2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
4FT8A 5DUKA 1IZ1A 3D0SA 1J59A 1B59A 3F8FA 3F8CA 4KIGA 1F9NA 3H3UA 3KLNA 4WXDA 4AD9A 3NQOA 1LEAA 2EFOA 5JR3A 3DV8A 2LSOA 4IRGA 4ENMA 2H09A 1BI2A 1MJ9A 1J5YA 1QVPA 4YIIA 3F8MA 1O3TA 5D6EA 3K1PA 2FSWA 2PEXA 4GGGA 2G9WA 2HFHA 3CUOA 4GCVA 1PP8F 4L9JA 2L4MA 3C18A 5D5WB 1XCVA 3F72A 2IA2A 2XAQA 2K86A 3VFZA 3R0JA 2HEOA 5CVJA 3DEUA 4OIQF 1EV7A 3O3KA 4R79A 1WRJA 1YS7A 2P5LC 1J75A 2DAOA 2PQ8A 4CHUA 3I64A 3F8BA 4LLNA 4OOIA 1R23A 4U0YA 3FMQA 1HKQA 4YFXF 4EGYA 2FOKA 2L3DA 1RNLA 1KA8A 2NRAC 1FBSA 5D5XB 1U3EM 2FXAA 5F1RA 3M9AA 3AAFA 3KCCA 2CG4A 4O5VA 4R8HA 4ZZDA 4WXCA 1YS6A 1BJAA 2MLKA 4IXAA 4ESFA 1QGPA 1F4KA 1LQ1A 5DEQA 5JFRA 1DP7P 2F5FA 3MEXA 1FBQA 2MD5A 4HF2A 3IC7A 1TQPA 5LGUA 2HTJA 3KFWX 4KN4X 2RV8A 2NNYA 1KU3A 3RPQA 1ODDA 1IN5A 3M7GA 3DP7A 3ZN1A 4UVBA 3T5XA 5FO5A 4HX7A 1S3JA 4OIPF 3S2WA 1O7FA 3GW2A 4BQAA 4IJAA 5L3DA 3MWMA 1O3RA 4CXFA 3WTSC 1FSHA 2XHKA 4KT5C 1P92A 5LRRA 2OU2A 3HYIA 3K1NA 3WU0A 1TQIA 1S7AA 2R7DA 2EA4A 4OU0A 3TO7A 4EMSA 3Q9SA 4PGGA 3O6BB 5JVTA 4BXUA 2L02A 1U78A 5HDGA 5D6FA 1O7LA 4A0XA 2CWEA 1XSDA 2VBZA 3W6KB 2M1BA 4YFNF 1XDSA 4IF4A 2CFXA 4Q48A 1XMAA 1YW8A 3KZYA 3SFZA 1C0WA 5HDNA 2QBYA 3FM5A 2ZXJA 5E1ZB 3JSOA 4HQEA 4AWXB 2HTSA 2GA2A 4NQWA 2PFBA 5D4SA 4HDUA 5L3CA 1QW1A 2HKXA 3KP6A 3ZMZA 4L9TA 3NRVA 5FB2A 2YSRA 3RJPA 1USTA 4HYEA 2ZNZA 2C6YA 3GO5A 1YFHA 4EM1A 2GA1A 3HSRA 1IW7F 4GYGA 2F2EA 1STZA 1FP2A 3GZ5A 5JI6A 4HW0A 4RAZA 4LFUA 1JE8A 3SZPA 3HRTA 2OBPA 5E1WA 1OYIA 3GVAA 2VOPA 4IHTA 2R7FA 3HRMA 1JXSA 2A69F 5BPIA 4M6YA 1BOAA 4FX4A 2O6GE 3E97A 4UXNA 1O3QA 2QYOA 3OV8A 1SD6A 1SFUA 1LNWA 2STWA 4HLYA 3CUQA 4JBAA 1G3WA 2D45A 2QUFA 2ZKZA 5FFZA 2QLZA 3E5XA 1HKSA 4ENKA 2VBWA 2E1NA 4CZZA 2CYYA 1ULYA 2Z33A 3HOTA 3GYHX 2VODA 2IRFG 4GYIA 5FFXA 1BN5A 1YLFA 1H0MA 4HV5A 2WWYA 3DQVC 2NAZA 4LG0A 4ENNA 1Y0UA 1ZGJA 4BHCA 3LAPA 5BOXA 3LWFA 5CVVA 1QPMA 2ZCWA 4BH9A 1QNTA 2A6EF 1KU7A 4I09A 4XBFA 3RPUA 3RYPA 2V1DA 2DLLA 2H27A 2BYVE 1E17A 3CO6C 4TV7A 3P9CA 1G3TA 2CSOA 2EA2A 5D5UB 3BDDA 4AIKA 2EV0A 2O03A 3ZQ7A 3I0TA 4FHTA 4OINF 4IVNA 4PDKA 5ILUA 1FY7A 2FE3A 4PZJA 4HA8A 5HLGA 1YTYA 4EQQA 3E6BA 2W84A 1P4WA 3HTSB 3WTZA 2MC3A 3BJAA 1LDJA 1XSVA 3CUQB 2K5FA 3LAJA 3V8JA 2DTRA 4ON0A 4WK8F 4KICA 5E8GA 1RZ4A 3FF5A 4EJTA 1D5VA 1QZZA 1MJAA 2EV5A 4I7HA 4QWQA 5CJ9A 2EFNA 2EJRA 4JQFA 3SZTA 4KYWA 3GWZA 4RB2C 2DK5A 2XUBA 4L0ZB 2KIMA 1H9GA 2XGXA 4EGZA 2XRNA 3RDIA 4CICA 3I71A 4MTEA 2K4BA 3TOAA 1GHCA 4XRFA 1D8KA 3KP7A 1G3SA 5EEHA 1XGSA 2XAFA 3ROUA 4HOBA 2V79A 2EFPA 3JSPA 2XKOA 2VE9A 3J80Z 1ZAOA 2BE5F 4BHBA 2H6CA 3TDZC 1U5TC 2LDUA 1Z6RA 3KP4A 1ZYRF 3WTVC 2M5WA 3WTWC 3ECHA 3P7NA 2J5PA 3KP5A 5FD5A 4DQ2A 1I1SA 1EH8A 2O8XA 4IHSA 5D8LB 1DUXC 3CUQC 2HR3A 2VN2A 4G8XA 2KRFA 1OMIA 1Z91A 3JW4A 4BHPA 2FBHA 4EM0B 5ICFA 2IA0A 2RQPA 3EDPA 1X3UA 2UWMA 1FBUA 5LGNA 1F1ZA 5L3FA 3RI4A 3I59A 4MNUA 2K27A 2EFQA 3FZVA 3GFJA 3I53A 2O3FA 1L3LA 1W5TA 3L00A 3TGNA 2RN7A 4KIBA 3HTUA 3DPLC 2OZUA 5BMZA 2F5CA 4M9XA 1T2KA 3E19A 1R1VA 1SMTA 5CLSA 1BIAA 1R36A 3IWZA 2FEZA 2FRHA 2CO5A 1VTNC 1CF7A 3QPTA 3P9IA 4JK1X 5L3EA 6PAXA 3HHGA 2XIGA 1J0RA 1GXPA 2P4WA 2XAJA 4P9UA 1WI9A 1NHAA 3WU1B 1CF7B 2P8TA 2QQBA 3M1EA 5FGMA 3V8KA 1FOKA 1YYVA 4RB0A 2J5OA 1WQ2A 2UXXA 1HSTA 4AVPA 3G3ZA 3LQQA 2B0LA 2YU3A 2P6TA 4WF2A 2NNNA 4UV8A 4M74A 3LSTA 1I1GA 4P55A 3PFIA 5EEGA 4OIOF 4M9SA 5L3GA 1FZPB 3K2ZA 1D3YA 4MGRA 3QU6A 2DI3A 1FYKA 1KU2A 2ISYA 4HQMA 1AWCA 1Z6TA 1XB4A 5DCMB 2QENA 1FNNA 3RKXA 3HRSA 5LEKA 4U88A 1YIOA 2P6SA 3J81K 5D4RA 1J2XA 2IP2A 2F5EA 1TW3A 4IPAA 4H0EA 3ULQB 4IRIA 4KMFA 1T98A 2A6HF 5HS9A 2QVOA 1Q1HA 4S05A 5DCFA 1V3FA 2BEOA 2KJCA 1MZBA 4Y17A 3DF8A 1R58A 1ON2A 4BNCA 2HGCA 4KN7X 1I6XA 3LA2A 1W7PB 1T6SA 3QU3A 3QRFF 3SHFA 2FMLA 3ELKA 2K4JA 1SFXA 1SFEA 1OYWA 1T0FA 2Z5UA 1B9MA 2TDXA 4EJOA 5LHIA 5TRDA 2ZFWA 1IN7A 2XAGA 2WV0A 4WXHA 3R60A 2DQLA 5BS6A 1W7PA 2HYGD 2ZO4A 4LB5A 4RB1A 2EFWA 2RKHA 3F6OA 1OR7A 4MQ9F 1LEBA 3HHHA 3GEZA 4BYYA 2W24A 4A0ZA 2ZBKA 1TNTA 2QWWA 3L9FA 2DQRA 2P5VA 2P7VB 3KE2A 4L5JA 4CO8A 5L3BA 4CGZA 1IXRC 2HKOA 2JSCA 1B1BA 1U6GA 2D1HA 2LF8A 2HYFA 5D8KB 2A07F 2MA3A 3BP8A 3LA3A 1HW2A 1SD4A 2OQGA 1ON1A 5JHUA 4KFCA 1IF1A 1FT9A 2DPUA 5ICEA 1UFMA 1O57A 2KIUA 4G7ZF 1WSUA 1PP7U 3MAJA 2V9VA 3SXYA 2COMA 2YPRA 3V7SA 5HLIA 3FXRA 2JPCA 1W5SA 2WC2A 2V1XA 2GQQA 1H9TA 2HS5A 2BBYA 3QP6A 1FC3A 3ZP5A 4N9HA 5DDGA 2H94A 3HOSA 3OOPA 2UZKA 2IVMA 2A61A 1YO5C 2G7HA 2OZ6A 1U5TA 1U5TB 2ADUA 1KQ8A 3ABUA 2M30A 4RAYA 2GIVA 1B4AA 3BWGA 2P5KA 1FX7A 4RGUA 1G3YA 1SD7A 5AIQA 3F23A 4YFKF 4N0BA 4EJWA 4KNYA 2PI0A 3FMRA 2M45A 4BAYA 4L5IA 3F22A 1XGMA 1MJBA 2JZYA 1HW5A 4XSZF 2HWVA 5FLXK 2DW4A 2JT1A 2E7WA 3PQKA 1QZYA 1DPRA 4E70A 1MDMA 5E18F 3T8RA 3CJNA 1P2FA 3V8LA 3DPTA 1I27A 2MH9A 3WGGA 2PBIA 3WTUC 3REOA 3BJ6A 1USSA 2Q8KA 1ZHFA 2BV6A 4LK1F 3E3VA 1IN6A 4EJVA 2VBYA 3N97A 3BOQA 1TNSA 3L7WA 2GZWA 3L09A 3R0AA 2GAUA 2OD5A 5IT9K 4I02A 2LNBA 4N9IA 4A6EA 3CTAA 3MZYA 3FM3A 4I98B 3DFGA 3MZHA 1MDMB 1FYLA 3HSFA 3FX3A 5HLHA 1B9NA 3ABTA 1Z1DA 1KQ9A 1GXQA 