2DTRA

Structure of diphtheria toxin repressor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
214
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Repressor
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title High-resolution structure of the diphtheria toxin repressor complexed with cobalt and manganese reveals an SH3-like third domain and suggests a possible role of phosphate as co-corepressor.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 44
structure length 214
sequence length 223
ec nomenclature
pdb deposition date 1996-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dtrA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2dtrA02
5DD8A 5H6RA 1B1BA 1KU3A 2XV4S 4I7HA 4TV7A 5CVRA 5E17F 3LFKA 2K4BA 3RKYA 1IN5A 1TW3A 2IJLA 1Z7UA 3R0AA 1YIOA 2P5KA 1H9TA 3ZMDA 3L09A 4HZFA 3R4KA 4M6YA 1RZ4A 5E1XA 3I59A 1MJ9A 1RUOA 2IRFG 2RN7A 2FEZA 1GHCA 2HQRA 5ILSA 1YQAA 5DCFA 2EK5A 3RI4A 4OIQF 3M8EA 2XRNA 2IA2A 3TO7A 2HKOA 2KJCA 1ZREA 2FXAA 4WK8F 5AONA 4WCGA 5LGNA 2V9VA 4ESJA 3WGGA 2KIUA 4I0BA 5LEKA 5J6XA 1YS6A 2XIGA 2NAZA 1QPMA 4G6QA 3P9CA 4JBAA 3NRVA 5IT9Z 1D5VA 3C7JA 3M9AA 2PN6A 4XLPF 2DTRA 2ZKZA 1LEBA 2CW0F 3DFGA 5ILVA 1FZPB 2VBYA 2Z5UA 3KP6A 4HW0A 4BXUA 2ZFWA 3CUQA 2QQAA 1FWZA 4MNUA 2ESHA 2ACJA 4Y17A 2JSCA 4ENKA 5EEGA 3ECHA 3WODF 1F5TA 2Q8KA 3GWZA 5BQTA 2MA3A 4PCQA 1K6OA 4ZYDA 1XN7A 1FSHA 4PDKA 2FF4A 1SFUA 5D5WB 2ESNA 3BPVA 1KQ9A 1RI7A 1U5TA 2HS5A 3RKWA 2E1CA 3V7RA 2G7UA 3EDPA 4L9TA 4AVPA 2L4AA 3WE3A 5CVJA 2MLKA 1LDJA 5HLIA 2UWMA 1U6GA 3KP4A 3KCCA 2FRHA 4LJZF 4ENNA 5LEJA 1ZRFA 3HSFA 3K69A 2EV6A 2RKHA 1G3YA 3FXRA 5D6EA 2LDUA 3HOSA 4H0EA 2WWYA 1QGPA 3HSRA 3TDZC 4RGSA 2OA4A 4LGWA 3E6DA 1WWXA 1TW2A 2DBBA 4M9XA 5F6FA 4U88A 3MQ0A 3GUDA 2QBYB 2YX4A 2K27A 4E70A 5LHIA 1IN7A 1B6AA 1EH6A 2EFPA 4HAMA 5IT9K 3HRTA 4S05A 2HWVA 1FYMA 2RDPA 2X0LA 2L3DA 3DPTA 4HF0A 2OQGA 1CF7B 2ELHA 4IHSA 2LF7A 2K02A 4Q48A 3B73A 4KN7X 5L3BA 2GZWA 1YLFA 2YX7A 3D5LA 3KETA 3T5XA 1UCRA 1KGSA 5IT3A 2EWNA 2XAFA 2Y0MA 1T2KA 1XDUA 4EM2A 2STWA 3R0JA 2JTVA 2KIMA 1XGNA 3TQNA 4D0PA 3QPTA 5H6QA 5DUKA 3HRUA 1BI1A 4EM1A 2O03A 5E8IA 4MQVA 4Z2YA 2NNNA 1BBYA 1S3JA 4I0AA 5TRDA 1XCVA 3EQLF 3JAMZ 4UVAA 2F2EA 1BOAA 4HLYA 1IXCA 2K86A 4GYIA 3S2WA 1U5TC 2ZCWA 4IF4A 3B02A 1KU2A 3KLOA 4IRGA 1ZN2A 2YSRA 2V1UA 2RV8A 1LEAA 2EFWA 2FA5A 2A07F 3QAHA 4HOBA 3L9FA 3OV8A 2TDXA 1V3FA 4ZH4F 1EH8A 4LK0F 3T0YA 4A0XA 4HX8A 1BM9A 1SD7A 3I0TA 2ZMEA 3R60A 4KA4A 2QQ9A 1HBXG 1IN4A 5E1WA 5HVQC 3MFKA 5HLGA 3IWFA 5DUIA 1K78A 1J75A 2FBHA 2R7DA 2W24A 5H20A 2VBXA 3WTXC 4R8HA 1BI0A 3BZ6A 4KIBA 2DQRA 4G7HF 3JTGA 3BDDA 5LHGA 3L7WA 4I2OA 2QVOA 1IN6A 1HW1A 2CYYA 2O3FA 5E20A 1G4DA 3PQJA 1S7AA 2QENA 4EJVA 2GXGA 1U2WA 2O8XA 4M74A 4L0ZB 3F8NA 1GXQA 4CO8A 1WSUA 1AOYA 4G7ZF 1IAWA 3GVAA 5E8GA 1XD7A 1T98A 3H3UA 2L54A 2CSOA 2OZUA 2J5OA 4CHUA 3FZVA 3DPLC 3QRFF 5HLHA 5CVVA 3I4PA 5LBQA 4HBLA 4P9FA 2CO5A 4HF2A 1T6SA 2XAQA 4Y15A 1U78A 4P55A 2GA2A 1HSJA 3JAMK 2P7CB 1NHAA 2OZ6A 3E5XA 4RB0A 4S04A 1R5GA 5D4SA 5J8CA 2HDCA 2Z99A 3FM5A 4A0YA 4RAYA 2M45A 3IRQA 2JPCA 1LDKB 5LHHA 3MZHA 2R3SA 1W7PA 2FSWA 1DDNA 3RTRA 3DXJF 4CICA 1KU7A 1Z6TA 3ML6A 4KIFA 1FP2A 2EFNA 1ZRDA 2RNJA 1OKRA 2CGPA 3BY6A 3I54A 4LLGF 2UZKA 2PJPA 1FOKA 4O3MA 1FYKA 2VBZA 3K1PA 1K7AA 2GWRA 2FE3A 3ABUA 4GO1A 2YPRA 4EMSA 3L00A 3LQRA 5KVRA 3J80Z 3R61A 5D5VB 1EV7A 3BWGA 2V79A 1FYLA 3H3ZA 4A12A 1Z05A 3EYYA 5FGMA 3TOBA 1MDMA 3FMQA 1R1TA 1SAXA 3FM3A 4KN4X 3WTYC 1R5HA 5HDGA 4AIKA 3HRSA 2FBIA 2EA4A 1I27A 4HX7A 4HQMA 2AS5F 2GAUA 2HOEA 1XSVA 3RPUA 4LFUA 1YW7A 3BJOA 4OMZA 2DW4A 2XAHA 3CUOA 4GYGA 4KT5C 5DCMB 4UVCA 1HSTA 5BS6A 4ENMA 3SZPA 4EVIA 1IF1A 4EGYA 1PP7U 1HKSA 4OU0A 3BJAA 4U0VA 5DYMA 1XDSA 3QU3A 3WGHA 1F1ZA 4DQ2A 2NRAC 2VODA 3PQKA 3Q5FA 2KRFA 3F8CA 2O0YA 3TO9A 1E2XA 3ZMVA 2EFOA 4WX9A 2RVCA 3QU6A 3ROUA 1F9NA 3HYIA 3P9KA 3WTWC 1FLIA 4I02A 2MC3A 1O3SA 5CYVA 2QM3A 3COAC 2H6BA 4RGXA 1O3RA 1EH7A 1ZLKA 3ZMZA 5E18F 5D4RA 3LAPA 3RYPA 1ZG1A 4EJTA 1ZG5A 2QZ8A 2ZBKA 3M8FA 1PUEE 2HYFA 1SD6A 3KP2A 1W4MA 2K7LA 2OQRA 5JHUA 2XVCA 1AWCA 4AD9A 3WTZA 2BBYA 4LB5A 4MHGA 3GFLA 1I1SA 1IW7F 2A6EF 5JR3A 2YU3A 1BI2A 4AIJA 4BHPA 2MH2A 3HUGA 2Y75A 5TJJA 1W7PD 4IXAA 3J80K 3J7AO 2QWWA 4CYDA 2OU2A 5LRRA 2LKPA 2F5CA 1F4KA 4LG0A 3QP5A 3V8KA 1Z6RA 4UV9A 2O61A 2ADUA 2DT5A 1SMYF 1FNNA 1O7FA 3E6BA 2D45A 1HXDA 5FD6A 1BJAA 3V8JA 2DAOA 2L4MA 3FHZA 1WQ2A 1FX7A 1WI9A 1DPRA 4OIRF 4BQAA 3IKTA 5JVTA 3G73A 4M9ZA 2ISZA 1TQPA 1YW8A 5CVIA 1DP7P 2XKOA 2E7WA 2M5WA 2MD5A 1K79A 2H27A 1XSXA 3OOPA 2PFBA 1TQIA 2P4WA 2W25A 2HQNA 2JRTA 1R22A 4XRFA 4Y13A 1PDNC 2XASA 4KIGA 1R00A 3F72A 4OINF 4WWCA 3I64A 2VC0A 3F23A 2Z9OA 5CJ9A 3DKWA 3HTUA 4MQ9F 5JFRA 3QPHA 3C18A 5ICEA 4BHBA 1GXPA 3N4MA 3M7GA 5K5RA 3WTSC 4U0WA 1BIBA 4HV5A 2JZYA 4HYEA 4Q47A 4M71A 3HOTA 1R1VA 2BEOA 2FNPA 5L3GA 2HYGD 3RIRA 4UNOA 2FU4A 3ELKA 1FSEA 2W57A 3SZTA 1USSA 1KQ8A 3FMSA 2PQ8A 1WKMA 4KMFA 5DEQA 4NB5A 1XB4A 4OIOF 1MGTA 3FXUA 4U7BA 5ILUA 5ICGA 5L3DA 3E6MA 3T1BA 1ZARA 2V1XA 3KFWX 4OIPF 3GZ5A 2UXNA 4KICA 4LK1F 4IPAA 3BPXA 3HTSB 1D8JA 2A69F 3WG9A 1BIAA 4M73A 4ENJA 3GFJA 3VOEA 1P4WA 3CJNA 3CLOA 1FP1D 3P9IA 2ZNZA 3ZN0A 3GF2A 3IWZA 1LVAA 3IL2A 2HEOA 3SXYA 3ABTA 4KYWA 1R23A 2RC4A 2L01A 1JGSA 2L02A 3TKYA 4BH9A 2XUBA 1SMTA 3C3WA 1P4AA 2IW5A 2HR3A 1IUYA 2ZJ2A 4IHTA 1FBQA 1X3UA 4F7ZA 3EUHA 1B9NA 1LB2A 4UV8A 4MGRA 4MEYF 4CDGA 4XSZF 1SD4A 1YW9A 3CO7C 1W5TA 5ED4A 4WXCA 1B59A 3CO6C 1YTYA 4HF1A 2VT2A 4L5JA 2RQPA 3ULQB 3FWEA 1B4AA 4LMYA 1OPCA 4HX4A 5FB2A 3ECOA 3HSEA 1ONVA 2VOPA 3F22A 2A68F 1BC7C 4UHTA 2A3SA 2P6TA 4WXDA 1XSDA 3BP8A 4LLNA 1ON1A 4BNCA 3T8RA 5HS7A 3I53A 2EV0A 3I59B 3V4GA 3V8LA 1YG2A 4BHCA 3LA2A 2XAJA 1CGPA 4RB2C 1LNWA 2STTA 2KJBA 3FF5A 2UXXA 3ZN1A 5F1RA 1D8KA 1ZH5A 3ZMTA 5D8LB 2A5YB 4U0YA 3PFIA 3JW4A 2DO7A 2IA0A 4JK1X 2DI3A 4A5MA 1T39A 3F3XA 2XKPA 2D1HA 2G7HA 4GCVA 1BI3A 2DK8A 2DU9A 4WF2A 3RPQA 2CQKA 4BAYA 2IT0A 1J2XA 1OYYA 3FMRA 5BPDA 3HRMA 1ODDA 2QYOA 2R7FA 3IC7A 3MWMA 3FXQA 2Z33A 2QBYA 3WGIA 2NYXA 3LSTA 3DQVC 1QQIA 3HHHA 2DPDA 2O6GE 3KE2A 3RDIA 1TBXA 1O3QA 5F64A 1SFEA 4G94A 3L2CA 1CF7A 3W6KB 4N9HA 3CUQB 2M30A 3DEUA 2H09A 4G7OF 1YYVA 3EETA 3ZQ7A 3Q9SA 1J5YA 3O2PE 3QP6A 3MZYA 1FBSA 5BMZA 4RGRA 3U1DA 1I6XA 2W84A 5A2QZ 1DPUA 4O6JA 4Q4ZF 1U5TB 1STZA 3ZP5A 3FX3A 1J9IA 4FX0A 2VT3A 3CTAA 1L3LA 5LRSA 4GXOA 2BGCA 3WTTC 2V1DA 1ZGJA 2IVMA 4JQFA 1LJ9A 4OOIA 4YG2F 2NS0A 3RKXA 1ZRCA 1O7LA 4IRHA 2C6YA 2F5EA 1FPQA 3GW2A 3H92A 3WE2A 1QO0D 3JTHA 3NEUA 4YFXF 2LF8A 2J5PA 1UB9A 4RAZA 3VEPA 2FOKA 5L3FA 3F8MA 3IRRA 5FLXZ 1S29A 3SFZA 4KNYA 1FT9A 4PGGA 4MTEA 2PBIA 3NQOA 1S6LA 4L0YB 4LLLA 3LAJA 4EJUA 1ZHFA 1KU9A 2P6SA 4KFCA 3GZ6A 1P92A 5D5XB 1FC3A 3W6JB 3O3KA 2EV5A 4A2UA 1BN5A 2D2WA 1C0WA 3G3ZA 3HHGA 2Q2EA 1U3EM 3F6VA 1UHWA 4EGZA 2H94A 2OAZA 3AAFA 1HQCA 5HS8A 4PGHA 3EYIA 3GO5A 3ZMUA 4HA8A 2PI0A 4DNCA 1O3TA 3WU1B 2E7XA 4XBFA 2QLZA 1FY7A 3WTVC 3V7SA 1FBUA 2K4JA 5KK1A 4XLNF 4FHTA 5A2QK 3ERED 3LA7A 2VN2A 1XGMA 1H0MA 3E6CC 4ASNA 1VTNC 4EJOA 1KYWA 3F8BA 3QOPA 2HKXA 3F6OA 3TOAA 4GGGA 1KA8A 4QWQA 4YFNF 3WU0A 2XROA 2W85A 3RJPA 4KUMA 3RYRA 4ESBA 3P7NA 3TO6A 4ZZDA 2Q0OA 5CVUA 1ZGAA 4LB6B 2P8TA 2XHKA 2ZMEB 2AXLA 4RB3C 2PG4A 1P2FA 3VB2A 4U7DA 3N97A 4HDVA 1UFMA 4L9JA 2WV0A 5FLXK 5LGUA 1K78B 4XSXF 1TNTA 1TNSA 3MAJA 3ISPA 4FT8A 4FX4A 4HLXA 1OMIA 1REPC 1LQ1A 3LA3A 1ZLJA 2EJRA 3GYHX 2B0LA 1MD0A 2OD5A 4M72A 4MEXF 3JSPA 3SQNA 4YFKF 1JXSA 4EQQA 3DV8A 2OBPA 1PP8F 5K5OA 2PMHA 1MJAA 2BE5F 1WRJA 2VXZA 1A04A 2LSOA 1T0FA 1E17A 4EM0B 4P9UA 3DF8A 3O6BB 2CG4A 3IHUA 4B09A 1Y0UA 3KLNA 1XGOA 1V4RA 5AIPA 3REOA 1JHHA 5ICCA 1OYIA 2GA1A 2HTSA 1MJBA 4ZYGA 2DK5A 1UHMA 2HGCA 1ULYA 2D1VA 3K1NA 1SD5A 3F8FA 4HDUA 1S8NA 1I5ZA 2JT1A 3TGNA 5LLQA 1G3SA 2WTEA 5DCMA 2EA2A 1XMKA 2MLGA 1IRGA 4CXFA 1IXRC 5L3CA 1ON2A 1MKMA 3KP5A 1XMAA 2JPBA 2XAGA 2DQLA 5E1ZB 3E3VA 1KQ0A 1ZAOA 1W7PB 2DLLA 1L0OC 2IA1A 1S7OA 4BYYA 2DFIA 1D3YA 2FMLA 3D0SA 3KEQA 3VFZA 4A0ZA 3CDHA 5CLSA 3I58A 5HS9A 4HV6A 2VC1A 3U2RA 2HZTA 4CZZA 4O5VA 3K9TA 4R79A 1YS7A 2YR2A 5DDGA 4CGZA 3CUQC 5FO5A 2FMYA 1P4XA 3GEZA 3E97A 3KZYA 3ZPLA 2VE8A 2H6CA 2E1NA 1H9GA 1IXSB 1Q1HA 2ETHA 2BV6A 1KYZA 3ZMSA 1QNTA 2NNYA 4I09A 3KP7A 2P5VA 4K2EA 4A5NA 1U8RA 1MDMB 1HKTA 1J0RA 2ISYA 4IJAA 4KMUX 4P5OA 4G8XA 3BOQA 5ICFA 4KDPA 1R36A 3LWFA 3SHFA 2FQ3A 3U9GA 1SFXA 2ZXJA 2GXBA 2GIVA 3GFIA 3GXOA 3M1EA 3MCZA 4LD5A 4EJWA 2M1BA 2QQBA 4AIHA 2G9WA 3E5QA 5FD5A 1DUXC 1QZZA 3IKVA 1JE8A 1OR7A 3C1DA 1JHFA 2A6HF 1RUNA 2M8EA 1HW2A 3T8TA 4YIIA 2F5DA 1O57A 5BPIA 4HQEA 2KIFA 4A6DA 4Q5SF 2IPQX 4G9YA 4L5IA 3DP7A 3F21A 1LDDA 4L9NA 4P96A 3GFMA 5BOXA 1TTYA 2ZO4A 3KEOA 2RGVA 2VONA 1TQMA 4M9SA 2VBWA 4QLCU 5JI6A 4L9VA 1QZYA 5EEHA 2MBFA 1R58A 2FBKA 2EFQA 4UVBA 5J8FA 3I71A 4RB1A 4UXNA 4IVNA 4ZYHA 2LNBA 3K2ZA 3E5UA 4RGUA 1R1UA 1RNLA 1J59A 2QUFA 2CWEA 3J81Z 1G3WA 1P6RA 3LQQA 5HDNA 3HIFA 4ESFA 3WTUC 1RIOH 4IRIA 3KP3A 1BC8C 5AIQA 4ON0A 2GQQA 4I98B 1QBJA 2Z3YA 2ZNYA 4LG0B 3TDUC 4MTDA 3GX4X 2BYVE 2WC2A 1GVJA 3MEXA 4AWXB 5FFXA 3I5UA 3BROA 1T38A 5DD4A 4YIFA 1YO5C 5FFZA 1ZG3A 1G6NA 3V7CA 1IZ1A 4N0BA 1MZBA 2V6CA 4I01A 2VE9A 4M6XA 1USTA 4B8XA 2PEXA 6PAXA 2PMUA 5D6FA 2F5FA 4L18B 3JSOA 1XCBA 4NQWA 1G3TA 1ZYRF 4A6EA 5D8KB 2HFHA 1I1GA 4WXHA 4RS8A 3K0LA 2CFXA 2VOOA 5L3EA 4ZZLA 3VODA 2Y48A 2P7VB 1IRFA 1B9MA 3K1MA 2DPUA 4ZYEA 2P5LC 4ETSA 2KKOA 2IP2A 1R7JA 1IN8A 3GLXA 4UUVA 3KZZA 4R1HA 1HKQA 1HW5A 1Z9CA 3R6SA 5K5QA 2X4HA 5DV5A 2COMA 1YFHA 1J7KA 2PLYA 1Z1DA 1Z91A 5LGTA 1W5SA 4PZJA 4G6DA 2M87A 2A61A 2HTJA 2XGXA 5HDKA 2EB7A 3Q9VA 5ERIA 1OYWA 4EV0A 4NHJA 2MH9A 5HOOA 2FNAA 4OMYA 5D5UB 3BJ6A 1TLHB 1XGSA 4N9IA 5K1YA 3J81K
chains in the Genus database with same CATH superfamily
1Z21A 2MGQA 5DD8A 1VQ5I 1VQKI 5H6RA 2I8DA 2XGDA 1B1BA 3FHNA 3L2WA 3OSGA 1KU3A 2XV4S 4I7HA 4TV7A 5CVRA 5E17F 1JJ8C 3LFKA 3MD2A 1WJDA 2L9RA 4NC6A 2K4BA 3LL7A 3RKYA 1IN5A 1TW3A 2IJLA 2OJED 1Z7UA 2AQEA 3R0AA 2VKHA 1YIOA 2P5KA 1H9TA 3ZMDA 3L09A 2CUZA 3R4KA 4HZFA 1RKTA 1RZ4A 1TT5B 4M6YA 3I59A 5E1XA 3ZGKA 4CA0A 2JQ7A 1MJ9A 1WZ2A 1RUOA 2IRFG 4AUXA 1XC5A 1A6QA 2RN7A 3VPRA 2FEZA 2NVTJ 1GHCA 3ABKH 1H88C 2HQRA 2OCCH 5ILSA 1YQAA 5DCFA 2EK5A 1Y8RB 5DTDA 3RI4A 4KJZA 4OIQF 4FE7A 3M8EA 2XRNA 1W0UA 1G8XA 2IA2A 3N05A 3H9GA 2GOMA 2IGKA 1KZHA 3TO7A 2HKOA 3G1MA 5C3EJ 2DA1A 3CP2A 2WB1A 3JAMR 3JREA 1WH5A 2KJCA 1SANA 2LY2A 1ZREA 2FXAA 4WK8F 2X1CA 1U0JA 3KZIC 1D1AA 5AONA 3M4OJ 5EYRA 4WCGA 2OTLI 4C3HJ 5LGNA 2V9VA 4ESJA 2O7OA 3WGGA 2OF7A 3LFUA 2KIUA 4I0BA 5LEKA 2DT6A 2AHQA 5J6XA 1YS6A 2XIGA 2NAZA 1QPMA 1U9NA 3J7ZI 1K4SA 4G6QA 3P9CA 2DOEA 2VJIA 1Y0NA 5HNFA 4JBAA 3NRVA 5IT9Z 1D5VA 4E7JA 3I4MJ 3C7JA 3J7AY 1O4XA 3S2DJ 1V55H 2LH9A 4BL0B 3M9AA 2PN6A 4XLPF 2DTRA 2ZKZA 1LEBA 2CW0F 3LSGA 3VSLA 3DFGA 5ILVA 1A35A 2CMPA 1P7IA 1FZPB 2VBYA 4HSTA 2Z5UA 1JKPC 3KP6A 4HW0A 4DW6A 4BXUA 2CRGA 2ZFWA 3CUQA 2QQAA 3AFHA 4FQGA 1FWZA 1ZELA 4MNUA 4CYCA 1LVKA 1MBGA 2ESHA 2ACJA 4Y17A 2JSCA 2ZXHA 2QEXI 1JUMA 4ENKA 2M9HA 5EEGA 3ECHA 4RM3A 3WODF 1F5TA 2Q8KA 3GWZA 1MMSA 5BQTA 2MA3A 4PCQA 1K6OA 4ZYDA 1XN7A 1FSHA 3L2VA 4PDKA 4DOZA 2O8KA 2FF4A 1SFUA 2M4KA 5D5WB 2ESNA 3BPVA 5DM6F 4XLFA 2TRTA 3ZRGA 1KQ9A 1RI7A 2HZDA 1U5TA 1A36A 4RM2A 2HS5A 3RKWA 1Z3YA 2E1CA 4BJTA 1SAUA 3OS1A 3V7RA 2G7UA 3EDPA 4L9TA 1IJWC 2DJIA 2R0QC 4OWRB 4CCJA 1Y39A 4AVPA 1UJ8A 2L4AA 3BTIA 3WE3A 1X4PA 5CVJA 1RESA 2DOAA 2MLKA 1GT0C 2LBFB 1LDJA 3NWSA 2CV1A 2FX0A 5HLIA 2UWMA 4M3DA 3WHCA 1U6GA 2WV1A 3KP4A 3KCCA 3U21A 3SDGA 3GBGA 2FRHA 2K40A 2M0CA 3FXMA 4Y33A 3GTOJ 4LJZF 2IS4A 4ENNA 1N25A 2QF7A 2CW8A 4IZZA 5LEJA 1ZRFA 3HSFA 2D5VA 3QYEA 3J81R 2NOGA 3K69A 3RQIA 2EV6A 1ETKA 1V54H 4AYBA 2RKHA 1G3YA 2VJJA 1BOBA 3FXRA 5D6EA 3BT9A 2X1EA 3MKYB 2LDUA 3HOSA 3OYNA 4H0EA 4V2GA 2WWYA 1QGPA 3HSRA 4C2UA 