1G3TA

Cys102ser dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
224
structure length
215
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 67
structure length 215
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3tA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3tA03
1G3WA 1FSEA 5DDGA 1QZYA 3HSFA 2ESNA 2GXBA 4ENNA 5LRRA 2MLGA 4CGZA 3E97A 3K1NA 3NQOA 4LGWA 1O3RA 4GO1A 3BJOA 2DAOA 1W5SA 1B59A 1P2FA 2YU3A 3RKYA 3L09A 3AAFA 2P4WA 2L3DA 2O03A 1YFHA 3ISPA 3KP7A 2ZMEA 4Y17A 2W24A 2BEOA 1TQIA 1GXQA 2JSCA 3BP8A 3DP7A 3FMRA 2OQGA 4LG0B 4GYIA 1IRFA 2IW5A 4KN4X 4UVAA 1HW2A 1KQ9A 1IN8A 3IHUA 1TNSA 1IF1A 1XSVA 2FMLA 1O57A 1TQPA 3GWZA 4N9IA 1MGTA 3F8MA 2XAGA 1KU3A 2L4MA 2OBPA 2CW0F 1YW8A 5AIPA 1G3YA 3TO9A 2V1XA 4QLCU 2JRTA 1XB4A 1FC3A 2DPDA 1B4AA 1QBJA 2ZO4A 5LLQA 2A69F 2H09A 2E1CA 1YW9A 4Y15A 4G9YA 2ZKZA 3BJAA 2MLKA 4I09A 2XAQA 1U5TA 1R58A 2JPCA 2O6GE 4LLNA 2CYYA 2RQPA 3E6DA 5IT3A 3M8EA 2HQRA 4PGGA 5CVRA 1OYYA 3RYRA 4G6DA 3HOTA 5KK1A 5L3FA 3GFJA 1BJAA 5D6EA 3EUHA 1SD6A 2DI3A 3V7RA 2QQAA 3KFWX 1G6NA 2IVMA 5J8FA 5BS6A 2HFHA 3FHZA 1ZLKA 2BYVE 5L3BA 4WXHA 3VFZA 5JR3A 2RV8A 3G73A 1AWCA 3ZP5A 2COMA 2VOPA 3HHGA 3F8FA 1T0FA 2NAZA 3DKWA 2VE9A 2NNYA 4LD5A 2BGCA 1QW1A 3GEZA 5JFRA 2EV0A 2CGPA 1Z9CA 1D5VA 5H6QA 3J81K 5D5UB 3KZZA 3MHXA 2ISZA 4HA8A 4HV6A 2MH2A 1BI3A 1FOKA 5HS7A 4UUVA 4WK8F 2FBIA 1BC7C 4OMZA 4EQQA 4FHTA 4KIGA 2GIVA 4M6YA 2L4AA 2W25A 1XGNA 2D2WA 4RB1A 4CYDA 1S8NA 2DW4A 1XGOA 1R1VA 3LSTA 1R22A 1J59A 5K5QA 4IHTA 1QPMA 1IAWA 2QWWA 4KDPA 1KU7A 4XSZF 1JE8A 3LAJA 3PFIA 4UVBA 1OKRA 2FRHA 3C1DA 2P5KA 2XROA 4LLGF 1AOYA 3K1PA 2QQBA 3H3UA 2Z3YA 1HW5A 4XLNF 1PDNC 4MEYF 2Z99A 1WSUA 3H92A 4IJAA 2EWNA 2LKPA 1ZGJA 1DDNA 5HDNA 3L00A 3IKVA 4UV9A 2FQ3A 2NRAC 3TGNA 2Y0MA 3O6BB 1RUOA 3WTSC 5CJ9A 2GCXA 3GUDA 5CVVA 3F21A 4G7OF 2ZFWA 2FU4A 4A0YA 5HVQC 5DCFA 1PP7U 3S2WA 4KYWA 1FT9A 1ODDA 3QP5A 2P5LC 4IF4A 2K4JA 3V7CA 2VBZA 2RGVA 1TLHB 1JXSA 3RYPA 1Z05A 3DV8A 2V1UA 1S29A 2HZTA 3HRSA 1RUNA 3E5UA 1OYWA 2KIUA 3KP4A 4UVCA 3DPTA 4HF0A 5CVIA 1ZG1A 3BZ6A 3I0TA 2VOOA 2G7HA 4YFNF 3SHFA 3ZMZA 2A61A 3F23A 5DUKA 1DPRA 2E7XA 2KJCA 3BWGA 3CO6C 3CUOA 3WGGA 1S7AA 4RB3C 5HDGA 2F5DA 3JTGA 1I1GA 3GW2A 2PG4A 1Z7UA 3JAMK 1BOAA 3GO5A 3JSOA 4GYGA 4M9ZA 3Q5FA 3MEXA 1ZAOA 4MQ9F 3E5XA 4U7DA 1XD7A 1DPUA 1HKSA 4TV7A 1WI9A 4RGSA 2HQNA 3K69A 1F5TA 3ECHA 1XDUA 2EFQA 4WCGA 5LEKA 1USSA 2CSOA 1XMKA 1U5TC 3T0YA 2UZKA 4P55A 3DF8A 4LMYA 1L3LA 1D3YA 4OIRF 1I27A 3KZYA 3I59A 1RI7A 1ZHFA 2IRFG 3F22A 3QRFF 5DCMA 2ZMEB 2O0YA 3I64A 4KMFA 3BY6A 2A68F 3RJPA 3HUGA 4KA4A 2JTVA 5FFZA 4L9NA 2D1VA 1G3SA 1K6OA 4Q5SF 5DD8A 2VXZA 1XSDA 4AIHA 5ILVA 4E70A 3GF2A 4A6EA 4CDGA 2LF8A 3FZVA 1ON1A 4YG2F 4RGRA 3PQKA 3LFKA 4WX9A 1FY7A 2MD5A 4HF1A 1IN6A 1DP7P 1IXCA 5J6XA 2IT0A 2Y48A 2Z9OA 2ESHA 4JQFA 1CF7A 2DO7A 2QLZA 4R8HA 5E1WA 2XRNA 1TBXA 2Q8KA 4LJZF 4ESBA 3LWFA 2PJPA 1KYZA 1XMAA 2HKOA 2XV4S 3KE2A 4A5MA 4K2EA 3HRTA 4H0EA 1PUEE 5D5XB 3ZPLA 3JW4A 3R61A 2EFWA 1FP2A 1W7PA 3P9CA 3T8TA 2QBYA 4EJWA 1IRGA 5D5VB 5AIQA 3I71A 5ICGA 4NHJA 2P7VB 3FM5A 2E1NA 5BOXA 3R0AA 2ETHA 4O6JA 1DUXC 1SD5A 2V79A 1R1TA 1B1BA 2K4BA 3I59B 4ZZLA 2QVOA 2YX7A 2OQRA 4OOIA 1HSJA 3Q9SA 1SMTA 4YIIA 3HSRA 3RIRA 1JHFA 5ICCA 3CO7C 2XASA 1ON2A 5ILUA 3T5XA 3F8BA 2WWYA 1VTNC 1Z1DA 2PBIA 3EYIA 1LDDA 1ZGAA 3FM3A 1KU9A 2GA1A 2L01A 1KQ0A 1B9NA 3ML6A 1MZBA 4PCQA 2CQKA 4ZYGA 3KETA 2YPRA 3J80K 2V6CA 5E1XA 2PMHA 1EH8A 2M8EA 1ZH5A 5FGMA 3WU0A 1EH7A 2BV6A 1K79A 4LK1F 4MNUA 3C18A 1L0OC 1IN4A 4HOBA 3FMQA 1IN5A 1T98A 1JHHA 3FF5A 1BN5A 5HDKA 3EETA 3LA2A 2LNBA 5DUIA 2EFOA 2IA0A 3WE3A 3RDIA 1BIBA 1ZYRF 3U1DA 4RB0A 2DQLA 3G3ZA 4KIBA 2IP2A 2XKOA 4KFCA 1R1UA 3V4GA 1Q1HA 4LLLA 4LG0A 4PZJA 1QGPA 2HKXA 3MZYA 2ZBKA 3BROA 1J0RA 3LA3A 5LGUA 1TQMA 2OAZA 1J5YA 3KP6A 4XRFA 4HLYA 2JPBA 3I4PA 2FOKA 2K86A 3HSEA 3FWEA 2BE5F 4BHPA 5D5WB 4RAYA 4ENJA 2VBXA 1ZN2A 3R4KA 2JZYA 3IC7A 5D4RA 4L18B 3P9KA 1TNTA 3J81Z 2EV5A 4QWQA 1T6SA 1CGPA 2UXNA 3IWZA 2O3FA 4RAZA 3EDPA 5BPIA 5LEJA 4N0BA 3ZN1A 1QZZA 2DU9A 4AIKA 4NQWA 3V8LA 4KICA 1MD0A 4ENMA 4M72A 1TW2A 5HLGA 4EM0B 3LA7A 3ULQB 2M1BA 2IPQX 3BJ6A 1FYKA 4PGHA 2PLYA 5E8IA 3TOAA 3TO7A 2OU2A 3ABTA 4HBLA 4P9FA 3ZMTA 2CO5A 3MWMA 4HF2A 4IRHA 3J7AO 1XGMA 1BIAA 2F5FA 1O7LA 4YFKF 4DQ2A 2EV6A 5DV5A 3C7JA 1E2XA 3E3VA 4M9XA 1LEBA 2XGXA 2HDCA 3MQ0A 4G94A 3RI4A 1QNTA 2VBWA 3FXUA 1BM9A 4L5JA 1OPCA 3GLXA 5EEGA 4L0YB 2EA2A 3KP2A 3V7SA 1Z6RA 4CHUA 2YX4A 3IWFA 2W85A 1YO5C 3ZMDA 4OU0A 3KP5A 1YTYA 4B8XA 4KN7X 1FSHA 1MJBA 1LJ9A 2KIFA 4L9VA 2DT5A 1FBUA 4U7BA 4G7HF 5F64A 4WF2A 1P4WA 4EV0A 2R7FA 2YR2A 4ETSA 2HEOA 1FP1D 1H9GA 4F7ZA 1V4RA 4UV8A 4RS8A 4HDVA 3B02A 3K9TA 5E8GA 4FT8A 5ERIA 2GZWA 3TQNA 1O7FA 2VT2A 3R0JA 4A0ZA 3CUQB 3SFZA 3WTWC 1B9MA 2EJRA 2HTJA 2FMYA 2HOEA 1YQAA 2AXLA 1I1SA 3QU3A 3IRQA 4HX8A 2BBYA 3SQNA 4L9TA 4M9SA 1SFUA 2H6CA 3F8CA 4EGZA 5BPDA 3IKTA 5K5OA 5IT9Z 2EA4A 2K27A 3T8RA 4R1HA 2PN6A 2V1DA 4N9HA 2EB7A 4IHSA 2F5EA 2F5CA 1BI0A 1O3QA 3HHHA 4A12A 2ZCWA 3RKWA 4R79A 4Q47A 1SD7A 4HAMA 5F1RA 1G4DA 4EVIA 1C0WA 1WWXA 2STWA 2M45A 