1P92A

Crystal structure of (h79a)dtxr
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
226
structure length
218
Chain Sequence
MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKARLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Diphtheria toxin repressor
publication title Determinants of the SRC homology domain 3-like fold.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 58
structure length 218
sequence length 226
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p92A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1p92A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1p92A03
3EETA 5JHUA 2KIUA 1G3TA 2ELHA 4RS8A 4IJAA 2KJCA 2VXZA 3WG9A 5FLXK 3OOPA 5FB2A 3RKWA 2ZJ2A 3BROA 4UV8A 3I54A 5HOOA 4I09A 4F7ZA 1FBUA 3KEQA 3ISPA 5LHGA 2P7VB 2KIFA 5CVIA 4KIBA 1USSA 3WGGA 4KA4A 2PQ8A 3CJNA 3WTYC 2QM3A 4XSXF 4CICA 4RB3C 4I01A 2ZO4A 1LVAA 3F21A 4EJOA 4HLXA 1KQ0A 2EJRA 4UHTA 1WRJA 1S8NA 3J80K 2BE5F 1EV7A 2KIMA 3KP7A 1QW1A 4IPAA 2XAFA 2O61A 1XCVA 1ZYRF 3F8BA 5LGNA 3E97A 3DP7A 4BXUA 1JE8A 3WTZA 2Z99A 2KRFA 3ABUA 1PP7U 5BQTA 3ECOA 4WWCA 2P4WA 3ECHA 4Z2YA 1XGNA 2VT3A 4E70A 2OAZA 1BM9A 2J5OA 3BJAA 3K69A 1TW2A 1T0FA 2V6CA 3N97A 5DV5A 1EH7A 1GVJA 1STZA 4FX0A 4U0YA 2PJPA 2HS5A 4UVBA 4HZFA 1IRGA 5D5WB 2FBHA 4BHPA 3QU3A 2L01A 3KCCA 4RGRA 1P4WA 2NAZA 2XAGA 4KICA 4OIRF 1XSXA 4OIPF 4CXFA 4N9HA 2HDCA 4UVAA 3F6VA 4I02A 3CUOA 3CTAA 1QNTA 5K5RA 3GX4X 5ICGA 1BIAA 1B1BA 2CGPA 2ADUA 3FM3A 1D3YA 1HW5A 4Q5SF 1ZGAA 2XKPA 5D5VB 4BHBA 1B6AA 3LAJA 2HKOA 3IHUA 3WU1B 1O3SA 1USTA 5A2QK 4YG2F 3KP3A 3RKXA 5D6FA 4RGUA 3KP2A 3Q9SA 4AIKA 5CVJA 2FSWA 3T5XA 2ACJA 3K1NA 1D8KA 2W24A 5HS8A 1R36A 2UXXA 1LDJA 1DUXC 2MH2A 3WODF 2QBYA 3GF2A 3WTVC 3GW2A 4EGZA 1XGMA 4CYDA 4BYYA 1TQMA 2XIGA 3MAJA 5KK1A 4WXDA 4WX9A 2G7UA 4O5VA 2DQLA 1H9TA 1XD7A 3BOQA 1JXSA 5DCMB 1LDDA 3J7AO 3E5UA 2L02A 4MEXF 3Q9VA 2GIVA 4EV0A 1CF7B 3TDZC 1FYLA 3GUDA 3JW4A 3WTXC 3HYIA 3CLOA 1YW7A 1FBQA 1Z91A 1GHCA 2DTRA 2DQRA 2HYFA 4KIFA 4LK0F 3GFLA 1L0OC 1W7PA 3ZMDA 4M9SA 4NB5A 4DNCA 3CDHA 1ZRFA 2YU3A 2OD5A 2D45A 6PAXA 3RTRA 3FMQA 2R3SA 3OV8A 1TTYA 1P92A 3HSRA 2HQNA 1HW2A 4ESBA 2XV4S 2QYOA 1S29A 2M30A 1YW8A 1S3JA 1F4KA 3E19A 1R1UA 4I2OA 4GGGA 2DBBA 3KP4A 5HS7A 3E6DA 1FY7A 1KYZA 2X0LA 3EYIA 5J6XA 1S6LA 4LK1F 2RGVA 5EEGA 2EFPA 2PG4A 2Z33A 4IRGA 1V3FA 1XGSA 2DFIA 4N9IA 4BNCA 2IRFG 1FYKA 2DU9A 1R58A 3LSTA 2BGCA 4MHGA 3K1PA 2B0LA 3M7GA 2VBZA 4ASNA 4LMYA 1Z1DA 3MEXA 5L3GA 4OOIA 4HQEA 2DPDA 5CVUA 1T98A 5JFRA 1EH8A 2LSOA 5BPIA 5LRSA 4GO1A 3BP8A 3VEPA 3QOPA 4IRHA 2ZNYA 4M9ZA 4B09A 4I0AA 3SZPA 2HWVA 2PMUA 2C6YA 4PZJA 2O3FA 2LDUA 2K02A 3RDIA 2RVCA 3P9IA 3WU0A 3P9KA 3FHZA 3E6CC 4UNOA 3D5LA 4LLLA 3ZQ7A 5D5UB 2RV8A 1EH6A 4CO8A 4A0XA 2WTEA 3VB2A 3BY6A 1IN6A 3C1DA 4M6XA 5DUIA 3LQQA 5CJ9A 1U2WA 3KLOA 3GFMA 3TDUC 3PFIA 1IW7F 2NYXA 1XMKA 5HS9A 3AAFA 2WWYA 4BH9A 1LDKB 1UFMA 3LQRA 5H20A 3T0YA 5E1WA 3I5UA 1XMAA 1VTNC 1OKRA 3NQOA 5JI6A 1B9MA 4RGXA 1GXPA 4JQFA 1SMYF 3I59B 3JTGA 3I71A 1YLFA 2ZFWA 4OINF 1K78B 1U5TA 2LKPA 4LGWA 1MGTA 2GWRA 1T38A 3IKVA 1Z9CA 3FXUA 4KUMA 2KJBA 5LLQA 2LF7A 3BWGA 2K7LA 3NEUA 3K0LA 3DKWA 2FNPA 5FFXA 4KMFA 2VBXA 5L3FA 1YO5C 4HW0A 1DPUA 3I53A 3TOBA 2R7DA 4U0VA 2E7XA 3P9CA 3W6KB 4L9JA 1O7FA 1W5TA 2OA4A 2FMYA 1OMIA 2P6SA 4ENNA 1U8RA 3FXQA 3E5XA 2OZUA 3MHXA 1IAWA 3CO7C 3C18A 3HSEA 4KN7X 1ZRDA 1TNTA 2O6GE 4EQQA 5F1RA 4Y15A 1HKQA 2H09A 5H6RA 1YTYA 2WC2A 1SD6A 1Z05A 2L4MA 3M9AA 2CSOA 2K86A 3QAHA 4L0ZB 1W4MA 3U2RA 4LB5A 1SAXA 1PDNC 2QUFA 2L54A 4LLGF 2M5WA 2QQBA 2EV5A 3KETA 1F5TA 2NNYA 4IVNA 1P2FA 3LFKA 4O3MA 4HV5A 3RPQA 1MDMA 3DV8A 3FM5A 3CUQA 3WE2A 5DD4A 4ENMA 3IWFA 5E8GA 3H92A 2F5EA 3V7SA 3PQKA 2P6TA 4EM0B 5ED4A 3H3UA 2FOKA 3DPTA 1FSHA 1XDUA 4M71A 5L3CA 2WV0A 2FNAA 5DYMA 2IJLA 4G7HF 1X3UA 4HLYA 4XBFA 1IXSB 4PDKA 3E3VA 3SZTA 1LQ1A 1Y0UA 1BIBA 4H0EA 1ZG1A 4WXHA 3R61A 2A07F 1OYWA 1FLIA 2XROA 5BOXA 4ZH4F 1BN5A 3HRUA 1I5ZA 2OQRA 1K7AA 2GXBA 1KQ9A 2IA0A 5H6QA 5LEKA 5HLGA 3F8MA 2PN6A 4JK1X 2XUBA 4L9NA 4RB2C 1WI9A 2PFBA 1W7PD 3ABTA 3DXJF 3DQVC 3T1BA 3JTHA 5HDGA 3R6SA 2CWEA 2IA2A 2ZCWA 2UWMA 2E1NA 1TNSA 2K4YA 3KFWX 5E1ZB 5LRRA 3EUHA 2CQKA 1G4DA 2HQRA 5L3DA 3ROUA 3IKTA 4KFCA 4AWXB 5DDGA 1R5GA 3I58A 1B4AA 4QWQA 3WGIA 1I1GA 3FZVA 1ONVA 2DO7A 3ERED 3CO6C 1QQIA 3O3KA 4FT8A 1SMTA 4UUVA 4RB1A 1KQ8A 2DPUA 1H9GA 3RI4A 2ZXJA 2FRHA 3HTSB 1DPRA 4LJZF 2H6CA 4HX8A 4O6JA 4HAMA 3WGHA 3J81K 2P5VA 1YW9A 5L3EA 2PEXA 1SD7A 3BDDA 2P5LC 3LA2A 2FBKA 1TBXA 5LHIA 1ZGJA 4EJTA 1BI2A 1ZLJA 2RDPA 2HFHA 5HLIA 4HV6A 1MJ9A 2MLGA 4LLNA 4LB6B 2Y48A 3H3ZA 5DCMA 4KYWA 3VFZA 1FT9A 3HOSA 3ZMZA 3BJOA 4RB0A 1J59A 3U9GA 2AS5F 1Q1HA 4MQVA 4OU0A 3JSPA 2BEOA 2NNNA 4G7OF 4HDUA 4I7HA 2A3SA 1U6GA 5BMZA 3L2CA 3GZ6A 2MD5A 2EA2A 3V4GA 2PBIA 3C7JA 4GYGA 1QPMA 3G73A 3HHGA 5CVRA 4PGGA 5LGTA 5IT9Z 1T6SA 5K1YA 3F72A 1QZYA 4RAYA 1BBYA 5FGMA 1I6XA 4P55A 5LBQA 2QBYB 1TLHB 1Z6RA 5FO5A 4BAYA 4Y13A 1JHFA 3WTTC 2Z9OA 3ZN1A 4YFKF 5D6EA 3DPLC 3JAMZ 5E1XA 2H94A 1B9NA 3IRQA 2YPRA 1BI1A 2ESHA 3V8JA 3D0SA 2OBPA 3HRTA 2MH9A 2YR2A 1U3EM 1REPC 4HF1A 4AD9A 4EMSA 3SQNA 2PLYA 2FBIA 4PCQA 