1DPRA

Structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOX REPRESSOR
publication title Structures of the apo- and the metal ion-activated forms of the diphtheria tox repressor from Corynebacterium diphtheriae.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulation
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1dprA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1dprA02
3F8FA 4P5OA 1IXSB 2FBHA 2LF8A 1S3JA 1ZRFA 3PFIA 1A04A 4BHBA 4RB3C 3CLOA 1P6RA 3JTGA 4AWXB 1V4RA 1J9IA 5JFRA 1WRJA 1FP1D 2FBIA 4KT5C 2NNNA 3WTZA 3FMSA 3J80K 2ISYA 2IPQX 3V7SA 2K7LA 2XASA 4IHTA 5DV5A 1IN8A 2O3FA 4LFUA 2VC0A 3NQOA 4KFCA 3WGHA 1O3QA 4HA8A 3M7GA 2ACJA 2RKHA 3GUDA 4KIFA 4OIPF 4OINF 4N9IA 5KK1A 1R1TA 2OZ6A 4M72A 4ZYGA 3JAMZ 4CDGA 3ZPLA 4KIBA 2P4WA 4RB2C 3K2ZA 4AIJA 3ZP5A 1ZGJA 2OU2A 3I53A 4A0YA 1HXDA 4L9NA 5H20A 2BGCA 3PQKA 2EB7A 5D5UB 2XAGA 5DEQA 1KU2A 2DTRA 4O5VA 2A6EF 5E1ZB 4U0VA 1KU3A 3CDHA 4HYEA 2R3SA 5LGUA 4YG2F 3RJPA 2ISZA 4UNOA 2O0YA 2ZBKA 1IN6A 3ZN1A 5IT9Z 1R1VA 2ZJ2A 3RIRA 3RKXA 4L5IA 4IRGA 3JSOA 1O7LA 4ZYDA 3KP3A 1G3SA 3I5UA 3ROUA 1K6OA 3F3XA 1IN5A 5FGMA 1RUOA 1SD4A 5J8FA 4U0YA 1K78A 3IHUA 4CXFA 3GZ5A 1KYWA 3KP4A 5BPIA 3J81K 1TQIA 3ABUA 1ZHFA 2ZMEB 3F6OA 1ZH5A 4OMYA 5CVUA 1TQPA 4EMSA 3E5XA 3SHFA 5E1WA 2D1VA 4A12A 4P9UA 4MNUA 2CO5A 4RGRA 2FNPA 3SQNA 1KGSA 5L3DA 2MC3A 4AIKA 2HR3A 1DDNA 2E1CA 3E5UA 1HQCA 2ZMEA 2M8EA 6PAXA 1IW7F 4RB1A 3S2WA 5FB2A 4MTDA 2CQKA 3HSRA 2Z33A 2ADUA 2FF4A 1P4XA 1KU7A 3HRMA 1JHHA 2FSWA 1OMIA 3KP2A 3MCZA 5LGTA 1BI2A 1GXQA 4LK0F 1R58A 2A61A 5D6EA 4YFNF 2MLGA 2A68F 2O6GE 2JSCA 5K5QA 3WTUC 1QGPA 3K1PA 3BPXA 2VOOA 1B6AA 5D5WB 1WWXA 1YTYA 5HVQC 2BYVE 2QUFA 3QP5A 3R0AA 2ZKZA 4OIRF 3ZMDA 4H0EA 2A07F 5LEKA 4HLXA 3RDIA 2F5EA 1SMYF 2COMA 2IA1A 5CLSA 4ZYHA 2YX7A 2KJCA 2DI3A 1DUXC 3U2RA 4WWCA 2WWYA 4HF1A 3GXOA 3I64A 3ABTA 4ZYEA 3WTSC 4IRIA 3FWEA 3TDUC 3GFLA 3TOBA 4WXHA 3V8LA 4XRFA 2PMHA 4EGYA 2HWVA 3MFKA 1ZN2A 3N4MA 1Z05A 2QENA 1JE8A 1D8KA 5F64A 3P9IA 1J75A 1TQMA 1R7JA 3ZMTA 5AIPA 1S8NA 4KUMA 4FHTA 1UHWA 1U78A 5LHHA 2L4MA 2V1DA 3K69A 2HOEA 4ON0A 4A5MA 3IWZA 3EYYA 5HOOA 1QPMA 2XAJA 3QRFF 3RPUA 3V7CA 2R7FA 2FU4A 2PEXA 1HBXG 3F8CA 4EV0A 3O6BB 4BQAA 4Q5SF 5BS6A 1LDJA 1BI1A 1LJ9A 4HW0A 4HAMA 3E97A 1FY7A 3RYRA 2MD5A 2ZXJA 4MEXF 4LLGF 4N9HA 4B09A 1SFUA 3BROA 4EJOA 1Z9CA 4EJWA 1R36A 2A69F 1YFHA 3DP7A 1T38A 3B02A 4P55A 5AONA 3ZMVA 3KFWX 2X0LA 2EFOA 3F6VA 1LDKB 4Z2YA 3T8TA 2OD5A 4KMUX 2EFWA 3GZ6A 3RI4A 1TW3A 4GYIA 5LBQA 3GF2A 1MGTA 2XKPA 3T0YA 4EJTA 3F8BA 5ILUA 1W5TA 2QZ8A 2VT2A 5DCMB 3ZMUA 1UFMA 2STTA 2VOPA 2M45A 2IP2A 4DNCA 4RAZA 3TO9A 3FMQA 3GVAA 4NQWA 3EYIA 2WTEA 4RAYA 4IHSA 4BH9A 1R5GA 4PZJA 2P7CB 3IWFA 2JTVA 5LRSA 2ZNYA 1Z6TA 3O3KA 1RUNA 3KEQA 3P9KA 3AAFA 2UXXA 4RS8A 1YW7A 3QPHA 2IW5A 1FZPB 1YW9A 2AS5F 2HFHA 5E17F 4M9ZA 5FO5A 1FOKA 4JBAA 1HKTA 1D8JA 4CGZA 2GA1A 1FSEA 1G3WA 3FZVA 1H9GA 4BXUA 3GLXA 2C6YA 1U3EM 3BPVA 1MKMA 2XHKA 1FC3A 3KP7A 2FBKA 3COAC 3ZN0A 2VBYA 4A6EA 2XUBA 1KA8A 4Y13A 3HTSB 4I01A 4HLYA 4ETSA 4ENNA 2K86A 1NHAA 2CSOA 1BOAA 4P9FA 4UXNA 1FBQA 5FFZA 5D4RA 5E1XA 2RDPA 2XIGA 3LA3A 3WTTC 4U7DA 5D5XB 4XBFA 5CVJA 4I0AA 5HDGA 3TDZC 5JHUA 1UHMA 2L4AA 1J0RA 4HV5A 1XCBA 2EK5A 3M1EA 3L09A 5BOXA 5K1YA 2QQ9A 1OYWA 1IAWA 4UHTA 1O3RA 3H3ZA 2EFPA 3KETA 1L3LA 4PGGA 2P8TA 4QWQA 3FXQA 4L9JA 2IJLA 2Q8KA 5HDNA 1HW5A 2CW0F 5ILSA 1XGOA 3E6CC 2ZCWA 3QOPA 2H6CA 1USSA 2G9WA 3TO7A 3QU6A 4OU0A 2DT5A 4QLCU 3CUOA 3KE2A 2M87A 2CG4A 1WI9A 5F1RA 4KDPA 1TW2A 2BV6A 3GWZA 3P9CA 4M6YA 1BN5A 1Z91A 2HS5A 3O2PE 2EV0A 5LLQA 1XDUA 3MZHA 3IRRA 2YPRA 1X3UA 3QAHA 2X4HA 1SD6A 4OMZA 2LDUA 2BBYA 4YFXF 4MQVA 1WSUA 1U6GA 2MA3A 1F4KA 1HKQA 1MJBA 4I2OA 4HBLA 4BHCA 2V6CA 4A5NA 3ECOA 1PUEE 2JT1A 4CO8A 5TRDA 1HW1A 3BDDA 2W57A 1AWCA 3VOEA 2FEZA 5CJ9A 2F5DA 3ELKA 3GFMA 4WX9A 2XRNA 4Q47A 2K4JA 3DKWA 1SFXA 2STWA 1W5SA 2HQRA 3KP5A 1K78B 2GAUA 1Z6RA 4PCQA 3ISPA 4YFKF 5DD4A 3JTHA 2P6SA 3FHZA 3BJ6A 4Q48A 1YYVA 2RNJA 2A6HF 2P6TA 3IRQA 3E3VA 2ETHA 3F22A 5FLXZ 3F72A 4E70A 5DDGA 1FWZA 4EJVA 2OAZA 3V8JA 1KQ8A 1MDMA 5A2QK 3FM3A 3WGGA 3ERED 2XVCA 1I6XA 1TNSA 2HZTA 5L3EA 3T5XA 2V9VA 4HV6A 3KZZA 3DEUA 5HLGA 3R0JA 3CO7C 3JSPA 2P5KA 2Z99A 4UVBA 1XN7A 2IRFG 1FYMA 1YQAA 1BIBA 2MBFA 5H6QA 1S7OA 4DQ2A 3VB2A 3MEXA 5IT3A 3M8FA 3GFIA 5L3FA 3BZ6A 3HYIA 3WG9A 4NB5A 3W6JB 3VFZA 4Y17A 4PDKA 1Q1HA 3TGNA 4IVNA 1D5VA 2RV8A 3HUGA 1QNTA 4A0XA 2HYGD 1IUYA 3W6KB 4S04A 1G6NA 2DPDA 4I0BA 3K1NA 1F1ZA 4G7HF 2HKXA 1ZREA 2LSOA 5J8CA 2VE9A 3MQ0A 3WGIA 2FE3A 3E6BA 1IXRC 3RKYA 2PLYA 2EWNA 3RKWA 3WTXC 1I27A 5JVTA 2W84A 1FYKA 3DQVC 3JAMK 4XLNF 5DYMA 4Q4ZF 4WF2A 3QP6A 1FNNA 4YIIA 4G7ZF 4NHJA 5CVRA 3QU3A 4N0BA 4LB6B 3MAJA 1FBSA 2XAQA 4MHGA 1TBXA 5ICFA 1H9TA 5J6XA 2YX4A 1TLHB 4YIFA 1LVAA 2DFIA 1HSJA 1CGPA 2D2WA 4MEYF 2DK8A 4L5JA 2DBBA 1U2WA 3H92A 3L7WA 5IT9K 3V7RA 3HSEA 1REPC 5E18F 1CF7A 2ZO4A 3M8EA 3R60A 1WKMA 2QQAA 3MWMA 4CZZA 3HHHA 4XSXF 2H27A 4Y15A 1SFEA 5E8IA 2GA2A 2GZWA 2CYYA 1GVJA 4BYYA 4M71A 1V3FA 2FQ3A 4KA4A 2DPUA 1IN7A 1YW8A 2W24A 2YR2A 3F8NA 2O61A 2Y48A 2DO7A 4F7ZA 1P4AA 2QM3A 3NEUA 2P5VA 1U5TB 3WE2A 2LKPA 2PFBA 4R1HA 3DPLC 2FRHA 3NRVA 4HX8A 4HX4A 1HW2A 2O8XA 3WE3A 3FX3A 1VTNC 4JQFA 5CYVA 4I98B 4KYWA 2HTJA 4HDUA 1H0MA 5JI6A 1ZG3A 4RB0A 4LLLA 4GYGA 3WODF 1EH8A 4LB5A 4HQMA 1U5TA 4EM1A 2J5PA 4L18B 2EFQA 4EM2A 5ICCA 4GXOA 3LFKA 1B59A 3GFJA 2VONA 3K9TA 3DF8A 1USTA 1T39A 4WK8F 1QQIA 1U8RA 3IKVA 4IXAA 2V1XA 3FF5A 2DQLA 3LAJA 1BM9A 4KN7X 4G8XA 5H6RA 1IZ1A 2IVMA 4OIQF 2IA2A 4IPAA 2DAOA 2F5CA 4ENMA 2Z9OA 4MQ9F 5BQTA 1DP7P 3KP6A 1T0FA 1JGSA 2O03A 3J80Z 3LWFA 4EJUA 2P5LC 1UB9A 2QYOA 5DUIA 1R5HA 2IT0A 3LA2A 2JZYA 3SZTA 4I09A 4AVPA 2KRFA 1SD5A 4FX4A 3BJOA 3WU1B 2QLZA 4ENJA 1KQ9A 1O3SA 3KLNA 2L54A 3HOTA 3ZMZA 3R4KA 2XV4S 3C1DA 3GYHX 1P2FA 3LA7A 4UVAA 3J7AO 4L0ZB 5LHIA 4KIGA 2QBYB 2QVOA 1OPCA 1I5ZA 4GO1A 2V1UA 1IF1A 3GO5A 1Z1DA 1OR7A 3I59A 1LQ1A 3K0LA 4GCVA 1J7KA 2OQGA 2RN7A 1XGMA 2QBYA 3Q5FA 1L0OC 4ZZLA 4G7OF 3L9FA 4IF4A 4AD9A 4OOIA 3U1DA 1XD7A 4HZFA 3C7JA 1W4MA 2HYFA 3Q9VA 5HS7A 1U5TC 3CTAA 1RNLA 2CGPA 3HTUA 2HDCA 4MGRA 4BHPA 2OQRA 3I4PA 5EEGA 1W7PB 1XMKA 3WU0A 2GXBA 1ZARA 2XROA 1O7FA 1HSTA 3H3UA 2UWMA 2NNYA 1XGSA 2HTSA 4WXCA 5L3GA 2RGVA 5CVVA 2OBPA 1ZRCA 1IRFA 2B0LA 2G7HA 1E17A 3HSFA 4L0YB 2L01A 1K79A 3RYPA 3F8MA 1W7PA 1SD7A 4LG0A 2ESNA 4EGZA 2PJPA 1BC7C 1XGNA 2TDXA 1C0WA 1T98A 2H94A 4EQQA 4M74A 2P7VB 5ILVA 2PN6A 4KNYA 4WCGA 2A3SA 2CFXA 4IRHA 2ZFWA 4KMFA 5HLIA 5AIQA 5FFXA 1KYZA 2DW4A 2VC1A 1DPRA 1R22A 2XGXA 3EDPA 2KIUA 5F6FA 3R6SA 1GXPA 1XSDA 4HX7A 2QQBA 2PG4A 4A6DA 1ZGAA 2QWWA 3HOSA 1T6SA 1B1BA 1Y0UA 3DFGA 2VE8A 3JW4A 4UV8A 3CUQB 3B73A 3CJNA 1J2XA 1EV7A 1QO0D 4LJZF 3L2CA 2VT3A 2MLKA 3FMRA 3E5QA 3KLOA 1MDMB 3WTWC 4RGUA 3F21A 4TV7A 1O57A 5CVIA 3SXYA 1XB4A 5DUKA 4L9TA 1XCVA 3TKYA 2L02A 3Q9SA 1Z7UA 3OOPA 2VBWA 1S7AA 2Q0OA 1IRGA 3CUQA 5EEHA 2HQNA 1J5YA 4P96A 1BIAA 3VODA 4FT8A 1OKRA 1HKSA 4UVCA 2UZKA 3BY6A 2R7DA 1BI0A 2J5OA 2EA2A 2Y75A 1I1GA 1TNTA 3V4GA 4UV9A 2LF7A 4B8XA 2KIFA 1WQ2A 4LGWA 3OV8A 2MH9A 4EVIA 3KZYA 1ULYA 5LEJA 2VN2A 1LB2A 2RC4A 3LQRA 1QZZA 3EQLF 3MZYA 1W7PD 5HLHA 2NRAC 3SZPA 1FBUA 1JHFA 1LEBA 1YG2A 5LRRA 4CICA 1ODDA 3ML6A 3G73A 1RI7A 4U7BA 1IXCA 4O3MA 3BWGA 3VEPA 1K7AA 2WV0A 3C18A 5D5VB 3TO6A 5L3CA 1XMAA 1YS7A 1DPUA 3EUHA 1RZ4A 3REOA 2D45A 1R23A 4OIOF 5E20A 5K5OA 2JRTA 1E2XA 2FMLA 4GGGA 3ZQ7A 5FD5A 5DD8A 3E6MA 3IC7A 5TJJA 2BEOA 1IN4A 1QZYA 5D6FA 1XSVA 3TOAA 2HGCA 2YSRA 4M6XA 2DK5A 2Y0MA 3TQNA 3LSTA 1YIOA 2ZNZA 3GEZA 1G3TA 2ESHA 2G7UA 3HIFA 2KKOA 5LGNA 1B9NA 4ASNA 3FXRA 1T2KA 2CWEA 3ZMSA 3I58A 1ZRDA 2PQ8A 3U9GA 4FX0A 1D3YA 2ELHA 1EH6A 4HOBA 4S05A 1CF7B 2RQPA 1ZAOA 2L3DA 3FXUA 2VODA 1YS6A 1J59A 3BOQA 4ZH4F 2YU3A 3LQQA 5LHGA 3CUQC 5ICEA 1FP2A 3D0SA 3ECHA 4MTEA 1EH7A 3N97A 2PI0A 2NYXA 1F9NA 4JK1X 2WC2A 2Z5UA 3D5LA 5E8GA 1ZG1A 4M73A 1R00A 3IKTA 3HRSA 5FLXK 2HEOA 4KN4X 2NAZA 2H09A 4KICA 2K4BA 1SAXA 2OZUA 1FPQA 2XAFA 4A0ZA 2DQRA 1ON1A 2M30A 1LEAA 1XDSA 3DXJF 4CYDA 4U0WA 2XKOA 2H6BA 2IA0A 4M9SA 2M1BA 3KEOA 3C3WA 3M9AA 3WTYC 1STZA 3T1BA 2V79A 4L9VA 4BNCA 2KJBA 4D0PA 4LMYA 2FXAA 1OYIA 2RVCA 4ESBA 3RPQA 1FLIA 2EA4A 4M9XA 1F5TA 3RTRA 1G3YA 4XLPF 1AOYA 1BJAA 2JPBA 3G3ZA 3GX4X 3HRTA 4UUVA 4LD5A 2F5FA 3K1MA 3E6DA 4A2UA 2GIVA 2HKOA 4CHUA 1GHCA 1MZBA 3V8KA 4IJAA 3I0TA 4RGSA 2FNAA 2LNBA 4I02A 2VBXA 5DCFA 2MH2A 2PBIA 1PDNC 1PP7U 3R61A 5D8KB 1R1UA 3KCCA 3T8RA 1FYLA 4RGXA 2D1HA 2DU9A 4AIHA 4WXDA 4XSZF 2W85A 2A5YB 3BJAA 4G6QA 5JR3A 3FM5A 1ONVA 2W25A 4U88A 1B9MA 4O6JA 5D8LB 2FOKA 4PGHA 2NS0A 3PQJA 4G94A 2DLLA 3SFZA 2JPCA 1FX7A 4R8HA 5K5RA 1I1SA 1KU9A 3BP8A 2Q2EA 1ON2A 1MJAA 2EV5A 2XAHA 1RIOH 4ESFA 5L3BA 1QBJA 3I59B 5HDKA 5DCMA 1FSHA 5HS9A 3I54A 3L00A 2FMYA 5HS8A 2E7XA 4G6DA 1OYYA 2EJRA 2KIMA 4EM0B 2UXNA 2F2EA 2EV6A 5BPDA 3EETA 3DPTA 5BMZA 2VBZA 4G9YA 3HRUA 2M5WA 2E7WA 3LAPA 3P7NA 3IL2A 2VXZA 1ZYRF 2PMUA 1LNWA 5KVRA 3I71A 1ZG5A 5ICGA 1B4AA 1BC8C 3DV8A 3CO6C 1YO5C 2OA4A 5D4SA 3QPTA 4BAYA 1FT9A 1ZLJA 1ZLKA 4ENKA 1S6LA 1BBYA 5ED4A 1O3TA 4R79A 3ULQB 3F23A 3HHGA 4ZZDA 1S29A 1TTYA 1JXSA 1MD0A 4I7HA 5A2QZ 1G4DA 2Z3YA 2GXGA 2BE5F 2GWRA 4LG0B 2K27A 5FD6A 2E1NA 1KQ0A 2AXLA 4ESJA 1MJ9A 3J81Z 4HDVA 1BI3A 1SMTA 5ERIA 4HF0A 2K02A 2GQQA 4K2EA 3GW2A 1UCRA 4HQEA 2FA5A 1PP8F 1P4WA 1XSXA 2EFNA 4HF2A 3WTVC 4LLNA 1LDDA 1P92A 4LK1F 1YLFA
chains in the Genus database with same CATH superfamily
3F8FA 4P5OA 3H0GJ 3HKZN 1IXSB 2FBHA 4BXFA 2LF8A 2YU9J 3WHBA 1E3HA 4AU7A 3OIQA 1S3JA 2NS7A 4DW6A 1ZRFA 3PFIA 1A04A 4BHBA 4RB3C 3CLOA 1G8XA 4BE1A 3M3YJ 1P6RA 3JTGA 1MMDA 1V4RA 4AWXB 3MVPA 2W82A 1J9IA 5JFRA 3BR0A 1MNDA 1R71A 5FKLA 2CQNA 1WRJA 1IJWC 1FP1D 2XB5A 4PFOA 2FBIA 4KT5C 2NNNA 3WTZA 2L7ZA 3FMSA 2ISYA 4YEJA 1I39A 2IPQX 3J80K 2VKDA 1BL0A 4DGWB 2F48A 2K3PA 3V7SA 2K7LA 2XASA 2VKEA 3D1NI 4FCYA 4IHTA 5DV5A 1TWAJ 1F36A 1QZEA 4B3AA 2LLKA 1AU7A 2JA8J 4E7LA 2IS4A 1IN8A 3BLYA 2E2IJ 2JUCA 2O3FA 4LFUA 2VC0A 3NQOA 4KFCA 4UUTA 3WGHA 3I56I 2HOSA 2B9SA 1O3QA 3BC8A 2PJRB 4HA8A 3M7GA 2ACJA 2RKHA 3GUDA 2VJ5A 4KIFA 4OIPF 4OINF 1R5ID 1LUJB 3PUFA 2IGMA 4N9IA 3K4NA 1OLTA 1GT0C 2MABA 2W00A 1YOVB 5KK1A 1R1TA 2OZ6A 4M72A 3TP0A 4ZYGA 3JAMZ 2LTPA 1JGGA 4CDGA 3ZPLA 4KIBA 2P4WA 4RB2C 3K2ZA 4AIJA 3ZP5A 1XMXA 1ZGJA 3Q0WA 2OU2A 3I53A 1AHDP 4A0YA 3CMYA 1HXDA 4L9NA 4HSTA 5H20A 2BGCA 1SFKA 1VQNI 2MZ4A 3PQKA 1V5EA 1FJLA 2EB7A 2L5QA 3S2HJ 3KYLA 3C2GA 4XKWA 2PJRA 5D5UB 2F6CA 3KYDB 4PFPA 2XAGA 1VF9A 3G6EI 5DEQA 3IP4B 2ZJRF 1OJLA 1KU2A 2DTRA 3HG9A 4O5VA 5IY5H 2A6EF 3MN2A 5E1ZB 3ZOBA 3OYHA 4U0VA 1UJ8A 3OYCA 1FMVA 1KU3A 2BHZA 3CDHA 1B8IB 3K4JA 4HYEA 2R4GA 1HA8A 3JCUC 2R3SA 5LGUA 1RKWA 4F3QA 4YG2F 3RJPA 1AKHB 1E3PA 3FHNA 4CSWA 2ISZA 3FKJA 4UNOA 2O0YA 1X2MA 2ZBKA 1IN6A 1ETQA 3ZN1A 4XLAA 5IT9Z 1R1VA 2ZJ2A 3RIRA 3RKXA 4L5IA 4IRGA 1A31A 3JSOA 1O7LA 3Q0UA 3JRGA 4ZYDA 3KP3A 5IP7J 2HQ5A 2QCOA 1G3SA 3E0JB 4ANJA 3I5UA 3ROUA 1K6OA 3F3XA 1IN5A 2V1NA 5FGMA 5LD2C 1RUOA 4UY8I 1SD4A 5J8FA 4U0YA 2I5UA 1B8IA 1K78A 3IHUA 3FISA 4RLFA 3GZ5A 4CXFA 1KYWA 5IT9R 3KP4A 4BY1J 5BPIA 3J81K 1TQIA 3ABUA 4V2GA 1ZHFA 2ZMEB 3F6OA 2RAEA 1ZH5A 4OMYA 1XS9A 4UB6C 2HDWA 3OS1A 3OY9A 5M3FJ 2AXTC 2GOMA 4W1UA 5LFAA 1RQ6A 2FJ1A 5CVUA 5J47A 1TQPA 4EMSA 3E5XA 3SHFA 2F4IA 5E1WA 2D1VA 4A12A 4P9UA 4MNUA 1GV5A 2CO5A 2QKMB 1BJZA 4A3LJ 1POGA 2IEKA 2FNPA 4RGRA 3SQNA 1KGSA 5L3DA 2E1MB 1D0YA 2MC3A 3KPHA 2W4SA 4AIKA 2HR3A 2I8DA 1DDNA 2BVMA 5E79C 3FK7A 2WAFA 2E1CA 3E5UA 2WA0A 2DA3A 1HQCA 4YELA 2ZMEA 1ZR4A 1RC9A 2M8EA 6PAXA 1IW7F 3BG5A 3S2WA 5FB2A 4RB1A 4MTDA 2CQKA 1QPIA 3HSRA 4CUGA 2ADUA 2Z33A 2RNGA 2BXYA 2FF4A 4PJLA 2VUMJ 3DEWA 2X1DA 4XONA 1P4XA 4C3HJ 2M35A 1KU7A 3HRMA 2K9QA 1JHHA 2FSWA 1U0JA 1OMIA 3SDGA 2HOTA 