1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
3JSOA 2A6HF 2F2EA 2P5LC 3C7JA 1ZG1A 2HR3A 2HYFA 1ZGAA 3D5LA 1USSA 1RIOH 5L3DA 4EGZA 3JW4A 4G7HF 2W24A 5JR3A 4Y13A 2XROA 4FX0A 1IN8A 2C6YA 3OV8A 4LMYA 4A5MA 3WGIA 1CF7A 4S05A 3SQNA 2F5DA 3WTTC 2O6GE 2PFBA 4GXOA 3HHGA 4IRIA 2CFXA 2HDCA 5HS9A 2OZ6A 3I0TA 3DKWA 3RPQA 4OIQF 3WTUC 5EEGA 5L3CA 2RN7A 1MKMA 4M74A 3JSPA 4I01A 3RKYA 3B73A 2V79A 1T2KA 3CUOA 3LAPA 1GVJA 4Q47A 1MJBA 1KU9A 2FOKA 2Y75A 1Z05A 2UXNA 1YQAA 4OIOF 2V1DA 2KJBA 4KT5C 4LK0F 2KIMA 3H3ZA 1MDMA 1GXPA 2FBHA 4BHBA 3RDIA 5JFRA 2NRAC 3GUDA 1KU3A 3EQLF 4XSXF 2EK5A 4RGSA 3ECOA 3ISPA 2JTVA 1K79A 4HLXA 4U7BA 4YFXF 5CJ9A 3HYIA 2K4JA 2OA4A 1IXRC 3L9FA 3Q9SA 4WCGA 1FLIA 1RUOA 2L02A 5FLXZ 5DCMB 3BDDA 4L0YB 2EA4A 3WTVC 1WKMA 2MLKA 1CGPA 4ZYDA 2ZFWA 2P5VA 5DUKA 1XCVA 2Z33A 2LNBA 1RNLA 4HQMA 3R60A 3FXRA 4PDKA 3K69A 5ICFA 3V8JA 2BGCA 1KU2A 2FNAA 2FNPA 2ESNA 3ZP5A 5K5OA 4MQVA 3F6VA 1U2WA 4CYDA 3I58A 1KA8A 5LHIA 4U0YA 1C0WA 4L9NA 1D8JA 1B1BA 1LVAA 3FHZA 3M1EA 3HRTA 3LAJA 4HF1A 4RB2C 1JHHA 4UUVA 1J7KA 4WXDA 4CO8A 2GWRA 4ON0A 3KETA 3B02A 1SMYF 3ZPLA 1P6RA 1UHMA 4WX9A 5FD6A 5F6FA 5H6QA 1O3QA 1WSUA 1D5VA 3ABTA 4BNCA 1KQ0A 3OOPA 1ZYRF 2AXLA 4AIHA 4PGHA 3WTWC 2E7WA 2HFHA 1R36A 3BJOA 4ZYGA 3ZN0A 1FWZA 1O57A 3ABUA 5E1ZB 3C1DA 1ODDA 4FHTA 4N0BA 3KZZA 1R1TA 1W5TA 4ZYEA 2A3SA 4LJZF 5K5RA 2ZKZA 1FYKA 3KP3A 4TV7A 4HV5A 3F72A 4EJVA 5CVVA 4UV9A 1Z1DA 5DDGA 2QENA 2AS5F 5HVQC 2NNYA 2PJPA 5DCFA 3LSTA 3SZPA 3J80K 3HSRA 4RB3C 2XASA 2J5PA 1R00A 2VBZA 3IWZA 5DD8A 1QBJA 1GHCA 5AONA 2BYVE 1O3SA 2XAFA 2MA3A 2HTSA 2H27A 4M9XA 4A6DA 2L54A 4HYEA 3KZYA 3GZ6A 4UVAA 4GYGA 1P2FA 2HKXA 2LX9A 4MTDA 3KP5A 4KDPA 3BWGA 3FX3A 3IC7A 4FT8A 2KRFA 2P6SA 4RGXA 4U0WA 2EFWA 3HSFA 4CGZA 3G3ZA 5D8KB 3RKXA 5KK1A 4XBFA 3M8FA 1R22A 4UVBA 4EM0B 1TLHB 1I1GA 1LDDA 4XRFA 3GFLA 3QU3A 1TNSA 3FF5A 2QBYA 3JTHA 3LWFA 1YG2A 2M45A 2O03A 2MH9A 3DFGA 2XKOA 5H20A 2EV0A 2EWNA 2WWYA 2X4HA 3GVAA 2XAJA 5ED4A 5D4RA 2FMLA 1V3FA 1W7PA 3V8KA 3WTZA 1XGMA 3QRFF 1UHWA 3HOSA 1BIBA 2J5OA 1LEAA 2GQQA 2P4WA 2G7HA 3V4GA 2YU3A 2RVCA 2NYXA 4CHUA 1OYIA 5LEJA 1G3SA 2VT2A 3LFKA 5EEHA 1MJAA 1HW5A 2JRTA 3GWZA 2RDPA 2BV6A 2XHKA 5K5QA 4CDGA 1W4MA 4LGWA 2K27A 2Q8KA 1YYVA 4MEYF 2A07F 1U8RA 2XAGA 3P9CA 4RAZA 2IW5A 4FX4A 2V6CA 4L5IA 1K7AA 2P7VB 4OINF 3BOQA 1IAWA 1IXSB 3G73A 1DDNA 5HS8A 1WWXA 1OPCA 4M9SA 1IN6A 1QNTA 1FOKA 5JVTA 1P92A 2KKOA 1IN4A 3ELKA 4N9IA 1J5YA 4BH9A 2DFIA 4BHPA 2K4YA 5LBQA 3K2ZA 2IRFG 2F5CA 3QOPA 3R6SA 2XKPA 1Z6RA 2HQNA 2RGVA 4KUMA 3QU6A 2W25A 3T5XA 3H92A 3QP5A 4ZYHA 3VB2A 1RUNA 5LRRA 3MWMA 4KIFA 3GYHX 1RZ4A 1TQMA 3KLNA 1T98A 2CO5A 1TW3A 4LB6B 2GA2A 2K5IA 5TRDA 1T39A 3HIFA 2VC1A 3HHHA 3BP8A 2EV5A 2FMYA 3TO9A 2DQRA 2GZWA 3BJAA 3LA7A 3ZMTA 5KVRA 2EFQA 2UZKA 4I7HA 3KLOA 1U5TA 2LKPA 2L4MA 3QP6A 3I71A 3KP4A 3ECHA 4M6YA 1R58A 5E17F 3U9GA 3KP6A 1JXSA 3GFMA 5E1WA 3AAFA 5FO5A 1YW7A 4P9FA 2ISZA 2DW4A 1W5SA 4OIPF 4D0PA 3DQVC 4HBLA 2DK8A 3R0JA 3U2RA 4G7ZF 1K78A 1YIOA 3GF2A 4JQFA 1BIAA 5IT9K 4HZFA 3WGHA 1EH6A 5ILVA 3RJPA 1BOAA 4IF4A 1MD0A 3E6MA 4LK1F 1XN7A 2ZXJA 3ZMSA 3HTUA 2ESHA 2RQPA 4G6DA 2PMHA 3RPUA 2ZNYA 2FXAA 2F5FA 1P4AA 3F8CA 1IF1A 2MC3A 1YFHA 2M30A 1B9NA 1D8KA 1OMIA 4GGGA 2L4AA 4L9JA 1ZREA 3BROA 1W7PD 1CF7B 3GFIA 5IT9Z 2P7CB 1LQ1A 1TQIA 4RGRA 3V7RA 1S29A 4RAYA 1G3TA 4NB5A 4ESJA 2Q2EA 1T38A 4ENNA 1UFMA 3T8TA 3ZMDA 4EMSA 3CO7C 3KP2A 4M6XA 3FZVA 1ON1A 5FLXK 2YPRA 4HF2A 3WODF 4U0VA 3ZMVA 4LB5A 2E7XA 4ESFA 5L3GA 1TBXA 5CLSA 4OIRF 1LDKB 2FEZA 1Z6TA 1QO0D 5E20A 1MDMB 3SHFA 3BZ6A 3HRUA 2ZNZA 2GXGA 4MEXF 3M7GA 3K1NA 5JI6A 2P8TA 1DUXC 2FBKA 5D6EA 3L00A 5FD5A 3P9IA 3FMSA 1FBSA 1ULYA 2VONA 1LDJA 5BOXA 3QPTA 3CUQA 2EFPA 1PP7U 3MZYA 3H3UA 1USTA 3HSEA 4M9ZA 3WTXC 2A5YB 4DQ2A 1BC8C 2DBBA 1PUEE 2Z3YA 2IA2A 5FFXA 4WXCA 3ZQ7A 5ICCA 5D5XB 2PLYA 1YTYA 3LQRA 3I5UA 2HYGD 3D0SA 5AIPA 1IN7A 1FYMA 4GO1A 1KYZA 3MFKA 1LB2A 3RYRA 4KFCA 4HA8A 5A2QZ 2KJCA 1IN5A 1B59A 1R7JA 1XSVA 2UWMA 2Z5UA 1JE8A 6PAXA 2VOOA 2OAZA 3ZN1A 5HS7A 1Z9CA 4B09A 4M71A 1DPRA 2IA0A 2M1BA 4HOBA 4ENMA 3PFIA 5K1YA 2D1VA 1QPMA 3FM3A 4ZZLA 4EVIA 4YFKF 1YLFA 2BE5F 4K2EA 4KMUX 2CGPA 3DXJF 3WGGA 1IZ1A 4IXAA 1E17A 2M87A 2W57A 4O5VA 4IJAA 1B4AA 2IPQX 3C18A 4KIBA 1U5TC 4M72A 1IUYA 4OU0A 4QWQA 2QQBA 3ML6A 3DEUA 2EB7A 4EJOA 2EJRA 1SD6A 2MBFA 5FB2A 1XCBA 3P9KA 4ETSA 2BBYA 4KA4A 5DYMA 2PN6A 3NRVA 1XD7A 2CG4A 2EFNA 2RC4A 4RS8A 3JAMZ 4EQQA 4AIKA 2FA5A 4A5NA 4MHGA 1NHAA 4I0BA 1MZBA 1XSXA 2VODA 2WC2A 4BYYA 3WE3A 3ROUA 4ESBA 1XSDA 1FP2A 3I59A 2QZ8A 5BPIA 1F9NA 4LLNA 2G7UA 3EYIA 3EYYA 3LA3A 3GFJA 2DTRA 3CJNA 5ERIA 2FE3A 3COAC 2H94A 2PEXA 3WG9A 4EM1A 2W85A 1R1VA 1REPC 1F1ZA 4GCVA 2JZYA 4EV0A 1G4DA 1HKSA 3L2CA 2V1UA 2H6BA 1ZRFA 4ENKA 2KIUA 1KQ8A 4AD9A 3HTSB 5HDGA 4I98B 5E1XA 4UNOA 4LG0A 2OD5A 4CICA 1ZN2A 1UB9A 1R1UA 5DV5A 2YX7A 2RNJA 2RV8A 1KGSA 1OR7A 4G7OF 2VN2A 3LQQA 1FSHA 2QBYB 1RI7A 3KFWX 1BI3A 1QVPA 3E3VA 2CQKA 2A69F 2IJLA 4LLLA 1J0RA 1W7PB 1JHFA 1OKRA 1SAXA 4MTEA 4O3MA 2RKHA 2ETHA 4EGYA 3HUGA 3KCCA 1FBUA 3K0LA 3M8EA 2GCXA 