2DTRA

Structure of diphtheria toxin repressor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
214
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the diphtheria toxin repressor complexed with cobalt and manganese reveals an SH3-like third domain and suggests a possible role of phosphate as co-corepressor.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 44
structure length 214
sequence length 223
ec nomenclature
pdb deposition date 1996-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dtrA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2dtrA02
4H0EA 2DFIA 1QZYA 2EV5A 4AIJA 2HQRA 3HRSA 5JVTA 1XMAA 4M72A 4OMYA 3ELKA 1KYZA 1BIAA 4EVIA 1U6GA 5D4SA 4E70A 1FYLA 2VN2A 1IN6A 5E1ZB 3I0TA 4LG0A 3V7RA 4RGUA 5HDKA 2Y75A 5CVRA 1BM9A 2RNJA 3U2RA 3WTYC 2A3SA 1LDKB 3QP5A 2L54A 2HR3A 3FWEA 5K5QA 4HLYA 3E5QA 3I53A 2XV4S 1TW3A 1B9MA 3O6BB 1J7KA 3CDHA 2LF8A 1LB2A 3HRUA 1ZGJA 4LB6B 2NNYA 4R79A 1P4WA 1R22A 1OMIA 2MA3A 2IT0A 3HIFA 3REOA 3WTTC 2CGPA 4EMSA 2H6CA 1EH8A 2F5FA 4HW0A 1FZPB 1JE8A 4M73A 5D4RA 2HEOA 2A69F 2IA1A 3W6JB 3MCZA 4KICA 2V1UA 4HX7A 3CUQA 1S6LA 3SZTA 3IHUA 3F6VA 3R4KA 1FP2A 3FXRA 2PN6A 1JHFA 1HKSA 3C1DA 2O3FA 2TDXA 1GHCA 1HKTA 5ED4A 2UWMA 2LKPA 3PQKA 4CXFA 2FSWA 1ZARA 1KU3A 3GZ6A 4A6DA 3QAHA 1ZAOA 4EGZA 2ETHA 1K79A 4PDKA 2XVCA 1OYWA 4EGYA 5ILSA 2P4WA 4ESBA 3DP7A 2L01A 1E2XA 1FP1D 4NQWA 5LHHA 5BPIA 4RAYA 4BAYA 2FBIA 1MD0A 3R60A 3GX4X 1YW7A 4I02A 4P9FA 1ZYRF 1TW2A 3H3ZA 2DQLA 1P4XA 4XBFA 5E1WA 2P6SA 1TNTA 3KP2A 1HSJA 4YIFA 1MJ9A 3J81K 2RVCA 3DV8A 3GZ5A 1XN7A 2JRTA 4M9XA 3ERED 2Z33A 1O3QA 3OOPA 5CLSA 3L09A 2OZUA 2PBIA 1PP8F 5FGMA 5KVRA 1BI2A 2KKOA 2UZKA 3GVAA 5H6QA 1R7JA 2HTSA 5AIQA 3H92A 2QUFA 1BC8C 5LLQA 3JAMK 1GXQA 4HZFA 3TO6A 4Y13A 4I2OA 5E20A 3M1EA 3E5UA 5DCMB 3WODF 2ZXJA 4LLGF 4PCQA 3PQJA 1SFXA 4HV5A 5L3BA 2IA0A 2KJBA 4CDGA 3PFIA 1R5HA 2CFXA 2F2EA 2M30A 1EH6A 3FMRA 2IA2A 3F3XA 1YFHA 3E6BA 3CJNA 2V1XA 4WXCA 2E7WA 3QOPA 1UFMA 2EA2A 3KP5A 4A2UA 3Q9SA 3HOTA 2L3DA 1BIBA 1YS7A 1UB9A 5D5VB 3JAMZ 2QQBA 2BEOA 3Q5FA 4ZYHA 2E1CA 4IHSA 1HKQA 2EJRA 3VB2A 3SZPA 3KEOA 3MFKA 3EQLF 1S3JA 4FHTA 4OOIA 3HOSA 3ZMUA 2ZFWA 3HSFA 3F8FA 3J80K 4I0AA 5HVQC 4LMYA 2XRNA 1DPRA 3FZVA 5HLGA 5TJJA 3KP6A 1SMTA 2M5WA 4ZZDA 5CVVA 1J75A 1TTYA 1DPUA 1YW9A 1WSUA 4BHPA 3K1MA 4AD9A 1FT9A 1S8NA 2H94A 4PZJA 1UHMA 4HQEA 2RC4A 4LGWA 4NB5A 5CJ9A 1RUOA 1RZ4A 4L9NA 3CO6C 1PUEE 4KYWA 3AAFA 1FYMA 5D6FA 3RTRA 5J6XA 3NQOA 1YIOA 4XLPF 3LSTA 3RPQA 1O3RA 4OINF 1SD5A 1USSA 3RPUA 5K5OA 4A12A 5D5UB 2EV6A 3GFJA 3ML6A 3OV8A 4YG2F 2RDPA 1QNTA 1XDSA 1TQIA 1W7PD 1U3EM 1K78A 4O5VA 1W5SA 3F6OA 2XROA 2M45A 2O0YA 4M6XA 2FBKA 5CVUA 4CO8A 2DAOA 3RYRA 3ULQB 1ODDA 5AONA 3M7GA 5FO5A 4RGRA 5DD8A 5L3CA 2ZBKA 4D0PA 2HFHA 1WQ2A 3T0YA 1LVAA 1OPCA 3BJAA 1P6RA 1XGOA 2GXGA 2F5CA 5H6RA 1BBYA 3WTZA 4BHBA 1YS6A 2LF7A 4ZYGA 1ZLJA 2Y0MA 2DBBA 3GYHX 3BZ6A 3SHFA 1J2XA 2EB7A 5E1XA 3FF5A 1UCRA 3N4MA 2DW4A 2X4HA 2Q2EA 2IRFG 3I64A 1FBUA 2BYVE 1T98A 2K7LA 2D2WA 1Q1HA 4LB5A 4P96A 2HQNA 2LDUA 1ZG5A 2ELHA 4KIFA 4ZYDA 1T0FA 2QLZA 3GFLA 4RAZA 4YIIA 1U8RA 2ZKZA 3V8JA 4XRFA 3IRQA 2A07F 3P9CA 2A6HF 2EFWA 4G94A 3WTUC 5LGUA 2WWYA 3K1NA 4P55A 5CVIA 1LDJA 5HLHA 2OA4A 3IC7A 5HS9A 2QENA 1D3YA 3HRMA 1Z05A 5K5RA 1I27A 2NRAC 5BMZA 2FXAA 4DNCA 3JTGA 3BROA 4HX4A 4P5OA 3WG9A 2XKOA 4HQMA 3F21A 1LEAA 2IPQX 3V7SA 3I54A 1XB4A 3CLOA 1TLHB 2OU2A 4L5JA 4Z2YA 2X0LA 4TV7A 4CGZA 1QQIA 2A61A 3HHGA 2M8EA 4EJWA 4EM1A 2FQ3A 4ENMA 4K2EA 1Z7UA 1BJAA 3TOBA 1XCVA 3ECOA 4OIOF 6PAXA 3VOEA 4Q4ZF 1ZLKA 2P5KA 4IRGA 2D45A 2CO5A 2DO7A 1QPMA 3GEZA 2DU9A 2GA2A 4MGRA 4MHGA 1L3LA 1MGTA 4S04A 2R3SA 2KRFA 4Y17A 5LEJA 2GAUA 1HW1A 1U5TB 2DT5A 3CUOA 4I01A 1FWZA 1G3SA 4CHUA 5LGNA 1KU2A 4M74A 3ROUA 1H9GA 3G3ZA 2JZYA 1ZRCA 2Z99A 4RGXA 1ZRFA 2XUBA 5LRRA 2ZMEB 1GXPA 3JTHA 4WF2A 3DQVC 4B8XA 3GO5A 4M9SA 3F72A 1TQPA 3M9AA 1I6XA 3IKVA 4U7DA 2GXBA 4UV9A 5CYVA 2QQAA 5L3GA 4BNCA 4GCVA 2C6YA 3L9FA 4OIQF 2JSCA 5DV5A 4S05A 4HF1A 1HXDA 1FPQA 2EWNA 2VC0A 4PGGA 3J80Z 2HYFA 5ICEA 4I98B 5HLIA 1IXRC 1PP7U 1XGSA 2NYXA 3JSPA 2QZ8A 3HRTA 1B6AA 1MZBA 4IJAA 1DUXC 3R61A 2V1DA 3DKWA 5HOOA 1LDDA 2NNNA 4AVPA 2VODA 2L02A 4O6JA 3IKTA 3WGHA 1Z6TA 4N0BA 4MEYF 2H09A 3R0AA 1U2WA 2MLGA 3TO7A 1X3UA 2PMUA 3E5XA 4ESJA 2WV0A 4UNOA 5JHUA 5D5XB 2RV8A 4KIGA 5DUKA 4G6DA 1IN4A 2OAZA 3QU3A 5HDNA 3RYPA 2RN7A 3JW4A 1ZGAA 2ESNA 4MTDA 4EJUA 4KT5C 1BI0A 2LSOA 2VT3A 5IT3A 3KP3A 4RGSA 3KP7A 3SXYA 1SMYF 2XIGA 3L00A 2PFBA 1T39A 3C7JA 4HF0A 4Q47A 1XGNA 1ZN2A 1SFUA 1C0WA 1ZREA 1F1ZA 3E6DA 2COMA 4HLXA 3K0LA 5LEKA 3WGIA 3KP4A 1F4KA 4ESFA 1H0MA 4KN7X 3HUGA 2HTJA 2ZMEA 3J81Z 2YPRA 4LK0F 2K4BA 2HZTA 2P5LC 2P6TA 5BOXA 5DCMA 2Z5UA 1BN5A 3TO9A 4YFXF 4JK1X 1AOYA 3FHZA 4KIBA 3EUHA 1IAWA 5FD5A 4IXAA 2QVOA 2W57A 1I1GA 3U9GA 4BXUA 3IRRA 1B1BA 3EETA 4I0BA 3N97A 3RJPA 5F64A 1R5GA 4UXNA 5D8KB 4ENNA 1KQ8A 3KETA 4IF4A 2H6BA 2YR2A 3H3UA 1IW7F 1I5ZA 4ZYEA 3L7WA 3K2ZA 2O6GE 2K86A 5E17F 5HS7A 3MEXA 2MLKA 2Q0OA 3G73A 3IWFA 2PQ8A 2PMHA 1O7LA 2XKPA 3S2WA 3QRFF 5E8GA 2FEZA 2VBZA 3ZN0A 1QZZA 3GUDA 2RGVA 2BBYA 1O57A 4UHTA 3HHHA 1XMKA 3GFIA 3RDIA 2IJLA 2EFOA 2STTA 1UHWA 1BI1A 2G7HA 3K1PA 1YTYA 4N9IA 1D8KA 3FXQA 1SD4A 3MZYA 2RKHA 2EK5A 1ON2A 3WTVC 3T5XA 4GXOA 3LA3A 1IUYA 2GA1A 1F5TA 3I58A 4RB3C 2XAJA 3F8BA 3WTXC 2W24A 4BYYA 1ZG1A 4WX9A 2OQRA 1IXCA 3BWGA 4ON0A 4JQFA 1SFEA 4G8XA 4R1HA 2FBHA 5ICFA 5A2QZ 1ON1A 3LAJA 2HKXA 4UVBA 3I59B 1GVJA 3BPXA 3QP6A 1ZG3A 2FF4A 1NHAA 1P2FA 2B0LA 5BQTA 2IW5A 1YG2A 3R6SA 3C3WA 2KIFA 3L2CA 3LFKA 2HYGD 3TDUC 1O3SA 4GO1A 1S7OA 3B73A 5D8LB 3NRVA 3ABUA 2ESHA 2A6EF 1OR7A 1G6NA 2UXNA 2MBFA 3FM5A 2DK8A 2YX4A 1REPC 1IRFA 2F5DA 2K02A 1SD6A 4A6EA 1MJAA 2QBYB 3TGNA 1OKRA 2QQ9A 2IVMA 3ABTA 2QYOA 4Q5SF 2HGCA 1B59A 2FOKA 3EYYA 1Z91A 2D1HA 3Q9VA 1FLIA 3T8RA 2STWA 5L3DA 5FB2A 4QWQA 3NEUA 2NAZA 1E17A 1IZ1A 1R58A 1AWCA 2Y48A 1STZA 3TOAA 3U1DA 1FX7A 1W5TA 2O8XA 3KEQA 1ZH5A 1KA8A 1J9IA 3WE3A 1MDMA 3BJOA 3ZQ7A 4OMZA 2VOPA 3LWFA 4AIKA 1FBQA 1IN5A 2VBYA 3I4PA 2FMYA 1KYWA 3MWMA 4EM2A 2JTVA 1RNLA 1IF1A 4MEXF 2A5YB 1ONVA 2P8TA 4WK8F 1XCBA 3FMQA 3HTUA 1RIOH 4WXDA 4GGGA 4GYGA 1D8JA 1HW5A 2ADUA 5J8CA 5JI6A 4O3MA 2HS5A 4UVAA 1WKMA 4MQ9F 2DPUA 4LD5A 2FMLA 5DEQA 4U0YA 4KN4X 4U7BA 1BC7C 3RI4A 1G3TA 3GW2A 1XSDA 4XSXF 3VODA 1ZHFA 1YYVA 4KDPA 5LBQA 3FM3A 1XGMA 2KJCA 2OZ6A 2KIMA 4L5IA 4RB2C 2PJPA 2HWVA 1FOKA 1R36A 3IWZA 2LNBA 2VE9A 2OD5A 4L0ZB 2GQQA 4KFCA 4OIPF 4G6QA 3GXOA 3T1BA 3P7NA 4HOBA 1W7PA 2P5VA 3MAJA 4HDVA 3T8TA 4M9ZA 3C18A 5DCFA 3TDZC 3W6KB 2AXLA 2QBYA 4HX8A 4ASNA 3KZZA 2Q8KA 1SD7A 3BDDA 4NHJA 1QGPA 5E8IA 4HYEA 1B4AA 1RUNA 5DYMA 4HF2A 1SAXA 2DK5A 3MZHA 2CQKA 1FBSA 3ZP5A 4LK1F 2V6CA 2E7XA 2DTRA 4WWCA 2EV0A 5H20A 2R7FA 2L4MA 2VE8A 5ICCA 3TQNA 4WCGA 1KQ0A 1DDNA 2XHKA 3V8KA 5ILVA 4LJZF 4BH9A 3O3KA 4WXHA 5HDGA 5BPDA 4L18B 2O03A 3GF2A 3KLOA 1ZRDA 4FX0A 2CWEA 1L0OC 4HBLA 2JPCA 4JBAA 2DQRA 4Y15A 2CSOA 3TKYA 1XSVA 2VT2A 3BJ6A 2PI0A 4L9JA 2EFNA 3CTAA 1USTA 4P9UA 5F1RA 1R23A 1IRGA 1WRJA 2XGXA 3M8EA 1BOAA 1T6SA 4RB1A 4AWXB 3BY6A 3J7AO 3EDPA 1U5TA 3ISPA 5JR3A 1W4MA 1R00A 3ZMZA 1S29A 3WTWC 1P92A 1WI9A 1R1VA 3P9KA 3P9IA 1DP7P 4HDUA 1KQ9A 3F22A 3FXUA 3GWZA 2XASA 3HSRA 2XAFA 2K4JA 4N9HA 3B02A 4Q48A 1TQMA 4QLCU 2NS0A 1T38A 5ERIA 1LJ9A 3QU6A 2CW0F 2OBPA 3KCCA 1K78B 3RKWA 1J0RA 4MQVA 3DF8A 1O3TA 1Z6RA 1LQ1A 2ZNYA 1TBXA 1FSHA 2QWWA 4IRHA 2RQPA 5LHIA 3E6MA 2KIUA 3I59A 4EM0B 2VBXA 2VBWA 1T2KA 3SFZA 4ETSA 4CYDA 4PGHA 2MD5A 3DFGA 3VFZA 5D6EA 1TNSA 4FT8A 1HQCA 4YFNF 3F8MA 4OIRF 5LHGA 2M87A 2WTEA 3LQQA 1CF7B 1XDUA 1H9TA 1V4RA 3HTSB 2W25A 3LA7A 2W84A 1LEBA 5FFZA 2JT1A 1R1UA 4AIHA 1YLFA 2UXXA 1QO0D 2E1NA 2CYYA 4XSZF 3V4GA 2MC3A 5A2QK 1MKMA 1EH7A 3VEPA 4G7ZF 1KU7A 2VOOA 1P4AA 1W7PB 1FSEA 4KMUX 3RKYA 3V7CA 2QM3A 1S7AA 3M8FA 2EFQA 3QPTA 5DD4A 1MJBA 2A68F 4ZH4F 4U0WA 1XD7A 2OQGA 3ZMVA 3E6CC 3DPLC 5TRDA 2Z9OA 4HAMA 2XAGA 4CICA 2BE5F 1YO5C 2M1BA 1Z9CA 1IN8A 1FYKA 2AS5F 4EJVA 4A0ZA 4GYIA 1JHHA 4CZZA 1YW8A 5L3EA 2O61A 3KLNA 1Z1DA 2FNPA 5J8FA 3CUQC 2GWRA 3F23A 2DPDA 2R7DA 3GFMA 1FNNA 3K69A 3WE2A 4RB0A 4EQQA 2G7UA 3COAC 3CUQB 5KK1A 4EJOA 4B09A 3HSEA 4KNYA 5IT9K 4MTEA 4I7HA 4M6YA 4LLNA 1K6OA 4DQ2A 3KE2A 5K1YA 1OYYA 4A0XA 1V3FA 3DEUA 2CG4A 2VXZA 3BP8A 1B9NA 2DLLA 3WTSC 2FNAA 3KFWX 2BGCA 5BS6A 1K7AA 4F7ZA 3E3VA 4LLLA 3KZYA 4UUVA 3I5UA 3O2PE 2Z3YA 5L3FA 3WU0A 5FD6A 1G3WA 5DUIA 1IXSB 2YX7A 3FMSA 1ULYA 4RS8A 1KU9A 2L4AA 4IVNA 4M71A 5FFXA 4HV6A 4L9TA 5ICGA 3ZMTA 1U5TC 1J5YA 2H27A 2DI3A 2J5PA 2WC2A 2EFPA 2FA5A 3BOQA 3JSOA 4G9YA 5IT9Z 5FLXK 3GLXA 2ACJA 2XAQA 2J5OA 1XSXA 3DPTA 1PDNC 3LA2A 5ILUA 2XAHA 4A0YA 1FY7A 2F5EA 3SQNA 3HYIA 4I09A 4KUMA 4UV8A 1VTNC 4IRIA 5DDGA 2ZO4A 3FX3A 2YU3A 4A5MA 3RIRA 3IL2A 4U0VA 5D5WB 3QPHA 1OYIA 4OU0A 4MNUA 2D1VA 1MDMB 2IP2A 1O7FA 4KMFA 3ECHA 4EV0A 2GIVA 4XLNF 5EEHA 3I71A 3CO7C 3WGGA 5LRSA 5CVJA 2FRHA 1U78A 4IHTA 4EJTA 2V79A 1R1TA 4UVCA 4YFKF 5AIPA 5FLXZ 1G3YA 3WU1B 1D5VA 2PG4A 5JFRA 5HS8A 4L9VA 1HW2A 3D5LA 3LQRA 1RI7A 3BPVA 1KGSA 3ZN1A 2ISZA 4ENJA 2ISYA 5E18F 2VONA 4FX4A 3E97A 4HA8A 1WWXA 4LG0B 2YSRA 3LAPA 2BV6A 5EEGA 2W85A 1F9NA 4LFUA 1HBXG 1QBJA 2HOEA 1JXSA 4ENKA 2FU4A 3R0JA 4BHCA 2G9WA 2P7VB 2P7CB 4A5NA 3F8CA 3ZPLA 1I1SA 4IPAA 2K27A 3D0SA 2GZWA 4L0YB 1LNWA 5LGTA 3ZMDA 4KA4A 2MH2A 2HDCA 1IN7A 2PEXA 2ZJ2A 2JPBA 1FC3A 4BQAA 3V8LA 2ZNZA 3EYIA 2VC1A 1BI3A 2FE3A 3MQ0A 2ZCWA 2EA4A 4U88A 5F6FA 1G4DA 4R8HA 4G7HF 4ZZLA 3K9TA 3DXJF 1A04A 1CF7A 1EV7A 1HSTA 1YQAA 2V9VA 2HKOA 3ZMSA 2PLYA 1CGPA 3RKXA 1Y0UA 1J59A 4G7OF 3F8NA 2MH9A 1JGSA
chains in the Genus database with same CATH superfamily
4H0EA 2DFIA 1QZYA 2JA2A 2XB5A 2EV5A 4AIJA 2HQRA 3HRSA 5JVTA 4B3AA 1XMAA 3E0JB 4M72A 3M07A 2I5UA 4OMYA 3ELKA 1KYZA 2DJIA 2KISA 1BIAA 4PSWA 1MMGA 3TW7A 4EVIA 2DMPA 3DBHB 1U6GA 5D4SA 4E70A 2ZJPF 2VN2A 1IN6A 1FYLA 5E1ZB 3I0TA 1D1BA 1Z3XA 3H36A 4IQ4A 5IYCJ 4LG0A 1SVOA 4NQWB 3VSKA 2E71A 5GP9A 1IC8A 4Y52J 3V7RA 2HI3A 3ABMH 4RGUA 4IZZA 1R5ID 1W0UA 5HDKA 4ZTJA 2Y75A 4AUXA 3BG6A 5CVRA 4LIUA 1BM9A 2RNJA 4D7MA 1WPKA 2HOSA 2QF7A 3U2RA 3WTYC 4M3GA 1GVDA 5HLTA 2A3SA 3QYBA 1LDKB 1VQ4I 3QP5A 3U1KA 2L54A 2BVLA 2HR3A 3FWEA 5K5QA 2KP6A 4HLYA 3E5QA 3I53A 3QOEA 1U9NA 1BW6A 2XV4S 4G6TB 3FKJA 3OS1A 1BL0A 1TW3A 3SFIA 3S3NA 3F0CA 3H0GJ 1B9MA 3O6BB 1J7KA 1H8AC 3K4CA 1X1PA 4LOCA 3CDHA 4JOMA 2LF8A 1LB2A 5JHFA 3HRUA 1ZGJA 2EZIA 4LB6B 2NNYA 1GDTA 2HQ5A 4R79A 2IS6A 1P4WA 1TWHJ 2ZSIB 1D1CA 1R22A 1E3OC 1OMIA 2MA3A 2IT0A 3LMMA 1VQ7I 3HIFA 3PNTA 3REOA 3WTTC 2CGPA 4EMSA 3S3OA 2H6CA 1EH8A 2F5FA 4HW0A 1FZPB 2ID6A 1JE8A 4M73A 5D4RA 2HEOA 2N8GA 2A69F 4MLOA 1K6YA 2IA1A 3HGGA 3SEZA 4AM3A 3W6JB 2XF6A 2RNGA 3MCZA 2K9NA 4KICA 2V1UA 2ECBA 5EZHA 4HX7A 2CV0A 5C44J 3CUQA 1S6LA 1MH3A 2CUJA 3SZTA 3IHUA 4AC0A 3F6VA 3R4KA 1FP2A 2DDBA 1LFBA 3FXRA 2PN6A 1JHFA 4E7KA 2JN6A 2W7NA 1HKSA 5EG0A 2R7WA 5K7ZA 3BR0A 3C1DA 2TDXA 2O3FA 1GHCA 1MBFA 1HKTA 3LSPA 5ED4A 2IGOA 1B72B 2UWMA 3ASNH 2LKPA 3PQKA 4CXFA 4CCOA 4BXFA 2A5WA 1K4SA 3G71I 2FSWA 3C2HA 1IDZA 4Y4RA 3S1RJ 1ZARA 1IGNA 2E2JJ 1KU3A 2FOWA 2VASA 3GZ6A 4ZDLA 4A6DA 2L2OA 3CP8A 3QAHA 1ZAOA 4IL6C 2YU9J 2O5RA 4EGZA 2ETHA 2IS1A 3CCRI 3HOVJ 1K79A 4PDKA 2XVCA 1OYWA 4EGYA 2CQ7A 1Y6IA 4C3HJ 5ILSA 2P4WA 5IPAA 4ESBA 4AVZA 4ZDPA 1BW5A 4FISA 3RQ4A 1YJWI 4CCNA 3DP7A 2L01A 2EZKA 5FLXR 1E2XA 1FP1D 1V54H 2IAIA 4NQWA 5J40A 5IOZA 2DA2A 1MSEC 3HPHA 5LHHA 5BPIA 4RAYA 4BAYA 2GOXB 2HQAA 1WFXA 1MNMC 2FBIA 1R49A 1FOXA 4XOTA 1YITI 4B4CA 1MD0A 1H88C 2E2HJ 2LLKA 3R60A 3GX4X 1YW7A 4I02A 4P9FA 3OR1C 1ZYRF 1TW2A 2K9SA 3H3ZA 2DQLA 2OTLI 1P4XA 4XBFA 3JR9A 2JA7J 3A0BC 3MN2A 5E1WA 2P6SA 1R4MB 1IV8A 2F4OB 1TNTA 3H5AA 1FJLA 3OIPA 2NVQJ 5J4YA 3KP2A 3H3VK 3LNQA 3OYLA 3KIOA 1HSJA 1WJ5A 4YIFA 1MJ9A 3J81K 2Y69H 2RVCA 3DV8A 