1G3TA

Cys102ser dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
215
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 67
structure length 215
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3tA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3tA03
5BPDA 1SAXA 1ZGJA 1QO0D 1S7OA 4LG0A 3FZVA 4KNYA 4EV0A 1IZ1A 2V1DA 3REOA 2ZNYA 3WTTC 4N9HA 1LDDA 2UZKA 4KFCA 2FNPA 2BYVE 4M6YA 2PJPA 1YO5C 2JPBA 3R4KA 3JAMK 1RUOA 2M87A 4IHSA 2ZBKA 3KP2A 5E18F 4CXFA 2GA2A 3TOAA 5K5OA 1FY7A 3FM3A 1CF7A 3K9TA 4FT8A 3R61A 2RC4A 3T1BA 1F4KA 2FQ3A 2RKHA 4KICA 3IWZA 2K5IA 3HHGA 2KIFA 1HKSA 2YU3A 1I6XA 3HRSA 4BH9A 2EV0A 2IPQX 5H20A 1D8KA 2DPUA 4A5MA 1XSDA 3G3ZA 4HW0A 1XSXA 1IN4A 4RAYA 1BC8C 2J5OA 4YFXF 1HQCA 3RTRA 4BYYA 2L02A 3WG9A 1R5GA 2XROA 3J80K 3CUQA 2VN2A 4CO8A 5K5QA 3KP4A 4DQ2A 5JHUA 1JE8A 3E97A 4O5VA 4WWCA 4ZH4F 1Q1HA 1MGTA 1UHMA 2HWVA 3QU3A 4HQEA 2P4WA 4ESJA 1V3FA 2A5YB 4M9XA 4G8XA 1W7PA 2W25A 1EH7A 2AS5F 4PCQA 4EVIA 1XDUA 2F5DA 2K27A 4DNCA 4HLXA 3HOTA 4AD9A 1IN8A 4WF2A 1J7KA 1FOKA 2PLYA 4EJOA 2IA2A 4L9TA 4YG2F 2QLZA 2IA0A 4HBLA 2C6YA 4G94A 3IWFA 2W84A 2PFBA 5HS8A 1BI1A 3HRTA 1XB4A 4U0VA 2ISYA 4XSXF 3DKWA 3MZYA 3L00A 5LRSA 4GCVA 4UXNA 2GCXA 4TV7A 2BV6A 3LA3A 2DO7A 3E5UA 1HSTA 5E1ZB 1STZA 2ZO4A 4HQMA 1D5VA 4BHBA 4M6XA 2D2WA 1ZG3A 5CVRA 3E19A 4GO1A 1V4RA 5FGMA 4CGZA 3AAFA 3GF2A 3IRQA 1PUEE 1IXSB 3EDPA 1MJAA 1R1VA 2DAOA 1UCRA 2J5PA 2XRNA 5D6FA 5ERIA 3K2ZA 2DQLA 4AWXB 4WXCA 4CYDA 4LLGF 3DPTA 4KIFA 1MJ9A 2PI0A 4LG0B 2GXGA 3GZ6A 1FNNA 3NEUA 1A04A 1ZLKA 2EA2A 3WTZA 3Q9SA 1S7AA 3D0SA 2XV4S 1W7PB 1I1SA 2K4BA 4L5IA 2P8TA 4ON0A 3KLOA 3QRFF 4EMSA 4HF2A 5D6EA 5J8CA 1U78A 4UVBA 1P6RA 5E8IA 5E17F 3BZ6A 5HS9A 2ZCWA 4OU0A 4A0XA 1SFXA 1D8JA 4ASNA 3GWZA 2D45A 4Y17A 3I0TA 2BEOA 4KA4A 2CO5A 2DU9A 2QVOA 1R00A 2EFOA 3R6SA 4I09A 1IRFA 4R79A 2JSCA 3FHZA 3DF8A 1I5ZA 4WX9A 3TDUC 2Y75A 4WK8F 2GIVA 1B59A 4LFUA 2L4AA 4HZFA 1W5SA 4HV5A 2F2EA 3U1DA 2WWYA 2VT3A 2A07F 4M9ZA 1B4AA 2P7VB 2Q2EA 3K1NA 2XKOA 4M73A 3C3WA 2M1BA 2H6BA 3J7AO 2OD5A 1WRJA 3U2RA 4Q4ZF 1FLIA 1G3YA 4ZYDA 5EEHA 2GAUA 3T8TA 4AIKA 1OYWA 1GXPA 2IP2A 2F5FA 3QPTA 2K86A 1H0MA 5BMZA 3BJ6A 5E8GA 4A6EA 1T2KA 5IT3A 2EV5A 2F5CA 4MGRA 2VBWA 2FSWA 3MHXA 1RI7A 4WXDA 3HTSB 3P9KA 5L3CA 2X0LA 2Z3YA 4HAMA 2ELHA 2OU2A 3F8CA 3MWMA 4Q47A 3DQVC 3VB2A 1R1TA 1SMYF 3F8MA 1YS7A 4HV6A 2HGCA 2M30A 2PN6A 1B1BA 4D0PA 3J80Z 1OR7A 5L3GA 1OPCA 2B0LA 1ZREA 5HS7A 4ESFA 3OV8A 3DXJF 3KEQA 4OOIA 1XGOA 5ICEA 1Z6TA 3WTYC 2L4MA 2W57A 1X3UA 2V9VA 1WI9A 1ZYRF 4B09A 4FHTA 1F5TA 3FX3A 5AIQA 4RS8A 1RIOH 1DUXC 4N9IA 1ZN2A 1TQPA 1USTA 4HOBA 3QPHA 4EJUA 2MD5A 4KN7X 3CUQC 2QUFA 2VC1A 2DLLA 4E70A 3R0AA 3N97A 1SFEA 4BHCA 1G6NA 2ISZA 1FBQA 1J59A 3WTSC 1KYZA 2PG4A 3SHFA 4GXOA 1TQMA 3BPXA 4BNCA 1U2WA 4NHJA 2HEOA 1LDJA 1ZARA 5FFXA 4XLNF 2VXZA 4L9VA 4KN4X 3F6VA 1TQIA 3EYYA 4EGYA 3KFWX 3TGNA 1R1UA 5K1YA 3ZN1A 4M72A 2P5VA 3FWEA 3DV8A 4R8HA 3BDDA 3ROUA 4A5NA 4BXUA 3L9FA 3LAJA 5H6RA 2KIMA 2PQ8A 4LGWA 1P4AA 1J2XA 1MDMA 1FT9A 4L9JA 4EJVA 2G7HA 2EFNA 1FYKA 3B73A 3VEPA 4LD5A 3SFZA 1CF7B 4Y15A 2XUBA 1W5TA 1HKQA 3KE2A 4IXAA 5D5XB 1YW9A 1U5TC 3HIFA 3I54A 1O7FA 1KQ9A 4U7BA 3VODA 2OQGA 4P55A 3F3XA 2NNYA 4Z2YA 2M5WA 3ZMTA 5F1RA 2FE3A 5D4SA 1R22A 1Z91A 1VTNC 3S2WA 2O0YA 2QENA 3I58A 4MTEA 3GVAA 4NB5A 4AIJA 2LNBA 1YW8A 5LBQA 4YFKF 1BIBA 1FP1D 4ESBA 2AXLA 2FNAA 4P5OA 1GHCA 2WV0A 1KU3A 4AVPA 2YPRA 2NRAC 1BC7C 4HX4A 3V8KA 4HYEA 3MQ0A 5J8FA 1BBYA 5DDGA 3NQOA 2ESHA 5HLGA 2DK8A 2FEZA 4JK1X 1G3SA 2EWNA 1MJBA 2BE5F 4XBFA 1QZZA 4U0YA 5ILSA 4LLLA 2O61A 3E6DA 2IRFG 2KJBA 3RJPA 4WXHA 3LSTA 1CGPA 1OKRA 4M9SA 1WWXA 4HX7A 2NNNA 1IRGA 3WU1B 1T98A 3C18A 5A2QK 5HOOA 1IN5A 4MHGA 1FPQA 2MBFA 3BJAA 4CDGA 3U9GA 5IT9Z 2CQKA 2H09A 2BBYA 2QBYA 3E6BA 5BOXA 3JW4A 1R23A 5LHGA 3R60A 2ETHA 1JGSA 3GUDA 4A6DA 1QQIA 5ED4A 4IPAA 3WGHA 1PP7U 2P7CB 3J81K 1P92A 3KP6A 2FMLA 3FF5A 2P5LC 3QP5A 1PP8F 1LQ1A 2DPDA 4HX8A 1XGSA 2YR2A 3KZYA 3QP6A 4CZZA 3GX4X 5LHIA 2VBXA 4RB0A 4S05A 2H27A 2L01A 5LHHA 1BI0A 2UXXA 3KP7A 1W4MA 3C7JA 3FXRA 1J75A 3DFGA 3H3ZA 3F6OA 3CLOA 3PQKA 3F21A 5BQTA 5D8KB 1IAWA 4L18B 3MCZA 3JTGA 2K02A 4OIQF 1U5TB 5JFRA 4RB3C 4RB2C 3GZ5A 2LDUA 2O8XA 2QM3A 5DEQA 2DT5A 2E7WA 4UUVA 1FZPB 4L0YB 3FMSA 2FU4A 3I4PA 3HOSA 1F1ZA 4Q48A 4ETSA 1FWZA 4G6DA 3TDZC 4K2EA 4A2UA 2H6CA 2XAJA 2LX9A 1T0FA 2M45A 4KMUX 3TQNA 2KKOA 1KA8A 4YIFA 1IUYA 1ZRCA 1BI3A 1USSA 3P9CA 3Q9VA 3HSFA 5D4RA 5FFZA 3IRRA 3RPUA 2MH9A 5CVIA 5D8LB 1QVPA 1LEBA 3HSRA 3RDIA 2K7LA 3ULQB 6PAXA 2K5LA 4QWQA 1BOAA 2IW5A 3IL2A 1ZLJA 2Z99A 5HLIA 1SD7A 4EM1A 1ZGAA 5K5RA 1QBJA 2OBPA 4UVAA 4OIRF 1ON2A 3GFLA 1DPRA 1WKMA 3E5QA 1MDMB 1UB9A 2CW0F 1ZAOA 2P6SA 4WCGA 3J81Z 1WSUA 2XASA 2QWWA 2GZWA 2STWA 4IRHA 2VOPA 1IXRC 3RYPA 3WTUC 3KLNA 1KU2A 2EFWA 3T0YA 4KYWA 5FD6A 1BI2A 2XVCA 4BHPA 1B9MA 1MD0A 3ZN0A 2VOOA 2ZFWA 3ZPLA 1ZH5A 3DPLC 3RKYA 1OYYA 2OQRA 2HR3A 4OMYA 4P96A 5E1WA 1FP2A 4MNUA 1UHWA 3M9AA 1SMTA 2RNJA 2D1HA 2A3SA 1JHHA 2E1NA 1FSHA 3SQNA 3O6BB 2HS5A 3TO9A 3HRUA 2XIGA 3TOBA 3EYIA 2RN7A 1H9GA 3K1PA 5HDGA 4I0AA 4R1HA 1XSVA 