1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
3RPQA 4LFUA 2VE9A 1EH8A 1D3YA 1B9MA 2P7VB 1SAXA 3J80K 2ESHA 3J81Z 1BIBA 1O7LA 3BPVA 2WC2A 4I7HA 3VB2A 4KUMA 1PDNC 1GXQA 3I59A 4N9HA 4I09A 1K6OA 4TV7A 2JPBA 2E7WA 3LQQA 5H20A 1XN7A 2MH2A 2KIMA 3FF5A 1RZ4A 1FZPB 4CO8A 1WRJA 1XSXA 3AAFA 1ONVA 1IRFA 3TO7A 5E20A 4EV0A 1R5GA 5H6RA 5HLGA 3ZMUA 5FLXZ 5LGTA 2V9VA 1O3QA 1IXCA 3L00A 3G3ZA 4YFXF 4RGRA 2F2EA 2FBHA 4YIIA 2RNJA 2BBYA 1XDUA 2ZMEB 5ED4A 3C18A 4ENNA 1ZLKA 3ZMVA 3P9CA 3E6CC 2DO7A 3H3ZA 3DKWA 1P6RA 2GA1A 2KIUA 4R8HA 1HSJA 2O0YA 1TNTA 2YSRA 2HFHA 3MFKA 3TKYA 2UXNA 1YO5C 2NAZA 3FMQA 2H94A 1TNSA 2PQ8A 3I5UA 1ON2A 3RI4A 1G3TA 3M8EA 5ICFA 5BS6A 5L3CA 4U7DA 5JHUA 2K4BA 1CGPA 3LA7A 1ODDA 2EFNA 1ZREA 4M9ZA 4BQAA 2G9WA 4EM1A 5L3DA 2O61A 2GXBA 2STWA 4XSXF 1T2KA 3T8RA 1YQAA 4L9JA 3IKTA 3N4MA 3M1EA 2AXLA 4ENMA 2YPRA 1D5VA 1IXRC 2LDUA 5FLXK 5AIQA 2OAZA 4DQ2A 2DPDA 4UV8A 3JAMK 4LG0B 3FHZA 2V1XA 1P4AA 5IT9Z 2P5KA 2A07F 1ZARA 1ZYRF 1BOAA 5DUIA 3HSEA 5EEHA 1KU7A 1ZHFA 1BI3A 3CUQA 2AS5F 1IN7A 5IT9K 3KP5A 5CLSA 4EJTA 1BN5A 4PDKA 2L4MA 2VBZA 4LK1F 5E18F 3I53A 2Z99A 1YFHA 2C6YA 1ZH5A 2VONA 4OMYA 3JAMZ 4P96A 5DYMA 3PFIA 2O3FA 2PBIA 3EETA 3VOEA 4YIFA 2WTEA 2DQRA 1H0MA 5LLQA 1Q1HA 1J0RA 1H9TA 3L9FA 1D8KA 2H6CA 4A0YA 2FMYA 2DTRA 1EV7A 4ZYHA 1OPCA 3RTRA 3HTSB 4FHTA 5F1RA 2IPQX 2LKPA 3CTAA 3WTXC 4LB5A 1SD5A 4G7OF 1XGOA 3LQRA 2CFXA 2DQLA 4N9IA 4QWQA 1OYWA 1MJAA 2LSOA 4LLGF 1KQ0A 4Q48A 4OIPF 2DT5A 4EGZA 2YR2A 2K5LA 4ESBA 1P2FA 3V7CA 2DK8A 2P6TA 4KIFA 3ZMDA 3SFZA 2HDCA 1R22A 3L2CA 3HSFA 4U0YA 2K4YA 2W57A 4L9NA 4G8XA 5DEQA 1FBQA 2BYVE 3LAPA 1HW5A 2KIFA 5J6XA 1YW7A 4RGXA 4B09A 5TJJA 4AVPA 4UXNA 4LJZF 2K02A 1IF1A 3HHHA 1IW7F 1T0FA 1HSTA 3GO5A 4HLYA 4FX0A 3F3XA 3CUQC 3HUGA 1OYIA 4G9YA 4Y13A 3KFWX 2L01A 2H3JA 2RGVA 3MZYA 3E6DA 1FP2A 3K1NA 1W7PA 2D2WA 4KA4A 3R0AA 5ICGA 1LDDA 1HW2A 2ISYA 2RVCA 2Y0MA 2XAJA 3LSTA 1K78A 5CVUA 3PQKA 2UWMA 4Y17A 1LB2A 1DUXC 2ZO4A 5LEKA 4RB1A 2QWWA 5JI6A 2UZKA 4HF1A 3V8KA 5BPIA 3DP7A 2FBKA 3DEUA 2A6HF 2FSWA 2GA2A 4Q47A 4HBLA 1LEAA 1SD6A 3MEXA 1O3SA 1ZAOA 4CDGA 2V79A 3K9TA 3JTHA 3QU3A 4M9SA 2VBYA 2ZMEA 5HS7A 2M8EA 4BXUA 4KIBA 2MH9A 4A0XA 4HOBA 3SZTA 2ZNZA 3QAHA 1FBUA 1B1BA 5FD5A 1BC7C 4I0AA 3QPTA 3IKVA 1TQPA 3GW2A 3P7NA 1D8JA 1R7JA 2QUFA 4MQVA 3KLNA 2P7CB 3CO7C 3RYPA 4M6XA 4IXAA 3GX4X 1P4WA 4GGGA 3I71A 1W4MA 4D0PA 3HRMA 3ZP5A 3WTUC 3LFKA 2P6SA 1XSDA 4AIJA 1TQIA 4HZFA 2F5CA 2FMLA 3IWFA 2P8TA 4YFNF 1JGSA 4EM0B 3K2ZA 3CUOA 3KEQA 5DCFA 4KDPA 1Z9CA 4GO1A 1XCBA 3ECHA 1OYYA 1J5YA 1U6GA 1ZGAA 4EVIA 2IJLA 3J7AO 1JHHA 2CSOA 1IAWA 1FSHA 2OU2A 4Y15A 3ABUA 3C1DA 2NNYA 4QLCU 1W7PD 4F7ZA 2EV0A 5LGUA 6PAXA 4OIOF 1S6LA 3K0LA 2HEOA 2QQBA 1PP7U 1QBJA 3CLOA 1HXDA 2ZFWA 2K4JA 2DU9A 4RGUA 4B8XA 3KCCA 5L3BA 5D5WB 3KP7A 3MAJA 2D1VA 4OIRF 1YTYA 3ISPA 3GLXA 1SMTA 1ZGJA 4UV9A 4YG2F 3SQNA 2G7UA 2KJBA 3C3WA 2EWNA 1BC8C 2R3SA 2EV5A 5D5XB 1QZYA 3GF2A 4ZH4F 4ASNA 3GFJA 1DPUA 4E70A 3NQOA 2XAQA 2VN2A 1QZZA 3WTTC 4IHTA 2Z3YA 4ETSA 1J9IA 1MKMA 3WGHA 5K5OA 2EK5A 3ECOA 2IRFG 4CXFA 2PG4A 4A6EA 1FBSA 3F8MA 2QENA 5L3FA 4L9TA 1NHAA 3RJPA 2IP2A 1J59A 4ZZDA 2P4WA 4WXHA 4M74A 2EA2A 3QU6A 5LRRA 4HV6A 1RI7A 3I4PA 2EFWA 1FNNA 4U0VA 4LLLA 1RIOH 3I59B 2FOKA 4RB3C 1QPMA 4HDVA 4GCVA 1QQIA 1QO0D 3ZMTA 1E17A 1MJBA 3E5QA 2GXGA 1U5TA 1V3FA 2CWEA 2RQPA 2RV8A 1WKMA 4KMUX 1KGSA 3DXJF 4IRGA 4I2OA 1R00A 3RKYA 1BYMA 1U8RA 3HRTA 2O6GE 1FWZA 4HX7A 2V6CA 1TQMA 3WU1B 1LJ9A 3KP6A 3PQJA 1U2WA 1IN5A 4P9FA 3TDUC 3B73A 1KU2A 2A3SA 2DI3A 2HTSA 1TLHB 5HOOA 2ADUA 1A04A 5HLIA 3BWGA 1U5TC 1L3LA 2P5VA 2K86A 1O7FA 2PJPA 1O57A 1F4KA 4O3MA 3TDZC 5FD6A 1TW3A 4BNCA 2OQGA 4UUVA 5EEGA 3I54A 1U78A 4YFKF 1CF7B 2FA5A 2M1BA 2FQ3A 5DDGA 4M72A 2FRHA 1FT9A 3WE2A 1BI2A 1XSVA 3MCZA 5HS9A 3U1DA 4Q4ZF 3HIFA 2G7HA 1YYVA 1FY7A 5TRDA 1G3SA 1EH6A 1T39A 3WU0A 5DV5A 4IF4A 4WXCA 5LHIA 2HQRA 1WQ2A 2ZCWA 2A6EF 3IRRA 1SFUA 4G6DA 1C0WA 3J81K 4XLNF 5E1XA 1ZG3A 1MDMA 4JQFA 3L09A 3E5UA 3H92A 1XGMA 3KLOA 4ENJA 1LVAA 2GWRA 3S2WA 1MD0A 1GXPA 2M30A 1X3UA 2IVMA 1OR7A 1BM9A 2MC3A 3FXQA 2JT1A 4MEXF 3SXYA 3T5XA 4IJAA 1HKSA 5JFRA 4PZJA 4U88A 3JSOA 5CYVA 2HKOA 3QP6A 3COAC 1HQCA 2GIVA 2MLKA 3D0SA 1W5SA 3F6VA 2TDXA 1H9GA 3LAJA 1J75A 4HQEA 5A2QZ 4M71A 4P9UA 1KYWA 3M9AA 1F9NA 2XAHA 1XMAA 1UHMA 4P5OA 1XDSA 3K69A 3MZHA 1TW2A 1UCRA 4BHPA 2A69F 3FM5A 3F22A 3I0TA 4H0EA 3BOQA 3HOTA 3HYIA 4EMSA 4RB2C 4AIHA 1T98A 3BROA 3DQVC 3RYRA 3GZ6A 4G94A 2QVOA 1PUEE 2GZWA 2BEOA 4HLXA 1MZBA 3LA2A 5D4SA 3LA3A 2A61A 4KICA 1UB9A 2H09A 2HR3A 4GYIA 1FSEA 1I6XA 3E19A 3V7RA 2XVCA 2CGPA 1J2XA 4M6YA 1KQ8A 1S29A 1R36A 1RNLA 4WXDA 2RC4A 2ZNYA 2GQQA 3KZZA 2WWYA 4FX4A 1HBXG 4KYWA 1XB4A 2JTVA 2DK5A 1K78B 3F72A 4NHJA 2FNPA 5JVTA 3F6OA 2FU4A 3TOAA 3IRQA 3BY6A 4K2EA 1T6SA 2ZKZA 3EQLF 4BHCA 4DNCA 4ON0A 4L18B 4IRHA 2XRNA 3B02A 3N97A 4XBFA 3ROUA 2VE8A 1ULYA 4CICA 5CVVA 1R23A 5KVRA 5J8CA 3R6SA 2Z5UA 1G3YA 2EA4A 2XROA 3FM3A 2VODA 2K27A 4M73A 4FT8A 3V8LA 2ZXJA 3G73A 1ZRFA 4HX8A 1ZG5A 3RDIA 2DLLA 3WTYC 2M45A 1S8NA 3KEOA 3HOSA 2BGCA 2FE3A 