2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
5L3EA 1OYWA 1YW9A 3CLOA 2BV6A 4LLLA 2PMUA 1BIAA 1Z6TA 4M9XA 5H20A 1S7OA 3V8KA 1MD0A 5IT3A 2VOOA 4FX4A 4WK8F 1IAWA 2DW4A 3SZPA 2L4MA 1QVPA 3FHZA 1DP7P 2FEZA 4BHPA 1R00A 3O6BB 2DTRA 3MWMA 1J9IA 4YIIA 4WXHA 1FPQA 3F8CA 4GGGA 3BPXA 2P5LC 2XKOA 1TLHB 3KP7A 1IRFA 4LK0F 2GZWA 4KYWA 3Q9SA 3HTSB 4JBAA 2Q0OA 2HQNA 3HHGA 1TW2A 2K7LA 2DFIA 2MLGA 3GFIA 4LK1F 1IN8A 3IWZA 4KN4X 2J5PA 3QAHA 4LFUA 1HW5A 1R1TA 2MBFA 1F4KA 1BN5A 4NQWA 5CYVA 5A2QK 4IXAA 2RKHA 4XSZF 3LQQA 4KICA 4ZZDA 3CUOA 5JVTA 4RB1A 5IT9Z 2K27A 3HYIA 1YS7A 3JSOA 1GXPA 3FXUA 1P4AA 4KIGA 3I64A 4HQMA 4BHCA 3RIRA 4EMSA 4JQFA 3R60A 4U88A 1MDMB 1FYKA 2AS5F 3I54A 4D0PA 3DEUA 3I53A 3FMRA 2ESNA 4I0AA 2FMLA 2L02A 2M30A 1XSVA 2LKPA 2HR3A 4KUMA 2IJLA 3QOPA 2HOEA 3JAMK 3FX3A 3COAC 5HVQC 3HRMA 2FF4A 5ICFA 2W57A 2XKPA 3IL2A 2YX4A 2JZYA 5ICCA 5HS7A 1Z05A 4O3MA 2D2WA 3KZZA 4CGZA 2NS0A 5LRSA 1FP1D 1YIOA 5LHHA 3E97A 2FMYA 3Q5FA 1RNLA 1XSXA 3N97A 4WWCA 3C3WA 2V1XA 4HLXA 1R7JA 1YQAA 3MEXA 1XGOA 5HS8A 2IPQX 3IC7A 3RKXA 2O3FA 1J0RA 1CGPA 4R1HA 5FFZA 3GVAA 4IHSA 1MZBA 2EK5A 3M7GA 1GHCA 2FQ3A 4IVNA 5H6QA 3FXQA 2E7XA 4HBLA 2HQRA 2HYGD 1WWXA 4S04A 1J75A 1P4XA 4Q47A 2VT2A 5E1XA 1IZ1A 4RAYA 2FBIA 1R36A 2QENA 1S6LA 2LF7A 3RJPA 3SHFA 3LA7A 1V3FA 5HLHA 3QP5A 2TDXA 3RKWA 4HAMA 5AIQA 2V79A 1H0MA 5ILSA 3WODF 3QP6A 5D8KB 3TO9A 2MH9A 3I59A 1B59A 3FWEA 4MHGA 4RGUA 4PCQA 2FU4A 5ILUA 3O2PE 1ZAOA 1FX7A 3HUGA 2EV6A 4P96A 1XCBA 2FRHA 2L4AA 3SQNA 1PP7U 2VBXA 1KYZA 4BNCA 2XAHA 4G6QA 1RZ4A 2P5KA 1O3SA 3BDDA 2R7FA 2XV4S 3P9CA 1QZZA 4L5IA 2QWWA 2JPCA 4GXOA 5K1YA 3WTSC 4L0ZB 2Y48A 4EV0A 2M45A 2O0YA 3LWFA 4AD9A 3GFLA 2O61A 3KCCA 5HDKA 4AIHA 2QM3A 3K1MA 1CF7B 3MQ0A 2Q2EA 1SMTA 3BP8A 3BWGA 4WF2A 2QQBA 4GYGA 3M8FA 2EFPA 1TQMA 2EB7A 2OD5A 4BXUA 2DPUA 1UHWA 4CZZA 4A0XA 3ISPA 2OZUA 4EJTA 2OA4A 2VBYA 5JR3A 1LDKB 1I1SA 1P6RA 1TTYA 3WTXC 3B02A 3HRTA 2OQGA 2QVOA 1T38A 4EVIA 4ESJA 5E17F 2F5FA 4HQEA 4LG0B 4M6XA 2RC4A 5L3BA 3QU3A 3HOTA 4AIJA 1XGNA 4M71A 1XD7A 5LRRA 1W7PB 1J5YA 1S8NA 5BOXA 1C0WA 1ON2A 4KNYA 3HTUA 1IW7F 4WXDA 2ZFWA 1YW7A 2P6TA 2Z33A 1DPUA 2DU9A 1FP2A 1TNTA 4XSXF 1XMAA 2OQRA 2XROA 1FT9A 1FYMA 1U5TC 3ZPLA 2FXAA 5ICEA 4IHTA 3GLXA 4ETSA 1OMIA 2L3DA 5TRDA 2IA2A 2Y0MA 2HTSA 5DYMA 2H27A 3ZN0A 1U8RA 2CFXA 2DPDA 4Q5SF 2V1UA 3RYPA 3MFKA 3SFZA 1KU9A 3ZMVA 5HDGA 3WG9A 1P2FA 4TV7A 2RNJA 4RGRA 5DCMB 3T8TA 3VB2A 3F3XA 2F5DA 3V4GA 3J80K 2Z9OA 3RI4A 3U2RA 2ZNYA 5BS6A 1YW8A 4Y15A 3WGHA 1ZLJA 3TDZC 1USSA 1G3TA 2H3JA 4L0YB 2DLLA 2F5EA 2W85A 1XDSA 1MDMA 1FSHA 5CVJA 5TJJA 1B4AA 1YO5C 2HFHA 1QGPA 3GZ6A 5FLXZ 5DEQA 2MD5A 4KIFA 3GZ5A 4HZFA 3LQRA 3CUQB 1I27A 1HW1A 4HF2A 1O3TA 3KZYA 1B9MA 5EEGA 2K4YA 4YFKF 1K78B 3QPHA 1ONVA 3H92A 5DD4A 1BBYA 2HDCA 4PDKA 1L0OC 5L3GA 3TOBA 3ZMTA 1QNTA 4PGGA 4G9YA 3SXYA 3F8MA 2XGXA 5ERIA 1KU2A 1L3LA 2P5VA 2H09A 1FBSA 3RPQA 1KU3A 4KDPA 4EM2A 2ACJA 1ZHFA 4HOBA 3GFMA 3V8LA 4LB6B 5L3CA 5BPIA 2GAUA 4I02A 2KJBA 1B1BA 1X3UA 2QUFA 1SFXA 3REOA 4NB5A 4HW0A 4BAYA 1IN6A 1BI0A 1D5VA 4OU0A 2EFQA 2QYOA 1XDUA 1UB9A 1K6OA 2CGPA 1YTYA 1KQ8A 4O6JA 3IRRA 2PG4A 1AWCA 2XAJA 4I2OA 2ESHA 2B0LA 3CTAA 2A69F 1BI3A 1IF1A 2KIFA 1IN7A 2IVMA 3GWZA 2ZMEB 3ROUA 4A2UA 1STZA 2R7DA 3PQJA 2R3SA 5HLIA 4EM0B 5HS9A 3DQVC 3OOPA 3HOSA 1SMYF 2XAGA 3AAFA 2YX7A 2M1BA 2L54A 5JFRA 2BGCA 3HHHA 2YR2A 5D8LB 3KEOA 3HSRA 3F72A 2ETHA 3T1BA 3F23A 3ZMZA 5FGMA 2PN6A 4EJOA 1XMKA 2Y75A 3KP3A 5CVRA 1CF7A 2GQQA 2CWEA 5J8FA 2VOPA 1JGSA 2OAZA 2V1DA 2ZKZA 1ZRDA 4LJZF 2DBBA 2K4BA 2DAOA 4U0WA 3SZTA 5LEJA 1BI1A 2LNBA 2VN2A 4RS8A 4ENMA 4IRHA 1Y0UA 2K5FA 1BYMA 1QO0D 1T0FA 3R61A 2A5YB 4H0EA 3DF8A 3G3ZA 4G6DA 4M9ZA 2E1NA 3E5UA 2VT3A 4OIOF 4LG0A 3S2WA 4DQ2A 3B73A 3RDIA 3TOAA 2XASA 1TNSA 2IA0A 3RKYA 1W7PA 4RB3C 3C18A 3C7JA 1YYVA 1WI9A 1YG2A 2MC3A 1RIOH 1F1ZA 3CDHA 4B09A 1BIBA 4IJAA 2PQ8A 3VFZA 2BE5F 1B9NA 3IKTA 2GIVA 2LF8A 1MGTA 4UV9A 4R79A 1T98A 2P8TA 1QBJA 4G94A 4ZZLA 2STTA 5LHGA 5E8IA 1G3WA 3CO6C 1R23A 3V7SA 4L9JA 4P55A 3JSPA 2LX9A 5D6EA 2DT5A 3ZP5A 3ABUA 4F7ZA 2EFNA 3RTRA 5DCMA 4HYEA 3I4PA 1O3RA 1V4RA 4MNUA 1KYWA 2A3SA 3D0SA 3E5XA 1K7AA 2WTEA 4L9NA 1IN4A 2RGVA 3FMSA 3I71A 1J2XA 4XLNF 5D6FA 3ERED 3GFJA 4KMUX 5D5VB 4ZYHA 1GXQA 3FF5A 6PAXA 2O03A 3FXRA 3KFWX 3DFGA 1P92A 2EFOA 2MLKA 1LVAA 3PFIA 2CYYA 2VXZA 2W24A 1ZGJA 3CUQA 3LSTA 3BPVA 2IRFG 2H6BA 4LD5A 2O8XA 1K78A 1F9NA 1Z1DA 4HA8A 1ZLKA 3JW4A 2KKOA 4KA4A 5D4SA 2HYFA 4IPAA 5JI6A 4M9SA 2D45A 1W4MA 2IA1A 2M8EA 3FM5A 1Q1HA 1RUNA 4EGZA 1F5TA 2VBWA 4YIFA 4OINF 1ZRFA 4P5OA 4G8XA 2WC2A 3TGNA 5BMZA 3ZQ7A 4M73A 1MKMA 2GXBA 4CO8A 5F1RA 2FE3A 3HSFA 5D5XB 3FM3A 5LLQA 4N9HA 2P7VB 3K1PA 3BY6A 4Z2YA 5KVRA 1OPCA 2BEOA 4A5MA 4UUVA 1RI7A 2G9WA 4HV5A 5J8CA 