1L0OC 3JTHA 1GXQA 3ERED 2Z33A 2ZNZA 3W6KB 4KUMA 5LLQA 2FMYA 1O57A 4HDVA 3JAMZ 3BY6A 2XAQA 2K4JA 3GFIA 2PMUA 1K78A 1B9NA 1BM9A 3E5XA 5ILVA 4N0BA 2HDCA 4UNOA 4PGHA 2EJRA 3C1DA 2K4YA 2F5EA 4UV8A 3E6CC 3JSPA 1YYVA 2FBIA 3RKXA 2ZJ2A 3HSEA 1YW7A 2HQRA 1HW1A 5DYMA 2QYOA 4KT5C 1YG2A 5ICGA 3M7GA 2DTRA 1R7JA 3GFJA 3KP5A 1G3TA 5E1XA 2COMA 1DP7P 1KGSA 4U0WA 2FBKA 3I5UA 3RKWA 2MLGA 1R58A 1K78B 4I0BA 4G9YA 2XAHA 2CSOA 4M74A 1I1GA 1R5HA 1C0WA 4FX4A 1TW2A 2A68F 2W85A 1FBSA 3TO6A 3PFIA 2Q0OA 4NQWA 4BAYA 3ZMVA 1QGPA 2MH2A 3V7RA 4LB6B 3RYRA 3HHHA 1TNTA 2EB7A 1JHFA 1OYIA 2MA3A 3ZMDA 3V7CA 5BS6A 4EQQA 4HF0A 2EFPA 1MKMA 4O6JA 1LVAA 2FF4A 2RGVA 1LB2A 4P9FA 3Q5FA 2BGCA 3IKVA 5JI6A 1BIAA 2QQBA 2DK5A 4OIOF 3GW2A 2STTA 4GYGA 3I59A 2LF8A 2HKXA 1FSEA 1IF1A 3T8RA 2YSRA 3ZMUA 2W24A 2JT1A 2HTSA 2D1VA 1L3LA 2A61A 3RPQA 2MC3A 1LJ9A 1J5YA 3F8BA 1IW7F 2GXBA 3BPVA 5TRDA 2M8EA 5CLSA 4RB1A 4MEYF 2DFIA 2MLKA 1XCVA 2DQRA 3IHUA 2ZKZA 1UFMA 1O3RA 5D5UB 2CFXA 1YFHA 5DUKA 1IN6A 3RIRA 1PDNC 2Z9OA 3ECOA 2L3DA 4UHTA 4LJZF 3LQQA 1OMIA 2VBYA 5DD8A 1LDKB 4CHUA 1BYMA 1Z1DA 4ZYHA 2XAFA 5DCMA 3G73A 1ODDA 5IT9K 3RI4A 2FBHA 1SD6A 1QPMA 2Z5UA 3WTWC 2JPCA 4UV9A 5D5VB 1XCBA 1XGNA 3WE3A 2R7DA 2ZXJA 2XKPA 1Z05A 4A12A 2HKOA 2YX4A 3MFKA 4LK0F 4KMFA 3O2PE 4B8XA 2R7FA 1YIOA 4MTDA 1JXSA 3KZZA 3COAC 3VFZA 1S3JA 2CGPA 4PDKA 2OAZA 3F8NA 5LGUA 4LLNA 3KCCA 2IA1A 3V4GA 2O6GE 4CICA 3MAJA 4QLCU 4L9NA 5HDKA 3E3VA 3L09A 3LQRA 2EV6A 2CG4A 3P9IA 1KU9A 2FOKA 5FLXK 2OZUA 2VBZA 2VE9A 5J6XA 1P2FA 4HDUA 4L0ZB 2QQAA 4YFNF 3HTUA 4EJWA 3I59B 3LA2A 3V8LA 4LMYA 4A0ZA 3JSOA 3ZQ7A 2O03A 5ICCA 4ENNA 1T39A 1SD4A 2NYXA 1ULYA 2FXAA 4KIBA 2R3SA 4UVCA 4EGZA 3T5XA 1W7PD 4XSZF 4ZYGA 2VT2A 3DEUA 4I7HA 3ML6A 1DDNA 1HSJA 3H3UA 5ILUA 2RQPA 2P6TA 1T38A 3CTAA 3CO7C 3GLXA 1F9NA 3F72A 3IC7A 1BJAA 3CO6C 3HRMA 4ZZLA 5CVJA 3WE2A 4IJAA 2ACJA 3R0JA 1D3YA 1DPUA 4MQVA 3H92A 3NRVA 3ZP5A 3TO7A 3CUQB 3FXUA 1E2XA 5HLHA 4ENMA 1B6AA 4IHTA 4M71A 5KVRA 3B02A 4G7ZF 4G7HF 3WU0A 2CYYA 1IXCA 2WTEA 3L2CA 1GVJA 4U7DA 2RDPA 4MQ9F 3BP8A 1YS6A 1TNSA 4PZJA 1BN5A 5LEJA 1G4DA 2K5FA 5F64A 1HBXG 2ZMEA 3M1EA 3GEZA 3FM5A 3LA7A 1I27A 2A69F 4H0EA 3K0LA 3WGIA 3MZHA 1SFUA 1TLHB 4LK1F 2ESNA 5H6QA 2DI3A 4RAZA 1FX7A 5CVUA 2L54A 4JBAA 3L7WA 3F22A 2PBIA 2UXNA 3EUHA 1Z7UA 1O3SA 1S29A 4HLYA 3SZPA 1RNLA 2UWMA 2HTJA 2O3FA 1P4XA 1U6GA 1QZYA 2KIUA 1SD5A 4OMZA 4RGSA 5DCMB 2EA4A 1IN7A 2RVCA 5D5WB 5FLXZ 1K7AA 3I64A 4FX0A 2XAGA 3EETA 3ZMSA 4XRFA 4A0YA 1TW3A 3FXQA 4BQAA 3O3KA 1QNTA 3HUGA 3KETA 3DP7A 3SZTA 3I53A 3QU6A 1Z6RA 2RV8A 5A2QZ 3BJOA 1LNWA 4XLPF 3QAHA 2V6CA 2XHKA 3GXOA 1R36A 2GQQA 4ENKA 1RUNA 1ZRDA 1K6OA 5FO5A 2E1CA 2FA5A 2VE8A 5AIPA 4ZZDA 3TKYA 1ZG5A 2YX7A 4PGGA 2X4HA 4ZYEA 1RZ4A 4L5JA 2V1XA 3PQJA 1YLFA 2QBYB 1YTYA 3MEXA 2JRTA 2Y0MA 2H3JA 2IT0A 3KEOA 1EV7A 2Q8KA 1H9TA 1EH8A 1XGMA 2EFQA 1P4WA 2CWEA 4AIHA 3BROA 2VC0A 2FRHA 2VODA 1TTYA 2V1UA 3W6JB 4F7ZA 2HOEA 2OA4A 2V79A 2HFHA 3FMRA 3HYIA 1AOYA 1S8NA 1O3TA 4OIPF 1XD7A 2NAZA 1T6SA 2KJCA 1FYLA 1KU7A 2G7UA 5LGNA 1HW5A 2H94A 1XN7A 4KDPA 1J9IA 2WC2A 5HVQC 2NS0A 3SXYA 4YIIA 3OOPA 4LB5A 3V7SA 3VOEA 3K1MA 3LFKA 4ENJA 2OZ6A 1KQ8A 4HF1A 2QZ8A 2ADUA 1KYWA 4Y13A 5F6FA 1WQ2A 1K79A 1TBXA 2GWRA 5L3EA 2JZYA 3CJNA 5EEGA 5KK1A 4S04A 3ABTA 5LRRA 4I02A 2IVMA 3EQLF 4O3MA 2HYFA 2LF7A 2DW4A 3LWFA 1ZRFA 3WTXC 2HZTA 4EM0B 5DUIA 1E17A 5JVTA 3N4MA 2Y48A 1O3QA 2IJLA 4IRGA 3ABUA 3GFMA 5E20A 3GO5A 2G9WA 2XGXA 3BWGA 1ZG1A 5JR3A 4JQFA 1U3EM 2HYGD 1EH6A 3WODF 5LEKA 2HQNA 4IVNA 2DBBA 1YQAA 4G6QA 4RGXA 3M8EA 4GGGA 3WTVC 5LGTA 5ICFA 1O7LA 5FB2A 2PEXA 3P7NA 3D5LA 5L3FA 1J0RA 2VONA 5CVVA 1S6LA 3LAPA 2A6HF 1XMAA 5CYVA 1Y0UA 3IKTA 5FD5A 2QQ9A 3F23A 5TJJA 4HA8A 4P9UA 3QOPA 2KRFA 4U88A 2GA1A 5L3BA 2TDXA 2EK5A 4EM2A 4RGUA 4RGRA 1U5TA 5DCFA 3E6MA 4G7OF 4GYIA 3GYHX 1REPC 4Q5SF 3ISPA 2LSOA 1FYMA 2LKPA 3ELKA 1ON1A 1U8RA 1XMKA 5DV5A 2A6EF 1KQ0A 3FMQA 1HKTA 2JTVA 1NHAA 3CDHA 2PMHA 1FBUA 3V8JA 4I98B 5DD4A 4I01A 3CUOA 1QW1A 5CJ9A 4IRIA 4MEXF 3WGGA 3ECHA 3BOQA 5AONA 5HDNA 1HXDA 1ONVA 3KP3A 2E7XA 1ZHFA 1FC3A 2P5KA 3ZMZA 1Z9CA 1LEAA 5L3DA 1XDSA 1HW2A 5BPIA 4I2OA 4KIGA 3I71A 4IF4A 4OINF 4EJTA 2ZMEB 1MZBA 3M8FA 3K69A 3F8FA 1G3WA 1AWCA
chains in the Genus database with same CATH superfamily
3CCSI 3MEVA 1B72A 5BPDA 1QWEA 4FIBA 2RI3A 3JRZA 2DL5A 1SAXA 4GFBA 2B8AA 4ZGJB 1ZGJA 1QO0D 1S7OA 1AWJA 4LG0A 2HQ5A 3FZVA 4EV0A 4KNYA 1YWPA 4C92B 3BC8A 4KT6A 1IZ1A 2V1DA 4II2A 1GFDA 3REOA 3RZDJ 1JU5C 2ZNYA 3WTTC 4N9HA 1MV0B 2RQVA 1LDDA 2P81A 1RETA 2HDDA 3MKDA 4K11A 5GANe 2LK2A 2UZKA 4KFCA 4F7UF 2AKLA 2CUJA 4PNOA 2FNPA 2BYVE 2DOAA 4LITA 4M6YA 3SDGA 3JR9A 3M4OJ 2GF7A 2JMAA 2PJPA 3I5RA 4PL6A 5L23A 5GAN8 5K7FA 1ZBXA 3INZA 1YO5C 4D9JA 4BXXJ 2AK5A 2EYZA 2ELKA 1QVGS 4BE1A 2X4WA 3DLAA 4ESRA 2DYRH 2JPBA 5JVGF 4IX7A 4WTOB 1WYXA 2M02A 1JJ6C 3HTRA 1WHUA 3CZ6A 2DOFA 3R4KA 3VYRB 3JAMK 1EZZB 3PNWC 3Q0WA 5IY5H 1RUOA 1TOVA 3OB9A 2M87A 1YJWT 2R7SA 4IHSA 2ZBKA 3KP2A 2K2VA 4F93B 1Y6IA 4XKVA 2XGEA 3QHSA 4C8QG 3KYCB 2NWMA 2MIOA 1ABQA 2M9HA 5E18F 3CCLI 4CXFA 3SWNC 1IDZA 3HL2A 2FL7A 