2OQRA 1B6AA 3QP5A 2GWRA 3E5UA 3GFMA 2VONA 3KEOA 3WTYC 3IRQA 2E1CA 3F8NA 3WE2A 3HSEA 2X4HA 3QOPA 1ZG5A 5HS8A 2DT5A 5J8CA 4RGRA 3ZMSA 2PJPA 4M6XA 4L18B 3TO9A 2V1UA 4LLGF 3TKYA 3COAC 3TOBA 1HKTA 3O2PE 1BIBA 1XN7A 4ZYDA 3J81Z 4MEXF 3WG9A 1O3SA 1IN4A 5ICGA 3TQNA 2VC1A 1K78B 4G9YA 3CDHA 4WX9A 3IWFA 4U7DA 2FNPA 4HF1A 2RNJA 2MLGA 3VODA 1ZRDA 4AIJA 2DFIA 4HZFA 4HBLA 3L2CA 5K1YA 2Q2EA 1IRFA 1J7KA 3BPVA 4CYDA 1BC8C 5DCMA 4YIFA 2O61A 2XV4S 1HW1A 3RTRA 5H20A 1JHFA 1UB9A 1P6RA 2PG4A 1J9IA 2ACJA 4A0YA 3I58A 4I0AA 1A04A 1XSXA 2GCXA 1I5ZA 2L54A 2MBFA 3EQLF 1LB2A 3R4KA 5ICCA 1Z05A 2IJLA 2WTEA 2ZJ2A 2OAZA 4UUVA 2RC4A 2AS5F 3C3WA 4KUMA 2R3SA 2Z3YA 2PN6A 2JTVA 2QZ8A 3WTTC 3GUDA 3C7JA 4OMZA 4GO1A 3B73A 2VOOA 4P5OA 2IT0A 4LGWA 3JAMZ 1R1UA 1G6NA 2G7UA 1HBXG 4LK0F 3I4PA 4ASNA 3H3ZA 4Q4ZF 1XGNA 4A5NA 4ESBA 1T39A 1ONVA 1P4XA 2VC0A 5E17F 4UHTA 2FNAA 2FQ3A 3D5LA 3JAMK 3W6JB 1IUYA 2FF4A 3ZMUA 4M9ZA 3JTGA 4KMUX 3T8TA 1JGSA 1DPUA 3ZMVA 1ZRFA 2VBXA 4G6DA 2DBBA 1CGPA 1ZG3A 4ZYEA 2HDCA 3KP3A 1PUEE 3EYYA 1RIOH 5E20A 4Y15A 1R7JA 3ISPA 1ZGAA 3F6VA 5IT9Z 2CW0F 4R1HA 3BY6A 3LQRA 4LLLA 3J80K 3P9KA 1WKMA 4UVCA 5KVRA 2LF7A 3J7AO 1AOYA 3MCZA 4A12A 4I0BA 1EH7A 3K69A 4U0WA 2K02A 3QAHA 2V6CA 5F6FA 1BI0A 4XSXF 3IKTA 4OIRF 2F5DA 4HLXA 1S7OA 1FYMA 3I54A 2EK5A 2YR2A 2YX7A 2QQAA 1HSJA 4MQVA 4FX0A 2XROA 1ZN2A 1W4MA 3R61A 4QLCU 3KP2A 1S6LA 1D8JA 3ZPLA 1GVJA 2DPDA 3GF2A 2Y48A 3MFKA 4LG0B 3Q9VA 4EM2A 3ZMTA 2KIFA 4PGHA 3VEPA 4ZYGA 4ZYHA 2LKPA 5LHHA 2XASA 4G7HF 3NEUA 3H92A 4HAMA 1HQCA 4UV9A 3IL2A 1OYYA 1TLHB 2FMYA 1QQIA 1HXDA 2L4AA 1SMYF 5FLXZ 4ESJA 1BI1A 3LA7A 2DO7A 2K7LA 4NB5A 3CO7C 1ZLKA 2A3SA 2K5IA 2FU4A 3U9GA 3GXOA 3QPHA 4A5MA 2H6BA 2E7XA 1MGTA 1XD7A 1K6OA 2Z9OA 1R5GA 1R5HA 2ZMEA 1U8RA 1U2WA 2K4YA 3ERED 4LB6B 1KU9A 4M73A 1RUOA 3GFLA 1BBYA 2GXGA 2W57A 4S04A 1FLIA 2A68F 3TDUC 3E6DA 1DDNA 1YG2A 3LFKA 2OA4A 2NYXA 1W7PD 1Z7UA 1BM9A 4G94A 2H3JA 5DV5A 2P7CB 2D1VA 1RI7A 2EWNA 3EUHA 4ZZLA 2A5YB 2RDPA 3C1DA 2EV6A 3E5QA 1EH6A 3KZZA 3G73A 4A2UA 4HX4A 5CVIA 4KDPA 2Z99A 2EB7A 2QM3A 4P9FA 4Q5SF 5K5QA 5ILVA 2L01A 1YW7A 3HUGA 3KETA 3R6SA 2CGPA 3K9TA 2ISZA 1IN8A 5K5RA 1QBJA 3V7CA 1LDKB 5LLQA 1TW2A 1F5TA 3VOEA 3RKYA 5FD6A 4UVAA 2D2WA 4RGXA 2PLYA 2X0LA 5DD4A 1YQAA 3GLXA 3F21A 3E6MA 4B09A 1R1TA 4L9NA 1OKRA 1ZRCA 4HDVA 5HS7A 4CDGA 2FBKA 2QQ9A 3FMSA 4D0PA 2ZMEB 2Y0MA 3FWEA 4LD5A 1UHWA 4O3MA 1LDDA 2PMUA 2XVCA 4M71A 5A2QK 2M8EA 1XDUA 4PCQA 1FSEA 1R00A 1QO0D 2RVCA 1UCRA 3FXUA 1P4AA 4L9VA 5DUIA 2O0YA 3ZN0A 5LRSA 3IKVA 5F64A 3ZMDA 5KK1A 4ETSA 5CVUA 3DXJF 1OPCA 1SAXA 5CYVA 4EVIA 5ERIA 5LEJA 1UHMA 3B02A 2W25A 5E1XA 5K5OA 4L0YB 3HRUA 3WODF 5BPDA 3T1BA 3BPXA 3RIRA 4KIFA 3TO6A 2K5LA 1BI3A 2YX4A 4HV6A 1K7AA 3K1MA 4HF0A 3BROA 2PMHA 2VE8A 4MHGA 4Y13A 3HIFA 3FXQA 4IRHA 1K79A 4U0VA 5J6XA 4G6QA 3JTHA 1S29A 2BGCA 1YW9A 1ZLJA 4Z2YA 1LJ9A 4DNCA 3GFIA 3K0LA 1RUNA 3Q5FA 1R22A 3WE3A 1KQ0A 5H6RA 1XMKA 2HZTA 3RKWA 2QBYB 2M87A 1ZARA 2JPBA 3WTXC 2FA5A 1IXSB 1FWZA 4OMYA 1BC7C 1IXCA 1ZREA 1L0OC 3I5UA 4XLNF 3M8FA 3IHUA 1G4DA 5E8IA 1XCBA 3KEQA 3EYIA 4EV0A 1MD0A 5DYMA 5LHGA 2VT3A 3N4MA 3KLOA 2ETHA 1KYWA 1WWXA 3U1DA 1S8NA 4A6DA 5A2QZ 2IPQX 2FBIA 2DK8A 5D5VB 1V4RA 1IAWA 5DD8A 3BZ6A 2XAHA 2LX9A 1MKMA 4MTDA 1IRGA 4RGSA 4P96A 3F3XA 3M8EA 2STTA 2HOEA 4LMYA 4WCGA 4YG2F 5LGTA 3E6CC 5TJJA 2AXLA 4HX8A 3V4GA 3BJOA 1E2XA 4RS8A 2VXZA 3MHXA 5AIPA 2GXBA 4I2OA 4LJZF 2ESHA 3T0YA 3ML6A 1TBXA 5CVRA 5LBQA 4WWCA 4M72A 1ZG1A 4Q47A 1LVAA 3DKWA 3IRRA 2W85A 3EETA 4RB3C 2ELHA 2HQNA 5HVQC 2VT2A 2KJBA 3RYRA 2HQRA 4MEYF 2UXNA 3PQJA 3V7RA 1BYMA 1FPQA 3WGHA 4KA4A 5IT3A 4U7BA 1ZH5A 2RGVA 4NHJA 3VB2A 2CQKA 2IA1A 1JHHA 4ENJA 3CLOA 3WGIA 2ESNA 5ILSA 1TQMA 4UNOA 1K78A 1T38A 3U2RA 3FHZA 1TTYA 5HOOA 1Z9CA 5ED4A 4EJUA 1REPC 1SD5A 5HDKA 3GX4X 5AONA 1FP1D 2NS0A 4GXOA 4F7ZA 2IW5A 3I59B 4XLPF 4O6JA 2DU9A 2JRTA 2Q0OA 3ECOA 3MQ0A 4ZH4F 1KYZA 4B8XA 2ZNYA 4I01A 3SQNA 2XKPA 3GZ6A 2KKOA 4AIHA 1PDNC 5BQTA 5H6QA 1XGOA 2MH2A 4K2EA 5J8FA 2Y75A 4G7OF 1KGSA
chains in the Genus database with same CATH superfamily
4PJOE 2LY9A 5CKDA 4FT8A 5DUKA 3VPRA 1ZHIA 2X3XD 1IZ1A 2DK3A 1QHGA 1VZ0A 1YX5A 2WB1N 3M55A 2IS2A 4RBOA 3A0BC 3S1RJ 1T0FC 3D0SA 1J59A 2IS1A 1B59A 2KRCA 2QASA 2YLCA 4GLKA 4OAZA 4RTXA 2BY2A 3F8CA 3F8FA 3GTQJ 4KIGA 1F9NA 2NOGA 3H3UA 3KLNA 4A4FA 2KYMA 1B7TA 2ZPBB 2LG4A 2O4XB 1OLTA 4WXDA 4AD9A 2CYZB 2NUPA 2Q2EB 2I10A 1M2VA 3CCSA 1RPWA 3NQOA 4HRIA 3BDLA 1LEAA 3OYBA 4AFSC 3BG3A 4AUXA 1S72I 2X48A 2EFOA 5JR3A 1DU6A 3DV8A 2LSOA 3JCUC 4IRGA 5FKKA 2WACA 4XLAA 4ENMA 1WJDA 4KITB 3I35A 3GBGA 4FIBA 4ESRA 1FYNA 3CF2A 2H09A 2H8WA 4JS5A 3A98A 1BI2A 2XF5A 1MJ9A 1J5YA 1QVPA 2PNIA 1X1DA 2ECCA 4YIIA 4ZDLA 3OSFA 3DPUA 1EKEA 1VQOI 2NVYJ 1ZGWA 2BKDN 4IZZA 4FCYA 1WFXA 3F8MA 1PRLC 1X1AA 1O3TA 3HB9A 1X2KA 3P8DA 5HK3A 4D6WA 4M7AA 5D6EA 3K1PA 3K4CA 2FSWA 1EA3A 1ZR2A 1AT1B 1ZSZA 1IGNA 1GBRA 4NQWB 2RHIA 2EZLA 3DLLF 4AT1B 2PEXA 2UUZA 4GGGA 5FRMA 2MC4A 1OULA 2G9WA 1JKPC 1JEGA 1MBFA 3J81E 3LFUA 4RDUA 4ZTJA 3AT1B 1PD1A 2HFHA 3CJTB 1DJ7B 3CUOA 3OR1C 4GCVA 1PP8F 