2CWEA 3IHUA 1FX7A 3U1DA 2VBYA 3GW2A 4L5JA 1JGSA 4BAYA 1QZYA 1FY7A 3REOA 5D8LB 2HKOA 5E8IA 2A68F 2K02A 4PCQA 2HWVA 4L9VA 1ZHFA 5CVIA 1FSEA 5LEKA 1HSTA 2O0YA 1FP1D 2XV4S 3PQKA 1FYLA 2HQRA 4Z2YA 1EH7A 1S7AA 3L09A 3TDZC 2VBXA 4G8XA 2V1XA 5AIQA 4AWXB 1I6XA 1SFUA 1BM9A 3TKYA 2L3DA 4Q48A 5CVUA 3R0AA 5F1RA 3S2WA 2DPDA 3DF8A 1BN5A 2GA1A 3IKVA 2ELHA 1BJAA 2QYOA 3R61A 1A04A 1HW2A 4PGGA 3FXQA 5BPDA 3MCZA 1F5TA 3DPTA 2HGCA 3F22A 2F5EA 4MGRA 2Z9OA 3MHXA 4I0AA 4A6EA 5J6XA 3F6OA 3T8RA 4KICA 3HRSA 3CTAA 3GO5A 4CZZA 3CDHA 1IRGA 4S04A 1PP8F 4LD5A 2ZMEB 4ZZDA 5BS6A 4DNCA 3RTRA 4NHJA 4LFUA 5CVJA 5LHHA 1U5TB 3WE2A 4BQAA 1S6LA 5LRSA 3BPVA 2DAOA 4MNUA 3RIRA 4G6QA 1YS6A 2CSOA 5HDKA 4WXHA 4KMFA 2HTJA 2JPBA 3KP7A 1R5HA 2OU2A 3VODA 5D5VB 2M8EA 3F23A 1GXQA 3KEOA 1U78A 1G6NA 1YO5C 1J59A 1K78B 2MD5A 5LHGA 3WU0A 4Y17A 3ERED 5E8GA 4AVPA 3VEPA 4L0ZB 2QQAA 1XGOA 1FPQA 3W6JB 2DI3A 5LGUA 1O3TA 2Y0MA 4YIFA 4YIIA 1YW9A 2FRHA 4F7ZA 4ENJA 1R5GA 4E70A 2X0LA 2ISYA 2QQ9A 2YR2A 3SXYA 5TJJA 2DPUA 3WTYC 4I09A 5IT3A 2XAQA 2FF4A 1O7LA 3LA2A 1SD5A 2DK5A 4YFNF 4O6JA 4UHTA 2Y48A 1L0OC 3FMQA 3RKWA 1I27A 1AOYA 1HXDA 5HDNA 5HLHA 2XUBA 1EV7A 2HZTA 3E6DA 4XLPF 1LJ9A 4IHTA 3WTSC 3NQOA 1ZLJA 3I54A 1G3WA 4Q5SF 2PBIA 2R7FA 2OBPA 2XVCA 2E1NA 3TDUC 4IHSA 3GX4X 3V7SA 3MZHA 3F8FA 4KYWA 2GAUA 3TOBA 1YS7A 1MJ9A 5DUIA 2O61A 2XRNA 4A0YA 3ZMUA 3TGNA 2OQRA 3L7WA 2H09A 2PQ8A 3K1PA 4GYIA 2O8XA 4HW0A 4HX7A 1ZH5A 2XGXA 4OMYA 3DV8A 1KYWA 4HLYA 5A2QK 1QGPA 3IRRA 2DU9A 5L3EA 2EFOA 1TQPA 2H3JA 4MQ9F 4I2OA 3BPXA 3CUQB 4BHCA 2D1HA 1BYMA 1J2XA 3E5XA 3F8MA 4RB1A 3SFZA 2STWA 3V8LA 2Q0OA 2XAHA 2ADUA 2XIGA 1QQIA 2V9VA 1SFEA 1HKTA 3TQNA 2FU4A 3GEZA 3ULQB 1WI9A 5DCMA 4KIGA 3ZMZA 2NNNA 2DT5A 4HV6A 3IKTA 1QW1A 1PDNC 5ILUA 2NAZA 2E1CA 1SFXA 1TTYA 1FT9A 4JK1X 3J81K 4HAMA 3GZ5A 1FC3A 4HDUA 1IRFA 3FMRA 2QVOA 4RB0A 3E19A 1XB4A 4HDVA 4IPAA 1KU7A 1I1SA 1TW2A 1ZG3A 4OOIA 2LF7A 3E5UA 3JAMK 2Z99A 2WV0A 3E6BA 1FNNA 1STZA 3W6KB 1IW7F 5E18F 2VE8A 2BEOA 1DPUA 2KIFA 4JBAA 1LNWA 4P9UA 4Y15A 3Q9VA 1J75A 2HEOA 3FM5A 2GXBA 1HBXG 2D2WA 2CYYA 1BI0A 4UVCA 4EM2A 1SD7A 2K7LA 2R7DA 3J81Z 1FBQA 3O6BB 1OYWA 1H9GA 4KN4X 2TDXA 4HX4A 1L3LA 2COMA 2UXXA 4M73A 3I53A 2ACJA 5F64A 3T0YA 2IVMA 4CXFA 3IL2A 4P96A 1BI1A 2PG4A 2JPCA 2G9WA 3DPLC 2JSCA 1KQ9A 3TO6A 2ZJ2A 4IRHA 2D45A 5L3BA 3CLOA 4XLNF 1U3EM 2R3SA 3K1MA 3IRQA 3I59B 2QWWA 3GLXA 3MAJA 3RI4A 5ICEA 4P55A 4BXUA 2NS0A 1Z7UA 3T1BA 3TO7A 2O3FA 1S8NA 3F8NA 3O2PE 3SZTA 5LLQA 1ZRDA 5L3FA 3JTGA 1S7OA 2L01A 3VOEA 2DO7A 2QM3A 3J7AO 4ZH4F 3E5QA 2QLZA 1TNTA 4R8HA 4WWCA 1H9TA 2IT0A 5JHUA 2MLGA 1XDUA 4OMZA 4LG0B 4G94A 2PMUA 4L18B 4IVNA 3F21A 5FFZA 2OQGA 3TOAA 1P4WA 1AWCA 2K4BA 1B9MA 1HQCA 2OZUA 4A2UA 3J80Z 2YSRA 1HKQA 2LF8A 2CW0F 1FZPB 5BQTA 4G9YA 4L9TA 4WF2A 1BBYA 1V4RA 5D5UB 5J8CA 4LLGF 1MGTA 1QZZA 3P7NA 4AIJA 4UXNA 3HRMA 1B6AA 1YW8A 1T6SA 2LSOA 3WU1B 3BJ6A 4U88A 2VBWA 1H0MA 2ZBKA 2HOEA 1WRJA 3N4MA 3CUQC 4EJTA 5CYVA 3N97A 4UV8A 4IRGA 1P4XA 1ZARA 3CO6C 3FWEA 3K9TA 5BMZA 1EH8A 3NEUA 3BY6A 2WTEA 3E97A 5HLIA 1T0FA 1G3YA 1OYYA 4EJUA 1U6GA 4EJWA 2QUFA 4NQWA 1E2XA 1ON2A 1SMTA 3EDPA 2ZO4A 4B8XA 1S3JA 3GXOA 2STTA 5DEQA 1ONVA 5D5WB 2IP2A 1UCRA 4N9HA 2DQLA 3I64A 2VOPA 1O7FA 2EV6A 4A0XA 2H6CA 4YG2F 1ZRCA 2JT1A 3O3KA 4Q4ZF 1HW1A 2YX4A 1I5ZA 3E6CC 4KNYA 4XSZF 2PI0A 4HQEA 4QLCU 5H6RA 2W84A 4U7DA 2VT3A 1XMKA 1DP7P 3EUHA 2FSWA 5D4SA 4KN7X 2VC0A 3VFZA 4A12A 1BI2A 2FBIA 2B0LA 2IA1A 5DD4A 2MH2A 2ZCWA 4R79A 2VE9A 4HX8A 5ILSA 1Q1HA 2K5FA 3F8BA 1O3RA 2FQ3A 3C3WA 4R1HA 3R4KA 1ZG5A 1X3UA 1WQ2A 5D6FA 2LDUA 1BC7C 3QPHA 3Q5FA 1J9IA 2A6EF 5LGNA 2A61A 4RGUA 1XMAA 3FXUA 4ASNA 3KE2A 3HOTA 4A0ZA 2ZMEA 1ZGJA 4P5OA 1XGNA 2GIVA 4WK8F 3V7CA 2M5WA 5FGMA 2VXZA 1Y0UA 2EA2A 1Z91A 3IWFA 1XGSA 4HF0A 5LGTA 2DLLA 1LEBA 3MQ0A 1ZLKA 3F3XA 2K86A 2P5KA 3I4PA 4PZJA 5J8FA 5HLGA 3KEQA 1K6OA 2HS5A 3QAHA 3PQJA 5HOOA 1SD4A 1VTNC 5ICGA 5CVRA 1XDSA 3EETA 1HSJA 1R23A 3M9AA 3MEXA 2P6TA 1ZAOA 1IXCA 1F4KA 4I02A 2K5LA 1D3YA 3RYPA 4H0EA 3DP7A
chains in the Genus database with same CATH superfamily
2NOGA 5DS9A 3G1OA 4IEJA 4QTRA 2A6HF 2F2EA 3JSOA 2P5LC 1R77A 3C7JA 5CKEA 1ZG1A 3ASKA 4AT1B 2HR3A 1RAGB 1XC5A 2HYFA 3HB9A 1ZGAA 3OYHA 1EKEA 3OR2C 1N78A 2HYJA 4PFZA 3ZBDA 4EATA 1QKWA 3D5LA 3G2BA 1GV2A 4P1WA 1USSA 1RIOH 1X2MA 1AOJA 2E34A 1VI0A 1W36C 2XGDA 4XKBA 5L3DA 1PWTA 1YOVB 1X19A 3JW4A 4EGZA 4G7HF 1R71A 2LMJA 2M16A 3I35A 1OJLA 3RKQA 2W24A 5JR3A 3HPWA 3OIOA 4KITB 2QAZA 4Y13A 2XROA 4FX0A 1VQ8T 1Y7XA 4D5CA 1IN8A 3ZQIA 4CCJA 2C6YA 1ZBXA 3OV8A 4LMYA 4A5MA 2DAQA 3WGIA 4DOZA 1VQKQ 1UDLA 1CF7A 5FU6C 1K73U 1F1BB 2EAYA 4S05A 3J7AY 3PMTA 4C5IA 3E1SA 3OL3A 2M0YA 3OW2S 4E7HA 2KRNA 3FKJA 1Z21A 4PJMA 3SQNA 3REBB 4QVDA 2F5DA 4XU1A 3G4SA 1OR7C 3WTTC 4X0GA 2O6GE 2PFBA 4M78A 2CV1A 1S72A 4GXOA 3HHGA 4IRIA 3M4OJ 2EIKH 4BL0B 2CFXA 2HDCA 3HM5A 3MKLA 2OZ6A 5HS9A 1WI7A 2X6OA 3BCBA 3I0TA 1Q82C 3DKWA 2YRDA 3S3MA 2JOYA 4JP0A 3WHCA 3RPQA 2DKGA 4J9IA 4C0ZA 2DIQA 2JXBA 2QA4T 2DXCA 4EMKC 4OIQF 1YJNT 3WTUC 5EEGA 4ITVA 2LY2A 5DLQE 3ABKH 4ORZA 5L3CA 2RN7A 