2DTRA

Structure of diphtheria toxin repressor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
214
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title High-resolution structure of the diphtheria toxin repressor complexed with cobalt and manganese reveals an SH3-like third domain and suggests a possible role of phosphate as co-corepressor.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Repressor
total genus 44
structure length 214
sequence length 223
ec nomenclature
pdb deposition date 1996-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dtrA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2dtrA02
3K1MA 1R1UA 1YW8A 3K1PA 2PN6A 3MWMA 5FLXK 5FFZA 2Q8KA 2H27A 1CGPA 1IN7A 2K02A 1T2KA 3KZZA 1XD7A 1FLIA 1PP8F 1RZ4A 3KP3A 3JW4A 1LNWA 2XIGA 4PCQA 3TQNA 4EJUA 2E1CA 3C18A 1XMAA 2NAZA 2G7HA 1S7AA 4U7BA 2Z33A 1BI1A 4MNUA 4D0PA 4EJOA 1YFHA 2Z9OA 2BGCA 3MCZA 1FX7A 4LG0A 2F5CA 2K4BA 1EV7A 3CJNA 4DQ2A 2Y75A 3TDUC 2PI0A 1S7OA 3T5XA 2G9WA 1D8KA 1O3TA 2BE5F 1XB4A 1STZA 4HQEA 1R5HA 3HOTA 3O3KA 1MJ9A 4Z2YA 5D5UB 1ZN2A 3FM3A 3HSFA 4M6YA 3OV8A 4P96A 3KFWX 1U8RA 3WU1B 3WG9A 2XAQA 3HUGA 3M1EA 2DW4A 3M8FA 4FHTA 2ELHA 3DF8A 2ACJA 1J5YA 4P5OA 3FXRA 5BS6A 4MTEA 1QZZA 5CVJA 2VOOA 4UV9A 2LF8A 2RN7A 2OZ6A 4OINF 4OIQF 1G4DA 3K0LA 1U5TB 1WWXA 3FHZA 3ABTA 3FX3A 2H09A 3T1BA 1F4KA 2HR3A 1YG2A 3BROA 2X0LA 1SFEA 1W5SA 3J81Z 1WQ2A 3ULQB 5BQTA 4XBFA 5JR3A 2YX7A 3TOAA 5HS8A 3H92A 3U2RA 1HKTA 4YIIA 2IJLA 1IW7F 5HVQC 1DP7P 1ULYA 2HGCA 4I01A 3L00A 4WF2A 3FXUA 3HIFA 2F2EA 1K78B 5H6QA 4LJZF 3E6DA 3GW2A 4ETSA 2LNBA 3F3XA 3U9GA 1LDKB 1YIOA 5D4SA 3FMQA 2FNPA 2FF4A 4A5NA 2K4JA 4GXOA 3QP6A 4A5MA 1K78A 1I27A 2K86A 3D5LA 5AIQA 1D8JA 3EYIA 3Q9VA 4LFUA 1TNTA 1TW3A 3LQRA 2C6YA 5A2QZ 1R23A 1XN7A 2IVMA 2W84A 5H6RA 1YW7A 5ICGA 1YTYA 2V6CA 5ERIA 1E17A 3EDPA 1B6AA 3MAJA 3OOPA 4Y15A 3NEUA 2GAUA 2R7DA 3GFMA 2M45A 1ZLKA 2O3FA 3KP6A 4LK1F 5E20A 1ZARA 1JXSA 4WX9A 3QRFF 1WSUA 5F64A 3ZMUA 2BV6A 3JTHA 3GWZA 2M87A 2F5FA 2VODA 2HS5A 3GO5A 4Y13A 4Q48A 1Q1HA 3HHGA 3HRTA 2OU2A 5HS7A 2Y48A 3L2CA 2KJCA 5HDGA 1USSA 4UXNA 1J2XA 3E6MA 4G6QA 3R61A 3ERED 2O8XA 2YR2A 2P5LC 1YS7A 1QPMA 1XMKA 5LGNA 4FX0A 2V1DA 3GZ6A 5D8KB 2D1HA 3EUHA 2ZNYA 4OOIA 2XGXA 1R5GA 5JFRA 5L3FA 2EJRA 1I1GA 2XAFA 3C7JA 2MA3A 3EETA 2IP2A 2GQQA 2LF7A 2RDPA 4BH9A 4YFXF 1ZG5A 1KU3A 2IA2A 3M8EA 4RB2C 4Y17A 2L54A 4ZZLA 4KFCA 1Z6RA 3RI4A 3W6KB 3WU0A 2OZUA 3LAPA 3EQLF 3KP4A 1IF1A 2PLYA 1O3SA 1LDDA 4HLXA 2W57A 1RUNA 4KA4A 5DV5A 1I5ZA 2QQ9A 2HWVA 4P9UA 2DT5A 1P92A 2ZFWA 3ZMZA 3FWEA 1OPCA 2ZMEB 5LRRA 5BPDA 3T0YA 1H0MA 5AONA 2D2WA 1BI0A 2CWEA 3VFZA 2EV5A 4DNCA 1B1BA 4A0ZA 2ZMEA 3E6BA 2OAZA 1I1SA 3I64A 4LK0F 1F9NA 1TBXA 3NRVA 4ZYEA 4XSZF 2RKHA 4HA8A 1FNNA 3P7NA 4Q47A 2DU9A 4ZH4F 1SAXA 1Z6TA 4A0XA 3KE2A 3LQQA 5JHUA 2LKPA 3I53A 1ODDA 3F22A 2OQGA 2V79A 2V9VA 1SMYF 4HDVA 3LA3A 3WTTC 5D5WB 1XCBA 4BHPA 4G9YA 2B0LA 4CZZA 5LGUA 3F23A 1BI3A 1XGNA 5DYMA 4A2UA 3RYPA 4ESJA 2GXGA 1JE8A 1JHFA 3LA7A 3K69A 1DPUA 1JGSA 1GVJA 2GWRA 3TKYA 1A04A 1RUOA 3I54A 4XLPF 3DQVC 4BNCA 1HKSA 4CXFA 5J8FA 1D5VA 4B09A 2GA2A 3ABUA 3GFLA 4ON0A 2DI3A 3F8CA 4KIBA 1USTA 2A68F 2M1BA 1QNTA 5FO5A 2STWA 1FWZA 2CW0F 2QVOA 3IRRA 1S8NA 4HZFA 3CO6C 5JI6A 5BOXA 1XSDA 5FFXA 5D4RA 2A6EF 2PBIA 3V7CA 2JZYA 1T6SA 3G3ZA 3IWFA 1K7AA 2DO7A 3CUQB 1BM9A 2M30A 1PUEE 5DD8A 2L3DA 4HV6A 4EM0B 3ZMSA 5E1WA 3TGNA 1J59A 3QPHA 4RB3C 3CTAA 1OYYA 1YLFA 2VT2A 3CUQA 3DXJF 4R79A 2HOEA 3K9TA 1OMIA 3BPXA 2WC2A 5BPIA 3KLOA 4F7ZA 4ENMA 4WXHA 2A07F 2L01A 3M9AA 1VTNC 1DPRA 1HW5A 1ZH5A 2YU3A 3JSPA 3K2ZA 2F5DA 4L9JA 3P9IA 1EH6A 4IRIA 3ML6A 4O6JA 1BBYA 2R3SA 3R0JA 4WK8F 3RDIA 2FBKA 4EM2A 3N4MA 5LEJA 4HV5A 4QWQA 2CYYA 2W25A 2HFHA 3CO7C 4FT8A 3HHHA 4CHUA 4I02A 5K5RA 3J81K 3KEOA 4IF4A 2V1XA 4LB6B 1P4XA 4GYIA 1B4AA 5IT9Z 3KEQA 2PFBA 1LEBA 1BJAA 1IRGA 2MH9A 2MC3A 1MGTA 5LHHA 3E5QA 1G3SA 4HF2A 5TRDA 2TDXA 1BOAA 4I98B 4LG0B 3ZMTA 4BHBA 4K2EA 3ELKA 5FGMA 1XSXA 3I71A 2EFOA 1P4WA 1Z05A 2ZXJA 1GXQA 2MLKA 2P6TA 1O3RA 5D6EA 1FBUA 3MQ0A 1ON2A 5E1ZB 4OMZA 4AIKA 3HSEA 4O3MA 2MH2A 3WTWC 1T98A 4HX8A 5JVTA 4UUVA 3KP2A 1UCRA 4RS8A 1EH8A 1BC8C 1SD6A 5E18F 2PMUA 2IPQX 4IJAA 4OU0A 3MZHA 1F5TA 4KN4X 2UWMA 3FM5A 2MBFA 2H94A 2VXZA 1HSJA 4RGXA 4KIFA 1TW2A 2FU4A 3TOBA 2IA1A 4I09A 5J6XA 4A0YA 1S29A 3QOPA 2PG4A 3SQNA 4EM1A 4HX4A 4IRHA 4ZYDA 1T0FA 3ISPA 1SFUA 1MJAA 4U0VA 2RC4A 4R8HA 1QQIA 5D5VB 4I7HA 4TV7A 5LHIA 3REOA 4RB0A 4UHTA 2EFQA 4ENNA 1R22A 4CICA 1O7FA 3BDDA 3DKWA 4HQMA 4XRFA 4ESBA 2QM3A 5DD4A 1K6OA 3V7SA 1TLHB 3C3WA 4U0YA 4HX7A 4WXCA 3W6JB 4YIFA 1F1ZA 4KUMA 2HKXA 3D0SA 1BC7C 2QBYB 3B73A 4OIRF 5BMZA 5DDGA 3ZQ7A 3ZN0A 1MJBA 5ILUA 4MQ9F 1GXPA 4YG2F 4EJVA 4A6EA 4L9TA 4RAYA 1NHAA 4U0WA 1KQ9A 2QBYA 2GXBA 2HYGD 4RAZA 3T8TA 4ZZDA 3L7WA 6PAXA 2EA4A 3E97A 2QYOA 3R6SA 1REPC 3HRUA 2D1VA 1H9GA 1J7KA 3VEPA 2A6HF 3I59B 1KA8A 2XV4S 5H20A 4L5IA 2UXXA 2FSWA 1HXDA 3F6OA 3WTZA 1K79A 1O57A 3V8JA 3COAC 2DAOA 3IHUA 1R1TA 3I59A 3V4GA 4RB1A 2PJPA 3JAMK 1KU7A 4PGGA 5LHGA 1OYIA 4M9SA 4KT5C 2WTEA 3PFIA 2A5YB 3IRQA 1ZHFA 4AD9A 3WGIA 3TO7A 1V3FA 3HYIA 2FXAA 2JRTA 3GZ5A 2KIFA 4I0BA 2L4MA 4MQVA 2NYXA 3F8BA 3RPUA 3GF2A 3E3VA 5ICFA 4EGZA 1U5TC 3QU3A 2XVCA 2EA2A 3V8LA 3F6VA 1H9TA 2O0YA 2OBPA 1FT9A 1IXRC 2DK5A 1EH7A 2PEXA 3HTSB 3Q5FA 2FEZA 3O6BB 3JTGA 4G94A 4G6DA 2XASA 2HDCA 1FBQA 4L0YB 1YS6A 2EFNA 5HDKA 4MEXF 3WODF 1HW2A 1R1VA 3GLXA 1ZG1A 5ICEA 3FZVA 4P9FA 1MZBA 4BAYA 3FMSA 3GX4X 4ENJA 2XKOA 1LQ1A 2A3SA 1WI9A 3QAHA 4L5JA 2QQAA 2VBWA 4M74A 1ZGAA 2AS5F 4EJTA 4OIPF 3EYYA 4HF0A 1SMTA 1T39A 3SZTA 1SD5A 1XCVA 2EFWA 3JSOA 3SZPA 1P2FA 2FA5A 1Z91A 4IHSA 3WTVC 2COMA 4PZJA 3U1DA 3RKYA 1FY7A 3ECOA 4PGHA 1T38A 3ZPLA 4G7OF 4BYYA 4HYEA 4CYDA 2NNNA 2XHKA 2JTVA 5LBQA 4MTDA 5LLQA 5CLSA 1OKRA 1LB2A 5LEKA 1AWCA 2H6BA 4I0AA 3IKVA 2VE9A 3SHFA 1SFXA 3J80K 2PQ8A 1YYVA 1QBJA 2QWWA 3I5UA 2DBBA 2J5PA 2X4HA 4GGGA 2BYVE 4G8XA 4ASNA 1KU2A 4L9NA 4HDUA 2EWNA 1X3UA 1FC3A 3L9FA 2Y0MA 3ZP5A 2IW5A 3CUOA 3BZ6A 3CDHA 4NB5A 1P4AA 2JT1A 4YFNF 5ICCA 1HBXG 3L09A 5J8CA 2Z3YA 1R36A 4GO1A 2VBZA 5KK1A 5L3DA 5HLGA 2XROA 1UB9A 4UVBA 2QQBA 2VC1A 2JPBA 1L3LA 2HQRA 1LEAA 4BHCA 2O6GE 2A61A 1ZLJA 3BP8A 4AIHA 4M73A 2VONA 2L4AA 4BXUA 2KJBA 4AIJA 1BIAA 3GYHX 3E5UA 5KVRA 3F8FA 2ZJ2A 3IC7A 1J0RA 4M6XA 4XSXF 2CGPA 3G73A 2LSOA 3C1DA 1P6RA 2XAHA 2NNYA 3Q9SA 3GEZA 1R7JA 3SFZA 4OMYA 2WV0A 1BIBA 3QP5A 3SXYA 5LGTA 1ZRCA 5L3GA 5E8IA 3VOEA 2P8TA 3MFKA 4HBLA 2EK5A 4BQAA 2ESNA 3LSTA 2EV6A 1G3YA 1DUXC 5L3BA 2Q0OA 2AXLA 3HTUA 3PQKA 1R58A 1W5TA 4UVAA 1ZRDA 1IAWA 1YW9A 1WKMA 4LLGF 4AWXB 4GCVA 4ZYGA 4EGYA 4G7ZF 2EV0A 4LLLA 4LD5A 2XRNA 2CFXA 5LRSA 1J9IA 2GIVA 4PDKA 4UVCA 1U3EM 1XSVA 4E70A 1KQ8A 4P55A 3RTRA 3FMRA 2RNJA 5EEHA 3KETA 1S6LA 4AVPA 2K27A 2DFIA 3O2PE 3RIRA 1LVAA 3MZYA 2FE3A 3R0AA 3ZMDA 1YO5C 1FSHA 4IVNA 4S04A 2GZWA 4HAMA 3S2WA 3DEUA 5ILVA 5IT3A 3BOQA 5DCMB 4RGRA 4Q5SF 4M9ZA 1QZYA 5A2QK 5L3EA 2E7XA 1IXCA 3LFKA 1IN4A 4KYWA 4FX4A 2XUBA 5TJJA 5D6FA 5DCMA 4WCGA 4IXAA 2W85A 5K5OA 2P4WA 4EJWA 4KDPA 4R1HA 4XLNF 3BJAA 4RGUA 1XGMA 3LWFA 1IRFA 5CVUA 2E1NA 4B8XA 3CUQC 1TQIA 1TNSA 2P5VA 1AOYA 5D8LB 4RGSA 5HLIA 3GFJA 4HLYA 4ENKA 2ISYA 4LLNA 3MEXA 3H3UA 2ETHA 1O3QA 4KMUX 1FSEA 2P7CB 2FBHA 5FLXZ 2HQNA 5HLHA 3DPLC 3F8NA 5CVVA 2F5EA 3BWGA 1ZREA 2VOPA 3T8RA 2KIMA 4IRGA 4G7HF 1U5TA 2H6CA 1CF7B 3WE2A 1DDNA 1OR7A 2JSCA 4S05A 2O03A 1QO0D 2HTSA 2HYFA 2OQRA 1CF7A 4KICA 2M5WA 2XKPA 2BEOA 3WTYC 3DV8A 1ZGJA 3ROUA 5FD5A 3ZN1A 4KMFA 1KYZA 2VE8A 2NRAC 2D45A 4WWCA 2DK8A 3HRMA 2STTA 5DUKA 3RKWA 3BPVA 4NQWA 5CVRA 2XAJA 1FYMA 1Z1DA 3J7AO 3FXQA 3RJPA 3GFIA 1WRJA 3QU6A 2PMHA 3RPQA 5FB2A 5L3CA 4MHGA 1IN5A 2OD5A 4IHTA 1O7LA 2MLGA 2ZNZA 4M9XA 2HEOA 1IN8A 4KIGA 2Z99A 5E8GA 1Z9CA 1UHMA 4L18B 3BJOA 4EV0A 5F1RA 3WTUC 4N9IA 4JBAA 3WTXC 1HSTA 2FBIA 3N97A 2RVCA 1IN6A 3WTSC 4CO8A 4LMYA 1G6NA 3ECHA 2VBYA 4IPAA 1SD7A 2GA1A 2HZTA 3V7RA 3TO6A 4OIOF 2Q2EA 2ESHA 4U7DA 3DP7A 5HS9A 2RQPA 3PQJA 2VC0A 1FZPB 3GUDA 1QGPA 1B9NA 1S3JA 1TTYA 2KKOA 2Z5UA 4MEYF 3VB2A 3DFGA 4ZYHA 2BBYA 1RIOH 3VODA 3QPTA 2A69F 3KLNA 3B02A 1MKMA 2QZ8A 3TDZC 2QUFA 1LJ9A 1B9MA 2IA0A 1ZG3A 2EFPA 2FRHA 2QLZA 3GXOA 5EEGA 4HW0A 4LB5A 1Z7UA 3R4KA 1TQPA 2KRFA 2YSRA 4I2OA 1U6GA 5HOOA 2W24A 5ILSA 2J5OA 4JK1X 4MGRA 3BJ6A 1KU9A 2DLLA 1MD0A 5CYVA 1V4RA 5AIPA 5DCFA 4O5VA 1E2XA 3V8KA 5K1YA 2FMYA 2FNAA 2P7VB 1RI7A 3WGGA 2VT3A 1KGSA 4KN7X 3CLOA 4GYGA 2NS0A 1W7PD 1JHHA 2ZBKA 4UNOA 2IT0A 2ISZA 4M72A 1L0OC 1FOKA 2G7UA 2R7FA 4Q4ZF 2MD5A 1XGOA 3IL2A 5CVIA 3HOSA 5DUIA 2E7WA 4L0ZB 3H3ZA 1FYKA 3RYRA 2HKOA 1FYLA 4U88A 5K5QA 2ZKZA 1XDSA 3E6CC 3LA2A 2VBXA 1ONVA 1LDJA 3RKXA 1C0WA 1KYWA 2HTJA 5CJ9A 3JAMZ 1W4MA 1UHWA 2JPCA 2RGVA 2O61A 1GHCA 3FF5A 4LGWA 1XGSA 4H0EA 3WGHA 1J75A 4UV8A 4EQQA 1ZRFA 3GVAA 1RNLA 4CGZA 2P6SA 3I4PA 3M7GA 1MDMB 2CSOA 4EVIA 2V1UA 2FMLA 1D3YA 1ZAOA 1G3TA 1MDMA 1IZ1A 1XDUA 3IWZA 4NHJA 2L02A 5F6FA 1PP7U 3IKTA 1I6XA 5IT9K 2ADUA 3LAJA 4CDGA 5ED4A 1IUYA 2OA4A 3DPTA 1IXSB 3E5XA 2DQRA 1R00A 3KCCA 4N9HA 2LDUA 3F8MA 5E17F 5HDNA 1YQAA 2FQ3A 4A6DA 2ZO4A 2K7LA 1B59A 5DEQA 3K1NA 3KP5A 2ZCWA 4HOBA 1HKQA 1BI2A 2DQLA 3NQOA 3F21A 4HF1A 3HSRA 4KNYA 4QLCU 2DTRA 2XAGA 4M71A 5E1XA 2YPRA 2UXNA 1FBSA 1FP2A 1HW1A 2DPUA 1ON1A 4ESFA 1W7PB 3AAFA 1Y0UA 5D5XB 1SD4A 1ZYRF 3KP7A 2CO5A 2P5KA 3I58A 3TO9A 4A12A 1HQCA 3HRSA 3P9KA 1W7PA 4N0BA 2IRFG 4YFKF 1G3WA 2FOKA 3R60A 3I0TA 4EMSA 2WWYA 4L9VA 1PDNC 3F72A 1FPQA 3P9CA 5FD6A 2CQKA 1KQ0A 1U78A 3WE3A 2EB7A 2VN2A 1BN5A 2DPDA 2M8EA 2RV8A 1OYWA 3ZMVA 2KIUA 3KZYA 2CG4A 2QENA 2YX4A 4WXDA 2UZKA 1FP1D 4JQFA 1TQMA 1U2WA 1UFMA 3J80Z 3BY6A
chains in the Genus database with same CATH superfamily
1ZTRA 1UHSA 3K1MA 2I5UA 1R1UA 1YW8A 1NH3A 3K1PA 1FTZA 1WH7A 2G0EA 2PN6A 3MWMA 3TP0A 2DYRH 5FLXK 5FFZA 1E3OC 2EH3A 3CCSI 4XK4A 2NOJB 2Q8KA 2H27A 1UG0A 2O9LA 5EGOA 1LE8A 1CGPA 1IN7A 5IOYA 1JUSA 3OYFA 2AQEA 2K02A 2IGMA 4A3GJ 2KDZA 1R9TJ 3G1OA 3OWTA 1T2KA 4LITA 3KZZA 1XD7A 1FLIA 1PP8F 5EJCA 2LY1A 1RZ4A 1FOXA 3KP3A 3H9JA 4FISA 3JW4A 1X1BA 1LNWA 3ZQHA 2XIGA 4PCQA 2H8RA 4J19A 2CUFA 3TQNA 4EJUA 2E1CA 1ETWA 2XPUA 3C18A 3HZJA 2DMUA 1XMAA 2NAZA 2HPIA 2G7HA 1S7AA 5GTHC 4U7BA 2Z33A 2FD5A 1BI1A 5EYRA 2YU9J 4MNUA 3IUOA 4D0PA 4EJOA 5IPAA 1YFHA 3H9QA 4BQOA 2XRLA 4XLHA 1OCZH 2Z9OA 1JKOC 2BGCA 1TP4A 4HSTA 3A0BC 3PO2J 1HDPA 3MCZA 3AG2H 2V4JC 2OTLI 2DT6A 1FX7A 2GOMA 4LG0A 1S7EA 2F5CA 2MABA 4ITVA 3SEZA 2K4BA 1EV7A 3CJNA 2ZSIB 4DQ2A 2Y75A 3TDUC 1OLTA 2Y30A 2PI0A 1S7OA 3P5JA 3T5XA 2G9WA 4XKVA 4RBOA 1D8KA 1O3TA 3LSKA 1JUMA 2BE5F 3A02A 4E7HA 5FROA 1XB4A 1STZA 4LIVA 4HQEA 1R5HA 2GIZA 2PMZN 3HUGB 1Y8QB 4PFOA 3HOTA 3O3KA 1MJ9A 3GTLJ 3GTOJ 1VZ0A 2WY8Q 4Z2YA 5D5UB 1WI3A 2R93J 1ZN2A 3J7AY 3FM3A 3HSFA 1PYVA 4M6YA 1TWAJ 3S15J 3OIQA 1P7IA 5KAIC 3OV8A 4P96A 3KFWX 1U8RA 3WU1B 3WG9A 1Z0XA 3HOXJ 4D9JA 2XAQA 3ZQGA 1Z67A 3HUGA 3M1EA 4C2MJ 3HJEA 2DW4A 3HDDA 3M8FA 2JQ7A 4FHTA 2FUG2 2VKVA 2ELHA 3DF8A 2NS8A 2ACJA 5EEAA 1J5YA 4P5OA 5DM7F 3FXRA 4AC0A 2E5ZA 5BS6A 2K9QA 3S1NJ 4MTEA 3BG6A 1QZZA 3CCRI 5CVJA 2VOOA 4UV9A 2LF8A 2RN7A 2OZ6A 4OINF 1VQ8I 1RKTA 1VI0A 4EEFG 4OIQF 3GMEA 1G4DA 2KMUA 3A03A 3K0LA 1CQTA 4HNTA 1U5TB 1WWXA 3FHZA 1H89C 3ABTA 4AIDA 3FX3A 2H09A 3T1BA 3JCUC 4IO9F 2HR3A 1F4KA 1YG2A 3BROA 1I39A 2X0LA 2MUNA 2DFEA 1SFEA 3CC2I 1W5SA 1HOMA 2QKMB 3H9GA 1QHHD 1WQ2A 3J81Z 4DZPA 3ULQB 5BQTA 2E36A 1U9OA 4XBFA 3S17J 5JR3A 2YX7A 1I3QJ 3TOAA 3FKJA 2M4GA 5HS8A 3JR9A 3H92A 3L2QA 2DN0A 4F52A 4AVZA 2DYSH 2CQQA 3U2RA 3HM5A 1HKTA 4YIIA 2IJLA 1IW7F 3HXLA 5HVQC 1DP7P 1WVRA 1ULYA 2HGCA 4I01A 4CH7A 3L00A 3PSFA 4WF2A 3FXUA 1SFKA 3HIFA 2R7WA 2F2EA 1K78B 1FOYA 5H6QA 2HDWA 3ABMH 4LJZF 3E6DA 3CP8A 3GW2A 4ETSA 3CDIA 2LNBA 3F3XA 4G12A 3U9GA 1LDKB 1YIOA 5D4SA 3FMQA 2FNPA 2FF4A 3OY9A 1XC5A 