2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
b'DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
molecule tags Transcription regulator
source organism Corynebacterium diphtheriae
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
4ZZLA 3ZMTA 1XDSA 5L3EA 2V1UA 3QRFF 3KP3A 4DQ2A 4XLNF 4B09A 2EB7A 5HLIA 4LJZF 3RJPA 1MZBA 3H3UA 3JSOA 4HQEA 1YG2A 3I54A 1KU3A 1ZHFA 4LG0B 2O3FA 1B6AA 3GFLA 1TW3A 2PQ8A 2F2EA 3J80Z 2JTVA 2OU2A 2X0LA 2JPCA 3K9TA 1V3FA 2YR2A 4G8XA 1SFEA 4U0VA 4LD5A 2NS0A 4KT5C 5H6QA 3KZZA 3FX3A 4I01A 1FX7A 1J9IA 2QM3A 1SAXA 3D0SA 4KN7X 3GUDA 2ETHA 2P5VA 1K79A 3GZ5A 2E7WA 1FZPB 2LSOA 4EJVA 3FXQA 2OQGA 5IT9Z 2ZKZA 4OIPF 1QZYA 1IRFA 2H6BA 1XB4A 3FMSA 4Q47A 1TTYA 2BEOA 4G94A 5CYVA 4YG2F 4ENMA 2PEXA 4HF2A 2Y0MA 5LGNA 2Z9OA 3BPVA 3GW2A 3CUQB 3WGHA 3H3ZA 1HKSA 4KIGA 1BI3A 3L7WA 2Y48A 4GO1A 2XRNA 1QBJA 1K7AA 1VTNC 1YW8A 4JK1X 2COMA 4YFNF 5D5UB 5AONA 5D8LB 1P4WA 4MQ9F 3HUGA 1U5TA 1FYLA 2YX4A 2XVCA 3IKTA 2CG4A 2IP2A 1I5ZA 2FA5A 1YS6A 1Z9CA 3TDZC 2EV6A 3LA3A 4WXHA 3RKXA 4L5JA 4OIRF 3DXJF 4UNOA 2ADUA 2R7FA 4LB5A 2PLYA 1MJBA 2Q2EA 5CVVA 3ABTA 3GVAA 1XD7A 3Q9SA 1LJ9A 3HTUA 5DCFA 2W85A 4AD9A 2DO7A 2GXGA 2HYGD 2W84A 3ECOA 3M8FA 6PAXA 2UXNA 4BQAA 4G7ZF 3ZMZA 2EFPA 4KMFA 4XLPF 1CGPA 5EEHA 2L4AA 3ZP5A 1H0MA 3CUQA 1J5YA 3HTSB 3K2ZA 1FSEA 3ROUA 3O6BB 4IHTA 4CO8A 3DQVC 5D4SA 2PMHA 5E1XA 3Q9VA 1FT9A 3L2CA 1EH6A 2IRFG 3SHFA 3C18A 4KUMA 4M6YA 2ZFWA 2D45A 2VBZA 2E7XA 3FMQA 4A5MA 4CYDA 1PDNC 3OV8A 3WTWC 2FXAA 1O57A 4XSZF 2IA2A 4A12A 4R79A 4ESJA 2PG4A 3TOAA 2DT5A 1KU2A 4MGRA 5L3DA 3I0TA 1H9TA 2H6CA 1F5TA 1EH8A 1FSHA 2HQRA 2MLGA 4CHUA 1I1GA 4RGUA 2YSRA 4WWCA 4EVIA 5A2QZ 5LLQA 2GA1A 1RI7A 1X3UA 2FU4A 4AIJA 1ZLJA 3P9KA 2XAFA 4I09A 4PDKA 5K5QA 3QPHA 2DBBA 2IW5A 4IXAA 2FRHA 1HKTA 3CUOA 4EMSA 5FLXK 2A07F 2XIGA 2ZNYA 3F8MA 2XROA 1SMTA 2R7DA 2NNNA 5K1YA 3IL2A 3ERED 5LHIA 1XGMA 4RB0A 3HOSA 2HQNA 1HW1A 3LWFA 4A2UA 4UV9A 1FP2A 3E6MA 1IXCA 4ZYHA 2ACJA 3BPXA 3IKVA 1T6SA 4HX4A 3WODF 1ZGJA 5JVTA 2M87A 1G3TA 1XGOA 3T8TA 1L3LA 5BPDA 1UB9A 5D6FA 1T38A 4UVAA 1CF7A 2DTRA 3KE2A 4WX9A 3T8RA 4KDPA 5F1RA 1QNTA 3D5LA 1TNSA 3VODA 3IWFA 1MDMA 1B59A 4L9VA 2GIVA 3K1MA 4U0WA 2XAHA 2F5DA 5LRSA 3FXUA 2VBXA 4I0AA 1IZ1A 5BOXA 4CZZA 5D6EA 4U7DA 3BJ6A 1QO0D 1U5TC 1U2WA 1FPQA 3CDHA 2IT0A 5CVUA 3SZPA 4EJUA 3DP7A 2CYYA 2NRAC 2CWEA 3K1PA 2ESNA 2BYVE 1IXRC 5ILUA 1ZRDA 3TO9A 1S6LA 3TO7A 3MWMA 5D5WB 3KETA 1EH7A 1FBSA 1GVJA 4O5VA 5FD5A 3LA7A 4P55A 3GXOA 2CSOA 5E17F 1HQCA 1T39A 4ZYDA 5A2QK 1R1UA 2LF8A 2QUFA 2FBKA 2RDPA 1D5VA 4H0EA 1SD4A 1Z1DA 2ZCWA 1ZG5A 2PFBA 4JBAA 1TBXA 1LDKB 3IC7A 2IVMA 4RGXA 1BC7C 2P6TA 4FX4A 1TW2A 3COAC 4HZFA 2DQRA 4OOIA 1UFMA 2FQ3A 1ZGAA 5BPIA 1LQ1A 1B9MA 2HTJA 1FLIA 2G7HA 3M1EA 3QP6A 3T0YA 3FF5A 2ELHA 3GFJA 1SMYF 2VC0A 3G73A 4U0YA 1XSDA 2RC4A 2LDUA 4K2EA 1B9NA 2KIFA 2KIUA 4L9JA 4IJAA 3GFIA 2Z5UA 1I27A 3WU0A 2HKOA 1O3TA 3GWZA 1GXPA 1BI1A 3GFMA 2GZWA 4EM1A 2QBYB 3V7CA 2VOOA 1ZRCA 3R0JA 5ICFA 3WTSC 3M9AA 4UHTA 2BV6A 5FLXZ 3LSTA 3KEOA 2FE3A 3I4PA 2O8XA 3RKWA 3TKYA 2W24A 1TQIA 1K6OA 3JTHA 5F64A 1WWXA 5D5VB 2NNYA 4XSXF 2M1BA 3O2PE 3BJAA 5ICCA 1ZG3A 2IA1A 2MD5A 4MEYF 3CUQC 3CLOA 2DU9A 5CVJA 1R1TA 5LHHA 1CF7B 3W6KB 1R1VA 4KICA 1MDMB 1S29A 1R00A 1PP7U 1D8JA 1YW7A 5HLGA 2NYXA 2ZXJA 3ZMSA 4GXOA 5E1ZB 1KQ8A 1WSUA 3SFZA 5DUKA 2O6GE 3ZPLA 1E2XA 2D1HA 2ZMEB 4AIKA 3F8FA 3F22A 1YS7A 1HXDA 3CJNA 4RAZA 4BYYA 4PGHA 1ON1A 3GF2A 3HRUA 3RPUA 4NQWA 1LEAA 2X4HA 1FOKA 1RIOH 2FEZA 2QQ9A 1RNLA 3TQNA 2FNPA 3SXYA 4XRFA 2EV5A 5JI6A 4ENJA 3ML6A 3F8BA 4EJWA 3C7JA 5LRRA 5FD6A 1JE8A 2XKOA 2OZUA 3MHXA 3ABUA 2OA4A 1AWCA 5ILVA 3KFWX 3WU1B 4BHPA 3E3VA 2GXBA 3M7GA 4RB1A 5LBQA 2VODA 1W5SA 3L00A 4QLCU 1IUYA 3J80K 1IRGA 4EV0A 1LEBA 3K0LA 2HTSA 3O3KA 1S7AA 1Z91A 1FYMA 2CQKA 2Z99A 1J59A 2XAQA 2HKXA 4L9NA 4L5IA 3WTXC 4U7BA 2BE5F 2R3SA 3SQNA 2DLLA 3J81Z 2EV0A 3BROA 1USSA 4N0BA 1OYYA 4WK8F 1FC3A 3F6VA 1USTA 4HQMA 3E19A 4PGGA 4LLLA 1S8NA 3CO7C 4HYEA 2F5FA 4UVBA 4EQQA 3E5QA 3MFKA 1MKMA 2E1CA 3CTAA 2EK5A 2PBIA 2XUBA 2HYFA 4LK1F 2DFIA 3TO6A 1MJAA 4LGWA 4I98B 2JZYA 1ON2A 3JTGA 4HF1A 1S3JA 2P8TA 5DEQA 2BGCA 3NQOA 2AS5F 3M8EA 2VC1A 5DDGA 3P7NA 4AIHA 3EETA 5L3CA 1ZYRF 3KP7A 2KJCA 2QQBA 3WE3A 3ELKA 1XN7A 3QU6A 5LGTA 4BNCA 4GYIA 3K69A 3FM5A 3LQRA 4HF0A 3WE2A 3NEUA 4P5OA 4YFKF 2M30A 1ZLKA 3KP4A 2FSWA 3U2RA 1ZREA 1REPC 1NHAA 2LKPA 3BZ6A 3QPTA 3WTVC 2VT2A 3LAPA 4HDUA 3VOEA 4OU0A 2IJLA 3W6JB 1E17A 4G6QA 1XCVA 4LK0F 1O7LA 5IT9K 2HR3A 1U3EM 3GZ6A 4A6DA 1ODDA 3V7SA 4P9UA 4A5NA 1LDDA 5LEJA 1KYWA 2KIMA 1XMAA 1OMIA 4CXFA 4IRHA 4HX7A 4HLYA 4Y13A 1FBUA 3DKWA 3WTTC 2K5FA 2STWA 1IN4A 2L54A 1D8KA 1DPUA 2MH2A 4HDVA 1SD6A 5L3FA 3MQ0A 1W7PD 3MAJA 1KA8A 2A6EF 5BQTA 1IN7A 4EM0B 3BP8A 5ED4A 2VE8A 3RI4A 2V9VA 4E70A 2WV0A 1IAWA 2FMLA 3FZVA 1RZ4A 1B4AA 2W57A 1IF1A 2F5CA 4I2OA 4WXDA 1W4MA 2K86A 1C0WA 3U9GA 4ESFA 4M6XA 3ZMDA 2GQQA 1U8RA 3GEZA 4M73A 4A0ZA 1YTYA 5LEKA 1YO5C 4QWQA 2Q8KA 2J5PA 3KP5A 1J2XA 1SFXA 3F6OA 1GHCA 2HZTA 2C6YA 1HKQA 1G3SA 2P6SA 3WTZA 3I64A 2G9WA 2UXXA 2OBPA 1EV7A 1YLFA 3F72A 