2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
4HQEA 1D8KA 3GW2A 1FPQA 2FE3A 3F8NA 2RKHA 2CFXA 3K2ZA 3TGNA 5K5QA 4UUVA 3G73A 2X4HA 4G7ZF 2KKOA 3M7GA 3E97A 1V4RA 4P9FA 1OPCA 3HSFA 2STTA 4MQVA 3IRQA 4ENMA 2BV6A 1U3EM 4UVAA 2IA1A 1KYWA 4HBLA 2KIFA 1KQ9A 2ZMEB 3C7JA 4UV9A 3KZYA 1LDDA 1AOYA 4EJVA 4N9IA 2HWVA 2M8EA 3CUOA 1SAXA 1KQ8A 3GVAA 2DQRA 2XKOA 4BH9A 1K7AA 1IUYA 5HS7A 3WTYC 5DCMB 3KP6A 3O3KA 3BJOA 4KT5C 5LRSA 3MFKA 3L09A 5DUIA 5FFXA 1AWCA 4YFNF 1LVAA 4L18B 1P92A 1LEBA 2PBIA 5K5RA 2E1NA 2F5FA 3WE3A 1R23A 1TW3A 4HOBA 4U7DA 5LBQA 1E2XA 3WTZA 3WTVC 1QGPA 3F8FA 3FWEA 2VBZA 3OOPA 3ZN1A 3I54A 5LGTA 2NRAC 5DYMA 4S04A 4A12A 1LJ9A 4UVBA 3V4GA 1PP8F 3R4KA 1R5HA 1REPC 3I64A 5DDGA 3E6DA 2XV4S 3HUGA 3EETA 4WK8F 4PGHA 2C6YA 4HW0A 1Z1DA 2P6SA 3FM5A 4U7BA 2ACJA 3TO7A 5HS9A 4HV6A 3GFLA 4KICA 3QPHA 2EJRA 4IRHA 4M6XA 3DPLC 4TV7A 2VN2A 5HLIA 1RI7A 1D5VA 5D5XB 4HX7A 1BM9A 4KN7X 4M9XA 5ERIA 5D6EA 1O3TA 3E6BA 2P6TA 2M1BA 5CVRA 4DNCA 3HSRA 2GA1A 2Z5UA 3FMSA 4MNUA 3F21A 2HOEA 5L3DA 4OIPF 2WTEA 4YG2F 4XSZF 1GVJA 4M72A 4KYWA 2FMLA 1B9MA 1F1ZA 1IN8A 2VXZA 2RDPA 2ZKZA 4ENKA 1W7PA 2EB7A 3F22A 1FNNA 3U2RA 4M71A 1IRGA 4BQAA 5ED4A 5LHHA 2EFWA 4WX9A 2PMHA 2MBFA 3JW4A 4BYYA 3KETA 4EJUA 3RDIA 2O3FA 2RC4A 4ASNA 4IRGA 3WG9A 3I53A 2DT5A 3SZPA 5HOOA 1FBSA 1Z6RA 2H94A 5A2QK 3DQVC 3LQQA 2V1DA 2VC1A 1EH7A 1QBJA 4IJAA 5E8IA 1R22A 3RIRA 2XROA 1HKQA 5IT3A 1MKMA 1U2WA 2VT3A 4MHGA 1FX7A 4MEXF 5ICGA 4PZJA 1J59A 3WTXC 1PP7U 4HLXA 2IVMA 2QBYA 2HQRA 4ZZDA 2GZWA 4PDKA 1XGMA 1L0OC 3FF5A 1QO0D 1IN4A 2Q0OA 1W7PB 1TTYA 2DO7A 4RB0A 2YSRA 4QWQA 4RGXA 1J2XA 2XHKA 3MCZA 5AIQA 2O6GE 2CW0F 2HYFA 2WWYA 3FXUA 4M74A 4IPAA 3ZPLA 2MA3A 1ONVA 2K27A 2IJLA 2LNBA 1R5GA 5A2QZ 2Z99A 4ESFA 2D45A 2BGCA 4KN4X 3QP6A 4BHPA 5K1YA 3WTUC 1XN7A 1QVPA 4G8XA 2Q2EA 1ZH5A 3J80K 2OAZA 4GYIA 2EFQA 2X0LA 1UB9A 3DV8A 4M73A 1MJBA 3CJNA 3HOTA 2ISZA 4HF2A 1MZBA 3BDDA 3C1DA 4WXCA 1KA8A 4HDVA 4L9NA 3ROUA 3RPUA 2J5OA 2H3JA 1F5TA 4WXDA 1TQMA 1H9TA 3KEQA 3NRVA 1YYVA 2A68F 2L4AA 4U88A 1X3UA 1O7LA 1BOAA 2W25A 4HLYA 3MAJA 2BBYA 3IC7A 2DK5A 2ZNZA 5AIPA 2CG4A 3JAMK 5CJ9A 2EWNA 2CGPA 2ZJ2A 6PAXA 3I5UA 4EJWA 5CLSA 3L2CA 2M87A 2B0LA 1HW2A 1MGTA 3E5QA 2K86A 4WCGA 3LAJA 2IA0A 3U1DA 5ICEA 3ERED 3J80Z 2VONA 4M9ZA 3LWFA 4KMFA 4U0YA 3PQKA 1S7AA 1T98A 3BPVA 2D2WA 2CWEA 2G9WA 5E20A 5H6QA 4KUMA 4LFUA 1O3RA 1P4WA 4N0BA 1GXPA 4EJTA 1LQ1A 1FYMA 1RUOA 5L3GA 2HS5A 1U78A 4ZH4F 1J7KA 2G7HA 2D1HA 2FEZA 5CVIA 1R58A 1GHCA 2V9VA 5LHGA 4A6DA 1XDUA 4H0EA 2L3DA 2F5CA 3GFIA 3WTSC 3JAMZ 1F9NA 2K02A 3ECOA 1BN5A 1OYIA 3WGHA 2GAUA 3BOQA 2MLKA 4EGZA 4ENJA 1HKSA 2WC2A 1ZYRF 4HZFA 2F5EA 2YX4A 3GYHX 2XIGA 3HHGA 2V1XA 3QU6A 4XSXF 3HYIA 2XAGA 2VE9A 2JPBA 3HRUA 4L5JA 1ZREA 3Q5FA 3I71A 1V3FA 1YW9A 4O3MA 4RGRA 1UCRA 5D4RA 4P55A 2HYGD 5HLGA 2OZ6A 4IF4A 1G4DA 5JVTA 1SD7A 3BP8A 3M1EA 1OR7A 3FZVA 2R7DA 4UHTA 2HEOA 3M8EA 3R0JA 4RAYA 3QU3A 1SD4A 3F8MA 3L9FA 1W5SA 2DAOA 1IF1A 5LLQA 4EJOA 2NS0A 1SFUA 1K79A 3EQLF 1HXDA 5HLHA 2MH2A 5CVUA 1H0MA 5HDGA 4KMUX 2K4YA 4KNYA 1TLHB 2IW5A 5DUKA 1HW1A 3DF8A 3BROA 2DI3A 2QWWA 2XASA 2ESHA 3ISPA 3RI4A 1S6LA 1FLIA 4A0ZA 2VBWA 1JGSA 4G7OF 2JTVA 2FSWA 4R79A 1OYWA 4R1HA 2MC3A 1TNSA 4CXFA 5E1ZB 3P9CA 4OIQF 1SMYF 2ISYA 4IHTA 1ZG5A 1QNTA 2KIUA 4EM0B 3ELKA 1WRJA 4OIRF 4OMZA 4KIBA 3KE2A 3IKTA 4ZYGA 1WI9A 2DQLA 3CTAA 2GCXA 4FHTA 1TQPA 3FM3A 5AONA 2L4MA 2RNJA 4I98B 2VC0A 2Q8KA 1XGOA 1F4KA 4I0AA 2A07F 5FD6A 3VOEA 1G3YA 1I6XA 2DU9A 3HHHA 4YFXF 3CUQB 3RKXA 2UZKA 1FSHA 2Z3YA 2NYXA 4JQFA 2VT2A 2NNNA 2H27A 3HRSA 2AS5F 4GXOA 4M6YA 3E3VA 1MD0A 5E18F 2BYVE 3P9IA 1C0WA 4Y13A 4ENNA 1LDKB 1R1TA 1WSUA 3WU0A 4MTDA 3KP5A 4LK0F 3ABTA 5HDKA 1ULYA 3ZMVA 2K4JA 1L3LA 5BQTA 1SFEA 4OU0A 2OU2A 4EVIA 4OIOF 4G6DA 4AIKA 1EH8A 4HX8A 1KYZA 4CGZA 2V79A 3I4PA 5ILUA 4A2UA 1KU3A 4AIHA 4EGYA 1FBUA 2IP2A 1WQ2A 2O0YA 2P8TA 1I27A 3LQRA 4LJZF 3BY6A 3LAPA 1IN7A 2KJBA 1USSA 4HDUA 3LA3A 4NQWA 2JRTA 4XLPF 3BZ6A 4HX4A 5FO5A 3TDZC 3GWZA 2NNYA 3WE2A 2Y48A 5EEGA 2Y0MA 2PN6A 3U9GA 1U8RA 3REOA 1K6OA 1J75A 3IL2A 1G3TA 4PCQA 1FSEA 2O03A 3OV8A 1KU2A 4MQ9F 4CO8A 1QZYA 2FNAA 4L9VA 3JSPA 3H3UA 4A5MA 1D3YA 2BEOA 1MJAA 3SXYA 2W85A 3LA7A 3IHUA 2EA2A 1FZPB 3V8LA 2H6CA 3E19A 2XVCA 1ZRFA 4LD5A 1P4AA 5LRRA 1B1BA 4JBAA 3R61A 2FBKA 1S29A 1Z7UA 1BYMA 2R3SA 3ZQ7A 1IXRC 2IA2A 3KLNA 2H6BA 3J7AO 5KVRA 1Z05A 2V6CA 1PDNC 3H92A 2ZO4A 1T39A 2KRFA 3ZMZA 3I59A 4R8HA 1ZRCA 1XSVA 3GX4X 3F72A 2ZNYA 2DTRA 1DPUA 3ZP5A 1R36A 1TQIA 5ILSA 1QW1A 4EM1A 5JI6A 4LB6B 3CO6C 1XB4A 5DCFA 2K5FA 2ADUA 3DKWA 2MH9A 2HFHA 3TOBA 2PEXA 4FT8A 5H20A 1ZLKA 4FX4A 2FF4A 1O57A 5L3FA 3GFMA 2EV5A 2PI0A 4I01A 4HF0A 1HQCA 2YPRA 2BE5F 2IT0A 1IAWA 5E8GA 1ON2A 1XCBA 5K5OA 2PJPA 2GWRA 4LB5A 4G9YA 5FLXK 1T0FA 2DW4A 4MGRA 2FOKA 3ZMSA 3P9KA 5E1XA 3F8CA 3IKVA 4I7HA 3E6CC 2STWA 3GFJA 1FWZA 3I59B 1ON1A 1O3SA 1J9IA 4G6QA 4OMYA 1ZRDA 4UV8A 1EV7A 1IN6A 2ESNA 2ZCWA 3ZMTA 3T5XA 1MDMA 2XAJA 4EM2A 1XDSA 1YW8A 2VE8A 4BXUA 2ZBKA 3QAHA 4WWCA 5LEKA 2IPQX 3CUQC 1UHMA 3GUDA 2R7FA 2F2EA 5FB2A 3KLOA 3ZMDA 2GXGA 