2KIQA 3TDZC 2DMPA 4RGSA 2OA4A 4LGWA 4LOCA 2QA4I 4F91B 3E6DA 1WWXA 1D1CA 3OYDA 2ECBA 1ZGWA 1TW2A 1A31A 1BR2A 1MMAA 2R5YB 3FIWA 2DBBA 2BXZA 4M9XA 2MC4A 5F6FA 4U88A 3MQ0A 2R7XA 2VI6A 1EA3A 2IEKA 3HC7A 3GUDA 2QBYB 2YX4A 2K27A 5JLXA 2JWTA 1X58A 2I5UA 4E70A 5LHIA 5IYBJ 1IN7A 1B6AA 1EH6A 4C2TA 2EFPA 3IP4B 4HAMA 5IT9K 3OS2A 3SFIA 3HRTA 4S05A 2HWVA 2F48A 2EZLA 4BU2A 1FYMA 2RDPA 3OYEA 2X0LA 4NUBA 4B3AA 3OSFA 2L3DA 2ZB9A 3DPTA 4B43A 4HF0A 3HJEA 2IGNA 2X1DA 1VQ4I 3ZQFA 2OQGA 4I99C 5JLWA 2DMQA 1CF7B 2ELHA 4CH7A 4IHSA 2LF7A 2EH3A 2K02A 5IOZA 4Q48A 3B73A 3QODA 4KN7X 1I3AA 5L3BA 2GZWA 1YLFA 2YX7A 3D5LA 4M3EA 3T5XA 3KETA 1UCRA 1KGSA 1S9HA 2KDOA 5IT3A 2EWNA 3JRGA 1XPXA 1AKHB 5J4VA 2XAFA 2Y0MA 1T2KA 1IV8A 1XDUA 4EM2A 1JKQC 2STWA 3R0JA 1OFCX 2JTVA 4X1EA 2KIMA 3PIOF 3GMEA 2K5CA 1XGNA 2X51A 3TQNA 4W97A 5K7FA 4D0PA 3QPTA 5H6QA 3IAS2 1K6YA 5DUKA 3HRUA 1VFCA 1BI1A 4EM1A 2JA8J 2O03A 3EUKL 5E8IA 2KL4A 3J80R 4CUGA 3M8JA 1TWAJ 4MQVA 4Z2YA 5M5XJ 2HOSA 2NNNA 1A6IA 1BBYA 1S3JA 1SVLA 4I0AA 3HB9A 3Q0WA 2O5RA 5TRDA 1XCVA 3EQLF 1LUJB 3JAMZ 5LD2C 2QSHX 4UVAA 3RKQA 2F2EA 3AG1H 4ZC3A 1BOAA 5H2FC 1IXCA 1LFBA 3CMAI 4HLYA 5FLMJ 2K86A 3FXJA 3S3MA 4GYIA 1X2MA 3DKXA 3S2WA 1U5TC 2ZCWA 3VYUB 2VQCA 4IF4A 3B02A 3GLLA 3MKLA 4FETA 1KU2A 3X2QH 2NS7A 2W82A 2E5NA 3GTQJ 3KLOA 4GRIA 2VLAA 2CQXA 1LFPA 1ZN2A 3Q0UA 4IRGA 3CZ6A 2YSRA 4G12A 2V1UA 3HG9A 2LRDA 2RV8A 1LEAA 3BTCA 2EFWA 4KT6A 1OQYA 2FA5A 4D9JA 2A07F 2IGOA 2NVXJ 3QAHA 4HOBA 3S93A 4IOCF 3L9FA 2HQ5A 2ZXWH 4UUSB 3OV8A 2TDXA 2B7EA 4E6KG 1V3FA 4ZH4F 2PJRA 4II3A 1EH8A 2R7ZJ 4LK0F 5EGOA 3T0YA 3VWBA 4HX8A 3WHBA 4A0XA 1BM9A 1SD7A 4QPOA 3I0TA 2ZMEA 4PSXA 1R71A 3BC8A 4BY1J 2VUMJ 3R60A 4KA4A 1JKRC 4PJ0C 1CQTA 2QQ9A 1GV2A 1XMXA 1BA5A 3VSKA 1HBXG 1IN4A 3CMEI 5E1WA 5HVQC 3MFKA 3BG3A 4RAFA 5IY5H 3OR2C 5HLGA 3IWFA 5DUIA 1K78A 3ZQGA 1J75A 2FBHA 2R7DA 2NVUB 2W24A 3U1KA 1VQ9I 5H20A 2VBXA 3WTXC 5J1UA 4R8HA 1BI0A 1BW5A 3BZ6A 4KIBA 2DQRA 4G7HF 1FTTA 4F92B 1T33A 3JTGA 4A3FJ 3BDDA 1FOWA 4EATA 1W0TA 1S5LC 5LHGA 3L7WA 4I2OA 2EIJH 2QVOA 3S1RJ 1IN6A 4Y7NJ 1HW1A 2CYYA 3A2KA 2O3FA 2Q2EB 3TBIA 3ZQHA 5F1JA 5E20A 3CCMI 5CPRB 1YHQI 3BR6A 3DPUA 3OWTA 1G4DA 1ETWA 1I3QJ 3PQJA 3AG4H 3KYLA 4I6ZA 1S7AA 2QENA 4EJVA 2GXGA 1WJFA 3MKZA 1VI0A 2LP0A 3D5SC 1U2WA 3A4CA 3CJRB 3QQAA 2O8XA 4M74A 3F9KA 4L0ZB 1IV6A 3F8NA 2ELJA 4JOMA 2KMUA 1GXQA 2N8GA 4CO8A 2V9PA 2EQRA 2HVRA 1WSUA 1AOYA 4V2FA 5E3LA 2LD5A 1QHGA 4G7ZF 4HPQA 1IAWA 4IQ4A 4A3DJ 3GVAA 2WAEA 5E8GA 4Y3OA 1XD7A 1T98A 3H3UA 3OYGA 1B72B 5IT9R 4BY7J 2L54A 2CSOA 2OZUA 1LE8B 2J5OA 1WFXA 1SC7A 4CHUA 3FZVA 4IOAF 3HOYJ 3DPLC 4YEJA 1HF0A 3QRFF 4G6TB 5HLHA 5CVVA 2AO9A 2DA5A 2LC2A 3G1LA 3I4PA 5LBQA 4HBLA 2CO5A 4P9FA 4HF2A 1T6SA 2XAQA 4Y15A 3W3CA 1OLTA 4PFPA 1U78A 3CESA 4P55A 2QCOA 4XLEA 2GA2A 1E3HA 1HSJA 1D0XA 3JAMK 2P7CB 4H4KC 1JT0A 4A93J 1HOMA 1NHAA 5GPCA 2OZ6A 3E5XA 2JA2A 4RB0A 2R7VA 4S04A 1IRZA 1TWCJ 2FJ1A 4HNTA 1W5CC 1R5GA 5D4SA 2HVQA 4XRMA 4BEHA 2ID3A 2QSGX 3CDIA 5J8CA 4RBOA 2HDCA 5F08A 2H1KA 4HNUA 1MNDA 1WJEA 2Z99A 3FM5A 1YX5A 2CS3A 2EPFA 4A0YA 2IAIA 4RAYA 2M45A 2XPWA 3IRQA 2JPCA 3JR9A 2MG4A 3H5NA 1LDKB 5LHHA 3AG3H 1XS9A 1UAAA 4A3JJ 3MZHA 2R3SA 3MZ8A 1W7PA 2FSWA 1DDNA 2K3PA 3ABLH 3RTRA 3DXJF 2F5VA 1NG6A 4CICA 4XQFA 5DM7F 3A52A 3RQ4A 1KU7A 1Z6TA 2HYJA 3ML6A 4KIFA 2OUMA 1FP2A 2JVGA 1ENHA 2EFNA 4XM3A 3EUHC 1JJ6C 2L0KA 4A3GJ 1ZRDA 3C2GA 2RNJA 1OKRA 2LREA 2CGPA 3BY6A 2HQAA 2VIXA 1WHUA 3I54A 4C3JJ 4LLGF 3RZDJ 3CLQA 2L7FP 2UZKA 2PJPA 2JA7J 1FOKA 4O3MA 1FYKA 2ZMEC 2VBZA 3K1PA 3IH2A 1K7AA 2VKEA 5KCMA 2ZSHB 2GWRA 4C9YA 4B44A 2FE3A 3ABUA 4LIUA 1JKOC 2DMUA 1FMVA 5CQEA 2W1OA 5FKNA 4BKXA 3HOUJ 1RC9A 2A5WA 4GO1A 2YPRA 4EMSA 2LYCA 3L00A 2JRMA 3CQZJ 3LQRA 1R9TJ 2PMZA 1MBKA 2H8WA 5KVRA 4A3BJ 3J80Z 3PO2J 3R61A 4IHVA 5D5VB 1EV7A 3BWGA 2V79A 1FYLA 3H3ZA 2BVLA 4A12A 4D7MA 2R7TA 1Z05A 2HNHA 3EYYA 4UB6C 4N4NB 5FGMA 3E0JB 3O8HA 3TOBA 2JMWA 1MDMA 2HI3A 1R4MB 3E1SA 3FMQA 1W36C 2E71A 1R1TA 1SAXA 2OCEA 3FM3A 4KN4X 3WTYC 1R5HA 3K4CA 1VQNI 5HDGA 4AIKA 1YITI 1P9QC 1GDTA 3HRSA 4JX6A 2FBIA 4XKBA 2DXIA 2EA4A 5JHFA 3HKZA 5E3OA 2JK3A 1E3OC 1I27A 4HX7A 3K6GA 4HQMA 2AS5F 2GAUA 2HOEA 3B6AA 3HOZJ 5GTHC 1XSVA 3RPUA 4LFUA 1YW7A 2X6WA 4CZCA 4ZYAA 3CCEI 3FXLA 3BJOA 4OMZA 2DW4A 2ID6A 2XAHA 2RAEA 3CUOA 3DLAA 4M3BA 2ME0A 4GYGA 4KT5C 5IYCJ 2LVSA 5DCMB 4UVCA 1APLC 1SVMA 1HSTA 3PSFA 5BS6A 4A3MJ 1M1EB 4ENMA 4HEA2 3SZPA 1K83J 2L5QA 5C44J 4EVIA 4D7NA 1IF1A 3C2HA 2ICWG 4EGYA 3OYBA 2ZC2A 1PP7U 1HKSA 4OU0A 3BJAA 5GAGJ 4E7KA 4U0VA 4XKCA 2WY7Q 5DYMA 5KHDA 2X6YA 2K9SA 1XDSA 2QKLB 3QU3A 3QWLA 3WGHA 1F1ZA 4BUPA 1GUUA 1MBFA 3JRFA 4DQ2A 2ELKA 3OYCA 2NRAC 2VODA 2A05A 1N78A 3MN2A 2IXSA 2K9NA 3PQKA 3Q5FA 2KRFA 3F8CA 3JRBA 5GP9A 2O0YA 3TO9A 2M35A 2BY2A 1E2XA 3ZMVA 1SFKA 5CQGA 2BVMA 2EFOA 4WX9A 3A01B 2RVCA 2NVYJ 3QU6A 3ROUA 4BXXJ 3GCMA 1X3WB 4IHXA 1F9NA 2KISA 3HYIA 3P9KA 3HM5A 3WTWC 4I02A 1FLIA 4XN3A 2CJJA 2MC3A 1O3SA 5CYVA 2QM3A 1N77A 3COAC 2H6BA 5FLVA 2WA0A 4RGXA 1O3RA 1EH7A 2VQGA 1ZLKA 3ZMZA 5E18F 5D4RA 3LAPA 3K7AJ 3RYPA 5F0CA 3H0DA 2R93J 3H9JA 4F93B 1ZG1A 4EJTA 1ZG5A 2QZ8A 3TW7A 3GZNB 5E79C 1EJ9A 2ZBKA 3I4NJ 3M8FA 2R7SA 1PUEE 4KISA 2HYFA 1SD6A 3KP2A 1W4MA 2K7LA 2OQRA 5JHUA 1TZLA 2XVCA 2LKXA 1AWCA 3S32A 4AD9A 3WTZA 2BBYA 4LB5A 5EZHA 4MHGA 3S1MJ 3GFLA 1I1SA 3BG9A 2CUJA 1IW7F 2DA4A 3CCRI 3TMOA 1XTAA 2A6EF 2EIKH 2MABA 2V9KA 4MFDA 5JR3A 2YU3A 1BI2A 1FIAA 4AIJA 2QSFX 2MH2A 4BHPA 3HUGA 2RREA 5FKMA 2Y75A 3PUBA 5TJJA 3CCUI 2DFHA 2VQLA 1W7PD 4IXAA 2CV2A 3J80K 3PUFA 3H9QA 1QU3A 3J7AO 2QWWA 4CYDA 2OU2A 3BR3A 4Y52J 1QA6A 5LRRA 2LKPA 2F5CA 1F4KA 4LG0A 4XICA 2X98A 1I50J 1WGXA 2VKDA 3IH3A 3OYLA 3QP5A 3ZQCA 2HOTA 3V8KA 3MVPA 1Z6RA 4UV9A 5M3FJ 5M3MJ 2O61A 2ADUA 2DT5A 4BE1A 1SMYF 4E7SA 1FNNA 4U87A 3ABMH 1ZR4A 1Z67A 1O7FA 2DOFA 3E6BA 2D45A 3HOWJ 1HXDA 3K10A 1WJAA 5FD6A 1I6HJ 3D1NI 1BJAA 3V8JA 2DAOA 2L4MA 4XONA 3KPHA 3FHZA 2E35A 1WQ2A 1WVRA 3V42A 1SFOJ 1FX7A 3BR5A 1MSFC 1WI9A 3A03A 4UUTA 1DPRA 4OIRF 4BQAA 3IKTA 4F55A 5JVTA 2BXYA 3G73A 4M9ZA 3BQYA 2ISZA 1TQPA 1YW8A 2CUEA 4B3XA 5CVIA 1DP7P 2G0EA 2XKOA 2E7WA 1RETA 5FJ8J 1Z77A 2M5WA 2MD5A 1K79A 2H27A 3VYSB 2RNGA 1XSXA 3SEQA 4FE4A 3OOPA 1UG0A 2PFBA 1IC8A 2ZSIB 1TQIA 2P4WA 2W25A 1F36A 3DU6A 4BACA 2HQNA 2JRTA 1R22A 4XRFA 4Y13A 1PDNC 2XASA 4KIGA 3RPUD 3AL0C 1PUFB 5EF6A 3DEEA 1Y56A 1R00A 3W2VA 2ME6A 3F72A 4OINF 4WWCA 3I64A 2VC0A 5F04A 3TP0A 3F23A 2Z9OA 5CJ9A 4CSWA 3DKWA 3HTUA 2DODA 3A1YA 4MQ9F 1TWFJ 5JFRA 2DFFA 3QPHA 2BW3B 3C18A 3W2WA 5ICEA 4Z6YA 4BHBA 1GXPA 2RQQA 2XGEA 3N4MA 2L7ZA 3M7GA 4XN0A 3VYRB 5K5RA 3FK7A 4OAYA 3DEWA 3BR0A 3WTSC 2IBDA 1UMQA 1SVOA 1UZCA 1BIBA 2M3AA 3HBLA 2JZYA 4HV5A 4U0WA 4HYEA 4Q47A 5IP6A 4M71A 1QPIA 3HOTA 4E7HA 1U8BA 3H1CA 3PO3J 3TL4X 2VB6A 3FBIB 1R1VA 2BEOA 2ZJPF 2FNPA 4M6VA 5L3GA 2XPVA 1MNEA 2GXAA 4V19K 1TC3C 4ZTFA 3OL3A 1V5GA 2R7QA 2HYGD 1IRXA 3RIRA 3LSIA 2HDDA 5F0HA 4UNOA 2FU4A 2B9SA 3FXOA 1BR4A 3ELKA 5IP9J 1IDZA 1FSEA 3JRAA 2W57A 3HGYA 4FISA 2XB5A 3SZTA 1USSA 3S3NA 4CCNA 1FJLA 1KQ8A 3FMSA 2XSDC 1NK3P 2PQ8A 1WKMA 4KMFA 3H5AA 5DEQA 4NB5A 4BGDA 2M7AA 1XB4A 3JRIA 4OIOF 3A0BC 1MGTA 3SJMA 1JGGA 5M5YJ 3FXUA 4NBQA 4U7BA 5ILUA 5ICGA 3LSJA 2MYSA 3ASOH 2E2HJ 3OYIA 3H5RA 3WG7H 2DA2A 4BQQA 5FRMA 4DGWB 3S3OA 5L3DA 3OYAA 3E6MA 3T1BA 1UG2A 5FKOA 1MH3A 5KAIC 1UHSA 1Z0XA 1ZARA 2V1XA 3KFWX 3NAUA 3IAM2 4UB8C 4OIPF 2HU9A 3GZ5A 2UXNA 4B4CA 2DA6A 4KICA 1LFUP 4LK1F 3M07A 4IPAA 3PL8A 1H8AC 3BPXA 3HTSB 1FOXA 1D8JA 2R5ZA 1ETVA 2JN6A 1UELB 2A69F 2MW8A 3LSMA 1Q1VA 3WG9A 1BIAA 4NQWB 1MBJA 4M73A 1WJ5A 1OCCH 4ENJA 2MUNA 3GFJA 3VOEA 2KHMA 1P4WA 3CJNA 3CLOA 1FP1D 3P9IA 2ZNZA 3ZN0A 1WJBA 4N4OB 3GF2A 2DYRH 2F4MB 3IWZA 1LVAA 3IL2A 5M5WJ 2HEOA 3SXYA 3ABTA 4NDLA 5EEAA 4KYWA 1R23A 4MLOA 2MSYA 3K70C 5GADJ 2KRCA 2RC4A 2L01A 4HG2A 1JGSA 2L02A 3K4NA 3TKYA 4AVZA 4BH9A 4YIRX 2WAQN 5F0FA 2XUBA 1ETQA 5EG0B 1SMTA 3C3WA 4YRVA 1P4AA 2IW5A 2HR3A 1IUYA 2ZJ2A 3FXKA 3L2QA 4IHTA 1FBQA 2L2OA 1MW7A 3S15J 1X3UA 3A02A 1FOYA 4F7ZA 1E0EA 3EUHA 2DFEA 3OIOA 1B9NA 1B8IB 4AIDA 1LB2A 4UV8A 4MGRA 4XR6A 3DU5A 4MEYF 4CDGA 2V6EA 1OCZH 1YRNB 4XSZF 1SD4A 1YW9A 3CO7C 2ZJQF 1W5TA 2BOLA 5ED4A 2P81A 5IP7J 4HSRA 1B59A 3OR1C 4WXCA 2TCTA 1T0FC 3CO6C 4XKVA 4XOTA 1R4NB 1YTYA 2GLOA 2E36A 4YELA 4HF1A 2VT2A 2VJ4A 3G2BA 4RLFA 4L5JA 2RQPA 1TWGJ 2R4GA 3ULQB 3FWEA 1B4AA 4LMYA 3ZCOA 1OPCA 3LSRA 5JVGF 2DDBA 4HX4A 5FB2A 5C4JJ 5KAFC 3ECOA 3HSEA 2V7FA 1ONVA 2VOPA 3F22A 2A68F 1VQPI 2Q1ZB 4ZJZA 3CC4I 1E3PA 1JT6A 1PYVA 3LNQA 1BC7C 4UHTA 3BZKA 1X1CA 3EPZA 1FIPA 2A3SA 2JUGA 2P6TA 1IUFA 1K61A 4WXDA 1XSDA 2DDAA 3ZQQA 1X1PA 3BP8A 4F52A 4LLNA 1ON1A 4BNCA 4DBQA 3T8RA 3L1PA 5HS7A 3H35A 1MBHA 3FKJA 4X0GA 2WBMA 1ETOA 1YOVB 3I53A 2EV0A 4JP0A 3I59B 4JX4A 3TEDA 1IG7A 4CCLA 3M3YJ 3V4GA 3V8LA 5C4XJ 9ANTA 2FQ4A 1YG2A 3BR2A 4BHCA 3PNYA 1OCRH 1T95A 1NTCA 2LBFA 3LA2A 3DTIA 2XAJA 1JTXA 2M34A 1CGPA 1IO2A 2QKMB 2KQRA 4RB2C 3CJTB 1LNWA 2STTA 2KJBA 3FF5A 2UXXA 3ZN1A 3RSNA 5F1RA 1D8KA 1X2NA 1MH4A 1ZH5A 3ZMTA 2Y0SN 5D8LB 2A5YB 4U0YA 3PFIA 3BG5A 3JW4A 4D1QA 1T8IA 2DO7A 2IA0A 3BG7A 1OCPA 2Y9YA 4BDZA 2L9VA 1DP3A 1TT0A 4JK1X 2DI3A 2L9NA 4A5MA 2V4JC 1T39A 1GVDA 3HZJA 3ZR8X 3F3XA 4FASD 2XKPA 2D1HA 2G7HA 1HDPA 1JUSA 2NOJB 4GCVA 1J09A 4W1UA 1BI3A 2DK8A 2DU9A 4WF2A 3RPQA 2CQKA 4BAYA 4C2MJ 1J2XA 1OYYA 4C3IJ 2IT0A 3KYDB 3FMRA 4E7LA 5BPDA 2R5YA 3HRMA 3VDXA 3HOVJ 3IV5A 1ODDA 1YJ9I 4PJJA 2F4OB 1DGWY 1A5JA 2L7KA 2QYOA 4I76A 2R7FA 3IC7A 3MWMA 2LG4A 5J1YA 2XRLA 2W00A 3FXQA 2Z33A 2QBYA 3WGIA 3S1QJ 2NYXA 3S17J 3LSTA 3Q0VA 3PJRA 3DQVC 1QQIA 3HHHA 1POGA 3G6EI 3BR1A 2DPDA 2O6GE 2DN0A 3KE2A 1U9OA 3RDIA 1TBXA 2DMNA 4IL6C 1O3QA 2OPTA 5F64A 4B1RA 1SFEA 3WU2C 4G94A 3L2CA 1CF7A 3F0CA 1TL8A 4HRIA 3W6KB 4N9HA 2CUFA 3CUQB 1XG1A 2IS1A 2M30A 3ONQA 3UKGA 4CYCB 3B6CA 3DEUA 1AKHA 1QRYA 1V5EA 2Y0SA 2H09A 4G7OF 1YYVA 3EETA 3BG6A 3HPHA 3Q9SA 3ZQ7A 3LSPA 1J5YA 3O2PE 5GPAA 3QP6A 1YE9A 4JX5A 4FTHA 3MZYA 2KFDA 4XORA 3SYTA 1FBSA 1NH3A 5B3SH 5BMZA 2BY3A 4E7ZA 4RGRA 1Y1WJ 4M3GA 3CD6I 3K4LA 3QYBA 3U1DA 1I6XA 3J7YJ 3CMYA 2W84A 5A2QZ 1DPUA 4O6JA 2L7MP 4Q4ZF 3JRHA 2BZTA 1U5TB 1STZA 2EZIA 3ZP5A 3DTKA 1W1WE 2MVTA 4A3IJ 3FX3A 3I56I 1J9IA 3QOEA 1Z7LA 4FX0A 1EKEA 2VT3A 3CTAA 1QZEA 4XKWA 3J7AW 1L3LA 2LR8A 1OR7C 5LRSA 4GXOA 1R6RA 2GBYA 4GDFA 4XLHA 2BGCA 3PIPF 4XLCA 4DBRA 2XGCA 3GTJJ 3WTTC 2V1DA 4RMNA 1ZGJA 2IVMA 4Y4RA 4JQFA 2EINH 1LJ9A 3H3VK 4OOIA 4YG2F 2NS0A 3OL4A 4PFOA 3RKXA 4MFEA 1ZRCA 1WCMJ 2CQQA 3OYJA 3HXLA 1O7LA 1ACIA 2W4SA 2OC6A 4LIVA 2M8GX 4IRHA 5BNGA 3FK6A 2VQHA 2C6YA 2F5EA 1FPQA 2VASA 3CMMA 3GW2A 3L2RA 3H92A 3WE2A 3KEYA 1S72I 4II2A 1QO0D 3JTHA 3NEUA 2UV1A 4YFXF 4UUSA 3AKZA 4A3KJ 1TP4A 2LF8A 1ETYA 2J5PA 1UB9A 3CC2I 5FRNA 4DYRA 4RAZA 1W36D 3VEPA 1BR1A 2X6OA 2FOKA 3CF2A 5B5EC 3QPLA 2WB1N 5L3FA 2E1MB 2XF7A 3F8MA 1XX5A 3IRRA 4NC7A 5FLXZ 1S29A 1RPWA 3SFZA 4KNYA 1NK2P 1FT9A 4PGGA 4MTEA 2YUSA 2GOXB 2PBIA 3NQOA 2X6XA 5B1BH 4QTRA 3DLLF 1S6LA 4L0YB 4LLLA 2KPMA 3LAJA 3FISA 4XOPA 2XDVA 3H0GJ 2R92J 5FROA 2NS8A 4AU7A 4EJUA 1ZHFA 2B63J 1D5YA 1KU9A 2P6SA 4KFCA 3GZ6A 1P92A 2LOOA 3K2AA 5CKTA 5D5XB 1ZR2A 3ASNH 2V1NA 1FC3A 3BQZA 4OAZA 3W6JB 3BLYA 3O3KA 4IEJA 2EV5A 1RR8C 2KZGA 4A2UA 1BN5A 2D2WA 5B1AH 1C0WA 3G3ZA 2M0MA 4BBSJ 4XNFA 3BTJA 2MD0A 2F4IA 3HHGA 2Q2EA 2IGMA 1R49A 1U3EM 3F6VA 2XF5A 1UHWA 4EGZA 2H94A 2EBIA 2OAZA 3AAFA 1MMNA 3PNVA 1HQCA 5HS8A 4A3EJ 3UR3C 1YJWI 4BJ5C 2E19A 4PGHA 5GAEJ 5EJCA 2E1OA 2LK2A 3EYIA 1YX3A 2XAUA 3GO5A 3SEZA 3ZMUA 2WY8Q 3TP3A 4HA8A 2PI0A 4DYQA 2VPLA 2CH0A 1MMDA 2DCEA 4DNCA 5LFAA 3WU1B 1O3TA 2E7XA 4LITA 4XBFA 4A3LJ 2QLZA 1FY7A 1AHDP 1Z3XA 3OIQA 2JVHA 2LTPA 3V7SA 5J4YA 3WTVC 2R5ZB 2KP6A 1FBUA 5IYDJ 1P7JA 1QVUA 2K4JA 5KK1A 4IKFA 1ZK8A 4XLNF 1YJNI 2K9LA 1PVEA 1B72A 3IUOA 1HA8A 4FHTA 1LE8A 5A2QK 1D0YA 5DS9A 