKA 4BS9A 4WX9A 1IGNA 5F1RA 3I64A 3KEYA 4HLXA 4UB6C 1SANA 2IBDA 3L09A 5ICGA 4QWQA 3HOWJ 3S2DJ 4FT8A 3DBHB 5KVRA 3DPUA 3ZQHA 1WJBA 3TW7A 2DK5A 4I6ZA 4HF2A 1MBEA 1U8RA 1Z1DA 5HDNA 3K1PA 4KMFA 1Y8RB 2WB1A 2ESHA 1V3FA 2Y31A 4FX4A 3HRSA 1OLTA 4F7ZA 3BCBA 4J00A 3TQNA 1R1UA 3GFJA 5LGUA 1HLVA 3JRFA 3CC4I 1RNLA 4MTEA 4ZDPA 4XICA 5D5VB 4S05A 1VQPI 1WJCA 2XSDC 2I8DA 2HQ5A 2NS8A 3MD2A 2ME6A 4LMYA 2F48A 3OYIA 3CCLI 3GTKJ 1O7LA 3G1MA 3CMMA 5E8IA 1TQPA 3E7LA 2L54A 4BXXJ 2XF6A 3S1RJ 4DYRA 1VQKI 1DP7P 3L2CA 3U1DA 4A3FJ 3CDLA 5BMZA 2PJPA 5D8LB 1SVLA 2M3AA 4G7HF 4XONA 5IP6A 4NHJA 1JXSA 1RPWA 2O0YA 1HCRA 3CJQB 1RZ4A 2JSCA 2JPBA 4ENNA 1U78A 3DBRB 3DEEA 3F22A 4B3XA 2E1CA 5A2QZ 1A36A 2HVQA 2KRHA 2QQBA 2QKMB 2L5QA 1OFCX 3K4NA 2CV2A 1UG2A 4XN0A 1ZN2A 1XC5A 2F5CA 2A3SA 3GZ5A 2M30A 4AVPA 4KT6A 2FXAA 3ELKA 2R5ZA 2OCEA 3Q3SA 1NHAA 4HDUA 1USSA 2DMPA 4N4OB 4M6YA 3WTTC 3B02A 2NVXJ 4RB0A 5E20A 2ZMEA 3BLYA 2M8EA 1ENHA 4CCOA 4D5FA 3A01A 4G6QA 1AU7A 3IL2A 2Y0SN 3EUAA 1KU9A 3F21A 2B7EA 3HHHA 4IHXA 2B63J 3VSLA 3OYDA 5K5QA 4NBQA 4U7DA 2K4BA 3GTJJ 2ZB9A 4BKXA 3BJAA 1MDMA 3PUFA 3LSJA 3COAC 3I59A 4B4CA 1CF7B 1Z67A 1APLC 3J80Z 4L0YB 4DZJA 4ZDLA 4ZH4F 3LFKA 2E34A 2P4WA 1T98A 3AG2H 3T1BA 3BCAA 3JRIA 4EJTA 3WGIA 5J1RA 3OS2A 4C30A 1X3WB 3H0DA 3CC7I 1VNDA 5ERIA 1ZHFA 2IA1A 2X4HA 5B1AH 1LQ1A 5FKMA 3K2ZA 2PMZN 4V2FA 4GDFA 1TWAJ 4U87A 1J59A 2CRGA 1IN7A 2MSYA 4A0ZA 5ILUA 1FTTA 2HGCA 4PDKA 2HVSA 2BY1A 2OV7A 3F8CA 3ISPA 3HOSA 2E35A 3HM5A 4IHTA 2VJ5A 5HDKA 2XIGA 1RRJA 1K7AA 1PUEE 1NTCA 2IGMA 2MD5A 4MFDA 2ESNA 5FO5A 3BZCA 1MMSA 4H0EA 2AXLA 2BHZA 3IWFA 1A04A 3A01B 1FP2A 2HWVA 2PQ8A 1IRFA 2OC6A 2V6CA 3CJTB 5EDNA 3GVAA 1HA8A 3LFUA 1J5YA 1X1BA 2XC7A 4OMZA 2ZXWH 2DMNA 3TDZC 5J6XA 4O5VA 2DT5A 3ZXSA 3MKZA 1YI2I 4ZYAA 2XUBA 3FBIB 1UCRA 1OCZH 3KX2A 2COBA 5JLXA 2R7UA 2PI0A 2IGOA 2XRLA 1JHFA 1DP3A 2X6WA 5DYMA 1IF1A 3H92A 3OYHA 3FMQA 4GYGA 3ZP5A 1PP8F 3OYJA 3QQAA 1F1ZA 5FKNA 1XCBA 2FJ1A 3FKJA 4Z2YA 1LUJB 3T8TA 1QZZA 5L3DA 2P81A 1JTXA 4A0XA 5GAGJ 1YTYA 3ZGKA 4RBOA 4ZTFA 1XPXA 1FBQA 2EIKH 1V54H 2WY8Q 3G73A 5JVGF 5TJJA 2DMQA 4KIBA 4Y33A 2QSGX 5IT3A 1R6RA 4RM3A 4HQMA 2DYRH 2NS0A 4XMYA 2K3FA 3CMAI 1E0EA 4CCNA 1X2NA 2FEZA 2DT6A 3U21A 4HNUA 5FLVA 3PM1A 4MNUA 2LF8A 5K7FA 4ZDOA 1EKEA 1MNEA 3ZQ7A 2E7XA 2VLAA 3D5RC 4PK4A 4XRFA 4EVIA 2MFZA 4HV5A 3FXLA 3FXRA 1MSFC 6PAXA 5JHUA 4WXHA 3TO7A 1ETOA 5M5XJ 5FLXZ 5J47A 3PSFA 4AIJA 2W24A 1R71A 4EJOA 2CUJA 4DYCA 1VQ5I 2MA3A 4U7BA 1IRZA 3TP0A 1H8AC 1VF9A 2CU7A 2I5UA 4BUPA 2CW0F 3FXUA 3GCMA 5HS8A 4OIOF 5D6FA 2Q8KA 1USTA 1YIJI 3TGNA 1QU3A 1J7KA 3BR0A 1YFHA 3PO2J 1XSDA 4A3BJ 3F9KA 3V8KA 3S3MA 5IOZA 1GDTA 2DI3A 2R7VA 3CZ6A 4C3HJ 3GLXA 2PBIA 3IAS2 3OOPA 2FU4A 3OYMA 3VFZA 4B47A 3DBLB 3HHGA 4NNJA 2R7WA 1BBYA 3K4CA 1EH6A 5E1WA 4X0GA 1OR7C 1D0XA 3OS0A 2RAEA 2ELJA 4Y7NJ 4DBRA 4F93B 2JUGA 1HW1A 3F6OA 4RDUA 3OSGA 1VQ6I 2ZNYA 1KU3A 2L2OA 2UWMA 3WHBA 4ZZLA 3BTLA 2FMLA 1TC3C 2V6EA 2OU2A 3ROUA 3CF5F 4ENKA 2IAIA 3R6SA 1IC8A 1S7OA 1D3YA 3RPUD 2Z33A 4BBRJ 4BJTA 2LBFA 2EFOA 2FQ3A 2QKLB 4X1EA 3X2QH 3OYLA 3E6MA 2KP6A 4KUMA 4KITB 2Z16A 3FXJA 3EYIA 4LB5A 1ETXA 3HOTA 2MLGA 1XGMA 1V5FA 1X2MA 4MFEA 2QA4I 2HVRA 1IXSB 2LK2A 2ZXIA 4C2TA 3CLOA 2LF7A 2XROA 4CXFA 2E2HJ 5HDGA 2JTVA 2DK8A 2DFFA 2PFBA 4XLPF 5CQEA 2XPVA 2QF7A 4DQ2A 1E3OC 1ODDA 2CGPA 4WK8F 4EM0B 4OMYA 4WXDA 2E1MB 2O3FA 2GIVA 1RR7A 2H8WA 2VBWA 5DV5A 3L1PA 2CUZA 3D5SC 2UZKA 3GTMJ 2HDWA 3HOUJ 2QQ8A 4Y17A 1FSHA 1DUXC 2EV0A 4Y3OA 1FPQA 3R4KA 1S9HA 3GTOJ 2DFHA 4NC7A 2DTZA 4RAGA 2STWA 1K61A 5F0HA 4HOBA 1IN5A 4D1QA 4JYKA 3E6CC 5AIQA 2GLOA 1G3SA 2IVMA 2AQEA 3LSTA 3JRBA 4BU2A 2LC2A 2ZXHA 1IW7F 2ZFUA 5BPDA 3RJPA 2PMHA 1WWXA 2R7FA 4W97A 2EFQA 1RUOA 1UELB 2OQRA 4XK4A 5FD6A 4UUSA 1ETYA 3SQNA 2DU9A 2DCEA 4MEXF 4F3QA 3CCYA 2WA0A 2DMTA 2YS9A 5L3EA 4CSWA 2YU9J 3NWSA 1BI2A 4OIPF 1XGSA 1Z05A 5DUKA 2XF7A 4ZTJA 4XLHA 1WJAA 3Q0WA 2L9SA 2K40A 2ZJPF 4HEA2 1DQUA 2R3SA 1VQNI 3QPTA 5CVJA 4BHCA 4NQWB 3N97A 4IOCF 5DD4A 3EPZA 1JE8A 2Y75A 3M7GA 1ON1A 4HF0A 2RKHA 2WAFA 5GPCA 1VFCA 4YIFA 3S17J 2HPMA 3B73A 3CDIA 2EFWA 1VQ8I 4A0YA 2XAJA 1V5GA 1O3SA 2YR2A 3OYNA 3BPXA 4HLYA 3A2KA 3QAHA 4QLCU 3BTIA 3S8PA 5M3MJ 2P5LC 2RREA 4HQEA 1UFMA 4UY8I 3KIOA 4RB3C 4XRSA 4OINF 4E7ZA 4UVBA 1OPCA 1B8IB 3AG3H 4FCYA 4BAYA 2CS3A 4XIDA 3A0BC 3AL0B 3KEOA 1FSEA 5JVTA 2GXAA 3PL8A 4ENMA 3KP7A 3OIPA 5ILVA 4YFKF 2QWWA 2KRCA 1SVOA 3SJMA 4JBAA 2GA2A 2STTA 4KNYA 1BJZA 2JZYA 1WJDA 1HSTA 1Y39A 1X4OA 4BJ6C 2WAQA 5FB2A 5IOYA 2VL8A 3TEDA 2R7DA 3E5QA 5D6EA 3OIQA 2M35A 3BR1A 3GW2A 1QZYA 3R61A 5ED4A 5IY5H 1TNSA 1ACIA 1TNTA 4A93J 1QVUA 3ONQA 3NARA 4V2GA 1BI1A 1TW2A 3JW4A 1P6RA 3V42A 2E1MC 1R1TA 3ABUA 4IJAA 3H3UA 5CJ9A 5EJCA 3GZNB 5E3MA 2OBPA 2ME0A 4TV7A 2DLLA 5CVIA 1TQIA 4IHWA 5C3EJ 5EG0A 1T2KA 2IS1A 1R23A 4LJZF 1JI8A 3C7JA 3IAM2 2JA5J 3VYUB 3WTUC 2LYCA 3ZMSA 3FXMA 2OQGA 5E18F 2FOKA 2P0TA 2IP2A 5EF6A 2A61A 5HNHA 1I1SA 3QYFA 3OYKA 1IN8A 3OS1A 3OIOA 1CGPA 3BZKA 4AUXA 2YX7A 3OR1C 3CCVI 1O3TA 1F9NA 1LNWA 2K5CA 1YX3A 2CG4A 3HKZA 5HS9A 3DCFA 3D5LA 2LREA 5LFAA 2ELHA 2LVSA 2M0CA 1FBUA 2OA4A 4XR6A 3K7AJ 1MZBA 3WTWC 1ITYA 3G1OA 2IEKA 2IGKA 2XHKA 4CDGA 4CCMA 3HRMA 4XM3A 4R79A 3DFGA 2HKXA 1EH7A 2BVLA 4XLEA 4A3MJ 1E2XA 2R7RA 5D8KB 3WG7H 1MNDA 2P7CB 2L4AA 3VWBA 3ZQCA 1GXQA 4GRIA 2P6TA 1FOKA 2CJJA 4HPQA 2H94A 1YLFA 2F5DA 1RQ6A 4XKCA 3I3LA 3JRCA 2V4JC 4J01A 1YJ9I 4IOAF 3TMOA 4AIKA 2ISZA 2XAUA 3HG9A 4HX7A 4KN7X 4ON0A 1VQOI 4HZFA 3BTCA 4JX6A 3L2QA 2ISYA 2QYOA 1NK3P 3HTUA 3TBIA 1MNMC 1MIJA 3I56I 3OYCA 3HC7A 3FDYA 2M87A 1BL0A 3H3VK 5FRNA 1WFXA 1UHSA 2VQLA 5DCMB 2KFDA 3PNYA 1G3WA 1ZTRA 1DU0A 4UV8A 3QYEA 2RV8A 3HUGB 2H1KA 2L02A 3FK6A 4BE1A 3IC7A 4PUSA 3GTLJ 1GV5A 4HSRA 2OD5A 1TT5B 4ZJZA 4RGSA 2KJCA 1IXCA 3C18A 1MD0A 2JA2A 1PDNC 2VKEA 3DU5A 2EB7A 5GADJ 3J81K 1TTYA 1K6YA 5IYCJ 2QSHX 1BW5A 2EFPA 2XF5A 4IXAA 5LEKA 4I0BA 3D1NI 3F23A 4XLNF 3HJEA 2LLKA 2MG4A 1EV7A 3A0HC 4JK1X 2VC1A 1LFBA 3IKTA 3A03A 4HF1A 3M1CA 3O2PE 2F4OB 2HZTA 3OL3A 2HI3A 3FM3A 3PQJA 2LP0A 3QPHA 2K9LA 2IS6A 3BP8A 2JA8J 1YYVA 2DMUA 2DJNA 3ASNH 3BDDA 3LSGA 3ZPLA 1F36A 5C4JJ 2KJBA 4P9FA 2ZSHB 3LSKA 3KP5A 4KA4A 1GVJA 1I39A 2NYXA 2RC4A 1I6XA 1I1GA 4ETSA 4O3MA 1ETWA 2CQKA 3FM5A 2X51A 1LDKB 2PX9A 5TISC 3NAUA 2QBYA 2E36A 2Y48A 4A3DJ 3OV8A 2XDVA 3MKLA 4ESFA 3H36A 3VSKA 1Z77A 1ZG5A 5EGOB 3MEXA 5F08A 3CUQC 3OR2C 4FX0A 1K78A 3FWEA 3WG9A 3GF2A 3BT9A 4HX4A 2AO9A 1G8XA 4UUVA 5H6QA 1KYZA 4A69C 3LSPA 3FKIJ 4G94A 1R1VA 3JTHA 1BN5A 2M5WA 2EZLA 1WI3A 1HDDC 1IN4A 4M9ZA 3LWFA 3J81R 4A5NA 3JAMK 2JRTA 3HGGA 3RSNA 3CJRB 2EIMH 4UVAA 4ITVA 3RPQA 4AC0A 3JRGA 5LBQA 2R92J 1FWZA 3S1QJ 2E2IJ 4C9YA 2NVUB 3A4CA 2BZTA 2DA5A 2GOXB 4RM2A 2V9PA 2CQNA 3EUHC 1V55H 2WBMA 2E2JJ 4B3AA 4BL0B 1BW6A 2E19A 3CMYA 1H88C 3IH2A 1T0FC 4HYEA 2DOAA 2M7AA 5B5EC 1SFEA 2MD0A 3H35A 2DO7A 5F6FA 4XN3A 4IL6C 1K78B 4IHYA 3DPTA 3SZGA 2E60A 5FGMA 4KICA 1LDDA 3CD6I 4KDPA 1OCTC 3F8MA 3BOQA 2O03A 4ABZA 1S72I 1JGGA 2HDDA 5FKKA 1C0WA 2NOGA 2BY0A 2EQRA 3BWGA 1KU2A 1SMTA 3L9FA 1IN6A 3V8JA 3VYRB 2WY7Q 3G71I 1ZR4A 2E1NA 3H5NA 3QP6A 1LEBA 2FNPA 2TRTA 1IV8A 3LAPA 3OYEA 2W4SA 2F5FA 5KCMA 3OOUA 9ANTA 4HX8A 1SFKA 2P8TA 2NOJB 4QPQA 4UV9A 1WRJA 3E5XA 1BA5A 3DTEA 3JAMR 4L18B 2OPTA 3PNVA 1XN7A 1Z21A 4EEFG 5LGTA 1E17A 1W4MA 2GIZA 2BEOA 4IPAA 1MH4A 1SFXA 3G1LA 1FYKA 4OU0A 2HOSA 4HBLA 4K2EA 1OCCH 2YSRA 3I58A 2HDCA 1QVTA 3BTJA 1LFPA 2HOAA 1Y6IA 2JN6A 1MBJA 3ZMZA 4CICA 5H2FC 2KKOA 3J7AO 3S93A 3NEUA 2OF7A 2X48A 3FF5A 1W7PA 2M0MA 1D1AA 4NC8A 2PEXA 5J1UA 2HXIA 3EUKL 3KP2A 1IV6A 3RYRA 3FXOA 4IEJA 2R4GA 3WU1B 2VPLA 2D2WA 5F0CA 5DM7F 3H3ZA 5ICCA 1JUMA 2L7ZA 2HU9A 1B6AA 1P4XA 2R5ZB 2VOPA 3CCRI 1M1EB 5FFXA 3LQRA 5BPIA 4KMUX 1LDJA 3KP6A 5C44J 1QGPA 1D5YA 1UB9A 1S8NA 2YPRA 2M34A 4Q47A 1R4MB 2ZMEB 5CLSA 2RDPA 1RIOH 2XB0X 1SD4A 4HV6A 3CCMI 5HNFA 4RB1A 4IX7A 2KZVA 1D0ZA 1FZPB 4G6TB 3M1EA 4BBSJ 2Z99A 4CCLA 2ZJ2A 1OYWA 4LD5A 2E7WA 2VB6A 2NNYA 2OAZA 5DCFA 3BC8A 2UXNA 1MDMB 2MABA 3I59B 4I0AA 2DJIA 1LVKA 1MMNA 3F0CA 2JK3A 4PSXA 1YIOA 2HFHA 2J5PA 4M9SA 5E3OA 4QIWN 1FIAA 1NH3A 3G4SI 1IRGA 1FYMA 3CO6C 4P5OA 1HOMA 4CYDA 2E5ZA 1PJRA 4I01A 4D5CA 1DPUA 1BIBA 5L3BA 1VQ9I 5J4VA 1YW7A 2GQQA 3SZTA 3TP3A 2ZNZA 1MH3A 3BQYA 3DLAA 3HDDA 2FSWA 5CVRA 1OJLA 1ZARA 2ACJA 3WGGA 1HKQA 2EPFA 1BC7C 3ERED 3PIOF 1O7FA 3TO6A 1WJ5A 4BEHA 1U9NA 4B43A 2EA2A 2H6CA 3BY6A 1W36D 1RESA 4O6JA 2YX4A 1DU6A 4DOZA 4F91B 3HSFA 1T56A 5F1JA 2DA4A 2KMUA 1X19A 3QOPA 2QVOA 3PNTA 1AOYA 2HQAA 4LG3A 4LGWA 1T8IA 1IG7A 1ZRDA 2N8GA 5B1BH 2Y69H 3ERMA 4YIIA 3GBGA 4M3DA 4E7SA 3AAFA 1S7AA 4CGZA 1TW3A 2CSOA 2DN0A 1OYIA 4DNCA 3ABTA 4C3IJ 3C2BA 3IP4B 1W0TA 2LH9A 1X1CA 4IRGA 4EQQA 3LAJA 1W36C 3BZ6A 4L5JA 3TDUC 1O4XA 4Y52J 1OYYA 1XX5A 1MMGA 3UR3C 1F43A 1FMVA 3ESWB 4AIDA 2JA7J 2NRAC 3DEUA 1HKTA 1ZAOA 1P2FA 3C2HA 4LFUA 3HSEA 1QNTA 1U5TA 2R7OA 3QODA 2VJ4A 4GXOA 2JQ7A 3OY9A 3S1MJ 1BIAA 4OIRF 4DBQA 4D9JA 1QQIA 4EV0A 1SMYF 3FXQA 3SEQA 3IUOA 1FX7A 3VPRA 4YIRX 1IXRC 3K4LA 5K5RA 2B9SA 3LSMA 5AIPA 1FJLA 1NG6A 2JPCA 3I54A 2HQRA 4A3JJ 4PZJA 2K4JA 3BROA 2DA1A 3GYHX 2IS2A 1P9QC 3FISA 2IPQX 3ZQLA 2E71A 1TP4A 3SYTA 2R7SA 2HXOA 2X6XA 3HEFA 3ZMTA 3MZ8A 4M6XA 3FMRA 2ZXJA 1QZEA 3KLOA 1BR4A 3GMEA 2ZMEC 4Y13A 4QPOA 1MMDA 1S3JA 3QPSA 3HKZN 4D7NA 4PCQA 1JKQC 3MVPA 2XRNA 2K9MA 3RKQA 5D5XB 3I53A 3ABKH 3FK7A 1R7JA 2QQ9A 2Z1DA 2QSFX 4R1HA 2DPDA 1BR2A 3N4MA 5BOXA 3WE2A 3ABMH 4BYYA 4L5IA 3IRRA 2M1BA 4MGRA 1XGNA 2I10A 2VBYA 3CCEI 4E7HA 2MUNA 2G0EA 4BXUA 5CYVA 1Y8QB 4A6DA 1JT0A 2R5YA 2MYSA 2PMUA 1JHHA 1W1WE 1LFUP 2ZFWA 2GXBA 1MJ9A 5K7ZA 3GEZA 2O61A 3NRVA 2VODA 3HXLA 1TWFJ 3D0SA 5FKLA 2X1CA 2FOWA 4UNOA 3ZN1A 2LR8A 1K79A 5DS9A 3DKXA 5H20A 1K83J 2IJLA 2XPUA 3SZPA 5FJ8J 2ELKA 1R9TJ 1R5ID 2ECCA 5K5OA 5L3FA 1VI0A 2MH9A 2D45A 1SEUA 2A07F 2VT2A 1X4PA 1I6HJ 2GBYA 1JKOC 4LLGF 3BR6A 1ETQA 2K9SA 3SFIA 2L7KA 1HKSA 1NK2P 1TWGJ 1X1AA 5IP9J 2M4KA 3L2WA 4IQJA 1MBKA 1SD6A 3H5AA 4B09A 4BHPA 2M7BA 3HSRA 4ZC3A 4JP0A 3P9IA 2LBFB 3MAJA 4WWCA 2ZC2A 1LEAA 3HZJA 4BQQA 2MVTA 1HDPA 2MGQA 3CF2A 2WAEA 