1G3TA

Cys102ser dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
215
Chain Sequence
b'DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 67
structure length 215
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3tA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3tA03
3I54A 2EV6A 3VOEA 3T5XA 1BI1A 4LB6B 3MAJA 2EK5A 2LF7A 5L3DA 3Q9SA 1VTNC 1W5SA 3WTYC 2K5FA 4P9FA 3P9CA 4HAMA 1MJBA 3RTRA 2IJLA 3V8LA 3KEQA 1TNSA 2QVOA 1CF7B 1RNLA 2GA1A 4WXCA 3WE2A 4AWXB 3HTUA 1AWCA 4OMYA 2O3FA 1W7PD 2R3SA 4CZZA 4PDKA 3F22A 3Q9VA 5BOXA 2Q2EA 3U2RA 1LB2A 3S2WA 3COAC 5J8CA 4RGUA 3DFGA 2HKXA 5ILSA 4HX8A 4KICA 3M8FA 2PJPA 5BS6A 2JT1A 3EDPA 4XRFA 1DP7P 4B09A 1TW3A 4RGSA 1IN5A 1WQ2A 2HS5A 3CDHA 2ISYA 4XLNF 2O6GE 3QPTA 5CVUA 1LEAA 3DP7A 3F8MA 1EH8A 3HSFA 4L9JA 3ZP5A 2F2EA 4HX7A 2RV8A 2MH9A 3WTTC 5ICCA 2RN7A 1ON1A 2R7FA 4IRGA 2JPBA 4DQ2A 1R5HA 2BGCA 3FHZA 4MEYF 1I5ZA 5D4SA 4UUVA 3VB2A 3ZMSA 5K5OA 4HYEA 4FX0A 2GXBA 3BZ6A 3D5LA 4EV0A 4RB0A 4A5MA 1Z05A 3HSRA 1IZ1A 2Z9OA 3TKYA 2M5WA 4QLCU 2OD5A 4S04A 2M30A 5CVIA 3T1BA 1R5GA 5CVVA 1HW2A 4RB1A 5DV5A 1UFMA 1ZREA 4WXDA 1H9GA 3GWZA 5LHIA 2DK5A 3RKWA 2VBYA 2D1VA 3TO9A 1JGSA 5BMZA 5DUKA 5K5RA 1P4AA 5HDGA 3D0SA 4H0EA 1K78A 2MH2A 1XD7A 2VONA 1HW1A 4LB5A 1HKTA 3EUHA 4EGZA 2DO7A 2A5YB 3I58A 3M1EA 2DFIA 1FBQA 3JTHA 2HZTA 2K27A 1YIOA 4M74A 1BOAA 4K2EA 4WCGA 2VOOA 3WTXC 4UVAA 3NRVA 2W85A 3C1DA 1T0FA 4YFNF 2XHKA 3GFJA 5D4RA 4PGHA 3R4KA 1LDKB 4XSXF 4ZYGA 2Y0MA 1B9NA 2EA4A 3QU3A 1JE8A 1QW1A 1FY7A 2VC0A 2K86A 2VC1A 2B0LA 2RDPA 1KU9A 3LA3A 3QU6A 3CO7C 2GA2A 4HDUA 3F3XA 1ULYA 2XIGA 3H3UA 4HV5A 3GFLA 4I09A 1S6LA 6PAXA 1B4AA 3IWFA 3G3ZA 4B8XA 3HUGA 4IJAA 4KIGA 1R36A 1O3SA 1FP1D 4HQMA 1YW9A 1LDDA 4KUMA 1KGSA 2XAQA 2WC2A 2OZ6A 4WX9A 1PP8F 3FXRA 3LSTA 2LDUA 4A2UA 5ERIA 3U1DA 2DU9A 4Y13A 1ZH5A 2F5FA 4I2OA 2X0LA 4JQFA 4M71A 4L0YB 4EJUA 4AIHA 4PZJA 3V7CA 3HTSB 1WRJA 2W57A 5LRRA 4PGGA 4RB2C 3L7WA 4A12A 2NS0A 3EYYA 2QENA 4GYGA 4ENNA 1J7KA 5H6RA 2DPDA 2L02A 2P5KA 3K1NA 4BH9A 3G73A 3QP5A 3O6BB 4KN4X 5BPIA 5D8LB 1TW2A 5JVTA 1XDSA 2EWNA 1YS6A 3B02A 1FZPB 1YG2A 2Z5UA 3WG9A 3GX4X 5LEKA 1JHFA 2Z3YA 5L3BA 3GF2A 3DQVC 5HLHA 2L3DA 3EQLF 4KMUX 4U7DA 1FSEA 1REPC 5AIQA 5H6QA 1E17A 1ONVA 3F6OA 5D6FA 1BI3A 1QBJA 2YX4A 1LEBA 3DF8A 1Z1DA 2YX7A 3RPUA 1SD6A 1T6SA 2VBXA 4BXUA 2DT5A 3U9GA 1MJAA 1Z9CA 3WTWC 5AIPA 4WWCA 2CQKA 2V1XA 1XSXA 4GO1A 3MFKA 4L5JA 5LLQA 2BYVE 2Y75A 2STWA 1WWXA 1O7FA 4MEXF 2HFHA 1IW7F 4ENMA 4CYDA 4YFXF 4RAZA 2ZJ2A 3IKTA 2KKOA 3FM5A 1MD0A 1BM9A 2H3JA 2A07F 2ACJA 3RDIA 4A6EA 2FE3A 2Y48A 3M8EA 2DQRA 3IHUA 1IXCA 2O0YA 1YS7A 2J5OA 4BHBA 1XGMA 3E3VA 2E7WA 2EFNA 3TDZC 3HHHA 5HOOA 1EV7A 1QZZA 1G4DA 5L3FA 4HQEA 1Z7UA 3CUQC 2XVCA 1YW7A 1FWZA 5FD5A 4O5VA 4A0ZA 5HDKA 1C0WA 5L3EA 2UXXA 1EH6A 3FX3A 1XGOA 2Q0OA 3BJ6A 3WU1B 3GYHX 3BOQA 2XRNA 1IRFA 2IRFG 3IRRA 4G9YA 2VODA 2OU2A 2JPCA 1Z6RA 1QZYA 3LFKA 1O3TA 4EVIA 1FBSA 5D8KB 2F5EA 1D8KA 1MGTA 5LGUA 1ZAOA 2PMUA 4BHPA 1RZ4A 1BJAA 4KFCA 3HSEA 3TOAA 3L00A 1ZLJA 2QLZA 2ESNA 2A69F 2E7XA 2MLGA 3HHGA 3E5QA 5BPDA 2WWYA 5JI6A 1HSTA 3VODA 5DUIA 3CO6C 1P92A 4O6JA 4A0YA 5JR3A 4P55A 4KYWA 2M1BA 3HRUA 2A68F 4LLNA 3R6SA 3PQJA 2V1UA 2K4BA 2K02A 1FPQA 1MJ9A 5E1WA 5J6XA 5F1RA 1PP7U 2IP2A 3FF5A 2FSWA 4U0VA 2HTJA 4HF2A 4MQ9F 1ZARA 2ZMEA 3FZVA 2Z99A 1GVJA 2XAFA 1STZA 2RNJA 5DCMA 1S3JA 2FMYA 3NEUA 3E6MA 1KQ9A 3IL2A 2L54A 4M72A 3ISPA 3TGNA 2GXGA 4ASNA 2UZKA 3P9IA 1PUEE 3V8JA 1T98A 2ELHA 1MDMA 2FBIA 4UVBA 2VXZA 3GFMA 2BBYA 2OQGA 5FO5A 4WXHA 2ETHA 3F23A 1FT9A 1USSA 1BYMA 3KZYA 1YYVA 1H0MA 1D3YA 2QYOA 1SFXA 3R60A 2K5LA 3BDDA 3E6CC 2H6CA 1RUNA 3DKWA 4U88A 1F1ZA 2MC3A 3WGHA 1KQ8A 2W24A 1R1UA 4LJZF 1ZN2A 5K1YA 3H92A 3RPQA 3BWGA 2VT2A 3K1MA 3BJAA 4U0YA 1HW5A 1BN5A 3ECOA 3ZMDA 4L9NA 4N9IA 5F64A 5ILVA 2WV0A 3BY6A 3RYPA 4KIFA 1XN7A 2PBIA 1IN8A 4CGZA 5LHHA 5L3CA 3I64A 4BHCA 1WKMA 4EGYA 3SFZA 2DPUA 1W7PA 3GZ5A 3GEZA 5H20A 3JTGA 3ABUA 1Q1HA 3SZPA 5KVRA 3R0AA 2QM3A 2YR2A 4PCQA 4AD9A 1FBUA 1IXRC 5K5QA 2HGCA 4ESFA 3QRFF 3JSOA 2P5LC 5CLSA 1R22A 4Q5SF 2XAHA 4S05A 3I4PA 4RAYA 1R00A 4EM1A 2XAGA 2RC4A 3W6JB 2EFWA 1P6RA 3IRQA 1FLIA 4ESJA 3IKVA 4ON0A 3E19A 1U5TA 2KJBA 1FSHA 1Y0UA 3O3KA 4R1HA 3P9KA 3C18A 3CUQA 3I71A 4JBAA 2O8XA 1G6NA 3ULQB 4Q48A 1T38A 2ZNZA 2PEXA 2Q8KA 5HS8A 2FEZA 4BQAA 5IT9Z 5D5VB 2GCXA 4G6QA 2QBYA 1MKMA 1G3SA 3KP4A 2LF8A 5FFXA 1O3RA 1KYZA 1T2KA 4LD5A 3RKXA 2JZYA 2F5CA 3KFWX 3DXJF 2D1HA 1ZRDA 4M6YA 1H9TA 2LSOA 1A04A 2C6YA 2NNYA 3BPVA 5HLGA 1B9MA 2H6BA 2P7CB 1LQ1A 4IRHA 4XSZF 3GVAA 4G8XA 2OQRA 4A6DA 1LDJA 3R61A 1QVPA 2GAUA 2BEOA 3I59A 4EJOA 2ZCWA 2FBHA 2GZWA 1S7OA 2A61A 5D5UB 2PI0A 3WGGA 2IW5A 1K78B 5HDNA 2RKHA 5E8IA 2EFQA 2HKOA 3KCCA 1XSVA 4YIIA 4IPAA 4G7ZF 1L3LA 4OIOF 3FXUA 4JK1X 1BC7C 2RQPA 3KZZA 1JXSA 3J80Z 1J59A 3WODF 3GO5A 5E8GA 1XGSA 2VOPA 4HA8A 5L3GA 4UVCA 4ZZDA 3ZN0A 2KIUA 1IAWA 3WGIA 3E6BA 4RGXA 1SD7A 4ESBA 5ED4A 4AVPA 3KLNA 4FT8A 3HOSA 2XUBA 1UHMA 2D45A 1XSDA 4LG0A 1J75A 2ZNYA 1I1GA 4GYIA 5ICEA 5ICGA 3K0LA 3E5UA 1TBXA 1ZHFA 2PG4A 4LLGF 3CUOA 3F8BA 2FNPA 4GGGA 3ZMVA 1YFHA 