3VYTB 3ERED 4XK4A 2XB0X 3LA7A 3CCQI 2VN2A 1XGMA 3OIPA 2EZKA 4IO9F 1R5ID 1H0MA 3E6CC 4ASNA 1JI8A 1VTNC 5EDNA 4ZDPA 1BW6A 4DYCA 3CF5F 4EJOA 1KYWA 2A6TA 3F8BA 4FCYA 1BJZA 3QOPA 1HCRA 2HKXA 3F6OA 1OISA 3TOAA 4GGGA 1KA8A 2LMDA 3NWTA 3HGGA 4QWQA 4CCMA 2W48A 4YFNF 2PX9A 3G4SI 3WU0A 2XROA 4BE0A 2W85A 3RJPA 4KUMA 3RYRA 4ESBA 2ECCA 2X48A 1ETXA 3P7NA 3TO6A 4ZZDA 2XF6A 2MFZA 2Q0OA 4XRSG 5CVUA 1ZGAA 4IQJA 2PJRB 4PJLA 5EGOB 2QGUA 1X19A 3KX2A 4LB6B 2P8TA 2XHKA 2M4GA 4AYBN 4DIQA 4RA2A 2ZMEB 2AXLA 4RB3C 2PG4A 1P2FA 2KT0A 3VB2A 4U7DA 3N97A 4BE2A 4HDVA 3OMYA 1MMGA 3JRCA 5TISC 1UFMA 4L9JA 1BL0A 4J01A 1FTZA 1LKXA 2WV0A 1ZKGA 2ZJRF 2O9LA 5FLXK 5LGUA 2K9MA 1K78B 4XSXF 2DTZA 3JRDA 1TNTA 1TNSA 3MAJA 3ZOBA 2JA6J 3ISPA 4XMYA 4PJMA 3ZQLA 1F43A 4FT8A 4FX4A 4HLXA 1OMIA 1REPC 1LQ1A 3CP8A 3LA3A 1ZLJA 1HC8A 2WADA 2EJRA 2E34A 3GYHX 1FMWA 2Y31A 1IGNA 2HPIA 2B0LA 1AU7A 1MD0A 2OD5A 4M72A 4MEXF 5J3LA 3JSPA 3SQNA 4YFKF 1JXSA 4A3CJ 4UY8I 2BY1A 1MBEA 2ZFUA 4EQQA 3DV8A 3I55I 1HLVA 2OBPA 3C2BA 1WI3A 3BCAA 3PFYA 1PP8F 5K5OA 2M2EA 1TWHJ 2PMHA 1WJCA 1G2HA 1MJAA 2BE5F 1WRJA 4JYKA 2VXZA 1OCOH 1A04A 2NXNB 2LSOA 1T0FA 1E17A 2LY1A 4EM0B 4P9UA 3DBRB 3DF8A 3M1CA 3O6BB 3EUAA 2CG4A 3FKIJ 3IHUA 2I10A 4B09A 1Y0UA 4F3QA 3KLNA 1XGOA 2EILH 1V4RA 2KZVA 2IS6A 4B48A 5AIPA 2H1LA 2Z2SB 2P0TA 3REOA 1JHHA 5ICCA 1OYIA 2GA1A 1JUPA 2P0WA 2HTSA 1MJBA 4ZYGA 1D0ZA 2DK5A 3S16J 1UHMA 2HGCA 1ULYA 2D1VA 4AM3A 3CC7I 3K1NA 1SD5A 4BJ6C 3LSHA 3F8FA 4HDUA 1S8NA 1I5ZA 2JT1A 2XPUA 3TGNA 5LLQA 2H8RA 2R7OA 1OCTC 2HOAA 1G3SA 2WTEA 5DCMA 2EA2A 3A0HC 1XMKA 5J40A 2R7RA 2MLGA 4ITVA 3ZXSA 1NG7A 1AA7A 3LOCA 1IRGA 4CXFA 2BY0A 3TW6A 1IXRC 5L3CA 1YI2I 1ON2A 4BEHB 1MKMA 1D1BA 1PJRA 5FKKA 3KP5A 1XMAA 3S8PA 2JPBA 1ORKA 3AG2H 3OOUA 3FBNB 5GAHJ 2XAGA 2DQLA 4ZTJA 2M7BA 3HDDA 5E1ZB 2V26A 3E3VA 4RAGA 2JJ7A 4GFBA 4RLQA 1VQOI 1KQ0A 4J19A 1ZAOA 3K4JA 3A01A 1W7PB 2DLLA 1L0OC 2IA1A 1S7OA 4BYYA 2F6CA 5IPAA 1S7EA 4IHYA 2HPMA 2DFIA 1D3YA 2FMLA 3D0SA 5A2QR 3KEQA 3VFZA 4IHWA 4A0ZA 3CDHA 3E7LA 5CLSA 3I58A 5HS9A 4HV6A 2VXDA 4CCKA 2VC1A 5FKLA 3U2RA 2HZTA 2LY9A 2AXTC 4CZZA 4O5VA 3K9TA 4R79A 1MSEC 2BHZA 2ZXIA 1YS7A 3GTKJ 5HLTA 3PSIA 2YR2A 2BHYA 5DDGA 4CGZA 3I9V2 3CUQC 1WPKA 3DKYA 5FO5A 2FMYA 3CCLI 4XL9A 1P4XA 4M3FA 3GEZA 3MMYB 3OY9A 5KNLA 3E97A 3KZYA 3H36A 3ZPLA 2VE8A 3CCYA 2H6CA 2R7UA 1GV5A 2E1NA 5B66C 1H9GA 1IXSB 1Q1HA 4PK4A 2AQFA 4IX7A 2ETHA 2Y30A 2BV6A 1KYZA 3BCBA 1G59A 1I39A 1QNTA 2VKVA 3ZMSA 1MNMC 2DMTA 2NNYA 4I09A 4PJNA 3KP7A 2P5VA 4K2EA 4DZJA 4A5NA 1U8RA 2E60A 4BBRJ 1MDMB 1HKTA 1J0RA 2ISYA 3DWLE 4IJAA 4KMUX 4P5OA 3DBLB 3BOQA 4G8XA 5ICFA 1FEXA 4KDPA 1R36A 3LWFA 3SHFA 2QQ8A 1Y8QB 2FQ3A 5EZGA 3I3LA 3U9GA 4KITB 2VPRA 1VQLI 2K3FA 5FLXR 1SFXA 2ZXJA 4BQNA 1V5FA 2CQNA 3CCSI 2GXBA 2CQ7A 2HXOA 2GIVA 1JTYA 1ITYA 4S0HB 3K70D 2DYSH 3HOXJ 2E2JJ 2JSPA 1VQMI 3GFIA 2YU9J 2K85A 1K4TA 3GXOA 3M1EA 3MCZA 4LD5A 4HNVA 2VL8A 3FDYA 4EJWA 2Y9ZA 1QVTA 3PM1A 2M1BA 2QQBA 4AIHA 3KYCB 2G9WA 3SZGA 3CDLA 4ABZA 3E5QA 1MIJA 5FD5A 2NVQJ 2CW7A 1DUXC 1VQ6I 3L2UA 2X85A 2FOWA 1QZZA 3IKVA 1JE8A 4ZDLA 4CCOA 1OR7A 3C1DA 2GM4A 1SEUA 1T08B 1JHFA 4B47A 2A6HF 1RUNA 4PSWA 2M8EA 4ANJA 1HW2A 3T8TA 3AL0B 3ESWB 4YIIA 2F5DA 1O57A 5BPIA 3ERMA 4HQEA 4BQOA 3RZOJ 2KIFA 4A6DA 3DTEA 4Q5SF 1X3ZB 4NNJA 2IPQX 3S14J 4G9YA 2LKSA 4L5IA 1QHHD 1X4OA 3DP7A 3F21A 2E1MC 1LDDA 1DU6A 4L9NA 5K7HA 1Y1VJ 1RQ6A 2WAQA 4P96A 3GFMA 5BOXA 1TTYA 2ZO4A 3KEOA 2K9QA 2RGVA 2HVSA 1PUFA 2CU7A 2VONA 2XSJC 1TQMA 3W2AA 4M9SA 2VBWA 3HPGA 4QLCU 2COBA 1H89C 3CCVI 5JI6A 3RCOA 4L9VA 1QZYA 2BW3A 3NARA 5EEHA 4PUSA 4X6AJ 1KONA 2CFOA 3OYFA 1N75A 2MBFA 2EIMH 3Q3SA 1R58A 2FBKA 4D5FA 4XIDA 2EFQA 4UVBA 1VZ0A 5J8FA 3I71A 2XC7A 4RB1A 4UXNA 3JCUC 4IVNA 1VQ7I 4ZYHA 2LNBA 3K2ZA 4BXFA 5F27A 3E5UA 4RGUA 1R1UA 2JUCA 1Y6IA 1RNLA 1J59A 4XLAA 5E3MA 3PNTA 1WH7A 2QUFA 2CWEA 3J81Z 1VNDA 1X1AA 3HUGB 1G3WA 1P6RA 3LQQA 5HDNA 1DU0A 3HIFA 4ESFA 3WTUC 1RIOH 2UUZA 3O8GA 3QPSA 4IRIA 3KP3A 1BC8C 5AIQA 3S1NJ 1LPQA 4LG3A 4ON0A 3GTLJ 2PMZN 3K4MA 2GQQA 1RRJA 1HDDC 4I98B 1QBJA 3SDBA 2Z3YA 2ZNYA 4LG0B 3TDUC 4AC0A 3D5RC 2Z1DA 2DA3A 3DCFA 3ZQIA 4MTDA 2LFBA 1EF4A 3GX4X 2BYVE 2WC2A 1GVJA 4A69C 2CV0A 3MEXA 4QPQA 4AWXB 5J1RA 5FFXA 3I5UA 3BROA 2HXIA 2Z16A 3LSKA 5HNHA 1X1BA 5E3NA 1T38A 5DD4A 3OYHA 4YIFA 1VQ8I 5K7ZA 1YO5C 5FFZA 2E5ZA 1ZG3A 4EEFG 1G6NA 2KRHA 1ZQ3P 3V7CA 1IZ1A 2EZHA 3K4KA 4N0BA 2JA5J 3HL2A 3P5JA 1IDYA 1MZBA 2X9DA 2V6CA 4I01A 2VE9A 4XRSA 3HKZN 4M6XA 1USTA 4B8XA 2PEXA 4MIMA 4DJAA 2R7WA 2KLOA 4ZDOA 6PAXA 2PMUA 5D6FA 2HDWA 2L9SA 3G71I 2F5FA 4RDUA 3MKWB 2W7NA 4L18B 3GTPJ 3JSOA 1XCBA 4NQWA 1G3TA 2DT7B 1ZYRF 4E4HA 2DA7A 4D5CA 4BS9A 4A6EA 5D8KB 2HFHA 1I1GA 4WXHA 4RS8A 3W6VA 1T56A 2FD5A 4BDYA 3K0LA 2Y69H 2CFXA 3LMMA 4C30A 2VOOA 5L3EA 4ZZLA 3VODA 1OJLA 2Y48A 3DBHB 4MO7A 1ERDA 2P7VB 1IRFA 4P1WA 1B9MA 3G1OA 4J00A 3K1MA 3GTGJ 3BTLA 3CJQB 4DZPA 3BZCA 2DPUA 4ZYEA 2MZ4A 3GTMJ 2P5LC 1GLNA 4ETSA 1ZTRA 5TGTA 3KIOA 5J47A 1RR7A 2KKOA 2IP2A 3HEFA 4NC8A 1R7JA 1IN8A 3GLXA 4UUVA 3S2HJ 2Y2ZA 3KZZA 4R1HA 1HKQA 2FUG2 1HW5A 3OS0A 5GTIC 1Z9CA 4QSHA 3R6SA 5K5QA 5EG0A 2OV7A 2X4HA 5DV5A 2COMA 1YFHA 1J7KA 2LLKA 3K4BA 2PLYA 1Z1DA 1Z91A 5IOYA 1RKWA 1VF9A 1X1DA 1YIJI 5LGTA 1B8IA 4L5EA 2KDZA 1DQUA 1W5SA 2IS2A 3OYKA 3IH4A 4PZJA 1YRNA 5HODA 4G6DA 3OYMA 2M87A 2GIZA 2E2IJ 2A61A 1DGRM 2HTJA 2VJ5A 2XGXA 5HDKA 2EB7A 3Q9VA 5ERIA 1OYWA 4EV0A 3CCJI 4E7IA 4NHJA 2MH9A 4QIWN 5HOOA 2FNAA 4OMYA 5D5UB 3BJ6A 1TLHB 3QYFA 1XGSA 4N9IA 2YS9A 5K1YA 2DJNA 3UNGC 2WAFA 2OTJI 3J81K
chains in the Genus database with same CATH topology
5DD8A 5H6RA 1B1BA 1KU3A 2XV4S 4I7HA 4TV7A 5CVRA 5E17F 3LFKA 2K4BA 3RKYA 1IN5A 1TW3A 2IJLA 1Z7UA 3R0AA 1YIOA 2P5KA 1H9TA 3ZMDA 3L09A 4HZFA 3R4KA 4M6YA 1RZ4A 5E1XA 3I59A 1MJ9A 1RUOA 2IRFG 2RN7A 2FEZA 1GHCA 2HQRA 5ILSA 1YQAA 5DCFA 2EK5A 3RI4A 4OIQF 3M8EA 2XRNA 2IA2A 3TO7A 2HKOA 2KJCA 1ZREA 2FXAA 4WK8F 5AONA 4WCGA 5LGNA 2V9VA 4ESJA 3WGGA 2KIUA 4I0BA 5LEKA 5J6XA 1YS6A 2XIGA 2NAZA 1QPMA 4G6QA 3P9CA 4JBAA 3NRVA 5IT9Z 1D5VA 3C7JA 3M9AA 2PN6A 4XLPF 2DTRA 2ZKZA 1LEBA 2CW0F 3DFGA 5ILVA 1FZPB 2VBYA 2Z5UA 3KP6A 4HW0A 4BXUA 2ZFWA 3CUQA 2QQAA 1FWZA 4MNUA 2ESHA 2ACJA 4Y17A 2JSCA 4ENKA 5EEGA 3ECHA 3WODF 1F5TA 2Q8KA 3GWZA 5BQTA 2MA3A 4PCQA 1K6OA 4ZYDA 1XN7A 1FSHA 4PDKA 2FF4A 1SFUA 5D5WB 2ESNA 3BPVA 1KQ9A 1RI7A 1U5TA 2HS5A 3RKWA 2E1CA 3V7RA 2G7UA 3EDPA 4L9TA 4AVPA 2L4AA 3WE3A 5CVJA 2MLKA 1LDJA 5HLIA 2UWMA 1U6GA 3KP4A 3KCCA 2FRHA 4LJZF 4ENNA 5LEJA 1ZRFA 3HSFA 3K69A 2EV6A 2RKHA 1G3YA 3FXRA 5D6EA 2LDUA 3HOSA 4H0EA 2WWYA 1QGPA 3HSRA 3TDZC 4RGSA 2OA4A 4LGWA 3E6DA 1WWXA 1TW2A 2DBBA 4M9XA 5F6FA 4U88A 3MQ0A 3GUDA 2QBYB 2YX4A 2K27A 4E70A 5LHIA 1IN7A 1B6AA 1EH6A 2EFPA 4HAMA 5IT9K 3HRTA 4S05A 2HWVA 1FYMA 2RDPA 2X0LA 2L3DA 3DPTA 4HF0A 2OQGA 1CF7B 2ELHA 4IHSA 2LF7A 2K02A 4Q48A 3B73A 4KN7X 5L3BA 2GZWA 1YLFA 2YX7A 3D5LA 3KETA 3T5XA 1UCRA 1KGSA 5IT3A 2EWNA 2XAFA 2Y0MA 1T2KA 1XDUA 4EM2A 2STWA 3R0JA 2JTVA 2KIMA 1XGNA 3TQNA 4D0PA 3QPTA 5H6QA 5DUKA 3HRUA 1BI1A 4EM1A 2O03A 5E8IA 4MQVA 4Z2YA 2NNNA 1BBYA 1S3JA 4I0AA 5TRDA 1XCVA 3EQLF 3JAMZ 4UVAA 2F2EA 1BOAA 4HLYA 1IXCA 2K86A 4GYIA 3S2WA 1U5TC 2ZCWA 4IF4A 3B02A 1KU2A 3KLOA 4IRGA 1ZN2A 2YSRA 2V1UA 2RV8A 1LEAA 2EFWA 2FA5A 2A07F 3QAHA 4HOBA 3L9FA 3OV8A 2TDXA 1V3FA 4ZH4F 1EH8A 4LK0F 3T0YA 4A0XA 4HX8A 1BM9A 1SD7A 3I0TA 2ZMEA 3R60A 4KA4A 2QQ9A 1HBXG 1IN4A 5E1WA 5HVQC 3MFKA 5HLGA 3IWFA 5DUIA 1K78A 1J75A 2FBHA 2R7DA 2W24A 5H20A 2VBXA 3WTXC 4R8HA 1BI0A 3BZ6A 4KIBA 2DQRA 4G7HF 3JTGA 3BDDA 5LHGA 3L7WA 4I2OA 2QVOA 1IN6A 1HW1A 2CYYA 2O3FA 5E20A 1G4DA 3PQJA 1S7AA 2QENA 4EJVA 2GXGA 1U2WA 2O8XA 4M74A 4L0ZB 3F8NA 1GXQA 4CO8A 1WSUA 1AOYA 4G7ZF 1IAWA 3GVAA 5E8GA 1XD7A 1T98A 3H3UA 2L54A 2CSOA 2OZUA 2J5OA 4CHUA 3FZVA 3DPLC 3QRFF 5HLHA 5CVVA 3I4PA 5LBQA 4HBLA 4P9FA 2CO5A 4HF2A 1T6SA 2XAQA 4Y15A 1U78A 4P55A 2GA2A 1HSJA 3JAMK 2P7CB 1NHAA 2OZ6A 3E5XA 4RB0A 4S04A 1R5GA 5D4SA 5J8CA 2HDCA 2Z99A 3FM5A 4A0YA 4RAYA 2M45A 3IRQA 2JPCA 1LDKB 5LHHA 3MZHA 2R3SA 1W7PA 2FSWA 1DDNA 3RTRA 3DXJF 4CICA 1KU7A 1Z6TA 3ML6A 4KIFA 1FP2A 2EFNA 1ZRDA 2RNJA 1OKRA 2CGPA 3BY6A 3I54A 4LLGF 2UZKA 2PJPA 1FOKA 4O3MA 1FYKA 2VBZA 3K1PA 1K7AA 2GWRA 2FE3A 3ABUA 4GO1A 2YPRA 4EMSA 3L00A 3LQRA 5KVRA 3J80Z 3R61A 5D5VB 1EV7A 3BWGA 2V79A 1FYLA 3H3ZA 4A12A 1Z05A 3EYYA 5FGMA 3TOBA 1MDMA 3FMQA 1R1TA 1SAXA 3FM3A 4KN4X 3WTYC 1R5HA 5HDGA 4AIKA 3HRSA 2FBIA 2EA4A 1I27A 4HX7A 4HQMA 2AS5F 2GAUA 2HOEA 1XSVA 3RPUA 4LFUA 1YW7A 3BJOA 4OMZA 2DW4A 2XAHA 3CUOA 4GYGA 4KT5C 5DCMB 4UVCA 1HSTA 5BS6A 4ENMA 3SZPA 4EVIA 1IF1A 4EGYA 1PP7U 1HKSA 4OU0A 3BJAA 4U0VA 5DYMA 1XDSA 3QU3A 3WGHA 1F1ZA 4DQ2A 2NRAC 2VODA 3PQKA 3Q5FA 2KRFA 3F8CA 2O0YA 3TO9A 1E2XA 3ZMVA 2EFOA 4WX9A 2RVCA 3QU6A 3ROUA 1F9NA 3HYIA 3P9KA 3WTWC 1FLIA 4I02A 2MC3A 1O3SA 5CYVA 2QM3A 3COAC 2H6BA 4RGXA 1O3RA 1EH7A 1ZLKA 3ZMZA 5E18F 5D4RA 3LAPA 3RYPA 1ZG1A 4EJTA 1ZG5A 2QZ8A 2ZBKA 3M8FA 1PUEE 2HYFA 1SD6A 3KP2A 1W4MA 2K7LA 2OQRA 5JHUA 2XVCA 1AWCA 4AD9A 3WTZA 2BBYA 4LB5A 4MHGA 3GFLA 1I1SA 1IW7F 2A6EF 5JR3A 2YU3A 1BI2A 4AIJA 4BHPA 2MH2A 3HUGA 2Y75A 5TJJA 1W7PD 4IXAA 3J80K 3J7AO 2QWWA 4CYDA 2OU2A 5LRRA 2LKPA 2F5CA 1F4KA 4LG0A 3QP5A 3V8KA 1Z6RA 4UV9A 2O61A 2ADUA 2DT5A 1SMYF 1FNNA 1O7FA 3E6BA 2D45A 1HXDA 5FD6A 1BJAA 3V8JA 2DAOA 2L4MA 3FHZA 1WQ2A 1FX7A 1WI9A 1DPRA 4OIRF 4BQAA 3IKTA 5JVTA 3G73A 4M9ZA 2ISZA 1TQPA 1YW8A 5CVIA 1DP7P 2XKOA 2E7WA 2M5WA 2MD5A 1K79A 2H27A 1XSXA 3OOPA 2PFBA 1TQIA 2P4WA 2W25A 2HQNA 2JRTA 1R22A 4XRFA 4Y13A 1PDNC 2XASA 4KIGA 1R00A 3F72A 4OINF 4WWCA 3I64A 2VC0A 3F23A 2Z9OA 5CJ9A 3DKWA 3HTUA 4MQ9F 5JFRA 3QPHA 3C18A 5ICEA 4BHBA 1GXPA 3N4MA 3M7GA 5K5RA 3WTSC 4U0WA 1BIBA 4HV5A 2JZYA 4HYEA 4Q47A 4M71A 3HOTA 1R1VA 2BEOA 2FNPA 5L3GA 2HYGD 3RIRA 4UNOA 2FU4A 3ELKA 1FSEA 2W57A 3SZTA 1USSA 1KQ8A 3FMSA 2PQ8A 1WKMA 4KMFA 5DEQA 4NB5A 1XB4A 4OIOF 1MGTA 3FXUA 4U7BA 5ILUA 5ICGA 5L3DA 3E6MA 3T1BA 1ZARA 2V1XA 3KFWX 4OIPF 3GZ5A 2UXNA 4KICA 4LK1F 4IPAA 3BPXA 3HTSB 1D8JA 2A69F 3WG9A 1BIAA 4M73A 4ENJA 3GFJA 3VOEA 1P4WA 3CJNA 3CLOA 1FP1D 3P9IA 2ZNZA 3ZN0A 3GF2A 3IWZA 1LVAA 3IL2A 2HEOA 3SXYA 3ABTA 4KYWA 1R23A 2RC4A 2L01A 1JGSA 2L02A 3TKYA 4BH9A 2XUBA 1SMTA 3C3WA 1P4AA 2IW5A 2HR3A 1IUYA 2ZJ2A 4IHTA 1FBQA 1X3UA 4F7ZA 3EUHA 1B9NA 1LB2A 4UV8A 4MGRA 4MEYF 4CDGA 4XSZF 1SD4A 1YW9A 3CO7C 1W5TA 5ED4A 4WXCA 1B59A 3CO6C 1YTYA 4HF1A 2VT2A 4L5JA 2RQPA 3ULQB 3FWEA 1B4AA 4LMYA 1OPCA 4HX4A 5FB2A 3ECOA 3HSEA 1ONVA 2VOPA 3F22A 2A68F 1BC7C 4UHTA 2A3SA 2P6TA 4WXDA 1XSDA 3BP8A 4LLNA 1ON1A 4BNCA 3T8RA 5HS7A 3I53A 2EV0A 3I59B 3V4GA 3V8LA 1YG2A 4BHCA 3LA2A 2XAJA 1CGPA 4RB2C 1LNWA 2STTA 2KJBA 3FF5A 2UXXA 3ZN1A 5F1RA 1D8KA 1ZH5A 3ZMTA 5D8LB 2A5YB 4U0YA 3PFIA 3JW4A 2DO7A 2IA0A 4JK1X 2DI3A 4A5MA 1T39A 3F3XA 2XKPA 2D1HA 2G7HA 4GCVA 1BI3A 2DK8A 2DU9A 4WF2A 3RPQA 2CQKA 4BAYA 2IT0A 1J2XA 1OYYA 3FMRA 5BPDA 3HRMA 1ODDA 2QYOA 2R7FA 3IC7A 3MWMA 3FXQA 2Z33A 2QBYA 3WGIA 2NYXA 3LSTA 3DQVC 1QQIA 3HHHA 2DPDA 2O6GE 3KE2A 3RDIA 1TBXA 1O3QA 5F64A 1SFEA 4G94A 3L2CA 1CF7A 3W6KB 4N9HA 3CUQB 2M30A 3DEUA 2H09A 4G7OF 1YYVA 3EETA 3ZQ7A 3Q9SA 1J5YA 3O2PE 3QP6A 3MZYA 1FBSA 5BMZA 4RGRA 3U1DA 1I6XA 2W84A 5A2QZ 1DPUA 4O6JA 4Q4ZF 1U5TB 1STZA 3ZP5A 3FX3A 1J9IA 4FX0A 2VT3A 3CTAA 1L3LA 5LRSA 4GXOA 2BGCA 3WTTC 2V1DA 1ZGJA 2IVMA 4JQFA 1LJ9A 4OOIA 4YG2F 2NS0A 3RKXA 1ZRCA 1O7LA 4IRHA 2C6YA 2F5EA 1FPQA 3GW2A 3H92A 3WE2A 1QO0D 3JTHA 3NEUA 4YFXF 2LF8A 2J5PA 1UB9A 4RAZA 3VEPA 2FOKA 5L3FA 3F8MA 3IRRA 5FLXZ 1S29A 3SFZA 4KNYA 1FT9A 4PGGA 4MTEA 2PBIA 3NQOA 1S6LA 4L0YB 4LLLA 3LAJA 4EJUA 1ZHFA 1KU9A 2P6SA 4KFCA 3GZ6A 1P92A 5D5XB 1FC3A 3W6JB 3O3KA 2EV5A 4A2UA 1BN5A 2D2WA 1C0WA 3G3ZA 3HHGA 2Q2EA 1U3EM 3F6VA 1UHWA 4EGZA 2H94A 2OAZA 3AAFA 1HQCA 5HS8A 4PGHA 3EYIA 3GO5A 3ZMUA 4HA8A 2PI0A 4DNCA 1O3TA 3WU1B 