1FIPA 1OCPA 2R5YB 3J81Z 2KIFA 3GX4X 1STZA 3CDHA 1KZHA 1OKRA 4F55A 4Y15A 3BPVA 3ZQGA 1TZLA 1VQ7I 4E70A 3W6JB 2EH3A 4RAZA 2JA6J 2F5VA 2K85A 2NNNA 5LRRA 5GAHJ 4HDVA 2JRMA 1O3QA 2VBXA 2M8GX 2F6CA 5KNLA 4A3EJ 2P5KA 3RQ4A 1D8KA 1FYLA 4B8XA 2X98A 1QA6A 2K27A 2HYGD 3CUOA 5LGNA 4M3GA 3CLQA 3TO9A 3H5RA 2JJ7A 2RQPA 4HRIA 1N75A 1Z6RA 3TOAA 2ZJRF 1TWHJ 3MFKA 2H09A 3DP7A 4CYCA 3S14J 5L3GA 4CZCA 1Z0XA 4NDLA 4S0HB 4UUSB 2M2EA 4RAFA 2DTRA 3WE3A 1TWCJ 3OL4A 3QYBA 4YELA 3WODF 5E1ZB 2Q1ZB 5E79C 2EBIA 2FBIA 3BR3A 3MZHA 3DU6A 2DAOA 4YEJA 2XGXA 1ZR2A 2K86A 1P7JA 3HPGA 3LA3A 1J2XA 3CC2I 2O8XA 2DYSH 5DDGA 5B66C 1IJWC 2R7TA 1W5CC 4PJLA 1RR8C 2L7MP 4A3GJ 3I71A 2VT3A 4G8XA 1T33A 3WTXC 3K70D 2W57A 2H8RA 3CCUI 5EYRA 4I02A 3S15J 2GWRA 2WB1N 3HYIA 1I3AA 2CQ7A 4YG2F 3WHCA 1HW5A 3CCQI 3JAMZ 1G59A 1BM9A 3K6GA 1O57A 2XGDA 3OYBA 3J7AY 4EGZA 3IH4A 3G2BA 4XNFA 1TT0A 3KEQA 1XSVA 2CUEA 4XLAA 2EILH 3R0JA 2LNBA 3K70C 2TDXA 4L9VA 5HLGA 3JR9A 2VE9A 1A6IA 1XMKA 4RLFA 3E97A 3KFWX 3NQOA 2JT1A 4GYIA 2R93J 4CHUA 1XD7A 3RCOA 2LY9A 5E3NA 4B48A 3J7YJ 4XSXF 3ZR8X 2ZKZA 1OCRH 3M9AA 1R58A 3RQIA 4L5EA 2VASA 1JTYA 3I55I 1DGRM 2XAHA 4E7KA 2VOOA 3QOEA 2RNGA 4MIMA 4UXNA 1WJFA 4RGXA 2DOFA 2DA7A 3E6DA 2VONA 3SFZA 5GTHC 5FRMA 4G7OF 3Q5FA 2ZCWA 3VB2A 1ETKA 2NAZA 3JTGA 3IRQA 3DF8A 3PFIA 4M71A 3S16J 5JHFA 2QCOA 1ZK8A 1GUUA 3MKYB 4OWRB 4CO8A 1IRXA 3LSRA 3H9GA 3H0GJ 1PUFA 2F2EA 4NC6A 5E17F 2C6YA 4RGRA 5EG0B 1T6SA 1P4WA 3L2VA 1A5JA 1IDZA 3WTYC 3L2RA 3CP2A 4QSHA 5CQGA 3VYSB 3JREA 2HOTA 2DA6A 1YW9A 2LY1A 1MBGA 1BR1A 1YS7A 5BS6A 1ZREA 3T5XA 3K10A 2IA0A 2J5OA 2FD5A 4XBFA 4M3BA 2X1EA 3AL0C 1VQMI 4IO9F 2R7QA 2BW3A 2LDUA 2CV1A 2BGCA 3R0AA 1MSEC 4XORA 4JOMA 4E7LA 3OYAA 5GP9A 4BDYA 2H27A 3KZIC 5ICFA 4HA8A 2DQRA 3K69A 3T8RA 2DA2A 1D1CA 4FQGA 4LITA 1FC3A 1B72A 2VUMJ 1I50J 3ASOH 1JUSA 1U6GA 2VKHA 3FZVA 4XKVA 2V9KA 3BG3A 3VEPA 3HOXJ 1CQTA 4YFNF 1JJ8C 2CFOA 3HOZJ 2HKOA 4Z6YA 3I0TA 1GLNA 1K4SA 2EK5A 1ZH5A 3O8HA 3JRHA 1XDUA 1MKMA 4OOIA 1YQAA 4A3CJ 1U8BA 2EA4A 5D5UB 3S1NJ 1PP7U 4U0YA 1YOVB 3DTKA 5DUIA 1YRNA 4HAMA 2L9RA 1MMAA 3CTAA 5K7HA 2ZBKA 4II3A 2GM4A 1LKXA 4EM2A 3Q0UA 3UNGC 4ZYEA 1OISA 5M5WJ 2UV1A 2NXNB 4N9HA 2B0LA 4FHTA 4MEYF 2WV1A 3K0LA 2MC4A 2FRHA 1J0RA 4MLOA 1T08B 2BW3B 1T95A 2VQCA 4FTHA 1FLIA 1D5VA 2QGUA 2CUFA 5KAIC 1ZG1A 4XOTA 2EV5A 2XPWA 4IHVA 1IUFA 3GZ6A 3DWLE 1HXDA 3LL7A 4PFPA 1Y1WJ 3OYGA 3PO3J 4EJWA 1ZG3A 3WTZA 1G3TA 4ENJA 3ZOBA 2IXSA 4ANJA 5HOOA 3HRTA 2OCCH 4BQAA 2IS4A 4XQFA 1R22A 2DPUA 3FBNB 2NS7A 4B1RA 1O3RA 1JKPC 1V5EA 1B4AA 5LEJA 4V19K 4EJUA 3CCJI 2BXZA 2DFIA 2KDOA 2KRFA 2VE8A 3LQQA 4ZYDA 2OTLI 5F27A 1N25A 4J19A 3ML6A 2YUSA 3S2HJ 4G7ZF 1A6QA 1R49A 1YO5C 2CV0A 4ZYHA 1GHCA 1TL8A 1P92A 1Y56A 2Q2EA 4HW0A 4CA0A 2QM3A 1HSJA 4GCVA 3RKYA 1JUPA 1Y0UA 3P9KA 2BVMA 3QU6A 2BV6A 2A05A 3GTQJ 1KYWA 4AIHA 3DEWA 5CKTA 4P1WA 2DODA 3K1NA 2XASA 3FMSA 1KQ8A 3ECHA 3QPLA 2W48A 1UZCA 3RYPA 3DXJF 1YW8A 2K9NA 3E3VA 3PQKA 3U9GA 3HPHA 2QBYB 4U0WA 4FISA 1K4TA 1R00A 2COMA 4A3LJ 3C2GA 1DGWY 2NVQJ 5K1YA 4Y4RA 2A6EF 1HW2A 3KZZA 2MH2A 4IKFA 3ULQB 4P96A 2F4MB 2DFEA 1B9MA 2VI6A 4YFXF 3LSIA 4M74A 2KT0A 3OYFA 4KIGA 1YX5A 5IT9K 1Z9CA 1KONA 5C4XJ 5CPRB 4KJZA 5M3FJ 4JX5A 1WI9A 3P7NA 4NB5A 1B9NA 4BQOA 4ESBA 3L7WA 3P9CA 1CF7A 1IZ1A 3LA2A 3DKYA 3EDPA 4KYWA 3BQZA 2Q2EB 1W0UA 4ZYGA 3REOA 1FOXA 5LHHA 3QP5A 5EZGA 1I27A 2L4MA 1YITI 1UJ8A 4PJNA 5F04A 2VPRA 2M45A 4AYBA 1R5HA 1YJWI 2R0QC 3R60A 1B1BA 3PIPF 1SAXA 2LMDA 2H1LA 2RGVA 2VN2A 2VJIA 5EEGA 3RIRA 1OR7A 4AVZA 5J40A 2FBHA 4L0ZB 2KQRA 4PJ0C 2CWEA 5F64A 1XTAA 2HOEA 1UAAA 5JR3A 2LRDA 1ZELA 1PYVA 3H9QA 1ZKGA 3VODA 4KIFA 2EINH 2NVYJ 3SDGA 2BY3A 3DQVC 4BE2A 3GXOA 2CQQA 1G2HA 1QPMA 5EEHA 2ID6A 4IRHA 1Z3YA 4A3IJ 4N9IA 2L9NA 4FASD 2CYYA 4H4KC 3KZYA 3DV8A 4U88A 4MQ9F 3EQLF 2LKXA 2KIQA 4LIVA 3MZYA 1YG2A 3TOBA 3RZOJ 3M07A 1F5TA 5IT9R 1XG1A 3RPUA 4Q48A 3EETA 4F52A 3GWZA 1U2WA 1ERDA 1ZLJA 4UB8C 4EJVA 5CVVA 4F92B 4XRMA 4DYQA 5DM6F 5HLTA 2F5EA 1RETA 2BE5F 3A52A 3FHNA 4EMSA 1AWCA 4D7MA 2Q0OA 3ABLH 2KIMA 3GFMA 2F4IA 1RKWA 3BJOA 3ECOA 3H1CA 3L2UA 1J75A 1BI0A 4A5MA 2UUZA 3E0JB 1FEXA 4AM3A 3I5UA 4UHTA 1POGA 1REPC 2ZJQF 2P0WA 1X1PA 2ZSIB 3KYDB 5J4YA 2ICWG 3SEZA 1S5LC 2WTEA 1G3YA 4KN4X 3GTPJ 1W7PB 2K7LA 4PSWA 5E3LA 1FNNA 3MQ0A 5LRSA 3CMEI 3HBLA 2VXDA 3CO7C 3HOVJ 2FBKA 4I09A 1H89C 2WADA 4LG0A 3DLLF 1WCMJ 5LD2C 5JFRA 2X6YA 4A2UA 1ULYA 3RI4A 1MW7A 2X85A 2G7UA 2XAQA 4OAYA 1VZ0A 2AS5F 1U0JA 2W00A 1D0YA 1MJBA 2V79A 2V7FA 2EZHA 2W82A 5LHIA 1FOWA 3M8JA 3K4KA 4RAYA 2CQXA 4M9XA 2EWNA 5FD5A 1LVAA 2CH0A 3FIWA 3LNQA 1WSUA 4XOPA 5HS7A 4MTDA 2WAQN 2DBBA 5IP7J 2FNAA 3BR5A 2AHQA 2DA3A 2MLKA 3AFHA 4KISA 5D4RA 1SD5A 2EFNA 2HTJA 5L3CA 2W25A 2XV4S 2Y30A 2V1XA 3QRFF 2AQFA 4ZZDA 2HYFA 2BY2A 1QHGA 2P6SA 3KLNA 1EF4A 1W5SA 4II2A 4PGHA 1KU7A 2ADUA 3ZRGA 1HQCA 4M3FA 4RS8A 2LFBA 3E5UA 4LG0B 2ECBA 2EZKA 1VQ4I 3FXKA 4EGYA 5HODA 1SFOJ 1BC8C 1U9OA 3TKYA 4KT5C 4DZPA 2Y0MA 3BG9A 5EEAA 3E6BA 3UKGA 4BEHB 3JRDA 1MGTA 1WJEA 4LLLA 2KLOA 4XKWA 2O7OA 1XS9A 2XKPA 1F4KA 2A6HF 2JMWA 1QBJA 2EZIA 1JT6A 1KA8A 2FQ4A 2MW8A 3BG7A 1BJAA 2QLZA 4DW6A 4GGGA 5H6RA 2W1OA 1UG0A 5ILSA 1H9TA 2M4GA 3I4NJ
chains in the Genus database with same CATH topology
1B59A 1W7PD 1XGOA 3M8EA 2G7HA 5A2QK 1SD7A 1HBXG 4A12A 1H0MA 3GO5A 3O6BB 2XAFA 1U5TB 1XB4A 3BJ6A 5JI6A 2ZO4A 1UHWA 2Z3YA 1MJAA 2RNJA 4Q4ZF 1XDSA 5CVUA 2PN6A 4M73A 2IW5A 2GA1A 4LK0F 4G6DA 4WCGA 3KCCA 4XSZF 5DEQA 3MCZA 1R5GA 1X3UA 2VXZA 1W5TA 3HRUA 2DW4A 3I4PA 3IHUA 3J80K 3JSPA 2V1UA 2MBFA 4R8HA 1Z91A 4IVNA 2HTSA 4S04A 4NQWA 4I98B 2QZ8A 2L3DA 2UXXA 3RTRA 3KP3A 1D8JA 4P9UA 1ONVA 5BQTA 4IF4A 5AONA 1R36A 3QU3A 2PG4A 4I7HA 2V1DA 5KK1A 5LLQA 5FFZA 1XSXA 3GFLA 1G6NA 1DPRA 4BH9A 1TLHB 3U2RA 3KP4A 1LB2A 3ZMUA 1KQ0A 1QO0D 3O3KA 5D5WB 2RVCA 4GO1A 4I2OA 2V9VA 3WTSC 1FY7A 3M8FA 1BI3A 2RN7A 2G9WA 2HS5A 2DQLA 4L9TA 2IT0A 2W85A 4EM1A 3FHZA 3MWMA 5LHGA 2VBZA 3LA7A 4Q5SF 1RI7A 2QQAA 4L9NA 1T38A 3C3WA 4WF2A 3RDIA 2O6GE 4N0BA 2K02A 4LLNA 4U0VA 4UVCA 2Z5UA 3V7CA 3GUDA 2GAUA 1P4AA 4MHGA 2A69F 3RKWA 4RB2C 1KGSA 4PGGA 5ICEA 1U5TC 2FMYA 4LB6B 1U3EM 1IAWA 4IRIA 1LJ9A 3V4GA 4LK1F 3G3ZA 2HR3A 3KE2A 1T39A 3C1DA 1V4RA 4OIQF 5FLXK 3CUQA 2WV0A 4ESJA 3L00A 3WU0A 4JQFA 2FA5A 3IKVA 2IRFG 5E8GA 1XMAA 2MC3A 2P5VA 3W6KB 2Z9OA 2D1VA 2GZWA 1ZGJA 2WWYA 3VOEA 1XCVA 1ZYRF 1Z6TA 5HLIA 5TRDA 3DPLC 2ETHA 3F8BA 2BYVE 2KIUA 2W84A 4MQVA 1G4DA 5IT9Z 2PLYA 1RUNA 3EUHA 1ZGAA 5DCMA 1J9IA 2CO5A 1WKMA 3HUGA 1T0FA 4M72A 3EYYA 1IUYA 1TQMA 2EV6A 3Q9SA 2BBYA 5J8FA 3HTSB 2A5YB 3CUQB 1FBSA 2XKOA 3RKXA 3WTVC 2WC2A 4WXCA 2VC0A 2P7VB 1DDNA 3V8LA 4P55A 1ZRFA 3V7RA 5J8CA 4CZZA 2HQNA 2X0LA 3ZMVA 5HVQC 2LKPA 2IA2A 1Z7UA 1TBXA 3SHFA 3GFIA 3S2WA 3DKWA 4AD9A 1KQ9A 2D1HA 4BNCA 3SXYA 4BHBA 2XAGA 5E1XA 2L01A 1VTNC 1UHMA 4A6EA 5HLHA 3ZMDA 1I5ZA 1K6OA 3T0YA 3CJNA 1FT9A 3F3XA 1EH8A 5D4SA 3F6VA 1H9GA 3ZN0A 1L0OC 1S29A 3F8FA 3K9TA 2FE3A 3KETA 2H6BA 3IWZA 4RGUA 3V7SA 1S6LA 4D0PA 2CFXA 3FX3A 1GXPA 2HEOA 1WQ2A 2A68F 2EJRA 2QENA 3F8NA 3Q9VA 4IHSA 1L3LA 4G9YA 2LSOA 1OMIA 2OZUA 1BOAA 4ASNA 2FF4A 3HIFA 4AWXB 1Q1HA 1FP1D 2OZ6A 5DD8A 2GXGA 1ON2A 2YU3A 2XVCA 3JSOA 4KFCA 1YS6A 3WGHA 3K1MA 1ZRCA 3F72A 2QUFA 1SFUA 1ZLKA 1JGSA 4L9JA 4WX9A 5F1RA 3I64A 4HLXA 3L09A 5ICGA 4QWQA 4FT8A 5KVRA 2DK5A 4HF2A 1U8RA 1Z1DA 5HDNA 3K1PA 4KMFA 2ESHA 1V3FA 4FX4A 3HRSA 4F7ZA 3TQNA 1R1UA 3GFJA 5LGUA 1RNLA 4MTEA 5D5VB 4S05A 4LMYA 1O7LA 5E8IA 1TQPA 2L54A 1DP7P 3L2CA 3U1DA 5BMZA 2PJPA 5D8LB 4G7HF 4NHJA 1JXSA 2O0YA 1RZ4A 2JSCA 2JPBA 4ENNA 1U78A 3F22A 2E1CA 5A2QZ 2QQBA 1ZN2A 2F5CA 2A3SA 3GZ5A 2M30A 4AVPA 2FXAA 3ELKA 1NHAA 4HDUA 1USSA 4M6YA 3WTTC 3B02A 4RB0A 5E20A 2ZMEA 2M8EA 4G6QA 3IL2A 1KU9A 3F21A 3HHHA 5K5QA 4U7DA 2K4BA 3BJAA 1MDMA 3COAC 3I59A 1CF7B 3J80Z 4L0YB 4ZH4F 3LFKA 2P4WA 1T98A 3T1BA 4EJTA 3WGIA 5ERIA 1ZHFA 2IA1A 2X4HA 1LQ1A 3K2ZA 1J59A 1IN7A 4A0ZA 5ILUA 2HGCA 4PDKA 3F8CA 3ISPA 3HOSA 4IHTA 5HDKA 2XIGA 1K7AA 1PUEE 2MD5A 2ESNA 5FO5A 4H0EA 2AXLA 3IWFA 1A04A 1FP2A 2HWVA 2PQ8A 1IRFA 2V6CA 3GVAA 1J5YA 4OMZA 3TDZC 5J6XA 4O5VA 2DT5A 2XUBA 1UCRA 2PI0A 1JHFA 5DYMA 1IF1A 3H92A 3FMQA 4GYGA 3ZP5A 1PP8F 1F1ZA 1XCBA 4Z2YA 3T8TA 1QZZA 5L3DA 4A0XA 1YTYA 1FBQA 3G73A 5TJJA 4KIBA 5IT3A 4HQMA 2NS0A 2FEZA 4MNUA 2LF8A 3ZQ7A 2E7XA 4XRFA 4EVIA 4HV5A 3FXRA 6PAXA 5JHUA 4WXHA 3TO7A 5FLXZ 4AIJA 2W24A 4EJOA 2MA3A 4U7BA 2CW0F 3FXUA 5HS8A 4OIOF 5D6FA 2Q8KA 1USTA 3TGNA 1J7KA 1YFHA 1XSDA 3V8KA 2DI3A 3GLXA 2PBIA 3OOPA 2FU4A 3VFZA 3HHGA 1BBYA 5E1WA 1EH6A 1HW1A 3F6OA 2ZNYA 1KU3A 2UWMA 4ZZLA 2FMLA 2OU2A 3ROUA 4ENKA 3R6SA 1S7OA 1D3YA 2Z33A 2EFOA 2FQ3A 3E6MA 4KUMA 3EYIA 4LB5A 3HOTA 2MLGA 1XGMA 1IXSB 3CLOA 2LF7A 2XROA 4CXFA 5HDGA 2JTVA 2DK8A 2PFBA 4XLPF 4DQ2A 2CGPA 1ODDA 4WK8F 4EM0B 4OMYA 4WXDA 2O3FA 2GIVA 2VBWA 5DV5A 2UZKA 4Y17A 1FSHA 1DUXC 2EV0A 1FPQA 3R4KA 2STWA 4HOBA 1IN5A 3E6CC 5AIQA 1G3SA 2IVMA 3LSTA 1IW7F 5BPDA 3RJPA 2PMHA 1WWXA 2R7FA 1RUOA 2EFQA 2OQRA 5FD6A 3SQNA 2DU9A 4MEXF 5L3EA 1BI2A 4OIPF 1XGSA 1Z05A 5DUKA 2R3SA 3QPTA 5CVJA 4BHCA 3N97A 5DD4A 1JE8A 2Y75A 3M7GA 1ON1A 4HF0A 2RKHA 4YIFA 3B73A 2EFWA 4A0YA 2XAJA 1O3SA 2YR2A 4HLYA 3BPXA 3QAHA 4QLCU 2P5LC 4HQEA 1UFMA 4RB3C 4OINF 4UVBA 1OPCA 4BAYA 3KEOA 1FSEA 5JVTA 4ENMA 3KP7A 5ILVA 4YFKF 2QWWA 4JBAA 2GA2A 2STTA 4KNYA 2JZYA 1HSTA 5FB2A 2R7DA 3E5QA 5D6EA 3GW2A 1QZYA 3R61A 5ED4A 1TNSA 1TNTA 1BI1A 1TW2A 3JW4A 1P6RA 1R1TA 3ABUA 4IJAA 3H3UA 5CJ9A 2OBPA 4TV7A 2DLLA 5CVIA 1TQIA 1T2KA 1R23A 4LJZF 3C7JA 3WTUC 3ZMSA 2OQGA 5E18F 2FOKA 2IP2A 2A61A 1I1SA 1IN8A 1CGPA 2YX7A 1O3TA 1F9NA 1LNWA 5HS9A 2CG4A 3D5LA 2ELHA 1FBUA 2OA4A 1MZBA 3WTWC 2XHKA 4CDGA 3HRMA 4R79A 2HKXA 3DFGA 1EH7A 1E2XA 5D8KB 2P7CB 2L4AA 1GXQA 2P6TA 1FOKA 2H94A 1YLFA 2F5DA 4AIKA 2ISZA 4HX7A 4KN7X 4ON0A 4HZFA 2ISYA 2QYOA 3HTUA 2M87A 5DCMB 1G3WA 4UV8A 2RV8A 2L02A 3IC7A 2OD5A 4RGSA 2KJCA 1IXCA 3C18A 1MD0A 1PDNC 2EB7A 3J81K 1TTYA 2EFPA 4IXAA 5LEKA 4I0BA 3F23A 4XLNF 1EV7A 4JK1X 2VC1A 3IKTA 4HF1A 3O2PE 2HZTA 3FM3A 3PQJA 3QPHA 3BP8A 1YYVA 3BDDA 3ZPLA 2KJBA 4P9FA 3KP5A 4KA4A 1GVJA 