1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
3IWFA 5H6QA 2F5DA 3ZMUA 2ZXJA 2DK5A 3JW4A 3FZVA 5CJ9A 5IT3A 3WTWC 1KQ9A 1V4RA 1J5YA 1SD5A 2XKPA 4KUMA 3CJNA 3EYIA 2ETHA 3SXYA 1SD6A 1BM9A 3FM3A 1H0MA 3COAC 3I0TA 4WXDA 2WC2A 4CO8A 3WTVC 1HQCA 2UXXA 4I2OA 3GWZA 3S2WA 1YLFA 2QVOA 1XSDA 1RIOH 1R36A 4L0ZB 1MJBA 4EJOA 3BPXA 4P9FA 3Q9SA 1J2XA 3LA2A 4G7ZF 2ZMEB 1LDDA 3L7WA 4DQ2A 3CUQC 3MAJA 2OQRA 4TV7A 2VE8A 2EA4A 3V8KA 1BIBA 1CF7A 1BJAA 4FX4A 3P9CA 1QQIA 4UVBA 4KYWA 1C0WA 3I54A 2VODA 2GCXA 4UNOA 4ETSA 3R6SA 4N9HA 5FFXA 1QO0D 1DP7P 5CYVA 5LHGA 2RV8A 1S3JA 1WQ2A 3N97A 2VE9A 1BI3A 2K27A 2DAOA 4ENNA 2M30A 4NQWA 4U7BA 1ZG1A 3ULQB 3V7CA 1RZ4A 4KN7X 1OPCA 5FD5A 3H92A 5CVUA 1ZRDA 3E5XA 3RKXA 3RYPA 2KJBA 3VB2A 3DF8A 1LJ9A 4D0PA 3TOBA 4OMYA 4CHUA 4L9TA 2J5OA 3WTZA 1IF1A 3C18A 5BS6A 4AIHA 4ENJA 2P8TA 5D6FA 4RAYA 1ZGJA 2EB7A 2QQBA 1G3YA 1SFUA 4UHTA 4LG0A 5K5RA 4H0EA 2TDXA 1B6AA 4HZFA 5DCMB 1KU9A 1B59A 2KIFA 4XBFA 2P6SA 1U5TA 3K1PA 2IT0A 5HOOA 3L2CA 4WK8F 5HDKA 1K79A 3DXJF 5BOXA 3BOQA 1ZGAA 1IRFA 5AIQA 3I5UA 3KCCA 2QQAA 2NS0A 1FX7A 3B02A 3T8RA 1F9NA 1YG2A 5E20A 4AIJA 2RDPA 5LEKA 2A68F 1HBXG 2PFBA 3SQNA 4P9UA 2E1NA 1BYMA 3I64A 2JZYA 3MCZA 2RQPA 4BXUA 1OYWA 4EGYA 3FXRA 1BI1A 2E1CA 5ILUA 4KIGA 2FQ3A 5DEQA 3KLNA 1LNWA 4ZYDA 3WTUC 4UV9A 4A6DA 1TLHB 2A61A 2P5VA 3JTHA 3BPVA 2EJRA 4HDVA 1FSEA 3I71A 2XVCA 2IPQX 5E1WA 1R00A 2D45A 4LD5A 2XASA 3U2RA 1R23A 3WE2A 4MQVA 2XGXA 4NHJA 3DEUA 3J81K 4S04A 3V8JA 1ZLKA 4LJZF 3EQLF 1Z7UA 2P5LC 1ZHFA 1BC7C 1FBQA 5D6EA 4A0ZA 5L3GA 2C6YA 5HS7A 3WTXC 1ZRFA 1R5GA 4UXNA 1UHWA 2GA2A 3LFKA 2XHKA 2EFNA 1R58A 4BYYA 4HLXA 3T1BA 2JPCA 1T38A 4OOIA 2M8EA 1IZ1A 4L9JA 1MGTA 3K1NA 2VBZA 3HSFA 4G8XA 4IRIA 4HQMA 3ZMDA 4LK1F 1FP1D 3JSPA 2KJCA 3L09A 1J0RA 3O6BB 1J59A 4KIBA 2HEOA 3QPHA 5CVJA 2FA5A 2DLLA 2MC3A 4AVPA 1P92A 3IRQA 1K78B 2CO5A 1CF7B 2QQ9A 5J8CA 1H9GA 3ELKA 5A2QK 2XAGA 4M6XA 4Y17A 2KKOA 4HF0A 3GFJA 5JR3A 1XGNA 2O3FA 1O3RA 1W7PD 4WF2A 2P6TA 2QENA 1WWXA 4G94A 1FY7A 2QM3A 1EV7A 1LDKB 3MQ0A 1IAWA 1YS7A 3KE2A 3KP2A 1HXDA 3GFLA 1XGMA 3DQVC 4HW0A 1RNLA 4HBLA 2PI0A 3DV8A 4HV5A 3RIRA 2Z5UA 1BC8C 3KP7A 3ZMVA 5F64A 1X3UA 3CLOA 4LFUA 2XAHA 4AWXB 4Q4ZF 2G9WA 3IL2A 2ELHA 4GO1A 3BWGA 4G6QA 3AAFA 2YU3A 4N9IA 4GYIA 2RC4A 4B09A 2FE3A 1B1BA 3CTAA 4O3MA 1MDMA 3WU0A 3IKVA 1TQIA 2BYVE 1JXSA 1U6GA 4M9XA 2MLGA 1JHFA 1KU7A 3E6MA 2EV0A 1J7KA 2XRNA 1QW1A 4ZYEA 1Z91A 4IRGA 5BMZA 1S8NA 5FB2A 1FNNA 2ESNA 3Q5FA 4JBAA 1T39A 3R61A 3GZ6A 5LRRA 5J8FA 3TOAA 2KIMA 3CUQB 5IT9K 2UXNA 2HTJA 1W4MA 5KVRA 3LA3A 2H6CA 1D8KA 2GQQA 2IA0A 3HSEA 1YW9A 1EH6A 4R79A 3K1MA 1K7AA 2XV4S 5L3BA 1FBSA 3J80K 3TQNA 4A5NA 1P4WA 1ZARA 3E3VA 3GVAA 3BP8A 4BHBA 2YPRA 1D5VA 2X0LA 1LDJA 5JHUA 4L18B 1STZA 4UV8A 5DDGA 1U5TC 5ICGA 3M7GA 4I0BA 2FF4A 2GXGA 3E19A 2Q0OA 4KMUX 1S29A 3P9KA 5LEJA 3HRMA 3F72A 4OIRF 5BPDA 3ECOA 4RB1A 1P6RA 1RUNA 2QYOA 2BGCA 1JHHA 1FSHA 2Y75A 2XUBA 1XMKA 1HW1A 4PGGA 3LWFA 5D8LB 2YSRA 2F5EA 1EH7A 4I0AA 1XDSA 1AOYA 4EMSA 2VONA 1BBYA 2PG4A 5E18F 5FLXZ 2M45A 3TDZC 5ILVA 4CDGA 2LKPA 2PN6A 2BEOA 1ODDA 2H94A 4MNUA 4XRFA 5JI6A 3FMSA 3M8EA 1XMAA 3RYRA 2O6GE 3D0SA 4EQQA 4ZYHA 3ZMTA 1B4AA 5DD4A 2CGPA 2ZKZA 2W84A 4M6YA 4KN4X 1FYKA 4ZZDA 2DQLA 2EFWA 1J75A 2UWMA 3T0YA 2F5FA 1ZLJA 2VOPA 1FC3A 3ZMSA 3P7NA 3K9TA 1P4XA 2AXLA 4HX8A 2ZO4A 1I1GA 1UHMA 1KU3A 3F8BA 3KP3A 2O0YA 2P7VB 3MZYA 3HOSA 1HKSA 3M9AA 2QZ8A 3M1EA 1QGPA 1SAXA 5L3FA 1FWZA 4U0WA 4WWCA 2ZJ2A 4EJUA 1R5HA 4WXCA 2D1VA 3HRUA 1F5TA 3EUHA 5D5XB 2CWEA 1D3YA 3FXQA 1IN6A 1KYZA 5E17F 4Q47A 4WX9A 3ECHA 5HS8A 3GO5A 1YS6A 4M74A 2VXZA 4RGXA 2LF7A 1FYLA 1SD7A 3PQKA 2HKXA 4U0VA 1O7LA 4OINF 3HUGA 4EM0B 4PZJA 2STTA 1Y0UA 3V4GA 4EJTA 4NB5A 1PUEE 4XLNF 2B0LA 3I4PA 4IJAA 2A5YB 1XGSA 1T98A 4LG0B 3HTSB 4FT8A 2L01A 1A04A 1P4AA 3DKWA 3Q9VA 2D1HA 1KA8A 2ZNYA 4RB0A 2PMHA 3RI4A 4KNYA 2Z99A 5HDGA 4IHSA 1PDNC 2HFHA 2OBPA 3CO6C 1MD0A 5DCFA 3BJAA 1XCVA 4U0YA 4P5OA 2ZBKA 1BIAA 3J80Z 3KEOA 4XSZF 1FZPB 4I09A 2EFPA 1HSJA 2DO7A 2LNBA 4IHTA 3I58A 4PGHA 1KU2A 3VODA 1LEBA 3LSTA 3TO7A 2Z3YA 1Z1DA 3TDUC 2FU4A 4RS8A 1USSA 2YR2A 1FYMA 4Q5SF 1WKMA 2V1XA 5E1XA 1ON2A 1YFHA 5JVTA 5FLXK 5KK1A 5D5UB 3GF2A 2W85A 3V7SA 4ENKA 2DU9A 1O57A 3ZN0A 3E6BA 2V6CA 5HVQC 1HKQA 5BPIA 1T6SA 2R3SA 1YYVA 2YX4A 3QRFF 2QWWA 2FSWA 1W7PB 2IVMA 4O6JA 1MJAA 1QNTA 2PJPA 5DD8A 3C3WA 1L3LA 4EJVA 2J5PA 1I27A 1KYWA 2IP2A 3G73A 3MFKA 3HRTA 5DUKA 2P7CB 3NEUA 3GFIA 5L3CA 2DFIA 2VC0A 2ZNZA 5HLIA 2PBIA 1F1ZA 4R8HA 3V8LA 1G3SA 4R1HA 5H20A 2EWNA 4M73A 4Y13A 1D8JA 3JAMK 3WGHA 4KT5C 3QAHA 5L3EA 2W57A 4RGSA 4IXAA 5LHHA 1YW8A 1RI7A 1TNTA 3F8MA 2MH2A 3F8CA 4RB3C 4IRHA 1Q1HA 3E97A 2K4JA 2LF8A 1IXCA 1GXQA 2H27A 3NQOA 3PQJA 4N0BA 4FHTA 3HHGA 1U8RA 4OMZA 4A0XA 2K5FA 2EFQA 2DT5A 3F6VA 2EV5A 4CZZA 4LB6B 2V1UA 4G9YA 3H3UA 1IUYA 2MLKA 3VEPA 3ZMZA 1XDUA 2Q2EA 3R0AA 1HW2A 1YIOA 1HW5A 4CGZA 2V1DA 2E7XA 1S7OA 5LHIA 4I01A 2ISZA 5K5QA 2AS5F 1TW2A 2DK8A 2HDCA 3TGNA 2OZ6A 3DFGA 5EEHA 2OQGA 1TNSA 2RVCA 1TQMA 3CDHA 1ZN2A 1JE8A 4U7DA 5FD6A 3D5LA 4LMYA 1BI2A 1USTA 2HYGD 