4NHJA 3R4KA 2F5FA 2GXGA 2KKOA 2ZMEA 2STWA 3REOA 1W7PB 3SFZA 3I0TA 3EYYA 3GO5A 2XAJA 3GZ5A 4S05A 1RNLA 1OR7A 1B59A 2K4BA 2ESNA 3V7RA 2VOPA 2GA2A 1I27A 1ZAOA 1J2XA 2XHKA 4HF0A 4EM1A 1BC7C 3M8FA 4KDPA 1O57A 4CGZA 5EEHA 3T8RA 4IRIA 4LFUA 1LB2A 2JZYA 3WTSC 4LG0A 5CLSA 2K27A 3MFKA 5E17F 2IVMA 1LNWA 2CG4A 1YQAA 1XN7A 2JRTA 2CYYA 3COAC 1MJBA 2H27A 1P4XA 4GCVA 1R5HA 2NRAC 3E6MA 1IRFA 1IF1A 3HSFA 5ICEA 2G9WA 4GXOA 1KU7A 3TOAA 4D0PA 2HKXA 2V79A 2FQ3A 3RYRA 3WE3A 1IN8A 5ILUA 4CDGA 2M1BA 3P7NA 1LJ9A 1IN5A 3L7WA 5AONA 2ZBKA 3U1DA 5FLXZ 2JT1A 2VOOA 1YYVA 3ZMUA 1P6RA 2OU2A 2STTA 2A5YB 3VOEA 3JSOA 3I59A 1IXRC 5DD8A 2JTVA 3F6OA 1OYIA 5DUKA 4MNUA 3ZMSA 3TO9A 5F64A 3GFIA 1OYYA 2M87A 1YS7A 2CW0F 1BC8C 1YIOA 4Q48A 2HZTA 4EM2A 3MZYA 2M8EA 2EFOA 5F6FA 3HTUA 3E5QA 4HBLA 1JHHA 4A6DA 3J80Z 3WTWC 3GEZA 1HKTA 5ICFA 1WQ2A 1FSEA 2GZWA 5LHHA 1ZREA 1Z6TA 3ML6A 3DFGA 2V9VA 4ETSA 2K5FA 2VT2A 3HRMA 1R1TA 3BPXA 4ZZDA 3QP6A 4HX7A 2RKHA 3JAMK 2A61A 2CO5A 4RGSA 3IWZA 3B73A 4DQ2A 1HKSA 3RKYA 4HF2A 3RYPA 1AWCA 2M45A 2J5PA 2F2EA 4MTEA 3F23A 4S04A 1ZG3A 5D4RA 1FBSA 3FMRA 4EJVA 4BQAA 1ZRCA 2EWNA 3MWMA 1U5TB 4JBAA 1MZBA 5BS6A 4AIJA 1U78A 1UHWA 5FD5A 3LA7A 1QVPA 4Y17A 1I1SA 4HDVA 1ZH5A 4G9YA 1UCRA 5D4SA 3KEOA 3HOTA 1IUYA 1YFHA 2CFXA 3EQLF 4TV7A 2O0YA 2VONA 4CZZA 2IW5A 2RQPA 4A2UA 3FXRA 2GA1A 3K9TA 2VBWA 1ON1A 1G3WA 3GFJA 1BJAA 4L18B 5ILVA 2BBYA 2FE3A 3MCZA 4CHUA 3I64A 4I0BA 5J8CA 1UB9A 1R23A 2X4HA 3QPTA 2GCXA 1HW1A 2G7HA 4U7DA 3ZMTA 2D1VA 3M8EA 2DT5A 4A0ZA 2R7FA 3N4MA 5A2QZ 2Z3YA 2OQGA 4XLNF 3V8KA 3ZP5A 5CVVA 5LEJA 2XAHA 1D8JA 3M1EA 3HHHA 1KGSA 2BV6A 1IN4A 2A6HF 4B8XA 2IP2A 4A5NA 2Q0OA 2A68F 5E20A 3FMSA 2ZNZA 1HSJA 2L3DA 4R1HA 1MDMB 2FA5A 2W25A 2RC4A 3CUQB 3HIFA 1FPQA 1LEAA 5ILSA 4WF2A 1OPCA 1ZARA 2XGXA 4BHCA 1O7LA 5FFZA 4A0YA 1ZHFA 4KMUX 2D2WA 4NQWA 3ZPLA 2F5CA 4M72A 2HTJA 4UXNA 4P5OA 1DDNA 4YFNF 2W57A 2ZKZA 2QLZA 1P4AA 2H3JA 3TO6A 4L9TA 2COMA 4HYEA 1R7JA 4A12A 1W5SA 4QLCU 3KLNA 2VC1A 3SHFA 4XRFA 2FF4A 2FEZA 2EFQA 2NS0A 2A6EF 3I4PA 3TQNA 1PP8F 1H0MA 4L9VA 2GQQA 4M6YA 1O3QA 2DK5A 4M74A 1ULYA 3R60A 1RI7A 4RAZA 5TRDA 3GVAA 2K5IA 2LNBA 2QQAA 1RIOH 2ISZA 2DLLA 3LAPA 1FP2A 1WWXA 4KN4X 1HSTA 5JR3A 1FWZA 2VODA 1HQCA 4XLPF 1PUEE 1UHMA 2EFNA 3O6BB 3BZ6A 5HVQC 1T39A 2EA4A 4OIQF 2TDXA 2JSCA 1AOYA 1XSDA 1F1ZA 3V8LA 4MTDA 2W84A 2F5DA 3V7CA 1FZPB 4KNYA 3EDPA 2DW4A 3F8NA 2UZKA 3KE2A 2VBYA 2MBFA 1WKMA 4ZYHA 2EFWA 1TW3A 1G6NA 2L4AA 5BPDA 1FYMA 3PQJA 3F8CA 4A6EA 2E7WA 2V1XA 1YG2A 3ULQB 1T2KA 1FOKA 5TJJA 3T8TA 4P9FA 1J9IA 2EV6A 3LA3A 3TGNA 1MD0A 1BYMA 3Q5FA 5FD6A 1E2XA 4WCGA 1CF7A 4Q47A 5K5QA 2QQ9A 2XKOA 3FWEA 3NRVA 2V1UA 4IXAA 4EVIA 4K2EA 5HDNA 3GLXA 3QP5A 2PI0A 2LF8A 3DF8A 5D8KB 2P8TA 2Q8KA 2Z5UA 4PGHA 4ENJA 1MJAA 4AVPA 4OIOF 2VE8A 3HUGA 1ODDA 2HOEA 1S7AA 4AIHA 4IF4A 2HTSA 2RNJA 4FHTA 2A69F 4IHSA 4IHTA 1XGOA 4HQMA 3RIRA 2V1DA 1G3YA 2MA3A 4YFXF 4L5IA 2ISYA 2AXLA 1ON2A 2O8XA 1FC3A 3F3XA 4KT5C 1DP7P 3O2PE 2DI3A 3GYHX 1IXCA 2W85A 3E6BA 1S7OA 4EJWA 2HGCA 5KVRA 4P9UA 5D8LB 3VODA 4OMZA 3ZMVA 5DCFA 3HRSA 2QVOA 3R0JA 3GXOA 1SFXA 3F8FA 4G7ZF 2XASA 2IT0A 1E17A 4HX4A 5ERIA 3QRFF 1NHAA 4XSZF 1J75A 4YIIA 3FF5A 1XSVA 5E18F 1SFEA 2DAOA 1QBJA 1TQPA 2YSRA 4WXCA 4KIGA 5HLHA 4I98B 1R1VA 4MEYF 5K5OA 3BPVA 4LD5A 2YX7A 2K5LA 5IT3A 4OMYA 4EJUA 1RZ4A 3L00A 3RPUA 1QGPA 3MQ0A 1J7KA 2ZMEB 1RUOA 1IN7A 1L3LA 4G6DA 1O3RA 2QZ8A 2XAQA 1G3SA 4M73A 2LX9A 2D1HA 1XDSA 2P7CB 3K1MA 4ZYEA 4M9XA 4P96A 1XB4A 4R8HA 3C3WA 1U5TC 2EV0A 2OZ6A 5L3BA 1BI3A 2JPBA 2EK5A 4A5MA 3KZYA 5CYVA 5D5XB 1IZ1A 1QO0D 2XVCA 4U88A 3K2ZA 1A04A 4ZYDA 4L5JA 3QPHA 2QENA 5AIQA 1O3TA 4G6QA 4LG0B 5LGUA 2P5KA 2PMHA 1TQIA 1MKMA 2FXAA 1R22A 1SD5A 2H6BA 3QU6A 2HR3A 4WK8F 1GXQA 1K78A 2VN2A 2HYGD 4FX4A 3MZHA 5JVTA 3L9FA 2ETHA 3RJPA 5IT9K 3IC7A 1C0WA 2HEOA 3WTUC 1KA8A 4U7BA 4N0BA 2E1CA 3KZZA 2Y75A 2FMLA 2UXNA 4G8XA 3TKYA 2JPCA 4UVCA 5J8FA 4MQ9F 4ON0A 3S2WA 3W6JB 1KYWA 2MLKA 1D5VA 1K79A 4ZYGA 1K6OA 4HOBA 5DEQA 1HBXG 4Q4ZF 1ZN2A 2YX4A 4L0YB 3LWFA 1WSUA 1CGPA 5HDKA 2IA1A 4YIFA 3CUQC 5E8IA 1FP1D 2DK8A 4GYIA 4ENKA 3R0AA 1V4RA 5ICCA 2XRNA 5AIPA 1F9NA 2Y0MA 1ZLKA 2O03A 2GAUA 2RN7A 1J0RA 2VC0A 4R79A 3KP5A 1JGSA 2BYVE 2VE9A 4MGRA 1HXDA 1KU3A 2Q2EA 1BI0A 3BJ6A 3F22A 1QZZA 1ZG5A 2IPQX 3L09A 3G3ZA 2QWWA 4EGYA 1FNNA 2EB7A 2MC3A 4U0WA 1SD4A 4ZZLA 3IL2A 4ESJA 1KU2A 1J5YA 4G94A 4ESFA 1Z7UA 3FX3A 3ZN0A 3GWZA 1YS6A 3ELKA 4HA8A 3TO7A 4UV9A 2FU4A 1BOAA 1LEBA 3J81Z 3B02A 3DEUA 3SXYA 1RUNA 3IRRA 1FX7A 1XCBA 1R00A 1SFUA 1KU9A 3KP6A 2K4JA
chains in the Genus database with same CATH superfamily