2NYXA 2RC4A 1I6XA 1I1GA 4ETSA 4O3MA 2CQKA 3FM5A 1LDKB 2QBYA 2Y48A 3OV8A 4ESFA 1ZG5A 3MEXA 3CUQC 4FX0A 1K78A 3FWEA 3WG9A 3GF2A 4HX4A 4UUVA 5H6QA 1KYZA 4G94A 1R1VA 3JTHA 1BN5A 2M5WA 1IN4A 4M9ZA 3LWFA 4A5NA 3JAMK 2JRTA 4UVAA 3RPQA 5LBQA 1FWZA 4HYEA 1SFEA 2DO7A 5F6FA 1K78B 3DPTA 5FGMA 4KICA 1LDDA 4KDPA 3F8MA 3BOQA 2O03A 1C0WA 3BWGA 1SMTA 1KU2A 3L9FA 1IN6A 3V8JA 2E1NA 3QP6A 1LEBA 2FNPA 3LAPA 2F5FA 4HX8A 2P8TA 4UV9A 1WRJA 3E5XA 4L18B 1XN7A 5LGTA 1E17A 1W4MA 2BEOA 4IPAA 1SFXA 1FYKA 4OU0A 4HBLA 4K2EA 2YSRA 3I58A 2HDCA 3ZMZA 4CICA 2KKOA 3J7AO 3NEUA 3FF5A 1W7PA 2PEXA 3KP2A 3RYRA 3WU1B 2D2WA 3H3ZA 5ICCA 2VOPA 1B6AA 1P4XA 5FFXA 3LQRA 5BPIA 4KMUX 1LDJA 3KP6A 1QGPA 1UB9A 1S8NA 2YPRA 4Q47A 2ZMEB 5CLSA 2RDPA 1RIOH 1SD4A 4HV6A 4RB1A 1FZPB 3M1EA 2Z99A 2ZJ2A 1OYWA 4LD5A 2E7WA 2NNYA 2OAZA 5DCFA 2UXNA 1MDMB 3I59B 4I0AA 1YIOA 2HFHA 2J5PA 4M9SA 1IRGA 1FYMA 3CO6C 4P5OA 4CYDA 4I01A 1DPUA 1BIBA 5L3BA 1YW7A 2GQQA 3SZTA 2ZNZA 2FSWA 5CVRA 1ZARA 2ACJA 3WGGA 1HKQA 1BC7C 3ERED 1O7FA 3TO6A 2EA2A 2H6CA 3BY6A 4O6JA 2YX4A 3HSFA 3QOPA 2QVOA 1AOYA 4LGWA 1ZRDA 4YIIA 3AAFA 1S7AA 4CGZA 1TW3A 2CSOA 1OYIA 4DNCA 3ABTA 4EQQA 3LAJA 4IRGA 3BZ6A 4L5JA 3TDUC 1OYYA 1HKTA 2NRAC 3DEUA 1ZAOA 1P2FA 4LFUA 3HSEA 1QNTA 1U5TA 4GXOA 1BIAA 4OIRF 4EV0A 1QQIA 1SMYF 3FXQA 1FX7A 1IXRC 5K5RA 5AIPA 3I54A 2JPCA 2HQRA 4PZJA 2K4JA 3BROA 3GYHX 2IPQX 3ZMTA 4M6XA 3FMRA 2ZXJA 3KLOA 4Y13A 1S3JA 4PCQA 2XRNA 5D5XB 3I53A 1R7JA 2QQ9A 4R1HA 2DPDA 3N4MA 5BOXA 3WE2A 4BYYA 3IRRA 4L5IA 2M1BA 4MGRA 1XGNA 2VBYA 4BXUA 5CYVA 4A6DA 2PMUA 1JHHA 2ZFWA 2GXBA 1MJ9A 3GEZA 2O61A 3NRVA 2VODA 3D0SA 4UNOA 3ZN1A 1K79A 5H20A 2IJLA 3SZPA 5K5OA 5L3FA 2MH9A 2D45A 2A07F 2VT2A 4LLGF 1HKSA 1SD6A 4B09A 4BHPA 3HSRA 3P9IA 3MAJA 4WWCA 1LEAA 3J81Z 2KIFA 3GX4X 1STZA 3CDHA 1OKRA 4Y15A 3BPVA 4E70A 3W6JB 4RAZA 2NNNA 5LRRA 4HDVA 1O3QA 2VBXA 2P5KA 1FYLA 1D8KA 4B8XA 2K27A 2HYGD 3CUOA 5LGNA 3TO9A 2RQPA 1Z6RA 3TOAA 3MFKA 2H09A 3DP7A 5L3GA 2DTRA 3WE3A 3WODF 5E1ZB 2FBIA 3MZHA 2DAOA 2XGXA 2K86A 3LA3A 1J2XA 2O8XA 5DDGA 3I71A 2VT3A 4G8XA 3WTXC 2W57A 4I02A 2GWRA 3HYIA 4YG2F 1HW5A 3JAMZ 1BM9A 1O57A 4EGZA 3KEQA 1XSVA 3R0JA 2LNBA 2TDXA 4L9VA 5HLGA 2VE9A 1XMKA 3E97A 3KFWX 3NQOA 2JT1A 4GYIA 4CHUA 1XD7A 4XSXF 2ZKZA 3M9AA 1R58A 2XAHA 2VOOA 4UXNA 4RGXA 3E6DA 2VONA 3SFZA 4G7OF 3Q5FA 2ZCWA 3VB2A 2NAZA 3JTGA 3IRQA 3DF8A 3PFIA 4M71A 4CO8A 2F2EA 5E17F 2C6YA 4RGRA 1T6SA 1P4WA 3WTYC 1YW9A 1YS7A 5BS6A 1ZREA 3T5XA 2IA0A 2J5OA 4XBFA 2LDUA 2BGCA 3R0AA 2H27A 5ICFA 4HA8A 2DQRA 3K69A 3T8RA 1FC3A 1U6GA 3FZVA 3VEPA 4YFNF 2HKOA 3I0TA 2EK5A 1ZH5A 1XDUA 1MKMA 4OOIA 1YQAA 2EA4A 5D5UB 1PP7U 4U0YA 5DUIA 4HAMA 3CTAA 2ZBKA 4EM2A 4ZYEA 4N9HA 2B0LA 4FHTA 4MEYF 3K0LA 2FRHA 1J0RA 1FLIA 1D5VA 1ZG1A 2EV5A 3GZ6A 1HXDA 4EJWA 1ZG3A 3WTZA 1G3TA 4ENJA 5HOOA 3HRTA 4BQAA 1R22A 2DPUA 1O3RA 5LEJA 1B4AA 4EJUA 4ZYDA 2DFIA 2KRFA 2VE8A 3LQQA 3ML6A 4G7ZF 1YO5C 4ZYHA 1GHCA 1P92A 2Q2EA 4HW0A 2QM3A 1HSJA 4GCVA 3RKYA 1Y0UA 3P9KA 3QU6A 2BV6A 1KYWA 4AIHA 3K1NA 2XASA 3FMSA 1KQ8A 3ECHA 3RYPA 3DXJF 3U9GA 1YW8A 3E3VA 3PQKA 2QBYB 4U0WA 1R00A 2COMA 5K1YA 2A6EF 1HW2A 3KZZA 2MH2A 3ULQB 4P96A 1B9MA 4YFXF 4M74A 4KIGA 5IT9K 1Z9CA 1WI9A 3P7NA 4NB5A 1B9NA 4ESBA 3L7WA 3P9CA 1CF7A 1IZ1A 3LA2A 3EDPA 4KYWA 4ZYGA 3REOA 5LHHA 3QP5A 1I27A 2L4MA 2M45A 1R5HA 3R60A 1B1BA 1SAXA 2RGVA 2VN2A 5EEGA 3RIRA 1OR7A 2FBHA 4L0ZB 2CWEA 5F64A 2HOEA 5JR3A 3VODA 4KIFA 3DQVC 3GXOA 1QPMA 5EEHA 4IRHA 4N9IA 2CYYA 3KZYA 3DV8A 4U88A 4MQ9F 3EQLF 3MZYA 1YG2A 3TOBA 1F5TA 3RPUA 4Q48A 3EETA 3GWZA 1U2WA 1ZLJA 4EJVA 5CVVA 2F5EA 2BE5F 4EMSA 1AWCA 2Q0OA 2KIMA 3GFMA 3ECOA 3BJOA 1J75A 1BI0A 4A5MA 3I5UA 4UHTA 1REPC 4KN4X 2WTEA 1G3YA 1W7PB 2K7LA 1FNNA 3MQ0A 5LRSA 3CO7C 2FBKA 4I09A 4LG0A 5JFRA 4A2UA 1ULYA 3RI4A 2G7UA 2XAQA 2AS5F 1MJBA 2V79A 5LHIA 4RAYA 4M9XA 2EWNA 5FD5A 1LVAA 1WSUA 5HS7A 4MTDA 2DBBA 2FNAA 2MLKA 5D4RA 1SD5A 2EFNA 2HTJA 5L3CA 2W25A 2XV4S 2V1XA 3QRFF 4ZZDA 2HYFA 2P6SA 3KLNA 1W5SA 4PGHA 1KU7A 2ADUA 1HQCA 4RS8A 3E5UA 4LG0B 4EGYA 1BC8C 3TKYA 4KT5C 2Y0MA 3E6BA 1MGTA 4LLLA 2XKPA 1F4KA 2A6HF 1QBJA 1KA8A 1BJAA 2QLZA 4GGGA 5H6RA 5ILSA 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B59 A;  1W7P D;  1XGO A;  3M8E A;  2G7H A;  5A2Q K;  1SD7 A;  1HBX G;  4A12 A;  1H0M A;  3GO5 A;  3O6B B;  2XAF A;  1U5T B;  1XB4 A;  3BJ6 A;  5JI6 A;  2ZO4 A;  1UHW A;  2Z3Y A;  1MJA A;  2RNJ A;  4Q4Z F;  1XDS A;  5CVU A;  2PN6 A;  4M73 A;  2IW5 A;  2GA1 A;  4LK0 F;  4G6D A;  4WCG A;  3KCC A;  4XSZ F;  5DEQ A;  3MCZ A;  1R5G A;  1X3U A;  2VXZ A;  1W5T A;  3HRU A;  2DW4 A;  3I4P A;  3IHU A;  3J80 K;  3JSP A;  2V1U A;  2MBF A;  4R8H A;  1Z91 A;  4IVN A;  2HTS A;  4S04 A;  4NQW A;  4I98 B;  2QZ8 A;  2L3D A;  2UXX A;  3RTR A;  3KP3 A;  1D8J A;  4P9U A;  1ONV A;  5BQT A;  4IF4 A;  5AON A;  1R36 A;  3QU3 A;  2PG4 A;  4I7H A;  2V1D A;  5KK1 A;  5LLQ A;  5FFZ A;  1XSX A;  3GFL A;  1G6N A;  1DPR A;  4BH9 A;  1TLH B;  3U2R A;  3KP4 A;  1LB2 A;  3ZMU A;  1KQ0 A;  1QO0 D;  3O3K A;  5D5W B;  2RVC A;  4GO1 A;  4I2O A;  2V9V A;  3WTS C;  1FY7 A;  3M8F A;  1BI3 A;  2RN7 A;  2G9W A;  2HS5 A;  2DQL A;  4L9T A;  2IT0 A;  2W85 A;  4EM1 A;  3FHZ A;  3MWM A;  5LHG A;  2VBZ A;  3LA7 A;  4Q5S F;  1RI7 A;  2QQA A;  4L9N A;  1T38 A;  3C3W A;  4WF2 A;  3RDI A;  2O6G E;  4N0B A;  2K02 A;  4LLN A;  4U0V A;  4UVC A;  2Z5U A;  3V7C A;  3GUD A;  2GAU A;  1P4A A;  4MHG A;  2A69 F;  3RKW A;  4RB2 C;  1KGS A;  4PGG A;  5ICE A;  1U5T C;  2FMY A;  4LB6 B;  1U3E M;  1IAW A;  4IRI A;  1LJ9 A;  3V4G A;  4LK1 F;  3G3Z A;  2HR3 A;  3KE2 A;  1T39 A;  3C1D A;  1V4R A;  4OIQ F;  5FLX K;  3CUQ A;  2WV0 A;  4ESJ A;  3L00 A;  3WU0 A;  4JQF A;  2FA5 A;  3IKV A;  2IRF G;  5E8G A;  1XMA A;  2MC3 A;  2P5V A;  3W6K B;  2Z9O A;  2D1V A;  2GZW A;  1ZGJ A;  2WWY A;  3VOE A;  1XCV A;  1ZYR F;  1Z6T A;  5HLI A;  5TRD A;  3DPL C;  2ETH A;  3F8B A;  2BYV E;  2KIU A;  2W84 A;  4MQV A;  1G4D A;  5IT9 Z;  2PLY A;  1RUN A;  3EUH A;  1ZGA A;  5DCM A;  1J9I A;  2CO5 A;  1WKM A;  3HUG A;  1T0F A;  4M72 A;  3EYY A;  1IUY A;  1TQM A;  2EV6 A;  3Q9S A;  2BBY A;  5J8F A;  3HTS B;  2A5Y B;  3CUQ B;  1FBS A;  2XKO A;  3RKX A;  3WTV C;  2WC2 A;  4WXC A;  2VC0 A;  2P7V B;  1DDN A;  3V8L A;  4P55 A;  1ZRF A;  3V7R A;  5J8C A;  4CZZ A;  2HQN A;  2X0L A;  3ZMV A;  5HVQ C;  2LKP A;  2IA2 A;  1Z7U A;  1TBX A;  3SHF A;  3GFI A;  3S2W A;  3DKW A;  4AD9 A;  1KQ9 A;  2D1H A;  4BNC A;  3SXY A;  4BHB A;  2XAG A;  5E1X A;  2L01 A;  1VTN C;  1UHM A;  4A6E A;  5HLH A;  3ZMD A;  1I5Z A;  1K6O A;  3T0Y A;  3CJN A;  1FT9 A;  3F3X A;  1EH8 A;  5D4S A;  3F6V A;  1H9G A;  3ZN0 A;  1L0O C;  1S29 A;  3F8F A;  3K9T A;  2FE3 A;  3KET A;  2H6B A;  3IWZ A;  4RGU A;  3V7S A;  1S6L A;  4D0P A;  2CFX A;  3FX3 A;  1GXP A;  2HEO A;  1WQ2 A;  2A68 F;  2EJR A;  2QEN A;  3F8N A;  3Q9V A;  4IHS A;  1L3L A;  4G9Y A;  2LSO A;  1OMI A;  2OZU A;  1BOA A;  4ASN A;  2FF4 A;  3HIF A;  4AWX B;  1Q1H A;  1FP1 D;  2OZ6 A;  5DD8 A;  2GXG A;  1ON2 A;  2YU3 A;  2XVC A;  3JSO A;  4KFC A;  1YS6 A;  3WGH A;  3K1M A;  1ZRC A;  3F72 A;  2QUF A;  1SFU A;  1ZLK A;  1JGS A;  4L9J A;  4WX9 A;  5F1R A;  3I64 A;  4HLX A;  3L09 A;  5ICG A;  4QWQ A;  4FT8 A;  5KVR A;  2DK5 A;  4HF2 A;  1U8R A;  1Z1D A;  5HDN A;  3K1P A;  4KMF A;  2ESH A;  1V3F A;  4FX4 A;  3HRS A;  4F7Z A;  3TQN A;  1R1U A;  3GFJ A;  5LGU A;  1RNL A;  4MTE A;  5D5V B;  4S05 A;  4LMY A;  1O7L A;  5E8I A;  1TQP A;  2L54 A;  1DP7 P;  3L2C A;  3U1D A;  5BMZ A;  2PJP A;  5D8L B;  4G7H F;  4NHJ A;  1JXS A;  2O0Y A;  1RZ4 A;  2JSC A;  2JPB A;  4ENN A;  1U78 A;  3F22 A;  2E1C A;  5A2Q Z;  2QQB A;  1ZN2 A;  2F5C A;  2A3S A;  3GZ5 A;  2M30 A;  4AVP A;  2FXA A;  3ELK A;  1NHA A;  4HDU A;  1USS A;  4M6Y A;  3WTT C;  3B02 A;  4RB0 A;  5E20 A;  2ZME A;  2M8E A;  4G6Q A;  3IL2 A;  1KU9 A;  3F21 A;  3HHH A;  5K5Q A;  4U7D A;  2K4B A;  3BJA A;  1MDM A;  3COA C;  3I59 A;  1CF7 B;  3J80 Z;  4L0Y B;  4ZH4 F;  3LFK A;  2P4W A;  1T98 A;  3T1B A;  4EJT A;  3WGI A;  5ERI A;  1ZHF A;  2IA1 A;  2X4H A;  1LQ1 A;  3K2Z A;  1J59 A;  1IN7 A;  4A0Z A;  5ILU A;  2HGC A;  4PDK A;  3F8C A;  3ISP A;  3HOS A;  4IHT A;  5HDK A;  2XIG A;  1K7A A;  1PUE E;  2MD5 A;  2ESN A;  5FO5 A;  4H0E A;  2AXL A;  3IWF A;  1A04 A;  1FP2 A;  2HWV A;  2PQ8 A;  1IRF A;  2V6C A;  3GVA A;  1J5Y A;  4OMZ A;  3TDZ C;  5J6X A;  4O5V A;  2DT5 A;  2XUB A;  1UCR A;  2PI0 A;  1JHF A;  5DYM A;  1IF1 A;  3H92 A;  3FMQ A;  4GYG A;  3ZP5 A;  1PP8 F;  1F1Z A;  1XCB A;  4Z2Y A;  3T8T A;  1QZZ A;  5L3D A;  4A0X A;  1YTY A;  1FBQ A;  3G73 A;  5TJJ A;  4KIB A;  5IT3 A;  4HQM A;  2NS0 A;  2FEZ A;  4MNU A;  2LF8 A;  3ZQ7 A;  2E7X A;  4XRF A;  4EVI A;  4HV5 A;  3FXR A;  6PAX A;  5JHU A;  4WXH A;  3TO7 A;  5FLX Z;  4AIJ A;  2W24 A;  4EJO A;  2MA3 A;  4U7B A;  2CW0 F;  3FXU A;  5HS8 A;  4OIO F;  5D6F A;  2Q8K A;  1UST A;  3TGN A;  1J7K A;  1YFH A;  1XSD A;  3V8K A;  2DI3 A;  3GLX A;  2PBI A;  3OOP A;  2FU4 A;  3VFZ A;  3HHG A;  1BBY A;  5E1W A;  1EH6 A;  1HW1 A;  3F6O A;  2ZNY A;  1KU3 A;  2UWM A;  4ZZL A;  2FML A;  2OU2 A;  3ROU A;  4ENK A;  3R6S A;  1S7O A;  1D3Y A;  2Z33 A;  2EFO A;  2FQ3 A;  3E6M A;  4KUM A;  3EYI A;  4LB5 A;  3HOT A;  2MLG A;  1XGM A;  1IXS B;  3CLO A;  2LF7 A;  2XRO A;  4CXF A;  5HDG A;  2JTV A;  2DK8 A;  2PFB A;  4XLP F;  4DQ2 A;  2CGP A;  1ODD A;  4WK8 F;  4EM0 B;  4OMY A;  4WXD A;  2O3F A;  2GIV A;  2VBW A;  5DV5 A;  2UZK A;  4Y17 A;  1FSH A;  1DUX C;  2EV0 A;  1FPQ A;  3R4K A;  2STW A;  4HOB A;  1IN5 A;  3E6C C;  5AIQ A;  1G3S A;  2IVM A;  3LST A;  1IW7 F;  5BPD A;  3RJP A;  2PMH A;  1WWX A;  2R7F A;  1RUO A;  2EFQ A;  2OQR A;  5FD6 A;  3SQN A;  2DU9 A;  4MEX F;  5L3E A;  1BI2 A;  4OIP F;  1XGS A;  1Z05 A;  5DUK A;  2R3S A;  3QPT A;  5CVJ A;  4BHC A;  3N97 A;  5DD4 A;  1JE8 A;  2Y75 A;  3M7G A;  1ON1 A;  4HF0 A;  2RKH A;  4YIF A;  3B73 A;  2EFW A;  4A0Y A;  2XAJ A;  1O3S A;  2YR2 A;  4HLY A;  3BPX