2K86A 2ADUA 2QBYB 4KN7X 5DD8A 5ED4A 3H3ZA 4M74A 1QQIA 4OMZA 2NNNA 3DV8A 4UXNA 1FBQA 3I58A 3QPTA 5D5WB 3MZHA 1REPC 5IT9K 4OIRF 4S05A 3DPTA 4MEXF 2RQPA 1YLFA 3J81Z 1BM9A 2W84A 3EQLF 1JHHA 3HRUA 3V7CA 4MQVA 4ASNA 4EJUA 4PGHA 1EV7A 2XHKA 1BC8C 4MQ9F 4G7OF 1FZPB 2QLZA 4WCGA 3ZN1A 1W5SA 3NEUA 2G7HA 1EH6A 2ZMEA 4Y17A 3HIFA 2XRNA 2STWA 2XIGA 1LDJA 1Z7UA 1HKQA 1FBUA 1G3SA 3LAJA 1OYYA 3GW2A 1HBXG 3GUDA 3LA2A 5CVUA 3K2ZA 5FD6A 1G6NA 3J7AO 4HF0A 4R8HA 2OU2A 4IRGA 4N9IA 1XN7A 3KEQA 1ZG3A 2A6EF 1FWZA 1ZREA 3GEZA 5LGNA 3N4MA 5LHIA 1I6XA 4FX0A 3WTYC 1LB2A 1FLIA 5LGUA 2FBHA 2X4HA 2V9VA 1TQIA 2F5CA 1Z6RA 3GX4X 4ENKA 3KP4A 4EM1A 2XVCA 2P4WA 5A2QZ 5EEHA 1KQ9A 1IRGA 2A61A 2EFWA 5H6RA 1JXSA 3F8BA 4LLGF 4CYDA 3H3UA 2L01A 3QRFF 3R4KA 3JTHA 3KLOA 5AONA 2HS5A 3BJ6A 1GVJA 1JHFA 3WU0A 1YS6A 2K4JA 1P4WA 2PFBA 1ZRCA 2C6YA 2HTJA 1WSUA 4I01A 5D5UB 2DI3A 1HQCA 4XRFA 4OMYA 5LEKA 3F8NA 3JAMZ 2ZO4A 4JK1X 3FZVA 3E19A 1IXCA 3IKVA 4U7DA 2F2EA 4ZYGA 4EJVA 3KP5A 3HRSA 3ZMDA 5D4RA 2K5IA 2XUBA 1USTA 2EA2A 4RGSA 4WX9A 2MA3A 1UHMA 2RN7A 3ZMSA 2IT0A 3E6CC 2CO5A 3DXJF 5E1WA 1KA8A 3IHUA 1R58A 2VBZA 1UFMA 4HX8A 3T5XA 5BQTA 3ULQB 1E2XA 4P9UA 3G73A 3K9TA 3BROA 3LFKA 1T2KA 4NHJA 2KRFA 5DUIA 2KIMA 5FD5A 4ENNA 1R5HA 1DDNA 5DV5A 1ZGAA 3LAPA 1R5GA 3WGGA 2VC1A 1O7LA 1HSJA 1U2WA 2RV8A 2UWMA 4YG2F 4Y13A 1K79A 1FYLA 2VE8A 4I7HA 3GYHX 3WTWC 4RB0A 3E5QA 5DDGA 1XGSA 2BBYA 4M6YA 3BOQA 2GXGA 3L9FA 3W6JB 1WRJA 1KGSA 2NRAC 3ML6A 4ESFA 5FFXA 2K5LA 3NRVA 2YU3A 3ECOA 2UXNA 1E17A 1DUXC 3E6BA 1KU7A 1LEAA 4A6DA 1IXSB 3DKWA 2G7UA 1D8KA 3IWFA 2DQRA 1O57A 2HEOA 3TO6A 1HXDA 1HKTA 2KIUA 4A0YA 1AOYA 2H94A 3C1DA 5CJ9A 3M1EA 1SAXA 1ZYRF 4ZYDA 2VE9A 4BH9A 4WXCA 3I0TA 2CW0F 4IF4A 4GCVA 4CICA 5JHUA 1I1GA 2WWYA 5LBQA 4B8XA 2LSOA 3L7WA 2M87A 3L2CA 3WTUC 2A68F 4ENJA 4GYIA 4I09A 4OOIA 3V7RA 5L3DA 3CUQC 2QBYA 4CXFA 2X0LA 3F6VA 2XAFA 5K5RA 4U0VA 1PP8F 2Z5UA 3WTTC 2KJCA 4DNCA 4OIPF 4N0BA 5K5OA 1QPMA 3NQOA 1QW1A 3F22A 5L3FA 2PJPA 3DP7A 1YFHA 2FSWA 5FLXK 1Z91A 2ISZA 1IUYA 5F64A 2JT1A 2EA4A 4MTEA 3DPLC 3K69A 3M8EA 2PEXA 1HW2A 4LLNA 4UVBA 1ULYA 3KLNA 3WE2A 3QU6A 3F8FA 4BHBA 3VEPA 5DCFA 4MGRA 1SFEA 1XCVA 5J6XA 3MHXA 4HX4A 4G7HF 1SFUA 4A5NA 1QZYA 3CO7C 4L18B 4KT5C 1J7KA 3J80Z 3HSEA 1S29A 2YSRA 2OZ6A 2XAQA 1ODDA 1LDDA 1XB4A 4L9TA 3T8RA 3T0YA 3Q9VA 2PBIA 5CLSA 4KFCA 1U5TB 1T6SA 4EJWA 4ON0A 4KIBA 5KK1A 1B6AA 1OYIA 2J5OA 1S7AA 2DQLA 1J59A 1IN5A 3P9KA 2QZ8A 4A12A 3P9IA 3E3VA 1R1UA 1G4DA 3F6OA 5DUKA 2A6HF 2RDPA 4HX7A 5FO5A 2P6SA 1S3JA 2RVCA 3GO5A 2UXXA 4L5JA 5E20A 4BQAA 4ZH4F 2EWNA 2PMHA 2QQAA 3TO7A 2QQ9A 2ZXJA 4MTDA 1MJ9A 1H9GA 1UCRA 1LEBA 1BI2A 4QLCU 4FHTA 5E18F 1ZH5A 2FA5A 3E6MA 5HOOA 3BJOA 4Q48A 4UVCA 1RUOA 3ZMUA 3KP2A 1I5ZA 2D1VA 3L09A 1IXRC 5CVVA 4A6EA 3PQKA 1HSTA 4CHUA 2HKOA 3GF2A 2BYVE 2HGCA 5E8GA 1FSEA 4L9VA 2CSOA 3MZYA 1O3QA 4EGYA 3E6DA 4OIQF 1FOKA 4XBFA 4UHTA 1ZN2A 2ZJ2A 2JTVA 1OR7A 4UVAA 5FB2A 3KE2A 3FMQA 2DO7A 2JSCA 2AXLA 2ZBKA 2ELHA 4UNOA 2NYXA 5CVIA 1ZARA 3K1NA 1FC3A 3EYIA 1ON1A 2IP2A 5ILVA 1W7PD 4MEYF 3W6KB 2CG4A 4HLYA 2NAZA 4HF1A 1R1VA 1TQPA 3VODA 4UV8A 3U1DA 2VC0A 4ZYEA 2GWRA 2EV0A 1PDNC 1MJAA 1T39A 2GA2A 3MCZA 3BJAA 2E7WA 1XGMA 2WV0A 1LJ9A 4A0ZA 3EDPA 3BZ6A 2A07F 2OBPA 4XLPF 1WKMA 1NHAA 4BYYA 2HKXA 3R0JA 4ESBA 1MJBA 4Q4ZF 3R6SA 3L00A 3JTGA 1SD5A 2YPRA 2Z99A 2DK5A 1O7FA 4KMFA 3GXOA 4I0BA 4GO1A 2E1CA 2V6CA 4YFNF 4AVPA 3EETA 4FT8A 5LGTA 4K2EA 3R0AA 4RAZA 2FNAA 3KP6A 5ICGA 4EQQA 3TQNA 5E1ZB 1BC7C 2EJRA 4LGWA 2Z3YA 3MAJA 3CJNA 4I98B 2GA1A 5F6FA 2GCXA 2UZKA 3F21A 3WE3A 4AWXB 4U0YA 2FBKA 2K02A 3RYRA 4G7ZF 4QWQA 3WTZA 4LMYA 2O6GE 4PZJA 4CDGA 1PUEE 2VODA 1U78A 2FOKA 1ZG1A 1D3YA 2DK8A 2CQKA 4RGXA 3I59B 4IRIA 1SD4A 1BOAA 1D8JA 5HDNA 1KQ0A 1DPRA 2COMA 4U7BA 2EV5A 3IRQA 2IW5A 2ISYA 2HWVA 3TKYA 1EH7A 3K0LA 2ZNZA 1TBXA 4HDUA 3OV8A 1ZG5A 3WTVC 4HDVA 1U3EM 4P9FA 1JE8A 1Z9CA 2JPBA 1WQ2A 1FNNA 1R22A 1TW3A 1SD6A 4HV6A 2Q8KA 2NNYA 3I5UA 3D5LA 1A04A 5K5QA 3M9AA 3RPUA 1XSDA 4LB5A 3WU1B 3KETA 3EUHA 2H6CA 4E70A 2JRTA 1FY7A 2FNPA 2PI0A 3WGIA 2VONA 3ELKA 4RB2C 1G3YA 3V8JA 1VTNC 3VOEA 2ZCWA 1EH8A 1U5TA 3TDUC 1W5TA 2W25A 1OKRA 1SD7A 2HZTA 3EYYA 3P7NA 2M5WA 1BJAA 3O3KA 3ECHA 3U9GA 2LDUA 2MH2A 3J81K 1LQ1A 5BPDA 2PLYA 1U6GA 3ABTA 4M72A 5AIPA 4AIKA 1HKSA 5HLGA 2P7CB 1H9TA 4O5VA 4YFXF 1LNWA 3LA3A 2D1HA
chains in the Genus database with same CATH superfamily
