1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
b'MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
1ZYRF 2HYFA 2C6YA 2HZTA 4ENNA 1A04A 1DUXC 1IW7F 5FLXZ 1XGNA 2FEZA 2O61A 2JTVA 2XAJA 4RGUA 1R1UA 3K2ZA 5HVQC 1RUOA 3BJOA 3MWMA 1YO5C 5L3BA 2PLYA 1B1BA 1XB4A 3IL2A 5CVIA 3F8FA 1BC7C 4KYWA 3IHUA 2JRTA 2PMUA 3RKWA 1QZYA 3HHHA 2HDCA 3C3WA 2P8TA 3ULQB 3P9KA 5FO5A 4LJZF 4FX0A 5DDGA 4CXFA 3KZZA 5CVJA 3BWGA 1BI0A 4HDVA 1YQAA 4HW0A 1LB2A 4EGZA 1DP7P 2H3JA 3TDUC 2DFIA 3F8CA 5D6EA 3B73A 3SZTA 4ENKA 3KEQA 2KRFA 2K4BA 3K9TA 4KUMA 4M9XA 4I02A 2RKHA 3ZMDA 1UCRA 2A69F 5LGNA 1FYKA 1XDUA 1LNWA 1LEAA 2F2EA 4U0YA 2YX4A 1TW2A 2V1UA 4L9TA 2STWA 3VODA 1W7PD 4ASNA 5D8LB 3I53A 4A12A 4LMYA 5A2QK 5DD8A 3FWEA 4GYIA 3BJAA 3I54A 2GZWA 1J0RA 4BHBA 4OIQF 4ENJA 2ZNZA 1HXDA 2WC2A 3J7AO 4G7ZF 2O0YA 5E8GA 2NRAC 1LEBA 1I1SA 2WV0A 2QUFA 3JTGA 4R1HA 3L09A 2DT5A 2NNYA 3AAFA 5J8CA 1K6OA 2H27A 1U2WA 4UV9A 1OKRA 2Q0OA 1IXRC 1R5GA 4KIFA 4LB5A 5L3GA 4ZYEA 3FZVA 3K1PA 2QBYB 2VOPA 4RGXA 2MLKA 1K79A 2EA2A 1LDKB 2VE9A 1USSA 1BM9A 3QRFF 3LAJA 4YIFA 4P9UA 1P2FA 3R4KA 3WTSC 4KN4X 1OYIA 2HOEA 2M87A 3WTTC 2M8EA 5LGTA 5FFZA 3W6JB 3JSOA 4I0BA 5CVRA 2LX9A 2A68F 3J80Z 3DKWA 1XMKA 3JAMZ 1XSVA 4L9JA 2VC1A 2F5EA 3JW4A 2PFBA 4UVBA 5D8KB 4LLGF 3ZMVA 3QPHA 3CUQC 1RNLA 2DLLA 4QLCU 1BI3A 1OMIA 1IN8A 3VOEA 2Z3YA 3K0LA 4RGSA 3IKTA 2IA2A 4ETSA 2CGPA 1TLHB 3RJPA 2FMYA 1WKMA 1Z1DA 1RIOH 4P5OA 2R7DA 3BDDA 2D45A 3E6BA 2MH9A 5E18F 1XGMA 2GA1A 2XROA 1SD6A 3R60A 4HBLA 3CUQB 2OD5A 3D5LA 4NB5A 1EV7A 1DDNA 4KA4A 4MTDA 4CDGA 5LRRA 4P96A 4M71A 4G7OF 1D5VA 4ESJA 3FXRA 4KDPA 2L4MA 2ZNYA 1YIOA 3CJNA 2D1HA 1OYWA 5ICEA 4LG0A 1IN6A 3LA7A 5L3EA 1Z9CA 4AWXB 2O03A 1ZAOA 1B9MA 4TV7A 1KQ0A 1O3TA 2Y0MA 2XAQA 2H6CA 2DQLA 1KU9A 3PFIA 3DQVC 3QAHA 2ZCWA 2VT2A 5DCMB 2XHKA 2HKXA 4RGRA 4EVIA 2EV5A 3F72A 3FMSA 4Y15A 4MQ9F 1AOYA 4UVAA 1QQIA 4EJTA 5L3FA 1BJAA 1YYVA 2FA5A 3COAC 3V8JA 2E7WA 4ESBA 3SFZA 3MFKA 4EGYA 3EYYA 1IF1A 3WTZA 1LDDA 4HV5A 2K5LA 3IKVA 4OINF 4MEYF 1O3RA 4HX8A 5CVUA 3FXUA 3HRTA 1R7JA 3KE2A 1D3YA 3V7CA 4HAMA 2XKPA 2ZKZA 4JK1X 1KYZA 3T1BA 2VONA 2NAZA 2LSOA 3ZPLA 1BIBA 3M7GA 2QQAA 3KCCA 1SFEA 3D0SA 5LHGA 5ICFA 4LK0F 2GXGA 3MQ0A 4RB0A 1KQ9A 3I0TA 2FNPA 2HTJA 1P6RA 2UZKA 5L3DA 1R1VA 4PZJA 3RKXA 1KYWA 2K27A 1T2KA 3R0JA 4LLLA 1YW9A 4KIBA 2CSOA 3TO6A 3EDPA 3QOPA 2NS0A 4FT8A 4R79A 1QVPA 2G9WA 3LQQA 2HYGD 3T0YA 1L3LA 5D5WB 3N97A 3RPQA 1NHAA 1PP8F 1S29A 3O6BB 3J81Z 1FOKA 1Z7UA 2EFOA 4A6DA 5LRSA 4UNOA 5D4RA 2VXZA 3PQJA 2O3FA 1G3YA 1O7LA 4LD5A 1IUYA 4YG2F 4GXOA 2A07F 1OPCA 3CDHA 2PN6A 2BV6A 1Z91A 4KN7X 1H0MA 1S8NA 1FT9A 4A5MA 1BN5A 3B02A 5FD6A 2W57A 1U8RA 3HUGA 4Q4ZF 2DU9A 1S7OA 3ABTA 3QP6A 3HRSA 4E70A 3I59B 1EH7A 4PDKA 3ZMSA 2EK5A 2JPCA 5DEQA 3FMQA 5K5OA 5F1RA 2Z99A 2G7UA 3ISPA 1Z6TA 3GZ6A 3ECHA 1U5TC 4YFNF 3WGGA 4WCGA 3CO7C 2CYYA 3T5XA 2ZFWA 4Y13A 4HQMA 4M9ZA 3H3UA 2FXAA 4HLYA 2HKOA 3KEOA 2H6BA 2ACJA 5D5XB 2HWVA 1MD0A 1PUEE 4L0ZB 1Z05A 3WU1B 3TO7A 4U7DA 3FMRA 4JQFA 1W4MA 2XVCA 2V1DA 2ZBKA 2P5VA 5F64A 5IT9Z 2IA1A 1IXCA 4EM1A 4XRFA 3HRUA 4EV0A 4HX4A 3FF5A 1ZG1A 3GW2A 1AWCA 2UXXA 3F21A 2UWMA 3REOA 5FLXK 2XAHA 3ZMTA 2QBYA 3FX3A 4MGRA 4LGWA 3KP7A 2DBBA 2W85A 1MJ9A 3I58A 4AIKA 3HYIA 4PCQA 2EB7A 1P4AA 1MGTA 2YSRA 2Z9OA 4BXUA 5BMZA 5FB2A 2DK8A 2EFQA 1FYMA 3GFLA 2AS5F 4BH9A 5JI6A 4EQQA 3DF8A 2V9VA 3Q9VA 1KGSA 2ISZA 1LDJA 1E17A 1WQ2A 3IWZA 1YFHA 2L3DA 5E1XA 3C7JA 5KVRA 1ZREA 1MZBA 4L0YB 3F22A 2IA0A 1UHMA 4KIGA 5LEKA 2Z33A 5A2QZ 3I64A 5BPIA 4S04A 5D6FA 3RKYA 1P4XA 1IN4A 3WTWC 5CYVA 2HTSA 3HSRA 3KLOA 5J6XA 3MHXA 3WU0A 5ICCA 1F5TA 3MZYA 4BHCA 1F4KA 1ON2A 5HDGA 2A61A 1LVAA 1G3WA 2H94A 2J5PA 1QO0D 3CUQA 4GO1A 1V3FA 5CVVA 5BS6A 3OV8A 4CGZA 1ONVA 4L5JA 2RQPA 3EUHA 2PI0A 4M6XA 5HLGA 2DQRA 2HEOA 1BYMA 2H09A 4B09A 1JHHA 4JBAA 3GUDA 3R61A 5JR3A 4RB2C 2IP2A 1ZARA 1FP2A 2R7FA 2FMLA 5TRDA 5IT3A 5L3CA 4AD9A 3G73A 4I09A 1ZLJA 3WGHA 4EJUA 2QVOA 1DPUA 2OZ6A 2BYVE 5CLSA 4A0ZA 2GIVA 5JFRA 1XSDA 3GEZA 3DEUA 2QWWA 1J2XA 2K86A 3E6DA 1T0FA 1XGSA 1V4RA 2A6EF 5DD4A 2D2WA 4XSXF 3FM5A 3GFJA 2EV6A 3ERED 4LB6B 3KP3A 3W6KB 2LKPA 5LGUA 3H92A 3KP6A 2Z5UA 5DCMA 3P9IA 1UFMA 2IVMA 4OIPF 3EQLF 2W84A 3TKYA 4MTEA 2VBYA 2K5FA 1FY7A 1W5SA 3FXQA 3I5UA 2QQBA 4OIOF 5DUIA 4Y17A 4EM2A 2ISYA 5AIPA 2VBZA 5F6FA 1U3EM 4IVNA 4LK1F 1X3UA 2ELHA 3SQNA 4RB1A 4I2OA 2KIMA 4KMUX 2XV4S 4LFUA 2EWNA 2FNAA 2M30A 1ZN2A 4EJOA 4OMZA 2KIUA 1FSEA 4MHGA 4GYGA 1FBQA 3HIFA 3WTVC 2VBWA 3BROA 4ENMA 2DI3A 2FBIA 1S6LA 1HW1A 1O57A 2ZMEB 1OYYA 3DPTA 4EJVA 2YPRA 4DQ2A 1UB9A 4EJWA 1IZ1A 2VBXA 1B6AA 1TW3A 5LHHA 1TNTA 1G4DA 1RZ4A 1MKMA 2A6HF 2L02A 1GXPA 1C0WA 5ILVA 5ICGA 2CW0F 1ZHFA 3BPVA 1YG2A 2JSCA 1GHCA 3KP4A 4UUVA 2JZYA 1O3QA 3JTHA 2RV8A 3RPUA 3TOBA 4BAYA 5HS9A 1TQMA 4S05A 1ZH5A 4K2EA 3IRQA 4WF2A 1SMTA 2FBHA 3P9CA 3LQRA 3HSFA 4G94A 1F9NA 1HKSA 5E8IA 3WTXC 5HS8A 2XUBA 2FU4A 2F5FA 4HLXA 3HOTA 3ZP5A 3H3ZA 2K02A 2IW5A 3MAJA 4U7BA 2X0LA 3WE2A 1YW7A 5DYMA 1MDMB 1CGPA 1KA8A 1HQCA 1ZLKA 1R5HA 2CFXA 1BI2A 3F6VA 4L18B 4IJAA 3DFGA 5FGMA 4ZZLA 2EA4A 2QM3A 