2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
1I5ZA 1ZLJA 3J81K 4ESBA 2HGCA 3OOPA 3TO9A 4LK1F 4OU0A 2ZNZA 4EJUA 4GXOA 3WE2A 4ZZLA 2A6HF 4LLGF 5FFXA 3MZHA 3F8NA 5D8LB 5HLHA 1QW1A 3M9AA 3Q9VA 1Z05A 1IW7F 5K5RA 3LQQA 3JTGA 1IN6A 4MNUA 1CF7B 1BOAA 2K5FA 4IPAA 4HV5A 1XGNA 4OIQF 3ULQB 5E8IA 3ZMUA 4TV7A 1YYVA 2LKPA 1P2FA 3HSEA 5FLXK 5L3GA 2DLLA 2KJCA 2FE3A 2XV4S 2C6YA 1J75A 1LDJA 1XSVA 2FNAA 4CO8A 5H6QA 2P5VA 3K1PA 2K27A 2H09A 2XHKA 2YX7A 4XLNF 4I2OA 1XMKA 1IAWA 4WCGA 1OYWA 1D8KA 2H6BA 4LFUA 1FT9A 3QU6A 3GX4X 3DPTA 4KNYA 3SQNA 2TDXA 3BOQA 4YFNF 2UXNA 1R22A 1ONVA 1ZRDA 1D8JA 2EK5A 4FHTA 5TRDA 5ED4A 4KFCA 1P4WA 2Z3YA 2ACJA 2XAJA 1IN7A 3T1BA 1BI2A 4LB5A 1DPRA 1F5TA 3ROUA 3ISPA 2L4MA 5LGNA 2L02A 2NS0A 1IF1A 3QPTA 4WK8F 2EA2A 1HBXG 2QYOA 3EETA 3QRFF 5ERIA 4P55A 3ZMZA 1OPCA 3HRSA 2V1DA 3LA7A 4RGSA 4OIPF 2IA2A 1XGMA 1ZRCA 3U2RA 4HF2A 3ZMDA 2MLKA 3U9GA 1T2KA 2QM3A 4EM2A 2HR3A 3FXQA 1Z1DA 4HQEA 3MWMA 2F5FA 3J81Z 2GZWA 5CVRA 1QNTA 3DF8A 4UXNA 1KQ0A 1JE8A 5DDGA 3ZPLA 2EFQA 2Q8KA 2G7UA 4N9IA 3CUOA 5HS8A 5CVVA 4HBLA 2YPRA 5H20A 2CQKA 1W4MA 3QAHA 3VOEA 1FX7A 3LFKA 2D1HA 3V8LA 4BQAA 1PP7U 4ENJA 1TW2A 4RGUA 1UB9A 4BHBA 2HKXA 4L5JA 4LLNA 5DUKA 5J8CA 1ULYA 4G7HF 5FLXZ 5LHHA 3QP5A 3V7RA 5J8FA 5FO5A 4XSXF 3IL2A 2FF4A 4KT5C 4EQQA 5LEJA 2IVMA 5J6XA 2PG4A 1R23A 1YS7A 1U5TA 1LDKB 2L3DA 3I54A 3GW2A 3I53A 2A68F 1R5HA 2WWYA 4GYIA 3WTTC 2XROA 2VE8A 2A69F 2YR2A 5ILUA 4Y17A 5HDGA 3TDUC 3ZP5A 1W7PA 1WRJA 2EJRA 5FD6A 3TQNA 1SMTA 3E97A 2PEXA 1R00A 3IWZA 5D5XB 3EQLF 2FQ3A 1EV7A 1S8NA 1OYYA 1KQ8A 2ZKZA 1A04A 3RTRA 3E5XA 3HHGA 4I0BA 4L5IA 3R6SA 2GA2A 2BBYA 4OMZA 3I64A 2V9VA 2O61A 3P9KA 4OOIA 4U0YA 1IRGA 3IC7A 5E1XA 4ESJA 2MLGA 4JQFA 4RGXA 3HYIA 2FEZA 4JBAA 3O6BB 1QBJA 2XVCA 4HDUA 4EGZA 3ZMVA 1MD0A 1O7FA 2Q0OA 1FBQA 3IKVA 3KZZA 1S6LA 1W5TA 3GO5A 4EM1A 1EH8A 1LB2A 1XD7A 4G8XA 3JSPA 3E19A 1J5YA 1SD4A 3I5UA 1HKSA 4HX8A 1G4DA 2HYFA 3IRRA 4JK1X 2NNYA 2O6GE 2ZCWA 2HS5A 3TO6A 4MGRA 1LEAA 1RUOA 1FP1D 4PDKA 3RYRA 5A2QK 4NHJA 3BPXA 3N4MA 4S04A 2DK5A 4PGGA 2W85A 2EV0A 4OIOF 5L3DA 2PFBA 3KP5A 4ZH4F 2GA1A 1U78A 3RKYA 4A6DA 1UHMA 3ZN0A 4RGRA 4BNCA 5H6RA 1I6XA 2BEOA 2WTEA 5LGUA 3J7AO 5D4RA 3FZVA 2NNNA 3F3XA 3WGIA 2LSOA 3L9FA 2FBKA 4U7DA 2EWNA 2P7CB 1B4AA 3GXOA 1REPC 1PP8F 4WXHA 2K5LA 1TLHB 4U0VA 5LEKA 2K4YA 4MTEA 3DQVC 3R60A 3QU3A 3L00A 1MJBA 1I1SA 4K2EA 4AVPA 4KUMA 5D6EA 1BM9A 3RIRA 5FFZA 3WGHA 4CZZA 2VODA 3MZYA 4Q4ZF 4L9NA 2AS5F 4KMUX 3KP6A 4YFXF 5CVIA 4IRGA 4RB1A 1YW9A 3SHFA 1B6AA 1P92A 2F5CA 2RDPA 2UXXA 5CYVA 1C0WA 4U0WA 3H92A 4Q5SF 4A5NA 3KEQA 3LSTA 2EFNA 4M73A 4AWXB 1OR7A 1ZH5A 3FWEA 3J80Z 3RKWA 1K78A 1U8RA 2DQLA 3MEXA 4BH9A 3W6JB 2OZ6A 2ISYA 3GF2A 2X4HA 3SZTA 2JZYA 4B09A 1ZYRF 1XGOA 5AONA 1QGPA 1JGSA 5DCMB 1YTYA 5JR3A 4UVAA 2PI0A 1FWZA 3JAMZ 3HRTA 2PBIA 3RKXA 4IRHA 5ICFA 1Z6RA 3TGNA 4ZZDA 2K4JA 1IXRC 4MHGA 2ZMEA 1B9NA 3FMQA 2A07F 3D0SA 5HDNA 3RDIA 4ENKA 2MC3A 1FYKA 1USSA 4LG0A 1LQ1A 3JW4A 1MGTA 2FA5A 2RQPA 4HX4A 1BI0A 2DU9A 4GGGA 2G9WA 4UVBA 1HSJA 3R0AA 2DFIA 4GCVA 3PQKA 1XSXA 1CF7A 2V1UA 2P6SA 2P5KA 4EGYA 3QPHA 5F6FA 3HSFA 1LEBA 3P9CA 5ICGA 4Z2YA 1G3WA 3KP4A 3V7CA 2KJBA 2VONA 4KIFA 2G7HA 3ZMSA 2Q2EA 4RAZA 5CLSA 3BJOA 1YS6A 2BYVE 3CUQB 3I59A 5AIQA 3C7JA 3G3ZA 5DV5A 2P8TA 2FNPA 2EV6A 1RNLA 4D0PA 3VB2A 5IT9K 1HKQA 5BPDA 2R7FA 3KETA 5E20A 1J0RA 1GVJA 3LA2A 5D8KB 1SAXA 4N9HA 5E18F 3RPQA 3FHZA 2M1BA 5DYMA 3GUDA 1O57A 2PLYA 4QLCU 1T39A 1R36A 1HKTA 1FSHA 2O0YA 3SXYA 2ELHA 4R1HA 1YO5C 3QOPA 2B0LA 4M6YA 4WXCA 4HAMA 1E17A 2VBWA 4RB3C 4WXDA 2PMHA 4IF4A 1O3TA 3KFWX 3C1DA 1TNSA 4HF0A 1R1VA 3RJPA 3KCCA 4P9UA 1FLIA 2RGVA 1R1UA 2KRFA 1IZ1A 1S3JA 1ON2A 1HW1A 2JTVA 3K2ZA 2IA0A 3T5XA 1DP7P 4ZYEA 2FSWA 2A5YB 1YW7A 2P6TA 2HYGD 4NB5A 5ILSA 4NQWA 2JSCA 1T38A 1Z91A 2MA3A 3K0LA 4G9YA 2DT5A 1B59A 4KMFA 2HDCA 1BC7C 1YFHA 3PFIA 3ZQ7A 4G94A 2XKOA 2Z9OA 3ZN1A 4F7ZA 1S7OA 1QVPA 2CGPA 1F1ZA 4N0BA 4ESFA 2VXZA 3B02A 3ECOA 3GFJA 2M30A 3LAJA 1I1GA 1QZYA 4LB6B 2Z33A 3IKTA 4EV0A 2LF7A 2X0LA 2QUFA 2OQGA 3BJAA 1Q1HA 1G6NA 4EJOA 1XDUA 2JRTA 2IT0A 4IXAA 5FGMA 3I4PA 3ABTA 2XAQA 2V6CA 3JTHA 4R8HA 5IT9Z 2Y48A 2OQRA 5L3BA 4MQ9F 5CVUA 3CDHA 5IT3A 2E7XA 2IJLA 2RNJA 1MJAA 4I7HA 3V7SA 4UHTA 1BI3A 4A2UA 4CXFA 3DV8A 2W57A 1SFUA 5JI6A 2RC4A 2STWA 3Q5FA 2YX4A 2ADUA 4HX7A 3P7NA 3V8JA 4EJWA 5L3EA 4KICA 4G7OF 3GLXA 4HYEA 5K5OA 4L0YB 4A0ZA 2MBFA 3CTAA 3F8MA 4MEXF 1RZ4A 1D3YA 1ZN2A 5JFRA 1DUXC 2WV0A 3K69A 1MZBA 4KYWA 3I0TA 1BYMA 4KIGA 2XAFA 3FF5A 5E1ZB 2L4AA 3BROA 5K5QA 2J5PA 3KZYA 2DPDA 4ETSA 2EFOA 1FPQA 3HRMA 3CUQC 4YG2F 4RB2C 4M9XA 2VT3A 3TO7A 3WODF 1H0MA 2D45A 1XCVA 2YU3A 2GAUA 2KIMA 2ESHA 3F8BA 4HLXA 1TTYA 4BHPA 1FBSA 3HTSB 3DP7A 1FC3A 1R1TA 3B73A 3D5LA 5D5UB 4L0ZB 4M9ZA 1HW5A 3OV8A 3W6KB 4BAYA 1J7KA 3T8RA 4EMSA 2GWRA 1W7PB 3O2PE 2EA4A 3DKWA 2W84A 2PQ8A 1G3SA 2KKOA 1FP2A 5HVQC 1UFMA 1Z7UA 3GFMA 1WI9A 2E1NA 2QBYB 1O3RA 4KIBA 2M5WA 1KYZA 3H3ZA 5CVJA 2Y0MA 5L3FA 3WTZA 3BP8A 2PJPA 4L9JA 1O7LA 2Y75A 2D1VA 1FBUA 2E1CA 1FOKA 3VODA 2K86A 5BQTA 2A6EF 4PCQA 2ZFWA 1FYMA 