3I64A 5ICEA 1FC3A 1XGSA 4ESFA 2VOPA 2RN7A 1ZRDA 5AONA 5FO5A 2Q2EA 2PEXA 3C7JA 1FYLA 5E8GA 1STZA 1FOKA 4ESJA 4A5NA 5LHGA 3R0JA 4IHSA 4L9VA 2VT3A 2NYXA 3ABTA 5J8FA 1RUNA 4M9XA 2XASA 3W6KB 5D8KB 4RB0A 2Q0OA 1YW8A 5FB2A 1HKTA 2K5FA 3HSRA 1SFEA 3ZQ7A 2PI0A 1LEBA 2YX4A 1XMKA 4KN7X 4LK0F 3P9KA 2F5DA 3KP2A 4RGSA 2CQKA 1P92A 1BI0A 2QM3A 5BMZA 2JPCA 3R4KA 5D4RA 2HS5A 2YX7A 3BP8A 3NEUA 2IW5A 4MTEA 2V1DA 5E17F 5A2QK 2KRFA 5F6FA 3WE3A 3L7WA 2W25A 2L4AA 1QNTA 3WTWC 4CYDA 3OOPA 1FLIA 4JK1X 2O03A 3GFLA 3F8NA 1R1UA 3HHGA 4S05A 4ZZLA 1VTNC 3KP3A 3DV8A 3BJOA 1JE8A 1AOYA 2PMUA 3BJ6A 2Q8KA 5IT3A 1I1SA 4PGHA 2Y48A 3FZVA 1BBYA 3QPHA 2PMHA 1U3EM 3M7GA 1O3TA 4MQ9F 2BV6A 3WODF 5CVJA 1Z6TA 2VC1A 1LDJA 2BE5F 4EGYA 1SD7A 2HQNA 5CJ9A 5HDKA 2HZTA 2XHKA 4KIGA 3FMSA 4EQQA 3VEPA 1WSUA 2X0LA 1E2XA 1LNWA 5K5RA 1IXSB 2XKPA 3VODA 3W6JB 1UFMA 2EJRA 4L5IA 4WK8F 4UVCA 3V8JA 2E1CA 1ZRCA 3F23A 3CUQB 3ELKA 3HTUA 2HGCA 4NB5A 1U5TB 4IRIA 4ZYEA 1AWCA 5H6QA 5LEJA 2L3DA 1FP1D 3DFGA 4L0YB 3WGIA 3GZ5A 3DPLC 5ERIA 4WCGA 4PCQA 4R1HA 1P4XA 4BYYA 2FXAA 1ZN2A 2W85A 5KK1A 2MLGA 2Z33A 1SMYF 2L54A 2NNNA 4XLPF 2Z9OA 4WWCA 1WWXA 1XCVA 1QW1A 4CZZA 1JXSA 1Z7UA 2ETHA 3P9IA 2R7DA 3E3VA 3K1PA 1ZG1A 4OU0A 3CO6C 4WX9A 5DCMB 1KYZA 1IZ1A 2M5WA 2L02A 3CDHA 1DPRA 3GVAA 5CVRA 2DPUA 5HDGA 4A2UA 2FEZA 2PLYA 4U0WA 4XSZF 1SFXA 1OMIA 3R61A 2HTJA 5CVIA 1JHFA 1Z91A 5DCMA 5K1YA 4HW0A 2IA0A 1S7AA 1R1TA 2STTA 5DD8A 4G6QA 4LG0A 2F5EA 1R5HA 3LWFA 1ZLJA 3RIRA 1I27A 2GCXA 1G3WA 5ILSA 2QBYB 4HA8A 4I0BA 4NQWA 4S04A 1GVJA 3ZN1A 3O2PE 1BJAA 3ZN0A 2EV6A 3FXUA 3GUDA 4UHTA 2QZ8A 1KU9A 4KNYA 2QQ9A 5L3GA 2RDPA 2B0LA 4RS8A 4GXOA 2OZ6A 2E1NA 3MQ0A 4N0BA 4O6JA 3WGGA 2YU3A 3Q5FA 4AIKA 3SZPA 1QVPA 4HQMA 2DBBA 2X4HA 1IRGA 1UHWA 2M87A 2D1HA 4AWXB 1K79A 1B9NA 5E1ZB 2CYYA 1I1GA 1SD4A 1F5TA 3EYIA 3IHUA 4LLNA 3M8FA 2RKHA 4OIQF 3CJNA 5JR3A 1ON1A 1OKRA 1HW1A 4L0ZB 5HVQC 4XRFA 2CO5A 4ZYGA 3DF8A 2CW0F 4RAZA 4CHUA 1KA8A 2DFIA 4I02A 1S7OA 4Q5SF 5L3EA 4LB6B 4EJVA 1S3JA 2MD5A 3GXOA 5D5VB 5LHHA 3BPXA 3OV8A 3V4GA 3MHXA 3WTVC 2IA2A 3GWZA 3SHFA 4OINF 3VFZA 1Z05A 2OD5A 4L5JA 1PP8F 3QP5A 4IVNA 1RUOA 3BJAA 4HF0A 1WI9A 2ZJ2A 2EFOA 2QYOA 3FMRA 2QQAA 2W84A 1KQ9A 3HRUA 2A5YB 1O3RA 2P5LC 3F8FA 4IPAA 4UVAA 2FF4A 3ML6A 1B4AA 3EYYA 1EH7A 3TGNA 3EDPA 2LF7A 5E1WA 2OZUA 2DW4A 4BHBA 3U2RA 4G7ZF 2ELHA 4MNUA 1FYKA 1BI1A 5BOXA 2KJCA 4JBAA 1B59A 2DAOA 1J7KA 1T38A 5E8IA 2W24A 4O5VA 1YS7A 2XAGA 3WTSC 2EFQA 3MWMA 1B6AA 3JSPA 3TQNA 5FFXA 3ZMSA 4ENKA 4AD9A 2XIGA 1GHCA 2E7XA 4U7BA 1V4RA 1K7AA 3NRVA 1XD7A 3F8CA 2UXXA 2NRAC 2VC0A 4UNOA 4HF2A 3RPUA 3ZPLA 2FBIA 2JZYA 2PN6A 2XUBA 3U9GA 3O3KA 3KETA 5K5QA 2R7FA 3FWEA 4RAYA 2VBWA 3E97A 1L0OC 3KP4A 2JRTA 3IWZA 2ZBKA 4P55A 2OA4A 5BQTA 3FXRA 3HRSA 2HYGD 4ZYDA 4HAMA 1HKQA 4I98B 2MBFA 2CG4A 1W7PB 3KZYA 5AIPA 2H6BA 1MGTA 4BAYA 2XAFA 4MTDA 5HS8A 1MDMB 2VXZA 4LMYA 3IC7A 1USSA 4HYEA 1DDNA 3I58A 1IN4A 5HDNA 4R79A 1YS6A 2QBYA 1YG2A 5D8LB 1W5TA 2HWVA 1R58A 3JTGA 2HOEA 1REPC 3EUHA 3WTZA 1I5ZA 2LF8A 1FPQA 2Y75A 4G7HF 2OBPA 3QRFF 3E6BA 1MJ9A 3GEZA 2J5PA 1Z6RA 2A68F 2LNBA 2IA1A 4LGWA 2QLZA 5ICCA 3D5LA 1Z1DA 4I01A 5HLHA 2NS0A 5FFZA 5D6EA 3F21A 2J5OA 1LQ1A 1IUYA 1IN6A 3T1BA 3T0YA 1FYMA 1TBXA 2HKXA 2VT2A 4MHGA 4EJUA 1Y0UA 5ILUA 3IL2A 2LX9A 5LRSA 4HV5A 4GYGA 3Q9SA 4PGGA 1LDKB 5DD4A 3E5XA 2K7LA 4UVBA 2HYFA 5FGMA 2KKOA 5D5UB 2O8XA 5LGNA 2XV4S 2COMA 2MA3A 3V7SA 2EFPA 3O6BB 1G6NA 3J80Z 1DP7P 3T8TA 5ILVA 4HDUA 3KE2A 3ERED 3FX3A 1CF7A 3GFMA 3R60A 4A12A 2IT0A 1IN8A 3RKWA 3RKXA 4CGZA 5D6FA 2JSCA 1YLFA 1XGNA 4KFCA 5DUKA 4BH9A 2ISZA 2XKOA 2VOOA 1F1ZA 3ZMZA 4KMFA 1YW9A 2WV0A 1R1VA 3TOBA 5F64A 4A6DA 3REOA 2ACJA 1BIAA 3F8BA 2XGXA 3ULQB 2FNAA 3K1MA 3GFIA 2V1UA 4OOIA 3H3UA 2D45A 2K5IA 1TTYA 4EJOA 3GYHX 3DPTA 4HX4A 4KN4X 4EM2A 1KU3A 4KT5C 3TO6A 2H27A 1G4DA 2EB7A 3Q9VA 2GAUA 4MEYF 3QOPA 1YIOA 3TO9A 2F5FA 1USTA 3BDDA 3BZ6A 4OMZA 4EJWA 2ESNA 3E6MA 3JW4A 4A0ZA 2OQRA 4A5MA 1FX7A 1QGPA 5LBQA 2PFBA 4MGRA 4Z2YA 3WG9A 5BPDA 4WF2A 4LD5A 2VBXA
chains in the Genus database with same CATH superfamily
1JKQC 2QQ8A 3G2BA 3FXKA 3H1CA 2YU9J 1C0MA 3R6OA 2F4MB 3BZKA 2B7EA 4LFUA 3RPQA 3F70A 2JMAA 1WI3A 4BJTA 2N8GA 4BI8B 2VE9A 1Y57A 3L1AA 2NS7A 3A52A 3CMMA 4BUGA 2CQNA 2RF0A 1EH8A 2D9TA 1W2BP 2VB6A 1D3YA 1HOMA 2LVSA 2JA6J 1B9MA 2P7VB 1SAXA 2E71A 2MGQA 2ESHA 3J80K 1G2HA 2XDBA 1C6VX 2LCSA 2NVXJ 2X98A 3I9V2 3I5RA 3L2VA 3J81Z 5LJ3h 1BIBA 2FVUA 3HPGA 1RAEB 1O7LA 3BPVA 2WC2A 3BT9A 4I7HA 2KLOA 3VB2A 1RABB 2DLPA 4KUMA 1X27A 5KYXA 1PDNC 1GXQA 1K4US 3ASNH 1FTTA 3TMOA 3OYKA 3I59A 4N9HA 4M77D 3JB9J 3QQAA 4BDZA 4C8QA 1E3PA 2LQWA 4I09A 1AA7A 1VQOT 1JTXA 1WH7A 3IH2A 1K6OA 2CZ1B 3EAEA 4IKFA 2WAQA 2COBA 4TV7A 2JPBA 2COYA 2E7WA 4IIOA 2VIXA 3LQQA 2LKXA 1PG5B 2E3IA 3BCAA 1EX4A 3EPZA 2ZXIA 5H20A 2KT0A 3WHCA 2R5YB 1OX9A 4YIRX 3MPUB 3OIOA 1XN7A 3MZ8A 2COZA 2MH2A 2KIMA 3TBIA 3FF5A 1RZ4A 3G1JA 3A01B 4CO8A 1FZPB 1VIFA 1A6IA 3CQTA 3CMAQ 1WRJA 3HPWA 1MV0B 4Y7NJ 1XSXA 3AAFA 4J9DA 1ONVA 2V9KA 5B66C 1PC0A 1IRFA 3S17J 3TO7A 5E20A 1QVTA 2Y31A 3SWNB 2SEMA 4EV0A 