2ZBKA 5DYMA 1J9IA 3QP6A 1L0OC 4MNUA 3LWFA 1F5TA 2EJRA 4Z2YA 2PN6A 5EEHA 5LHGA 1U3EM 4N9HA 2EV5A 5E1XA 3ZPLA 3WU0A 2KIMA 3HYIA 2E1NA 4ETSA 4IHSA 1D5VA 1GXQA 3K9TA 5ILUA 4P5OA 2DBBA 1IN4A 3M9AA 4UXNA 4R79A 4OINF 1O57A 1Z6TA 4BYYA 2X4HA 5IT9K 5E1ZB 1OR7A 2EFOA 5D5XB 3JAMK 4FHTA 2PLYA 1RIOH 1XGNA 3F72A 1S7AA 3FXQA 2ADUA 4I01A 3FMSA 2V1DA 2FMLA 1G3YA 4RS8A 3FWEA 3MCZA 3JSPA 1RI7A 4LLLA 3KETA 4M9XA 1FYLA 1SD4A 3WTSC 4MQVA 4MTEA 2DK8A 3J81Z 4P9UA 1ZRCA 2P8TA 3ELKA 4M9SA 3SQNA 3FMQA 4NQWA 5E17F 1BBYA 4Y17A 1DUXC 3PQKA 4HLYA 2O03A 3ERED 2A6HF 3ML6A 5TJJA 4IRIA 3N97A 2LKPA 1YO5C 2M8EA 3LAPA 5CVRA 2YPRA 3J80K 5CJ9A 2DLLA 4KIBA 5DEQA 5HS7A 4HDVA 2P6SA 3N4MA 4E70A 2L4MA 3ZQ7A 2P6TA 3SHFA 4MGRA 1V3FA 1I6XA 2MLKA 3GFIA 3MWMA 1UB9A 2UXNA 2HR3A 3H3ZA 2MD5A 5LGTA 2IT0A 2ISZA 1K6OA 1QPMA 2RVCA 2UWMA 3O2PE 4OIRF 1U78A 3MZYA 2EFPA 3P7NA 2XKPA 2GIVA 3JW4A 1J5YA 4UHTA 1TQMA 1CF7A 2OZUA 4KT5C 4KMFA 5JHUA 2COMA 1U6GA 3HRTA 3TDUC 5E20A 5DCFA 2V6CA 1XB4A 3F6VA 5IT3A 2M87A 2MA3A 4XLPF 3RKYA 2HEOA 3T8TA 2HWVA 2QQAA 4G7OF 1KQ0A 2A6EF 1HKSA 4RGRA 4UV8A 2JSCA 1IUYA 1FX7A 4WF2A 1ZLKA 4L9TA 3BROA 1OPCA 3VEPA 2K5IA 1LVAA 3IWZA 4L18B 1SMYF 5LRSA 1XMKA 1XCVA 1XCBA 1DPUA 4M6XA 2CYYA 3KE2A 4EQQA 3EYIA 2JRTA 3RI4A 4BNCA 1W5TA 1HXDA 2VN2A 4Y15A 1J2XA 1YTYA 2G7UA 2VBZA 1ODDA 3LAJA 2V9VA 3B73A 2QZ8A 3KP6A 2FOKA 3DEUA 3J81K 3OOPA 2DQLA 1B1BA 5CVJA 1GXPA 1UHWA 1W4MA 2WTEA 3KP5A 4EM2A 3CLOA 2D2WA 4I02A 3FMRA 3KP2A 3LA2A 1F4KA 1E2XA 1ZG5A 1IRGA 2AXLA 5LGNA 5E18F 3DPTA 4MTDA 1OYYA 1B6AA 1SD5A 2CW0F 1P4XA 4OU0A 5CYVA 3T0YA 5FLXK 1YLFA 1G3WA 3ABTA 3L09A 5J8FA 3RYRA 1BIAA 4WK8F 1SFUA 3R0JA 4GXOA 1TTYA 2W84A 2GQQA 2MBFA 4ZYHA 2ZMEB 1OKRA 4OMZA 3WE3A 1P4WA 5DCMB 1IF1A 3HIFA 4XBFA 3L9FA 4A0XA 1KYWA 2P4WA 4IF4A 3PFIA 4HBLA 1XMAA 3KLOA 3E5XA 1MDMB 4CDGA 2FBKA 1OYIA 3KP3A 3MEXA 4UNOA 4LK0F 1FYKA 4M9ZA 3WTZA 4BAYA 1QNTA 4R8HA 4KNYA 2DI3A 2K7LA 2L4AA 4EM0B 2EB7A 3MQ0A 4YIFA 2CGPA 1J0RA 2QWWA 3F21A 1T39A 1YQAA 4FX4A 1K7AA 3IC7A 1USTA 3GLXA 4CICA 3K2ZA 4U0WA 2FRHA 2O61A 4HLXA 1KU7A 2BV6A 1SAXA 5DDGA 2CWEA 2HQRA 2L01A 4HOBA 1G3TA 2XV4S 2VE9A 1JHHA 3CTAA 3I53A 3ZN1A 5FGMA 3L2CA 4LGWA 3BJOA 4ZH4F 4ENKA 3JAMZ 2NRAC 1W7PB 5F6FA 3RJPA 3VFZA 2VBWA 2H09A 5AONA 4I0BA 3HRSA 2NAZA 2ZXJA 1ON2A 4Q47A 1U8RA 4HW0A 4G6DA 1DPRA 4TV7A 2H94A 2HOEA 3LQQA 4U7BA 1KA8A 1I1SA 4P96A 3ZMZA 3E6DA 4O3MA 1SMTA 4I7HA 2IVMA 4ZZLA 1U5TB 4KDPA 2IA0A 1UCRA 3CUQB 5EEGA 4L5IA 4F7ZA 2W25A 4N0BA 3MHXA 1HQCA 1QQIA 4EJVA 2J5PA 2FQ3A 2KIFA 2P7VB 3GXOA 2CG4A 3I0TA 2H27A 4LMYA 4EJWA 2QBYB 1TLHB 1S8NA 2ZKZA 5ICFA 1RUOA 3KEOA 1I27A 3Q5FA 4IHTA 4L0ZB 5LEJA 2HYFA 2XGXA 3HRMA 4NB5A 1HBXG 4EJTA 2NNNA 2DAOA 4I0AA 2NYXA 3T8RA 2K4JA 3BP8A 1BC8C 2LX9A 4Q4ZF 4HX4A 2PQ8A 2ZFWA 4AIKA 2OA4A 4KA4A 2DTRA 2JTVA 1AOYA 4ZYDA 2VE8A 4G7HF 1CGPA 1BI2A 3I59B 2HYGD 1U2WA 2YU3A 3K1PA 2G9WA 1D8JA 2HDCA 2ZO4A 2LNBA 5D6EA 1ZGAA 2KJCA 1KU2A 1K79A 4CHUA 1OYWA 2EA2A 2IPQX 2GWRA 2K4YA 1HSJA 2AS5F 2FU4A 2DW4A 1R1TA 2TDXA 1YW8A 4DNCA 5A2QZ 4YG2F 2PFBA 3RIRA 4YFKF 3QPHA 1TNTA 1IXSB 1TQPA 3GZ6A 3ROUA 2HQNA 3E97A 2RGVA 4CO8A 1MZBA 3TO7A 1X3UA 1BI0A 4I98B 2HTSA 5HLIA 3WTUC 4LG0B 4CXFA 3SXYA 2A3SA 4QWQA 1FYMA 4A5NA 5BQTA 1S29A 1SFEA 3ZMTA 2QUFA 1WSUA 1BIBA 4MHGA 5KK1A 3K69A 1O7LA 4HF1A 1P2FA 4ENJA 3SZTA 1PDNC 4GCVA 4LFUA 1FOKA 3MZHA 5DD8A 1HKQA 3V7RA 2P5VA 3FM3A 3M7GA 3J7AO 1FNNA 3I5UA 1LNWA 1F9NA 2CFXA 3TQNA 2BE5F 3ECHA 1ZYRF 2G7HA 1GHCA 2XAJA 5DD4A 5JFRA 3C7JA 4RB3C 4G94A 2VT3A 2V79A 2STTA 1QO0D 1R7JA 1O3QA 4EMSA 5HS9A 3LQRA 4M73A 2M45A 3TOBA 5LBQA 1WI9A 1NHAA 4IXAA 1V4RA 3AAFA 2FNAA 2KRFA 4AIJA 4HF0A 2FA5A 3TO6A 2PMHA 3OV8A 2FXAA 3C3WA 5FLXZ 4NHJA 4HV6A 4D0PA 2Z33A 3QOPA 1FC3A 2IA2A 1R1VA 3DPLC 2ESHA 3LA7A 1DDNA 1TQIA 4OOIA 3KP7A 3WTVC 5TRDA 1EH7A 2XKOA 2FF4A 5FFZA 2OAZA 5FB2A 1Z91A 1ZRFA 3CJNA 3DV8A 1U5TC 4UV9A 3W6KB 4OIQF 3NQOA 1FP2A 3F8FA 1ZG1A 1OMIA 1IN6A 4HZFA 2CSOA 2QQ9A 5D5WB 3F8CA 3ZMUA 1XDUA 3REOA 3F8NA 4KN7X 2CO5A 4ZYEA 3GUDA 2EV0A 2IA1A 3QAHA 1LJ9A 5FD6A 5A2QK 1IN7A 3EETA 3V8KA 2YSRA 4IVNA 1ZG3A 1KU3A 3GW2A 1R58A 1R23A 2XASA 2QQBA 1QGPA 1ZGJA 1B59A 3HOTA 4L9VA 2OBPA 2XROA 3V7SA 3BPXA 4LK1F 4OIPF 2E1CA 3V4GA 2R7DA 5HVQC 2F5DA
chains in the Genus database with same CATH superfamily
3I54A 2QGGA 2E5QA 2EV6A 2W82A 4FW1A 4FE4A 4OP0A 3CCQT 5L8RE 3S93A 2F4OB 4BQQA 2DMPA 3VOEA 3GTGJ 1ACMB 2E5ZA 2LCLA 2DA9A 2CYZB 2BXZA 1TOVA 3T5XA 2LDMA 3EG2A 3OB9A 4JJNK 1YJ9Q 4XLEA 1SANA 3HEFA 4BBRJ 4KUIA 3LYIA 1BI1A 3DKMA 4M7DD 2JTMA 4ZNXA 2VKVA 2IS1A 3CMEQ 4LB6B 3O8VA 4M4ZA 4C0GA 3MAJA 1PSFA 1B07A 2EK5A 2LF7A 5L3DA 1W2BP 3Q9SA 3MKLA 2XD0A 1VTNC 4M75C 1W5SA 2ZPEB 3WTYC 4NC6A 1ZSGA 3JCMV 4BB7A 2E1MC 3OWTA 2DN0A 2F69A 2E5NA 2XB5A 5F27A 2K5FA 3CF5F 4R0KA 4P9FA 4X34A 4M78C 3P9CA 4HAMA 1KD1R 1FIPA 1MJBA 3KYDB 3RTRA 1SRLA 4A4EA 2RHXA 1BK2A 2IJLA 3LL7A 3OR1C 3P5JA 3V8LA 1GT0C 4BUGA 1BKBA 2LP0A 3KEQA 2GQVA 5HK3A 1TNSA 3GTLJ 2QVOA 1CF7B 2DXUA 4M77D 1RNLA 2X1DA 4Z89A 1VQ7Q 4IQJA 4A4FA 2GA1A 4FT2A 4J9EA 4J6WA 4WXCA 2FPFA 3WE2A 4AWXB 5KYNA 3TEDA 2X4JA 1VQOA 