4WXHA 2PEXA 4M72A 2OU2A 3MEXA 1XB4A 2HR3A 3LQRA 2M1BA 4XSXF 5LLQA 5CVIA 3I53A 2A6EF 2Y0MA 1IXSB 5H6RA 4G7HF 3RTRA 4M71A 3PFIA 4MEYF 3F6OA 5ICCA 1YTYA 1Z05A 2M87A 1LVAA 4OU0A 3F23A 2Z9OA 1LQ1A 2MBFA 4I02A 5E1ZB 2CSOA 2CW0F 2FNAA 5EEGA 3ERED 4HX4A 2JSCA 2W24A 1UFMA 3HIFA 2MH9A 2HWVA 2O61A 4KA4A 3R0JA 4I7HA 2GXBA 5BQTA 1ON1A 4GGGA 4BHPA 1K6OA 5AONA 1SFEA 4HYEA 5LGNA 1TW3A 2HTSA 4GXOA 4LB5A 4UVAA 2DTRA 1UCRA 3FHZA 5AIPA 2ESHA 2GIVA 2K02A 2FEZA 2FNPA 2GWRA 1F4KA 4EM2A 1G4DA 3WTTC 4HOBA 2DI3A 3SZTA 2VOOA 3FX3A 1SFXA 4M9SA 2A6HF 5D5VB 2P4WA 1BN5A 1XSVA 4XLPF 4KMFA 3HHHA 4LLNA 1ZH5A 5LGTA 1L0OC 2A69F 4E70A 2GZWA 4OIPF 2RKHA 3GX4X 3ISPA 2K7LA 1V3FA 2ACJA 5E8IA 1G3TA 4HF1A 1TTYA 3WTYC 3HOTA 4YIFA 2VN2A 3JAMZ 2FOKA 3E6DA 4EM1A 3OOPA 1IN4A 3GW2A 3EDPA 5K5OA 2RGVA 2FBKA 2F5CA 4YFXF 1RUOA 4GYGA 4A5MA 2PMUA 1Z9CA 1OR7A 3JSOA 4HLYA 1KGSA 1GVJA 2VBXA 3KZYA 2QBYA 1ZG5A 3GUDA 4IF4A 3GFMA 2XAQA 5D8KB 4HF2A 4PCQA 1R1VA 2KIUA 1GXPA 2V79A 2W25A 4MTDA 2FMYA 6PAXA 2H6BA 2EFOA 2QLZA 1HSTA 1MZBA 3FF5A 3NRVA 2IJLA 2H3JA 4A2UA 1T2KA 4ON0A 3HSRA 1SMYF 1E17A 2IA1A 5LGUA 2EA2A 1W7PA 2O8XA 3WE3A 2G7HA 2Q8KA 2H09A 1QPMA 5CVVA 3WU1B 4DNCA 5LBQA 1DPUA 3KLOA 4IVNA 4KICA 3F8FA 1KQ0A 3E6CC 1R1UA 4GCVA 3IKTA 2CQKA 3VFZA 5ICEA 1O3QA 3VOEA 2HOEA 3LQQA 2BV6A 2FBHA 3FMRA 4P55A 2WWYA 1W5TA 3IC7A 4OIOF 3RJPA 2K4BA 5K1YA 2HKOA 5FFZA 1G3WA 3CUOA 3U1DA 5A2QZ 3KZZA 1FBUA 3WODF 3GEZA 2BBYA 3W6JB 3TO9A 1IN8A 2IA2A 2M5WA 3WTSC 2UZKA 3OV8A 1ZYRF 3ZPLA 4L9NA 2XROA 3REOA 1I6XA 1QBJA 4ESFA 1HKTA 4HAMA 2KRFA 3RKYA 3SFZA 2NNYA 4LLGF 2CYYA 3WG9A 3ML6A 4PDKA 4LLLA 3N4MA 1ZAOA 3CUQA 4MHGA 2OD5A 2NNNA 3SZPA 1BI0A 4L9VA 3HTUA 1ZG3A 3ZP5A 1WSUA 1S7AA 3E5QA 1EH8A 2Z33A 1PP8F 1ULYA 1DDNA 2HQNA 4EV0A 4ZH4F 1U2WA 3GLXA 3V7RA 2ADUA 4B8XA 1Z6RA 3MZHA 1H9TA 2D2WA 1AWCA 4BH9A 2JPBA 1REPC 2R7DA 2YX7A 3R60A 3J81Z 1J9IA 2FBIA 1XN7A 3IWZA 3I59B 1IN5A 3KP6A 4Y15A 3BJOA 1Z6TA 4IPAA 2L02A 5FGMA 3F8NA 4WCGA 4HV6A 4MEXF 2A3SA 2VBYA 3K2ZA 1TQPA 4AIKA 5F6FA 5CLSA 3KFWX 2X4HA 2K5LA 3SHFA 2MD5A 3O3KA 4G6DA 2VC1A 1U3EM 1B9NA 4EJWA 1KQ8A 1FP2A 5ERIA 3F21A 4UVCA 3CO7C 1B9MA 3HRSA 4HX7A 2RNJA 3LA7A 3WGIA 2K5IA 2XKOA 4ZZLA 4LGWA 3C7JA 3QU6A 2V9VA 4S05A 2E7WA 1K78A 2PLYA 4EVIA 1PP7U 4CICA 4BHCA 2EK5A 4ESBA 5D4RA 2ZFWA 3RPQA 4K2EA 2LSOA 2NYXA 3QP6A 3DPTA 4O5VA 4CXFA 3E5UA 5ILSA 2DBBA 4A12A 1OMIA 4BQAA 3ZQ7A 3BROA 4AD9A 3KP5A 3MHXA 2A07F 3K0LA 3TO6A 4M9ZA 1E2XA 1IN7A 3L00A 2JTVA 3LAJA 1S6LA 1YQAA 2GAUA 1T0FA 3RKWA 5LRSA 1FOKA 4U88A 4L5JA 3JTGA 3K69A 4YIIA 3QU3A 4KIFA 1O3SA 5HDNA 1QZYA 5HLHA 2ZCWA 4MTEA 4RGUA 1VTNC 4MGRA 1MDMB 1ZRCA 3QOPA 3FXUA 1SMTA 2LX9A 3EETA 2JRTA 5ED4A 2FRHA 2HQRA 2HGCA 4QLCU 5IT9Z 3C1DA 2LDUA 5D5WB 2R7FA 1JGSA 1G6NA 3DPLC 5D4SA 2JT1A 1FT9A 2OA4A 2MA3A 1QVPA 4Z2YA 4KFCA 3M8FA 5DV5A 3IHUA 2IW5A 1ONVA 2CFXA 3BDDA 2PQ8A 3FWEA 5J6XA 4HA8A 4KDPA 3T8TA 2NAZA 4RGRA 1MKMA 5CVRA 4L0YB 1GHCA 1YW7A 1U5TB 1WI9A 2G7UA 3H3ZA 4OIQF 3LAPA 4I98B 2DQRA 2STWA 1IRGA 3HYIA 4ZYGA 1DUXC 2O03A 3T5XA 4F7ZA 4HDUA 2WTEA 2K4YA 3RDIA 5F1RA 2DPUA 3EYYA 3MWMA 2L4AA 4A0YA 5TRDA 4UUVA 1FLIA 2VBWA 2FMLA 4ASNA 4JQFA 3ABTA 2RN7A 2DW4A 3TKYA 1I5ZA 2GA1A 4JK1X 4BAYA 1ZREA 2ISYA 3O2PE 3KP4A 1CGPA 3BY6A 4YG2F 4ENMA 1OYIA 5TJJA 1U78A 2OZUA 4RB2C 2HS5A 5HLGA 1MJ9A 2IRFG 4HQEA 3G3ZA 1XSXA 1NHAA 3J7AO 4FX0A 3WGGA 4G7OF 3IRRA 1TBXA 4YFNF 3GYHX 2K86A 3F3XA 4RAZA 2Y48A 4LK0F 4YFKF 2XIGA 3FM5A 5JFRA 1SD4A 3GZ5A 2EV6A 2F2EA 5L3DA 3KETA 4ESJA 4Q48A 4MQ9F 5DUIA 1LB2A 4EGZA 3U9GA 3ROUA 1QZZA 1W5SA 3I59A 5E8GA 3W6KB 4A6EA 3ABUA 2QBYB 4QWQA 2HZTA 2OAZA 1XGOA 2HYFA 2FXAA 3F22A 2XAFA 3KEQA 1LEAA 1IW7F 1XD7A 4CYDA 1IXRC 1R1TA 2P5KA 3RPUA 2VT2A 1O7FA 1UB9A 2BE5F 1I1SA 3FMQA 2WV0A 3DP7A 2L54A 5ICFA 1YO5C 1WRJA 2NRAC 2COMA 1FPQA 3GXOA 4BNCA 4L5IA 1O3TA 3L9FA 1OKRA 1BOAA 1XCBA 2DPDA 3QP5A 3QPTA 3BZ6A 1P2FA 1R22A 5DCMA 4P96A 5DYMA 3P9IA 2L3DA 1R7JA 1DPRA 5HS9A 2CG4A 5FO5A 1OYYA 2QUFA 2L4MA 2XAJA 3B73A 3BJ6A 2VT3A 3R4KA 2ZMEA 3ZN1A
chains in the Genus database with same CATH superfamily
3IWFA 4A3EJ 5H6QA 1G8XA 4B3XA 2F5DA 3HOVJ 3LX7A 3ZMUA 2EZIA 4D8KA 2ZXJA 2DK5A 3JW4A 1X1PA 4XU3A 2VI6A 3FZVA 3OYBA 5CJ9A 5IT3A 2KMUA 1PWTA 3ZRGA 3WTWC 3F9KA 4E7HA 2GLOA 1KHCA 5GADJ 1KQ9A 1I07A 2LY9A 1PCXA 3J80R 2CZ0B 1WXBA 1V4RA 3EGDB 1J5YA 2MW8A 4MDWA 1SD5A 4KUIA 3CCJA 2XKPA 3KEYA 2EIJH 2L9RA 1YRNB 1VQ7Q 2H3EB 2H8RA 4KUMA 1U1SA 2RI3A 3CJNA 2CW8A 2OC6A 2XIDA 3EYIA 2ETHA 3DCFA 3SXYA 3JRBA 3H0GJ 1T08B 2R93J 3ZBDA 3I55Q 2EPDA 2ID6A 2EYXA 2EYQA 2JJ9A 1SD6A 4AM3A 4UB8C 1BM9A 1JTYA 3FM3A 5M5WJ 1H0MA 2K3FA 3COAC 3I0TA 4PJ0C 4WXDA 2CV2A 2HSEB 4F7UE 2WC2A 2F4MB 2D9TA 3THKA 2HXOA 1ETVA 4C92E 4M7AE 4CO8A 5LJ5h 3WTVC 3VJPA 5IHKA 1HQCA 2O9LA 4E7JA 1B3QA 5D6XA 2UXXA 4I2OA 2F69A 3M55A 3GWZA 3S2WA 1YLFA 4IKFA 2JT4A 2A0FB 2QVOA 3HG9A 1XSDA 1RIOH 1WX6A 1R36A 4JRIA 2VQGA 1DU6A 3TSWA 3CC7T 2DE0X 4L0ZB 1MJBA 1X6BA 4EJOA 1KIKA 3JB9D 2FZGB 3BPXA 4P9FA 3Q9SA 2O9SA 1J2XA 3LA2A 3H9GA 2IS1A 2FZCB 2M4KA 4G7ZF 2ZMEB 2KROA 1LDDA 3RPUD 1K61A 2LMJA 3UA6A 