4A3JJ 2DL3A 3L1PA 2L3RA 4J9CA 4HT9A 1Z77A 1OCCH 1R5GA 2LMJA 4F7UE 5H6RA 5HLGA 2VV5A 3HL8A 2Z16A 3TREA 5GAOm 3NTKA 3ZMUA 5FLXZ 3TP0A 3L2QA 2LOOA 2DMOA 4PJOG 5LGTA 2DA6A 3CCVI 1NEGA 1FMKA 2V9VA 4IZZA 1O3QA 2H1KA 1IXCA 1CKBA 4RTXA 5HNHA 3L00A 1YITA 4Y4RA 4KGXB 1OZ3A 1M1KR 3G3ZA 4YFXF 4RGRA 4S0HB 2F2EA 1F1BB 1LJOA 1ZSZA 4XN0A 1UEBA 3H0HA 2FBHA 4YIIA 2DOFA 2MAMA 2RN8A 2RNJA 2JA8J 4A3KJ 2LLKA 4NOYA 3KYLA 3FEOA 2BBYA 2LVMA 2O7OA 2M1HA 1UMQA 3C94A 3G6EQ 3QUIA 5IHNA 1Y6IA 2NOGA 1XDUA 4OB0B 1YBYA 2ZMEB 5ED4A 2KT8A 2X48A 3C18A 4C9YA 1YWPA 4M78A 3TEEA 1X1PA 4ENNA 1ZLKA 5GAN2 4MDXA 3GTQJ 4M7AB 2H8RA 3ZMVA 1ETVA 3HFNA 3JCMQ 5IP9J 3P9CA 3E6CC 1W2BS 3BTLA 2XMFA 4HVVA 2VLAA 4BI4A 1VQ7A 2DO7A 3ZOBA 2QASA 3NHNA 3LGFA 4BQQA 3H3ZA 3U1KA 1E3HA 3IP4B 4LIUA 2Y0SA 3PIOF 3DKWA 2O31A 1P6RA 1GL5A 2GA1A 2E2IJ 2DBMA 2KIUA 2JTFA 2BHYA 4R8HA 2EYQA 2E5NA 2V1QA 4J9IA 3OYYA 1HSJA 4ZDOA 2X6OA 4IX7A 2CP5A 2O0YA 1TNTA 2YSRA 2HFHA 2F4OB 3MFKA 3GTOJ 3IH4A 3HOYJ 2CQ7A 2E5QA 2FYKA 2HBWA 2KVQG 3NGPA 1LUJB 1BA5A 2QAZA 3TKYA 3J80R 2KDOA 1M8VA 3PTAA 2WY7Q 3TVTA 2VL8A 1ETQA 2UXNA 1QPIA 4B6MA 3I55A 1YO5C 4HT8A 3ABLH 1B07A 2WA0A 5EGOB 2HOAA 2RNAA 2NAZA 3FMQA 2H94A 1TNSA 1W6XA 2PQ8A 3I5UA 1ON2A 3RI4A 4Y52J 1G3TA 2CQQA 3GOXA 2M0MA 3M8EA 5TGTA 1J3TA 5ICFA 1H8AC 1XTDA 4FM4B 4Z02A 4DOWA 3JAME 1C1AA 2XDPA 1U5SA 2V6EA 5BS6A 5DS9A 4N4IA 4YEJA 4XLFA 5L3CA 1KD1U 2K2MA 5DM7R 4U7DA 5JHUA 2DOAA 2IEKA 2K4BA 4XLHA 3LA7A 1CGPA 4C8QB 1WGSA 1ODDA 4JYKA 2EFNA 3GPLA 2M0OA 5HK0A 3LSHA 1ZREA 5M9OA 3CQZJ 3K4MA 2L3SA 3N5BB 2CMPA 4M9ZA 4J9FA 2VUMJ 1VQ5T 2KRHA 4BQAA 1BR1A 2G9WA 2OPTA 1SHFA 1VQ5A 2IIMA 2QSFX 1YIJI 1ZQ1A 2FQ4A 5L3DA 4EM1A 1VQ7I 2O61A 2GXBA 1Q86R 4QQDA 2QEXI 2STWA 4XSXF 2E5ZA 4E7SA 3PJRA 1T2KA 3T8RA 2L2PA 2ZCFB 5EZHA 3LL7A 1QKWA 1YQAA 4L9JA 2EIMH 3OYMA 3IKTA 3N4MA 1IHVA 3HZJA 3M1EA 2FZCB 4FE4A 1S72I 4I6ZA 4HVWA 4OB1B 5LJ5h 3JCMg 3BFMA 4ENMA 2YPRA 1YN8A 1D5VA 1IXRC 2LDUA 3C2GA 5AIQA 2OAZA 4DQ2A 2DXIA 5FLXK 3CCLT 2DPDA 2CH4A 2F2XA 4Y91A 4UV8A 4ZGEB 2OCEA 3JAMK 4LG0B 3O8VA 4XK4A 3M4GA 3FHZA 3CCRQ 2BZTA 2V1XA 1MBGA 2W82A 1P4AA 3K4LA 5IT9Z 4MZMA 2P5KA 2P0PA 2A07F 1TXQA 2IS2A 2WSCE 1ZARA 5FU6C 2MWPA 1ZYRF 3FXMA 2MWOA 1BOAA 2HQXA 4L59A 5GMKi 1T33A 5DUIA 1IGQA 4FL6A 3HSEA 5EEHA 4M78E 2R7WA 1KU7A 3DWLE 1ZHFA 1BI3A 5GANj 5IH2A 3K6GA 2EJGA 1YI2A 3CUQA 2AS5F 1IN7A 3OWTA 3RMSA 5IT9K 3KP5A 5CLSA 4EJTA 2RNGA 1BN5A 4PDKA 2QTXA 2L4MA 2VBZA 4LK1F 5E18F 4OVAA 1VQ6T 2DYRH 5JHFA 1VQ6A 5A0LA 1D3BB 3I53A 2M4KA 1WJAA 4C92G 2Z99A 1FOYA 1A31A 3QYFA 1YFHA 3NFCA 1ZLMA 3G71Q 4A4HA 2C6YA 1ZH5A 4DJAA 2L5QA 4X9CA 2VONA 4OMYA 2LCCA 4OB3B 3JAMZ 4F7UA 4P96A 4RTZA 5DYMA 2K3YA 1JQQA 3I9QA 1QVGP 1QVFS 3PFIA 2O3FA 2PBIA 4BUPA 2EYZA 4XKBA 2ZJRF 3P8HA 4OMFB 4P5NA 4PJOC 3EETA 1UG0A 3VOEA 4C3JJ 4EATA 4YIFA 2WTEA 4XQFA 1AKHB 2DQRA 4M77G 1H0MA 1N78A 5LLQA 2GBYA 3CDIA 3A8LB 4QQGA 2E5KA 1B72A 5EEAA 1SKUB 1Q1HA 4KUDK 1J0RA 1H9TA 4FU6A 3JRZA 3L9FA 1D8KA 2XDVA 1YHQQ 2FPFA 2H6CA 1QZEA 3DU5A 2ROLA 1ZHIA 4RBOA 4A0YA 3FXJA 2FMYA 1R0BG 3CJTB 3HHTB 1R9TJ 2DTRA 1FOXA 5LFAA 1GFDA 2MPXC 1JXMA 1EV7A 2EZIA 3KYCB 2KFDA 3ZQHA 3EH2A 4ZYHA 1OPCA 3AG2H 3RTRA 3G4SI 1TG0A 1AEYA 1Q7YU 4FHTA 1MIJA 2UUZA 5F1RA 3HTSB 2IPQX 4M3GA 1ETWA 1QWEA 1MMNA 2LKPA 3CTAA 3WTXC 1VI0A 4LB5A 1VQ8A 1Z21A 3MEVA 2M8GX 1SD5A 2D8JA 4G7OF 4RUGA 4A63B 1KJWA 1LKXA 1XGOA 1NM7A 1PKTA 2DA2A 1TT0A 3LQRA 4R0KA 1MMSA 4OWRB 3ER0A 3CMYA 3ONQA 2YXYA 1WFWA 3FIWA 2GNCA 4ZJZA 2CFXA 2DQLA 4N9IA 4QWQA 1OYWA 3B6AA 1X3WB 3S93A 3VYSB 1FYNA 2CS7A 2O4XB 3FXLA 4IURA 1MJAA 2LSOA 4LLGF 4X6AJ 1KQ0A 2DOEA 4Q48A 2ZPIB 1KG1A 4OIPF 2DT5A 3QXEB 4A3FJ 2JN0A 4EGZA 2YR2A 1YWOA 1M2OA 1JKRC 2DNUA 2K5LA 1YJ9T 4EMHA 1EF4A 1W4SA 4B3XA 4ESBA 1P2FA 2LP0A 4L6V5 1PYVA 3HPHA 3V7CA 1ZK8A 3M53A 2DK8A 2ZC2A 2P6TA 4KIFA 2MZ4A 3ZMDA 1AWXA 4NQWB 1S1NA 2K3XA 2DILA 3E2UA 1Q7YR 5JVGF 3DLAA 3SFZA 1N25A 4FSXA 2RAEA 2HDCA 1R22A 3J7ZI 2LRQA 1OCPA 2MC4A 3L2CA 3HSFA 4U0YA 2K4YA 4LUDA 2W57A 4L9NA 1KC8U 1NK2P 2OTJT 4PL6A 4G8XA 5DEQA 1GCPA 1KQSS 1FBQA 2R7XA 2BYVE 2K3FA 2X1DA 4RA2A 3LAPA 1UHFA 3FDYA 2XPVA 2P4RA 3J80E 1S72Q 2GF7A 1HW5A 2BXYA 1VQ4I 3W3CA 2KIFA 5HK3A 3LSIA 1X6BA 2DF6A 2JVVA 3Q0VA 1H92A 3PNTA 5J6XA 1YW7A 4RGXA 1XPXA 2JM9A 5C4JJ 5GAMj 4F92B 2OTLA 4B09A 1H641 1VUBA 5TJJA 2OTLT 5E79C 2HDAA 5CIUA 3S1RJ 4AVPA 4UXNA 4LJZF 2K02A 1IF1A 2W10A 4IUUA 3RBBB 3FKJA 3HHHA 1IW7F 2VVKA 3TCJA 1T0FA 2BE7D 1HSTA 1U1SA 3GO5A 3S15J 1PD0A 4M6VA 4HLYA 2LJ3A 5F0FA 2O88A 1KC8R 4FX0A 3F3XA 3CUQC 3HUGA 1X1BA 1Y96A 3MN2A 4C3IJ 4DZPA 4A93J 5GAMd 4J5YA 1OYIA 4G9YA 1YE9A 1KQSP 4Y13A 3KFWX 2L01A 4FISA 3BTJA 2H3JA 3HJEA 3THKA 2DZ9A 2RGVA 3MZYA 3FDRA 3E6DA 1FP2A 3K1NA 1W7PA 1WI7A 4OGCA 2HPIA 1O75A 1YJ9Q 1WJQA 2D2WA 1I3QJ 2QA4Q 3E0JB 4M7DD 1SSHA 4KA4A 3A8MB 2EILH 3R0AA 4NUBA 1YRNA 1OI1A 5CKDA 5JLWA 4RAFA 2M34A 2HDWA 5ICGA 1LDDA 3EG0A 3INZA 2OTJI 3I56I 4TVRA 1VQ9I 1HW2A 2ISYA 2CYZB 2QA4I 2R5MA 2V8KA 2DFUA 1DJ7B 4J8OA 2RVCA 2Y0MA 3SDGA 2EQIA 2ID6A 4DBFA 4Y33A 4ABZA 3GNFB 2XAJA 3LSTA 1K78A 5CVUA 2HL5C 