3HTUA 4FIBA 3U21A 2E3HA 2YRCA 2Z0WA 4GLMA 3SD4A 5I2SA 5GAMg 5DM7R 3TVTA 1AWCA 4D1QA 2B8AA 2Y30A 1RADB 5A0DA 3CCUA 4NDLA 4OMYA 3S15J 2R7WA 1BR1A 1T3LA 3SFMA 2O3FA 3VSLA 1W7PD 2L7FP 1WJAA 1JO8A 2R3SA 2RI3A 2LT4A 3CC4T 3BY7A 4PJNA 3VS6A 2EYXA 3OIOA 4CZZA 4PDKA 3S17J 2FG0A 3F22A 2V8JA 3Q9VA 3I56T 5BOXA 2CT3A 2D6FA 1Z7LA 2Q2EA 2WADA 3U2RA 1BJZA 1LB2A 3S2WA 3COAC 2EVRA 1YI2T 2R7OA 2O4XA 5J8CA 4JJBA 1JT6A 4II1A 5KCHA 4RGUA 1XG1A 3J81R 3DFGA 2HQHA 2HKXA 5GAEJ 3BC8A 2PVGB 2LTOA 2M1HA 4XONA 5GAOn 5ILSA 3X20B 3CMAT 1U1SA 3BR0A 3EGUA 4BJTA 1JXOA 2QA4Q 4BDYA 2OTJQ 2O5RA 4HX8A 4KICA 5DTDA 1U8BA 1JQQA 2DK3A 5CIUA 3CCET 1JTYA 2CH0A 3M8FA 2QCOA 2L8DA 2KRHA 2PJPA 2RHYA 4PJOC 5BS6A 2JT1A 4M78E 3EDPA 2L5QA 3H0DA 2EGEA 1UGRB 3HGYA 4D5FA 4XRFA 1DP7P 4B09A 3FLGA 1TW3A 5FKMA 1JUPA 4RGSA 5F0HA 1V5FA 2RQRA 2ECCA 1QLYA 1IN5A 1WXTA 4YIRX 1LUJB 1WQ2A 2HS5A 3CDHA 2Z16A 3BZCA 3QYEA 2AZVA 2DTIA 1AA7A 3ERMA 3FK6A 2QXFA 3OYEA 1UZCA 3VS5A 3D5RC 1X19A 2ISYA 5B1BH 4XLNF 2O6GE 1TUDA 4D7MA 1WQWA 1G8XA 3AFHA 1ZUUA 3TCJA 3QPTA 4A4GA 5CVUA 3CD6T 4RAGA 1VQNI 1LEAA 3DP7A 5FLXR 1WJQA 2A36A 4M7DA 3F8MA 3EHRA 4C9YA 1EH8A 1W6XA 4EDUA 3HSFA 4L9JA 3ZP5A 1IO6A 1VQ5A 2LBFA 4J19A 2F2VA 2F2EA 4HX7A 2PTKA 1TT5B 4J00A 1ZA2B 3K4CA 3H6ZA 2RHIA 5D6XA 3TBIA 5JLXA 3FHNA 2CSIA 2GFUA 2YUQA 5LJ3e 3JCMW 5KHDA 2RV8A 4E7IA 1M2VA 2OI3A 2L7ZA 2MH9A 3U23A 2CRGA 2HU9A 3WTTC 5ICCA 1WFXA 1XTDA 1VFCA 2RN7A 1ON1A 2KP6A 2R7FA 4IRGA 2JPBA 5EZGA 4DQ2A 4MZTA 1R5HA 2BGCA 3OS2A 3FHZA 3G4SI 1ARKA 3FRNA 3H5RA 2VQHA 3GTJJ 2RB6A 2XK0A 3MP8A 2UUZA 4MEYF 1YJWT 1I5ZA 3X25B 3A52A 3A01B 2DERA 2O4XB 2O01E 1XTAA 1VQPA 5D4SA 4UUVA 1M90R 1ETOA 2VJJA 3VB2A 1D1CA 3ZMSA 3OYNA 2DTOA 5K5OA 1TC3C 4HYEA 4FX0A 4QKUA 4X1VA 1OCOH 4L5GA 3JB9H 2GXBA 4F7UA 3BZ6A 4C3HJ 3O5ZA 1KQ2A 2R7UA 3IH2A 2E12A 2WY8Q 3OYHA 1TH7A 1HK9A 2W4SA 3D5LA 2MD0A 2CMPA 4RB0A 4EV0A 1D1AA 4A5MA 1Z05A 4D9JA 4QTRA 1E0EA 2P0TA 3HSRA 1IZ1A 3M5AA 4J6XA 1VQKT 2Z9OA 4FASD 4A3DJ 3TKYA 2A6TA 1WJCA 1BA5A 2M5WA 4QLCU 2OD5A 4F91B 4S04A 3S3NA 2M30A 4QT7A 3THKA 1Y8RB 2DOEA 3JRHA 5LJ5h 1YJ9T 2XF6A 3S1NJ 1FTTA 5CVIA 1NZ9A 2W1OA 1Q82C 1WJ5A 2CU7A 3JR9A 2V8IA 3GF5A 2FD5A 2J6KA 4IURA 3JCMQ 2EBPA 2FJ1A 3T1BA 2LR8A 1I1JA 4M75D 1R5GA 2QEXI 5CVVA 4B48A 3TW6A 4DZPA 1OJLA 3IUOA 1JKRC 3HZJA 3LWIA 3SEZA 5GAN6 4E47A 3VSKA 4N4GA 4M78D 2Q1ZB 1HW2A 2DILA 1U1TA 1VQ9A 4RB1A 1WHHA 1R5ID 5DV5A 2RQUA 3C0CA 1YHQI 2V1QA 3CCLQ 3QSUA 3N05A 2AHJB 1T33A 5GTIC 2QKMB 4AM3A 5GAN3 1UFMA 3I55A 1O4XA 3OYAA 1ZREA 3FB9A 4WXDA 4A3MJ 2EIFA 1M3BA 1VQ9Q 4QVCA 3HB9A 1H9GA 3GWZA 4RTXA 3M4GA 1Q7YR 5LHIA 2EQJA 2DK5A 1YJNT 3RKWA 1U5SA 2DVJA 1KQSP 1M2VB 2VBYA 5C4JJ 5DS9A 1RR8C 4ZDOA 1V54H 1VNDA 3E1SA 1U06A 1WJSA 2F2XA 2LRQA 5IXFA 2D1VA 2W00A 1O9SA 1H8KA 1VQ8T 3TO9A 1JGSA 5BMZA 5I21A 1BU1A 1ZSZC 5DUKA 2BHYA 5K5RA 2E6ZA 1P4AA 1A6QA 3D0SA 5HDGA 3PIPF 4H0EA 1FMWA 2LD5A 5IPAA 5KAFC 1K78A 1GFCA 1NEGA 2MH2A 2FRYA 2LCCA 1NG2A 3FIFA 3HFOA 5IXBA 4WTOB 1SF9A 1XD7A 1LE8B 1QVGS 3FIWA 4NC8A 2VONA 2E1OA 5FU6B 2M7AA 2BTTA 1HW1A 2K3PA 4LB5A 3GIBA 1BW5A 2ICWG 2HD0A 1HKTA 3EUHA 3Q0WA 2RO0A 4EGZA 5D7UA 1ORKA 2DO7A 2A5YB 2DFHA 3I58A 3M1EA 2NVXJ 3VYUB 1U0JA 2DFIA 1FBQA 3JTHA 1PC0A 4BEHB 2HZTA 1S1NA 2COZA 1UHCA 2K27A 1YIOA 2OAUA 5GTHC 1YWPA 4M74A 2KXDA 1BOAA 4K2EA 4WCGA 5FRMA 4EEFG 1KC8R 2R5YA 2DMNA 2VOOA 4PL6A 3WTXC 1I3AA 4UVAA 1I3QJ 3NRVA 2W85A 2YUSA 1D3BA 4FE7A 1BL0A 2XDVA 1K76A 1K0SA 3C1DA 2CS7A 1T0FA 4ME7A 4B9XA 4X9DA 4S0HB 3E0JB 2COYA 1MH3A 3FISA 2XHKA 4XKWA 4YFNF 2LKXA 1OYXA 1K9AA 2BZXA 3CC7A 3GFJA 5D4RA 2QG9B 2DX1A 3DTEA 2L89A 4PGHA 5J4VA 4PJOD 3UATA 2ZPBB 2VVKA 2QF7A 2HPMA 1Y0NA 3PE0A 3R4KA 4PFPA 1E7OA 4YEJA 1X1CA 4OMPA 3CCJA 5HCKA 5BNGA 4N0AA 1LDKB 4XSXF 1ETQA 4ZYGA 2DL8A 2Y0MA 3K4LA 1FOWA 1B9NA 4D7NA 4XK4A 4BUPA 1JJ2S 2EA4A 1YN8A 3QU3A 1PD1A 1JE8A 4Y28E 1VOMA 1X2MA 3CCVI 1FY7A 1QW1A 3RR6A 2VC0A 3R6NA 9ANTA 1LFUP 2K86A 5HNFA 2JTEA 2G0EA 2IXSA 2B0LA 2VC1A 1Y71A 4M7DG 3AHUA 2RDPA 2EQIA 1KU9A 4LE9A 4XTXA 3LA3A 3NWTA 4GRIA 3VYTB 3QU6A 3CO7C 3QYBA 2GA2A 1R4NB 5IOZA 2A37A 1VQMT 4I6ZA 4HDUA 4DYQA 3F3XA 4RCCA 1ULYA 3KIOA 1QVGA 2XIGA 3H3UA 3LW5E 3SDGA 1AOJA 3H1CA 4HV5A 2CQ7A 2EZKA 3L2UA 2I8DA 4JDSA 2KY9A 4JYKA 3GFLA 1K73R 4I09A 4M78A 3C2HA 1S6LA 4PLLA 1XS9A 1JB0E 2CH4W 4BU2A 3RPUD 5GMKm 4UUSB 6PAXA 3RQ4A 4M77G 1B4AA 3IWFA 4XLHA 3U1KA 1Y39A 3CMET 3FKJA 3G3ZA 4B8XA 2QYZA 2O31A 3VS4A 3HUGA 4IJAA 2HI3A 3WHBA 1WHJA 2I10A 3PNWC 1T95A 3H5NA 2PVDB 1TWFJ 4FCYA 5B1AH 4KIGA 4ZC3A 1Q86U 4KUDK 1RKWA 5EC7A 2EIJH 1RI0A 2M3AA 1YITI 1OU8A 2CUFA 2CW7A 1R36A 2C06A 1WPYA 2MAMA 5J26A 3HOYJ 1O3SA 5CAIA 1TL8A 1FP1D 4HQMA 4EMKC 3SWNA 1YW9A 1LDDA 4KUMA 1NM7A 2VXDA 2M16A 1KZHA 2GQIA 3UA7A 2OX7A 4CCMA 1KGSA 2XAQA 3HFNA 3CCMI 5E3MA 4AYBA 4E6RA 2WC2A 5GAHJ 2J6FA 2OZ6A 3GBGA 4WX9A 1PP8F 4KITB 1Q81R 2D0NA 1NPPA 8AT1B 3FXRA 2MF2A 3I35A 4AC0A 3JSCA 1JJ2A 3LSTA 3RKQA 4JRIA 1ZR2A 4M77F 2LDUA 1ETWA 1GV2A 2EBIA 5ERIA 3M1CA 4A2UA 1WQ7A 1ZHIA 3U1DA 1NTCA 3PMTA 2DU9A 4ATOA 4Y13A 3LGFA 1MNEA 1ZH5A 3OR2C 2F5FA 2IS6A 4PFZA 3Q3SA 3JCMg 4I2OA 1SSFA 