1TW2A 1MJ9A 3V7SA 4AIJA 4GO1A 4KDPA 3N4MA 1DP7P 3I58A 5D5VB 3R6SA 4EQQA 4HQMA 5LGUA 2CSOA 5FLXZ 1TBXA 3WGIA 1XSXA 5ICCA 2LX9A 1FT9A 3CO7C 1Q1HA 1BI3A 1SMTA 1BC7C 1FBQA 1USTA 1HSJA 1LB2A 3EDPA 2P7CB 1YIOA 2L54A 2FA5A 2OQGA 2QVOA 2QM3A 5TJJA 2FBHA 4GGGA 5J8CA 2MLGA 1QQIA 2D1VA 2XKPA 1MDMB 2LSOA 1T2KA 3BJ6A 4ZYEA 3L00A 1Z91A 1R7JA 3HRTA 2PG4A 4Z2YA 3VEPA 1U6GA 1Z6TA 4Q4ZF 4HA8A 2VODA 1FY7A 2QYOA 2DLLA 4KIFA 4ON0A 3LFKA 5CVVA 1ZG3A 2XAHA 3NEUA 3BWGA 2L01A 4M9SA 2W24A 2ZXJA 3RJPA 3F6VA 3MEXA 2M45A 4ZYHA 3WU1B 4P96A 3FX3A 2RGVA 3MZYA 5JHUA 2VOOA 3K69A 4A5NA 3ZN0A 1YLFA 2HGCA 2K5IA 1BIAA 1VTNC 3PQJA 4I02A 4BAYA 2DFIA 2ZFWA 2XAQA 2GIVA 1GXQA 2CO5A 3V8JA 2UXNA 2DBBA 2HQNA 3VB2A 1SD5A 3TQNA 2EFOA 2HTJA 4WXHA 4ETSA 2HTSA 4U0WA 1XD7A 2EV6A 2O61A 2UWMA 4I0BA 1RZ4A 3BJAA 3WODF 1STZA 4CICA 5TRDA 2FMYA 4KFCA 2A6HF 3N97A 1BBYA 1NHAA 5F6FA 3MZHA 3RPQA 2H09A 1CGPA 1O7FA 3CUQA 2CQKA 2JPCA 4XRFA 2PFBA 4RAZA 2HDCA 1G6NA 3HIFA 2PLYA 5D5WB 1YO5C 4AD9A 4RGSA 1BI1A 3IWFA 2LF8A 3D0SA 5F1RA 4IVNA 4RB1A 5DD4A 2RN7A 2F5DA 4O5VA 4ZZLA 1TNTA 3TOAA 3TO9A 4B09A 5L3CA 2HR3A 2KIMA 1ZGJA 1FP1D 1FP2A 1B4AA 3IWZA 4Y17A 2E7WA 3FMRA 5ICFA 4AVPA 1LEAA 5LHIA 1YS7A 1KU9A 1H9GA 4XLNF 2A69F 3DP7A 3ML6A 4MTEA 2FNPA 2FU4A 3KZZA 2FBIA 1XSDA 4NHJA 1BI2A 4RB2C 4U0VA 1I5ZA 2FXAA 1O3QA 1XMAA 5HDNA 3DEUA 4RB3C 3TKYA 3F6OA 1SFXA 3B73A 2QQBA 2VBXA 3RYRA 1YTYA 1HW5A 4BHCA 1G3WA 1CF7A 3K1PA 5H6RA 4XBFA 2DK8A 1UFMA 3JTHA 4PGGA 3KFWX 2EA4A 3GEZA 1J0RA 3TDUC 1WKMA 3B02A 1OYYA 5E1WA 2KJCA 3KP4A 3EUHA 3T8TA 2LDUA 3JTGA 3NQOA 1P2FA 4DQ2A 4Q48A 1K78A 5JR3A 5BPDA 2TDXA 1YQAA 3S2WA 5ILVA 1OMIA 2EFNA 3HTSB 2XAFA 2O8XA 4I2OA 5DD8A 2OD5A 5DEQA 3EYYA 5D4SA 3RKWA 4RS8A 1U5TA 3LSTA 5L3EA 1E17A 3K9TA 3M8FA 1FOKA 1IXSB 1W4MA 1T38A 2ETHA 2P7VB 5HS8A 4LK1F 4EV0A 4Q47A 5D8LB 3H3ZA 1BJAA 2PQ8A 2HZTA 2YX7A 1XMKA 2MD5A 1WWXA 3DFGA 1KGSA 3WTWC 4FX0A 5D8KB 3KP7A 1CF7B 4IXAA 2EK5A 4D0PA 2VOPA 3FHZA 2EV0A 5CVJA 2RQPA 5D6FA 4L0ZB 2CYYA 3Q9SA 1BC8C 4GCVA 1I1SA 1FYKA 1EH6A 1DDNA 4ESJA 1K78B 1R1UA 2OA4A 1DPRA 1T6SA 2RV8A 1ZN2A 3QP5A 1I1GA 4ESBA 4L0YB 1U5TB 3V7RA 5FD5A 4I09A 3HOSA 2OBPA 3CDHA 4LG0A 3K0LA 2A5YB 1JXSA 1YS6A 1W7PD 3R0AA 3DXJF 2J5PA 3MHXA 4P5OA 3T0YA 4HAMA 2QZ8A 1DUXC 4AWXB 2XGXA 2ELHA 2RVCA 1FC3A 4S05A 2P5VA 4LLLA 3GO5A 2L02A 1KU7A 3GLXA 3RTRA 1B6AA 1B59A 3P7NA 3JSOA 4MEYF 3IRRA 2COMA 3WGGA 2QQAA 3GZ6A 3ZMUA 2W57A 1RNLA 3MQ0A 3ABUA 3QPTA 5J6XA 1Z9CA 3I0TA 4BHBA 3E5UA 3C3WA 3O2PE 2JZYA 2DPUA 2P5LC 1HSTA 1RIOH 1RUNA 1IRFA 3SFZA 3F23A 4KA4A 4LG0B 1HBXG 3VFZA 5D5UB 3D5LA 3V8KA 2E7XA 4A6EA 4NB5A 5HVQC 1S8NA 1BI0A 1ZLJA 4JK1X 4IHSA 3SQNA 3RYPA 1B9NA 3VODA 4L9JA 1R1VA 1JHFA 4O6JA 1ZARA 4CZZA 3E6MA 2P4WA 2HKOA 2LF7A 3RKYA 2WV0A 3QRFF 1LNWA 3COAC 1IXCA 2IRFG 4Q5SF 2P5KA 3L7WA 5F64A 2G7UA 3J81K 2VBYA 5IT9K 2YR2A 4B8XA 5BOXA 1PUEE 4G7HF 1ODDA 1Y0UA 2Y75A 2QBYB 3SHFA 5KK1A 1R00A 3MWMA 2NAZA 2XRNA 2AXLA 3T8RA 2YU3A 2M5WA 5FFZA 1IZ1A 5LEJA 3KCCA 1YFHA 2GQQA 3K1MA 2K5LA 1S7OA 1YG2A 1YW7A 2A3SA 4CDGA 4CYDA 5DV5A 2Z33A 1KQ0A 3SZTA 2Z9OA 3M9AA 2W84A 2LKPA 2FRHA 4ZYDA 4HF1A 2A6EF 4WF2A 4L9TA 4G94A 1JHHA 4RGUA 3EYIA 3K1NA 3O6BB 2DPDA 1BIBA 5J8FA 3DPTA 3J81Z 1LDJA 5IT9Z 2V1UA 4LLGF 2EFPA 3FMQA 5BPIA 4IRIA 3WTTC 5EEHA 4L5IA 3Q9VA 3ULQB 5JFRA 5FGMA 4F7ZA 1ZG1A 5E17F 3ECHA 3HSEA 4BNCA 2XUBA 1UHWA 1ZHFA 3HRMA 1OKRA 3GZ5A 4OINF 4UVCA 1FYLA 4A0XA 2JSCA 3FXRA 3CLOA 1IW7F 4A0YA 4EMSA 4QLCU 3F8BA 2UXXA 3KEOA 2OQRA 1D8JA 1XCVA 1J5YA 1A04A 3LA2A 3E5XA 5L3BA 2GA2A 4YFKF 3QOPA 3W6JB 3GXOA 1XGSA 1P4XA 4E70A 4LLNA 2K4BA 4YIFA 2QLZA 1U5TC 2QENA 2JT1A 1IN5A 1G3SA 4GYGA 2M30A 1JE8A 4HV5A 4YIIA 4LGWA 3BPXA 2PMUA 4K2EA 5BMZA 1SD6A 4UNOA 3KP3A 3KP2A 1HKTA 1XGNA 2K7LA 5LGNA 2HKXA 1P6RA 3AAFA 2E1CA 4CHUA 3R60A 3G3ZA 3T1BA 5BS6A 4LMYA 4HYEA 4KIGA 2FQ3A 2A61A 2ZMEA 3FXQA 2QQ9A 1ZGAA 1QPMA 3V7CA 1W5TA 5CYVA 1QZZA 3W6KB 3HTUA 3TO6A 2GXBA 4P9UA 3F3XA 5DCMA 3GF2A 2OZUA 3PFIA 2QUFA 4N9HA 1ZAOA 4Y15A 1S3JA 4UXNA 3C18A 4OOIA
chains in the Genus database with same CATH superfamily
4HQEA 4N0AC 4LNPA 1RACB 1D8KA 3MKWB 2HQAA 1RAEB 3GW2A 2CSIA 3URGA 1YIJA 1FPQA 3MN2A 4KITB 2JSPA 2FE3A 1KZHA 3F8NA 2RKHA 1G59A 2AHJB 1TG0A 2KAFA 4DOWA 3SDGA 1N9RA 2CFXA 2PX9A 1QVUA 3K2ZA 3CMYA 1K4SA 2K5CA 4F7UG 3CMEA 1Y0MA 3TGNA 5K5QA 4UUVA 3T9NA 3G73A 3GZNB 4J7IA 3IAM2 1GDTA 2X4HA 4G7ZF 1JKQC 4HT8A 3AG4H 4IIMA 2KKOA 4MO7A 1QVFA 3M7GA 1J3TA 3E97A 1V4RA 4P9FA 2W82A 5M5YJ 3V42A 1OPCA 2KE9A 3HSFA 2STTA 1YJWT 1VQ4Q 5GAHJ 2OTJT 4MQVA 5FKOA 3IRQA 3SYTA 2BV6A 5HNHA 4ENMA 1B72A 3HOWJ 1U3EM 3I4NJ 4UVAA 3SD4A 2B8AA 1K4TA 4QQ6A 3BG9A 3M4OJ 2IA1A 2CP5A 2HQEA 1KYWA 4HBLA 2ESWA 2JT4A 3M0UA 5KCHA 2HKNA 2A6TA 2KIFA 1NZ9A 5E3NA 1KQ9A 2BUDA 1TT5B 2WAEA 3CP8A 4JZ4A 2ZMEB 4M7AD 5FRMA 2Z16A 3C7JA 1ETKA 2DTOA 2NXNB 1YJWI 3OYGA 2BHZA 4UV9A 5CKEA 3H1CA 3EFRA 3OMCA 1A0NB 1ACIA 8AT1B 3KZYA 1LDDA 2AKLA 2LC4A 4LIUA 1AOYA 4MMKA 4EJVA 4PJOA 4N9IA 2HWVA 3JRFA 1R9TJ 3SB2A 4B9WA 2IS4A 9ANTA 1EJ9A 2M8EA 3CUOA 1SAXA 1KQ8A 1Y07A 3GVAA 2DQRA 3WHCA 2XKOA 4BH9A 