1Z6RA 3TGNA 4FHTA 1MD0A 5HDNA 4KA4A 4R8HA 4LLNA 4G7OF 5FB2A 3H92A 3HHGA 1PP8F 1FNNA 2OAZA 5J6XA 3LFKA 5J8CA 2ZJ2A 1GXQA 3T1BA 4P9FA 5D5XB 2QZ8A 1ZAOA 1OR7A 2HOEA 4L0ZB 1Q1HA 3BWGA 5DD8A 3P9CA 3RYRA 2V6CA 3I5UA 1ZH5A 3I71A 5K5OA 2VE9A 2OQRA 4Z2YA 2Z33A 2HGCA 5BS6A 3I58A 1S7OA 3ECHA 4Q48A 4KMUX 4MQVA 4HW0A 1I1SA 4I02A 1G3WA 1A04A 3GLXA 1J7KA 3E5UA 3LQQA 3WTYC 2VOPA 3DPLC 1JHFA 2Q0OA 5AIPA 4HX8A 1WQ2A 3ZN0A 2P5LC 2K02A 2ESHA 4OINF 2A5YB 3E5XA 5FFXA 1BOAA 2O0YA 1U6GA 4A0XA 1XSXA 3F3XA 4AVPA 2FBHA 4L9TA 3R0AA 1IW7F 4LLGF 5DCMB 2ZNZA 4ZYEA 2F5EA 1IN6A 4HA8A 1ZG1A 2MA3A 3LAJA 1F4KA 1YFHA 1BBYA 1YIOA 4D0PA 1W5TA 1BM9A 2V79A 3K1NA 2XASA 3FM3A 2EFNA 4NB5A 3I59A 4CGZA 2L3DA 1ONVA 2H3JA 1R22A 4RGRA 4WCGA 3TDUC 2K4BA 1DUXC 3BJOA 4IRIA 3J7AO 5J8FA 1JXSA 1L0OC 3G3ZA 4JQFA 4MTEA 1O7FA 2HEOA 1XCBA 1MJ9A 4N9HA 2DPDA 4EJTA 5L3GA 4UUVA 5CLSA 5IT3A 4O3MA 2P5KA 5FFZA 1I6XA 2O61A 1PUEE 2XGXA 5HVQC 1BYMA 3E97A 2OZ6A 1R7JA 2DPUA 4Y15A 2FOKA 2GA2A 4DNCA 5KK1A 4IRGA 2LF7A 3I53A 1KU7A 4S05A 3BY6A 2P4WA 1SFUA 4HAMA 2RNJA 4WXCA 4UVCA 4EGYA 1KQ9A 1KYZA 2DK8A 3HHHA 3QU3A 1SD7A 4ETSA 4I0BA 2D2WA 5JHUA 5HS8A 3FHZA 1U78A 2RGVA 2A3SA 1FWZA 5F6FA 1Y0UA 5KVRA 2PN6A 2JSCA 1IXSB 2Y75A 2CFXA 1R23A 3HRTA 2GAUA 4PCQA 1T0FA 2JT1A 3F21A 2GWRA 5E8IA 1JGSA 4KFCA 2XAGA 4YIFA 3MZYA 5D8KB 4GGGA 1P2FA 2KRFA 1JHHA 1LB2A 1HSJA 3GX4X 1XSVA 2L01A 2K5IA 2M8EA 2EJRA 2H94A 4OMZA 3IWZA 1G3YA 1ZN2A 2WC2A 1W7PA 3V8JA 1U5TB 2M5WA 4GCVA 3U1DA 3KLOA 2XV4S 4M9XA 1XGNA 3ULQB 2H27A 3KLNA 4P96A 4ZH4F 3E6DA 5BMZA 2P7CB 2DW4A 4NHJA 5FO5A 2EA4A 3E6BA 2MBFA 1BJAA 3F8CA 1P4AA 2NAZA 5AIQA 3RPQA 4MTDA 1YW9A 2ZBKA 3B02A 3FXRA 1DPRA 3FMRA 2ZO4A 4G7HF 2L4MA 4KIFA 5DV5A 1STZA 4YIIA 1XDUA 5E18F 3HRSA 3HSRA 4Q4ZF 3KZYA 3SZTA 1OYWA 2XKPA 1TLHB 5JFRA 1FP1D 1HSTA 4KIBA 4RB3C 3ZQ7A 1IN5A 2DK5A 3WGGA 3FWEA 5EEGA 3DFGA 3T5XA 4MEXF 1HW2A 2L02A 4M9ZA 2FBIA 4IVNA 4UXNA 1R58A 4LG0A 3GO5A 3VB2A 5LHGA 3WGIA 5DD4A 3RYPA 3EUHA 1WRJA 2P7VB 2EFQA 3PQJA 3N97A 4HV6A 1FBQA 4FT8A 1OKRA 3PQKA 3V8LA 2QENA 2MC3A 4KNYA 4CICA 3DEUA 1LNWA 2VBWA 4UV8A 4TV7A 3LA2A 1O3RA 5DYMA 4EGZA 4ZYGA 4EJOA 4IHSA 3F23A 2JPBA 3KP2A 4OIQF 2KJBA 2RV8A 3R61A 1XMKA 4U88A 3L9FA 2RVCA 3HSFA 1KGSA 1OYIA 4G9YA 2O03A 5HDGA 3N4MA 1K78A 1J75A 5E8GA 4IPAA 5FGMA 1D3YA 1KU9A 2A6HF 4RB2C 4ZZDA 3J81K 2BBYA 2VN2A 5TRDA 4O6JA 2IPQX 4LMYA 3B73A 4IF4A 3R4KA 5H20A 2KKOA 1ZRFA 4RGSA 3P9IA 1R36A 1F9NA 1T2KA 2ZMEA 3PFIA 4N9IA 4GYGA 1H9GA 3C1DA 1QPMA 2QQAA 3L09A 3TOBA 1QVPA 3V4GA 2K7LA 5HS7A 3E6CC 2MLKA 2V1XA 3V7RA 5ERIA 4ASNA 4M74A 2W25A 5K5RA 2FMYA 5CVIA 3DV8A 2UWMA 4KN4X 1UCRA 3JSPA 1YQAA 4A6EA 3GYHX 1YYVA 3KCCA 4YFXF 1UHWA 1QQIA 4L0YB 3BDDA 2EA2A 3AAFA 2A69F 1QW1A 2CW0F 5DUIA 1W7PB 3S2WA 2QVOA 2VXZA 2LX9A 4ESBA 1QZZA 4WF2A 2YU3A 4EM2A 5ILSA 5CVRA 2V1DA 1OPCA 4I7HA 1P4XA 2M45A 3KP6A 2HS5A 3RTRA 2J5OA 1T98A 4L18B 2CO5A 2EWNA 1V4RA 4KYWA 2LNBA 1Z05A 2IA0A 3R6SA 2RKHA 2QBYA 2CGPA 4CDGA 4BH9A 1KQ0A 2YPRA 3QAHA 2PJPA 1RUNA 1IN8A 1XGSA 4ENKA 4OIOF 1HW5A 3DF8A 2HWVA 5ICGA 4XBFA 2B0LA 2TDXA 2XAJA 3HIFA 1BI2A 1Z7UA 2MH9A 1BC8C 2VBYA 4BHBA 3OOPA 5HLHA 1QGPA 2ISYA 4S04A 4HLXA 3BOQA 1R5GA 3EYIA 2DI3A 2RQPA 2WTEA 2G7UA 5H6RA 2HFHA 2H09A 4BAYA 2FNAA 3QP5A 1MGTA 2HDCA 5CJ9A 2K4YA 1ZARA 1LVAA 2WWYA 3C3WA 2FF4A 4R1HA 4BHCA 5ICEA 1ULYA 1TQMA 3WTUC 1O3SA 3VFZA 3I59B 5E1WA 3R60A 3ZMUA 3QOPA 3MCZA 2E1NA 4LFUA 3EYYA 3Q5FA 2K4JA 4HV5A 3HOTA 1P6RA 4AWXB 3RDIA 2AXLA 2YX7A 5L3BA 5HOOA 2A61A 3JAMK 1TNTA 3V8KA 2UZKA 1LDJA 2DQLA 5JR3A 1AOYA 4Y17A 1G4DA 5TJJA 3IRRA 2STTA 1BI0A 3CO6C 4OMYA 4M71A 1P92A 1BN5A 2QYOA 1Z6TA 5HDKA 1HBXG 3WG9A 3HRMA 3EQLF 5DCMA 1BIAA 4MHGA 1TQPA 3REOA 4PZJA 3MZHA 3ZMVA 2PI0A 4RS8A 1R5HA 5HS9A 1DDNA 4F7ZA 4BXUA 3F8NA 3HYIA 3HSEA 3VEPA 2EFWA 3ZN1A 1F1ZA 4G6DA 3IRQA 4M9SA 1RUOA 4ON0A 4LB6B 1B1BA 4Q5SF 4B8XA 3DPTA 3ISPA 1FYKA 3MEXA 4A0YA 2QLZA 2EFOA 1WI9A 2JRTA 2K5LA 2K27A 2A68F 2XHKA 4MNUA 5E20A 2OD5A 2ISZA 3EDPA 1G6NA 3JAMZ 1BIBA 3IHUA 1UHMA 5D4RA 4RAYA 4FX0A 3RKYA 4HOBA 1O3QA 3KEQA 1FY7A 2PMUA 2Z3YA 3RIRA 3JW4A 2RN7A 1DP7P 4M72A 2GCXA 1J0RA 2VONA 1K78B 4HBLA 4ENNA 3NRVA 2DAOA 2QWWA 1WKMA 2VT3A 5LGUA 2D1VA 1SD5A
chains in the Genus database with same CATH superfamily
1JT0A 1K9MR 3VU3C 1YITQ 4ZZLA 2Y31A 1NBEB 3JRAA 1YNZA 3ZMTA 1XDSA 5L3EA 2V1UA 2RHXA 3QRFF 3KP3A 2L89A 2YRCA 3J7AF 4XU1A 4DQ2A 4XLNF 5EG0A 4J01A 2RHYA 3JB9H 1TWAJ 1I07A 4KH0B 4B09A 2AIRB 3CCQT 3E9GA 5KHDA 5GANd 2EB7A 1OCOH 5HLIA 4LJZF 5F0FA 3RJPA 2O9LA 3TMOA 2X51A 3CPFA 4B44A 1UUEA 5IH2A 2DD5A 1MZBA 3H3UA 2QA4I 1U1SA 1VQ6T 3JSOA 4HQEA 1YG2A 1JJ8C 3HL8A 3I54A 3OB9A 3BG9A 1VQLQ 4ZGJB 2VASA 1KU3A 1ZHFA 2LQKA 4EIKA 2HD0A 4A3CJ 1M1KU 2KE9A 4LG0B 4NBQA 2KXCA 2O3FA 1B6AA 3GFLA 1TW3A 4N4NB 2PQ8A 1YJNT 2JA8J 2F2EA 3J80Z 1M2OA 2JTVA 2QSHX 2OU2A 3KUFA 5B66C 2X0LA 3M0PA 2JPCA 1RUWA 2YS9A 2DTIA 3SEQA 3GBQA 1AOJA 2X1EA 1LKXA 3K9TA 1V3FA 3CF5F 2JWTA 2YR2A 5A2QR 4F7UB 4G8XA 4XKVA 3IAM2 2IIMA 3JCUC 4OAZA 2L3SA 5CQXA 1SFEA 4U0VA 4E7HA 4LD5A 4D8DA 2NS0A 2XICA 3CCQA 3GIBA 3QPLA 2PMZN 1SHFA 4F52A 