1VTNC 3C3WA 3LWFA 3LQRA 5CJ9A 4AIJA 2CYYA 3SFZA 1SD6A 4GO1A 1ODDA 1XB4A 3QP6A 2HEOA 5DEQA 1EH6A 3BJ6A 1Z6TA 2COMA 3M8EA 5LHGA 1O3QA 2GXGA 4HOBA 1WWXA 5EEHA 5F1RA 5K1YA 2JT1A 4R79A 5FD5A 5AIPA 1GXQA 4GYGA 2XRNA 1BC8C 2OAZA 5E1WA 2L54A 1XGSA 1DPUA 1XCBA 5LHIA 4PGHA 3DFGA 3WTWC 4O5VA 1LNWA 3HUGA 1SFEA 4LMYA 1BN5A 5DUIA 4HZFA 2FXAA 2NYXA 3HRUA 1LDDA 1GHCA 2ZJ2A 1MDMB 2XUBA 3VFZA 4KN4X 2DBBA 4HQMA 1KU7A 4HF1A 3KP7A 2KIUA 2PMUA 5JHUA 4U88A 5E17F 5BS6A 4EJVA 1ZG3A 1H9TA 2K02A 3NRVA 2HTJA 2LF8A 1B9MA 4WWCA 2QQAA 1J2XA 1G3TA 3KE2A 2NAZA 3GFIA 4L9VA 1FSEA 5D5WB 3V4GA 5D6FA 1R5GA 3COAC 3E6BA 4HW0A 4P9FA 1ZAOA 1L0OC 2PN6A 3WTXC 1ZREA 4CDGA 4ZYHA 2QLZA 2MH2A 1QPMA 1O3SA 1T98A 4QWQA 1P4AA 4Q47A 5EEGA 1R7JA 2P7VB 5A2QZ 1YQAA 3IHUA 2BE5F 3LA3A 2H6CA 4AIHA 3GWZA 1X3UA 4A0XA 4CGZA 2EFWA 3FM5A 3CO6C 6PAXA 2VC1A 4MTDA 3RI4A 1Z9CA 2VT2A 2Z5UA 3KLOA 4BHCA 1UCRA 4FX0A 4E70A 2DTRA 3WE3A 4WF2A 2F2EA 2A61A 3CUQA 2CWEA 2RV8A 1UHWA 3F8CA 1FYLA 2RVCA 2QENA 2OZUA 2A3SA 1TQPA 1SD5A 1HXDA 3V8KA 2V1XA 3HOTA 4UV8A 4M71A 3NQOA 1JXSA 4M72A 1HSTA 3MHXA 3R61A 3T0YA 1LVAA 2LNBA 2ZMEB 2GIVA 1BIBA 3TOAA 3HOSA 2VBXA 2ZXJA 1ZGAA 4KN7X 3RPUA 1IN5A 3E5QA 3F23A 1I27A 3CLOA 2O3FA 4LG0B 3PQJA 4CYDA 3Q9SA 3G73A 3WU1B 1BIAA 3WTUC 4YIIA 5KVRA 1TQIA 2H94A 2ETHA 3K1NA 3M1EA 1ON1A 2P5LC 3JSOA 1AOYA 4UNOA 2K5IA 1OYIA 5HS9A 3MQ0A 2JPCA 2GCXA 2IPQX 2CSOA 1YIOA 1K7AA 4EJTA 1LJ9A 2FU4A 3I59B 2V79A 1XMAA 4XSZF 2DO7A 2FRHA 3L09A 3BY6A 4A6EA 4ASNA 3H3UA 2STTA 2MH9A 4BYYA 3WU0A 3C18A 4A0YA 1ZG5A 2UWMA 2WC2A 1OKRA 4YFKF 3TDZC 2HOEA 3BPVA 2R3SA 2XAHA 2P4WA 1T0FA 4M9SA 3GZ5A 5JVTA 4AD9A 2YSRA 1EH7A 1K79A 1STZA 3I58A 3R0JA 4XLPF 3MFKA 5LBQA 1TQMA 2FBHA 3FXUA 4UV9A 2M8EA 1H9GA 2F5DA 3L2CA 3GVAA 1DDNA 2H3JA 4OMYA 4I98B 2XASA 3TKYA 2D2WA 3ML6A 3BZ6A 4PZJA 2QZ8A 3EYYA 3SZPA 2FOKA 4CICA 5F64A 1R58A 1JHHA 3WTSC 2HZTA 3IWFA 4Q48A 3KEOA 2IW5A 2OU2A 3ABUA 3KP2A 4L18B 2AXLA 2OD5A 2EFPA 2K7LA 1XDSA 4LK0F 4XBFA 3AAFA 4I02A 4O3MA 4MQVA 3ZMTA 2O03A 2DK8A 3FX3A 4RAYA 4A5MA 5D4SA 5KK1A 1ZG1A 5ICEA 5DD8A 3WG9A 3F6OA 4S05A 4CHUA 1SFXA 1ZGJA 1TNTA 2O8XA 4G6DA 1V4RA 4I01A 5HLGA 1AWCA 2W25A 4LJZF 1IXCA 4ENMA 4G6QA 2MD5A 4MEYF 2Z99A 1W5SA 1PDNC 1KU9A 3REOA 4A12A 1P4XA 1WSUA 4HLYA 2HQRA 2CW0F 4IHSA 2JPBA 2VC0A 1HW2A 3GEZA 2DI3A 2ESNA 4O6JA 2XIGA 2GXBA 3WTYC 1NHAA 1B1BA 2HTSA 3MAJA 3GYHX 4H0EA 2LX9A 1F9NA 3RYPA 1FNNA 2EV5A 4Y15A 4ZYDA 2M87A 4HA8A 1U5TB 2QBYA 2VBYA 2L01A 2W24A 2GQQA 5HS7A 5DD4A 1FY7A 4HV6A 3DXJF 3KP3A 3O3KA 2VBZA 3N97A 3P9IA 2XGXA 1CGPA 2DPUA 1S7AA 3EYIA 1U6GA 2HQNA 3T8TA 1XSDA 1BJAA 3FXRA 4KA4A 1GXPA 2R7DA 2NRAC 1E2XA 5BPIA 1TBXA 3ERED 1YG2A 5ILVA 2XAGA 4LD5A 3WGGA 1Y0UA 4L9TA 5TJJA 4M6XA 3J80K 4U7BA 4RB0A 2IRFG 1J9IA 1BI1A 3MCZA 4AIKA 1YW8A 2K4BA 1RI7A 1ZRFA 2BV6A 5E8GA 1IRFA 3F22A 2RKHA 1P6RA 3WTVC 3I71A 3IRQA 1KGSA 1L3LA 4IRIA 3E6MA 1BBYA 1D5VA 1KU3A 3ELKA 5LRRA 4IHTA 3JAMK 5HLIA 2DQRA 1SMYF 2DW4A 1KYWA 2H27A 1OMIA 2LDUA 3NEUA 1MDMA 4Y13A 2HWVA 1ZLKA 3FMRA 3BWGA 1G3YA 4RS8A 3EUHA 3U1DA 4IJAA 4FT8A 4BXUA 2VN2A 2E7WA 1S29A 1SD7A 2VOPA 1IXSB 1QZZA 4ZYGA 4HDVA 3HSRA 2XKPA 2OBPA 1KU2A 1T6SA 5FB2A 2HKOA 1KA8A 2F5EA 1TW3A 2CO5A 1F4KA 4P96A 1W7PD 3E6CC 3DEUA 2BGCA 3HHHA 3ECHA 1RUNA 1WKMA 3HIFA 3FMSA 1IUYA 4LLLA 1RIOH 4B8XA 4G7ZF 3GFLA 4P5OA 5BOXA 2CFXA 3F72A 2J5OA 4ON0A 3KLNA 1FZPB 4DNCA 1WQ2A 1IN4A 5DCMA 1XN7A 3GZ6A 3FM3A 5DCFA 4YIFA 3M7GA 1K6OA 5ICCA 3BDDA 2ZO4A 2EB7A 4FX4A 1KQ9A 1J59A 2QWWA 3K9TA 2FMYA 1V3FA 3EDPA 1HQCA 2IP2A 1ZHFA 4XRFA 1USTA 2UZKA 4LGWA 2DAOA 2QQ9A 4OINF 3F21A 3M8FA 2ZBKA 2KIFA 4M74A 1QQIA 1MJ9A 3LAPA 5HOOA 3S2WA 4WX9A 1MKMA 1YLFA 4UUVA 2CG4A 2FBIA 2IA1A 1JHFA 3F6VA 4OIRF 3K1MA 3CJNA 1IN8A 1PUEE 3TOBA 4IVNA 4EM0B 3E5UA 4UVCA 2QVOA 5HDKA 2ISZA 2OA4A 2QQBA 2RN7A 1U2WA 3F8FA 3L7WA 4ENNA 4DQ2A 5LGTA 2M45A 1U3EM 3CO7C 1K78B 4KDPA 2VOOA 5BMZA 5L3CA 4I0AA 5LLQA 2FMLA 3VEPA 4I09A 3DPLC 4EVIA 5D5VB 3E6DA 5LRSA 1U5TC 2ZNYA 3HTUA 2HFHA 1QO0D 2VE9A 3R4KA 1ZARA 3E3VA
chains in the Genus database with same CATH superfamily
3CCMA 3D1NI 4XRSG 1R4NB 3CCLI 2EW3A 2KAFA 4OWRB 5JLXA 4LDWA 1K9MU 4JJNK 3RERA 4IIMA 1I5ZA 3M0PA 1Q81C 4M7AB 1X2NA 1ZLJA 3ABMH 1RR8C 1IJWC 1X1CA 3J81K 4ESBA 1W36D 2Y0SN 1PSEA 1QKWA 3M59A 1R9TJ 1WH5A 2CP5A 2HGCA 2GF7A 3OOPA 2CKKA 3SHWA 2DD5A 4RTTA 2LMDA 1OISA 4ZTJA 1NH3A 4QKUA 2BY1A 3BQZA 3L2WA 3QO3A 4IUPA 3AHUA 3TO9A 4LK1F 2E71A 3BE3A 5GAMh 1RKTA 3ZQFA 4V2GA 2HVRA 1PNJA 4OU0A 4FL6A 1RQ6A 1ABOA 1JO8A 3CD6I 1KC8U 1B3QA 1F36A 2ZNZA 5EGOA 5M5YJ 1N8RR 4EJUA 1K9MC 4GXOA 3WE2A 4ZZLA 2L3PA 4IOAF 2A6HF 3EUAA 1VQ4I 3LH0A 4LLGF 5FFXA 1ZUKA 3MZHA 2WAQA 2NVYJ 2RO0A 1K73R 1VQKA 3O8HA 4D1QA 1MV0B 3BG3A 1B34A 1ZUYA 3F8NA 2WA0A 5D8LB 1CKBA 5HLHA 1K8AR 3EG1A 3UDCA 3JREA 3M9AA 1QW1A 1GCPA 1JKPC 2BW3A 1UTIA 2M0OA 4AG2C 3Q9VA 2I0NA 1Z05A 3S15J 1IW7F 1MMNA 2EZIA 2LREA 1FOYA 3F9KA 3LQQA 5K5RA 3JTGA 2HBWA 1IN6A 2XPVA 2DBMA 1KC8C 4XQ3A 3JCUC 4MNUA 3MN2A 4ITVA 5IY5H 1CF7B 1BOAA 2R7VA 1UFFA 2CZ0B 3E9GA 2LZ6B 2D8HA 1AA7A 3O8GA 3PUBA 2K5FA 4IPAA 4HV5A 