4A5NA 2K4JA 4GXOA 2BXYA 2L7ZA 3QP6A 4A5MA 1Q1VA 1K78A 1I27A 2K86A 3D5LA 2Y31A 3CF5F 5AIQA 4X1EA 1D8JA 1MBGA 3OSGA 3EYIA 1IDYA 2R92J 3Q9VA 3AKZA 5M5XJ 4LFUA 1TNTA 3CLQA 1TW3A 3LQRA 2X6OA 2C6YA 2R7UA 1R5ID 5A2QZ 1R23A 1GV2A 1XN7A 2IVMA 2W84A 3G2BA 5M3MJ 5H6RA 1YW7A 5ICGA 2DJIA 1YTYA 3MZ8A 2V6CA 2V26A 3J7AW 5ERIA 1E17A 1MBKA 3EDPA 3L1PA 1B6AA 3MAJA 3D1NI 3OOPA 1B8IB 3MKWB 2P0TA 1N25A 3L2RA 4Y15A 1K6YA 1T33A 3NEUA 2GAUA 3PJRA 2R7DA 3GFMA 4NNJA 4BXFA 2Z16A 2M45A 1ZLKA 1B8IA 2O3FA 3KP6A 4LK1F 5E20A 1ZARA 2CRGA 1ZGWA 4FETA 2I8DA 2DFHA 3OYLA 1JXSA 4PFPA 4WX9A 3QRFF 1T0FC 1WSUA 2BY2A 5F64A 1Z3YA 3ZMUA 4A3CJ 2BV6A 4ZTFA 3JTHA 2HYJA 3GWZA 2M87A 5FKKA 2F5FA 2GBYA 4F55A 2VODA 2LY9A 2HS5A 1OISA 1VQOI 4XL9A 3GO5A 4Y7NJ 4Y13A 4Q48A 1Q1HA 3HHGA 3HRTA 1FTTA 3FIWA 2OU2A 5E79C 5HS7A 2DMPA 2Y48A 3L2CA 1TC3C 3JRGA 4XIDA 2F48A 3NARA 2KJCA 1EF4A 5HDGA 2Y2ZA 1X19A 1MBEA 1USSA 4UXNA 3GTPJ 1JUPA 4XM3A 2QF7A 1J2XA 3E6MA 4FASD 1EA3A 4G6QA 1MSEC 3VYUB 3R61A 3OR2C 4RMNA 3ERED 2O8XA 2YR2A 4C3IJ 2P5LC 1YS7A 4A3LJ 1F43A 5H2FC 3LFUA 1FMVA 2FJ1A 1QPIA 1TWFJ 2X6XA 1QPMA 3CZ6A 1XMKA 2XAUA 5LGNA 4FX0A 4RM2A 1OCCH 1TT0A 2V1DA 3GZ6A 4XLEA 5D8KB 3LSIA 2D1HA 2HQ5A 9ANTA 2CFOA 3EUHA 5IT9R 2ZNYA 4OOIA 2FOWA 2ICWG 4ZDLA 4BY7J 1OJLA 2XGXA 1R5GA 4XQFA 5JFRA 2DDBA 4BGDA 2K9LA 5L3FA 2EJRA 1I1GA 1IRXA 4BQQA 2R7SA 4F92B 5J1RA 2XAFA 3JRFA 1MMSA 2QKLB 3RKQA 4ZC3A 3C7JA 2IXSA 1UG2A 2MA3A 3EETA 2VKDA 2IP2A 2GQQA 1V55H 2LF7A 2RDPA 3S8PA 4BH9A 4LIUA 4YFXF 1ZG5A 1KU3A 2KZGA 3K4BA 3BTJA 3OYGA 1R71A 2IA2A 5IOZA 3FDYA 1EJ9A 3M8EA 4RB2C 1QZEA 4Y17A 2L54A 3BTIA 3HPGA 4ZZLA 3CESA 4IHWA 3SJMA 4KFCA 1Z6RA 3RI4A 3W6KB 3WU0A 1W1WE 2KZVA 2OJED 2OZUA 2EPFA 2XGCA 3LAPA 2K9SA 2KHMA 3EQLF 1Z7LA 3KP4A 1IF1A 2PLYA 1O3SA 3BTCA 1LDDA 4HLXA 2W57A 1RUNA 5FRMA 3ZQCA 4KA4A 1VQ7I 2VPLA 2VQLA 5DV5A 2VKEA 1I5ZA 2QQ9A 2HWVA 1D1CA 4P9UA 1BOBA 2DT5A 2XDVA 4CCKA 1P92A 1VNDA 3DEEA 1UMQA 2ZFWA 3ZMZA 3FWEA 1HDDC 1F36A 1OPCA 3BR0A 2ZMEB 2QEXI 5LRRA 4EATA 3CMAI 5BPDA 2R7TA 3CJTB 1BW6A 3T0YA 1H0MA 1MH3A 4CZCA 2NVXJ 3RQIA 5AONA 2D2WA 4C9YA 1BI0A 2CWEA 3VFZA 2EV5A 3ZGKA 4DNCA 1B1BA 4A0ZA 2B7EA 1N77A 2ZMEA 3E6BA 1D0XA 2PMZA 2WA0A 2OAZA 1I1SA 3I64A 3J7YJ 1AA7A 4J00A 3PIPF 2DMQA 2ID6A 3TW7A 4PJNA 2M0CA 2JSPA 4LK0F 1LPQA 1F9NA 1TBXA 3OYEA 3NRVA 4ZYEA 4XSZF 2RKHA 3WHBA 4HA8A 4C3HJ 1FNNA 3P7NA 4Q47A 2DU9A 4XLAA 4ZH4F 1SAXA 1IGNA 1Z6TA 1MH4A 4A0XA 4A93J 1JJ6C 2K40A 3KE2A 3E7LA 3LQQA 5JHUA 2LKPA 3I53A 4PJJA 2MD0A 4FE7A 1R49A 4B3XA 4XORA 5FLXR 1MBJA 1ODDA 3M1CA 3F22A 1WH5A 2OQGA 3MD2A 2V79A 2EIJH 2V9VA 2R7OA 2RQQA 5C3EJ 5B1AH 1SMYF 3DLLF 3CCYA 1APLC 1RPWA 3N05A 1YX5A 4HDVA 3VDXA 3LA3A 4AYBN 3WTTC 3K70D 1FEXA 5D5WB 3LSHA 1RKWA 1XCBA 3QPSA 4OAYA 4BHPA 4G9YA 5J1YA 4BJ6C 1LFBA 2JUGA 2CUZA 2B0LA 4CZZA 5LGUA 3F23A 1VQ5I 1BI3A 2E1OA 1XGNA 4XKWA 5DYMA 4A2UA 2QSHX 3RYPA 1U8BA 4ESJA 3BG3A 2OC6A 3VSKA 2GXGA 1JE8A 2LFBA 1JHFA 3LA7A 2R5ZB 3K69A 5B1BH 1DPUA 1JGSA 3QODA 2NVUB 1GVJA 2GWRA 3TKYA 2JA6J 1A04A 4P1WA 4JX4A 1RUOA 3SZGA 3ESWB 2ELKA 3I54A 4XLPF 3DQVC 4BNCA 2IGOA 1TWCJ 1HKSA 2P0WA 3LSPA 2MFZA 2R5ZA 1ZQ3P 4I99C 3LOCA 4CXFA 2CUEA 3OS2A 5F1JA 4HPQA 2OPTA 5J8FA 1D5VA 4BEHB 4B09A 2GA2A 3ABUA 3GFLA 2Q1ZB 4BJTA 4ON0A 5HODA 1RR8C 3K4LA 5IP7J 2DI3A 2E60A 3F8CA 3PUFA 3GTMJ 2R7VA 1XX5A 2L7KA 2LR8A 4KIBA 1USTA 2A68F 1ETOA 2M1BA 1QNTA 5FO5A 2X48A 2STWA 1FWZA 4BEHA 2IS4A 2CW0F 2VQGA 2QVOA 4IOCF 3IRRA 1JKQC 4B47A 4A3DJ 1S8NA 5GPAA 3BC8A 4HZFA 3TL4X 5JI6A 3CO6C 5BOXA 1XSDA 5FFXA 3IH4A 5D4RA 1I50J 2A6EF 2E34A 2PBIA 3V7CA 2L7FP 2JZYA 4ZTJA 1T6SA 3G3ZA 3IWFA 2WAQN 5GPCA 2DO7A 1K7AA 3CUQB 1BM9A 4D5FA 4V2GA 2M30A 3DKYA 3OOUA 1PUEE 2IS6A 5DD8A 2L3DA 4HV6A 3RZDJ 4EM0B 3ZMSA 5KCMA 5E1WA 2OUMA 3TGNA 1J59A 3CCJI 3QPHA 2ZFUA 3SDGA 3FXLA 4RB3C 3CTAA 3CUQA 1LVKA 1OYYA 1YLFA 2VT2A 3DXJF 2KISA 2WADA 3OYNA 4R79A 1PVEA 2HOEA 3K9TA 3JRAA 3OYIA 1FIPA 1OMIA 2L9RA 3BPXA 2WC2A 5BPIA 3KLOA 3TW6A 4F7ZA 5FLMJ 1XTAA 4WXHA 4ENMA 2A07F 2L01A 3M9AA 1VTNC 4C3JJ 2EZIA 1DPRA 4HRIA 1HW5A 2V6EA 1ZH5A 3S1MJ 1IDZA 2OTJI 2O7OA 2YU3A 4XR6A 1MMAA 3JSPA 3K2ZA 1ORKA 2W82A 4GFBA 2F5DA 2NVYJ 4L9JA 3P9IA 1EH6A 2VI6A 4XRSG 4IRIA 3ML6A 4O6JA 1BBYA 2R3SA 3R0JA 4WK8F 3RDIA 2FBKA 4EM2A 3N4MA 2JN6A 5F0HA 5LEJA 4A3KJ 4HV5A 3BR6A 1K83J 2V1NA 1LKXA 5GAHJ 2CYYA 4QWQA 2W25A 2HFHA 3CO7C 2E71A 5GTIC 4FT8A 3HHHA 4CHUA 1RESA 4I02A 1M1EB 5K5RA 3J81K 3KEOA 4IF4A 2V1XA 4BE2A 1MNDA 4LB6B 1P4XA 1NK2P 4GYIA 2X1DA 1B4AA 3H35A 4YEJA 1NK3P 1ETXA 5IT9Z 3IP4B 3CC7I 3KEQA 3CJRB 3DPUA 3I9V2 2PFBA 5GADJ 1T56A 1LEBA 1BJAA 1A35A 1IRGA 4E7KA 2MH9A 2MC3A 1MGTA 4IHVA 2VJJA 5LHHA 3E5QA 1A6QA 1G3SA 3PSIA 4HF2A 5TRDA 4DYQA 2TDXA 3D5RC 1BOAA 1V54H 5EF6A 4I98B 4LG0B 3ZMTA 4BHBA 4UUTA 4K2EA 3ELKA 5FGMA 1TT5B 1XSXA 3I71A 2EFOA 1P4WA 1Z05A 3B6CA 4BE1A 2ZXJA 3HGGA 3KEYA 1AHDP 1GXQA 1T95A 2MLKA 2P6TA 1O3RA 4QIWN 4AM3A 5D6EA 3DBLB 1FBUA 2TCTA 3SYTA 3VSLA 3MQ0A 1ON2A 3K7AJ 3GCMA 2EZHA 4OMZA 5E1ZB 4AIKA 3HSEA 2ID3A 1YE9A 2MH2A 3FBIB 3WTWC 4O3MA 1E0EA 1T98A 4HX8A 5JVTA 3C2HA 4UUVA 3HC7A 4BDZA 2HZDA 3KP2A 1UCRA 4RS8A 1EH8A 4M3BA 1BC8C 1BR4A 1SD6A 5E18F 1MMGA 2PMUA 1Y0NA 2IPQX 2XPVA 4IJAA 4OU0A 3M8JA 3MZHA 1F5TA 4KN4X 5FKNA 1TL8A 2E19A 2UWMA 3CD6I 2M34A 2DOFA 3FM5A 2MBFA 2H94A 2VXZA 1WJAA 1HSJA 4RGXA 4KIFA 4Z6YA 1TW2A 2DA3A 2FU4A 4BE0A 2XPWA 3TOBA 3IV5A 1SVLA 2IA1A 2Y0SN 4XMYA 3D5SC 1U0JA 1ENHA 3BQYA 4I09A 2R0QC 5J6XA 4A0YA 1S29A 3RPUD 2F4MB 2R4GA 2PG4A 3QOPA 1GUUA 3SQNA 3PIOF 2X6WA 4FTHA 4EM1A 1D1BA 3BR5A 4HX4A 4IRHA 4ZYDA 1T0FA 4FCYA 2COBA 3ISPA 1SFUA 5FKMA 2HOSA 2NXNB 1MJAA 1KZHA 2VLAA 2H1KA 1YJ9I 4U0VA 2RC4A 3DU6A 4R8HA 3NAUA 1QQIA 3L2VA 5D5VB 4I7HA 1AKHB 4TV7A 3CCQI 5LHIA 3CCLI 3REOA 4RB0A 4UHTA 1WFXA 4B4CA 3OL4A 2LTPA 2EFQA 4ENNA 3GTGJ 3K4MA 2LY2A 2R7XA 1G59A 1J09A 4QPOA 1R22A 4CICA 4RLQA 4A3FJ 1LFUP 1O7FA 3AG4H 3BDDA 3DKWA 1XMXA 3X2QH 1AKHA 1A36A 4HQMA 2X98A 4OAZA 4XRFA 4ESBA 4II2A 2QM3A 5DD4A 1K6OA 4E7SA 3I55I 3V7SA 4AYBA 2W7NA 3PNYA 2LMDA 1D5YA 1E3HA 1T08B 1EKEA 2A5WA 1R4MB 1TLHB 4A3JJ 1LFPA 1NTCA 2E1MB 3C3WA 4U0YA 4HX7A 3CCVI 4WXCA 3W6JB 3BCAA 4YIFA 2MC4A 1F1ZA 3OYKA 5IY5H 4KUMA 2HKXA 3D0SA 4QSHA 1MBFA 4Y4RA 5CPRB 4B43A 1BC7C 1Y1VJ 2NS7A 4E7IA 3B73A 3FXJA 4OIRF 1WJEA 4JX6A 4LG3A 5BMZA 5DDGA 4CSWA 2KQRA 4BACA 2BHZA 5M3FJ 3ZQ7A 3ZN0A 1MJBA 3GTJJ 2HPMA 5ILUA 1TZLA 4MQ9F 3OYCA 1GXPA 2FQ4A 1PJRA 4YG2F 4EJVA 4KISA 1ETVA 4A6EA 4L9TA 5IP6A 4RAYA 4IL6C 1NHAA 4U0WA 1KQ9A 2BW3B 2QBYA 4YRVA 2GXBA 1A5JA 3G4SI 2ZJPF 4C30A 3S14J 4IQ4A 1FMWA 2VPRA 2HYGD 2QA4I 4RAZA 3T8TA 4ANJA 4ZZDA 4B48A 3L7WA 6PAXA 2EA4A 3E97A 2QYOA 3LNQA 3R6SA 2BW3A 2EZKA 5JLWA 3OYJA 4V2FA 3K4CA 4C2TA 1REPC 4F93B 1IC8A 2V9PA 3HRUA 2D1VA 2WB1N 1H9GA 3VYRB 3ABLH 3PUBA 2JJ7A 1J7KA 2D5VA 4RLFA 5J47A 3VEPA 2XB5A 2A6HF 2DA4A 3I59B 4GRIA 1KA8A 2XV4S 1E3PA 5H20A 4CYCB 4L5IA 2K9NA 2UXXA 2FSWA 1HXDA 4N4OB 2DOAA 3ONQA 3F6OA 3WTZA 2WAQA 1K79A 5FRNA 3K4JA 5C4JJ 1O57A 2BXZA 2E35A 3V8JA 1OFCX 3COAC 2DAOA 3IHUA 3HOYJ 1R1TA 2IS2A 3I59A 3BG5A 3V4GA 3CCUI 4CYCA 4ABZA 1R4NB 4RB1A 2PJPA 3JAMK 3V42A 1KU7A 1Y8RB 1AU7A 4PGGA 5LHGA 1VQMI 2X9DA 1HLVA 2OV7A 5IYCJ 1OYIA 2HVQA 4KT5C 2WTEA 3PFIA 2A5YB 4M9SA 1YJWI 5J4VA 3IRQA 1ZHFA 3ASOH 4AD9A 3WGIA 4M3EA 3TO7A 1V3FA 2CW8A 1XPXA 3HYIA 4CCNA 3I4MJ 2FXAA 5EDNA 2JRTA 5M5WJ 3K4NA 1DP3A 3BR2A 4N4NB 4XRMA 3GZ5A 2LK2A 2KIFA 4IZZA 4I0BA 2L4MA 5JVGF 3BT9A 4XOPA 3AL0C 3NWSA 3AG3H 4D7NA 2JA2A 4MQVA 1MMNA 2NYXA 3F8BA 4A3MJ 3M07A 4HEA2 3RPUA 3UNGC 3GF2A 1S5LC 1ZK8A 3E3VA 5ICFA 2X1EA 3DLAA 4EGZA 1U5TC 4E4HA 2H8WA 4D1QA 2Y9YA 1SAUA 5FKOA 3QU3A 4XLCA 2E2JJ 2XVCA 2EA2A 1OR7C 3V8LA 1RRJA 1JJ8C 1R6RA 3F6VA 1H9TA 2O0YA 2OBPA 1FT9A 1IXRC 2ME0A 2DK5A 2EIKH 4CA0A 1RQ6A 1EH7A 3HEFA 3S3NA 2PEXA 3HTSB 3Q5FA 2FEZA 4DZJA 2BZTA 2XF6A 3O6BB 2JA7J 3JTGA 3HOVJ 4HNUA 4G94A 4J01A 4G6DA 2XASA 2HDCA 2ZB9A 1FBQA 4L0YB 4BKXA 4MFEA 2LBFB 1YS6A 2EFNA 5HDKA 4MEXF 2F6CA 3WODF 4A3EJ 2N8GA 3FXMA 3B6AA 1DGWY 1R1VA 3GLXA 1GT0C 1HW2A 2ZXWH 3F9KA 1ZG1A 2HQAA 5ICEA 3FZVA 4P9FA 3MMYB 1MZBA 2LBFA 4BAYA 3EUKL 3FMSA 3GX4X 4F91B 4ENJA 2XKOA 1LQ1A 3OYAA 2A3SA 3OMYA 1PUFB 1X4OA 1WI9A 3G71I 2VASA 3J7ZI 4RA2A 3QAHA 4L5JA 2QQAA 1ZKGA 2VBWA 3IAM2 4M74A 2QBYB 1ZGAA 2AS5F 1ETYA 4EJTA 4ZDOA 4OIPF 3EYYA 3FBNB 3OIOA 3SEQA 2E5NA 4BY1J 2CH0A 4HF0A 3MVPA 1SMTA 3KYLA 2EILH 1PUFA 1T39A 3SZTA 1SD5A 1OCRH 1XCVA 2CS3A 4I76A 2EFWA 3CDLA 3JSOA 5GAEJ 3SZPA 2ME6A 1P2FA 2FA5A 3OYMA 1Z91A 4IHSA 2HOTA 3CP2A 3WTVC 4HNVA 2Y9ZA 2COMA 2CJJA 3BCBA 4PZJA 3U1DA 4XN3A 3RKYA 1FY7A 3ECOA 4PGHA 4Y33A 1T38A 3ZPLA 4G7OF 4BYYA 4V19K 4HYEA 4CYDA 2NNNA 1NG7A 4BS9A 3VWBA 2Y69H 2XHKA 3FXKA 2L9SA 5KNLA 2JTVA 2LLKA 5IYBJ 1Y39A 4AUXA 1X3ZB 5LBQA 4MTDA 5C4XJ 1UZCA 2Y0SA 2XC7A 2DA5A 5LLQA 4BDYA 2M3AA 5CLSA 1OKRA 1OQYA 1LB2A 2CV0A 5LEKA 3HKZN 3ZQFA 1AWCA 2VJ4A 1TWGJ 4CCJA 2H6BA 3I4NJ 1DU6A 4I0AA 5TGTA 3IKVA 3JRBA 1WHUA 2BOLA 2HVSA 2VE9A 2F5VA 2IAIA 3S1RJ 3SHFA 1SFXA 1QHGA 4E6KG 2JWTA 3J80K 2PQ8A 1YYVA 1QBJA 2QWWA 2WAFA 1WJFA 3I5UA 2DBBA 2J5PA 4ZYAA 2X4HA 4GGGA 2BYVE 2KL4A 4G8XA 4ASNA 1HCRA 1KU2A 4L9NA 4HDUA 2EWNA 2R7ZJ 1X3UA 4B1RA 3H5RA 1FC3A 3RCOA 3L9FA 2DMTA 2Y0MA 3ZP5A 2IW5A 2V9KA 2K3PA 3CUOA 3BZ6A 4X0GA 3MKYB 5EZHA 3CDHA 1BJZA 1DQUA 4NB5A 1P4AA 1V5GA 1QVTA 3KYDB 3CCMI 3S1QJ 4HG2A 2JT1A 4YFNF 2DODA 2QGUA 4B3AA 5ICCA 1HBXG 1IO2A 3L09A 5J8CA 1WGXA 2Z3YA 3LSJA 1R36A 5F0FA 3QQAA 1GDTA 4GO1A 2A6TA 4BQNA 2VBZA 5KK1A 1WJ5A 5L3DA 3GZNB 5HLGA 2VXDA 1WJDA 2XROA 1UB9A 2MSYA 4UVBA 2QQBA 2LH9A 2JPBA 2VC1A 4LOCA 1L3LA 3HOZJ 2HQRA 4KT6A 3OYDA 1LEAA 2M35A 4BHCA 1B72B 2O6GE 1POGA 2A61A 5LD2C 3AG1H 1LUJB 1ZLJA 2CQXA 4D5CA 4I6ZA 3KX2A 3BP8A 4AIHA 4M73A 1KONA 2VONA 1A31A 2L4AA 1JT0A 4BXUA 2KJBA 1BR2A 4W97A 3O8GA 3E1SA 1B72A 3WHCA 4AIJA 1BIAA 2WY7Q 4XOTA 3GYHX 4MO7A 3ZQQA 1DU0A 2KIQA 3E5UA 5KVRA 3F8FA 2EINH 2ZJ2A 3IC7A 3TMOA 1J0RA 2XGEA 4M6XA 4XSXF 2CGPA 3G73A 1ZELA 3L2UA 1QRYA 4GDFA 2WB1A 3QPLA 2F4IA 2LSOA 1P6RA 2XAHA 3C1DA 3Q9SA 4DGWB 2NNYA 3GEZA 1R7JA 2ZXIA 3HPHA 5E3LA 3SFZA 4OMYA 2WV0A 2ZMEC 2VQCA 1BIBA 1YI2I 3QP5A 3FK7A 4XONA 3SXYA 5LGTA 1ZRCA 5L3GA 2DTZA 4QTRA 1JTXA 2A05A 2FX0A 4OWRB 5E8IA 4KITB 2QSGX 3BQZA 4L5EA 3W2AA 2W4SA 3VYSB 3VOEA 2P8TA 2LYCA 3MFKA 5B5EC 4ZJZA 4IQJA 4HBLA 3FKIJ 1X2MA 2EK5A 2XSDC 2ECBA 4BQAA 4BU2A 2ESNA 4XLFA 1W36C 3LSTA 4G6TB 2EV6A 4XRSA 1G3YA 1DUXC 1ZR2A 4CUGA 5L3BA 2Q0OA 2AXLA 3H5AA 3TEDA 2PJRB 3HTUA 2P81A 2DT7B 3PQKA 1MMDA 1R58A 2R7QA 1W5TA 4S0HB 4UVAA 4A69C 1ZRDA 2LVSA 1IAWA 1YW9A 2NOGA 5TISC 3A4CA 1WKMA 3IAS2 4M3FA 3E0JB 2PJRA 3RZOJ 4LLGF 4AWXB 1YJNI 4GCVA 4ZYGA 3AFHA 4EGYA 4G7ZF 2EV0A 3IH3A 1IUFA 4A3BJ 4LLLA 4LD5A 2XRNA 2CFXA 4NC7A 5LRSA 5CKTA 3F0CA 4HSRA 1J9IA 2GIVA 4PDKA 4UVCA 1U3EM 5GP9A 4PK4A 1IV6A 3BG9A 5HLTA 1I6HJ 1XSVA 2AXTC 4E70A 2L2OA 3BG7A 2M0MA 1KQ8A 4P55A 1YOVB 3RTRA 3PNVA 1LE8B 2GM4A 1YRNB 2LOOA 3FMRA 2RNJA 5EEHA 4II3A 4ZDPA 1IRZA 3A1YA 3KETA 1XG1A 3CMYA 2Z1DA 2Z2SB 1S6LA 2VJIA 4AVPA 1JI8A 1RC9A 4BBSJ 2K27A 2DFIA 3O2PE 3RIRA 1LVAA 1YRNA 3MZYA 2FE3A 2JVGA 3R0AA 3ZMDA 1YO5C 2XF7A 2EQRA 1FSHA 4IVNA 4S04A 2GZWA 2JVHA 4HAMA 3S2WA 3DEUA 5ILVA 2DJNA 5IT3A 3BOQA 3DWLE 1VQ6I 5DCMB 4JX5A 4RGRA 1X1AA 4RAGA 4Q5SF 4M9ZA 2K5CA 3HL2A 3OSFA 2ZJQF 1QZYA 3BLYA 3EUAA 4BUPA 2RNGA 2CMPA 5L3EA 5A2QK 2E7XA 5C44J 5CQGA 1IXCA 3LFKA 1IN4A 4KYWA 2KFDA 4FX4A 3UR3C 3GTKJ 2RREA 2XUBA 3CMMA 5TJJA 5D6FA 5DCMA 4WCGA 4IXAA 4W1UA 2M4KA 2W85A 2H1LA 3Q0UA 4PUSA 4AU7A 2X1CA 2XB0X 3DU5A 3MKLA 2P4WA 5K5OA 2BY3A 4EJWA 4KDPA 1ETKA 1YX3A 2M7BA 4R1HA 4XLNF 1IV8A 3BJAA 2LKXA 1K61A 4RGUA 1JKPC 1X2NA 4DBRA 1X1DA 1XGMA 3VPRA 3H1CA 3JAMR 3LWFA 1WPKA 1IRFA 3JRCA 3OS1A 4MIMA 5CVUA 2E1NA 4B8XA 3ERMA 3CUQC 1YHQI 3H3VK 1TQIA 1OCOH 1TNSA 2ECCA 1BW5A 2P5VA 2CQ7A 2L0KA 2WBMA 4U87A 3PM1A 