1W0TA 3KP2A 2CS3A 3MCZA 1BI2A 2ELKA 5LGTA 1GXQA 2LBFA 4LK0F 3BR6A 1R58A 2MGQA 4IHYA 2A61A 2HQAA 4CCJA 2R7VA 3O8HA 5D6EA 3CC4I 2XF6A 4L5EA 4YFNF 3S3OA 2MLGA 2A68F 2O6GE 2JSCA 2DYRH 3CCSI 3ASNH 4ABZA 1Z0XA 4BBRJ 5K5QA 1QGPA 3WTUC 3K1PA 3BPXA 2VOOA 3FXJA 4QPQA 4A3FJ 1B6AA 5D5WB 1WJDA 1WWXA 1APLC 3U21A 5HVQC 1U9NA 1YTYA 2HU9A 2A05A 2BYVE 1OFCX 2R7SA 1IUFA 2QUFA 3QP5A 3R0AA 2ZKZA 4OIRF 3VSKA 2AHQA 1NK3P 3OOUA 3ZMDA 4H0EA 2A07F 1LKXA 5LEKA 2K5CA 4HLXA 4CCKA 3RDIA 1R49A 2XAUA 2F5EA 3J7AY 1SMYF 2COMA 2KZVA 2IA1A 5CLSA 4ZYHA 1BR2A 2YX7A 2KJCA 4CA0A 2XGEA 2QSHX 2DI3A 2BY2A 1DUXC 3U2RA 1EF4A 2DA4A 4WWCA 2E34A 1IG7A 4XKCA 1SANA 2WWYA 4HF1A 2M4GA 4HG2A 3H0DA 5E3MA 3GXOA 3G1OA 2KDZA 3I64A 3L2WA 3PFYA 3PL8A 1OQYA 2DA5A 2M0CA 3ABTA 2EIJH 3B6AA 3FBNB 2NVQJ 4ZYEA 2GOXB 3WTSC 1X2NA 3A1YA 1YRNB 2X6YA 4IRIA 3DBRB 3FWEA 3TDUC 3GFLA 2VJ4A 3TOBA 2DODA 4WXHA 3V8LA 3H5NA 4B4CA 4XRFA 2V6EA 2PMHA 4EGYA 2HWVA 3MFKA 1ZN2A 1ZQ3P 3DPUA 3N4MA 1MBEA 1Z05A 2QENA 1JE8A 4RBOA 2HI3A 1A6IA 2XRLA 1D8KA 2X6OA 5F64A 1VQLI 3P9IA 1J75A 1TQMA 1X1BA 1R7JA 2ECBA 1NK2P 2KFDA 3ZQIA 3ZMTA 3BT9A 3PIOF 5AIPA 1S8NA 1X1CA 4KUMA 4FHTA 1UHWA 1U78A 2M7BA 3EUAA 2M9HA 5LHHA 3VYRB 1B72B 2L4MA 2QGUA 1YRNA 2V1DA 3K69A 2HOEA 2W48A 1GV2A 2VQCA 3HBLA 3X2QH 4Z6YA 4ON0A 3GCMA 4A5MA 4C3IJ 3HJEA 3CP8A 3IWZA 2DA2A 2JN6A 2KL4A 3EYYA 5HOOA 1H88C 1QPMA 2ME0A 2XAJA 2HXOA 3W2WA 3QRFF 2VASA 1VQ4I 3RPUA 1PUFB 3V7CA 2R7FA 4EATA 2FU4A 5KCMA 3MD2A 2XB0X 2DT7B 1T8IA 4A3DJ 2PEXA 5IOZA 1HBXG 4F55A 3E1SA 3F8CA 3CESA 2ZXIA 1B72A 2ZMEC 4EV0A 3O6BB 4BQAA 2FQ4A 4Q5SF 5BS6A 1LDJA 1BI1A 1LJ9A 3DWLE 4HW0A 2DJNA 4HAMA 3LSPA 4ZYAA 4CCOA 3E97A 2JVHA 2OUMA 1FY7A 5EG0B 4CH7A 3RYRA 4BJ6C 5EGOB 3QWLA 3H9JA 2MD5A 2ZXJA 2NS8A 4MEXF 2L9VA 2PMZA 4LLGF 2OPTA 3K4LA 4N9HA 4B09A 1SFUA 1Q1VA 3BROA 2E1MC 4EJOA 3CMAI 4F92B 4BUPA 2KIQA 1Z9CA 4EJWA 1R36A 2A69F 2VLAA 2OCCH 4BDZA 4MLOA 1YFHA 3DP7A 1T38A 1HOMA 2R7OA 3B02A 4P55A 5AONA 3ZMVA 4DYQA 3KFWX 2IS1A 5KAFC 1T33A 2LH9A 2X1CA 2X0LA 2EFOA 3F6VA 1LDKB 1IDYA 4AYBN 4Z2YA 2GLOA 3T8TA 2OD5A 5GAGJ 2L7MP 4KMUX 5EG0A 3GZ6A 2EFWA 3RI4A 1TW3A 1RKTA 3FKIJ 4GYIA 5B1BH 5B3SH 2VL8A 1EA3A 2XPWA 5F08A 5LBQA 4DBRA 3GF2A 2Y0SN 3DU6A 1MGTA 2XKPA 3T0YA 4EJTA 3F8BA 4B44A 5ILUA 1W5TA 2QZ8A 2VT2A 2QSFX 5DCMB 3AG3H 3ZMUA 1UFMA 2STTA 3OYNA 4D5FA 2VOPA 2BW3A 3TL4X 2M45A 2IP2A 1R9TJ 4DNCA 3S17J 4RAZA 4D9JA 3TO9A 3FMQA 3GVAA 4NQWA 3ABMH 2K9NA 3EYIA 4IHWA 4I6ZA 1BR1A 4BBSJ 2WTEA 4RAYA 4IHSA 4BH9A 2BY3A 1R5GA 2X98A 4PZJA 4BQQA 2P7CB 2OTJI 3IWFA 2JTVA 1SVLA 5LRSA 1Z21A 2ZNYA 4IKFA 2LG4A 1Z6TA 2DA1A 3O3KA 1RUNA 3KEQA 3GTOJ 5KNLA 2H8WA 3P9KA 3AAFA 2UXXA 4RS8A 1YW7A 1FOYA 1DU0A 3I4NJ 3QPHA 4OWRB 3M8JA 2IW5A 1MIJA 1FZPB 1YW9A 2K85A 4F52A 4DZJA 2AS5F 3DKYA 3W3CA 2HFHA 3HOWJ 5E17F 4M9ZA 5FO5A 1FOKA 3AG1H 2YUSA 2MG4A 4JBAA 1HKTA 2Y9ZA 1V54H 3QYEA 2DA6A 1D8JA 4CGZA 1WPKA 1QA6A 2GA1A 1FSEA 1G3WA 3F0CA 3FZVA 2ZC2A 1H9GA 4FASD 4BACA 2DDAA 3TP3A 4I76A 4BXUA 5J1UA 2K40A 2DMTA 3GLXA 4Y33A 2C6YA 2KPMA 2K3FA 1YX5A 3KZIC 1U3EM 2CV0A 1MBKA 2NOGA 3BPVA 1AA7A 5CQGA 1MKMA 3I55I 2XHKA 2LP0A 2V7FA 1XPXA 1GDTA 1TWFJ 1FC3A 3KP7A 2FBKA 4Y4RA 3COAC 5CPRB 2MYSA 3LSKA 2R5ZA 1I3AA 3ZN0A 1G59A 2VBYA 4A6EA 3OL4A 2XUBA 1LFPA 1E3OC 1KA8A 4Y13A 4H4KC 3HTSB 1MW7A 2JUGA 3CCYA 3LOCA 3H5AA 4FETA 1HDPA 4I01A 4IOAF 4HLYA 3OS2A 4IL6C 4ETSA 4ENNA 3H9GA 5DM6F 2K86A 2VXDA 1NHAA 2CSOA 1BOAA 1W1WE 4P9FA 4UXNA 2DMUA 1FBQA 1D1AA 5FFZA 5D4RA 5E1XA 2RDPA 2Z1DA 2XIGA 3LA3A 3WTTC 2CQ7A 3ZQFA 3QYBA 4U7DA 5D5XB 2WAEA 4XBFA 4M3DA 4A3KJ 2L7KA 2BVLA 5CVJA 4I0AA 5HDGA 3TDZC 5JHUA 1UHMA 2L4AA 3LSGA 3K7AJ 1J0RA 3GZNB 4HV5A 3QPSA 1XCBA 2EK5A 3M1EA 2WV1A 3L09A 3QYFA 5BOXA 5K1YA 2QQ9A 1OYWA 4XRSA 1IAWA 3GBGA 1QVTA 4UHTA 1JKPC 1W36D 3LSJA 3H3ZA 1O3RA 2AQEA 2EFPA 3KETA 1A5JA 3AL0B 2P0WA 2Z16A 4F91B 1L3LA 4PGGA 3TMOA 2DFFA 2P8TA 4QWQA 2LREA 1U8BA 2CFOA 3W6VA 3FXQA 3LMMA 4L9JA 2IJLA 2Q8KA 3AG4H 5HDNA 4DBQA 2DT6A 2RREA 1W36C 2CUZA 1ETOA 1HW5A 2CW0F 5ILSA 1FOWA 1XGOA 3E6CC 2ZCWA 4PSWA 4A3GJ 4IZZA 3ZCOA 4IOCF 3QOPA 2W1OA 1OCPA 2H6CA 3CZ6A 3AFHA 1USSA 2G9WA 4HRIA 4ZC3A 2WAQA 2JA7J 3TO7A 3QU6A 2HPIA 4DYRA 4OU0A 2DT5A 3CC7I 1QRYA 3LSHA 3PNYA 4UUSA 4IHVA 2Y31A 1MH4A 4QLCU 5GTIC 1K4TA 3CUOA 5J4YA 3KE2A 2GIZA 2XC7A 1MMAA 2M87A 2EZLA 2CG4A 2EZIA 3CCJI 1WI9A 5F1RA 2HVQA 4KDPA 2ZSIB 3WHCA 2IS6A 2CH0A 1TW2A 3BCBA 4LG3A 2BV6A 4NDLA 3GWZA 3P9CA 4F93B 5DM7F 4A3CJ 4M6YA 3S1RJ 1OISA 5EZGA 1BN5A 1Z91A 2HS5A 3O2PE 2EV0A 1LFBA 1WGXA 5LLQA 1ERDA 1FTZA 3BCAA 1O4XA 3TW6A 1XDUA 3PNVA 3MZHA 3IRRA 3CDLA 2YPRA 1G2HA 2DJIA 1X3UA 4Y3OA 3QAHA 2PX9A 2X4HA 3PJRA 3TBIA 1SD6A 4OMZA 2LDUA 2BBYA 4QSHA 3EUKL 2KRCA 4MO7A 1EKEA 3BTIA 4YFXF 4MQVA 1WSUA 1U6GA 2MA3A 1VQ7I 1F4KA 3H36A 1OCTC 4CCMA 1RRJA 1HKQA 1MJBA 4I2OA 4HBLA 4BHCA 2V6CA 3QPLA 1IC8A 4A5NA 4LITA 3ECOA 1PUEE 3PSIA 2JT1A 3OYDA 4CO8A 5TRDA 1HW1A 3BDDA 5E3LA 2ICWG 3VPRA 2W57A 1YIJI 1AWCA 1HDDC 3VOEA 1ZKGA 2FEZA 2E2JJ 2VPLA 4JOMA 5CJ9A 2OV7A 3K10A 3JAMR 2F5DA 3BQYA 3ELKA 3CCMI 5GP9A 2VQHA 3GFMA 4RMNA 1JTYA 2KDOA 4WX9A 4BE0A 3S2DJ 2XRNA 4Q47A 2K4JA 3HM5A 3DKWA 1SFXA 2O5RA 2STWA 1W5SA 5FRMA 2HQRA 3KP5A 4BQNA 1K78B 2GAUA 4C2UA 3IH2A 9ANTA 1Z6RA 3UR3C 2DMPA 1I6HJ 1JUPA 3ISPA 4PCQA 4YFKF 5GTHC 5DD4A 3JTHA 2P6SA 3FHZA 3BJ6A 4Q48A 1YYVA 1VI0A 2RNJA 3KYCB 3JRCA 1FIPA 3OYJA 2A6HF 1A36A 2P6TA 2WY7Q 3IRQA 3P5JA 3E3VA 2ETHA 3F22A 3SEQA 5DS9A 1SVMA 1YHQI 5FLXZ 3UKGA 1JT6A 2Y69H 3F72A 1ETYA 1WJEA 4E70A 2V4JC 5DDGA 1FWZA 4EJVA 3PNTA 2OAZA 2L7FP 2JWTA 5K7ZA 3V8JA 1KQ8A 5IPAA 2BOLA 1MDMA 4YIRX 5A2QK 3FM3A 2LMDA 3WGGA 2EZKA 4GDFA 3ERED 2XVCA 1SVOA 2MD0A 1I6XA 1TNSA 2HZTA 5J3LA 5L3EA 3T5XA 5FLXR 2V9VA 4IEJA 2HOAA 3MMYB 4HV6A 3KZZA 4M6VA 2XPVA 4XK4A 3DEUA 2EIMH 3HL2A 2R7WA 3CJRB 4IQ4A 5HLGA 3FBIB 3R0JA 1U9OA 3JSPA 2P5KA 2Z99A 3CO7C 1BR4A 3GTJJ 4UVBA 1XN7A 3K4CA 2IRFG 4AM3A 2GM4A 4BXXJ 3MKWB 2WY8Q 1FYMA 1YQAA 2E36A 1BIBA 2IGKA 3HUGB 1ITYA 2MBFA 5H6QA 5M3MJ 1S7OA 3NAUA 2LBFB 4DQ2A 1F43A 2ECCA 3VB2A 2HVSA 3MEXA 1RESA 5IT3A 3AL0C 3M8FA 4A3IJ 5K7FA 3GFIA 5L3FA 3BZ6A 3HYIA 3WG9A 5GAHJ 3QODA 2CW7A 4PSXA 3S1QJ 4NB5A 2QSGX 4JX5A 3W6JB 3Q3SA 2F5VA 4Y17A 3VFZA 1W0UA 4PDKA 2KQRA 3DLLF 5JVGF 3KX2A 4CZCA 3ASOH 2VQGA 1Q1HA 3G71I 1WI3A 3TGNA 4IVNA 1D5VA 3JREA 3HKZA 2RV8A 3HUGA 4ZTJA 1X3ZB 1UMQA 1QNTA 4A0XA 2HYGD 1IUYA 3HOUJ 4FISA 3W6KB 4S04A 1G6NA 4XKBA 1H89C 4NC6A 2DPDA 4I0BA 3K1NA 3ZQQA 1F1ZA 3GTGJ 4G7HF 2HKXA 2NXNB 1ZREA 2LSOA 2R5YB 2O8KA 5J8CA 3BTCA 4GFBA 1Y8RB 4XMYA 2VE9A 3M4OJ 1JTXA 3VDXA 3MQ0A 4YRVA 3WGIA 2FE3A 1WVRA 3E6BA 1IXRC 3RKYA 2PLYA 2DN0A 1YJWI 2EWNA 5C4XJ 2MW8A 3RKWA 3WTXC 1BOBA 1I27A 5JLWA 2ME6A 5JVTA 5C4JJ 1ETVA 5EYRA 2W84A 1FYKA 2JRMA 3DQVC 2JK3A 2XF7A 3JAMK 3A4CA 4XLNF 3CQZJ 5DYMA 4Q4ZF 1HLVA 4WF2A 1BA5A 2ELJA 3QP6A 1FNNA 2L9RA 2Q1ZB 3DU5A 4ITVA 3A03A 4W97A 2XSDC 2LFBA 4YIIA 4G7ZF 2NOJB 2CQQA 3OYKA 1DP3A 1YX3A 4NHJA 5F04A 5CVRA 4J19A 3QU3A 4N0BA 5IP9J 2R5YA 1SC7A 1QHHD 3HGGA 2COBA 1JJ6C 3HDDA 4LB6B 3MAJA 1FBSA 2H1LA 3LNQA 2XAQA 4RAFA 4MHGA 1TBXA 3PSFA 4NBQA 3SFIA 3CCLI 5ICFA 1H9TA 3RZOJ 3HOVJ 5J6XA 2YX4A 1Y0NA 3SZGA 1TLHB 3KEYA 4C30A 4YIFA 1YJ9I 1LVAA 2DFIA 4X6AJ 4AUXA 2OCEA 1HSJA 3HOXJ 2CUEA 1X19A 1I3QJ 1ETKA 1CGPA 4MIMA 1MH3A 2D2WA 4MEYF 2IXSA 2DK8A 3GLLA 2WADA 4L5JA 1Z3XA 2DBBA 4IO9F 3L2QA 1U2WA 3H92A 3L7WA 3UNGC 5IT9K 1LFUP 1SAUA 3V7RA 3HSEA 2E2HJ 2Y9YA 4DJAA 1TC3C 4HNVA 2LRDA 1REPC 4LIUA 5E18F 2ZB9A 2UV1A 1CF7A 1V55H 1IO2A 2ZO4A 4BU2A 3M8EA 2EILH 3DBLB 1WKMA 2QQAA 3MWMA 3R60A 4CZZA 3HHHA 4XSXF 4XNFA 2K9MA 5TGTA 2GXAA 3ABLH 2H27A 4Y15A 1SFEA 2X48A 5E8IA 4J01A 1LPQA 3ZQGA 1YE9A 2DTZA 3DTIA 2GA2A 2GZWA 5FKKA 3A2KA 1JKQC 2CYYA 1GVJA 4BYYA 3KIOA 4M71A 1V3FA 2FQ3A 4KA4A 4C3JJ 1IN7A 2DPUA 1MBHA 1YW8A 2EQRA 2W24A 4XORA 3GTLJ 2EZHA 1YJNI 2YR2A 2QQ8A 3F8NA 2X6WA 3N05A 2DMNA 3LSRA 2O61A 1NG7A 4A3BJ 2CMPA 1ETXA 2QA4I 1VQ9I 2Y48A 3S93A 2DO7A 4F7ZA 2JA5J 3DTKA 2I10A 5CKTA 3AKZA 2JQ7A 1JJ8C 2JA2A 1P4AA 1FIAA 2QM3A 3NEUA 4NUBA 3A01B 2P5VA 1U5TB 2LY9A 2E60A 3ONQA 2LKPA 4II3A 3WE2A 2Y2ZA 4RDUA 3K2AA 2PFBA 4R1HA 3DPLC 4XOPA 3IAS2 3SJMA 2FRHA 1WJAA 1IGNA 3NRVA 4HX8A 2DA7A 1I50J 2M2EA 4AIDA 2B63J 4HX4A 1HW2A 2O8XA 1IRXA 2OF7A 3WE3A 2ZJQF 3FX3A 1VTNC 4JQFA 5CYVA 4I98B 4XKVA 4KYWA 2HTJA 1IDZA 4HDUA 3CMEI 1H0MA 2DCEA 5JI6A 3OYFA 3HOYJ 1ZG3A 1MSEC 1Z67A 4RB0A 3JRFA 2E35A 4LLLA 2BW3B 2MC4A 3OMYA 3H5RA 3PM1A 4GYGA 5M5WJ 3WODF 5B1AH 1EH8A 2CJJA 4NQWB 1VQ5I 3QOEA 5GADJ 1Y1WJ 3A01A 4LB5A 1FOXA 2CV1A 5FROA 4HQMA 1U5TA 4EM1A 2J5PA 4L18B 2LD5A 2EFQA 4EM2A 3L2VA 5ICCA 4GXOA 2AQFA 3LFKA 1B59A 3BG3A 5F27A 3CF5F 3GFJA 2R7QA 2VONA 3K9TA 1E0EA 5J1YA 2HVRA 3DF8A 3EPZA 1D0ZA 1FMWA 1T95A 1SFOJ 2VQLA 1USTA 1T39A 4WK8F 1QQIA 1U8RA 3IKVA 4IXAA 2V1XA 3FF5A 5KHDA 2DQLA 3LAJA 5F0FA 1BM9A 4BE2A 4KN7X 3CCRI 2ZFUA 4U87A 4G8XA 4PJMA 5H6RA 5CQEA 1IZ1A 2IVMA 5EDNA 1XG1A 2P0TA 4OIQF 2BY1A 1N25A 2IA2A 4IPAA 4E7KA 4V2FA 1TT5B 2OC6A 4D1QA 3F9KA 4RM3A 2DAOA 2VPRA 3BG9A 1NH3A 2F5CA 1JT0A 1V5GA 4RLQA 4ENMA 1T08B 4MQ9F 3RZDJ 5BQTA 2Z9OA 1DP7P 1PJRA 2ZXHA 3CJTB 3KP6A 1T0FA 3K70D 3CCEI 3FDYA 1JGSA 3A52A 2O03A 3HOZJ 3J80Z 3LWFA 4EJUA 2F4MB 4IQJA 3SYTA 1UB9A 4XN3A 2P5LC 3DEEA 2QYOA 4D7NA 1VQ6I 5DUIA 2P81A 3CCQI 2R5ZB 1R5HA 4BQOA 3LSMA 1S7EA 2NVUB 2IT0A 3LA2A 2JZYA 2M7AA 5FLMJ 3SZTA 2L0KA 1Z77A 4I09A 4AVPA 1K4SA 2KRFA 1RPWA 3RCOA 3J7ZI 1SD5A 3K70C 3OIPA 5M5YJ 4FX4A 3GMEA 3BJOA 3WU1B 3OL3A 3CLQA 3RPUD 1J09A 2QLZA 3CJQB 4ENJA 4A3MJ 1KQ9A 2HXIA 1O3SA 3KLNA 1TP4A 2L54A 3HOTA 2XGCA 3R4KA 4XN0A 3ZMZA 2XV4S 2LKSA 3C1DA 2M34A 2E5NA 3GYHX 1P2FA 2VKHA 3LA7A 4JX6A 4UVAA 3J7AO 5C44J 4L0ZB 5LHIA 4KIGA 1X1PA 1MBGA 2QBYB 2E19A 2QVOA 4NNJA 1WHUA 1OPCA 2R7ZJ 1I5ZA 5HNFA 2ID6A 2LR8A 4GO1A 5IP6A 1DU6A 2V1UA 2M0MA 1N78A 1IF1A 2ZSHB 3RQIA 3GO5A 1Z1DA 1OR7A 3I59A 4FE4A 2CUFA 1LQ1A 3K4KA 3ESWB 3K0LA 4XLEA 1WFXA 4GCVA 4E7ZA 1WCMJ 4B43A 2BY0A 2V9PA 2Y30A 3BR1A 3VYSB 1J7KA 3V42A 1MBFA 2OQGA 1P9QC 4ZDLA 2RN7A 1P7IA 1XGMA 1VQPI 2QBYA 2CUJA 5H2FC 2QEXI 3Q5FA 5EZHA 2CU7A 3ZGKA 1L0OC 4ZZLA 4G7OF 3L9FA 4IF4A 1X4PA 1MMNA 2IGOA 3JRAA 4BL0B 3MZ8A 4AD9A 2KRHA 2BZTA 4E4HA 4DZPA 2VJIA 4OOIA 3U1DA 1XD7A 3AG2H 4HZFA 3C7JA 4A69C 1W4MA 3MKLA 1GLNA 2HYFA 3J7YJ 3Q9VA 5HS7A 3NARA 1S5LC 3TW7A 1U5TC 2DOEA 3CTAA 3S1NJ 3ABKH 1RNLA 2CGPA 3HTUA 2HDCA 4MGRA 4BHPA 2OQRA 3I4PA 5EEGA 4UUSB 2KMUA 1W7PB 1VQMI 4ZJZA 4EEFG 1XMKA 3WU0A 2GXBA 2UUZA 1UAAA 2FUG2 3I9V2 4IHXA 2X6XA 3ZRGA 1ZARA 2BXZA 1QVUA 1ACIA 5FKNA 2IBDA 3HXLA 3I3LA 1O7FA 2XROA 4HNUA 1HSTA 3H3UA 2AO9A 1CQTA 2OTLI 2UWMA 4PJJA 2NNYA 1HF0A 4B3XA 3H3VK 3VWBA 1XGSA 2HTSA 4WXCA 5L3GA 2RGVA 5TISC 3WG7H 5CVVA 3H9QA 2OBPA 4XICA 1ZRCA 1IRFA 4A3EJ 2B0LA 2Z2SB 2G7HA 3HSFA 3IAM2 5J1RA 4L0YB 2L01A 1E17A 3W2VA 2QKLB 3DBHB 1K79A 2R7UA 3RYPA 3F8MA 5FRNA 1N75A 1W7PA 4MFEA 2R0QC 1VQKI 2JVGA 1SD7A 4LG0A 2ESNA 4AYBA 5K7HA 4EGZA 2PJPA 3JRBA 1DGWY 1BC7C 4LIVA 1XGNA 2TRTA 1T0FC 2QF7A 2TDXA 3CDIA 4MFDA 2ID3A 1C0WA 2MUNA 3DTEA 2Y0SA 3S16J 1T98A 2H94A 4PJNA 3RQ4A 4EQQA 4M74A 4C2TA 1YITI 2P7VB 5ILVA 3S32A 1TT0A 2PN6A 4QIWN 4KNYA 1ENHA 4WCGA 2A3SA 2CFXA 4IRHA 4BDYA 4JX4A 2ZFWA 3C2HA 3PUBA 5FJ8J 4KMFA 2CW8A 5HLIA 2TCTA 3DCFA 3GTKJ 5AIQA 3BG6A 1VQ8I 3HPGA 5FFXA 1KYZA 2DW4A 2VC1A 2WBMA 1LVKA 1DPRA 1R22A 2XGXA 3EDPA 2KIUA 5F6FA 3R6SA 1GXPA 1XSDA 4HX7A 2QQBA 2PG4A 4A6DA 4N4OB 4B1RA 1ZGAA 3JR9A 2QWWA 3HOSA 1S72I 2XDVA 1UG2A 2VJJA 1T6SA 4BJTA 1B1BA 1Y0UA 3DFGA 2VE8A 3JW4A 3LFUA 1MSFC 4UV8A 3CUQB 3B73A 2HPMA 4A93J 1M1EB 3OYLA 4E7HA 3L2UA 2R93J 3CJNA 1J2XA 1EV7A 3E7LA 2XF5A 5IYCJ 1OR7C 4QPOA 4XOTA 5J40A 3K6GA 1QO0D 5IYDJ 2HZDA 4LJZF 5IOYA 2G0EA 3L2CA 2VT3A 3HEFA 2MLKA 3FMRA 3E5QA 3KLOA 4PUSA 1MDMB 2EBIA 5FKOA 3WTWC 4RGUA 1WJCA 3BG7A 3F21A 4TV7A 