1T95A 4L9JA 4C2UA 2CV0A 2L4MA 3UA7A 2VJJA 1Z9ZA 2H1KA 2ZXWH 5F08A 2R58A 3C18A 1K83J 2QKLB 5D5WB 1BCOA 3OR2C 2RREA 1XCVA 4BI8B 3F72A 2IA2A 5EYRA 2KBTA 4L5EA 2XAQA 4M7DD 1R77A 1MMAA 2K86A 2VXDA 2CW8A 3VFZA 4C3IJ 3R0JA 2HEOA 4F17A 3FK6A 2LBFB 1YITI 1X58A 5CVJA 3QDFA 4RUGA 1LJOA 3DEUA 2LNHB 1MNDA 3BTJA 4OIQF 2HL3A 1VQ9Q 5J3BA 1EV7A 1Y6IA 2HQ5A 3O3KA 2X85A 4LUDA 4R79A 4GDFA 3HOXJ 1OPLA 2X1EA 1H8AC 1ZSZB 1WRJA 1VQ4Q 1JB0E 1YS7A 2XDPA 1XTAA 1NYFA 2P5LC 1J75A 1QVGA 2OTJQ 4CSWA 1WXUA 2DAOA 1HDDC 5J26A 1QVGS 2PQ8A 5FKOA 1APLC 4CHUA 3A52A 4A3JJ 3LSJA 3G6EA 3I64A 3M54A 1ZELA 1H88C 2CREA 2CP3A 1YE9A 3F8BA 1RAFB 2MWPA 3MEVA 5GPCA 4OOIA 4LLNA 5KYYB 1R23A 1N77A 1B07A 2VKHA 2LJ0A 4M3GA 1XOVA 2JOYA 2KRNA 4U0YA 3FMQA 1AEYA 1HKQA 4YFXF 1IRXA 4M77C 3ASNH 2RJFA 4JZ3A 4EGYA 5FW9A 3JRGA 2FOKA 2L3DA 1RNLA 1KA8A 2NRAC 2EGAA 3JCMb 1FBSA 3RKQA 1M30A 3DLMA 2R5YB 4AMCA 3ABKH 5D5XB 1U3EM 1WHMA 2HMAA 2FXAA 2AZSA 3H9GA 1R49A 2EKHA 2R7OA 5F1RA 2I0NA 4B9WA 3M9AA 4C0FA 4BACA 1JTYA 3AAFA 1ZK8A 2CG4A 3KCCA 4O5VA 4R8HA 5C4XJ 1G83A 3JCMe 1CKAA 3JAME 2B86A 2L5QA 3FK7A 4ZZDA 4WXCA 4YIRX 3ABLH 1YS6A 4CCKA 2DRMA 1BJAA 5M5YJ 3H0FA 3SWNB 3TQ7P 3FKJA 2JMAA 2BXZA 1I1JA 1Q82U 2MLKA 4F91B 5IY5H 2MAMA 2BY3A 3I3LA 2K57A 3UA6A 1WIEA 4IXAA 2VKVA 1NBEB 2GBQA 2W00A 4ESFA 5C44J 2E1MB 1QGPA 3X26B 3CMEQ 1YIJQ 3CCJA 4FASD 4QKUA 1X2NA 4DW6A 1LQ1A 1F4KA 1KD1R 1KD1U 4PLIA 4CI0C 4QPOA 2F6CA 1SRMA 5DEQA 5JFRA 3JRCA 1VQPQ 3I56Q 2K9GA 2PX9A 2WAQA 1Z77A 2Z2SB 1DP7P 3MP8A 2F5FA 2WAFA 3MEXA 1FBQA 2DA6A 2MD5A 1E0EA 2DT7B 3LOCA 4JP0A 2PJRA 3NTKA 2D9TA 1VQ7I 4HF2A 3IC7A 1OX9A 1VQPA 1TQPA 2DOAA 4OMOA 5LGUA 3BW1A 2KMUA 2HTJA 3K70D 3KFWX 3C2HA 4KN4X 4XK4A 2RV8A 2EJFA 2JZ2A 2NNYA 4M3DA 4OMLA 3OQ5A 3TP0A 1KU3A 3RPQA 2O9SA 2MYSA 4RG2A 5M3MJ 4XU2A 1ODDA 4J9FA 2Y9YA 1YJNA 3SHWA 2K3FA 1W36C 1D0ZA 1IN5A 2HXOA 3M7GA 4EPCA 3CJRB 3WHCA 3DP7A 3ZN1A 3HKZN 5CQYA 1A0NB 2JTFA 1MBHA 3CMEA 3Q3SA 1MBKA 2M51A 1M90U 2MUNA 4UVBA 3T5XA 5FO5A 2E65A 1K73U 2JS0A 2FRWA 4HX7A 1S3JA 3C2BA 4C3HJ 4OIPF 1HD3A 3VDXA 5I11A 2HZYA 3EG9B 3S2WA 1O7FA 2HDWA 3GW2A 1V29B 4BQAA 3OWTA 4CUGA 2LTOA 3LH0A 3D7SB 4IJAA 1WDXA 4AFZC 5L3DA 3MWMA 1O3RA 4CXFA 4HVUA 4HXJA 1JJ2P 3WTSC 1FSHA 2XHKA 4KT5C 3M4YA 3UT1A 1P92A 4X1EA 2OU2A 5LRRA 2IGOA 5AT1B 5KYNA 1Z3YA 2E2IJ 1NJIC 1BU1A 3HYIA 3PMTA 2VQHA 1RQ6A 2DYRH 2DPPB 4UY8I 2DYIA 4V2SA 1NPRA 1I5OB 2EQUA 3PGGA 4X1VA 5M9OA 3K1NA 3WU0A 2B63J 1TQIA 1N8RR 1S7AA 3BY7A 2CQ7A 5GAMd 2R7DA 2AXTC 1YNZA 2EA4A 3FEOA 4OU0A 2KAFA 3HC7A 2M1HA 2YUNA 1ZSGA 3L2WA 3TO7A 4B43A 1OQYA 2KT0A 4OB2B 4JX4A 4EMSA 3PNVA 3E7LA 3HBLA 4W97A 1VQNA 2OTJT 2VWFA 1FIPA 3Q9SA 4PGGA 1BCMA 1KK7A 3O6BB 5JLXA 3FLGA 3QJYA 2L02A 4BXUA 5JVTA 2K3BA 4M77B 3CCJQ 2LC2A 1U78A 2MGQA 3A02A 4JX5A 1QLYA 3BG5A 3I56A 4Y91A 5HDGA 5D6FA 4S0HB 8ATCB 4PJOB 3RZOJ 1O7LA 2W0ZA 3DU5A 4A0XA 2CWEA 3JRIA 4PFZA 3W3CA 2DT6A 1XSDA 2DF6A 2FZCB 3WVDB 4C8QC 1W1WE 4XN0A 2F1LA 3QPLA 2VBZA 3W6KB 4A3BJ 3ASOH 2M1BA 1R71A 3M0TA 4YFNF 1JBMA 2CSIA 1XDSA 2B7EA 4IF4A 2F2XA 2CFXA 2M2EA 1XMAA 4Q48A 4IOCF 1YW8A 2NLUA 3KZYA 1ETVA 3H1CA 3SFZA 2X1CA 4C9YA 3OIQA 5HDNA 1C0WA 2QBYA 1HOMA 3OA6A 2ED0A 3FM5A 2GNCA 3FC3A 1YX3A 1FIAA 5LJ5f 2ZXJA 5E1ZB 1UB4A 2HSPA 3JSOA 1QWFA 4NS5A 1KONA 4A93J 4HQEA 1XTDA 4AWXB 3PO3J 1KHIA 2PUOB 2HTSA 1GCQC 3M0PA 3QXEB 1VQOA 2GA2A 4NQWA 2PFBA 1I50J 2Y0SA 5D4SA 3H5RA 2KE9A 4RTUA 3F70A 4HDUA 1H641 3CCUQ 4Y52J 5L3CA 1QW1A 1ZUKA 2FPDA 4LNPA 2HKXA 4ELZC 3KP6A 2V1RA 4OB1B 4W1UA 3ZMZA 2DNUA 2EQIA 4PJOC 5GJVB 2CQNA 4K11A 3CCRQ 3KFVA 3GOXA 2OX7A 4M78G 1ARKA 2KDSA 5FU7B 5GAMh 4L9TA 4BQNA 1QP3A 3NRVA 4GY5A 3QHSA 3C12A 5HCKA 3IUOA 4OWRB 1VQLI 2LH9A 5FB2A 4ZGDB 2D6FA 2IIMA 2YSRA 3RJPA 2R92J 1VYTA 1WYXA 1USTA 4LN2A 4HYEA 2ZNZA 2C6YA 4C5IA 4IUVA 1VQ9T 3GO5A 2CDTA 1MIJA 1E3PA 3MVPA 2MK5A 1YFHA 1XQHA 1MNEA 2IGMA 5KYWB 2DCEA 4EM1A 3GIBA 1YJNI 2GA1A 3HSRA 2JM9A 1IW7F 4M7AD 2OTJA 5CKTA 4GYGA 2V7FA 3BTCA 1VQMQ 2F2EA 4I99C 3WHBA 5GANd 1STZA 4LIVA 1FP2A 1Z67A 3GZ5A 1GFDA 3JRHA 1YN8A 5JI6A 2PMZA 1K4TA 4HW0A 1WGXA 4RAZA 4MFDA 1TWHJ 3G71T 4LFUA 1JE8A 5KCHA 2EYWA 3SZPA 3K4BA 1TWFJ 4ZYAA 1RR7A 3RZDJ 3HRTA 3ZXSA 4ITVA 2ED1A 1W1FA 2E70A 1M4ZA 2EQMA 1SHFA 3UNGC 3PFSA 1N9SA 4CA0A 2OBPA 2JA7J 1GCPA 1NK3P 3CBPA 5E1WA 5J1YA 2CRGA 1OYIA 3GVAA 4M7AB 2DA7A 2VOPA 2CJJA 2DMQA 4A3GJ 3W2WA 4IHTA 3ASKA 2R7FA 5A0GA 3HRMA 1JXSA 1WZOA 2P4RA 3OYFA 4JZ4A 4M75A 2A69F 1PJRA 2A6TA 5BPIA 4M6YA 2BHZA 1VQ4A 1BOAA 4ZC3A 4FX4A 2HBPA 1OZ3A 2H8HA 1YJ9T 3MZ8A 3E97A 1ETQA 2O6GE 2DXUA 4QVDA 1Z21A 4UXNA 1O3QA 1ZQ3P 1Y57A 4CYCA 2QYOA 5FWCA 3OV8A 1SD6A 4M6VA 4J83A 3FJPA 1ABOA 5KCMA 2ZXIA 1LNWA 1TWGJ 1SFUA 2STWA 2PUKB 2WSFE 2C06A 3CCLA 2GXAA 5GAOr 1R4NB 2Y4YA 2QQ8A 1Y8QB 1IV8A 4HLYA 2R7ZJ 3CUQA 4XRSA 4JBAA 5LJ3j 2QA4A 2L3SA 1NE8A 1G3WA 4FL6A 1YITT 2IBDA 2QUFA 4YELA 2D45A 3AKZA 4X9DA 4Y92A 1OU9A 2ZKZA 5FFZA 3NHNA 2QLZA 3E5XA 3KBGA 2RA2A 1K1ZA 3RQ4A 2O7OA 1GLNA 1HKSA 4RAGA 1OQKA 4ENKA 5FLXR 1ZX6A 1X3ZB 2VBWA 4E7IA 1WQ7A 3HOYJ 2E1NA 4CZZA 1NJIU 2CYYA 1YP5A 1WA7A 4HT9A 1H3ZA 