2GA2A 1N8RU 2ZFUA 2DFFA 3TOAA 1GBQA 3CCET 1D1CA 5K5OA 2COWA 1FY7A 3FM3A 1NPRA 4NOYA 1CF7A 3K9TA 2M0YA 4G6TB 5AYFA 4BQOA 4FT8A 1YJ9I 3R61A 3A02A 2RC4A 3H0DA 2RHXA 2BY2A 2LY2A 3T1BA 2FQ3A 1F4KA 2RQRA 3JCMg 5BNGA 1Z9QA 2RKHA 1JJ2A 1V1CA 4AUXA 1PNJA 5K7ZA 3URGA 1KONA 2X6XA 4KICA 3IWZA 3HOYJ 2DBKA 3QYBA 2K5IA 3HHGA 2KIFA 1HKSA 2YU3A 1I6XA 1E3HA 2R5AA 3DB4A 3HRSA 5HK3A 3MEAA 1D5YA 3JB9D 4BH9A 5E79C 4KISA 2EV0A 2IPQX 3OYNA 1WGSA 1H92A 5H20A 1D8KA 2O31A 2DPUA 4A5MA 2J7IA 1XSDA 3PNTA 1G59A 4B48A 2XGDA 3G3ZA 3MN2A 3M5AA 4HW0A 4C5HA 2L8DA 2Y31A 1XSXA 5IOYA 1IN4A 4RAYA 3M55A 3TQ7P 4M75F 2R5YA 2KI7A 2L3SA 1BC8C 5GAMe 1MMNA 5EGOB 3KYLA 2CSIA 2J5OA 3LSJA 2HQEA 4YFXF 1HQCA 1VFCA 3RTRA 2DMTA 1KK7A 4BYYA 1UAAA 1EA3A 2L02A 3WG9A 1R5GA 2G6FX 2XROA 1SKUB 3J80K 4KGVB 2X1DA 2VN2A 3CUQA 3CC4I 1JTYA 4LNPA 4CO8A 2JMWA 1GCQA 2CW7A 3CCYA 2QA4I 1WZOA 5K5QA 5GPAA 3OYJA 3M0TA 2ZPEB 3CCRI 1A5JA 3NHNA 3LH0A 3KP4A 4DQ2A 3K4NA 1T0HA 4XU2A 4Q5WA 1YJNI 1AA7A 1NE8A 2AHJB 2QSFX 5F1JA 3QYGB 3OR2C 2IXSA 3H6ZA 5JHUA 2X1EA 1TWCJ 1JE8A 5LJ3h 3E97A 4O5VA 4WWCA 3ZQHA 4ZH4F 1BB9A 1Q1HA 4M4ZA 3MP6A 1MGTA 2MC4A 1UHMA 3IUOA 3W2AA 2FB7A 2HCKA 5B1AH 2CUZA 2CZ1B 2HWVA 4XTVA 3QU3A 4HQEA 4Y92A 1XG1A 3ZQLA 2QTXA 3WU2C 2K9GA 4MZMA 1OCCH 4NDLA 3L2VA 2P4WA 4ESJA 2C0OA 4E7JA 1W0TA 1V3FA 3X2QH 2A5YB 2X6OA 4M9XA 4G8XA 4XLEA 1RADB 3E1SA 4N4IA 1BR4A 1W7PA 2LH9A 1UHSA 3JRFA 1U1SA 4D5CA 1B72B 2RN8A 2W25A 1M2VB 1S72T 1EH7A 2AS5F 3I4MJ 5GANd 3G7ZA 1MMSA 4X34A 4PCQA 4EVIA 1HSQA 3A0HC 2KYBA 3BFMA 1XDUA 3BG9A 2F5DA 2K27A 4DNCA 4CC2A 5IXBA 3CCVQ 4HLXA 4PK4A 1B3QA 3HOTA 4AD9A 1IN8A 3PFYA 4WF2A 4RTTA 1J7KA 2H1KA 1FOKA 2PLYA 4GBQA 2E6NA 5J26A 4J9EA 4HNTA 2B7EA 5FKLA 2QGGA 1NBEB 4EJOA 3OSVA 1YJ9A 3M59A 1QVGA 1OPKA 2DX1A 2IA2A 4L9TA 3ZOBA 2QLZA 4YG2F 5GANj 3MP8A 1K8AR 3A8HB 3TREA 4BUGA 1BOBA 2IA0A 1IO6A 1PHTA 4HBLA 2C6YA 2L5QA 2AO9A 4G94A 5KCHA 1VQOQ 4IUUA 3VPRA 3IWFA 1LPQA 2DL8A 2XF5A 2SRCA 2W84A 1ZA1B 2F1LA 1K0XA 1OCPA 3BTCA 5J3LA 2PFBA 5HS8A 2RQWA 3F0CA 3CXCP 3QWYA 1BI1A 1W5CC 3HRTA 3S8PA 4F91B 2O2OA 2MPXC 1XB4A 3MKLA 4M3BA 5J47A 2QTVA 4U0VA 2ISYA 4XSXF 3M9QA 2ROLA 1MMGA 4J9CA 1SAUA 3DKWA 5GAHJ 4BI3A 1UELB 2DA7A 3RERA 1Y0MA 1HF0A 2HYJA 2ZMEC 3MZYA 5F27A 1QP3A 2XPUA 3L00A 4IZZA 4JRQA 2GXAA 3PUBA 2ZC2A 1IHWA 1T3LA 5LRSA 2YSQA 4GCVA 4RKUE 4UXNA 2GCXA 2K7AA 3PGGA 4JDSA 4M6VA 4PFZA 3H5NA 4TV7A 1E3PA 2BV6A 2IEKA 2MW8A 3LA3A 5EG0A 3JREA 3K4JA 3CCVI 1Q95G 2E5QA 1YI2T 1T8IA 2YRDA 2DO7A 2A36A 4XU1A 3CCEQ 3L1PA 2EJFA 3E5UA 4LDXA 1UUEA 2YRCA 1VQ4T 1VQ8I 4C5GA 1HSTA 5E1ZB 2B86A 2Q1ZB 2K3XA 2CP2A 3T9NA 1STZA 2VQLA 2EYYA 2ZO4A 4HQMA 2NVQJ 3IH4A 1D5VA 4BHBA 4ZNXA 4M6XA 2HL3A 2WSFE 2RD1A 2F2WA 3M57A 3UATA 2RH2A 2D2WA 3DEEA 3I56Q 2KYMA 2CW8A 1WH7A 4MDXA 1ZG3A 2MUNA 2V8IA 4Z8AA 5AT1B 5CVRA 2E2JJ 3TSZA 2OTLT 3E19A 4GO1A 3HFNA 2NUPB 1V4RA 1Y8RB 2EYQA 5FGMA 2FRYA 2MYSA 1UGQB 4FYXB 4CGZA 3AAFA 5FWBA 4JX5A 3GF2A 1IXDA 2N8GA 4DOVA 1K1ZA 2EBIA 3IRQA 2XICA 3JB9F 4BY6C 1FTZA 4HCZA 1WJAA 1X4OA 1QA6A 2DA3A 4RBOA 4E7IA 1POGA 2L3QA 3QUIA 1Q81R 1VIEA 2ECBA 4ZDLA 1PUEE 1LOJA 1FOWA 2JUFA 1IXSB 4OF1A 3CCQT 4M7DD 5E3NA 2D0QB 2HI3A 1MHNA 2DO3A 3EDPA 2R5YB 4MDWA 1TG0A 2RQUA 4M3FA 1RQ6A 2XU8A 4JYKA 1AZEA 2F5VA 1BK2A 1MJAA 1R1VA 1YITA 3HP9A 1I6HJ 2IPOB 2DAOA 1UCRA 2J5PA 2X6WA 2XRNA 1RRJA 1X1CA 4MMKA 5D6FA 1B8IA 3S14J 2KHMA 5ERIA 2R92J 1PKSA 2W10A 4QQ6A 3K2ZA 2LR8A 2DQLA 1ZR4A 1N9SA 2CZ0B 4OB3B 5L8RE 4AWXB 4B43A 4JS4A 4WXCA 3CCEA 2OUMA 4CYDA 4E7SA 4LLGF 3M07A 3A8LB 1WGXA 3O5ZA 3DPTA 2JJ9A 4Y91A 2QGFB 4J5YA 3IAM2 4DJAA 4KUIA 1X2QA 4KIFA 3FKJA 1UFFA 1VQ6T 2GOMA 3PVQA 4AC0A 1MJ9A 4A4FA 2PI0A 4LG0B 3AKZA 5I22A 3PNVA 3WHBA 2GXGA 3GZ6A 1Z77A 1FNNA 3NEUA 1A04A 1KZHA 5A0DA 3OW2S 1ZLKA 2EA2A 3WTZA 2DD5A 1ABOA 4KUDK 4V2SA 1VQOA 3M4YA 2MFZA 4QQDA 5IT9E 3PIPA 3CMEQ 2CQXA 2DEQA 3BLYA 1M1GA 3Q9SA 3E9FA 3OY9A 1S7AA 2UUZA 3D0SA 3QWLA 1VQ4I 2XV4S 1W7PB 2VYTA 2ZCFB 3CD6A 1I1SA 3VYSB 2R5MA 2HNIA 2K4BA 2LOOA 4L5IA 1GDTA 1VQ6I 1OR7C 4B4CA 2KBTA 3EG2A 2QK0A 1BJZA 3E0JB 1OZ2A 5GAOq 2CP0A 4C8QD 1I3QJ 2E19A 2P8TA 3NARA 1HDPA 1HYOA 3QQAA 4KITB 5KAIC 4AFZC 3VS4A 4J7IA 1VQKI 2LC2A 4ON0A 4C8QC 2QQRA 5JLWA 3HB9A 2LMDA 3KLOA 1FXXA 3OYIA 1PG5B 2JT4A 3QRFF 4Z02A 1VQ8A 5GMKe 4EMSA 4XORA 4HF2A 5D6EA 5J8CA 1U78A 4UVBA 2F69A 1P6RA 1ETYA 5E8IA 5E17F 4IURA 2WA0A 3VU3C 3VJPA 3HOZJ 3VV0A 1YI2Q 2L9RA 3BZ6A 4M3GA 4E6KG 1VQOT 5HS9A 3OYMA 3QDFA 2ZCWA 4OU0A 4A0XA 1SFXA 5F0HA 2F4OB 1D8JA 4ASNA 3GWZA 2D45A 4Y17A 3I0TA 4ZTFA 2D9TA 3K10A 2BEOA 3VYHB 2DA5A 2PMZN 1RESA 3CESA 3I35A 3ZEHA 4BDYA 4KA4A 2CO5A 2PU9B 1YCYA 2JVVA 2E64A 2Z16A 4RTYA 2DU9A 3PIPF 4M7DB 2QVOA 1QZEA 2DMNA 2DL3A 1R00A 1D1AA 2EFOA 1Y1VJ 3R6SA 1Q1VA 4I09A 1IRFA 1GUUA 1NM7A 4R79A 2P4RA 1N75A 1N78A 4C0GA 2JSCA 1WJ5A 2DJNA 3FHZA 2EVRA 3DF8A 1I5ZA 4WX9A 2FOWA 3TDUC 1XMXA 3Q0VA 4FISA 5IT9R 4DYRA 2EYWA 4XAXB 2BY1A 1EFNA 3JCMb 2Y75A 2VUMJ 1VQ8Q 4WK8F 3CP8A 5GAMj 4DOZA 5HNHA 2GIVA 3OIQA 1B59A 1UGSB 2HPIA 4LFUA 5HK0A 2L4AA 4HZFA 3A5ZB 2LLKA 1W5SA 2K3BA 3J80R 2KGTA 1KQSP 1MBGA 4HV5A 2E60A 5A0LA 3TL4X 