3CCST 1ZSZA 3CCUT 1Z67A 2VWFA 1XGNA 4OIQF 3CCVQ 3NGPA 4JS4A 3ULQB 5E8IA 2C0OA 2C06A 3ZMUA 3M5AA 4TV7A 2GTJA 1Z0XA 1YYVA 5FKLA 2LKPA 1P2FA 3OYHA 3HSEA 3CCEI 5FRMA 3QKJA 5FLXK 1K1ZA 3L2QA 5L3GA 1A35A 1BKBA 2UUZA 4M78D 2HNIA 1EKEA 2DLLA 2KJCA 4PJOG 3A0BC 2LY2A 1X2MA 5GAEJ 5J47A 1TWBA 2ZPIB 2FE3A 2XV4S 1JJ6C 3A8OB 3VS3A 5CK9A 1RAIB 1G59A 3QWXX 2WV1A 1Y96A 4JP0A 2C6YA 1J75A 1LDJA 1XSVA 1YITI 2FNAA 4CO8A 5H6QA 2P5VA 1K61A 1X3WB 3DBLB 1ZSGA 2AZSA 3K1PA 4M7DF 2K27A 2GFAA 2DERA 2H09A 2OV7A 1WHKA 1QLYA 2XHKA 1YCSB 1VQ7I 2QDLA 2YX7A 3BTLA 4XLNF 1XMKA 1IAWA 4I2OA 1VQ6Q 4WCGA 1LUJB 5J3LA 3LSPA 3QSUA 3SDGA 1FXXA 2V26A 1TP4A 1FEXA 1OYWA 3CQTA 1D8KA 2ESWA 3HL2A 4LD6A 2ZSHB 4C2MJ 2DJNA 2X9HA 2VJIA 3ZQQA 4A3KJ 2DN0A 2H6BA 4IUVA 3GTMJ 4LFUA 2DL3A 1FT9A 2YUSA 1IC8A 2F2VA 2MC4A 3QU6A 4E7ZA 3GX4X 2FVUA 2QASA 3DPTA 3G4SI 4KNYA 2FQ4A 3SQNA 2TDXA 3BOQA 3OYLA 4J9BA 4YFNF 1O9SA 1RKWA 2UXNA 2VXFA 3HSBA 2CP0A 2LR8A 1R22A 4PUSA 3I56I 2K9QA 1ONVA 1K73U 4AFZC 2X4YA 4FT4A 1ZTRA 5EF6A 4X6AJ 2KNBB 1ZRDA 2MOXA 1D8JA 1T3SA 2DL8A 3OYCA 2EK5A 3CF5F 4JRQA 2OUMA 3NWTA 4FHTA 3BR6A 3ZCOA 1TUGB 4OMNA 5TRDA 5ED4A 4A53A 4KFCA 1P4WA 2F48A 2Z3YA 2LCLA 4Q5WA 2ACJA 1SSFA 2QTVA 2XAJA 2RQTA 1AOJA 2RK1A 2Y90A 2ZJRF 1IN7A 3T1BA 3GTJJ 2KROA 2X4JA 4C8QB 1BI2A 2MVTA 4RTYA 2P81A 1IHWA 3M0RA 5J4VA 4LB5A 2A0FB 1NG2A 1PWTA 1DPRA 2DDBA 2Y0SA 3ROUA 3ISPA 1F5TA 1PKTA 2DVEA 3EGXB 3EAEA 3CC7I 2L4MA 3IP4B 5IYCJ 1NLOC 1K73C 4PJOA 2LK2A 4FASD 4C0DB 2R7TA 5LGNA 4A3FJ 2L02A 2RHYA 5D6YA 2RNGA 5IHIA 3PIPA 2YUQA 2NS0A 4C5IA 1FIPA 1NTCA 3IH4A 5J4YA 2L7FP 1OCZH 3QPTA 1IF1A 4WK8F 1VUBA 2RJDA 4M77B 4F17A 2EA2A 3CMYA 1HBXG 2GTOA 1IXDA 2QYOA 2J6KA 3EETA 3QRFF 2QQ8A 2RHUA 5ERIA 3CC4A 4RA2A 1YOVB 4P55A 2JT4A 3ZMZA 4J5YA 2HI3A 3X26B 1NG6A 1OPCA 2V1DA 3HRSA 3LA7A 4RGSA 2ME6A 4FTHA 4OIPF 2L0KA 2XF6A 2IA2A 1XX5A 4HG2A 1XGMA 3HZJA 5FJ8J 3OS1A 2DO3A 2DZCA 1ZRCA 1MBFA 1AHJB 1Q7YC 3U2RA 4HCZA 3GTOJ 1H641 1ITYA 5J39A 2AHJB 4E7KA 3HJEA 2E1HA 1MBHA 4HF2A 3ZMDA 3VWBA 1Z21A 3CCMQ 2MLKA 3U9GA 1T2KA 4W1UA 2QM3A 2M1HA 2K5CA 5LJ5d 3GP8A 2CS3A 4EM2A 1I8FA 3PMIA 1RRJA 2FPDA 2ZGWA 1S72T 2HR3A 3FXQA 1Z1DA 3GCMA 4HQEA 1MBEA 5GMKm 3MWMA 1X4OA 2F5FA 3J81Z 4L5EA 4HVWA 5IOZA 2PJRA 5CKHA 3BG7A 1QVFS 2K3XA 1W0TA 4D9JA 1S5LC 2F2XA 3HM5A 4M78E 2CV1A 2CQXA 4N0AC 1YCYA 2GZWA 2BXZA 3VS4A 5CVRA 1QNTA 3DF8A 4JZ3A 4UXNA 1KQ0A 1JE8A 4DBRA 5DDGA 3VS1A 2OPTA 3ZPLA 2O9SA 1Q86U 5FROA 2EFQA 2Q8KA 2G7UA 4N9IA 4RTWA 1YHQQ 3CUOA 3PNYA 4YEJA 4KUIA 5HS8A 3K4KA 2EQIA 2CGHA 1NLPC 5CVVA 3BW1A 2XDDA 3PSFA 2F1LA 3G71A 1IUFA 3I56A 5E3OA 4HBLA 5LD2C 2YPRA 5H20A 1W0UA 2B7EA 1VQ9I 2A7YA 2M0YA 2ZCFB 2CQKA 1W4MA 4LNPA 2VUMJ 3QAHA 2AT1B 2QQRA 3VOEA 2COWA 2EQKA 2XPWA 1E3OC 4PLLA 2RQVA 2DJZA 2VKDA 1FX7A 3LFKA 3I4NJ 2BZTA 1PD1A 2D1HA 3CCJQ 1PUFB 5GAHJ 1TWFJ 3K7AJ 3V8LA 4LG3A 2R5ZA 4HT9A 4BQAA 3PVLA 2XPUA 4RTZA 4EMKC 9ATCB 4R55A 1BA5A 3VS6A 3OWTA 1PP7U 1Q86C 1AVZC 2DFHA 4ENJA 2HDAA 3QYBA 1WHHA 2VYTA 4MFEA 3NAUA 1TW2A 4B3AA 4RGUA 3CCRI 1UB9A 5A0GA 1AZEA 3CLQA 4C3JJ 2YDLA 3S14J 2OTJI 2XC7A 3LFUA 2HU9A 1TOVA 4V2SA 3RESA 4BHBA 3OL4A 1U1TA 2VKVA 3OSVA 2HKXA 4XTVA 4L5JA 2FHDA 4BS9A 4LLNA 5DUKA 2GBYA 3PNTA 5J8CA 2H1LA 1ULYA 2X35A 4G7HF 4XMYA 5GMKl 3OY9A 3CJTB 5FLXZ 3ZQCA 1FJLA 3JRFA 5LHHA 3QP5A 3OSSC 4M78C 2ELJA 2DEUA 3V7RA 2X4WA 3OW2P 2R7UA 3MEVA 3K10A 4QTRA 5J8FA 2CT4A 3OR2C 2C0IA 3C12A 1UECA 4F91B 2W4SA 5FO5A 1RUWA 4XSXF 1WHMA 1WPYA 6AT1B 4MDWA 3GTGJ 3JCMQ 2VJ4A 3K6GA 2FF4A 4KT5C 4EQQA 3IL2A 4PJOF 5LEJA 1OR7C 1Z3YA 5GANe 3PIPF 4X9CA 2PUOB 2IVMA 3FXLA 5J6XA 1YE9A 1YI2I 1QVGP 1OU9A 2PG4A 1R23A 5F1JA 1YJ9I 1YS7A 4A4FA 1U5TA 1LDKB 1I3QJ 4B9XA 3W2VA 2L3DA 2XGEA 3J81E 3CC2I 3I54A 1VQLI 4XKWA 4BDZA 5HCKA 4BU2A 1UEBA 4LN2A 3GW2A 1IB8A 4OP0A 2ECCA 1UUEA 3I53A 1T8IA 2A68F 1R5HA 1XTDA 1GUUA 4M6VA 2WWYA 1IO2A 2P0WA 2ICWG 2EFIA 3H41A 2R7XA 5GANh 4GYIA 3VU3C 1ZELA 3WTTC 2XROA 5M3FJ 2HOAA 3CCSA 4MDXA 2VE8A 4FYVB 3JCMc 1JUPA 2A69F 4LXCA 1SC7A 2YR2A 5ILUA 2HDWA 1GVDA 3H9JA 2R5YB 4Y17A 1XNIA 1AT1B 5HDGA 2DL7A 1U9NA 2HZDA 3TDUC 1VOMA 2LYCA 1VQ4Q 1TWHJ 3HPHA 3ZP5A 2JA5J 1W7PA 3WHCA 1WRJA 2EJRA 4ZJZA 5FD6A 1ACMB 3TQNA 2LRQA 3CCQT 3FC3A 1WI3A 1AWXA 3H5RA 1SMTA 3E97A 4II3A 2PEXA 5HNFA 3A5ZB 2BY0A 1R00A 2K3PA 4NC8A 3RQ4A 3IWZA 2JVHA 5D5XB 2MG4A 3EQLF 4KITB 2ZMEC 1K9AA 1J09A 3JCMf 2COZA 2FQ3A 1EV7A 4MMLA 1S8NA 8ATCB 1FOXA 1OYYA 1WX6A 1KQ8A 5L8RE 2ZKZA 2QQSA 4YIRX 3BR0A 1A04A 1Y0NA 2DYRH 3RTRA 3SYTA 3K4NA 3E5XA 2LKXA 1M3BA 1QVFA 3HHGA 4I0BA 4L5IA 3R6SA 2E12A 3UKGA 2GA2A 2KBTA 2K3BA 1MH3A 2BBYA 2K9MA 3WXMB 3LSIA 4XOPA 4OMZA 3I64A 2PTKA 4M75B 2V9VA 2O61A 3P9KA 1QKXA 3CC4Q 4BDYA 3QHSA 4OOIA 5CQYA 3CCEQ 4U0YA 1V55H 1IRGA 3MO8A 2EJ9A 1VQMQ 3EH1A 3IC7A 5E1XA 1V54H 5B1AH 1AZGB 3QZ5B 4FSSA 2HOTA 2DVJA 4ESJA 2KL4A 1NEBA 2MLGA 3BC8A 4JQFA 2BHYA 4BY7J 1WZOA 1WJDA 1X01A 4RGXA 2EBPA 3NTHA 3HYIA 1N77A 5FLVA 1PCXA 2FEZA 4PJJA 1Y71A 3MMYB 1SSHA 1YJWI 4JBAA 4XK4A 3O6BB 3WHBA 2W00A 2X6WA 1KJWA 3S16J 2LDMA 3CPWS 2R7WA 5LJ5h 3ZL7C 1QBJA 2XVCA 1SFKA 4HDUA 