3TQ7P 1MKMA 4M74A 3GTJJ 2DEQA 1OX9A 3JSPA 2MF2A 4A93J 1S1NA 1WGXA 4I01A 1S72I 2PVOB 2QKMB 3RKYA 3B73A 1QRYA 2V79A 1T2KA 1JJ2S 3CUOA 2EFIA 3LAPA 2CT4A 1ZHIA 1GVJA 1M30A 2J6OA 3JRIA 1NK2P 5GTHC 4KT0E 4Q47A 2W1OA 3PIOF 2CP2A 4JZ3A 2NUPB 3GTPJ 1MJBA 1KU9A 1OZ2A 3QYGB 2FOKA 4BUGA 3CD6Q 3CCUI 2Y75A 1Z05A 2UXNA 3VYTB 1YQAA 5I22A 5GAOr 1H3ZA 1M1FA 4OIOF 2V1DA 5I2MA 5EG0B 1G5VA 2KJBA 4KT5C 4LK0F 3W3CA 1X3ZB 3RQ4A 1KHCA 1Y0NA 2KIMA 5EZHA 2MCNA 2ICWG 3HOZJ 3H3ZA 4OMQA 3VU3C 1K0SA 2ZFUA 1MDMA 3BZCA 3CCST 3FXMA 4U87A 2M3AA 1SAUA 2X9DA 1GXPA 3CCVA 1VUBA 1FEXA 1C6VX 2OX7A 2WSFE 4AUXA 3GZNB 2ECZA 1SHGA 3PE0A 4FE4A 2FBHA 1X2NA 3Q1JA 2OTJT 4BHBA 3RDIA 5EJCA 5JFRA 3GUDA 2NRAC 2ZXIA 4M78D 1B07A 1KU3A 3EQLF 1H8AC 4XSXF 2EK5A 4RGSA 2ENMA 3G6EQ 1D0YA 3ECOA 3CPWS 3ISPA 1N8RR 2JTVA 1K79A 4L6V5 1WPYA 4X34A 4HLXA 1H8KA 4U7BA 4YFXF 3QJ6A 2CUZA 5GAMj 5CJ9A 3HYIA 3M57A 2SEMA 3CCVI 2VLAA 2K4JA 1D3BB 3I55I 2CH4W 5FW9A 1N8RC 3HXLA 2OA4A 2E2IJ 1I1JA 4GY5A 3TMOA 4KGVB 4IZZA 4KRTA 1IXRC 3TCJA 1SKUB 3L9FA 2L3PA 2OJ2A 2WSCE 3Q9SA 4WCGA 3OYLA 1IUFA 1TZLA 2LY1A 1MBGA 3H3VK 4RTXA 3QYFA 2VQHA 1MHNA 2HKNA 1FLIA 2JW4A 1RUOA 2K3FA 2JM8A 3CCRQ 2L02A 4I76A 5FLXZ 5DCMB 3ABMH 4C30A 3BDDA 4L0YB 4HVUA 3M58A 1G8XA 2WA0A 4FW2A 3Q0VA 2NUZA 1QVGP 3FXKA 3QKJA 2K3BA 2KRHA 2QASA 3EFRA 2CP5A 2Z0WA 3KYDB 2EA4A 2F4MB 3P8HA 4OP0A 5GAMf 1S5LC 5CKBA 3WTVC 3D7SB 1WKMA 2MLKA 2E1MB 1KHIA 1PUFB 1CGPA 4B6MA 1E3PA 2F4IA 3TW7A 3ZR8X 3KUFA 4ZYDA 1MMGA 1B34B 1TUGB 5GJWB 2JUGA 2ZFWA 2PMZN 2DE0X 2W82A 1NPPA 2MK5A 1ZUYA 2P5VA 5DUKA 1O75A 1XCVA 1LPLA 2GOMA 4LIVA 4J7FA 2Z33A 2FRYA 2LNBA 4FU6A 3UWNA 2DNUA 3CCET 1RNLA 3LL7A 4HQMA 1VIEA 4F92B 3R60A 3FXRA 4RUGA 3SB2A 1ZUKA 4PDKA 5M3MJ 1KSWA 4A3BJ 2CUFA 3K69A 3QXEB 5ICFA 4LDXA 3FBNB 3TW6A 3V8JA 2BGCA 1MSEC 3VKIA 1KU2A 1YRNA 2FNAA 4QPOA 4C8QD 2FNPA 5J4VA 1JI8A 1VQ5Q 2ESNA 2DRMA 2LZ6B 5IHKA 2BVMA 3ZP5A 5K5OA 4MQVA 2LDMA 4UUTA 3F6VA 5F0HA 2KNBB 1U2WA 5IHIA 2JJ7A 1UMQA 1JXOA 3EUHC 4CYDA 2LNVA 2YUQA 3JCMP 4XTWA 3IAM2 5CQGA 2YSQA 2L7MP 1LPQA 3I58A 1KA8A 5LHIA 4U0YA 3ZXSA 5K7FA 1NJIC 3SJMA 1VQMQ 1C0WA 2E5ZA 4L9NA 4M3EA 1CSKA 5JLWA 1D8JA 2L5QA 4M3DA 3GBQA 4PL6A 1G83A 2HZYA 5HY6A 4HEA2 1B1BA 1LVAA 2WY7Q 2Y9YA 2HL3A 3FHZA 1I3QJ 2QXFA 1YITQ 3M1EA 2AXTC 2BY1A 3HRTA 3LAJA 2YU9J 4HF1A 3MO8A 2I10A 4RB2C 2VQLA 1JHHA 4UUVA 2LT4A 4RMNA 1J7KA 2LP5A 4EEFG 4WXDA 4CO8A 2GWRA 2K9MA 4ON0A 3KETA 4LDYA 2VL8A 3B02A 2ED1A 4C8QE 2V1QA 1LCKA 2DFUA 3CESA 3OS2A 1SMYF 3ZPLA 1P6RA 1X1PA 3DBLB 3H0GJ 3OL4A 2R7ZJ 1K6YA 2A0FB 1UHMA 4WX9A 3CCLA 3PNWC 5LL6S 2RJEA 1BW6A 5GAN6 2VKVA 2WAEA 5FD6A 3G1JA 4PFPA 5F6FA 3M0TA 4XM3A 5H6QA 1O3QA 1WSUA 2M7AA 1D5VA 3EGXA 4C8QC 3QWXX 4M7DG 3ABTA 3I3LA 4F3QA 3RMSA 2O01E 4DJAA 2P4TA 1JTYA 1SVLA 3QQAA 1KQ0A 4BNCA 1N27A 5GAMe 3OOPA 1ZYRF 1UJ8A 1M5Q1 2P0QA 2AXLA 3BC8A 4AIHA 3M4GA 4PGHA 1VQ7T 3WTWC 3H5NA 1MNDA 3CCJI 2RK1A 3A2KA 4PFOA 3S14J 3I4MJ 3I5RA 3N05A 4E6KG 3VRZA 3CCLI 1X6GA 2AKLA 2E7WA 3F0CA 2HFHA 4HT9A 1YFNA 4MFDA 1R36A 5CKTA 3A0BC 3BJOA 1UHFA 1PJRA 2DZCA 2O9VA 4M6VA 2PVDB 3ZN0A 4ZYGA 4EMGA 1AWOA 1FWZA 1O57A 2GGRA 2RMOA 3ABUA 1FOXA 5E1ZB 3UATA 1WCMJ 2LBFA 4HNUA 1OOTA 2DA9A 3C1DA 1OLTA 4Y52J 2J05A 3CCQQ 1ODDA 3HKZA 4FHTA 1OV3A 4N0BA 1UFFA 1GV5A 3KZZA 3LH5A 4A53A 1R1TA 2A28A 4OB2B 2OTLQ 2DXBA 2L89A 1MMDA 9ATCB 2HZDA 1W5TA 3LSGA 5J3LA 2DBMA 1ZUUA 2ZPFB 4ZYEA 4RDUA 2KK4A 1YI2A 1DP3A 3QWLA 3JRFA 4CC4B 2A3SA 4PJLA 1E3HA 3WG7H 1D5YA 5LJ3g 3ME9A 4LJZF 4RBOA 5M5XJ 3K4JA 2ZKZA 5K5RA 3X20B 1FYKA 4MZTA 3FXOA 1IGNA 3ZL7C 3WVDB 1KQSS 1JJ8C 3KP3A 4UUSB 3LSPA 4JJDA 2VJ5A 3M5AA 4TV7A 5I21A 4HV5A 3IH3A 1H641 1AZGB 2K7AA 2COZA 3F72A 4MMKA 4EJVA 5IN1A 3RNJA 2Y69H 5CVVA 2R5MA 4UV9A 1W5CC 1Z1DA 1Q86R 5DDGA 2QENA 2DDAA 2AS5F 1I5OB 2QEXQ 5HVQC 2NNYA 2PUOB 5FLXE 2HPIA 3PNVA 3OYCA 2MGQA 2PJPA 5HKCA 3BG5A 1QKXA 5DCFA 3LSTA 1U1SA 3SZPA 3J80K 1Q86C 3HSRA 1RR8C 3KPHA 1OULA 2D0QB 3L42A 4OB0B 4KH1B 2M9UA 1M90R 3G4ST 1DGWY 4RB3C 2XASA 2KY9A 2J5PA 1R00A 4DBFA 3FRNA 1S72T 2MYSA 3EHRA 2VBZA 3IWZA 5DD8A 2EYXA 1QBJA 1GHCA 5AONA 2BYVE 2R5YA 4WCIA 1M90C 2X1CA 3JR9A 4AFSC 2V1RA 3OR1C 1LE8B 1WHJA 2KT8A 4M75A 3T9NA 2OI3A 2ID3A 1O3SA 4NNJA 2LD5A 4IQ4A 1JKRC 2DA3A 2XAFA 2MA3A 2HTSA 2H27A 5FRNA 1N77A 4M9XA 4A6DA 2HVRA 2BZ8A 2L54A 4E7ZA 1Z3YA 2EJFA 2LMDA 4HYEA 3KZYA 2VJJA 3JRAA 3GZ6A 4KGZB 4UVAA 4GYGA 5D7UA 1P2FA 2HKXA 2EIMH 1R4NB 2OTJQ 2LX9A 5H2FC 4MTDA 2E10A 3KP5A 4KDPA 2EJ9A 2DA1A 4N4OB 4X6AJ 3BWGA 2L3QA 1WJBA 2JMCA 3FX3A 3OS0A 1UHSA 3FEOA 2DYRH 3IC7A 4BS9A 4Z6YA 1UG0A 2KRFA 2XGCA 4FT8A 4AIDA 5IP9J 2F2WA 2K3YA 2QG9B 1MW7A 2P6SA 4UB6C 2HQXA 2DYSH 2LQNA 4RGXA 4U0WA 2EFWA 2IS2A 4F14A 3CDLA 3HSFA 3PVLA 4RCCA 4CGZA 1A31A 3J80E 1KIKA 3G3ZA 4ZYAA 4CYCA 3HGGA 3SWNB 1S7EA 3OSFA 4QQDA 5D8KB 3EG9A 5FU6B 1K76A 3OSGA 2R5ZA 2RHIA 1W2BP 3RKXA 3J80R 5KK1A 2OJED 2A6TA 2KT1A 4XBFA 5GAOn 2O7OA 3MCAB 5IPAA 5K7HA 3HZJA 3I5SA 1B72A 5E3OA 1RAHB 2FUG2 2V7FA 3M8FA 1UJ0A 1R22A 4UVBA 4EM0B 3VYHB 3BR1A 1TLHB 4M7DB 2BHYA 2DMUA 1I1GA 4HCZA 1LDDA 4XRFA 1JJ6C 5E3MA 1W0UA 