1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
3CTAA 2E1NA 2ZNZA 2XAGA 1FOKA 1GXPA 1U5TC 4AWXB 3ECHA 1U78A 2CWEA 5HLIA 5IT9Z 1FC3A 3BP8A 4B09A 3F8MA 5FLXZ 1MKMA 2VBZA 1BI1A 2L01A 3QAHA 1LB2A 5ERIA 3SHFA 3R0AA 4MNUA 1EH7A 1CF7A 4MEYF 1DPRA 1YW8A 3RDIA 3FM3A 1TBXA 3E19A 2DT5A 3JAMK 2MH2A 1R1UA 1HW2A 4HW0A 1FBQA 3LA3A 3C18A 4WXHA 5BPIA 1RNLA 4FHTA 3WTUC 2HQRA 4OINF 2EWNA 1S7AA 5L3GA 4DQ2A 2DPUA 3DKWA 1U6GA 3NEUA 1Z6TA 4FX4A 4Q4ZF 1AOYA 4MHGA 3SZPA 2RKHA 3BJAA 1QPMA 4RB2C 1SFUA 2O03A 1WQ2A 3BPXA 3KCCA 5FD5A 3R4KA 2MBFA 3D0SA 1RI7A 5DV5A 2WV0A 3K1PA 5DD8A 3KETA 1XB4A 2PJPA 5D4SA 2BV6A 2RV8A 1I27A 1B4AA 3Q9SA 3TGNA 4U0WA 1U5TB 1SFXA 3RYPA 2A68F 3IC7A 2VONA 3V8JA 3HYIA 2VBYA 1XCVA 3GLXA 3GFMA 3IWZA 4M72A 4ZYEA 2HQNA 1OYIA 4KMFA 4ESJA 2CYYA 1K78A 1HKQA 4A0ZA 1IZ1A 4UVCA 4G9YA 1B1BA 4M9ZA 2XUBA 4L0YB 5KVRA 2RQPA 5CJ9A 4LLLA 4I98B 1KU7A 4D0PA 1R5HA 1KGSA 2YSRA 1GVJA 5K5QA 2D1VA 4Y17A 5FLXK 2A6HF 2DK8A 4O6JA 3ABTA 5ILUA 1IXCA 2ZXJA 3U9GA 4M9XA 2VOOA 1REPC 4N9HA 5K5OA 1PP7U 5D5WB 4EGZA 4BAYA 3MFKA 1ONVA 3GZ5A 3VODA 1XD7A 3HRTA 1UHMA 3ABUA 4IHTA 4HX7A 4LGWA 2XAQA 3GWZA 3KP4A 3N4MA 3T8RA 4PGGA 4UUVA 3QOPA 2CQKA 4YFXF 4UVBA 2L02A 1K7AA 4BNCA 4HLYA 4WX9A 2AXLA 2PBIA 4KA4A 1ULYA 4PDKA 1QZZA 5L3CA 3ZMTA 1FWZA 2RC4A 5D5VB 2PG4A 2RGVA 3BDDA 2H6CA 2LF7A 2Z3YA 2EB7A 4RAZA 3FXUA 2FBHA 5CVJA 4HV6A 4GO1A 3IL2A 3T5XA 3G3ZA 3WTYC 1FT9A 3HSFA 3LSTA 3LQRA 5HS7A 1ZN2A 1YG2A 1ZG3A 1RZ4A 1J0RA 3RPQA 4E70A 1QZYA 4RB0A 3RYRA 1SD7A 3QU3A 3ZMVA 3T0YA 5E17F 3JTHA 1FBSA 3VOEA 3SZTA 3KZZA 1WWXA 3WODF 3ELKA 4L9NA 1XCBA 2ADUA 1W5TA 3F6VA 2FMLA 1TLHB 4B8XA 3NRVA 3EETA 3T1BA 2Z99A 2K4JA 1ZHFA 5LRRA 1OMIA 2HWVA 2ZMEB 2FXAA 2COMA 4Y13A 4PCQA 3F72A 2DBBA 3C3WA 5FO5A 4G6DA 3TO7A 3DP7A 1HBXG 5ICFA 3ECOA 2M5WA 5HLHA 4AD9A 1O3TA 5DCMB 1LJ9A 2V1XA 2STWA 3RI4A 2K5IA 3KEOA 2DAOA 3F3XA 2LKPA 5LRSA 3WTSC 1T98A 3VEPA 1FYKA 1J75A 2L4MA 1JHHA 2A61A 3CDHA 2BGCA 3FXRA 3WU0A 5D5UB 2MLGA 4EV0A 3WTTC 2OZ6A 4EJWA 1CGPA 4HQEA 4HF0A 1LQ1A 1FLIA 4XSZF 2OU2A 4KYWA 1BC7C 4YIIA 3S2WA 2OZUA 4IRHA 1V4RA 3OV8A 3EDPA 1O57A 3J80Z 4KT5C 4L5IA 1ZLJA 4LFUA 3F8BA 2XKOA 3VFZA 2HTSA 2V1UA 2DQLA 1BC8C 3CUOA 1IN4A 1S8NA 4HQMA 3QRFF 4ASNA 4CGZA 2ETHA 3HUGA 1YYVA 3DV8A 3O3KA 3O2PE 1YIOA 4KN4X 1O7FA 4I2OA 4ON0A 2HYFA 3LAJA 4KNYA 2VXZA 1ZRFA 2XAFA 1F9NA 4RGRA 3I71A 3AAFA 2H6BA 1WKMA 4XBFA 2P6SA 2FE3A 2IJLA 2J5PA 4EJTA 1W7PB 3CUQC 1GXQA 2KJCA 3WTZA 4Q47A 1STZA 1Y0UA 5DCFA 3GXOA 5E18F 1TNSA 5DUIA 2K27A 1I6XA 4P55A 3WTXC 3WGHA 1VTNC 4JBAA 1D3YA 1B59A 3JW4A 1K6OA 4R79A 2BBYA 4KIFA 2ESHA 4HDUA 2XV4S 1W5SA 1WI9A 1QO0D 5F1RA 2FEZA 1F4KA 3E6BA 1SMYF 5L3FA 1XGNA 3ERED 3JTGA 1BIAA 2QVOA 2FMYA 1BOAA 2DK5A 2EFOA 5LHGA 2Y48A 3ZMZA 2NAZA 5J8FA 5CLSA 5CVUA 4YIFA 4O3MA 2VODA 4OIRF 2QM3A 4ZZLA 1YO5C 3QP6A 3PFIA 2B0LA 4LG0B 2EFQA 1FYMA 1TQIA 3F22A 1E2XA 2K4BA 2NS0A 5D4RA 1B9NA 4ZYGA 2XRNA 1ZRDA 4BHCA 1IW7F 3FM5A 3U2RA 1CF7B 2HKXA 3GFIA 4KICA 4AIKA 1KQ8A 3J80K 1Z7UA 4M71A 2P4WA 1BYMA 3JSPA 3HOTA 2GXBA 3ULQB 3IHUA 3PQKA 2MLKA 1O3SA 5F64A 2H3JA 1QGPA 2P5KA 3G73A 1A04A 2FA5A 4U0YA 3KLNA 2NYXA 1IF1A 4R1HA 4U7BA 1MJ9A 3QPHA 3BJOA 2D1HA 2BEOA 5JR3A 1WSUA 3B02A 5D8KB 3FHZA 4G8XA 3J81K 3EUHA 5BPDA 2JRTA 3M7GA 2PFBA 2G7HA 4FT8A 1K78B 1OYYA 4HX4A 3TQNA 5BOXA 1LVAA 3HRUA 1ZG1A 4WWCA 2H94A 3L7WA 3TKYA 2Q8KA 5FD6A 2XKPA 1TW3A 5D6EA 4EJVA 3E5UA 5ICCA 4BXUA 3HTSB 5K1YA 3E6MA 3SXYA 2NRAC 2QWWA 3M8FA 2FU4A 4S05A 1J9IA 2L3DA 1XGMA 2QENA 3N97A 2HKOA 3U1DA 2W85A 3LAPA 3E3VA 1RUOA 3DXJF 4EJUA 4HOBA 5JI6A 1Z05A 2FBIA 2JPCA 2O0YA 1ZLKA 2YU3A 2LNBA 1U2WA 3DQVC 5HDNA 4GYIA 2R7DA 2K5FA 3L00A 3I58A 3I5UA 5BS6A 4Q5SF 6PAXA 4OU0A 4OMYA 5FFZA 2L4AA 3HTUA 4HYEA 2H09A 2XHKA 4LMYA 1OR7A 4G94A 4L0ZB 1YTYA 5TRDA 2IVMA 1TTYA 3P7NA 1FSHA 4G7OF 4HA8A 3V8KA 4ENMA 3H3ZA 2EFPA 4I02A 3KP6A 3TO9A 5J8CA 5FB2A 1SMTA 5A2QK 1P4AA 1MDMA 2OBPA 2J5OA 2IT0A 2DPDA 5BQTA 2DW4A 2AS5F 4G7HF 2WC2A 3FXQA 4KIGA 3GVAA 1ZH5A 1R1TA 3HSRA 4I09A 3TOAA 1T6SA 3DF8A 2Y0MA 1KU2A 3REOA 2G7UA 2E7WA 1H9TA 4L9VA 4MEXF 5LGNA 2VBXA 1G3WA 1LDKB 3GF2A 5LEJA 3K69A 2R7FA 1XGSA 3Q5FA 5HOOA 3B73A 4LG0A 4ZYDA 3J7AO 4M73A 4IXAA 3KLOA 4KMUX 4UXNA 4H0EA 3FZVA 2BE5F 2R3SA 1UB9A 3E6CC 2XAJA 4LLGF 3GFJA 4S04A 2XASA 3P9CA 3L2CA 2CO5A 2Q0OA 2YPRA 1F5TA 4UV9A 4OIQF 4CDGA 3MZHA 4BHPA 1DDNA 2O8XA 3NQOA 5HS8A 4P9UA 5LEKA 5L3DA 3SQNA 4HX8A 3DPLC 3FF5A 4A0XA 3CUQA 3K0LA 3MQ0A 2ELHA 4WK8F 3I64A 3F6OA 4XLNF 2JPBA 2RNJA 5E1WA 2WWYA 1ZGJA 4LLNA 2E7XA 4A5MA 3F8FA 3RKYA 1XSXA 2UWMA 5D8LB 1RIOH 5HLGA 3F8NA 1W7PA 1HXDA 3K9TA 1XMAA 2EV0A 1J5YA 3W6JB 1PP8F 5H6RA 1P4XA 3WE2A 3SFZA 1ZARA 1ODDA 2FNAA 2F5CA 5ED4A 3WG9A 1I5ZA 4LB5A 2X0LA 2P7VB 3WTVC 1S6LA 1P92A 4EJOA 3C1DA 3WE3A 1KQ9A 3LA2A 4O5VA 2C6YA 3GEZA 2KIFA 1BBYA 4P9FA 1QBJA 1FZPB 2HR3A 2CW0F 5JVTA 1D8KA 4HV5A 1LDDA 2DLLA 4MGRA 2ZBKA 1K79A 3KEQA 4K2EA 4HDVA 3ZPLA 3HOSA 2M30A 2Z5UA 1O3QA 5E20A 2ZNYA 4L18B 1QVPA 2HFHA 2PMHA 2KIMA 2OA4A 3ML6A 3H3UA 2P5LC 3I59A 2XAHA 2X4HA 2XIGA 2EA4A 5AIPA 5DD4A 3I54A 1IN6A 2GQQA 