2D5VA 1JJ2P 3K7AJ 2Y69H 3L7WA 3OYAA 2R5ZA 3GF5A 3PM1A 3CUQC 4DQ2A 2LMDA 3MAJA 4JX5A 2OQRA 2E2HJ 4A3DJ 4TV7A 3CMMA 1JXOA 2VE8A 3CCVT 1Y96A 2EA4A 2XMFA 1WXTA 2HXIA 4LDXA 3G4SI 2DA4A 4R0KA 2I10A 3JRFA 4M77B 3V8KA 1BIBA 4ZTFA 3ZCOA 1CF7A 1IB8A 2E41A 2FYKA 2LCSA 1BJAA 2QGFB 2RD1A 2DTHA 4FISA 2EH3A 4FX4A 5GP9A 3CC7I 3P9CA 2OCEA 5CKBA 1QQIA 4UVBA 4KYWA 1PC0A 2NOGA 3K4KA 2KDZA 5GAOr 1C0WA 1JJ2S 3Q0VA 1R6RA 2RJEA 3I54A 2VODA 2EGCA 4WCIA 2FQ4A 1X6GA 3G6EI 2KYMA 3I55T 1E3PA 3GTMJ 2DTIA 4DOWA 5KYWB 4X6AJ 4UNOA 4ETSA 3R6SA 2GCXA 4N9HA 5FFXA 3OYEA 1S1NA 2YUNA 4N0AA 1QO0D 1B34A 1DP7P 1N75A 5CYVA 5GANf 1M90C 3H0DA 4GFBA 1OJLA 5LHGA 1OR7C 4M77C 3VDXA 1AWWA 2M3AA 2XAUA 2RV8A 1S3JA 1BOBA 1WQ2A 1X01A 1VQ5Q 3N97A 2P0PA 4RTUA 1XX5A 3GLLA 2VE9A 1SC7A 2A37A 4OGEA 1VQMT 1BI3A 3QKJA 2JMCA 5CPRB 4UC4A 2LC4A 2K27A 2DAOA 2WBMA 4ENNA 2M30A 4NQWA 4U7BA 1E6HA 4BI3A 4QVDA 1ZG1A 2DF6A 2CZ6B 1VZ0A 1LE8A 3TEDA 2B86A 2YLBA 3ULQB 3V7CA 5EDNA 3EH1A 1O4XA 2CFOA 3QJ6A 4PJNA 2RI2A 4NNJA 3SEMA 1RZ4A 4KN7X 3CCEQ 1OPCA 5FD5A 4TVRA 3H92A 2DXBA 2EGEA 1N8RR 2KRSA 5CVUA 1ZRDA 3MKYB 3X26B 5C4JJ 1KQ1A 3H1CA 4M78G 4J7FA 3E5XA 1ZR2A 3GNFB 1NG6A 3RKXA 3RYPA 1FTZA 2OTLI 4IZZA 3C2BA 3DLLF 4HRIA 1YHQT 2KJBA 3I3LA 1QP3A 4M7DE 4KBMB 2LBFA 1VQLT 3TMOA 4C8QD 2LT1A 3VB2A 1IDYA 5GTHC 3AKZA 3CMEA 2DKGA 2BKDN 1Q82U 4PJOC 4QPQA 2E71A 1YBYA 4PLIA 1LPQA 3G1MA 2BY0A 3DF8A 4BEHA 1SFOJ 2RO0A 3BFMA 2Q1ZB 2OTJA 1LJ9A 3OYHA 4EATA 2L0AA 4D0PA 3TOBA 4OMYA 4CHUA 2DL3A 2X85A 4L9TA 2J5OA 3DU6A 3I56I 1WIEA 2NXNB 2KR3A 3PMIA 3UDCA 4C8QA 2KFDA 3HC7A 1QRYA 2GM4A 3WTZA 1IF1A 3EHRA 1UJYA 2KXDA 2VQCA 3SZGA 3D7SB 1G59A 3C18A 5BS6A 2J6KA 5LJ3f 4AIHA 3GPLA 4ENJA 4II2A 1TL8A 2PNIA 2P8TA 5D6FA 2GQVA 4RAYA 2O4XA 3HFOA 3G2BA 1C6VX 1OEBA 4FYWB 1ETKA 2WA0A 3RNJA 1ZGJA 4PFZA 2EB7A 2QQBA 2MWOA 3EG9B 1G3YA 2OI3A 2RHZA 3JRIA 5LJ5g 4XU1A 1SFUA 4UHTA 2CGHA 4LG0A 3QUIA 1RESA 2VVKA 3FK7A 2HSPA 5E3NA 2ROLA 5K5RA 2TDXA 4H0EA 1B6AA 2M0MA 4HZFA 5DCMB 1K4SA 1KU9A 1B59A 2KIFA 4XBFA 3ZQHA 1YCSB 2P6SA 1HSQA 1U5TA 4M7DG 2KT8A 5FKNA 3K1PA 4ZC3A 2IT0A 3AG2H 3NARA 2ZXHA 3ESWB 5HOOA 2H1LA 3P5JA 3N05A 3QOEA 4FCYA 3L2CA 3OYIA 2IGOA 2HQHA 4ELYC 2CT4A 2L3QA 5HDKA 4WK8F 1K79A 3OS1A 2ECCA 3DXJF 5BOXA 2JA7J 3BOQA 1WA7A 3CCRI 2DMPA 4F7UF 1OCPA 1ZGAA 2E34A 2R7XA 1IRFA 5AIQA 3EFSA 3META 3I5UA 2JMWA 3KCCA 2QQAA 2R7TA 3VUZA 2NS0A 1FX7A 4C3JJ 3G1JA 3QZ5B 1UHFA 1WJQA 3B02A 2PVGB 3T8RA 4RM3A 1F9NA 1YG2A 5E20A 4AIJA 1I81A 2RDPA 2E1HA 5LEKA 2QF7A 1VQKI 4BE0A 2EQIA 3HHTB 4RTZA 4DOVA 1AZEA 1D09B 2ED1A 4CC7A 1LPLA 2JUCA 1TXQA 3C4SA 3LSJA 5E3OA 1JJ2A 2DK3A 2BZ8A 3CXCP 1ACMB 1YE9A 2Y90A 2Y4XA 2ZSHB 5GMKe 2V9KA 1X1CA 3CC4Q 2A68F 4XTVA 1HBXG 4DGWB 2AKKA 3HP9A 2PFBA 2KMTA 1ITYA 5CAIA 3CP2A 2L7KA 4L59A 2GOXB 1VNDA 3SQNA 1V5FA 3H5RA 3TW6A 5KE2A 3KIOA 5J40A 4NDLA 1VQ8I 2DL4A 2RK2A 2A08A 4P9UA 2E1NA 1BYMA 2RNAA 1WPKA 4E47A 2ABLA 1VQ4T 3I64A 2JZYA 4XKCA 3MCZA 3UKGA 1BR2A 3M4YA 4YTLA 2RQPA 5J3BA 4BXUA 4M7DA 4J9IA 1GFCA 2CMPA 3EGUA 3UF4A 1OYWA 3S2DJ 4EGYA 3FXRA 1BI1A 5A0GA 2E1CA 4DBFA 1K9MR 1KQSA 2DOEA 1Y8QB 4JPBW 5ILUA 4OMPA 1D3BB 4KIGA 4PSWA 2J6FA 1EA3A 2R7VA 5C3EJ 4GBQA 2FQ3A 2DERA 5GANd 1VQ8T 5DEQA 2KAFA 1OCCH 3KLNA 1LNWA 3OSVA 1K73R 4ZYDA 4XNFA 2VYTA 3WTUC 5A2QE 3PNYA 3E9GA 5KH6A 3PIPA 3AT1B 1UDLA 1LUJB 4UV9A 2YRVA 4A6DA 3C94A 3ME9A 1TLHB 1KQSP 2A61A 3CJQB 3CPWA 2JTEA 1HK9A 4CH7A 2P5VA 3REBB 3JTHA 4PSXA 1SEMA 3TL4X 4BXXJ 5FU7C 4C9YA 1B72A 2KDSA 2X4JA 3BPVA 1VQKT 1Q86R 2EJRA 4HDVA 4IOAF 3QJYA 2R92J 1FYNA 1FSEA 3I71A 2XVCA 2DXTA 2IPQX 2GXAA 5E1WA 1ETQA 1R00A 3CC4T 2D45A 4LD5A 2XASA 5KYUA 4ZN1A 3PL8A 4A4GA 3U2RA 4LE9A 2ZJQF 1R23A 3WE2A 4MQVA 2WSFE 1JT6A 2XGXA 4CCKA 3GTGJ 1YITT 4C5HA 1QQJA 2KBTA 2LR8A 4HEA2 3CC2T 1T0HA 3MEAA 4EMHA 3JB9J 3S2HJ 3MKWB 2SRCA 4NHJA 3DEUA 3J81K 2EJ9A 5HNHA 4Z02A 4BI8B 4S04A 2DO3A 2W10A 3V8JA 1ZLKA 2RPNA 1N9SA 3RUXA 4LJZF 2W0ZA 4DZJA 3K70C 3EQLF 4UY8I 3WHBA 4Y52J 3OL4A 3M07A 3H0IA 3LLRA 4HKEA 5EG2A 4LITA 5FLVA 1LFBA 3VS3A 1Y0NA 4PKCC 2E2IJ 2QDLA 1Z7UA 5CQYA 4IHVA 3SHWA 4XU2A 1J3TA 1TUCA 1JEGA 2TRTA 4J9DA 1Z0XA 2P5LC 2X9DA 3A0BC 3OYDA 1ZHFA 1BC7C 2C0IA 2DFUA 4W97A 4RTXA 3CCUA 1D1CA 1FBQA 5D6EA 4A0ZA 5L3GA 2C6YA 2HL3A 4FYVB 4OMOA 5HS7A 4XOPA 1VQOA 1AHJB 1WHJA 1YI2Q 2M9HA 2FVUA 2R57A 4M7DF 3L1AA 1J09A 2M02A 3OS0A 2DFEA 3BR2A 4MFEA 3S6WA 3WTXC 1WJFA 1R0CB 1ZRFA 3JCMc 4BACA 2AIRB 1R5GA 4X9DA 4J19A 4UXNA 1UHWA 2GA2A 3LFKA 2XHKA 2MK5A 2EFNA 2F4IA 1R58A 3A5ZB 5E79C 3TQ7P 1P7JA 5B1BH 4BYYA 4HLXA 3FXKA 3T1BA 1KHIA 2Z1DA 1MHNA 1QWEA 3NHNA 3DTKA 3G6EA 5J3LA 2QYZA 2I0NA 4KITB 2JTMA 2JPCA 2X3XD 4LNPA 3S32A 2P84A 3TW7A 1QP2A 1T38A 4BY7J 2K9NA 1SSFA 4OOIA 5JHFA 1BB9A 2IGNA 1LJOA 2M8EA 2KRCA 1WHLA 2IPOB 2ZPFB 2PJRA 3PE0A 1IZ1A 4L9JA 3A98A 1MGTA 1K0SA 2X1DA 4F7UB 1BW5A 3K1NA 3CCMQ 2VBZA 2G0EA 3HSFA 4G8XA 4PJOF 4HG2A 4HQMA 3ZMDA 3OYFA 1U8BA 4IRIA 4BY6C 4XTXA 5GAOm 4LK1F 1FP1D 3VSKA 2UUZA 3JSPA 1ABOA 4AFUC 5IY5H 1MBJA 3I9V2 5EZHA 2K2VA 3JCMg 3VUBA 5IYCJ 1AEYA 1EJ9A 2NS8A 2KJCA 2VKDA 1XQHA 3L09A 3KZIC 