1G3TA

Cys102ser dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
215
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 67
structure length 215
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3tA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3tA03
2LF8A 5DD8A 3ZN1A 2DPDA 3R0JA 1P4WA 3RTRA 3GO5A 4MQVA 2P6SA 1U8RA 4EJUA 3KP7A 1IAWA 5E18F 3ZMDA 2FA5A 5K5QA 2EJRA 2D2WA 3DQVC 1CF7A 4QLCU 2DAOA 3HHHA 4F7ZA 3QP6A 1S3JA 4K2EA 1IXRC 2R3SA 3FZVA 1KU7A 4P9UA 2EV6A 4LG0B 4P5OA 2UWMA 3K69A 5CVVA 3KP3A 3D5LA 2ZMEB 2VOOA 1MDMA 2JT1A 2D1HA 3V7SA 4FT8A 1HSJA 3DFGA 5FO5A 2PMHA 4YFXF 4PCQA 3O6BB 4MHGA 3WODF 5JR3A 3PQKA 4P55A 1IXSB 2P5VA 4OU0A 4HF1A 2O61A 5HLGA 2FQ3A 4LFUA 1TQPA 1K79A 5E1ZB 1O3SA 4A0YA 2F5DA 2TDXA 4U0WA 2YX7A 5DD4A 2LNBA 1WSUA 3RPQA 1W5TA 1WRJA 2G7UA 1XGNA 2EA4A 4O6JA 2Z3YA 3GX4X 1CF7B 2K5LA 1LVAA 1I1GA 4MGRA 2YU3A 5D4SA 5HDGA 1J59A 2AXLA 5LRSA 4AVPA 4KMUX 4G7HF 4OINF 2PG4A 5CVIA 5ILUA 2M1BA 4BHBA 3M9AA 3FM5A 2V6CA 1IN6A 1XD7A 3QPHA 1CGPA 2EB7A 2RVCA 5F6FA 1HKTA 4RB0A 2HOEA 4KYWA 1S7OA 3WG9A 5E20A 2CW0F 4BQAA 2KIMA 3E6BA 1P6RA 3ZP5A 1G6NA 3D0SA 5J8CA 1JHHA 4ENKA 5E8GA 1IZ1A 3R61A 2EA2A 1G3TA 4PZJA 2W84A 2MBFA 3E5UA 2OBPA 2CG4A 3I71A 1D3YA 1XDSA 2XIGA 3DV8A 2VN2A 2GWRA 2E7XA 3TDZC 2XVCA 3EUHA 3NQOA 1ZRDA 1HSTA 3QOPA 3J81K 1HW2A 4PGGA 2XRNA 3RPUA 4XBFA 4MNUA 2B0LA 1Z6TA 4OIQF 1FNNA 3F72A 2A07F 1AOYA 4DNCA 1IW7F 3H92A 1YQAA 5D5WB 4LJZF 3HRMA 3P9KA 3JW4A 2G9WA 2K02A 4JQFA 1Z05A 5BS6A 1NHAA 3CTAA 4HV5A 5JHUA 3PQJA 2L01A 3LWFA 4EM1A 4IRIA 3C3WA 2OZUA 1I1SA 1JGSA 1U5TC 1UB9A 5F1RA 5BOXA 1HKSA 2ZNZA 2XAFA 3JTGA 1QQIA 3BY6A 3E5XA 2M5WA 4IJAA 2VT2A 4UVCA 3GZ6A 3GFIA 1MJBA 4HX8A 1K78B 4OIPF 1XB4A 3DP7A 3ECOA 3V7RA 4UNOA 1YIOA 3LFKA 1R58A 1XGMA 2MH2A 1T6SA 1SD7A 1RIOH 1O3TA 3AAFA 2VBXA 3V8JA 1UHWA 2WWYA 1I6XA 3IRRA 3KETA 1XCBA 2RDPA 5E1WA 3GYHX 4ENNA 3E6CC 3GLXA 3ZQ7A 2PBIA 2NYXA 2PMUA 2FNPA 3V8LA 2ADUA 3RKWA 4U88A 1U5TA 2OD5A 3F6OA 5LGTA 2D1VA 1FOKA 2ISYA 1C0WA 3RI4A 1FYKA 5L3DA 2K4YA 1T39A 1LDJA 4GGGA 1WQ2A 3HTUA 1F1ZA 4XRFA 1OPCA 4G7OF 4RAYA 3LAJA 4G7ZF 1KGSA 1QBJA 3L7WA 3F8MA 4KT5C 1QZYA 3ABTA 3E3VA 4KIBA 2RQPA 2ZXJA 5A2QZ 4G6DA 4LD5A 5LHHA 1YO5C 4ZH4F 4M6XA 3RYRA 3L00A 3M7GA 1H9TA 1WI9A 2EFPA 1BI1A 1FBSA 3LA7A 1J0RA 2A68F 4PDKA 2Y75A 4A5MA 1USTA 1U2WA 2KJBA 2FE3A 5HS8A 2H94A 2BYVE 1KA8A 2A3SA 2FXAA 3WTVC 2DU9A 1R23A 3BROA 4ZYDA 1J75A 5E8IA 5TJJA 4NQWA 1V3FA 3MZYA 2DK5A 1ZREA 2YPRA 1Z6RA 4WK8F 3LQQA 4FHTA 3BZ6A 4Q47A 4KIFA 2YX4A 4I2OA 3DEUA 5FD6A 2QQAA 2NNYA 4KICA 3I0TA 1LEBA 4LLNA 5CVJA 5HDKA 3HSFA 4GYIA 4ZZLA 6PAXA 2HDCA 1R00A 1Z9CA 2G7HA 3B73A 3R60A 2Q2EA 4B09A 2VBZA 3ML6A 2QQBA 2XUBA 3MFKA 2Z5UA 2ZBKA 3KFWX 3ZN0A 5H6QA 1D8KA 2NS0A 4HLYA 4LK1F 4XLNF 3CLOA 1R5GA 3I54A 2CO5A 2NAZA 1Z7UA 5JVTA 2QUFA 5LHIA 4EVIA 4H0EA 5FD5A 2LDUA 2STWA 3WE2A 5CYVA 1DP7P 2K86A 4M9ZA 4G8XA 3MQ0A 4IRHA 1HBXG 3KP4A 5FB2A 1HW1A 2CFXA 3VOEA 2LSOA 2NNNA 1ZARA 3K0LA 4HQMA 3LSTA 2A6EF 1O7FA 3JAMK 2XAQA 2O0YA 3Q9SA 3DF8A 4ZYGA 1USSA 5D8KB 2FMLA 2EWNA 2CYYA 2QBYA 4IRGA 2CWEA 4MTEA 4RGRA 2X4HA 2VBWA 2R7FA 4WF2A 1R36A 5HDNA 1XMKA 2RV8A 1MKMA 2JZYA 2PJPA 4ON0A 4CZZA 3DPTA 3KZZA 1TW2A 2Q8KA 3WTZA 1BC7C 5HLIA 4M71A 4Y17A 4LG0A 4HA8A 2IW5A 2ISZA 2PEXA 1FBQA 2J5OA 1ZG1A 2ZFWA 5FGMA 5D6FA 2X0LA 4I7HA 1H9GA 5HS9A 3V7CA 2F5CA 4GCVA 4XSXF 5BPIA 1J5YA 3FF5A 2JRTA 1ZAOA 4OIOF 3OV8A 3GW2A 3REOA 1LB2A 1IUYA 3L2CA 1XDUA 3SXYA 4YG2F 2FEZA 1SD4A 3RYPA 4A5NA 3I59A 2FBIA 3O2PE 2EFWA 3E5QA 2WC2A 1O7LA 2QBYB 4KMFA 3ELKA 1EH8A 1LNWA 1BC8C 3QP5A 4ETSA 1MJAA 3DPLC 1ZLJA 5AONA 4KN7X 2DTRA 4UVAA 3WTXC 3BPVA 1ZLKA 1BJAA 1EV7A 4A6DA 1W5SA 4ZZDA 2HKXA 2PN6A 1TNSA 3IC7A 4MTDA 2J5PA 3IKTA 3WGGA 2YR2A 3MHXA 3IKVA 3ZMTA 3BWGA 4DQ2A 5TRDA 3LQRA 3R6SA 1R1UA 4RGSA 2A69F 3RKYA 5IT9K 3E19A 1J2XA 5LHGA 3T8RA 3CUQC 2O03A 2GIVA 3M8EA 5L3BA 1DUXC 3I59B 5CJ9A 4ESJA 2HGCA 4OIRF 3T5XA 4HZFA 2M30A 5LGNA 2AS5F 1I27A 4AWXB 3T1BA 4Q5SF 4OMYA 1D5VA 2K4JA 3LAPA 1IN8A 1DPRA 1FSHA 1SAXA 4HYEA 2HFHA 1ZG5A 4O3MA 4L18B 1FY7A 1SMTA 2XHKA 4RB3C 4XLPF 2XROA 4I01A 2ETHA 1YG2A 3HHGA 1H0MA 2HR3A 3HRSA 3CO6C 3FXUA 2UXXA 2K27A 2H6CA 3F8BA 1GHCA 1O3RA 2GXGA 2IA1A 1P4XA 3HTSB 1R22A 3HSEA 2RKHA 1I5ZA 3F8NA 4CDGA 2YSRA 4QWQA 2EV0A 5CVRA 3TOAA 1FYMA 1U6GA 4U0VA 1Z91A 1S7AA 4L9TA 4Z2YA 1J9IA 1HQCA 1ULYA 2IA2A 3SZPA 3J80Z 2QQ9A 1QW1A 2JTVA 5ICFA 1U78A 2MLGA 1FLIA 2FF4A 1K78A 5DUKA 1BM9A 1OMIA 5DDGA 1BI3A 3ZMSA 1YW9A 1FP1D 3K9TA 2HQNA 4M9SA 1MGTA 1R1VA 3T0YA 2P5KA 3H3ZA 3KEOA 2ACJA 4JBAA 3ULQB 2DO7A 1GXQA 3HRUA 4CYDA 1SD6A 5ICEA 2QYOA 3SHFA 1TQMA 2DI3A 4WXDA 3WGHA 1QNTA 3HUGA 1XN7A 4HDVA 3I58A 1B4AA 1HXDA 2JPBA 3CUQB 1B6AA 4M74A 4Y13A 3KLNA 4MEXF 3P9IA 3U2RA 5KVRA 3ZMZA 1ZG3A 1G3YA 2KIUA 1JE8A 4RGUA 4WCGA 2XGXA 3QAHA 2Z99A 4L9NA 2ELHA 2E7WA 2W24A 5K5OA 1XSDA 3BP8A 2QZ8A 2VOPA 3U1DA 2E1NA 2JPCA 5D5XB 4I98B 3O3KA 3WTSC 4E70A 3M1EA 1K7AA 3GUDA 3JTHA 2XKOA 2ZO4A 5BQTA 5DUIA 3HRTA 1IRGA 3DKWA 3HIFA 3VFZA 3BJAA 3BPXA 3GF2A 4CXFA 4XSZF 1P4AA 2XKPA 3ERED 1B9MA 4S04A 3VEPA 2D45A 1FZPB 4CO8A 