1DPRA

Structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
b'DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structures of the apo- and the metal ion-activated forms of the diphtheria tox repressor from Corynebacterium diphtheriae.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulation
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dprA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1dprA02
3E6DA 5LEJA 3BDDA 3M9AA 1FP1D 4EVIA 2GWRA 1RI7A 1XD7A 1LDDA 5JI6A 3DEUA 2EV6A 1TW3A 3I53A 3ELKA 2HFHA 1S8NA 5F64A 2DFIA 2BV6A 5HS9A 4HA8A 4HF2A 3ZMSA 3RKYA 3FM3A 4Y17A 2EJRA 2DPUA 1F4KA 3QOPA 3ZMVA 2EA2A 4A0YA 4U88A 3ABUA 4RGUA 1IUYA 2BYVE 3GF2A 4LD5A 3MAJA 2XHKA 1KYZA 5D8LB 1LEBA 3DPLC 4GYIA 2PQ8A 2FQ3A 3WTUC 2QBYA 3W6JB 5L3FA 2IJLA 2DI3A 2JRTA 1PP8F 1MJBA 1X3UA 5H6RA 3BY6A 4CDGA 2PBIA 2EA4A 3C3WA 5DDGA 3IHUA 2X0LA 2PMUA 1MDMA 2EB7A 3R0AA 2B0LA 2STWA 3LA2A 4JQFA 1DP7P 3C7JA 4YIIA 3EYYA 4K2EA 1YO5C 3I4PA 1WSUA 1LNWA 2LDUA 3MFKA 4LMYA 2KIUA 4A0ZA 2PJPA 4HLYA 3RPUA 5D6FA 2XROA 2DTRA 1HKQA 3DPTA 3BJAA 4HOBA 1LDKB 3I5UA 3GZ6A 1USSA 2FEZA 3F8CA 2TDXA 3JAMZ 3SHFA 2YU3A 3S2WA 4MTEA 2CO5A 3HRMA 3LQRA 4ZYHA 2ZNYA 3LA3A 2CQKA 4Y15A 4ENKA 3U2RA 1I1SA 1FBUA 4UV9A 4UVBA 4RGXA 3WTTC 3QPTA 1J9IA 3COAC 3JSOA 1KA8A 3FM5A 2FU4A 1S7AA 5CVVA 2UXNA 2CFXA 1ZHFA 3V4GA 2NAZA 2HEOA 4ZYDA 2H6BA 2L01A 4WXDA 1BBYA 3T1BA 5ILVA 1R36A 1RZ4A 4P55A 1SFEA 5KK1A 3D5LA 3GXOA 3PQKA 1XMAA 1DPUA 3U9GA 4M72A 2L4AA 2VBZA 4G7ZF 1OMIA 3F8MA 1O3QA 3K69A 5LRSA 4CZZA 2VXZA 4EJVA 4HV6A 3HTSB 2ZFWA 2DK8A 1GXPA 3U1DA 3KP4A 5K5QA 2HGCA 3TO7A 3KEQA 2GA1A 3WG9A 1I6XA 2HYGD 1R00A 1FNNA 2OA4A 5FGMA 3P9IA 2P6SA 2V1DA 3ROUA 3BPVA 2MH9A 2M45A 2ELHA 1J7KA 3V7RA 4B8XA 3FWEA 3KP5A 5BQTA 4KIFA 1HW2A 4LGWA 1ZG5A 2QM3A 5HS8A 1W7PB 5HDGA 2QBYB 2O8XA 2O3FA 3ML6A 2WV0A 2XVCA 3WE2A 4A0XA 2C6YA 4EV0A 4A2UA 4IRHA 4A6EA 3B02A 3F22A 4OIQF 4OIPF 3F8NA 3TQNA 4GGGA 4Q47A 4AIJA 3BJOA 2COMA 5CJ9A 5DD8A 2HWVA 1BJAA 1MD0A 1YIOA 2QLZA 1XGSA 1AOYA 1K7AA 6PAXA 2ZCWA 4ENNA 1DPRA 2IA2A 1YYVA 4IVNA 4PGHA 3TOBA 2KKOA 1DUXC 1FP2A 4M71A 2G7UA 4OMYA 1L0OC 4N9IA 4OIRF 2ISZA 4I09A 1Q1HA 2DQLA 5BOXA 2D45A 3IKTA 2PN6A 2V6CA 4DNCA 3CTAA 2Z99A 4S04A 4LK1F 4M74A 3CO7C 2RDPA 3IL2A 3FX3A 4I0BA 5DD4A 4CXFA 3CUQA 1FBSA 4KDPA 4Q48A 4HW0A 3SZTA 4ZYGA 4LLNA 1AWCA 2Y0MA 5F6FA 2P4WA 5A2QK 4WX9A 3WE3A 5JR3A 2IVMA 1TW2A 4U0YA 4WWCA 3ECHA 2O6GE 4M9ZA 1XSVA 5L3EA 1QZZA 4LLLA 3GX4X 4L18B 3HHHA 4FHTA 5IT9K 2FA5A 1SD6A 1V3FA 2O03A 3JTGA 3ERED 4LG0B 4L5JA 4BHPA 4BH9A 1IN8A 1FSEA 1J2XA 4UVAA 1XMKA 2H94A 4ON0A 2FSWA 3HYIA 2K4JA 2IRFG 2RVCA 4EM2A 2GAUA 3IRRA 2L54A 1B9NA 4KYWA 2W85A 2PLYA 4CO8A 4XBFA 4HX8A 2ISYA 4HDVA 1QZYA 1TTYA 2ESNA 1KQ8A 5DV5A 2ZKZA 4BQAA 1SAXA 2DLLA 1WKMA 3EETA 3F3XA 4Q5SF 1BI0A 2Z9OA 1REPC 1BI2A 2X4HA 1EH8A 4HDUA 1XDUA 5LRRA 4R8HA 1W5TA 2VC1A 2AXLA 2L02A 3C18A 1SD4A 3MEXA 1QNTA 2FBKA 1FOKA 2DAOA 3FMSA 3WTZA 5L3CA 3SQNA 5FB2A 1SD5A 1XDSA 5FFZA 1LEAA 2OZ6A 5K5RA 3FMQA 5DCFA 2JSCA 3B73A 3WTYC 4I7HA 4U0WA 4EGYA 1W5SA 3HSRA 3E6BA 1WRJA 3TDUC 2EFPA 1CGPA 4YG2F 1B6AA 2HS5A 2BBYA 2CSOA 2A5YB 3N97A 1OKRA 2D1VA 1U5TA 1OPCA 4OOIA 5KVRA 4BNCA 3F6OA 1B4AA 1ZRFA 1OR7A 3GFMA 1ZG3A 1G4DA 2RV8A 2F5DA 4ZZLA 1IN7A 3K9TA 5D4SA 3I59B 2H09A 4MQVA 3ZMUA 3WODF 4NHJA 1RIOH 4IPAA 1G6NA 1LJ9A 2CW0F 2WC2A 5DCMB 1ON2A 5FO5A 5JFRA 1KU2A 4XRFA 1XSXA 1RNLA 5E8GA 3ECOA 2IA0A 3BJ6A 1BC7C 1HW5A 2NNNA 3V7CA 2FXAA 3M8EA 5ERIA 5ILSA 4ZH4F 4FX0A 2KRFA 2A3SA 4D0PA 3HIFA 3GFJA 1H9GA 4HV5A 3IRQA 2K7LA 2JPCA 1WI9A 2FMLA 4BAYA 3KP3A 3JW4A 2HDCA 1T98A 3ZMDA 2DQRA 1IW7F 4S05A 3J81Z 3WU0A 4UVCA 1E2XA 3BP8A 4UXNA 1ZAOA 4BHBA 1YS6A 2CWEA 5DYMA 2L4MA 2P7CB 3FXUA 1T6SA 1R1TA 1TQPA 4G6DA 5ICEA 4G8XA 1Y0UA 3GYHX 4OMZA 4M6XA 2RN7A 3VODA 3HHGA 1FT9A 1KGSA 4OU0A 5LBQA 1W7PA 1D3YA 4ASNA 2O61A 4L0ZB 3TOAA 5HLGA 3JSPA 3QPHA 1YW7A 3FZVA 1USTA 2F5FA 1MZBA 4PCQA 1KQ9A 2A61A 3ZP5A 2VODA 4LB6B 2QENA 4U7BA 1L3LA 1D5VA 3RJPA 2YX7A 4P96A 1FYMA 2FE3A 5L3DA 1C0WA 1HKSA 2OQRA 2PG4A 1TQMA 2D2WA 1LVAA 1RUOA 3P9CA 4PZJA 2ZNZA 4PDKA 3KZZA 3P7NA 3VFZA 1J59A 4BYYA 5D4RA 3J80K 2RQPA 3VOEA 3L00A 3QU3A 4G94A 2VT3A 4OINF 1U6GA 5L3GA 2VONA 1IN6A 4I02A 1U5TB 1K78B 3Q9SA 1P4WA 4HZFA 2V1XA 3LSTA 1PP7U 4HAMA 5CVJA 2MBFA 5TRDA 2MA3A 1J5YA 5FFXA 3R4KA 3V7SA 3L2CA 1STZA 4F7ZA 2DPDA 4XSZF 4CICA 1ZGAA 3NRVA 5LHIA 2H6CA 5EEGA 1ZH5A 4KMFA 4I2OA 2OZUA 3Q9VA 4EMSA 1JXSA 1XSDA 2Z33A 3KP6A 3D0SA 4GO1A 4NQWA 3NQOA 4LG0A 3HOSA 5ICCA 2XAFA 4L9TA 1UB9A 4IHTA 4AIKA 1ZLJA 4A5NA 1YFHA 1ZREA 1T39A 4XLNF 1T38A 2K02A 2G9WA 3LA7A 2XAGA 2XKOA 1IN5A 2VBWA 1W7PD 4N9HA 2QQAA 1XGMA 3RTRA 2EWNA 1Z6TA 2LNBA 3VEPA 3CUQC 2HTJA 4YFNF 2MLKA 1V4RA 3LFKA 4GCVA 1GVJA 3ZPLA 4TV7A 1KQ0A 3KEOA 3RI4A 1FSHA 4E70A 4IF4A 5LGUA 2A69F 4WK8F 4H0EA 4MQ9F 2OQGA 1T2KA 3HUGA 1G3WA 2J5PA 1P4AA 1YG2A 2ZMEB 1HSJA 4WF2A 3PFIA 4YFXF 2IP2A 2R3SA 3GUDA 3LWFA 1ZGJA 3DQVC 2EFQA 4UHTA 2XV4S 5FLXZ 2RKHA 5LGNA 3E6CC 3L09A 2P8TA 1BC8C 1IN4A 3Q5FA 5ICFA 3HRTA 1F1ZA 2HZTA 3M7GA 1FYKA 3CUOA 4AD9A 4EJOA 1R5HA 1FBQA 2NNYA 2M87A 2QZ8A 2PI0A 3RDIA 2VOOA 1R1VA 2HTSA 3I59A 4RB3C 3E3VA 1BI3A 3JTHA 2VBXA 1I5ZA 2QYOA 4G7HF 1TNSA 3FF5A 3N4MA 4O6JA 5DCMA 5J8FA 4ESFA 3CLOA 1G3SA 1YW9A 3O6BB 4O5VA 1UHWA 3I71A 1U3EM 4KNYA 5LEKA 2DO7A 3ABTA 3JAMK 5HDNA 2XKPA 2P7VB 4IJAA 5JHUA 3MZYA 3EQLF 1FLIA 1G3YA 1LQ1A 4GYGA 1ZN2A 5BS6A 2Z3YA 1TNTA 4ESJA 2KIFA 2OAZA 1U5TC 1EH7A 1R23A 4EGZA 2P5VA 1UCRA 1BM9A 1S3JA 3KZYA 4A5MA 2KJBA 2LF8A 5E20A 1FYLA 3RYRA 3GVAA 2DW4A 2QWWA 3T5XA 1SFXA 2JTVA 4P9FA 3M1EA 2FNPA 1R5GA 3G3ZA 2KJCA 3F6VA 1K79A 1SMTA 2A6EF 3H3UA 1D8JA 2DBBA 3F8BA 2G7HA 2XGXA 4HX4A 2BE5F 2ZBKA 4I0AA 4FT8A 1T0FA 1KU9A 3OOPA 1TLHB 4EJWA 3HRUA 3TO9A 1QO0D 1IXRC 2OBPA 3HRSA 4ZYEA 3E5XA 5HVQC 5DEQA 1O3TA 3GFLA 3ZN0A 5K1YA 4RB1A 2O0YA 2XAJA 3QU6A 3GZ5A 4MHGA 3EDPA 3GLXA 1FPQA 3K1NA 3IWZA 4G6QA 1HBXG 1GHCA 2WTEA 1GXQA 2DK5A 1ON1A 1QQIA 4EJTA 4FX4A 1FY7A 1QBJA 3BROA 4A12A 2OU2A 3FHZA 4KUMA 3DV8A 5D5UB 3V8KA 4AWXB 2YPRA 2W84A 5LHGA 3WTVC 5E1ZB 4YFKF 3RPQA 2NS0A 2HKOA 5CVUA 2JZYA 1I1GA 2CG4A 2MD5A 2XIGA 2K4BA 4ENMA 5LHHA 4XLPF 3RKWA 1MJ9A 3I54A 4ETSA 4KIBA 1K78A 1O3SA 1B9MA 1QGPA 3RYPA 4IHSA 2GA2A 5DUKA 1FWZA 3P9KA 3VB2A 4XSXF 2HQRA 1BIBA 1U2WA 2D1HA 5ICGA 1U78A 2LF7A 3REOA 2XRNA 1E17A 1IXSB 4MNUA 4EJUA 2RGVA 1R1UA 1HXDA 4CHUA 4KA4A 3KE2A 3GO5A 2E1NA 2LKPA 3ISPA 1CF7B 4BXUA 1ZYRF 3HSFA 1BN5A 4B09A 4PGGA 1BI1A 4MTDA 2H27A 2DT5A 3I0TA 5FD6A 4IRGA 3LAJA 1B59A 1MJAA 2K86A 4MEYF 2PMHA 2F5EA 1P6RA 4MEXF 2QUFA 4L5IA 4RB0A 1R7JA 4ENJA 4AIHA 4OIOF 2HOEA 3G73A 2BEOA 2EFWA 2Q0OA 2RC4A 3OV8A 1ZRDA 2E1CA 2ETHA 3DFGA 1XCBA 4CGZA 2FNAA 2ZXJA 2KIMA 2Q8KA 3KLOA 4U7DA 1LDJA 5D5XB 4JBAA 1HSTA 2YSRA 4L9JA 3IKVA 3FXQA 3WTWC 4G7OF 3TGNA 3KCCA 2ADUA 4N0BA 3WTXC 4HF1A 1ONVA 1B1BA 2F2EA 3LQQA 4P9UA 3CJNA 2ZMEA 1O7FA 3GFIA 3EUHA 5E1WA 2E7WA 3O2PE 3CO6C 1YQAA 5D6EA 1A04A 2MH2A 5E8IA 1HQCA 5EEHA 4U0VA 5ILUA 4Q4ZF 5AIPA 2A07F 4HQMA 1JHFA 1XB4A 4KT5C 5LGTA 2Y75A 3BZ6A 2NYXA 1O57A 1OYWA 3SXYA 2XUBA 1SD7A 2VT2A 1Z05A 3L7WA 5D5WB 2L3DA 5DUIA 4KIGA 4QWQA 1Z6RA 2QQBA 4M73A 3T8RA 5A2QZ 1J0RA 2JPBA 1P92A 2W25A 2VE8A 3DXJF 4LFUA 2VOPA 2EFOA 3MZHA 5E1XA 3V8JA 2FRHA 4R79A 5IT9Z 3R61A 2J5OA 2BGCA 4RAZA 1KU3A 3K1PA 4G9YA 3I58A 2PFBA 2VN2A 1IAWA 3WTSC 5BPDA 2R7FA 1W4MA 4IXAA 3F23A 4KN4X 5K5OA 2Y48A 3EYIA 3GW2A 3GEZA 4EM0B 2VE9A 2A68F 4JK1X 1S29A 5HLHA 3WGGA 5J8CA 1HKTA 1YS7A 4RAYA 1ULYA 4M6YA 4I98B 2VBYA 3GWZA 2RNJA 1FC3A 5CYVA 2Z5UA 1ZG1A 5D5VB 1P4XA 4UNOA 1IXCA 2FF4A 3K0LA 1UFMA 4LLGF 5H6QA 3QP6A 1IRGA 2LSOA 5JVTA 3TKYA 4KMUX 2GXBA 4RGRA 2MC3A 2HR3A 3E5UA 5L3BA 3KETA 3ULQB 2XAHA 3ZMTA 3WU1B 1XGNA 1H9TA 4LJZF 2EFNA 5HLIA 1OYYA 1BIAA 2UZKA 2EK5A 3KLNA 5F1RA 2R7DA 4Y13A 4UV8A 2A6HF 1PUEE 4DQ2A 4HQEA 2EV5A 3J7AO 2E7XA 4R1HA 4M9SA 1XN7A 1WWXA 3R60A 4BHCA 3J81K 4L9NA 1H0MA 2UWMA 3H92A 5LLQA 1LB2A 2M5WA 2HKXA 1MDMB 4NB5A 2HYFA 5HS7A 2NRAC 2ZJ2A 1KYWA 3F8FA 3R6SA 2AS5F 1MKMA 1OYIA 1JE8A 1O7LA 2V1UA 1SFUA 2FMYA 2IT0A 3E5QA 4A6DA 3RKXA 4L9VA 1EV7A 4KN7X 3SFZA 4IRIA 3TO6A 2VC0A 3LAPA 1YW8A 5FD5A 2M30A 4RGSA 4YIFA 1HW1A 3O3KA 4HBLA 1TBXA 2OD5A 3W6KB 3DKWA 3E97A 2P5LC 4UUVA 2M1BA 5CVIA 1CF7A 5H20A 3KFWX 1ZLKA 1FX7A 4M9XA 2XAQA 1SMYF 1YLFA 4HF0A 1S7OA 1S6LA 4LB5A 2QQ9A 5ED4A 1F5TA 4HLXA 4WXHA 1DDNA 1O3RA 1ZARA 2PEXA 3H3ZA 2ACJA 1Z1DA 1UHMA 2DU9A 4WXCA 3C1DA 5D8KB 1R58A 3ZN1A 4Z2YA 4EM1A 4CYDA 5AIQA 1D8KA 2FOKA 3CDHA 4RS8A 4KFCA 3BPXA 1VTNC 1XGOA 4RB2C 4O3MA 3MQ0A 2V9VA 4AVPA 4HYEA 3T0YA 3R0JA 3SZPA 2ESHA 5CVRA 2JT1A 4I01A 3IWFA 5TJJA 2YR2A 3QP5A 3HTUA 2EV0A 1P2FA 1K6OA 1IZ1A 3J80Z 1JGSA 4ESBA 3NEUA 3HSEA 1ZRCA 2YX4A 4KICA 2FBHA 3KP7A 3K2ZA 1IRFA 1JHHA 2P6TA 2P5KA 4QLCU 3PQJA 2Q2EA 2ZO4A 2IW5A 2STTA 4L0YB 2CYYA 3MCZA 2CGPA 3QRFF 5IT3A 1Z7UA 2W57A 5HDKA 2GXGA 5J6XA 3QAHA 2QVOA 3L9FA 2XASA 1TQIA 4LK0F 2WWYA 1IF1A 4GXOA 2IA1A 3FMRA 5HOOA 1RUNA 1Z9CA 3DP7A 3TDZC 2HQNA 3T8TA 1WQ2A 1Z91A 2MLGA 4EQQA 1F9NA 5E17F 3E6MA 1XCVA 4ZZDA 3F21A 3WGIA 3K1MA 1R22A 1I27A 3FXRA 2V79A 5AONA 3IC7A 2IPQX 1KU7A 1FZPB 1MGTA 4HX7A 2GIVA 3MWMA 3AAFA 3V8LA 3KP2A 1NHAA 1G3TA 2GQQA 3BWGA 3RIRA 1EH6A 5E18F 3ZMZA 5FLXK 2F5CA 3BOQA 3WGHA 3F72A 2K27A 4P5OA 2GZWA 3DF8A 3HOTA 3CUQB 1YTYA 1PDNC 2M8EA 2FBIA 1QPMA 2W24A 3I64A 3M8FA 1J75A 1ODDA 4MGRA 5BMZA 3ZQ7A 4WCGA 5BPIA 5CLSA 2UXXA 1BOAA 1U8RA
chains in the Genus database with same CATH superfamily
3E6DA 1R4NB 5LEJA 3JREA 1MNDA 3BCBA 3BDDA 3M9AA 4E6KG 4AVZA 3S3OA 1FP1D 2K9QA 3A4CA 4ITVA 4EVIA 2GWRA 1VF9A 1OCRH 2GIZA 2XGCA 1RI7A 1XD7A 1LDDA 2HYJA 3QWLA 5JI6A 3DEUA 2EV6A 1TW3A 4BGDA 4BBRJ 1SAUA 4B43A 1ZKGA 3I53A 2BW3A 3HGYA 3ELKA 5KCMA 2HFHA 1S8NA 5F64A 5F0HA 2DFIA 2BV6A 5HS9A 1MMDA 4HA8A 2UUZA 4HF2A 3ZMSA 4LIVA 3RKYA 3FM3A 2R7ZJ 4Y17A 2LBFA 2EJRA 2DPUA 4DYRA 1F4KA 3QOPA 3ZMVA 2CRGA 3VYSB 4B3AA 2E1MC 2EA2A 1JKOC 4Y52J 4A0YA 1BR2A 2I8DA 4U88A 4A3BJ 3ABUA 4RGUA 2R5ZA 4Y7NJ 2WADA 4BY7J 1IUYA 2MVTA 3TW7A 2DMNA 2BYVE 3GF2A 3KYCB 1E3HA 2QSGX 4LD5A 3MAJA 3CCUI 2XHKA 2ELKA 2R7XA 1KYZA 5D8LB 3OS0A 1LEBA 4B47A 3EUAA 3DPLC 2ELJA 1F36A 4GYIA 3OS1A 2PQ8A 2FQ3A 3WTUC 2QBYA 2DA7A 3W6JB 4E7ZA 5L3FA 2IJLA 3HXLA 2CFOA 2DI3A 2JRTA 1PP8F 4V19K 4JX4A 1MJBA 1X3UA 3BTCA 2OTJI 4CA0A 3M3YJ 5H6RA 3BR3A 2KT0A 3A03A 3BY6A 1Z21A 4CDGA 3CP8A 2PBIA 3JRDA 2EA4A 3C3WA 3HKZA 5DDGA 3IHUA 2X0LA 4RDUA 2PMUA 2H1LA 1MDMA 2W00A 2EB7A 3R0AA 2B0LA 2STWA 1ZR4A 1EF4A 3LA2A 4JQFA 1DP7P 1TT5B 2MW8A 2JUGA 3C7JA 4YIIA 3JRFA 1QZEA 3EYYA 1JUSA 4K2EA 1LFPA 1YO5C 3I4PA 1WH7A 1WSUA 1LNWA 2LDUA 2MZ4A 3MFKA 3K4JA 4LMYA 2KIUA 2K40A 2W4SA 4A0ZA 2PJPA 1LFUP 4HLYA 3RPUA 4XQFA 5D6FA 2XROA 2DTRA 2MGQA 1HKQA 3DPTA 3OL3A 2DOFA 3BJAA 3AKZA 3HZJA 4HOBA 1JGGA 1LDKB 3I5UA 3GZ6A 1USSA 2FEZA 3F8CA 5KAFC 5M5WJ 2DDAA 2TDXA 3JAMZ 2Z16A 3SHFA 2YU3A 3UR3C 2ZC2A 3S2WA 4MTEA 2CO5A 3HRMA 3CDIA 3LQRA 3BQYA 4ZYHA 3TBIA 2ZNYA 3LA3A 2E5NA 3N05A 2CQKA 4Y15A 4ENKA 2VB6A 3ZXSA 3U2RA 1I1SA 1FBUA 3ABMH 1FTTA 1YITI 2F4MB 4UV9A 4UVBA 4RGXA 5FLVA 1QA6A 2HVSA 3QYFA 4IHYA 1JKQC 5EEAA 3WTTC 3LOCA 3QPTA 1J9IA 3COAC 1D0ZA 3JSOA 1KA8A 3FM5A 1K83J 4NC7A 4FE7A 4UUSA 2FU4A 1S7AA 5CVVA 2UXNA 2CFXA 1ZHFA 3V4GA 2NAZA 1UJ8A 3CQZJ 2HEOA 2H6BA 2L01A 4WXDA 4ZYDA 1BBYA 4BU2A 3T1BA 2Q1ZB 5ILVA 5FKLA 3KIOA 3S3MA 3M1CA 1R36A 3ERMA 2XC7A 1RZ4A 4P55A 3RSNA 1SFEA 5KK1A 2IEKA 3D5LA 3GXOA 3PQKA 4S0HB 1QHHD 4XLAA 4D1QA 3K70D 4V2FA 1WZ2A 1IDYA 1XMAA 3ASNH 5FRMA 1VQ6I 1DPUA 3ZQHA 4F52A 3U9GA 4M72A 2L4AA 2VBZA 3I55I 5JLXA 4G7ZF 1OMIA 1BW6A 3VSLA 3F8MA 1O3QA 3L2VA 4E7SA 1XTAA 4HG2A 3VYRB 4XKBA 3HOYJ 2F5VA 3K69A 3ESWB 5LRSA 2QKMB 2DA1A 4CZZA 5TISC 2VXZA 3A52A 5E3OA 3VWBA 2NVYJ 1PVEA 3VDXA 4BEHA 4EJVA 4HV6A 3HTSB 