4G12A 1TWAJ 4EGZA 2XRLA 2DXUA 3L2ZA 1YJ9A 4PSWA 3ZMVA 1MD0A 1WJBA 5GTIC 1APLC 3CDLA 1A0NB 1O7FA 3DKYA 4CCOA 2Q0OA 3CCYA 3A4CA 4DZJA 3BFMA 1FBQA 4XTWA 1M90R 3IKVA 3KZZA 1UJ0A 2DA5A 3JSCA 1S6LA 1W5TA 3LYIA 3ME9A 1X2KA 2DMNA 2VPRA 3GO5A 4EM1A 1EH8A 4PJNA 5BNGA 1LB2A 3PO2J 2E64A 2ZSIB 3G4SQ 1KD1R 1XD7A 5M5WJ 3NTIA 4G8XA 3JSPA 2F2WA 1WJ5A 3G71Q 3E19A 3RMQA 1J5YA 1SD4A 3I56Q 3I5UA 4ZGJB 1UGSB 1KQSS 1HKSA 1OQYA 4D5FA 4KGXB 5IN1A 4HX8A 1G4DA 2HYFA 2RD1A 3IRRA 5GAOq 2DA1A 3M07A 4LD9K 4BXFA 4JK1X 2NNYA 2O6GE 5GJWB 2ZCWA 2HS5A 3TO6A 4QVDA 4MGRA 5IHNA 5KCMA 1LEAA 3EG9A 2CQ7A 5F0FA 2LP0A 2QGFB 1RUOA 1FP1D 4PDKA 3RYRA 2RHXA 5A2QK 4NHJA 3BPXA 1M8MA 5DS9A 1UB4A 4W97A 4ABZA 1VQMT 2QGGA 3N4MA 4S04A 2DK5A 4PGGA 5GAMf 3FK6A 3UR3C 2W85A 1S72A 1VQ6I 4RMNA 4N4HA 3CC7Q 2P0QA 2RQUA 2EV0A 2OTLQ 4OIOF 2PVDB 5L3DA 5IPAA 3MEAA 3PIOA 2PFBA 2E2HJ 3ZRGA 4BGDA 3KP5A 4ZH4F 1HYOA 3VJPA 3THKA 1N27A 1RACB 3A8GB 1Q82R 2GA1A 1U9OA 1SG5A 4BI3A 1E3PA 2QSGX 3OYJA 4IZZA 2SRCA 1U78A 5C44J 5LJ3e 4C2UA 1OCOH 3RKYA 4A6DA 2M51A 2JUGA 1ZHIA 1R4MB 2F5KA 2M0CA 3CF2A 1NE8A 1UHMA 4II2A 3Q1JA 4WTOB 3RDVA 1W1WE 2PMZN 1HJDA 3RCOA 3ZN0A 5EEAA 4RGRA 3ABLH 3BQYA 4BNCA 2XD0A 1K6YA 4AU7A 5H6RA 5KCHA 1M90U 1I6XA 1YWOA 1D1AA 1VQ5T 4HT8A 2BEOA 2WTEA 5LGUA 3NHNA 2BXYA 4FCYA 4XU1A 2VKNA 5DLOA 1BB9A 4E2FB 1Z9QA 1JKRC 2HMAA 1NPPA 5LJ3h 2N8GA 3A02A 1ZLMA 1XTAA 3J7AO 5D4RA 3FZVA 2R7SA 1M3AA 1FOWA 2NNNA 1KONA 2ECZA 2O2OA 3F3XA 1WZ2A 4XLCA 4M78G 3WGIA 2LSOA 1E6HA 3J7AW 3HL8A 3L9FA 5KYWA 2FBKA 4FYWB 3OIQA 4U7DA 1WJCA 1MIJA 3HOUJ 2EQJA 2BUDA 3ZBDA 2EWNA 2P7CB 2JJ7A 3CCJI 2YWWA 4N0AA 3JRCA 3G6ET 1B4AA 1TT5B 3G1OA 2H1KA 2BE7D 3OW2S 1VQ9Q 2E34A 3ZQGA 5CKDA 1VA7A 1FTZA 3GXOA 1SKUB 4S0HB 2IIMA 1REPC 2I10A 1DJ7B 1PP8F 1NYFA 3QWYA 4WXHA 2K5LA 1TLHB 4U0VA 5LEKA 1M1GA 3M53A 2K4YA 2HQAA 3JRGA 4MTEA 3DTIA 4BY1J 1SRMA 4ZNXA 4E4HA 1D5YA 3DQVC 3JCMX 3R60A 3QU3A 1QVGS 2F4MB 2JW4A 3CPWA 2LOOA 5FRNA 3L00A 1UE9A 2K7AA 1MJBA 1I1SA 2LNVA 3BCAA 3MKWB 3DKMA 3CXCP 1PD0A 2ATCB 2L9SA 3TREA 4K2EA 3H5AA 3H0HA 2MPXC 2QG9B 1BR4A 3CMEI 1LE8A 3ZXSA 4KUMA 4AVPA 1O4XA 5D6EA 3TL4X 4EMKA 1Q82U 1BM9A 3CEYA 3RIRA 4YTLA 1WQWA 5FFZA 2NUPA 4B47A 2YLBA 2LT1A 2KRSA 1Z3XA 3EH2A 3WGHA 3CCLT 2ZZDA 3KIOA 4CZZA 2VODA 3MZYA 2O01E 5KYUB 4Q4ZF 1VYVA 3PFYA 4L9NA 1TC3C 1SEUA 1XC5A 2AS5F 4KMUX 3WG7H 3KP6A 3TMOA 3H9NA 1Y6IA 4YFXF 1KQSA 5CVIA 4IRGA 3OS2A 2OTLI 4RB1A 4LDVA 1Q81R 4HRIA 1YW9A 3SHFA 2KDZA 5GAOm 1B6AA 3TP3A 1P92A 4AG1C 3QYHB 4OGCA 1SPKA 3MKYB 4M7DG 3PT9A 1ERDA 4JOMA 1XQHA 4ZN1A 1VNDA 2F5CA 2RDPA 2UXXA 2WAQN 5CYVA 1IRZA 1C0WA 4M78A 4DA4A 2O5RA 3TBIA 2G3RA 5IAYA 3CCMI 2YT6A 2JA6J 3TEEA 1Q82C 4U0WA 3H92A 1KZHA 3PIOF 4Q5SF 2XKOC 5EJCA 4A5NA 3CCQA 3KEQA 3FXMA 1YJ9Q 2YRVA 2CH4W 2EJFA 1SANA 2MK5A 1MNDA 1F1BB 1PKSA 4ZDLA 3LSTA 4EIKA 3CC2Q 2EFNA 4M73A 4AWXB 4A3LJ 1ACIA 2CSQA 1ABQA 4XICA 1OR7A 2VKEA 1ZH5A 1X3ZB 4MO7A 3FWEA 2YS9A 4CCJA 1K9MR 4DJAA 2OF7A 2V7FA 1EF4A 1X1AA 1OCPA 3IQLA 4B1RA 3EHQA 4FU6A 3J80Z 3PNWC 3RKWA 1K78A 1U8RA 3ZEHA 2DQLA 3MEXA 4ZC3A 3W6JB 4BH9A 2JTMA 3VUZA 4DOZA 1EIFA 2ZPBB 2OZ6A 2ISYA 5FU6B 5GMKe 3GF2A 3D5RC 2XDBA 5IOYA 3UWNA 2X4HA 2VQGA 2EAYA 1J3TA 4ELZC 4CSWA 4A63B 1ARKA 3SZTA 2P4RA 3E2UA 4Y91A 3EFOA 5KYXB 3SEMA 2JZYA 4R56A 2ZPGB 4B09A 4M75E 1O75A 1U3OA 4QSHA 3JRIA 2CW7A 2QEXI 1WJRA 1R5ID 1VQKI 1KC8R 5AT1B 2PMZA 1ZYRF 3M0QA 2NUTB 1XGOA 5AONA 3DBHB 1QGPA 2MIOA 3M8JA 1JGSA 2QGUA 5DCMB 1YTYA 5JR3A 5CIUA 4UVAA 2PI0A 2YHTA 1K4TA 1NJIU 1FWZA 3JAMZ 5GMKh 3VYTB 5B66C 1Y8RB 3LWHA 4MIMA 3HRTA 2PBIA 3RKXA 2ROTA 3OL3A 2EPDA 4IRHA 1Y57A 3AL0C 1BL0A 2XF7A 5ICFA 1Z6RA 2DAQA 5GAOl 4C3HJ 1I1JA 5EG0B 4B43A 3TGNA 4J6XA 3REBB 4C5EA 4ZZDA 2K4JA 1UGQB 5J26A 4L5GA 1IXRC 2CJJA 3C2HA 4QQGA 4MHGA 2ZMEA 3I3LA 1B9NA 3EHRA 3I5RA 2W82A 3FMQA 2A07F 3D0SA 5HDNA 3RDIA 2W7NA 1NG7A 4IHVA 1JQQA 1VQ7T 4ENKA 2DXCA 2FPFA 2LJ0A 2MC3A 1FYKA 3WVDB 4BD3A 1USSA 1NJIC 1VQ8T 5FKNA 3W2WA 2DMQA 4RG2A 3OW2A 1V5EA 3E7LA 4LG0A 4EDUA 1H3ZA 1LQ1A 3JW4A 3OA6A 1QVFP 5CPRB 2CSIA 4KUDK 1MGTA 2FA5A 2FZCB 1WHLA 3E9FA 2RQPA 4HX4A 1BI0A 2DU9A 2KR3A 3OYBA 5J40A 2J6OA 4GGGA 2G9WA 4J9DA 2D9TA 4UVBA 1OX8A 2JMWA 1QVGA 4PK4A 2M2EA 3DEEA 1HSJA 5F04A 4Z02A 3R0AA 3ASNH 2JVGA 2EJGA 3RUXA 2DCEA 2DFIA 5H2FC 4GCVA 3TQ7P 3PQKA 1XSXA 1OCRH 4IKFA 1CF7A 4F14A 1VQMA 2ZFUA 3LMMA 4KBMB 4BACA 2MGQA 3S2HJ 2VXEA 2V1UA 4JJDA 4FM4B 2P6SA 2P5KA 4C92D 4EGYA 1B72B 3J80E 4PFZA 3RMSA 3META 3QPHA 5KYYA 5F6FA 3AG4H 4F7UE 1AKHA 3AT1B 3HSFA 1LEBA 2JN0A 3P9CA 4M3BA 2TRTA 2DTZA 2X6OA 4M78F 3LOCA 3RR6A 1TWCJ 2CH4A 5ICGA 4C0FA 4XTXA 2KYMA 4YRVA 5KE2A 4FT2A 1LFUP 2FYKA 2RA2A 1H88C 3FBNB 1G3WA 3KP4A 4G6TB 2KJBA 4Z2YA 3V7CA 5IYBJ 2VONA 4OAYA 1H8KA 1ETXA 2DTIA 4KIFA 2QEXA 2G7HA 1JJ2S 3ZMSA 2W48A 2Q2EA 3B6CA 4RAZA 4A4HA 5CLSA 3BJOA 2JA7J 1YS6A 2BYVE 3CUQB 3I59A 5AIQA 3C7JA 2VJJA 2E65A 4M7DB 4ZGEB 1NK3P 3JAME 3G3ZA 1OYXA 5DV5A 1UHFA 3S93A 2P8TA 1YBYA 2DX1A 1WJFA 2FNPA 2LJ3A 5GANf 2EV6A 2K9SA 2NVXJ 2QK0A 1HK9A 2RHZA 1OX9A 1VQ5A 1D0XA 5EZGA 1ZBXA 1RNLA 4D0PA 3A1PA 3GPLA 2E5ZA 