1DPRA

Structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structures of the apo- and the metal ion-activated forms of the diphtheria tox repressor from Corynebacterium diphtheriae.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dprA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1dprA02
2ZCWA 4IHSA 3WTTC 2PN6A 1D3YA 1BIAA 1YW9A 1Z6RA 2VBXA 4ETSA 2HR3A 1YO5C 1JXSA 4FT8A 3E6DA 2DPDA 1LJ9A 3MAJA 2GZWA 4FHTA 1IXSB 3WTUC 2L3DA 1IN6A 4GCVA 1V4RA 4KICA 2VC1A 1R5HA 2H27A 2LNBA 4BQAA 4U7BA 1R22A 3SXYA 2O8XA 3M8EA 2IJLA 1HSJA 5JI6A 2VBZA 5ILVA 3CTAA 2M30A 3IKVA 2OQGA 1U6GA 3CO7C 4D0PA 2ZBKA 1B59A 2YSRA 3J7AO 5E20A 4KA4A 4A6EA 2OZUA 4IRIA 1UB9A 3E6MA 1YTYA 2WC2A 2HTSA 3M7GA 4H0EA 1H9TA 3JSPA 1Z9CA 2RNJA 1OMIA 1F4KA 4BXUA 2MLKA 4L5JA 4ZYDA 4Q47A 3SHFA 3U1DA 5BS6A 2A3SA 1SFEA 4AIHA 3GLXA 4Y13A 2F5FA 2MH2A 4YFKF 3ZMUA 2H6BA 1R1TA 5KK1A 2IP2A 3CO6C 3FXQA 4I0BA 5CVJA 3JTHA 2COMA 2CW0F 2A6EF 1GXQA 2QLZA 1Z05A 2PBIA 2A6HF 3P9IA 1QNTA 5K5QA 2F5CA 4RGSA 2DBBA 2VT2A 3GZ6A 4ZYHA 4Z2YA 1QQIA 2Z5UA 3HOSA 3IRRA 5HS9A 4UNOA 4LG0A 2DQLA 5AONA 1BC7C 5LBQA 3WTXC 2AS5F 2GWRA 1MD0A 1F5TA 1ULYA 1I1SA 3BPXA 1WI9A 2YR2A 2K27A 5FFZA 4YFXF 1JHHA 1LDDA 2GA2A 4LB6B 3RPQA 3E5XA 4A6DA 4XLPF 4KFCA 2RGVA 4ENJA 2DLLA 4I2OA 2X4HA 3NQOA 5JFRA 3R0JA 2P6SA 3OV8A 3ZMTA 5FO5A 1VTNC 2FNPA 2WTEA 3HTSB 3KP7A 2KJBA 1SAXA 3ROUA 4HX8A 4RAYA 5BPDA 5FLXZ 3IWFA 5AIPA 4HAMA 2PMHA 1QO0D 2DI3A 1P4WA 2E7WA 1AWCA 1U5TA 4G9YA 3EQLF 2HWVA 2R7FA 3FMRA 2XKPA 2PG4A 2HS5A 4HLXA 2P5VA 1DPUA 4BYYA 3KZZA 1XDSA 5DD8A 1FBSA 3BDDA 2CGPA 1K6OA 2PJPA 2L4MA 3DPLC 4PZJA 2K86A 1XGMA 4HA8A 1OYWA 1BC8C 3BWGA 4EM0B 2XHKA 2QENA 2MBFA 4A0ZA 3VB2A 3GW2A 1YYVA 3J80K 3GZ5A 2XAJA 1K7AA 3ECHA 4OMZA 4IF4A 3MCZA 3F6OA 4GXOA 1J5YA 1DDNA 1ZRCA 5DUIA 3CUQC 4L9NA 2UWMA 4RB2C 2RQPA 3V8LA 3GEZA 2EK5A 4HBLA 4XRFA 2NAZA 3V7RA 2RC4A 2ZXJA 3IHUA 4BNCA 4IHTA 2W24A 4AIKA 4HF0A 4LGWA 1IW7F 1YQAA 1QGPA 5E8IA 1JE8A 3V7SA 4DQ2A 3L00A 1O3QA 3IWZA 3WG9A 4WK8F 1BI0A 4R79A 4U88A 4ENKA 3N97A 4MEXF 4RB3C 2NS0A 5JHUA 5CVIA 3ZMVA 1KU7A 3GUDA 1B4AA 4LMYA 4G7OF 1LVAA 3FXRA 1F9NA 4A12A 2MD5A 4KMUX 1IN8A 3F3XA 1KU3A 3M9AA 2ZMEB 5ILSA 4I98B 4MTDA 1IRFA 1ZRFA 4B09A 5J8CA 1FYMA 4LLLA 1R1UA 5HDNA 1HKQA 2UXXA 3F8FA 2MC3A 5F6FA 2ZKZA 3I71A 4G6QA 3BJ6A 5D5UB 2P4WA 2G7UA 1P4XA 3I59A 2ISYA 3BJOA 3COAC 5LHGA 2H09A 5E17F 2M1BA 3FMSA 4EVIA 3CJNA 3QPTA 3G3ZA 5DYMA 3VOEA 2LF7A 4BH9A 4YIIA 4YFNF 4BHCA 4U0VA 3M1EA 2JSCA 5HLIA 1O3SA 1HW1A 4G6DA 4R1HA 4CO8A 5ICCA 1HBXG 3DQVC 3BY6A 1ZYRF 3ELKA 1W7PB 4MHGA 2HYGD 4QLCU 4EMSA 1L3LA 3T5XA 3RKWA 2D45A 4L9TA 2VOOA 2XGXA 1USSA 2V1UA 4AIJA 1TQIA 4AD9A 1SD6A 5HDGA 5ILUA 4UHTA 5CLSA 2O6GE 2XAQA 3HYIA 4KIBA 3WU1B 4P9UA 1EH8A 5JVTA 3ZN1A 1T39A 5LGTA 4M9XA 2QM3A 4HX4A 5H6QA 1D8JA 1RNLA 2K4JA 4ESFA 5HOOA 1MDMA 4HV5A 1G4DA 1GVJA 4OIPF 4R8HA 5CYVA 2XASA 4G7ZF 1QZZA 2F2EA 2OQRA 2OU2A 2VE8A 2GIVA 3K1NA 4EJUA 3WTZA 1XMKA 1K79A 2NRAC 1R5GA 4HF1A 1U8RA 4UXNA 3CUQA 2KKOA 3LAJA 1T38A 3KLNA 5TJJA 1GHCA 1EV7A 2ZJ2A 1ON2A 3ULQB 3E97A 3RYPA 3QU6A 2XAHA 1HW5A 3ZPLA 3IL2A 3FZVA 3PFIA 2DFIA 3ISPA 3KETA 3O2PE 4S05A 4P55A 4O6JA 2OBPA 5LHHA 1ZG3A 4HOBA 2EA4A 3WTVC 4BHBA 1KQ0A 1OPCA 2FXAA 4EM1A 3REOA 2EFOA 3FM3A 3TDZC 4MQVA 4RB0A 3RI4A 1BI3A 5BQTA 3VFZA 2BYVE 3HRTA 3SZPA 2KJCA 1WQ2A 2E7XA 2VBWA 2O3FA 4BHPA 2PI0A 5D4RA 1S8NA 4P5OA 5CJ9A 4BAYA 3LSTA 1FBUA 4LD5A 5K5RA 1TTYA 2LSOA 4UUVA 2RVCA 3V7CA 4AWXB 3NEUA 1U78A 4HYEA 4GGGA 1XSXA 1YLFA 1OKRA 4LLNA 4DNCA 3C7JA 1RI7A 4CGZA 5CVRA 3JW4A 5LRRA 4EV0A 3JAMZ 2Q2EA 2HZTA 1FC3A 4U0WA 4L0YB 2F5DA 4PGGA 1RUOA 3B02A 4A2UA 3ZP5A 3GVAA 1YFHA 2FU4A 1EH6A 2GA1A 3T0YA 4L5IA 4LG0B 2EFQA 5FGMA 1O3TA 2Y0MA 1MJBA 2Y75A 5HDKA 2QBYA 1Y0UA 2DW4A 1STZA 1RUNA 5HLGA 3TOAA 3ABUA 3C3WA 5JR3A 2K7LA 5ICFA 2BV6A 4U0YA 2D1HA 4A0YA 5D4SA 3QRFF 4P96A 2ETHA 2QUFA 2WWYA 1J7KA 3FM5A 2KIMA 2GXBA 4N0BA 5FLXK 3GO5A 4EGYA 3RKYA 2OD5A 4FX0A 1GXPA 1MJ9A 2V1DA 3KZYA 4TV7A 3KP5A 4HV6A 4M74A 2RV8A 3KE2A 3KP4A 3TGNA 3RKXA 4ZH4F 5LHIA 4LJZF 4ZYEA 1Z6TA 3E3VA 3HRUA 2CSOA 1S3JA 5F1RA 2Z99A 2ISZA 4HDUA 1I6XA 1ZREA 1KA8A 2EA2A 2J5PA 3TKYA 5DCMA 5IT3A 3LAPA 5LGNA 4OIRF 1YIOA 3BPVA 2Q8KA 3F21A 2DTRA 2ZNZA 3OOPA 5DUKA 2C6YA 2MA3A 1LDJA 2P5LC 4XSZF 3I53A 2W84A 3ML6A 3G73A 2A07F 3HHHA 2EJRA 2LKPA 3TQNA 2FA5A 2P8TA 5HVQC 5FD5A 1B6AA 3HTUA 5ED4A 1XMAA 1HW2A 4M6YA 1WKMA 3F8CA 3EYIA 1J0RA 4XSXF 4Q4ZF 3RJPA 4MGRA 3EDPA 1ZLKA 2HGCA 4HW0A 4GYGA 1P92A 1Z7UA 1FY7A 1G6NA 5D5VB 3HSEA 3WTWC 4N9HA 1KU2A 3SQNA 4OIQF 1FWZA 1BOAA 2V79A 2W25A 3U2RA 5L3BA 1BM9A 2M87A 1SD4A 3MZHA 5J6XA 4OIOF 1R23A 1O7LA 5BMZA 1P6RA 2FBHA 3WE3A 1T98A 3KEQA 1G3TA 1SFXA 2O03A 2XIGA 1DP7P 1BI1A 3NRVA 4Y15A 1IRGA 1R7JA 2HYFA 1UFMA 2DO7A 2L01A 3I59B 4MEYF 3K69A 1UHWA 3R6SA 2FRHA 2DU9A 2VE9A 4WWCA 1R1VA 2EV0A 3FX3A 4KN4X 3BROA 2AXLA 3BOQA 3I58A 3R0AA 1E2XA 3HSFA 2HFHA 2VOPA 2IRFG 2P7CB 1FSHA 1MKMA 4KUMA 4IPAA 3WE2A 3DEUA 2EWNA 3J81Z 2VONA 2CYYA 4ZZDA 4B8XA 5D5XB 1FYKA 5BPIA 1LEBA 5HS7A 4KT5C 1JGSA 4HZFA 4EJWA 1AOYA 2O61A 1FP1D 2M45A 3WODF 3QU3A 2Q0OA 1TQPA 2V9VA 3K0LA 2BGCA 1REPC 3N4MA 4WXCA 2CWEA 3I5UA 1XD7A 1SMTA 1XB4A 4IXAA 3TO6A 2P5KA 4ENMA 2KIUA 1UHMA 2RDPA 1IXCA 1S29A 1XCBA 5D6FA 5CVVA 1TW2A 3ZMSA 2QVOA 3EETA 2EV6A 2V6CA 2M8EA 4Y17A 1PUEE 5E1ZB 2HQRA 1BBYA 4RAZA 4JQFA 4PCQA 5FFXA 2L54A 5HS8A 1MDMB 2LF8A 1HXDA 4KN7X 1CF7A 2H94A 2WV0A 1O3RA 4ESJA 3M8FA 2VC0A 3GWZA 1FBQA 1I1GA 2GQQA 3E5QA 1LDKB 3T1BA 5BOXA 4M72A 4CICA 3F22A 4RB1A 5L3DA 1ZGJA 2P7VB 3CUOA 3QP6A 4LK0F 4G8XA 2KRFA 1G3YA 2NNNA 2DT5A 3SZTA 5KVRA 4I02A 1K78A 2H6CA 3IKTA 2ZMEA 4HDVA 3ZN0A 3PQJA 1PP7U 4G94A 2FOKA 4K2EA 2XKOA 2STTA 2FE3A 3EUHA 3W6JB 1C0WA 2XROA 3SFZA 1KYWA 1WWXA 3KP6A 4MQ9F 4O5VA 2BEOA 1PP8F 1WSUA 3CDHA 3MFKA 4XLNF 3U9GA 5E1WA 2R7DA 1IZ1A 3P7NA 3F8MA 4EGZA 4M71A 2D1VA 3O3KA 3V8KA 1SFUA 3LA3A 3ERED 3F8NA 3IRQA 1ZN2A 5E8GA 4L0ZB 1JHFA 3QAHA 4LFUA 1J9IA 1OR7A 1KQ8A 4KDPA 4PDKA 3L09A 2O0YA 3WGGA 2ADUA 1HKTA 2BBYA 1W7PA 2PLYA 5D6EA 2BE5F 4M9SA 3JAMK 2FNAA 2HQNA 2XUBA 4G7HF 2CO5A 3L2CA 5DV5A 1RIOH 4HF2A 3GFIA 2QQBA 1FT9A 1ONVA 3E6BA 3WGHA 4NQWA 2QQ9A 3FF5A 5LLQA 1OYIA 2XRNA 1L0OC 4EJVA 1T0FA 1EH7A 1BJAA 1SD5A 1IAWA 3C18A 1XSVA 1Z91A 2Z33A 5K1YA 4UV9A 2QBYB 4Q48A 1XSDA 3KLOA 2A69F 2FBKA 3ZMZA 1W5TA 2PMUA 1Z1DA 3TOBA 3E6CC 1S7OA 3RYRA 1FOKA 4ESBA 5FB2A 1LQ1A 2JTVA 3MQ0A 4JK1X 5L3FA 2MLGA 1BI2A 4O3MA 4MNUA 2HKOA 5AIQA 1YW8A 4IRGA 1LB2A 2A68F 2XAFA 2HTJA 3WGIA 3GXOA 4HX7A 3EYYA 1HKSA 1FP2A 4ON0A 3ZQ7A 1YS7A 2NYXA 3PQKA 4E70A 2G9WA 1TNTA 4IJAA 1ODDA 2R3SA 1DPRA 4OINF 5ICGA 4L18B 4YIFA 1IN4A 2HEOA 1E17A 2FBIA 4ZYGA 3D5LA 1J59A 2OA4A 1LEAA 4I0AA 2W85A 1TLHB 5DCMB 4UV8A 4A0XA 1I27A 1G3WA 1R36A 2IW5A 3DFGA 2DPUA 2JZYA 2E1CA 2HOEA 3LA7A 4S04A 3ABTA 2OAZA 1P4AA 3HRSA 1TQMA 2HKXA 4KIGA 2VODA 3R61A 4CHUA 3RIRA 2M5WA 5F64A 1TW3A 1KYZA 4U7DA 4HLYA 2RKHA 3R60A 3K1PA 1USTA 5DEQA 1XGNA 3HSRA 3KCCA 2FSWA 2JPCA 3WTYC 3P9CA 3HIFA 1U5TB 4I01A 2Y48A 4Q5SF 3B73A 5D8KB 1D5VA 1TBXA 1SD7A 3AAFA 4CXFA 3V8JA 2A5YB 1YW7A 2GAUA 4RGXA 4M9ZA 3KFWX 3DPTA 2ESNA 4L9JA 2FQ3A 1BIBA 3KP2A 2QQAA 2LDUA 4GYIA 3MEXA 1B9NA 1FZPB 1KU9A 3T8TA 4RGUA 5D8LB 1CGPA 2QYOA 3RPUA 5ICEA 3JSOA 2ESHA 3GYHX 3I54A 2K02A 3FWEA 2CG4A 2FEZA 1IN5A 3LWFA 4F7ZA 3GF2A 1ZHFA 4M73A 1P2FA 2W57A 3S2WA 3TDUC 1ZAOA 3TO7A 4XBFA 2VN2A 5D5WB 3GFJA 3MZYA 2B0LA 4EM2A 3HHGA 3FHZA 2VBYA 2F5EA 1MJAA 5A2QK 4WX9A 3F72A 5L3EA 4JBAA 4EQQA 1I5ZA 3J81K 2UXNA 1YS6A 3P9KA 1BN5A 3GFLA 2TDXA 1PDNC 3LQRA 3KP3A 2L02A 4OU0A 3HOTA 4EJTA 4L9VA 1B1BA 4UVCA 1ZGAA 4CYDA 5TRDA 1YG2A 3F6VA 1QPMA 1O7FA 1TNSA 1S7AA 1MGTA 6PAXA 2IA0A 1H9GA 1QZYA 5L3GA 1D8KA 3BJAA 3RDIA 1F1ZA 2OZ6A 3LA2A 4RS8A 4I09A 1FLIA 5EEGA 2EFNA 1MZBA 2CQKA 1U2WA 3H3UA 5H20A 2D2WA 3K2ZA 1J75A 2XAGA 5LRSA 1B9MA 5A2QZ 4A5NA 3C1DA 2EV5A 2EB7A 2PEXA 4KYWA 1IUYA 2MH9A 2YX4A 4EJOA 2V1XA 4NHJA 3VEPA 4A5MA 1CF7B 1NHAA 3Q5FA 3I64A 3RTRA 4IVNA 2UZKA 1ZH5A 1XN7A 4GO1A 1O57A 1R58A 4P9FA 2IPQX 3V4GA 2GXGA 5DD4A 2DAOA 1QBJA 2JRTA 2IA1A 1OYYA 3KEOA 5LEKA 4MTEA 3O6BB 2ACJA 1KGSA 4ENNA 3FMQA 3LFKA 4YG2F 1T2KA 1K78B 1HQCA 2FMLA 3QP5A 1FYLA 5DDGA 3W6KB 4OOIA 2EFWA 3K1MA 5EEHA 4RGRA 1ZARA 3J80Z 4FX4A 4LB5A 1XDUA 2X0LA 4M6XA 2RN7A 2E1NA 1ON1A 4N9IA 3IC7A 2CFXA 2K4BA 2ZO4A 2IT0A 2YPRA 1HSTA 4AVPA 3D0SA 3R4KA 2JPBA 3H3ZA 2ELHA 5E18F 3FXUA 3DF8A 2J5OA 2ZNYA 2DK5A 3MWMA 2STWA 1IN7A 4KMFA 4WF2A 1XCVA 5L3CA 2QWWA 3QOPA 2ZFWA 1FX7A 1H0MA 1FSEA 3ECOA 2PQ8A 3CUQB 1R00A 2YX7A 2A61A 4CZZA 3L7WA 3E5UA 3WU0A 3DV8A 2YU3A 1FNNA 1J2XA 2VT3A 2NNYA 5CVUA 2FMYA 2DK8A 4ZZLA 3DKWA 5LEJA 1LNWA 2QZ8A 5IT9K 2Z3YA 3F8BA 5K5OA 3T8RA 1T6SA 5LGUA 2G7HA 4LK1F 1IF1A 3JTGA 3GFMA 2FF4A 3VODA 1FPQA 4ASNA 3ZMDA 2P6TA 4IRHA 3LQQA 3HRMA 3Q9VA 4WCGA 1S6LA 1WRJA 4HQMA 4WXDA 2XVCA 1A04A 1ZG1A 4OMYA 1ZRDA 3I4PA 3BZ6A 4CDGA 1IXRC 4UVBA 5HLHA 3GX4X 5DCFA 2EFPA 4UVAA 1W4MA 2IA2A 3QPHA 4NB5A 4PGHA 2HDCA 3K9TA 1U3EM 3L9FA 3DP7A 5E1XA 1DUXC 2IVMA 3HUGA 1KQ9A 1ZLJA 4QWQA 4WXHA 1Q1HA 2JT1A 2KIFA 4KNYA 1ZG5A 3WTSC 4KIFA 5IT9Z 1G3SA 2VXZA 1V3FA 3I0TA 3CLOA 3H92A 3F23A 2PFBA 3BP8A 1RZ4A 2XV4S 1W5SA 3Q9SA 5H6RA 5FD6A 1SMYF 1XGSA 2L4AA 3DXJF 5ERIA 1X3UA 2DQRA 2Z9OA 5J8FA 4HQEA 1XGOA 4I7HA 3TO9A 1UCRA 1U5TC 1W7PD 4LLGF
chains in the Genus database with same CATH superfamily
3MKYB 3L2QA 2ZCWA 1R6RA 4IHSA 3WTTC 2PN6A 1D3YA 2K3PA 1BIAA 1DU0A 1YW9A 3K4LA 1Z6RA 2VBXA 3QYFA 4ETSA 2HR3A 1YO5C 1JXSA 4FT8A 3S1RJ 4DOZA 2E35A 1U0JA 3E6DA 2DPDA 1LJ9A 3PO3J 1UAAA 2ZJPF 3MAJA 1SVLA 2GZWA 1D5YA 4FHTA 1IXSB 2CW8A 4X6AJ 2COBA 3WTUC 3B6CA 4V19K 2L3DA 5IYDJ 4G6TB 4FTHA 3HGGA 1IN6A 1UJ8A 4XRMA 4GCVA 1OLTA 1V4RA 3A03A 1JKOC 3TW7A 4KICA 4RLFA 2VC1A 2DYSH 1R5HA 2H27A 1Z3XA 2CJJA 2LNBA 4BQAA 1ETQA 4U7BA 1R22A 2VPRA 3MKLA 3SXYA 1ITYA 2O8XA 2R5ZB 3M8EA 2IJLA 2ZXWH 2NVUB 4AYBA 1HSJA 5JI6A 2VBZA 3PUFA 5ILVA 3CTAA 1I6HJ 2M30A 3CF5F 2LKSA 3IKVA 2OQGA 3B6AA 1U6GA 2EQRA 3CO7C 5IP9J 4D0PA 2ZBKA 1B59A 2YSRA 5EZHA 4IX7A 1GUUA 2ZSIB 3J7AO 5E20A 4KA4A 2GM4A 4A6EA 2OZUA 2MZ4A 4C30A 4IRIA 1UB9A 3E6MA 1YTYA 2WC2A 2HTSA 3M7GA 2M3AA 5JHFA 5FKMA 5K7FA 4H0EA 3BTIA 1H9TA 3JSPA 1SVOA 3ZQIA 3HZJA 3H3VK 1SVMA 3Q0WA 1Z9CA 2RNJA 1OMIA 1F4KA 4BXUA 1NG6A 1E0EA 2MLKA 4L5JA 4ZYDA 1LVKA 2GIZA 4Q47A 1OFCX 1MNMC 3QPSA 3SHFA 3U1DA 5BS6A 5JLWA 4J01A 2A3SA 1SFEA 4AIHA 2R7UA 3GLXA 1OQYA 2F5FA 4Y13A 2E34A 2MH2A 2ZXHA 4YFKF 3DKXA 3ZMUA 2H6BA 3DEWA 1R1TA 2XRLA 1T33A 1D0ZA 5KK1A 2IP2A 3CO6C 2ZFUA 3ESWB 3FXQA 4I0BA 5CVJA 3LSHA 3JTHA 3AKZA 2COMA 4LOCA 2WADA 3SDGA 2CW0F 2HU9A 2A6EF 3S3NA 1GXQA 2QLZA 4E7SA 1Z05A 2PBIA 1CQTA 2A6HF 3P9IA 3HKZA 1D1AA 1QNTA 2CFOA 1JJ6C 5K5QA 1XG1A 2F5CA 5GP9A 4RBOA 1QA6A 4RGSA 2DBBA 1X3ZB 2FQ4A 1JUMA 2VT2A 3GZ6A 4II2A 4KT6A 5EGOB 3BTLA 5E3OA 3LNQA 4ZYHA 4Z2YA 2OTJI 2F4IA 1PJRA 1QQIA 4CA0A 2FOWA 2Z5UA 3HOSA 3DEEA 3IRRA 5HS9A 4UNOA 2CH0A 4LG0A 1PUFB 2DQLA 5AONA 3ONQA 1NTCA 1BC7C 4OWRB 5LBQA 4JYKA 5GAGJ 2JRMA 3WTXC 2AS5F 2GWRA 4JP0A 1MD0A 1F5TA 1ULYA 1OCCH 1I1SA 3BPXA 1WI9A 2YR2A 3DU5A 1TWFJ 2ZSHB 2K27A 3IH2A 5FFZA 3CCEI 3ZGKA 1ZK8A 3IH3A 2CV0A 4W97A 4YFXF 3FBIB 2JA5J 2RREA 1JHHA 3EUAA 2HPMA 1LDDA 2GA2A 4LB6B 3RPQA 3E5XA 2M0CA 4A6DA 4XLPF 4KFCA 2RGVA 4ENJA 2NVTJ 4BJ6C 4PSWA 2R92J 2DLLA 2H1KA 4PJMA 3K70D 2O8KA 4I2OA 3CMMA 2X4HA 3NQOA 2L7FP 5JFRA 3R0JA 2P6SA 2R7ZJ 3OV8A 1LUJB 1VQ7I 2BXYA 3H0DA 3ZMTA 5FO5A 2A5WA 5EF6A 1VTNC 2YU9J 1ETYA 2FNPA 2WTEA 3HTSB 1AA7A 3KP7A 2KJBA 1SAXA 2VKEA 3ROUA 4HX8A 4RAYA 5BPDA 2X6WA 5FLXZ 4BJ5C 3IWFA 1Y1WJ 5AIPA 4HAMA 2PMHA 2E36A 1QO0D 2KQRA 4BS9A 2DI3A 4XM3A 1V5GA 1P4WA 3ZOBA 1BR4A 2E7WA 2KDOA 2VB6A 2DJIA 5IOYA 1AWCA 1K6YA 1U5TA 3S14J 1JKRC 4G9YA 3EQLF 2HWVA 3G1MA 3BR0A 2R7FA 5CQGA 