1T38A 1G3TA 4EGYA 2J5OA 2IA2A 2RDPA 1LNWA 2W57A 4L9JA 4BHBA 2H6BA 1J9IA 2A5YB 3IRRA 1RIOH 1SFXA 1YYVA 3W6JB 4ZYHA 1U5TB 3B73A 1IN7A 1XGSA 2DQRA 2JT1A 2DPUA 4UNOA 4YFXF 1OR7A 3HYIA 2RN7A 4MQVA 2DK8A 4BQAA 4ESFA 4A2UA 1FBQA 4HW0A 2YSRA 2EFPA 2QUFA 3NRVA 1FNNA 2OA4A 4GXOA 4BXUA 5ILSA 2R3SA 1U78A 2XAFA 3RPQA 1YLFA 4MTEA 3O3KA 2P7CB 5IT9K 1XN7A 3K1MA 2VC1A 2K7LA 1LEAA 4HQEA 2EFNA 2ACJA 1BI2A 5HLIA 1IXRC 1FZPB 1A04A 1OYIA 1FWZA 1HXDA 2VN2A 4S05A 2RVCA 3WTVC 4HZFA 3ZMUA 2VONA 4XSXF 4MGRA 2HR3A 3N97A 3GZ6A 5CYVA 5A2QK 2ELHA 4I98B 3GFIA 1T2KA 4HX4A 2Q2EA 1ZRCA 3KEQA 3CDHA 1P6RA 2K5FA 3JSPA 4OMYA 5AONA 5LGTA 2ADUA 3F6OA 2GXGA 1UHWA 1XSXA 2QZ8A 2FXAA 2XAHA 1STZA 4G6QA 4OIPF 2RNJA 4I0BA 2WV0A 3L7WA 3TDZC 2O8XA 1O3TA 3WTUC 2ZJ2A 1ZG3A 4I01A 3E5QA 1LDKB 1W7PD 2MA3A 5DCMB 4G8XA 1K78A 2D1HA 2G9WA 1KYWA 5ED4A 1J2XA 3I58A 4HQMA 1PP8F 3HIFA 5FLXK 3DXJF 2LF7A 4UXNA 3RKXA 5D8LB 3ZMSA 1MKMA 1D8JA 3CTAA 4IPAA 3U9GA 2FSWA 2XHKA 1LVAA 5FO5A 3BPXA 4LB5A 1FX7A 5E18F 4MTDA 5H6RA 1XCBA 2XUBA 4EM1A 3M9AA 2B0LA 2H3JA 1R23A 2QENA 3KLOA 2H27A 3GVAA 4U88A 2DK5A 4JBAA 5D8KB 4ENKA 4U0VA 1REPC 4LK0F 4ASNA 3Q9VA 3TOBA 4M73A 4P96A 1BBYA 3TO6A 1ULYA 1QVPA 4RB2C 3FXRA 3FMSA 4I2OA 5HS8A 1USTA 3WGIA 5FB2A 1LDJA 1HKTA 3F72A 4CICA 3V8KA 2PFBA 1TTYA 2Y75A 2C6YA 2UWMA 3JTHA 4Q48A 4D0PA 3DQVC 3ZQ7A 3M8FA 2CFXA 2F2EA 4HV5A 3CUQA 1BC8C 2G7UA 4EJTA 3EQLF 3EYYA 5D6FA 2HWVA 1W5TA 3GXOA 5E17F 4A0XA 1P4AA 1CF7B 2FA5A 1UB9A 5TRDA 2GWRA 1R7JA 4IRIA 2MH9A 5ICEA 2DTRA 1KU2A 5LGNA 2PMUA 5TJJA 1ZRFA 1TW3A 1YW7A 2AS5F 2P6SA 1QO0D 3C3WA 4OIQF 2KKOA 3QOPA 5FFXA 1R5GA 1R36A 3LQRA 3BDDA 2X0LA 3HRUA 3E6BA 1ONVA 3KP3A 2A07F 4P9UA 1WKMA 2NYXA 3E6CC 3QU6A 2MC3A 1W4MA 5H20A 3CLOA 2FNPA 1XDSA 2J5PA 1H0MA 1U8RA 4A6DA 3GFMA 3SXYA 4LB6B 1MDMB 4A5NA 3JAMZ 4AIJA 3I54A 3L9FA 4BH9A 1QQIA 4HYEA 2HGCA 1MJ9A 2P6TA 3L2CA 4UHTA 2A6HF 3U2RA 4L0ZB 4B09A 3TKYA 2PEXA 2L02A 1ZREA 4L5IA 2TDXA 2H94A 3MCZA 4OINF 3P7NA 3I53A 3WTXC 4RGUA 4ESJA 2QBYB 1HQCA 2A3SA 3WGHA 1HSTA 1Z91A 1U2WA 4HLXA 4EMSA 5DYMA 3P9IA 5L3DA 4WXDA 1RZ4A 5F6FA 3GZ5A 3HRMA 2FNAA 5JVTA 5LHHA 3IL2A 3M1EA 5FD6A 1S3JA 1X3UA 2QQ9A 2NS0A 3F6VA 3MZHA 3WU1B 1KQ8A 5E1ZB 3QPHA 3ERED 1HKQA 1U6GA 4FX4A 1S6LA 4U0YA 2DBBA 2OZUA 3ECOA 4I7HA 1R00A 1F9NA 2M87A 5LHGA 3MFKA 1UHMA 4AVPA 3WTZA 4I02A 2DLLA 5HS9A 3LQQA 1H9TA 3PQJA 3REOA 4EM2A 2ZXJA 3I5UA 5LRSA 3BOQA 1YS7A 4AD9A 1O3SA 1GVJA 2VBYA 2FF4A 4ZYEA 4MHGA 3ZN0A 2A6EF 3MAJA 3W6KB 4OIOF 1MDMA 1J7KA 4CO8A 2W84A 2QM3A 5KVRA 3V8JA 2QYOA 3F8NA 4KIFA 5BQTA 4KNYA 5HLHA 3M7GA 2XKPA 3D5LA 4DNCA 3GX4X 3LAPA 2K5IA 3K2ZA 4P5OA 2STTA 3RTRA 2XVCA 2RKHA 2FBHA 4ZZDA 4M71A 1LQ1A 1XCVA 3CJNA 5LBQA 1IUYA 2OD5A 1I5ZA 3VB2A 4XBFA 5J8CA 3FX3A 1LB2A 2Z33A 2P8TA 2X4HA 2GQQA 1ZG5A 1WQ2A 2L54A 2MBFA 4KUMA 1FBSA 3BPVA 1SMYF 4M6XA 1BI1A 1FLIA 6PAXA 4CZZA 3HTSB 4AWXB 2O61A 3E19A 3VODA 1P92A 2VC0A 1EV7A 2PI0A 3DEUA 2FEZA 2XAJA 4Y13A 2PQ8A 3HTUA 5K1YA 2FE3A 4O5VA 3OV8A 2D45A 4U0WA 3RPUA 2LX9A 2ZNZA 1YG2A 4YIFA 4IRGA 5DEQA 1T39A 3HOSA 2GA2A 4RGXA 2GAUA 1FYLA 3DPLC 1S7OA 1KA8A 5FD5A 1SAXA 4CXFA 2ZNYA 1R5HA 2XIGA 2DFIA 3KEOA 2KRFA 3COAC 5D4SA 1KGSA 5FLXZ 2Q0OA 2K02A 3KLNA 3SZPA 4HDUA 2WC2A 4IXAA 3TDUC 1B6AA 5L3EA 4BHCA 2K4YA 2HS5A 3QPTA 1U3EM 3OOPA 2V9VA 4G7ZF 3WTYC 1GHCA 3WODF 2HYGD 4WXCA 4PDKA 5DD4A 3CUQC 1HBXG 3GYHX 1ZLJA 3WE2A 5L3GA 5LHIA 2M30A 1P4XA 4WWCA 3WG9A 4KMUX 1RNLA 3ZMVA 4EJVA 1BYMA 4BNCA 1IXSB 2R7DA 1YIOA 2EK5A 1FYMA 5CVJA 1WRJA 5CVUA 4BYYA 2WTEA 4ZH4F 3ROUA 4M74A 3GFLA 3E6MA 3VOEA 3VEPA 4ZYDA 1K78B 2E7WA 4HX7A 5L3CA 1IW7F 3F3XA 5HOOA 2M5WA 1OMIA 1YS6A 4JK1X 5EEHA 1JGSA 1HW1A 1K7AA 2K5LA 2HYFA 1I6XA 1V3FA 3QAHA 4O3MA 5BMZA 1ZARA 3H3ZA 1UFMA 5ICFA 2IA1A 1GXPA 3D0SA 5E20A 1ZRDA 2VE8A 1MJAA 4EJOA 3K0LA 3R60A 4IVNA 2FBKA 4NB5A 5A2QZ 2CG4A 1EH6A 4GCVA 2OZ6A 5JHUA 3ABUA 4S04A 3N4MA 2KJBA 2KIMA 3QP6A 4XLPF 1FPQA 1E17A 2VODA 5K5RA 4BAYA 4LFUA 3KCCA 4KT5C 2VT3A 2UXXA 1UCRA 1SD4A 2NNNA 2LSOA 3T1BA 2HTSA 2ISYA 1F4KA 1F1ZA 3R6SA 3DFGA 3NEUA 1SFEA 3FXQA 5CLSA 3WTTC 1D8KA 2P5VA 4GGGA 4FX0A 4EJUA 4Z2YA 1Y0UA 4Q4ZF 4ON0A 2CWEA 2LDUA 3SZTA 4I0AA 1W7PB 5JI6A 1IZ1A 3ELKA 2RC4A 2IJLA 3J80Z 1J75A 1NHAA 4MEXF 2Z5UA 1Z6TA 3O2PE
chains in the Genus database with same CATH superfamily
4E6KG 1G3WA 1FSEA 4CCNA 2ZJQF 5KYNA 1GDTA 4LG3A 3OSGA 2XHCA 2F4OB 1Y96A 5CAIA 5DDGA 5B3SH 1QZYA 4C92F 3JCMb 3EHRA 1AZEA 3HSFA 3BLYA 2ESNA 4MO7A 4W1UA 2GXBA 4M77D 5C4JJ 4G12A 2ZC2A 1YRNB 1VQ6I 2LTOA 3MKWB 3SWNB 1Y56A 3M53A 5F27A 1V5FA 3JRAA 4ENNA 2FRYA 2RI5A 3I56Q 5LRRA 3H3VK 2MLGA 2J06A 4XKVA 1AHDP 4CGZA 1QLYA 2PQWA 4PL6A 3E97A 3K1NA 3NQOA 4LGWA 1CSKA 1K9MR 1O3RA 1PKSA 2M4KA 4GO1A 1PWTA 3BJOA 4XN3A 3CCQT 4UY8I 2RJCA 5EC7A 2KRCA 4I76A 3OBWA 2DAOA 1RAHB 1W5SA 1B59A 1P2FA 2BHZA 3M9QA 1HDPA 2YU3A 2LFBA 2EFIA 1VQ9I 1FMVA 2SRCA 5JLXA 2PJRB 3RKYA 3L09A 3AAFA 3RDVA 4ZN1A 3JCMc 5HCKA 2P4WA 1OFCX 2L3DA 3F0CA 2O03A 4BQOA 2GM4A 4IOAF 1YFHA 1FTZA 3ISPA 3KP7A 2PU9B 2R0QC 1TUGB 2ZMEA 3KZIC 2M0YA 1MUZA 3LSPA 2VQCA 4Y17A 5LD2C 4IHYA 2AK5A 2K5CA 2W24A 2BEOA 2EIKH 