2X0LA 1QPIA 2IS4A 1R8OB 4C2MJ 4JQFA 3ER0A 4M71A 3OQ5A 4L0YB 3ZQIA 4EJUA 3HC7A 4AIHA 4PZJA 3V7CA 1Z9QA 2DYBA 3HTSB 2OTLA 4M7AF 1WRJA 2W57A 5LRRA 3AL0B 1VQNQ 4HG2A 2R7TA 2EQRA 3HKZN 4PGGA 5EGOA 4RB2C 1QWFA 2ED1A 1X4PA 2LC4A 3L7WA 4C92C 4XKVA 1ITYA 3CPWS 3H9NA 4JS5A 5HKCA 4A12A 2X35A 5I22A 5GAN8 1W1FA 3L1PA 2RK1A 2DO3A 2KT1A 2EGAA 3MJXA 1SVOA 2NS0A 2WAEA 4CC2A 3EYYA 1PNJA 3FJ5A 3FXOA 2QGUA 3ESWB 2QENA 4GYGA 3H0IA 1D0XA 1J7KA 5H6RA 4ENNA 3QZ9B 3CXCS 1RESA 2DPDA 2L02A 2P5KA 3K1NA 4BH9A 2DA4A 3G73A 1VIEA 3FK7A 1WJEA 3S32A 3CZ6A 2MI6A 3QP5A 4AU7A 3K10A 5AT1B 1SSHA 1WGXA 2E19A 3O6BB 3RUXA 3VUBA 4F55A 2IVWA 4KN4X 4XR6A 5BPIA 1RI9A 5D8LB 3G4SQ 1TW2A 5JVTA 3CCSA 2Y0SA 1XDSA 2PJRB 3FXLA 1D0ZA 2EWNA 1YS6A 2QA4T 3B02A 3X26B 2OTJT 3HOWJ 4J9CA 1FZPB 1YG2A 4JX6A 2BUDA 4C0DB 3OYCA 2LJ3A 2Z5UA 3WG9A 3GX4X 5LEKA 1JHFA 4E2FB 1M1GA 3LOCA 2Z3YA 1M1KR 3M0TA 5L3BA 4IUUA 3ZQCA 3GF2A 4MO7A 3DQVC 1QU3A 5HLHA 2GOXB 2L3DA 3EQLF 4W1UA 2COWA 4FSSA 2EYYA 3TREA 4KMUX 4U7DA 1FSEA 3CBMA 1REPC 5D6WA 2R7XA 2RAEA 1RL2A 3C94A 3SWNB 3HOUJ 1VQOI 1PUFB 2EJ9A 3W3CA 3I9V2 2OC6A 5AIQA 5H6QA 3P8DA 1E17A 1EX4A 1ONVA 2P0WA 3F6OA 3OOUA 5D6FA 4E7ZA 1BI3A 3KYCB 1X2KA 1QBJA 3QJYA 2KZGA 2YX4A 1LEBA 3DF8A 1ENHA 1Z1DA 1X1AA 2F4IA 3BLYA 3CCUI 3G2BA 2JA6J 3OMCA 3S14J 5KE3A 3S3MA 1K9MU 2YX7A 5JHFA 3RPUA 2NVQJ 4MFDA 3RZDJ 1SD6A 2RJEA 2MPXC 2L0KA 1RR7A 1U9NA 5GJWB 1X1DA 3LSHA 4XIDA 3QHSA 4B1RA 1T6SA 1NJIR 1X69A 2QEXQ 2K5CA 2VBXA 4PSXA 5KCMA 2DT5A 2F48A 4BXUA 1J09A 2LQNA 2P81A 2BOLA 1UEBA 2LCSA 5KYWA 3RQIA 1NYGA 1Y96B 3QG1A 3U9GA 1Q1VA 3GPLA 4HT8A 1MJAA 1Z9CA 3CPWA 4C92E 4JRPA 2QDYB 3WTWC 3MEWA 5AIPA 4OMMA 2HKNA 1WI3A 1YHQQ 1N5ZA 4WWCA 2OCCH 1E6HA 2DE0X 2CQKA 2JTFA 4NBQA 3TP0A 4ORZA 4RM3A 2V1XA 5M5YJ 2R93J 5GAOq 1XSXA 5CKBA 3CXCA 2L3QA 3LSKA 4GO1A 3M4YA 3MFKA 4L5JA 5LLQA 2BYVE 4HCZA 2Y75A 5CQGA 2M9HA 2STWA 4KGXB 1WWXA 2OJED 1VQ4I 3DWLE 1A5JA 2MVTA 1DU0A 4YRVA 3ZL7C 4RMOA 1WZ2A 3OS1A 1MV3A 2DXBA 2CZ0B 5FROA 1TTHB 1O7FA 3EFRA 4MEXF 2OPTA 2JWTA 3PNYA 4M75G 5TISC 4A93J 2HFHA 2KYMA 5GAN5 3EG3A 1IW7F 1GUUA 3JRFA 4C5HA 1H92A 4ENMA 5CKEA 4JP0A 4V2SA 3K70C 1X27A 4F92B 1HCRA 4CYDA 4YFXF 2R5ZA 4JPBW 3J7AW 1V1CA 5HLTA 2IGKA 4RAZA 2HQ5A 4J9FA 1IXDA 1SHGA 4CH7A 2DXIA 1MSFC 4M7AC 3LWHA 1I6HJ 2ZJ2A 3IKTA 2CUEA 2KKOA 3FM5A 3ZRGA 1MD0A 3O8HA 4BQOA 1B8IA 4CCJA 1BM9A 2YHTA 1SG5A 4AUXA 2B7EA 2A07F 2H3JA 2K79A 5EJCA 1VQ5I 2M0OA 2ACJA 3RDIA 4A6EA 1SFOJ 5J47A 1JXMA 1NG7A 2FE3A 2Y48A 2BE7D 3M8EA 1ZELA 2DQRA 2KYBA 1JU5C 1UJYA 3IHUA 1IXCA 1ZSZA 2P0QA 4LIVA 2O0YA 5CPRB 1YS7A 4M75F 4AFQC 5C0MA 3VS2A 3PTAA 2KL4A 2PX9A 2R7VA 1TG0A 2BY1A 3BG9A 4ZN1A 2J5OA 1VQ9T 4BHBA 1XGMA 2H1LA 1R6RA 2KBTA 1ZBJA 5KYWB 2KDOA 3QYFA 2YLBA 2K57A 1YCYA 2L3PA 2VPRA 4LDXA 2AK5A 2KEAA 4A4HA 4IIMA 3E3VA 2RNGA 1ZR4A 2E7WA 2Y31A 3D7SB 1SEUA 1VQPI 2R92J 2EFNA 2X3WD 1HC8A 5FKLA 3TDZC 1WHMA 4A53A 5IY5H 2FPDA 4AMCA 1M8VA 3HHHA 1HDDC 1QMCA 5HOOA 1OV3A 2QKLB 3PUBA 1EV7A 3CCLT 3CCVQ 4JRQA 1CKAA 1QZZA 3G1MA 4IHYA 1G4DA 5L3FA 4HCCA 3IAS2 4JS4A 4HQEA 4J9HA 3IP4B 4C92D 1Z7UA 2B86A 1MBEA 3VV0A 4BS9A 3CUQC 5J3LA 4M77E 2XVCA 3DBHB 1K4US 1MH4A 2WY7Q 3G1OA 1YW7A 2E2IJ 1GCPA 4PJOG 4HT9A 2MABA 3G6EA 1FWZA 2NXNB 2XGEA 5C3EJ 3OSFA 4HXJA 5FD5A 4O5VA 3A5ZB 2ME0A 4VUBA 1G83A 2RN8A 2WSEE 2BY3A 1I5OB 1SKUB 4Y4RA 2E2JJ 4LXCA 4A0ZA 1D1BA 4F93B 5HDKA 3ZBDA 1C0WA 5B3SH 5L3EA 2CUBA 4M7AE 2GF7A 1WJBA 1EH6A 2UXXA 3FX3A 4XOTA 1NG6A 1XGOA 4CI0C 2Q0OA 3BJ6A 2X6YA 2H8HA 2E6NA 3WU1B 1JBMA 3I3LA 3I55I 2P0KA 1KD1U 3GYHX 3BOQA 2JS2A 1VQ6A 2H3EB 2GOMA 1YITQ 4U87A 3MEAA 2JA8J 2XRNA 3OYFA 3QUIA 1IRFA 2DD4A 2EIMH 3EUAA 2IRFG 1GRIA 4PJOF 3IRRA 2HKQB 1DQUA 1ZA1B 3MCAB 3RDVA 1Q86C 1NBEB 4XK8E 1J3TA 3CCMQ 4G9YA 5GPAA 2VODA 2OU2A 2JVGA 2JPCA 3JB9D 4RKUE 1HYOA 2AKKA 1ABOA 1PHTA 4ZGDB 1V55H 1Z6RA 5CK9A 1QZYA 3B6CA 3LFKA 1HF0A 1O3TA 5A2QR 1UECA 1QVFP 5CQEA 1SFKA 4EVIA 1FBSA 2JOYA 5D8KB 3JRDA 5LJ3f 2RF0A 2F5EA 2VI6A 3RERA 2LG4A 1D8KA 1MGTA 2WB1N 3K4NA 3O8GA 1ZAOA 1XC5A 5LGUA 3L2QA 1XOVA 2VXEA 2EH3A 2PMUA 4BHPA 2JVVA 1RZ4A 1K8AR 1BJAA 1JRIA 3HKSA 4KFCA 3HSEA 2GBYA 2O8KA 2BVMA 3TOAA 2WBMA 3BE3A 2CSQA 3VRZA 1VQLA 5EZHA 1OCTC 3L00A 1ZLJA 3PIPA 1B34A 2QLZA 2ESNA 1IJWC 2A69F 2DYRH 2E7XA 1MBKA 2MLGA 3HHGA 3E5QA 3KBGA 5BPDA 2WWYA 3CMYA 4LITA 1I39A 5JI6A 1HSTA 1QA6A 3CC7I 4BBSJ 1MUZA 2DTZA 2JW4A 1YX3A 2P0PA 5IHIA 3VODA 2RQTA 3S6WA 4D5CA 1BR2A 2DF6A 5DUIA 3CO6C 4E6KG 3DB4A 3B6AA 5LJ3j 1GVDA 1P92A 2QASA 4ZTJA 4O6JA 4A0YA 5JR3A 4P55A 3CCJI 4KYWA 2RD1A 2A0FB 2VXFA 2HDWA 2M1BA 3K70D 4RTVA 3HRUA 3VS0A 2ZB9A 2G3RA 2A68F 4P5NA 3URGA 4LLNA 2DFEA 3R6SA 3PQJA 2XPWA 1W2BS 2JSPA 2EJGA 1U9OA 2IGMA 4F17A 3PFSA 1OQYA 2V1UA 3QYHB 3QOEA 2K2VA 3NWSA 4IUQA 3WVDB 3CEYA 2DEUA 4M7AD 2K4BA 1S72A 2K02A 4BKXA 3LSRA 2MOXA 1FPQA 1MJ9A 5E1WA 5J1UA 3HJEA 1AVZC 3OYYA 3VUZA 2MC4A 4E7JA 2WSCE 1OLTA 1WCMJ 4B3XA 1VYTA 4C5GA 2W0ZA 4FU6A 1VQOQ 5J6XA 5F1RA 1N75A 1X3ZB 1EJ9A 2BW3B 1POGA 1PP7U 2KRMA 4HVWA 3VS7A 1Y6IA 2IBDA 2IP2A 1FMVA 2ABLA 2Z2SB 4PUSA 2CP7A 2VQGA 3FF5A 1VIFA 2DIQA 4OB0B 4V2GA 5GMKe 3CCUQ 2FSWA 