A;  3QAH A;  4QLC U;  2P5L C;  4HQE A;  1UFM A;  4RB3 C;  4OIN F;  4UVB A;  1OPC A;  4BAY A;  3KEO A;  1FSE A;  5JVT A;  4ENM A;  3KP7 A;  5ILV A;  4YFK F;  2QWW A;  4JBA A;  2GA2 A;  2STT A;  4KNY A;  2JZY A;  1HST A;  5FB2 A;  2R7D A;  3E5Q A;  5D6E A;  3GW2 A;  1QZY A;  3R61 A;  5ED4 A;  1TNS A;  1TNT A;  1BI1 A;  1TW2 A;  3JW4 A;  1P6R A;  1R1T A;  3ABU A;  4IJA A;  3H3U A;  5CJ9 A;  2OBP A;  4TV7 A;  2DLL A;  5CVI A;  1TQI A;  1T2K A;  1R23 A;  4LJZ F;  3C7J A;  3WTU C;  3ZMS A;  2OQG A;  5E18 F;  2FOK A;  2IP2 A;  2A61 A;  1I1S A;  1IN8 A;  1CGP A;  2YX7 A;  1O3T A;  1F9N A;  1LNW A;  5HS9 A;  2CG4 A;  3D5L A;  2ELH A;  1FBU A;  2OA4 A;  1MZB A;  3WTW C;  2XHK A;  4CDG A;  3HRM A;  4R79 A;  2HKX A;  3DFG A;  1EH7 A;  1E2X A;  5D8K B;  2P7C B;  2L4A A;  1GXQ A;  2P6T A;  1FOK A;  2H94 A;  1YLF A;  2F5D A;  4AIK A;  2ISZ A;  4HX7 A;  4KN7 X;  4ON0 A;  4HZF A;  2ISY A;  2QYO A;  3HTU A;  2M87 A;  5DCM B;  1G3W A;  4UV8 A;  2RV8 A;  2L02 A;  3IC7 A;  2OD5 A;  4RGS A;  2KJC A;  1IXC A;  3C18 A;  1MD0 A;  1PDN C;  2EB7 A;  3J81 K;  1TTY A;  2EFP A;  4IXA A;  5LEK A;  4I0B A;  3F23 A;  4XLN F;  1EV7 A;  4JK1 X;  2VC1 A;  3IKT A;  4HF1 A;  3O2P E;  2HZT A;  3FM3 A;  3PQJ A;  3QPH A;  3BP8 A;  1YYV A;  3BDD A;  3ZPL A;  2KJB A;  4P9F A;  3KP5 A;  4KA4 A;  1GVJ A;  2NYX A;  2RC4 A;  1I6X A;  1I1G A;  4ETS A;  4O3M A;  2CQK A;  3FM5 A;  1LDK B;  2QBY A;  2Y48 A;  3OV8 A;  4ESF A;  1ZG5 A;  3MEX A;  3CUQ C;  4FX0 A;  1K78 A;  3FWE A;  3WG9 A;  3GF2 A;  4HX4 A;  4UUV A;  5H6Q A;  1KYZ A;  4G94 A;  1R1V A;  3JTH A;  1BN5 A;  2M5W A;  1IN4 A;  4M9Z A;  3LWF A;  4A5N A;  3JAM K;  2JRT A;  4UVA A;  3RPQ A;  5LBQ A;  1FWZ A;  4HYE A;  1SFE A;  2DO7 A;  5F6F A;  1K78 B;  3DPT A;  5FGM A;  4KIC A;  1LDD A;  4KDP A;  3F8M A;  3BOQ A;  2O03 A;  1C0W A;  3BWG A;  1SMT A;  1KU2 A;  3L9F A;  1IN6 A;  3V8J A;  2E1N A;  3QP6 A;  1LEB A;  2FNP A;  3LAP A;  2F5F A;  4HX8 A;  2P8T A;  4UV9 A;  1WRJ A;  3E5X A;  4L18 B;  1XN7 A;  5LGT A;  1E17 A;  1W4M A;  2BEO A;  4IPA A;  1SFX A;  1FYK A;  4OU0 A;  4HBL A;  4K2E A;  2YSR A;  3I58 A;  2HDC A;  3ZMZ A;  4CIC A;  2KKO A;  3J7A O;  3NEU A;  3FF5 A;  1W7P A;  2PEX A;  3KP2 A;  3RYR A;  3WU1 B;  2D2W A;  3H3Z A;  5ICC A;  2VOP A;  1B6A A;  1P4X A;  5FFX A;  3LQR A;  5BPI A;  4KMU X;  1LDJ A;  3KP6 A;  1QGP A;  1UB9 A;  1S8N A;  2YPR A;  4Q47 A;  2ZME B;  5CLS A;  2RDP A;  1RIO H;  1SD4 A;  4HV6 A;  4RB1 A;  1FZP B;  3M1E A;  2Z99 A;  2ZJ2 A;  1OYW A;  4LD5 A;  2E7W A;  2NNY A;  2OAZ A;  5DCF A;  2UXN A;  1MDM B;  3I59 B;  4I0A A;  1YIO A;  2HFH A;  2J5P A;  4M9S A;  1IRG A;  1FYM A;  3CO6 C;  4P5O A;  4CYD A;  4I01 A;  1DPU A;  1BIB A;  5L3B A;  1YW7 A;  2GQQ A;  3SZT A;  2ZNZ A;  2FSW A;  5CVR A;  1ZAR A;  2ACJ A;  3WGG A;  1HKQ A;  1BC7 C;  3ERE D;  1O7F A;  3TO6 A;  2EA2 A;  2H6C A;  3BY6 A;  4O6J A;  2YX4 A;  3HSF A;  3QOP A;  2QVO A;  1AOY A;  4LGW A;  1ZRD A;  4YII A;  3AAF A;  1S7A A;  4CGZ A;  1TW3 A;  2CSO A;  1OYI A;  4DNC A;  3ABT A;  4EQQ A;  3LAJ A;  4IRG A;  3BZ6 A;  4L5J A;  3TDU C;  1OYY A;  1HKT A;  2NRA C;  3DEU A;  1ZAO A;  1P2F A;  4LFU A;  3HSE A;  1QNT A;  1U5T A;  4GXO A;  1BIA A;  4OIR F;  4EV0 A;  1QQI A;  1SMY F;  3FXQ A;  1FX7 A;  1IXR C;  5K5R A;  5AIP A;  3I54 A;  2JPC A;  2HQR A;  4PZJ A;  2K4J A;  3BRO A;  3GYH X;  2IPQ X;  3ZMT A;  4M6X A;  3FMR A;  2ZXJ A;  3KLO A;  4Y13 A;  1S3J A;  4PCQ A;  2XRN A;  5D5X B;  3I53 A;  1R7J A;  2QQ9 A;  4R1H A;  2DPD A;  3N4M A;  5BOX A;  3WE2 A;  4BYY A;  3IRR A;  4L5I A;  2M1B A;  4MGR A;  1XGN A;  2VBY A;  4BXU A;  5CYV A;  4A6D A;  2PMU A;  1JHH A;  2ZFW A;  2GXB A;  1MJ9 A;  3GEZ A;  2O61 A;  3NRV A;  2VOD A;  3D0S A;  4UNO A;  3ZN1 A;  1K79 A;  5H20 A;  2IJL A;  3SZP A;  5K5O A;  5L3F A;  2MH9 A;  2D45 A;  2A07 F;  2VT2 A;  4LLG F;  1HKS A;  1SD6 A;  4B09 A;  4BHP A;  3HSR A;  3P9I A;  3MAJ A;  4WWC A;  1LEA A;  3J81 Z;  2KIF A;  3GX4 X;  1STZ A;  3CDH A;  1OKR A;  4Y15 A;  3BPV A;  4E70 A;  3W6J B;  4RAZ A;  2NNN A;  5LRR A;  4HDV A;  1O3Q A;  2VBX A;  2P5K A;  1FYL A;  1D8K A;  4B8X A;  2K27 A;  2HYG D;  3CUO A;  5LGN A;  3TO9 A;  2RQP A;  1Z6R A;  3TOA A;  3MFK A;  2H09 A;  3DP7 A;  5L3G A;  2DTR A;  3WE3 A;  3WOD F;  5E1Z B;  2FBI A;  3MZH A;  2DAO A;  2XGX A;  2K86 A;  3LA3 A;  1J2X A;  2O8X A;  5DDG A;  3I71 A;  2VT3 A;  4G8X A;  3WTX C;  2W57 A;  4I02 A;  2GWR A;  3HYI A;  4YG2 F;  1HW5 A;  3JAM Z;  1BM9 A;  1O57 A;  4EGZ A;  3KEQ A;  1XSV A;  3R0J A;  2LNB A;  2TDX A;  4L9V A;  5HLG A;  2VE9 A;  1XMK A;  3E97 A;  3KFW X;  3NQO A;  2JT1 A;  4GYI A;  4CHU A;  1XD7 A;  4XSX F;  2ZKZ A;  3M9A A;  1R58 A;  2XAH A;  2VOO A;  4UXN A;  4RGX A;  3E6D A;  2VON A;  3SFZ A;  4G7O F;  3Q5F A;  2ZCW A;  3VB2 A;  2NAZ A;  3JTG A;  3IRQ A;  3DF8 A;  3PFI A;  4M71 A;  4CO8 A;  2F2E A;  5E17 F;  2C6Y A;  4RGR A;  1T6S A;  1P4W A;  3WTY C;  1YW9 A;  1YS7 A;  5BS6 A;  1ZRE A;  3T5X A;  2IA0 A;  2J5O A;  4XBF A;  2LDU A;  2BGC A;  3R0A A;  2H27 A;  5ICF A;  4HA8 A;  2DQR A;  3K69 A;  3T8R A;  1FC3 A;  1U6G A;  3FZV A;  3VEP A;  4YFN F;  2HKO A;  3I0T A;  2EK5 A;  1ZH5 A;  1XDU A;  1MKM A;  4OOI A;  1YQA A;  2EA4 A;  5D5U B;  1PP7 U;  4U0Y A;  5DUI A;  4HAM A;  3CTA A;  2ZBK A;  4EM2 A;  4ZYE A;  4N9H A;  2B0L A;  4FHT A;  4MEY F;  3K0L A;  2FRH A;  1J0R A;  1FLI A;  1D5V A;  1ZG1 A;  2EV5 A;  3GZ6 A;  1HXD A;  4EJW A;  1ZG3 A;  3WTZ A;  1G3T A;  4ENJ A;  5HOO A;  3HRT A;  4BQA A;  1R22 A;  2DPU A;  1O3R A;  5LEJ A;  1B4A A;  4EJU A;  4ZYD A;  2DFI A;  2KRF A;  2VE8 A;  3LQQ A;  3ML6 A;  4G7Z F;  1YO5 C;  4ZYH A;  1GHC A;  1P92 A;  2Q2E A;  4HW0 A;  2QM3 A;  1HSJ A;  4GCV A;  3RKY A;  1Y0U A;  3P9K A;  3QU6 A;  2BV6 A;  1KYW A;  4AIH A;  3K1N A;  2XAS A;  3FMS A;  1KQ8 A;  3ECH A;  3RYP A;  3DXJ F;  3U9G A;  1YW8 A;  3E3V A;  3PQK A;  2QBY B;  4U0W A;  1R00 A;  2COM A;  5K1Y A;  2A6E F;  1HW2 A;  3KZZ A;  2MH2 A;  3ULQ B;  4P96 A;  1B9M A;  4YFX F;  4M74 A;  4KIG A;  5IT9 K;  1Z9C A;  1WI9 A;  3P7N A;  4NB5 A;  1B9N A;  4ESB A;  3L7W A;  3P9C A;  1CF7 A;  1IZ1 A;  3LA2 A;  3EDP A;  4KYW A;  4ZYG A;  3REO A;  5LHH A;  3QP5 A;  1I27 A;  2L4M A;  2M45 A;  1R5H A;  3R60 A;  1B1B A;  1SAX A;  2RGV A;  2VN2 A;  5EEG A;  3RIR A;  1OR7 A;  2FBH A;  4L0Z B;  2CWE A;  5F64 A;  2HOE A;  5JR3 A;  3VOD A;  4KIF A;  3DQV C;  3GXO A;  1QPM A;  5EEH A;  4IRH A;  4N9I A;  2CYY A;  3KZY A;  3DV8 A;  4U88 A;  4MQ9 F;  3EQL F;  3MZY A;  1YG2 A;  3TOB A;  1F5T A;  3RPU A;  4Q48 A;  3EET A;  3GWZ A;  1U2W A;  1ZLJ A;  4EJV A;  5CVV A;  2F5E A;  2BE5 F;  4EMS A;  1AWC A;  2Q0O A;  2KIM A;  3GFM A;  3ECO A;  3BJO A;  1J75 A;  1BI0 A;  4A5M A;  3I5U A;  4UHT A;  1REP C;  4KN4 X;  2WTE A;  1G3Y A;  1W7P B;  2K7L A;  1FNN A;  3MQ0 A;  5LRS A;  3CO7 C;  2FBK A;  4I09 A;  4LG0 A;  5JFR A;  4A2U A;  1ULY A;  3RI4 A;  2G7U A;  2XAQ A;  2AS5 F;  1MJB A;  2V79 A;  5LHI A;  4RAY A;  4M9X A;  2EWN A;  5FD5 A;  1LVA A;  1WSU A;  5HS7 A;  4MTD A;  2DBB A;  2FNA A;  2MLK A;  5D4R A;  1SD5 A;  2EFN A;  2HTJ A;  5L3C A;  2W25 A;  2XV4 S;  2V1X A;  3QRF F;  4ZZD A;  2HYF A;  2P6S A;  3KLN A;  1W5S A;  4PGH A;  1KU7 A;  2ADU A;  1HQC A;  4RS8 A;  3E5U A;  4LG0 B;  4EGY A;  1BC8 C;  3TKY A;  4KT5 C;  2Y0M A;  3E6B A;  1MGT A;  4LLL A;  2XKP A;  1F4K A;  2A6H F;  1QBJ A;  1KA8 A;  1BJA A;  2QLZ A;  4GGG A;  5H6R A;  5ILS A;  1H9T A; 
#chains in the Genus database with same CATH topology
 4M3E A;  4HNT A;  1B59 A;  4B44 A;  1Y0N A;  1W7P D;  1XGO A;  3M8E A;  4W1U A;  2G7H A;  4PJJ A;  3BG6 A;  5M5Y J;  1SD7 A;  5A2Q K;  2KDZ A;  1HBX G;  4A12 A;  3VYT B;  1H0M A;  1Q1V A;  2CW8 A;  2X9D A;  3GO5 A;  2OTJ I;  2BOL A;  3BR2 A;  3W2W A;  2IGN A;  3KPH A;  4C3J J;  3O6B B;  2XAF A;  3CQZ J;  4PJM A;  2W7N A;  1U5T B;  3KYC B;  1QPI A;  1XB4 A;  3BJ6 A;  5JI6 A;  2ZO4 A;  4N4N B;  2VQG A;  1UHW A;  2Z3Y A;  1MJA A;  2DDA A;  2RNJ A;  4Q4Z F;  1XDS A;  3PFY A;  5CVU A;  4C2M J;  2PN6 A;  4M73 A;  2IW5 A;  2GA1 A;  5F0F A;  2RQQ A;  4G6D A;  4LK0 F;  4IZZ A;  4WCG A;  1HC8 A;  3KCC A;  3S3N A;  5GPA A;  2K3P A;  4XSZ F;  2VJJ A;  3MCZ A;  5DEQ A;  1R5G A;  1X3U A;  2VXZ A;  4OAZ A;  3ZQI A;  3G6E I;  2K9Q A;  1A35 A;  1W5T A;  2Y0S A;  3HRU A;  3HGY A;  2DW4 A;  3I4P A;  3ZCO A;  2XB5 A;  2LY2 A;  3MMY B;  2O9L A;  3IHU A;  3J80 K;  4BXF A;  4HST A;  3SDB A;  3JSP A;  2V1U A;  2MBF A;  4R8H A;  1Z91 A;  4IVN A;  3TW6 A;  2HTS A;  3QWL A;  4I99 C;  4NQW A;  4S04 A;  4I98 B;  2QZ8 A;  2L3D A;  2UXX A;  3RTR A;  3KP3 A;  1D8J A;  4P9U A;  1ONV A;  5BQT A;  4IQ4 A;  1LPQ A;  4IF4 A;  5AON A;  1R36 A;  5DTD A;  3QU3 A;  1E3H A;  1OQY A;  1WVR A;  1J09 A;  2LTP A;  2PG4 A;  4I7H A;  5TGT A;  2VKV A;  4DIQ A;  5IYB J;  2V1D A;  3I4M J;  2PMZ A;  5KK1 A;  1E3P A;  5LLQ A;  4M6V A;  5FFZ A;  1EA3 A;  1XSX A;  3GFL A;  1G6N A;  1DPR A;  4XLF A;  4BH9 A;  1WZ2 A;  1TLH B;  3M4O J;  3U2R A;  1EJ9 A;  1B8I A;  4MO7 A;  3KP4 A;  2OJE D;  5A2Q R;  1LB2 A;  3ZMU A;  3J7Z I;  1KQ0 A;  3J7A W;  1QO0 D;  1BOB A;  3O3K A;  5D5W B;  2RVC A;  1P7I A;  4JX4 A;  4GO1 A;  4I2O A;  2V9V A;  3WTS C;  1FY7 A;  3M8F A;  4E7I A;  1BI3 A;  2RN7 A;  2G9W A;  2HS5 A;  2V1N A;  2DQL A;  4L9T A;  1OCO H;  1A31 A;  2IT0 A;  3I9V 2;  2W85 A;  4EM1 A;  1YJN I;  5FRO A;  5J3L A;  3FHZ A;  2X6O A;  5GAE J;  3IH3 A;  3MWM A;  5LHG A;  1SC7 A;  2VBZ A;  4AU7 A;  3LA7 A;  3N05 A;  2JWT A;  4Q5S F;  3GTG J;  1N78 A;  2Z2S B;  2E5N A;  4E4H A;  1RI7 A;  2Y2Z A;  2QQA A;  1D1B A;  4L9N A;  1VQL I;  1T38 A;  2DDB A;  2BXY A;  2Y9Y A;  4XL9 A;  3C3W A;  4WF2 A;  3RDI A;  2O6G E;  4BE0 A;  1Y1V J;  2JVH A;  4N0B A;  3J80 R;  2K02 A;  4LLN A;  2DT7 B;  3MN2 A;  1LE8 A;  4U0V A;  4UVC A;  1GT0 C;  2Z5U A;  2VIX A;  3V7C A;  3GUD A;  2GAU A;  5FLM J;  3Q0V