4C2MJ 1O57A 5CVIA 3SXYA 1XB4A 1WJBA 3FXKA 4L9TA 1XCVA 5DUKA 2L02A 3TKYA 4E7JA 1XC5A 4ZDPA 3Q9SA 1Z7UA 3OOPA 3OSFA 2VBWA 3J7AW 4QTRA 1JUSA 1S7AA 2Q0OA 3D5RC 2IGNA 3HB9A 3CUQA 5EEHA 4D5CA 2LY2A 1IRGA 2HQNA 1J5YA 2RQQA 1WH5A 4P96A 1BIAA 1A35A 3VODA 4XQFA 2VIXA 4FT8A 2KP6A 1OKRA 1KZHA 1HKSA 5FLVA 4UVCA 1R4MB 3OYBA 2UZKA 3BY6A 2R7DA 1D1BA 1BI0A 2J5OA 4RM2A 3S8PA 3VSLA 2EA2A 5EF6A 2Y75A 5C3EJ 1I1GA 1TNTA 3V4GA 4UV9A 1VNDA 2LF7A 4B8XA 2KIFA 1WQ2A 1WJFA 4KISA 2EINH 5GPAA 1Z7LA 2E71A 4LGWA 3JRDA 1PYVA 3OV8A 1UHSA 2MH9A 4EVIA 3KZYA 1ULYA 5LEJA 5M5XJ 3A02A 2VN2A 4KT6A 1LB2A 2RC4A 4ZTFA 3LQRA 1QZZA 4JYKA 2CV2A 3EQLF 3H1CA 3MZYA 1W7PD 3LL7A 2VKVA 3CP2A 5HLHA 2NRAC 1QU3A 3DKXA 1X3WB 3SZPA 5EEAA 1FBUA 1JHFA 4XR6A 3JRIA 4X1EA 1AKHA 3PO2J 1LEBA 1YG2A 3PIPF 5LRRA 4CICA 3OYEA 2DOAA 4I99C 1ODDA 3ML6A 2LK2A 4RAGA 3G73A 5E3NA 1RI7A 4U7BA 1DQUA 2R7XA 1IXCA 4O3MA 1R4NB 4Y52J 3BWGA 3VEPA 1K7AA 2WV0A 3C18A 5EJCA 2FD5A 2PMZN 5D5VB 1TWGJ 3CD6I 3TO6A 5L3CA 3BR2A 1XMAA 1YS7A 1MMGA 4PJ0C 1DPUA 3EUHA 1RZ4A 3REOA 2D45A 1W5CC 4XRSG 4B48A 1R23A 1MNEA 4DYCA 3ZQCA 3D5SC 4BS9A 4BJ5C 3A0BC 4OIOF 4J00A 3ERMA 1D5YA 1JKRC 1H8AC 3S1MJ 5GPCA 2CQXA 5E20A 5K5OA 3G1LA 1IRZA 2JRTA 1E2XA 2X51A 1TL8A 2DFEA 2FMLA 4GGGA 4LOCA 3ZQ7A 5FD5A 2M4KA 3BR5A 5DD8A 3E6MA 3HZJA 2L9NA 3IC7A 5TJJA 2JA6J 3GTPJ 2BEOA 1IN4A 1TWHJ 1QZYA 1ZELA 3NWSA 2ZXWH 5D6FA 1XSVA 3TOAA 2HGCA 2KLOA 1VZ0A 2YSRA 4M6XA 3SEZA 2DK5A 2Y0MA 3TQNA 3LSTA 2DFHA 2NVYJ 5FKMA 1YIOA 2ZNZA 2L9SA 3GEZA 2X1EA 1G3TA 2ESHA 2G7UA 3HIFA 2KKOA 3BTJA 5LGNA 4S0HB 4Y7NJ 1B9NA 2DYSH 3BR3A 4ASNA 3FXRA 3HPHA 3OYGA 1T2KA 3BQZA 2A5WA 2CWEA 3ZMSA 2LY1A 3I58A 1ZRDA 2PQ8A 3HGYA 1ZK8A 3U9GA 4FX0A 5F1JA 1D3YA 2K9SA 4XLHA 1FTTA 3S14J 1Y6IA 2ELHA 1FEXA 2MVTA 1EH6A 4HOBA 3BZCA 4S05A 2IS2A 1Y8QB 5KAIC 1CF7B 4E7SA 3PO3J 2RQPA 1ZAOA 5DTDA 5J4VA 2L3DA 3FXUA 4CYCB 2VODA 1YS6A 1J59A 3BOQA 3OIOA 2YU3A 4ZH4F 5BNGA 3LQQA 4PK4A 2V9KA 5LHGA 3CUQC 4XRMA 5ICEA 1FP2A 3JRHA 3D0SA 2MFZA 3ECHA 4MTEA 2YS9A 1EH7A 1QHGA 3N97A 3ZQLA 2PI0A 2K9LA 2NYXA 3K4MA 1F9NA 4JK1X 3GTMJ 3FK6A 2WC2A 2Z5UA 3M1CA 3D5LA 5E8GA 1ZG1A 1Z3YA 2KZGA 3G2BA 4M73A 4FTHA 1R00A 3IKTA 4BKXA 4CCNA 3HRSA 2JSPA 3G1MA 5FLXK 1R6RA 4AC0A 2HEOA 4CYCA 3O8GA 4KN4X 1OCCH 2EIKH 2NAZA 4GRIA 2H09A 3G4SI 1MNMC 3W2AA 4KICA 1K83J 1WH7A 2K4BA 2XPUA 1SAXA 3FXLA 4II2A 2OZUA 1FPQA 2XAFA 1LE8B 3FXMA 3C2BA 4NC8A 4A0ZA 2BHYA 4XIDA 1ZGWA 2DQRA 1ON1A 2M30A 1LEAA 1XDSA 1DGRM 1SEUA 3OR2C 3DXJF 2HNHA 4CYDA 4U0WA 1A6QA 2XKOA 1GUUA 2H6BA 2IA0A 2WB1N 4M9SA 5B5EC 2M1BA 3KEOA 3C3WA 3M9AA 4BY7J 3WTYC 1MBJA 1STZA 2O7OA 3T1BA 2V79A 5F0HA 4L9VA 3FXOA 2KJBA 2X9DA 3IH4A 4D0PA 4BNCA 4D7MA 4LMYA 2FXAA 5HNHA 3TEDA 4HNTA 1P7JA 1OYIA 2R7RA 1LE8A 1PVEA 1S9HA 3MKZA 2RVCA 4ESBA 3MKYB 3RPQA 3ZQHA 4C9YA 1FLIA 5JHFA 3EUHC 1JKOC 2EA4A 4FE7A 3CMMA 4BEHB 2F4OB 2LYCA 4M9XA 1F5TA 3OYAA 3RTRA 1ORKA 1OCRH 4E7IA 1G3YA 2ZJPF 1Y39A 4XLPF 3IV5A 1AOYA 1BJAA 3GTQJ 2JPBA 3S15J 3G3ZA 3GX4X 3HRTA 4RA2A 4UUVA 4LD5A 2F5FA 1OCZH 5JLXA 2M8GX 3K1MA 3E6DA 4A2UA 2HDDA 2GIVA 3L1PA 2HKOA 5HODA 1PUFA 1D1CA 4CHUA 3OWTA 3HC7A 4G12A 1GHCA 4XLCA 1MZBA 3IH3A 3V8KA 1RETA 4IJAA 3I0TA 4IX7A 1UG0A 2H1KA 3VYTB 3U1KA 2W7NA 4RGSA 2FNAA 2LNBA 3B6CA 4I02A 2JMWA 2VBXA 5DCFA 2MH2A 4BEHA 3SDBA 1ZTRA 1OCOH 2PBIA 3RSNA 2V26A 2DDBA 1PDNC 2NVTJ 1X1DA 2KT0A 4M3EA 1TZLA 1ZR2A 1PP7U 4ZDOA 3ZXSA 2WAQN 3R61A 2E5ZA 2LVSA 2A6TA 3OS0A 3BZKA 2CRGA 5D8KB 1R1UA 1K61A 3KCCA 3FIWA 3T8RA 1BW5A 1FYLA 2Q2EB 4RGXA 1D0XA 2GBYA 5EGOA 2DXIA 2D1HA 1RR8C 2DU9A 4AIHA 2VI6A 4WXDA 4XSZF 2W85A 3OSGA 2A5YB 3BJAA 2XSJC 4G6QA 4M3BA 5JR3A 3FM5A 1ONVA 3CF2A 3CC2I 2LKXA 3ZR8X 3H35A 4JP0A 5HLTA 4DIQA 3WU2C 2W25A 1JI8A 4U88A 2D5VA 1B9MA 1UELB 1HC8A 4O6JA 3S3MA 5GAEJ 5D8LB 2FOKA 4CCLA 4PGHA 2NS0A 3PQJA 4G94A 2DLLA 3SFZA 2JPCA 1FX7A 4HEA2 1KONA 4R8HA 4E6KG 2OJED 4BGDA 5K5RA 3VYUB 3Q0VA 4A3JJ 1I1SA 4DOZA 2VB6A 1KU9A 3S3NA 3BP8A 2Q2EA 5F0CA 1ON2A 1TWCJ 1MJAA 1WJ5A 2E1OA 2EV5A 2DOFA 2XAHA 1RR7A 1RIOH 4ESFA 1GVDA 5L3BA 1QBJA 1X58A 2DMQA 3I59B 4HSRA 3J80R 2HYJA 2XGDA 5HDKA 3LSIA 5DCMA 1FSHA 5HS9A 2R7TA 4G6TB 4OAZA 2EPFA 1ETWA 3I54A 3L00A 2FMYA 2R92J 5HS8A 2E7XA 4G6DA 1IV8A 1VQOI 1X4OA 4N4NB 2IAIA 1OYYA 2EJRA 3K4BA 4XLFA 2KIMA 3OR1C 2JJ7A 3NWTA 4EM0B 2UXNA 4AVZA 3M07A 2F2EA 2EV6A 1YI2I 1V5FA 5BPDA 3EETA 3DPTA 5BMZA 2VBZA 4G9YA 3HRUA 2M5WA 1HCRA 3RKQA 2E7WA 3QQAA 4FQGA 2M3AA 4UB8C 3LAPA 3P7NA 3IL2A 2VXZA 4XM3A 4NC7A 1ZYRF 2NVXJ 1Y56A 2PMUA 1LNWA 5KVRA 3I71A 3I4MJ 2EH3A 1VFCA 2N8GA 1ZG5A 5ICGA 1B4AA 1BC8C 3DV8A 2LC2A 4KITB 1K6YA 1Y1VJ 3CO6C 1YO5C 2OA4A 5D4SA 3QPTA 4BAYA 4HPQA 1FT9A 1ZLJA 4M3FA 1ZLKA 1WZ2A 3CCUI 4ENKA 1S6LA 4OAYA 1BBYA 1NTCA 5ED4A 4X0GA 1NG6A 1O3TA 2WB1A 4R79A 2L2OA 3ULQB 3OYIA 3F23A 1N77A 3BTLA 2KISA 3HHGA 3DLAA 1UZCA 4ZZDA 1S29A 1XX5A 1TTYA 1JXSA 1MD0A 3OYMA 4I7HA 1EJ9A 3A0HC 4P1WA 1JUMA 4V19K 1IV6A 5A2QZ 1G4DA 2Z3YA 2GXGA 1MMSA 2BE5F 2GWRA 4LG0B 2K27A 5FD6A 2E1NA 1KQ0A 2AXLA 4ESJA 1MJ9A 1BW6A 3J81Z 4HDVA 2X85A 1BI3A 1SMTA 3IUOA 5ERIA 4HF0A 2FX0A 2K02A 2GQQA 4XL9A 4K2EA 5IYBJ 3CCVI 2LOOA 1T56A 3GW2A 2MSYA 1UCRA 4KJZA 4HQEA 2H8RA 2FA5A 1PP8F 1XTAA 2O9LA 5A2QR 4M3GA 1P4WA 1XSXA 2EFNA 4HF2A 5E3OA 3WTVC 3L2RA 4LLNA 2B7EA 3J81R 4B47A 5B66C 1LDDA 1P92A 4LK1F 1YLFA 2KHMA 1X1AA 2FOWA
chains in the Genus database with same CATH topology
3F8FA 4P5OA 1IXSB 2FBHA 2LF8A 1S3JA 1ZRFA 3PFIA 1A04A 4BHBA 4RB3C 3CLOA 1P6RA 3JTGA 4AWXB 1V4RA 1J9IA 5JFRA 1WRJA 1FP1D 2FBIA 4KT5C 2NNNA 3WTZA 3FMSA 3J80K 2ISYA 2IPQX 3V7SA 2K7LA 2XASA 4IHTA 5DV5A 1IN8A 2O3FA 4LFUA 2VC0A 3NQOA 4KFCA 3WGHA 1O3QA 4HA8A 3M7GA 2ACJA 2RKHA 3GUDA 4KIFA 4OIPF 4OINF 4N9IA 5KK1A 1R1TA 2OZ6A 4M72A 4ZYGA 3JAMZ 4CDGA 3ZPLA 4KIBA 2P4WA 4RB2C 3K2ZA 4AIJA 3ZP5A 1ZGJA 2OU2A 3I53A 4A0YA 1HXDA 4L9NA 5H20A 2BGCA 3PQKA 2EB7A 5D5UB 2XAGA 5DEQA 1KU2A 2DTRA 4O5VA 2A6EF 5E1ZB 4U0VA 1KU3A 3CDHA 4HYEA 2R3SA 5LGUA 4YG2F 3RJPA 2ISZA 4UNOA 2O0YA 2ZBKA 1IN6A 3ZN1A 5IT9Z 1R1VA 2ZJ2A 3RIRA 3RKXA 4L5IA 4IRGA 3JSOA 1O7LA 4ZYDA 3KP3A 1G3SA 3I5UA 3ROUA 1K6OA 3F3XA 1IN5A 5FGMA 1RUOA 1SD4A 5J8FA 4U0YA 1K78A 3IHUA 4CXFA 3GZ5A 1KYWA 3KP4A 5BPIA 3J81K 1TQIA 3ABUA 1ZHFA 2ZMEB 3F6OA 1ZH5A 4OMYA 5CVUA 1TQPA 4EMSA 3E5XA 3SHFA 5E1WA 2D1VA 4A12A 4P9UA 4MNUA 2CO5A 4RGRA 2FNPA 3SQNA 1KGSA 5L3DA 2MC3A 4AIKA 2HR3A 1DDNA 2E1CA 3E5UA 1HQCA 2ZMEA 2M8EA 6PAXA 1IW7F 4RB1A 3S2WA 5FB2A 4MTDA 2CQKA 3HSRA 2Z33A 2ADUA 2FF4A 1P4XA 1KU7A 3HRMA 1JHHA 2FSWA 1OMIA 3KP2A 3MCZA 5LGTA 1BI2A 1GXQA 4LK0F 1R58A 2A61A 5D6EA 4YFNF 2MLGA 2A68F 2O6GE 2JSCA 5K5QA 3WTUC 1QGPA 3K1PA 3BPXA 2VOOA 1B6AA 5D5WB 1WWXA 1YTYA 5HVQC 2BYVE 2QUFA 3QP5A 3R0AA 2ZKZA 4OIRF 3ZMDA 4H0EA 2A07F 5LEKA 4HLXA 3RDIA 2F5EA 1SMYF 2COMA 2IA1A 5CLSA 4ZYHA 2YX7A 2KJCA 2DI3A 1DUXC 3U2RA 4WWCA 2WWYA 4HF1A 3GXOA 3I64A 3ABTA 4ZYEA 3WTSC 4IRIA 3FWEA 3TDUC 3GFLA 3TOBA 4WXHA 3V8LA 4XRFA 2PMHA 4EGYA 2HWVA 3MFKA 1ZN2A 3N4MA 1Z05A 2QENA 1JE8A 1D8KA 5F64A 3P9IA 1J75A 1TQMA 1R7JA 3ZMTA 5AIPA 1S8NA 4KUMA 4FHTA 1UHWA 1U78A 5LHHA 2L4MA 2V1DA 3K69A 2HOEA 4ON0A 4A5MA 3IWZA 3EYYA 5HOOA 1QPMA 2XAJA 3QRFF 3RPUA 3V7CA 2R7FA 2FU4A 2PEXA 1HBXG 3F8CA 4EV0A 3O6BB 4BQAA 4Q5SF 5BS6A 1LDJA 1BI1A 1LJ9A 4HW0A 4HAMA 3E97A 1FY7A 3RYRA 2MD5A 2ZXJA 4MEXF 4LLGF 4N9HA 4B09A 1SFUA 3BROA 4EJOA 1Z9CA 4EJWA 1R36A 2A69F 1YFHA 3DP7A 1T38A 3B02A 4P55A 5AONA 3ZMVA 3KFWX 2X0LA 2EFOA 3F6VA 1LDKB 4Z2YA 3T8TA 2OD5A 4KMUX 2EFWA 3GZ6A 3RI4A 1TW3A 4GYIA 5LBQA 3GF2A 1MGTA 2XKPA 3T0YA 4EJTA 3F8BA 5ILUA 1W5TA 2QZ8A 2VT2A 5DCMB 3ZMUA 1UFMA 2STTA 2VOPA 2M45A 2IP2A 4DNCA 4RAZA 3TO9A 3FMQA 3GVAA 4NQWA 3EYIA 2WTEA 4RAYA 4IHSA 4BH9A 1R5GA 4PZJA 2P7CB 3IWFA 2JTVA 5LRSA 2ZNYA 1Z6TA 3O3KA 1RUNA 3KEQA 3P9KA 3AAFA 2UXXA 4RS8A 1YW7A 3QPHA 2IW5A 1FZPB 1YW9A 2AS5F 2HFHA 5E17F 4M9ZA 5FO5A 1FOKA 4JBAA 1HKTA 1D8JA 4CGZA 2GA1A 1FSEA 1G3WA 3FZVA 1H9GA 4BXUA 3GLXA 2C6YA 1U3EM 3BPVA 1MKMA 2XHKA 1FC3A 3KP7A 2FBKA 3COAC 3ZN0A 2VBYA 4A6EA 2XUBA 1KA8A 4Y13A 3HTSB 4I01A 4HLYA 4ETSA 4ENNA 2K86A 1NHAA 2CSOA 1BOAA 4P9FA 4UXNA 1FBQA 5FFZA 5D4RA 5E1XA 2RDPA 2XIGA 3LA3A 3WTTC 4U7DA 5D5XB 4XBFA 5CVJA 4I0AA 5HDGA 3TDZC 5JHUA 1UHMA 2L4AA 1J0RA 4HV5A 1XCBA 2EK5A 3M1EA 3L09A 5BOXA 5K1YA 2QQ9A 1OYWA 1IAWA 4UHTA 1O3RA 3H3ZA 2EFPA 3KETA 1L3LA 4PGGA 2P8TA 4QWQA 3FXQA 4L9JA 2IJLA 2Q8KA 5HDNA 1HW5A 2CW0F 5ILSA 1XGOA 3E6CC 2ZCWA 3QOPA 2H6CA 1USSA 2G9WA 3TO7A 3QU6A 4OU0A 2DT5A 4QLCU 3CUOA 3KE2A 2M87A 2CG4A 1WI9A 5F1RA 4KDPA 1TW2A 2BV6A 3GWZA 3P9CA 4M6YA 1BN5A 1Z91A 2HS5A 3O2PE 2EV0A 5LLQA 1XDUA 3MZHA 3IRRA 2YPRA 1X3UA 3QAHA 2X4HA 1SD6A 4OMZA 2LDUA 2BBYA 4YFXF 4MQVA 1WSUA 1U6GA 2MA3A 1F4KA 1HKQA 1MJBA 4I2OA 4HBLA 4BHCA 2V6CA 4A5NA 3ECOA 1PUEE 2JT1A 4CO8A 5TRDA 1HW1A 3BDDA 2W57A 1AWCA 3VOEA 2FEZA 5CJ9A 2F5DA 3ELKA 3GFMA 4WX9A 2XRNA 4Q47A 2K4JA 3DKWA 1SFXA 2STWA 1W5SA 2HQRA 3KP5A 1K78B 2GAUA 1Z6RA 4PCQA 3ISPA 4YFKF 5DD4A 3JTHA 2P6SA 3FHZA 3BJ6A 4Q48A 1YYVA 2RNJA 2A6HF 2P6TA 3IRQA 3E3VA 2ETHA 3F22A 5FLXZ 3F72A 4E70A 5DDGA 1FWZA 4EJVA 2OAZA 3V8JA 1KQ8A 1MDMA 5A2QK 3FM3A 3WGGA 3ERED 2XVCA 1I6XA 1TNSA 2HZTA 5L3EA 3T5XA 2V9VA 4HV6A 3KZZA 3DEUA 5HLGA 3R0JA 3CO7C 3JSPA 2P5KA 2Z99A 4UVBA 1XN7A 2IRFG 1FYMA 1YQAA 1BIBA 2MBFA 5H6QA 1S7OA 4DQ2A 3VB2A 3MEXA 5IT3A 3M8FA 3GFIA 5L3FA 3BZ6A 3HYIA 3WG9A 4NB5A 3W6JB 3VFZA 4Y17A 4PDKA 1Q1HA 3TGNA 4IVNA 1D5VA 2RV8A 3HUGA 1QNTA 4A0XA 2HYGD 1IUYA 3W6KB 4S04A 1G6NA 2DPDA 4I0BA 3K1NA 1F1ZA 4G7HF 2HKXA 1ZREA 2LSOA 5J8CA 2VE9A 3MQ0A 3WGIA 2FE3A 3E6BA 1IXRC 3RKYA 2PLYA 2EWNA 3RKWA 3WTXC 1I27A 5JVTA 2W84A 1FYKA 3DQVC 3JAMK 4XLNF 5DYMA 4Q4ZF 4WF2A 3QP6A 1FNNA 4YIIA 4G7ZF 4NHJA 5CVRA 3QU3A 4N0BA 4LB6B 3MAJA 1FBSA 2XAQA 4MHGA 1TBXA 5ICFA 1H9TA 5J6XA 2YX4A 1TLHB 4YIFA 1LVAA 2DFIA 1HSJA 1CGPA 2D2WA 4MEYF 2DK8A 4L5JA 2DBBA 1U2WA 3H92A 3L7WA 5IT9K 3V7RA 3HSEA 1REPC 5E18F 1CF7A 2ZO4A 3M8EA 3R60A 1WKMA 2QQAA 3MWMA 4CZZA 3HHHA 4XSXF 2H27A 4Y15A 1SFEA 5E8IA 2GA2A 2GZWA 2CYYA 1GVJA 4BYYA 4M71A 1V3FA 2FQ3A 4KA4A 2DPUA 1IN7A 1YW8A 2W24A 2YR2A 3F8NA 2O61A 2Y48A 2DO7A 4F7ZA 1P4AA 2QM3A 3NEUA 2P5VA 1U5TB 3WE2A 2LKPA 2PFBA 4R1HA 3DPLC 2FRHA 3NRVA 4HX8A 4HX4A 1HW2A 2O8XA 3WE3A 3FX3A 1VTNC 4JQFA 5CYVA 4I98B 4KYWA 2HTJA 4HDUA 1H0MA 5JI6A 1ZG3A 4RB0A 4LLLA 4GYGA 3WODF 1EH8A 4LB5A 4HQMA 1U5TA 4EM1A 2J5PA 4L18B 2EFQA 4EM2A 5ICCA 4GXOA 3LFKA 1B59A 3GFJA 2VONA 3K9TA 3DF8A 1USTA 1T39A 4WK8F 1QQIA 1U8RA 3IKVA 4IXAA 2V1XA 3FF5A 2DQLA 3LAJA 1BM9A 4KN7X 4G8XA 5H6RA 1IZ1A 2IVMA 4OIQF 2IA2A 4IPAA 2DAOA 2F5CA 4ENMA 2Z9OA 4MQ9F 5BQTA 1DP7P 3KP6A 1T0FA 1JGSA 2O03A 3J80Z 3LWFA 4EJUA 2P5LC 1UB9A 2QYOA 5DUIA 1R5HA 2IT0A 3LA2A 2JZYA 3SZTA 4I09A 4AVPA 2KRFA 1SD5A 4FX4A 3BJOA 3WU1B 2QLZA 4ENJA 1KQ9A 1O3SA 3KLNA 2L54A 3HOTA 3ZMZA 3R4KA 2XV4S 3C1DA 3GYHX 1P2FA 3LA7A 4UVAA 3J7AO 4L0ZB 5LHIA 4KIGA 2QBYB 2QVOA 1OPCA 1I5ZA 4GO1A 2V1UA 1IF1A 3GO5A 1Z1DA 1OR7A 3I59A 1LQ1A 3K0LA 4GCVA 1J7KA 2OQGA 2RN7A 1XGMA 2QBYA 3Q5FA 1L0OC 4ZZLA 4G7OF 3L9FA 4IF4A 4AD9A 4OOIA 3U1DA 1XD7A 4HZFA 3C7JA 1W4MA 2HYFA 3Q9VA 5HS7A 1U5TC 3CTAA 1RNLA 2CGPA 3HTUA 2HDCA 4MGRA 4BHPA 2OQRA 3I4PA 5EEGA 1W7PB 1XMKA 3WU0A 2GXBA 1ZARA 2XROA 1O7FA 1HSTA 3H3UA 2UWMA 2NNYA 1XGSA 2HTSA 4WXCA 5L3GA 2RGVA 5CVVA 2OBPA 1ZRCA 1IRFA 2B0LA 2G7HA 1E17A 3HSFA 4L0YB 2L01A 1K79A 3RYPA 3F8MA 1W7PA 1SD7A 4LG0A 2ESNA 4EGZA 2PJPA 1BC7C 1XGNA 2TDXA 1C0WA 1T98A 2H94A 4EQQA 4M74A 2P7VB 5ILVA 2PN6A 4KNYA 4WCGA 2A3SA 2CFXA 4IRHA 2ZFWA 4KMFA 5HLIA 5AIQA 5FFXA 1KYZA 2DW4A 2VC1A 1DPRA 1R22A 2XGXA 3EDPA 2KIUA 5F6FA 3R6SA 1GXPA 1XSDA 4HX7A 2QQBA 2PG4A 4A6DA 1ZGAA 2QWWA 3HOSA 1T6SA 1B1BA 1Y0UA 3DFGA 2VE8A 3JW4A 4UV8A 3CUQB 3B73A 3CJNA 1J2XA 1EV7A 1QO0D 4LJZF 3L2CA 2VT3A 2MLKA 3FMRA 3E5QA 3KLOA 1MDMB 3WTWC 4RGUA 3F21A 