1ZN2A 5AIPA 2DT5A 2BV6A 1L3LA 2BE5F 3F8FA 2QWWA 4I09A 2R7DA 3EQLF 4IHSA 1YW8A 2EFOA 4A2UA 1R5HA 4CHUA 3TKYA 2XAHA 3C1DA 5ICCA 3FXRA 3GEZA 2UZKA 1DPUA 1B59A 4HV6A 3TGNA 1B1BA 5ICGA 1LJ9A 1XGSA 2VT3A 1PUEE 1ON1A 3WU1B 3HSRA 3ISPA 3LA2A 1FWZA 5EEHA 2M45A 3RJPA 4A0XA 5FLXZ 1FBUA 3P7NA 4LB6B 2A61A 4ASNA 2LKPA 4KUMA 1G3SA 1A04A 3R4KA 1OYIA 3Q9VA 2VXZA 5DCMB 4LLLA 5H20A 3BOQA 1F9NA 4HAMA 2FOKA 3ROUA 2NRAC 2FBHA 4L9JA 2F5FA 2RGVA 3W6KB 3KE2A 1RUNA 2HEOA 5D4RA 3N4MA 3V4GA 4P9FA 2CSOA 2ZKZA 2GCXA 1T38A 4BHPA 4NHJA 5D5UB 2KKOA 4R79A 2O6GE 2QLZA 4WWCA 3P9CA 5F64A 1KU9A 4ENJA 1T2KA 4RB2C 4ZYEA 2RNJA 5K5RA 1ZGAA 4M9XA 1TBXA 5FFZA 2O3FA 4R1HA 2RN7A 3PFIA 2E1CA 2VC1A 3ZMVA 3NEUA 3U9GA 1EH6A 5IT3A 2L4MA 2HS5A 2GZWA 2HZTA 3R0AA 2WTEA 5HLHA 1P92A 2BGCA 2COMA 4RGXA 1XMAA 4LK0F 2W85A 4L5IA 1P2FA 1GXPA 1O57A 1MZBA 4OMZA 3K2ZA 5ILVA 4U7DA 2DPUA 1SMYF 2P7VB 4AIKA 4YFNF 5LEJA 2HTSA 5L3CA 3K1MA 3ZPLA 3TO7A 4G6QA 4BYYA 4I0AA 4KNYA 4GO1A 1TTYA 4UXNA 1KQ9A 2IT0A 3C7JA 2PQ8A 1SFXA 5J6XA 2GQQA 3RDIA 3CO7C 3GVAA 3K1PA 2OAZA 4AD9A 3EETA 1R7JA 3IWZA 4HBLA 3I53A 3ZMUA 3IL2A 4BH9A 3QU3A 3HOTA 4GXOA 4I02A 1RZ4A 5LBQA 4IHTA 4BXUA 3FMSA 3IWFA 2P8TA 2CGPA 3BDDA 1WWXA 1BOAA 1BI0A 1ZRCA 2HWVA 1W4MA 2H3JA 3QRFF 2V79A 5HVQC 1IF1A 2V9VA 1KYWA 2FNAA 1LDDA 2DQRA 3VB2A 4MQ9F 1TLHB 5DYMA 4MEYF 1SD5A 4O5VA 1L0OC 4P96A 1YS6A 2A6HF 2XAJA 3S2WA 2C6YA 3CJNA 2L4AA 4FX0A 1SFUA 4IVNA 4L0YB 2HKOA 1S8NA 1T0FA 1D8JA 3Q5FA 3KCCA 1LQ1A 1ZH5A 2KJCA 1S29A 5J8FA 4WX9A 2LF7A 4HX7A 5ED4A 1IN7A 4YFKF 3E6MA 1Z1DA 1ONVA 5JI6A 1OKRA 3MEXA 2L3DA 2K7LA 2M87A 3IHUA 2XASA 4L9VA 1FYLA 2OQGA 3M8FA 3MZHA 4M73A 1X3UA 2O8XA 2Z33A 3F23A 4WXCA 4OOIA 2Z9OA 4KN4X 1W7PA 3GZ5A 4HW0A 3BJOA 2HQRA 1FP2A 1KQ8A 5DV5A 4U0YA 3NRVA 3I64A 5H6RA 4M72A 4UHTA 2M8EA 1U3EM 3I5UA 1UFMA 3MWMA 5E17F 3KP2A 1OR7A 4ZYHA 4YIIA 4N9HA 4M6YA 1HW5A 2K4BA 2EFNA 2Q0OA 3IRQA 1SFEA 4FX4A 4NB5A 5HS7A 1REPC 4D0PA 4IXAA 3CDHA 1LEAA 4BHCA 2MH9A 2WV0A 2KRFA 2V1XA 1F5TA 1PP8F 2MLKA 3TOBA 4G94A 2VC0A 5A2QK 3JAMZ 3CUQA 3G3ZA 4RB1A 4KA4A 1MDMB 1W7PB 3JSOA 3J7AO 2Y0MA 5D8LB 2XAGA 5FLXK 3DXJF 2PLYA 4EM0B 2MD5A 4IPAA 3CUOA 4HQEA 1JXSA 4S05A 4U7BA 1ZHFA 3ECHA 5L3GA 1FC3A 3WTWC 1QO0D 2OZ6A 5D6EA 3HOSA 4N9IA 4CGZA 3KP5A 3TO6A 1S6LA 4HF2A 1DDNA 2IRFG 3EDPA 3JSPA 4RS8A 4I0BA 2VONA 2V1DA 3WE3A 1G4DA 1YW7A 2HYGD 1UCRA 2K5IA 5JFRA 2IP2A 5AIQA 2DW4A 2STTA 3GFLA 5L3EA 1YLFA 2DBBA 3T8TA 2ESNA 2H09A 4UV8A 5L3FA 1BYMA 1O3QA 5ERIA 4WXHA 3F6VA 5BPDA 1STZA 2PFBA 5CLSA 3WU0A 3LA3A 2MA3A 2L54A 4LMYA 2VODA 1Y0UA 1QZZA 4G9YA 3F3XA 1TNTA 4YIFA 3GFJA 1ON2A 4IF4A 1XCVA 2ESHA 4N0BA 3FWEA 5CVUA 4KFCA 4HOBA 1EH7A 1JHFA 4L5JA 4JK1X 5IT9Z 1IXCA 2GA1A 2GXBA 3QPTA 2VBYA 2DFIA 4UV9A 1HKQA 1MD0A 1XSXA 5BMZA 1QPMA 1ZYRF 5DCMA 1BIBA 3TQNA 1OYYA 1PP7U 4EGYA 2QM3A 5E1XA 2V1UA 1ZGJA 1B9NA 1W7PD 2IPQX 3RKXA 3VODA 1VTNC 4EGZA 1T98A 4CICA 3I4PA 1V4RA 4ENMA 1BN5A 1KQ0A 4Y15A 2QVOA 4KDPA 3RIRA 3FXQA 2IA0A 2VE9A 2LX9A 3W6JB 4EJOA 3EYIA 3H3UA 3KP6A 4LB5A 5LLQA 1IRFA 4EM2A 2BBYA 3F8CA 4EJWA 1G3WA 2XV4S 2H6BA 2JSCA 3OOPA 1Q1HA 1TQIA 4HX4A 4A6EA 1QVPA 4LLGF 2FBKA 1OYWA 4UVBA 1FX7A 1ZRFA 2P7CB 3J81Z 3B02A 1KU2A 5DCFA 4KIGA 2GA2A 1U5TB 1TW3A 3SFZA 4PGHA 1FSEA 5ILSA 2PI0A 1BIAA 4EJTA 1YFHA 2OQRA 1LDKB 4HDUA 2HTJA 5DEQA 3L9FA 2EFQA 3HYIA 2DLLA 3N97A 3FHZA 4A12A 3GXOA 4RAZA 2MC3A 3TDUC 3WTYC 2ZNYA 2P6TA 5HOOA 5FFXA 3WGIA 3KLOA 3SZTA 2RC4A 3ABUA 5D5VB 2Y48A 3C18A 2DQLA 2ZJ2A 3QU6A 3SQNA 2OU2A 1QGPA 4AIHA 1YS7A 5KK1A 1F4KA 2A5YB 4TV7A 1K6OA 2K5FA 4HF0A 1FT9A 2DK8A 1FPQA 2OA4A 5LRRA 1GVJA 4R8HA 2EV5A 2F5EA 4ESFA 1RUOA 1UHMA 3WTUC 3V8KA 2BEOA 2H27A 3GFMA 2EK5A 1XSVA 1AWCA 1RNLA 3F22A 2P4WA 2FSWA 2FRHA 2KIFA 5K1YA 1IN5A 1BBYA 4Q48A 3BJ6A 4HLXA 1BI2A 5EEGA 4EMSA 3FX3A 5LGUA 4EQQA 3E6DA 4L0ZB 4LGWA 2UXNA 3EYYA 1J7KA 3E97A 3G73A 1KYZA 4GYGA 4UUVA 1WKMA 2IVMA 2IJLA 4B8XA 4BAYA 1E17A 3TO9A 3KEQA 4BNCA 4EV0A 2FU4A 1MJ9A 2CQKA 2W25A 1XGOA 2P5LC 3J80K 1RI7A 1E2XA 3K1NA 3FMRA 4A0ZA 2GAUA 3FM3A 3GWZA 1PDNC 4ESBA 4Q4ZF 2F2EA 4EJVA 2FMYA 1YTYA 2QENA 2ZCWA 1YYVA 1R1TA 3F21A 3WTTC 2W57A 3MAJA 2VE8A 1ODDA 3L09A 1IN4A 3KZYA 3FMQA 2L02A 2ZMEA 1KU3A 2HYFA 5LEKA 3MCZA 3COAC 4AIJA
chains in the Genus database with same CATH superfamily
2LF8A 5DD8A 3HKZN 3ZN1A 2XGCA 1XOVA 2DPDA 3R0JA 3FXOA 1WI7A 1KG1A 4A69C 1P4WA 4D5CA 2Y9ZA 3RTRA 1D3BA 3GO5A 2RJFA 4MQVA 3EG0A 2P6SA 1U8RA 1DP3A 1FEXA 4EJUA 4J6YA 3VUBA 3GBGA 1HA8A 3KP7A 2E2IJ 1W4SA 9ANTA 4Y91A 5IYBJ 2LC2A 2RI2A 3JCMW 1IAWA 2K2MA 2CUDA 4RG2A 1GDTA 2MGQA 5E18F 2GIZA 2VL8A 4NBQA 4DZJA 3CC7T 1AT1B 3WHCA 4X9DA 2EW3A 3JRIA 1IDYA 1OOTA 2PQWA 3ZMDA 1ZGWA 2FA5A 1Y1VJ 4BEHA 5C4XJ 1M5Q1 3FIWA 3ZFJA 2ME6A 2LJ0A 2OAUA 3LW5E 1DU0A 2RK1A 2IAIA 4A3KJ 1VQMA 2CH0A 5K5QA 3ZQFA 2EJRA 2XDVA 2D2WA 5J4VA 2IS4A 3MEUA 1IXDA 1R6RA 3DQVC 1W36D 1PD1A 4Y92A 1CF7A 4QLCU 5M5XJ 5GMKe 2DAOA 1Q7YU 1UB4A 5IYDJ 2CZ1B 3PJRA 3Q0UA 3OY9A 2DAQA 3U21A 1W0UA 2RF0A 1Y96B 1NEBA 3HHHA 1W2BP 4F7ZA 2DETA 5GTHC 2D0NA 1IRZA 4XN3A 2VJIA 3QP6A 1S3JA 4K2EA 4RAGA 2OCEA 1IXRC 2R3SA 1TUCA 2COZA 