1AOYA 5D8LB 3QWLA 3CF2A 1BA5A 4RGSA 5B3SH 4M3GA 5HLIA 5DS9A 2RAEA 3CJQB 1X1CA 3GFJA 4HLYA 1IJWC 4ENKA 3FK6A 1JGGA 2ISYA 1MW7A 5IYDJ 1QA6A 3C2GA 1P7JA 4LLNA 2KDOA 5M5YJ 3PFYA 3LSMA 2GLOA 3MEXA 3H3UA 5GAGJ 2ETHA 3HKZA 1SANA 1O3QA 3AL0B 4KMUX 2M9HA 5KAFC 5BNGA 5E3NA 2ZXHA 1FSEA 2P7CB 3ZQLA 3A0HC 2FBHA 1VQ9I 1RETA 5FLXZ 2HQNA 4IHYA 2TRTA 2OCEA 3PNTA 5HLHA 3WG7H 3DPLC 3F8NA 5CVVA 2F5EA 1MSFC 3BWGA 1ZREA 2VL8A 2VOPA 2XGDA 1Y56A 4XICA 1DGRM 3T8RA 2DDAA 2KIMA 3BR3A 4XKCA 4IRGA 4G7HF 1U5TA 2H6CA 1CF7B 3WE2A 1VQLI 2DFFA 2KPMA 1OCTC 1DDNA 3K70C 1ITYA 1OR7A 2JSCA 4S05A 3G6EI 2O03A 2VQHA 3A01B 4BXXJ 3ZRGA 4PJ0C 1QO0D 1SC7A 3CCEI 2HTSA 3MKZA 5FJ8J 2HYFA 2OQRA 2ZC2A 1CF7A 2M8GX 4JYKA 3H36A 4KICA 2W00A 1D0ZA 2M5WA 2XKPA 2BEOA 4CCOA 3WTYC 3DV8A 2IS1A 2CUJA 2LC2A 1ZGJA 4PJLA 2XSJC 5EG0B 3ROUA 3OS0A 2JA8J 4BL0B 5FD5A 3A01A 4NQWB 3W6VA 3ZN1A 1UJ8A 2MW8A 4KMFA 1KYZA 3PO3J 2VE8A 4NC8A 4DJAA 2NRAC 3H0GJ 5K7HA 5IP9J 2MYSA 2OF7A 2D45A 2IGNA 4JOMA 5EG0A 4WWCA 1NG6A 2DK8A 3ABKH 3HRMA 3JRDA 2STTA 3CC4I 2YUSA 5DUKA 3RKWA 3BPVA 4NQWA 2CV2A 5CVRA 2XAJA 1FYMA 1Z1DA 3U1KA 3J7AO 3FXQA 2LD5A 1U9NA 3S3OA 3RJPA 3GFIA 1WRJA 1N78A 1VF9A 3HBLA 3ZR8X 3QU6A 3UKGA 2EZLA 3BTLA 2CU7A 3M4OJ 2PMHA 3RPQA 2QCOA 5FB2A 5L3CA 4MHGA 1IN5A 2GOXB 2OD5A 2CW7A 1X4PA 1Y6IA 2E2HJ 1VQNI 4IHTA 2UUZA 3RSNA 1O7LA 2MLGA 1Z21A 2ZNZA 4M9XA 3ZCOA 2HEOA 3FHNA 2EBIA 1IN8A 2GXAA 1P9QC 2JK3A 3GLLA 2E2IJ 4KIGA 2Z99A 1X58A 5E8GA 1Z9CA 3W2VA 1UHMA 4L18B 5LFAA 4RAFA 3BJOA 2DXIA 4EV0A 5F1RA 1V5FA 3WTUC 4N9IA 3FXOA 1SVMA 1JTYA 2HNHA 4JBAA 1MIJA 2LKSA 5F04A 3WTXC 1HSTA 2FBIA 2Q2EB 3N97A 2BVLA 2RVCA 1IN6A 3WTSC 3EPZA 4CO8A 4LMYA 2MG4A 1G6NA 3ECHA 5B66C 1ETQA 4UUSB 2R7RA 1VQ4I 2VBYA 4IPAA 1SD7A 2GA1A 2HZTA 2IGKA 3V7RA 3TO6A 2LRDA 1IG7A 4OIOF 2Q2EA 2ESHA 3VYTB 4U7DA 3DP7A 5HS9A 1W36D 2RQPA 3PL8A 3PQJA 2LP0A 2VC0A 1FZPB 3J80R 1S72I 3GUDA 1QGPA 2HXOA 5J4YA 4UUSA 2L5QA 1B9NA 4XNFA 1S3JA 1TTYA 2KKOA 2Z5UA 1V5EA 4MEYF 3OIPA 4M6VA 2IEKA 3GBGA 3VB2A 3DFGA 3KIOA 4ZYHA 3A2KA 1HA8A 2BBYA 1H88C 3HB9A 2PX9A 2VUMJ 1RIOH 3VODA 3BZCA 2A69F 3KLNA 2W48A 3B02A 1MKMA 3QPTA 3S16J 3Q0VA 2QZ8A 2AHQA 3TDZC 4C2UA 2QUFA 3K10A 3IH2A 3I56I 1LJ9A 1XS9A 1B9MA 2IA0A 2DMNA 4DOZA 5F27A 2JA5J 3ZQIA 3QYBA 3W3CA 4NC6A 1SEUA 2K85A 1SVOA 3S93A 5JLXA 3O8HA 1ZG3A 2EFPA 2FRHA 3QYFA 4MLOA 3HGYA 3K2AA 4DYRA 3JRIA 1ERDA 2QLZA 3GXOA 5EEGA 5K7ZA 4HW0A 3S2DJ 5JHFA 2JMWA 3Q0WA 3OYHA 1FOWA 3OL3A 3L2WA 3KZIC 2CV1A 4LB5A 5E3MA 1Z7UA 2WV1A 3DCFA 4IEJA 3R4KA 5EZGA 2BHYA 2DA1A 2KRHA 3ZOBA 1X3WB 3NWTA 4YIRX 5K7FA 1HF0A 1TQPA 5F0CA 2L9VA 2KRFA 2YSRA 4I2OA 4UB6C 2R5YB 3SDBA 5FKLA 3OR1C 2ZSHB 1I3AA 2E1MC 2KP6A 1U6GA 4JP0A 2HU9A 5HOOA 2W24A 3JRHA 5ILSA 1TWHJ 2J5OA 2MGQA 3DKXA 4JK1X 4NUBA 1HC8A 3CQZJ 4MGRA 3WU2C 3BJ6A 1KU9A 2DLLA 3LMMA 5J1UA 3DBRB 3DEWA 2LREA 2R5YA 1Z3XA 2XF5A 1W0TA 1MD0A 5CYVA 1V4RA 5AIPA 5DCFA 1X1PA 4CCMA 4O5VA 3LL7A 1E2XA 1GV5A 4E7JA 3V8KA 1WJBA 5K1YA 2FMYA 2FNAA 3U21A 2P7VB 1RI7A 3WGGA 3H5NA 1FJLA 4Y3OA 2VT3A 1KGSA 4B44A 4KN7X 1D0YA 3CLOA 5J40A 1K4TA 2JUCA 4GYGA 3W2WA 2NS0A 1VQKI 5HNFA 3K6GA 1W7PD 4E7ZA 1JHHA 2HOAA 4XN0A 2ZBKA 4UNOA 2IT0A 5CQEA 1Y1WJ 5HNHA 2ISZA 4M72A 1L0OC 1FOKA 2G7UA 2R7FA 4Q4ZF 2MD5A 3LSGA 3SFIA 3C2BA 1XGOA 2DCEA 2DOEA 2O5RA 5CVIA 3IL2A 3HOSA 5DUIA 2E7WA 1Z77A 4L0ZB 1MBHA 3H3ZA 4FE4A 4PSXA 1K4SA 1FYKA 3DTIA 2HKOA 3RYRA 2MZ4A 4PSWA 1FYLA 2QSFX 2K9MA 4U88A 1W5CC 5K5QA 4D7MA 2ZKZA 1XDSA 3E6CC 3LA2A 3S2HJ 1BR1A 2M7AA 3HOUJ 2VBXA 1ONVA 1LDJA 3ASNH 3RKXA 1C0WA 4UY8I 2AQFA 4CCLA 1KYWA 2HTJA 5CJ9A 5F08A 4XKBA 3JAMZ 1W4MA 1UHWA 2JPCA 2RGVA 3A52A 2O61A 1GHCA 3FF5A 4LGWA 1QU3A 2KT0A 2L7MP 1XGSA 4H0EA 4YELA 3CMEI 3WGHA 1J75A 4UV8A 3K4KA 1GVDA 4EQQA 4DBQA 1ZRFA 3OYBA 2IBDA 5KHDA 3GVAA 1RNLA 2CQNA 2DA2A 2BY0A 4CGZA 1JT6A 2P6SA 3Q3SA 3DTKA 3I4PA 3M7GA 3EUHC 2I10A 1G8XA 2BY1A 2KRCA 4MFDA 1MDMB 1H8AC 3J81R 2CSOA 4EVIA 2V1UA 2FMLA 3JREA 3GTQJ 1D3YA 1UELB 2ELJA 1JKRC 2X6YA 1ZR4A 2M2EA 3G1LA 1ZAOA 4IHXA 1G3TA 1MDMA 1IZ1A 3QOEA 3H0DA 3HG9A 1XDUA 3IWZA 4E7LA 3TP3A 4NHJA 2L02A 4NDLA 5F6FA 3S3MA 1GLNA 1D1AA 2DA6A 3BR1A 1PP7U 3IKTA 2HDDA 2O8KA 1G2HA 1I6XA 1QVUA 1T8IA 4DW6A 2BVMA 5IT9K 3QYEA 4RDUA 4FQGA 2ADUA 2HVRA 1VQPI 3LAJA 4CDGA 5ED4A 1SFOJ 1IUYA 2OA4A 4M3DA 3DPTA 4PJMA 1IXSB 3E5XA 2DQRA 1S9HA 4A3IJ 1R00A 3KCCA 1BL0A 2VKHA 3FISA 4N9HA 5J3LA 2UV1A 2NVQJ 2LDUA 3F8MA 2L9NA 1FIAA 1OCPA 5E17F 5A2QR 5HDNA 1YQAA 2FQ3A 2B9SA 4Y52J 2KLOA 4A6DA 2JRMA 2QQ8A 2ZO4A 2K7LA 2WAEA 1B59A 5DEQA 3K1NA 3KP5A 2ZCWA 4HOBA 2X51A 3BZKA 1HKQA 1BI2A 2DA7A 2HXIA 3DBHB 1ACIA 2DQLA 2OCCH 3NQOA 3F21A 1W0UA 3DTEA 3HOWJ 4HF1A 3HSRA 3LSRA 4KNYA 1A6IA 3S32A 3G1MA 4QLCU 4IKFA 2DTRA 2XAGA 4M71A 5E1XA 2YPRA 2UXNA 5E3OA 1FBSA 1FP2A 1HW1A 3TBIA 2DPUA 3M3YJ 1ON1A 4QPQA 5DTDA 1W7PB 4ESFA 3AAFA 2AO9A 2EIMH 1Y0UA 5D5XB 4IOAF 2VB6A 1SD4A 1ZYRF 3KP7A 2CO5A 2P5KA 3I58A 2B63J 3TO9A 3MN2A 4KJZA 4A12A 2X85A 3RQ4A 1WZ2A 1HQCA 3HRSA 4H4KC 3P9KA 4BBRJ 2NVTJ 4F3QA 3KPHA 1W7PA 3KYCB 2LG4A 1MNMC 4N0BA 2IRFG 1WJCA 4YFKF 1VFCA 1MNEA 1N75A 1G3WA 2FOKA 3R60A 2HI3A 3I0TA 4EMSA 2WWYA 2V7FA 2YS9A 4L9VA 2K3FA 4BJ5C 1PDNC 3F72A 2F4OB 1FPQA 3P9CA 5FD6A 1YITI 4X6AJ 2CQKA 1RR7A 1KQ0A 1U78A 1YIJI 1WCMJ 3WE3A 2EB7A 2VN2A 1BN5A 3ZXSA 2DPDA 2M8EA 2RV8A 4NBQA 1OYWA 3ZMVA 2W1OA 2VJ5A 2KIUA 3KZYA 2CG4A 1UAAA 2ZJRF 5FLVA 4RM3A 3I3LA 4UB8C 2QENA 2MVTA 2YX4A 4WXDA 4DYCA 2UZKA 4IX7A 1FP1D 5DM6F 4JQFA 1TQMA 2VIXA 5EGOB 1U2WA 4DIQA 1UFMA 1O4XA 3J80Z 3BY6A
chains in the Genus database with same CATH topology
3K1MA 1R1UA 1YW8A 3K1PA 2PN6A 3MWMA 5FLXK 5FFZA 2Q8KA 2H27A 1CGPA 1IN7A 2K02A 1T2KA 3KZZA 1XD7A 1FLIA 1PP8F 1RZ4A 3KP3A 3JW4A 1LNWA 2XIGA 4PCQA 3TQNA 4EJUA 2E1CA 3C18A 1XMAA 2NAZA 2G7HA 1S7AA 4U7BA 2Z33A 1BI1A 4MNUA 4D0PA 4EJOA 1YFHA 2Z9OA 2BGCA 3MCZA 1FX7A 4LG0A 2F5CA 2K4BA 1EV7A 3CJNA 4DQ2A 2Y75A 3TDUC 2PI0A 1S7OA 3T5XA 2G9WA 1D8KA 1O3TA 2BE5F 1XB4A 1STZA 4HQEA 1R5HA 3HOTA 3O3KA 1MJ9A 4Z2YA 5D5UB 1ZN2A 3FM3A 3HSFA 4M6YA 3OV8A 4P96A 3KFWX 1U8RA 3WU1B 3WG9A 2XAQA 3HUGA 3M1EA 2DW4A 3M8FA 4FHTA 2ELHA 3DF8A 2ACJA 1J5YA 4P5OA 3FXRA 5BS6A 4MTEA 1QZZA 5CVJA 2VOOA 4UV9A 2LF8A 2RN7A 2OZ6A 4OINF 4OIQF 1G4DA 3K0LA 1U5TB 1WWXA 3FHZA 3ABTA 3FX3A 2H09A 3T1BA 1F4KA 2HR3A 1YG2A 3BROA 2X0LA 1SFEA 1W5SA 3J81Z 1WQ2A 3ULQB 5BQTA 4XBFA 5JR3A 2YX7A 3TOAA 5HS8A 3H92A 3U2RA 1HKTA 4YIIA 2IJLA 1IW7F 5HVQC 1DP7P 1ULYA 2HGCA 4I01A 3L00A 4WF2A 3FXUA 3HIFA 2F2EA 1K78B 5H6QA 4LJZF 3E6DA 3GW2A 4ETSA 2LNBA 3F3XA 3U9GA 1LDKB 1YIOA 5D4SA 3FMQA 2FNPA 2FF4A 4A5NA 2K4JA 4GXOA 3QP6A 4A5MA 1K78A 1I27A 2K86A 3D5LA 5AIQA 1D8JA 3EYIA 3Q9VA 4LFUA 1TNTA 1TW3A 3LQRA 2C6YA 5A2QZ 1R23A 1XN7A 2IVMA 2W84A 5H6RA 1YW7A 5ICGA 1YTYA 2V6CA 5ERIA 1E17A 3EDPA 1B6AA 3MAJA 3OOPA 4Y15A 3NEUA 2GAUA 2R7DA 3GFMA 2M45A 1ZLKA 2O3FA 3KP6A 4LK1F 5E20A 1ZARA 1JXSA 4WX9A 3QRFF 1WSUA 5F64A 3ZMUA 2BV6A 3JTHA 3GWZA 2M87A 2F5FA 2VODA 2HS5A 3GO5A 4Y13A 4Q48A 1Q1HA 3HHGA 3HRTA 2OU2A 5HS7A 2Y48A 3L2CA 2KJCA 5HDGA 1USSA 4UXNA 1J2XA 3E6MA 4G6QA 3R61A 3ERED 2O8XA 2YR2A 2P5LC 1YS7A 1QPMA 1XMKA 5LGNA 4FX0A 2V1DA 3GZ6A 5D8KB 2D1HA 3EUHA 2ZNYA 4OOIA 2XGXA 1R5GA 5JFRA 5L3FA 2EJRA 1I1GA 2XAFA 3C7JA 2MA3A 3EETA 2IP2A 2GQQA 2LF7A 2RDPA 4BH9A 4YFXF 1ZG5A 1KU3A 2IA2A 3M8EA 4RB2C 4Y17A 2L54A 4ZZLA 4KFCA 1Z6RA 3RI4A 3W6KB 3WU0A 2OZUA 3LAPA 3EQLF 3KP4A 1IF1A 2PLYA 1O3SA 1LDDA 4HLXA 2W57A 1RUNA 4KA4A 5DV5A 1I5ZA 2QQ9A 2HWVA 4P9UA 2DT5A 1P92A 2ZFWA 3ZMZA 3FWEA 1OPCA 2ZMEB 5LRRA 5BPDA 3T0YA 1H0MA 5AONA 2D2WA 1BI0A 2CWEA 3VFZA 2EV5A 4DNCA 1B1BA 4A0ZA 2ZMEA 3E6BA 2OAZA 1I1SA 3I64A 4LK0F 1F9NA 1TBXA 3NRVA 4ZYEA 4XSZF 2RKHA 4HA8A 1FNNA 3P7NA 4Q47A 2DU9A 4ZH4F 1SAXA 1Z6TA 4A0XA 3KE2A 3LQQA 5JHUA 2LKPA 3I53A 1ODDA 3F22A 2OQGA 2V79A 2V9VA 1SMYF 4HDVA 3LA3A 3WTTC 5D5WB 1XCBA 4BHPA 4G9YA 2B0LA 4CZZA 5LGUA 3F23A 1BI3A 1XGNA 5DYMA 4A2UA 3RYPA 4ESJA 2GXGA 1JE8A 1JHFA 3LA7A 3K69A 1DPUA 1JGSA 1GVJA 2GWRA 3TKYA 1A04A 1RUOA 3I54A 4XLPF 3DQVC 4BNCA 1HKSA 4CXFA 5J8FA 1D5VA 4B09A 2GA2A 3ABUA 3GFLA 4ON0A 2DI3A 3F8CA 4KIBA 1USTA 2A68F 2M1BA 1QNTA 5FO5A 2STWA 1FWZA 2CW0F 2QVOA 3IRRA 1S8NA 4HZFA 3CO6C 5JI6A 5BOXA 1XSDA 5FFXA 5D4RA 2A6EF 2PBIA 3V7CA 2JZYA 1T6SA 3G3ZA 3IWFA 1K7AA 2DO7A 3CUQB 1BM9A 2M30A 1PUEE 5DD8A 2L3DA 4HV6A 4EM0B 3ZMSA 5E1WA 3TGNA 1J59A 3QPHA 4RB3C 3CTAA 1OYYA 1YLFA 2VT2A 3CUQA 3DXJF 4R79A 2HOEA 3K9TA 1OMIA 3BPXA 2WC2A 5BPIA 3KLOA 4F7ZA 4ENMA 4WXHA 2A07F 2L01A 3M9AA 1VTNC 1DPRA 1HW5A 1ZH5A 2YU3A 3JSPA 3K2ZA 2F5DA 4L9JA 3P9IA 1EH6A 4IRIA 3ML6A 4O6JA 1BBYA 2R3SA 3R0JA 4WK8F 3RDIA 2FBKA 4EM2A 3N4MA 5LEJA 4HV5A 4QWQA 2CYYA 2W25A 2HFHA 3CO7C 4FT8A 3HHHA 4CHUA 4I02A 5K5RA 3J81K 3KEOA 4IF4A 2V1XA 4LB6B 1P4XA 4GYIA 1B4AA 5IT9Z 3KEQA 2PFBA 1LEBA 1BJAA 1IRGA 2MH9A 2MC3A 1MGTA 5LHHA 3E5QA 1G3SA 4HF2A 5TRDA 2TDXA 1BOAA 4I98B 4LG0B 3ZMTA 4BHBA 4K2EA 3ELKA 5FGMA 1XSXA 3I71A 2EFOA 1P4WA 1Z05A 2ZXJA 1GXQA 2MLKA 2P6TA 1O3RA 5D6EA 1FBUA 3MQ0A 1ON2A 5E1ZB 4OMZA 4AIKA 3HSEA 4O3MA 2MH2A 3WTWC 1T98A 4HX8A 5JVTA 4UUVA 3KP2A 1UCRA 4RS8A 1EH8A 1BC8C 1SD6A 5E18F 2PMUA 2IPQX 4IJAA 4OU0A 3MZHA 1F5TA 4KN4X 2UWMA 3FM5A 2MBFA 2H94A 2VXZA 1HSJA 4RGXA 4KIFA 1TW2A 2FU4A 3TOBA 2IA1A 4I09A 5J6XA 4A0YA 1S29A 3QOPA 2PG4A 3SQNA 4EM1A 4HX4A 4IRHA 4ZYDA 1T0FA 3ISPA 1SFUA 1MJAA 4U0VA 2RC4A 4R8HA 1QQIA 5D5VB 4I7HA 4TV7A 5LHIA 3REOA 4RB0A 4UHTA 2EFQA 4ENNA 1R22A 4CICA 1O7FA 3BDDA 3DKWA 4HQMA 4XRFA 4ESBA 2QM3A 5DD4A 1K6OA 3V7SA 1TLHB 3C3WA 4U0YA 4HX7A 4WXCA 3W6JB 4YIFA 1F1ZA 4KUMA 2HKXA 3D0SA 1BC7C 2QBYB 3B73A 4OIRF 5BMZA 5DDGA 3ZQ7A 3ZN0A 1MJBA 5ILUA 4MQ9F 1GXPA 4YG2F 4EJVA 4A6EA 4L9TA 4RAYA 1NHAA 4U0WA 1KQ9A 2QBYA 2GXBA 2HYGD 4RAZA 3T8TA 4ZZDA 3L7WA 6PAXA 2EA4A 3E97A 2QYOA 3R6SA 1REPC 3HRUA 2D1VA 1H9GA 1J7KA 3VEPA 2A6HF 3I59B 1KA8A 2XV4S 5H20A 4L5IA 2UXXA 2FSWA 1HXDA 3F6OA 3WTZA 1K79A 1O57A 3V8JA 3COAC 2DAOA 3IHUA 1R1TA 3I59A 3V4GA 4RB1A 2PJPA 3JAMK 1KU7A 4PGGA 5LHGA 1OYIA 4M9SA 4KT5C 2WTEA 3PFIA 2A5YB 3IRQA 1ZHFA 4AD9A 3WGIA 3TO7A 1V3FA 3HYIA 2FXAA 2JRTA 3GZ5A 2KIFA 4I0BA 2L4MA 4MQVA 2NYXA 3F8BA 3RPUA 3GF2A 3E3VA 5ICFA 4EGZA 1U5TC 3QU3A 2XVCA 2EA2A 3V8LA 3F6VA 1H9TA 2O0YA 2OBPA 1FT9A 1IXRC 2DK5A 1EH7A 2PEXA 3HTSB 3Q5FA 2FEZA 3O6BB 3JTGA 4G94A 4G6DA 2XASA 2HDCA 1FBQA 4L0YB 1YS6A 2EFNA 5HDKA 4MEXF 3WODF 1HW2A 1R1VA 3GLXA 1ZG1A 5ICEA 3FZVA 4P9FA 1MZBA 4BAYA 3FMSA 3GX4X 4ENJA 2XKOA 1LQ1A 2A3SA 1WI9A 3QAHA 4L5JA 2QQAA 2VBWA 4M74A 1ZGAA 2AS5F 4EJTA 4OIPF 3EYYA 4HF0A 1SMTA 1T39A 3SZTA 1SD5A 1XCVA 2EFWA 3JSOA 3SZPA 1P2FA 2FA5A 1Z91A 4IHSA 3WTVC 2COMA 4PZJA 3U1DA 3RKYA 1FY7A 3ECOA 4PGHA 1T38A 3ZPLA 4G7OF 4BYYA 4HYEA 4CYDA 2NNNA 2XHKA 2JTVA 5LBQA 4MTDA 5LLQA 5CLSA 1OKRA 1LB2A 5LEKA 1AWCA 2H6BA 4I0AA 3IKVA 2VE9A 3SHFA 1SFXA 3J80K 2PQ8A 1YYVA 1QBJA 2QWWA 3I5UA 2DBBA 2J5PA 2X4HA 4GGGA 2BYVE 4G8XA 4ASNA 1KU2A 4L9NA 4HDUA 2EWNA 1X3UA 1FC3A 3L9FA 2Y0MA 3ZP5A 2IW5A 3CUOA 3BZ6A 3CDHA 4NB5A 1P4AA 2JT1A 4YFNF 5ICCA 1HBXG 3L09A 5J8CA 2Z3YA 1R36A 4GO1A 2VBZA 5KK1A 5L3DA 5HLGA 2XROA 1UB9A 4UVBA 2QQBA 2VC1A 2JPBA 1L3LA 2HQRA 1LEAA 4BHCA 2O6GE 2A61A 1ZLJA 3BP8A 4AIHA 4M73A 2VONA 2L4AA 4BXUA 2KJBA 4AIJA 1BIAA 3GYHX 3E5UA 5KVRA 3F8FA 2ZJ2A 3IC7A 1J0RA 4M6XA 4XSXF 2CGPA 3G73A 2LSOA 3C1DA 1P6RA 2XAHA 2NNYA 3Q9SA 3GEZA 1R7JA 3SFZA 4OMYA 2WV0A 1BIBA 3QP5A 3SXYA 5LGTA 1ZRCA 5L3GA 5E8IA 3VOEA 2P8TA 3MFKA 4HBLA 2EK5A 4BQAA 2ESNA 3LSTA 2EV6A 1G3YA 1DUXC 5L3BA 2Q0OA 2AXLA 3HTUA 3PQKA 1R58A 1W5TA 4UVAA 1ZRDA 1IAWA 1YW9A 1WKMA 4LLGF 4AWXB 4GCVA 4ZYGA 4EGYA 4G7ZF 2EV0A 4LLLA 4LD5A 2XRNA 2CFXA 5LRSA 1J9IA 2GIVA 4PDKA 4UVCA 1U3EM 1XSVA 4E70A 1KQ8A 4P55A 3RTRA 3FMRA 2RNJA 5EEHA 3KETA 1S6LA 4AVPA 2K27A 2DFIA 3O2PE 3RIRA 1LVAA 3MZYA 2FE3A 3R0AA 3ZMDA 1YO5C 1FSHA 4IVNA 4S04A 2GZWA 4HAMA 3S2WA 3DEUA 