5KK1A 3EYYA 4A12A 3MEXA 4NQWA 2JTVA 3HSEA 2KKOA 4RGSA 3LQQA 5E1XA 3H92A 1T0FA 2QLZA 4UVAA 3I4PA 1WRJA 2ISYA 3TOBA 4IRGA 1ZG5A 4UHTA 2P6TA 5DCMA 2M1BA 4M6XA 4OMZA 4RAYA 4ENNA 2ZFWA 3M9AA 3PQJA 1PDNC 4MQVA 2XROA 2K4YA 2IA1A 5D5XB 2YX4A 4AIHA 2P7CB 3BOQA 3T8TA 2A6EF 2DI3A 3GFLA 3GO5A 3R60A 2Z33A 4JK1X 2M45A 1YFHA 5BMZA 3ZMSA 2HYGD 4XRFA 1S3JA 4A6DA 1JXSA 1BI3A 2G9WA 1IUYA 1GHCA 4HLXA 4ZH4F 1PUEE 1MJAA 2XVCA 4WXDA 3KE2A 2EV6A 4L9TA 5IT9K 2QQBA 4F7ZA 2LX9A 5IT3A 1Z91A 1TW2A 2DQRA 5LHHA 5ICGA 1W7PD 4KN7X 4KDPA 2PEXA 3KP2A 2CGPA 2BYVE 4JQFA 2Q2EA 3IKTA 2RDPA 1QW1A 4HF2A 2QYOA 5CVVA 2LSOA 4A5NA 4MTEA 1IXSB 2LF8A 4PZJA 5JHUA 3LWFA 5LGTA 4I7HA 3R61A 2W24A 2ZKZA 4DNCA 1EV7A 1R58A 5EEGA 2E1CA 1SD6A 4EM0B 1I1SA 2VBWA 4QLCU 4IVNA 1XSDA 4UV8A 2W84A 3QU6A 4EQQA 4XLPF 1XDSA 4RS8A 4CYDA 3LFKA 1B6AA 2W57A 1P4WA 1FBUA 4OOIA 3TDZC 4LK1F 2ZMEA 4MQ9F 1XSVA 4KFCA 3BROA 1KU9A 2QZ8A 3ZQ7A 3F21A 1U5TA 1IRGA 3FX3A 2TDXA 3BJ6A 2HDCA 3RKWA 3KP5A 2QQ9A 2A3SA 1G4DA 1R22A 1W4MA 2MD5A 1MD0A 3K2ZA 3EQLF 4HF1A 2MA3A 5CVRA 1C0WA 3RIRA 3RTRA 4FX0A 4LK0F 1KU3A 1R7JA 1BI2A 1MGTA 3V7SA 4MTDA 1Z1DA 3MZYA 3O6BB 3ZN1A 3D5LA 4ENJA 4N0BA 1TQPA 1HQCA 1LNWA 4OIPF 1Z6RA 2NNNA 1IXRC 1BI0A 4GCVA 2A07F 4M74A 5CVIA 4U0VA 3CO7C 5FGMA 3P9IA 1YS6A 5LGUA 5ILSA 5DUKA 1R5GA 4BHBA 2GCXA 3IRQA 4GYGA 4CHUA 3MCZA 5J6XA 1FYLA 1U8RA 1I1GA 1H0MA 2VN2A 3TDUC 5TJJA 4CZZA 4YFKF 5K5RA 1EH8A 2IRFG 2IW5A 4XSXF 3KP7A 3WGIA 1QNTA 4GGGA 1J7KA 1R00A 1SFEA 1ZREA 2EJRA 1D5VA 2JZYA 3E5XA 2O61A 2F5DA 3V8LA 2PMUA 5LLQA 1P2FA 1T39A 2YR2A 4ZZDA 3GUDA 2UXNA 5JFRA 3RJPA 2O3FA 2LDUA 3MHXA 1QQIA 3QPTA 4ESBA 4Y15A 4YFNF 1ON1A 3HIFA 1JHFA 3IKVA 2QBYA 1LDJA 2EV5A 1G3SA 1E17A 2K86A 4KIBA 2NNYA 1U3EM 4IF4A 1J59A 2WTEA 4M6YA 4G6QA 4Q48A 1L3LA 3K1MA 4CXFA 2XGXA 3JAMZ 1X3UA 3RKXA 1IN7A 3HRSA 2ACJA 5FFXA 3DPTA 5EEHA 5LHIA 1BN5A 2FOKA 3ROUA 5H20A 2UXXA 4AIJA 2GXGA 1USSA 2VOPA 1FPQA 2PQ8A 1R23A 3J81Z 2F5FA 3OOPA 2MH9A 2FRHA 5L3EA 4M9SA 1ON2A 4WCGA 4YG2F 1KYWA 1Q1HA 1OYWA 1HKTA 2HTJA 3KFWX 4PGHA 2D45A 4ZYHA 3BWGA 2L54A 1IN8A 3DFGA 1ZGAA 2GAUA 2KIUA 3MWMA 1R36A 5CYVA 4HAMA 1G3TA 2QQAA 1HSTA 2GA1A 3E97A 1S7OA 3ZN0A 3FMQA 4LD5A 5E1ZB 2ZJ2A 2VE9A 4EMSA 5E8IA 1TNTA 1DP7P 3V7CA 2HS5A 1YQAA 1UFMA 1XDUA 3E6DA 2VC0A 1Z9CA 1FNNA 3R6SA 2O6GE 2FSWA 2IPQX 2M87A 3F8CA 3HHGA 3QP5A 1FP2A 5ILVA 4BQAA 1EH6A 2JT1A 3HHHA 1MJBA 1MDMB 4WXCA 2ESNA 5AIQA 2GWRA 1IN5A 4EM1A 2V1DA 5LBQA 2VT2A 2V79A 4CO8A 2JSCA 3BY6A 4NHJA 5AONA 1LEBA 2CSOA 4LB6B 3L9FA 3I59B 1YS7A 3IRRA 3DEUA 4NB5A 1JGSA 1T38A 3M1EA 3WU1B 2QUFA 3COAC 1FSEA 3LA7A 2ISZA 3L09A 5ICEA 1YLFA 4HBLA 4I01A 3WGGA 2VT3A 1OKRA 2V9VA 4TV7A 5L3BA 2V6CA 2W25A 2KRFA 1G6NA 4A6EA 3ZMDA 4KUMA 1HSJA 4N9IA 4P96A 2OQRA 1UHWA 1AWCA 4P5OA 2GA2A 1FY7A 1DUXC 2PI0A 5HVQC 2Y75A 1BIBA 4IJAA 2FNPA 1TQMA 1RUNA 2DU9A 2PLYA 1UCRA 2DTRA 1MZBA 2P8TA 1B9MA 4BYYA 3GYHX 4L5JA 3RPUA 1KYZA 4LJZF 2FF4A 3BZ6A 3ISPA 3ZP5A 1HW1A 1OPCA 1G3YA 2K7LA 2EFNA 5DDGA 2OQGA 3GW2A 4ENKA 2FBKA 4EGYA 3M8EA 4ETSA 1F1ZA 1SAXA 1SD4A 1H9GA 1FP1D 1J2XA 2OAZA 2GZWA 5E8GA 5F6FA 1R1VA 2CG4A 2ZCWA 4QWQA 3R0JA 4I0AA 4UNOA 2EFWA 2RVCA 4G7ZF 1O3RA 3JSOA 1D8JA 2EK5A 2CFXA 1JE8A 2ZO4A 2A69F 3V7RA 3ZMUA 3KZYA 3KP3A 5A2QZ 1T2KA 2D2WA 4HZFA 3EYIA 2RN7A 3V4GA 3I53A 2M8EA 2QBYB 4EVIA 3WTWC 2IA2A 2EA2A 2PN6A 1HW5A 1KA8A 5D6FA 2OD5A 2IP2A 2KJBA 1XGOA 1SD5A 3K1NA 2VC1A 4L9JA 3FMRA 2K02A 4Z2YA 2F2EA 1L0OC 2YX7A 2K5LA 2FQ3A 4GXOA 3GZ6A 3Q9VA 1YW9A 4RGXA 1ZAOA 5DYMA 1IAWA 1IRFA 3CO6C 4ESFA 3FMSA 3E5QA 3W6KB 1BM9A 2HOEA 4IPAA 3FWEA 4RB1A 1V3FA 2P5VA 4RGUA 4BH9A 4WF2A 2A5YB 5H6QA 3GX4X 5HDGA 4U7DA 2HGCA 3MAJA 4RB3C 4A0YA 1USTA 1P6RA 1HKSA 3CLOA 3CUQB 3IWFA 3I0TA 2VE8A 1XMKA 4EM2A 4A2UA 2H27A 3BPVA 1XN7A 3CJNA 1S29A 4U88A 1ZRCA 3TO6A 2DO7A 1BJAA 4AVPA 2F5EA 2DFIA 1LEAA 2Z9OA 3P9KA 1FX7A 3F23A 4R8HA 1DPUA 2STTA 5HDKA 2HEOA 3C7JA 1O7LA 4I0BA 1KQ0A 2HZTA 4OIOF 1ZYRF 5DEQA 3HRMA 4CICA 2GIVA 1YW7A 1NHAA 5HS9A 3VB2A 2UZKA 4IHSA 4IRIA 2MC3A 2IA0A
chains in the Genus database with same CATH superfamily
5CO7A 4F3QA 4R0KA 2MF2A 4B9WA 3TP0A 3CD6Q 3CTAA 3ZQFA 1N75A 1M8MA 2QKLB 2RA2A 4J01A 2E1NA 2DMPA 2ZNZA 2P0QA 5GANe 1K1ZA 1VQPT 2B63J 2XAGA 3S14J 1FOKA 3CCLQ 4M7DA 3KYDB 2Z0WA 4OAZA 1X4OA 2WY8Q 5CIUA 4X0GA 1GXPA 2CZ0B 2MZ4A 2E41A 5HY6A 3VUBA 4E7LA 4A4GA 1U5TC 4BE1A 3CPFA 4AWXB 2MWPA 3M4GA 1YJ9A 3ECHA 2RQTA 1MSFC 2KBTA 1U78A 1RABB 3GIBA 1PCXA 2CWEA 1CKBA 2B9SA 1SF9A 5H2FC 5HLIA 5AYFA 5IT9Z 2VGMA 1FC3A 1SHFA 4DYQA 4PJLA 4AIDA 3BP8A 3OYBA 3EFRA 1S5LC 4B09A 2DT6A 2HCKA 2FB7A 1IUFA 3I5RA 3F8MA 5FLXZ 2RHXA 3CC4I 4FCYA 4QSHA 1MKMA 2Y69H 4JJNK 2VBZA 1VQMI 2HVSA 3GTOJ 2XPVA 2WA0A 2KIQA 1BI1A 1EZZB 1YCSB 3ASKA 3KBGA 3PGGA 2DFHA 5GANg 3MEAA 1HLVA 2L01A 2OTLA 4FYYB 3QAHA 1LB2A 1TWHJ 5ERIA 3BQYA 3HSBA 3SHFA 3R0AA 1UE9A 4MNUA 2M7AA 4M78F 1EH7A 3J7AY 2PJRB 3EUKL 2C0OA 1YJNQ 2YT6A 3FDRA 1W2BS 4PJOC 5D7UA 1YX5A 2DL8A 1CF7A 4MEYF 4AM3A 2EW3A 2CP7A 1POGA 1A36A 1DPRA 1YW8A 2Q2EB 2EYQA 4M7AB 3RZDJ 4PSWA 1IGUA 3RDIA 1ETVA 3FM3A 4QQDA 1TBXA 3QODA 