3FLGA 3KYLA 3CCVT 1WZ2A 1QVGA 2Z2SB 3HBLA 1PHTA 3GFLA 3JCMg 4C9YA 2CFOA 3QU3A 4C2MJ 1Y0MA 1TNSA 2WADA 1AT1B 1HA8A 1HLVA 2DMOA 2RQUA 3EGDB 4J6XA 3ZQQA 3FF5A 2JMAA 1AWWA 5LD2C 2QBYA 1PNJA 1JTXA 3JTHA 3EFOB 2VWFA 4XORA 3CC2I 3LWFA 1YG2A 2M45A 1BKBA 2O03A 3RZOJ 1M2OA 3SDZA 4DEXA 4BQQA 2M0MA 2H1KA 2ZPHB 2MH9A 2RQQA 3DFGA 3QOEA 2XKOA 5H20A 1ZQ1A 2K79A 4NUBA 2L9SA 3ZQFA 2EV0A 2EWNA 2WWYA 1WX6A 2X4HA 1LVKA 2XAJA 3GVAA 4CCNA 5ED4A 5D4RA 3JRGA 2FMLA 3HUGB 1V3FA 2KPMA 1ZGWA 2WSEE 2ZPGB 3M4YA 4PJJA 2HSPA 1W7PA 3MPUB 4J00A 3EG0A 3V8KA 3WTZA 1XGMA 3QRFF 1UHWA 3FHNA 3HOSA 5KYWA 3FDYA 1GL5A 3K4LA 2XPWA 4M75F 3O8GA 3FC3A 1BIBA 2J5OA 3LSHA 1LEAA 2GQQA 2P4WA 2G7HA 2X35A 3QZ9B 1I3AA 3V4GA 4FT4A 4PLIA 1VQLQ 3G71A 2R7VA 1AD5A 2YU3A 4JJNK 2RVCA 2CKKA 3NTKA 2NYXA 1HF0A 4CHUA 1UG1A 4XK8E 1OYIA 2R7QA 5LEJA 4ZGEB 4JS5A 1G3SA 4XRMA 3PSIA 4KUIA 4FISA 3OW2P 2DXUA 1ETQA 2VT2A 3BDUA 1A0NB 4XN3A 2HOSA 1OZ3A 3LFKA 5EEHA 1YIJA 1X27A 1MJAA 1U8BA 1HW5A 2PUKB 5D6XA 5GANj 2JRTA 2CUEA 1BOBA 2CUDA 3GWZA 2RDPA 1M1KC 2BV6A 3KZIC 2XHKA 4PJOA 5K5QA 1GFCA 4ELYC 4GLMA 4CDGA 3LX7A 4CCLA 1SFOJ 2CT3A 1W4MA 3TP3A 3UT1A 5GAOq 2QYZA 3X28B 1ETVA 5HNHA 4LGWA 2F48A 2K27A 2Q8KA 1YYVA 1I6HJ 1XNIA 2BY3A 2DT7B 4MEYF 5LJ5d 3X2QH 2A07F 1U8RA 3UR3C 1VQ4A 2BZYA 4RTUA 1YIJI 4DOWA 2OC6A 2FYKA 4IUUA 2JM9A 4DBHA 2RQRA 3H5RA 2ED0A 2XAGA 2LTOA 4Z89A 3P9CA 5GANf 3CC7A 2VJ4A 4RAZA 3HTRA 2IW5A 2KR3A 2VV5A 4FX4A 2V6CA 2ZJQF 4L5IA 4BBRJ 1K7AA 1JJ2P 2PMZA 1M1EB 1YHQA 2KDZA 5DM7F 1TH7A 2JA5J 2P7VB 2Y2ZA 4OINF 2KDSA 3SFIA 3BOQA 3SEZA 2PZ1A 1IAWA 3OWTA 1IXSB 3MEUA 2GQVA 5KE3A 5EGOB 5FLMJ 3G73A 1VQ4I 4J8OA 4Z88A 4ZGDB 1DDNA 5C0MA 2KMUA 5GMKj 2OAWA 2QA4Q 5HS8A 1T08B 1WWXA 2ATCB 1OPCA 1RRJA 1J3TA 1YJNQ 3CC7I 1MV3A 2LYCA 3MZ8A 4M9SA 1IN6A 2L7ZA 1QNTA 2V1NA 5GPCA 1FOKA 3OYKA 2L3SA 2HVQA 2DFEA 2RJDA 5JVTA 1K73C 3RR6A 5IYDJ 1TWBA 2E65A 1YHQI 1P92A 3OYEA 3CBPA 3SD4A 2KKOA 1PKSA 5KE2A 3CCJT 1IN4A 3ELKA 1VYVA 4N9IA 1QPIA 1J5YA 3GNGA 3CCLT 4BH9A 2DFIA 4BHPA 4LIUA 4A3CJ 5LBQA 1WXBA 3K2ZA 2K4YA 1VQOQ 4C0DC 3GLLA 2XPUA 2F5CA 2IRFG 2D0NA 1TT0A 3QOPA 3R6SA 4E7JA 4C2UA 1RI0A 2XKPA 2RK2A 3IH4A 1Z6RA 1SANA 2HQNA 4BKXA 2RGVA 4C92F 2EILH 4KUMA 1V76A 1IB8A 3QIIA 3QU6A 3A0HC 4M77G 2W25A 3T5XA 2M8GX 3GBGA 3M8JA 5FKLA 3H92A 3ZQLA 3CPWP 4JS4A 2KAFA 2NYSA 2HXIA 3QP5A 4BEHB 4ZYHA 1UECA 3IQLA 3VB2A 2O88A 1RUNA 5LRRA 3OS1A 4BJ5C 1NLOC 2FX0A 5CKFA 1JEGA 5JLXA 1WXUA 3CCSQ 3ZFJA 4A3FJ 3MWMA 2QGGA 3VYRB 4IUQA 4UC4A 3TEEA 1SF9A 2RM4A 4KIFA 3A52A 4PJOF 1QVTA 3GYHX 1RZ4A 1TQMA 5GAOl 2JA6J 3KLNA 4JYKA 1QQJA 3ZRGA 1T98A 2CO5A 1TW3A 4EPCA 1WNLA 2XG8D 1KD1U 2ZJRF 3CC4Q 2OUMA 3BR0A 4LB6B 2GA2A 2K5IA 1PYVA 5TRDA 2EPFA 1WHKA 5GANe 1T39A 3GIBA 3HIFA 2VC1A 3HHHA 3BP8A 3QJYA 2EV5A 1VQPI 2HOAA 2FMYA 2LC2A 4LITA 1F43A 3L2VA 3TO9A 1W70A 1G59A 1U9OA 2DQRA 3M59A 2GZWA 2X4WA 4C3IJ 5FKKA 3S3NA 1T0JA 3BJAA 3LA7A 4AFZC 3ZMTA 5HLTA 4MZPA 4OB1B 4QVZA 2BIVA 3NTHA 2B9SA 5KVRA 2EFQA 1OEBA 1NK3P 3H35A 2PX9A 2UZKA 2HOTA 2O8KA 2ZB9A 5GAN7 4I7HA 2YUPA 4AG2C 3KLOA 4A3MJ 5IAYA 1U5TA 2ECCA 5LJ3d 4HCKA 4ELZC 2FG0A 4C5EA 2LKPA 2L4MA 1X1BA 2HNHA 2JVGA 3QP6A 2E36A 3I71A 2BY0A 3KP4A 4XK4A 3ECHA 4M6YA 4N4HA 1IC8A 1R58A 4BJTA 5E17F 2ROLA 2X4JA 2V6EA 2RQTA 4BU2A 4J6WA 3QDRB 3QHSA 4J9BA 1APLC 2MVTA 1IV8A 2L9RA 1VQ9Q 4D1QA 3E7LA 4PSWA 2CH4A 4Y28E 3U9GA 2W0ZA 2AHQA 3G6EA 3OYNA 4PSXA 4BBSJ 3KP6A 3GCMA 1JXSA 3GFMA 5E1WA 3AAFA 5FO5A 2EIFA 1YW7A 4P9FA 2ISZA 2QDLA 3VS0A 4A4EA 4EDUA 3CCEQ 2DOAA 2DW4A 3D5RC 4D7NA 2I0NA 1FMKA 4QW2A 1W5SA 1ZSGA 4CUGA 2HNIA 4OIPF 4D0PA 1W36D 3LWIA 3A8MB 3DQVC 4HBLA 2ABLA 3K4NA 3F70A 3SDGA 2DK8A 4JRKA 2DLPA 3R0JA 3U2RA 4M7AA 4G7ZF 1K78A 1WJDA 1YIOA 2E5NA 3GF2A 4JQFA 4M78F 4Y91A 1BIAA 5IT9K 4HZFA 2CDTA 3WGHA 2W00A 1EH6A 3Q0WA 5J40A 5ILVA 2KBTA 1C1AA 5TISC 1FJLA 3RJPA 3G6EI 1AU7A 1BOAA 4IF4A 1R8OB 4J9EA 3VS2A 1MD0A 1SFKA 3E6MA 2VKEA 2YS9A 4LK1F 5F0FA 1X6OA 3PJRA 2E71A 3OYDA 1A6QA 1MBEA 1XN7A 4CCOA 2ZXJA 1I81A 2ZAEA 3QODA 2O4XB 2ELKA 2HDDA 5CPRB 3ZMSA 2QKLB 2GF7A 3LFUA 4FYXB 2EQUA 4HVVA 3HTUA 3HOUJ 3PIOA 1SSFA 4JJBA 2OV7A 2EGAA 2WACA 2ESHA 2RQPA 4G6DA 4DBQA 4DOVA 3DU5A 1QVUA 5B66C 2EQJA 5KYXA 1DJ7B 2PMHA 3RPUA 2R7TA 2ZNYA 1NLPC 4D6WA 1VQKA 1R9TJ 4M7DD 2LVMA 1TWCJ 2FXAA 2F5FA 3GTKJ 3OYBA 1B7TA 1UGQB 5EF6A 2MMPA 2BW3A 2K85A 5E3NA 3OY9A 1X6BA 3TEDA 2E64A 5LJ5h 1K9AA 1YBYA 1JB0E 1P4AA 1PRLC 3A01B 2LY9A 3F8CA 2DIGA 3LGLA 1IF1A 3TSZA 3VJPA 1IGUA 2DA7A 2MC3A 2NOJB 1UGSB 5KYUA 1D09B 2E1HA 4M77A 3KXTA 3CBOA 2DCEA 3U21A 2MUNA 2XGEA 4II2A 3K10A 1YFHA 5IT9E 1AKHA 2M30A 1B9NA 4II3A 1VQKI 2DMNA 1JO8A 3OW2A 1OCRH 4IOAF 1QWFA 3RCOA 1NM7A 5IT9R 1HYOA 5C3EJ 2J6KA 2QGFB 1D8KA 1OMIA 3K6GA 4GGGA 5KYYA 2L4AA 4L9JA 5GAN5 1ZREA 2FO0A 3BROA 3CBMA 1FTTA 1Y1VJ 3SWNC 1NZ9A 2CZ7B 5GAOm 1VQ7Q 4M7DE 4NDLA 3SDBA 1W7PD 1CF7B 3DEWA 1PVEA 3JCMd 4J7IA 5KNLA 5IYCJ 3BY7A 1KQSP 4Y33A 2DOFA 1IO2A 2ELJA 3GFIA 5IT9Z 2P7CB 1LQ1A 4LNPA 1XS9A 4RTVA 2NLUA 1TQIA 1RR7A 4RGRA 5EEAA 2IEKA 3V7RA 2VVKA 5DM7R 3OYYA 1S29A 4RAYA 4N4IA 2R4GA 3S3OA 3NFCA 1G3TA 