2ME6A 3FMRA 1YX5A 2XKPA 2PG4A 2IS2A 2HS5A 4HLXA 2P5VA 2O5RA 1DPUA 4BYYA 3L2WA 3KZZA 3ZQGA 1XDSA 3JRBA 5DD8A 2DJNA 3RZDJ 1FBSA 1UZCA 3BDDA 5FKOA 3S1MJ 2DOFA 2CGPA 1K6OA 2JA6J 1ETWA 3DTKA 2PJPA 2L4MA 5IP7J 3DPLC 1X58A 4PZJA 2K86A 1XGMA 3W2AA 3F0CA 4HA8A 1OYWA 3KYCB 1BC8C 3OWTA 3ZQCA 3BWGA 4D9JA 4EM0B 2XHKA 3K4NA 3DLLF 2QENA 3ZRGA 2MBFA 4A0ZA 4A3KJ 1TWGJ 3CJQB 3VB2A 2KZGA 1TWCJ 3TP3A 3GW2A 2ZB9A 1YYVA 3J80K 2H8WA 3CP8A 3GZ5A 3ZCOA 3TBIA 2XAJA 1K7AA 4BY1J 3ECHA 1Y6IA 5M5YJ 4OMZA 4E4HA 3BR3A 4IHWA 1OR7C 2XB5A 4IF4A 3MCZA 3A0BC 3F6OA 4GXOA 1J5YA 1DDNA 1ZRCA 5DUIA 3CUQC 3FXMA 2L9NA 4L9NA 2UWMA 2R4GA 5GPCA 4PFOA 4RB2C 2DXIA 1MW7A 2RQPA 3OYFA 3V8LA 3GEZA 4YELA 2EK5A 3AL0C 3HM5A 4HBLA 4XRFA 2NAZA 3UKGA 3V7RA 2RC4A 2ZXJA 4F3QA 3IHUA 4BNCA 1TZLA 4IHTA 2W24A 2IS1A 1XTAA 4ZTJA 4XKBA 4AIKA 4BACA 4HF0A 4LGWA 2JA2A 1WJEA 4NC8A 1FIAA 1IW7F 3MMYB 2HVSA 1A6IA 4E7LA 1YQAA 1QGPA 1W36C 5E8IA 2RAEA 3V7SA 4DQ2A 3L00A 1JE8A 1O3QA 1WJCA 2R7RA 3S3OA 3IWZA 4Y4RA 3WG9A 1V5FA 4UUTA 5M3MJ 4WK8F 1BI0A 4R79A 3OYKA 2E5NA 3VSLA 4DZJA 1UMQA 3ASNH 4U88A 5IOZA 4ENKA 3N97A 3WG7H 2JJ7A 4MEXF 4A3FJ 4RB3C 1MMDA 2NS0A 5JHUA 3PM1A 3D1NI 3NAUA 5CVIA 3ZMVA 1KU7A 1YX3A 3GUDA 1B4AA 4LMYA 4JX5A 4G7OF 1LVAA 2AHQA 3FXRA 1F9NA 4A12A 2BY3A 2R7XA 2MD5A 4KMUX 4GDFA 1IN8A 1T0FC 3F3XA 1X19A 4YIRX 1KU3A 3M9AA 4DIQA 2ZMEB 5ILSA 4I98B 4MTDA 1IRFA 1ZRFA 4B09A 5J8CA 4J19A 1FYMA 1WCMJ 4LLLA 1VQOI 1R1UA 5HDNA 2PMZA 1HKQA 2UXXA 3F8FA 3ABMH 2EZKA 2MC3A 5F6FA 1WJDA 2CMPA 2GOXB 2ZKZA 2QCOA 1R4MB 3I71A 1GV2A 2L5QA 4G6QA 2W7NA 3JRFA 3BJ6A 5D5UB 4YEJA 3SJMA 2P4WA 2G7UA 1P4XA 3I59A 4BKXA 3DPUA 4ZJZA 3GTJJ 1FJLA 2ISYA 1V54H 3BJOA 3DTIA 3Q0VA 3COAC 3PFYA 5LHGA 2H09A 2K9NA 5E17F 3SYTA 2K40A 2M1BA 3FMSA 4EVIA 5KCMA 2A05A 1I3QJ 2JWTA 2VI6A 3CJNA 3QPTA 1HDPA 4XN0A 3G2BA 2VASA 5H2FC 4B1RA 1T08B 3G3ZA 5DYMA 3VOEA 2LF7A 4BH9A 1ACIA 1R9TJ 3CCVI 3J7YJ 3BR6A 4YIIA 4YFNF 4BHCA 4U0VA 1BJZA 2NVQJ 3M1EA 1BA5A 2NS8A 2JSCA 4F93B 1YI2I 1U9NA 4HEA2 5HLIA 2EIJH 1O3SA 1XMXA 3VYSB 1HW1A 3O8HA 2M4KA 4G6DA 4EATA 4R1HA 4UY8I 3OYAA 4CO8A 1V55H 5ICCA 1HBXG 3DQVC 4FISA 3SDBA 4JOMA 2M8GX 3BY6A 4ZC3A 2BW3A 4BE2A 2WAEA 1ZYRF 2DT6A 1W7PB 3ELKA 2XB0X 3AG4H 2CV1A 4MHGA 3RQ4A 2HYGD 2VKVA 4BJTA 4QLCU 4EMSA 4X1EA 2XGCA 2E5ZA 1L3LA 1P9QC 3T5XA 4BDZA 1Z0XA 3D5SC 4B4CA 1S7EA 3RKWA 3BC8A 4A3MJ 2VJJA 2D45A 2L7ZA 4L9TA 3BG6A 2VOOA 2X98A 3FXJA 2XGXA 3ABKH 3MVPA 4B47A 1USSA 2V1UA 4AIJA 1GLNA 1TQIA 4AD9A 1SD6A 5HDGA 2VQHA 4BDYA 1RKWA 5J3LA 5ILUA 4UHTA 5CLSA 4NNJA 1D0XA 2CQQA 5A2QR 1X4OA 2O6GE 3CC4I 2X6XA 2XAQA 2HVQA 3CCRI 4DBQA 3LSPA 2CUZA 3HYIA 4KIBA 3WU1B 3J81R 2LTPA 3I9V2 2VLAA 4P9UA 3OIQA 3BG7A 1EH8A 5JVTA 2XDVA 3E0JB 1VF9A 3ZN1A 1T39A 3K4JA 1IDZA 2VKDA 5LGTA 4M9XA 3K70C 2LP0A 4B3XA 3OOUA 2QM3A 4HX4A 5H6QA 1D8JA 1RNLA 1MH3A 2NOGA 3WU2C 3VYTB 1E3PA 2K4JA 2CQNA 1P7IA 4ESFA 5HOOA 1MDMA 4HV5A 5FKKA 1G4DA 1GVJA 5M5WJ 3OYNA 4OIPF 4R8HA 5CYVA 1OCZH 2DYRH 1ENHA 2XASA 2IGKA 1QZZA 2F2EA 2F5VA 4G7ZF 2OQRA 3J7AW 2OU2A 2VE8A 4XR6A 2GIVA 4NUBA 3K1NA 4M3DA 4EJUA 3WTZA 1Y0NA 1XMKA 1K79A 2NRAC 1R5GA 4I76A 1TL8A 3S8PA 4C3JJ 4HF1A 1U8BA 1U8RA 3K4CA 1UG0A 4UXNA 5J4VA 2X1EA 3M8JA 5J1RA 2W1OA 3FIWA 3CUQA 4KJZA 1PYVA 3JRHA 2KKOA 1W5CC 3LAJA 3J80R 1T38A 1T56A 4M3BA 2L7KA 2LK2A 3KLNA 5TJJA 1GHCA 1EV7A 3CCLI 1FOYA 2EIMH 2ZJ2A 1X3WB 1ON2A 3ULQB 4XKWA 3E97A 3RYPA 3QU6A 5J1UA 2XAHA 1HW5A 3EUKL 1JGGA 5EG0A 4IKFA 4XOTA 4BE0A 3ZPLA 3IL2A 2BY1A 3FZVA 3JREA 1D1BA 2BY0A 5C4XJ 1YE9A 3PFIA 4DYRA 2DFIA 1A35A 3EPZA 3ISPA 1T95A 3KETA 3VSKA 3O2PE 4S05A 2R5YB 5F0CA 2MW8A 1ETOA 4P55A 3OYJA 4O6JA 9ANTA 2M7BA 2VJIA 2OBPA 5LHHA 1ZG3A 1WHUA 5FKNA 3L2UA 4IHXA 4HOBA 2EA4A 4DYCA 3WTVC 4BHBA 1F43A 1KQ0A 1OPCA 1X4PA 2FXAA 1AKHA 4BXXJ 4EM1A 3NWSA 4OAZA 3SFIA 3REOA 2EFOA 3HOWJ 3FM3A 3QOEA 3TDZC 1FMVA 4MQVA 1H8AC 4RB0A 3BQYA 3CMEI 3RI4A 2OPTA 2AO9A 1BI3A 5BQTA 3VFZA 2BYVE 2XPUA 1ETKA 3HRTA 1XC5A 3SZPA 4CCLA 5IY5H 2KJCA 1WQ2A 2E7XA 1Y8QB 2VBWA 2CQ7A 2BXZA 5FROA 1B8IA 4IHYA 2O3FA 4BHPA 2PI0A 2M35A 1TP4A 5D4RA 1S8NA 3OR2C 4QTRA 2HYJA 4P5OA 5CJ9A 5B1BH 1B72A 2IS6A 4BAYA 5LFAA 3FXLA 1DQUA 3KYLA 3LSTA 1FBUA 5DM6F 4LD5A 4ZDPA 1TTYA 1VI0A 5K5RA 2JA7J 2LSOA 4UB6C 4UUVA 1YRNB 2RVCA 4BUPA 3V7CA 2JSPA 2QA4I 1RESA 4AWXB 2V6EA 3NEUA 1U78A 2LH9A 4GGGA 4HYEA 1XSXA 3J7ZI 1YLFA 1OKRA 1SEUA 1MNEA 4NBQA 3OIPA 2K9LA 3HOZJ 2VJ4A 4LLNA 4DNCA 2FJ1A 2Y31A 5DTDA 3C7JA 3BTJA 1RI7A 2X6YA 3K2AA 3MD2A 4ZTFA 3GBGA 2VQGA 4CGZA 1EF4A 1WH7A 5CVRA 1FOXA 3JW4A 4P1WA 3OYIA 1MH4A 2Y0SN 3PO2J 5LRRA 4EV0A 1V5EA 3JAMZ 1LFUP 1AU7A 2Q2EA 2HZTA 1FC3A 4MLOA 4U0WA 4L0YB 4X0GA 4BQQA 2F5DA 2QSHX 2BZTA 4PGGA 1RUOA 2KPMA 4GFBA 3B02A 1JKQC 2JN6A 4A2UA 4N4OB 3ZP5A 1SANA 2CV2A 2FUG2 3CMAI 3CMYA 2CUFA 3GVAA 2VL8A 4RAFA 1YFHA 2FU4A 1EH6A 1HF0A 2GA1A 4AC0A 3T0YA 4L5IA 4LG0B 5J47A 2EFQA 5FGMA 1O3TA 2ELKA 1ZGWA 4C9YA 4HPQA 2HOAA 2Y0MA 5FRMA 3H9QA 1MJBA 2Y75A 4C3HJ 5HDKA 2QBYA 1Y0UA 1WPKA 2DW4A 3KZIC 1STZA 4IHVA 1RUNA 1A31A 2W82A 5HLGA 1YJWI 3KPHA 2DFHA 3TOAA 5EDNA 3ABUA 4ITVA 1FOWA 3C3WA 5JR3A 2K7LA 2GOMA 2LOOA 2W00A 2K3FA 2DT7B 4OAYA 5ICFA 4MIMA 1S9HA 4XONA 4RM2A 2BV6A 4U0YA 2D1HA 4A0YA 1GT0C 3BQZA 3G71I 1HOMA 5D4SA 3QRFF 1OJLA 2ETHA 4P96A 2QUFA 1POGA 3GTLJ 2WWYA 2EILH 1J7KA 2YS9A 4LIVA 3JRIA 5M3FJ 1E3HA 4BU2A 3FM5A 3U1KA 2KIMA 2XSDC 2GXBA 3DBLB 4N0BA 4CCNA 5FLXK 5IT9R 3GO5A 4CYCB 4EGYA 3A1YA 4AUXA 4BQNA 4XORA 3RKYA 2GXAA 3KIOA 1A5JA 2OD5A 2CU7A 4FX0A 3IAM2 1GXPA 3FK6A 4II3A 2JVGA 2KISA 2LY1A 1MJ9A 2V1DA 3S15J 3KZYA 4TV7A 3KP5A 2O7OA 1MMAA 4A69C 1MBGA 2LBFB 4HV6A 5DS9A 4M74A 4E7KA 2RV8A 1QVUA 2KL4A 1O4XA 4CCJA 3KE2A 2LR8A 3KP4A 3TGNA 4HNUA 2D5VA 3RKXA 4ZH4F 3TL4X 2Z1DA 1JTXA 2DA7A 2DA6A 5LHIA 5FJ8J 4LJZF 4ZYEA 3HEFA 1Z6TA 2R5ZA 3E3VA 3HRUA 2WAQN 4S0HB 2CSOA 1K83J 1JTYA 1S3JA 2IBDA 4YRVA 1R71A 2R7TA 5F1RA 2Z99A 2ZC2A 1Z67A 2KRCA 2ISZA 3ZQQA 4CCMA 4KITB 4HDUA 2K5CA 1I6XA 5EYRA 1HDDC 3OYCA 2OCCH 1ZREA 1VQNI 1KA8A 2EA2A 2J5PA 3TKYA 5DCMA 2R93J 5IT3A 3HJEA 1VQ8I 3LAPA 3AG2H 5LGNA 3FXKA 1MBHA 3DBRB 1YIOA 3NWTA 2KT0A 4OIRF 5HNHA 3BPVA 2Q8KA 2I5UA 3F21A 2DTRA 2QEXI 2DMQA 2WY8Q 2ZNZA 3OOPA 2P81A 2DOAA 5DUKA 2C6YA 2MA3A 1LDJA 2K9SA 3V42A 2TRTA 2P5LC 4XSZF 4KISA 4XLAA 1MSFC 5J4YA 3I53A 4FASD 2KHMA 2W84A 2DODA 2OUMA 3ML6A 1H88C 3G73A 2A07F 1I3AA 4XNFA 4A3LJ 3HHHA 1JI8A 2EJRA 3HPGA 2LKPA 3TQNA 2FA5A 2P8TA 5HVQC 2DTZA 5F1JA 5FD5A 1B6AA 3HTUA 5ED4A 1XMAA 3CF2A 4B3AA 3S93A 1HW2A 4M6YA 2OV7A 1WKMA 2B63J 3AG1H 3F8CA 3S2HJ 1QZEA 3EYIA 2P0WA 2E2JJ 1J0RA 4XSXF 4Q4ZF 3RJPA 2ZMEC 3ERMA 3L2RA 3HL2A 3NARA 4MGRA 1IDYA 3TP0A 1HC8A 4C2UA 3KYDB 3EDPA 2HOTA 1ZLKA 4MFDA 3EUHC 2HGCA 4HW0A 2V9KA 2XC7A 1JT0A 4C2TA 1W0UA 4GYGA 4XLEA 1P92A 2P0TA 5KHDA 4A3DJ 1Z7UA 5C3EJ 1FY7A 1G6NA 1QHHD 3A02A 3HSEA 5D5VB 1APLC 2M7AA 1DU6A 3WTWC 1SAUA 4N9HA 1KU2A 2VIXA 1WVRA 2XGDA 2DOEA 4IOCF 3SQNA 4OIQF 1FWZA 1BOAA 2DA3A 2V79A 2W25A 3U2RA 2A6TA 5L3BA 3OYMA 3IH4A 3WHCA 5F04A 5IYCJ 1BM9A 2M87A 2R7QA 1K61A 1SD4A 1D1CA 2AXTC 3MZ8A 3MZHA 5J6XA 2W48A 1N77A 4I99C 4XMYA 4OIOF 1R23A 2Z16A 4ZYAA 3RPUD 1O7LA 1DGRM 1WJBA 4BBRJ 2E19A 5BMZA 1P6RA 2MC4A 2FBHA 3WE3A 2L9SA 2X1DA 1T98A 3KEQA 4Y3OA 3G4SI 1LE8B 1G3TA 1SFXA 2O03A 2HZDA 2XIGA 1DP7P 1BI1A 1ETXA 3NRVA 4Y15A 1IRGA 2DA1A 4BXFA 2XPVA 3GTOJ 3W2WA 1R7JA 2HYFA 1LPQA 1UFMA 2DO7A 5CPRB 2L01A 3DWLE 3I59B 1N78A 1GV5A 3BG5A 4MEYF 3K69A 2VPLA 1UHWA 2EH3A 3HC7A 3R6SA 4I6ZA 2FRHA 4AM3A 2CUEA 2DU9A 2KFDA 2ZJQF 2VE9A 4WWCA 1R1VA 1IUFA 2EV0A 2LLKA 4DZPA 1MMSA 3FX3A 3K6GA 4KN4X 3BROA 2AXLA 1X1PA 3BOQA 1JT6A 3I58A 2PJRA 3R0AA 3L1PA 3AG3H 2WV1A 1E2XA 4Y33A 1EKEA 1TWHJ 3HSFA 1X1CA 3HB9A 2NVXJ 2QKMB 3S3MA 2HFHA 3W6VA 2VOPA 5FRNA 2QQ8A 1QVTA 2IRFG 1ZELA 4IQJA 2P7CB 1FSHA 3CLQA 1MKMA 4KUMA 2DMTA 3GLLA 4HG2A 1W1WE 3IP4B 3ZXSA 1LFPA 4IPAA 3WE2A 3SEQA 3DEUA 2BHZA 2EWNA 3J81Z 2VONA 2IGOA 2CYYA 4JX4A 5HLTA 4ZZDA 2HXOA 3C2GA 4B8XA 5D5XB 1FYKA 5BPIA 1LEBA 1KONA 1LFBA 5HS7A 4KT5C 3UNGC 3H35A 3CJRB 4UUSA 3RSNA 4BQOA 2ID6A 2Y9YA 3K4MA 1JGSA 4A3BJ 4HZFA 3GTKJ 1OISA 4EJWA 5IPAA 2HI3A 2QSFX 2WB1A 1AOYA 2O61A 1FP1D 5FLXR 1TT5B 2E1MB 2HNHA 3FISA 2M45A 3WODF 2B9SA 2QSGX 1FTTA 3QU3A 2Q0OA 1TQPA 5E3MA 2V9VA 3W2VA 1K4TA 3K0LA 2BGCA 1REPC 3N4MA 4BY7J 4WXCA 4HRIA 2CWEA 2V9PA 3I5UA 2BOLA 3QODA 1XD7A 3QWLA 4NC6A 3HOXJ 2O9LA 1SMTA 1X1DA 4ZDOA 3I4MJ 1RQ6A 1XB4A 4IXAA 3TO6A 2P5KA 4ENMA 2KIUA 2NS7A 1UHMA 1D0YA 2RDPA 2B7EA 2M4GA 4FQGA 3CCMI 1IXCA 1U9OA 1S29A 4MFEA 1XCBA 5D6FA 5CVVA 1TW2A 3ZMSA 2QVOA 3EETA 1JUSA 2EV6A 3PSFA 4IQ4A 2V6CA 3GTGJ 2M8EA 1X1AA 2JUGA 4Y17A 1PUEE 1IRZA 5E1ZB 2HQRA 2L9RA 3GCMA 1BBYA 3DU6A 1PVEA 4RAZA 5IYBJ 4JQFA 1G59A 4PCQA 5FFXA 2CRGA 2L54A 5HS8A 3WHBA 1MDMB 2LF8A 2Y0SA 1HXDA 4KN7X 1CF7A 2H94A 2WV0A 4ABZA 4G12A 2I10A 3X2QH 3HG9A 1O3RA 4ESJA 1YIJI 3M8FA 2VC0A 3GWZA 2MG4A 1FBQA 3FBNB 1I1GA 2KIQA 2LMDA 2L2OA 4DYQA 2GQQA 2X48A 3E5QA 1LDKB 2DA5A 1Z3YA 3PIPF 3K4KA 3T1BA 5BOXA 2MUNA 2W4SA 4M72A 2NVYJ 4CICA 4CZCA 3IAS2 3F22A 4RB1A 4AVZA 5L3DA 3SZGA 3VPRA 4XQFA 1ZGJA 1ZQ3P 2P7VB 3CUOA 3QP6A 3TMOA 2KP6A 1NK2P 5F0HA 4LK0F 4G8XA 2KRFA 1G3YA 2NNNA 2DT5A 3SZTA 5KVRA 4I02A 1K78A 2H6CA 3HUGB 3SEZA 3IKTA 2ZMEA 1BL0A 2Z2SB 3ZN0A 4HDVA 3MN2A 1YJ9I 3PQJA 1PP7U 2L7MP 2FOKA 4G94A 4K2EA 5EZGA 5GTIC 5EG0B 3I3LA 2XGEA 4BEHA 3A01B 4A3EJ 2XKOA 2BY2A 2E2IJ 2STTA 1UG2A 2FE3A 2MFZA 1WH5A 3EUHA 4HNTA 4M3GA 3W6JB 2EIKH 1C0WA 4FE7A 2XROA 3SFZA 1KYWA 1EA3A 1WWXA 2FX0A 4C2MJ 3KP6A 2JK3A 4MQ9F 1MBKA 3CDLA 4O5VA 2BEOA 2CQXA 3BZKA 4XLCA 2IEKA 4FE4A 1ZKGA 2M0MA 2DMNA 1XX5A 3QQAA 1PP8F 1NK3P 3CCQI 3OL3A 1WSUA 3CDHA 3M07A 4HSRA 3MFKA 4XLNF 1WJAA 3U9GA 1WJ5A 2LY9A 5E1WA 3D5RC 2R7DA 1IZ1A 3P7NA 2H8RA 3F8MA 4EGZA 4PJJA 4M71A 2D1VA 3O3KA 3V8KA 3A0HC 3G1LA 1SFUA 3LA3A 3ERED 2ME0A 1GVDA 3F8NA 3HPHA 1WZ2A 2XF7A 2LYCA 1Z7LA 3S32A 3IRQA 3M3YJ 3BG9A 3BT9A 1ZN2A 5E8GA 3JRDA 1IC8A 4L0ZB 1B8IB 3GMEA 2GBYA 5GPAA 1JHFA 3QAHA 4LFUA 1J9IA 1OR7A 1KQ8A 5M5XJ 4C3IJ 4KDPA 4PDKA 2GLOA 3L09A 2JUCA 2O0YA 4B48A 3WGGA 1IGNA 2ADUA 3JRAA 1HKTA 2BBYA 4DJAA 1W7PA 1RR8C 2PLYA 1MBJA 2UV1A 5D6EA 2BE5F 2Y30A 4D7NA 4M9SA 5EEAA 1YOVB 3JAMK 2M9HA 3RCOA 2FNAA 1IJWC 4CH7A 2H1LA 3JRGA 2HQNA 2DDBA 2XUBA 1EJ9A 4G7HF 5B3SH 2CO5A 3L2CA 5DV5A 1RIOH 1E3OC 4HF2A 3GFIA 2QQBA 4IO9F 1FT9A 3S17J 1ONVA 3E6BA 3QYBA 5CQEA 2UUZA 5TGTA 1IV6A 3OYLA 4XN3A 2HVRA 1WFXA 1JKPC 3N05A 3WGHA 2DDAA 4A3JJ 3BLYA 4NQWA 3GTPJ 4V2FA 2QQ9A 3H5NA 1GDTA 3FF5A 3BR1A 2VUMJ 1QHGA 5LLQA 2VKHA 1OYIA 2HQAA 3ZQHA 2XRNA 1F36A 1L0OC 4EJVA 2E60A 2DMPA 2LC2A 1KZHA 1T0FA 1EH7A 5EJCA 2K9MA 1BJAA 2BVMA 4M3EA 2JQ7A 4M3FA 3LSRA 1SD5A 1XPXA 1IAWA 3C18A 1XSVA 1Z91A 4PUSA 4PJNA 2Z33A 2DFEA 4UV9A 5K1YA 2QBYB 4Q48A 5GADJ 1MSEC 3A52A 2WBMA 1XSDA 2EZLA 3KLOA 2LG4A 1VQ6I 3DBHB 2A69F 2FBKA 3E7LA 2BVLA 3ZMZA 1W5TA 2PMUA 1Z1DA 2RNGA 3TOBA 3OL4A 4IOAF 1DP3A 3E6CC 1S7OA 4QPOA 3RYRA 3OR1C 1FOKA 2CW7A 4ESBA 4XKCA 4E7ZA 5FB2A 3PNTA 1LQ1A 2JTVA 3MQ0A 4JK1X 2QF7A 1TT0A 5L3FA 2MLGA 1BI2A 1R5ID 4CSWA 4CUGA 4O3MA 3CC7I 2FD5A 1MMNA 2I8DA 2R7OA 2M34A 3FKIJ 4MNUA 4RMNA 2HKOA 2L9VA 1ZR2A 2NOJB 4F52A 5AIQA 1YW8A 4IRGA 5KNLA 3CP2A 1LB2A 2A68F 3AFHA 2XAFA 2HTJA 3WGIA 3OSFA 3GXOA 3FXOA 4D5FA 4HX7A 3HOUJ 2EINH 3EYYA 1W36D 1HKSA 2AQEA 1FP2A 1VQKI 3L2VA 4ON0A 3ZQ7A 1YS7A 2NYXA 3PQKA 3RZOJ 2Y9ZA 1OCPA 4E70A 2G9WA 5B1AH 1T8IA 1TNTA 4IJAA 1ODDA 3OS1A 3LFUA 3H5RA 2R3SA 3BG3A 2L0KA 1I39A 5TISC 1DPRA 2R5YA 1MBFA 1QRYA 3PL8A 2JVHA 4OINF 5ICGA 3MKZA 4L18B 2X1CA 4YIFA 3F9KA 4F91B 3HXLA 1IN4A 2X85A 3I4NJ 2ZXIA 3OIOA 2HEOA 1E17A 3Q3SA 5LD2C 2FBIA 3PIOF 4ZYGA 3D5LA 3I56I 1J59A 2OA4A 1LEAA 4I0AA 2K9QA 4A3GJ 3BR2A 2W85A 1TLHB 5DCMB 4UV8A 3U21A 4DW6A 1K4SA 2E2HJ 4A0XA 1I27A 1G3WA 1R36A 1H89C 1FEXA 4E7IA 2IW5A 3DFGA 