A;  1P4A A;  4MHG A;  2A69 F;  1RC9 A;  3CES A;  3B6C A;  3RKW A;  4RB2 C;  1KGS A;  4PGG A;  5ICE A;  3MKW B;  3E1S A;  1U5T C;  2FMY A;  2JVG A;  5J1Y A;  4LB6 B;  4CH7 A;  4FE7 A;  2KZG A;  2V26 A;  3BG5 A;  4X6A J;  3W3C A;  1U3E M;  3K4B A;  2QEX I;  3K4J A;  3LSH A;  4BAC A;  1IAW A;  4IRI A;  1LJ9 A;  3V4G A;  4LK1 F;  4EAT A;  3B6A A;  2KHM A;  2HR3 A;  3G3Z A;  5EZH A;  5FKO A;  3KE2 A;  2FX0 A;  1X3Z B;  1T39 A;  2M9H A;  1V4R A;  3C1D A;  3PSI A;  4OIQ F;  5FLX K;  3CUQ A;  2WV0 A;  4ESJ A;  2LD5 A;  3L00 A;  3WU0 A;  2O5R A;  2OUM A;  4JQF A;  1ZGW A;  2FA5 A;  3IKV A;  2IRF G;  4CYC B;  1RKT A;  5E8G A;  1XMA A;  2MC3 A;  3U1K A;  3OWT A;  2P5V A;  3W6K B;  2Z9O A;  1ETV A;  2CW7 A;  2L9V A;  2D1V A;  2GZW A;  1ZGJ A;  2WWY A;  3AKZ A;  1QHH D;  3VOE A;  1LE8 B;  1XCV A;  2XGC A;  4LIU A;  1ZYR F;  1Z6T A;  5HLI A;  5TRD A;  2R7X A;  4DJA A;  2X1D A;  3DPL C;  3NWT A;  2ETH A;  2LKS A;  4BDZ A;  4GFB A;  3F8B A;  2BYV E;  4XLC A;  4RMN A;  1GVD A;  2KIU A;  2W84 A;  2JSP A;  2XGE A;  1WH5 A;  4MQV A;  3W2V A;  1G4D A;  5IT9 Z;  2HNH A;  2PLY A;  1WPK A;  1RUN A;  4YRV A;  4BY1 J;  2HYJ A;  3K4M A;  2FUG 2;  3EUH A;  3K2A A;  1ZGA A;  4RA2 A;  5DCM A;  5KHD A;  1J9I A;  2CO5 A;  3ZQQ A;  1WKM A;  3HUG A;  4XRS G;  1MBF A;  3LOC A;  1T0F A;  4M72 A;  1AHD P;  2D5V A;  3HOY J;  1WGX A;  3OMY A;  4C2U A;  3EYY A;  4XKB A;  3OSF A;  1IUY A;  1TQM A;  2EV6 A;  3PUB A;  3Q9S A;  2BBY A;  4BGD A;  1FOY A;  5J8F A;  3HTS B;  4CCK A;  2A5Y B;  3S3O A;  3CUQ B;  4HNV A;  3S32 A;  1FBS A;  2XKO A;  3P5J A;  3CP8 A;  4AYB N;  4CUG A;  3KYL A;  3RZD J;  4DGW B;  1X58 A;  3RKX A;  3WTV C;  2WC2 A;  4WXC A;  2VC0 A;  2P7V B;  1JKR C;  1DDN A;  1AA7 A;  2Y9Z A;  3V8L A;  4P55 A;  2LOO A;  3CCS I;  1ZRF A;  1X1D A;  3HB9 A;  3V7R A;  5J8C A;  4CZZ A;  4E6K G;  2HQN A;  2A5W A;  2X0L A;  3ZMV A;  3W6V A;  5IYD J;  5HVQ C;  2LKP A;  2IA2 A;  5FLX R;  1WH7 A;  2A6T A;  3WU2 C;  3H9J A;  5KAF C;  1Z7U A;  3DTI A;  1TBX A;  2NVT J;  1JJ6 C;  3SHF A;  3GFI A;  3S2W A;  3ZQF A;  3O8G A;  1IO2 A;  3AG4 H;  3DKW A;  4BY7 J;  4AD9 A;  1NG7 A;  1KQ9 A;  2D1H A;  4BNC A;  4A3K J;  3JCU C;  3SXY A;  1AKH A;  4UUT A;  4HG2 A;  4BHB A;  2HPI A;  3TL4 X;  1SAU A;  1Z7L A;  4LOC A;  2KL4 A;  4E7J A;  1ORK A;  1HF0 A;  2XAG A;  5E1X A;  2L01 A;  1YE9 A;  1QRY A;  4QTR A;  1FTZ A;  1VTN C;  1WHU A;  5GTI C;  1UHM A;  1PUF B;  4A6E A;  5HLH A;  1YHQ I;  3ZMD A;  1I5Z A;  3GLL A;  1K6O A;  2TCT A;  3T0Y A;  3CJN A;  1FT9 A;  1GV2 A;  3F3X A;  4CCJ A;  1EH8 A;  3A1Y A;  5D4S A;  3F6V A;  5EGO A;  1H9G A;  2LG4 A;  3IV5 A;  3PJR A;  3ZN0 A;  5IPA A;  2PJR A;  2JUC A;  1L0O C;  1S29 A;  4G12 A;  3F8F A;  4FE4 A;  3AG1 H;  2FE3 A;  3K9T A;  3LMM A;  2BHY A;  3KET A;  2H6B A;  3IWZ A;  4RGU A;  2MZ4 A;  2GOM A;  1IDY A;  2XSJ C;  3V7S A;  2AXT C;  2DOE A;  1S6L A;  2R7Z J;  4D0P A;  2CFX A;  3FX3 A;  3M3Y J;  1GXP A;  2KPM A;  2HEO A;  1S7E A;  1WQ2 A;  2ID3 A;  2A68 F;  2EJR A;  2QEN A;  3F8N A;  3JRA A;  1PVE A;  1MBH A;  3Q9V A;  1B72 B;  4IHS A;  1AKH B;  1L3L A;  4G9Y A;  2HZD A;  5JLW A;  2CMP A;  2LSO A;  1ZQ3 P;  3HL2 A;  1OMI A;  3VDX A;  2DXI A;  1UMQ A;  1SVM A;  2OZU A;  2VKD A;  5BNG A;  1BOA A;  4ASN A;  2FF4 A;  2O8K A;  3W2A A;  3HIF A;  4AWX B;  1Q1H A;  3A02 A;  4BJ5 C;  1N77 A;  1FP1 D;  4FET A;  2OZ6 A;  5DD8 A;  1YRN B;  2GXG A;  2L7F P;  1ON2 A;  2YU3 A;  2XVC A;  1Z3X A;  3JSO A;  4KFC A;  1YS6 A;  3WGH A;  1R4N B;  2EIJ H;  2VQH A;  4NUB A;  3K1M A;  4PFO A;  1FMW A;  2E1O A;  1ZRC A;  5B3S H;  4I76 A;  2PJR B;  1XMX A;  4RLQ A;  3F72 A;  4BQN A;  1I3Q J;  2QUF A;  1SFU A;  2KIS A;  2L0K A;  1JGS A;  4L9J A;  1ZLK A;  4BS9 A;  4WX9 A;  1IGN A;  5F1R A;  3I64 A;  3KEY A;  4HLX A;  4UB6 C;  1SAN A;  2IBD A;  3L09 A;  5ICG A;  4QWQ A;  3HOW J;  3S2D J;  4FT8 A;  3DBH B;  5KVR A;  3DPU A;  3ZQH A;  1WJB A;  3TW7 A;  2DK5 A;  4I6Z A;  4HF2 A;  1MBE A;  1U8R A;  1Z1D A;  5HDN A;  3K1P A;  4KMF A;  1Y8R B;  2WB1 A;  2ESH A;  1V3F A;  2Y31 A;  4FX4 A;  3HRS A;  1OLT A;  4F7Z A;  3BCB A;  4J00 A;  3TQN A;  1R1U A;  3GFJ A;  5LGU A;  1HLV A;  3JRF A;  3CC4 I;  1RNL A;  4MTE A;  4ZDP A;  4XIC A;  5D5V B;  4S05 A;  1VQP I;  1WJC A;  2XSD C;  2I8D A;  2HQ5 A;  2NS8 A;  3MD2 A;  2ME6 A;  4LMY A;  2F48 A;  3OYI A;  3CCL I;  3GTK J;  1O7L A;  3G1M A;  3CMM A;  5E8I A;  1TQP A;  3E7L A;  2L54 A;  4BXX J;  2XF6 A;  3S1R J;  4DYR A;  1VQK I;  1DP7 P;  3L2C A;  3U1D A;  4A3F J;  3CDL A;  5BMZ A;  2PJP A;  5D8L B;  1SVL A;  2M3A A;  4G7H F;  4XON A;  5IP6 A;  4NHJ A;  1JXS A;  1RPW A;  2O0Y A;  1HCR A;  3CJQ B;  1RZ4 A;  2JSC A;  2JPB A;  4ENN A;  1U78 A;  3DBR B;  3DEE A;  3F22 A;  4B3X A;  2E1C A;  5A2Q Z;  1A36 A;  2HVQ A;  2KRH A;  2QQB A;  2QKM B;  2L5Q A;  1OFC X;  3K4N A;  2CV2 A;  1UG2 A;  4XN0 A;  1ZN2 A;  1XC5 A;  2F5C A;  2A3S A;  3GZ5 A;  2M30 A;  4AVP A;  4KT6 A;  2FXA A;  3ELK A;  2R5Z A;  2OCE A;  3Q3S A;  1NHA A;  4HDU A;  1USS A;  2DMP A;  4N4O B;  4M6Y A;  3WTT C;  3B02 A;  2NVX J;  4RB0 A;  5E20 A;  2ZME A;  3BLY A;  2M8E A;  1ENH A;  4CCO A;  4D5F A;  3A01 A;  4G6Q A;  1AU7 A;  3IL2 A;  2Y0S N;  3EUA A;  1KU9 A;  3F21 A;  2B7E A;  3HHH A;  4IHX A;  2B63 J;  3VSL A;  3OYD A;  5K5Q A;  4NBQ A;  4U7D A;  2K4B A;  3GTJ J;  2ZB9 A;  4BKX A;  3BJA A;  1MDM A;  3PUF A;  3LSJ A;  3COA C;  3I59 A;  4B4C A;  1CF7 B;  1Z67 A;  1APL C;  3J80 Z;  4L0Y B;  4DZJ A;  4ZDL A;  4ZH4 F;  3LFK A;  2E34 A;  2P4W A;  1T98 A;  3AG2 H;  3T1B A;  3BCA A;  3JRI A;  4EJT A;  3WGI A;  5J1R A;  3OS2 A;  4C30 A;  1X3W B;  3H0D A;  3CC7 I;  1VND A;  5ERI A;  1ZHF A;  2IA1 A;  2X4H A;  5B1A H;  1LQ1 A;  5FKM A;  3K2Z A;  2PMZ N;  4V2F A;  4GDF A;  1TWA J;  4U87 A;  1J59 A;  2CRG A;  1IN7 A;  2MSY A;  4A0Z A;  5ILU A;  1FTT A;  2HGC A;  4PDK A;  2HVS A;  2BY1 A;  2OV7 A;  3F8C A;  3ISP A;  3HOS A;  2E35 A;  3HM5 A;  4IHT A;  2VJ5 A;  5HDK A;  2XIG A;  1RRJ A;  1K7A A;  1PUE E;  1NTC A;  2IGM A;  2MD5 A;  4MFD A;  2ESN A;  5FO5 A;  3BZC A;  1MMS A;  4H0E A;  2AXL A;  2BHZ A;  3IWF A;  1A04 A;  3A01 B;  1FP2 A;  2HWV A;  2PQ8 A;  1IRF A;  2OC6 A;  2V6C A;  3CJT B;  5EDN A;  3GVA A;  1HA8 A;  3LFU A;  1J5Y A;  1X1B A;  2XC7 A;  4OMZ A;  2ZXW H;  2DMN A;  3TDZ C;  5J6X A;  4O5V A;  2DT5 A;  3ZXS A;  3MKZ A;  1YI2 I;  4ZYA A;  2XUB A;  3FBI B;  1UCR A;  1OCZ H;  3KX2 A;  2COB A;  5JLX A;  2R7U A;  2PI0 A;  2IGO A;  2XRL A;  1JHF A;  1DP3 A;  2X6W A;  5DYM A;  1IF1 A;  3H92 A;  3OYH A;  3FMQ A;  4GYG A;  3ZP5 A;  1PP8 F;  3OYJ A;  3QQA A;  1F1Z A;  5FKN A;  1XCB A;  2FJ1 A;  3FKJ A;  4Z2Y A;  1LUJ B;  3T8T A;  1QZZ A;  5L3D A;  2P81 A;  1JTX A;  4A0X A;  5GAG J;  1YTY A;  3ZGK A;  4RBO A;  4ZTF A;  1XPX A;  1FBQ A;  2EIK H;  1V54 H;  2WY8 Q;  3G73 A;  5JVG F;  5TJJ A;  2DMQ A;  4KIB A;  4Y33 A;  2QSG X;  5IT3 A;  1R6R A;  4RM3 A;  4HQM A;  2DYR H;  2NS0 A;  4XMY A;  2K3F A;  3CMA I;  1E0E A;  4CCN A;  1X2N A;  2FEZ A;  2DT6 A;  3U21 A;  4HNU A;  5FLV A;  3PM1 A;  4MNU A;  2LF8 A;  5K7F A;  4ZDO A;  1EKE A;  1MNE A;  3ZQ7 A;  2E7X A;  2VLA A;  3D5R C;  4PK4 A;  4XRF A;  4EVI A;  2MFZ A;  4HV5 A;  3FXL A;  3FXR A;  1MSF C;  6PAX A;  5JHU A;  4WXH A;  3TO7 A;  1ETO A;  5M5X J;  5FLX Z;  5J47 A;  3PSF A;  4AIJ A;  2W24 A;  1R71 A;  4EJO A;  2CUJ A;  4DYC A;  1VQ5 I;  2MA3 A;  4U7B A;  1IRZ A;  3TP0 A;  1H8A C;  1VF9 A;  2CU7 A;  2I5U A;  4BUP A;  2CW0 F;  3FXU A;  3GCM A;  5HS8 A;  4OIO F;  5D6F A;  2Q8K A;  1UST A;  1YIJ I;  3TGN A;  1QU3 A;  1J7K A;  3BR0 A;  1YFH A;  3PO2 J;  1XSD A;  4A3B J;  3F9K A;  3V8K A;  3S3M A;  5IOZ A;  1GDT A;  2DI3 A;  2R7V A;  3CZ6 A;  4C3H J;  3GLX A;  2PBI A;  3IAS 2;  3OOP A;  2FU4 A;  3OYM A;  3VFZ A;  4B47 A;  3DBL B;  3HHG A;  4NNJ A;  2R7W A;  1BBY A;  3K4C A;  1EH6 A;  5E1W A;  4X0G A;  1OR7 C;  1D0X A;  3OS0 A;  2RAE A;  2ELJ A;  4Y7N J;  4DBR A;  4F93 B;  2JUG A;  1HW1 A;  3F6O A;  4RDU A;  3OSG A;  1VQ6 I;  2ZNY A;  1KU3 A;  2L2O A;  2UWM A;  3WHB A;  4ZZL A;  3BTL A;  2FML A;  1TC3 C;  2V6E A;  2OU2 A;  3ROU A;  3CF5 F;  4ENK A;  2IAI A;  3R6S A;  1IC8 A;  1S7O A;  1D3Y A;  3RPU D;  2Z33 A;  4BBR J;  4BJT A;  2LBF A;  2EFO A;  2FQ3 A;  2QKL B;  4X1E A;  3X2Q H;  3OYL A;  3E6M A;  2KP6 A;  4KUM A;  4KIT B;  2Z16 A;  3FXJ A;  3EYI A;  4LB5 A;  1ETX A;  3HOT A;  2MLG A;  1XGM A;  1V5F A;  1X2M A;  4MFE A;  2QA4 I;  2HVR A;  1IXS B;  2LK2 A;  2ZXI A;  4C2T A;  3CLO A;  2LF7 A;  2XRO A;  4CXF A;  2E2H J;  5HDG A;  2JTV A;  2DK8 A;  2DFF A;  2PFB A;  4XLP F;  5CQE A;  2XPV A;  2QF7 A;  4DQ2 A;  1E3O C;  1ODD A;  2CGP A;  4WK8 F;  4EM0 B;  4OMY A;  4WXD A;  2E1M B;  2O3F A;  2GIV A;  1RR7 A;  2H8W A;  2VBW A;  5DV5 A;  3L1P A;  2CUZ A;  3D5S C;  2UZK A;  3GTM J;  2HDW A;  3HOU J;  2QQ8 A;  4Y17 A;  1FSH A;  1DUX C;  2EV0 A;  4Y3O A;  1FPQ A;  3R4K A;  1S9H A;  3GTO J;  2DFH A;  4NC7 A;  2DTZ A;  4RAG A;  2STW A;  1K61 A;  5F0H A;  4HOB A;  1IN5 A;  4D1Q A;  4JYK A;  3E6C C;  5AIQ A;  2GLO A;  1G3S A;  2IVM A;  2AQE A;  3LST A;  3JRB A;  4BU2 A;  2LC2 A;  2ZXH A;  1IW7 F;  2ZFU A;  5BPD A;  3RJP A;  2PMH A;  1WWX A;  2R7F A;  4W97 A;  2EFQ A;  1RUO A;  1UEL B;  2OQR A;  4XK4 A;  5FD6 A;  4UUS A;  1ETY A;  3SQN A;  2DU9 A;  2DCE A;  4MEX F;  4F3Q A;  3CCY A;  2WA0 A;  2DMT A;  2YS9 A;  5L3E A;  4CSW A;  2YU9 J;  3NWS A;  1BI2 A;  4OIP F;  1XGS A;  1Z05 A;  5DUK A;  2XF7 A;  4ZTJ A;  4XLH A;  1WJA A;  3Q0W A;  2L9S A;  2K40 A;  2ZJP F;  4HEA 2;  1DQU A;  2R3S A;  1VQN I;  3QPT A;  5CVJ A;  4BHC A;  4NQW B;  3N97 A;  4IOC F;  5DD4 A;  3EPZ A;  1JE8 A;  2Y75 A;  3M7G A;  1ON1 A;  4HF0 A;  2RKH A;  2WAF A;  5GPC A;  1VFC A;  4YIF A;  3S17 J;  2HPM A;  3B73 A;  3CDI A;  2EFW A;  1VQ8 I;  4A0Y A;  2XAJ A;  1V5G A;  1O3S A;  2YR2 A;  3OYN A;  3BPX A;  4HLY