1MSFC 1YIJT 2M16A 1YJNT 4CCMA 3E1SA 3VB2A 1Q7YR 3VYRB 1WJQA 1I4K1 2L3QA 1VQPA 5IT9K 2RHIA 3TW7A 1HDDC 2P84A 1XJWB 5GAMj 3CC4I 2RQQA 2JNGA 1HKQA 3X24B 1I50J 2HYJA 2DODA 3LSMA 3J7AF 3LSJA 3H5NA 4B3XA 2M7BA 1UZCA 1QP3A 3O8VA 4LDYA 3FBIB 3G6EA 5BPDA 2MZ4A 2CP6A 2R7FA 2VJ5A 2QF7A 4ZDOA 2DK3A 4Y33A 2R5AA 2EYWA 3KETA 5E20A 2V8KA 4RLQA 1J0RA 2F5VA 2DYIA 2E4HA 1GVJA 1JRIA 3A03A 2CRGA 3LA2A 5D8KB 5DM7F 1X75C 3QJYA 1WXBA 1SAXA 4IUTA 4J83A 3CCQQ 4N9HA 4OMFB 2WB1N 4FW1A 5C0MA 5E18F 4CYCB 3EGUA 4J6WA 4UB8C 4C0ZA 2CS7A 2M4GA 3RPQA 2IS4A 3ZOBA 1EFNA 2EGEA 3VV0A 3FHZA 2GQVA 5FU7B 2M1BA 5DYMA 4XK8E 1E6GA 3GUDA 1O57A 5EGOB 1ETKA 2PLYA 3S1RJ 2BTTA 1ENHA 2KDSA 4QLCU 1T39A 2DTOA 1R36A 2DT7B 2F69A 2KEAA 2KRMA 1HKTA 3S17J 1FSHA 2O0YA 3C0CA 3SXYA 5GANd 4GLKA 2ELHA 1D3BB 4R1HA 3G71I 1YO5C 1KSWA 3GZNB 1B34B 2JJ9A 3QOEA 2K40A 2NS8A 3QOPA 1UAAA 5LJ5f 2RI3A 2V8JA 1JT0A 1LJOA 2JMAA 1MGQA 1Q86R 2D5VA 1Q1VA 2B0LA 4N4NB 4FSXA 3OSGA 2BW3B 4M6YA 4WXCA 4M7AD 3OYYA 3VYSB 1JTYA 4HAMA 1YP5A 1X1PA 5I21A 1E17A 2AZVA 5CKFA 2VBWA 1N75A 5JLWA 4RB3C 2R5MA 4RM2A 4WXDA 2HDDA 1Q95G 1YRNB 2PMHA 3NPFA 4C92E 2VGNA 4IF4A 1RPWA 1ZSZB 2QSHX 2Q1ZB 1O3TA 3KFWX 1N5ZA 4MZMA 4BY6B 3C1DA 1WNLA 1TNSA 4CC7A 3OYGA 4HF0A 4XKCA 1Q7YU 1R1VA 1ORKA 3RJPA 5CAIA 2EKOA 3KCCA 2DYBA 2RM4A 3SEQA 4OMMA 4P9UA 1X4PA 1ZBJA 4E6RA 3CMEQ 4WCIA 4JRKA 4Y92A 1U5SA 2AQFA 2L7KA 1FLIA 2RGVA 3H36A 4IQJA 1Y8QB 1T0HA 1R1UA 2KRFA 1IZ1A 2L3SA 3OYEA 1S3JA 3DB3A 2DNUA 3VPRA 2NVTJ 1ON2A 1HW1A 1VF9A 2JTVA 2WY8Q 2X98A 1M30A 4OB0B 3K2ZA 4PKCC 1JT6A 4E7IA 2IA0A 1U1SA 3GBGA 2A37A 3PMTA 3T5XA 1DP7P 1XG1A 4ZYEA 1X58A 4FQGA 2FSWA 2QCOA 2A5YB 5KAFC 2FEIA 1YW7A 2P6TA 4BL0B 4UUSB 2DRMA 2EQMA 2HYGD 2KP6A 3NTKA 4NB5A 5ILSA 2YU9J 1JJ2A 4NQWA 1KQ1A 1NPRA 1PRLC 3A0HC 2EYZA 2RI5A 2JSCA 1T38A 2RMOA 2O88A 1Z91A 2MA3A 4L6V5 3K0LA 4G9YA 4AUXA 1WI7A 2DT5A 2R58A 2YUNA 3KUFA 2R7ZJ 3GTKJ 1B59A 2E5NA 4HCCA 1VQNT 4KMFA 2HDCA 3PM1A 1BC7C 4FW2A 3QJ6A 1YFHA 1OPKA 4IQ4A 1UGRB 3DLLA 3PFIA 2IVWA 3NWSA 3ZQ7A 4G94A 2XKOA 2Z9OA 2HQEA 1ETYA 3QXEB 1WH7A 4C92C 3ZN1A 4F7ZA 1IDZA 1S7OA 2XF5A 5D7UA 1QVPA 3K4JA 1WHUA 2CGPA 2M34A 3VYHB 3SD4A 3CCSI 3CCUI 3LSGA 3M4GA 1F1ZA 3P5JA 3H0GJ 4N0BA 2DA7A 2AKLA 4ESFA 3PGGA 5DM7R 2M3AA 1JEGA 2DBKA 2VXZA 3B02A 4OB3B 3K4BA 4C9YA 3U1KA 3ECOA 4DGWB 3GFJA 2M30A 4CCLA 3LAJA 2EYYA 2QEXQ 1I1GA 3TVTA 1VQ8A 1QZYA 1GDTA 2WBMA 1WXTA 4LB6B 1IGNA 2OCEA 2J7IA 2Z33A 4LUEA 3IKTA 4EV0A 2IS2A 2E1OA 2L7ZA 5IP6A 4J00A 3NMZC 5LJ3f 2LF7A 2WB1A 4PJOB 2MD0A 2X0LA 2QUFA 2OQGA 3BJAA 1G8XA 1Q1HA 3RPUD 4BXXJ 1HD3A 1W2BP 1G6NA 4EJOA 5IXFA 1XDUA 2JRTA 1BU1A 2IT0A 3FLGA 3JB9D 1DQUA 3J81R 1H92A 4IXAA 2MI6A 5FU6C 3FDYA 5FGMA 2MCNA 1VQ5Q 4X0GA 1IREB 1WJSA 3I4PA 4D7NA 3PJRA 4AFUC 2NUZA 4CRIA 2AK5A 4ELYC 3ABTA 3AG2H 2KY9A 2XAQA 2WAFA 2V6CA 3JTHA 3VYUB 3BY7A 3T9NA 1VQPQ 4R8HA 1ZR2A 5IT9Z 2M9UA 1YJWT 2Y48A 1DU0A 2OQRA 2KZVA 5L3BA 2KXDA 4M7AE 1QP2A 4CH7A 2DETA 5EG2A 4MQ9F 1LCKA 5CVUA 1V29B 3SB2A 2QSFX 2LY1A 3CCEA 2TCTA 1IV6A 5IXBA 3CDHA 3M0TA 5E3LA 4F55A 3QUIA 2HBPA 3Q3SA 4C8QD 3G6EQ 2DMOA 1WCMJ 1A6QA 2V1NA 5IT3A 2E7XA 4CCNA 1SRLA 2IJLA 2RNJA 3QZ9B 1MJAA 4MLOA 5J3BA 4ZYAA 1A6IA 2LC2A 1OCTC 2JTFA 4I7HA 2LQNA 2XB5A 1LKXA 3V7SA 1P9QC 4ANJA 4BE2A 3H3VK 2XMFA 4UHTA 1BI3A 4A2UA 4CXFA 1SHGA 3DV8A 4M77D 4NS5A 2W57A 4Z8AA 1SFUA 2FJ1A 2H8WA 5JI6A 1EJ9A 4JJBA 4IIOA 2A6TA 2HQXA 2RC4A 2STWA 2LMJA 3M54A 2ZXIA 3Q5FA 3H8ZA 2YX4A 2ADUA 2IGMA 3H0DA 5IP9J 3M3YJ 1ZUUA 4HX7A 2V1RA 2V1QA 1JU5C 3P7NA 3M0SA 2EYXA 5LJ3d 1W1FA 2O4XA 1A5JA 1G83A 1LOJA 1C1AA 4M75A 2GOMA 3V8JA 2XGDA 4EJWA 5L3EA 1WHGA 3SWNC 1YJNA 2HQHA 4BB7A 2HNHA 3QQAA 4KICA 5KH6A 2Y31A 4AYBA 5FLXR 4G7OF 3CCUA 4J19A 3GLXA 4F7UG 3PFSA 4HYEA 4XLAA 1ETWA 3I9V2 5K5OA 4L0YB 1R0BG 1R8OB 1X2QA 1V76A 2RF0A 3RBBB 2E1MB 4A0ZA 2MBFA 3CTAA 3F8MA 4MEXF 2DD4A 1RZ4A 2ED1A 1M1KR 1D3YA 1IHVA 4M7AC 1JXMA 2GFUA 4N4IA 1ZN2A 5JFRA 1DUXC 4BI8B 2WV0A 3AKZA 5I11A 4BEHA 2E36A 3K69A 1TL8A 1MZBA 4ORZA 4KYWA 3CMAT 3DLLF 3IH2A 3CCVT 3I0TA 2DDAA 3HOVJ 1FYNA 2XICA 3R6OA 4XM3A 2DRKA 3CBPA 3M9QA 1BYMA 3INZA 2R4GA 2QTXA 1D1BA 3LGFA 3JCMJ 4QT7A 4KIGA 4M3EA 2XAFA 1QHHD 4XU3A 3FF5A 3PTAA 4XQFA 2QKLB 1S72I 1X6OA 1T95A 5E1ZB 1RR7A 2L4AA 3BROA 5F27A 1FMWA 2EH3A 1D1CA 1UG1A 2FG0A 1JTXA 2EYQA 3QYFA 2DIQA 2VB6A 1PJRA 1Z7LA 5LFAA 2LT4A 5K5QA 2J5PA 2XU8A 2ZPFB 4IHYA 4RCBA 2EIMH 3KZYA 2DPDA 1RAHB 3VS7A 4ETSA 1BOBA 2EFOA 1R49A 2HSPA 2LKSA 2X1EA 4RLFA 2LVMA 1RAAB 4RTXA 5GANj 1FPQA 1WVRA 3A01B 3HRMA 3CUQC 2DFFA 4YG2F 4RB2C 2FOWA 3C95A 1SHFA 4OMOA 4M9XA 5FLXE 2QA4T 1NK2P 1DP3A 2AKKA 2VT3A 1W4SA 4FISA 2R7RA 2R93J 3TO7A 1GRIA 2VASA 3BT9A 3A2KA 3WODF 1H0MA 2D45A 4Z89A 1HDPA 1XCVA 4JX5A 1JGGA 2LJ1A 3VRYA 3DWLE 3HOWJ 2M35A 2YU3A 2IS1A 3ZQIA 2GAUA 2KIMA 2ESHA 3CP8A 1UG2A 4MFDA 2HOSA 3F8BA 4HLXA 1TTYA 3V42A 4BHPA 4F7UA 1FBSA 3PL8A 1IGUA 3VS2A 5GP9A 1T0JA 3G7ZA 3HTSB 3OBWA 3DP7A 1MSEC 1FC3A 1R1TA 3B73A 3D5LA 5D5UB 4L0ZB 4M9ZA 4DYCA 4C8QE 1HW5A 1PM3A 4V2FA 4RMOA 2IS6A 3OV8A 4RCCA 1I5OB 1V5FA 5GADJ 5F0CA 3W6KB 3C2BA 2CU7A 