1ULYA 2GGRA 1YJWI 1ZBJA 2RHXA 4CC3A 5D6YA 1MSEC 2Y0SN 2WSCE 3KYLA 2HKNA 4XKWA 1HC8A 1UAAA 2YUSA 1T33A 4AC0A 3H6ZA 2XDVA 2I8DA 1F1BB 2LBFA 2Z33A 4PJMA 1ACMB 3HOTA 3DKXA 3GYHX 2VODA 2IRFG 3A2KA 1R6RA 4RAFA 3PO2J 2V8JA 4GYIA 2MSYA 5FFXA 2YRVA 5GAOn 3CD6T 3HGGA 1N8RU 1V1CA 1BN5A 1YLFA 1H0MA 2CQQA 1UGPB 2R7XA 3LH5A 5DY9A 3JCMf 1YJWT 4HV5A 2KQWA 3CCMI 1QKXA 2WWYA 2N8GA 4JYKA 2ZJQF 1KFZA 4L6V5 3DQVC 5GPAA 2M8GX 2VGMA 3M9QA 2NAZA 3KYCB 2JK3A 4CYCB 3CC2T 4LG0A 2EYYA 4P5NA 3ZFJA 2GTJA 3JB9I 1NLOC 3EGXA 2XG8D 1G2HA 4ENNA 1WJCA 1Y0UA 1ZGJA 4BHCA 3LAPA 5HNFA 2MF2A 1ITYA 5K7FA 2AK5A 3OYCA 2EAYA 1ACIA 2CZ1B 4HCBA 5BOXA 2RHYA 3LWFA 3GP8A 1SSHA 3TMOA 1IHWA 3PIOA 2HQAA 3OS0A 2MZ4A 3CXCP 4QIWN 5CIUA 5CVVA 3RQIA 3RR6A 2E5ZA 1QPMA 2L0KA 5F27A 2ZCWA 4BH9A 2F69A 3OW2A 2KP6A 1QNTA 2COYA 4UB6C 2MIOA 5E3OA 2QA4T 1PWTA 4FE7A 4EMKB 4BXFA 3VU3C 2A6EF 4C8QF 4CCLA 1ORKA 1KU7A 1BL0A 2RQQA 3CJQB 1PHTA 2HVRA 3OIOA 3CZ6A 4I09A 3SDBA 4Y33A 4XBFA 4AVZA 3RPUA 3RYPA 2L3RA 3HOUJ 1I39A 2V1DA 3GNGA 3X25B 3NTHA 4F7UB 2DLLA 2E5NA 4J9CA 2ZC2A 5LJ3h 3CCMT 1QPIA 3DKYA 5GAHJ 2OUMA 2H27A 4XL9A 4AM3A 5CKBA 2BYVE 1X43A 3WG7H 4RTTA 1E17A 2BUDA 3CO6C 4TV7A 2CZ0B 5GJWB 2DFHA 4D8DA 4WTOB 2LCSA 3P9CA 1G3TA 2CSOA 2EA2A 3EGXB 5D5UB 3NWSA 4BL0B 1TWAJ 2L9VA 3BDDA 4AIKA 1G2BA 2EV0A 3ABMH 2CS7A 4BBSJ 3A8OB 2O03A 1QZEA 3ZQ7A 3EUHC 4JUVA 1QCFA 4A69C 1VYVA 2KXDA 5KYWA 1KZHA 2LDMA 5KNLA 1S72T 1JUPA 1TUDA 1Q7YR 3I0TA 4FHTA 1X1PA 3T9NA 4X9CA 5GMKh 3PL8A 4Z8AA 2COWA 1SF9A 2KIQA 3ZL7C 3J7AF 3IAS2 3NAUA 4OINF 1MHNA 3I4MJ 1FOXA 3EUKL 3PJRA 3WVEB 4IVNA 3K6GA 5FWBA 4PDKA 5ILUA 1KJWA 3JV3A 3OSSC 1FY7A 1OR7C 2FE3A 3BR1A 1TL8A 3J7YJ 4PZJA 3A0HC 3ERMA 2QAZA 4HA8A 4PJOG 5HLGA 2DLPA 3OS5A 2XDDA 1YTYA 3CCQT 3M0RA 1Q86U 3KYDB 1UMQA 4EQQA 2VLAA 2DJQA 2ZZDA 2UV1A 5FROA 3E6BA 4OMQA 1NG7A 2W84A 2COZA 1VQ8T 2MD0A 4FW1A 1P4WA 2LY2A 1ZR4A 3HTSB 5GANf 3B6AA 4PUSA 4OB0B 4UB8C 4F14A 3WTZA 4RTZA 4RMOA 3BJAA 2MC3A 2DMTA 1LDJA 1XSVA 5EGOB 2FUG2 3CUQB 4Y7NJ 1HF0A 4FE4A 1M2OA 4RTWA 4DEYA 4C30A 3QYHB 4ABZA 4IHWA 5EF6A 1GVDA 1UJ0A 2ESWA 3BTIA 2L0AA 5GMKj 1M1EB 1FMWA 2DAQA 4OMFB 4BB7A 2RNAA 4XU1A 4F92B 2K5FA 3LLRA 3LW5E 5DTDA 1PYVA 2XRLA 2EBPA 4HVWA 3LAJA 1FMVA 3V8JA 3OW2S 3U21A 2E5QA 2DTRA 4ON0A 4WK8F 4KICA 1RRJA 4QTRA 4E7HA 5E8GA 1MUZA 5LJ3f 1RZ4A 3FF5A 5E3MA 4NBQA 1X6OA 4EJTA 4A3MJ 1D5VA 1ZUUA 1QZZA 1VOMA 2RQWA 3SB2A 1T8IA 1MJAA 2EV5A 4I7HA 2IS6A 4QWQA 5CJ9A 3H3VK 2EFNA 2QA4Q 4A3CJ 2QDLA 3OYHA 3JSCA 4A63B 2EJRA 4JQFA 3SZTA 3CC7Q 1QVTA 2EZHA 3DWLE 5KAIC 4KYWA 2NUTA 3CMYA 3GWZA 5EG0A 4RB2C 3CCSI 2AKLA 4MZTA 1K9MC 3JB9H 2DK5A 2RNGA 2EZKA 2WAEA 2XUBA 2DTZA 1TXQA 2O01E 4L0ZB 4QVZA 2KIMA 3H36A 4XTUA 5IYCJ 2E71A 1KIKA 1H9GA 1IO6A 2XGXA 4EGZA 2O8KA 3RMSA 1KC8R 1WXTA 3EAEA 2XRNA 3RDIA 4UUTA 1WJQA 5GAOl 3VRYA 5IHIA 1CQTA 3ZQCA 1OCRH 4CICA 3Q0WA 3I71A 1EZZB 2Z0WA 1WJSA 4MTEA 1V5EA 2K4BA 3TOAA 1GHCA 5FLMJ 4XRFA 1D8KA 3JRDA 2QYZA 3KP7A 3MEAA 1G3SA 1IHVA 1XG1A 5EEHA 1XGSA 4Z6YA 4R56A 1JT0A 2NUPB 1JKQC 2XAFA 2PVOB 3ROUA 4HOBA 1QP2A 2V79A 2CZ6B 2VVKA 5IN1A 1W2BP 2EFPA 2E60A 3PFYA 3JSPA 2CP6A 3UDCA 4IIOA 3X20B 3JCMJ 2XKOA 2VE9A 2KK4A 5GADJ 1IV6A 2LNVA 3J80Z 3ME9A 4LDVA 2JA6J 1D3BB 1ZAOA 4IQJA 2ZPIB 4NL3A 2BE5F 2PVDB 4BHBA 2DJNA 2HI3A 4NUBA 2DTOA 1AKHB 1VQ7T 2H6CA 3TDZC 1U5TC 1FJLA 2LDUA 2KVQG 1Z6RA 3CPFA 3KP4A 1ZYRF 5F0CA 2M5WA 3WTVC 3QWYA 3CCMQ 1P9QC 1A6IA 3ECHA 3WTWC 3S2HJ 5KYUB 4FYWB 3P7NA 4MO7A 2J5PA 4XTZA 3BR0A 2M9UA 3KP5A 5FD5A 4DQ2A 1I1SA 3JRAA 1EH8A 1D3BA 2XK0A 2XU8A 1YI2Q 4LD9K 2O8XA 4IHSA 5D8LB 1JUMA 3H0GJ 5E3LA 5EEAA 3JCMd 1VQKA 1DUXC 3ZGKA 2ECZA 4JLIA 3CUQC 3I56T 2HR3A 1X75C 2H8RA 2KGTA 2VN2A 4G8XA 2ZMEC 1YFNA 3ZQIA 3CC4T 2KRFA 5GANh 1OMIA 1Z91A 3JW4A 1OOTA 1D0XA 4BHPA 2M0YA 3TP3A 2TCTA 2JUCA 2RPNA 2X98A 5GAMg 1VQMI 3G1OA 1QQJA 2FBHA 2XF6A 4EM0B 2GFUA 5ICFA 2IA0A 3OS1A 2RQPA 1M8MA 3EDPA 1X3UA 4IIMA 2UWMA 1YJ9I 2CUBA 2HSEB 1FBUA 2SEMA 1K9AA 3INZA 1Y96A 4N4GA 5LGNA 4C2MJ 4E47A 1F1ZA 3H5AA 4BU2A 5IP6A 5L3FA 3RI4A 3I59A 1BW5A 4MNUA 2K27A 1PG5B 2EFQA 3FZVA 1H8KA 3SFMA 3S16J 3GFJA 5B1AH 4X6AJ 3I53A 4C92B 1YI2A 2O3FA 1L3LA 2JNGA 1W5TA 1PCXA 3L00A 5DM6F 5IYDJ 2DRKA 4A4HA 4PJOA 3BR3A 3TGNA 1UG0A 2VV5A 3H0HA 2DERA 4PJOD 3VWBA 2L89A 3CCVA 4OMPA 1JRIA 2RN7A 4KIBA 4C5EA 2H1LA 3VYTB 3BG6A 3HTUA 3DPLC 4JJDA 2OZUA 1LFUP 3CC2A 3FIWA 1OCZH 2DJIA 2I5UA 4B4CA 2F5CA 4M9XA 5DM7F 5BMZA 2CUFA 1T2KA 2CV2A 2L2PA 1RAEB 2XD0A 1MBEA 1K8AC 3IP4B 3FXMA 3HOWJ 3E19A 1R1VA 2XDBA 1SMTA 5CLSA 3O8GA 1BIAA 1QVUA 1R36A 3IWZA 3L1AA 3FBNB 3I55T 2FEZA 3BZKA 1O75A 2QGGA 4M7AC 2FRHA 3EGDA 4MDXA 4A3DJ 2CO5A 4XRMA 1PD0A 2ICWG 2RI3A 4II1A 1VTNC 1X19A 5ECAA 1CF7A 1T56A 3QPTA 5KYXA 3I55Q 3GTOJ 3P9IA 4PSWA 4JK1X 4EMGA 4ZGJB 2CUJA 3EG0A 4CC7A 2DODA 3OSVA 5L3EA 6PAXA 3HHGA 2XIGA 1IDYA 5IOZA 1PUFA 2MABA 1Q95G 2ELKA 5DLOA 1EF4A 4E7SA 1J0RA 3CESA 3OYMA 1GXPA 2C0OA 2VGNA 2BVLA 2VKDA 2YDLA 3H9JA 2JUGA 4DGWB 2ID3A 4I76A 4IX7A 3SWNC 2ZSHB 3LSKA 2P4WA 3SEZA 1O9SA 4V2FA 2XAJA 3M4OJ 4UC4A 2E1OA 4P9UA 1MV3A 4M7DC 1ETYA 3JB9J 1WI9A 