2EYWA 2GBQA 5HY6A 4C0DC 1LKXA 4U0VA 2EZHA 1VQ7I 4XTYA 1VQNT 2LMJA 3BTJA 3RZOJ 2F2WA 2HTJA 3PSFA 1D5YA 2GM4A 1TXQA 4K11A 4HF2A 1FIAA 4MQ9F 4DGWB 1ZARA 2ZMEA 3FZVA 1GDTA 1QCNA 5M9OA 2Z99A 1T0HA 3VRYA 1GVJA 2BZ8A 2XAFA 1Y07A 2ZC2A 4RTZA 1STZA 2RNJA 3HG9A 5DCMA 1X58A 1S3JA 2FMYA 1KONA 3NEUA 3E6MA 4XLCA 1KQ9A 2DBKA 3IL2A 1DGRM 4FETA 1X01A 2L54A 4M72A 1K9MC 4M3GA 3GTKJ 3ISPA 3S1QJ 2DKGA 3UNGC 2PZ1A 2V8KA 2GGRA 3TGNA 2GXGA 1FOYA 4ASNA 2UZKA 3P9IA 3HOZJ 1IB8A 2ED0A 3KEYA 1PUEE 3V8JA 3EGDA 2EYQA 1T98A 2E41A 4M75E 3G4ST 2ELHA 1MDMA 2M0MA 2CV1A 2FBIA 2OCEA 1VQ4A 4UVBA 5HK0A 3MKWB 1M90U 2V4JC 2NLUA 2VXZA 3M3YJ 2K9NA 5IHKA 2BXYA 3GFMA 4J83A 2BBYA 2OQGA 3AT1B 5FO5A 2DMQA 2ETHA 4WXHA 3F23A 2YRDA 3JCMP 2DRMA 2K7AA 1FT9A 4A3LJ 2I5UA 3EH1A 1USSA 2L2OA 3UF4A 3M0RA 1VQ4Q 4J7IA 2C0OA 4LUDA 3KZYA 2V7FA 3PT9A 2CT4A 1UG2A 4KH1B 1YYVA 1BYMA 1H0MA 1D3YA 2KPMA 4PJJA 2QYOA 5KYUA 1SFXA 2ZCFB 3H0HA 5LJ3d 3R60A 2K5LA 2CREA 3GNGA 4FT4A 4DEYA 3BDDA 1W2BA 4LDWA 2R7RA 5DY9A 3E6CC 2H6CA 2OF7A 1RUNA 3PVQA 3DKWA 1S5LC 2TCTA 3QPSA 4U88A 1K4TA 2HEQA 2YUNA 1F1ZA 2MC3A 2L0AA 3HBLA 4D8KA 2A05A 1NK3P 2NYSA 3QJ6A 2YSQA 1E3HA 4A3GJ 3WGHA 4BY7J 1BW6A 2OTLI 3OS5A 4RTUA 2M7BA 5DM7F 2DT7B 3JCUC 1KQ8A 3BR2A 2QEXT 2W24A 3VJPA 3HPWA 1R1UA 3NFCA 4LJZF 2XC7A 2GFAA 1VQ5Q 1WXBA 2VJIA 2VKNA 3I4MJ 1ZN2A 3X24B 2HYJA 5K1YA 1R0CB 3H92A 1LFBA 4OF1A 4LD6A 3K6GA 1X2QA 2X9HA 3CP8A 3RPQA 3G71A 4RMNA 1AT1B 3S2HJ 1YHQT 1ZK8A 2ID3A 3BWGA 2Q2EB 4NOYA 1RAHB 2VT2A 5FU7B 3GLLA 2MW8A 3K1MA 4M77A 2CQXA 4HNUA 3BJAA 2CUDA 4CC4B 2CJJA 1Q7YU 4U0YA 1HW5A 2KXCA 1BN5A 3DEEA 3ECOA 1OR7C 3FXJA 3ONQA 3ZMDA 4L9NA 4N9IA 5F64A 2VLAA 1GBQA 3CCSI 3T9NA 5ILVA 3FDRA 2WV0A 3BY6A 3RYPA 4XKCA 2JZ2A 2AZSA 2LFBA 4KIFA 1Z21A 4BY6C 1XN7A 2DZCA 3OSVA 1VQPQ 4M7AA 3BTCA 3CC2A 5LL6S 2PBIA 1IN8A 3MVPA 4E7SA 5LHHA 3BTLA 5L3CA 3I64A 4CGZA 3M0PA 4OMOA 4BHCA 5KAIC 3CCRA 2HSEB 1WKMA 2VJ4A 4PJOE 1QVUA 2EGCA 2LLKA 3SFZA 4EGYA 3BG5A 1W7PA 2DPUA 3VU3C 1H3ZA 2HBPA 3GZ5A 3GEZA 5H20A 1JEGA 1YE9A 3NAUA 3JTGA 1UGVA 3FJPA 4JJCA 3ABUA 2HNIA 1Q1HA 3SZPA 5KVRA 2RPNA 2AXTC 2QM3A 2YR2A 3R0AA 2XDPA 1E3PA 4XKBA 1WDXA 5GANe 3GCMA 3UPUA 4E7LA 4PCQA 4PJMA 4AD9A 1RAFB 1FBUA 1IXRC 3SEMA 5KYUB 5K5QA 2HGCA 8ATCB 3J80E 4DIQA 5GADJ 1IGQA 4ESFA 3QRFF 2LNHB 2JA2A 2X4YA 1KC8U 3JSOA 2P5LC 3CDIA 5CLSA 2ROTA 1R22A 1NPRA 4BXFA 1N78A 4Q5SF 2XAHA 5GAOl 4S05A 3QXEB 1ZQ3P 2NVUB 2XG8D 3A8LB 4DA4A 4M7DB 3I4PA 4RAYA 2CZ7B 1R00A 3SEQA 5EG0A 1MNMC 3M59A 4C5EA 5GMKi 2FZGB 4EM1A 2XAGA 2RC4A 3W6JB 2E64A 2EFWA 2HZYA 1P6RA 2LKSA 2LBFB 2X48A 4FSXA 3IRQA 3BCAA 1FLIA 4IKFA 2LRDA 2V1NA 4ESJA 4EATA 1CSKA 2BIVA 3UA6A 1M3AA 4AYBN 3DLAA 2DDBA 4UB8C 3IKVA 4AVZA 1YIJA 4JJDA 2L9NA 2QQSA 4ON0A 3JRIA 3E19A 4J7FA 3I55Q 1U5TA 4C92G 2KJBA 1FSHA 3PSIA 1Y0UA 3O3KA 4R1HA 3P9KA 1M3CA 3ASOH 3C18A 3CUQA 4XLFA 4MZPA 3I71A 3A4CA 3PM1A 2O8XA 4JBAA 1G6NA 1GCQC 3SHWA 3BG3A 1BOBA 4Q48A 3ULQB 4CRIA 1T38A 3M9QA 2ZNZA 5F0CA 2VGNA 1MBGA 1IHWA 1N8RR 2PEXA 2KFDA 2Q8KA 3RNJA 1KD1C 2E60A 4XLAA 3ZOBA 3DLLF 3HDDA 2NWMA 2O9VA 3CCVT 1X1PA 5HS8A 5M3FJ 2R7SA 2FEZA 3K7AJ 4BQAA 3ZFJA 5A0LA 4GLKA 3QBYA 2A3LA 4F7UB 3JRGA 5IT9Z 2DPPB 5D5VB 1RPWA 2GCXA 4G6QA 2FZCB 3D5SC 2QBYA 1RAAB 1MKMA 1G3SA 2IGOA 2NUZA 5LJ5g 1KQSS 3KP4A 4KGVB 2LF8A 5FFXA 2FQ4A 4QPOA 2VQLA 2D9TA 3OW2P 1O3RA 1KYZA 2GTJA 1T2KA 1K73U 1N25A 2R58A 5CKTA 4ZDLA 1RQ6A 4JUVA 4LD5A 3RKXA 3VYRB 3NHNA 4Z02A 4XTVA 2CZ1B 2JZYA 2F5CA 4C92F 5GAOp 3KFWX 1AWXA 1MGQA 2M4KA 2PNIA 3DXJF 1UG0A 3VWBA 3ZCOA 2D1HA 1ZRDA 2HPIA 3KX2A 4A69C 4M6YA 1H9TA 4DBQA 2Y0SN 2VQCA 2LSOA 2QSGX 2WSFE 4OAYA 1A04A 2DZ9A 3CPFA 2ROLA 1JUSA 3KFVA 2C6YA 3PL8A 4DBHA 2L9SA 2NNYA 2EKOA 2KI7A 2VGMA 3BPVA 2YU9J 3JB9G 5HLGA 1B9MA 2H6BA 2P7CB 2XKOC 1R71A 4QQDA 1LQ1A 3F9KA 4MDXA 3H35A 3META 5KYYA 3CC7Q 4IRHA 4XSZF 3GVAA 4G8XA 4NC7A 2ECBA 2JVHA 5JVGF 1G59A 2OQRA 5FWCA 1YITT 2PMZN 3KZIC 4L59A 4A6DA 1WA7A 2E65A 1LDJA 4ESRA 2ZXWH 3CCJQ 2DA5A 3R61A 4RM2A 1QVPA 2GAUA 1IG7A 1QP2A 2BEOA 2M51A 3I59A 4EJOA 2ZCWA 2JXBA 1PRLC 2FBHA 2VC8A 4DBFA 1Q81U 2JM8A 2GZWA 3CCMT 3ZQGA 1S7OA 2A61A 5D5UB 2F5TX 3CJTB 2MG4A 2PI0A 3WGGA 1ZTRA 4HEA2 4CUGA 1C1AA 2IW5A 4OAZA 1ZX6A 1UGPB 1BR4A 1K78B 5HDNA 2RKHA 1LFPA 2HOAA 5F04A 2CP3A 2KRNA 1G2BA 2QTVA 4M75A 4DW6A 5E8IA 2BHZA 1Z3YA 3JB9F 2EFQA 1K0XA 2HKOA 1VQ7A 1KK7A 2R7ZJ 2HCKA 3KCCA 2MMPA 1XSVA 3LSGA 3TSZA 2WV1A 1IZ6A 2RQQA 4QSHA 4BGDA 3G6EI 2JS0A 2VUBA 1RKTA 1KQSA 3PUFA 2JN6A 4IPAA 4YIIA 1KHCA 1XJWB 4G7ZF 2CQNA 1L3LA 1ZBXA 2VWFA 4JX5A 3EHQA 4OIOF 2M35A 4Y91A 3FXUA 1QVTA 3IH3A 4I99C 1WH7A 1Z0XA 2DYSH 4JK1X 5K7HA 2RQPA 3KZZA 1BC7C 3J80Z 3L2WA 1J59A 1JXSA 1VUBA 2NUTA 3A02A 3WODF 2KISA 1RLPC 3MPUB 3GO5A 2DOFA 2WAQA 2ZSIB 5E8GA 1XGSA 2FOWA 2R5YB 4HA8A 2VOPA 4J6YA 3C95A 3VYGA 5GP9A 4EPCA 5L3GA 1B72A 1D3BB 4C3JJ 2XMFA 4M7AG 1Y1WJ 4UVCA 1RC9A 1SVLA 4LNPA 3A1PA 2ZXHA 3BR6A 3GMEA 1M1EB 4ZZDA 3BDUA 4HKEA 3PO3J 1QKWA 5LJ3h 4DOVA 3ZN0A 1ZQ1A 1VQ6I 2OUMA 2KVQG 2VKDA 2KIUA 3SDBA 2D5VA 1IAWA 4A4KA 3A0BC 1X6BA 2ZAEA 2KT0A 3EGXA 1K4SA 4XN0A 4PLIA 2XGCA 1M1KU 3WGIA 3E6BA 2KIQA 2V6EA 