2F2EA 3U1DA 1VQ8T 1GL5A 2WWYA 3SDZA 2YLCA 3DLLA 2VT3A 2A07F 2PMZA 4C92D 4M9ZA 1B4AA 3X20B 2P7VB 1TUDA 2Q2EA 3K1NA 1MBJA 4A4HA 2XKOA 1VQLA 4M73A 1ETQA 2MI6A 1QHGA 2EIFA 3KFVA 2KE9A 2DOEA 3QODA 3C3WA 2YDLA 2M1BA 2Y90A 2H6BA 3J7AO 3REAB 2OD5A 5GAMd 3CCUI 1WRJA 2FJ1A 3U2RA 3I55Q 3S1RJ 2GFUA 4Q4ZF 1FLIA 4RTVA 3L42A 1G8XA 1G3YA 3WVEB 3DTIA 3NAUA 4ZYDA 5EEHA 1SRLA 3NTHA 3VS6A 1WQWA 5HNFA 2LVMA 7AT1B 2GAUA 2WAQN 3T8TA 2FEIA 2HQHA 4AIKA 3E9GA 3J7ZI 1WJQA 2C0IA 4IUVA 3CCRT 3VUZA 1OYWA 2I5UA 2EYXA 4ORZA 3CD6I 2YUOA 3UNGC 3GTOJ 1UJYA 1GXPA 1X4PA 1BCOA 1K8AC 2IP2A 2HQXA 3CC7A 4M3DA 3ZGKA 2D0NA 2F5FA 3CPWP 2BW3A 1VQ6A 2BHYA 3QPTA 2R7WA 3K6GA 2K86A 3EFRA 2LQWA 1N25A 3JCMh 4F7UG 1H0MA 2EQRA 2Y69H 2DZ9A 5BMZA 2KP6A 2HVRA 2KT8A 3BJ6A 5E8GA 4A6EA 4Z88A 5A0GA 3EGXB 2ZXIA 4OAYA 3SZGA 5C44J 1T2KA 1N77A 1M2VA 2EGEA 4M3EA 2V9PA 5IT3A 2EV5A 2F5CA 4MGRA 2VBWA 2GQIA 4LOCA 1OFCX 5EZHA 2FSWA 3MHXA 4HRIA 1RI7A 3ZR8X 5EF6A 2QGUA 3EUAA 4WXDA 4XKCA 1R9TJ 3HFOA 3PMIA 3OOUA 3HTSB 1KD1U 3SJMA 5EGOA 4EEFG 3P9KA 4IIMA 5L3CA 4IUTA 3MEUA 1VQNI 1Y96A 3BTJA 2X0LA 2Z3YA 4XU3A 1YJWQ 2I0NA 2R7OA 4HAMA 2ELHA 2OU2A 3F8CA 3MWMA 4E7KA 2QXFA 4Q47A 3DQVC 1I0CA 3TEEA 3VB2A 1DP3A 1R1TA 1G2BA 5GAN5 3QYHB 1SMYF 2JA8J 3PO3J 2DEUA 2VQCA 3F8MA 3OSGA 5J3BA 1YS7A 3UT1A 2W82A 4HV6A 3CC2Q 4IEJA 1OU8A 4CC7A 3IH2A 1M27C 1ZA2B 2HGCA 1RAAB 1ZHIA 2M30A 2V1RA 1Q82U 4C92E 5TGTA 3A8MB 4RG8A 3JCMJ 1XX5A 3BG3A 2PN6A 1B1BA 4ITVA 2YUPA 1D1BA 1FJLA 3VSLA 4D0PA 3J80Z 1OR7A 1WHGA 3OYCA 2JTEA 3CC2T 1AWWA 1GXIE 4OMMA 4Y52J 2DODA 3CQTA 5L3GA 2K3YA 1OPCA 2B0LA 3CJQB 2VIXA 3MZ8A 1ZREA 3QIIA 3L2QA 4HKEA 5HS7A 3GBQA 1JKPC 2HVSA 2NOJB 3FXMA 2QCOA 2DDAA 4ESFA 2KRNA 3OV8A 4A4GA 2X9DA 3DXJF 1N5ZA 3KEQA 5F0CA 4C8QF 1YJNT 1GV5A 4OOIA 1XGOA 2DE0X 4M78D 1H3ZA 4LIVA 2HQAA 5ICEA 3CBOA 1KHIA 1Z6TA 3LH5A 1BBZA 3M53A 3WTYC 5IYDJ 1YX5A 1NYFA 3CC4T 1M1EB 1Q86R 1M9SA 1UDLA 3CC2I 2KDZA 1A0NB 2EQKA 2JOYA 2AZSA 2FPFA 3PT9A 4DOWA 1YFNA 2TCTA 5C6SA 3CMMA 3JCMV 1WVRA 1ZK8A 2L4MA 2ELJA 2VKVA 2OCCH 4J19A 1HA8A 2W57A 2GGRA 2YLBA 1X3UA 3DU5A 2V9VA 4M75E 2IGKA 1WI9A 1SVMA 1ZYRF 4B09A 4FHTA 1F5TA 3FX3A 3QWXX 5AIQA 5I11A 4RS8A 3JRHA 1RIOH 2X3WD 1WJBA 1A35A 4M77C 1NK2P 5LJ5e 2DT7B 1DUXC 1YX3A 4N9IA 1D09B 3CC4A 2M7BA 1PJRA 4FQGA 3BG6A 1OX9A 4A53A 1X58A 3JCMX 1ZN2A 4V2GA 4BJ5C 3OYGA 5J1RA 1TUCA 1IJWC 3RMSA 1MSFC 3RQ4A 1TQPA 1X3ZB 3I55T 4DBRA 1NG7A 4ZC3A 1USTA 1BW6A 3C12A 4HOBA 3QPHA 3HPHA 4EJUA 4BQQA 2MD5A 4KN7X 3CUQC 5FKOA 4RM2A 1YNZA 2J6FA 2QUFA 3FJPA 3EHQA 3ZBDA 1VQ5T 1F1BB 3N05A 4M7AA 2VC1A 2LD5A 1V54H 2DLLA 1OX8A 3A52A 3TCJA 3DBRB 4E70A 1IG7A 4RUGA 3R0AA 3N97A 4A4EA 1YJNA 2K9LA 4F7UE 2IS6A 1M2OA 1MW7A 1SFEA 2JA6J 4BHCA 2OC6A 1G6NA 2HL5C 1ZSZB 1JUPA 2ISZA 1H3HA 4HVUA 2BXYA 1FBQA 3HC7A 1J59A 2CP7A 3R6NA 5KYUB 3WTSC 1KYZA 2PG4A 3SHFA 2L3PA 3KEYA 4GXOA 1TQMA 3BPXA 4BNCA 4M78C 3OA6A 2R93J 2M4GA 1JJ2P 1U2WA 3CCJA 4NHJA 4NBQA 4BS9A 2JVGA 3AL0B 3O8GA 2HEOA 1Y8QB 4XOTA 2P0QA 4DEYA 1T56A 2VGMA 1LDJA 2EW3A 1ZARA 5FFXA 2VQGA 4XLNF 5C4XJ 2XK0A 2VXZA 3HJEA 3RZOJ 4BGDA 2Z1DA 4L9VA 4KN4X 3F6VA 2LQKA 2DKGA 4KH0B 1NG6A 1Y96B 2DL4A 1TQIA 1MBFA 3EYYA 3S93A 1VYUA 3CPFA 4EGYA 3KFWX 3TGNA 3PMTA 4M78B 4MZPA 2E1MB 1R1UA 1IRXA 4PJ0C 2BZTA 5K1YA 1EJ9A 4EMHA 2QSHX 2CP3A 4W97A 4M72A 3ZN1A 5FRNA 1LJOA 4XLHA 2DA6A 1V5FA 4GY5A 3K7AJ 3AL0C 3PM1A 2R7XA 2OCEA 1QMCA 2ATCB 2M51A 2P5VA 1ORKA 4UUSA 3FWEA 4I6ZA 1A36A 3DV8A 5FLVA 4R8HA 4FYWB 4NL3A 1KC8R 2IG0A 4D8DA 1AU7A 2D8HA 3BDDA 2V8JA 1NJIC 3ROUA 4A5NA 2L9SA 3L9FA 4BXUA 2XRLA 5H6RA 2KIMA 2PQ8A 3LAJA 3CMEI 4LGWA 1P4AA 4XOPA 1PSFA 4BEHB 3HDDA 5GJVB 3CC2A 4B3XA 1J2XA 1MDMA 1APLC 1QKXA 2H3EB 5FKNA 1FT9A 3U23A 5E3OA 3FXKA 4JPBW 1WCMJ 4YEJA 4L9JA 2X1CA 2E71A 2M1HA 2RJFA 1YIJQ 4EJVA 1SF9A 3NPFA 4M75B 2G7HA 3X24B 3FBIB 1KQ1A 3QPLA 3OYEA 2EFNA 2NS8A 5KHDA 1JB0E 1NPPA 4C2TA 3CCMI 2LJ0A 1UTIA 5CO7A 5CKFA 3MO8A 4HNUA 1W1FA 5KYYB 3LL7A 1PSEA 2RHZA 1FYKA 3B73A 3W6VA 3DKXA 3VEPA 2MK5A 4B47A 2MGQA 3MKYB 3BW1A 2NXNB 2JUGA 4LD5A 4XLFA 3S1NJ 2WSEE 3SFZA 2QYZA 4Y7NJ 2LT4A 2LNHB 3QOEA 1CF7B 4IO9F 4Y15A 2XUBA 1W5TA 3A01A 1HKQA 4FASD 1M4ZA 3KE2A 3HXLA 2CKKA 2K9QA 2QEXQ 3RKQA 3GIBA 4IXAA 5D5XB 1YW9A 1U5TC 2VWFA 2KFDA 3HIFA 3I54A 1O7FA 1KQ9A 2V9KA 4U7BA 1FYNA 3VODA 2MVTA 2HKQB 3CJRB 2LCLA 2QA4T 2HZYA 2OTLQ 2OQGA 3PNYA 4P55A 2EKOA 3F3XA 2QEXT 4RAGA 1JKRC 3LMMA 2NNYA 1H641 4Z2YA 1NEBA 3ZQFA 2M5WA 3ZMTA 1T3SA 4M7AD 2XGCA 5F1RA 3HOUJ 2FE3A 5D4SA 1NZ9A 3DBHB 1YHQA 3CLQA 1R22A 2KRMA 2WACA 2DAQA 4Y28E 1IB8A 5K7HA 4L6V5 3GTLJ 1Z91A 3BDLA 3VKIA 3GNFB 5EG0B 1AD5A 4M78E 1VTNC 3S2WA 3CCJI 1VQ4Q 3GBGA 1JUSA 3VWBA 1VYVA 4XTUA 3S3NA 4DEXA 2L7KA 4P5NA 2O0YA 1OJLA 2Q2EB 1K9AA 2SEMA 3QBYA 4EIKA 3LSIA 2QENA 3I58A 4BUPA 2NUTB 4LD9K 2DTHA 4MTEA 3GVAA 1SHGA 2OAWA 5D6XA 1T0JA 4NB5A 3D7SB 4AIJA 2LNBA 5LJ3d 3EFOB 2L7FP 4XNFA 1YW8A 3HOXJ 5LBQA 4NC6A 4Z89A 3GPLA 4YFKF 1JT0A 1BIBA 4XONA 1FP1D 2PQWA 8AT1B 4ESBA 2AXLA 3SFIA 2CV1A 3EFOA 2E34A 4OP0A 2FNAA 4P5OA 3CCVA 1WZ2A 4UUTA 1GHCA 4J6XA 4RAFA 3RR6A 2WV0A 1KU3A 3W3CA 2YPRA 4AVPA 2NRAC 1ZBJA 