2QCOA 3BR0A 1AZGB 4MMLA 3TSZA 1VQMI 3FZVA 1PUFA 2CW7A 1KU7A 3HOVJ 5H2FC 2EJFA 5DLOA 3A52A 4P9UA 2W48A 2EV6A 4C92F 4FYVB 3HPGA 4M6VA 4LG0B 2FG0A 4M3DA 2JSPA 4XAXB 4P5OA 2UWMA 4FW1A 1VQOQ 1Q7YC 3K69A 3DEEA 3HFNA 4ZC3A 2O9SA 5CVVA 5J3BA 2DERA 3KP3A 2CMPA 3D5LA 2ZMEB 2VOOA 3X26B 2QDYB 1W0TA 1MDMA 4NNJA 2JT1A 2D1HA 3V7SA 2O9LA 5E3MA 4FT8A 1HSJA 3K70D 3C95A 2LTPA 3DFGA 3JCMg 2DMUA 5FO5A 2PMHA 3L1PA 2M16A 4D5FA 4YFXF 4PCQA 2PTKA 4NOYA 3CXCP 3O6BB 4MHGA 1VYVA 1VQ6A 4C92E 1U9NA 3WODF 2RHYA 5JR3A 4ZTJA 1Z21A 3DKXA 4OAZA 1D3BB 2ZXIA 3PQKA 4A3GJ 4P55A 2JMAA 1CSKA 1T8IA 1VQPQ 1IXSB 3DB4A 2RHUA 3REBB 2P5VA 4OU0A 4HF1A 2O61A 4J7FA 2F4IA 5HLGA 2FQ3A 4LFUA 1TQPA 1K79A 3EG2A 3HGYA 5E1ZB 5FKMA 3QZ5B 2ENMA 4OF1A 1O3SA 1Z67A 2F5DA 2TDXA 4U0WA 2YX7A 5DD4A 4A0YA 3S1QJ 1QLYA 4D6WA 5IHKA 2X51A 3BFMA 5IH2A 2LNBA 4S0HB 1G8XA 1WSUA 2IVWA 4B4CA 4J9IA 3L2ZA 5FKLA 2CFOA 3VUZA 3RPQA 4QVDA 1W5TA 1WRJA 5LD2C 4IO9F 1WYXA 3VS6A 3GMEA 1BW5A 2G7UA 1VQPA 1XGNA 3SDBA 4KBMB 3CCQQ 2G0EA 2EA4A 4O6JA 5CKDA 4DOZA 3FKIJ 1Z9ZA 3CCSI 2Y31A 2CP7A 2Z3YA 4HSRA 3GX4X 2YLCA 5F0HA 4KGVB 1WDXA 4M78C 2R7RA 3J7AW 1CKAA 1CF7B 2D8HA 2K5LA 1TT0A 2NVXJ 1VQ8A 1LVAA 1I1GA 4MGRA 2YU3A 5D4SA 1SKUB 4M77B 1MBGA 3PMIA 2LCSA 2VJJA 5HDGA 3W2WA 5JHFA 2YWWA 3J80E 1J59A 1WJRA 3G6EQ 2AXLA 1X4OA 5LRSA 1QKXA 2C0IA 4AVPA 4KMUX 4G7HF 3MKYB 2E65A 4PJMA 4OINF 3PE0A 5IHIA 1B8IA 2PG4A 2X6YA 5CVIA 5ILUA 4B9XA 1VQ7T 2M1BA 1AWJA 2R7UA 1AWXA 4LOCA 4BHBA 5GAMj 2WAQA 4J7IA 4N0AC 5KYWA 3M9AA 2KROA 1JUPA 1JJ2A 3W2VA 2F48A 1TWAJ 3FM5A 4QIWN 1P7JA 4PJNA 2BVLA 2V6CA 1KZHA 1IN6A 1XD7A 3QPHA 1CGPA 4P5NA 2JS2A 1EA3A 5GADJ 1VQ8I 3I55Q 1M1EB 2EB7A 2P0WA 3QPLA 4UY8I 2RVCA 1QCFA 3CCJT 4C0DC 3M56A 2OJ2A 5F6FA 1ETVA 4RTTA 2X6WA 4B3AA 1HKTA 2CU7A 1QVFA 3OYEA 4RB0A 2HOEA 4M75F 3SWNB 4KYWA 1S7OA 3WG9A 1O75A 3HOWJ 2HPIA 3L1AA 3C2HA 3QPSA 1OU9A 4BY7J 5E20A 2CW0F 4BQAA 5CKFA 5L23A 2ATCB 1KQSA 2ZCFB 1RESA 2LRDA 2KIMA 3DPUA 3E6BA 3V42A 4BL0B 1P6RA 3ZP5A 2WACA 3EG9B 3RERA 1G6NA 3B6CA 3D0SA 5J8CA 1JHHA 4ENKA 2LD5A 3CJRB 2E71A 1HK9A 1R4NB 5E8GA 1IZ1A 5KYUB 3R61A 4M3FA 3RNJA 2J6OA 4B9WA 3CC7A 2EA2A 3PVQA 4E6KG 4OMFB 5CKEA 1YI2Q 2V4JC 3HL2A 1GBRA 4F93B 1G3TA 1TS9A 2CKKA 1XQHA 1KFZA 2CS3A 5GPCA 2XDPA 4PZJA 3FLGA 1WH7A 2W84A 3J80R 2MBFA 3E5UA 2OBPA 3CP8A 2XB5A 2QA4A 1W2BS 1IO2A 2CG4A 3I71A 1D3YA 2K9GA 3I9V2 3OYNA 1XDSA 3JB9H 5FW9A 2XIGA 3IUOA 5JLXA 3RESA 3DV8A 2VN2A 1YWOA 1VQ9A 1XG1A 3CBMA 3TQ7P 3JCUC 2GWRA 2JN0A 2E7XA 1NG7A 2IIMA 5GMKl 5C6SA 3TDZC 1I39A 2XVCA 5I11A 3PIOA 3EUHA 3NQOA 1ZRDA 3CC7I 2R7ZJ 2FPEA 1HSTA 3ASOH 2XK0A 2RQTA 3CBPA 1MNEA 4PK4A 1KQ2A 2W82A 2CYZB 5GJVB 4BY1J 3QOPA 3J81K 1HW2A 4IHXA 1M1KU 1WPKA 2XRNA 4PGGA 3VSKA 4AUXA 4IHVA 2LQKA 3RPUA 2IBDA 2QA4I 5HK3A 4XBFA 2L7MP 2LYCA 4MNUA 2Y0SA 2B0LA 2JMWA 2V9PA 1B8IB 1AHDP 4H4KC 2XGEA 2DFEA 1Z6TA 2OTJA 5EG0B 2C06A 4HVUA 4N0AA 2FHDA 2X48A 3X28B 4OIQF 4ZNXA 3E9GA 2OUMA 1FNNA 4XU1A 2W4SA 3F72A 4DOWA 2A07F 1WXTA 1VQKT 1GFDA 4CCKA 1T33A 1AOYA 1A6IA 1R4MB 4DNCA 1IW7F 3H92A 1M1KC 4M7AA 1YQAA 1R0BG 1FTTA 2IEKA 1NH3A 1W70A 1AWWA 5D5WB 4BJTA 4LJZF 5IP7J 3P8BB 2OTJI 3JCMf 2EYZA 2XKOC 2YDLA 3HRMA 3P9KA 3ULRB 1VQ4T 3EGDA 3JW4A 1YFNA 4AG1C 2G9WA 2K02A 2CDTA 4DOVA 5GAMf 4JQFA 1YIJQ 1Z05A 2RO0A 3MEVA 2DMQA 1Q81R 1B34B 3G71A 5BS6A 1VQ5A 4HG2A 4Q5WA 3CCVA 3OYHA 1NHAA 4RDUA 3CDLA 2DZCA 5HNHA 3VS1A 3CTAA 4HV5A 5JHUA 3PQJA 2L01A 2DOEA 3LWFA 4EM1A 2E2HJ 4IRIA 2RHIA 3C3WA 1QHGA 3G1JA 2OZUA 2MMPA 1I1SA 3LOCA 1V29B 3VRYA 1JGSA 3OMCA 1U5TC 2I2LA 2RQVA 1UB9A 1A0NB 5F1RA 2RN8A 5BOXA 1HKSA 3BTLA 1FIPA 2ZJRF 5GAOq 3DEWA 1G2BA 3FK6A 3QODA 2BVMA 3S93A 2ZNZA 3QIIA 4M77E 4F7UA 2MD0A 4BXFA 2MAMA 3CC2A 2L0AA 4Z8AA 3CCVI 4M78B 2XAFA 2XMFA 2FD5A 3JTGA 2QYZA 1QQIA 1XC5A 3BY6A 3E5XA 2M5WA 4IJAA 3KIOA 3ZCOA 2VT2A 4UVCA 1UGQB 2A37A 2CZ7B 4XTVA 3OQ5A 4A3LJ 1QKWA 3GZ6A 2MWPA 2VUBA 3GFIA 1MJBA 3S3NA 4HVVA 4HX8A 5ECAA 1Y0MA 3JCMQ 1M9SA 1K78B 3A8OB 4OIPF 3HGGA 1JXMA 1XB4A 1JJ6C 1ZBJA 1IC8A 3DP7A 3ECOA 3V7RA 4UNOA 2P4RA 3CD6T 2EINH 5FKOA 1NJIR 4BBSJ 1YIOA 3LFKA 2KRCA 3R6NA 1R58A 1XGMA 2MH2A 5J1RA 1T6SA 1SD7A 3CC2I 1PM3A 5EG2A 1RIOH 1O3TA 3OIPA 1K6YA 3BR5A 1TTHB 4RUGA 4C8QC 2QF7A 3N05A 3CMEQ 1R0CB 3AAFA 2VBXA 5J39A 2L7KA 2FVUA 3V8JA 2LP5A 1W1WE 2W00A 3FBNB 2DK3A 1UHWA 4NDLA 2WWYA 1D1AA 3TP0A 1ACMB 1I6XA 4A93J 3DB3A 5J40A 3RQIA 2AQFA 1FTZA 5LJ3g 3IRRA 1VQ6Q 3KETA 4F55A 1XCBA 4M77D 2RDPA 5E1WA 1M2OA 3GYHX 3IAM2 4ENNA 1KC8R 4GLKA 3E6CC 3NWSA 3GLXA 3ZQCA 2DRMA 2NWMA 3TSWA 4ZGDB 3ZQ7A 3CXCS 2PBIA 2NYXA 3S17J 5HY6A 2PMUA 4XTZA 2FNPA 4A4HA 3L2QA 3EGDB 2E35A 5GAOn 4GLMA 3H9NA 3TBIA 1WJCA 4DGWB 2Y4YA 3EFSA 1G59A 1JUSA 2A0FB 3HUGB 2COYA 3LH5A 1MSEC 2BOLA 3CCJI 1TUDA 5LJ3d 3V8LA 2E6ZA 4BGDA 2ADUA 3ONQA 4F7UG 3RKWA 4U88A 3JRAA 2P81A 1LFUP 2DA1A 1D09B 3H9GA 2OAWA 4FTHA 1PRMC 4JLGA 1U5TA 2OD5A 3F6OA 5F04A 2H8RA 2LZ6B 5LGTA 2D1VA 2RI3A 3OYCA 1RC9A 2ISYA 1FOKA 3E2UA 4E7IA 1C0WA 3TW6A 2MPXC 2RHXA 3S1MJ 3RI4A 2QASA 2ROLA 4XQFA 1FYKA 5L3DA 2K4YA 4PJJA 2X98A 4IHYA 4F7UB 1T39A 1LDJA 2R93J 1LPLA 3JCMV 4JX5A 4LDYA 1VQ8Q 