1MBFA 2ZFWA 2DK8A 1GXPA 3SFIA 3U1DA 3KP4A 5K5QA 3OYBA 1RKTA 2HGCA 3TO7A 2LVSA 2M0MA 3KEQA 2GA1A 3B6AA 3WG9A 4PJLA 1I6XA 2E35A 4XORA 2HYGD 1R00A 1FNNA 2K3PA 2OA4A 5FGMA 1MNMC 2EINH 3P9IA 4XN0A 2P6SA 2V1DA 3ROUA 3BPVA 2MH9A 2W1OA 4CZCA 2M45A 5EF6A 2ELHA 1J7KA 3V7RA 3MN2A 4B8XA 2I10A 3PIPF 2XF7A 2WBMA 1AA7A 4DYCA 2Y9ZA 5KAIC 3BR1A 3FWEA 1Z3XA 3CESA 3DBLB 3KP5A 1J09A 2L7MP 3HOZJ 4GDFA 5BQTA 4KIFA 1ZTRA 1DQUA 1HW2A 4LGWA 1ZG5A 2QEXI 2QM3A 3M4OJ 4NNJA 4B4CA 4Z6YA 3ASOH 4N4OB 5HS8A 3OS2A 1W7PB 5HDGA 2QBYB 2O8XA 2DYRH 3G2BA 2O3FA 3ML6A 4A3JJ 2X9DA 2WV0A 2XVCA 3WE2A 3NWTA 4A0XA 1XMXA 3CC2I 2E5ZA 1NK2P 3RPUD 2C6YA 4EV0A 3OYNA 4A2UA 4B3XA 4IRHA 4BL0B 3U21A 2DXIA 4A6EA 3B02A 3F22A 4CCMA 5GPCA 4OIQF 3QQAA 4A3EJ 5FKKA 4YIRX 4OIPF 1LFBA 3H9QA 1YHQI 1JT0A 4A3GJ 3F8NA 2F48A 3TQNA 4GGGA 4Q47A 2VXDA 4X0GA 4AIJA 3BJOA 3LSRA 2COMA 5CJ9A 1MBKA 5DD8A 1K61A 4AC0A 2HWVA 3BR0A 1VQNI 3FXKA 1BJAA 1MD0A 3C2GA 2ECBA 4II2A 2DMUA 1YIOA 2VJ4A 2QLZA 3BG5A 3HC7A 1RESA 3Q0UA 1XGSA 2JWTA 1K7AA 1AOYA 4MIMA 6PAXA 2JVGA 2ZCWA 3S8PA 3EUKL 1LUJB 3F0CA 4ENNA 1DPRA 2IA2A 1YYVA 2JA6J 3L2QA 3CLQA 4IVNA 2E19A 4PGHA 5CQEA 3TOBA 2CQQA 2KKOA 1OJLA 1DUXC 5GADJ 1FTZA 1FP2A 4M71A 1JUPA 2G7UA 1Q1VA 3S1RJ 1L0OC 4N9IA 1Y8RB 4OIRF 2ISZA 4OMYA 4DOZA 4I09A 2XSJC 1Q1HA 2DQLA 3DLLF 5BOXA 1X1PA 2JA5J 2D45A 1BJZA 4AU7A 3IKTA 1CQTA 3O8GA 1D0YA 2PN6A 2V6CA 4DNCA 3DEWA 2LY2A 3CTAA 3LSJA 5J3LA 4RBOA 2Z99A 2DT6A 4S04A 3CZ6A 4LK1F 5FJ8J 4M74A 2QCOA 3L2RA 3CO7C 2RDPA 3IL2A 3FX3A 4I0BA 5HLTA 1V55H 5DD4A 1APLC 3TMOA 3CUQA 4CXFA 1FBSA 4RM3A 1U9OA 1KONA 3H5AA 4KDPA 4Q48A 2IS2A 2HVQA 4HW0A 4RA2A 2XDVA 1QVUA 3SZTA 2GBYA 3ONQA 4ZYGA 4LLNA 1MMNA 1AWCA 3FIWA 2L9RA 5M5YJ 2Y0MA 5F6FA 2P4WA 1XG1A 3DPUA 5A2QK 3G6EI 2O7OA 4WX9A 3CJRB 4NDLA 3S17J 2BY1A 2VJJA 3WE3A 2FX0A 5JR3A 2IVMA 1TW2A 4U0YA 3BG9A 4WWCA 3ECHA 2RAEA 2O6GE 4M9ZA 4RAGA 4HNVA 1XSVA 4C3JJ 3JRAA 5L3EA 1QZZA 5HNFA 4LLLA 4NBQA 3GX4X 4L18B 3S1MJ 2ZXWH 2KHMA 3HHHA 2HXOA 2JSPA 4FHTA 2FA5A 5IT9K 1BR1A 2LFBA 1IJWC 1SD6A 2CU7A 3LSPA 3RZDJ 4AM3A 1V3FA 2ZB9A 4NQWB 2O03A 1T33A 5GPAA 3JTGA 3ERED 4LG0B 4L5JA 2NVXJ 4DIQA 1AKHB 4BHPA 5GAEJ 4PSXA 2DA3A 2KMUA 1IN8A 4BH9A 3IH3A 1FSEA 1J2XA 4UVAA 1ETVA 1XMKA 3J81R 2H94A 1A6IA 4ON0A 2FSWA 3FXOA 4YRVA 3HYIA 2K4JA 2KQRA 2IRFG 2VLAA 1S7EA 2IAIA 2RVCA 1AU7A 5IP9J 3H35A 4EM2A 2L7FP 3A0BC 2GAUA 3S14J 3ZCOA 3IRRA 2V6EA 2L54A 1B9NA 3OY9A 4KYWA 3DWLE 2W85A 2PLYA 2AQEA 4CO8A 4XBFA 4BE0A 4HX8A 2ISYA 4HDVA 1QZYA 1TTYA 2ESNA 2M9HA 1KQ8A 5DV5A 2IGNA 2DA6A 2ZKZA 4BQAA 2EZHA 4RMNA 1SAXA 2DLLA 1S9HA 1WKMA 1X58A 3EETA 3F3XA 4Q5SF 1BI0A 1OCZH 4BE2A 1IGNA 2Z9OA 1REPC 1BI2A 1JUMA 1T08B 1FOXA 2LY9A 2X4HA 3HOUJ 1EH8A 1P9QC 4XRMA 1XDUA 4HDUA 5FKMA 3OYEA 5LRRA 4R8HA 1W5TA 2VC1A 2Y30A 2AXLA 2L02A 1MH3A 1DGRM 2X1DA 1JKPC 3C18A 2KP6A 1SD4A 1ENHA 3MEXA 3KYDB 5C4JJ 4J01A 3HUGB 1QNTA 2FBKA 3K70C 1FOYA 2H8WA 1FOKA 2DAOA 3FMSA 4HSTA 1NTCA 3M8JA 2DA4A 2JQ7A 2BVMA 3WTZA 5L3CA 3BZKA 3PJRA 3SQNA 5FB2A 1SD5A 1MBHA 1XDSA 2BVLA 5FFZA 5C3EJ 1LEAA 4XK4A 3G1OA 1HF0A 1IDZA 1TL8A 2OZ6A 9ANTA 5K5RA 3FMQA 4YELA 1DGWY 5DCFA 2JSCA 3B73A 3WTYC 3PO3J 4OAYA 1R6RA 4I7HA 4U0WA 4EGYA 3FISA 2X1CA 1W5SA 3HSRA 5B5EC 3E6BA 2FOWA 1WRJA 1FMWA 2VL8A 3TDUC 2EFPA 1CGPA 5F04A 2P0WA 4YG2F 1B6AA 4XRSA 3I56I 2HS5A 2BBYA 1B72B 5GAHJ 3JRIA 3W2WA 2NVQJ 4NC6A 1G2HA 2VUMJ 5IYDJ 2CSOA 1W36D 2A5YB 3N97A 1OKRA 2D1VA 2LKXA 1U5TA 1OPCA 2W48A 3ZQLA 4OOIA 3D5SC 5KVRA 1Y1WJ 4BNCA 3F6OA 1N77A 1K4TA 4C2TA 1B4AA 2XPWA 1Y6IA 2K9MA 1ZRFA 1MMSA 1OR7A 5J47A 1YI2I 3GFMA 1ZG3A 1G4DA 4LG3A 2ZXHA 2RV8A 4JOMA 1SFOJ 1Y1VJ 4LOCA 2F5DA 4PJJA 4ZZLA 1TWAJ 5J40A 1YJWI 3H0GJ 1IN7A 5H2FC 1NG7A 3AG3H 3PL8A 4UY8I 2MUNA 3K9TA 3S1NJ 5D4SA 3OYLA 3I59B 1MH4A 2EH3A 2H09A 5EJCA 4MQVA 2DA2A 3ZMUA 2EIKH 4IQ4A 3K2AA 3WODF 1E3OC 1WFXA 2CUFA 1AHDP 4NHJA 3I3LA 1RIOH 4IPAA 1G6NA 1LJ9A 2CW0F 2WC2A 5DCMB 1MBGA 1ON2A 5FO5A 5JFRA 1KU2A 4XRFA 2GM4A 1XSXA 1RNLA 2AXTC 4PSWA 4BS9A 1D1BA 5E8GA 3ECOA 1PYVA 1HA8A 2OC6A 2IA0A 1W0TA 4IQJA 1UMQA 3BJ6A 1BC7C 1HW5A 2NNNA 3V7CA 4F92B 3DTEA 2FXAA 3M8EA 3AL0B 5ERIA 1OCPA 5ILSA 2MD0A 4ZH4F 3HDDA 1U8BA 5LFAA 4FX0A 3QYEA 2KRFA 2A3SA 4D0PA 3HIFA 3GFJA 1H9GA 2JUCA 2XGDA 4HV5A 3IRQA 1KZHA 2LRDA 3S32A 2K7LA 2JPCA 1WI9A 1WHUA 2LOOA 1MBJA 2FMLA 4BAYA 3KP3A 4XM3A 3JW4A 4QTRA 2HDCA 5HNHA 1HCRA 1T98A 3QPSA 2VKVA 4NUBA 3ZMDA 2DQRA 4XN3A 1ACIA 1IW7F 3JRHA 4S05A 1NH3A 3J81Z 3WU0A 2CUEA 2HOTA 5IYCJ 4UVCA 2IBDA 5C44J 1E2XA 2PJRB 2XF6A 3BP8A 3WU2C 4C30A 4UXNA 2ZSHB 1ZAOA 2JK3A 4BHBA 3F9KA 4CCKA 1TZLA 2CQXA 1YS6A 2CWEA 5DYMA 2L4MA 2P7CB 2R0QC 3OR2C 2V9KA 3FXUA 1T6SA 1R1TA 1TQPA 4G6DA 1RQ6A 3HGGA 3K10A 5ICEA 4G8XA 1Y0UA 2WB1N 1HC8A 2B7EA 3M07A 3GYHX 4OMZA 4M6XA 2RN7A 2XAUA 3VODA 1XS9A 3HHGA 4FE4A 1FT9A 1KGSA 4OU0A 2HOSA 4ZC3A 3J7YJ 2LKSA 5LBQA 1W7PA 1D3YA 4ASNA 1W5CC 2O61A 4E7JA 3D5RC 4XOPA 1H88C 4L0ZB 1HOMA 3TOAA 5HLGA 3OYJA 1X2NA 3JSPA 3J7AW 2CS3A 2ME0A 3QPHA 1YW7A 3FZVA 1USTA 4D7NA 2F5FA 1MZBA 2EIJH 4PCQA 1KQ9A 2HOAA 2A61A 2E2HJ 3ZP5A 1NK3P 2VODA 1OISA 1F43A 3VPRA 3HEFA 1WVRA 4LB6B 3AG2H 2QENA 5EZGA 4U7BA 5B1AH 1L3LA 4IOAF 1D5VA 4D9JA 3RJPA 2YX7A 4P96A 1FYMA 2FE3A 5E3LA 3WHBA 5L3DA 1C0WA 1WPKA 1HKSA 2FJ1A 2OQRA 2PG4A 4AYBN 1TQMA 2D2WA 1LVAA 1RUOA 3P9CA 3MMYB 1ETYA 4MFEA 4PZJA 2ZNZA 3HB9A 1QPIA 4PDKA 4BXFA 3KZZA 3P7NA 4DYQA 2A5WA 3VFZA 1J59A 4BYYA 5D4RA 2QKLB 1B8IB 3J80K 1ZELA 2L0KA 5FLMJ 4FETA 2RQPA 2DN0A 3P5JA 3VOEA 3L00A 2K9NA 3QU3A 2X85A 4G94A 2VT3A 2L5QA 3JCUC 3FBIB 3IAS2 4OINF 4EATA 4G6TB 4E7IA 4A69C 1U6GA 3S1QJ 2NVUB 2WA0A 5L3GA 3LSGA 2WAQA 1MW7A 1FOWA 1SC7A 2DMPA 2KZGA 2VONA 1IN6A 4I02A 1S5LC 1Y56A 1U5TB 2DTZA 1JTYA 1K78B 1LKXA 3Q9SA 4KT6A 3CP2A 1P4WA 3QOEA 5K7FA 3OIQA 4HZFA 2V1XA 2ZJQF 2XB5A 3LSTA 1PP7U 2M35A 4HAMA 3ABKH 1ETXA 5CVJA 2MBFA 5TRDA 2MA3A 1J5YA 5FFXA 4PJNA 2FD5A 3R4KA 3V7SA 1UZCA 4X6AJ 4C9YA 3S15J 3G1MA 5JVGF 2DMTA 3L2CA 5K7HA 1STZA 4F7ZA 4G12A 2PMZA 2VKEA 5IP6A 2DPDA 1NG6A 4XSZF 2TCTA 4CICA 1ZGAA 3NRVA 5LHIA 2H6CA 5EEGA 3FK7A 1ZH5A 3BG6A 4KMFA 4I2OA 4ZDLA 5CPRB 2OZUA 3Q9VA 3CCMI 4EMSA 4IOCF 1JXSA 1XSDA 1FIAA 4IKFA 1WH5A 1Z77A 3W3CA 2Z33A 1ITYA 2KZVA 1YJNI 3KP6A 1I3QJ 4W97A 3D0SA 2DFEA 1ETKA 3I4NJ 4GO1A 3BR2A 2VKHA 5B1BH 4NQWA 3NQOA 4LG0A 3HOSA 2QA4I 5ICCA 4ZDPA 2LC2A 1X19A 1AKHA 1QHGA 2XAFA 1PJRA 2HNHA 3E7LA 2LP0A 4L9TA 1UB9A 4HRIA 4IHTA 1UELB 4AIKA 2OUMA 1ZLJA 4A5NA 2K9SA 2BY2A 1YFHA 1YRNB 1ZREA 1A5JA 1T39A 4CCLA 5EZHA 2BY3A 2Y2ZA 4FCYA 2VI6A 4XLNF 3ZR8X 2JMWA 4M3FA 2IS4A 4HPQA 1Y0NA 1T38A 2K02A 2G9WA 3LA7A 3RKQA 3OYAA 1OLTA 2XAGA 2XKOA 2NS7A 1IN5A 2UV1A 3OR1C 2VBWA 1W7PD 3OSGA 4N9HA 4XLEA 2QQAA 1XGMA 3RTRA 1W36C 1X4OA 2EWNA 3CCLI 1Z6TA 2GOMA 2LNBA 3VEPA 3ZQFA 2R7RA 4BBSJ 4GRIA 3CUQC 2HTJA 2D5VA 3CMMA 3SZGA 2XGEA 4YFNF 4A3LJ 2MLKA 4OWRB 1V4RA 3B6CA 3LFKA 4XLHA 4GCVA 1PUFB 3A01B 1GVJA 1H89C 1GV5A 3ZPLA 1SFKA 4TV7A 3CMYA 3MVPA 1KQ0A 5C4XJ 1JI8A 3PNVA 2VKDA 3KEOA 1VQ8I 4II3A 3RI4A 2JJ7A 4IHXA 1FSHA 4E70A 1Y39A 4IF4A 5LGUA 2DFHA 2HU9A 3TL4X 2A69F 4WK8F 1R9TJ 4H0EA 4P1WA 1RKWA 4MQ9F 2OQGA 2XRLA 3K4NA 2R4GA 1T2KA 5EGOB 4HNUA 1LPQA 3HUGA 2HPMA 3CC4I 4XOTA 3U1KA 2VQGA 1OQYA 2DYSH 1G3WA 3CCYA 2COBA 2J5PA 1P4AA 3UNGC 1YG2A 5J4VA 3SEQA 2ZMEB 1HSJA 4WF2A 3PFIA 4XMYA 4YFXF 3W2AA 3GTLJ 3CCEI 1YJ9I 2IP2A 2E2IJ 4XKWA 2R3SA 3GUDA 3LWFA 1ZGJA 3DQVC 3RZOJ 2EFQA 2N8GA 4UHTA 1H8AC 3BC8A 1WJEA 3K4CA 3ZQQA 2XV4S 1VNDA 5FLXZ 2LTPA 2R5YB 1GT0C 1X3WB 2RKHA 3W2VA 5LGNA 2Y9YA 4D5FA 2IS6A 3E6CC 2BXZA 1B72A 3L09A 3J7ZI 2P8TA 2W82A 4N4NB 1VQLI 5F1JA 1BC8C 3CDLA 5CQGA 1IN4A 3HKZN 4X1EA 3JR9A 3Q5FA 5ICFA 5GP9A 1TWCJ 4QSHA 5EDNA 3HRTA 2LLKA 1F1ZA 4M3DA 2HZTA 3M7GA 3BT9A 1FYKA 2HQAA 3K4KA 1SVLA 2ZJRF 3K4MA 1POGA 3CUOA 3PUBA 4AD9A 4EJOA 1R5HA 1FBQA 3E1SA 2NNYA 2M87A 3HPGA 2QZ8A 1Z0XA 2PI0A 5M3FJ 3RDIA 2VOOA 1R1VA 2HTSA 3I59A 1XX5A 4RB3C 2CH0A 2PX9A 3E3VA 2EZLA 2TRTA 3Q0WA 1BI3A 3JTHA 2IGMA 1FJLA 1QVTA 3J7AY 2VBXA 1HDDC 4DZJA 2CV0A 2B63J 1I5ZA 2QYOA 4G7HF 3LMMA 1TNSA 2EQRA 2MABA 3FF5A 4CCJA 3N4MA 2ME6A 4O6JA 5DCMA 4XLFA 5J8FA 2VPRA 1FIPA 4ESFA 4HEA2 5CKTA 3CLOA 1G3SA 1YW9A 1IV6A 3O6BB 4A3DJ 2GOXB 4O5VA 1UHWA 3RQIA 2NVTJ 3KZIC 2R92J 3UKGA 3I71A 1GLNA 2E1MB 4IO9F 1U3EM 4KNYA 5LEKA 1LE8B 2DO7A 3ABTA 3JAMK 5HDNA 1MIJA 2XKPA 1QU3A 2P7VB 2WAFA 4IJAA 5JHUA 3MZYA 3EQLF 2KISA 1FLIA 1TC3C 1G3YA 3Q0VA 4GYGA 1LQ1A 1DU0A 3FK6A 1ZN2A 4ZTJA 5BS6A 2ZJPF 2Z3YA 1TNTA 4ESJA 3AG4H 1SEUA 2KIFA 5IP7J 2OAZA 2PJRA 4DBQA 1U5TC 1EH7A 1R23A 4EGZA 2P5VA 1D1CA 2LR8A 1UCRA 4ZYAA 1BM9A 3KYLA 2OPTA 1S3JA 1OR7C 3KZYA 4A5MA 3X2QH 2KJBA 2LF8A 5E20A 1FYLA 4W1UA 3RYRA 4FQGA 3GVAA 3BTIA 2DOEA 2DW4A 2QWWA 3WG7H 2LD5A 3T5XA 3CF2A 2OJED 1SFXA 2JTVA 4P9FA 3M1EA 2W7NA 3IAM2 1N25A 4DW6A 2E36A 3GMEA 2FNPA 1R5GA 3G3ZA 2KJCA 4IX7A 3F6VA 1K79A 1SMTA 2A6EF 3H3UA 1D8JA 2I5UA 1T56A 3H36A 1Z3YA 2DBBA 3F8BA 2G7HA 2HDDA 3OYIA 3BTLA 2LMDA 2XGXA 4HX4A 3RCOA 2BE5F 1UG0A 3LSHA 2ZBKA 4XL9A 4I0AA 3OWTA 4FT8A 1T0FA 1KU9A 1P7JA 3OOPA 1TLHB 4EJWA 3HRUA 3TO9A 1QO0D 1IXRC 3K7AJ 3BZCA 3HOXJ 3BG3A 2K3FA 4E7KA 4BJ6C 2OBPA 5J1UA 4CCOA 1X1AA 4HNTA 1E3PA 3HJEA 3HRSA 4ZYEA 3HOVJ 2L9NA 3E5XA 5HVQC 5DEQA 2L2OA 1O3TA 1N78A 2DOAA 3GFLA 3ZN0A 5K1YA 4RB1A 2O0YA 2XAJA 3QU6A 3GZ5A 1FEXA 4MLOA 4MHGA 3EDPA 1EJ9A 3GLXA 4C2MJ 3PIOF 1ETOA 2L7ZA 1FPQA 3K1NA 3BQZA 3IWZA 4Y33A 2BY0A 4G6QA 2M0CA 1HBXG 4PFOA 1GHCA 2HXIA 3NARA 2WTEA 3PSFA 1I39A 2Y69H 5IOZA 1GXQA 2OTLI 3TW6A 1ORKA 3HL2A 2DK5A 1N75A 4XIDA 1GV2A 1ON1A 3ZQGA 4F91B 1QQIA 4EJTA 2KDOA 2KPMA 1B8IA 3Q3SA 4IL6C 4FX4A 3BTJA 1FY7A 1Z7LA 3BROA 5J1RA 1VZ0A 1QBJA 4A12A 3PSIA 2OU2A 3FHZA 3OIPA 4KUMA 1W0UA 4PK4A 3DV8A 5D5UB 1BOBA 3V8KA 2M7AA 4AWXB 1A35A 5J1YA 2YPRA 2G0EA 4U87A 3S93A 2W84A 5LHGA 3SJMA 5E3NA 2KL4A 4PUSA 3WTVC 3S2HJ 5E1ZB 4YFKF 3RPQA 2NS0A 2HKOA 5CVUA 2Y0SN 3SEZA 2JZYA 1I1GA 2CG4A 2MD5A 2XIGA 2K4BA 4ENMA 5A2QR 4J00A 1BW5A 5LHHA 1I3AA 4XLPF 2MYSA 1MJ9A 3C2HA 3I54A 1WJAA 3RKWA 1YOVB 4ETSA 4F55A 2VQCA 1IC8A 2DA5A 4KIBA 2R93J 1K78A 2MSYA 1I6HJ 3GTMJ 1O3SA 2KFDA 1B9MA 2EILH 1QGPA 3RYPA 4E4HA 3MZ8A 2GA2A 5M5XJ 1R49A 4IHSA 3A2KA 5KHDA 5DUKA 1FWZA 3CJQB 3P9KA 3VB2A 4XSXF 2HQRA 1BIBA 1U2WA 5IT9R 4ZJZA 2D1HA 5ICGA 1U78A 2HPIA 3MKZA 2LF7A 3REOA 1ZQ3P 2XRNA 1E17A 1IXSB 5FRNA 4MNUA 1MMAA 2GXAA 4EJUA 1TT0A 1R71A 2RGVA 4QIWN 3H9GA 3OL4A 1R1UA 1HXDA 4CHUA 3K4LA 4KA4A 1X3ZB 3H1CA 3KE2A 3GO5A 1T8IA 4M3EA 5GTHC 2WV1A 1X1CA 2BXYA 2ID6A 4EEFG 2X6YA 2AHQA 2E1NA 2RNGA 4QPQA 2P81A 3HOWJ 2LKPA 3KPHA 4PFPA 3ISPA 1CF7B 4BXUA 3TEDA 1ZYRF 3HSFA 1BN5A 4B09A 5IOYA 4PGGA 1BI1A 2FQ4A 4MTDA 2H27A 4M6VA 2DT5A 4DGWB 3I0TA 2QSFX 3HPHA 5FD6A 4IRGA 1YRNA 3LAJA 1O4XA 1B59A 1MJAA 1MBEA 1YX5A 2K86A 2M2EA 3V42A 3IV5A 4MEYF 3CC7I 2PMHA 3PNTA 2F5EA 5DM6F 2OCEA 1P6RA 4MEXF 3PUFA 4XLCA 2QUFA 2LY1A 4L5IA 5DTDA 2CMPA 4RB0A 1R7JA 4ENJA 3G1LA 4AIHA 2QQ8A 4OIOF 2HOEA 3G73A 4M3GA 3OMYA 2BEOA 5TGTA 4CYCA 2EFWA 2Q0OA 2RC4A 3OV8A 1ZRDA 2E1CA 2ETHA 1D0XA 3DFGA 1XCBA 2M4KA 3KX2A 3OIOA 2X48A 4ANJA 4CGZA 4RM2A 2FNAA 1GDTA 1PUFA 2ZXJA 3CCQI 3A01A 2M8GX 2VIXA 5FKOA 3H3VK 2KIMA 3DTIA 2Q8KA 3KLOA 4U7DA 1LDJA 2F6CA 3VYUB 1BL0A 5D5XB 4JBAA 1HSTA 2YSRA 4L9JA 2DODA 4BJ5C 3IKVA 3GTQJ 3FXQA 4B48A 2V9PA 3K6GA 3MKWB 4Y4RA 3WTWC 3DU6A 3D1NI 3FHNA 4G7OF 4BKXA 3AG1H 1S72I 4BQOA 1BA5A 3TGNA 3KCCA 1V5EA 2ADUA 1D5YA 4N0BA 5J4YA 3WTXC 3DKXA 3FDYA 2ZFUA 5EGOA 4HF1A 1ONVA 4IHVA 1B1BA 1RPWA 2LK2A 1RR8C 1MSEC 4V2GA 5F0FA 3EPZA 2F2EA 3LQQA 4P9UA 3CJNA 4Y3OA 2F4IA 3GTPJ 3SYTA 2ZMEA 1O7FA 3GFIA 3EUHA 1HDPA 1IRZA 5E1WA 1UHSA 5F08A 2E7WA 3O2PE 3LL7A 5JHFA 2DMQA 2WY8Q 3CO6C 1YQAA 2VJ5A 1VQ7I 3ZQCA 5D6EA 1A04A 3JRBA 2MG4A 3ABLH 2L7KA 4BQNA 2MH2A 3FKIJ 2JA2A 2A05A 2O5RA 4AIDA 5E8IA 1HQCA 4DJAA 1VFCA 5EEHA 1V5FA 2Q2EB 