1G3TA

Cys102ser dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
215
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 67
structure length 215
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3tA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3tA03
4YFXF 3KP6A 2FBIA 3CDHA 5HLIA 4OINF 5HDGA 4ENNA 3MEXA 1XGSA 2K02A 4D0PA 2QQBA 2XRNA 2XKPA 3H3ZA 4MEXF 1KQ0A 3WTSC 6PAXA 3SZTA 1G3TA 4FX4A 3TGNA 4M73A 1SMTA 1MGTA 2V79A 2NYXA 2K4YA 4G8XA 2K5LA 1R7JA 3DF8A 2XROA 2EFQA 4UVAA 3M1EA 4LJZF 2D45A 4ASNA 1EH7A 4ZH4F 1I6XA 1R1UA 3E5UA 2YX7A 4P96A 3ZMZA 3M7GA 3WTYC 4BHBA 4ESJA 3VOEA 5D4RA 3RKYA 2ZMEB 2QBYB 2EFNA 2P4WA 2V1DA 3E5XA 4EJWA 1FSHA 2ESNA 5F64A 2VOPA 5EEGA 3F21A 1HW1A 3LA2A 2NNNA 1OYIA 3WTWC 1Z05A 5E1XA 3K0LA 4I0BA 5FFXA 1BIBA 1FWZA 1W5SA 1P6RA 2CGPA 2FRHA 3E97A 2VODA 1GVJA 4JQFA 1UHWA 3TO7A 4G94A 2A5YB 2MD5A 3C18A 3RTRA 4OIPF 4JBAA 1JGSA 4IXAA 5TRDA 1DDNA 2GWRA 1JE8A 4I0AA 5A2QZ 4OIOF 1T39A 3GFJA 2E7XA 4HQEA 1YW7A 4PDKA 1I27A 3I59A 1J9IA 1OPCA 5D5XB 2MLGA 1IW7F 1RZ4A 3OV8A 2OQGA 3MZYA 3QP6A 4CICA 1D8JA 1MKMA 3HHGA 5DUKA 4GCVA 1XB4A 4HV6A 2FBKA 3KLOA 4G9YA 1BIAA 4XSZF 3QRFF 1U6GA 1Z6RA 2PBIA 2M45A 3C3WA 2IA2A 2C6YA 5HLGA 5LEKA 1R58A 1QVPA 3BDDA 5IT3A 3KEOA 4BNCA 2CG4A 3I54A 3F8FA 1AOYA 4HF2A 2YSRA 1QZYA 3HTUA 4A0ZA 4EM2A 3IHUA 1ON1A 2JPCA 4L5JA 1HBXG 2EV6A 2DI3A 3E3VA 1YFHA 4M74A 1DPUA 2FMLA 3RPQA 3GZ5A 2PFBA 4ZZLA 4KMUX 5LEJA 1SMYF 5HS9A 4P5OA 3F8BA 2M30A 5AONA 4BAYA 3QPTA 1MDMA 4WX9A 3U1DA 1G3SA 4HX8A 1R1VA 4Q4ZF 3JAMZ 2DQRA 5A2QK 3TO6A 2JPBA 3KFWX 3JTGA 1YW8A 3TKYA 3W6KB 3J81Z 1YW9A 1U5TB 1PDNC 3WU1B 4HA8A 4YG2F 2DBBA 4EM1A 4L5IA 3RPUA 3F8MA 1KQ8A 1ZG1A 4P9FA 2VXZA 4YIFA 1R5HA 3O2PE 4EJTA 4PGHA 4NHJA 2FE3A 3MCZA 3ZP5A 1KU9A 1FYKA 5J8CA 2K7LA 5TJJA 1QNTA 4LMYA 1S8NA 1QZZA 1P2FA 2PEXA 2PN6A 4FT8A 2F2EA 5FD6A 1WI9A 5L3FA 1IN8A 4ENKA 1O3RA 4XSXF 2M1BA 2K4BA 4IRHA 5E18F 1QBJA 4UNOA 3KEQA 4JK1X 1BN5A 3F8CA 3RYPA 1FC3A 3J80K 2EFOA 4U0VA 3V4GA 3GUDA 2EA2A 3FHZA 4PZJA 1LEAA 1ULYA 1ZN2A 2VBWA 3RKWA 3E6DA 4MTDA 1FX7A 1IRGA 2Z33A 5F6FA 1F5TA 4O3MA 2K4JA 3WU0A 3PQKA 5CYVA 2QZ8A 3IRQA 1BJAA 2OD5A 2P7CB 4LLGF 5DV5A 1UB9A 3ZQ7A 4S05A 3B02A 4ESFA 3V8LA 1Z7UA 5FO5A 2K5FA 1SAXA 1FOKA 3E6BA 3RKXA 2RGVA 4ON0A 1FP1D 2HOEA 1BM9A 2GCXA 1S3JA 2Z3YA 1BOAA 3DPLC 5DCMA 1ZRCA 2G9WA 2X0LA 2DPUA 2G7UA 1TQPA 2EA4A 3E6CC 3ROUA 2A69F 4LB5A 3OOPA 3WGHA 3JW4A 2ZFWA 2EV5A 2DK5A 4HOBA 5LGTA 1YIOA 1IXRC 4LK1F 4RAYA 3U9GA 4F7ZA 1KQ9A 4P55A 3C1DA 5DYMA 1X3UA 4CZZA 5H20A 3IKTA 4KDPA 2OA4A 1TQMA 2ZJ2A 2V9VA 3QU6A 3I0TA 2OQRA 4ZZDA 4HLYA 2KIMA 2LF8A 1ZREA 1OKRA 3BP8A 4EMSA 2DQLA 2LDUA 4PGGA 1P4WA 4OMZA 5BPIA 4B8XA 2DPDA 4IJAA 3P9CA 4EV0A 3KE2A 3L9FA 4CXFA 2XAJA 3L7WA 1I5ZA 2V6CA 3E5QA 1FNNA 3I4PA 1J75A 1GHCA 1MDMB 3KCCA 1R22A 1A04A 2XIGA 2OU2A 1KYZA 2YU3A 4L0ZB 2QLZA 2Q8KA 3WTUC 4EGZA 5AIQA 5BOXA 1JHFA 3IC7A 2R7FA 4Y17A 2W24A 1OMIA 3R0JA 3M9AA 2EV0A 4KICA 4G6DA 3QAHA 4TV7A 5J6XA 4KA4A 2W57A 1QPMA 5K1YA 3F6OA 1QW1A 3WODF 2G7HA 4UV8A 2M87A 2F5DA 1XN7A 4G6QA 4MQ9F 3CUQA 2L3DA 1HKQA 1I1GA 1TNSA 1T38A 1C0WA 2VN2A 1TW2A 1YS7A 1J7KA 1L3LA 5AIPA 4LG0A 4RGSA 2XAFA 3LQQA 3KLNA 5ED4A 2Y48A 3GLXA 5ILSA 1YQAA 3TDUC 1IUYA 1KA8A 1SD4A 1F4KA 2VC1A 2LSOA 4BYYA 2BE5F 2MLKA 3MAJA 3WGGA 4RGXA 2FU4A 2ELHA 2RKHA 4A5NA 1MJ9A 2HFHA 3PQJA 3ELKA 4RB2C 4H0EA 3SXYA 2ACJA 1P4XA 4KT5C 3TDZC 2V1XA 1IF1A 1H9GA 2H3JA 2EK5A 4WWCA 1ZG5A 3CO6C 4I7HA 4BXUA 1FLIA 5DDGA 3GZ6A 4L9JA 1BI1A 4EGYA 2FA5A 5D6EA 1SD7A 5BS6A 2HTSA 5LHGA 4OIRF 1RI7A 2O03A 3LAPA 5DCMB 1J2XA 1EH8A 3BY6A 3QU3A 2HR3A 4WXCA 4KN4X 3K1MA 2GIVA 3CUOA 4S04A 4UVCA 3TQNA 4P9UA 2LF7A 2L4AA 1R5GA 1FYLA 2HYGD 2MC3A 2IA1A 3L2CA 3Q9SA 2ETHA 1O7LA 3BPVA 1REPC 3T0YA 2RQPA 4LGWA 1TTYA 2NAZA 3HRUA 1ZRDA 4ENJA 3BWGA 3HRMA 1XGOA 4A5MA 1VTNC 3QPHA 4R1HA 3EUHA 4CGZA 4OIQF 4M71A 1IRFA 3CUQC 5D4SA 4U88A 4U7BA 1S7OA 3KZYA 2RVCA 4ENMA 2IVMA 4BHPA 1CF7A 5LBQA 4KYWA 2VC0A 4WXHA 4RB1A 3K69A 5FB2A 5D6FA 2FMYA 1OYYA 4M9XA 3JSPA 2NNYA 2UWMA 2V1UA 5CVVA 1QGPA 4HLXA 1YLFA 2BYVE 2HGCA 2ADUA 4I09A 3O3KA 1EV7A 5D8KB 1BI2A 4I2OA 1WWXA 2HEOA 4FX0A 2H27A 4Z2YA 1H0MA 2LNBA 2HQNA 3BJOA 1W4MA 2QWWA 3KP3A 1ZARA 1LDJA 4IHTA 4CHUA 4ESBA 4LLNA 3I71A 4YIIA 4ZYHA 3VB2A 2ZKZA 2GAUA 2RDPA 4RB3C 1Z1DA 4O5VA 3V8JA 3R60A 1GXPA 4XLNF 3IL2A 1O7FA 5ILUA 5J8FA 1XDSA 2Z5UA 4UUVA 1UFMA 2RC4A 2A6EF 4AIHA 5DD4A 4PCQA 1SD6A 2IP2A 1Y0UA 3WTZA 4G7ZF 4B09A 5ICFA 2F5CA 2H6BA 2R3SA 4LG0B 4MQVA 4HDVA 4LB6B 2MH9A 1XCVA 5CVRA 4A0YA 4ZYGA 1DUXC 3F3XA 5LRSA 2NS0A 5BPDA 2PG4A 3S2WA 1FP2A 2IJLA 4CDGA 3MHXA 1XMKA 2W85A 4Q48A 3BJAA 3FXQA 1ZG3A 2M5WA 4BH9A 3V7CA 5D5UB 2BV6A 3I64A 2KRFA 5FGMA 2L02A 2FOKA 1RUNA 3W6JB 2Q0OA 4KNYA 4L18B 4CYDA 2IW5A 2CSOA 3G73A 1R1TA 1K78A 2BGCA 3JAMK 2O61A 2WTEA 2QVOA 2XASA 3ABTA 4LK0F 1QO0D 5HOOA 2VBZA 4RGRA 1P92A 2COMA 4WXDA 1HKTA 2DW4A 4WCGA 3T8TA 2EB7A 4WF2A 3J81K 1XGNA 3DPTA 2UXNA 1WSUA 3M8FA 1XSVA 2LX9A 1IN6A 1J59A 2JZYA 2CO5A 1HW2A 1O3TA 3T8RA 4G7HF 2CQKA 1BYMA 2R7DA 1STZA 4OMYA 4N9IA 1ODDA 4FHTA 2EFWA 4QWQA 4R8HA 1I1SA 1WRJA 