3EETA 2R5ZA 5JHUA 2DMOA 3GLLA 2KIUA 2E6ZA 5J26A 2YU9J 4B4CA 5KE2A 1G3TA 3BT9A 4Z88A 1WJAA 3EUHC 5IHKA 2ELHA 1FOXA 2IG0A 1VQ8Q 4RS8A 4IJAA 1YJNT 4C92G 2KJCA 2VXZA 4ITVA 3WG9A 5FLXK 2PVGB 1I07A 1ABOA 3OOPA 2GFUA 2EIMH 5FB2A 1N27A 3OYJA 1MGQA 3RKWA 2ZJ2A 3BROA 5DLOA 2R7XA 4UV8A 1WYXA 2AT1B 3I54A 3TL4X 1D1CA 1K0XA 4R56A 4RMOA 4LXCA 5HOOA 4I09A 4F7ZA 1FBUA 2CQXA 5JVGF 5A0LA 3KEQA 2Y4YA 3PTAA 3ISPA 2LCLA 2FRYA 4PUSA 5LHGA 3QYEA 2CQQA 2DT6A 2P7VB 3MD2A 2KIFA 5CVIA 3JCMd 4KIBA 1VQ5Q 3SWNC 4C0DB 4YEJA 2M0CA 5EZGA 1JRIA 1USSA 2Y69H 5HODA 1TC3C 1QWEA 1KD1U 2RF0A 2LY1A 3C2BA 3AG4H 3WGGA 4BE0A 4KA4A 1GT0C 3UA7A 1OU9A 2QQSA 1KG1A 3MKDA 1IG7A 2PQ8A 4M78A 4QQDA 2DBMA 1NEBA 5IHNA 3TREA 5GAN4 4ESRA 2LBFA 3CJNA 5K7HA 5GAOl 4QTRA 4MFEA 2QM3A 3WTYC 3OYIA 1VQKI 4XSXF 1JTXA 3KFVA 3S2HJ 5IN1A 1WXUA 2J05A 3HFOA 1Y0NA 4CICA 4RB3C 2FOWA 1ZKGA 2ZO4A 1LVAA 4I01A 3F21A 4EJOA 4PLIA 1BR2A 1VQ9Q 4UC4A 4HLXA 2R5MA 3PVQA 3C2GA 1D0YA 1KQ0A 2JJ7A 3K4KA 2EJRA 2UUZA 3OMYA 4UHTA 1WRJA 1S8NA 3J80K 3LSKA 3CMEI 2M4KA 3GBGA 2ZAEA 3ASOH 2B63J 4XTXA 4C92C 2BE5F 4PJOD 1EV7A 2VGMA 1LE8B 3VSKA 1IGUA 2KIMA 1E0EA 2L0AA 3KP7A 1QW1A 1IO6A 2WADA 4IPAA 4KGXB 2XAFA 1M1KR 1LFBA 2VKEA 3HP9A 2OC6A 2DAQA 3CD6Q 4R0KA 3EH1A 3JCMP 2EZHA 2LP5A 5IHIA 2EILH 1TWBA 2O61A 1XG1A 4AC0A 1XMXA 1XCVA 2IGMA 5J47A 2RJEA 3M56A 5LJ3e 1ZYRF 1UAAA 2E71A 4C5EA 3OL4A 1RI0A 4M78E 3EHQA 4P1WA 3CCRI 3M59A 3F8BA 1OX8A 1N8RU 5LGNA 4PKCC 2VKDA 3JCMX 3E97A 2E60A 3DP7A 3MEVA 1BW6A 4BXUA 1JE8A 2EYYA 3WTZA 3CQZJ 2JW4A 2VKNA 2CZ6B 3VRZA 1I39A 5B1BH 2HL3A 2EQUA 2Z99A 2KRFA 1SVOA 4A53A 3ABUA 4WCIA 4II2A 5BQTA 1PP7U 3ECOA 4WWCA 1WXBA 2PTKA 2P4WA 2RHZA 4RUGA 1W1FA 1PCXA 1NH3A 5FU7B 3CC7Q 3ECHA 3ZCOA 3OR2C 4NQWB 1XGNA 2VT3A 4Z2YA 2QCOA 4E70A 4YTLA 4DOVA 2L7FP 2DZ9A 2OAZA 1BM9A 3WXMB 3LYIA 2CP3A 3CCVI 3VPRA 2J5OA 3BJAA 2DMTA 3K69A 1TW2A 1T0FA 1BOBA 2CMPA 2V6CA 2TCTA 5TISC 3C4SA 3M4YA 3MP6A 5C3EJ 3N97A 4H4KC 2AO9A 4KULA 2EW3A 1YI2I 1RACB 4M7AB 5DV5A 2CH0A 2OTLQ 4PL6A 1EH7A 4XN0A 2K7AA 4BEHA 1GVJA 1VQ7T 1KD1C 3EFSA 3ME9A 2VXFA 5GAN2 1STZA 4FX0A 4U0YA 2PJPA 1Y71A 2VJJA 3REBB 2QA4Q 2HS5A 1B7TA 4FSXA 2E6NA 4DEXA 3MKYB 2HVRA 2CZ1B 3DBRB 4UVBA 3BC8A 3EG9B 4M75B 3VS3A 3JCMe 1YJWA 3JSCA 5GMKh 4HZFA 1GV5A 1IRGA 3OYGA 1FIPA 3FDYA 3E1SA 4C2UA 2MAMA 2X6YA 5D5WB 1OZ3A 2FBHA 3PUBA 2QKLB 4BHPA 1V5GA 3QU3A 2LNHB 2QSFX 2R7OA 2L01A 3KCCA 2PVOB 4BXXJ 1NG2A 5KYXA 4RGRA 1X19A 2JQ7A 2WAFA 3CCMT 1P4WA 2NAZA 1S1NA 4RAGA 3ABKH 4GLMA 1FIAA 4RG2A 1B07A 2COZA 2XAGA 4KICA 1WJRA 4OIRF 3JCMb 1XSXA 3GCMA 4XICA 1YJNI 4OIPF 2VV5A 4CXFA 3JRDA 3E9FA 4N9HA 2W82A 1K8AR 2XPWA 2JJ9A 3CBPA 2HDCA 3AL0C 4UVAA 2LDMA 4NUBA 1YJWT 3F6VA 2LKSA 4I02A 3A1YA 3CUOA 2XU8A 3PIOA 1JEGA 3CTAA 1QNTA 2QGUA 1MV3A 5K5RA 3GX4X 3M07A 2COWA 3SWNB 1KQSA 5ICGA 3TEEA 1BIAA 2BHZA 2BE7D 2DRKA 5GAN3 1X75C 1OJLA 1B1BA 4BJTA 3FLGA 3MP8A 3RPUD 4FE4A 2CGPA 2WAEA 5KNLA 2ADUA 4OMPA 1GHCA 3FM3A 1D3YA 1HW5A 1UJ8A 5GAOn 4Q5SF 1SANA 7AT1B 2DA1A 4J9CA 3VKIA 1TWFJ 4PJOC 1N8RC 2LY2A 1ZGAA 1JJ6C 1Z9ZA 1VQOT 2XKPA 4C8QD 4A4KA 1ZGWA 1T33A 2EQIA 1HSQA 5D5VB 1EA3A 3JCMQ 1UGVA 2ZFUA 2RQUA 3QBYA 2HVQA 3BQYA 4BHBA 2XSDC 3FJPA 1B6AA 2VQGA 2MWOA 1Y7XA 1GCQC 3LAJA 1YJ9Q 2HKOA 3IHUA 3H1CA 2IAIA 4YIRX 3TEDA 3R6NA 1FOYA 3WU1B 1O3SA 2C0OA 1USTA 5A2QK 4YG2F 2DD5A 3KP3A 3RKXA 5D6FA 1F43A 2X35A 4JOMA 4RGUA 3KP2A 2EJFA 3I4NJ 3AKZA 3Q9SA 4BDZA 4AIKA 5CVJA 3QWYA 4RTTA 4BJ6C 1Z77A 2FSWA 1Y1WJ 3T5XA 3TP3A 1ETVA 4D8KA 3EG0A 1WH5A 2M9HA 1YJ9A 1TZLA 2ACJA 2DN0A 3K1NA 1D8KA 4XONA 3NARA 3I3LA 2W24A 1ZSZC 2R5AA 5HS8A 1R36A 2A6TA 2OCCH 5KYUA 3HPGA 2UXXA 1LDJA 3OYKA 1AVZC 3JREA 4PJOF 3S3OA 2D0NA 1WCMJ 1DUXC 1VQMQ 1G5VA 2MH2A 3WODF 2QBYA 1O9SA 3M0PA 1NJIR 4QIWN 1ZX6A 3FXJA 1A6QA 2LG4A 3LSRA 2QXFA 1PVEA 3GF2A 3ZR8X 3A8HB 4QKUA 5F08A 3WTVC 3HPWA 3GW2A 2CREA 4OGEA 3BTCA 4EGZA 3CCUQ 1YJ9T 2H8HA 2ZMEC 1XTDA 5F1JA 1DU0A 4MDXA 5GMKe 1XGMA 1SVLA 4FQGA 1UECA 3WG7H 4CYDA 4BYYA 2EPDA 1TQMA 2XIGA 5CKHA 2LREA 3EGXA 1BKBA 3I35A 3MAJA 1VIEA 3NTHA 1TT5B 5KK1A 4ZDLA 4DEYA 2DJZA 4WXDA 3GF5A 4WX9A 4F7UF 2G7UA 4O5VA 1OR7C 1VI0A 4E7SA 4PJNA 3P8BB 2CP2A 1W0UA 2DQLA 4F93B 1H9TA 1XD7A 3FKIJ 3BOQA 1JXSA 2DEUA 5DCMB 1LDDA 3ABLH 1NK2P 2HCKA 2HOSA 4PFOA 3J7AO 3PVLA 2QAZA 3E5UA 2L02A 4C0DC 2ZB9A 4MEXF 2QK0A 3Q9VA 2QDYB 3VS7A 2GIVA 2VIXA 2OJ2A 1NK3P 2CGHA 1GDTA 3QDFA 4EV0A 2K9SA 1CF7B 4RLFA 3GTGJ 3BG5A 3MEWA 3TDZC 4C5HA 3HXLA 2NUTB 2RHYA 3QWXX 1FYLA 3TBIA 3GUDA 4JJNK 4A63B 3JW4A 2V9KA 3WTXC 3HYIA 3CLOA 1XC5A 2KYBA 1SFOJ 1U1TA 3ZOBA 4W97A 4A3KJ 3MEUA 1YW7A 4LD6A 4ELZC 1FBQA 1K4US 1Z91A 4BBSJ 2DTRA 3ZQHA 2DQRA 2HYFA 4JP0A 4KITB 2HPIA 4KIFA 4LK0F 3UR3C 3GFLA 1MNEA 1L0OC 3CCJA 1W7PA 3S1RJ 1X1CA 3ZMDA 4M9SA 5C44J 1M90R 1IGNA 4NB5A 4FW1A 4DNCA 1RAFB 1WIEA 1ZA1B 2GBYA 3CDHA 1ZRFA 4PFPA 2XMFA 1I50J 5FKLA 2G0EA 2OD5A 2YU3A 1K9MU 2D45A 2C0TA 1PD0A 2PMZN 6PAXA 3RTRA 3FMQA 4IQ4A 4M4ZA 1U1SA 2MUNA 2PUOB 1B8IA 4KT0E 2R3SA 4AFZC 2QQRA 1J3TA 3M0QA 4OGCA 2LLKA 3S14J 3OV8A 3OSVA 4E7IA 3HUGB 3AL0B 3S8PA 1TTYA 2W4SA 1P92A 3HSRA 1QHGA 1UHFA 2MIOA 1YRNB 1BCMA 2HQ5A 3HZJA 1W36D 2QG9B 2RO0A 2HQNA 2MD0A 1WHUA 3CCMI 5GAMg 1HW2A 4ESBA 2R7QA 3CCJT 2O8KA 2M1HA 2XV4S 3DWLE 1RETA 4Z89A 2ECBA 2HL5C 1H3HA 2O88A 2QYOA 1E6HA 2IS1A 1PM3A 1S29A 2M30A 1Q81U 4IUQA 4J7IA 3BR5A 2GTOA 2DL5A 2CJJA 2XDDA 1BR1A 2RI3A 4PJOB 1Y96B 2NVYJ 1YW8A 4N4OB 4M7DB 1S3JA 1B34A 2CH4W 1F4KA 3E19A 1R1UA 2NS8A 4I2OA 2A08A 4HXJA 4GGGA 2MW8A 3LSGA 2B86A 3ZL7C 2DBBA 3IAS2 3KP4A 4HKEA 2MYSA 3CCUA 5HS7A 3E6DA 2IGKA 1FY7A 1I3AA 2DXTA 2GQVA 5IYCJ 4CC4B 1KQ2A 1AT1B 3HKSA 1KYZA 2X0LA 1K73U 4RCBA 3G1OA 3EYIA 2L0KA 1VQOI 5J6XA 2AXTC 1FTTA 4X1EA 5K7ZA 