2H8WA 5L3EA 1OYWA 1YW9A 3A4CA 3CLOA 4XKWA 1WX6A 2BV6A 2BOLA 4BQOA 4LLLA 4ZJZA 4BDYA 2PMUA 2QGFB 3PMTA 3R6NA 2V1RA 5GAOn 1IREB 1BIAA 1Z6TA 4M9XA 5H20A 1S7OA 3I9V2 1MD0A 3V8KA 5GAGJ 5IT3A 4WK8F 2WY8Q 4FX4A 1IAWA 1KONA 1QKXA 2VXFA 3R6OA 2DW4A 4A3MJ 5IHNA 4BI4A 4E7HA 3SZPA 2CUZA 2QSFX 4BQNA 2L4MA 1QVPA 1AU7A 1WHJA 2A36A 2JMWA 3FHZA 1DP7P 2LZ6B 2DEQA 2FEZA 4BHPA 4QVDA 1D5YA 1R00A 1JI8A 3THKA 2M9HA 3O6BB 3X25B 4XU3A 1ETKA 1OFCX 2DTRA 1WCMJ 3MWMA 2ID3A 4YIIA 4AIDA 3OYGA 3FXMA 4S0HB 3ASNH 4WXHA 1OOTA 5LJ5h 3GPLA 1FPQA 2M2EA 4GDFA 2C0TA 1RAFB 2E35A 4AFUC 3F8CA 2BXZA 2ZC2A 4GGGA 1M27C 1I5LA 3BPXA 3Q3SA 4ZNXA 1VQ8T 2P5LC 1Y6IA 2XKOA 1K1ZA 2ZZDA 1PJRA 1TLHB 2XD0A 2VJJA 2NWMA 4F7UG 2VUBA 4HNUA 3KP7A 3OSSC 2VOOA 2IPOB 5FU6B 1R4NB 2E64A 1IRFA 2DYBA 1NPRA 2V8KA 4B6MA 1WJDA 4BY7J 2LJ3A 1K73R 4E6RA 4DJAA 4XM3A 4LK0F 2GZWA 3QYEA 2P81A 3Q9SA 1PUFB 2O8KA 4KYWA 3HOYJ 1CKBA 1QWFA 1U06A 3JCMJ 3HTSB 3M07A 3SJMA 2DM1A 3CDLA 3UDCA 4JBAA 2VXEA 2Q0OA 2HQNA 3HHGA 1TW2A 2K7LA 4CCJA 2G6FX 1WHUA 1ZQ1A 3ULRB 2DFIA 2MLGA 2Z0WA 3CMEQ 4BS9A 3GFIA 4LK1F 1IN8A 1X58A 3IWZA 3H3VK 1PD0A 4KN4X 3OR2C 1RQ6A 2M51A 3QZ9B 3J7AY 4XTYA 5KYUA 4C8QC 2J5PA 3GZNB 1E3HA 2KQRA 3QAHA 3S8PA 1NPPA 1WXBA 4LFUA 2V7FA 1HW5A 2DTOA 5GANf 1R1TA 1WHGA 2MBFA 1F4KA 1BN5A 5EG0A 4UC4A 3UATA 2XGCA 4NQWA 1N6AA 3CQTA 5H2FC 1C0MA 5HK0A 3DU6A 1TUDA 2LOOA 3JCMb 5CYVA 3SEMA 2QCOA 2LDMA 3OYYA 5IP6A 1QHHD 3OIPA 1YIJQ 5A2QK 4IXAA 1RAIB 5GAOm 2RKHA 3H35A 4MDWA 4XSZF 2ZAEA 3LQQA 1TWGJ 4AFQC 4KICA 2HDAA 1PHTA 1GUUA 1WGXA 4ZZDA 3G4SA 3CUOA 5JVTA 2LKSA 1MNDA 4RB1A 1VQOI 5IT9Z 2EVRA 2AHQA 2DYRH 2E1MC 2K27A 1YS7A 3HYIA 5JHFA 3JSOA 3FXUA 1GXPA 1P4AA 1WXTA 2X4YA 4KIGA 5GAN7 3I64A 4B9XA 4HQMA 2JN6A 1Y57A 4XU1A 1A31A 5KHDA 4OB2B 1K9MU 1MBFA 4BHCA 3RIRA 1J9IA 1SRLA 4EMSA 2V9PA 3AG1H 4JQFA 2DJQA 5LD2C 3R60A 4U88A 1MDMB 3RR6A 1S72A 3AHUA 1JUSA 1LKXA 4A4EA 1WJCA 1M90U 2EYZA 5GAMg 1FYKA 4DYQA 3MP8A 2JRMA 2J6FA 2AS5F 3UNGC 1NH3A 3I54A 5FLXE 3GTQJ 2J05A 3TU4K 2PNIA 4D0PA 3TP0A 4FASD 2J6OA 1B34B 3DEUA 1AD5A 1FYNA 1N27A 3M0SA 3OR1C 4BB7A 4GFBA 3AG2H 3FMRA 2ESNA 3I53A 2L2OA 2FMLA 4I0AA 4DYRA 1AZGB 2YXYA 3K70D 3A98A 1H89C 2D5VA 2L02A 2KZGA 4E7KA 1PYVA 1XSVA 2M30A 4OF1A 1TWFJ 2LKPA 2HR3A 1DU0A 3BTCA 4J6YA 2G3RA 2O5RA 4KUMA 5GMKh 2IJLA 3QOPA 1EF4A 2HOEA 3VSKA 3JAMK 2MIOA 2L3RA 3FX3A 9ANTA 3AG4H 3COAC 4CZCA 1VQ6Q 4HT9A 3S2DJ 2HD0A 1MGQA 3I9QA 3GCMA 1X01A 5HVQC 3HRMA 4FSXA 1MBJA 2FF4A 5ICFA 4OMPA 1VQOA 2W57A 2XKPA 2EIKH 3DBHB 2YX4A 3FKJA 3IL2A 5HCKA 3LSMA 2JZYA 5ICCA 5GMKl 3CCJT 5HS7A 1Z05A 4O3MA 4A3JJ 2D2WA 1X6GA 2KT0A 2JTMA 2W0ZA 1K8AC 4OAZA 3W2WA 2JJ9A 3JB9J 3PIOF 3KZZA 1I3QJ 1Q81C 4CGZA 3H36A 2NS0A 4J7IA 5LRSA 5GAMj 1FP1D 2I10A 1YIOA 5LHHA 3E97A 2FMYA 3SZGA 2K3BA 3OW2S 1VQ5Q 3Q5FA 1RNLA 1AKHB 2AIRB 2LNHB 1LE8A 4L5GA 2X1DA 3DBLB 4M3DA 2HQAA 1N8RC 2D6FA 1XSXA 3N97A 4C8QG 4WWCA 4ZN1A 3C3WA 2BHZA 2V1XA 4HLXA 1R7JA 3L2RA 1M3AA 5CAIA 1YJNT 5DM7F 1YQAA 3MEXA 1XGOA 4BKXA 4M78E 2R4GA 3BG9A 2IPQX 5HS8A 2X6WA 2EIFA 3HFOA 3IC7A 3RKXA 2O3FA 4C9YA 1J0RA 2XSDC 1YP5A 1KHCA 1CGPA 4R1HA 5FFZA 3GVAA 3L2WA 4IHSA 1YHQI 2HMAA 1QA6A 4IHYA 2LCLA 2AXTC 1MZBA 3HPGA 4M3EA 2MAMA 4JLGA 4RTUA 2EK5A 3C95A 3M7GA 4E47A 2F69A 1OCZH 1GHCA 1ZX6A 2CSIA 2ESWA 2GOMA 1I1JA 5HODA 3E9FA 3QDFA 3CC4Q 2FQ3A 4IVNA 2IBDA 2Y0SA 1TOVA 2LT4A 2LX7A 5H6QA 4AYBN 3FXQA 4M78A 2E7XA 1YI2I 4HBLA 2HQRA 2HI3A 3H9QA 4BY1J 3LFUA 3EFRA 2HYGD 5GADJ 3VS5A 1WWXA 2I8DA 1I81A 4J5YA 3VRYA 2Z2SB 3L2UA 1HF0A 1QCOA 4BDZA 1PCXA 1OCOH 2K9QA 3SWNA 1YIJI 3L2ZA 3CD6Q 4Z6YA 4B43A 4S04A 1JT6A 2PJRB 2DNUA 1J75A 2XG8D 1P4XA 3QHSA 1Q86R 4L5EA 2HOAA 4Q47A 1Y56A 4B44A 5IOZA 1HA8A 1M2VA 4A4FA 3ABKH 2EQJA 4HCCA 4G6TB 2VT2A 3OYDA 5E1XA 2HAXA 2M3AA 3I55Q 1Y71A 1IZ1A 4RAYA 2FBIA 1R36A 4GLMA 2QENA 4ZN3A 1S6LA 2LF7A 3RJPA 3SHFA 3VS3A 1UG1A 3LA7A 3OYAA 1V3FA 2IS2A 3E0JB 2EQUA 1MMGA 2OTLT 3RQ4A 5HLHA 3MKYB 1YJ9Q 5GTIC 4BEHA 4XMYA 4PFZA 1R0BG 2A28A 4IUUA 3C12A 2ME0A 3QP5A 2TDXA 3RKWA 4HAMA 2QF7A 1BW6A 2V79A 5AIQA 4AVZA 1NM7A 1VYVA 2D1XA 3CMEA 2K40A 2F6CA 3JREA 5LJ3g 4XKBA 1YX5A 4D8KA 1H0MA 5ILSA 3CMET 3WODF 1MH4A 3QP6A 5J1RA 2M0YA 2R5MA 2ZPBB 3LSGA 3TO9A 2FOWA 2MH9A 5E3LA 5D8KB 3HKZA 4V2GA 4DYCA 2DL4A 2AZSA 5EZHA 2IG0A 2M0OA 2OX7A 2PTKA 2DK3A 2X6OA 3I59A 3I35A 2VGMA 1ZUKA 2HXIA 4M75G 1A0NB 1B59A 3FWEA 1VUBA 4MHGA 4RGUA 3S1NJ 4PCQA 4FYXB 1WHKA 2FU4A 4IUQA 5IXFA 5ILUA 3O2PE 1ZAOA 2CV0A 1FX7A 1X69A 2VYTA 4RLQA 3HUGA 3DPUA 2EV6A 1MBGA 2Q1ZB 4P96A 1Y8RB 3HOXJ 2LRQA 3ABMH 2H1KA 3PT9A 4LDYA 2CJJA 2WBMA 1XCBA 3BZCA 5B66C 1VQ6I 3H9NA 1Y39A 2FRHA 2L4AA 3SQNA 4A3CJ 1SKUB 2JZ2A 1PP7U 2VBXA 2MK5A 4A4GA 1KYZA 3DLLF 5KYXB 4QTRA 2NXNB 2XAHA 4RAGA 4D5CA 1R9TJ 4BNCA 1N9SA 1FJLA 2Y69H 5GJWB 1BR2A 4G6QA 1RZ4A 5C6SA 2P5KA 2MI6A 1VQKQ 2NVTJ 1DJ7B 2RQVA 2EYYA 3JCMf 5HLTA 2FG0A 2QTXA 1O3SA 1MV3A 1VQ7T 1AWWA 1OISA 1RI0A 3BDDA 2MWPA 2R7FA 4HVWA 1ETOA 4A4KA 2QQRA 2XV4S 1MMAA 3P9CA 2OJED 3ABLH 1QZZA 2Y31A 4XKVA 4L5IA 2QWWA 2RQRA 2JPCA 4GXOA 5B1AH 5DM7R 2DRKA 2K7AA 3F70A 5K1YA 4X34A 3VU3C 3WTSC 3FISA 1EJ9A 2UUZA 2JA2A 3K4LA 3CJTB 