4GGGA 2TCTA 2HXIA 4A3MJ 1UAAA 4AM3A 1WQ2A 1N9SA 4HCKA 4B48A 2DA2A 2DA5A 5HK0A 1KONA 5CQGA 3HTUA 2E12A 2HKNA 4E7ZA 4LD9K 1K8AC 2ECZA 1F1ZA 4XRFA 4MZPA 3K4BA 1OPCA 4N4NB 1UMQA 5K7ZA 2XICA 4RTXA 1NK2P 3FISA 2ID6A 4C3JJ 4G7OF 3C12A 3OOUA 4Y28E 5LJ3j 4RAYA 3CCQT 1VQLQ 3LAJA 4G7ZF 4OMNA 1X1CA 5IXBA 1KGSA 1QBJA 3G1OA 3L7WA 3F8MA 3J81E 5A2QR 3WVDB 4KT5C 1QZYA 1A5JA 1J3TA 3ABTA 3E3VA 2LMDA 1WHHA 1M3CA 2HDAA 3EGXA 4C8QA 4KIBA 4JJBA 1ETYA 4BQQA 2CP5A 4JYKA 2RQPA 1S1NA 1IV6A 3OB9A 2ZXJA 5A2QZ 3SFMA 1QVGP 4F92B 4FIBA 2DJZA 2R58A 1OYXA 1RRJA 1RAGB 2V8KA 1PVEA 4G6DA 4LD5A 4D9JA 1LJOA 5BNGA 1WJFA 5FLXR 5LHHA 2DA4A 2H8HA 5EDNA 5EF6A 1C6VX 3AG2H 1YO5C 1ZSGA 1JQQA 2IS1A 2BZTA 4ZH4F 4QVCA 4A3JJ 4A3BJ 3JB9F 3BG6A 4M3BA 2EBIA 4M6XA 2ZGWA 2HL3A 1X1DA 3RYRA 3L00A 4JX6A 2QSHX 4XTYA 1AWOA 1YJ9T 3M7GA 1OQKA 2XAUA 2L7ZA 2H1LA 1HLVA 4QQGA 1OULA 1N25A 1H9TA 4M78F 4AFUC 3I55T 2PVOB 2LK2A 1K9MC 3E1SA 1VZ0A 2DXCA 1WI9A 4ATOA 2EFPA 1BI1A 2NVYJ 3D5SC 1FBSA 4YEJA 4B43A 3I9QA 5CKBA 1K73U 1HJDA 1WH5A 3LA7A 2DMTA 2MABA 1VQKI 3MVPA 1XNIA 1J0RA 2A68F 2HI3A 4PDKA 2Y75A 4A5MA 2M0MA 3PO3J 3VDXA 1USTA 3NAUA 1ZK8A 2MK5A 1U2WA 2RH2A 1MMAA 1F1BB 4LUEA 3JCMh 3CMAT 5GAMh 2KJBA 2YHTA 2FE3A 2JUFA 4M78E 1VQ9Q 2LFBA 2WAEA 3UT1A 3TEEA 5HS8A 3FIFA 2DKGA 2F5TX 1GLNA 4DA4A 5GANe 2H94A 2EIKH 2BYVE 2L3QA 1KA8A 7AT1B 1DGWY 4CI0C 1Q7YR 2A3SA 2JWTA 4LXCA 1K73C 3WU2C 2FXAA 2RNGA 3BE3A 3CCMT 2KDSA 3CCRT 3H6ZA 4QPOA 4C8QG 1VQNA 2COWA 3WTVC 1R8OB 1Q82U 2K7AA 3LWHA 2DU9A 3TCJA 2ZPBB 3CD6A 2ZPEB 4F04B 4J9HA 5GAEJ 2KZGA 4D8DA 1R23A 2X1EA 3BROA 4ZYDA 2FEIA 3CJTB 3PNWC 1QP2A 4DJAA 3OYGA 1NLOC 1EFNA 1J75A 2FZKB 4C8QB 2ZJQF 5IY5H 5E8IA 5TJJA 2DT7B 3CQZJ 2D5VA 4LDWA 5CKHA 1PSFA 4NQWA 2L89A 2L7FP 1V3FA 3MZYA 2DK5A 5GAGJ 3M53A 1ZREA 5KYNA 2YPRA 1Z6RA 1VQNI 3VU3C 3ZBDA 3S2DJ 2MZ4A 4WK8F 3LQQA 2D6FA 3CPFA 2AQEA 1Q82C 2JA6J 2RNAA 3CD6I 4C92A 5GAN8 4FQGA 4FHTA 5LJ3f 2RA2A 2JRMA 3BZ6A 3RPUD 3HKSA 3CPWA 2XSJC 3O8VA 4Q47A 4KIFA 1ZSZC 2JXBA 2YX4A 3G71Q 4I2OA 4IUQA 1ERDA 1VQ5Q 3DEUA 5FD6A 1M27C 2RK2A 1YWPA 2VC8A 3QUIA 2QQAA 2NNYA 1Y57A 2MFZA 4KICA 3I0TA 5IYCJ 2YSQA 2GTOA 1LEBA 2RJCA 4LLNA 5CVJA 5HDKA 2X3WD 3QQAA 3OIOA 3F9KA 4M75C 5D6YA 3BR2A 3HSFA 4GYIA 3X2QH 4ZZLA 1RABB 2DILA 3A0HC 1BBZA 2LJ3A 4N4GA 6PAXA 1Y8RB 1R00A 2HDCA 4BI3A 3CCLQ 2K9MA 2NVUB 2QG9B 2BHYA 2WV1A 2GBYA 1Z9CA 4M3GA 2OTLQ 1BR4A 2G7HA 2AIRB 3CC2Q 3O8GA 2R7OA 3B73A 2GXAA 3R6OA 4W97A 3R60A 2PU9B 2Q2EA 4RTVA 3D7SB 4B09A 3PIPF 2VBZA 3ML6A 2QQBA 2XUBA 3MFKA 4JPBW 3UA6A 1M8VA 2Z5UA 2ZBKA 3KFWX 4X1EA 3ZN0A 5H6QA 3ZRGA 1RAFB 1D8KA 2NS0A 4FSXA 3LL7A 4HLYA 4LK1F 2HXOA 4XLNF 1OFCX 3CLOA 1R5GA 3I54A 3TL4X 2CO5A 4LIVA 3TP3A 1MHNA 3CMYA 1JEGA 2NAZA 1Z7UA 5JVTA 2QUFA 1YN8A 1X2MA 2OC6A 4EVIA 5LHIA 5FD5A 4H0EA 2CW8A 1E6GA 4E2FB 9ATCB 2LDUA 2O88A 1LNXA 4W1UA 2STWA 3WE2A 3EFOB 5HODA 1YJWA 3OSGA 5CYVA 1DP7P 2K86A 2DVEA 2VXFA 3P8HA 4JUVA 4M9ZA 2DL3A 3H0HA 1VQ4Q 4IQ4A 5F0CA 4G8XA 2R5ZA 2NOJB 3MQ0A 4IRHA 2VJ4A 1HBXG 3KP4A 1V5FA 5FB2A 4ZDOA 4BJ6C 4HNTA 4C92G 2IPOB 4OP0A 2DEQA 4C5GA 1HW1A 4XM3A 5IP9J 3CCEA 3JCMP 4NQWB 1IGQA 2CFXA 3FXLA 3VOEA 2LSOA 5EZGA 3WG7H 3GF5A 3D1NI 1ZR4A 2NNNA 1V1CA 1ZARA 3S2HJ 3K0LA 3OYAA 1F43A 1I81A 5CO7A 3UKGA 2KAFA 1X27A 4HQMA 3LSTA 2A6EF 2DDBA 1O7FA 1WHLA 4B47A 2KLOA 3X24B 4ZGJB 1RUWA 3UDCA 1BCOA 3JAMK 3CMET 3NARA 5GAOl 2P84A 1SRLA 2XAQA 1ZHIA 2O0YA 5KCMA 3Q9SA 3DF8A 2EKHA 4ZYGA 1USSA 5D8KB 1WJAA 2EZKA 3CCEI 2KQWA 2M0YA 2FMLA 1VYUA 1YJNQ 1T0FC 3BDUA 4OWRB 2EWNA 2CYYA 2QBYA 4IRGA 2EIFA 2CWEA 3TEDA 3NFCA 4C5IA 4MTEA 4G6TB 4RGRA 4CCMA 3FB9A 2X4HA 2VBWA 4LDUA 2JNGA 2R7FA 3TMOA 2O5RA 4WF2A 4J00A 1E7OA 5CAIA 3H35A 4J83A 2JS0A 4NC7A 2K6DA 4J6XA 1R36A 2XF6A 5HDNA 2YUPA 1XMKA 4BBRJ 3M55A 4CC3A 2RV8A 2QTXA 3BC8A 1MKMA 1KSWA 1BR2A 2JZYA 1NZ9A 1H92A 2J6FA 3T9NA 1V76A 1Y96A 2PJPA 4ON0A 3DTKA 3C2GA 3OMGA 1S72Q 4CZZA 3DPTA 3KZZA 1TW2A 2Q8KA 5M3FJ 4IUVA 5GTIC 4XR6A 2JVGA 3WTZA 1E3OC 1BC7C 3CCRA 5HLIA 3CMAI 1OISA 1ZKGA 4M71A 4Y17A 1OX9A 2COBA 1OZ2A 1M1KR 4HSTA 4LG0A 4HA8A 4UUSA 2Z16A 2IW5A 2ISZA 1QZEA 2PEXA 4A4FA 1FBQA 3E7LA 3TVTA 2J5OA 2JA2A 1ZG1A 2ZFWA 2DXUA 1E3PA 5FGMA 5D6FA 2X0LA 4I7HA 1HF0A 1ZLMA 3TREA 1H9GA 2M4KA 5HS9A 3V7CA 2R5YB 1JXOA 2M02A 2F5CA 1Z0XA 1RI0A 4GCVA 4XSXF 5BPIA 1BK2A 3DLMA 1J5YA 3S14J 3FF5A 1T3SA 2JRTA 1ZAOA 2I10A 4OIOF 1JBMA 4C0GA 4IOCF 3CCMI 3CCRI 1QVGS 2E1HA 2KMUA 3OV8A 1IRXA 1ZQ1A 4LITA 1JJ2P 3LLRA 3GW2A 2QKLB 1VQLT 1VQ6T 2L9VA 1RKTA 1QVUA 3CDIA 3Q3SA 3REOA 3K4LA 3SEZA 3L2CA 1LB2A 2H8WA 1IUYA 2DJNA 3DTIA 1U06A 2HEQA 2V8IA 5I2SA 1NJIU 1XDUA 3SXYA 4RCCA 1RAAB 4YG2F 2FEZA 1SD4A 1QCOA 3RYPA 5IHNA 4Y3OA 3GTMJ 1GBQA 1ZSZB 2X85A 4A5NA 3I59A 3N5BB 1D0XA 2FBIA 4HEA2 4BJ5C 4ZYAA 1QVFP 2L2OA 2OV7A 1QA6A 3CCYA 3O2PE 5EZHA 2AK5A 1IZ6A 2LX7A 2CZ6B 2HBPA 2O01E 4C8QD 2EFWA 3E5QA 3M4GA 2WC2A 3PVLA 3OW2A 4M75B 1O7LA 1U1SA 2QBYB 2G3RA 5E3LA 1KQSP 5LJ3h 3CC4A 4OGEA 3H8ZA 4XKVA 3GNFB 1MSFC 4KMFA 2YUSA 3ELKA 1T3LA 2KMTA 3QYHB 4C2MJ 1EH8A 1YHQT 1LNWA 2E19A 1BC8C 3QP5A 1V54H 1PKSA 2Y69H 2EFIA 4ETSA 3CCUT 4M77A 2VIXA 1MJAA 