A;  3A2K A;  3QAH A;  4QLC U;  3BTI A;  3S8P A;  5M3M J;  2P5L C;  2RRE A;  4HQE A;  1UFM A;  4UY8 I;  3KIO A;  4RB3 C;  4XRS A;  4OIN F;  4E7Z A;  4UVB A;  1OPC A;  1B8I B;  3AG3 H;  4FCY A;  4BAY A;  2CS3 A;  4XID A;  3A0B C;  3AL0 B;  3KEO A;  1FSE A;  5JVT A;  2GXA A;  3PL8 A;  4ENM A;  3KP7 A;  3OIP A;  5ILV A;  4YFK F;  2QWW A;  2KRC A;  1SVO A;  3SJM A;  4JBA A;  2GA2 A;  2STT A;  4KNY A;  1BJZ A;  2JZY A;  1WJD A;  1HST A;  1Y39 A;  1X4O A;  4BJ6 C;  2WAQ A;  5FB2 A;  5IOY A;  2VL8 A;  3TED A;  2R7D A;  3E5Q A;  5D6E A;  3OIQ A;  2M35 A;  3BR1 A;  3GW2 A;  1QZY A;  3R61 A;  5ED4 A;  5IY5 H;  1TNS A;  1ACI A;  1TNT A;  4A93 J;  1QVU A;  3ONQ A;  3NAR A;  4V2G A;  1BI1 A;  1TW2 A;  3JW4 A;  1P6R A;  3V42 A;  2E1M C;  1R1T A;  3ABU A;  4IJA A;  3H3U A;  5CJ9 A;  5EJC A;  3GZN B;  5E3M A;  2OBP A;  2ME0 A;  4TV7 A;  2DLL A;  5CVI A;  1TQI A;  4IHW A;  5C3E J;  5EG0 A;  1T2K A;  2IS1 A;  1R23 A;  4LJZ F;  1JI8 A;  3C7J A;  3IAM 2;  2JA5 J;  3VYU B;  3WTU C;  2LYC A;  3ZMS A;  3FXM A;  2OQG A;  5E18 F;  2FOK A;  2P0T A;  2IP2 A;  5EF6 A;  2A61 A;  5HNH A;  1I1S A;  3QYF A;  3OYK A;  1IN8 A;  3OS1 A;  3OIO A;  1CGP A;  3BZK A;  4AUX A;  2YX7 A;  3OR1 C;  3CCV I;  1O3T A;  1F9N A;  1LNW A;  2K5C A;  1YX3 A;  2CG4 A;  3HKZ A;  5HS9 A;  3DCF A;  3D5L A;  2LRE A;  5LFA A;  2ELH A;  2LVS A;  2M0C A;  1FBU A;  2OA4 A;  4XR6 A;  3K7A J;  1MZB A;  3WTW C;  1ITY A;  3G1O A;  2IEK A;  2IGK A;  2XHK A;  4CDG A;  4CCM A;  3HRM A;  4XM3 A;  4R79 A;  3DFG A;  2HKX A;  1EH7 A;  2BVL A;  4XLE A;  4A3M J;  1E2X A;  2R7R A;  5D8K B;  3WG7 H;  1MND A;  2P7C B;  2L4A A;  3VWB A;  3ZQC A;  1GXQ A;  4GRI A;  2P6T A;  1FOK A;  2CJJ A;  4HPQ A;  2H94 A;  1YLF A;  2F5D A;  1RQ6 A;  4XKC A;  3I3L A;  3JRC A;  2V4J C;  4J01 A;  1YJ9 I;  4IOA F;  3TMO A;  4AIK A;  2ISZ A;  2XAU A;  3HG9 A;  4HX7 A;  4KN7 X;  4ON0 A;  1VQO I;  4HZF A;  3BTC A;  4JX6 A;  3L2Q A;  2ISY A;  2QYO A;  1NK3 P;  3HTU A;  3TBI A;  1MNM C;  1MIJ A;  3I56 I;  3OYC A;  3HC7 A;  3FDY A;  2M87 A;  1BL0 A;  3H3V K;  5FRN A;  1WFX A;  1UHS A;  2VQL A;  5DCM B;  2KFD A;  3PNY A;  1G3W A;  1ZTR A;  1DU0 A;  4UV8 A;  3QYE A;  2RV8 A;  3HUG B;  2H1K A;  2L02 A;  3FK6 A;  4BE1 A;  3IC7 A;  4PUS A;  3GTL J;  1GV5 A;  4HSR A;  2OD5 A;  1TT5 B;  4ZJZ A;  4RGS A;  2KJC A;  1IXC A;  3C18 A;  1MD0 A;  2JA2 A;  1PDN C;  2VKE A;  3DU5 A;  2EB7 A;  5GAD J;  3J81 K;  1TTY A;  1K6Y A;  5IYC J;  2QSH X;  1BW5 A;  2EFP A;  2XF5 A;  4IXA A;  5LEK A;  4I0B A;  3D1N I;  3F23 A;  4XLN F;  3HJE A;  2LLK A;  2MG4 A;  1EV7 A;  3A0H C;  4JK1 X;  2VC1 A;  1LFB A;  3IKT A;  3A03 A;  4HF1 A;  3M1C A;  3O2P E;  2F4O B;  2HZT A;  3OL3 A;  2HI3 A;  3FM3 A;  3PQJ A;  2LP0 A;  3QPH A;  2K9L A;  2IS6 A;  3BP8 A;  2JA8 J;  1YYV A;  2DMU A;  2DJN A;  3ASN H;  3BDD A;  3LSG A;  3ZPL A;  1F36 A;  5C4J J;  2KJB A;  4P9F A;  2ZSH B;  3LSK A;  3KP5 A;  4KA4 A;  1GVJ A;  1I39 A;  2NYX A;  2RC4 A;  1I6X A;  1I1G A;  4ETS A;  4O3M A;  1ETW A;  2CQK A;  3FM5 A;  2X51 A;  1LDK B;  2PX9 A;  5TIS C;  3NAU A;  2QBY A;  2E36 A;  2Y48 A;  4A3D J;  3OV8 A;  2XDV A;  3MKL A;  4ESF A;  3H36 A;  3VSK A;  1Z77 A;  1ZG5 A;  5EGO B;  3MEX A;  5F08 A;  3CUQ C;  3OR2 C;  4FX0 A;  1K78 A;  3FWE A;  3WG9 A;  3GF2 A;  3BT9 A;  4HX4 A;  2AO9 A;  1G8X A;  4UUV A;  5H6Q A;  1KYZ A;  4A69 C;  3LSP A;  3FKI J;  4G94 A;  1R1V A;  3JTH A;  1BN5 A;  2M5W A;  2EZL A;  1WI3 A;  1HDD C;  1IN4 A;  4M9Z A;  3LWF A;  3J81 R;  4A5N A;  3JAM K;  2JRT A;  3HGG A;  3RSN A;  3CJR B;  2EIM H;  4UVA A;  4ITV A;  3RPQ A;  4AC0 A;  3JRG A;  5LBQ A;  2R92 J;  1FWZ A;  3S1Q J;  2E2I J;  4C9Y A;  2NVU B;  3A4C A;  2BZT A;  2DA5 A;  2GOX B;  4RM2 A;  2V9P A;  2CQN A;  3EUH C;  1V55 H;  2WBM A;  2E2J J;  4B3A A;  4BL0 B;  1BW6 A;  2E19 A;  3CMY A;  1H88 C;  3IH2 A;  1T0F C;  4HYE A;  2DOA A;  2M7A A;  5B5E C;  1SFE A;  2MD0 A;  3H35 A;  2DO7 A;  5F6F A;  4XN3 A;  4IL6 C;  1K78 B;  4IHY A;  3DPT A;  3SZG A;  2E60 A;  5FGM A;  4KIC A;  1LDD A;  3CD6 I;  4KDP A;  1OCT C;  3F8M A;  3BOQ A;  2O03 A;  4ABZ A;  1S72 I;  1JGG A;  2HDD A;  5FKK A;  1C0W A;  2NOG A;  2BY0 A;  2EQR A;  3BWG A;  1KU2 A;  1SMT A;  3L9F A;  1IN6 A;  3V8J A;  3VYR B;  2WY7 Q;  3G71 I;  1ZR4 A;  2E1N A;  3H5N A;  3QP6 A;  1LEB A;  2FNP A;  2TRT A;  1IV8 A;  3LAP A;  3OYE A;  2W4S A;  2F5F A;  5KCM A;  3OOU A;  9ANT A;  4HX8 A;  1SFK A;  2P8T A;  2NOJ B;  4QPQ A;  4UV9 A;  1WRJ A;  3E5X A;  1BA5 A;  3DTE A;  3JAM R;  4L18 B;  2OPT A;  3PNV A;  1XN7 A;  1Z21 A;  4EEF G;  5LGT A;  1E17 A;  1W4M A;  2GIZ A;  2BEO A;  4IPA A;  1MH4 A;  1SFX A;  3G1L A;  1FYK A;  4OU0 A;  2HOS A;  4HBL A;  4K2E A;  1OCC H;  2YSR A;  3I58 A;  2HDC A;  1QVT A;  3BTJ A;  1LFP A;  2HOA A;  1Y6I A;  2JN6 A;  1MBJ A;  3ZMZ A;  4CIC A;  5H2F C;  2KKO A;  3J7A O;  3S93 A;  3NEU A;  2OF7 A;  2X48 A;  3FF5 A;  1W7P A;  2M0M A;  1D1A A;  4NC8 A;  2PEX A;  5J1U A;  2HXI A;  3EUK L;  3KP2 A;  1IV6 A;  3RYR A;  3FXO A;  4IEJ A;  2R4G A;  3WU1 B;  2VPL A;  2D2W A;  5F0C A;  5DM7 F;  3H3Z A;  5ICC A;  1JUM A;  2L7Z A;  2HU9 A;  1B6A A;  1P4X A;  2R5Z B;  2VOP A;  3CCR I;  1M1E B;  5FFX A;  3LQR A;  5BPI A;  4KMU X;  1LDJ A;  3KP6 A;  5C44 J;  1QGP A;  1D5Y A;  1UB9 A;  1S8N A;  2YPR A;  2M34 A;  4Q47 A;  1R4M B;  2ZME B;  5CLS A;  2RDP A;  1RIO H;  2XB0 X;  1SD4 A;  4HV6 A;  3CCM I;  5HNF A;  4RB1 A;  4IX7 A;  2KZV A;  1D0Z A;  1FZP B;  4G6T B;  3M1E A;  4BBS J;  2Z99 A;  4CCL A;  2ZJ2 A;  1OYW A;  4LD5 A;  2E7W A;  2VB6 A;  2NNY A;  2OAZ A;  5DCF A;  3BC8 A;  2UXN A;  1MDM B;  2MAB A;  3I59 B;  4I0A A;  2DJI A;  1LVK A;  1MMN A;  3F0C A;  2JK3 A;  4PSX A;  1YIO A;  2HFH A;  2J5P A;  4M9S A;  5E3O A;  4QIW N;  1FIA A;  1NH3 A;  3G4S I;  1IRG A;  1FYM A;  3CO6 C;  4P5O A;  1HOM A;  4CYD A;  2E5Z A;  1PJR A;  4I01 A;  4D5C A;  1DPU A;  1BIB A;  5L3B A;  1VQ9 I;  5J4V A;  1YW7 A;  2GQQ A;  3SZT A;  3TP3 A;  2ZNZ A;  1MH3 A;  3BQY A;  3DLA A;  3HDD A;  2FSW A;  5CVR A;  1OJL A;  1ZAR A;  2ACJ A;  3WGG A;  1HKQ A;  2EPF A;  1BC7 C;  3ERE D;  3PIO F;  1O7F A;  3TO6 A;  1WJ5 A;  4BEH A;  1U9N A;  4B43 A;  2EA2 A;  2H6C A;  3BY6 A;  1W36 D;  1RES A;  4O6J A;  2YX4 A;  1DU6 A;  4DOZ A;  4F91 B;  3HSF A;  1T56 A;  5F1J A;  2DA4 A;  2KMU A;  1X19 A;  3QOP A;  2QVO A;  3PNT A;  1AOY A;  2HQA A;  4LG3 A;  4LGW A;  1T8I A;  1IG7 A;  1ZRD A;  2N8G A;  5B1B H;  2Y69 H;  3ERM A;  4YII A;  3GBG A;  4M3D A;  4E7S A;  3AAF A;  1S7A A;  4CGZ A;  1TW3 A;  2CSO A;  2DN0 A;  1OYI A;  4DNC A;  3ABT A;  4C3I J;  3C2B A;  3IP4 B;  1W0T A;  2LH9 A;  1X1C A;  4IRG A;  4EQQ A;  3LAJ A;  1W36 C;  3BZ6 A;  4L5J A;  3TDU C;  1O4X A;  4Y52 J;  1OYY A;  1XX5 A;  1MMG A;  3UR3 C;  1F43 A;  1FMV A;  3ESW B;  4AID A;  2JA7 J;  2NRA C;  3DEU A;  1HKT A;  1ZAO A;  1P2F A;  3C2H A;  4LFU A;  3HSE A;  1QNT A;  1U5T A;  2R7O A;  3QOD A;  2VJ4 A;  4GXO A;  2JQ7 A;  3OY9 A;  3S1M J;  1BIA A;  4OIR F;  4DBQ A;  4D9J A;  1QQI A;  4EV0 A;  1SMY F;  3FXQ A;  3SEQ A;  3IUO A;  1FX7 A;  3VPR A;  4YIR X;  1IXR C;  3K4L A;  5K5R A;  2B9S A;  3LSM A;  5AIP A;  1FJL A;  1NG6 A;  2JPC A;  3I54 A;  2HQR A;  4A3J J;  4PZJ A;  2K4J A;  3BRO A;  2DA1 A;  3GYH X;  2IS2 A;  1P9Q C;  3FIS A;  2IPQ X;  3ZQL A;  2E71 A;  1TP4 A;  3SYT A;  2R7S A;  2HXO A;  2X6X A;  3HEF A;  3ZMT A;  3MZ8 A;  4M6X A;  3FMR A;  2ZXJ A;  1QZE A;  3KLO A;  1BR4 A;  3GME A;  2ZME C;  4Y13 A;  4QPO A;  1MMD A;  1S3J A;  3QPS A;  3HKZ N;  4D7N A;  4PCQ A;  1JKQ C;  3MVP A;  2XRN A;  2K9M A;  3RKQ A;  5D5X B;  3I53 A;  3ABK H;  3FK7 A;  1R7J A;  2QQ9 A;  2Z1D A;  2QSF X;  4R1H A;  2DPD A;  1BR2 A;  3N4M A;  5BOX A;  3WE2 A;  3ABM H;  4BYY A;  4L5I A;  3IRR A;  2M1B A;  4MGR A;  1XGN A;  2I10 A;  2VBY A;  3CCE I;  4E7H A;  2MUN A;  2G0E A;  4BXU A;  5CYV A;  1Y8Q B;  4A6D A;  1JT0 A;  2R5Y A;  2MYS A;  2PMU A;  1JHH A;  1W1W E;  1LFU P;  2ZFW A;  2GXB A;  1MJ9 A;  5K7Z A;  3GEZ A;  2O61 A;  3NRV A;  2VOD A;  3HXL A;  1TWF J;  3D0S A;  5FKL A;  2X1C A;  2FOW A;  4UNO A;  3ZN1 A;  2LR8 A;  1K79 A;  5DS9 A;  3DKX A;  5H20 A;  1K83 J;  2IJL A;  2XPU A;  3SZP A;  5FJ8 J;  2ELK A;  1R9T J;  1R5I D;  2ECC A;  5K5O A;  5L3F A;  1VI0 A;  2MH9 A;  2D45 A;  1SEU A;  2A07 F;  2VT2 A;  1X4P A;  1I6H J;  2GBY A;  1JKO C;  4LLG F;  3BR6 A;  1ETQ A;  2K9S A;  3SFI A;  2L7K A;  1HKS A;  1NK2 P;  1TWG J;  1X1A A;  5IP9 J;  2M4K A;  3L2W A;  4IQJ A;  1MBK A;  1SD6 A;  3H5A A;  4B09 A;  4BHP A;  2M7B A;  3HSR A;  4ZC3 A;  4JP0 A;  3P9I A;  2LBF B;  3MAJ A;  4WWC A;  2ZC2 A;  1LEA A;  3HZJ A;  4BQQ A;  2MVT A;  1HDP A;  2MGQ A;  3CF2 A;  2WAE A;  1FIP A;  1OCP A;  2R5Y B;  3J81 Z;  2KIF A;  3GX4 X;  1STZ A;  3CDH A;  1KZH A;  1OKR A;  4F55 A;  4Y15 A;  3BPV A;  3ZQG A;  1TZL A;  1VQ7 I;  4E70 A;  3W6J B;  2EH3 A;  4RAZ A;  2JA6 J;  2F5V A;  2K85 A;  2NNN A;  5LRR A;  5GAH J;  4HDV A;  2JRM A;  1O3Q A;  2VBX A;  2M8G X;  2F6C A;  5KNL A;  4A3E J;  2P5K A;  3RQ4 A;  1D8K A;  1FYL A;  4B8X A;  2X98 A;  1QA6 A;  2K27 A;  2HYG D;  3CUO A;  5LGN A;  4M3G A;  3CLQ A;  3TO9 A;  3H5R A;  2JJ7 A;  2RQP A;  4HRI A;  1N75 A;  1Z6R A;  3TOA A;  2ZJR F;  1TWH J;  3MFK A;  2H09 A;  3DP7 A;  4CYC A;  3S14 J;  5L3G A;  4CZC A;  1Z0X A;  4NDL A;  4S0H B;  4UUS B;  2M2E A;  4RAF A;  2DTR A;  3WE3 A;  1TWC J;  3OL4 A;  3QYB A;  4YEL A;  3WOD F;  5E1Z B;  2Q1Z B;  5E79 C;  2EBI A;  2FBI A;  3BR3 A;  3MZH A;  3DU6 A;  2DAO A;  4YEJ A;  2XGX A;  1ZR2 A;  2K86 A;  1P7J A;  3HPG A;  3LA3 A;  1J2X A;  3CC2 I;  2O8X A;  2DYS H;  5DDG A;  5B66 C;  1IJW C;  2R7T A;  1W5C C;  4PJL A;  1RR8 C;  2L7M P;  4A3G J;  3I71 A;  2VT3 A;  4G8X A;  1T33 A;  3WTX C;  3K70 D;  2W57 A;  2H8R A;  3CCU I;  5EYR A;  4I02 A;  3S15 J;  2GWR A;  2WB1 N;  3HYI A;  1I3A A;  2CQ7 A;  4YG2 F;  3WHC A;  1HW5 A;  