3C12A 4AG1C 1YJNA 3PQKA 1TUDA 4CI0C 2UWMA 5GMKe 4Y17A 1LB2A 3FC3A 1WA7A 2V8JA 1DUXC 2ZO4A 3WVEB 3SWNC 5CCAA 5LEKA 4RB1A 2QWWA 3LSRA 2R92J 5JI6A 5FLXE 3CCET 2UZKA 2CUFA 1K0SA 2NYSA 1UGQB 1I07A 4HF1A 3V8KA 2MVTA 5BPIA 4J9EA 2ZPBB 1Q81U 3DP7A 2FBKA 4PJOB 4C2UA 2DA5A 4K11A 3DEUA 1RETA 2A6HF 1TWCJ 2L9SA 4E7ZA 2FSWA 2GA2A 4Q47A 5HY6A 1KZHA 2VKDA 3F0CA 2JUCA 4M78C 4HBLA 1VQNQ 1MNEA 3SJMA 1LEAA 1IDZA 1SD6A 1NG2A 1DGWY 4II2A 2K40A 1PSEA 2GGRA 4FYVB 3PVLA 4RTVA 2PX9A 4Z89A 3MEXA 1LFUP 4IO9F 4M7AE 5KYWB 1O3SA 2M35A 1ZAOA 4CDGA 2V79A 1E7OA 2IBDA 4MZPA 3K9TA 4ESRA 2IS6A 3JTHA 3QU3A 4M9SA 1LFBA 4N4NB 4BQNA 3C2HA 1X58A 4OAZA 2VBYA 1U06A 1KD1R 2NXNB 1N8RR 2ZMEA 3V42A 3OMCA 5HS7A 2M8EA 4BXUA 3OY9A 4KIBA 2MH9A 3NARA 3OS1A 4HVUA 5F0CA 4A0XA 2HBPA 4HOBA 3SZTA 1WZOA 5L8RE 1X75C 2ZNZA 5A0GA 3QAHA 4QSHA 2NUTB 2FJ1A 1RI9A 4MIMA 2DEQA 1MGQA 4EIKA 1FBUA 4C30A 1B1BA 2W00A 5FD5A 5FRMA 1EIFA 1BC7C 1D1AA 1IG7A 1WHLA 4I0AA 5FROA 3QPTA 4RCCA 5B5EC 2QA4T 5M3MJ 1EKEA 3H35A 3IKVA 3QYEA 1TQPA 1M3BA 2QA4A 1IB8A 3CCUT 3EH1A 3LWIA 3GW2A 4IUQA 1YJNI 1NJIU 3P7NA 1D8JA 2CJJA 4PJOD 3FK6A 2DBKA 1R7JA 3VRZA 4GBQA 2QUFA 2LG4A 4MQVA 3KLNA 4LNPA 4XRSA 2YHTA 2QEXT 1VQLT 1X1AA 2W4SA 3CO7C 2P7CB 4JRKA 4B47A 5GAOl 3MKWB 3RYPA 4PKCC 1K8AC 4AMCA 3DU6A 1PM3A 4M6XA 2VJ5A 4IXAA 1SHGA 3GX4X 1WX6A 1XJWB 4F16A 3EFOA 3H36A 1QMCA 1P4WA 3DB4A 3CCMQ 2JJ7A 3ZFJA 4GGGA 3I71A 3SFIA 1I0CA 1W4MA 1G59A 4F52A 1JI8A 3RQIA 3HRMA 4D0PA 2RPNA 3ZP5A 1AD5A 3WTUC 3HKZN 3LFKA 1H8KA 4IL6C 2P6SA 1XSDA 4AIJA 3A2KA 3TW6A 1TQIA 1N27A 4XKCA 1BCOA 2RO0A 4J83A 1BL0A 4HZFA 3A01A 3BTIA 2EIFA 1EJ9A 3CBMA 2F5CA 4F3QA 2FMLA 3RSNA 2EYXA 2CREA 2BIVA 2XK0A 1WNLA 3BTCA 3JRCA 5GANd 1RQ6A 1HCRA 3A4CA 4ZC3A 4N0AC 2CUJA 3Q0UA 2D5VA 3IWFA 2P8TA 1ORKA 1FJLA 2A0FB 4C92A 4W97A 4J6YA 3CC4A 3OL3A 2LQKA 4YFNF 2NVUB 3OSGA 1JGSA 2W1OA 3S1MJ 2I10A 1ETXA 5IXBA 4M3EA 4EM0B 3GNGA 1QVFP 4IHXA 3BR0A 3K2ZA 2LJ0A 5GAOr 3JB9F 3M9QA 2W0ZA 1JJ2S 2JSPA 3CJRB 3CUOA 2F5TX 1HDPA 2QGUA 3KEQA 5DCFA 4KDPA 1M3CA 2E12A 4CC2A 1AWOA 1YJWI 5E3OA 1YJ9I 1Z9CA 1RADB 2BXZA 3CCUA 3GTMJ 1OZ2A 4GO1A 4M7DF 2FX0A 2HPMA 1XCBA 3ECHA 1ETKA 1OYYA 3HG9A 2BVMA 2X6WA 1J5YA 4ME7A 1U6GA 3ZRGA 1MSFC 1ZGAA 2KBTA 4EVIA 1X6GA 2IJLA 2KQRA 1JHHA 2KL4A 3J7AO 5KCHA 2VKHA 3GIBA 1W1FA 3MKZA 3J7AF 2CSOA 4U87A 1IAWA 4BBSJ 1FSHA 2OU2A 2YT6A 4HSTA 3SEMA 3QWYA 2ROTA 3MEWA 3OIPA 4Y15A 1WYXA 2HDDA 1X2MA 5AYFA 3QZ5B 2ZPFB 3ABUA 3I55Q 2ZJPF 2VGNA 3C1DA 2NNYA 2WAEA 2XF7A 3WU2C 4QLCU 2LX7A 4M7AC 2AK5A 1W7PD 4F7ZA 4LDWA 2EV0A 4X1EA 1SG5A 4M75A 1TWFJ 2KISA 1LPQA 3PMIA 5LGUA 4KT6A 3TSZA 5F08A 2JNGA 1UUEA 2Y0SN 4I99C 6PAXA 2CQXA 4OIOF 4R55A 4M77F 1S6LA 3K0LA 4PFPA 2QQBA 1PP7U 2HEOA 1QBJA 4YTLA 1VA7A 1KD1C 3CLOA 1PUFB 1HXDA 4J00A 2RJCA 2BY3A 5A2QR 2COWA 2ZFWA 2K4JA 3CC4I 1WIEA 2L89A 3FLGA 3S14J 2O01E 3GTKJ 2VQCA 3M55A 2DU9A 5F1JA 4RGUA 5L23A 4B8XA 5GMKm 2E19A 5LJ5f 2G0EA 2RREA 3KCCA 3ASKA 5L3BA 3E7LA 4FT2A 5D5WB 2MOXA 3DLLA 2HEQA 4ZGJB 4C0ZA 3I5SA 3KP7A 3MAJA 4V2FA 1EZZB 1RLPC 3NMZC 1N75A 3JB9H 4IQ4A 2D1VA 2HVSA 2YUNA 2DMQA 1XX5A 2LNVA 4OIRF 2RHZA 3OYNA 1YTYA 3ISPA 4F55A 3GLXA 1QP3A 1SMTA 4JZ3A 2YSQA 2FPDA 2B9SA 1ZGJA 1KC8C 5LJ5g 1Z9ZA 5KYUA 4KUIA 4UV9A 1KK7A 3SDZA 3CC7Q 4YG2F 1NZ9A 5J1YA 2WY8Q 3SQNA 3JAMR 3D5SC 2LREA 2XB5A 4D8DA 2DMTA 2L2OA 3FRNA 2G7UA 3RPUD 2DTOA 3B6CA 2KJBA 3EFOB 2XHCA 1ZA1B 3C3WA 1A5JA 5C4XJ 2EWNA 4B9XA 3LSMA 1BC8C 2R3SA 5HNFA 1VQOI 5B1BH 3ZR8X 2LDMA 2CU7A 2EV5A 5D5XB 1QZYA 3GF2A 2K5CA 1TT5B 4ZH4F 5LD2C 3C4SA 3CF2A 4ASNA 1X1CA 3ABKH 5GADJ 2L0AA 3GFJA 1KSWA 4JUVA 3WG7H 4BQOA 1DPUA 4E70A 3NQOA 2H3EB 2HNIA 3A98A 2XAQA 2JJ9A 2BY2A 1QZZA 2VN2A 2XGEA 3ZQGA 3WTTC 4IHTA 2Z3YA 1ZUUA 4ETSA 1J9IA 2K3PA 5J40A 2XIDA 1K73U 3LNQA 4EMKC 1MKMA 2HOSA 3HOVJ 2PU9B 3WGHA 4C92B 3GZNB 4NBQA 1MBFA 3J81R 1Q7YC 3GBQA 2ED0A 5F0HA 5K5OA 1TUCA 2EK5A 2Y2ZA 1NLOC 3ECOA 2IRFG 2RHYA 3HTRA 4CXFA 2O8KA 2PG4A 4A6EA 3JRDA 2ZPGB 4J6WA 1FBSA 3F8MA 2O9SA 2QENA 5L3FA 2PJRB 4L9TA 1W70A 1NHAA 3CMEI 3RJPA 2IP2A 1J59A 2KXDA 2RJFA 1N6AA 4ZZDA 2O9VA 2DIGA 3JRAA 4Z8AA 2P4WA 4M3FA 1YITI 3CD6I 2RHXA 4M78F 2FOWA 3FJ5A 3QSUA 4WXHA 2LTPA 1ZGWA 2YRVA 1WZ2A 2QGGA 1G5VA 2DTZA 4M74A 1Y1VJ 2BVLA 2EA2A 3LLRA 3QU6A 4J01A 4AC0A 1T3LA 1QVGS 1DU6A 1B34A 1YI2I 1FTZA 3VYTB 1RL2A 5LRRA 1JUPA 2DXCA 4HV6A 1NYFA 1RI7A 3PNYA 3H0IA 1Y39A 4M75E 2OJED 3OYAA 1IRZA 4OMOA 3WXMB 5KYXB 3I4PA 2EFWA 1FNNA 4U0VA 1W36C 2QDLA 4LLLA 2RQUA 2VI6A 4XKWA 1RIOH 5GAN4 1RKTA 1TL8A 3I59B 2FOKA 4RB3C 2EAYA 1QPMA 4HDVA 4GCVA 1VQ6I 4RG8A 3QDRB 4XU2A 1QQIA 1YIJQ 3FISA 3EGXA 2KQWA 1QO0D 3ZMTA 5TISC 3OYLA 1E17A 2O2OA 3CCVT 1VQKA 2DA1A 4FASD 2YRDA 4XTZA 2ELJA 1PVEA 1MJBA 2EZHA 2OC6A 3E5QA 2GXGA 3OL4A 1DQUA 3FHNA 3PFYA 1U5TA 2GFAA 1XMXA 1K9AA 3HOZJ 1V3FA 4DW6A 2ZJQF 2ZGWA 2LMDA 3PGGA 2FUG2 2R93J 2CWEA 2RQPA 3JREA 1WGXA 2R7RA 2X6YA 2RV8A 2FPEA 1MMAA 1WKMA 3HEFA 4KMUX 5GAGJ 1OX8A 2CZ6B 2E3HA 1KGSA 2M02A 1PRMC 3EHRA 3Q1JA 3QBYA 4M75D 2CH0A 3IV5A 1RAFB 4UB8C 2JA7J 1IXDA 2R5ZB 4PLIA 3AFHA 3DXJF 4NL3A 4IRGA 4I2OA 3RNJA 5GP9A 