2OJED 1OZ2A 2MZ4A 1KFZA 3JRFA 1OX8A 3BG5A 4KT5C 1KD1R 5H6QA 4C0GA 4YEJA 3KZZA 4A4HA 5I11A 3FX3A 1GFCA 4I01A 1FX7A 1J9IA 2OTLT 2J6KA 2QKLB 3TVTA 3JB9J 2QM3A 2C06A 2OPTA 5L23A 5CQGA 2WACA 4MIMA 1SAXA 4ZN1A 4DJAA 1I8FA 2XC7A 3MKYB 1KSWA 4HVWA 2GQIA 3D0SA 4B43A 2CV0A 1RACB 4KN7X 3CPWS 2DL3A 2BHYA 3GUDA 2ETHA 2P5VA 1K79A 3GZ5A 2E7WA 3TW6A 3MPUB 3PIOA 5GAOr 1FZPB 2LSOA 2R7XA 4EJVA 3FXQA 3RCOA 3PTAA 1G5VA 3CMEQ 2OQGA 1SG5A 2RI5A 3SWNB 5IT9Z 2ZKZA 4H4KC 4OIPF 2FQ4A 1QZYA 2KT8A 2QA4Q 1IRFA 1RR8C 2RQWA 2YU9J 3ZQIA 3QPSA 2H6BA 1XB4A 1MMGA 4BJTA 3FMSA 4Q47A 1TTYA 2BEOA 4G94A 5CYVA 3VDXA 4YG2F 4ENMA 3JV3A 2PMZA 2PEXA 4HF2A 2E35A 2DTOA 4RMOA 1D3BB 5FKOA 1JO8A 2Y0MA 1O9SA 5GAMj 3G4ST 1K4TA 2F1LA 1UB4A 2FL7A 3PT9A 5KE2A 5LGNA 3GF5A 4JLGA 2Z9OA 4NL2A 3BPVA 3GW2A 1UHFA 2X4XA 3CUQB 3WGHA 3VRYA 2BIVA 2DFFA 3H3ZA 4CI0C 2E41A 2E6ZA 1UGQB 1HKSA 2IS4A 4KIGA 1BI3A 3L7WA 2Y48A 3FK6A 4GO1A 3J81R 4FYXB 4C8QD 2XRNA 1QBJA 1K9AA 1K7AA 3EPZA 3LH5A 1VTNC 2DA4A 3OWTA 1YW8A 4BEHB 3EG9B 4JK1X 3TW7A 3CC2A 1AZEA 3M3YJ 4C0DC 2COMA 3K7AJ 3REBB 1BU1A 2L2PA 4YFNF 5D5UB 3QXEB 3O5ZA 5AONA 2LY9A 4HNVA 4C92D 1MMSA 1ZSGA 5D8LB 2JM9A 1R5ID 4QPOA 2EBIA 5FLMJ 3LSPA 1ZK8A 1P4WA 5KCOA 4IQ4A 3CCUT 2CDTA 4B1RA 4MQ9F 3HUGA 2CZ6B 2ECZA 1U5TA 3KZIC 4A3LJ 2K9MA 5DS9A 1FYLA 2CP7A 2A05A 3W2AA 2YX4A 4LXCA 2ICWG 1P7IA 3ZXSA 3BC8A 1PUFA 2X85A 2RQTA 3WVDB 1A31A 3ONQA 2AO9A 5FKMA 5J4YA 1F43A 4FYVB 1VQPQ 3AL0B 3G4SA 3HM5A 2XVCA 4Q5WA 1M4ZA 2DA5A 3FISA 3IKTA 2CG4A 1WHMA 4B6MA 4BB7A 5A0GA 3CC4T 4DA4A 3VS4A 2IP2A 1MMNA 2ZC2A 2VXFA 1I5ZA 3FXJA 4RKUE 3P5JA 4EDUA 3CCEA 4MMKA 3TBIA 3VYTB 2EZHA 3OYNA 1N75A 1VQ9I 2FUG2 2FA5A 1OCCH 5JLXA 4IHXA 1YS6A 4M78B 1Z9CA 1NE8A 2VB6A 2HOSA 4HXJA 5IP7J 2NUTB 2LREA 3TDZC 3JRHA 1QVGP 3WHBA 3FXKA 1VQLT 1GFDA 1JTXA 3VPRA 2ZPIB 5K7HA 1I50J 1E0EA 3K70C 2E5ZA 2EV6A 1IJWC 3CCYA 2G3RA 3LA3A 3J7YJ 1NEBA 4WXHA 1WQ7A 2L0KA 4L5JA 3RKXA 3LSGA 4OIRF 4AUXA 1MSFC 3AG3H 1IB8A 3DXJF 1R0BG 2CP2A 1WCMJ 2DXTA 1X2QA 2LR8A 2JVVA 2LRQA 2CUBA 4PJJA 2F2XA 2HXOA 4UNOA 2ADUA 2R7FA 3M8JA 1YJNA 4LB5A 1WPYA 4CCLA 3JCMW 2PLYA 1MJBA 1ZUKA 1RETA 3C12A 1M90U 2Q2EA 2DN0A 5CVVA 4AM3A 3H0DA 3VYSB 3ABTA 2ZJQF 3VUBA 3GVAA 1XD7A 3JRZA 1T33A 4M3FA 1M2VB 5FU7C 3Q9SA 3CCSQ 3O8GA 1PUFB 1LJ9A 3RPUD 4FW2A 5GMKe 1IHVA 2ME0A 3HTUA 3F0CA 5DCFA 2LBFB 1JKRC 3A8GB 3GOXA 1U8BA 2KY9A 3M0QA 2W85A 4AD9A 1VQ4I 3N5BB 3E1SA 4BI4A 2DO7A 4BUGA 2GXGA 5IOZA 3K10A 5GANg 3G6EQ 2HYGD 4BJ6C 2W84A 2VVKA 4YTLA 4M7AB 2FPDA 3ECOA 3M8FA 5J4VA 1V5FA 6PAXA 2UXNA 4CA0A 3CCST 5H2FC 1YWOA 1I81A 3RKQA 3PFSA 4BQAA 1NJIU 2DJQA 4G7ZF 3ZMZA 1XG1A 1QKXA 2EFPA 4KMFA 2KEAA 2BXYA 2V8JA 3VSLA 1MSEC 4XLPF 1CGPA 5D6XA 4QVDA 5EEHA 1JGGA 1DJ7B 1K76A 3CC7A 2L4AA 4KT6A 2R7QA 3ZP5A 2R7OA 3CUQA 1H0MA 1JJ6C 2CH4W 1J5YA 2IAIA 2LP0A 3HTSB 2JRMA 2HDDA 1OLTA 1Z7LA 2JQ7A 3CJTB 2BZTA 4LUDA 3K2ZA 4RTYA 8ATCB 4M7DA 2DL8A 3HOYJ 1FSEA 3JCMV 1TWCJ 3ROUA 3K4NA 3OS1A 3O6BB 2CT3A 1NPPA 5CK9A 4IHTA 4MDWA 3OR1C 4CO8A 3SHWA 2W4SA 3DQVC 4YIRX 1JJ2P 4DZPA 2QDLA 2EQMA 1QRYA 5D4SA 2DIQA 4Z88A 4F92B 4FCYA 3EG1A 4W1UA 3CCMQ 2GIZA 1FMWA 1W5CC 2PMHA 2TCTA 1W36D 3RZOJ 1TUDA 2QGFB 3E2UA 3UWNA 1Y6IA 5E1XA 2LD5A 3Q9VA 1OULA 4C3JJ 1FT9A 5GTHC 2EZIA 2XB0X 3DEEA 1GXIE 4QKUA 3CD6T 3L2CA 4IOAF 1EH6A 3MZ8A 3SHFA 2IRFG 1B34A 3C18A 2GM4A 2NS8A 1I5OB 1UGSB 3FIWA 4HVVA 4A63B 3JRIA 4J7IA 3OBYA 1YJNQ 4KUMA 4NS5A 4M3GA 2BW3B 4M6YA 4E7IA 2ZFWA 4HKEA 2D45A 3IH4A 1V55H 2R7SA 4N4IA 2VBZA 2E7XA 3ME9A 3RESA 2IS6A 1ETQA 3FMQA 4A5MA 4CYDA 1SVLA 1SEUA 3W3CA 1PDNC 1Q81C 2KL4A 3OV8A 3WTWC 1RAGB 2BZXA 4MZMA 9ATCB 3TU4K 2FXAA 1O57A 2ROTA 4BBRJ 4XSZF 2CQXA 3VS0A 5GANf 2IA2A 2NVUB 4BU2A 2A37A 4A12A 1N9SA 2PUOB 4R79A 4ESJA 4F3QA 2AKLA 1MBEA 3LGLA 1KC8R 3DBHB 2YUPA 4IZZA 1ETYA 1MBHA 2DX1A 2PG4A 4LD9K 2ZXIA 3TOAA 2DT5A 3OBWA 1KU2A 3BTLA 4JZ3A 4MGRA 5L3DA 3I0TA 3BCBA 1H9TA 2W0ZA 3JCMQ 2H6CA 1VI0A 4BQNA 2F4OB 3CMAQ 3HGGA 1F5TA 2DVJA 1QP3A 2QG9B 2RNAA 4J9GA 5HY6A 2M0YA 4D8KA 1M1KR 2L9VA 1EH8A 1FSHA 2XMFA 3M4GA 1F1BB 1FIAA 2HQRA 2MLGA 1KQSP 4CHUA 1I1GA 4IOCF 3S15J 1QVFP 2VKVA 1X6OA 1TWBA 4RGUA 2YSRA 2PVDB 3JCMh 3UA7A 4WWCA 4AFQC 4EVIA 2J7IA 1VQPA 5A2QZ 1WJDA 5LLQA 2GA1A 1XOVA 1RI7A 2HBPA 1X3UA 3IV5A 2FU4A 4A54A 1Z3YA 3GMEA 1OJLA 4AIJA 5CKBA 5GANe 1ZLJA 3P9KA 5BNGA 3S1QJ 3EFRA 2XAFA 4I09A 2GTJA 4XTVA 3Q0WA 3REAB 4GFBA 3H41A 2QF7A 4PDKA 4KITB 5K5QA 3QPHA 2DBBA 3CCVI 4FSSA 2IW5A 4IXAA 4PLIA 4W97A 5KYWA 2FRHA 1HKTA 5J3LA 1Y39A 2JXBA 5F0CA 3DCFA 2ABLA 1MW7A 4XM3A 3K4MA 5I2SA 3CUOA 4V2FA 3DB4A 3VUZA 1YJWT 2CJJA 1PD1A 2EKOA 4RM3A 4EMSA 5FLXK 2O4XA 1Z21A 3BR0A 3H3VK 2A07F 3CCLA 3CCMT 2XIGA 1QCNA 1KQSS 3HOXJ 4MZTA 5TGTA 3ZQQA 2ZNYA 3F8MA 2FZCB 3BG3A 4J19A 1X2MA 2BHZA 2CUDA 2O7OA 2XROA 2EJFA 3L42A 4KBMB 1SMTA 2CREA 2XAUA 2GXAA 2R7DA 2NNNA 5K1YA 3IL2A 3ERED 4L59A 5GMKh 5LHIA 1XGMA 3OIOA 4RB0A 3HOSA 2LTOA 4PFZA 3OSVA 2HQNA 2RHUA 2WAFA 2E1OA 3BG6A 1HW1A 3LWFA 4DOWA 1H8KA 1X4PA 4A2UA 3QKJA 1K1ZA 4UV9A 2EYYA 1VQ9T 1FP2A 3E6MA 1IXCA 4ZYHA 2ACJA 3BPXA 2DPPB 2EGAA 4A4EA 1BL0A 3AL0C 1ERDA 3P8HA 1X2NA 3IKVA 