4BAYA 1ETVA 1J7KA 3T8RA 3DU6A 1MNMC 4EMSA 3JCMP 4M3GA 1S72Q 3RNJA 2GWRA 1W7PB 1I6HJ 4AFSC 3SFIA 2V9PA 1M1KU 3O2PE 2MMPA 2R0QC 2EA4A 2A3LA 3DKWA 2COBA 3RSNA 3I4MJ 2W84A 1TTHB 3M55A 4E7HA 2B63J 2PQ8A 1RADB 1I39A 2RNAA 1B07A 5I2MA 2Z1DA 2A36A 1G3SA 3LNQA 2KKOA 1FP2A 4RDUA 4M77E 5HVQC 1UFMA 3PUFA 4LIUA 4KRTA 5K7HA 3R6NA 1Z7UA 2NS7A 1WXUA 2BZYA 5ECAA 3GFMA 1OU8A 2DOFA 3I55T 1WI9A 1IGQA 2ZAEA 2E1NA 1PVEA 1HLVA 3HFNA 1MMAA 4AMCA 4L59A 1QZEA 2QBYB 2DYSH 1O3RA 4KIBA 2M5WA 1KYZA 3H3ZA 2DL5A 5CKTA 5CVJA 2Y0MA 5LJ5j 1E3HA 5L3FA 2BY2A 3WTZA 3ONQA 3BP8A 2LBFA 2PJPA 3HHTB 1M1KC 3EGDB 1TUCA 4L9JA 4B44A 1O7LA 2Y75A 2ME0A 4EATA 5DTDA 2D1VA 1FBUA 2E1CA 1HA8A 4LOCA 1EA3A 3QBYA 4RTUA 2ZPEB 1QWEA 2DLPA 1VQNA 5GAN5 4J9GA 1AHDP 2J06A 4LE9A 2A08A 1FOKA 4M4ZA 3OSFA 3EG0A 3H0IA 3FHNA 3VODA 2ID3A 2K86A 5BQTA 2O9LA 1K76A 2A6EF 4PCQA 4QPOA 2ZFWA 1FYMA 5D6WA 3WVEB 2L9NA 3X20B 4Y7NJ 2ZXWH 1VTNC 4C8QC 2E70A 3C3WA 4EEFG 4NL3A 1Z9ZA 1LFBA 4BY6C 3DB4A 5CQXA 2VQCA 4IO9F 3LWFA 4IOCF 3LQRA 2X6YA 5CJ9A 4AIJA 4A3JJ 2CYYA 1POGA 3K70D 2E3IA 2HL3A 2XIDA 2AO9A 3S1QJ 4OVAA 1M2VB 1NEGA 3SFZA 4JUVA 2RH2A 4XONA 4JX6A 1SD6A 4C0DC 5KYNA 4GO1A 2MW8A 1ODDA 1XB4A 1YHQT 1H3HA 1JUSA 3QP6A 3CCQI 2HEOA 3QG1A 5DEQA 4HNUA 4M77C 1EH6A 2ABLA 2OJ2A 3BJ6A 3U23A 4JRPA 1Z6TA 2WSEE 4XORA 3CQZJ 2COMA 2JS0A 4M75D 5GJVB 5GAOr 1M8VA 2JMCA 3M8EA 4J8OA 1IO6A 3X2QH 2DKGA 2DA3A 2XDPA 2JSPA 3KYCB 5LHGA 1O3QA 2GXGA 4RAGA 1JB0E 4HOBA 4E7JA 1GT0C 1KK7A 2OI3A 1GXIE 1N25A 3QIIA 1D0YA 2XG8D 4DBQA 3S3OA 1FMVA 3L42A 1YJNQ 1WWXA 5EEHA 5F1RA 4XAXB 5K1YA 2JT1A 4R79A 1VYUA 5FD5A 5AIPA 1GXQA 2MSYA 2UV1A 2XRNA 4GYGA 1XOVA 2IPOB 1BC8C 2X51A 2OAZA 5E1WA 3EG9B 2EZHA 4JLIA 3JRHA 2L54A 2DF6A 4C92A 1XGSA 1DPUA 1XCBA 3KEYA 5LHIA 3OYFA 4PGHA 2A5WA 1XPXA 1EX4A 4HVVA 3DFGA 4HSTA 3WTWC 1IV8A 4O5VA 2X9DA 2CV2A 1R0CB 4GLMA 1LNWA 4HNTA 1M3CA 4F7UF 4LDXA 3CCSQ 3M0UA 3HUGA 1SFEA 2JN6A 1VIEA 1Y07A 4IX7A 4LMYA 2QYZA 1BN5A 5DUIA 4EMHA 4BE0A 4HZFA 2FXAA 2NYXA 3HRUA 3OMYA 1LDDA 1QVTA 4C5GA 1GHCA 4EMGA 2M0MA 1QMCA 2DILA 2LQKA 5FKOA 3Q0WA 1VQOT 1GCQC 2ZJ2A 2L9RA 3S1NJ 2RAEA 1OZ3A 2JA2A 1MDMB 1PC0A 1RAFB 4X34A 2XUBA 3FK7A 3F70A 3HB9A 4GY5A 5I2SA 3GOXA 2AHQA 2KZGA 2HSEB 3VFZA 2VKHA 4KN4X 2EBIA 1B7TA 5EC7A 1K83J 1ZA2B 2DBBA 4IHXA 4NBQA 2YRCA 2IGOA 4HQMA 1KU7A 4HF1A 5LJ3j 2IG0A 1NJIR 4B6MA 3IAS2 3BTCA 3KP7A 5GAOp 1RETA 2KIUA 2OCCH 3M57A 1S9HA 2PMUA 5JHUA 2K79A 4BUGA 1T0FC 2DL4A 1NBEB 2LQ8A 3HGYA 2XSDC 1B8IA 4U88A 3HOZJ 2HD0A 5HODA 2J05A 5FKMA 5E3NA 5E17F 3N05A 2HCKA 3G1JA 3C4SA 5BS6A 4A4EA 4M7AG 3GTLJ 5KYXA 3FISA 5DLQE 2DPPB 1ZA1B 1Y1VJ 4EJVA 1ZG3A 1H9TA 2ZJPF 2MWPA 2K02A 3MCAB 3NRVA 5B3SH 1GLNA 2HTJA 4QQDA 3PO3J 2L89A 5B1BH 2KLOA 3BTIA 2LF8A 5CKBA 1B9MA 4WWCA 2QQAA 4NNJA 2KI7A 4OF1A 2DXTA 4QVZA 1BR2A 4BJTA 2HVSA 1J2XA 3RKQA 1G3TA 4UY8I 3KE2A 3IH3A 2NAZA 1A31A 3CMAA 3GFIA 3W3CA 3HPGA 1TUDA 2I8DA 1TSFA 4NL2A 3CCVA 3CD6T 4L9VA 1FSEA 2DOAA 5D5WB 5KYWB 3V4GA 1TH7A 1VQMI 2HL5C 1VIFA 4OB1B 5D6FA 1VQ4T 2RI2A 1U06A 4F3QA 2E19A 5B5EC 1R5GA 2I5UA 1OQKA 2Y4YA 3COAC 1OOTA 3E6BA 4HW0A 2FB7A 4P9FA 4TVRA 4KJZA 1S1NA 2D1XA 1VFCA 1ZAOA 1ZQ3P 2Z16A 4CI0C 1L0OC 2PN6A 2NXNB 2Z0WA 3MKLA 3WTXC 1BR1A 3JCMe 4OB2B 4XKBA 2EPFA 3Q0VA 4XU0A 3OQ5A 5I22A 1ETOA 1ZREA 5C4JJ 2YRDA 1T3LA 4CDGA 2FO0A 4ZYHA 3N5BB 3J7YJ 2QLZA 3EUKL 2MH2A 3K4MA 3BDLA 4KT0E 2QA4A 4RBOA 3SWNA 1QPMA 1DU6A 1X43A 3CP2A 1O3SA 2E6ZA 1T98A 1YFNA 5FWBA 4QWQA 1P4AA 2EIJH 3HXLA 4Q47A 1VQKQ 3BLYA 2MFZA 5EEGA 4JS5A 1R7JA 2P7VB 5A2QZ 4AC0A 1R71A 3FRNA 1IG7A 1YQAA 2HQ5A 2BE5F 3IHUA 4EMKB 3E0JB 3LA3A 1Y7XA 1RL2A 5DM6F 2WSCE 3CCET 4M7AA 3OYDA 4OMQA 1RC9A 2H6CA 4Z6YA 4AIHA 2LY9A 3GWZA 2JRMA 4NDLA 2E5KA 2K9LA 3CZ6A 1VQ5I 1OFCX 1X3UA 2JM8A 1LFPA 4A0XA 1SF9A 4CGZA 4A3CJ 4CC2A 2EFWA 4AM3A 2L3RA 2Y9YA 1I3AA 4C92F 2D0QB 3FM5A 3KPHA 2XAUA 2H8RA 3J80R 3JB9I 3CO6C 4AT1B 1VQPI 6PAXA 5IH2A 1YITT 3HTRA 2DA6A 2VC1A 2DA4A 1OI1A 2EKHA 3L1AA 1RI9A 5AYFA 4MTDA 3RI4A 1RABB 1Z9CA 3U21A 2VT2A 3PE0A 2CP3A 3X25B 2Z5UA 4DBHA 3PSIA 3GIBA 1RAGB 4YELA 4M78B 3SFMA 3JCMg 4FYYB 3KLOA 2E35A 2LH9A 2COYA 4CA0A 4BHCA 3JRBA 1Y1WJ 3FEOA 1UCRA 4C3IJ 4FX0A 3G6EI 4F93B 4E70A 3DBRB 4N4GA 2P4TA 2DTRA 3WE3A 3HDDA 5K7ZA 3K70C 2KYBA 2VVKA 4WF2A 7AT1B 3JCMV 2F2EA 2A61A 2JUFA 1WPKA 2CWEA 3CUQA 5CQEA 4HSRA 2C0TA 2GBQA 1LPQA 3G4ST 3JB9G 2RV8A 2ID6A 1AWOA 3OYAA 3I55A 4A3IJ 4XOTA 4NC6A 2HKNA 1UHWA 4IL6C 3JAMR 2VUBA 3F8CA 1G5VA 1FYLA 3I56T 2RVCA 3EFSA 3BTJA 5GMKj 4M75C 4HEA2 2QENA 2OZUA 4Y3OA 2KMUA 2X3XD 4KGVB 3EG2A 3VYGA 2A3SA 3OB9A 1TQPA 1SD5A 2DXIA 1HXDA 3V8KA 3EFOB 3AG3H 2V1XA 2CUBA 1ZKGA 1KHIA 3I9QA 2GM4A 4BQNA 5GAN4 3DTEA 4BE1A 4C2TA 3HOTA 1I81A 2KPMA 1RAEB 4UV8A 3URGA 4M71A 1T33A 3NQOA 5GAMe 4IHWA 2LVSA 3KYLA 4KISA 1JXSA 1M27C 3CC7T 4M72A 4AVZA 4J9HA 4XRMA 1HSTA 2P0KA 3MHXA 3R61A 4XLHA 2DIGA 2CH0A 4PFOA 4NUBA 4M77G 4CC4B 3FDRA 1HCRA 5J1YA 4A3GJ 4XLFA 4OAZA 5A2QE 2PX9A 1MBKA 3T0YA 1LVAA 4CYCA 5GAN3 2MF2A 2LNBA 3FKIJ 5CKEA 1BW6A 2ZMEB 2DMPA 2GIVA 4J9IA 3VRZA 1YHQA 1OZ2A 3GBQA 1BIBA 3TOAA 4OMPA 1KQ2A 