5ILVA 5IT3A 3BOQA 5DCMB 4RGRA 4Q5SF 4M9ZA 1QZYA 5A2QK 5L3EA 2E7XA 1IXCA 3LFKA 1IN4A 4KYWA 4FX4A 2XUBA 5TJJA 5D6FA 5DCMA 4WCGA 4IXAA 2W85A 5K5OA 2P4WA 4EJWA 4KDPA 4R1HA 4XLNF 3BJAA 4RGUA 1XGMA 3LWFA 1IRFA 5CVUA 2E1NA 4B8XA 3CUQC 1TQIA 1TNSA 2P5VA 1AOYA 5D8LB 4RGSA 5HLIA 3GFJA 4HLYA 4ENKA 2ISYA 4LLNA 3MEXA 3H3UA 2ETHA 1O3QA 4KMUX 1FSEA 2P7CB 2FBHA 5FLXZ 2HQNA 5HLHA 3DPLC 3F8NA 5CVVA 2F5EA 3BWGA 1ZREA 2VOPA 3T8RA 2KIMA 4IRGA 4G7HF 1U5TA 2H6CA 1CF7B 3WE2A 1DDNA 1OR7A 2JSCA 4S05A 2O03A 1QO0D 2HTSA 2HYFA 2OQRA 1CF7A 4KICA 2M5WA 2XKPA 2BEOA 3WTYC 3DV8A 1ZGJA 3ROUA 5FD5A 3ZN1A 4KMFA 1KYZA 2VE8A 2NRAC 2D45A 4WWCA 2DK8A 3HRMA 2STTA 5DUKA 3RKWA 3BPVA 4NQWA 5CVRA 2XAJA 1FYMA 1Z1DA 3J7AO 3FXQA 3RJPA 3GFIA 1WRJA 3QU6A 2PMHA 3RPQA 5FB2A 5L3CA 4MHGA 1IN5A 2OD5A 4IHTA 1O7LA 2MLGA 2ZNZA 4M9XA 2HEOA 1IN8A 4KIGA 2Z99A 5E8GA 1Z9CA 1UHMA 4L18B 3BJOA 4EV0A 5F1RA 3WTUC 4N9IA 4JBAA 3WTXC 1HSTA 2FBIA 3N97A 2RVCA 1IN6A 3WTSC 4CO8A 4LMYA 1G6NA 3ECHA 2VBYA 4IPAA 1SD7A 2GA1A 2HZTA 3V7RA 3TO6A 4OIOF 2Q2EA 2ESHA 4U7DA 3DP7A 5HS9A 2RQPA 3PQJA 2VC0A 1FZPB 3GUDA 1QGPA 1B9NA 1S3JA 1TTYA 2KKOA 2Z5UA 4MEYF 3VB2A 3DFGA 4ZYHA 2BBYA 1RIOH 3VODA 3QPTA 2A69F 3KLNA 3B02A 1MKMA 2QZ8A 3TDZC 2QUFA 1LJ9A 1B9MA 2IA0A 1ZG3A 2EFPA 2FRHA 2QLZA 3GXOA 5EEGA 4HW0A 4LB5A 1Z7UA 3R4KA 1TQPA 2KRFA 2YSRA 4I2OA 1U6GA 5HOOA 2W24A 5ILSA 2J5OA 4JK1X 4MGRA 3BJ6A 1KU9A 2DLLA 1MD0A 5CYVA 1V4RA 5AIPA 5DCFA 4O5VA 1E2XA 3V8KA 5K1YA 2FMYA 2FNAA 2P7VB 1RI7A 3WGGA 2VT3A 1KGSA 4KN7X 3CLOA 4GYGA 2NS0A 1W7PD 1JHHA 2ZBKA 4UNOA 2IT0A 2ISZA 4M72A 1L0OC 1FOKA 2G7UA 2R7FA 4Q4ZF 2MD5A 1XGOA 3IL2A 5CVIA 3HOSA 5DUIA 2E7WA 4L0ZB 3H3ZA 1FYKA 3RYRA 2HKOA 1FYLA 4U88A 5K5QA 2ZKZA 1XDSA 3E6CC 3LA2A 2VBXA 1ONVA 1LDJA 3RKXA 1C0WA 1KYWA 2HTJA 5CJ9A 3JAMZ 1W4MA 1UHWA 2JPCA 2RGVA 2O61A 1GHCA 3FF5A 4LGWA 1XGSA 4H0EA 3WGHA 1J75A 4UV8A 4EQQA 1ZRFA 3GVAA 1RNLA 4CGZA 2P6SA 3I4PA 3M7GA 1MDMB 2CSOA 4EVIA 2V1UA 2FMLA 1D3YA 1ZAOA 1G3TA 1MDMA 1IZ1A 1XDUA 3IWZA 4NHJA 2L02A 5F6FA 1PP7U 3IKTA 1I6XA 5IT9K 2ADUA 3LAJA 4CDGA 5ED4A 1IUYA 2OA4A 3DPTA 1IXSB 3E5XA 2DQRA 1R00A 3KCCA 4N9HA 2LDUA 3F8MA 5E17F 5HDNA 1YQAA 2FQ3A 4A6DA 2ZO4A 2K7LA 1B59A 5DEQA 3K1NA 3KP5A 2ZCWA 4HOBA 1HKQA 1BI2A 2DQLA 3NQOA 3F21A 4HF1A 3HSRA 4KNYA 4QLCU 2DTRA 2XAGA 4M71A 5E1XA 2YPRA 2UXNA 1FBSA 1FP2A 1HW1A 2DPUA 1ON1A 4ESFA 1W7PB 3AAFA 1Y0UA 5D5XB 1SD4A 1ZYRF 3KP7A 2CO5A 2P5KA 3I58A 3TO9A 4A12A 1HQCA 3HRSA 3P9KA 1W7PA 4N0BA 2IRFG 4YFKF 1G3WA 2FOKA 3R60A 3I0TA 4EMSA 2WWYA 4L9VA 1PDNC 3F72A 1FPQA 3P9CA 5FD6A 2CQKA 1KQ0A 1U78A 3WE3A 2EB7A 2VN2A 1BN5A 2DPDA 2M8EA 2RV8A 1OYWA 3ZMVA 2KIUA 3KZYA 2CG4A 2QENA 2YX4A 4WXDA 2UZKA 1FP1D 4JQFA 1TQMA 1U2WA 1UFMA 3J80Z 3BY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1M A;  1R1U A;  1YW8 A;  3K1P A;  2PN6 A;  3MWM A;  5FLX K;  5FFZ A;  2Q8K A;  2H27 A;  1CGP A;  1IN7 A;  2K02 A;  1T2K A;  3KZZ A;  1XD7 A;  1FLI A;  1PP8 F;  1RZ4 A;  3KP3 A;  3JW4 A;  1LNW A;  2XIG A;  4PCQ A;  3TQN A;  4EJU A;  2E1C A;  3C18 A;  1XMA A;  2NAZ A;  2G7H A;  1S7A A;  4U7B A;  2Z33 A;  1BI1 A;  4MNU A;  4D0P A;  4EJO A;  1YFH A;  2Z9O A;  2BGC A;  3MCZ A;  1FX7 A;  4LG0 A;  2F5C A;  2K4B A;  1EV7 A;  3CJN A;  4DQ2 A;  2Y75 A;  3TDU C;  2PI0 A;  1S7O A;  3T5X A;  2G9W A;  1D8K A;  1O3T A;  2BE5 F;  1XB4 A;  1STZ A;  4HQE A;  1R5H A;  3HOT A;  3O3K A;  1MJ9 A;  4Z2Y A;  5D5U B;  1ZN2 A;  3FM3 A;  3HSF A;  4M6Y A;  3OV8 A;  4P96 A;  3KFW X;  1U8R A;  3WU1 B;  3WG9 A;  2XAQ A;  3HUG A;  3M1E A;  2DW4 A;  3M8F A;  4FHT A;  2ELH A;  3DF8 A;  2ACJ A;  1J5Y A;  4P5O A;  3FXR A;  5BS6 A;  4MTE A;  1QZZ A;  5CVJ A;  2VOO A;  4UV9 A;  2LF8 A;  2RN7 A;  2OZ6 A;  4OIN F;  4OIQ F;  1G4D A;  3K0L A;  1U5T B;  1WWX A;  3FHZ A;  3ABT A;  3FX3 A;  2H09 A;  3T1B A;  1F4K A;  2HR3 A;  1YG2 A;  3BRO A;  2X0L A;  1SFE A;  1W5S A;  3J81 Z;  1WQ2 A;  3ULQ B;  5BQT A;  4XBF A;  5JR3 A;  2YX7 A;  3TOA A;  5HS8 A;  3H92 A;  3U2R A;  1HKT A;  4YII A;  2IJL A;  1IW7 F;  5HVQ C;  1DP7 P;  1ULY A;  2HGC A;  4I01 A;  3L00 A;  4WF2 A;  3FXU A;  3HIF A;  2F2E A;  1K78 B;  5H6Q A;  4LJZ F;  3E6D A;  3GW2 A;  4ETS A;  2LNB A;  3F3X A;  3U9G A;  1LDK B;  1YIO A;  5D4S A;  3FMQ A;  2FNP A;  2FF4 A;  4A5N A;  2K4J A;  4GXO A;  3QP6 A;  4A5M A;  1K78 A;  1I27 A;  2K86 A;  3D5L A;  5AIQ A;  1D8J A;  3EYI A;  3Q9V A;  4LFU A;  1TNT A;  1TW3 A;  3LQR A;  2C6Y A;  5A2Q Z;  1R23 A;  1XN7 A;  2IVM A;  2W84 A;  5H6R A;  1YW7 A;  5ICG A;  1YTY A;  2V6C A;  5ERI A;  1E17 A;  3EDP A;  1B6A A;  3MAJ A;  3OOP A;  4Y15 A;  3NEU A;  2GAU A;  2R7D A;  3GFM A;  2M45 A;  1ZLK A;  2O3F A;  3KP6 A;  4LK1 F;  5E20 A;  1ZAR A;  1JXS A;  4WX9 A;  3QRF F;  1WSU A;  5F64 A;  3ZMU A;  2BV6 A;  3JTH A;  3GWZ A;  2M87 A;  2F5F A;  2VOD A;  2HS5 A;  3GO5 A;  4Y13 A;  4Q48 A;  1Q1H A;  3HHG A;  3HRT A;  2OU2 A;  5HS7 A;  2Y48 A;  3L2C A;  2KJC A;  5HDG A;  1USS A;  4UXN A;  1J2X A;  3E6M A;  4G6Q A;  3R61 A;  3ERE D;  2O8X A;  2YR2 A;  2P5L C;  1YS7 A;  1QPM A;  1XMK A;  5LGN A;  4FX0 A;  2V1D A;  3GZ6 A;  5D8K B;  2D1H A;  3EUH A;  2ZNY A;  4OOI A;  2XGX A;  1R5G A;  5JFR A;  5L3F A;  2EJR A;  1I1G A;  2XAF A;  3C7J A;  2MA3 A;  3EET A;  2IP2 A;  2GQQ A;  2LF7 A;  2RDP A;  4BH9 A;  4YFX F;  1ZG5 A;  1KU3 A;  2IA2 A;  3M8E A;  4RB2 C;  4Y17 A;  2L54 A;  4ZZL A;  4KFC A;  1Z6R A;  3RI4 A;  3W6K B;  3WU0 A;  2OZU A;  3LAP A;  3EQL F;  3KP4 A;  1IF1 A;  2PLY A;  1O3S A;  1LDD A;  4HLX A;  2W57 A;  1RUN A;  4KA4 A;  5DV5 A;  1I5Z A;  2QQ9 A;  2HWV A;  4P9U A;  2DT5 A;  1P92 A;  2ZFW A;  3ZMZ A;  3FWE A;  1OPC A;  2ZME B;  5LRR A;  5BPD A;  3T0Y A;  1H0M A;  5AON A;  2D2W A;  1BI0 A;  2CWE A;  3VFZ A;  2EV5 A;  4DNC A;  1B1B A;  4A0Z A;  2ZME A;  3E6B A;  2OAZ A;  1I1S A;  3I64 A;  4LK0 F;  1F9N A;  1TBX A;  3NRV A;  4ZYE A;  4XSZ F;  2RKH A;  4HA8 A;  1FNN A;  3P7N A;  4Q47 A;  2DU9 A;  4ZH4 F;  1SAX A;  1Z6T A;  4A0X A;  3KE2 A;  3LQQ A;  5JHU A;  2LKP A;  3I53 A;  1ODD A;  3F22 A;  2OQG A;  2V79 A;  2V9V A;  1SMY F;  4HDV A;  3LA3 A;  3WTT C;  5D5W B;  1XCB A;  4BHP A;  4G9Y A;  2B0L A;  4CZZ A;  5LGU A;  3F23 A;  1BI3 A;  1XGN A;  5DYM A;  4A2U A;  3RYP A;  4ESJ A;  2GXG A;  1JE8 A;  1JHF A;  3LA7 A;  3K69 A;  1DPU A;  1JGS A;  1GVJ A;  2GWR A;  3TKY A;  1A04 A;  1RUO A;  3I54 A;  4XLP F;  3DQV C;  4BNC A;  1HKS A;  4CXF A;  5J8F A;  1D5V A;  4B09 A;  2GA2 A;  3ABU A;  3GFL A;  4ON0 A;  2DI3 A;  3F8C A;  4KIB A;  1UST A;  2A68 F;  2M1B A;  1QNT A;  5FO5 A;  2STW A;  1FWZ A;  2CW0 F;  2QVO A;  3IRR A;  1S8N A;  4HZF A;  3CO6 C;  5JI6 A;  5BOX A;  1XSD A;  5FFX A;  5D4R A;  2A6E F;  2PBI A;  3V7C A;  2JZY A;  1T6S A;  3G3Z A;  3IWF A;  1K7A A;  2DO7 A;  3CUQ B;  1BM9 A;  2M30 A;  1PUE E;  5DD8 A;  2L3D A;  4HV6 A;  4EM0 B;  3ZMS A;  5E1W A;  3TGN A;  1J59 A;  3QPH A;  4RB3 C;  3CTA A;  1OYY A;  1YLF A;  2VT2 A;  3CUQ A;  3DXJ F;  4R79 A;  2HOE A;  3K9T A;  1OMI A;  3BPX A;  2WC2 A;  5BPI A;  3KLO A;  4F7Z A;  4ENM A;  4WXH A;  2A07 F;  2L01 A;  3M9A A;  1VTN C;  1DPR A;  1HW5 A;  1ZH5 A;  2YU3 A;  3JSP A;  3K2Z A;  2F5D A;  4L9J A;  3P9I A;  1EH6 A;  4IRI A;  3ML6 A;  4O6J A;  1BBY A;  2R3S A;  3R0J A;  4WK8 F;  3RDI A;  2FBK A;  4EM2 A;  3N4M A;  5LEJ A;  4HV5 A;  4QWQ A;  2CYY A;  2W25 A;  2HFH A;  3CO7 C;  4FT8 A;  3HHH A;  4CHU A;  4I02 A;  5K5R A;  3J81 K;  3KEO A;  4IF4 A;  2V1X A;  4LB6 B;  1P4X A;  4GYI A;  1B4A A;  5IT9 Z;  3KEQ A;  2PFB A;  1LEB A;  1BJA A;  1IRG A;  2MH9 A;  2MC3 A;  1MGT A;  5LHH A;  3E5Q A;  1G3S A;  4HF2 A;  5TRD A;  2TDX A;  1BOA A;  4I98 B;  4LG0 B;  3ZMT A;  4BHB A;  4K2E A;  3ELK A;  5FGM A;  1XSX A;  3I71 A;  2EFO A;  1P4W A;  1Z05 A;  2ZXJ A;  1GXQ A;  2MLK A;  2P6T A;  1O3R A;  5D6E A;  1FBU A;  3MQ0 A;  1ON2 A;  5E1Z B;  4OMZ A;  4AIK A;  3HSE A;  4O3M A;  2MH2 A;  3WTW C;  1T98 A;  4HX8 A;  5JVT A;  4UUV A;  3KP2 A;  1UCR A;  4RS8 A;  1EH8 A;  1BC8 C;  1SD6 A;  5E18 F;  2PMU A;  2IPQ X;  4IJA A;  4OU0 A;  3MZH A;  1F5T A;  4KN4 X;  2UWM A;  3FM5 A;  2MBF A;  2H94 A;  2VXZ A;  1HSJ A;  4RGX A;  4KIF A;  1TW2 A;  2FU4 A;  3TOB A;  2IA1 A;  4I09 A;  5J6X A;  4A0Y A;  1S29 A;  3QOP A;  2PG4 A;  3SQN A;  4EM1 A;  4HX4 A;  4IRH A;  4ZYD A;  1T0F A;  3ISP A;  1SFU A;  1MJA A;  4U0V A;  2RC4 A;  4R8H A;  1QQI A;  5D5V B;  4I7H A;  4TV7 A;  5LHI A;  3REO A;  4RB0 A;  4UHT A;  2EFQ A;  4ENN A;  1R22 A;  4CIC A;  1O7F A;  3BDD A;  3DKW A;  4HQM A;  4XRF A;  4ESB A;  2QM3 A;  5DD4 A;  1K6O A;  3V7S A;  1TLH B;  3C3W A;  4U0Y A;  4HX7 A;  4WXC A;  3W6J B;  4YIF A;  1F1Z A;  4KUM A;  2HKX A;  3D0S A;  1BC7 C;  2QBY B;  3B73 A;  4OIR F;  5BMZ A;  5DDG A;  3ZQ7 A;  3ZN0 A;  1MJB A;  5ILU A;  4MQ9 F;  1GXP A;  4YG2 F;  4EJV A;  4A6E A;  4L9T A;  4RAY A;  1NHA A;  4U0W A;  1KQ9 A;  2QBY A;  2GXB A;  2HYG D;  4RAZ A;  3T8T A;  4ZZD A;  3L7W A;  6PAX A;  2EA4 A;  3E97 A;  2QYO A;  3R6S A;  1REP C;  3HRU A;  2D1V A;  1H9G A;  1J7K A;  3VEP A;  2A6H F;  3I59 B;  1KA8 A;  2XV4 S;  5H20 A;  4L5I A;  2UXX A;  2FSW A;  1HXD A;  3F6O A;  3WTZ A;  1K79 A;  1O57 A;  3V8J A;  3COA C;  2DAO A;  3IHU A;  1R1T A;  3I59 A;  3V4G A;  4RB1 A;  2PJP A;  3JAM K;  1KU7 A;  4PGG A;  5LHG A;  1OYI A;  4M9S A;  4KT5 C;  2WTE A;  3PFI A;  2A5Y B;  3IRQ A;  1ZHF A;  4AD9 A;  3WGI A;  3TO7 A;  1V3F A;  3HYI A;  2FXA A;  2JRT A;  3GZ5 A;  2KIF A;  4I0B A;  2L4M A;  4MQV A;  2NYX A;  3F8B A;  3RPU A;  3GF2 A;  3E3V A;  5ICF A;  4EGZ A;  1U5T C;  3QU3 A;  2XVC A;  2EA2 A;  3V8L A;  3F6V A;  1H9T A;  2O0Y A;  2OBP A;  1FT9 A;  1IXR C;  2DK5 A;  1EH7 A;  2PEX A;  3HTS B;  3Q5F A;  2FEZ A;  3O6B B;  3JTG A;  4G94 A;  4G6D A;  2XAS A;  2HDC A;  1FBQ A;  4L0Y B;  1YS6 A;  2EFN A;  5HDK A;  4MEX F;  3WOD F;  1HW2 A;  1R1V A;  3GLX A;  1ZG1 A;  5ICE A;  3FZV A;  4P9F A;  1MZB A;  4BAY A;  3FMS A;  3GX4 X;  4ENJ A;  2XKO A;  1LQ1 A;  2A3S A;  1WI9 A;  3QAH A;  4L5J A;  2QQA A;  2VBW A;  4M74 A;  1ZGA A;  2AS5 F;  4EJT A;  4OIP F;  3EYY A;  4HF0 A;  1SMT A;  1T39 A;  3SZT A;  1SD5 A;  1XCV A;  2EFW A;  3JSO A;  3SZP A;  1P2F A;  2FA5 A;  1Z91 A;  4IHS A;  3WTV C;  2COM A;  4PZJ A;  3U1D A;  3RKY A;  1FY7 A;  3ECO A;  4PGH A;  1T38 A;  3ZPL A;  4G7O F;  4BYY A;  4HYE A;  4CYD A;  2NNN A;  2XHK A;  2JTV A;  5LBQ A;  4MTD A;  5LLQ A;  5CLS A;  1OKR A;  1LB2 A;  5LEK A;  1AWC A;  2H6B A;  4I0A A;  3IKV A;  2VE9 A;  3SHF A;  1SFX A;  3J80 K;  2PQ8 A;  1YYV A;  1QBJ A;  2QWW A;  3I5U A;  2DBB A;  2J5P A;  2X4H A;  4GGG A;  2BYV E;  4G8X A;  4ASN A;  1KU2 A;  4L9N A;  4HDU A;  2EWN A;  1X3U A;  1FC3 A;  3L9F A;  2Y0M A;  3ZP5 A;  2IW5 A;  3CUO A;  3BZ6 A;  3CDH A;  4NB5 A;  1P4A A;  2JT1 A;  4YFN F;  5ICC A;  1HBX G;  3L09 A;  5J8C A;  2Z3Y A;  1R36 A;  4GO1 A;  2VBZ A;  5KK1 A;  5L3D A;  5HLG A;  2XRO A;  1UB9 A;  4UVB A;  2QQB A;  2VC1 A;  2JPB A;  1L3L A;  2HQR A;  1LEA A;  4BHC A;  2O6G E;  2A61 A;  1ZLJ A;  3BP8 A;  4AIH A;  4M73 A;  2VON A;  2L4A A;  4BXU A;  2KJB A;  4AIJ A;  1BIA A;  3GYH X;  3E5U A;  5KVR A;  3F8F A;  2ZJ2 A;  3IC7 A;  1J0R A;  4M6X A;  4XSX F;  2CGP A;  3G73 A;  2LSO A;  3C1D A;  1P6R A;  2XAH A;  2NNY A;  3Q9S A;  3GEZ A;  1R7J A;  3SFZ A;  4OMY A;  2WV0 A;  1BIB A;  3QP5 A;  3SXY A;  5LGT A;  1ZRC A;  5L3G A;  5E8I A;  3VOE A;  2P8T A;  3MFK A;  4HBL A;  2EK5 A;  4BQA A;  2ESN A;  3LST A;  2EV6 A;  1G3Y A;  1DUX C;  5L3B A;  2Q0O A;  2AXL A;  3HTU A;  3PQK A;  1R58 A;  1W5T A;  4UVA A;  1ZRD A;  1IAW A;  1YW9 A;  1WKM A;  4LLG F;  4AWX B;  4GCV A;  4ZYG A;  4EGY A;  4G7Z F;  2EV0 A;  4LLL A;  4LD5 A;  2XRN