4TV7A 1O57A 5CVIA 3SXYA 1XB4A 5DUKA 4L9TA 1XCVA 3TKYA 2L02A 3Q9SA 1Z7UA 3OOPA 2VBWA 1S7AA 2Q0OA 1IRGA 3CUQA 5EEHA 2HQNA 1J5YA 4P96A 1BIAA 3VODA 4FT8A 1OKRA 1HKSA 4UVCA 2UZKA 3BY6A 2R7DA 1BI0A 2J5OA 2EA2A 2Y75A 1I1GA 1TNTA 3V4GA 4UV9A 2LF7A 4B8XA 2KIFA 1WQ2A 4LGWA 3OV8A 2MH9A 4EVIA 3KZYA 1ULYA 5LEJA 2VN2A 1LB2A 2RC4A 3LQRA 1QZZA 3EQLF 3MZYA 1W7PD 5HLHA 2NRAC 3SZPA 1FBUA 1JHFA 1LEBA 1YG2A 5LRRA 4CICA 1ODDA 3ML6A 3G73A 1RI7A 4U7BA 1IXCA 4O3MA 3BWGA 3VEPA 1K7AA 2WV0A 3C18A 5D5VB 3TO6A 5L3CA 1XMAA 1YS7A 1DPUA 3EUHA 1RZ4A 3REOA 2D45A 1R23A 4OIOF 5E20A 5K5OA 2JRTA 1E2XA 2FMLA 4GGGA 3ZQ7A 5FD5A 5DD8A 3E6MA 3IC7A 5TJJA 2BEOA 1IN4A 1QZYA 5D6FA 1XSVA 3TOAA 2HGCA 2YSRA 4M6XA 2DK5A 2Y0MA 3TQNA 3LSTA 1YIOA 2ZNZA 3GEZA 1G3TA 2ESHA 2G7UA 3HIFA 2KKOA 5LGNA 1B9NA 4ASNA 3FXRA 1T2KA 2CWEA 3ZMSA 3I58A 1ZRDA 2PQ8A 3U9GA 4FX0A 1D3YA 2ELHA 1EH6A 4HOBA 4S05A 1CF7B 2RQPA 1ZAOA 2L3DA 3FXUA 2VODA 1YS6A 1J59A 3BOQA 4ZH4F 2YU3A 3LQQA 5LHGA 3CUQC 5ICEA 1FP2A 3D0SA 3ECHA 4MTEA 1EH7A 3N97A 2PI0A 2NYXA 1F9NA 4JK1X 2WC2A 2Z5UA 3D5LA 5E8GA 1ZG1A 4M73A 1R00A 3IKTA 3HRSA 5FLXK 2HEOA 4KN4X 2NAZA 2H09A 4KICA 2K4BA 1SAXA 2OZUA 1FPQA 2XAFA 4A0ZA 2DQRA 1ON1A 2M30A 1LEAA 1XDSA 3DXJF 4CYDA 4U0WA 2XKOA 2H6BA 2IA0A 4M9SA 2M1BA 3KEOA 3C3WA 3M9AA 3WTYC 1STZA 3T1BA 2V79A 4L9VA 4BNCA 2KJBA 4D0PA 4LMYA 2FXAA 1OYIA 2RVCA 4ESBA 3RPQA 1FLIA 2EA4A 4M9XA 1F5TA 3RTRA 1G3YA 4XLPF 1AOYA 1BJAA 2JPBA 3G3ZA 3GX4X 3HRTA 4UUVA 4LD5A 2F5FA 3K1MA 3E6DA 4A2UA 2GIVA 2HKOA 4CHUA 1GHCA 1MZBA 3V8KA 4IJAA 3I0TA 4RGSA 2FNAA 2LNBA 4I02A 2VBXA 5DCFA 2MH2A 2PBIA 1PDNC 1PP7U 3R61A 5D8KB 1R1UA 3KCCA 3T8RA 1FYLA 4RGXA 2D1HA 2DU9A 4AIHA 4WXDA 4XSZF 2W85A 2A5YB 3BJAA 4G6QA 5JR3A 3FM5A 1ONVA 2W25A 4U88A 1B9MA 4O6JA 5D8LB 2FOKA 4PGHA 2NS0A 3PQJA 4G94A 2DLLA 3SFZA 2JPCA 1FX7A 4R8HA 5K5RA 1I1SA 1KU9A 3BP8A 2Q2EA 1ON2A 1MJAA 2EV5A 2XAHA 1RIOH 4ESFA 5L3BA 1QBJA 3I59B 5HDKA 5DCMA 1FSHA 5HS9A 3I54A 3L00A 2FMYA 5HS8A 2E7XA 4G6DA 1OYYA 2EJRA 2KIMA 4EM0B 2UXNA 2F2EA 2EV6A 5BPDA 3EETA 3DPTA 5BMZA 2VBZA 4G9YA 3HRUA 2M5WA 2E7WA 3LAPA 3P7NA 3IL2A 2VXZA 1ZYRF 2PMUA 1LNWA 5KVRA 3I71A 1ZG5A 5ICGA 1B4AA 1BC8C 3DV8A 3CO6C 1YO5C 2OA4A 5D4SA 3QPTA 4BAYA 1FT9A 1ZLJA 1ZLKA 4ENKA 1S6LA 1BBYA 5ED4A 1O3TA 4R79A 3ULQB 3F23A 3HHGA 4ZZDA 1S29A 1TTYA 1JXSA 1MD0A 4I7HA 5A2QZ 1G4DA 2Z3YA 2GXGA 2BE5F 2GWRA 4LG0B 2K27A 5FD6A 2E1NA 1KQ0A 2AXLA 4ESJA 1MJ9A 3J81Z 4HDVA 1BI3A 1SMTA 5ERIA 4HF0A 2K02A 2GQQA 4K2EA 3GW2A 1UCRA 4HQEA 2FA5A 1PP8F 1P4WA 1XSXA 2EFNA 4HF2A 3WTVC 4LLNA 1LDDA 1P92A 4LK1F 1YLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8F A;  4P5O A;  1IXS B;  2FBH A;  2LF8 A;  1S3J A;  1ZRF A;  3PFI A;  1A04 A;  4BHB A;  4RB3 C;  3CLO A;  1P6R A;  3JTG A;  4AWX B;  1V4R A;  1J9I A;  5JFR A;  1WRJ A;  1FP1 D;  2FBI A;  4KT5 C;  2NNN A;  3WTZ A;  3FMS A;  3J80 K;  2ISY A;  2IPQ X;  3V7S A;  2K7L A;  2XAS A;  4IHT A;  5DV5 A;  1IN8 A;  2O3F A;  4LFU A;  2VC0 A;  3NQO A;  4KFC A;  3WGH A;  1O3Q A;  4HA8 A;  3M7G A;  2ACJ A;  2RKH A;  3GUD A;  4KIF A;  4OIP F;  4OIN F;  4N9I A;  5KK1 A;  1R1T A;  2OZ6 A;  4M72 A;  4ZYG A;  3JAM Z;  4CDG A;  3ZPL A;  4KIB A;  2P4W A;  4RB2 C;  3K2Z A;  4AIJ A;  3ZP5 A;  1ZGJ A;  2OU2 A;  3I53 A;  4A0Y A;  1HXD A;  4L9N A;  5H20 A;  2BGC A;  3PQK A;  2EB7 A;  5D5U B;  2XAG A;  5DEQ A;  1KU2 A;  2DTR A;  4O5V A;  2A6E F;  5E1Z B;  4U0V A;  1KU3 A;  3CDH A;  4HYE A;  2R3S A;  5LGU A;  4YG2 F;  3RJP A;  2ISZ A;  4UNO A;  2O0Y A;  2ZBK A;  1IN6 A;  3ZN1 A;  5IT9 Z;  1R1V A;  2ZJ2 A;  3RIR A;  3RKX A;  4L5I A;  4IRG A;  3JSO A;  1O7L A;  4ZYD A;  3KP3 A;  1G3S A;  3I5U A;  3ROU A;  1K6O A;  3F3X A;  1IN5 A;  5FGM A;  1RUO A;  1SD4 A;  5J8F A;  4U0Y A;  1K78 A;  3IHU A;  4CXF A;  3GZ5 A;  1KYW A;  3KP4 A;  5BPI A;  3J81 K;  1TQI A;  3ABU A;  1ZHF A;  2ZME B;  3F6O A;  1ZH5 A;  4OMY A;  5CVU A;  1TQP A;  4EMS A;  3E5X A;  3SHF A;  5E1W A;  2D1V A;  4A12 A;  4P9U A;  4MNU A;  2CO5 A;  4RGR A;  2FNP A;  3SQN A;  1KGS A;  5L3D A;  2MC3 A;  4AIK A;  2HR3 A;  1DDN A;  2E1C A;  3E5U A;  1HQC A;  2ZME A;  2M8E A;  6PAX A;  1IW7 F;  4RB1 A;  3S2W A;  5FB2 A;  4MTD A;  2CQK A;  3HSR A;  2Z33 A;  2ADU A;  2FF4 A;  1P4X A;  1KU7 A;  3HRM A;  1JHH A;  2FSW A;  1OMI A;  3KP2 A;  3MCZ A;  5LGT A;  1BI2 A;  1GXQ A;  4LK0 F;  1R58 A;  2A61 A;  5D6E A;  4YFN F;  2MLG A;  2A68 F;  2O6G E;  2JSC A;  5K5Q A;  3WTU C;  1QGP A;  3K1P A;  3BPX A;  2VOO A;  1B6A A;  5D5W B;  1WWX A;  1YTY A;  5HVQ C;  2BYV E;  2QUF A;  3QP5 A;  3R0A A;  2ZKZ A;  4OIR F;  3ZMD A;  4H0E A;  2A07 F;  5LEK A;  4HLX A;  3RDI A;  2F5E A;  1SMY F;  2COM A;  2IA1 A;  5CLS A;  4ZYH A;  2YX7 A;  2KJC A;  2DI3 A;  1DUX C;  3U2R A;  4WWC A;  2WWY A;  4HF1 A;  3GXO A;  3I64 A;  3ABT A;  4ZYE A;  3WTS C;  4IRI A;  3FWE A;  3TDU C;  3GFL A;  3TOB A;  4WXH A;  3V8L A;  4XRF A;  2PMH A;  4EGY A;  2HWV A;  3MFK A;  1ZN2 A;  3N4M A;  1Z05 A;  2QEN A;  1JE8 A;  1D8K A;  5F64 A;  3P9I A;  1J75 A;  1TQM A;  1R7J A;  3ZMT A;  5AIP A;  1S8N A;  4KUM A;  4FHT A;  1UHW A;  1U78 A;  5LHH A;  2L4M A;  2V1D A;  3K69 A;  2HOE A;  4ON0 A;  4A5M A;  3IWZ A;  3EYY A;  5HOO A;  1QPM A;  2XAJ A;  3QRF F;  3RPU A;  3V7C A;  2R7F A;  2FU4 A;  2PEX A;  1HBX G;  3F8C A;  4EV0 A;  3O6B B;  4BQA A;  4Q5S F;  5BS6 A;  1LDJ A;  1BI1 A;  1LJ9 A;  4HW0 A;  4HAM A;  3E97 A;  1FY7 A;  3RYR A;  2MD5 A;  2ZXJ A;  4MEX F;  4LLG F;  4N9H A;  4B09 A;  1SFU A;  3BRO A;  4EJO A;  1Z9C A;  4EJW A;  1R36 A;  2A69 F;  1YFH A;  3DP7 A;  1T38 A;  3B02 A;  4P55 A;  5AON A;  3ZMV A;  3KFW X;  2X0L A;  2EFO A;  3F6V A;  1LDK B;  4Z2Y A;  3T8T A;  2OD5 A;  4KMU X;  2EFW A;  3GZ6 A;  3RI4 A;  1TW3 A;  4GYI A;  5LBQ A;  3GF2 A;  1MGT A;  2XKP A;  3T0Y A;  4EJT A;  3F8B A;  5ILU A;  1W5T A;  2QZ8 A;  2VT2 A;  5DCM B;  3ZMU A;  1UFM A;  2STT A;  2VOP A;  2M45 A;  2IP2 A;  4DNC A;  4RAZ A;  3TO9 A;  3FMQ A;  3GVA A;  4NQW A;  3EYI A;  2WTE A;  4RAY A;  4IHS A;  4BH9 A;  1R5G A;  4PZJ A;  2P7C B;  3IWF A;  2JTV A;  5LRS A;  2ZNY A;  1Z6T A;  3O3K A;  1RUN A;  3KEQ A;  3P9K A;  3AAF A;  2UXX A;  4RS8 A;  1YW7 A;  3QPH A;  2IW5 A;  1FZP B;  1YW9 A;  2AS5 F;  2HFH A;  5E17 F;  4M9Z A;  5FO5 A;  1FOK A;  4JBA A;  1HKT A;  1D8J A;  4CGZ A;  2GA1 A;  1FSE A;  1G3W A;  3FZV A;  1H9G A;  4BXU A;  3GLX A;  2C6Y A;  1U3E M;  3BPV A;  1MKM A;  2XHK A;  1FC3 A;  3KP7 A;  2FBK A;  3COA C;  3ZN0 A;  2VBY A;  4A6E A;  2XUB A;  1KA8 A;  4Y13 A;  3HTS B;  4I01 A;  4HLY A;  4ETS A;  4ENN A;  2K86 A;  1NHA A;  2CSO A;  1BOA A;  4P9F A;  4UXN A;  1FBQ A;  5FFZ A;  5D4R A;  5E1X A;  2RDP A;  2XIG A;  3LA3 A;  3WTT C;  4U7D A;  5D5X B;  4XBF A;  5CVJ A;  4I0A A;  5HDG A;  3TDZ C;  5JHU A;  1UHM A;  2L4A A;  1J0R A;  4HV5 A;  1XCB A;  2EK5 A;  3M1E A;  3L09 A;  5BOX A;  5K1Y A;  2QQ9 A;  1OYW A;  1IAW A;  4UHT A;  1O3R A;  3H3Z A;  2EFP A;  3KET A;  1L3L A;  4PGG A;  2P8T A;  4QWQ A;  3FXQ A;  4L9J A;  2IJL A;  2Q8K A;  5HDN A;  1HW5 A;  2CW0 F;  5ILS A;  1XGO A;  3E6C C;  2ZCW A;  3QOP A;  2H6C A;  1USS A;  2G9W A;  3TO7 A;  3QU6 A;  4OU0 A;  2DT5 A;  4QLC U;  3CUO A;  3KE2 A;  2M87 A;  2CG4 A;  1WI9 A;  5F1R A;  4KDP A;  1TW2 A;  2BV6 A;  3GWZ A;  3P9C A;  4M6Y A;  1BN5 A;  1Z91 A;  2HS5 A;  3O2P E;  2EV0 A;  5LLQ A;  1XDU A;  3MZH A;  3IRR A;  2YPR A;  1X3U A;  3QAH A;  2X4H A;  1SD6 A;  4OMZ A;  2LDU A;  2BBY A;  4YFX F;  4MQV A;  1WSU A;  1U6G A;  2MA3 A;  1F4K A;  1HKQ A;  1MJB A;  4I2O A;  4HBL A;  4BHC A;  2V6C A;  4A5N A;  3ECO A;  1PUE E;  2JT1 A;  4CO8 A;  5TRD A;  1HW1 A;  3BDD A;  2W57 A;  1AWC A;  3VOE A;  2FEZ A;  5CJ9 A;  2F5D A;  3ELK A;  3GFM A;  4WX9 A;  2XRN A;  4Q47 A;  2K4J A;  3DKW A;  1SFX A;  2STW A;  1W5S A;  2HQR A;  3KP5 A;  1K78 B;  2GAU A;  1Z6R A;  4PCQ A;  3ISP A;  4YFK F;  5DD4 A;  3JTH A;  2P6S A;  3FHZ A;  3BJ6 A;  4Q48 A;  1YYV A;  2RNJ A;  2A6H F;  2P6T A;  3IRQ A;  3E3V A;  2ETH A;  3F22 A;  5FLX Z;  3F72 A;  4E70 A;  5DDG A;  1FWZ A;  4EJV A;  2OAZ A;  3V8J A;  1KQ8 A;  1MDM A;  5A2Q K;  3FM3 A;  3WGG A;  3ERE D;  2XVC A;  1I6X A;  1TNS A;  2HZT A;  5L3E A;  3T5X A;  2V9V A;  4HV6 A;  3KZZ A;  3DEU A;  5HLG A;  3R0J A;  3CO7 C;  3JSP A;  2P5K A;  2Z99 A;  4UVB A;  1XN7 A;  2IRF G;  1FYM A;  1YQA A;  1BIB A;  2MBF A;  5H6Q A;  1S7O A;  4DQ2 A;  3VB2 A;  3MEX A;  5IT3 A;  3M8F A;  3GFI A;  5L3F A;  3BZ6 A;  3HYI A;  3WG9 A;  4NB5 A;  3W6J B;  3VFZ A;  4Y17 A;  4PDK A;  1Q1H A;  3TGN A;  4IVN A;  1D5V A;  2RV8 A;  3HUG A;  1QNT A;  4A0X A;  2HYG D;  1IUY A;  3W6K B;  4S04 A;  1G6N A;  2DPD A;  4I0B A;  3K1N A;  1F1Z A;  4G7H F;  2HKX A;  1ZRE A;  2LSO A;  5J8C A;  2VE9 A;  3MQ0 A;  3WGI A;  2FE3 A;  3E6B A;  1IXR C;  3RKY A;  2PLY A;  2EWN A;  3RKW A;  3WTX C;  1I27 A;  5JVT A;  2W84 A;  1FYK A;  3DQV C;  3JAM K;  4XLN F;  5DYM A;  4Q4Z F;  4WF2 A;  3QP6 A;  1FNN A;  4YII A;  4G7Z F;  4NHJ A;  5CVR A;  3QU3 A;  4N0B A;  4LB6 B;  3MAJ A;  1FBS A;  2XAQ A;  4MHG A;  1TBX A;  5ICF A;  1H9T A;  5J6X A;  2YX4 A;  1TLH B;  4YIF A;  1LVA A;  2DFI A;  1HSJ A;  1CGP A;  2D2W A;  4MEY F;  2DK8 A;  4L5J A;  2DBB A;  1U2W A;  3H92 A;  3L7W A;  5IT9 K;  3V7R A;  3HSE A;  1REP C;  5E18 F;  1CF7 A;  2ZO4 A;  3M8E A;  3R60 A;  1WKM A;  2QQA A;  3MWM A;  4CZZ A;  3HHH A;  4XSX F;  2H27 A;  4Y15 A;  1SFE A;  5E8I A;  2GA2 A;  2GZW A;  2CYY A;  1GVJ A;  4BYY A;  4M71 A;  1V3F A;  2FQ3 A;  4KA4 A;  2DPU A;  1IN7 A;  1YW8 A;  2W24 A;  2YR2 A;  3F8N A;  2O61 A;  2Y48 A;  2DO7 A;  4F7Z A;  1P4A A;  2QM3 A;  3NEU A;  2P5V A;  1U5T B;  3WE2 A;  2LKP A;  2PFB A;  4R1H A;  3DPL C;  2FRH A;  3NRV A;  4HX8 A;  4HX4 A;  1HW2 A;  2O8X A;  3WE3 A;  3FX3 A;  1VTN C;  4JQF A;  5CYV A;  4I98 B;  4KYW A;  2HTJ A;  4HDU A;  1H0M A;  5JI6 A;  1ZG3 A;  4RB0 A;  4LLL A;  4GYG A;  3WOD F;  1EH8 A;  4LB5 A;  4HQM A;  1U5T A;  4EM1 A;  2J5P A;  4L18 B;  2EFQ A;  4EM2 A;  5ICC A;  4GXO A;  3LFK A;  1B59 A;  3GFJ A;  2VON A;  3K9T A;  3DF8 A;  1UST A;  1T39 A;  4WK8 F;  1QQI A;  1U8R A;  3IKV A;  4IXA A;  2V1X A;  3FF5 A;  2DQL A;  3LAJ A;  1BM9 A;  4KN7 X;  4G8X A;  5H6R A;  1IZ1 A;  2IVM A;  4OIQ F;  2IA2 A;  4IPA A;  2DAO A;  2F5C A;  4ENM A;  2Z9O A;  4MQ9 F;  5BQT A;  1DP7 P;  3KP6 A;  1T0F A;  1JGS A;  2O03 A;  3J80 Z;  3LWF A;  4EJU A;  2P5L C;  1UB9 A;  2QYO A;  5DUI A;  1R5H A;  2IT0 A;  3LA2 A;  2JZY A;  3SZT A;  4I09 A;  4AVP A;  2KRF A;  1SD5 A;  4FX4 A;  3BJO A;  3WU1 B;  2QLZ A;  4ENJ A;  1KQ9 A;  1O3S A;  3KLN A;  2L54 A;  3HOT A;  3ZMZ A;  3R4K A;  2XV4 S;  3C1D A;  3GYH X;  1P2F A;  3LA7 A;  4UVA A;  3J7A O;  4L0Z B;  5LHI A;  4KIG A;  2QBY B;  2QVO A;  1OPC A;  1I5Z A;  4GO1 A;  2V1U A;  1IF1 A;  3GO5 A;  1Z1D A;  1OR7 A;  3I59 A;  1LQ1 A;  3K0L A;  4GCV A;  1J7K A;  2OQG A;  2RN7 A;  1XGM A;  2QBY A;  3Q5F A;  1L0O C;  4ZZL A;  4G7O F;  3L9F A;  4IF4 A;  4AD9 A;  4OOI A;  3U1D A;  1XD7 A;  4HZF A;  3C7J A;  1W4M A;  2HYF A;  3Q9V A;  5HS7 A;  1U5T C;  3CTA A;  1RNL A;  2CGP A;  3HTU A;  2HDC A;  4MGR A;  4BHP A;  2OQR A;  3I4P A;  5EEG A;  1W7P B;  1XMK A;  3WU0 A;  2GXB A;  1ZAR A;  2XRO A;  1O7F A;  1HST A;  3H3U A;  2UWM A;  2NNY A;  1XGS A;  2HTS A;  4WXC A;  5L3G A;  2RGV A;  5CVV A;  2OBP A;  1ZRC A;  1IRF A;  2B0L A;  2G7H A;  1E17 A;  3HSF A;  4L0Y B;  2L01 A;  1K79 A;  3RYP A;  3F8M A;  1W7P A;  1SD7 A;  4LG0 A;  2ESN A;  4EGZ A;  2PJP A;  1BC7 C;  1XGN A;  2TDX A;  1C0W A;  1T98 A;  2H94 A;  4EQQ A;  4M74 A;  2P7V B;  5ILV A;  2PN6 A;  4KNY A;  4WCG A;  2A3S A;  2CFX A;  4IRH A;  2ZFW A;  4KMF