1XPXA 4A3IJ 2XF7A 5LJ3h 1T6SA 2RQQA 4HX4A 2E36A 1PYVA 3A1YA 2XPWA 5FROA 3GLLA 2EW3A 2DL4A 2FPFA 3WODF 1ZGJA 1EFNA 2CYZB 5JVTA 3JCMb 1VQPI 2M87A 1LE8A 5IHNA 1G3TA 1XGOA 3CQZJ 3T8TA 2MD0A 2LKXA 1KJWA 4C8QG 1L3LA 1Q7YU 4NC7A 5LJ5d 4AYBA 2K57A 4C2MJ 3AHUA 2CP0A 2F2WA 4XU0A 1Y57A 4IL6C 4OMFB 5F0HA 1Y1VJ 1MBJA 5HNHA 5BPDA 1UB9A 4GRIA 5D6FA 1Y8QB 4PJOA 5ECAA 3FKIJ 2AT1B 1WZOA 2E3IA 1T38A 1G59A 3MEUA 3HP9A 4F7UG 1GV2A 1DP3A 4UVAA 2DDAA 1CF7A 4BI8B 3GPLA 1X3WB 4DZJA 1JBMA 1QVUA 5IN1A 2DTRA 3KE2A 4II2A 4WX9A 4RBOA 3T8RA 1IO2A 1ZLMA 2LJ3A 1LNXA 5L8RE 1MGQA 2OAUA 1OFCX 1N5ZA 4E7KA 1YJWA 1KONA 4KDPA 1VQLA 5F1RA 3HPHA 1QNTA 3D5LA 1QVTA 2W48A 2LOOA 1TNSA 1H641 2IXSA 1X2KA 3VODA 3JCMc 1LJOA 4JX6A 3E0JB 4ZYAA 3IWFA 4L9VA 1B59A 1MDMA 1APLC 1ZX6A 2GIVA 2YLBA 3QHSA 2YDLA 2HYJA 3K1MA 3H5AA 4U0WA 1E6HA 1YI2A 2XAHA 2F5DA 2DFEA 5LRSA 1PC0A 2FO0A 2CGHA 2ZPGB 3A1PA 3FXUA 4I76A 5F08A 4CSWA 1RRJA 1Y96A 2VBXA 3CDLA 3NTHA 1Q81U 2HVRA 4I0AA 3HOVJ 1UMQA 3ZCOA 1IZ1A 5KYWB 2LYCA 5EGOA 5BOXA 4CZZA 1ZKGA 5D6EA 4HSRA 3BJ6A 4U7DA 1QO0D 1U5TC 2P0QA 2M2EA 1U2WA 2CH4A 1FPQA 2B7EA 3CDHA 2AKKA 3JR9A 3PUBA 2IT0A 2E70A 2HAXA 3DKYA 5J39A 5CVUA 3SZPA 4EJUA 3CMEI 1IHWA 3DP7A 1R8OB 5M9OA 1TWHJ 2QEXI 2CYYA 1OU9A 2QYZA 2HVSA 3ASOH 3CLQA 2NRAC 3J7AW 2CWEA 2JOYA 3TCJA 4C92B 4EMKC 2K9NA 2LNHB 2JTEA 1OPLA 1YITT 3CC2T 1K4SA 4E7SA 4D5FA 4GY5A 1IV8A 2ESNA 3K1PA 4PJ0C 2BYVE 5EZGA 2EQIA 1IXRC 3GTGJ 1XX5A 2R58A 1GV5A 1Z3XA 3SDBA 3A01A 2K2VA 5D6WA 4F7UF 2X4WA 4XLAA 5ILUA 2EFIA 1ZRDA 3TO9A 1S6LA 1SVMA 2FZGB 2IBDA 1EJ9A 3DPUA 2KQWA 2JZ2A 2RJDA 5KYUB 3TO7A 3MWMA 5D5WB 1EH7A 3KETA 2M1HA 2QTVA 3VSKA 3H6ZA 1FBSA 2XPUA 4HVUA 1GVJA 3U23A 3V42A 2B86A 4ELZC 4O5VA 5GPCA 2ELJA 5FD5A 2CUFA 3LA7A 1AU7A 2KNBB 2E1MB 1D5YA 2HBWA 2PNIA 1ZA2B 3UATA 2MC4A 4M78C 4P55A 2HNHA 3GXOA 2CSOA 5C4JJ 3J81E 5E17F 4C0ZA 1LFBA 1HQCA 4BS9A 2HI3A 1O4XA 2AHJB 5FLXE 3I9V2 1T39A 3RQ4A 4ZYDA 2WAQN 5A2QK 3CXCA 1VZ0A 1R1UA 2LF8A 2QUFA 2FBKA 5FJ8J 3PJRA 3I5SA 3E7LA 2BVMA 2I5UA 2R57A 2RDPA 1ACMB 3EFOB 3OY9A 2BW3A 3CESA 1D5VA 4H0EA 1HDDC 1UGRB 2BE9B 1SD4A 3PGGA 1WGXA 1Z1DA 2E2IJ 5LJ5f 3K2AA 2OTLA 2ATCB 1XS9A 3MD2A 2E34A 1B34B 4NC8A 2ZCWA 3NAUA 1OI1A 3M56A 2MW8A 1CKBA 2WY7Q 1ZG5A 1AWJA 2ZCFB 3CCRI 2PFBA 4JBAA 3OS2A 2LJ1A 2PUKB 2FRYA 4HT9A 2E60A 1TBXA 1LDKB 3IC7A 3QQAA 2XDPA 2I2LA 2IVMA 1C0MA 1NG6A 1HC8A 1M30A 3MEAA 4RGXA 3I4MJ 3PVQA 1UAAA 1BC7C 1I5LA 2P6TA 1B07A 1ACIA 2R7VA 4FX4A 3PO2J 3OIQA 1TW2A 3COAC 1XTDA 2DA9A 4YRVA 2DYRH 4HZFA 4A69C 3H0GJ 1AWXA 2LJ0A 2DQRA 4LDUA 2OI3A 1NH3A 2DO3A 4J9FA 3SEZA 4OOIA 2CP3A 3CD6I 2NUPB 1X4OA 3BLYA 1RL2A 1UFMA 1UGVA 2L3QA 1K8AR 3S2HJ 1WX6A 2FQ3A 1ZGAA 2IGOA 5BPIA 1KD1C 1KQSA 1W1WE 1LQ1A 5GAHJ 1B9MA 2E71A 5E3MA 2MAMA 1VQ5A 4FT4A 2HTJA 1BW5A 1FLIA 1JQQA 2G7HA 4M7AE 2FVUA 3M1EA 3QP6A 2VUMJ 3T0YA 3FF5A 3K6GA 1TT0A 2D0NA 4LIVA 3LOCA 2ELHA 4N4HA 1IG7A 1WHLA 2JK3A 3HKZA 3GFJA 1SMYF 2VC0A 3G73A 2RA2A 4U0YA 1XSDA 2RC4A 5C3EJ 2LDUA 3IH3A 4K2EA 1WH7A 1K4US 2XF6A 1B9NA 2KIFA 2CZ0B 2IEKA 4IHYA 4FYYB 2HZDA 2KIUA 4L9JA 2OJ2A 3M0SA 4IJAA 3GFIA 1WI7A 2Z5UA 3QDRB 4UY8I 2KBTA 1JUPA 3I55A 1PHTA 4ELYC 3OYLA 3CCUQ 1I27A 1WJBA 4DYRA 3WU0A 1X6BA 3EHRA 2HKOA 1MV0B 2XSJC 1YFNA 2HNIA 2DOAA 4XKCA 1O3TA 1VYTA 3GWZA 5F1JA 2EQJA 1GXPA 2VGMA 1BI1A 1N8RR 3PIPF 3GFMA 2GZWA 2YUNA 4EM1A 1V1CA 4HNUA 5FWCA 2QBYB 1X3ZB 3V7CA 4QPQA 2VOOA 2D0QB 4RA2A 1OZ3A 1NG7A 2A3LA 2K3FA 3PMIA 3URGA 2LK2A 1Z0XA 1ZRCA 4CH7A 3R0JA 3R6OA 5ICFA 2OX7A 3WTSC 3G71T 1SVOA 3GNFB 3S2DJ 2HQ5A 2LTPA 3M9AA 1Z67A 2WADA 5FRMA 5GANh 1VQKI 4UHTA 2DZCA 3I55Q 2BV6A 4XRSG 5FLXZ 5IYDJ 2K3XA 5K7ZA 3LSTA 4DBFA 4RCCA 2ELKA 3KEOA 1YI2Q 5KYUA 3I9QA 3QWYA 2FE3A 3I4PA 4A93J 4F16A 1Q7YR 2X35A 2EKHA 2O8XA 3ZQFA 2MG4A 3RKWA 4C3HJ 3EGXA 2O88A 1M1EB 4A3BJ 1U06A 2NUTA 3HOUJ 1WJEA 4CCOA 1NLOC 3TKYA 4M77E 2W24A 1QVFA 1ZA1B 3MMYB 2KZGA 3META 1TQIA 3VS6A 2NOGA 2CRGA 1VQ7A 2EJ9A 3SWNC 3OMGA 1K6OA 2JMWA 2VKNA 3RBBB 3JTHA 1AWOA 1EKEA 2XGDA 3FK7A 1WWXA 5F64A 5D5VB 2LCLA 2NNYA 3GP8A 4XSXF 1QHHD 2M1BA 4CC7A 4EMKB 5KYNA 1SRLA 4C92A 2ZPEB 1VQMI 3CC4Q 3O2PE 2CKKA 4ZGDB 4C8QE 3QBYA 2HL5C 4HRIA 3BG7A 3BJAA 1P9QC 1TOVA 3A5ZB 4KGXB 3UDCA 5ICCA 2GF7A 1ZG3A 3HOWJ 1PKTA 2IA1A 3KXTA 2CP5A 1B8IB 2MD5A 4MEYF 1WHHA 3CUQC 5EEAA 1KG1A 3N05A 2EIFA 2VGNA 3QG1A 1W2BS 3CLOA 2DU9A 1Q81R 5CVJA 5CKFA 5LJ5j 2K3PA 4XNFA 1R1TA 2KDOA 4JPBW 5LHHA 1NEGA 4LD6A 1CF7B 4XRSA 3W6KB 3SJMA 1ZR4A 3S14J 4M77F 1R1VA 4Y33A 4DGWB 4OGEA 1K8AC 2OTJQ 4ITVA 2P0TA 4XORA 4BD3A 4KICA 2L8DA 3CXCP 5FU6C 3CCVQ 1MDMB 1VQ7T 4QW2A 5B5EC 1S29A 1R00A 1PP7U 3ZQGA 1D8JA 4JP0A 1JB0E 1YI2T 1YW7A 1M5Q1 5HLGA 3LL7A 2ZSIB 3JCMP 2NYXA 2ZXJA 2R7UA 4BQQA 1JUMA 4GXOA 2DA3A 5E1ZB 3ZMSA 3OSFA 2ID6A 1KQ8A 4CC2A 1WSUA 2DRMA 5C0MA 3AFHA 3SFZA 2B9SA 1PWTA 2F5TX 4IUQA 4XK8E 5DUKA 2O6GE 2OCEA 2KI7A 3ZPLA 1E2XA 1N25A 2D1HA 2DMTA 2L7MP 3ZEHA 4BUPA 4HSTA 5LD2C 3S16J 3DU6A 2ZMEB 4RTTA 4AIKA 1WVRA 2ZJPF 3CC7I 3F8FA 4C3IJ 1VYUA 2COWA 4EMHA 1VQMA 2DT6A 2HEQA 4AFSC 4NNJA 3SWNA 3F22A 2Y2ZA 1EIFA 3FBNB 3E9FA 1YS7A 1HXDA 1QZEA 3NWSA 4HG2A 