2E7XA 4XBFA 2QLZA 1FY7A 3WTVC 3V7SA 1FBUA 2K4JA 5KK1A 4XLNF 4FHTA 5A2QK 3ERED 3LA7A 2VN2A 1XGMA 1H0MA 3E6CC 4ASNA 1VTNC 4EJOA 1KYWA 3F8BA 3QOPA 2HKXA 3F6OA 3TOAA 4GGGA 1KA8A 4QWQA 4YFNF 3WU0A 2XROA 2W85A 3RJPA 4KUMA 3RYRA 4ESBA 3P7NA 3TO6A 4ZZDA 2Q0OA 5CVUA 1ZGAA 4LB6B 2P8TA 2XHKA 2ZMEB 2AXLA 4RB3C 2PG4A 1P2FA 3VB2A 4U7DA 3N97A 4HDVA 1UFMA 4L9JA 2WV0A 5FLXK 5LGUA 1K78B 4XSXF 1TNTA 1TNSA 3MAJA 3ISPA 4FT8A 4FX4A 4HLXA 1OMIA 1REPC 1LQ1A 3LA3A 1ZLJA 2EJRA 3GYHX 2B0LA 1MD0A 2OD5A 4M72A 4MEXF 3JSPA 3SQNA 4YFKF 1JXSA 4EQQA 3DV8A 2OBPA 1PP8F 5K5OA 2PMHA 1MJAA 2BE5F 1WRJA 2VXZA 1A04A 2LSOA 1T0FA 1E17A 4EM0B 4P9UA 3DF8A 3O6BB 2CG4A 3IHUA 4B09A 1Y0UA 3KLNA 1XGOA 1V4RA 5AIPA 3REOA 1JHHA 5ICCA 1OYIA 2GA1A 2HTSA 1MJBA 4ZYGA 2DK5A 1UHMA 2HGCA 1ULYA 2D1VA 3K1NA 1SD5A 3F8FA 4HDUA 1S8NA 1I5ZA 2JT1A 3TGNA 5LLQA 1G3SA 2WTEA 5DCMA 2EA2A 1XMKA 2MLGA 1IRGA 4CXFA 1IXRC 5L3CA 1ON2A 1MKMA 3KP5A 1XMAA 2JPBA 2XAGA 2DQLA 5E1ZB 3E3VA 1KQ0A 1ZAOA 1W7PB 2DLLA 1L0OC 2IA1A 1S7OA 4BYYA 2DFIA 1D3YA 2FMLA 3D0SA 3KEQA 3VFZA 4A0ZA 3CDHA 5CLSA 3I58A 5HS9A 4HV6A 2VC1A 3U2RA 2HZTA 4CZZA 4O5VA 3K9TA 4R79A 1YS7A 2YR2A 5DDGA 4CGZA 3CUQC 5FO5A 2FMYA 1P4XA 3GEZA 3E97A 3KZYA 3ZPLA 2VE8A 2H6CA 2E1NA 1H9GA 1IXSB 1Q1HA 2ETHA 2BV6A 1KYZA 3ZMSA 1QNTA 2NNYA 4I09A 3KP7A 2P5VA 4K2EA 4A5NA 1U8RA 1MDMB 1HKTA 1J0RA 2ISYA 4IJAA 4KMUX 4P5OA 4G8XA 3BOQA 5ICFA 4KDPA 1R36A 3LWFA 3SHFA 2FQ3A 3U9GA 1SFXA 2ZXJA 2GXBA 2GIVA 3GFIA 3GXOA 3M1EA 3MCZA 4LD5A 4EJWA 2M1BA 2QQBA 4AIHA 2G9WA 3E5QA 5FD5A 1DUXC 1QZZA 3IKVA 1JE8A 1OR7A 3C1DA 1JHFA 2A6HF 1RUNA 2M8EA 1HW2A 3T8TA 4YIIA 2F5DA 1O57A 5BPIA 4HQEA 2KIFA 4A6DA 4Q5SF 2IPQX 4G9YA 4L5IA 3DP7A 3F21A 1LDDA 4L9NA 4P96A 3GFMA 5BOXA 1TTYA 2ZO4A 3KEOA 2RGVA 2VONA 1TQMA 4M9SA 2VBWA 4QLCU 5JI6A 4L9VA 1QZYA 5EEHA 2MBFA 1R58A 2FBKA 2EFQA 4UVBA 5J8FA 3I71A 4RB1A 4UXNA 4IVNA 4ZYHA 2LNBA 3K2ZA 3E5UA 4RGUA 1R1UA 1RNLA 1J59A 2QUFA 2CWEA 3J81Z 1G3WA 1P6RA 3LQQA 5HDNA 3HIFA 4ESFA 3WTUC 1RIOH 4IRIA 3KP3A 1BC8C 5AIQA 4ON0A 2GQQA 4I98B 1QBJA 2Z3YA 2ZNYA 4LG0B 3TDUC 4MTDA 3GX4X 2BYVE 2WC2A 1GVJA 3MEXA 4AWXB 5FFXA 3I5UA 3BROA 1T38A 5DD4A 4YIFA 1YO5C 5FFZA 1ZG3A 1G6NA 3V7CA 1IZ1A 4N0BA 1MZBA 2V6CA 4I01A 2VE9A 4M6XA 1USTA 4B8XA 2PEXA 6PAXA 2PMUA 5D6FA 2F5FA 4L18B 3JSOA 1XCBA 4NQWA 1G3TA 1ZYRF 4A6EA 5D8KB 2HFHA 1I1GA 4WXHA 4RS8A 3K0LA 2CFXA 2VOOA 5L3EA 4ZZLA 3VODA 2Y48A 2P7VB 1IRFA 1B9MA 3K1MA 2DPUA 4ZYEA 2P5LC 4ETSA 2KKOA 2IP2A 1R7JA 1IN8A 3GLXA 4UUVA 3KZZA 4R1HA 1HKQA 1HW5A 1Z9CA 3R6SA 5K5QA 2X4HA 5DV5A 2COMA 1YFHA 1J7KA 2PLYA 1Z1DA 1Z91A 5LGTA 1W5SA 4PZJA 4G6DA 2M87A 2A61A 2HTJA 2XGXA 5HDKA 2EB7A 3Q9VA 5ERIA 1OYWA 4EV0A 4NHJA 2MH9A 5HOOA 2FNAA 4OMYA 5D5UB 3BJ6A 1TLHB 1XGSA 4N9IA 5K1YA 3J81K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DD8 A;  5H6R A;  1B1B A;  1KU3 A;  2XV4 S;  4I7H A;  4TV7 A;  5CVR A;  5E17 F;  3LFK A;  2K4B A;  3RKY A;  1IN5 A;  1TW3 A;  2IJL A;  1Z7U A;  3R0A A;  1YIO A;  2P5K A;  1H9T A;  3ZMD A;  3L09 A;  4HZF A;  3R4K A;  4M6Y A;  1RZ4 A;  5E1X A;  3I59 A;  1MJ9 A;  1RUO A;  2IRF G;  2RN7 A;  2FEZ A;  1GHC A;  2HQR A;  5ILS A;  1YQA A;  5DCF A;  2EK5 A;  3RI4 A;  4OIQ F;  3M8E A;  2XRN A;  2IA2 A;  3TO7 A;  2HKO A;  2KJC A;  1ZRE A;  2FXA A;  4WK8 F;  5AON A;  4WCG A;  5LGN A;  2V9V A;  4ESJ A;  3WGG A;  2KIU A;  4I0B A;  5LEK A;  5J6X A;  1YS6 A;  2XIG A;  2NAZ A;  1QPM A;  4G6Q A;  3P9C A;  4JBA A;  3NRV A;  5IT9 Z;  1D5V A;  3C7J A;  3M9A A;  2PN6 A;  4XLP F;  2DTR A;  2ZKZ A;  1LEB A;  2CW0 F;  3DFG A;  5ILV A;  1FZP B;  2VBY A;  2Z5U A;  3KP6 A;  4HW0 A;  4BXU A;  2ZFW A;  3CUQ A;  2QQA A;  1FWZ A;  4MNU A;  2ESH A;  2ACJ A;  4Y17 A;  2JSC A;  4ENK A;  5EEG A;  3ECH A;  3WOD F;  1F5T A;  2Q8K A;  3GWZ A;  5BQT A;  2MA3 A;  4PCQ A;  1K6O A;  4ZYD A;  1XN7 A;  1FSH A;  4PDK A;  2FF4 A;  1SFU A;  5D5W B;  2ESN A;  3BPV A;  1KQ9 A;  1RI7 A;  1U5T A;  2HS5 A;  3RKW A;  2E1C A;  3V7R A;  2G7U A;  3EDP A;  4L9T A;  4AVP A;  2L4A A;  3WE3 A;  5CVJ A;  2MLK A;  1LDJ A;  5HLI A;  2UWM A;  1U6G A;  3KP4 A;  3KCC A;  2FRH A;  4LJZ F;  4ENN A;  5LEJ A;  1ZRF A;  3HSF A;  3K69 A;  2EV6 A;  2RKH A;  1G3Y A;  3FXR A;  5D6E A;  2LDU A;  3HOS A;  4H0E A;  2WWY A;  1QGP A;  3HSR A;  3TDZ C;  4RGS A;  2OA4 A;  4LGW A;  3E6D A;  1WWX A;  1TW2 A;  2DBB A;  4M9X A;  5F6F A;  4U88 A;  3MQ0 A;  3GUD A;  2QBY B;  2YX4 A;  2K27 A;  4E70 A;  5LHI A;  1IN7 A;  1B6A A;  1EH6 A;  2EFP A;  4HAM A;  5IT9 K;  3HRT A;  4S05 A;  2HWV A;  1FYM A;  2RDP A;  2X0L A;  2L3D A;  3DPT A;  4HF0 A;  2OQG A;  1CF7 B;  2ELH A;  4IHS A;  2LF7 A;  2K02 A;  4Q48 A;  3B73 A;  4KN7 X;  5L3B A;  2GZW A;  1YLF A;  2YX7 A;  3D5L A;  3KET A;  3T5X A;  1UCR A;  1KGS A;  5IT3 A;  2EWN A;  2XAF A;  2Y0M A;  1T2K A;  1XDU A;  4EM2 A;  2STW A;  3R0J A;  2JTV A;  2KIM A;  1XGN A;  3TQN A;  4D0P A;  3QPT A;  5H6Q A;  5DUK A;  3HRU A;  1BI1 A;  4EM1 A;  2O03 A;  5E8I A;  4MQV A;  4Z2Y A;  2NNN A;  1BBY A;  1S3J A;  4I0A A;  5TRD A;  1XCV A;  3EQL F;  3JAM Z;  4UVA A;  2F2E A;  1BOA A;  4HLY A;  1IXC A;  2K86 A;  4GYI A;  3S2W A;  1U5T C;  2ZCW A;  4IF4 A;  3B02 A;  1KU2 A;  3KLO A;  4IRG A;  1ZN2 A;  2YSR A;  2V1U A;  2RV8 A;  1LEA A;  2EFW A;  2FA5 A;  2A07 F;  3QAH A;  4HOB A;  3L9F A;  3OV8 A;  2TDX A;  1V3F A;  4ZH4 F;  1EH8 A;  4LK0 F;  3T0Y A;  4A0X A;  4HX8 A;  1BM9 A;  1SD7 A;  3I0T A;  2ZME A;  3R60 A;  4KA4 A;  2QQ9 A;  1HBX G;  1IN4 A;  5E1W A;  5HVQ C;  3MFK A;  5HLG A;  3IWF A;  5DUI A;  1K78 A;  1J75 A;  2FBH A;  2R7D A;  2W24 A;  5H20 A;  2VBX A;  3WTX C;  4R8H A;  1BI0 A;  3BZ6 A;  4KIB A;  2DQR A;  4G7H F;  3JTG A;  3BDD A;  5LHG A;  3L7W A;  4I2O A;  2QVO A;  1IN6 A;  1HW1 A;  2CYY A;  2O3F A;  5E20 A;  1G4D A;  3PQJ A;  1S7A A;  2QEN A;  4EJV A;  2GXG A;  1U2W A;  2O8X A;  4M74 A;  4L0Z B;  3F8N A;  1GXQ A;  4CO8 A;  1WSU A;  1AOY A;  4G7Z F;  1IAW A;  3GVA A;  5E8G A;  1XD7 A;  1T98 A;  3H3U A;  2L54 A;  2CSO A;  2OZU A;  2J5O A;  4CHU A;  3FZV A;  3DPL C;  3QRF F;  5HLH A;  5CVV A;  3I4P A;  5LBQ A;  4HBL A;  4P9F A;  2CO5 A;  4HF2 A;  1T6S A;  2XAQ A;  4Y15 A;  1U78 A;  4P55 A;  2GA2 A;  1HSJ A;  3JAM K;  2P7C B;  1NHA A;  2OZ6 A;  3E5X A;  4RB0 A;  4S04 A;  1R5G A;  5D4S A;  5J8C A;  2HDC A;  2Z99 A;  3FM5 A;  4A0Y A;  4RAY A;  2M45 A;  3IRQ A;  2JPC A;  1LDK B;  5LHH A;  3MZH A;  2R3S A;  1W7P A;  2FSW A;  1DDN A;  3RTR A;  3DXJ F;  4CIC A;  1KU7 A;  1Z6T A;  3ML6 A;  4KIF A;  1FP2 A;  2EFN A;  1ZRD A;  2RNJ A;  1OKR A;  2CGP A;  3BY6 A;  3I54 A;  4LLG F;  2UZK A;  2PJP A;  1FOK A;  4O3M A;  1FYK A;  2VBZ A;  3K1P A;  1K7A A;  2GWR A;  2FE3 A;  3ABU A;  4GO1 A;  2YPR A;  4EMS A;  3L00 A;  3LQR A;  5KVR A;  3J80 Z;  3R61 A;  5D5V B;  1EV7 A;  3BWG A;  2V79 A;  1FYL A;  3H3Z A;  4A12 A;  1Z05 A;  3EYY A;  5FGM A;  3TOB A;  1MDM A;  3FMQ A;  1R1T A;  1SAX A;  3FM3 A;  4KN4 X;  3WTY C;  1R5H A;  5HDG A;  4AIK A;  3HRS A;  2FBI A;  2EA4 A;  1I27 A;  4HX7 A;  4HQM A;  2AS5 F;  2GAU A;  2HOE A;  1XSV A;  3RPU A;  4LFU A;  1YW7 A;  3BJO A;  4OMZ A;  2DW4 A;  2XAH A;  3CUO A;  4GYG A;  4KT5 C;  5DCM B;  4UVC A;  1HST A;  5BS6 A;  4ENM A;  3SZP A;  4EVI A;  1IF1 A;  4EGY A;  1PP7 U;  1HKS A;  4OU0 A;  3BJA A;  4U0V A;  5DYM A;  1XDS A;  3QU3 A;  3WGH A;  1F1Z A;  4DQ2 A;  2NRA C;  2VOD A;  3PQK A;  3Q5F A;  2KRF A;  3F8C A;  2O0Y A;  3TO9 A;  1E2X A;  3ZMV A;  2EFO A;  4WX9 A;  2RVC A;  3QU6 A;  3ROU A;  1F9N A;  3HYI A;  3P9K A;  3WTW C;  1FLI A;  4I02 A;  2MC3 A;  1O3S A;  5CYV A;  2QM3 A;  3COA C;  2H6B A;  4RGX A;  1O3R A;  1EH7 A;  1ZLK A;  3ZMZ A;  5E18 F;  5D4R A;  3LAP A;  3RYP A;  1ZG1 A;  4EJT A;  1ZG5 A;  2QZ8 A;  2ZBK A;  3M8F A;  1PUE E;  2HYF A;  1SD6 A;  3KP2 A;  1W4M A;  2K7L A;  2OQR A;  5JHU A;  2XVC A;  1AWC A;  4AD9 A;  3WTZ A;  2BBY A;  4LB5 A;  4MHG A;  3GFL A;  1I1S A;  1IW7 F;  2A6E F;  5JR3 A;  2YU3 A;  1BI2 A;  4AIJ A;  4BHP A;  2MH2 A;  3HUG A;  2Y75 A;  5TJJ A;  1W7P D;  4IXA A;  3J80 K;  3J7A O;  2QWW A;  4CYD A;  2OU2 A;  5LRR A;  2LKP A;  2F5C A;  1F4K A;  4LG0 A;  3QP5 A;  3V8K A;  1Z6R A;  4UV9 A;  2O61 A;  2ADU A;  2DT5 A;  1SMY F;  1FNN A;  1O7F A;  3E6B A;  2D45 A;  1HXD A;  5FD6 A;  1BJA A;  3V8J A;  2DAO A;  2L4M A;  3FHZ A;  1WQ2 A;  1FX7 A;  1WI9 A;  1DPR A;  4OIR F;  4BQA A;  3IKT A;  5JVT A;  3G73 A;  4M9Z A;  2ISZ A;  1TQP A;  1YW8 A;  5CVI A;  1DP7 P;  2XKO A;  2E7W A;  2M5W A;  2MD5 A;  1K79 A;  2H27 A;  1XSX A;  3OOP A;  2PFB A;  1TQI A;  2P4W A;  2W25 A;  2HQN A;  2JRT A;  1R22 A;  4XRF A;  4Y13 A;  1PDN C;  2XAS A;  4KIG A;  1R00 A;  3F72 A;  4OIN F;  4WWC A;  3I64 A;  2VC0 A;  3F23 A;  2Z9O A;  5CJ9 A;  3DKW A;  3HTU A;  4MQ9 F;  5JFR A;  3QPH A;  3C18 A;  5ICE A;  4BHB A;  1GXP A;  3N4M A;  3M7G A;  5K5R A;  3WTS C;  4U0W A;  1BIB A;  4HV5 A;  2JZY A;  4HYE A;  4Q47 A;  4M71 A;  3HOT A;  1R1V A;  2BEO A;  2FNP A;  5L3G A;  2HYG D;  3RIR A;  4UNO A;  2FU4 A;  3ELK A;  1FSE A;  2W57 A;  3SZT A;  1USS A;  1KQ8 A;  3FMS A;  2PQ8 A;  1WKM A;  4KMF A;  5DEQ A;  4NB5 A;  1XB4 A;  4OIO F;  1MGT A;  3FXU A;  4U7B A;  5ILU A;  5ICG A;  5L3D A;  3E6M A;  3T1B A;  1ZAR A;  2V1X A;  3KFW X;  4OIP F;  3GZ5 A;  2UXN A;  4KIC A;  4LK1 F;  4IPA A;  3BPX A;  3HTS B;  1D8J A;  2A69 F;  3WG9 A;  1BIA A;  4M73 A;  4ENJ A;  3GFJ A;  3VOE A;  1P4W A;  3CJN A;  3CLO A;  1FP1 D;  3P9I A;  2ZNZ A;  3ZN0 A;  3GF2 A;  3IWZ A;  1LVA A;  3IL2 A;  2HEO A;  3SXY A;  3ABT A;  4KYW A;  1R23 A;  2RC4 A;  2L01 A;  1JGS A;  2L02 A;  3TKY A;  4BH9 A;  2XUB A;  1SMT A;  3C3W A;  1P4A A;  2IW5 A;  2HR3 A;  1IUY A;  2ZJ2 A;  4IHT A;  1FBQ A;  1X3U A;  4F7Z A;  3EUH A;  1B9N A;  1LB2 A;  4UV8 A;  4MGR A;  4MEY F;  4CDG A;  4XSZ F;  1SD4 A;  1YW9 A;  3CO7 C;  1W5T A;  5ED4 A;  4WXC A;  1B59 A;  3CO6 C;  1YTY A;  4HF1 A;  2VT2 A;  4L5J A;  2RQP A;  3ULQ B;  3FWE A;  1B4A A;  4LMY A;  1OPC A;  4HX4 A;  5FB2 A;  3ECO A;  3HSE A;  1ONV A;  2VOP A;  3F22 A;  2A68 F;  1BC7 C;  4UHT A;  2A3S A;  2P6T A;  4WXD A;  1XSD A;  3BP8 A;  4LLN A;  1ON1 A;  4BNC A;  3T8R A;  5HS7 A;  3I53 A;  2EV0 A;  3I59 B;  3V4G A;  3V8L A;  1YG2 A;  4BHC A;  3LA2 A;  2XAJ A;  1CGP A;  4RB2 C;  1LNW A;  2STT A;  2KJB A;  3FF5 A;  2UXX A;  3ZN1 A;  5F1R A;  1D8K A;  1ZH5 A;  3ZMT A;  5D8L B;  2A5Y B;  4U0Y A;  3PFI A;  3JW4 A;  2DO7 A;  2IA0 A;  4JK1 X;  2DI3 A;  4A5M A;  1T39 A;  3F3X A;  2XKP A;  2D1H A;  2G7H A;  4GCV A;  1BI3 A;  2DK8 A;  2DU9 A;  4WF2 A;  3RPQ A;  2CQK A;  4BAY A;  2IT0 A;  1J2X A;  1OYY A;  3FMR A;  5BPD A;  3HRM A;  1ODD A;  2QYO A;  2R7F A;  3IC7 A;  3MWM A;  3FXQ A;  2Z33 A;  2QBY A;  3WGI A;  2NYX A;  3LST A;  3DQV C;  1QQI A;  3HHH A;  2DPD A;  2O6G E;  3KE2 A;  3RDI A;  1TBX A;  1O3Q A;  5F64 A;  1SFE A;  4G94 A;  3L2C A;  1CF7 A;  3W6K B;  4N9H A;  3CUQ B;  2M30 A;  3DEU A;  2H09 A;  4G7O F;  1YYV A;  3EET A;  3ZQ7 A;  3Q9S A;  1J5Y A;  3O2P E;  3QP6 A;  3MZY A;  1FBS A;  5BMZ A;  4RGR A;  3U1D A;  1I6X A;  2W84 A;  5A2Q Z;  1DPU A;  4O6J A;  4Q4Z F;  1U5T B;  1STZ A;  3ZP5 A;  3FX3 A;  1J9I A;  4FX0 A;  2VT3 A;  3CTA A;  1L3L A;  5LRS A;  4GXO A;  2BGC A;  3WTT C;  2V1D A;  1ZGJ A;  2IVM A;  4JQF A;  1LJ9 A;  4OOI A;  4YG2 F;  2NS0 A;  3RKX A;  1ZRC A;  1O7L A;  4IRH A;  2C6Y A;  2F5E A;  1FPQ A;  3GW2 A;  3H92 A;  3WE2 A;  1QO0 D;  3JTH A;  3NEU A;  4YFX F;  2LF8 A;  2J5P A;  1UB9 A;  4RAZ A;  3VEP A;  2FOK A;  5L3F A;  3F8M A;  3IRR A;  5FLX Z;  1S29 A;  3SFZ A;  4KNY A;  1FT9 A;  4PGG A;  4MTE A;  2PBI A;  3NQO A;  1S6L A;  4L0Y B;  4LLL A;  3LAJ A;  4EJU A;  1ZHF A;  1KU9 A;  