3F6OA 2AXLA 4IHTA 1K7AA 4ON0A 3I59A 3HTUA 3E6MA 3SHFA 2X4HA 3M8FA 4EMSA 2XAGA 5KK1A 1YS7A 2RDPA 4WX9A 4YIIA 2K4JA 2VN2A 4OMYA 3F3XA 5JHUA 2YU3A 3WE3A 5E17F 1R23A 2WTEA 1T98A 1LQ1A 1T38A 1R58A 5AONA 2M1BA 1EH6A 4YFXF 3V7SA 2XRNA 1SD4A 4RB3C 2Y48A 4BYYA 1FBSA 5E1ZB 4D0PA 4LG0B 1KU2A 3U1DA 2EFWA 3V8KA 5EEHA 3T8TA 4P55A 4HV6A 2VT3A 4U88A 3TOAA 3VB2A 2LF8A 1TNSA 1E2XA 1FSHA 2HFHA 3E5XA 2ETHA 1IXSB 4IRHA 2E7XA 1D8JA 4MNUA 4HA8A 4L5IA 3ABUA 5HLHA 2EV0A 2K4YA 1GVJA 3J81K 3LWFA 1XMAA 3GYHX 2L54A 4NHJA 3V4GA 4WK8F 5H20A 2CWEA 1UHWA 1R36A 2VOOA 3KLNA 2J5OA 1WRJA 6PAXA 1W7PB 4HF2A 4RAZA 3N4MA 2VE8A 4N0BA 4IF4A 2FBKA 2O6GE 1OR7A 2LF7A 4HOBA 3IC7A 3E19A 2ESNA 2F5CA 1B59A 2L01A 2OBPA 4HX7A 1DPRA 4I0AA 2RN7A 3HTSB 4XSZF 3G3ZA 3DV8A 5H6RA 5EEGA 3HHGA 3CTAA 1ZGJA 2GWRA 3NEUA 4P9FA 1U78A 3E3VA 2VC0A 1HSTA 1F1ZA 2ADUA 1WSUA 1PDNC 1HW2A 1QGPA 2STTA 3C1DA 1FP1D 4XBFA 4U0VA 3ZN1A 4DNCA 5K5QA 1FWZA 2RC4A 1U5TB 4Z2YA 1Q1HA 1Z6RA 4OIRF 2OZUA 3RDIA 5HDNA 3LA3A 3F8MA 3ROUA 2GQQA 2O8XA 3L9FA 4IHSA 2KIFA 4IPAA 1SAXA 1KU7A 1IAWA 5E20A 3KFWX 3ML6A 4XLPF 2W25A 3P7NA 1ON1A 3DXJF 5BQTA 2E1CA 4CHUA 4CYDA 1CF7B 5BOXA 1R00A 2P6TA 1O3SA 4A2UA 2FOKA 5IT9K 3Q9SA 3BOQA 5K1YA 3PQKA 1J9IA 2P5LC 3VFZA 2P4WA 2IJLA 2MA3A 4F7ZA 4KICA 2BGCA 1G3SA 2P6SA 1YLFA 1G3TA 3E97A 4U0WA 4XLNF 1XGOA 1TTYA 2F5DA 5HLIA 1HSJA 5JVTA 3QPTA 4ESFA 1S3JA 2NYXA 1K78B 2PEXA 3GZ5A 4HZFA 1U6GA 3R0AA 3ZN0A 5K5RA 1QNTA 4PGGA 4N9IA 5FD5A 4UV8A 1O7FA 4LLNA 1B9NA 2XKOA 3L7WA 2HR3A 2LDUA 3QU6A 1ZRFA 2COMA 3C18A 2MD5A 3ZQ7A 2RVCA 2HQNA 1J5YA 4Q48A 1QW1A 4FHTA 1FYLA 2OQRA 3WTUC 2Y75A 4G9YA 1W5TA 1KQ8A 3ZMUA 3M8EA 1BOAA 1IN5A 2YX7A 2MLGA 2LNBA 1P4WA 1J59A 2WWYA 2BEOA 2MC3A 4RS8A 3GXOA 2XGXA 2ZMEA 2HGCA 2RNJA 3V8LA 1KU3A 4M9SA 4N9HA 5ERIA 2P5KA 4Q5SF 3GVAA 4HF1A 4BHPA 2PMHA 3MCZA 2GCXA 4I98B 1I27A 2KJBA 2Q2EA 4ZYDA 5DUKA 2EFNA 4BNCA 2RGVA 3MEXA 2M45A 3V7RA 1XCBA 4FX4A 1JHFA 1LJ9A 5LEJA 4RAYA 3BZ6A 3RI4A 3L2CA 2FQ3A 2KKOA 1YW8A 3E5QA 4IXAA 1Y0UA 3BPXA 1MJAA 2IPQX 4M72A 3GLXA 3U2RA 2ZO4A 3J80K 3SXYA 4NQWA 2BE5F 2GXBA 1HKTA 3WG9A 3FM3A 3WODF 3JAMK 2CO5A 1XD7A 1B4AA 1ULYA 3U9GA 2QLZA 4H0EA 4A6EA 1MDMA 2V79A 3K1NA 2D1VA 2A3SA 3BJ6A 2DW4A 1YTYA 5ED4A 2EJRA 3LA2A 2PG4A 4WXDA 2OAZA 3R6SA 4AIHA 3LAPA 3IWFA 1JE8A 1BI1A 2DO7A 4CO8A 2UXNA 3QU3A 2IT0A 3KETA 5ILUA 1GXQA 3M9AA 3KZYA 3LSTA 4A5NA 3GFIA 2P7VB 1FLIA 3MZHA 4R8HA 1XDSA 5HDKA 5FFXA 4UVCA 2EFPA 2DPUA 3RYPA 3OOPA 1S7AA 1SD7A 2V1XA 3F8BA 4UHTA 2E1NA 3TGNA 2FSWA 3RTRA 3CO6C 1QPMA 2PJPA 4G8XA 3GWZA 3I71A 2BBYA 4O6JA 3LFKA 3ELKA 4WWCA 5LBQA 2QZ8A 2K7LA 1T6SA 1T39A 3Q5FA 3TDZC 3M1EA 3I4PA 3KP5A 1ZRCA 4KMFA 4G6QA 3GO5A 4KNYA 3SZPA 2QQ9A 3KP2A 1STZA 1I6XA 5HOOA 5TJJA 2M5WA 4HYEA 1XSXA 2HQRA 1PP7U 1RUNA 4M74A 3DPLC 4OOIA 1J7KA 1REPC 3IRRA 1H9GA 3O3KA 1FPQA 1W7PA 2ESHA 2GAUA 1QZZA 1BBYA 2DK5A 1HW5A 3BP8A 2JT1A 3E5UA 1FC3A 1R22A 1FZPB 4G6DA 3GX4X 1FBUA 3NQOA 2R3SA 3DP7A 1WWXA 3K69A 2JPBA 4A0XA 3RIRA 1VTNC 5BPDA 4ZH4F 2FRHA 3CUOA 4YFKF 1R1TA 2NNNA 4MEXF 1SFUA 4O5VA 4M6YA 1ZRDA 2VODA 3GF2A 3F8NA 2ZJ2A 4EM0B 3T8RA 2XAFA 4M73A 1L0OC 2MBFA 2OA4A 3RYRA 4ZZDA 1YS6A 3L00A 3CLOA 4AIJA 1FX7A 1HBXG 1ZG3A 4IRGA 2XIGA 4BQAA 1U5TA 4WXHA 2KJCA 2K5IA 4GCVA 2XASA 2W24A 4HDUA 3O2PE 1USTA 3BY6A 1I1GA 3FHZA 4O3MA 3QP5A 1HKQA 1TBXA 3NRVA 4A0YA 1IN7A 3WGIA 4GGGA 2DPDA 4L9VA 2FF4A 2ZXJA 4I01A 1SMYF 3GFMA 4G7HF 4KFCA 4ZYHA 5J8FA 2A5YB 1IRGA 1D8KA 4OU0A 4B8XA 5H6QA 2QYOA 2B0LA 3VEPA 2MH2A 1ZG5A 2DTRA 1CF7A 4CICA 3K1MA 3ZMZA 4WXCA 1WI9A 4Q47A 3ECOA 1RI7A 2G7HA 2IRFG 1IRFA 1XCVA 5DV5A 4PGHA 1MJBA 2PQ8A 2DAOA 4I7HA 4KT5C 3F23A 2YR2A 4UXNA 1I5ZA 2L4AA 3JSPA 2OQGA 1JXSA 1P92A 3S2WA 5E1WA 3TO9A 1H9TA 3HSEA 4QWQA 2P7CB 4ZYGA 4HQEA 1K78A 5HS7A 4L9NA 5LHIA 2CG4A 2Q8KA 1ODDA 1FNNA 2GA2A 1BIAA 5LLQA 4HF0A 5AIQA 2FE3A 2V6CA 2HS5A 3EETA 4IRIA 2PBIA 2TDXA 3HRMA 1ZGAA 3EYIA 5D5UB 3HOSA 4AVPA 1BC8C 1SD5A 5D5VB 1XN7A 5DCFA 4CZZA 5CJ9A 1QBJA 3TQNA 3WTYC 1G6NA 2CQKA 3E6CC 1TQIA 5D4SA 1TQPA 2QENA 2OU2A 1SFXA 1EH8A 4MQVA 5ILSA 1JGSA 1J75A
chains in the Genus database with same CATH superfamily
1I50J 1ZYRF 1ZA1B 4J9DA 3VUBA 1QVFA 2MD0A 3JB9J 2Y9YA 5FKMA 2HYFA 2DD4A 4M77D 3C2BA 5GAOr 2C6YA 4N0AC 2O31A 2HZTA 4ENNA 1KSWA 1A04A 1DUXC 2A37A 3CCMA 2WAQN 1IW7F 4LIVA 2JJ9A 5FLXZ 1JO8A 2DFUA 1XGNA 1KC8R 1VQPQ 2FEZA 2O61A 1Z9QA 2X3XD 2JTVA 2MPXC 2ZXIA 4AYBN 1EFNA 2XAJA 3BQYA 5KAFC 5M3MJ 5LD2C 1RAHB 3SDZA 2HDDA 3AG3H 4RGUA 1KQ1A 2BTTA 1HD3A 4D1QA 2K2VA 1R1UA 4HNUA 2F6CA 1I07A 4X1VA 9ATCB 4JZ4A 3K2ZA 3CLQA 2ED1A 5HVQC 4KUDK 1RUOA 3BJOA 4IUQA 3MWMA 4A3LJ 1YO5C 3OS0A 5L3BA 4M3EA 3OYBA 1OU9A 4I99C 2PLYA 1B1BA 4OMLA 1XB4A 1YX3A 3IL2A 5FWBA 1Q7YR 5CVIA 4XTYA 3LSIA 3F8FA 2FPFA 1BKBA 2JRMA 5BNGA 3CEYA 2M3AA 3A03A 3HJEA 4M3DA 1DU0A 4UUSA 3VWBA 1BC7C 1NZ9A 2B8AA 3M59A 1Q81C 1Q86R 4KYWA 5J26A 1OFCX 1VQ5I 3IHUA 5ECAA 2JRTA 4A4FA 3I56I 2MWOA 2PMUA 3RKWA 2QYZA 1QZYA 2YRVA 3PMTA 3G6EQ 3HHHA 2HDCA 1WGSA 3C3WA 2P8TA 3M8JA 2NWMA 4Q5WA 3ULQB 3P9KA 1X1AA 3C2HA 5FO5A 4BY7J 3W2VA 1X2NA 3JB9F 4LJZF 4FX0A 