3CMEA 1W0TA 1M4ZA 3JCMV 4NNJA 1R00A 3RKYA 5I22A 3CCJT 4EMKB 1BYMA 1A0NB 4JRIA 1U8RA 2AQFA 2X9DA 3CCJA 1M30A 3HRTA 3CCMA 4P1WA 1FWZA 2O6GE 2B86A 2BZXA 3QYGB 4HX7A 2R0QC 3KIOA 2X3WD 2V6CA 1TQMA 2QCOA 3JRGA 3WU1B 3G4SA 3C0CA 3KUFA 1LJ9A 3KP6A 4DBQA 4E7LA 3OS2A 4FIBA 3PQJA 1U2WA 3JCMX 1IN5A 2K9SA 1M9SA 1WXUA 5GAN8 3CPWA 4P9FA 1N77A 5GPAA 1Y1WJ 3LH0A 3QIIA 2QEXQ 3TDUC 4RDUA 1OU9A 3B73A 4XR6A 2H8HA 1KU2A 2A3SA 1Y0MA 4KH1B 2YUOA 1YJWT 1OPKA 1YIJT 2DI3A 2HTSA 1TLHB 2CUEA 5HOOA 2ADUA 1A04A 1NPRA 5HLIA 3BWGA 3RZDJ 4BS9A 1RPWA 5EF6A 2K7AA 3G6EI 1K8AU 3HFOA 2CZ0B 1U5TC 5K7HA 1L3LA 2KK4A 2EYWA 3BR1A 4Z88A 1VQOQ 4QVDA 1UG2A 3O5ZA 1Y0NA 2P5VA 2K86A 4MDWA 1O7FA 4BJ6C 1RR8C 2PJPA 2HKQB 3L42A 4OGEA 1D0ZA 4UUSB 5GAN5 4BBRJ 3UPUA 1JT0A 2CT3A 1O57A 1F4KA 1YI2Q 1WHMA 5J47A 2EBPA 4O3MA 2ZSIB 4FW2A 1TUGB 3BCBA 2ZZDA 3TDZC 2E1MC 1V54H 5FD6A 4BEHB 3H9NA 2JK3A 3VS5A 1I1JA 4A4GA 1TW3A 4BNCA 3SZGA 2LQ8A 2OQGA 4RLQA 3OYGA 3PVQA 2WACA 2ME6A 1GVDA 2ECZA 2KYBA 4UUVA 4E7JA 5EEGA 3I54A 5KNLA 2EFIA 2A7YA 1U78A 1NH3A 2LR8A 4YFKF 2R7UA 1CF7B 2VYTA 2DFFA 2LT1A 2FA5A 2ZFUA 1MSEC 1KHIA 2VWFA 2M1BA 3VYRB 2BZ8A 1QWFA 1AZGB 3ZEHA 2FQ3A 2M9UA 5DDGA 3I56T 2XPUA 4M72A 3TEDA 2FRHA 4IUTA 5CQYA 1WHGA 1FT9A 1IHWA 2BW3B 3WE2A 3KFVA 3AL0B 4FQGA 3EG3A 3QDFA 4AVZA 4C92D 1BI2A 1XSVA 2D0QB 3OW2P 5D7UA 2MI6A 3G6ET 4J6XA 4C5EA 2DA4A 2XICA 4A53A 5CK9A 2HYJA 3MCZA 2FD5A 2A08A 5HS9A 3U1DA 2ENMA 3IQLA 5E3MA 4Q4ZF 3HIFA 2G7HA 1YYVA 3KEYA 2P84A 1FY7A 4LD5A 5TRDA 2HZYA 5C6SA 1V5FA 1G3SA 1EH6A 1T39A 3D1NI 2A05A 3H9GA 3WU0A 2XC7A 5DV5A 1ENHA 2K9QA 4IF4A 4WXCA 1ZUYA 3BE3A 2F48A 2HQRA 5LHIA 1WQ2A 2XGDA 3BW1A 3OS5A 2ZCWA 2IGOA 2A6EF 2RI2A 2DM1A 3M56A 5C44J 3LSJA 3IRRA 1SFUA 2X4XA 3AG3H 3HP9A 4G6DA 1C0WA 5IT9R 2HQHA 5FKLA 3J81K 1NLPC 2E41A 1VQMI 2IGKA 4XLNF 1EFNA 5E1XA 1RR7A 1ZG3A 1MDMA 1WLPB 4JQFA 4C8QD 3PUFA 3L09A 5IOZA 3BG9A 3H92A 3E5UA 2IGNA 2TCTA 2EGAA 2RD1A 3A1PA 4FYWB 3ULRB 1XGMA 2L9RA 1T0HA 3KLOA 4HNVA 4ENJA 2HSPA 1LVAA 4LITA 1TU0B 4C5HA 5K7FA 1GV5A 1PRLC 2GWRA 4V19K 2EVRA 2VKEA 1R5ID 2J7IA 3META 3S2WA 3GTGJ 2MCNA 1MD0A 1GXPA 2GTJA 2M30A 1HYOA 4AM3A 1X3UA 3HSBA 2IVMA 4X34A 1OR7A 2E34A 3OR2C 4PJLA 1Q95G 1BM9A 2K6DA 2PUOB 2AIRB 3FXQA 2MC3A 2JT1A 3BLYA 4AU7A 4MEXF 3H3VK 3PNWC 4FYXB 4C92E 3SXYA 3T5XA 4IJAA 2PMZN 1OCRH 2ICWG 4F14A 1P7JA 4RM3A 3DTKA 1OEBA 1X01A 1MUZA 1PJRA 2VPLA 3ZQFA 3MP1A 1T0FC 2RHIA 2MF2A 1HKSA 2RK2A 3EHQA 3EGDB 3CCLQ 1ERDA 2BOLA 2CUZA 3BG7A 2EGEA 3RR6A 2K79A 1P9QC 5JFRA 1D3BA 2GLOA 4PZJA 2DYBA 4U88A 3JSOA 4CC7A 2XSJC 1K76A 2EKHA 4BY6C 3G4SQ 5CYVA 4L5EA 3CC2T 2HKOA 2CH4W 3QP6A 4FSSA 3COAC 1PSFA 2PVDB 1HQCA 2GIVA 2VQHA 3PL8A 3M59A 3M54A 2C0OA 1VQ7T 2JTEA 3VS6A 3DEEA 1HDDC 4PJOE 3RESA 1VQMA 1ETYA 2MLKA 2V1NA 3K10A 3D0SA 1YCYA 1D09B 2EJFA 1W5SA 2FZGB 4JJBA 4C0FA 2X1EA 3DKMA 2DXBA 3F6VA 4M78B 2TDXA 1H9GA 3LAJA 1J75A 1TWGJ 2MYSA 2ELKA 2AQEA 5C0MA 2JRMA 4HQEA 2EZKA 2VJIA 2OTLI 4JJDA 2X6XA 2DT7B 5A2QZ 1GCQA 3JCMf 4M71A 1BR4A 1KYWA 4P9UA 3M9AA 4M7AF 1F9NA 2XAHA 4PK4A 2DIQA 1XMAA 2L3PA 3PFSA 4OMMA 5FU6B 2F2VA 1UHMA 3JCMh 4NDLA 3JRHA 4P5OA 1GRIA 1XDSA 3HKZA 2M0YA 1BK2A 5CKEA 5LJ5d 2JN6A 2GBQA 2XU8A 1QHGA 3K69A 3MZHA 3JRIA 1TW2A 4JZ4A 2DEUA 2DFEA 2HOTA 2NVYJ 1UCRA 4BHPA 3VYGA 5IN1A 2JA5J 2A69F 3FM5A 3F22A 5KYUB 1LVKA 2AHQA 2KROA 4MMKA 3I0TA 4H0EA 3JB9D 3S3OA 2ZPHB 4M7AD 3BOQA 3SD4A 3EUHC 3HOTA 3HYIA 4EMSA 4RB2C 1TOVA 4AIHA 1WJBA 4E7KA 2OI3A 1T98A 3BROA 3DQVC 1XG1A 3ERMA 2QG9B 2DXTA 3H0FA 4RG2A 1KHCA 5ECAA 3S1NJ 2LT4A 2F69A 4C3HJ 3RYRA 5EG0A 2DMUA 3G1MA 3GZ6A 2JTMA 3VS7A 4G94A 2QVOA 3J81E 1PUEE 2LNHB 2GZWA 2BEOA 5IYDJ 4HLXA 3E9FA 1MZBA 3LA2A 5D4SA 2EIJH 3LA3A 1SRLA 4HG2A 2VXEA 5I21A 4RTTA 1UAAA 2VJJA 3M0UA 4M78D 4RMOA 2A61A 1I5LA 4KICA 1UB9A 4J7IA 1X4PA 2H09A 2HR3A 4GYIA 1FSEA 1I6XA 1F43A 1SFKA 3V7RA 2XVCA 2Y4XA 3E19A 3VV0A 2KT1A 1MMGA 1OV3A 1E6GA 2CGPA 2E36A 1J2XA 1JU5C 4E7IA 4PLLA 4M6YA 1KQ8A 1JBMA 3DKYA 2EYYA 1S29A 1R36A 3ZQQA 2EQKA 5IYBJ 3L2ZA 1RNLA 2P0WA 2E10A 4DEYA 4RM2A 4WXDA 2LBFB 2RC4A 4KITB 1E3OC 2ZNYA 2GQQA 3KZZA 4B4CA 1JRIA 2CUDA 1WJSA 4BB7A 4V2SA 1VQPQ 3JCMe 3LW5E 2WWYA 4XU1A 3EUAA 1VQ9T 5GTIC 2O5RA 1YRNB 4CRIA 3CCLI 4FX4A 1HBXG 1SANA 4KYWA 1SRMA 1G8XA 1XB4A 1WPKA 1TTHB 2JTVA 2DK5A 2L3QA 3DBHB 4JX5A 4D7NA 1K78B 3JCMb 4LDUA 4QTRA 3F72A 4NHJA 1RUWA 1X2KA 5A0DA 1VQ8Q 1Z3YA 2Q1ZB 5GAHJ 3CCEI 2FNPA 5JVTA 1WQWA 4D6WA 1RKWA 3F6OA 4CYCB 3VS1A 4BDYA 3R6NA 1VOMA 3OMGA 4PSWA 1WJRA 4OF1A 5CAIA 1VYTA 5KYYA 3CCST 2A37A 2FU4A 1KIKA 1T56A 4XN3A 3TOAA 3UF4A 3IRQA 3W6VA 4E7HA 3BY6A 5GANe 3ZXSA 4F7UG 4K2EA 1Q82U 2KDSA 1AHJB 3VWBA 5LJ3e 1T6SA 2ZKZA 3EQLF 3X26B 2HKNA 4BHCA 4IHWA 4DNCA 1LCKA 1W2BA 1JUSA 1Z3XA 1MH3A 2JWTA 2KI7A 2KYMA 4ON0A 2LK2A 1YHQI 1WDXA 2QI2A 4M77A 4N0AA 3HGYA 4L18B 3S6WA 1BB9A 7AT1B 2F1LA 3M5AA 4OMPA 5LJ3f 4IRHA 2XRNA 2CZ7B 3M0PA 3B02A 4IUVA 3CCQQ 2CP7A 3M58A 5EDNA 3U21A 3N97A 4XBFA 3S3MA 2A36A 2OTJQ 3ME9A 3ROUA 2VE8A 1ULYA 3BC8A 4CICA 4D9JA 5CVVA 1R23A 3TL4X 2MD0A 5KVRA 5J8CA 1SSFA 4QPQA 4PJOA 3R6SA 1S9HA 3L2UA 4MZTA 