4U0VA 1X1DA 5ILUA 3S3NA 5DS9A 3AFHA 4Q4ZF 5AIPA 2K85A 2A07F 4HQMA 4A3FJ 1JHFA 1XB4A 4KT5C 5LGTA 5FROA 2R5YA 1T95A 1K6YA 2V7FA 2Y75A 2NYXA 1O57A 1OYWA 3BZ6A 2P0TA 1VQ9I 4ZDOA 3E0JB 3SXYA 2XUBA 1SD7A 1G8XA 5FLXR 3K4BA 2VT2A 1RRJA 1Z05A 3L7WA 4RLQA 5D5WB 4XICA 2L3DA 3GCMA 5DUIA 2VJIA 4KIGA 2GLOA 4QWQA 2ECCA 1E0EA 1Z6RA 2QQBA 1SVOA 4M73A 3T8RA 5EG0B 4KITB 5A2QZ 1UAAA 2DJIA 1J0RA 3DTKA 3FXJA 2JPBA 1WI3A 1P92A 5IYBJ 2HQ5A 2W25A 3BCAA 2VE8A 3DXJF 3GTKJ 5EYRA 4LFUA 2VOPA 2EFOA 4XR6A 3MZHA 3ZOBA 3DU5A 5E1XA 2JN6A 5B3SH 3V8JA 2FRHA 4R79A 1ERDA 5IT9Z 3R61A 1V54H 5FKNA 4CH7A 2J5OA 4DZPA 1WJDA 2BGCA 1JJ6C 4RAZA 1KU3A 3K1PA 1R4MB 4G9YA 1RC9A 3I58A 2PFBA 2VN2A 1OCOH 1IAWA 2JA7J 1IV8A 3WTSC 4I6ZA 3FXLA 1GUUA 4UUTA 5BPDA 2R7FA 2Y31A 4D5CA 1W4MA 4XKVA 3PO2J 3CCRI 4IXAA 3DLAA 3F23A 1LE8A 4BDYA 2JVHA 4KN4X 5K5OA 2Y48A 3RQ4A 3EYIA 3HBLA 2IXSA 3GW2A 3GEZA 3LSIA 4EM0B 2QF7A 2VE9A 4C2UA 2A68F 4E7LA 2KLOA 4JK1X 3PNYA 3OYMA 1S29A 5HLHA 4IZZA 3WGGA 5J8CA 4BY1J 4F3QA 1HKTA 4HSRA 1YS7A 1ZGWA 1JKRC 5F27A 4RAYA 2E71A 1ULYA 4M6YA 4I98B 2VBYA 2MFZA 1TWHJ 3GWZA 1R5ID 2WY7Q 2RNJA 1FC3A 5CYVA 3NWSA 4A3IJ 2Z5UA 2R7SA 4I76A 1ZG1A 5D5VB 3OYGA 3NAUA 1TP4A 1P4XA 2HI3A 4UNOA 1IXCA 2O9LA 2CV2A 2HZDA 5KNLA 2FF4A 1IO2A 3G71I 3K0LA 1G59A 4IHWA 4C3HJ 1UFMA 3VSKA 4LLGF 5H6QA 3CCSI 3QP6A 1IRGA 2EZKA 2LSOA 2QSHX 4CYCB 4F93B 3A02A 5JVTA 2M7BA 1MMGA 4RAFA 2X6OA 3FBNB 2HDWA 3TKYA 2EIMH 4KMUX 2OF7A 1X4PA 2GXBA 4RGRA 2MC3A 2HR3A 2BW3B 4C3IJ 1JJ8C 3E5UA 5L3BA 3QPLA 1OCTC 3KETA 3OSFA 3DKYA 2M3AA 1QRYA 2Z1DA 4DBRA 3ULQB 2XAHA 1A6QA 1OFCX 2LBFB 1P7IA 3ZMTA 3WU1B 1YX3A 2CQ7A 1X2MA 1XGNA 3LSMA 3J80R 3SDGA 1H9TA 4LJZF 2EFNA 5HLIA 1OYYA 3AL0C 5LD2C 4CCNA 1BIAA 2DDBA 2UZKA 2R5ZB 2EK5A 3KLNA 2XF5A 5F1RA 2K9LA 5K7ZA 2NOGA 2R7DA 4JX5A 2A6HF 4UV8A 1I50J 4Y13A 1PUEE 4DQ2A 4HQEA 3GTGJ 1SANA 2EV5A 3G4SI 3J7AO 2E7XA 4R1HA 2DT7B 1JTXA 4M9SA 1XN7A 5GTIC 1WWXA 3R60A 4BHCA 2O8KA 3J81K 2XB0X 3S16J 3CJTB 4UB8C 4L9NA 2Y0SA 5M3MJ 1VQKI 1H0MA 2UWMA 2IGOA 3H92A 2ZSIB 5LLQA 3S2DJ 2VASA 2MC4A 4IEJA 4PJMA 4ZTFA 2X98A 1LB2A 2M5WA 2HKXA 1ETWA 1VI0A 4NB5A 1MDMB 2FUG2 2HYFA 1LVKA 5HS7A 2E34A 4OAZA 2ZJ2A 2NRAC 1KYWA 3OYHA 3F8FA 4JYKA 3GTJJ 3R6SA 2AS5F 1MKMA 1OYIA 1JE8A 1O7LA 4MFDA 2V1UA 3PFYA 2KRCA 1RETA 1SFUA 1FMVA 3H9JA 4BQQA 2BHZA 2V26A 2FMYA 3TP3A 2IT0A 1A31A 2QGUA 3E5QA 3LFUA 3FKJA 3CMAI 4A6DA 5DM7F 2YS9A 1DP3A 1WJFA 4BJTA 1VQ4I 1T0FC 3RKXA 2M34A 1IG7A 2X6WA 4L9VA 1XC5A 1SVMA 1EV7A 4KN7X 4MO7A 2CUZA 3I4MJ 1WJ5A 3SFZA 1U0JA 4IRIA 3TO6A 3TP0A 1U9NA 3L1PA 2VC0A 3LAPA 1TWGJ 1UG2A 1YW8A 3WHCA 3HG9A 5FD5A 4B44A 3JRGA 2YU9J 2WAEA 4YEJA 2M30A 1JT6A 4RGSA 1W1WE 4QPOA 4YIFA 1DU6A 1HW1A 3O3KA 2IGKA 4HBLA 1TBXA 2OD5A 3MKLA 2R7VA 2X6XA 2EBIA 3W6KB 3DKWA 2CW7A 2R7OA 3E97A 2BZTA 4RLFA 3JRCA 2P5LC 4UUVA 1XPXA 2M1BA 3QYBA 5CVIA 1CF7A 5H20A 3KFWX 4H4KC 3LNQA 1ZLKA 2NXNB 2WAQN 1FX7A 4M9XA 1EA3A 2XAQA 4UUSB 3OYKA 2E2JJ 2H8RA 2OV7A 2LG4A 1SMYF 1YIJI 3W6VA 1WCMJ 3O8HA 1YLFA 4HF0A 2RQQA 2KIQA 1S7OA 2K5CA 3OYDA 1S6LA 3QODA 2QQ9A 4LB5A 5ED4A 4JP0A 4J19A 1F5TA 3GZNB 4HLXA 4WXHA 2BOLA 4AUXA 1DDNA 4LIUA 4FISA 1O3RA 1HLVA 1WJCA 2CV1A 2IS1A 1ZARA 2E60A 2PEXA 3H3ZA 3IH4A 3MKYB 3HM5A 3CD6I 2ACJA 1Z1DA 3GTOJ 2HVRA 1UHMA 2DU9A 2WB1A 4WXCA 4XRSG 3FXMA 3ZQIA 4JX6A 3MD2A 5E79C 5B66C 3C1DA 5D8KB 4CSWA 3CCJI 1R58A 3ZN1A 3OYCA 2PMZN 4Z2YA 2XPUA 3CF5F 2DFFA 1MNEA 4EM1A 4CYDA 5AIQA 1D8KA 2FOKA 3CDHA 4GFBA 2ZXIA 4RS8A 2M4GA 4CUGA 4KFCA 4KISA 3BPXA 3PM1A 3DCFA 1XGOA 4BE1A 1VTNC 2F4OB 4RB2C 4O3MA 3ZGKA 3ZRGA 4B1RA 3MQ0A 2V9VA 2L9SA 3DBRB 4HYEA 3T0YA 4AVPA 3BR6A 4BEHB 3R0JA 4UB6C 3SZPA 2ESHA 1VQMI 5CVRA 3L2WA 2JT1A 2LH9A 4BXXJ 4I01A 4PJ0C 3IWFA 5TJJA 2YR2A 3QP5A 2AO9A 3HTUA 2EV0A 5IY5H 2DJNA 1P2FA 3CMEI 3H5NA 3IP4B 1K6OA 2L9VA 1IZ1A 3J80Z 1JGSA 4D7MA 4ESBA 3NEUA 3HSEA 1ZRCA 2YX4A 4KICA 2FBHA 4AYBA 4I99C 2ID3A 1WJBA 1IUFA 3KP7A 1WGXA 3K2ZA 1IRFA 2RREA 2V1NA 1JHHA 1TWFJ 2P6TA 2P5KA 2ICWG 4QLCU 3PQJA 2Q2EA 2ZO4A 2IW5A 3IUOA 3L2UA 2STTA 4L0YB 2CYYA 2KDZA 3MCZA 3GLLA 3DBHB 2JRMA 3QRFF 2CGPA 2CUJA 5IPAA 5IT3A 2EPFA 3LSKA 1Z7UA 2DCEA 2W57A 2R7QA 5HDKA 3OOUA 2GXGA 5J6XA 3QAHA 2QVOA 3L9FA 4FASD 2XASA 1TQIA 4LK0F 3VYTB 2WWYA 4E7HA 4A3KJ 2CW8A 1IF1A 2JA8J 4ABZA 2A6TA 2V4JC 5E3MA 4GXOA 2LYCA 2IA1A 3FMRA 3H0DA 1MSFC 5EG0A 3GBGA 5F0CA 5HOOA 1RUNA 1Z9CA 3DP7A 3TDZC 2VQHA 1VQPI 2HQNA 2NS8A 3T8TA 5HODA 2H1KA 1ZR2A 1WQ2A 3CCVI 3IH2A 1Z91A 2MLGA 4EQQA 1RR7A 3I9V2 1F9NA 1A36A 3A0HC 4A93J 2R7UA 5E17F 4FTHA 5BNGA 2BHYA 3E6MA 3JAMR 4BUPA 1VQ5I 1XCVA 2X1EA 3H5RA 4ZZDA 3F21A 3WGIA 3A1YA 2AQFA 2NOJB 3K1MA 5JLWA 4NC8A 2R7WA 1K4SA 3BLYA 2XPVA 1OCCH 1D1AA 3DEEA 1R22A 1I27A 3OYFA 1V5GA 3FXRA 2V79A 1YE9A 2ZMEC 3EUHC 5AONA 4BACA 4A3CJ 3IC7A 2IPQX 1KU7A 3C2BA 1FZPB 2OCCH 4LITA 1ETQA 2VPLA 1M1EB 1MGTA 4HX7A 1IRXA 2GIVA 4XNFA 2XSDC 3MWMA 4A3MJ 2CQNA 3BG7A 1X1BA 3AAFA 3V8LA 3KP2A 3SDBA 1NHAA 1G3TA 1BR4A 4KJZA 1Y8QB 2GQQA 2E1OA 3BWGA 3RIRA 1EH6A 5E18F 3ZMZA 4BDZA 5FLXK 2F5CA 3BOQA 3WGHA 1VQOI 3F72A 2K27A 4P5OA 1GVDA 2GZWA 3DF8A 1EKEA 2B9SA 3HOTA 3CUQB 4L5EA 1YTYA 1PDNC 4XKCA 3BR5A 2M8EA 2FBIA 2R7TA 1QPMA 2W24A 2VQLA 4M3BA 3I64A 3M8FA 1J75A 1ODDA 2X51A 2CJJA 4MGRA 3KEYA 2EZIA 5BMZA 3ZQ7A 4WCGA 4XONA 2LREA 2YUSA 5GAGJ 5BPIA 5CLSA 2KRHA 2UXXA 1BOAA 1Z67A 1U8RA 2Z2SB 1ZK8A
chains in the Genus database with same CATH topology
3E6DA 5LEJA 3BDDA 3M9AA 1FP1D 4EVIA 2GWRA 1RI7A 1XD7A 1LDDA 5JI6A 3DEUA 2EV6A 1TW3A 3I53A 3ELKA 2HFHA 1S8NA 5F64A 2DFIA 2BV6A 5HS9A 4HA8A 4HF2A 3ZMSA 3RKYA 3FM3A 4Y17A 2EJRA 2DPUA 1F4KA 3QOPA 3ZMVA 2EA2A 4A0YA 4U88A 3ABUA 4RGUA 1IUYA 2BYVE 3GF2A 4LD5A 3MAJA 2XHKA 1KYZA 5D8LB 1LEBA 3DPLC 4GYIA 2PQ8A 2FQ3A 3WTUC 2QBYA 3W6JB 5L3FA 2IJLA 2DI3A 2JRTA 1PP8F 1MJBA 1X3UA 5H6RA 3BY6A 4CDGA 2PBIA 2EA4A 3C3WA 5DDGA 3IHUA 2X0LA 2PMUA 1MDMA 2EB7A 3R0AA 2B0LA 2STWA 3LA2A 4JQFA 1DP7P 3C7JA 4YIIA 3EYYA 4K2EA 1YO5C 3I4PA 1WSUA 1LNWA 2LDUA 3MFKA 4LMYA 2KIUA 4A0ZA 2PJPA 4HLYA 3RPUA 5D6FA 2XROA 2DTRA 1HKQA 3DPTA 3BJAA 4HOBA 1LDKB 3I5UA 3GZ6A 1USSA 2FEZA 3F8CA 2TDXA 3JAMZ 3SHFA 2YU3A 3S2WA 4MTEA 2CO5A 3HRMA 3LQRA 4ZYHA 2ZNYA 3LA3A 2CQKA 4Y15A 4ENKA 3U2RA 1I1SA 1FBUA 4UV9A 4UVBA 4RGXA 3WTTC 3QPTA 1J9IA 3COAC 3JSOA 1KA8A 3FM5A 2FU4A 1S7AA 5CVVA 2UXNA 2CFXA 1ZHFA 3V4GA 2NAZA 2HEOA 4ZYDA 2H6BA 2L01A 4WXDA 1BBYA 3T1BA 5ILVA 1R36A 1RZ4A 4P55A 1SFEA 5KK1A 3D5LA 3GXOA 3PQKA 1XMAA 1DPUA 3U9GA 4M72A 2L4AA 2VBZA 4G7ZF 1OMIA 3F8MA 1O3QA 3K69A 5LRSA 4CZZA 2VXZA 4EJVA 4HV6A 3HTSB 2ZFWA 2DK8A 1GXPA 3U1DA 3KP4A 5K5QA 2HGCA 3TO7A 3KEQA 2GA1A 3WG9A 1I6XA 2HYGD 1R00A 1FNNA 2OA4A 5FGMA 3P9IA 2P6SA 2V1DA 3ROUA 3BPVA 2MH9A 2M45A 2ELHA 1J7KA 3V7RA 4B8XA 3FWEA 3KP5A 5BQTA 4KIFA 1HW2A 4LGWA 1ZG5A 2QM3A 5HS8A 1W7PB 5HDGA 2QBYB 2O8XA 2O3FA 3ML6A 2WV0A 2XVCA 3WE2A 4A0XA 2C6YA 4EV0A 4A2UA 4IRHA 4A6EA 3B02A 3F22A 4OIQF 4OIPF 3F8NA 3TQNA 4GGGA 4Q47A 4AIJA 3BJOA 2COMA 5CJ9A 5DD8A 2HWVA 1BJAA 1MD0A 1YIOA 2QLZA 1XGSA 1AOYA 1K7AA 6PAXA 2ZCWA 4ENNA 1DPRA 2IA2A 1YYVA 4IVNA 4PGHA 3TOBA 2KKOA 1DUXC 1FP2A 4M71A 2G7UA 4OMYA 1L0OC 4N9IA 4OIRF 2ISZA 4I09A 1Q1HA 2DQLA 5BOXA 2D45A 3IKTA 2PN6A 2V6CA 4DNCA 3CTAA 2Z99A 4S04A 4LK1F 4M74A 3CO7C 2RDPA 3IL2A 3FX3A 4I0BA 5DD4A 4CXFA 3CUQA 1FBSA 4KDPA 4Q48A 4HW0A 3SZTA 4ZYGA 4LLNA 1AWCA 2Y0MA 5F6FA 2P4WA 5A2QK 4WX9A 3WE3A 5JR3A 2IVMA 1TW2A 4U0YA 4WWCA 3ECHA 2O6GE 4M9ZA 1XSVA 5L3EA 1QZZA 4LLLA 3GX4X 4L18B 3HHHA 4FHTA 5IT9K 2FA5A 1SD6A 1V3FA 2O03A 3JTGA 3ERED 4LG0B 4L5JA 4BHPA 4BH9A 1IN8A 1FSEA 1J2XA 4UVAA 1XMKA 2H94A 4ON0A 2FSWA 3HYIA 2K4JA 2IRFG 2RVCA 4EM2A 2GAUA 3IRRA 2L54A 1B9NA 4KYWA 2W85A 2PLYA 4CO8A 4XBFA 4HX8A 2ISYA 4HDVA 1QZYA 1TTYA 2ESNA 1KQ8A 5DV5A 2ZKZA 4BQAA 1SAXA 2DLLA 1WKMA 3EETA 3F3XA 4Q5SF 1BI0A 2Z9OA 1REPC 1BI2A 2X4HA 1EH8A 4HDUA 1XDUA 5LRRA 4R8HA 1W5TA 2VC1A 2AXLA 2L02A 3C18A 1SD4A 3MEXA 1QNTA 2FBKA 1FOKA 2DAOA 3FMSA 3WTZA 5L3CA 3SQNA 5FB2A 1SD5A 1XDSA 5FFZA 1LEAA 2OZ6A 5K5RA 3FMQA 5DCFA 2JSCA 3B73A 3WTYC 4I7HA 4U0WA 4EGYA 1W5SA 3HSRA 3E6BA 1WRJA 3TDUC 2EFPA 1CGPA 4YG2F 1B6AA 2HS5A 2BBYA 2CSOA 2A5YB 3N97A 1OKRA 2D1VA 1U5TA 1OPCA 4OOIA 5KVRA 4BNCA 3F6OA 1B4AA 1ZRFA 1OR7A 3GFMA 1ZG3A 1G4DA 2RV8A 2F5DA 4ZZLA 1IN7A 3K9TA 5D4SA 3I59B 2H09A 4MQVA 3ZMUA 3WODF 4NHJA 1RIOH 4IPAA 1G6NA 1LJ9A 2CW0F 2WC2A 5DCMB 1ON2A 5FO5A 5JFRA 1KU2A 4XRFA 1XSXA 1RNLA 5E8GA 3ECOA 2IA0A 3BJ6A 1BC7C 1HW5A 2NNNA 3V7CA 2FXAA 3M8EA 5ERIA 5ILSA 4ZH4F 4FX0A 2KRFA 2A3SA 4D0PA 3HIFA 3GFJA 1H9GA 4HV5A 3IRQA 2K7LA 2JPCA 1WI9A 2FMLA 4BAYA 3KP3A 3JW4A 2HDCA 1T98A 3ZMDA 2DQRA 1IW7F 4S05A 3J81Z 3WU0A 4UVCA 1E2XA 3BP8A 4UXNA 1ZAOA 4BHBA 1YS6A 2CWEA 5DYMA 2L4MA 2P7CB 3FXUA 1T6SA 1R1TA 1TQPA 4G6DA 5ICEA 4G8XA 1Y0UA 3GYHX 4OMZA 4M6XA 2RN7A 3VODA 3HHGA 1FT9A 1KGSA 4OU0A 5LBQA 1W7PA 1D3YA 4ASNA 2O61A 4L0ZB 3TOAA 5HLGA 3JSPA 3QPHA 1YW7A 3FZVA 1USTA 2F5FA 1MZBA 4PCQA 1KQ9A 2A61A 3ZP5A 2VODA 4LB6B 2QENA 4U7BA 1L3LA 1D5VA 3RJPA 2YX7A 4P96A 1FYMA 2FE3A 5L3DA 1C0WA 1HKSA 2OQRA 2PG4A 1TQMA 2D2WA 1LVAA 1RUOA 3P9CA 4PZJA 2ZNZA 4PDKA 3KZZA 3P7NA 3VFZA 1J59A 4BYYA 5D4RA 3J80K 2RQPA 3VOEA 3L00A 3QU3A 4G94A 2VT3A 4OINF 1U6GA 5L3GA 2VONA 1IN6A 4I02A 1U5TB 1K78B 3Q9SA 1P4WA 4HZFA 2V1XA 3LSTA 1PP7U 4HAMA 5CVJA 2MBFA 5TRDA 2MA3A 1J5YA 5FFXA 3R4KA 3V7SA 3L2CA 1STZA 4F7ZA 2DPDA 4XSZF 4CICA 1ZGAA 3NRVA 5LHIA 2H6CA 5EEGA 1ZH5A 4KMFA 4I2OA 2OZUA 3Q9VA 4EMSA 1JXSA 1XSDA 2Z33A 3KP6A 3D0SA 4GO1A 4NQWA 3NQOA 4LG0A 3HOSA 5ICCA 2XAFA 4L9TA 1UB9A 4IHTA 4AIKA 1ZLJA 4A5NA 1YFHA 1ZREA 1T39A 4XLNF 1T38A 2K02A 2G9WA 3LA7A 2XAGA 2XKOA 1IN5A 2VBWA 1W7PD 4N9HA 2QQAA 1XGMA 3RTRA 2EWNA 1Z6TA 2LNBA 3VEPA 3CUQC 2HTJA 4YFNF 2MLKA 1V4RA 3LFKA 4GCVA 1GVJA 3ZPLA 4TV7A 1KQ0A 3KEOA 3RI4A 1FSHA 4E70A 4IF4A 5LGUA 2A69F 4WK8F 4H0EA 4MQ9F 2OQGA 1T2KA 3HUGA 1G3WA 2J5PA 1P4AA 1YG2A 2ZMEB 1HSJA 4WF2A 3PFIA 4YFXF 2IP2A 2R3SA 3GUDA 3LWFA 1ZGJA 3DQVC 2EFQA 4UHTA 2XV4S 5FLXZ 2RKHA 5LGNA 3E6CC 3L09A 2P8TA 1BC8C 1IN4A 3Q5FA 5ICFA 3HRTA 1F1ZA 2HZTA 3M7GA 1FYKA 3CUOA 4AD9A 4EJOA 1R5HA 1FBQA 2NNYA 2M87A 2QZ8A 2PI0A 3RDIA 2VOOA 1R1VA 2HTSA 3I59A 4RB3C 3E3VA 1BI3A 3JTHA 2VBXA 1I5ZA 2QYOA 4G7HF 1TNSA 3FF5A 3N4MA 4O6JA 5DCMA 5J8FA 4ESFA 3CLOA 1G3SA 1YW9A 3O6BB 4O5VA 1UHWA 3I71A 1U3EM 4KNYA 5LEKA 2DO7A 3ABTA 3JAMK 5HDNA 2XKPA 2P7VB 4IJAA 5JHUA 3MZYA 3EQLF 1FLIA 1G3YA 1LQ1A 4GYGA 1ZN2A 5BS6A 2Z3YA 1TNTA 4ESJA 2KIFA 2OAZA 1U5TC 1EH7A 1R23A 4EGZA 2P5VA 1UCRA 1BM9A 1S3JA 3KZYA 4A5MA 2KJBA 2LF8A 5E20A 1FYLA 3RYRA 3GVAA 2DW4A 2QWWA 3T5XA 1SFXA 2JTVA 4P9FA 3M1EA 2FNPA 1R5GA 3G3ZA 2KJCA 3F6VA 1K79A 1SMTA 2A6EF 3H3UA 1D8JA 2DBBA 3F8BA 2G7HA 2XGXA 4HX4A 2BE5F 2ZBKA 4I0AA 4FT8A 1T0FA 1KU9A 3OOPA 1TLHB 4EJWA 3HRUA 3TO9A 1QO0D 1IXRC 2OBPA 3HRSA 4ZYEA 3E5XA 5HVQC 5DEQA 1O3TA 3GFLA 3ZN0A 5K1YA 4RB1A 2O0YA 2XAJA 3QU6A 3GZ5A 4MHGA 3EDPA 3GLXA 1FPQA 3K1NA 3IWZA 4G6QA 1HBXG 1GHCA 2WTEA 1GXQA 2DK5A 1ON1A 1QQIA 4EJTA 4FX4A 1FY7A 1QBJA 3BROA 4A12A 2OU2A 3FHZA 4KUMA 3DV8A 5D5UB 3V8KA 4AWXB 2YPRA 2W84A 5LHGA 3WTVC 5E1ZB 4YFKF 3RPQA 2NS0A 2HKOA 5CVUA 2JZYA 1I1GA 2CG4A 2MD5A 2XIGA 2K4BA 4ENMA 5LHHA 4XLPF 3RKWA 1MJ9A 3I54A 4ETSA 4KIBA 1K78A 1O3SA 1B9MA 1QGPA 3RYPA 4IHSA 2GA2A 5DUKA 1FWZA 3P9KA 3VB2A 4XSXF 2HQRA 1BIBA 1U2WA 2D1HA 5ICGA 1U78A 2LF7A 3REOA 2XRNA 1E17A 1IXSB 4MNUA 4EJUA 2RGVA 1R1UA 1HXDA 4CHUA 4KA4A 3KE2A 3GO5A 2E1NA 2LKPA 3ISPA 1CF7B 4BXUA 1ZYRF 3HSFA 1BN5A 4B09A 4PGGA 1BI1A 4MTDA 2H27A 2DT5A 3I0TA 5FD6A 4IRGA 3LAJA 1B59A 1MJAA 2K86A 4MEYF 2PMHA 2F5EA 1P6RA 4MEXF 2QUFA 4L5IA 4RB0A 1R7JA 4ENJA 4AIHA 4OIOF 2HOEA 3G73A 2BEOA 2EFWA 2Q0OA 2RC4A 3OV8A 1ZRDA 2E1CA 2ETHA 3DFGA 1XCBA 4CGZA 2FNAA 2ZXJA 2KIMA 2Q8KA 3KLOA 4U7DA 1LDJA 5D5XB 4JBAA 1HSTA 2YSRA 4L9JA 3IKVA 3FXQA 3WTWC 4G7OF 3TGNA 