3CCQ I;  3JAM Z;  1G59 A;  1BM9 A;  3K6G A;  1O57 A;  2XGD A;  3OYB A;  3J7A Y;  4EGZ A;  3IH4 A;  3G2B A;  4XNF A;  1TT0 A;  3KEQ A;  1XSV A;  2CUE A;  4XLA A;  2EIL H;  3R0J A;  2LNB A;  3K70 C;  2TDX A;  4L9V A;  5HLG A;  3JR9 A;  2VE9 A;  1A6I A;  1XMK A;  4RLF A;  3E97 A;  3KFW X;  3NQO A;  2JT1 A;  4GYI A;  2R93 J;  4CHU A;  1XD7 A;  3RCO A;  2LY9 A;  5E3N A;  4B48 A;  3J7Y J;  4XSX F;  3ZR8 X;  2ZKZ A;  1OCR H;  3M9A A;  1R58 A;  3RQI A;  4L5E A;  2VAS A;  1JTY A;  3I55 I;  1DGR M;  2XAH A;  4E7K A;  2VOO A;  3QOE A;  2RNG A;  4MIM A;  4UXN A;  1WJF A;  4RGX A;  2DOF A;  2DA7 A;  3E6D A;  2VON A;  3SFZ A;  5GTH C;  5FRM A;  4G7O F;  3Q5F A;  2ZCW A;  3VB2 A;  1ETK A;  2NAZ A;  3JTG A;  3IRQ A;  3DF8 A;  3PFI A;  4M71 A;  3S16 J;  5JHF A;  2QCO A;  1ZK8 A;  1GUU A;  3MKY B;  4OWR B;  4CO8 A;  1IRX A;  3LSR A;  3H9G A;  3H0G J;  1PUF A;  2F2E A;  4NC6 A;  5E17 F;  2C6Y A;  4RGR A;  5EG0 B;  1T6S A;  1P4W A;  3L2V A;  1A5J A;  1IDZ A;  3WTY C;  3L2R A;  3CP2 A;  4QSH A;  5CQG A;  3VYS B;  3JRE A;  2HOT A;  2DA6 A;  1YW9 A;  2LY1 A;  1MBG A;  1BR1 A;  1YS7 A;  5BS6 A;  1ZRE A;  3T5X A;  3K10 A;  2IA0 A;  2J5O A;  2FD5 A;  4XBF A;  4M3B A;  2X1E A;  3AL0 C;  1VQM I;  4IO9 F;  2R7Q A;  2BW3 A;  2LDU A;  2CV1 A;  2BGC A;  3R0A A;  1MSE C;  4XOR A;  4JOM A;  4E7L A;  3OYA A;  5GP9 A;  4BDY A;  2H27 A;  3KZI C;  5ICF A;  4HA8 A;  2DQR A;  3K69 A;  3T8R A;  2DA2 A;  1D1C A;  4FQG A;  4LIT A;  1FC3 A;  1B72 A;  2VUM J;  1I50 J;  3ASO H;  1JUS A;  1U6G A;  2VKH A;  3FZV A;  4XKV A;  2V9K A;  3BG3 A;  3VEP A;  3HOX J;  1CQT A;  4YFN F;  1JJ8 C;  2CFO A;  3HOZ J;  2HKO A;  4Z6Y A;  3I0T A;  1GLN A;  1K4S A;  2EK5 A;  1ZH5 A;  3O8H A;  3JRH A;  1XDU A;  1MKM A;  4OOI A;  1YQA A;  4A3C J;  1U8B A;  2EA4 A;  5D5U B;  3S1N J;  1PP7 U;  4U0Y A;  1YOV B;  3DTK A;  5DUI A;  1YRN A;  4HAM A;  2L9R A;  1MMA A;  3CTA A;  5K7H A;  2ZBK A;  4II3 A;  2GM4 A;  1LKX A;  4EM2 A;  3Q0U A;  3UNG C;  4ZYE A;  1OIS A;  5M5W J;  2UV1 A;  2NXN B;  4N9H A;  2B0L A;  4FHT A;  4MEY F;  2WV1 A;  3K0L A;  2MC4 A;  2FRH A;  1J0R A;  4MLO A;  1T08 B;  2BW3 B;  1T95 A;  2VQC A;  4FTH A;  1FLI A;  1D5V A;  2QGU A;  2CUF A;  5KAI C;  1ZG1 A;  4XOT A;  2EV5 A;  2XPW A;  4IHV A;  1IUF A;  3GZ6 A;  3DWL E;  1HXD A;  3LL7 A;  4PFP A;  1Y1W J;  3OYG A;  3PO3 J;  4EJW A;  1ZG3 A;  3WTZ A;  1G3T A;  4ENJ A;  3ZOB A;  2IXS A;  4ANJ A;  5HOO A;  3HRT A;  2OCC H;  4BQA A;  2IS4 A;  4XQF A;  1R22 A;  2DPU A;  3FBN B;  2NS7 A;  4B1R A;  1O3R A;  1JKP C;  1V5E A;  1B4A A;  5LEJ A;  4V19 K;  4EJU A;  3CCJ I;  2BXZ A;  2DFI A;  2KDO A;  2KRF A;  2VE8 A;  3LQQ A;  4ZYD A;  2OTL I;  5F27 A;  1N25 A;  4J19 A;  3ML6 A;  2YUS A;  3S2H J;  4G7Z F;  1A6Q A;  1R49 A;  1YO5 C;  2CV0 A;  4ZYH A;  1GHC A;  1TL8 A;  1P92 A;  1Y56 A;  2Q2E A;  4HW0 A;  4CA0 A;  2QM3 A;  1HSJ A;  4GCV A;  3RKY A;  1JUP A;  1Y0U A;  3P9K A;  2BVM A;  3QU6 A;  2BV6 A;  2A05 A;  3GTQ J;  1KYW A;  4AIH A;  3DEW A;  5CKT A;  4P1W A;  2DOD A;  3K1N A;  2XAS A;  3FMS A;  1KQ8 A;  3ECH A;  3QPL A;  2W48 A;  1UZC A;  3RYP A;  3DXJ F;  1YW8 A;  2K9N A;  3E3V A;  3PQK A;  3U9G A;  3HPH A;  2QBY B;  4U0W A;  4FIS A;  1K4T A;  1R00 A;  2COM A;  4A3L J;  3C2G A;  1DGW Y;  2NVQ J;  5K1Y A;  4Y4R A;  2A6E F;  1HW2 A;  3KZZ A;  2MH2 A;  4IKF A;  3ULQ B;  4P96 A;  2F4M B;  2DFE A;  1B9M A;  2VI6 A;  4YFX F;  3LSI A;  4M74 A;  2KT0 A;  3OYF A;  4KIG A;  1YX5 A;  5IT9 K;  1Z9C A;  1KON A;  5C4X J;  5CPR B;  4KJZ A;  5M3F J;  4JX5 A;  1WI9 A;  3P7N A;  4NB5 A;  1B9N A;  4BQO A;  4ESB A;  3L7W A;  3P9C A;  1CF7 A;  1IZ1 A;  3LA2 A;  3DKY A;  3EDP A;  4KYW A;  3BQZ A;  2Q2E B;  1W0U A;  4ZYG A;  3REO A;  1FOX A;  5LHH A;  3QP5 A;  5EZG A;  1I27 A;  2L4M A;  1YIT I;  1UJ8 A;  4PJN A;  5F04 A;  2VPR A;  2M45 A;  4AYB A;  1R5H A;  1YJW I;  2R0Q C;  3R60 A;  1B1B A;  3PIP F;  1SAX A;  2LMD A;  2H1L A;  2RGV A;  2VN2 A;  2VJI A;  5EEG A;  3RIR A;  1OR7 A;  4AVZ A;  5J40 A;  2FBH A;  4L0Z B;  2KQR A;  4PJ0 C;  2CWE A;  5F64 A;  1XTA A;  2HOE A;  1UAA A;  5JR3 A;  2LRD A;  1ZEL A;  1PYV A;  3H9Q A;  1ZKG A;  3VOD A;  4KIF A;  2EIN H;  2NVY J;  3SDG A;  2BY3 A;  3DQV C;  4BE2 A;  3GXO A;  2CQQ A;  1G2H A;  1QPM A;  5EEH A;  2ID6 A;  4IRH A;  1Z3Y A;  4A3I J;  4N9I A;  2L9N A;  4FAS D;  2CYY A;  4H4K C;  3KZY A;  3DV8 A;  4U88 A;  4MQ9 F;  3EQL F;  2LKX A;  2KIQ A;  4LIV A;  3MZY A;  1YG2 A;  3TOB A;  3RZO J;  3M07 A;  1F5T A;  5IT9 R;  1XG1 A;  3RPU A;  4Q48 A;  3EET A;  4F52 A;  3GWZ A;  1U2W A;  1ERD A;  1ZLJ A;  4UB8 C;  4EJV A;  5CVV A;  4F92 B;  4XRM A;  4DYQ A;  5DM6 F;  5HLT A;  2F5E A;  1RET A;  2BE5 F;  3A52 A;  3FHN A;  4EMS A;  1AWC A;  4D7M A;  2Q0O A;  3ABL H;  2KIM A;  3GFM A;  2F4I A;  1RKW A;  3BJO A;  3ECO A;  3H1C A;  3L2U A;  1J75 A;  1BI0 A;  4A5M A;  2UUZ A;  3E0J B;  1FEX A;  4AM3 A;  3I5U A;  4UHT A;  1POG A;  1REP C;  2ZJQ F;  2P0W A;  1X1P A;  2ZSI B;  3KYD B;  5J4Y A;  2ICW G;  3SEZ A;  1S5L C;  2WTE A;  1G3Y A;  4KN4 X;  3GTP J;  1W7P B;  2K7L A;  4PSW A;  5E3L A;  1FNN A;  3MQ0 A;  5LRS A;  3CME I;  3HBL A;  2VXD A;  3CO7 C;  3HOV J;  2FBK A;  4I09 A;  1H89 C;  2WAD A;  4LG0 A;  3DLL F;  1WCM J;  5LD2 C;  5JFR A;  2X6Y A;  4A2U A;  1ULY A;  3RI4 A;  1MW7 A;  2X85 A;  2G7U A;  2XAQ A;  4OAY A;  1VZ0 A;  2AS5 F;  1U0J A;  2W00 A;  1D0Y A;  1MJB A;  2V79 A;  2V7F A;  2EZH A;  2W82 A;  5LHI A;  1FOW A;  3M8J A;  3K4K A;  4RAY A;  2CQX A;  4M9X A;  2EWN A;  5FD5 A;  1LVA A;  2CH0 A;  3FIW A;  3LNQ A;  1WSU A;  4XOP A;  5HS7 A;  4MTD A;  2WAQ N;  2DBB A;  5IP7 J;  2FNA A;  3BR5 A;  2AHQ A;  2DA3 A;  2MLK A;  3AFH A;  4KIS A;  5D4R A;  1SD5 A;  2EFN A;  2HTJ A;  5L3C A;  2W25 A;  2XV4 S;  2Y30 A;  2V1X A;  3QRF F;  2AQF A;  4ZZD A;  2HYF A;  2BY2 A;  1QHG A;  2P6S A;  3KLN A;  1EF4 A;  1W5S A;  4II2 A;  4PGH A;  1KU7 A;  2ADU A;  3ZRG A;  1HQC A;  4M3F A;  4RS8 A;  2LFB A;  3E5U A;  4LG0 B;  2ECB A;  2EZK A;  1VQ4 I;  3FXK A;  4EGY A;  5HOD A;  1SFO J;  1BC8 C;  1U9O A;  3TKY A;  4KT5 C;  4DZP A;  2Y0M A;  3BG9 A;  5EEA A;  3E6B A;  3UKG A;  4BEH B;  3JRD A;  1MGT A;  1WJE A;  4LLL A;  2KLO A;  4XKW A;  2O7O A;  1XS9 A;  2XKP A;  1F4K A;  2A6H F;  2JMW A;  1QBJ A;  2EZI A;  1JT6 A;  1KA8 A;  2FQ4 A;  2MW8 A;  3BG7 A;  1BJA A;  2QLZ A;  4DW6 A;  4GGG A;  5H6R A;  2W1O A;  1UG0 A;  5ILS A;  1H9T A;  2M4G A;  3I4N J; 
#chains in the Genus database with same CATH homology
 1B59 A;  1W7P D;  1XGO A;  3M8E A;  2G7H A;  5A2Q K;  1SD7 A;  1HBX G;  4A12 A;  1H0M A;  3GO5 A;  3O6B B;  2XAF A;  1U5T B;  1XB4 A;  3BJ6 A;  5JI6 A;  2ZO4 A;  1UHW A;  2Z3Y A;  1MJA A;  2RNJ A;  4Q4Z F;  1XDS A;  5CVU A;  2PN6 A;  4M73 A;  2IW5 A;  2GA1 A;  4LK0 F;  4G6D A;  4WCG A;  3KCC A;  4XSZ F;  5DEQ A;  3MCZ A;  1R5G A;  1X3U A;  2VXZ A;  1W5T A;  3HRU A;  2DW4 A;  3I4P A;  3IHU A;  3J80 K;  3JSP A;  2V1U A;  2MBF A;  4R8H A;  1Z91 A;  4IVN A;  2HTS A;  4S04 A;  4NQW A;  4I98 B;  2QZ8 A;  2L3D A;  2UXX A;  3RTR A;  3KP3 A;  1D8J A;  4P9U A;  1ONV A;  5BQT A;  4IF4 A;  5AON A;  1R36 A;  3QU3 A;  2PG4 A;  4I7H A;  2V1D A;  5KK1 A;  5LLQ A;  5FFZ A;  1XSX A;  3GFL A;  1G6N A;  1DPR A;  4BH9 A;  1TLH B;  3U2R A;  3KP4 A;  1LB2 A;  3ZMU A;  1KQ0 A;  1QO0 D;  3O3K A;  5D5W B;  2RVC A;  4GO1 A;  4I2O A;  2V9V A;  3WTS C;  1FY7 A;  3M8F A;  1BI3 A;  2RN7 A;  2G9W A;  2HS5 A;  2DQL A;  4L9T A;  2IT0 A;  2W85 A;  4EM1 A;  3FHZ A;  3MWM A;  5LHG A;  2VBZ A;  3LA7 A;  4Q5S F;  1RI7 A;  2QQA A;  4L9N A;  1T38 A;  3C3W A;  4WF2 A;  3RDI A;  2O6G E;  4N0B A;  2K02 A;  4LLN A;  4U0V A;  4UVC A;  2Z5U A;  3V7C A;  3GUD A;  2GAU A;  1P4A A;  4MHG A;  2A69 F;  3RKW A;  4RB2 C;  1KGS A;  4PGG A;  5ICE A;  1U5T C;  2FMY A;  4LB6 B;  1U3E M;  1IAW A;  4IRI A;  1LJ9 A;  3V4G A;  4LK1 F;  3G3Z A;  2HR3 A;  3KE2 A;  1T39 A;  3C1D A;  1V4R A;  4OIQ F;  5FLX K;  3CUQ A;  2WV0 A;  4ESJ A;  3L00 A;  3WU0 A;  4JQF A;  2FA5 A;  3IKV A;  2IRF G;  5E8G A;  1XMA A;  2MC3 A;  2P5V A;  3W6K B;  2Z9O A;  2D1V A;  2GZW A;  1ZGJ A;  2WWY A;  3VOE A;  1XCV A;  1ZYR F;  1Z6T A;  5HLI A;  5TRD A;  3DPL C;  2ETH A;  3F8B A;  2BYV E;  2KIU A;  2W84 A;  4MQV A;  1G4D A;  5IT9 Z;  2PLY A;  1RUN A;  3EUH A;  1ZGA A;  5DCM A;  1J9I A;  2CO5 A;  1WKM A;  3HUG A;  1T0F A;  4M72 A;  3EYY A;  1IUY A;  1TQM A;  2EV6 A;  3Q9S A;  2BBY A;  5J8F A;  3HTS B;  2A5Y B;  3CUQ B;  1FBS A;  2XKO A;  3RKX A;  3WTV C;  2WC2 A;  4WXC A;  2VC0 A;  2P7V B;  1DDN A;  3V8L A;  4P55 A;  1ZRF A;  3V7R A;  5J8C A;  4CZZ A;  2HQN A;  2X0L A;  3ZMV A;  5HVQ C;  2LKP A;  2IA2 A;  1Z7U A;  1TBX A;  3SHF A;  3GFI A;  3S2W A;  3DKW A;  4AD9 A;  1KQ9 A;  2D1H A;  4BNC A;  3SXY A;  4BHB A;  2XAG A;  5E1X A;  2L01 A;  1VTN C;  1UHM A;  4A6E A;  5HLH A;  3ZMD A;  1I5Z A;  1K6O A;  3T0Y A;  3CJN A;  1FT9 A;  3F3X A;  1EH8 A;  5D4S A;  3F6V A;  1H9G A;  3ZN0 A;  1L0O C;  1S29 A;  3F8F A;  3K9T A;  2FE3 A;  3KET A;  2H6B A;  3IWZ A;  4RGU A;  3V7S A;  1S6L A;  4D0P A;  2CFX A;  3FX3 A;  1GXP A;  2HEO A;  1WQ2 A;  2A68 F;  2EJR A;  2QEN A;  3F8N A;  3Q9V A;  4IHS A;  1L3L A;  4G9Y A;  2LSO A;  1OMI A;  2OZU A;  1BOA A;  4ASN A;  2FF4 A;  3HIF A;  4AWX B;  1Q1H A;  1FP1 D;  2OZ6 A;  5DD8 A;  2GXG A;  1ON2 A;  2YU3 A;  2XVC A;  3JSO A;  4KFC A;  1YS6 A;  3WGH A;  3K1M A;  1ZRC A;  3F72 A;  2QUF A;  1SFU A;  1ZLK A;  1JGS A;  4L9J A;  4WX9 A;  5F1R A;  3I64 A;  4HLX A;  3L09 A;  5ICG A;  4QWQ A;  4FT8 A;  5KVR A;  2DK5 A;  4HF2 A;  1U8R A;  1Z1D A;  5HDN A;  3K1P A;  4KMF A;  2ESH A;  1V3F A;  4FX4 A;  3HRS A;  4F7Z A;  3TQN A;  1R1U A;  3GFJ A;  5LGU A;  1RNL A;  4MTE A;  5D5V B;  4S05 A;  4LMY A;  1O7L A;  5E8I A;  1TQP A;  2L54 A;  1DP7 P;  3L2C A;  3U1D A;  5BMZ A;  2PJP A;  5D8L B;  4G7H F;  4NHJ A;  1JXS A;  2O0Y A;  1RZ4 A;  2JSC A;  