2P6S A;  4KFC A;  3GZ6 A;  1P92 A;  5D5X B;  1FC3 A;  3W6J B;  3O3K A;  2EV5 A;  4A2U A;  1BN5 A;  2D2W A;  1C0W A;  3G3Z A;  3HHG A;  2Q2E A;  1U3E M;  3F6V A;  1UHW A;  4EGZ A;  2H94 A;  2OAZ A;  3AAF A;  1HQC A;  5HS8 A;  4PGH A;  3EYI A;  3GO5 A;  3ZMU A;  4HA8 A;  2PI0 A;  4DNC A;  1O3T A;  3WU1 B;  2E7X A;  4XBF A;  2QLZ A;  1FY7 A;  3WTV C;  3V7S A;  1FBU A;  2K4J A;  5KK1 A;  4XLN F;  4FHT A;  5A2Q K;  3ERE D;  3LA7 A;  2VN2 A;  1XGM A;  1H0M A;  3E6C C;  4ASN A;  1VTN C;  4EJO A;  1KYW A;  3F8B A;  3QOP A;  2HKX A;  3F6O A;  3TOA A;  4GGG A;  1KA8 A;  4QWQ A;  4YFN F;  3WU0 A;  2XRO A;  2W85 A;  3RJP A;  4KUM A;  3RYR A;  4ESB A;  3P7N A;  3TO6 A;  4ZZD A;  2Q0O A;  5CVU A;  1ZGA A;  4LB6 B;  2P8T A;  2XHK A;  2ZME B;  2AXL A;  4RB3 C;  2PG4 A;  1P2F A;  3VB2 A;  4U7D A;  3N97 A;  4HDV A;  1UFM A;  4L9J A;  2WV0 A;  5FLX K;  5LGU A;  1K78 B;  4XSX F;  1TNT A;  1TNS A;  3MAJ A;  3ISP A;  4FT8 A;  4FX4 A;  4HLX A;  1OMI A;  1REP C;  1LQ1 A;  3LA3 A;  1ZLJ A;  2EJR A;  3GYH X;  2B0L A;  1MD0 A;  2OD5 A;  4M72 A;  4MEX F;  3JSP A;  3SQN A;  4YFK F;  1JXS A;  4EQQ A;  3DV8 A;  2OBP A;  1PP8 F;  5K5O A;  2PMH A;  1MJA A;  2BE5 F;  1WRJ A;  2VXZ A;  1A04 A;  2LSO A;  1T0F A;  1E17 A;  4EM0 B;  4P9U A;  3DF8 A;  3O6B B;  2CG4 A;  3IHU A;  4B09 A;  1Y0U A;  3KLN A;  1XGO A;  1V4R A;  5AIP A;  3REO A;  1JHH A;  5ICC A;  1OYI A;  2GA1 A;  2HTS A;  1MJB A;  4ZYG A;  2DK5 A;  1UHM A;  2HGC A;  1ULY A;  2D1V A;  3K1N A;  1SD5 A;  3F8F A;  4HDU A;  1S8N A;  1I5Z A;  2JT1 A;  3TGN A;  5LLQ A;  1G3S A;  2WTE A;  5DCM A;  2EA2 A;  1XMK A;  2MLG A;  1IRG A;  4CXF A;  1IXR C;  5L3C A;  1ON2 A;  1MKM A;  3KP5 A;  1XMA A;  2JPB A;  2XAG A;  2DQL A;  5E1Z B;  3E3V A;  1KQ0 A;  1ZAO A;  1W7P B;  2DLL A;  1L0O C;  2IA1 A;  1S7O A;  4BYY A;  2DFI A;  1D3Y A;  2FML A;  3D0S A;  3KEQ A;  3VFZ A;  4A0Z A;  3CDH A;  5CLS A;  3I58 A;  5HS9 A;  4HV6 A;  2VC1 A;  3U2R A;  2HZT A;  4CZZ A;  4O5V A;  3K9T A;  4R79 A;  1YS7 A;  2YR2 A;  5DDG A;  4CGZ A;  3CUQ C;  5FO5 A;  2FMY A;  1P4X A;  3GEZ A;  3E97 A;  3KZY A;  3ZPL A;  2VE8 A;  2H6C A;  2E1N A;  1H9G A;  1IXS B;  1Q1H A;  2ETH A;  2BV6 A;  1KYZ A;  3ZMS A;  1QNT A;  2NNY A;  4I09 A;  3KP7 A;  2P5V A;  4K2E A;  4A5N A;  1U8R A;  1MDM B;  1HKT A;  1J0R A;  2ISY A;  4IJA A;  4KMU X;  4P5O A;  4G8X A;  3BOQ A;  5ICF A;  4KDP A;  1R36 A;  3LWF A;  3SHF A;  2FQ3 A;  3U9G A;  1SFX A;  2ZXJ A;  2GXB A;  2GIV A;  3GFI A;  3GXO A;  3M1E A;  3MCZ A;  4LD5 A;  4EJW A;  2M1B A;  2QQB A;  4AIH A;  2G9W A;  3E5Q A;  5FD5 A;  1DUX C;  1QZZ A;  3IKV A;  1JE8 A;  1OR7 A;  3C1D A;  1JHF A;  2A6H F;  1RUN A;  2M8E A;  1HW2 A;  3T8T A;  4YII A;  2F5D A;  1O57 A;  5BPI A;  4HQE A;  2KIF A;  4A6D A;  4Q5S F;  2IPQ X;  4G9Y A;  4L5I A;  3DP7 A;  3F21 A;  1LDD A;  4L9N A;  4P96 A;  3GFM A;  5BOX A;  1TTY A;  2ZO4 A;  3KEO A;  2RGV A;  2VON A;  1TQM A;  4M9S A;  2VBW A;  4QLC U;  5JI6 A;  4L9V A;  1QZY A;  5EEH A;  2MBF A;  1R58 A;  2FBK A;  2EFQ A;  4UVB A;  5J8F A;  3I71 A;  4RB1 A;  4UXN A;  4IVN A;  4ZYH A;  2LNB A;  3K2Z A;  3E5U A;  4RGU A;  1R1U A;  1RNL A;  1J59 A;  2QUF A;  2CWE A;  3J81 Z;  1G3W A;  1P6R A;  3LQQ A;  5HDN A;  3HIF A;  4ESF A;  3WTU C;  1RIO H;  4IRI A;  3KP3 A;  1BC8 C;  5AIQ A;  4ON0 A;  2GQQ A;  4I98 B;  1QBJ A;  2Z3Y A;  2ZNY A;  4LG0 B;  3TDU C;  4MTD A;  3GX4 X;  2BYV E;  2WC2 A;  1GVJ A;  3MEX A;  4AWX B;  5FFX A;  3I5U A;  3BRO A;  1T38 A;  5DD4 A;  4YIF A;  1YO5 C;  5FFZ A;  1ZG3 A;  1G6N A;  3V7C A;  1IZ1 A;  4N0B A;  1MZB A;  2V6C A;  4I01 A;  2VE9 A;  4M6X A;  1UST A;  4B8X A;  2PEX A;  6PAX A;  2PMU A;  5D6F A;  2F5F A;  4L18 B;  3JSO A;  1XCB A;  4NQW A;  1G3T A;  1ZYR F;  4A6E A;  5D8K B;  2HFH A;  1I1G A;  4WXH A;  4RS8 A;  3K0L A;  2CFX A;  2VOO A;  5L3E A;  4ZZL A;  3VOD A;  2Y48 A;  2P7V B;  1IRF A;  1B9M A;  3K1M A;  2DPU A;  4ZYE A;  2P5L C;  4ETS A;  2KKO A;  2IP2 A;  1R7J A;  1IN8 A;  3GLX A;  4UUV A;  3KZZ A;  4R1H A;  1HKQ A;  1HW5 A;  1Z9C A;  3R6S A;  5K5Q A;  2X4H A;  5DV5 A;  2COM A;  1YFH A;  1J7K A;  2PLY A;  1Z1D A;  1Z91 A;  5LGT A;  1W5S A;  4PZJ A;  4G6D A;  2M87 A;  2A61 A;  2HTJ A;  2XGX A;  5HDK A;  2EB7 A;  3Q9V A;  5ERI A;  1OYW A;  4EV0 A;  4NHJ A;  2MH9 A;  5HOO A;  2FNA A;  4OMY A;  5D5U B;  3BJ6 A;  1TLH B;  1XGS A;  4N9I A;  5K1Y A;  3J81 K; 
#chains in the Genus database with same CATH topology
 1Z21 A;  2MGQ A;  5DD8 A;  1VQ5 I;  1VQK I;  5H6R A;  2I8D A;  2XGD A;  1B1B A;  3FHN A;  3L2W A;  3OSG A;  1KU3 A;  2XV4 S;  4I7H A;  4TV7 A;  5CVR A;  5E17 F;  1JJ8 C;  3LFK A;  3MD2 A;  1WJD A;  2L9R A;  4NC6 A;  2K4B A;  3LL7 A;  3RKY A;  1IN5 A;  1TW3 A;  2IJL A;  2OJE D;  1Z7U A;  2AQE A;  3R0A A;  2VKH A;  1YIO A;  2P5K A;  1H9T A;  3ZMD A;  3L09 A;  2CUZ A;  3R4K A;  4HZF A;  1RKT A;  1RZ4 A;  1TT5 B;  4M6Y A;  3I59 A;  5E1X A;  3ZGK A;  4CA0 A;  2JQ7 A;  1MJ9 A;  1WZ2 A;  1RUO A;  2IRF G;  4AUX A;  1XC5 A;  1A6Q A;  2RN7 A;  3VPR A;  2FEZ A;  2NVT J;  1GHC A;  3ABK H;  1H88 C;  2HQR A;  2OCC H;  5ILS A;  1YQA A;  5DCF A;  2EK5 A;  1Y8R B;  5DTD A;  3RI4 A;  4KJZ A;  4OIQ F;  4FE7 A;  3M8E A;  2XRN A;  1W0U A;  1G8X A;  2IA2 A;  3N05 A;  3H9G A;  2GOM A;  2IGK A;  1KZH A;  3TO7 A;  2HKO A;  3G1M A;  5C3E J;  2DA1 A;  3CP2 A;  2WB1 A;  3JAM R;  3JRE A;  1WH5 A;  2KJC A;  1SAN A;  2LY2 A;  1ZRE A;  2FXA A;  4WK8 F;  2X1C A;  1U0J A;  3KZI C;  1D1A A;  5AON A;  3M4O J;  5EYR A;  4WCG A;  2OTL I;  4C3H J;  5LGN A;  2V9V A;  4ESJ A;  2O7O A;  3WGG A;  2OF7 A;  3LFU A;  2KIU A;  4I0B A;  5LEK A;  2DT6 A;  2AHQ A;  5J6X A;  1YS6 A;  2XIG A;  2NAZ A;  1QPM A;  1U9N A;  3J7Z I;  1K4S A;  4G6Q A;  3P9C A;  2DOE A;  2VJI A;  1Y0N A;  5HNF A;  4JBA A;  3NRV A;  5IT9 Z;  1D5V A;  4E7J A;  3I4M J;  3C7J A;  3J7A Y;  1O4X A;  3S2D J;  1V55 H;  2LH9 A;  4BL0 B;  3M9A A;  2PN6 A;  4XLP F;  2DTR A;  2ZKZ A;  1LEB A;  2CW0 F;  3LSG A;  3VSL A;  3DFG A;  5ILV A;  1A35 A;  2CMP A;  1P7I A;  1FZP B;  2VBY A;  4HST A;  2Z5U A;  1JKP C;  3KP6 A;  4HW0 A;  4DW6 A;  4BXU A;  2CRG A;  2ZFW A;  3CUQ A;  2QQA A;  3AFH A;  4FQG A;  1FWZ A;  1ZEL A;  4MNU A;  4CYC A;  1LVK A;  1MBG A;  2ESH A;  2ACJ A;  4Y17 A;  2JSC A;  2ZXH A;  2QEX I;  1JUM A;  4ENK A;  2M9H A;  5EEG A;  3ECH A;  4RM3 A;  3WOD F;  1F5T A;  2Q8K A;  3GWZ A;  1MMS A;  5BQT A;  2MA3 A;  4PCQ A;  1K6O A;  4ZYD A;  1XN7 A;  1FSH A;  3L2V A;  4PDK A;  4DOZ A;  2O8K A;  2FF4 A;  1SFU A;  2M4K A;  5D5W B;  2ESN A;  3BPV A;  5DM6 F;  4XLF A;  2TRT A;  3ZRG A;  1KQ9 A;  1RI7 A;  2HZD A;  1U5T A;  1A36 A;  4RM2 A;  2HS5 A;  3RKW A;  1Z3Y A;  2E1C A;  4BJT A;  1SAU A;  3OS1 A;  3V7R A;  2G7U A;  3EDP A;  4L9T A;  1IJW C;  2DJI A;  2R0Q C;  4OWR B;  4CCJ A;  1Y39 A;  4AVP A;  1UJ8 A;  2L4A A;  3BTI A;  3WE3 A;  1X4P A;  5CVJ A;  1RES A;  2DOA A;  2MLK A;  1GT0 C;  2LBF B;  1LDJ A;  3NWS A;  2CV1 A;  2FX0 A;  5HLI A;  2UWM A;  4M3D A;  3WHC A;  1U6G A;  2WV1 A;  3KP4 A;  3KCC A;  3U21 A;  3SDG A;  3GBG A;  2FRH A;  2K40 A;  2M0C A;  3FXM A;  4Y33 A;  3GTO J;  4LJZ F;  2IS4 A;  4ENN A;  1N25 A;  2QF7 A;  2CW8 A;  4IZZ A;  5LEJ A;  1ZRF A;  3HSF A;  2D5V A;  3QYE A;  3J81 R;  2NOG A;  3K69 A;  3RQI A;  2EV6 A;  1ETK A;  1V54 H;  4AYB A;  2RKH A;  1G3Y A;  2VJJ A;  1BOB A;  3FXR A;  5D6E A;  3BT9 A;  2X1E A;  3MKY B;  2LDU A;  3HOS A;  3OYN A;  4H0E A;  4V2G A;  2WWY A;  1QGP A;  3HSR A;  4C2U A;  2KIQ A;  3TDZ C;  2DMP A;  4RGS A;  2OA4 A;  4LGW A;  4LOC A;  2QA4 I;  4F91 B;  3E6D A;  1WWX A;  1D1C A;  3OYD A;  2ECB A;  1ZGW A;  1TW2 A;  1A31 A;  1BR2 A;  1MMA A;  2R5Y B;  3FIW A;  2DBB A;  2BXZ A;  4M9X A;  2MC4 A;  5F6F A;  4U88 A;  3MQ0 A;  2R7X A;  2VI6 A;  1EA3 A;  2IEK A;  3HC7 A;  3GUD A;  2QBY B;  2YX4 A;  2K27 A;  5JLX A;  2JWT A;  1X58 A;  2I5U A;  4E70 A;  5LHI A;  5IYB J;  1IN7 A;  1B6A A;  1EH6 A;  4C2T A;  2EFP A;  3IP4 B;  4HAM A;  5IT9 K;  3OS2 A;  3SFI A;  3HRT A;  4S05 A;  2HWV A;  2F48 A;  2EZL A;  4BU2 A;  1FYM A;  2RDP A;  3OYE A;  2X0L A;  4NUB A;  4B3A A;  3OSF A;  2L3D A;  2ZB9 A;  3DPT A;  4B43 A;  4HF0 A;  3HJE A;  2IGN A;  2X1D A;  1VQ4 I;  3ZQF A;  2OQG A;  4I99 C;  5JLW A;  2DMQ A;  1CF7 B;  2ELH A;  4CH7 A;  4IHS A;  2LF7 A;  2EH3 A;  2K02 A;  5IOZ A;  4Q48 A;  3B73 A;  3QOD A;  4KN7 X;  1I3A A;  5L3B A;  2GZW A;  1YLF A;  2YX7 A;  3D5L A;  4M3E A;  3T5X A;  3KET A;  1UCR A;  1KGS A;  1S9H A;  2KDO A;  5IT3 A;  2EWN A;  3JRG A;  1XPX A;  1AKH B;  5J4V A;  2XAF A;  2Y0M A;  1T2K A;  1IV8 A;  1XDU A;  4EM2 A;  1JKQ C;  2STW A;  3R0J A;  1OFC X;  2JTV A;  4X1E A;  2KIM A;  3PIO F;  3GME A;  2K5C A;  1XGN A;  2X51 A;  3TQN A;  4W97 A;  5K7F A;  4D0P A;  3QPT A;  5H6Q A;  3IAS 2;  1K6Y A;  5DUK A;  3HRU A;  1VFC A;  1BI1 A;  4EM1 A;  2JA8 J;  2O03 A;  3EUK L;  5E8I A;  2KL4 A;  3J80 R;  4CUG A;  3M8J A;  1TWA J;  4MQV A;  4Z2Y A;  5M5X J;  2HOS A;  2NNN A;  1A6I A;  1BBY A;  1S3J A;  1SVL A;  4I0A A;  3HB9 A;  3Q0W A;  2O5R A;  5TRD A;  1XCV A;  3EQL F;  1LUJ B;  3JAM Z;  5LD2 C;  2QSH X;  4UVA A;  3RKQ A;  2F2E A;  3AG1 H;  4ZC3 A;  1BOA A;  5H2F C;  1IXC A;  1LFB A;  3CMA I;  4HLY A;  5FLM J;  2K86 A;  3FXJ A;  3S3M A;  4GYI A;  1X2M A;  3DKX A;  3S2W A;  1U5T C;  2ZCW A;  3VYU B;  2VQC A;  4IF4 A;  3B02 A;  3GLL A;  3MKL A;  4FET A;  1KU2 A;  3X2Q H;  2NS7 A;  2W82 A;  2E5N A;  3GTQ J;  3KLO A;  4GRI A;  2VLA A;  2CQX A;  1LFP A;  1ZN2 A;  3Q0U A;  4IRG A;  3CZ6 A;  2YSR A;  4G12 A;  2V1U A;  3HG9 A;  2LRD A;  2RV8 A;  1LEA A;  3BTC A;  2EFW A;  4KT6 A;  1OQY A;  2FA5 A;  4D9J A;  2A07 F;  2IGO A;  2NVX J;  3QAH A;  4HOB A;  3S93 A;  4IOC F;  3L9F A;  2HQ5 A;  2ZXW H;  4UUS B;  3OV8 A;  2TDX A;  2B7E A;  4E6K G;  1V3F A;  4ZH4 F;  2PJR A;  4II3 A;  1EH8 A;  2R7Z J;  4LK0 F;  5EGO A;  3T0Y A;  3VWB A;  4HX8 A;  3WHB A;  4A0X A;  1BM9 A;  1SD7 A;  4QPO A;  3I0T A;  2ZME A;  4PSX A;  1R71 A;  3BC8 A;  4BY1 J;  2VUM J;  3R60 A;  4KA4 A;  1JKR C;  4PJ0 C;  1CQT A;  2QQ9 A;  1GV2 A;  1XMX A;  1BA5 A;  3VSK A;  1HBX G;  1IN4 A;  3CME I;  5E1W A;  5HVQ C;  3MFK A;  3BG3 A;  4RAF A;  5IY5 H;  3OR2 C;  5HLG A;  3IWF A;  5DUI A;  1K78 A;  3ZQG A;  1J75 A;  2FBH A;  2R7D A;  2NVU B;  2W24 A;  3U1K A;  1VQ9 I;  5H20 A;  2VBX A;  3WTX C;  5J1U A;  4R8H A;  1BI0 A;  1BW5 A;  3BZ6 A;  4KIB A;  2DQR A;  4G7H F;  1FTT A;  4F92 B;  1T33 A;  3JTG A;  4A3F J;  3BDD A;  1FOW A;  4EAT A;  1W0T A;  1S5L C;  5LHG A;  3L7W A;  4I2O A;  2EIJ H;  2QVO A;  3S1R J;  1IN6 A;  4Y7N J;  1HW1 A;  2CYY A;  3A2K A;  2O3F A;  2Q2E B;  3TBI A;  3ZQH A;  5F1J A;  5E20 A;  3CCM I;  5CPR B;  1YHQ I;  3BR6 A;  3DPU A;  3OWT A;  1G4D A;  1ETW A;  1I3Q J;  3PQJ A;  3AG4 H;  3KYL A;  4I6Z A;  1S7A A;  2QEN A;  4EJV A;  2GXG A;  1WJF A;  3MKZ A;  1VI0 A;  2LP0 A;  3D5S C;  1U2W A;  3A4C A;  3CJR B;  3QQA A;  2O8X A;  4M74 A;  3F9K A;  4L0Z B;  1IV6 A;  3F8N A;  2ELJ A;  4JOM A;  2KMU A;  1GXQ A;  2N8G A;  4CO8 A;  2V9P A;  2EQR A;  2HVR A;  1WSU A;  1AOY A;  4V2F A;  5E3L A;  2LD5 A;  1QHG A;  4G7Z F;  4HPQ A;  1IAW A;  4IQ4 A;  4A3D J;  3GVA A;  2WAE A;  5E8G A;  4Y3O A;  1XD7 A;  1T98 A;  3H3U A;  3OYG A;  1B72 B;  5IT9 R;  4BY7 J;  2L54 A;  2CSO A;  2OZU A;  1LE8 B;  2J5O A;  1WFX A;  1SC7 A;  4CHU A;  3FZV A;  4IOA F;  3HOY J;  3DPL C;  4YEJ A;  1HF0 A;  3QRF F;  4G6T B;  5HLH A;  5CVV A;  2AO9 A;  2DA5 A;  2LC2 A;  3G1L A;  3I4P A;  5LBQ A;  4HBL A;  2CO5 A;  4P9F A;  4HF2 A;  1T6S A;  2XAQ A;  4Y15 A;  3W3C A;  1OLT A;  4PFP A;  1U78 A;  3CES