2ZSHB 1MMNA 4RAFA 3HUGB 3CCVI 5DDGA 1I1JA 1FEXA 2AKKA 3BE3A 4OB2B 4CXFA 3KZZA 1VQOI 2OTLI 5CVJA 3BWGA 3TBIA 1BI0A 3BR5A 4LD9K 4HDVA 2W4SA 2DJZA 1YQAA 2DL4A 4HW0A 4X9DA 2FYKA 3LGLA 4BB7A 3A01A 1LB2A 1LPLA 4EGZA 1DP7P 1C1AA 4DEYA 2H3JA 4JLIA 4M7DE 3TDUC 1JUSA 2GQIA 2DFIA 2X9DA 3F8CA 4IQ4A 4D8KA 5D6EA 3CD6I 4JJBA 3B73A 5KCMA 3SZTA 4ENKA 1VQKA 3KEQA 2R5YB 1YNZA 2KRFA 4OF1A 1W5CC 2K4BA 3K9TA 4KUMA 3JCUC 2RKHA 4I02A 1UCRA 2A69F 2UUZA 4M9XA 3ZMDA 5LGNA 3J80K 1FYKA 2HBPA 4XNFA 2DZ9A 1XDUA 2ED0A 1LNWA 1LEAA 3CCRT 3OQ5A 1YJ9A 3LX7A 3DKMA 3CC4Q 1IB8A 2VGMA 2F2EA 4U0YA 2JMAA 4ATOA 2YX4A 4ZDOA 1TW2A 2DMQA 2KT0A 2V1UA 2RJFA 2BY1A 2NS7A 4L9TA 1HJDA 1PYVA 2STWA 2CZ6B 2ZFUA 1QVFP 3VODA 3VPRA 2HAXA 1W7PD 1K4TA 3VS3A 2R7QA 3MN2A 4PFOA 4ASNA 5D8LB 2M7BA 1FYNA 3I53A 1AU7A 4A12A 2HXIA 3EG3A 3H36A 2ZPGB 1UHFA 5M5WJ 3HFNA 4LMYA 4M3BA 4AYBA 4DBQA 2M02A 5A2QK 1VQLT 3OYDA 2ZC2A 3JRCA 1VQNI 2E10A 5LJ5j 1FMWA 2LR8A 4X9CA 5DD8A 3FWEA 4M6VA 3VS0A 4JX5A 1E0EA 4GYIA 3BJAA 3I54A 3CCQQ 2P0PA 4GLKA 5D6WA 2E5QA 2XHCA 1MH3A 5FLXR 2YDLA 3QBYA 4PNOA 4XU3A 1I3QJ 3FXLA 4QTRA 2GZWA 2XD0A 1J0RA 4BHBA 4OIQF 3PUFA 2A36A 4ENJA 5KCHA 3ONQA 2ZNZA 2N8GA 2YT6A 2VPLA 1HXDA 3VS1A 2WC2A 1M8MA 3J7AO 2COWA 4G7ZF 4IHVA 2RI5A 2M0CA 5IT9R 2O0YA 5E8GA 3RZDJ 2VQGA 2NRAC 1LEBA 1I1SA 2ELKA 1ABOA 4GBQA 5LJ3e 4XKWA 2E12A 2WV0A 1SRLA 2JWTA 4E6RA 4LD6A 1TUCA 3CCMQ 4J01A 3CMAT 4BGDA 2QUFA 1AWXA 2P81A 3TVTA 1SSFA 1WA7A 2OTJA 2RAEA 3VDXA 3JTGA 2DYIA 3PNYA 1W1FA 3S17J 4R1HA 4LXCA 3L09A 2DT5A 3GTKJ 1JU5C 4XOTA 2X9HA 2M7AA 2NNYA 5GJWB 3AAFA 1TP4A 5J8CA 2ID3A 1WHHA 1QMCA 1UGPB 3DBHB 2M4GA 1K6OA 1LCKA 2ABLA 2RK2A 2H27A 4K11A 3UWNA 1VQ8Q 1MMSA 1U2WA 2CFOA 4QQGA 3JCMc 4UV9A 2M16A 3EHQA 4WTOB 3CCUA 1OKRA 2Q0OA 1IXRC 1VQ9A 1NJIC 1R5GA 3ABMH 4PSWA 2YU9J 2OJ2A 4C92F 1M1KR 4KIFA 4LB5A 4GLMA 4C5HA 5L3GA 1G59A 2MIOA 2BY3A 4ZYEA 2BUDA 1PJRA 4IL6C 5EDNA 1MSFC 2Y4YA 1OCCH 3FZVA 3EFRA 1JKQC 3GMEA 4DW6A 3K1PA 3M0PA 2QBYB 5FLMJ 2VOPA 4DGWB 2CP5A 2RM4A 3G4SA 3NWTA 4YIRX 2V6EA 4RGXA 2LQNA 2KXCA 2MLKA 3TP0A 1LFUP 2QA4I 1SPKA 1G8XA 3IH3A 3KZIC 5A0DA 1K79A 2EA2A 3H5NA 1LDKB 1ERDA 1QKXA 3MEAA 4NL2A 3VRZA 1Q82R 2VE9A 2HQHA 1USSA 3CMMA 1BM9A 2L9RA 2JVGA 2HPIA 3LAJA 3QRFF 4YIFA 4P9UA 1P2FA 3R4KA 4GRIA 3WTSC 1YIJI 1YE9A 1MNMC 4KN4X 1M3CA 2VGNA 1VQPT 1OYIA 2HOEA 2M87A 1PVEA 2Y2ZA 3WTTC 2M8EA 3W6VA 5HKCA 3OMGA 1Q81U 5LGTA 5FFZA 3CF5F 4JS5A 5GPAA 3W6JB 4F7UG 4IURA 3JSOA 3I5RA 2K9SA 4I0BA 5CVRA 2LX9A 1M4ZA 2DL3A 3QJYA 4M78D 2A68F 2XB0X 3J80Z 2XKOC 2BHYA 3DKWA 3GIBA 4ZC3A 1AWOA 3EUAA 2RO0A 2X4XA 3VS6A 4A4HA 3KUFA 1XMKA 5DM7F 3JAMZ 2NUTA 1VQ6A 3ZR8X 1XSVA 4L9JA 3FIWA 4XICA 2YUPA 4ZTJA 1LUJB 2VC1A 1WHMA 2QI2A 2F5EA 3AHUA 1MH4A 3JW4A 2PFBA 4BU2A 3UPUA 2LJ3A 2RHUA 1S1NA 4UVBA 5D8KB 1KC8U 3FIFA 3HHTB 4RTWA 3HOVJ 4LLGF 2YSQA 2D1XA 2XG8D 3ZMVA 3VS4A 2OCEA 3KYCB 3QPHA 4NDLA 1AA7A 4M78G 2D0NA 3LWHA 3PIPA 3DB3A 2FJ1A 3K6GA 3CUQC 1RNLA 4XK8E 2DLLA 2M1HA 3G6ET 4C9YA 3TP3A 2Y30A 4C8QF 2VVKA 2PTKA 1U9NA 1IGNA 1AHJB 3LGFA 1KQSA 4QLCU 5CKEA 1YJNT 2LCLA 4E47A 2DIGA 3Q0WA 3IUOA 1BI3A 2M0YA 2FD5A 1S72Q 3I55T 4JJNK 1S72T 1OMIA 1IN8A 1Y57A 3VOEA 2Z3YA 4NS5A 3K0LA 4RGSA 2H8RA 2XB5A 1ZBXA 3IKTA 2IA2A 4ETSA 5GANg 4PJOB 2CGPA 1H3ZA 2FO0A 1IC8A 4C0GA 1D1CA 3BR0A 1UJ0A 2E19A 4PJNA 1TLHB 5CPRB 3SEZA 4N4NB 3RJPA 1NPRA 2FMYA 1WKMA 1Z1DA 1RIOH 3FBIB 2MSYA 3LMMA 2R7DA 4P5OA 1RADB 3BDDA 2E41A 2D45A 1E6HA 2WSEE 3H9GA 4XN0A 2KZVA 3E6BA 2MH9A 3CJQB 5E18F 1WLPB 1ETWA 1Q95G 2ZJQF 1XGMA 2GA1A 1QCNA 5KE2A 1TH7A 4DBFA 5GANf 2NOJB 2DBKA 1VI0A 3QSUA 4FASD 4UUTA 2XROA 1K1ZA 3FKJA 1SD6A 1IO6A 3R60A 1MUZA 1Z3XA 2CDTA 3CC4T 4HBLA 1N77A 2B63J 3CUQB 1YCSB 2OD5A 4M7AB 3D5LA 1ZKGA 1ZUYA 3L1AA 3HOWJ 4NB5A 3MKLA 4E7ZA 3S1QJ 1E7OA 3T9NA 1XPXA 4JJCA 3K4MA 1KC8C 3GTQJ 1QVTA 1EV7A 1BR1A 1DDNA 3KPHA 3JRZA 1PSFA 3ASOH 4JRPA 2BOLA 1KD1C 4EDUA 3J7ZI 4KA4A 3UNGC 1JB0E 2RD1A 4IZZA 3C95A 3CCUQ 1R6RA 1RESA 4QVDA 4MTDA 2XF6A 1K0XA 4CDGA 1RLQC 3O5ZA 4Z89A 4PJJA 5LRRA 4P96A 2JA5J 1I8FA 1T0FC 3TCJA 4M71A 4G7OF 1VQ5Q 1Z0XA 4ESJA 1D5VA 2EAYA 3FXRA 1MHNA 2DA9A 4KDPA 4XAXB 4IHWA 1ZUKA 3S14J 3I56Q 3S16J 2XDDA 4C30A 2L4MA 4XKCA 3RMSA 2ZNYA 1ORKA 2HCKA 1YI2T 2CZ1B 2DVJA 1YIOA 3CJNA 2D1HA 1NJIU 1OYWA 5ICEA 3K4JA 4LG0A 4EMGA 3PFYA 2BE9B 3PMIA 2FHDA 3CCVQ 2Y0SN 1JUPA 3UKGA 1IN6A 2F4MB 3M4OJ 2K3YA 5IHIA 1VQOQ 2OTLQ 4LN2A 3LA7A 4EMKC 2R5ZA 4M7DA 5L3EA 1Z9CA 3J80R 3CCMT 4AWXB 2O03A 1ZAOA 3S15J 4PJ0C 4J9FA 4BDYA 2IEKA 1EF4A 3JAMR 2EIKH 4MFEA 3LYIA 2TCTA 1B9MA 3ZQCA 1LE8B 2CT4A 5J4VA 4BY6C 3CD6Q 2BW3B 1X3ZB 3DTEA 1MMDA 4TV7A 2ECZA 2CU7A 4CYCB 4MDWA 1N8RR 2ZZDA 1KQ0A 1RC9A 1MBEA 1O3TA 3FJ5A 3QHSA 2VJJA 2VI6A 4EMHA 2Y0MA 1ETYA 3CBMA 2XAQA 3E0JB 3VRYA 4D7MA 5FU7C 1KQSP 4CCNA 2WV1A 1XG1A 2H6CA 1IV6A 1WJDA 3B6AA 2JA6J 1M1GA 1RQ6A 1WPYA 1CKAA 2DQLA 1KU9A 3PFIA 2LZ6B 1EKEA 4C8QC 3DQVC 3QAHA 2ZCWA 2VT2A 1AKHB 1VQ7A 5DCMB 3K2AA 5EG0B 3LLRA 2EBIA 1T95A 3RQIA 1AVZC 5HLTA 2XHKA 3HFOA 2HKXA 1RUWA 3EUKL 4RGRA 4EVIA 2DZCA 2L8DA 4FT4A 2MCNA 3CPWS 4J9BA 2GF7A 2EV5A 4A4KA 4CSWA 