1OV3A 4J6XA 3CCQQ 1S6LA 1HK9A 4LK1F 1SHGA 2LQWA 5HCKA 3JB9D 2RGVA 5EEGA 4MLOA 2EFPA 2PG4A 4MMKA 1VQLQ 2JS0A 2Z33A 4IRGA 2OTJT 5CQEA 2HKQB 2DXUA 4PJLA 4F7UB 3H35A 2H8RA 2VGNA 3EFOB 5KYYA 2HYJA 1G8XA 1V3FA 3CLQA 3OQ5A 2M02A 1XGSA 2DFIA 1EF4A 4FYYB 4CH7A 1QCFA 1WFXA 4N9IA 4BNCA 2IRFG 2DXBA 1FYKA 2PVDB 3H5RA 1SFKA 4XTZA 2DU9A 3HPHA 3ABMH 5HK0A 1VQNQ 1R58A 3LSTA 2BGCA 1VQPQ 4MHGA 1PD1A 3FK7A 3K1PA 2Y9ZA 3GP8A 1SSFA 2B7EA 1FMVA 4A3CJ 2B0LA 4YELA 2LVMA 3M7GA 2KHMA 2VBZA 4ASNA 4J9HA 3REAB 3CMAQ 4LMYA 1Z1DA 2I5UA 3BCAA 1WJSA 2OTJQ 4XU3A 3MKLA 1TOVA 1S72A 2FPEA 1BBZA 2M34A 3MEXA 4JZ4A 1VYVA 3TSZA 2KPMA 3VYTB 3UNGC 4EMKC 2K6DA 5L3GA 3E9GA 1K83J 4CYCA 1K9MC 4OOIA 4HQEA 2DPDA 2KNBB 5IXFA 5CVUA 1T98A 4A3IJ 5LD2C 1U3OA 5JFRA 1EH8A 2LSOA 1CKAA 1H8KA 5BPIA 2MGQA 3EUKL 4XRSA 1BB9A 2LVSA 3DTKA 5LRSA 4GO1A 2BY1A 3BP8A 3QOPA 3VEPA 4IRHA 1MW7A 2BOLA 2M0OA 2HZDA 2BY3A 2ZNYA 3FC3A 3BR2A 3BR6A 4M9ZA 2MMPA 2CDTA 4B09A 4I0AA 3SZPA 1TL8A 5I22A 5I2SA 3L2VA 3CMMA 4CCOA 2HWVA 1VQ8T 2PMUA 2C6YA 2DTHA 2BXZA 3FISA 4PZJA 4X9DA 4C0GA 2LH9A 1Q81C 5JHFA 3PMTA 4OAYA 2O3FA 2LDUA 2K02A 3FKJA 4MMLA 3RDIA 2RVCA 2L3SA 1Y56A 3P9IA 3WU0A 4DYRA 4J9FA 3Q0UA 3L1PA 3P9KA 4C5GA 4DOWA 3FHZA 1DGRM 2KR3A 2EBPA 3E6CC 4UNOA 3CCEQ 1TUGB 4KGVB 4F14A 1KC8R 3D5LA 1YX3A 4LLLA 3S15J 2MABA 1W36C 3ZQ7A 2E34A 5D5UB 1RLQC 3G6EI 2MF2A 3LNQA 2RV8A 3MN2A 4J9BA 4L5GA 2JN6A 1EH6A 4CO8A 1XS9A 4A0XA 2WTEA 3NFCA 1KIKA 1D3BA 1OZ2A 2KMTA 3M0SA 2X51A 2MVTA 3I55Q 5C4XJ 1VQ5T 1M9SA 3VB2A 3QODA 3BY6A 1IN6A 1WLPB 2LT1A 3C1DA 4HPQA 4MO7A 3K7AJ 4M6XA 5KH6A 4C8QB 1QLYA 5DUIA 4GRIA 4L6V5 3LQQA 2E3IA 2BY0A 5CJ9A 2KT8A 2LJ0A 3EH2A 3QZ5B 3I56Q 1VQ8A 3CC2A 2HMAA 2ZPFB 1U2WA 5GANg 3EUAA 3DLAA 1AWXA 3G71T 3KLOA 4F52A 3ZEHA 4CRIA 2XAUA 2JTEA 2L5QA 3GFMA 2L9RA 2DTIA 2BZTA 3E2UA 3HB9A 1U0JA 2BW3A 3QSUA 1JUSA 3TDUC 2K3BA 5GMKl 1M1KU 1R0CB 2E3HA 3PFIA 3CC2T 1IW7F 2DL4A 4XNFA 4DYCA 4VUBA 1UG0A 2NYXA 1XMKA 4M75E 3CCJI 3VDXA 3PE0A 4FYXB 1MMGA 2LTPA 3C2HA 5HS9A 5IYDJ 1TS9A 4JUVA 3AAFA 2WWYA 1OYXA 2CSQA 1MBHA 3A8GB 4BH9A 1D0XA 2ZC2A 1LDKB 3K4BA 1YOVB 2FYKA 1AWJA 1UFMA 1MNMC 4CC3A 2HXOA 3A03A 2WAQN 3LQRA 2DJQA 5H20A 3IV5A 5GAN7 4PJ0C 3GNFB 1NPPA 4GBQA 3EAEA 3T0YA 4M78D 3H3VK 3CD6T 5E1WA 4M7DD 3I5UA 1XMAA 1VTNC 2DYRH 3M0UA 2D8JA 2Y90A 4ZGDB 1OKRA 3CBMA 3NQOA 1UG1A 2DXCA 2MPXC 5JI6A 2E35A 1B9MA 2QF7A 3ZRGA 1RPWA 1YCYA 3L42A 4RGXA 1GXPA 1KZHA 4JQFA 4X0GA 1SMYF 3I59B 1HLVA 2JT4A 4RDUA 5GAEJ 1SAUA 3JB9F 2PJRA 3DEWA 4J19A 1Y8QB 4BU2A 1AU7A 3JTGA 3I71A 3DKMA 2KDOA 1QZEA 1VQKA 1YLFA 1HA8A 2K57A 2ZFWA 4OINF 5J4YA 1LNXA 1ZBJA 1K78B 3UA6A 3ZFJA 3CZ6A 2QTVA 3URGA 1U5TA 2LKPA 4LGWA 3UT1A 1MGTA 1QVFA 2GWRA 3RDVA 5M9OA 1X27A 3HOXJ 3A4CA 3SJMA 3IKVA 1Z9CA 4NC6A 3Q3SA 1T38A 3J81R 2F2VA 2RPNA 2X4XA 3PM1A 3CMEA 1RAGB 1WZOA 3FXUA 3BDLA 4M75D 1I6HJ 4KUMA 2KJBA 5LLQA 1NZ9A 2CH4A 2LF7A 2MWPA 2OI3A 1PRLC 3BWGA 2WY7Q 3QOEA 2DFHA 2K7LA 3HGGA 5GP9A 1ZHIA 4RBOA 2GOXB 2ATCB 2EJGA 3NEUA 2PMZA 3ZQLA 3GTOJ 1M2OA 3K0LA 2RB6A 4ZNXA 2EGEA 2RI2A 1Z3XA 3DKWA 3TW6A 1JKRC 2OTLT 1X58A 2FNPA 5M3FJ 5FFXA 4KMFA 5EGOB 2KISA 2HQHA 4J6WA 1T95A 1TWCJ 5LL6S 2R7WA 2QA4T 2VBXA 4JX5A 2AZSA 4AIDA 5L3FA 1YO5C 4NS5A 3CMET 1YIJQ 1FMKA 4BGDA 3CCRA 4HW0A 5FKOA 1DPUA 3I53A 1PUFA 3TOBA 2VUMJ 2KRSA 1V76A 2EJ9A 5DY9A 5EYRA 3BG7A 2R7DA 4C92F 1ITYA 3O8VA 4U0VA 2E7XA 3P9CA 2AQFA 2X6XA 3W6KB 4L9JA 2L2OA 4EEFG 1O7FA 3H8ZA 1W5TA 2OA4A 2COBA 1NLOC 1PSEA 2DL7A 2IEKA 2XI9A 4LUDA 2L89A 1M1KC 3PNWC 3GZNB 2KQWA 3PFYA 1NE8A 2FMYA 3QHSA 3GPLA 1OMIA 2JN0A 3JCMf 4M7AG 4C2MJ 2P6SA 4ENNA 1U8RA 2OCEA 3E5XA 3FXQA 2OZUA 2CS7A 2HQEA 3LX7A 1VQ8I 2YUPA 3MHXA 2BVLA 1Q7YU 3HOWJ 1X43A 1IAWA 4BI8B 3CO7C 1X1BA 3LOCA 4AUXA 3C18A 1YWPA 3OSGA 3HSEA 1R0BG 2RN8A 4J6YA 2IS4A 4KN7X 1ZRDA 1TNTA 2O6GE 4EQQA 3I5SA 1KFZA 5F1RA 2OX7A 4Y15A 3BR3A 1HKQA 1HYOA 1YI2A 1O4XA 4Q5WA 1VQ4A 2LCSA 2H09A 5H6RA 2XC7A 4NOYA 1K73R 2K3PA 1YTYA 4JLIA 1D1AA 3QJ6A 2WC2A 4ZTFA 1C6VX 4ZGEB 1SD6A 4HCZA 3VYHB 1PHTA 1VQ5I 2KZVA 8ATCB 2D9TA 1Z05A 2DJNA 4LDXA 2EZKA 2L4MA 3PJRA 4Y4RA 4FYVB 3M9AA 1MSFC 4Y33A 4BB7A 2CSOA 1QVGA 2K86A 3QAHA 4II1A 4L0ZB 1W4MA 3U2RA 1X2MA 4M78C 5FU7C 4LB5A 3DLLA 1SAXA 1PDNC 2QUFA 4GFBA 2L54A 3SD4A 2YSQA 1YI2T 4LLGF 1IREB 1VQ4T 2M5WA 1ZUUA 3G71I 2QQBA 5F27A 2Z0WA 2EV5A 3KETA 1F5TA 1QA6A 2NNYA 4HCCA 4IVNA 1P2FA 3LFKA 2EIKH 4D5FA 4AG1C 4BBRJ 1NJIU 4O3MA 3TVTA 3BQZA 4HV5A 3HTRA 1W2BS 3A01B 3RPQA 2VPRA 3MMYB 2L9VA 1A6IA 4XLHA 3DV8A 5EZHA 1MDMA 4JPBW 2Q2EB 4M7AC 3FM5A 2DVEA 1RQ6A 1ZQ1A 3CUQA 2DXIA 4X34A 5LJ3g 5CQYA 2LTOA 2RH2A 3QZ9B 3EG1A 1V5FA 2HAXA 3WE2A 4BUPA 5DD4A 5GPCA 1RAHB 3OYNA 4ENMA 2WB1A 4M75C 3IWFA 1ZTRA 5E8GA 3H92A 3CD6I 1G2HA 2F5EA 3V7SA 2BTTA 3EGDA 4HVUA 1WJCA 4XM3A 3S16J 3AG3H 2FVUA 4M78F 2CUZA 3PQKA 1OCPA 5CIUA 1MBEA 2P6TA 4EM0B 5ED4A 2LNVA 2MCNA 2JUCA 3H3UA 2ZXHA 3S93A 2HEQA 1K8AC 1OCCH 2FOKA 3DKYA 3DPTA 1FSHA 5CKFA 3OA6A 2RREA 3C94A 1XDUA 4M71A 1B72B 5L3CA 1QMCA 3LH0A 2WV0A 2FNAA 4W1UA 5DYMA 4Y52J 2ICWG 3PSFA 4HVWA 4OMMA 3ER0A 2DO3A 4FT2A 3UWNA 1Q7YC 4M7AF 4XORA 4Z8AA 2IJLA 3OB9A 3CMYA 3G7ZA 4G7HF 1A31A 1AZGB 1X3UA 4HLYA 