3GTLJ 3RERA 3NGPA 3CJNA 2EYXA 4RAZA 1Z77A 4BYYA 4N0AA 4FSXA 2Y90A 2RQVA 3X26B 3I55I 4F91B 2L7ZA 1TWGJ 4OB0B 4PGHA 1ON1A 3G1MA 1X75C 3GF2A 3HRUA 1QHGA 4JS5A 3RPUA 4A3KJ 4NQWA 5M3FJ 2QAZA 1GBRA 1LEAA 2ECCA 2UV1A 1QCFA 4IUUA 2KR3A 2X4HA 2RJFA 5TISC 1RIOH 1FOKA 1QWEA 2FEZA 5GAN5 2QQ9A 1TUCA 4D7NA 5IHKA 2K85A 1EX4A 3ZFJA 1RNLA 2VQGA 1BCOA 1GL5A 1XJWB 3TQNA 1ETOA 2FNPA 3SXYA 4XRFA 5JLWA 1IZ6A 2H1LA 5CKTA 2I0NA 1Z9QA 2QTXA 3FB9A 2EV5A 1YJNI 3VYGA 3LFUA 5JI6A 4ENJA 2NUZA 3ML6A 3F8BA 1M8MA 3CCUI 2MPXC 5LJ5e 2BKDN 4EJWA 2NVTJ 1HJDA 4J6YA 3C7JA 3FXOA 1I0CA 1RAAB 3ABLH 1SEMA 2EVRA 2IGKA 4L6V5 4C92F 5LRRA 2RJEA 1OCRH 1H88C 5GAOl 5FD6A 3WHCA 4GLMA 4A4KA 1JE8A 1PSEA 1YP5A 1RR7A 3DKMA 4LDYA 2M9HA 2P0PA 2R7ZJ 2XKOA 2ED0A 5C6SA 1VUBA 2X3WD 5CIUA 1UG0A 2GOXB 3CJRB 2YUSA 2OZUA 3MHXA 4BE2A 2HDAA 3ABUA 3A4CA 3P8BB 2OA4A 1AWCA 5ILVA 3BY7A 2DERA 3KFWX 4OAYA 1Y8RB 1Y71A 4HCZA 1T95A 2VKDA 3JAME 2XGEA 3M4OJ 1TC3C 1M1GA 5KNLA 1MNEA 4DIQA 3WU1B 4BHPA 4MO7A 5I21A 3LSHA 2NXNB 3E3VA 2GXBA 4X0GA 4C8QA 2HOTA 2GBYA 2M7BA 3M7GA 5LBQA 4RB1A 2VODA 2BY3A 2HKNA 1W5SA 2AZSA 1W4SA 4Y92A 3S1MJ 3DLLA 3QSUA 2KQRA 2E1HA 4C92E 1YIJQ 1T3LA 4J00A 3L00A 2LCSA 2DYSH 2Z0WA 3I56T 2DA6A 1YCSB 1K9MU 4HCBA 4ZC3A 2DMNA 4QLCU 1IUYA 3A03A 3J80K 3H0IA 4DEYA 5LJ3g 2L3PA 1IRGA 3TP0A 5D6YA 4Y3OA 4EV0A 1LEBA 3K0LA 4AG1C 5IXBA 4BXFA 4Y7NJ 2HTSA 3HG9A 3O3KA 3A8OB 1S7AA 1J3TA 1S72Q 2DE0X 1CSKA 1Z91A 2W7NA 1FYMA 2FEIA 2CQKA 3H5NA 2Z99A 1X6GA 3CCVT 4EMGA 1VQ7Q 1YJ9Q 1Z9ZA 1J59A 1Q1VA 2XAQA 3NTKA 3CCRA 1H3HA 2HKXA 3VJPA 4L9NA 2A5WA 9ANTA 2XB5A 1T0JA 2M02A 2QI2A 4M7DE 2EGEA 3QWLA 4L5IA 3L1AA 2M0OA 3WTXC 4U7BA 2BE5F 2D6FA 2R3SA 3SQNA 4JJNK 2DLLA 3KYLA 3J81Z 2EV0A 3QYGB 3BROA 1USSA 4N0BA 1YRNB 1U9OA 5CKDA 2QEXA 1OYYA 3DLAA 1FC3A 3F6VA 4WK8F 2E10A 2FZKB 4HCKA 4JOMA 4NQWB 3HKZN 1USTA 4B9XA 3CCLQ 1LFPA 4E47A 1IGNA 1SSFA 3GNGA 4HQMA 5HODA 3E19A 4PGGA 2EIMH 3TSZA 4LLLA 1S8NA 3VYUB 4A3MJ 2C0IA 5J1RA 3G1LA 1QPIA 3KIOA 3U1KA 3CMAI 3CO7C 5M5WJ 3D7SB 4HYEA 4RG2A 2F5FA 4UVBA 2ZXHA 3H9GA 4EQQA 4MMLA 3E5QA 4PNOA 3PFYA 2V1RA 5EJCA 1FYNA 2JS0A 1ARKA 3RQIA 3A8HB 1S5LC 3CBPA 1R49A 4FYWB 4P5NA 4CZCA 4DBRA 2X6YA 1BCMA 4FISA 2H1KA 3ASNH 3MFKA 1Y07A 1WH5A 5GAOm 1KD1U 1MKMA 3M0UA 2E1CA 3CTAA 3OW2S 2EK5A 2DODA 2PBIA 2W10A 3P8DA 1EA3A 1M1FA 1YJWI 1S72A 2XUBA 4B3XA 3CCQI 4M7DB 2KRSA 2HYFA 3HGYA 4LK1F 3JCMX 2DIGA 1MIJA 4J5YA 2DFIA 3TO6A 3GTPJ 3EGDB 4IIOA 2F5KA 3A52A 2BE7D 5GMKl 2YRVA 2LVSA 1B3QA 1MJAA 1PKSA 1V5EA 3ULRB 2CUZA 3JRCA 4LGWA 4JJCA 1I1JA 4BE0A 1DGWY 2DJNA 2M34A 4I98B 4MLOA 3UR3C 3PNWC 2JZYA 4JLIA 3DEWA 1ON2A 1FIPA 4PJMA 3JTGA 3PO3J 5FLXR 3FDRA 4DOVA 4HF1A 1S3JA 4EMKA 1VQNQ 2WSFE 2D1XA 1M9SA 2HL3A 1OR7C 1WJFA 2VQHA 2VXDA 2P8TA 3AKZA 5DY9A 1KK7A 1OX9A 5DEQA 4BDYA 2RD1A 4OVAA 5GANj 2BGCA 4U87A 1N78A 1YCYA 3NQOA 1B8IA 4ME7A 1BK2A 2AS5F 3HJEA 2AZVA 3M8EA 3CCSA 1ZSZB 4IHVA 1ZQ3P 2VC1A 5DDGA 1XC5A 3M5AA 3LH0A 3P7NA 4ZN3A 5J1UA 2YRDA 4M3EA 3EETA 4AIHA 5L3CA 2IS1A 4Y52J 4B48A 1W2BA 1ZYRF 3KP7A 3FDYA 5M5YJ 3JAMR 2HSEB 5GAOn 1GRIA 1IRZA 3BFMA 3L2ZA 4KUDK 2X9DA 2KMTA 2KJCA 3LWHA 3MP6A 5GAMe 2QQBA 4RMNA 3WE3A 3M07A 1H92A 3ELKA 1S7EA 1XN7A 2EAYA 4J9IA 4XTUA 3QU6A 3OYKA 2MYSA 3KYCB 3I56I 4M78A 5HLTA 5LGTA 4BNCA 4GYIA 1WIEA 1K83J 2DEQA 3K69A 3FM5A 1SPKA 2YHTA 3LQRA 3FXLA 4HF0A 2G0EA 3WE2A 2L9SA 2RNGA 3NEUA 4P5OA 4JYKA 2LKSA 1R4MB 3DTKA 5EYRA 4YFKF 3PIOF 2RHIA 3JCMf 3CCJA 1G2HA 2KDZA 2M30A 3BW1A 1ZLKA 2KYBA 3KP4A 4FIBA 4PUSA 3LX7A 2FSWA 4M6VA 4XLCA 1ZSZA 3U2RA 1ZREA 2LT4A 3H0HA 1NZ9A 1REPC 1BBZA 1NHAA 2LKPA 5K7FA 1ETVA 5CO7A 5LJ5h 4M7DG 2MGQA 3SB2A 1HSQA 2HQXA 3BZ6A 3QPTA 3WTVC 4PFOA 1WDXA 2RQRA 2XK0A 3NTIA 4AC0A 3TREA 2VT2A 3CBMA 3LAPA 4HDUA 2CUJA 3VOEA 4LNPA 2CP6A 4ZDLA 1Y1WJ 3WXMB 3CCET 3BQZA 2E5QA 4M78F 2OCCH 4OU0A 2B8AA 2J06A 2M8GX 4XIDA 1YIJA 1IDZA 2IJLA 2VQLA 3W6JB 1E17A 4G6QA 4JX5A 2XRLA 1TL8A 5CKHA 1R4NB 1XCVA 4E7ZA 3HUGB 1WNLA 4Z02A 1EF4A 4LK0F 2DZ9A 1O7LA 5IT9K 2HR3A 2CH0A 1MBKA 1JUSA 2FOWA 2MIOA 2MSYA 2PX9A 1U3EM 2X98A 5GMKj 2H8WA 3GZ6A 2V9KA 3VS1A 3OW2P 2Y0SN 4OB2B 4A6DA 5A0LA 1ODDA 3V7SA 4FT2A 4P9UA 2NVYJ 3QODA 2A6TA 2MWPA 3FLGA 3I35A 3EUAA 4A5NA 5LJ3f 4XK4A 5GAMh 3JRGA 3C2GA 2CQNA 1LDDA 3OMYA 4M75F 5LEJA 2LDMA 4LOCA 2V9PA 3GCMA 1KYWA 2PJRA 2KAFA 3LSJA 3C4SA 2KIMA 3H9QA 1XMAA 2HMAA 1VQ4A 1OMIA 4QTRA 4BQOA 2KIQA 4CXFA 3A8LB 1JJ2A 2GNCA 4IRHA 3B6CA 4HX7A 4IUVA 4HLYA 4AG2C 4Y13A 1VQNA 3NHNA 3L2QA 1G8XA 1FBUA 3DKWA 3WTTC 1IC8A 2EPDA 2LG4A 2STWA 2DVEA 2K5FA 2DXBA 4RCBA 1IN4A 2L54A 1D8KA 1DPUA 1WHGA 3EGUA 1FJLA 2MH2A 2R5AA 1NJIR 4HDVA 1VQPT 4L5EA 1SD6A 4F7UE 2JVGA 5L3FA 1V54H 2CQQA 2VJJA 2EINH 2L9NA 3KPHA 3MQ0A 2WAEA 4RLQA 1YRNA 1MBGA 1W7PD 1UG1A 2JS2A 3MAJA 3D1NI 2K3YA 3BR1A 4MFEA 1KA8A 4IKFA 3RR6A 1VQ8A 2A6EF 4C8QC 5GMKi 3QZ9B 5FKKA 2CSQA 5M3MJ 1TU0B 3B6AA 1KQ1A 2LC4A 3M0RA 4CCKA 3J7AY 2KMUA 2OUMA 1IN7A 5BQTA 1WA7A 4EM0B 1Y7XA 2V1NA 3BP8A 5ED4A 1PRMC 1FMVA 3DLMA 3I5RA 2VE8A 3O8VA 2KYMA 2RPNA 3BZKA 4F7UA 4DYCA 2V9VA 1ENHA 4KJZA 2WV0A 4E70A 3RI4A 3HSBA 1IAWA 2FMLA 3FZVA 3JB9D 4DYQA 1RZ4A 