3OIPA 4D5FA 1VQNQ 3F72A 1FJLA 1N75A 3FMSA 2V9PA 4Y15A 4MQ9F 1TS9A 3FDYA 3PTAA 1HYOA 1AOYA 2EZIA 1WQWA 4UVAA 2YS9A 1QQIA 4DJAA 5GAMj 4EJTA 2E1HA 1IRZA 5L3FA 1BJAA 3CF2A 2ZXWH 1YYVA 2FA5A 4AVZA 2QQRA 2KZGA 3COAC 3V8JA 2VJ4A 2E7WA 4ESBA 3SFZA 3MFKA 4EGYA 2O9LA 3C12A 2KT8A 5B66C 3EYYA 2YHTA 1IF1A 4UB8C 4OMOA 4M77C 3RMQA 1DQUA 2JA8J 3WTZA 1LDDA 3JB9D 4A3FJ 1UAAA 1X27A 2WY7Q 5IP7J 1VQLA 1MNEA 3PUBA 4HV5A 1H88C 2K5LA 1JQQA 3IKVA 4OINF 1QCOA 4CCMA 2GOMA 4MEYF 1O3RA 4HX8A 4XTVA 5LJ5g 1GFCA 5CVUA 3FXUA 1JT6A 3HRTA 3RESA 1K8AR 1VQKT 1AD5A 1R7JA 2EIFA 3KE2A 1D3YA 1JT0A 2NVXJ 4UB6C 2JTFA 3H0HA 4KH1B 5CQXA 3V7CA 4QVZA 5LJ3d 3C94A 2QGGA 4HAMA 2QTVA 2XKPA 2AHQA 2I5UA 2ZKZA 2ZJRF 4JK1X 4OB1B 1KYZA 3T1BA 3ASKA 2VYTA 1VQ4I 2VONA 1YJ9T 2NAZA 3PGGA 2LSOA 3JRHA 1WYXA 4A3CJ 4JDSA 2FZGB 3JSCA 5CIUA 1OOTA 2EQIA 5LJ5f 3EPZA 3INZA 3ZPLA 3HOYJ 1BIBA 1WJQA 5GAN7 3M7GA 5DTDA 2QQAA 3CP2A 3ZCOA 3KCCA 4C3HJ 4YRVA 4KRTA 4MZPA 1SFEA 2HDWA 3D0SA 4BE1A 1PRLC 1UHCA 3VYTB 5LHGA 3PVLA 3ASNH 2RQTA 2DIQA 3MJXA 1YITI 2P84A 3I56A 3CMAA 2Z2SB 3JCMd 5ICFA 2DTZA 1XNIA 2JM9A 4M77B 3R6NA 4LK0F 3MKYB 3KYLA 3A1PA 2PQWA 2ZPHB 5KCOA 2GXGA 4HCBA 4BDZA 3MQ0A 3HL2A 1H8AC 4RB0A 2QA4Q 3ER0A 1ZK8A 1KQ9A 1AHDP 4II3A 3I0TA 2JS0A 2LJ0A 2RNAA 1K73C 3PO2J 3IP4B 4II2A 3QIIA 2F5TX 1GV5A 1JKOC 2L7FP 2FNPA 5KAIC 3S1RJ 2HTJA 2JN6A 1YRNA 1AZGB 1N27A 3OBYA 3ULRB 3SWNA 5LJ3h 1KD1U 1UGQB 2JA7J 2QXFA 1P6RA 1WDXA 2D8HA 2GLOA 4DBRA 2UZKA 5L3DA 2PVDB 1R1VA 1Y0NA 2EYWA 4PZJA 4OMFB 1YIJQ 3J7YJ 2YUQA 4F7UF 4V19K 3RKXA 2KRNA 5CK9A 5EZHA 4ZDPA 1KYWA 2K27A 1T2KA 3S2HJ 5KE3A 3R0JA 2OX7A 4QQ6A 1JUMA 4LLLA 1YW9A 3NHNA 3FRNA 4KIBA 5GAN5 2CSOA 3TO6A 1M2VB 3EDPA 2B9SA 3QOPA 1NPPA 2NUPB 2OTJT 2NS0A 4FT8A 4R79A 1QVPA 1LJOA 1RL2A 2GGRA 2KFDA 4HSRA 3VYRB 2G9WA 3LQQA 2HYGD 3T0YA 2L9NA 2CP7A 3F0CA 1VQMI 1L3LA 1ZX6A 5D5WB 2XSDC 3OR2C 2A0FB 3N97A 2YRCA 3RPQA 1WHGA 3K70D 1NHAA 4RG2A 1PP8F 2DT7B 2M34A 3PIOF 1S29A 4RCCA 4QSHA 1QZEA 3NMZC 2QKLB 3O6BB 3J81Z 5J1RA 1FOKA 1Z7UA 3A8HB 2EFOA 3CCUT 4IO9F 1JXOA 2L5QA 4A6DA 1SVLA 5LRSA 4UNOA 4ZN3A 1VQ9Q 1HA8A 4DZJA 2RK1A 5D4RA 2ENMA 2O01E 4ME7A 5B1AH 2R93J 1OLTA 1QCFA 3RQ4A 2VXZA 1A5JA 4RTVA 5GMKe 3PQJA 4C92D 2O3FA 1G3YA 2PU9B 5IY5H 3G4ST 1O7LA 2DILA 3NARA 4LD5A 3EH2A 2DL7A 1IUYA 1M1EB 2MF2A 4YG2F 5FU6B 3CCSQ 3CCVT 4GXOA 2A07F 4BY1J 1OCRH 3E9FA 2OTLT 5CAIA 3CXCS 1OPCA 2L2PA 3CDHA 2X51A 2WY8Q 4XOPA 3H5RA 2PN6A 3CQTA 2KROA 4Z88A 3EGDB 2BV6A 1LFPA 1Z91A 4KN7X 1H0MA 4N0AA 5GANe 1S8NA 5A0GA 2E64A 1SFKA 4FISA 2V9KA 1FT9A 2W10A 4LUEA 3L42A 3CD6T 1JTYA 4EIKA 4N4HA 4WCIA 1GV2A 2HI3A 4A5MA 1BN5A 4RM3A 3OS2A 1WJEA 3E7LA 2CUEA 3EG0A 4FSSA 4AG1C 3G6EA 4E7IA 3B02A 1LNXA 2FUG2 2V7FA 4B44A 1NEBA 1FOXA 5FD6A 4P5NA 1OJLA 3OY9A 2W57A 2DOAA 1D09B 2PMZN 3C4SA 2A05A 3OWTA 1U8RA 3VS7A 4XTUA 3HUGA 4Q4ZF 4I6ZA 3CBOA 2K3PA 5FKOA 1K9MR 2DU9A 1S7OA 3ABTA 2R5MA 3OYNA 3FXJA 3QP6A 1SEUA 4XU0A 2VKHA 2WAFA 1BJZA 3HRSA 3ZRGA 1ZSZC 4PFZA 3OYKA 2HL3A 3RUXA 3A2KA 4E70A 1YX5A 3I59B 1EH7A 4PDKA 3ZMSA 2KRHA 2XGCA 2KDZA 1B72B 4ZYAA 2EK5A 4R55A 4FE4A 2R5YA 1VQNT 2DCEA 2JPCA 3CCSA 1TZLA 1I4K1 3BDLA 3QZ9B 5DEQA 4BUGA 3FMQA 2LQWA 3AFHA 1YHQI 3CC4A 4XQFA 5F1RA 5K5OA 3EFSA 5C4XJ 2LY9A 2H8WA 1DP3A 4J9GA 1JRIA 2Z99A 5GAOq 2G7UA 3ISPA 3BG3A 2EFIA 1Z6TA 3GZ6A 2NLUA 1RRJA 3ECHA 3UA7A 1U5TC 2DA4A 2L9SA 3WGGA 4YFNF 5CKTA 5DS9A 4WCGA 3CO7C 1RLPC 2EJFA 4RMOA 2CYYA 2ZPBB 3T5XA 3ZQLA 1XS9A 2SRCA 5FRNA 2ZFWA 4Y13A 2E65A 3QZ5B 4XU1A 4DBHA 1WPKA 3Q1JA 1B34B 1EJ9A 5FRMA 1NBEB 3A02A 3A8LB 5DLQE 2LCCA 2IIMA 4HQMA 5GADJ 4M9ZA 3H3UA 3KYDB 2FXAA 4HLYA 3CC2I 2LNVA 2ZGWA 2HKOA 3KEOA 1ACIA 3QQAA 2H6BA 2ACJA 4CUGA 4DYRA 1K4US 4JX4A 1RAEB 1AZEA 3EH1A 3MEUA 2ID6A 3QDRB 3CZ6A 1Y96B 1OX9A 3BY7A 3CCQA 3B6CA 5D5XB 2RH2A 2EQRA 2HWVA 1UDLA 1MD0A 2DM1A 1A35A 2JUFA 5J47A 1PUEE 2VB6A 3CCEI 4L0ZB 3J81R 4M78C 1A6IA 1R8OB 3DB4A 1BB9A 1Z05A 4CCLA 3WU1B 2MAMA 3QWYA 2E1MC 3PL8A 2J06A 3TO7A 4U7DA 3FMRA 1X2MA 4JQFA 2E36A 2HXOA 2I2LA 3NTKA 2NOGA 4J6WA 1XTDA 2KISA 3BR2A 5FKNA 1W4MA 4J8OA 5HNFA 3DWLE 2XVCA 3X25B 4C8QE 2V1DA 3H0GJ 2ZBKA 2V8IA 2WAEA 1WQ7A 4IUTA 2M51A 2P5VA 5F64A 4CC4B 1VQ8A 5IT9Z 3QKJA 4EATA 3H35A 2IA1A 2M9UA 2J6KA 2JTEA 2VKVA 1U3OA 4NC8A 1IXCA 1BCOA 4EM1A 2EZHA 4XRFA 1Q82U 1G5VA 3HRUA 2JUCA 2LVSA 2K3FA 3UDCA 4EV0A 3LSRA 3G71I 4HX4A 1E3PA 4J7IA 1W2BA 2DN0A 3D5SC 3FF5A 3GW2A 1ZG1A 3X26B 1AWCA 2UXXA 1BW5A 4Z6YA 1OR7C 2IXSA 3CC7I 1T3LA 1RPWA 3F21A 4J5YA 2DOFA 3U23A 1ZGWA 4M78B 1UELB 4PK4A 2UWMA 2QCOA 3REOA 5HODA 4A3GJ 1UHSA 5FLXK 1Y0MA 4JLGA 4BI8B 1BW6A 2XAHA 3DKXA 2DRKA 4Y7NJ 4QVCA 3ZMTA 2LTPA 4MLOA 2QBYA 3A1YA 2ZSIB 4KJZA 3FX3A 2BHZA 4MGRA 5F08A 4KGXB 4LGWA 3KP7A 4M77E 2M8GX 3BDUA 4G12A 4OWRB 2DBBA 4CC2A 3P8BB 2W85A 1XJWB 1MJ9A 3I58A 4AIKA 2EJGA 3HYIA 4PCQA 1M8VA 2ECCA 2EB7A 2LBFB 1P4AA 1MGTA 2YSRA 1SKUB 4NNJA 2Z9OA 4BXUA 1EIFA 1GLNA 5BMZA 5FB2A 3M9QA 2AZSA 2DK8A 2EFQA 2I8DA 5JLXA 1W0TA 1FYMA 2A28A 1VQ4Q 3GFLA 2YRDA 1FIPA 4ZGJB 3HXLA 2AS5F 4KITB 2EINH 5HK0A 4BH9A 1LFBA 3H5AA 3PNVA 4EQQA 5JI6A 2VUMJ 1WJRA 