3IP4B 1J0RA 2M0OA 3O6BB 1QKXA 1R71A 1J59A 4KIBA 2JA5J 2HEOA 4OMFB 3OW2A 1KC8R 5C0MA 5CKDA 1E3HA 3QPHA 2JA6J 5CVJA 2FA5A 1U3OA 2L5QA 4M7AA 2V1QA 4J5YA 2E6ZA 3ONQA 3EH2A 1VQNA 2DLLA 1I0CA 2MC3A 5J47A 3DEWA 5DS9A 1ZSZC 4IUUA 2EQKA 2HAXA 1ZGWA 5KAFC 2B8AA 3WVDB 1MBKA 2KGTA 4AVPA 1NG7A 3HKZA 2HVRA 1PD0A 2GFUA 1P92A 3EFOA 3QYGB 2JSPA 1X75C 2VKEA 3FHNA 5KAIC 2O31A 1E6GA 2BW3B 1VUBA 3HL2A 2QGUA 3IRQA 1QPIA 2HKNA 2KRMA 3LOCA 4M7DC 1WFWA 2OTJQ 2K40A 1VA7A 4QQ6A 1SG5A 1G5VA 3FBIB 1K78B 1NG2A 3G6ET 1WI7A 2CO5A 3ZXSA 1CF7B 4N4NB 2QQ9A 2JM8A 3DKMA 2DRMA 5J8CA 1H9GA 3ELKA 5A2QK 3ULRB 2XAGA 4B3AA 4I76A 2K5CA 4CCJA 2VKVA 4ZDOA 1UGPB 2AZSA 3ZL7C 3IUOA 1X1DA 3L2ZA 1QVFS 1QVTA 2BVLA 2R5ZB 9ATCB 4B1RA 1ZSZA 2EYZA 4M6XA 2V8IA 4PJLA 4Y17A 2DA3A 4A3KJ 1FIPA 2WY7Q 1K4US 2KKOA 2JQ7A 2A28A 4L5GA 3SEZA 2D0NA 3I5SA 4HF0A 2ZPEB 5CIUA 2RQWA 5L8RE 4FYYB 3A52A 2V1NA 3GFJA 4XAXB 5JR3A 1XGNA 2O3FA 4OAYA 1O3RA 4FE4A 2R5AA 1W7PD 3VS7A 4MMKA 4WF2A 5IOZA 1RKWA 4DOZA 1R9TJ 1GRIA 2LJ0A 2XC7A 2P6TA 2YUSA 2J05A 3BDLA 1MBFA 1V54H 1WWXA 2QENA 4G94A 4A3MJ 1FY7A 2QM3A 3K4CA 1A6QA 2CRGA 3RZOJ 3RMQA 1EV7A 1LDKB 3MQ0A 1IAWA 1YS7A 1K83J 3KE2A 1M27C 5EC7A 3QBYA 1IGQA 1JUSA 1RRJA 1OU8A 2E5ZA 3KP2A 1HXDA 3GFLA 2YUPA 3PUBA 1XGMA 1NE8A 2X48A 3DQVC 2CV0A 1W1FA 1W2BA 1RAGB 2MWPA 3H9JA 3CCST 5I21A 2EZLA 3S16J 4J9FA 4U87A 4HW0A 2PTKA 1ORKA 3G71A 1UGVA 3BG3A 1RNLA 4DIQA 3QWXX 1JKOC 2BTTA 4JJBA 4HBLA 2PI0A 5HY6A 3DV8A 1QCOA 4C92G 4Z89A 4HV5A 2OAWA 3K4MA 3M0TA 3HXLA 5H2FC 1E7OA 2EFIA 3RIRA 2Z5UA 5GAN4 2LCCA 4A53A 2CQQA 1QCNA 1Z9ZA 2PX9A 3B6CA 1BC8C 5IXFA 4M6VA 2CSQA 2FB7A 3KP7A 5GPCA 1EIFA 3ZMVA 4RTVA 4DA4A 5F64A 4C8QG 1X3UA 2XGEA 2EQJA 3CLOA 5J1UA 2DL8A 4LFUA 2NVUB 1PUFB 2F48A 4A3BJ 2X1CA 2QA4Q 2XAHA 4AWXB 4Q4ZF 4IIOA 1VQ4A 5DTDA 2G9WA 3IL2A 2K3BA 2ELHA 3A8GB 4GO1A 2LKXA 1VQ7A 3BWGA 4G6QA 2QA4I 3VV0A 4E7LA 2AQEA 1EKEA 3AAFA 1VYVA 2GIZA 3M8JA 2YU3A 4N9IA 4XTWA 1FEXA 4GYIA 3QG1A 2RC4A 4B09A 4M7DB 4B47A 4X0GA 4XQFA 3A03A 2YSQA 4L6V5 2FE3A 3FDYA 4M78E 2HOTA 3DB4A 1B1BA 3QZ9B 2PUOB 4OGCA 3CTAA 3DKXA 2FX0A 2ELKA 1JGGA 1KD1R 4NBQA 1MBHA 1FTTA 2TCTA 2DFHA 5IPAA 4C30A 2QCOA 1MDMA 4O3MA 4KJZA 2YWWA 1M3AA 3WU0A 4BJ6C 3IKVA 5HK3A 5GMKl 4JRPA 4FASD 1TQIA 4XK4A 2DD4A 1GV2A 2BYVE 4L5EA 3HKSA 4CZCA 1JXSA 3CCUQ 4N4HA 1U6GA 4M9XA 2MLGA 1JHFA 1KU7A 3D5RC 2RM4A 4XTUA 3E6MA 2EV0A 1XOVA 3N5BB 3BR0A 1J7KA 2XRNA 3AG3H 4RLQA 1QW1A 1VI0A 4ZYEA 1Y07A 1YI2A 1A0NB 1U5SA 3HGYA 1BJZA 1Z91A 1WH5A 3DLAA 4IRGA 5BMZA 1TUGB 5J26A 1S8NA 1SEUA 5FB2A 1FNNA 1ZTRA 2ESNA 1FXXA 1YCYA 5A0LA 3PNTA 1NEBA 2ID3A 3Q5FA 2LRQA 4JBAA 3BT9A 3CCYA 3W2AA 1K6YA 1T39A 3R61A 4KISA 3GZ6A 2NWMA 4JP0A 2CQXA 1ZBJA 5LRRA 5J8FA 2H8WA 3TOAA 1WHMA 1YITA 2B63J 1WZOA 2KIMA 2R5MA 3CUQB 2GBQA 3RBBB 5IT9K 2UXNA 4BY1J 2HTJA 1W4MA 2L3PA 2HYJA 5KVRA 1IC8A 1PG5B 3C95A 3LA3A 2H6CA 4E7ZA 1D8KA 2GQQA 3K4JA 3K4BA 5EZGA 3HSBA 2IA0A 3HSEA 1YW9A 1PSFA 2VXDA 1EH6A 1U9OA 4R79A 3NTHA 3K1MA 1K7AA 1MMGA 2X4WA 1VQPQ 2XV4S 3I4NJ 5L3BA 1FBSA 3J80K 3NFCA 3TQNA 4A5NA 3HUGB 1P4WA 1K73C 1ZARA 3E3VA 3GVAA 3ZQQA 3BP8A 2L3SA 4BHBA 3HGGA 2D8HA 4KRTA 4XQ3A 2YPRA 1D5VA 1BR1A 2X0LA 2QG9B 5IOYA 4C2TA 2DA7A 1WJSA 1LDJA 4OMLA 2DN0A 5JHUA 4L18B 2ZC2A 1STZA 2X6YA 1M3CA 4F91B 1OX8A 4LXCA 1TOVA 3SFMA 3JAME 3L2VA 1V1CA 1OZ3A 5K7FA 4UV8A 5DDGA 3OS2A 1UGSB 1U5TC 2NVYJ 5ICGA 3M7GA 3HJEA 2VJIA 3GTJJ 4I0BA 2FF4A 1S7EA 2GXGA 4D5CA 3CCUI 1EX4A 3E19A 4M7AC 2Q0OA 4KMUX 1S29A 3P9KA 2FPDA 1PJRA 5J4VA 2HNIA 3EG1A 1VQOQ 1VYTA 5LEJA 1GL5A 2Q2EB 3HRMA 2CU7A 3OMYA 1NPPA 2P4RA 3FBNB 3FC3A 3F72A 4OIRF 2PJRB 5KE3A 1EZZB 5EGOA 1MMSA 3H3VK 2JMAA 2AHQA 4DZPA 2JNGA 1PHTA 2QA4T 3ERMA 3M9QA 4MZMA 2K3XA 1RI0A 5KYNA 1M1KR 2O4XB 5BPDA 3Q0UA 2F5VA 1RUWA 3ECOA 4FETA 4RB1A 5GAN7 4C0DB 1LVKA 2CZ7B 2DA2A 1P6RA 3BCAA 4E4HA 3JRHA 1NTCA 1RUNA 2HD0A 4A3IJ 4V2FA 2Y9YA 2DA6A 2QYOA 2BGCA 3QDRB 1JHHA 2XSJC 2MAMA 4GLKA 2DA1A 2E5QA 3C0CA 4F55A 1FSHA 1AT1B 1ZUUA 2VKHA 4DYRA 5LJ5e 2Y75A 4ZDLA 3RQ4A 2LNVA 2RA2A 1QWFA 5EJCA 1D1BA 1R77A 1UELB 1TS9A 2XUBA 4CSWA 2XICA 3OL3A 5FWCA 2E70A 1XMKA 3A01A 1HW1A 4PGGA 1U1TA 1BCOA 2OF7A 1JT0A 3LWFA 1IRXA 3O8HA 3LSGA 3SDBA 2EIMH 2YSRA 5D8LB 2F5EA 4RTYA 2KZGA 4J6YA 1MV0B 4JLGA 1EH7A 3Q1JA 4KH1B 1LE8B 4I0AA 1WLPB 1WJ5A 3HOWJ 2V8KA 3CCJI 4C3HJ 3MKLA 3O5ZA 4B6MA 5GANe 1QVFA 1XDSA 2ZB9A 4DBRA 1S9HA 2IGMA 4EMSA 1AOYA 4F17A 2VONA 4AFZC 1BBYA 4MMLA 2PG4A 2IS4A 5E18F 2OJ2A 2VIXA 2QEXA 5K7HA 5FLXZ 2RF0A 5LFAA 4EEFG 3WVEB 1MNEA 1Z67A 2LOOA 2CP0A 2EKHA 2M45A 3TDZC 2LJ1A 2M2EA 4H4KC 5ILVA 2I2LA 1AU7A 4CDGA 1Y6IA 2LKPA 2PN6A 2BEOA 3J7ZI 1ODDA 2H94A 4MNUA 4XRFA 4AFQC 1Q81U 2O8KA 2O5RA 5JI6A 1ZA1B 3NMZC 4IUVA 4BD3A 3FMSA 3M8EA 5CQGA 3BR6A 3KXTA 2V7FA 1MV3A 1XMAA 5D6WA 3RYRA 1WVRA 3TP0A 3CCQI 2HEQA 2ELJA 3PNVA 1BL0A 2RHUA 5DM6F 2DETA 2P0WA 4IL6C 3D0SA 2O6GE 4EQQA 3J7AY 2AZVA 4ZYHA 3ZMTA 1B4AA 2PQWA 2X3WD 5DD4A 2MCNA 2CGPA 2ZKZA 5KYXB 2W84A 4M6YA 4D6WA 2PVDB 4FIBA 4QVCA 4KN4X 1Y56A 2C0TA 2RAEA 1FYKA 1K8AU 4OB2B 4ZZDA 4OP0A 1TWCJ 3L2UA 2DMNA 2XSDC 3BTLA 4OWRB 4XKWA 