3UNGC 4CUGA 2P84A 4OMQA 1SF9A 1JT6A 1B4AA 3DBRB 4J9HA 4IQJA 3H9JA 4A3DJ 2W57A 3EFSA 2PVGB 1IF1A 2F5CA 4I2OA 4WXDA 1W4MA 4UC4A 5FLVA 3PVLA 2DFHA 3CCJQ 2K86A 3A0HC 2XG8D 4A3EJ 2ENMA 3JRDA 2ZPHB 2BTTA 3FIFA 3OYIA 3HC7A 2L7FP 1RADB 1C0WA 2EPFA 3RZDJ 4OB3B 4C92G 3U9GA 1BA5A 4ESFA 4M7DD 4AMCA 3MEVA 2F6CA 4M6XA 3CCMI 3ZMDA 2GQQA 5F04A 2NVXJ 3MO8A 1U1TA 2ZPBB 3VS2A 2K40A 3L1PA 3HDDA 1U8RA 1M27C 2PTKA 3EH1A 3GEZA 1RI0A 4M73A 2V1QA 4A0ZA 3OYHA 4PSWA 5GP9A 2CV1A 4M3BA 1PSFA 1YTYA 2C0TA 1JTYA 2FB7A 4QSHA 4J9CA 5LEKA 4X1VA 3S3MA 2GLOA 1UELB 1RLPC 3RMSA 1YO5C 3HXLA 2GBQA 4QWQA 2CSIA 2DA2A 2Q8KA 5GMKm 3CD6Q 2J5PA 1D1AA 3KP5A 1J2XA 1SFXA 3F6OA 1C1AA 4OMLA 3HL2A 3ZBDA 3S17J 1GHCA 1FMKA 2VI6A 2HXIA 2FD5A 1WFWA 4IURA 3OYCA 5HCKA 2DEUA 3JREA 2SRCA 3QYEA 2HZTA 5EDNA 4R0KA 1VYVA 2LQWA 4XICA 2MUNA 2L2OA 2C6YA 2B63J 1SC7A 1HKQA 3S1NJ 1G3SA 2COYA 4PKCC 1BKBA 2P6SA 1F36A 3WTZA 2L7KA 2K2MA 1IUFA 3I64A 2HPMA 2G9WA 5IYBJ 2UXXA 3GTOJ 2OBPA 1HOMA 1EV7A 1YLFA 4QIWN 5FW9A 2OTJT 3F72A 4RAFA 1Z6RA 3TGNA 2E64A 3D5SC 1D0XA 2RM4A 5IP6A 1X01A 2QDYB 4FHTA 4XMYA 1MD0A 1WI3A 5HDNA 3GTKJ 3CPWA 3IUOA 4AT1B 2EYZA 3MP1A 4KA4A 1T56A 4R8HA 3QJ6A 4LLNA 4JJBA 4LE9A 3VS5A 1TXQA 4G7OF 5FB2A 3G6EI 3H92A 3HHGA 1W70A 1PP8F 1G2BA 1FNNA 2OAZA 5J6XA 4IX7A 2DA7A 3LFKA 4XR6A 5J8CA 2ZJ2A 1GXQA 2JA6J 4EATA 1TSFA 3C94A 3X20B 1X27A 3T1BA 3ESWB 5GAMd 5E3LA 2FRWA 1I3QJ 1JXMA 4P9FA 5D5XB 2E5KA 2QZ8A 1GCPA 3NPFA 2RH2A 1ZAOA 4G6TB 2DYBA 1E3PA 1OR7A 4D7MA 2JA2A 2EGCA 2HOEA 3Q3SA 4L0ZB 2BY2A 1K73C 1BW6A 1J09A 3BTIA 1H8AC 1RQ6A 1VQ9A 3CMAT 4ATOA 3ZQLA 2E12A 2EYQA 1Q1HA 3BWGA 5JVGF 4I6ZA 5DD8A 3P9CA 1N9RA 4N4OB 3ZR8X 5EG2A 1R9TJ 1U0JA 3R6NA 4PJOB 3OMCA 3RYRA 4E4HA 2KISA 4I99C 2V6CA 1YWPA 1T0HA 5IPAA 3G4SI 1UZCA 2LC2A 3I5UA 4DW6A 1ZH5A 4TVRA 2O5RA 3MKWB 1CQTA 1H3ZA 1AHJB 3I71A 5K5OA 2VE9A 2OQRA 4RG8A 3PL8A 4XLEA 4Z2YA 2Z33A 2LMJA 1OCZH 1R71A 2K6DA 1V5GA 3NFCA 1WHUA 2HGCA 3I3LA 1WHKA 5CAIA 5GAOq 2E65A 5BS6A 2E2HJ 3I58A 1W36C 1GT0C 1VQMT 2LZ6B 4RDUA 1S7OA 2R7RA 1MV3A 2LX7A 4M77C 3ECHA 4RTWA 4Q48A 3PIPA 1ETXA 4KMUX 4MQVA 4HW0A 1I1SA 1E6GA 4I02A 2QEXQ 3RSNA 1G3WA 2VPLA 3QYBA 1A04A 3G6EA 3GLXA 4GLKA 4Z89A 5KYYA 2V8KA 1J7KA 1XTAA 3E5UA 5LJ3e 4PSXA 3LQQA 3CC2I 3WTYC 2VOPA 3SEMA 3DPLC 5FKNA 3BDUA 1JHFA 2Q0OA 2OTJA 1D1BA 5AIPA 4HX8A 1WQ2A 2KZVA 2R5YB 3ER0A 3KBGA 3QIIA 4X9CA 4C8QF 3ZN0A 1YX3A 2P5LC 2K02A 1VOMA 2ESHA 5GADJ 3Q1JA 1YHQT 4RTUA 4F55A 3PM1A 4OINF 5LL6S 2LVMA 2DTZA 2A5YB 1YJ9A 3E5XA 4J9BA 5CQEA 4CC4B 2Z1DA 5FFXA 1BOAA 2O0YA 3M0TA 3S1RJ 1VQ6I 1U6GA 3BCAA 2J6OA 4A0XA 4BY6B 5A2QE 6AT1B 1Q82R 3UT1A 1MBFA 1XSXA 1WXBA 3LSKA 3OS0A 3BR6A 2ROLA 2Y30A 3F3XA 1OQYA 5B1BH 3EG0A 1VQ6Q 4AVPA 2FBHA 4L9TA 4KGZB 3R0AA 2AQFA 2V8IA 2QA4T 1VQ5T 1IW7F 2R4GA 2K9GA 4LLGF 1DU6A 4JJDA 5DCMB 2DXUA 1KQ2A 2ZNZA 2RK1A 4QT7A 4ZYEA 3VV0A 1SRMA 2F5EA 1IN6A 2DA1A 4HA8A 1ZG1A 2MA3A 1WJ5A 2A28A 3SDGA 2E4HA 5CR2A 4F93B 3AT1B 1K9MC 1I6HJ 2HVQA 1OYXA 3MEWA 1DQUA 3QUIA 3K4KA 3LAJA 5GAN8 2CV2A 1HLVA 1F4KA 1YFHA 3OSSC 1BBYA 2DL7A 5LFAA 1PCXA 2OTLQ 1YIOA 2JVHA 4D0PA 2WA0A 1HF0A 4L5GA 1X1DA 1UDLA 1W5TA 2JMCA 4C2UA 1BM9A 1UHCA 4NOYA 3S6WA 3CCRT 1FOWA 4C5GA 3SDZA 3BQYA 1IGQA 2V79A 3K1NA 2XASA 3FM3A 3FJ5A 4XLHA 2EFNA 5JHFA 1HYOA 5F27A 4NB5A 2EZKA 1SANA 3I59A 5J3BA 4CGZA 2COZA 1BR2A 3G4SQ 3F9KA 2L3DA 1NM7A 1FOYA 2EILH 2R92J 4IO9F 3G6ET 4HCCA 3MKDA 1ONVA 2H3JA 3EAEA 1R22A 3AG2H 4FASD 4RGRA 1SSHA 2VQCA 4WCGA 1VQ9Q 1NTCA 2VKEA 5AYFA 2E6NA 2BXZA 3TDUC 2VWFA 4XKWA 2YSQA 1IV6A 1ETWA 3ASKA 1EZZB 4JDSA 2K4BA 1DUXC 4F04B 2KRHA 4S0HB 4PL6A 1SHGA 1M1KC 3BJOA 4IRIA 8AT1B 3J7AO 2WB1N 5J8FA 1JXSA 1D09B 1YN8A 4K11A 1L0OC 3NMZC 4FU6A 3LYIA 1PNJA 3G3ZA 3VS3A 4JQFA 2M4KA 3C0CA 4MTEA 4GDFA 3GTJJ 1O7FA 3LW5E 3X25B 2HEOA 1XCBA 5C4XJ 1K0SA 1VQ7I 1WJAA 2DAQA 1IREB 4XQ3A 3JB9F 1MJ9A 4N9HA 5IYCJ 4QQGA 4CCJA 2M0MA 2DPDA 4PJOG 1JJ2S 1I4K1 1VQLI 4EJTA 1X58A 2ZMEC 5L3GA 4UUVA 5CLSA 2E1MC 2CMPA 2M0CA 1ZUUA 5GJVB 4NUBA 1TT5B 5IT3A 2DLPA 4XL9A 2E2JJ 4O3MA 2P5KA 4II3A 5FFZA 1I6XA 3DWLE 2HU9A 3GTMJ 2O61A 4C0DB 3I56Q 2HQEA 1GUUA 4X34A 1M90R 1VQKA 2PQWA 3PSIA 3HHTB 2PJRB 4AU7A 4M75B 1GBQA 3DTIA 1PUEE 3W2VA 2XGXA 5CQYA 1Q7YC 5HVQC 2HOAA 3E97A 3HFOA 5FU6B 1BYMA 2OZ6A 1Q95G 3EG2A 1R7JA 3KFVA 1PJRA 4BKXA 2DPUA 1X19A 3AG4H 3T9NA 4Y15A 4M4ZA 3LLRA 2DETA 2FOKA 1I39A 5CPRB 3I4NJ 2GA2A 4DNCA 3ZGKA 3D5RC 2CZ7B 5KK1A 3MN2A 4IRGA 2DTHA 1YITI 2LF7A 4J9EA 3OR2C 2DK3A 3I53A 1KU7A 4S05A 2K3BA 2DMUA 2DM1A 1ZR2A 2DFUA 3EFOA 1IGUA 3BY6A 2DXIA 2P4WA 1SFUA 1VQNI 4ZGEB 4HAMA 2JUGA 2JJ9A 1UEBA 2RNJA 1OEBA 4WXCA 1NK3P 1M2VA 4JRPA 4UVCA 4EGYA 2IG0A 2P0KA 2YXYA 1Y0MA 4ZDOA 1VF9A 2L0AA 2EIJH 3K4BA 2ZPFB 1E3HA 2BY1A 1MNDA 1KQ9A 3OYBA 3IH2A 2RK2A 1KYZA 2DK8A 5J40A 4PJNA 3HHHA 2KFDA 3QU3A 4WCIA 5FKLA 1WZ2A 2D8HA 3CCJI 1SD7A 1M3CA 2QXFA 2P81A 5AT1B 4ETSA 5GAMf 4V19K 2DDBA 5HKCA 4D5CA 1A5JA 4GBQA 4HNTA 4M77B 2P0WA 4ESRA 3LWIA 4I0BA 2D2WA 3SZGA 5LJ5g 1Q82U 1YJWQ 1IO6A 5JHUA 4C9YA 5HS8A 3FHZA 2MF2A 4LDXA 4OGCA 3OW2A 1U78A 2RI2A 2HDWA 2DD4A 3MVPA 4QVCA 2RGVA 3O8HA 4XTXA 2K9QA 2A3SA 