4NB5A 4M7DC 4ESJA 2AIRB 2Q2EA 1T38A 4B3XA 4ENNA 1K83J 5EZGA 1HSQA 3G71T 3CD6A 2A7YA 4XQ3A 1UFMA 3T8TA 3ZMDA 4EMSA 1UUEA 1RKTA 4XTUA 3CO7C 1JJ2A 4M7AF 1KFZA 3BR3A 3PFSA 2XIDA 4M3BA 3BG7A 3KP2A 2DETA 2E12A 2KRCA 1U0JA 1WXTA 1AHJB 2WB1A 2MIOA 1YIJT 3CCUA 4CA0A 4M6XA 3FZVA 1ON1A 1IG7A 2UV1A 2DJZA 1X1DA 3C2GA 5M5YJ 5FLXK 2E5QA 4BQNA 3HPHA 2P0WA 2YPRA 3HJEA 4PK4A 1YWOA 2RHXA 1SC7A 4E6RA 3CCMA 4HF2A 2DMPA 5LFAA 3WODF 3CD6I 2DVJA 2M0OA 2C0IA 4LD9K 5FWCA 4U0VA 4A69C 1BW5A 4UY8I 2IGOA 3ZMVA 4LB5A 2E7XA 2XAUA 3TBIA 4ANJA 3LNQA 1VQ4T 4C5GA 2O9LA 4ESFA 5L3GA 1IO6A 1PCXA 2DFHA 3BQZA 4NC8A 1TBXA 5CLSA 4OIRF 5A0DA 3CC7T 1LDKB 2K9QA 3G1MA 2CJJA 2V8JA 1IRXA 2XDDA 2FEZA 1EA3A 3IUOA 1Z6TA 3CZ6A 3CCMI 3BCAA 1QO0D 2YT6A 3G4SQ 1YHQT 2HU9A 1RESA 5E20A 3M0RA 1MDMB 3SHFA 3BZ6A 3HRUA 1O4XA 4K11A 4RLFA 3K2AA 3CPWA 4M77F 3EPZA 4XAXB 2WAFA 3I55A 2ZNZA 1BU1A 2GXGA 3CCRA 1K8AR 5FKNA 4MEXF 1LUJB 2MW8A 2K9SA 2ME0A 4XLFA 3M7GA 3MD2A 3K1NA 3DB3A 1E7OA 2F5TX 5JI6A 2P8TA 1J09A 1DUXC 1BCMA 2FBKA 5D6EA 3L00A 2CQNA 2FQ4A 3P9IA 5FD5A 3FMSA 1IZ6A 1FBSA 1JT6A 1T0FC 2DL3A 4D5FA 4XNFA 1FYNA 1ULYA 1GVDA 1QZEA 1WIEA 2VONA 3MEAA 1SRMA 1JKPC 1D0ZA 1LDJA 5BOXA 5LJ3h 4J9HA 3S93A 2JMWA 3QPTA 5FLXR 2F2XA 4N0AA 1ACIA 4QSHA 3CUQA 2EFPA 4XIDA 1PP7U 3VWBA 2NUTB 4HVWA 3HEFA 3CCRI 2R93J 1WJAA 1ZLMA 4W97A 3MZYA 1FIPA 2NS7A 1UB4A 1FMWA 3H3UA 1Y96A 1USTA 2X6YA 3HSEA 3IAS2 4M9ZA 1TWHJ 3WTXC 2DRKA 2K2MA 4DZJA 2A5YB 4BY6C 4G6TB 1BB9A 4DQ2A 1MBHA 2LREA 2X98A 2L0KA 3H1CA 4V2FA 3M3YJ 4N4NB 1WQWA 1BC8C 2DBBA 3DTKA 3OYMA 4XR6A 1PUEE 3AL0B 2KT0A 4OAYA 2Z3YA 3GOXA 2IA2A 3OBWA 2XDVA 4GFBA 5FFXA 2A37A 4WXCA 1K9MU 3FISA 1V5EA 3ZQ7A 5IOYA 3FDRA 3LYIA 4X9CA 5IH2A 2RO0A 1Q81R 4RTZA 5ICCA 5D5XB 2JTMA 2PLYA 5LJ5g 1YTYA 1V29B 2HQAA 1NG7A 2DZ9A 2JS0A 3FK7A 3LQRA 3PM1A 5FJ8J 1VQPT 3I5UA 5L23A 2HYGD 3D0SA 1N25A 1DU0A 2DXIA 5AIPA 1NH3A 3HPGA 1UJYA 1X2KA 2V8IA 1IN7A 2JA2A 4FQGA 2VUBA 1WA7A 1FYMA 4GO1A 3JCMX 1KYZA 3MFKA 1VQ5I 1LB2A 1RAEB 2JNGA 2E41A 3RYRA 2HEQA 1ETXA 1A35A 2DTHA 1IDYA 2E19A 4OWRB 4CSWA 1RPWA 4KFCA 2K9GA 1YRNB 4M75G 4HA8A 2CSQA 3MEVA 2CUJA 1Z0XA 5C4JJ 1PSEA 5A2QZ 4C0DB 5M3FJ 1RABB 2KJCA 4MIMA 3CMYA 4RKUE 1IN5A 1B59A 1FIAA 1MMNA 1R7JA 1XSVA 2Z5UA 2VB6A 1JE8A 6PAXA 2VOOA 2UWMA 2XD0A 2YRVA 1M3CA 2LLKA 2OAZA 3L1AA 2CS3A 1SEMA 1YITI 2XICA 4AG1C 3PNYA 3AHUA 2JTEA 4J9DA 3ZN1A 5HS7A 1Z9CA 4R56A 1UTIA 4B09A 2KEAA 2RD1A 1H3HA 4M71A 3CMEA 1BR1A 1MH4A 1DPRA 2IA0A 2M1BA 3AFHA 4B1RA 4HOBA 4ENMA 1KONA 3CQZJ 3PFIA 5HCKA 1WJSA 3S8PA 5K1YA 1PG5B 2D1VA 1QPMA 3FM3A 4ZZLA 3CCJA 3G6ET 1HD3A 1TC3C 4HXJA 1Q7YR 4AYBN 1TL8A 4EVIA 2NVQJ 4YFKF 1WHMA 1YLFA 2DJIA 5I2SA 2BE5F 4K2EA 1VFCA 1RI9A 4KMUX 4IHXA 3CMEI 2IGKA 2FJ1A 2CGPA 1WJQA 3DXJF 5C4XJ 3EGXB 3VYGA 3WGGA 4Z02A 1X3WB 2R7OA 1IZ1A 2ZMEC 2HPMA 4IXAA 4BDZA 1E17A 3C12A 2TRTA 2M87A 2FPEA 3E9GA 4IURA 2RI5A 1QHHD 2W57A 2EQIA 4QT7A 4O5VA 1NPRA 4IJAA 5GAN2 1B4AA 2IPQX 3C18A 4KIBA 1WQ7A 1VQ6Q 1U5TC 4UB8C 4M72A 1IUYA 2QQSA 4OU0A 2XHCA 4FT2A 4LUEA 4QWQA 2L9VA 3M55A 2FEIA 1EIFA 2KGTA 2QQBA 3CP8A 3ML6A 2HI3A 5KH6A 1NBEB 2OTLI 3PGGA 3UPUA 3DEUA 1UGRB 2EB7A 5CQXA 3TREA 3VV0A 1Q82U 4EJOA 3OYJA 2EJRA 2FPFA 2MOXA 2LBFB 1SD6A 2MBFA 2FZGB 3SYTA 4C2TA 1IHVA 3QO3A 2VKHA 5FB2A 1TUDA 4C0FA 2QQ8A 4E7SA 1HCRA 1XCBA 3P9KA 4ETSA 2KXDA 2BBYA 1VQKT 1KQSA 4KA4A 5DYMA 4A3JJ 4NL3A 3LMMA 2YXYA 1VQNA 2H3EB 2QI2A 3S15J 4KH0B 1AHDP 5DTDA 2ZCFB 1Z9QA 5M5WJ 4IOCF 2KP6A 5GAHJ 4C92G 2PN6A 1WI3A 3NRVA 3PNTA 2L7KA 3HC7A 1XD7A 2CG4A 5CO7A 3OMCA 4M3FA 5C44J 1K4SA 2LRQA 4CI0C 2EFNA 2LKXA 2RNGA 2RC4A 4RS8A 3IH2A 3JAMZ 4JX6A 4XTYA 2PJRA 2F69A 3CCLQ 3OIPA 7AT1B 4EQQA 1D1BA 2DODA 1VNDA 2WBMA 3JCMJ 4MO7A 2FA5A 4AIKA 1KC8R 3CXCS 2MI6A 1VQNI 1AVZC 1FXXA 3EAEA 2VI6A 4A5NA 4RAGA 1GDTA 1MNEA 2X3XD 1Z3XA 4MHGA 1QCOA 2KYMA 4J9GA 4PJOG 4A4GA 4AMCA 1K8AU 2BXZA 1RKWA 1NHAA 3J7AF 4I0BA 1MZBA 1XSXA 2JWTA 2EINH 2VODA 4CH7A 3S2DJ 1JBMA 2CP0A 2K9NA 2VUMJ 2CYZB 2WC2A 1YI2Q 2F5VA 4CRIA 4BYYA 3GMEA 3WE3A 3ROUA 1M27C 3QYHB 2VJIA 1TWFJ 3DTEA 4ESBA 3C94A 1XSDA 1FP2A 4Y7NJ 3ER0A 3I59A 4XN0A 4M77E 2QZ8A 5BPIA 1F9NA 4LLNA 4JRIA 2G7UA 3CJQB 4Z8AA 4IUPA 4DW6A 3EYIA 3EYYA 1X75C 2L0AA 1K0XA 2R92J 1Z9ZA 4HPQA 3LA3A 3IV5A 2BE7D 3GFJA 2R5YB 2KRMA 2PVGB 2CP6A 5EYRA 1H88C 2KZVA 2DTRA 2OTJI 2CQQA 4M75B 3CJNA 3CD6T 4FYVB 2JRMA 2H1LA 1HDDC 5ERIA 2QQRA 4M77C 3X26B 3VUZA 2MD0A 1ETKA 2FE3A 3COAC 2JVHA 2H94A 2PEXA 2DMTA 1FOYA 3WG9A 2LQKA 5CKHA 4FE7A 3NARA 4EM1A 5GMKi 5GAEJ 2EZLA 2W85A 3CCUT 1R1VA 3KBGA 1REPC 2AKKA 1U9NA 4J9FA 2P4RA 1LFPA 4LOCA 1VF9A 4Y3OA 1F1ZA 1RC9A 1CKAA 4GCVA 1JXMA 3HL8A 3EUAA 4FW1A 1X4OA 2Y0SN 1OFCX 4IHVA 1Q81U 3CCMT 4IKFA 2IGMA 2A36A 3SEMA 1YJ9A 2JZYA 4EV0A 1G4DA 1HKSA 3L2CA 2OTJA 1KD1R 2V1UA 1W0TA 2H6BA 1ZRFA 3SEQA 4ENKA 2KIUA 1KQ8A 2DL5A 4BY7J 4AD9A 1ETYA 1W6XA 4CYCB 3HTSB 4NOYA 3S6WA 1HDPA 3EG9B 1KD1C 3CMAA 1M8VA 5HDGA 4I98B 5M9OA 5GAOp 2R5ZB 2DD4A 3DU6A 2ZPBB 5E1XA 4UNOA 4LG0A 2HAXA 2OCCH 2OD5A 4CICA 4PUSA 3WHBA 1U3OA 3CC2A 1Y8QB 1ZN2A 2RF0A 1MMSA 3J7ZI 2CP3A 1UB9A 1YJ9I 1B72B 