2EQRA 2QF7A 5GANe 1TQIA 2ICWG 4KT0E 1GXQA 2JSCA 3BP8A 3DP7A 2H1KA 3E1SA 2I10A 3FMRA 2KVQG 3N05A 1R4NB 1YJ9T 2OQGA 4LG0B 4GYIA 1WGSA 3BTLA 1IRFA 2MWPA 2IW5A 2YUSA 4KN4X 2MYSA 2JK3A 4UVAA 3JCMQ 3URGA 4C5GA 3ZXSA 1HW2A 3K4LA 3MD2A 2FB7A 1KQ9A 4F7UF 1IN8A 2LY9A 3HHTB 3IHUA 1TNSA 1IF1A 1XSVA 2BXZA 2FMLA 2RMOA 1O57A 1TQPA 1VQ7A 4M7AG 3GWZA 2QA4A 3TL4X 4N9IA 1MGTA 2FJ1A 3F8MA 3S3NA 5GAN3 2VV5A 2X1CA 1KU3A 2XAGA 3KFVA 4C0DB 2OTLT 2L4MA 3JB9I 1UGVA 2OBPA 1NEGA 2HSPA 1YW8A 2CW0F 1ORKA 2ED0A 5AIPA 1G3YA 3TO9A 2V1XA 3BG5A 4QLCU 1N78A 2JRTA 4QQ6A 4C8QA 1LPQA 1XB4A 2EKOA 1FC3A 3FDYA 1Y39A 2DPDA 1QVGP 1B4AA 3CC2Q 4FSSA 1QBJA 1V1CA 1UJYA 2ZO4A 2OAUA 3TSZA 4F14A 3CMET 5LLQA 2A69F 2H09A 5IPAA 1TC3C 3TVTA 2HAXA 4M7DF 2CJJA 2LR8A 2Y31A 2WB1A 1YW9A 2E1CA 1Y07A 3MJXA 4Y15A 4RTYA 1RR8C 1YJWA 4G9YA 2ZKZA 3QG1A 2UUZA 1NG2A 3OIPA 1QCOA 1SHGA 1ZHIA 4KULA 3BJAA 3FC3A 2MLKA 4I09A 2XAQA 1VQ4I 3TCJA 2GIZA 2AQEA 1U5TA 1R58A 4II2A 3A8LB 3JB9J 2YT6A 1MNMC 1Z7LA 2JPCA 2O6GE 3KPHA 4LLNA 2E5ZA 2CYYA 2B63J 5GTIC 2RQPA 3E6DA 2E1MB 5IT3A 1JKPC 1LE8A 1DJ7B 2NUTA 4BDYA 3CCQI 3M8EA 1QP2A 3ZRGA 1B72A 3TW7A 1V5EA 1Q95G 4J9GA 4RG8A 4G6TB 2OPTA 2HQAA 2KT0A 1RAGB 4A4KA 4E7IA 2RA2A 5FW9A 2XICA 2EIMH 2HQRA 1MMDA 4PGGA 1X3WB 1ZQ3P 2DMNA 2HQHA 3EFOA 1IG7A 3VS6A 5CVRA 3OWTA 1OYYA 4LIUA 5IT9E 4EATA 3A4CA 2B86A 4AYBA 2KMTA 4NNJA 3RYRA 1HK9A 4G6DA 3W2WA 1ZA1B 2OX7A 1JJ2A 4C2MJ 3HOTA 3META 2X6XA 3BTCA 1Z3YA 5KK1A 5L3FA 3D1NI 3GFJA 2ED1A 1BJAA 1CKAA 5D6EA 3EUHA 4FT4A 4Y28E 1SD6A 2DI3A 4EMKB 3V7RA 2DYBA 2QQAA 3KFWX 1G6NA 2HNHA 2IVMA 5J8FA 1PKTA 5BS6A 2HFHA 3FHZA 1NYFA 2ROLA 3OL4A 3FJ5A 4DZJA 4A54A 1QHGA 4ATOA 2X51A 1ZLKA 2BYVE 5L3BA 2EJGA 3FXKA 1ZR4A 3CC4I 1VYUA 5IT9R 5IYCJ 1WX6A 3OYFA 3PSFA 1UUEA 2DFEA 3G1OA 4LOCA 2N8GA 4WXHA 3VFZA 4HKEA 5GAOm 3FIWA 4MLOA 4M7DG 3LSHA 4OMQA 4BDZA 3LYIA 1XMXA 1MHNA 4YRVA 5JR3A 1WVRA 3JRDA 1NBEB 2QA4Q 2RV8A 1XX5A 2L9NA 2XF7A 3G73A 1W70A 2WAFA 2R7UA 3HFOA 2CUJA 1AWCA 3ZP5A 3GF5A 5CPRB 2C06A 2RB6A 3AL0B 4IHWA 3CCJI 1I8FA 4L5GA 4LDXA 1W6XA 3QO3A 2W48A 4BEHB 2LT4A 5M9OA 4KBMB 1WPKA 4M78C 3SDGA 1EJ9A 2COMA 2LOOA 2VOPA 3HHGA 3F8FA 2EQJA 3CLQA 3QYEA 2QG9B 1T0FA 2NAZA 3DKWA 5KE3A 3JB9F 1MNDA 1VQKI 2X35A 2M0OA 1M2VA 2RN8A 2VE9A 3BY7A 1WI7A 2NNYA 4CC2A 4LD5A 3L2UA 4EEFG 3CCLT 2LY1A 2BGCA 2DJIA 1IO2A 3FXLA 1XOVA 4KJZA 4E7JA 1QW1A 2E6ZA 2GTOA 3GEZA 3HBLA 4HPQA 3LLRA 4XU3A 3LWIA 4M7AA 5JFRA 2EV0A 3LNQA 2BE7D 2DYSH 1T0FC 3RMQA 4F91B 2CGPA 2EINH 2G3RA 1BR4A 4E7SA 1Z9CA 1VQ8Q 1D5VA 5H6QA 1GV5A 3J81K 1YCYA 5D5UB 4DGWB 2SEMA 1X4PA 3H1CA 1M1FA 1RABB 3H0IA 3KZZA 3MHXA 2ISZA 4HA8A 4RMNA 2JUFA 4HV6A 2EJ9A 2F5KA 1Q86R 2LP0A 2MH2A 4HNUA 1BI3A 3DBHB 4A53A 3IP4B 1FOKA 2DXCA 5HS7A 4IOCF 1D0ZA 1Y1VJ 4V2GA 3ZBDA 1VQMQ 3ZOBA 4XONA 2CV0A 1TWFJ 3J7AY 4UUVA 2KXDA 2QTVA 4MZTA 2M0CA 3K4KA 1IO6A 3GTGJ 1O4XA 5EJCA 1SVMA 1YJNA 4WK8F 2FBIA 3MKLA 1X2NA 3PJRA 3OW2S 1BC7C 1QCFA 3SB2A 2YXYA 4OMZA 3EG1A 4EQQA 2DCEA 1D1CA 4FHTA 2X3WD 4A3KJ 4KIGA 3I55Q 1ZA2B 2RHIA 3HC7A 3C12A 2GIVA 1ZUYA 1UGQB 4M6YA 3CCST 1KQSP 4MFDA 1LCKA 2L4AA 2W25A 2PVOB 1XGNA 3I56I 4M7DE 2D2WA 4RB1A 4CYDA 3CC2T 5KYXA 1S8NA 2EZKA 2DW4A 3AKZA 1XGOA 1R1VA 2A05A 3CCMI 2NVTJ 3LSTA 3S14J 1ERDA 4DBFA 3OOUA 4BL0B 2LCSA 3R6NA 1R22A 1J59A 2DXUA 3M5AA 5K5QA 4IHTA 1QPMA 2V1QA 1B72B 1IAWA 3PIOA 2YDLA 4OMNA 2QWWA 1TOVA 4KGXB 1RETA 4KDPA 1X1BA 4IIOA 1QVGA 3CD6T 1KU7A 4XSZF 2V9KA 1EA3A 3CXCA 3AG2H 1VQ6A 1JE8A 4FYYB 1JJ2S 4CCMA 1FOXA 1ABQA 3IQLA 1M9SA 4B44A 4OAYA 3LAJA 4JJDA 3TQ7P 1SRMA 5GAMd 3OA6A 2PZ1A 4YTLA 3I55A 1X1CA 3HKZN 3CCJT 5KAIC 2VXEA 5B66C 3GTQJ 3H0HA 4E2FB 2LNVA 1MNEA 2E64A 5FJ8J 3PFIA 2RHUA 2NVUB 4UVBA 5D6XA 1LJOA 2DL4A 2AQFA 1OKRA 2FRHA 5IP7J 1VA7A 2Y2ZA 3C1DA 4DBHA 1LFPA 2P5KA 2HQ5A 2DA1A 3ZQQA 5LJ5g 2XROA 3OS0A 3VS5A 2A08A 3CCLI 4LLGF 4IIMA 1JRIA 4PJOC 1B34B 4CRIA 4B3AA 1AOYA 3K1PA 3VYTB 1JGGA 3CCRT 2QQBA 3H3UA 3I5SA 2QEXQ 2Z3YA 2YLCA 5FKKA 1HW5A 2VASA 2HPMA 4PJNA 4XLNF 1PDNC 2X4YA 4MEYF 4M77G 2E36A 1WJCA 1OPKA 3ASOH 1RUWA 2EAYA 3I35A 4BY6C 4C0FA 2E6NA 4FE7A 2X6WA 4KH1B 2JMCA 2DTZA 2Z99A 4BY1J 1N8RC 1WSUA 3H92A 4CZCA 1OU9A 4IJAA 5GAOl 4FT2A 4HT8A 2EWNA 2LKPA 1FXXA 3ZQCA 1ZGJA 1DDNA 2MI6A 5HDNA 1HLVA 3L00A 1JKOC 1F43A 2RQWA 3IKVA 2V7FA 4UV9A 5HODA 2V9PA 2YRDA 2FQ3A 2NRAC 3TGNA 4LDUA 4MDWA 2Y0MA 1EX4A 1H88C 1K4SA 3CCVT 3O6BB 4C8QG 1RUOA 1Y57A 2ME0A 3WTSC 2DVJA 4LNPA 1Q82U 2VJ5A 5CJ9A 3LH0A 5KHDA 3QJ6A 4C8QE 2GCXA 3GUDA 2E4HA 2BVLA 5CVVA 3F21A 2LH9A 4G7OF 4K11A 2ZFWA 2FU4A 1QVFP 3I56T 3EH1A 1OZ2A 4IEJA 2LMDA 4A0YA 5HVQC 3FKJA 2RQVA 5DCFA 3NHNA 2DETA 3LMMA 1MW7A 1PP7U 4BD3A 3S2WA 3VYUB 2HXOA 1G2HA 3CPWA 4KYWA 4BUGA 5A0DA 2ME6A 3BG6A 1FT9A 1VQPA 2DE0X 1C6VX 4QPQA 2FUG2 1ODDA 4YEJA 3OBYA 3ZCOA 3JREA 3QP5A 2P5LC 2DILA 4XLEA 4AVZA 2EPDA 3X20B 2YUQA 2WA0A 2M2EA 4IF4A 2EJFA 2K4JA 1E6GA 1M5Q1 3V7CA 3VYRB 2VBZA 3VS3A 4ME7A 2RGVA 1TLHB 4XICA 1JXSA 2I5UA 3HM5A 3RYPA 1Z05A 3DV8A 1WPYA 4MMKA 2V1UA 4NC8A 1S29A 2HZTA 3HRSA 1RUNA 1T08B 2A3LA 3E5UA 3RQIA 3BFMA 1OYWA 2KIUA 1WXTA 4C5EA 1VQ8I 5CCAA 2OCEA 4JOMA 3QJYA 