1R9TJ 1Q86U 3BG9A 3DPLC 1OR7C 3A5ZB 5CQYA 1UJ8A 3VYHB 1ZLJA 4PFPA 4IX7A 5GMKi 1T0HA 1X3WB 5AONA 1AU7A 1YRNB 1CKBA 2HVRA 4KN7X 2DTRA 4UVAA 4EEFG 3BPVA 2PMZN 2RAEA 3WTXC 1ZLKA 5GAN6 3CC4I 1UTIA 1BJAA 3QYFA 2DA9A 1MW7A 1WJEA 1EV7A 1N9RA 4A6DA 1W5SA 3MMYB 1QPIA 2A36A 2CSIA 4UUSB 3BR1A 3L2WA 1VYTA 4ZZDA 4LNPA 2HKXA 1DGRM 2PN6A 1TNSA 4PJ0C 1QMCA 1WLPB 3IC7A 4MTDA 2J5PA 5KYXB 3IKTA 3WGGA 4FYXB 2WB1N 2EGEA 2O4XA 2YR2A 2ZPIB 2R0QC 3I4NJ 1Q86C 3MHXA 3IKVA 3ZMTA 1ETOA 1DJ7B 3PUFA 3MKZA 5GAMg 3KYCB 3BWGA 4DQ2A 3GTLJ 5TRDA 2HZDA 3LQRA 3R6SA 3DLAA 3RSNA 1R1UA 3K4JA 4B1RA 2JJ9A 2VGMA 3EHRA 2YRCA 3ZEHA 3DBRB 4RGSA 2XPVA 4GBQA 1RR8C 2QEXT 3EG9A 3H0FA 2KIQA 2A69F 2QGUA 1UGVA 4PLLA 3G4ST 3RKYA 2YT6A 5IT9K 1AVZC 4XTXA 3E19A 1J2XA 5LHGA 2JA8J 3CCSA 5KYUA 3T8RA 1JB0E 1JTXA 1M3BA 3CUQC 5GMKm 5IAYA 2O03A 2GIVA 2B7EA 3M8EA 5L3BA 1DUXC 3ME9A 3I59B 5DLQE 2K3FA 1VUBA 5CJ9A 3HM5A 4ESJA 5LJ5j 3QXEB 2HGCA 2M3AA 3Q0VA 5GAMd 4OIRF 4UB6C 5CKTA 4CSWA 3T5XA 4HZFA 2L3PA 3RR6A 3JAME 2DN0A 1BR1A 2M30A 3H9QA 5LGNA 1Y71A 1M1FA 1W2BA 3HKZA 2AS5F 2HKQB 4M77G 2HSEB 1I27A 2FQ4A 4AWXB 2L0KA 4BE0A 2X35A 4XLHA 1NLPC 2DM1A 1GXIE 2DODA 2PX9A 2LOOA 3URGA 3K4NA 1SF9A 2ZZDA 1G2HA 1QRYA 1RAEB 3T1BA 4Q5SF 1UGRB 5CR2A 4J6WA 1UHCA 4GY5A 3JCMd 4C92D 4OMYA 3M4OJ 1D5VA 2L3RA 4CC7A 1A36A 2ED0A 2LKSA 2K4JA 3LAPA 4OB0B 4JZ4A 4MDXA 1IN8A 1DPRA 1FSHA 3H0IA 1SAXA 4J5YA 2DYRH 3JCMc 2E6NA 4HT8A 4HYEA 2PJRB 2HFHA 2CZ0B 1YE9A 3HC7A 1ZG5A 2E64A 3QWXX 3CCLT 4O3MA 1U0JA 4L18B 1FY7A 2XIDA 1ZR2A 3CQTA 3I56Q 4M7AG 1SMTA 3DKYA 5EG0A 3QBYA 2XHKA 3NTIA 4U87A 2OTLT 2QI2A 1JT0A 1Y7XA 1UGSB 1YX5A 4RB3C 3LNQA 2F1LA 3FJ5A 1YJWQ 1VIFA 2R57A 4XLPF 2XROA 1EIFA 1LVKA 1POGA 2QDLA 4I01A 2ETHA 2XF5A 1HCRA 1YG2A 3HHGA 5FWBA 1QP3A 1K9MR 3C0CA 1H0MA 3U1KA 2O4XB 2HR3A 3M4YA 2EBPA 2AXTC 3IV5A 3HRSA 3OR2C 5M9OA 3CO6C 2P0QA 2VKEA 3FXUA 1PSEA 4HCZA 2UXXA 4RMOA 2K27A 2H6CA 5EGOB 3MP8A 2Y30A 2LDMA 3REAB 1ZELA 3F8BA 2HOTA 1GHCA 1O3RA 2RJDA 2X3XD 3BQYA 2X4WA 2GXGA 1SFOJ 2PVDB 4QKUA 2IA1A 1P4XA 2L3SA 4DBHA 3OL4A 3HTSB 2PZ1A 1R22A 2PVGB 4XQ3A 3HSEA 1YITQ 4KULA 4AFQC 2RKHA 1I5ZA 3F8NA 1T0JA 1UG2A 1X6GA 4CDGA 1B34A 3AFHA 3A8HB 3LGFA 4BUGA 3RZOJ 2YSRA 3OYJA 2BTTA 4QWQA 3FXJA 2EV0A 5KNLA 2FO0A 3QZ9B 2LTOA 4MZMA 1XS9A 5CVRA 3TOAA 1FYMA 4M75E 1U6GA 2Z2SB 4U0VA 1SPKA 1Z91A 3SD4A 5GJWB 1S7AA 2WB1A 4D7MA 3NMZC 3K6GA 4L9TA 1X2QA 1K1ZA 4BD3A 1X4PA 2JM8A 4Z2YA 1J9IA 1IV8A 1K73R 1KD1C 4C9YA 1HQCA 3SWNC 2SRCA 1YX3A 2K9NA 4XORA 2AKKA 2EQIA 1TT5B 2BKDN 3SDZA 3CJQB 1ULYA 3M57A 2IA2A 1QCNA 3SZPA 2KT8A 2KRNA 3J80Z 1JKQC 3JV3A 4M78A 4E7HA 1H641 2XC7A 2QQ9A 3O8HA 3S1RJ 1QW1A 2JTVA 5ICFA 3ZQHA 3LSIA 1NBEB 1U78A 2XB0X 1TWHJ 1G5VA 2C0OA 2MLGA 1LFPA 1FLIA 2LY9A 2R7VA 2FF4A 3CEYA 1BW6A 1YJNT 2DFFA 3X20B 1K78A 3SZGA 2ZAEA 3JRGA 3MKDA 3ASNH 3DBHB 2A08A 4LDVA 4C30A 5DUKA 3JB9I 2JVVA 1BM9A 1OMIA 5DDGA 1BI3A 3ZMSA 2X6XA 2DD4A 5FU7C 1YW9A 1Y1WJ 2P0TA 2HYJA 4M75D 4RAFA 5CCAA 1FP1D 3K9TA 2HQNA 4RLFA 3J7ZI 3CF5F 3G7ZA 2DLPA 4M9SA 1MGTA 3RDVA 5D6WA 1YNZA 3MCAB 4CC4B 1R1VA 1UHSA 3T0YA 2P5KA 2X6OA 3H3ZA 3CCUI 3DTEA 2DMOA 4R56A 3KEOA 3RCOA 2ACJA 3M9QA 4JBAA 3SYTA 3KYLA 1GCQC 2RHZA 1S72T 3ULQB 1OU8A 1P7IA 3KZIC 4FSSA 4ESRA 2DO7A 2X4YA 4AU7A 2GQIA 4RTZA 5KAFC 4CC2A 2DPPB 2E36A 1GXQA 3BR3A 2GOMA 3HRUA 4CYDA 4QTRA 2QKMB 5C4JJ 1SD6A 3SEMA 5ICEA 2RMOA 3VS5A 4F14A 3GIBA 2QYOA 2XI9A 3SHFA 1TQMA 2M7BA 2MVTA 4A54A 1TH7A 3A03A 1JJ2S 5JLWA 1NYFA 3CP2A 2DI3A 3BTIA 3LSGA 4WXDA 3WGHA 3MD2A 3L2UA 1QNTA 1IB8A 3HUGA 2VKDA 4CA0A 1XN7A 4RLQA 3I58A 1B4AA 4HDVA 1OI1A 2QQSA 3JB9G 4M7DF 1HXDA 2R5AA 2Y2ZA 2JPBA 3CUQB 1IGNA 3BCAA 1B6AA 4M74A 4Y13A 3KLNA 4ANJA 4MEXF 2AZSA 3OYLA 3P9IA 3M58A 5IT9E 3U2RA 3CBOA 4E6RA 4M78G 4E7KA 2F4OB 5KVRA 2YRDA 1VQMQ 2ZPGB 3ZMZA 3SWNA 1RR7A 1ZG3A 1SFKA 2DXIA 2LY2A 2QEXI 2ZXWH 1N78A 2FYKA 1V55H 4PJOF 2M2EA 1SSFA 4LN2A 1M8MA 1G3YA 2V8JA 2BXYA 4XICA 2KIUA 1NK3P 3VYTB 2CQXA 2DX1A 2WA0A 1ETWA 2W10A 1KQSS 4M7DE 5LL6S 1JE8A 3DKMA 4RGUA 3RBBB 2ICWG 2DL7A 3DU5A 4WCGA 2D1XA 2XGXA 2DCEA 2Z99A 3PNYA 3QAHA 4L9NA 4N4OB 5FRMA 3GTKJ 1RLQC 2O31A 2ELHA 1RL2A 3FDRA 2MOXA 1I5LA 2E5NA 5HNFA 2E7WA 5A0LA 2DBMA 2W24A 2KISA 5K5OA 1XSDA 1N6AA 4OMPA 2ZC2A 4PJOE 2OJED 5F0FA 1FXXA 4J8OA 1X01A 1KK7A 1VQ7A 1X6BA 5DY9A 3BP8A 4ELZC 1MH4A 2Y90A 4JJNK 2DL8A 2QZ8A 2VOPA 1IGUA 2O9VA 5I22A 2ELKA 3VYUB 5HLTA 4BDYA 3A98A 3U1DA 3LX7A 3VS7A 4XKWA 2E1NA 1TL8A 2DXBA 3PIPA 2JPCA 5D5XB 4CCOA 3AHUA 4I98B 1GCQA 3O3KA 2WADA 4XU2A 4V19K 3CCJA 4YRVA 2E3HA 3WTSC 3META 4KT6A 4RCBA 1MMDA 4E70A 3M1EA 1OPKA 1YCSB 2HD0A 2KFDA 1VNDA 1K7AA 1AKHB 1VQ7I 4XK8E 2DDAA 1IO6A 3GUDA 2BZYA 2JZ2A 5KYYB 3I4MJ 4ZDLA 2HDDA 1RADB 4XOTA 3JTHA 2XKOA 4KT0E 5B5EC 2HNIA 1VQOT 2ZO4A 2CV2A 3CCSQ 3FBIB 5BQTA 5DUIA 2VJ5A 3HRTA 2V1RA 1IRGA 4L6V5 4CCNA 1NYGA 3WVEB 2M35A 2E3IA 4ME7A 3AG3H 3DKWA 4EATA 3PSIA 3HIFA 3VFZA 3BJAA 3BPXA 3GF2A 4AIDA 2HL5C 4J9CA 1BOBA 5I2MA 5LJ5h 4KITB 1W36C 5GPAA 4CXFA 2DVJA 4XSZF 1P4AA 1WJ5A 1I3QJ 2XKPA 2DJIA 3ERED 2E5KA 1SANA 4Y7NJ 1MNMC 1B9MA 2W0ZA 2L9NA 4S04A 2BY2A 2NS7A 2ZSHB 