A;  2CFX A;  5LRS A;  1J9I A;  2GIV A;  4PDK A;  4UVC A;  1U3E M;  1XSV A;  4E70 A;  1KQ8 A;  4P55 A;  3RTR A;  3FMR A;  2RNJ A;  5EEH A;  3KET A;  1S6L A;  4AVP A;  2K27 A;  2DFI A;  3O2P E;  3RIR A;  1LVA A;  3MZY A;  2FE3 A;  3R0A A;  3ZMD A;  1YO5 C;  1FSH A;  4IVN A;  4S04 A;  2GZW A;  4HAM A;  3S2W A;  3DEU A;  5ILV A;  5IT3 A;  3BOQ A;  5DCM B;  4RGR A;  4Q5S F;  4M9Z A;  1QZY A;  5A2Q K;  5L3E A;  2E7X A;  1IXC A;  3LFK A;  1IN4 A;  4KYW A;  4FX4 A;  2XUB A;  5TJJ A;  5D6F A;  5DCM A;  4WCG A;  4IXA A;  2W85 A;  5K5O A;  2P4W A;  4EJW A;  4KDP A;  4R1H A;  4XLN F;  3BJA A;  4RGU A;  1XGM A;  3LWF A;  1IRF A;  5CVU A;  2E1N A;  4B8X A;  3CUQ C;  1TQI A;  1TNS A;  2P5V A;  1AOY A;  5D8L B;  4RGS A;  5HLI A;  3GFJ A;  4HLY A;  4ENK A;  2ISY A;  4LLN A;  3MEX A;  3H3U A;  2ETH A;  1O3Q A;  4KMU X;  1FSE A;  2P7C B;  2FBH A;  5FLX Z;  2HQN A;  5HLH A;  3DPL C;  3F8N A;  5CVV A;  2F5E A;  3BWG A;  1ZRE A;  2VOP A;  3T8R A;  2KIM A;  4IRG A;  4G7H F;  1U5T A;  2H6C A;  1CF7 B;  3WE2 A;  1DDN A;  1OR7 A;  2JSC A;  4S05 A;  2O03 A;  1QO0 D;  2HTS A;  2HYF A;  2OQR A;  1CF7 A;  4KIC A;  2M5W A;  2XKP A;  2BEO A;  3WTY C;  3DV8 A;  1ZGJ A;  3ROU A;  5FD5 A;  3ZN1 A;  4KMF A;  1KYZ A;  2VE8 A;  2NRA C;  2D45 A;  4WWC A;  2DK8 A;  3HRM A;  2STT A;  5DUK A;  3RKW A;  3BPV A;  4NQW A;  5CVR A;  2XAJ A;  1FYM A;  1Z1D A;  3J7A O;  3FXQ A;  3RJP A;  3GFI A;  1WRJ A;  3QU6 A;  2PMH A;  3RPQ A;  5FB2 A;  5L3C A;  4MHG A;  1IN5 A;  2OD5 A;  4IHT A;  1O7L A;  2MLG A;  2ZNZ A;  4M9X A;  2HEO A;  1IN8 A;  4KIG A;  2Z99 A;  5E8G A;  1Z9C A;  1UHM A;  4L18 B;  3BJO A;  4EV0 A;  5F1R A;  3WTU C;  4N9I A;  4JBA A;  3WTX C;  1HST A;  2FBI A;  3N97 A;  2RVC A;  1IN6 A;  3WTS C;  4CO8 A;  4LMY A;  1G6N A;  3ECH A;  2VBY A;  4IPA A;  1SD7 A;  2GA1 A;  2HZT A;  3V7R A;  3TO6 A;  4OIO F;  2Q2E A;  2ESH A;  4U7D A;  3DP7 A;  5HS9 A;  2RQP A;  3PQJ A;  2VC0 A;  1FZP B;  3GUD A;  1QGP A;  1B9N A;  1S3J A;  1TTY A;  2KKO A;  2Z5U A;  4MEY F;  3VB2 A;  3DFG A;  4ZYH A;  2BBY A;  1RIO H;  3VOD A;  3QPT A;  2A69 F;  3KLN A;  3B02 A;  1MKM A;  2QZ8 A;  3TDZ C;  2QUF A;  1LJ9 A;  1B9M A;  2IA0 A;  1ZG3 A;  2EFP A;  2FRH A;  2QLZ A;  3GXO A;  5EEG A;  4HW0 A;  4LB5 A;  1Z7U A;  3R4K A;  1TQP A;  2KRF A;  2YSR A;  4I2O A;  1U6G A;  5HOO A;  2W24 A;  5ILS A;  2J5O A;  4JK1 X;  4MGR A;  3BJ6 A;  1KU9 A;  2DLL A;  1MD0 A;  5CYV A;  1V4R A;  5AIP A;  5DCF A;  4O5V A;  1E2X A;  3V8K A;  5K1Y A;  2FMY A;  2FNA A;  2P7V B;  1RI7 A;  3WGG A;  2VT3 A;  1KGS A;  4KN7 X;  3CLO A;  4GYG A;  2NS0 A;  1W7P D;  1JHH A;  2ZBK A;  4UNO A;  2IT0 A;  2ISZ A;  4M72 A;  1L0O C;  1FOK A;  2G7U A;  2R7F A;  4Q4Z F;  2MD5 A;  1XGO A;  3IL2 A;  5CVI A;  3HOS A;  5DUI A;  2E7W A;  4L0Z B;  3H3Z A;  1FYK A;  3RYR A;  2HKO A;  1FYL A;  4U88 A;  5K5Q A;  2ZKZ A;  1XDS A;  3E6C C;  3LA2 A;  2VBX A;  1ONV A;  1LDJ A;  3RKX A;  1C0W A;  1KYW A;  2HTJ A;  5CJ9 A;  3JAM Z;  1W4M A;  1UHW A;  2JPC A;  2RGV A;  2O61 A;  1GHC A;  3FF5 A;  4LGW A;  1XGS A;  4H0E A;  3WGH A;  1J75 A;  4UV8 A;  4EQQ A;  1ZRF A;  3GVA A;  1RNL A;  4CGZ A;  2P6S A;  3I4P A;  3M7G A;  1MDM B;  2CSO A;  4EVI A;  2V1U A;  2FML A;  1D3Y A;  1ZAO A;  1G3T A;  1MDM A;  1IZ1 A;  1XDU A;  3IWZ A;  4NHJ A;  2L02 A;  5F6F A;  1PP7 U;  3IKT A;  1I6X A;  5IT9 K;  2ADU A;  3LAJ A;  4CDG A;  5ED4 A;  1IUY A;  2OA4 A;  3DPT A;  1IXS B;  3E5X A;  2DQR A;  1R00 A;  3KCC A;  4N9H A;  2LDU A;  3F8M A;  5E17 F;  5HDN A;  1YQA A;  2FQ3 A;  4A6D A;  2ZO4 A;  2K7L A;  1B59 A;  5DEQ A;  3K1N A;  3KP5 A;  2ZCW A;  4HOB A;  1HKQ A;  1BI2 A;  2DQL A;  3NQO A;  3F21 A;  4HF1 A;  3HSR A;  4KNY A;  4QLC U;  2DTR A;  2XAG A;  4M71 A;  5E1X A;  2YPR A;  2UXN A;  1FBS A;  1FP2 A;  1HW1 A;  2DPU A;  1ON1 A;  4ESF A;  1W7P B;  3AAF A;  1Y0U A;  5D5X B;  1SD4 A;  1ZYR F;  3KP7 A;  2CO5 A;  2P5K A;  3I58 A;  3TO9 A;  4A12 A;  1HQC A;  3HRS A;  3P9K A;  1W7P A;  4N0B A;  2IRF G;  4YFK F;  1G3W A;  2FOK A;  3R60 A;  3I0T A;  4EMS A;  2WWY A;  4L9V A;  1PDN C;  3F72 A;  1FPQ A;  3P9C A;  5FD6 A;  2CQK A;  1KQ0 A;  1U78 A;  3WE3 A;  2EB7 A;  2VN2 A;  1BN5 A;  2DPD A;  2M8E A;  2RV8 A;  1OYW A;  3ZMV A;  2KIU A;  3KZY A;  2CG4 A;  2QEN A;  2YX4 A;  4WXD A;  2UZK A;  1FP1 D;  4JQF A;  1TQM A;  1U2W A;  1UFM A;  3J80 Z;  3BY6 A; 
#chains in the Genus database with same CATH topology
 1ZTR A;  1UHS A;  3K1M A;  2I5U A;  1R1U A;  1YW8 A;  1NH3 A;  3K1P A;  1FTZ A;  1WH7 A;  2G0E A;  2PN6 A;  3MWM A;  3TP0 A;  2DYR H;  5FLX K;  5FFZ A;  1E3O C;  2EH3 A;  3CCS I;  4XK4 A;  2NOJ B;  2Q8K A;  2H27 A;  1UG0 A;  2O9L A;  5EGO A;  1LE8 A;  1CGP A;  1IN7 A;  5IOY A;  1JUS A;  3OYF A;  2AQE A;  2K02 A;  2IGM A;  4A3G J;  2KDZ A;  1R9T J;  3G1O A;  3OWT A;  1T2K A;  4LIT A;  3KZZ A;  1XD7 A;  1FLI A;  1PP8 F;  5EJC A;  2LY1 A;  1RZ4 A;  1FOX A;  3KP3 A;  3H9J A;  4FIS A;  3JW4 A;  1X1B A;  1LNW A;  3ZQH A;  2XIG A;  4PCQ A;  2H8R A;  4J19 A;  2CUF A;  3TQN A;  4EJU A;  2E1C A;  1ETW A;  2XPU A;  3C18 A;  3HZJ A;  2DMU A;  1XMA A;  2NAZ A;  2HPI A;  2G7H A;  1S7A A;  5GTH C;  4U7B A;  2Z33 A;  2FD5 A;  1BI1 A;  5EYR A;  2YU9 J;  4MNU A;  3IUO A;  4D0P A;  4EJO A;  5IPA A;  1YFH A;  3H9Q A;  4BQO A;  2XRL A;  4XLH A;  1OCZ H;  2Z9O A;  1JKO C;  2BGC A;  1TP4 A;  4HST A;  3A0B C;  3PO2 J;  1HDP A;  3MCZ A;  3AG2 H;  2V4J C;  2OTL I;  2DT6 A;  1FX7 A;  2GOM A;  4LG0 A;  1S7E A;  2F5C A;  2MAB A;  4ITV A;  3SEZ A;  2K4B A;  1EV7 A;  3CJN A;  2ZSI B;  4DQ2 A;  2Y75 A;  3TDU C;  1OLT A;  2Y30 A;  2PI0 A;  1S7O A;  3P5J A;  3T5X A;  2G9W A;  4XKV A;  4RBO A;  1D8K A;  1O3T A;  3LSK A;  1JUM A;  2BE5 F;  3A02 A;  4E7H A;  5FRO A;  1XB4 A;  1STZ A;  4LIV A;  4HQE A;  1R5H A;  2GIZ A;  2PMZ N;  3HUG B;  1Y8Q B;  4PFO A;  3HOT A;  3O3K A;  1MJ9 A;  3GTL J;  3GTO J;  1VZ0 A;  2WY8 Q;  4Z2Y A;  5D5U B;  1WI3 A;  2R93 J;  1ZN2 A;  3J7A Y;  3FM3 A;  3HSF A;  1PYV A;  4M6Y A;  1TWA J;  3S15 J;  3OIQ A;  1P7I A;  5KAI C;  3OV8 A;  4P96 A;  3KFW X;  1U8R A;  3WU1 B;  3WG9 A;  1Z0X A;  3HOX J;  4D9J A;  2XAQ A;  3ZQG A;  1Z67 A;  3HUG A;  3M1E A;  4C2M J;  3HJE A;  2DW4 A;  3HDD A;  3M8F A;  2JQ7 A;  4FHT A;  2FUG 2;  2VKV A;  2ELH A;  3DF8 A;  2NS8 A;  2ACJ A;  5EEA A;  1J5Y A;  4P5O A;  5DM7 F;  3FXR A;  4AC0 A;  2E5Z A;  5BS6 A;  2K9Q A;  3S1N J;  4MTE A;  3BG6 A;  1QZZ A;  3CCR I;  5CVJ A;  2VOO A;  4UV9 A;  2LF8 A;  2RN7 A;  2OZ6 A;  4OIN F;  1VQ8 I;  1RKT A;  1VI0 A;  4EEF G;  4OIQ F;  3GME A;  1G4D A;  2KMU A;  3A03 A;  3K0L A;  1CQT A;  4HNT A;  1U5T B;  1WWX A;  3FHZ A;  1H89 C;  3ABT A;  4AID A;  3FX3 A;  2H09 A;  3T1B A;  3JCU C;  4IO9 F;  2HR3 A;  1F4K A;  1YG2 A;  3BRO A;  1I39 A;  2X0L A;  2MUN A;  2DFE A;  1SFE A;  3CC2 I;  1W5S A;  1HOM A;  2QKM B;  3H9G A;  1QHH D;  1WQ2 A;  3J81 Z;  4DZP A;  3ULQ B;  5BQT A;  2E36 A;  1U9O A;  4XBF A;  3S17 J;  5JR3 A;  2YX7 A;  1I3Q J;  3TOA A;  3FKJ A;  2M4G A;  5HS8 A;  3JR9 A;  3H92 A;  3L2Q A;  2DN0 A;  4F52 A;  4AVZ A;  2DYS H;  2CQQ A;  3U2R A;  3HM5 A;  1HKT A;  4YII A;  2IJL A;  1IW7 F;  3HXL A;  5HVQ C;  1DP7 P;  1WVR A;  1ULY A;  2HGC A;  4I01 A;  4CH7 A;  3L00 A;  3PSF A;  4WF2 A;  3FXU A;  1SFK A;  3HIF A;  2R7W A;  2F2E A;  1K78 B;  1FOY A;  5H6Q A;  2HDW A;  3ABM H;  4LJZ F;  3E6D A;  3CP8 A;  3GW2 A;  4ETS A;  3CDI A;  2LNB A;  3F3X A;  4G12 A;  3U9G A;  1LDK B;  1YIO A;  5D4S A;  3FMQ A;  2FNP A;  2FF4 A;  3OY9 A;  1XC5 A;  4A5N A;  2K4J A;  4GXO A;  2BXY A;  2L7Z A;  3QP6 A;  4A5M A;  1Q1V A;  1K78 A;  1I27 A;  2K86 A;  3D5L A;  2Y31 A;  3CF5 F;  5AIQ A;  4X1E A;  1D8J A;  1MBG A;  3OSG A;  3EYI A;  1IDY A;  2R92 J;  3Q9V A;  3AKZ A;  5M5X J;  4LFU A;  1TNT A;  3CLQ A;  1TW3 A;  3LQR A;  2X6O A;  2C6Y A;  2R7U A;  1R5I D;  5A2Q Z;  1R23 A;  1GV2 A;  1XN7 A;  2IVM A;  2W84 A;  3G2B A;  5M3M J;  5H6R A;  1YW7 A;  5ICG A;  2DJI A;  1YTY A;  3MZ8 A;  2V6C A;  2V26 A;  3J7A W;  5ERI A;  1E17 A;  1MBK A;  3EDP A;  3L1P A;  1B6A A;  3MAJ A;  3D1N I;  3OOP A;  1B8I B;  3MKW B;  2P0T A;  1N25 A;  3L2R A;  4Y15 A;  1K6Y A;  1T33 A;  3NEU A;  2GAU A;  3PJR A;  2R7D A;  3GFM A;  4NNJ A;  4BXF A;  2Z16 A;  2M45 A;  1ZLK A;  1B8I A;  2O3F A;  3KP6 A;  4LK1 F;  5E20 A;  1ZAR A;  2CRG A;  1ZGW A;  4FET A;  2I8D A;  2DFH A;  3OYL A;  1JXS A;  4PFP A;  4WX9 A;  3QRF F;  1T0F C;  1WSU A;  2BY2 A;  5F64 A;  1Z3Y A;  3ZMU A;  4A3C J;  2BV6 A;  4ZTF A;  3JTH A;  2HYJ A;  3GWZ A;  2M87 A;  5FKK A;  2F5F A;  2GBY A;  4F55 A;  2VOD A;  2LY9 A;  2HS5 A;  1OIS A;  1VQO I;  4XL9 A;  3GO5 A;  4Y7N J;  4Y13 A;  4Q48 A;  1Q1H A;  3HHG A;  3HRT A;  1FTT A;  3FIW A;  2OU2 A;  5E79 C;  5HS7 A;  2DMP A;  2Y48 A;  3L2C A;  1TC3 C;  3JRG A;  4XID A;  2F48 A;  3NAR A;  2KJC A;  1EF4 A;  5HDG A;  2Y2Z A;  1X19 A;  1MBE A;  1USS A;  4UXN A;  3GTP J;  1JUP A;  4XM3 A;  2QF7 A;  1J2X A;  3E6M A;  4FAS D;  1EA3 A;  4G6Q A;  1MSE C;  3VYU B;  3R61 A;  3OR2 C;  4RMN A;  3ERE D;  2O8X A;  2YR2 A;  4C3I J;  2P5L C;  1YS7 A;  4A3L J;  1F43 A;  5H2F C;  3LFU A;  1FMV A;  2FJ1 A;  1QPI A;  1TWF J;  2X6X A;  1QPM A;  3CZ6 A;  1XMK A;  2XAU A;  5LGN A;  4FX0 A;  4RM2 A;  1OCC H;  1TT0 A;  2V1D A;  3GZ6 A;  4XLE A;  5D8K B;  3LSI A;  2D1H A;  2HQ5 A;  9ANT A;  2CFO A;  3EUH A;  5IT9 R;  2ZNY A;  4OOI A;  2FOW A;  2ICW G;  4ZDL A;  4BY7 J;  1OJL A;  2XGX A;  1R5G A;  4XQF A;  5JFR A;  2DDB A;  4BGD A;  2K9L A;  5L3F A;  2EJR A;  1I1G A;  1IRX A;  4BQQ A;  2R7S A;  4F92 B;  5J1R A;  2XAF A;  3JRF A;  1MMS A;  2QKL B;  3RKQ A;  4ZC3 A;  3C7J A;  2IXS A;  1UG2 A;  2MA3 A;  3EET A;  2VKD A;  2IP2 A;  2GQQ A;  1V55 H;  2LF7 A;  2RDP A;  3S8P A;  4BH9 A;  4LIU A;  4YFX F;  1ZG5 A;  1KU3 A;  2KZG A;  3K4B A;  3BTJ A;  3OYG A;  1R71 A;  2IA2 A;  5IOZ A;  3FDY A;  1EJ9 A;  3M8E A;  4RB2 C;  1QZE A;  4Y17 A;  2L54 A;  3BTI A;  3HPG A;  4ZZL A;  3CES A;  4IHW A;  3SJM A;  4KFC A;  1Z6R A;  3RI4 A;  3W6K B;  3WU0 A;  1W1W E;  2KZV A;  2OJE D;  2OZU A;  2EPF A;  2XGC A;  3LAP A;  2K9S A;  2KHM A;  3EQL F;  1Z7L A;  3KP4 A;  1IF1 A;  2PLY A;  1O3S A;  3BTC A;  1LDD A;  4HLX A;  2W57 A;  1RUN A;  5FRM A;  3ZQC A;  4KA4 A;  1VQ7 I;  2VPL A;  2VQL A;  5DV5 A;  2VKE A;  1I5Z A;  2QQ9 A;  2HWV A;  1D1C A;  4P9U A;  1BOB A;  2DT5 A;  2XDV A;  4CCK A;  1P92 A;  1VND A;  3DEE A;  1UMQ A;  2ZFW A;  3ZMZ A;  3FWE A;  1HDD C;  1F36 A;  1OPC A;  3BR0 A;  2ZME B;  2QEX I;  5LRR A;  4EAT A;  3CMA I;  5BPD A;  2R7T A;  3CJT B;  1BW6 A;  3T0Y A;  1H0M A;  1MH3 A;  4CZC A;  2NVX J;  3RQI A;  5AON A;  2D2W A;  4C9Y A;  1BI0 A;  2CWE A;  3VFZ A;  2EV5 A;  3ZGK A;  4DNC A;  1B1B A;  4A0Z A;  2B7E A;  1N77 A;  2ZME A;  3E6B A;  1D0X A;  2PMZ A;  2WA0 A;  2OAZ A;  1I1S A;  3I64 A;  3J7Y J;  1AA7 A;  4J00 A;  3PIP F;  2DMQ A;  2ID6 A;  3TW7 A;  4PJN A;  2M0C A;  2JSP A;  4LK0 F;  1LPQ A;  1F9N A;  1TBX A;  3OYE A;  3NRV A;  4ZYE A;  4XSZ F;  2RKH A;  3WHB A;  4HA8 A;  4C3H J;  1FNN A;  3P7N A;  4Q47 A;  2DU9 A;  4XLA A;  4ZH4 F;  1SAX A;  1IGN A;  1Z6T A;  1MH4 A;  4A0X A;  4A93 J;  1JJ6 C;  2K40 A;  3KE2 A;  3E7L A;  3LQQ A;  5JHU A;  2LKP A;  3I53 A;  4PJJ A;  2MD0 A;  4FE7 A;  1R49 A;  4B3X A;  4XOR A;  5FLX R;  1MBJ A;  1ODD A;  3M1C A;  3F22 A;  1WH5 A;  2OQG A;  3MD2 A;  2V79 A;  2EIJ H;  2V9V A;  2R7O A;  2RQQ A;  5C3E J;  5B1A H;  1SMY F;  3DLL F;  3CCY A;  1APL C;  1RPW A;  3N05 A;  1YX5 A;  4HDV A;  3VDX A;  3LA3 A;  4AYB N;  3WTT C;  3K70 D;  1FEX A;  5D5W B;  3LSH A;  1RKW A;  1XCB A;  3QPS A;  4OAY