3GLLA 3K4CA 3HOSA 2IXSA 5KHDA 2VBXA 2X48A 2ZXJA 1ZGAA 2VL8A 3BZKA 3OR1C 2CDTA 1R6RA 4KN7X 1HOMA 3LGLA 3RPUA 4C0GA 5F08A 1IN5A 4J9CA 3E5QA 3A98A 2E6NA 2VC8A 3JR9A 3F23A 1I27A 1M5Q1 3CLOA 4LUDA 4QW2A 2O3FA 3K4LA 4LG0B 4LIVA 3PQJA 4CYDA 2SEMA 1D3BA 1PYVA 4KGZB 2P0TA 3VUBA 1M4ZA 2GIZA 2DZ9A 2LCCA 4ZTFA 2GLOA 2ZPHB 3Q9SA 3G73A 2R57A 5GAMg 5CR2A 2YSQA 2EVRA 4RUGA 2CZ1B 3WU1B 3L1PA 3H9QA 4F92B 2KDOA 2KT0A 3DU5A 2HAXA 1BIAA 4M7AF 1GBQA 2CUZA 4D8DA 3WTUC 2MYSA 5GPCA 3ZQLA 1KG1A 4YIIA 3KX2A 3G1LA 5KVRA 1TQIA 3L2RA 4QIWN 2CMPA 2H94A 3PNVA 3OOUA 1YRNA 2JS2A 4C8QA 2CZ6B 4OGEA 2ETHA 2VLAA 3K1NA 1UGPB 3KFVA 4KH1B 1GV5A 3M1EA 1ON1A 2P5LC 1JBMA 3JSOA 1QCFA 2CYZB 2F5TX 3S6WA 4XRSA 4UNOA 1AOYA 2QXFA 3EGXA 3HC7A 5KYYB 4PJLA 4N4OB 1AKHB 3CXCS 2K5IA 1VQ9T 1VQOA 1OYIA 5HS9A 3A8HB 4A4KA 2DT6A 3IV5A 3K2AA 2FRYA 2AXTC 4X9DA 3MQ0A 2JPCA 2J6FA 3ASOH 4M77A 3QYGB 1OJLA 2GCXA 2IPQX 1VZ0A 2CSOA 2KE9A 4FIBA 3UATA 1WLPB 1YIOA 1K7AA 5IYDJ 3RZDJ 4EJTA 3GTQJ 2Q2EB 2PVOB 5DY9A 4A54A 1NYGA 2CZ7B 1LJ9A 2FU4A 4E6KG 3X28B 3I59B 4ZDPA 1H8AC 1RI0A 3CCLA 2V79A 3CCRT 1XMAA 1X6BA 2RQWA 4XSZF 1JUMA 2RREA 3PVQA 5HY6A 2OTJT 2QA4Q 1YX3A 2DO7A 2M4KA 4QVCA 4UUSA 2FRHA 3L09A 1DGRM 3HKZN 4X1EA 1VQ8I 3OS0A 3FIFA 2KXCA 3BY6A 4D8KA 1QA6A 4A6EA 4ASNA 2FRWA 2KK4A 3S3MA 1Y0MA 4J6YA 5CCAA 5D6XA 1MH4A 3H3UA 1WFWA 3P8BB 4A4GA 2STTA 2FD5A 1X69A 1N8RU 4ZN3A 4IUUA 2MH9A 3LLRA 3MEWA 4BYYA 3WU0A 2BVLA 2H3EB 3MVPA 2R92J 1XMXA 2XB0X 1OV3A 2B8AA 4UB6C 3JRZA 3CMAQ 3BG6A 1KIKA 3C18A 2LNHB 3LX7A 2CUDA 3CD6A 1M2OA 2VIXA 1MHNA 5GAN7 2K2VA 1M9SA 4A0YA 3LW5E 2JQ7A 1GCQA 1ZG5A 2BZXA 2UWMA 2DTHA 2WC2A 2W10A 3KBGA 3SJMA 1VQ4A 1OKRA 1K8AU 4YFKF 3TDZC 2E2IJ 4GDFA 3BG5A 2YUOA 1YI2T 1RLPC 2ZB9A 5LL6S 4UC4A 1QRYA 2HOEA 3RQIA 4KH0B 3CCUQ 1Y96B 3CPWP 3BPVA 1YJ9T 4AYBN 1WQ7A 3LH5A 3S8PA 4JLGA 4PL6A 2R3SA 1N8RC 1VQLT 3CC2T 4M7DD 2XAHA 2YLCA 2P4WA 1T0FA 1UG0A 3NARA 3BR2A 4M9SA 1MMSA 2EIFA 3GZ5A 1W5CC 5JVTA 2KMTA 2RQRA 3MKDA 5FWCA 4AD9A 2YSRA 1EH7A 1Y39A 1QQJA 4BBRJ 5HKCA 1G2HA 3A8LB 2W1OA 1PUFA 1K79A 1STZA 3I55Q 3I58A 2LG4A 2V8IA 2IGKA 3W6VA 1VYTA 3OYKA 2HKQB 1MBJA 4M3DA 3JB9F 3M56A 1K8AC 1K4SA 2EGAA 4DOWA 3R0JA 4XLPF 2F4IA 3MFKA 5LBQA 4J9EA 1TQMA 2Y4XA 2FBHA 2LQWA 4CC3A 3FXUA 4UV9A 3BDUA 4DBFA 2M8EA 1H9GA 2F5DA 3MD2A 3GVAA 4PSXA 3L2CA 1DDNA 2H3JA 3EUHC 3GMEA 2EGCA 4JRIA 4OMYA 1KQSP 4I98B 2ED0A 5GAOn 4E7LA 2XASA 2JZ2A 3FXOA 1UJ8A 3TKYA 2D2WA 4F04B 4A3DJ 3G1MA 3HBLA 1I5LA 3ML6A 3JCMb 3BZ6A 4PZJA 2QZ8A 3EYYA 3SZPA 1YIJI 5CO7A 2FOKA 1YJNI 4CICA 5F64A 3L2UA 1R58A 2PZ1A 2E60A 1YITA 3ZQHA 4C8QF 2KRHA 2AIRB 1X19A 2Z2SB 1JHHA 2ZXHA 9ANTA 4D7MA 2HZTA 3IWFA 3WTSC 5KAIC 2K6DA 4Q48A 1VQ7A 1X27A 4CCKA 2DFEA 4DEXA 3ERMA 3KEOA 2L2OA 1W36C 4BKXA 1PHTA 2IW5A 1UMQA 4A93J 4CZCA 2OU2A 3ABUA 4M75G 3KP2A 2VQLA 4L18B 4DYQA 2KGTA 2AXLA 2DM1A 4M77F 2OD5A 2HZYA 2EFPA 3BR3A 2K7LA 5JVGF 5KNLA 3G4SA 5KCOA 3JB9H 1XDSA 3IUOA 4LK0F 4XBFA 3AAFA 5IHKA 1QCNA 3REAB 3DPUA 3OMGA 4I02A 1WDXA 3CXCA 3OYMA 3TW6A 3M58A 3VKIA 3LWIA 4RTVA 2VQHA 4KT6A 4O3MA 2HXIA 1NM7A 3LL7A 1WYXA 2NLUA 5E3MA 2CP7A 2BHZA 3A1YA 4MQVA 3ZMTA 2CUJA 1GL5A 1MMDA 1E0EA 1WGXA 2O03A 4QQ6A 3H0FA 3MP6A 2B9SA 2K57A 2DK8A 1TZLA 2EZKA 1OCCH 3FX3A 4NQWB 4RAYA 4QPQA 2R5YA 1C0MA 1X6GA 4J9FA 3JRAA 4A5MA 1M1EB 3HKZA 1Z77A 5D4SA 2R7QA 1SVMA 4HVUA 2LCSA 3FJPA 3BCBA 4MMKA 1ZR4A 5KK1A 1ZG1A 2PJRB 3GTPJ 2PQWA 3CC7A 5ICEA 3C94A 5FLMJ 5DD8A 3WG9A 4MZTA 1GFDA 5JHFA 1P7JA 1SEMA 2FZKB 2MABA 2K9NA 3F6OA 3EPZA 1GFCA 2GOXB 4S05A 2VPLA 3MEUA 1VQOQ 1OLTA 1S7EA 4CHUA 2K3FA 3UNGC 2K3YA 1SFXA 1ZGJA 3DLMA 3QDRB 1TNTA 3M4OJ 2D8JA 1TT0A 3HOYJ 2VV5A 3G2BA 2O8XA 4M7DE 3BZCA 2FUG2 3A8MB 4G6DA 5IT9R 3CBOA 3GF5A 1V4RA 4XIDA 4D6WA 4I01A 5HLGA 1AWCA 2W25A 4BBSJ 3LSHA 1IXCA 4LJZF 5GPAA 3A01A 4ENMA 2KT1A 4XU2A 1YIJA 4HNVA 1RLQC 2OX7A 4FE4A 3MP1A 3C2GA 3DTKA 2MD5A 4G6QA 4MEYF 4NC7A 4XR6A 3OS5A 2Z99A 2BZ8A 2KVQG 3CCLQ 3JB9J 2R5ZB 2HXOA 2LFBA 4OMLA 3OIOA 3KXTA 1VQ6T 1W5SA 1WFXA 1PDNC 3QPSA 4J01A 2QAZA 4BI4A 2IEKA 4J7FA 3SEZA 1LPLA 4AFQC 1R77A 1KU9A 3REOA 4A12A 4C30A 3MZ8A 1P4XA 5HK3A 1W70A 1WSUA 1LNXA 4HLYA 3SZGA 2HQRA 2M02A 2CW0F 3F0CA 4IHSA 2JPBA 3DKXA 3EFRA 1FMKA 2DE0X 4XN3A 2VC0A 3AL0B 1JKQC 1HW2A 2LTOA 4BQOA 3GEZA 2DI3A 1A36A 2P0PA 2ESNA 3GNGA 3CD6Q 4O6JA 2V4JC 2JWTA 2OAUA 5FKKA 2XIGA 3S32A 2GXBA 1VQ9A 1DGWY 2KRNA 3ZGKA 1QU3A 4Z88A 5A0DA 3WTYC 1VQNI 3JV3A 3M1CA 1NHAA 5IT9E 3FIWA 1B1BA 2HTSA 2Y69H 3UA6A 3UA7A 1UJYA 3MAJA 4A3BJ 3GYHX 2GQIA 3KZIC 4H0EA 1F9NA 3RYPA 2LX9A 1FNNA 3S2DJ 2EV5A 4Y15A 1N78A 4ZYDA 2K2MA 4II1A 4EPCA 5GANg 4I76A 4PJOD 4GBQA 4I6ZA 5GMKi 4M7DC 2WACA 2L0AA 1MUZA 1V1CA 2E10A 3SDZA 2M87A 4HA8A 1U5TB 1WHJA 3TSZA 3CCRA 1KFZA 2QBYA 2RJEA 3TU4K 3HOXJ 3BG9A 2VBYA 2VXDA 3FXKA 2L01A 2OTJA 2W24A 5A0LA 1D09B 1WGSA 2I2LA 1PG5B 2WY7Q 2CQQA 2GQQA 5HS7A 4DOVA 5DD4A 3TP0A 2QI2A 4I99C 2KQWA 1FY7A 4HV6A 3DXJF 4GRIA 1TWGJ 2EINH 3KP3A 3O3KA 2O4XB 3ER0A 2L8DA 2VBZA 2EQUA 2KSSA 4Y4RA 5LJ5e 3EGDA 3N97A 1OEBA 3CCJT 3ABKH 2EILH 3P9IA 2XGXA 1CGPA 2DPUA 1S7AA 3OYNA 1YX5A 