2R58A 1BC7C 4HCBA 1N8RC 4HX4A 3TP3A 1H88C 3V8KA 1UE9A 1XJWB 1JEGA 3CQZJ 2EQIA 4HYEA 2QDLA 3MQ0A 2DXBA 3OS2A 1U8BA 4IHYA 5J8FA 1BBYA 4P1WA 5DDGA 1QVGP 2DETA 3NQOA 1U9NA 4DYCA 4HCCA 1MNDA 2ESHA 5HLGA 2DK8A 2FEZA 2DMQA 4JK1X 3QDRB 1G3SA 1UG0A 2EWNA 2EZKA 2K57A 4PSWA 1MJBA 1RAEB 2QKMB 2BE5F 1UJ8A 3C0CA 4A63B 4XBFA 1QZZA 3CP2A 4CH7A 1FMVA 5ILSA 3K2AA 4D7NA 4U0YA 2D8JA 2DJIA 4LLLA 2KPMA 3GMEA 3LNQA 4A3LJ 3M56A 2PTKA 4M77B 3SB2A 5GMKh 2O61A 3E6DA 1MMAA 2A5WA 4HT8A 4ZDPA 2DYSH 2IRFG 4C0FA 3UWNA 2KJBA 3RJPA 4CYCA 1OZ3A 4WXHA 4XN0A 3LSTA 1K73C 1YJWA 3L1AA 4PJOF 1T95A 4BDZA 3P8DA 1CGPA 1OKRA 3VUBA 1IRZA 2JS0A 2LJ3A 1W2BP 4M9SA 1WWXA 2LTPA 4HX7A 1I39A 3KXTA 3THKA 2KMTA 2COZA 3DB3A 1MUZA 4M7DA 2NNNA 1IRGA 2A7YA 3WU1B 1AWXA 2KRSA 1XS9A 4F3QA 3H9NA 1T98A 3C18A 1K9MR 1OU9A 5A2QK 3I3LA 5HOOA 3I4NJ 4JLGA 1IN5A 4QTRA 2BZ8A 3EAEA 3BG7A 1XOVA 4MHGA 1FPQA 2MBFA 2VC8A 4QSHA 2Y0SA 3AG2H 2P4TA 1WI7A 3BJAA 4LE9A 4AFUC 2W48A 4BL0B 5GAN4 1VOMA 4JJNK 2KSSA 1UMQA 4KJZA 2E2IJ 2ED0A 3M0RA 2DNUA 5GAOm 3LSHA 4CDGA 2O9VA 3U9GA 2HDWA 5IT9Z 2HMAA 2CQKA 3FJ5A 2H09A 3Q1JA 1J3TA 2BBYA 2QBYA 3E6BA 5F04A 5BOXA 2IGNA 3JW4A 3OYBA 3EH1A 2WV1A 1R23A 1TWAJ 4UY8I 2PVGB 1JKOC 4KRTA 1GV2A 5LHGA 5ECAA 4OMQA 1WIEA 1OLTA 3R60A 3GOXA 5D6YA 2ETHA 1JGSA 3GUDA 3A8GB 4A6DA 1QQIA 5ED4A 3OL3A 1JRIA 1OPLA 1ARKA 4OAZA 1R0CB 5GAN7 4IPAA 3WGHA 4B9XA 1PP7U 1D0XA 1JGGA 1RAHB 2HXOA 3H41A 4N0AC 3CCSA 1OQYA 2P7CB 3J81K 1P92A 3KP6A 2R7VA 3FEOA 1W2BA 2FMLA 4CYCB 2A3LA 1DU0A 3FF5A 2P5LC 3C2BA 3QP5A 1TL8A 1PP8F 3GNGA 5CKTA 1LQ1A 2K3FA 4B9WA 5KCOA 4RMNA 1IDYA 5CQGA 1IV8A 4FETA 2CREA 1S7EA 1NK3P 2DPDA 2FZKB 2FZGB 2JXBA 2E1MC 3A01B 2LP0A 4HX8A 2KQWA 2LRQA 3JV3A 3P8BB 2LKXA 2C0TA 4IOAF 3KPHA 1XGSA 1SRMA 2YR2A 4BJTA 3KZYA 3QP6A 3A2KA 2E4HA 1WXTA 4CZZA 5DM7R 2GFAA 3GX4X 5LHIA 1T33A 2VBXA 2BZXA 3CBPA 4RB0A 4S05A 4IHWA 5GTIC 2ZGWA 2H27A 1WXBA 4AMCA 5GMKi 3JCMQ 3TVTA 1MH3A 1Q86U 2L01A 1QVFP 2DTIA 4BY7J 2RHYA 1IHVA 2X35A 5LHHA 1BI0A 4RG2A 4NNJA 4WCIA 5IOZA 1VF9A 2UXXA 2O9SA 3ZFJA 2YRVA 2X3XD 2EIJH 1U9OA 3A03A 2MWOA 3CCJT 1LFUP 3KP7A 5M5WJ 2PJRA 1W4MA 3LSKA 3I5SA 1NJIR 3C7JA 3QYFA 2BE9B 2M0CA 4M78G 3FXRA 1J75A 4GLKA 2DJQA 1YI2I 2VJJA 3UPUA 4XRSA 1F43A 4F52A 4XL9A 3DFGA 4PKCC 4M7AB 3H3ZA 3F6OA 2CUBA 1IGQA 1Z3XA 3CLOA 4ZYAA 1I07A 2JTFA 3LOCA 3PQKA 1PUFA 3BG5A 3F21A 1UHCA 2VV5A 3LGLA 3EG1A 5BQTA 4IQ4A 2AQFA 3UR3C 1IC8A 5FKKA 1JJ8C 5GAOn 1RUWA 4F16A 1M90R 1Y56A 3DPUA 5D8KB 1IAWA 4L18B 3O8VA 3MCZA 3JTGA 3BY7A 1AKHB 2XF7A 2K02A 4OIQF 2QF7A 4QQGA 1U5TB 1R6RA 2RJEA 3VS2A 1V29B 5JFRA 4RB3C 4RB2C 1AKHA 2JM8A 3GZ5A 2LDUA 2O8XA 2QM3A 2MF2A 1VQPT 5DEQA 2DT5A 3OSFA 2E7WA 1S72A 4UUVA 2CMPA 1FZPB 4L0YB 3FMSA 3G2BA 2FU4A 3G71T 3I4PA 4XRSG 1OCOH 3HOSA 1F1ZA 4LUDA 3CJTB 4Q48A 4ETSA 2MCNA 1FWZA 4JLIA 1VQNA 4C92A 4DIQA 5FLMJ 3QG1A 4J9GA 4G6DA 3CCJQ 3TDZC 1ZTRA 4K2EA 2MG4A 4A2UA 4LD6A 2H6CA 4LXCA 2HXIA 3H5AA 2PJRB 4QKUA 4IHVA 5GAMh 4BJ6C 1YHQT 4FL6A 3WG7H 2XAJA 2LX9A 2Y0SN 1T0FA 2M45A 4KMUX 3GTMJ 3TQNA 2KKOA 2M35A 1VQ9A 1QKWA 2OTLI 2CT4A 3CMAT 3OIPA 1KA8A 2RAEA 3CCQQ 1RLQC 5IXFA 4YIFA 2LRDA 3DTKA 5B66C 1M1FA 4E7LA 3G4SA 1IUYA 1I4K1 1SC7A 1ZRCA 4CI0C 2CH0A 1BI3A 2NS7A 1R71A 1HCRA 1WQ7A 3ZL7C 1R4NB 4HPQA 1TUGB 1USSA 2D5VA 4A3BJ 4BKXA 2ZJPF 1JI8A 5KYYA 2VI6A 4OMPA 4OGCA 3H5RA 5IAYA 3G1LA 3P9CA 3Q9VA 1WI3A 3HSFA 5D4RA 4FTHA 1VQ6Q 5FFZA 3IRRA 2GLOA 4XK8E 4M75A 3RPUA 4YTLA 3CF5F 1VA7A 3NFCA 2MH9A 4V2FA 5CVIA 3SEQA 5D8LB 4A3CJ 3H9QA 2W4SA 1PYVA 1LEBA 2EZHA 1QVPA 1M3CA 1UGPB 5HKCA 1QQJA 2IS2A 2YXYA 4OMLA 2ZJQF 2XKOC 5IHNA 3TSWA 2KZVA 3HSRA 4I76A 3RDIA 2K7LA 4DZPA 3TEDA 3ULQB 1O9SA 3H8ZA 3LYIA 4BI4A 6PAXA 1ZQ1A 2K5LA 1KD1C 1UG2A 2E6ZA 2KXDA 3OWTA 4QWQA 4RTUA 1VQ9Q 3EG9B 1BOAA 3LSGA 5CQYA 2IW5A 3DKMA 5DY9A 1K83J 1Q81U 2XDDA 3IL2A 3J80E 1ZLJA 1OCZH 4AU7A 3MJXA 2BIVA 2Z99A 4EMGA 1DU6A 5HLIA 5IHIA 3A4CA 2JW4A 1SD7A 4EM1A 1ZGAA 5K5RA 1NTCA 4MO7A 2OBPA 2HPMA 1QBJA 4UVAA 1YCSB 1TT0A 5I21A 3NTIA 4OIRF 1JXOA 1TH7A 1ON2A 4RCCA 5KYNA 3GFLA 2HZDA 1DPRA 1Z3YA 3CCQI 1WKMA 2CUEA 3E5QA 1MDMB 1UB9A 1YE9A 4BE2A 4BXFA 2CW0F 1W0UA 1OOTA 3I56A 1ZAOA 2P6SA 3OS0A 1H8AC 2RO0A 2ZB9A 1HOMA 4WCGA 2E41A 3P5JA 1G2HA 1Q7YR 1G83A 3J81Z 1ZSGA 4J9HA 1WSUA 1U1TA 2DXUA 3VSKA 2CQQA 2XASA 2HOSA 3LLRA 5EZGA 1N9RA 3VRZA 5GAOr 2JA7J 1VQ7Q 3HBLA 3JAMR 2QWWA 2WAEA 1IREB 3PTAA 2GZWA 3SWNB 3W2WA 1N6AA 2DBMA 1W70A 4M77G 4E47A 1TT5B 4QPOA 1X19A 2STWA 3FC3A 2JSPA 3QSUA 4IRHA 4M78A 3DBLB 2VOPA 2OTJI 2KAFA 1GCQC 3FRNA 1IXRC 2LJ1A 3RYPA 3WTUC 4XN3A 3G6ET 3H35A 1ETXA 1KU2A 3KLNA 2P84A 5GANf 2EFWA 1A6QA 3T0YA 4KYWA 2IIMA 3QZ9B 3AG3H 4PJOD 3GZNB 5FD6A 1BI2A 1WXUA 4J00A 4C8QA 2XVCA 4BHPA 4ELYC 2DVJA 1YRNA 2M9UA 1B9MA 1MD0A 1VQLT 5LJ5j 3ZN0A 1I8FA 2RJCA 2VOOA 2FG0A 2ZFWA 4J9IA 3LSPA 3ZPLA 1ZH5A 2DIQA 2QG9B 4KGZB 4C0ZA 5KE2A 3DPLC 4J01A 2K9MA 3G4SQ 3SD4A 5LJ5d 3BQZA 3OYLA 3RKYA 1QHHD 4AFQC 1GRIA 2R4GA 2CV2A 1OYYA 5IYCJ 4MIMA 1AHJB 3OW2A 2OQRA 1YBYA 2HR3A 4YIRX 1X1BA 3BCBA 4OMYA 2IGOA 4P96A 5E1WA 3S32A 1FP2A 3ZQIA 2GQVA 4A3GJ 4MNUA 2KRHA 1R0BG 4NS5A 2KT0A 