3VEPA 4XIDA 4LG3A 2D45A 2HMAA 2X4XA 4XLFA 4CO8A 3ABKH 5K7FA 1FZPB 2CGHA 1ZN2A 2QSFX 5AIPA 2D8JA 2DT5A 2HQHA 2BV6A 1L3LA 1SG5A 1ETXA 2BE5F 2NUPB 2XU8A 4BDZA 3A1PA 3F8FA 2QWWA 3FHNA 3MP1A 4VUBA 4I09A 4WCIA 2R7DA 2KRHA 2EPFA 5FROA 2MYSA 3EQLF 4WTOB 5A0GA 2GFUA 1JU5C 4IHSA 1YW8A 3TU4K 1OCRH 2R4GA 2EFOA 2VQLA 5C0MA 2XRLA 1N8RU 4A2UA 4FISA 2KDZA 1KD1U 5B66C 4OGCA 2NUTA 1R5HA 4CHUA 3TKYA 1IUFA 2XAHA 3C1DA 4XLEA 5ICCA 4D7NA 1OLTA 3FXRA 2R5ZB 2RQRA 5FU7B 2LMJA 3K70C 4X34A 3GEZA 4QW2A 3K2AA 2UZKA 1DPUA 4OB3B 3JCMe 1B59A 4HV6A 3TGNA 1B1BA 3C2BA 5ICGA 1Q95G 1LJ9A 2DZ9A 3I5RA 4FYWB 2DTIA 5GAMe 1XGSA 2A5WA 2VT3A 1PUEE 2VKHA 2CQ7A 2CV1A 1ON1A 5FU6B 3BDLA 3WU1B 3HSRA 3G6ET 2VQCA 3ISPA 1ETKA 2F6CA 1VQKA 2XHCA 1U9OA 1ENHA 3QJYA 3JREA 2DMNA 1N8RC 3LA2A 1IG7A 2HSPA 2VWFA 1FWZA 3I56T 5EEHA 2M45A 2V26A 3RJPA 1ZTRA 4A0XA 1Y6IA 4B44A 1B72B 1UFFA 1WJSA 2KXCA 3VSLA 4HKEA 5FLXZ 1FBUA 3P7NA 4LB6B 2R7XA 4PJLA 4KISA 3H5RA 2DTZA 2A61A 1WZOA 1VQ4A 5LFAA 4ASNA 2DFHA 4BUPA 2LKPA 4KUMA 1G3SA 1PD0A 1X43A 2YUOA 1NEGA 3NHNA 4Z02A 1A04A 3LH0A 2EILH 1WVRA 3R4KA 1OYIA 1SEUA 3ESWB 3E9FA 4HRIA 4DEXA 4PKCC 1TZLA 4QQDA 3CC7Q 2Q1ZB 2LKXA 3NTHA 2LP0A 4KH1B 3GTQJ 1U5SA 3Q9VA 2LLKA 2X1DA 2VXZA 2E10A 1MMNA 5DCMB 4HT9A 2J6KA 4LLLA 4KGXB 3O5ZA 3MEWA 3L42A 5H20A 2QA4Q 3BOQA 4LE9A 5C3EJ 3EH2A 1MBEA 4II2A 3MKWB 4FYYB 1F9NA 4HAMA 1E0EA 1ZBXA 2FZCB 1VQ4I 4B6MA 1TWCJ 2FOKA 3ROUA 2NRAC 3FXMA 3MN2A 4MFEA 2FBHA 3FRNA 2GGRA 4L9JA 1U1TA 2F5FA 3MKLA 5GAN4 2RGVA 3IH4A 3J81R 3MJXA 3ZGKA 3W6KB 4V2GA 3M0PA 1GV5A 2F5VA 2ABLA 4IIMA 2CUJA 2DTOA 1YI2T 2EQJA 2L9RA 1KQ1A 3BZCA 1BU1A 2TRTA 1Q86R 3KE2A 1RUNA 2XPUA 5B3SH 2HEOA 5D4RA 1R49A 3FDYA 2FX0A 1D0YA 3N4MA 4QQ6A 5GMKj 3V4GA 1WX6A 1I4K1 2CREA 3FJPA 2NUTB 2O2OA 4P9FA 4XKCA 4XMYA 3RMQA 1H3ZA 1WHGA 3EG1A 2CSOA 2ZKZA 2GCXA 3IAS2 2OTJQ 3EFOA 1JGGA 2HQAA 1K83J 4BHPA 1T38A 4NHJA 3BZKA 5D5UB 2KNBB 1X3ZB 1OPLA 4JS4A 2R5MA 2KKOA 4IUPA 3JB9D 4AYBN 3GTPJ 4R79A 2O6GE 2QLZA 4WWCA 2MCNA 3GBQA 4DBQA 8ATCB 4CH7A 1EZZB 3P9CA 1IHWA 2LT1A 5F64A 1GCPA 5GAN3 1KU9A 4ENJA 1YP5A 1T2KA 4RB2C 4M78D 1YCYA 4ZYEA 3UWNA 1TC3C 1U8BA 2EQKA 3QSUA 3M0TA 4M7AF 4RTYA 5KAIC 2RNJA 1BA5A 5K5RA 1ZGAA 4KRTA 2WY7Q 4M9XA 4XRSA 4BI4A 1JTYA 1TBXA 2K5CA 2I8DA 1TSFA 3PGGA 4RA2A 5FFZA 2RB6A 2L9SA 2O3FA 2GQVA 3DLLF 4R1HA 2MSYA 2RN7A 4G12A 3PFIA 3HDDA 3M3YJ 2E1CA 5HCKA 1VQOA 1MIJA 5M5YJ 3JR9A 2VC1A 1SSHA 2DD5A 3L2VA 3KYDB 4BKXA 3CCVQ 2OX7A 3ZMVA 4M3EA 1PWTA 3NEUA 3U9GA 3TW7A 2DXTA 1EH6A 8AT1B 1T08B 4KH0B 4IUUA 4N4HA 5IT3A 1UELB 3JB9J 2L4MA 2HS5A 2GZWA 3A02A 3ASKA 4XTWA 2EYYA 4XU3A 2HZTA 1E6HA 2AT1B 3VV0A 3R0AA 3QKJA 3KXTA 5CQXA 4UB8C 3BCBA 1YIJT 4XONA 1VQOI 2EZLA 2K3BA 2DYSH 1UECA 5CQEA 1Z77A 2WTEA 5HLHA 1HDDC 1P92A 2BGCA 2COMA 3H0GJ 2NVTJ 4MFDA 2FPDA 2M0OA 1XMAA 4RGXA 4II1A 3Q0WA 2JUCA 2W85A 4LK0F 4L5IA 4JDSA 3OYBA 3BTJA 1P2FA 3OW2P 4OVAA 1GXPA 1APLC 1V5GA 1NE8A 2BY0A 1O57A 2A28A 2Z0WA 4GRIA 1MV3A 1MZBA 4OMZA 3K2ZA 5ILVA 3CMMA 4YIRX 4U7DA 2EJGA 5EYRA 5J47A 2H1KA 2DPUA 1SMYF 2W7NA 1VQ7Q 2P7VB 3H9JA 4AIKA 4C3IJ 3SFIA 3KEYA 3CCQA 4BS9A 2Y9YA 4YFNF 2G6FX 5LEJA 3A2KA 1WQWA 4MDWA 2HTSA 4AMCA 5L3CA 3K1MA 3ZPLA 4GFBA 2R5YA 1F36A 4BQOA 4Y52J 3PMTA 3TO7A 2BHZA 5F1JA 2EYWA 4XRSG 4G6QA 2FZGB 4I99C 4BYYA 4YELA 2YLBA 2FPFA 4I0AA 1SVOA 3K7AJ 4KNYA 3CCJQ 1QVGA 4NL2A 4GO1A 1TTYA 4UXNA 4XL9A 4ZTFA 1KQ9A 2IT0A 3PNVA 4ABZA 1RACB 3C7JA 2DBKA 4PSWA 2PQ8A 1SFXA 2QQ8A 4PFOA 5GP9A 5J6XA 2GQQA 2VKNA 5J26A 5CK9A 3RDIA 2F2XA 3CO7C 2JJ7A 3GVAA 2OAZA 3K1PA 3CCQI 3ZOBA 4AD9A 4NUBA 3VYRB 3EETA 1IHVA 1PG5B 1YJ9A 1R7JA 1BKBA 1ZSZA 3OYMA 3IWZA 4HBLA 4MLOA 4IHWA 3I55A 1FMVA 3I53A 3ZMUA 1TWFJ 3IL2A 1LE8B 2IGOA 4BH9A 4CUGA 1VIEA 3QU3A 1NTCA 3AT1B 3A0BC 1S5LC 3HOTA 3OYDA 4GXOA 3G6EI 3B6AA 1SVMA 4I02A 3OYFA 1KHIA 2AKLA 4M75A 1RZ4A 1OCZH 3VRZA 5LBQA 4HVWA 1SVLA 1M90U 3CMAA 1UGPB 4IHTA 4BXUA 3FMSA 3HPHA 3IWFA 2LJ1A 2QAZA 2P8TA 1AEYA 1X6OA 2CGPA 1YJ9I 1B07A 1X69A 3BLYA 3BDDA 3HPWA 3FXKA 1AA7A 4NC6A 1GRIA 3I55I 1ZX6A 3JRBA 2M51A 3CPWS 1PYVA 4XTUA 1WWXA 5KHDA 3KUFA 4M7DC 1BOAA 4DW6A 1BI0A 1ZRCA 2BY3A 2HWVA 1W4MA 3WHBA 3GTGJ 2H3JA 3QRFF 3ZR8X 3VS0A 4HXJA 1YRNA 3ZQGA 2XSDC 2V79A 5HVQC 1XX5A 2DA3A 1JKOC 2LQWA 1WCMJ 2QGGA 4HNVA 1IF1A 2V9VA 1KYWA 2ID3A 2FNAA 4YTLA 5AT1B 3CCMA 1LDDA 1OCOH 1PC0A 3UA7A 1VQPT 2EIJH 2K85A 5M5WJ 1GUUA 3PNTA 2V7FA 5FJ8J 1M90C 3M07A 2DQRA 3H0DA 4PJOC 2JTEA 2ROTA 5CPRB 3VB2A 5KE2A 1YITA 4HCCA 4MQ9F 1TLHB 3IH2A 4L5EA 5DYMA 1JKRC 3OIQA 3LSKA 3CESA 4MEYF 2OF7A 2CV0A 5KYXA 3K4MA 3VS2A 2YUNA 4RBOA 1SD5A 3LSHA 4O5VA 4F91B 3OBWA 5LJ3e 1VQ8T 1L0OC 1Y39A 2HOAA 1NG6A 1SEMA 2WSEE 1TP4A 2J06A 3NTKA 4A3IJ 5LJ5g 2AHQA 1VQKQ 1GFCA 4P96A 2KT1A 2QQRA 1YS6A 2A6HF 1VOMA 5J4YA 1AOJA 2B86A 2DIQA 4DBFA 2XAJA 1WI3A 2K9QA 3S2WA 1OV3A 3OS5A 2KSSA 2C6YA 3UPUA 1WXUA 3CJNA 4A4EA 3QWYA 4LDXA 2LC4A 2E34A 4CRIA 4FETA 2E5ZA 2X1CA 3JRFA 2L4AA 2ZB9A 4M75G 4FX0A 3GCMA 4A3FJ 2LRQA 5LJ5d 1SFUA 2NXNB 4IVNA 4BB7A 4IKFA 2MG4A 2KQRA 2QK0A 4L0YB 3OBYA 2HKOA 3F0CA 2ESWA 3S3OA 2X4JA 5IN1A 4JZ3A 2ECCA 1K0SA 4Y33A 1S8NA 1T0FA 4AT1B 