2E1OA 3CPFA 2ZPFB 3DF8A 4LE9A 4M75F 4M75A 1QP3A 2V9VA 3HKZA 2LY2A 2HNHA 2HKQB 4DZPA 4RTTA 3Q9VA 3M4YA 1ZBJA 1KGSA 4CZCA 1LDJA 1KONA 2ISZA 1TC3C 1E17A 2DYBA 3THKA 1YITQ 1PC0A 5FJ8J 4IHXA 1TTHB 4J6YA 1OQKA 1WQ2A 3IWZA 2DMNA 1V29B 3NGPA 4PLLA 3VJPA 2IS1A 2GTOA 2VQHA 2JS2A 4OP0A 1YFHA 2LRQA 2L3DA 2FOWA 4Y4RA 5E1XA 2COYA 2LG4A 2G6FX 2V1RA 3C7JA 4MZTA 1TUGB 4XM3A 4BD3A 5KVRA 2O9SA 1ZREA 1MZBA 5GP9A 2XDBA 1MMAA 3F22A 1A31A 4L0YB 4KISA 1A6QA 2IA0A 1YJWI 1GUUA 3CJRB 1T0JA 4UC4A 3FLGA 1UHMA 4KIGA 2W00A 5LEKA 2Z33A 3H3VK 5CR2A 2WAQA 2QAZA 3FC3A 1Q7YC 1U0JA 2DDAA 2KQRA 3I64A 5A2QZ 3LNQA 5BPIA 4A3JJ 1LKXA 2WBMA 3N05A 3W3CA 4S04A 2F2WA 2VXFA 4OMNA 5KHDA 2YUOA 4AU7A 2DFEA 5D6FA 3RKYA 1P4XA 2EGCA 1IN4A 3WTWC 2VWFA 4L59A 2O7OA 2X6OA 2NVYJ 5HCKA 3F9KA 5CYVA 1XMXA 1S72A 3TU4K 2CQNA 1NLOC 3FDRA 1Z67A 4J9CA 1Q86C 2VASA 2R7OA 4LDXA 2EGAA 2HTSA 4BS9A 2HDAA 1QVUA 3HSRA 2K7AA 2XI9A 3KLOA 2NVTJ 5J6XA 1UE9A 2RQWA 1VQMQ 3MHXA 3UT1A 2DEUA 4PJOA 1ZSGA 3FISA 3WU0A 4UY8I 5ICCA 1ZQ1A 2CREA 5KYYB 1F5TA 3MZYA 5I2MA 1X58A 2E5KA 1QVGS 1WHUA 4BHCA 1F4KA 1ON2A 1SVMA 2CH0A 2K79A 2ZPEB 2KDOA 5HDGA 1W2BP 2A61A 1LVAA 1G3WA 2H94A 3K4NA 1R49A 2NUZA 4NBQA 2ECBA 1QWEA 2KSSA 2VV5A 2M0MA 2HOTA 4OMQA 2J5PA 4LDYA 1QO0D 4HG2A 3JRIA 5KH6A 1PNJA 3CUQA 4XRSA 5CQEA 4RKUE 1WHJA 4GO1A 4BI3A 1V3FA 5CVVA 4M7AA 3DLAA 5BS6A 1R4NB 1OZ3A 4ZN1A 1MW7A 3OV8A 4CGZA 1SFOJ 3EAEA 1ONVA 3KBGA 2IGMA 2JSPA 4L5JA 2HMAA 2RQPA 1BR2A 3EUHA 1G2HA 1UJYA 2PI0A 3OW2S 2QEXI 1VYUA 4M6XA 5HLGA 2H1LA 3O8HA 2EILH 1T8IA 1RAFB 2RQRA 2DQRA 1P7JA 2E6NA 3RR6A 1K8AC 2HEOA 1BYMA 2AT1B 3L2WA 2H09A 2VXDA 2P4RA 4B09A 1VQ5A 1JHHA 2OCCH 4C2MJ 4JBAA 2HYJA 3BCAA 3GUDA 1IZ6A 5C0MA 4HPQA 4YEJA 3R61A 4D9JA 2IP2A 5JR3A 4RB2C 1QQJA 1ZARA 1MGQA 1FP2A 2DJIA 2FMLA 2R7FA 3OL3A 1RABB 1HLVA 2QG9B 1WZOA 1PD0A 5JLWA 4Z02A 5TRDA 5IT3A 4C2UA 4RBOA 5L3CA 2R0QC 4BBSJ 1RAIB 3N5BB 1VNDA 4JJDA 2OV7A 1GXIE 3OSFA 2V4JC 3LSPA 3DKYA 2AHJB 4BEHB 4FIBA 4AD9A 2AQEA 3BTCA 3G73A 3EGUA 3CCVA 3D5RC 2E60A 2TRTA 4I09A 2XPWA 1U8BA 2PVGB 4HVUA 1O4XA 1ZLJA 1VQOA 2OTLA 3I35A 3WGHA 2DA1A 2X85A 4EJUA 2J7IA 2QVOA 4OMMA 5J3BA 1K4SA 1DPUA 2OZ6A 2BYVE 5GMKh 1WZ2A 1F43A 2X1DA 1IREB 1X3WB 3ZBDA 4B1RA 1R9TJ 4RUGA 1Z9ZA 3HPWA 3MO8A 3CD6A 5CLSA 1LE8A 2O2OA 4FT2A 4A0ZA 2GIVA 5JFRA 2BW3A 3MEVA 4MZMA 1IRXA 1XSDA 1M9SA 2C0TA 4CYCA 1I5LA 5GAN3 3GEZA 3DEUA 2VQCA 3M57A 3LH5A 4NL3A 2K9GA 4MFDA 2QWWA 1J2XA 2K86A 1NLPC 4RTUA 3REAB 3VKIA 3QDFA 3E6DA 2K3XA 1T0FA 1XGSA 2XK0A 3F70A 1YHQQ 1V4RA 3QO3A 4W97A 2A6EF 5DD4A 2D2WA 4XSXF 2CP3A 1NYGA 4RG8A 5GANh 3FM5A 3GFJA 2QK0A 4A63B 1N78A 2EV6A 1YJWA 3ERED 4LB6B 4F16A 5A2QR 3KP3A 3W6KB 1RR7A 1JJ2S 2LKPA 3LSHA 5GAOm 3S8PA 5LGUA 1CSKA 3H92A 3FJPA 3KP6A 2Z5UA 1OPKA 3REBB 2O5RA 1AKHA 3CJTB 5LJ3j 5DCMA 5EG0A 2CZ7B 5C6SA 3BG7A 4A3EJ 2DJQA 4F7UE 2L3QA 4M3FA 3P9IA 1UFMA 1OQYA 2IVMA 3UR3C 2WACA 4OIPF 4XTXA 3EQLF 2W84A 4IOCF 3TKYA 1M1KC 1VQNA 3OSGA 4MTEA 2VBYA 3CC2Q 4Y92A 2K5FA 1RI0A 1FY7A 1W5SA 3PIPF 3FXQA 2DNUA 3I5UA 2LY1A 2QQBA 2B7EA 4OIOF 2IVWA 5DUIA 2DKGA 1NG6A 4Y17A 1MMGA 4QPQA 4EM2A 1YP5A 5IYBJ 2Y4XA 1U1SA 3CCEQ 1D3BB 2ISYA 5F27A 5M5XJ 2LREA 4C0DC 1M30A 4NUBA 1OULA 2L3SA 1TT0A 5AIPA 3HZJA 4C5EA 1Q7YU 3HEFA 2JK3A 4V2FA 3GNGA 4M78E 3K70C 1UGVA 3PVQA 2GQVA 4NC6A 1X1PA 3ESWB 5IP9J 2BKDN 2ZMEC 1YFNA 5F0FA 3BQZA 2QQ8A 2VBZA 5F6FA 1U3EM 1U06A 4IVNA 5I22A 1Q86U 2VUBA 2XGEA 4GFBA 2XDVA 4LK1F 3CCST 1X3UA 1GBRA 3TEDA 2RQQA 2R58A 2ELHA 3SQNA 5GMKm 1GL5A 4RB1A 4I2OA 3M5AA 2KIMA 4Y52J 4KMUX 2XV4S 5DY9A 3VSLA 1PD1A 4BKXA 2LKSA 4LFUA 2KP6A 2VLAA 3O8GA 3CCRI 1TWHJ 2EWNA 2PJRB 4C92C 2LNHB 2FNAA 2LOOA 5J1UA 2M30A 4BJ6C 1NG2A 3SHWA 1ZN2A 2BVLA 3JCMQ 2BZTA 3G71Q 4EJOA 4OMZA 4BJ5C 2KIUA 3M53A 1FSEA 1XX5A 4MHGA 4GYGA 3HTRA 2HZDA 3LSMA 1SHFA 1FBQA 3CC7Q 2F4IA 3HIFA 1OCPA 1AOJA 1WJSA 2KAFA 2BXZA 3MKWB 3WTVC 2ZCFB 2VBWA 3BROA 2MYSA 4ENMA 4C0DB 2DI3A 1TWAJ 4M77A 2FBIA 2H1KA 1B7TA 1S6LA 3EG2A 1HW1A 5CKDA 1O57A 5GAOl 3RKQA 3HGGA 1H3HA 1YWPA 4RLQA 2QA4A 3JRFA 3VYUB 1R77A 2VC8A 2ZMEB 3FXKA 1OYYA 2DA2A 1KK7A 3DPTA 4FCYA 2FPEA 4EJVA 2CYZB 3MCAB 3CCQT 2YPRA 2VKEA 1V5GA 5TISC 1Y8QB 4DQ2A 1UB9A 5J4YA 1E3OC 2MK5A 4IKFA 3G1JA 1UG1A 3SD4A 4EJWA 3ZL7C 1IZ1A 1Z3YA 1P7IA 1YIJA 2C06A 1KHCA 2VBXA 3U21A 1B6AA 1B8IB 2KE9A 2P0QA 2FL7A 2RREA 1TW3A 5LHHA 1TNTA 2CKKA 3ZFJA 1G4DA 5I2SA 1RZ4A 4C92B 1MKMA 2A6HF 2DFFA 2L02A 2WA0A 1GXPA 1C0WA 2DXIA 3RZOJ 3EFOB 3MPUB 1KQ2A 3JCMb 5GAGJ 4GDFA 2RF0A 2DJNA 3BTIA 3CCJI 4M7DF 2XC7A 4QKUA 2CQXA 2NUPA 5ILVA 5ICGA 3NTIA 2Q2EB 2CW0F 1ZHFA 3BPVA 2EZLA 1YG2A 1FTZA 3HL8A 1M90R 2JSCA 1MBGA 1SAUA 3K7AJ 3GBGA 1GHCA 3ZQGA 2GXAA 1LPQA 3KP4A 4UUVA 2JZYA 1VA7A 1VQ8T 2EZKA 3SEQA 1O3QA 3JTHA 2RV8A 4RTXA 2JN0A 2F48A 2LK2A 3RPUA 3TOBA 4Y28E 4XN3A 1IGUA 4BAYA 2LC2A 5HS9A 4CCJA 1TQMA 3H1CA 4PJMA 4S05A 1ZH5A 3X28B 3W2AA 2RJCA 4K2EA 1TOVA 5GMKl 3IRQA 1IHWA 4JPBW 4WF2A 1SMTA 3BR6A 2FBHA 4RA2A 3FB9A 1YJWQ 3P9CA 3LQRA 1KZHA 3IQLA 3X20B 3BTJA 3HSFA 4G94A 1F9NA 1HKSA 2BE7D 5E8IA 4F92B 5HS8A 3DTIA 2XUBA 3WTXC 2C0OA 3PNTA 5K7FA 4XLAA 