2LK2A 1X01A 2DT5A 3CMMA 3JAMK 2MH2A 2HDWA 1IRZA 1T56A 3HOUJ 1R1UA 1HW2A 4IHXA 4HW0A 1FBQA 3LA3A 1RAHB 1P9QC 3IQLA 3OW2P 4M7AG 3C18A 4WXHA 3HFNA 1VQLA 5BPIA 2DMOA 2DMUA 3UR3C 1PYVA 1TTHB 2L89A 1RNLA 4VUBA 4FHTA 4DOZA 1M1KR 2KHMA 3BY7A 1GBRA 3WTUC 3VS7A 3QWYA 2RB6A 5IHNA 2HQRA 4OINF 2EWNA 1S7AA 3VWBA 5L3GA 3UA6A 4DQ2A 1K9AA 3M8JA 3CCJA 9ANTA 1JT0A 2DPUA 3ZCOA 1FOXA 3FK7A 1TL8A 3CF2A 3CCVQ 3DKWA 1S7EA 2H1LA 3JRFA 1UJ8A 3OIOA 2FL7A 1U6GA 4OAYA 4C8QF 3NEUA 4IURA 4NBQA 4BEHB 1Z6TA 4FX4A 3JB9I 1WDXA 4Q4ZF 1AOYA 3VUZA 1Q7YU 4MHGA 1W0TA 1B3QA 2R5ZA 3OYEA 1JBMA 3SZPA 3MEVA 2RKHA 3BJAA 2KGTA 2DTIA 4M75A 2QA4A 3CC7T 1G2HA 1QPMA 4ME7A 4C8QD 1JJ8C 2FO0A 4RB2C 1SFUA 1GFCA 2DETA 2O03A 2BZ8A 1M1EB 1M30A 1T8IA 5KE3A 2NS8A 2K85A 1WQ2A 4Y4RA 3BPXA 2AIRB 2DDAA 3KCCA 3WG7H 5FD5A 3R4KA 2MBFA 3D0SA 3M56A 2X6WA 2FZCB 3JB9G 1KQSA 3KIOA 1RI7A 3NARA 1WZ2A 1X3ZB 1V1CA 3K6GA 1ZTRA 5E79C 3OW2S 3QYHB 1XX5A 5DV5A 4ELYC 2WV0A 1Q81R 2JTEA 3K1PA 2TRTA 3EUAA 5DD8A 3KETA 1VQ4Q 4JLIA 1VQNA 3HGYA 1X58A 1XB4A 2PJPA 2K6DA 4J9HA 3TQ7P 3URGA 1XJWB 5GAOp 4GY5A 2X4WA 5D4SA 2BV6A 5F0FA 2RV8A 1I27A 1HF0A 1B4AA 2BVLA 3Q9SA 3TGNA 3JRGA 4U0WA 1Z0XA 3HKZA 1Z9ZA 3F0CA 2M1HA 1U5TB 4QQ6A 1SFXA 4AG2C 2M8GX 3G2BA 2CREA 4DOWA 3RYPA 2A68F 1UMQA 3IC7A 3CCRT 3VYHB 2VL8A 1H641 3CCUQ 3G1JA 2E1OA 2VONA 4BJTA 4Z02A 3SFMA 3V8JA 1FIAA 1I8FA 3HYIA 2VBYA 1XCVA 3GLXA 5C3EJ 4PJOG 1EF4A 2GBQA 1UG1A 3GFMA 3IWZA 4M72A 4ZYEA 3A8LB 4RKUE 2HQNA 1S72Q 1OYIA 2YDLA 4KMFA 1BA5A 4ESJA 2CYYA 3DTIA 1K78A 1HKQA 1AKHB 4A0ZA 4WCIA 2KDSA 3E19A 3BCBA 1IZ1A 5HLTA 4UVCA 3MKZA 4G9YA 1YHQI 1WXTA 1SVLA 1B1BA 2RHZA 1IRXA 4RTYA 2OTJT 1FIPA 4M9ZA 1MNDA 2XUBA 4L0YB 3DKXA 5KVRA 2RQPA 5CJ9A 2RK2A 5A2QE 3S3NA 1HDPA 4LLLA 2R93J 2WB1A 3TW6A 1X6OA 2FVUA 5L23A 3CMAT 4RLFA 4C92B 3K2AA 1ZBXA 3BE3A 3S93A 1JI8A 4I98B 1KU7A 2BW3A 1LFPA 5F0HA 3A8GB 1RI0A 2DZCA 2VKHA 2VKVA 4D0PA 2HOTA 3OYJA 2LX7A 2E5NA 1R5HA 1U1TA 3C12A 1KGSA 1VQKA 2YSRA 5IOYA 2QDLA 3H41A 5KH6A 2RNGA 1GVJA 5K5QA 2QCOA 3FLGA 2D1VA 4Y17A 5FLXK 1OZ2A 2A6HF 2DK8A 4O6JA 3ABTA 4HSTA 4CYCB 4ABZA 5J1YA 5ILUA 5M3FJ 1FEXA 1SHGA 4OMLA 1IXCA 2MIOA 2ZXJA 4UUTA 5FU6B 4PK4A 3VSLA 2M51A 1A31A 2M0YA 3U9GA 1XG1A 4M9XA 3AG4H 3J7YJ 3CCQI 2VQHA 1REPC 2VOOA 1UGQB 4N9HA 3NMZC 4JJBA 4B3XA 3DEEA 3MVPA 2WSCE 4B44A 5K5OA 3OYYA 2DA2A 4C2UA 4A63B 1YITA 5FKLA 1PP7U 4UY8I 5D5WB 4EGZA 2FZGB 3L2WA 2DEQA 1VQ5I 2IXSA 1W36C 2JW4A 4BAYA 3MFKA 1ONVA 4CC3A 1PSEA 4M7DD 3JRIA 4LDYA 3H9JA 3GZ5A 4IHVA 1K6YA 3HPHA 1DU6A 2V9PA 4C8QA 3LSMA 2BE7D 4E6KG 3VODA 1XD7A 3HRTA 2XF5A 5E3OA 1WJDA 2KRCA 1RPWA 1UHMA 2QF7A 3ABUA 4HX7A 4IHTA 1QWFA 2W10A 1M1KU 4AUXA 3HBLA 1S9HA 2XAQA 3GWZA 3KP4A 4LGWA 3JRDA 3N4MA 3MJXA 3T8RA 3DLLA 4PGGA 2DMNA 2BOLA 3QOPA 3HOXJ 4UUVA 2CQKA 3OY9A 4YFXF 4BDZA 1D09B 1NM7A 1RI9A 4UVBA 2J6OA 2L02A 3QZ9B 1K7AA 2CT4A 1VQ7Q 3BC8A 1OU8A 1VQLI 2DA4A 1PNJA 1QVGS 2KSSA 4BNCA 3LSRA 2HMAA 1JO8A 2IAIA 4HLYA 4WX9A 3FXJA 3REBB 2AXLA 1MNMC 2PBIA 1C1AA 4KA4A 1ULYA 2KQWA 2M9UA 1YJ9T 4PDKA 2QEXT 2BY1A 2EJGA 1P7IA 5GPCA 2P0WA 1QZZA 1K4SA 2Y0SN 1N77A 5L3CA 3ZMTA 2FUG2 2ECBA 2ELKA 1M3AA 4N4IA 1FWZA 2RC4A 5D5VB 2PG4A 2RGVA 3BDDA 4XK4A 3CMAA 1AU7A 2H6CA 1ZUUA 2L3QA 2RJFA 4M78A 1SFOJ 2LF7A 3QJYA 1AA7A 2EB7A 2Z3YA 3AFHA 3FXUA 4RAZA 4W1UA 4HNTA 2CZ6B 1KD1C 2FBHA 4FETA 4IO9F 2E5ZA 2VC8A 2EIJH 1LE8A 3SDZA 3B6AA 5GAMd 3A1YA 3H5RA 5A2QR 2KT8A 5CVJA 2X9HA 4XK8E 1FMVA 3PM1A 3GTPJ 1YWPA 1QVFS 2DXIA 1GUUA 4HV6A 3C0CA 3EGDB 3PIPF 1OJLA 4GO1A 4BI3A 2IGNA 3IL2A 3T5XA 2HNHA 3G3ZA 3TCJA 4J9GA 3WTYC 4EPCA 4DYCA 1FT9A 3HSFA 3LSTA 3IAM2 3LQRA 3JR9A 5HS7A 1ZN2A 4BB7A 1YG2A 1ZG3A 4QQGA 1RZ4A 1J0RA 3RPQA 4C5IA 1U1SA 2Y2ZA 4FSXA 3JCMX 2DILA 1QZYA 1WFXA 4E70A 4RB0A 1QMCA 5D6YA 3RYRA 1SD7A 2MWOA 3QU3A 4F7UB 2VV5A 4XU1A 2ZPGB 5LJ5j 3LYIA 4FYVB 4XRSG 3ZMVA 3T0YA 4FASD 4UB6C 5IYCJ 5E17F 1KONA 3JTHA 3VPRA 3EG9B 1FBSA 2PMZA 2EYWA 3VOEA 3SZTA 4M77E 5GAN6 3KZZA 1WWXA 2KNBB 2H8RA 4JX5A 1KK7A 1IZ6A 4A4HA 1YE9A 3WODF 4D8DA 1FMWA 3ELKA 2XDPA 4L9NA 1PUFA 2ELJA 1XCBA 2ADUA 2BHYA 2V7FA 2FRWA 2IPOB 1W5TA 3MKYB 5FKOA 4AVZA 3F6VA 5GAMe 1TC3C 2K9GA 4QIWN 4QW2A 1S72T 4C5HA 2FMLA 1TLHB 1WVRA 2WADA 2X6XA 4C0FA 1VQ8Q 4B8XA 4NUBA 3NRVA 3EETA 3T1BA 2Z99A 1Y8QB 2K4JA 5FU7B 3JCMd 1ZHFA 5LRRA 1VA7A 1OMIA 2RQUA 1C0MA 4CC2A 1UHFA 2HWVA 4X9CA 1QLYA 2ZMEB 5IAYA 3JAME 2OJ2A 1H92A 2FXAA 2CW8A 2CV2A 1WI3A 2COMA 1SVOA 4Y13A 4QTRA 1N27A 3JCMg 4BI8B 5FKMA 3H0FA 3S3MA 2LD5A 1G2BA 2DRMA 4EIKA 5GAOn 3CC7A 4PCQA 3F72A 2DBBA 3C3WA 5FO5A 2ZJPF 3K70D 1WHJA 1V5EA 3DBRB 4G6DA 3TO7A 2IG0A 3DP7A 4C2MJ 1HBXG 5IH2A 5ICFA 3ECOA 2JN0A 2X48A 4J5YA 2M5WA 5HLHA 4AD9A 1O3TA 2HZDA 5DCMB 1LJ9A 4OP0A 2V1XA 3CCMT 2STWA 3JRAA 3RI4A 2K5IA 4FM4B 3CC4A 5F27A 2K9MA 2LY9A 3KEOA 2DAOA 3TSZA 3F3XA 5KYYB 3CXCP 3K4NA 4II2A 1RETA 5M5YJ 2LKPA 3CMET 3CD6T 2ED0A 1WFWA 2CUDA 2AT1B 5LRSA 3OB9A 3WTSC 2KI7A 3A0HC 1T98A 1IO2A 2VQLA 1JKPC 3VEPA 1FYKA 1J75A 4RCBA 1RL2A 2RQRA 5D6XA 2L4MA 1ZSZA 1JHHA 2A61A 2DXUA 3CDHA 2BGCA 3FXRA 3WU0A 2JMAA 5GAMf 5D5UB 1X75C 1QVGP 