A;  4BHP A;  4G9Y A;  5J1Y A;  4BJ6 C;  1LFB A;  2JUG A;  2CUZ A;  2B0L A;  4CZZ A;  5LGU A;  3F23 A;  1VQ5 I;  1BI3 A;  2E1O A;  1XGN A;  4XKW A;  5DYM A;  4A2U A;  2QSH X;  3RYP A;  1U8B A;  4ESJ A;  3BG3 A;  2OC6 A;  3VSK A;  2GXG A;  1JE8 A;  2LFB A;  1JHF A;  3LA7 A;  2R5Z B;  3K69 A;  5B1B H;  1DPU A;  1JGS A;  3QOD A;  2NVU B;  1GVJ A;  2GWR A;  3TKY A;  2JA6 J;  1A04 A;  4P1W A;  4JX4 A;  1RUO A;  3SZG A;  3ESW B;  2ELK A;  3I54 A;  4XLP F;  3DQV C;  4BNC A;  2IGO A;  1TWC J;  1HKS A;  2P0W A;  3LSP A;  2MFZ A;  2R5Z A;  1ZQ3 P;  4I99 C;  3LOC A;  4CXF A;  2CUE A;  3OS2 A;  5F1J A;  4HPQ A;  2OPT A;  5J8F A;  1D5V A;  4BEH B;  4B09 A;  2GA2 A;  3ABU A;  3GFL A;  2Q1Z B;  4BJT A;  4ON0 A;  5HOD A;  1RR8 C;  3K4L A;  5IP7 J;  2DI3 A;  2E60 A;  3F8C A;  3PUF A;  3GTM J;  2R7V A;  1XX5 A;  2L7K A;  2LR8 A;  4KIB A;  1UST A;  2A68 F;  1ETO A;  2M1B A;  1QNT A;  5FO5 A;  2X48 A;  2STW A;  1FWZ A;  4BEH A;  2IS4 A;  2CW0 F;  2VQG A;  2QVO A;  4IOC F;  3IRR A;  1JKQ C;  4B47 A;  4A3D J;  1S8N A;  5GPA A;  3BC8 A;  4HZF A;  3TL4 X;  5JI6 A;  3CO6 C;  5BOX A;  1XSD A;  5FFX A;  3IH4 A;  5D4R A;  1I50 J;  2A6E F;  2E34 A;  2PBI A;  3V7C A;  2L7F P;  2JZY A;  4ZTJ A;  1T6S A;  3G3Z A;  3IWF A;  2WAQ N;  5GPC A;  2DO7 A;  1K7A A;  3CUQ B;  1BM9 A;  4D5F A;  4V2G A;  2M30 A;  3DKY A;  3OOU A;  1PUE E;  2IS6 A;  5DD8 A;  2L3D A;  4HV6 A;  3RZD J;  4EM0 B;  3ZMS A;  5KCM A;  5E1W A;  2OUM A;  3TGN A;  1J59 A;  3CCJ I;  3QPH A;  2ZFU A;  3SDG A;  3FXL A;  4RB3 C;  3CTA A;  3CUQ A;  1LVK A;  1OYY A;  1YLF A;  2VT2 A;  3DXJ F;  2KIS A;  2WAD A;  3OYN A;  4R79 A;  1PVE A;  2HOE A;  3K9T A;  3JRA A;  3OYI A;  1FIP A;  1OMI A;  2L9R A;  3BPX A;  2WC2 A;  5BPI A;  3KLO A;  3TW6 A;  4F7Z A;  5FLM J;  1XTA A;  4WXH A;  4ENM A;  2A07 F;  2L01 A;  3M9A A;  1VTN C;  4C3J J;  2EZI A;  1DPR A;  4HRI A;  1HW5 A;  2V6E A;  1ZH5 A;  3S1M J;  1IDZ A;  2OTJ I;  2O7O A;  2YU3 A;  4XR6 A;  1MMA A;  3JSP A;  3K2Z A;  1ORK A;  2W82 A;  4GFB A;  2F5D A;  2NVY J;  4L9J A;  3P9I A;  1EH6 A;  2VI6 A;  4XRS G;  4IRI A;  3ML6 A;  4O6J A;  1BBY A;  2R3S A;  3R0J A;  4WK8 F;  3RDI A;  2FBK A;  4EM2 A;  3N4M A;  2JN6 A;  5F0H A;  5LEJ A;  4A3K J;  4HV5 A;  3BR6 A;  1K83 J;  2V1N A;  1LKX A;  5GAH J;  2CYY A;  4QWQ A;  2W25 A;  2HFH A;  3CO7 C;  2E71 A;  5GTI C;  4FT8 A;  3HHH A;  4CHU A;  1RES A;  4I02 A;  1M1E B;  5K5R A;  3J81 K;  3KEO A;  4IF4 A;  2V1X A;  4BE2 A;  1MND A;  4LB6 B;  1P4X A;  1NK2 P;  4GYI A;  2X1D A;  1B4A A;  3H35 A;  4YEJ A;  1NK3 P;  1ETX A;  5IT9 Z;  3IP4 B;  3CC7 I;  3KEQ A;  3CJR B;  3DPU A;  3I9V 2;  2PFB A;  5GAD J;  1T56 A;  1LEB A;  1BJA A;  1A35 A;  1IRG A;  4E7K A;  2MH9 A;  2MC3 A;  1MGT A;  4IHV A;  2VJJ A;  5LHH A;  3E5Q A;  1A6Q A;  1G3S A;  3PSI A;  4HF2 A;  5TRD A;  4DYQ A;  2TDX A;  3D5R C;  1BOA A;  1V54 H;  5EF6 A;  4I98 B;  4LG0 B;  3ZMT A;  4BHB A;  4UUT A;  4K2E A;  3ELK A;  5FGM A;  1TT5 B;  1XSX A;  3I71 A;  2EFO A;  1P4W A;  1Z05 A;  3B6C A;  4BE1 A;  2ZXJ A;  3HGG A;  3KEY A;  1AHD P;  1GXQ A;  1T95 A;  2MLK A;  2P6T A;  1O3R A;  4QIW N;  4AM3 A;  5D6E A;  3DBL B;  1FBU A;  2TCT A;  3SYT A;  3VSL A;  3MQ0 A;  1ON2 A;  3K7A J;  3GCM A;  2EZH A;  4OMZ A;  5E1Z B;  4AIK A;  3HSE A;  2ID3 A;  1YE9 A;  2MH2 A;  3FBI B;  3WTW C;  4O3M A;  1E0E A;  1T98 A;  4HX8 A;  5JVT A;  3C2H A;  4UUV A;  3HC7 A;  4BDZ A;  2HZD A;  3KP2 A;  1UCR A;  4RS8 A;  1EH8 A;  4M3B A;  1BC8 C;  1BR4 A;  1SD6 A;  5E18 F;  1MMG A;  2PMU A;  1Y0N A;  2IPQ X;  2XPV A;  4IJA A;  4OU0 A;  3M8J A;  3MZH A;  1F5T A;  4KN4 X;  5FKN A;  1TL8 A;  2E19 A;  2UWM A;  3CD6 I;  2M34 A;  2DOF A;  3FM5 A;  2MBF A;  2H94 A;  2VXZ A;  1WJA A;  1HSJ A;  4RGX A;  4KIF A;  4Z6Y A;  1TW2 A;  2DA3 A;  2FU4 A;  4BE0 A;  2XPW A;  3TOB A;  3IV5 A;  1SVL A;  2IA1 A;  2Y0S N;  4XMY A;  3D5S C;  1U0J A;  1ENH A;  3BQY A;  4I09 A;  2R0Q C;  5J6X A;  4A0Y A;  1S29 A;  3RPU D;  2F4M B;  2R4G A;  2PG4 A;  3QOP A;  1GUU A;  3SQN A;  3PIO F;  2X6W A;  4FTH A;  4EM1 A;  1D1B A;  3BR5 A;  4HX4 A;  4IRH A;  4ZYD A;  1T0F A;  4FCY A;  2COB A;  3ISP A;  1SFU A;  5FKM A;  2HOS A;  2NXN B;  1MJA A;  1KZH A;  2VLA A;  2H1K A;  1YJ9 I;  4U0V A;  2RC4 A;  3DU6 A;  4R8H A;  3NAU A;  1QQI A;  3L2V A;  5D5V B;  4I7H A;  1AKH B;  4TV7 A;  3CCQ I;  5LHI A;  3CCL I;  3REO A;  4RB0 A;  4UHT A;  1WFX A;  4B4C A;  3OL4 A;  2LTP A;  2EFQ A;  4ENN A;  3GTG J;  3K4M A;  2LY2 A;  2R7X A;  1G59 A;  1J09 A;  4QPO A;  1R22 A;  4CIC A;  4RLQ A;  4A3F J;  1LFU P;  1O7F A;  3AG4 H;  3BDD A;  3DKW A;  1XMX A;  3X2Q H;  1AKH A;  1A36 A;  4HQM A;  2X98 A;  4OAZ A;  4XRF A;  4ESB A;  4II2 A;  2QM3 A;  5DD4 A;  1K6O A;  4E7S A;  3I55 I;  3V7S A;  4AYB A;  2W7N A;  3PNY A;  2LMD A;  1D5Y A;  1E3H A;  1T08 B;  1EKE A;  2A5W A;  1R4M B;  1TLH B;  4A3J J;  1LFP A;  1NTC A;  2E1M B;  3C3W A;  4U0Y A;  4HX7 A;  3CCV I;  4WXC A;  3W6J B;  3BCA A;  4YIF A;  2MC4 A;  1F1Z A;  3OYK A;  5IY5 H;  4KUM A;  2HKX A;  3D0S A;  4QSH A;  1MBF A;  4Y4R A;  5CPR B;  4B43 A;  1BC7 C;  1Y1V J;  2NS7 A;  4E7I A;  3B73 A;  3FXJ A;  4OIR F;  1WJE A;  4JX6 A;  4LG3 A;  5BMZ A;  5DDG A;  4CSW A;  2KQR A;  4BAC A;  2BHZ A;  5M3F J;  3ZQ7 A;  3ZN0 A;  1MJB A;  3GTJ J;  2HPM A;  5ILU A;  1TZL A;  4MQ9 F;  3OYC A;  1GXP A;  2FQ4 A;  1PJR A;  4YG2 F;  4EJV A;  4KIS A;  1ETV A;  4A6E A;  4L9T A;  5IP6 A;  4RAY A;  4IL6 C;  1NHA A;  4U0W A;  1KQ9 A;  2BW3 B;  2QBY A;  4YRV A;  2GXB A;  1A5J A;  3G4S I;  2ZJP F;  4C30 A;  3S14 J;  4IQ4 A;  1FMW A;  2VPR A;  2HYG D;  2QA4 I;  4RAZ A;  3T8T A;  4ANJ A;  4ZZD A;  4B48 A;  3L7W A;  6PAX A;  2EA4 A;  3E97 A;  2QYO A;  3LNQ A;  3R6S A;  2BW3 A;  2EZK A;  5JLW A;  3OYJ A;  4V2F A;  3K4C A;  4C2T A;  1REP C;  4F93 B;  1IC8 A;  2V9P A;  3HRU A;  2D1V A;  2WB1 N;  1H9G A;  3VYR B;  3ABL H;  3PUB A;  2JJ7 A;  1J7K A;  2D5V A;  4RLF A;  5J47 A;  3VEP A;  2XB5 A;  2A6H F;  2DA4 A;  3I59 B;  4GRI A;  1KA8 A;  2XV4 S;  1E3P A;  5H20 A;  4CYC B;  4L5I A;  2K9N A;  2UXX A;  2FSW A;  1HXD A;  4N4O B;  2DOA A;  3ONQ A;  3F6O A;  3WTZ A;  2WAQ A;  1K79 A;  5FRN A;  3K4J A;  5C4J J;  1O57 A;  2BXZ A;  2E35 A;  3V8J A;  1OFC X;  3COA C;  2DAO A;  3IHU A;  3HOY J;  1R1T A;  2IS2 A;  3I59 A;  3BG5 A;  3V4G A;  3CCU I;  4CYC A;  4ABZ A;  1R4N B;  4RB1 A;  2PJP A;  3JAM K;  3V42 A;  1KU7 A;  1Y8R B;  1AU7 A;  4PGG A;  5LHG A;  1VQM I;  2X9D A;  1HLV A;  2OV7 A;  5IYC J;  1OYI A;  2HVQ A;  4KT5 C;  2WTE A;  3PFI A;  2A5Y B;  4M9S A;  1YJW I;  5J4V A;  3IRQ A;  1ZHF A;  3ASO H;  4AD9 A;  3WGI A;  4M3E A;  3TO7 A;  1V3F A;  2CW8 A;  1XPX A;  3HYI A;  4CCN A;  3I4M J;  2FXA A;  5EDN A;  2JRT A;  5M5W J;  3K4N A;  1DP3 A;  3BR2 A;  4N4N B;  4XRM A;  3GZ5 A;  2LK2 A;  2KIF A;  4IZZ A;  4I0B A;  2L4M A;  5JVG F;  3BT9 A;  4XOP A;  3AL0 C;  3NWS A;  3AG3 H;  4D7N A;  2JA2 A;  4MQV A;  1MMN A;  2NYX A;  3F8B A;  4A3M J;  3M07 A;  4HEA 2;  3RPU A;  3UNG C;  3GF2 A;  1S5L C;  1ZK8 A;  3E3V A;  5ICF A;  2X1E A;  3DLA A;  4EGZ A;  1U5T C;  4E4H A;  2H8W A;  4D1Q A;  2Y9Y A;  1SAU A;  5FKO A;  3QU3 A;  4XLC A;  2E2J J;  2XVC A;  2EA2 A;  1OR7 C;  3V8L A;  1RRJ A;  1JJ8 C;  1R6R A;  3F6V A;  1H9T A;  2O0Y A;  2OBP A;  1FT9 A;  1IXR C;  2ME0 A;  2DK5 A;  2EIK H;  4CA0 A;  1RQ6 A;  1EH7 A;  3HEF A;  3S3N A;  2PEX A;  3HTS B;  3Q5F A;  2FEZ A;  4DZJ A;  2BZT A;  2XF6 A;  3O6B B;  2JA7 J;  3JTG A;  3HOV J;  4HNU A;  4G94 A;  4J01 A;  4G6D A;  2XAS A;  2HDC A;  2ZB9 A;  1FBQ A;  4L0Y B;  4BKX A;  4MFE A;  2LBF B;  1YS6 A;  2EFN A;  5HDK A;  4MEX F;  2F6C A;  3WOD F;  4A3E J;  2N8G A;  3FXM A;  3B6A A;  1DGW Y;  1R1V A;  3GLX A;  1GT0 C;  1HW2 A;  2ZXW H;  3F9K A;  1ZG1 A;  2HQA A;  5ICE A;  3FZV A;  4P9F A;  3MMY B;  1MZB A;  2LBF A;  4BAY A;  3EUK L;  3FMS A;  3GX4 X;  4F91 B;  4ENJ A;  2XKO A;  1LQ1 A;  3OYA A;  2A3S A;  3OMY A;  1PUF B;  1X4O A;  1WI9 A;  3G71 I;  2VAS A;  3J7Z I;  4RA2 A;  3QAH A;  4L5J A;  2QQA A;  1ZKG A;  2VBW A;  3IAM 2;  4M74 A;  2QBY B;  1ZGA A;  2AS5 F;  1ETY A;  4EJT A;  4ZDO A;  4OIP F;  3EYY A;  3FBN B;  3OIO A;  3SEQ A;  2E5N A;  4BY1 J;  2CH0 A;  4HF0 A;  3MVP A;  1SMT A;  3KYL A;  2EIL H;  1PUF A;  1T39 A;  3SZT A;  1SD5 A;  1OCR H;  1XCV A;  2CS3 A;  4I76 A;  2EFW A;  3CDL A;  3JSO A;  5GAE J;  3SZP A;  2ME6 A;  1P2F A;  2FA5 A;  3OYM A;  1Z91 A;  4IHS A;  2HOT A;  3CP2 A;  3WTV C;  4HNV A;  2Y9Z A;  2COM A;  2CJJ A;  3BCB A;  4PZJ A;  3U1D A;  4XN3 A;  3RKY A;  1FY7 A;  3ECO A;  4PGH A;  4Y33 A;  1T38 A;  3ZPL A;  4G7O F;  4BYY A;  4V19 K;  4HYE A;  4CYD A;  2NNN A;  1NG7 A;  4BS9 A;  3VWB A;  2Y69 H;  2XHK A;  3FXK A;  2L9S A;  5KNL A;  2JTV A;  2LLK A;  5IYB J;  1Y39 A;  4AUX A;  1X3Z B;  5LBQ A;  4MTD A;  5C4X J;  1UZC A;  2Y0S A;  2XC7 A;  2DA5 A;  5LLQ A;  4BDY A;  2M3A A;  5CLS A;  1OKR A;  1OQY A;  1LB2 A;  2CV0 A;  5LEK A;  3HKZ N;  3ZQF A;  1AWC A;  2VJ4 A;  1TWG J;  4CCJ A;  2H6B A;  3I4N J;  1DU6 A;  4I0A A;  5TGT A;  3IKV A;  3JRB A;  1WHU A;  2BOL A;  2HVS A;  2VE9 A;  2F5V A;  2IAI A;  3S1R J;  3SHF A;  1SFX A;  1QHG A;  4E6K G;  2JWT A;  3J80 K;  2PQ8 A;  1YYV A;  1QBJ A;  2QWW A;  2WAF A;  1WJF A;  3I5U A;  2DBB A;  2J5P A;  4ZYA A;  2X4H A;  4GGG A;  2BYV E;  2KL4 A;  4G8X A;  4ASN A;  1HCR A;  1KU2 A;  4L9N A;  4HDU A;  2EWN A;  2R7Z J;  1X3U A;  4B1R A;  3H5R A;  1FC3 A;  3RCO A;  3L9F A;  2DMT A;  2Y0M A;  3ZP5 A;  2IW5 A;  2V9K A;  2K3P A;  3CUO A;  3BZ6 A;  4X0G A;  3MKY B;  5EZH A;  3CDH A;  1BJZ A;  1DQU A;  4NB5 A;  1P4A A;  1V5G A;  1QVT A;  3KYD B;  3CCM I;  3S1Q J;  4HG2 A;  2JT1 A;  4YFN F;  2DOD A;  2QGU A;  4B3A A;  5ICC A;  1HBX G;  1IO2 A;  3L09 A;  5J8C A;  1WGX A;  2Z3Y A;  3LSJ A;  1R36 A;  5F0F A;  3QQA A;  1GDT A;  4GO1 A;  2A6T A;  4BQN A;  2VBZ A;  5KK1 A;  1WJ5 A;  5L3D A;  3GZN B;  5HLG A;  2VXD A;  1WJD A;  2XRO A;  1UB9 A;  2MSY A;  4UVB A;  2QQB A;  2LH9 A;  2JPB A;  2VC1 A;  4LOC A;  1L3L A;  3HOZ J;  2HQR A;  4KT6 A;  3OYD A;  1LEA A;  2M35 A;  4BHC A;  1B72 B;  2O6G E;  1POG A;  2A61 A;  5LD2 C;  3AG1 H;  1LUJ B;  1ZLJ A;  2CQX A;  4D5C A;  4I6Z A;  3KX2 A;  3BP8 A;  4AIH A;  4M73 A;  1KON A;  2VON A;  1A31 A;  2L4A A;  1JT0 A;  4BXU A;  2KJB A;  1BR2 A;  4W97 A;  3O8G A;  3E1S A;  1B72 A;  3WHC A;  4AIJ A;  1BIA A;  2WY7 Q;  4XOT A;  3GYH X;  4MO7 A;  3ZQQ A;  1DU0 A;  2KIQ A;  3E5U A;  5KVR A;  3F8F A;  2EIN H;  2ZJ2 A;  3IC7 A;  3TMO A;  1J0R A;  2XGE A;  4M6X A;  4XSX F;  2CGP A;  3G73 A;  1ZEL A;  3L2U A;  1QRY A;  4GDF A;  2WB1 A;  3QPL A;  2F4I A;  2LSO A;  1P6R A;  2XAH A;  3C1D A;  3Q9S A;  4DGW B;  2NNY A;  3GEZ A;  1R7J A;  2ZXI A;  3HPH A;  5E3L A;  3SFZ A;  4OMY A;  2WV0 A;  2ZME C;  2VQC A;  1BIB A;  1YI2 I;  3QP5 A;  3FK7 A;  4XON A;  3SXY A;  5LGT A;  1ZRC A;  5L3G A;  2DTZ A;  4QTR A;  1JTX A;  2A05 A;  2FX0 A;  4OWR B;  5E8I A;  4KIT B;  2QSG X;  3BQZ A;  4L5E A;  3W2A A;  2W4S A;  3VYS B;  3VOE A;  2P8T A;  2LYC A;  3MFK A;  5B5E C;  4ZJZ A;  4IQJ A;  4HBL A;  3FKI J;  1X2M A;  2EK5 A;  2XSD C;  2ECB A;  4BQA A;  4BU2 A;  2ESN A;  4XLF A;  1W36 C;  3LST A;  4G6T B;  2EV6 A;  4XRS A;  1G3Y A;  1DUX C;  1ZR2 A;  4CUG A;  5L3B A;  2Q0O A;  2AXL A;  3H5A A;  3TED A;  2PJR B;  3HTU A;  2P81 A;  2DT7 B;  3PQK A;  1MMD A;  1R58 A;  2R7Q A;  1W5T A;  4S0H B;  4UVA A;  4A69 C;  1ZRD A;  2LVS A;  1IAW A;  1YW9 A;  2NOG A;  5TIS C;  3A4C A;  1WKM A;  3IAS 2;  4M3F A;  3E0J B;  2PJR A;  3RZO J;  4LLG F;  4AWX B;  1YJN I;  4GCV A;  4ZYG A;  3AFH A;  4EGY