1EFNA 2M4GA 4RGXA 1SD7A 4ESBA 5ED4A 1ERDA 4KGZB 1P9QC 2NVYJ 1TWAJ 4ELZC 4AVPA 3C2BA 3JRCA 2DD5A 3J81E 3KLNA 3I4NJ 4A3KJ 4FT8A 3HOSA 5IP6A 3MP1A 1M90C 4CSWA 3EFSA 5E3OA 2BVLA 3W6VA 2E35A 2RJDA 1UHSA 2IGNA 1VQOT 3UDCA 4ZGEB 2KDSA 2JJ7A 2XUBA 2B9SA 3TW7A 1UHMA 2D45A 1XSDA 2NS7A 4LG0A 3QWLA 1J75A 2RHUA 3QO3A 4XU3A 2ZNYA 3VPRA 3W2AA 1I1GA 2CZ6B 4GYIA 2HQEA 2GLOA 5ICEA 5ICGA 3K0LA 2XSDC 3CCUT 1NYFA 2VKEA 3E5UA 1TBXA 3QZ5B 3VYHB 1ZHFA 1NJIU 2SEMA 2PG4A 2PU9B 1RAGB 2RH2A 3INZA 3ZQFA 5GJVB 2OTLQ 3MKDA 4LLGF 3CBOA 3REBB 3CUOA 5GANh 3CC4A 4C8QB 2Y4YA 3F8BA 2FNPA 4GGGA 3ZMVA 1YFHA 1UGQB 3HOVJ 2MWOA 2JQ7A 3A8MB 3OYKA 4PJOA 2DJZA 3VS1A 2ZBKA 4IO9F 5CR2A 5DYMA 3I56A 3CDLA 1VQLI 1J9IA 2E4HA 2Y90A 3NPFA 4M78B 5CKDA 3QP6A 4ZYAA 2CQQA 3GTOJ 5M5XJ 1L0OC 4MNUA 2HOTA 3GTPJ 3LWFA 1LVKA 4XTUA 1YI2A 1YX5A 1F5TA 2F1LA 2V9PA 5GAMd 2EJRA 3FXMA 4Z2YA 5KCOA 2M9UA 2Y69H 3EUKL 3HUGB 2K9MA 3NARA 4IOCF 4L5EA 3G7ZA 1TWCJ 3CQTA 3NGPA 2G6FX 5DLQE 3UT1A 1PD0A 2PN6A 2LJ1A 2NUPA 5EEHA 1PKSA 3CMAA 3H3VK 1KSWA 5LHGA 3CMMA 4BI4A 1QQJA 1U3EM 4N9HA 1A6IA 3CCSQ 2EV5A 5I2MA 2LYCA 1XPXA 4Z88A 1VQ4T 4HSTA 3CCEA 4FYWB 2EILH 3DU6A 5E1XA 3WXMB 3ZPLA 3S3OA 1Q7YC 3M4OJ 3BT9A 1SHFA 4CA0A 3BR5A 3WU0A 2KIMA 2KGTA 4J9GA 4OB1B 5GAMe 3OSGA 3HYIA 3QWXX 4HSRA 5A0GA 1S72I 2E1NA 4ETSA 1FXXA 4IHSA 2CP6A 1QP3A 1D5VA 1GXQA 4HCKA 3K9TA 5ILUA 2JUGA 4P5OA 3OIPA 1N9SA 2DBBA 2WAFA 5KYXA 1IN4A 4XTWA 4FTHA 2LY9A 3LMMA 3M9AA 1AEYA 4UXNA 4R79A 4OINF 4C2UA 4JLGA 1K61A 3DB3A 1O57A 2ECZA 1Z6TA 4BYYA 2X4HA 5IT9K 3MP6A 4XQFA 5GAGJ 3CD6A 1VZ0A 5E1ZB 2SRCA 1OR7A 1NH3A 2EFOA 5D5XB 3SB2A 4FYYB 3JAMK 3IAM2 3OMYA 4FHTA 4UUTA 1LOJA 2LZ6B 2PLYA 3A8OB 4B6MA 3QKJA 1VQ5T 2VB6A 5DM6F 2FVUA 5IP9J 5EGOB 1RIOH 1T0JA 1QHGA 1FTZA 2L3SA 1XMXA 1XGNA 5CKFA 3F72A 1S7AA 3FXQA 2XI9A 5EG2A 1YCSB 5EDNA 1R49A 2ADUA 1I4K1 1KC8C 4PFOA 4Y92A 1X3WB 2D8HA 1AKHA 2DMTA 3M07A 4I01A 3FMSA 1DJ7B 3ZQLA 2V1DA 3BFMA 2PUKB 2FMLA 1BCMA 1G3YA 5KNLA 4CC3A 1YJWA 4RS8A 2CP0A 4AFSC 3FWEA 4X1EA 3MCZA 2L7KA 2C0TA 3JRZA 3AG4H 3JSPA 1RI7A 2TRTA 4LLLA 1ZUKA 3P8HA 3J7YJ 1VQPT 1PM3A 5E79C 1HA8A 4IUPA 1IRXA 1F43A 4Z6YA 2NUPB 3KETA 3C12A 5IP7J 2X51A 4M9XA 2X4WA 1FYLA 2YLCA 1RABB 2IIMA 1W1WE 5CKHA 1OX8A 1SD4A 3WTSC 1X1BA 2DK8A 4MQVA 4MTEA 1P7IA 1VQKA 3HOXJ 3J81Z 4P9UA 4CYCA 1ZRCA 2P8TA 1Y56A 3ELKA 4M9SA 2R0QC 3SQNA 2O9LA 3FMQA 1MMGA 4NQWA 3BR3A 1RETA 5E17F 1O75A 1RAIB 1YJ9A 2LC2A 1ABQA 3LSMA 1BBYA 2J7IA 4Y17A 1W70A 1RACB 2X9DA 2KQWA 3A8HB 2K6DA 2H1KA 1TWBA 1DUXC 3PQKA 3ZQQA 4HLYA 4ZTFA 4IHVA 4OVAA 1MNDA 4F04B 4BJ5C 1DP3A 2O03A 3ERED 2A6HF 4RCBA 3ML6A 5TJJA 1GCQA 4UB6C 5FU6C 4X9CA 3L2ZA 4A3FJ 2DETA 4IRIA 4C8QF 3N97A 2KZVA 2LKPA 2NS8A 2Y2ZA 1YO5C 1K73C 2HXOA 2M8EA 1CQTA 3LAPA 4YELA 3JCMc 2DDAA 5CVRA 3MKYB 2RM4A 2YPRA 3G71I 3J80K 4IHXA 3JREA 5CJ9A 1OEBA 4RDUA 2LQWA 2DLLA 4KIBA 3I55T 1MV0B 5DEQA 5HS7A 4HDVA 2HMAA 3JB9J 1OZ2A 4QIWN 1WJDA 2P6SA 4RUGA 1KG1A 3MN2A 1FEXA 3N4MA 2XPVA 4E70A 1YJNA 1Z77A 1RAEB 3TSWA 2YUOA 3KUFA 3RSNA 2FUG2 4BI8B 1D0YA 2L4MA 1YBYA 4LN2A 3H0FA 3ZQ7A 2P6TA 3CC2I 2MIOA 1VQ8A 5CQYA 1E3OC 4MZMA 3SHFA 3DTIA 1KFZA 4MGRA 3BTIA 3CCRI 4ELYC 1HJDA 4KULA 4ZDPA 5C44J 1VYUA 2DFFA 1WJRA 1I6XA 1V3FA 1WPKA 2MLKA 1IO2A 1PRMC 3GFIA 4A3IJ 3MWMA 1Z9ZA 1UB9A 1GV5A 2VYTA 2UXNA 2L9VA 1QZEA 3ABLH 2E36A 1QCFA 4RA2A 1IGNA 2L2PA 4C5IA 1Q81C 1TWHJ 2HR3A 1M1FA 5C6SA 2K9GA 3H3ZA 4A3EJ 1K83J 2MD5A 5F08A 4LIUA 4DYCA 5LGTA 2ME6A 4X0GA 2R5ZB 2ISZA 1K6OA 2LVSA 2IT0A 3FKIJ 1HOMA 3ASKA 1K8AU 1QPMA 3G6EQ 1IRZA 2MCNA 2HAXA 2HOSA 2RVCA 4GBQA 2UWMA 1X75C 1MIJA 1W36C 3O2PE 3RMQA 5HODA 4OIRF 4E4HA 1C6VX 4JZ4A 3RESA 5GMKj 1K6YA 1B8IB 2ZPGB 2LJ0A 4RTWA 1NLPC 4ZJZA 1EIFA 2LNVA 5IYBJ 4YTLA 1U78A 3MZYA 3CP2A 2DMOA 5F0FA 1UGSB 1OOTA 2EFPA 5FKKA 3P7NA 2E70A 2XKPA 3MKZA 4B9WA 2CGHA 3CCQA 1MBJA 3PNTA 3CC7T 3M8JA 1YIJI 1NLOC 1ZSZB 2RK2A 3UKGA 2X85A 3H41A 2GIVA 2EPDA 1FMKA 2AQFA 3JW4A 3EUHC 4IEJA 4NUBA 5GPCA 3MMYB 1J5YA 2CKKA 1VQ6Q 4UHTA 2KMTA 3ZEHA 5GANd 2KHMA 1TQMA 4LUEA 3KPHA 3CCJT 1TWGJ 4IIOA 2DJQA 4N4NB 4R55A 5IYDJ 1SEMA 2X3XD 1CF7A 3Q1JA 3VDXA 3NTIA 3JCMb 2OZUA 4KT5C 4KMFA 1UTIA 4A54A 1OCPA 5JHUA 4N4OB 4M3DA 4Y33A 3MEVA 3J7AY 2J06A 2COMA 2LK2A 1U6GA 2MGQA 2V9KA 4PJLA 1QWEA 3QIIA 3HRTA 2XSJC 3TDUC 4CZCA 2RI5A 5E20A 1LJOA 5DCFA 1TUCA 2ZGWA 1YNZA 2V6CA 1XB4A 3F6VA 5IT3A 3FC3A 4RTTA 1IDZA 4CCNA 2DL5A 2M87A 2MA3A 5FKOA 1M1KC 2JRMA 3RBBB 1Z3XA 3G1LA 4XLPF 3RKYA 1UAAA 2HEOA 5LJ5e 3T8TA 3VYSB 3EG9A 1Q82R 2HWVA 2QQAA 2DTHA 4G7OF 1UUEA 1KQ0A 5D6YA 5GMKl 2A6EF 3QODA 3I5SA 5GAMh 1VQMA 1HKSA 2CFOA 5CO7A 4TVRA 4RGRA 4UV8A 1N77A 3TEEA 4EMKA 3JCMJ 2LREA 1VQ7T 4FISA 2KQRA 4C2TA 2KK4A 2QK0A 2E2HJ 4MLOA 2JSCA 1LNXA 1IUYA 2QSFX 2F5VA 2M02A 1QVFS 1FX7A 4WF2A 2QTXA 3EH2A 4C8QC 4BD3A 1ZLKA 2K3FA 3MO8A 4J9BA 4L9TA 3BROA 1OPCA 1B7TA 1VQLQ 3CMEA 2RI2A 3VEPA 3DLLA 3BCBA 2DJIA 2K5IA 4F14A 1LVAA 1S9HA 3IWZA 2HVQA 4IHWA 4L18B 1WI7A 4I76A 5DLOA 1NJIC 2YRVA 1QRYA 1T3SA 3OYMA 1SMYF 4H4KC 5LRSA 5E3NA 1XMKA 5J40A 1PWTA 3AL0C 2H8WA 1ETVA 3FBNB 1R0BG 2D0QB 3BDLA 1WJFA 1OFCX 1XCVA 1KIKA 1XCBA 