1XPXA 1VQ9Q 2MLGA 4EV0A 3WTTC 4OMMA 1K4US 2O5RA 2DL5A 2KAFA 2OZ6A 4EJWA 4RBOA 2L3SA 3LL7A 1K8AU 1CGPA 4HQEA 4RCCA 2PTKA 4HF0A 5DLQE 2L5QA 1LQ1A 1VOMA 3CLQA 4J9IA 4ZGJB 1FLIA 2OF7A 4XSZF 2DKGA 2OU2A 4KYWA 2HEQA 2SEMA 2NYSA 1JKRC 1MV0B 5CCAA 1BC7C 4YIIA 2X51A 3S2WA 2OZUA 2YUOA 3P5JA 4IRHA 2V1NA 1Z21A 3O8GA 3REAB 3QYEA 3NWSA 4JOMA 3CBPA 1V4RA 3A4CA 3GMEA 1TXQA 3OV8A 1HSQA 3EDPA 1O57A 3J80Z 2LP5A 3Q1JA 3VS6A 4J7FA 1WNLA 4KT5C 4L5IA 1ZLJA 4FW2A 1FYNA 2DFUA 3I9QA 4LFUA 5HCKA 3F8BA 2L9NA 2YRCA 3MP1A 1I1JA 2XKOA 5EJCA 2HTSA 3VFZA 4ZTJA 3H5NA 2V1UA 1OV3A 4C30A 1Y96A 2DQLA 1BC8C 1YIJA 3FKIJ 4A3BJ 3H9GA 2DL7A 3FIFA 5GAHJ 1NLOC 3CCEQ 3CUOA 4KH0B 3JRCA 2RPNA 4PJNA 2QSFX 1IN4A 2LRQA 3GF5A 3QDFA 1N6AA 1MHNA 3H3VK 4AFUC 1VQ9T 1WJBA 1S8NA 2A08A 3W2AA 1W6XA 4IL6C 2V8KA 3EAEA 4BS9A 4HQMA 5GTHC 3QRFF 1ZX6A 4Y52J 1RC9A 2X1CA 4ASNA 2EKOA 3FJ5A 1K4TA 5FLMJ 3WU2C 1JRIA 5J4YA 3JCMV 4CGZA 2ETHA 2CRGA 3HUGA 1YYVA 4M77C 2DNUA 3DV8A 3O3KA 4ATOA 1ETWA 2ZPIB 2A7YA 3O2PE 2L9SA 1OFCX 5FRNA 1YIOA 4KN4X 1O7FA 4I2OA 2KLOA 4ON0A 4OB1B 2CQNA 2HYFA 4LOCA 1QQJA 1SRLA 1MMNA 1W1WE 1WHLA 2BUDA 3AG3H 3LAJA 2MK5A 4Y91A 4AFZC 4KNYA 4CH7A 2VXZA 3QSUA 2J7IA 1ZRFA 2E65A 3HDDA 2XAFA 1F9NA 2XI9A 4RGRA 4M78B 5B1AH 3I71A 1MBKA 3AAFA 1Y39A 1PRLC 2I8DA 2HYJA 3AG1H 2R5MA 2H6BA 2IGOA 2V4JC 5F04A 1IC8A 1WKMA 4XBFA 3VS5A 2P6SA 2WACA 4XU2A 1TOVA 3QWLA 4M7AF 2KFDA 2DL3A 2FE3A 2X1EA 1ZA2B 2JXBA 4C92E 2IJLA 2J5PA 2LBFB 4EJTA 4XN3A 4M7DG 4ZDLA 3QDRB 4ZNXA 2BXZA 3OS5A 2D0QB 4HCBA 2QGFB 2E2HJ 1VQLT 1W7PB 2HOAA 2LNHB 4KJZA 3RNJA 2CW7A 2RMOA 5CQYA 1N8RC 3CUQC 1GXQA 2KJCA 3WTZA 2O7OA 1D1CA 4Q47A 1KSWA 1Y96B 1STZA 2HKQB 1BR4A 2X1DA 1Y0UA 2K9SA 5DCFA 1B07A 1XOVA 3DLMA 1IGQA 2H1KA 3ZQCA 3CESA 2LT1A 2ECZA 3GXOA 5E18F 1TNSA 2VLAA 2LY2A 1WHMA 5GANj 3SFIA 1RADB 3G71Q 1FMKA 5KAIC 1VF9A 3I5SA 5IP6A 2K27A 1I6XA 1T95A 4P55A 4HNUA 5DUIA 1R9TJ 4BY1J 2RK1A 5FLXR 3WTXC 5L8RE 5C4JJ 3WGHA 4JZ3A 1VTNC 2GOMA 4ZDPA 4JBAA 1VQLQ 1D3YA 3INZA 2XF7A 1B59A 2JA8J 1X3WB 4IUQA 3JW4A 1K6OA 1I81A 3SB2A 2QTXA 4R79A 2GLOA 2BBYA 3QKJA 3K10A 3JRBA 4CC7A 4KIFA 2ESHA 3CCRQ 1JJ2S 3PMIA 4HDUA 5LJ3f 3G4SQ 2XV4S 3I4NJ 4X6AJ 1W5SA 3CCJQ 1KC8C 1TZLA 1WI9A 1QO0D 2E1HA 4IOAF 5F1RA 5IP7J 4F7UG 2FEZA 8AT1B 3CCVA 2JOYA 1F4KA 2J6KA 3E6BA 2K2MA 2Z1DA 1UHCA 4C0GA 3CPWS 4XORA 1Z3YA 2DDBA 1D3BA 1MH3A 1SMYF 3LSGA 2MAMA 2G3RA 1SANA 2MI6A 5L3FA 1VQNI 1KQ2A 1XGNA 1WJ5A 3ERED 2CZ1B 3JTGA 5GANf 2SRCA 5J26A 1BIAA 2QVOA 1YIJT 2MFZA 5GAOr 2FMYA 1BOAA 1KHCA 2DK5A 2QQ8A 1WH5A 2LMDA 4D1QA 4M77G 3I55Q 2YUPA 2EFOA 2E5QA 5HK0A 2RM4A 5LHGA 5IN1A 1NYGA 2Y48A 3CDIA 1ZR4A 4DZPA 1Y6IA 3HFOA 3ZMZA 4CUGA 4BQNA 3OWTA 2LC2A 2NAZA 1R4MB 5J8FA 1QKXA 2LQWA 5CLSA 3RPUD 5CVUA 4F17A 1WHUA 5DM7R 4YIFA 4HG2A 4O3MA 3S2HJ 1TWCJ 1IV6A 1H88C 3UF4A 2VODA 3OYAA 3PTAA 3CC2Q 1WQWA 3CCRI 4OIRF 2QM3A 3FDYA 4BQOA 4ZZLA 1YO5C 1MBJA 2ROTA 3QP6A 1E6GA 1Y7XA 2C0TA 4M77B 5GAN7 3VU3C 3OW2A 2LLKA 5DY9A 2K9NA 4P1WA 1TT0A 2J06A 1OCRH 1TUGB 2LH9A 2XAUA 3PFIA 3LX7A 3PIPA 2KK4A 1HK9A 3HGGA 2B0LA 3H0DA 3TEDA 4LG0B 3JCMb 2EFQA 2R7OA 1IV8A 2IBDA 1FYMA 2JA5J 4LDUA 2LVSA 2V6EA 5IT9E 2DXCA 1TQIA 3F22A 1X2QA 1PJRA 5IYDJ 1E2XA 1D0YA 4F55A 1B8IA 3ME9A 3LSJA 2K4BA 1M3CA 1K8AR 2O9LA 2NS0A 3PO2J 4IKFA 5D4RA 2NUTB 4KGVB 5HK3A 5TISC 1B9NA 1Z67A 4ZYGA 5DM7F 2R5AA 4M78G 3PIOA 1YJWA 3BR2A 2XRNA 3ZGKA 2VYTA 4LUEA 4OMOA 1ZRDA 3HPWA 4BHCA 5C6SA 3D7SB 4BKXA 2K2VA 1PG5B 3MCAB 2L0AA 1IW7F 3FM5A 2E5KA 2ESWA 3U2RA 2QEXI 1CF7B 4V19K 2HKXA 2N8GA 2DF6A 3GFIA 2YHTA 4KT0E 5CKHA 4CI0C 1K9MR 3UT1A 4Y92A 4KICA 2VXDA 3ZRGA 4AIKA 3Q3SA 1KQ8A 1TWBA 3QZ5B 4PJOB 3DU6A 1KG1A 2YLCA 2E6ZA 1U9NA 1Z7UA 4M71A 2P4WA 3DBHB 3J80K 3JSPA 2HDDA 3S1QJ 4A93J 1BYMA 3HOTA 3H0IA 4FT2A 4CA0A 2GXBA 2HZYA 4FT4A 5K7ZA 1ETOA 1E0EA 1ZKGA 3ULQB 4HT8A 3IHUA 1QP3A 2O31A 3PT9A 2XIDA 4N0AA 2P84A 3PQKA 3FHNA 4C0DB 3OYDA 1F43A 2A05A 1PKSA 1Q95G 2EFIA 2MLKA 1M27C 4G6TB 1O3SA 5CKDA 2XK0A 1OCZH 5F64A 3M9QA 2WAEA 1PD1A 2KRNA 2H3JA 3MZ8A 1QGPA 4AYBA 2DVEA 4AT1B 2XICA 2M9HA 1UELB 2P5KA 1QWEA 3G73A 1A04A 2FA5A 5KYXA 4U0YA 1QVFA 3QPLA 3RUXA 3KLNA 1J09A 2NYXA 1IF1A 1OX9A 4ZGEB 1H8AC 1HJDA 2VQGA 3A2KA 2HQ5A 4R1HA 2J05A 4U7BA 3S17J 3IP4B 1MJ9A 3CMYA 2R0QC 2FRYA 3E9FA 4M78D 1QCOA 3JRZA 3EH1A 4C5GA 2QEXA 3QPHA 4Q5WA 3BJOA 2DIGA 2PVGB 1KQ1A 2EINH 2LY1A 2V9KA 2D1HA 4BE2A 1H8KA 2BEOA 4YRVA 5EYRA 5JR3A 3SYTA 1G5VA 1WSUA 1UGSB 3B02A 1Q81C 5D8KB 3GPLA 4RG2A 1YJWI 3QOEA 2BE9B 1IO6A 2KQRA 4G8XA 3FHZA 3M0QA 4BXXJ 4J9FA 4II3A 3TMOA 5FROA 2MW8A 3A0BC 3CMEI 1I07A 1OYXA 3BCAA 3MP8A 3CJRB 3J81K 3EUHA 2NUTA 1VQ4T 1O4XA 3OS0A 2D5VA 3X24B 2CDTA 5BPDA 1Q7YR 1TUCA 2JRTA 3M7GA 2COZA 3SJMA 2M4KA 2PFBA 2G7HA 5J47A 1WGXA 2ZAEA 4FT8A 1VQ8T 1K78B 4C0ZA 4FSSA 2DERA 1OYYA 2EBIA 3PSFA 1NZ9A 4HX4A 1UFFA 3H9QA 3TQNA 3ULRB 5BOXA 4XKCA 1LVAA 3HRUA 3M5AA 3S3OA 2QK0A 3OYIA 3BG9A 1WJFA 2GOXB 4M77A 4OVAA 3SZGA 1ZG1A 5J3BA 4BL0B 5J4VA 5FU6C 4WWCA 4XTWA 2H94A 4K11A 3L7WA 3TKYA 2XF6A 5GAGJ 2D6FA 5GADJ 2Q8KA 4DGWB 4OB0B 4B48A 2X4JA 2CH4W 5FD6A 4C5EA 3B6CA 1VQOA 