1ZELA 2WY7Q 2Y48A 4L0ZB 2E60A 4EV0A 5IT9R 2M45A 2YLCA 4CUGA 1N25A 5M5WJ 2O0YA 3SEQA 5M5YJ 3LWFA 2DE0X 4AD9A 2LVMA 4XK4A 3GFLA 3M4YA 2O61A 2EZKA 1JTXA 2E5KA 3FHNA 4LITA 2K85A 3KCCA 5HDKA 1UGRB 4JPBW 1MNMC 2WADA 2LD5A 4C92F 4AIHA 2QM3A 3K1MA 1CF7B 3MQ0A 1M1KC 2K5CA 2DYSH 3CC4I 1LNXA 2Q2EA 2CQQA 2ZJRF 1M4ZA 2HCKA 2LTPA 1ABQA 3CCMQ 1SMTA 2DPPB 1VQ6A 3B6AA 3BP8A 3E2UA 2RN8A 2E6NA 2HKQB 3VYHB 3ASOH 3BWGA 4WF2A 3S1QJ 5E3MA 3O5ZA 5IT9E 2QQBA 4GYGA 4RCCA 4PSWA 4XU0A 3TQ7P 3CJRB 1E7OA 3M8FA 2M02A 2EFPA 1TQMA 3M8JA 2VLAA 2TRTA 3PO3J 2EB7A 2OD5A 1AHJB 4BXUA 4JLIA 2DPUA 3CD6I 1JUPA 3NMZC 1WJEA 1UHWA 4CZZA 3K2AA 2QEXT 2YUPA 4A0XA 3KIOA 3ISPA 3OYBA 2OZUA 1ZBXA 4EJTA 1WI3A 1CQTA 2OA4A 2VBYA 3I55I 4LXCA 5FU7C 2C06A 1VQLQ 5JR3A 1VQ5A 3GTJJ 4CCKA 3HP9A 2E1HA 2L3PA 2EW3A 2CP7A 5B5EC 1M3BA 1LDKB 1ENHA 4FQGA 1I1SA 5A0LA 5C0MA 2GOXB 3CMAI 4JRKA 2DFFA 1P6RA 2HNIA 1TTYA 1Z21A 1Y0NA 3WTXC 3B02A 1IDZA 2RJEA 4NL3A 3HRTA 2COZA 2IIMA 4E7LA 3DLLA 3ZOBA 2OQGA 2QVOA 3PUFA 4F16A 1GFDA 5FKLA 2GBQA 4FT4A 4FTHA 2DJNA 1TWBA 1T38A 4EVIA 4ESJA 2B63J 5E17F 2F5FA 3ASKA 3HM5A 1Z0XA 2A3LA 3CC4A 1ZKGA 1T3SA 4BE1A 4YEJA 2L3SA 4M7DC 4M7AC 4HQEA 3LGLA 4LG0B 3HPHA 2E70A 1H92A 1SFKA 4IX7A 1UHSA 4M6XA 1E6GA 2RC4A 2CMPA 5L3BA 2DOEA 3QU3A 3HOTA 3JRCA 1PC0A 1QMCA 1SHGA 4AIJA 1NG2A 3EUHC 5KCOA 2LREA 2K6DA 4G12A 4D6WA 1XGNA 4M71A 1XD7A 3WHCA 5GPCA 1NZ9A 2DIGA 2RPNA 4XTXA 2DKGA 5LRRA 1RAEB 1W7PB 4JZ4A 1Q86C 1J5YA 1S8NA 1VI0A 5F0FA 5BOXA 1O4XA 3JCMV 2EYWA 1C0WA 3CD6A 1ON2A 4KNYA 1AA7A 3HTUA 1RLPC 5GAOl 4ZTFA 2KY9A 4J6WA 2ZPGB 1IW7F 4WXDA 2ZFWA 1YW7A 4Y3OA 2R7ZJ 2A5WA 1OJLA 1UG0A 2P6TA 2A0FB 3UA7A 2Z33A 1DPUA 2DU9A 3RKQA 3M5AA 4RUGA 4RMOA 1FP2A 3I55A 2Z16A 2DL5A 2FO0A 3PVQA 1R49A 1TNTA 4XSXF 1XMAA 1RADB 2HXOA 2OQRA 1XJWB 3EGXB 2XROA 4OB3B 1MNEA 1FT9A 1VQKI 2JA5J 1V55H 1FYMA 1MV0B 1U5TC 3DLMA 2CZ0B 3RUXA 3RESA 5CCAA 3ZPLA 1YJ9A 2FXAA 5ICEA 4IHTA 4JOMA 1OCRH 2W4SA 3MKZA 3REBB 3CF5F 1R5ID 1KK7A 5DY9A 3HGYA 1LFUP 1PUFA 1E6HA 3MEVA 4E7IA 2BXYA 3GLXA 4ETSA 2V6EA 3MD2A 4MZPA 1OMIA 3Q0UA 3OYIA 2L3DA 5TRDA 2IA2A 4XAXB 1X3WB 1SRMA 2Y0MA 2HTSA 2LNVA 5DYMA 2H27A 4RBOA 1S5LC 3ZN0A 3M55A 1BJZA 2DJIA 1U8RA 4AT1B 1KQSA 2FHDA 2I0NA 3CP2A 2CFXA 2DPDA 3URGA 2R93J 2LVSA 3TEEA 1VQMQ 1V5EA 2V1QA 1JKRC 4KRTA 4Q5SF 5LL6S 1NJIU 2V1UA 3HSBA 3QO3A 2KXCA 4JS4A 3RYPA 1TS9A 3MFKA 1X1CA 3OL3A 3FXLA 4OWRB 3SFZA 1KQSP 1G83A 4RCBA 4AG1C 2V26A 1IXDA 2CQNA 1IRZA 1KU9A 2F2WA 2QYZA 3ZMVA 1ZGWA 2EFIA 2ROLA 5GAMe 3CCMI 3CCQA 5KYYB 5HDGA 3WG9A 3KYLA 2P0TA 4C0DB 1P2FA 2XICA 3JRDA 4EDUA 4TV7A 2RNJA 4RGRA 5DCMB 3T8TA 3VB2A 1YRNB 3F3XA 2OJ2A 1YITQ 2F5DA 3V4GA 2CZ1B 2GM4A 4JRIA 4I76A 1Q7YU 3J80K 2Z9OA 2ID6A 4C92E 4M7DA 4M75A 3RI4A 1XNIA 3VYRB 1WQWA 3FK6A 4M77D 5C44J 5GMKm 2PVDB 5CQYA 3U2RA 2ZNYA 5BS6A 2EQKA 3T9NA 2NVQJ 1YW8A 2FYKA 4Y15A 5J1UA 3PNWC 1K73C 2KFDA 1I07A 3WGHA 4IEJA 1ZLJA 1ZTRA 2K9NA 3PSIA 1USSA 1KZHA 3TDZC 2EH3A 2DILA 2DMOA 3FLGA 2F4IA 4UB8C 2WAQN 1G3TA 2H3JA 3ZQFA 5KH6A 4L0YB 5GAMh 5CIUA 4J9FA 1VQLI 3JB9G 2DLLA 2F5EA 1RESA 2W85A 4C5EA 2XKOC 1GL5A 4M6VA 3UA6A 1XDSA 1MDMA 3ZQCA 5CVJA 5TJJA 1B4AA 1FSHA 5C3EJ 3A2KA 1V29B 4M77B 2EYQA 5J3BA 3CCSQ 4DA4A 4Y91A 3AL0C 4CCOA 1YO5C 3PTAA 2HFHA 2GTJA 4M7DG 1WDXA 4M7AG 2GXAA 1HDDC 3H41A 1QGPA 3LSHA 4E4HA 5HKCA 3GZ6A 1K4TA 1B34A 2IGKA 1R4MB 3NFCA 5CK9A 2BY1A 4IZZA 2IGOA 1ZSZB 5EF6A 1ACIA 3X28B 5FLXZ 5DLQE 4RG2A 5DEQA 4EMKB 1U9OA 3GTOJ 3EG3A 2VXDA 4HPQA 2HQXA 3CCMA 1PVEA 1VOMA 2MD5A 2W82A 2QSGX 1I6HJ 1FOXA 2K79A 3PNVA 3FIWA 3CMYA 4HCBA 2QQSA 1WJ5A 4KIFA 3HXLA 3S17J 3GP8A 3GZ5A 4HZFA 2DMPA 3LQRA 2VQLA 5EZGA 3CUQB 2PQWA 3BCAA 1I27A 1HW1A 4HF2A 5IHKA 1O3TA 3KZYA 1B9MA 5EEGA 2K4YA 1QP3A 4YFKF 3VS6A 3CCEQ 3G2BA 1APLC 3VDXA 3KFVA 5DLOA 2I2LA 4NBQA 2VKHA 3M0PA 3EAEA 3BQYA 4UUSB 3G71I 1K78B 4IHWA 2GFAA 3OIOA 3HDDA 3QPHA 3PNYA 3EG1A 3HKSA 3VUZA 3G4SQ 1ONVA 4CRIA 1VQPA 3M0UA 3H92A 3HOZJ 2VPLA 2ZPFB 1KC8C 1VQ4Q 1WI7A 3CC7T 2CV1A 3BR5A 1LUJB 3O8VA 5DD4A 4C5IA 2HDDA 1NJIR 5JVGF 1BBYA 2HDCA 4PDKA 1L0OC 5L3GA 1AKHA 2DX1A 2M16A 2E65A 2DL3A 3TOBA 3ZMTA 1S72Q 5TGTA 4FU6A 2X51A 4D7MA 1QNTA 1QVFS 4PGGA 1NBEB 4JRPA 2EJFA 4ME7A 4OMMA 5CKBA 4G9YA 4B47A 1QLYA 3WG7H 3SXYA 3F8MA 2XGXA 4CCNA 3C94A 2L0KA 2CH0A 3OQ5A 3LL7A 1A36A 4IOCF 3X2QH 2COYA 2FEIA 2KHMA 5ERIA 3H0FA 1KU2A 5IYBJ 1VQMI 1L3LA 3HB9A 2FUG2 2P5VA 2H09A 3QYBA 5B1BH 3TSWA 5GMKi 1RR7A 1FBSA 3RPQA 2AO9A 1RLQC 3Q1JA 4M4ZA 1YHQT 2XPVA 1UJ0A 1XOVA 4CC4B 1G8XA 4GLKA 1KU3A 2RNAA 1QCNA 4KDPA 1QVGS 5IP9J 3RZDJ 2V8JA 4EM2A 2FX0A 2ACJA 2EINH 3CCQI 3HOWJ 3C2GA 1ZHFA 1JU5C 3H8ZA 4PJOF 2HSEB 2OCEA 4HOBA 2X1EA 5DM6F 3S3OA 3GTKJ 3GFMA 3FJPA 3V8LA 4FSSA 2CS3A 1YI2T 2DOFA 2DA1A 4LB6B 2X98A 1ZLMA 2LCSA 5L3CA 5BPIA 