1N5ZA 1D0ZA 1D8JA 3UATA 1PNJA 3Q5FA 5FRNA 2CQNA 1MGQA 3KCCA 3NWTA 2VASA 3OMYA 1VQMT 1LQ1A 1ZH5A 4X6AJ 3J7AY 5HKCA 2KJCA 1ABQA 3AL0C 4A3DJ 2R7QA 1S29A 4QSHA 5J8FA 4WX9A 2LF7A 4HX7A 1YIJA 2VV5A 5ED4A 1IN7A 3QJ6A 4YFKF 1K4TA 3E6MA 1OCCH 4JRIA 1K4US 3OSSC 4M7DA 1XMXA 1Z1DA 2XPWA 2IGKA 3HB9A 4XNFA 1WA7A 3I3LA 2WAFA 2IS2A 2PJRA 1BL0A 2AO9A 3KPHA 4XKBA 1ONVA 5JI6A 3PSFA 1VQNQ 2KHMA 2WAQN 1X2KA 5KCOA 1OKRA 3MEXA 2XG8D 4KGZB 2QA4T 1W5CC 2RI5A 3AKZA 1S9HA 4C0DB 2L3DA 1VQ9T 3CD6Q 2K7LA 4CYCB 4PJOA 2E41A 3G1MA 3S15J 3EHQA 2M87A 1YIJI 3IHUA 4OB2B 2XASA 4C0ZA 1YOVB 4L9VA 1FYLA 4FE7A 2JA5J 5GAN7 3PT9A 2OQGA 4C5HA 4OMLA 1WFXA 3M8FA 1M2VB 2LVSA 2EZHA 2FJ1A 3MZHA 4FCYA 3M8JA 1Y0NA 4A3EJ 5EGOA 4JLIA 1K76A 3ER0A 4JRPA 2VUMJ 2E70A 4M73A 2RQUA 1X3UA 2FB7A 2KE9A 1I5OB 3AG4H 2DO3A 2O8XA 4PSXA 4KUDK 2OTJT 1AZEA 2Z33A 4CCLA 4E47A 2L2PA 4KJZA 3F23A 2VXEA 1FOWA 2V1QA 2JK3A 2WSCE 1D1BA 3ABLH 3JRCA 4WXCA 2CH4W 2JOYA 2E4HA 1RKWA 4OOIA 2DNUA 3CMEA 4QPQA 1FMWA 1E3HA 4KN4X 2Z9OA 2VVKA 4JOMA 5GAN5 1W7PA 2MC4A 1X2NA 4D1QA 1I3AA 1C1AA 4JJDA 1AD5A 2JA7J 2CS7A 5F08A 3GZ5A 3QDFA 3HOUJ 5GMKh 3QO3A 4M4ZA 3SB2A 4HW0A 4C2TA 2ED1A 3BJOA 2SEMA 2HQRA 1FP2A 1D1CA 1OCPA 1KQ8A 2M1HA 3ZL7C 4M7DG 2CT3A 2VB6A 1UUEA 5DV5A 2M9HA 3CZ6A 4U0YA 3NRVA 3I64A 5H6RA 4M72A 4UHTA 3S1NJ 3CMEI 1R77A 3U23A 1ZUKA 3G71T 2M8EA 4A63B 3CCVT 3ERMA 1VQ5T 3SEQA 5JVGF 1U3EM 3I5UA 3HOZJ 2E60A 1WXBA 2F4MB 3VS3A 1UFMA 3A4CA 1M4ZA 3FKJA 3MWMA 4PJOG 5E17F 4M7DB 3DWLE 3KP2A 1OR7A 4ITVA 2M8GX 3FK7A 3VPRA 1VQ6I 2Y0SN 3OS1A 2K9SA 3AG1H 4YIIA 5F27A 4ZYHA 2C0TA 3IQLA 4OMQA 1BJZA 4BEHB 1UEBA 2CH4A 4N9HA 4D8KA 3H5AA 4M6YA 1HW5A 2K4BA 1UDLA 2YS9A 2EFNA 3D5RC 2Q0OA 5EJCA 3OW2S 1N8RR 2PUOB 4XOPA 2MWOA 1KD1R 3IRQA 1SFEA 4FX4A 4NB5A 4PJOB 2Y4XA 3CC2T 1HC8A 5HS7A 3MPUB 3EUHC 2DYBA 2JW4A 3VWBA 4IURA 2HU9A 1XPXA 4UUTA 1REPC 1VI0A 4D0PA 3CCEQ 1WIEA 1EJ9A 5GANg 1VA7A 4IXAA 4K11A 3PM1A 2VPLA 3CDHA 4PUSA 1LEAA 3K4CA 4BHCA 2MH9A 1IREB 4R55A 2WV0A 1PHTA 4UC4A 1FMKA 2JTFA 2ZPHB 2KRFA 2L5QA 2V1XA 3SDGA 5DTDA 1VQPI 1PP8F 1F5TA 3HHTB 3BY7A 1PUFB 5DS9A 1VFCA 5LJ5f 2EH3A 4P1WA 3K4KA 2MLKA 3KBGA 1M3AA 1VQLA 2PMZA 3JAMR 3TOBA 2CRGA 2LQ8A 1YJ9Q 2KGTA 4DBRA 4IZZA 1HDPA 3GLLA 4G94A 1UE9A 2NUZA 2VC0A 5A2QK 1HSQA 3JAMZ 1RLPC 3BW1A 1I6HJ 3LWIA 3NGPA 5GANd 3CUQA 3G3ZA 2FUG2 5TISC 4RB1A 4KA4A 1MDMB 1W7PB 3JSOA 1T56A 2KL4A 3J7AO 2K3PA 3W3CA 4M7AC 2D9TA 2Y0MA 1WHUA 2LQNA 3K10A 5D8LB 3I5SA 3QYBA 2M34A 3CMAQ 2XAGA 5FLXK 4MMKA 3DXJF 2VPRA 1VQLI 2XF7A 3QDRB 2AZVA 2PLYA 4LIUA 1JJ8C 3S6WA 4EIKA 4EM0B 4ZDPA 2DOAA 1JT6A 2MD5A 3AL0B 1WGSA 2B8AA 1H8KA 1RQ6A 3OR1C 4IPAA 4MZTA 1YHQA 4DYRA 1PCXA 2KBTA 2HCKA 3C94A 2K2VA 3CUOA 3CCUA 2LNVA 4HQEA 3ZXSA 1H8AC 1JXSA 1GL5A 2FOWA 4HPQA 4S05A 4U7BA 5D6XA 2GNCA 3HFOA 4OB1B 5GAOr 1ZHFA 2GLOA 1Z3XA 3ECHA 4AVZA 2KT0A 4FM4B 2KK4A 3CCMQ 3CCRQ 1TOVA 5L3GA 1DQUA 1SC7A 3A8LB 1QHHD 2EYQA 5GANj 1FC3A 3WTWC 1RAHB 1X75C 2I0NA 2QGFB 3QG1A 4PLIA 1GVDA 1QO0D 4DYQA 3HOXJ 2VYTA 4R0KA 3JCMX 1Q82R 2KRSA 2OZ6A 3F70A 4LD6A 2GM4A 1SHGA 4NL3A 1Y8QB 4CCJA 5D6EA 3HOSA 1YHQI 4BXXJ 1WJQA 2CP6A 4N9IA 4EMGA 3S8PA 1LKXA 1W6XA 1WNLA 4CGZA 3KP5A 3GNGA 1PJRA 2VQGA 3TO6A 1X19A 1O4XA 2QXFA 2ELJA 5FU6C 4TVRA 3EPZA 1JKPC 1R71A 3HTRA 4MO7A 4XN0A 3PO2J 1S6LA 2IG0A 5C44J 1ZUUA 4C3HJ 3DCFA 2VLAA 5B1AH 1DDNA 2IRFG 4HF2A 2LREA 2BZXA 1AKHA 2JM9A 1EX4A 3QHSA 3EDPA 2MUNA 1Q1VA 5KYYA 1N75A 2VQHA 2JN6A 2YXYA 3CXCA 4AC0A 3M5AA 4E7SA 3JSPA 1VQ9I 2NYSA 3HG9A 4E4HA 3DLLA 4HCBA 4RS8A 1UHFA 1K8AU 3LFUA 2YUQA 5KYWB 2QEXA 3G4SA 2UV1A 4I0BA 1MBJA 2VONA 4BE2A 2V1DA 3WE3A 2PNIA 2X9HA 1IDZA 1I1JA 5GAN2 3DBLB 3QOEA 1G4DA 4KUIA 1YW7A 2HYGD 1UCRA 1LUJB 1CQTA 3ZQQA 5JFRA 2K5IA 1Z3YA 2V9KA 3BR6A 2RD1A 4FT2A 3GTJJ 2EAYA 3CF2A 2D0QB 2K79A 3IP4B 2IP2A 4C5EA 1QVFS 3LMMA 5AIQA 2IGMA 3VJPA 3CC4Q 2DA6A 2DW4A 4NC8A 5A0DA 1I8FA 5FKNA 2STTA 3GFLA 2LCLA 4FW2A 5L3EA 3G4SI 4IL6C 1YLFA 2QSGX 2DBBA 2R7SA 2F2WA 2GBQA 3T8TA 2ESNA 4X1VA 2H09A 3J7YJ 4XK4A 4UV8A 5L3FA 2NUPA 2EQRA 1BYMA 1O3QA 4Z88A 4M77F 1KIKA 3GTOJ 6AT1B 2CUFA 2E2JJ 2KXDA 5ERIA 4WXHA 4X0GA 2O8KA 3F6VA 5BPDA 1QQJA 1B7TA 2HQEA 2DTHA 2HAXA 1STZA 3SJMA 1KHCA 4AFZC 1PRLC 2PFBA 2CT4A 3EH1A 5CLSA 3IH3A 2BY1A 3LA3A 3WU0A 4FASD 3CCLA 2MA3A 2L54A 2W1OA 4LMYA 2KEAA 4JX4A 2VODA 1Y0UA 1N27A 1QZZA 3PL8A 5FLVA 3E0JB 3HL8A 5LJ5e 2JT4A 4OMOA 2OTLA 4G9YA 4A4GA 3G71I 3F3XA 1JRIA 1TNTA 4YIFA 1VQ5I 3GFJA 1P9QC 1M30A 2FL7A 1ON2A 1B3QA 5K7HA 2F5KA 2N8GA 3EGUA 2WSFE 1K61A 3OA6A 4IF4A 1I0CA 4EMHA 2XDDA 1HOMA 1ZA1B 2KDOA 1X1BA 1VQNT 1XCVA 2ESHA 4N0BA 2DFUA 4C0FA 4HNUA 3FWEA 1B72A 5CVUA 4M7DD 3H5NA 3CCLI 4KFCA 4V2SA 4I76A 4HOBA 4BY6B 5IT9R 1EH7A 1S7EA 2MW8A 5GANf 2DJQA 1JHFA 5E79C 4RTWA 2OTLI 4L5JA 2A7YA 4JK1X 4J19A 4LUDA 5GAOp 4Y4RA 3LSMA 5IT9Z 1IXCA 2GA1A 2GXBA 2M9UA 3QPTA 2VBYA 4BQNA 2K3XA 4RM2A 2DFIA 4PJOD 1TG0A 1WJDA 2P0PA 4UV9A 2V6EA 1HKQA 4N4IA 1MD0A 3LSRA 1XSXA 3MO8A 5BMZA 1QPMA 5KE3A 2GTJA 1ZYRF 4L59A 5DCMA 5EC7A 5IOYA 5A2QE 3OYYA 4M7AB 1BIBA 1WGXA 2B63J 3TQNA 1U3OA 2DA7A 2FRYA 4B3XA 1RAIB 3BT9A 1OYYA 1M90R 2HDWA 2GFAA 