2IS4A 4F92B 4F55A 2DPUA 2JZYA 2E1CA 2CUJA 2HOEA 3LA7A 1NG7A 4S04A 5DM7F 2DA4A 3ABTA 2OAZA 3QPLA 1P4AA 3HRSA 1IV8A 1TQMA 4QSHA 2V26A 1FMWA 2HKXA 4KIGA 2VODA 5HNFA 3R61A 1YRNA 4CHUA 2MD0A 2F4MB 2M5WA 3LSGA 3RIRA 2XF6A 5F64A 2V7FA 1TW3A 2R7VA 1KYZA 2NXNB 3FK7A 4U7DA 4HLYA 2RKHA 3R60A 1VQ5I 3K1PA 1USTA 3CDIA 5DEQA 1XGNA 3E1SA 3HSRA 3KCCA 5B5EC 2FSWA 2JPCA 1ERDA 3WTYC 3P9CA 4CCKA 1VQ4I 3HIFA 3HGYA 1U5TB 1FIPA 4PK4A 3S1QJ 4I01A 1HA8A 2Y48A 2VQCA 3UR3C 4Y7NJ 4Q5SF 3B73A 2OTLI 5C4JJ 3OYHA 4NDLA 3PNYA 5D8KB 1D5VA 1OCRH 5KAFC 2Y2ZA 3OS0A 1TBXA 2KDZA 1SD7A 2V1NA 3AAFA 2HOSA 1Y8RB 2XPWA 1ETVA 4CXFA 2F6CA 1Y1VJ 3V8JA 2A5YB 1YW7A 4NC7A 3C2BA 2OJED 2LFBA 1RPWA 3BCAA 2GAUA 1WGXA 4PJLA 4RGXA 4M9ZA 2HPIA 4RDUA 3KFWX 3DPTA 2R7SA 2ESNA 1A36A 4L9JA 2FQ3A 1BIBA 3FDYA 4XLHA 3JRCA 3CESA 3PSIA 3KP2A 4BGDA 3TW6A 2QQAA 3ASOH 3JAMR 2LDUA 3LSJA 5F0FA 4GYIA 4Z6YA 3MEXA 1UELB 1B9NA 1FZPB 2JMWA 1KU9A 3T8TA 4RGUA 5D8LB 1CGPA 3CCJI 2QYOA 3JCUC 3RPUA 2EZHA 5ICEA 3JSOA 2ESHA 3GYHX 3H1CA 3I54A 2K02A 3FWEA 1N75A 3OYDA 2CG4A 2ECBA 1IN5A 2FEZA 3CCYA 3LWFA 4F7ZA 3GF2A 1ZHFA 4M73A 2AQFA 1VQLI 5JLXA 1P2FA 4CYCA 2W57A 3K10A 3S2WA 3TDUC 1ZAOA 3ABLH 4XOPA 3PJRA 3TO7A 4XBFA 2VN2A 5D5WB 2HQ5A 3GFJA 3MZYA 2VQLA 2B0LA 1MIJA 4EM2A 3HHGA 4DBRA 3FHZA 2VBYA 1R49A 2F5EA 1MJAA 5A2QK 3M4OJ 2PJRB 1NH3A 4WX9A 2E1MC 3BR5A 3F72A 5L3EA 4EEFG 3S1NJ 4RM3A 4JBAA 4BL0B 3KEYA 5FLMJ 1J09A 5EGOA 3GTQJ 2LBFA 4D1QA 4EQQA 1I5ZA 3J81K 2UXNA 1YS6A 3I55I 1PUFA 3P9KA 3S16J 1A6QA 1BN5A 3GFLA 5E79C 2TDXA 3QYEA 5GAEJ 1PDNC 3LQRA 1ZTRA 3KP3A 2L02A 4OU0A 3HOTA 2OCEA 4EJTA 3RQIA 2X51A 4L9VA 4BBSJ 1QPIA 1B1BA 4UVCA 2MVTA 4UUSB 4B43A 2M2EA 1ZGAA 4ANJA 4CYDA 5TRDA 3LSKA 4E7JA 3DKYA 4XL9A 4L5EA 2WA0A 1BR2A 4H4KC 3H5AA 1YG2A 3F6VA 2MYSA 1QPMA 2E1OA 1O7FA 2DA2A 3BTCA 4D7MA 2RQQA 1TNSA 1VQPI 1S7AA 4V2GA 1MGTA 4AYBN 6PAXA 2IA0A 1H9GA 1QZYA 5L3GA 2VJ5A 1QU3A 1D8KA 2KLOA 1SFKA 3BJAA 3RDIA 1F1ZA 2OZ6A 3LA2A 1UHSA 4RS8A 4QPQA 1RR7A 4I09A 5GAHJ 2VXDA 4CCOA 1FLIA 5EEGA 2IAIA 3BCBA 2E71A 2EFNA 4RLQA 1MZBA 2CQKA 1OCOH 4AU7A 3LL7A 1U2WA 1BW6A 3H3UA 5H20A 4LG3A 2D2WA 3K2ZA 3PNVA 4LITA 1J75A 2XAGA 5LRSA 1B9MA 1G2HA 1VQMI 5A2QZ 1AHDP 4A5NA 1RETA 3C1DA 2EV5A 2EB7A 4RAGA 2PEXA 2XAUA 4KYWA 1IUYA 2MH9A 2YX4A 4EJOA 1JJ8C 2V1XA 5F27A 4NHJA 4A93J 3VEPA 4A5MA 1CF7B 1NHAA 2JA8J 3Q5FA 3I64A 2YUSA 3Q0UA 2DMUA 4IVNA 3RTRA 4XRSA 3OS2A 2UZKA 1ZH5A 1XN7A 4GO1A 4XRSG 2BW3B 1O57A 3HOVJ 1R58A 4XK4A 4P9FA 2IPQX 1Y39A 3V4GA 3BZCA 2GXGA 1RRJA 1S72I 5DD4A 3H0GJ 2DAOA 3DTEA 2LKXA 2V4JC 1YJNI 4M6VA 1YHQI 1QBJA 1VZ0A 2JRTA 3CZ6A 2IA1A 1OYYA 2DCEA 3LMMA 3KEOA 5LEKA 4IEJA 4MTEA 3O6BB 2LY2A 4HSTA 2ACJA 2ID3A 1KGSA 3VDXA 4ENNA 1WI3A 2CS3A 3FMQA 3GZNB 3HKZN 3LFKA 3G6EI 3RKQA 1W0TA 3VWBA 4YG2F 3K4BA 1T2KA 1VFCA 2LVSA 1K78B 1HQCA 2FMLA 3LSIA 1LE8A 3QP5A 1FYLA 5DDGA 5J1YA 3W6KB 4OOIA 4BEHB 2EFWA 3K1MA 5EEHA 4QIWN 4RGRA 1WJFA 1ZARA 3J80Z 4FX4A 3P5JA 1Z77A 4LB5A 1XDUA 2X0LA 2Y69H 4M6XA 2RN7A 3IV5A 2E1NA 1BOBA 1ON1A 4N9IA 1JUPA 1I50J 3IC7A 2CFXA 3H36A 2K4BA 2ZO4A 4PSXA 2IT0A 1IO2A 2YPRA 1HSTA 3J7AY 2R0QC 3KX2A 4JX6A 1N25A 3OMYA 4AVPA 5JVGF 3S2DJ 1X1BA 3G1OA 1M1EB 3D0SA 3CQZJ 3R4KA 3OYEA 2JPBA 3OYBA 3H3ZA 2ELHA 2EBIA 1SFOJ 2X9DA 5E3NA 5E18F 3FXUA 3DF8A 2K85A 1BW5A 2J5OA 2EZIA 2ZNYA 4XIDA 2DK5A 1VNDA 3CCSI 3MWMA 2WAFA 2STWA 1IN7A 1IRXA 4KMFA 2MABA 4WF2A 1XCVA 5L3CA 2QWWA 3QOPA 5FKLA 2Q1ZB 1OCTC 1FTZA 2ZFWA 3PUBA 1FX7A 1H0MA 1FSEA 3ECOA 4DGWB 3H9JA 2PQ8A 4PFPA 3CUQB 1YITI 1R00A 2YX7A 1X2NA 1Q1VA 2A61A 1LKXA 4CZZA 3L7WA 3E5UA 2OF7A 3WU0A 4RA2A 4UB8C 4N4NB 4B44A 3MKWB 3TEDA 3HBLA 4ZDLA 2N8GA 3AL0B 3H9GA 3DV8A 2LD5A 2YU3A 5GTHC 1FNNA 1J2XA 4IZZA 2F48A 2VT3A 4J00A 3GTMJ 2NNYA 5CVUA 2IGMA 3A4CA 3C2HA 2FMYA 2DK8A 4ZZLA 5IP6A 3DKWA 1X2MA 5LEJA 2R7WA 1LNWA 2QZ8A 4E6KG 2EPFA 5IT9K 2Z3YA 3F8BA 2DN0A 2X6OA 4LIUA 5K5OA 4NQWB 3T8RA 1T6SA 3HDDA 5LGUA 2G7HA 1TWAJ 3CJTB 1AKHB 4LK1F 1IF1A 3JTGA 1TC3C 3GFMA 2DFFA 2FF4A 1FPQA 3VODA 4ASNA 3ZMDA 2P6TA 4IRHA 4AIDA 1VQ9I 3LQQA 3HRMA 1S5LC 4XLFA 1Y56A 3Q9VA 4E7HA 4FCYA 1G8XA 5HODA 1ZR4A 4WCGA 5FLVA 1S6LA 1BR1A 3VYRB 1WRJA 2ICWG 4HQMA 3OSGA 2XSJC 5CKTA 3K7AJ 3CD6I 4WXDA 2XVCA 5B66C 4Y52J 1MBEA 1B72B 2ZJRF 1A04A 1ZG1A 4OMYA 1R4NB 2LREA 2MSYA 3JR9A 4BE1A 1ZRDA 4D5CA 1HLVA 3OY9A 3I4PA 1RKTA 3BZ6A 1IXRC 4CDGA 2MGQA 4UVBA 5HLHA 1RC9A 3GX4X 1IG7A 2BHYA 5DCFA 2EFPA 2WAQA 5F08A 5J40A 4A3IJ 4UVAA 1W4MA 2HDDA 2G0EA 2IA2A 3QPHA 4U87A 3FHNA 4NB5A 4PGHA 2HDCA 2ECCA 3K9TA 1MMGA 2IXSA 1U3EM 3L9FA 2KMUA 3W3CA 3DP7A 5E1XA 5K7ZA 2ELJA 4A3CJ 2XF5A 1DUXC 2Q2EB 2QGUA 3LOCA 1Z21A 2IVMA 2HDWA 2QKLB 1P7JA 3CC2I 3CCUI 3DCFA 1MNDA 3HUGA 1KQ9A 1DGWY 3O8GA 5BNGA 5C44J 3ZQLA 2OC6A 1ZLJA 4QWQA 4WXHA 1Q1HA 4PJ0C 2JT1A 4XICA 3A2KA 1SC7A 4XKVA 3A01A 2KIFA 3ZQFA 5K7HA 4KNYA 2F4OB 1ZG5A 3WTSC 4KIFA 5IT9Z 1G3SA 2VXZA 3OYGA 4MO7A 1V3FA 3I0TA 1ORKA 3CLOA 3H92A 3F23A 5KAIC 2PFBA 3BP8A 1RZ4A 2KRHA 2TCTA 2XV4S 4W1UA 1W5SA 3Q9SA 3M1CA 5H6RA 5FD6A 1SMYF 4IL6C 1XGSA 2L4AA 3DXJF 5E3LA 3LSMA 2HXIA 4HNVA 1XS9A 5ERIA 1X3UA 3HOYJ 2DQRA 3ZR8X 3DLAA 2KZVA 2WB1N 2Z9OA 4GRIA 2IGNA 5J8FA 2PMZN 3VYUB 2WY7Q 4HQEA 3IUOA 1XGOA 4I7HA 2LRDA 3TO9A 1UCRA 1HCRA 3FKJA 4FETA 1U5TC 1W7PD 2PX9A 4LLGF
chains in the Genus database with same CATH topology
2ZCWA 4IHSA 3WTTC 2PN6A 1D3YA 1BIAA 1YW9A 1Z6RA 2VBXA 4ETSA 2HR3A 1YO5C 1JXSA 4FT8A 3E6DA 2DPDA 1LJ9A 3MAJA 2GZWA 4FHTA 1IXSB 3WTUC 2L3DA 1IN6A 4GCVA 1V4RA 4KICA 2VC1A 1R5HA 2H27A 2LNBA 4BQAA 4U7BA 1R22A 3SXYA 2O8XA 3M8EA 2IJLA 1HSJA 5JI6A 2VBZA 5ILVA 3CTAA 2M30A 3IKVA 2OQGA 1U6GA 3CO7C 4D0PA 2ZBKA 1B59A 2YSRA 3J7AO 5E20A 4KA4A 4A6EA 2OZUA 4IRIA 1UB9A 3E6MA 1YTYA 2WC2A 2HTSA 3M7GA 4H0EA 1H9TA 3JSPA 1Z9CA 2RNJA 1OMIA 1F4KA 4BXUA 2MLKA 4L5JA 4ZYDA 4Q47A 3SHFA 3U1DA 5BS6A 2A3SA 1SFEA 4AIHA 3GLXA 4Y13A 2F5FA 2MH2A 4YFKF 3ZMUA 2H6BA 1R1TA 5KK1A 2IP2A 3CO6C 3FXQA 4I0BA 5CVJA 3JTHA 2COMA 2CW0F 2A6EF 1GXQA 2QLZA 1Z05A 2PBIA 2A6HF 3P9IA 1QNTA 5K5QA 2F5CA 4RGSA 2DBBA 2VT2A 3GZ6A 4ZYHA 4Z2YA 1QQIA 2Z5UA 3HOSA 3IRRA 5HS9A 4UNOA 4LG0A 2DQLA 5AONA 1BC7C 5LBQA 3WTXC 2AS5F 2GWRA 1MD0A 1F5TA 1ULYA 1I1SA 3BPXA 1WI9A 2YR2A 2K27A 5FFZA 4YFXF 1JHHA 1LDDA 2GA2A 4LB6B 3RPQA 3E5XA 4A6DA 4XLPF 4KFCA 2RGVA 4ENJA 2DLLA 4I2OA 2X4HA 3NQOA 5JFRA 3R0JA 2P6SA 3OV8A 3ZMTA 5FO5A 1VTNC 2FNPA 2WTEA 3HTSB 3KP7A 2KJBA 1SAXA 3ROUA 4HX8A 4RAYA 5BPDA 5FLXZ 3IWFA 5AIPA 4HAMA 2PMHA 1QO0D 2DI3A 1P4WA 2E7WA 1AWCA 1U5TA 4G9YA 3EQLF 2HWVA 2R7FA 3FMRA 2XKPA 2PG4A 2HS5A 4HLXA 2P5VA 1DPUA 4BYYA 3KZZA 1XDSA 5DD8A 1FBSA 3BDDA 2CGPA 1K6OA 2PJPA 2L4MA 3DPLC 4PZJA 2K86A 1XGMA 4HA8A 1OYWA 1BC8C 3BWGA 4EM0B 2XHKA 2QENA 2MBFA 4A0ZA 3VB2A 3GW2A 1YYVA 3J80K 3GZ5A 2XAJA 1K7AA 3ECHA 4OMZA 4IF4A 3MCZA 3F6OA 4GXOA 1J5YA 1DDNA 1ZRCA 5DUIA 3CUQC 4L9NA 2UWMA 4RB2C 2RQPA 3V8LA 3GEZA 2EK5A 4HBLA 4XRFA 2NAZA 3V7RA 2RC4A 2ZXJA 3IHUA 4BNCA 4IHTA 2W24A 4AIKA 4HF0A 4LGWA 1IW7F 1YQAA 1QGPA 5E8IA 1JE8A 3V7SA 4DQ2A 3L00A 1O3QA 3IWZA 3WG9A 4WK8F 1BI0A 4R79A 4U88A 4ENKA 3N97A 4MEXF 4RB3C 2NS0A 5JHUA 5CVIA 3ZMVA 1KU7A 3GUDA 1B4AA 4LMYA 4G7OF 1LVAA 3FXRA 1F9NA 4A12A 2MD5A 4KMUX 1IN8A 3F3XA 1KU3A 3M9AA 2ZMEB 5ILSA 4I98B 4MTDA 1IRFA 1ZRFA 4B09A 5J8CA 1FYMA 4LLLA 1R1UA 5HDNA 1HKQA 2UXXA 3F8FA 2MC3A 5F6FA 2ZKZA 3I71A 4G6QA 3BJ6A 5D5UB 2P4WA 2G7UA 1P4XA 3I59A 2ISYA 3BJOA 3COAC 5LHGA 2H09A 5E17F 2M1BA 3FMSA 4EVIA 3CJNA 3QPTA 3G3ZA 5DYMA 3VOEA 2LF7A 4BH9A 4YIIA 4YFNF 4BHCA 4U0VA 3M1EA 2JSCA 5HLIA 1O3SA 1HW1A 4G6DA 4R1HA 4CO8A 5ICCA 1HBXG 3DQVC 3BY6A 1ZYRF 3ELKA 1W7PB 4MHGA 2HYGD 4QLCU 4EMSA 1L3LA 3T5XA 3RKWA 2D45A 4L9TA 2VOOA 2XGXA 1USSA 2V1UA 4AIJA 1TQIA 4AD9A 1SD6A 5HDGA 5ILUA 4UHTA 5CLSA 2O6GE 2XAQA 3HYIA 4KIBA 3WU1B 4P9UA 1EH8A 5JVTA 3ZN1A 1T39A 5LGTA 4M9XA 2QM3A 4HX4A 5H6QA 1D8JA 1RNLA 2K4JA 4ESFA 5HOOA 1MDMA 4HV5A 1G4DA 1GVJA 4OIPF 4R8HA 5CYVA 2XASA 4G7ZF 1QZZA 2F2EA 2OQRA 2OU2A 2VE8A 2GIVA 3K1NA 4EJUA 3WTZA 1XMKA 1K79A 2NRAC 1R5GA 4HF1A 1U8RA 4UXNA 3CUQA 2KKOA 3LAJA 1T38A 3KLNA 5TJJA 1GHCA 1EV7A 2ZJ2A 1ON2A 3ULQB 3E97A 3RYPA 3QU6A 2XAHA 1HW5A 3ZPLA 3IL2A 3FZVA 3PFIA 2DFIA 3ISPA 3KETA 3O2PE 4S05A 4P55A 4O6JA 2OBPA 5LHHA 1ZG3A 4HOBA 2EA4A 3WTVC 4BHBA 1KQ0A 1OPCA 2FXAA 4EM1A 3REOA 2EFOA 3FM3A 3TDZC 4MQVA 4RB0A 3RI4A 1BI3A 5BQTA 3VFZA 2BYVE 3HRTA 3SZPA 2KJCA 1WQ2A 2E7XA 2VBWA 2O3FA 4BHPA 2PI0A 5D4RA 1S8NA 4P5OA 5CJ9A 4BAYA 3LSTA 1FBUA 4LD5A 5K5RA 1TTYA 2LSOA 4UUVA 2RVCA 3V7CA 4AWXB 3NEUA 1U78A 4HYEA 4GGGA 1XSXA 1YLFA 1OKRA 4LLNA 4DNCA 3C7JA 1RI7A 4CGZA 5CVRA 3JW4A 5LRRA 4EV0A 3JAMZ 2Q2EA 2HZTA 1FC3A 4U0WA 4L0YB 2F5DA 4PGGA 1RUOA 3B02A 4A2UA 3ZP5A 3GVAA 1YFHA 2FU4A 1EH6A 2GA1A 3T0YA 4L5IA 4LG0B 2EFQA 5FGMA 1O3TA 2Y0MA 1MJBA 2Y75A 5HDKA 2QBYA 1Y0UA 2DW4A 1STZA 1RUNA 5HLGA 3TOAA 3ABUA 3C3WA 5JR3A 2K7LA 5ICFA 2BV6A 4U0YA 2D1HA 4A0YA 5D4SA 3QRFF 4P96A 2ETHA 2QUFA 2WWYA 1J7KA 3FM5A 2KIMA 2GXBA 4N0BA 5FLXK 3GO5A 4EGYA 3RKYA 2OD5A 4FX0A 1GXPA 1MJ9A 2V1DA 3KZYA 4TV7A 3KP5A 4HV6A 4M74A 2RV8A 3KE2A 3KP4A 3TGNA 3RKXA 4ZH4F 5LHIA 4LJZF 4ZYEA 1Z6TA 3E3VA 3HRUA 2CSOA 1S3JA 5F1RA 2Z99A 2ISZA 4HDUA 1I6XA 1ZREA 1KA8A 2EA2A 2J5PA 3TKYA 5DCMA 5IT3A 3LAPA 5LGNA 4OIRF 1YIOA 3BPVA 2Q8KA 3F21A 2DTRA 2ZNZA 3OOPA 5DUKA 2C6YA 2MA3A 1LDJA 2P5LC 4XSZF 3I53A 2W84A 3ML6A 3G73A 2A07F 3HHHA 2EJRA 2LKPA 3TQNA 2FA5A 2P8TA 5HVQC 5FD5A 1B6AA 3HTUA 5ED4A 1XMAA 1HW2A 4M6YA 1WKMA 3F8CA 3EYIA 1J0RA 4XSXF 4Q4ZF 3RJPA 4MGRA 3EDPA 1ZLKA 2HGCA 4HW0A 4GYGA 1P92A 1Z7UA 1FY7A 1G6NA 5D5VB 3HSEA 3WTWC 4N9HA 1KU2A 3SQNA 4OIQF 1FWZA 1BOAA 2V79A 2W25A 3U2RA 5L3BA 1BM9A 2M87A 1SD4A 3MZHA 5J6XA 4OIOF 1R23A 1O7LA 5BMZA 1P6RA 2FBHA 3WE3A 1T98A 3KEQA 1G3TA 1SFXA 2O03A 2XIGA 1DP7P 1BI1A 3NRVA 4Y15A 1IRGA 1R7JA 2HYFA 1UFMA 2DO7A 2L01A 3I59B 4MEYF 3K69A 1UHWA 3R6SA 2FRHA 2DU9A 2VE9A 4WWCA 1R1VA 2EV0A 3FX3A 4KN4X 3BROA 2AXLA 3BOQA 3I58A 3R0AA 1E2XA 3HSFA 2HFHA 2VOPA 2IRFG 2P7CB 1FSHA 1MKMA 4KUMA 4IPAA 3WE2A 3DEUA 2EWNA 3J81Z 2VONA 2CYYA 4ZZDA 4B8XA 5D5XB 1FYKA 5BPIA 1LEBA 5HS7A 4KT5C 1JGSA 4HZFA 4EJWA 1AOYA 2O61A 1FP1D 2M45A 3WODF 3QU3A 2Q0OA 1TQPA 2V9VA 3K0LA 2BGCA 1REPC 3N4MA 4WXCA 2CWEA 3I5UA 1XD7A 1SMTA 1XB4A 4IXAA 3TO6A 2P5KA 4ENMA 2KIUA 1UHMA 2RDPA 1IXCA 1S29A 1XCBA 5D6FA 5CVVA 1TW2A 3ZMSA 2QVOA 3EETA 2EV6A 2V6CA 2M8EA 4Y17A 1PUEE 5E1ZB 2HQRA 1BBYA 4RAZA 4JQFA 4PCQA 5FFXA 2L54A 5HS8A 1MDMB 2LF8A 1HXDA 4KN7X 1CF7A 2H94A 2WV0A 1O3RA 4ESJA 3M8FA 2VC0A 3GWZA 1FBQA 1I1GA 2GQQA 3E5QA 1LDKB 3T1BA 5BOXA 4M72A 4CICA 3F22A 4RB1A 5L3DA 1ZGJA 2P7VB 3CUOA 3QP6A 4LK0F 4G8XA 2KRFA 1G3YA 2NNNA 2DT5A 3SZTA 5KVRA 4I02A 1K78A 2H6CA 3IKTA 2ZMEA 4HDVA 3ZN0A 3PQJA 1PP7U 4G94A 2FOKA 4K2EA 2XKOA 2STTA 2FE3A 3EUHA 3W6JB 1C0WA 2XROA 3SFZA 1KYWA 1WWXA 3KP6A 4MQ9F 4O5VA 2BEOA 1PP8F 1WSUA 3CDHA 3MFKA 4XLNF 3U9GA 5E1WA 2R7DA 1IZ1A 3P7NA 3F8MA 4EGZA 4M71A 2D1VA 3O3KA 3V8KA 1SFUA 3LA3A 3ERED 3F8NA 3IRQA 1ZN2A 5E8GA 4L0ZB 1JHFA 3QAHA 4LFUA 1J9IA 1OR7A 1KQ8A 4KDPA 4PDKA 3L09A 2O0YA 3WGGA 2ADUA 1HKTA 2BBYA 1W7PA 2PLYA 5D6EA 2BE5F 4M9SA 3JAMK 2FNAA 2HQNA 2XUBA 4G7HF 2CO5A 3L2CA 5DV5A 1RIOH 4HF2A 3GFIA 2QQBA 1FT9A 1ONVA 3E6BA 3WGHA 4NQWA 2QQ9A 3FF5A 5LLQA 1OYIA 2XRNA 1L0OC 4EJVA 1T0FA 1EH7A 1BJAA 1SD5A 1IAWA 3C18A 1XSVA 1Z91A 2Z33A 5K1YA 4UV9A 2QBYB 4Q48A 1XSDA 3KLOA 2A69F 2FBKA 3ZMZA 1W5TA 2PMUA 1Z1DA 3TOBA 3E6CC 1S7OA 3RYRA 1FOKA 4ESBA 5FB2A 1LQ1A 2JTVA 3MQ0A 4JK1X 5L3FA 2MLGA 1BI2A 4O3MA 4MNUA 2HKOA 5AIQA 1YW8A 4IRGA 1LB2A 2A68F 2XAFA 2HTJA 3WGIA 3GXOA 4HX7A 3EYYA 1HKSA 1FP2A 4ON0A 3ZQ7A 1YS7A 2NYXA 3PQKA 4E70A 2G9WA 1TNTA 4IJAA 1ODDA 2R3SA 1DPRA 4OINF 5ICGA 4L18B 4YIFA 1IN4A 2HEOA 1E17A 2FBIA 4ZYGA 3D5LA 1J59A 2OA4A 1LEAA 4I0AA 2W85A 1TLHB 5DCMB 4UV8A 4A0XA 1I27A 1G3WA 1R36A 2IW5A 3DFGA 