4XBFA 3CC7I 1JTYA 2Y9YA 1X4PA 1IXSB 1WHKA 1Q1VA 3KPHA 4LDUA 4AYBN 4PDKA 4ZC3A 5J3LA 1LE8A 1R49A 3E3VA 1T0FC 4D1QA 3OYYA 3SFMA 4KH0B 3JCMV 2V6EA 3SZTA 3A1PA 1T8IA 2XG8D 4M75F 1WHJA 1LQ1A 1M90U 1OFCX 2K85A 3GTPJ 4X6AJ 1B3QA 2F2WA 3JCMh 3VS6A 5CR2A 1Y0UA 5FROA 3ZQQA 3OS1A 1BIBA 3A5ZB 1WJEA 3IH2A 1QPIA 1MIJA 2IGNA 2V9PA 4H0EA 2R7VA 1Y0MA 3QYHB 2OTLI 3G1LA 2DTZA 4FE7A 1ZG1A 2JMWA 2ENMA 4JS4A 2AQEA 4WXHA 2E5ZA 2R5ZB 5GANj 1JUMA 1M1FA 4CA0A 2OF7A 2EYZA 1OLTA 3R61A 2A07F 3PFSA 1OYWA 1FLIA 3S1MJ 1TT0A 2QA4I 4M77A 2XROA 1Q86R 1PKTA 1I5OB 3CCLQ 5BOXA 4ZH4F 2HSPA 2FL7A 1BN5A 3HRUA 4ZGJB 4AVZA 4CCKA 1I5ZA 1MHNA 1V54H 3BE3A 2OQRA 3CC4Q 2M2EA 3HKZA 3LFUA 1K7AA 2GXBA 1KQ9A 1M3BA 2V8JA 4IUVA 3DCFA 4IEJA 2DZCA 3MO8A 3DB3A 1I0CA 3CEYA 4XTVA 2IA0A 1UGPB 1NJIC 3CXCA 1RKTA 5H6QA 5HLGA 5LEKA 3O5ZA 5EG2A 5KCOA 3F8MA 2PN6A 5E3LA 5BNGA 4JK1X 3J7AW 1N6AA 2RM4A 1QKWA 2LP0A 1Y39A 2XUBA 3RKQA 1MBFA 2CP0A 2LQKA 5E79C 4L9NA 4RB2C 2HBWA 1GFDA 1WI9A 2VQHA 3HEFA 1X1PA 2XHCA 3VYGA 2PFBA 1W7PD 3T9NA 2DA3A 4G6TB 4D5CA 3ABTA 3DXJF 4XLAA 2DA5A 3DQVC 3T1BA 4DBRA 1R71A 2LYCA 3JTHA 5HDGA 3R6SA 4I6ZA 2CWEA 1WQ7A 2M9UA 4LD9K 5IH2A 3VYRB 2J06A 2IS6A 2IA2A 2XF7A 2ZCWA 2UWMA 2E1NA 1GFCA 2YRVA 1TNSA 4M77E 2K4YA 3D7SB 3K4LA 3KFWX 4M78B 5J4VA 1VQ7A 5E1ZB 2LBFB 2H3EB 5LRRA 2X3WD 1ZA2B 3EUHA 5EG0A 2CQKA 3HOZJ 3K4NA 1HCRA 2VASA 3OYBA 3M5AA 2XF5A 1ABQA 2F1LA 1OCOH 4QQ6A 1G4DA 3K6GA 4QVZA 3OW2S 1D5YA 1VNDA 1WZ2A 3FB9A 2K40A 1UHSA 4JJDA 3SB2A 1M8VA 3N05A 1R4NB 4PJOG 1YHQQ 1W2BP 2Z1DA 4Y7NJ 5IOYA 2KT0A 2P4TA 2HQRA 3EGUA 1VQ4I 3OIQA 3OY9A 5GAOp 1GLNA 4PJJA 5L3DA 4UB6C 1MSEC 3M4GA 3CCMA 3ROUA 2R7ZJ 2Y0SN 3IKTA 5IP6A 4TVRA 2KI7A 4KFCA 1M90C 4AWXB 1X6GA 3GTMJ 3FDRA 2XKOC 3KBGA 3SWNA 3UATA 1VQNT 5HNFA 3HOYJ 1VQ6Q 3OBYA 4DGWB 2I10A 2AHJB 4C3JJ 4RCCA 1YNZA 5IT9E 4B44A 5DDGA 3X20B 4JRQA 2VKHA 3CDLA 2M0YA 1R5GA 3I58A 1B4AA 2KYMA 4QWQA 4LG3A 2MC4A 1V55H 4F7UG 1Z3YA 5KCMA 1D09B 3L2ZA 3VS2A 4S0HB 5E3MA 3VS4A 3WGIA 2L9NA 3WVDB 3S2DJ 4BL0B 2FZCB 3BZCA 3CCUI 2L3QA 1I1GA 2K2VA 3FZVA 3UKGA 1ONVA 2DO7A 2VKVA 4CCLA 2RK1A 4OB2B 4AFUC 1VQOA 2DMPA 3ERED 2DA6A 4XLFA 3CO6C 5J1RA 5KYWA 1QQIA 3O3KA 4FT8A 3RSNA 1SMTA 1I1JA 4RTVA 5FWBA 3SHWA 1IZ6A 4ZN1A 4FL6A 1IRZA 2ED1A 2NUPB 3TU4K 1GVDA 4RB1A 3CP8A 4UUVA 1KQ8A 4A3DJ 2DK3A 4C92A 2DPUA 1H9GA 3X26B 1S9HA 2F2XA 1K8AU 1TSFA 5IT9R 3RI4A 1AOJA 2D1XA 3OMCA 4GDFA 2ZXJA 1AHDP 1KC8U 2FRHA 2K3FA 2RJFA 2ELJA 2DJIA 4XKCA 2ZJRF 2VJIA 4V2GA 3HTSB 1BK2A 3U1KA 4IUTA 4BD3A 1DPRA 3JAME 4LJZF 3TP0A 4M7DC 2BE9B 5J39A 4U87A 2DA9A 4A3JJ 2P0TA 4BEHB 2FPDA 2H6CA 3I9QA 4HX8A 5GPAA 3OYDA 4O6JA 1HF0A 4HAMA 2BVMA 3WGHA 3W6VA 2CW7A 3J81K 2GXAA 4RTYA 3FXMA 5D6XA 2M16A 3M0RA 2P5VA 4BY1J 1YW9A 5KHDA 1WHHA 2VQLA 5L3EA 2JWTA 1MUZA 3EG2A 3OMGA 2PEXA 3W2VA 1SD7A 3G4SQ 3BDDA 3I55T 4HCBA 5FKKA 2P5LC 2BHYA 2FBKA 3FIWA 3LA2A 1ACIA 1BCOA 1TBXA 5LHIA 2EAYA 2JTFA 1ZGJA 1ZQ3P 4EJTA 2KQRA 1BI2A 1MBJA 3DPUA 1V29B 2ZZDA 3H41A 5GAMf 5KYXB 1ZLJA 3CCVQ 1K76A 2RDPA 2HFHA 1JI8A 3JAMR 4OB3B 1RAAB 4C92E 5HLIA 3I56T 2MG4A 9ANTA 4HV6A 4JRPA 2A0FB 1MJ9A 2MLGA 4LLNA 2EYXA 4LB6B 2Y48A 1IB8A 3H3ZA 2E5QA 5DCMA 2YUNA 4M7DF 1P7IA 4KYWA 3VFZA 4A3GJ 1FT9A 3PNVA 3HOSA 3ZMZA 1UMQA 3BJOA 2QDLA 1X1AA 4RB0A 1J59A 1ETOA 4F91B 4B9WA 5I11A 1IXDA 3U9GA 2EYWA 2GTJA 2AS5F 2DFFA 3NPFA 4OF1A 1Q1HA 1GUUA 4MQVA 4OU0A 4FIBA 4D7NA 3JSPA 2BEOA 2KL4A 2NNNA 4G7OF 3Q1JA 3B6AA 4C8QG 1SC7A 1UDLA 4HDUA 2MI6A 2EH3A 4I7HA 5AT1B 5GAMj 4CC2A 3QYBA 3G6EA 2A3SA 3JRCA 2FEIA 1U6GA 5BMZA 3OS5A 3A02A 2DTOA 4LIVA 3L2CA 3GZ6A 4RTUA 2MD5A 2EA2A 3V4GA 2PBIA 3C7JA 2YLBA 1AKHA 2KLOA 4GYGA 4C3IJ 3J7AY 4KT6A 2GBQA 4HSRA 1QPMA 1EJ9A 3OW2P 3G73A 3JCUC 1M1EB 3HHGA 1XX5A 1CKBA 5CVRA 4MIMA 2DMQA 5IP7J 4PGGA 2EZIA 1WFWA 5LGTA 2M3AA 1KC8C 3E0JB 5IT9Z 1T6SA 1VQLI 4J9DA 2DF6A 2QI2A 3PMIA 4ZYAA 5K1YA 1NBEB 4J9GA 3F72A 4Y91A 1BU1A 1HDPA 1QZYA 4RAYA 1QVUA 3VU3C 1BBYA 2XSJC 2DA7A 1XPXA 3K70D 1LVKA 5FGMA 1I6XA 4CSWA 2JA6J 3F70A 4M77B 2HD0A 4P55A 2WSFE 2NVQJ 2KDZA 2DT7B 5LBQA 5DTDA 2K5CA 2QBYB 1TLHB 4PJOA 1Y96A 2LQNA 3A98A 1Z6RA 1A0NB 5FO5A 3ZQFA 3OS0A 2BIVA 2LT4A 5GAN8 1VQNI 2KFDA 4BAYA 2ESWA 3BLYA 1VQPI 2EKOA 4AM3A 2CUFA 4Y13A 1K61A 1GCQA 2WV1A 5DS9A 1JHFA 3F9KA 4C8QC 3CMAI 3WTTC 1ZUYA 3RQ4A 2Z9OA 1TUDA 3EGXB 4LNPA 3VUZA 3ZN1A 2X85A 4M3EA 4YFKF 2KIQA 2OTJI 1UE9A 5D6EA 1QCOA 2ID6A 3DPLC 2V1QA 3SDZA 3JAMZ 5E1XA 3DB4A 1YIJT 3HL8A 4C3HJ 1WVRA 1IJWC 2E70A 1AHJB 4HNTA 3I4MJ 3CCSQ 2H94A 4BACA 1B9NA 3IRQA 4GLKA 4F7UA 3BW1A 5GAMd 2D6FA 4RTZA 2YPRA 2HDDA 2CV0A 5GAOr 1BI1A 2ESHA 4A3BJ 5FLXE 2R7UA 3OYAA 1ZSZA 1RLPC 3D0SA 3V8JA 2X9HA 1QWFA 2OBPA 4EMGA 3HM5A 3GTJJ 2FHDA 2QEXQ 5HLTA 3HRTA 2MH9A 2YR2A 1IHVA 1LPQA 1TTHB 2L2PA 3KXTA 3GIBA 1U3EM 2JTMA 4N0AA 1REPC 1Y57A 5GAMh 3H0IA 4HF1A 4AD9A 1R8OB 2V26A 4EMSA 1POGA 3SQNA 2D5VA 2JM8A 4OWRB 4RLQA 2PLYA 1TH7A 2FBIA 1DJ7B 3CF5F 2LC2A 4V19K 3SEMA 2DVJA 2N8GA 2HKNA 2PUKB 3X2QH 4PCQA 4NHJA 3CDIA 3R4KA 2ZPBB 2F5FA 2GXGA 2KKOA 2ZMEA 1P9QC 2EQMA 3CBOA 3M57A 4LDWA 2J6OA 3ULRB 1N9SA 1WI7A 4JYKA 5IPAA 3REOA 2STWA 1XJWB 1W7PB 3D5SC 3SFZA 1CQTA 2C06A 2P84A 4XTUA 3S6WA 3I0TA 