3KP4A 4UVCA 4XLAA 1OISA 4FE4A 3DPTA 4HF0A 4IUVA 1Y8RB 1D1BA 5CVIA 1ZG1A 3BZ6A 2CREA 4WTOB 3GNFB 3I0TA 3FEOA 2XKOC 3VSLA 3PIOF 2VOOA 2DERA 1X2MA 2G7HA 5BNGA 4YFNF 3O8GA 3ZQIA 2AKLA 2KL4A 3ZL7C 3SHFA 5KYXB 3ZMZA 1WI3A 2A61A 3CJRB 3F23A 1OOTA 3E2UA 5DUKA 1DPRA 2DRMA 2E7XA 2KJCA 3BWGA 3CO6C 3NWSA 3HG9A 3I55T 2AKKA 3CUOA 2HXIA 3KUFA 3WGGA 1S7AA 2ZFUA 5HDGA 2X48A 4RB3C 1R77A 3VYGA 5GAMf 2F5DA 3OYBA 1JO8A 1VQ9Q 3JTGA 1I1GA 2GQVA 5CKEA 3CMAT 3GW2A 2VKDA 3OQ5A 2PG4A 2KDZA 1IHWA 3LSRA 1Z7UA 3JAMK 3GLLA 2CU7A 1BOAA 1NM7A 2MG4A 3G4ST 3GO5A 4M7AD 3JSOA 4GYGA 1MH4A 4M9ZA 1Y0NA 3Q5FA 2P81A 4OMLA 3MEXA 1ZAOA 1YOVB 2NUTB 4XLCA 2R5AA 4J6WA 4BB7A 4QTRA 1UE9A 3EFOB 1OCPA 2CGHA 2DOEA 5D7UA 2LRDA 4ZN3A 3KIOA 2L3RA 3CD6Q 4MQ9F 2M9HA 3E5XA 4Y3OA 3LFUA 2KMUA 3CMEI 4A3FJ 2HSEB 5KCOA 2ECZA 3MP6A 5KCMA 1XD7A 4U7DA 3U21A 2FZGB 1DPUA 1HKSA 3K4CA 1ZSZA 4TV7A 1N9RA 1WI9A 4M75B 4RGSA 2HQNA 3K69A 4XMYA 3EG3A 1IDYA 1TWGJ 5HK0A 1F5TA 2VXFA 3ECHA 1FOYA 1YJNI 1XDUA 2ELJA 1JQQA 2X4WA 5FU7B 2EFQA 2K40A 5C6SA 1WQWA 4WCGA 5LEKA 1USSA 4J6YA 1AVZC 2CSOA 1A35A 3M56A 1ITYA 1XMKA 1U5TC 3T0YA 2UZKA 1LNXA 5FRNA 2KBTA 4V2SA 1KG1A 4JJNK 2DMTA 2JS2A 4P55A 3DF8A 4LMYA 1L3LA 2JA8J 4FL6A 2AO9A 1TT5B 1D3YA 2VWFA 5KH6A 4M3DA 3U23A 2D8JA 2L89A 4OIRF 1I27A 3KZYA 3TP0A 3I59A 1RI7A 1Q81C 4M7DA 2DEUA 4HSTA 1HDDC 2CQ7A 2D0NA 3CCUA 1ZHFA 5EG0B 2IRFG 1PSEA 1ZUKA 1UGPB 4LE9A 1PYVA 1MGQA 4NQWB 4IHVA 2XU8A 2F2WA 3F22A 2L5QA 4A3EJ 3QRFF 1E0EA 1M3AA 2ID3A 2HQEA 4AFSC 1VQ5A 1I3AA 1K83J 2ZMEB 2HOAA 5DCMA 2O0YA 1RKWA 1PJRA 2CH4W 2XGCA 5HY6A 3I64A 1SEUA 3L1AA 4KISA 4KMFA 2L7KA 3BY6A 2L7FP 3BG3A 5H2FC 3C2HA 5FU6B 4AM3A 3LSJA 5J47A 2EYQA 1YITT 2A68F 2DOAA 3EGXB 3RJPA 1ETOA 3HUGA 2L3QA 4KA4A 4XORA 2R7TA 2JTVA 1M2VB 2FHDA 2NWMA 3JCMV 1I07A 2ZXIA 3JB9G 4V19K 5FFZA 4L9NA 4NL2A 2A7YA 3S6WA 3CC2A 2D1VA 1G3SA 1MBGA 5K7FA 1YI2T 3CC4A 2DD4A 1K6OA 2KZVA 4Q5SF 5DD8A 2YUNA 3GBQA 1HD3A 2VXZA 1DU0A 1ARKA 1K9MC 2BKDN 1XSDA 1TWBA 1BKBA 4AIHA 1V5GA 5J3BA 3CD6A 2D1XA 5ILVA 2VVKA 4FU6A 4KGZB 4MFEA 3GF2A 4E70A 4E7HA 3CMAI 2GXAA 2EGAA 2XB0X 1K4TA 3EH2A 4A6EA 4CDGA 1ACMB 2LF8A 3FZVA 2LRQA 1ON1A 2DL3A 3C0CA 1D3BB 4YG2F 2EKHA 2ZZDA 4RGRA 2BIVA 3H6ZA 5IHKA 3M58A 1POGA 9ANTA 3JRBA 3PQKA 4IHXA 3I4NJ 2MZ4A 1MMNA 2X6OA 1PSFA 1X3ZB 4UUSB 1QVFA 4B1RA 4MIMA 3ERMA 3E7LA 1I39A 1P9QC 1ABOA 1AKHA 3VKIA 3M4OJ 3LFKA 3CCMQ 2RJEA 4WX9A 4P5NA 1FY7A 1NG6A 2MD5A 4HF1A 1IN6A 2CW8A 1GCQA 1DP7P 3BQZA 2HDDA 2DDAA 1IXCA 2F48A 2LY2A 5J6XA 1QKWA 2RAEA 2IT0A 1WLPB 2A5WA 2IGNA 5LFAA 2MFZA 3M3YJ 5GMKl 3G1MA 2Y48A 2Z9OA 2ESHA 2FEIA 1ZK8A 4JQFA 2LX7A 3ME9A 3IH4A 1YHQQ 2IS6A 4PKCC 3M54A 2D6FA 1CF7A 2DO7A 4C2TA 2QLZA 2OAWA 3NTHA 4R8HA 4D9JA 5E1WA 1YCSB 3BR0A 1J3TA 2XRNA 5EG0A 2WACA 2KPMA 1TBXA 2AHJB 3BW1A 1M90U 2FQ4A 2Q8KA 1IRZA 5CKFA 4LJZF 4ESBA 3LWFA 7AT1B 2O31A 2PJPA 1WHKA 1KYZA 4JRIA 3JB9H 2KQWA 2P0KA 2E60A 1XMAA 1OULA 1PVEA 2O4XB 1SC7A 2HKOA 2XV4S 3KE2A 1C0MA 5LL6S 1HF0A 1T0HA 4A5MA 3HOWJ 4JLIA 3OB9A 4K2EA 4CCJA 3HRTA 3D5SC 4H0EA 2X4XA 1W2BA 4J9BA 1KFZA 1PUEE 3M0RA 1S5LC 1IV8A 2BZTA 5FKLA 5D5XB 3CMAQ 3G71Q 3CC4Q 2M7AA 5EEAA 3ZPLA 4FTHA 4PLLA 4R56A 1NPPA 1ZKGA 2DEQA 3JW4A 3HOZJ 3R61A 2EFWA 3G4SQ 1FP2A 1W7PA 1Z21A 1X19A 3P9CA 1RQ6A 2E5QA 2QTXA 3T8TA 2QBYA 2WY7Q 3X25B 4EJWA 1IRGA 1RI0A 2CH0A 3MEVA 4RMOA 1MBEA 1QP3A 3VRYA 1UJ8A 5D5VB 1IREB 1OX8A 1A6QA 2YHTA 4M75E 2LBFA 2BW3A 2XB5A 5AIQA 1GBRA 1U9NA 3I71A 5ICGA 2CMPA 4PJOG 2O88A 4NHJA 2P7VB 2VQLA 3ASNH 2MAMA 3BE3A 3HFNA 4M77E 4RTTA 5GAOp 3FM5A 2E1NA 2NS7A 5BOXA 4KRTA 1YFNA 1JEGA 3R0AA 2ETHA 4XNFA 1I5LA 3I3LA 3NWTA 4O6JA 1DUXC 1SD5A 2V79A 4XM3A 2K9GA 4ZGDB 4Z89A 2BOLA 2XGEA 1R1TA 4CCLA 4IO9F 3EG0A 2CV2A 1K76A 1AD5A 1B1BA 3S3MA 2K4BA 2X6YA 3DBLB 1HC8A 2CZ0B 2KAFA 3I59B 4CC3A 4ZZLA 2K9LA 2QVOA 1WHJA 2CKKA 2YX7A 1VQPQ 4ELYC 1M1KC 2OQRA 4OOIA 1HSJA 3Q9SA 1KSWA 2CP3A 2JQ7A 1BBZA 1SMTA 4YIIA 2MGQA 3M57A 3HSRA 3RIRA 3OS2A 1DGWY 4ABZA 1M30A 1JHFA 1ACIA 3H0FA 3PMIA 1SSHA 3UA7A 3SJMA 5ICCA 2DPPB 4BXFA 2DL8A 5EGOA 3LL7A 3CO7C 2XASA 3JRZA 3QYHB 3LWHA 3HZJA 4A3CJ 2MMPA 3L2ZA 4JJCA 1ON2A 5ILUA 3VS7A 3T5XA 3F8BA 3PL8A 1S72T 5HNHA 2WWYA 1E6HA 1WA7A 1VTNC 2P0PA 1IRXA 1Z1DA 2PBIA 3EYIA 2DF6A 2XD0A 5LJ5f 2MWOA 8AT1B 4R55A 1QVFS 2NXNB 1LDDA 1ZGAA 3FM3A 4J9HA 1VQNI 4A93J 1KU9A 2GA1A 2L01A 1KQ0A 1ZSGA 3VUZA 4LDYA 4RG2A 1V29B 1SAUA 1B9NA 4AT1B 1YITQ 3LGFA 1OYXA 2E3HA 5IHIA 5F1JA 1JJ8C 2JM9A 3ML6A 3PE0A 1MZBA 4PCQA 2CQKA 5KAFC 2KSSA 2V8KA 3FK6A 2EBPA 1RPWA 4ZYGA 3KETA 2YPRA 5J26A 2L9SA 3J80K 2V6CA 3JR9A 5D6YA 5E1XA 1OR7C 3M0SA 2FPDA 4XTVA 1VUBA 3RSNA 1VF9A 2PMHA 4XRMA 1N77A 3TU4K 1EH8A 2VPRA 2M8EA 3V42A 1UDLA 3RBBB 1ZH5A 2LYCA 5FGMA 3WU0A 1ZGWA 3O8HA 2JOYA 4C3IJ 3OYLA 4PFPA 4BKXA 3OYGA 1EH7A 2JA6J 2BV6A 5IP9J 2QGUA 4LK1F 5K7ZA 1K79A 1OU8A 2VKNA 5LJ5e 4MNUA 3C18A 2IGOA 3OW2P 2LMJA 4PFZA 1L0OC 1WJEA 3QPSA 1K9MU 1IN4A 2Z0WA 3HXLA 3J7AW 4OMFB 2L9RA 4HOBA 1BJZA 3FMQA 3TEDA 5C0MA 4AG1C 2LK2A 1IN5A 1T98A 1UG2A 2CW7A 1JHHA 2I0NA 4KUDK 2DTOA 3FF5A 4A69C 1GCPA 1BN5A 5HDKA 2VI6A 1YX5A 2ZCFB 3QSUA 3EETA 1GUUA 