5GAOn 1Z77A 4LD9K 1K7AA 3SDZA 1IUYA 5HS7A 4PJ0C 3WTYC 3M53A 5DCMB 5LFAA 3CCSA 2DNUA 3KP6A 3O3KA 3BJOA 4HG2A 4KT5C 2I2LA 5LRSA 3PNTA 1H8KA 3MFKA 3EG1A 4XM3A 3L09A 2MVTA 5IP6A 5F04A 5DUIA 4OVAA 5FFXA 3JCMg 3I56Q 1AWCA 3EH1A 4NC6A 1LVAA 4JX4A 4YFNF 1KONA 4L18B 1P92A 5M3MJ 1LEBA 2PBIA 3UT1A 3RR6A 4AUXA 2E1NA 3KZIC 5K5RA 4G12A 1Y6IA 5K7ZA 3BQZA 1RL2A 1B7TA 4PL6A 4X34A 2F5FA 3WE3A 1VNDA 1OX9A 2NUZA 2VUBA 1R23A 1TW3A 2O8KA 1UDLA 2Y4XA 3CMAA 1NJIU 4HOBA 4U7DA 1UAAA 1X2KA 5LBQA 5J3LA 1E2XA 3WTZA 3AKZA 3ME9A 3WTVC 1QGPA 4GRIA 1XJWB 4HVUA 3F8FA 4BB7A 2KQWA 3QJ6A 3FWEA 3TQ7P 3ZQQA 3TBIA 2CZ7B 1GCQA 1VQLT 2VBZA 1SG5A 2A05A 2M0MA 2MAMA 1XNIA 4QVCA 3OOPA 4LDXA 3ZN1A 4BI8B 2BHYA 3I54A 2Y9ZA 2FPFA 5LGTA 2NRAC 1VQPA 1Y1VJ 1WZOA 3CCUQ 5DYMA 4JS5A 1X01A 3VS5A 3LWIA 4S04A 2BIVA 4A12A 1LJ9A 4UVBA 3V4GA 1PP8F 1W2BS 2HNIA 3LSGA 3R4KA 1VQNA 2GQVA 2P4RA 2R7QA 2VKVA 4F92B 1R5HA 1YHQA 1REPC 3JAME 3I64A 3NAUA 1K61A 1AVZC 2LZ6B 3ZL7C 1BW5A 1YFNA 5DDGA 3E6DA 2XV4S 1S7EA 3HUGA 3EETA 4WK8F 2F1LA 4PGHA 1HLVA 4OMLA 3E2UA 2C6YA 1KFZA 2GFUA 4M78F 4HW0A 3M07A 1Z1DA 1VQOA 2P6SA 3FM5A 3ASOH 4U7BA 1LE8A 2ACJA 1KQ2A 3TO7A 5HS9A 2CKKA 3EUAA 3X2QH 1KQSA 4HV6A 1BBZA 1OPLA 2GQIA 2RN8A 5C6SA 1IZ6A 3GFLA 2O7OA 3QPHA 4KICA 2VPLA 1YITQ 1WI7A 2EJRA 3QIIA 2COYA 3BTLA 4IRHA 3ZQFA 4M6XA 2EGCA 4PJOB 5F0HA 3DPLC 1YJ9A 2XF7A 1PRLC 4MIMA 4TV7A 4C3JJ 1W2BP 2VN2A 1OOTA 3M1CA 3JB9J 1NG6A 5HLIA 3TP3A 5E3OA 2M16A 3MMYB 1RI7A 2KMUA 1K76A 1D5VA 5D5XB 2ZPIB 4XU1A 3FXMA 4HX7A 1KHCA 2AIRB 2PUKB 2KL4A 1BM9A 4KN7X 4IUQA 1HYOA 3RZOJ 1EX4A 2MABA 4BL0B 4M9XA 5ERIA 4B48A 2RMOA 5GMKl 1CKBA 5D6EA 1O3TA 4DEXA 3JRDA 1TWHJ 2EGAA 2DM1A 3EHRA 4LUEA 3J7AF 3E6BA 2P6TA 2NVUB 2M1BA 2AQEA 2BTTA 5CVRA 4Z8AA 3VS1A 4DNCA 5LJ5j 3HSRA 3DPUA 2FPEA 2BZYA 2GA1A 1RADB 1LOJA 1YJNQ 4DBFA 2FJ1A 2Z5UA 3A98A 3JCMe 1K9MU 3FMSA 3FJPA 2QAZA 3CCMQ 4MNUA 2D0NA 2E5KA 4KGXB 3PL8A 3F21A 2MIOA 3C0CA 4DYRA 2CYZB 2HOEA 4M75D 1M4ZA 2CGHA 4AMCA 5L3DA 3DBHB 2WBMA 1G5VA 2E71A 4E7LA 4B3XA 5J47A 4OIPF 1ZSZB 1ETWA 3KFVA 4M6VA 4M77A 1IHWA 1I6HJ 5CQYA 4E7KA 2WTEA 1PCXA 4YG2F 4XSZF 4A3DJ 2FVUA 1GVJA 4Y7NJ 2A08A 1QP3A 4HT9A 3CPWS 1T56A 2W10A 4M72A 1R4NB 2X6XA 4KYWA 3DTIA 2VVKA 5KE3A 2L0KA 4Y91A 2VLAA 4CA0A 3G71I 1WXBA 2WACA 4KH0B 4ZNXA 1OCPA 3O8HA 2IS1A 2FMLA 4IUVA 1B9MA 5GAOr 2EVRA 4OB2B 1X3WB 1F1ZA 4DBQA 2HKQB 4M78A 3GTGJ 2DVJA 3HUGB 1IN8A 1PM3A 1BR4A 2VXZA 3CJTB 2RDPA 2ZKZA 4MDWA 4ENKA 1W7PA 2EB7A 1Q82C 2EIMH 1M30A 3S32A 3F22A 2R7VA 1FNNA 3U2RA 4M71A 3S2HJ 1IRGA 4DOVA 4BQAA 1HJDA 4XQFA 1VQ6Q 1Q7YU 2BXZA 5ED4A 2K3XA 3TVTA 2MYSA 5LHHA 3ULRB 4EDUA 3RZDJ 4D5FA 3CCMA 1S72A 3NTHA 2EFWA 4CC3A 4WX9A 2MFZA 2PMHA 3VS2A 2MBFA 4FU6A 1OYXA 3JW4A 4BYYA 4CZCA 2NYSA 3KETA 5DS9A 1N25A 3CPWP 4EJUA 3RDIA 2F48A 1ARKA 4HSTA 3DKMA 1ZTRA 2Z0WA 1YI2A 1GV2A 2O3FA 2QCOA 2RC4A 1D09B 5A2QR 4ASNA 4II2A 4ELYC 4XKVA 3EPZA 1FMVA 4IRGA 3WG9A 1VQKT 3I53A 2IS6A 2DT5A 4RAFA 3SZPA 1WHMA 3WVEB 1X4PA 5HOOA 1QP2A 2DXUA 2H8HA 4A3JJ 1FBSA 1R5ID 4J9CA 5GANe 2WAFA 1I50J 2JM8A 3AL0B 2X98A 3JCUC 1TWCJ 3S1MJ 3FLGA 3A8HB 1B07A 1IUFA 1Z6RA 2H94A 5A2QK 3DQVC 3LQQA 4XU2A 1X1BA 2V1DA 4JLGA 2XDPA 2E34A 5IP7J 1N9SA 1VQKI 4BJTA 2HL3A 2VC1A 1EH7A 4QIWN 3G4ST 1QBJA 3G1MA 3TP0A 4IJAA 4C92A 4MFEA 3KUFA 2CZ6B 1WZ2A 1M90C 2L9SA 5E8IA 3F70A 2FEIA 3VS6A 1R22A 3JCMd 1QVFP 2DA2A 3BZKA 3RIRA 2XROA 1VFCA 2DJZA 1HKQA 5IT3A 3PJRA 3CDLA 1IDYA 1MKMA 2E2HJ 1W4SA 2HVSA 3ASKA 1U2WA 3L42A 5CIUA 3CCET 1JUMA 5GAOp 2VT3A 1ZQ3P 2QASA 4M77B 2YT6A 5D6YA 4MHGA 1FX7A 4MEXF 1SAUA 3OS5A 3K6GA 1U3OA 3E7LA 2CT3A 3HKSA 5GAOm 5ICGA 3S2DJ 3C2BA 3G4SI 3DBLB 4PZJA 1J59A 3A8LB 3WTXC 4ATOA 1PP7U 1BOBA 4PLIA 4HLXA 1TT0A 2IVMA 1NK3P 2QBYA 1BKBA 2HQRA 1KHIA 2DTIA 4EATA 2E5NA 2GZWA 4PDKA 1XGMA 4ZZDA 1L0OC 1RR8C 2X35A 3CXCS 3FF5A 1WDXA 1QO0D 2DBMA 2WY7Q 1IN4A 3LGLA 2LOOA 3GTLJ 3ABKH 1XC5A 4M78B 2F4OB 1E3PA 5LJ3e 2KHMA 5CR2A 3K4NA 2Q0OA 3OWTA 2E70A 2HI3A 1PG5B 1AHDP 2E3IA 3FKJA 2K3BA 3EG0A 4LUDA 1W7PB 4CC2A 3G6ET 2LC2A 4RCCA 1TTYA 4Z88A 2DO7A 4RB0A 2YSRA 1KD1C 2L2PA 4RBOA 5GAN8 2MC4A 4QWQA 4RGXA 4DGWB 2OI3A 1J2XA 2XHKA 3MCZA 5AIQA 2XI9A 2K9LA 3BG5A 1K4US 4Y3OA 4BACA 1G2HA 3H41A 2O6GE 5GMKe 2CW0F 2HYFA 2DXTA 2KMTA 2WWYA 4AFQC 3CJQB 1VQ9A 4OMNA 3FXUA 4M74A 3GOXA 1IREB 3UA6A 2CJJA 2DMQA 3CMMA 2MA3A 4IPAA 1ONVA 3ZPLA 1R8OB 1UJ0A 2PU9B 2VV5A 2ROLA 2LR8A 2K27A 2RF0A 2DXBA 3CXCP 3CC7A 2YUQA 2IJLA 3OBWA 2E2JJ 1S9HA 3LGFA 1MBFA 2Y0SA 2DXCA 2LNBA 1VQ8T 1R5GA 2BY3A 5A2QZ 4M77E 3BQYA 5CQXA 1ZLMA 2EZKA 2Z99A 3J80R 4ESFA 1V55H 2D45A 2BGCA 4KN4X 4M3GA 3QP6A 1RLPC 4OB0B 4BHPA 3JCMh 3VV0A 5GANd 2DYSH 2MI6A 2R92J 1BU1A 5K1YA 1WPYA 4HCCA 2JWTA 3SZGA 1OR7C 5GMKi 3WTUC 1XN7A 1JKRC 4DYCA 5EC7A 3CCJT 3FK6A 3PNYA 2NOGA 1QVPA 4D7MA 3H5AA 1U9NA 4G8XA 2K7AA 4ZGDB 1NG2A 2Q2EA 1VQ8I 1ZH5A 3J80K 2D8HA 4M78E 2MWPA 2OAZA 4C92B 4GYIA 5IY5H 1R6RA 1NEGA 1A35A 2EFQA 2ZMEC 4DZJA 2VQLA 1LFBA 4C8QF 3JB9G 2JA8J 4QVZA 1OQYA 2O9VA 2QEXA 2X0LA 1UB9A 3DV8A 1R4MB 3NARA 3PUFA 4M73A 2VXFA 4IUPA 2DRMA 1MJBA 3CJNA 5BNGA 4ITVA 