3TSWA 2ZXIA 5GANf 4NDLA 2E41A 5C0MA 1MMSA 5DM7F 4HCKA 3EYYA 3GO5A 2XAJA 3GZ5A 4S05A 1RNLA 1OR7A 4I76A 2YRDA 3M54A 1B59A 2YUSA 1EKEA 3I55I 1TXQA 2K4BA 2ESNA 2LMJA 3V7RA 1Q95G 1K4TA 3QKJA 1ZR4A 1NPRA 2VOPA 2JVVA 2GA2A 2JUGA 2Q1ZB 3DBHB 4FCYA 1VIFA 3THKA 1I27A 1LUJB 4N4HA 1ZAOA 4ORZA 1J2XA 2XHKA 2ECCA 3CJQB 3I56I 3EPZA 4HF0A 2DMUA 3H5AA 2JMCA 5E3OA 2HPMA 3J80E 3H36A 1NEGA 2E2IJ 2W1OA 4EM1A 1BC7C 1PG5B 2GGRA 2OAUA 3M8FA 1HJDA 3P8DA 4KDPA 3P8HA 5KCHA 1UHCA 5A0DA 9ATCB 1O57A 4CGZA 2CRGA 1B34B 1JXMA 5EEHA 3T8RA 3V42A 4XOTA 4IRIA 2WSCE 3ERMA 2B9SA 4N4IA 4LFUA 3WU2C 2VYTA 1N9RA 3QJYA 1LB2A 1T3SA 5FLVA 2JZYA 2RNGA 1KHIA 2EINH 3WTSC 2ABLA 2NLUA 2YUQA 4LG0A 4A4FA 5CLSA 3S3MA 2K27A 3BCBA 3K70C 3MFKA 5E17F 3PT9A 1ETKA 2AK5A 4C2TA 2F4OB 2IVMA 4FTHA 3JB9G 3IAM2 1LNWA 1ACMB 2CG4A 1A35A 1YQAA 2QKMB 4J00A 1XN7A 2JRTA 4BQQA 1RRJA 5DM7R 2CV1A 2CYYA 3COAC 4OMQA 4Z02A 1MJBA 4V2FA 2H27A 2R58A 1P4XA 2KVQG 4EPCA 4GCVA 1WPKA 3AFHA 1VQ5A 3TW7A 1R5HA 4E7HA 3GTKJ 2NRAC 3E6MA 1IRFA 4HNUA 1IF1A 5KYYB 4KUDK 2HSEB 3NWSA 2LZ6B 3HSFA 5ICEA 2TRTA 3FBNB 4FW2A 2G9WA 2EKHA 2VL8A 2K9NA 1YJWQ 4GXOA 4QPOA 4J83A 2O4XA 4M6VA 4IO9F 3OYCA 1KU7A 2A28A 3TOAA 4D0PA 2FUG2 2F5VA 2HKXA 4HG2A 1X01A 3LH5A 2VXDA 3QO3A 5ECAA 5GAMe 3G71A 2V79A 4BJ5C 2FQ3A 3RYRA 3WE3A 3D1NI 4JZ3A 3Q0WA 1JJ8C 3M4OJ 4RKUE 3U23A 1IN8A 1K73C 2ZXWH 2FG0A 2I2LA 4NBQA 2GLOA 1VQ9A 1UELB 1XTAA 3H9QA 2BKDN 5ILUA 3M9QA 5CO7A 3JRIA 4CDGA 2M1BA 4MFDA 2V1NA 3P7NA 1QP2A 1LJ9A 1IN5A 4CUGA 3L7WA 1EFNA 1VFCA 1N77A 5AONA 2ZBKA 1RR8C 4FETA 3U1DA 4OAZA 5FLXZ 1Y6IA 2JT1A 5JLXA 2VOOA 5KAIC 2W0ZA 1Q86U 4XMYA 1U9OA 1ZELA 1VQ7I 1FMWA 1YYVA 3ZMUA 3CPWA 3H9GA 3QPSA 4XKVA 3SEQA 2E64A 4C5IA 5GANd 3QYGB 4E2FB 3CD6A 2ZGWA 1P6RA 4QSHA 2OU2A 3CPFA 4JJBA 1VQ9T 4XAXB 2STTA 3LSIA 2A5YB 3VOEA 3JSOA 2DBKA 4ATOA 3I59A 3G71Q 1SEUA 2IIMA 3BTLA 5FJ8J 3A2KA 3QPLA 3Q0VA 1FJLA 1YIJI 1IXRC 3CCLT 5DD8A 1OISA 2JTVA 1OYIA 3F6OA 5DUKA 3OYFA 1PSFA 2V4JC 4MNUA 2AIRB 2R57A 1LOJA 5GANh 1JJ2S 2BZ8A 2X1DA 1IDYA 3ZMSA 3TO9A 3CC4T 5F64A 2RQTA 1GL5A 3GFIA 2E12A 4UY8I 1YITQ 1OYYA 2M87A 1YN8A 2E10A 1ORKA 2JXBA 1YS7A 1Z7LA 4IKFA 1V5EA 2KRCA 2CW0F 2DA4A 2RQQA 1H88C 3N5BB 4EMHA 1BC8C 3CC7A 2GOMA 3JCMc 2ZSHB 2WSEE 1DGWY 3KX2A 1YIOA 4Q48A 2JVGA 1H89C 3HBLA 4A93J 2M8GX 4AFQC 2HZTA 4YRVA 4J8OA 2X4YA 4EMKA 4EM2A 3MZYA 3VWBA 2CQ7A 2EFOA 2EZLA 2M8EA 5F6FA 1D3BB 2P0KA 3HTUA 3E5QA 4HBLA 1JT6A 2LC4A 2E4HA 3QDRB 4M77D 3HGYA 3ASKA 5LFAA 1MBGA 1JHHA 4A6DA 5EGOA 3FK6A 2R5YA 3OSFA 3J80Z 1PKSA 4RM3A 2FPFA 3WTWC 2ECZA 2F4IA 4XK4A 1WJQA 3KYCB 2K9LA 3GEZA 5F0HA 1BL0A 2DYSH 1HKTA 4BY7J 3K4MA 1WQ2A 5ICFA 1QU3A 3IQLA 1UUEA 2OTLA 1FSEA 2ELKA 2GZWA 5LHHA 3C95A 1ZREA 2HU9A 1Z6TA 5A0GA 1Q82R 3CC7T 3ML6A 1LPLA 2CU7A 3DFGA 2V9VA 4ETSA 4E7ZA 5A2QE 5LJ5g 4LIUA 4DW6A 2GQIA 2QA4A 3HOUJ 1N75A 1UZCA 2AZVA 2BW3B 5E3NA 3DLMA 2WBMA 2K5FA 2VT2A 1Y07A 3HFNA 1VOMA 1M2VB 1Y8RB 3C0CA 3VV0A 1Z21A 3HRMA 1R1TA 2DILA 4B3XA 3X28B 4HT9A 3QIIA 2ME0A 3BPXA 4ZZDA 3QP6A 2V1RA 4LUEA 4HX7A 3M55A 4MZPA 1YHQT 2RKHA 3JAMK 4V2SA 2A61A 1KSWA 3M53A 2ZCFB 4F55A 3PO3J 2IS2A 1RC9A 1RABB 3RNJA 5I21A 4JS5A 2LD5A 1ETQA 3SDGA 1QVFS 2DEQA 5KYNA 2P0WA 1IO2A 2CO5A 4RGSA 3IWZA 3SDBA 1C1AA 2RHUA 1ETWA 2YUOA 3B73A 5FRNA 4M78G 4DQ2A 1HKSA 1Q86C 2L3RA 1WJBA 5L8RE 3RKYA 5GTIC 1M3AA 1VQ6T 4IIMA 4HF2A 2KP6A 4RG8A 3RYPA 4ZDPA 4B3AA 1PWTA 1Z9QA 2COYA 1AWCA 2M45A 2J5PA 2CUBA 2DMNA 2MZ4A 2KXCA 1BA5A 1KK7A 1E6GA 2F2EA 2HZYA 4MTEA 2JA5J 4HRIA 3F23A 4XRMA 1HC8A 2E5KA 3RERA 1UG2A 2Y31A 4S04A 1ZG3A 5D4RA 1FBSA 3A8LB 1F36A 2A37A 2PJRB 3FMRA 3OYLA 2L3PA 4ABZA 3DLLF 5LJ3j 4EJVA 4BQAA 4J01A 1ZRCA 5F04A 5IY5H 2ZSIB 2EWNA 4KISA 2R0QC 3MWMA 1K1ZA 4B1RA 1U5TB 3DU5A 5GANe 4JBAA 1MZBA 2P81A 4IOCF 1K4SA 1RAEB 4UUSA 5BS6A 3CQTA 3BR1A 3LWIA 4AIJA 4KUIA 1U78A 1UHWA 5FD5A 3K10A 1JU5C 2Z16A 3LA7A 1QVPA 1OU8A 4Y17A 1I1SA 3NTKA 4M75G 2VC8A 4HDVA 1ZH5A 4G9YA 2JS2A 3VS5A 4F92B 1M5Q1 2O2OA 1UCRA 1DU6A 3DBLB 5D4SA 1X6BA 2M7AA 3FBIB 5FU6B 3KEOA 2XF6A 3A01A 3HOTA 5GAN5 1IUYA 3RZOJ 1IUFA 1YFHA 2CFXA 5GMKm 2I8DA 4LITA 2KMUA 1AEYA 4XKBA 2DOAA 3EQLF 4TV7A 2VWFA 5GJVB 2EVRA 4J7FA 1OI1A 2NXNB 1WI3A 2O0YA 2Y30A 3O8GA 2W48A 1WH7A 1WQWA 2VONA 4CZZA 2IW5A 2RQPA 4A2UA 2J7IA 4ZDOA 3FXRA 1X2QA 2GA1A 3K9TA 1W6XA 2VBWA 1ON1A 2R93J 1PUFB 1G3WA 1X2NA 3ZQIA 3JRFA 1VQMA 3NWTA 4XOPA 1NG7A 2KK4A 3G4ST 3LGFA 4N4NB 4C92D 3GFJA 1BJAA 1GRIA 5DLQE 1JJ2P 2GF7A 3CJTB 1VQ9I 5ILVA 1WGXA 2BBYA 1KONA 2FE3A 2JSPA 3MCZA 4L18B 2X4JA 4CHUA 2PQWA 2AKLA 3I64A 4I0BA 5J8CA 1UB9A 1MMNA 5HNHA 1I3QJ 1F1BB 2HOAA 2RJCA 3CCLI 1R23A 4NC7A 2X4HA 2EQJA 2KEAA 5GAOq 1QVGS 3QPTA 2VB6A 2LFBA 2A3LA 5C4JJ 2GCXA 1HW1A 2G7HA 2M4GA 3CC4I 4U7DA 3SZGA 3ZMTA 3EHRA 1VQMT 2D1VA 3M8EA 3H0HA 5LJ3d 4F3QA 2DT5A 1IHWA 3PL8A 2AKKA 4A0ZA 3LSJA 2R7FA 3N4MA 5A2QZ 2LJ1A 2VLAA 2Z3YA 1DP3A 2OQGA 4DBFA 3TQ7P 1PYVA 1X3WB 4XLNF 2MOXA 3RUXA 5B66C 2X4WA 3V8KA 1GCPA 5CVVA 5LEJA 3ZP5A 3RZDJ 3HOVJ 2EYQA 1OEBA 3RESA 2XAHA 3W2WA 3A0HC 1D8JA 1FOWA 3M1EA 4PSWA 1WNLA 4Y28E 3L2QA 1X69A 1AWWA 3HHHA 3H9JA 4M77F 1KGSA 2BV6A 2PZ1A 1IN4A 2A6HF 1S72Q 4UUTA 5GJWB 1MMAA 4HEA2 