3LA2A 2LNBA 5GPCA 5DUIA 3CC7I 2QGFB 2EFOA 2IA0A 2YS9A 2KLOA 1HA8A 4FASD 1SHFA 3QWXX 5A2QE 3GBGA 3KEYA 2VLAA 1RL2A 2HL3A 3CF5F 5GAN6 2EYYA 2XDVA 3A01A 3WE3A 2OJ2A 3RDIA 1XQHA 2Z1DA 3S1RJ 1BIBA 3EG9A 1ZYRF 2R5ZA 3TEEA 2XPWA 3U1DA 4RB0A 3HEFA 2DQLA 3G3ZA 4KIBA 4BE0A 2IP2A 2ABLA 2XKOA 1KHCA 2DA9A 3ZR8X 4JYKA 4KFCA 4A4FA 2QCOA 1R1UA 3OYAA 3BT9A 3A8OB 3V4GA 1Q1HA 4LLLA 4OGCA 2E71A 1OCZH 3OIQA 4LG0A 3MO8A 4PZJA 1QGPA 3TREA 3MKDA 4HXJA 2HKXA 4XTYA 3MZYA 4V2FA 1AU7A 2QDLA 2ZPIB 4PJOA 2LJ0A 4PJJA 3CCEA 2CH4A 2WADA 2OTJA 2ZBKA 3BROA 1J0RA 3LA3A 3KX2A 5LGUA 1TQMA 1X1DA 2OAZA 2J6OA 4FIBA 2MCNA 3G71T 2H8HA 1RLQC 1W36D 4AMCA 2XDBA 1S72I 3VJPA 1J5YA 2MSYA 5J4YA 1PUFA 1B8IB 4XTZA 3KP6A 4XRFA 4CA0A 1QQJA 4N0AA 1YJNQ 3CCQQ 2Q2EB 2D5VA 4HLYA 4KUIA 2JPBA 2KROA 3LW5E 1X6OA 3I4PA 2FOKA 2KRSA 2K86A 3ULRB 2LD5A 1VQ5Q 2WAEA 4HCCA 3K4NA 1NLOC 3HSEA 2DA4A 3CDLA 1S9HA 3FWEA 1Z9QA 2V26A 1NZ9A 4JX4A 2BE5F 4BHPA 4HT9A 5D5WB 4YIRX 4PNOA 4RAYA 4ENJA 3JCUC 1WQ7A 2IS4A 2R7XA 1IGNA 3SWNA 2VBXA 2LCLA 1ZN2A 4BXXJ 2IBDA 5F04A 2M51A 3R4KA 4J5YA 2JZYA 4LUEA 3IC7A 5D4RA 1K9AA 4L18B 1GT0C 3EGDB 2ZGWA 3P9KA 2E5KA 1TNTA 2KR3A 3J80R 3X28B 1KD1U 3J81Z 2EV5A 3M0PA 4QWQA 2CSIA 1T6SA 4BJ5C 2RNAA 1CGPA 1E3OC 2DIGA 2UXNA 2UV1A 3IWZA 3FK7A 2GBYA 2HOSA 2VJJA 4FM4B 2OJED 1VQPT 1BA5A 2FVUA 2L2PA 1HJDA 2JM8A 1PRMC 1X43A 2O3FA 4RAZA 3EDPA 1YJ9Q 4MDXA 5CQGA 5BPIA 1A6IA 2QYZA 2J7IA 3CCYA 1OQYA 4B43A 5LEJA 3PIPF 1WHLA 4N0BA 1X69A 2KZGA 3VSKA 3IAM2 3ZN1A 1X58A 1VQ9A 1QZZA 2DU9A 2DIQA 4AIKA 1K73C 3Q0UA 1IV6A 3U1KA 4B6MA 4NQWA 1K1ZA 1FMWA 3V8LA 2CUEA 4KICA 4Z88A 1MD0A 1RKTA 5J1UA 1K0SA 4XOTA 4ENMA 5DLOA 5A0GA 4M72A 5M5YJ 2X3XD 4BUPA 1H92A 1TW2A 2JRMA 2R93J 5HLGA 2CP0A 4EM0B 2JVGA 3LA7A 3GMEA 3KYDB 2E12A 5FWBA 3ULQB 3VYSB 2JMWA 3OMGA 2OTJQ 3BTIA 3EFRA 3HSBA 1YHQA 3SWNC 2M1BA 3J81R 2DA7A 2M16A 3CCUI 2IPQX 1DGRM 2DXTA 3H5RA 3BJ6A 3D7SB 1FYKA 2XDPA 4PGHA 2PLYA 2R58A 5E8IA 4F52A 2WSCE 3C2GA 1VYVA 4C5IA 1GLNA 4B4CA 3OYCA 2E3IA 3TOAA 3TO7A 2L8DA 2OU2A 3ABTA 4HBLA 4P9FA 3M0QA 4JRKA 4LD6A 2HMAA 1TG0A 3H5NA 2X1EA 1RRJA 2MK5A 1ZTRA 2NS8A 3ZMTA 1RR7A 2CUBA 2ESWA 3MP8A 2CO5A 3QYBA 1D5YA 2HZYA 4DZPA 2DMUA 1T95A 3DTIA 3MWMA 4X0GA 4J01A 1U06A 1WYXA 2C0OA 1N8RU 2DRKA 4HF2A 4RKUE 1SF9A 1WFXA 4IRHA 1XGMA 3J7AO 3PIPA 1BIAA 2EZIA 2Y0SA 2F5FA 5HNFA 9ATCB 4M7AE 1KC8R 1AEYA 1O7LA 1I50J 4UB6C 4YFKF 2VQHA 2EV6A 2QSFX 5DV5A 4DQ2A 2DYIA 2KRMA 1E2XA 3E3VA 4M9XA 2P0WA 1LEBA 1OZ3A 2V8JA 4Y33A 2FZCB 5GAMj 2LVMA 1ZUUA 3ZFJA 1KD1C 2XGXA 2HDCA 3MQ0A 4G94A 3RI4A 2PTKA 1K8AU 1JUMA 1QNTA 2VBWA 3ZQLA 3FXUA 1BM9A 1VQMI 2J05A 1JT6A 4J9IA 2R7OA 4L5JA 1OPCA 3VWBA 4RTWA 4CC4B 4M7AC 1TWAJ 1PHTA 1V54H 5CQYA 3GLXA 4D5FA 5EEGA 3DLAA 1YJ9A 4L0YB 2E1HA 4VUBA 2FOWA 2EA2A 3P8BB 1MMSA 3PNYA 3GTJJ 1MMGA 2BY3A 1WJRA 3KP2A 3BDUA 3V7SA 1EZZB 2KT1A 1Z6RA 4L6V5 1MBKA 3DLLA 2DBMA 1VQLA 1LE8B 2OC6A 1VNDA 1UGSB 4CHUA 2YX4A 2JJ9A 3CCEQ 3AHUA 3IWFA 1XC5A 2W85A 5E3MA 2K9QA 2KQRA 3ZMDA 1VQPI 1YO5C 1N9SA 2EYWA 4OU0A 3KP5A 3ER0A 2IXSA 3JCMh 1YTYA 4B8XA 2DOFA 2AZSA 4KN7X 1FSHA 2JUCA 1MJBA 4F04B 1LJ9A 2KIFA 1VQOT 3LGLA 4QQDA 2K3BA 4L9VA 4F7UG 2DT5A 1U3OA 2CT3A 1FBUA 2L7MP 4U7BA 4G7HF 1JKQC 4J9FA 3JCMg 5F64A 4Q5WA 3JCMd 1R0BG 4GFBA 4I99C 2MC4A 1Y96B 3A8MB 2HI3A 3H9JA 2XSJC 1R5ID 4WF2A 1P4WA 4EV0A 2R7FA 2YR2A 5FLVA 1I81A 5GMKj 4ETSA 2HEOA 1FP1D 1EIFA 2RD1A 1H9GA 2RK1A 4F7ZA 3CBOA 5KE2A 1V4RA 2R4GA 1M3CA 4UV8A 2YUOA 3EAEA 4II3A 4RS8A 2PVDB 4C92E 5IXBA 4ZJZA 6AT1B 2DA3A 4HDVA 1JUSA 3B02A 1R6RA 3K9TA 5E8GA 1NLPC 1PG5B 4FT8A 1OCTC 5ERIA 2GZWA 3OYEA 3TQNA 1O7FA 2VT2A 3CCRA 2L3PA 3R0JA 4A0ZA 1R8OB 1SPKA 3CUQB 4HG2A 2E1MC 4PSWA 2HDAA 3SFZA 4F55A 4PK4A 3WTWC 2E2IJ 4PJLA 2IG0A 3CCLQ 1B9MA 2F4MB 2EJRA 2HTJA 5KYUB 2FMYA 2HOEA 2R92J 1I3QJ 1YQAA 1WHHA 5JLWA 3O8VA 2IIMA 2CQXA 2AXLA 1I1SA 2YWWA 3QU3A 2JNGA 3M4GA 3IRQA 4XQ3A 4HX8A 1Z9ZA 1NE8A 2BBYA 1WCMJ 3SQNA 4L9TA 4M9SA 2OV7A 3H5AA 1SFUA 3WU2C 1OQKA 3QDRB 4XKWA 1UHCA 5DM7R 4LD9K 3IH3A 2H6CA 3F8CA 4EGZA 5BPDA 2K9MA 2JT4A 2DT6A 4Y4RA 3IKTA 2DT7B 2M35A 5K5OA 5CKHA 2X9DA 5IT9Z 2EA4A 4HNTA 2COBA 3FKIJ 3JRFA 2E5NA 2K27A 2TCTA 3T8RA 1SG5A 1KQSA 4R1HA 2DJQA 2PN6A 5GAOn 1VQMT 3RCOA 2V1DA 4N9HA 3BCAA 3LSKA 4DBRA 3J7YJ 2L0AA 4AUXA 3T9NA 5LJ3d 4M75G 1B07A 2BW3B 2EB7A 1ZR2A 1BK2A 1GFCA 2HKNA 2K57A 1RADB 3QIIA 3I56A 1TU0B 3GPLA 4IHSA 1MH3A 3H41A 1OCRH 2CP2A 2DA6A 2CS7A 2ZPHB 4U87A 4D7MA 1N75A 1SEMA 2F5EA 2F5CA 1BI0A 1O3QA 3K10A 2HVRA 2DZ9A 4CCKA 2FZKB 4OB2B 2Y69H 3HHHA 3K2AA 3LOCA 4A12A 2HBWA 2J6KA 2RI3A 3JV3A 2K3YA 3HL2A 2ZCWA 3RKWA 4HVWA 2JUGA 4Q47A 4R79A 1SD7A 4HAMA 3A0HC 4W97A 4XKCA 5GP9A 3OSVA 5F1RA 3CCUQ 3A03A 1G4DA 4EVIA 3MVPA 2GLOA 1G83A 3NPFA 1S72Q 2OTLQ 1C0WA 1X6GA 1WWXA 3G6EA 1FIPA 5IYBJ 2STWA 2M45A 1O9SA 3OYKA 1T38A 1YI2A 2O2OA 4R0KA 4RTUA 1TZLA 1G3TA 4EGYA 3M59A 1H3HA 2J5OA 3S93A 2IA2A 2RDPA 1Y71A 3NGPA 1FJLA 1LNWA 2VQGA 5AYFA 2KHMA 2HBPA 2QAZA 3QWYA 5GMKm 4XLHA 2W57A 4L9JA 3NTIA 4M6VA 4BHBA 2H6BA 3OYJA 1J9IA 2VC8A 3CPWS 4OB3B 1UZCA 2ZPGB 2A5YB 1KONA 1WJBA 3MEAA 3IRRA 2D0QB 4LDVA 2GBQA 1VQMA 