2I8DA 3HOTA 4ZDPA 2ISZA 4QVDA 1WHKA 1K8AU 1QVGS 1M1KC 2CUZA 4HF2A 1E3OC 1MZBA 2H3EB 3BDDA 3C1DA 2WB1N 1KA8A 3I9V2 4WXCA 3SDBA 3QYFA 4L9NA 3ROUA 4HDVA 3RPUA 4Y4RA 1F1BB 5CKHA 3MP6A 1I39A 4MFDA 4BU2A 2PQWA 5KH6A 2J5OA 3CCQI 4A63B 2H3JA 1F5TA 4A3CJ 1FOWA 3G2BA 4WXDA 3O5ZA 1VQ4T 3M0QA 4GDFA 3S3NA 1TQMA 1N77A 1AHJB 1H9TA 3KEQA 3NRVA 1YYVA 1DU6A 3FEOA 2A68F 1EA3A 1BL0A 2L8DA 4QKUA 5IHIA 4KJZA 2V1RA 2SEMA 1FTZA 1E0EA 2XU8A 3GP8A 1KC8R 2L4AA 4X9DA 2BVLA 2CQ7A 4U88A 1X3UA 5LJ3d 2LVMA 1A5JA 1O7LA 1BOAA 1UGPB 4MZTA 2JTFA 2QK0A 2W25A 4HLYA 3MAJA 2BBYA 3FC3A 3OW2S 2JTEA 3IC7A 2DK5A 3HBLA 1JUSA 9ATCB 1QZEA 2ZNZA 3QJYA 1QVGP 5AIPA 3HGGA 4HSRA 5IOYA 2HQXA 2LNVA 4JJDA 4C5IA 2CG4A 4LOCA 2LMJA 3JAMK 1JXMA 2PVGB 3BDUA 5GANh 5CJ9A 2EWNA 2CGPA 2ZJ2A 2NS7A 6PAXA 1X6GA 3CBPA 4FYVB 4HVVA 4C92E 4BY7J 3OY9A 3I5UA 1N6AA 4EJWA 5CLSA 4AFSC 3L2CA 1BJZA 2M87A 2P0KA 3ASNH 2B0LA 1HW2A 1MGTA 3A0HC 1UMQA 3GBGA 4EMGA 3E5QA 2K86A 2OPTA 4WCGA 3LAJA 4MMLA 4NS5A 2IA0A 1LKXA 2ZB9A 4JOMA 3TW7A 1C0MA 3U1DA 5ICEA 3KIOA 2FL7A 1BA5A 2GIZA 2LBFA 3ERED 3Q0VA 2QGUA 3J80Z 2VONA 4M9ZA 3LWFA 4KMFA 4U0YA 3PQKA 1ZBJA 3RSNA 1S7AA 2X1CA 2DJQA 1T98A 1FJLA 2DOAA 1ENHA 2KVQG 4C8QA 4BUPA 3BPVA 2Q2EB 1EF4A 3HC7A 2JOYA 4KRTA 2H1KA 2D2WA 1YRNA 3NTKA 4LDYA 4YELA 4WCIA 3HL8A 3GF5A 2CWEA 4RM3A 2G9WA 2R5ZA 5E20A 3K4JA 5H6QA 4UC4A 1UG2A 2DOFA 4KUMA 2E1HA 4LFUA 1O3RA 1P4WA 2E6ZA 2XIDA 4CI0C 4JRQA 2WAQA 4N0BA 2RI2A 4PFZA 5J1UA 1GXPA 3C12A 2X4WA 2OJED 4EJTA 1LQ1A 3I56A 1FYMA 1TWFJ 4PSXA 1UHCA 2RNAA 4PJOC 1V76A 2DT6A 1LFPA 2W7NA 1A36A 2YRVA 4YRVA 1RUOA 2EQUA 2GOMA 5L3GA 3SFMA 5LJ3h 2HS5A 1PKSA 1U78A 3I5SA 3QZ9B 4ZH4F 2QYZA 3BLYA 1J7KA 2G7HA 1XX5A 2EJGA 2D1HA 1X58A 1OISA 2FEZA 4IX7A 5CVIA 1R77A 3HZJA 1UUEA 3S17J 1R58A 1GHCA 2V9VA 4BEHB 1WJSA 2E4HA 2JVHA 3S3OA 3S15J 2JNGA 2DODA 5LHGA 1LCKA 4BBRJ 4A6DA 3LWHA 2V8JA 1XDUA 2J7IA 4H0EA 3L2UA 1Y7XA 4C0DB 2L3DA 2DPPB 1G8XA 3QHSA 3MJXA 3MD2A 5GMKh 2HSEB 2F5CA 3VS3A 2OTLT 3GFIA 4ZC3A 4CC4B 3WTSC 3JAMZ 2EQJA 4M7DA 2EKOA 2PNIA 1TUDA 1F9NA 2K02A 3ECOA 4JJCA 2K9SA 4NL2A 1BN5A 4RMOA 4AYBA 3PFYA 4N4OB 3DLMA 5IN1A 1OYIA 2Z1DA 1IGNA 3K4MA 1M1FA 3WGHA 1Q95G 3G7ZA 2KY9A 1M1EB 2XF6A 3ZOBA 3OYJA 2GAUA 3BOQA 3M58A 2DDBA 2MLKA 3BCAA 4EGZA 4ENJA 4D1QA 2FPDA 1BR2A 1HKSA 2WC2A 1ZYRF 4HZFA 2F5EA 3OB9A 2YX4A 2CV2A 3GYHX 5A0GA 3H36A 4A3EJ 2DXIA 1TWGJ 3BTIA 2K3PA 1ZSZC 3AT1B 2OTLI 2M35A 1W6XA 3HL2A 3K70D 1Y39A 3CCLT 2XB5A 2XIGA 3HHGA 1VQKQ 3L2QA 2GFAA 2YRDA 4C0GA 2V1XA 3QU6A 2QTVA 3HHTB 2BZXA 3PO3J 4XSXF 3JRAA 2X4JA 1V54H 5CPRB 3HYIA 2DFEA 4PK4A 2R7ZJ 2A5WA 2X6OA 2LKXA 2XAGA 2VE9A 5GPCA 1WFXA 1M8MA 2M51A 2DCEA 1W2BA 2B9SA 5I2MA 1YITA 2MF2A 2JPBA 1QCOA 4JS4A 1E7OA 1G83A 4I76A 3CCLI 2X1DA 1W36D 3BR0A 3HRUA 4L5JA 1LNXA 1ZREA 4TVRA 5IH2A 2LKSA 3Q5FA 2A36A 3H0GJ 3I71A 4C8QB 2CP2A 4IUTA 3JCMX 3G4SQ 4L6V5 1YRNB 8ATCB 2DA9A 1V3FA 4OWRB 5FU7B 1YW9A 3P8DA 2AKKA 4D7NA 1JJ2A 2O88A 3U23A 4O3MA 4RGRA 1UCRA 1O9SA 3CCMT 4CC7A 5D4RA 4BY1J 3JRHA 1WJQA 1ZR4A 1LFUP 4M3FA 2FZGB 1JO8A 5CAIA 1SEUA 4B3AA 2EAYA 2DZ9A 3W3CA 4EMKA 3LSHA 4P55A 2YUOA 1OJLA 2HYGD 5CK9A 2A28A 2IBDA 5HLGA 3R6OA 1ERDA 3ABLH 4J5YA 1T33A 2OZ6A 4XRSA 2PVDB 3ZBDA 2JA6J 1YJNA 4IF4A 4BXFA 1G4DA 2HBPA 4FL6A 1Q81U 1ZKGA 5JVTA 1AZGB 1SD7A 2YS9A 4DOZA 3BP8A 1I07A 3A8GB 1RABB 3FXKA 4LDVA 3M1EA 3HKZN 2IPOB 3AL0C 1OR7A 3CCRT 1WLPB 3FZVA 3X25B 2R7DA 4UHTA 2HEOA 2HSPA 2MSYA 4M7AF 2YRCA 4XR6A 3M8EA 3R0JA 4RAYA 3QU3A 1SD4A 4M7DB 3F8MA 3HDDA 3OYHA 1WJEA 2R7UA 1WH5A 3FIWA 4UY8I 1WNLA 2DLPA 3PT9A 2L3PA 3L9FA 3BFMA 1OZ3A 1W5SA 1X2NA 4IKFA 3MKDA 2F2XA 2DAOA 1MH3A 1IF1A 2AZVA 4C8QE 5LLQA 3FXJA 3CCRI 4EJOA 2NS0A 1SFUA 1K79A 1JJ2P 5A2QE 2CSQA 5HODA 4XOTA 4BS9A 3X28B 2R0QC 3EQLF 5FW9A 4M77C 5GAN4 2JZ2A 2XD0A 2Y9YA 2ZPFB 3GIBA 1QHGA 2DF6A 1WI3A 3DBRB 2KR3A 4XRMA 1BR1A 1JB0E 1VQ8Q 1SRMA 1HXDA 3QYBA 5HLHA 3INZA 1RAAB 4ZTFA 2VKEA 1HDPA 4RG2A 2MH2A 5CVUA 1VQ6A 1H0MA 5HDGA 2XGDA 3CPWA 1HF0A 5LJ5g 4AU7A 4KMUX 1EIFA 4KNYA 2K4YA 3F0CA 1NLOC 1TLHB 2IW5A 2GBQA 4M78C 1X1CA 3JCMc 3DU5A 5DUKA 2M0YA 4XOPA 1HW1A 1W0UA 3P5JA 1K73R 2F69A 2F4IA 4N4IA 4RTXA 3DF8A 3U21A 3BROA 1K6YA 2DI3A 3CCQQ 2QWWA 2XASA 2ESHA 3ISPA 3KYCB 3RI4A 4XKBA 3H9JA 5IPAA 1S6LA 1R71A 4M7DE 1FLIA 4EMKB 2XC7A 2VASA 2VJJA 1XOVA 3IV5A 1ZUKA 3IQLA 1Q86R 3VRYA 2L5QA 4A0ZA 2VBWA 5DY9A 1JGSA 2CS3A 4G7OF 2EBPA 1VQMT 4YIRX 2JTVA 2LY2A 1GVDA 3RESA 2FSWA 1UGVA 2LG4A 2EYXA 4R79A 4JJBA 2WSEE 4DA4A 2E10A 1OYWA 2YXYA 4R1HA 3CLQA 1ZR2A 2FB7A 2GTOA 2MC3A 1YIJI 2DT7B 2DK3A 2DL3A 2LP5A 1KQSP 1TNSA 1RKWA 1YX5A 3W2VA 1WJCA 5E1ZB 4CXFA 4QTRA 1U5SA 2B86A 5EG2A 2PJRA 4M7AA 3P9CA 2EZLA 4OIQF 2RHYA 4EIKA 1QMCA 1N8RR 1SMYF 3CMEI 1VQMI 2ISYA 4IHTA 3DWLE 3UDCA 3SFIA 2DL5A 3JCMJ 3OYNA 4NC8A 1M2OA 1WJBA 3L2ZA 1FOXA 1ZG5A 1QNTA 2KIUA 4C92C 4LDWA 4EM0B 1YJWA 3ELKA 3VUBA 2OTJA 1WRJA 2TRTA 4OIRF 1CQTA 1R0CB 3BCBA 4IUUA 2C0IA 3JSCA 4OMZA 4GFBA 2SRCA 4KIBA 2DTHA 1F36A 3KE2A 5J40A 3IKTA 3G1LA 4E2FB 4ZYGA 4WTOB 2DA7A 3E0JB 4NBQA 1WI9A 2DQLA 3S3MA 1WGSA 3PSIA 3CTAA 3MKLA 4F55A 3OSGA 