A;  4G7Z F;  2EV0 A;  3IH3 A;  1IUF A;  4A3B J;  4LLL A;  4LD5 A;  2XRN A;  2CFX A;  4NC7 A;  5LRS A;  5CKT A;  3F0C A;  4HSR A;  1J9I A;  2GIV A;  4PDK A;  4UVC A;  1U3E M;  5GP9 A;  4PK4 A;  1IV6 A;  3BG9 A;  5HLT A;  1I6H J;  1XSV A;  2AXT C;  4E70 A;  2L2O A;  3BG7 A;  2M0M A;  1KQ8 A;  4P55 A;  1YOV B;  3RTR A;  3PNV A;  1LE8 B;  2GM4 A;  1YRN B;  2LOO A;  3FMR A;  2RNJ A;  5EEH A;  4II3 A;  4ZDP A;  1IRZ A;  3A1Y A;  3KET A;  1XG1 A;  3CMY A;  2Z1D A;  2Z2S B;  1S6L A;  2VJI A;  4AVP A;  1JI8 A;  1RC9 A;  4BBS J;  2K27 A;  2DFI A;  3O2P E;  3RIR A;  1LVA A;  1YRN A;  3MZY A;  2FE3 A;  2JVG A;  3R0A A;  3ZMD A;  1YO5 C;  2XF7 A;  2EQR A;  1FSH A;  4IVN A;  4S04 A;  2GZW A;  2JVH A;  4HAM A;  3S2W A;  3DEU A;  5ILV A;  2DJN A;  5IT3 A;  3BOQ A;  3DWL E;  1VQ6 I;  5DCM B;  4JX5 A;  4RGR A;  1X1A A;  4RAG A;  4Q5S F;  4M9Z A;  2K5C A;  3HL2 A;  3OSF A;  2ZJQ F;  1QZY A;  3BLY A;  3EUA A;  4BUP A;  2RNG A;  2CMP A;  5L3E A;  5A2Q K;  2E7X A;  5C44 J;  5CQG A;  1IXC A;  3LFK A;  1IN4 A;  4KYW A;  2KFD A;  4FX4 A;  3UR3 C;  3GTK J;  2RRE A;  2XUB A;  3CMM A;  5TJJ A;  5D6F A;  5DCM A;  4WCG A;  4IXA A;  4W1U A;  2M4K A;  2W85 A;  2H1L A;  3Q0U A;  4PUS A;  4AU7 A;  2X1C A;  2XB0 X;  3DU5 A;  3MKL A;  2P4W A;  5K5O A;  2BY3 A;  4EJW A;  4KDP A;  1ETK A;  1YX3 A;  2M7B A;  4R1H A;  4XLN F;  1IV8 A;  3BJA A;  2LKX A;  1K61 A;  4RGU A;  1JKP C;  1X2N A;  4DBR A;  1X1D A;  1XGM A;  3VPR A;  3H1C A;  3JAM R;  3LWF A;  1WPK A;  1IRF A;  3JRC A;  3OS1 A;  4MIM A;  5CVU A;  2E1N A;  4B8X A;  3ERM A;  3CUQ C;  1YHQ I;  3H3V K;  1TQI A;  1OCO H;  1TNS A;  2ECC A;  1BW5 A;  2P5V A;  2CQ7 A;  2L0K A;  2WBM A;  4U87 A;  3PM1 A;  1AOY A;  5D8L B;  3QWL A;  3CF2 A;  1BA5 A;  4RGS A;  5B3S H;  4M3G A;  5HLI A;  5DS9 A;  2RAE A;  3CJQ B;  1X1C A;  3GFJ A;  4HLY A;  1IJW C;  4ENK A;  3FK6 A;  1JGG A;  2ISY A;  1MW7 A;  5IYD J;  1QA6 A;  3C2G A;  1P7J A;  4LLN A;  2KDO A;  5M5Y J;  3PFY A;  3LSM A;  2GLO A;  3MEX A;  3H3U A;  5GAG J;  2ETH A;  3HKZ A;  1SAN A;  1O3Q A;  3AL0 B;  4KMU X;  2M9H A;  5KAF C;  5BNG A;  5E3N A;  2ZXH A;  1FSE A;  2P7C B;  3ZQL A;  3A0H C;  2FBH A;  1VQ9 I;  1RET A;  5FLX Z;  2HQN A;  4IHY A;  2TRT A;  2OCE A;  3PNT A;  5HLH A;  3WG7 H;  3DPL C;  3F8N A;  5CVV A;  2F5E A;  1MSF C;  3BWG A;  1ZRE A;  2VL8 A;  2VOP A;  2XGD A;  1Y56 A;  4XIC A;  1DGR M;  3T8R A;  2DDA A;  2KIM A;  3BR3 A;  4XKC A;  4IRG A;  4G7H F;  1U5T A;  2H6C A;  1CF7 B;  3WE2 A;  1VQL I;  2DFF A;  2KPM A;  1OCT C;  1DDN A;  3K70 C;  1ITY A;  1OR7 A;  2JSC A;  4S05 A;  3G6E I;  2O03 A;  2VQH A;  3A01 B;  4BXX J;  3ZRG A;  4PJ0 C;  1QO0 D;  1SC7 A;  3CCE I;  2HTS A;  3MKZ A;  5FJ8 J;  2HYF A;  2OQR A;  2ZC2 A;  1CF7 A;  2M8G X;  4JYK A;  3H36 A;  4KIC A;  2W00 A;  1D0Z A;  2M5W A;  2XKP A;  2BEO A;  4CCO A;  3WTY C;  3DV8 A;  2IS1 A;  2CUJ A;  2LC2 A;  1ZGJ A;  4PJL A;  2XSJ C;  5EG0 B;  3ROU A;  3OS0 A;  2JA8 J;  4BL0 B;  5FD5 A;  3A01 A;  4NQW B;  3W6V A;  3ZN1 A;  1UJ8 A;  2MW8 A;  4KMF A;  1KYZ A;  3PO3 J;  2VE8 A;  4NC8 A;  4DJA A;  2NRA C;  3H0G J;  5K7H A;  5IP9 J;  2MYS A;  2OF7 A;  2D45 A;  2IGN A;  4JOM A;  5EG0 A;  4WWC A;  1NG6 A;  2DK8 A;  3ABK H;  3HRM A;  3JRD A;  2STT A;  3CC4 I;  2YUS A;  5DUK A;  3RKW A;  3BPV A;  4NQW A;  2CV2 A;  5CVR A;  2XAJ A;  1FYM A;  1Z1D A;  3U1K A;  3J7A O;  3FXQ A;  2LD5 A;  1U9N A;  3S3O A;  3RJP A;  3GFI A;  1WRJ A;  1N78 A;  1VF9 A;  3HBL A;  3ZR8 X;  3QU6 A;  3UKG A;  2EZL A;  3BTL A;  2CU7 A;  3M4O J;  2PMH A;  3RPQ A;  2QCO A;  5FB2 A;  5L3C A;  4MHG A;  1IN5 A;  2GOX B;  2OD5 A;  2CW7 A;  1X4P A;  1Y6I A;  2E2H J;  1VQN I;  4IHT A;  2UUZ A;  3RSN A;  1O7L A;  2MLG A;  1Z21 A;  2ZNZ A;  4M9X A;  3ZCO A;  2HEO A;  3FHN A;  2EBI A;  1IN8 A;  2GXA A;  1P9Q C;  2JK3 A;  3GLL A;  2E2I J;  4KIG A;  2Z99 A;  1X58 A;  5E8G A;  1Z9C A;  3W2V A;  1UHM A;  4L18 B;  5LFA A;  4RAF A;  3BJO A;  2DXI A;  4EV0 A;  5F1R A;  1V5F A;  3WTU C;  4N9I A;  3FXO A;  1SVM A;  1JTY A;  2HNH A;  4JBA A;  1MIJ A;  2LKS A;  5F04 A;  3WTX C;  1HST A;  2FBI A;  2Q2E B;  3N97 A;  2BVL A;  2RVC A;  1IN6 A;  3WTS C;  3EPZ A;  4CO8 A;  4LMY A;  2MG4 A;  1G6N A;  3ECH A;  5B66 C;  1ETQ A;  4UUS B;  2R7R A;  1VQ4 I;  2VBY A;  4IPA A;  1SD7 A;  2GA1 A;  2HZT A;  2IGK A;  3V7R A;  3TO6 A;  2LRD A;  1IG7 A;  4OIO F;  2Q2E A;  2ESH A;  3VYT B;  4U7D A;  3DP7 A;  5HS9 A;  1W36 D;  2RQP A;  3PL8 A;  3PQJ A;  2LP0 A;  2VC0 A;  1FZP B;  3J80 R;  1S72 I;  3GUD A;  1QGP A;  2HXO A;  5J4Y A;  4UUS A;  2L5Q A;  1B9N A;  4XNF A;  1S3J A;  1TTY A;  2KKO A;  2Z5U A;  1V5E A;  4MEY F;  3OIP A;  4M6V A;  2IEK A;  3GBG A;  3VB2 A;  3DFG A;  3KIO A;  4ZYH A;  3A2K A;  1HA8 A;  2BBY A;  1H88 C;  3HB9 A;  2PX9 A;  2VUM J;  1RIO H;  3VOD A;  3BZC A;  2A69 F;  3KLN A;  2W48 A;  3B02 A;  1MKM A;  3QPT A;  3S16 J;  3Q0V A;  2QZ8 A;  2AHQ A;  3TDZ C;  4C2U A;  2QUF A;  3K10 A;  3IH2 A;  3I56 I;  1LJ9 A;  1XS9 A;  1B9M A;  2IA0 A;  2DMN A;  4DOZ A;  5F27 A;  2JA5 J;  3ZQI A;  3QYB A;  3W3C A;  4NC6 A;  1SEU A;  2K85 A;  1SVO A;  3S93 A;  5JLX A;  3O8H A;  1ZG3 A;  2EFP A;  2FRH A;  3QYF A;  4MLO A;  3HGY A;  3K2A A;  4DYR A;  3JRI A;  1ERD A;  2QLZ A;  3GXO A;  5EEG A;  5K7Z A;  4HW0 A;  3S2D J;  5JHF A;  2JMW A;  3Q0W A;  3OYH A;  1FOW A;  3OL3 A;  3L2W A;  3KZI C;  2CV1 A;  4LB5 A;  5E3M A;  1Z7U A;  2WV1 A;  3DCF A;  4IEJ A;  3R4K A;  5EZG A;  2BHY A;  2DA1 A;  2KRH A;  3ZOB A;  1X3W B;  3NWT A;  4YIR X;  5K7F A;  1HF0 A;  1TQP A;  5F0C A;  2L9V A;  2KRF A;  2YSR A;  4I2O A;  4UB6 C;  2R5Y B;  3SDB A;  5FKL A;  3OR1 C;  2ZSH B;  1I3A A;  2E1M C;  2KP6 A;  1U6G A;  4JP0 A;  2HU9 A;  5HOO A;  2W24 A;  3JRH A;  5ILS A;  1TWH J;  2J5O A;  2MGQ A;  3DKX A;  4JK1 X;  4NUB A;  1HC8 A;  3CQZ J;  4MGR A;  3WU2 C;  3BJ6 A;  1KU9 A;  2DLL A;  3LMM A;  5J1U A;  3DBR B;  3DEW A;  2LRE A;  2R5Y A;  1Z3X A;  2XF5 A;  1W0T A;  1MD0 A;  5CYV A;  1V4R A;  5AIP A;  5DCF A;  1X1P A;  4CCM A;  4O5V A;  3LL7 A;  1E2X A;  1GV5 A;  4E7J A;  3V8K A;  1WJB A;  5K1Y A;  2FMY A;  2FNA A;  3U21 A;  2P7V B;  1RI7 A;  3WGG A;  3H5N A;  1FJL A;  4Y3O A;  2VT3 A;  1KGS A;  4B44 A;  4KN7 X;  1D0Y A;  3CLO A;  5J40 A;  1K4T A;  2JUC A;  4GYG A;  3W2W A;  2NS0 A;  1VQK I;  5HNF A;  3K6G A;  1W7P D;  4E7Z A;  1JHH A;  2HOA A;  4XN0 A;  2ZBK A;  4UNO A;  2IT0 A;  5CQE A;  1Y1W J;  5HNH A;  2ISZ A;  4M72 A;  1L0O C;  1FOK A;  2G7U A;  2R7F A;  4Q4Z F;  2MD5 A;  3LSG A;  3SFI A;  3C2B A;  1XGO A;  2DCE A;  2DOE A;  2O5R A;  5CVI A;  3IL2 A;  3HOS A;  5DUI A;  2E7W A;  1Z77 A;  4L0Z B;  1MBH A;  3H3Z A;  4FE4 A;  4PSX A;  1K4S A;  1FYK A;  3DTI A;  2HKO A;  3RYR A;  2MZ4 A;  4PSW A;  1FYL A;  2QSF X;  2K9M A;  4U88 A;  1W5C C;  5K5Q A;  4D7M A;  2ZKZ A;  1XDS A;  3E6C C;  3LA2 A;  3S2H J;  1BR1 A;  2M7A A;  3HOU J;  2VBX A;  1ONV A;  1LDJ A;  3ASN H;  3RKX A;  1C0W A;  4UY8 I;  2AQF A;  4CCL A;  1KYW A;  2HTJ A;  5CJ9 A;  5F08 A;  4XKB A;  3JAM Z;  1W4M A;  1UHW A;  2JPC A;  2RGV A;  3A52 A;  2O61 A;  1GHC A;  3FF5 A;  4LGW A;  1QU3 A;  2KT0 A;  2L7M P;  1XGS A;  4H0E A;  4YEL A;  3CME I;  3WGH A;  1J75 A;  4UV8 A;  3K4K A;  1GVD A;  4EQQ A;  4DBQ A;  1ZRF A;  3OYB A;  2IBD A;  5KHD A;  3GVA A;  1RNL A;  2CQN A;  2DA2 A;  2BY0 A;  4CGZ A;  1JT6 A;  2P6S A;  3Q3S A;  3DTK A;  3I4P A;  3M7G A;  3EUH C;  2I10 A;  1G8X A;  2BY1 A;  2KRC A;  4MFD A;  1MDM B;  1H8A C;  3J81 R;  2CSO A;  4EVI A;  2V1U A;  2FML A;  3JRE A;  3GTQ J;  1D3Y A;  1UEL B;  2ELJ A;  1JKR C;  2X6Y A;  1ZR4 A;  2M2E A;  3G1L A;  1ZAO A;  4IHX A;  1G3T A;  1MDM A;  1IZ1 A;  3QOE A;  3H0D A;  3HG9 A;  1XDU A;  3IWZ A;  4E7L A;  3TP3 A;  4NHJ A;  2L02 A;  4NDL A;  5F6F A;  3S3M A;  1GLN A;  1D1A A;  2DA6 A;  3BR1 A;  1PP7 U;  3IKT A;  2HDD A;  2O8K A;  1G2H A;  1I6X A;  1QVU A;  1T8I A;  4DW6 A;  2BVM A;  5IT9 K;  3QYE A;  4RDU A;  4FQG A;  2ADU A;  2HVR A;  1VQP I;  3LAJ A;  4CDG A;  5ED4 A;  1SFO J;  1IUY A;  2OA4 A;  4M3D A;  3DPT A;  4PJM A;  1IXS B;  3E5X A;  2DQR A;  1S9H A;  4A3I J;  1R00 A;  3KCC A;  1BL0 A;  2VKH A;  3FIS A;  4N9H A;  5J3L A;  2UV1 A;  2NVQ J;  2LDU A;  3F8M A;  2L9N A;  1FIA A;  1OCP A;  5E17 F;  5A2Q R;  5HDN A;  1YQA A;  2FQ3 A;  2B9S A;  4Y52 J;  2KLO A;  4A6D A;  2JRM A;  2QQ8 A;  2ZO4 A;  2K7L A;  2WAE A;  1B59 A;  5DEQ A;  3K1N A;  3KP5 A;  2ZCW A;  4HOB A;  2X51 A;  3BZK A;  1HKQ A;  1BI2 A;  2DA7 A;  2HXI A;  3DBH B;  1ACI A;  2DQL A;  2OCC H;  3NQO A;  3F21 A;  1W0U A;  3DTE A;  3HOW J;  4HF1 A;  3HSR A;  3LSR A;  4KNY A;  1A6I A;  3S32 A;  3G1M A;  4QLC U;  4IKF A;  2DTR A;  2XAG A;  4M71 A;  5E1X A;  2YPR A;  2UXN A;  5E3O A;  1FBS A;  1FP2 A;  1HW1 A;  3TBI A;  2DPU A;  3M3Y J;  1ON1 A;  4QPQ A;  5DTD A;  1W7P B;  4ESF A;  3AAF A;  2AO9 A;  2EIM H;  1Y0U A;  5D5X B;  4IOA F;  2VB6 A;  1SD4 A;  1ZYR F;  3KP7 A;  2CO5 A;  2P5K A;  3I58 A;  2B63 J;  3TO9 A;  3MN2 A;  4KJZ A;  4A12 A;  2X85 A;  3RQ4 A;  1WZ2 A;  1HQC A;  3HRS A;  4H4K C;  3P9K A;  4BBR J;  2NVT J;  4F3Q A;  3KPH A;  1W7P A;  3KYC B;  2LG4 A;  1MNM C;  4N0B A;  2IRF G;  1WJC A;  4YFK F;  1VFC A;  1MNE A;  1N75 A;  1G3W A;  2FOK A;  3R60 A;  2HI3 A;  3I0T A;  4EMS A;  2WWY A;  2V7F A;  2YS9 A;  4L9V A;  2K3F A;  4BJ5 C;  1PDN C;  3F72 A;  2F4O B;  1FPQ A;  3P9C A;  5FD6 A;  1YIT I;  4X6A J;  2CQK A;  1RR7 A;  1KQ0 A;  1U78 A;  1YIJ I;  1WCM J;  3WE3 A;  2EB7 A;  2VN2 A;  1BN5 A;  3ZXS A;  2DPD A;  2M8E A;  2RV8 A;  4NBQ A;  1OYW A;  3ZMV A;  2W1O A;  2VJ5 A;  2KIU A;  3KZY A;  2CG4 A;  1UAA A;  2ZJR F;  5FLV A;  4RM3 A;  3I3L A;  4UB8 C;  2QEN A;  2MVT A;  2YX4 A;  4WXD A;  4DYC A;  2UZK A;  4IX7 A;  1FP1 D;  5DM6 F;  4JQF A;  1TQM A;  2VIX A;  5EGO B;  1U2W A;  4DIQ A;  1UFM A;  1O4X A;  3J80 Z;  3BY6 A; 
#chains in the Genus database with same CATH homology