2DO3A 1R1UA 5DV5A 4IO9F 5B1BH 4M78G 3ULRB 4KBMB 3OYGA 3C2BA 2DTOA 3UF4A 2HKQB 1DU6A 2HQHA 2WAQN 3HFOA 2HQEA 1WJ5A 2YX7A 4BE0A 1PD0A 3EG2A 3I55T 3CCRT 5DLOA 3KFVA 2RNJA 3CMAI 2XRLA 1T95A 2RV8A 1KGSA 1OR7A 4X1VA 2HBWA 2RB6A 2KIQA 1B8IA 3BFMA 4G7OF 5CCAA 2DEUA 2VN2A 2KFDA 3LQQA 1FSHA 3JB9H 3VSLA 2QBYB 2CZ6B 1RI7A 2ZJPF 1A6IA 2B7EA 4E4HA 1ITYA 1HK9A 4OB3B 4RG2A 3NGPA 2WB1N 1A36A 3KFWX 3A03A 3RQIA 2EBPA 1BI3A 1QVPA 3EH1A 5KCHA 1IREB 1I50J 3E3VA 4S0HB 1FTZA 1XX5A 1BK2A 1Y1WJ 4EMKA 1QP3A 3JCMh 2CQKA 4A63B 1TUCA 2A69F 2HSEB 2IJLA 2EYWA 1NJIU 4LLLA 3C0CA 1J0RA 1W7PB 2VC8A 1JHFA 1T33A 3JB9I 1GXIE 1OKRA 2OCEA 3CF5F 1SAXA 1M3AA 5KYWB 1ARKA 4C92A 3U23A 1Q7YU 4MTEA 2LG4A 4O3MA 2C0OA 2MAMA 3I9QA 4R55A 5GAMh 2RKHA 1OU8A 4XLEA 2ETHA 3RMQA 2EW3A 4EGYA 3HUGA 3KCCA 3H5AA 5KAIC 1FBUA 1LNXA 4JPBW 3VS6A 4J19A 3R6NA 3K0LA 4R0KA 3M8EA 2CW8A 4XLAA 3TSWA 1YX3A 1XJWB 3LGFA 3L2RA 2GCXA 1I8FA 2CWEA 3IHUA 1UAAA 1FX7A 1QVFA 3U1DA 2VBYA 3GW2A 4L5JA 1ZR2A 2VKNA 1TP4A 1JGSA 4BAYA 1QZYA 2L8DA 4N0AC 1FY7A 3REOA 1OI1A 3H0IA 4MDXA 5D8LB 2HKOA 5E8IA 1ZSZA 5DY9A 3X24B 3K4KA 1MBFA 2A68F 2HWVA 2K02A 4PCQA 2CV0A 4NQWB 2MC4A 1BL0A 2LCCA 4L9VA 4ZGJB 1ZHFA 4GLKA 1YJWA 1VQ8Q 2C06A 2KHMA 2KISA 1QVFS 5CVIA 2YUOA 4FSSA 3LWHA 4GRIA 2F6CA 1FSEA 3AL0C 2AT1B 5LEKA 1HSTA 3H9GA 3DPUA 1HC8A 2O0YA 1FP1D 2XV4S 3PQKA 3CJTB 4FTHA 2X4YA 1K4TA 4JUVA 5D6YA 1VQOA 4M7AG 1NG6A 1FYLA 3FJPA 2HQRA 3RDVA 4Z2YA 2Y30A 4JRPA 3OSVA 2DFFA 3VYSB 3JRZA 1VZ0A 2B8AA 3IP4B 1YJNI 4XLHA 1Y6IA 1QLYA 2KQRA 2GM4A 1YJWI 3W2AA 4XL9A 3K4CA 4B9WA 1EH7A 3H9QA 2KMTA 4TVRA 4BB7A 2OPTA 1JGGA 5FWBA 3CMET 1S7AA 3G71Q 3JB9F 4E47A 1KC8U 3L09A 3TDZC 4XU0A 3MMYB 3HHTB 5LJ5e 3JCMQ 3C4SA 2X3WD 2VBXA 3FB9A 3PMIA 4G8XA 1VQOI 2CZ1B 1MBJA 1BBZA 3CLQA 3DLAA 1QA6A 2V1XA 5AIQA 2DERA 3VS4A 1I4K1 1MBKA 1JRIA 2E60A 4AWXB 4ME7A 1ZK8A 4XKCA 1GT0C 1MV0B 4B3AA 3FXLA 1I6XA 3UNGC 3ZQCA 2EVRA 1SFUA 1I5LA 3QPLA 1PSFA 2J6FA 1BM9A 2IS4A 2VPRA 3TKYA 2FL7A 3MVPA 2L3DA 4Q48A 5CVUA 1OPKA 3R0AA 4AFQC 5F1RA 2YRCA 3S2WA 2DPDA 1R0BG 3H6ZA 3MP6A 3RESA 1TS9A 4X9DA 2H8RA 3CF2A 2QGUA 2E35A 2X1DA 4DZPA 4BE2A 5E3LA 2Y4YA 3CC4A 2VXFA 1OISA 3AG4H 1MIJA 4W1UA 3J7AW 3HKSA 3DF8A 1BN5A 2GA1A 4JX4A 3K70C 3CCSI 5LJ3f 2W10A 2YUNA 3THKA 4F7UG 3IKVA 3GP8A 2ELHA 5EDNA 1BJAA 3CC7Q 2QYOA 1T3SA 1YNZA 3LLRA 2MPXC 2E5KA 3JV3A 2C0TA 3BTLA 2IXSA 1YHQQ 3R61A 1A04A 5GMKl 1VQPA 1HW2A 4PGGA 1ZBJA 3FXQA 5BPDA 1WGSA 4AYBA 1WHHA 1ETOA 5J1UA 3MCZA 4BUPA 2DJQA 4LE9A 4XOPA 3VS7A 3CC4I 3DKXA 4XLCA 3PUBA 2MG4A 1F5TA 3DPTA 2AK5A 1WH7A 2HGCA 1XTDA 3DKMA 3F22A 2F5EA 4MGRA 3QZ5B 3I9V2 1VQNT 2Z9OA 2P0KA 3MHXA 1WH5A 4I0AA 2YHTA 2RH2A 1V5GA 3EUKL 2CMPA 4A6EA 5J6XA 5EG2A 3PFYA 2K40A 1Y39A 3F6OA 4OF1A 2EGCA 3T8RA 4KICA 4HNTA 2R7RA 3HRSA 2E6ZA 2VASA 5E79C 2XK0A 1PRMC 3CTAA 3GO5A 4CZZA 3ABLH 3CDHA 1IRGA 2CP7A 1AA7A 4S04A 4A3EJ 1PP8F 3UA6A 2LKSA 2ZC2A 3HFNA 4LD5A 2KVQG 4LUDA 2ZMEB 1M8MA 1RETA 2E2HJ 2DBKA 1I39A 4ZZDA 4IL6C 3JRCA 5BS6A 3BT9A 3W2VA 4DNCA 3RTRA 4ZTJA 4NHJA 4LFUA 2L2OA 3JCMV 5CVJA 2EYQA 2BZTA 2CQ7A 5LHHA 1U5TB 4PLLA 4FL6A 3WE2A 4BQAA 4Y92A 1S6LA 5J39A 1HOMA 5LRSA 3WU2C 3NAUA 5GAMg 3BPVA 1VQ9I 2DAOA 4MNUA 1QMCA 3RIRA 2M51A 4IIMA 4C8QA 1RQ6A 2KROA 4Q5WA 1E6GA 2AO9A 3BQYA 4G6QA 3H0HA 2EYZA 4MZMA 5J4YA 4YELA 4BD3A 1YS6A 2XDPA 3R6OA 3OYFA 1UHCA 2CSOA 3BDLA 5HDKA 3M0UA 4WXHA 4XQFA 3UKGA 2HTJA 4KMFA 1UE9A 2JPBA 2M02A 5GAN3 4V2SA 5FLVA 4M75D 3KP7A 1R5HA 1Q95G 3NTIA 4IUTA 1K9MR 2OU2A 3VODA 5D5VB 5FRMA 1DQUA 3DEEA 3M07A 2M8EA 3MP1A 2LNHB 2RI3A 3BG9A 4PJNA 3F23A 1JQQA 2HXOA 2O2OA 1GXQA 3KEOA 3UA7A 5LJ3e 5J1YA 1ETWA 2R0QC 1U78A 1G6NA 1YO5C 1J59A 1WFWA 4J5YA 2ROTA 1T8IA 3ZCOA 1K78B 3P8BB 4XTVA 2MD5A 2VXEA 4A54A 1NG2A 2D8HA 5LHGA 3UDCA 3WU0A 2NVYJ 4II1A 1X4PA 4Y17A 2B63J 1UEBA 3ERED 3QUIA 5FKOA 2X48A 3EHQA 2E70A 4M3GA 2E4HA 4F93B 3JCMf 4BI4A 1M2VA 5E8GA 5GADJ 1YJ9T 4BQOA 5ECAA 4BE1A 3HOVJ 4AVPA 2EQMA 1OCCH 2J06A 3ASNH 5GTIC 3VEPA 2K3XA 4L0ZB 4M75E 1POGA 2QQAA 2JT4A 4ATOA 2K5CA 5CQYA 1XGOA 4VUBA 4IHYA 1FPQA 3A1PA 2IS1A 2DL4A 3CMAT 2WV1A 3W6JB 3LW5E 3LSRA 2DI3A 4X1EA 2I8DA 1YP5A 2BOLA 5LGUA 4E7IA 2IVWA 2GBYA 1O3TA 2VGNA 3H8ZA 5KYXB 1SHFA 2BE9B 1RACB 4OMPA 1MH3A 2Y0MA 3AG1H 4YIFA 4M75C 3CC2T 4XMYA 4AVZA 4YIIA 2XMFA 1YW9A 2BW3B 3L2UA 2FRHA 4F7ZA 2HL5C 3O8VA 4ENJA 4C0GA 3HG9A 1R5GA 4E70A 4HSRA 2VQCA 4AFUC 1MSFC 4BI3A 3B6AA 2Y0SA 1OCPA 2X0LA 4M77B 1TTHB 2Y90A 4F7UA 1GFDA 4PKCC 1AWXA 2ISYA 1AKHB 2QQ9A 2YR2A 3SXYA 3M56A 4MMLA 3DLMA 4A3KJ 5TJJA 5GMKm 2DPUA 4E7LA 3WTYC 3NMZC 4I09A 5IT3A 2XAQA 2FF4A 3A01A 4ZDPA 4IX7A 1O7LA 5KYYB 3LA2A 2YLCA 4C8QF 2VKDA 5TGTA 4BY1J 2NXNB 1WLPB 2BUDA 2RPNA 5A0GA 1M3BA 3I4NJ 1SD5A 4RMOA 5FKMA 2VIXA 2R7XA 1UELB 2X6XA 3S1QJ 1NTCA 2DK5A 3K4BA 4CC3A 3ESWB 4YFNF 2XSDC 1NEGA 2VGMA 4O6JA 4C92D 4UHTA 3CXCP 1UZCA 2Y48A 1L0OC 4CC7A 3FMQA 2WAQA 3RKWA 1R0CB 2X51A 3ZGKA 1VYUA 2XDBA 1I27A 2DMQA 1AOYA 2LQWA 3AT1B 1HXDA 3AG2H 5HDNA 3TU4K 5HLHA 1WPKA 4I6ZA 2XUBA 1Y07A 2Q2EB 3FK6A 1EV7A 1GBQA 4JDSA 5GJVB 2HZTA 3E6DA 2FD5A 2F2VA 3JRBA 4XLPF 