3GPLA 2GCXA 5CQGA 3J80E 3GTQJ 4FHTA 1TQPA 3L1AA 2LYCA 1D1CA 3UA7A 3FM3A 2ABLA 5AONA 2L4MA 2EQRA 2RNJA 4I98B 3UKGA 2EJFA 2VC0A 3CC4T 2Q8KA 1XGOA 1X27A 5FKKA 1F4KA 5GJVB 4I0AA 2A07F 5FKLA 5FD6A 2NS8A 2E41A 4A4GA 2WADA 4M3EA 2CV0A 3JRIA 3CXCA 3VOEA 1TS9A 2XGCA 1G3YA 3B6AA 4CH7A 3OS1A 1I6XA 2DU9A 3F9KA 2R7TA 5GAOl 3HHHA 2ROTA 4YFXF 3CUQB 3RKXA 3HOXJ 2UZKA 1JKPC 5LJ5e 3I55T 2M0CA 3AG1H 1FSHA 2C06A 2Z3YA 3S1QJ 2NYXA 4I99C 4JQFA 1CSKA 1UGRB 1UTIA 2DX1A 2VT2A 1AEYA 3CC4I 4KT6A 3FIFA 1ZSGA 1YCYA 1ZQ1A 2QKLB 5EG0B 2NNNA 4XONA 2BE7D 2H27A 1AKHB 3HRSA 2AS5F 4Y33A 1ZSZA 4GXOA 4M6YA 2EIKH 1MD0A 3E3VA 1MGQA 2DBKA 5IOZA 5E18F 2W4SA 3LLRA 2FO0A 2BYVE 1WVRA 1PWTA 3P9IA 3I55I 1QWFA 4M77F 4MLOA 5HCKA 1C0WA 4Y13A 5H2FC 1MMNA 1VQPT 4ENNA 4A3GJ 2FUG2 3LW5E 3LL7A 3S93A 1LDKB 3VRZA 2AHQA 2QA4T 3CF2A 3CESA 4J83A 2RK2A 4M7AB 2RHZA 2DFFA 1R1TA 2PJRB 2PMZN 4P5NA 1WSUA 2GXAA 3WU0A 4MTDA 2E1MB 1VQLA 1SF9A 3KP5A 4XK8E 4LK0F 3ABTA 5HDKA 2OTLQ 1ULYA 3ZMVA 2LJ1A 3BE3A 2GNCA 2COZA 2K4JA 3OIQA 1VQPI 1L3LA 3CD6T 1MV0B 2DMUA 1OCRH 5BQTA 1SFEA 4OU0A 3FBIB 4XAXB 2E6NA 3FDRA 3CJRB 3I9QA 4BQQA 2OU2A 2KXCA 2LQWA 3IH3A 1NYGA 2QA4I 4EVIA 4OIOF 1VQNI 4G6DA 2X3XD 4ZDLA 4A3LJ 4FQGA 4XIDA 1EH8A 4AIKA 4HX8A 3M55A 1T0FC 4CCLA 1M1KU 2CT4A 3MVPA 4XKWA 4EEFG 2JMAA 1KYZA 1NTCA 2V79A 2CMPA 4CGZA 1X6BA 3KPHA 3I4PA 2R7RA 3GTOJ 1YNZA 3RMQA 3CCLQ 5ILUA 2RI5A 4A2UA 3QG1A 1KU3A 3CD6I 3L2WA 3A2KA 4AIHA 2RH2A 4D6WA 4EGYA 1FBUA 4DJAA 3A1YA 2IP2A 1IDZA 1Z3YA 2F5TX 4FIBA 4PNOA 1QVGA 3QSUA 3SWNB 3OSVA 1WQ2A 1XG1A 2JRMA 2K9QA 3LYIA 2ID3A 2O0YA 2P8TA 1I27A 2XAUA 1A31A 2NUTA 3EHQA 3LQRA 4CUGA 4IHYA 2IGKA 3L2RA 3UWNA 3KEYA 2CU7A 4LJZF 1QCNA 4JDSA 3BY6A 4HNVA 2OF7A 4IHVA 2MWOA 3LAPA 2RJDA 2I5UA 3N5BB 1IN7A 4PJOG 2KJBA 4M75A 1USSA 1UGSB 2DRKA 4HDUA 2EQKA 3LA3A 4C0DC 4NQWA 4M7AE 1UHFA 2JRTA 3ZRGA 4KISA 2VC8A 1AA7A 2CW7A 5J3BA 4XLPF 1DGWY 3K10A 2XICA 3BZ6A 1BW6A 1GFCA 3M57A 4C3HJ 5LJ5d 4HX4A 1HOMA 5FO5A 3KYLA 2EYYA 3M0PA 3G71T 3TDZC 2NOJB 2OAUA 3GWZA 4C92F 3OYCA 3OW2A 2MZ4A 1B8IA 2FZKB 2L9RA 3I5RA 1FXXA 2NNYA 2DMPA 4BGDA 3WE2A 2HEQA 2Y48A 2K2VA 2ZPEB 4VUBA 3FHNA 2Y0MA 2MD0A 2PN6A 5EEGA 3U9GA 5JLWA 1U8RA 3DTEA 2ECZA 2K9GA 3MZ8A 4XMYA 4XQ3A 2DA4A 2J05A 2LTOA 1Q81R 3REOA 3JRGA 1K6OA 4IHWA 3GTMJ 3AFHA 3M9QA 1J75A 1GL5A 2KYBA 3CCVT 3IL2A 2B63J 1G3TA 4PCQA 4ANJA 5C4JJ 1AWXA 1Y8QB 2RAEA 2R57A 1FSEA 2DA3A 2O03A 3CCRQ 3OV8A 2K2MA 5JHFA 2DD5A 1KU2A 4MQ9F 5CQEA 1QKXA 3QODA 5KYNA 2UUZA 1WXUA 4RTYA 4CO8A 1MV3A 1QZYA 4ORZA 2FNAA 4F52A 5DLQE 3EAEA 4OP0A 4HXJA 1MNEA 4L9VA 4J7FA 4C8QC 1X1DA 3JSPA 1H8AC 5KAIC 3H3UA 4A5MA 1UE9A 2RJFA 3FXLA 2QSGX 1OLTA 2DJIA 3CCVI 2JS0A 2K3YA 2XK0A 4LE9A 5FU7C 4ABZA 1D3YA 3UATA 2BEOA 2ZC2A 1RQ6A 1MJAA 2KRMA 3SXYA 1F43A 2P0WA 2W85A 3KXTA 4IQJA 3LA7A 4UUTA 3FDYA 2EA2A 3IHUA 4XLCA 3A03A 3SEZA 5IYDJ 1FZPB 4BXXJ 1QU3A 3V8LA 2TCTA 2AZSA 2H6CA 3I3LA 1U06A 2RI3A 4JX5A 3CC2T 4EMHA 3E19A 2XVCA 4MZPA 1WJRA 4F14A 2VPRA 5TGTA 1ZRFA 1JU5C 2E5QA 3MO8A 5IHNA 5J26A 2DYIA 4AFZC 4LD5A 1RI0A 1S72I 2NUTB 3A0BC 1P4AA 3CDIA 5GP9A 1YWPA 5LRRA 1B1BA 1OZ2A 4JBAA 3BW1A 3R61A 3VDXA 2FBKA 1HCRA 1S29A 4HNUA 2HPIA 1Z7UA 4M75B 5I21A 1BYMA 3OR1C 2R3SA 3CC2I 1YI2I 3EGDA 3CP2A 4NQWB 3W2WA 3ZQ7A 1RKTA 2DYBA 4XU0A 4J9EA 1IXRC 1WCMJ 2IA2A 3KLNA 1I8FA 2H6BA 3M0SA 3LFUA 1VQKA 2LNHB 3BT9A 4M7DC 3J7AO 1P7IA 4YTLA 3UF4A 5KVRA 3DKXA 4HEA2 3JB9I 1YIJQ 1Z05A 3K70C 2RQQA 2CH0A 2V6CA 3HFOA 1B8IB 1PDNC 4L59A 1OULA 3H92A 1VF9A 4B6MA 1KIKA 3CMEQ 2ZO4A 3H5NA 2YLBA 5GAMj 1VQMQ 1SSHA 2HDWA 3GLLA 1T39A 1IGUA 2KRFA 1U8BA 2V26A 3ZMZA 2Y90A 4IURA 3A4CA 3I59A 4R8HA 3VYGA 1HD3A 3H9QA 2BZ8A 1ZRCA 3JB9D 4PFPA 4K11A 3MKZA 3G4SA 1XSVA 1Z67A 4JLIA 3GX4X 3F72A 5EDNA 2ZNYA 4W97A 4CYCB 4DBRA 2DTRA 2VXEA 2XSJC 5F1JA 2KDOA 4BJ5C 2L89A 3OBYA 2ZJQF 3CCEA 2KRSA 4PJJA 1GRIA 1NK2P 1DPUA 4M4ZA 2CV1A 2QTXA 3BTJA 4KBMB 4M77G 2VYTA 3OYBA 1M3CA 3ZP5A 3HEFA 5A0LA 1R36A 1TQIA 5ILSA 4GBQA 1J09A 2W0ZA 2ZSIB 2MK5A 1YHQI 2A7YA 4M75E 5KYWA 1XS9A 4Z02A 4A4EA 2RD1A 3GNGA 4XTUA 1QW1A 4EM1A 5JI6A 4LB6B 3CO6C 1XB4A 4RA2A 3M4GA 4FW2A 2VKNA 4S0HB 3RDVA 5DCFA 3HXLA 4C30A 4EMKC 2L9VA 2K5FA 2ADUA 4M78G 1W1WE 3DKWA 5KYUA 1MSEC 1SFKA 4HRIA 2MH9A 2J6KA 3G6EA 2HFHA 3H0DA 3TOBA 2L7ZA 2RJCA 1ACMB 3WHBA 2E65A 1Z21A 1D0YA 2PEXA 4FT8A 5H20A 1ZLKA 4DIQA 2IGMA 4FX4A 2EH3A 4E4HA 2E2IJ 2JTMA 4A3BJ 2FF4A 4II1A 3CC4Q 1ETVA 3RCOA 1O57A 1K1ZA 4D9JA 5L3FA 1I4K1 1PHTA 2QQ8A 2YSQA 5FLXR 3GFMA 1WHJA 5I11A 2EV5A 2LY1A 5B1AH 3LSIA 2PI0A 3FJ5A 2L0AA 4I01A 4HF0A 3E9GA 1HQCA 4LN2A 1JT0A 3EGDB 4XTZA 5FLVA 2K85A 2NVQJ 2YPRA 2BE5F 4PSWA 2IT0A 3CC7I 2P0PA 3I55Q 1IAWA 2VJ4A 2HZYA 5E8GA 3JRZA 3S6WA 1ON2A 1XCBA 5K5OA 2PJPA 5GANj 1NJIR 4ZTJA 2GWRA 2JW4A 1VQ8A 3B6CA 3LH0A 1VQ5T 3CCQT 1NE8A 1MMDA 4LB5A 1V29B 3H0FA 1MMAA 3K4CA 4G9YA 1T0FA 2Y0SN 4BQOA 5FLXK 3PTAA 2DW4A 4MGRA 3QOEA 2FOKA 1M9SA 2M4GA 3ZMSA 4C2TA 3TEEA 3P9KA 3MP1A 2CP3A 5E1XA 3C95A 5M9OA 3A8MB 3F8CA 3IKVA 2WB1A 4I7HA 1YCSB 3E6CC 3TREA 1NBEB 2STWA 3CCJA 2D9TA 2YDLA 5GTHC 3GFJA 3ZR8X 1FWZA 2X85A 