A;  5HLI A;  5AIQ A;  5FFX A;  1KYZ A;  2DW4 A;  2VC1 A;  1DPR A;  1R22 A;  2XGX A;  3EDP A;  2KIU A;  5F6F A;  3R6S A;  1GXP A;  1XSD A;  4HX7 A;  2QQB A;  2PG4 A;  4A6D A;  1ZGA A;  2QWW A;  3HOS A;  1T6S A;  1B1B A;  1Y0U A;  3DFG A;  2VE8 A;  3JW4 A;  4UV8 A;  3CUQ B;  3B73 A;  3CJN A;  1J2X A;  1EV7 A;  1QO0 D;  4LJZ F;  3L2C A;  2VT3 A;  2MLK A;  3FMR A;  3E5Q A;  3KLO A;  1MDM B;  3WTW C;  4RGU A;  3F21 A;  4TV7 A;  1O57 A;  5CVI A;  3SXY A;  1XB4 A;  5DUK A;  4L9T A;  1XCV A;  3TKY A;  2L02 A;  3Q9S A;  1Z7U A;  3OOP A;  2VBW A;  1S7A A;  2Q0O A;  1IRG A;  3CUQ A;  5EEH A;  2HQN A;  1J5Y A;  4P96 A;  1BIA A;  3VOD A;  4FT8 A;  1OKR A;  1HKS A;  4UVC A;  2UZK A;  3BY6 A;  2R7D A;  1BI0 A;  2J5O A;  2EA2 A;  2Y75 A;  1I1G A;  1TNT A;  3V4G A;  4UV9 A;  2LF7 A;  4B8X A;  2KIF A;  1WQ2 A;  4LGW A;  3OV8 A;  2MH9 A;  4EVI A;  3KZY A;  1ULY A;  5LEJ A;  2VN2 A;  1LB2 A;  2RC4 A;  3LQR A;  1QZZ A;  3EQL F;  3MZY A;  1W7P D;  5HLH A;  2NRA C;  3SZP A;  1FBU A;  1JHF A;  1LEB A;  1YG2 A;  5LRR A;  4CIC A;  1ODD A;  3ML6 A;  3G73 A;  1RI7 A;  4U7B A;  1IXC A;  4O3M A;  3BWG A;  3VEP A;  1K7A A;  2WV0 A;  3C18 A;  5D5V B;  3TO6 A;  5L3C A;  1XMA A;  1YS7 A;  1DPU A;  3EUH A;  1RZ4 A;  3REO A;  2D45 A;  1R23 A;  4OIO F;  5E20 A;  5K5O A;  2JRT A;  1E2X A;  2FML A;  4GGG A;  3ZQ7 A;  5FD5 A;  5DD8 A;  3E6M A;  3IC7 A;  5TJJ A;  2BEO A;  1IN4 A;  1QZY A;  5D6F A;  1XSV A;  3TOA A;  2HGC A;  2YSR A;  4M6X A;  2DK5 A;  2Y0M A;  3TQN A;  3LST A;  1YIO A;  2ZNZ A;  3GEZ A;  1G3T A;  2ESH A;  2G7U A;  3HIF A;  2KKO A;  5LGN A;  1B9N A;  4ASN A;  3FXR A;  1T2K A;  2CWE A;  3ZMS A;  3I58 A;  1ZRD A;  2PQ8 A;  3U9G A;  4FX0 A;  1D3Y A;  2ELH A;  1EH6 A;  4HOB A;  4S05 A;  1CF7 B;  2RQP A;  1ZAO A;  2L3D A;  3FXU A;  2VOD A;  1YS6 A;  1J59 A;  3BOQ A;  4ZH4 F;  2YU3 A;  3LQQ A;  5LHG A;  3CUQ C;  5ICE A;  1FP2 A;  3D0S A;  3ECH A;  4MTE A;  1EH7 A;  3N97 A;  2PI0 A;  2NYX A;  1F9N A;  4JK1 X;  2WC2 A;  2Z5U A;  3D5L A;  5E8G A;  1ZG1 A;  4M73 A;  1R00 A;  3IKT A;  3HRS A;  5FLX K;  2HEO A;  4KN4 X;  2NAZ A;  2H09 A;  4KIC A;  2K4B A;  1SAX A;  2OZU A;  1FPQ A;  2XAF A;  4A0Z A;  2DQR A;  1ON1 A;  2M30 A;  1LEA A;  1XDS A;  3DXJ F;  4CYD A;  4U0W A;  2XKO A;  2H6B A;  2IA0 A;  4M9S A;  2M1B A;  3KEO A;  3C3W A;  3M9A A;  3WTY C;  1STZ A;  3T1B A;  2V79 A;  4L9V A;  4BNC A;  2KJB A;  4D0P A;  4LMY A;  2FXA A;  1OYI A;  2RVC A;  4ESB A;  3RPQ A;  1FLI A;  2EA4 A;  4M9X A;  1F5T A;  3RTR A;  1G3Y A;  4XLP F;  1AOY A;  1BJA A;  2JPB A;  3G3Z A;  3GX4 X;  3HRT A;  4UUV A;  4LD5 A;  2F5F A;  3K1M A;  3E6D A;  4A2U A;  2GIV A;  2HKO A;  4CHU A;  1GHC A;  1MZB A;  3V8K A;  4IJA A;  3I0T A;  4RGS A;  2FNA A;  2LNB A;  4I02 A;  2VBX A;  5DCF A;  2MH2 A;  2PBI A;  1PDN C;  1PP7 U;  3R61 A;  5D8K B;  1R1U A;  3KCC A;  3T8R A;  1FYL A;  4RGX A;  2D1H A;  2DU9 A;  4AIH A;  4WXD A;  4XSZ F;  2W85 A;  2A5Y B;  3BJA A;  4G6Q A;  5JR3 A;  3FM5 A;  1ONV A;  2W25 A;  4U88 A;  1B9M A;  4O6J A;  5D8L B;  2FOK A;  4PGH A;  2NS0 A;  3PQJ A;  4G94 A;  2DLL A;  3SFZ A;  2JPC A;  1FX7 A;  4R8H A;  5K5R A;  1I1S A;  1KU9 A;  3BP8 A;  2Q2E A;  1ON2 A;  1MJA A;  2EV5 A;  2XAH A;  1RIO H;  4ESF A;  5L3B A;  1QBJ A;  3I59 B;  5HDK A;  5DCM A;  1FSH A;  5HS9 A;  3I54 A;  3L00 A;  2FMY A;  5HS8 A;  2E7X A;  4G6D A;  1OYY A;  2EJR A;  2KIM A;  4EM0 B;  2UXN A;  2F2E A;  2EV6 A;  5BPD A;  3EET A;  3DPT A;  5BMZ A;  2VBZ A;  4G9Y A;  3HRU A;  2M5W A;  2E7W A;  3LAP A;  3P7N A;  3IL2 A;  2VXZ A;  1ZYR F;  2PMU A;  1LNW A;  5KVR A;  3I71 A;  1ZG5 A;  5ICG A;  1B4A A;  1BC8 C;  3DV8 A;  3CO6 C;  1YO5 C;  2OA4 A;  5D4S A;  3QPT A;  4BAY A;  1FT9 A;  1ZLJ A;  1ZLK A;  4ENK A;  1S6L A;  1BBY A;  5ED4 A;  1O3T A;  4R79 A;  3ULQ B;  3F23 A;  3HHG A;  4ZZD A;  1S29 A;  1TTY A;  1JXS A;  1MD0 A;  4I7H A;  5A2Q Z;  1G4D A;  2Z3Y A;  2GXG A;  2BE5 F;  2GWR A;  4LG0 B;  2K27 A;  5FD6 A;  2E1N A;  1KQ0 A;  2AXL A;  4ESJ A;  1MJ9 A;  3J81 Z;  4HDV A;  1BI3 A;  1SMT A;  5ERI A;  4HF0 A;  2K02 A;  2GQQ A;  4K2E A;  3GW2 A;  1UCR A;  4HQE A;  2FA5 A;  1PP8 F;  1P4W A;  1XSX A;  2EFN A;  4HF2 A;  3WTV C;  4LLN A;  1LDD A;  1P92 A;  4LK1 F;  1YLF A; 
#chains in the Genus database with same CATH topology
 3F8F A;  4P5O A;  3H0G J;  3HKZ N;  1IXS B;  2FBH A;  4BXF A;  2LF8 A;  2YU9 J;  3WHB A;  1E3H A;  4AU7 A;  3OIQ A;  1S3J A;  2NS7 A;  4DW6 A;  1ZRF A;  3PFI A;  1A04 A;  4BHB A;  4RB3 C;  3CLO A;  1G8X A;  4BE1 A;  3M3Y J;  1P6R A;  3JTG A;  1MMD A;  1V4R A;  4AWX B;  3MVP A;  2W82 A;  1J9I A;  5JFR A;  3BR0 A;  1MND A;  1R71 A;  5FKL A;  2CQN A;  1WRJ A;  1IJW C;  1FP1 D;  2XB5 A;  4PFO A;  2FBI A;  4KT5 C;  2NNN A;  3WTZ A;  2L7Z A;  3FMS A;  2ISY A;  4YEJ A;  1I39 A;  2IPQ X;  3J80 K;  2VKD A;  1BL0 A;  4DGW B;  2F48 A;  2K3P A;  3V7S A;  2K7L A;  2XAS A;  2VKE A;  3D1N I;  4FCY A;  4IHT A;  5DV5 A;  1TWA J;  1F36 A;  1QZE A;  4B3A A;  2LLK A;  1AU7 A;  2JA8 J;  4E7L A;  2IS4 A;  1IN8 A;  3BLY A;  2E2I J;  2JUC A;  2O3F A;  4LFU A;  2VC0 A;  3NQO A;  4KFC A;  4UUT A;  3WGH A;  3I56 I;  2HOS A;  2B9S A;  1O3Q A;  3BC8 A;  2PJR B;  4HA8 A;  3M7G A;  2ACJ A;  2RKH A;  3GUD A;  2VJ5 A;  4KIF A;  4OIP F;  4OIN F;  1R5I D;  1LUJ B;  3PUF A;  2IGM A;  4N9I A;  3K4N A;  1OLT A;  1GT0 C;  2MAB A;  2W00 A;  1YOV B;  5KK1 A;  1R1T A;  2OZ6 A;  4M72 A;  3TP0 A;  4ZYG A;  3JAM Z;  2LTP A;  1JGG A;  4CDG A;  3ZPL A;  4KIB A;  2P4W A;  4RB2 C;  3K2Z A;  4AIJ A;  3ZP5 A;  1XMX A;  1ZGJ A;  3Q0W A;  2OU2 A;  3I53 A;  1AHD P;  4A0Y A;  3CMY A;  1HXD A;  4L9N A;  4HST A;  5H20 A;  2BGC A;  1SFK A;  1VQN I;  2MZ4 A;  3PQK A;  1V5E A;  1FJL A;  2EB7 A;  2L5Q A;  3S2H J;  3KYL A;  3C2G A;  4XKW A;  2PJR A;  5D5U B;  2F6C A;  3KYD B;  4PFP A;  2XAG A;  1VF9 A;  3G6E I;  5DEQ A;  3IP4 B;  2ZJR F;  1OJL A;  1KU2 A;  2DTR A;  3HG9 A;  4O5V A;  5IY5 H;  2A6E F;  3MN2 A;  5E1Z B;  3ZOB A;  3OYH A;  4U0V A;  1UJ8 A;  3OYC A;  1FMV A;  1KU3 A;  2BHZ A;  3CDH A;  1B8I B;  3K4J A;  4HYE A;  2R4G A;  1HA8 A;  3JCU C;  2R3S A;  5LGU A;  1RKW A;  4F3Q A;  4YG2 F;  3RJP A;  1AKH B;  1E3P A;  3FHN A;  4CSW A;  2ISZ A;  3FKJ A;  4UNO A;  2O0Y A;  1X2M A;  2ZBK A;  1IN6 A;  1ETQ A;  3ZN1 A;  4XLA A;  5IT9 Z;  1R1V A;  2ZJ2 A;  3RIR A;  3RKX A;  4L5I A;  4IRG A;  1A31 A;  3JSO A;  1O7L A;  3Q0U A;  3JRG A;  4ZYD A;  3KP3 A;  5IP7 J;  2HQ5 A;  2QCO A;  1G3S A;  3E0J B;  4ANJ A;  3I5U A;  3ROU A;  1K6O A;  3F3X A;  1IN5 A;  2V1N A;  5FGM A;  5LD2 C;  1RUO A;  4UY8 I;  1SD4 A;  5J8F A;  4U0Y A;  2I5U A;  1B8I A;  1K78 A;  3IHU A;  3FIS A;  4RLF A;  3GZ5 A;  4CXF A;  1KYW A;  5IT9 R;  3KP4 A;  4BY1 J;  5BPI A;  3J81 K;  1TQI A;  3ABU A;  4V2G A;  1ZHF A;  2ZME B;  3F6O A;  2RAE A;  1ZH5 A;  4OMY A;  1XS9 A;  4UB6 C;  2HDW A;  3OS1 A;  3OY9 A;  5M3F J;  2AXT C;  2GOM A;  4W1U A;  5LFA A;  1RQ6 A;  2FJ1 A;  5CVU A;  5J47 A;  1TQP A;  4EMS A;  3E5X A;  3SHF A;  2F4I A;  5E1W A;  2D1V A;  4A12 A;  4P9U A;  4MNU A;  1GV5 A;  2CO5 A;  2QKM B;  1BJZ A;  4A3L J;  1POG A;  2IEK A;  2FNP A;  4RGR A;  3SQN A;  1KGS A;  5L3D A;  2E1M B;  1D0Y A;  2MC3 A;  3KPH A;  2W4S A;  4AIK A;  2HR3 A;  2I8D A;  1DDN A;  2BVM A;  5E79 C;  3FK7 A;  2WAF A;  2E1C A;  3E5U A;  2WA0 A;  2DA3 A;  1HQC A;  4YEL A;  2ZME A;  1ZR4 A;  1RC9 A;  2M8E A;  6PAX A;  1IW7 F;  3BG5 A;  3S2W A;  5FB2 A;  4RB1 A;  4MTD A;  2CQK A;  1QPI A;  3HSR A;  4CUG A;  2ADU A;  2Z33 A;  2RNG A;  2BXY A;  2FF4 A;  4PJL A;  2VUM J;  3DEW A;  2X1D A;  4XON A;  1P4X A;  4C3H J;  2M35 A;  1KU7 A;  3HRM A;  2K9Q A;  1JHH A;  2FSW A;  1U0J A;  1OMI A;  3SDG A;  2HOT A;  1W0T A;  3KP2 A;  2CS3 A;  3MCZ A;  1BI2 A;  2ELK A;  5LGT A;  1GXQ A;  2LBF A;  4LK0 F;  3BR6 A;  1R58 A;  2MGQ A;  4IHY A;  2A61 A;  2HQA A;  4CCJ A;  2R7V A;  3O8H A;  5D6E A;  3CC4 I;  2XF6 A;  4L5E A;  4YFN F;  3S3O A;  2MLG A;  2A68 F;  2O6G E;  2JSC A;  2DYR H;  3CCS I;  3ASN H;  4ABZ A;  1Z0X A;  4BBR J;  5K5Q A;  1QGP A;  3WTU C;  3K1P A;  3BPX A;  2VOO A;  3FXJ A;  4QPQ A;  4A3F J;  1B6A A;  5D5W B;  1WJD A;  1WWX A;  1APL C;  3U21 A;  5HVQ C;  1U9N A;  1YTY A;  2HU9 A;  2A05 A;  2BYV E;  1OFC X;  2R7S A;  1IUF A;  2QUF A;  3QP5 A;  3R0A A;  2ZKZ A;  4OIR F;  3VSK A;  2AHQ A;  1NK3 P;  3OOU A;  3ZMD A;  4H0E A;  2A07 F;  1LKX A;  5LEK A;  2K5C A;  4HLX A;  4CCK A;  3RDI A;  1R49 A;  2XAU A;  2F5E A;  3J7A Y;  1SMY F;  2COM A;  2KZV A;  2IA1 A;  5CLS A;  4ZYH A;  1BR2 A;  2YX7 A;  2KJC A;  4CA0 A;  2XGE A;  2QSH X;  2DI3 A;  2BY2 A;  1DUX C;  3U2R A;  1EF4 A;  2DA4 A;  4WWC A;  2E34 A;  1IG7 A;  4XKC A;  1SAN A;  2WWY A;  4HF1 A;  2M4G A;  4HG2 A;  3H0D A;  5E3M A;  3GXO A;  3G1O A;  2KDZ A;  3I64 A;  3L2W A;  3PFY A;  3PL8 A;  1OQY A;  2DA5 A;  2M0C A;  3ABT A;  2EIJ H;  3B6A A;  3FBN B;  2NVQ J;  4ZYE A;  2GOX B;  3WTS C;  1X2N A;  3A1Y A;  1YRN B;  2X6Y A;  4IRI A;  3DBR B;  3FWE A;  3TDU C;  3GFL A;  2VJ4 A;  3TOB A;  2DOD A;  4WXH A;  3V8L A;  3H5N A;  4B4C A;  4XRF A;  2V6E A;  2PMH A;  4EGY A;  2HWV A;  3MFK A;  1ZN2 A;  1ZQ3 P;  3DPU A;  3N4M A;  1MBE A;  1Z05 A;  2QEN A;  1JE8 A;  4RBO A;  2HI3 A;  1A6I A;  2XRL A;  1D8K A;  2X6O A;  5F64 A;  1VQL I;  3P9I A;  1J75 A;  1TQM A;  1X1B A;  1R7J A;  2ECB A;  1NK2 P;  2KFD A;  3ZQI A;  3ZMT A;  3BT9 A;  3PIO F;  5AIP A;  1S8N A;  1X1C A;  4KUM A;  4FHT A;  1UHW A;  1U78 A;  2M7B A;  3EUA A;  2M9H A;  5LHH A;  3VYR B;  1B72 B;  2L4M A;  2QGU A;  1YRN A;  2V1D A;  3K69 A;  2HOE A;  2W48 A;  1GV2 A;  2VQC A;  3HBL A;  3X2Q H;  4Z6Y A;  4ON0 A;  3GCM A;  4A5M A;  4C3I J;  3HJE A;  3CP8 A;  3IWZ A;  2DA2 A;  2JN6 A;  2KL4 A;  3EYY A;  5HOO A;  1H88 C;  1QPM A;  2ME0 A;  2XAJ A;  2HXO A;  3W2W A;  3QRF F;  2VAS A;  1VQ4 I;  3RPU A;  1PUF B;  3V7C A;  2R7F A;  4EAT A;  2FU4 A;  5KCM A;  3MD2 A;  2XB0 X;  2DT7 B;  1T8I A;  4A3D J;  2PEX A;  5IOZ A;  1HBX G;  4F55 A;  3E1S A;  3F8C A;  3CES A;  2ZXI A;  1B72 A;  2ZME C;  4EV0 A;  3O6B B;  4BQA A;  2FQ4 A;  4Q5S F;  5BS6 A;  1LDJ A;  1BI1 A;  1LJ9 A;  3DWL E;  4HW0 A;  2DJN A;  4HAM A;  3LSP A;  4ZYA A;  4CCO A;  3E97 A;  2JVH A;  2OUM A;  1FY7 A;  5EG0 B;  4CH7 A;  3RYR A;  4BJ6 C;  5EGO B;  3QWL A;  3H9J A;  2MD5 A;  2ZXJ A;  2NS8 A;  4MEX F;  2L9V A;  2PMZ A;  4LLG F;  2OPT A;  3K4L A;  4N9H A;  4B09 A;  1SFU A;  1Q1V A;  3BRO A;  2E1M C;  4EJO A;  3CMA I;  4F92 B;  4BUP A;  2KIQ A;  1Z9C A;  4EJW A;  1R36 A;  2A69 F;  2VLA A;  2OCC H;  4BDZ A;  4MLO A;  1YFH A;  3DP7 A;  1T38 A;  1HOM A;  2R7O A;  3B02 A;  4P55 A;  5AON A;  3ZMV A;  4DYQ A;  3KFW X;  2IS1 A;  5KAF C;  1T33 A;  2LH9 A;  2X1C A;  2X0L A;  2EFO A;  3F6V A;  1LDK B;  1IDY A;  4AYB N;  4Z2Y A;  2GLO A;  3T8T A;  2OD5 A;  5GAG J;  2L7M P;  4KMU X;  5EG0 A;  3GZ6 A;  2EFW A;  3RI4 A;  1TW3 A;  1RKT A;  3FKI J;  4GYI A;  5B1B H;  5B3S H;  2VL8 A;  1EA3 A;  2XPW A;  5F08 A;  5LBQ A;  4DBR A;  3GF2 A;  2Y0S N;  3DU6 A;  1MGT A;  2XKP A;  3T0Y A;  4EJT A;  3F8B A;  4B44 A;  5ILU A;  1W5T A;  2QZ8 A;  2VT2 A;  2QSF X;  5DCM B;  3AG3 H;  3ZMU A;  1UFM A;  2STT A;  3OYN A;  4D5F A;  2VOP A;  2BW3 A;  3TL4 X;  2M45 A;  2IP2 A;  1R9T J;  4DNC A;  3S17 J;  4RAZ A;  4D9J A;  3TO9 A;  3FMQ A;  3GVA A;  4NQW A;  3ABM H;  2K9N A;  3EYI A;  4IHW A;  4I6Z A;  1BR1 A;  4BBS J;  2WTE A;  4RAY A;  4IHS A;  4BH9 A;  2BY3 A;  1R5G A;  2X98 A;  4PZJ A;  4BQQ A;  2P7C B;  2OTJ I;  3IWF A;  2JTV A;  1SVL A;  5LRS A;  1Z21 A;  2ZNY A;  4IKF A;  2LG4 A;  