2CV0A 1DPUA 4M6XA 1WHKA 4HVUA 3ZGKA 4II2A 2CYYA 3KE2A 4EQQA 3EYIA 4GFBA 2JRTA 4J5YA 3RI4A 5GANf 2P84A 1WX6A 3MD2A 1PSEA 2JA7J 4C92A 4BNCA 1W5TA 3A98A 1HXDA 2VN2A 1APLC 4Y15A 4IUVA 2HXIA 1J2XA 1WHUA 1YTYA 1UMQA 1TS9A 2JA5J 2H8RA 2IS2A 2DXCA 2G7UA 1UE9A 5I11A 1S72Q 1AWWA 4QQ6A 1OX9A 2VBZA 1ODDA 3LAJA 1W0TA 1EA3A 2V9VA 2O7OA 5IOYA 3B73A 3PVLA 2DA3A 3ABKH 2QZ8A 2DA6A 4A3BJ 1Y8QB 3KP6A 4MIMA 2N8GA 2DRKA 2FOKA 3WG7H 4B44A 3DEUA 3FBIB 2VUMJ 2ZFUA 4DBRA 2IAIA 3H8ZA 3J81K 2RJCA 1IV6A 2DODA 3OOPA 3E9GA 5GAN4 4FL6A 3CCQI 5GANj 2OTLT 3LSIA 5KE2A 2DQLA 2R4GA 2XB0X 1B1BA 2HVSA 1TT0A 3H9GA 1JGGA 3CBPA 3EG9B 1V29B 3SWNC 1R77A 1AWOA 4E7KA 5CVJA 1LPLA 4MMKA 1GXPA 1H3HA 1UHWA 1W4MA 2DIGA 3HSBA 2WTEA 2ZPFB 3KP5A 1GFDA 5J39A 2DA2A 4EM2A 1GBRA 4EMKB 2JK3A 3CLOA 1QVFA 2MUNA 2D2WA 4HPQA 3TMOA 2YXYA 2XU8A 4KT0E 2KR3A 4C8QE 3EFOA 3DCFA 1B34B 1WLPB 1OCCH 4I02A 3DBLB 5FJ8J 4L6V5 3FMRA 3VS3A 3JCMd 3KP2A 2GIZA 4C0FA 2EW3A 3LA2A 1F4KA 3A01A 1E2XA 1ZG5A 2CP5A 1IRGA 4M3BA 5FLMJ 3CCST 2AXLA 1A36A 5LGNA 5E18F 3IH4A 1UFFA 3DPTA 5E3LA 2FHDA 2QA4A 5IT9E 2OTJA 9ATCB 3JCMX 4Q5WA 4DOZA 3L1AA 4MTDA 1OYYA 1B6AA 1SD5A 2CW0F 1P4XA 2PQWA 4ZGJB 4OU0A 5CYVA 3T0YA 3JAME 4XRMA 2DA7A 2AQEA 1MSEC 5FLXK 1YLFA 4M6VA 1G3WA 3ABTA 3W2VA 3UR3C 2DEQA 2DL7A 4C3IJ 2EPFA 3JCMe 2R7QA 1JI8A 2PUOB 4C92B 3L2VA 4IQ4A 3L09A 5J8FA 2WACA 3RYRA 2DL3A 1M30A 1W36D 2K40A 2WA0A 1R9TJ 3A1YA 2A5WA 1BIAA 1UG1A 2V1RA 4WK8F 3TP3A 4IZZA 1SFUA 2X4XA 3LH5A 2I0NA 1WGSA 2X6XA 4XNFA 1PVEA 1ZGWA 3CESA 5J1RA 2VV5A 3R0JA 1I81A 2L9RA 4GXOA 3CC4I 4XU2A 1TTYA 2NOGA 3PIOF 3J7AF 2W84A 3EPZA 4OGCA 3I56I 4BE0A 2YUPA 2GQQA 2MBFA 4ZYHA 4DEXA 4G6TB 2ZMEB 3QPLA 3S1MJ 3OL3A 4B4CA 1OKRA 1LCKA 2VIXA 1AZGB 4OMZA 2XDBA 4RLFA 3WE3A 4HRIA 1DU6A 1YI2I 2X6WA 1P4WA 5DCMB 3NTKA 1IF1A 1IHVA 3G71Q 4DYRA 3SZGA 3LNQA 3HPGA 2AKLA 1CKBA 3HIFA 4XICA 4XBFA 2JJ9A 1WFWA 3L9FA 4A0XA 3A2KA 1KYWA 2P4WA 2MK5A 4IF4A 4XN3A 3PFIA 4HBLA 1VF9A 2QGFB 2EQMA 2WB1A 3CMAI 1XMAA 2W10A 2BE9B 1DGWY 1E6GA 2FEIA 2LT1A 3KLOA 3E5XA 1T8IA 4BXXJ 3EGDB 1MDMB 4A63B 2HL5C 1N8RU 4CDGA 2FBKA 3EFOB 1UJ8A 2O88A 1OYIA 3KP3A 5M3MJ 3MEXA 7AT1B 3CCEI 4LK0F 1FYKA 3DKYA 4UNOA 3NMZC 3M54A 4M9ZA 5FLVA 1S7EA 4QVZA 4DJAA 2EYZA 3CC2Q 3WTZA 4BAYA 1QNTA 2ID6A 4R8HA 4KNYA 4XORA 3M53A 3PO2J 1IUFA 3CCRQ 2DI3A 2DOAA 2K7LA 2V26A 1LE8A 1I50J 1OISA 3M0SA 2L4AA 4EM0B 3AG2H 2FX0A 3ZQHA 2EB7A 3MQ0A 4A3CJ 2MYSA 2JN0A 4YIFA 1JUMA 4IL6C 3LFUA 2CGPA 2WAQN 2JMCA 4N4HA 4XU0A 3REAB 1OPLA 4C8QD 3GBQA 5ECAA 1J0RA 2QWWA 3IQLA 4BEHA 3F21A 5J1YA 2C0IA 2HNHA 5IN1A 1T39A 3CD6I 1YQAA 2XF5A 4FX4A 4MFEA 1ETKA 3HPHA 1K7AA 4XOPA 4RG8A 1UELB 3IC7A 1USTA 3GLXA 3ZR8X 2XPUA 4KH0B 2JUCA 4F16A 5L23A 2RNAA 2LY1A 2X6OA 5FRNA 5CCAA 4CICA 3K2ZA 2BKDN 1BCOA 4AIDA 4U0WA 2FRHA 2O2OA 5EF6A 1W4SA 1X2NA 2O61A 3E9FA 3I5RA 2ATCB 2EKHA 4HLXA 1K8AC 4PKCC 2YT6A 3CCLA 1AZEA 2E3IA 5LD2C 2VL8A 1KU7A 5EEAA 2LX7A 3LSPA 2BV6A 4BI3A 2Z1DA 2ENMA 2X98A 2FZKB 3CCYA 1SAXA 5DDGA 2CWEA 1JKQC 1UHFA 3LH0A 2HQRA 1ZUYA 1JJ8C 3OL4A 2IG0A 3M0UA 4BY1J 4R56A 1YIJQ 2L01A 2FPEA 4HOBA 4JZ3A 4M77B 3HM5A 2OJ2A 4CCLA 1YJWI 1AU7A 2OV7A 3ABMH 1AD5A 2DM1A 1QVGP 3OYJA 1G2HA 1KHIA 1G3TA 3OSSC 1TZLA 2W48A 1PG5B 2XV4S 4KISA 2VPLA 1WHLA 1QKXA 3F0CA 2VE9A 4CCKA 1A35A 1JHHA 2LOOA 3CTAA 3CLQA 3I53A 3ZN1A 5FGMA 4XRSA 2KE9A 3L2CA 4M7AB 3K4JA 1TP4A 3EG1A 3N5BB 5B5EC 1Y57A 3ULRB 2CDTA 2DVEA 4LGWA 3HTRA 3BJOA 2E34A 4ZH4F 1A0NB 2VKHA 3Q0VA 4BL0B 3CF2A 4ENKA 3JAMZ 2DXTA 4ABZA 1VQKI 2NRAC 1W7PB 5F6FA 4NL3A 3HGGA 3RJPA 1SAUA 2E5KA 2B63J 1QHHD 3OYLA 3P8BB 4PSWA 3VFZA 4N4IA 2VBWA 4GDFA 2H09A 3BZKA 3MZ8A 1YJ9I 4J9DA 1M8MA 2DT6A 3V42A 5AONA 3G6ET 2J05A 4XQ3A 4KT6A 1OULA 4EIKA 3R6OA 5GMKh 4I0BA 3HRSA 5GAOr 2NAZA 2ZXJA 4UUSA 1Y1VJ 1N6AA 5A2QE 1ON2A 4Q47A 1U8RA 4HW0A 1MMNA 2HDDA 3KXTA 4G6DA 1DPRA 4TV7A 2H94A 2RHZA 1OCZH 1EZZB 3OW2S 2K85A 2HOEA 2HVRA 1TU0B 2A7YA 5EG0B 2QAZA 4DOWA 2EZLA 3LQQA 4P1WA 1JJ6C 1JJ2P 4U7BA 2QQ8A 1KA8A 1U3OA 5GAMf 1I1SA 4P96A 3ZMZA 3FDYA 1IC8A 3E6DA 1VQ6T 1Z67A 3OYDA 2YS9A 4O3MA 1B3QA 1SMTA 4I7HA 4LG3A 2IVMA 4ZZLA 2ZJQF 4V19K 3GOXA 1U5TB 4KDPA 1YJNI 1OQKA 1VA7A 2IA0A 2RREA 5HNHA 2IEKA 3OA6A 3F70A 4OMQA 1UCRA 1OU9A 3CUQB 5EEGA 4DZJA 2AT1B 4L5IA 1VQ8I 2K2MA 3A8GB 1WHGA 4JOMA 4F7ZA 1TSFA 4IUTA 2ZZDA 4QQGA 2W25A 4N0BA 1X43A 2KNBB 2W7NA 1YWOA 4C8QA 1G5VA 3MHXA 1HQCA 3H36A 1QQIA 4EJVA 2EQUA 2RMOA 2CP2A 6AT1B 3DKXA 2EZIA 3HXLA 5F1JA 1GXIE 2J5PA 4C30A 1A31A 2FQ3A 3TQ7P 2KIFA 2P7VB 3JRBA 2DAQA 3GXOA 3NTHA 2CG4A 3I0TA 3LSJA 1W0UA 5GAMj 2H27A 4LMYA 1AHJB 4EJWA 2KMUA 2QBYB 1TLHB 5K7FA 1S8NA 2ZKZA 3BG7A 5ICFA 1RUOA 5GAN2 4Y7NJ 1I5LA 3KEOA 1I27A 3Q5FA 3JCMh 3HP9A 2M2EA 2JMAA 4J8OA 4MMLA 4IHTA 4CC7A 3CCQQ 3SYTA 2GXAA 1Q95G 1MW7A 2CS3A 2KDZA 4L0ZB 5IAYA 5LEJA 2HYFA 2XGXA 3OYIA 2RJFA 5FW9A 3DPUA 1VQLT 4M3EA 3M56A 4RAFA 3HRMA 4QPQA 3AG3H 3SDZA 1YRNA 4NB5A 1HBXG 2LY2A 4FYVB 4EJTA 4QW2A 5IHNA 5IH2A 1PJRA 2DAOA 2NNNA 4I0AA 4IOAF 2RQWA 1V5EA 4PJ0C 4OB3B 2RA2A 2NYXA 3T8RA 2K4JA 4B47A 2LP5A 3WVEB 3C4SA 3DBRB 2LTPA 3BP8A 3OW2A 5FKNA 1RLQC 2A28A 1BC8C 2PJRA 