1ON1A 3I59B 4AC0A 1O3SA 3HOVJ 1VQPQ 1J9IA 3NWTA 4G6QA 3J81R 4KT0E 1KC8C 3EFOA 4E7SA 1VQ5I 4CCKA 2HMAA 4OMYA 3HP9A 1ZRDA 4C92G 1SHGA 2QA4Q 1VQNQ 3K4BA 4UV8A 1EV7A 2QI2A 2XG8D 5LJ5f 2XB0X 1IN6A 1X3ZB 4HPQA 2QEXI 2ZGWA 2W48A 4C2UA 1FTTA 2ESNA 2OCEA 3SEQA 2ZCWA 4BEHA 2KT1A 5F0FA 4Y28E 2GBYA 4V2GA 5HLTA 3PFSA 3ZMTA 2DD4A 3T5XA 1SHFA 1X2MA 2HCKA 1MDMA 2COBA 2LCLA 2XAJA 4EM2A 2DEUA 2RK1A 3AHUA 3GCMA 1XDSA 3CD6Q 1YW8A 2VE8A 4RTWA 2LT4A 4BXUA 2ZBKA 1I3AA 4FW1A 3QAHA 4WWCA 5CKTA 2RHUA 2RPNA 5LEKA 2O9SA 2IPQX 3OMGA 3CUQC 3TCJA 3HOUJ 5DTDA 1KQ1A 5KYWB 4M7DF 1UHMA 1TL8A 2Y4YA 1JUPA 2KPMA 3GUDA 4RLQA 2R7FA 1PSEA 1FOYA 2ED1A 2F2EA 5KYXA 1VQ4A 1FIPA 1Y8RB 3EFSA 5LJ3j 3I55A 5KCMA 5FB2A 2EW3A 3KLOA 5KYUB 2KQRA 3ZMDA 5DM7F 1NPPA 3EUKL 4CCJA 2DA1A 1H3HA 3ZEHA 3SHWA 1SC7A 3CBMA 2GXGA 4GLKA 1R49A 2BW3A 1TW2A 2OX7A 1C1AA 1MUZA 1YN8A 2E36A 1MJ9A 2J6FA 2E19A 4PKCC 3TMOA 3V7SA 4AIJA 1OCTC 1HC8A 4GO1A 1RLQC 2DMTA 4KDPA 2DDAA 5GMKj 2Y30A 3N4MA 3I58A 4QPQA 1DP7P 3VJPA 1IXDA 1SVMA 1V1CA 2D6FA 4M7AC 5D5VB 2L7FP 2M4KA 5KAFC 1DJ7B 2JUFA 2MOXA 2UV1A 3R6SA 4IOCF 2ATCB 3HGYA 3I35A 3OW2P 5M3FJ 2XPVA 2E1MC 4EQQA 4HQMA 2KISA 5LGUA 3L1PA 2CSOA 1MBHA 5FLXZ 1ZX6A 4E7HA 4XICA 3JB9H 2CP7A 3PVLA 1GUUA 4B1RA 3P8BB 1TBXA 3IAS2 3WGIA 4JUVA 2BZTA 1XSXA 3FK7A 1K9MR 5J4VA 5ICCA 2LX9A 1FT9A 1TUCA 2NVYJ 3CO7C 3UPUA 1ABQA 1ETOA 1Q1HA 1BI3A 5IYBJ 1SMTA 1BC7C 3NFCA 3SEMA 5GAN2 3VYHB 4CRIA 2RJEA 1S5LC 1AWWA 1FBQA 1WPKA 2F2VA 1T0JA 4PJMA 2OJ2A 1USTA 4OB1B 2FD5A 1HSJA 1M1GA 1LB2A 3FXOA 3EDPA 2MGQA 2P7CB 1VIFA 1A6IA 1RRJA 4BY6B 1ETQA 1YIOA 2L54A 4F04B 2FA5A 2EBIA 2OQGA 2QVOA 1FEXA 2L7KA 2QM3A 3EFOB 2CUBA 5TJJA 4J6WA 5JLXA 3MP8A 2FBHA 4GGGA 1WFWA 3LSMA 4BBSJ 3CCVQ 3SWNC 2Y2ZA 2EZIA 2CH4W 3C4SA 5J8CA 4FT4A 2MLGA 1QQIA 1MBJA 1SSFA 2PVOB 2H8WA 1U1TA 2LCSA 2D1VA 2HL5C 2XKPA 2VXDA 3J7YJ 1MDMB 2LSOA 4RAGA 1BB9A 2ZPBB 1T2KA 1WHHA 3BJ6A 3N05A 3RQIA 4AIDA 4ZYEA 1ITYA 3HG9A 3L00A 3BC8A 5GAGJ 1TUGB 2QQSA 2X3WD 1Z91A 2X4XA 3CF5F 2RB6A 5GAMf 1R7JA 3A52A 3HRTA 2PG4A 4Z2YA 3VEPA 1LPQA 1U6GA 1S72Q 5IYCJ 2M8GX 1Q7YR 4NC7A 5KYXB 1Z6TA 2DN0A 4Q4ZF 4B9XA 4YEJA 4HA8A 1QWEA 3WVDB 4N4NB 3OOUA 2VODA 2ELKA 3S8PA 5GJWB 1FY7A 2QYOA 2DLLA 2Z2SB 2HU9A 4KIFA 4ON0A 2M3AA 3S1RJ 4KULA 1YJWQ 4N4GA 2WA0A 3H6ZA 1YI2Q 2OTLA 3CC2Q 3LFKA 4C0ZA 1WJFA 2FQ4A 1JI8A 2BW3B 2HVRA 2RQUA 4J8OA 3EGUA 2F2WA 5CVVA 1ZG3A 2F4MB 2XAHA 3NEUA 2FHDA 3BWGA 2L3QA 2LREA 2JVGA 4JRPA 1NM7A 1O4XA 3BR5A 1OQKA 2L01A 4M9SA 4AYBN 2W24A 1TWBA 4LDUA 2DL7A 1K83J 1D3BB 2O2OA 3ZQCA 1ZELA 2O01E 2ZXJA 1QRYA 3S14J 3RJPA 4RKUE 4IQ4A 3F6VA 3U1KA 1X69A 3MEXA 1RAHB 4J6YA 4N4HA 3CCLA 2Y31A 4XN0A 4AVZA 1JRIA 1W1FA 2M45A 2RM4A 5F0CA 5M5XJ 3JREA 3M0RA 4ZYHA 3WU1B 3DEWA 4P96A 1ZUUA 3ZGKA 3FX3A 4PJLA 5C44J 4Y52J 2FYKA 2R5AA 2VJ5A 5M5WJ 4GLMA 3MEVA 2DMOA 3ZCOA 1YP5A 2RGVA 3MZYA 5JHUA 1GV5A 3CCUA 1TC3C 2E1OA 3OIOA 2IGOA 5FROA 4X1EA 3L2VA 2VOOA 2MUNA 1QCFA 1KG1A 1MMGA 2VL8A 3K69A 4LITA 4M3BA 4A5NA 4C9YA 3ZN0A 3LNQA 3MCAB 4MDXA 3VWBA 2HBWA 4HNTA 5GAOq 1YLFA 4A3IJ 2YU9J 2HGCA 1B3QA 4DBHA 5HK0A 2ID6A 5HKCA 4C8QG 2ZSHB 1RR7A 1OEBA 1I1JA 3HM5A 2K5IA 2RQVA 1BIAA 1VTNC 2VKHA 5KHDA 2JXBA 1QA6A 1UJ8A 1YHQQ 1OCZH 2HYJA 3PQJA 4I02A 2NVXJ 4BAYA 2A0FB 2DFIA 2ZFWA 3HKZA 2DA6A 5EEAA 2ZJRF 1KJWA 2HDAA 4OMOA 4HCBA 2XAQA 3THKA 3WG7H 3REBB 3OYDA 1JBMA 2GIVA 4IHXA 1X43A 1ZA1B 2HQHA 1IG7A 1GXQA 3OL4A 3OYLA 3FBNB 2KI7A 2KRNA 2CO5A 2I10A 3V8JA 4Z6YA 1Z9QA 3LSKA 2UXNA 1WHGA 4QW2A 5IXFA 4M75C 2DBBA 2LMDA 2FRYA 4J6XA 2HQNA 3VB2A 4BKXA 5LD2C 1SD5A 3TQNA 1RAFB 2CZ1B 2EJ9A 2KEAA 2CS7A 2P0QA 3META 1Y56A 2LFBA 4PFOA 1X19A 2EYQA 3PM1A 2EFOA 1OCOH 4ZJZA 3LSJA 3M4YA 3GTJJ 2IXSA 2HTJA 1VIEA 4FTHA 2LJ0A 4X0GA 4ELZC 4WXHA 4ETSA 2P84A 4J19A 2HTSA 1VYTA 1XTAA 2KBTA 3CCRA 4U0WA 2XPUA 2DIQA 5FWCA 1XD7A 2EV6A 3A02A 4FSSA 3DB4A 4AG1C 2JA5J 5FKMA 1MNMC 2EPFA 5EYRA 3CC7Q 4KUIA 2O61A 4M7DG 4OMMA 1GFDA 2KYMA 2OUMA 2UWMA 1HSQA 4II3A 4I0BA 2HOSA 1RZ4A 3BJAA 2DAQA 3WODF 1M2VA 1STZA 1K73C 5FWBA 4OGCA 2C0TA 4AG2C 5EF6A 2RO0A 4CICA 2QF7A 5TRDA 4F91B 2ZXIA 2FMYA 4KFCA 1DQUA 4IO9F 3W2AA 2A6HF 5CKDA 1Q82U 3N97A 1BBYA 5AYFA 2DFUA 4Z89A 5C4XJ 1NHAA 5F6FA 4UUSB 2DVEA 1VQ7T 3D7SB 5D6XA 2LP0A 1D1AA 3MZHA 3X26B 3RPQA 1JGGA 4ZDOA 2H8RA 1OV3A 2H09A 2DJNA 4JJNK 1Q86C 1CGPA 2R93J 2VWFA 1O7FA 3CUQA 3VSLA 2CQKA 1VQ5Q 2ZFUA 1PD1A 2JPCA 4XRFA 2PFBA 4RAZA 2HDCA 1U1SA 2EFIA 1G6NA 3HIFA 1YIJT 2LLKA 1TSFA 4E6RA 2PLYA 2QEXQ 3K7AJ 5D5WB 2DEQA 2EKHA 3DLAA 1X2QA 1YO5C 5EG0A 2CRGA 3RUXA 4F7UB 4AD9A 1AKHA 1VQ7I 1MIJA 1HK9A 3CMET 4RGSA 1BI1A 2CQQA 3IWFA 4RG8A 1K8AR 1JQQA 4JZ3A 2LF8A 3D0SA 4IEJA 4JP0A 4IVNA 5F1RA 1NG7A 4RB1A 2X4YA 2I0NA 5B66C 2X48A 3QYGB 1N8RC 3CQZJ 5DD4A 1E6HA 3MPUB 2RN7A 2K40A 2F5DA 4XK4A 2JN6A 2NWMA 1D1BA 4XN3A 4O5VA 4P1WA 4ZZLA 1TNTA 1JKOC 2M9UA 4BE1A 2JM9A 2QXFA 2DKGA 3P8HA 4HKEA 3M56A 2GF7A 3GBQA 3TOAA 4OB3B 3TU4K 2X51A 2CP0A 3TO9A 1CKAA 1TZLA 4B09A 3VS7A 2K9MA 5L3CA 2HR3A 2IEKA 4D8DA 1RAGB 2KIMA 2P0TA 3CPFA 2ENMA 1ZGJA 3BTCA 2JA2A 2Y69H 1VQMA 3HTRA 1FP1D 3JRCA 1FP2A 1B4AA 