4J9CA 1QVGA 2VJ4A 2XKPA 4A3CJ 1TW3A 3DPUA 4D7MA 2DXBA 3E7LA 5D6EA 4B47A 1M1KC 1YJNI 4EJVA 3E5UA 5ICCA 2EVRA 2QQRA 3TP3A 2XGCA 4BXUA 4W97A 3HTSB 2PUKB 2DL4A 2DA5A 4XRMA 1F1BB 5K1YA 3UA7A 1WXBA 1YJWT 2E6NA 2LCLA 4HCZA 4HXJA 4F7UF 1LPQA 3E6MA 4DW6A 2R7SA 2D9TA 4HT9A 3SXYA 2CMPA 2E1MB 2DOEA 4D5CA 2NRAC 2QWWA 3M8FA 1ETKA 2CP2A 4C92G 2FU4A 3CCSA 3AL0C 1I5OB 2NOJB 3X20B 4S05A 2EBPA 1J9IA 2L3DA 3HZJA 1W36D 3BTIA 1XGMA 2QENA 3N97A 2ENMA 3JB9J 2J6FA 2HKOA 3U1DA 4NQWB 2W85A 4BBRJ 3LAPA 2BW3B 2ME0A 2MUNA 3E3VA 3M0TA 4EMKA 4HNVA 1RUOA 1GRIA 2W0ZA 3UPUA 4RTZA 1ZBJA 3DXJF 2X85A 4EJUA 5M5WJ 1YP5A 1K73C 4D8KA 5GAMj 4HOBA 5JI6A 4PJOE 1Z05A 2FBIA 2F5TX 2JPCA 2P0PA 1VQMT 2O0YA 1U9OA 4BI4A 5IP9J 1K9MU 2ZGWA 2H8WA 1ZLKA 2YU3A 2ZPBB 1O75A 2M2EA 1EA3A 4RMOA 3PVQA 2FOWA 1DGRM 3K4KA 2LNBA 4M75F 1U2WA 4FTHA 3DQVC 2XSDC 5HDNA 1SPKA 2GTOA 3I35A 3PVLA 4CC4B 5IHKA 3AHUA 4V2GA 1ZGWA 3ZL7C 4MDWA 4GYIA 2E19A 2R7DA 3OYLA 2K5FA 2FYKA 2ZJQF 1IJWC 2DJNA 3L00A 3I58A 3I5UA 3OR2C 5GP9A 4J00A 2HVQA 5BS6A 3TW7A 4Q5SF 3VRYA 3BQZA 1W2BA 6PAXA 1HC8A 2MCNA 4OU0A 5FFZA 4OMYA 2LTOA 2OTJI 3G6EQ 2GFUA 4XL9A 3BT9A 2QQSA 1QPIA 3K4LA 1AHDP 1YBYA 4E7ZA 3GNGA 2E3IA 3IV5A 4N0AC 4PNOA 2RJEA 2L4AA 4M78E 3HTUA 2VIXA 4HYEA 3CC7Q 3OSVA 2MYSA 2CV1A 3S1RJ 1PC0A 4TVRA 1ARKA 5A0GA 3TL4X 2H09A 2XHKA 1OCOH 4QPOA 2LZ6B 2RI3A 5KYUA 4LMYA 1PWTA 3U21A 1OR7A 4G94A 4AC0A 2XG8D 3AT1B 3SWNB 3BG3A 4XU0A 4L0ZB 1JU5C 3JCMQ 1YTYA 2FHDA 4M75G 1CKAA 1YWOA 3CC4Q 5TRDA 3S1MJ 2IVMA 1BBZA 1TTYA 3JCMh 3I56Q 3P7NA 5KYXB 3ZQQA 3M55A 4ITVA 4N4HA 2VB6A 3L1PA 2FPDA 2IIMA 3FRNA 1FSHA 1APLC 4E47A 4G7OF 4HA8A 2WSFE 3V8KA 4LUDA 1KD1U 4ENMA 3H3ZA 2EFPA 4I02A 4UC4A 1ZHIA 3KP6A 1SEUA 1XTAA 2EZKA 3TO9A 2LRDA 3G1OA 5J8CA 2FG0A 2DYSH 2XDVA 2JJ9A 4FU6A 1IXDA 5F1JA 5FB2A 2VVKA 1SMTA 2XMFA 4M7DE 2ZXIA 4LG3A 2XB5A 3CCUI 1ZA1B 2QYZA 3G4ST 1ZELA 1RAAB 1VI0A 1P4AA 5A2QK 2E34A 1MDMA 2DBMA 2OBPA 2J5OA 1NTCA 3DB3A 3QUIA 2IT0A 5FJ8J 1ZUYA 2DPDA 3JB9H 4PL6A 5BQTA 2DW4A 3OYCA 4G7HF 2AS5F 2R7WA 2WC2A 3FXQA 4KIGA 1QP2A 2KEAA 2YWWA 4QKUA 3GVAA 1ZH5A 1R1TA 2F1LA 2LOOA 3HSRA 4I09A 3RMSA 3TOAA 1ZR2A 1T6SA 1KQSS 3META 2YSQA 3NGPA 1HA8A 3MN2A 1ABQA 3DF8A 2ZPEB 2Y0MA 3QYBA 5KNLA 1KU2A 2DTOA 2E60A 2V1QA 3EG2A 3BTLA 2KZVA 1TP4A 3REOA 1RAEB 4FYWB 2G7UA 2E7WA 5F0CA 1H9TA 4L9VA 4X9DA 4MEXF 5LGNA 1PVEA 3DKYA 2VBXA 1G3WA 3CXCS 1YITQ 2DTZA 1S72I 1LDKB 4BXFA 4F52A 4MO7A 2CKKA 3PFSA 3GF2A 5LEJA 5A0LA 3K69A 3AL0B 4JJDA 1K9MC 4J19A 2R7FA 2GTJA 3DLAA 2R7VA 2JA6J 5FW9A 1YI2T 1XGSA 1Q82R 1UGPB 3M1CA 2CU7A 2YRDA 3Q5FA 3GTLJ 5J39A 5HOOA 9ATCB 3B73A 4LG0A 3W2VA 4ZYDA 1QCFA 1VQ6Q 3J7AO 4M73A 4AU7A 2P4RA 2VASA 5KCOA 2F4OB 4ELZC 4CSWA 1V54H 4IXAA 3P8DA 3LMMA 3KLOA 3S15J 2LREA 3LWIA 4KMUX 3OMCA 3CCEA 1UZCA 4UXNA 4H0EA 3VYTB 1VQ5T 2VJJA 1NG6A 4JRKA 2DN0A 2R57A 3FZVA 2BE5F 2R3SA 4Y3OA 2O9VA 1UB9A 4RMNA 2R7UA 1W5CC 1MH4A 2XAJA 3C2GA 3E6CC 2JVGA 4LLGF 1RACB 2AKLA 4XM3A 3GFJA 4NC7A 5CKFA 4S04A 2XASA 3P9CA 1YFNA 5C44J 1YX3A 1YHQA 3L2CA 1WJSA 2A5WA 4EMKB 2CO5A 2ID6A 1YITI 2NUPB 4BD3A 2Q0OA 2E36A 1V29B 1HYOA 3H6ZA 2YPRA 1ZSZB 1F5TA 4UV9A 4OIQF 1AWXA 2CQXA 2H3EB 4J6YA 4CDGA 2F2WA 3MZHA 2O4XB 3BG7A 4BHPA 2ZMEC 1DDNA 3S2DJ 3JAMR 1DP3A 4ZGDB 2O8XA 3I3LA 3NQOA 5HNFA 4HEA2 3A1PA 2LJ3A 5GMKh 5HS8A 4P9UA 2BZXA 1VZ0A 5I2MA 1VYUA 1N9SA 3FXKA 3W2WA 1WH7A 2QSHX 3S1NJ 2COBA 1LKXA 3HKZN 2JM8A 5LEKA 5L3DA 3HJEA 4ZYAA 3SQNA 4HX8A 2X3WD 1J3TA 4Y7NJ 3DPLC 3FF5A 4A0XA 4C8QC 2CUFA 2L9VA 3CUQA 3JV3A 4M7DB 1I0CA 3LSHA 2MPXC 4XU3A 4ZN3A 3K0LA 3MQ0A 1TT5B 4C92A 4D9JA 2ELHA 4WK8F 3I64A 4E7KA 3F6OA 2RH2A 2JK3A 3M58A 3FEOA 1Y8RB 3FXMA 3MMYB 4XLNF 2F5VA 3MP6A 1X1PA 2JPBA 4OMNA 2RNJA 4HCKA 1D0ZA 5E1WA 1VQKQ 3FK6A 2WWYA 3M54A 2OV7A 1CQTA 1ZGJA 4A3JJ 2K3XA 1XC5A 4LLNA 4BJ6C 2NVXJ 4QVCA 2E7XA 4JRQA 3F8FA 3RKYA 4A5MA 2LCCA 2OTJQ 5FKNA 2ZCFB 1XSXA 2C06A 2UWMA 1TG0A 5D8LB 4J9BA 4E2FB 1Q81U 3HOVJ 2CGHA 2F4MB 5J1RA 1RIOH 5HLGA 4DJAA 3EHRA 5GMKe 1VQKT 2NVUB 1RESA 4YTLA 4ZTFA 3F8NA 2PNIA 5HODA 1MBGA 4WTOB 4J83A 1W7PA 3EGXA 1XMAA 1HXDA 3K9TA 2CP0A 3WVEB 3JRHA 2EV0A 2RO0A 3A01B 2L7MP 2H8HA 1J5YA 3W6JB 3RKQA 1U8BA 1PP8F 3EFOA 5FRMA 2HAXA 2A37A 2I5UA 1WI7A 1AWWA 3J80R 4C3HJ 1P7JA 2CQQA 2W82A 1P4XA 5H6RA 1OX8A 1RAIB 4OB3B 2BVMA 2HKNA 3BG6A 3RR6A 3WE2A 2M35A 4F7UA 3SFZA 1ZARA 2FJ1A 3L2QA 2COYA 2CT3A 1ODDA 2QSGX 3P8HA 2PZ1A 4FQGA 1BCMA 1VYVA 2FNAA 4MZMA 2F5CA 2JM9A 5ED4A 3WG9A 4A3GJ 1W4SA 3GZNB 4KITB 1WHHA 4D7NA 2E70A 2IGMA 1M90U 2VPLA 1I5ZA 4JPBW 4YELA 1VQ7A 5B1BH 2QA4I 3H35A 3BR0A 1V55H 4LB5A 2JWTA 3J81R 2IS1A 2X0LA 5LJ5h 2P7VB 4MMKA 3WTVC 3C4SA 4JRPA 3HP9A 3C94A 3H9NA 1S6LA 4MMLA 4XLEA 2XHCA 3L2ZA 3ZBDA 3F9KA 1P92A 1TWGJ 4S0HB 4HVUA 5J3LA 2HVRA 1NG2A 2YLBA 2KT0A 3OL3A 4XLHA 2KZGA 2EGCA 1A0NB 3KYCB 4EJOA 3C1DA 3WE3A 1KQ9A 2HXOA 4C2TA 3EGDA 3HUGB 3LA2A 1RAFB 2PMZN 4O5VA 5EDNA 1OZ3A 2KE9A 3L2VA 2RJCA 1WHGA 2ED1A 1YOVB 1K0SA 1WPKA 2IS6A 5C4XJ 2C6YA 1SEMA 2E10A 2BZYA 3GEZA 2HBWA 4OMFB 5IXBA 3CCVI 1RRJA 1EJ9A 2LKSA 1N25A 2KIFA 3BLYA 5EF6A 2VWFA 1BBYA 2VKDA 3M0RA 4X34A 