2DQLA 4BE2A 1NEGA 3VRYA 2QEXQ 1Q82R 2E1MC 3GTOJ 1RAFB 1JUPA 1YJNT 2BE9B 5DLQE 2EFWA 1J75A 2UWMA 3FDRA 3T0YA 4J01A 3QDFA 3A8OB 2FZKB 1AZGB 2ZPGB 4NUBA 2F5FA 3FXLA 1JXMA 2DDAA 2ZSIB 1ZLJA 2KHMA 2XHCA 1Y96B 3M4OJ 2VOPA 4LDUA 3IQLA 5CR2A 3JCUC 1FC3A 3ZMSA 3P7NA 1DQUA 2A36A 5FLMJ 3K9TA 1P4XA 4ME7A 4A4EA 2AXLA 3JRDA 4HX8A 2ZO4A 1I1GA 1S5LC 4IHWA 2D1XA 1UHMA 1KU3A 3F8BA 2DMTA 1WHUA 3KP3A 2EAYA 2O0YA 1VYUA 2P7VB 3MZYA 4JX4A 3HOSA 1HJDA 1S72T 1PYVA 3L2WA 1HKSA 3M9AA 2AHJB 1WZ2A 2KQWA 3CBOA 4RCBA 1NBEB 3M5AA 2QZ8A 3DEEA 2DYRH 3M1EA 2ESWA 3X28B 5GTIC 1FJLA 3I56A 2XU8A 1GBRA 1QGPA 3QXEB 3K10A 1SAXA 2CH0A 2NVQJ 1MH4A 2MZ4A 1OZ2A 4PLLA 5L3FA 1FWZA 4U0WA 1Z3YA 5JLXA 2VJ5A 3JCMf 4WWCA 3FEOA 2ZJ2A 4JS4A 1SRMA 1AWXA 2GFAA 3E9FA 4QVZA 4EJUA 1DGWY 1R5HA 3CPFA 4WXCA 1BA5A 2D1VA 2CUBA 5I2MA 3OR2C 3HRUA 1F5TA 3EUHA 4AG1C 5D5XB 2CWEA 4HCBA 1D3YA 5CKFA 2MC4A 3FXQA 1IJWC 1WJEA 1IN6A 1KYZA 5F0CA 5E3LA 5E17F 1UECA 4Q47A 4BY6B 4PJOE 2JVHA 4WX9A 1D1AA 2GNCA 2DTZA 1IUFA 3ECHA 3OYMA 3E7LA 5HS8A 1MNMC 2K6DA 4A54A 3GO5A 2DXIA 1YS6A 2EPFA 4M75A 1YX3A 4M74A 4CCNA 2VXZA 4BE1A 1D3BA 1KD1U 4RGXA 1LFPA 2LF7A 3GCMA 3FKJA 4IOCF 2DA9A 2WY8Q 1FYLA 1SD7A 1UHSA 1FMWA 2HKXA 3PQKA 2P81A 3CDIA 1O7LA 4U0VA 2V6EA 1KJWA 1TWAJ 3AG1H 4OINF 1WJRA 2MABA 3HUGA 5IXBA 4EM0B 4PZJA 2CS3A 2XKOC 2STTA 2XGCA 5GAMf 1Y0UA 1DGRM 2BZXA 5AYFA 1W0UA 1VF9A 2XB5A 3V4GA 3ER0A 3LYIA 5GAN2 1G83A 3CC2I 2CUZA 3IH2A 4F14A 2WAQN 2KXCA 5J1YA 4RG2A 2N8GA 4F3QA 2L2OA 4EJTA 5FU6B 4NB5A 2AKLA 1PUEE 1BK2A 4XLNF 4CC2A 2B0LA 3CMET 3I4PA 4IJAA 2A5YB 1XGSA 2QXFA 1T98A 2LH9A 1SVOA 4J8OA 2MOXA 4LG0B 3AL0B 2LJ3A 1I4K1 3HTSB 3JCMh 1MSFC 5M5YJ 4FT8A 2L01A 2E65A 1QVFP 2RN8A 1A04A 3MD2A 5HCKA 1P4AA 2XF7A 3DKWA 1OX9A 2DTOA 4JS5A 1NK2P 2HOSA 3Q9VA 2L9NA 4JYKA 2D1HA 1Q7YC 2E1MB 4NC8A 4A3FJ 1X69A 3OYLA 2DX1A 1RPWA 2MUNA 5I2SA 4XOTA 1KA8A 2ZNYA 3I4MJ 4RB0A 3S17J 4NL2A 5GMKj 2PMHA 3GBGA 3PSIA 3RI4A 4KNYA 2RB6A 2R7OA 1R4MB 4BDYA 4BDZA 3I9QA 2Z99A 4RTWA 3VSLA 5HDGA 4FM4B 4XLCA 4IHSA 2OBPA 2HFHA 1PDNC 3K70D 3CO6C 1MD0A 5DCFA 3CMAT 4KT0E 4DBQA 1IGNA 2DL5A 2BXZA 2L9SA 4XK8E 1K9MU 1ABQA 3INZA 4BI4A 1JU5C 3CC7A 1N9RA 5D7UA 2LRDA 3B6AA 3MP8A 5GAGJ 2BY3A 2EBPA 3EGXA 4J9BA 3OW2P 3FXJA 1MUZA 4M78D 3BJAA 1XCVA 2KPMA 4M3DA 4HNUA 5FRNA 3I5RA 2HVSA 1VIFA 4U0YA 3MJXA 3GMEA 4P5OA 2ZBKA 2A7YA 5DLOA 1YJWT 1BIAA 3MEVA 2EILH 3J80Z 3KEOA 4XSZF 1FZPB 2LQWA 3SD4A 4I09A 2EFPA 3WHCA 4M78C 1WJAA 3M0PA 1FMVA 2HCKA 1HSJA 2DO7A 2OPTA 5F27A 2LNBA 1A35A 4IHTA 3I58A 4PGHA 1TG0A 1KU2A 2HBWA 2QTXA 4LG3A 5L23A 1VQ7T 3VODA 5FW9A 1LEBA 2L89A 4LDYA 3LSTA 3TO7A 2Z3YA 3HBLA 4CI0C 2ZPHB 2DILA 2M4GA 3OYCA 2CQNA 1Z1DA 2KIQA 4M3GA 3TDUC 2QEXT 2FU4A 2A05A 3FISA 4C8QB 4RS8A 3G71Q 2KZVA 3S8PA 2DEQA 3H9NA 4XKVA 1USSA 1CSKA 3MZ8A 3O8VA 1X2NA 5ECAA 1WNLA 1YJ9I 1F1BB 1M1EB 5LJ5j 3CPWP 4IHYA 2LDMA 2XD0A 2YR2A 3CCUT 1FYMA 4Q5SF 1WKMA 2V1XA 3H36A 5E1XA 1EF4A 2OCCH 2RREA 1ON2A 4M75E 2RQRA 2OV7A 1YFHA 2CYZB 5FU7B 1VQ5A 5JVTA 5FLXK 2LQ8A 2QGGA 5KK1A 1N8RU 2NUZA 3LH0A 2W4SA 5D5UB 4J83A 2BY1A 3CCRA 3GF2A 2W85A 3V7SA 4ENKA 3FLGA 2DU9A 1O57A 1MH3A 5GANj 4M7DD 5C4XJ 3PMTA 3M4GA 2EBIA 1ZELA 5C44J 3ZN0A 2E35A 2V6CA 3E6BA 3JCMW 5HVQC 5CK9A 1JO8A 3A0HC 1UE9A 1HKQA 2DYSH 5BPIA 5BNGA 1LOJA 2UV1A 4XR6A 1T6SA 2R3SA 4UB6C 1YYVA 4BQNA 2YX4A 3QRFF 4ZTJA 3BG5A 2XDPA 4MZTA 2QWWA 2WSEE 2DMOA 5GAMh 2FHDA 5HODA 3HDDA 2FSWA 1W7PB 2IVMA 1QZEA 3CMEQ 4O6JA 1MJAA 1QNTA 4ZDPA 3HOUJ 4KULA 2PJPA 3RDVA 5DD8A 5FKOA 3C3WA 1L3LA 5IN1A 4EJVA 2LREA 2FPFA 2BIVA 3W6VA 2YUQA 1SAUA 5LJ3j 4XRSA 2EVRA 2J5PA 2XDBA 1I27A 4JZ3A 1KYWA 4D9JA 2IP2A 4HVWA 4LDWA 3OS5A 3G73A 2I5UA 3MFKA 2AXTC 3HRTA 5DUKA 3OSFA 1RKTA 1TWBA 2P7CB 3NEUA 1PNJA 2GF7A 4D1QA 2RMOA 3GFIA 1WH7A 5F0FA 5L3CA 1VQMA 2M35A 2DFIA 2VC0A 2ZNZA 5HLIA 5KNLA 2X4XA 2DPPB 3CD6T 3M0SA 2PBIA 3OYKA 3OSGA 1F1ZA 4R8HA 4PK4A 1X4OA 3V8LA 2LKSA 5J4YA 2L2PA 1G3SA 2EQRA 2R5YA 1P9QC 2MFZA 4R1HA 2VC8A 5H20A 1IG7A 3TU4K 5EG0B 2EWNA 4M73A 2MF2A 5EYRA 3I55I 1K76A 1PKSA 3VYSB 2VUMJ 4Y13A 1D8JA 2P0KA 3JAMK 3R6NA 1UAAA 1MNDA 3WGHA 1F36A 2K9SA 4KT5C 1PD1A 2H8HA 2LD5A 3QAHA 4HVUA 5L3EA 2W57A 4Z8AA 4IEJA 2DJQA 1RETA 3P8DA 4PJOA 4RGSA 4IXAA 3PIPF 2E3HA 3TREA 2J06A 2CKKA 3VS2A 3A1YA 5LHHA 1YW8A 3KYLA 1RI7A 2K9LA 1TNTA 3F8MA 3OY9A 1WJDA 1WQWA 3BG6A 2K9MA 4KGVB 4D8DA 2MH2A 3F8CA 3LSMA 2HDDA 4CUGA 1H89C 4RB3C 5CKEA 1X19A 1RACB 3PGGA 3CCQA 2QA4A 4IRHA 1X3ZB 2M9UA 2NVXJ 1Q1HA 2BHZA 3E97A 1UUEA 2E64A 2K4JA 2LF8A 2CP6A 2HI3A 3FXOA 3PSFA 4A3LJ 2JVGA 1M8MA 1UGRB 3A8LB 1MIJA 2RJCA 4KH0B 1ZKGA 3HZJA 4LDVA 4FSSA 1IXCA 1I3AA 3HOYJ 2KVQG 1GXQA 2E19A 2L3RA 2DCEA 4JUVA 1YHQQ 4M77D 2H27A 2BZYA 3NQOA 3PQJA 4FE7A 4N0BA 4FHTA 3J7AW 2LC2A 3QPLA 1H3HA 1Z7LA 3HHGA 1U8RA 3G71T 4RKUE 4OMZA 3ZOBA 4A0XA 5C6SA 2PU9B 2XK0A 1SVMA 2KE9A 2K5FA 1UJ8A 2MMPA 2EFQA 2DT5A 3DBRB 3HM5A 4F04B 4XICA 3I56Q 2NOJB 3BG9A 3F6VA 3CCMA 5B5EC 1XS9A 1WYXA 2RJDA 1UG2A 2EV5A 4CZZA 3JCMX 4LB6B 2V1UA 2CUJA 1T0JA 4G9YA 2LCLA 1RLQC 3H3UA 1K4TA 3FXMA 2EIFA 1IUYA 2MLKA 2RI5A 3VEPA 4FW2A 3ZMZA 