A;  4P55 A;  2QCO A;  4XLE A;  2GA2 A;  1E3H A;  1HSJ A;  1D0X A;  3JAM K;  2P7C B;  4H4K C;  1JT0 A;  4A93 J;  1HOM A;  1NHA A;  5GPC A;  2OZ6 A;  3E5X A;  2JA2 A;  4RB0 A;  2R7V A;  4S04 A;  1IRZ A;  1TWC J;  2FJ1 A;  4HNT A;  1W5C C;  1R5G A;  5D4S A;  2HVQ A;  4XRM A;  4BEH A;  2ID3 A;  2QSG X;  3CDI A;  5J8C A;  4RBO A;  2HDC A;  5F08 A;  2H1K A;  4HNU A;  1MND A;  1WJE A;  2Z99 A;  3FM5 A;  1YX5 A;  2CS3 A;  2EPF A;  4A0Y A;  2IAI A;  4RAY A;  2M45 A;  2XPW A;  3IRQ A;  2JPC A;  3JR9 A;  2MG4 A;  3H5N A;  1LDK B;  5LHH A;  3AG3 H;  1XS9 A;  1UAA A;  4A3J J;  3MZH A;  2R3S A;  3MZ8 A;  1W7P A;  2FSW A;  1DDN A;  2K3P A;  3ABL H;  3RTR A;  3DXJ F;  2F5V A;  1NG6 A;  4CIC A;  4XQF A;  5DM7 F;  3A52 A;  3RQ4 A;  1KU7 A;  1Z6T A;  2HYJ A;  3ML6 A;  4KIF A;  2OUM A;  1FP2 A;  2JVG A;  1ENH A;  2EFN A;  4XM3 A;  3EUH C;  1JJ6 C;  2L0K A;  4A3G J;  1ZRD A;  3C2G A;  2RNJ A;  1OKR A;  2LRE A;  2CGP A;  3BY6 A;  2HQA A;  2VIX A;  1WHU A;  3I54 A;  4C3J J;  4LLG F;  3RZD J;  3CLQ A;  2L7F P;  2UZK A;  2PJP A;  2JA7 J;  1FOK A;  4O3M A;  1FYK A;  2ZME C;  2VBZ A;  3K1P A;  3IH2 A;  1K7A A;  2VKE A;  5KCM A;  2ZSH B;  2GWR A;  4C9Y A;  4B44 A;  2FE3 A;  3ABU A;  4LIU A;  1JKO C;  2DMU A;  1FMV A;  5CQE A;  2W1O A;  5FKN A;  4BKX A;  3HOU J;  1RC9 A;  2A5W A;  4GO1 A;  2YPR A;  4EMS A;  2LYC A;  3L00 A;  2JRM A;  3CQZ J;  3LQR A;  1R9T J;  2PMZ A;  1MBK A;  2H8W A;  5KVR A;  4A3B J;  3J80 Z;  3PO2 J;  3R61 A;  4IHV A;  5D5V B;  1EV7 A;  3BWG A;  2V79 A;  1FYL A;  3H3Z A;  2BVL A;  4A12 A;  4D7M A;  2R7T A;  1Z05 A;  2HNH A;  3EYY A;  4UB6 C;  4N4N B;  5FGM A;  3E0J B;  3O8H A;  3TOB A;  2JMW A;  1MDM A;  2HI3 A;  1R4M B;  3E1S A;  3FMQ A;  1W36 C;  2E71 A;  1R1T A;  1SAX A;  2OCE A;  3FM3 A;  4KN4 X;  3WTY C;  1R5H A;  3K4C A;  1VQN I;  5HDG A;  4AIK A;  1YIT I;  1P9Q C;  1GDT A;  3HRS A;  4JX6 A;  2FBI A;  4XKB A;  2DXI A;  2EA4 A;  5JHF A;  3HKZ A;  5E3O A;  2JK3 A;  1E3O C;  1I27 A;  4HX7 A;  3K6G A;  4HQM A;  2AS5 F;  2GAU A;  2HOE A;  3B6A A;  3HOZ J;  5GTH C;  1XSV A;  3RPU A;  4LFU A;  1YW7 A;  2X6W A;  4CZC A;  4ZYA A;  3CCE I;  3FXL A;  3BJO A;  4OMZ A;  2DW4 A;  2ID6 A;  2XAH A;  2RAE A;  3CUO A;  3DLA A;  4M3B A;  2ME0 A;  4GYG A;  4KT5 C;  5IYC J;  2LVS A;  5DCM B;  4UVC A;  1APL C;  1SVM A;  1HST A;  3PSF A;  5BS6 A;  4A3M J;  1M1E B;  4ENM A;  4HEA 2;  3SZP A;  1K83 J;  2L5Q A;  5C44 J;  4EVI A;  4D7N A;  1IF1 A;  3C2H A;  2ICW G;  4EGY A;  3OYB A;  2ZC2 A;  1PP7 U;  1HKS A;  4OU0 A;  3BJA A;  5GAG J;  4E7K A;  4U0V A;  4XKC A;  2WY7 Q;  5DYM A;  5KHD A;  2X6Y A;  2K9S A;  1XDS A;  2QKL B;  3QU3 A;  3QWL A;  3WGH A;  1F1Z A;  4BUP A;  1GUU A;  1MBF A;  3JRF A;  4DQ2 A;  2ELK A;  3OYC A;  2NRA C;  2VOD A;  2A05 A;  1N78 A;  3MN2 A;  2IXS A;  2K9N A;  3PQK A;  3Q5F A;  2KRF A;  3F8C A;  3JRB A;  5GP9 A;  2O0Y A;  3TO9 A;  2M35 A;  2BY2 A;  1E2X A;  3ZMV A;  1SFK A;  5CQG A;  2BVM A;  2EFO A;  4WX9 A;  3A01 B;  2RVC A;  2NVY J;  3QU6 A;  3ROU A;  4BXX J;  3GCM A;  1X3W B;  4IHX A;  1F9N A;  2KIS A;  3HYI A;  3P9K A;  3HM5 A;  3WTW C;  4I02 A;  1FLI A;  4XN3 A;  2CJJ A;  2MC3 A;  1O3S A;  5CYV A;  2QM3 A;  1N77 A;  3COA C;  2H6B A;  5FLV A;  2WA0 A;  4RGX A;  1O3R A;  1EH7 A;  2VQG A;  1ZLK A;  3ZMZ A;  5E18 F;  5D4R A;  3LAP A;  3K7A J;  3RYP A;  5F0C A;  3H0D A;  2R93 J;  3H9J A;  4F93 B;  1ZG1 A;  4EJT A;  1ZG5 A;  2QZ8 A;  3TW7 A;  3GZN B;  5E79 C;  1EJ9 A;  2ZBK A;  3I4N J;  3M8F A;  2R7S A;  1PUE E;  4KIS A;  2HYF A;  1SD6 A;  3KP2 A;  1W4M A;  2K7L A;  2OQR A;  5JHU A;  1TZL A;  2XVC A;  2LKX A;  1AWC A;  3S32 A;  4AD9 A;  3WTZ A;  2BBY A;  4LB5 A;  5EZH A;  4MHG A;  3S1M J;  3GFL A;  1I1S A;  3BG9 A;  2CUJ A;  1IW7 F;  2DA4 A;  3CCR I;  3TMO A;  1XTA A;  2A6E F;  2EIK H;  2MAB A;  2V9K A;  4MFD A;  5JR3 A;  2YU3 A;  1BI2 A;  1FIA A;  4AIJ A;  2QSF X;  2MH2 A;  4BHP A;  3HUG A;  2RRE A;  5FKM A;  2Y75 A;  3PUB A;  5TJJ A;  3CCU I;  2DFH A;  2VQL A;  1W7P D;  4IXA A;  2CV2 A;  3J80 K;  3PUF A;  3H9Q A;  1QU3 A;  3J7A O;  2QWW A;  4CYD A;  2OU2 A;  3BR3 A;  4Y52 J;  1QA6 A;  5LRR A;  2LKP A;  2F5C A;  1F4K A;  4LG0 A;  4XIC A;  2X98 A;  1I50 J;  1WGX A;  2VKD A;  3IH3 A;  3OYL A;  3QP5 A;  3ZQC A;  2HOT A;  3V8K A;  3MVP A;  1Z6R A;  4UV9 A;  5M3F J;  5M3M J;  2O61 A;  2ADU A;  2DT5 A;  4BE1 A;  1SMY F;  4E7S A;  1FNN A;  4U87 A;  3ABM H;  1ZR4 A;  1Z67 A;  1O7F A;  2DOF A;  3E6B A;  2D45 A;  3HOW J;  1HXD A;  3K10 A;  1WJA A;  5FD6 A;  1I6H J;  3D1N I;  1BJA A;  3V8J A;  2DAO A;  2L4M A;  4XON A;  3KPH A;  3FHZ A;  2E35 A;  1WQ2 A;  1WVR A;  3V42 A;  1SFO J;  1FX7 A;  3BR5 A;  1MSF C;  1WI9 A;  3A03 A;  4UUT A;  1DPR A;  4OIR F;  4BQA A;  3IKT A;  4F55 A;  5JVT A;  2BXY A;  3G73 A;  4M9Z A;  3BQY A;  2ISZ A;  1TQP A;  1YW8 A;  2CUE A;  4B3X A;  5CVI A;  1DP7 P;  2G0E A;  2XKO A;  2E7W A;  1RET A;  5FJ8 J;  1Z77 A;  2M5W A;  2MD5 A;  1K79 A;  2H27 A;  3VYS B;  2RNG A;  1XSX A;  3SEQ A;  4FE4 A;  3OOP A;  1UG0 A;  2PFB A;  1IC8 A;  2ZSI B;  1TQI A;  2P4W A;  2W25 A;  1F36 A;  3DU6 A;  4BAC A;  2HQN A;  2JRT A;  1R22 A;  4XRF A;  4Y13 A;  1PDN C;  2XAS A;  4KIG A;  3RPU D;  3AL0 C;  1PUF B;  5EF6 A;  3DEE A;  1Y56 A;  1R00 A;  3W2V A;  2ME6 A;  3F72 A;  4OIN F;  4WWC A;  3I64 A;  2VC0 A;  5F04 A;  3TP0 A;  3F23 A;  2Z9O A;  5CJ9 A;  4CSW A;  3DKW A;  3HTU A;  2DOD A;  3A1Y A;  4MQ9 F;  1TWF J;  5JFR A;  2DFF A;  3QPH A;  2BW3 B;  3C18 A;  3W2W A;  5ICE A;  4Z6Y A;  4BHB A;  1GXP A;  2RQQ A;  2XGE A;  3N4M A;  2L7Z A;  3M7G A;  4XN0 A;  3VYR B;  5K5R A;  3FK7 A;  4OAY A;  3DEW A;  3BR0 A;  3WTS C;  2IBD A;  1UMQ A;  1SVO A;  1UZC A;  1BIB A;  2M3A A;  3HBL A;  2JZY A;  4HV5 A;  4U0W A;  4HYE A;  4Q47 A;  5IP6 A;  4M71 A;  1QPI A;  3HOT A;  4E7H A;  1U8B A;  3H1C A;  3PO3 J;  3TL4 X;  2VB6 A;  3FBI B;  1R1V A;  2BEO A;  2ZJP F;  2FNP A;  4M6V A;  5L3G A;  2XPV A;  1MNE A;  2GXA A;  4V19 K;  1TC3 C;  4ZTF A;  3OL3 A;  1V5G A;  2R7Q A;  2HYG D;  1IRX A;  3RIR A;  3LSI A;  2HDD A;  5F0H A;  4UNO A;  2FU4 A;  2B9S A;  3FXO A;  1BR4 A;  3ELK A;  5IP9 J;  1IDZ A;  1FSE A;  3JRA A;  2W57 A;  3HGY A;  4FIS A;  2XB5 A;  3SZT A;  1USS A;  3S3N A;  4CCN A;  1FJL A;  1KQ8 A;  3FMS A;  2XSD C;  1NK3 P;  2PQ8 A;  1WKM A;  4KMF A;  3H5A A;  5DEQ A;  4NB5 A;  4BGD A;  2M7A A;  1XB4 A;  3JRI A;  4OIO F;  3A0B C;  1MGT A;  3SJM A;  1JGG A;  5M5Y J;  3FXU A;  4NBQ A;  4U7B A;  5ILU A;  5ICG A;  3LSJ A;  2MYS A;  3ASO H;  2E2H J;  3OYI A;  3H5R A;  3WG7 H;  2DA2 A;  4BQQ A;  5FRM A;  4DGW B;  3S3O A;  5L3D A;  3OYA A;  3E6M A;  3T1B A;  1UG2 A;  5FKO A;  1MH3 A;  5KAI C;  1UHS A;  1Z0X A;  1ZAR A;  2V1X A;  3KFW X;  3NAU A;  3IAM 2;  4UB8 C;  4OIP F;  2HU9 A;  3GZ5 A;  2UXN A;  4B4C A;  2DA6 A;  4KIC A;  1LFU P;  4LK1 F;  3M07 A;  4IPA A;  3PL8 A;  1H8A C;  3BPX A;  3HTS B;  1FOX A;  1D8J A;  2R5Z A;  1ETV A;  2JN6 A;  1UEL B;  2A69 F;  2MW8 A;  3LSM A;  1Q1V A;  3WG9 A;  1BIA A;  4NQW B;  1MBJ A;  4M73 A;  1WJ5 A;  1OCC H;  4ENJ A;  2MUN A;  3GFJ A;  3VOE A;  2KHM A;  1P4W A;  3CJN A;  3CLO A;  1FP1 D;  3P9I A;  2ZNZ A;  3ZN0 A;  1WJB A;  4N4O B;  3GF2 A;  2DYR H;  2F4M B;  3IWZ A;  1LVA A;  3IL2 A;  5M5W J;  2HEO A;  3SXY A;  3ABT A;  4NDL A;  5EEA A;  4KYW A;  1R23 A;  4MLO A;  2MSY A;  3K70 C;  5GAD J;  2KRC A;  2RC4 A;  2L01 A;  4HG2 A;  1JGS A;  2L02 A;  3K4N A;  3TKY A;  4AVZ A;  4BH9 A;  4YIR X;  2WAQ N;  5F0F A;  2XUB A;  1ETQ A;  5EG0 B;  1SMT A;  3C3W A;  4YRV A;  1P4A A;  2IW5 A;  2HR3 A;  1IUY A;  2ZJ2 A;  3FXK A;  3L2Q A;  4IHT A;  1FBQ A;  2L2O A;  1MW7 A;  3S15 J;  1X3U A;  3A02 A;  1FOY A;  4F7Z A;  1E0E A;  3EUH A;  2DFE A;  3OIO A;  1B9N A;  1B8I B;  4AID A;  1LB2 A;  4UV8 A;  4MGR A;  4XR6 A;  3DU5 A;  4MEY F;  4CDG A;  2V6E A;  1OCZ H;  1YRN B;  4XSZ F;  1SD4 A;  1YW9 A;  3CO7 C;  2ZJQ F;  1W5T A;  2BOL A;  5ED4 A;  2P81 A;  5IP7 J;  4HSR A;  1B59 A;  3OR1 C;  4WXC A;  2TCT A;  1T0F C;  3CO6 C;  4XKV A;  4XOT A;  1R4N B;  1YTY A;  2GLO A;  2E36 A;  4YEL A;  4HF1 A;  2VT2 A;  2VJ4 A;  3G2B A;  4RLF A;  4L5J A;  2RQP A;  1TWG J;  2R4G A;  3ULQ B;  3FWE A;  1B4A A;  4LMY A;  3ZCO A;  1OPC A;  3LSR A;  5JVG F;  2DDB A;  4HX4 A;  5FB2 A;  5C4J J;  5KAF C;  3ECO A;  3HSE A;  2V7F A;  1ONV A;  2VOP A;  3F22 A;  2A68 F;  1VQP I;  2Q1Z B;  4ZJZ A;  3CC4 I;  1E3P A;  1JT6 A;  1PYV A;  3LNQ A;  1BC7 C;  4UHT A;  3BZK A;  1X1C A;  3EPZ A;  1FIP A;  2A3S A;  2JUG A;  2P6T A;  1IUF A;  1K61 A;  4WXD A;  1XSD A;  2DDA A;  3ZQQ A;  1X1P A;  3BP8 A;  4F52 A;  4LLN A;  1ON1 A;  4BNC A;  4DBQ A;  3T8R A;  3L1P A;  5HS7 A;  3H35 A;  1MBH A;  3FKJ A;  4X0G A;  2WBM A;  1ETO A;  1YOV B;  3I53 A;  2EV0 A;  4JP0 A;  3I59 B;  4JX4 A;  3TED A;  1IG7 A;  4CCL A;  3M3Y J;  3V4G A;  3V8L A;  5C4X J;  9ANT A;  2FQ4 A;  1YG2 A;  3BR2 A;  4BHC A;  3PNY A;  1OCR H;  1T95 A;  1NTC A;  2LBF A;  3LA2 A;  3DTI A;  2XAJ A;  1JTX A;  2M34 A;  1CGP A;  1IO2 A;  2QKM B;  2KQR A;  4RB2 C;  3CJT B;  1LNW A;  2STT A;  2KJB A;  3FF5 A;  2UXX A;  3ZN1 A;  3RSN A;  5F1R A;  1D8K A;  1X2N A;  1MH4 A;  1ZH5 A;  3ZMT A;  2Y0S N;  5D8L B;  2A5Y B;  4U0Y A;  3PFI A;  3BG5 A;  3JW4 A;  4D1Q A;  1T8I A;  2DO7 A;  2IA0 A;  3BG7 A;  1OCP A;  2Y9Y A;  4BDZ A;  2L9V A;  1DP3 A;  1TT0 A;  4JK1 X;  2DI3 A;  2L9N A;  4A5M A;  2V4J C;  1T39 A;  1GVD A;  3HZJ A;  3ZR8 X;  3F3X A;  4FAS D;  2XKP A;  2D1H A;  2G7H A;  1HDP A;  1JUS A;  2NOJ B;  4GCV A;  1J09 A;  4W1U A;  1BI3 A;  2DK8 A;  2DU9 A;  4WF2 A;  3RPQ A;  2CQK A;  4BAY A;  4C2M J;  1J2X A;  1OYY A;  4C3I J;  2IT0 A;  3KYD B;  3FMR A;  4E7L A;  5BPD A;  2R5Y A;  3HRM A;  3VDX A;  3HOV J;  3IV5 A;  1ODD A;  1YJ9 I;  4PJJ A;  2F4O B;  1DGW Y;  1A5J A;  2L7K A;  2QYO A;  4I76 A;  2R7F A;  3IC7 A;  3MWM A;  2LG4 A;  5J1Y A;  2XRL A;  2W00 A;  3FXQ A;  2Z33 A;  2QBY A;  3WGI A;  3S1Q J;  2NYX A;  3S17 J;  3LST A;  3Q0V A;  3PJR A;  3DQV C;  1QQI A;  3HHH A;  1POG A;  3G6E I;  3BR1 A;  2DPD A;  2O6G E;  2DN0 A;  3KE2 A;  1U9O A;  3RDI A;  1TBX A;  2DMN A;  4IL6 C;  1O3Q A;  2OPT A;  5F64 A;  4B1R A;  1SFE A;  3WU2 C;  4G94 A;  3L2C A;  1CF7 A;  3F0C A;  1TL8 A;  4HRI A;  3W6K B;  4N9H A;  2CUF A;  3CUQ B;  1XG1 A;  2IS1 A;  2M30 A;  3ONQ A;  3UKG A;  4CYC B;  3B6C A;  3DEU A;  1AKH A;  1QRY A;  1V5E A;  2Y0S A;  2H09 A;  4G7O F;  1YYV A;  3EET A;  3BG6 A;  3HPH A;  3Q9S A;  3ZQ7 A;  3LSP A;  1J5Y A;  3O2P E;  5GPA A;  3QP6 A;  1YE9 A;  4JX5 A;  4FTH A;  3MZY A;  2KFD A;  4XOR A;  3SYT A;  1FBS A;  1NH3 A;  5B3S H;  5BMZ A;  2BY3 A;  4E7Z A;  4RGR A;  1Y1W J;  4M3G A;  3CD6 I;  3K4L A;  3QYB A;  3U1D A;  1I6X A;  3J7Y J;  3CMY A;  2W84 A;  5A2Q Z;  1DPU A;  4O6J A;  2L7M P;  4Q4Z F;  3JRH A;  2BZT A;  1U5T B;  1STZ A;  2EZI A;  3ZP5 A;  3DTK A;  1W1W E;  2MVT A;  4A3I J;  3FX3 A;  3I56 I;  1J9I A;  3QOE A;  1Z7L A;  4FX0 A;  1EKE A;  2VT3 A;  3CTA A;  1QZE A;  4XKW A;  3J7A W;  1L3L A;  2LR8 A;  1OR7 C;  5LRS A;  4GXO A;  1R6R A;  2GBY A;  4GDF A;  4XLH A;  2BGC A;  3PIP F;  4XLC A;  4DBR A;  2XGC A;  3GTJ J;  3WTT C;  2V1D A;  4RMN A;  1ZGJ A;  2IVM A;  4Y4R A;  4JQF A;  2EIN H;  1LJ9 A;  3H3V K;  4OOI A;  4YG2 F;  2NS0 A;  3OL4 A;  4PFO A;  3RKX A;  4MFE A;  1ZRC A;  1WCM J;  2CQQ A;  3OYJ A;  3HXL A;  1O7L A;  1ACI A;  2W4S A;  2OC6 A;  4LIV A;  2M8G X;  4IRH A;  5BNG A;  3FK6 A;  2VQH A;  2C6Y A;  2F5E A;  1FPQ A;  2VAS A;  3CMM A;  3GW2 A;  3L2R A;  3H92 A;  3WE2 A;  3KEY A;  1S72 I;  4II2 A;  1QO0 D;  3JTH A;  3NEU A;  2UV1 A;  4YFX