3CCJI 1NHAA 1X1CA 3ZRGA 2K6DA 4XU0A 3WU1B 2Z1DA 4C3JJ 2LCLA 5HKCA 1WLPB 2IAIA 5I2MA 1CF7B 2P8TA 2QQBA 3M1EA 5FGMA 3V8KA 1FOKA 5IYBJ 2HL5C 4IO9F 1YYVA 2HAXA 5C0MA 1DU0A 1M1GA 4RB0A 3HKSA 2J5OA 4KH0B 5GMKl 3O8HA 2K85A 5K7ZA 1YRNA 1UUEA 1T3SA 1UJYA 1WQ2A 1M8VA 2UXXA 1HSTA 3NARA 3ZOBA 3G3ZA 1SAUA 4AVPA 3LQQA 2A28A 2B0LA 2YU3A 2P6TA 4WF2A 2XC7A 4C2TA 3S14J 3J7AW 1PKTA 4XTVA 2NNNA 1Y1WJ 1I4K1 2KYBA 4R55A 5LJ5h 4UV8A 4Z89A 2RN8A 1G8XA 1UDLA 4M74A 3CC7A 3LSTA 1I5LA 1I1GA 4DOVA 2E10A 4P55A 2YUOA 2LOOA 3PFIA 2GTOA 1VQLA 5EEGA 4OIOF 4M9SA 5L3GA 3A8GB 2AT1B 4J7IA 1GRIA 1FZPB 3K2ZA 1D3YA 3G1MA 4FW2A 4N4HA 3JCMc 2VB6A 4MGRA 3QU6A 3N05A 2DI3A 5GP9A 2LQ8A 2XHCA 4IUUA 1FYKA 2CP5A 4G12A 1KU2A 2CQXA 2ISYA 1SEUA 4FSXA 4HQMA 2LX7A 4CZCA 3SD4A 2FD5A 1Q81R 3CCEQ 1VI0A 2KL4A 5I22A 2V6EA 3HJEA 3MCAB 3JCMP 4D7MA 1Q7YU 2LK2A 3MPUB 3PNWC 1AWCA 1Z6TA 3G4SA 1XB4A 4PJNA 5DCMB 2VXEA 2FOWA 2QENA 4NC6A 2BIVA 2ELJA 1GFCA 2K3YA 1FNNA 3RKXA 1M5Q1 1M9SA 3FXOA 1WJEA 3HRSA 3S8PA 4KGVB 2X3WD 3S93A 5LEKA 4B1RA 1TG0A 2IEKA 4NNJA 3ZQQA 2EJ9A 2X4JA 2KRHA 4U88A 1YIOA 2R7WA 2P6SA 5F0HA 5D4RA 3J81K 1U5SA 3JRFA 2RQTA 4DOZA 2DXIA 1YRNB 1M3CA 2DFUA 1OCOH 1J2XA 4KBMB 2IP2A 2F5EA 5J4VA 1TW3A 4IPAA 2LD5A 4M78D 5LJ5e 4H0EA 4IHYA 4DOWA 3ULQB 4IRIA 4JRKA 1Y7XA 2DJZA 4AYBN 3BFMA 4KMFA 4B48A 2NVXJ 2Y90A 4HCZA 4KGXB 1T98A 3GTMJ 2A6HF 3HPGA 4MZMA 1UGSB 5HS9A 3CD6Q 2QVOA 2AKKA 3QYEA 4BDZA 1JO8A 3CCUT 4JX6A 2HQXA 1Q1HA 2RJDA 4S05A 5DCFA 1AHDP 2JTEA 1N8RC 1HCRA 1V3FA 4LOCA 2BEOA 2LY1A 2KJCA 2X6WA 2DTHA 3VS1A 3CCLI 1MZBA 4Y17A 3DF8A 1R58A 2NXNB 1ON2A 4BNCA 1PUFB 3KUFA 4F16A 2DA9A 1JUSA 2A05A 2HGCA 4KN7X 4EMKC 3H0DA 1OCCH 3SZGA 1I6XA 3LA2A 4LG3A 2DD5A 4BBRJ 2DVEA 1K9MU 3Q1JA 1W7PB 1W6XA 2YSQA 2KZVA 2R4GA 2X6YA 5JLWA 2PZ1A 4L5GA 3LYIA 1T6SA 1X01A 3QU3A 3M07A 4HCKA 4C92C 3QRFF 3SHFA 3K7AJ 2FMLA 1Y39A 3HPHA 2O88A 1M90C 1O4XA 3GTGJ 3CQZJ 5IHNA 4OMMA 3ELKA 1DP3A 3AHUA 4XU3A 2K4JA 4J01A 3I5RA 3E9FA 4J8OA 3DLLA 3H35A 1VUBA 3A8MB 3EH1A 1V5FA 3EPZA 1SFXA 1X2MA 1SFEA 1OYWA 4N4NB 4PFOA 1T0FA 5GAN6 3M3YJ 3S17J 4J19A 2M4KA 2RK2A 2Z5UA 3BC8A 1LVKA 1B9MA 2TDXA 5TGTA 4NOYA 4ZN3A 1FEXA 4KT6A 4EJOA 4LIUA 5LHIA 3OYIA 2E3HA 2QSFX 5TRDA 3CC7I 2BXYA 4AU7A 1HSQA 2HXIA 4XORA 1B72B 2DN0A 2ZFWA 1W70A 1IN7A 2LFBA 4XTXA 5GAN7 2XAGA 2WV0A 4WXHA 2E1MC 3NWTA 1M3AA 3HFOA 1VQ8Q 3N5BB 3R60A 4KUIA 2DQLA 4DZJA 3C94A 5BS6A 1W7PA 2EQKA 1TT0A 4B47A 2DDBA 3GTLJ 2ZPFB 4U87A 5KHDA 2R93J 1WQWA 2VUMJ 1H89C 2XI9A 1YHQT 2HYGD 9ANTA 2ZO4A 4M77E 4PJOF 2E19A 2L9NA 2AZVA 3DLAA 4LB5A 3EG1A 4RB1A 5A0LA 5J4YA 2EFWA 2JMCA 4HG2A 1UJ8A 2RKHA 3F6OA 1OR7A 3BQYA 4MQ9F 3BE3A 1LEBA 3HHHA 4YTLA 2FPFA 3GEZA 3CC4Q 3KPHA 4BYYA 2C0TA 2W24A 3MMYB 4A0ZA 5GTHC 3H5NA 3QYFA 2ZBKA 1QCNA 1TNTA 2QWWA 3L9FA 1K8AU 1PSFA 2DQRA 3CDLA 2P5VA 2P7VB 1GV2A 1MH3A 3KE2A 4L5JA 4CO8A 5F0FA 2QQSA 4N4IA 1V55H 2FZKB 3MP6A 4E6RA 1R5ID 3C2GA 3QYBA 3U1KA 4AYBA 2O2OA 3M53A 4FSSA 5L3BA 4CGZA 1IXRC 1SKUB 2QXFA 2HKOA 2XF7A 3LGFA 1K9MR 1RABB 2GIZA 5IH2A 1FTZA 5IPAA 2JSCA 2PTKA 2DL8A 3OW2P 1B1BA 2SRCA 5FLVA 1U6GA 4CCNA 3QUIA 3QZ9B 3M0QA 2D1HA 2LF8A 3J80R 2HYFA 3OMGA 2GFAA 3RERA 5D8KB 1ZSZC 2FRYA 3CC4A 4XM3A 2A07F 3EG2A 2BVMA 2MA3A 3FBIB 3BDUA 3BP8A 5A2QE 1TWCJ 3LA3A 1U9NA 2JVHA 1HW2A 1NZ9A 1SD4A 3CEYA 3DB4A 1VQ6I 5KH6A 2OQGA 1ON1A 3S1NJ 5JHUA 4KFCA 2LJ3A 3MN2A 3JRZA 3A5ZB 3MKYB 2W10A 1IF1A 1YJNT 3UATA 1FT9A 2DPUA 5ICEA 4P1WA 2PMZN 1X4OA 3OYDA 2MFZA 4XIDA 1UFMA 3ZQHA 1O57A 1XMXA 2KIUA 4XMYA 5KAFC 1JJ8C 4G7ZF 1U1TA 2DBKA 2KROA 1SVOA 1WSUA 3MAJA 5GAEJ 2LLKA 2V9VA 5J1UA 3SXYA 2COMA 2YPRA 3V7SA 1AWJA 3RMQA 3UPUA 1KSWA 5HLIA 2KISA 3FXRA 3AFHA 3K4NA 1MGQA 2ZGWA 4IUTA 3UWNA 1YJWQ 2JPCA 1Z0XA 1PSEA 1W5SA 2WC2A 2AQEA 2XPVA 2C0IA 1ABQA 2V1XA 2GQQA 3NFCA 4TVRA 3OYNA 1H9TA 2HS5A 2IGNA 4YRVA 4BY1J 3P5JA 2QEXI 2BBYA 3QP6A 1FC3A 3BG7A 3ZP5A 1D5YA 1BA5A 3FXKA 3MP1A 4F7UE 4N9HA 3CCQQ 3G4ST 1N27A 1UGRB 4DBFA 5DDGA 4M3BA 2CP7A 2EYXA 4PK4A 4F04B 2H94A 2DDAA 3HOSA 3OOPA 2CGHA 2F2WA 1K4SA 2R7VA 2UZKA 4ZJZA 4J7FA 4JJNK 2RI2A 1NEBA 2EIKH 3JCMW 2DZCA 2IVMA 2A61A 3S1QJ 3BR5A 1YO5C 3VSKA 5LD2C 2G7HA 1TP4A 2OZ6A 3WU2C 2DD4A 1P7IA 5LFAA 1U5TA 5GAOp 1QVFS 1U5TB 2YU9J 2ADUA 2BY1A 1KQ8A 3CBOA 4EDUA 3ABUA 4CCMA 3SDGA 3ER0A 2HKQB 1HJDA 1POGA 2M30A 4RAYA 5J47A 5GMKi 2LCCA 1VQPT 3OS2A 1A5JA 4Z02A 2GIVA 3RUXA 3HDDA 1B4AA 2M7AA 1WH7A 3BWGA 2P5KA 1FX7A 4RGUA 1G3YA 1SD7A 2E1HA 1NLPC 1IGUA 5AIQA 2CH4W 4A54A 5A0DA 3F23A 5GAN8 1Z7LA 4YFKF 4N0BA 2KEAA 4B3XA 3CCJT 4EJWA 5EDNA 4J00A 2PI0A 4KNYA 1TTHB 1UHSA 2AHQA 3VV0A 3FMRA 4QSHA 4C5HA 1JU5C 3W2VA 1ZTRA 3F9KA 2M45A 2JRMA 4BAYA 2QKMB 4L5IA 4DYRA 1VQ8I 1SG5A 1MMGA 3F22A 1XGMA 1MJBA 1YWOA 2YRCA 1E7OA 2A7YA 3NMZC 2JZYA 1HW5A 4XSZF 2QG9B 2HWVA 4HNUA 3ZEHA 4F7UG 3EGDB 4GFBA 5FLXK 3GPLA 2DW4A 2M34A 2JT1A 2R5AA 4A3IJ 4EEFG 1SFOJ 2E7WA 1S7EA 3PQKA 1QZYA 1DPRA 1R4MB 4E70A 2CUDA 1S72Q 1MMNA 1MDMA 2JN6A 3PVQA 3CD6A 4IQ4A 4ZDPA 4CCJA 2VJ4A 5E18F 3T8RA 2FO0A 3CJNA 2OJ2A 3MKLA 3BLYA 3HTRA 1P2FA 4XICA 4PNOA 1Q86R 2VJ5A 2HDDA 1NG6A 3V8LA 