2GAUA 2IGMA 4I02A 2KJBA 3PIPF 1AT1B 1EIFA 3H9GA 4FISA 1LPQA 2V8IA 1B1BA 2K3XA 1UDLA 4QQ6A 2FL7A 1D09B 1Q82U 1X3UA 1WNLA 1AHDP 2XRLA 2OAUA 1YIJT 2QUFA 4XNFA 1SFXA 3REOA 4NB5A 5IAYA 2A08A 4HW0A 4M3BA 2HEQA 2F5VA 3G1MA 4BAYA 2VJ4A 1JGGA 1LFBA 2W10A 3HC7A 2CP5A 2HVSA 1IN6A 5GAOp 1RR8C 1BI0A 3QXEB 5KCHA 2EZIA 2NUPB 1N75A 4XLAA 1D5VA 2X3XD 3M53A 2Y9ZA 2BW3B 2M34A 3RCOA 4OU0A 1XS9A 3DTKA 3CCSI 2EFQA 2D8HA 1T95A 1SVOA 2GBYA 2EBIA 2QYOA 1Y1WJ 5GAN4 4F55A 1B72B 1BR4A 1XDUA 1UB9A 2NUTB 2RM4A 1VQMA 4NOYA 1Z9QA 2DN0A 4II3A 2CYZB 3LOCA 2DMNA 3H9JA 1K6OA 1HCRA 1YTYA 2CGPA 1VYUA 1WLPB 1KQ8A 2DL7A 4O6JA 2AK5A 3IRRA 4CH7A 2PG4A 2W48A 2XAJA 3FDYA 1AWCA 3S1MJ 4I2OA 3OY9A 1LJOA 2JTEA 2ESHA 2MSYA 2XGEA 4J9BA 2B0LA 1QPIA 1W1FA 3CTAA 4ZTJA 2L7MP 1XG1A 2K9SA 4JP0A 2CP2A 4BY6B 1W4SA 2A69F 2E5NA 1BL0A 4C92D 2H8HA 1HD3A 1TL8A 1BI3A 3TW7A 1JUMA 1IF1A 2LMJA 2KIFA 4RTWA 2E10A 1Z77A 2RJDA 3FIFA 5JLWA 3HOVJ 4R55A 3CCUA 1IN7A 2IVMA 3GWZA 2ZMEB 3TMOA 4M78C 2LC2A 1IV8A 3ROUA 4A2UA 2LG4A 2NVYJ 1STZA 2R7DA 3PQJA 2R3SA 5HLIA 4EM0B 5HS9A 3DQVC 2FB7A 5KYXA 3CCEI 3GTMJ 3WU2C 3OW2A 4P1WA 3OOPA 2DFEA 3HOSA 1VQNT 1X1PA 3BDUA 4C92B 1VZ0A 2PUKB 3SWNC 4E7ZA 1SMYF 4CYCB 5GAN5 2XAGA 3AAFA 3EH1A 1AEYA 2YX7A 3UT1A 2OTJA 5LJ3e 2M1BA 4B4CA 3G4SI 2COBA 5DTDA 3PO2J 1WIEA 4F7UF 2L54A 3BR3A 5JFRA 1FOWA 4NC8A 1M1FA 2O9SA 2BGCA 3OW2P 3HHHA 2YR2A 5D8LB 3OSGA 3P8DA 1D3BB 1VQ4I 2HQHA 3CCSA 5CKDA 1H8KA 4X1VA 2HVQA 2WB1A 2DBKA 1MHNA 3G6EQ 3BT9A 3JRGA 2DRMA 4LE9A 2Z1DA 2YRDA 4NS5A 3KEOA 3FB9A 3HSRA 2HZYA 1S72I 3F72A 2ETHA 2O01E 3DKXA 3T1BA 2HU9A 4FL6A 3S6WA 3F23A 4C0ZA 2Y30A 3ZMZA 1TWHJ 4JX5A 5FGMA 2RB6A 1ETVA 3BG5A 2PN6A 4XQFA 2JUGA 4EJOA 5J39A 1XMKA 2K3FA 2Y75A 2BE7D 3KP3A 2R57A 3CCVQ 4HNTA 2YRCA 1SVLA 1X75C 3NPFA 2CSQA 3NTKA 1YITI 3GLLA 3Q0VA 2X1CA 5CVRA 1CF7A 4FYYB 4RTZA 4XQ3A 2HL5C 5EGOB 3QWXX 2GQQA 4C5GA 4FYVB 5A2QE 5GAOq 3O8HA 2CWEA 3CESA 5J8FA 1BOBA 1GV2A 3HOUJ 2VOPA 1GBRA 1ZSGA 3CCEA 1JGSA 2JA8J 2LQNA 4X9CA 5FLXR 5HK3A 2ZJPF 2BKDN 2OAZA 3KX2A 2V1DA 2X9DA 5GAN3 2ZKZA 3HL2A 3H0HA 1G59A 1Z67A 3RQIA 2OAWA 4J83A 1KD1U 1WJQA 4QSHA 3FKIJ 3B6CA 1R71A 1GCQA 2CDTA 1ZRDA 1SHFA 4LJZF 1VQ4A 2DBBA 4BJ5C 1WH5A 2K4BA 2DAOA 3VUBA 2E34A 4U0WA 2XC7A 3HGGA 3SZTA 5LEJA 5KE3A 3JAMR 1BI1A 4IIMA 1W2BS 4AC0A 4ATOA 4DGWB 4OMNA 4PJOE 1VFCA 2KEAA 1SC7A 2QA4Q 4WCIA 2LNBA 1D1BA 2KAFA 2MGQA 2VN2A 4RS8A 1VIEA 4ENMA 1OULA 3ZFJA 4CI0C 1ARKA 1FMKA 1XC5A 2GIZA 4IRHA 1Y0UA 2KSSA 2K5FA 1BYMA 2R0QC 2KT1A 2VQCA 1QO0D 4A3IJ 4LOCA 1KFZA 1T0FA 3R61A 2A5YB 2NS8A 4H0EA 3OSVA 1ETXA 3DF8A 2K3YA 3K4MA 3CMAT 3G3ZA 4G6DA 4M9ZA 2E1NA 1AWXA 2CP0A 4PJNA 3CCRQ 1YITA 5EDNA 4D5FA 3E5UA 4CCLA 2VT3A 4OIOF 2L3QA 1UZCA 1S1NA 3JAME 4LG0A 2MWOA 3VYUB 1PSEA 2Y90A 2JVHA 4M78G 3S2WA 4DQ2A 3B73A 3RDIA 4DEXA 2RHUA 3JR9A 2KRCA 1V5FA 1YFNA 2FJ1A 1P7IA 1YJWQ 4F93B 1S9HA 3I4MJ 1Y0MA 3TOAA 2XASA 1D1CA 4YRVA 1TNSA 2IA0A 3RKYA 1W7PA 4RB3C 3FDRA 4M77F 3C18A 3C7JA 2RA2A 4A54A 3H6ZA 1YYVA 1WI9A 1YG2A 2L0AA 2MC3A 3CQZJ 1RIOH 1F1ZA 1E0EA 4C3IJ 2PVGB 3CDHA 2HYJA 4ZYAA 4A69C 2DD5A 4B09A 3S14J 1BIBA 2ZGWA 2EZLA 2K9MA 1DGRM 3OS2A 1RRJA 1G5VA 4ANJA 1ZA1B 4MMLA 4LUEA 4IJAA 1WHLA 3QUIA 2DXTA 3KZIC 4AFSC 4M77E 2PQ8A 3EGXA 2ECZA 2HZDA 2XSJC 3VFZA 1N78A 2HL3A 4BXXJ 1FXXA 5CQEA 2BE5F 1B9NA 2LKXA 1K0XA 3IKTA 2HPMA 2GIVA 4AM3A 2MMPA 4IUPA 1VQKT 2LF8A 2JSPA 2WAFA 2ZXWH 2QSHX 2EGCA 4C8QF 4BGDA 1TUCA 3JB9D 1MGTA 4UV9A 1U9NA 1AVZC 5ECAA 1U5SA 2MD0A 2NOJB 4JX6A 4R79A 4KT0E 1IJWC 1T98A 3JCMc 2P8TA 1ZBJA 4F7UE 1QBJA 4G94A 4ZZLA 3RPUD 5LHGA 2STTA 1NYFA 4FT2A 4M7DD 2P84A 5IH2A 3CMEI 2XIDA 5FKMA 5E8IA 4XLHA 3L2VA 1G3WA 5GTHC 3CO6C 1X43A 1R23A 2DTZA 1JKOC 2E19A 4BE2A 3VS2A 3V7SA 3CCVI 4L9JA 1K0SA 1KD1R 2R7WA 4P55A 4MZMA 3JSPA 4N4NB 2LX9A 1J09A 5D6EA 1WZOA 2R5AA 4N4GA 2DT5A 3ZP5A 3ABUA 2AZVA 1WXUA 4NL2A 1OPKA 2RK2A 4OGEA 1TT0A 4I99C 2L7ZA 1UGQB 4V2FA 5KYYA 4NDLA 2JA7J 1RUWA 4F7ZA 4LIUA 1SSFA 3OYHA 2JMCA 2EFNA 3RTRA 2DTHA 3VKIA 5DCMA 1YRNA 4HYEA 2GQIA 3I4PA 4BUPA 1O3RA 3EGDA 4CCMA 1QZEA 3I56T 4YTLA 1M90R 1ETYA 2EKOA 1V4RA 4MNUA 1NE8A 3CC2A 1KYWA 1NLPC 5D6XA 4XTWA 1UECA 3AFHA 1H88C 2A3SA 3D0SA 3E5XA 3H5AA 2LY9A 1RAGB 1VQ9T 3JCMW 4W1UA 2W1OA 2IS1A 1G2BA 1K7AA 3VWBA 2R7SA 1H8AC 2WSFE 2WTEA 3G6EA 3HBLA 4C3HJ 4L9NA 1IN4A 2RGVA 3FMSA 5K7HA 3U21A 2CUEA 2MW8A 3BG3A 1J2XA 3I71A 4PLLA 4LD6A 2YWWA 4ELYC 2QA4I 4K11A 4XLNF 3UR3C 2QDYB 2WSEE 4M77A 5D6FA 1PNJA 2EZHA 3ERED 3GFJA 1EZZB 1Y1VJ 4XTUA 5FU6C 4MMKA 1I0CA 4KMUX 2JQ7A 2KR3A 5D5VB 3CCLT 1VQLT 1MMNA 3UWNA 1OEBA 4ZYHA 1GXQA 2KL4A 3FF5A 2CW8A 6PAXA 3META 1W1WE 3FK7A 2O03A 2OCCH 3FXRA 4H4KC 2RJFA 2MYSA 2ZXHA 3MEUA 2EKHA 3CCVA 4KULA 3KFWX 3DFGA 1ZSZA 3FEOA 1JKPC 2CT4A 3EUAA 3M59A 3PIOA 3SB2A 4GRIA 