F;  4UUS A;  3AKZ A;  4A3K J;  1TP4 A;  2LF8 A;  1ETY A;  2J5P A;  1UB9 A;  3CC2 I;  5FRN A;  4DYR A;  4RAZ A;  1W36 D;  3VEP A;  1BR1 A;  2X6O A;  2FOK A;  3CF2 A;  5B5E C;  3QPL A;  2WB1 N;  5L3F A;  2E1M B;  2XF7 A;  3F8M A;  1XX5 A;  3IRR A;  4NC7 A;  5FLX Z;  1S29 A;  1RPW A;  3SFZ A;  4KNY A;  1NK2 P;  1FT9 A;  4PGG A;  4MTE A;  2YUS A;  2GOX B;  2PBI A;  3NQO A;  2X6X A;  5B1B H;  4QTR A;  3DLL F;  1S6L A;  4L0Y B;  4LLL A;  2KPM A;  3LAJ A;  3FIS A;  4XOP A;  2XDV A;  3H0G J;  2R92 J;  5FRO A;  2NS8 A;  4AU7 A;  4EJU A;  1ZHF A;  2B63 J;  1D5Y A;  1KU9 A;  2P6S A;  4KFC A;  3GZ6 A;  1P92 A;  2LOO A;  3K2A A;  5CKT A;  5D5X B;  1ZR2 A;  3ASN H;  2V1N A;  1FC3 A;  3BQZ A;  4OAZ A;  3W6J B;  3BLY A;  3O3K A;  4IEJ A;  2EV5 A;  1RR8 C;  2KZG A;  4A2U A;  1BN5 A;  2D2W A;  5B1A H;  1C0W A;  3G3Z A;  2M0M A;  4BBS J;  4XNF A;  3BTJ A;  2MD0 A;  2F4I A;  3HHG A;  2Q2E A;  2IGM A;  1R49 A;  1U3E M;  3F6V A;  2XF5 A;  1UHW A;  4EGZ A;  2H94 A;  2EBI A;  2OAZ A;  3AAF A;  1MMN A;  3PNV A;  1HQC A;  5HS8 A;  4A3E J;  3UR3 C;  1YJW I;  4BJ5 C;  2E19 A;  4PGH A;  5GAE J;  5EJC A;  2E1O A;  2LK2 A;  3EYI A;  1YX3 A;  2XAU A;  3GO5 A;  3SEZ A;  3ZMU A;  2WY8 Q;  3TP3 A;  4HA8 A;  2PI0 A;  4DYQ A;  2VPL A;  2CH0 A;  1MMD A;  2DCE A;  4DNC A;  5LFA A;  3WU1 B;  1O3T A;  2E7X A;  4LIT A;  4XBF A;  4A3L J;  2QLZ A;  1FY7 A;  1AHD P;  1Z3X A;  3OIQ A;  2JVH A;  2LTP A;  3V7S A;  5J4Y A;  3WTV C;  2R5Z B;  2KP6 A;  1FBU A;  5IYD J;  1P7J A;  1QVU A;  2K4J A;  5KK1 A;  4IKF A;  1ZK8 A;  4XLN F;  1YJN I;  2K9L A;  1PVE A;  1B72 A;  3IUO A;  1HA8 A;  4FHT A;  1LE8 A;  5A2Q K;  1D0Y A;  5DS9 A;  3VYT B;  3ERE D;  4XK4 A;  2XB0 X;  3LA7 A;  3CCQ I;  2VN2 A;  1XGM A;  3OIP A;  2EZK A;  4IO9 F;  1R5I D;  1H0M A;  3E6C C;  4ASN A;  1JI8 A;  1VTN C;  5EDN A;  4ZDP A;  1BW6 A;  4DYC A;  3CF5 F;  4EJO A;  1KYW A;  2A6T A;  3F8B A;  4FCY A;  1BJZ A;  3QOP A;  1HCR A;  2HKX A;  3F6O A;  1OIS A;  3TOA A;  4GGG A;  1KA8 A;  2LMD A;  3NWT A;  3HGG A;  4QWQ A;  4CCM A;  2W48 A;  4YFN F;  2PX9 A;  3G4S I;  3WU0 A;  2XRO A;  4BE0 A;  2W85 A;  3RJP A;  4KUM A;  3RYR A;  4ESB A;  2ECC A;  2X48 A;  1ETX A;  3P7N A;  3TO6 A;  4ZZD A;  2XF6 A;  2MFZ A;  2Q0O A;  4XRS G;  5CVU A;  1ZGA A;  4IQJ A;  2PJR B;  4PJL A;  5EGO B;  2QGU A;  1X19 A;  3KX2 A;  4LB6 B;  2P8T A;  2XHK A;  2M4G A;  4AYB N;  4DIQ A;  4RA2 A;  2ZME B;  2AXL A;  4RB3 C;  2PG4 A;  1P2F A;  2KT0 A;  3VB2 A;  4U7D A;  3N97 A;  4BE2 A;  4HDV A;  3OMY A;  1MMG A;  3JRC A;  5TIS C;  1UFM A;  4L9J A;  1BL0 A;  4J01 A;  1FTZ A;  1LKX A;  2WV0 A;  1ZKG A;  2ZJR F;  2O9L A;  5FLX K;  5LGU A;  2K9M A;  1K78 B;  4XSX F;  2DTZ A;  3JRD A;  1TNT A;  1TNS A;  3MAJ A;  3ZOB A;  2JA6 J;  3ISP A;  4XMY A;  4PJM A;  3ZQL A;  1F43 A;  4FT8 A;  4FX4 A;  4HLX A;  1OMI A;  1REP C;  1LQ1 A;  3CP8 A;  3LA3 A;  1ZLJ A;  1HC8 A;  2WAD A;  2EJR A;  2E34 A;  3GYH X;  1FMW A;  2Y31 A;  1IGN A;  2HPI A;  2B0L A;  1AU7 A;  1MD0 A;  2OD5 A;  4M72 A;  4MEX F;  5J3L A;  3JSP A;  3SQN A;  4YFK F;  1JXS A;  4A3C J;  4UY8 I;  2BY1 A;  1MBE A;  2ZFU A;  4EQQ A;  3DV8 A;  3I55 I;  1HLV A;  2OBP A;  3C2B A;  1WI3 A;  3BCA A;  3PFY A;  1PP8 F;  5K5O A;  2M2E A;  1TWH J;  2PMH A;  1WJC A;  1G2H A;  1MJA A;  2BE5 F;  1WRJ A;  4JYK A;  2VXZ A;  1OCO H;  1A04 A;  2NXN B;  2LSO A;  1T0F A;  1E17 A;  2LY1 A;  4EM0 B;  4P9U A;  3DBR B;  3DF8 A;  3M1C A;  3O6B B;  3EUA A;  2CG4 A;  3FKI J;  3IHU A;  2I10 A;  4B09 A;  1Y0U A;  4F3Q A;  3KLN A;  1XGO A;  2EIL H;  1V4R A;  2KZV A;  2IS6 A;  4B48 A;  5AIP A;  2H1L A;  2Z2S B;  2P0T A;  3REO A;  1JHH A;  5ICC A;  1OYI A;  2GA1 A;  1JUP A;  2P0W A;  2HTS A;  1MJB A;  4ZYG A;  1D0Z A;  2DK5 A;  3S16 J;  1UHM A;  2HGC A;  1ULY A;  2D1V A;  4AM3 A;  3CC7 I;  3K1N A;  1SD5 A;  4BJ6 C;  3LSH A;  3F8F A;  4HDU A;  1S8N A;  1I5Z A;  2JT1 A;  2XPU A;  3TGN A;  5LLQ A;  2H8R A;  2R7O A;  1OCT C;  2HOA A;  1G3S A;  2WTE A;  5DCM A;  2EA2 A;  3A0H C;  1XMK A;  5J40 A;  2R7R A;  2MLG A;  4ITV A;  3ZXS A;  1NG7 A;  1AA7 A;  3LOC A;  1IRG A;  4CXF A;  2BY0 A;  3TW6 A;  1IXR C;  5L3C A;  1YI2 I;  1ON2 A;  4BEH B;  1MKM A;  1D1B A;  1PJR A;  5FKK A;  3KP5 A;  1XMA A;  3S8P A;  2JPB A;  1ORK A;  3AG2 H;  3OOU A;  3FBN B;  5GAH J;  2XAG A;  2DQL A;  4ZTJ A;  2M7B A;  3HDD A;  5E1Z B;  2V26 A;  3E3V A;  4RAG A;  2JJ7 A;  4GFB A;  4RLQ A;  1VQO I;  1KQ0 A;  4J19 A;  1ZAO A;  3K4J A;  3A01 A;  1W7P B;  2DLL A;  1L0O C;  2IA1 A;  1S7O A;  4BYY A;  2F6C A;  5IPA A;  1S7E A;  4IHY A;  2HPM A;  2DFI A;  1D3Y A;  2FML A;  3D0S A;  5A2Q R;  3KEQ A;  3VFZ A;  4IHW A;  4A0Z A;  3CDH A;  3E7L A;  5CLS A;  3I58 A;  5HS9 A;  4HV6 A;  2VXD A;  4CCK A;  2VC1 A;  5FKL A;  3U2R A;  2HZT A;  2LY9 A;  2AXT C;  4CZZ A;  4O5V A;  3K9T A;  4R79 A;  1MSE C;  2BHZ A;  2ZXI A;  1YS7 A;  3GTK J;  5HLT A;  3PSI A;  2YR2 A;  2BHY A;  5DDG A;  4CGZ A;  3I9V 2;  3CUQ C;  1WPK A;  3DKY A;  5FO5 A;  2FMY A;  3CCL I;  4XL9 A;  1P4X A;  4M3F A;  3GEZ A;  3MMY B;  3OY9 A;  5KNL A;  3E97 A;  3KZY A;  3H36 A;  3ZPL A;  2VE8 A;  3CCY A;  2H6C A;  2R7U A;  1GV5 A;  2E1N A;  5B66 C;  1H9G A;  1IXS B;  1Q1H A;  4PK4 A;  2AQF A;  4IX7 A;  2ETH A;  2Y30 A;  2BV6 A;  1KYZ A;  3BCB A;  1G59 A;  1I39 A;  1QNT A;  2VKV A;  3ZMS A;  1MNM C;  2DMT A;  2NNY A;  4I09 A;  4PJN A;  3KP7 A;  2P5V A;  4K2E A;  4DZJ A;  4A5N A;  1U8R A;  2E60 A;  4BBR J;  1MDM B;  1HKT A;  1J0R A;  2ISY A;  3DWL E;  4IJA A;  4KMU X;  4P5O A;  3DBL B;  3BOQ A;  4G8X A;  5ICF A;  1FEX A;  4KDP A;  1R36 A;  3LWF A;  3SHF A;  2QQ8 A;  1Y8Q B;  2FQ3 A;  5EZG A;  3I3L A;  3U9G A;  4KIT B;  2VPR A;  1VQL I;  2K3F A;  5FLX R;  1SFX A;  2ZXJ A;  4BQN A;  1V5F A;  2CQN A;  3CCS I;  2GXB A;  2CQ7 A;  2HXO A;  2GIV A;  1JTY A;  1ITY A;  4S0H B;  3K70 D;  2DYS H;  3HOX J;  2E2J J;  2JSP A;  1VQM I;  3GFI A;  2YU9 J;  2K85 A;  1K4T A;  3GXO A;  3M1E A;  3MCZ A;  4LD5 A;  4HNV A;  2VL8 A;  3FDY A;  4EJW A;  2Y9Z A;  1QVT A;  3PM1 A;  2M1B A;  2QQB A;  4AIH A;  3KYC B;  2G9W A;  3SZG A;  3CDL A;  4ABZ A;  3E5Q A;  1MIJ A;  5FD5 A;  2NVQ J;  2CW7 A;  1DUX C;  1VQ6 I;  3L2U A;  2X85 A;  2FOW A;  1QZZ A;  3IKV A;  1JE8 A;  4ZDL A;  4CCO A;  1OR7 A;  3C1D A;  2GM4 A;  1SEU A;  1T08 B;  1JHF A;  4B47 A;  2A6H F;  1RUN A;  4PSW A;  2M8E A;  4ANJ A;  1HW2 A;  3T8T A;  3AL0 B;  3ESW B;  4YII A;  2F5D A;  1O57 A;  5BPI A;  3ERM A;  4HQE A;  4BQO A;  3RZO J;  2KIF A;  4A6D A;  3DTE A;  4Q5S F;  1X3Z B;  4NNJ A;  2IPQ X;  3S14 J;  4G9Y A;  2LKS A;  4L5I A;  1QHH D;  1X4O A;  3DP7 A;  3F21 A;  2E1M C;  1LDD A;  1DU6 A;  4L9N A;  5K7H A;  1Y1V J;  1RQ6 A;  2WAQ A;  4P96 A;  3GFM A;  5BOX A;  1TTY A;  2ZO4 A;  3KEO A;  2K9Q A;  2RGV A;  2HVS A;  1PUF A;  2CU7 A;  2VON A;  2XSJ C;  1TQM A;  3W2A A;  4M9S A;  2VBW A;  3HPG A;  4QLC U;  2COB A;  1H89 C;  3CCV I;  5JI6 A;  3RCO A;  4L9V A;  1QZY A;  2BW3 A;  3NAR A;  5EEH A;  4PUS A;  4X6A J;  1KON A;  2CFO A;  3OYF A;  1N75 A;  2MBF A;  2EIM H;  3Q3S A;  1R58 A;  2FBK A;  4D5F A;  4XID A;  2EFQ A;  4UVB A;  1VZ0 A;  5J8F A;  3I71 A;  2XC7 A;  4RB1 A;  4UXN A;  3JCU C;  4IVN A;  1VQ7 I;  4ZYH A;  2LNB A;  3K2Z A;  4BXF A;  5F27 A;  3E5U A;  4RGU A;  1R1U A;  2JUC A;  1Y6I A;  1RNL A;  1J59 A;  4XLA A;  5E3M A;  3PNT A;  1WH7 A;  2QUF A;  2CWE A;  3J81 Z;  1VND A;  1X1A A;  3HUG B;  1G3W A;  1P6R A;  3LQQ A;  5HDN A;  1DU0 A;  3HIF A;  4ESF A;  3WTU C;  1RIO H;  2UUZ A;  3O8G A;  3QPS A;  4IRI A;  3KP3 A;  1BC8 C;  5AIQ A;  3S1N J;  1LPQ A;  4LG3 A;  4ON0 A;  3GTL J;  2PMZ N;  3K4M A;  2GQQ A;  1RRJ A;  1HDD C;  4I98 B;  1QBJ A;  3SDB A;  2Z3Y A;  2ZNY A;  4LG0 B;  3TDU C;  4AC0 A;  3D5R C;  2Z1D A;  2DA3 A;  3DCF A;  3ZQI A;  4MTD A;  2LFB A;  1EF4 A;  3GX4 X;  2BYV E;  2WC2 A;  1GVJ A;  4A69 C;  2CV0 A;  3MEX A;  4QPQ A;  4AWX B;  5J1R A;  5FFX A;  3I5U A;  3BRO A;  2HXI A;  2Z16 A;  3LSK A;  5HNH A;  1X1B A;  5E3N A;  1T38 A;  5DD4 A;  3OYH A;  4YIF A;  1VQ8 I;  5K7Z A;  1YO5 C;  5FFZ A;  2E5Z A;  1ZG3 A;  4EEF G;  1G6N A;  2KRH A;  1ZQ3 P;  3V7C A;  1IZ1 A;  2EZH A;  3K4K A;  4N0B A;  2JA5 J;  3HL2 A;  3P5J A;  1IDY A;  1MZB A;  2X9D A;  2V6C A;  4I01 A;  2VE9 A;  4XRS A;  3HKZ N;  4M6X A;  1UST A;  4B8X A;  2PEX A;  4MIM A;  4DJA A;  2R7W A;  2KLO A;  4ZDO A;  6PAX A;  2PMU A;  5D6F A;  2HDW A;  2L9S A;  3G71 I;  2F5F A;  4RDU A;  3MKW B;  2W7N A;  4L18 B;  3GTP J;  3JSO A;  1XCB A;  4NQW A;  1G3T A;  2DT7 B;  1ZYR F;  4E4H A;  2DA7 A;  4D5C A;  4BS9 A;  4A6E A;  5D8K B;  2HFH A;  1I1G A;  4WXH A;  4RS8 A;  3W6V A;  1T56 A;  2FD5 A;  4BDY A;  3K0L A;  2Y69 H;  2CFX A;  3LMM A;  4C30 A;  2VOO A;  5L3E A;  4ZZL A;  3VOD A;  1OJL A;  2Y48 A;  3DBH B;  4MO7 A;  1ERD A;  2P7V B;  1IRF A;  4P1W A;  1B9M A;  3G1O A;  4J00 A;  3K1M A;  3GTG J;  3BTL A;  3CJQ B;  4DZP A;  3BZC A;  2DPU A;  4ZYE A;  2MZ4 A;  3GTM J;  2P5L C;  1GLN A;  4ETS A;  1ZTR A;  5TGT A;  3KIO A;  5J47 A;  1RR7 A;  2KKO A;  2IP2 A;  3HEF A;  4NC8 A;  1R7J A;  1IN8 A;  3GLX A;  4UUV A;  3S2H J;  2Y2Z A;  3KZZ A;  4R1H A;  1HKQ A;  2FUG 2;  1HW5 A;  3OS0 A;  5GTI C;  1Z9C A;  4QSH A;  3R6S A;  5K5Q A;  5EG0 A;  2OV7 A;  2X4H A;  5DV5 A;  2COM A;  1YFH A;  1J7K A;  2LLK A;  3K4B A;  2PLY A;  1Z1D A;  1Z91 A;  5IOY A;  1RKW A;  1VF9 A;  1X1D A;  1YIJ I;  5LGT A;  1B8I A;  4L5E A;  2KDZ A;  1DQU A;  1W5S A;  2IS2 A;  3OYK A;  3IH4 A;  4PZJ A;  1YRN A;  5HOD A;  4G6D A;  3OYM A;  2M87 A;  2GIZ A;  2E2I J;  2A61 A;  1DGR M;  2HTJ A;  2VJ5 A;  2XGX A;  5HDK A;  2EB7 A;  3Q9V A;  5ERI A;  1OYW A;  4EV0 A;  3CCJ I;  4E7I A;  4NHJ A;  2MH9 A;  4QIW N;  5HOO A;  2FNA A;  4OMY A;  5D5U B;  3BJ6 A;  1TLH B;  3QYF A;  1XGS A;  4N9I A;  2YS9 A;  5K1Y A;  2DJN A;  3UNG C;  2WAF A;  2OTJ I;  3J81 K; 
#chains in the Genus database with same CATH homology