4IX7A 1R5ID 2LOOA 1OQYA 2WY8Q 2EQRA 2FD5A 4B8XA 4A69C 4J9IA 4BXFA 2IP2A 3FXKA 3HG9A 3NAUA 4A5NA 2H1KA 2Q0OA 2NOJB 2BXYA 2LY9A 4A3MJ 2LJ3A 4Y92A 4IURA 2A68F 4A4HA 5E20A 3FMSA 2JMAA 2ZNZA 2E2JJ 1HSJA 2L3DA 4MZMA 2PU9B 4R1HA 5B3SH 1QVFP 4JLGA 1QVTA 1MDMB 2FA5A 5GAHJ 2X1EA 2W25A 2RC4A 3PIPA 1YHQI 3H0DA 3CUQB 1T08B 3HIFA 2LMDA 2E2HJ 3JCMg 1FPQA 1LEAA 4FSSA 4IHVA 5ILSA 2KRMA 1FEXA 2YRCA 4WF2A 3R6OA 3L2WA 4IHWA 3CCSA 1OPCA 3LSHA 2QQ8A 4F04B 1ZARA 3EGDB 3JRHA 4CCNA 2XGXA 2RNAA 3D5RC 1O7LA 3W3CA 4BHCA 5GTHC 1VQ6I 2KDSA 5FFZA 2KY9A 2O9LA 5M3MJ 3VYSB 1H8AC 4ME7A 4A0YA 1ZHFA 4ZTJA 1JQQA 5CAIA 4KMUX 2J6FA 5CKTA 2D2WA 4NQWA 3ZPLA 2VPLA 2QEXA 3OSSC 2QGGA 3DTIA 5CCAA 2F5CA 5CKDA 1ZBXA 1X1DA 1NTCA 2ZJPF 2FZKB 3SFIA 4XQ3A 2OPTA 2WAQA 4M72A 5FW9A 2HTJA 4CCMA 3DU6A 4UXNA 4P5OA 1DDNA 4YFNF 5GMKj 2W57A 2ZKZA 3JRZA 3CCST 2QLZA 1OCTC 1ETYA 3BG6A 4CI0C 4RMNA 5H2FC 2XIDA 3CCQA 2XD0A 1RUWA 3JRAA 2KGTA 1P4AA 2IGOA 2H3JA 3CC2Q 4OMLA 2CS3A 4M7AA 2FZGB 1VQLA 3TO6A 4L9TA 2R4GA 5L23A 2COMA 3M58A 4BI3A 3OIOA 3S17J 4D8DA 4B6MA 2QEXT 4HYEA 1R7JA 2DRMA 2J6KA 3H0FA 1PJRA 1YBYA 4XL9A 4A12A 3OL3A 3TCJA 5EF6A 5CQGA 4XN3A 1W5SA 4K11A 1WJ5A 4QLCU 2F5TX 3CXCS 1OCRH 1JXOA 4X9CA 1MH3A 4BE2A 1WJDA 1WHLA 2P0PA 4M75A 3EG9A 2DYBA 2LCCA 4QQGA 3JB9I 3CCYA 3KLNA 3GTLJ 2VC1A 4M3GA 1W1WE 4WTOB 3CCQT 1VQNA 3OW2A 1VQPA 3SHFA 4XR6A 4XRFA 2KZGA 3L2UA 1VQLT 1K0SA 2FF4A 2CUDA 3O8HA 2FEZA 2EFQA 2DDAA 2NS0A 3OOUA 2A6EF 1YWOA 1T0JA 2FO0A 3EG3A 3I4PA 3TQNA 3DEEA 3CMAA 2DKGA 1PP8F 5B1AH 1H0MA 4OMOA 4M7DG 2OTJA 4L9VA 4A3EJ 2PX9A 3PIOF 3G4SI 2UV1A 2GQQA 4M6YA 3JR9A 1QCNA 2DYIA 1QHHD 2WACA 2O9SA 1QVGP 2LRDA 2NUPA 4M7AE 1O3QA 2DK5A 2NOGA 4M74A 5TGTA 1ULYA 3R60A 3WHBA 1HOMA 1RI7A 4RAZA 2K79A 4QT7A 2W10A 5TRDA 4QVDA 3GVAA 1VQPT 2K5IA 2LNBA 1GBQA 2QQAA 4IHXA 1RIOH 1QP3A 5KYUB 3BG3A 2CUJA 2SEMA 4HT8A 5FWCA 2ISZA 3G1MA 2DLLA 3LAPA 4F16A 1C0MA 3CMAT 2XDVA 1VQKQ 1FP2A 3J7ZI 1AD5A 1PRMC 2ZPGB 1WWXA 3S3NA 4KN4X 1HSTA 2E1OA 5JR3A 1VQMI 1FWZA 3HJEA 2VODA 5FKMA 1EZZB 4M3BA 2F48A 1HQCA 2JNGA 4XLPF 2VI6A 1PUEE 2M0MA 2YXYA 2FX0A 1JUPA 1UHMA 2EFNA 3O6BB 4FYWB 3CMEQ 1AZEA 2FQ4A 2O31A 3BZ6A 5F0FA 5HVQC 4B48A 3FRNA 2RHIA 3HSBA 3JRGA 4CZCA 3BDUA 1T39A 3OBWA 3CCEA 1I81A 5EG0B 3RBBB 1SKUB 1TWAJ 2EPFA 2EA4A 1H641 1OULA 4GY5A 4OIQF 1SPKA 4JRKA 1NM7A 2TDXA 3DKXA 2JSCA 4Z6YA 5GAOm 4XKWA 1AOYA 5HK3A 1XSDA 1F1ZA 1TWHJ 3V8LA 4CC7A 4MTDA 3PO2J 4RA2A 2A36A 3GNGA 3JB9J 2W84A 4XLEA 3BTIA 1UFFA 1XQHA 4JRIA 2KT1A 2F5DA 3V7CA 2R92J 1E7OA 2DD4A 3JCMJ 3OS2A 1FZPB 2CP6A 2XK0A 1LJOA 3OYEA 4KNYA 1QQJA 3CCRQ 3KYDB 5K7FA 5EJCA 2V8IA 2W00A 3EDPA 2DW4A 4DYQA 4E6RA 2PNIA 3F8NA 3CCET 4LOCA 2UZKA 2YS9A 3I56A 3KE2A 1VYUA 2VUBA 4L5EA 3UF4A 2EFIA 2VBYA 2ID3A 2F5KA 2EIFA 2E1MC 3DTEA 1KQSS 4II3A 2MBFA 1WKMA 4BUGA 2L7ZA 2K3XA 4ZYHA 2OAWA 2EFWA 1X4OA 2VJ4A 1UJYA 2KROA 1FTZA 4MDWA 5HY6A 2JA8J 1TW3A 3ONQA 1G6NA 3LSMA 2L4AA 5BPDA 3MCAB 1Z0XA 1FYMA 4ZJZA 1RADB 1AA7A 2ROTA 3PQJA 1N25A 2GIZA 3F8CA 1NYGA 1O75A 2ME6A 1VUBA 4A6EA 3A8MB 5IYBJ 5M5YJ 4BI4A 2E7WA 2V1XA 1YG2A 2HXIA 5FKNA 3VUBA 5LJ5f 2DDBA 1GBRA 4A54A 3RQIA 3ULQB 1T2KA 1FOKA 2K9GA 5TJJA 3T8TA 2G3RA 4P9FA 3LLRA 2RD1A 1LFUP 3RMQA 4C8QF 5KYWB 1YITA 1YI2Q 1J9IA 2EV6A 3H5NA 1VQ4Q 3LA3A 3TGNA 4FASD 1MD0A 1BYMA 2DL3A 3Q5FA 4J9EA 5FD6A 1SVMA 4C92B 1E2XA 3MPUB 4D9JA 3H9NA 2K9QA 1YFNA 2YLCA 5EC7A 3J7AF 4WCGA 1CF7A 4Q47A 3CCSI 4A4EA 5K5QA 1E3PA 2NUTA 2QQ9A 2XKOA 3FWEA 5CQXA 4BQOA 4AMCA 4DA4A 3NRVA 3CXCP 2V1UA 2DCEA 4L59A 1Q7YR 3BY7A 4IXAA 3K2AA 4EVIA 2X6WA 4K2EA 1VYTA 5HDNA 4DBQA 3GLXA 1YITT 4N0AC 3OYMA 1WA7A 3QP5A 4B47A 2PI0A 2LF8A 3DF8A 2LK2A 2QEXI 1WPYA 1N5ZA 5D8KB 4XRSG 3I55A 2P8TA 3IH4A 3VRYA 2NVTJ 2CZ0B 2Q8KA 3EFRA 1YX5A 2Z5UA 4PGHA 3IH3A 3LWHA 1YJNQ 2E19A 3A52A 2DM1A 3GTQJ 4ENJA 2Y2ZA 1X6OA 3FJ5A 1WX6A 3AG1H 1Q82U 1RL2A 1MJAA 4AVPA 4OIOF 4AYBA 4HSTA 1JKPC 2VE8A 3CCQI 1JBMA 3KUFA 4OMFB 3HUGA 2M7BA 4OVAA 2CW8A 1R9TJ 5CKEA 5D6YA 1YRNA 1ODDA 1XOVA 3KYLA 4A4GA 2HOEA 2FB7A 1S7AA 1BJZA 5FLMJ 4E7LA 4AIHA 1M1GA 1NYFA 1T0HA 2CYZB 2K3YA 4IL6C 2H8WA 4IF4A 2HTSA 3U21A 4LE9A 2OV7A 2FJ1A 2RNJA 5J40A 4E4HA 4FU6A 4R55A 2K9MA 1UGRB 1CSKA 4FHTA 3HDDA 1LFPA 1SF9A 2DETA 2BUDA 1IV6A 2O01E 4QPQA 1IC8A 2JA7J 1FYNA 1A36A 2A69F 1MV0B 1YIJA 4IHSA 4IHTA 1XGOA 4HQMA 3RR6A 3RIRA 4D6WA 1U5SA 1IV8A 4M7DA 2LQ8A 2E36A 2V1DA 2F6CA 1G3YA 2MA3A 4YFXF 4L5IA 3G1JA 4XK8E 2ISYA 3INZA 2AXLA 2ZJQF 3I9V2 2GNCA 1ON2A 2O8XA 1S7EA 1FC3A 2XB5A 3F3XA 2HDAA 3VJPA 4B9XA 1RI9A 4KT5C 2HBPA 1DP7P 4E7JA 2CSIA 3O2PE 1WXTA 4JDSA 2DI3A 2CV2A 2YHTA 3LL7A 3GYHX 1KD1R 1IXCA 1WHMA 2MFZA 2HI3A 2V7FA 1G59A 2G6FX 2VVKA 4OP0A 1JB0E 4KH1B 2KRHA 2CT4A 1UB4A 2W85A 1AKHB 1D1BA 2RA2A 3E6BA 1S7OA 4EJWA 3EFOA 3JV3A 2MSYA 4ANJA 5EEAA 2HGCA 2HQAA 5FRMA 3PNYA 3ESWB 5KVRA 3CJRB 1SRLA 4P9UA 5D8LB 4BS9A 5J1YA 3VODA 3ZBDA 3BFMA 2VJ5A 4OMZA 4PJOE 4BY6C 3ZMVA 4M7DE 2NVUB 4MZTA 5DCFA 3HRSA 1M4ZA 3S1QJ 1D0ZA 2QVOA 2E1MB 3R0JA 3GXOA 5KE3A 1SFXA 1QKXA 1KQSP 3F8FA 4G7ZF 3LW5E 2OJED 2X3XD 4M3FA 1SHFA 2JK3A 1YJWI 3CCEI 3MP1A 2XASA 2XPUA 2IT0A 1E17A 4DZJA 2A05A 2A5WA 3H0GJ 3TMOA 4C9YA 1BW5A 5FLXR 