3CCRI 2IS6A 4A3LJ 1TUGB 3K4KA 4A3BJ 1VYTA 4EMKA 1KIKA 1HK9A 2C0OA 1OV3A 1P92A 4D9JA 2EFOA 2MLKA 3A01B 3HKZN 1LVAA 4LUDA 5CKFA 4MLOA 2RQWA 3PFIA 1YBYA 2CYYA 4DOVA 2QXFA 3JCMg 2JUFA 2JM9A 1OPLA 2VXZA 2W24A 3K4NA 3LMMA 3OS5A 1YJWI 4GY5A 3EG9B 1ZGJA 2WACA 2OUMA 2ZPEB 5I21A 3CUQA 3LSTA 5TISC 3Q0WA 2QK0A 3JCUC 2L2PA 3BPVA 2KDZA 2JTFA 3S93A 2IRFG 2ZPIB 4A63B 2FD5A 2H6BA 4MZTA 1IO6A 4PJOD 3NAUA 2F5KA 1WA7A 4LD5A 1K8AU 2O8XA 4UUSA 2N8GA 1K78A 1F9NA 1Z1DA 4HA8A 1ZLKA 5HY6A 3JW4A 2KKOA 4M75C 1FTTA 1Q81U 3J7YJ 4KA4A 1AWJA 2LY1A 5GP9A 5D4SA 1EFNA 4AG2C 3CCJQ 2QA4A 2HYFA 4IPAA 5JI6A 2P0PA 4M9SA 1GDTA 1FMVA 2D45A 1SANA 1W4MA 2IA1A 2M8EA 3C2HA 4Y33A 1IZ6A 2O4XB 1NK2P 3FM5A 3DCFA 2Y4XA 4HCZA 3DEWA 1VQNQ 1Q1HA 3QPLA 3JRFA 5LJ3j 1N8RU 1VQ5I 5D7UA 3JSCA 4WTOB 4IHXA 4PJOB 2NVXJ 1MSEC 1RUNA 3W2AA 4EGZA 1F5TA 4XN3A 2VBWA 1O75A 2B9SA 2EAYA 4YIFA 5KCMA 3CF2A 5LJ5g 2R58A 4OINF 3CCRA 2CH4W 4E6KG 4IURA 1GLNA 1W70A 4OAYA 1ZRFA 3FBIB 4P5OA 4G8XA 3VYSB 4A3DJ 2WC2A 9ATCB 1YJNQ 5FJ8J 3TGNA 3CJQB 3M57A 1WH7A 3PGGA 5BMZA 3ZQ7A 4M73A 1X2KA 4C8QE 1MKMA 3MEWA 2RREA 4XR6A 4Z8AA 1YJWA 3VRZA 2GXBA 4QVZA 3CCYA 4HVVA 4CO8A 5F1RA 4P5NA 3OYLA 1K9AA 2FE3A 3HSFA 5D5XB 3FM3A 5LJ5f 3KXTA 5LLQA 1JB0E 3ZRGA 2ZFUA 4N9HA 1RI9A 2P7VB 3K1PA 5J26A 3BY6A 4Z2YA 2ECBA 1OCPA 4FCYA 2A7YA 1WVRA 3I5SA 3OMCA 2L89A 5KVRA 1OPCA 2BEOA 4M3FA 1MSFC 2BZ8A 2M0CA 1WQ7A 4A5MA 4UUVA 3EH2A 1RI7A 3NARA 1TTHB 2G9WA 3OSFA 3BW1A 4HV5A 5J8CA 3CCQT 3K70C 2K86A 1IGNA 1ACMB 1M2OA 2RD1A 4BI8B 2ADUA 2Y2ZA 2QBYB 4JJNK 4KN7X 5DD8A 3QSUA 4CC3A 1C6VX 4BQQA 1NTCA 3H3ZA 5ED4A 1VIFA 4IUTA 8AT1B 1YCSB 4M74A 1QQIA 3WVDB 5M9OA 1VQ8A 4XICA 2BVLA 3VS7A 4OMZA 2NNNA 4KGVB 1VQPQ 3PFYA 3DV8A 4UXNA 1FBQA 3I58A 4RLFA 1CSKA 1SF9A 3QPTA 5D5WB 3MZHA 3J7AW 2JVVA 1OCCH 4LDVA 3GOXA 3M3YJ 1YJ9I 1REPC 4Y4RA 5IT9K 1DQUA 3VYGA 4OIRF 2NUPA 4S05A 3BZKA 2VJ5A 2BW3A 3DPTA 4MEXF 3A1PA 2OTLQ 1ZHIA 2OI3A 3LSIA 3OYFA 2RQPA 4BXFA 1RAHB 1YLFA 1T0JA 1FEXA 3RNJA 1UEBA 3J81Z 1BM9A 3HEFA 1X1DA 3L2QA 2RQQA 2W84A 3DKYA 3EQLF 1B72A 1JHHA 1UHFA 3HRUA 2NUTA 3V7CA 2K3PA 5I2MA 1Z3YA 4MQVA 4ASNA 4XL9A 2ELJA 4EJUA 4PGHA 3X24B 4F7UB 1EV7A 1RC9A 4M3GA 2DA7A 3TP3A 3J7ZI 2R5ZB 2XHKA 2JM8A 1BC8C 3EG2A 4ZGEB 4MQ9F 4G7OF 2J6KA 2PZ1A 3EFSA 5GAN8 3BCBA 3TL4X 1FZPB 4OMLA 1DU6A 4RM2A 2D0NA 1W36C 4CC7A 2VVKA 2QLZA 4WCGA 3ZN1A 3OWTA 1IUFA 4IO9F 4J9HA 1U0JA 3C2BA 1MUZA 1W5SA 3NEUA 2G7HA 1EH6A 2ZMEA 3AG3H 2DXUA 1X4PA 4Y17A 2FZCB 3EHQA 4BJTA 3NHNA 5D6YA 3RMSA 1N8RR 3HIFA 2XRNA 2STWA 2XIGA 1LDJA 1Z7UA 4II1A 1YOVB 4JUVA 1HKQA 1K4US 2VB6A 1QU3A 4LG3A 1FBUA 4Y92A 3RMQA 4C92A 2O88A 1G3SA 4JJDA 4CYCA 2X4JA 1ORKA 5F04A 3LAJA 1BA5A 2D0QB 1OYYA 3GW2A 3C0CA 1SG5A 1HBXG 3GUDA 7AT1B 2VQHA 2ZSIB 1QVFA 3LA2A 5CQXA 1WFXA 5CVUA 3U23A 3K2ZA 5FD6A 3LGFA 1D3BA 2F48A 1F36A 1XTAA 5J4YA 5GAMd 1VQ7Q 1VQNI 2C0IA 1UTIA 2EGAA 3G4ST 4F17A 1G6NA 1QHGA 1RKWA 1QVFP 3J7AO 4HF0A 4R8HA 2YUQA 2JJ7A 2OU2A 4IRGA 3OYEA 4PL6A 4N9IA 3IQLA 1XN7A 5CQGA 3OYNA 2BY0A 4GBQA 2ROTA 4HKEA 3KEQA 1ZG3A 2A6EF 1RKTA 1FWZA 1ZREA 1NEBA 2ZXIA 5F0CA 3CP8A 3GEZA 3A8OB 2DO3A 3JRZA 1I3AA 2BVMA 2E1OA 4X1EA 5LGNA 5IYDJ 1S72T 3N4MA 5LHIA 1BK2A 1I6XA 1QVGA 4FX0A 2X85A 3WTYC 1LB2A 5LGUA 1YJNI 1FLIA 2FBHA 2X4HA 2CZ6B 1M1KU 1KQ2A 2HKNA 4U87A 2V9VA 5A0GA 4YELA 1TQIA 3MZ8A 4XU2A 4ZDLA 2F5CA 1X6OA 2KQWA 2BHYA 2JK3A 1Z6RA 2GF7A 4KGZB 1QVGP 1FMWA 5EGOA 4FM4B 2FRYA 2P4RA 5LFAA 2QG9B 3GX4X 3CXCS 3GNFB 1ETQA 3CPWA 2JT4A 4ENKA 3KP4A 3KPHA 2DA5A 4EM1A 2XVCA 4CSWA 4IKFA 2CREA 2P4WA 3CCUQ 5KYWB 2LLKA 4HT8A 3A02A 5FW9A 4AFZC 5A2QZ 3CPWP 3KYDB 5EEHA 3X26B 1A6IA 4HNVA 1JJ6C 3M9QA 3I4NJ 2CW7A 2M0MA 1EA3A 1KQ9A 1U1TA 2AHJB 3CCJA 3P8BB 3JV3A 1IRGA 2A61A 2EFWA 1VQNA 1IDYA 2HQ5A 2KDOA 2NLUA 4J00A 2DT7B 4PUSA 5H6RA 5KYNA 2OTJQ 1VQOT 3JB9F 1W0TA 1ZR2A 4QPQA 1VQPI 4JS5A 2X48A 1JXSA 2KRHA 3PVLA 5I11A 3JCMX 3F8BA 4LLGF 4CYDA 1V5GA 1X2MA 3IUOA 3H3UA 3IH2A 3EFOB 4J9GA 1AZEA 2L01A 1YN8A 3QRFF 4M7DF 2GGRA 2MFZA 3R4KA 4BU2A 4M7AF 3NTHA 1V54H 3JTHA 2R7OA 1K76A 2XF6A 4C8QD 5CKEA 4RTVA 3KLOA 5AONA 2HS5A 3CBMA 1YJNA 3BJ6A 1GVJA 1JHFA 2CUBA 3J7AF 3WU0A 1YS6A 2K4JA 2OF7A 3H1CA 1P4WA 2PFBA 2LT1A 4FYWB 5IN1A 2MOXA 1ZRCA 2C6YA 1UAAA 1SEMA 2HTJA 3SDZA 1WSUA 2CQXA 3S15J 1B3QA 1M1EB 4I01A 4ZDOA 3ERMA 4C3JJ 5D5UB 2DI3A 4C8QB 1PRMC 3CBPA 3MO8A 1HQCA 4XRFA 4OMYA 3LSKA 1T0HA 1NG7A 5LEKA 3IV5A 4PJ0C 3F8NA 3JAMZ 2ZO4A 4JK1X 3FZVA 3G71T 4XRSA 2JS0A 3E19A 3D5RC 3NTIA 2PMZA 4QT7A 3TVTA 1IXCA 3IKVA 4U7DA 4BJ6C 2F2EA 2E5QA 2DA3A 5GAOr 2VPRA 4PFPA 4ZYGA 4EJVA 3KP5A 4OMQA 2JMAA 1JJ2A 1U1SA 3RERA 1LOJA 3HRSA 2DLPA 3GMEA 3BFMA 1S7EA 3ZMDA 3G1JA 3SHWA 1QRYA 3RSNA 1YCYA 4KITB 3RDVA 2R7RA 3D1NI 5D4RA 1ZUUA 1OU9A 1JJ2P 3NGPA 2KI7A 2K5IA 2XUBA 1USTA 1GCQC 