 5DD8 A;  5H6R A;  1B1B A;  1KU3 A;  2XV4 S;  4I7H A;  4TV7 A;  5CVR A;  5E17 F;  3LFK A;  2K4B A;  3RKY A;  1IN5 A;  1TW3 A;  2IJL A;  1Z7U A;  3R0A A;  1YIO A;  2P5K A;  1H9T A;  3ZMD A;  3L09 A;  4HZF A;  3R4K A;  4M6Y A;  1RZ4 A;  5E1X A;  3I59 A;  1MJ9 A;  1RUO A;  2IRF G;  2RN7 A;  2FEZ A;  1GHC A;  2HQR A;  5ILS A;  1YQA A;  5DCF A;  2EK5 A;  3RI4 A;  4OIQ F;  3M8E A;  2XRN A;  2IA2 A;  3TO7 A;  2HKO A;  2KJC A;  1ZRE A;  2FXA A;  4WK8 F;  5AON A;  4WCG A;  5LGN A;  2V9V A;  4ESJ A;  3WGG A;  2KIU A;  4I0B A;  5LEK A;  5J6X A;  1YS6 A;  2XIG A;  2NAZ A;  1QPM A;  4G6Q A;  3P9C A;  4JBA A;  3NRV A;  5IT9 Z;  1D5V A;  3C7J A;  3M9A A;  2PN6 A;  4XLP F;  2DTR A;  2ZKZ A;  1LEB A;  2CW0 F;  3DFG A;  5ILV A;  1FZP B;  2VBY A;  2Z5U A;  3KP6 A;  4HW0 A;  4BXU A;  2ZFW A;  3CUQ A;  2QQA A;  1FWZ A;  4MNU A;  2ESH A;  2ACJ A;  4Y17 A;  2JSC A;  4ENK A;  5EEG A;  3ECH A;  3WOD F;  1F5T A;  2Q8K A;  3GWZ A;  5BQT A;  2MA3 A;  4PCQ A;  1K6O A;  4ZYD A;  1XN7 A;  1FSH A;  4PDK A;  2FF4 A;  1SFU A;  5D5W B;  2ESN A;  3BPV A;  1KQ9 A;  1RI7 A;  1U5T A;  2HS5 A;  3RKW A;  2E1C A;  3V7R A;  2G7U A;  3EDP A;  4L9T A;  4AVP A;  2L4A A;  3WE3 A;  5CVJ A;  2MLK A;  1LDJ A;  5HLI A;  2UWM A;  1U6G A;  3KP4 A;  3KCC A;  2FRH A;  4LJZ F;  4ENN A;  5LEJ A;  1ZRF A;  3HSF A;  3K69 A;  2EV6 A;  2RKH A;  1G3Y A;  3FXR A;  5D6E A;  2LDU A;  3HOS A;  4H0E A;  2WWY A;  1QGP A;  3HSR A;  3TDZ C;  4RGS A;  2OA4 A;  4LGW A;  3E6D A;  1WWX A;  1TW2 A;  2DBB A;  4M9X A;  5F6F A;  4U88 A;  3MQ0 A;  3GUD A;  2QBY B;  2YX4 A;  2K27 A;  4E70 A;  5LHI A;  1IN7 A;  1B6A A;  1EH6 A;  2EFP A;  4HAM A;  5IT9 K;  3HRT A;  4S05 A;  2HWV A;  1FYM A;  2RDP A;  2X0L A;  2L3D A;  3DPT A;  4HF0 A;  2OQG A;  1CF7 B;  2ELH A;  4IHS A;  2LF7 A;  2K02 A;  4Q48 A;  3B73 A;  4KN7 X;  5L3B A;  2GZW A;  1YLF A;  2YX7 A;  3D5L A;  3KET A;  3T5X A;  1UCR A;  1KGS A;  5IT3 A;  2EWN A;  2XAF A;  2Y0M A;  1T2K A;  1XDU A;  4EM2 A;  2STW A;  3R0J A;  2JTV A;  2KIM A;  1XGN A;  3TQN A;  4D0P A;  3QPT A;  5H6Q A;  5DUK A;  3HRU A;  1BI1 A;  4EM1 A;  2O03 A;  5E8I A;  4MQV A;  4Z2Y A;  2NNN A;  1BBY A;  1S3J A;  4I0A A;  5TRD A;  1XCV A;  3EQL F;  3JAM Z;  4UVA A;  2F2E A;  1BOA A;  4HLY A;  1IXC A;  2K86 A;  4GYI A;  3S2W A;  1U5T C;  2ZCW A;  4IF4 A;  3B02 A;  1KU2 A;  3KLO A;  4IRG A;  1ZN2 A;  2YSR A;  2V1U A;  2RV8 A;  1LEA A;  2EFW A;  2FA5 A;  2A07 F;  3QAH A;  4HOB A;  3L9F A;  3OV8 A;  2TDX A;  1V3F A;  4ZH4 F;  1EH8 A;  4LK0 F;  3T0Y A;  4A0X A;  4HX8 A;  1BM9 A;  1SD7 A;  3I0T A;  2ZME A;  3R60 A;  4KA4 A;  2QQ9 A;  1HBX G;  1IN4 A;  5E1W A;  5HVQ C;  3MFK A;  5HLG A;  3IWF A;  5DUI A;  1K78 A;  1J75 A;  2FBH A;  2R7D A;  2W24 A;  5H20 A;  2VBX A;  3WTX C;  4R8H A;  1BI0 A;  3BZ6 A;  4KIB A;  2DQR A;  4G7H F;  3JTG A;  3BDD A;  5LHG A;  3L7W A;  4I2O A;  2QVO A;  1IN6 A;  1HW1 A;  2CYY A;  2O3F A;  5E20 A;  1G4D A;  3PQJ A;  1S7A A;  2QEN A;  4EJV A;  2GXG A;  1U2W A;  2O8X A;  4M74 A;  4L0Z B;  3F8N A;  1GXQ A;  4CO8 A;  1WSU A;  1AOY A;  4G7Z F;  1IAW A;  3GVA A;  5E8G A;  1XD7 A;  1T98 A;  3H3U A;  2L54 A;  2CSO A;  2OZU A;  2J5O A;  4CHU A;  3FZV A;  3DPL C;  3QRF F;  5HLH A;  5CVV A;  3I4P A;  5LBQ A;  4HBL A;  4P9F A;  2CO5 A;  4HF2 A;  1T6S A;  2XAQ A;  4Y15 A;  1U78 A;  4P55 A;  2GA2 A;  1HSJ A;  3JAM K;  2P7C B;  1NHA A;  2OZ6 A;  3E5X A;  4RB0 A;  4S04 A;  1R5G A;  5D4S A;  5J8C A;  2HDC A;  2Z99 A;  3FM5 A;  4A0Y A;  4RAY A;  2M45 A;  3IRQ A;  2JPC A;  1LDK B;  5LHH A;  3MZH A;  2R3S A;  1W7P A;  2FSW A;  1DDN A;  3RTR A;  3DXJ F;  4CIC A;  1KU7 A;  1Z6T A;  3ML6 A;  4KIF A;  1FP2 A;  2EFN A;  1ZRD A;  2RNJ A;  1OKR A;  2CGP A;  3BY6 A;  3I54 A;  4LLG F;  2UZK A;  2PJP A;  1FOK A;  4O3M A;  1FYK A;  2VBZ A;  3K1P A;  1K7A A;  2GWR A;  2FE3 A;  3ABU A;  4GO1 A;  2YPR A;  4EMS A;  3L00 A;  3LQR A;  5KVR A;  3J80 Z;  3R61 A;  5D5V B;  1EV7 A;  3BWG A;  2V79 A;  1FYL A;  3H3Z A;  4A12 A;  1Z05 A;  3EYY A;  5FGM A;  3TOB A;  1MDM A;  3FMQ A;  1R1T A;  1SAX A;  3FM3 A;  4KN4 X;  3WTY C;  1R5H A;  5HDG A;  4AIK A;  3HRS A;  2FBI A;  2EA4 A;  1I27 A;  4HX7 A;  4HQM A;  2AS5 F;  2GAU A;  2HOE A;  1XSV A;  3RPU A;  4LFU A;  1YW7 A;  3BJO A;  4OMZ A;  2DW4 A;  2XAH A;  3CUO A;  4GYG A;  4KT5 C;  5DCM B;  4UVC A;  1HST A;  5BS6 A;  4ENM A;  3SZP A;  4EVI A;  1IF1 A;  4EGY A;  1PP7 U;  1HKS A;  4OU0 A;  3BJA A;  4U0V A;  5DYM A;  1XDS A;  3QU3 A;  3WGH A;  1F1Z A;  4DQ2 A;  2NRA C;  2VOD A;  3PQK A;  3Q5F A;  2KRF A;  3F8C A;  2O0Y A;  3TO9 A;  1E2X A;  3ZMV A;  2EFO A;  4WX9 A;  2RVC A;  3QU6 A;  3ROU A;  1F9N A;  3HYI A;  3P9K A;  3WTW C;  1FLI A;  4I02 A;  2MC3 A;  1O3S A;  5CYV A;  2QM3 A;  3COA C;  2H6B A;  4RGX A;  1O3R A;  1EH7 A;  1ZLK A;  3ZMZ A;  5E18 F;  5D4R A;  3LAP A;  3RYP A;  1ZG1 A;  4EJT A;  1ZG5 A;  2QZ8 A;  2ZBK A;  3M8F A;  1PUE E;  2HYF A;  1SD6 A;  3KP2 A;  1W4M A;  2K7L A;  2OQR A;  5JHU A;  2XVC A;  1AWC A;  4AD9 A;  3WTZ A;  2BBY A;  4LB5 A;  4MHG A;  3GFL A;  1I1S A;  1IW7 F;  2A6E F;  5JR3 A;  2YU3 A;  1BI2 A;  4AIJ A;  4BHP A;  2MH2 A;  3HUG A;  2Y75 A;  5TJJ A;  1W7P D;  4IXA A;  3J80 K;  3J7A O;  2QWW A;  4CYD A;  2OU2 A;  5LRR A;  2LKP A;  2F5C A;  1F4K A;  4LG0 A;  3QP5 A;  3V8K A;  1Z6R A;  4UV9 A;  2O61 A;  2ADU A;  2DT5 A;  1SMY F;  1FNN A;  1O7F A;  3E6B A;  2D45 A;  1HXD A;  5FD6 A;  1BJA A;  3V8J A;  2DAO A;  2L4M A;  3FHZ A;  1WQ2 A;  1FX7 A;  1WI9 A;  1DPR A;  4OIR F;  4BQA A;  3IKT A;  5JVT A;  3G73 A;  4M9Z A;  2ISZ A;  1TQP A;  1YW8 A;  5CVI A;  1DP7 P;  2XKO A;  2E7W A;  2M5W A;  2MD5 A;  1K79 A;  2H27 A;  1XSX A;  3OOP A;  2PFB A;  1TQI A;  2P4W A;  2W25 A;  2HQN A;  2JRT A;  1R22 A;  4XRF A;  4Y13 A;  1PDN C;  2XAS A;  4KIG A;  1R00 A;  3F72 A;  4OIN F;  4WWC A;  3I64 A;  2VC0 A;  3F23 A;  2Z9O A;  5CJ9 A;  3DKW A;  3HTU A;  4MQ9 F;  5JFR A;  3QPH A;  3C18 A;  5ICE A;  4BHB A;  1GXP A;  3N4M A;  3M7G A;  5K5R A;  3WTS C;  4U0W A;  1BIB A;  4HV5 A;  2JZY A;  4HYE A;  4Q47 A;  4M71 A;  3HOT A;  1R1V A;  2BEO A;  2FNP A;  5L3G A;  2HYG D;  3RIR A;  4UNO A;  2FU4 A;  3ELK A;  1FSE A;  2W57 A;  3SZT A;  1USS A;  1KQ8 A;  3FMS A;  2PQ8 A;  1WKM A;  4KMF A;  5DEQ A;  4NB5 A;  1XB4 A;  4OIO F;  1MGT A;  3FXU A;  4U7B A;  5ILU A;  5ICG A;  5L3D A;  3E6M A;  3T1B A;  1ZAR A;  2V1X A;  3KFW X;  4OIP F;  3GZ5 A;  2UXN A;  4KIC A;  4LK1 F;  4IPA A;  3BPX A;  3HTS B;  1D8J A;  2A69 F;  3WG9 A;  1BIA A;  4M73 A;  4ENJ A;  3GFJ A;  3VOE A;  1P4W A;  3CJN A;  3CLO A;  1FP1 D;  3P9I A;  2ZNZ A;  3ZN0 A;  3GF2 A;  3IWZ A;  1LVA A;  3IL2 A;  2HEO A;  3SXY A;  3ABT A;  4KYW A;  1R23 A;  2RC4 A;  2L01 A;  1JGS A;  2L02 A;  3TKY A;  4BH9 A;  2XUB A;  1SMT A;  3C3W A;  1P4A A;  2IW5 A;  2HR3 A;  1IUY A;  2ZJ2 A;  4IHT A;  1FBQ A;  1X3U A;  4F7Z A;  3EUH A;  1B9N A;  1LB2 A;  4UV8 A;  4MGR A;  4MEY F;  4CDG A;  4XSZ F;  1SD4 A;  1YW9 A;  3CO7 C;  1W5T A;  5ED4 A;  4WXC A;  1B59 A;  3CO6 C;  1YTY A;  4HF1 A;  2VT2 A;  4L5J A;  2RQP A;  3ULQ B;  3FWE A;  1B4A A;  4LMY A;  1OPC A;  4HX4 A;  5FB2 A;  3ECO A;  3HSE A;  1ONV A;  2VOP A;  3F22 A;  2A68 F;  1BC7 C;  4UHT A;  2A3S A;  2P6T A;  4WXD A;  1XSD A;  3BP8 A;  4LLN A;  1ON1 A;  4BNC A;  3T8R A;  5HS7 A;  3I53 A;  2EV0 A;  3I59 B;  3V4G A;  3V8L A;  1YG2 A;  4BHC A;  3LA2 A;  2XAJ A;  1CGP A;  4RB2 C;  1LNW A;  2STT A;  2KJB A;  3FF5 A;  2UXX A;  3ZN1 A;  5F1R A;  1D8K A;  1ZH5 A;  3ZMT A;  5D8L B;  2A5Y B;  4U0Y A;  3PFI A;  3JW4 A;  2DO7 A;  2IA0 A;  4JK1 X;  2DI3 A;  4A5M A;  1T39 A;  3F3X A;  2XKP A;  2D1H A;  2G7H A;  4GCV A;  1BI3 A;  2DK8 A;  2DU9 A;  4WF2 A;  3RPQ A;  2CQK A;  4BAY A;  2IT0 A;  1J2X A;  1OYY A;  3FMR A;  5BPD A;  3HRM A;  1ODD A;  2QYO A;  2R7F A;  3IC7 A;  3MWM A;  3FXQ A;  2Z33 A;  2QBY A;  3WGI A;  2NYX A;  3LST A;  3DQV C;  1QQI A;  3HHH A;  2DPD A;  2O6G E;  3KE2 A;  3RDI A;  1TBX A;  1O3Q A;  5F64 A;  1SFE A;  4G94 A;  3L2C A;  1CF7 A;  3W6K B;  4N9H A;  3CUQ B;  2M30 A;  3DEU A;  2H09 A;  4G7O F;  1YYV A;  3EET A;  3ZQ7 A;  3Q9S A;  1J5Y A;  3O2P E;  3QP6 A;  3MZY A;  1FBS A;  5BMZ A;  4RGR A;  3U1D A;  1I6X A;  2W84 A;  5A2Q Z;  1DPU A;  4O6J A;  4Q4Z F;  1U5T B;  1STZ A;  3ZP5 A;  3FX3 A;  1J9I A;  4FX0 A;  2VT3 A;  3CTA A;  1L3L A;  5LRS A;  4GXO A;  2BGC A;  3WTT C;  2V1D A;  1ZGJ A;  2IVM A;  4JQF A;  1LJ9 A;  4OOI A;  4YG2 F;  2NS0 A;  3RKX A;  1ZRC A;  1O7L A;  4IRH A;  2C6Y A;  2F5E A;  1FPQ A;  3GW2 A;  3H92 A;  3WE2 A;  1QO0 D;  3JTH A;  3NEU A;  4YFX F;  2LF8 A;  2J5P A;  1UB9 A;  4RAZ A;  3VEP A;  2FOK A;  5L3F A;  3F8M A;  3IRR A;  5FLX Z;  1S29 A;  3SFZ A;  4KNY A;  1FT9 A;  4PGG A;  4MTE A;  2PBI A;  3NQO A;  1S6L A;  4L0Y B;  4LLL A;  3LAJ A;  4EJU A;  1ZHF A;  1KU9 A;  2P6S A;  4KFC A;  3GZ6 A;  1P92 A;  5D5X B;  1FC3 A;  3W6J B;  3O3K A;  2EV5 A;  4A2U A;  1BN5 A;  2D2W A;  1C0W A;  3G3Z A;  3HHG A;  2Q2E A;  1U3E M;  3F6V A;  1UHW A;  4EGZ A;  2H94 A;  2OAZ A;  3AAF A;  1HQC A;  5HS8 A;  4PGH A;  3EYI A;  3GO5 A;  3ZMU A;  4HA8 A;  2PI0 A;  4DNC A;  1O3T A;  3WU1 B;  2E7X A;  4XBF A;  2QLZ A;  1FY7 A;  3WTV C;  3V7S A;  1FBU A;  2K4J A;  5KK1 A;  4XLN F;  4FHT A;  5A2Q K;  3ERE D;  3LA7 A;  2VN2 A;  1XGM A;  1H0M A;  3E6C C;  4ASN A;  1VTN C;  4EJO A;  1KYW A;  3F8B A;  3QOP A;  2HKX A;  3F6O A;  3TOA A;  4GGG A;  1KA8 A;  4QWQ A;  4YFN F;  3WU0 A;  2XRO A;  2W85 A;  3RJP A;  4KUM A;  3RYR A;  4ESB A;  3P7N A;  3TO6 A;  4ZZD A;  2Q0O A;  5CVU A;  1ZGA A;  4LB6 B;  2P8T A;  2XHK A;  2ZME B;  2AXL A;  4RB3 C;  2PG4 A;  1P2F A;  3VB2 A;  4U7D A;  3N97 A;  4HDV A;  1UFM A;  4L9J A;  2WV0 A;  5FLX K;  5LGU A;  1K78 B;  4XSX F;  1TNT A;  1TNS A;  3MAJ A;  3ISP A;  4FT8 A;  4FX4 A;  4HLX A;  1OMI A;  1REP C;  1LQ1 A;  3LA3 A;  1ZLJ A;  2EJR A;  3GYH X;  2B0L A;  1MD0 A;  2OD5 A;  4M72 A;  4MEX F;  3JSP A;  3SQN A;  4YFK F;  1JXS A;  4EQQ A;  3DV8 A;  2OBP A;  1PP8 F;  5K5O A;  2PMH A;  1MJA A;  2BE5 F;  1WRJ A;  2VXZ A;  1A04 A;  2LSO A;  1T0F A;  1E17 A;  4EM0 B;  4P9U A;  3DF8 A;  3O6B B;  2CG4 A;  3IHU A;  4B09 A;  1Y0U A;  3KLN A;  1XGO A;  1V4R A;  5AIP A;  3REO A;  1JHH A;  5ICC A;  1OYI A;  2GA1 A;  2HTS A;  1MJB A;  4ZYG A;  2DK5 A;  1UHM A;  2HGC A;  1ULY A;  2D1V A;  3K1N A;  1SD5 A;  3F8F A;  4HDU A;  1S8N A;  1I5Z A;  2JT1 A;  3TGN A;  5LLQ A;  1G3S A;  2WTE A;  5DCM A;  2EA2 A;  1XMK A;  2MLG A;  1IRG A;  4CXF A;  1IXR C;  5L3C A;  1ON2 A;  1MKM A;  3KP5 A;  1XMA A;  2JPB A;  2XAG A;  2DQL A;  5E1Z B;  3E3V A;  1KQ0 A;  1ZAO A;  1W7P B;  2DLL A;  1L0O C;  2IA1 A;  1S7O A;  4BYY A;  2DFI A;  1D3Y A;  2FML A;  3D0S A;  3KEQ A;  3VFZ A;  4A0Z A;  3CDH A;  5CLS A;  3I58 A;  5HS9 A;  4HV6 A;  2VC1 A;  3U2R A;  2HZT A;  4CZZ A;  4O5V A;  3K9T A;  4R79 A;  1YS7 A;  2YR2 A;  5DDG A;  4CGZ A;  3CUQ C;  5FO5 A;  2FMY A;  1P4X A;  3GEZ A;  3E97 A;  3KZY A;  3ZPL A;  2VE8 A;  2H6C A;  2E1N A;  1H9G A;  1IXS B;  1Q1H A;  2ETH A;  2BV6 A;  1KYZ A;  3ZMS A;  1QNT A;  2NNY A;  4I09 A;  3KP7 A;  2P5V A;  4K2E A;  4A5N A;  1U8R A;  1MDM B;  1HKT A;  1J0R A;  2ISY A;  4IJA A;  4KMU X;  4P5O A;  4G8X A;  3BOQ A;  5ICF A;  4KDP A;  1R36 A;  3LWF A;  3SHF A;  2FQ3 A;  3U9G A;  1SFX A;  2ZXJ A;  2GXB A;  2GIV A;  3GFI A;  3GXO A;  3M1E A;  3MCZ A;  4LD5 A;  4EJW A;  2M1B A;  2QQB A;  4AIH A;  2G9W A;  3E5Q A;  5FD5 A;  1DUX C;  1QZZ A;  3IKV A;  1JE8 A;  1OR7 A;  3C1D A;  1JHF A;  2A6H F;  1RUN A;  2M8E A;  1HW2 A;  3T8T A;  4YII A;  2F5D A;  1O57 A;  5BPI A;  4HQE A;  2KIF A;  4A6D A;  4Q5S F;  2IPQ X;  4G9Y A;  4L5I A;  3DP7 A;  3F21 A;  1LDD A;  4L9N A;  4P96 A;  3GFM A;  5BOX A;  1TTY A;  2ZO4 A;  3KEO A;  2RGV A;  2VON A;  1TQM A;  4M9S A;  2VBW A;  4QLC U;  5JI6 A;  4L9V A;  1QZY A;  5EEH A;  2MBF A;  1R58 A;  2FBK A;  2EFQ A;  4UVB A;  5J8F A;  3I71 A;  4RB1 A;  4UXN A;  4IVN A;  4ZYH A;  2LNB A;  3K2Z A;  3E5U A;  4RGU A;  1R1U A;  1RNL A;  1J59 A;  2QUF A;  2CWE A;  3J81 Z;  1G3W A;  1P6R A;  3LQQ A;  5HDN A;  3HIF A;  4ESF A;  3WTU C;  1RIO H;  4IRI A;  3KP3 A;  1BC8 C;  5AIQ A;  4ON0 A;  2GQQ A;  4I98 B;  1QBJ A;  2Z3Y A;  2ZNY A;  4LG0 B;  3TDU C;  4MTD A;  3GX4 X;  2BYV E;  2WC2 A;  1GVJ A;  3MEX A;  4AWX B;  5FFX A;  3I5U A;  3BRO A;  1T38 A;  5DD4 A;  4YIF A;  1YO5 C;  5FFZ A;  1ZG3 A;  1G6N A;  3V7C A;  1IZ1 A;  4N0B A;  1MZB A;  2V6C A;  4I01 A;  2VE9 A;  4M6X A;  1UST A;  4B8X A;  2PEX A;  6PAX A;  2PMU A;  5D6F A;  2F5F A;  4L18 B;  3JSO A;  1XCB A;  4NQW A;  1G3T A;  1ZYR F;  4A6E A;  5D8K B;  2HFH A;  1I1G A;  4WXH A;  4RS8 A;  3K0L A;  2CFX A;  2VOO A;  5L3E A;  4ZZL A;  3VOD A;  2Y48 A;  2P7V B;  1IRF A;  1B9M A;  3K1M A;  2DPU A;  4ZYE A;  2P5L C;  4ETS A;  2KKO A;  2IP2 A;  1R7J A;  1IN8 A;  3GLX A;  4UUV A;  3KZZ A;  4R1H A;  1HKQ A;  1HW5 A;  1Z9C A;  3R6S A;  5K5Q A;  2X4H A;  5DV5 A;  2COM A;  1YFH A;  1J7K A;  2PLY A;  1Z1D A;  1Z91 A;  5LGT A;  1W5S A;  4PZJ A;  4G6D A;  2M87 A;  2A61 A;  2HTJ A;  2XGX A;  5HDK A;  2EB7 A;  3Q9V A;  5ERI A;  1OYW A;  4EV0 A;  4NHJ A;  2MH9 A;  5HOO A;  2FNA A;  4OMY A;  5D5U B;  3BJ6 A;  1TLH B;  1XGS A;  4N9I A;  5K1Y A;  3J81 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...