2DPUA 2JZYA 2E1CA 2HOEA 3LA7A 4S04A 3ABTA 2OAZA 1P4AA 3HRSA 1TQMA 2HKXA 4KIGA 2VODA 3R61A 4CHUA 3RIRA 2M5WA 5F64A 1TW3A 1KYZA 4U7DA 4HLYA 2RKHA 3R60A 3K1PA 1USTA 5DEQA 1XGNA 3HSRA 3KCCA 2FSWA 2JPCA 3WTYC 3P9CA 3HIFA 1U5TB 4I01A 2Y48A 4Q5SF 3B73A 5D8KB 1D5VA 1TBXA 1SD7A 3AAFA 4CXFA 3V8JA 2A5YB 1YW7A 2GAUA 4RGXA 4M9ZA 3KFWX 3DPTA 2ESNA 4L9JA 2FQ3A 1BIBA 3KP2A 2QQAA 2LDUA 4GYIA 3MEXA 1B9NA 1FZPB 1KU9A 3T8TA 4RGUA 5D8LB 1CGPA 2QYOA 3RPUA 5ICEA 3JSOA 2ESHA 3GYHX 3I54A 2K02A 3FWEA 2CG4A 2FEZA 1IN5A 3LWFA 4F7ZA 3GF2A 1ZHFA 4M73A 1P2FA 2W57A 3S2WA 3TDUC 1ZAOA 3TO7A 4XBFA 2VN2A 5D5WB 3GFJA 3MZYA 2B0LA 4EM2A 3HHGA 3FHZA 2VBYA 2F5EA 1MJAA 5A2QK 4WX9A 3F72A 5L3EA 4JBAA 4EQQA 1I5ZA 3J81K 2UXNA 1YS6A 3P9KA 1BN5A 3GFLA 2TDXA 1PDNC 3LQRA 3KP3A 2L02A 4OU0A 3HOTA 4EJTA 4L9VA 1B1BA 4UVCA 1ZGAA 4CYDA 5TRDA 1YG2A 3F6VA 1QPMA 1O7FA 1TNSA 1S7AA 1MGTA 6PAXA 2IA0A 1H9GA 1QZYA 5L3GA 1D8KA 3BJAA 3RDIA 1F1ZA 2OZ6A 3LA2A 4RS8A 4I09A 1FLIA 5EEGA 2EFNA 1MZBA 2CQKA 1U2WA 3H3UA 5H20A 2D2WA 3K2ZA 1J75A 2XAGA 5LRSA 1B9MA 5A2QZ 4A5NA 3C1DA 2EV5A 2EB7A 2PEXA 4KYWA 1IUYA 2MH9A 2YX4A 4EJOA 2V1XA 4NHJA 3VEPA 4A5MA 1CF7B 1NHAA 3Q5FA 3I64A 3RTRA 4IVNA 2UZKA 1ZH5A 1XN7A 4GO1A 1O57A 1R58A 4P9FA 2IPQX 3V4GA 2GXGA 5DD4A 2DAOA 1QBJA 2JRTA 2IA1A 1OYYA 3KEOA 5LEKA 4MTEA 3O6BB 2ACJA 1KGSA 4ENNA 3FMQA 3LFKA 4YG2F 1T2KA 1K78B 1HQCA 2FMLA 3QP5A 1FYLA 5DDGA 3W6KB 4OOIA 2EFWA 3K1MA 5EEHA 4RGRA 1ZARA 3J80Z 4FX4A 4LB5A 1XDUA 2X0LA 4M6XA 2RN7A 2E1NA 1ON1A 4N9IA 3IC7A 2CFXA 2K4BA 2ZO4A 2IT0A 2YPRA 1HSTA 4AVPA 3D0SA 3R4KA 2JPBA 3H3ZA 2ELHA 5E18F 3FXUA 3DF8A 2J5OA 2ZNYA 2DK5A 3MWMA 2STWA 1IN7A 4KMFA 4WF2A 1XCVA 5L3CA 2QWWA 3QOPA 2ZFWA 1FX7A 1H0MA 1FSEA 3ECOA 2PQ8A 3CUQB 1R00A 2YX7A 2A61A 4CZZA 3L7WA 3E5UA 3WU0A 3DV8A 2YU3A 1FNNA 1J2XA 2VT3A 2NNYA 5CVUA 2FMYA 2DK8A 4ZZLA 3DKWA 5LEJA 1LNWA 2QZ8A 5IT9K 2Z3YA 3F8BA 5K5OA 3T8RA 1T6SA 5LGUA 2G7HA 4LK1F 1IF1A 3JTGA 3GFMA 2FF4A 3VODA 1FPQA 4ASNA 3ZMDA 2P6TA 4IRHA 3LQQA 3HRMA 3Q9VA 4WCGA 1S6LA 1WRJA 4HQMA 4WXDA 2XVCA 1A04A 1ZG1A 4OMYA 1ZRDA 3I4PA 3BZ6A 4CDGA 1IXRC 4UVBA 5HLHA 3GX4X 5DCFA 2EFPA 4UVAA 1W4MA 2IA2A 3QPHA 4NB5A 4PGHA 2HDCA 3K9TA 1U3EM 3L9FA 3DP7A 5E1XA 1DUXC 2IVMA 3HUGA 1KQ9A 1ZLJA 4QWQA 4WXHA 1Q1HA 2JT1A 2KIFA 4KNYA 1ZG5A 3WTSC 4KIFA 5IT9Z 1G3SA 2VXZA 1V3FA 3I0TA 3CLOA 3H92A 3F23A 2PFBA 3BP8A 1RZ4A 2XV4S 1W5SA 3Q9SA 5H6RA 5FD6A 1SMYF 1XGSA 2L4AA 3DXJF 5ERIA 1X3UA 2DQRA 2Z9OA 5J8FA 4HQEA 1XGOA 4I7HA 3TO9A 1UCRA 1U5TC 1W7PD 4LLGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCW A;  4IHS A;  3WTT C;  2PN6 A;  1D3Y A;  1BIA A;  1YW9 A;  1Z6R A;  2VBX A;  4ETS A;  2HR3 A;  1YO5 C;  1JXS A;  4FT8 A;  3E6D A;  2DPD A;  1LJ9 A;  3MAJ A;  2GZW A;  4FHT A;  1IXS B;  3WTU C;  2L3D A;  1IN6 A;  4GCV A;  1V4R A;  4KIC A;  2VC1 A;  1R5H A;  2H27 A;  2LNB A;  4BQA A;  4U7B A;  1R22 A;  3SXY A;  2O8X A;  3M8E A;  2IJL A;  1HSJ A;  5JI6 A;  2VBZ A;  5ILV A;  3CTA A;  2M30 A;  3IKV A;  2OQG A;  1U6G A;  3CO7 C;  4D0P A;  2ZBK A;  1B59 A;  2YSR A;  3J7A O;  5E20 A;  4KA4 A;  4A6E A;  2OZU A;  4IRI A;  1UB9 A;  3E6M A;  1YTY A;  2WC2 A;  2HTS A;  3M7G A;  4H0E A;  1H9T A;  3JSP A;  1Z9C A;  2RNJ A;  1OMI A;  1F4K A;  4BXU A;  2MLK A;  4L5J A;  4ZYD A;  4Q47 A;  3SHF A;  3U1D A;  5BS6 A;  2A3S A;  1SFE A;  4AIH A;  3GLX A;  4Y13 A;  2F5F A;  2MH2 A;  4YFK F;  3ZMU A;  2H6B A;  1R1T A;  5KK1 A;  2IP2 A;  3CO6 C;  3FXQ A;  4I0B A;  5CVJ A;  3JTH A;  2COM A;  2CW0 F;  2A6E F;  1GXQ A;  2QLZ A;  1Z05 A;  2PBI A;  2A6H F;  3P9I A;  1QNT A;  5K5Q A;  2F5C A;  4RGS A;  2DBB A;  2VT2 A;  3GZ6 A;  4ZYH A;  4Z2Y A;  1QQI A;  2Z5U A;  3HOS A;  3IRR A;  5HS9 A;  4UNO A;  4LG0 A;  2DQL A;  5AON A;  1BC7 C;  5LBQ A;  3WTX C;  2AS5 F;  2GWR A;  1MD0 A;  1F5T A;  1ULY A;  1I1S A;  3BPX A;  1WI9 A;  2YR2 A;  2K27 A;  5FFZ A;  4YFX F;  1JHH A;  1LDD A;  2GA2 A;  4LB6 B;  3RPQ A;  3E5X A;  4A6D A;  4XLP F;  4KFC A;  2RGV A;  4ENJ A;  2DLL A;  4I2O A;  2X4H A;  3NQO A;  5JFR A;  3R0J A;  2P6S A;  3OV8 A;  3ZMT A;  5FO5 A;  1VTN C;  2FNP A;  2WTE A;  3HTS B;  3KP7 A;  2KJB A;  1SAX A;  3ROU A;  4HX8 A;  4RAY A;  5BPD A;  5FLX Z;  3IWF A;  5AIP A;  4HAM A;  2PMH A;  1QO0 D;  2DI3 A;  1P4W A;  2E7W A;  1AWC A;  1U5T A;  4G9Y A;  3EQL F;  2HWV A;  2R7F A;  3FMR A;  2XKP A;  2PG4 A;  2HS5 A;  4HLX A;  2P5V A;  1DPU A;  4BYY A;  3KZZ A;  1XDS A;  5DD8 A;  1FBS A;  3BDD A;  2CGP A;  1K6O A;  2PJP A;  2L4M A;  3DPL C;  4PZJ A;  2K86 A;  1XGM A;  4HA8 A;  1OYW A;  1BC8 C;  3BWG A;  4EM0 B;  2XHK A;  2QEN A;  2MBF A;  4A0Z A;  3VB2 A;  3GW2 A;  1YYV A;  3J80 K;  3GZ5 A;  2XAJ A;  1K7A A;  3ECH A;  4OMZ A;  4IF4 A;  3MCZ A;  3F6O A;  4GXO A;  1J5Y A;  1DDN A;  1ZRC A;  5DUI A;  3CUQ C;  4L9N A;  2UWM A;  4RB2 C;  2RQP A;  3V8L A;  3GEZ A;  2EK5 A;  4HBL A;  4XRF A;  2NAZ A;  3V7R A;  2RC4 A;  2ZXJ A;  3IHU A;  4BNC A;  4IHT A;  2W24 A;  4AIK A;  4HF0 A;  4LGW A;  1IW7 F;  1YQA A;  1QGP A;  5E8I A;  1JE8 A;  3V7S A;  4DQ2 A;  3L00 A;  1O3Q A;  3IWZ A;  3WG9 A;  4WK8 F;  1BI0 A;  4R79 A;  4U88 A;  4ENK A;  3N97 A;  4MEX F;  4RB3 C;  2NS0 A;  5JHU A;  5CVI A;  3ZMV A;  1KU7 A;  3GUD A;  1B4A A;  4LMY A;  4G7O F;  1LVA A;  3FXR A;  1F9N A;  4A12 A;  2MD5 A;  4KMU X;  1IN8 A;  3F3X A;  1KU3 A;  3M9A A;  2ZME B;  5ILS A;  4I98 B;  4MTD A;  1IRF A;  1ZRF A;  4B09 A;  5J8C A;  1FYM A;  4LLL A;  1R1U A;  5HDN A;  1HKQ A;  2UXX A;  3F8F A;  2MC3 A;  5F6F A;  2ZKZ A;  3I71 A;  4G6Q A;  3BJ6 A;  5D5U B;  2P4W A;  2G7U A;  1P4X A;  3I59 A;  2ISY A;  3BJO A;  3COA C;  5LHG A;  2H09 A;  5E17 F;  2M1B A;  3FMS A;  4EVI A;  3CJN A;  3QPT A;  3G3Z A;  5DYM A;  3VOE A;  2LF7 A;  4BH9 A;  4YII A;  4YFN F;  4BHC A;  4U0V A;  3M1E A;  2JSC A;  5HLI A;  1O3S A;  1HW1 A;  4G6D A;  4R1H A;  4CO8 A;  5ICC A;  1HBX G;  3DQV C;  3BY6 A;  1ZYR F;  3ELK A;  1W7P B;  4MHG A;  2HYG D;  4QLC U;  4EMS A;  1L3L A;  3T5X A;  3RKW A;  2D45 A;  4L9T A;  2VOO A;  2XGX A;  1USS A;  2V1U A;  4AIJ A;  1TQI A;  4AD9 A;  1SD6 A;  5HDG A;  5ILU A;  4UHT A;  5CLS A;  2O6G E;  2XAQ A;  3HYI A;  4KIB A;  3WU1 B;  4P9U A;  1EH8 A;  5JVT A;  3ZN1 A;  1T39 A;  5LGT A;  4M9X A;  2QM3 A;  4HX4 A;  5H6Q A;  1D8J A;  1RNL A;  2K4J A;  4ESF A;  5HOO A;  1MDM A;  4HV5 A;  1G4D A;  1GVJ A;  4OIP F;  4R8H A;  5CYV A;  2XAS A;  4G7Z F;  1QZZ A;  2F2E A;  2OQR A;  2OU2 A;  2VE8 A;  2GIV A;  3K1N A;  4EJU A;  3WTZ A;  1XMK A;  1K79 A;  2NRA C;  1R5G A;  4HF1 A;  1U8R A;  4UXN A;  3CUQ A;  2KKO A;  3LAJ A;  1T38 A;  3KLN A;  5TJJ A;  1GHC A;  1EV7 A;  2ZJ2 A;  1ON2 A;  3ULQ B;  3E97 A;  3RYP A;  3QU6 A;  2XAH A;  1HW5 A;  3ZPL A;  3IL2 A;  3FZV A;  3PFI A;  2DFI A;  3ISP A;  3KET A;  3O2P E;  4S05 A;  4P55 A;  4O6J A;  2OBP A;  5LHH A;  1ZG3 A;  4HOB A;  2EA4 A;  3WTV C;  4BHB A;  1KQ0 A;  1OPC A;  2FXA A;  4EM1 A;  3REO A;  2EFO A;  3FM3 A;  3TDZ C;  4MQV A;  4RB0 A;  3RI4 A;  1BI3 A;  5BQT A;  3VFZ A;  2BYV E;  3HRT A;  3SZP A;  2KJC A;  1WQ2 A;  2E7X A;  2VBW A;  2O3F A;  4BHP A;  2PI0 A;  5D4R A;  1S8N A;  4P5O A;  5CJ9 A;  4BAY A;  3LST A;  1FBU A;  4LD5 A;  5K5R A;  1TTY A;  2LSO A;  4UUV A;  2RVC A;  3V7C A;  4AWX B;  3NEU A;  1U78 A;  4HYE A;  4GGG A;  1XSX A;  1YLF A;  1OKR A;  4LLN A;  4DNC A;  3C7J A;  1RI7 A;  4CGZ A;  5CVR A;  3JW4 A;  5LRR A;  4EV0 A;  3JAM Z;  2Q2E A;  2HZT A;  1FC3 A;  4U0W A;  4L0Y B;  2F5D A;  4PGG A;  1RUO A;  3B02 A;  4A2U A;  3ZP5 A;  3GVA A;  1YFH A;  2FU4 A;  1EH6 A;  2GA1 A;  3T0Y A;  4L5I A;  4LG0 B;  2EFQ A;  5FGM A;  1O3T A;  2Y0M A;  1MJB A;  2Y75 A;  5HDK A;  2QBY A;  1Y0U A;  2DW4 A;  1STZ A;  1RUN A;  5HLG A;  3TOA A;  3ABU A;  3C3W A;  5JR3 A;  2K7L A;  5ICF A;  2BV6 A;  4U0Y A;  2D1H A;  4A0Y A;  5D4S A;  3QRF F;  4P96 A;  2ETH A;  2QUF A;  2WWY A;  1J7K A;  3FM5 A;  2KIM A;  2GXB A;  4N0B A;  5FLX K;  3GO5 A;  4EGY A;  3RKY A;  2OD5 A;  4FX0 A;  1GXP A;  1MJ9 A;  2V1D A;  3KZY A;  4TV7 A;  3KP5 A;  4HV6 A;  4M74 A;  2RV8 A;  3KE2 A;  3KP4 A;  3TGN A;  3RKX A;  4ZH4 F;  5LHI A;  4LJZ F;  4ZYE A;  1Z6T A;  3E3V A;  3HRU A;  2CSO A;  1S3J A;  5F1R A;  2Z99 A;  2ISZ A;  4HDU A;  1I6X A;  1ZRE A;  1KA8 A;  2EA2 A;  2J5P A;  3TKY A;  5DCM A;  5IT3 A;  3LAP A;  5LGN A;  4OIR F;  1YIO A;  3BPV A;  2Q8K A;  3F21 A;  2DTR A;  2ZNZ A;  3OOP A;  5DUK A;  2C6Y A;  2MA3 A;  1LDJ A;  2P5L C;  4XSZ F;  3I53 A;  2W84 A;  3ML6 A;  3G73 A;  2A07 F;  3HHH A;  2EJR A;  2LKP A;  3TQN A;  2FA5 A;  2P8T A;  5HVQ C;  5FD5 A;  1B6A A;  3HTU A;  5ED4 A;  1XMA A;  1HW2 A;  4M6Y A;  1WKM A;  3F8C A;  3EYI A;  1J0R A;  4XSX F;  4Q4Z F;  3RJP A;  4MGR A;  3EDP A;  1ZLK A;  2HGC A;  4HW0 A;  4GYG A;  1P92 A;  1Z7U A;  1FY7 A;  1G6N A;  5D5V B;  3HSE A;  3WTW C;  4N9H A;  1KU2 A;  3SQN A;  4OIQ F;  1FWZ A;  1BOA A;  2V79 A;  2W25 A;  3U2R A;  5L3B A;  1BM9 A;  2M87 A;  1SD4 A;  3MZH A;  5J6X A;  4OIO F;  1R23 A;  1O7L A;  5BMZ A;  1P6R A;  2FBH A;  3WE3 A;  1T98 A;  3KEQ A;  1G3T A;  1SFX A;  2O03 A;  2XIG A;  1DP7 P;  1BI1 A;  3NRV A;  4Y15 A;  1IRG A;  1R7J A;  2HYF A;  1UFM A;  2DO7 A;  2L01 A;  3I59 B;  4MEY F;  3K69 A;  1UHW A;  3R6S A;  2FRH A;  2DU9 A;  2VE9 A;  4WWC A;  1R1V A;  2EV0 A;  3FX3 A;  4KN4 X;  3BRO A;  2AXL A;  3BOQ A;  3I58 A;  3R0A A;  1E2X A;  3HSF A;  2HFH A;  2VOP A;  2IRF G;  2P7C B;  1FSH A;  1MKM A;  4KUM A;  4IPA A;  3WE2 A;  3DEU A;  2EWN A;  3J81 Z;  2VON A;  2CYY A;  4ZZD A;  4B8X A;  5D5X B;  1FYK A;  5BPI A;  1LEB A;  5HS7 A;  4KT5 C;  1JGS A;  4HZF A;  4EJW A;  1AOY A;  2O61 A;  1FP1 D;  2M45 A;  3WOD F;  3QU3 A;  2Q0O A;  1TQP A;  2V9V A;  3K0L A;  2BGC A;  1REP C;  3N4M A;  4WXC A;  2CWE A;  3I5U A;  1XD7 A;  1SMT A;  1XB4 A;  4IXA A;  3TO6 A;  2P5K A;  4ENM A;  2KIU A;  1UHM A;  2RDP A;  1IXC A;  1S29 A;  1XCB A;  5D6F A;  5CVV A;  1TW2 A;  3ZMS A;  2QVO A;  3EET A;  2EV6 A;  2V6C A;  2M8E A;  4Y17 A;  1PUE E;  5E1Z B;  2HQR A;  1BBY A;  4RAZ A;  4JQF A;  4PCQ A;  5FFX A;  2L54 A;  5HS8 A;  1MDM B;  2LF8 A;  1HXD A;  4KN7 X;  1CF7 A;  2H94 A;  2WV0 A;  1O3R A;  4ESJ A;  3M8F A;  2VC0 A;  3GWZ A;  1FBQ A;  1I1G A;  2GQQ A;  3E5Q A;  1LDK B;  3T1B A;  5BOX A;  4M72 A;  4CIC A;  3F22 A;  4RB1 A;  5L3D A;  1ZGJ A;  2P7V B;  3CUO A;  3QP6 A;  4LK0 F;  4G8X A;  2KRF A;  1G3Y A;  2NNN A;  2DT5 A;  3SZT A;  5KVR A;  4I02 A;  1K78 A;  2H6C A;  3IKT A;  2ZME A;  4HDV A;  3ZN0 A;  3PQJ A;  1PP7 U;  4G94 A;  2FOK A;  4K2E A;  2XKO A;  2STT A;  2FE3 A;  3EUH A;  3W6J B;  1C0W A;  2XRO A;  3SFZ A;  1KYW A;  1WWX A;  3KP6 A;  4MQ9 F;  4O5V A;  2BEO A;  1PP8 F;  1WSU A;  3CDH A;  3MFK A;  4XLN F;  3U9G A;  5E1W A;  2R7D A;  1IZ1 A;  3P7N A;  3F8M A;  4EGZ A;  4M71 A;  2D1V A;  3O3K A;  3V8K A;  1SFU A;  3LA3 A;  3ERE D;  3F8N A;  3IRQ A;  1ZN2 A;  5E8G A;  4L0Z B;  1JHF A;  3QAH A;  4LFU A;  1J9I A;  1OR7 A;  1KQ8 A;  4KDP A;  4PDK A;  3L09 A;  2O0Y A;  3WGG A;  2ADU A;  1HKT A;  2BBY A;  1W7P A;  2PLY A;  5D6E A;  2BE5 F;  4M9S A;  3JAM K;  2FNA A;  2HQN A;  2XUB A;  4G7H F;  2CO5 A;  3L2C A;  5DV5 A;  1RIO H;  4HF2 A;  3GFI A;  2QQB A;  1FT9 A;  1ONV A;  3E6B A;  3WGH A;  4NQW A;  2QQ9 A;  3FF5 A;  5LLQ A;  1OYI A;  2XRN A;  1L0O C;  4EJV A;  1T0F A;  1EH7 A;  1BJA A;  1SD5 A;  1IAW A;  3C18 A;  1XSV A;  1Z91 A;  2Z33 A;  5K1Y A;  4UV9 A;  2QBY B;  4Q48 A;  1XSD A;  3KLO A;  2A69 F;  2FBK A;  3ZMZ A;  1W5T A;  2PMU A;  1Z1D A;  3TOB A;  3E6C C;  1S7O A;  3RYR A;  1FOK A;  4ESB A;  5FB2 A;  1LQ1 A;  2JTV A;  3MQ0 A;  4JK1 X;  5L3F A;  2MLG A;  1BI2 A;  4O3M