3IWZA 4Y17A 4AM3A 2E7WA 5L8RE 3CEYA 3FMRA 2NUPA 2RA2A 1M90U 5I2SA 4XRSG 2F5VA 5ICFA 4AT1B 5FU6B 2LD5A 2EGEA 4AVPA 1LEAA 2VKDA 1EKEA 5LHIA 1IC8A 2W00A 1H88C 4NL3A 1RUWA 1YS7A 1KU9A 4UB6C 1JJ8C 2EZHA 5C0MA 4RDUA 2GTJA 1H9GA 2BVMA 2A69F 4XLNF 3DP7A 3ML6A 4MTEA 5GAN6 4QPOA 1GBQA 2VB6A 4C3IJ 3VKIA 3GTPJ 2VI6A 2FNPA 2FU4A 2JN0A 5LL6S 2M1HA 3KZZA 2FBIA 4DYQA 4CCMA 3M3YJ 2M7AA 1C6VX 2DA5A 3LOCA 2O4XA 1UELB 2QSHX 4F7UE 4J9BA 1N78A 3EGXA 2VQHA 5B1BH 1M2VB 3SWNA 4C0FA 4C5HA 5FLXE 1XSDA 3HSBA 3CCST 2ZXHA 7AT1B 2OTJI 4NHJA 1JXOA 4A93J 1TH7A 1BI2A 4RB2C 1X75C 2E64A 2MW8A 3M0TA 2WSCE 1NPRA 4U0VA 5HNFA 4OMFB 3BZCA 5J4YA 3OYEA 1I5ZA 1KD1U 2FXAA 1O3QA 1AWJA 3OYYA 2ZXWH 1XMAA 2BY0A 5HDNA 3S1NJ 3DEUA 4LXCA 4RB3C 3TKYA 2A37A 4HCZA 4IZZA 3F6OA 4C5EA 1N27A 4Y92A 2QGGA 1SFXA 3B73A 1QPIA 2FRWA 4M75F 3CMAT 2QQBA 2HDDA 1Z9ZA 2M34A 1NLPC 3CCSI 5GAMg 3H5RA 4XU3A 2VBXA 5L23A 3RYRA 1YTYA 4X9CA 1HW5A 4BHCA 4PJOD 3CC4A 4AFUC 1G3WA 1CF7A 2PUOB 3K1PA 5H6RA 5EZGA 4XBFA 2DK8A 1UFMA 3J81E 3KBGA 3JTHA 1I0CA 4OMPA 4PGGA 2LX7A 3QDRB 5KE2A 4BQNA 3KFWX 4GY5A 1SKUB 1WHUA 5IT9E 1ABOA 2EA4A 1UG1A 3GEZA 2JUGA 3H9GA 1J0RA 4ZYAA 3TDUC 3VYSB 1WKMA 3CMAI 1XPXA 3GTKJ 4X1VA 2CQNA 3B02A 2R5YA 2LRQA 3MEWA 5GAN5 2DETA 1OYYA 2JK3A 3BR1A 5E1WA 2CZ0B 2PMZA 1VQNT 3E1SA 2KJCA 3KP4A 3A5ZB 3EUHA 3T8TA 3DTKA 2LDUA 1Z0XA 3JTGA 2XDVA 4OMQA 1WH7A 1VI0A 4LG3A 3NQOA 1P2FA 4DQ2A 2E35A 4Q48A 4B47A 1P9QC 1OX8A 2V8KA 2NUPB 3HOYJ 5E79C 1PNJA 1MBEA 2V8IA 1K78A 3EH2A 3Q1JA 1T08B 5JR3A 5CO7A 5BPDA 1VQOT 1Z3XA 2TDXA 1YQAA 3J7AY 3S2WA 1KSWA 1W70A 5ILVA 3HFNA 1OMIA 1YE9A 2D0QB 3H35A 3PMIA 4NOYA 2EFNA 3BR6A 5EJCA 2G0EA 2P81A 3HTSB 3H0IA 2QA4A 2CH4A 3NWSA 3QWYA 4F17A 3S16J 2COWA 2IGNA 2XAFA 1B72B 4M7AG 2L2OA 2O8XA 5DD8A 2OD5A 5DEQA 3EYYA 1WJAA 3CZ6A 5D4SA 3RKWA 4RS8A 5GTIC 1U5TA 3J7ZI 1VQLI 1AU7A 2DYRH 3VSKA 1LJOA 3LSTA 5L3EA 2L3SA 4ZN1A 2BY2A 1E17A 1YJ9T 4OAZA 4BY6C 4XLFA 1M27C 3QUIA 1KC8U 1E3HA 2JA7J 1WQWA 1ZBXA 3CD6A 1VQOI 2D1XA 2O4XB 1SANA 3K9TA 3M8FA 1FOKA 1IXSB 1W4MA 5EGOA 1T38A 2ETHA 1X6OA 2P7VB 3EGXB 1MBKA 4A4HA 2EQMA 5HS8A 2MG4A 3DEEA 4LK1F 1AZEA 3VPRA 4EV0A 2J06A 2RHXA 3PGGA 4Q47A 2OV7A 4D5CA 1MW7A 1TXQA 5GAEJ 3K4KA 2RNGA 5D8LB 3H3ZA 1BJAA 2PQ8A 1YJ9I 1PSFA 5GANg 4M3DA 1Z7LA 4KH1B 2HZTA 2YX7A 1XMKA 2L9NA 2JUCA 2HXIA 2MD5A 2G6FX 1HDDC 4XLHA 1WWXA 3DFGA 5B5EC 2ZAEA 1KGSA 4BE2A 3WTWC 1K0SA 4FX0A 2KRHA 1XTDA 5D8KB 3NPFA 2IAIA 3KP7A 2LTPA 4F16A 2YUNA 3QBYA 1CF7B 4FISA 3MEUA 2CREA 1Q81C 2R7WA 4EPCA 1SRLA 1AWOA 1T3LA 5HK3A 4IXAA 3EG3A 4RUGA 3JB9F 2EK5A 3G1JA 4I2OA 4D0PA 4FASD 4DW6A 2VOPA 3PMTA 3DU6A 3GNFB 1LPLA 5GAMe 3FHZA 4X6AJ 2X1EA 2LH9A 2EV0A 2D5VA 5CVJA 2RQPA 5D6FA 4IL6C 1A6QA 2CYYA 4L0ZB 3A1PA 1YWOA 2XGEA 3Q9SA 4A3FJ 3ZXSA 4NNJA 1V5EA 2R5YB 1BC8C 2A3LA 1T95A 4GCVA 4ZGEB 4CYCA 2R7SA 4E7ZA 2EYWA 3G71A 3TEDA 3BR2A 3UNGC 4CSWA 3JR9A 1I1SA 3JCMV 2HXOA 3HPGA 3E9FA 1FYKA 2ZJPF 1I3QJ 3OYKA 1EH6A 1DDNA 4J9IA 3A01A 5AT1B 2EQIA 3CBOA 2KXDA 1WXTA 3H9NA 4ESJA 1K78B 2IVWA 2L7MP 3WXMB 1OCCH 1RAIB 1R1UA 2OA4A 3PO2J 5LJ3g 4PJOE 1DPRA 1T6SA 1U9OA 2RV8A 5F27A 3M54A 1ZN2A 2CUJA 3CCVA 1S72T 3QP5A 4B43A 3ZQHA 3VYRB 1I1GA 4ESBA 1PJRA 5FKNA 4L0YB 2WY8Q 3FKIJ 2R5MA 4M77D 2HAXA 1MMSA 4NUBA 1U5TB 3UR3C 1M5Q1 2VQCA 1R0BG 3NHNA 1TOVA 2AQFA 2FG0A 1POGA 4A3MJ 3V7RA 2KT8A 1YI2T 4E7IA 1FYNA 5J1YA 4N0AA 3RBBB 2VIXA 1OU8A 5EGOB 4J9DA 4FCYA 1LE8B 2VGMA 2LT1A 5FD5A 2V9KA 4I09A 3HOSA 2OBPA 1WJDA 3CDHA 1RPWA 3FRNA 2CFOA 4LG0A 1ZK8A 2A5YB 3K0LA 4M78D 5LJ5h 2M9HA 3OSFA 4XTXA 2XDDA 4FYXB 1JXSA 1YS6A 1Q82R 1VQ7Q 1DGRM 1W7PD 2DTZA 3R0AA 2QQRA 3DXJF 2J5PA 3MHXA 3TL4X 1QVFS 4P5OA 2K57A 3T0YA 3CC2A 1UB4A 2HPMA 3G1OA 5C3EJ 1DU0A 3RERA 3ABMH 2DIGA 4HAMA 2QZ8A 1DUXC 2HQ5A 5CCAA 2QDYB 4AWXB 1UJYA 3VS0A 3FISA 3OYMA 3QZ5B 4HVWA 2D8JA 2XGXA 1ZHIA 5D7UA 2LQKA 3X24B 5ECAA 2YWWA 2K3FA 1LUJB 4B4CA 2ELHA 1BCMA 2RVCA 1FC3A 4ME7A 4A53A 3VYTB 4S05A 1T8IA 2QGFB 2JQ7A 2P5VA 2X9DA 1APLC 1IRZA 4LLLA 2RHIA 3GO5A 4LIVA 3TW6A 2C0OA 1D0XA 2L02A 1KU7A 4FT2A 3QYHB 3GLXA 2AK5A 3RTRA 4JPBW 2BOLA 4E47A 2DILA 1D0ZA 5B3SH 1MBGA 1VA7A 5GAMd 1B6AA 1B59A 2EYZA 3P7NA 3OR2C 4ZN3A 2HOTA 3JSOA 4MEYF 3IRRA 1W36C 2GLOA 2COMA 2JJ9A 2ZZDA 4PJNA 3WGGA 3VYUB 1YHQT 2QQAA 2CUFA 3GZ6A 2WSFE 4OGEA 4V19K 2KT0A 1D5YA 3ZMUA 2E60A 2LK2A 2W57A 1OFCX 2KZGA 3ZFJA 2W1OA 1UZCA 1RNLA 3MQ0A 3QQAA 4OAYA 4F3QA 1W0TA 1Y96A 3NGPA 2R58A 3ABUA 3OQ5A 3ERMA 3A01B 2R7XA 4QQDA 4RTUA 3QPTA 3M5AA 4M75G 4QQGA 5J6XA 4BUGA 1IJWC 2XHCA 4C92D 1Z9CA 3I0TA 3WU2C 1M90R 4BHBA 2KGTA 4E6KG 3E5UA 3C3WA 2CUDA 3O2PE 2B7EA 3LSPA 1JJ6C 2JZYA 1FIAA 1TTHB 3QXEB 1VOMA 5GADJ 2OTJQ 3R6NA 2JS2A 4DEYA 2DPUA 2P5LC 2XF5A 4PUSA 5HY6A 3EG2A 3CCEI 2ZPHB 2IIMA 1HSTA 4B44A 3RQ4A 4HCKA 1VQ9T 2ME0A 1NEBA 2K79A 3M59A 1ZA2B 2VGNA 4XLEA 1RIOH 1WIEA 2J6OA 1RUNA 4OF1A 1QQJA 1X1AA 4J9FA 1BCOA 1IRFA 1FMKA 1BK2A 3CC7T 2PZ1A 3REAB 2O5RA 3SFZA 3F23A 4BI3A 4KA4A 5KCOA 2V1NA 3CQTA 3CCSQ 2BKDN 4MZMA 4LG0B 4R0KA 2LQ8A 2DOEA 2CDTA 4XTYA 1VUBA 4V2SA 3VUZA 1NJIC 1H3ZA 1HBXG 3VFZA 4JYKA 2DERA 3BY7A 