3GZ5A 1O4XA 1XN7A 2JRTA 1ETKA 2KIQA 3TP3A 4M9XA 3ERED 2Z33A 5M5XJ 3OYFA 1O3QA 3OOPA 2R5YB 5CLSA 3BR5A 3BG9A 2HOAA 3CC7I 3L09A 2OZUA 2PBIA 3OYCA 4F3QA 1PP8F 5FGMA 5KVRA 1BI2A 2KKOA 2UZKA 1APLC 4A3CJ 3GVAA 5H6QA 1R7JA 2HTSA 5AIQA 3H92A 1QZEA 3SDBA 5K7HA 3UKGA 2OV7A 2QUFA 3DTIA 4EATA 5LLQA 3JAMK 1GXQA 4HZFA 1BC8C 3GZNB 1FMWA 4BACA 3TO6A 4Y13A 3PIPF 1JT0A 1D0YA 4RBOA 4I2OA 5E20A 3M1EA 2DJNA 3HXLA 3E5UA 3LSMA 1LE8A 2JA5J 5F0CA 2VL8A 5DCMB 3WODF 2ZXJA 2R4GA 4LLGF 4PCQA 3PQJA 1SFXA 1TWAJ 4HV5A 3K70D 5L3BA 2IA0A 4XLHA 1D0XA 2KJBA 5M5WJ 4QIWN 1DP3A 4CDGA 5GTIC 1Y1VJ 1YHQI 4PJMA 3PFIA 1R5HA 3EPZA 2CFXA 4BBRJ 2F6CA 3W2WA 2F2EA 2M30A 3HUGB 5KAIC 4LIVA 1Y8RB 2DA4A 1EH6A 2QA4I 3CLQA 3FMRA 2LK2A 3BR2A 2IA2A 3F3XA 2X9DA 1JKPC 1YFHA 3PNVA 1WI3A 4C3IJ 3HJEA 3E6BA 2XF7A 3CJNA 3RSNA 1SANA 2V1XA 2LG4A 4WXCA 3OR2C 2VKHA 2E7WA 2LD5A 3QOPA 1IUFA 3OIQA 1UFMA 5EGOA 3HGYA 3OIOA 2EA2A 3KP5A 4A2UA 1R9TJ 3Q9SA 3HOTA 2L3DA 3DKXA 1BIBA 1YS7A 1UB9A 3FBIB 3J7AW 2WB1N 5D5VB 4A3FJ 3JAMZ 3JAMR 2QQBA 2BEOA 3Q5FA 4ZYHA 2W1OA 1TZLA 2E1CA 4IHSA 1HKQA 2EJRA 3VB2A 1OCTC 2DA7A 2K5CA 3H5RA 1VFCA 2K3PA 3E7LA 1GUUA 3SZPA 1DQUA 2FX0A 3EQLF 3KEOA 3MFKA 1S3JA 4FHTA 4OOIA 3HOSA 3ZMUA 4XQFA 2ZFWA 1H89C 3HSFA 5C4JJ 3F8FA 3VSLA 4XN0A 3J80K 4I0AA 5HVQC 1NH3A 1HF0A 1QHHD 4AIDA 2LP0A 4LMYA 2XRNA 1DPRA 4ITVA 2VKEA 3FZVA 4A3DJ 5HLGA 5TJJA 3KP6A 2BHZA 1SMTA 2OF7A 1T08B 1DGRM 5E3OA 2M5WA 4ZZDA 5CVVA 1G59A 4MIMA 1J75A 1TTYA 3GTPJ 1FMVA 1DPUA 1YW9A 1WSUA 3IUOA 1JTYA 2YS9A 3A1YA 2K9MA 4BHPA 4D1QA 1V5FA 3K1MA 4AD9A 5BNGA 3E1SA 4E7ZA 3FXOA 1FT9A 1S8NA 2H94A 4PZJA 1UHMA 4HQEA 3ZQLA 2RC4A 2XPVA 4LGWA 1MBGA 4NB5A 5CJ9A 3JRGA 2CV1A 3TMOA 1RUOA 2WAQA 1RZ4A 3BR6A 4L9NA 3CO6C 2JQ7A 5F08A 1PUEE 3AAFA 4KYWA 1UMQA 4BBSJ 1FYMA 5D6FA 3RTRA 4QTRA 4BGDA 5J6XA 1RQ6A 2Y9ZA 5J3LA 3NQOA 3ZCOA 3W6VA 1RPWA 1G2HA 1YIOA 4XLPF 3LSTA 1QPIA 3I4NJ 3JRFA 5KNLA 2Z2SB 2WY8Q 2E1MB 3RPQA 1O3RA 4KJZA 3PO3J 2K40A 4X6AJ 2WB1A 4OINF 1SD5A 1WJAA 1USSA 1ZELA 4CSWA 4CCMA 3RPUA 2HPIA 5K5OA 4A12A 3ASOH 3ESWB 3OL3A 1MBHA 3SDGA 2R5ZB 2L9VA 4XORA 2HXOA 2EV6A 3GFJA 3ML6A 3OV8A 4YG2F 5D5UB 2AQEA 2RAEA 3ZQHA 2RDPA 3AG4H 3QPLA 1QNTA 1FEXA 2RREA 3TL4X 5H2FC 1XDSA 1D5YA 4PJLA 2LY9A 1TQIA 1UHSA 1W7PD 2DODA 1U3EM 1K78A 4O5VA 3MKZA 2BY3A 2X6YA 1W5SA 2E2IJ 1SFKA 3F6OA 2XROA 3PL8A 2H8WA 2M45A 3HG9A 2BVMA 2JVHA 3FK7A 2JUCA 4DGWB 1P7IA 2O0YA 2JSPA 3H0DA 4M6XA 2FBKA 5CVUA 2LR8A 4CO8A 1QU3A 2DAOA 3RYRA 1D1AA 3ULQB 2GXAA 1YIJI 1ODDA 2R7UA 4DOZA 5AONA 3M7GA 5FO5A 4HNUA 4RGRA 2VB6A 4KITB 1HA8A 1BR2A 4F52A 1K83J 1ETYA 3J7YJ 2E35A 2FD5A 5DD8A 5L3CA 1E3HA 2Z16A 2ZBKA 4D0PA 2HFHA 4V19K 1ZGWA 4J19A 1NTCA 3RZDJ 1WQ2A 3T0YA 5HNHA 1LVAA 1OPCA 1EA3A 3BJAA 1P6RA 3OMYA 1XGOA 4RAFA 2F5CA 2GXGA 5H6RA 1BBYA 3WTZA 4RLFA 4BHBA 4HSTA 1YS6A 3OYJA 2COBA 2L7KA 3MZ8A 1QHGA 2GOMA 2LF7A 4ZYGA 5EGOB 1ZLJA 2HOTA 2VQLA 2Y0MA 2VKDA 3EUHC 2DBBA 3ZXSA 3GYHX 3BZ6A 1MNEA 3ZQGA 1DU6A 3SHFA 2DA5A 3OYKA 2AQFA 1J2XA 2HNHA 2ZJQF 2EB7A 5E1XA 3FF5A 1UCRA 3S1NJ 3N4MA 1GV2A 1LUJB 2DW4A 2X4HA 2Q2EA 2IRFG 3I64A 1UG0A 1FBUA 5GAHJ 2BYVE 5FKMA 1T98A 2K7LA 1OCRH 3FXJA 2D2WA 1QVTA 2HDWA 1Q1HA 4LB5A 4P96A 3H5NA 2E1OA 4N4NB 3OYBA 5GAGJ 1M1EB 2HQNA 2VKVA 4XM3A 2LDUA 4IQJA 4RM2A 4B3XA 1ZG5A 1W36C 2ELHA 4KIFA 2IS2A 3FXMA 4ZYDA 4MFDA 1T0FA 3FK6A 2QLZA 2CQNA 3JCUC 1VQKI 3GFLA 4RAZA 4YIIA 1U8RA 3PIOF 2ZKZA 3V8JA 4XRFA 3IRQA 3DEEA 2A07F 2R7TA 3P9CA 2A6HF 4I99C 4II2A 4Z6YA 2EFWA 5E79C 1LFUP 2F48A 4G94A 1T0FC 3WTUC 2TRTA 1R4NB 1X3WB 5EZGA 5LGUA 1Z0XA 3BC8A 2WWYA 3K1NA 3ZQCA 4P55A 2CUZA 4XLCA 1LDJA 4OAYA 5CVIA 3VYTB 5HLHA 2OA4A 3BCAA 3IC7A 4PK4A 5HS9A 2QENA 4XICA 1D3YA 3HRMA 4ZYAA 5C4XJ 1FIPA 1OISA 1Z05A 4RM3A 4D5FA 5K5RA 2E1MC 2GLOA 1I27A 3BLYA 3GLLA 2NRAC 2K85A 5BMZA 2FXAA 4DNCA 4M3FA 3JTGA 3BROA 4FTHA 4HX4A 4P5OA 4UB8C 3WG9A 4S0HB 1MNDA 3MVPA 5KHDA 2JA8J 1WVRA 2XKOA 4HQMA 4D5CA 3F21A 2DFFA 2M2EA 3Q3SA 1LEAA 2IPQX 1K61A 2V9KA 3K2AA 5F0FA 2MGQA 3I54A 2Y0SA 3V7SA 5B66C 4ZC3A 2KRCA 3CF2A 2VLAA 4E7IA 1XB4A 1SFOJ 2ELKA 3CLOA 1TLHB 1Y56A 5FLVA 3HKZA 2OU2A 3ONQA 4L5JA 2R93J 4Z2YA 3LSGA 4HNVA 2X0LA 4TV7A 4CGZA 1QQIA 2A61A 2EILH 2OTJI 3HHGA 2M8EA 4EJWA 4EM1A 2XB0X 1PYVA 5F27A 2W4SA 2FQ3A 4ENMA 1X1DA 4K2EA 2V26A 5HNFA 1RETA 3CD6I 1Z7UA 1BJAA 3TOBA 1XCVA 2ZB9A 4PFPA 4Y33A 3ECOA 4OIOF 6PAXA 3GMEA 4DW6A 4F93B 2MVTA 1LFPA 4J00A 3VOEA 3GTKJ 1POGA 2WAQN 3FKIJ 4Q4ZF 1ZLKA 2P5KA 4IRGA 2D45A 2NVTJ 3Q0WA 2CO5A 2DO7A 1YX3A 1QPMA 3GEZA 4B43A 2DU9A 2GA2A 4MGRA 3ZQIA 4MHGA 2YUSA 2KDZA 1L3LA 1MGTA 2NVXJ 4S04A 2R3SA 2VJIA 3PUFA 3ZOBA 2KRFA 5EEAA 2DXIA 4Y17A 5LEJA 3C2GA 2GAUA 2R7XA 1WH7A 1HW1A 1U5TB 3S17J 4A3MJ 2H1LA 2DT5A 3CUOA 1T95A 2LFBA 4I01A 1FWZA 1ETXA 1G3SA 4CHUA 4CZCA 2Q1ZB 1VZ0A 2M0CA 3O8GA 5B1BH 1KU2A 2XPUA 5LGNA 4M74A 3ROUA 1H9GA 3G3ZA 2E19A 2JZYA 2NS8A 4GRIA 3L1PA 4BE2A 1ZRCA 2Z99A 4RGXA 1ZRFA 2XUBA 1TT5B 5LRRA 3OYMA 2ZMEB 2L5QA 3JTHA 1GXPA 2L9SA 4WF2A 3FXKA 4BJ6C 1MW7A 1TWGJ 3QQAA 3DQVC 4B8XA 2D5VA 1TP4A 3GO5A 4M9SA 3F72A 4IKFA 2LY2A 1TQPA 1GLNA 3M9AA 1I6XA 1TT0A 2QCOA 3IKVA 4U7DA 2CS3A 3PFYA 2GXBA 2E36A 4UV9A 2QQAA 5CYVA 5L3GA 4BNCA 4A3BJ 4GCVA 2O8KA 2C6YA 3L9FA 4OIQF 2JSCA 1IV6A 5DM7F 3CZ6A 3A03A 5DV5A 2PJRA 4S05A 4HF1A 4ABZA 1AKHB 1HXDA 1FPQA 2PJRB 3QODA 2EWNA 2VC0A 3CESA 4PGGA 3J80Z 1JJ6C 4GFBA 2EIMH 2HYFA 3PNYA 3NWSA 5ICEA 4I98B 2QKLB 5HLIA 1IXRC 4CUGA 1PP7U 3FHNA 1B8IA 1XGSA 1B72A 1RKTA 3CCJI 2NYXA 3JSPA 1Z77A 2QZ8A 3HRTA 2X1DA 5GADJ 3OY9A 5KAFC 2LY1A 2KFDA 1B6AA 3CC4I 1N75A 1W36D 2F5VA 1OCCH 4U87A 1MZBA 4IJAA 1DUXC 3R61A 2V1DA 3DKWA 2KLOA 5HOOA 1LDDA 4E7HA 2NNNA 2NVUB 1PVEA 4M3EA 1MSFC 2VIXA 2XSDC 4AVPA 1JT6A 2MD0A 2VODA 2L02A 3CCEI 4O6JA 3IKTA 5KCMA 3WGHA 1Z6TA 3J7ZI 4N0BA 4MEYF 2H09A 4RAGA 2I8DA 2ZJRF 5EYRA 3R0AA 1U2WA 1Z3YA 2MLGA 1MIJA 3TO7A 1JUPA 1X3UA 3E5XA 2CQQA 2PMUA 1X4PA 4CYCB 2V1NA 4M3BA 4ESJA 3OWTA 2WV0A 4BY7J 2NOJB 4CCJA 1X4OA 1IJWC 4UNOA 5JHUA 4UY8I 5D5XB 4YRVA 1TWCJ 2RV8A 4KIGA 5DUKA 4G6DA 1IN4A 2IGMA 2L9NA 2BW3B 2OAZA 3X2QH 3RPUD 3QU3A 2IEKA 5HDNA 2ZSHB 3RYPA 1A36A 1MMSA 2RN7A 3M3YJ 3JW4A 1ZGAA 2ESNA 1AHDP 4RMNA 1I3QJ 4MTDA 4EJUA 2QSGX 4KT5C 1BI0A 2LSOA 1WHUA 1QRYA 2VT3A 5IT3A 4II3A 3KP3A 1U8BA 4RGSA 3KP7A 3SXYA 1HLVA 4IOCF 1SMYF 2XIGA 2LREA 1V55H 3L00A 2PFBA 3K10A 1T39A 3C7JA 3BZKA 3LFUA 2EIKH 4HF0A 4B1RA 5J4VA 4ZJZA 2L0KA 2JJ7A 4BE0A 1LVKA 2ICWG 4Q47A 4A3LJ 1XGNA 1ZN2A 1SEUA 2XSJC 1SFUA 1C0WA 1ZREA 4W97A 4DZJA 1F1ZA 3E6DA 2COMA 1WH5A 4HLXA 3AG3H 3HOYJ 2ZMEC 3K0LA 1ETOA 3LSIA 3O8HA 3S1MJ 5LEKA 4E7SA 3H9GA 3WGIA 3OYHA 3PJRA 3KP4A 3GCMA 1F4KA 1ETQA 1A5JA 4ESFA 4MO7A 5J1YA 1J09A 4KN7X 1H0MA 3HUGA 2AO9A 2HTJA 2ZMEA 5LFAA 3RZOJ 3J81Z 2YPRA 4LK0F 3WHBA 2K4BA 2HZTA 2P5LC 1Z67A 3OS0A 4L5EA 2P6TA 3KYCB 4AYBA 1PUFB 5BOXA 1N25A 5DCMA 3BG3A 2Z5UA 1BN5A 3TO9A 4YFXF 4GDFA 3LSHA 4JK1X 5C3EJ 4MFEA 1AOYA 3FHZA 1S5LC 2CW7A 3EUHA 4KIBA 1IAWA 5FD5A 2DMQA 4IXAA 3NWTA 2QGUA 2QVOA 2W57A 1I1GA 3U9GA 4BXUA 3IRRA 1B1BA 3EETA 4XLAA 4I0BA 5M5YJ 1ZR4A 2EQRA 3RJPA 5F64A 3N97A 2W82A 3CP2A 3L2VA 1XC5A 3JRDA 4FETA 2Y2ZA 3I3LA 1R5GA 4XLFA 4UXNA 3I56I 5D8KB 3D5RC 4ENNA 1KQ8A 3KETA 3FIWA 4IO9F 4BQOA 4NNJA 4IF4A 2H6BA 2YR2A 1WJEA 3PSFA 4DBQA 3H3UA 1WJCA 3DWLE 1ETWA 1IW7F 3PM1A 1I5ZA 4G12A 2DYSH 1RKWA 5K7FA 1YI2I 3A02A 3HC7A 3LL7A 3L7WA 4ZYEA 3K2ZA 3JRIA 3GTLJ 2O6GE 2XGCA 2K86A 1Q1VA 5E17F 2ZFUA 5HS7A 3MEXA 2MLKA 2Q0OA 3M8JA 3G73A 1AA7A 5IOYA 3IWFA 2PQ8A 2R5YA 5A2QR 2PMHA 1O7LA 2XKPA 3S2WA 3QRFF 5E8GA 2MC4A 3W2VA 3CCMI 2FEZA 2VBZA 3ZN0A 1QZZA 2K9LA 3GUDA 2XPWA 1WZ2A 4KT6A 2RGVA 2M9HA 3D1NI 2BBYA 1O57A 4UHTA 3HHHA 1FIAA 2R0QC 2KDOA 2VXDA 1KONA 1XMKA 2X1EA 3RDIA 3GFIA 3CCVI 2IJLA 2EFOA 3HOZJ 2H8RA 2STTA 3DPUA 1UHWA 1BI1A 1JJ8C 2G7HA 3K1PA 3MKLA 4ZDOA 1YTYA 3NAUA 3ZQFA 4N9IA 3MMYB 1D8KA 2Y30A 3HZJA 3FXQA 3Q0UA 1SD4A 5E3NA 3MZYA 2RKHA 1VQOI 2EK5A 1ON2A 3WTVC 3OYAA 3HDDA 3T5XA 4GXOA 3LA3A 1IUYA 2GA1A 4BEHA 3DLLF 3I58A 1F5TA 4M6VA 4RB3C 2XAJA 3F8BA 3WTXC 1ORKA 1ZR2A 4BEHB 3FXLA 2W24A 4BYYA 1ZG1A 4WX9A 4PJ0C 2OQRA 4HSRA 2B9SA 1IXCA 2R7ZJ 4UB6C 3BWGA 4ON0A 3A52A 4JQFA 2IXSA 1SFEA 4G8XA 4R1HA 2FBHA 5ICFA 5A2QZ 1ON1A 4NDLA 4C2TA 3LAJA 2NVYJ 2HKXA 4UVBA 1WJFA 3I59B 1GVJA 2L7MP 3BPXA 4JP0A 3QP6A 3B6AA 1ZG3A 2LOOA 2FF4A 4E4HA 1NHAA 2BXYA 1P2FA 2B0LA 4RLQA 1VQNI 5BQTA 5E3LA 2IW5A 1TC3C 1YG2A 3R6SA 4LG3A 3C3WA 2KIFA 4BS9A 3L2CA 3LFKA 2HYGD 2V7FA 4NBQA 3TDUC 2HU9A 1O3SA 4GO1A 1S7OA 1OR7C 3B73A 2V4JC 2MUNA 5D8LB 3NRVA 3ABUA 2ESHA 3GBGA 2ME0A 4BKXA 1ZTRA 2A6EF 1FTTA 2R7RA 2V6EA 4QPOA 2EZHA 1IDYA 3HBLA 1OR7A 4BUPA 2FUG2 1G6NA 2UXNA 2R7OA 2MBFA 3FM5A 1VQ5I 3PUBA 4DBRA 2DK8A 2YX4A 4B44A 3H9JA 1REPC 2F4IA 3CQZJ 1IRFA 3IAS2 2F5DA 2K02A 3IH4A 4JX5A 1SD6A 4X1EA 1MJAA 2MW8A 4A6EA 2QBYB 3BTLA 3H9QA 3TGNA 1K4TA 3ERMA 3MKYB 1OKRA 1BR4A 2ZXIA 1WGXA 1N78A 2IGKA 2QQ9A 1I39A 5FLMJ 1Y1WJ 2IVMA 3ABTA 2QYOA 2BOLA 2HVRA 4Q5SF 3AKZA 2HGCA 2EIJH 2ID3A 1B59A 3EYYA 2FOKA 3BTCA 3FDYA 1XG1A 4N4OB 2LMDA 2ECCA 4YEJA 3AG1H 1Z91A 3UNGC 1UJ8A 3S3MA 2D1HA 3Q9VA 2HZDA 2BY1A 3DTEA 1FLIA 3T8RA 2STWA 3EUKL 3CMEI 3LSKA 3ABKH 5L3DA 5FB2A 4QWQA 2KPMA 1A6QA 3NEUA 3SJMA 2CJJA 2I10A 2NAZA 4HNTA 4XIDA 1E17A 1IZ1A 2VQCA 4C30A 1RR8C 1R58A 2WY7Q 2JWTA 4BU2A 1AWCA 2Y48A 2JA6J 3K4LA 1STZA 5EF6A 1UAAA 3TOAA 3U1DA 5M3MJ 1FX7A 1W5TA 2DTZA 3C2BA 1MMAA 3HPGA 2O8XA 2DFHA 4A3IJ 3KEQA 3QPSA 1ZH5A 3DEWA 1A31A 1KA8A 2DA1A 5GPAA 1J9IA 3WE3A 1MDMA 3BJOA 3ZQ7A 4PJJA 2M34A 4OMZA 3CDIA 2VOPA 3CCSI 2DT7B 3LWFA 1XS9A 4AIKA 1FBQA 1IN5A 4A3GJ 2IGNA 2VBYA 3I4PA 4NC7A 3S1QJ 2FMYA 3S15J 1KYWA 2JTVA 1RNLA 3MWMA 3DLAA 4EM2A 1JKRC 4MEXF 1IF1A 2A5YB 1ONVA 4RA2A 1PUFA 4DYCA 2P8TA 4WK8F 1XCBA 3GTMJ 3HOXJ 2L9RA 3FMQA 3HTUA 4BQNA 3QWLA 4XK4A 1HOMA 3DKYA 1RIOH 3WHCA 4HG2A 4WXDA 4GGGA 4GYGA 1D8JA 3ZRGA 1HW5A 3FBNB 2ADUA 1BA5A 5J8CA 5JI6A 4ANJA 4IOAF 1ENHA 3WG7H 2HS5A 4O3MA 4UVAA 1WKMA 4MQ9F 2RQQA 2DPUA 2K3FA 1OCPA 4LD5A 1WCMJ 2FMLA 2QKMB 5DEQA 2W48A 4U0YA 4KN4X 5EG0B 4U7BA 1VQ6I 3WU2C 1MBKA 1SAUA 1BC7C 4HRIA 3TP0A 3RI4A 2V9PA 2Y0SN 1G3TA 1YJNI 3GW2A 1F43A 1XSDA 4NC8A 4XSXF 4XKWA 5GTHC 3VODA 1ZHFA 1YYVA 1NK2P 4EEFG 3CC2I 4KDPA 5LBQA 2CFOA 2Q2EB 3FM3A 1XGMA 2ELJA 2KJCA 1IRXA 2OZ6A 2KIMA 2M4KA 4L5IA 4RB2C 4BL0B 2PJPA 2HWVA 1FOKA 1FOWA 1R36A 2LNBA 3IWZA 2VE9A 2OD5A 4L0ZB 1RESA 2MYSA 2GQQA 4KFCA 4OIPF 3L2RA 4G6QA 5IY5H 3GXOA 3T1BA 3P7NA 4HOBA 4XMYA 4CCLA 1IG7A 3K6GA 1X1CA 2UUZA 3ZR8X 1W7PA 2P5VA 2OUMA 2IBDA 3MAJA 4HDVA 3CMYA 3RCOA 3T8TA 1UG2A 3C18A 4M9ZA 1IO2A 5DCFA 3TDZC 2CUFA 4F92B 1F36A 3W6KB 1V5EA 1X1AA 1I50J 2CMPA 2AXLA 2QBYA 4HX8A 2KRHA 4ASNA 3KZZA 2Q8KA 2DOAA 1SD7A 2JMWA 3BDDA 1LPQA 5FKNA 4NHJA 1ETVA 5B1AH 2EH3A 1JKOC 1QGPA 3TEDA 3G1MA 2DOFA 5E8IA 4HYEA 1B4AA 1RUNA 1X2NA 5DYMA 2AXTC 3OYDA 2XGDA 2BY2A 4HF2A 1SAXA 2M0MA 2DK5A 3MZHA 2CQKA 4KISA 4IHWA 2LRDA 1FBSA 1XX5A 3GTOJ 1EF4A 2CRGA 3ZP5A 3DCFA 3LSJA 2E5ZA 4LK1F 2V6CA 5IP7J 2E7XA 2DTRA 4WWCA 2EV0A 5H20A 2R7FA 2L4MA 2VE8A 2BHYA 4XKVA 5ICCA 2KQRA 3OSGA 2DT6A 3KYLA 1A6IA 2LVSA 3TQNA 4WCGA 1RC9A 1KQ0A 1KZHA 1DDNA 2XHKA 2XAUA 3V8KA 4NC6A 5ILVA 4LJZF 4BH9A 3QYFA 1Z21A 2JRMA 3O3KA 3GTGJ 4WXHA 5HDGA 5M3FJ 3S2HJ 5BPDA 5J1UA 5IP6A 4C2UA 1UELB 2R7VA 9ANTA 4L18B 2O03A 3GF2A 2O7OA 3KLOA 1ZRDA 2KT0A 4AU7A 3ABLH 4FX0A 3VPRA 2CWEA 1L0OC 1QVUA 4HBLA 2JPCA 3BTJA 2DQRA 4JBAA 3BR1A 4C9YA 4QPQA 4I6ZA 1YX5A 4Y15A 4XNFA 3K7AJ 2CSOA 3FISA 3TKYA 5FROA 4XL9A 3JRHA 5FRMA 1XSVA 2VT2A 2X6XA 3BJ6A 2PI0A 3KEYA 4L9JA 1X19A 2EFNA 3CTAA 1USTA 1ZK8A 1G8XA 2CH0A 4P9UA 3F9KA 5F1RA 1R23A 1S72I 1IRGA 3BG7A 1WRJA 2XGXA 2ME6A 3M8EA 2DDAA 1BOAA 5JLWA 3MD2A 4CA0A 1T6SA 4RB1A 4AWXB 2JVGA 1JUSA 2VUMJ 4IHYA 3BY6A 2E60A 4XRSA 3J7AO 4HPQA 2FQ4A 3EDPA 1U5TA 2X48A 3ISPA 5IYBJ 1W4MA 5JR3A 2B63J 1R00A 1OFCX 3ZMZA 2UV1A 