3KCCA 2ADUA 4N0BA 3WTXC 4HF1A 1ONVA 1B1BA 2F2EA 3LQQA 4P9UA 3CJNA 2ZMEA 1O7FA 3GFIA 3EUHA 5E1WA 2E7WA 3O2PE 3CO6C 1YQAA 5D6EA 1A04A 2MH2A 5E8IA 1HQCA 5EEHA 4U0VA 5ILUA 4Q4ZF 5AIPA 2A07F 4HQMA 1JHFA 1XB4A 4KT5C 5LGTA 2Y75A 3BZ6A 2NYXA 1O57A 1OYWA 3SXYA 2XUBA 1SD7A 2VT2A 1Z05A 3L7WA 5D5WB 2L3DA 5DUIA 4KIGA 4QWQA 1Z6RA 2QQBA 4M73A 3T8RA 5A2QZ 1J0RA 2JPBA 1P92A 2W25A 2VE8A 3DXJF 4LFUA 2VOPA 2EFOA 3MZHA 5E1XA 3V8JA 2FRHA 4R79A 5IT9Z 3R61A 2J5OA 2BGCA 4RAZA 1KU3A 3K1PA 4G9YA 3I58A 2PFBA 2VN2A 1IAWA 3WTSC 5BPDA 2R7FA 1W4MA 4IXAA 3F23A 4KN4X 5K5OA 2Y48A 3EYIA 3GW2A 3GEZA 4EM0B 2VE9A 2A68F 4JK1X 1S29A 5HLHA 3WGGA 5J8CA 1HKTA 1YS7A 4RAYA 1ULYA 4M6YA 4I98B 2VBYA 3GWZA 2RNJA 1FC3A 5CYVA 2Z5UA 1ZG1A 5D5VB 1P4XA 4UNOA 1IXCA 2FF4A 3K0LA 1UFMA 4LLGF 5H6QA 3QP6A 1IRGA 2LSOA 5JVTA 3TKYA 4KMUX 2GXBA 4RGRA 2MC3A 2HR3A 3E5UA 5L3BA 3KETA 3ULQB 2XAHA 3ZMTA 3WU1B 1XGNA 1H9TA 4LJZF 2EFNA 5HLIA 1OYYA 1BIAA 2UZKA 2EK5A 3KLNA 5F1RA 2R7DA 4Y13A 4UV8A 2A6HF 1PUEE 4DQ2A 4HQEA 2EV5A 3J7AO 2E7XA 4R1HA 4M9SA 1XN7A 1WWXA 3R60A 4BHCA 3J81K 4L9NA 1H0MA 2UWMA 3H92A 5LLQA 1LB2A 2M5WA 2HKXA 1MDMB 4NB5A 2HYFA 5HS7A 2NRAC 2ZJ2A 1KYWA 3F8FA 3R6SA 2AS5F 1MKMA 1OYIA 1JE8A 1O7LA 2V1UA 1SFUA 2FMYA 2IT0A 3E5QA 4A6DA 3RKXA 4L9VA 1EV7A 4KN7X 3SFZA 4IRIA 3TO6A 2VC0A 3LAPA 1YW8A 5FD5A 2M30A 4RGSA 4YIFA 1HW1A 3O3KA 4HBLA 1TBXA 2OD5A 3W6KB 3DKWA 3E97A 2P5LC 4UUVA 2M1BA 5CVIA 1CF7A 5H20A 3KFWX 1ZLKA 1FX7A 4M9XA 2XAQA 1SMYF 1YLFA 4HF0A 1S7OA 1S6LA 4LB5A 2QQ9A 5ED4A 1F5TA 4HLXA 4WXHA 1DDNA 1O3RA 1ZARA 2PEXA 3H3ZA 2ACJA 1Z1DA 1UHMA 2DU9A 4WXCA 3C1DA 5D8KB 1R58A 3ZN1A 4Z2YA 4EM1A 4CYDA 5AIQA 1D8KA 2FOKA 3CDHA 4RS8A 4KFCA 3BPXA 1VTNC 1XGOA 4RB2C 4O3MA 3MQ0A 2V9VA 4AVPA 4HYEA 3T0YA 3R0JA 3SZPA 2ESHA 5CVRA 2JT1A 4I01A 3IWFA 5TJJA 2YR2A 3QP5A 3HTUA 2EV0A 1P2FA 1K6OA 1IZ1A 3J80Z 1JGSA 4ESBA 3NEUA 3HSEA 1ZRCA 2YX4A 4KICA 2FBHA 3KP7A 3K2ZA 1IRFA 1JHHA 2P6TA 2P5KA 4QLCU 3PQJA 2Q2EA 2ZO4A 2IW5A 2STTA 4L0YB 2CYYA 3MCZA 2CGPA 3QRFF 5IT3A 1Z7UA 2W57A 5HDKA 2GXGA 5J6XA 3QAHA 2QVOA 3L9FA 2XASA 1TQIA 4LK0F 2WWYA 1IF1A 4GXOA 2IA1A 3FMRA 5HOOA 1RUNA 1Z9CA 3DP7A 3TDZC 2HQNA 3T8TA 1WQ2A 1Z91A 2MLGA 4EQQA 1F9NA 5E17F 3E6MA 1XCVA 4ZZDA 3F21A 3WGIA 3K1MA 1R22A 1I27A 3FXRA 2V79A 5AONA 3IC7A 2IPQX 1KU7A 1FZPB 1MGTA 4HX7A 2GIVA 3MWMA 3AAFA 3V8LA 3KP2A 1NHAA 1G3TA 2GQQA 3BWGA 3RIRA 1EH6A 5E18F 3ZMZA 5FLXK 2F5CA 3BOQA 3WGHA 3F72A 2K27A 4P5OA 2GZWA 3DF8A 3HOTA 3CUQB 1YTYA 1PDNC 2M8EA 2FBIA 1QPMA 2W24A 3I64A 3M8FA 1J75A 1ODDA 4MGRA 5BMZA 3ZQ7A 4WCGA 5BPIA 5CLSA 2UXXA 1BOAA 1U8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6D A;  5LEJ A;  3BDD A;  3M9A A;  1FP1 D;  4EVI A;  2GWR A;  1RI7 A;  1XD7 A;  1LDD A;  5JI6 A;  3DEU A;  2EV6 A;  1TW3 A;  3I53 A;  3ELK A;  2HFH A;  1S8N A;  5F64 A;  2DFI A;  2BV6 A;  5HS9 A;  4HA8 A;  4HF2 A;  3ZMS A;  3RKY A;  3FM3 A;  4Y17 A;  2EJR A;  2DPU A;  1F4K A;  3QOP A;  3ZMV A;  2EA2 A;  4A0Y A;  4U88 A;  3ABU A;  4RGU A;  1IUY A;  2BYV E;  3GF2 A;  4LD5 A;  3MAJ A;  2XHK A;  1KYZ A;  5D8L B;  1LEB A;  3DPL C;  4GYI A;  2PQ8 A;  2FQ3 A;  3WTU C;  2QBY A;  3W6J B;  5L3F A;  2IJL A;  2DI3 A;  2JRT A;  1PP8 F;  1MJB A;  1X3U A;  5H6R A;  3BY6 A;  4CDG A;  2PBI A;  2EA4 A;  3C3W A;  5DDG A;  3IHU A;  2X0L A;  2PMU A;  1MDM A;  2EB7 A;  3R0A A;  2B0L A;  2STW A;  3LA2 A;  4JQF A;  1DP7 P;  3C7J A;  4YII A;  3EYY A;  4K2E A;  1YO5 C;  3I4P A;  1WSU A;  1LNW A;  2LDU A;  3MFK A;  4LMY A;  2KIU A;  4A0Z A;  2PJP A;  4HLY A;  3RPU A;  5D6F A;  2XRO A;  2DTR A;  1HKQ A;  3DPT A;  3BJA A;  4HOB A;  1LDK B;  3I5U A;  3GZ6 A;  1USS A;  2FEZ A;  3F8C A;  2TDX A;  3JAM Z;  3SHF A;  2YU3 A;  3S2W A;  4MTE A;  2CO5 A;  3HRM A;  3LQR A;  4ZYH A;  2ZNY A;  3LA3 A;  2CQK A;  4Y15 A;  4ENK A;  3U2R A;  1I1S A;  1FBU A;  4UV9 A;  4UVB A;  4RGX A;  3WTT C;  3QPT A;  1J9I A;  3COA C;  3JSO A;  1KA8 A;  3FM5 A;  2FU4 A;  1S7A A;  5CVV A;  2UXN A;  2CFX A;  1ZHF A;  3V4G A;  2NAZ A;  2HEO A;  4ZYD A;  2H6B A;  2L01 A;  4WXD A;  1BBY A;  3T1B A;  5ILV A;  1R36 A;  1RZ4 A;  4P55 A;  1SFE A;  5KK1 A;  3D5L A;  3GXO A;  3PQK A;  1XMA A;  1DPU A;  3U9G A;  4M72 A;  2L4A A;  2VBZ A;  4G7Z F;  1OMI A;  3F8M A;  1O3Q A;  3K69 A;  5LRS A;  4CZZ A;  2VXZ A;  4EJV A;  4HV6 A;  3HTS B;  2ZFW A;  2DK8 A;  1GXP A;  3U1D A;  3KP4 A;  5K5Q A;  2HGC A;  3TO7 A;  3KEQ A;  2GA1 A;  3WG9 A;  1I6X A;  2HYG D;  1R00 A;  1FNN A;  2OA4 A;  5FGM A;  3P9I A;  2P6S A;  2V1D A;  3ROU A;  3BPV A;  2MH9 A;  2M45 A;  2ELH A;  1J7K A;  3V7R A;  4B8X A;  3FWE A;  3KP5 A;  5BQT A;  4KIF A;  1HW2 A;  4LGW A;  1ZG5 A;  2QM3 A;  5HS8 A;  1W7P B;  5HDG A;  2QBY B;  2O8X A;  2O3F A;  3ML6 A;  2WV0 A;  2XVC A;  3WE2 A;  4A0X A;  2C6Y A;  4EV0 A;  4A2U A;  4IRH A;  4A6E A;  3B02 A;  3F22 A;  4OIQ F;  4OIP F;  3F8N A;  3TQN A;  4GGG A;  4Q47 A;  4AIJ A;  3BJO A;  2COM A;  5CJ9 A;  5DD8 A;  2HWV A;  1BJA A;  1MD0 A;  1YIO A;  2QLZ A;  1XGS A;  1AOY A;  1K7A A;  6PAX A;  2ZCW A;  4ENN A;  1DPR A;  2IA2 A;  1YYV A;  4IVN A;  4PGH A;  3TOB A;  2KKO A;  1DUX C;  1FP2 A;  4M71 A;  2G7U A;  4OMY A;  1L0O C;  4N9I A;  4OIR F;  2ISZ A;  4I09 A;  1Q1H A;  2DQL A;  5BOX A;  2D45 A;  3IKT A;  2PN6 A;  2V6C A;  4DNC A;  3CTA A;  2Z99 A;  4S04 A;  4LK1 F;  4M74 A;  3CO7 C;  2RDP A;  3IL2 A;  3FX3 A;  4I0B A;  5DD4 A;  4CXF A;  3CUQ A;  1FBS A;  4KDP A;  4Q48 A;  4HW0 A;  3SZT A;  4ZYG A;  4LLN A;  1AWC A;  2Y0M A;  5F6F A;  2P4W A;  5A2Q K;  4WX9 A;  3WE3 A;  5JR3 A;  2IVM A;  1TW2 A;  4U0Y A;  4WWC A;  3ECH A;  2O6G E;  4M9Z A;  1XSV A;  5L3E A;  1QZZ A;  4LLL A;  3GX4 X;  4L18 B;  3HHH A;  4FHT A;  5IT9 K;  2FA5 A;  1SD6 A;  1V3F A;  2O03 A;  3JTG A;  3ERE D;  4LG0 B;  4L5J A;  4BHP A;  4BH9 A;  1IN8 A;  1FSE A;  1J2X A;  4UVA A;  1XMK A;  2H94 A;  4ON0 A;  2FSW A;  3HYI A;  2K4J A;  2IRF G;  2RVC A;  4EM2 A;  2GAU A;  3IRR A;  2L54 A;  1B9N A;  4KYW A;  2W85 A;  2PLY A;  4CO8 A;  4XBF A;  4HX8 A;  2ISY A;  4HDV A;  1QZY A;  1TTY A;  2ESN A;  1KQ8 A;  5DV5 A;  2ZKZ A;  4BQA A;  1SAX A;  2DLL A;  1WKM A;  3EET A;  3F3X A;  4Q5S F;  1BI0 A;  2Z9O A;  1REP C;  1BI2 A;  2X4H A;  1EH8 A;  4HDU A;  1XDU A;  5LRR A;  4R8H A;  1W5T A;  2VC1 A;  2AXL A;  2L02 A;  3C18 A;  1SD4 A;  3MEX A;  1QNT A;  2FBK A;  1FOK A;  2DAO A;  3FMS A;  3WTZ A;  5L3C A;  3SQN A;  5FB2 A;  1SD5 A;  1XDS A;  5FFZ A;  1LEA A;  2OZ6 A;  5K5R A;  3FMQ A;  5DCF A;  2JSC A;  3B73 A;  3WTY C;  4I7H A;  4U0W A;  4EGY A;  1W5S A;  3HSR A;  3E6B A;  1WRJ A;  3TDU C;  2EFP A;  1CGP A;  4YG2 F;  1B6A A;  2HS5 A;  2BBY A;  2CSO A;  2A5Y B;  3N97 A;  1OKR A;  2D1V A;  1U5T A;  1OPC A;  4OOI A;  5KVR A;  4BNC A;  3F6O A;  1B4A A;  1ZRF A;  1OR7 A;  3GFM A;  1ZG3 A;  1G4D A;  2RV8 A;  2F5D A;  4ZZL A;  1IN7 A;  3K9T A;  5D4S A;  3I59 B;  2H09 A;  4MQV A;  3ZMU A;  3WOD F;  4NHJ A;  1RIO H;  4IPA A;  1G6N A;  1LJ9 A;  2CW0 F;  2WC2 A;  5DCM B;  1ON2 A;  5FO5 A;  5JFR A;  1KU2 A;  4XRF A;  1XSX A;  1RNL A;  5E8G A;  3ECO A;  2IA0 A;  3BJ6 A;  1BC7 C;  1HW5 A;  2NNN A;  3V7C A;  2FXA A;  3M8E A;  5ERI A;  5ILS A;  4ZH4 F;  4FX0 A;  2KRF A;  2A3S A;  4D0P A;  3HIF A;  3GFJ A;  1H9G A;  4HV5 A;  3IRQ A;  2K7L A;  2JPC A;  1WI9 A;  2FML A;  4BAY A;  3KP3 A;  3JW4 A;  2HDC A;  1T98 A;  3ZMD A;  2DQR A;  1IW7 F;  4S05 A;  3J81 Z;  3WU0 A;  4UVC A;  1E2X A;  3BP8 A;  4UXN A;  1ZAO A;  4BHB A;  1YS6 A;  2CWE A;  5DYM A;  2L4M A;  2P7C B;  3FXU A;  1T6S A;  1R1T A;  1TQP A;  4G6D A;  5ICE A;  4G8X A;  1Y0U A;  3GYH X;  4OMZ A;  4M6X A;  2RN7 A;  3VOD A;  3HHG A;  1FT9 A;  1KGS A;  4OU0 A;  5LBQ A;  1W7P A;  1D3Y A;  4ASN A;  2O61 A;  4L0Z B;  3TOA A;  5HLG A;  3JSP A;  3QPH A;  1YW7 A;  3FZV A;  1UST A;  2F5F A;  1MZB A;  4PCQ A;  1KQ9 A;  2A61 A;  3ZP5 A;  2VOD A;  4LB6 B;  2QEN A;  4U7B A;  1L3L A;  1D5V A;  3RJP A;  2YX7 A;  4P96 A;  1FYM A;  2FE3 A;  5L3D A;  1C0W A;  1HKS A;  2OQR A;  2PG4 A;  1TQM A;  2D2W A;  1LVA A;  1RUO A;  3P9C A;  4PZJ A;  2ZNZ A;  4PDK A;  3KZZ A;  3P7N A;  3VFZ A;  1J59 A;  4BYY A;  5D4R A;  3J80 K;  2RQP A;  3VOE A;  3L00 A;  3QU3 A;  4G94 A;  2VT3 A;  4OIN F;  1U6G A;  5L3G A;  2VON A;  1IN6 A;  4I02 A;  1U5T B;  1K78 B;  3Q9S A;  1P4W A;  4HZF A;  2V1X A;  3LST A;  1PP7 U;  4HAM A;  5CVJ A;  2MBF A;  5TRD A;  2MA3 A;  1J5Y A;  5FFX A;  3R4K A;  3V7S A;  3L2C A;  1STZ A;  4F7Z A;  2DPD A;  4XSZ F;  4CIC A;  1ZGA A;  3NRV A;  5LHI A;  2H6C A;  5EEG A;  1ZH5 A;  4KMF A;  4I2O A;  2OZU A;  3Q9V A;  4EMS A;  1JXS A;  1XSD A;  2Z33 A;  3KP6 A;  3D0S A;  4GO1 A;  4NQW A;  3NQO A;  4LG0 A;  3HOS A;  5ICC A;  2XAF A;  4L9T A;  1UB9 A;  4IHT A;  4AIK A;  1ZLJ A;  4A5N A;  1YFH A;  1ZRE A;  1T39 A;  4XLN F;  1T38 A;  2K02 A;  2G9W A;  3LA7 A;  2XAG A;  2XKO A;  1IN5 A;  2VBW A;  1W7P D;  4N9H A;  2QQA A;  1XGM A;  3RTR A;  2EWN A;  1Z6T A;  2LNB A;  3VEP A;  3CUQ C;  2HTJ A;  4YFN F;  2MLK A;  1V4R A;  3LFK A;  4GCV A;  1GVJ A;  3ZPL A;  4TV7 A;  1KQ0 A;  3KEO A;  3RI4 A;  1FSH A;  4E70 A;  4IF4 A;  5LGU A;  2A69 F;  4WK8 F;  4H0E A;  4MQ9 F;  2OQG A;  1T2K A;  3HUG A;  1G3W A;  2J5P A;  1P4A A;  1YG2 A;  2ZME B;  1HSJ A;  4WF2 A;  3PFI A;  4YFX F;  2IP2 A;  2R3S A;  3GUD A;  3LWF A;  1ZGJ A;  3DQV C;  2EFQ A;  4UHT A;  2XV4 S;  5FLX Z;  2RKH A;  5LGN A;  3E6C C;  3L09 A;  2P8T A;  1BC8 C;  1IN4 A;  3Q5F A;  5ICF A;  3HRT A;  1F1Z A;  2HZT A;  3M7G A;  1FYK A;  3CUO A;  4AD9 A;  4EJO A;  1R5H A;  1FBQ A;  2NNY A;  2M87 A;  2QZ8 A;  2PI0 A;  3RDI A;  2VOO A;  1R1V A;  2HTS A;  3I59 A;  4RB3 C;  3E3V A;  1BI3 A;  3JTH A;  2VBX A;  1I5Z A;  2QYO A;  4G7H F;  1TNS A;  3FF5 A;  3N4M A;  4O6J A;  5DCM A;  5J8F A;  4ESF A;  3CLO A;  1G3S A;  1YW9 A;  3O6B B;  4O5V A;  1UHW A;  3I71 A;  1U3E M;  4KNY A;  5LEK A;  2DO7 A;  3ABT A;  3JAM K;  5HDN A;  2XKP A;  2P7V B;  4IJA A;  5JHU A;  3MZY A;  3EQL F;  1FLI A;  1G3Y A;  1LQ1 A;  4GYG A;  1ZN2 A;  5BS6 A;  2Z3Y A;  1TNT A;  4ESJ A;  2KIF A;  2OAZ A;  1U5T C;  1EH7 A;  1R23 A;  4EGZ A;  2P5V A;  1UCR A;  1BM9 A;  1S3J A;  3KZY A;  4A5M A;  2KJB A;  2LF8 A;  5E20 A;  1FYL A;  3RYR A;  3GVA A;  2DW4 A;  2QWW A;  3T5X A;  1SFX A;  2JTV A;  4P9F A;  3M1E A;  2FNP A;  1R5G A;  3G3Z A;  2KJC A;  3F6V A;  1K79 A;  1SMT A;  2A6E F;  3H3U A;  1D8J A;  2DBB A;  3F8B A;  2G7H A;  2XGX A;  4HX4 A;  2BE5 F;  2ZBK A;  4I0A A;  4FT8 A;  1T0F A;  1KU9 A;  3OOP A;  1TLH B;  4EJW A;  3HRU A;  3TO9 A;  1QO0 D;  1IXR C;  2OBP A;  3HRS A;  4ZYE A;  3E5X A;  5HVQ C;  5DEQ A;  1O3T A;  3GFL A;  3ZN0 A;  5K1Y A;  4RB1 A;  2O0Y A;  2XAJ A;  3QU6 A;  3GZ5 A;  4MHG A;  3EDP A;  3GLX A;  1FPQ A;  3K1N A;  3IWZ A;  4G6Q A;  1HBX G;  1GHC A;  2WTE A;  1GXQ A;  2DK5 A;  1ON1 A;  1QQI A;  4EJT A;  4FX4 A;  1FY7 A;  1QBJ A;  3BRO A;  4A12 A;  2OU2 A;  3FHZ A;  4KUM A;  3DV8 A;  5D5U B;  3V8K A;  4AWX B;  2YPR A;  2W84 A;  5LHG A;  3WTV C;  5E1Z B;  4YFK F;  3RPQ A;  2NS0 A;  2HKO A;  5CVU A;  2JZY A;  1I1G A;  2CG4 A;  2MD5 A;  2XIG A;  2K4B A;  4ENM A;  5LHH A;  4XLP F;  3RKW A;  1MJ9 A;  3I54 A;  4ETS A;  4KIB A;  1K78 A;  1O3S A;  1B9M A;  1QGP A;  3RYP A;  4IHS A;  2GA2 A;  5DUK A;  1FWZ A;  3P9K A;  3VB2 A;  4XSX F;  2HQR A;  1BIB A;  1U2W A;  2D1H A;  5ICG A;  1U78 A;  2LF7 A;  3REO A;  2XRN A;  1E17 A;  1IXS B;  4MNU A;  4EJU A;  2RGV A;  1R1U A;  1HXD A;  4CHU A;  4KA4 A;  3KE2 A;  3GO5 A;  2E1N A;  2LKP A;  3ISP A;  1CF7 B;  4BXU A;  1ZYR F;  3HSF A;  1BN5 A;  4B09 A;  4PGG A;  1BI1 A;  4MTD A;  2H27 A;  2DT5 A;  3I0T A;  5FD6 A;  4IRG A;  