1RIOH 4M7DB 1VQOA 1SFXA 1YYVA 3JRIA 3ASKA 5FLXE 3W6JB 4ZYHA 1U5TB 3B73A 2G6FX 4BE2A 2ID6A 3CCJQ 4JP0A 4NBQA 1IN7A 1NG7A 1XGSA 3FISA 2C0IA 2DJZA 4FYWB 4C8QF 3QYGB 1QWEA 2DQRA 3X2QH 3HKSA 2ECBA 2V1RA 2JT1A 2DPUA 4UNOA 1WJFA 2COWA 2PX9A 1JXOA 2XG8D 4RCCA 1OV3A 4YFXF 1OR7A 3HYIA 2XSDC 2RN7A 3IV5A 2E19A 4MQVA 1SFOJ 3AT1B 1ZELA 1YX3A 2GOXB 3HKZA 2CUZA 3CCRQ 3G4SA 4A3IJ 5B5EC 1EF4A 3KYLA 2DK8A 1MMAA 4EMHA 2QEXT 1SSFA 2NVQJ 2VUMJ 2QXFA 2K9NA 3CMYA 4BQAA 2LBFB 4ESFA 3G6ET 3W2VA 3CCMA 2LDMA 4A2UA 1YNZA 5KYYA 3S17J 1FBQA 2CZ1B 2K3PA 1OJLA 3HB9A 4HW0A 1Y7XA 1QZEA 2ZPFB 3EHQA 1AWWA 2YSRA 2EFPA 2QUFA 4FQGA 2DL5A 3NRVA 2EQUA 4OMOA 1XJWB 1FNNA 1V55H 2OA4A 2WBMA 4BBRJ 4GXOA 4BXUA 1VQOQ 5ILSA 2R3SA 4DEYA 5GADJ 8ATCB 1U78A 2P0TA 2XAFA 4M7AF 3CC7Q 3RPQA 4J83A 3VS0A 5E3OA 2KY9A 2Z2SB 1YLFA 1MSEC 2LTPA 4MTEA 2MF2A 1CKBA 3O3KA 4KH0B 5M5WJ 2P7CB 5IT9K 1XN7A 2MD0A 1GBQA 2R7RA 1TTHB 1NYGA 1AKHB 1BOBA 2EIJH 4BQQA 4LN2A 4C8QB 3K1MA 1I0CA 2VC1A 4AFQC 2O9LA 3LSGA 2KISA 2WSFE 3JCMJ 1MV3A 1RLPC 2K7LA 4KGVB 1LEAA 1YP5A 4HQEA 2EFNA 2RO0A 2RJFA 3PVQA 2ACJA 1VQKT 2LKSA 1W36C 1BI2A 1X1AA 5HLIA 1IXRC 5HLTA 1FZPB 2COYA 1A04A 4RUGA 3G71I 4MZMA 3OMYA 4CUGA 2QEXA 1OYIA 1FWZA 1HXDA 2HVSA 4GBQA 5CIUA 2VN2A 1PD1A 1YIJA 1YJNT 4S05A 2QKMB 3K4JA 2MIOA 2YSQA 3INZA 2RVCA 3S1QJ 5C4XJ 1QHHD 5KCHA 3WTVC 1JJ2P 4HZFA 4C0GA 5F0FA 1K8AC 3ZMUA 2VONA 2VKVA 1WHGA 4OP0A 3PSIA 1SRLA 2KK4A 3L2RA 4FW2A 4XSXF 4MGRA 2LP5A 2HR3A 3N97A 1QA6A 3CPFA 1YJWQ 3P5JA 1SANA 3GZ6A 1T0JA 2OF7A 4NUBA 5CYVA 5A2QK 1KQ2A 2ELHA 4I98B 1H89C 3GFIA 4RM3A 3LSIA 4C92B 1MBHA 1T2KA 4NC6A 4F93B 4HX4A 2XK0A 4E7ZA 2Q2EA 1BL0A 1ZRCA 1AZGB 1I5OB 3KEQA 1X1PA 3CDHA 1VQLT 2HU9A 4IUTA 1AWXA 4D8KA 1J09A 1P6RA 2K5FA 4ELZC 1X4OA 1VOMA 3JSPA 4OMYA 1MBFA 4RAGA 5AONA 3M07A 1R49A 3M55A 2VB6A 3FBIB 4WCIA 1FMKA 5LGTA 4J9CA 2ADUA 2DTHA 3F6OA 1Z77A 2GXGA 1UHWA 1X27A 2AIRB 2JMAA 1XSXA 4UB8C 2CZ6B 2TRTA 2QZ8A 2FXAA 5IOZA 2CP5A 5GAGJ 1LFUP 4IL6C 2EW3A 2XAHA 3ONQA 1STZA 1E3PA 3FLGA 1SVLA 2X85A 5GANd 2CUFA 4G6QA 4DOZA 3HOYJ 1YI2I 3M8JA 4OIPF 3G6EI 3J7ZI 1B7TA 2E10A 1XTAA 2GOMA 2HL5C 2K6DA 1ZQ1A 4A3LJ 1JB0E 3SEMA 1VQ8A 2RNJA 1JXMA 4I0BA 2WV0A 3MCAB 4JPBW 4GDFA 1E3HA 3CESA 4OWRB 4C9YA 4OAZA 4DJAA 5CKBA 1NH3A 3L7WA 2DYRH 5J3LA 3TDZC 2QQSA 3KYCB 2GFUA 3JSCA 5GAMe 1KQSS 2O8XA 4AC0A 1O3TA 5L8RE 4N4OB 2XF5A 2WSEE 5CKDA 1GXIE 1Q7YR 3UA6A 3WTUC 2PMZN 2ZJ2A 1ZG3A 3FXOA 1ETWA 4E7LA 4I01A 3E5QA 1LDKB 1W7PD 3E0JB 3MMYB 3MPUB 3BC8A 2MA3A 3I4MJ 2DMPA 5DCMB 4G8XA 2F2VA 2GTJA 1JJ6C 2KYBA 4IQ4A 1K78A 3NFCA 5KYWA 2D1HA 2G9WA 1UG0A 1KYWA 4C5HA 1Y0MA 1BW6A 1FEXA 3P8DA 5ED4A 2O01E 3C94A 2BZYA 2E34A 1J2XA 1U9OA 1ETVA 3I58A 4HQMA 2R5YB 1PP8F 1OLTA 3K70C 1I4K1 3EGXA 3HIFA 2D8HA 5CKTA 4QSHA 2DXBA 1IXDA 2XPUA 3DXJF 4AYBN 5FLXK 3K70D 4JZ3A 3RUXA 2LF7A 4BJ6C 2EGCA 1Q81R 1QVTA 4UXNA 4EIKA 5GAN7 4M78B 1Y1WJ 5J40A 3CCRI 1IZ6A 3GNGA 3RKXA 5D8LB 3ZMSA 3FXJA 1JTXA 1MKMA 3IAS2 2VJ4A 2EZHA 3SZGA 1OCOH 3BR6A 1D8JA 3CTAA 1AOJA 1Q1VA 1AWJA 2ZAEA 3UWNA 4F17A 1Y6IA 4E6RA 4IPAA 5GJVB 3W2AA 1P7JA 3U9GA 2FSWA 1E7OA 2XHKA 5GANj 1K73R 1LVAA 2KRHA 3BR1A 1IB8A 2CS3A 1K0XA 3UPUA 4JX6A 5FO5A 3BPXA 2I2LA 2HEQA 4C92G 1ZSZB 1AWOA 3LH5A 3AG1H 3M1CA 4LB5A 4BS9A 2VUBA 4XQFA 4N4GA 1M1GA 1KIKA 4HRIA 4B9WA 1W5CC 1DU6A 3REAB 5EYRA 3DEWA 2DX1A 1FX7A 5FROA 1VQLI 4FYXB 3SFMA 1MIJA 1RESA 3K7AJ 5EZGA 5E18F 2DJNA 3C2BA 3O2PE 4MTDA 3H8ZA 3X24B 1F36A 3BCBA 4BGDA 3CCVI 2HQXA 5LJ3e 3C95A 5H6RA 1XCBA 2XUBA 4EM1A 3M9AA 3WVDB 2B0LA 2H3JA 2DVEA 2P4RA 2E41A 2LREA 2RM4A 2COZA 4UUTA 1R23A 2XPVA 3H35A 1UFFA 2JN6A 1UMQA 2HDWA 3JCMW 1M8VA 5L23A 3DWLE 1XTDA 2QENA 1U8BA 1GV2A 3KLOA 2NYSA 4XL9A 2H27A 2KP6A 3GVAA 4U88A 2DK5A 1ZX6A 3X26B 1VQNA 3QODA 2RHXA 2JTEA 4JBAA 5D8KB 2Z16A 2YRCA 5LJ3h 4RTXA 3CCVA 2BY1A 3PNVA 1X2KA 1Z0XA 4ENKA 2IS1A 4U0VA 1RI9A 3S2HJ 2R57A 1REPC 4RDUA 2VYTA 3PNTA 1T3SA 3WVEB 1H641 2RQUA 2R5YA 3CCLA 3DKMA 4LK0F 4ASNA 3DKXA 3Q9VA 3W6VA 1UTIA 3TOBA 1WH7A 4BI4A 3CBPA 4M73A 4HSRA 1BBYA 2Q1ZB 4P96A 3TO6A 1UJ0A 2JJ7A 2JN0A 4M75C 1ULYA 2HYJA 1JU5C 1SVOA 3CMMA 1QVPA 4RB2C 3FXRA 3FMSA 2DLPA 5GJWB 4I2OA 1VQ8T 4EPCA 5HS8A 1USTA 3GTPJ 3PFSA 2CV1A 3WGIA 1BCOA 2ZSIB 1LKXA 2MPXC 3EUAA 2NOGA 4ZC3A 1ETKA 4A3BJ 1W1FA 1IDZA 2LC4A 4A4HA 5FB2A 1KJWA 3CXCS 2DXIA 2OI3A 3A8GB 1LDJA 2FRWA 4ZDLA 1HKTA 2CYZB 3F72A 4CICA 3L2VA 5DM6F 1QWFA 1WFWA 2IVWA 4NS5A 4X34A 4CC7A 4BQNA 1Q86U 5I11A 3V8KA 1WHMA 1WH5A 4M78F 2PFBA 1TTYA 4PSXA 2Y75A 3VPRA 2LQWA 2NVYJ 1YE9A 2C6YA 2RQQA 2UWMA 1WZOA 3JTHA 4Q48A 4D0PA 4XIDA 3DQVC 1NPRA 2RJDA 3EFSA 3ZQ7A 2BVMA 1XPXA 3M8FA 4BI8B 2CFXA 2F2EA 4HV5A 3CUQA 1BCMA 1BC8C 1T3LA 2DN0A 4HCBA 2G7UA 4EJTA 3EQLF 3JRCA 3QZ9B 2W7NA 3CCSQ 2NOJB 1HOMA 3EYYA 2E70A 5D6FA 2HWVA 1W5TA 3GXOA 5E17F 3CQTA 5GAOr 3RKQA 1WZ2A 4XU2A 1D0YA 4A0XA 5HK3A 5EG2A 4IX7A 1P4AA 3S16J 1OEBA 1CF7B 5B1BH 2PVGB 2FA5A 3Q3SA 1O75A 3M0UA 5I22A 1UB9A 4EDUA 2L9VA 5TRDA 4M77A 4PUSA 5FLMJ 1VQ5I 2GWRA 1UHFA 5GAMh 1QMCA 1R7JA 4IRIA 2DFHA 3OS1A 3PUFA 2MH9A 2JXBA 5GANg 1LOJA 3CEYA 5CK9A 5GMKe 3ZEHA 1TWCJ 3DLMA 2XRLA 5ICEA 