3K1NA 3MQ0A 2XKOA 3LWFA 3VODA 2MH2A 2ZBKA 1XD7A 4KUMA 2HTJA 3AAFA 4XBFA 3N97A 2ZMEA 2QBYA 5DEQA 4EQQA 3BOQA 4KMFA 1U8RA 4HX4A 4HYEA 3HRSA 4L0YB 1S6LA 1ZRFA 2DT5A 3TOBA 2FEZA 3I59B 4A6EA 5K5QA 2HKOA 3FF5A 5HDNA 3CO7C 3ZMDA 1U78A 2A6HF 3CLOA 3IWZA 2O0YA 4OU0A 4BQAA 1EH6A 1H9TA 1FY7A 1KU7A 5FLXZ 1CF7B 3KP7A 1B9NA 2A61A 2K86A 1G3YA 2YPRA 3MWMA 2WC2A 2P7VB 2XAHA 3T1BA 5FFZA 3GX4X 1CGPA 2XAGA 3ECHA 2D1VA 1SFXA 2VBYA 3DKWA 4ZYDA 1J5YA 1KGSA 1YS6A 2OZUA 5CJ9A 2YR2A 3O6BB 4IPAA 1JHHA 2CFXA 2LKPA 3HYIA 5HDKA 1RUOA 1HXDA 3PFIA 5DCFA 3KP2A 3HRTA 3DV8A 2J5OA 2PI0A 1E17A 2BEOA 4QLCU 3Q9VA 3RDIA 2D1HA 2W84A 3IKVA 1BC7C 2JRTA 4GGGA 4MNUA 1ZYRF 1Z91A 3P9KA 4KIGA 4Q47A 2VT2A 4L9VA 2P6SA 2VT3A 2GQQA 3GEZA 3ULQB 3HSRA 5ERIA 2UZKA 3SZPA 3LSTA 4UV9A 3FXUA 1T98A 2IT0A 5CVIA 3RJPA 4KN7X 3N4MA 2DAOA 5ICCA 1RIOH 1S7AA 2FBHA 2K5IA 1T6SA 3EYYA 3MFKA 5KK1A 1B4AA 3ZN1A 3NRVA 5LRRA 3WTVC 2QYOA 4I01A 2JTVA 2L01A 1LVAA 2OAZA 5E8GA 2P5LC 3FXRA 5FLXK 2ZNZA 3R0AA 4EM0B 1XGMA 5JI6A 3ZMSA 4LLLA 1BI0A 3M8EA 3EQLF 2KJBA 1R36A 3I53A 4Y15A 1FPQA 1PUEE 5LHIA 4XRFA 4HBLA 1E2XA 3FX3A 1IAWA 1PP7U 2ESHA 3NEUA 1P4AA 1HSJA 4XLPF 3KP5A 1D3YA 3I58A 2CWEA 2IPQX 3P7NA 4LD5A 5L3GA 4HF0A 1V4RA 3V7SA 3E6MA 5BQTA 4GXOA 1XMAA 1FSEA 1ON2A 4YFKF 1FBUA 3GFMA 2DK8A 4MEYF 1SFUA 4HW0A 2IRFG 3LA7A 5EEHA 1YTYA 3P9IA 5HS7A 1UCRA 1O3QA 5LGUA 2KKOA 1O3SA 2GXBA 2ZCWA 5K5OA 2FF4A 4HV5A 1Q1HA 4KIFA 3J7AO 1IXCA 2UXXA 1MJAA 4A12A 1K78B 1ZH5A 1UHMA 2PMUA 2FNPA 4AIKA 2H09A 1F9NA 3FM3A 4UHTA 4EJVA 4AIJA 2DLLA 4M9ZA 1BBYA 2ZXJA 2HKXA 2XVCA 4GYGA 2P6TA 2M8EA 3IWFA 3GFLA 3BROA 3LFKA 2PJPA 2JSCA 4NQWA 1LNWA 3DXJF 1MJBA 1B6AA 2AS5F 5ILVA 3U2RA 4HDUA 2E7WA 3F6VA 1K6OA 1IN7A 3K2ZA 1YG2A 4A0XA 1W7PD 2XUBA 4BHCA 1PP8F 2WWYA 2DTRA 3LA3A 5CVUA 3RI4A 1KYWA 1JXSA 4M6YA 1K7AA 1ZLJA 1WQ2A 5L3DA 1B9MA 1V3FA 4L9NA 2FXAA 2IA0A 1R00A 5HS8A 4A6DA 4HF1A 3F72A 4A2UA 4IVNA 3FZVA 3GVAA 2CW0F 3FMRA 2QQAA 1Z6TA 3GF2A 4M9SA 1LDKB 3IRRA 2ZO4A 3DQVC 5DD8A 3ABUA 3FMQA 4O6JA 2HS5A 2B0LA 4U0YA 1WKMA 3G3ZA 2XV4S 2P5KA 1SFEA 1LQ1A 4MHGA 1TBXA 4MGRA 3ERED 4L9TA 4EJUA 2VE9A 1OR7A 5BMZA 2DU9A 3D5LA 4ZYEA 2BBYA 2TDXA 3V8KA 1XCBA 5E1WA 5JFRA 1LJ9A 4N9HA 3EETA 1F1ZA 5JHUA 2JT1A 5JVTA 1D8KA 2XAQA 1U5TC 3F8NA 3DFGA 5H6RA 2VBXA 3LAJA 5HVQC 1QQIA 4IRIA 2J5PA 1LB2A 4K2EA 4IRGA 1YO5C 1RNLA 5L3EA 1KU3A 4WK8F 1AWCA 2QQ9A 2X4HA 3HIFA 4NB5A 2HYFA 3DP7A 2D2WA 3NQOA 3WE2A 5HLHA 2GA2A 2XGXA 2YX4A 2GXGA 4GYIA 3JTHA 2QUFA 3F22A 3J80Z 2H94A 4KIBA 2O8XA 1FBQA 3RYRA 1G6NA 4GO1A 3FM5A 3CUQB 1YYVA 4HZFA 1GXQA 4HAMA 2WV0A 1ZAOA 3GW2A 2STWA 3QP5A 1FBSA 4UXNA 2EWNA 5FD5A 3VEPA 2QENA 5L3CA 1NHAA 2H6CA 2QM3A 5ICEA 3JSOA 4CO8A 5E20A 2P8TA 1W5TA 5KVRA 1U2WA 4RAZA 5E1ZB 1W7PA 3ZN0A 1U3EM 1TNTA 1OYWA 4ETSA 3C7JA 1KU2A 3VFZA 3T5XA 1HSTA 1FT9A 2RN7A 3ZMVA 4G7OF 1L0OC 1G4DA 2STTA 4U7DA 3TO9A 5IT9Z 4AWXB 2ZNYA 2A68F 3R61A 1HQCA 1B59A 2DFIA 1ZGJA 2VE8A 5K5RA 2EFPA 2L54A 2E1NA 1TW3A 4IHSA 1XSDA 2W25A 2DO7A 3I5UA 1J0RA 3R6SA 2OBPA 4Q5SF 1T0FA 3REOA 1K79A 2O3FA 2Q2EA 4HX7A 3HSEA 2HZTA 3KZZA 2KJCA 3ISPA 3MZHA 2HDCA 5E17F 1IXSB 4AD9A 4EJOA 1HW5A 3SQNA 3H3UA 2EJRA 1ZHFA 4AVPA 2P5VA 2KIUA 4YFNF 3COAC 4RS8A 5D8LB 1SD5A 2MA3A 2E1CA 2KIFA 3Q5FA 1ZLKA 2Z9OA 3GO5A 4R79A 2Y75A 2XHKA 5E8IA 3CTAA 4Y13A 4RGUA 3EYIA 1MD0A 2OZ6A 3WE3A 1T2KA 2RV8A 2Z99A 1XSXA 1G3WA 3WGIA 2CYYA 5IT9K 1IN5A 3F23A 3ECOA 3WTTC 3GYHX 2A3SA 2FSWA 4KFCA 3ZPLA 1S29A 1ZGAA 2FNAA 1FZPB 2HQRA 1IN4A 2FQ3A 3WG9A 4OOIA 3TOAA 3ZMUA 3K9TA 3CJNA 3KP4A 1R23A 4DNCA 4M72A 1LEBA 5CVJA 1ONVA 5DUIA 4MTEA 1HKSA 3ZMTA 2F5FA 3GWZA 5LLQA 2NRAC 2VOOA 3ML6A 3D0SA 3H92A 4N0BA 2MBFA 1TQIA 4I02A 2ISYA 3HTSB 3HOSA 3LQRA 5L3BA 3L00A 3V7RA 5H6QA 2L4MA 2ISZA 2RNJA 3HUGA 3K1PA 1O57A 5CLSA 5D5WB 5D5VB 5LGNA 2PMHA 3BJ6A 3HHHA 2PLYA 3SFZA 3RIRA 4DQ2A 1D5VA 3E19A 1MZBA 3GXOA 2F5EA 1XDUA 1BI3A 3EDPA 3DEUA 3FMSA 3QOPA 3KETA 2GA1A 4LFUA 2VONA 4EVIA 2A07F 2HWVA 3R4KA 3FWEA 1USSA 1Z9CA 3SHFA 1USTA 1BC8C 4HQMA 1DP7P 2O6GE 1B1BA 4IF4A 3GFIA 4E70A 3BZ6A 4RB0A 2Y0MA 5F1RA 3HOTA 2GZWA 5ICGA 1W7PB 1FYMA 2AXLA 1TLHB 3L09A 2PQ8A 1U5TA 3WTXC 1DPRA 3B73A 3BPXA 1LDDA 4I98B 1IZ1A 4UVBA 4U0WA 2K27A 5JR3A 4M6XA 3HSFA 5LHHA
chains in the Genus database with same CATH superfamily
4YFXF 1I3AA 4IOAF 3GBGA 1KJWA 3JCMg 5KCHA 3GBQA 2MD0A 4XTXA 4J9FA 3KP6A 4J01A 4KULA 3ZQFA 1M1FA 2KDSA 5CQGA 2FBIA 3CDHA 3MD2A 1LPQA 2DXUA 5HLIA 3IQLA 4OINF 1OX8A 1WHJA 4J9EA 2VKHA 1UFFA 3JCMJ 2BTTA 5HDGA 2LCLA 2VKDA 3DTIA 4XKCA 4XLHA 1HOMA 1QVTA 3QUIA 2C0OA 3FRNA 2XPWA 4ENNA 1HSQA 2EGAA 3MEXA 1XGSA 1WVRA 2K02A 1UGPB 5KCOA 2VXDA 3FXKA 4M3FA 3E1SA 3LSJA 4D0PA 1YCSB 4F16A 4C5EA 4B43A 2MW8A 2QQBA 2XKPA 2XRNA 3DWLE 4OWRB 2M4GA 3H3ZA 3DTKA 3A8LB 4MEXF 4NL2A 1KQ0A 2ROTA 3WTSC 6PAXA 2CT4A 1APLC 3CCQA 1PYVA 2OTLQ 3LSHA 2Q2EB 1V54H 4A3KJ 2MVTA 3SZTA 4C0DB 5FW9A 1G3TA 5CKFA 2CQ7A 4FX4A 4XONA 4L6V5 4M77D 1Q82U 2YRCA 4HKEA 3TGNA 2QGUA 4M73A 1W6XA 2EYZA 1KD1R 9ATCB 1T08B 2KXCA 1SMTA 1WDXA 3RPUD 1A36A 4A4GA 1Q7YC 2E1HA 1MGTA 2V79A 2OTJA 2NYXA 2LJ3A 2K4YA 4F04B 4HEA2 3OS1A 