3TW7A 2CSQA 5GAN2 2FPDA 2CS3A 3AG2H 2FU4A 2DFHA 4XMYA 4EMKB 2X6XA 4LG3A 2LLKA 3LOCA 4HCCA 2DA7A 3HC7A 1HCRA 1OEBA 1X01A 4BQQA 1WXUA 2CT3A 1VF9A 3M0UA 2F5FA 4HLXA 2K57A 2RJDA 2V8KA 1EX4A 3HOTA 1T08B 1K0SA 4NQWB 1K73R 4JOMA 2MFZA 3ZP5A 4BY6B 3EGDA 3H3ZA 3SEMA 3UATA 2K02A 1MBHA 2IW5A 3MAJA 4U7BA 2X0LA 1NK3P 1PRMC 3OYLA 1A0NB 1M1KU 3WE2A 3MP8A 3GPLA 1YW7A 5DYMA 4ZNXA 3OYEA 3PNWC 1MDMB 1CGPA 2K6DA 1POGA 1KA8A 4G6TB 1HQCA 3MMYB 2EBPA 5FU7B 4XLFA 1ZLKA 1R5HA 2CFXA 1BI2A 4AFZC 3F6VA 2Y90A 7AT1B 1H8KA 1M5Q1 1M1FA 2GBYA 4IJAA 4L18B 2RQVA 3IAS2 4CRIA 1LVKA 2YWWA 3X24B 3DFGA 3TMOA 4C8QB 5CQGA 3DU6A 2ATCB 5FGMA 2EPFA 1ENHA 2JJ7A 3K4CA 2L2OA 3HOUJ 4M75D 2KMUA 3OIOA 2AQFA 2JTMA 4ZZLA 2EA4A 3MP1A 1N8RC 2QM3A 3A0HC 3F6OA 2XPUA 2AXLA 5FKKA 1NH3A 4IHTA 4KGVB 5IXFA 1K7AA 1CQTA 1JJ2A 2E34A 4ON0A 3MKZA 1IDYA 1XC5A 2JVHA 3BR1A 2L0AA 2DL5A 2QEXQ 3E2UA 3I59A 1AWJA 2IGOA 3A52A 2CUFA 3JRBA 4A3IJ 1DJ7B 1B72A 2LMDA 2Y0SA 3HTUA 4A54A 2CH4W 3CC2T 3E6MA 2DOEA 3SHFA 2X4HA 3L1PA 2R92J 1FOWA 3I4NJ 4J19A 2JVVA 3M8FA 4EMSA 3A8MB 2XAGA 5D6XA 1WJCA 4I76A 2CV1A 1GCQA 4KUIA 4D6WA 4RMNA 5KK1A 5J1YA 1IUFA 1PM3A 2X3WD 1YS7A 4M75G 2RDPA 2HQ5A 4YIIA 4WX9A 2K4JA 4X1EA 2VN2A 5I11A 2GOXB 1WX6A 2NS8A 3S93A 1YJNI 3F3XA 1WJBA 5JHUA 5GPCA 4OMYA 2P0TA 1V1CA 2CUBA 2YU3A 3WE3A 2D9TA 4LDUA 5E17F 3OSVA 4MMKA 2EGEA 3I55I 1R23A 1UGSB 2DL8A 2WTEA 1N25A 1X43A 2G0EA 1QU3A 1N9SA 1T98A 2R7ZJ 1LQ1A 1BR4A 3FXMA 3OYCA 1T38A 2HKNA 4BE2A 1R58A 1B34A 2E3HA 2IAIA 2E6ZA 1FMVA 4F17A 3O8VA 4QT7A 2EVRA 3QG1A 5M9OA 2IS6A 1QVGA 4XKBA 1TUDA 4C2TA 5AONA 5M5YJ 2M1BA 2KT1A 2QASA 3AL0C 4LUDA 4XIDA 3VU3C 4E2FB 1QA6A 1Y96A 2HQAA 1EH6A 1BOBA 2AK5A 5IHNA 5FLXE 4JRKA 4XK4A 4C3IJ 3QWLA 4JYKA 4YFXF 2D8JA 3V7SA 2XRNA 2FB7A 1X69A 2DVEA 2QQSA 1SD4A 2GBQA 2HZYA 4NOYA 1WJ5A 4RB3C 5KYXB 5GAHJ 1P9QC 2Y48A 3ZQQA 2V1QA 4KH0B 4BYYA 4AM3A 3SYTA 2EW3A 1FBSA 5E1ZB 3GTJJ 2DXTA 4FSXA 5IT9E 3HGYA 3ZEHA 4D0PA 3TREA 2KK4A 5EZGA 4LG0B 1YN8A 4ANJA 4MO7A 2KEAA 2VPRA 3J7AW 1YBYA 1KU2A 3U1DA 3GTLJ 1Q82C 2EFWA 3V8KA 1VOMA 4PJOG 4M7AD 3CCLI 4C5GA 3OOUA 1JEGA 5EEHA 3T8TA 4P55A 1VYTA 4HV6A 2CP6A 3D7SB 2VT3A 5E3MA 4U88A 3TOAA 3VB2A 2LF8A 1TNSA 1VQ5T 3FKIJ 1ZHIA 1E2XA 2KYBA 1FSHA 3BC8A 4AT1B 4HSTA 2HFHA 4E6KG 3A4CA 1HC8A 3E5XA 2ETHA 3I56T 1I39A 2UV1A 4B48A 3AL0B 1IXSB 2RQUA 3H6ZA 4IRHA 3JV3A 2IPOB 1YI2I 2DBMA 5A0LA 2MI6A 2E7XA 1D8JA 4F52A 4XRSG 4MNUA 4GY5A 4HA8A 1V5FA 3GZNB 2AZVA 2DLPA 2PUOB 3M0SA 4L5IA 4CC3A 4M7AG 3AG1H 1HOMA 1Y07A 2ROTA 3ABUA 5HLHA 2QSHX 4M78A 3RNJA 3PJRA 2EV0A 1VQOT 2K4YA 1Z7LA 1GVJA 3J81K 5CCAA 2JMWA 2KDSA 2DYRH 3LWFA 1BCMA 3SDGA 1XMAA 3CCMI 3GYHX 2L54A 4NHJA 5FROA 1T56A 3V4GA 4RTYA 1VZ0A 1ABQA 4D7NA 4WK8F 5KYNA 5H20A 1PUFB 2VKNA 2JMCA 4IEJA 5B5EC 2L3RA 2A7YA 2O88A 2CWEA 1G83A 1UHWA 1R36A 2H8HA 4KGZB 1WHLA 2D6FA 2LBFA 5M3FJ 2VOOA 3GF5A 3KLNA 2J5OA 3TL4X 1RAGB 3GBQA 1PWTA 3OS5A 1WRJA 6PAXA 4PL6A 1VQ4A 3I5SA 2XSJC 1NG7A 3E1SA 1W7PB 5F0CA 4DYQA 2EPDA 3JCMg 3CCRQ 3QWXX 5AYFA 1X6OA 4HF2A 2YLBA 2CW7A 1WH7A 1Z21A 3DCFA 3OMYA 3Q0VA 4RAZA 1JKPC 3N4MA 3ZGKA 5E3NA 1HSQA 1TWBA 2E4HA 3BG9A 2P0KA 2VE8A 4IIMA 4J6XA 4C92E 3H41A 1VIEA 4N0BA 2KI7A 3AT1B 4IF4A 3M58A 1YITA 2DDBA 4HKEA 1IV8A 2CV0A 2FBKA 2O6GE 5E79C 1OR7A 2X6YA 1O75A 2LF7A 4HOBA 1V55H 1ETXA 1WXTA 4AMCA 3BW1A 3JCMf 5EYRA 3IC7A 3M0TA 1QVGP 1DGWY 2E35A 3E19A 1KQSS 5GAN6 2ESNA 2F5CA 3EGXB 1AT1B 2R7VA 4ELZC 1B59A 1N8RU 1G2BA 1JKRC 4IUVA 2L01A 3SWNC 2LYCA 2OBPA 4MDXA 2AIRB 2F4OB 4HX7A 1DPRA 1M3BA 4I0AA 3RBBB 2RN7A 4LIUA 1Y56A 1T0HA 3HTSB 3RCOA 2EH3A 4XSZF 3RDVA 3WVEB 3G3ZA 3WHBA 2CS7A 1WH5A 3DBLB 2W0ZA 4DOZA 1H89C 3DV8A 2D0QB 1JXMA 5GMKj 1J09A 2JM8A 5H6RA 1GFDA 5EEGA 2E2JJ 3HHGA 2KIQA 3K4BA 4Y33A 4A69C 3CCJQ 2I0NA 1DGRM 3DU5A 1ZSZB 3CTAA 1VQKI 1ZGJA 2GWRA 3NEUA 2BZXA 3FK6A 4S0HB 4A3BJ 1VQMA 2JQ7A 3X2QH 4P9FA 4JX6A 1SC7A 1GT0C 1RR8C 3L2QA 1U78A 3E3VA 1I5OB 3EHRA 4R0KA 1RAAB 2VC0A 1HSTA 2L89A 1F1ZA 2ADUA 1WSUA 5KYYA 1PDNC 4AC0A 5IXBA 1HW2A 4KT6A 3CMEI 1JBMA 2F2XA 3L2ZA 1QGPA 1OCTC 1YJ9I 2STTA 2J6FA 3C1DA 1K9MC 1FP1D 2RHZA 3G1MA 4XBFA 4U0VA 3ZN1A 3NWSA 1W1WE 4DNCA 2R7RA 1TSFA 2RPNA 1Q81R 5K5QA 1C6VX 1FWZA 1QLYA 2RC4A 2FVUA 5EC7A 4F7UB 2K3BA 1U5TB 5L8RE 3C2GA 1Q1VA 3HM5A 2WADA 3G1LA 4Z2YA 2QF7A 2LCSA 2O4XB 4IUPA 3D1NI 2JXBA 3NPFA 3META 2HVQA 3J7AF 1Q1HA 3BT9A 1Z6RA 1MBFA 2OZUA 4OIRF 1SVOA 3RDIA 1K8AU 1YOVB 5HDNA 2GFAA 3HP9A 3HPHA 3LA3A 5FKLA 4A3MJ 3M56A 3OA6A 2QA4T 3CMYA 2LDMA 3VS2A 2EIMH 4MIMA 4E7JA 1ACMB 2PMZA 2BXYA 3F8MA 2LT1A 2OPTA 2GQQA 2MG4A 2XF5A 3ROUA 2O8XA 1WI3A 3L9FA 4IHSA 2LQ8A 1YIJT 2KIFA 2LH9A 3RERA 4DOVA 1X4OA 2BZ8A 4Z8AA 4IPAA 1I3AA 1SAXA 4E7SA 1KU7A 1IAWA 2ELJA 5E20A 2A08A 4FYYB 3KFWX 5EF6A 4HVVA 3ML6A 2KYMA 1JJ2P 4XLPF 3M54A 2W25A 2I10A 1ON1A 3DXJF 3P7NA 5BQTA 2E1MB 2E1CA 4FYWB 2Q1ZB 1X2QA 4XORA 3E9GA 2QGUA 1RKTA 3SFMA 4CHUA 2FX0A 4CYDA 1CF7B 1EZZB 5BOXA 4F14A 5IAYA 4BEHA 2RHXA 1R00A 2P6TA 1O3SA 2OTJI 4J7FA 4M77G 4A2UA 1MIJA 2LMJA 3FBNB 2FOKA 1Y8RB 5IT9K 4M7DD 5LJ5e 3Q9SA 2MVTA 3J80E 1VYVA 4W1UA 2A6TA 3JRAA 3BOQA 4XR6A 