1UHWA 3M9AA 2RMOA 3GCMA 4A3EJ 1SMTA 2CUDA 2RNJA 2D1HA 4BB7A 1ITYA 3H0HA 3CMEA 2DDBA 2A3SA 1JHHA 4UB6C 4ZGDB 2E1NA 5KH6A 1FSHA 2AQEA 1MSEC 5CQXA 1B7TA 3MD2A 2NVXJ 3S2HJ 2KQRA 1K4US 4HSTA 3EPZA 3NWTA 3SQNA 4OB1B 3UKGA 1W36C 5J40A 3O6BB 2HS5A 3H9GA 1QRYA 1V76A 3BR0A 2QDYB 3TO9A 3HRUA 3LGFA 1X6GA 2XIGA 4JX6A 3IV5A 2P0KA 1TWFJ 3TOBA 3EYIA 2H8HA 2K6DA 2B9SA 2VJ5A 4UUSB 4UB8C 2RN7A 1H9GA 3PFSA 4R55A 3CMET 4LN2A 3M0UA 3K1PA 2XG8D 2VL8A 1ZUYA 1ZUKA 5HDGA 3X25B 4C92C 5KYWA 4I0AA 2KL4A 4R1HA 5IP9J 1XSVA 1L0OC 1QWFA 3J81R 3OIOA 3HZJA 3JTHA 4CZCA 1GXQA 3ERED 2KR3A 1K73R 2CJJA 2Z33A 2BVLA 2ZNZA 3W6KB 2OJ2A 4X9CA 1FIAA 4KUMA 2FMYA 1O57A 5LLQA 1E3OC 1Q82C 4HDVA 1YN8A 2DA4A 3JAMZ 3BY6A 1OQKA 2XAQA 2Z0WA 1MMDA 4XM3A 1TSFA 2K4JA 1Q7YC 3GFIA 2PMUA 1K78A 3RUXA 1B9NA 1BM9A 3E5XA 4HEA2 5ILVA 2RNGA 2R5ZB 4N0BA 2HDCA 4UNOA 4PGHA 3EGDB 3C1DA 2EJRA 2F4IA 2F5EA 2K4YA 4OMNA 4UV8A 1QPIA 1JO8A 3FB9A 3E6CC 2VJ4A 2ZSIB 3TP0A 3JSPA 4JZ3A 1LUJB 1YYVA 2FBIA 2CV0A 1VNDA 4XKBA 3RKXA 1WDXA 2ZJ2A 2DZCA 1Y71A 1WPKA 3HSEA 1SSFA 2GNCA 2LDMA 3FDYA 1YW7A 3GTKJ 4PSXA 1M8MA 2HQRA 2KEAA 1WJFA 1YJWI 1VQ4A 1MBHA 1HW1A 4KBMB 2G3RA 3B6CA 5DYMA 1KHCA 1WHHA 1ZUUA 1VQ5Q 3PVLA 2NUZA 1P9QC 2L7MP 1T0FC 2QYOA 2M8GX 2MAMA 1U5SA 2W0ZA 1VQKQ 5FW9A 3ASOH 3D5RC 3OYAA 2OX7A 2DLPA 3WHCA 4KT5C 2ICWG 3LFUA 4VUBA 5D6WA 1YG2A 3BR5A 4HSRA 4BEHA 5ICGA 4QVZA 1R8OB 3M7GA 1T08B 1V5EA 3WXMB 4GLMA 1OCRH 1R7JA 2DTRA 3GFJA 3KP5A 5CQEA 3JRIA 3CPWA 2YWWA 4ZTJA 5DM6F 2R7UA 1N27A 4AYBN 4FU6A 1WX6A 1G3TA 5E1XA 4C9YA 3BR1A 2X4XA 4XLCA 2COMA 5FLXE 1DP7P 1KGSA 4U0WA 3EG3A 2FBKA 3I5UA 3RKWA 3OSSC 2MLGA 1W6XA 3M54A 2AXTC 5CAIA 2K85A 2ZPIB 1R58A 4LIUA 1VYTA 1K78B 5M9OA 4I0BA 5HCKA 2FHDA 2XMFA 4G9YA 1VZ0A 2XAHA 2JQ7A 2CSOA 2XPWA 1Z0XA 3CMAI 3ZQQA 5C4JJ 2UV1A 4M74A 3JCMf 1I1GA 5E3MA 1K9MU 1R5HA 3EUHC 1C0WA 1OULA 4IOCF 1FIPA 1WJSA 1I3AA 1X3WB 4FX4A 1M90U 1K8AU 2RI5A 3H0FA 2DIGA 2IGMA 5FJ8J 1ZELA 1TW2A 2A68F 3OBWA 3LWIA 3HPGA 3I55I 2L0AA 2ROTA 5CKDA 1OISA 2CS3A 2EGAA 2W85A 1FBSA 3TO6A 1VQMT 1ZQ3P 2LCCA 3PFIA 4J9DA 4IHXA 1SEMA 2Q0OA 4NQWA 4BAYA 3ZMVA 1QGPA 1HLVA 1LE8B 1AT1B 2MH2A 3V7RA 4OVAA 3CCLT 4LB6B 4PUSA 5DS9A 3RYRA 3HHHA 1VQPI 1VI0A 1TNTA 2ZSHB 1OV3A 2FVUA 3VS3A 2HSEB 3FXOA 2EB7A 2W7NA 1VUBA 3R6OA 2M2EA 4E4HA 3ZCOA 1JHFA 3S6WA 4LDUA 2VKNA 3DKYA 2DPPB 2I8DA 4M77A 1OYIA 1SFKA 2MA3A 2NLUA 3ZMDA 1O4XA 3V7CA 2JM9A 5BS6A 4EQQA 3K4BA 4HF0A 2EFPA 3TBIA 3CC7I 1K6YA 2L3RA 4PJOB 2Y9YA 2GTJA 1MKMA 4O6JA 1LVAA 2FF4A 2RGVA 4I99C 1M8VA 2ID3A 1LB2A 3LSMA 2DA2A 2LKSA 5FLXR 1PRMC 3BE3A 1JBMA 3RNJA 2RQTA 3PIOF 4P9FA 3Q5FA 5GANg 2DTOA 2C06A 3J7AF 4EMKB 3CXCS 2BGCA 4Z6YA 3J7YJ 3JB9H 3IKVA 5JI6A 1ZX6A 3ZRGA 1B07A 1QVFS 5GANh 2KK4A 3FHNA 4J9BA 1SG5A 5LJ3g 1BIAA 3SEZA 2YUQA 2CQ7A 2QQBA 2DK5A 4OIOF 2J05A 3GW2A 3M0SA 4C8QE 4M7DE 2STTA 4GYGA 1MH4A 3GLLA 4XLAA 1YRNB 3I59A 5LJ5h 2XB0X 2LF8A 4AYBA 2AT1B 3ZXSA 2HKXA 1C6VX 1X2NA 1HDDC 2RA2A 1FSEA 3L2UA 1IF1A 4QT7A 2HAXA 1UGRB 3T8RA 3AG1H 2BE7D 4X1EA 1W1WE 4QVCA 4D1QA 2YSRA 3ZMUA 4DZJA 4N0AA 5HY6A 2W24A 2X9HA 2JT1A 1DGRM 3K4MA 5JLXA 3M3YJ 1QCNA 2HTSA 5A2QR 4EMKC 2X6YA 4BD3A 2DK3A 3HSBA 2D1VA 4RM3A 4D5FA 4PJOE 3M8JA 2H8WA 2PX9A 1WHMA 4JJCA 1L3LA 1IGUA 1JTXA 4G12A 3S2DJ 2F2VA 3NGPA 3DU6A 2A61A 3RPQA 2MC3A 1LJ9A 1VQ7A 1YIJI 1J5YA 1SSHA 4RA2A 1WLPB 2KVQG 3OYKA 1TS9A 1VQ5A 3F8BA 2CQNA 1IW7F 3S3OA 2MWPA 2GXBA 2XI9A 1GFCA 3BPVA 5EJCA 3CD6T 5TRDA 2M8EA 1MBKA 4RLFA 5CLSA 2CDTA 4FE4A 5EEAA 1D3BA 3CC4Q 3VS0A 3SEMA 2IS1A 4RB1A 4MEYF 3H3VK 2IVWA 2DFIA 2MLKA 1XCVA 3X26B 1KFZA 4IKFA 2BHZA 1CQTA 2EFIA 2DQRA 3IHUA 3FIWA 3L2WA 2ZKZA 4J8OA 3CD6Q 1UFMA 3HUGB 1O3RA 5D5UB 2CFXA 1YFHA 1KSWA 2DF6A 2LCSA 5DUKA 1ZR2A 1VQKT 2HEQA 3G71I 2BY3A 1IN6A 1Z21A 4C3HJ 5DLOA 2V8KA 3RIRA 4DGWB 3ECOA 1PDNC 2L3DA 2Z9OA 3OMYA 1NYGA 2HBWA 2V6EA 5B3SH 1YIJT 4UHTA 1I50J 4L5EA 4LJZF 1MNMC 1E7OA 1VIFA 2F5KA 2DA1A 3LQQA 1E6HA 1OMIA 4CSWA 4C3JJ 2F5TX 4JRIA 4X1VA 3BT9A 2VBYA 2OPTA 5DD8A 1LDKB 1W2BS 4CHUA 1RR8C 3CCMA 1BYMA 1Z1DA 3SYTA 2EKHA 4ZYHA 2V1QA 2XAFA 3CBMA 5GAGJ 5DCMA 1NLOC 1WFWA 4NL2A 2K2MA 2KY9A 3G73A 3REBB 4ABZA 1ODDA 5IT9K 3RI4A 2FBHA 3LX7A 1SD6A 2XD0A 1QPMA 3ASNH 1S9HA 1K76A 2Z5UA 1EIFA 5GP9A 3WTWC 2JPCA 1K9MC 3JCMW 4UV9A 2XHCA 5D5VB 1VQ7T 1XCBA 1Y57A 2RK1A 1XGNA 3WE3A 2R7DA 2ZXJA 1OCTC 2E70A 2XKPA 3TU4K 3OYFA 1Y07A 5GMKj 1Z05A 4GDFA 1IZ6A 4A12A 2HKOA 2F6CA 2YX4A 5HODA 2CH4W 4LDWA 1ETVA 3MFKA 2L7ZA 2DT6A 9ANTA 1X01A 4C0DB 3K4KA 2WAQA 3CCVT 4LK0F 3UA6A 4KMFA 2M34A 5CKBA 3O2PE 3H0GJ 2VJIA 3S17J 3BQYA 4ZGEB 2H1LA 3QJYA 4B8XA 2XIDA 2R7FA 1YIOA 4MTDA 3OYHA 1JXSA 1PCXA 4V19K 4XTXA 2HOTA 4XU0A 2QASA 3KZZA 5GTHC 3COAC 4M7AE 3GP8A 3VFZA 1S3JA 2CGPA 2DA9A 2RI2A 2RJDA 2LYCA 5LJ3j 4PDKA 1KQSA 2OAZA 3PIOA 2W00A 3CC7T 1VQNQ 1GBRA 3F8NA 5LGUA 2DMOA 3ME9A 2CRGA 3L2ZA 2VB6A 4LLNA 2L2OA 3QZ5B 1K0SA 4CC4B 2OTJQ 2X51A 3EUKL 4LUEA 3MPUB 4C0DC 2GIZA 3KCCA 2HOAA 2E1HA 5GAMg 1LFBA 3ABLH 1A31A 4BQNA 2EPDA 4M78F 2IA1A 3ERMA 1X2KA 3V4GA 2X4JA 4RTZA 2PNIA 4C92G 2O6GE 2O4XA 4CICA 2CYZB 3MAJA 2AKKA 3G4ST 2OJED 2W1OA 1Q82R 2K40A 