3E0JB 4G6TB 1HK9A 4RG8A 1VQPI 2EBIA 3DPTA 4MDWA 1I27A 1PVEA 3HL8A 2F48A 3I4NJ 5K7HA 2HYJA 2MH9A 3CCVT 3WGGA 2PBIA 1BW6A 1GL5A 3WTUC 3REOA 2YHTA 1W0TA 4OGCA 5IP7J 4II2A 3RCOA 1UTIA 4XOPA 4M77D 2XPUA 4XRSG 2CSQA 2RMOA 4ZGEB 3I9V2 3FDRA 1V54H 3BJ6A 1UFFA 1USSA 2R5ZA 1R8OB 4D1QA 3GTKJ 1M3BA 2EPDA 3QSUA 3CMAI 2Q8KA 2QEXQ 1ZHFA 2BV6A 4LK1F 3E3VA 3R6OA 2ZCFB 4C0ZA 4EATA 1PRMC 3IH2A 3JB9F 2E6NA 1IN6A 2M02A 1TUCA 1P7JA 2W4SA 4EJVA 4C8QA 4BY6B 4JJBA 4X34A 2VBYA 3GLLA 3HG9A 3D5RC 2DFEA 3GMEA 2EIJH 3N97A 1UECA 2BW3B 1XJWB 3M0UA 3BOQA 1SANA 4EIKA 2HQEA 5C6SA 2MVTA 1TNSA 3L7WA 3VYHB 4C8QG 2GZWA 3HM5A 2P4TA 4HKEA 2L3PA 3L09A 3R0AA 2GAUA 1YIJT 2KMTA 2D0QB 1I3AA 3W6VA 1JXOA 3HFNA 2LMJA 1B34A 1EFNA 4LE9A 4BJ6C 4BKXA 2OD5A 3G71I 5IT9K 4M78E 4I02A 2LNBA 1X69A 1X6GA 3HHTB 2LQNA 4N9IA 2DL3A 3VS0A 4A6EA 1QRYA 3CTAA 3MZYA 3FM3A 4I98B 2QF7A 1X1BA 4XN3A 4BI4A 3DFGA 1YBYA 3MZHA 4M7DF 5FJ8J 3NTIA 3G1JA 1MDMB 1FYLA 3HSFA 3FX3A 2R57A 2RH2A 3VKIA 4AG2C 4C0GA 3OOUA 5HLHA 1B9NA 3ABTA 2DMNA 1Z1DA 3LGLA 1KQ9A 1GXQA 2JSPA 1ETWA 2OQRA 1WFWA 4A4EA 1B6AA 3QP5A 2GWRA 3E5UA 3GFMA 1W0UA 2VONA 2F4OB 2K9LA 3KEOA 1UE9A 2QDYB 3K10A 1YITQ 2M4GA 3WTYC 3IRQA 2E1CA 3F8NA 1IB8A 4OAYA 2LT4A 3J81R 3A8HB 3OY9A 3H0IA 3WE2A 1RLQC 5GAMj 3HSEA 1IDZA 5GTIC 2X4HA 1D0YA 1I3QJ 5KYYA 3CCRA 3I56I 1VQ4T 3QOPA 3ZR8X 3J7AY 2K2VA 3PIPF 1NJIR 1ZG5A 5HS8A 2HNIA 5CQEA 2E35A 2XGDA 1N75A 2DT5A 3R6NA 5J8CA 5I2SA 1D1AA 4RGRA 1VQKT 3ZMSA 2PJPA 3FKIJ 3GF5A 4M6XA 3AG3H 4L18B 1RAGB 2BE7D 2Y4XA 1Q1VA 3VS7A 3EGUA 3TO9A 4CC2A 3K2AA 3ZCOA 5GMKm 1U0JA 1X6BA 1FXXA 3O8VA 1RADB 5IT9E 4D5CA 2M7BA 3CMAQ 1VQ5I 8AT1B 3EFRA 1LUJB 1NTCA 1VIFA 2V1UA 4LLGF 2NUZA 4Y28E 2QEXT 2QEXA 1ZLMA 4Y4RA 4V19K 1NG2A 3LX7A 1VQ8A 1NEGA 2DZ9A 3TKYA 1OJLA 1D09B 3COAC 2YS9A 3TL4X 1VA7A 1R0BG 1BJZA 2M0MA 3TOBA 2FJ1A 5C3EJ 3CC2Q 5CKFA 1HKTA 2L3QA 3O2PE 4A3FJ 4DYQA 3CCST 1BIBA 1XN7A 3DBRB 4ZYDA 3J81Z 3DTIA 2D0NA 2LVMA 2CMPA 4M77A 4BS9A 2EYQA 2W1OA 3MKZA 3CD6I 4MEXF 3A01B 3WG9A 1O3SA 4D8KA 3EHRA 2BZTA 2E6ZA 4B44A 1IN4A 2VI6A 5ICGA 3TQNA 2VC1A 3LNQA 3PNYA 2L7KA 4BE1A 1VIEA 4M78F 1K78B 3S3NA 3FHNA 2ZJRF 2OAWA 4G9YA 3CDHA 4WX9A 2LP0A 3IWFA 2DL5A 3LWIA 1YJNQ 1NYGA 4U7DA 4JPBW 1F43A 1WZ2A 3FISA 1K61A 2AQFA 2DYSH 1W2BS 4UUSB 1A6QA 2L9RA 2YRDA 3L2QA 2FNPA 4HF1A 2EFIA 1VQ7Q 1MBGA 2RNJA 2NVTJ 1M1KR 2MLGA 3VODA 3VYRB 2OTJI 2RM4A 1ZRDA 3OYKA 4RA2A 4FYYB 3OYGA 1E3OC 4AIJA 2J06A 1WJFA 1VF9A 3HXLA 5D6WA 1Y0NA 1WHHA 2DFIA 4M7DB 4HZFA 3IV5A 2V1NA 4HBLA 3JAMR 3M0SA 4BEHA 3CCQA 1ETOA 3PUBA 4IHXA 1RKTA 3L2CA 5K1YA 2Q2EA 1M2VB 3QJ6A 1IRFA 3SJMA 1UELB 1J7KA 4Y3OA 3BPVA 2LRDA 4CYDA 3EG3A 4HPQA 2CW7A 1IC8A 2A36A 5M5XJ 1BC8C 2CUZA 2OV7A 5DCMA 4YIFA 2O61A 3HSBA 2XV4S 2KT1A 1SC7A 4PLLA 1HW1A 2BW3A 1TUGB 1YHQQ 1R9TJ 3RTRA 3UR3C 3HKZA 5H20A 3HL2A 3TBIA 3K4JA 4PSXA 1OU8A 2DVJA 1J3TA 1JHFA 1UB9A 1P6RA 2QGUA 2PG4A 2XSDC 4F3QA 1J9IA 3QODA 2RHZA 2WSEE 3EFOB 4B9XA 4KH1B 2ACJA 4A0YA 3I58A 4I0AA 1WJRA 2VC8A 3JR9A 1A04A 1ETKA 1XSXA 5EG2A 4C0DB 2B8AA 5M5WJ 3H41A 3VS6A 3OL4A 3HUGB 2XMFA 2GCXA 2K7AA 3FIFA 4RCBA 1I5ZA 4XTWA 4HT8A 2L54A 2MBFA 3EQLF 4OMNA 3CLQA 4RTYA 4H4KC 1LB2A 1OI1A 3R4KA 3MEUA 1ZUYA 2M0OA 5M3FJ 5ICCA 1GBQA 1B34B 5TISC 3TW6A 1K0SA 1Z05A 3EUAA 2IJLA 2WTEA 2ZJ2A 3S3OA 2OAZA 2ZPGB 4HVVA 4UUVA 4RM3A 2RC4A 2QA4I 2M16A 2A08A 2AS5F 2M0CA 3C3WA 4KUMA 1W36D 1Q82C 2R3SA 2Z3YA 2PN6A 2JTVA 2QZ8A 2J6FA 1Q81U 4DZPA 4F55A 4BDYA 3HOZJ 3CCRT 3SEMA 1A31A 3WTTC 1JJ2S 3GUDA 3AL0C 3C7JA 3S2DJ 4J6XA 5GANj 1M90R 3QYGB 2DXCA 3PUFA 2DMUA 1U06A 4KULA 1LKXA 2W7NA 1WPYA 5CQXA 1S9HA 4CCOA 3JCMX 5EG0B 3BT9A 2X6XA 2EILH 2Y30A 3OMYA 4OMZA 3RBBB 5DM7R 4IKFA 3DU6A 4GO1A 3B73A 2P0QA 3REBB 2VOOA 1LPQA 3TEEA 3CPWP 4P5OA 2LMDA 3AL0B 2IT0A 4LGWA 3JAMZ 3DCFA 3LSGA 2O31A 1R1UA 1G6NA 2G7UA 3OYLA 4LK0F 2R0QC 1HBXG 1BKBA 3I4PA 4ASNA 3H3ZA 2Y2ZA 2JS2A 4Q4ZF 5IXFA 1XGNA 4A5NA 4DA4A 1KC8C 1VQOT 2KQRA 4ESBA 1WI3A 4E7KA 1T39A 2RAEA 4ZDOA 1ONVA 1P4XA 2VC0A 5E17F 2YT6A 4UHTA 1VQLQ 2DOEA 2FNAA 2FQ3A 3MD2A 4KGZB 4XKVA 3D5LA 1YOVB 3W6JB 2NS8A 3ZQGA 2E34A 3JAMK 1IUYA 1N5ZA 2PVGB 3CPWA 4LUEA 1AA7A 4MZPA 2LTPA 4C92E 4RLFA 1Y56A 2FF4A 3ZMUA 1RLPC 5EGOA 3DTKA 4M9ZA 3CCRI 1WJAA 2RQVA 3JB9D 2CS3A 4BY7J 3BR6A 2FG0A 3JTGA 4KMUX 2CKKA 5KYXB 2ZPHB 5KE2A 3T8TA 1JGSA 1WJ5A 4E7ZA 3CCUI 1DPUA 2PU9B 3ZMVA 2DA4A 1R0CB 1ZRFA 1KHCA 2KRSA 2DFFA 3M5AA 5LJ5d 2VBXA 4G6DA 1Y07A 3QIIA 3CXCS 2DA1A 4XLEA 3KX2A 1QMCA 1KQSS 2Y31A 5IP9J 5H2FC 2DBBA 3HEFA 1CGPA 2VASA 1ZG3A 4C0DC 1LNXA 4ZYEA 2HDCA 5HNHA 3KP3A 2X1DA 3B6CA 1PUEE 4C8QE 3EYYA 2K3PA 4OVAA 2P0WA 1SVLA 1TU0B 1XNIA 4NL2A 1RAHB 5L23A 3SEQA 1RIOH 3VRZA 3LSPA 1E6HA 2RD1A 1MH4A 3CP8A 4HEA2 1Q82R 5E20A 3SYTA 2VQGA 1V5GA 1N78A 4C92A 4YEJA 4Y15A 1R7JA 2BZ8A 2DA5A 3ISPA 4J5YA 4M4ZA 2ENMA 2OC6A 1TWBA 1ZGAA 1IUFA 2A37A 2R5MA 3CCEI 1T3LA 3F6VA 5IT9Z 4RLQA 1M1FA 2CW0F 4R1HA 3D1NI 3BY6A 1Y96B 5L8RE 4BD3A 1AWWA 5CPRB 5FKLA 1WHLA 3PVLA 3UF4A 5HY6A 3G7ZA 1BB9A 3LQRA 3OB9A 4LLLA 3J80K 3P9KA 2QK0A 2ROTA 1WKMA 2LVSA 4XKBA 1AU7A 2JW4A 4UVCA 1IRZA 1OZ2A 