1Z6T A;  2DA1 A;  3O3K A;  1RUN A;  3KEQ A;  3GTO J;  5KNL A;  2H8W A;  3P9K A;  3AAF A;  2UXX A;  4RS8 A;  1YW7 A;  1FOY A;  1DU0 A;  3I4N J;  3QPH A;  4OWR B;  3M8J A;  2IW5 A;  1MIJ A;  1FZP B;  1YW9 A;  2K85 A;  4F52 A;  4DZJ A;  2AS5 F;  3DKY A;  3W3C A;  2HFH A;  3HOW J;  5E17 F;  4M9Z A;  5FO5 A;  1FOK A;  3AG1 H;  2YUS A;  2MG4 A;  4JBA A;  1HKT A;  2Y9Z A;  1V54 H;  3QYE A;  2DA6 A;  1D8J A;  4CGZ A;  1WPK A;  1QA6 A;  2GA1 A;  1FSE A;  1G3W A;  3F0C A;  3FZV A;  2ZC2 A;  1H9G A;  4FAS D;  4BAC A;  2DDA A;  3TP3 A;  4I76 A;  4BXU A;  5J1U A;  2K40 A;  2DMT A;  3GLX A;  4Y33 A;  2C6Y A;  2KPM A;  2K3F A;  1YX5 A;  3KZI C;  1U3E M;  2CV0 A;  1MBK A;  2NOG A;  3BPV A;  1AA7 A;  5CQG A;  1MKM A;  3I55 I;  2XHK A;  2LP0 A;  2V7F A;  1XPX A;  1GDT A;  1TWF J;  1FC3 A;  3KP7 A;  2FBK A;  4Y4R A;  3COA C;  5CPR B;  2MYS A;  3LSK A;  2R5Z A;  1I3A A;  3ZN0 A;  1G59 A;  2VBY A;  4A6E A;  3OL4 A;  2XUB A;  1LFP A;  1E3O C;  1KA8 A;  4Y13 A;  4H4K C;  3HTS B;  1MW7 A;  2JUG A;  3CCY A;  3LOC A;  3H5A A;  4FET A;  1HDP A;  4I01 A;  4IOA F;  4HLY A;  3OS2 A;  4IL6 C;  4ETS A;  4ENN A;  3H9G A;  5DM6 F;  2K86 A;  2VXD A;  1NHA A;  2CSO A;  1BOA A;  1W1W E;  4P9F A;  4UXN A;  2DMU A;  1FBQ A;  1D1A A;  5FFZ A;  5D4R A;  5E1X A;  2RDP A;  2Z1D A;  2XIG A;  3LA3 A;  3WTT C;  2CQ7 A;  3ZQF A;  3QYB A;  4U7D A;  5D5X B;  2WAE A;  4XBF A;  4M3D A;  4A3K J;  2L7K A;  2BVL A;  5CVJ A;  4I0A A;  5HDG A;  3TDZ C;  5JHU A;  1UHM A;  2L4A A;  3LSG A;  3K7A J;  1J0R A;  3GZN B;  4HV5 A;  3QPS A;  1XCB A;  2EK5 A;  3M1E A;  2WV1 A;  3L09 A;  3QYF A;  5BOX A;  5K1Y A;  2QQ9 A;  1OYW A;  4XRS A;  1IAW A;  3GBG A;  1QVT A;  4UHT A;  1JKP C;  1W36 D;  3LSJ A;  3H3Z A;  1O3R A;  2AQE A;  2EFP A;  3KET A;  1A5J A;  3AL0 B;  2P0W A;  2Z16 A;  4F91 B;  1L3L A;  4PGG A;  3TMO A;  2DFF A;  2P8T A;  4QWQ A;  2LRE A;  1U8B A;  2CFO A;  3W6V A;  3FXQ A;  3LMM A;  4L9J A;  2IJL A;  2Q8K A;  3AG4 H;  5HDN A;  4DBQ A;  2DT6 A;  2RRE A;  1W36 C;  2CUZ A;  1ETO A;  1HW5 A;  2CW0 F;  5ILS A;  1FOW A;  1XGO A;  3E6C C;  2ZCW A;  4PSW A;  4A3G J;  4IZZ A;  3ZCO A;  4IOC F;  3QOP A;  2W1O A;  1OCP A;  2H6C A;  3CZ6 A;  3AFH A;  1USS A;  2G9W A;  4HRI A;  4ZC3 A;  2WAQ A;  2JA7 J;  3TO7 A;  3QU6 A;  2HPI A;  4DYR A;  4OU0 A;  2DT5 A;  3CC7 I;  1QRY A;  3LSH A;  3PNY A;  4UUS A;  4IHV A;  2Y31 A;  1MH4 A;  4QLC U;  5GTI C;  1K4T A;  3CUO A;  5J4Y A;  3KE2 A;  2GIZ A;  2XC7 A;  1MMA A;  2M87 A;  2EZL A;  2CG4 A;  2EZI A;  3CCJ I;  1WI9 A;  5F1R A;  2HVQ A;  4KDP A;  2ZSI B;  3WHC A;  2IS6 A;  2CH0 A;  1TW2 A;  3BCB A;  4LG3 A;  2BV6 A;  4NDL A;  3GWZ A;  3P9C A;  4F93 B;  5DM7 F;  4A3C J;  4M6Y A;  3S1R J;  1OIS A;  5EZG A;  1BN5 A;  1Z91 A;  2HS5 A;  3O2P E;  2EV0 A;  1LFB A;  1WGX A;  5LLQ A;  1ERD A;  1FTZ A;  3BCA A;  1O4X A;  3TW6 A;  1XDU A;  3PNV A;  3MZH A;  3IRR A;  3CDL A;  2YPR A;  1G2H A;  2DJI A;  1X3U A;  4Y3O A;  3QAH A;  2PX9 A;  2X4H A;  3PJR A;  3TBI A;  1SD6 A;  4OMZ A;  2LDU A;  2BBY A;  4QSH A;  3EUK L;  2KRC A;  4MO7 A;  1EKE A;  3BTI A;  4YFX F;  4MQV A;  1WSU A;  1U6G A;  2MA3 A;  1VQ7 I;  1F4K A;  3H36 A;  1OCT C;  4CCM A;  1RRJ A;  1HKQ A;  1MJB A;  4I2O A;  4HBL A;  4BHC A;  2V6C A;  3QPL A;  1IC8 A;  4A5N A;  4LIT A;  3ECO A;  1PUE E;  3PSI A;  2JT1 A;  3OYD A;  4CO8 A;  5TRD A;  1HW1 A;  3BDD A;  5E3L A;  2ICW G;  3VPR A;  2W57 A;  1YIJ I;  1AWC A;  1HDD C;  3VOE A;  1ZKG A;  2FEZ A;  2E2J J;  2VPL A;  4JOM A;  5CJ9 A;  2OV7 A;  3K10 A;  3JAM R;  2F5D A;  3BQY A;  3ELK A;  3CCM I;  5GP9 A;  2VQH A;  3GFM A;  4RMN A;  1JTY A;  2KDO A;  4WX9 A;  4BE0 A;  3S2D J;  2XRN A;  4Q47 A;  2K4J A;  3HM5 A;  3DKW A;  1SFX A;  2O5R A;  2STW A;  1W5S A;  5FRM A;  2HQR A;  3KP5 A;  4BQN A;  1K78 B;  2GAU A;  4C2U A;  3IH2 A;  9ANT A;  1Z6R A;  3UR3 C;  2DMP A;  1I6H J;  1JUP A;  3ISP A;  4PCQ A;  4YFK F;  5GTH C;  5DD4 A;  3JTH A;  2P6S A;  3FHZ A;  3BJ6 A;  4Q48 A;  1YYV A;  1VI0 A;  2RNJ A;  3KYC B;  3JRC A;  1FIP A;  3OYJ A;  2A6H F;  1A36 A;  2P6T A;  2WY7 Q;  3IRQ A;  3P5J A;  3E3V A;  2ETH A;  3F22 A;  3SEQ A;  5DS9 A;  1SVM A;  1YHQ I;  5FLX Z;  3UKG A;  1JT6 A;  2Y69 H;  3F72 A;  1ETY A;  1WJE A;  4E70 A;  2V4J C;  5DDG A;  1FWZ A;  4EJV A;  3PNT A;  2OAZ A;  2L7F P;  2JWT A;  5K7Z A;  3V8J A;  1KQ8 A;  5IPA A;  2BOL A;  1MDM A;  4YIR X;  5A2Q K;  3FM3 A;  2LMD A;  3WGG A;  2EZK A;  4GDF A;  3ERE D;  2XVC A;  1SVO A;  2MD0 A;  1I6X A;  1TNS A;  2HZT A;  5J3L A;  5L3E A;  3T5X A;  5FLX R;  2V9V A;  4IEJ A;  2HOA A;  3MMY B;  4HV6 A;  3KZZ A;  4M6V A;  2XPV A;  4XK4 A;  3DEU A;  2EIM H;  3HL2 A;  2R7W A;  3CJR B;  4IQ4 A;  5HLG A;  3FBI B;  3R0J A;  1U9O A;  3JSP A;  2P5K A;  2Z99 A;  3CO7 C;  1BR4 A;  3GTJ J;  4UVB A;  1XN7 A;  3K4C A;  2IRF G;  4AM3 A;  2GM4 A;  4BXX J;  3MKW B;  2WY8 Q;  1FYM A;  1YQA A;  2E36 A;  1BIB A;  2IGK A;  3HUG B;  1ITY A;  2MBF A;  5H6Q A;  5M3M J;  1S7O A;  3NAU A;  2LBF B;  4DQ2 A;  1F43 A;  2ECC A;  3VB2 A;  2HVS A;  3MEX A;  1RES A;  5IT3 A;  3AL0 C;  3M8F A;  4A3I J;  5K7F A;  3GFI A;  5L3F A;  3BZ6 A;  3HYI A;  3WG9 A;  5GAH J;  3QOD A;  2CW7 A;  4PSX A;  3S1Q J;  4NB5 A;  2QSG X;  4JX5 A;  3W6J B;  3Q3S A;  2F5V A;  4Y17 A;  3VFZ A;  1W0U A;  4PDK A;  2KQR A;  3DLL F;  5JVG F;  3KX2 A;  4CZC A;  3ASO H;  2VQG A;  1Q1H A;  3G71 I;  1WI3 A;  3TGN A;  4IVN A;  1D5V A;  3JRE A;  3HKZ A;  2RV8 A;  3HUG A;  4ZTJ A;  1X3Z B;  1UMQ A;  1QNT A;  4A0X A;  2HYG D;  1IUY A;  3HOU J;  4FIS A;  3W6K B;  4S04 A;  1G6N A;  4XKB A;  1H89 C;  4NC6 A;  2DPD A;  4I0B A;  3K1N A;  3ZQQ A;  1F1Z A;  3GTG J;  4G7H F;  2HKX A;  2NXN B;  1ZRE A;  2LSO A;  2R5Y B;  2O8K A;  5J8C A;  3BTC A;  4GFB A;  1Y8R B;  4XMY A;  2VE9 A;  3M4O J;  1JTX A;  3VDX A;  3MQ0 A;  4YRV A;  3WGI A;  2FE3 A;  1WVR A;  3E6B A;  1IXR C;  3RKY A;  2PLY A;  2DN0 A;  1YJW I;  2EWN A;  5C4X J;  2MW8 A;  3RKW A;  3WTX C;  1BOB A;  1I27 A;  5JLW A;  2ME6 A;  5JVT A;  5C4J J;  1ETV A;  5EYR A;  2W84 A;  1FYK A;  2JRM A;  3DQV C;  2JK3 A;  2XF7 A;  3JAM K;  3A4C A;  4XLN F;  3CQZ J;  5DYM A;  4Q4Z F;  1HLV A;  4WF2 A;  1BA5 A;  2ELJ A;  3QP6 A;  1FNN A;  2L9R A;  2Q1Z B;  3DU5 A;  4ITV A;  3A03 A;  4W97 A;  2XSD C;  2LFB A;  4YII A;  4G7Z F;  2NOJ B;  2CQQ A;  3OYK A;  1DP3 A;  1YX3 A;  4NHJ A;  5F04 A;  5CVR A;  4J19 A;  3QU3 A;  4N0B A;  5IP9 J;  2R5Y A;  1SC7 A;  1QHH D;  3HGG A;  2COB A;  1JJ6 C;  3HDD A;  4LB6 B;  3MAJ A;  1FBS A;  2H1L A;  3LNQ A;  2XAQ A;  4RAF A;  4MHG A;  1TBX A;  3PSF A;  4NBQ A;  3SFI A;  3CCL I;  5ICF A;  1H9T A;  3RZO J;  3HOV J;  5J6X A;  2YX4 A;  1Y0N A;  3SZG A;  1TLH B;  3KEY A;  4C30 A;  4YIF A;  1YJ9 I;  1LVA A;  2DFI A;  4X6A J;  4AUX A;  2OCE A;  1HSJ A;  3HOX J;  2CUE A;  1X19 A;  1I3Q J;  1ETK A;  1CGP A;  4MIM A;  1MH3 A;  2D2W A;  4MEY F;  2IXS A;  2DK8 A;  3GLL A;  2WAD A;  4L5J A;  1Z3X A;  2DBB A;  4IO9 F;  3L2Q A;  1U2W A;  3H92 A;  3L7W A;  3UNG C;  5IT9 K;  1LFU P;  1SAU A;  3V7R A;  3HSE A;  2E2H J;  2Y9Y A;  4DJA A;  1TC3 C;  4HNV A;  2LRD A;  1REP C;  4LIU A;  5E18 F;  2ZB9 A;  2UV1 A;  1CF7 A;  1V55 H;  1IO2 A;  2ZO4 A;  4BU2 A;  3M8E A;  2EIL H;  3DBL B;  1WKM A;  2QQA A;  3MWM A;  3R60 A;  4CZZ A;  3HHH A;  4XSX F;  4XNF A;  2K9M A;  5TGT A;  2GXA A;  3ABL H;  2H27 A;  4Y15 A;  1SFE A;  2X48 A;  5E8I A;  4J01 A;  1LPQ A;  3ZQG A;  1YE9 A;  2DTZ A;  3DTI A;  2GA2 A;  2GZW A;  5FKK A;  3A2K A;  1JKQ C;  2CYY A;  1GVJ A;  4BYY A;  3KIO A;  4M71 A;  1V3F A;  2FQ3 A;  4KA4 A;  4C3J J;  1IN7 A;  2DPU A;  1MBH A;  1YW8 A;  2EQR A;  2W24 A;  4XOR A;  3GTL J;  2EZH A;  1YJN I;  2YR2 A;  2QQ8 A;  3F8N A;  2X6W A;  3N05 A;  2DMN A;  3LSR A;  2O61 A;  1NG7 A;  4A3B J;  2CMP A;  1ETX A;  2QA4 I;  1VQ9 I;  2Y48 A;  3S93 A;  2DO7 A;  4F7Z A;  2JA5 J;  3DTK A;  2I10 A;  5CKT A;  3AKZ A;  2JQ7 A;  1JJ8 C;  2JA2 A;  1P4A A;  1FIA A;  2QM3 A;  3NEU A;  4NUB A;  3A01 B;  2P5V A;  1U5T B;  2LY9 A;  2E60 A;  3ONQ A;  2LKP A;  4II3 A;  3WE2 A;  2Y2Z A;  4RDU A;  3K2A A;  2PFB A;  4R1H A;  3DPL C;  4XOP A;  3IAS 2;  3SJM A;  2FRH A;  1WJA A;  1IGN A;  3NRV A;  4HX8 A;  2DA7 A;  1I50 J;  2M2E A;  4AID A;  2B63 J;  4HX4 A;  1HW2 A;  2O8X A;  1IRX A;  2OF7 A;  3WE3 A;  2ZJQ F;  3FX3 A;  1VTN C;  4JQF A;  5CYV A;  4I98 B;  4XKV A;  4KYW A;  2HTJ A;  1IDZ A;  4HDU A;  3CME I;  1H0M A;  2DCE A;  5JI6 A;  3OYF A;  3HOY J;  1ZG3 A;  1MSE C;  1Z67 A;  4RB0 A;  3JRF A;  2E35 A;  4LLL A;  2BW3 B;  2MC4 A;  3OMY A;  3H5R A;  3PM1 A;  4GYG A;  5M5W J;  3WOD F;  5B1A H;  1EH8 A;  2CJJ A;  4NQW B;  1VQ5 I;  3QOE A;  5GAD J;  1Y1W J;  3A01 A;  4LB5 A;  1FOX A;  2CV1 A;  5FRO A;  4HQM A;  1U5T A;  4EM1 A;  2J5P A;  4L18 B;  2LD5 A;  2EFQ A;  4EM2 A;  3L2V A;  5ICC A;  4GXO A;  2AQF A;  3LFK A;  1B59 A;  3BG3 A;  5F27 A;  3CF5 F;  3GFJ A;  2R7Q A;  2VON A;  3K9T A;  1E0E A;  5J1Y A;  2HVR A;  3DF8 A;  3EPZ A;  1D0Z A;  1FMW A;  1T95 A;  1SFO J;  2VQL A;  1UST A;  1T39 A;  4WK8 F;  1QQI A;  1U8R A;  3IKV A;  4IXA A;  2V1X A;  3FF5 A;  5KHD A;  2DQL A;  3LAJ A;  5F0F A;  1BM9 A;  4BE2 A;  4KN7 X;  3CCR I;  2ZFU A;  4U87 A;  4G8X A;  4PJM A;  5H6R A;  5CQE A;  1IZ1 A;  2IVM A;  5EDN A;  1XG1 A;  2P0T A;  4OIQ F;  2BY1 A;  1N25 A;  2IA2 A;  4IPA A;  4E7K A;  4V2F A;  1TT5 B;  2OC6 A;  4D1Q A;  3F9K A;  4RM3 A;  2DAO A;  2VPR A;  3BG9 A;  1NH3 A;  2F5C A;  1JT0 A;  1V5G A;  4RLQ A;  4ENM A;  1T08 B;  4MQ9 F;  3RZD J;  5BQT A;  2Z9O A;  1DP7 P;  1PJR A;  2ZXH A;  3CJT B;  3KP6 A;  1T0F A;  3K70 D;  3CCE I;  3FDY A;  1JGS A;  3A52 A;  2O03 A;  3HOZ J;  3J80 Z;  3LWF A;  4EJU A;  2F4M B;  4IQJ A;  3SYT A;  1UB9 A;  4XN3 A;  2P5L C;  3DEE A;  2QYO A;  4D7N A;  1VQ6 I;  5DUI A;  2P81 A;  3CCQ I;  2R5Z B;  1R5H A;  4BQO A;  3LSM A;  1S7E A;  2NVU B;  2IT0 A;  3LA2 A;  2JZY A;  2M7A A;  5FLM J;  3SZT A;  2L0K A;  1Z77 A;  4I09 A;  4AVP A;  1K4S A;  2KRF A;  1RPW A;  3RCO A;  3J7Z I;  1SD5 A;  3K70 C;  3OIP A;  5M5Y J;  4FX4 A;  3GME A;  3BJO A;  3WU1 B;  3OL3 A;  3CLQ A;  3RPU D;  1J09 A;  2QLZ A;  3CJQ B;  4ENJ A;  4A3M J;  1KQ9 A;  2HXI A;  1O3S A;  3KLN A;  1TP4 A;  2L54 A;  3HOT A;  2XGC A;  3R4K A;  4XN0 A;  3ZMZ A;  2XV4 S;  2LKS A;  3C1D A;  2M34 A;  2E5N A;  3GYH X;  1P2F A;  2VKH A;  3LA7 A;  4JX6 A;  4UVA A;  3J7A O;  5C44 J;  4L0Z B;  5LHI A;  4KIG A;  1X1P A;  1MBG A;  2QBY B;  2E19 A;  2QVO A;  4NNJ A;  1WHU A;  1OPC A;  2R7Z J;  1I5Z A;  5HNF A;  2ID6 A;  2LR8 A;  4GO1 A;  5IP6 A;  1DU6 A;  2V1U A;  2M0M A;  1N78 A;  1IF1 A;  2ZSH B;  3RQI A;  3GO5 A;  1Z1D A;  1OR7 A;  3I59 A;  4FE4 A;  2CUF A;  1LQ1 A;  3K4K A;  3ESW B;  3K0L A;  4XLE A;  1WFX A;  4GCV A;  4E7Z A;  1WCM J;  4B43 A;  2BY0 A;  2V9P A;  2Y30 A;  3BR1 A;  3VYS B;  1J7K A;  3V42 A;  1MBF A;  2OQG A;  1P9Q C;  4ZDL A;  2RN7 A;  1P7I A;  1XGM A;  1VQP I;  2QBY A;  2CUJ A;  5H2F C;  2QEX I;  3Q5F A;  5EZH A;  2CU7 A;  3ZGK A;  1L0O C;  4ZZL A;  4G7O F;  3L9F A;  4IF4 A;  1X4P A;  1MMN A;  2IGO A;  3JRA A;  4BL0 B;  3MZ8 A;  4AD9 A;  2KRH A;  2BZT A;  4E4H A;  4DZP A;  2VJI A;  4OOI A;  3U1D A;  1XD7 A;  3AG2 H;  4HZF A;  3C7J A;  4A69 C;  1W4M A;  3MKL A;  1GLN A;  2HYF A;  3J7Y J;  3Q9V A;  5HS7 A;  3NAR A;  1S5L C;  3TW7 A;  1U5T C;  2DOE A;  3CTA A;  3S1N J;  3ABK H;  1RNL A;  2CGP A;  3HTU A;  2HDC A;  4MGR A;  4BHP A;  2OQR A;  3I4P A;  5EEG A;  4UUS B;  2KMU A;  1W7P B;  1VQM I;  4ZJZ A;  4EEF G;  1XMK A;  3WU0 A;  2GXB A;  2UUZ A;  1UAA A;  2FUG 2;  3I9V 2;  