2EIMH 2EA2A 4PK4A 1HSQA 1ZUYA 4RGSA 3ZGKA 4WX9A 1SAUA 2E1MB 2MA3A 4C2MJ 1UHMA 3H5NA 2RN7A 4B1RA 4J9DA 3ZMSA 2IT0A 3E6CC 4ESRA 2OTLA 2CO5A 4TVRA 3BE3A 3DXJF 1BR1A 3VS0A 5E1WA 1KA8A 1W5CC 5GAN2 4LDXA 3IHUA 5C4JJ 1R58A 2VBZA 5LJ3d 4KH1B 4L6V5 3S16J 3OIQA 5F27A 4CA0A 2ZCFB 2E2HJ 4LIVA 1PM3A 4C2UA 1UFMA 4HX8A 3INZA 2XU8A 1MMSA 5GANg 3T5XA 5GAHJ 1Q7YR 5BQTA 1PWTA 3D7SB 3ULQB 1T0FC 3FXKA 1CKAA 4D1QA 5B3SH 2DZ9A 1E2XA 4P9UA 1ERDA 3VSLA 1UGPB 4BL0B 4DZJA 3G73A 4X6AJ 4XOTA 3K9TA 3BROA 3DTIA 3LFKA 5IOYA 5L8RE 2OPTA 4EMGA 3JCMd 4N4OB 1T2KA 2A37A 2VJIA 2ED0A 4NHJA 2KRFA 1UB4A 2NYSA 2MF2A 1UUEA 3J81R 3DTEA 5DUIA 1KHIA 2D9TA 3DWLE 2VL8A 2P0QA 2KMTA 4Z02A 3VPRA 2KIMA 5A0DA 5FD5A 4ENNA 1W2BA 1R5HA 3CCUI 2ZB9A 1J3TA 1DDNA 1K73U 2KP6A 2PJRA 2FQ4A 5DV5A 1ZGAA 3LAPA 1R5GA 3QG1A 1KSWA 2DAQA 3WGGA 3IAM2 2VC1A 4IIOA 3CPWS 1O7LA 2JS2A 1HSJA 1ITYA 1I8FA 1QKWA 1U2WA 3SFIA 4MO7A 1A35A 3ER0A 2RV8A 1W2BP 2DERA 3P5JA 3OYCA 2H8RA 4BBRJ 1VQ7A 3JCMe 2UWMA 2M7BA 2OTJI 2LQKA 3OOUA 2HNHA 3J81E 4YG2F 3G1OA 4Y13A 3LWIA 4MDXA 1K79A 1FYLA 3W6VA 5LJ3h 2VE8A 4XORA 1F43A 3ME9A 4I7HA 2VGNA 3KUFA 4QIWN 2HVRA 2XB0X 5GANj 2YU9J 3WTWC 3GYHX 4RB0A 3E5QA 2LC4A 3M0QA 2B86A 4L59A 2XMFA 5DDGA 1X2QA 1Y96B 1AWOA 1XGSA 1JEGA 5CR2A 2R7VA 2JNGA 2BBYA 5FRNA 5HNFA 4A93J 4M6YA 1T3LA 4DEYA 1WYXA 1YX3A 5IP7J 2RI5A 2V1NA 1Y07A 3BOQA 1K9MC 2KDSA 2GXGA 3L9FA 3W6JB 2BZXA 3JCMh 4PLIA 4M7DE 2CP3A 4M7AE 1WRJA 3L1PA 1KGSA 2NRAC 3ML6A 4ESFA 3A01A 1PKSA 2CFOA 5FFXA 2K5LA 3NRVA 4RTTA 2JWTA 2MABA 2YU3A 3JRIA 4KJZA 1M8MA 1RETA 2DBMA 4N4HA 3ECOA 1LPLA 3DEEA 3TW6A 4XTZA 3REAB 4QQGA 2UXNA 1IHWA 3PL8A 1E17A 1DUXC 3EG9A 3E6BA 2EILH 1OU8A 4XTVA 2A05A 4A3FJ 1NG6A 1KU7A 1SSHA 1VF9A 4KBMB 1LEAA 2WAEA 4C0DC 2BY3A 2YDLA 1U8BA 5EJCA 4A6DA 3JRAA 2XHCA 1OYXA 1VNDA 1VQ6T 2QQ8A 5J1YA 2OC6A 1IXSB 5K7FA 1TU0B 1VA7A 3DKWA 3CC2Q 3M54A 2G7UA 2RO0A 1OZ2A 1MH3A 1D8KA 3A0HC 2HQEA 2TCTA 3IWFA 1TC3C 2RI3A 4C5HA 2QEXA 1KC8U 1MIJA 4R56A 2IXSA 5CO7A 2DQRA 1JJ2S 2AKKA 1O57A 2HEOA 3TO6A 1PKTA 2CUJA 1HYOA 2O4XA 3QIIA 1BB9A 1HXDA 2LR8A 2CV2A 1HKTA 3CDIA 2QKLB 1JXOA 2EQMA 2KIUA 4A0YA 5A2QR 2MG4A 2COWA 3MKDA 1AOYA 3M0TA 4PJOA 3CC7Q 2H94A 1Y8QB 3C1DA 1B8IB 1X27A 5CJ9A 3M1EA 1SEUA 1YNZA 2WB1N 1SAXA 1WPYA 1ZYRF 4ZYDA 4KH0B 4J19A 2VE9A 2KNBB 4BH9A 3LSRA 3S3MA 3PIPA 1KJWA 4WXCA 4M77C 1VQ5T 2IAIA 4EATA 3I0TA 4JZ3A 3IP4B 3GTPJ 2EBPA 2CW0F 2JVGA 4IF4A 2RMOA 1TWCJ 3EUKL 3OS0A 2HSPA 4GCVA 2CUFA 4CICA 3RZOJ 3S3NA 2EQRA 1GT0C 2MUNA 1WHHA 2RHIA 3A1YA 1I1GA 3KYCB 5JHUA 2WWYA 5LBQA 1ZSZC 2DZCA 3MN2A 4RKUE 1Q82R 4XKCA 4B8XA 2O9LA 2FRWA 4EMKC 2LSOA 4BBSJ 2YUSA 1EX4A 4RAFA 3L7WA 2JN0A 1TWAJ 3M0RA 2Y9YA 3OA6A 2M87A 3L2CA 3CC4T 3D5SC 3WTUC 3K4BA 2A68F 1YHQQ 4ENJA 3QQAA 2GFUA 1BU1A 2PVOB 4N0AA 4A3KJ 4GYIA 2HOTA 4I09A 4OOIA 5FLVA 2CS7A 3V7RA 1T08B 4M75D 3NWTA 5L3DA 2VKNA 3CUQC 3DB4A 4FE7A 2M4KA 1PG5B 4V19K 1RPWA 2XDPA 1T33A 3OYJA 3FRNA 3A8MB 1YI2Q 1UGVA 1D0YA 4X0GA 2QBYA 1H641 4B3XA 4CXFA 2K9GA 3V42A 3CD6T 2X0LA 3QWLA 5J3LA 3F6VA 2KRNA 2XAFA 1OX9A 5FKOA 5KAIC 3MKWB 1I4K1 3G7ZA 1XQHA 3LH0A 2VQGA 2JUCA 1IC8A 4JJCA 4EPCA 3N05A 3IH4A 5K5RA 8ATCB 4U0VA 4M75B 4B9WA 3I55T 2VKDA 1PP8F 2BE9B 3MP1A 3ZEHA 3QWYA 5GAN6 2Z5UA 3WTTC 4UUTA 1Y7XA 2KJCA 3CPFA 5F1JA 1M9SA 1Z9ZA 3O8GA 4DNCA 4UY8I 1XMXA 2B8AA 1YJ9T 2RI2A 4OIPF 3L42A 1UG2A 4N0BA 4RM3A 5K5OA 1QPMA 3NQOA 1QW1A 4F7UA 3F22A 2DOAA 3HPWA 5L3FA 2DYIA 4M78F 1UELB 3I3LA 4A3EJ 2PU9B 5GMKe 1XX5A 2PJPA 3VS4A 1Q86U 3DP7A 2R5ZA 1YFHA 2LBFB 1IRXA 4PJLA 5M3FJ 1I39A 3H0GJ 1KC8R 2FSWA 2GNCA 5FLXK 1M30A 2DFUA 2KRSA 3QYHB 4DOWA 1Z91A 4AU7A 2FPDA 2M4GA 2ISZA 3F0CA 3AT1B 1IUYA 1IG7A 5F64A 2HDWA 2JT1A 3QPSA 2EA4A 4MTEA 1M1GA 5GAMf 3TBIA 4A4HA 3HFNA 3DPLC 3A8GB 2M7AA 2LJ0A 3K7AJ 3K69A 3CC2I 1YWPA 3M8EA 2BIVA 1X4OA 2PEXA 1HW2A 4OMFB 5CPRB 1U3OA 3A0BC 4HRIA 4LLNA 2L9NA 4KUIA 4UVBA 2DD4A 2DA2A 3OMGA 1E3OC 3OBYA 4IOAF 5FWBA 3TSZA 1ULYA 3KLNA 2F5TX 5AT1B 1VQ8Q 2KT8A 4M77G 5IYCJ 3UKGA 2QGGA 1HLVA 2NVUB 1SFOJ 3G6EI 1UE9A 3WE2A 3HZJA 3QU6A 5M3MJ 5FU7B 3F8FA 1A5JA 1GV5A 4I6ZA 5F08A 3CC7I 4BHBA 5GPAA 4LN2A 2X6XA 3VEPA 3LSJA 4XONA 5DCFA 2X6YA 2RHXA 4ZGDB 4M7AD 4MGRA 4AUXA 2V9KA 2XGDA 1SFEA 1AOJA 3QBYA 3OYMA 1BCMA 2O2OA 4YIRX 3GBQA 1OR7C 5CKTA 1JJ8C 4J01A 1XCVA 2E6ZA 5J6XA 5M5XJ 3MHXA 4Y7NJ 3ZR8X 1W36D 1N5ZA 4C0FA 4HX4A 3VV0A 2GTOA 4BD3A 4G7HF 2XDDA 1SFUA 4A5NA 1QZYA 1JO8A 2K2MA 2DA4A 3W2VA 1HC8A 2Y0SN 4M7DB 4M7AB 5FKKA 2LQ8A 2DDAA 5IY5H 5EYRA 3CO7C 2R5YB 4FW1A 4L18B 2RQUA 4AMCA 5DS9A 4HCKA 3ESWB 4PNOA 4KT5C 4BY6C 4OB1B 3CCMT 5KYWA 1WFWA 2CU7A 1J7KA 4AYBA 1NYGA 3DLAA 3HSEA 3MVPA 3J80Z 1S29A 2YSRA 1GCPA 2ZMEC 2OZ6A 2XAQA 2JW4A 1ODDA 2VV5A 5FWCA 2O7OA 1LDDA 2LTOA 4J9IA 3M1CA 1X3ZB 4F3QA 2DMUA 1XB4A 