3LAJ A;  1B59 A;  1MJA A;  2K86 A;  4MEY F;  2PMH A;  2F5E A;  1P6R A;  4MEX F;  2QUF A;  4L5I A;  4RB0 A;  1R7J A;  4ENJ A;  4AIH A;  4OIO F;  2HOE A;  3G73 A;  2BEO A;  2EFW A;  2Q0O A;  2RC4 A;  3OV8 A;  1ZRD A;  2E1C A;  2ETH A;  3DFG A;  1XCB A;  4CGZ A;  2FNA A;  2ZXJ A;  2KIM A;  2Q8K A;  3KLO A;  4U7D A;  1LDJ A;  5D5X B;  4JBA A;  1HST A;  2YSR A;  4L9J A;  3IKV A;  3FXQ A;  3WTW C;  4G7O F;  3TGN A;  3KCC A;  2ADU A;  4N0B A;  3WTX C;  4HF1 A;  1ONV A;  1B1B A;  2F2E A;  3LQQ A;  4P9U A;  3CJN A;  2ZME A;  1O7F A;  3GFI A;  3EUH A;  5E1W A;  2E7W A;  3O2P E;  3CO6 C;  1YQA A;  5D6E A;  1A04 A;  2MH2 A;  5E8I A;  1HQC A;  5EEH A;  4U0V A;  5ILU A;  4Q4Z F;  5AIP A;  2A07 F;  4HQM A;  1JHF A;  1XB4 A;  4KT5 C;  5LGT A;  2Y75 A;  3BZ6 A;  2NYX A;  1O57 A;  1OYW A;  3SXY A;  2XUB A;  1SD7 A;  2VT2 A;  1Z05 A;  3L7W A;  5D5W B;  2L3D A;  5DUI A;  4KIG A;  4QWQ A;  1Z6R A;  2QQB A;  4M73 A;  3T8R A;  5A2Q Z;  1J0R A;  2JPB A;  1P92 A;  2W25 A;  2VE8 A;  3DXJ F;  4LFU A;  2VOP A;  2EFO A;  3MZH A;  5E1X A;  3V8J A;  2FRH A;  4R79 A;  5IT9 Z;  3R61 A;  2J5O A;  2BGC A;  4RAZ A;  1KU3 A;  3K1P A;  4G9Y A;  3I58 A;  2PFB A;  2VN2 A;  1IAW A;  3WTS C;  5BPD A;  2R7F A;  1W4M A;  4IXA A;  3F23 A;  4KN4 X;  5K5O A;  2Y48 A;  3EYI A;  3GW2 A;  3GEZ A;  4EM0 B;  2VE9 A;  2A68 F;  4JK1 X;  1S29 A;  5HLH A;  3WGG A;  5J8C A;  1HKT A;  1YS7 A;  4RAY A;  1ULY A;  4M6Y A;  4I98 B;  2VBY A;  3GWZ A;  2RNJ A;  1FC3 A;  5CYV A;  2Z5U A;  1ZG1 A;  5D5V B;  1P4X A;  4UNO A;  1IXC A;  2FF4 A;  3K0L A;  1UFM A;  4LLG F;  5H6Q A;  3QP6 A;  1IRG A;  2LSO A;  5JVT A;  3TKY A;  4KMU X;  2GXB A;  4RGR A;  2MC3 A;  2HR3 A;  3E5U A;  5L3B A;  3KET A;  3ULQ B;  2XAH A;  3ZMT A;  3WU1 B;  1XGN A;  1H9T A;  4LJZ F;  2EFN A;  5HLI A;  1OYY A;  1BIA A;  2UZK A;  2EK5 A;  3KLN A;  5F1R A;  2R7D A;  4Y13 A;  4UV8 A;  2A6H F;  1PUE E;  4DQ2 A;  4HQE A;  2EV5 A;  3J7A O;  2E7X A;  4R1H A;  4M9S A;  1XN7 A;  1WWX A;  3R60 A;  4BHC A;  3J81 K;  4L9N A;  1H0M A;  2UWM A;  3H92 A;  5LLQ A;  1LB2 A;  2M5W A;  2HKX A;  1MDM B;  4NB5 A;  2HYF A;  5HS7 A;  2NRA C;  2ZJ2 A;  1KYW A;  3F8F A;  3R6S A;  2AS5 F;  1MKM A;  1OYI A;  1JE8 A;  1O7L A;  2V1U A;  1SFU A;  2FMY A;  2IT0 A;  3E5Q A;  4A6D A;  3RKX A;  4L9V A;  1EV7 A;  4KN7 X;  3SFZ A;  4IRI A;  3TO6 A;  2VC0 A;  3LAP A;  1YW8 A;  5FD5 A;  2M30 A;  4RGS A;  4YIF A;  1HW1 A;  3O3K A;  4HBL A;  1TBX A;  2OD5 A;  3W6K B;  3DKW A;  3E97 A;  2P5L C;  4UUV A;  2M1B A;  5CVI A;  1CF7 A;  5H20 A;  3KFW X;  1ZLK A;  1FX7 A;  4M9X A;  2XAQ A;  1SMY F;  1YLF A;  4HF0 A;  1S7O A;  1S6L A;  4LB5 A;  2QQ9 A;  5ED4 A;  1F5T A;  4HLX A;  4WXH A;  1DDN A;  1O3R A;  1ZAR A;  2PEX A;  3H3Z A;  2ACJ A;  1Z1D A;  1UHM A;  2DU9 A;  4WXC A;  3C1D A;  5D8K B;  1R58 A;  3ZN1 A;  4Z2Y A;  4EM1 A;  4CYD A;  5AIQ A;  1D8K A;  2FOK A;  3CDH A;  4RS8 A;  4KFC A;  3BPX A;  1VTN C;  1XGO A;  4RB2 C;  4O3M A;  3MQ0 A;  2V9V A;  4AVP A;  4HYE A;  3T0Y A;  3R0J A;  3SZP A;  2ESH A;  5CVR A;  2JT1 A;  4I01 A;  3IWF A;  5TJJ A;  2YR2 A;  3QP5 A;  3HTU A;  2EV0 A;  1P2F A;  1K6O A;  1IZ1 A;  3J80 Z;  1JGS A;  4ESB A;  3NEU A;  3HSE A;  1ZRC A;  2YX4 A;  4KIC A;  2FBH A;  3KP7 A;  3K2Z A;  1IRF A;  1JHH A;  2P6T A;  2P5K A;  4QLC U;  3PQJ A;  2Q2E A;  2ZO4 A;  2IW5 A;  2STT A;  4L0Y B;  2CYY A;  3MCZ A;  2CGP A;  3QRF F;  5IT3 A;  1Z7U A;  2W57 A;  5HDK A;  2GXG A;  5J6X A;  3QAH A;  2QVO A;  3L9F A;  2XAS A;  1TQI A;  4LK0 F;  2WWY A;  1IF1 A;  4GXO A;  2IA1 A;  3FMR A;  5HOO A;  1RUN A;  1Z9C A;  3DP7 A;  3TDZ C;  2HQN A;  3T8T A;  1WQ2 A;  1Z91 A;  2MLG A;  4EQQ A;  1F9N A;  5E17 F;  3E6M A;  1XCV A;  4ZZD A;  3F21 A;  3WGI A;  3K1M A;  1R22 A;  1I27 A;  3FXR A;  2V79 A;  5AON A;  3IC7 A;  2IPQ X;  1KU7 A;  1FZP B;  1MGT A;  4HX7 A;  2GIV A;  3MWM A;  3AAF A;  3V8L A;  3KP2 A;  1NHA A;  1G3T A;  2GQQ A;  3BWG A;  3RIR A;  1EH6 A;  5E18 F;  3ZMZ A;  5FLX K;  2F5C A;  3BOQ A;  3WGH A;  3F72 A;  2K27 A;  4P5O A;  2GZW A;  3DF8 A;  3HOT A;  3CUQ B;  1YTY A;  1PDN C;  2M8E A;  2FBI A;  1QPM A;  2W24 A;  3I64 A;  3M8F A;  1J75 A;  1ODD A;  4MGR A;  5BMZ A;  3ZQ7 A;  4WCG A;  5BPI A;  5CLS A;  2UXX A;  1BOA A;  1U8R A; 
#chains in the Genus database with same CATH topology
 3E6D A;  1R4N B;  5LEJ A;  3JRE A;  1MND A;  3BCB A;  3BDD A;  3M9A A;  4E6K G;  4AVZ A;  3S3O A;  1FP1 D;  2K9Q A;  3A4C A;  4ITV A;  4EVI A;  2GWR A;  1VF9 A;  1OCR H;  2GIZ A;  2XGC A;  1RI7 A;  1XD7 A;  1LDD A;  2HYJ A;  3QWL A;  5JI6 A;  3DEU A;  2EV6 A;  1TW3 A;  4BGD A;  4BBR J;  1SAU A;  4B43 A;  1ZKG A;  3I53 A;  2BW3 A;  3HGY A;  3ELK A;  5KCM A;  2HFH A;  1S8N A;  5F64 A;  5F0H A;  2DFI A;  2BV6 A;  5HS9 A;  1MMD A;  4HA8 A;  2UUZ A;  4HF2 A;  3ZMS A;  4LIV A;  3RKY A;  3FM3 A;  2R7Z J;  4Y17 A;  2LBF A;  2EJR A;  2DPU A;  4DYR A;  1F4K A;  3QOP A;  3ZMV A;  2CRG A;  3VYS B;  4B3A A;  2E1M C;  2EA2 A;  1JKO C;  4Y52 J;  4A0Y A;  1BR2 A;  2I8D A;  4U88 A;  4A3B J;  3ABU A;  4RGU A;  2R5Z A;  4Y7N J;  2WAD A;  4BY7 J;  1IUY A;  2MVT A;  3TW7 A;  2DMN A;  2BYV E;  3GF2 A;  3KYC B;  1E3H A;  2QSG X;  4LD5 A;  3MAJ A;  3CCU I;  2XHK A;  2ELK A;  2R7X A;  1KYZ A;  5D8L B;  3OS0 A;  1LEB A;  4B47 A;  3EUA A;  3DPL C;  2ELJ A;  1F36 A;  4GYI A;  3OS1 A;  2PQ8 A;  2FQ3 A;  3WTU C;  2QBY A;  2DA7 A;  3W6J B;  4E7Z A;  5L3F A;  2IJL A;  3HXL A;  2CFO A;  2DI3 A;  2JRT A;  1PP8 F;  4V19 K;  4JX4 A;  1MJB A;  1X3U A;  3BTC A;  2OTJ I;  4CA0 A;  3M3Y J;  5H6R A;  3BR3 A;  2KT0 A;  3A03 A;  3BY6 A;  1Z21 A;  4CDG A;  3CP8 A;  2PBI A;  3JRD A;  2EA4 A;  3C3W A;  3HKZ A;  5DDG A;  3IHU A;  2X0L A;  4RDU A;  2PMU A;  2H1L A;  1MDM A;  2W00 A;  2EB7 A;  3R0A A;  2B0L A;  2STW A;  1ZR4 A;  1EF4 A;  3LA2 A;  4JQF A;  1DP7 P;  1TT5 B;  2MW8 A;  2JUG A;  3C7J A;  4YII A;  3JRF A;  1QZE A;  3EYY A;  1JUS A;  4K2E A;  1LFP A;  1YO5 C;  3I4P A;  1WH7 A;  1WSU A;  1LNW A;  2LDU A;  2MZ4 A;  3MFK A;  3K4J A;  4LMY A;  2KIU A;  2K40 A;  2W4S A;  4A0Z A;  2PJP A;  1LFU P;  4HLY A;  3RPU A;  4XQF A;  5D6F A;  2XRO A;  2DTR A;  2MGQ A;  1HKQ A;  3DPT A;  3OL3 A;  2DOF A;  3BJA A;  3AKZ A;  3HZJ A;  4HOB A;  1JGG A;  1LDK B;  3I5U A;  3GZ6 A;  1USS A;  2FEZ A;  3F8C A;  5KAF C;  5M5W J;  2DDA A;  2TDX A;  3JAM Z;  2Z16 A;  3SHF A;  2YU3 A;  3UR3 C;  2ZC2 A;  3S2W A;  4MTE A;  2CO5 A;  3HRM A;  3CDI A;  3LQR A;  3BQY A;  4ZYH A;  3TBI A;  2ZNY A;  3LA3 A;  2E5N A;  3N05 A;  2CQK A;  4Y15 A;  4ENK A;  2VB6 A;  3ZXS A;  3U2R A;  1I1S A;  1FBU A;  3ABM H;  1FTT A;  1YIT I;  2F4M B;  4UV9 A;  4UVB A;  4RGX A;  5FLV A;  1QA6 A;  2HVS A;  3QYF A;  4IHY A;  1JKQ C;  5EEA A;  3WTT C;  3LOC A;  3QPT A;  1J9I A;  3COA C;  1D0Z A;  3JSO A;  1KA8 A;  3FM5 A;  1K83 J;  4NC7 A;  4FE7 A;  4UUS A;  2FU4 A;  1S7A A;  5CVV A;  2UXN A;  2CFX A;  1ZHF A;  3V4G A;  2NAZ A;  1UJ8 A;  3CQZ J;  2HEO A;  2H6B A;  2L01 A;  4WXD A;  4ZYD A;  1BBY A;  4BU2 A;  3T1B A;  2Q1Z B;  5ILV A;  5FKL A;  3KIO A;  3S3M A;  3M1C A;  1R36 A;  3ERM A;  2XC7 A;  1RZ4 A;  4P55 A;  3RSN A;  1SFE A;  5KK1 A;  2IEK A;  3D5L A;  3GXO A;  3PQK A;  4S0H B;  1QHH D;  4XLA A;  4D1Q A;  3K70 D;  4V2F A;  1WZ2 A;  1IDY A;  1XMA A;  3ASN H;  5FRM A;  1VQ6 I;  1DPU A;  3ZQH A;  4F52 A;  3U9G A;  4M72 A;  2L4A A;  2VBZ A;  3I55 I;  5JLX A;  4G7Z F;  1OMI A;  1BW6 A;  3VSL A;  3F8M A;  1O3Q A;  3L2V A;  4E7S A;  1XTA A;  4HG2 A;  3VYR B;  4XKB A;  3HOY J;  2F5V A;  3K69 A;  3ESW B;  5LRS A;  2QKM B;  2DA1 A;  4CZZ A;  5TIS C;  2VXZ A;  3A52 A;  5E3O A;  3VWB A;  2NVY J;  1PVE A;  3VDX A;  4BEH A;  4EJV A;  4HV6 A;  3HTS B;  1MBF A;  2ZFW A;  2DK8 A;  1GXP A;  3SFI A;  3U1D A;  3KP4 A;  5K5Q A;  3OYB A;  1RKT A;  2HGC A;  3TO7 A;  2LVS A;  2M0M A;  3KEQ A;  2GA1 A;  3B6A A;  3WG9 A;  4PJL A;  1I6X A;  2E35 A;  4XOR A;  2HYG D;  1R00 A;  1FNN A;  2K3P A;  2OA4 A;  5FGM A;  1MNM C;  2EIN H;  3P9I A;  4XN0 A;  2P6S A;  2V1D A;  3ROU A;  3BPV A;  2MH9 A;  2W1O A;  4CZC A;  2M45 A;  5EF6 A;  2ELH A;  1J7K A;  3V7R A;  3MN2 A;  4B8X A;  2I10 A;  3PIP F;  2XF7 A;  2WBM A;  1AA7 A;  4DYC A;  2Y9Z A;  5KAI C;  3BR1 A;  3FWE A;  1Z3X A;  3CES A;  3DBL B;  3KP5 A;  1J09 A;  2L7M P;  3HOZ J;  4GDF A;  5BQT A;  4KIF A;  1ZTR A;  1DQU A;  1HW2 A;  4LGW A;  1ZG5 A;  2QEX I;  2QM3 A;  3M4O J;  4NNJ A;  4B4C A;  4Z6Y A;  3ASO H;  4N4O B;  5HS8 A;  3OS2 A;  1W7P B;  5HDG A;  2QBY B;  2O8X A;  2DYR H;  3G2B A;  2O3F A;  3ML6 A;  4A3J J;  2X9D A;  2WV0 A;  2XVC A;  3WE2 A;  3NWT A;  4A0X A;  1XMX A;  3CC2 I;  2E5Z A;  1NK2 P;  3RPU D;  2C6Y A;  4EV0 A;  3OYN A;  4A2U A;  4B3X A;  4IRH A;  4BL0 B;  3U21 A;  2DXI A;  4A6E A;  3B02 A;  3F22 A;  4CCM A;  5GPC A;  4OIQ F;  3QQA A;  4A3E J;  5FKK A;  4YIR X;  4OIP F;  1LFB A;  3H9Q A;  1YHQ I;  1JT0 A;  4A3G J;  3F8N A;  2F48 A;  3TQN A;  4GGG A;  4Q47 A;  2VXD A;  4X0G A;  4AIJ A;  3BJO A;  3LSR A;  2COM A;  5CJ9 A;  1MBK A;  5DD8 A;  1K61 A;  4AC0 A;  2HWV A;  3BR0 A;  1VQN I;  3FXK A;  1BJA A;  1MD0 A;  3C2G A;  2ECB A;  4II2 A;  2DMU A;  1YIO A;  2VJ4 A;  2QLZ A;  3BG5 A;  3HC7 A;  1RES A;  3Q0U A;  1XGS A;  2JWT A;  1K7A A;  1AOY A;  4MIM A;  6PAX A;  2JVG A;  2ZCW A;  3S8P A;  3EUK L;  1LUJ B;  3F0C A;  4ENN A;  1DPR A;  2IA2 A;  1YYV A;  2JA6 J;  3L2Q A;  3CLQ A;  4IVN A;  2E19 A;  4PGH A;  5CQE A;  3TOB A;  2CQQ A;  2KKO A;  1OJL A;  1DUX C;  5GAD J;  1FTZ A;  1FP2 A;  4M71 A;  1JUP A;  2G7U A;  1Q1V A;  3S1R J;  1L0O C;  4N9I A;  1Y8R B;  4OIR F;  2ISZ A;  4OMY A;  4DOZ A;  4I09 A;  2XSJ C;  1Q1H A;  2DQL A;  3DLL F;  5BOX A;  1X1P A;  2JA5 J;  2D45 A;  1BJZ A;  4AU7 A;  3IKT A;  1CQT A;  3O8G A;  1D0Y A;  2PN6 A;  2V6C A;  4DNC A;  3DEW A;  2LY2 A;  3CTA A;  3LSJ A;  5J3L A;  4RBO A;  2Z99 A;  2DT6 A;  4S04 A;  3CZ6 A;  4LK1 F;  5FJ8 J;  4M74 A;  2QCO A;  3L2R A;  3CO7 C;  2RDP A;  3IL2 A;  3FX3 A;  4I0B A;  5HLT A;  1V55 H;  5DD4 A;  1APL C;  3TMO A;  3CUQ A;  4CXF A;  1FBS A;  4RM3 A;  1U9O A;  1KON A;  3H5A A;  4KDP A;  4Q48 A;  2IS2 A;  2HVQ A;  4HW0 A;  4RA2 A;  2XDV A;  1QVU A;  3SZT A;  2GBY A;  3ONQ A;  4ZYG A;  4LLN A;  1MMN A;  1AWC A;  3FIW A;  2L9R A;  5M5Y J;  2Y0M A;  5F6F A;  2P4W A;  1XG1 A;  3DPU A;  5A2Q K;  3G6E I;  2O7O A;  4WX9 A;  3CJR B;  4NDL A;  3S17 J;  2BY1 A;  2VJJ A;  3WE3 A;  2FX0 A;  5JR3 A;  2IVM A;  1TW2 A;  4U0Y A;  3BG9 A;  4WWC A;  3ECH A;  2RAE A;  2O6G E;  4M9Z A;  4RAG A;  4HNV A;  1XSV A;  4C3J J;  3JRA A;  5L3E A;  1QZZ A;  5HNF A;  4LLL A;  4NBQ A;  3GX4 X;  4L18 B;  3S1M J;  2ZXW H;  2KHM A;  3HHH A;  2HXO A;  2JSP A;  4FHT A;  2FA5 A;  5IT9 K;  1BR1 A;  2LFB A;  1IJW C;  1SD6 A;  2CU7 A;  3LSP A;  3RZD J;  4AM3 A;  1V3F A;  2ZB9 A;  4NQW B;  2O03 A;  1T33 A;  5GPA A;  3JTG A;  3ERE D;  4LG0 B;  4L5J A;  2NVX J;  4DIQ A;  1AKH B;  4BHP A;  5GAE J;  4PSX A;  2DA3 A;  2KMU A;  1IN8 A;  4BH9 A;  3IH3 A;  1FSE A;  1J2X A;  4UVA A;  1ETV A;  1XMK A;  3J81 R;  2H94 A;  1A6I A;  4ON0 A;  2FSW A;  3FXO A;  4YRV A;  3HYI A;  2K4J A;  2KQR A;  2IRF G;  2VLA A;  1S7E A;  2IAI A;  2RVC A;  1AU7 A;  5IP9 J;  3H35 A;  4EM2 A;  2L7F P;  3A0B C;  2GAU A;  3S14 J;  3ZCO A;  3IRR A;  2V6E A;  2L54 A;  1B9N A;  3OY9 A;  4KYW A;  3DWL E;  2W85 A;  2PLY A;  2AQE A;  4CO8 A;  4XBF A;  4BE0 A;  4HX8 A;  2ISY A;  4HDV A;  1QZY A;  1TTY A;  2ESN A;  2M9H A;  1KQ8 A;  5DV5 A;  2IGN A;  2DA6 A;  2ZKZ A;  4BQA A;  2EZH A;  4RMN A;  1SAX A;  2DLL A;  1S9H A;  1WKM A;  1X58 A;  3EET A;  