4OMMA 4G8XA 3JREA 2ZAEA 2DMOA 3M0TA 2K5LA 4H4KC 1R7JA 3DF8A 2XROA 3CMEQ 2EFQA 2NUPA 4UVAA 1BKBA 4QKUA 3CCMQ 2CZ1B 3M1EA 5I21A 3FJPA 4LJZF 2D45A 1NPPA 4ASNA 3OIPA 2FPFA 1U3OA 1W2BA 1EH7A 4ZH4F 3PTAA 3HPWA 4OMNA 1I6XA 2YWWA 1R1UA 3E5UA 2YX7A 4P96A 4AUXA 2LQNA 1S72Q 3ZMZA 3M7GA 3WTYC 4BHBA 1W1FA 5B3SH 2QGFB 4J9IA 2E41A 3ZCOA 1ZA2B 3CMEA 2DERA 2KQRA 4IZZA 4PJJA 1IHVA 5J3LA 4ESJA 2M35A 2MFZA 3VOEA 5D4RA 3RKYA 1RR8C 2VKEA 3K4JA 1N27A 2FG0A 2GTOA 2ZMEB 3TBIA 4RTWA 2QBYB 3WHBA 2EFNA 2P4WA 3MCAB 2V1DA 1HLVA 2QA4A 2DYSH 3BR0A 2AXTC 3E5XA 2DIQA 4EJWA 1FSHA 2LNHB 1MBFA 2I8DA 2ESNA 3TW6A 5F64A 4NS5A 2VOPA 3A8HB 5EEGA 3OS5A 1M3AA 2YUSA 1HW1A 3LA2A 3F21A 3JB9D 1ZUKA 1WPKA 2EGCA 3QYGB 2NNNA 1W1WE 1OYIA 2B8AA 2M51A 3I5SA 5CQXA 3H3VK 2EQIA 2JVHA 2ME0A 3WTWC 1Z05A 2LY9A 4G6TB 3H0HA 2GOXB 5E1XA 2K2MA 3PMTA 4Q5WA 2OTLA 3K0LA 4BXXJ 2GFAA 4I0BA 4K11A 4DBFA 1MMGA 5FFXA 1VQMQ 2X6WA 2EIMH 1OPKA 3EG9A 3IH3A 3F0CA 2OPTA 3QXEB 1BIBA 1FWZA 1W5SA 1P6RA 3NTKA 3HGYA 3GMEA 2HI3A 2CGPA 2CSIA 2FRHA 2Y0SN 3G1OA 3HJEA 1S1NA 3E97A 1WGSA 2E71A 4M7AB 2RAEA 4AFQC 5GANg 2P0PA 2YSQA 5GAOr 1VQ8Q 1M90C 1GT0C 2VODA 1GVJA 4JQFA 5GAGJ 2J7IA 2E64A 2PNIA 5HODA 3QSUA 2ME6A 3BG9A 1UHWA 3TO7A 3CCMA 2K9SA 4G94A 3CCRI 4ZTJA 2GLOA 2A5YB 2MD5A 3C18A 1WQ7A 3HTRA 3VU3C 1D1CA 3RTRA 4OIPF 4EEFG 4JBAA 1JGSA 1TUCA 3VYTB 2HBPA 4DIQA 4XTYA 1IUFA 4IXAA 2JN0A 2L9RA 3IH2A 5TRDA 1DDNA 2AZSA 2MIOA 2IG0A 2GWRA 1JE8A 2LZ6B 1NJIR 4FSXA 3IAM2 4M78D 3S3MA 2L0AA 2XDVA 4I0AA 4UUTA 1J3TA 2KY9A 5FWCA 3WHCA 1PKTA 5A2QZ 5HKCA 1R8OB 1Q86U 3GIBA 2O8KA 4OIOF 1EJ9A 1AWXA 4C92D 5LJ5g 1XNIA 2ZXHA 3J7YJ 1T39A 1TT5B 3GFJA 2E7XA 4J9HA 5EYRA 4HQEA 2CDTA 1YW7A 2PX9A 4PDKA 2FPEA 1DJ7B 3JSCA 1I27A 3I59A 1J9IA 1OPCA 5E79C 2KRSA 4IL6C 4J7FA 5D5XB 2MLGA 2KDZA 2HKNA 2LQKA 1IW7F 2KZVA 2PUOB 4J19A 2QAZA 1RZ4A 2E5KA 1YCYA 3BTIA 3OV8A 2OQGA 4ELYC 3CCVT 5DM6F 3MZYA 1KZHA 3QP6A 3FBNB 4CICA 1D8JA 2EJFA 1VQMA 2OTJI 1MKMA 1FEXA 3HHGA 5DUKA 1TS9A 4GCVA 1XB4A 4HV6A 1KQ2A 3EFRA 4PJNA 4XQFA 1VQPQ 3U21A 4FU6A 3EAEA 2FBKA 1ETQA 3KLOA 4G9YA 2Y0SA 4ITVA 2MMPA 1BIAA 3CXCS 1B72A 3EFOB 4NBQA 3JB9H 5A2QR 4XSZF 3QRFF 1G2HA 2X3WD 3A03A 1VQ8A 1U6GA 3I4NJ 2ZPEB 2DJNA 4F7UA 2FB7A 1Z6RA 3G7ZA 4X6AJ 1TXQA 1RAIB 5GAN6 3EGDA 2PBIA 2HVRA 3FLGA 2M45A 3M54A 3HUGB 2M7BA 3ZQLA 4OVAA 3CMEI 2HPIA 2LRDA 2L89A 4XLAA 3C3WA 1YRNB 2IA2A 4NNJA 3VYHB 1VQ7T 2C6YA 1VQ4T 1NPRA 1GCPA 2YLCA 1TOVA 2QTVA 1JJ2A 5HLGA 5LEKA 1R58A 1HCRA 2A7YA 2YU9J 1QVPA 3BDDA 5FU6C 1NG2A 3QG1A 4Y28E 1XTDA 3HPGA 5IT3A 1QVFA 3KEOA 3CPWA 4BNCA 2CG4A 1UMQA 2LREA 1ACIA 3I54A 2EIKH 1ZSZB 3F8FA 5A0DA 4IQJA 4EMKC 1K61A 1AOYA 2LJ0A 1LE8B 5GAN3 4JRIA 4HF2A 2YSRA 1QZYA 4E6KG 3HTUA 4A0ZA 2PU9B 2VUBA 4D8KA 4PJ0C 3BR3A 4EM2A 2EPDA 4CCNA 2F1LA 1B7TA 3IHUA 2V1RA 4MFDA 1IV8A 4XKWA 1ON1A 2JPCA 4L5JA 1T8IA 1D5YA 1HBXG 2GTJA 2EV6A 2OTLI 2QXFA 2DI3A 3E3VA 4XKVA 1QZEA 1YFHA 4M74A 1DPUA 1QWEA 3DB3A 2FMLA 1ABOA 1EKEA 1MH3A 5FKKA 3RPQA 1CQTA 2EJGA 3MKDA 3CMAT 3A4CA 3GZ5A 3CCJA 4DJAA 2M2EA 1WXTA 2PFBA 2WY8Q 4KMUX 4ZZLA 2KMUA 5LEJA 1K4US 3I55T 1VA7A 1SMYF 3CP2A 2A3LA 2QEXQ 2Y2ZA 5HS9A 4U87A 2DIGA 4HT9A 2IS6A 4P5OA 4DOVA 3F8BA 2VQHA 3MP6A 5B66C 2M30A 4IUUA 2KYMA 4IUQA 1VQPA 3CCMI 3RQ4A 2B86A 5AONA 4N4HA 4XK4A 4BAYA 3QPTA 1PUFA 1MDMA 4WX9A 3U1DA 5IP9J 1NBEB 1G3SA 4HX8A 3HC7A 1R1VA 3ZQCA 3PNWC 4Q4ZF 1S72I 3S1QJ 3JAMZ 2DQRA 5A2QK 1LKXA 5LJ3e 4NC7A 4RDUA 2VV5A 3INZA 3S17J 1I50J 3S1NJ 3TO6A 2BE9B 1OFCX 2JPBA 3KFWX 3JTGA 3HDDA 3J7AY 1IDZA 1OU8A 3JCMc 3I56Q 3EGXB 4KBMB 4V2FA 3TSWA 1YW8A 1TWCJ 9ANTA 2EQRA 3TKYA 2NOJB 4PK4A 4IO9F 3W6KB 4FCYA 2DETA 4LIVA 3J81Z 1YW9A 1U5TB 1PDNC 1AWJA 2PVDB 3WU1B 1AT1B 3C0CA 4WCIA 3FXOA 3OSVA 3CP8A 4CC7A 4IQ4A 2D6FA 4HA8A 5CO7A 3S16J 3H5RA 2BZXA 4YG2F 2DBBA 2ESWA 4LE9A 1Z7LA 4EM1A 4M77A 1PG5B 2W1OA 4L5IA 2CP3A 4AFUC 3JRBA 2LOOA 2E12A 1E6GA 1SRLA 2VC8A 2WACA 3RPUA 3F8MA 3Q0VA 3FBIB 1W2BS 1H89C 3JAMR 2E36A 3CCYA 3GTOJ 1KQ8A 1ZG1A 2BY3A 1VYVA 1VQMI 3S2HJ 5KYNA 2CUEA 2QASA 2L7ZA 4P9FA 4L5GA 2E10A 3HKZN 4PJOD 2VXZA 1H92A 4YIFA 1R5HA 3F70A 3FK6A 5KYWA 3PO3J 3SYTA 3O2PE 1DP3A 4NDLA 4EJTA 3UKGA 3A02A 2BZ8A 1T3LA 1VQ8I 2QEXA 4PGHA 1VQ5T 4NHJA 5GMKe 3J81R 2FE3A 3MCZA 3HKSA 1N75A 3ZP5A 3OSGA 2D9TA 1KU9A 5IXBA 2F69A 1FYKA 5J8CA 2DM1A 5A0GA 2PZ1A 1K73C 2L9NA 1D3BA 5FLVA 2RI5A 1D09B 1X6GA 2K7LA 4OMPA 3B6CA 3H36A 2G3RA 5J1RA 5TJJA 3QZ9B 1QNTA 1TL8A 4LMYA 1ZA1B 5EG2A 4B1RA 3VWBA 3I9QA 1QRYA 3NARA 2RJEA 1S8NA 1QZZA 2VQLA 1P2FA 2PEXA 5GTIC 4Y33A 1KHCA 2A36A 2JTFA 5GJVB 3I56A 3CCET 2PN6A 4MO7A 3H41A 2MI6A 4FT8A 2F2EA 1V76A 4N4GA 5FD6A 5KHDA 2VLAA 1WFWA 1WI9A 4F7UG 3UR3C 2ZPGB 2RPNA 5J4YA 5L3FA 1IN8A 4ENKA 1O3RA 2RNAA 4XSXF 2M1BA 2K4BA 4FM4B 3CCSQ 4M3BA 2GF7A 4IRHA 5E18F 3ZOBA 1QBJA 2NUPB 2XD0A 4JX6A 4HNVA 3KEQA 4UNOA 2J6OA 3H9QA 2KROA 4JK1X 1TTHB 1BN5A 3F8CA 1RAEB 4R0KA 1ABQA 1YJWQ 3RYPA 1FC3A 3J80K 3OYBA 3GNGA 3CCLT 1IGNA 2EFOA 4U0VA 2VIXA 2Z0WA 3V4GA 2JM9A 2ZFUA 4J7IA 3OQ5A 2NVYJ 3GUDA 4IKFA 4OAYA 2CT3A 2L3SA 3EH1A 2EA2A 3FHZA 3S2DJ 3UT1A 4PZJA 4IHYA 5AT1B 1FOXA 1LEAA 1MGQA 1AZGB 