2DTRA 1KU2A 3BZKA 2EGEA 1UB4A 4S0HB 5LGNA 2PMUA 5TJJA 5GMKh 1ZRFA 1BU1A 1VI0A 1QKXA 1TW3A 3K4BA 1YW7A 1WJQA 1YWPA 5FRMA 2AS5F 3AL0C 3TSWA 3DTEA 2P6SA 3MKZA 1OX9A 1QO0D 2DK3A 4QKUA 1Q82C 3C3WA 5M3MJ 4OIQF 1N5ZA 2KKOA 1FOWA 3QOPA 3DU5A 1R5GA 5FFXA 1R36A 1GRIA 3LQRA 4I6ZA 4JS4A 5DY9A 2DKGA 4LITA 5GAN5 2KDOA 3BDDA 2GNCA 4JLGA 2X0LA 3HRUA 1YIJI 3E6BA 1ONVA 1V76A 3KP3A 2A07F 1XNIA 5FWCA 4IUQA 4PJOF 4P9UA 3OMCA 1WKMA 2NYXA 3QU6A 2XGDA 3E6CC 1VIFA 5GAN8 2MC3A 1W4MA 4B47A 4QT7A 5H20A 3CLOA 2BZXA 4A4GA 4B9XA 4UUSA 1WGXA 1WJSA 1TS9A 2FNPA 3BZCA 3DTKA 1XDSA 3PVLA 4QVCA 2J5PA 1H0MA 2KDSA 4GLKA 4QIWN 2F4IA 2RF0A 1U8RA 2VGMA 2BHYA 3ZQGA 4A6DA 1LPLA 1FYNA 2CP6A 1R71A 3H9NA 3GFMA 2KIQA 4BE1A 1YITI 4JRQA 2XMFA 3SXYA 2IGKA 4LB6B 4A5NA 1MDMB 2QQRA 2ZJRF 1PRLC 3VS1A 2QEXI 3PUBA 1AT1B 3JAMZ 1H3ZA 3CP2A 2CZ7B 4IUUA 4AIJA 1VQNQ 4DYCA 5M5XJ 5F0HA 4J19A 3I54A 1JBMA 2JA5J 3GCMA 4FCYA 3L9FA 4BH9A 1QQIA 4HYEA 4XKBA 3QOEA 1M3BA 2ZPEB 3VDXA 2HGCA 5FKMA 1MJ9A 2P6TA 3L2CA 2H1LA 3FXMA 4JX5A 4UHTA 4N4IA 5CR2A 4JZ4A 2M1HA 2RQRA 3THKA 3CQZJ 2A6HF 3U2RA 4B48A 2EYZA 2F69A 3HOVJ 1TWHJ 1TT0A 4L0ZB 1IHVA 5LJ5h 4B09A 2ENMA 3GIBA 3TKYA 2PEXA 3PT9A 1RC9A 1YITA 2LKXA 5CQXA 1ZLMA 2L02A 4AFUC 3OYIA 1IUFA 1ZREA 4M78A 4L5IA 1W2BS 2TDXA 4M7AB 1NTCA 3J7AF 1W0TA 3SFIA 2H94A 3G1JA 4M3GA 2AXTC 3MCZA 2RHYA 3HGGA 3OYDA 4OINF 2MOXA 2P84A 2J6FA 3FB9A 3P7NA 3I53A 1WXBA 3FJPA 3P8HA 2L7ZA 4RA2A 3WTXC 4F7UB 2XC7A 5LJ5j 4M78D 1TSFA 4HVVA 3CDIA 4QQGA 5IH2A 4RGUA 4ESJA 2QBYB 5DLQE 1HQCA 1VQKQ 2A3SA 3WGHA 4J6XA 5FKNA 1HSTA 4F3QA 5IYDJ 4M75A 4DIQA 1Z91A 1U2WA 2KGTA 4HLXA 3H0DA 4EMSA 2EIFA 2LZ6B 5DYMA 2A37A 3NTKA 3P9IA 5L3DA 3EGDA 4WXDA 1X2QA 1RZ4A 2LT1A 2O9VA 4GY5A 5F6FA 3GZ5A 3HRMA 2MUNA 5GMKi 2FNAA 3CCQA 1VQ7Q 3AG3H 5JVTA 2VJIA 1U1SA 3CJQB 4FW1A 5LHHA 3A0BC 1YJWT 5EDNA 3BG9A 3HL8A 3VYHB 3CMEA 1K8AR 1ETXA 3IL2A 2PUOB 2ZB9A 3M1EA 1RAEB 4PJMA 5FD6A 1S3JA 3UDCA 1X3UA 5GTHC 4X6AJ 2EQMA 4PLIA 4ZYAA 2QQ9A 3OYYA 4B3XA 2NS0A 4J7IA 2BXYA 2BY0A 2QQ8A 3F6VA 3MZHA 2EQIA 2W82A 3WU1B 3OYNA 1BW5A 1KHIA 5J1RA 1R0CB 1ZBXA 1KQ8A 2NUPA 2FD5A 1VQ6Q 5GAN4 4IQJA 3BR5A 2DAQA 5E1ZB 3QPHA 2LJ1A 2BTTA 2XF6A 2CUDA 3ERED 4X1VA 1G5VA 2KEAA 4JJBA 1HKQA 3WG7H 1U6GA 2VPLA 1H8AC 2F5VA 1MV0B 1UG1A 2K79A 1K73U 4FX4A 5EGOB 1RAFB 1S6LA 2JZ2A 1UGRB 1WJDA 3LX7A 2XDDA 4U0YA 3A52A 2DBBA 4XTXA 2LG4A 4X1EA 2OZUA 3ECOA 4I7HA 1R00A 1KD1R 2JVVA 4NL3A 3PFYA 2LVSA 1YWOA 4BEHA 1F9NA 3I55I 1B3QA 2M87A 3Q0VA 3JRHA 4ZTFA 5LHGA 3SHWA 3CC4T 3MFKA 2QASA 1UHMA 4AVPA 4XR6A 2ZXHA 3B6AA 3WTZA 4Z6YA 2IS2A 2W0ZA 3M0TA 4I02A 4DW6A 4PJOD 2DLLA 3OY9A 5HS9A 1T8IA 2LNHB 2P0QA 3D5RC 3LQQA 4M75D 3VS2A 2CQQA 3OIOA 4F7UA 3JRGA 3BR3A 2JA7J 2IAIA 2FL7A 5A0LA 1H9TA 1YN8A 3QBYA 3DBRB 3PQJA 1Z67A 3REOA 3OYHA 4EM2A 2WV1A 2A28A 2ZXJA 3HTRA 1JUPA 3I9QA 4XK4A 3I5UA 1IGQA 5LRSA 3BOQA 3MEWA 1YS7A 1R4MB 2DDBA 4AD9A 3RERA 1O3SA 1GVJA 2HVQA 2CSQA 2GGRA 2EQKA 2PUKB 3KBGA 2VBYA 3EG2A 2A36A 4QVDA 2ZPBB 5GANf 2FF4A 3I9V2 4ZYEA 4MHGA 1U0JA 2DBKA 4L59A 4BACA 1M90C 4C92D 1YRNA 3ZN0A 4M77F 2A6EF 3MAJA 3W6KB 2JSPA 2K3XA 4OIOF 3J80E 1GFDA 1MDMA 1J7KA 1M1EB 5GAN2 3CCSA 3EGUA 3SEZA 3MEUA 4M4ZA 4CO8A 2QKLB 3Q0WA 2EYXA 3BG7A 3CXCP 2OCCH 3JB9D 4C0ZA 5IN1A 2W84A 4X9CA 3OSFA 3PO3J 3DEEA 3ABMH 2QM3A 5KVRA 3V8JA 4A3GJ 5JHFA 3VS4A 3CC7A 4A63B 4P1WA 2QYOA 3F8NA 2NUPB 3E9GA 4KIFA 2MABA 4Y52J 5GAMg 1YIJQ 5BQTA 2R7SA 4AIDA 2B9SA 1PD0A 2AT1B 3QUIA 4KNYA 1Q82R 4ZGEB 5HLHA 2D9TA 4Z8AA 4C3HJ 3M7GA 4M7DD 4CH7A 2K7AA 2Y4XA 2XKPA 3WHBA 3D5LA 4DNCA 4D7NA 2DA5A 2EZLA 1F1BB 3GX4X 1PC0A 1VYTA 5ECAA 3LAPA 2EILH 2E2HJ 1QVUA 2K5IA 3K2ZA 1NJIU 4E47A 2BZ8A 2M3AA 4P5OA 1D1AA 2O8KA 5LJ5d 5EZHA 2HKQB 3A1PA 2ZJPF 1SKUB 5DS9A 2NVXJ 1RAAB 2K2VA 2P4TA 2V8IA 3L1PA 2STTA 4M77C 1WJAA 2WAQN 3HDDA 3RTRA 4XN0A 2DNUA 4HEA2 4JDSA 4EMKC 4LDWA 2XVCA 1QRYA 2X98A 4DA4A 2CFOA 3RMSA 5IHNA 3UATA 4PJOE 2RKHA 4RLQA 2HZDA 2F2XA 2FBHA 4ZZDA 4CI0C 4M71A 1ZSZC 3CMAA 1LQ1A 1XCVA 3HPGA 5E79C 1WXUA 3S3OA 3CCVQ 2DODA 4E4HA 4E7KA 1PCXA 4M3BA 3CJNA 5LBQA 3LSMA 1IUYA 2GFAA 2OD5A 2L3SA 2MVTA 3C4SA 1I5ZA 3UR3C 3VB2A 4XBFA 2NLUA 2V6EA 1T56A 5J8CA 3A5ZB 1NJIR 1W2BP 4HVUA 3CCMT 3FX3A 1LB2A 3GZNB 2Z33A 3OSSC 5K7HA 5J39A 2P8TA 1TP4A 3E9FA 2X4HA 1D09B 2L2OA 4DYRA 2GQQA 1ZG5A 4RTZA 2QSHX 4JRPA 4X9DA 1WQ2A 2L54A 4A3DJ 2MBFA 4KUMA 3VV0A 3CD6I 4A3MJ 4XRSA 1YHQT 1FBSA 3BPVA 3FBNB 3QXEB 1SMYF 4M6XA 1BI1A 1NK2P 2M34A 3EUHC 6PAXA 1FLIA 2Y90A 5LJ3g 4NDLA 2HD0A 4CZZA 1A36A 3HTSB 1T33A 4AWXB 1JKRC 2O61A 2YUPA 5FU7C 2MW8A 3HPHA 3VODA 3E19A 1NJIC 2IEKA 2K2MA 3PTAA 1WJ5A 1P92A 1W4SA 1VFCA 1TL8A 2VC0A 1EV7A 5KYWB 2I8DA 1ZBJA 2PI0A 4OMMA 1EFNA 1I6HJ 2KRNA 2DA2A 2CT4A 2NUZA 2OUMA 2FEZA 3DEUA 2HNIA 2R5ZB 1VQ6T 2XAJA 4Y13A 2KFDA 3A98A 1M90R 2PQ8A 3HTUA 3TMOA 4FYVB 1QCNA 5K1YA 3GTOJ 3DPUA 5HKCA 3G1LA 5C44J 1JTYA 1TH7A 2M7BA 1HSQA 3S15J 2PMZA 3O5ZA 4J9EA 3A1YA 2FE3A 3QQAA 1M1KR 3G7ZA 3NAUA 1FTTA 1XS9A 4ESRA 3H9QA 2B7EA 4O5VA 4IURA 3OV8A 5IOYA 1PM3A 4A4EA 2H8WA 2ZMEC 1G59A 4M75F 1KC8C 2VXDA 1UECA 2KE9A 2D45A 3I5RA 1UELB 3VRZA 4U0WA 3RPUA 2JVHA 