1LJ9A 2EZKA 2BHZA 1ZA1B 2GQIA 1WDXA 3NPFA 2JTFA 2NVTJ 4OMLA 4ZDLA 3H36A 4IHTA 1EX4A 4V2GA 4QPQA 1Q82R 4PJOD 4HG2A 1GUUA 2ZGWA 1EFNA 1ABOA 2K3PA 4BACA 3JCMe 3WTSC 5JHFA 1F36A 3NQOA 2DA2A 3FIFA 2MFZA 1ZLJA 3I54A 1G3WA 2XKOC 4C92E 1PC0A 4Q5SF 2PBIA 1CKBA 2QSHX 2R7FA 2OBPA 2XVCA 1MUZA 1YJWT 2E1NA 3Q0UA 1TXQA 1ACMB 3TDUC 4IHSA 4YEJA 3GX4X 3G4SI 3V7SA 2M35A 1Y8RB 3MZHA 2CUBA 8ATCB 3F8FA 4F91B 4KYWA 1LKXA 2GAUA 2M9HA 2K9LA 3TOBA 1YS7A 1VYTA 5GANh 4C92C 2ID6A 1MJ9A 1W1FA 2NWMA 4F52A 5DUIA 2O61A 2XRNA 1M4ZA 1VQOT 3HSBA 5B5EC 4A0YA 2EQKA 3O5ZA 3ZMUA 2BXYA 2M0CA 4PJOE 4RCBA 3TGNA 2GNCA 2OAUA 2LJ1A 2OQRA 3L7WA 2H09A 5FROA 2RN8A 3DB4A 3JSCA 4C3HJ 2E3HA 2PQ8A 3K1PA 4GYIA 5F08A 2NUPA 2ZZDA 1S72Q 4HSTA 2D1XA 1GLNA 2FRWA 2O31A 1M9SA 4QKUA 2O8XA 4HW0A 1IGQA 1W1WE 4HX7A 4NBQA 1ZH5A 4F7UF 2GTOA 1SG5A 2XF6A 2XGXA 4OMYA 3DV8A 2F1LA 2QK0A 1KYWA 4HLYA 3A02A 2CRGA 3MP8A 5A2QK 2YDLA 5EG0A 3LSKA 4PJOC 1QGPA 1K8AC 3IRRA 3URGA 4F55A 2DU9A 1RLPC 3OIQA 2PU9B 5C6SA 5L3EA 2EFOA 2IG0A 2SRCA 4JX5A 2KSSA 2JK3A 1TQPA 1ZSZC 2H3JA 1Y56A 4G12A 2HCKA 1RLQC 3CCUQ 4MQ9F 1XMXA 4I2OA 1X69A 2D6FA 2V26A 2XI9A 3BPXA 1IV6A 4ZNXA 2V9PA 3CUQB 4BHCA 1ZKGA 3HOWJ 1U5SA 1YCYA 5AYFA 2LFBA 2RA2A 4CZCA 3CCMQ 1Y96B 2D1HA 2BZXA 5GMKh 4XRSG 2YUSA 3KEYA 1BYMA 1J2XA 1QU3A 3B6CA 3E5XA 3F8MA 4RB1A 2HDWA 3SFZA 2DX1A 2STWA 3MKDA 3OBYA 2HMAA 3VUBA 2EGEA 5J26A 3V8LA 1OCOH 2Q0OA 2D8JA 3CC4T 5EC7A 5IP7J 1KJWA 2GIZA 2RNAA 4LDWA 1D1AA 2ADUA 2XAHA 1BR4A 2GFUA 2XIGA 1VQ5A 1QQIA 3PO2J 2RHYA 1D3BA 2NUTA 4B48A 1SPKA 2V9VA 4KUDK 1SFEA 3BR5A 4B9XA 1HKTA 3TQNA 3E9FA 2FU4A 3GEZA 1S9HA 3OS5A 3A8OB 4RTYA 2LTPA 3ULQB 2AQEA 1UGVA 3QPSA 2XPVA 5A2QE 1WHLA 1X01A 1Q81C 1WI9A 3CCVQ 1VQMA 5DCMA 4KIGA 4DYRA 1Z7LA 2HVSA 2K57A 2Z1DA 4KGXB 4CC2A 3I55Q 3ZMZA 2FZKB 2NNNA 2H8HA 2DT5A 5A2QR 2GTJA 2BKDN 3GTGJ 4HV6A 2BVLA 3IKTA 1YITA 4M78E 2JQ7A 3GF5A 1QW1A 1PDNC 1PUFA 5ILUA 1V5FA 1X58A 2NAZA 1GCQA 3BZKA 1B34A 1JT0A 2E1CA 2VYTA 1SFXA 3DTIA 3HDDA 2KRSA 1QCFA 2ME6A 1TTYA 3GNFB 1FT9A 1QHGA 4JK1X 2YLBA 2DXTA 3JCMb 3V42A 3J81K 4HAMA 1VQ9T 2KDOA 1VQMI 4J01A 1ZELA 2DVEA 2X4XA 4M78C 3GZ5A 1FC3A 2JA8J 1MMAA 4HDUA 1PD1A 1IRFA 2CH0A 3FMRA 1RAFB 1XOVA 2IIMA 3A8GB 3EFSA 2QVOA 2RHUA 4RB0A 3E19A 4M7AD 1XB4A 2EIJH 2H8WA 4JOMA 4HDVA 3LH0A 4D8DA 3K4MA 1IJWC 2CS7A 4RM3A 5CIUA 2LK2A 1QVFP 4IPAA 1KU7A 2DK3A 2HD0A 2COBA 4KULA 1A5JA 1GBRA 3NWTA 1I1SA 1IDZA 8AT1B 1TW2A 1ZG3A 2DN0A 4OOIA 2LF7A 3E5UA 3JAMK 2Z99A 1E6HA 4HRIA 1VQ6A 3S1NJ 2R7SA 1NJIR 3BE3A 1YX5A 4ZDOA 3JCUC 2CREA 5CAIA 3RBBB 2EQRA 2WV0A 3GTLJ 2DOEA 3E6BA 3GPLA 2R57A 1MGQA 3OB9A 1V55H 3CCQA 1FNNA 1STZA 4H4KC 2EJGA 3W6KB 4DEYA 1IW7F 5E18F 2A05A 2VE8A 5GAMd 1TWAJ 3W2WA 3CQTA 2BEOA 1E3OC 1DPUA 1Q7YC 3J81E 2QTXA 2KIFA 5DM6F 2OTLA 3QYBA 4JBAA 3AKZA 1VQ6I 2ECBA 4QQ6A 1LNWA 2OF7A 3FIWA 4P9UA 1WJEA 4Y15A 2DL8A 3L2ZA 3Q9VA 3H9NA 4LN2A 3PVQA 3DCFA 1J75A 1BR2A 2HEOA 3OMGA 4XONA 3FM5A 3J81R 4RM2A 3RUXA 4XU3A 2GXBA 1HBXG 1K61A 2KLOA 2D2WA 1LJOA 2XU8A 2A3LA 2R7UA 3MEWA 2PQWA 3TL4X 2KYBA 5GANg 3VS3A 1GRIA 3JB9G 2IAIA 3G1LA 2CYYA 2X1EA 4DBRA 1BI0A 3CCQI 4A3DJ 3WVEB 3OMYA 4UVCA 2M34A 4EM2A 2IS6A 2QTVA 1FMVA 2V8KA 3JB9J 2G3RA 3CDIA 2MZ4A 1SD7A 4BGDA 2FVUA 2K7LA 2R7DA 3J81Z 2GXAA 3JAME 2JN6A 1FBQA 3O6BB 1P7JA 1FOWA 1N9RA 1OYWA 1H9GA 3QSUA 5FU7B 4ABZA 1JKOC 3RPUD 4KN4X 4OGCA 2QEXA 2TDXA 3HL2A 1WHUA 4M7AE 3JAMR 3CMEQ 1VA7A 1WZOA 1KG1A 4ZC3A 4HX4A 2DTIA 4BI8B 1B3QA 1L3LA 4IIOA 2COMA 4XKWA 3JRHA 1T0HA 5CQEA 1YN8A 3M0SA 5F0CA 2A5WA 3JRDA 2EPDA 3A5ZB 3CXCA 2UXXA 5KAFC 4M73A 2HDAA 3I53A 2LJ0A 1QCNA 4XU2A 4XRSA 5F64A 2ACJA 2LCSA 3GTQJ 4M77D 1ZR4A 5AT1B 3CCJQ 2L7FP 3S32A 3OA6A 1IXDA 4V19K 4M7AC 3HGYA 3EH2A 3KYCB 6AT1B 3LSMA 1RAAB 3T0YA 2QEXI 2IVMA 2PJRB 2JS2A 2FPDA 3I56A 3PIPA 4CXFA 3G7ZA 3IL2A 4FETA 2COYA 4P96A 1BI1A 5IXFA 5L8RE 4ZTFA 1YI2I 3DBHB 2PG4A 2JPCA 4L59A 2G9WA 3BTIA 3LSIA 3DPLC 2JSCA 1KQ9A 2AHJB 3DWLE 4N4GA 1WYXA 1RAIB 1KC8C 2VQGA 4OVAA 3TO6A 2ZJ2A 4IRHA 3QG1A 1RADB 5CR2A 4KT6A 5L3BA 2D45A 1G2HA 3SZGA 4XTXA 1ABQA 4MLOA 4CCKA 4UUSA 5A0LA 2LC4A 5JVGF 4RLQA 4GDFA 1Z67A 3CLOA 2CGHA 5F04A 4XLNF 2R3SA 3I56I 3K1MA 4E7KA 1XPXA 1U3EM 3IRQA 3I59B 2XF7A 4F7UE 2QWWA 3GLXA 4F16A 3VPRA 3L1PA 3MAJA 2DTZA 1Y71A 4MDWA 2XB5A 3RI4A 2XC7A 3EG3A 5ICEA 4A3IJ 1AEYA 4RA2A 4P55A 4BXUA 2Y31A 2COWA 1VQNQ 2NS0A 5KCMA 4BJ6C 5IOZA 2V4JC 2L9NA 1Z7UA 1JUPA 4YRVA 5IYBJ 1EJ9A 2QDYB 3T1BA 3TO7A 4RTTA 5IXBA 4C5HA 4JJCA 2DILA 2BY2A 3M1CA 2O3FA 3C2HA 1S8NA 3INZA 1JUMA 5HNFA 3F8NA 4PNOA 2CQXA 3REAB 4A4HA 3O2PE 1TSFA 3FKIJ 3SZTA 5F27A 2A08A 3HP9A 2RREA 4HKEA 4LD6A 5LLQA 5HODA 1ZRDA 5L3FA 3JTGA 4A3GJ 1LE8A 1S7OA 1XQHA 3BR6A 2KQWA 4FSXA 4FYWB 2L01A 3VOEA 4FASD 1JKQC 3HOXJ 2D9TA 2DO7A 2QM3A 3ONQA 1ENHA 3J7AO 2CZ0B 4B43A 2EKHA 4ZH4F 3D5SC 3VYUB 3DLLA 2GOXB 4I99C 5GANd 4ZN1A 5J47A 1JU5C 3E5QA 5GPAA 2DA6A 2DA5A 2F4OB 4DGWB 2M4KA 4HNVA 2FHDA 1N5ZA 1P9QC 2ZPIB 2QLZA 3BLYA 1TNTA 4R8HA 4WWCA 1XTAA 4WTOB 2LR8A 4PJ0C 1TT5B 2R7WA 1H9TA 9ANTA 2IT0A 2K6DA 1DGRM 5BNGA 5JHUA 1ERDA 2MLGA 3CCYA 3NHNA 2D5VA 