2Z5UA 1G3YA 2EA4A 2XROA 2DJQA 3GF5A 4Y28E 1H3HA 2E6NA 2A28A 2J05A 3FM3A 4PJJA 2VODA 2K27A 2R7TA 2WB1A 4B43A 2E4HA 1W36D 3CCLA 5CKHA 4M73A 2RQQA 4FT8A 2ZXJA 3V8LA 3S1QJ 1GBQA 3N05A 3G73A 1IV6A 4HX8A 1ZRFA 2CP2A 2LZ6B 1ZG5A 3VYHB 3CCRA 5E3NA 3RDIA 2NWMA 5KYNA 2C06A 2DLLA 3WTYC 2M45A 1S8NA 1K8AR 3KEOA 3HOSA 4AT1B 1PNJA 4M7DA 4A3EJ 2BGCA 2JUFA 2FE3A 3I64A 5HKCA 5IPAA 1UGSB 2IVWA 1VQ8T 1K61A 1WHUA 5ICEA 3P8BB 1FC3A 1XGSA 4ESFA 4CCNA 1R4NB 4AYBA 2PJRA 2VOPA 2CKKA 4QQ6A 2NUTA 1NJIR 5GANh 4IIMA 2RN7A 3CC2I 1ZRDA 2BY1A 4XNFA 2Q2EA 2PEXA 5AONA 5FO5A 3SYTA 4JS5A 1MBHA 2FG0A 3H8ZA 3C7JA 1FYLA 5E8GA 2CT4A 5LJ3g 1STZA 4QPOA 1JJ2A 1FOKA 1QCFA 4ESJA 2ZPEB 3A8HB 5IHKA 2EINH 1VQPI 2DVJA 2GOXB 2YDLA 1EA3A 4C8QG 3CCEQ 3KPHA 1YJ9A 4B44A 4R56A 1A35A 2K3BA 4FYYB 5EG2A 4A5NA 1U8BA 5CQGA 5LHGA 1Q81C 4ZDLA 3R0JA 5LJ3j 4IHSA 1ZQ3P 2CUBA 4L9VA 1N8RC 4M7DE 2VT3A 1IO2A 4A3CJ 2FEIA 4LN2A 1VQNA 2NYXA 4GRIA 4IOCF 3ABTA 2QSGX 2EQUA 1VQNT 3QO3A 5J8FA 5GAOq 3A8OB 3H41A 2EH3A 1RUNA 3EGXB 2RB6A 4PNOA 1MNDA 2E1OA 2MIOA 2KRCA 4M9XA 4JJNK 3TP3A 2XASA 3W6KB 5D8KB 4Y92A 2SRCA 2Z2SB 2JZ2A 1M1FA 1UGPB 2AO9A 2A5WA 3M8JA 4F17A 1FXXA 1VQ5I 5KH6A 1ZUKA 2DFHA 4FT4A 4RB0A 1YIJA 2Q0OA 1YW8A 3MKLA 5FB2A 1LFPA 4QT7A 3OQ5A 1HKTA 1Y8QB 2KEAA 1NG6A 2K5FA 1WJCA 3OW2A 3QJ6A 3HSRA 2HCKA 4BXFA 4G6TB 1SFEA 1YX3A 3ZQ7A 2KPMA 5GJVB 4BY6B 2PI0A 4XORA 2ZXWH 5DLOA 4M77E 1LEBA 5DTDA 2YX4A 1JEGA 1PD1A 3JSCA 5CR2A 1XMKA 4KN7X 1HJDA 3CC7T 4LK0F 3P9KA 3CCUQ 3VS4A 4D7MA 3SEQA 4XU0A 3RQ4A 3QOEA 1FOWA 2F5DA 4C5IA 5JLXA 3KP2A 4RGSA 2IXSA 4CH7A 2FL7A 4XU3A 4C0DC 5GAMe 3OA6A 3GP8A 2CQKA 2LCLA 5F04A 1VQPA 4C2TA 4CYCA 3PT9A 8ATCB 1XTAA 5DM6F 2VKNA 2D8HA 1P92A 2DZCA 2WV1A 1BI0A 1SEUA 2HMAA 1GT0C 4BKXA 1AHDP 2QM3A 2KMTA 1JGGA 1J09A 4G12A 5BMZA 2TRTA 3G7ZA 2JPCA 5LJ5e 3R4KA 2RJDA 2KXCA 4ZN1A 2IGMA 5D4RA 2L0KA 3NPFA 2HS5A 1Z67A 1RAHB 1YX5A 2YX7A 2DA9A 5KE2A 3BP8A 3NEUA 1FMWA 2RK1A 2IW5A 4MTEA 2V1DA 2QF7A 1AKHA 2L7FP 2KY9A 3M4YA 5GAN7 4DEXA 5E17F 2DRMA 2ME0A 2KE9A 2QDYB 4E2FB 1VQLQ 5A2QK 2D0NA 2KRFA 2RQWA 1VFCA 5F6FA 2K9MA 3WE3A 3AT1B 3L7WA 2W25A 2L4AA 1K73C 3EUKL 1FMVA 1QNTA 3WTWC 1JJ8C 3K4KA 2RQRA 4CYDA 3G6EA 3CCMT 3KXTA 1IREB 4JPBW 3OOPA 4NC6A 1TWHJ 1QCOA 4RTWA 1FLIA 4JK1X 2A6TA 2PUKB 2O03A 4OP0A 3PIOA 1YNZA 3GFLA 3F8NA 2DTHA 1R1UA 2KP6A 1UDLA 4DYCA 2VKVA 2YRCA 1KFZA 2LYCA 3L2WA 1VQMT 3I4MJ 1MBEA 3L2RA 2JW4A 5FU7B 3HHGA 4S05A 3JCMP 2EQJA 2LY1A 3TQ7P 4ZZLA 1D0XA 5M5YJ 3I55I 2RH2A 1BR2A 1D1BA 1MH4A 2EQRA 4AYBN 1LE8B 1GFCA 1Q81R 1M8MA 3RERA 1GXIE 2HSEB 1VTNC 3PSIA 2NUPB 3KP3A 3DV8A 2UV1A 1SPKA 2WSFE 2VJ4A 2FB7A 3C95A 3BJOA 4CSWA 5LJ5j 3OW2S 3A0HC 2W48A 4DZJA 1JE8A 1RAAB 4F04B 1AOYA 1W1WE 2DJNA 4FE7A 1PHTA 4N4OB 4XM3A 4ZDPA 3VSKA 2PMUA 5IYCJ 2CP0A 3BJ6A 3DBRB 1YFNA 1ZSGA 3FJPA 2Q8KA 2NS8A 3BR3A 1NJIC 4J7FA 5IT3A 1W5CC 4PGHA 1OCOH 4RMNA 2R7VA 1I1SA 2Y48A 2F5KA 3M4OJ 5KHDA 2RI3A 2OV7A 2JMCA 3FZVA 1BBYA 4JOMA 1CQTA 1K83J 3QPHA 3SFMA 5KAIC 1YITT 3CXCA 4CCOA 1YJNT 5LJ3d 2M9HA 1I5OB 2RJEA 2PMHA 4E47A 1U3EM 2PNIA 1QCNA 1WH5A 5AT1B 2QEXA 3M7GA 1O3TA 2VGMA 4MQ9F 2ZAEA 4CCMA 5GAMh 3BQZA 5J4VA 2BV6A 3K7AJ 5EGOA 3WODF 3UT1A 5CVJA 1Z6TA 1JXOA 2VC1A 4FTHA 1JJ6C 1LDJA 2BE5F 3HOWJ 3KBGA 3A5ZB 4EGYA 1SD7A 1VNDA 2HQNA 4RTUA 5CJ9A 5HDKA 3VRYA 2ED1A 2J6OA 2HZTA 2XHKA 4KIGA 1UJ0A 3FMSA 4BJ5C 4EQQA 5EG0B 1NG7A 3DPUA 1IGUA 2VASA 5J4YA 2YLBA 6AT1B 1FEXA 1IV8A 2CRGA 1OULA 1RAGB 3QHSA 3LYIA 4N4HA 4DOVA 5FWCA 3VEPA 2P0QA 1JUMA 1WSUA 2Z0WA 1Q1VA 4RLFA 3SDBA 4FCYA 3M57A 4XK8E 2X0LA 4DBRA 3CCMI 1VQ4A 1E2XA 1LNWA 5K5RA 4XQ3A 3VYUB 1VQ4T 4LD6A 2R58A 1SVOA 4ANJA 3CC4T 2AXTC 2P4TA 4ZTFA 1IXSB 2XKPA 3VODA 3NTHA 3CXCP 3W6JB 1UFMA 3H9JA 4Z6YA 2EJRA 4L5IA 2PTKA 3QZ9B 3EG1A 4WK8F 3CP2A 3I55T 2EQMA 2OAWA 2XKOC 4UVCA 1SVLA 4N4GA 5HCKA 2Z1DA 3V8JA 4X1VA 4EMGA 5IT9E 1U9OA 1WHJA 4MMLA 8AT1B 2HQAA 4LE9A 2HQ5A 1SFOJ 1ITYA 2E1CA 1GCQC 1ZRCA 2I8DA 1RAIB 3F23A 3CUQB 3ELKA 1U3OA 3HTUA 3JCMW 3RUXA 2K85A 2HGCA 3SEZA 3ZQIA 3S16J 1RESA 4NB5A 1WXTA 3M07A 4J9GA 2R7QA 1S5LC 1U5TB 1QHHD 3ZQCA 4IRIA 1NEBA 4ZYEA 1TH7A 3QPLA 2JUGA 1AWCA 1TC3C 5H6QA 5LEJA 4YRVA 3CLQA 2L3DA 2CW7A 3CF5F 1FP1D 3O8HA 3DFGA 1T08B 4D5FA 3LSGA 5GTHC 4L0YB 2M7AA 3S3NA 2PVGB 3WGIA 2JXBA 4XLAA 3GZ5A 5C3EJ 3DPLC 2JS2A 3OYFA 1MNMC 1AT1B 5ERIA 3NWTA 3MD2A 2F6CA 1CSKA 3CC2Q 4M7DB 1OOTA 4KRTA 4WCGA 1XOVA 3JV3A 1M90C 5CKBA 2DK3A 2E65A 2B63J 4A69C 4BGDA 4JRPA 1WJ5A 4PCQA 4AFQC 4M7AA 1IUFA 4R1HA 2H8WA 1P4XA 4KGZB 4M78G 4OMNA 3DTEA 1NTCA 4BYYA 2FXAA 2XI9A 1V76A 2L9VA 5GAN3 1ZELA 1ZN2A 2W85A 1POGA 2MLGA 3CJQB 5KK1A 2Z33A 1K1ZA 1SMYF 1OPLA 4J9HA 5KYWA 3U23A 1VQ4Q 1BJZA 2LRDA 3QWLA 2L54A 3KX2A 2XB0X 2NNNA 4XLPF 4BE0A 1R71A 2Z9OA 5KYYB 2QQRA 2M7BA 1M2VB 4CA0A 2DA3A 1JTYA 1UGVA 4B9WA 1UHSA 1VQKQ 1IRXA 3BQYA 4WWCA 1WWXA 1XCVA 4EEFG 2DXUA 1OCTC 1QW1A 4CZZA 1MW7A 3ZCOA 1N9RA 2L9NA 2WB1N 1JXSA 1Z7UA 1ZR2A 1RRJA 2ETHA 3P9IA 3RZOJ 2FRYA 2NUPA 2VC8A 2R7DA 3E3VA 3K1PA 1ZG1A 3CPFA 1PWTA 2Y9YA 4OU0A 3CO6C 2FHDA 4M77B 2KAFA 3BY7A 3CCQI 4WX9A 1WJFA 2DN0A 3OS0A 