3KX2A 1HCRA 1S29A 2WBMA 2L7ZA 2XF5A 3CDLA 3WTWC 1P92A 1WI9A 4FQGA 2HYJA 1R1VA 2PMZN 3P9KA 2K9QA 1ZKGA 2KL4A 1MH4A 1OJLA 4BDZA 2XRLA 3P9IA 3IH2A 5FRNA 2VJ4A 1DP7P 2DFEA 4HDUA 2G0EA 4XRMA 1KQ9A 2BW3A 3F22A 4J01A 3FXUA 3GWZA 2E5NA 2XASA 2VJJA 5EJCA 3HSRA 3OYEA 2XAFA 2K4JA 4N9HA 3B02A 4Q48A 4CH7A 5IP9J 3JRCA 1TQMA 1X58A 4OWRB 4QLCU 4BE1A 2NS0A 1JKQC 3VYRB 2HVSA 1T38A 2ZXHA 1OCOH 2CW8A 1N77A 5ERIA 4A3EJ 1LJ9A 3CF5F 3QU6A 4B48A 2CW0F 2OBPA 3HKZN 3KCCA 1W5CC 4FE7A 1K78B 3RKWA 1U9OA 1J0RA 1T33A 1Z7LA 2OCEA 4MQVA 3DF8A 1O3TA 4DJAA 2X51A 5F04A 1Z6RA 1LQ1A 1A35A 1HDPA 2ZNYA 2Z1DA 1TBXA 1FSHA 1ITYA 3LOCA 2KMUA 4CCKA 3BTIA 2QWWA 4IRHA 3KZIC 1XTAA 1MBEA 1Y8QB 2RQPA 5LHIA 2MFZA 3E6MA 1YE9A 4UUSA 2KIUA 3I59A 4EM0B 4XONA 2VBXA 2VBWA 1T2KA 3SFZA 2LBFB 3DBLB 4ETSA 4CYDA 2CQXA 4PGHA 2MD5A 1EKEA 3DFGA 3K4KA 2JK3A 2VJ5A 2VPRA 2X85A 3VFZA 5F0HA 3MKWB 5D6EA 5B5EC 4IHXA 1TNSA 1NG7A 2GBYA 4FT8A 1HQCA 3I4MJ 3W3CA 4YFNF 2HPMA 3F8MA 4OIRF 5EDNA 4Y7NJ 2VI6A 5LHGA 3UR3C 2KHMA 2M87A 1TL8A 2E34A 3OYIA 1CQTA 2WTEA 3LQQA 1GV5A 4F55A 3G2BA 1CF7B 3HM5A 1BR1A 1XDUA 1H9TA 1V4RA 3HTSB 5CPRB 2X98A 2AHQA 2W25A 3LA7A 3S16J 4IEJA 4FCYA 2P0WA 1W0TA 1P9QC 1VQ9I 2W84A 1LEBA 5FFZA 2XDVA 3P5JA 2JT1A 1GT0C 2H1KA 1R1UA 4AIHA 1YLFA 1NK3P 2UXXA 1QO0D 4DYRA 4RDUA 3K4NA 4C2MJ 2E1NA 2CYYA 2MG4A 4XSZF 3V4GA 2MC3A 5A2QK 1MKMA 1EH7A 3VEPA 4G7ZF 5DS9A 3BT9A 1KU7A 2VQGA 5F1JA 2Y9YA 2VOOA 3J7AY 1P4AA 1W7PB 1FSEA 1S7EA 4KMUX 1VQPI 3A2KA 3RKYA 3V7CA 1YRNB 4BJTA 2BZTA 2QM3A 3JRBA 4CYCA 2KZVA 1P7JA 3H35A 2WAFA 1S7AA 5HODA 2EPFA 3CJTB 3M8FA 1SVLA 3BQYA 5LD2C 2DCEA 2EFQA 2W00A 3TBIA 1ERDA 3QPTA 4JX6A 5DD4A 1MJBA 3IP4B 2A68F 4ZH4F 4E7LA 1WJDA 4U0WA 1XD7A 2OQGA 3ZMVA 1FTZA 3E6CC 3CCQI 3DPLC 5TRDA 2EZLA 2Z9OA 4HAMA 2DMNA 2XAGA 4CICA 2BE5F 1AKHA 2B7EA 2M1BA 1FOYA 3OSFA 1YO5C 1Z9CA 1IN8A 1FYKA 2AS5F 2DN0A 1YOVB 1OCZH 4EJVA 4JYKA 4A0ZA 3M4OJ 4GYIA 1JHHA 1X2MA 2EBIA 4CZZA 3JRAA 1YW8A 2BXZA 5L3EA 2O61A 3KLNA 1Z1DA 2MABA 2FNPA 4UUTA 4AYBN 3K70C 3M1CA 3SYTA 5J8FA 3CUQC 2GWRA 3F23A 3Q0VA 4UUSB 2DPDA 4A3JJ 2LKSA 4YIRX 1U0JA 2R7DA 4BXXJ 3GFMA 1FNNA 3CJRB 3K69A 5FKKA 3WE2A 4RB0A 1DU0A 4EQQA 3S14J 2G7UA 3COAC 1BOBA 4DZPA 3CUQB 5KK1A 1X3ZB 4EJOA 4B09A 4E7JA 3HSEA 4KNYA 5IT9K 4XOPA 4MTEA 3OOUA 3DU6A 4I7HA 3AFHA 4M6YA 4LLNA 2GIZA 3CMMA 1K6OA 1DGWY 2QQ8A 4DQ2A 3G4SI 3KE2A 3L2UA 4W1UA 4IHVA 1B8IB 5JVGF 5K1YA 1OYYA 3AG2H 2R92J 4A0XA 1ACIA 4XN3A 1E0EA 1V3FA 1QA6A 3DEUA 2CG4A 4D7NA 3G1OA 2R7SA 3HL2A 3BP8A 2VXZA 1B9NA 2DLLA 2HXIA 3WTSC 3A01A 2FNAA 2M35A 3KFWX 2BGCA 5CKTA 3RQIA 5BS6A 4PSXA 1K7AA 4F7ZA 3E3VA 4LLLA 1Y39A 3KZYA 5E3MA 4UUVA 3IV5A 1OLTA 2OPTA 2WV1A 3K4MA 5JLXA 1TWFJ 1WJBA 3I5UA 3L2QA 3O2PE 1JGGA 2Z3YA 3RKQA 3SEQA 5L3FA 4I76A 2KZGA 3WU0A 2DA3A 5FD6A 3OL4A 3DBRB 3J81R 1G3WA 4XR6A 5DUIA 1IXSB 3PSIA 2YX7A 1NG6A 1R71A 3FMSA 1ULYA 2X6OA 3HOWJ 4RS8A 3VYUB 1KU9A 2LYCA 2L4AA 4IVNA 4M71A 5FFXA 4DYQA 3U21A 5FJ8J 1AU7A 4DIQA 1IRZA 5FKOA 4HV6A 4L9TA 2VPLA 2R7QA 2BY0A 5ICGA 3ZMTA 1U5TC 1J5YA 2H27A 2DI3A 2J5PA 2WC2A 4B47A 5TGTA 2EFPA 2FA5A 3BOQA 2VQHA 3JSOA 4G9YA 3TW6A 3I55I 4BJ5C 2FJ1A 5IT9Z 5FLXK 1MBJA 3GLXA 4D9JA 2O9LA 1VQ8I 2ACJA 2IS4A 3CMAI 2ZC2A 2XAQA 4C3JJ 2J5OA 1VQLI 3BR3A 1YJ9I 1XSXA 1W1WE 2A05A 3DPTA 3LA2A 1PDNC 5ILUA 2HDDA 4A3KJ 2TCTA 1UZCA 3BCBA 2XAHA 4HEA2 4A0YA 3L2WA 3A4CA 1FY7A 1E3PA 4OAZA 4PJNA 1D0ZA 3IH3A 2F5EA 2M8GX 3SQNA 3VDXA 2MSYA 3HYIA 4I09A 4F91B 3G1LA 4KUMA 4UV8A 1VTNC 2CV2A 4IRIA 1I3AA 1OQYA 5DDGA 2ZO4A 3QYEA 3FX3A 2YU3A 3CCYA 4A5MA 1R6RA 5IYDJ 2MZ4A 5J47A 2M4GA 4LITA 3RIRA 3IL2A 1LE8B 4U0VA 5D5WB 3VYSB 2L7FP 3QPHA 3OYGA 1OYIA 5DM6F 3HEFA 4OU0A 4MNUA 2D1VA 1MDMB 2ZXWH 2IP2A 1PJRA 1S9HA 2P81A 1O7FA 3PO2J 1I6HJ 2LBFA 4NUBA 3JREA 4KMFA 3ECHA 4EV0A 2GIVA 4XLNF 1XPXA 2Y31A 5EEHA 3I71A 3OS2A 3CO7C 2WAEA 3WGGA 1SVMA 3I9V2 5LRSA 1MMDA 2A6TA 3S32A 4FASD 1JI8A 3DTKA 5CVJA 2F4MB 2DYRH 2FRHA 3KYDB 1HC8A 3HB9A 1U78A 2NS7A 3DU5A 2WADA 1VNDA 4IHTA 3GTJJ 4YELA 4JX4A 4EJTA 2V79A 1R1TA 1BJZA 4UVCA 5CQGA 4E6KG 4YFKF 3HOUJ 2PX9A 2LH9A 2X1CA 5J1RA 5AIPA 5FLXZ 1G3YA 3WU1B 3B6CA 1D5VA 2JUGA 2PG4A 5JFRA 5HS8A 5TISC 4XKCA 3K4BA 4L9VA 1HW2A 3D5LA 3CCLI 2QSFX 3LQRA 1EJ9A 1RI7A 3BPVA 1KGSA 2DOEA 3BZCA 3AL0C 3CCUI 2WA0A 2OC6A 4IX7A 3ZN1A 2ISZA 4ENJA 3LSRA 2HVQA 4PFOA 2ISYA 2DMUA 5E18F 2EINH 2VONA 4FX4A 3E97A 3ZGKA 2XGEA 4PUSA 3A01B 4HA8A 1WWXA 2DMTA 3H1CA 4LG0B 2YSRA 3LAPA 2BV6A 4BQQA 3BQZA 3AL0B 3ZQQA 2LKXA 1T56A 5EEGA 2QSHX 2W85A 1F9NA 4LFUA 1HBXG 1QBJA 1XMXA 5DTDA 2HOEA 1JXSA 1YRNA 4ENKA 1X1BA 3S93A 4P1WA 4BY1J 2P0TA 1VF9A 3N05A 4Y3OA 2FU4A 3R0JA 4BHCA 2G9WA 2LTPA 2P7VB 2XC7A 3EUAA 1MMNA 4A5NA 2P7CB 1RR7A 4A69C 2NOGA 5GPCA 3F8CA 2DA6A 3G6EI 3J80R 3ZPLA 4XLEA 3NARA 2R5ZA 1RRJA 1I1SA 4IPAA 2K27A 3D0SA 2GZWA 4L0YB 1LNWA 3BG5A 5LGTA 5GAEJ 3ZMDA 4KA4A 2MH2A 2HDCA 1SC7A 1JUMA 4A93J 1IN7A 2PEXA 2ZJ2A 2NXNB 2JPBA 4H4KC 1FC3A 3A0HC 4BQAA 3V8LA 2GM4A 4BDYA 2CUEA 2ZNZA 1VI0A 2M7AA 4V2FA 4M3DA 3EYIA 2VC1A 4X0GA 2PMZA 1JTXA 3VWBA 1BI3A 2LC2A 1V5GA 2FE3A 2OCCH 3V42A 4V2GA 2M3AA 1VQMI 3MQ0A 2ZCWA 5IT9R 1LKXA 1T8IA 4ZTFA 2EA4A 2QEXI 3CJQB 3GTQJ 3SZGA 4U88A 1Y0NA 4XRSG 5F6FA 5B3SH 1G4DA 4R8HA 4G7HF 4ZZLA 2OJED 3K9TA 2X6WA 3D5SC 3W2AA 3DXJF 2M7BA 1A04A 2CU7A 1CF7A 3S8PA 3KPHA 5FKLA 1EV7A 3IAM2 1HDDC 1HSTA 3OYNA 1YQAA 2V9VA 4FE4A 5CQEA 2HKOA 3S2DJ 3ZMSA 4QSHA 1ZQ3P 2PLYA 1CGPA 3RKXA 1Y0UA 4XKBA 1J59A 4G7OF 3F8NA 3K4JA 2MH9A 1JGSA
chains in the Genus database with same CATH topology
4H0EA 2DFIA 1QZYA 2EV5A 4AIJA 2HQRA 3HRSA 5JVTA 1XMAA 4M72A 4OMYA 3ELKA 1KYZA 1BIAA 4EVIA 1U6GA 5D4SA 4E70A 1FYLA 2VN2A 1IN6A 5E1ZB 3I0TA 4LG0A 3V7RA 4RGUA 5HDKA 2Y75A 5CVRA 1BM9A 2RNJA 3U2RA 3WTYC 2A3SA 1LDKB 3QP5A 2L54A 2HR3A 3FWEA 5K5QA 4HLYA 3E5QA 3I53A 2XV4S 1TW3A 1B9MA 3O6BB 1J7KA 3CDHA 2LF8A 1LB2A 3HRUA 1ZGJA 4LB6B 2NNYA 4R79A 1P4WA 1R22A 1OMIA 2MA3A 2IT0A 3HIFA 3REOA 3WTTC 2CGPA 4EMSA 2H6CA 1EH8A 2F5FA 4HW0A 1FZPB 1JE8A 4M73A 5D4RA 2HEOA 2A69F 2IA1A 3W6JB 3MCZA 4KICA 2V1UA 4HX7A 3CUQA 1S6LA 3SZTA 3IHUA 3F6VA 3R4KA 1FP2A 3FXRA 2PN6A 1JHFA 1HKSA 3C1DA 2O3FA 2TDXA 1GHCA 1HKTA 5ED4A 2UWMA 2LKPA 3PQKA 4CXFA 2FSWA 1ZARA 1KU3A 3GZ6A 4A6DA 3QAHA 1ZAOA 4EGZA 2ETHA 1K79A 4PDKA 2XVCA 1OYWA 4EGYA 5ILSA 2P4WA 4ESBA 3DP7A 2L01A 1E2XA 1FP1D 4NQWA 5LHHA 5BPIA 4RAYA 4BAYA 2FBIA 1MD0A 3R60A 3GX4X 1YW7A 4I02A 4P9FA 1ZYRF 1TW2A 3H3ZA 2DQLA 1P4XA 4XBFA 5E1WA 2P6SA 1TNTA 3KP2A 1HSJA 4YIFA 1MJ9A 3J81K 2RVCA 3DV8A 3GZ5A 1XN7A 2JRTA 4M9XA 3ERED 2Z33A 1O3QA 3OOPA 5CLSA 3L09A 2OZUA 2PBIA 1PP8F 5FGMA 5KVRA 1BI2A 2KKOA 2UZKA 3GVAA 5H6QA 1R7JA 2HTSA 5AIQA 3H92A 2QUFA 1BC8C 5LLQA 3JAMK 1GXQA 4HZFA 3TO6A 4Y13A 4I2OA 5E20A 3M1EA 3E5UA 5DCMB 3WODF 2ZXJA 4LLGF 4PCQA 3PQJA 1SFXA 4HV5A 5L3BA 2IA0A 2KJBA 4CDGA 3PFIA 1R5HA 2CFXA 2F2EA 2M30A 1EH6A 3FMRA 2IA2A 3F3XA 1YFHA 3E6BA 3CJNA 2V1XA 4WXCA 2E7WA 3QOPA 1UFMA 2EA2A 3KP5A 4A2UA 3Q9SA 3HOTA 2L3DA 1BIBA 1YS7A 1UB9A 5D5VB 3JAMZ 2QQBA 2BEOA 3Q5FA 4ZYHA 2E1CA 4IHSA 1HKQA 2EJRA 3VB2A 3SZPA 3KEOA 3MFKA 3EQLF 1S3JA 4FHTA 4OOIA 3HOSA 3ZMUA 2ZFWA 3HSFA 3F8FA 3J80K 4I0AA 5HVQC 4LMYA 2XRNA 1DPRA 3FZVA 5HLGA 5TJJA 3KP6A 1SMTA 2M5WA 4ZZDA 5CVVA 1J75A 1TTYA 1DPUA 1YW9A 1WSUA 4BHPA 3K1MA 4AD9A 1FT9A 1S8NA 2H94A 4PZJA 1UHMA 4HQEA 2RC4A 4LGWA 4NB5A 5CJ9A 1RUOA 1RZ4A 4L9NA 3CO6C 1PUEE 4KYWA 3AAFA 1FYMA 5D6FA 3RTRA 5J6XA 3NQOA 1YIOA 4XLPF 3LSTA 3RPQA 1O3RA 4OINF 1SD5A 1USSA 3RPUA 5K5OA 4A12A 5D5UB 2EV6A 3GFJA 3ML6A 3OV8A 4YG2F 2RDPA 1QNTA 1XDSA 1TQIA 1W7PD 1U3EM 1K78A 4O5VA 1W5SA 3F6OA 2XROA 2M45A 2O0YA 4M6XA 2FBKA 5CVUA 4CO8A 2DAOA 3RYRA 3ULQB 1ODDA 5AONA 3M7GA 5FO5A 4RGRA 5DD8A 5L3CA 2ZBKA 4D0PA 2HFHA 1WQ2A 3T0YA 1LVAA 1OPCA 3BJAA 1P6RA 1XGOA 2GXGA 2F5CA 5H6RA 1BBYA 3WTZA 4BHBA 1YS6A 2LF7A 4ZYGA 1ZLJA 2Y0MA 2DBBA 3GYHX 3BZ6A 3SHFA 1J2XA 2EB7A 5E1XA 3FF5A 1UCRA 3N4MA 2DW4A 2X4HA 2Q2EA 2IRFG 3I64A 1FBUA 2BYVE 1T98A 2K7LA 2D2WA 1Q1HA 4LB5A 4P96A 2HQNA 2LDUA 1ZG5A 2ELHA 4KIFA 4ZYDA 1T0FA 2QLZA 3GFLA 4RAZA 4YIIA 1U8RA 2ZKZA 3V8JA 4XRFA 3IRQA 2A07F 3P9CA 2A6HF 2EFWA 4G94A 3WTUC 5LGUA 2WWYA 3K1NA 4P55A 5CVIA 1LDJA 5HLHA 2OA4A 3IC7A 5HS9A 2QENA 1D3YA 3HRMA 1Z05A 5K5RA 1I27A 2NRAC 5BMZA 2FXAA 4DNCA 3JTGA 3BROA 4HX4A 4P5OA 3WG9A 2XKOA 4HQMA 3F21A 1LEAA 2IPQX 3V7SA 3I54A 1XB4A 3CLOA 1TLHB 2OU2A 4L5JA 4Z2YA 2X0LA 4TV7A 4CGZA 1QQIA 2A61A 3HHGA 2M8EA 4EJWA 4EM1A 2FQ3A 4ENMA 4K2EA 1Z7UA 1BJAA 3TOBA 1XCVA 3ECOA 4OIOF 6PAXA 3VOEA 4Q4ZF 1ZLKA 2P5KA 4IRGA 2D45A 2CO5A 2DO7A 1QPMA 3GEZA 2DU9A 2GA2A 4MGRA 4MHGA 1L3LA 1MGTA 4S04A 2R3SA 2KRFA 4Y17A 5LEJA 2GAUA 1HW1A 1U5TB 2DT5A 3CUOA 4I01A 1FWZA 1G3SA 4CHUA 5LGNA 1KU2A 4M74A 3ROUA 1H9GA 3G3ZA 2JZYA 1ZRCA 2Z99A 4RGXA 1ZRFA 2XUBA 5LRRA 2ZMEB 1GXPA 3JTHA 4WF2A 3DQVC 4B8XA 3GO5A 4M9SA 3F72A 1TQPA 3M9AA 1I6XA 3IKVA 4U7DA 2GXBA 4UV9A 5CYVA 2QQAA 5L3GA 4BNCA 4GCVA 2C6YA 3L9FA 4OIQF 2JSCA 5DV5A 4S05A 4HF1A 1HXDA 1FPQA 2EWNA 2VC0A 4PGGA 3J80Z 2HYFA 5ICEA 4I98B 5HLIA 1IXRC 1PP7U 1XGSA 2NYXA 3JSPA 2QZ8A 3HRTA 1B6AA 1MZBA 4IJAA 1DUXC 3R61A 2V1DA 3DKWA 5HOOA 1LDDA 2NNNA 4AVPA 2VODA 2L02A 4O6JA 3IKTA 3WGHA 1Z6TA 4N0BA 4MEYF 2H09A 3R0AA 1U2WA 2MLGA 3TO7A 1X3UA 2PMUA 3E5XA 4ESJA 2WV0A 4UNOA 5JHUA 5D5XB 2RV8A 4KIGA 5DUKA 4G6DA 1IN4A 2OAZA 3QU3A 5HDNA 3RYPA 2RN7A 3JW4A 1ZGAA 2ESNA 4MTDA 4EJUA 4KT5C 1BI0A 2LSOA 2VT3A 5IT3A 3KP3A 4RGSA 3KP7A 3SXYA 1SMYF 2XIGA 3L00A 2PFBA 1T39A 3C7JA 4HF0A 4Q47A 1XGNA 1ZN2A 1SFUA 1C0WA 1ZREA 1F1ZA 3E6DA 2COMA 4HLXA 3K0LA 5LEKA 3WGIA 3KP4A 1F4KA 4ESFA 1H0MA 4KN7X 3HUGA 2HTJA 2ZMEA 3J81Z 2YPRA 4LK0F 2K4BA 2HZTA 2P5LC 2P6TA 5BOXA 5DCMA 2Z5UA 1BN5A 3TO9A 4YFXF 4JK1X 1AOYA 3FHZA 4KIBA 3EUHA 1IAWA 5FD5A 4IXAA 2QVOA 2W57A 1I1GA 3U9GA 4BXUA 3IRRA 1B1BA 3EETA 4I0BA 3N97A 3RJPA 5F64A 1R5GA 4UXNA 5D8KB 4ENNA 1KQ8A 3KETA 4IF4A 2H6BA 2YR2A 3H3UA 1IW7F 1I5ZA 4ZYEA 3L7WA 3K2ZA 2O6GE 2K86A 5E17F 5HS7A 3MEXA 2MLKA 2Q0OA 3G73A 3IWFA 2PQ8A 2PMHA 1O7LA 2XKPA 3S2WA 3QRFF 5E8GA 2FEZA 2VBZA 3ZN0A 1QZZA 3GUDA 2RGVA 2BBYA 1O57A 4UHTA 3HHHA 1XMKA 3GFIA 3RDIA 2IJLA 2EFOA 2STTA 1UHWA 1BI1A 2G7HA 3K1PA 1YTYA 4N9IA 1D8KA 3FXQA 1SD4A 3MZYA 2RKHA 2EK5A 1ON2A 3WTVC 3T5XA 4GXOA 3LA3A 1IUYA 2GA1A 1F5TA 3I58A 4RB3C 2XAJA 3F8BA 3WTXC 2W24A 4BYYA 1ZG1A 4WX9A 2OQRA 1IXCA 3BWGA 4ON0A 4JQFA 1SFEA 4G8XA 4R1HA 2FBHA 5ICFA 5A2QZ 1ON1A 3LAJA 2HKXA 4UVBA 3I59B 1GVJA 3BPXA 3QP6A 1ZG3A 2FF4A 1NHAA 1P2FA 2B0LA 5BQTA 2IW5A 1YG2A 3R6SA 3C3WA 2KIFA 3L2CA 3LFKA 2HYGD 3TDUC 1O3SA 4GO1A 1S7OA 3B73A 5D8LB 3NRVA 3ABUA 2ESHA 2A6EF 1OR7A 1G6NA 2UXNA 2MBFA 3FM5A 2DK8A 2YX4A 1REPC 1IRFA 2F5DA 2K02A 1SD6A 4A6EA 1MJAA 2QBYB 3TGNA 1OKRA 2QQ9A 2IVMA 3ABTA 2QYOA 4Q5SF 2HGCA 1B59A 2FOKA 3EYYA 1Z91A 2D1HA 3Q9VA 1FLIA 3T8RA 2STWA 5L3DA 5FB2A 4QWQA 3NEUA 2NAZA 1E17A 1IZ1A 1R58A 1AWCA 2Y48A 1STZA 3TOAA 3U1DA 1FX7A 1W5TA 2O8XA 3KEQA 1ZH5A 1KA8A 1J9IA 3WE3A 1MDMA 3BJOA 3ZQ7A 4OMZA 2VOPA 3LWFA 4AIKA 1FBQA 1IN5A 2VBYA 3I4PA 2FMYA 1KYWA 3MWMA 4EM2A 2JTVA 1RNLA 1IF1A 4MEXF 2A5YB 1ONVA 2P8TA 4WK8F 1XCBA 3FMQA 3HTUA 1RIOH 4WXDA 4GGGA 4GYGA 1D8JA 1HW5A 2ADUA 5J8CA 5JI6A 4O3MA 2HS5A 4UVAA 1WKMA 4MQ9F 2DPUA 4LD5A 2FMLA 5DEQA 4U0YA 4KN4X 4U7BA 1BC7C 3RI4A 1G3TA 3GW2A 1XSDA 4XSXF 3VODA 1ZHFA 1YYVA 4KDPA 5LBQA 3FM3A 1XGMA 2KJCA 2OZ6A 2KIMA 4L5IA 4RB2C 2PJPA 2HWVA 1FOKA 1R36A 3IWZA 2LNBA 2VE9A 2OD5A 4L0ZB 2GQQA 4KFCA 4OIPF 4G6QA 3GXOA 3T1BA 3P7NA 4HOBA 1W7PA 2P5VA 3MAJA 4HDVA 3T8TA 4M9ZA 3C18A 5DCFA 3TDZC 3W6KB 2AXLA 2QBYA 4HX8A 4ASNA 3KZZA 2Q8KA 1SD7A 3BDDA 4NHJA 1QGPA 5E8IA 4HYEA 1B4AA 1RUNA 5DYMA 4HF2A 1SAXA 2DK5A 3MZHA 2CQKA 1FBSA 3ZP5A 4LK1F 2V6CA 2E7XA 2DTRA 4WWCA 2EV0A 5H20A 2R7FA 2L4MA 2VE8A 5ICCA 3TQNA 4WCGA 1KQ0A 1DDNA 2XHKA 3V8KA 5ILVA 4LJZF 4BH9A 3O3KA 4WXHA 5HDGA 5BPDA 4L18B 2O03A 