4IHX A;  2X6X A;  3ZRG A;  1ZAR A;  2BXZ A;  1QVU A;  1ACI A;  5FKN A;  2IBD A;  3HXL A;  3I3L A;  1O7F A;  2XRO A;  4HNU A;  1HST A;  3H3U A;  2AO9 A;  1CQT A;  2OTL I;  2UWM A;  4PJJ A;  2NNY A;  1HF0 A;  4B3X A;  3H3V K;  3VWB A;  1XGS A;  2HTS A;  4WXC A;  5L3G A;  2RGV A;  5TIS C;  3WG7 H;  5CVV A;  3H9Q A;  2OBP A;  4XIC A;  1ZRC A;  1IRF A;  4A3E J;  2B0L A;  2Z2S B;  2G7H A;  3HSF A;  3IAM 2;  5J1R A;  4L0Y B;  2L01 A;  1E17 A;  3W2V A;  2QKL B;  3DBH B;  1K79 A;  2R7U A;  3RYP A;  3F8M A;  5FRN A;  1N75 A;  1W7P A;  4MFE A;  2R0Q C;  1VQK I;  2JVG A;  1SD7 A;  4LG0 A;  2ESN A;  4AYB A;  5K7H A;  4EGZ A;  2PJP A;  3JRB A;  1DGW Y;  1BC7 C;  4LIV A;  1XGN A;  2TRT A;  1T0F C;  2QF7 A;  2TDX A;  3CDI A;  4MFD A;  2ID3 A;  1C0W A;  2MUN A;  3DTE A;  2Y0S A;  3S16 J;  1T98 A;  2H94 A;  4PJN A;  3RQ4 A;  4EQQ A;  4M74 A;  4C2T A;  1YIT I;  2P7V B;  5ILV A;  3S32 A;  1TT0 A;  2PN6 A;  4QIW N;  4KNY A;  1ENH A;  4WCG A;  2A3S A;  2CFX A;  4IRH A;  4BDY A;  4JX4 A;  2ZFW A;  3C2H A;  3PUB A;  5FJ8 J;  4KMF A;  2CW8 A;  5HLI A;  2TCT A;  3DCF A;  3GTK J;  5AIQ A;  3BG6 A;  1VQ8 I;  3HPG A;  5FFX A;  1KYZ A;  2DW4 A;  2VC1 A;  2WBM A;  1LVK A;  1DPR A;  1R22 A;  2XGX A;  3EDP A;  2KIU A;  5F6F A;  3R6S A;  1GXP A;  1XSD A;  4HX7 A;  2QQB A;  2PG4 A;  4A6D A;  4N4O B;  4B1R A;  1ZGA A;  3JR9 A;  2QWW A;  3HOS A;  1S72 I;  2XDV A;  1UG2 A;  2VJJ A;  1T6S A;  4BJT A;  1B1B A;  1Y0U A;  3DFG A;  2VE8 A;  3JW4 A;  3LFU A;  1MSF C;  4UV8 A;  3CUQ B;  3B73 A;  2HPM A;  4A93 J;  1M1E B;  3OYL A;  4E7H A;  3L2U A;  2R93 J;  3CJN A;  1J2X A;  1EV7 A;  3E7L A;  2XF5 A;  5IYC J;  1OR7 C;  4QPO A;  4XOT A;  5J40 A;  3K6G A;  1QO0 D;  5IYD J;  2HZD A;  4LJZ F;  5IOY A;  2G0E A;  3L2C A;  2VT3 A;  3HEF A;  2MLK A;  3FMR A;  3E5Q A;  3KLO A;  4PUS A;  1MDM B;  2EBI A;  5FKO A;  3WTW C;  4RGU A;  1WJC A;  3BG7 A;  3F21 A;  4TV7 A;  4C2M J;  1O57 A;  5CVI A;  3SXY A;  1XB4 A;  1WJB A;  3FXK A;  4L9T A;  1XCV A;  5DUK A;  2L02 A;  3TKY A;  4E7J A;  1XC5 A;  4ZDP A;  3Q9S A;  1Z7U A;  3OOP A;  3OSF A;  2VBW A;  3J7A W;  4QTR A;  1JUS A;  1S7A A;  2Q0O A;  3D5R C;  2IGN A;  3HB9 A;  3CUQ A;  5EEH A;  4D5C A;  2LY2 A;  1IRG A;  2HQN A;  1J5Y A;  2RQQ A;  1WH5 A;  4P96 A;  1BIA A;  1A35 A;  3VOD A;  4XQF A;  2VIX A;  4FT8 A;  2KP6 A;  1OKR A;  1KZH A;  1HKS A;  5FLV A;  4UVC A;  1R4M B;  3OYB A;  2UZK A;  3BY6 A;  2R7D A;  1D1B A;  1BI0 A;  2J5O A;  4RM2 A;  3S8P A;  3VSL A;  2EA2 A;  5EF6 A;  2Y75 A;  5C3E J;  1I1G A;  1TNT A;  3V4G A;  4UV9 A;  1VND A;  2LF7 A;  4B8X A;  2KIF A;  1WQ2 A;  1WJF A;  4KIS A;  2EIN H;  5GPA A;  1Z7L A;  2E71 A;  4LGW A;  3JRD A;  1PYV A;  3OV8 A;  1UHS A;  2MH9 A;  4EVI A;  3KZY A;  1ULY A;  5LEJ A;  5M5X J;  3A02 A;  2VN2 A;  4KT6 A;  1LB2 A;  2RC4 A;  4ZTF A;  3LQR A;  1QZZ A;  4JYK A;  2CV2 A;  3EQL F;  3H1C A;  3MZY A;  1W7P D;  3LL7 A;  2VKV A;  3CP2 A;  5HLH A;  2NRA C;  1QU3 A;  3DKX A;  1X3W B;  3SZP A;  5EEA A;  1FBU A;  1JHF A;  4XR6 A;  3JRI A;  4X1E A;  1AKH A;  3PO2 J;  1LEB A;  1YG2 A;  3PIP F;  5LRR A;  4CIC A;  3OYE A;  2DOA A;  4I99 C;  1ODD A;  3ML6 A;  2LK2 A;  4RAG A;  3G73 A;  5E3N A;  1RI7 A;  4U7B A;  1DQU A;  2R7X A;  1IXC A;  4O3M A;  1R4N B;  4Y52 J;  3BWG A;  3VEP A;  1K7A A;  2WV0 A;  3C18 A;  5EJC A;  2FD5 A;  2PMZ N;  5D5V B;  1TWG J;  3CD6 I;  3TO6 A;  5L3C A;  3BR2 A;  1XMA A;  1YS7 A;  1MMG A;  4PJ0 C;  1DPU A;  3EUH A;  1RZ4 A;  3REO A;  2D45 A;  1W5C C;  4XRS G;  4B48 A;  1R23 A;  1MNE A;  4DYC A;  3ZQC A;  3D5S C;  4BS9 A;  4BJ5 C;  3A0B C;  4OIO F;  4J00 A;  3ERM A;  1D5Y A;  1JKR C;  1H8A C;  3S1M J;  5GPC A;  2CQX A;  5E20 A;  5K5O A;  3G1L A;  1IRZ A;  2JRT A;  1E2X A;  2X51 A;  1TL8 A;  2DFE A;  2FML A;  4GGG A;  4LOC A;  3ZQ7 A;  5FD5 A;  2M4K A;  3BR5 A;  5DD8 A;  3E6M A;  3HZJ A;  2L9N A;  3IC7 A;  5TJJ A;  2JA6 J;  3GTP J;  2BEO A;  1IN4 A;  1TWH J;  1QZY A;  1ZEL A;  3NWS A;  2ZXW H;  5D6F A;  1XSV A;  3TOA A;  2HGC A;  2KLO A;  1VZ0 A;  2YSR A;  4M6X A;  3SEZ A;  2DK5 A;  2Y0M A;  3TQN A;  3LST A;  2DFH A;  2NVY J;  5FKM A;  1YIO A;  2ZNZ A;  2L9S A;  3GEZ A;  2X1E A;  1G3T A;  2ESH A;  2G7U A;  3HIF A;  2KKO A;  3BTJ A;  5LGN A;  4S0H B;  4Y7N J;  1B9N A;  2DYS H;  3BR3 A;  4ASN A;  3FXR A;  3HPH A;  3OYG A;  1T2K A;  3BQZ A;  2A5W A;  2CWE A;  3ZMS A;  2LY1 A;  3I58 A;  1ZRD A;  2PQ8 A;  3HGY A;  1ZK8 A;  3U9G A;  4FX0 A;  5F1J A;  1D3Y A;  2K9S A;  4XLH A;  1FTT A;  3S14 J;  1Y6I A;  2ELH A;  1FEX A;  2MVT A;  1EH6 A;  4HOB A;  3BZC A;  4S05 A;  2IS2 A;  1Y8Q B;  5KAI C;  1CF7 B;  4E7S A;  3PO3 J;  2RQP A;  1ZAO A;  5DTD A;  5J4V A;  2L3D A;  3FXU A;  4CYC B;  2VOD A;  1YS6 A;  1J59 A;  3BOQ A;  3OIO A;  2YU3 A;  4ZH4 F;  5BNG A;  3LQQ A;  4PK4 A;  2V9K A;  5LHG A;  3CUQ C;  4XRM A;  5ICE A;  1FP2 A;  3JRH A;  3D0S A;  2MFZ A;  3ECH A;  4MTE A;  2YS9 A;  1EH7 A;  1QHG A;  3N97 A;  3ZQL A;  2PI0 A;  2K9L A;  2NYX A;  3K4M A;  1F9N A;  4JK1 X;  3GTM J;  3FK6 A;  2WC2 A;  2Z5U A;  3M1C A;  3D5L A;  5E8G A;  1ZG1 A;  1Z3Y A;  2KZG A;  3G2B A;  4M73 A;  4FTH A;  1R00 A;  3IKT A;  4BKX A;  4CCN A;  3HRS A;  2JSP A;  3G1M A;  5FLX K;  1R6R A;  4AC0 A;  2HEO A;  4CYC A;  3O8G A;  4KN4 X;  1OCC H;  2EIK H;  2NAZ A;  4GRI A;  2H09 A;  3G4S I;  1MNM C;  3W2A A;  4KIC A;  1K83 J;  1WH7 A;  2K4B A;  2XPU A;  1SAX A;  3FXL A;  4II2 A;  2OZU A;  1FPQ A;  2XAF A;  1LE8 B;  3FXM A;  3C2B A;  4NC8 A;  4A0Z A;  2BHY A;  4XID A;  1ZGW A;  2DQR A;  1ON1 A;  2M30 A;  1LEA A;  1XDS A;  1DGR M;  1SEU A;  3OR2 C;  3DXJ F;  2HNH A;  4CYD A;  4U0W A;  1A6Q A;  2XKO A;  1GUU A;  2H6B A;  2IA0 A;  2WB1 N;  4M9S A;  5B5E C;  2M1B A;  3KEO A;  3C3W A;  3M9A A;  4BY7 J;  3WTY C;  1MBJ A;  1STZ A;  2O7O A;  3T1B A;  2V79 A;  5F0H A;  4L9V A;  3FXO A;  2KJB A;  2X9D A;  3IH4 A;  4D0P A;  4BNC A;  4D7M A;  4LMY A;  2FXA A;  5HNH A;  3TED A;  4HNT A;  1P7J A;  1OYI A;  2R7R A;  1LE8 A;  1PVE A;  1S9H A;  3MKZ A;  2RVC A;  4ESB A;  3MKY B;  3RPQ A;  3ZQH A;  4C9Y A;  1FLI A;  5JHF A;  3EUH C;  1JKO C;  2EA4 A;  4FE7 A;  3CMM A;  4BEH B;  2F4O B;  2LYC A;  4M9X A;  1F5T A;  3OYA A;  3RTR A;  1ORK A;  1OCR H;  4E7I A;  1G3Y A;  2ZJP F;  1Y39 A;  4XLP F;  3IV5 A;  1AOY A;  1BJA A;  3GTQ J;  2JPB A;  3S15 J;  3G3Z A;  3GX4 X;  3HRT A;  4RA2 A;  4UUV A;  4LD5 A;  2F5F A;  1OCZ H;  5JLX A;  2M8G X;  3K1M A;  3E6D A;  4A2U A;  2HDD A;  2GIV A;  3L1P A;  2HKO A;  5HOD A;  1PUF A;  1D1C A;  4CHU A;  3OWT A;  3HC7 A;  4G12 A;  1GHC A;  4XLC A;  1MZB A;  3IH3 A;  3V8K A;  1RET A;  4IJA A;  3I0T A;  4IX7 A;  1UG0 A;  2H1K A;  3VYT B;  3U1K A;  2W7N A;  4RGS A;  2FNA A;  2LNB A;  3B6C A;  4I02 A;  2JMW A;  2VBX A;  5DCF A;  2MH2 A;  4BEH A;  3SDB A;  1ZTR A;  1OCO H;  2PBI A;  3RSN A;  2V26 A;  2DDB A;  1PDN C;  2NVT J;  1X1D A;  2KT0 A;  4M3E A;  1TZL A;  1ZR2 A;  1PP7 U;  4ZDO A;  3ZXS A;  2WAQ N;  3R61 A;  2E5Z A;  2LVS A;  2A6T A;  3OS0 A;  3BZK A;  2CRG A;  5D8K B;  1R1U A;  1K61 A;  3KCC A;  3FIW A;  3T8R A;  1BW5 A;  1FYL A;  2Q2E B;  4RGX A;  1D0X A;  2GBY A;  5EGO A;  2DXI A;  2D1H A;  1RR8 C;  2DU9 A;  4AIH A;  2VI6 A;  4WXD A;  4XSZ F;  2W85 A;  3OSG A;  2A5Y B;  3BJA A;  2XSJ C;  4G6Q A;  4M3B A;  5JR3 A;  3FM5 A;  1ONV A;  3CF2 A;  3CC2 I;  2LKX A;  3ZR8 X;  3H35 A;  4JP0 A;  5HLT A;  4DIQ A;  3WU2 C;  2W25 A;  1JI8 A;  4U88 A;  2D5V A;  1B9M A;  1UEL B;  1HC8 A;  4O6J A;  3S3M A;  5GAE J;  5D8L B;  2FOK A;  4CCL A;  4PGH A;  2NS0 A;  3PQJ A;  4G94 A;  2DLL A;  3SFZ A;  2JPC A;  1FX7 A;  4HEA 2;  1KON A;  4R8H A;  4E6K G;  2OJE D;  4BGD A;  5K5R A;  3VYU B;  3Q0V A;  4A3J J;  1I1S A;  4DOZ A;  2VB6 A;  1KU9 A;  3S3N A;  3BP8 A;  2Q2E A;  5F0C A;  1ON2 A;  1TWC J;  1MJA A;  1WJ5 A;  2E1O A;  2EV5 A;  2DOF A;  2XAH A;  1RR7 A;  1RIO H;  4ESF A;  1GVD A;  5L3B A;  1QBJ A;  1X58 A;  2DMQ A;  3I59 B;  4HSR A;  3J80 R;  2HYJ A;  2XGD A;  5HDK A;  3LSI A;  5DCM A;  1FSH A;  5HS9 A;  2R7T A;  4G6T B;  4OAZ A;  2EPF A;  1ETW A;  3I54 A;  3L00 A;  2FMY A;  2R92 J;  5HS8 A;  2E7X A;  4G6D A;  1IV8 A;  1VQO I;  1X4O A;  4N4N B;  2IAI A;  1OYY A;  2EJR A;  3K4B A;  4XLF A;  2KIM A;  3OR1 C;  2JJ7 A;  3NWT A;  4EM0 B;  2UXN A;  4AVZ A;  3M07 A;  2F2E A;  2EV6 A;  1YI2 I;  1V5F A;  5BPD A;  3EET A;  3DPT A;  5BMZ A;  2VBZ A;  4G9Y A;  3HRU A;  2M5W A;  1HCR A;  3RKQ A;  2E7W A;  3QQA A;  4FQG A;  2M3A A;  4UB8 C;  3LAP A;  3P7N A;  3IL2 A;  2VXZ A;  4XM3 A;  4NC7 A;  1ZYR F;  2NVX J;  1Y56 A;  2PMU A;  1LNW A;  5KVR A;  3I71 A;  3I4M J;  2EH3 A;  1VFC A;  2N8G A;  1ZG5 A;  5ICG A;  1B4A A;  1BC8 C;  3DV8 A;  2LC2 A;  4KIT B;  1K6Y A;  1Y1V J;  3CO6 C;  1YO5 C;  2OA4 A;  5D4S A;  3QPT A;  4BAY A;  4HPQ A;  1FT9 A;  1ZLJ A;  4M3F A;  1ZLK A;  1WZ2 A;  3CCU I;  4ENK A;  1S6L A;  4OAY A;  1BBY A;  1NTC A;  5ED4 A;  4X0G A;  1NG6 A;  1O3T A;  2WB1 A;  4R79 A;  2L2O A;  3ULQ B;  3OYI A;  3F23 A;  1N77 A;  3BTL A;  2KIS A;  3HHG A;  3DLA A;  1UZC A;  4ZZD A;  1S29 A;  1XX5 A;  1TTY A;  1JXS A;  1MD0 A;  3OYM A;  4I7H A;  1EJ9 A;  3A0H C;  4P1W A;  1JUM A;  4V19 K;  1IV6 A;  5A2Q Z;  1G4D A;  2Z3Y A;  2GXG A;  1MMS A;  2BE5 F;  2GWR A;  4LG0 B;  2K27 A;  5FD6 A;  2E1N A;  1KQ0 A;  2AXL A;  4ESJ A;  1MJ9 A;  1BW6 A;  3J81 Z;  4HDV A;  2X85 A;  1BI3 A;  1SMT A;  3IUO A;  5ERI A;  4HF0 A;  2FX0 A;  2K02 A;  2GQQ A;  4XL9 A;  4K2E A;  5IYB J;  3CCV I;  2LOO A;  1T56 A;  3GW2 A;  2MSY A;  1UCR A;  4KJZ A;  4HQE A;  2H8R A;  2FA5 A;  1PP8 F;  1XTA A;  2O9L A;  5A2Q R;  4M3G A;  1P4W A;  1XSX A;  2EFN A;  4HF2 A;  5E3O A;  3WTV C;  3L2R A;  4LLN A;  2B7E A;  3J81 R;  4B47 A;  5B66 C;  1LDD A;  1P92 A;  4LK1 F;  1YLF A;  2KHM A;  1X1A A;  2FOW A; 
#chains in the Genus database with same CATH homology