4GY5A 1AHDP 3CCSI 5KHDA 4C2UA 1XDUA 3FIFA 2Q2EA 1V76A 3CMAQ 5GAEJ 3R0AA 2ZCFB 2ZGWA 1HW2A 4DBHA 3OW2S 3ABMH 3HL8A 1YIOA 3PJRA 4C92B 1K73U 3FJ5A 3CQTA 1N5ZA 3SYTA 3X25B 3EUKL 1HW5A 1NPRA 2ME0A 2WAEA 4CGZA 3G4ST 1Q7YR 2V1DA 4PJOB 1H641 2E7XA 2NS7A 4BS9A 1S7OA 1VQPI 3EFRA 3CMYA 3CCVI 5LHIA 1KSWA 4I01A 2E6NA 3NTKA 5KYXA 3CCET 1IXDA 4JJNK 2ISZA 3JAMR 3BZCA 4CYCB 1XTAA 4ITVA 5TGTA 4Y3OA 5K5QA 3CCEI 2AS5F 5KCOA 3RZDJ 4B43A 4NC7A 1TW2A 3X20B 4KGXB 5LJ5f 1TU0B 2G3RA 1T3LA 2DK8A 3REAB 5HK0A 1F43A 1FMKA 2HDCA 3HKZN 1K8AR 2ZXIA 3TGNA 5FLXE 2VJ4A 4XN3A 2OZ6A 3DFGA 5EEHA 3CMAA 2OQGA 2ZXWH 2E2JJ 1TNSA 1VQ8Q 4VUBA 2RVCA 4BUPA 1TQMA 1JI8A 1LCKA 3BY7A 4HXJA 4M75G 3CDHA 1ZN2A 4AYBA 2B9SA 4M78A 1JE8A 2LYCA 1GT0C 1AKHB 1VIEA 1OPLA 4U7DA 5FD6A 3D5LA 4LMYA 2QSHX 1K8AC 3IAS2 1TT5B 2QQ8A 1TUDA 2MI6A 4CC3A 2AO9A 5IP9J 1BI2A 1USTA 2HYGD 4WXHA 2PEXA 1M5Q1 3JRCA 4QT7A 5GAOq 1Q81R 2DVJA 4M72A 2QKMB 1YJNA 2OU2A 3TP3A 3RKQA 3MEXA 3LH5A 1XB4A 4ZGDB 1VQKQ 2L7FP 2L7MP 4RLFA 2HR3A 3LQRA 4DYCA 3PIOA 3ASOH 2KP6A 2M1BA 3JV3A 3M53A 3CC4A 2F5KA 3QSUA 4XSXF 2XI9A 2MG4A 3OIPA 5LLQA 3GTQJ 2ATCB 5CVIA 1OU9A 5D6YA 1P7IA 9ANTA 5LJ3e 1KQ2A 3BLYA 3CCRQ 2DNUA 3EHQA 2CUEA 3OMCA 2DOFA 3I53A 1SPKA 2CUFA 3CC2A 2YUOA 2A6EF 2Y0MA 4XORA 1XMXA 2CP3A 2EKOA 2VXFA 4EMKB 4MLOA 4I99C 4EDUA 1IXSB 2QDYB 3WU2C 3I56T 3GIBA 1XTDA 1U9NA 3CZ6A 2R7UA 4BQQA 4AUXA 1T3SA 3JCMd 3EPZA 2P0TA 3Q3SA 4E7IA 1YHQA 1N78A 2X6XA 2D0QB 3SJMA 1GUUA 4F52A 1S72A 5H6RA 4G7HF 2G6FX 2V26A 3IAM2 4UUSB 1MGQA 4PFPA 3RTRA 1HC8A 1NYGA 1X43A 3EG2A 2KT0A 1VQOI 3P8BB 4M71A 2DDBA 1WXUA 3PFIA 4MEYF 2ZMEC 2R7ZJ 1OCZH 3F6OA 1QVGS 4FT2A 5ICCA 1AWJA 1YTYA 4C0DC 1HDPA 2WV1A 2E60A 2XPWA 3V42A 1YI2I 2F2VA 1W36D 1DJ7B 1Z05A 1JBMA 2M87A 2JUGA 2BW3A 1TWGJ 1LVAA 5KYWA 3E0JB 1X4PA 4OU0A 3HOZJ 1IGUA 3F23A 1GCPA 2FRYA 2Z9OA 1LQ1A 2Y2ZA 5K7ZA 4XU0A 5GMKh 2MBFA 1WJCA 4I02A 2FUG2 5E1ZB 4UUTA 4WTOB 2P4TA 2CSOA 3MEWA 2CW0F 2FNAA 2VQLA 5J1RA 4Y91A 2ZJRF 2E3IA 3M58A 3X2QH 1TWHJ 3NWSA 4HSTA 4RBOA 2DJZA 4BJTA 1VQMQ 3VKIA 4C0FA 5EEGA 3CF2A 3ERED 4HX4A 2GTOA 2JSCA 2W24A 1UFMA 2YS9A 1M2VB 2RHIA 1V5EA 4QQGA 4M7AB 2HNHA 3OYGA 3HIFA 2NVTJ 1KD1C 2MSYA 5B3SH 1OULA 3LL7A 1M3BA 1PRMC 4AG2C 2KQRA 2MH9A 2PMZN 1M1KC 2HWVA 3NWTA 1LKXA 2RNGA 4KA4A 2O61A 2RK1A 3R0JA 4I7HA 2GXBA 1YIJI 1ON1A 4GGGA 4BHPA 5BQTA 1BBZA 2DXCA 2WSCE 3FRNA 4QW2A 4C5IA 4DEXA 4LIUA 1TZLA 2HDWA 3T9NA 3S1QJ 1A5JA 3RMSA 4ORZA 5I22A 1K6OA 1YWOA 3OMGA 1RAHB 3PVQA 1RI9A 4OVAA 2IIMA 5AONA 1SFEA 4AYBN 4HYEA 5LGNA 4RMOA 1TW3A 2HTSA 3VU3C 5GJWB 3CCLQ 1TWFJ 4GXOA 3SFIA 4UVAA 4LB5A 3FIWA 2DTRA 1UCRA 4M3BA 1T8IA 2V9PA 5TISC 1IRZA 3EG9A 3FHZA 5AIPA 2CW7A 2ESHA 2WAFA 3S1MJ 1KK7A 3JB9H 1N27A 2GIVA 1ZX6A 2K02A 3S1NJ 2NUTA 1XG1A 4EIKA 2FEZA 2FNPA 3JB9F 4Y28E 2XB0X 1Q86U 2GWRA 4MIMA 5F04A 4FYXB 2QEXI 4F92B 2F2WA 2VLAA 1I3QJ 4CC4B 5IH2A 1LNXA 4LUEA 4OMQA 2M7BA 1F4KA 3M0RA 4A69C 4DYQA 4EM2A 1G4DA 1QU3A 5M5XJ 3JCMV 1Q7YU 3WTTC 1DP3A 1BKBA 2F1LA 4PJOG 3QHSA 4HOBA 2DI3A 3SZTA 2VOOA 3J81R 3FX3A 1X2MA 1SFXA 4M9SA 2A6HF 5D5VB 2P4WA 5LD2C 2X9HA 1BN5A 1NJIC 2RHXA 4YRVA 1UEBA 2DEUA 1XSVA 4G12A 4C92D 3EGDA 3OA6A 3L2QA 4XLPF 2L9VA 2F2XA 1YJ9A 2JA8J 3CC2Q 1R8OB 4KMFA 3HHHA 4LLNA 1BR4A 1ZH5A 1PM3A 4F7UA 1FIAA 3PIOF 1IREB 5LGTA 7AT1B 5GANg 3GTKJ 2OX7A 3QODA 3J81E 2IS2A 4M77G 2R5YB 3CCMT 2LTOA 3OSSC 1L0OC 2FPEA 1OPKA 2A69F 4BGDA 2GGRA 1Y8RB 2JRMA 4E70A 3DB3A 2YT6A 1X1AA 2GZWA 1SF9A 4OIPF 2DD5A 2HZDA 2RKHA 2GBYA 2ZPIB 4BB7A 3GX4X 4IUTA 3ISPA 8ATCB 1CQTA 2MGQA 2K7LA 2MIOA 1V3FA 5E8IA 2ACJA 2LG4A 1WI3A 1G3TA 3OYNA 4EMKC 4HF1A 2JN0A 2WACA 2NUPA 1KG1A 4LD6A 3NGPA 1WHKA 1TTYA 2VASA 2CDTA 3WTYC 3HOTA 3SEQA 1RQ6A 4YIFA 2VN2A 3HB9A 3U21A 3JAMZ 2JM9A 1U0JA 1V5GA 2FOKA 3E6DA 4EM1A 3J7YJ 1YOVB 3OOPA 4Y33A 2CSIA 1IN4A 2VL8A 3GW2A 2ECZA 2L8DA 3VS6A 4E6RA 1WJBA 3BG7A 3EDPA 5K5OA 3MO8A 1ACIA 2RGVA 3RCOA 1NM7A 2FEIA 3JCMb 2FBKA 2HDAA 2F5CA 2K9GA 2LLKA 4YFXF 4RUGA 1OFCX 3CMEI 3URGA 1N8RC 5E3MA 1RUOA 1MBEA 4GYGA 2K7AA 1VQLA 1K9AA 2LP0A 4A5MA 1SANA 2PMUA 1ZUKA 2DZCA 3CCRT 2HU9A 2ME6A 1OI1A 1Z9CA 2LK2A 3LSKA 3M3YJ 1SKUB 3CCEA 3DKYA 1VQ4Q 4NOYA 3M0QA 3BR1A 2M34A 1WGXA 4M78B 1OR7A 3ABKH 3JSOA 4M77A 3JB9G 4HLYA 5EEAA 1B8IA 3D1NI 1KGSA 2LY1A 4ATOA 5GMKi 1GVJA 1WFXA 2VBXA 3GNGA 3QWYA 3KZYA 3R6OA 4HT9A 2XDVA 3UA7A 2LBFB 3H0HA 4PUSA 3SWNB 1YJWI 4IUPA 4M3FA 2GQIA 2DJIA 3CCLT 1YIJT 2QBYA 4ANJA 2XGDA 5IT9E 1FOYA 1ZG5A 1AKHA 2JXBA 3GUDA 4IF4A 1Y1VJ 2OTJI 3GFMA 3IH3A 1MMNA 2XAQA 3Q0WA 4RG8A 5D8KB 5IP7J 2VPLA 4HF2A 3PO2J 4M75C 5LJ5d 4CYCA 3JREA 4PCQA 2LZ6B 3GTPJ 1R1VA 1UZCA 3C12A 5GJVB 2V4JC 2MVTA 2VUBA 4N4GA 2IBDA 2KIUA 1GXPA 3CXCS 2V79A 2W25A 1VQ9I 4MTDA 4XRMA 1QKWA 2FMYA 4XLAA 6PAXA 3A8HB 2KDOA 2H6BA 2EFOA 2W1OA 2QLZA 2XF5A 4E7SA 1HSTA 1N77A 3DWLE 3RSNA 4J6WA 3QWLA 3S15J 4Q5WA 3J7AF 1MZBA 4M7AG 3GZNB 3MCAB 1Z21A 1UTIA 3FF5A 2DMUA 3EUHC 1WQ7A 3NRVA 2ZZDA 1GXIE 2IJLA 2H3JA 1VQNQ 4HT8A 2FG0A 3LWIA 4A2UA 6AT1B 1T2KA 2R7QA 1VOMA 4ON0A 4A3GJ 3BR3A 3HSRA 1SMYF 1VQLI 4LOCA 3CEYA 2I8DA 1AD5A 1E17A 1YHQI 