5GAMg 5K1YA 3PQKA 3JAME 1J9IA 4ZGDB 2P5LC 3VFZA 2P4WA 2IJLA 4LDVA 2O9VA 2VXEA 2CUZA 2MA3A 3CCUI 4HT8A 1RKWA 1F1BB 1RI9A 1VQ9I 4F7ZA 2HD0A 3VUZA 3ABLH 4KICA 3A98A 4F3QA 5IOYA 4CI0C 2BGCA 2DD5A 2MC4A 2DTHA 1G3SA 2OJED 3RPUD 3EG9B 3P8DA 5GAMf 4X0GA 1M27C 3DEEA 2YUNA 1YHQA 1Y7XA 2MABA 2P6SA 4PSXA 5KYUB 1X19A 3UA6A 1YLFA 3CPWA 4M7DG 2GNCA 2KR3A 2RB6A 1G3TA 3E97A 3OYJA 1ZQ3P 4U0WA 4XLNF 1YJNQ 2MOXA 3PM1A 1XGOA 5GTHC 3G4SI 2KNBB 4CA0A 2FG0A 2OI3A 1AEYA 1TTYA 1X1CA 2F5DA 5KYWA 3JCMJ 3I55Q 3OIQA 5EGOB 2QDYB 2DMOA 2RHIA 5HLIA 2FRWA 1IDZA 1D1AA 3BR3A 2KRMA 2EIJH 3OYYA 4NC7A 1HSJA 2JT4A 5JVTA 3QPTA 4ESFA 3H9NA 1S3JA 2AXTC 2NYXA 1IJWC 2DXUA 3CC2A 1K78B 3TSWA 4OVAA 2K9NA 2PEXA 2XICA 3GZ5A 1JI8A 4HZFA 1U6GA 3R0AA 4AFUC 2HU9A 3ZN0A 4DYCA 4E7KA 1UGRB 1GRIA 5K5RA 2M2EA 2RI2A 2V8JA 1QNTA 2KBTA 2PVOB 4PGGA 1RETA 4IIOA 1UEBA 3G2BA 4H4KC 3CCEA 1D0ZA 3HDDA 1VFCA 4N9IA 1D3BA 3SJMA 3P8HA 3CMEA 2VJIA 3I3LA 3LSJA 5FD5A 4UV8A 4B3AA 4PLIA 1O7FA 1APLC 4LLNA 1B9NA 1QKWA 2AKLA 2EQMA 2RJEA 2FZCB 3PT9A 5GAOn 1NJIR 1Z77A 3H0FA 2XKOA 1W36D 2HVRA 1TL8A 4XRMA 3GTOJ 1K76A 1VQ6I 3PFSA 3L7WA 3CP8A 4PJOF 2HR3A 3OYAA 2JOYA 2LDUA 1JGGA 3QU6A 2XAUA 3S1NJ 4AUXA 1ZRFA 2K9QA 2COMA 3C18A 2HSPA 4A53A 3CCLQ 2LP0A 2HQEA 2MD5A 4AIDA 2OAUA 3ZQ7A 2ME0A 2RVCA 2O8KA 1PHTA 2HQNA 3SFIA 3JR9A 2E70A 5KYWB 3P5JA 3KXTA 3JB9H 2MWPA 3LSKA 1J5YA 4Q48A 1QW1A 2HSEB 2X4WA 4LNPA 3WVDB 5IN1A 4C5IA 4FHTA 1FYLA 2ROLA 1FXXA 2PJRA 4HCZA 2OQRA 3GCMA 5I21A 3ZQHA 3H0IA 4YELA 4OGCA 3WTUC 5IH2A 3G71A 1R4MB 4BL0B 4M7AF 2Y75A 4G9YA 2M35A 1YI2Q 1ETOA 2IS4A 1W5TA 1KQ8A 1K9MU 3ZMUA 4ESRA 3M8EA 3H0DA 4FU6A 3CC7A 1WI7A 1BOAA 4PFPA 4RDUA 1OCZH 3VYGA 3TW6A 2DO3A 4RTZA 1IN5A 1U1TA 2YX7A 2MLGA 4FYXB 4OGEA 1WXBA 2LNBA 5FLVA 3KEYA 1BA5A 1P4WA 2BIVA 4C0FA 4D8DA 1J59A 2EJ9A 1OX8A 4BJTA 2BEOA 3I9V2 2WWYA 1QWFA 4IQJA 2KHMA 1VIFA 3MVPA 2MC3A 3S1MJ 4RS8A 1A36A 3GXOA 1ETQA 2XGXA 2ZMEA 5JVGF 2HGCA 2HOSA 1K83J 3LFUA 4B9XA 4A4EA 2RNJA 3ZQFA 2DYSH 1WNLA 2KRCA 2DTOA 5K7ZA 3V8LA 5GANd 4ELYC 1KU3A 4M9SA 2IS2A 4N9HA 4BI4A 4OMPA 5ERIA 2P5KA 4B9WA 1WJAA 4Q5SF 1KFZA 5EEAA 3GVAA 3GLLA 1B8IA 3CPWP 3CCYA 1H641 4HF1A 4A3DJ 1OYXA 2F2VA 3TEEA 4BHPA 4M75C 1MBKA 1QHGA 2CW8A 4IHYA 4C92A 2PMHA 2EKHA 3JCMe 3EFOA 3MCZA 1YCYA 2GCXA 4I98B 1I27A 1SRMA 2DE0X 2EYZA 2KJBA 2Q2EA 1FMKA 4XTWA 4ZYDA 4Y3OA 5DUKA 1R71A 4DA4A 1BBZA 2EFNA 4V2SA 2QDLA 4N4IA 1R0CB 4BNCA 2RGVA 1JJ6C 4UUSB 5IYCJ 2BY2A 1OV3A 4BE0A 2YXYA 2RHYA 4RM2A 1SEMA 4J9IA 1K61A 2FZKB 3PSIA 3QYBA 4KULA 3CQZJ 3MEXA 2M45A 1SSHA 2F5KA 3V7RA 1XCBA 3BLYA 3M1CA 3U1KA 2LD5A 2ICWG 4FX4A 4JUVA 4BXXJ 1JHFA 1LJ9A 2XGDA 5LEJA 3NFCA 1NYFA 2RA2A 3A8OB 3Q3SA 2XPVA 1PCXA 4RAYA 2E3IA 3CDLA 4RCBA 3BFMA 4HVWA 3CXCA 2K40A 3BZ6A 3MD2A 1MBJA 5K7HA 4XL9A 1EA3A 2PNIA 1VQ7T 3RI4A 1X75C 3QXEB 2Y31A 4M75B 4E7LA 4MMLA 3OYGA 3A01B 3L2CA 1T33A 2FRYA 2FQ3A 4BUPA 3M0RA 3DBRB 3TQ7P 2KKOA 4EMKA 2L7MP 1YW8A 3E5QA 4IXAA 1TT5B 1Y0UA 4PJOC 3DLLA 3DLLF 1VQKQ 4QPOA 3BPXA 4EEFG 4J00A 1OPLA 5IOZA 2R4GA 1MJAA 2IPQX 2K5CA 3GLXA 4M72A 2ZO4A 4OAYA 4ZDLA 4NQWA 2BE5F 3SXYA 3U2RA 2GXBA 3WG9A 1V5EA 1HKTA 3BTLA 2DPPB 3A8GB 1ARKA 3FM3A 2JUGA 3WODF 3JAMK 2CO5A 1ZLMA 2LC4A 1VQ4T 2DF6A 1WVRA 1KD1R 3CMEQ 3GTMJ 5HY6A 1XD7A 1YJ9Q 1B4AA 3JCMP 1ULYA 5E3LA 2OC6A 3U9GA 2QLZA 4A6EA 4H0EA 1MDMA 1KJWA 2OF7A 2KY9A 3MEWA 2KPMA 2M9HA 3A0BC 3HOXJ 2V79A 3K1NA 1Y1VJ 2A3SA 2D1VA 3BJ6A 2DW4A 1YTYA 2A3LA 2C0IA 3QJ6A 2CP2A 1K9AA 1Y6IA 1YITT 5ED4A 3GTPJ 1UUEA 4M7AC 1VQ7I 5AT1B 4C8QA 2E5NA 3V42A 5GAN4 1ETKA 4A3KJ 1I81A 2EJRA 5C44J 3EUHC 3PE0A 3IAM2 3LA2A 3HOZJ 2PG4A 3JRGA 4LITA 1PKSA 3M0QA 2IGKA 4WXDA 5J40A 2KLOA 2XRLA 1UG0A 3JCMV 2DETA 2W48A 2OAZA 1TWGJ 3GP8A 2QEXA 5F0HA 3R6SA 4AIHA 3LAPA 3QYEA 1NK2P 3IWFA 1UTIA 1JE8A 1BI1A 1E6GA 2DO7A 1N9RA 2BZYA 3J7AY 5DM7R 3AG4H 4CO8A 5DLOA 2UXNA 3QU3A 2DAQA 2Z1DA 2W1OA 1TWCJ 5JHFA 2IT0A 3GNFB 3KETA 5ILUA 1GXQA 1OISA 3KZYA 3LSTA 3M9AA 3OYHA 2L3PA 2PZ1A 3IV5A 4JZ3A 2CRGA 4HEA2 4A5NA 3GFIA 2PUKB 5J39A 2P7VB 2VL8A 1FLIA 3MZHA 4XQ3A 4R8HA 4M77F 1XDSA 1X1BA 5HDKA 1VQLI 4ITVA 1BK2A 5FFXA 2BVMA 1I6HJ 1ITYA 1X6GA 1YWOA 1ZUUA 3CDIA 4UVCA 1W6XA 4FQGA 2OTJQ 1IO2A 2F69A 3G7ZA 2E71A 1T3SA 1IXDA 2EFPA 2GIZA 2DMUA 1VQMT 1QVFS 1HDDC 2X48A 2DPUA 3RYPA 2L9VA 2R7XA 3LSGA 4N4OB 3H9JA 3OOPA 4XLHA 4TVRA 1Y1WJ 2EYQA 2JNGA 3MKDA 2RN8A 3NTHA 3PSFA 2KMTA 5GAMe 3CCLT 5LJ5d 1S7AA 1SD7A 2V1XA 4DIQA 2X98A 3LW5E 1GCPA 1R0BG 3F8BA 3VSKA 1M2OA 4UHTA 2E1NA 4XLCA 2LVMA 2SEMA 2KXDA 3TGNA 2FSWA 4LOCA 3I9QA 3J81E 2DXCA 2R57A 3RTRA 1OU8A 3CO6C 2ZPIB 1QPMA 2W82A 2PJPA 3LH0A 2QGFB 2QSGX 4G8XA 4BQOA 1M2VA 3CXCP 4XTZA 5CKHA 2CQ7A 3GWZA 3I71A 3OYIA 3CMAI 2GFUA 2BBYA 3KIOA 5KYXA 1J75A 4O6JA 3LFKA 2DERA 3FK7A 1WIEA 4ZJZA 3ELKA 3OYMA 4WWCA 6AT1B 3HKSA 3ZOBA 4AG2C 4FW1A 5LBQA 2DRMA 2QZ8A 2GTJA 3G4SQ 2Z16A 3L2UA 1W2BS 2K7LA 3M3YJ 4DOWA 1T6SA 2P0WA 1T39A 2CGHA 3Q5FA 5EG2A 4FW2A 4VUBA 1PKTA 4XONA 1TWFJ 3TDZC 3M1EA 3I4PA 4QW2A 2HPMA 3KP5A 1MV0B 4CC7A 1ZRCA 1FIAA 2KL4A 4KMFA 1FTTA 3A5ZB 2EYYA 4G6QA 5CKFA 3GO5A 4KNYA 3SZPA 2QQ9A 3KP2A 