5D5UB 1VQ9I 2GOXB 2QDLA 3ONQA 3D5LA 3V8KA 2E7XA 1KD1R 3Q0WA 2V4JC 4A6EA 1QKWA 3BDLA 5DM7R 3G6EI 1PUFA 2O9LA 4D8KA 2ECCA 1M1KR 3ZQLA 4NB5A 2WV1A 5HVQC 1S8NA 1BI0A 1SPKA 1WX6A 3CMAQ 3LMMA 1ZLJA 2F5KA 4JK1X 1B34A 5GAMh 5FU6C 4IHSA 3SQNA 2OAWA 2QKMB 5TISC 2EILH 1O75A 3W6VA 3NTIA 4H4KC 3RYPA 2KZVA 2QEXT 1B9NA 3VODA 4L9JA 2CQXA 1R1VA 3OYFA 1SVOA 1MH4A 3JCMb 4J00A 4RM2A 1JHFA 4O6JA 1ZARA 3FB9A 4CZZA 2V9PA 4XTVA 5EZHA 1IB8A 1KQSS 4C2MJ 3G71Q 1K73U 3O8VA 3E6MA 4XL9A 1WA7A 4BJ6C 2P4WA 2HKOA 2LF7A 3PVQA 5IT9R 3RKYA 1DP3A 2WV0A 3QRFF 1SFOJ 1H641 1VQ5A 3CCQA 3HPHA 1N5ZA 3PIOF 1LNWA 3LH5A 5GMKm 3IH2A 2E5ZA 3K2AA 1WJ5A 3COAC 1G2BA 3QYEA 1WHLA 1IXCA 2OCCH 3OL3A 2IRFG 4IOAF 1Y96B 4Q5SF 2BE9B 2P5KA 4RCBA 3L7WA 2DE0X 3QO3A 1Q86U 1VQLQ 1RESA 5F64A 2XSDC 2G7UA 2BXYA 3J81K 3CCJI 1M3BA 2VBYA 2DL8A 1H92A 3MEAA 5FLMJ 5IT9K 2YR2A 3QPLA 4B8XA 4E7JA 5BOXA 2JJ7A 4I6ZA 1VQOQ 1PUEE 1IGQA 1QLYA 2HOAA 2CUEA 4G7HF 2LJ3A 1ODDA 1Y0UA 2Y75A 3BG3A 2QBYB 1GCPA 2YUSA 3ESWB 3SJMA 3JCMQ 3SHFA 5KK1A 1R00A 2ECBA 2MMPA 3MWMA 3OIPA 1NYFA 2KLOA 2NAZA 3JV3A 2V7FA 2XPWA 1RC9A 1UGQB 4Q5WA 2XRNA 3OA6A 3JCMP 1N8RU 3M8JA 1YJ9Q 1AT1B 2YUPA 1TU0B 2AXLA 3RPUD 2YU3A 3T8RA 1GT0C 3JAMR 2ZPGB 3TSWA 2M5WA 4BE0A 2QG9B 3QPSA 2EINH 3RMSA 5FFZA 3O8GA 1GBRA 1IZ1A 5LEJA 3D1NI 3KCCA 1MHNA 3A8OB 3OYIA 2X6WA 4FE4A 2KSSA 1ETXA 3C2HA 3ZQGA 2X9HA 1UECA 1JEGA 1IV6A 1K9MC 1VQ4I 1YFHA 2GQQA 1D3BA 1I5LA 2EIJH 2XRLA 3K1MA 2K5LA 3C94A 1S7OA 4U87A 2KRCA 1YG2A 5GPAA 1YW7A 2A3SA 2EIFA 4CDGA 3PE0A 3PIPF 1PUFB 1Y1WJ 4BDYA 1ETYA 4CYDA 3BR3A 4A3KJ 2RQWA 5IP9J 5DV5A 3ER0A 1P7JA 5FJ8J 2Z33A 1OPKA 4ZGJB 1KQ0A 3SZTA 2Z9OA 1B34B 3M9AA 2W84A 1I5OB 4RTTA 1ZGWA 2LKPA 3PUBA 3NMZC 2ELJA 5J39A 5F08A 4RMNA 2FRHA 1Y71A 3CCYA 2KFDA 4ZYDA 4HF1A 1GLNA 4BD3A 2LQNA 2A6EF 4WF2A 1H89C 4A54A 1TWAJ 4L9TA 4G94A 4CCOA 1Y0NA 2M2EA 3HB9A 2NLUA 2OC6A 4ESRA 2PTKA 1RETA 4W1UA 3I56T 3HPWA 4FYYB 3LSRA 2IS2A 1JHHA 3I4MJ 4RGUA 4F7UF 4FSXA 2YHTA 3EYIA 3K1NA 3O6BB 3PIOA 4BI4A 1KK7A 1N75A 2DPDA 1BIBA 3HOZJ 2LY9A 1XMXA 3IUOA 5J8FA 2K9NA 3AG2H 5A0DA 1SVLA 3DPTA 3J81Z 2JMWA 1X4OA 1LDJA 4FYWB 2R4GA 1X1PA 3DCFA 5IT9Z 3DB3A 1QVTA 1M3AA 2V1UA 4LLGF 5KYYA 2EFPA 3FMQA 1T3SA 1Q7YC 5BPIA 4IRIA 3H0HA 2H1LA 3I56I 6AT1B 3WTTC 1IHVA 2WAQN 3OMYA 1TP4A 4C8QD 4LD6A 4BDZA 2R7OA 2CW8A 5EEHA 4C5GA 5IHKA 4L5IA 2KK4A 5DLOA 3Q9VA 3QDFA 3ULQB 3KX2A 1VYUA 1E6GA 2P4TA 5JFRA 3CCUT 4KGZB 3Q0UA 2XKOC 1AD5A 1M8VA 1UG0A 5K7HA 1UEBA 1YBYA 5FGMA 4F7ZA 1ZG1A 5E17F 1V5GA 3ECHA 5E3MA 3JCMf 1W5CC 1ORKA 2YLCA 3JCMW 3KYDB 2DMNA 1JTYA 3HSEA 4BNCA 4J9HA 4FETA 2KROA 1K9AA 1JT6A 2DZCA 2XUBA 1SEMA 1UHWA 1ZHFA 3HRMA 1OKRA 3RNJA 5K7FA 3GZ5A 4OINF 4UVCA 2DO3A 1PYVA 4J01A 3CCUI 3VS4A 4KUDK 1FYLA 1VYVA 5GAN7 2KP6A 2XMFA 4A0XA 4XLAA 2JSCA 3FXRA 3CLOA 2L3RA 1IW7F 4A0YA 4EMSA 4QLCU 5I22A 3F8BA 3HJEA 2UXXA 3KEOA 4FM4B 2IG0A 2ED0A 2OQRA 1V5FA 3EUHC 3OYAA 1D8JA 2K6DA 3PIPA 3DLLF 4UUSA 1YITT 1XCVA 1J5YA 2KDSA 5D6WA 4M7DD 3D5SC 1A04A 4DZPA 2ZCFB 1GCQC 3C2GA 3LA2A 2JVVA 1IO6A 3IP4B 3E5XA 5L3BA 2GA2A 2GM4A 3EG9A 4R56A 3H8ZA 2HNHA 4YFKF 3PNVA 4CCNA 1NH3A 4F93B 2HD0A 1EZZB 3QOPA 4L5EA 3W6JB 2CP6A 3GXOA 4JRIA 1XGSA 4JRKA 3H3VK 1FMWA 2DL4A 1P4XA 4E70A 2X6YA 4A4KA 1PKTA 2LBFB 4JX6A 4LLNA 2K4BA 2XDBA 2M02A 4RLFA 4FE7A 1YITI 4YIFA 1OU9A 4F7UA 2QLZA 4G6TB 3LX7A 1U5TC 1YX3A 2QENA 5E3LA 1XQHA 1WGXA 2JT1A 3DKYA 1IN5A 3QWLA 1G3SA 4GYGA 5KNLA 1IRXA 3X20B 2M30A 1JE8A 4KGVB 4HV5A 4YIIA 4LGWA 2VQGA 1YJNT 1MSFC 2R5ZB 3TSZA 1EFNA 3BPXA 5KYYB 2F6CA 4PLLA 2PMUA 4K2EA 5BMZA 3CCEQ 2HVQA 5GANf 2RREA 1SD6A 4UNOA 1QHHD 2LRDA 5FRNA 3KP3A 1PVEA 2ME6A 1U0JA 2KDZA 3KP2A 2FZCB 1PRMC 2DFHA 4QSHA 2MCNA 2G3RA 2KNBB 1S1NA 1VZ0A 3QWXX 2FX0A 1HKTA 2V1QA 1JJ2S 3IH4A 1YJNI 1AOJA 1T0HA 2JMCA 1ZUYA 4A4FA 1K0XA 1XGNA 2K7LA 2AT1B 1WYXA 3CCMI 2M7BA 5LGNA 4XKCA 2HKXA 3GMEA 4NDLA 1I81A 1LVKA 2O31A 5DM6F 1VQ9Q 2GGRA 1P6RA 5IAYA 3AAFA 2E1CA 5GAN3 4CHUA 3Q3SA 3R60A 4L5GA 3G3ZA 4UB8C 3T1BA 3D5RC 5BS6A 1OI1A 3OS2A 2E12A 5J1RA 2RQTA 4RTZA 3G6EQ 1PD0A 3MKYB 4LMYA 1WQ7A 4HYEA 3PNWC 3OS0A 2FOWA 4J9GA 4KIGA 2LCCA 4IIOA 1RI9A 2FQ3A 2A61A 2ZMEA 3FXQA 2LDMA 2QQ9A 3DLLA 4XNFA 1VQ6T 3BG6A 2EPDA 3OSSC 1HA8A 1ZGAA 1QPMA 3K4LA 3V7CA 4A69C 3J7AW 2KIQA 1MNDA 3ZQIA 2BY1A 1W5TA 4XORA 1UHSA 5IXBA 5CYVA 2LVSA 2N8GA 3AG3H 2HZDA 2ICWG 1QZZA 3W6KB 3HTUA 3EG9B 2VUMJ 2QSFX 2RQRA 5LJ3f 4PJOF 1K8AC 3TO6A 3PSFA 2GXBA 2VJIA 4RTVA 1Q1VA 4P9UA 1VQ6I 3F3XA 2V6EA 4QT7A 4R55A 5DCMA 4XTWA 3BG7A 3GF2A 2AXTC 2E3HA 1UFFA 1GXIE 3RKQA 1YOVB 4V2FA 1PC0A 3VU3C 2OZUA 3PFIA 1VQ7A 2QUFA 2AO9A 5JVGF 4N9HA 1JTXA 2NVTJ 3QKJA 3CCJQ 1ZAOA 2M0OA 4Y15A 5CKBA 1IV8A 1S3JA 1IO2A 2MPXC 3JRBA 2Q1ZB 5CKFA 4UXNA 1Y57A 3C18A 4OOIA
chains in the Genus database with same CATH topology
4HQEA 4N0AC 1D8KA 3GW2A 3URGA 1YIJA 1FPQA 2FE3A 3F8NA 2RKHA 2KAFA 2AHJB 4DOWA 1N9RA 2CFXA 3K2ZA 4F7UG 3CMEA 3TGNA 5K5QA 4UUVA 3T9NA 3G73A 4J7IA 2X4HA 4G7ZF 4HT8A 2KKOA 1QVFA 3M7GA 3E97A 1V4RA 4P9FA 1OPCA 3HSFA 2STTA 1YJWT 2OTJT 4MQVA 3IRQA 4ENMA 2BV6A 1U3EM 4UVAA 3SD4A 2B8AA