5GAMj 2IA1A 4BQOA 3BTJA 5LGUA 2DYBA 1H8AC 2EA2A 1YITQ 1OQYA 2RQTA 2OTLT 3A01B 4M7AF 3EAEA 3QYEA 2M51A 1W7PA 2O8XA 3WE3A 4AT1B 2R4GA 2G7HA 1WCMJ 2Q8KA 4GDFA 4FT4A 2K79A 3S3OA 1YJWA 3MMYB 3GBQA 4YEJA 4XTYA 1VQPA 3WG7H 1VQ9A 3CCLA 4C92C 2H09A 3K4LA 3UNGC 1B7TA 1D5YA 1QPMA 4CA0A 2CUDA 5CVVA 3ASNH 5GAMe 3WU1B 4DNCA 5LBQA 3VYUB 1DPUA 3KLOA 3EG0A 2PMZA 2JTFA 4HCKA 4IVNA 4KICA 2X4YA 3F8FA 4BXFA 1KQ0A 4C2MJ 1X2KA 3VRZA 1M90R 1UFFA 4QKUA 2Y0SN 3E6CC 1YJNI 1R1UA 2LTPA 1OCRH 1VQMI 2D8JA 3BTIA 3BE3A 1OCTC 4GCVA 1NLPC 3IKTA 1POGA 2CQKA 4XLEA 3VFZA 2KRNA 4XN0A 4QTRA 4CCOA 4XRSG 5FU6C 4FU6A 1N25A 5ICEA 1O3QA 2AQFA 3VOEA 3VS1A 3J80E 3H9QA 2HOEA 3G4SA 2HZYA 3LQQA 2BV6A 2Y9ZA 2O7OA 2VB6A 5GAMd 2FBHA 3FMRA 4P55A 2VJJA 1B07A 2WWYA 1W5TA 4B9XA 3OR1C 2BY2A 5GAHJ 3IC7A 2H1KA 2CREA 5GAN5 3WXMB 3BDUA 2M1HA 1M30A 4OIOF 4M4ZA 1SRLA 2GTJA 3KYDB 3RJPA 1HA8A 2Z0WA 3VWBA 2VWFA 4M77E 1H92A 1VQ8A 1CKBA 4ABZA 3PFSA 1ERDA 2K4BA 5GAN3 4M7AD 2KL4A 2QSGX 4PJMA 5K1YA 2HKOA 5FFZA 1AVZC 1G3WA 2JVVA 1HLVA 3ZQGA 3CUOA 5IYDJ 2M8GX 1A31A 1UHCA 3U1DA 1JKRC 4PNOA 1ZBXA 1K0XA 5A2QZ 1JTXA 1OCOH 4R56A 2ZAEA 2R7RA 3KZZA 2KLOA 3LSIA 3EFOB 2J7IA 1FBUA 1WPYA 4B9WA 3WODF 3GEZA 2COBA 1QHHD 2DIGA 1APLC 4D7MA 2BBYA 3W6JB 1E0EA 1WDXA 1ZQ1A 2EJFA 4JDSA 5EF6A 1VQKA 1VQPT 4KT6A 2YLCA 3TO9A 1IN8A 2IA2A 3BR5A 2M5WA 3WTSC 2J6OA 2UZKA 2XG8D 3P8HA 4NS5A 3OV8A 1TC3C 3CCJT 1W36C 1ZYRF 3ZPLA 3AG4H 4L9NA 2AK5A 2XROA 4Z88A 3REOA 2DBMA 1KC8C 1I6XA 1QBJA 4NQWB 1XNIA 4ESFA 1HKTA 1BCMA 2Y4YA 1QA6A 4HAMA 1UJ0A 4HSRA 1I6HJ 2KRFA 2Y30A 3W2VA 4NC6A 3RKYA 3SFZA 2NNYA 1B72B 3G7ZA 4LLGF 5GMKm 3RERA 3W2WA 3OQ5A 2CYYA 3VS0A 1G2HA 2K9QA 4P1WA 3ML6A 3WG9A 4PDKA 4LLLA 2O01E 5LL6S 3AHUA 1JJ8C 2IS6A 3N4MA 2YRCA 3IV5A 3QYFA 1Q1VA 1YNZA 3A8MB 2VGMA 4CRIA 1ZAOA 4AFSC 1I5LA 2A6TA 3CUQA 4II3A 2EW3A 4IIMA 4EMKA 4FQGA 5CCAA 5KYYA 1I8FA 4MHGA 3H35A 2OD5A 2NNNA 3IH4A 3SZPA 4LD9K 1BI0A 3S3NA 2VGNA 5KCMA 3G71I 4L9VA 2O2OA 3JRZA 3HTUA 1ZG3A 3ZP5A 2K3YA 2LP5A 2V1RA 1WSUA 2VKNA 3F70A 3UATA 2C06A 2IAIA 1S7AA 3E5QA 1EH8A 2M0CA 2Z33A 1PP8F 2BUDA 4ZGEB 1ULYA 1HDDC 2OTLQ 1DDNA 2HQNA 2NLUA 2X51A 4EV0A 3QIIA 2D6FA 4ZH4F 1U2WA 3GLXA 3KFVA 1YX5A 3V7RA 2ADUA 4B8XA 2CP7A 1Z6RA 2Y31A 3MZHA 1H9TA 1JB0E 4YIRX 2RQUA 2SEMA 4C5EA 2D2WA 1AWCA 3K2AA 4HNTA 4PJJA 4GLMA 4BH9A 4IUQA 2KSSA 2JPBA 4M75D 4N0AC 1M2VA 1REPC 1GVDA 2R7DA 3W3CA 2YX7A 3R60A 3J81Z 3OIOA 2E5KA 3MPUB 4BKXA 3MKZA 1J9IA 2E5NA 2FBIA 2BZTA 2K85A 4M75B 2E12A 3A2KA 1XN7A 3IWZA 1VQNI 2QSFX 3I35A 3I59B 2DAQA 1IN5A 1OLTA 4V2GA 2QQRA 3KP6A 2HQXA 4JJDA 3I55A 4Y15A 2K3PA 1W4SA 3BJOA 3VYHB 1Z6TA 4IPAA 1FOXA 3H0FA 2L02A 2IEKA 2DVEA 5FGMA 1KFZA 1Z3XA 2E1OA 3F8NA 2XRLA 4F93B 4HV6A 4WCGA 1VQ5I 3JCMe 5B1AH 1C0MA 2DMQA 2E10A 4MEXF 1CKAA 2A3SA 4B48A 3CD6I 1TTHB 5CKHA 5KYUB 2O88A 2VBYA 1JQQA 4XTZA 1VQ6T 2DLPA 5F0HA 4AC0A 4C8QE 3K2ZA 1W2BP 4B44A 4A4HA 1TQPA 1JKPC 3OYYA 4X1VA 1YP5A 2E4HA 3DTIA 3G6EQ 4AIKA 4RDUA 3DTEA 2JS2A 5F6FA 3CF5F 5CLSA 3SWNA 3KFWX 1DU0A 2CJJA 2LFBA 2HPIA 2X4HA 1Y39A 1XPXA 2FOWA 1WHGA 3GP8A 5JLWA 2DRKA 2XPVA 2K5LA 3KPHA 1JRIA 3SHFA 2EQUA 4C92A 4KGZB 4S0HB 3S1RJ 2IVWA 2P0QA 3DBHB 4HPQA 2MD5A 2JN6A 2FO0A 3O3KA 1W2BS 3UR3C 3LGLA 3K4NA 3PT9A 1GBQA 4M75F 3A4CA 1SVLA 3S14J 2BOLA 3ASKA 3LSHA 4G6DA 5KCHA 1OV3A 2VC1A 3BQYA 2LY2A 1B9NA 1U3EM 4EJWA 1KQ8A 1FP2A 2WAQA 5ERIA 2CS7A 2COYA 3F21A 4HCZA 4F7UG 4UVCA 2R7SA 3CCJQ 1B9MA 4XM3A 3HRSA 3CO7C 3O8GA 4HX7A 2RNJA 1X58A 3LA7A 3WGIA 4IQ4A 2XF6A 4XLFA 2K5IA 2XKOA 4AIDA 4I6ZA 1W1WE 4ZZLA 3SB2A 4LGWA 8AT1B 4OB3B 3C7JA 5M3MJ 3PNWC 1HCRA 3QU6A 2V9VA 3M0UA 2NUPB 4QPOA 2EZHA 4S05A 3OBWA 1Y1WJ 1PVEA 1YJNQ 4JZ4A 3VPRA 2E7WA 1Q86C 2ED0A 2LT4A 1TSFA 1E3OC 4ELZC 4RA2A 4JJCA 1K78A 2PLYA 3LNQA 4V19K 1ZUYA 2CT3A 5CQEA 4EVIA 1PP7U 1YJ9T 5EG0A 4CICA 4BHCA 1V29B 1QHGA 2EK5A 3AL0C 4ESBA 2JOYA 1UG0A 5D4RA 3CBPA 5LJ3d 2ZFWA 4E2FB 3RPQA 2DJNA 3G1OA 2KT1A 4A3JJ 4K2EA 2LSOA 1ENHA 3QPSA 3S93A 4C92F 2ZFUA 3BTCA 2W00A 3U1KA 5FJ8J 2F4OB 2NYXA 1VQ7I 1I5OB 2MYSA 3QP6A 4JX6A 1QLYA 3MEUA 4MFDA 3DPTA 4O5VA 4XKBA 1H3ZA 4IO9F 4CXFA 2PZ1A 3E5UA 1GCQA 2VPRA 5F08A 2V8JA 1M1FA 2R0QC 2QAZA 1MMAA 2DBBA 1V55H 5ILSA 4C3IJ 4HNVA 2EYYA 4RAGA 2KYBA 2BVMA 4A12A 2COZA 4JRKA 3ZQLA 1OMIA 2EYWA 4BQAA 1ETOA 3ZQ7A 3BROA 3KBGA 3ZFJA 2ECBA 1D0YA 3KP5A 4AD9A 3MHXA 4AMCA 2A07F 3K0LA 3TO6A 4M9ZA 1SSHA 3JB9I 1E2XA 5GAOn 4J9GA 1IN7A 2OJED 3L00A 2QQSA 3JSCA 2JTVA 1OYXA 3NPFA 3LAJA 4IQJA 1S6LA 1HYOA 1YWPA 1IV8A 1YQAA 2GAUA 2EZKA 3RQIA 2KNBB 2NYSA 1M1KU 3E1SA 3ZGKA 3E2UA 2MD0A 2YU9J 1QCFA 3LGFA 1T0FA 3GOXA 4XONA 3ZQFA 4UUSA 3L2RA 1X1BA 3CMAI 1R0BG 3CCSQ 1VQ9Q 5JVGF 4G6TB 1RABB 1T95A 1HOMA 1YFNA 3VYRB 1I50J 2FJ1A 3RKWA 3KUFA 4LUDA 5IYBJ 2HQ5A 5LRSA 1PSEA 2BHYA 1VQ6Q 4C0ZA 4ZYAA 1NZ9A 3K6GA 3ZQCA 4Z6YA 1FOKA 3GTLJ 2CP2A 5IP6A 4U88A 3QO3A 1B8IB 1M2OA 4OMMA 2WB1A 4L5JA 3JTGA 2JZ2A 3K69A 4YIIA 1NH3A 3DLLA 2LQNA 4ESRA 4ZN3A 1YJ9Q 3QU3A 4A63B 1TH7A 4KIFA 1O3SA 5HDNA 1QZYA 3CCVA 1QVGA 3ZQIA 1AWOA 4QIWN 5HLHA 2LVMA 4A3CJ 1G2BA 4PL6A 2W48A 5A2QR 1EFNA 4DEYA 3HPWA 