A;  4MNU A;  2HKO A;  5AIQ A;  1YW8 A;  4IRG A;  1LB2 A;  2A68 F;  2XAF A;  2HTJ A;  3WGI A;  3GXO A;  4HX7 A;  3EYY A;  1HKS A;  1FP2 A;  4ON0 A;  3ZQ7 A;  1YS7 A;  2NYX A;  3PQK A;  4E70 A;  2G9W A;  1TNT A;  4IJA A;  1ODD A;  2R3S A;  1DPR A;  4OIN F;  5ICG A;  4L18 B;  4YIF A;  1IN4 A;  2HEO A;  1E17 A;  2FBI A;  4ZYG A;  3D5L A;  1J59 A;  2OA4 A;  1LEA A;  4I0A A;  2W85 A;  1TLH B;  5DCM B;  4UV8 A;  4A0X A;  1I27 A;  1G3W A;  1R36 A;  2IW5 A;  3DFG A;  2DPU A;  2JZY A;  2E1C A;  2HOE A;  3LA7 A;  4S04 A;  3ABT A;  2OAZ A;  1P4A A;  3HRS A;  1TQM A;  2HKX A;  4KIG A;  2VOD A;  3R61 A;  4CHU A;  3RIR A;  2M5W A;  5F64 A;  1TW3 A;  1KYZ A;  4U7D A;  4HLY A;  2RKH A;  3R60 A;  3K1P A;  1UST A;  5DEQ A;  1XGN A;  3HSR A;  3KCC A;  2FSW A;  2JPC A;  3WTY C;  3P9C A;  3HIF A;  1U5T B;  4I01 A;  2Y48 A;  4Q5S F;  3B73 A;  5D8K B;  1D5V A;  1TBX A;  1SD7 A;  3AAF A;  4CXF A;  3V8J A;  2A5Y B;  1YW7 A;  2GAU A;  4RGX A;  4M9Z A;  3KFW X;  3DPT A;  2ESN A;  4L9J A;  2FQ3 A;  1BIB A;  3KP2 A;  2QQA A;  2LDU A;  4GYI A;  3MEX A;  1B9N A;  1FZP B;  1KU9 A;  3T8T A;  4RGU A;  5D8L B;  1CGP A;  2QYO A;  3RPU A;  5ICE A;  3JSO A;  2ESH A;  3GYH X;  3I54 A;  2K02 A;  3FWE A;  2CG4 A;  2FEZ A;  1IN5 A;  3LWF A;  4F7Z A;  3GF2 A;  1ZHF A;  4M73 A;  1P2F A;  2W57 A;  3S2W A;  3TDU C;  1ZAO A;  3TO7 A;  4XBF A;  2VN2 A;  5D5W B;  3GFJ A;  3MZY A;  2B0L A;  4EM2 A;  3HHG A;  3FHZ A;  2VBY A;  2F5E A;  1MJA A;  5A2Q K;  4WX9 A;  3F72 A;  5L3E A;  4JBA A;  4EQQ A;  1I5Z A;  3J81 K;  2UXN A;  1YS6 A;  3P9K A;  1BN5 A;  3GFL A;  2TDX A;  1PDN C;  3LQR A;  3KP3 A;  2L02 A;  4OU0 A;  3HOT A;  4EJT A;  4L9V A;  1B1B A;  4UVC A;  1ZGA A;  4CYD A;  5TRD A;  1YG2 A;  3F6V A;  1QPM A;  1O7F A;  1TNS A;  1S7A A;  1MGT A;  6PAX A;  2IA0 A;  1H9G A;  1QZY A;  5L3G A;  1D8K A;  3BJA A;  3RDI A;  1F1Z A;  2OZ6 A;  3LA2 A;  4RS8 A;  4I09 A;  1FLI A;  5EEG A;  2EFN A;  1MZB A;  2CQK A;  1U2W A;  3H3U A;  5H20 A;  2D2W A;  3K2Z A;  1J75 A;  2XAG A;  5LRS A;  1B9M A;  5A2Q Z;  4A5N A;  3C1D A;  2EV5 A;  2EB7 A;  2PEX A;  4KYW A;  1IUY A;  2MH9 A;  2YX4 A;  4EJO A;  2V1X A;  4NHJ A;  3VEP A;  4A5M A;  1CF7 B;  1NHA A;  3Q5F A;  3I64 A;  3RTR A;  4IVN A;  2UZK A;  1ZH5 A;  1XN7 A;  4GO1 A;  1O57 A;  1R58 A;  4P9F A;  2IPQ X;  3V4G A;  2GXG A;  5DD4 A;  2DAO A;  1QBJ A;  2JRT A;  2IA1 A;  1OYY A;  3KEO A;  5LEK A;  4MTE A;  3O6B B;  2ACJ A;  1KGS A;  4ENN A;  3FMQ A;  3LFK A;  4YG2 F;  1T2K A;  1K78 B;  1HQC A;  2FML A;  3QP5 A;  1FYL A;  5DDG A;  3W6K B;  4OOI A;  2EFW A;  3K1M A;  5EEH A;  4RGR A;  1ZAR A;  3J80 Z;  4FX4 A;  4LB5 A;  1XDU A;  2X0L A;  4M6X A;  2RN7 A;  2E1N A;  1ON1 A;  4N9I A;  3IC7 A;  2CFX A;  2K4B A;  2ZO4 A;  2IT0 A;  2YPR A;  1HST A;  4AVP A;  3D0S A;  3R4K A;  2JPB A;  3H3Z A;  2ELH A;  5E18 F;  3FXU A;  3DF8 A;  2J5O A;  2ZNY A;  2DK5 A;  3MWM A;  2STW A;  1IN7 A;  4KMF A;  4WF2 A;  1XCV A;  5L3C A;  2QWW A;  3QOP A;  2ZFW A;  1FX7 A;  1H0M A;  1FSE A;  3ECO A;  2PQ8 A;  3CUQ B;  1R00 A;  2YX7 A;  2A61 A;  4CZZ A;  3L7W A;  3E5U A;  3WU0 A;  3DV8 A;  2YU3 A;  1FNN A;  1J2X A;  2VT3 A;  2NNY A;  5CVU A;  2FMY A;  2DK8 A;  4ZZL A;  3DKW A;  5LEJ A;  1LNW A;  2QZ8 A;  5IT9 K;  2Z3Y A;  3F8B A;  5K5O A;  3T8R A;  1T6S A;  5LGU A;  2G7H A;  4LK1 F;  1IF1 A;  3JTG A;  3GFM A;  2FF4 A;  3VOD A;  1FPQ A;  4ASN A;  3ZMD A;  2P6T A;  4IRH A;  3LQQ A;  3HRM A;  3Q9V A;  4WCG A;  1S6L A;  1WRJ A;  4HQM A;  4WXD A;  2XVC A;  1A04 A;  1ZG1 A;  4OMY A;  1ZRD A;  3I4P A;  3BZ6 A;  4CDG A;  1IXR C;  4UVB A;  5HLH A;  3GX4 X;  5DCF A;  2EFP A;  4UVA A;  1W4M A;  2IA2 A;  3QPH A;  4NB5 A;  4PGH A;  2HDC A;  3K9T A;  1U3E M;  3L9F A;  3DP7 A;  5E1X A;  1DUX C;  2IVM A;  3HUG A;  1KQ9 A;  1ZLJ A;  4QWQ A;  4WXH A;  1Q1H A;  2JT1 A;  2KIF A;  4KNY A;  1ZG5 A;  3WTS C;  4KIF A;  5IT9 Z;  1G3S A;  2VXZ A;  1V3F A;  3I0T A;  3CLO A;  3H92 A;  3F23 A;  2PFB A;  3BP8 A;  1RZ4 A;  2XV4 S;  1W5S A;  3Q9S A;  5H6R A;  5FD6 A;  1SMY F;  1XGS A;  2L4A A;  3DXJ F;  5ERI A;  1X3U A;  2DQR A;  2Z9O A;  5J8F A;  4HQE A;  1XGO A;  4I7H A;  3TO9 A;  1UCR A;  1U5T C;  1W7P D;  4LLG F; 
#chains in the Genus database with same CATH topology
 3MKY B;  3L2Q A;  2ZCW A;  1R6R A;  4IHS A;  3WTT C;  2PN6 A;  1D3Y A;  2K3P A;  1BIA A;  1DU0 A;  1YW9 A;  3K4L A;  1Z6R A;  2VBX A;  3QYF A;  4ETS A;  2HR3 A;  1YO5 C;  1JXS A;  4FT8 A;  3S1R J;  4DOZ A;  2E35 A;  1U0J A;  3E6D A;  2DPD A;  1LJ9 A;  3PO3 J;  1UAA A;  2ZJP F;  3MAJ A;  1SVL A;  2GZW A;  1D5Y A;  4FHT A;  1IXS B;  2CW8 A;  4X6A J;  2COB A;  3WTU C;  3B6C A;  4V19 K;  2L3D A;  5IYD J;  4G6T B;  4FTH A;  3HGG A;  1IN6 A;  1UJ8 A;  4XRM A;  4GCV A;  1OLT A;  1V4R A;  3A03 A;  1JKO C;  3TW7 A;  4KIC A;  4RLF A;  2VC1 A;  2DYS H;  1R5H A;  2H27 A;  1Z3X A;  2CJJ A;  2LNB A;  4BQA A;  1ETQ A;  4U7B A;  1R22 A;  2VPR A;  3MKL A;  3SXY A;  1ITY A;  2O8X A;  2R5Z B;  3M8E A;  2IJL A;  2ZXW H;  2NVU B;  4AYB A;  1HSJ A;  5JI6 A;  2VBZ A;  3PUF A;  5ILV A;  3CTA A;  1I6H J;  2M30 A;  3CF5 F;  2LKS A;  3IKV A;  2OQG A;  3B6A A;  1U6G A;  2EQR A;  3CO7 C;  5IP9 J;  4D0P A;  2ZBK A;  1B59 A;  2YSR A;  5EZH A;  4IX7 A;  1GUU A;  2ZSI B;  3J7A O;  5E20 A;  4KA4 A;  2GM4 A;  4A6E A;  2OZU A;  2MZ4 A;  4C30 A;  4IRI A;  1UB9 A;  3E6M A;  1YTY A;  2WC2 A;  2HTS A;  3M7G A;  2M3A A;  5JHF A;  5FKM A;  5K7F A;  4H0E A;  3BTI A;  1H9T A;  3JSP A;  1SVO A;  3ZQI A;  3HZJ A;  3H3V K;  1SVM A;  3Q0W A;  1Z9C A;  2RNJ A;  1OMI A;  1F4K A;  4BXU A;  1NG6 A;  1E0E A;  2MLK A;  4L5J A;  4ZYD A;  1LVK A;  2GIZ A;  4Q47 A;  1OFC X;  1MNM C;  3QPS A;  3SHF A;  3U1D A;  5BS6 A;  5JLW A;  4J01 A;  2A3S A;  1SFE A;  4AIH A;  2R7U A;  3GLX A;  1OQY A;  2F5F A;  4Y13 A;  2E34 A;  2MH2 A;  2ZXH A;  4YFK F;  3DKX A;  3ZMU A;  2H6B A;  3DEW A;  1R1T A;  2XRL A;  1T33 A;  1D0Z A;  5KK1 A;  2IP2 A;  3CO6 C;  2ZFU A;  3ESW B;  3FXQ A;  4I0B A;  5CVJ A;  3LSH A;  3JTH A;  3AKZ A;  2COM A;  4LOC A;  2WAD A;  3SDG A;  2CW0 F;  2HU9 A;  2A6E F;  3S3N A;  1GXQ A;  2QLZ A;  4E7S A;  1Z05 A;  2PBI A;  1CQT A;  2A6H F;  3P9I A;  3HKZ A;  1D1A A;  1QNT A;  2CFO A;  1JJ6 C;  5K5Q A;  1XG1 A;  2F5C A;  5GP9 A;  4RBO A;  1QA6 A;  4RGS A;  2DBB A;  1X3Z B;  2FQ4 A;  1JUM A;  2VT2 A;  3GZ6 A;  4II2 A;  4KT6 A;  5EGO B;  3BTL A;  5E3O A;  3LNQ A;  4ZYH A;  4Z2Y A;  2OTJ I;  2F4I A;  1PJR A;  1QQI A;  4CA0 A;  2FOW A;  2Z5U A;  3HOS A;  3DEE A;  3IRR A;  5HS9 A;  4UNO A;  2CH0 A;  4LG0 A;  1PUF B;  2DQL A;  5AON A;  3ONQ A;  1NTC A;  1BC7 C;  4OWR B;  5LBQ A;  4JYK A;  5GAG J;  2JRM A;  3WTX C;  2AS5 F;  2GWR A;  4JP0 A;  1MD0 A;  1F5T A;  1ULY A;  1OCC H;  1I1S A;  3BPX A;  1WI9 A;  2YR2 A;  3DU5 A;  1TWF J;  2ZSH B;  2K27 A;  3IH2 A;  5FFZ A;  3CCE I;  3ZGK A;  1ZK8 A;  3IH3 A;  2CV0 A;  4W97 A;  4YFX F;  3FBI B;  2JA5 J;  2RRE A;  1JHH A;  3EUA A;  2HPM A;  1LDD A;  2GA2 A;  4LB6 B;  3RPQ A;  3E5X A;  2M0C A;  4A6D A;  4XLP F;  4KFC A;  2RGV A;  4ENJ A;  2NVT J;  4BJ6 C;  4PSW A;  2R92 J;  2DLL A;  2H1K A;  4PJM A;  3K70 D;  2O8K A;  4I2O A;  3CMM A;  2X4H A;  3NQO A;  2L7F P;  5JFR A;  3R0J A;  2P6S A;  2R7Z J;  3OV8 A;  1LUJ B;  1VQ7 I;  2BXY A;  3H0D A;  3ZMT A;  5FO5 A;  2A5W A;  5EF6 A;  1VTN C;  2YU9 J;  1ETY A;  2FNP A;  2WTE A;  3HTS B;  1AA7 A;  3KP7 A;  2KJB A;  1SAX A;  2VKE A;  3ROU A;  4HX8 A;  4RAY A;  5BPD A;  2X6W A;  5FLX Z;  4BJ5 C;  3IWF A;  1Y1W J;  5AIP A;  4HAM A;  2PMH A;  2E36 A;  1QO0 D;  2KQR A;  4BS9 A;  2DI3 A;  4XM3 A;  1V5G A;  1P4W A;  3ZOB A;  1BR4 A;  2E7W A;  2KDO A;  2VB6 A;  2DJI A;  5IOY A;  1AWC A;  1K6Y A;  1U5T A;  3S14 J;  1JKR C;  4G9Y A;  3EQL F;  2HWV A;  3G1M A;  3BR0 A;  2R7F A;  5CQG A;  2ME6 A;  3FMR A;  1YX5 A;  2XKP A;  2PG4 A;  2IS2 A;  2HS5 A;  4HLX A;  2P5V A;  2O5R A;  1DPU A;  4BYY A;  3L2W A;  3KZZ A;  3ZQG A;  1XDS A;  3JRB A;  5DD8 A;  2DJN A;  3RZD J;  1FBS A;  1UZC A;  3BDD A;  5FKO A;  3S1M J;  2DOF A;  2CGP A;  1K6O A;  2JA6 J;  1ETW A;  3DTK A;  2PJP A;  2L4M A;  5IP7 J;  3DPL C;  1X58 A;  4PZJ A;  2K86 A;  1XGM A;  3W2A A;  3F0C A;  4HA8 A;  1OYW A;  3KYC B;  1BC8 C;  3OWT A;  3ZQC A;  3BWG A;  4D9J A;  4EM0 B;  2XHK A;  3K4N A;  3DLL F;  2QEN A;  3ZRG A;  2MBF A;  4A0Z A;  4A3K J;  1TWG J;  3CJQ B;  3VB2 A;  2KZG A;  1TWC J;  3TP3 A;  3GW2 A;  2ZB9 A;  1YYV A;  3J80 K;  2H8W A;  3CP8 A;  3GZ5 A;  3ZCO A;  3TBI A;  2XAJ A;  1K7A A;  4BY1 J;  3ECH A;  1Y6I A;  5M5Y J;  4OMZ A;  4E4H A;  3BR3 A;  4IHW A;  1OR7 C;  2XB5 A;  4IF4 A;  3MCZ A;  3A0B C;  3F6O A;  4GXO A;  1J5Y A;  1DDN A;  1ZRC A;  5DUI A;  3CUQ C;  3FXM A;  2L9N A;  4L9N A;  2UWM A;  2R4G A;  5GPC A;  4PFO A;  4RB2 C;  2DXI A;  1MW7 A;  2RQP A;  3OYF A;  3V8L A;  3GEZ A;  4YEL A;  2EK5 A;  3AL0 C;  3HM5 A;  4HBL A;  4XRF A;  2NAZ A;  3UKG A;  3V7R A;  2RC4 A;  2ZXJ A;  4F3Q A;  3IHU A;  4BNC A;  1TZL A;  4IHT A;  2W24 A;  2IS1 A;  1XTA A;  4ZTJ A;  4XKB A;  4AIK A;  4BAC A;  4HF0 A;  4LGW A;  2JA2 A;  1WJE A;  4NC8 A;  1FIA A;  1IW7 F;  3MMY B;  2HVS A;  1A6I A;  4E7L A;  1YQA A;  1QGP A;  1W36 C;  5E8I A;  2RAE A;  3V7S A;  4DQ2 A;  3L00 A;  1JE8 A;  1O3Q A;  1WJC A;  2R7R A;  3S3O A;  3IWZ A;  4Y4R A;  3WG9 A;  1V5F A;  4UUT A;  5M3M J;  4WK8 F;  1BI0 A;  4R79 A;  3OYK A;  2E5N A;  3VSL A;  4DZJ A;  1UMQ A;  3ASN H;  4U88 A;  5IOZ A;  4ENK A;  3N97 A;  3WG7 H;  2JJ7 A;  4MEX F;  4A3F J;  4RB3 C;  1MMD A;  2NS0 A;  5JHU A;  3PM1 A;  3D1N I;  3NAU A;  5CVI A;  3ZMV A;  1KU7 A;  1YX3 A;  3GUD A;  1B4A A;  4LMY A;  4JX5 A;  4G7O F;  1LVA A;  2AHQ A;  3FXR A;  1F9N A;  4A12 A;  2BY3 A;  2R7X A;  2MD5 A;  4KMU X;  4GDF A;  1IN8 A;  1T0F C;  3F3X A;  1X19 A;  4YIR X;  1KU3 A;  3M9A A;  4DIQ A;  2ZME B;  5ILS A;  4I98 B;  4MTD A;  1IRF A;  1ZRF A;  4B09 A;  5J8C A;  4J19 A;  1FYM A;  1WCM J;  4LLL A;  1VQO I;  1R1U A;  5HDN A;  2PMZ A;  1HKQ A;  2UXX A;  3F8F A;  3ABM H;  2EZK A;  2MC3 A;  5F6F A;  1WJD A;  2CMP A;  2GOX B;  2ZKZ A;  2QCO A;  1R4M B;  3I71 A;  1GV2 A;  2L5Q A;  4G6Q A;  2W7N A;  3JRF A;  3BJ6 A;  5D5U B;  4YEJ A;  3SJM A;  2P4W A;  2G7U A;  1P4X A;  3I59 A;  4BKX A;  3DPU A;  4ZJZ A;  3GTJ J;  1FJL A;  2ISY A;  1V54 H;  3BJO A;  3DTI A;  3Q0V A;  3COA C;  3PFY A;  5LHG A;  2H09 A;  2K9N A;  5E17 F;  3SYT A;  2K40 A;  2M1B A;  3FMS A;  4EVI A;  5KCM A;  2A05 A;  1I3Q J;  2JWT A;  2VI6 A;  3CJN A;  3QPT A;  1HDP A;  4XN0 A;  3G2B A;  2VAS A;  5H2F C;  4B1R A;  1T08 B;  3G3Z A;  5DYM A;  3VOE A;  2LF7 A;  4BH9 A;  1ACI A;  1R9T J;  3CCV I;  3J7Y J;  3BR6 A;  4YII A;  4YFN F;  4BHC A;  4U0V A;  1BJZ A;  2NVQ J;  3M1E A;  1BA5 A;  2NS8 A;  2JSC A;  4F93 B;  1YI2 I;  1U9N A;  4HEA 2;  5HLI A;  2EIJ H;  1O3S A;  1XMX A;  3VYS B;  1HW1 A;  3O8H A;  2M4K A;  4G6D A;  4EAT A;  4R1H A;  4UY8 I;  3OYA A;  4CO8 A;  1V55 H;  5ICC A;  1HBX G;  3DQV C;  4FIS A;  3SDB A;  4JOM A;  2M8G X;  3BY6 A;  4ZC3 A;  2BW3 A;  4BE2 A;  2WAE A;  1ZYR F;  2DT6 A;  1W7P B;  3ELK A;  2XB0 X;  3AG4 H;  2CV1 A;  4MHG A;  3RQ4 A;  2HYG D;  2VKV A;  4BJT A;  4QLC U;  4EMS A;  4X1E A;  2XGC A;  2E5Z A;  1L3L A;  1P9Q C;  3T5X A;  4BDZ A;  1Z0X A;  3D5S C;  4B4C A;  1S7E A;  3RKW A;  3BC8 A;  4A3M J;  2VJJ A;  2D45 A;  2L7Z A;  4L9T A;  3BG6 A;  2VOO A;  2X98 A;  3FXJ A;  2XGX A;  3ABK H;  3MVP A;  4B47 A;  1USS A;  2V1U A;  4AIJ A;  1GLN A;  1TQI A;  4AD9 A;  1SD6 A;  5HDG A;  2VQH A;  4BDY A;  1RKW A;  5J3L A;  5ILU A;  4UHT A;  5CLS A;  