1PUFB 2LX9A 5FU6C 4C2UA 3REBB 3JCMX 1VQ9T 2ZNZA 5GAHJ 3K6GA 4QVZA 4DBQA 2R7WA 1Q86C 1YG2A 1GL5A 3HOUJ 3S2DJ 2H3EB 2ROTA 5FLXR 4II1A 4YIFA 4IRGA 2F1LA 3H9GA 3ABKH 1VQ5T 5DEQA 1H8KA 2DTIA 1T39A 4ZGJB 1A5JA 2WB1N 2QDYB 3GP8A 4A3JJ 1QVGS 3S1NJ 4ORZA 3ZQFA 1BB9A 2VIXA 3HOSA 4D5CA 2H8RA 3RR6A 1YBYA 3DB4A 4C92A 2GA2A 4QPOA 2KNBB 2X1DA 3QPLA 4RGXA 2WAQA 2CDTA 3Q1JA 4C3JJ 4C0DC 3A2KA 4CYCB 2GAUA 4CYCA 1FYLA 1CQTA 3DPLC 1S7OA 3BR2A 4XU0A 1KA8A 5FD5A 4M78E 1BR1A 2RPNA 2DFFA 4CXFA 1SAXA 2PJRA 2JW4A 3RNJA 2ZNYA 3HPWA 1R5HA 2XIGA 1AA7A 3PM1A 1MSFC 4JUVA 1NK3P 2DFIA 3KEOA 2KRFA 4BU2A 4Y92A 2IPOB 2E65A 3CCEI 4ZDPA 5I2MA 2O5RA 4MZPA 5F0CA 3RQ4A 3COAC 5D6WA 3RESA 5D4SA 4D1QA 2OTLI 2ELKA 2V1NA 2QA4I 2A0FB 3EG9B 2QK0A 2R7VA 1KGSA 5FLXZ 3OW2A 3CBMA 5GPAA 4QW2A 4Y7NJ 1YIJT 2BUDA 3GOXA 3NARA 2Q0OA 4AU7A 2K02A 3KLNA 5E3NA 5B1AH 4OB1B 2HCKA 3SZPA 3TP3A 3NMZC 2JTMA 4PJ0C 4HDUA 1IC8A 3WHCA 3GTMJ 2WC2A 4IXAA 2EH3A 1KK7A 4J8OA 5CQEA 3TDUC 1DQUA 4PJOB 1B6AA 2RK2A 2VKHA 5L3EA 4BHCA 2RHZA 2K4YA 1G8XA 3N5BB 4ZTJA 3L42A 2CQNA 3QWLA 2HS5A 3QPTA 3RZDJ 4F7UE 2AZVA 2OTJT 4DEXA 1U3EM 3OOPA 2HOTA 1Q7YC 1VQ4T 3JAMR 1YI2Q 4BJTA 4BY6B 2V9VA 1S1NA 1TXQA 4G7ZF 3WTYC 1GHCA 4RBOA 2WY8Q 1VQNT 3WODF 2VGNA 2LQ8A 3A8HB 1D0XA 2HYGD 3QKJA 3AFHA 1N8RR 1N25A 4WXCA 2YU9J 3WXMB 5GAOq 4PDKA 4IUPA 3JCMP 2XIDA 2X4JA 4RAFA 5DD4A 1LVKA 3CUQC 3ESWB 1KZHA 3GYHX 1HBXG 1TUCA 2JTFA 2LCCA 1ZLJA 3WE2A 5L3GA 5LHIA 5IY5H 1R9TJ 2M02A 1NEBA 4MMLA 2M30A 4ZNXA 2RI2A 4N4HA 3SDZA 1Y8QB 2QGGA 1APLC 2Y30A 3HJEA 1P4XA 3DB3A 2LQNA 3FRNA 2M9UA 4WWCA 3VU3C 3WG9A 3FDRA 3G4SI 2Y4YA 2YLBA 4RLFA 4KMUX 1SFKA 1M1KU 1RNLA 3JCMf 3S32A 3ZMVA 4EJVA 1GCQC 4XTUA 3ABLH 4GRIA 4J9DA 1BYMA 4UC4A 2M4GA 2AHQA 2EPFA 2O7OA 3EUKL 4BNCA 2YRVA 1IXSB 2FPEA 4N4NB 2VL8A 1ENHA 4KITB 3CCJA 2R7DA 1YIOA 2A6TA 4RTVA 2E2JJ 2EK5A 2RNGA 2ECCA 3M4YA 1FYMA 2F6CA 5CVJA 3PO2J 1Z3XA 1WRJA 4BI3A 4Y91A 5LJ3f 3JAME 5CVUA 3JCMe 2RH2A 3KXTA 3UNGC 1VQOI 4BYYA 2WTEA 4XRSG 3DU6A 4FETA 3ROUA 4M74A 4ZH4F 2GQIA 4LUDA 3RZOJ 3DKYA 3GFLA 3L2WA 3E6MA 4EMGA 1U5SA 2VKEA 3HUGB 3J81E 4JS5A 1UAAA 3VOEA 3VEPA 1IGUA 2M0MA 5IP6A 4J00A 4ZYDA 1K78B 3A02A 2E7WA 3CZ6A 3H36A 1JI8A 2LQKA 4AFZC 4HX7A 1VQ7T 3CC7T 5L3CA 1IW7F 3F3XA 4CSWA 5HOOA 2LJ3A 2M5WA 4XK8E 3CCET 1OMIA 4N0AC 1PNJA 1YJWI 2PNIA 1YS6A 3SD4A 1G2BA 2QA4T 1WNLA 3VUBA 4JK1X 1WHUA 5DTDA 2C0TA 5EEHA 1JGSA 3F9KA 1HW1A 3HGYA 1K7AA 1HYOA 2K5LA 2HYFA 1I6XA 2KT8A 2OTLA 1QPIA 1W0UA 1I1JA 1X01A 1V3FA 3IUOA 4L5EA 5KYYB 3QAHA 4EMKA 2XAUA 4O3MA 2FPFA 2KXCA 5BMZA 2XI9A 4PFOA 3HP9A 1M2OA 1ZARA 2FX0A 3H3ZA 1UFMA 2R7QA 3GTLJ 2DO3A 5ICFA 4GLMA 4DOVA 2LC2A 1W1WE 4RCBA 4OMPA 2JWTA 5IXFA 2IA1A 3BTJA 3K4MA 1WDXA 3AG4H 1D3BA 5AT1B 5IAYA 4M3FA 3DLLF 5GAEJ 4HCZA 5LJ3j 4M7DC 1GXPA 1KC8U 3D0SA 2OTJI 1UEBA 5E20A 1ZRDA 2VE8A 1MJAA 4EJOA 3K0LA 3W3CA 4LXCA 4XU1A 1IJWC 4D8DA 2FO0A 3R60A 2ZSHB 4HCKA 1JT0A 3QDFA 4BBSJ 2E35A 3G2BA 4IVNA 2FBKA 1M4ZA 4OVAA 4DOWA 2W10A 2ATCB 2QI2A 2W4SA 1EKEA 3QHSA 4NB5A 5EF6A 1C1AA 5E3LA 4H4KC 1VQLQ 1FIAA 4DYQA 1VQ4A 5J4VA 5A2QZ 2CG4A 1EH6A 2LLKA 2O4XA 3MN2A 4FISA 2EBIA 4GCVA 2Y9ZA 2KI7A 2OZ6A 3ZGKA 2W1OA 5JHUA 1UHSA 3ABUA 3FHNA 1KQ1A 4S04A 3N4MA 3QZ5B 5I2SA 1X75C 2KJBA 5GANh 2KIMA 3QP6A 4XLPF 1N27A 4AG2C 3MKYB 1FPQA 1Q81U 2DD5A 3UT1A 2DFUA 1M27C 3CP8A 2FYKA 3UKGA 3OR1C 2QSGX 1E17A 1M8MA 3BDLA 3UF4A 2CRGA 3B6CA 3QYFA 3RPUD 3SDBA 5K5RA 3CCSI 2VODA 3OS5A 4D6WA 1A0NB 3S8PA 2HPIA 4CCOA 4BAYA 3OYMA 4IZZA 4C30A 3HOXJ 5TGTA 2K85A 3CC2I 4LFUA 1K6YA 3KCCA 4KT5C 3S1MJ 5I21A 4BY7J 3CF2A 2DM1A 5J1YA 2R7ZJ 2VT3A 1A31A 4C8QC 2UXXA 1UCRA 3TW6A 3ZQHA 1VQ7I 2JA2A 1SD4A 4M78G 2NNNA 1ETQA 5A2QR 2GF7A 1U1TA 1VQ4Q 2LSOA 1K61A 1RAIB 2ZXWH 5FKOA 3T1BA 3OR2C 1TUDA 2EVRA 2HTSA 4XLFA 2IGMA 2BY2A 4LIVA 2ISYA 3OL3A 4RM2A 2CP7A 1F4KA 3PNWC 3EPZA 4NC7A 4OB0B 4Z02A 1F1ZA 3CMEQ 3CCUT 3R6SA 3PMTA 1VZ0A 3DFGA 4NOYA 5M3FJ 1B34A 2DL7A 4IKFA 1OI1A 2KYMA 2R5MA 2DMQA 1SFEA 3NEUA 1QU3A 4FSXA 3FXQA 2M8GX 1OCCH 1XG1A 1DP3A 3DCFA 1GVDA 3SYTA 5CLSA 3WTTC 2BE9B 5JVGF 1D8KA 4KT6A 1LUJB 4OGEA 2P5VA 3FIFA 4GGGA 1AHJB 1P7IA 2RQTA 5KYUA 4ANJA 1S7EA 1HCRA 3R6OA 3G71A 2G0EA 3CPWP 2X9HA 3L2QA 4FX0A 1WIEA 1ETYA 4Z2YA 4EJUA 3IH2A 3A01B 4XOPA 1X6BA 4XTWA 1YJ9I 4C92C 2V4JC 1S72A 1Y0UA 4Q4ZF 4XAXB 2Y9YA 4ON0A 4F16A 2L0KA 4OF1A 1K4US 4YELA 2CWEA 5DM7F 2K9SA 2RREA 1BR2A 3BQYA 2K3FA 3GTKJ 4M77B 2LDUA 1Q7YU 3MP1A 2DZCA 3TBIA 3MZ8A 1LFBA 5TISC 3SZTA 4I0AA 4TVRA 1VIEA 3SEQA 1W7PB 1VQKA 2W00A 5JI6A 2JS0A 3CJTB 1IZ1A 5F08A 5C3EJ 1N6AA 2DMOA 3ELKA 2F5TX 2O9SA 2RC4A 2FG0A 1OPLA 3F70A 4F92B 3H0GJ 1YHQI 2IJLA 5KNLA 3J80Z 4ZDOA 4J7FA 1J75A 1B8IA 2Y0SN 3PGGA 4ITVA 1NHAA 4C8QD 2B8AA 4MEXF 2Z5UA 2E1OA 4M3EA 4HNVA 3G6EQ 1Z6TA 1RACB 3C7JA 5CO7A 1MBJA
chains in the Genus database with same CATH topology
1G3WA 1FSEA 2XHCA 5CAIA 1Y96A 5DDGA 1QZYA 4C92F 3JCMb 3HSFA 4M77D 2ESNA 2GXBA 2LTOA 3SWNB 3M53A 4ENNA 2RI5A 5LRRA 2MLGA 4PL6A 4CGZA 2PQWA 3E97A 3K1NA 3NQOA 4LGWA 1O3RA 4GO1A 3BJOA 3CCQT 2RJCA 3OBWA 2DAOA 1W5SA 1B59A 1P2FA 3M9QA 2YU3A 2EFIA 3RKYA 3L09A 3AAFA 4ZN1A