5DCMB 2XF5A 1KYZA 3GVAA 1IZ1A 2L02A 2M5WA 1DPRA 3CDHA 5CVRA 2R7ZJ 3I4NJ 2YUQA 5IY5H 2KRSA 5FWBA 4JRQA 2DPUA 1QVGA 5HDGA 3ZL7C 4NS5A 4A2UA 2FEZA 2PLYA 4U0WA 2MK5A 1UJYA 4ZGDB 4HCZA 4XSZF 2O4XA 1SFXA 2KGTA 2KSSA 4ORZA 1OMIA 5IHIA 3G71A 2EZLA 4BL0B 3LSPA 3R61A 2C0IA 2YLCA 2HTJA 5CVIA 3RMQA 3CCJQ 1JHFA 3TSWA 3W2AA 4LXCA 1Z91A 4A4FA 5DCMA 5K7ZA 3D5RC 4HRIA 1B8IA 5K1YA 4HW0A 2IA0A 2MW8A 4OMQA 5EZGA 1S7AA 3CP8A 1R1TA 4F7UF 9ANTA 5FLXR 4OMLA 2STTA 5DD8A 3DLMA 1BBZA 4G6QA 4LG0A 2F5EA 4HNTA 1R5HA 5CKTA 4DYRA 3LWFA 3P5JA 3OYIA 1GDTA 4M75C 1ZLJA 3X20B 3RIRA 5IAYA 1I27A 1JT6A 4CCKA 1D5YA 2GCXA 2KZVA 3K4CA 3NWSA 1G3WA 4KBMB 3M0QA 2V26A 3K4JA 4HXJA 3HL2A 2HVQA 1K9MR 5ILSA 2QBYB 2BZYA 3FXOA 3ESWB 1YJWQ 1UJ8A 4HA8A 3WHBA 2CSIA 2X35A 4I0BA 4NQWA 4S04A 3MEAA 1GVJA 3ZN1A 2H1LA 3O2PE 3QJYA 1X69A 2DL7A 1BJAA 3ZN0A 2JVHA 1X3ZB 2EV6A 3FXUA 3GUDA 4ATOA 3M3YJ 4UHTA 1I8FA 2QZ8A 3BG3A 1KU9A 4KNYA 2QQ9A 3BR5A 3UA7A 3GTLJ 1X19A 2E1MB 5L3GA 5IP6A 2IS4A 2DJZA 3E9GA 2LD5A 3CC7A 4LOCA 2DPPB 4LDYA 5J1UA 2RDPA 4HKEA 2B0LA 1Z9QA 1I6HJ 2W7NA 1YI2T 4RS8A 2XPWA 2RA2A 4XTVA 2V9PA 4CCLA 4GXOA 2YS9A 1ZR4A 3CPWS 5A2QE 2G3RA 2OZ6A 3LOCA 2PZ1A 2LY9A 4KGVB 5GANf 2OAUA 2E1NA 1V5GA 5IXFA 4DA4A 2R5YA 1LPLA 3MQ0A 4N0BA 1TWAJ 3PM1A 4W1UA 5M5WJ 2GXAA 4O6JA 2M51A 1WFXA 2GIZA 3WGGA 2V1RA 3X24B 2YU3A 2J6KA 5FW9A 4PJNA 2HAXA 4GLKA 3GBGA 3Q5FA 3JCUC 4AIKA 3SZPA 4C2MJ 1VQ5Q 3QPSA 4HQMA 1QVPA 5CQEA 4AFZC 2CGHA 2DBBA 3E1SA 3SWNA 2X4HA 1IRGA 1OJLA 2HXIA 1X1DA 1UHWA 2M87A 2D1HA 4AWXB 1K79A 3EG9B 3SB2A 1B9NA 3I56Q 1AOJA 3K70D 1W0UA 4F93B 2GQIA 2X4YA 2OCCH 1D0YA 5E1ZB 2CYYA 1I1GA 2LP5A 4EMKA 3H5RA 3RKQA 2O9LA 1SD4A 2Y30A 4Y3OA 1F5TA 1NYGA 4LDVA 2MUNA 5GAN6 2ECBA 1LNXA 2DERA 3EYIA 2LFBA 1N5ZA 3IHUA 1G83A 4LLNA 3M8FA 2RKHA 4OIQF 1NE8A 2BTTA 4QW2A 3CJNA 5JR3A 2VQLA 2E2HJ 1ON1A 1K73R 3VDXA 2GM4A 4KH0B 1OKRA 2ABLA 3S2HJ 4L5GA 1HW1A 3EGUA 4ZNXA 2ZB9A 4L0ZB 5D6XA 2XF6A 3H9QA 3H0DA 2CSQA 2X85A 5B1AH 4XRFA 5HVQC 2DL5A 4M77C 4GY5A 3CZ6A 3VUZA 4MFDA 1T0JA 4Q5WA 1UZCA 4LUEA 2CO5A 2M3AA 1WCMJ 3Q3SA 4XTWA 4ZYGA 1QVUA 1G2BA 4UC4A 2KR3A 4XIDA 3DF8A 1XC5A 4J19A 1Y8RB 2CW0F 1SAUA 2DX1A 2EBIA 1ACIA 4AG2C 4RAZA 2KRNA 5DM7F 2R4GA 1PCXA 4CHUA 2M4GA 1KA8A 2DFIA 3LFUA 3CCVA 3UATA 4A3MJ 4I02A 4JP0A 5CO7A 1K4SA 3CCRT 3IUOA 1OQYA 1VQPT 1S7OA 3H5NA 4Q5SF 1P7IA 3W2WA 1TWBA 1VQ6Q 2JMWA 5CPRB 4CCJA 5L3EA 1M1EB 2LTOA 2DJIA 4LB6B 1TP4A 1LE8A 1R4MB 2DD4A 4EJVA 2HU9A 5GAOp 1S3JA 3ZBDA 5GAMg 4UUSA 3LSKA 3HKSA 4XTUA 2MD5A 1KQ1A 1UTIA 4E6KG 4B3AA 3GXOA 2CP3A 4II1A 5D5VB 3G71T 5LHHA 3BPXA 3OV8A 4QVZA 5DLQE 1APLC 3BDLA 1R49A 3V4GA 3MHXA 3CDLA 3QWXX 3WTVC 2V7FA 3QYBA 3AKZA 2HL3A 2IA2A 3GWZA 3SHFA 5B3SH 1HSQA 4GLMA 4OINF 3VFZA 3MKYB 3HB9A 2JOYA 3OIQA 1RC9A 3X25B 1Z05A 1ZBXA 2M16A 1DP3A 2M0CA 1H88C 3JR9A 4DIQA 3MJXA 2OD5A 3CMAI 1OQKA 1UG1A 1K6YA 2JT4A 4L5JA 1PP8F 4XTYA 3QP5A 1Y07A 1FIAA 4IVNA 1RUOA 3BJAA 4HF0A 4F7UB 2M2EA 1WI9A 3H0GJ 5GMKj 2WBMA 3UDCA 3G4ST 2G6FX 1GUUA 2ZJ2A 2E60A 1I3AA 1WJEA 2EFOA 1WJDA 4NC7A 2QYOA 1V55H 3FMRA 3K2AA 2QQAA 1VQ7Q 2W84A 1RLQC 2EGCA 3CBOA 1KQ9A 3HRUA 1KQSA 3UKGA 1TS9A 3LMMA 1Q86U 1OLTA 2A5YB 2XAUA 5KCOA 3G1LA 4B1RA 1DGRM 1O3RA 2Y4YA 2P5LC 3F8FA 1T8IA 1YHQT 4IPAA 1YHQA 2LC4A 2DODA 2L7MP 4WCIA 3CCUI 1MHNA 2DMPA 2IPOB 3MO8A 1ARKA 4UVAA 1SEMA 3QKJA 4MFEA 3UWNA 2FF4A 4LG3A 2L7KA 3UNGC 1Y96B 3BZCA 3ML6A 2CS3A 3Q0WA 1B4AA 2V4JC 3EYYA 1WXBA 4M75G 4A3BJ 3EG9A 1EH7A 4IUPA 5J3BA 3TGNA 3EDPA 2BHZA 4DYQA 1RI0A 1OCZH 2LF7A 3FK7A 5E1WA 3GTJJ 2V8IA 3A1YA 4IHVA 2I0NA 2OZUA 4D5CA 2DW4A 4XOTA 4C0DB 4M7AG 4EDUA 2AZSA 1B72B 3M0RA 4BHBA 3S32A 1MMDA 3DBLB 3U2RA 4D1QA 2L8DA 1U9NA 2WAQN 4G7ZF 1VQKI 2ELHA 3GMEA 4MNUA 3OYCA 3CCRI 1M27C 2OJ2A 2DE0X 2P0TA 3UA6A 1AWWA 5CKFA 1T95A 1H89C 1FYKA 2E70A 1BI1A 3HXLA 3JCMJ 4B48A 2FO0A 5I2SA 1VQLA 5BOXA 2HD0A 4C92F 2KJCA 1IO6A 4PFZA 4JBAA 1B59A 2DAOA 1YOVB 1J7KA 3ZQLA 2DA7A 1T38A 1GV2A 5E8IA 2W24A 1T3SA 1Q82R 4O5VA 2E6ZA 4VUBA 1S72A 1YS7A 5GAMf 2XAGA 4I76A 3URGA 4XRMA 3O8GA 3WTSC 1S72T 3MMYB 4AFSC 2EFQA 1KONA 4XTXA 3MWMA 1QP2A 1B6AA 3JSPA 2D6FA 3HDDA 3OYBA 4UB6C 1SVMA 3DCFA 1ZBJA 3TQNA 5FFXA 5J3LA 2WSEE 3OB9A 3ZMSA 4ENKA 2LY2A 2R5AA 4XMYA 5D6WA 4M75B 3CCJI 4AD9A 1GLNA 2XIGA 4C92C 3NAUA 1GHCA 3M1CA 3CD6Q 2E7XA 5FJ8J 4U7BA 3PMTA 3VS0A 2DVEA 1V4RA 1K7AA 2X9HA 3NRVA 4RTYA 2ESWA 1XD7A 3MKDA 4A4KA 1VQNI 4X0GA 3VS3A 4V2GA 4PJ0C 2F5VA 3F8CA 1AVZC 2I5UA 2KDZA 4A54A 3PUBA 1O4XA 2UXXA 3OR1C 1E6HA 1QQJA 1F36A 2PVOB 2NRAC 4XAXB 2DT6A 1DU0A 3AL0C 2K57A 2VC0A 2QYZA 3MP8A 1VQOA 4UNOA 4QVCA 2JM8A 4BACA 2CP6A 2CV2A 4HF2A 3RPUA 3ZPLA 3SHWA 2ZXHA 4E6RA 1M1KU 3EGDA 2FBIA 2JZYA 2LC2A 5FKKA 2DTIA 4PJMA 3FKIJ 2MMPA 4OB2B 1Y7XA 1ZKGA 3S2DJ 2HZDA 2PN6A 2XUBA 2CV0A 1VQLI 2VUBA 3U9GA 1HK9A 3M0TA 2MSYA 3O3KA 1XS9A 1OFCX 2CDTA 1VQ9Q 3KETA 3OYEA 1OU8A 5K5QA 2R7FA 2AKKA 1X2NA 3FWEA 4RAYA 2DYIA 3QODA 3AG1H 1K0XA 2VBWA 2DDAA 3E97A 1L0OC 4LDXA 1UECA 4RCBA 1V5EA 3KP4A 2PQWA 4JJCA 1Z7LA 1M90U 1OR7C 3LH5A 4KULA 1Z0XA 3BR2A 2JRTA 5DY9A 3VS2A 3TU4K 1BW5A 3JRBA 3IWZA 2ZBKA 