3GF2A 3KLOA 1ZRDA 4FX0A 2CWEA 1L0OC 4HBLA 2JPCA 4JBAA 2DQRA 4Y15A 2CSOA 3TKYA 1XSVA 2VT2A 3BJ6A 2PI0A 4L9JA 2EFNA 3CTAA 1USTA 4P9UA 5F1RA 1R23A 1IRGA 1WRJA 2XGXA 3M8EA 1BOAA 1T6SA 4RB1A 4AWXB 3BY6A 3J7AO 3EDPA 1U5TA 3ISPA 5JR3A 1W4MA 1R00A 3ZMZA 1S29A 3WTWC 1P92A 1WI9A 1R1VA 3P9KA 3P9IA 1DP7P 4HDUA 1KQ9A 3F22A 3FXUA 3GWZA 2XASA 3HSRA 2XAFA 2K4JA 4N9HA 3B02A 4Q48A 1TQMA 4QLCU 2NS0A 1T38A 5ERIA 1LJ9A 3QU6A 2CW0F 2OBPA 3KCCA 1K78B 3RKWA 1J0RA 4MQVA 3DF8A 1O3TA 1Z6RA 1LQ1A 2ZNYA 1TBXA 1FSHA 2QWWA 4IRHA 2RQPA 5LHIA 3E6MA 2KIUA 3I59A 4EM0B 2VBXA 2VBWA 1T2KA 3SFZA 4ETSA 4CYDA 4PGHA 2MD5A 3DFGA 3VFZA 5D6EA 1TNSA 4FT8A 1HQCA 4YFNF 3F8MA 4OIRF 5LHGA 2M87A 2WTEA 3LQQA 1CF7B 1XDUA 1H9TA 1V4RA 3HTSB 2W25A 3LA7A 2W84A 1LEBA 5FFZA 2JT1A 1R1UA 4AIHA 1YLFA 2UXXA 1QO0D 2E1NA 2CYYA 4XSZF 3V4GA 2MC3A 5A2QK 1MKMA 1EH7A 3VEPA 4G7ZF 1KU7A 2VOOA 1P4AA 1W7PB 1FSEA 4KMUX 3RKYA 3V7CA 2QM3A 1S7AA 3M8FA 2EFQA 3QPTA 5DD4A 1MJBA 2A68F 4ZH4F 4U0WA 1XD7A 2OQGA 3ZMVA 3E6CC 3DPLC 5TRDA 2Z9OA 4HAMA 2XAGA 4CICA 2BE5F 1YO5C 2M1BA 1Z9CA 1IN8A 1FYKA 2AS5F 4EJVA 4A0ZA 4GYIA 1JHHA 4CZZA 1YW8A 5L3EA 2O61A 3KLNA 1Z1DA 2FNPA 5J8FA 3CUQC 2GWRA 3F23A 2DPDA 2R7DA 3GFMA 1FNNA 3K69A 3WE2A 4RB0A 4EQQA 2G7UA 3COAC 3CUQB 5KK1A 4EJOA 4B09A 3HSEA 4KNYA 5IT9K 4MTEA 4I7HA 4M6YA 4LLNA 1K6OA 4DQ2A 3KE2A 5K1YA 1OYYA 4A0XA 1V3FA 3DEUA 2CG4A 2VXZA 3BP8A 1B9NA 2DLLA 3WTSC 2FNAA 3KFWX 2BGCA 5BS6A 1K7AA 4F7ZA 3E3VA 4LLLA 3KZYA 4UUVA 3I5UA 3O2PE 2Z3YA 5L3FA 3WU0A 5FD6A 1G3WA 5DUIA 1IXSB 2YX7A 3FMSA 1ULYA 4RS8A 1KU9A 2L4AA 4IVNA 4M71A 5FFXA 4HV6A 4L9TA 5ICGA 3ZMTA 1U5TC 1J5YA 2H27A 2DI3A 2J5PA 2WC2A 2EFPA 2FA5A 3BOQA 3JSOA 4G9YA 5IT9Z 5FLXK 3GLXA 2ACJA 2XAQA 2J5OA 1XSXA 3DPTA 1PDNC 3LA2A 5ILUA 2XAHA 4A0YA 1FY7A 2F5EA 3SQNA 3HYIA 4I09A 4KUMA 4UV8A 1VTNC 4IRIA 5DDGA 2ZO4A 3FX3A 2YU3A 4A5MA 3RIRA 3IL2A 4U0VA 5D5WB 3QPHA 1OYIA 4OU0A 4MNUA 2D1VA 1MDMB 2IP2A 1O7FA 4KMFA 3ECHA 4EV0A 2GIVA 4XLNF 5EEHA 3I71A 3CO7C 3WGGA 5LRSA 5CVJA 2FRHA 1U78A 4IHTA 4EJTA 2V79A 1R1TA 4UVCA 4YFKF 5AIPA 5FLXZ 1G3YA 3WU1B 1D5VA 2PG4A 5JFRA 5HS8A 4L9VA 1HW2A 3D5LA 3LQRA 1RI7A 3BPVA 1KGSA 3ZN1A 2ISZA 4ENJA 2ISYA 5E18F 2VONA 4FX4A 3E97A 4HA8A 1WWXA 4LG0B 2YSRA 3LAPA 2BV6A 5EEGA 2W85A 1F9NA 4LFUA 1HBXG 1QBJA 2HOEA 1JXSA 4ENKA 2FU4A 3R0JA 4BHCA 2G9WA 2P7VB 2P7CB 4A5NA 3F8CA 3ZPLA 1I1SA 4IPAA 2K27A 3D0SA 2GZWA 4L0YB 1LNWA 5LGTA 3ZMDA 4KA4A 2MH2A 2HDCA 1IN7A 2PEXA 2ZJ2A 2JPBA 1FC3A 4BQAA 3V8LA 2ZNZA 3EYIA 2VC1A 1BI3A 2FE3A 3MQ0A 2ZCWA 2EA4A 4U88A 5F6FA 1G4DA 4R8HA 4G7HF 4ZZLA 3K9TA 3DXJF 1A04A 1CF7A 1EV7A 1HSTA 1YQAA 2V9VA 2HKOA 3ZMSA 2PLYA 1CGPA 3RKXA 1Y0UA 1J59A 4G7OF 3F8NA 2MH9A 1JGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0E A;  2DFI A;  1QZY A;  2EV5 A;  4AIJ A;  2HQR A;  3HRS A;  5JVT A;  1XMA A;  4M72 A;  4OMY A;  3ELK A;  1KYZ A;  1BIA A;  4EVI A;  1U6G A;  5D4S A;  4E70 A;  1FYL A;  2VN2 A;  1IN6 A;  5E1Z B;  3I0T A;  4LG0 A;  3V7R A;  4RGU A;  5HDK A;  2Y75 A;  5CVR A;  1BM9 A;  2RNJ A;  3U2R A;  3WTY C;  2A3S A;  1LDK B;  3QP5 A;  2L54 A;  2HR3 A;  3FWE A;  5K5Q A;  4HLY A;  3E5Q A;  3I53 A;  2XV4 S;  1TW3 A;  1B9M A;  3O6B B;  1J7K A;  3CDH A;  2LF8 A;  1LB2 A;  3HRU A;  1ZGJ A;  4LB6 B;  2NNY A;  4R79 A;  1P4W A;  1R22 A;  1OMI A;  2MA3 A;  2IT0 A;  3HIF A;  3REO A;  3WTT C;  2CGP A;  4EMS A;  2H6C A;  1EH8 A;  2F5F A;  4HW0 A;  1FZP B;  1JE8 A;  4M73 A;  5D4R A;  2HEO A;  2A69 F;  2IA1 A;  3W6J B;  3MCZ A;  4KIC A;  2V1U A;  4HX7 A;  3CUQ A;  1S6L A;  3SZT A;  3IHU A;  3F6V A;  3R4K A;  1FP2 A;  3FXR A;  2PN6 A;  1JHF A;  1HKS A;  3C1D A;  2O3F A;  2TDX A;  1GHC A;  1HKT A;  5ED4 A;  2UWM A;  2LKP A;  3PQK A;  4CXF A;  2FSW A;  1ZAR A;  1KU3 A;  3GZ6 A;  4A6D A;  3QAH A;  1ZAO A;  4EGZ A;  2ETH A;  1K79 A;  4PDK A;  2XVC A;  1OYW A;  4EGY A;  5ILS A;  2P4W A;  4ESB A;  3DP7 A;  2L01 A;  1E2X A;  1FP1 D;  4NQW A;  5LHH A;  5BPI A;  4RAY A;  4BAY A;  2FBI A;  1MD0 A;  3R60 A;  3GX4 X;  1YW7 A;  4I02 A;  4P9F A;  1ZYR F;  1TW2 A;  3H3Z A;  2DQL A;  1P4X A;  4XBF A;  5E1W A;  2P6S A;  1TNT A;  3KP2 A;  1HSJ A;  4YIF A;  1MJ9 A;  3J81 K;  2RVC A;  3DV8 A;  3GZ5 A;  1XN7 A;  2JRT A;  4M9X A;  3ERE D;  2Z33 A;  1O3Q A;  3OOP A;  5CLS A;  3L09 A;  2OZU A;  2PBI A;  1PP8 F;  5FGM A;  5KVR A;  1BI2 A;  2KKO A;  2UZK A;  3GVA A;  5H6Q A;  1R7J A;  2HTS A;  5AIQ A;  3H92 A;  2QUF A;  1BC8 C;  5LLQ A;  3JAM K;  1GXQ A;  4HZF A;  3TO6 A;  4Y13 A;  4I2O A;  5E20 A;  3M1E A;  3E5U A;  5DCM B;  3WOD F;  2ZXJ A;  4LLG F;  4PCQ A;  3PQJ A;  1SFX A;  4HV5 A;  5L3B A;  2IA0 A;  2KJB A;  4CDG A;  3PFI A;  1R5H A;  2CFX A;  2F2E A;  2M30 A;  1EH6 A;  3FMR A;  2IA2 A;  3F3X A;  1YFH A;  3E6B A;  3CJN A;  2V1X A;  4WXC A;  2E7W A;  3QOP A;  1UFM A;  2EA2 A;  3KP5 A;  4A2U A;  3Q9S A;  3HOT A;  2L3D A;  1BIB A;  1YS7 A;  1UB9 A;  5D5V B;  3JAM Z;  2QQB A;  2BEO A;  3Q5F A;  4ZYH A;  2E1C A;  4IHS A;  1HKQ A;  2EJR A;  3VB2 A;  3SZP A;  3KEO A;  3MFK A;  3EQL F;  1S3J A;  4FHT A;  4OOI A;  3HOS A;  3ZMU A;  2ZFW A;  3HSF A;  3F8F A;  3J80 K;  4I0A A;  5HVQ C;  4LMY A;  2XRN A;  1DPR A;  3FZV A;  5HLG A;  5TJJ A;  3KP6 A;  1SMT A;  2M5W A;  4ZZD A;  5CVV A;  1J75 A;  1TTY A;  1DPU A;  1YW9 A;  1WSU A;  4BHP A;  3K1M A;  4AD9 A;  1FT9 A;  1S8N A;  2H94 A;  4PZJ A;  1UHM A;  4HQE A;  2RC4 A;  4LGW A;  4NB5 A;  5CJ9 A;  1RUO A;  1RZ4 A;  4L9N A;  3CO6 C;  1PUE E;  4KYW A;  3AAF A;  1FYM A;  5D6F A;  3RTR A;  5J6X A;  3NQO A;  1YIO A;  4XLP F;  3LST A;  3RPQ A;  1O3R A;  4OIN F;  1SD5 A;  1USS A;  3RPU A;  5K5O A;  4A12 A;  5D5U B;  2EV6 A;  3GFJ A;  3ML6 A;  3OV8 A;  4YG2 F;  2RDP A;  1QNT A;  1XDS A;  1TQI A;  1W7P D;  1U3E M;  1K78 A;  4O5V A;  1W5S A;  3F6O A;  2XRO A;  2M45 A;  2O0Y A;  4M6X A;  2FBK A;  5CVU A;  4CO8 A;  2DAO A;  3RYR A;  3ULQ B;  1ODD A;  5AON A;  3M7G A;  5FO5 A;  4RGR A;  5DD8 A;  5L3C A;  2ZBK A;  4D0P A;  2HFH A;  1WQ2 A;  3T0Y A;  1LVA A;  1OPC A;  3BJA A;  1P6R A;  1XGO A;  2GXG A;  2F5C A;  5H6R A;  1BBY A;  3WTZ A;  4BHB A;  1YS6 A;  2LF7 A;  4ZYG A;  1ZLJ A;  2Y0M A;  2DBB A;  3GYH X;  3BZ6 A;  3SHF A;  1J2X A;  2EB7 A;  5E1X A;  3FF5 A;  1UCR A;  3N4M A;  2DW4 A;  2X4H A;  2Q2E A;  2IRF G;  3I64 A;  1FBU A;  2BYV E;  1T98 A;  2K7L A;  2D2W A;  1Q1H A;  4LB5 A;  4P96 A;  2HQN A;  2LDU A;  1ZG5 A;  2ELH A;  4KIF A;  4ZYD A;  1T0F A;  2QLZ A;  3GFL A;  4RAZ A;  4YII A;  1U8R A;  2ZKZ A;  3V8J A;  4XRF A;  3IRQ A;  2A07 F;  3P9C A;  2A6H F;  2EFW A;  4G94 A;  3WTU C;  5LGU A;  2WWY A;  3K1N A;  4P55 A;  5CVI A;  1LDJ A;  5HLH A;  2OA4 A;  3IC7 A;  5HS9 A;  2QEN A;  1D3Y A;  3HRM A;  1Z05 A;  5K5R A;  1I27 A;  2NRA C;  5BMZ A;  2FXA A;  4DNC A;  3JTG A;  3BRO A;  4HX4 A;  4P5O A;  3WG9 A;  2XKO A;  4HQM A;  3F21 A;  1LEA A;  2IPQ X;  3V7S A;  3I54 A;  1XB4 A;  3CLO A;  1TLH B;  2OU2 A;  4L5J A;  4Z2Y A;  2X0L A;  4TV7 A;  4CGZ A;  1QQI A;  2A61 A;  3HHG A;  2M8E A;  4EJW A;  4EM1 A;  2FQ3 A;  4ENM A;  4K2E A;  1Z7U A;  1BJA A;  3TOB A;  1XCV A;  3ECO A;  4OIO F;  6PAX A;  3VOE A;  4Q4Z F;  1ZLK A;  2P5K A;  4IRG A;  2D45 A;  2CO5 A;  2DO7 A;  1QPM A;  3GEZ A;  2DU9 A;  2GA2 A;  4MGR A;  4MHG A;  1L3L A;  1MGT A;  4S04 A;  2R3S A;  2KRF A;  4Y17 A;  5LEJ A;  2GAU A;  1HW1 A;  1U5T B;  2DT5 A;  3CUO A;  4I01 A;  1FWZ A;  1G3S A;  4CHU A;  5LGN A;  1KU2 A;  4M74 A;  3ROU A;  1H9G A;  3G3Z A;  2JZY A;  1ZRC A;  2Z99 A;  4RGX A;  1ZRF A;  2XUB A;  5LRR A;  2ZME B;  1GXP A;  3JTH A;  4WF2 A;  3DQV C;  4B8X A;  3GO5 A;  4M9S A;  3F72 A;  1TQP A;  3M9A A;  1I6X A;  3IKV A;  4U7D A;  2GXB A;  4UV9 A;  5CYV A;  2QQA A;  5L3G A;  4BNC A;  4GCV A;  2C6Y A;  3L9F A;  4OIQ F;  2JSC A;  5DV5 A;  4S05 A;  4HF1 A;  1HXD A;  1FPQ A;  2EWN A;  2VC0 A;  4PGG A;  3J80 Z;  2HYF A;  5ICE A;  4I98 B;  5HLI A;  1IXR C;  1PP7 U;  1XGS A;  2NYX A;  3JSP A;  2QZ8 A;  3HRT A;  1B6A A;  1MZB A;  4IJA A;  1DUX C;  3R61 A;  2V1D A;  3DKW A;  5HOO A;  1LDD A;  2NNN A;  4AVP A;  2VOD A;  2L02 A;  4O6J A;  3IKT A;  3WGH A;  1Z6T A;  4N0B A;  4MEY F;  2H09 A;  3R0A A;  1U2W A;  2MLG A;  3TO7 A;  1X3U A;  2PMU A;  3E5X A;  4ESJ A;  2WV0 A;  4UNO A;  5JHU A;  5D5X B;  2RV8 A;  4KIG A;  5DUK A;  4G6D A;  1IN4 A;  2OAZ A;  3QU3 A;  5HDN A;  3RYP A;  2RN7 A;  3JW4 A;  1ZGA A;  2ESN A;  4MTD A;  4EJU A;  4KT5 C;  1BI0 A;  2LSO A;  2VT3 A;  5IT3 A;  3KP3 A;  4RGS A;  3KP7 A;  3SXY A;  1SMY F;  2XIG A;  3L00 A;  2PFB A;  1T39 A;  3C7J A;  4HF0 A;  4Q47 A;  1XGN A;  1ZN2 A;  1SFU A;  1C0W A;  1ZRE A;  1F1Z A;  3E6D A;  2COM A;  4HLX A;  3K0L A;  5LEK A;  3WGI A;  3KP4 A;  1F4K A;  4ESF A;  1H0M A;  4KN7 X;  3HUG A;  2HTJ A;  2ZME A;  3J81 Z;  2YPR A;  4LK0 F;  2K4B A;  2HZT A;  2P5L C;  2P6T A;  5BOX A;  5DCM A;  2Z5U A;  1BN5 A;  3TO9 A;  4YFX F;  4JK1 X;  1AOY A;  3FHZ A;  4KIB A;  3EUH A;  1IAW A;  5FD5 A;  4IXA A;  2QVO A;  2W57 A;  1I1G A;  3U9G A;  4BXU A;  3IRR A;  1B1B A;  3EET A;  4I0B A;  3N97 A;  3RJP A;  5F64 A;  1R5G A;  4UXN A;  5D8K B;  4ENN A;  1KQ8 A;  3KET A;  4IF4 A;  2H6B A;  2YR2 A;  3H3U A;  1IW7 F;  1I5Z A;  4ZYE A;  3L7W A;  3K2Z A;  2O6G E;  2K86 A;  5E17 F;  5HS7 A;  3MEX A;  2MLK A;  2Q0O A;  3G73 A;  3IWF A;  2PQ8 A;  2PMH A;  1O7L A;  2XKP A;  3S2W A;  3QRF F;  5E8G A;  2FEZ A;  2VBZ A;  3ZN0 A;  1QZZ A;  3GUD A;  2RGV A;  2BBY A;  1O57 A;  4UHT A;  3HHH A;  1XMK A;  3GFI A;  3RDI A;  2IJL A;  2EFO A;  2STT A;  1UHW A;  1BI1 A;  2G7H A;  3K1P A;  1YTY A;  4N9I A;  1D8K A;  3FXQ A;  1SD4 A;  3MZY A;  2RKH A;  2EK5 A;  1ON2 A;  3WTV C;  3T5X A;  4GXO A;  3LA3 A;  1IUY A;  2GA1 A;  1F5T A;  3I58 A;  4RB3 C;  2XAJ A;  3F8B A;  3WTX C;  2W24 A;  4BYY A;  1ZG1 A;  4WX9 A;  2OQR A;  1IXC A;  3BWG A;  4ON0 A;  4JQF A;  1SFE A;  4G8X A;  4R1H A;  2FBH A;  5ICF A;  5A2Q Z;  1ON1 A;  3LAJ A;  2HKX A;  4UVB A;  3I59 B;  1GVJ A;  3BPX A;  3QP6 A;  1ZG3 A;  2FF4 A;  1NHA A;  1P2F A;  2B0L A;  5BQT A;  2IW5 A;  1YG2 A;  3R6S A;  3C3W A;  2KIF A;  3L2C A;  3LFK A;  2HYG D;  3TDU C;  1O3S A;  4GO1 A;  1S7O A;  3B73 A;  5D8L B;  3NRV A;  3ABU A;  2ESH A;  2A6E F;  1OR7 A;  1G6N A;  2UXN A;  2MBF A;  3FM5 A;  2DK8 A;  2YX4 A;  1REP C;  1IRF A;  2F5D A;  2K02 A;  1SD6 A;  4A6E A;  1MJA A;  2QBY B;  3TGN A;  1OKR A;  2QQ9 A;  2IVM A;  3ABT A;  2QYO A;  4Q5S F;  2HGC A;  1B59 A;  2FOK A;  3EYY A;  1Z91 A;  2D1H A;  3Q9V A;  1FLI A;  3T8R A;  2STW A;  5L3D A;  5FB2 A;  4QWQ A;  3NEU A;  2NAZ A;  1E17 A;  1IZ1 A;  1R58 A;  1AWC A;  2Y48 A;  1STZ A;  3TOA A;  3U1D A;  1FX7 A;  1W5T A;  2O8X A;  3KEQ A;  1ZH5 A;  1KA8 A;  1J9I A;  3WE3 A;  1MDM A;  3BJO A;  3ZQ7 A;  4OMZ A;  2VOP A;  3LWF A;  4AIK A;  1FBQ A;  1IN5 A;  2VBY A;  3I4P A;  2FMY A;  1KYW A;  3MWM A;  4EM2 A;  2JTV A;  1RNL A;  1IF1 A;  4MEX F;  2A5Y B;  1ONV A;  2P8T A;  4WK8 F;  1XCB A;  3FMQ A;  3HTU A;  1RIO H;  4WXD A;  4GGG A;  4GYG A;  1D8J A;  1HW5 A;  2ADU A;  5J8C A;  5JI6 A;  4O3M A;  2HS5 A;  4UVA A;  1WKM A;  4MQ9 F;  2DPU A;  4LD5 A;  2FML A;  5DEQ A;  4U0Y A;  4KN4 X;  4U7B A;  1BC7 C;  3RI4 A;  1G3T A;  3GW2 A;  1XSD A;  4XSX F;  3VOD A;  1ZHF A;  1YYV A;  4KDP A;  5LBQ A;  3FM3 A;  1XGM A;  2KJC A;  2OZ6 A;  2KIM A;  4L5I A;  4RB2 C;  2PJP A;  2HWV A;  1FOK A;  1R36 A;  3IWZ A;  2LNB A;  2VE9 A;  2OD5 A;  4L0Z B;  2GQQ A;  4KFC A;  4OIP F;  4G6Q A;  3GXO A;  3T1B A;  3P7N A;  4HOB A;  1W7P A;  2P5V A;  3MAJ A;  4HDV A;  3T8T A;  4M9Z A;  3C18 A;  5DCF A;  3TDZ C;  3W6K B;  2AXL A;  2QBY A;  4HX8 A;  4ASN A;  3KZZ A;  2Q8K A;  1SD7 A;  3BDD A;  4NHJ A;  1QGP