4A3KJ 4RLQA 5IH2A 1PD0A 2PUKB 2HSPA 4QW2A 5B1BH 4QLCU 1VQ9T 3FXLA 4L9NA 2LBFB 1SEUA 5HDKA 3E3VA 3OMCA 3QO3A 4DBQA 1S72I 5IHKA 2BOLA 3L09A 1VQMI 1RLPC 2EIKH 3LQRA 2EV6A 2JWTA 4OB0B 2XSJC 2EH3A 5FU6B 2CG4A 3P9IA 2DFEA 1HJDA 3JCUC 1R4MB 3FDRA 2ME0A 1ZGWA 2XSDC 1KU9A 2CP6A 2FOKA 3O8HA 5GPCA 3S3MA 5FLXK 1EKEA 4A54A 4BY6B 3CCRA 1QVTA 2OZUA 2M16A 1AEYA 3BZCA 1KG1A 4HCKA 2YS9A 5J4YA 2VKHA 2VBZA 1UG1A 2VE9A 1JXMA 4QIWN 2VKDA 4A4KA 5GMKm 4HVWA 3JCMd 5J6XA 1P2FA 3VS5A 4HDUA 3CF2A 4L0ZB 4BU2A 2QQAA 1QVUA 4II1A 1U0JA 8ATCB 1X27A 4B1RA 5C3EJ 3N5BB 5KE3A 4YFNF 3HTUA 4EJWA 1RC9A 3I59B 3LA2A 2NVTJ 3V8LA 4LMYA 4A0ZA 3JSOA 3ZQ7A 1TWBA 1X69A 2O03A 1X75C 2ED1A 5GAN2 5ICCA 4JS5A 3C4SA 4ENNA 4ELZC 1T39A 1SD4A 2NYXA 5DTDA 3DLLF 2J6OA 2NOGA 1ULYA 5LFAA 2FXAA 4KIBA 1K4TA 3M1CA 1LPLA 1PRLC 1TU0B 2JA2A 2R3SA 2EQJA 4UVCA 4AIDA 3HG9A 1ZKGA 4EGZA 2BKDN 2OTJA 3HPWA 4PJOC 1XPXA 1YJ9Q 3T5XA 2LX7A 3EG0A 2NVUB 1W7PD 3Q0UA 2KNBB 1RI9A 2MOXA 4A3MJ 4JJBA 1BU1A 2DYIA 4XSZF 1DJ7B 4BI8B 5H2FC 4ZYGA 5FU7B 3SHWA 2JS2A 2VT2A 3DEUA 4DBFA 4I7HA 4A3DJ 3I9QA 1S72Q 3ML6A 1GT0C 3VYTB 1DDNA 2NYSA 5FWCA 1HSJA 4PJMA 4MMLA 1ZSZC 3H3UA 5B5EC 1HD3A 3L2RA 4RDUA 2J6KA 5M3MJ 5LJ3f 2DXIA 2KROA 3G1MA 5ILUA 2P0PA 1OI1A 4FE7A 4MFDA 2VKEA 5KYUA 1S5LC 5F08A 2O9LA 2RF0A 4S0HB 1Y0NA 2RQPA 2HD0A 2P6TA 3RSNA 1FOYA 3GF5A 2KRCA 1T38A 4M77E 2G0EA 3CTAA 2EJ9A 3CO7C 3GLXA 3J81E 3QPSA 1V5GA 3A1PA 5FU7C 1F9NA 2R57A 1FMKA 3F72A 3FIFA 3OMGA 2GBQA 4E7HA 3M4GA 4C8QB 3TMOA 3IC7A 4NQWB 3CCQA 1BJAA 2ZXHA 3VYGA 3JB9G 3J7AW 2DMUA 3CO6C 1TWHJ 1X43A 1IV6A 4XIDA 3HRMA 2XDVA 4JOMA 4A93J 4ZZLA 3VS7A 2YU9J 5CVJA 3DTEA 2M4KA 1RKTA 1XTAA 3WE2A 1U06A 4IJAA 1WJDA 4PFOA 3BR2A 2ACJA 3R0JA 2MMPA 2BW3B 1D3YA 1DPUA 4M75D 1PM3A 1ENHA 3RPUD 3EH2A 1XNIA 4IL6C 2QSGX 2RM4A 3FLGA 2WAFA 4MQVA 1CSKA 3H92A 3NRVA 3ZP5A 1M3BA 2GTOA 1JJ2S 2X4YA 3TO7A 3CUQB 3FXUA 4RMOA 1E2XA 5HLHA 4BACA 2ECCA 2ABLA 1SANA 1CKBA 4M7DC 1H8KA 3CCRQ 3RBBB 5FROA 4X9DA 4ENMA 1D0YA 4CC3A 3LWHA 1B6AA 4J6YA 2V1NA 1SVLA 4IHTA 3CCUT 2RB6A 4M71A 2WY8Q 2R7QA 5KVRA 2ME6A 3U21A 1BA5A 3HKZN 2LMJA 1TC3C 3B02A 3EGDA 3MEWA 3VRYA 4G7ZF 4EMKA 4G7HF 1TZLA 2FD5A 3WU0A 2QEXI 3QJ6A 1B34B 2CYYA 4M75C 2DERA 4FSXA 5GMKl 1WJRA 1IXCA 2DRMA 4B44A 3CCMT 4M7AG 4X0GA 2R0QC 2WTEA 2LZ6B 3HGGA 4N4HA 3JRCA 1K61A 5E3LA 1GVJA 3L2CA 4N4OB 2A0FB 2OI3A 4U7DA 1U3OA 2E10A 2RHIA 2VVKA 1YOVB 4CUGA 3TW7A 3C2GA 3I56T 2TRTA 2JUCA 2R7RA 2RDPA 5I2SA 4MQ9F 2EZIA 2KMUA 3C2HA 3BP8A 4FSSA 4ZDOA 1ETWA 2LT1A 1YS6A 1TNSA 4R56A 2K3PA 5M3FJ 4PZJA 2EIMH 5J1UA 4CRIA 1BN5A 4MFEA 5LEJA 3OR1C 1G4DA 2K5FA 5F64A 1HBXG 3J7AY 5D7UA 5GAN3 2ZMEA 4X6AJ 3M1EA 4CCMA 3GEZA 1UJ0A 1M1KC 4UC4A 1WFXA 1PKTA 3FM5A 3LA7A 4KGXB 2Y2ZA 1X1DA 3RMQA 1I27A 2IBDA 3JRAA 2VXFA 2A69F 1NJIU 1YJ9T 4JP0A 2CP5A 4DW6A 3GTPJ 5LJ5g 4H0EA 1UB4A 1UGVA 5J4VA 2FPDA 4LDVA 1KJWA 3PSIA 5KCMA 4DA4A 3K0LA 4PJOA 3OS5A 2VQHA 1ETOA 3WGIA 3MZHA 5J39A 4HT9A 1SFUA 2EAYA 4ZJZA 1TLHB 3DCFA 4J83A 2A08A 1AOJA 3PJRA 1TWGJ 3PUFA 5CPRB 1WHKA 2JJ7A 4XTZA 1XTDA 2V26A 2V4JC 2IAIA 3RESA 1BW5A 2JMCA 3BTLA 2MABA 2L9VA 2JNGA 2K9SA 3M0QA 4LK1F 2ESNA 3KUFA 3BTIA 1YITQ 1Q86C 1O75A 2L2PA 3M58A 1C0MA 1KD1R 2AZVA 5H6QA 1EF4A 5TISC 1WA7A 2R7ZJ 1Y1WJ 2DI3A 2A6TA 2LP5A 4JRPA 1Q81C 2KIQA 4RAZA 5EC7A 2XB5A 2EGCA 2VPRA 1FX7A 1RKWA 5CVUA 2A28A 2L54A 2LQNA 4JBAA 3L7WA 2E1OA 4YELA 3F22A 2PBIA 3NTKA 4ME7A 2VXDA 2HDAA 3ABKH 1E0EA 2UXNA 2WADA 3EUHA 4XR6A 4EPCA 1Z7UA 5F0FA 2WBMA 2JN6A 1YI2A 3IAS2 1O3SA 4OMFB 4M7DF 2MZ4A 2E65A 1S29A 4HLYA 1JQQA 3SZPA 1RNLA 2UWMA 3CCLQ 3W2VA 2M0OA 1G5VA 2HTJA 1MBEA 1GLNA 2O3FA 5KYXA 1P4XA 1P7IA 1I5OB 1U6GA 1ZSZA 1QZYA 2DJZA 4A3JJ 3CC7Q 2KIUA 4EATA 5EG2A 2FRWA 1VQNT 1SD5A 4OMZA 3A1YA 4RGSA 5DCMB 1VQLI 2EA4A 3CCST 1IN7A 4D6WA 2RVCA 5D5WB 5FLXZ 3OW2P 1NG2A 1X2MA 3CCUA 2ID6A 1K7AA 2QEXA 1KQ2A 2J06A 3I64A 1SVOA 4FX0A 1B8IB 2XAGA 3EETA 2E5NA 3ZMSA 2ZPBB 3ZQCA 1RI0A 2QKLB 3ONQA 4XRFA 3HKSA 3FK7A 3A8OB 4CCKA 4A0YA 1TW3A 3MKZA 4F04B 3CPWS 4L5GA 3FXQA 3Q3SA 3OBYA 4BQAA 3CCEI 5LJ3e 1WH5A 1QNTA 3O3KA 3HUGA 2GOXB 3KETA 1TXQA 4OGEA 3I9V2 3HKZA 1QCFA 3DP7A 2CUFA 4BE0A 1DQUA 3SZTA 4JJDA 3I53A 2HBPA 3QU6A 1Z6RA 2DXTA 1GVDA 3G6EA 2E3IA 2RV8A 4IQJA 3I56I 2ZZDA 3F9KA 5DM7F 1SFOJ 1BR2A 5A2QZ 3BJOA 1LNWA 4XLPF 2O8KA 1M30A 3QAHA 1YWOA 3G1JA 3LSRA 2O4XB 3C95A 2V6CA 2XHKA 3G71Q 1PC0A 3GXOA 4OWRB 1PWTA 5EDNA 1R36A 2GQQA 3EGXA 4ENKA 4FYVB 4FM4B 1M1KU 4ZN3A 4Y33A 3CCUQ 4IUQA 1WNLA 1RUNA 1ERDA 1ZRDA 1UECA 1K6OA 5FO5A 2FZCB 2E1CA 2FA5A 2M3AA 1BCMA 2E5KA 2VGNA 1KQSS 5KAFC 2VE8A 2K5CA 2KT1A 5CIUA 2O5RA 5AIPA 4ZZDA 5LL6S 3JCMP 1TP4A 3CCMQ 3K4CA 3TKYA 4A3IJ 1ZG5A 2YX7A 4FYYB 2GBYA 4PGGA 2X4HA 3OYDA 3UF4A 2CT3A 3RCOA 4ZYEA 4F14A 1RZ4A 4L5JA 2QA4Q 2CH4A 2V1XA 3PQJA 4HG2A 2QI2A 1YLFA 2QBYB 2E5ZA 1K73U 2RQQA 3PO2J 3SFMA 3PE0A 1YTYA 1KC8U 2RK2A 4M77D 1VQ7I 2QA4A 3MEXA 2RHUA 1M1KR 5IPAA 1ACMB 3RQIA 4C3IJ 1ACIA 1FEXA 4ZN1A 3JB9J 2JRTA 2WB1A 1I81A 2Y0MA 4AG2C 1RL2A 3CDLA 2H3JA 5GAOp 3CXCA 1AWOA 3PL8A 2IT0A 1IO2A 4PJOG 3KIOA 1AHDP 4FW2A 2LREA 3CCLA 3EHRA 1W36D 3HL8A 3KEOA 1EV7A 