1M8VA 2ZCWA 4MTEA 5DM7F 4RGUA 3HPHA 4BU2A 1VTNC 5GAOl 4MGRA 4MDXA 1MDMB 1ZRCA 1TP4A 1R49A 2M16A 4IURA 4OAZA 3CLQA 3QOPA 4DW6A 3L42A 3FXUA 3H6ZA 1JUMA 1SMTA 2LX9A 3PVLA 3LWHA 5EGOB 1H8KA 3EETA 5GAMg 1YIJQ 3LSRA 5IHIA 1Y71A 1KC8U 2JRTA 3JRGA 2M0YA 3JR9A 1Y0MA 2WADA 2DA5A 2OAUA 5DM7R 5ED4A 1ZQ3P 2FRHA 1K9MC 4DJAA 3FB9A 2HQRA 3FK6A 1TT0A 3LFUA 3NAUA 2HGCA 4QLCU 2EJGA 3CQZJ 5IT9Z 5DY9A 5F1JA 1Y7XA 2Z16A 3C1DA 2DL7A 2LDUA 5D5WB 2VV5A 2R7FA 2RQVA 2DT7B 1JGSA 1G6NA 3OIQA 3DPLC 2JW4A 1RAEB 5D4SA 2JT1A 1FT9A 3C2GA 1RR8C 2OA4A 2MA3A 1HF0A 1QVPA 2KEAA 1ZLMA 2PUKB 4EPCA 4Z2YA 3CBMA 3OBYA 4KFCA 1XJWB 2KY9A 3CESA 3M8FA 5DV5A 3F0CA 4R55A 4D7NA 3IHUA 1M9SA 4NL3A 4X1EA 3TVTA 2IW5A 1ONVA 1IDZA 2MPXC 1Q81C 1H88C 2FL7A 2JS0A 3A1PA 4W1UA 2ROTA 1KONA 2CFXA 3BDDA 4IX7A 2ENMA 2PQ8A 3FWEA 5J6XA 2KI7A 1YIJA 1PUFA 5GAOp 3EG3A 4BUGA 4HA8A 4FSXA 4KDPA 2DT6A 3D5SC 2X6OA 1RL2A 3EGXB 4Y92A 1GFDA 3T8TA 3H41A 3OB9A 1KZHA 2NAZA 1ZHIA 1Q82C 1KQSS 1JJ6C 2IXSA 1O75A 4RGRA 1MKMA 5I11A 1AA7A 3ABLH 5CVRA 2HMAA 4CCLA 5FKLA 2RHYA 4ZJZA 4L0YB 1GHCA 2QI2A 3SWNC 1YW7A 1U5TB 3PO3J 2FD5A 4YELA 1WI9A 1S72I 3BQZA 1R5ID 3FKIJ 4QQDA 2G7UA 3H3ZA 3RESA 4OIQF 2HVQA 2OTLA 3LAPA 4I98B 3VYGA 2DQRA 2W82A 3U23A 4N4OB 2STWA 3JCMQ 2DFFA 1IRGA 3HYIA 4ZYGA 1OOTA 2HL5C 2R58A 1OISA 4RM2A 1DUXC 1I1JA 2CZ1B 2O03A 2VQHA 4MZPA 5AT1B 2GOMA 3UPUA 4OMNA 4B4CA 3T5XA 2CP5A 2X35A 4F7ZA 3BC8A 3PUFA 4HDUA 1GV5A 2VXEA 1NJIR 2DOAA 2WTEA 1UGQB 2LX7A 1VQ9T 4N4IA 2R7WA 2K4YA 2XPUA 3RDIA 3MN2A 5F1RA 3L1PA 2DPUA 2BXYA 3EYYA 4AU7A 2RJFA 1SFKA 3MWMA 2L4AA 3LMMA 1W5CC 4OB0B 5FWBA 2JJ7A 2Y0SA 4A0YA 4OF1A 5TRDA 4UUVA 5M9OA 1C1AA 2OTJT 3OWTA 4QSHA 1FLIA 2VBWA 2FMLA 4XIDA 5IT9R 1U06A 2YXYA 3OOUA 5HNFA 3DLMA 4BEHB 1LFUP 4ASNA 2M7AA 3ABTA 4JQFA 3CCLI 2QK0A 2RN7A 4RAFA 3JCMP 2DW4A 3HPGA 3HEFA 3TKYA 1IZ6A 5GAN8 1I5ZA 2GA1A 3OYJA 4LN2A 4FL6A 3RR6A 1D0XA 4J7IA 5GPAA 4ZNXA 4JK1X 1BW6A 4PFOA 2E36A 4BAYA 2A3LA 1NJIU 1ZREA 4X34A 4PJOD 1YJWQ 2KISA 2ISYA 4M3EA 5FLXR 4BBRJ 1YITI 3O2PE 2FRWA 4P5NA 4J9CA 3CCQT 3CP8A 1M4ZA 1ZK8A 3KP4A 4BJ5C 1CGPA 1UMQA 1HD3A 2HQAA 2JK3A 3BY6A 3DU5A 4YG2F 2DYIA 2RQQA 4ENMA 1OYIA 5TJJA 4C0GA 3CC4I 1U78A 1W70A 5FKKA 2OZUA 4BBSJ 1VQ5T 4RB2C 2HS5A 5HLGA 4FTHA 1ZSGA 1MJ9A 2IRFG 4C5GA 3SDGA 4JLIA 4HQEA 1T33A 3G3ZA 1GCQC 4K11A 1XSXA 1NHAA 3J7AO 3HFNA 3VS5A 2YRDA 4FX0A 2HPMA 2HBPA 2QASA 2XDDA 3WGGA 4G7OF 3IRRA 2DXUA 5CO7A 3CJRB 1TBXA 3TBIA 2LNHB 2NUTB 4BL0B 4YFNF 3GYHX 3HTRA 3M54A 2K86A 1QVGP 3F3XA 1IHWA 4RAZA 2Y48A 4LK0F 1WHHA 1YRNA 4CCMA 4YFKF 2XIGA 2X1EA 3FM5A 5JFRA 2LVSA 4MO7A 3LSPA 2ZJPF 1SD4A 1W0TA 3DPUA 4FW1A 1OQKA 2RH2A 2QTVA 1MSEC 1B34B 2CQ7A 1SHGA 3GZ5A 2EV6A 4J00A 4A4FA 2F2EA 1ZA2B 1T0FC 2BE7D 2K2MA 5L3DA 3KETA 2K57A 3M57A 3NTIA 4ESJA 4Q48A 1FOWA 4MQ9F 3KYCB 5DUIA 4EGZA 1LB2A 3UT1A 3U9GA 3H5NA 1QZZA 1W5SA 3I59A 5E8GA 3ROUA 5M3FJ 1Y57A 3KX2A 1X6OA 1JKQC 3W6KB 4M77F 4X9CA 3FJPA 4OB1B 2HQEA 4A6EA 3CCMI 3ABUA 3M56A 3M59A 4HCCA 2QBYB 1XC5A 4QWQA 3H8ZA 1X2QA 1ZSZB 1S72Q 2HZTA 2OAZA 1K1ZA 5J39A 2DBKA 1Z77A 5HKCA 1XGOA 1QMCA 1VQ4I 3VS4A 4C8QF 4E6KG 2LQKA 1X27A 2HYFA 1GLNA 3QYBA 1IHVA 2FXAA 3CCQQ 3F22A 2IGKA 2JWTA 3M1CA 2EQMA 2XAFA 1D0ZA 2WB1N 3KEQA 1LEAA 1IO6A 2B7EA 1IW7F 1MMDA 1XD7A 4E7KA 3LW5E 4CYDA 1A36A 2DZ9A 2DIQA 3CJTB 1PRLC 1IO2A 1N6AA 1IXRC 2ICWG 1R1TA 3MVPA 2OUMA 2Z2SB 2X98A 5LJ3h 5CKTA 2P5KA 2A5WA 1YN8A 1Q95G 4KUDK 4IHXA 3RPUA 2VT2A 1O7FA 3PTAA 1R4NB 1UB9A 5IHNA 2IG0A 2BE5F 3G1LA 1MBGA 1T56A 1VFCA 3VYTB 3FMQA 1I1SA 1BU1A 2JA2A 3DP7A 2WV0A 1W6XA 2L54A 3X24B 5LJ3g 5ICFA 2HOAA 4XL9A 1YO5C 5A0DA 1IV6A 3CD6Q 1Z9QA 5FKMA 3H5AA 4II1A 4JOMA 1NLOC 3TEEA 2HKQB 1WRJA 2NRAC 1M90U 3ZR8X 1ETWA 2COMA 5IAYA 3S3MA 3TSZA 3BW1A 4J6XA 3PFYA 2CH4W 1FPQA 2ZPBB 3ZEHA 2F6CA 1M1GA 4HVVA 3JRAA 4Y7NJ 1UG1A 3CCSA 1AOJA 3GXOA 4BNCA 2JUFA 2EINH 4L5IA 1PKTA 1RADB 5HLTA 2COWA 1O3TA 4D5FA 3L9FA 1OKRA 5FROA 1NYFA 1VQ6A 3CPWS 3CDLA 3EUAA 4A93J 2L0KA 2KRHA 3AFHA 1BOAA 4EMGA 2CV1A 1XCBA 3QQAA 1QVUA 3DBLB 3QP5A 2DPDA 3QPTA 2F5TX 4RTTA 2YHTA 1ETXA 1RR7A 3BZ6A 3A02A 3CXCA 3C2HA 4ZGJB 3CCVQ 1UB4A 1P2FA 1R22A 5DCMA 1MW7A 2CH4A 4P96A 2PVOB 3CD6A 3MP6A 5DYMA 1RC9A 5FRMA 4F16A 1SHFA 5KYYB 2EIKH 2DM1A 3SDZA 1RAAB 5B66C 4C8QC 3JCMJ 4RCCA 3MP1A 3P9IA 1VQLQ 1A6IA 5GAN6 1WGSA 4Y4RA 2L3DA 4M78F 1R7JA 4XLHA 1DPRA 4J9EA 5GANh 2AT1B 2QKLB 2EGAA 2YDLA 2O9VA 1ARKA 4LIVA 5HS9A 1ZR4A 3QYHB 4A4KA 4GRIA 2CG4A 4RMNA 3HOXJ 1VQ6I 1YI2T 4XMYA 1ETYA 3MKDA 1O9SA 4V2SA 5FO5A 4AVZA 2W7NA 1RAIB 4J9HA 3UWNA 1OYYA 3BZKA 2QUFA 1NK3P 1GDTA 2L7ZA 2KK4A 1I39A 3BCBA 1VQOT 2L4MA 5CQXA 1RLPC 2XAJA 1X3WB 3B73A 3CC7Q 3BJ6A 2VT3A 4JRQA 3TCJA 2DODA 3G4SQ 2X6WA 3R4KA 2C0OA 1VQNT 2ZMEA 3ZN1A
chains in the Genus database with same CATH topology
3IWFA 5H6QA 2F5DA 3LX7A 3ZMUA 2ZXJA 2DK5A 3JW4A 4XU3A 3FZVA 3OYBA 5CJ9A 5IT3A 3WTWC 1KHCA 4E7HA 1KQ9A 2CZ0B 1V4RA 4MDWA 1J5YA 1SD5A 4KUIA 3CCJA 2XKPA 1U1SA 4KUMA 2RI3A 3CJNA 2XIDA 3EYIA 2ETHA 3SXYA 3ZBDA 2EYQA 1SD6A 1BM9A 3FM3A 1H0MA 3COAC 3I0TA 4WXDA 4F7UE 2WC2A 2D9TA 4C92E 4M7AE