1U6GA 4IEJA 3EYIA 2HQNA 2BVMA 3T8TA 4HCBA 2PUKB 4V19K 1X1DA 2L5QA 1JXOA 2NVQJ 2LLKA 2G0EA 3ZR8X 3DCFA 1CQTA 1TU0B 1XSDA 2M8GX 4CUGA 4LDUA 1BJAA 4U87A 2M9HA 4F16A 5IP7J 1C6VX 2BY3A 4JJCA 1YITQ 2AQEA 3OBYA 1ETQA 4PNOA 2RJFA 4BEHB 2DOEA 4H4KC 2KIQA 1YI2A 3FXRA 4A3EJ 2IAIA 2KISA 1VQ7Q 4KA4A 2XSJC 1GXPA 2L9VA 2R7DA 2LRDA 2NRAC 1Y56A 5HLTA 1ZQ1A 1WJAA 1E2XA 2L2PA 3CMET 1VQ8Q 1M2VA 5BPIA 2A28A 1VQLA 3CC2A 1TBXA 1LVKA 3ERED 5FU7C 3TEDA 1YG2A 4FETA 3HPWA 4KULA 5ILVA 2XAGA 4LD5A 3WGGA 1BBZA 2CT3A 2VI6A 1Y0UA 2OC6A 1BCMA 4L9TA 2BIVA 1MBGA 5TJJA 3QODA 3LSRA 2PVGB 4M6XA 2W0ZA 3UF4A 2PNIA 5GAGJ 3J80K 3D7SB 1VI0A 3AG1H 4M75F 4U7BA 3HFOA 5LJ5g 4IURA 5HK0A 4RB0A 2IRFG 2F6CA 1J9IA 1NZ9A 3MPUB 3JCMd 4C92G 1BI1A 3MCZA 1SVLA 3OIPA 2OTLT 2CW8A 4AIKA 5TISC 1YW8A 3ASKA 4JZ4A 2K4BA 4E7SA 1RI7A 1ZRFA 2BV6A 4JYKA 2DXBA 5E8GA 2FL7A 1IRFA 2GXAA 3F22A 3H9GA 2RKHA 1P6RA 1PSFA 1YNZA 4PJ0C 3WTVC 2XK0A 3I71A 1UHSA 2Y30A 1MMGA 5GTHC 1KGSA 4BUPA 4XL9A 3IRQA 1L3LA 4JX4A 1BCOA 4IRIA 3P8HA 2XDVA 3CCMT 1M1FA 1T56A 3E6MA 1FTTA 1TS9A 2FZGB 2DFUA 1BBYA 1GBRA 4K11A 4Y28E 3MKZA 2FPEA 1D5VA 5K7FA 1KU3A 3ELKA 5LRRA 3Q0UA 4IHTA 3JAMK 1ZSZC 5HLIA 1T08B 1MNEA 3MP8A 2DQRA 1SMYF 2LX7A 3HP9A 4F7UB 2ROLA 5HNHA 2DW4A 2X1DA 4PLIA 1KYWA 3HGGA 2H27A 1OMIA 1JJ8C 5FW9A 3FB9A 1AEYA 2OAWA 2LDUA 1ZX6A 2O31A 3NEUA 1MDMA 2X3WD 3W2AA 1W2BS 5J1RA 3CMAI 5C6SA 2RN8A 3ULRB 3CCVI 1QHGA 4Y13A 2HWVA 2KFDA 2ZC2A 1ZLKA 2HEQA 8AT1B 4PFPA 1U0JA 3FMRA 4PJOE 2CV0A 1F43A 3ESWB 2BKDN 2QEXT 5EYRA 3BWGA 1VQKT 3A52A 1BK2A 5GAN6 3H1CA 3AFHA 1G3YA 2LTPA 3JRDA 2KHMA 3DEWA 4BJ5C 4RS8A 3RZOJ 3D5SC 2MWOA 1YIJQ 1JJ2P 5KYUA 2D6FA 1SAUA 4HPQA 4XN0A 4B4CA 2LD5A 1N9SA 3S3NA 1YJWA 3EUHA 3U1DA 4IJAA 3TSWA 2JVVA 5EDNA 4FT8A 4BXUA 2VN2A 4JDSA 1ZK8A 1S29A 2E7WA 1SD7A 2F4OB 2VOPA 2QA4I 2RJCA 4D5CA 1YN8A 1IXSB 1KD1U 2LBFB 2K9GA 1WIEA 1QVUA 1G2BA 1QZZA 3QYEA 3IAM2 4ZYGA 1UGVA 2EQRA 1VQPT 4HDVA 3HSRA 2MAMA 1U8BA 2XKPA 1N9RA 1CKAA 2EIKH 3J7ZI 3VSLA 1FIAA 1KU2A 1T6SA 2OBPA 2ZJQF 2CQNA 1HC8A 5FB2A 1UHCA 2HKOA 4BJ6C 2X1CA 1KA8A 2F5EA 1TW3A 2CO5A 1F4KA 4AIDA 4HKEA 5GAMd 4P96A 1W7PD 3E6CC 4HCKA 3DEUA 2G6FX 2BGCA 2L7MP 3VSKA 2QDYB 2YXYA 1M90C 2R7OA 3BR1A 3HHHA 4FYXB 1W6XA 1BJZA 3ECHA 1RUNA 4Y52J 3FXJA 1WKMA 2KQRA 5M3MJ 2VGMA 3O5ZA 5LJ3g 1JI8A 2JA8J 3HIFA 5J1UA 1KD1C 3FMSA 1IUYA 4LLLA 3TCJA 1UELB 5E79C 2ECBA 1RIOH 3L2VA 4B8XA 4G7ZF 3GFLA 2RPNA 4PJOC 2MUNA 3CMMA 3SDBA 2WAEA 2IGNA 2X6XA 4P5OA 2Y9ZA 3QWLA 5BOXA 2BE9B 2CFXA 2ENMA 2LC4A 2GNCA 2K85A 1X1BA 3F72A 4ATOA 4C5HA 2V6EA 2ELKA 1TXQA 5TGTA 2IBDA 4M3FA 3CCRQ 2J5OA 4NOYA 5GAN8 2KT8A 3WU2C 2OTJQ 2A05A 4ON0A 3KLNA 1QWFA 3M4YA 2NUTA 1FZPB 4DYRA 2H8HA 4P5NA 2CFOA 2NOGA 1VQ6A 4DNCA 3BR5A 1WQ2A 1IN4A 5DCMA 2EZLA 3FJ5A 3NFCA 4J7IA 3I55I 1XN7A 4FE7A 3GZ6A 3FM3A 1BW5A 5KE3A 1UDLA 5DCFA 4YIFA 2B86A 3M7GA 1AWJA 1K6OA 3S1MJ 2DA9A 5ICCA 3BDDA 2ZO4A 1TG0A 1IDYA 2EB7A 4FX4A 1IZ6A 4HXJA 4B9WA 5EG0A 4ESRA 1D0ZA 3VS5A 2PU9B 1KQ9A 2DJQA 1J59A 2JK3A 4C92B 4XTZA 2QWWA 2E41A 2BOLA 4P1WA 4UUTA 2Y2ZA 4JPBW 4ZGDB 1K0XA 1K0SA 5EZHA 2WADA 3K9TA 3CJRB 3H6ZA 2O9VA 3CDIA 3HUGB 5C3EJ 5C4XJ 2JXBA 2GGRA 2FMYA 3H35A 5M5XJ 3QDFA 4BQQA 2NWMA 1YI2Q 1V3FA 4F52A 2DA2A 3EDPA 2DJIA 4XLEA 1MV3A 1HQCA 2HVQA 2IP2A 1ZHFA 4XRFA 3UT1A 2D0NA 1USTA 1QPIA 2UZKA 4R0KA 1VQLQ 3UPUA 5L23A 4LGWA 2DAOA 3VDXA 2QQ9A 4OINF 3F21A 4XTUA 3M8FA 2ZBKA 4RAFA 2KIFA 4M74A 3P8DA 1QQIA 1LE8B 2E5QA 1MJ9A 1HF0A 3CC4T 4VUBA 2CP2A 3HEFA 2NUPB 1W2BA 3LAPA 1YHQI 3JCMh 1HSQA 1B8IB 5HOOA 3CESA 4RG8A 3S2WA 1YWPA 3CCJA 4WX9A 3I5SA 4B48A 1MKMA 1YLFA 4UUVA 2CG4A 2FBIA 3OYIA 1B72A 3B6AA 2E1MC 2IA1A 2HPIA 1WA7A 1JHFA 1EZZB 1VQNQ 2DMTA 3F6VA 4A69C 4DZPA 1OPLA 2LP5A 2JTEA 3VS0A 4OIRF 3K1MA 4IUQA 1SFOJ 3CJNA 2HPMA 1IN8A 3DLAA 1I07A 1PUEE 1H89C 2NYSA 3CBMA 4GFBA 3TOBA 2E3HA 4RKUE 1AD5A 4IVNA 2JUCA 4RM3A 1JKOC 2WSFE 3QPLA 4LITA 4EM0B 1SVOA 3LSKA 2O8KA 3ZFJA 1MW7A 3E5UA 2CUEA 4XNFA 2NVUB 4XKVA 1CSKA 1K4US 5F0HA 4UVCA 1AU7A 2QVOA 2O7OA 5HDKA 2ISZA 1WJEA 2OA4A 1E7OA 2DEQA 2JOYA 4DW6A 4DEYA 5CQGA 2QQBA 1IRXA 2RN7A 1U2WA 3F8FA 1RESA 3CMEA 3L7WA 2QKMB 5A2QR 3I35A 4MZPA 1AWWA 4ENNA 3HKSA 5GAN2 3MJXA 4M7DA 3CPFA 4DQ2A 3JCMW 4X1VA 5M9OA 5LGTA 2E2JJ 2JM9A 1N6AA 2XGCA 2YUPA 2M45A 3G71T 1OULA 1U3EM 3CO7C 1K78B 1GV2A 2CREA 1Q81U 4KDPA 4E47A 3HG9A 1I0CA 1KHCA 1VQOI 1V5GA 2XI9A 2X4XA 2VOOA 5BMZA 2DMUA 2RK2A 5L3CA 4I0AA 3J7AY 1PRMC 2NOJB 3GNFB 5LLQA 2FMLA 3FKJA 3OMCA 1QCOA 3VEPA 2V9KA 4I09A 2OJED 2M7AA 2KRCA 3DPLC 2RB6A 2XHCA 2OTLA 4EVIA 4DIQA 3E6DA 5D5VB 3EG3A 4ME7A 5LRSA 1U5TC 2ZNYA 3SWNB 4C8QG 3KYDB 1P7IA 3HTUA 1ZGWA 2HFHA 4XTYA 2CUFA 1XS9A 1QO0D 3CJQB 2VE9A 2FX0A 2X85A 4PJMA 4A3MJ 1YJWQ 3R4KA 1ZARA 3E3VA
chains in the Genus database with same CATH topology
3CCMA 2KAFA 4LDWA 1K9MU 4JJNK 3RERA 1I5ZA 1Q81C 4M7AB 1ZLJA 3J81K 4ESBA 1PSEA 3M59A 2HGCA 2GF7A 3OOPA 2CKKA 4JS5A 2DD5A 4ZTJA 3AHUA 3QO3A 4IUPA 3L2WA 3TO9A 4LK1F 5GAMh 4OU0A 4FL6A 1KC8U 2ZNZA 4EJUA 1K9MC 4GXOA 3WE2A 4ZZLA 2A6HF 3LH0A 4LLGF 5FFXA 3MZHA 2RO0A 1VQKA 1B34A 3F8NA