A;  5E8I A;  4HYE A;  1B4A A;  1RUN A;  5DYM A;  4HF2 A;  1SAX A;  2DK5 A;  3MZH A;  2CQK A;  1FBS A;  3ZP5 A;  4LK1 F;  2V6C A;  2E7X A;  2DTR A;  4WWC A;  2EV0 A;  5H20 A;  2R7F A;  2L4M A;  2VE8 A;  5ICC A;  3TQN A;  4WCG A;  1KQ0 A;  1DDN A;  2XHK A;  3V8K A;  5ILV A;  4LJZ F;  4BH9 A;  3O3K A;  4WXH A;  5HDG A;  5BPD A;  4L18 B;  2O03 A;  3GF2 A;  3KLO A;  1ZRD A;  4FX0 A;  2CWE A;  1L0O C;  4HBL A;  2JPC A;  4JBA A;  2DQR A;  4Y15 A;  2CSO A;  3TKY A;  1XSV A;  2VT2 A;  3BJ6 A;  2PI0 A;  4L9J A;  2EFN A;  3CTA A;  1UST A;  4P9U A;  5F1R A;  1R23 A;  1IRG A;  1WRJ A;  2XGX A;  3M8E A;  1BOA A;  1T6S A;  4RB1 A;  4AWX B;  3BY6 A;  3J7A O;  3EDP A;  1U5T A;  3ISP A;  5JR3 A;  1W4M A;  1R00 A;  3ZMZ A;  1S29 A;  3WTW C;  1P92 A;  1WI9 A;  1R1V A;  3P9K A;  3P9I A;  1DP7 P;  4HDU A;  1KQ9 A;  3F22 A;  3FXU A;  3GWZ A;  2XAS A;  3HSR A;  2XAF A;  2K4J A;  4N9H A;  3B02 A;  4Q48 A;  1TQM A;  4QLC U;  2NS0 A;  1T38 A;  5ERI A;  1LJ9 A;  3QU6 A;  2CW0 F;  2OBP A;  3KCC A;  1K78 B;  3RKW A;  1J0R A;  4MQV A;  3DF8 A;  1O3T A;  1Z6R A;  1LQ1 A;  2ZNY A;  1TBX A;  1FSH A;  2QWW A;  4IRH A;  2RQP A;  5LHI A;  3E6M A;  2KIU A;  3I59 A;  4EM0 B;  2VBX A;  2VBW A;  1T2K A;  3SFZ A;  4ETS A;  4CYD A;  4PGH A;  2MD5 A;  3DFG A;  3VFZ A;  5D6E A;  1TNS A;  4FT8 A;  1HQC A;  4YFN F;  3F8M A;  4OIR F;  5LHG A;  2M87 A;  2WTE A;  3LQQ A;  1CF7 B;  1XDU A;  1H9T A;  1V4R A;  3HTS B;  2W25 A;  3LA7 A;  2W84 A;  1LEB A;  5FFZ A;  2JT1 A;  1R1U A;  4AIH A;  1YLF A;  2UXX A;  1QO0 D;  2E1N A;  2CYY A;  4XSZ F;  3V4G A;  2MC3 A;  5A2Q K;  1MKM A;  1EH7 A;  3VEP A;  4G7Z F;  1KU7 A;  2VOO A;  1P4A A;  1W7P B;  1FSE A;  4KMU X;  3RKY A;  3V7C A;  2QM3 A;  1S7A A;  3M8F A;  2EFQ A;  3QPT A;  5DD4 A;  1MJB A;  2A68 F;  4ZH4 F;  4U0W A;  1XD7 A;  2OQG A;  3ZMV A;  3E6C C;  3DPL C;  5TRD A;  2Z9O A;  4HAM A;  2XAG A;  4CIC A;  2BE5 F;  1YO5 C;  2M1B A;  1Z9C A;  1IN8 A;  1FYK A;  2AS5 F;  4EJV A;  4A0Z A;  4GYI A;  1JHH A;  4CZZ A;  1YW8 A;  5L3E A;  2O61 A;  3KLN A;  1Z1D A;  2FNP A;  5J8F A;  3CUQ C;  2GWR A;  3F23 A;  2DPD A;  2R7D A;  3GFM A;  1FNN A;  3K69 A;  3WE2 A;  4RB0 A;  4EQQ A;  2G7U A;  3COA C;  3CUQ B;  5KK1 A;  4EJO A;  4B09 A;  3HSE A;  4KNY A;  5IT9 K;  4MTE A;  4I7H A;  4M6Y A;  4LLN A;  1K6O A;  4DQ2 A;  3KE2 A;  5K1Y A;  1OYY A;  4A0X A;  1V3F A;  3DEU A;  2CG4 A;  2VXZ A;  3BP8 A;  1B9N A;  2DLL A;  3WTS C;  2FNA A;  3KFW X;  2BGC A;  5BS6 A;  1K7A A;  4F7Z A;  3E3V A;  4LLL A;  3KZY A;  4UUV A;  3I5U A;  3O2P E;  2Z3Y A;  5L3F A;  3WU0 A;  5FD6 A;  1G3W A;  5DUI A;  1IXS B;  2YX7 A;  3FMS A;  1ULY A;  4RS8 A;  1KU9 A;  2L4A A;  4IVN A;  4M71 A;  5FFX A;  4HV6 A;  4L9T A;  5ICG A;  3ZMT A;  1U5T C;  1J5Y A;  2H27 A;  2DI3 A;  2J5P A;  2WC2 A;  2EFP A;  2FA5 A;  3BOQ A;  3JSO A;  4G9Y A;  5IT9 Z;  5FLX K;  3GLX A;  2ACJ A;  2XAQ A;  2J5O A;  1XSX A;  3DPT A;  1PDN C;  3LA2 A;  5ILU A;  2XAH A;  4A0Y A;  1FY7 A;  2F5E A;  3SQN A;  3HYI A;  4I09 A;  4KUM A;  4UV8 A;  1VTN C;  4IRI A;  5DDG A;  2ZO4 A;  3FX3 A;  2YU3 A;  4A5M A;  3RIR A;  3IL2 A;  4U0V A;  5D5W B;  3QPH A;  1OYI A;  4OU0 A;  4MNU A;  2D1V A;  1MDM B;  2IP2 A;  1O7F A;  4KMF A;  3ECH A;  4EV0 A;  2GIV A;  4XLN F;  5EEH A;  3I71 A;  3CO7 C;  3WGG A;  5LRS A;  5CVJ A;  2FRH A;  1U78 A;  4IHT A;  4EJT A;  2V79 A;  1R1T A;  4UVC A;  4YFK F;  5AIP A;  5FLX Z;  1G3Y A;  3WU1 B;  1D5V A;  2PG4 A;  5JFR A;  5HS8 A;  4L9V A;  1HW2 A;  3D5L A;  3LQR A;  1RI7 A;  3BPV A;  1KGS A;  3ZN1 A;  2ISZ A;  4ENJ A;  2ISY A;  5E18 F;  2VON A;  4FX4 A;  3E97 A;  4HA8 A;  1WWX A;  4LG0 B;  2YSR A;  3LAP A;  2BV6 A;  5EEG A;  2W85 A;  1F9N A;  4LFU A;  1HBX G;  1QBJ A;  2HOE A;  1JXS A;  4ENK A;  2FU4 A;  3R0J A;  4BHC A;  2G9W A;  2P7V B;  2P7C B;  4A5N A;  3F8C A;  3ZPL A;  1I1S A;  4IPA A;  2K27 A;  3D0S A;  2GZW A;  4L0Y B;  1LNW A;  5LGT A;  3ZMD A;  4KA4 A;  2MH2 A;  2HDC A;  1IN7 A;  2PEX A;  2ZJ2 A;  2JPB A;  1FC3 A;  4BQA A;  3V8L A;  2ZNZ A;  3EYI A;  2VC1 A;  1BI3 A;  2FE3 A;  3MQ0 A;  2ZCW A;  2EA4 A;  4U88 A;  5F6F A;  1G4D A;  4R8H A;  4G7H F;  4ZZL A;  3K9T A;  3DXJ F;  1A04 A;  1CF7 A;  1EV7 A;  1HST A;  1YQA A;  2V9V A;  2HKO A;  3ZMS A;  2PLY A;  1CGP A;  3RKX A;  1Y0U A;  1J59 A;  4G7O F;  3F8N A;  2MH9 A;  1JGS A; 
#chains in the Genus database with same CATH topology
 4H0E A;  2DFI A;  1QZY A;  2JA2 A;  2XB5 A;  2EV5 A;  4AIJ A;  2HQR A;  3HRS A;  5JVT A;  4B3A A;  1XMA A;  3E0J B;  4M72 A;  3M07 A;  2I5U A;  4OMY A;  3ELK A;  1KYZ A;  2DJI A;  2KIS A;  1BIA A;  4PSW A;  1MMG A;  3TW7 A;  4EVI A;  2DMP A;  3DBH B;  1U6G A;  5D4S A;  4E70 A;  2ZJP F;  2VN2 A;  1IN6 A;  1FYL A;  5E1Z B;  3I0T A;  1D1B A;  1Z3X A;  3H36 A;  4IQ4 A;  5IYC J;  4LG0 A;  1SVO A;  4NQW B;  3VSK A;  2E71 A;  5GP9 A;  1IC8 A;  4Y52 J;  3V7R A;  2HI3 A;  3ABM H;  4RGU A;  4IZZ A;  1R5I D;  1W0U A;  5HDK A;  4ZTJ A;  2Y75 A;  4AUX A;  3BG6 A;  5CVR A;  4LIU A;  1BM9 A;  2RNJ A;  4D7M A;  1WPK A;  2HOS A;  2QF7 A;  3U2R A;  3WTY C;  4M3G A;  1GVD A;  5HLT A;  2A3S A;  3QYB A;  1LDK B;  1VQ4 I;  3QP5 A;  3U1K A;  2L54 A;  2BVL A;  2HR3 A;  3FWE A;  5K5Q A;  2KP6 A;  4HLY A;  3E5Q A;  3I53 A;  3QOE A;  1U9N A;  1BW6 A;  2XV4 S;  4G6T B;  3FKJ A;  3OS1 A;  1BL0 A;  1TW3 A;  3SFI A;  3S3N A;  3F0C A;  3H0G J;  1B9M A;  3O6B B;  1J7K A;  1H8A C;  3K4C A;  1X1P A;  4LOC A;  3CDH A;  4JOM A;  2LF8 A;  1LB2 A;  5JHF A;  3HRU A;  1ZGJ A;  2EZI A;  4LB6 B;  2NNY A;  1GDT A;  2HQ5 A;  4R79 A;  2IS6 A;  1P4W A;  1TWH J;  2ZSI B;  1D1C A;  1R22 A;  1E3O C;  1OMI A;  2MA3 A;  2IT0 A;  3LMM A;  1VQ7 I;  3HIF A;  3PNT A;  3REO A;  3WTT C;  2CGP A;  4EMS A;  3S3O A;  2H6C A;  1EH8 A;  2F5F A;  4HW0 A;  1FZP B;  2ID6 A;  1JE8 A;  4M73 A;  5D4R A;  2HEO A;  2N8G A;  2A69 F;  4MLO A;  1K6Y A;  2IA1 A;  3HGG A;  3SEZ A;  4AM3 A;  3W6J B;  2XF6 A;  2RNG A;  3MCZ A;  2K9N A;  4KIC A;  2V1U A;  2ECB A;  5EZH A;  4HX7 A;  2CV0 A;  5C44 J;  3CUQ A;  1S6L A;  1MH3 A;  2CUJ A;  3SZT A;  3IHU A;  4AC0 A;  3F6V A;  3R4K A;  1FP2 A;  2DDB A;  1LFB A;  3FXR A;  2PN6 A;  1JHF A;  4E7K A;  2JN6 A;  2W7N A;  1HKS A;  5EG0 A;  2R7W A;  5K7Z A;  3BR0 A;  3C1D A;  2TDX A;  2O3F A;  1GHC A;  1MBF A;  1HKT A;  3LSP A;  5ED4 A;  2IGO A;  1B72 B;  2UWM A;  3ASN H;  2LKP A;  3PQK A;  4CXF A;  4CCO A;  4BXF A;  2A5W A;  1K4S A;  3G71 I;  2FSW A;  3C2H A;  1IDZ A;  4Y4R A;  3S1R J;  1ZAR A;  1IGN A;  2E2J J;  1KU3 A;  2FOW A;  2VAS A;  3GZ6 A;  4ZDL A;  4A6D A;  2L2O A;  3CP8 A;  3QAH A;  1ZAO A;  4IL6 C;  2YU9 J;  2O5R A;  4EGZ A;  2ETH A;  2IS1 A;  3CCR I;  3HOV J;  1K79 A;  4PDK A;  2XVC A;  1OYW A;  4EGY A;  2CQ7 A;  1Y6I A;  4C3H J;  5ILS A;  2P4W A;  5IPA A;  4ESB A;  4AVZ A;  4ZDP A;  1BW5 A;  4FIS A;  3RQ4 A;  1YJW I;  4CCN A;  3DP7 A;  2L01 A;  2EZK A;  5FLX R;  1E2X A;  1FP1 D;  1V54 H;  2IAI A;  4NQW A;  5J40 A;  5IOZ A;  2DA2 A;  1MSE C;  3HPH A;  5LHH A;  5BPI A;  4RAY A;  4BAY A;  2GOX B;  2HQA A;  1WFX A;  1MNM C;  2FBI A;  1R49 A;  1FOX A;  4XOT A;  1YIT I;  4B4C A;  1MD0 A;  1H88 C;  2E2H J;  2LLK A;  3R60 A;  3GX4 X;  1YW7 A;  4I02 A;  4P9F A;  3OR1 C;  1ZYR F;  1TW2 A;  2K9S A;  3H3Z A;  2DQL A;  2OTL I;  1P4X A;  4XBF A;  3JR9 A;  2JA7 J;  3A0B C;  3MN2 A;  5E1W A;  2P6S A;  1R4M B;  1IV8 A;  2F4O B;  1TNT A;  3H5A A;  1FJL A;  3OIP A;  2NVQ J;  5J4Y A;  3KP2 A;  3H3V K;  3LNQ A;  3OYL A;  3KIO A;  1HSJ A;  1WJ5 A;  4YIF A;  1MJ9 A;  3J81 K;  2Y69 H;  2RVC A;  3DV8 A;  3GZ5 A;  1O4X A;  1XN7 A;  2JRT A;  1ETK A;  2KIQ A;  3TP3 A;  4M9X A;  3ERE D;  2Z33 A;  5M5X J;  3OYF A;  1O3Q A;  3OOP A;  2R5Y B;  5CLS A;  3BR5 A;  3BG9 A;  2HOA A;  3CC7 I;  3L09 A;  2OZU A;  2PBI A;  3OYC A;  4F3Q A;  1PP8 F;  5FGM A;  5KVR A;  1BI2 A;  2KKO A;  2UZK A;  1APL C;  4A3C J;  3GVA A;  5H6Q A;  1R7J A;  2HTS A;  5AIQ A;  3H92 A;  1QZE A;  3SDB A;  5K7H A;  3UKG A;  2OV7 A;  2QUF A;  3DTI A;  4EAT A;  5LLQ A;  3JAM K;  1GXQ A;  4HZF A;  1BC8 C;  3GZN B;  1FMW A;  4BAC A;  3TO6 A;  4Y13 A;  3PIP F;  1JT0 A;  1D0Y A;  4RBO A;  4I2O A;  5E20 A;  3M1E A;  2DJN A;  3HXL A;  3E5U A;  3LSM A;  1LE8 A;  2JA5 J;  5F0C A;  2VL8 A;  5DCM B;  3WOD F;  2ZXJ A;  2R4G A;  4LLG F;  4PCQ A;  3PQJ A;  1SFX A;  1TWA J;  4HV5 A;  3K70 D;  5L3B A;  2IA0 A;  4XLH A;  1D0X A;  2KJB A;  5M5W J;  4QIW N;  1DP3 A;  4CDG A;  5GTI C;  1Y1V J;  1YHQ I;  4PJM A;  3PFI A;  1R5H A;  3EPZ A;  2CFX A;  4BBR J;  2F6C A;  3W2W A;  2F2E A;  2M30 A;  3HUG B;  5KAI C;  4LIV A;  1Y8R B;  2DA4 A;  1EH6 A;  2QA4 I;  3CLQ A;  3FMR A;  2LK2 A;  3BR2 A;  2IA2 A;  3F3X A;  2X9D A;  1JKP C;  1YFH A;  3PNV A;  1WI3 A;  4C3I J;  3HJE A;  3E6B A;  2XF7 A;  3CJN A;  3RSN A;  1SAN A;  2V1X A;  2LG4 A;  4WXC A;  3OR2 C;  2VKH A;  2E7W A;  2LD5 A;  3QOP A;  1IUF A;  3OIQ A;  1UFM A;  5EGO A;  3HGY A;  3OIO A;  2EA2 A;  3KP5 A;  4A2U A;  1R9T J;  3Q9S A;  3HOT A;  2L3D A;  3DKX A;  1BIB A;  1YS7 A;  1UB9 A;  3FBI B;  3J7A W;  2WB1 N;  5D5V B;  4A3F J;  3JAM Z;  3JAM R;  2QQB A;  2BEO A;  3Q5F A;  4ZYH A;  2W1O A;  1TZL A;  2E1C A;  4IHS A;  1HKQ A;  2EJR A;  3VB2 A;  1OCT C;  2DA7 A;  2K5C A;  3H5R A;  1VFC A;  2K3P A;  3E7L A;  1GUU A;  3SZP A;  1DQU A;  2FX0 A;  3EQL F;  3KEO A;  3MFK A;  1S3J A;  4FHT A;  4OOI A;  3HOS A;  3ZMU A;  4XQF A;  2ZFW A;  1H89 C;  3HSF A;  5C4J J;  3F8F A;  3VSL A;  4XN0 A;  3J80 K;  4I0A A;  5HVQ C;  1NH3 A;  1HF0 A;  1QHH D;  4AID A;  2LP0 A;  4LMY A;  2XRN A;  1DPR A;  4ITV A;  2VKE A;  3FZV A;  4A3D J;  5HLG A;  5TJJ A;  3KP6 A;  2BHZ A;  1SMT A;  2OF7 A;  1T08 B;  1DGR M;  5E3O A;  2M5W A;  4ZZD A;  5CVV A;  1G59 A;  4MIM A;  1J75 A;  1TTY A;  3GTP J;  1FMV A;  1DPU A;  1YW9 A;  1WSU A;  3IUO A;  1JTY A;  2YS9 A;  3A1Y A;  2K9M A;  4BHP A;  4D1Q A;  1V5F A;  3K1M A;  4AD9 A;  5BNG A;  3E1S A;  4E7Z A;  3FXO A;  1FT9 A;  1S8N A;  2H94 A;  4PZJ A;  1UHM A;  4HQE A;  3ZQL A;  2RC4 A;  2XPV A;  4LGW A;  1MBG A;  4NB5 A;  5CJ9 A;  3JRG A;  2CV1 A;  3TMO A;  1RUO A;  2WAQ A;  1RZ4 A;  3BR6 A;  4L9N A;  3CO6 C;  2JQ7 A;  5F08 A;  1PUE E;  3AAF A;  4KYW A;  1UMQ A;  4BBS J;  1FYM A;  5D6F A;  3RTR A;  4QTR A;  4BGD A;  5J6X A;  1RQ6 A;  2Y9Z A;  5J3L A;  3NQO A;  3ZCO A;  3W6V A;  1RPW A;  1G2H A;  1YIO A;  4XLP F;  3LST A;  1QPI A;  3I4N J;  3JRF A;  5KNL A;  2Z2S B;  2WY8 Q;  2E1M B;  3RPQ A;  1O3R A;  4KJZ A;  3PO3 J;  2K40 A;  4X6A J;  2WB1 A;  4OIN F;  1SD5 A;  1WJA A;  1USS A;  1ZEL A;  4CSW A;  4CCM A;  3RPU A;  2HPI A;  5K5O A;  4A12 A;  3ASO H;  3ESW B;  3OL3 A;  1MBH A;  3SDG A;  2R5Z B;  2L9V A;  4XOR A;  2HXO A;  2EV6 A;  3GFJ A;  3ML6 A;  3OV8 A;  4YG2 F;  5D5U B;  2AQE A;  2RAE A;  3ZQH A;  2RDP A;  3AG4 H;  3QPL A;  1QNT A;  1FEX A;  2RRE A;  3TL4 X;  5H2F C;  1XDS A;  1D5Y A;  4PJL A;  2LY9 A;  1TQI A;  1UHS A;  1W7P D;  2DOD A;  1U3E M;  1K78 A;  4O5V A;  3MKZ A;  2BY3 A;  2X6Y A;  1W5S A;  2E2I J;  1SFK A;  3F6O A;  2XRO A;  3PL8 A;  2H8W A;  2M45 A;  3HG9 A;  2BVM A;  2JVH A;  3FK7 A;  2JUC A;  4DGW B;  1P7I A;  2O0Y A;  2JSP A;  3H0D A;  4M6X A;  2FBK A;  5CVU A;  2LR8 A;  4CO8 A;  1QU3 A;  2DAO A;  3RYR A;  1D1A A;  3ULQ B;  2GXA A;  1YIJ I;  1ODD A;  2R7U A;  4DOZ A;  5AON A;  3M7G A;  5FO5 A;  4HNU A;  4RGR A;  2VB6 A;  4KIT B;  1HA8 A;  1BR2 A;  4F52 A;  1K83 J;  1ETY A;  3J7Y J;  2E35 A;  2FD5 A;  5DD8 A;  5L3C A;  1E3H A;  2Z16 A;  2ZBK A;  4D0P A;  2HFH A;  4V19 K;  1ZGW A;  4J19 A;  1NTC A;  3RZD J;  1WQ2 A;  3T0Y A;  5HNH A;  1LVA A;  