4NNJ A;  1D0X A;  2CQQ A;  5A2Q R;  1X4O A;  2O6G E;  3CC4 I;  2X6X A;  2XAQ A;  2HVQ A;  3CCR I;  4DBQ A;  3LSP A;  2CUZ A;  3HYI A;  4KIB A;  3WU1 B;  3J81 R;  2LTP A;  3I9V 2;  2VLA A;  4P9U A;  3OIQ A;  3BG7 A;  1EH8 A;  5JVT A;  2XDV A;  3E0J B;  1VF9 A;  3ZN1 A;  1T39 A;  3K4J A;  1IDZ A;  2VKD A;  5LGT A;  4M9X A;  3K70 C;  2LP0 A;  4B3X A;  3OOU A;  2QM3 A;  4HX4 A;  5H6Q A;  1D8J A;  1RNL A;  1MH3 A;  2NOG A;  3WU2 C;  3VYT B;  1E3P A;  2K4J A;  2CQN A;  1P7I A;  4ESF A;  5HOO A;  1MDM A;  4HV5 A;  5FKK A;  1G4D A;  1GVJ A;  5M5W J;  3OYN A;  4OIP F;  4R8H A;  5CYV A;  1OCZ H;  2DYR H;  1ENH A;  2XAS A;  2IGK A;  1QZZ A;  2F2E A;  2F5V A;  4G7Z F;  2OQR A;  3J7A W;  2OU2 A;  2VE8 A;  4XR6 A;  2GIV A;  4NUB A;  3K1N A;  4M3D A;  4EJU A;  3WTZ A;  1Y0N A;  1XMK A;  1K79 A;  2NRA C;  1R5G A;  4I76 A;  1TL8 A;  3S8P A;  4C3J J;  4HF1 A;  1U8B A;  1U8R A;  3K4C A;  1UG0 A;  4UXN A;  5J4V A;  2X1E A;  3M8J A;  5J1R A;  2W1O A;  3FIW A;  3CUQ A;  4KJZ A;  1PYV A;  3JRH A;  2KKO A;  1W5C C;  3LAJ A;  3J80 R;  1T38 A;  1T56 A;  4M3B A;  2L7K A;  2LK2 A;  3KLN A;  5TJJ A;  1GHC A;  1EV7 A;  3CCL I;  1FOY A;  2EIM H;  2ZJ2 A;  1X3W B;  1ON2 A;  3ULQ B;  4XKW A;  3E97 A;  3RYP A;  3QU6 A;  5J1U A;  2XAH A;  1HW5 A;  3EUK L;  1JGG A;  5EG0 A;  4IKF A;  4XOT A;  4BE0 A;  3ZPL A;  3IL2 A;  2BY1 A;  3FZV A;  3JRE A;  1D1B A;  2BY0 A;  5C4X J;  1YE9 A;  3PFI A;  4DYR A;  2DFI A;  1A35 A;  3EPZ A;  3ISP A;  1T95 A;  3KET A;  3VSK A;  3O2P E;  4S05 A;  2R5Y B;  5F0C A;  2MW8 A;  1ETO A;  4P55 A;  3OYJ A;  4O6J A;  9ANT A;  2M7B A;  2VJI A;  2OBP A;  5LHH A;  1ZG3 A;  1WHU A;  5FKN A;  3L2U A;  4IHX A;  4HOB A;  2EA4 A;  4DYC A;  3WTV C;  4BHB A;  1F43 A;  1KQ0 A;  1OPC A;  1X4P A;  2FXA A;  1AKH A;  4BXX J;  4EM1 A;  3NWS A;  4OAZ A;  3SFI A;  3REO A;  2EFO A;  3HOW J;  3FM3 A;  3QOE A;  3TDZ C;  1FMV A;  4MQV A;  1H8A C;  4RB0 A;  3BQY A;  3CME I;  3RI4 A;  2OPT A;  2AO9 A;  1BI3 A;  5BQT A;  3VFZ A;  2BYV E;  2XPU A;  1ETK A;  3HRT A;  1XC5 A;  3SZP A;  4CCL A;  5IY5 H;  2KJC A;  1WQ2 A;  2E7X A;  1Y8Q B;  2VBW A;  2CQ7 A;  2BXZ A;  5FRO A;  1B8I A;  4IHY A;  2O3F A;  4BHP A;  2PI0 A;  2M35 A;  1TP4 A;  5D4R A;  1S8N A;  3OR2 C;  4QTR A;  2HYJ A;  4P5O A;  5CJ9 A;  5B1B H;  1B72 A;  2IS6 A;  4BAY A;  5LFA A;  3FXL A;  1DQU A;  3KYL A;  3LST A;  1FBU A;  5DM6 F;  4LD5 A;  4ZDP A;  1TTY A;  1VI0 A;  5K5R A;  2JA7 J;  2LSO A;  4UB6 C;  4UUV A;  1YRN B;  2RVC A;  4BUP A;  3V7C A;  2JSP A;  2QA4 I;  1RES A;  4AWX B;  2V6E A;  3NEU A;  1U78 A;  2LH9 A;  4GGG A;  4HYE A;  1XSX A;  3J7Z I;  1YLF A;  1OKR A;  1SEU A;  1MNE A;  4NBQ A;  3OIP A;  2K9L A;  3HOZ J;  2VJ4 A;  4LLN A;  4DNC A;  2FJ1 A;  2Y31 A;  5DTD A;  3C7J A;  3BTJ A;  1RI7 A;  2X6Y A;  3K2A A;  3MD2 A;  4ZTF A;  3GBG A;  2VQG A;  4CGZ A;  1EF4 A;  1WH7 A;  5CVR A;  1FOX A;  3JW4 A;  4P1W A;  3OYI A;  1MH4 A;  2Y0S N;  3PO2 J;  5LRR A;  4EV0 A;  1V5E A;  3JAM Z;  1LFU P;  1AU7 A;  2Q2E A;  2HZT A;  1FC3 A;  4MLO A;  4U0W A;  4L0Y B;  4X0G A;  4BQQ A;  2F5D A;  2QSH X;  2BZT A;  4PGG A;  1RUO A;  2KPM A;  4GFB A;  3B02 A;  1JKQ C;  2JN6 A;  4A2U A;  4N4O B;  3ZP5 A;  1SAN A;  2CV2 A;  2FUG 2;  3CMA I;  3CMY A;  2CUF A;  3GVA A;  2VL8 A;  4RAF A;  1YFH A;  2FU4 A;  1EH6 A;  1HF0 A;  2GA1 A;  4AC0 A;  3T0Y A;  4L5I A;  4LG0 B;  5J47 A;  2EFQ A;  5FGM A;  1O3T A;  2ELK A;  1ZGW A;  4C9Y A;  4HPQ A;  2HOA A;  2Y0M A;  5FRM A;  3H9Q A;  1MJB A;  2Y75 A;  4C3H J;  5HDK A;  2QBY A;  1Y0U A;  1WPK A;  2DW4 A;  3KZI C;  1STZ A;  4IHV A;  1RUN A;  1A31 A;  2W82 A;  5HLG A;  1YJW I;  3KPH A;  2DFH A;  3TOA A;  5EDN A;  3ABU A;  4ITV A;  1FOW A;  3C3W A;  5JR3 A;  2K7L A;  2GOM A;  2LOO A;  2W00 A;  2K3F A;  2DT7 B;  4OAY A;  5ICF A;  4MIM A;  1S9H A;  4XON A;  4RM2 A;  2BV6 A;  4U0Y A;  2D1H A;  4A0Y A;  1GT0 C;  3BQZ A;  3G71 I;  1HOM A;  5D4S A;  3QRF F;  1OJL A;  2ETH A;  4P96 A;  2QUF A;  1POG A;  3GTL J;  2WWY A;  2EIL H;  1J7K A;  2YS9 A;  4LIV A;  3JRI A;  5M3F J;  1E3H A;  4BU2 A;  3FM5 A;  3U1K A;  2KIM A;  2XSD C;  2GXB A;  3DBL B;  4N0B A;  4CCN A;  5FLX K;  5IT9 R;  3GO5 A;  4CYC B;  4EGY A;  3A1Y A;  4AUX A;  4BQN A;  4XOR A;  3RKY A;  2GXA A;  3KIO A;  1A5J A;  2OD5 A;  2CU7 A;  4FX0 A;  3IAM 2;  1GXP A;  3FK6 A;  4II3 A;  2JVG A;  2KIS A;  2LY1 A;  1MJ9 A;  2V1D A;  3S15 J;  3KZY A;  4TV7 A;  3KP5 A;  2O7O A;  1MMA A;  4A69 C;  1MBG A;  2LBF B;  4HV6 A;  5DS9 A;  4M74 A;  4E7K A;  2RV8 A;  1QVU A;  2KL4 A;  1O4X A;  4CCJ A;  3KE2 A;  2LR8 A;  3KP4 A;  3TGN A;  4HNU A;  2D5V A;  3RKX A;  4ZH4 F;  3TL4 X;  2Z1D A;  1JTX A;  2DA7 A;  2DA6 A;  5LHI A;  5FJ8 J;  4LJZ F;  4ZYE A;  3HEF A;  1Z6T A;  2R5Z A;  3E3V A;  3HRU A;  2WAQ N;  4S0H B;  2CSO A;  1K83 J;  1JTY A;  1S3J A;  2IBD A;  4YRV A;  1R71 A;  2R7T A;  5F1R A;  2Z99 A;  2ZC2 A;  1Z67 A;  2KRC A;  2ISZ A;  3ZQQ A;  4CCM A;  4KIT B;  4HDU A;  2K5C A;  1I6X A;  5EYR A;  1HDD C;  3OYC A;  2OCC H;  1ZRE A;  1VQN I;  1KA8 A;  2EA2 A;  2J5P A;  3TKY A;  5DCM A;  2R93 J;  5IT3 A;  3HJE A;  1VQ8 I;  3LAP A;  3AG2 H;  5LGN A;  3FXK A;  1MBH A;  3DBR B;  1YIO A;  3NWT A;  2KT0 A;  4OIR F;  5HNH A;  3BPV A;  2Q8K A;  2I5U A;  3F21 A;  2DTR A;  2QEX I;  2DMQ A;  2WY8 Q;  2ZNZ A;  3OOP A;  2P81 A;  2DOA A;  5DUK A;  2C6Y A;  2MA3 A;  1LDJ A;  2K9S A;  3V42 A;  2TRT A;  2P5L C;  4XSZ F;  4KIS A;  4XLA A;  1MSF C;  5J4Y A;  3I53 A;  4FAS D;  2KHM A;  2W84 A;  2DOD A;  2OUM A;  3ML6 A;  1H88 C;  3G73 A;  2A07 F;  1I3A A;  4XNF A;  4A3L J;  3HHH A;  1JI8 A;  2EJR A;  3HPG A;  2LKP A;  3TQN A;  2FA5 A;  2P8T A;  5HVQ C;  2DTZ A;  5F1J A;  5FD5 A;  1B6A A;  3HTU A;  5ED4 A;  1XMA A;  3CF2 A;  4B3A A;  3S93 A;  1HW2 A;  4M6Y A;  2OV7 A;  1WKM A;  2B63 J;  3AG1 H;  3F8C A;  3S2H J;  1QZE A;  3EYI A;  2P0W A;  2E2J J;  1J0R A;  4XSX F;  4Q4Z F;  3RJP A;  2ZME C;  3ERM A;  3L2R A;  3HL2 A;  3NAR A;  4MGR A;  1IDY A;  3TP0 A;  1HC8 A;  4C2U A;  3KYD B;  3EDP A;  2HOT A;  1ZLK A;  4MFD A;  3EUH C;  2HGC A;  4HW0 A;  2V9K A;  2XC7 A;  1JT0 A;  4C2T A;  1W0U A;  4GYG A;  4XLE A;  1P92 A;  2P0T A;  5KHD A;  4A3D J;  1Z7U A;  5C3E J;  1FY7 A;  1G6N A;  1QHH D;  3A02 A;  3HSE A;  5D5V B;  1APL C;  2M7A A;  1DU6 A;  3WTW C;  1SAU A;  4N9H A;  1KU2 A;  2VIX A;  1WVR A;  2XGD A;  2DOE A;  4IOC F;  3SQN A;  4OIQ F;  1FWZ A;  1BOA A;  2DA3 A;  2V79 A;  2W25 A;  3U2R A;  2A6T A;  5L3B A;  3OYM A;  3IH4 A;  3WHC A;  5F04 A;  5IYC J;  1BM9 A;  2M87 A;  2R7Q A;  1K61 A;  1SD4 A;  1D1C A;  2AXT C;  3MZ8 A;  3MZH A;  5J6X A;  2W48 A;  1N77 A;  4I99 C;  4XMY A;  4OIO F;  1R23 A;  2Z16 A;  4ZYA A;  3RPU D;  1O7L A;  1DGR M;  1WJB A;  4BBR J;  2E19 A;  5BMZ A;  1P6R A;  2MC4 A;  2FBH A;  3WE3 A;  2L9S A;  2X1D A;  1T98 A;  3KEQ A;  4Y3O A;  3G4S I;  1LE8 B;  1G3T A;  1SFX A;  2O03 A;  2HZD A;  2XIG A;  1DP7 P;  1BI1 A;  1ETX A;  3NRV A;  4Y15 A;  1IRG A;  2DA1 A;  4BXF A;  2XPV A;  3GTO J;  3W2W A;  1R7J A;  2HYF A;  1LPQ A;  1UFM A;  2DO7 A;  5CPR B;  2L01 A;  3DWL E;  3I59 B;  1N78 A;  1GV5 A;  3BG5 A;  4MEY F;  3K69 A;  2VPL A;  1UHW A;  2EH3 A;  3HC7 A;  3R6S A;  4I6Z A;  2FRH A;  4AM3 A;  2CUE A;  2DU9 A;  2KFD A;  2ZJQ F;  2VE9 A;  4WWC A;  1R1V A;  1IUF A;  2EV0 A;  2LLK A;  4DZP A;  1MMS A;  3FX3 A;  3K6G A;  4KN4 X;  3BRO A;  2AXL A;  1X1P A;  3BOQ A;  1JT6 A;  3I58 A;  2PJR A;  3R0A A;  3L1P A;  3AG3 H;  2WV1 A;  1E2X A;  4Y33 A;  1EKE A;  1TWH J;  3HSF A;  1X1C A;  3HB9 A;  2NVX J;  2QKM B;  3S3M A;  2HFH A;  3W6V A;  2VOP A;  5FRN A;  2QQ8 A;  1QVT A;  2IRF G;  1ZEL A;  4IQJ A;  2P7C B;  1FSH A;  3CLQ A;  1MKM A;  4KUM A;  2DMT A;  3GLL A;  4HG2 A;  1W1W E;  3IP4 B;  3ZXS A;  1LFP A;  4IPA A;  3WE2 A;  3SEQ A;  3DEU A;  2BHZ A;  2EWN A;  3J81 Z;  2VON A;  2IGO A;  2CYY A;  4JX4 A;  5HLT A;  4ZZD A;  2HXO A;  3C2G A;  4B8X A;  5D5X B;  1FYK A;  5BPI A;  1LEB A;  1KON A;  1LFB A;  5HS7 A;  4KT5 C;  3UNG C;  3H35 A;  3CJR B;  4UUS A;  3RSN A;  4BQO A;  2ID6 A;  2Y9Y A;  3K4M A;  1JGS A;  4A3B J;  4HZF A;  3GTK J;  1OIS A;  4EJW A;  5IPA A;  2HI3 A;  2QSF X;  2WB1 A;  1AOY A;  2O61 A;  1FP1 D;  5FLX R;  1TT5 B;  2E1M B;  2HNH A;  3FIS A;  2M45 A;  3WOD F;  2B9S A;  2QSG X;  1FTT A;  3QU3 A;  2Q0O A;  1TQP A;  5E3M A;  2V9V A;  3W2V A;  1K4T A;  3K0L A;  2BGC A;  1REP C;  3N4M A;  4BY7 J;  4WXC A;  4HRI A;  2CWE A;  2V9P A;  3I5U A;  2BOL A;  3QOD A;  1XD7 A;  3QWL A;  4NC6 A;  3HOX J;  2O9L A;  1SMT A;  1X1D A;  4ZDO A;  3I4M J;  1RQ6 A;  1XB4 A;  4IXA A;  3TO6 A;  2P5K A;  4ENM A;  2KIU A;  2NS7 A;  1UHM A;  1D0Y A;  2RDP A;  2B7E A;  2M4G A;  4FQG A;  3CCM I;  1IXC A;  1U9O A;  1S29 A;  4MFE A;  1XCB A;  5D6F A;  5CVV A;  1TW2 A;  3ZMS A;  2QVO A;  3EET A;  1JUS A;  2EV6 A;  3PSF A;  4IQ4 A;  2V6C A;  3GTG J;  2M8E A;  1X1A A;  2JUG A;  4Y17 A;  1PUE E;  1IRZ A;  5E1Z B;  2HQR A;  2L9R A;  3GCM A;  1BBY A;  3DU6 A;  1PVE A;  4RAZ A;  5IYB J;  4JQF A;  1G59 A;  4PCQ A;  5FFX A;  2CRG A;  2L54 A;  5HS8 A;  3WHB A;  1MDM B;  2LF8 A;  2Y0S A;  1HXD A;  4KN7 X;  1CF7 A;  2H94 A;  2WV0 A;  4ABZ A;  4G12 A;  2I10 A;  3X2Q H;  3HG9 A;  1O3R A;  4ESJ A;  1YIJ I;  3M8F A;  2VC0 A;  3GWZ A;  2MG4 A;  1FBQ A;  3FBN B;  1I1G A;  2KIQ A;  2LMD A;  2L2O A;  4DYQ A;  2GQQ A;  2X48 A;  3E5Q A;  1LDK B;  2DA5 A;  1Z3Y A;  3PIP F;  3K4K A;  3T1B A;  5BOX A;  2MUN A;  2W4S A;  4M72 A;  2NVY J;  4CIC A;  4CZC A;  3IAS 2;  3F22 A;  4RB1 A;  4AVZ A;  5L3D A;  3SZG A;  3VPR A;  4XQF A;  1ZGJ A;  1ZQ3 P;  2P7V B;  3CUO A;  3QP6 A;  3TMO A;  2KP6 A;  1NK2 P;  5F0H A;  4LK0 F;  4G8X A;  2KRF A;  1G3Y A;  2NNN A;  2DT5 A;  3SZT A;  5KVR A;  4I02 A;  1K78 A;  2H6C A;  3HUG B;  3SEZ A;  3IKT A;  2ZME A;  1BL0 A;  2Z2S B;  3ZN0 A;  4HDV A;  3MN2 A;  1YJ9 I;  3PQJ A;  1PP7 U;  2L7M P;  2FOK A;  4G94 A;  4K2E A;  5EZG A;  5GTI C;  5EG0 B;  3I3L A;  2XGE A;  4BEH A;  3A01 B;  4A3E J;  2XKO A;  2BY2 A;  2E2I J;  2STT A;  1UG2 A;  2FE3 A;  2MFZ A;  1WH5 A;  3EUH A;  4HNT A;  4M3G A;  3W6J B;  2EIK H;  1C0W A;  4FE7 A;  2XRO A;  3SFZ A;  1KYW A;  1EA3 A;  1WWX A;  2FX0 A;  4C2M J;  3KP6 A;  2JK3 A;  4MQ9 F;  1MBK A;  3CDL A;  4O5V A;  2BEO A;  2CQX A;  3BZK A;  4XLC A;  2IEK A;  4FE4 A;  1ZKG A;  2M0M A;  2DMN A;  1XX5 A;  3QQA A;  1PP8 F;  1NK3 P;  3CCQ I;  3OL3 A;  1WSU A;  3CDH A;  3M07 A;  4HSR A;  3MFK A;  4XLN F;  1WJA A;  3U9G A;  1WJ5 A;  2LY9 A;  5E1W A;  3D5R C;  2R7D A;  1IZ1 A;  3P7N A;  2H8R A;  3F8M A;  4EGZ A;  4PJJ A;  4M71 A;  2D1V A;  3O3K A;  3V8K A;  3A0H C;  3G1L A;  1SFU A;  3LA3 A;  3ERE D;  2ME0 A;  1GVD A;  3F8N A;  3HPH A;  1WZ2 A;  2XF7 A;  2LYC A;  1Z7L A;  3S32 A;  3IRQ A;  3M3Y J;  3BG9 A;  3BT9 A;  1ZN2 A;  5E8G A;  3JRD A;  1IC8 A;  4L0Z B;  1B8I B;  3GME A;  2GBY A;  5GPA A;  1JHF A;  3QAH A;  4LFU A;  1J9I A;  1OR7 A;  1KQ8 A;  5M5X J;  4C3I J;  4KDP A;  4PDK A;  2GLO A;  3L09 A;  2JUC A;  2O0Y A;  4B48 A;  3WGG A;  1IGN A;  2ADU A;  3JRA A;  1HKT A;  2BBY A;  4DJA A;  1W7P A;  1RR8 C;  2PLY A;  1MBJ A;  2UV1 A;  5D6E A;  2BE5 F;  2Y30 A;  4D7N A;  4M9S A;  5EEA A;  1YOV B;  3JAM K;  2M9H A;  3RCO A;  2FNA A;  1IJW C;  4CH7 A;  2H1L A;  3JRG A;  2HQN A;  2DDB A;  2XUB A;  1EJ9 A;  4G7H F;  5B3S H;  2CO5 A;  3L2C A;  5DV5 A;  1RIO H;  1E3O C;  4HF2 A;  3GFI A;  2QQB A;  4IO9 F;  1FT9 A;  3S17 J;  1ONV A;  3E6B A;  3QYB A;  5CQE A;  2UUZ A;  5TGT A;  1IV6 A;  3OYL A;  4XN3 A;  2HVR A;  1WFX A;  1JKP C;  3N05 A;  3WGH