4P9FA 1QBJA 3ABKH 1FZPB 1Q86U 3CC2A 1D0XA 2HR3A 2P81A 2CW0F 4GFBA 5JVTA 2KMTA 4C8QG 1PRMC 1MMSA 1D8KA 2O88A 4HV5A 2BIVA 1LDDA 1BR1A 2EQMA 4AFSC 1YITT 1Z3XA 2DLLA 2A28A 3EG1A 4MGRA 2ZBKA 3VYRB 1K79A 5LJ3g 1OCCH 3GTGJ 2NUZA 4M3FA 3KEQA 1ACMB 2WY7Q 4K2EA 4XQ3A 1IDZA 4HDVA 2WSEE 1M1GA 3ZPLA 3HOSA 2WV1A 2Z5UA 2EZHA 2M30A 4XOPA 4E7HA 1O3QA 1KJWA 4X1VA 1LPLA 2XDDA 3X2QH 5E20A 2EJ9A 5EEAA 1YI2I 1UGVA 3DEWA 1TS9A 2HQEA 2AZSA 3JCMc 1B8IB 3ZQHA 2W48A 1Y1VJ 2VKNA 2ZNYA 2CUJA 1TH7A 4P5NA 4C8QB 4LITA 2V8JA 4DA4A 1NLPC 4L18B 2ABLA 2PUOB 4JX4A 3NTIA 2DMTA 1JKQC 3M53A 1QVPA 4AYBN 1RLQC 2HFHA 2JT4A 3QQAA 3CC4T 2PMHA 2KIMA 2OA4A 3ML6A 3BW1A 2RREA 3H3UA 3VDXA 3UWNA 2EQJA 3LSIA 2P5LC 3I59A 2XAHA 5IY5H 1QVFP 1MMAA 2X4HA 2XIGA 2EA4A 5AIPA 5DD4A 3G4SI 2HPIA 1NBEB 5JLXA 3OYMA 1WJEA 3I54A 1PD0A 1JUMA 2DFEA 2OC6A 2MC4A 1IN6A 2LQ8A 3ZXSA 2GQQA 2VXFA 4C3JJ 3VS4A 1X2NA 5KK1A 5D6WA 3K4MA 3EYYA 4A12A 2R7XA 4M75D 2RN8A 5LJ5d 1ENHA 5BNGA 2V8IA 4C8QE 1OULA 3LH5A 3CCQQ 3MEXA 2D8HA 1BR2A 4FYXB 3NWTA 4A53A 3V42A 4NQWA 2JTVA 5GAN4 1SFKA 2CS7A 4LD9K 1CSKA 3HSEA 3CJTB 2KKOA 4FE4A 5CKTA 1K61A 2YXYA 1YHQT 4RGSA 3L42A 2DD4A 4J8OA 1LFBA 1OCPA 2JA7J 3LQQA 1T0HA 5HKCA 5E1XA 3H92A 3OIQA 1T0FA 2QLZA 4UVAA 5GPAA 3OYFA 2PVDB 3ER0A 4B6MA 3QYFA 3I4PA 4XMYA 2GQIA 1WRJA 2JVHA 2ISYA 3TOBA 3K70C 4IUTA 4XIDA 2C0IA 1GCPA 4BQQA 4D5FA 4IRGA 2IEKA 1ZG5A 2NWMA 4UHTA 5KYUB 2P6TA 2G6FX 1JKOC 1LJOA 2KRSA 4GRIA 5DCMA 1JQQA 3ASOH 1UGRB 2M1BA 4M6XA 1VUBA 2DYBA 1K76A 3ABMH 2RNAA 2EIMH 5J40A 1WZOA 4OMZA 5KCHA 1YI2A 1R8OB 1OOTA 4RAYA 1DQUA 2E2IJ 4ENNA 3HB9A 3A01A 1E3HA 1LUJB 2WAFA 3PNVA 1RR8C 2X6YA 2XB0X 2ZFWA 1X1AA 3M9AA 3PQJA 1H3ZA 1PDNC 3DWLE 4MQVA 2XROA 2K4YA 3JREA 1IHWA 1T0FC 3LSKA 2IA1A 3JSCA 3CCET 3O5ZA 4A4KA 5LJ5g 5D5XB 4LNPA 3DU5A 2YX4A 4AIHA 5EGOB 3OSGA 2P7CB 2DK3A 3BOQA 2L8DA 3CCQT 4RTWA 1GFDA 3T8TA 3HOZJ 4I76A 2A6EF 4N4OB 1WQ7A 2DI3A 2GF7A 2F48A 5CR2A 2DBKA 1GDTA 1NJIR 3HC7A 3GFLA 1MMDA 4RAFA 2DX1A 3GO5A 4C92F 3R60A 4A69C 2GNCA 2Z33A 2DRKA 3R6NA 1VQ8A 2ZC2A 4JK1X 1NK2P 3CCVT 3IH3A 2M45A 1KIKA 2GBYA 2LKXA 1YFHA 1H89C 1HOMA 2LJ1A 5GAN5 2EILH 1EIFA 5BMZA 3A8HB 3ZMSA 2CJJA 3ZQLA 2JS2A 4JX6A 1E7OA 4HSRA 2HYGD 1GXIE 3IUOA 4XRFA 1MV3A 1R71A 1S3JA 1ZSGA 3HHTB 4GLMA 3JCMW 4A3IJ 4DIQA 3NTHA 4A6DA 5IT9R 4J7IA 1JXSA 2L7ZA 1BI3A 2G9WA 3PSIA 2Y31A 3CD6I 1V5FA 4QPQA 1IUYA 1NK3P 4FISA 4IQ4A 1GHCA 1OLTA 3M4OJ 3H5AA 1I50J 3CBMA 4PJOF 4HLXA 1ZUKA 2X98A 2E35A 2IGKA 2YRVA 4ZH4F 1TWAJ 1HDDC 1PUEE 1MJAA 2XVCA 1FTZA 2CH4A 3GTJJ 3CP8A 1ORKA 2KDZA 3P8BB 4L5GA 4B9XA 1Q86R 4PJOD 4RTUA 4BEHA 3UKGA 4WXDA 2GFAA 4JJCA 4RDUA 1QCNA 3SEMA 3TEEA 3CCSQ 1SRMA 1RR7A 3KE2A 5KE2A 1JUSA 2AQEA 2UV1A 1JXMA 1VQOI 2HDAA 3J81E 2F69A 2EV6A 2YUSA 4C92C 4CRIA 5GMKl 5IPAA 3CC2T 2X3XD 3CXCA 4IUVA 4L9TA 5IT9K 4QVDA 2W7NA 2QQBA 4F7ZA 2EYYA 5DM6F 2LX9A 3AG2H 3KXTA 3GP8A 5IT3A 1WGSA 2GGRA 2P4TA 3G7ZA 4C0DC 2KPMA 3J7AF 1XNIA 4L6V5 1Z91A 1TW2A 2DQRA 5LHHA 4UUSA 2DD5A 2CSIA 5ICGA 2XC7A 5CPRB 4A4FA 1W7PD 2DA3A 4V2SA 7AT1B 4NC6A 4KN7X 1KD1R 4KDPA 3QBYA 2PEXA 2LJ0A 2NVQJ 2VQCA 3KP2A 5EC7A 2KXCA 3H0GJ 2CGPA 3X28B 2VPRA 4M7AA 2BYVE 4JQFA 4J6WA 2A6TA 2Q2EA 2ZSHB 1HD3A 3IKTA 2KR3A 4IX7A 2RDPA 4M4ZA 1M9SA 1QW1A 4HF2A 4G12A 2DXTA 4DBRA 3ZEHA 2QYOA 2QA4T 1MSEC 1AZEA 2A3LA 4M75C 4IUPA 2TCTA 2LSOA 5CVVA 1MGQA 1OU9A 4XQFA 3G6EA 1VQPQ 4A5NA 4MTEA 3SEZA 1IXSB 3LWHA 4CCJA 3ABLH 3LFUA 2QKMB 4EEFG 4PFPA 4JP0A 3CCJT 2PJRA 3DBLB 1VQ6T 2LF8A 4IUUA 2D1XA 4PZJA 2KVQG 4Z89A 4PJMA 5JHUA 2VJ5A 4BGDA 3LWFA 4DYRA 2L7FP 4BY6C 2CUZA 2Y0SA 4UB8C 1X1DA 4XKWA 3RQIA 5LGTA 3I55I 4F16A 3M07A 4I7HA 1Y57A 2OX7A 1V76A 2M4GA 3R61A 1LOJA 2DMQA 2W24A 2ZKZA 3I56A 4DNCA 1EV7A 1Q82U 1R58A 5EEGA 2E1CA 1SD6A 2MSYA 3OS1A 3KFVA 4EM0B 2R7TA 3QWXX 1JUPA 1I1SA 2VGNA 2VBWA 2HXIA 3S16J 4QLCU 4JS5A 4CCOA 4IVNA 1M2VB 2BXYA 1K8AC 1XSDA 2HPMA 3VJPA 4UV8A 2L0KA 2W84A 1UG2A 2NVYJ 4E7IA 3MD2A 2LYCA 3QU6A 4EQQA 2K5CA 4XLPF 3CCRA 4JS4A 5KYYA 4AG1C 1XDSA 4Z6YA 4PJOA 5FLVA 4M77D 1MBHA 1XMXA 5FKKA 1PHTA 5A0DA 3CMEQ 3PIOF 3G1LA 3HOYJ 1XQHA 2B7EA 4RS8A 1ACIA 3JCUC 1BB9A 3QYGB 2AHJB 4CYDA 3LFKA 4KT6A 1B6AA 1VQ4I 2W57A 4IOCF 2I0NA 1P4WA 2L7KA 1BCOA 1FBUA 4OOIA 1W2BP 2QXFA 5IHIA 3TDZC 1VQ5Q 1Q82C 1QVTA 3I55A 2E1MC 4Z88A 3LW5E 2QA4Q 2Y30A 3FISA 3CP2A 3QPSA 4AFQC 1NJIC 1SKUB 2XD0A 3OIPA 1F36A 3BZKA 2JQ7A 4LK1F 1GVDA 2ZMEA 4E7JA 2RQQA 2R7ZJ 4A54A 1DGWY 1ETXA 4MQ9F 3RQ4A 1XSVA 3A5ZB 4KFCA 5CKBA 3W3CA 3BROA 1E3PA 1KU9A 2QZ8A 3HOWJ 2KT1A 2JTFA 4E4HA 1LVKA 4BACA 3ZQ7A 5EG2A 3WHBA 3F21A 2AQFA 2B8AA 2NS7A 1U5TA 4CZCA 1IRGA 4J9DA 2JUFA 3FX3A 3VS1A 1QHHD 1Y56A 2TDXA 3SDGA 1FOWA 1X6GA 2NOGA 4RTVA 8ATCB 3OYHA 2O8KA 1B72B 3BJ6A 2HDCA 3QO3A 4RG8A 5JLWA 3O8HA 2JNGA 4LDXA 3CJQB 2ZPHB 3E2UA 4F04B 4NDLA 1JT6A 2MD0A 3ASNH 3KP5A 3RKWA 5I21A 2QQ9A 2DT7B 3EG9A 2A3SA 2LBFA 3MKLA 3PNYA 2E3HA 1WX6A 1VQMA 2IS2A 2W4SA 4F93B 1G4DA 2JVVA 1R22A 1W4MA 4PJJA 2R7RA 2NVTJ 2MD5A 3CDLA 1K83J 1MD0A 3K2ZA 3EQLF 4HF1A 1OPKA 3HEFA 2MA3A 5CVRA 4BE0A 4EMGA 2AO9A 1C0WA 5LJ5f 3RIRA 3CCUA 3RTRA 