2GM4A 2Q8KA 1H9TA 1VQ9I 2ZPGB 1EH8A 1XGMA 2EFQA 1P4WA 4EDUA 3UDCA 2OTLA 2CWEA 2JA5J 2AHQA 2OAUA 1UEBA 1JUMA 4AIHA 2A05A 3OYYA 1I1JA 2K79A 3G4SI 2COYA 3BROA 4RTXA 5J1YA 2VC0A 1RPWA 2FRHA 2CZ6B 4D7MA 2VODA 1TTYA 3MKWB 2Y4XA 2PZ1A 3OS1A 2D6FA 2V1UA 4OMOA 1NEGA 4Y3OA 3W6JB 1FMWA 1ETKA 5CKHA 2X85A 4F7ZA 5FU6C 3FKIJ 5M5YJ 2HOEA 2OA4A 1LNXA 3BDUA 4MLOA 2V79A 1BL0A 1P7JA 4PLIA 2LVSA 2HFHA 2JRMA 3FMRA 3G1OA 3DWLE 1LCKA 2E35A 1YP5A 1UHFA 4OB2B 1N8RR 1K4SA 2MD0A 3HYIA 2LNVA 4XTYA 1AOYA 4CCJA 1PUFB 1S8NA 2R7TA 2O88A 5GAEJ 2QQSA 2NVYJ 1O3TA 2DN0A 2KDOA 2EQUA 3H0IA 2JZ2A 5GAOl 4OIPF 3OQ5A 1IUFA 1QLYA 4FW1A 1R49A 1XD7A 4AVZA 4B3AA 1YIJA 2NAZA 4AG1C 1T6SA 2KISA 2KJCA 2KZGA 5KNLA 2CS7A 1FYLA 3FXJA 2CSQA 2KDSA 3KBGA 2OV7A 2YHTA 2DVEA 2YUSA 1KU7A 3HGYA 2FX0A 2G7UA 1X6OA 2JK3A 5LGNA 2EQMA 1X6BA 2DXCA 4HNVA 2A37A 1YJNQ 1LE8A 1HW5A 2H94A 3AG4H 1GCPA 1CKAA 3A98A 1XN7A 4U87A 4D8KA 2LY1A 3GTJJ 5LJ5f 4KDPA 1MIJA 2WC2A 4CCLA 1J9IA 3FISA 1FOXA 4M7DG 4DYQA 5HVQC 2RREA 2NS0A 3SXYA 3HOVJ 1Z9ZA 4YIIA 2YT6A 3OOPA 2E12A 4LB5A 4TVRA 3V7SA 3G71A 2FYKA 3VOEA 2NUTA 3MVPA 3K1MA 2CZ7B 5C0MA 3LFKA 4J7FA 1BR1A 3EGUA 4ENJA 2VASA 1LFPA 2OZ6A 4F17A 1KQ8A 4HF1A 2QZ8A 2VXEA 4AM3A 3ER0A 2P0TA 3X28B 2OTJT 2ADUA 1KYWA 4NC7A 4XTWA 4Y13A 2AIRB 2DRKA 3KX2A 5F6FA 5GAN6 4PJNA 2EILH 3ZQGA 2RNAA 1WQ2A 4J9FA 1QCOA 1I5LA 4M7AC 1K79A 1TBXA 4BBSJ 2GWRA 5L3EA 1AZGB 2JZYA 3CJNA 5EEGA 1NLPC 4CA0A 2F4MB 4YRVA 5KK1A 4PJJA 3VDXA 4S04A 4C30A 4J6WA 2NUPA 4E7ZA 2ECZA 3S15J 2DD4A 4Y4RA 3ABTA 5LRRA 4I02A 2IVMA 3QKJA 2XDPA 3EQLF 2HU9A 1AVZC 4XRMA 1UZCA 4O3MA 2EZLA 2HYFA 3BZKA 5FKMA 3H36A 2LF7A 2KXCA 1VQPQ 2DW4A 3LWFA 1X1AA 1ZRFA 3FK6A 2PVDB 3WTXC 1X1PA 2HZTA 1W4SA 3HM5A 1VQOI 4EM0B 3S16J 3D5SC 2DL7A 3JSCA 5DUIA 4RCBA 1YHQQ 2L9NA 5CR2A 5CCAA 5IYBJ 1MGQA 2KLOA 1F36A 3JB9I 2P0WA 2M0MA 4XK4A 2F48A 4BBRJ 1E17A 3K4LA 2VUBA 5JVTA 2Y4YA 2E36A 2Y48A 3N4MA 1O3QA 2Y30A 4BY1J 2DCEA 3ESWB 4F7UA 4B6MA 2IJLA 2E3HA 4IRGA 1Z7LA 2ZPHB 3ABUA 3GFMA 5E20A 3GO5A 5IP7J 3S1QJ 3C94A 2G9WA 2XGXA 3BWGA 2DYBA 4A69C 3IQLA 4F55A 1ZG1A 2LG4A 3PSFA 2PUOB 1TTHB 4FT2A 3CMAQ 2JVHA 5JR3A 1RAGB 1C1AA 1WJEA 2DTZA 3CEYA 1PVEA 9ATCB 4JRKA 3K70D 4JQFA 2EPFA 1XC5A 4KH1B 3AHUA 1U3EM 2HYGD 4ANJA 2XC7A 3MMYB 1EH6A 3WODF 1SHFA 2EBPA 1MV3A 3V42A 5LEKA 3ABMH 2H8RA 2HQNA 5DLQE 3K70C 2BUDA 4IVNA 2DBBA 4KT0E 2WSCE 5HLTA 4LDYA 1YQAA 4G6QA 4RGXA 1VQMA 3M8EA 2MSYA 4GGGA 2BZYA 2FO0A 2ZPFB 3LW5E 3META 2Z2SB 5GAMf 3EG9A 3KZIC 1BKBA 1WPYA 2EINH 3WTVC 5LGTA 3JRDA 1WHLA 5ICFA 1O7LA 5FB2A 5CK9A 2QAZA 2PEXA 2XAUA 3P7NA 3D5LA 1EX4A 4M7AF 3SDBA 1RAIB 5L3FA 1J0RA 2VONA 4C5IA 2O7OA 1V55H 1YHQI 1Z67A 5CVVA 4QPQA 3P8HA 1S6LA 4NC8A 3LAPA 1HK9A 3QXEB 4NUBA 1Y7XA 3VS1A 2A6HF 1XMAA 5CYVA 1PD1A 4R0KA 4XQFA 1JKQC 4N4NB 5LD2C 2V7FA 1Y0UA 1IGNA 3IKTA 2EJGA 3ULRB 1Y39A 4C5EA 3CMAA 1XQHA 5FD5A 3DLMA 3EFSA 2QQ9A 4JZ4A 3F23A 2RPNA 2F2XA 2OF7A 5TJJA 4HA8A 1D3BB 4HVVA 1KIKA 3RDVA 4P9UA 2YUNA 5GJWB 4E6RA 3QOPA 2I2LA 2KRFA 4U88A 4CCNA 2GA1A 5L3BA 3I55A 2TDXA 2EK5A 4EM2A 4RGUA 2QQ8A 2WB1N 2COBA 4RGRA 1Q7YU 2ZJRF 4N4GA 2L0KA 1M5Q1 4PJLA 3TW6A 1QU3A 3MCAB 2PVOB 1U5TA 4KULA 3SWNA 4XICA 5A2QE 2DFHA 5DCFA 3CMYA 2D1XA 3HHTB 3E6MA 3JCMc 2O01E 3M0PA 1YITI 5IP6A 1VQPA 2JTMA 4H4KC 5M5XJ 1LKXA 3OL4A 4E2FB 2XF6A 4G7OF 3MP1A 4JX4A 4DBHA 4GYIA 2BXZA 3JRBA 3UA7A 3GYHX 5IN1A 1OYXA 3BR6A 1E6GA 2DMPA 1REPC 2LTOA 4Q5SF 1A6IA 3JCMe 3BCAA 1D0ZA 2LY9A 3E7LA 1RR7A 3ISPA 5FRMA 4LG3A 2BTTA 2LSOA 2ZAEA 3WVDB 1VQMQ 3JAME 1FYMA 5CKEA 4FCYA 2LKPA 5JHFA 4F7UB 3ELKA 2VPLA 2IS4A 1ON1A 2B63J 1U8RA 1OEBA 4A3FJ 1XMKA 2HNHA 4C2MJ 5DV5A 1RABB 2DM1A 3E2UA 2A6EF 3DEWA 1KQ0A 3HEFA 3KYDB 3NWSA 3QYEA 2WY7Q 2FUG2 4GRIA 3D1NI 2DFUA 2ZXWH 5EYRA 3AT1B 3ASKA 4C92F 2FPEA 3A0BC 3FMQA 2CFOA 4XMYA 5GADJ 1HKTA 4AT1B 3CCSQ 4IUPA 4FT4A 2JTVA 3B6AA 2CU7A 3IH3A 1NHAA 2DILA 3CDHA 2PMHA 3IP4B 1FBUA 1H89C 2XPVA 3H9JA 4I98B 3V8JA 4L59A 4PLLA 4ATOA 5DD4A 3G6EQ 3CDIA 2HVQA 4I01A 4W1UA 3CUOA 3VYUB 1QW1A 2ENMA 3NMZC 2BVMA 4PFPA 4XQ3A 2K9NA 5CJ9A 1B34A 1J09A 4IRIA 4MEXF 3AFHA 1NH3A 4F92B 4AFSC 3WGGA 2BY0A 2X48A 3ECHA 4JUVA 1M3AA 3BOQA 5AONA 5HDNA 2E2HJ 1HC8A 2L89A 1HXDA 1ONVA 1FTTA 1SPKA 3KP3A 1WHJA 2CGHA 4M75G 1VQLQ 2XDBA 1RAFB 4QVDA 2E7XA 5I2MA 1VQKA 3H1CA 3BR3A 5KYWB 2JN0A 2LFBA 1QVFA 1ZHFA 1FC3A 1DGWY 2P5KA 4HXJA 4II3A 3ZMZA 1M90C 4MZTA 1Z9CA 4RTWA 1LEAA 1LVKA 1MNEA 5L3DA 2X98A 3GTGJ 1XDSA 3S1MJ 1WJCA 1HW2A 1S1NA 4M77F 5BPIA 3U1KA 6AT1B 1YITT 4I2OA 3JRGA 4KIGA 3GTQJ 2FQ4A 2I10A 3I71A 4IF4A 1RACB 4OINF 4EJTA 2ZMEB 1MZBA 4XKWA 2VLAA 1R77A 3G6EI 2LC4A 2LQ8A 4CCOA 1ZLMA 4C2UA 1VQ5I 2Y9ZA 2R5ZA 3M8FA 3K69A 3FBNB 2ESWA 2M7AA 3F8FA 1KC8C 5KYXB 1JT6A 1G3WA 1R5ID 3HOWJ 2LBFA 3F70A 4IIOA 1QP2A 1AWCA 2HKNA
chains in the Genus database with same CATH topology
3MEVA 4FIBA 5BPDA 2RI3A 3JRZA 1SAXA 2B8AA 4ZGJB 1ZGJA 1QO0D 1S7OA 4LG0A 3FZVA 4KNYA 4EV0A 4C92B 1IZ1A 2V1DA 3REOA 1YJNT 2ZNYA 3WTTC 4N9HA 5GANe 1LDDA 2UZKA 4KFCA 4F7UF 4PNOA 2FNPA 2BYVE 1M90U 4M6YA 5GAN8 2GF7A 4PL6A 2PJPA 1ZBXA 3INZA 1YO5C 1QVGS 4BE1A 2X4WA 2JPBA