3F3X A;  4Q5S F;  1BI0 A;  1OCZ H;  4BE2 A;  1IGN A;  2Z9O A;  1REP C;  1BI2 A;  1JUM A;  1T08 B;  1FOX A;  2LY9 A;  2X4H A;  3HOU J;  1EH8 A;  1P9Q C;  4XRM A;  1XDU A;  4HDU A;  5FKM A;  3OYE A;  5LRR A;  4R8H A;  1W5T A;  2VC1 A;  2Y30 A;  2AXL A;  2L02 A;  1MH3 A;  1DGR M;  2X1D A;  1JKP C;  3C18 A;  2KP6 A;  1SD4 A;  1ENH A;  3MEX A;  3KYD B;  5C4J J;  4J01 A;  3HUG B;  1QNT A;  2FBK A;  3K70 C;  1FOY A;  2H8W A;  1FOK A;  2DAO A;  3FMS A;  4HST A;  1NTC A;  3M8J A;  2DA4 A;  2JQ7 A;  2BVM A;  3WTZ A;  5L3C A;  3BZK A;  3PJR A;  3SQN A;  5FB2 A;  1SD5 A;  1MBH A;  1XDS A;  2BVL A;  5FFZ A;  5C3E J;  1LEA A;  4XK4 A;  3G1O A;  1HF0 A;  1IDZ A;  1TL8 A;  2OZ6 A;  9ANT A;  5K5R A;  3FMQ A;  4YEL A;  1DGW Y;  5DCF A;  2JSC A;  3B73 A;  3WTY C;  3PO3 J;  4OAY A;  1R6R A;  4I7H A;  4U0W A;  4EGY A;  3FIS A;  2X1C A;  1W5S A;  3HSR A;  5B5E C;  3E6B A;  2FOW A;  1WRJ A;  1FMW A;  2VL8 A;  3TDU C;  2EFP A;  1CGP A;  5F04 A;  2P0W A;  4YG2 F;  1B6A A;  4XRS A;  3I56 I;  2HS5 A;  2BBY A;  1B72 B;  5GAH J;  3JRI A;  3W2W A;  2NVQ J;  4NC6 A;  1G2H A;  2VUM J;  5IYD J;  2CSO A;  1W36 D;  2A5Y B;  3N97 A;  1OKR A;  2D1V A;  2LKX A;  1U5T A;  1OPC A;  2W48 A;  3ZQL A;  4OOI A;  3D5S C;  5KVR A;  1Y1W J;  4BNC A;  3F6O A;  1N77 A;  1K4T A;  4C2T A;  1B4A A;  2XPW A;  1Y6I A;  2K9M A;  1ZRF A;  1MMS A;  1OR7 A;  5J47 A;  1YI2 I;  3GFM A;  1ZG3 A;  1G4D A;  4LG3 A;  2ZXH A;  2RV8 A;  4JOM A;  1SFO J;  1Y1V J;  4LOC A;  2F5D A;  4PJJ A;  4ZZL A;  1TWA J;  5J40 A;  1YJW I;  3H0G J;  1IN7 A;  5H2F C;  1NG7 A;  3AG3 H;  3PL8 A;  4UY8 I;  2MUN A;  3K9T A;  3S1N J;  5D4S A;  3OYL A;  3I59 B;  1MH4 A;  2EH3 A;  2H09 A;  5EJC A;  4MQV A;  2DA2 A;  3ZMU A;  2EIK H;  4IQ4 A;  3K2A A;  3WOD F;  1E3O C;  1WFX A;  2CUF A;  1AHD P;  4NHJ A;  3I3L A;  1RIO H;  4IPA A;  1G6N A;  1LJ9 A;  2CW0 F;  2WC2 A;  5DCM B;  1MBG A;  1ON2 A;  5FO5 A;  5JFR A;  1KU2 A;  4XRF A;  2GM4 A;  1XSX A;  1RNL A;  2AXT C;  4PSW A;  4BS9 A;  1D1B A;  5E8G A;  3ECO A;  1PYV A;  1HA8 A;  2OC6 A;  2IA0 A;  1W0T A;  4IQJ A;  1UMQ A;  3BJ6 A;  1BC7 C;  1HW5 A;  2NNN A;  3V7C A;  4F92 B;  3DTE A;  2FXA A;  3M8E A;  3AL0 B;  5ERI A;  1OCP A;  5ILS A;  2MD0 A;  4ZH4 F;  3HDD A;  1U8B A;  5LFA A;  4FX0 A;  3QYE A;  2KRF A;  2A3S A;  4D0P A;  3HIF A;  3GFJ A;  1H9G A;  2JUC A;  2XGD A;  4HV5 A;  3IRQ A;  1KZH A;  2LRD A;  3S32 A;  2K7L A;  2JPC A;  1WI9 A;  1WHU A;  2LOO A;  1MBJ A;  2FML A;  4BAY A;  3KP3 A;  4XM3 A;  3JW4 A;  4QTR A;  2HDC A;  5HNH A;  1HCR A;  1T98 A;  3QPS A;  2VKV A;  4NUB A;  3ZMD A;  2DQR A;  4XN3 A;  1ACI A;  1IW7 F;  3JRH A;  4S05 A;  1NH3 A;  3J81 Z;  3WU0 A;  2CUE A;  2HOT A;  5IYC J;  4UVC A;  2IBD A;  5C44 J;  1E2X A;  2PJR B;  2XF6 A;  3BP8 A;  3WU2 C;  4C30 A;  4UXN A;  2ZSH B;  1ZAO A;  2JK3 A;  4BHB A;  3F9K A;  4CCK A;  1TZL A;  2CQX A;  1YS6 A;  2CWE A;  5DYM A;  2L4M A;  2P7C B;  2R0Q C;  3OR2 C;  2V9K A;  3FXU A;  1T6S A;  1R1T A;  1TQP A;  4G6D A;  1RQ6 A;  3HGG A;  3K10 A;  5ICE A;  4G8X A;  1Y0U A;  2WB1 N;  1HC8 A;  2B7E A;  3M07 A;  3GYH X;  4OMZ A;  4M6X A;  2RN7 A;  2XAU A;  3VOD A;  1XS9 A;  3HHG A;  4FE4 A;  1FT9 A;  1KGS A;  4OU0 A;  2HOS A;  4ZC3 A;  3J7Y J;  2LKS A;  5LBQ A;  1W7P A;  1D3Y A;  4ASN A;  1W5C C;  2O61 A;  4E7J A;  3D5R C;  4XOP A;  1H88 C;  4L0Z B;  1HOM A;  3TOA A;  5HLG A;  3OYJ A;  1X2N A;  3JSP A;  3J7A W;  2CS3 A;  2ME0 A;  3QPH A;  1YW7 A;  3FZV A;  1UST A;  4D7N A;  2F5F A;  1MZB A;  2EIJ H;  4PCQ A;  1KQ9 A;  2HOA A;  2A61 A;  2E2H J;  3ZP5 A;  1NK3 P;  2VOD A;  1OIS A;  1F43 A;  3VPR A;  3HEF A;  1WVR A;  4LB6 B;  3AG2 H;  2QEN A;  5EZG A;  4U7B A;  5B1A H;  1L3L A;  4IOA F;  1D5V A;  4D9J A;  3RJP A;  2YX7 A;  4P96 A;  1FYM A;  2FE3 A;  5E3L A;  3WHB A;  5L3D A;  1C0W A;  1WPK A;  1HKS A;  2FJ1 A;  2OQR A;  2PG4 A;  4AYB N;  1TQM A;  2D2W A;  1LVA A;  1RUO A;  3P9C A;  3MMY B;  1ETY A;  4MFE A;  4PZJ A;  2ZNZ A;  3HB9 A;  1QPI A;  4PDK A;  4BXF A;  3KZZ A;  3P7N A;  4DYQ A;  2A5W A;  3VFZ A;  1J59 A;  4BYY A;  5D4R A;  2QKL B;  1B8I B;  3J80 K;  1ZEL A;  2L0K A;  5FLM J;  4FET A;  2RQP A;  2DN0 A;  3P5J A;  3VOE A;  3L00 A;  2K9N A;  3QU3 A;  2X85 A;  4G94 A;  2VT3 A;  2L5Q A;  3JCU C;  3FBI B;  3IAS 2;  4OIN F;  4EAT A;  4G6T B;  4E7I A;  4A69 C;  1U6G A;  3S1Q J;  2NVU B;  2WA0 A;  5L3G A;  3LSG A;  2WAQ A;  1MW7 A;  1FOW A;  1SC7 A;  2DMP A;  2KZG A;  2VON A;  1IN6 A;  4I02 A;  1S5L C;  1Y56 A;  1U5T B;  2DTZ A;  1JTY A;  1K78 B;  1LKX A;  3Q9S A;  4KT6 A;  3CP2 A;  1P4W A;  3QOE A;  5K7F A;  3OIQ A;  4HZF A;  2V1X A;  2ZJQ F;  2XB5 A;  3LST A;  1PP7 U;  2M35 A;  4HAM A;  3ABK H;  1ETX A;  5CVJ A;  2MBF A;  5TRD A;  2MA3 A;  1J5Y A;  5FFX A;  4PJN A;  2FD5 A;  3R4K A;  3V7S A;  1UZC A;  4X6A J;  4C9Y A;  3S15 J;  3G1M A;  5JVG F;  2DMT A;  3L2C A;  5K7H A;  1STZ A;  4F7Z A;  4G12 A;  2PMZ A;  2VKE A;  5IP6 A;  2DPD A;  1NG6 A;  4XSZ F;  2TCT A;  4CIC A;  1ZGA A;  3NRV A;  5LHI A;  2H6C A;  5EEG A;  3FK7 A;  1ZH5 A;  3BG6 A;  4KMF A;  4I2O A;  4ZDL A;  5CPR B;  2OZU A;  3Q9V A;  3CCM I;  4EMS A;  4IOC F;  1JXS A;  1XSD A;  1FIA A;  4IKF A;  1WH5 A;  1Z77 A;  3W3C A;  2Z33 A;  1ITY A;  2KZV A;  1YJN I;  3KP6 A;  1I3Q J;  4W97 A;  3D0S A;  2DFE A;  1ETK A;  3I4N J;  4GO1 A;  3BR2 A;  2VKH A;  5B1B H;  4NQW A;  3NQO A;  4LG0 A;  3HOS A;  2QA4 I;  5ICC A;  4ZDP A;  2LC2 A;  1X19 A;  1AKH A;  1QHG A;  2XAF A;  1PJR A;  2HNH A;  3E7L A;  2LP0 A;  4L9T A;  1UB9 A;  4HRI A;  4IHT A;  1UEL B;  4AIK A;  2OUM A;  1ZLJ A;  4A5N A;  2K9S A;  2BY2 A;  1YFH A;  1YRN B;  1ZRE A;  1A5J A;  1T39 A;  4CCL A;  5EZH A;  2BY3 A;  2Y2Z A;  4FCY A;  2VI6 A;  4XLN F;  3ZR8 X;  2JMW A;  4M3F A;  2IS4 A;  4HPQ A;  1Y0N A;  1T38 A;  2K02 A;  2G9W A;  3LA7 A;  3RKQ A;  3OYA A;  1OLT A;  2XAG A;  2XKO A;  2NS7 A;  1IN5 A;  2UV1 A;  3OR1 C;  2VBW A;  1W7P D;  3OSG A;  4N9H A;  4XLE A;  2QQA A;  1XGM A;  3RTR A;  1W36 C;  1X4O A;  2EWN A;  3CCL I;  1Z6T A;  2GOM A;  2LNB A;  3VEP A;  3ZQF A;  2R7R A;  4BBS J;  4GRI A;  3CUQ C;  2HTJ A;  2D5V A;  3CMM A;  3SZG A;  2XGE A;  4YFN F;  4A3L J;  2MLK A;  4OWR B;  1V4R A;  3B6C A;  3LFK A;  4XLH A;  4GCV A;  1PUF B;  3A01 B;  1GVJ A;  1H89 C;  1GV5 A;  3ZPL A;  1SFK A;  4TV7 A;  3CMY A;  3MVP A;  1KQ0 A;  5C4X J;  1JI8 A;  3PNV A;  2VKD A;  3KEO A;  1VQ8 I;  4II3 A;  3RI4 A;  2JJ7 A;  4IHX A;  1FSH A;  4E70 A;  1Y39 A;  4IF4 A;  5LGU A;  2DFH A;  2HU9 A;  3TL4 X;  2A69 F;  4WK8 F;  1R9T J;  4H0E A;  4P1W A;  1RKW A;  4MQ9 F;  2OQG A;  2XRL A;  3K4N A;  2R4G A;  1T2K A;  5EGO B;  4HNU A;  1LPQ A;  3HUG A;  2HPM A;  3CC4 I;  4XOT A;  3U1K A;  2VQG A;  1OQY A;  2DYS H;  1G3W A;  3CCY A;  2COB A;  2J5P A;  1P4A A;  3UNG C;  1YG2 A;  5J4V A;  3SEQ A;  2ZME B;  1HSJ A;  4WF2 A;  3PFI A;  4XMY A;  4YFX F;  3W2A A;  3GTL J;  3CCE I;  1YJ9 I;  2IP2 A;  2E2I J;  4XKW A;  2R3S A;  3GUD A;  3LWF A;  1ZGJ A;  3DQV C;  3RZO J;  2EFQ A;  2N8G A;  4UHT A;  1H8A C;  3BC8 A;  1WJE A;  3K4C A;  3ZQQ A;  2XV4 S;  1VND A;  5FLX Z;  2LTP A;  2R5Y B;  1GT0 C;  1X3W B;  2RKH A;  3W2V A;  5LGN A;  2Y9Y A;  4D5F A;  2IS6 A;  3E6C C;  2BXZ A;  1B72 A;  3L09 A;  3J7Z I;  2P8T A;  2W82 A;  4N4N B;  1VQL I;  5F1J A;  1BC8 C;  3CDL A;  5CQG A;  1IN4 A;  3HKZ N;  4X1E A;  3JR9 A;  3Q5F A;  5ICF A;  5GP9 A;  1TWC J;  4QSH A;  5EDN A;  3HRT A;  2LLK A;  1F1Z A;  4M3D A;  2HZT A;  3M7G A;  3BT9 A;  1FYK A;  2HQA A;  3K4K A;  1SVL A;  2ZJR F;  3K4M A;  1POG A;  3CUO A;  3PUB A;  4AD9 A;  4EJO A;  1R5H A;  1FBQ A;  3E1S A;  2NNY A;  2M87 A;  3HPG A;  2QZ8 A;  1Z0X A;  2PI0 A;  5M3F J;  3RDI A;  2VOO A;  1R1V A;  2HTS A;  3I59 A;  1XX5 A;  4RB3 C;  2CH0 A;  2PX9 A;  3E3V A;  2EZL A;  2TRT A;  3Q0W A;  1BI3 A;  3JTH A;  2IGM A;  1FJL A;  1QVT A;  3J7A Y;  2VBX A;  1HDD C;  4DZJ A;  2CV0 A;  2B63 J;  1I5Z A;  2QYO A;  4G7H F;  3LMM A;  1TNS A;  2EQR A;  2MAB A;  3FF5 A;  4CCJ A;  3N4M A;  2ME6 A;  4O6J A;  5DCM A;  4XLF A;  5J8F A;  2VPR A;  1FIP A;  4ESF A;  4HEA 2;  5CKT A;  3CLO A;  1G3S A;  1YW9 A;  1IV6 A;  3O6B B;  4A3D J;  2GOX B;  4O5V A;  1UHW A;  3RQI A;  2NVT J;  3KZI C;  2R92 J;  3UKG A;  3I71 A;  1GLN A;  2E1M B;  4IO9 F;  1U3E M;  4KNY A;  5LEK A;  1LE8 B;  2DO7 A;  3ABT A;  3JAM K;  5HDN A;  1MIJ A;  2XKP A;  1QU3 A;  2P7V B;  2WAF A;  4IJA A;  5JHU A;  3MZY A;  3EQL F;  2KIS A;  1FLI A;  1TC3 C;  1G3Y A;  3Q0V A;  4GYG A;  1LQ1 A;  1DU0 A;  3FK6 A;  1ZN2 A;  4ZTJ A;  5BS6 A;  2ZJP F;  2Z3Y A;  1TNT A;  4ESJ A;  3AG4 H;  1SEU A;  2KIF A;  5IP7 J;  2OAZ A;  2PJR A;  4DBQ A;  1U5T C;  1EH7 A;  1R23 A;  4EGZ A;  2P5V A;  1D1C A;  2LR8 A;  1UCR A;  4ZYA A;  1BM9 A;  3KYL A;  2OPT A;  1S3J A;  1OR7 C;  3KZY A;  4A5M A;  3X2Q H;  2KJB A;  2LF8 A;  5E20 A;  1FYL A;  4W1U A;  3RYR A;  4FQG A;  3GVA A;  3BTI A;  2DOE A;  2DW4 A;  2QWW A;  3WG7 H;  2LD5 A;  3T5X A;  3CF2 A;  2OJE D;  1SFX A;  2JTV A;  4P9F A;  3M1E A;  2W7N A;  3IAM 2;  1N25 A;  4DW6 A;  2E36 A;  3GME A;  2FNP A;  1R5G A;  3G3Z A;  2KJC A;  4IX7 A;  3F6V A;  1K79 A;  1SMT A;  2A6E F;  3H3U A;  1D8J A;  2I5U A;  1T56 A;  3H36 A;  1Z3Y A;  2DBB A;  3F8B A;  2G7H A;  2HDD A;  3OYI A;  3BTL A;  2LMD A;  2XGX A;  4HX4 A;  3RCO A;  2BE5 F;  1UG0 A;  3LSH A;  2ZBK A;  4XL9 A;  4I0A A;  3OWT A;  4FT8 A;  1T0F A;  1KU9 A;  1P7J A;  3OOP A;  1TLH B;  4EJW A;  3HRU A;  3TO9 A;  1QO0 D;  1IXR C;  3K7A J;  3BZC A;  3HOX J;  3BG3 A;  2K3F A;  4E7K A;  4BJ6 C;  2OBP A;  5J1U A;  4CCO A;  1X1A A;  4HNT A;  1E3P A;  3HJE A;  3HRS A;  4ZYE A;  3HOV J;  2L9N A;  3E5X A;  5HVQ C;  5DEQ A;  2L2O A;  1O3T A;  1N78 A;  2DOA A;  3GFL A;  3ZN0 A;  5K1Y A;  4RB1 A;  2O0Y A;  2XAJ A;  3QU6 A;  3GZ5 A;  1FEX A;  4MLO A;  4MHG A;  3EDP A;  1EJ9 A;  3GLX A;  4C2M J;  3PIO F;  1ETO A;  2L7Z A;  1FPQ A;  3K1N A;  3BQZ A;  3IWZ A;  4Y33 A;  2BY0 A;  4G6Q A;  2M0C A;  1HBX G;  4PFO A;  1GHC A;  2HXI A;  3NAR A;  2WTE A;  3PSF A;  1I39 A;  2Y69 H;  5IOZ A;  1GXQ A;  2OTL I;  3TW6 A;  1ORK A;  3HL2 A;  2DK5 A;  1N75 A;  4XID A;  1GV2 A;  1ON1 A;  3ZQG A;  4F91 B;  1QQI A;  4EJT A;  2KDO A;  2KPM A;  1B8I A;  3Q3S A;  4IL6 C;  4FX4 A;  3BTJ A;  1FY7 A;  1Z7L A;  3BRO A;  5J1R A;  1VZ0 A;  1QBJ A;  4A12 A;  3PSI A;  2OU2 A;  3FHZ A;  3OIP A;  4KUM A;  1W0U A;  4PK4 A;  3DV8 A;  5D5U B;  1BOB A;  3V8K A;  2M7A A;  4AWX B;  1A35 A;  5J1Y A;  2YPR A;  2G0E A;  4U87 A;  3S93 A;  2W84 A;  5LHG A;  3SJM A;  5E3N A;  2KL4 A;  4PUS A;  3WTV C;  3S2H J;  5E1Z B;  4YFK F;  3RPQ A;  2NS0 A;  2HKO A;  5CVU A;  2Y0S N;  3SEZ A;  2JZY A;  1I1G A;  2CG4 A;  2MD5 A;  2XIG A;  2K4B A;  4ENM A;  5A2Q R;  4J00 A;  1BW5 A;  5LHH A;  1I3A A;  4XLP F;  2MYS A;  1MJ9 A;  3C2H A;  3I54 A;  1WJA A;  3RKW A;  1YOV B;  4ETS A;  4F55 A;  2VQC A;  1IC8 A;  2DA5 A;  4KIB A;  2R93 J;  1K78 A;  2MSY A;  1I6H J;  3GTM J;  1O3S A;  2KFD A;  1B9M A;  2EIL H;  1QGP A;  3RYP A;  4E4H A;  3MZ8 A;  2GA2 A;  5M5X J;  1R49 A;  4IHS A;  3A2K A;  5KHD A;  5DUK A;  1FWZ A;  3CJQ B;  3P9K A;  3VB2 A;  4XSX F;  2HQR A;  1BIB A;  1U2W A;  5IT9 R;  4ZJZ A;  2D1H A;  5ICG A;  1U78 A;  2HPI A;  3MKZ A;  2LF7 A;  3REO A;  1ZQ3 P;  2XRN A;  1E17 A;  1IXS B;  5FRN A;  4MNU A;  1MMA A;  2GXA A;  4EJU A;  1TT0 A;  1R71 A;  2RGV A;  4QIW N;  3H9G A;  3OL4 A;  1R1U A;  1HXD A;  4CHU A;  3K4L A;  4KA4 A;  1X3Z B;  3H1C A;  3KE2 A;  3GO5 A;  1T8I A;  4M3E A;  5GTH C;  2WV1 A;  1X1C A;  2BXY A;  2ID6 A;  4EEF G;  2X6Y A;  2AHQ A;  