1ZR4A 1STZA 1ZR2A 1SHGA 3H8ZA 4XU2A 2E5ZA 2EQJA 1I6XA 2NVQJ 1X6BA 4J9HA 1S9HA 2X1EA 3OL4A 2K85A 5GTIC 2MGQA 3OSSC 5HOOA 3UF4A 5TJJA 2M5WA 4HYEA 4L5EA 2R7TA 1HK9A 2CMPA 2J6OA 5J3LA 1XSXA 2J05A 1TU0B 3MZ8A 2NUTB 2HQRA 5D6YA 1PP7U 1VQ6Q 1K6YA 1OI1A 2ZXHA 5KNLA 2E2HJ 1RUNA 4M74A 2DA3A 3DPLC 4F55A 1SF9A 3ABKH 3OS1A 1VQPI 4OOIA 5HNHA 1GVDA 1PUFA 2LX7A 3QUIA 1J7KA 4E4HA 4B47A 5D7UA 2X35A 3IH2A 4ORZA 1REPC 2CUJA 2X1CA 3BG6A 2KQWA 3TSZA 3IRRA 2EYXA 5GAOp 1D0XA 1H9GA 3ERMA 3KX2A 3O3KA 2VKDA 5GAEJ 1FPQA 3CCRA 1YHQT 1W7PA 5TGTA 4D5CA 1HF0A 2V1NA 2ESHA 1SG5A 2Y9ZA 4JRIA 4M4ZA 2ZJPF 8ATCB 2DK3A 1M90C 4LDWA 2LJ1A 2GAUA 1QZZA 1ZTRA 3S3OA 1UFFA 1BBYA 2CUDA 4A4GA 2DK5A 1OCOH 3JREA 2XMFA 8AT1B 1NE8A 3VV0A 5E3OA 1IGQA 4EPCA 1HW5A 3BP8A 2JT1A 2R7WA 2LP5A 3E5UA 3MP6A 1W0UA 1FC3A 1R22A 4FTHA 2DA6A 2WSFE 4HXJA 1FZPB 3R6OA 4FE7A 2L7ZA 4G6DA 3OYFA 3GX4X 1FBUA 4OB3B 3NQOA 2R3SA 2OAWA 3EGXA 3DP7A 2YLCA 2OUMA 1WWXA 3K69A 4ZTFA 4IOAF 2JPBA 4A0XA 4B43A 2FQ4A 5CO7A 3RIRA 3SZGA 5H2FC 1VTNC 1VUBA 2EQKA 3G6EI 2KRSA 2DMTA 5BPDA 1PG5B 4ZH4F 2COZA 2FRHA 2X4JA 1YJWT 2K2MA 3CCET 1WJFA 2CV2A 3CUOA 4AFQC 4YFKF 1R1TA 2NNNA 3HPGA 3S3NA 2DEQA 5HK3A 4R56A 3CCJT 4MEXF 1SFUA 3CMET 4JRQA 4O5VA 1QPIA 1DU6A 1CKBA 1LOJA 4KT0E 4M6YA 1D5YA 5LJ5h 4YTLA 3JB9G 1ZRDA 4M7DC 4B6MA 4CH7A 1C0MA 3SB2A 1ZA2B 3K4LA 4QIWN 2VODA 3EG1A 2KGTA 1QP2A 4DEXA 2GM4A 3GF2A 1AWWA 3F8NA 5FWCA 1X4PA 3CCJA 2ZJ2A 4A93J 4EM0B 3BZCA 4M75E 1TG0A 2EQUA 2KVQG 3T8RA 2COBA 2XAFA 4HRIA 1ZSZA 3K4KA 4HNVA 3C0CA 3CC7T 1KHIA 5C4JJ 4B3XA 4BBRJ 3G1OA 3VYSB 4M73A 4ZGEB 3L2VA 3WHCA 3CCSI 3QYGB 1H92A 1L0OC 4L6V5 5GMKi 2MBFA 4E7HA 4ABZA 2M4KA 2ZB9A 2F5VA 2OA4A 3RYRA 2AO9A 3CC4I 3QYHB 4XLEA 4FM4B 2JA2A 4ZZDA 3URGA 1YS6A 1V54H 3L00A 2LTOA 3G71T 3CLOA 1ZELA 4AIJA 5C3EJ 1FX7A 3QODA 3HBLA 1M3AA 4BQNA 1UZCA 1ZG3A 4IRGA 2HOAA 1HBXG 1TXQA 5F04A 2R5AA 1BL0A 4PKCC 2LFBA 3OW2A 2XIGA 5B1BH 1GDTA 4BQAA 2W7NA 2IG0A 1U5TA 4WXHA 4F7UA 3I4MJ 3S6WA 1QHHD 2KJCA 4GCVA 2K5IA 2LQKA 2LT4A 2O4XA 2QTXA 4QQDA 2XASA 5FW9A 3OB9A 2R5ZB 2G3RA 2MUNA 2W24A 4M7DB 3QYFA 4HDUA 5CKBA 3O2PE 2DTIA 5FU6C 1USTA 3BY6A 1I1GA 3FHZA 5IPAA 1S7EA 5LL6S 3PO3J 2M0OA 4O3MA 3QP5A 1HKQA 3CCQI 3JCMh 1N6AA 3M55A 2DMPA 5IP6A 1TBXA 3NRVA 2ZAEA 4A0YA 1IN7A 1XTAA 3DEWA 4Y91A 3WGIA 4GGGA 2DPDA 4L9VA 2FF4A 2ZXJA 3PIOA 2QKMB 4IX7A 1Y39A 3QPSA 4I01A 1N5ZA 4PJOE 1SMYF 3GFMA 3BCBA 4G7HF 1VQPA 1XOVA 4KFCA 3FEOA 1MSEC 4ZYHA 5J8FA 2HNIA 1VQ9T 3WU2C 2A5YB 4M78F 3BG5A 1W36C 2IGNA 2VJ5A 1IRGA 1D8KA 4OU0A 4B8XA 2LKXA 5LJ3g 4P1WA 2XU8A 2HL5C 4PUSA 5H6QA 2QYOA 3ZQIA 1WFWA 2DODA 4II1A 2B0LA 3VEPA 2MH2A 1UB4A 3HSBA 1ZG5A 3HG9A 2DTRA 3ME9A 4HT9A 2WB1N 3CESA 1CF7A 2R7SA 2HBWA 2MW8A 4CICA 3K1MA 1B3QA 1VQ7Q 2JZ2A 1WGXA 1WFXA 3JB9I 2XDPA 3W2WA 3ZMZA 1UECA 4AFSC 4WXCA 3QPLA 5DM6F 1ETVA 1WI9A 2IBDA 4Q47A 3ECOA 3BZKA 1RI7A 3LL7A 2G7HA 2IRFG 5LJ3f 4M7AE 5F1JA 1IRFA 1VQ8I 1XCVA 2CQQA 2Y69H 2DT6A 1W70A 1R5ID 5DV5A 4JS4A 1E3HA 2K9MA 3SDBA 1D1BA 4IUUA 4JP0A 4PGHA 1MJBA 2HVSA 1OZ2A 1FOYA 1GCQC 4PJLA 2NXNB 2PQ8A 2XF7A 2X4YA 4BXFA 1V76A 4C0ZA 4FL6A 2DAOA 4I7HA 3L2RA 2PX9A 4KT5C 4J83A 4CCKA 2F1LA 3EG9A 3F23A 4C92G 1KG1A 1XQHA 5LFAA 2YUSA 2B86A 4J9EA 2YR2A 4OB0B 4UXNA 2FEIA 1I5ZA 1F36A 2NVUB 4HNTA 2L4AA 3JSPA 2OQGA 3S3MA 2R7UA 1JXSA 1B07A 1I0CA 3KFVA 5KYUA 4U87A 4F91B 1P92A 5A2QE 4F04B 1YJNA 3Q0UA 2ESWA 3M07A 3DTKA 4RAGA 3S2WA 5E1WA 3VS5A 4F93B 3VYHB 2ME6A 1VQLQ 3I55A 1M90U 1U9OA 1MNDA 9ANTA 1GBQA 5EGOA 3TO9A 2EKOA 2D5VA 3ZXSA 3FHNA 1H9TA 2JW4A 3JRDA 3K10A 2VQLA 1IHVA 1VQ6T 4V2GA 1QRYA 3HSEA 2DA5A 4XKVA 4QWQA 2P7CB 4X6AJ 1NEGA 1PSEA 4ZYGA 4HQEA 3WG7H 1K78A 5HS7A 1WCMJ 1JJ8C 3DLMA 3WXMB 4L9NA 5LHIA 2RNGA 4BACA 2RMOA 2CG4A 1RACB 2BY0A 2DX1A 2Q8KA 1ODDA 5B3SH 1FNNA 2DXBA 2CP0A 2GA2A 1BIAA 3H9QA 5LLQA 4FETA 4HF0A 5AIQA 3S2DJ 2XIDA 2H3EB 2FE3A 2V6CA 1NM7A 5GAMd 2HS5A 1BU1A 4PJOD 3S32A 3LWIA 3OW2P 1JTXA 3EETA 3QOEA 4RLFA 5EJCA 4IRIA 2CH4A 2PBIA 2TDXA 2MMPA 5GAN8 4B4CA 5CQYA 3HRMA 3CMAQ 1ZGAA 1O9SA 3AKZA 3EYIA 1WHKA 2HEQA 4L5GA 2CSIA 5D5UB 2LRDA 3HOSA 4OAZA 1S5LC 1W4SA 4X34A 4AVPA 1BC8C 2MZ4A 1HDPA 2L7KA 4CCOA 1Y71A 1SD5A 4HCKA 4C3JJ 5D5VB 3GTGJ 5L23A 1MV3A 1XN7A 5DCFA 2Z0WA 4CZZA 3NAUA 4C8QD 2CZ0B 5CJ9A 1QBJA 2QEXT 3TQNA 4M3GA 3CCLA 3WTYC 1SANA 2A5WA 2WSCE 4KBMB 5GANj 1NTCA 1YRNB 2NYSA 1G6NA 3HB9A 3M4GA 4N4GA 1KIKA 3SWNB 2VIXA 2CQKA 5IYDJ 3HKZN 5IHKA 1UJ8A 2RI3A 3GOXA 3E6CC 2CJJA 1UG2A 1X1DA 1TQIA 1D0YA 3RSNA 5D4SA 1UMQA 1U5SA 2QSFX 3CBPA 2L0KA 3DPUA 4FYVB 5GJVB 3JCMW 2V26A 2HQXA 1TQPA 2WB1A 2QENA 2OU2A 2P4TA 3FXOA 3OMCA 1IG7A 1SFXA 1EH8A 1K73U 1YI2A 4MQVA 5ILSA 3OBWA 1JGSA 3OR1C 2K9LA 5GAMh 4C8QG 3JCMX 2E2IJ 1X2KA 1J3TA 1S72I 3IH4A 2X6WA
chains in the Genus database with same CATH topology
1ZYRF 3VUBA 1QVFA 3JB9J 2DD4A 2HYFA 4M77D 5GAOr 2C6YA 4N0AC 2HZTA 4ENNA 1A04A 1DUXC 3CCMA 1IW7F 5FLXZ 1XGNA 2FEZA 2O61A 2JTVA 2XAJA 3SDZA 4RGUA 1KQ1A 2K2VA 1R1UA 3K2ZA 5HVQC 4KUDK 1RUOA 3BJOA 4IUQA 3MWMA 1YO5C 3OS0A 5L3BA 3OYBA 2PLYA 1B1BA 1XB4A 3IL2A 5CVIA 4XTYA 3F8FA 1BKBA 3CEYA</