2P4RA 4HX4A 1YP5A 2ZPHB 5ERIA 3G6ET 1NLPC 3QRFF 4IUPA 4AT1B 2ROLA 2X1CA 2EGAA 5B5EC 1B8IB 1NHAA 4F7UE 1Q82C 4XSZF 1U9NA 2XICA 1N8RR 2C0IA 3G2BA 1PNJA 3KIOA 2Y0SA 2JVHA 2XGDA 1KJWA 3NTIA 3M8JA 3OWTA 2XDPA 3A8OB 2WA0A 3P5JA 2QSGX 3W2AA 4P5NA 3JCMW 1RESA 2E1HA 1J75A 4YIIA 2AHQA 4PNOA 3AG2H 3FF5A 1I4K1 1XSVA 5E18F 2X98A 3VS1A 1SFEA 5IAYA 2DAOA 1QBJA 5IXBA 2DFEA 4LN2A 1TQPA 1IGQA 1ZSZB 2YSRA 2L8DA 3WHCA 4WXCA 4KIGA 5HLHA 1K9AA 1SEMA 3QUIA 2R7TA 1FXXA 1W70A 1VQ7Q 2VXEA 4I98B 1N78A 1R1VA 4MEYF 2GFAA 5K5OA 3BPVA 4EDUA 4LD5A 2YX7A 2K5LA 2XDBA 2F69A 1UGSB 5IT3A 4OMYA 4A3LJ 3META 2X9DA 1OQKA 4NNJA 3VYUB 2BZYA 2DERA 3OIPA 1JGGA 4KGZB 2LRQA 3NMZC 4EJUA 1RZ4A 3L00A 4J5YA 3RPUA 4AG2C 1QGPA 3MQ0A 2DNUA 3FHNA 1PC0A 1J7KA 1TG0A 2DOEA 2ZMEB 4RAFA 2EBIA 1RUOA 4XU1A 1YITI 2NVXJ 5CK9A 1Z67A 1IN7A 1OOTA 3J80R 3OYHA 1L3LA 4C8QA 4G6DA 1O3RA 2DLPA 3CCMQ 3KEYA 1RR7A 2QZ8A 4IHYA 4G12A 2XAQA 1G3SA 4M73A 3WVEB 2LX9A 2D1HA 1RKWA 2CKKA 4X1VA 4UB8C 3PGGA 1XDSA 1TP4A 2XRLA 1M27C 1JKOC 1YJ9I 2P7CB 2E65A 3MEAA 4HVVA 3K1MA 4ZYEA 4E47A 2XGCA 2Z2SB 4QW2A 2L9SA 3BTJA 4RTXA 4XLCA 2O7OA 4M9XA 4KBMB 4LDVA 4JJCA 4P96A 1XB4A 4R8HA 3F0CA 2Y4XA 3C3WA 1GXIE 2SRCA 4IQJA 1U5TC 2EV0A 1SSHA 2OZ6A 2BY2A 2WB1N 5L3BA 1BI3A 2JPBA 2EK5A 3MZ8A 2P0QA 2GM4A 2DFUA 1MH4A 4A5MA 1S72T 3VS0A 4NC8A 3KZYA 5CYVA 5D5XB 1UJ0A 1ZK8A 1IZ1A 1E3HA 4IIOA 5AYFA 1XNIA 4RTWA 3RMSA 3JB9H 3JRBA 5IOZA 1VQOQ 4AFSC 1QO0D 2XVCA 4U88A 4XQFA 3L2RA 1U8BA 1SG5A 1OPKA 3K2ZA 1A04A 4ZYDA 3NHNA 3UPUA 3CCLA 4L5JA 2DX1A 5FU6C 1W5CC 2XPVA 3QPHA 1VA7A 2QENA 3QWLA 4CYCB 2RMOA 8AT1B 2JRMA 5AIQA 3CC4A 4C8QE 5LJ5j 2RQVA 2NUZA 2ZPEB 2L7KA 1O3TA 1BR4A 4G6QA 3CCUT 4LG0B 4PK4A 5LGUA 2P5KA 1H92A 2PMHA 1TQIA 2KXDA 2W7NA 1TUCA 1G83A 1OX9A 1MKMA 2FXAA 1ENHA 5JLWA 1R22A 1SD5A 2QYZA 1WDXA 2ED0A 2H6BA 3LGLA 3AHUA 3QU6A 2HR3A 3SYTA 1X3ZB 2M51A 3FIFA 4WK8F 3K4JA 1JJ2A 1GXQA 3UDCA 2KSSA 1K78A 4BY6B 2JM9A 1W0TA 2VN2A 1ETXA 1Y1VJ 3HC7A 2HYGD 5F0CA 4FX4A 3MKWB 1ZLMA 1LKXA 1MNDA 3MZHA 1G2BA 5JVTA 3AT1B 5CKBA 3H6ZA 3L9FA 1ARKA 3FEOA 3VSLA 2O4XB 3FXLA 3CPWS 2ETHA 2DODA 4BE1A 4XTYA 4ZN3A 4ELYC 4NL2A 2LX7A 3QG1A 2BZXA 5GADJ 3E7LA 1M2VA 1EX4A 2O9VA 2CFOA 4B43A 2X48A 3RJPA 5IT9K 1X2KA 2KE9A 3IC7A 1C0WA 1M30A 1I8FA 5GMKi 2HEOA 3WTUC 2HVSA 4XU2A 4OB1B 3HKZN 1KA8A 3ZQGA 4N0BA 5IP9J 4U7BA 1LCKA 2DL8A 4DBHA 2E1CA 3MJXA 3IP4B 3KZZA 1QRYA 1IDZA 2D0QB 4EATA 2Y75A 4F17A 2FMLA 1YHQA 2UXNA 1I5LA 4G8XA 5M5WJ 3TKYA 2JPCA 4DIQA 2JA2A 1ZSGA 4BKXA 3J81E 4FT4A 4UVCA 5J8FA 4MQ9F 4ON0A 4KJZA 1WJFA 3S2WA 3W6JB 3S1NJ 3LMMA 4OB0B 1KYWA 2MLKA 1D5VA 4PJMA 2B8AA 2RQRA 1K79A 2DOFA 4ZYGA 3HL2A 3CP2A 1K6OA 5D6WA 5LJ5d 1VQ6A 3GBQA 2FRWA 2HOTA 4HOBA 5DEQA 4DOZA 5LJ3f 3G6EQ 1KQ1A 3KZIC 3RCOA 1GV2A 3IUOA 3M1CA 4M3DA 4M7AD 1OCZH 2CT3A 6AT1B 4XIDA 2XGEA 2CP7A 1A5JA 1MMDA 1HBXG 3BR0A 2DE0X 2QSHX 4Q4ZF 1W4SA 4I99C 4IOAF 2IPOB 5LJ5h 2RQWA 1ZN2A 2YX4A 4L0YB 3CESA 3LWFA 3PNTA 1WSUA 2QTXA 3CF2A 3FXOA 1U06A 1R6RA 4RM2A 2RI5A 1VZ0A 4E7KA 1CGPA 1VF9A 2QGFB 5HDKA 3J7YJ 2IA1A 5A2QR 3BG9A 4YIFA 1APLC 3CUQC 1T3LA 2YT6A 3ZXSA 1HD3A 2RJDA 1H3ZA 1NG6A 5E8IA 2HDWA 3S32A 1FP1D 3OR1C 4EMKB 4NL3A 2DK8A 2X6OA 4GYIA 2M35A 2R7SA 1SRMA 2K2MA 1E3OC 4ENKA 4XTWA 1VQKT 1YCSB 2DIGA 3R0AA 1V4RA 3PSIA 4E6KG 5ICCA 4AU7A 2XRNA 1RAIB 4M77G 5EDNA 5AIPA 1F9NA 2DIQA 2Y0MA 3ZGKA 2R5YB 1UGQB 5C6SA 1JT0A 4KRTA 1MBKA 5J3BA 2NS7A 3NGPA 2DPPB 2QASA 2IXSA 1ZLKA 2O03A 4C0FA 3CCJQ 4JX6A 4C0ZA 4LDYA 2IBDA 2LKXA 2H1LA 1K9MR 3X24B 2XB0X 1OPLA 3SEZA 3LSPA 3ZQCA 2GAUA 2RN7A 2NYSA 1TWGJ 2D8HA 1J0RA 2VC0A 4BQNA 4EIKA 4R79A 2HQXA 3KP5A 1JGSA 2BYVE 2VE9A 4IUUA 4MGRA 2E5NA 2R7RA 3ASNH 5GAGJ 1HXDA 4PLLA 1WHGA 3M0TA 3G4SA 2I0NA 5I2MA 1KU3A 4FM4B 1S72I 2ZPIB 4OMNA 2NWMA 2Q2EA 1BI0A 3BJ6A 2V8KA 2JOYA 1DQUA 3F22A 1QZZA 1Q81R 1JKQC 2JZ2A 1ZG5A 2IPQX 2MK5A 4CCJA 2RAEA 3L09A 4Y3OA 2EIJH 3G3ZA 3BZKA 1M8MA 2A7YA 3CCRT 3M3YJ 3CCVA 4HNVA 2QWWA 4EGYA 1FNNA 4IZZA 3B6CA 1TU0B 1R4MB 1K6YA 2EB7A 2O5RA 1S5LC 2MC3A 4C30A 3HHTB 4PFZA 4U0WA 2KAFA 5M5XJ 4N4GA 2CQNA 3X25B 1EIFA 3PUFA 3QYFA 2DA2A 1SD4A 2KRNA 1ZUKA 5DM6F 3QXEB 4ZZLA 3IL2A 4ESJA 2F4MB 1P7JA 1KU2A 1J5YA 3GMEA 4G94A 4XU0A 3GOXA 5J1UA 2JUFA 1W2BA 1ZR2A 4ESFA 4M77C 1B72A 1Z7UA 3CCVT 3FX3A 3K4CA 3GWZA 3ZN0A 1YS6A 5GAN6 2OUMA 3ELKA 4DJAA 4DZPA 5D7UA 4HA8A 3TO7A 4QVCA 3CPWP 1KHCA 1R77A 1IRXA 3C12A 5HKCA 4UV9A 2YWWA 2FU4A 2KBTA 1BOAA 4UUSB 2RHXA 1YE9A 1LEBA 5LJ5e 2L7MP 4A3FJ 1HDDC 1AWOA 3J81Z 2HNHA 3L1AA 4BDYA 4PSXA 1UEBA 5CPRB 2CUEA 3B02A 3DEUA 3A0BC 3SXYA 1V1CA 2CP5A 1J09A 1T56A 2IVWA 4D7MA 1RUNA 1M3CA 2RK2A 3I5RA 3QQAA 3MVPA 2YDLA 1YJNA 3IRRA 3PIPF 2CZ7B 1WGSA 5LJ3h 1FX7A 1JO8A 1XCBA 2VQCA 1R00A 1SFUA 5KAFC 2EGCA 1ERDA 2HNIA 2EQKA 4JX4A 1KU9A 4FISA 3MKZA 3CC2I 1UTIA 3KP6A 2LR8A 2K4JA
chains in the Genus database with same CATH topology
3EETA 5JHUA 2E6ZA 2KIUA 5J26A 5KE2A 1G3TA 2ELHA 2IG0A 4RS8A 4IJAA 1YJNT 4C92G 2KJCA 2VXZA 2PVGB 3WG9A 5FLXK 3OOPA 2GFUA 5FB2A 1N27A 3OYJA 1MGQA 3RKWA 2ZJ2A 3BROA 5DLOA 4UV8A 3I54A 4R56A 4RMOA 5HOOA 4I09A 4F7ZA 1FBUA 5A0LA 3KEQA 2Y4YA 3PTAA 3ISPA 2LCLA 5LHGA 2P7VB 2KIFA 5CVIA 3JCM