A;  2DDA A;  4A3J J;  3BLY A;  4NQW A;  3GTP J;  4V2F A;  2QQ9 A;  3H5N A;  1GDT A;  3FF5 A;  3BR1 A;  2VUM J;  1QHG A;  5LLQ A;  2VKH A;  1OYI A;  2HQA A;  3ZQH A;  2XRN A;  1F36 A;  1L0O C;  4EJV A;  2E60 A;  2DMP A;  2LC2 A;  1KZH A;  1T0F A;  1EH7 A;  5EJC A;  2K9M A;  1BJA A;  2BVM A;  4M3E A;  2JQ7 A;  4M3F A;  3LSR A;  1SD5 A;  1XPX A;  1IAW A;  3C18 A;  1XSV A;  1Z91 A;  4PUS A;  4PJN A;  2Z33 A;  2DFE A;  4UV9 A;  5K1Y A;  2QBY B;  4Q48 A;  5GAD J;  1MSE C;  3A52 A;  2WBM A;  1XSD A;  2EZL A;  3KLO A;  2LG4 A;  1VQ6 I;  3DBH B;  2A69 F;  2FBK A;  3E7L A;  2BVL A;  3ZMZ A;  1W5T A;  2PMU A;  1Z1D A;  2RNG A;  3TOB A;  3OL4 A;  4IOA F;  1DP3 A;  3E6C C;  1S7O A;  4QPO A;  3RYR A;  3OR1 C;  1FOK A;  2CW7 A;  4ESB A;  4XKC A;  4E7Z A;  5FB2 A;  3PNT A;  1LQ1 A;  2JTV A;  3MQ0 A;  4JK1 X;  2QF7 A;  1TT0 A;  5L3F A;  2MLG A;  1BI2 A;  1R5I D;  4CSW A;  4CUG A;  4O3M A;  3CC7 I;  2FD5 A;  1MMN A;  2I8D A;  2R7O A;  2M34 A;  3FKI J;  4MNU A;  4RMN A;  2HKO A;  2L9V A;  1ZR2 A;  2NOJ B;  4F52 A;  5AIQ A;  1YW8 A;  4IRG A;  5KNL A;  3CP2 A;  1LB2 A;  2A68 F;  3AFH A;  2XAF A;  2HTJ A;  3WGI A;  3OSF A;  3GXO A;  3FXO A;  4D5F A;  4HX7 A;  3HOU J;  2EIN H;  3EYY A;  1W36 D;  1HKS A;  2AQE A;  1FP2 A;  1VQK I;  3L2V A;  4ON0 A;  3ZQ7 A;  1YS7 A;  2NYX A;  3PQK A;  3RZO J;  2Y9Z A;  1OCP A;  4E70 A;  2G9W A;  5B1A H;  1T8I A;  1TNT A;  4IJA A;  1ODD A;  3OS1 A;  3LFU A;  3H5R A;  2R3S A;  3BG3 A;  2L0K A;  1I39 A;  5TIS C;  1DPR A;  2R5Y A;  1MBF A;  1QRY A;  3PL8 A;  2JVH A;  4OIN F;  5ICG A;  3MKZ A;  4L18 B;  2X1C A;  4YIF A;  3F9K A;  4F91 B;  3HXL A;  1IN4 A;  2X85 A;  3I4N J;  2ZXI A;  3OIO A;  2HEO A;  1E17 A;  3Q3S A;  5LD2 C;  2FBI A;  3PIO F;  4ZYG A;  3D5L A;  3I56 I;  1J59 A;  2OA4 A;  1LEA A;  4I0A A;  2K9Q A;  4A3G J;  3BR2 A;  2W85 A;  1TLH B;  5DCM B;  4UV8 A;  3U21 A;  4DW6 A;  1K4S A;  2E2H J;  4A0X A;  1I27 A;  1G3W A;  1R36 A;  1H89 C;  1FEX A;  4E7I A;  2IW5 A;  3DFG A;  2IS4 A;  4F92 B;  4F55 A;  2DPU A;  2JZY A;  2E1C A;  2CUJ A;  2HOE A;  3LA7 A;  1NG7 A;  4S04 A;  5DM7 F;  2DA4 A;  3ABT A;  2OAZ A;  3QPL A;  1P4A A;  3HRS A;  1IV8 A;  1TQM A;  4QSH A;  2V26 A;  1FMW A;  2HKX A;  4KIG A;  2VOD A;  5HNF A;  3R61 A;  1YRN A;  4CHU A;  2MD0 A;  2F4M B;  2M5W A;  3LSG A;  3RIR A;  2XF6 A;  5F64 A;  2V7F A;  1TW3 A;  2R7V A;  1KYZ A;  2NXN B;  3FK7 A;  4U7D A;  4HLY A;  2RKH A;  3R60 A;  1VQ5 I;  3K1P A;  1UST A;  3CDI A;  5DEQ A;  1XGN A;  3E1S A;  3HSR A;  3KCC A;  5B5E C;  2FSW A;  2JPC A;  1ERD A;  3WTY C;  3P9C A;  4CCK A;  1VQ4 I;  3HIF A;  3HGY A;  1U5T B;  1FIP A;  4PK4 A;  3S1Q J;  4I01 A;  1HA8 A;  2Y48 A;  2VQC A;  3UR3 C;  4Y7N J;  4Q5S F;  3B73 A;  2OTL I;  5C4J J;  3OYH A;  4NDL A;  3PNY A;  5D8K B;  1D5V A;  1OCR H;  5KAF C;  2Y2Z A;  3OS0 A;  1TBX A;  2KDZ A;  1SD7 A;  2V1N A;  3AAF A;  2HOS A;  1Y8R B;  2XPW A;  1ETV A;  4CXF A;  2F6C A;  1Y1V J;  3V8J A;  2A5Y B;  1YW7 A;  4NC7 A;  3C2B A;  2OJE D;  2LFB A;  1RPW A;  3BCA A;  2GAU A;  1WGX A;  4PJL A;  4RGX A;  4M9Z A;  2HPI A;  4RDU A;  3KFW X;  3DPT A;  2R7S A;  2ESN A;  1A36 A;  4L9J A;  2FQ3 A;  1BIB A;  3FDY A;  4XLH A;  3JRC A;  3CES A;  3PSI A;  3KP2 A;  4BGD A;  3TW6 A;  2QQA A;  3ASO H;  3JAM R;  2LDU A;  3LSJ A;  5F0F A;  4GYI A;  4Z6Y A;  3MEX A;  1UEL B;  1B9N A;  1FZP B;  2JMW A;  1KU9 A;  3T8T A;  4RGU A;  5D8L B;  1CGP A;  3CCJ I;  2QYO A;  3JCU C;  3RPU A;  2EZH A;  5ICE A;  3JSO A;  2ESH A;  3GYH X;  3H1C A;  3I54 A;  2K02 A;  3FWE A;  1N75 A;  3OYD A;  2CG4 A;  2ECB A;  1IN5 A;  2FEZ A;  3CCY A;  3LWF A;  4F7Z A;  3GF2 A;  1ZHF A;  4M73 A;  2AQF A;  1VQL I;  5JLX A;  1P2F A;  4CYC A;  2W57 A;  3K10 A;  3S2W A;  3TDU C;  1ZAO A;  3ABL H;  4XOP A;  3PJR A;  3TO7 A;  4XBF A;  2VN2 A;  5D5W B;  2HQ5 A;  3GFJ A;  3MZY A;  2VQL A;  2B0L A;  1MIJ A;  4EM2 A;  3HHG A;  4DBR A;  3FHZ A;  2VBY A;  1R49 A;  2F5E A;  1MJA A;  5A2Q K;  3M4O J;  2PJR B;  1NH3 A;  4WX9 A;  2E1M C;  3BR5 A;  3F72 A;  5L3E A;  4EEF G;  3S1N J;  4RM3 A;  4JBA A;  4BL0 B;  3KEY A;  5FLM J;  1J09 A;  5EGO A;  3GTQ J;  2LBF A;  4D1Q A;  4EQQ A;  1I5Z A;  3J81 K;  2UXN A;  1YS6 A;  3I55 I;  1PUF A;  3P9K A;  3S16 J;  1A6Q A;  1BN5 A;  3GFL A;  5E79 C;  2TDX A;  3QYE A;  5GAE J;  1PDN C;  3LQR A;  1ZTR A;  3KP3 A;  2L02 A;  4OU0 A;  3HOT A;  2OCE A;  4EJT A;  3RQI A;  2X51 A;  4L9V A;  4BBS J;  1QPI A;  1B1B A;  4UVC A;  2MVT A;  4UUS B;  4B43 A;  2M2E A;  1ZGA A;  4ANJ A;  4CYD A;  5TRD A;  3LSK A;  4E7J A;  3DKY A;  4XL9 A;  4L5E A;  2WA0 A;  1BR2 A;  4H4K C;  3H5A A;  1YG2 A;  3F6V A;  2MYS A;  1QPM A;  2E1O A;  1O7F A;  2DA2 A;  3BTC A;  4D7M A;  2RQQ A;  1TNS A;  1VQP I;  1S7A A;  4V2G A;  1MGT A;  4AYB N;  6PAX A;  2IA0 A;  1H9G A;  1QZY A;  5L3G A;  2VJ5 A;  1QU3 A;  1D8K A;  2KLO A;  1SFK A;  3BJA A;  3RDI A;  1F1Z A;  2OZ6 A;  3LA2 A;  1UHS A;  4RS8 A;  4QPQ A;  1RR7 A;  4I09 A;  5GAH J;  2VXD A;  4CCO A;  1FLI A;  5EEG A;  2IAI A;  3BCB A;  2E71 A;  2EFN A;  4RLQ A;  1MZB A;  2CQK A;  1OCO H;  4AU7 A;  3LL7 A;  1U2W A;  1BW6 A;  3H3U A;  5H20 A;  4LG3 A;  2D2W A;  3K2Z A;  3PNV A;  4LIT A;  1J75 A;  2XAG A;  5LRS A;  1B9M A;  1G2H A;  1VQM I;  5A2Q Z;  1AHD P;  4A5N A;  1RET A;  3C1D A;  2EV5 A;  2EB7 A;  4RAG A;  2PEX A;  2XAU A;  4KYW A;  1IUY A;  2MH9 A;  2YX4 A;  4EJO A;  1JJ8 C;  2V1X A;  5F27 A;  4NHJ A;  4A93 J;  3VEP A;  4A5M A;  1CF7 B;  1NHA A;  2JA8 J;  3Q5F A;  3I64 A;  2YUS A;  3Q0U A;  2DMU A;  4IVN A;  3RTR A;  4XRS A;  3OS2 A;  2UZK A;  1ZH5 A;  1XN7 A;  4GO1 A;  4XRS G;  2BW3 B;  1O57 A;  3HOV J;  1R58 A;  4XK4 A;  4P9F A;  2IPQ X;  1Y39 A;  3V4G A;  3BZC A;  2GXG A;  1RRJ A;  1S72 I;  5DD4 A;  3H0G J;  2DAO A;  3DTE A;  2LKX A;  2V4J C;  1YJN I;  4M6V A;  1YHQ I;  1QBJ A;  1VZ0 A;  2JRT A;  3CZ6 A;  2IA1 A;  1OYY A;  2DCE A;  3LMM A;  3KEO A;  5LEK A;  4IEJ A;  4MTE A;  3O6B B;  2LY2 A;  4HST A;  2ACJ A;  2ID3 A;  1KGS A;  3VDX A;  4ENN A;  1WI3 A;  2CS3 A;  3FMQ A;  3GZN B;  3HKZ N;  3LFK A;  3G6E I;  3RKQ A;  1W0T A;  3VWB A;  4YG2 F;  3K4B A;  1T2K A;  1VFC A;  2LVS A;  1K78 B;  1HQC A;  2FML A;  3LSI A;  1LE8 A;  3QP5 A;  1FYL A;  5DDG A;  5J1Y A;  3W6K B;  4OOI A;  4BEH B;  2EFW A;  3K1M A;  5EEH A;  4QIW N;  4RGR A;  1WJF A;  1ZAR A;  3J80 Z;  4FX4 A;  3P5J A;  1Z77 A;  4LB5 A;  1XDU A;  2X0L A;  2Y69 H;  4M6X A;  2RN7 A;  3IV5 A;  2E1N A;  1BOB A;  1ON1 A;  4N9I A;  1JUP A;  1I50 J;  3IC7 A;  2CFX A;  3H36 A;  2K4B A;  2ZO4 A;  4PSX A;  2IT0 A;  1IO2 A;  2YPR A;  1HST A;  3J7A Y;  2R0Q C;  3KX2 A;  4JX6 A;  1N25 A;  3OMY A;  4AVP A;  5JVG F;  3S2D J;  1X1B A;  3G1O A;  1M1E B;  3D0S A;  3CQZ J;  3R4K A;  3OYE A;  2JPB A;  3OYB A;  3H3Z A;  2ELH A;  2EBI A;  1SFO J;  2X9D A;  5E3N A;  5E18 F;  3FXU A;  3DF8 A;  2K85 A;  1BW5 A;  2J5O A;  2EZI A;  2ZNY A;  4XID A;  2DK5 A;  1VND A;  3CCS I;  3MWM A;  2WAF A;  2STW A;  1IN7 A;  1IRX A;  4KMF A;  2MAB A;  4WF2 A;  1XCV A;  5L3C A;  2QWW A;  3QOP A;  5FKL A;  2Q1Z B;  1OCT C;  1FTZ A;  2ZFW A;  3PUB A;  1FX7 A;  1H0M A;  1FSE A;  3ECO A;  4DGW B;  3H9J A;  2PQ8 A;  4PFP A;  3CUQ B;  1YIT I;  1R00 A;  2YX7 A;  1X2N A;  1Q1V A;  2A61 A;  1LKX A;  4CZZ A;  3L7W A;  3E5U A;  2OF7 A;  3WU0 A;  4RA2 A;  4UB8 C;  4N4N B;  4B44 A;  3MKW B;  3TED A;  3HBL A;  4ZDL A;  2N8G A;  3AL0 B;  3H9G A;  3DV8 A;  2LD5 A;  2YU3 A;  5GTH C;  1FNN A;  1J2X A;  4IZZ A;  2F48 A;  2VT3 A;  4J00 A;  3GTM J;  2NNY A;  5CVU A;  2IGM A;  3A4C A;  3C2H A;  2FMY A;  2DK8 A;  4ZZL A;  5IP6 A;  3DKW A;  1X2M A;  5LEJ A;  2R7W A;  1LNW A;  2QZ8 A;  4E6K G;  2EPF A;  5IT9 K;  2Z3Y A;  3F8B A;  2DN0 A;  2X6O A;  4LIU A;  5K5O A;  4NQW B;  3T8R A;  1T6S A;  3HDD A;  5LGU A;  2G7H A;  1TWA J;  3CJT B;  1AKH B;  4LK1 F;  1IF1 A;  3JTG A;  1TC3 C;  3GFM A;  2DFF A;  2FF4 A;  1FPQ A;  3VOD A;  4ASN A;  3ZMD A;  2P6T A;  4IRH A;  4AID A;  1VQ9 I;  3LQQ A;  3HRM A;  1S5L C;  4XLF A;  1Y56 A;  3Q9V A;  4E7H A;  4FCY A;  1G8X A;  5HOD A;  1ZR4 A;  4WCG A;  5FLV A;  1S6L A;  1BR1 A;  3VYR B;  1WRJ A;  2ICW G;  4HQM A;  3OSG A;  2XSJ C;  5CKT A;  3K7A J;  3CD6 I;  4WXD A;  2XVC A;  5B66 C;  4Y52 J;  1MBE A;  1B72 B;  2ZJR F;  1A04 A;  1ZG1 A;  4OMY A;  1R4N B;  2LRE A;  2MSY A;  3JR9 A;  4BE1 A;  1ZRD A;  4D5C A;  1HLV A;  3OY9 A;  3I4P A;  1RKT A;  3BZ6 A;  1IXR C;  4CDG A;  2MGQ A;  4UVB A;  5HLH A;  1RC9 A;  3GX4 X;  1IG7 A;  2BHY A;  5DCF A;  2EFP A;  2WAQ A;  5F08 A;  5J40 A;  4A3I J;  4UVA A;  1W4M A;  2HDD A;  2G0E A;  2IA2 A;  3QPH A;  4U87 A;  3FHN A;  4NB5 A;  4PGH A;  2HDC A;  2ECC A;  3K9T A;  1MMG A;  2IXS A;  1U3E M;  3L9F A;  2KMU A;  3W3C A;  3DP7 A;  5E1X A;  5K7Z A;  2ELJ A;  4A3C J;  2XF5 A;  1DUX C;  2Q2E B;  2QGU A;  3LOC A;  1Z21 A;  2IVM A;  2HDW A;  2QKL B;  1P7J A;  3CC2 I;  3CCU I;  3DCF A;  1MND A;  3HUG A;  1KQ9 A;  1DGW Y;  3O8G A;  5BNG A;  5C44 J;  3ZQL A;  2OC6 A;  1ZLJ A;  4QWQ A;  4WXH A;  1Q1H A;  4PJ0 C;  2JT1 A;  4XIC A;  3A2K A;  1SC7 A;  4XKV A;  3A01 A;  2KIF A;  3ZQF A;  5K7H A;  4KNY A;  2F4O B;  1ZG5 A;  3WTS C;  4KIF A;  5IT9 Z;  1G3S A;  2VXZ A;  3OYG A;  4MO7 A;  1V3F A;  3I0T A;  1ORK A;  3CLO A;  3H92 A;  3F23 A;  5KAI C;  2PFB A;  3BP8 A;  1RZ4 A;  2KRH A;  2TCT A;  2XV4 S;  4W1U A;  1W5S A;  3Q9S A;  3M1C A;  5H6R A;  5FD6 A;  1SMY F;  4IL6 C;  1XGS A;  2L4A A;  3DXJ F;  5E3L A;  3LSM A;  2HXI A;  4HNV A;  1XS9 A;  5ERI A;  1X3U A;  3HOY J;  2DQR A;  3ZR8 X;  3DLA A;  2KZV A;  2WB1 N;  2Z9O A;  4GRI A;  2IGN A;  5J8F A;  2PMZ N;  3VYU B;  2WY7 Q;  4HQE A;  3IUO A;  1XGO A;  4I7H A;  2LRD A;  3TO9 A;  1UCR A;  1HCR A;  3FKJ A;  4FET A;  1U5T C;  1W7P D;  2PX9 A;  4LLG F; 
#chains in the Genus database with same CATH homology