2E1N A;  2RNG A;  4QPQ A;  2P81 A;  3HOW J;  2LKP A;  3KPH A;  4PFP A;  3ISP A;  1CF7 B;  4BXU A;  3TED A;  1ZYR F;  3HSF A;  1BN5 A;  4B09 A;  5IOY A;  4PGG A;  1BI1 A;  2FQ4 A;  4MTD A;  2H27 A;  4M6V A;  2DT5 A;  4DGW B;  3I0T A;  2QSF X;  3HPH A;  5FD6 A;  4IRG A;  1YRN A;  3LAJ A;  1O4X A;  1B59 A;  1MJA A;  1MBE A;  1YX5 A;  2K86 A;  2M2E A;  3V42 A;  3IV5 A;  4MEY F;  3CC7 I;  2PMH A;  3PNT A;  2F5E A;  5DM6 F;  2OCE A;  1P6R A;  4MEX F;  3PUF A;  4XLC A;  2QUF A;  2LY1 A;  4L5I A;  5DTD A;  2CMP A;  4RB0 A;  1R7J A;  4ENJ A;  3G1L A;  4AIH A;  2QQ8 A;  4OIO F;  2HOE A;  3G73 A;  4M3G A;  3OMY A;  2BEO A;  5TGT A;  4CYC A;  2EFW A;  2Q0O A;  2RC4 A;  3OV8 A;  1ZRD A;  2E1C A;  2ETH A;  1D0X A;  3DFG A;  1XCB A;  2M4K A;  3KX2 A;  3OIO A;  2X48 A;  4ANJ A;  4CGZ A;  4RM2 A;  2FNA A;  1GDT A;  1PUF A;  2ZXJ A;  3CCQ I;  3A01 A;  2M8G X;  2VIX A;  5FKO A;  3H3V K;  2KIM A;  3DTI A;  2Q8K A;  3KLO A;  4U7D A;  1LDJ A;  2F6C A;  3VYU B;  1BL0 A;  5D5X B;  4JBA A;  1HST A;  2YSR A;  4L9J A;  2DOD A;  4BJ5 C;  3IKV A;  3GTQ J;  3FXQ A;  4B48 A;  2V9P A;  3K6G A;  3MKW B;  4Y4R A;  3WTW C;  3DU6 A;  3D1N I;  3FHN A;  4G7O F;  4BKX A;  3AG1 H;  1S72 I;  4BQO A;  1BA5 A;  3TGN A;  3KCC A;  1V5E A;  2ADU A;  1D5Y A;  4N0B A;  5J4Y A;  3WTX C;  3DKX A;  3FDY A;  2ZFU A;  5EGO A;  4HF1 A;  1ONV A;  4IHV A;  1B1B A;  1RPW A;  2LK2 A;  1RR8 C;  1MSE C;  4V2G A;  5F0F A;  3EPZ A;  2F2E A;  3LQQ A;  4P9U A;  3CJN A;  4Y3O A;  2F4I A;  3GTP J;  3SYT A;  2ZME A;  1O7F A;  3GFI A;  3EUH A;  1HDP A;  1IRZ A;  5E1W A;  1UHS A;  5F08 A;  2E7W A;  3O2P E;  3LL7 A;  5JHF A;  2DMQ A;  2WY8 Q;  3CO6 C;  1YQA A;  2VJ5 A;  1VQ7 I;  3ZQC A;  5D6E A;  1A04 A;  3JRB A;  2MG4 A;  3ABL H;  2L7K A;  4BQN A;  2MH2 A;  3FKI J;  2JA2 A;  2A05 A;  2O5R A;  4AID A;  5E8I A;  1HQC A;  4DJA A;  1VFC A;  5EEH A;  1V5F A;  2Q2E B;  4U0V A;  1X1D A;  5ILU A;  3S3N A;  5DS9 A;  3AFH A;  4Q4Z F;  5AIP A;  2K85 A;  2A07 F;  4HQM A;  4A3F J;  1JHF A;  1XB4 A;  4KT5 C;  5LGT A;  5FRO A;  2R5Y A;  1T95 A;  1K6Y A;  2V7F A;  2Y75 A;  2NYX A;  1O57 A;  1OYW A;  3BZ6 A;  2P0T A;  1VQ9 I;  4ZDO A;  3E0J B;  3SXY A;  2XUB A;  1SD7 A;  1G8X A;  5FLX R;  3K4B A;  2VT2 A;  1RRJ A;  1Z05 A;  3L7W A;  4RLQ A;  5D5W B;  4XIC A;  2L3D A;  3GCM A;  5DUI A;  2VJI A;  4KIG A;  2GLO A;  4QWQ A;  2ECC A;  1E0E A;  1Z6R A;  2QQB A;  1SVO A;  4M73 A;  3T8R A;  5EG0 B;  4KIT B;  5A2Q Z;  1UAA A;  2DJI A;  1J0R A;  3DTK A;  3FXJ A;  2JPB A;  1WI3 A;  1P92 A;  5IYB J;  2HQ5 A;  2W25 A;  3BCA A;  2VE8 A;  3DXJ F;  3GTK J;  5EYR A;  4LFU A;  2VOP A;  2EFO A;  4XR6 A;  3MZH A;  3ZOB A;  3DU5 A;  5E1X A;  2JN6 A;  5B3S H;  3V8J A;  2FRH A;  4R79 A;  1ERD A;  5IT9 Z;  3R61 A;  1V54 H;  5FKN A;  4CH7 A;  2J5O A;  4DZP A;  1WJD A;  2BGC A;  1JJ6 C;  4RAZ A;  1KU3 A;  3K1P A;  1R4M B;  4G9Y A;  1RC9 A;  3I58 A;  2PFB A;  2VN2 A;  1OCO H;  1IAW A;  2JA7 J;  1IV8 A;  3WTS C;  4I6Z A;  3FXL A;  1GUU A;  4UUT A;  5BPD A;  2R7F A;  2Y31 A;  4D5C A;  1W4M A;  4XKV A;  3PO2 J;  3CCR I;  4IXA A;  3DLA A;  3F23 A;  1LE8 A;  4BDY A;  2JVH A;  4KN4 X;  5K5O A;  2Y48 A;  3RQ4 A;  3EYI A;  3HBL A;  2IXS A;  3GW2 A;  3GEZ A;  3LSI A;  4EM0 B;  2QF7 A;  2VE9 A;  4C2U A;  2A68 F;  4E7L A;  2KLO A;  4JK1 X;  3PNY A;  3OYM A;  1S29 A;  5HLH A;  4IZZ A;  3WGG A;  5J8C A;  4BY1 J;  4F3Q A;  1HKT A;  4HSR A;  1YS7 A;  1ZGW A;  1JKR C;  5F27 A;  4RAY A;  2E71 A;  1ULY A;  4M6Y A;  4I98 B;  2VBY A;  2MFZ A;  1TWH J;  3GWZ A;  1R5I D;  2WY7 Q;  2RNJ A;  1FC3 A;  5CYV A;  3NWS A;  4A3I J;  2Z5U A;  2R7S A;  4I76 A;  1ZG1 A;  5D5V B;  3OYG A;  3NAU A;  1TP4 A;  1P4X A;  2HI3 A;  4UNO A;  1IXC A;  2O9L A;  2CV2 A;  2HZD A;  5KNL A;  2FF4 A;  1IO2 A;  3G71 I;  3K0L A;  1G59 A;  4IHW A;  4C3H J;  1UFM A;  3VSK A;  4LLG F;  5H6Q A;  3CCS I;  3QP6 A;  1IRG A;  2EZK A;  2LSO A;  2QSH X;  4CYC B;  4F93 B;  3A02 A;  5JVT A;  2M7B A;  1MMG A;  4RAF A;  2X6O A;  3FBN B;  2HDW A;  3TKY A;  2EIM H;  4KMU X;  2OF7 A;  1X4P A;  2GXB A;  4RGR A;  2MC3 A;  2HR3 A;  2BW3 B;  4C3I J;  1JJ8 C;  3E5U A;  5L3B A;  3QPL A;  1OCT C;  3KET A;  3OSF A;  3DKY A;  2M3A A;  1QRY A;  2Z1D A;  4DBR A;  3ULQ B;  2XAH A;  1A6Q A;  1OFC X;  2LBF B;  1P7I A;  3ZMT A;  3WU1 B;  1YX3 A;  2CQ7 A;  1X2M A;  1XGN A;  3LSM A;  3J80 R;  3SDG A;  1H9T A;  4LJZ F;  2EFN A;  5HLI A;  1OYY A;  3AL0 C;  5LD2 C;  4CCN A;  1BIA A;  2DDB A;  2UZK A;  2R5Z B;  2EK5 A;  3KLN A;  2XF5 A;  5F1R A;  2K9L A;  5K7Z A;  2NOG A;  2R7D A;  4JX5 A;  2A6H F;  4UV8 A;  1I50 J;  4Y13 A;  1PUE E;  4DQ2 A;  4HQE A;  3GTG J;  1SAN A;  2EV5 A;  3G4S I;  3J7A O;  2E7X A;  4R1H A;  2DT7 B;  1JTX A;  4M9S A;  1XN7 A;  5GTI C;  1WWX A;  3R60 A;  4BHC A;  2O8K A;  3J81 K;  2XB0 X;  3S16 J;  3CJT B;  4UB8 C;  4L9N A;  2Y0S A;  5M3M J;  1VQK I;  1H0M A;  2UWM A;  2IGO A;  3H92 A;  2ZSI B;  5LLQ A;  3S2D J;  2VAS A;  2MC4 A;  4IEJ A;  4PJM A;  4ZTF A;  2X98 A;  1LB2 A;  2M5W A;  2HKX A;  1ETW A;  1VI0 A;  4NB5 A;  1MDM B;  2FUG 2;  2HYF A;  1LVK A;  5HS7 A;  2E34 A;  4OAZ A;  2ZJ2 A;  2NRA C;  1KYW A;  3OYH A;  3F8F A;  4JYK A;  3GTJ J;  3R6S A;  2AS5 F;  1MKM A;  1OYI A;  1JE8 A;  1O7L A;  4MFD A;  2V1U A;  3PFY A;  2KRC A;  1RET A;  1SFU A;  1FMV A;  3H9J A;  4BQQ A;  2BHZ A;  2V26 A;  2FMY A;  3TP3 A;  2IT0 A;  1A31 A;  2QGU A;  3E5Q A;  3LFU A;  3FKJ A;  3CMA I;  4A6D A;  5DM7 F;  2YS9 A;  1DP3 A;  1WJF A;  4BJT A;  1VQ4 I;  1T0F C;  3RKX A;  2M34 A;  1IG7 A;  2X6W A;  4L9V A;  1XC5 A;  1SVM A;  1EV7 A;  4KN7 X;  4MO7 A;  2CUZ A;  3I4M J;  1WJ5 A;  3SFZ A;  1U0J A;  4IRI A;  3TO6 A;  3TP0 A;  1U9N A;  3L1P A;  2VC0 A;  3LAP A;  1TWG J;  1UG2 A;  1YW8 A;  3WHC A;  3HG9 A;  5FD5 A;  4B44 A;  3JRG A;  2YU9 J;  2WAE A;  4YEJ A;  2M30 A;  1JT6 A;  4RGS A;  1W1W E;  4QPO A;  4YIF A;  1DU6 A;  1HW1 A;  3O3K A;  2IGK A;  4HBL A;  1TBX A;  2OD5 A;  3MKL A;  2R7V A;  2X6X A;  2EBI A;  3W6K B;  3DKW A;  2CW7 A;  2R7O A;  3E97 A;  2BZT A;  4RLF A;  3JRC A;  2P5L C;  4UUV A;  1XPX A;  2M1B A;  3QYB A;  5CVI A;  1CF7 A;  5H20 A;  3KFW X;  4H4K C;  3LNQ A;  1ZLK A;  2NXN B;  2WAQ N;  1FX7 A;  4M9X A;  1EA3 A;  2XAQ A;  4UUS B;  3OYK A;  2E2J J;  2H8R A;  2OV7 A;  2LG4 A;  1SMY F;  1YIJ I;  3W6V A;  1WCM J;  3O8H A;  1YLF A;  4HF0 A;  2RQQ A;  2KIQ A;  1S7O A;  2K5C A;  3OYD A;  1S6L A;  3QOD A;  2QQ9 A;  4LB5 A;  5ED4 A;  4JP0 A;  4J19 A;  1F5T A;  3GZN B;  4HLX A;  4WXH A;  2BOL A;  4AUX A;  1DDN A;  4LIU A;  4FIS A;  1O3R A;  1HLV A;  1WJC A;  2CV1 A;  2IS1 A;  1ZAR A;  2E60 A;  2PEX A;  3H3Z A;  3IH4 A;  3MKY B;  3HM5 A;  3CD6 I;  2ACJ A;  1Z1D A;  3GTO J;  2HVR A;  1UHM A;  2DU9 A;  2WB1 A;  4WXC A;  4XRS G;  3FXM A;  3ZQI A;  4JX6 A;  3MD2 A;  5E79 C;  5B66 C;  3C1D A;  5D8K B;  4CSW A;  3CCJ I;  1R58 A;  3ZN1 A;  3OYC A;  2PMZ N;  4Z2Y A;  2XPU A;  3CF5 F;  2DFF A;  1MNE A;  4EM1 A;  4CYD A;  5AIQ A;  1D8K A;  2FOK A;  3CDH A;  4GFB A;  2ZXI A;  4RS8 A;  2M4G A;  4CUG A;  4KFC A;  4KIS A;  3BPX A;  3PM1 A;  3DCF A;  1XGO A;  4BE1 A;  1VTN C;  2F4O B;  4RB2 C;  4O3M A;  3ZGK A;  3ZRG A;  4B1R A;  3MQ0 A;  2V9V A;  2L9S A;  3DBR B;  4HYE A;  3T0Y A;  4AVP A;  3BR6 A;  4BEH B;  3R0J A;  4UB6 C;  3SZP A;  2ESH A;  1VQM I;  5CVR A;  3L2W A;  2JT1 A;  2LH9 A;  4BXX J;  4I01 A;  4PJ0 C;  3IWF A;  5TJJ A;  2YR2 A;  3QP5 A;  2AO9 A;  3HTU A;  2EV0 A;  5IY5 H;  2DJN A;  1P2F A;  3CME I;  3H5N A;  3IP4 B;  1K6O A;  2L9V A;  1IZ1 A;  3J80 Z;  1JGS A;  4D7M A;  4ESB A;  3NEU A;  3HSE A;  1ZRC A;  2YX4 A;  4KIC A;  2FBH A;  4AYB A;  4I99 C;  2ID3 A;  1WJB A;  1IUF A;  3KP7 A;  1WGX A;  3K2Z A;  1IRF A;  2RRE A;  2V1N A;  1JHH A;  1TWF J;  2P6T A;  2P5K A;  2ICW G;  4QLC U;  3PQJ A;  2Q2E A;  2ZO4 A;  2IW5 A;  3IUO A;  3L2U A;  2STT A;  4L0Y B;  2CYY A;  2KDZ A;  3MCZ A;  3GLL A;  3DBH B;  2JRM A;  3QRF F;  2CGP A;  2CUJ A;  5IPA A;  5IT3 A;  2EPF A;  3LSK A;  1Z7U A;  2DCE A;  2W57 A;  2R7Q A;  5HDK A;  3OOU A;  2GXG A;  5J6X A;  3QAH A;  2QVO A;  3L9F A;  4FAS D;  2XAS A;  1TQI A;  4LK0 F;  3VYT B;  2WWY A;  4E7H A;  4A3K J;  2CW8 A;  1IF1 A;  2JA8 J;  4ABZ A;  2A6T A;  2V4J C;  5E3M A;  4GXO A;  2LYC A;  2IA1 A;  3FMR A;  3H0D A;  1MSF C;  5EG0 A;  3GBG A;  5F0C A;  5HOO A;  1RUN A;  1Z9C A;  3DP7 A;  3TDZ C;  2VQH A;  1VQP I;  2HQN A;  2NS8 A;  3T8T A;  5HOD A;  2H1K A;  1ZR2 A;  1WQ2 A;  3CCV I;  3IH2 A;  1Z91 A;  2MLG A;  4EQQ A;  1RR7 A;  3I9V 2;  1F9N A;  1A36 A;  3A0H C;  4A93 J;  2R7U A;  5E17 F;  4FTH A;  5BNG A;  2BHY A;  3E6M A;  3JAM R;  4BUP A;  1VQ5 I;  1XCV A;  2X1E A;  3H5R A;  4ZZD A;  3F21 A;  3WGI A;  3A1Y A;  2AQF A;  2NOJ B;  3K1M A;  5JLW A;  4NC8 A;  2R7W A;  1K4S A;  3BLY A;  2XPV A;  1OCC H;  1D1A A;  3DEE A;  1R22 A;  1I27 A;  3OYF A;  1V5G A;  3FXR A;  2V79 A;  1YE9 A;  2ZME C;  3EUH C;  5AON A;  4BAC A;  4A3C J;  3IC7 A;  2IPQ X;  1KU7 A;  3C2B A;  1FZP B;  2OCC H;  4LIT A;  1ETQ A;  2VPL A;  1M1E B;  1MGT A;  4HX7 A;  1IRX A;  2GIV A;  4XNF A;  2XSD C;  3MWM A;  4A3M J;  2CQN A;  3BG7 A;  1X1B A;  3AAF A;  3V8L A;  3KP2 A;  3SDB A;  1NHA A;  1G3T A;  1BR4 A;  4KJZ A;  1Y8Q B;  2GQQ A;  2E1O A;  3BWG A;  3RIR A;  1EH6 A;  5E18 F;  3ZMZ A;  4BDZ A;  5FLX K;  2F5C A;  3BOQ A;  3WGH A;  1VQO I;  3F72 A;  2K27 A;  4P5O A;  1GVD A;  2GZW A;  3DF8 A;  1EKE A;  2B9S A;  3HOT A;  3CUQ B;  4L5E A;  1YTY A;  1PDN C;  4XKC A;  3BR5 A;  2M8E A;  2FBI A;  2R7T A;  1QPM A;  2W24 A;  2VQL A;  4M3B A;  3I64 A;  3M8F A;  1J75 A;  1ODD A;  2X51 A;  2CJJ A;  4MGR A;  3KEY A;  2EZI A;  5BMZ A;  3ZQ7 A;  4WCG A;  4XON A;  2LRE A;  2YUS A;  5GAG J;  5BPI A;  5CLS A;  2KRH A;  2UXX A;  1BOA A;  1Z67 A;  1U8R A;  2Z2S B;  1ZK8 A; 
#chains in the Genus database with same CATH homology