2AXTC 3IAS2 4FX0A 5CQGA 2R92J 2ZPFB 5CAIA 1SC7A 2RAEA 4LK0F 2DOFA 1R0CB 5LL6S 5IYBJ 1KU3A 2K57A 2NUPA 1R7JA 1BI2A 4MFDA 2DA6A 1MGTA 3V7SA 4MTDA 1Z1DA 3MZYA 3O6BB 3ZN1A 3D5LA 4C9YA 5GTIC 4N0BA 4ENJA 1TQPA 1HQCA 1LNWA 2M0MA 4F91B 4OIPF 1Z6RA 3KPHA 2JA2A 4F14A 4JZ4A 3M0PA 3PUBA 3L2UA 2NNNA 1IXRC 3D1NI 1B72A 2BTTA 1BI0A 3ZOBA 2R7QA 2X35A 4GCVA 2A07F 4L59A 4M74A 3E0JB 5CVIA 4U0VA 1U0JA 3CO7C 1ABOA 2EAYA 3HPGA 2O9SA 1SAUA 2E2JJ 4M3GA 4GDFA 2FPFA 5FWBA 3TU4K 2DIQA 1V5GA 5FGMA 1UJYA 2DA9A 5ECAA 1YJNT 3CEYA 3P9IA 3W6VA 1OEBA 1YS6A 5LGUA 1EX4A 4PLIA 5ILSA 3ZQGA 1MMGA 5DUKA 2Y4XA 4XONA 3PJRA 2MMPA 3T9NA 1R5GA 4BHBA 4LIUA 2Y9ZA 1QKWA 3SEQA 1M5Q1 3IRQA 2GCXA 1RAGB 2HNIA 4GYGA 1WJRA 4CHUA 4DEXA 2FPEA 2PVOB 3MCZA 5J6XA 2KRMA 1VYTA 2KXDA 3NAUA 1FYLA 2LP0A 1X6BA 2E4HA 5EG0A 1N8RR 2MABA 1U8RA 4J6XA 1I1GA 1H0MA 2VN2A 2L3PA 3RCOA 1MW7A 3OSSC 3TDUC 1PUFB 5TJJA 4CZZA 1YRNB 4YFKF 4DZJA 5K5RA 1FJLA 1BU1A 1EH8A 2IRFG 3CCMQ 1YN8A 3JCMP 2HQXA 3THKA 1VQOT 1D1AA 3CCYA 4A3KJ 1Y0NA 2XSJC 4B4CA 3GBGA 2QTVA 2IW5A 4NL2A 4XSXF 4C92D 3CCLI 4DBHA 2Y90A 1ETQA 3KP7A 2QI2A 3WGIA 4JRIA 3JCMJ 1QNTA 3EFSA 4M7DC 2GQVA 4GGGA 3M4YA 2JJ7A 2DTHA 1N8RU 3K4CA 1J7KA 1R00A 1Q86C 1SFEA 2EJRA 1ZREA 4H4KC 2JZYA 3E5XA 1D5VA 3HKSA 2MOXA 5KYNA 2O61A 1A6IA 2HQHA 4XTZA 2W00A 2F5DA 3K4BA 3V8LA 2M0OA 3H0HA 4GBQA 1T3LA 5GMKm 1KC8R 1EKEA 3BTJA 2PMUA 4B3AA 3VRZA 2ZB9A 1I3AA 5J1UA 5LLQA 1P2FA 1T39A 2CV0A 2OTLI 2HL3A 2LT4A 2YR2A 2F6CA 1RUWA 4ZZDA 2EPDA 2FQ4A 3GUDA 2UXNA 3HXLA 2HQAA 5JFRA 2M16A 3RJPA 3RBBB 1Y1WJ 2AKKA 1KFZA 2ZZDA 2O3FA 5GAMh 2LDUA 2LQNA 3MHXA 4HVVA 1QQIA 3ERMA 3QPTA 5GMKi 3IH4A 4XICA 4ESBA 1QHGA 2HOSA 4A4EA 4Y15A 4YFNF 4LDWA 4ZN1A 1VQMQ 1ON1A 3HIFA 3BDLA 1JHFA 3IKVA 2QBYA 1LDJA 2EV5A 1WCMJ 1G3SA 1E17A 2K86A 4KIBA 2NNYA 2DJQA 1U3EM 1MIJA 2JMCA 1AHJB 3BR6A 3GCMA 4IF4A 1J59A 2OJED 3DTKA 2WTEA 1D1BA 4M6YA 4KH1B 3SWNA 4G6QA 4Q48A 1L3LA 2CS3A 4KBMB 3K1MA 1XS9A 1AD5A 4CXFA 1YJ9I 3FBIB 3TSWA 2HU9A 2A0FB 3MPUB 5LJ3j 2JTMA 2KMUA 3DLLF 2XGXA 2QAZA 3EGXB 4EMKC 3CMAQ 3JAMZ 1X3UA 2XGEA 1YIJI 3RKXA 1UTIA 4OB2B 2JSPA 1IN7A 3S6WA 4M7AE 3BTCA 3HRSA 2CSQA 5DS9A 1M8VA 2ACJA 5CK9A 5FFXA 4OF1A 1RKWA 3DPTA 1UG0A 5EEHA 1VQ6I 1H3HA 3VSKA 5LHIA 1UECA 1BN5A 2FOKA 3ROUA 1R0BG 4EMHA 5B5EC 5GAMg 5H20A 2UXXA 4UUSB 1S1NA 3OR1C 4AIJA 4RTXA 1Q7YC 2V1RA 4HKEA 2GXGA 3L2RA 1Y0MA 3FC3A 2EIKH 1USSA 2K3PA 3CQZJ 3SD4A 1X2MA 2VOPA 1X43A 1FPQA 3JB9F 2ATCB 3LSPA 2L3RA 2DODA 3EH2A 3CD6A 2PQ8A 2F5KA 1R23A 4FL6A 3J81Z 5K7HA 2NXNB 1ZQ3P 2F5FA 3OOPA 2X4XA 4XKBA 3WVDB 2MH9A 3CCLA 1PM3A 2OAWA 2RHYA 2BHZA 2FRHA 5L3EA 1G8XA 3LGFA 3M57A 2XGDA 1UJ0A 1VIFA 4M3BA 3PE0A 3G6EI 4PLLA 4M9SA 4MZPA 1ON2A 1B34B 1JEGA 4I6ZA 2ROLA 2FX0A 2CP6A 5CKEA 1YJ9Q 4WCGA 4OWRB 4YG2F 1KYWA 1Q1HA 2CZ7B 4KGXB 1OYWA 1MBFA 2CP5A 1HKTA 2HTJA 5JVGF 3KFWX 4PGHA 2EH3A 1WLPB 4PKCC 4XTUA 2K40A 3KX2A 2M34A 4RAGA 2D45A 2AZVA 4ZYHA 3EG3A 3BWGA 2EYXA 1AOJA 4Y28E 2L54A 4FE7A 2E71A 4M6VA 4B43A 2UUZA 1WHKA 3FB9A 4LD6A 2XRLA 2O4XA 3E9GA 1SSHA 2FEIA 2HL5C 1IN8A 3DFGA 1ZGAA 2GAUA 2KIUA 3G71I 1U3OA 1MBEA 1R36A 3MWMA 5CYVA 1NH3A 4IHWA 1M3BA 2HD0A 2LNVA 3KEYA 5KYWA 3M0SA 4HAMA 2L9RA 4IZZA 1G3TA 1T0JA 2EZIA 2OTLQ 3KZIC 4MFEA 2QQAA 1M4ZA 1HSTA 5GAOm 4XRSA 2R5ZB 2XPUA 3GTMJ 1PKTA 5DLOA 2GA1A 1E3OC 3F70A 4ORZA 5GAOl 3J80E 3DCFA 1OCTC 1B34A 1UHSA 1YJNA 2O2OA 2FD5A 3E97A 1FXXA 4II1A 3OA6A 1S7OA 3ZN0A 4EATA 3CCJI 1GCQC 5DTDA 1IHVA 3FMQA 1K73R 1JJ2P 2CP3A 2X4YA 2BY2A 4LD5A 2RHIA 3QIIA 3D5RC 2ZFUA 3VYUB 1NE8A 1DU0A 1YI2Q 1AWOA 1QU3A 1VNDA 5E1ZB 1RKTA 1NJIU 2Q1ZB 2WAQA 1YHQQ 2LR8A 2ZJ2A 2VE9A 3I55T 4V2FA 3UNGC 1SSFA 2DJZA 3LGLA 2RD1A 3DTEA 3CCMI 2F2VA 4M77F 4NS5A 4EMSA 5E8IA 2DA1A 1TNTA 1DP7P 3V7CA 4NC8A 4RUGA 2HS5A 5HNHA 1YQAA 1UFMA 2KY9A 1IG7A 1XDUA 4KGZB 3KUFA 3CZ6A 1ZLMA 1W0UA 2JS0A 2CUEA 2VC0A 3E6DA 1Z9CA 2DLPA 2BY3A 2LFBA 2EYZA 4LN2A 3LOCA 1A5JA 1BK2A 2LMJA 1FNNA 1QZEA 3R6SA 3Q0UA 2O6GE 1WXUA 3I56I 2FSWA 2IPQX 2M87A 3F8CA 3HHGA 2VUBA 3FIWA 2OCCH 3QP5A 1FP2A 5ILVA 1SG5A 2JUGA 4XTVA 1OR7C 2CFOA 1EH6A 4BQAA 3VV0A 2JT1A 5FLXE 3HHHA 3OQ5A 1MJBA 2ZXHA 1ETYA 1MDMB 4WXCA 5FWCA 4HPQA 5B66C 2AHQA 2M3AA 3CCSI 1FTTA 2XU8A 2IS4A 3VS2A 2P0KA 2ESNA 1HCRA 1K0XA 5AIQA 2DJIA 2GWRA 3MKDA 1IN5A 4RA2A 4FIBA 1IDYA 3SHWA 4EM1A 2V1DA 2DA7A 1AVZC 1TU0B 2OTLT 1UEBA 4A3MJ 2E12A 4A3EJ 2D0NA 3ESWB 1YCYA 1Y71A 5LBQA 4QVZA 2VT2A 2MVTA 2V79A 4CO8A 2JSCA 3BY6A 4M3DA 5AONA 4NHJA 1I6HJ 1LEBA 1NEBA 2D8JA 2K3BA 4AMCA 4KISA 2CSOA 1VQ6A 4LB6B 1VQKI 4A3LJ 4CYCA 1BL0A 1VQ4A 3AKZA 1VQNQ 4YIRX 5LJ3d 4KUDK 1C6VX 2IVWA 3EUHC 3L9FA 3I59B 2KYBA 3G1MA 1YS7A 3OS2A 3DEUA 3IRRA 4NB5A 2VI6A 2K3YA 1JGSA 4M3EA 1T38A 3OMYA 1YIJQ 1WYXA 3M1EA 3WU1B 2QUFA 2B86A 3COAC 4XAXB 1FSEA 2WB1N 2WAQN 3LA7A 4M75E 3OYGA 1VQPI 1LCKA 1M2OA 4KUIA 3FXOA 4PJ0C 5KCMA 2ISZA 4OMQA 5GJWB 2LC4A 1M90C 1ERDA 3M59A 1TUDA 3L09A 5ICEA 1JJ6C 4FW1A 1YLFA 4HBLA 1OQYA 3OYNA 3JCMe 2EIFA 3A03A 4I01A 3A98A 4BUPA 1R4NB 1IGNA 3OMGA 3WGGA 5LJ5e 2VT3A 4IIMA 1OKRA 4XLAA 2MG4A 5E3LA 5GAEJ 4M7AD 2V9VA 4TV7A 2X9DA 3CQTA 