 3F8F A;  4P5O A;  1IXS B;  2FBH A;  2LF8 A;  1S3J A;  1ZRF A;  3PFI A;  1A04 A;  4BHB A;  4RB3 C;  3CLO A;  1P6R A;  3JTG A;  4AWX B;  1V4R A;  1J9I A;  5JFR A;  1WRJ A;  1FP1 D;  2FBI A;  4KT5 C;  2NNN A;  3WTZ A;  3FMS A;  3J80 K;  2ISY A;  2IPQ X;  3V7S A;  2K7L A;  2XAS A;  4IHT A;  5DV5 A;  1IN8 A;  2O3F A;  4LFU A;  2VC0 A;  3NQO A;  4KFC A;  3WGH A;  1O3Q A;  4HA8 A;  3M7G A;  2ACJ A;  2RKH A;  3GUD A;  4KIF A;  4OIP F;  4OIN F;  4N9I A;  5KK1 A;  1R1T A;  2OZ6 A;  4M72 A;  4ZYG A;  3JAM Z;  4CDG A;  3ZPL A;  4KIB A;  2P4W A;  4RB2 C;  3K2Z A;  4AIJ A;  3ZP5 A;  1ZGJ A;  2OU2 A;  3I53 A;  4A0Y A;  1HXD A;  4L9N A;  5H20 A;  2BGC A;  3PQK A;  2EB7 A;  5D5U B;  2XAG A;  5DEQ A;  1KU2 A;  2DTR A;  4O5V A;  2A6E F;  5E1Z B;  4U0V A;  1KU3 A;  3CDH A;  4HYE A;  2R3S A;  5LGU A;  4YG2 F;  3RJP A;  2ISZ A;  4UNO A;  2O0Y A;  2ZBK A;  1IN6 A;  3ZN1 A;  5IT9 Z;  1R1V A;  2ZJ2 A;  3RIR A;  3RKX A;  4L5I A;  4IRG A;  3JSO A;  1O7L A;  4ZYD A;  3KP3 A;  1G3S A;  3I5U A;  3ROU A;  1K6O A;  3F3X A;  1IN5 A;  5FGM A;  1RUO A;  1SD4 A;  5J8F A;  4U0Y A;  1K78 A;  3IHU A;  4CXF A;  3GZ5 A;  1KYW A;  3KP4 A;  5BPI A;  3J81 K;  1TQI A;  3ABU A;  1ZHF A;  2ZME B;  3F6O A;  1ZH5 A;  4OMY A;  5CVU A;  1TQP A;  4EMS A;  3E5X A;  3SHF A;  5E1W A;  2D1V A;  4A12 A;  4P9U A;  4MNU A;  2CO5 A;  4RGR A;  2FNP A;  3SQN A;  1KGS A;  5L3D A;  2MC3 A;  4AIK A;  2HR3 A;  1DDN A;  2E1C A;  3E5U A;  1HQC A;  2ZME A;  2M8E A;  6PAX A;  1IW7 F;  4RB1 A;  3S2W A;  5FB2 A;  4MTD A;  2CQK A;  3HSR A;  2Z33 A;  2ADU A;  2FF4 A;  1P4X A;  1KU7 A;  3HRM A;  1JHH A;  2FSW A;  1OMI A;  3KP2 A;  3MCZ A;  5LGT A;  1BI2 A;  1GXQ A;  4LK0 F;  1R58 A;  2A61 A;  5D6E A;  4YFN F;  2MLG A;  2A68 F;  2O6G E;  2JSC A;  5K5Q A;  3WTU C;  1QGP A;  3K1P A;  3BPX A;  2VOO A;  1B6A A;  5D5W B;  1WWX A;  1YTY A;  5HVQ C;  2BYV E;  2QUF A;  3QP5 A;  3R0A A;  2ZKZ A;  4OIR F;  3ZMD A;  4H0E A;  2A07 F;  5LEK A;  4HLX A;  3RDI A;  2F5E A;  1SMY F;  2COM A;  2IA1 A;  5CLS A;  4ZYH A;  2YX7 A;  2KJC A;  2DI3 A;  1DUX C;  3U2R A;  4WWC A;  2WWY A;  4HF1 A;  3GXO A;  3I64 A;  3ABT A;  4ZYE A;  3WTS C;  4IRI A;  3FWE A;  3TDU C;  3GFL A;  3TOB A;  4WXH A;  3V8L A;  4XRF A;  2PMH A;  4EGY A;  2HWV A;  3MFK A;  1ZN2 A;  3N4M A;  1Z05 A;  2QEN A;  1JE8 A;  1D8K A;  5F64 A;  3P9I A;  1J75 A;  1TQM A;  1R7J A;  3ZMT A;  5AIP A;  1S8N A;  4KUM A;  4FHT A;  1UHW A;  1U78 A;  5LHH A;  2L4M A;  2V1D A;  3K69 A;  2HOE A;  4ON0 A;  4A5M A;  3IWZ A;  3EYY A;  5HOO A;  1QPM A;  2XAJ A;  3QRF F;  3RPU A;  3V7C A;  2R7F A;  2FU4 A;  2PEX A;  1HBX G;  3F8C A;  4EV0 A;  3O6B B;  4BQA A;  4Q5S F;  5BS6 A;  1LDJ A;  1BI1 A;  1LJ9 A;  4HW0 A;  4HAM A;  3E97 A;  1FY7 A;  3RYR A;  2MD5 A;  2ZXJ A;  4MEX F;  4LLG F;  4N9H A;  4B09 A;  1SFU A;  3BRO A;  4EJO A;  1Z9C A;  4EJW A;  1R36 A;  2A69 F;  1YFH A;  3DP7 A;  1T38 A;  3B02 A;  4P55 A;  5AON A;  3ZMV A;  3KFW X;  2X0L A;  2EFO A;  3F6V A;  1LDK B;  4Z2Y A;  3T8T A;  2OD5 A;  4KMU X;  2EFW A;  3GZ6 A;  3RI4 A;  1TW3 A;  4GYI A;  5LBQ A;  3GF2 A;  1MGT A;  2XKP A;  3T0Y A;  4EJT A;  3F8B A;  5ILU A;  1W5T A;  2QZ8 A;  2VT2 A;  5DCM B;  3ZMU A;  1UFM A;  2STT A;  2VOP A;  2M45 A;  2IP2 A;  4DNC A;  4RAZ A;  3TO9 A;  3FMQ A;  3GVA A;  4NQW A;  3EYI A;  2WTE A;  4RAY A;  4IHS A;  4BH9 A;  1R5G A;  4PZJ A;  2P7C B;  3IWF A;  2JTV A;  5LRS A;  2ZNY A;  1Z6T A;  3O3K A;  1RUN A;  3KEQ A;  3P9K A;  3AAF A;  2UXX A;  4RS8 A;  1YW7 A;  3QPH A;  2IW5 A;  1FZP B;  1YW9 A;  2AS5 F;  2HFH A;  5E17 F;  4M9Z A;  5FO5 A;  1FOK A;  4JBA A;  1HKT A;  1D8J A;  4CGZ A;  2GA1 A;  1FSE A;  1G3W A;  3FZV A;  1H9G A;  4BXU A;  3GLX A;  2C6Y A;  1U3E M;  3BPV A;  1MKM A;  2XHK A;  1FC3 A;  3KP7 A;  2FBK A;  3COA C;  3ZN0 A;  2VBY A;  4A6E A;  2XUB A;  1KA8 A;  4Y13 A;  3HTS B;  4I01 A;  4HLY A;  4ETS A;  4ENN A;  2K86 A;  1NHA A;  2CSO A;  1BOA A;  4P9F A;  4UXN A;  1FBQ A;  5FFZ A;  5D4R A;  5E1X A;  2RDP A;  2XIG A;  3LA3 A;  3WTT C;  4U7D A;  5D5X B;  4XBF A;  5CVJ A;  4I0A A;  5HDG A;  3TDZ C;  5JHU A;  1UHM A;  2L4A A;  1J0R A;  4HV5 A;  1XCB A;  2EK5 A;  3M1E A;  3L09 A;  5BOX A;  5K1Y A;  2QQ9 A;  1OYW A;  1IAW A;  4UHT A;  1O3R A;  3H3Z A;  2EFP A;  3KET A;  1L3L A;  4PGG A;  2P8T A;  4QWQ A;  3FXQ A;  4L9J A;  2IJL A;  2Q8K A;  5HDN A;  1HW5 A;  2CW0 F;  5ILS A;  1XGO A;  3E6C C;  2ZCW A;  3QOP A;  2H6C A;  1USS A;  2G9W A;  3TO7 A;  3QU6 A;  4OU0 A;  2DT5 A;  4QLC U;  3CUO A;  3KE2 A;  2M87 A;  2CG4 A;  1WI9 A;  5F1R A;  4KDP A;  1TW2 A;  2BV6 A;  3GWZ A;  3P9C A;  4M6Y A;  1BN5 A;  1Z91 A;  2HS5 A;  3O2P E;  2EV0 A;  5LLQ A;  1XDU A;  3MZH A;  3IRR A;  2YPR A;  1X3U A;  3QAH A;  2X4H A;  1SD6 A;  4OMZ A;  2LDU A;  2BBY A;  4YFX F;  4MQV A;  1WSU A;  1U6G A;  2MA3 A;  1F4K A;  1HKQ A;  1MJB A;  4I2O A;  4HBL A;  4BHC A;  2V6C A;  4A5N A;  3ECO A;  1PUE E;  2JT1 A;  4CO8 A;  5TRD A;  1HW1 A;  3BDD A;  2W57 A;  1AWC A;  3VOE A;  2FEZ A;  5CJ9 A;  2F5D A;  3ELK A;  3GFM A;  4WX9 A;  2XRN A;  4Q47 A;  2K4J A;  3DKW A;  1SFX A;  2STW A;  1W5S A;  2HQR A;  3KP5 A;  1K78 B;  2GAU A;  1Z6R A;  4PCQ A;  3ISP A;  4YFK F;  5DD4 A;  3JTH A;  2P6S A;  3FHZ A;  3BJ6 A;  4Q48 A;  1YYV A;  2RNJ A;  2A6H F;  2P6T A;  3IRQ A;  3E3V A;  2ETH A;  3F22 A;  5FLX Z;  3F72 A;  4E70 A;  5DDG A;  1FWZ A;  4EJV A;  2OAZ A;  3V8J A;  1KQ8 A;  1MDM A;  5A2Q K;  3FM3 A;  3WGG A;  3ERE D;  2XVC A;  1I6X A;  1TNS A;  2HZT A;  5L3E A;  3T5X A;  2V9V A;  4HV6 A;  3KZZ A;  3DEU A;  5HLG A;  3R0J A;  3CO7 C;  3JSP A;  2P5K A;  2Z99 A;  4UVB A;  1XN7 A;  2IRF G;  1FYM A;  1YQA A;  1BIB A;  2MBF A;  5H6Q A;  1S7O A;  4DQ2 A;  3VB2 A;  3MEX A;  5IT3 A;  3M8F A;  3GFI A;  5L3F A;  3BZ6 A;  3HYI A;  3WG9 A;  4NB5 A;  3W6J B;  3VFZ A;  4Y17 A;  4PDK A;  1Q1H A;  3TGN A;  4IVN A;  1D5V A;  2RV8 A;  3HUG A;  1QNT A;  4A0X A;  2HYG D;  1IUY A;  3W6K B;  4S04 A;  1G6N A;  2DPD A;  4I0B A;  3K1N A;  1F1Z A;  4G7H F;  2HKX A;  1ZRE A;  2LSO A;  5J8C A;  2VE9 A;  3MQ0 A;  3WGI A;  2FE3 A;  3E6B A;  1IXR C;  3RKY A;  2PLY A;  2EWN A;  3RKW A;  3WTX C;  1I27 A;  5JVT A;  2W84 A;  1FYK A;  3DQV C;  3JAM K;  4XLN F;  5DYM A;  4Q4Z F;  4WF2 A;  3QP6 A;  1FNN A;  4YII A;  4G7Z F;  4NHJ A;  5CVR A;  3QU3 A;  4N0B A;  4LB6 B;  3MAJ A;  1FBS A;  2XAQ A;  4MHG A;  1TBX A;  5ICF A;  1H9T A;  5J6X A;  2YX4 A;  1TLH B;  4YIF A;  1LVA A;  2DFI A;  1HSJ A;  1CGP A;  2D2W A;  4MEY F;  2DK8 A;  4L5J A;  2DBB A;  1U2W A;  3H92 A;  3L7W A;  5IT9 K;  3V7R A;  3HSE A;  1REP C;  5E18 F;  1CF7 A;  2ZO4 A;  3M8E A;  3R60 A;  1WKM A;  2QQA A;  3MWM A;  4CZZ A;  3HHH A;  4XSX F;  2H27 A;  4Y15 A;  1SFE A;  5E8I A;  2GA2 A;  2GZW A;  2CYY A;  1GVJ A;  4BYY A;  4M71 A;  1V3F A;  2FQ3 A;  4KA4 A;  2DPU A;  1IN7 A;  1YW8 A;  2W24 A;  2YR2 A;  3F8N A;  2O61 A;  2Y48 A;  2DO7 A;  4F7Z A;  1P4A A;  2QM3 A;  3NEU A;  2P5V A;  1U5T B;  3WE2 A;  2LKP A;  2PFB A;  4R1H A;  3DPL C;  2FRH A;  3NRV A;  4HX8 A;  4HX4 A;  1HW2 A;  2O8X A;  3WE3 A;  3FX3 A;  1VTN C;  4JQF A;  5CYV A;  4I98 B;  4KYW A;  2HTJ A;  4HDU A;  1H0M A;  5JI6 A;  1ZG3 A;  4RB0 A;  4LLL A;  4GYG A;  3WOD F;  1EH8 A;  4LB5 A;  4HQM A;  1U5T A;  4EM1 A;  2J5P A;  4L18 B;  2EFQ A;  4EM2 A;  5ICC A;  4GXO A;  3LFK A;  1B59 A;  3GFJ A;  2VON A;  3K9T A;  3DF8 A;  1UST A;  1T39 A;  4WK8 F;  1QQI A;  1U8R A;  3IKV A;  4IXA A;  2V1X A;  3FF5 A;  2DQL A;  3LAJ A;  1BM9 A;  4KN7 X;  4G8X A;  5H6R A;  1IZ1 A;  2IVM A;  4OIQ F;  2IA2 A;  4IPA A;  2DAO A;  2F5C A;  4ENM A;  2Z9O A;  4MQ9 F;  5BQT A;  1DP7 P;  3KP6 A;  1T0F A;  1JGS A;  2O03 A;  3J80 Z;  3LWF A;  4EJU A;  2P5L C;  1UB9 A;  2QYO A;  5DUI A;  1R5H A;  2IT0 A;  3LA2 A;  2JZY A;  3SZT A;  4I09 A;  4AVP A;  2KRF A;  1SD5 A;  4FX4 A;  3BJO A;  3WU1 B;  2QLZ A;  4ENJ A;  1KQ9 A;  1O3S A;  3KLN A;  2L54 A;  3HOT A;  3ZMZ A;  3R4K A;  2XV4 S;  3C1D A;  3GYH X;  1P2F A;  3LA7 A;  4UVA A;  3J7A O;  4L0Z B;  5LHI A;  4KIG A;  2QBY B;  2QVO A;  1OPC A;  1I5Z A;  4GO1 A;  2V1U A;  1IF1 A;  3GO5 A;  1Z1D A;  1OR7 A;  3I59 A;  1LQ1 A;  3K0L A;  4GCV A;  1J7K A;  2OQG A;  2RN7 A;  1XGM A;  2QBY A;  3Q5F A;  1L0O C;  4ZZL A;  4G7O F;  3L9F A;  4IF4 A;  4AD9 A;  4OOI A;  3U1D A;  1XD7 A;  4HZF A;  3C7J A;  1W4M A;  2HYF A;  3Q9V A;  5HS7 A;  1U5T C;  3CTA A;  1RNL A;  2CGP A;  3HTU A;  2HDC A;  4MGR A;  4BHP A;  2OQR A;  3I4P A;  5EEG A;  1W7P B;  1XMK A;  3WU0 A;  2GXB A;  1ZAR A;  2XRO A;  1O7F A;  1HST A;  3H3U A;  2UWM A;  2NNY A;  1XGS A;  2HTS A;  4WXC A;  5L3G A;  2RGV A;  5CVV A;  2OBP A;  1ZRC A;  1IRF A;  2B0L A;  2G7H A;  1E17 A;  3HSF A;  4L0Y B;  2L01 A;  1K79 A;  3RYP A;  3F8M A;  1W7P A;  1SD7 A;  4LG0 A;  2ESN A;  4EGZ A;  2PJP A;  1BC7 C;  1XGN A;  2TDX A;  1C0W A;  1T98 A;  2H94 A;  4EQQ A;  4M74 A;  2P7V B;  5ILV A;  2PN6 A;  4KNY A;  4WCG A;  2A3S A;  2CFX A;  4IRH A;  2ZFW A;  4KMF A;  5HLI A;  5AIQ A;  5FFX A;  1KYZ A;  2DW4 A;  2VC1 A;  1DPR A;  1R22 A;  2XGX A;  3EDP A;  2KIU A;  5F6F A;  3R6S A;  1GXP A;  1XSD A;  4HX7 A;  2QQB A;  2PG4 A;  4A6D A;  1ZGA A;  2QWW A;  3HOS A;  1T6S A;  1B1B A;  1Y0U A;  3DFG A;  2VE8 A;  3JW4 A;  4UV8 A;  3CUQ B;  3B73 A;  3CJN A;  1J2X A;  1EV7 A;  1QO0 D;  4LJZ F;  3L2C A;  2VT3 A;  2MLK A;  3FMR A;  3E5Q A;  3KLO A;  1MDM B;  3WTW C;  4RGU A;  3F21 A;  4TV7 A;  1O57 A;  5CVI A;  3SXY A;  1XB4 A;  5DUK A;  4L9T A;  1XCV A;  3TKY A;  2L02 A;  3Q9S A;  1Z7U A;  3OOP A;  2VBW A;  1S7A A;  2Q0O A;  1IRG A;  3CUQ A;  5EEH A;  2HQN A;  1J5Y A;  4P96 A;  1BIA A;  3VOD A;  4FT8 A;  1OKR A;  1HKS A;  4UVC A;  2UZK A;  3BY6 A;  2R7D A;  1BI0 A;  2J5O A;  2EA2 A;  2Y75 A;  1I1G A;  1TNT A;  3V4G A;  4UV9 A;  2LF7 A;  4B8X A;  2KIF A;  1WQ2 A;  4LGW A;  3OV8 A;  2MH9 A;  4EVI A;  3KZY A;  1ULY A;  5LEJ A;  2VN2 A;  1LB2 A;  2RC4 A;  3LQR A;  1QZZ A;  3EQL F;  3MZY A;  1W7P D;  5HLH A;  2NRA C;  3SZP A;  1FBU A;  1JHF A;  1LEB A;  1YG2 A;  5LRR A;  4CIC A;  1ODD A;  3ML6 A;  3G73 A;  1RI7 A;  4U7B A;  1IXC A;  4O3M A;  3BWG A;  3VEP A;  1K7A A;  2WV0 A;  3C18 A;  5D5V B;  3TO6 A;  5L3C A;  1XMA A;  1YS7 A;  1DPU A;  3EUH A;  1RZ4 A;  3REO A;  2D45 A;  1R23 A;  4OIO F;  5E20 A;  5K5O A;  2JRT A;  1E2X A;  2FML A;  4GGG A;  3ZQ7 A;  5FD5 A;  5DD8 A;  3E6M A;  3IC7 A;  5TJJ A;  2BEO A;  1IN4 A;  1QZY A;  5D6F A;  1XSV A;  3TOA A;  2HGC A;  2YSR A;  4M6X A;  2DK5 A;  2Y0M A;  3TQN A;  3LST A;  1YIO A;  2ZNZ A;  3GEZ A;  1G3T A;  2ESH A;  2G7U A;  3HIF A;  2KKO A;  5LGN A;  1B9N A;  4ASN A;  3FXR A;  1T2K A;  2CWE A;  3ZMS A;  3I58 A;  1ZRD A;  2PQ8 A;  3U9G A;  4FX0 A;  1D3Y A;  2ELH A;  1EH6 A;  4HOB A;  4S05 A;  1CF7 B;  2RQP A;  1ZAO A;  2L3D A;  3FXU A;  2VOD A;  1YS6 A;  1J59 A;  3BOQ A;  4ZH4 F;  2YU3 A;  3LQQ A;  5LHG A;  3CUQ C;  5ICE A;  1FP2 A;  3D0S A;  3ECH A;  4MTE A;  1EH7 A;  3N97 A;  2PI0 A;  2NYX A;  1F9N A;  4JK1 X;  2WC2 A;  2Z5U A;  3D5L A;  5E8G A;  1ZG1 A;  4M73 A;  1R00 A;  3IKT A;  3HRS A;  5FLX K;  2HEO A;  4KN4 X;  2NAZ A;  2H09 A;  4KIC A;  2K4B A;  1SAX A;  2OZU A;  1FPQ A;  2XAF A;  4A0Z A;  2DQR A;  1ON1 A;  2M30 A;  1LEA A;  1XDS A;  3DXJ F;  4CYD A;  4U0W A;  2XKO A;  2H6B A;  2IA0 A;  4M9S A;  2M1B A;  3KEO A;  3C3W A;  3M9A A;  3WTY C;  1STZ A;  3T1B A;  2V79 A;  4L9V A;  4BNC A;  2KJB A;  4D0P A;  4LMY A;  2FXA A;  1OYI A;  2RVC A;  4ESB A;  3RPQ A;  1FLI A;  2EA4 A;  4M9X A;  1F5T A;  3RTR A;  1G3Y A;  4XLP F;  1AOY A;  1BJA A;  2JPB A;  3G3Z A;  3GX4 X;  3HRT A;  4UUV A;  4LD5 A;  2F5F A;  3K1M A;  3E6D A;  4A2U A;  2GIV A;  2HKO A;  4CHU A;  1GHC A;  1MZB A;  3V8K A;  4IJA A;  3I0T A;  4RGS A;  2FNA A;  2LNB A;  4I02 A;  2VBX A;  5DCF A;  2MH2 A;  2PBI A;  1PDN C;  1PP7 U;  3R61 A;  5D8K B;  1R1U A;  3KCC A;  3T8R A;  1FYL A;  4RGX A;  2D1H A;  2DU9 A;  4AIH A;  4WXD A;  4XSZ F;  2W85 A;  2A5Y B;  3BJA A;  4G6Q A;  5JR3 A;  3FM5 A;  1ONV A;  2W25 A;  4U88 A;  1B9M A;  4O6J A;  5D8L B;  2FOK A;  4PGH A;  2NS0 A;  3PQJ A;  4G94 A;  2DLL A;  3SFZ A;  2JPC A;  1FX7 A;  4R8H A;  5K5R A;  1I1S A;  1KU9 A;  3BP8 A;  2Q2E A;  1ON2 A;  1MJA A;  2EV5 A;  2XAH A;  1RIO H;  4ESF A;  5L3B A;  1QBJ A;  3I59 B;  5HDK A;  5DCM A;  1FSH A;  5HS9 A;  3I54 A;  3L00 A;  2FMY A;  5HS8 A;  2E7X A;  4G6D A;  1OYY A;  2EJR A;  2KIM A;  4EM0 B;  2UXN A;  2F2E A;  2EV6 A;  5BPD A;  3EET A;  3DPT A;  5BMZ A;  2VBZ A;  4G9Y A;  3HRU A;  2M5W A;  2E7W A;  3LAP A;  3P7N A;  3IL2 A;  2VXZ A;  1ZYR F;  2PMU A;  1LNW A;  5KVR A;  3I71 A;  1ZG5 A;  5ICG A;  1B4A A;  1BC8 C;  3DV8 A;  3CO6 C;  1YO5 C;  2OA4 A;  5D4S A;  3QPT A;  4BAY A;  1FT9 A;  1ZLJ A;  1ZLK A;  4ENK A;  1S6L A;  1BBY A;  5ED4 A;  1O3T A;  4R79 A;  3ULQ B;  3F23 A;  3HHG A;  4ZZD A;  1S29 A;  1TTY A;  1JXS A;  1MD0 A;  4I7H A;  5A2Q Z;  1G4D A;  2Z3Y A;  2GXG A;  2BE5 F;  2GWR A;  4LG0 B;  2K27 A;  5FD6 A;  2E1N A;  1KQ0 A;  2AXL A;  4ESJ A;  1MJ9 A;  3J81 Z;  4HDV A;  1BI3 A;  1SMT A;  5ERI A;  4HF0 A;  2K02 A;  2GQQ A;  4K2E A;  3GW2 A;  1UCR A;  4HQE A;  2FA5 A;  1PP8 F;  1P4W A;  1XSX A;  2EFN A;  4HF2 A;  3WTV C;  4LLN A;  1LDD A;  1P92 A;  4LK1 F;  1YLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...