1OPC A;  1EA3 A;  3BJA A;  1P6R A;  3OMY A;  1XGO A;  4RAF A;  2F5C A;  2GXG A;  5H6R A;  1BBY A;  3WTZ A;  4RLF A;  4BHB A;  4HST A;  1YS6 A;  3OYJ A;  2COB A;  2L7K A;  3MZ8 A;  1QHG A;  2GOM A;  2LF7 A;  4ZYG A;  5EGO B;  1ZLJ A;  2HOT A;  2VQL A;  2Y0M A;  2VKD A;  3EUH C;  2DBB A;  3ZXS A;  3GYH X;  3BZ6 A;  1MNE A;  3ZQG A;  1DU6 A;  3SHF A;  2DA5 A;  3OYK A;  2AQF A;  1J2X A;  2HNH A;  2ZJQ F;  2EB7 A;  5E1X A;  3FF5 A;  1UCR A;  3S1N J;  3N4M A;  1GV2 A;  1LUJ B;  2DW4 A;  2X4H A;  2Q2E A;  2IRF G;  3I64 A;  1UG0 A;  1FBU A;  5GAH J;  2BYV E;  5FKM A;  1T98 A;  2K7L A;  1OCR H;  3FXJ A;  2D2W A;  1QVT A;  2HDW A;  1Q1H A;  4LB5 A;  4P96 A;  3H5N A;  2E1O A;  4N4N B;  3OYB A;  5GAG J;  1M1E B;  2HQN A;  2VKV A;  4XM3 A;  2LDU A;  4IQJ A;  4RM2 A;  4B3X A;  1ZG5 A;  1W36 C;  2ELH A;  4KIF A;  2IS2 A;  3FXM A;  4ZYD A;  4MFD A;  1T0F A;  3FK6 A;  2QLZ A;  2CQN A;  3JCU C;  1VQK I;  3GFL A;  4RAZ A;  4YII A;  1U8R A;  3PIO F;  2ZKZ A;  3V8J A;  4XRF A;  3IRQ A;  3DEE A;  2A07 F;  2R7T A;  3P9C A;  2A6H F;  4I99 C;  4II2 A;  4Z6Y A;  2EFW A;  5E79 C;  1LFU P;  2F48 A;  4G94 A;  1T0F C;  3WTU C;  2TRT A;  1R4N B;  1X3W B;  5EZG A;  5LGU A;  1Z0X A;  3BC8 A;  2WWY A;  3K1N A;  3ZQC A;  4P55 A;  2CUZ A;  4XLC A;  1LDJ A;  4OAY A;  5CVI A;  3VYT B;  5HLH A;  2OA4 A;  3BCA A;  3IC7 A;  4PK4 A;  5HS9 A;  2QEN A;  4XIC A;  1D3Y A;  3HRM A;  4ZYA A;  5C4X J;  1FIP A;  1OIS A;  1Z05 A;  4RM3 A;  4D5F A;  5K5R A;  2E1M C;  2GLO A;  1I27 A;  3BLY A;  3GLL A;  2NRA C;  2K85 A;  5BMZ A;  2FXA A;  4DNC A;  4M3F A;  3JTG A;  3BRO A;  4FTH A;  4HX4 A;  4P5O A;  4UB8 C;  3WG9 A;  4S0H B;  1MND A;  3MVP A;  5KHD A;  2JA8 J;  1WVR A;  2XKO A;  4HQM A;  4D5C A;  3F21 A;  2DFF A;  2M2E A;  3Q3S A;  1LEA A;  2IPQ X;  1K61 A;  2V9K A;  3K2A A;  5F0F A;  2MGQ A;  3I54 A;  2Y0S A;  3V7S A;  5B66 C;  4ZC3 A;  2KRC A;  3CF2 A;  2VLA A;  4E7I A;  1XB4 A;  1SFO J;  2ELK A;  3CLO A;  1TLH B;  1Y56 A;  5FLV A;  3HKZ A;  2OU2 A;  3ONQ A;  4L5J A;  2R93 J;  4Z2Y A;  3LSG A;  4HNV A;  2X0L A;  4TV7 A;  4CGZ A;  1QQI A;  2A61 A;  2EIL H;  2OTJ I;  3HHG A;  2M8E A;  4EJW A;  4EM1 A;  2XB0 X;  1PYV A;  5F27 A;  2W4S A;  2FQ3 A;  4ENM A;  1X1D A;  4K2E A;  2V26 A;  5HNF A;  1RET A;  3CD6 I;  1Z7U A;  1BJA A;  3TOB A;  1XCV A;  2ZB9 A;  4PFP A;  4Y33 A;  3ECO A;  4OIO F;  6PAX A;  3GME A;  4DW6 A;  4F93 B;  2MVT A;  1LFP A;  4J00 A;  3VOE A;  3GTK J;  1POG A;  2WAQ N;  3FKI J;  4Q4Z F;  1ZLK A;  2P5K A;  4IRG A;  2D45 A;  2NVT J;  3Q0W A;  2CO5 A;  2DO7 A;  1YX3 A;  1QPM A;  3GEZ A;  4B43 A;  2DU9 A;  2GA2 A;  4MGR A;  3ZQI A;  4MHG A;  2YUS A;  2KDZ A;  1L3L A;  1MGT A;  2NVX J;  4S04 A;  2R3S A;  2VJI A;  3PUF A;  3ZOB A;  2KRF A;  5EEA A;  2DXI A;  4Y17 A;  5LEJ A;  3C2G A;  2GAU A;  2R7X A;  1WH7 A;  1HW1 A;  1U5T B;  3S17 J;  4A3M J;  2H1L A;  2DT5 A;  3CUO A;  1T95 A;  2LFB A;  4I01 A;  1FWZ A;  1ETX A;  1G3S A;  4CHU A;  4CZC A;  2Q1Z B;  1VZ0 A;  2M0C A;  3O8G A;  5B1B H;  1KU2 A;  2XPU A;  5LGN A;  4M74 A;  3ROU A;  1H9G A;  3G3Z A;  2E19 A;  2JZY A;  2NS8 A;  4GRI A;  3L1P A;  4BE2 A;  1ZRC A;  2Z99 A;  4RGX A;  1ZRF A;  2XUB A;  1TT5 B;  5LRR A;  3OYM A;  2ZME B;  2L5Q A;  3JTH A;  1GXP A;  2L9S A;  4WF2 A;  3FXK A;  4BJ6 C;  1MW7 A;  1TWG J;  3QQA A;  3DQV C;  4B8X A;  2D5V A;  1TP4 A;  3GO5 A;  4M9S A;  3F72 A;  4IKF A;  2LY2 A;  1TQP A;  1GLN A;  3M9A A;  1I6X A;  1TT0 A;  2QCO A;  3IKV A;  4U7D A;  2CS3 A;  3PFY A;  2GXB A;  2E36 A;  4UV9 A;  2QQA A;  5CYV A;  5L3G A;  4BNC A;  4A3B J;  4GCV A;  2O8K A;  2C6Y A;  3L9F A;  4OIQ F;  2JSC A;  1IV6 A;  5DM7 F;  3CZ6 A;  3A03 A;  5DV5 A;  2PJR A;  4S05 A;  4HF1 A;  4ABZ A;  1AKH B;  1HXD A;  1FPQ A;  2PJR B;  3QOD A;  2EWN A;  2VC0 A;  3CES A;  4PGG A;  3J80 Z;  1JJ6 C;  4GFB A;  2EIM H;  2HYF A;  3PNY A;  3NWS A;  5ICE A;  4I98 B;  2QKL B;  5HLI A;  1IXR C;  4CUG A;  1PP7 U;  3FHN A;  1B8I A;  1XGS A;  1B72 A;  1RKT A;  3CCJ I;  2NYX A;  3JSP A;  1Z77 A;  2QZ8 A;  3HRT A;  2X1D A;  5GAD J;  3OY9 A;  5KAF C;  2LY1 A;  2KFD A;  1B6A A;  3CC4 I;  1N75 A;  1W36 D;  2F5V A;  1OCC H;  4U87 A;  1MZB A;  4IJA A;  1DUX C;  3R61 A;  2V1D A;  3DKW A;  2KLO A;  5HOO A;  1LDD A;  4E7H A;  2NNN A;  2NVU B;  1PVE A;  4M3E A;  1MSF C;  2VIX A;  2XSD C;  4AVP A;  1JT6 A;  2MD0 A;  2VOD A;  2L02 A;  3CCE I;  4O6J A;  3IKT A;  5KCM A;  3WGH A;  1Z6T A;  3J7Z I;  4N0B A;  4MEY F;  2H09 A;  4RAG A;  2I8D A;  2ZJR F;  5EYR A;  3R0A A;  1U2W A;  1Z3Y A;  2MLG A;  1MIJ A;  3TO7 A;  1JUP A;  1X3U A;  3E5X A;  2CQQ A;  2PMU A;  1X4P A;  4CYC B;  2V1N A;  4M3B A;  4ESJ A;  3OWT A;  2WV0 A;  4BY7 J;  2NOJ B;  4CCJ A;  1X4O A;  1IJW C;  4UNO A;  5JHU A;  4UY8 I;  5D5X B;  4YRV A;  1TWC J;  2RV8 A;  4KIG A;  5DUK A;  4G6D A;  1IN4 A;  2IGM A;  2L9N A;  2BW3 B;  2OAZ A;  3X2Q H;  3RPU D;  3QU3 A;  2IEK A;  5HDN A;  2ZSH B;  3RYP A;  1A36 A;  1MMS A;  2RN7 A;  3M3Y J;  3JW4 A;  1ZGA A;  2ESN A;  1AHD P;  4RMN A;  1I3Q J;  4MTD A;  4EJU A;  2QSG X;  4KT5 C;  1BI0 A;  2LSO A;  1WHU A;  1QRY A;  2VT3 A;  5IT3 A;  4II3 A;  3KP3 A;  1U8B A;  4RGS A;  3KP7 A;  3SXY A;  1HLV A;  4IOC F;  1SMY F;  2XIG A;  2LRE A;  1V55 H;  3L00 A;  2PFB A;  3K10 A;  1T39 A;  3C7J A;  3BZK A;  3LFU A;  2EIK H;  4HF0 A;  4B1R A;  5J4V A;  4ZJZ A;  2L0K A;  2JJ7 A;  4BE0 A;  1LVK A;  2ICW G;  4Q47 A;  4A3L J;  1XGN A;  1ZN2 A;  1SEU A;  2XSJ C;  1SFU A;  1C0W A;  1ZRE A;  4W97 A;  4DZJ A;  1F1Z A;  3E6D A;  2COM A;  1WH5 A;  4HLX A;  3AG3 H;  3HOY J;  2ZME C;  3K0L A;  1ETO A;  3LSI A;  3O8H A;  3S1M J;  5LEK A;  4E7S A;  3H9G A;  3WGI A;  3OYH A;  3PJR A;  3KP4 A;  3GCM A;  1F4K A;  1ETQ A;  1A5J A;  4ESF A;  4MO7 A;  5J1Y A;  1J09 A;  4KN7 X;  1H0M A;  3HUG A;  2AO9 A;  2HTJ A;  2ZME A;  5LFA A;  3RZO J;  3J81 Z;  2YPR A;  4LK0 F;  3WHB A;  2K4B A;  2HZT A;  2P5L C;  1Z67 A;  3OS0 A;  4L5E A;  2P6T A;  3KYC B;  4AYB A;  1PUF B;  5BOX A;  1N25 A;  5DCM A;  3BG3 A;  2Z5U A;  1BN5 A;  3TO9 A;  4YFX F;  4GDF A;  3LSH A;  4JK1 X;  5C3E J;  4MFE A;  1AOY A;  3FHZ A;  1S5L C;  2CW7 A;  3EUH A;  4KIB A;  1IAW A;  5FD5 A;  2DMQ A;  4IXA A;  3NWT A;  2QGU A;  2QVO A;  2W57 A;  1I1G A;  3U9G A;  4BXU A;  3IRR A;  1B1B A;  3EET A;  4XLA A;  4I0B A;  5M5Y J;  1ZR4 A;  2EQR A;  3RJP A;  5F64 A;  3N97 A;  2W82 A;  3CP2 A;  3L2V A;  1XC5 A;  3JRD A;  4FET A;  2Y2Z A;  3I3L A;  1R5G A;  4XLF A;  4UXN A;  3I56 I;  5D8K B;  3D5R C;  4ENN A;  1KQ8 A;  3KET A;  3FIW A;  4IO9 F;  4BQO A;  4NNJ A;  4IF4 A;  2H6B A;  2YR2 A;  1WJE A;  3PSF A;  4DBQ A;  3H3U A;  1WJC A;  3DWL E;  1ETW A;  1IW7 F;  3PM1 A;  1I5Z A;  4G12 A;  2DYS H;  1RKW A;  5K7F A;  1YI2 I;  3A02 A;  3HC7 A;  3LL7 A;  3L7W A;  4ZYE A;  3K2Z A;  3JRI A;  3GTL J;  2O6G E;  2XGC A;  2K86 A;  1Q1V A;  5E17 F;  2ZFU A;  5HS7 A;  3MEX A;  2MLK A;  2Q0O A;  3M8J A;  3G73 A;  1AA7 A;  5IOY A;  3IWF A;  2PQ8 A;  2R5Y A;  5A2Q R;  2PMH A;  1O7L A;  2XKP A;  3S2W A;  3QRF F;  5E8G A;  2MC4 A;  3W2V A;  3CCM I;  2FEZ A;  2VBZ A;  3ZN0 A;  1QZZ A;  2K9L A;  3GUD A;  2XPW A;  1WZ2 A;  4KT6 A;  2RGV A;  2M9H A;  3D1N I;  2BBY A;  1O57 A;  4UHT A;  3HHH A;  1FIA A;  2R0Q C;  2KDO A;  2VXD A;  1KON A;  1XMK A;  2X1E A;  3RDI A;  3GFI A;  3CCV I;  2IJL A;  2EFO A;  3HOZ J;  2H8R A;  2STT A;  3DPU A;  1UHW A;  1BI1 A;  1JJ8 C;  2G7H A;  3K1P A;  3MKL A;  4ZDO A;  1YTY A;  3NAU A;  3ZQF A;  4N9I A;  3MMY B;  1D8K A;  2Y30 A;  3HZJ A;  3FXQ A;  3Q0U A;  1SD4 A;  5E3N A;  3MZY A;  2RKH A;  1VQO I;  2EK5 A;  1ON2 A;  3WTV C;  3OYA A;  3HDD A;  3T5X A;  4GXO A;  3LA3 A;  1IUY A;  2GA1 A;  4BEH A;  3DLL F;  3I58 A;  1F5T A;  4M6V A;  4RB3 C;  2XAJ A;  3F8B A;  3WTX C;  1ORK A;  1ZR2 A;  4BEH B;  3FXL A;  2W24 A;  4BYY A;  1ZG1 A;  4WX9 A;  4PJ0 C;  2OQR A;  4HSR A;  2B9S A;  1IXC A;  2R7Z J;  4UB6 C;  3BWG A;  4ON0 A;  3A52 A;  4JQF A;  2IXS A;  1SFE A;  4G8X A;  4R1H A;  2FBH A;  5ICF A;  5A2Q Z;  1ON1 A;  4NDL A;  4C2T A;  3LAJ A;  2NVY J;  2HKX A;  4UVB A;  1WJF A;  3I59 B;  1GVJ A;  2L7M P;  3BPX A;  4JP0 A;  3QP6 A;  3B6A A;  1ZG3 A;  2LOO A;  2FF4 A;  4E4H A;  1NHA A;  2BXY A;  1P2F A;  2B0L A;  4RLQ A;  1VQN I;  5BQT A;  5E3L A;  2IW5 A;  1TC3 C;  1YG2 A;  3R6S A;  4LG3 A;  3C3W A;  2KIF A;  4BS9 A;  3L2C A;  3LFK A;  2HYG D;  2V7F A;  4NBQ A;  3TDU C;  2HU9 A;  1O3S A;  4GO1 A;  1S7O A;  1OR7 C;  3B73 A;  2V4J C;  2MUN A;  5D8L B;  3NRV A;  3ABU A;  2ESH A;  3GBG A;  2ME0 A;  4BKX A;  1ZTR A;  2A6E F;  1FTT A;  2R7R A;  2V6E A;  4QPO A;  2EZH A;  1IDY A;  3HBL A;  1OR7 A;  4BUP A;  2FUG 2;  1G6N A;  2UXN A;  2R7O A;  2MBF A;  3FM5 A;  1VQ5 I;  3PUB A;  4DBR A;  2DK8 A;  2YX4 A;  4B44 A;  3H9J A;  1REP C;  2F4I A;  3CQZ J;  1IRF A;  3IAS 2;  2F5D A;  2K02 A;  3IH4 A;  4JX5 A;  1SD6 A;  4X1E A;  1MJA A;  2MW8 A;  4A6E A;  2QBY B;  3BTL A;  3H9Q A;  3TGN A;  1K4T A;  3ERM A;  3MKY B;  1OKR A;  1BR4 A;  2ZXI A;  1WGX A;  1N78 A;  2IGK A;  2QQ9 A;  1I39 A;  5FLM J;  1Y1W J;  2IVM A;  3ABT A;  2QYO A;  2BOL A;  2HVR A;  4Q5S F;  3AKZ A;  2HGC A;  2EIJ H;  2ID3 A;  1B59 A;  3EYY A;  2FOK A;  3BTC A;  3FDY A;  1XG1 A;  4N4O B;  2LMD A;  2ECC A;  4YEJ A;  3AG1 H;  1Z91 A;  3UNG C;  1UJ8 A;  3S3M A;  2D1H A;  3Q9V A;  2HZD A;  2BY1 A;  3DTE A;  1FLI A;  3T8R A;  2STW A;  3EUK L;  3CME I;  3LSK A;  3ABK H;  5L3D A;  5FB2 A;  4QWQ A;  2KPM A;  1A6Q A;  3NEU A;  3SJM A;  2CJJ A;  2I10 A;  2NAZ A;  4HNT A;  4XID A;  1E17 A;  1IZ1 A;  2VQC A;  4C30 A;  1RR8 C;  1R58 A;  2WY7 Q;  2JWT A;  4BU2 A;  1AWC A;  2Y48 A;  2JA6 J;  3K4L A;  1STZ A;  5EF6 A;  1UAA A;  3TOA A;  3U1D A;  5M3M J;  1FX7 A;  1W5T A;  2DTZ A;  3C2B A;  1MMA A;  3HPG A;  2O8X A;  2DFH A;  4A3I J;  3KEQ A;  3QPS A;  1ZH5 A;  3DEW A;  1A31 A;  1KA8 A;  2DA1 A;  5GPA A;  1J9I A;  3WE3 A;  1MDM A;  3BJO A;  3ZQ7 A;  4PJJ A;  2M34 A;  4OMZ A;  3CDI A;  2VOP A;  3CCS I;  2DT7 B;  3LWF A;  1XS9 A;  4AIK A;  1FBQ A;  1IN5 A;  4A3G J;  2IGN A;  2VBY A;  3I4P A;  4NC7 A;  3S1Q J;  2FMY A;  3S15 J;  1KYW A;  2JTV A;  1RNL A;  3MWM A;  3DLA A;  4EM2 A;  1JKR C;  4MEX F;  1IF1 A;  2A5Y B;  1ONV A;  4RA2 A;  1PUF A;  4DYC A;  2P8T A;  4WK8 F;  1XCB A;  3GTM J;  3HOX J;  2L9R A;  3FMQ A;  3HTU A;  4BQN A;  3QWL A;  4XK4 A;  1HOM A;  3DKY A;  1RIO H;  3WHC A;  4HG2 A;  4WXD A;  4GGG A;  4GYG A;  1D8J A;  3ZRG A;  1HW5 A;  3FBN B;  2ADU A;  1BA5 A;  5J8C A;  5JI6 A;  4ANJ A;  4IOA F;  1ENH A;  3WG7 H;  2HS5 A;  4O3M A;  4UVA A;  1WKM A;  4MQ9 F;  2RQQ A;  2DPU A;  2K3F A;  1OCP A;  4LD5 A;  1WCM J;  2FML A;  2QKM B;  5DEQ A;  2W48 A;  4U0Y A;  4KN4 X;  5EG0 B;  4U7B A;  1VQ6 I;  3WU2 C;  1MBK A;  1SAU A;  1BC7 C;  4HRI A;  3TP0 A;  3RI4 A;  2V9P A;  2Y0S N;  1G3T A;  1YJN I;  3GW2 A;  1F43 A;  1XSD A;  4NC8 A;  4XSX F;  4XKW A;  5GTH C;  3VOD A;  1ZHF A;  1YYV A;  1NK2 P;  4EEF G;  3CC2 I;  4KDP A;  5LBQ A;  2CFO A;  2Q2E B;  3FM3 A;  1XGM A;  2ELJ A;  2KJC A;  1IRX A;  2OZ6 A;  2KIM A;  2M4K A;  4L5I A;  4RB2 C;  4BL0 B;  2PJP A;  2HWV A;  1FOK A;  1FOW A;  1R36 A;  2LNB A;  3IWZ A;  2VE9 A;  2OD5 A;  4L0Z B;  1RES A;  2MYS A;  2GQQ A;  4KFC A;  4OIP F;  3L2R A;  4G6Q A;  5IY5 H;  3GXO A;  3T1B A;  3P7N A;  4HOB A;  4XMY A;  4CCL A;  1IG7 A;  3K6G A;  1X1C A;  2UUZ A;  3ZR8 X;  1W7P A;  2P5V A;  2OUM A;  2IBD A;  3MAJ A;  4HDV A;  3CMY A;  3RCO A;  3T8T A;  1UG2 A;  3C18 A;  4M9Z A;  1IO2 A;  5DCF A;  3TDZ C;  2CUF A;  4F92 B;  1F36 A;  3W6K B;  1V5E A;  1X1A A;  1I50 J;  2CMP A;  