 3E6D A;  5LEJ A;  3BDD A;  3M9A A;  1FP1 D;  4EVI A;  2GWR A;  1RI7 A;  1XD7 A;  1LDD A;  5JI6 A;  3DEU A;  2EV6 A;  1TW3 A;  3I53 A;  3ELK A;  2HFH A;  1S8N A;  5F64 A;  2DFI A;  2BV6 A;  5HS9 A;  4HA8 A;  4HF2 A;  3ZMS A;  3RKY A;  3FM3 A;  4Y17 A;  2EJR A;  2DPU A;  1F4K A;  3QOP A;  3ZMV A;  2EA2 A;  4A0Y A;  4U88 A;  3ABU A;  4RGU A;  1IUY A;  2BYV E;  3GF2 A;  4LD5 A;  3MAJ A;  2XHK A;  1KYZ A;  5D8L B;  1LEB A;  3DPL C;  4GYI A;  2PQ8 A;  2FQ3 A;  3WTU C;  2QBY A;  3W6J B;  5L3F A;  2IJL A;  2DI3 A;  2JRT A;  1PP8 F;  1MJB A;  1X3U A;  5H6R A;  3BY6 A;  4CDG A;  2PBI A;  2EA4 A;  3C3W A;  5DDG A;  3IHU A;  2X0L A;  2PMU A;  1MDM A;  2EB7 A;  3R0A A;  2B0L A;  2STW A;  3LA2 A;  4JQF A;  1DP7 P;  3C7J A;  4YII A;  3EYY A;  4K2E A;  1YO5 C;  3I4P A;  1WSU A;  1LNW A;  2LDU A;  3MFK A;  4LMY A;  2KIU A;  4A0Z A;  2PJP A;  4HLY A;  3RPU A;  5D6F A;  2XRO A;  2DTR A;  1HKQ A;  3DPT A;  3BJA A;  4HOB A;  1LDK B;  3I5U A;  3GZ6 A;  1USS A;  2FEZ A;  3F8C A;  2TDX A;  3JAM Z;  3SHF A;  2YU3 A;  3S2W A;  4MTE A;  2CO5 A;  3HRM A;  3LQR A;  4ZYH A;  2ZNY A;  3LA3 A;  2CQK A;  4Y15 A;  4ENK A;  3U2R A;  1I1S A;  1FBU A;  4UV9 A;  4UVB A;  4RGX A;  3WTT C;  3QPT A;  1J9I A;  3COA C;  3JSO A;  1KA8 A;  3FM5 A;  2FU4 A;  1S7A A;  5CVV A;  2UXN A;  2CFX A;  1ZHF A;  3V4G A;  2NAZ A;  2HEO A;  4ZYD A;  2H6B A;  2L01 A;  4WXD A;  1BBY A;  3T1B A;  5ILV A;  1R36 A;  1RZ4 A;  4P55 A;  1SFE A;  5KK1 A;  3D5L A;  3GXO A;  3PQK A;  1XMA A;  1DPU A;  3U9G A;  4M72 A;  2L4A A;  2VBZ A;  4G7Z F;  1OMI A;  3F8M A;  1O3Q A;  3K69 A;  5LRS A;  4CZZ A;  2VXZ A;  4EJV A;  4HV6 A;  3HTS B;  2ZFW A;  2DK8 A;  1GXP A;  3U1D A;  3KP4 A;  5K5Q A;  2HGC A;  3TO7 A;  3KEQ A;  2GA1 A;  3WG9 A;  1I6X A;  2HYG D;  1R00 A;  1FNN A;  2OA4 A;  5FGM A;  3P9I A;  2P6S A;  2V1D A;  3ROU A;  3BPV A;  2MH9 A;  2M45 A;  2ELH A;  1J7K A;  3V7R A;  4B8X A;  3FWE A;  3KP5 A;  5BQT A;  4KIF A;  1HW2 A;  4LGW A;  1ZG5 A;  2QM3 A;  5HS8 A;  1W7P B;  5HDG A;  2QBY B;  2O8X A;  2O3F A;  3ML6 A;  2WV0 A;  2XVC A;  3WE2 A;  4A0X A;  2C6Y A;  4EV0 A;  4A2U A;  4IRH A;  4A6E A;  3B02 A;  3F22 A;  4OIQ F;  4OIP F;  3F8N A;  3TQN A;  4GGG A;  4Q47 A;  4AIJ A;  3BJO A;  2COM A;  5CJ9 A;  5DD8 A;  2HWV A;  1BJA A;  1MD0 A;  1YIO A;  2QLZ A;  1XGS A;  1AOY A;  1K7A A;  6PAX A;  2ZCW A;  4ENN A;  1DPR A;  2IA2 A;  1YYV A;  4IVN A;  4PGH A;  3TOB A;  2KKO A;  1DUX C;  1FP2 A;  4M71 A;  2G7U A;  4OMY A;  1L0O C;  4N9I A;  4OIR F;  2ISZ A;  4I09 A;  1Q1H A;  2DQL A;  5BOX A;  2D45 A;  3IKT A;  2PN6 A;  2V6C A;  4DNC A;  3CTA A;  2Z99 A;  4S04 A;  4LK1 F;  4M74 A;  3CO7 C;  2RDP A;  3IL2 A;  3FX3 A;  4I0B A;  5DD4 A;  4CXF A;  3CUQ A;  1FBS A;  4KDP A;  4Q48 A;  4HW0 A;  3SZT A;  4ZYG A;  4LLN A;  1AWC A;  2Y0M A;  5F6F A;  2P4W A;  5A2Q K;  4WX9 A;  3WE3 A;  5JR3 A;  2IVM A;  1TW2 A;  4U0Y A;  4WWC A;  3ECH A;  2O6G E;  4M9Z A;  1XSV A;  5L3E A;  1QZZ A;  4LLL A;  3GX4 X;  4L18 B;  3HHH A;  4FHT A;  5IT9 K;  2FA5 A;  1SD6 A;  1V3F A;  2O03 A;  3JTG A;  3ERE D;  4LG0 B;  4L5J A;  4BHP A;  4BH9 A;  1IN8 A;  1FSE A;  1J2X A;  4UVA A;  1XMK A;  2H94 A;  4ON0 A;  2FSW A;  3HYI A;  2K4J A;  2IRF G;  2RVC A;  4EM2 A;  2GAU A;  3IRR A;  2L54 A;  1B9N A;  4KYW A;  2W85 A;  2PLY A;  4CO8 A;  4XBF A;  4HX8 A;  2ISY A;  4HDV A;  1QZY A;  1TTY A;  2ESN A;  1KQ8 A;  5DV5 A;  2ZKZ A;  4BQA A;  1SAX A;  2DLL A;  1WKM A;  3EET A;  3F3X A;  4Q5S F;  1BI0 A;  2Z9O A;  1REP C;  1BI2 A;  2X4H A;  1EH8 A;  4HDU A;  1XDU A;  5LRR A;  4R8H A;  1W5T A;  2VC1 A;  2AXL A;  2L02 A;  3C18 A;  1SD4 A;  3MEX A;  1QNT A;  2FBK A;  1FOK A;  2DAO A;  3FMS A;  3WTZ A;  5L3C A;  3SQN A;  5FB2 A;  1SD5 A;  1XDS A;  5FFZ A;  1LEA A;  2OZ6 A;  5K5R A;  3FMQ A;  5DCF A;  2JSC A;  3B73 A;  3WTY C;  4I7H A;  4U0W A;  4EGY A;  1W5S A;  3HSR A;  3E6B A;  1WRJ A;  3TDU C;  2EFP A;  1CGP A;  4YG2 F;  1B6A A;  2HS5 A;  2BBY A;  2CSO A;  2A5Y B;  3N97 A;  1OKR A;  2D1V A;  1U5T A;  1OPC A;  4OOI A;  5KVR A;  4BNC A;  3F6O A;  1B4A A;  1ZRF A;  1OR7 A;  3GFM A;  1ZG3 A;  1G4D A;  2RV8 A;  2F5D A;  4ZZL A;  1IN7 A;  3K9T A;  5D4S A;  3I59 B;  2H09 A;  4MQV A;  3ZMU A;  3WOD F;  4NHJ A;  1RIO H;  4IPA A;  1G6N A;  1LJ9 A;  2CW0 F;  2WC2 A;  5DCM B;  1ON2 A;  5FO5 A;  5JFR A;  1KU2 A;  4XRF A;  1XSX A;  1RNL A;  5E8G A;  3ECO A;  2IA0 A;  3BJ6 A;  1BC7 C;  1HW5 A;  2NNN A;  3V7C A;  2FXA A;  3M8E A;  5ERI A;  5ILS A;  4ZH4 F;  4FX0 A;  2KRF A;  2A3S A;  4D0P A;  3HIF A;  3GFJ A;  1H9G A;  4HV5 A;  3IRQ A;  2K7L A;  2JPC A;  1WI9 A;  2FML A;  4BAY A;  3KP3 A;  3JW4 A;  2HDC A;  1T98 A;  3ZMD A;  2DQR A;  1IW7 F;  4S05 A;  3J81 Z;  3WU0 A;  4UVC A;  1E2X A;  3BP8 A;  4UXN A;  1ZAO A;  4BHB A;  1YS6 A;  2CWE A;  5DYM A;  2L4M A;  2P7C B;  3FXU A;  1T6S A;  1R1T A;  1TQP A;  4G6D A;  5ICE A;  4G8X A;  1Y0U A;  3GYH X;  4OMZ A;  4M6X A;  2RN7 A;  3VOD A;  3HHG A;  1FT9 A;  1KGS A;  4OU0 A;  5LBQ A;  1W7P A;  1D3Y A;  4ASN A;  2O61 A;  4L0Z B;  3TOA A;  5HLG A;  3JSP A;  3QPH A;  1YW7 A;  3FZV A;  1UST A;  2F5F A;  1MZB A;  4PCQ A;  1KQ9 A;  2A61 A;  3ZP5 A;  2VOD A;  4LB6 B;  2QEN A;  4U7B A;  1L3L A;  1D5V A;  3RJP A;  2YX7 A;  4P96 A;  1FYM A;  2FE3 A;  5L3D A;  1C0W A;  1HKS A;  2OQR A;  2PG4 A;  1TQM A;  2D2W A;  1LVA A;  1RUO A;  3P9C A;  4PZJ A;  2ZNZ A;  4PDK A;  3KZZ A;  3P7N A;  3VFZ A;  1J59 A;  4BYY A;  5D4R A;  3J80 K;  2RQP A;  3VOE A;  3L00 A;  3QU3 A;  4G94 A;  2VT3 A;  4OIN F;  1U6G A;  5L3G A;  2VON A;  1IN6 A;  4I02 A;  1U5T B;  1K78 B;  3Q9S A;  1P4W A;  4HZF A;  2V1X A;  3LST A;  1PP7 U;  4HAM A;  5CVJ A;  2MBF A;  5TRD A;  2MA3 A;  1J5Y A;  5FFX A;  3R4K A;  3V7S A;  3L2C A;  1STZ A;  4F7Z A;  2DPD A;  4XSZ F;  4CIC A;  1ZGA A;  3NRV A;  5LHI A;  2H6C A;  5EEG A;  1ZH5 A;  4KMF A;  4I2O A;  2OZU A;  3Q9V A;  4EMS A;  1JXS A;  1XSD A;  2Z33 A;  3KP6 A;  3D0S A;  4GO1 A;  4NQW A;  3NQO A;  4LG0 A;  3HOS A;  5ICC A;  2XAF A;  4L9T A;  1UB9 A;  4IHT A;  4AIK A;  1ZLJ A;  4A5N A;  1YFH A;  1ZRE A;  1T39 A;  4XLN F;  1T38 A;  2K02 A;  2G9W A;  3LA7 A;  2XAG A;  2XKO A;  1IN5 A;  2VBW A;  1W7P D;  4N9H A;  2QQA A;  1XGM A;  3RTR A;  2EWN A;  1Z6T A;  2LNB A;  3VEP A;  3CUQ C;  2HTJ A;  4YFN F;  2MLK A;  1V4R A;  3LFK A;  4GCV A;  1GVJ A;  3ZPL A;  4TV7 A;  1KQ0 A;  3KEO A;  3RI4 A;  1FSH A;  4E70 A;  4IF4 A;  5LGU A;  2A69 F;  4WK8 F;  4H0E A;  4MQ9 F;  2OQG A;  1T2K A;  3HUG A;  1G3W A;  2J5P A;  1P4A A;  1YG2 A;  2ZME B;  1HSJ A;  4WF2 A;  3PFI A;  4YFX F;  2IP2 A;  2R3S A;  3GUD A;  3LWF A;  1ZGJ A;  3DQV C;  2EFQ A;  4UHT A;  2XV4 S;  5FLX Z;  2RKH A;  5LGN A;  3E6C C;  3L09 A;  2P8T A;  1BC8 C;  1IN4 A;  3Q5F A;  5ICF A;  3HRT A;  1F1Z A;  2HZT A;  3M7G A;  1FYK A;  3CUO A;  4AD9 A;  4EJO A;  1R5H A;  1FBQ A;  2NNY A;  2M87 A;  2QZ8 A;  2PI0 A;  3RDI A;  2VOO A;  1R1V A;  2HTS A;  3I59 A;  4RB3 C;  3E3V A;  1BI3 A;  3JTH A;  2VBX A;  1I5Z A;  2QYO A;  4G7H F;  1TNS A;  3FF5 A;  3N4M A;  4O6J A;  5DCM A;  5J8F A;  4ESF A;  3CLO A;  1G3S A;  1YW9 A;  3O6B B;  4O5V A;  1UHW A;  3I71 A;  1U3E M;  4KNY A;  5LEK A;  2DO7 A;  3ABT A;  3JAM K;  5HDN A;  2XKP A;  2P7V B;  4IJA A;  5JHU A;  3MZY A;  3EQL F;  1FLI A;  1G3Y A;  1LQ1 A;  4GYG A;  1ZN2 A;  5BS6 A;  2Z3Y A;  1TNT A;  4ESJ A;  2KIF A;  2OAZ A;  1U5T C;  1EH7 A;  1R23 A;  4EGZ A;  2P5V A;  1UCR A;  1BM9 A;  1S3J A;  3KZY A;  4A5M A;  2KJB A;  2LF8 A;  5E20 A;  1FYL A;  3RYR A;  3GVA A;  2DW4 A;  2QWW A;  3T5X A;  1SFX A;  2JTV A;  4P9F A;  3M1E A;  2FNP A;  1R5G A;  3G3Z A;  2KJC A;  3F6V A;  1K79 A;  1SMT A;  2A6E F;  3H3U A;  1D8J A;  2DBB A;  3F8B A;  2G7H A;  2XGX A;  4HX4 A;  2BE5 F;  2ZBK A;  4I0A A;  4FT8 A;  1T0F A;  1KU9 A;  3OOP A;  1TLH B;  4EJW A;  3HRU A;  3TO9 A;  1QO0 D;  1IXR C;  2OBP A;  3HRS A;  4ZYE A;  3E5X A;  5HVQ C;  5DEQ A;  1O3T A;  3GFL A;  3ZN0 A;  5K1Y A;  4RB1 A;  2O0Y A;  2XAJ A;  3QU6 A;  3GZ5 A;  4MHG A;  3EDP A;  3GLX A;  1FPQ A;  3K1N A;  3IWZ A;  4G6Q A;  1HBX G;  1GHC A;  2WTE A;  1GXQ A;  2DK5 A;  1ON1 A;  1QQI A;  4EJT A;  4FX4 A;  1FY7 A;  1QBJ A;  3BRO A;  4A12 A;  2OU2 A;  3FHZ A;  4KUM A;  3DV8 A;  5D5U B;  3V8K A;  4AWX B;  2YPR A;  2W84 A;  5LHG A;  3WTV C;  5E1Z B;  4YFK F;  3RPQ A;  2NS0 A;  2HKO A;  5CVU A;  2JZY A;  1I1G A;  2CG4 A;  2MD5 A;  2XIG A;  2K4B A;  4ENM A;  5LHH A;  4XLP F;  3RKW A;  1MJ9 A;  3I54 A;  4ETS A;  4KIB A;  1K78 A;  1O3S A;  1B9M A;  1QGP A;  3RYP A;  4IHS A;  2GA2 A;  5DUK A;  1FWZ A;  3P9K A;  3VB2 A;  4XSX F;  2HQR A;  1BIB A;  1U2W A;  2D1H A;  5ICG A;  1U78 A;  2LF7 A;  3REO A;  2XRN A;  1E17 A;  1IXS B;  4MNU A;  4EJU A;  2RGV A;  1R1U A;  1HXD A;  4CHU A;  4KA4 A;  3KE2 A;  3GO5 A;  2E1N A;  2LKP A;  3ISP A;  1CF7 B;  4BXU A;  1ZYR F;  3HSF A;  1BN5 A;  4B09 A;  4PGG A;  1BI1 A;  4MTD A;  2H27 A;  2DT5 A;  3I0T A;  5FD6 A;  4IRG A;  3LAJ A;  1B59 A;  1MJA A;  2K86 A;  4MEY F;  2PMH A;  2F5E A;  1P6R A;  4MEX F;  2QUF A;  4L5I A;  4RB0 A;  1R7J A;  4ENJ A;  4AIH A;  4OIO F;  2HOE A;  3G73 A;  2BEO A;  2EFW A;  2Q0O A;  2RC4 A;  3OV8 A;  1ZRD A;  2E1C A;  2ETH A;  3DFG A;  1XCB A;  4CGZ A;  2FNA A;  2ZXJ A;  2KIM A;  2Q8K A;  3KLO A;  4U7D A;  1LDJ A;  5D5X B;  4JBA A;  1HST A;  2YSR A;  4L9J A;  3IKV A;  3FXQ A;  3WTW C;  4G7O F;  3TGN A;  3KCC A;  2ADU A;  4N0B A;  3WTX C;  4HF1 A;  1ONV A;  1B1B A;  2F2E A;  3LQQ A;  4P9U A;  3CJN A;  2ZME A;  1O7F A;  3GFI A;  3EUH A;  5E1W A;  2E7W A;  3O2P E;  3CO6 C;  1YQA A;  5D6E A;  1A04 A;  2MH2 A;  5E8I A;  1HQC A;  5EEH A;  4U0V A;  5ILU A;  4Q4Z F;  5AIP A;  2A07 F;  4HQM A;  1JHF A;  1XB4 A;  4KT5 C;  5LGT A;  2Y75 A;  3BZ6 A;  2NYX A;  1O57 A;  1OYW A;  3SXY A;  2XUB A;  1SD7 A;  2VT2 A;  1Z05 A;  3L7W A;  5D5W B;  2L3D A;  5DUI A;  4KIG A;  4QWQ A;  1Z6R A;  2QQB A;  4M73 A;  3T8R A;  5A2Q Z;  1J0R A;  2JPB A;  1P92 A;  2W25 A;  2VE8 A;  3DXJ F;  4LFU A;  2VOP A;  2EFO A;  3MZH A;  5E1X A;  3V8J A;  2FRH A;  4R79 A;  5IT9 Z;  3R61 A;  2J5O A;  2BGC A;  4RAZ A;  1KU3 A;  3K1P A;  4G9Y A;  3I58 A;  2PFB A;  2VN2 A;  1IAW A;  3WTS C;  5BPD A;  2R7F A;  1W4M A;  4IXA A;  3F23 A;  4KN4 X;  5K5O A;  2Y48 A;  3EYI A;  3GW2 A;  3GEZ A;  4EM0 B;  2VE9 A;  2A68 F;  4JK1 X;  1S29 A;  5HLH A;  3WGG A;  5J8C A;  1HKT A;  1YS7 A;  4RAY A;  1ULY A;  4M6Y A;  4I98 B;  2VBY A;  3GWZ A;  2RNJ A;  1FC3 A;  5CYV A;  2Z5U A;  1ZG1 A;  5D5V B;  1P4X A;  4UNO A;  1IXC A;  2FF4 A;  3K0L A;  1UFM A;  4LLG F;  5H6Q A;  3QP6 A;  1IRG A;  2LSO A;  5JVT A;  3TKY A;  4KMU X;  2GXB A;  4RGR A;  2MC3 A;  2HR3 A;  3E5U A;  5L3B A;  3KET A;  3ULQ B;  2XAH A;  3ZMT A;  3WU1 B;  1XGN A;  1H9T A;  4LJZ F;  2EFN A;  5HLI A;  1OYY A;  1BIA A;  2UZK A;  2EK5 A;  3KLN A;  5F1R A;  2R7D A;  4Y13 A;  4UV8 A;  2A6H F;  1PUE E;  4DQ2 A;  4HQE A;  2EV5 A;  3J7A O;  2E7X A;  4R1H A;  4M9S A;  1XN7 A;  1WWX A;  3R60 A;  4BHC A;  3J81 K;  4L9N A;  1H0M A;  2UWM A;  3H92 A;  5LLQ A;  1LB2 A;  2M5W A;  2HKX A;  1MDM B;  4NB5 A;  2HYF A;  5HS7 A;  2NRA C;  2ZJ2 A;  1KYW A;  3F8F A;  3R6S A;  2AS5 F;  1MKM A;  1OYI A;  1JE8 A;  1O7L A;  2V1U A;  1SFU A;  2FMY A;  2IT0 A;  3E5Q A;  4A6D A;  3RKX A;  4L9V A;  1EV7 A;  4KN7 X;  3SFZ A;  4IRI A;  3TO6 A;  2VC0 A;  3LAP A;  1YW8 A;  5FD5 A;  2M30 A;  4RGS A;  4YIF A;  1HW1 A;  3O3K A;  4HBL A;  1TBX A;  2OD5 A;  3W6K B;  3DKW A;  3E97 A;  2P5L C;  4UUV A;  2M1B A;  5CVI A;  1CF7 A;  5H20 A;  3KFW X;  1ZLK A;  1FX7 A;  4M9X A;  2XAQ A;  1SMY F;  1YLF A;  4HF0 A;  1S7O A;  1S6L A;  4LB5 A;  2QQ9 A;  5ED4 A;  1F5T A;  4HLX A;  4WXH A;  1DDN A;  1O3R A;  1ZAR A;  2PEX A;  3H3Z A;  2ACJ A;  1Z1D A;  1UHM A;  2DU9 A;  4WXC A;  3C1D A;  5D8K B;  1R58 A;  3ZN1 A;  4Z2Y A;  4EM1 A;  4CYD A;  5AIQ A;  1D8K A;  2FOK A;  3CDH A;  4RS8 A;  4KFC A;  3BPX A;  1VTN C;  1XGO A;  4RB2 C;  4O3M A;  3MQ0 A;  2V9V A;  4AVP A;  4HYE A;  3T0Y A;  3R0J A;  3SZP A;  2ESH A;  5CVR A;  2JT1 A;  4I01 A;  3IWF A;  5TJJ A;  2YR2 A;  3QP5 A;  3HTU A;  2EV0 A;  1P2F A;  1K6O A;  1IZ1 A;  3J80 Z;  1JGS A;  4ESB A;  3NEU A;  3HSE A;  1ZRC A;  2YX4 A;  4KIC A;  2FBH A;  3KP7 A;  3K2Z A;  1IRF A;  1JHH A;  2P6T A;  2P5K A;  4QLC U;  3PQJ A;  2Q2E A;  2ZO4 A;  2IW5 A;  2STT A;  4L0Y B;  2CYY A;  3MCZ A;  2CGP A;  3QRF F;  5IT3 A;  1Z7U A;  2W57 A;  5HDK A;  2GXG A;  5J6X A;  3QAH A;  2QVO A;  3L9F A;  2XAS A;  1TQI A;  4LK0 F;  2WWY A;  1IF1 A;  4GXO A;  2IA1 A;  3FMR A;  5HOO A;  1RUN A;  1Z9C A;  3DP7 A;  3TDZ C;  2HQN A;  3T8T A;  1WQ2 A;  1Z91 A;  2MLG A;  4EQQ A;  1F9N A;  5E17 F;  3E6M A;  1XCV A;  4ZZD A;  3F21 A;  3WGI A;  3K1M A;  1R22 A;  1I27 A;  3FXR A;  2V79 A;  5AON A;  3IC7 A;  2IPQ X;  1KU7 A;  1FZP B;  1MGT A;  4HX7 A;  2GIV A;  3MWM A;  3AAF A;  3V8L A;  3KP2 A;  1NHA A;  1G3T A;  2GQQ A;  3BWG A;  3RIR A;  1EH6 A;  5E18 F;  3ZMZ A;  5FLX K;  2F5C A;  3BOQ A;  3WGH A;  3F72 A;  2K27 A;  4P5O A;  2GZW A;  3DF8 A;  3HOT A;  3CUQ B;  1YTY A;  1PDN C;  2M8E A;  2FBI A;  1QPM A;  2W24 A;  3I64 A;  3M8F A;  1J75 A;  1ODD A;  4MGR A;  5BMZ A;  3ZQ7 A;  4WCG A;  5BPI A;  5CLS A;  2UXX A;  1BOA A;  1U8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...