4Q4ZF 2KRSA 1HDPA 2XRLA 2MSYA 4HX4A 2LX9A 2PQ8A 1TUGB 5KYYB 1I0CA 2LQKA 4EMHA 2ZFWA 2QQRA 4AIKA 4OGEA 4M7DF 2OA4A 4KA4A 2DTRA 2JTVA 1AOYA 4F7UG 4ZYDA 2VE8A 2AO9A 2DLPA 3A0HC 4G7HF 4D8DA 1CGPA 3A03A 1BI2A 4EMGA 3I59B 2HYGD 4HNTA 3RMSA 2K9QA 1PUFA 1U2WA 2YU3A 3ASNH 3K1PA 4XM3A 2G9WA 4OMNA 1GLNA 1D8JA 3SFIA 1FOXA 1S72T 4NNJA 3DTKA 3CPWP 3HL8A 2M8GX 1HLVA 1OI1A 2HDCA 3GNFB 4GY5A 2D1XA 2ZO4A 3H9QA 2EAYA 1H641 2LNBA 5D6EA 4BE1A 2CH4A 3HL2A 1ZGAA 4X6AJ 2KJCA 1VQMI 1KU2A 1BBZA 1K79A 4M75B 3OYGA 3UWNA 1C0MA 2Y4XA 2XDDA 4CHUA 3CXCP 2E1MB 4F3QA 3K4MA 2UV1A 1OYWA 1VQNA 2EA2A 4FYXB 2IPQX 4J9IA 4XAXB 4Y52J 3M57A 3CC4Q 2GWRA 2K4YA 2BY0A 1HSJA 4XTZA 1Y96A 1OPKA 2R57A 2XICA 4F7UF 2AS5F 1RUWA 2FU4A 3OMGA 2DW4A 1R1TA 1FYNA 4AFZC 3FEOA 1AWJA 4FM4B 3I56Q 2P4RA 1T56A 2TDXA 3OS0A 1YW8A 3CMEI 2HL3A 3D1NI 2NUTB 5FLXE 2A08A 4DNCA 2HSPA 2XF7A 5LJ3g 5A2QZ 1PKTA 1WNLA 2ESWA 4YG2F 3BR1A 2J6OA 1YI2Q 1MHNA 2PFBA 3RIRA 5EYRA 4XRSG 1B72B 4YFKF 3W2WA 3QPHA 5KH6A 1I07A 2HQXA 3G4SA 4WCIA 4IX7A 3Q0UA 1M4ZA 3GZNB 1YRNB 1MMSA 1Q86R 3CMAQ 1WYXA 4AG2C 2CUZA 1H89C 2KLOA 5GAN7 4JX4A 1TNTA 3DU5A 1IXSB 2XAUA 3EGXB 4AFUC 2OAWA 1TQPA 3QWYA 3GZ6A 3CCEQ 1OZ3A 3M0QA 1P7JA 3QDRB 5FU7C 3ROUA 4LDUA 2ZMEC 4D6WA 2HQNA 2LQ8A 3FXKA 4PK4A 1I8FA 3E97A 2RGVA 4XL9A 3LX7A 4FW2A 2ZPHB 3VKIA 1IV8A 1KQ1A 4CO8A 4AT1B 3M58A 1R4MB 1MZBA 3TO7A 2KT8A 1X3UA 3TU4K 4BE2A 1YFNA 1N8RC 3PFYA 3BQYA 1VI0A 1WH5A 3RCOA 1WZOA 1BI0A 3QDFA 4C0ZA 4I98B 3X2QH 2K3BA 5J4YA 1NK2P 2PMZA 2HTSA 5HLIA 1EF4A 2FO0A 3CJQB 1PYVA 3WTUC 4LG0B 4CXFA 3OYBA 5GANg 2ZXIA 3IV5A 3CD6Q 3PNVA 2DBMA 2X1CA 3SXYA 5JLWA 2KRCA 1V76A 2GNCA 3PGGA 2P4TA 1JTXA 2A3SA 4QWQA 1FYMA 3EG0A 3G1JA 1FJLA 4Z8AA 4A5NA 2JM9A 4CCOA 2QEXA 2ELJA 5BQTA 3JV3A 4OB2B 1MBHA 2BZYA 2JT4A 4RTYA 5FWBA 1S29A 1SFEA 2VJ5A 2I2LA 1SC7A 4Y3OA 2KAFA 3H9JA 1MMAA 4PJOB 3ZMTA 2M0YA 2QUFA 2ELKA 4BDZA 3S8PA 3TL4X 1WSUA 1BIBA 3I9QA 4MHGA 1XQHA 3H5AA 5KK1A 4UY8I 2F5KA 3L42A 3G71T 2M0CA 1O7LA 3K69A 4HF1A 5IT9R 1YHQA 1P2FA 2CUJA 4ENJA 1M2OA 2O9SA 4AG1C 3SZTA 1PDNC 1F1BB 2E1HA 2EIKH 3JB9I 3K4BA 3JAMR 2DCEA 2L7MP 4GCVA 4C8QG 4M7DC 4LFUA 2HBWA 2JNGA 2Y9ZA 4HVVA 5LJ5f 3CQZJ 1FOKA 1YJWQ 2QA4I 1UDLA 2OTJI 3MZHA 2GTOA 2HDAA 4RG2A 1F36A 5DD8A 2QDLA 2D8JA 3CC2T 1RRJA 1HKQA 1OCRH 2KSSA 2VASA 3V7RA 2P5VA 4OMFB 2LH9A 1XNIA 2DYIA 2R5AA 4PNOA 3CCRT 3FM3A 3M7GA 2ZJPF 3J7AO 3QYGB 4M3FA 1FNNA 3I5UA 1LNWA 4F52A 5K7ZA 1SRMA 1JKPC 1Y7XA 1F9NA 2CFXA 4LD9K 1VQKQ 2ZJRF 3L2RA 4HCBA 2IPOB 4G12A 2BE5F 3TQNA 4M77C 5J3BA 1ETXA 2BZTA 3CJRB 3ECHA 2K3YA 1ZYRF 3S1RJ 2KROA 5KYXB 3M55A 4M78G 4A3JJ 2G7HA 4B3AA 2XAJA 5DD4A 5JFRA 3C7JA 4RB3C 4G94A 1GHCA 3ME9A 5B66C 5AYFA 2VT3A 2V79A 2STTA 1QO0D 1R7JA 2K9LA 1O3QA 4EMSA 4UC4A 3C2GA 5HS9A 3LQRA 4M73A 1SPKA 5LJ5j 4XMYA 4KRTA 2M45A 4B43A 3WHCA 1AHDP 1K9MR 2MWPA 2M34A 4HNVA 3TOBA 2DNUA 2EFIA 2QSHX 3PJRA 2XHCA 5LBQA 1N27A 1SVMA 3AKZA 4QVDA 1WVRA 4OWRB 1WI9A 2AIRB 1V5GA 1NHAA 1X4OA 3E7LA 1V4RA 4IXAA 5TGTA 1M9SA 4BY6B 3AAFA 1MBFA 1IREB 3EAEA 2FNAA 2KRFA 4AIJA 2LVMA 3OBWA 4HF0A 2FA5A 3TO6A 2DFUA 2PMHA 3OV8A 5GAOm 4KBMB 1YIJT 2FXAA 1Y0MA 2XGDA 3GP8A 3C3WA 5FLXZ 4NHJA 5IYCJ 1D09B 4HV6A 3HKZA 4D0PA 2Z33A 4FQGA 1M5Q1 3QOPA 2RQVA 3BW1A 1FC3A 1HD3A 4BACA 1AKHB 1X6GA 2IA2A 2LMDA 3J7ZI 3GTMJ 1IDYA 2DJNA 1ETYA 4II3A 4LOCA 2E10A 1BB9A 1X6OA 4M78F 1YJNQ 4W97A 5M5WJ 2F4MB 1R1VA 3OIQA 2QI2A 3DPLC 4BJ6C 4LDVA 5CQXA 4RLQA 2ESHA 3PIOA 4M7DE 3LA7A 3J80R 1VQ8Q 3BG6A 1EKEA 5C4XJ 2DMUA 1DDNA 1TQIA 1ZLMA 2K3XA 4OOIA 3KP7A 3CCVA 3WTVC 2AHQA 5TRDA 1ACIA 2HZDA 1Q82U 1EH7A 2XKOA 2FF4A 5FFZA 2OAZA 3WU2C 5FB2A 1KJWA 1Z91A 3OY9A 4V2FA 3JRAA 1WXUA 4NS5A 4ITVA 1ZRFA 3CJNA 1ZKGA 4JRKA 2DA1A 2PVOB 3QQAA 3DV8A 4CYCB 1U5TC 4NL2A 4UV9A 1LPQA 3W6KB 1UB4A 4OIQF 3NQOA 1K1ZA 1FP2A 3F8FA 4NQWB 1OMIA 1IN6A 4J01A 1ZG1A 2R5MA 4HZFA 2CSOA 3X28B 2BY2A 2MZ4A 1HSQA 1QCOA 3K2AA 2QQ9A 5D5WB 3F8CA 1PCXA 3BQZA 2F6CA 3ZMUA 1WIEA 1XDUA 3REOA 4RBOA 1JKOC 3F8NA 2JUFA 2YWWA 4KJZA 4KN7X 2L3RA 4MDWA 2CO5A 4ZYEA 4F7UE 3CCLI 1H88C 3E2UA 3GUDA 2EV0A 5LJ5d 1W5CC 2IA1A 1JT0A 3QAHA 2EINH 1LJ9A 2HQAA 2ZPIB 1VQ9I 2CW8A 4E7HA 3DLMA 3LGLA 3JCMf 4ZN3A 1YITA 5FD6A 5A2QK 1IN7A 1T08B 3EETA 1NE8A 1UJ0A 2COBA 2ZSHB 3PMIA 3V8KA 3LLRA 2YSRA 1M27C 2FRWA 4IVNA 1ZG3A 2NVTJ 2NOJB 1YOVB 1KU3A 1XX5A 3GW2A 3ZXSA 3SJMA 1R58A 3CCMA 2Y9YA 5LFAA 1N9RA 3K4KA 2DL4A 3S2DJ 1T0FC 1R23A 2EQKA 2FL7A 2XASA 4BQNA 4XU1A 2QQBA 2FB7A 1VYVA 3KYLA 3S16J 1GL5A 5H2FC 4ANJA 2JMWA 1QGPA 1NEBA 1MMDA 1ZGJA 3OBYA 1B59A 3DEWA 2BW3A 2MFZA 3HOTA 4L9VA 4LDYA 3H0GJ 2OBPA 1H8AC 3HHTB 2E71A 2XIDA 2XROA 1IGUA 2X1EA 1YP5A 2FYKA 3MEUA 4OMLA 3V7SA 3BPXA 4LK1F 2EJFA 4OIPF 3AG1H 2YDLA 4N0AC 2E1CA 3V4GA 1VQMQ 2K9SA 2CV2A 4JLIA 2R7DA 5HVQC 3GTQJ 2F5DA
chains in the Genus database with same CATH topology
3I54A 2E5QA 2EV6A 3CCQT 4OP0A 5L8RE 3VOEA 2LCLA 3OB9A 2CYZB 2LDMA 3T5XA 4JJNK 4KUIA 3LYIA 1BI1A 3DKMA 4M7DD 2JTMA 4LB6B 3O8VA 4C0GA 3MAJA 1PSFA 2EK5A 2LF7A 5L3DA 3Q9SA 2XD0A 1VTNC 4M75C 1W5SA 2ZPEB 3WTYC 3JCMV 4BB7A 2F69A 2K5FA 4X34A 4P9FA 4M78C 3P9CA 4HAMA 1MJBA</