3CC4Q 1DQUA 1ULYA 1ZN2A 2I10A 2VBWA 1T3SA 2IIMA 3C4SA 1VQMT 3RKWA 1A6QA 3E6DA 4RTXA 1VQPI 4LUEA 5C44J 3M58A 4GY5A 4KISA 2JUGA 1IG7A 1NYFA 4MTDA 2QI2A 4OB3B 1FX7A 3A98A 1OCPA 2KGTA 4I76A 1IRGA 3FKIJ 4BU2A 2Z33A 5F6FA 3OW2A 1F5TA 1GV5A 1HDDC 2PJRA 4JJBA 2DBKA 2V6EA 4O3MA 1KD1U 1B34B 1R77A 2K4JA 4BJTA 3WU0A 3DPUA 1KK7A 4M78A 3SWNB 1ARKA 3PQKA 5CYVA 2NOGA 4A63B 4EMKA 2EZIA 2QZ8A 3RR6A 4XRSG 3E9GA 3IRQA 1CKBA 2BW3A 2A05A 1BJAA 4M7DG 3VYUB 3KFVA 2OD5A 3MJXA 1Q95G 2P7CB 4LLGF 5DV5A 1UB9A 3ZQ7A 4S05A 3EG9B 1Z77A 3B02A 4ESFA 3V8LA 1Z7UA 3DU5A 5FO5A 2K5FA 4AT1B 1YIJT 1SAXA 3DTEA 1FOKA 4FIBA 2M8GX 2AIRB 2D1XA 4IURA 2F48A 3E6BA 3RKXA 5HCKA 1LFPA 2DPPB 2VL8A 2RGVA 4ON0A 2FUG2 2X6OA 2BZYA 1OU9A 5GAMj 5KYXA 2QA4T 2XSDC 1X1CA 3M9QA 3CCSA 1FP1D 2HOEA 1BM9A 2GCXA 4LN2A 1S3JA 2Z16A 3TSZA 2Z3YA 3HSBA 1BOAA 5H2FC 3DPLC 4BE2A 4F7UF 3CXCP 1ETOA 1VQ9T 2JMCA 2M34A 3L2VA 2M4KA 1YJWA 5DCMA 2B63J 1U0JA 2M0CA 1XC5A 2G9WA 1ZRCA 1OZ3A 2XK0A 1PKSA 3A8GB 2X0LA 2DPUA 2R7XA 2G7UA 2DK3A 1TQPA 2Y31A 1UJ0A 1YJ9Q 3LGFA 1R5ID 1O4XA 2EA4A 2QEXI 2R7OA 3AFHA 3E6CC 3KPHA 3ROUA 1HYOA 2QDLA 3M4YA 1JJ2S 4M77G 2Y30A 2DX1A 3URGA 2KR3A 2A69F 4LB5A 1QVFS 3OOPA 3VS7A 3I9V2 2I2LA 3CPWS 3PO2J 2JA5J 1O75A 2EQMA 3WGHA 3JW4A 2ZFWA 4FASD 1WJEA 2EV5A 5E3NA 3CBPA 3CEYA 1TWAJ 2DK5A 4RCBA 1MW7A 2O7OA 4HOBA 5JLXA 2KPMA 5LGTA 2ELJA 3OWTA 2OCEA 1ZLMA 4BY6B 3JB9J 1WH7A 4IHWA 3BQZA 3PNTA 1YOVB 2P4RA 4AG1C 3I56I 1YIOA 1IXRC 1WH5A 4LK1F 3C2HA 3RESA 4D7NA 2R7QA 5J39A 5DLOA 4ZGDB 4BQNA 4RAYA 4C3JJ 2RA2A 3U9GA 4F7ZA 2M7AA 1KQ9A 4MZPA 4FT2A 3IV5A 2L9VA 4NL3A 5CPRB 4M7DF 4P55A 1A5JA 4FYVB 3C1DA 3CMMA 5I22A 3A8MB 1M8VA 1RUWA 1B72B 3G4SQ 4RLQA 5DYMA 5I11A 1X3UA 4CZZA 3H5NA 1NJIU 4A4KA 2FHDA 4F7UB 2JM8A 3CBMA 1UGVA 2V8KA 2L0KA 3A1YA 4M75C 4XOPA 5H20A 4V2SA 3IKTA 4KDPA 1ETKA 2F5KA 4C8QC 2OA4A 3W6VA 1E3PA 2EJ9A 3JB9G 1TQMA 1UB4A 2ZJ2A 2VJ4A 2V9VA 4NC8A 4X9CA 3LSIA 3GTQJ 2IS1A 3JCMX 3QU6A 3I0TA 4KITB 3DCFA 1YJ9A 1RETA 5CAIA 2OQRA 4ZZDA 4HLYA 3NWTA 2KIMA 2RD1A 2LF8A 2ZJQF 1ZREA 4F7UE 3ZQQA 1QCOA 4XU1A 1YJNA 1OKRA 3BP8A 4EMSA 2DQLA 4AYBN 2LDUA 2QCOA 4DYCA 4C0FA 1ZX6A 2F5TX 2V26A 4PGGA 1BW5A 1SG5A 1P4WA 1Y1WJ 1WJCA 4OMZA 4XMYA 4B8XA 5BPIA 2DPDA 4Y91A 5IOZA 5IP6A 4M77F 1K0SA 1KSWA 1LCKA 2O9SA 4E47A 5LJ3g 1P9QC 1OCOH 2NUZA 4IJAA 1QLYA 1EFNA 3P9CA 1YP5A 4EV0A 2F2WA 3KE2A 3L9FA 4CXFA 2E4HA 2Y4YA 2XAJA 1QA6A 4YTLA 3L7WA 4C3IJ 2YRVA 1I5ZA 2E60A 2KT0A 1ZQ3P 2ZPHB 3G6EQ 1ZELA 2V6CA 4J9GA 3E5QA 1WYXA 2K85A 2DMQA 1FNNA 2DCEA 3SFMA 1SSFA 5ECAA 3LSPA 2FQ4A 3I4PA 2JXBA 3OYFA 3CCSI 2HOSA 3QWYA 1Y0NA 1Y71A 1RR7A 2AQFA 3GTMJ 2N8GA 1J75A 4KH0B 3G4SA 1GHCA 1MDMB 3HOZJ 2COYA 4FTHA 4FSSA 3ASKA 3KCCA 1YJWI 3CCQQ 1R22A 4L5EA 3TP3A 4V19K 2CP0A 4PJOA 4IEJA 1A04A 1X01A 3M53A 4L59A 2XIGA 3CC2Q 2OU2A 2IS2A 2CMPA 1KYZA 2YU3A 2NVXJ 1OJLA 2GQVA 2HSPA 4L0ZB 2QLZA 1B8IB 2XPVA 2LBFB 1XPXA 1TH7A 4M7DE 3CC4I 2Q8KA 2O2OA 4Y52J 3WTUC 2VJJA 1ETVA 4EGZA 2LMDA 4RBOA 1OCTC 2DFUA 3GZNB 2IXSA 3CBOA 5AIQA 2MAMA 5CK9A 2EPFA 3JB9F 5GMKh 3FC3A 2L9SA 5BOXA 1JJ8C 1JHFA 4QPOA 5F1JA 3IC7A 2BIVA 3CCJT 2R7FA 2AKLA 1JKRC 3SEZA 1IO6A 4E7SA 4EDUA 3KX2A 3GTLJ 4Y17A 2W24A 4AYBA 3QQAA 1G83A 4M78C 1V1CA 3PJRA 1OMIA 4J8OA 3R0JA 3M9AA 2EV0A 4KICA 1PSEA 5FKMA 4M77B 3VUZA 4RLFA 1X2KA 1FMVA 4G6DA 1T56A 4A3EJ 3BY7A 4J5YA 2NLUA 3L2WA 4CYCA 1Z9QA 4C0GA 4BD3A 5IP7J 5DM7R 1N5ZA 1EA3A 3QAHA 3JRHA 1UGRB 3D7SB 3SEMA 4TV7A 4QPQA 2NXNB 5C0MA 3TQ7P 5J6XA 3KEYA 4KA4A 2W57A 1QPMA 1V55H 4BJ5C 2E19A 5K1YA 4RG8A 3A0BC 3F6OA 3W2WA 1QW1A 3G6EA 3WODF 3H1CA 2M9UA 1WQWA 5EGOA 2G7HA 4M7AG 4UV8A 4ORZA 1N8RR 3HOWJ 3UATA 2M87A 2CZ7B 3VSKA 2F5DA 2WAFA 4XLEA 2QTXA 4B3AA 1XN7A 1OOTA 2KFDA 4G6QA 4MQ9F 4CI0C 2DD5A 3CUQA 3OS0A 1PM3A 2CYZB 5EF6A 3WXMB 1D3BB 2OJ2A 3CCUQ 3G71Q 2R0QC 1QVUA 1N78A 3CC2A 2L3DA 1HKQA 4N4IA 1I1GA 1TNSA 1SEMA 4XU3A 3HFNA 1T38A 4HCZA 3BC8A 4A3JJ 1C0WA 4M77E 1AVZC 1YJ9I 4ANJA 3K4KA 2XMFA 1YITT 1SFKA 1TW2A 1YS7A 1UHSA 2VN2A 1N8RC 2MYSA 1J7KA 2DL5A 1L3LA 3TEDA 2CV2A 5AIPA 5CIUA 4LG0A 2UV1A 4RGSA 1K9MC 2EQKA 2XAFA 3HXLA 1RL2A 1BCOA 5FLXE 1A6IA 1K73U 3LQQA 3O5ZA 3KLNA 5ED4A 3P8HA 5HNHA 1PD0A 3QZ5B 1H8KA 2QYZA 1Z21A 2Y48A 3GLXA 2YUPA 5ILSA 1YQAA 3IH4A 3TDUC 1IUYA 3HFOA 4BQQA 3BE3A 1KA8A 2IAIA 2DJZA 3BDLA 1SD4A 2DOEA 2RNGA 4XM3A 1F4KA 5LD2C 4II1A 1SAUA 1VQNQ 3OYEA 3PSFA 2JTMA 2VC1A 2LSOA 1OI1A 4BYYA 2BE5F 2HOTA 2MLKA 1ZUYA 3MAJA 4BY7J 2L7FP 1A35A 1SPKA 4GLMA 4MMLA 3WGGA 5GAMf 4RGXA 3LH0A 3LGLA 5KH6A 2CZ0B 3TREA 2FU4A 3P8BB 4LDXA 5GP9A 3G4SI 2ELHA 2RKHA 1JJ2P 4A5NA 1MJ9A 2HFHA 2PMZA 3KZIC 1ORKA 2IBDA 2L3QA 4E2FB 4M75D 2PJRB 3PQJA 3ELKA 4RB2C 3PM1A 1QVFP 4M7AF 3CPWP 4C8QD 2L5QA 2DOAA 1NG6A 5KCMA 4H0EA 3SXYA 2DA3A 1P4XA 2ACJA 4KT5C 3TDZC 2JUFA 3CCUA 2V1XA 1IF1A 4PNOA 3VS0A 2QKLB 3JRCA 4FE7A 5EEAA 1ZHIA 1H9GA 3BW1A 4CC4B 1VQKQ 2H3JA 1N25A 2EK5A 4WWCA 1ZG5A 3CO6C 1XS9A 1NK3P 2R7WA 2HXOA 2JMWA 2LH9A 4I7HA 5GJWB 4BXUA 1FLIA 5DDGA 4C92B 1KD1C 3GZ6A 3OYLA 4BKXA 1VQ6Q 2IGOA 2KIQA 1HDPA 4V2GA 1GFCA 2K3YA 3FDRA 4L9JA 1BI1A 3K6GA 1X75C 2QG9B 4XAXB 1N9SA 4EGYA 2FA5A 