2JPB A;  4ENN A;  1U78 A;  3F22 A;  2E1C A;  5A2Q Z;  2QQB A;  1ZN2 A;  2F5C A;  2A3S A;  3GZ5 A;  2M30 A;  4AVP A;  2FXA A;  3ELK A;  1NHA A;  4HDU A;  1USS A;  4M6Y A;  3WTT C;  3B02 A;  4RB0 A;  5E20 A;  2ZME A;  2M8E A;  4G6Q A;  3IL2 A;  1KU9 A;  3F21 A;  3HHH A;  5K5Q A;  4U7D A;  2K4B A;  3BJA A;  1MDM A;  3COA C;  3I59 A;  1CF7 B;  3J80 Z;  4L0Y B;  4ZH4 F;  3LFK A;  2P4W A;  1T98 A;  3T1B A;  4EJT A;  3WGI A;  5ERI A;  1ZHF A;  2IA1 A;  2X4H A;  1LQ1 A;  3K2Z A;  1J59 A;  1IN7 A;  4A0Z A;  5ILU A;  2HGC A;  4PDK A;  3F8C A;  3ISP A;  3HOS A;  4IHT A;  5HDK A;  2XIG A;  1K7A A;  1PUE E;  2MD5 A;  2ESN A;  5FO5 A;  4H0E A;  2AXL A;  3IWF A;  1A04 A;  1FP2 A;  2HWV A;  2PQ8 A;  1IRF A;  2V6C A;  3GVA A;  1J5Y A;  4OMZ A;  3TDZ C;  5J6X A;  4O5V A;  2DT5 A;  2XUB A;  1UCR A;  2PI0 A;  1JHF A;  5DYM A;  1IF1 A;  3H92 A;  3FMQ A;  4GYG A;  3ZP5 A;  1PP8 F;  1F1Z A;  1XCB A;  4Z2Y A;  3T8T A;  1QZZ A;  5L3D A;  4A0X A;  1YTY A;  1FBQ A;  3G73 A;  5TJJ A;  4KIB A;  5IT3 A;  4HQM A;  2NS0 A;  2FEZ A;  4MNU A;  2LF8 A;  3ZQ7 A;  2E7X A;  4XRF A;  4EVI A;  4HV5 A;  3FXR A;  6PAX A;  5JHU A;  4WXH A;  3TO7 A;  5FLX Z;  4AIJ A;  2W24 A;  4EJO A;  2MA3 A;  4U7B A;  2CW0 F;  3FXU A;  5HS8 A;  4OIO F;  5D6F A;  2Q8K A;  1UST A;  3TGN A;  1J7K A;  1YFH A;  1XSD A;  3V8K A;  2DI3 A;  3GLX A;  2PBI A;  3OOP A;  2FU4 A;  3VFZ A;  3HHG A;  1BBY A;  5E1W A;  1EH6 A;  1HW1 A;  3F6O A;  2ZNY A;  1KU3 A;  2UWM A;  4ZZL A;  2FML A;  2OU2 A;  3ROU A;  4ENK A;  3R6S A;  1S7O A;  1D3Y A;  2Z33 A;  2EFO A;  2FQ3 A;  3E6M A;  4KUM A;  3EYI A;  4LB5 A;  3HOT A;  2MLG A;  1XGM A;  1IXS B;  3CLO A;  2LF7 A;  2XRO A;  4CXF A;  5HDG A;  2JTV A;  2DK8 A;  2PFB A;  4XLP F;  4DQ2 A;  2CGP A;  1ODD A;  4WK8 F;  4EM0 B;  4OMY A;  4WXD A;  2O3F A;  2GIV A;  2VBW A;  5DV5 A;  2UZK A;  4Y17 A;  1FSH A;  1DUX C;  2EV0 A;  1FPQ A;  3R4K A;  2STW A;  4HOB A;  1IN5 A;  3E6C C;  5AIQ A;  1G3S A;  2IVM A;  3LST A;  1IW7 F;  5BPD A;  3RJP A;  2PMH A;  1WWX A;  2R7F A;  1RUO A;  2EFQ A;  2OQR A;  5FD6 A;  3SQN A;  2DU9 A;  4MEX F;  5L3E A;  1BI2 A;  4OIP F;  1XGS A;  1Z05 A;  5DUK A;  2R3S A;  3QPT A;  5CVJ A;  4BHC A;  3N97 A;  5DD4 A;  1JE8 A;  2Y75 A;  3M7G A;  1ON1 A;  4HF0 A;  2RKH A;  4YIF A;  3B73 A;  2EFW A;  4A0Y A;  2XAJ A;  1O3S A;  2YR2 A;  4HLY A;  3BPX A;  3QAH A;  4QLC U;  2P5L C;  4HQE A;  1UFM A;  4RB3 C;  4OIN F;  4UVB A;  1OPC A;  4BAY A;  3KEO A;  1FSE A;  5JVT A;  4ENM A;  3KP7 A;  5ILV A;  4YFK F;  2QWW A;  4JBA A;  2GA2 A;  2STT A;  4KNY A;  2JZY A;  1HST A;  5FB2 A;  2R7D A;  3E5Q A;  5D6E A;  3GW2 A;  1QZY A;  3R61 A;  5ED4 A;  1TNS A;  1TNT A;  1BI1 A;  1TW2 A;  3JW4 A;  1P6R A;  1R1T A;  3ABU A;  4IJA A;  3H3U A;  5CJ9 A;  2OBP A;  4TV7 A;  2DLL A;  5CVI A;  1TQI A;  1T2K A;  1R23 A;  4LJZ F;  3C7J A;  3WTU C;  3ZMS A;  2OQG A;  5E18 F;  2FOK A;  2IP2 A;  2A61 A;  1I1S A;  1IN8 A;  1CGP A;  2YX7 A;  1O3T A;  1F9N A;  1LNW A;  5HS9 A;  2CG4 A;  3D5L A;  2ELH A;  1FBU A;  2OA4 A;  1MZB A;  3WTW C;  2XHK A;  4CDG A;  3HRM A;  4R79 A;  2HKX A;  3DFG A;  1EH7 A;  1E2X A;  5D8K B;  2P7C B;  2L4A A;  1GXQ A;  2P6T A;  1FOK A;  2H94 A;  1YLF A;  2F5D A;  4AIK A;  2ISZ A;  4HX7 A;  4KN7 X;  4ON0 A;  4HZF A;  2ISY A;  2QYO A;  3HTU A;  2M87 A;  5DCM B;  1G3W A;  4UV8 A;  2RV8 A;  2L02 A;  3IC7 A;  2OD5 A;  4RGS A;  2KJC A;  1IXC A;  3C18 A;  1MD0 A;  1PDN C;  2EB7 A;  3J81 K;  1TTY A;  2EFP A;  4IXA A;  5LEK A;  4I0B A;  3F23 A;  4XLN F;  1EV7 A;  4JK1 X;  2VC1 A;  3IKT A;  4HF1 A;  3O2P E;  2HZT A;  3FM3 A;  3PQJ A;  3QPH A;  3BP8 A;  1YYV A;  3BDD A;  3ZPL A;  2KJB A;  4P9F A;  3KP5 A;  4KA4 A;  1GVJ A;  2NYX A;  2RC4 A;  1I6X A;  1I1G A;  4ETS A;  4O3M A;  2CQK A;  3FM5 A;  1LDK B;  2QBY A;  2Y48 A;  3OV8 A;  4ESF A;  1ZG5 A;  3MEX A;  3CUQ C;  4FX0 A;  1K78 A;  3FWE A;  3WG9 A;  3GF2 A;  4HX4 A;  4UUV A;  5H6Q A;  1KYZ A;  4G94 A;  1R1V A;  3JTH A;  1BN5 A;  2M5W A;  1IN4 A;  4M9Z A;  3LWF A;  4A5N A;  3JAM K;  2JRT A;  4UVA A;  3RPQ A;  5LBQ A;  1FWZ A;  4HYE A;  1SFE A;  2DO7 A;  5F6F A;  1K78 B;  3DPT A;  5FGM A;  4KIC A;  1LDD A;  4KDP A;  3F8M A;  3BOQ A;  2O03 A;  1C0W A;  3BWG A;  1SMT A;  1KU2 A;  3L9F A;  1IN6 A;  3V8J A;  2E1N A;  3QP6 A;  1LEB A;  2FNP A;  3LAP A;  2F5F A;  4HX8 A;  2P8T A;  4UV9 A;  1WRJ A;  3E5X A;  4L18 B;  1XN7 A;  5LGT A;  1E17 A;  1W4M A;  2BEO A;  4IPA A;  1SFX A;  1FYK A;  4OU0 A;  4HBL A;  4K2E A;  2YSR A;  3I58 A;  2HDC A;  3ZMZ A;  4CIC A;  2KKO A;  3J7A O;  3NEU A;  3FF5 A;  1W7P A;  2PEX A;  3KP2 A;  3RYR A;  3WU1 B;  2D2W A;  3H3Z A;  5ICC A;  2VOP A;  1B6A A;  1P4X A;  5FFX A;  3LQR A;  5BPI A;  4KMU X;  1LDJ A;  3KP6 A;  1QGP A;  1UB9 A;  1S8N A;  2YPR A;  4Q47 A;  2ZME B;  5CLS A;  2RDP A;  1RIO H;  1SD4 A;  4HV6 A;  4RB1 A;  1FZP B;  3M1E A;  2Z99 A;  2ZJ2 A;  1OYW A;  4LD5 A;  2E7W A;  2NNY A;  2OAZ A;  5DCF A;  2UXN A;  1MDM B;  3I59 B;  4I0A A;  1YIO A;  2HFH A;  2J5P A;  4M9S A;  1IRG A;  1FYM A;  3CO6 C;  4P5O A;  4CYD A;  4I01 A;  1DPU A;  1BIB A;  5L3B A;  1YW7 A;  2GQQ A;  3SZT A;  2ZNZ A;  2FSW A;  5CVR A;  1ZAR A;  2ACJ A;  3WGG A;  1HKQ A;  1BC7 C;  3ERE D;  1O7F A;  3TO6 A;  2EA2 A;  2H6C A;  3BY6 A;  4O6J A;  2YX4 A;  3HSF A;  3QOP A;  2QVO A;  1AOY A;  4LGW A;  1ZRD A;  4YII A;  3AAF A;  1S7A A;  4CGZ A;  1TW3 A;  2CSO A;  1OYI A;  4DNC A;  3ABT A;  4EQQ A;  3LAJ A;  4IRG A;  3BZ6 A;  4L5J A;  3TDU C;  1OYY A;  1HKT A;  2NRA C;  3DEU A;  1ZAO A;  1P2F A;  4LFU A;  3HSE A;  1QNT A;  1U5T A;  4GXO A;  1BIA A;  4OIR F;  4EV0 A;  1QQI A;  1SMY F;  3FXQ A;  1FX7 A;  1IXR C;  5K5R A;  5AIP A;  3I54 A;  2JPC A;  2HQR A;  4PZJ A;  2K4J A;  3BRO A;  3GYH X;  2IPQ X;  3ZMT A;  4M6X A;  3FMR A;  2ZXJ A;  3KLO A;  4Y13 A;  1S3J A;  4PCQ A;  2XRN A;  5D5X B;  3I53 A;  1R7J A;  2QQ9 A;  4R1H A;  2DPD A;  3N4M A;  5BOX A;  3WE2 A;  4BYY A;  3IRR A;  4L5I A;  2M1B A;  4MGR A;  1XGN A;  2VBY A;  4BXU A;  5CYV A;  4A6D A;  2PMU A;  1JHH A;  2ZFW A;  2GXB A;  1MJ9 A;  3GEZ A;  2O61 A;  3NRV A;  2VOD A;  3D0S A;  4UNO A;  3ZN1 A;  1K79 A;  5H20 A;  2IJL A;  3SZP A;  5K5O A;  5L3F A;  2MH9 A;  2D45 A;  2A07 F;  2VT2 A;  4LLG F;  1HKS A;  1SD6 A;  4B09 A;  4BHP A;  3HSR A;  3P9I A;  3MAJ A;  4WWC A;  1LEA A;  3J81 Z;  2KIF A;  3GX4 X;  1STZ A;  3CDH A;  1OKR A;  4Y15 A;  3BPV A;  4E70 A;  3W6J B;  4RAZ A;  2NNN A;  5LRR A;  4HDV A;  1O3Q A;  2VBX A;  2P5K A;  1FYL A;  1D8K A;  4B8X A;  2K27 A;  2HYG D;  3CUO A;  5LGN A;  3TO9 A;  2RQP A;  1Z6R A;  3TOA A;  3MFK A;  2H09 A;  3DP7 A;  5L3G A;  2DTR A;  3WE3 A;  3WOD F;  5E1Z B;  2FBI A;  3MZH A;  2DAO A;  2XGX A;  2K86 A;  3LA3 A;  1J2X A;  2O8X A;  5DDG A;  3I71 A;  2VT3 A;  4G8X A;  3WTX C;  2W57 A;  4I02 A;  2GWR A;  3HYI A;  4YG2 F;  1HW5 A;  3JAM Z;  1BM9 A;  1O57 A;  4EGZ A;  3KEQ A;  1XSV A;  3R0J A;  2LNB A;  2TDX A;  4L9V A;  5HLG A;  2VE9 A;  1XMK A;  3E97 A;  3KFW X;  3NQO A;  2JT1 A;  4GYI A;  4CHU A;  1XD7 A;  4XSX F;  2ZKZ A;  3M9A A;  1R58 A;  2XAH A;  2VOO A;  4UXN A;  4RGX A;  3E6D A;  2VON A;  3SFZ A;  4G7O F;  3Q5F A;  2ZCW A;  3VB2 A;  2NAZ A;  3JTG A;  3IRQ A;  3DF8 A;  3PFI A;  4M71 A;  4CO8 A;  2F2E A;  5E17 F;  2C6Y A;  4RGR A;  1T6S A;  1P4W A;  3WTY C;  1YW9 A;  1YS7 A;  5BS6 A;  1ZRE A;  3T5X A;  2IA0 A;  2J5O A;  4XBF A;  2LDU A;  2BGC A;  3R0A A;  2H27 A;  5ICF A;  4HA8 A;  2DQR A;  3K69 A;  3T8R A;  1FC3 A;  1U6G A;  3FZV A;  3VEP A;  4YFN F;  2HKO A;  3I0T A;  2EK5 A;  1ZH5 A;  1XDU A;  1MKM A;  4OOI A;  1YQA A;  2EA4 A;  5D5U B;  1PP7 U;  4U0Y A;  5DUI A;  4HAM A;  3CTA A;  2ZBK A;  4EM2 A;  4ZYE A;  4N9H A;  2B0L A;  4FHT A;  4MEY F;  3K0L A;  2FRH A;  1J0R A;  1FLI A;  1D5V A;  1ZG1 A;  2EV5 A;  3GZ6 A;  1HXD A;  4EJW A;  1ZG3 A;  3WTZ A;  1G3T A;  4ENJ A;  5HOO A;  3HRT A;  4BQA A;  1R22 A;  2DPU A;  1O3R A;  5LEJ A;  1B4A A;  4EJU A;  4ZYD A;  2DFI A;  2KRF A;  2VE8 A;  3LQQ A;  3ML6 A;  4G7Z F;  1YO5 C;  4ZYH A;  1GHC A;  1P92 A;  2Q2E A;  4HW0 A;  2QM3 A;  1HSJ A;  4GCV A;  3RKY A;  1Y0U A;  3P9K A;  3QU6 A;  2BV6 A;  1KYW A;  4AIH A;  3K1N A;  2XAS A;  3FMS A;  1KQ8 A;  3ECH A;  3RYP A;  3DXJ F;  3U9G A;  1YW8 A;  3E3V A;  3PQK A;  2QBY B;  4U0W A;  1R00 A;  2COM A;  5K1Y A;  2A6E F;  1HW2 A;  3KZZ A;  2MH2 A;  3ULQ B;  4P96 A;  1B9M A;  4YFX F;  4M74 A;  4KIG A;  5IT9 K;  1Z9C A;  1WI9 A;  3P7N A;  4NB5 A;  1B9N A;  4ESB A;  3L7W A;  3P9C A;  1CF7 A;  1IZ1 A;  3LA2 A;  3EDP A;  4KYW A;  4ZYG A;  3REO A;  5LHH A;  3QP5 A;  1I27 A;  2L4M A;  2M45 A;  1R5H A;  3R60 A;  1B1B A;  1SAX A;  2RGV A;  2VN2 A;  5EEG A;  3RIR A;  1OR7 A;  2FBH A;  4L0Z B;  2CWE A;  5F64 A;  2HOE A;  5JR3 A;  3VOD A;  4KIF A;  3DQV C;  3GXO A;  1QPM A;  5EEH A;  4IRH A;  4N9I A;  2CYY A;  3KZY A;  3DV8 A;  4U88 A;  4MQ9 F;  3EQL F;  3MZY A;  1YG2 A;  3TOB A;  1F5T A;  3RPU A;  4Q48 A;  3EET A;  3GWZ A;  1U2W A;  1ZLJ A;  4EJV A;  5CVV A;  2F5E A;  2BE5 F;  4EMS A;  1AWC A;  2Q0O A;  2KIM A;  3GFM A;  3ECO A;  3BJO A;  1J75 A;  1BI0 A;  4A5M A;  3I5U A;  4UHT A;  1REP C;  4KN4 X;  2WTE A;  1G3Y A;  1W7P B;  2K7L A;  1FNN A;  3MQ0 A;  5LRS A;  3CO7 C;  2FBK A;  4I09 A;  4LG0 A;  5JFR A;  4A2U A;  1ULY A;  3RI4 A;  2G7U A;  2XAQ A;  2AS5 F;  1MJB A;  2V79 A;  5LHI A;  4RAY A;  4M9X A;  2EWN A;  5FD5 A;  1LVA A;  1WSU A;  5HS7 A;  4MTD A;  2DBB A;  2FNA A;  2MLK A;  5D4R A;  1SD5 A;  2EFN A;  2HTJ A;  5L3C A;  2W25 A;  2XV4 S;  2V1X A;  3QRF F;  4ZZD A;  2HYF A;  2P6S A;  3KLN A;  1W5S A;  4PGH A;  1KU7 A;  2ADU A;  1HQC A;  4RS8 A;  3E5U A;  4LG0 B;  4EGY A;  1BC8 C;  3TKY A;  4KT5 C;  2Y0M A;  3E6B A;  1MGT A;  4LLL A;  2XKP A;  1F4K A;  2A6H F;  1QBJ A;  1KA8 A;  1BJA A;  2QLZ A;  4GGG A;  5H6R A;  5ILS A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...