 2ZCW A;  4IHS A;  3WTT C;  2PN6 A;  1D3Y A;  1BIA A;  1YW9 A;  1Z6R A;  2VBX A;  4ETS A;  2HR3 A;  1YO5 C;  1JXS A;  4FT8 A;  3E6D A;  2DPD A;  1LJ9 A;  3MAJ A;  2GZW A;  4FHT A;  1IXS B;  3WTU C;  2L3D A;  1IN6 A;  4GCV A;  1V4R A;  4KIC A;  2VC1 A;  1R5H A;  2H27 A;  2LNB A;  4BQA A;  4U7B A;  1R22 A;  3SXY A;  2O8X A;  3M8E A;  2IJL A;  1HSJ A;  5JI6 A;  2VBZ A;  5ILV A;  3CTA A;  2M30 A;  3IKV A;  2OQG A;  1U6G A;  3CO7 C;  4D0P A;  2ZBK A;  1B59 A;  2YSR A;  3J7A O;  5E20 A;  4KA4 A;  4A6E A;  2OZU A;  4IRI A;  1UB9 A;  3E6M A;  1YTY A;  2WC2 A;  2HTS A;  3M7G A;  4H0E A;  1H9T A;  3JSP A;  1Z9C A;  2RNJ A;  1OMI A;  1F4K A;  4BXU A;  2MLK A;  4L5J A;  4ZYD A;  4Q47 A;  3SHF A;  3U1D A;  5BS6 A;  2A3S A;  1SFE A;  4AIH A;  3GLX A;  4Y13 A;  2F5F A;  2MH2 A;  4YFK F;  3ZMU A;  2H6B A;  1R1T A;  5KK1 A;  2IP2 A;  3CO6 C;  3FXQ A;  4I0B A;  5CVJ A;  3JTH A;  2COM A;  2CW0 F;  2A6E F;  1GXQ A;  2QLZ A;  1Z05 A;  2PBI A;  2A6H F;  3P9I A;  1QNT A;  5K5Q A;  2F5C A;  4RGS A;  2DBB A;  2VT2 A;  3GZ6 A;  4ZYH A;  4Z2Y A;  1QQI A;  2Z5U A;  3HOS A;  3IRR A;  5HS9 A;  4UNO A;  4LG0 A;  2DQL A;  5AON A;  1BC7 C;  5LBQ A;  3WTX C;  2AS5 F;  2GWR A;  1MD0 A;  1F5T A;  1ULY A;  1I1S A;  3BPX A;  1WI9 A;  2YR2 A;  2K27 A;  5FFZ A;  4YFX F;  1JHH A;  1LDD A;  2GA2 A;  4LB6 B;  3RPQ A;  3E5X A;  4A6D A;  4XLP F;  4KFC A;  2RGV A;  4ENJ A;  2DLL A;  4I2O A;  2X4H A;  3NQO A;  5JFR A;  3R0J A;  2P6S A;  3OV8 A;  3ZMT A;  5FO5 A;  1VTN C;  2FNP A;  2WTE A;  3HTS B;  3KP7 A;  2KJB A;  1SAX A;  3ROU A;  4HX8 A;  4RAY A;  5BPD A;  5FLX Z;  3IWF A;  5AIP A;  4HAM A;  2PMH A;  1QO0 D;  2DI3 A;  1P4W A;  2E7W A;  1AWC A;  1U5T A;  4G9Y A;  3EQL F;  2HWV A;  2R7F A;  3FMR A;  2XKP A;  2PG4 A;  2HS5 A;  4HLX A;  2P5V A;  1DPU A;  4BYY A;  3KZZ A;  1XDS A;  5DD8 A;  1FBS A;  3BDD A;  2CGP A;  1K6O A;  2PJP A;  2L4M A;  3DPL C;  4PZJ A;  2K86 A;  1XGM A;  4HA8 A;  1OYW A;  1BC8 C;  3BWG A;  4EM0 B;  2XHK A;  2QEN A;  2MBF A;  4A0Z A;  3VB2 A;  3GW2 A;  1YYV A;  3J80 K;  3GZ5 A;  2XAJ A;  1K7A A;  3ECH A;  4OMZ A;  4IF4 A;  3MCZ A;  3F6O A;  4GXO A;  1J5Y A;  1DDN A;  1ZRC A;  5DUI A;  3CUQ C;  4L9N A;  2UWM A;  4RB2 C;  2RQP A;  3V8L A;  3GEZ A;  2EK5 A;  4HBL A;  4XRF A;  2NAZ A;  3V7R A;  2RC4 A;  2ZXJ A;  3IHU A;  4BNC A;  4IHT A;  2W24 A;  4AIK A;  4HF0 A;  4LGW A;  1IW7 F;  1YQA A;  1QGP A;  5E8I A;  1JE8 A;  3V7S A;  4DQ2 A;  3L00 A;  1O3Q A;  3IWZ A;  3WG9 A;  4WK8 F;  1BI0 A;  4R79 A;  4U88 A;  4ENK A;  3N97 A;  4MEX F;  4RB3 C;  2NS0 A;  5JHU A;  5CVI A;  3ZMV A;  1KU7 A;  3GUD A;  1B4A A;  4LMY A;  4G7O F;  1LVA A;  3FXR A;  1F9N A;  4A12 A;  2MD5 A;  4KMU X;  1IN8 A;  3F3X A;  1KU3 A;  3M9A A;  2ZME B;  5ILS A;  4I98 B;  4MTD A;  1IRF A;  1ZRF A;  4B09 A;  5J8C A;  1FYM A;  4LLL A;  1R1U A;  5HDN A;  1HKQ A;  2UXX A;  3F8F A;  2MC3 A;  5F6F A;  2ZKZ A;  3I71 A;  4G6Q A;  3BJ6 A;  5D5U B;  2P4W A;  2G7U A;  1P4X A;  3I59 A;  2ISY A;  3BJO A;  3COA C;  5LHG A;  2H09 A;  5E17 F;  2M1B A;  3FMS A;  4EVI A;  3CJN A;  3QPT A;  3G3Z A;  5DYM A;  3VOE A;  2LF7 A;  4BH9 A;  4YII A;  4YFN F;  4BHC A;  4U0V A;  3M1E A;  2JSC A;  5HLI A;  1O3S A;  1HW1 A;  4G6D A;  4R1H A;  4CO8 A;  5ICC A;  1HBX G;  3DQV C;  3BY6 A;  1ZYR F;  3ELK A;  1W7P B;  4MHG A;  2HYG D;  4QLC U;  4EMS A;  1L3L A;  3T5X A;  3RKW A;  2D45 A;  4L9T A;  2VOO A;  2XGX A;  1USS A;  2V1U A;  4AIJ A;  1TQI A;  4AD9 A;  1SD6 A;  5HDG A;  5ILU A;  4UHT A;  5CLS A;  2O6G E;  2XAQ A;  3HYI A;  4KIB A;  3WU1 B;  4P9U A;  1EH8 A;  5JVT A;  3ZN1 A;  1T39 A;  5LGT A;  4M9X A;  2QM3 A;  4HX4 A;  5H6Q A;  1D8J A;  1RNL A;  2K4J A;  4ESF A;  5HOO A;  1MDM A;  4HV5 A;  1G4D A;  1GVJ A;  4OIP F;  4R8H A;  5CYV A;  2XAS A;  4G7Z F;  1QZZ A;  2F2E A;  2OQR A;  2OU2 A;  2VE8 A;  2GIV A;  3K1N A;  4EJU A;  3WTZ A;  1XMK A;  1K79 A;  2NRA C;  1R5G A;  4HF1 A;  1U8R A;  4UXN A;  3CUQ A;  2KKO A;  3LAJ A;  1T38 A;  3KLN A;  5TJJ A;  1GHC A;  1EV7 A;  2ZJ2 A;  1ON2 A;  3ULQ B;  3E97 A;  3RYP A;  3QU6 A;  2XAH A;  1HW5 A;  3ZPL A;  3IL2 A;  3FZV A;  3PFI A;  2DFI A;  3ISP A;  3KET A;  3O2P E;  4S05 A;  4P55 A;  4O6J A;  2OBP A;  5LHH A;  1ZG3 A;  4HOB A;  2EA4 A;  3WTV C;  4BHB A;  1KQ0 A;  1OPC A;  2FXA A;  4EM1 A;  3REO A;  2EFO A;  3FM3 A;  3TDZ C;  4MQV A;  4RB0 A;  3RI4 A;  1BI3 A;  5BQT A;  3VFZ A;  2BYV E;  3HRT A;  3SZP A;  2KJC A;  1WQ2 A;  2E7X A;  2VBW A;  2O3F A;  4BHP A;  2PI0 A;  5D4R A;  1S8N A;  4P5O A;  5CJ9 A;  4BAY A;  3LST A;  1FBU A;  4LD5 A;  5K5R A;  1TTY A;  2LSO A;  4UUV A;  2RVC A;  3V7C A;  4AWX B;  3NEU A;  1U78 A;  4HYE A;  4GGG A;  1XSX A;  1YLF A;  1OKR A;  4LLN A;  4DNC A;  3C7J A;  1RI7 A;  4CGZ A;  5CVR A;  3JW4 A;  5LRR A;  4EV0 A;  3JAM Z;  2Q2E A;  2HZT A;  1FC3 A;  4U0W A;  4L0Y B;  2F5D A;  4PGG A;  1RUO A;  3B02 A;  4A2U A;  3ZP5 A;  3GVA A;  1YFH A;  2FU4 A;  1EH6 A;  2GA1 A;  3T0Y A;  4L5I A;  4LG0 B;  2EFQ A;  5FGM A;  1O3T A;  2Y0M A;  1MJB A;  2Y75 A;  5HDK A;  2QBY A;  1Y0U A;  2DW4 A;  1STZ A;  1RUN A;  5HLG A;  3TOA A;  3ABU A;  3C3W A;  5JR3 A;  2K7L A;  5ICF A;  2BV6 A;  4U0Y A;  2D1H A;  4A0Y A;  5D4S A;  3QRF F;  4P96 A;  2ETH A;  2QUF A;  2WWY A;  1J7K A;  3FM5 A;  2KIM A;  2GXB A;  4N0B A;  5FLX K;  3GO5 A;  4EGY A;  3RKY A;  2OD5 A;  4FX0 A;  1GXP A;  1MJ9 A;  2V1D A;  3KZY A;  4TV7 A;  3KP5 A;  4HV6 A;  4M74 A;  2RV8 A;  3KE2 A;  3KP4 A;  3TGN A;  3RKX A;  4ZH4 F;  5LHI A;  4LJZ F;  4ZYE A;  1Z6T A;  3E3V A;  3HRU A;  2CSO A;  1S3J A;  5F1R A;  2Z99 A;  2ISZ A;  4HDU A;  1I6X A;  1ZRE A;  1KA8 A;  2EA2 A;  2J5P A;  3TKY A;  5DCM A;  5IT3 A;  3LAP A;  5LGN A;  4OIR F;  1YIO A;  3BPV A;  2Q8K A;  3F21 A;  2DTR A;  2ZNZ A;  3OOP A;  5DUK A;  2C6Y A;  2MA3 A;  1LDJ A;  2P5L C;  4XSZ F;  3I53 A;  2W84 A;  3ML6 A;  3G73 A;  2A07 F;  3HHH A;  2EJR A;  2LKP A;  3TQN A;  2FA5 A;  2P8T A;  5HVQ C;  5FD5 A;  1B6A A;  3HTU A;  5ED4 A;  1XMA A;  1HW2 A;  4M6Y A;  1WKM A;  3F8C A;  3EYI A;  1J0R A;  4XSX F;  4Q4Z F;  3RJP A;  4MGR A;  3EDP A;  1ZLK A;  2HGC A;  4HW0 A;  4GYG A;  1P92 A;  1Z7U A;  1FY7 A;  1G6N A;  5D5V B;  3HSE A;  3WTW C;  4N9H A;  1KU2 A;  3SQN A;  4OIQ F;  1FWZ A;  1BOA A;  2V79 A;  2W25 A;  3U2R A;  5L3B A;  1BM9 A;  2M87 A;  1SD4 A;  3MZH A;  5J6X A;  4OIO F;  1R23 A;  1O7L A;  5BMZ A;  1P6R A;  2FBH A;  3WE3 A;  1T98 A;  3KEQ A;  1G3T A;  1SFX A;  2O03 A;  2XIG A;  1DP7 P;  1BI1 A;  3NRV A;  4Y15 A;  1IRG A;  1R7J A;  2HYF A;  1UFM A;  2DO7 A;  2L01 A;  3I59 B;  4MEY F;  3K69 A;  1UHW A;  3R6S A;  2FRH A;  2DU9 A;  2VE9 A;  4WWC A;  1R1V A;  2EV0 A;  3FX3 A;  4KN4 X;  3BRO A;  2AXL A;  3BOQ A;  3I58 A;  3R0A A;  1E2X A;  3HSF A;  2HFH A;  2VOP A;  2IRF G;  2P7C B;  1FSH A;  1MKM A;  4KUM A;  4IPA A;  3WE2 A;  3DEU A;  2EWN A;  3J81 Z;  2VON A;  2CYY A;  4ZZD A;  4B8X A;  5D5X B;  1FYK A;  5BPI A;  1LEB A;  5HS7 A;  4KT5 C;  1JGS A;  4HZF A;  4EJW A;  1AOY A;  2O61 A;  1FP1 D;  2M45 A;  3WOD F;  3QU3 A;  2Q0O A;  1TQP A;  2V9V A;  3K0L A;  2BGC A;  1REP C;  3N4M A;  4WXC A;  2CWE A;  3I5U A;  1XD7 A;  1SMT A;  1XB4 A;  4IXA A;  3TO6 A;  2P5K A;  4ENM A;  2KIU A;  1UHM A;  2RDP A;  1IXC A;  1S29 A;  1XCB A;  5D6F A;  5CVV A;  1TW2 A;  3ZMS A;  2QVO A;  3EET A;  2EV6 A;  2V6C A;  2M8E A;  4Y17 A;  1PUE E;  5E1Z B;  2HQR A;  1BBY A;  4RAZ A;  4JQF A;  4PCQ A;  5FFX A;  2L54 A;  5HS8 A;  1MDM B;  2LF8 A;  1HXD A;  4KN7 X;  1CF7 A;  2H94 A;  2WV0 A;  1O3R A;  4ESJ A;  3M8F A;  2VC0 A;  3GWZ A;  1FBQ A;  1I1G A;  2GQQ A;  3E5Q A;  1LDK B;  3T1B A;  5BOX A;  4M72 A;  4CIC A;  3F22 A;  4RB1 A;  5L3D A;  1ZGJ A;  2P7V B;  3CUO A;  3QP6 A;  4LK0 F;  4G8X A;  2KRF A;  1G3Y A;  2NNN A;  2DT5 A;  3SZT A;  5KVR A;  4I02 A;  1K78 A;  2H6C A;  3IKT A;  2ZME A;  4HDV A;  3ZN0 A;  3PQJ A;  1PP7 U;  4G94 A;  2FOK A;  4K2E A;  2XKO A;  2STT A;  2FE3 A;  3EUH A;  3W6J B;  1C0W A;  2XRO A;  3SFZ A;  1KYW A;  1WWX A;  3KP6 A;  4MQ9 F;  4O5V A;  2BEO A;  1PP8 F;  1WSU A;  3CDH A;  3MFK A;  4XLN F;  3U9G A;  5E1W A;  2R7D A;  1IZ1 A;  3P7N A;  3F8M A;  4EGZ A;  4M71 A;  2D1V A;  3O3K A;  3V8K A;  1SFU A;  3LA3 A;  3ERE D;  3F8N A;  3IRQ A;  1ZN2 A;  5E8G A;  4L0Z B;  1JHF A;  3QAH A;  4LFU A;  1J9I A;  1OR7 A;  1KQ8 A;  4KDP A;  4PDK A;  3L09 A;  2O0Y A;  3WGG A;  2ADU A;  1HKT A;  2BBY A;  1W7P A;  2PLY A;  5D6E A;  2BE5 F;  4M9S A;  3JAM K;  2FNA A;  2HQN A;  2XUB A;  4G7H F;  2CO5 A;  3L2C A;  5DV5 A;  1RIO H;  4HF2 A;  3GFI A;  2QQB A;  1FT9 A;  1ONV A;  3E6B A;  3WGH A;  4NQW A;  2QQ9 A;  3FF5 A;  5LLQ A;  1OYI A;  2XRN A;  1L0O C;  4EJV A;  1T0F A;  1EH7 A;  1BJA A;  1SD5 A;  1IAW A;  3C18 A;  1XSV A;  1Z91 A;  2Z33 A;  5K1Y A;  4UV9 A;  2QBY B;  4Q48 A;  1XSD A;  3KLO A;  2A69 F;  2FBK A;  3ZMZ A;  1W5T A;  2PMU A;  1Z1D A;  3TOB A;  3E6C C;  1S7O A;  3RYR A;  1FOK A;  4ESB A;  5FB2 A;  1LQ1 A;  2JTV A;  3MQ0 A;  4JK1 X;  5L3F A;  2MLG A;  1BI2 A;  4O3M A;  4MNU A;  2HKO A;  5AIQ A;  1YW8 A;  4IRG A;  1LB2 A;  2A68 F;  2XAF A;  2HTJ A;  3WGI A;  3GXO A;  4HX7 A;  3EYY A;  1HKS A;  1FP2 A;  4ON0 A;  3ZQ7 A;  1YS7 A;  2NYX A;  3PQK A;  4E70 A;  2G9W A;  1TNT A;  4IJA A;  1ODD A;  2R3S A;  1DPR A;  4OIN F;  5ICG A;  4L18 B;  4YIF A;  1IN4 A;  2HEO A;  1E17 A;  2FBI A;  4ZYG A;  3D5L A;  1J59 A;  2OA4 A;  1LEA A;  4I0A A;  2W85 A;  1TLH B;  5DCM B;  4UV8 A;  4A0X A;  1I27 A;  1G3W A;  1R36 A;  2IW5 A;  3DFG A;  2DPU A;  2JZY A;  2E1C A;  2HOE A;  3LA7 A;  4S04 A;  3ABT A;  2OAZ A;  1P4A A;  3HRS A;  1TQM A;  2HKX A;  4KIG A;  2VOD A;  3R61 A;  4CHU A;  3RIR A;  2M5W A;  5F64 A;  1TW3 A;  1KYZ A;  4U7D A;  4HLY A;  2RKH A;  3R60 A;  3K1P A;  1UST A;  5DEQ A;  1XGN A;  3HSR A;  3KCC A;  2FSW A;  2JPC A;  3WTY C;  3P9C A;  3HIF A;  1U5T B;  4I01 A;  2Y48 A;  4Q5S F;  3B73 A;  5D8K B;  1D5V A;  1TBX A;  1SD7 A;  3AAF A;  4CXF A;  3V8J A;  2A5Y B;  1YW7 A;  2GAU A;  4RGX A;  4M9Z A;  3KFW X;  3DPT A;  2ESN A;  4L9J A;  2FQ3 A;  1BIB A;  3KP2 A;  2QQA A;  2LDU A;  4GYI A;  3MEX A;  1B9N A;  1FZP B;  1KU9 A;  3T8T A;  4RGU A;  5D8L B;  1CGP A;  2QYO A;  3RPU A;  5ICE A;  3JSO A;  2ESH A;  3GYH X;  3I54 A;  2K02 A;  3FWE A;  2CG4 A;  2FEZ A;  1IN5 A;  3LWF A;  4F7Z A;  3GF2 A;  1ZHF A;  4M73 A;  1P2F A;  2W57 A;  3S2W A;  3TDU C;  1ZAO A;  3TO7 A;  4XBF A;  2VN2 A;  5D5W B;  3GFJ A;  3MZY A;  2B0L A;  4EM2 A;  3HHG A;  3FHZ A;  2VBY A;  2F5E A;  1MJA A;  5A2Q K;  4WX9 A;  3F72 A;  5L3E A;  4JBA A;  4EQQ A;  1I5Z A;  3J81 K;  2UXN A;  1YS6 A;  3P9K A;  1BN5 A;  3GFL A;  2TDX A;  1PDN C;  3LQR A;  3KP3 A;  2L02 A;  4OU0 A;  3HOT A;  4EJT A;  4L9V A;  1B1B A;  4UVC A;  1ZGA A;  4CYD A;  5TRD A;  1YG2 A;  3F6V A;  1QPM A;  1O7F A;  1TNS A;  1S7A A;  1MGT A;  6PAX A;  2IA0 A;  1H9G A;  1QZY A;  5L3G A;  1D8K A;  3BJA A;  3RDI A;  1F1Z A;  2OZ6 A;  3LA2 A;  4RS8 A;  4I09 A;  1FLI A;  5EEG A;  2EFN A;  1MZB A;  2CQK A;  1U2W A;  3H3U A;  5H20 A;  2D2W A;  3K2Z A;  1J75 A;  2XAG A;  5LRS A;  1B9M A;  5A2Q Z;  4A5N A;  3C1D A;  2EV5 A;  2EB7 A;  2PEX A;  4KYW A;  1IUY A;  2MH9 A;  2YX4 A;  4EJO A;  2V1X A;  4NHJ A;  3VEP A;  4A5M A;  1CF7 B;  1NHA A;  3Q5F A;  3I64 A;  3RTR A;  4IVN A;  2UZK A;  1ZH5 A;  1XN7 A;  4GO1 A;  1O57 A;  1R58 A;  4P9F A;  2IPQ X;  3V4G A;  2GXG A;  5DD4 A;  2DAO A;  1QBJ A;  2JRT A;  2IA1 A;  1OYY A;  3KEO A;  5LEK A;  4MTE A;  3O6B B;  2ACJ A;  1KGS A;  4ENN A;  3FMQ A;  3LFK A;  4YG2 F;  1T2K A;  1K78 B;  1HQC A;  2FML A;  3QP5 A;  1FYL A;  5DDG A;  3W6K B;  4OOI A;  2EFW A;  3K1M A;  5EEH A;  4RGR A;  1ZAR A;  3J80 Z;  4FX4 A;  4LB5 A;  1XDU A;  2X0L A;  4M6X A;  2RN7 A;  2E1N A;  1ON1 A;  4N9I A;  3IC7 A;  2CFX A;  2K4B A;  2ZO4 A;  2IT0 A;  2YPR A;  1HST A;  4AVP A;  3D0S A;  3R4K A;  2JPB A;  3H3Z A;  2ELH A;  5E18 F;  3FXU A;  3DF8 A;  2J5O A;  2ZNY A;  2DK5 A;  3MWM A;  2STW A;  1IN7 A;  4KMF A;  4WF2 A;  1XCV A;  5L3C A;  2QWW A;  3QOP A;  2ZFW A;  1FX7 A;  1H0M A;  1FSE A;  3ECO A;  2PQ8 A;  3CUQ B;  1R00 A;  2YX7 A;  2A61 A;  4CZZ A;  3L7W A;  3E5U A;  3WU0 A;  3DV8 A;  2YU3 A;  1FNN A;  1J2X A;  2VT3 A;  2NNY A;  5CVU A;  2FMY A;  2DK8 A;  4ZZL A;  3DKW A;  5LEJ A;  1LNW A;  2QZ8 A;  5IT9 K;  2Z3Y A;  3F8B A;  5K5O A;  3T8R A;  1T6S A;  5LGU A;  2G7H A;  4LK1 F;  1IF1 A;  3JTG A;  3GFM A;  2FF4 A;  3VOD A;  1FPQ A;  4ASN A;  3ZMD A;  2P6T A;  4IRH A;  3LQQ A;  3HRM A;  3Q9V A;  4WCG A;  1S6L A;  1WRJ A;  4HQM A;  4WXD A;  2XVC A;  1A04 A;  1ZG1 A;  4OMY A;  1ZRD A;  3I4P A;  3BZ6 A;  4CDG A;  1IXR C;  4UVB A;  5HLH A;  3GX4 X;  5DCF A;  2EFP A;  4UVA A;  1W4M A;  2IA2 A;  3QPH A;  4NB5 A;  4PGH A;  2HDC A;  3K9T A;  1U3E M;  3L9F A;  3DP7 A;  5E1X A;  1DUX C;  2IVM A;  3HUG A;  1KQ9 A;  1ZLJ A;  4QWQ A;  4WXH A;  1Q1H A;  2JT1 A;  2KIF A;  4KNY A;  1ZG5 A;  3WTS C;  4KIF A;  5IT9 Z;  1G3S A;  2VXZ A;  1V3F A;  3I0T A;  3CLO A;  3H92 A;  3F23 A;  2PFB A;  3BP8 A;  1RZ4 A;  2XV4 S;  1W5S A;  3Q9S A;  5H6R A;  5FD6 A;  1SMY F;  1XGS A;  2L4A A;  3DXJ F;  5ERI A;  1X3U A;  2DQR A;  2Z9O A;  5J8F A;  4HQE A;  1XGO A;  4I7H A;  3TO9 A;  1UCR A;  1U5T C;  1W7P D;  4LLG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...