2XPUA 4AFSC 5D6EA 4B44A 1SD7A 3QPSA 3AG1H 5BS6A 2DL8A 1JKQC 1WJQA 2CUZA 2HTSA 1RLQC 5EZHA 2JK3A 3BTCA 4OIRF 5LHGA 2M0OA 1X19A 2FZGB 4D5FA 2LTPA 1RI7A 2O03A 3LAPA 2EH3A 5DCMB 3S8PA 1G2BA 1J2XA 4QVCA 3DKXA 2RK1A 1EH8A 3BY6A 3QU3A 2HR3A 4WXCA 3G6EI 4KN4X 5J47A 3K1MA 4F92B 1K4TA 1WI7A 2GIVA 1Q81R 1OZ2A 4JUVA 4JRKA 2QQRA 3PIOA 2E6ZA 4BY1J 2XU8A 5IHNA 1GBRA 1K8AR 4CC3A 3HOYJ 4WTOB 3CUOA 4CCKA 4S04A 4UVCA 1E3OC 1SKUB 3REBB 3TQNA 4P9UA 2WV1A 4PJOC 4C2TA 2DTIA 2E5NA 1MBHA 3OYGA 4C3HJ 3CCQI 2XHCA 2VPLA 2LF7A 1U9OA 3CC2I 1HJDA 1D1AA 2RQQA 2L4AA 1R5GA 1FYLA 2HYGD 2MC3A 2JA6J 2IA1A 3BCBA 1UG0A 2CP5A 2OI3A 2EKHA 1SVOA 3L2CA 1X43A 1NK2P 3FEOA 2DYRH 2KLOA 2WAEA 2ETHA 3Q9SA 1O7LA 5TGTA 1BBZA 3UA6A 4FT4A 2OJED 3BPVA 1W70A 1WX6A 3WU2C 3QODA 3T0YA 4DBQA 4W1UA 1REPC 4LDWA 4PLIA 1K8AC 2RQPA 4LGWA 3CC7Q 3LNQA 3HL2A 2R7RA 1S72A 1TTYA 1W5CC 2NAZA 3HRUA 4BL0B 3ZEHA 1NH3A 4BBRJ 1ZRDA 1VQ6A 4M7AE 1X27A 4ENJA 4JYKA 3LX7A 2C0IA 2XF7A 5FU7C 2ZZDA 3BWGA 3HRMA 1WJDA 3KBGA 2MGQA 1D0YA 3GF5A 3FJ5A 2ZJPF 4AC0A 1OQYA 3Q0WA 2LVSA 2ZPFB 1OYXA 2CZ6B 3L1AA 1XGOA 1U06A 2KT8A 3QJ6A 3M57A 1D0ZA 4LDVA 1YI2T 5C6SA 4A5MA 3P5JA 1HF0A 3O8GA 1NLOC 2VWFA 3CD6Q 3A01B 1PD1A 2DEUA 3HEFA 5EG0A 1VTNC 4G12A 4PSWA 1TUGB 2XIDA 2P81A 3CJQB 2R92J 2WB1N 1NJIC 4R55A 2JW4A 3QPHA 4R1HA 4Z6YA 2VQGA 2HEQA 2J05A 2FYKA 5C4JJ 3IP4B 4JZ4A 5J3BA 3EUHA 4CGZA 2YHTA 3VS6A 1Y56A 4OIQF 3GTPJ 4DYRA 1YHQT 2BE7D 4M71A 2KZGA 1WNLA 2E5ZA 4F52A 4A53A 1IRFA 3HL8A 3CUQC 5D4SA 2EIJH 4IHXA 1IGQA 2C06A 1X1AA 2CP6A 1WHLA 2W7NA 2EAYA 4U88A 4D6WA 4U7BA 1S7OA 2DFEA 3KZYA 2RF0A 3BR6A 2RVCA 2VJIA 3G71I 3CCUI 5F0CA 2B9SA 1RESA 3S1MJ 1ZBJA 2DXCA 2HDAA 2P84A 2MK5A 3UF4A 4AVZA 2R7SA 4FE4A 3SEQA 2IVMA 4BHPA 4ENMA 1CF7A 5LBQA 4FW1A 3JCMf 1K1ZA 5FWBA 2W82A 5CQEA 2R5ZB 3KUFA 4KYWA 2VC0A 2KK4A 2DA6A 4WXHA 1PVEA 4RB1A 2M02A 4OF1A 1Z9ZA 3N05A 1ZUUA 2KQWA 1JRIA 3K69A 2OV7A 4KGXB 4AG2C 4B9XA 1XMXA 1ZTRA 3BG7A 1UG1A 5F0HA 3H6ZA 3GLLA 5FB2A 2X98A 3OBWA 4DEYA 2E1OA 2C0TA 4JZ3A 1R49A 3QO3A 5D6FA 2FMYA 1OYYA 4M9XA 3RSNA 3JSPA 2XI9A 4JX5A 2NNYA 2V1UA 5CVVA 2UWMA 4IIMA 2E1MC 3L2QA 4X0GA 1QGPA 1LNXA 1YJNT 2CQNA 4HLXA 2K3FA 1YLFA 2BYVE 2HGCA 2ADUA 1ENHA 2JJ7A 4I09A 2XGEA 4II3A 3MMYB 3O3KA 5EJCA 1VQNI 1EV7A 5D8KB 3JR9A 4LDUA 1WJ5A 1BI2A 2DA1A 1M3BA 1T0JA 1IJWC 1R9TJ 2L2OA 1KQ1A 4B48A 4I2OA 3OW2P 3CD6A 3L2ZA 1WWXA 4IUVA 5M5WJ 1EX4A 2HEOA 4FX0A 2H27A 5DTDA 2Y9ZA 4Z2YA 2DTOA 1WJFA 1H0MA 3PFSA 2R7ZJ 1WA7A 4E7LA 2DOFA 2BY0A 2X1DA 1MSFC 2LNVA 5CKBA 1VQOI 2LNBA 1SFOJ 3CQTA 2HQNA 3DBRB 3BJOA 3QDFA 2R5YA 4BB7A 3V42A 2M9HA 1W4MA 2QWWA 3OOUA 3KP3A 1YWOA 4GBQA 3EHQA 4JRPA 2DT7B 4HNUA 1RKWA 4XTZA 3EHRA 2DMPA 4OAZA 1F43A 1I39A 4RM2A 5DLQE 3BDUA 4FL6A 4A93J 3G4ST 4ZJZA 2K9NA 1ZARA 5HK3A 4HT8A 1WJAA 2FO0A 1ZBXA 1LDJA 5GAMe 4IHTA 4CHUA 4ESBA 5FRMA 2DRMA 4XNFA 2OTJT 4LLNA 3I71A 1R71A 1VQKI 3MKLA 5E3OA 4B6MA 4YIIA 4ZYHA 1QHGA 3VB2A 2ZKZA 3SB2A 1ZQ1A 2GAUA 1AEYA 2RDPA 4RB3C 1V5EA 1Z1DA 1VQ6I 4O5VA 4E7KA 2HD0A 1ZK8A 3V8JA 4ZDPA 3R60A 2V8JA 4ZGJB 1RAFB 5KE2A 1GXPA 4XLNF 3BG6A 3ZXSA 3EG3A 3VYSB 3IL2A 1O7FA 5ILUA 4P1WA 5J8FA 4JJDA 4KGZB 1XDSA 2Z5UA 4UUVA 5KYUB 3H9JA 1UFMA 2RC4A 4X1VA 4RA2A 1XJWB 2A6EF 2ZGWA 4AIHA 4LD9K 2MG4A 5DD4A 4PCQA 4MZMA 1SD6A 1SVMA 2ZPBB 2W10A 2JA8J 2IP2A 2X85A 1Y0UA 2JUCA 2JJ9A 3WTZA 2K5CA 4G7ZF 1TWFJ 4XL9A 5KAFC 4B09A 3RMSA 2KI7A 5ICFA 5GAMd 4E6RA 2F5CA 4DW6A 2H6BA 4FW2A 2L3RA 2KAFA 5GANf 4M75A 2R3SA 2HZDA 3MKWB 2RJCA 2XAUA 1UELB 3H35A 4MQVA 1Z67A 1LFUP 4LG0B 2IS4A 3JCMV 1K83J 2VPRA 4HDVA 1TWBA 2LP5A 2NYSA 4C8QA 2QSFX 1UJYA 2DZCA 2X3XD 3PFYA 2VKNA 4LB6B 5LFAA 3BT9A 2MH9A 1XCVA 3EG1A 4X9DA 5CVRA 4A0YA 4BE1A 4ZYGA 1DUXC 3F3XA 3OR1C 5LRSA 1N9RA 4XU2A 2JT4A 5FU6B 2NS0A 3BG3A 2HMAA 2XDBA 1C6VX 3OYDA 3NHNA 1NE8A 5BPDA 2DDBA 1JKPC 4ZGEB 2HYJA 1F36A 1X4OA 2PG4A 3VUBA 2QKMB 2LJ1A 3UPUA 4FYYB 3S2WA 1FP2A 1T0HA 5D6WA 1N8RU 2DN0A 3DLLA 3BFMA 2YT6A 1FOWA 3RKQA 2LRQA 2IGNA 2IJLA 2XG8D 2EYWA 4CDGA 3MHXA 1XMKA 1IV6A 2DILA 4IUPA 2IGMA 3AG3H 3CC7I 5GAOl 1KC8R 2X4WA 1FTZA 1K9MU 1OX9A 2W85A 2FJ1A 4Q48A 2M1HA 2EYQA 1AHJB 3WG7H 1BK2A 5GAOm 3BJAA 2MABA 4AM3A 3FXQA 1ZG3A 3CCRT 2M5WA 3M0SA 3H5AA 5GAN8 5LJ5f 2OUMA 1M5Q1 4BH9A 1H8AC 1G59A 5I2MA 3V7CA 4UB6C 1R0CB 2YRDA 3LH5A 5D5UB 4LDYA 2BV6A 4CH7A 1QPIA 2A08A 3I64A 5KE3A 2KRFA 4BS9A 3X2QH 3RZDJ 1RQ6A 1PJRA 5FGMA 2CSQA 3M56A 2L02A 5CKDA 3W2VA 2WA0A 2NVQJ 3GOXA 2ZC2A 1ERDA 3QWLA 2KRMA 4D8DA 2WAQN 3ZQGA 1GUUA 3KYDB 4N4NB 4XN0A 3LSRA 3MEAA 1KC8C 3CD6I 1WJBA 5CCAA 3UNGC 3C94A 2FOKA 3K7AJ 1RUNA 3W6JB 2Q0OA 1Q82R 4KNYA 2VYTA 2CS3A 1UUEA 3CJRB 4F17A 4YRVA 2NS7A 3NGPA 3EUHC 2EIFA 4L18B 2WADA 2LDMA 4QSHA 1WLPB 1Z3XA 5FKOA 4CYDA 2IW5A 4XN3A 2ROLA 3M0UA 4ZYAA 2CFOA 1MIJA 3QHSA 5IXFA 4EATA 2CSOA 2ZXIA 2F6CA 2KHMA 1Z3YA 1EZZB 3G73A 1R1TA 2YS9A 2BGCA 1K78A 4EIKA 4A3MJ 1LJOA 1GFDA 3JAMK 3HKZA 1OR7C 2O61A 2WTEA 3VS3A 2QVOA 2XASA 3ABTA 4LK0F 1N6AA 2XC7A 1X3WB 3OSSC 1X3ZB 5DY9A 4C30A 2HL3A 1KIKA 1QO0D 5HOOA 2VBZA 3HOXJ 4JPBW 1MH4A 1P92A 2COMA 4RGRA 4WXDA 4BXFA 5CKTA 2M3AA 1BJZA 2DW4A 4D1QA 3K4CA 