2ME0A 5KVRA 2LF7A 1TOVA 3NPFA 4JJCA 1W2BA 2Q1ZB 2X4YA 3LMMA 3X2QH 2GM4A 3J7AO 1AOYA 4QQ6A 2JWTA 1CSKA 3MCZA 7AT1B 2ZFUA 3Q0VA 4A12A 4I0BA 1EH7A 4BJ5C 4X0GA 3K69A 1QU3A 4U0WA 2K02A 3QAHA 4BJTA 2EJGA 2K9QA 2FPEA 4J9BA 2V6CA 3JCMV 3CMET 4M75G 1JKOC 2BHYA 2WY8Q 1K4US 3LSHA 5F6FA 1BI0A 3GTPJ 1AOJA 2NVUB 1QVFP 2F4MB 3G1LA 3H9QA 2HNHA 4XSXF 4EMKA 3M58A 3W2AA 2MOXA 5IAYA 3IKTA 4OIRF 2F5DA 2QSGX 1SEMA 1GV5A 1BR2A 4HLXA 2FEIA 5KYUA 3KXTA 2VKNA 1J09A 1S7OA 2CUEA 1FYMA 3I54A 3CC4I 2XPWA 2EK5A 2YR2A 2YX7A 2G6FX 2QQAA 3SDZA 1HSJA 2K5CA 2JA5J 1VYUA 2HD0A 4MQVA 1QCOA 4FX0A 2JN0A 2DETA 2XROA 1ZN2A 1W4MA 1VQ6A 4BQOA 2MG4A 3R61A 4BQQA 4QLCU 1GCQA 5LL6S 3KP2A 1C0MA 1S6LA 1D8JA 5I21A 3ZPLA 1GVJA 1XX5A 2KPMA 4PFPA 2DPDA 3GF2A 3S1MJ 2Y48A 3MFKA 4LG0B 4JRPA 3RSNA 3Q9VA 1OV3A 4IOAF 2NS7A 1WHUA 4BEHB 1DGRM 4EM2A 3QWXX 5CAIA 5E79C 2F5VA 2X4WA 3ZMTA 2KIFA 2Y69H 4BE2A 3NGPA 3EFOA 3VYGA 4PGHA 1RESA 3U23A 3BR2A 3J80E 4EMHA 1IO2A 3G2BA 1AKHA 1ZA1B 3TU4K 1VQ7A 4UUSA 1U1SA 1ZQ1A 1B72A 2KRMA 3VEPA 5A2QR 1CKBA 3ZQLA 4ZYGA 4ZYHA 3H8ZA 2ME6A 2LKPA 5LHHA 2XASA 4M75E 4G7HF 2VYTA 2XAUA 2EYZA 1VNDA 3A8LB 3NEUA 2AHJB 3H92A 1RR8C 4CH7A 4HAMA 1HQCA 4UV9A 3IL2A 1QA6A 4GRIA 1OYYA 5J1RA 2NVQJ 4XAXB 3TSWA 5FLXE 1JJ6C 3V42A 4IL6C 3IAM2 2DA2A 1JJ2A 1TLHB 2FMYA 1QQIA 2L7ZA 1Y1VJ 3LSRA 3CCQI 3VUZA 1HXDA 3JB9G 2D8HA 1VQOQ 1BOBA 5BNGA 1ENHA 2L4AA 4I6ZA 3C4SA 2XB5A 1SMYF 4JLGA 3TVTA 5FLXZ 1AVZC 1MNMC 2A0FB 2E3IA 4C5GA 1LCKA 2DL7A 3MJXA 4ESJA 1BI1A 4QPQA 1PNJA 2HEQA 3G4SQ 1MV0B 5IHKA 3LA7A 4FQGA 2K9MA 3VSLA 2DIQA 1JTXA 1K6YA 2JUFA 4DBHA 1UZCA 1VQMA 2DO7A 3DB3A 4J9EA 2K7LA 2L7MP 4NB5A 3CO7C 1D1CA 2W82A 1VFCA 1MSFC 3L1PA 3GCMA 1ZLKA 1YJ9Q 2A3SA 2KHMA 2J7IA 2K5IA 2FU4A 3M59A 3U9GA 4M77F 1KQSP 3GTJJ 4IHVA 3GXOA 3QPHA 4ELYC 1KQSA 4A5MA 2OTLT 3O5ZA 2L9SA 2MWOA 2H6BA 4E7LA 3WXMB 2XB0X 3GZNB 2K79A 2KY9A 1K73R 2E7XA 4ZN1A 1MGTA 1XD7A 3VYSB 2FL7A 3M4GA 1VQNI 1K6OA 1HA8A 4J9GA 1R5GA 2Z9OA 5FU7C 2DMPA 1R5HA 2ZMEA 3BTLA 1U8RA 2GQVA 3EH2A 2IXSA 2VIXA 5EJCA 2BE9B 2X51A 5JVGF 2CZ7B 1AZEA 2EIMH 2BZYA 2H3EB 1BR1A 2OCCH 1U2WA 1UGVA 2J6KA 3C0CA 1AWOA 2L8DA 2K4YA 4Z88A 2FHDA 3A1PA 3BCAA 3ERED 4BY6C 3OYEA 2X9HA 1QVFA 2WV1A 4LB6B 3OIPA 1LFPA 2QGFB 2XICA 3UKGA 1KU9A 1PKSA 4M73A 4RKUE 1RUOA 4RM2A 1RAIB 3FDYA 3GFLA 1BBYA 3RESA 5E3NA 2J6OA 2GXGA 2W57A 1TC3C 4S04A 4MMKA 1JGGA 3LWHA 1FLIA 2A68F 3CMAA 3TDUC 2VL8A 3E6DA 1DDNA 1WXBA 1YG2A 3LFKA 3OYAA 2OA4A 1GUUA 1U8BA 2KFDA 2NYXA 3I55I 2RF0A 4WCIA 5IXBA 1W7PD 1Z7UA 1BM9A 4XONA 4QW2A 2O9LA 4KJZA 2DMOA 1Q81C 3FXJA 1NM7A 2KT8A 4Q5WA 4G94A 1E6GA 3GNFB 1OEBA 1OX8A 2H3JA 5LJ5g 1JT6A 5F04A 1IG7A 3REAB 4JOMA 4A3KJ 5DV5A 1NK2P 1OFCX 2P7CB 2D1VA 2P0KA 1ERDA 3QO3A 3M1CA 1RI7A 1B8IB 2CH4A 2HCKA 3OBYA 2V8IA 2EWNA 2OF7A 3ONQA 3EUHA 1RKWA 2WB1A 2VKEA 4ZZLA 1GT0C 2XGEA 2A5YB 2RDPA 2RB6A 4AFQC 4A53A 5GANe 4HCCA 2FZGB 3C1DA 2GOXB 1X27A 2XSJC 2EV6A 3QQAA 3E5QA 4XK8E 1EH6A 2PJRB 1WHKA 2E64A 1IGQA 3PSFA 4HSTA 2F5TX 3KZZA 1WVRA 2K2MA 3G73A 4A2UA 2E36A 2JTMA 2WAQN 3DBHB 1K76A 4RMNA 1TZLA 1S5LC 4HX4A 5CVIA 2R7SA 4KDPA 2V9PA 2VXFA 4LDXA 2YUPA 2Z99A 3K4LA 4LITA 2TRTA 1S1NA 5FRNA 2EB7A 4J9IA 2JJ9A 2CFOA 4AG1C 2QM3A 2DE0X 4P9FA 5B5EC 5K5QA 4Q5SF 1B3QA 4XR6A 3PMIA 3AG1H 5ILVA 2L01A 1YW7A 3HUGA 4FETA 5FKNA 1OCTC 5CKHA 3QDRB 3CPWS 1ZBXA 3JCMh 2DX1A 3KETA 4DEXA 3R6SA 2LKSA 2CGPA 1SHGA 3HOVJ 3K9TA 2HU9A 1IN8A 2ISZA 1WNLA 4KRTA 1S72A 5K5RA 3LL7A 1QBJA 3V7CA 1LDKB 4DYCA 2GLOA 5LLQA 1YIJA 2D8JA 1TW2A 1F5TA 3ZBDA 3VOEA 4A3LJ 2ZAEA 2FYKA 3MKDA 3RKYA 2GQIA 2R7UA 2JA8J 2LREA 2JA2A 1LPLA 5FD6A 4QQGA 4UVAA 2D2WA 3A1YA 2WY7Q 1VQ9I 4RGXA 2PLYA 2KR3A 2RHUA 3CCYA 3MEWA 3QPSA 3VJPA 3IH4A 5IOYA 2E2JJ 2X0LA 5DD4A 1AWXA 5CCAA 3CCEA 2A5WA 1RC9A 1VQ5A 1YQAA 3GLXA 3HZJA 1G59A 3F21A 2DEQA 2QCOA 3BQZA 2JXBA 2Z16A 1FOYA 2LKXA 1M27C 1WHJA 3FB9A 2WA0A 3G4SI 2ABLA 2GBYA 3E6MA 1TH7A 2DIGA 4B09A 4M77G 3CCMA 1R1TA 3FXLA 1OPKA 4L9NA 5GAOm 1OKRA 2ATCB 4XKCA 1AHJB 2X4XA 1ZRCA 4HDVA 5HS7A 1F36A 4CDGA 2E12A 3RDVA 2JM8A 2FBKA 2QQ9A 3FMSA 3PM1A 4RTVA 1VQKQ 3OYYA 2DTIA 2A3LA 1WJBA 4D0PA 2ZMEB 2Y0MA 3CCLT 3DKMA 1IXDA 4DIQA 4XQFA 1NH3A 1WCMJ 2MI6A 2D1XA 1Y0MA 3CXCA 4XOTA 3TCJA 3FWEA 4LD5A 4C8QD 2FB7A 4XLHA 2DXTA 2HOTA 1UHWA 5B1BH 5GAGJ 2B9SA 4O3MA 1TS9A 2DKGA 1LDDA 2PMUA 2EZIA 2L2OA 4MLOA 4XLCA 5IT9R 1X2QA 2XVCA 2LR8A 2HPIA 1W5CC 2QSHX 2RO0A 4M71A 1EX4A 2DL4A 4PL6A 2LT1A 3K4KA 3ULRB 3IH3A 3PIOF 1K0XA 5A2QK 2M8EA 1XDUA 4ANJA 5FKMA 1N9RA 3D5SC 2DYBA 4R0KA 2MPXC 4PCQA 3X24B 1FSEA 1R00A 3CCSQ 5GMKe 2HOAA 1QO0D 3CMEI 4LDYA 2HVQA 1YJWA 2RVCA 4FU6A 1UCRA 4XNFA 3G6ET 3JREA 1JQQA 5CKEA 3FXUA 3CCVQ 1P4AA 1OCPA 4L9VA 5DUIA 2O0YA 1MMSA 3E2UA 2V9KA 3ZN0A 5LRSA 1I07A 2KDOA 3F0CA 3IKVA 5F64A 3IQLA 1IJWC 3OMCA 3CMAT 4II3A 3ZMDA 5KK1A 4ETSA 5CVUA 3CC7T 3SFIA 4E4HA 4JDSA 2FX0A 2MW8A 3DXJF 3CF5F 2DOFA 1OPCA 4JRIA 2KNBB 1SAXA 1XC5A 1VQ6T 1H3HA 3S3MA 5CYVA 2E2HJ 4JS4A 5HODA 1YCSB 4MMLA 3BCBA 5GAN2 3ZQFA 2F5KA 3TREA 4EVIA 2DA3A 5B3SH 2EVRA 3L42A 5ERIA 2G0EA 1UHMA 4M3FA 5LEJA 1HLVA 1IREB 1NPPA 