2O9SA 2FJ1A 1FWZA 4FQGA 5KCHA 5F6FA 1HA8A 1B7TA 1Y0UA 5KVRA 1NYGA 2PN6A 4CRIA 2DMQA 2VXEA 2JSCA 2RAEA 2X6XA 1A6IA 1IXSB 2DL5A 2QQSA 5IHIA 3A01B 3SFIA 1VQOA 1A35A 1NPRA 2LQNA 3OQ5A 2Y75A 1OCPA 2CFXA 4OB1B 1YHQI 3K70D 3TL4X 1R23A 3HRTA 2GAUA 4PCQA 1T0FA 4D9JA 1CKAA 4KGVB 2XF5A 1W2BP 4VUBA 5B3SH 2JT1A 3F21A 2GWRA 1VQNT 4ZTJA 2K7AA 3THKA 1YX5A 4V2GA 4XQFA 4E2FB 5E8IA 3INZA 1JGSA 4KFCA 2RB6A 5IP9J 1OU8A 1VQ4T 1KHIA 2X1DA 4R55A 2JJ7A 3G1OA 2XAGA 4YIFA 3ERMA 3HPWA 3MZYA 5D8KB 4GGGA 1ORKA 4M75C 2MCNA 4NL3A 3M57A 1Q86C 1TH7A 2YUOA 1P2FA 2YWWA 3HOZJ 2QEXT 2ZFUA 2KRFA 1LOJA 2WY8Q 4FE7A 1Y96B 1JHHA 2M7AA 3X2QH 1LB2A 2M35A 2QGGA 3VYHB 4Y91A 1C6VX 1KC8U 4RM2A 1HSJA 3GX4X 4BY1J 1XSVA 2L01A 2K5IA 4G12A 4PJOC 4BEHA 3EG9A 2M8EA 2EJRA 2H94A 4X1EA 2ZAEA 1RESA 4OMZA 1W6XA 3IWZA 1G3YA 1ZN2A 2WC2A 3K4CA 1W7PA 3LNQA 3V8JA 1S72I 4IUPA 1B72B 3UPUA 4M77A 3C2HA 1U5TB 3OYMA 2M5WA 4GCVA 1QWFA 1RAFB 4RAGA 2GFUA 2JW4A 2XPVA 3U1DA 3KLOA 5EZHA 1RAIB 1UE9A 4M78G 5KCMA 3BR2A 2XV4S 2Y4YA 4IEJA 4M9XA 1XGNA 3WVEB 3G7ZA 4F14A 2DJZA 1ZQ1A 3QO3A 1D3BA 2H3EB 4DOZA 2LQ8A 3OOUA 3ULQB 1T08B 3BZCA 3CCSI 1POGA 1AVZC 2H27A 3KLNA 4P96A 1LPQA 4XU3A 2K9SA 1X1CA 3VYRB 3CMAA 4ZH4F 1MMDA 3E6DA 5BMZA 1UECA 4E7JA 4CYCA 2P7CB 1NYFA 1VIFA 4XTWA 3H0FA 1PRLC 2PVOB 3A0BC 2DW4A 2LLKA 3VS7A 4NHJA 5FO5A 3E6BA 2EA4A 1ETKA 4Y4RA 2MBFA 1BJAA 1M3BA 3X24B 3G71Q 4UB8C 3F8CA 1LE8B 1P4AA 2NAZA 5AIQA 3RPQA 2EZLA 1YW9A 4MTDA 2ZBKA 3B02A 1WLPB 4RUGA 2XD0A 4MZPA 3FXRA 2XDBA 1HCRA 2RI3A 3CMEA 3WU2C 3FXMA 2NOJB 3HZJA 2TRTA 4ZDPA 1VFCA 1TTHB 1DPRA 3FMRA 2ZO4A 1D0ZA 3IQLA 3M9QA 4G7HF 2L4MA 4KIFA 4IHWA 5DV5A 2QASA 2HQHA 1STZA 4M75A 4YIIA 1VIEA 2EQKA 1QVGA 1XDUA 4J83A 5GPAA 5E18F 3SYTA 3HRSA 3HSRA 4Q4ZF 4BGDA 2HSPA 2XSDC 1PM3A 3GBGA 3OYFA 2AQEA 2R5MA 3CQTA 3KZYA 1TS9A 2XDDA 2QCOA 2ME6A 3SZTA 1BR1A 3DBLB 4J6XA 2XKPA 1OYWA 1YI2I 1ZUYA 3OYEA 1K73U 4AIDA 4AFZC 1FEXA 2V26A 2R5ZB 2GOMA 4CCNA 3CCJT 3CZ6A 1TLHB 1SKUB 2F5VA 5JFRA 3J80E 1FP1D 1HSTA 4A3FJ 2EQUA 4EPCA 4KIBA 3ZQ7A 4RB3C 2VJ4A 1Y56A 1DGRM 2OV7A 3FC3A 4II1A 5DM7R 1IN5A 2DK5A 2X6OA 3WGGA 1WYXA 3TQ7P 3FWEA 5EEGA 3DFGA 3M58A 3T5XA 1JKQC 4MEXF 1HW2A 2L02A 5DM6F 1AHDP 2NWMA 4M9ZA 2EYWA 2FBIA 2LY1A 5GTIC 2BZYA 2CQ7A 5KAFC 3LMMA 4M78E 4IVNA 4UXNA 4A53A 1RAEB 1R58A 2W1OA 2IS2A 4LG0A 5E3NA 3KEYA 3GO5A 1JI8A 5KYXB 3VB2A 1K61A 3OSGA 2DXCA 1MH3A 5LHGA 2QGUA 3MP8A 3WGIA 3OYAA 7AT1B 3CCLT 5DD4A 1AKHB 3RYPA 4C2TA 3EUHA 1WRJA 1JRIA 2BUDA 2P7VB 2EFQA 3PQJA 2CS7A 1W0UA 1ZBXA 3N97A 1A36A 2L9RA 1NK2P 4HV6A 1FBQA 4FT8A 3FJPA 1WJCA 3CEYA 1OKRA 4UUSA 3PQKA 3V8LA 4OMNA 2QQRA 3L2RA 3JCMe 2QENA 2V6EA 2A7YA 2MC3A 4HT8A 3DKXA 5EG0B 2DYIA 3CC4A 3CCQQ 4JRQA 2CZ1B 4KNYA 1YE9A 4CICA 5GAEJ 4RTXA 1M90C 3CC7Q 3DEUA 2X1CA 1AEYA 1LNWA 3W6VA 2SEMA 2VBWA 1VQOI 2I10A 1W1FA 4J9DA 3PUFA 4FTHA 2WB1A 4UV8A 4C0FA 4TV7A 1WXTA 2XU8A 2ZGWA 2X6WA 3LA2A 4JRKA 4C8QB 3M1CA 5KE3A 2O8KA 1O3RA 1S9HA 5DYMA 4XN3A 4EGZA 2KSSA 5CKEA 2WAQA 4C5EA 4ZYGA 3CCUA 4XAXB 3S32A 4M7AD 3G71I 2X4YA 1LVKA 2MVTA 2ZSHB 4EJOA 4IHSA 3F23A 2JUFA 2JPBA 4N4GA 3CCEQ 2KLOA 2Y69H 3KP2A 4LIUA 3CXCS 1N8RC 4OIQF 4XKBA 1FOXA 1VQ8T 2DNUA 2KJBA 3CMMA 2RV8A 4QVZA 3PE0A 4FW1A 3TEDA 1UTIA 3R61A 2JA7J 4PFPA 1RC9A 2VKHA 3CCLI 1XMKA 4U88A 3BTCA 3L9FA 3S3OA 1JKOC 1MNMC 2RVCA 3OL4A 2JMAA 2CUEA 3HSFA 2MMPA 3MJXA 1SFOJ 2FYKA 1KGSA 3H5RA 1OYIA 1GVDA 2EQRA 2M3AA 4G9YA 2JT4A 3HTRA 4OP0A 4A4GA 2M4GA 2DOFA 2O03A 4UUSB 1XMXA 3L2UA 1E7OA 1MUZA 1R0CB 1WHJA 2NLUA 5HDGA 3N4MA 1K78A 2JTMA 1TP4A 3UF4A 1QMCA 1J75A 3U21A 4PJOD 4BDZA 5E8GA 2Z16A 3LSIA 1ZTRA 5J47A 4IPAA 2RMOA 5FGMA 1D3YA 2NS7A 3J7ZI 2MK5A 1YITA 1D0YA 1KU9A 2A6HF 4RB2C 1AKHA 1LPLA 1LFUP 4ZZDA 3J81K 3KYDB 2VJIA 1YOVB 2MABA 4XLFA 2R0QC 2BBYA 2VN2A 2D8JA 1PVEA 4AVZA 5TRDA 5C44J 2R5ZA 4O6JA 3FEOA 5KYXA 5GAN4 2IPQX 4LMYA 2KDSA 5IT9E 3B73A 2RHZA 4IF4A 4DBQA 2J6FA 2VYTA 3R4KA 2XIDA 4J7FA 5H20A 3JB9G 1SAUA 2QSFX 4M7AF 1UG2A 2KKOA 1ZRFA 3HPGA 4RGSA 4PLLA 5KYYB 3IAS2 3CDIA 4XTYA 3P9IA 1R36A 3UKGA 3X28B 2M16A 1F9NA 3HFNA 4C5HA 1T2KA 2ZMEA 1S1NA 2Q1ZB 2H8HA 2LY2A 2K5CA 3PFIA 4N9IA 3OL3A 2JNGA 4FETA 2OAWA 5J26A 5LJ3j 1YIJT 4GYGA 5HK0A 1VQ8Q 1H9GA 2KRMA 1NG2A 1VQKQ 2D9TA 1YHQQ 3C1DA 1A0NB 1X69A 1WJSA 1XQHA 5FWBA 1R6RA 2DJIA 1OISA 2AK5A 1RKWA 1ABOA 1QPMA 2QQAA 4UUTA 3HB9A 3FKJA 3L09A 3TOBA 1QVPA 3CMYA 2DF6A 2NYSA 3LSMA 3ZQCA 1YBYA 1JXOA 4RLFA 4ABZA 4AFUC 3V4GA 4CC3A 4DBHA 1K6YA 2K7LA 5HS7A 3E6CC 2DILA 2MLKA 3QZ5B 2FPEA 2V1XA 4M77D 3V7RA 2KRNA 4PJLA 5ERIA 4ASNA 4M74A 2W25A 5K5RA 1VA7A 4CCMA 4M7AA 2KGTA 4QQ6A 4BY6C 2FMYA 3Q0VA 5CVIA 4J8OA 4C92C 3DV8A 1G83A 3JRBA 2UWMA 3GZNB 1ZGWA 3ZL7C 3M54A 2LBFA 2KRCA 4KN4X 2O2OA 1UCRA 3JSPA 2ZZDA 4CYCB 1LUJB 1YQAA 3ZOBA 1Q82C 4A6EA 1QA6A 3W2WA 3GYHX 1YYVA 3QWXX 2K79A 3I55T 1U9NA 1WJRA 2R7WA 3KCCA 2R7TA 4YFXF 2X4JA 2KVQG 5D7UA 3M55A 3VWBA 5A0DA 1UHWA 1QU3A 1QQIA 3A02A 2Q2EB 2DT7B 2UUZA 2LP5A 2QK0A 4B9WA 2LT1A 1BR4A 4L0YB 3BDDA 4XN0A 4LUEA 2EA2A 2X48A 3NARA 3AAFA 4Z8AA 1UFFA 2VPRA 2A69F 1QW1A 3H1CA 2CW0F 4UB6C 5DUIA 2F4MB 1B72A 1W7PB 3PNYA 4Z6YA 