4WCGA 1HKTA 3EFSA 5C3EJ 4JOMA 2Y9YA 2EB7A 3T8TA 1VYUA 2RO0A 2Z1DA 3GTJJ 4WF2A 2D8HA 2M0YA 2RREA 3J81K 4RTUA 1XGNA 3DPTA 2UXNA 3H9NA 1WSUA 4X34A 2JA7J 4GDFA 3M8FA 1XSVA 2LX9A 3EPZA 5CQYA 2J6KA 1IN6A 3VYRB 2D5VA 1J59A 2JZYA 2CO5A 1N77A 3PIPA 2O9LA 2GXAA 4LUDA 1RRJA 1HW2A 1AWOA 3ASOH 2LY1A 1RAGB 1O3TA 3T8RA 3JCMe 3CMET 4G7HF 3OYNA 1GDTA 1PRLC 2LMJA 4YIRX 3LOCA 3MZ8A 3BR5A 2CQKA 4HSRA 5IOYA 5DS9A 2JQ7A 2R7DA 1STZA 4OMYA 4N9IA 1Y57A 1BYMA 1ODDA 4FHTA 4JLIA 2EFWA 2AKKA 4QWQA 1XOVA 2MF2A 2RHXA 4R8HA 2DRKA 4QIWN 3D1NI 4RUGA 1I1SA 1WRJA 4OGCA 3K1NA 1DU0A 5LL6S 3MQ0A 2DA7A 4CZCA 3S15J 2V9KA 5JHFA 1UHFA 2RQWA 3OMGA 3DBHB 3C95A 2XKOA 3LWFA 3DB4A 4DGWB 3VODA 2MH2A 2ZBKA 1XD7A 4KUMA 2FD5A 2HTJA 3KIOA 4I99C 3AAFA 3ESWB 4RTYA 4XBFA 2E34A 3N97A 2OTLT 1M3CA 5GAN7 3CC4A 1QCNA 2ZMEA 2VGNA 2QBYA 3MPUB 1MV3A 5DEQA 1E3HA 4EQQA 2X4XA 3BOQA 5HLTA 3HGGA 4KMFA 3JCMd 1U8RA 1X1PA 1K6YA 2K9MA 4HX4A 1H88C 4HSTA 4HYEA 3HRSA 3W2AA 4L0YB 2EGEA 3MEUA 3OYYA 1GBQA 1K8AU 1FTTA 2CP7A 4MZTA 1VOMA 2PTKA 2R57A 1S6LA 1W0TA 4DOWA 1ZRFA 2KRHA 1WFXA 2DT5A 1BOBA 2HCKA 5EG0B 2ZJRF 3TOBA 2FEZA 3I59B 4A6EA 2DJQA 2KSSA 2M16A 4OMLA 5K5QA 1M1KR 3CCMT 2HKOA 3FF5A 5HDNA 2LT1A 2RHUA 3CO7C 1VQLQ 3PNYA 3LSKA 3A52A 3ZMDA 1M1GA 1U78A 1S72T 2A6HF 5GAN2 3CLOA 2CUFA 1MSEC 1QKXA 3IWZA 4KH1B 2O88A 2CUJA 2O0YA 3OBYA 1DU6A 3ABKH 3GNFB 1KONA 2V7FA 4AFZC 2KYBA 1I5LA 1DGRM 2E2IJ 1WIEA 4OU0A 3S3NA 2DL4A 4BQAA 4DEXA 1EH6A 1H9TA 1B07A 2K9QA 1FY7A 1KU7A 5FLXZ 2CW7A 1CF7B 3KP7A 1SANA 2GGRA 1B9NA 3C2GA 2A61A 2K86A 4S0HB 2JOYA 1XX5A 1QWFA 3JCMQ 1G3YA 3EGDB 2YPRA 5GADJ 1S9HA 3MWMA 1NEBA 2WC2A 2CH4W 1IREB 2P7VB 4Y3OA 4E7ZA 2XAHA 3EG2A 3T1BA 3CMAQ 3D5SC 4YELA 3I35A 5FFZA 1QKWA 3GX4X 3DLMA 3G1LA 2FVUA 1CGPA 4XTVA 2XAGA 3CESA 2DO3A 4W97A 4AU7A 3ECHA 1Y8QB 2NVUB 5HK0A 3I55Q 3QYFA 5GMKi 2E3IA 1SFXA 2D1VA 2VASA 2VBYA 3DKWA 4NC6A 1J5YA 1KGSA 1YS6A 2OZUA 5CJ9A 3U1KA 4F93B 4ZYDA 2YR2A 3O6BB 4IPAA 1JHHA 5IN1A 2CFXA 2LKPA 3DEWA 3HYIA 2RJDA 3TEEA 2DMUA 3VKIA 1X4PA 3JRIA 5GAMh 1PWTA 5HDKA 1RUOA 1UECA 2JZ2A 2KE9A 1HXDA 3PFIA 1QQJA 3DLAA 5J26A 1OQKA 5DCFA 4ZN1A 3KP2A 1M2OA 2A37A 3HRTA 3DV8A 2JTEA 4RG2A 1AD5A 2J5OA 5FLXR 2PI0A 2DTHA 1E17A 5IT9E 1VQ8T 2BEOA 3LFUA 4QLCU 1BU1A 1OV3A 3VV0A 3TVTA 3OIOA 2FEIA 3Q9VA 3RDIA 2D1HA 3OA6A 2W84A 3IKVA 3M1CA 4PLLA 3AL0C 1BC7C 3DBLB 2JRTA 4GGGA 1VQLA 2EQJA 4MNUA 4MMKA 4FQGA 2SRCA 1ZYRF 1M1EB 2OCCH 4II2A 3OYIA 1MNDA 2BHYA 1Z91A 3P9KA 3SD4A 4KIGA 2DVEA 2LVMA 3S93A 2NWMA 4Q47A 4C5IA 1IZ6A 2BUDA 2VT2A 4L9VA 2X1CA 4CA0A 1WJRA 1E6HA 2CKKA 2L2PA 4M78G 2AT1B 2P6SA 2ID3A 2VT3A 4BUGA 3VPRA 2HPMA 1PUFB 4XIDA 2GQQA 5J1YA 2Q1ZB 4E7IA 3GEZA 4RAGA 3ULQB 1IC8A 2XDDA 2K3PA 3OW2S 3HSRA 4RAFA 5LJ5e 1O9SA 3EUAA 5ERIA 4AIDA 2UZKA 3SZPA 3LSTA 4UV9A 5GANd 2LP0A 4C92G 3FXUA 4C2MJ 2DZ9A 2KMTA 1T98A 2IT0A 5CVIA 5TISC 3RJPA 1EF4A 3HHTB 4OB2B 2DFFA 3ZR8X 3NAUA 1TUDA 4KN7X 4HVVA 3N4MA 1RLPC 2ZPIB 2W4SA 2DAOA 5ICCA 1RIOH 1I3QJ 3DKYA 1S7AA 4GRIA 4ZN3A 3FIWA 4XORA 4BEHA 3I55A 2FBHA 1RI0A 1VQ5Q 1JO8A 5EZGA 2K5IA 4XLCA 3QYEA 4DA4A 1T6SA 3EYYA 3OYMA 3MFKA 4BJ6C 4J6WA 1RC9A 2KDOA 5KK1A 3VRZA 1X2MA 1B4AA 3ZN1A 3QIIA 3NRVA 2KRNA 5GTHC 1VQPT 1MMNA 5LRRA 3WTVC 3H0DA 2ID6A 2W00A 1PHTA 2QYOA 4I01A 4PJMA 4GFBA 3RMQA 2JTVA 2L01A 3M3YJ 1LVAA 2OAZA 2LQ8A 5E8GA 3QJYA 1PC0A 1U8BA 4VUBA 4C0DC 2P5LC 5F04A 2GFUA 1K9AA 5LJ5d 3FXRA 4M75B 3CCEQ 5FLXK 2ZNZA 5GAOq 4QTRA 4C8QB 1QVGP 3R0AA 4EM0B 2RJFA 1HA8A 2VVKA 3ME9A 1XGMA 2DNUA 1YNZA 4TVRA 2FRYA 3NPFA 2HU9A 2GOMA 3HB9A 3RCOA 3ZMSA 5JI6A 3I4MJ 2COZA 4LLLA 1BI0A 5KYWB 3X26B 4XK8E 3BZCA 3M8EA 4M3GA 1MBGA 3EQLF 2KJBA 1R36A 4D7MA 2H8WA 3I53A 4Y15A 2OX7A 1FPQA 2LCSA 1PUEE 2H8HA 1IRXA 5LHIA 3TL4X 2QK0A 3VRYA 4XRFA 1NG7A 3OYJA 1RACB 4HBLA 2JWTA 3CCLQ 1E2XA 4PL6A 3JCMW 5KYYA 3OY9A 3FX3A 3PUFA 3ZRGA 2RH2A 1IAWA 3FXMA 1WHUA 1PP7U 2DA9A 2XKOC 2ESHA 3NEUA 2BZTA 3LYIA 2JVVA 4M78F 1P4AA 1HSJA 4XLPF 1ACMB 3KP5A 2L8DA 3ULRB 1U9NA 2LKXA 1YFNA 1D3YA 3I58A 2CWEA 2IPQX 3P7NA 5FJ8J 1Y96A 4LD5A 3FKJA 3EGUA 4DZJA 4C0ZA 5L3GA 2MCNA 4HF0A 2GBQA 2COWA 1V4RA 2O9VA 2ZMEC 3AG2H 3MO8A 1WHKA 3V7SA 2E5QA 2K9LA 2HQHA 4C92F 2CJJA 1G8XA 3E6MA 5BQTA 4GXOA 1XMAA 1ETYA 1FSEA 3SZGA 1Y39A 2QSHX 5GAEJ 1ON2A 1AOJA 4YFKF 2RHZA 1FBUA 3GFMA 2DK8A 4MEYF 4KRTA 3F9KA 2ENMA 4QQ6A 1SFUA 3N5BB 4HW0A 2O31A 1OCZH 4ELZC 3HZJA 2AHQA 2VI6A 1D1BA 2XF5A 3LA7A 2XGCA 5EEHA 5F08A 5K7ZA 2IRFG 1TU0B 1YTYA 1W4SA 1M2VA 3P9IA 1YE9A 1VIFA 2GNCA 1M30A 2QEXT 5HS7A 3MKYB 1OCRH 1UCRA 3FXJA 5LGUA 2KKOA 3L2RA 1O3QA 1MMDA 1O3SA 3C12A 2PVOB 4HVUA 2HDDA 2GXBA 4M7DD 2ZCWA 5K5OA 2FF4A 4HV5A 2QGGA 1Q1HA 2EINH 4KIFA 1OLTA 1VQLI 3J7AO 2KT1A 3SDZA 2E65A 1IXCA 2NUTA 3JCMh 1VI0A 2UXXA 5AYFA 3RDVA 3CCEA 2DKGA 1MJAA 1YIJQ 1X2NA 4ZDOA 4A12A 1K78B 1UAAA 2DYIA 3GP8A 2AHJB 1ZH5A 1UHMA 3FIFA 2PMUA 4HCKA 3I56T 2GIZA 2F2VA 4J9CA 4M7AC 1KC8U 2FNPA 4AIKA 2QA4Q 2X51A 1TG0A 1UHCA 2H09A 2VJ5A 1F9NA 1NM7A 3MEVA 3PGGA 3Q1JA 4A4EA 1VQOQ 3FM3A 3VDXA 5GANj 4UHTA 1E7OA 2CRGA 1R0BG 2KBTA 1VQ9Q 4HG2A 2H1LA 4Y7NJ 4EJVA 4AIJA 5CKHA 1TSFA 1AZEA 2EYYA 2RMOA 2DLLA 