2L7FP 2W25A 3B02A 5E1XA 5B66C 5D6XA 4F93B 5K5OA 4NC7A 2ZJPF 2OAUA 2MCNA 4L0YB 1X4PA 3HRUA 3WODF 4JRQA 5BPDA 3T1BA 3BPXA 1AZGB 3RIRA 2F4IA 3CCLQ 2Y9ZA 3QZ5B 2EW3A 3KZIC 2ROLA 1MW7A 3BZCA 4KIFA 3TO6A 2CT4A 2K5LA 1FOWA 1BI3A 2W48A 2YX4A 2R7TA 3C95A 3HP9A 3QKJA 4HV6A 1K7AA 5AYFA 3K1MA 2R5YA 1XPXA 1QKWA 1VQNQ 2HOSA 1ZKGA 2KLOA 1AD5A 1W4SA 4VUBA 4HF0A 2QTXA 5LJ3e 3BROA 2PMHA 2OTLI 2VE8A 4MHGA 4Y13A 3THKA 3HIFA 1EIFA 4M7DA 3FXQA 1VQ9A 3S6WA 5D7UA 4IRHA 1K79A 4U0VA 1RL2A 4NDLA 3TSZA 4AFUC 2VQCA 5J6XA 2X6OA 1YI2T 4G6QA 3JTHA 4M75D 4N0AC 1S29A 5KCOA 4V2GA 4M7DG 2BGCA 2PQWA 2YUQA 2OTLQ 1YW9A 5GAN5 1ZLJA 5J40A 4Z2YA 1LE8B 2QTVA 1LJ9A 5EC7A 3G71Q 3A03A 4DNCA 3L2RA 3H9NA 4M78B 2JVGA 2JJ7A 1FMKA 2ZB9A 3GFIA 2XIDA 4GBQA 4E2FB 4M78C 4B3AA 3K0LA 1RUNA 3Q5FA 1R22A 2VJIA 3WE3A 3L2VA 1BK2A 2OI3A 3CDIA 2DBMA 3PIPA 1BR4A 2ZXHA 2EKOA 1RI0A 1KQ0A 5H6RA 2NWMA 4M75F 2COBA 1RETA 3CMMA 1XMKA 1UHFA 2HZTA 2XGCA 1VQKI 2GOMA 2ZPEB 4C92G 3I5SA 5LJ3g 2ECBA 3RKWA 2QBYB 3DEWA 3CCUA 2M87A 1ZARA 1E3HA 2JPBA 4LDWA 3WTXC 2FA5A 1IXSB 4NC8A 1KC8U 1G5VA 3VYUB 1EJ9A 1FWZA 4OMYA 1BC7C 1DGWY 4M3EA 1IXCA 4FISA 1ZREA 2CV1A 1MBJA 4DBRA 2WBMA 2NUTB 1L0OC 2VUBA 3I5UA 3AG4H 2LJ1A 4L59A 2GF7A 2O9VA 4XQ3A 3LSMA 4XLNF 4IUQA 3M8FA 4OP0A 1M1KC 4FYVB 4J9DA 3LSIA 2HDAA 4OF1A 1K73C 3CP2A 3X28B 2HBWA 4DBQA 5CR2A 2BY0A 3IHUA 2E5KA 1GXIE 1G4DA 1MMDA 5E8IA 1QVGP 1XCBA 3KEQA 3EYIA 4D5FA 1SPKA 3JCMg 4CC4B 4M7DE 4A4KA 4PJJA 2CP0A 4E7JA 2M9HA 4EV0A 4ZNXA 4QT7A 3OYJA 1V76A 1VQNT 4HNTA 1MD0A 2V8KA 5DYMA 5LHGA 4OGEA 2VT3A 3N4MA 2M35A 1I8FA 1SSFA 4BI3A 3KLOA 4B6MA 5J39A 5GAN4 2F2VA 3I9QA 2ETHA 1KYWA 1WWXA 1LE8A 3CQTA 3U1DA 1SVMA 1S8NA 5J3LA 4XTYA 2BOLA 1C1AA 4A6DA 4KT0E 3MO8A 3CC2I 1TSFA 2RI5A 5A2QZ 4A3EJ 6AT1B 2IPQX 2DK8A 2FBIA 2V26A 4E6KG 3DBLB 2DILA 2X9DA 2EGCA 2NYSA 3GBQA 2O5RA 1V4RA 5D5VB 4LDUA 1IAWA 1A36A 2P0PA 4HNVA 1DQUA 3M57A 1RACB 2RQRA 9ATCB 1VQLT 3VS2A 1VQ4I 5DD8A 2AO9A 3BZ6A 1KD1C 2LZ6B 3K70C 4BUPA 1YHQI 1YIJI 1VQ5Q 2XAHA 2LX9A 2CH0A 2VPRA 3EG9A 1Q7YC 5EZHA 1MKMA 3OBWA 1QWEA 4MTDA 1I6HJ 3VUBA 2EPFA 3AG2H 1IRGA 2YXYA 3OSGA 4RGSA 5GAMe 2CU7A 4P96A 3F3XA 4MIMA 3EFSA 3M8EA 3QBYA 4D9JA 2RJEA 2STTA 2RK1A 2KZGA 2QQRA 3HGYA 3S15J 1Y71A 4ORZA 2DO3A 2HOEA 4LMYA 3P8BB 2BZXA 1YITA 3RPUD 1T0HA 4WCGA 1RUWA 2KSSA 2NOJB 4C8QB 1H92A 1UEBA 2VQLA 4YG2F 5LGTA 3JRBA 3E6CC 3QG1A 1ETXA 5TJJA 3FJ5A 3CCVI 3VS5A 4M7AE 1X3WB 1SFKA 2AXLA 3SWNA 2LRQA 4HX8A 2R5ZB 2LQKA 2YLBA 2YWWA 3V4GA 5LJ5j 3BJOA 1E2XA 2MMPA 1QHHD 4RS8A 3K4MA 4XLFA 3TW7A 2VXZA 3PNTA 1WX6A 3META 3P8HA 3MHXA 5HK0A 1SRLA 5AIPA 5FU6B 1KQ2A 4LXCA 2DEUA 1OISA 1U9OA 2P0TA 2P84A 4KUDK 3BG9A 2IS4A 2GXBA 2LYCA 2K40A 4I2OA 1PM3A 4LJZF 1WI7A 2ESHA 3ML6A 1TBXA 3T0YA 5DS9A 3PE0A 3PTAA 5CVRA 5LBQA 2KDZA 3DTEA 2V1QA 4OB3B 4F7UA 4WWCA 4IURA 4M72A 3E1SA 1ZG1A 4Q47A 4PJ0C 3ESWB 4IEJA 2X35A 2E4HA 3QOEA 1LVAA 2OPTA 3DKWA 3VS4A 2K9NA 3KEYA 2W85A 3IRRA 2BTTA 4C92F 5CQGA 1B8IA 3E9GA 3EETA 4LD6A 4GLMA 3G6EQ 1VQ6Q 2QI2A 5HVQC 2ELHA 2HQNA 4RB3C 2VT2A 4BXXJ 2R7RA 2E41A 4J6YA 1N25A 4FYXB 1Z3XA 2HZDA 2KJBA 2V4JC 2CP2A 1K8AR 5GAMf 1YJ9A 3RYRA 4FT2A 3J7ZI 3RNJA 2JQ7A 2OJED 5GAOq 2HQRA 4AIDA 2IVWA 3QWLA 3DEEA 1ZA2B 1TT5B 2M3AA 1Z9QA 3OL3A 4RCCA 1VQ5T 1UHCA 4C92D 1LFBA 1YI2I 4MEYF 2UXNA 1UGQB 3PQJA 3V7RA 2RJCA 2AIRB 1UG2A 1BYMA 1PC0A 1GDTA 4F7UF 1XS9A 1VQMT 4M7AF 1FPQA 4KISA 3WGHA 2LP5A 4CRIA 4KA4A 2IPOB 1WHGA 4BGDA 5IT3A 2LC4A 4ATOA 1Q86C 4U7BA 3URGA 4FM4B 1ZH5A 1KG1A 5F1JA 2ID6A 2XKOC 3KIOA 3PSIA 2RGVA 5C4JJ 1PP7U 3VB2A 2CQKA 2WADA 4NHJA 1Y8RB 1T0JA 1IZ6A 2HPMA 2IA1A 1HYOA 5GANg 1JHHA 1M1KU 5DLQE 1YWPA 4BUGA 1RAAB 4ENJA 2IGKA 1WGSA 1KQ1A 1OYXA 3PT9A 3CLOA 3WGIA 2ESNA 5ILSA 4N0AA 1TQMA 4UNOA 3G6EI 2HQHA 4FT4A 1K78A 1T38A 1I0CA 5HLTA 4A4GA 1JKRC 1WH5A 3U2RA 2G3RA 3FHZA 5FU6C 3VS3A 4HSRA 1TTYA 5HOOA 2EIFA 2HVSA 2FQ4A 5ED4A 2EH3A 1Z9CA 2K9SA 2JMWA 4N4OB 3A01A 4BE0A 2DM1A 2CT3A 4PJLA 4J6WA 4M75B 1T08B 2R7QA 5JHFA 2FVUA 4EJUA 1REPC 1LOJA 1U3OA 4J9HA 1SD5A 3M8JA 3CBMA 5HDKA 1YHQA 4PKCC 4QQDA 3L2UA 3L2ZA 1YCYA 2OCEA 3M56A 3GX4X 5AONA 5CO7A 1FP1D 2NS0A 1D1BA 4GXOA 5EZGA 4F7ZA 3Q0UA 1JXMA 1BBZA 2IG0A 4M7AG 2DXBA 3JCMQ 4ME7A 1RI9A 4DJAA 2J05A 3S32A 2OTLA 3EHQA 4IUPA 2IW5A 4MFEA 3I59B 1HDPA 4F52A 5KE3A 4QVCA 4XLPF 2D5VA 2I2LA 1WPKA 2KI7A 4O6JA 2DU9A 2RQUA 3G71A 2JRTA 2Q0OA 3ECOA 1I81A 3MQ0A 3TEDA 3I55A 2P81A 4ZH4F 1C6VX 1KYZA 4B8XA 1UG1A 2LQWA 2ZNYA 4I01A 1A35A 4M75C 3SQNA 4ZTFA 2EGEA 2XKPA 3GZ6A 5LJ3d 2EQJA 2EQRA 1JI8A 3CCET 2KKOA 4AIHA 2K3XA 1PDNC 4D7NA 1N6AA 2JVVA 5BQTA 1FTTA 5H6QA 1XGOA 3MKWB 2O4XA 3A4CA 4FTHA 2MH2A 4K2EA 2VPLA 2KXCA 2ZSIB 5J8FA 2EINH 3HPWA 4M78A 5GAN3 5CK9A 3FRNA 2Y75A 2JT4A 4G7OF 1KGSA
chains in the Genus database with same CATH topology
4PJOE 5CKDA 4FT8A 5DUKA 1ZHIA 1IZ1A 2DK3A 3M55A 3D0SA 1J59A 4GLKA 1B59A 2YLCA 3F8FA 3F8CA 4KIGA 1F9NA 3H3UA 3KLNA 4A4FA 2ZPBB 2O4XB 3CCSA 4WXDA 4AD9A 2CYZB 3NQOA 1LEAA 3OYBA 2EFOA 5JR3A 3DV8A 2LSOA 4IRGA 2WACA 4ENMA 4FIBA 4JS5A 2H09A 1BI2A 1MJ9A 1J5YA 1QVPA 4YIIA 2VV5A 2BKDN