4P55A 3CD6T 2OA4A 3FIFA 2E35A 2XRLA 5BQTA 2NVQJ 3CD6A 3FXRA 3CCSQ 1HA8A 4AIDA 3RDVA 2QGFB 1WVRA 2DYSH 1AU7A 5FLVA 4J9BA 2AKLA 3HRSA 2RMOA 2HYGD 2R7SA 2XD0A 1X43A 4ZYDA 5FLMJ 4HAMA 4CC3A 1HKQA 3QYHB 2E2JJ 4I98B 2VXDA 1HD3A 2RM4A 2MBFA 1B8IB 4FW1A 5CQXA 1X4OA 5FKNA 1HC8A 2CG4A 1AWJA 2LJ1A 1W7PB 3KZYA 3T9NA 1UGRB 2YUSA 5AIPA 1XNIA 2GTOA 2H6BA 3REAB 1MGTA 3A02A 4IOAF 3CCQT 3QG1A 4BAYA 2JVGA 2XAFA 1X6OA 4MTDA 2LKSA 1I50J 1TZLA 1QA6A 2DD5A 2BUDA 4NL2A 3HUGB 2F2WA 2DCEA 5GJWB 3NTIA 5HS8A 3VKIA 1OYXA 3MP6A 3I35A 1MDMB 2QKLB 1VQMQ 2VXZA 4LMYA 3IC7A 3LWHA 1USSA 4HYEA 2DDBA 1DDNA 1B3QA 1R6RA 1VIEA 3OSFA 4ZN3A 2AT1B 4DOZA 4HEA2 5J26A 3EG2A 4BY1J 1VF9A 3DEWA 2K9NA 2ECCA 1BCMA 3I58A 3J7AW 1IN4A 2WADA 5D6YA 2BY0A 1M1GA 2R7OA 5HDNA 2Y69H 3JRFA 2PMZA 4R79A 1YS6A 2QBYA 1ZSZB 3UR3C 2IS1A 2E1HA 5FU7C 1YG2A 5D8LB 1W5TA 2K9LA 2XDDA 3CESA 2HWVA 1R58A 3JTGA 1R0CB 5GAOn 2X4JA 2HOEA 3IAS2 3PIPF 1REPC 5HLTA 1FIPA 4PSXA 2OUMA 3ZGKA 3EUHA 2L7ZA 2XGCA 3WTZA 1K9MC 1OISA 2CFOA 2F4IA 4QIWN 1I5ZA 2LF8A 3OYJA 2R5ZA 4JDSA 1FPQA 2Y75A 5I2MA 4G7HF 4CUGA 2OBPA 1TSFA 5J1RA 2OX7A 2A3LA 1B7TA 3QRFF 1JKPC 4KT0E 3E6BA 2MABA 2HI3A 1NBEB 2R57A 1R8OB 1MJ9A 3X2QH 3GEZA 4XL9A 2CV1A 3HM5A 3J7AY 2J5PA 3PO2J 2FZKB 1Z6RA 2Y90A 3J7YJ 2A68F 4M3DA 4D8KA 2DL4A 3AHUA 3W2VA 2LNBA 2QKMB 4DBHA 3LGLA 2X3XD 4XLCA 2IA1A 2VXFA 5KE3A 5IOYA 2DETA 4LGWA 5IP7J 2QLZA 3D5LA 5ICCA 2QK0A 1Z1DA 2HNHA 3C2BA 4I01A 5HLHA 3KZIC 4ZYAA 1ABOA 2IG0A 2K9GA 2NS0A 4HSRA 3CCQA 5FFZA 2OTLQ 4GDFA 5D6EA 3F21A 2I2LA 2KHMA 3HOUJ 4IQJA 4A3DJ 2J5OA 3RCOA 3DLLF 1LQ1A 1IUYA 1UHCA 9ATCB 2BE9B 5I11A 1IN6A 3HC7A 5LL6S 3T1BA 3T0YA 2BKDN 2QQSA 2DKGA 4RKUE 1FYMA 1QU3A 2J06A 1TBXA 2NUZA 1PKSA 4KJZA 2MFZA 1I81A 1N8RU 1YP5A 2DRKA 2HKXA 1D1CA 2FRWA 1VQ9A 4ITVA 1BKBA 3CC4Q 3X28B 2VT2A 2AZVA 1M3AA 3DTIA 2K2VA 3HGGA 4MHGA 4EJUA 5FRNA 1Y0UA 3FBNB 5E3LA 5ILUA 1RACB 3IL2A 2LX9A 4HNUA 3DB3A 1IJWC 5H2FC 4QKUA 1KQ2A 1ZTRA 2VPRA 4BU2A 3BG5A 4HV5A 5LRSA 1UELB 4GYGA 3Q9SA 2RQVA 3BDUA 2RHUA 4PGGA 1ETOA 2GFUA 2HVRA 3PIPA 2NVTJ 4M7DC 2MG4A 1Y56A 1LDKB 1YCSB 5DD4A 3D7SB 3G1OA 2NLUA 2HQEA 3E5XA 2K7LA 3OSVA 4HCKA 3CCSA 2EJ9A 4UVBA 1WHKA 2HYFA 5FGMA 2KKOA 3ABMH 3TW7A 2XSDC 4JX4A 1IC8A 1VQ8I 1ABQA 1MV3A 2NOJB 4JLGA 1HF0A 4M4ZA 4BXXJ 5D5UB 5GANg 1MBKA 3JCMd 4A3GJ 3A0BC 2O8XA 1WQ7A 1QRYA 3I3LA 5LGNA 3K70C 1XQHA 2KMUA 2XV4S 3JCMc 3CPWP 4BEHA 1BW6A 2COMA 2EPFA 2MA3A 5KCMA 1UFFA 3V7SA 5GMKh 2EFPA 2Y9ZA 3O6BB 1G6NA 2EPDA 3VPRA 1CKAA 2LH9A 4X9DA 3J80Z 2X4WA 4ZTJA 3MCAB 3GCMA 1DP7P 3T8TA 5ILVA 4HDUA 2XG8D 1MBJA 3KE2A 2WAFA 3PE0A 3ERED 3A8GB 3FBIB 2GOMA 3FX3A 3GLLA 2LBFA 2BW3A 1CF7A 2QSHX 1VYUA 2C0TA 4PUSA 3EFSA 4C8QC 4HCBA 3GFMA 1V1CA 4IEJA 4RAGA 3R60A 1B34B 4A12A 4C0GA 2IT0A 4GFBA 1IN8A 3IH3A 5GPCA 3CBPA 1BOBA 1H3ZA 4MO7A 1JO8A 3RKWA 3RKXA 2JS0A 4CGZA 4XOPA 4II3A 4UUTA 5D6FA 3BR6A 2ATCB 3WVDB 5BNGA 1QLYA 2JSCA 1ZX6A 2VQGA 3GTPJ 1YLFA 3AG4H 4AUXA 3KYDB 3OOUA 3OBYA 2EW3A 2LQNA 3CEYA 1VYVA 1VQKT 1VZ0A 1Q82C 1XGNA 3G71I 3JB9G 1NK3P 4KFCA 5DUKA 4BH9A 2ISZA 4C8QE 4EPCA 3OSSC 4M75F 1U0JA 2XKOA 2VOOA 3MVPA 4JLIA 1F1ZA 2EIKH 1GBRA 1UB4A 4XLEA 2ZSHB 3A03A 2YUPA 5GAEJ 3ZMZA 3CCSI 1YW9A 2WV0A 4IHYA 1JKOC 4KMFA 4KISA 1NPPA 1K9MU 4M7DG 2ZMEC 1R1VA 1PUFA 3TOBA 2B8AA 2YWWA 3PSFA 2JA2A 5F64A 5FKMA 3VSLA 1Q86C 4A6DA 3JB9I 1IGNA 2KIQA 1I4K1 1WPYA 1K4TA 3REOA 1V29B 5KAFC 4NC8A 1BU1A 5EJCA 1HLVA 1WHHA 4AFUC 1AZEA 1LOJA 3IAM2 4XONA 4XICA 3S8PA 1BIAA 2ACJA 4DGWB 1M5Q1 2KRMA 3CMET 3HOXJ 4BD3A 3OYHA 3F8BA 3CCYA 4ELYC 3H5AA 2DAQA 1JB0E 4PFOA 3OBWA 3CCEA 2XGXA 4CZCA 1QKXA 2E64A 2RQTA 5HODA 3ULQB 1Y71A 4JX6A 2FNAA 3VJPA 2AHJB 3K1MA 3HBLA 1SF9A 4A3IJ 2D1XA 1X2QA 1A6QA 2JQ7A 3EFRA 1YITQ 1ZSZC 3M0SA 3GFIA 2EKOA 1YJNQ 5EYRA 2V1UA 2OTJA 4OOIA 3I56A 4JS4A 3H3UA 2GQVA 2DMNA 2D45A 1IDYA 2K5IA 1TTYA 3LX7A 3VUBA 4EJOA 3OYDA 3GYHX 3MEUA 1SC7A 4BE2A 2OF7A 3DPTA 4HX4A 4MLOA 4UY8I 4KN4X 1O9SA 1YJWA 1QVFA 3FB9A 2P0KA 1A36A 4EM2A 4C5GA 4PJOF 1KU3A 3DKXA 1ZA2B 4KT5C 4M3BA 3TO6A 2H27A 1G4DA 2EB7A 5EC7A 3REBB 4WTOB 3Q9VA 2HXOA 5F27A 4C8QF 1R77A 3P8DA 2GAUA 3H6ZA 5GMKl 3F9KA 3K4BA 2QTVA 1UE9A 3ASOH 4MEYF 1S7EA 2DO3A 4BE1A 3PNVA 3BG6A 4H4KC 3QOPA 2X51A 3OMYA 4ELZC 2Q2EB 2KNBB 4HCCA 1YIOA 3TO9A 5FKOA 2F5FA 1USTA 3BDDA 4FETA 5M5XJ 3BZ6A 2RI5A 4A4EA 1I39A 4OMZA 4YELA 4LD9K 4XKVA 4BY7J 2ID3A 4EJWA 1IZ6A 2QXFA 4OAYA 2ESNA 1M90R 1N9SA 2P81A 3CXCS 3CCVQ 3E6MA 5M3FJ 3JW4A 3CMAA 4A0ZA 4BI3A 2OQRA 2CW8A 3CMEQ 3CMAT 3VU3C 2J6FA 5J39A 1JJ2P 4CC4B 4A5MA 3PO3J 4A3LJ 1FX7A 2IAIA 1QGPA 5LBQA 3CC7I 1M2VA 2PFBA 1E0EA 1U1TA 4MGRA 4HPQA 2X1CA 4E4HA 4Z2YA 2DL8A 3K4NA 3WG9A 5BPDA 4WF2A 2KZGA 4XRSG 3CC2A 2AXLA 2VBXA 4LIVA 1M1KC 1ACMB 4F91B
chains in the Genus database with same CATH topology
3R6OA 3RPQA 4LFUA 3F70A 4BI8B 2VE9A 3L1AA 4BUGA 1EH8A 2D9TA 1D3YA 1B9MA 2P7VB 1SAXA 3J80K 2ESHA 2XDBA 3L2VA 3J81Z 5LJ3h 1BIBA 2FVUA 2PUKB 1O7LA 3BPVA 2WC2A 4I7HA 3VB2A 4KUMA 1PDNC 1GXQA 3OYKA 3I59A 4N9HA 4M77D 3JB9J 4BDZA 4C8QA 4I09A 1VQOT 3EAEA 1K6OA 2CZ1B 4IKFA 4TV7A 2JPBA 2E7WA