 3K1M A;  1R1U A;  1YW8 A;  3K1P A;  2PN6 A;  3MWM A;  5FLX K;  5FFZ A;  2Q8K A;  2H27 A;  1CGP A;  1IN7 A;  2K02 A;  1T2K A;  3KZZ A;  1XD7 A;  1FLI A;  1PP8 F;  1RZ4 A;  3KP3 A;  3JW4 A;  1LNW A;  2XIG A;  4PCQ A;  3TQN A;  4EJU A;  2E1C A;  3C18 A;  1XMA A;  2NAZ A;  2G7H A;  1S7A A;  4U7B A;  2Z33 A;  1BI1 A;  4MNU A;  4D0P A;  4EJO A;  1YFH A;  2Z9O A;  2BGC A;  3MCZ A;  1FX7 A;  4LG0 A;  2F5C A;  2K4B A;  1EV7 A;  3CJN A;  4DQ2 A;  2Y75 A;  3TDU C;  2PI0 A;  1S7O A;  3T5X A;  2G9W A;  1D8K A;  1O3T A;  2BE5 F;  1XB4 A;  1STZ A;  4HQE A;  1R5H A;  3HOT A;  3O3K A;  1MJ9 A;  4Z2Y A;  5D5U B;  1ZN2 A;  3FM3 A;  3HSF A;  4M6Y A;  3OV8 A;  4P96 A;  3KFW X;  1U8R A;  3WU1 B;  3WG9 A;  2XAQ A;  3HUG A;  3M1E A;  2DW4 A;  3M8F A;  4FHT A;  2ELH A;  3DF8 A;  2ACJ A;  1J5Y A;  4P5O A;  3FXR A;  5BS6 A;  4MTE A;  1QZZ A;  5CVJ A;  2VOO A;  4UV9 A;  2LF8 A;  2RN7 A;  2OZ6 A;  4OIN F;  4OIQ F;  1G4D A;  3K0L A;  1U5T B;  1WWX A;  3FHZ A;  3ABT A;  3FX3 A;  2H09 A;  3T1B A;  1F4K A;  2HR3 A;  1YG2 A;  3BRO A;  2X0L A;  1SFE A;  1W5S A;  3J81 Z;  1WQ2 A;  3ULQ B;  5BQT A;  4XBF A;  5JR3 A;  2YX7 A;  3TOA A;  5HS8 A;  3H92 A;  3U2R A;  1HKT A;  4YII A;  2IJL A;  1IW7 F;  5HVQ C;  1DP7 P;  1ULY A;  2HGC A;  4I01 A;  3L00 A;  4WF2 A;  3FXU A;  3HIF A;  2F2E A;  1K78 B;  5H6Q A;  4LJZ F;  3E6D A;  3GW2 A;  4ETS A;  2LNB A;  3F3X A;  3U9G A;  1LDK B;  1YIO A;  5D4S A;  3FMQ A;  2FNP A;  2FF4 A;  4A5N A;  2K4J A;  4GXO A;  3QP6 A;  4A5M A;  1K78 A;  1I27 A;  2K86 A;  3D5L A;  5AIQ A;  1D8J A;  3EYI A;  3Q9V A;  4LFU A;  1TNT A;  1TW3 A;  3LQR A;  2C6Y A;  5A2Q Z;  1R23 A;  1XN7 A;  2IVM A;  2W84 A;  5H6R A;  1YW7 A;  5ICG A;  1YTY A;  2V6C A;  5ERI A;  1E17 A;  3EDP A;  1B6A A;  3MAJ A;  3OOP A;  4Y15 A;  3NEU A;  2GAU A;  2R7D A;  3GFM A;  2M45 A;  1ZLK A;  2O3F A;  3KP6 A;  4LK1 F;  5E20 A;  1ZAR A;  1JXS A;  4WX9 A;  3QRF F;  1WSU A;  5F64 A;  3ZMU A;  2BV6 A;  3JTH A;  3GWZ A;  2M87 A;  2F5F A;  2VOD A;  2HS5 A;  3GO5 A;  4Y13 A;  4Q48 A;  1Q1H A;  3HHG A;  3HRT A;  2OU2 A;  5HS7 A;  2Y48 A;  3L2C A;  2KJC A;  5HDG A;  1USS A;  4UXN A;  1J2X A;  3E6M A;  4G6Q A;  3R61 A;  3ERE D;  2O8X A;  2YR2 A;  2P5L C;  1YS7 A;  1QPM A;  1XMK A;  5LGN A;  4FX0 A;  2V1D A;  3GZ6 A;  5D8K B;  2D1H A;  3EUH A;  2ZNY A;  4OOI A;  2XGX A;  1R5G A;  5JFR A;  5L3F A;  2EJR A;  1I1G A;  2XAF A;  3C7J A;  2MA3 A;  3EET A;  2IP2 A;  2GQQ A;  2LF7 A;  2RDP A;  4BH9 A;  4YFX F;  1ZG5 A;  1KU3 A;  2IA2 A;  3M8E A;  4RB2 C;  4Y17 A;  2L54 A;  4ZZL A;  4KFC A;  1Z6R A;  3RI4 A;  3W6K B;  3WU0 A;  2OZU A;  3LAP A;  3EQL F;  3KP4 A;  1IF1 A;  2PLY A;  1O3S A;  1LDD A;  4HLX A;  2W57 A;  1RUN A;  4KA4 A;  5DV5 A;  1I5Z A;  2QQ9 A;  2HWV A;  4P9U A;  2DT5 A;  1P92 A;  2ZFW A;  3ZMZ A;  3FWE A;  1OPC A;  2ZME B;  5LRR A;  5BPD A;  3T0Y A;  1H0M A;  5AON A;  2D2W A;  1BI0 A;  2CWE A;  3VFZ A;  2EV5 A;  4DNC A;  1B1B A;  4A0Z A;  2ZME A;  3E6B A;  2OAZ A;  1I1S A;  3I64 A;  4LK0 F;  1F9N A;  1TBX A;  3NRV A;  4ZYE A;  4XSZ F;  2RKH A;  4HA8 A;  1FNN A;  3P7N A;  4Q47 A;  2DU9 A;  4ZH4 F;  1SAX A;  1Z6T A;  4A0X A;  3KE2 A;  3LQQ A;  5JHU A;  2LKP A;  3I53 A;  1ODD A;  3F22 A;  2OQG A;  2V79 A;  2V9V A;  1SMY F;  4HDV A;  3LA3 A;  3WTT C;  5D5W B;  1XCB A;  4BHP A;  4G9Y A;  2B0L A;  4CZZ A;  5LGU A;  3F23 A;  1BI3 A;  1XGN A;  5DYM A;  4A2U A;  3RYP A;  4ESJ A;  2GXG A;  1JE8 A;  1JHF A;  3LA7 A;  3K69 A;  1DPU A;  1JGS A;  1GVJ A;  2GWR A;  3TKY A;  1A04 A;  1RUO A;  3I54 A;  4XLP F;  3DQV C;  4BNC A;  1HKS A;  4CXF A;  5J8F A;  1D5V A;  4B09 A;  2GA2 A;  3ABU A;  3GFL A;  4ON0 A;  2DI3 A;  3F8C A;  4KIB A;  1UST A;  2A68 F;  2M1B A;  1QNT A;  5FO5 A;  2STW A;  1FWZ A;  2CW0 F;  2QVO A;  3IRR A;  1S8N A;  4HZF A;  3CO6 C;  5JI6 A;  5BOX A;  1XSD A;  5FFX A;  5D4R A;  2A6E F;  2PBI A;  3V7C A;  2JZY A;  1T6S A;  3G3Z A;  3IWF A;  1K7A A;  2DO7 A;  3CUQ B;  1BM9 A;  2M30 A;  1PUE E;  5DD8 A;  2L3D A;  4HV6 A;  4EM0 B;  3ZMS A;  5E1W A;  3TGN A;  1J59 A;  3QPH A;  4RB3 C;  3CTA A;  1OYY A;  1YLF A;  2VT2 A;  3CUQ A;  3DXJ F;  4R79 A;  2HOE A;  3K9T A;  1OMI A;  3BPX A;  2WC2 A;  5BPI A;  3KLO A;  4F7Z A;  4ENM A;  4WXH A;  2A07 F;  2L01 A;  3M9A A;  1VTN C;  1DPR A;  1HW5 A;  1ZH5 A;  2YU3 A;  3JSP A;  3K2Z A;  2F5D A;  4L9J A;  3P9I A;  1EH6 A;  4IRI A;  3ML6 A;  4O6J A;  1BBY A;  2R3S A;  3R0J A;  4WK8 F;  3RDI A;  2FBK A;  4EM2 A;  3N4M A;  5LEJ A;  4HV5 A;  4QWQ A;  2CYY A;  2W25 A;  2HFH A;  3CO7 C;  4FT8 A;  3HHH A;  4CHU A;  4I02 A;  5K5R A;  3J81 K;  3KEO A;  4IF4 A;  2V1X A;  4LB6 B;  1P4X A;  4GYI A;  1B4A A;  5IT9 Z;  3KEQ A;  2PFB A;  1LEB A;  1BJA A;  1IRG A;  2MH9 A;  2MC3 A;  1MGT A;  5LHH A;  3E5Q A;  1G3S A;  4HF2 A;  5TRD A;  2TDX A;  1BOA A;  4I98 B;  4LG0 B;  3ZMT A;  4BHB A;  4K2E A;  3ELK A;  5FGM A;  1XSX A;  3I71 A;  2EFO A;  1P4W A;  1Z05 A;  2ZXJ A;  1GXQ A;  2MLK A;  2P6T A;  1O3R A;  5D6E A;  1FBU A;  3MQ0 A;  1ON2 A;  5E1Z B;  4OMZ A;  4AIK A;  3HSE A;  4O3M A;  2MH2 A;  3WTW C;  1T98 A;  4HX8 A;  5JVT A;  4UUV A;  3KP2 A;  1UCR A;  4RS8 A;  1EH8 A;  1BC8 C;  1SD6 A;  5E18 F;  2PMU A;  2IPQ X;  4IJA A;  4OU0 A;  3MZH A;  1F5T A;  4KN4 X;  2UWM A;  3FM5 A;  2MBF A;  2H94 A;  2VXZ A;  1HSJ A;  4RGX A;  4KIF A;  1TW2 A;  2FU4 A;  3TOB A;  2IA1 A;  4I09 A;  5J6X A;  4A0Y A;  1S29 A;  3QOP A;  2PG4 A;  3SQN A;  4EM1 A;  4HX4 A;  4IRH A;  4ZYD A;  1T0F A;  3ISP A;  1SFU A;  1MJA A;  4U0V A;  2RC4 A;  4R8H A;  1QQI A;  5D5V B;  4I7H A;  4TV7 A;  5LHI A;  3REO A;  4RB0 A;  4UHT A;  2EFQ A;  4ENN A;  1R22 A;  4CIC A;  1O7F A;  3BDD A;  3DKW A;  4HQM A;  4XRF A;  4ESB A;  2QM3 A;  5DD4 A;  1K6O A;  3V7S A;  1TLH B;  3C3W A;  4U0Y A;  4HX7 A;  4WXC A;  3W6J B;  4YIF A;  1F1Z A;  4KUM A;  2HKX A;  3D0S A;  1BC7 C;  2QBY B;  3B73 A;  4OIR F;  5BMZ A;  5DDG A;  3ZQ7 A;  3ZN0 A;  1MJB A;  5ILU A;  4MQ9 F;  1GXP A;  4YG2 F;  4EJV A;  4A6E A;  4L9T A;  4RAY A;  1NHA A;  4U0W A;  1KQ9 A;  2QBY A;  2GXB A;  2HYG D;  4RAZ A;  3T8T A;  4ZZD A;  3L7W A;  6PAX A;  2EA4 A;  3E97 A;  2QYO A;  3R6S A;  1REP C;  3HRU A;  2D1V A;  1H9G A;  1J7K A;  3VEP A;  2A6H F;  3I59 B;  1KA8 A;  2XV4 S;  5H20 A;  4L5I A;  2UXX A;  2FSW A;  1HXD A;  3F6O A;  3WTZ A;  1K79 A;  1O57 A;  3V8J A;  3COA C;  2DAO A;  3IHU A;  1R1T A;  3I59 A;  3V4G A;  4RB1 A;  2PJP A;  3JAM K;  1KU7 A;  4PGG A;  5LHG A;  1OYI A;  4M9S A;  4KT5 C;  2WTE A;  3PFI A;  2A5Y B;  3IRQ A;  1ZHF A;  4AD9 A;  3WGI A;  3TO7 A;  1V3F A;  3HYI A;  2FXA A;  2JRT A;  3GZ5 A;  2KIF A;  4I0B A;  2L4M A;  4MQV A;  2NYX A;  3F8B A;  3RPU A;  3GF2 A;  3E3V A;  5ICF A;  4EGZ A;  1U5T C;  3QU3 A;  2XVC A;  2EA2 A;  3V8L A;  3F6V A;  1H9T A;  2O0Y A;  2OBP A;  1FT9 A;  1IXR C;  2DK5 A;  1EH7 A;  2PEX A;  3HTS B;  3Q5F A;  2FEZ A;  3O6B B;  3JTG A;  4G94 A;  4G6D A;  2XAS A;  2HDC A;  1FBQ A;  4L0Y B;  1YS6 A;  2EFN A;  5HDK A;  4MEX F;  3WOD F;  1HW2 A;  1R1V A;  3GLX A;  1ZG1 A;  5ICE A;  3FZV A;  4P9F A;  1MZB A;  4BAY A;  3FMS A;  3GX4 X;  4ENJ A;  2XKO A;  1LQ1 A;  2A3S A;  1WI9 A;  3QAH A;  4L5J A;  2QQA A;  2VBW A;  4M74 A;  1ZGA A;  2AS5 F;  4EJT A;  4OIP F;  3EYY A;  4HF0 A;  1SMT A;  1T39 A;  3SZT A;  1SD5 A;  1XCV A;  2EFW A;  3JSO A;  3SZP A;  1P2F A;  2FA5 A;  1Z91 A;  4IHS A;  3WTV C;  2COM A;  4PZJ A;  3U1D A;  3RKY A;  1FY7 A;  3ECO A;  4PGH A;  1T38 A;  3ZPL A;  4G7O F;  4BYY A;  4HYE A;  4CYD A;  2NNN A;  2XHK A;  2JTV A;  5LBQ A;  4MTD A;  5LLQ A;  5CLS A;  1OKR A;  1LB2 A;  5LEK A;  1AWC A;  2H6B A;  4I0A A;  3IKV A;  2VE9 A;  3SHF A;  1SFX A;  3J80 K;  2PQ8 A;  1YYV A;  1QBJ A;  2QWW A;  3I5U A;  2DBB A;  2J5P A;  2X4H A;  4GGG A;  2BYV E;  4G8X A;  4ASN A;  1KU2 A;  4L9N A;  4HDU A;  2EWN A;  1X3U A;  1FC3 A;  3L9F A;  2Y0M A;  3ZP5 A;  2IW5 A;  3CUO A;  3BZ6 A;  3CDH A;  4NB5 A;  1P4A A;  2JT1 A;  4YFN F;  5ICC A;  1HBX G;  3L09 A;  5J8C A;  2Z3Y A;  1R36 A;  4GO1 A;  2VBZ A;  5KK1 A;  5L3D A;  5HLG A;  2XRO A;  1UB9 A;  4UVB A;  2QQB A;  2VC1 A;  2JPB A;  1L3L A;  2HQR A;  1LEA A;  4BHC A;  2O6G E;  2A61 A;  1ZLJ A;  3BP8 A;  4AIH A;  4M73 A;  2VON A;  2L4A A;  4BXU A;  2KJB A;  4AIJ A;  1BIA A;  3GYH X;  3E5U A;  5KVR A;  3F8F A;  2ZJ2 A;  3IC7 A;  1J0R A;  4M6X A;  4XSX F;  2CGP A;  3G73 A;  2LSO A;  3C1D A;  1P6R A;  2XAH A;  2NNY A;  3Q9S A;  3GEZ A;  1R7J A;  3SFZ A;  4OMY A;  2WV0 A;  1BIB A;  3QP5 A;  3SXY A;  5LGT A;  1ZRC A;  5L3G A;  5E8I A;  3VOE A;  2P8T A;  3MFK A;  4HBL A;  2EK5 A;  4BQA A;  2ESN A;  3LST A;  2EV6 A;  1G3Y A;  1DUX C;  5L3B A;  2Q0O A;  2AXL A;  3HTU A;  3PQK A;  1R58 A;  1W5T A;  4UVA A;  1ZRD A;  1IAW A;  1YW9 A;  1WKM A;  4LLG F;  4AWX B;  4GCV A;  4ZYG A;  4EGY A;  4G7Z F;  2EV0 A;  4LLL A;  4LD5 A;  2XRN A;  2CFX A;  5LRS A;  1J9I A;  2GIV A;  4PDK A;  4UVC A;  1U3E M;  1XSV A;  4E70 A;  1KQ8 A;  4P55 A;  3RTR A;  3FMR A;  2RNJ A;  5EEH A;  3KET A;  1S6L A;  4AVP A;  2K27 A;  2DFI A;  3O2P E;  3RIR A;  1LVA A;  3MZY A;  2FE3 A;  3R0A A;  3ZMD A;  1YO5 C;  1FSH A;  4IVN A;  4S04 A;  2GZW A;  4HAM A;  3S2W A;  3DEU A;  5ILV A;  5IT3 A;  3BOQ A;  5DCM B;  4RGR A;  4Q5S F;  4M9Z A;  1QZY A;  5A2Q K;  5L3E A;  2E7X A;  1IXC A;  3LFK A;  1IN4 A;  4KYW A;  4FX4 A;  2XUB A;  5TJJ A;  5D6F A;  5DCM A;  4WCG A;  4IXA A;  2W85 A;  5K5O A;  2P4W A;  4EJW A;  4KDP A;  4R1H A;  4XLN F;  3BJA A;  4RGU A;  1XGM A;  3LWF A;  1IRF A;  5CVU A;  2E1N A;  4B8X A;  3CUQ C;  1TQI A;  1TNS A;  2P5V A;  1AOY A;  5D8L B;  4RGS A;  5HLI A;  3GFJ A;  4HLY A;  4ENK A;  2ISY A;  4LLN A;  3MEX A;  3H3U A;  2ETH A;  1O3Q A;  4KMU X;  1FSE A;  2P7C B;  2FBH A;  5FLX Z;  2HQN A;  5HLH A;  3DPL C;  3F8N A;  5CVV A;  2F5E A;  3BWG A;  1ZRE A;  2VOP A;  3T8R A;  2KIM A;  4IRG A;  4G7H F;  1U5T A;  2H6C A;  1CF7 B;  3WE2 A;  1DDN A;  1OR7 A;  2JSC A;  4S05 A;  2O03 A;  1QO0 D;  2HTS A;  2HYF A;  2OQR A;  1CF7 A;  4KIC A;  2M5W A;  2XKP A;  2BEO A;  3WTY C;  3DV8 A;  1ZGJ A;  3ROU A;  5FD5 A;  3ZN1 A;  4KMF A;  1KYZ A;  2VE8 A;  2NRA C;  2D45 A;  4WWC A;  2DK8 A;  3HRM A;  2STT A;  5DUK A;  3RKW A;  3BPV A;  4NQW A;  5CVR A;  2XAJ A;  1FYM A;  1Z1D A;  3J7A O;  3FXQ A;  3RJP A;  3GFI A;  1WRJ A;  3QU6 A;  2PMH A;  3RPQ A;  5FB2 A;  5L3C A;  4MHG A;  1IN5 A;  2OD5 A;  4IHT A;  1O7L A;  2MLG A;  2ZNZ A;  4M9X A;  2HEO A;  1IN8 A;  4KIG A;  2Z99 A;  5E8G A;  1Z9C A;  1UHM A;  4L18 B;  3BJO A;  4EV0 A;  5F1R A;  3WTU C;  4N9I A;  4JBA A;  3WTX C;  1HST A;  2FBI A;  3N97 A;  2RVC A;  1IN6 A;  3WTS C;  4CO8 A;  4LMY A;  1G6N A;  3ECH A;  2VBY A;  4IPA A;  1SD7 A;  2GA1 A;  2HZT A;  3V7R A;  3TO6 A;  4OIO F;  2Q2E A;  2ESH A;  4U7D A;  3DP7 A;  5HS9 A;  2RQP A;  3PQJ A;  2VC0 A;  1FZP B;  3GUD A;  1QGP A;  1B9N A;  1S3J A;  1TTY A;  2KKO A;  2Z5U A;  4MEY F;  3VB2 A;  3DFG A;  4ZYH A;  2BBY A;  1RIO H;  3VOD A;  3QPT A;  2A69 F;  3KLN A;  3B02 A;  1MKM A;  2QZ8 A;  3TDZ C;  2QUF A;  1LJ9 A;  1B9M A;  2IA0 A;  1ZG3 A;  2EFP A;  2FRH A;  2QLZ A;  3GXO A;  5EEG A;  4HW0 A;  4LB5 A;  1Z7U A;  3R4K A;  1TQP A;  2KRF A;  2YSR A;  4I2O A;  1U6G A;  5HOO A;  2W24 A;  5ILS A;  2J5O A;  4JK1 X;  4MGR A;  3BJ6 A;  1KU9 A;  2DLL A;  1MD0 A;  5CYV A;  1V4R A;  5AIP A;  5DCF A;  4O5V A;  1E2X A;  3V8K A;  5K1Y A;  2FMY A;  2FNA A;  2P7V B;  1RI7 A;  3WGG A;  2VT3 A;  1KGS A;  4KN7 X;  3CLO A;  4GYG A;  2NS0 A;  1W7P D;  1JHH A;  2ZBK A;  4UNO A;  2IT0 A;  2ISZ A;  4M72 A;  1L0O C;  1FOK A;  2G7U A;  2R7F A;  4Q4Z F;  2MD5 A;  1XGO A;  3IL2 A;  5CVI A;  3HOS A;  5DUI A;  2E7W A;  4L0Z B;  3H3Z A;  1FYK A;  3RYR A;  2HKO A;  1FYL A;  4U88 A;  5K5Q A;  2ZKZ A;  1XDS A;  3E6C C;  3LA2 A;  2VBX A;  1ONV A;  1LDJ A;  3RKX A;  1C0W A;  1KYW A;  2HTJ A;  5CJ9 A;  3JAM Z;  1W4M A;  1UHW A;  2JPC A;  2RGV A;  2O61 A;  1GHC A;  3FF5 A;  4LGW A;  1XGS A;  4H0E A;  3WGH A;  1J75 A;  4UV8 A;  4EQQ A;  1ZRF A;  3GVA A;  1RNL A;  4CGZ A;  2P6S A;  3I4P A;  3M7G A;  1MDM B;  2CSO A;  4EVI A;  2V1U A;  2FML A;  1D3Y A;  1ZAO A;  1G3T A;  1MDM A;  1IZ1 A;  1XDU A;  3IWZ A;  4NHJ A;  2L02 A;  5F6F A;  1PP7 U;  3IKT A;  1I6X A;  5IT9 K;  2ADU A;  3LAJ A;  4CDG A;  5ED4 A;  1IUY A;  2OA4 A;  3DPT A;  1IXS B;  3E5X A;  2DQR A;  1R00 A;  3KCC A;  4N9H A;  2LDU A;  3F8M A;  5E17 F;  5HDN A;  1YQA A;  2FQ3 A;  4A6D A;  2ZO4 A;  2K7L A;  1B59 A;  5DEQ A;  3K1N A;  3KP5 A;  2ZCW A;  4HOB A;  1HKQ A;  1BI2 A;  2DQL A;  3NQO A;  3F21 A;  4HF1 A;  3HSR A;  4KNY A;  4QLC U;  2DTR A;  2XAG A;  4M71 A;  5E1X A;  2YPR A;  2UXN A;  1FBS A;  1FP2 A;  1HW1 A;  2DPU A;  1ON1 A;  4ESF A;  1W7P B;  3AAF A;  1Y0U A;  5D5X B;  1SD4 A;  1ZYR F;  3KP7 A;  2CO5 A;  2P5K A;  3I58 A;  3TO9 A;  4A12 A;  1HQC A;  3HRS A;  3P9K A;  1W7P A;  4N0B A;  2IRF G;  4YFK F;  1G3W A;  2FOK A;  3R60 A;  3I0T A;  4EMS A;  2WWY A;  4L9V A;  1PDN C;  3F72 A;  1FPQ A;  3P9C A;  5FD6 A;  2CQK A;  1KQ0 A;  1U78 A;  3WE3 A;  2EB7 A;  2VN2 A;  1BN5 A;  2DPD A;  2M8E A;  2RV8 A;  1OYW A;  3ZMV A;  2KIU A;  3KZY A;  2CG4 A;  2QEN A;  2YX4 A;  4WXD A;  2UZK A;  1FP1 D;  4JQF A;  1TQM A;  1U2W A;  1UFM A;  3J80 Z;  3BY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...