3M0RA 4J9FA 4JP0A 1PP7U 4EDUA 3UF4A 2RPNA 4EGYA 3VKIA 2A05A 2QM3A 3A01A 2CUZA 2BIVA 2X9DA 5FLXE 5E1XA 1R5ID 1RI9A 2KVQG 2V1UA 1T95A 2OCCH 5GAHJ 2MI6A 1ZGJA 3RKQA 1B9NA 2GF7A 5CIUA 1YJNA 1FIAA 2Z1DA 2EIMH 1A31A 2EQMA 1WHJA 1Z7LA 2LG4A 2NS8A 3KFVA 2KI7A 1W7PD 2IPQX 2UUZA 3INZA 3M0SA 3WXMB 5FLMJ 5FWCA 3RKXA 3OSVA 3VODA 1VTNC 4XLCA 1T98A 4EGZA 4IEJA 2JQ7A 3GOXA 2HVSA 2IS6A 4CICA 2BZ8A 2MIOA 1ZUYA 2DRKA 2HQXA 2HBWA 4BE1A 4EPCA 3I4PA 2XGDA 3A1YA 3EUKL 1V4RA 2CP0A 3UNGC 5E3OA 4ENMA 2LVMA 3THKA 1X1PA 1BN5A 1KQ0A 3OYKA 1S72A 1YJNI 4Y15A 2VI6A 1DU6A 2QVOA 2RREA 3CLQA 4KDPA 2EGAA 1ORKA 2J7IA 1H89C 2K57A 4J9EA 3JCMJ 5I21A 1HYOA 3RIRA 1NM7A 3FXQA 1WQ7A 2IA0A 3J7AF 2VE9A 1KJWA 2LX9A 4RG8A 3I35A 4BY6C 1MV0B 4V2FA 3W6JB 4EJOA 4ORZA 4PFZA 3EYIA 3H3UA 1OX8A 3KP6A 1YJWT 1QWEA 1K9MU 2DT6A 5KH6A 4LB5A 5TGTA 2K40A 5LLQA 2EPDA 1IRFA 3G1LA 1EKEA 4EM2A 2BBYA 1D5YA 2M0CA 3OWTA 3OS0A 3JSCA 3CCET 3F8CA 1S72I 3JCMb 2LH9A 4EJWA 3QWLA 2ZFUA 3DU6A 1UJYA 2LT4A 1G3WA 2XV4S 4QVZA 2BE9B 2AHJB 3Q1JA 2H6BA 2JSCA 3OOPA 1Q1HA 1HD3A 4C92C 2ZSIB 1TQIA 2CSQA 2YU9J 2L8DA 2LNHB 1XTAA 3HZJA 1BB9A 1YITT 1OEBA 4HX4A 4OAYA 4F3QA 4A6EA 1QVPA 3M0QA 5J3LA 3VYGA 4J9DA 2GOXB 2YRVA 1YHQQ 2HNHA 1QWFA 1ARKA 2NVQJ 4LLGF 1OJLA 1XJWB 2B9SA 2BW3A 2FBKA 2NOGA 3PIOF 3A01B 2ZPFB 4F17A 3CCUQ 1ZA2B 3HEFA 5IOZA 1OYWA 2R92J 4UVBA 2EGCA 3GP8A 3ZQLA 1G83A 1FX7A 1ZRFA 4RTUA 3MZ8A 2P7CB 3VYSB 3RUXA 2RQQA 1SAUA 3J81Z 3B02A 2KYBA 1KU2A 3EFRA 4RMNA 5DCFA 1TUGB 4KIGA 3W6VA 1ETQA 2GA2A 5DM7F 3OS2A 1TWBA 1U5TB 3EUAA 2RQWA 4X9CA 1WZ2A 4AG2C 1TW3A 2XD0A 2DYIA 3JRZA 3CPWP 3SFZA 2A6TA 2KP6A 4PGHA 1FSEA 5ILSA 4FU6A 2HQ5A 1BIAA 3HJEA 2PI0A 4EJTA 4ZN1A 5GAOm 3C4SA 2JVHA 1YFHA 4JJCA 4A4KA 3EG3A 2M7AA 2OQRA 1SHFA 1EF4A 1LOJA 1LDKB 5M3MJ 3BQZA 2CP3A 4RM3A 4A53A 2BXZA 2E1MC 1LFBA 4HDUA 3S3MA 4C2UA 4PL6A 1N77A 1FYNA 4L5GA 2HTJA 2KPMA 3ZQIA 1J09A 3L9FA 5DEQA 2EFQA 4BU2A 3HYIA 2ECBA 2DLLA 3VS4A 2CUBA 3N97A 1AHJB 4QT7A 4EMKC 2QEXQ 3G4SQ 3FHZA 3M0UA 5J1UA 4ZJZA 2F2VA 4A12A 1MBFA 3GXOA 3EGXB 1LPQA 2DMPA 4RAZA 3PFYA 2MC3A 3TDUC 5IP6A 2ZJPF 1LE8A 5L8RE 1MBHA 3WTYC 1QVTA 2M4GA 4MIMA 1WHMA 4M77C 4M7AE 2ZNYA 4ZGEB 2P6TA 4DEYA 3W2AA 2R7WA 5HOOA 5FFXA 3WGIA 3RZDJ 3KLOA 2KR3A 3HSBA 3SZTA 1V5EA 1WJBA 1ITYA 3QYGB 3H41A 1WPYA 1XTDA 4JRKA 5GANh 5D7UA 2RC4A 3LSPA 5IXFA 3ABUA 3BTCA 5D5VB 2XDBA 2Y48A 3C18A 2EYXA 2DQLA 2ZJ2A 1Q81U 3PFSA 2ME0A 2BE7D 4F7UF 1FJLA 2OPTA 3QU6A 3SQNA 1NPPA 2OU2A 1RPWA 1QGPA 4AIHA 3PUBA 2CUEA 2DF6A 1YS7A 2K9LA 5KK1A 2IGNA 1F4KA 5KCHA 2A5YB 2ZXHA 1MUZA 4TV7A 2BW3B 4IOAF 3PTAA 1K6OA 2K5FA 4HF0A 1FT9A 2DIGA 2DK8A 4BACA 1FPQA 2I5UA 2IXSA 2OA4A 5LRRA 2HOSA 4A3CJ 4FT4A 4Z6YA 4J9GA 3JRDA 1MMGA 2J05A 3CC4T 5B1BH 1GVJA 1W1FA 1A6QA 4R8HA 4F7UE 2EV5A 3OSFA 2WY8Q 2F5EA 2RJEA 4F16A 3ABMH 5DM7R 3SHWA 2HZYA 3M59A 4ELYC 4M7AD 1Q81C 4ESFA 2KYMA 3A8MB 4NS5A 3S32A 2EZIA 1RUOA 2CP2A 2VGNA 1K0XA 1UHMA 4JRQA 4DZPA 4I6ZA 3WTUC 2DEUA 4XLAA 3V8KA 2P0KA 2E1OA 2VXDA 2BEOA 3GPLA 3X25B 2H27A 2LBFA 4ZN3A 3GFMA 2EK5A 4J9BA 4XRMA 1K4SA 3QYEA 1XSVA 3BG7A 1YBYA 3G6EA 1AWCA 4E7LA 1RNLA 3F22A 2P4WA 1BCMA 3P5JA 1OQYA 2FSWA 4GDFA 2DL4A 2F69A 4FL6A 4XU0A 2NLUA 3I56A 4IQJA 4Z89A 2R7TA 2FRHA 2KIFA 5K1YA 1IN5A 1X58A 4EMKA 2CJJA 2DOFA 1BBYA 4Q48A 3BJ6A 1QU3A 2P4TA 1Y56A 4HLXA 1BI2A 2ZMEC 3LSJA 1TXQA 5EEGA 4EMSA 4DYCA 5IPAA 1NPRA 3FX3A 1TU0B 1UG1A 5LGUA 1VF9A 1ACIA 4EQQA 4AYBA 3LYIA 2DL5A 4DIQA 1KC8U 1Y07A 1RETA 3MEAA 3E6DA 4PNOA 4J01A 1ABOA 4L0ZB 1NJIC 3HXLA 4LGWA 3I56I 1GT0C 2LY1A 2UXNA 3EYYA 4RKUE 1A35A 1K9AA 3FEOA 2LR8A 1J7KA 2HPMA 3E97A 4C92B 2A3LA 3G73A 1UG0A 2H3EB 3RMSA 3FC3A 3CCST 1MH3A 2HVQA 3KX2A 1YJWI 1KYZA 4GYGA 5FKKA 4UUVA 1Z9QA 1WKMA 3LGLA 3OL3A 4BI8B 1LCKA 1MNDA 4II3A 5J1YA 2VKVA 3L2RA 2QTVA 2IVMA 2IJLA 4B8XA 4BAYA 3GZNB 1MBKA 2O7OA 1JO8A 1E17A 3H1CA 1YI2A 3TO9A 3KEQA 1KC8C 3UR3C 4BNCA 3MP6A 4FE4A 1WFWA 2DE0X 2OI3A 2FRWA 5AYFA 1ZQ3P 4EV0A 2FU4A 1OZ3A 3A8GB 1MJ9A 4CZCA 2CQKA 2PUKB 3HBLA 4CYCA 2W25A 4F52A 3G2BA 1IJWC 1XGOA 2P5LC 2EJ9A 2JMCA 3J80K 3M1CA 1YITI 1RI7A 3JRHA 3H3VK 1E2XA 3H36A 3OYIA 1FOXA 2RM4A 2CQQA 1TWGJ 2V1NA 2KZVA 3K1NA 4C8QF 3FMRA 4A0ZA 2GAUA 3FM3A 3GWZA 1WHKA 2EQUA 3HP9A 2WBMA 4IUTA 2BUDA 1PDNC 1M2VA 3HOYJ 1UJ0A 1GV2A 4ESBA 4Q4ZF 2Q2EB 2F2EA 1FOYA 1YI2I 1H88C 4EJVA 2K3YA 4JS5A 2EVRA 2FMYA 2LBFB 1YTYA 2EKOA 5DM6F 1X1AA 2QENA 2E1MB 1C0MA 1SRMA 2ZCWA 2KY9A 1YYVA 1R1TA 2JUGA 1JI8A 4AFSC 3EAEA 1MMSA 3F21A 1H3HA 1M1GA 3NPFA 4C8QE 5EEAA 3WTTC 1I50J 2W57A 3MAJA 2JTMA 2LCCA 2E5QA 2VE8A 1ODDA 3L09A 3S16J 1O9SA 2KRMA 4OMMA 1IN4A 3BG5A 3FMQA 3KZYA 1I07A 3M54A 4IIOA 2L02A 4EMKB 1K8AR 1PKTA 3BG3A 1JUMA 2ZMEA 1KU3A 5E3NA 2HYFA 1NG2A 2MF2A 4E7JA 5LEKA 3MCZA 3COAC 3P8DA 3RQ4A 1UZCA 1OCTC 4AIJA
chains in the Genus database with same CATH topology
2LF8A 5DD8A 3ZN1A 1XOVA 2DPDA 3R0JA 1KG1A 1P4WA 1D3BA 3RTRA 3GO5A 2RJFA 4MQVA 2P6SA 1U8RA 4EJUA 4J6YA 3VUBA 3KP7A 1W4SA 4Y91A 3JCMW 2RI2A 1IAWA 4RG2A 5E18F 3CC7T 4X9DA 2PQWA 3ZMDA 2FA5A 1M5Q1 3ZFJA 3LW5E 2OAUA 2RK1A 1VQMA 5K5QA 2EJRA 2D2WA 3MEUA 3DQVC 1CF7A 4QLC