2AXL A;  2QBY A;  4HX8 A;  2KRH A;  4ASN A;  3KZZ A;  2Q8K A;  2DOA A;  1SD7 A;  2JMW A;  3BDD A;  1LPQ A;  5FKN A;  4NHJ A;  1ETV A;  5B1A H;  2EH3 A;  1JKO C;  1QGP A;  3TED A;  3G1M A;  2DOF A;  5E8I A;  4HYE A;  1B4A A;  1RUN A;  1X2N A;  5DYM A;  2AXT C;  3OYD A;  2XGD A;  2BY2 A;  4HF2 A;  1SAX A;  2M0M A;  2DK5 A;  3MZH A;  2CQK A;  4KIS A;  4IHW A;  2LRD A;  1FBS A;  1XX5 A;  3GTO J;  1EF4 A;  2CRG A;  3ZP5 A;  3DCF A;  3LSJ A;  2E5Z A;  4LK1 F;  2V6C A;  5IP7 J;  2E7X A;  2DTR A;  4WWC A;  2EV0 A;  5H20 A;  2R7F A;  2L4M A;  2VE8 A;  2BHY A;  4XKV A;  5ICC A;  2KQR A;  3OSG A;  2DT6 A;  3KYL A;  1A6I A;  2LVS A;  3TQN A;  4WCG A;  1RC9 A;  1KQ0 A;  1KZH A;  1DDN A;  2XHK A;  2XAU A;  3V8K A;  4NC6 A;  5ILV A;  4LJZ F;  4BH9 A;  3QYF A;  1Z21 A;  2JRM A;  3O3K A;  3GTG J;  4WXH A;  5HDG A;  5M3F J;  3S2H J;  5BPD A;  5J1U A;  5IP6 A;  4C2U A;  1UEL B;  2R7V A;  9ANT A;  4L18 B;  2O03 A;  3GF2 A;  2O7O A;  3KLO A;  1ZRD A;  2KT0 A;  4AU7 A;  3ABL H;  4FX0 A;  3VPR A;  2CWE A;  1L0O C;  1QVU A;  4HBL A;  2JPC A;  3BTJ A;  2DQR A;  4JBA A;  3BR1 A;  4C9Y A;  4QPQ A;  4I6Z A;  1YX5 A;  4Y15 A;  4XNF A;  3K7A J;  2CSO A;  3FIS A;  3TKY A;  5FRO A;  4XL9 A;  3JRH A;  5FRM A;  1XSV A;  2VT2 A;  2X6X A;  3BJ6 A;  2PI0 A;  3KEY A;  4L9J A;  1X19 A;  2EFN A;  3CTA A;  1UST A;  1ZK8 A;  1G8X A;  2CH0 A;  4P9U A;  3F9K A;  5F1R A;  1R23 A;  1S72 I;  1IRG A;  3BG7 A;  1WRJ A;  2XGX A;  2ME6 A;  3M8E A;  2DDA A;  1BOA A;  5JLW A;  3MD2 A;  4CA0 A;  1T6S A;  4RB1 A;  4AWX B;  2JVG A;  1JUS A;  2VUM J;  4IHY A;  3BY6 A;  2E60 A;  4XRS A;  3J7A O;  4HPQ A;  2FQ4 A;  3EDP A;  1U5T A;  2X48 A;  3ISP A;  5IYB J;  1W4M A;  5JR3 A;  2B63 J;  1R00 A;  1OFC X;  3ZMZ A;  2UV1 A;  3KX2 A;  1HCR A;  1S29 A;  2WBM A;  2L7Z A;  2XF5 A;  3CDL A;  3WTW C;  1P92 A;  1WI9 A;  4FQG A;  2HYJ A;  1R1V A;  2PMZ N;  3P9K A;  2K9Q A;  1ZKG A;  2KL4 A;  1MH4 A;  1OJL A;  4BDZ A;  2XRL A;  3P9I A;  3IH2 A;  5FRN A;  2VJ4 A;  1DP7 P;  2DFE A;  4HDU A;  2G0E A;  4XRM A;  1KQ9 A;  2BW3 A;  3F22 A;  4J01 A;  3FXU A;  3GWZ A;  2E5N A;  2XAS A;  2VJJ A;  5EJC A;  3HSR A;  3OYE A;  2XAF A;  2K4J A;  4N9H A;  3B02 A;  4Q48 A;  4CH7 A;  5IP9 J;  3JRC A;  1TQM A;  1X58 A;  4OWR B;  4QLC U;  4BE1 A;  2NS0 A;  1JKQ C;  3VYR B;  2HVS A;  1T38 A;  2ZXH A;  1OCO H;  2CW8 A;  1N77 A;  5ERI A;  4A3E J;  1LJ9 A;  3CF5 F;  3QU6 A;  4B48 A;  2CW0 F;  2OBP A;  3HKZ N;  3KCC A;  1W5C C;  4FE7 A;  1K78 B;  3RKW A;  1U9O A;  1J0R A;  1T33 A;  1Z7L A;  2OCE A;  4MQV A;  3DF8 A;  1O3T A;  4DJA A;  2X51 A;  5F04 A;  1Z6R A;  1LQ1 A;  1A35 A;  1HDP A;  2ZNY A;  2Z1D A;  1TBX A;  1FSH A;  1ITY A;  3LOC A;  2KMU A;  4CCK A;  3BTI A;  2QWW A;  4IRH A;  3KZI C;  1XTA A;  1MBE A;  1Y8Q B;  2RQP A;  5LHI A;  2MFZ A;  3E6M A;  1YE9 A;  4UUS A;  2KIU A;  3I59 A;  4EM0 B;  4XON A;  2VBX A;  2VBW A;  1T2K A;  3SFZ A;  2LBF B;  3DBL B;  4ETS A;  4CYD A;  2CQX A;  4PGH A;  2MD5 A;  1EKE A;  3DFG A;  3K4K A;  2JK3 A;  2VJ5 A;  2VPR A;  2X85 A;  3VFZ A;  5F0H A;  3MKW B;  5D6E A;  5B5E C;  4IHX A;  1TNS A;  1NG7 A;  2GBY A;  4FT8 A;  1HQC A;  3I4M J;  3W3C A;  4YFN F;  2HPM A;  3F8M A;  4OIR F;  5EDN A;  4Y7N J;  2VI6 A;  5LHG A;  3UR3 C;  2KHM A;  2M87 A;  1TL8 A;  2E34 A;  3OYI A;  1CQT A;  2WTE A;  3LQQ A;  1GV5 A;  4F55 A;  3G2B A;  1CF7 B;  3HM5 A;  1BR1 A;  1XDU A;  1H9T A;  1V4R A;  3HTS B;  5CPR B;  2X98 A;  2AHQ A;  2W25 A;  3LA7 A;  3S16 J;  4IEJ A;  4FCY A;  2P0W A;  1W0T A;  1P9Q C;  1VQ9 I;  2W84 A;  1LEB A;  5FFZ A;  2XDV A;  3P5J A;  2JT1 A;  1GT0 C;  2H1K A;  1R1U A;  4AIH A;  1YLF A;  1NK3 P;  2UXX A;  1QO0 D;  4DYR A;  4RDU A;  3K4N A;  4C2M J;  2E1N A;  2CYY A;  2MG4 A;  4XSZ F;  3V4G A;  2MC3 A;  5A2Q K;  1MKM A;  1EH7 A;  3VEP A;  4G7Z F;  5DS9 A;  3BT9 A;  1KU7 A;  2VQG A;  5F1J A;  2Y9Y A;  2VOO A;  3J7A Y;  1P4A A;  1W7P B;  1FSE A;  1S7E A;  4KMU X;  1VQP I;  3A2K A;  3RKY A;  3V7C A;  1YRN B;  4BJT A;  2BZT A;  2QM3 A;  3JRB A;  4CYC A;  2KZV A;  1P7J A;  3H35 A;  2WAF A;  1S7A A;  5HOD A;  2EPF A;  3CJT B;  3M8F A;  1SVL A;  3BQY A;  5LD2 C;  2DCE A;  2EFQ A;  2W00 A;  3TBI A;  1ERD A;  3QPT A;  4JX6 A;  5DD4 A;  1MJB A;  3IP4 B;  2A68 F;  4ZH4 F;  4E7L A;  1WJD A;  4U0W A;  1XD7 A;  2OQG A;  3ZMV A;  1FTZ A;  3E6C C;  3CCQ I;  3DPL C;  5TRD A;  2EZL A;  2Z9O A;  4HAM A;  2DMN A;  2XAG A;  4CIC A;  2BE5 F;  1AKH A;  2B7E A;  2M1B A;  1FOY A;  3OSF A;  1YO5 C;  1Z9C A;  1IN8 A;  1FYK A;  2AS5 F;  2DN0 A;  1YOV B;  1OCZ H;  4EJV A;  4JYK A;  4A0Z A;  3M4O J;  4GYI A;  1JHH A;  1X2M A;  2EBI A;  4CZZ A;  3JRA A;  1YW8 A;  2BXZ A;  5L3E A;  2O61 A;  3KLN A;  1Z1D A;  2MAB A;  2FNP A;  4UUT A;  4AYB N;  3K70 C;  3M1C A;  3SYT A;  5J8F A;  3CUQ C;  2GWR A;  3F23 A;  3Q0V A;  4UUS B;  2DPD A;  4A3J J;  2LKS A;  4YIR X;  1U0J A;  2R7D A;  4BXX J;  3GFM A;  1FNN A;  3CJR B;  3K69 A;  5FKK A;  3WE2 A;  4RB0 A;  1DU0 A;  4EQQ A;  3S14 J;  2G7U A;  3COA C;  1BOB A;  4DZP A;  3CUQ B;  5KK1 A;  1X3Z B;  4EJO A;  4B09 A;  4E7J A;  3HSE A;  4KNY A;  5IT9 K;  4XOP A;  4MTE A;  3OOU A;  3DU6 A;  4I7H A;  3AFH A;  4M6Y A;  4LLN A;  2GIZ A;  3CMM A;  1K6O A;  1DGW Y;  2QQ8 A;  4DQ2 A;  3G4S I;  3KE2 A;  3L2U A;  4W1U A;  4IHV A;  1B8I B;  5JVG F;  5K1Y A;  1OYY A;  3AG2 H;  2R92 J;  4A0X A;  1ACI A;  4XN3 A;  1E0E A;  1V3F A;  1QA6 A;  3DEU A;  2CG4 A;  4D7N A;  3G1O A;  2R7S A;  3HL2 A;  3BP8 A;  2VXZ A;  1B9N A;  2DLL A;  2HXI A;  3WTS C;  3A01 A;  2FNA A;  2M35 A;  3KFW X;  2BGC A;  5CKT A;  3RQI A;  5BS6 A;  4PSX A;  1K7A A;  4F7Z A;  3E3V A;  4LLL A;  1Y39 A;  3KZY A;  5E3M A;  4UUV A;  3IV5 A;  1OLT A;  2OPT A;  2WV1 A;  3K4M A;  5JLX A;  1TWF J;  1WJB A;  3I5U A;  3L2Q A;  3O2P E;  1JGG A;  2Z3Y A;  3RKQ A;  3SEQ A;  5L3F A;  4I76 A;  2KZG A;  3WU0 A;  2DA3 A;  5FD6 A;  3OL4 A;  3DBR B;  3J81 R;  1G3W A;  4XR6 A;  5DUI A;  1IXS B;  3PSI A;  2YX7 A;  1NG6 A;  1R71 A;  3FMS A;  1ULY A;  2X6O A;  3HOW J;  4RS8 A;  3VYU B;  1KU9 A;  2LYC A;  2L4A A;  4IVN A;  4M71 A;  5FFX A;  4DYQ A;  3U21 A;  5FJ8 J;  1AU7 A;  4DIQ A;  1IRZ A;  5FKO A;  4HV6 A;  4L9T A;  2VPL A;  2R7Q A;  2BY0 A;  5ICG A;  3ZMT A;  1U5T C;  1J5Y A;  2H27 A;  2DI3 A;  2J5P A;  2WC2 A;  4B47 A;  5TGT A;  2EFP A;  2FA5 A;  3BOQ A;  2VQH A;  3JSO A;  4G9Y A;  3TW6 A;  3I55 I;  4BJ5 C;  2FJ1 A;  5IT9 Z;  5FLX K;  1MBJ A;  3GLX A;  4D9J A;  2O9L A;  1VQ8 I;  2ACJ A;  2IS4 A;  3CMA I;  2ZC2 A;  2XAQ A;  4C3J J;  2J5O A;  1VQL I;  3BR3 A;  1YJ9 I;  1XSX A;  1W1W E;  2A05 A;  3DPT A;  3LA2 A;  1PDN C;  5ILU A;  2HDD A;  4A3K J;  2TCT A;  1UZC A;  3BCB A;  2XAH A;  4HEA 2;  4A0Y A;  3L2W A;  3A4C A;  1FY7 A;  1E3P A;  4OAZ A;  4PJN A;  1D0Z A;  3IH3 A;  2F5E A;  2M8G X;  3SQN A;  3VDX A;  2MSY A;  3HYI A;  4I09 A;  4F91 B;  3G1L A;  4KUM A;  4UV8 A;  1VTN C;  2CV2 A;  4IRI A;  1I3A A;  1OQY A;  5DDG A;  2ZO4 A;  3QYE A;  3FX3 A;  2YU3 A;  3CCY A;  4A5M A;  1R6R A;  5IYD J;  2MZ4 A;  5J47 A;  2M4G A;  4LIT A;  3RIR A;  3IL2 A;  1LE8 B;  4U0V A;  5D5W B;  3VYS B;  2L7F P;  3QPH A;  3OYG A;  1OYI A;  5DM6 F;  3HEF A;  4OU0 A;  4MNU A;  2D1V A;  1MDM B;  2ZXW H;  2IP2 A;  1PJR A;  1S9H A;  2P81 A;  1O7F A;  3PO2 J;  1I6H J;  2LBF A;  4NUB A;  3JRE A;  4KMF A;  3ECH A;  4EV0 A;  2GIV A;  4XLN F;  1XPX A;  2Y31 A;  5EEH A;  3I71 A;  3OS2 A;  3CO7 C;  2WAE A;  3WGG A;  1SVM A;  3I9V 2;  5LRS A;  1MMD A;  2A6T A;  3S32 A;  4FAS D;  1JI8 A;  3DTK A;  5CVJ A;  2F4M B;  2DYR H;  2FRH A;  3KYD B;  1HC8 A;  3HB9 A;  1U78 A;  2NS7 A;  3DU5 A;  2WAD A;  1VND A;  4IHT A;  3GTJ J;  4YEL A;  4JX4 A;  4EJT A;  2V79 A;  1R1T A;  1BJZ A;  4UVC A;  5CQG A;  4E6K G;  4YFK F;  3HOU J;  2PX9 A;  2LH9 A;  2X1C A;  5J1R A;  5AIP A;  5FLX Z;  1G3Y A;  3WU1 B;  3B6C A;  1D5V A;  2JUG A;  2PG4 A;  5JFR A;  5HS8 A;  5TIS C;  4XKC A;  3K4B A;  4L9V A;  1HW2 A;  3D5L A;  3CCL I;  2QSF X;  3LQR A;  1EJ9 A;  1RI7 A;  3BPV A;  1KGS A;  2DOE A;  3BZC A;  3AL0 C;  3CCU I;  2WA0 A;  2OC6 A;  4IX7 A;  3ZN1 A;  2ISZ A;  4ENJ A;  3LSR A;  2HVQ A;  4PFO A;  2ISY A;  2DMU A;  5E18 F;  2EIN H;  2VON A;  4FX4 A;  3E97 A;  3ZGK A;  2XGE A;  4PUS A;  3A01 B;  4HA8 A;  1WWX A;  2DMT A;  3H1C A;  4LG0 B;  2YSR A;  3LAP A;  2BV6 A;  4BQQ A;  3BQZ A;  3AL0 B;  3ZQQ A;  2LKX A;  1T56 A;  5EEG A;  2QSH X;  2W85 A;  1F9N A;  4LFU A;  1HBX G;  1QBJ A;  1XMX A;  5DTD A;  2HOE A;  1JXS A;  1YRN A;  4ENK A;  1X1B A;  3S93 A;  4P1W A;  4BY1 J;  2P0T A;  1VF9 A;  3N05 A;  4Y3O A;  2FU4 A;  3R0J A;  4BHC A;  2G9W A;  2LTP A;  2P7V B;  2XC7 A;  3EUA A;  1MMN A;  4A5N A;  2P7C B;  1RR7 A;  4A69 C;  2NOG A;  5GPC A;  3F8C A;  2DA6 A;  3G6E I;  3J80 R;  3ZPL A;  4XLE A;  3NAR A;  2R5Z A;  1RRJ A;  1I1S A;  4IPA A;  2K27 A;  3D0S A;  2GZW A;  4L0Y B;  1LNW A;  3BG5 A;  5LGT A;  5GAE J;  3ZMD A;  4KA4 A;  2MH2 A;  2HDC A;  1SC7 A;  1JUM A;  4A93 J;  1IN7 A;  2PEX A;  2ZJ2 A;  2NXN B;  2JPB A;  4H4K C;  1FC3 A;  3A0H C;  4BQA A;  3V8L A;  2GM4 A;  4BDY A;  2CUE A;  2ZNZ A;  1VI0 A;  2M7A A;  4V2F A;  4M3D A;  3EYI A;  2VC1 A;  4X0G A;  2PMZ A;  1JTX A;  3VWB A;  1BI3 A;  2LC2 A;  1V5G A;  2FE3 A;  2OCC H;  3V42 A;  4V2G A;  2M3A A;  1VQM I;  3MQ0 A;  2ZCW A;  5IT9 R;  1LKX A;  1T8I A;  4ZTF A;  2EA4 A;  2QEX I;  3CJQ B;  3GTQ J;  3SZG A;  4U88 A;  1Y0N A;  4XRS G;  5F6F A;  5B3S H;  1G4D A;  4R8H A;  4G7H F;  4ZZL A;  2OJE D;  3K9T A;  2X6W A;  3D5S C;  3W2A A;  3DXJ F;  2M7B A;  1A04 A;  2CU7 A;  1CF7 A;  3S8P A;  3KPH A;  5FKL A;  1EV7 A;  3IAM 2;  1HDD C;  1HST A;  3OYN A;  1YQA A;  2V9V A;  4FE4 A;  5CQE A;  2HKO A;  3S2D J;  3ZMS A;  4QSH A;  1ZQ3 P;  2PLY A;  1CGP A;  3RKX A;  1Y0U A;  4XKB A;  1J59 A;  4G7O F;  3F8N A;  3K4J A;  2MH9 A;  1JGS A; 
#chains in the Genus database with same CATH homology