3DKMA 1T33A 2EGAA 3CCST 1S72A 5L3BA 1AKHA 2VUMJ 2OAUA 2V6CA 2W25A 1Z7LA 3BR1A 4XNFA 1LFUP 2DPPB 3NTKA 3R6OA 4XR6A 2KRFA 3RSNA 1G6NA 1AZGB 1GBQA 3OL4A 4A6EA 3A8MB 2ID3A 3M3YJ 3RZOJ 3ZMDA 5M9OA 2G0EA 2KL4A 4KUMA 2OPTA 3S32A 1R77A 3C95A 4ESRA 1HSJA 2DOAA 4N9IA 2AK5A 3MEWA 4P96A 1BOBA 4PFOA 4B1RA 2DVJA 2NLUA 4KULA 2OQRA 1UHWA 3MKWB 1AWCA 3HTRA 4HRIA 4P5OA 3I4MJ 3MO8A 3VS3A 2JN6A 3RESA 2O01E 2GA2A 2WBMA 1FY7A 1UAAA 2DYIA 5I11A 1VQPA 1DUXC 1M1FA 1BKBA 4JYKA 2PI0A 3FJPA 2LVMA 3N5BB 5HVQC 3ZFJA 2Y75A 3BFMA 2CQ7A 1BIBA 4IJAA 2DM1A 3BZCA 1WIEA 3L1AA 5GAN8 4MDXA 2OTJA 4IQJA 1JTXA 2V26A 4JLGA 2FNPA 1GL5A 1TQMA 4C3IJ 1RUNA 2DU9A 3Q0WA 4NL3A 1K73U 2PLYA 2OI3A 4XOTA 2LQKA 2EQIA 4LDVA 2HSEB 4HVWA 3CPWP 4ANJA 1UCRA 2DTRA 3E1SA 4RLQA 2GXAA 5AT1B 2QGUA 2X6OA 4DEYA 1I5LA 2K9LA 3A02A 1MZBA 1WJAA 5KYWB 5LJ3h 3PL8A 2P8TA 1B9MA 4BYYA 2P0TA 3GYHX 4L5JA 2DZ9A 2RI5A 1BW6A 1KYZA 3RPUA 3H8ZA 4F7UE 4LJZF 3OSFA 3GTKJ 1OQKA 2K9QA 2COWA 2FF4A 3BZ6A 3ISPA 5B3SH 5M3MJ 1O9SA 1GV2A 1WPYA 3VKIA 1JJ2A 2DCEA 2MGQA 3C2BA 3ZP5A 2CYZB 1HW1A 3EG0A 4BDYA 3PO3J 2I10A 2BZTA 4DBFA 4JDSA 1LNXA 3PNWC 2PQWA 1OPCA 2RQWA 4M75B 1YNZA 1NYFA 1G3YA 4Y33A 1VFCA 2KP6A 2ME6A 1MUZA 4RTTA 5LFAA 3CPWA 2K7LA 2VKEA 1KQSP 2EFNA 5DDGA 3CMEA 1Z77A 2OQGA 2VXEA 2K3FA 1UUEA 4XTYA 3GW2A 4ENKA 3GOXA 3G4SA 2FBKA 1QRYA 3IH2A 1JB0E 4CCKA 4EGYA 4PUSA 3M8EA 1D5YA 4MZTA 2XPWA 5I2SA 4ETSA 1F1ZA 1SAXA 3LH0A 2ZJRF 5KAFC 2R5YB 1T3SA 4XLFA 4ZDOA 1SD4A 3G6ET 1H9GA 2PU9B 3A8OB 3HL8A 1Y07A 1FP1D 4X1EA 1J2XA 2CH0A 2OAZA 3ZQIA 4CCLA 6AT1B 1VQ5A 1QA6A 4Z8AA 2GZWA 2EQKA 2I2LA 2E64A 3NPFA 1SVMA 2F4IA 5E8GA 3J7AW 4GLKA 3CCUT 5F6FA 1I39A 1R1VA 3GLLA 5GJVB 2CG4A 2ZCWA 4QWQA 3CF5F 4OGCA 3EPZA 4MLOA 4PSXA 3KYLA 1EFNA 2QGGA 1KC8U 3R0JA 4I0AA 4OMPA 4UNOA 2EFWA 2RVCA 4G7ZF 1O3RA 3JSOA 1D8JA 3VYSB 5K7FA 1BW5A 4CCMA 1W1FA 1G83A 2EK5A 2GIZA 3WXMB 2CFXA 1JE8A 4PFZA 3JB9D 2PX9A 3QXEB 3UATA 3TVTA 3OBWA 1GV5A 3CBOA 3CCLT 4D6WA 2RQVA 3DB4A 2ZO4A 3M0UA 1OI1A 2A69F 4L5EA 4R55A 1G59A 1N5ZA 4DBQA 1TWFJ 5GAN2 1BJZA 1OISA 2KDOA 3PNTA 3V7RA 3KZYA 3ZMUA 4IIOA 1JXOA 4R56A 5EZGA 2R58A 1JTYA 5FU7C 2KRHA 3KP3A 4BU2A 5A2QZ 2D2WA 1T2KA 1WJQA 3D5SC 4HZFA 3EYIA 2F2XA 5JHFA 2RN7A 3V4GA 3GTQJ 1PSFA 1U06A 5GAOq 3I53A 4YEJA 2M8EA 2QBYB 1VQ7I 3BG5A 1M2VA 1RLPC 2XKOC 3C2HA 3VS0A 5GANd 4EVIA 3WTWC 2Z16A 4NOYA 2RJDA 4ZJZA 2HBPA 2QDYB 2IA2A 5E3MA 5M5XJ 2JZ2A 3EGUA 2HI3A 1IREB 2EA2A 2PN6A 4BBSJ 3PUFA 4MIMA 1VIEA 4LE9A 3UDCA 3OOUA 3NHNA 3U1KA 2LCSA 2DYRH 3N05A 1E6HA 1YJWQ 1HW5A 3U23A 2Z2SB 1KA8A 3OYKA 4JUVA 1M90R 5D6FA 4ZC3A 1LE8B 1A6QA 2OD5A 1UDLA 5GAN3 2IP2A 2KJBA 2Y4YA 3CC7I 2W1OA 1XGOA 2BKDN 5LD2C 1X27A 1SD5A 5EZHA 1WJCA 1Z9QA 3K1NA 5E3NA 2VC1A 2KISA 1GCQA 3SWNC 4L9JA 2M02A 3MEUA 3FMRA 3QJ6A 2DO3A 2EPFA 2K02A 4BY6B 1X19A 1ITYA 2EQUA 4Z2YA 4QT7A 3LNQA 1R6RA 4NNJA 3PMTA 3CCQA 2F2EA 3QHSA 1GLNA 1L0OC 2YX7A 2K5LA 2LG4A 4XKVA 2YU9J 3K7AJ 4XN0A 3EFOB 1X69A 2FQ3A 2M7BA 3H36A 4GXOA 3GZ6A 3RMQA 1AWJA 5IXFA 3Q9VA 1YRNA 1YW9A 4RGXA 5KHDA 1VQ8I 4RM2A 1W70A 1ZSZC 2EKHA 1AEYA 3X26B 1ZAOA 2RI2A 5DYMA 1IAWA 3X25B 3I56T 1N78A 2K7AA 1R5ID 1IRFA 3GBQA 1FOYA 1GT0C 5EG0B 5CQXA 3FKJA 3CO6C 1X2KA 4ESFA 1XTDA 1VQ7T 3FMSA 5GMKj 3E5QA 4KRTA 3W6KB 1BM9A 1KZHA 2R5YA 2YUNA 2YS9A 2LDMA 2DEUA 2HOEA 4M78C 1X1BA 4IPAA 2A36A 3FWEA 2VJIA 4RB1A 5C0MA 1V3FA 2P5VA 3FBNB 4XLCA 4F92B 5IOZA 3S8PA 3CC2I 1JGGA 4RM3A 1NPRA 1OPLA 3HM5A 3CCMA 3H1CA 4RGUA 2M0CA 3I9V2 4N4NB 1NPPA 2DAQA 4BH9A 2EJFA 2RHUA 4LXCA 4WF2A 4DOVA 2QEXQ 2L2OA 4HCCA 2HSPA 2A5YB 1AT1B 2BY0A 5H6QA 1KHIA 3O8VA 4OGEA 3RERA 4CCNA 5HDGA 4U7DA 3J7ZI 3GX4X 2QASA 2QG9B 2HGCA 2YUQA 3MAJA 4LIVA 4RB3C 4A0YA 1USTA 1ZK8A 2DFFA 4BUGA 3HL2A 5GANh 3ZR8X 1TSFA 2FZKB 4XTXA 1P6RA 1HKSA 3CLOA 3CUQB 3IWFA 3I0TA 4IEJA 2VE8A 1VQ9A 4M7AC 2DE0X 1R49A 1UB4A 1XMKA 4E6RA 1VQNT 2OCEA 1DJ7B 4EM2A 1N9RA 2KROA 4A2UA 1I4K1 2R4GA 4M7DF 4BJ5C 3QG1A 2ZSIB 2EQRA 3JCMf 3HG9A 2H27A 2LTPA 2XDBA 4BY7J 3BPVA 2EZLA 1X4PA 3LLRA 3G71T 1I3QJ 1X1CA 1S29A 1XN7A 3CJNA 3CMAI 1D3BB 4U88A 3BDUA 3ONQA 1ZRCA 2GM4A 3TO6A 5CQEA 4A3DJ 2JUCA 2DO7A 1BJAA 1NG7A 1U5SA 2CUBA 4EDUA 4AVPA 2F5EA 2DFIA 1WA7A 1LEAA 2Z9OA 4J9EA 3P9KA 2RF0A 2JMWA 3BR5A 1FX7A 3FXLA 1RQ6A 3SDBA 3PFYA 4U87A 3F23A 3OBYA 2EGEA 2K79A 3WHCA 1B7TA 5F08A 4E7SA 4R8HA 1DPUA 1NEGA 2STTA 2ECCA 3TBIA 3EHQA 5HDKA 2HEOA 1VQOQ 3C7JA 1O7LA 1KQ0A 3BR3A 4I0BA 2HZTA 4OIOF 1ZYRF 1T08B 3Q0VA 2ZXWH 5DEQA 5I22A 3TREA 3HRMA 1YW7A 2GIVA 4CICA 1NHAA 5HS9A 4I99C 3VB2A 3CCEI 1A35A 1VQ9I 1QVUA 3A52A 1ZQ1A 2UZKA 3K4JA 2ICWG 3GNFB 1MNEA 2JRMA 4IHSA 5EGOA 4A3FJ 1Q1VA 4IHYA 4IRIA 2KYMA 5LJ3e 3G71A 3RDVA 2L2PA 5TGTA 3NFCA 1IB8A 2OUMA 3VYGA 4N4GA 2MC3A 2IA0A 2Y9YA
chains in the Genus database with same CATH topology
5CO7A 2MF2A 4B9WA 3CTAA 2RA2A 2E1NA 2ZNZA 2P0QA 5GANe 1VQPT 2XAGA 1FOKA 4M7DA 5CIUA 5HY6A 1GXPA 2E41A 2CZ0B 3VUBA 4E7LA 4A4GA 1U5TC 4BE1A 3CPFA 4AWXB 2MWPA 3M4GA 1YJ9A 3ECHA 1U78A 3GIBA 2CWEA 5HLIA 5AYFA 5IT9Z 2VGMA 1FC3A 3OYBA 3BP8A 3EFRA 4B09A 2FB7A 3F8MA 5FLXZ 2RHXA 1MKMA 4JJNK