3S2WA 2DBMA 2XGCA 2QVOA 1QCOA 2VXZA 3CMET 1TG0A 1OOTA 2BZ8A 3TEEA 2LX9A 4BJ5C 4ESBA 1QZZA 4WF2A 2BVLA 2DMOA 2YU3A 3L2VA 2A36A 1VQ8I 4EM2A 1KIKA 3FHNA 4C5IA 5ILSA 2VL8A 5IY5H 5M5XJ 1QQJA 3AG1H 5CVRA 1OV3A 2XHCA 4KH1B 2RJCA 2V1DA 1OPCA 1P7JA 2Y9ZA 2F2VA 4I7HA 5E3OA 3DB3A 1IXDA 3EGXB 1P4XA 1HDPA 2M45A 2KXDA 3KP6A 3KX2A 3S93A 2PU9B 3OYJA 2HS5A 1ZBJA 4F17A 4M75G 4M7AG 3RTRA 3JSCA 2J5OA 4M7AC 2LFBA 5GAN6 2Y0SA 1T98A 4L18B 1HK9A 2J05A 4M78D 4N0AC 2CO5A 3QYFA 5J1YA 3ZQHA 1VQ6A 4E6RA 2LH9A 2WBMA 2EWNA 4BI3A 2CU7A 1X1AA 1GCQA 4KULA 1V4RA 3ABKH 4JX4A 1YJ9I 4PK4A 2XI9A 3F70A 4KYWA 2LNBA 2Y9YA 3M4YA 2WSCE 2O9VA 1Z05A 4KISA 2EJGA 3QYHB 2IA0A 2O31A 4D1QA 2GGRA 3R6SA 2ESWA 2RKHA 3CBOA 2QBYA 3ABMH 2CGPA 4CDGA 1GLNA 4BH9A 1WPKA 2JM8A 2RF0A 2HZYA 3BDLA 2RREA 1KQ0A 2DOEA 2QKMB 2YPRA 2DCEA 3QAHA 2PJPA 2OTJI 2EBPA 4OF1A 1ZHIA 1I3AA 3OIPA 1RUNA 3S8PA 2DBKA 1IN8A 4XTZA 3H35A 2VV5A 1Y0NA 1XGSA 3VKIA 1X43A 4ENKA 3PSFA 4OIOF 1HW5A 1M8VA 1YIJI 3DF8A 4WTOB 1Q86R 2ZXWH 2HWVA 1IRXA 3J80R 2MWOA 2XKOC 1KC8C 5ICGA 1TWFJ 2EH3A 3EHQA 1BB9A 3DLLF 4PJOF 2NUPA 3ZRGA 4XBFA 2B0LA 3CC4I 3SD4A 1VQMQ 2XDVA 3EH2A 2TDXA 2XAJA 3HIFA 1BI2A 2JUCA 1Z7UA 4ZJZA 4XU2A 1YJ9T 1RPWA 2BOLA 4KUIA 3CCEI 3RNJA 2MH9A 1BC8C 2LMDA 1V29B 2JTFA 1UJ8A 4ZTFA 4KRTA 4OMPA 1VQOT 1VQOQ 2OTLI 1ZELA 2VBYA 1OPKA 4BHBA 1N27A 1WGSA 4BBSJ 1U3OA 3OOPA 1VNDA 5B1AH 1X1BA 4P1WA 4Y28E 5GAN2 5HLHA 1QGPA 2JA5J 4JZ4A 1NJIC 3VRZA 2ISYA 4S04A 2YLCA 1QP2A 1M3AA 5GAGJ 2VJ5A 2VLAA 3CP8A 1JEGA 2WV1A 4HLXA 5IOYA 4BE1A 2KROA 1U5SA 3BOQA 4E6KG 1R5GA 2E19A 3S3NA 3EYIA 5DLQE 3G71A 3I56A 1W0TA 3LGFA 2DI3A 1GCQC 4BY7J 2RQPA 2WTEA 2CW7A 2G7UA 3CD6A 5H6RA 3TP3A 4PJOE 3UA6A 4XONA 1LCKA 4ZNXA 2OF7A 5DM7F 2DRKA 3GTQJ 3C2BA 3CF2A 2HFHA 1UJ0A 1UGPB 2H09A 5KAIC 5IT9R 4BAYA 3C95A 2FNAA 4OMMA 3QP5A 3G1JA 1VQ5Q 1MGTA 2HDCA 3A2KA 4ANJA 2GTOA 2PZ1A 5CJ9A 1PG5B 2L5QA 1MHNA 4HEA2 2K4YA 1K0XA 4B3AA 1ZARA 2X9HA 5E79C 1LVAA 3FBIB 2WWYA 3C3WA 1RLQC 2FF4A 2HCKA 2LCCA 4R1HA 1AWWA 4BHCA 5EF6A 3EUKL 2C0OA 5ICEA 5DTDA 1QVGS 2VIXA 2W00A 4XOTA 3OYGA 1ULYA 2F69A 1PD0A 1TQMA 4NDLA 3WTUC 3CC2Q 1VQ5I 2JN0A 1O3SA 3CJQB 3I59B 3VFZA 1NLPC 5E1WA 4C30A 3LSRA 3R60A 3ZMUA 1R77A 4R56A 2KT0A 1HD3A 2FX0A 4B47A 3PNVA 3BR5A 2GFAA 3EUHC 1MMAA 1K73R 3QOPA 1VQKT 3MCZA 2NVQJ 4E7LA 2E1NA 4LFUA 3EYYA 3MKLA 1RABB 2KT1A 3WG7H 3Q5FA 2VC8A 1H89C 2K4JA 4HV5A 2N8GA 1O75A 3HOTA 1P6RA 4AWXB 2AXTC 2D5VA 2R93J 1AD5A 2DKGA 3EG3A 4LDWA 1MH4A 3Q0UA 3RDIA 3MKZA 3FRNA 2HQAA 2F4IA 4M77G 2V4JC 2AXLA 4BL0B 2ZJRF 3CCMA 1SFKA 2YX7A 5L3BA 1AZGB 2MFZA 3MCAB 1N8RU 4M7DF 4AYBN 2DMPA 4RTVA 2P4RA 1Q86U 1GDTA 2G6FX 5HOOA 2A61A 3QDFA 4XOPA 3QOEA 1D1CA 3JAMK 1UHSA 1JKPC 2QSGX 5KH6A 1IDYA 1TNTA 2V7FA 1ABQA 2F48A 3V8KA 3A98A 2UZKA 1LDJA 2KPMA 2DQLA 5JR3A 1AOYA 4Y17A 2L3RA 1G4DA 3RUXA 4LG3A 5TJJA 3H36A 3IRRA 2STTA 4M75D 1T3SA 1ITYA 2CFOA 4BXXJ 1BI0A 2CW8A 3CO6C 2IGNA 4M71A 1T8IA 4FE4A 4YELA 1P92A 4OMYA 1RAHB 1XNIA 2P4TA 1BJZA 3CCRQ 2YUQA 1BN5A 2M51A 3H8ZA 4DEXA 5EGOB 2QYOA 1Z6TA 2QQ8A 1BOBA 5HDKA 1HBXG 3TSWA 2HKQB 3PNTA 3WG9A 1RI9A 5HNFA 3HRMA 5GAOp 3EQLF 5DCMA 4IIMA 5GAN3 1BIAA 3HEFA 4MHGA 1QLYA 1TQPA 3REOA 4MDXA 1AA7A 1V76A 3H9NA 3CPWP 4PZJA 1T0FC 2HPIA 2KHMA 3ZMVA 2ID3A 3MZHA 2YT6A 4X9DA 3SFMA 5DLOA 3OA6A 3JCMJ 1VQ4Q 2OC6A 2A08A 2X3XD 1S72T 2W82A 2PI0A 4ORZA 4RS8A 2FHDA 2QA4A 3EGDA 1KZHA 2O01E 3OYDA 3PMTA 1FXXA 1UJYA 2Z2SB 1R5HA 5HS9A 4M3DA 4FL6A 4QQDA 1DDNA 4F7ZA 4OWRB 4BXUA 3F8NA 1AT1B 1RKTA 3HYIA 3HSEA 4JRIA 3JCMg 5I22A 4X6AJ 5CCAA 1X1PA 3VEPA 4EEFG 2EFWA 3A8MB 4IUTA 3ZN1A 4MFDA 4JS4A 1F1ZA 4G6DA 3IRQA 5FU7B 4A4FA 4M9SA 1RUOA 2WSEE 4ON0A 4LB6B 2R5YA 2ED1A 2K9LA 4A3JJ 1QKWA 1FTTA 3HKSA 4RTZA 2IGMA 2A0FB 5IXFA 1B1BA 4HPQA 4Q5SF 1K8AU 4B8XA 2MOXA 4OMOA 3DPTA 2H8RA 5FRNA 3ISPA 2CT4A 5EC7A 1FYKA 3MEXA 3RDVA 3DTEA 4A0YA 4FM4B 1WXUA 1TUGB 5GAMg 2QLZA 3OYYA 2EFOA 1WI9A 2JRTA 2K5LA 4XRMA 2K27A 3IP4B 1OQKA 2A68F 4B4CA 2XHKA 4MNUA 1KHCA 5IAYA 4V2SA 5E20A 2OD5A 3CP2A 1ZSZC 2ISZA 5GJWB 3EDPA 1G6NA 3JAMZ 1BIBA 3BT9A 2Y4XA 3OS5A 3IHUA 1UHMA 2FG0A 2CS3A 1N6AA 4BACA 3K4LA 2IPOB 3M59A 4NC6A 2ECBA 4RAYA 5D4RA 4FX0A 2KK4A 3RMQA 3RKYA 2JSPA 4HOBA 3L2WA 4LITA 4M75E 4LN2A 1O3QA 2LRDA 1WQWA 2E3HA 2GQVA 3BE3A 3KEQA 5I2MA 3CCVA 1YHQA 3JCMd 1FY7A 1WFXA 3JB9I 4A3GJ 1FTZA 2LNVA 3K4JA 2PMUA 1N77A 2ZB9A 4JUVA 2Z3YA 1JU5C 2RN8A 3RIRA 4KT0E 4LDVA 3BR3A 2IVWA 3JW4A 2AHQA 2BY0A 3NWTA 2RN7A 1DP7P 4M72A 4D6WA 2GCXA 5LJ3d 3DU5A 1J0RA 2VONA 2COBA 2RQUA 1DU0A 2M9UA 3HBLA 4M7DC 5HK3A 1E3OC 1K78B 3M53A 4HBLA 4ENNA 1QVFS 2EIKH 1OCTC 2O4XB 1A6QA 3NRVA 2DAOA 2KP6A 2QWWA 1WKMA 2RO0A 2VT3A 2JN6A 2MI6A 4J6WA 3QJYA 3CC7T 1TZLA 2I8DA 2E5NA 5LGUA 2VUBA 3BTJA 3G2BA 5GAN7 2D1VA 1SD5A 1WJQA
chains in the Genus database with same CATH topology
3VU3C 4ZZLA 2RHXA 3ZMTA 1XDSA 5L3EA 2V1UA 3QRFF 3KP3A 2L89A 3J7AF 4XU1A 4DQ2A 4XLNF 2RHYA 3JB9H 4B09A 3CCQT 3E9GA 5GANd 2EB7A 5HLIA 4LJZF 3RJPA 2DD5A 1MZBA 3H3UA 1U1SA 3JSOA 4HQEA 1YG2A 3HL8A 3OB9A 3I54A 4ZGJB 1KU3A 1ZHFA 2LQKA 1M1KU 2HD0A 4LG0B 2O3FA 1B6AA 3GFLA 1TW3A 2PQ8A