 4H0E A;  2DFI A;  1QZY A;  2EV5 A;  4AIJ A;  2HQR A;  3HRS A;  5JVT A;  1XMA A;  4M72 A;  4OMY A;  3ELK A;  1KYZ A;  1BIA A;  4EVI A;  1U6G A;  5D4S A;  4E70 A;  1FYL A;  2VN2 A;  1IN6 A;  5E1Z B;  3I0T A;  4LG0 A;  3V7R A;  4RGU A;  5HDK A;  2Y75 A;  5CVR A;  1BM9 A;  2RNJ A;  3U2R A;  3WTY C;  2A3S A;  1LDK B;  3QP5 A;  2L54 A;  2HR3 A;  3FWE A;  5K5Q A;  4HLY A;  3E5Q A;  3I53 A;  2XV4 S;  1TW3 A;  1B9M A;  3O6B B;  1J7K A;  3CDH A;  2LF8 A;  1LB2 A;  3HRU A;  1ZGJ A;  4LB6 B;  2NNY A;  4R79 A;  1P4W A;  1R22 A;  1OMI A;  2MA3 A;  2IT0 A;  3HIF A;  3REO A;  3WTT C;  2CGP A;  4EMS A;  2H6C A;  1EH8 A;  2F5F A;  4HW0 A;  1FZP B;  1JE8 A;  4M73 A;  5D4R A;  2HEO A;  2A69 F;  2IA1 A;  3W6J B;  3MCZ A;  4KIC A;  2V1U A;  4HX7 A;  3CUQ A;  1S6L A;  3SZT A;  3IHU A;  3F6V A;  3R4K A;  1FP2 A;  3FXR A;  2PN6 A;  1JHF A;  1HKS A;  3C1D A;  2O3F A;  2TDX A;  1GHC A;  1HKT A;  5ED4 A;  2UWM A;  2LKP A;  3PQK A;  4CXF A;  2FSW A;  1ZAR A;  1KU3 A;  3GZ6 A;  4A6D A;  3QAH A;  1ZAO A;  4EGZ A;  2ETH A;  1K79 A;  4PDK A;  2XVC A;  1OYW A;  4EGY A;  5ILS A;  2P4W A;  4ESB A;  3DP7 A;  2L01 A;  1E2X A;  1FP1 D;  4NQW A;  5LHH A;  5BPI A;  4RAY A;  4BAY A;  2FBI A;  1MD0 A;  3R60 A;  3GX4 X;  1YW7 A;  4I02 A;  4P9F A;  1ZYR F;  1TW2 A;  3H3Z A;  2DQL A;  1P4X A;  4XBF A;  5E1W A;  2P6S A;  1TNT A;  3KP2 A;  1HSJ A;  4YIF A;  1MJ9 A;  3J81 K;  2RVC A;  3DV8 A;  3GZ5 A;  1XN7 A;  2JRT A;  4M9X A;  3ERE D;  2Z33 A;  1O3Q A;  3OOP A;  5CLS A;  3L09 A;  2OZU A;  2PBI A;  1PP8 F;  5FGM A;  5KVR A;  1BI2 A;  2KKO A;  2UZK A;  3GVA A;  5H6Q A;  1R7J A;  2HTS A;  5AIQ A;  3H92 A;  2QUF A;  1BC8 C;  5LLQ A;  3JAM K;  1GXQ A;  4HZF A;  3TO6 A;  4Y13 A;  4I2O A;  5E20 A;  3M1E A;  3E5U A;  5DCM B;  3WOD F;  2ZXJ A;  4LLG F;  4PCQ A;  3PQJ A;  1SFX A;  4HV5 A;  5L3B A;  2IA0 A;  2KJB A;  4CDG A;  3PFI A;  1R5H A;  2CFX A;  2F2E A;  2M30 A;  1EH6 A;  3FMR A;  2IA2 A;  3F3X A;  1YFH A;  3E6B A;  3CJN A;  2V1X A;  4WXC A;  2E7W A;  3QOP A;  1UFM A;  2EA2 A;  3KP5 A;  4A2U A;  3Q9S A;  3HOT A;  2L3D A;  1BIB A;  1YS7 A;  1UB9 A;  5D5V B;  3JAM Z;  2QQB A;  2BEO A;  3Q5F A;  4ZYH A;  2E1C A;  4IHS A;  1HKQ A;  2EJR A;  3VB2 A;  3SZP A;  3KEO A;  3MFK A;  3EQL F;  1S3J A;  4FHT A;  4OOI A;  3HOS A;  3ZMU A;  2ZFW A;  3HSF A;  3F8F A;  3J80 K;  4I0A A;  5HVQ C;  4LMY A;  2XRN A;  1DPR A;  3FZV A;  5HLG A;  5TJJ A;  3KP6 A;  1SMT A;  2M5W A;  4ZZD A;  5CVV A;  1J75 A;  1TTY A;  1DPU A;  1YW9 A;  1WSU A;  4BHP A;  3K1M A;  4AD9 A;  1FT9 A;  1S8N A;  2H94 A;  4PZJ A;  1UHM A;  4HQE A;  2RC4 A;  4LGW A;  4NB5 A;  5CJ9 A;  1RUO A;  1RZ4 A;  4L9N A;  3CO6 C;  1PUE E;  4KYW A;  3AAF A;  1FYM A;  5D6F A;  3RTR A;  5J6X A;  3NQO A;  1YIO A;  4XLP F;  3LST A;  3RPQ A;  1O3R A;  4OIN F;  1SD5 A;  1USS A;  3RPU A;  5K5O A;  4A12 A;  5D5U B;  2EV6 A;  3GFJ A;  3ML6 A;  3OV8 A;  4YG2 F;  2RDP A;  1QNT A;  1XDS A;  1TQI A;  1W7P D;  1U3E M;  1K78 A;  4O5V A;  1W5S A;  3F6O A;  2XRO A;  2M45 A;  2O0Y A;  4M6X A;  2FBK A;  5CVU A;  4CO8 A;  2DAO A;  3RYR A;  3ULQ B;  1ODD A;  5AON A;  3M7G A;  5FO5 A;  4RGR A;  5DD8 A;  5L3C A;  2ZBK A;  4D0P A;  2HFH A;  1WQ2 A;  3T0Y A;  1LVA A;  1OPC A;  3BJA A;  1P6R A;  1XGO A;  2GXG A;  2F5C A;  5H6R A;  1BBY A;  3WTZ A;  4BHB A;  1YS6 A;  2LF7 A;  4ZYG A;  1ZLJ A;  2Y0M A;  2DBB A;  3GYH X;  3BZ6 A;  3SHF A;  1J2X A;  2EB7 A;  5E1X A;  3FF5 A;  1UCR A;  3N4M A;  2DW4 A;  2X4H A;  2Q2E A;  2IRF G;  3I64 A;  1FBU A;  2BYV E;  1T98 A;  2K7L A;  2D2W A;  1Q1H A;  4LB5 A;  4P96 A;  2HQN A;  2LDU A;  1ZG5 A;  2ELH A;  4KIF A;  4ZYD A;  1T0F A;  2QLZ A;  3GFL A;  4RAZ A;  4YII A;  1U8R A;  2ZKZ A;  3V8J A;  4XRF A;  3IRQ A;  2A07 F;  3P9C A;  2A6H F;  2EFW A;  4G94 A;  3WTU C;  5LGU A;  2WWY A;  3K1N A;  4P55 A;  5CVI A;  1LDJ A;  5HLH A;  2OA4 A;  3IC7 A;  5HS9 A;  2QEN A;  1D3Y A;  3HRM A;  1Z05 A;  5K5R A;  1I27 A;  2NRA C;  5BMZ A;  2FXA A;  4DNC A;  3JTG A;  3BRO A;  4HX4 A;  4P5O A;  3WG9 A;  2XKO A;  4HQM A;  3F21 A;  1LEA A;  2IPQ X;  3V7S A;  3I54 A;  1XB4 A;  3CLO A;  1TLH B;  2OU2 A;  4L5J A;  4Z2Y A;  2X0L A;  4TV7 A;  4CGZ A;  1QQI A;  2A61 A;  3HHG A;  2M8E A;  4EJW A;  4EM1 A;  2FQ3 A;  4ENM A;  4K2E A;  1Z7U A;  1BJA A;  3TOB A;  1XCV A;  3ECO A;  4OIO F;  6PAX A;  3VOE A;  4Q4Z F;  1ZLK A;  2P5K A;  4IRG A;  2D45 A;  2CO5 A;  2DO7 A;  1QPM A;  3GEZ A;  2DU9 A;  2GA2 A;  4MGR A;  4MHG A;  1L3L A;  1MGT A;  4S04 A;  2R3S A;  2KRF A;  4Y17 A;  5LEJ A;  2GAU A;  1HW1 A;  1U5T B;  2DT5 A;  3CUO A;  4I01 A;  1FWZ A;  1G3S A;  4CHU A;  5LGN A;  1KU2 A;  4M74 A;  3ROU A;  1H9G A;  3G3Z A;  2JZY A;  1ZRC A;  2Z99 A;  4RGX A;  1ZRF A;  2XUB A;  5LRR A;  2ZME B;  1GXP A;  3JTH A;  4WF2 A;  3DQV C;  4B8X A;  3GO5 A;  4M9S A;  3F72 A;  1TQP A;  3M9A A;  1I6X A;  3IKV A;  4U7D A;  2GXB A;  4UV9 A;  5CYV A;  2QQA A;  5L3G A;  4BNC A;  4GCV A;  2C6Y A;  3L9F A;  4OIQ F;  2JSC A;  5DV5 A;  4S05 A;  4HF1 A;  1HXD A;  1FPQ A;  2EWN A;  2VC0 A;  4PGG A;  3J80 Z;  2HYF A;  5ICE A;  4I98 B;  5HLI A;  1IXR C;  1PP7 U;  1XGS A;  2NYX A;  3JSP A;  2QZ8 A;  3HRT A;  1B6A A;  1MZB A;  4IJA A;  1DUX C;  3R61 A;  2V1D A;  3DKW A;  5HOO A;  1LDD A;  2NNN A;  4AVP A;  2VOD A;  2L02 A;  4O6J A;  3IKT A;  3WGH A;  1Z6T A;  4N0B A;  4MEY F;  2H09 A;  3R0A A;  1U2W A;  2MLG A;  3TO7 A;  1X3U A;  2PMU A;  3E5X A;  4ESJ A;  2WV0 A;  4UNO A;  5JHU A;  5D5X B;  2RV8 A;  4KIG A;  5DUK A;  4G6D A;  1IN4 A;  2OAZ A;  3QU3 A;  5HDN A;  3RYP A;  2RN7 A;  3JW4 A;  1ZGA A;  2ESN A;  4MTD A;  4EJU A;  4KT5 C;  1BI0 A;  2LSO A;  2VT3 A;  5IT3 A;  3KP3 A;  4RGS A;  3KP7 A;  3SXY A;  1SMY F;  2XIG A;  3L00 A;  2PFB A;  1T39 A;  3C7J A;  4HF0 A;  4Q47 A;  1XGN A;  1ZN2 A;  1SFU A;  1C0W A;  1ZRE A;  1F1Z A;  3E6D A;  2COM A;  4HLX A;  3K0L A;  5LEK A;  3WGI A;  3KP4 A;  1F4K A;  4ESF A;  1H0M A;  4KN7 X;  3HUG A;  2HTJ A;  2ZME A;  3J81 Z;  2YPR A;  4LK0 F;  2K4B A;  2HZT A;  2P5L C;  2P6T A;  5BOX A;  5DCM A;  2Z5U A;  1BN5 A;  3TO9 A;  4YFX F;  4JK1 X;  1AOY A;  3FHZ A;  4KIB A;  3EUH A;  1IAW A;  5FD5 A;  4IXA A;  2QVO A;  2W57 A;  1I1G A;  3U9G A;  4BXU A;  3IRR A;  1B1B A;  3EET A;  4I0B A;  3N97 A;  3RJP A;  5F64 A;  1R5G A;  4UXN A;  5D8K B;  4ENN A;  1KQ8 A;  3KET A;  4IF4 A;  2H6B A;  2YR2 A;  3H3U A;  1IW7 F;  1I5Z A;  4ZYE A;  3L7W A;  3K2Z A;  2O6G E;  2K86 A;  5E17 F;  5HS7 A;  3MEX A;  2MLK A;  2Q0O A;  3G73 A;  3IWF A;  2PQ8 A;  2PMH A;  1O7L A;  2XKP A;  3S2W A;  3QRF F;  5E8G A;  2FEZ A;  2VBZ A;  3ZN0 A;  1QZZ A;  3GUD A;  2RGV A;  2BBY A;  1O57 A;  4UHT A;  3HHH A;  1XMK A;  3GFI A;  3RDI A;  2IJL A;  2EFO A;  2STT A;  1UHW A;  1BI1 A;  2G7H A;  3K1P A;  1YTY A;  4N9I A;  1D8K A;  3FXQ A;  1SD4 A;  3MZY A;  2RKH A;  2EK5 A;  1ON2 A;  3WTV C;  3T5X A;  4GXO A;  3LA3 A;  1IUY A;  2GA1 A;  1F5T A;  3I58 A;  4RB3 C;  2XAJ A;  3F8B A;  3WTX C;  2W24 A;  4BYY A;  1ZG1 A;  4WX9 A;  2OQR A;  1IXC A;  3BWG A;  4ON0 A;  4JQF A;  1SFE A;  4G8X A;  4R1H A;  2FBH A;  5ICF A;  5A2Q Z;  1ON1 A;  3LAJ A;  2HKX A;  4UVB A;  3I59 B;  1GVJ A;  3BPX A;  3QP6 A;  1ZG3 A;  2FF4 A;  1NHA A;  1P2F A;  2B0L A;  5BQT A;  2IW5 A;  1YG2 A;  3R6S A;  3C3W A;  2KIF A;  3L2C A;  3LFK A;  2HYG D;  3TDU C;  1O3S A;  4GO1 A;  1S7O A;  3B73 A;  5D8L B;  3NRV A;  3ABU A;  2ESH A;  2A6E F;  1OR7 A;  1G6N A;  2UXN A;  2MBF A;  3FM5 A;  2DK8 A;  2YX4 A;  1REP C;  1IRF A;  2F5D A;  2K02 A;  1SD6 A;  4A6E A;  1MJA A;  2QBY B;  3TGN A;  1OKR A;  2QQ9 A;  2IVM A;  3ABT A;  2QYO A;  4Q5S F;  2HGC A;  1B59 A;  2FOK A;  3EYY A;  1Z91 A;  2D1H A;  3Q9V A;  1FLI A;  3T8R A;  2STW A;  5L3D A;  5FB2 A;  4QWQ A;  3NEU A;  2NAZ A;  1E17 A;  1IZ1 A;  1R58 A;  1AWC A;  2Y48 A;  1STZ A;  3TOA A;  3U1D A;  1FX7 A;  1W5T A;  2O8X A;  3KEQ A;  1ZH5 A;  1KA8 A;  1J9I A;  3WE3 A;  1MDM A;  3BJO A;  3ZQ7 A;  4OMZ A;  2VOP A;  3LWF A;  4AIK A;  1FBQ A;  1IN5 A;  2VBY A;  3I4P A;  2FMY A;  1KYW A;  3MWM A;  4EM2 A;  2JTV A;  1RNL A;  1IF1 A;  4MEX F;  2A5Y B;  1ONV A;  2P8T A;  4WK8 F;  1XCB A;  3FMQ A;  3HTU A;  1RIO H;  4WXD A;  4GGG A;  4GYG A;  1D8J A;  1HW5 A;  2ADU A;  5J8C A;  5JI6 A;  4O3M A;  2HS5 A;  4UVA A;  1WKM A;  4MQ9 F;  2DPU A;  4LD5 A;  2FML A;  5DEQ A;  4U0Y A;  4KN4 X;  4U7B A;  1BC7 C;  3RI4 A;  1G3T A;  3GW2 A;  1XSD A;  4XSX F;  3VOD A;  1ZHF A;  1YYV A;  4KDP A;  5LBQ A;  3FM3 A;  1XGM A;  2KJC A;  2OZ6 A;  2KIM A;  4L5I A;  4RB2 C;  2PJP A;  2HWV A;  1FOK A;  1R36 A;  3IWZ A;  2LNB A;  2VE9 A;  2OD5 A;  4L0Z B;  2GQQ A;  4KFC A;  4OIP F;  4G6Q A;  3GXO A;  3T1B A;  3P7N A;  4HOB A;  1W7P A;  2P5V A;  3MAJ A;  4HDV A;  3T8T A;  4M9Z A;  3C18 A;  5DCF A;  3TDZ C;  3W6K B;  2AXL A;  2QBY A;  4HX8 A;  4ASN A;  3KZZ A;  2Q8K A;  1SD7 A;  3BDD A;  4NHJ A;  1QGP A;  5E8I A;  4HYE A;  1B4A A;  1RUN A;  5DYM A;  4HF2 A;  1SAX A;  2DK5 A;  3MZH A;  2CQK A;  1FBS A;  3ZP5 A;  4LK1 F;  2V6C A;  2E7X A;  2DTR A;  4WWC A;  2EV0 A;  5H20 A;  2R7F A;  2L4M A;  2VE8 A;  5ICC A;  3TQN A;  4WCG A;  1KQ0 A;  1DDN A;  2XHK A;  3V8K A;  5ILV A;  4LJZ F;  4BH9 A;  3O3K A;  4WXH A;  5HDG A;  5BPD A;  4L18 B;  2O03 A;  3GF2 A;  3KLO A;  1ZRD A;  4FX0 A;  2CWE A;  1L0O C;  4HBL A;  2JPC A;  4JBA A;  2DQR A;  4Y15 A;  2CSO A;  3TKY A;  1XSV A;  2VT2 A;  3BJ6 A;  2PI0 A;  4L9J A;  2EFN A;  3CTA A;  1UST A;  4P9U A;  5F1R A;  1R23 A;  1IRG A;  1WRJ A;  2XGX A;  3M8E A;  1BOA A;  1T6S A;  4RB1 A;  4AWX B;  3BY6 A;  3J7A O;  3EDP A;  1U5T A;  3ISP A;  5JR3 A;  1W4M A;  1R00 A;  3ZMZ A;  1S29 A;  3WTW C;  1P92 A;  1WI9 A;  1R1V A;  3P9K A;  3P9I A;  1DP7 P;  4HDU A;  1KQ9 A;  3F22 A;  3FXU A;  3GWZ A;  2XAS A;  3HSR A;  2XAF A;  2K4J A;  4N9H A;  3B02 A;  4Q48 A;  1TQM A;  4QLC U;  2NS0 A;  1T38 A;  5ERI A;  1LJ9 A;  3QU6 A;  2CW0 F;  2OBP A;  3KCC A;  1K78 B;  3RKW A;  1J0R A;  4MQV A;  3DF8 A;  1O3T A;  1Z6R A;  1LQ1 A;  2ZNY A;  1TBX A;  1FSH A;  2QWW A;  4IRH A;  2RQP A;  5LHI A;  3E6M A;  2KIU A;  3I59 A;  4EM0 B;  2VBX A;  2VBW A;  1T2K A;  3SFZ A;  4ETS A;  4CYD A;  4PGH A;  2MD5 A;  3DFG A;  3VFZ A;  5D6E A;  1TNS A;  4FT8 A;  1HQC A;  4YFN F;  3F8M A;  4OIR F;  5LHG A;  2M87 A;  2WTE A;  3LQQ A;  1CF7 B;  1XDU A;  1H9T A;  1V4R A;  3HTS B;  2W25 A;  3LA7 A;  2W84 A;  1LEB A;  5FFZ A;  2JT1 A;  1R1U A;  4AIH A;  1YLF A;  2UXX A;  1QO0 D;  2E1N A;  2CYY A;  4XSZ F;  3V4G A;  2MC3 A;  5A2Q K;  1MKM A;  1EH7 A;  3VEP A;  4G7Z F;  1KU7 A;  2VOO A;  1P4A A;  1W7P B;  1FSE A;  4KMU X;  3RKY A;  3V7C A;  2QM3 A;  1S7A A;  3M8F A;  2EFQ A;  3QPT A;  5DD4 A;  1MJB A;  2A68 F;  4ZH4 F;  4U0W A;  1XD7 A;  2OQG A;  3ZMV A;  3E6C C;  3DPL C;  5TRD A;  2Z9O A;  4HAM A;  2XAG A;  4CIC A;  2BE5 F;  1YO5 C;  2M1B A;  1Z9C A;  1IN8 A;  1FYK A;  2AS5 F;  4EJV A;  4A0Z A;  4GYI A;  1JHH A;  4CZZ A;  1YW8 A;  5L3E A;  2O61 A;  3KLN A;  1Z1D A;  2FNP A;  5J8F A;  3CUQ C;  2GWR A;  3F23 A;  2DPD A;  2R7D A;  3GFM A;  1FNN A;  3K69 A;  3WE2 A;  4RB0 A;  4EQQ A;  2G7U A;  3COA C;  3CUQ B;  5KK1 A;  4EJO A;  4B09 A;  3HSE A;  4KNY A;  5IT9 K;  4MTE A;  4I7H A;  4M6Y A;  4LLN A;  1K6O A;  4DQ2 A;  3KE2 A;  5K1Y A;  1OYY A;  4A0X A;  1V3F A;  3DEU A;  2CG4 A;  2VXZ A;  3BP8 A;  1B9N A;  2DLL A;  3WTS C;  2FNA A;  3KFW X;  2BGC A;  5BS6 A;  1K7A A;  4F7Z A;  3E3V A;  4LLL A;  3KZY A;  4UUV A;  3I5U A;  3O2P E;  2Z3Y A;  5L3F A;  3WU0 A;  5FD6 A;  1G3W A;  5DUI A;  1IXS B;  2YX7 A;  3FMS A;  1ULY A;  4RS8 A;  1KU9 A;  2L4A A;  4IVN A;  4M71 A;  5FFX A;  4HV6 A;  4L9T A;  5ICG A;  3ZMT A;  1U5T C;  1J5Y A;  2H27 A;  2DI3 A;  2J5P A;  2WC2 A;  2EFP A;  2FA5 A;  3BOQ A;  3JSO A;  4G9Y A;  5IT9 Z;  5FLX K;  3GLX A;  2ACJ A;  2XAQ A;  2J5O A;  1XSX A;  3DPT A;  1PDN C;  3LA2 A;  5ILU A;  2XAH A;  4A0Y A;  1FY7 A;  2F5E A;  3SQN A;  3HYI A;  4I09 A;  4KUM A;  4UV8 A;  1VTN C;  4IRI A;  5DDG A;  2ZO4 A;  3FX3 A;  2YU3 A;  4A5M A;  3RIR A;  3IL2 A;  4U0V A;  5D5W B;  3QPH A;  1OYI A;  4OU0 A;  4MNU A;  2D1V A;  1MDM B;  2IP2 A;  1O7F A;  4KMF A;  3ECH A;  4EV0 A;  2GIV A;  4XLN F;  5EEH A;  3I71 A;  3CO7 C;  3WGG A;  5LRS A;  5CVJ A;  2FRH A;  1U78 A;  4IHT A;  4EJT A;  2V79 A;  1R1T A;  4UVC A;  4YFK F;  5AIP A;  5FLX Z;  1G3Y A;  3WU1 B;  1D5V A;  2PG4 A;  5JFR A;  5HS8 A;  4L9V A;  1HW2 A;  3D5L A;  3LQR A;  1RI7 A;  3BPV A;  1KGS A;  3ZN1 A;  2ISZ A;  4ENJ A;  2ISY A;  5E18 F;  2VON A;  4FX4 A;  3E97 A;  4HA8 A;  1WWX A;  4LG0 B;  2YSR A;  3LAP A;  2BV6 A;  5EEG A;  2W85 A;  1F9N A;  4LFU A;  1HBX G;  1QBJ A;  2HOE A;  1JXS A;  4ENK A;  2FU4 A;  3R0J A;  4BHC A;  2G9W A;  2P7V B;  2P7C B;  4A5N A;  3F8C A;  3ZPL A;  1I1S A;  4IPA A;  2K27 A;  3D0S A;  2GZW A;  4L0Y B;  1LNW A;  5LGT A;  3ZMD A;  4KA4 A;  2MH2 A;  2HDC A;  1IN7 A;  2PEX A;  2ZJ2 A;  2JPB A;  1FC3 A;  4BQA A;  3V8L A;  2ZNZ A;  3EYI A;  2VC1 A;  1BI3 A;  2FE3 A;  3MQ0 A;  2ZCW A;  2EA4 A;  4U88 A;  5F6F A;  1G4D A;  4R8H A;  4G7H F;  4ZZL A;  3K9T A;  3DXJ F;  1A04 A;  1CF7 A;  1EV7 A;  1HST A;  1YQA A;  2V9V A;  2HKO A;  3ZMS A;  2PLY A;  1CGP A;  3RKX A;  1Y0U A;  1J59 A;  4G7O F;  3F8N A;  2MH9 A;  1JGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...