3CCLA 4M9ZA 1Q7YR 5IYBJ 3OYKA 4LNPA 1BBYA 2ZXJA 1H3HA 2HKXA 2XVCA 3G2BA 4GYGA 4Y4RA 1Y1VJ 4M78B 4EMKB 3CMAI 3CJTB 2P6TA 2HQXA 4UC4A 2M8EA 4J83A 1MBEA 1M8MA 3G71A 3J7AF 2BW3B 2P0WA 1JKOC 3IWFA 3M8JA 3GFLA 4XLFA 2R7UA 2X6YA 3M4GA 2RHIA 3BROA 3I55I 3LFKA 2P4TA 3HOUJ 3H8ZA 3QPLA 2H3EB 1X6OA 6AT1B 2K3BA 2PJPA 2JSCA 5M3MJ 1AHDP 4NQWA 4PJLA 3H0GJ 2DL3A 1LNWA 4HNTA 5LJ3f 5L8RE 2J6FA 2HQEA 3MVPA 4RMNA 3DXJF 4KJZA 2BHZA 1MJBA 1B6AA 2IEKA 4PJOG 4A4FA 4M78E 2AS5F 1IHWA 2K6DA 4PFOA 5ILVA 2YDLA 5KYXB 5JVGF 2DA2A 2ECBA 3U2RA 4HDUA 1CKAA 5A0LA 2E7WA 3F6VA 3ASNH 1LUJB 1K6OA 1IN7A 2LTOA 3ZBDA 5LJ5j 1KQSA 3K2ZA 1YG2A 3B6AA 4A0XA 5M5XJ 1W7PD 2XUBA 1FMWA 4E4HA 1NYGA 4C92E 4BHCA 1PSFA 2X35A 2LG4A 1VZ0A 1PP8F 2WWYA 3QOEA 2DTRA 2RHYA 2DL7A 1VQNA 1GV2A 4ESRA 2DF6A 3O8HA 1GCQA 2BVLA 2EW3A 3BG5A 1SC7A 3FK7A 2KXDA 3LA3A 1LFBA 3AG4H 4A69C 5CVUA 4MFEA 3RI4A 3A5ZB 3M0QA 4OGEA 1YIJA 1KYWA 1OEBA 2EZHA 4BACA 1JXSA 4M6YA 1K7AA 1ZLJA 2D0NA 5FKNA 1VQOA 4BBSJ 2H1KA 1WQ2A 5L3DA 2XB5A 2BXYA 1B9MA 2GQIA 1VQ9A 1IB8A 2RQTA 2E2JJ 2SEMA 4DBHA 3CF2A 1H3ZA 3K10A 4BE0A 3L42A 1V3FA 3CCST 1V5FA 5FLMJ 4L9NA 1B34A 2FXAA 2IA0A 1Q81C 3OYHA 1GLNA 1R00A 3SWNA 1M90R 4FETA 4PSXA 5HS8A 4XRMA 3G1JA 1WXBA 1QVGA 1YWPA 1R6RA 1YJWT 4A6DA 1D0XA 4HF1A 1VQKA 2AQEA 4J6XA 3F72A 4A2UA 2R58A 1I81A 1VQ5I 4IVNA 2F2XA 3FZVA 3GVAA 1JT0A 2CW0F 4B4CA 1SEUA 3FMRA 1ZSZC 4KT0E 4A3LJ 1MHNA 5GANh 2V1QA 1RI9A 3CC4T 2ED0A 2QQAA 3JRGA 3M5AA 2NS8A 8AT1B 1Z6TA 3QYBA 1BL0A 1PRMC 1XG1A 1IGUA 4XQ3A 3GF2A 4M9SA 1LDKB 4X1EA 3IRRA 2ZO4A 3DQVC 4JS4A 3PL8A 5DD8A 2HNIA 3ABUA 3FMQA 4O6JA 1X69A 2HS5A 2DXBA 2B0LA 3NFCA 4UUSA 4PJOF 3Q0UA 1JBMA 1VF9A 1WKMA 4U0YA 3SJMA 2O4XA 2HNHA 2DXIA 1MBKA 2ZXWH 5J40A 1UG2A 2GBYA 3CCEI 3QKJA 1KG1A 5IPAA 3G3ZA 4HXJA 3CC2T 2XV4S 1JGGA 2D0QB 4JRQA 3DEEA 1S7EA 1Y8RB 2K7AA 5KNLA 2R7TA 2MC4A 3K70C 2DAQA 1K76A 2DYBA 4CYCB 2P5KA 5GAOn 1SFEA 3JRDA 2EBPA 1M1KU 4J6YA 4C5HA 2DODA 1VIEA 3AT1B 1I5OB 1LQ1A 1TC3C 3PT9A 4MHGA 1TBXA 5LJ5h 3CCLI 4MGRA 3ERED 3I3LA 4L9TA 4EJUA 5B5EC 1WZOA 2WSCE 3BTJA 4LITA 1C1AA 2CW8A 1X6BA 2JSPA 2CQQA 2KP6A 2VE9A 1MNMC 4N0AC 1QMCA 4MIMA 1OR7A 3TW7A 5BMZA 3QWXX 2YUOA 1SF9A 2DU9A 3D5LA 4ZYEA 4A3GJ 2EVRA 2BBYA 3M59A 2TDXA 3QDRB 2EBIA 4CRIA 2LFBA 3V8KA 2R93J 4YEJA 1JB0E 2CU7A 1OULA 2A0FB 1XCBA 5E1WA 5JFRA 1WHMA 3EUKL 2MSYA 1LJ9A 4N9HA 4E7JA 3EETA 1F1ZA 5JHUA 3ZQHA 1J09A 1IRZA 3CCJQ 2DFHA 2YUQA 2JT1A 3CC7A 4LOCA 1D8KA 2ELKA 1U5TC 2XAQA 3F8NA 3FISA 5JVTA 3DFGA 2MPXC 4C92A 4ATOA 5H6RA 4OMOA 3VS5A 1YJ9T 1W0UA 2H8RA 2RQVA 2JS0A 3A0HC 3K4BA 1X1BA 2VQCA 2VBXA 3LAJA 1Q1VA 4A3DJ 4FYWB 2W48A 8ATCB 4CCJA 1PCXA 4DYQA 3UWNA 1MBJA 5HVQC 4PJOB 1K0XA 1NEGA 4XR6A 3RQIA 3LL7A 1QQIA 4IRIA 1UZCA 2CQXA 4IHVA 2CGHA 3D5RC 4JDSA 4ZNXA 3U23A 2YXYA 2BKDN 1QHHD 1MMAA 1YIJI 2J5PA 3S14J 1TWHJ 1LB2A 2JRMA 4M7AD 3A8OB 2ECZA 2F4OB 2WB1A 4K2EA 4BEHB 4IRGA 1YO5C 3RZOJ 1V29B 2QA4I 1RNLA 5L3EA 1BB9A 1UE9A 3ERMA 1VUBA 1M9SA 5IH2A 2JA2A 1EIFA 3META 1ZSGA 4QVDA 4PJOE 2DXTA 1KU3A 3LWIA 1VQ9I 4WK8F 1BR4A 3QBYA 4XTWA 1AWCA 1WHHA 2QQ9A 5GMKl 5I2SA 3E9FA 2BVMA 2X4HA 3X24B 3HIFA 4IOCF 4XU0A 5FU7B 4F55A 4NB5A 5GMKm 2HYFA 3DP7A 2D2WA 1T95A 3NQOA 3PVLA 3WE2A 5HLHA 2FL7A 4D9JA 2M0MA 1YITQ 2Z2SB 4ZTFA 2GA2A 1QP3A 2VXEA 4PFZA 3PUBA 1I8FA 2KEAA 2X9DA 2XGXA 2DMNA 3EH2A 3VSLA 3HM5A 2BXZA 5J1UA 2YX4A 1F1BB 2GXGA 4IX7A 4GYIA 3JTHA 4XRSA 5EGOB 2QUFA 3BCAA 3IUOA 3F22A 3FXLA 2H94A 3J80Z 4CCLA 4KIBA 2O8XA 1FBQA 3RYRA 2DBMA 4M7DA 2LC4A 1G6NA 1SHGA 1Q7YU 4GO1A 3BZKA 5IYDJ 4DZPA 3FM5A 3CUQB 5KYYB 1YYVA 4HZFA 1GXQA 4CSWA 3E7LA 2WSEE 4HAMA 4NOYA 3L1PA 1UGQB 5JLWA 2WV0A 4MDXA 1ETWA 1WI3A 3M07A 1ZAOA 1GCQC 2F4MB 1UDLA 3KYCB 1YX3A 4AMCA 1Y96B 2ZCFB 3OL3A 4B3XA 3GW2A 2WSFE 1B8IA 2STWA 2LBFA 1UGSB 3QP5A 4FISA 5D6YA 1JXMA 3J7ZI 4J9DA 2QQ8A 4IIOA 1FBSA 2UUZA 2DVJA 4XOTA 2JNGA 4UXNA 2EWNA 5FD5A 3JV3A 4QVZA 2Y90A 3G6ET 3VEPA 2OC6A 2QENA 1Y7XA 5GPCA 5L3CA 2IVWA 1SSHA 3PE0A 3PVQA 1NHAA 3TMOA 3J80R 1M2VB 2HVQA 3O8VA 4OMQA 2DTZA 3FB9A 4QW2A 4XKBA 4PUSA 4CC2A 3OMCA 3ABMH 2CH0A 3SWNC 2E1MB 2H6CA 3M4OJ 2QM3A 2EYXA 4HCBA 5ICEA 2MWPA 3JSOA 1U1TA 3ABLH 4F3QA 1KQSS 2F4IA 2RN8A 3CCQT 4CO8A 3RUXA 5E20A 1YITA 2P8TA 1W5TA 4HCCA 5KVRA 5M3FJ 2HXIA 2ED1A 2NUTB 1RADB 1B3QA 1U2WA 2R5AA 3REAB 2BOLA 5BNGA 3RNJA 1K73R 5LJ3d 3L2UA 1Y6IA 1AWWA 2B7EA 3BR2A 3PIOF 2PQWA 4RAZA 1MMSA 2D8JA 2AK5A 5HY6A 2A6TA 3SHWA 5E1ZB 2XICA 4M4ZA 1W7PA 3BQYA 3ZN0A 7AT1B 5A2QE 2Y69H 2HOAA 5IY5H 1QU3A 1U3EM 2VGMA 2LT4A 1TNTA 1OYWA 1FOYA 2RQRA 2LC2A 4PKCC 3OYAA 4ETSA 3C7JA 3K4LA 1KU2A 4UY8I 4OB1B 4Y92A 3VFZA 5HNFA 4EPCA 3T5XA 1HSTA 3RERA 3VJPA 5CKEA 4RTZA 1X58A 2ECCA 3GTKJ 1VFCA 1ZR2A 1FT9A 2RN7A 4RM3A 3ZMVA 1BR1A 1L0OC 1G4DA 1AKHA 2STTA 4G7OF 2IPOB 2V1NA 2PUKB 4IUTA 4U7DA 1FMKA 3TO9A 3K70D 2W0ZA 3LSMA 1ZR4A 5IT9Z 2JMAA 2CV0A 1Z0XA 1U1SA 4AWXB 2MWOA 2ZNYA 1QVGS 1V5GA 4Z89A 2V9PA 4DBRA 1IXDA 1HD3A 3DU6A 2E6NA 2LR8A 1W36C 2LLKA 2A68F 2V4JC 3SDBA 4NQWB 3R61A 2DMTA 2R7VA 1PNJA 1OPLA 1XQHA 4KUDK 2XDPA 1VNDA 1HQCA 1ETXA 1NZ9A 1A0NB 1B59A 2HZYA 2VB6A 1U5SA 1P7JA 1X1DA 2DFIA 