1XDUA 4OMZA 4LG0B 5LJ5j 2R58A 4RG8A 4G94A 2E1OA 4DYCA 2PMUA 1WHGA 1W2BA 4L18B 1HJDA 4IVNA 3SWNA 3F21A 5FFZA 5IP6A 1D0XA 3PIPF 3VRYA 1SSHA 3FJ5A 2OQGA 4J83A 2LJ3A 4RTWA 1R49A 1VQLA 1V54H 1Y57A 3KX2A 1YE9A 1ZTRA 4IQJA 1SVOA 4OMFB 3TOAA 3P5JA 4IUVA 1H89C 2JUCA 2V9KA 1P4WA 1AWCA 4IHWA 2K4BA 2PNIA 4NC6A 4B4CA 1B8IB 1PM3A 2KE9A 2IPOB 5LJ5f 3W6VA 3FBIB 3QWYA 5B1AH 1B9MA 1HQCA 2OZUA 2ZXWH 1V1CA 4M7DA 2P81A 2W4SA 2DYBA 3QBYA 2AQFA 2W7NA 4A2UA 3S1RJ 1Q1VA 3A98A 3J80Z 2YSRA 3K7AJ 1BCOA 1HKQA 2LF8A 1LFUP 4EMKB 2CW0F 1FZPB 2JUFA 3M0QA 3EGDA 3JCMc 5BQTA 2L3RA 1YJ9Q 1D1CA 4G9YA 1VQLI 1QWEA 4L9TA 4WF2A 4DIQA 3O8HA 1SRLA 1BBYA 3S1MJ 3EFOA 2JA7J 5F1JA 3VS1A 2JZ2A 1V4RA 2GLOA 5D5UB 2RJFA 1PKTA 3BR2A 5J8CA 1VQ8A 3PL8A 1EF4A 3H9JA 1RUWA 4C92B 1QVGS 4LLGF 1MGTA 3CMAQ 2QF7A 2CSIA 4JLGA 1VQ5T 4YTLA 3WXMB 4DA4A 3ZQHA 1QZZA 2UUZA 4DYQA 3M9QA 3P7NA 4AIJA 4FCYA 3MJXA 4UXNA 1R4MB 3HRMA 2DT6A 3QYEA 4A3LJ 5KHDA 1SEUA 3CC2Q 3LSJA 2X9HA 1WJCA 1H92A 1B6AA 1YW8A 5D6WA 1T6SA 2DDBA 2LSOA 1P7IA 3WU1B 1VQMT 2EKOA 1X1AA 4C8QG 3BJ6A 4U88A 3A1YA 2VBWA 1H0MA 2ZBKA 1VQ8I 2J7IA 4OMMA 4OMNA 4AC0A 3CJRB 3S17J 2RAEA 4PJOB 3RSNA 2HOEA 1WRJA 1N8RU 3N4MA 4YIRX 3HOYJ 1WVRA 2QA4A 3CUQC 3DLLF 2CV2A 4EJTA 1YITT 4A4KA 4HT8A 5CYVA 1GCPA 1M1GA 4KJZA 2N8GA 3N97A 1YJNA 4UV8A 2KZGA 1ZSZB 4IRGA 1MNMC 4FIBA 1P4XA 1RL2A 1ZARA 1KQ1A 2ZXHA 3CO6C 4LDVA 3SHWA 3FWEA 1NE8A 1M1KR 2M2EA 3K9TA 2QSFX 1X1CA 1EH8A 5BMZA 4GBQA 3MKYB 3ZQGA 4D7MA 4XICA 5J1RA 2JN0A 3MKWB 3NEUA 2M4GA 2KXCA 2P84A 2QCOA 2L2PA 2EZHA 3BY6A 3F9KA 2WTEA 3E97A 3ERMA 5HLIA 1T0FA 3K70D 5IHNA 4XKVA 1G3YA 4BXXJ 1NYFA 2QA4I 1R6RA 1VIFA 2RQVA 3G71I 5K7ZA 1OYYA 4JZ4A 1U6GA 4EJWA 4EJUA 2JJ9A 3NWSA 3BG6A 2RI2A 2QUFA 4NQWA 3N5BB 3SFMA 2LQ8A 2BTTA 2RHZA 2LVSA 4FM4B 2EH3A 5GAGJ 3RERA 3M54A 1E2XA 1ON2A 1SMTA 3EDPA 2ZO4A 4B8XA 1YWPA 1TWGJ 4L5EA 1S3JA 3GXOA 3J7YJ 1ZA2B 1VQ6T 2DA4A 2IBDA 2STTA 4L5GA 2X6WA 4B44A 4XOTA 5DEQA 4M7DF 1ONVA 5LJ3j 1BJZA 5D5WB 2IP2A 3CCSA 1G2BA 1UCRA 2E1MC 2DQLA 3I64A 4N9HA 1U06A 4EIKA 1YIJQ 5J3BA 2KL4A 2VOPA 1O7FA 1GCQC 4QQGA 2EV6A 3DKYA 4HCCA 1R5ID 2JVVA 3S16J 5EGOA 4J9CA 3CCQT 1CQTA 3PT9A 1N9SA 4A0XA 2H6CA 2DM1A 2VPLA 2NS8A 2O5RA 3H0FA 1K73R 1JUSA 2OTLT 4YG2F 2EBIA 1ZRCA 3KIOA 2JT1A 2DJNA 3A8LB 3MN2A 2XSJC 1SVMA 3O3KA 3VDXA 4Q4ZF 3META 4F04B 1YJWQ 1QP2A 3X25B 1HW1A 2X85A 1LFBA 2YX4A 1N75A 1X2QA 2LOOA 4KISA 4LXCA 1VQ4Q 3CP2A 1Q86U 4M78B 1ZX6A 4ZJZA 3CPFA 1I5ZA 3E6CC 2FZCB 1KK7A 2ESWA 2I2LA 2LH9A 2WY8Q 3H41A 2MSYA 2Q1ZB 1LOJA 4KNYA 2TCTA 2NVXJ 3DBRB 3ZOBA 2MWOA 4JLIA 2LX7A 1AZEA 2O9SA 1NEBA 2NVUB 4XSZF 2PI0A 4P5NA 1M90U 2ZSIB 4D9JA 4HQEA 1WJFA 3A4CA 4QLCU 5H6RA 1EZZB 3TP0A 4ESRA 2LCLA 2I5UA 2QEXT 2W84A 1K1ZA 4U7DA 1OCTC 2QSGX 3OOUA 2VT3A 1XMKA 3VSKA 5GAN4 3PUFA 1DP7P 4BEHA 3EUHA 2FSWA 2Y4XA 4MFEA 5D4SA 3Q3SA 2ZPEB 5IY5H 4AU7A 1YI2T 3RZDJ 4KN7X 2VC0A 3VFZA 2R5AA 3BW1A 2MABA 4RAFA 4CCMA 1BI2A 4A12A 2FBIA 2B0LA 2IA1A 2P0TA 5DD4A 2W48A 2MH2A 2ZCWA 4R79A 2VE9A 1OX8A 5CKDA 2LRDA 1VQ9A 2Z16A 2FOWA 3OYAA 3GTMJ 1NYGA 4HX8A 5ILSA 4J6YA 1K4US 3QDFA 5B3SH 3I56T 3CCEA 1OQYA 2DPPB 1Q1HA 2K5FA 3F8BA 4LG3A 1O3RA 4BY6B 2FQ3A 3C3WA 4R1HA 4JRQA 3R4KA 3BTCA 1ZG5A 1X3UA 5KYNA 3OYIA 4OGEA 1WQ2A 5D6FA 2LDUA 1BC7C 2CW7A 3QPHA 5HK3A 2PTKA 2EZIA 2AZVA 3Q5FA 3MKZA 1J9IA 5FU7C 2DYIA 2A6EF 4BXFA 2XF5A 5LGNA 2GBQA 2A61A 3CEYA 4RGUA 2B86A 2YWWA 4E2FB 4C8QB 1XMAA 1KQ2A 3FXUA 4ASNA 3CCEI 3KE2A 3HOTA 1VOMA 5GP9A 4A0ZA 2ZMEA 1ZGJA 3M53A 4BDYA 4M4ZA 4P5OA 1XGNA 1E0EA 2M1HA 3VS5A 2GIVA 1VQPQ 3OSSC 3OQ5A 2DL7A 4WK8F 1TU0B 5GAN8 3V7CA 1IHWA 2M5WA 3EGUA 5FGMA 5I11A 2LP0A 2CU7A 2VXZA 1OYXA 3L2QA 1Y0UA 3M0PA 2EA2A 3LOCA 1Z91A 1X43A 2JSPA 1O9SA 2GFAA 4C3JJ 2E3IA 4FYYB 4ZN3A 3S2HJ 1K9MC 1OU9A 3IWFA 3ASOH 1BA5A 1OPLA 1XGSA 1UGPB 2XB0X 2K2VA 2RQWA 4M7AB 3PSFA 4HF0A 4B47A 2DLLA 5LGTA 2FB7A 1LEBA 2E2JJ 1XG1A 3L2WA 1U1TA 2DF6A 3MQ0A 4EMHA 1W4SA 3ZEHA 4QIWN 3F3XA 1ORKA 1ZLKA 1Z77A 2Y9ZA 3GTOJ 3JREA 1C0MA 2K86A 1WJRA 3C95A 2P5KA 2EYYA 5GMKe 3BG3A 3U1KA 3I4PA 3E2UA 3HKZN 4PZJA 2F5KA 4NL2A 4A4FA 3D1NI 3TVTA 1IRZA 3BTJA 1OQKA 5J8FA 1M2VB 5HLGA 3PO3J 2M7BA 4XTZA 1I0CA 3KEQA 1K6OA 1OCZH 1T3LA 3JCMW 2HS5A 3QAHA 3CMMA 3PQJA 5HOOA 3E0JB 1SD4A 2MWPA 1VTNC 5KCOA 5HK0A 3PTAA 1W2BS 5ICGA 5CVRA 4OAZA 2HBPA 1XDSA 4Y4RA 4D8KA 2G6FX 1VQ7A 1TG0A 3EETA 1HSJA 4NS5A 2E6NA 1R23A 2KI7A 1WFXA 4HCBA 1UG2A 1AWJA 2DD5A 3M9AA 2ZSHB 2O4XA 3MEXA 5CK9A 1M1KU 2P6TA 2LT1A 1ZAOA 2G0EA 1IXCA 2P0PA 1TOVA 4NC7A 3H0DA 2RJCA 3FXJA 2HQ5A 1F4KA 3EG1A 4OMOA 4I02A 1I07A 2K5LA 4F17A 4QVCA 1ZQ3P 2VXDA 1N6AA 5KYUB 2AZSA 3AG3H 3JB9D 1D3YA 3A8HB 3RYPA 4H0EA 2IGNA 1T56A 1VQLT 4AM3A 1YCSB 4LDUA 3DP7A 1KZHA 1VQ7I 4F7UB 3P8DA 3I56Q
chains in the Genus database with same CATH topology
3JSOA 2A6HF 2F2EA 2P5LC 3C7JA 5CKEA 1ZG1A 3ASKA 2HR3A 2HYFA 1ZGAA 3OYHA 3ZBDA 3D5LA 1USSA 1RIOH 5L3DA 4EGZA 3JW4A 4G7HF 2M16A 2W24A 5JR3A 3HPWA 4Y13A 2XROA 4FX0A 1VQ8T 1Y7XA 1IN8A 2C6YA 1ZBXA 3OV8A 4LMYA 4A5MA 2DAQA 3WGIA 1CF7A 5FU6C 1K73U 2EAYA 4S05A 3PMTA 4C5IA 3E1SA 3OW2S 4E7HA