3BLYA 1ZGJA 4OB0B 5M9OA 4BDZA 2VE8A 3NWSA 1WGXA 3LMMA 5K5RA 2EFPA 1Q82C 2L54A 2E1NA 1TW3A 2EKOA 4IHSA 4BY6C 1TZLA 5FRNA 1XSDA 1X2QA 5IHIA 3ONQA 3BR1A 3AKZA 1KFZA 2JS2A 1S5LC 2W25A 2DO7A 4CCMA 2WBMA 4E7HA 3I5UA 2K9GA 4M6VA 1J0RA 3R6SA 2OBPA 3CCUT 2K40A 3G71T 2EQUA 3PSIA 1YBYA 1FYNA 3Q3SA 4Q5SF 4QT7A 2PVGB 3CCJI 3M0RA 3JCMP 1T0FA 1JUPA 5IT9R 4Z88A 3CLQA 4MLOA 3REOA 1ITYA 2LQWA 3ZFJA 1BCMA 1K79A 4RTVA 5IHKA 4JS5A 2O3FA 2Q2EA 4HX7A 2VKVA 1M4ZA 3HSEA 1GXIE 3JCMb 2HZTA 3KZZA 2E70A 2RB6A 2WY7Q 4QQGA 1GRIA 2KJCA 3ISPA 3MZHA 2HQAA 4JX4A 2K79A 2QDYB 1YI2Q 2HDCA 5E17F 1IXSB 4A4HA 4AD9A 4EJOA 1HW5A 3SQNA 1A31A 4BI3A 2LY2A 3H3UA 2WAQA 2EJRA 4J00A 3NTHA 3GCMA 1NTCA 3LSGA 2DE0X 1OISA 1ZHFA 1JI8A 2LX7A 4LD6A 3OB9A 3TU4K 4B47A 3IAS2 4AVPA 1RAAB 1VQNT 1GVDA 2QSGX 1JQQA 3CCVQ 2L3PA 1YHQQ 1YN8A 4Z8AA 1VQLT 2HBWA 2P5VA 2KIUA 2P0TA 4YFNF 3COAC 1NLPC 4RS8A 2CH4A 3VYGA 5D8LB 3J80E 4RTTA 4P5NA 1SD5A 2FX0A 2MA3A 2DLPA 2E1CA 4M3DA 2KIFA 3Q5FA 5F0FA 1IO2A 1RKTA 3OL4A 1ZLKA 2V8IA 2Z9OA 3A1PA 5GPAA 4KT6A 3GO5A 4R79A 1I0CA 2Y75A 1Q81U 3CQZJ 2XHKA 1VQOT 4CCOA 4DOZA 4UUSB 5E8IA 3CTAA 4LIUA 3JAME 4Y13A 1YITI 2O4XB 4RGUA 5LJ3j 4M75G 3EYIA 1LVKA 1MD0A 4C8QG 3H0IA 1HK9A 2P0KA 2OZ6A 3FHNA 2F5VA 5KAIC 2X9HA 1VQ7Q 1VQ4Q 3WE3A 1T2KA 2HVSA 4JJNK 2RV8A 4HPQA 2KISA 2Z99A 2MZ4A 2X4YA 4M7DC 1XSXA 3X28B 1Q86R 3ZL7C 1VQKT 1I6HJ 4GLKA 1G3WA 4BUPA 2KRCA 3J81E 1M90U 3WGIA 3E0JB 5D7UA 5FKLA 1YJNQ 4C2UA 3M0PA 4FYXB 1UEBA 3BTLA 2CYYA 5IT9K 1IN5A 4ZC3A 2OAWA 1VQ6T 3F23A 3HPHA 2LK2A 3ECOA 4PFPA 3JRFA 2HL5C 2RK2A 4CUGA 1WZ2A 3WTTC 3OS2A 2CS7A 3GYHX 3KYLA 1YX5A 2A3SA 2NVTJ 3MP8A 4J9BA 1YI2A 4M7AA 2LYCA 1M1KC 2FSWA 2X48A 1JJ6C 1SVLA 4KFCA 5B1AH 2OF7A 3MEWA 4M3EA 1MV0B 1WHGA 1RABB 1Q86C 3ZPLA 3E2UA 2CREA 1JTYA 1S29A 1ZGAA 2RM4A 2YUNA 2BY2A 2FNAA 2HKQB 2LCCA 1FZPB 3CDLA 2K3XA 3WVEB 3JB9I 2DD4A 4B9WA 2HQRA 1Y07A 3CCVA 4BGDA 3VS1A 2G6FX 1R4NB 4ZDLA 1YHQA 3AHUA 1IN4A 2FQ3A 2CP2A 2RI3A 3QYHB 3WG9A 4OOIA 3I5RA 1WJSA 3TOAA 1LPLA 3T9NA 2HDWA 4C5GA 5GMKj 3ZMUA 3K9TA 5L23A 2AO9A 2XF6A 3CJNA 4M77C 2XRLA 3KP4A 1R23A 5B1BH 4DNCA 4M72A 2QQSA 2BY1A 2R5MA 1LEBA 4QQDA 5GAMg 1JXOA 3HOVJ 1H641 5CVJA 1ONVA 2X1EA 4F14A 5DUIA 3UDCA 2RI2A 1FIAA 4I6ZA 4MTEA 5GAHJ 1HKSA 4HRIA 5GANe 3H9GA 3ZMTA 3TCJA 2F5FA 1I1JA 4Z02A 4N4OB 1AU7A 4UB8C 3GWZA 5LLQA 2NRAC 3R6OA 3A01A 4R56A 3ZGKA 2EZLA 4JP0A 2DA5A 1P7IA 2VOOA 3C2BA 3ML6A 2O01E 3ER0A 5EC7A 3D0SA 1VQ4A 1VQ7A 4M75F 2HQ5A 3H92A 4N0BA 4OMFB 4OP0A 3NMZC 3OMYA 2MBFA 3CF5F 3OR2C 4C8QF 3G1MA 3K4NA 3CC7T 2ABLA 2R4GA 1TQIA 2R5YB 4I02A 2YLBA 2ISYA 2QF7A 3VS2A 5M5YJ 3HTSB 3HOSA 3LQRA 1E0EA 3X25B 1VYTA 2LD5A 1WPYA 3PNVA 5L3BA 5IYCJ 1RAHB 1SHFA 4RKUE 5LJ3h 3L00A 3X20B 4BI4A 3S1RJ 3V7RA 1RPWA 5H6QA 3S3OA 5F27A 3J7AW 3EFOA 2DDAA 2JN6A 4JJCA 4ME7A 1T33A 5KYUA 5J4VA 4XICA 2DT6A 2L4MA 3DLLF 2E3HA 3EG0A 4A54A 4LXCA 1JUSA 4BQOA 1JTXA 2R5ZA 5EDNA 4KGVB 1KQSP 1W36D 2KNBB 3LLRA 2ISZA 2KVQG 3CD6T 1W2BP 1G5VA 2RNJA 3HUGA 2K57A 3K1PA 2LKSA 3MP1A 1O57A 4NUBA 3A2KA 2FRWA 5CLSA 4ABZA 1YRNA 3CMAA 5D5WB 2CV1A 2FZKB 3GPLA 3OSFA 5D5VB 2K2VA 3LW5E 3THKA 2HAXA 5LGNA 1DGWY 4M7DB 4A3CJ 2L7KA 2PMHA 3BJ6A 3HHHA 2PLYA 3SFZA 2FOWA 3RIRA 3K4MA 2RQUA 1IDYA 1WCMJ 3FDYA 4DQ2A 1C0MA 3ZQIA 1K4SA 3H0FA 1D5VA 2MOXA 3CPFA 3HP9A 1ZSZA 3E19A 1MNEA 1R4MB 1OCCH 2VUMJ 1ZKGA 4A3FJ 1LE8A 1BA5A 3M55A 5E3MA 1LOJA 4HVWA 4BI8B 2FZCB 2L7MP 1MZBA 3GXOA 1QP2A 5GAOp 2F5EA 1T0FC 1XDUA 1UTIA 1FIPA 1BI3A 2ZB9A 2XB0X 5FROA 3EDPA 3P8DA 3CCRQ 1GL5A 3DEUA 3FMSA 2IGKA 1JEGA 3QOPA 3MN2A 3KETA 2DEQA 2GA1A 4BDYA 4LFUA 4KUIA 2VONA 4EVIA 2A07F 3CMYA 2HWVA 2O5RA 2JVGA 5GAN4 2G0EA 2E35A 2ICWG 3R4KA 3FWEA 3OYCA 2OAUA 1USSA 3WVDB 1JT6A 2DJIA 1Z9CA 2A28A 2EFIA 3SHFA 1USTA 1BC8C 1M27C 1YI2I 1QCFA 4HQMA 1CSKA 3R6NA 3CXCA 1BR2A 4A3IJ 1DP7P 2I0NA 1SRMA 2O6GE 3GTGJ 4MDWA 3CDIA 1B1BA 2AZVA 5IAYA 3HBLA 2HSEB 4RMOA 3LWHA 4IF4A 3GFIA 1TT0A 5K7HA 2X6XA 4M75E 3W3CA 2Y4XA 4C8QE 3MKZA 3DKMA 4C92C 4E70A 2X4JA 1BW6A 3BZ6A 2EZKA 4LG3A 4RB0A 3CCVI 5K7FA 1YHQI 2CUBA 4JLGA 4N0AA 1I07A 3NTIA 2CUDA 1FXXA 1AA7A 2Y0MA 3OIQA 5F1RA 2A5WA 3HOTA 1POGA 1JU5C 3SDGA 3PIPF 2GZWA 1ZGWA 1HC8A 5ICGA 1W7PB 1FYMA 1UJ8A 1XTAA 2AXLA 3EGXA 3TP0A 2FPDA 3AL0B 5GAN5 4A3BJ 2DA4A 3HG9A 2PMZN 2P0QA 2COBA 1TLHB 4RCCA 3KXTA 1FJLA 2VXFA 1VQ5A 3L09A 1WXUA 1TP4A 2TRTA 3RBBB 2OTJQ 1K9MR 2PQ8A 1U5TA 4F91B 4D5CA 3WTXC 4C9YA 3JRAA 3PMIA 4EMGA 1JUMA 1DPRA 2XGDA 5E3LA 5C4XJ 3B73A 1AKHB 5D6XA 3BPXA 4EMHA 5CR2A 2GM4A 1LDDA 4I98B 1IZ1A 1I4K1 1TWGJ 3K2AA 4UVBA 3SFIA 1VQ7I 2J06A 3JCUC 1VQ4I 1MUZA 5DM7F 1Y0MA 3S6WA 2ZSHB 2XSJC 4U0WA 2K27A 3S32A 2E2HJ 1KHIA 2KL4A 3UA7A 2I5UA 5JR3A 4M6XA 2ZSIB 3VS4A 2TCTA 3CCRA 3HSFA 2ATCB 3JRZA 2MUNA 3CZ6A 2EILH 1YJNI 5LHHA 4XTUA
chains in the Genus database with same CATH topology
4YFXF 3JCMg 5KCHA 4XTXA 3KP6A 4KULA 1M1FA 2KDSA 2FBIA 3CDHA 2DXUA 5HLIA 4OINF 3JCMJ 5HDGA 2LCLA 3QUIA 3FRNA 4ENNA 3MEXA 1XGSA 1UGPB 2K02A 5KCOA 3E1SA 4D0PA 4C5EA 2QQBA 2XRNA 2XKPA 3H3ZA 3A8LB 4MEXF 4NL2A 1KQ0A 3WTSC 6PAXA 4C0DB 3SZTA 1G3TA 5CKFA 4FX4A 4L6V5 4M77D