1Z3XA 4JJBA 2MVTA 1WJFA 2VIXA 3AKZA 5GJVB 1LCKA 2XK0A 4L9TA 5I2SA 3T8RA 3T0YA 1ZQ3P 4C92C 1QCFA 3Q9VA 2PBIA 5CLSA 1UJYA 1ZA2B 3CC7A 4KFCA 1YWOA 2E36A 1U5TB 1T6SA 4EJWA 4ON0A 3EFOA 4KIBA 5KK1A 1B6AA 1OYIA 2J5OA 4Z89A 2ME6A 1VQPT 1S7AA 2DJZA 2YRVA 2DQLA 3SEZA 4XK8E 1J59A 3CBOA 1IN5A 5GANd 3P9KA 1IGUA 4Y52J 2LY2A 1K6YA 2LYCA 4ABZA 2D8JA 2MPXC 2QZ8A 2F2XA 1OLTA 2DDBA 4A12A 5I22A 2IEKA 3P9IA 2A6TA 3CMAQ 3E3VA 3ONQA 1WJSA 3MPUB 2B7EA 1JTYA 1R1UA 2E71A 2WV1A 2AKLA 4C8QA 1G4DA 3MMYB 1YHQA 3PM1A 4MFDA 2AQEA 2KZVA 1V1CA 2FZKB 3F6OA 3K4JA 4HEA2 5DUKA 1MW7A 1NLOC 2CP6A 2DEUA 1BCOA 2A6HF 3ZQIA 4LDUA 3VJPA 1C1AA 3PMIA 1GBQA 1ZR4A 2DMQA 2RDPA 4DW6A 4HX7A 5FO5A 3OMYA 5JLXA 4RG8A 3JCMQ 3TEDA 3W3CA 5GAEJ 5GANe 2KMUA 1POGA 2BZYA 2YSQA 2XI9A 1YI2A 1LVKA 2LJ1A 2DIQA 2P6SA 1GFCA 1S3JA 1IGQA 2R92J 1MBEA 1Z7LA 2XF5A 2RVCA 3GO5A 5IPAA 3CZ6A 2UXXA 4L5JA 5E20A 4BQAA 4ZH4F 5LJ3f 1X2NA 3P8HA 1O9SA 1YIJA 5E79C 2EWNA 3JRHA 2ZPHB 2PMHA 2QQAA 3TO7A 2NUZA 2LP0A 2IVWA 4OGCA 2QQ9A 2ZXJA 1HOMA 4BI3A 3EG0A 2E4HA 1R0CB 4JDSA 4PJJA 2DL8A 4MTDA 3H5RA 1MJ9A 1VQ8I 2YUOA 1H9GA 3LNQA 4KUDK 1UMQA 2X4WA 3E9GA 2KRMA 1UCRA 1LEBA 1BI2A 2W7NA 3LYIA 1A6QA 3CEYA 2M9UA 4QLCU 3K4CA 5GANh 2BY2A 4HG2A 4ITVA 4FHTA 5E18F 2QTVA 3BR2A 1I5OB 3OS1A 3A8LB 1ZH5A 2FA5A 4QKUA 1H3ZA 1UFFA 3AL0B 3E6MA 5HOOA 1RACB 3CXCA 3CLQA 1TXQA 3BJOA 3U1KA 2LQWA 4Q48A 1OQYA 2J06A 4UVCA 1RUOA 3OB9A 3FJ5A 3ZMUA 2RHYA 4R0KA 3KP2A 2XPUA 4FE4A 3GF5A 5F0HA 2CRGA 2R7UA 3HHTB 1I5ZA 3KBGA 2QGUA 3QZ5B 4LD9K 3CXCP 2VI6A 2D1VA 3BG7A 1GVDA 1NEGA 2RQTA 3L09A 1IXRC 4CC2A 1VQMT 5CVVA 4ELZC 3ZXSA 2GQVA 2KE9A 1GXIE 4E7JA 2QDLA 3DKMA 4A6EA 3LLRA 2YT6A 4FW2A 2O31A 5KYUB 1X19A 3DBRB 4F91B 2LFBA 1Q95G 1OQKA 3MJXA 2L9RA 3GIBA 5KNLA 5J4VA 1NJIC 3PQKA 4C92G 2AQFA 1HSTA 1K61A 1DGWY 4CHUA 1PSFA 2CGHA 2MZ4A 5D6WA 5EG0B 2HKOA 3GF2A 2YLBA 2BYVE 4NQWB 1RL2A 3UF4A 2HGCA 3RBBB 2XDVA 4XOPA 3I56Q 3BTIA 3CCUT 4A3GJ 5E8GA 1FSEA 3K10A 4L9VA 2ICWG 2CSOA 2E3IA 4BACA 3MZYA 1TH7A 1O3QA 2RH2A 4EGYA 3ZQQA 3E6DA 4OIQF 3LSPA 1JKQC 5E3NA 1FOKA 1ABOA 2KYMA 2FPEA 4XBFA 5LJ5j 1VQ9Q 2WA0A 1HJDA 1Q7YC 2JXBA 4UHTA 1FIPA 1ZN2A 2ZJ2A 1F1BB 4C2TA 2JTVA 2X35A 4BUGA 4EIKA 1JT0A 3LX7A 3MKLA 1TG0A 4A53A 4KGXB 2OTJT 3BR0A 1OR7A 3BG6A 2RAEA 3NWSA 3HJEA 4UVAA 5K7ZA 2XPWA 5FB2A 2X3WD 3KE2A 3BTLA 3FMQA 1Y96A 3QJ6A 2LK2A 2F2VA 4FIBA 4X9DA 2DO7A 1QWEA 1KQ1A 2Y4YA 3DB3A 3CCST 3CCLQ 3I5RA 2JSCA 5HNHA 2AXLA 2ZBKA 1WZ2A 2E3HA 2ELHA 4KISA 4UNOA 4J9CA 2NYXA 2L5QA 4JYKA 1KG1A 4RMNA 5IHIA 1K8AR 1K4SA 2LMDA 5CVIA 2L8DA 2BUDA 3M4GA 1ZARA 4QW2A 3PJRA 1Q81R 1V76A 3K1NA 3PNTA 1FC3A 3BY7A 3EYIA 1ON1A 2IP2A 1GRIA 2WSCE 2EJGA 5ILVA 1ZK8A 1D1AA 1R8OB 2O9VA 3DU5A 3ZBDA 5FKNA 2DA9A 1B07A 4M75F 1W7PD 3A5ZB 4HSRA 4Y28E 5IXBA 4MEYF 3W6KB 4QPOA 2QKMB 2CG4A 4HLYA 2NAZA 2K57A 4HF1A 1R1VA 2KIQA 1TQPA 3VODA 2OV7A 2K2VA 2MCNA 1E3PA 1FIAA 3OBWA 4UV8A 2K9LA 3QYFA 5AYFA 3U1DA 4Z88A 1FOYA 2VC0A 2E41A 5BNGA 1QQJA 4E7SA 3QDRB 3WHBA 4NUBA 4RA2A 4XRMA 4QQDA 4ZYEA 3CCET 2HBPA 3CCJI 5KAFC 2EIJH 3G1LA 3BQZA 1K9MR 2GWRA 3MEAA 1WJAA 2KROA 4EMHA 3M58A 2EV0A 1PDNC 3PUBA 2HOSA 1MJAA 1TT5B 3C4SA 2DA6A 3TREA 2ZSHB 3ZQLA 3J80R 3G71Q 1XTDA 2DETA 1T39A 1VQ4T 1WJBA 4XLFA 1B8IA 2GA2A 4OVAA 3LH5A 4RDUA 4Q5WA 4RTYA 4OP0A 6AT1B 3MCZA 3BJAA 1MBKA 2E7WA 1XGMA 2WV0A 1LJ9A 3BLYA 4A0ZA 5EC7A 1H3HA 3EDPA 3BDLA 2NOGA 3BZ6A 3CMAA 2A07F 2OBPA 4XLPF 3PE0A 1WKMA 1NHAA 1LE8B 2LRDA 2EQIA 2CQ7A 4IQ4A 4BYYA 2HKXA 2CUDA 1N9RA 2L7FP 4KT6A 3KEYA 2E12A 4MIMA 2DMTA 1X6BA 3R0JA 1SPKA 2P0KA 4DIQA 1M3CA 2KISA 4ESBA 4M78D 1UGSB 2IS4A 3WXMB 1MJBA 4Q4ZF 3R6SA 3L00A 3JTGA 4XRSG 2J7IA 4IUVA 2DODA 3J80E 1YITT 1SD5A 2F4MB 2YPRA 1MMDA 2DK5A 2LH9A 2Z99A 1O7FA 3SDGA 2GLOA 1B7TA 1NK3P 2F1LA 2R7QA 2XF7A 3GBGA 4EEFG 4KMFA 4JRQA 3GXOA 2KVQG 3QOEA 4J6XA 1PRLC 3LWHA 4I0BA 1WHMA 1OI1A 4GO1A 3S1RJ 3HL8A 2E1CA 2EYXA 4PSXA 2V6CA 4JX4A 5GMKj 3JCMP 4YFNF 2DCEA 4PJMA 4AVPA 3BTJA 1QVTA 4D7NA 3EETA 4M78B 2FVUA 3FBNB 4FT8A 5LGTA 5FRMA 3S2HJ 4C30A 3SYTA 4K2EA 3R0AA 3SDBA 4RAZA 4OMOA 2FNAA 2KXDA 3I56I 2P0WA 4J9EA 3CCQQ 3KP6A 3EGUA 5ICGA 2QEXQ 3K6GA 4DBHA 2RF0A 1UJ8A 4EQQA 3EPZA 4F92B 5J47A 2LCCA 3EGDB 3TQNA 3SWNB 2NS7A 3E1SA 4NC6A 4W97A 5E1ZB 5E3OA 1P9QC 1BC7C 5C4XJ 1VQ9I 2VUMJ 1W6XA 2LP5A 4II2A 1VQKA 3JB9H 1Q1VA 2L9VA 4NNJA 2EJRA 1M2VB 1R77A 4LGWA 4HXJA 2Z3YA 2WAQA 2DT6A 2R7TA 1TZLA 4IL6C 3MAJA 2OTLI 4IHVA 1JXMA 3ZQHA 3CJNA 1ETWA 4I98B 1PD1A 2ENMA 2HBWA 3M56A 3GTGJ 2GA1A 4PJOC 1Q82C 4XLCA 3QYGB 5F6FA 2GCXA 2UZKA 3H0DA 2L7KA 3F21A 2UV1A 3WE3A 3QJYA 4AWXB 1IB8A 4BE0A 2DXCA 3X20B 4E2FB 3CCLI 2EGEA 4BEHB 4ZGJB 4U0YA 1UHCA 3BR1A 2CT3A 2EPFA 2FBKA 2K02A 3RYRA 1T56A 1OCTC 4G7ZF 2X9HA 4QWQA 4PKCC 3WTZA 4XLEA 4LMYA 2E5ZA 2O6GE 2G0EA 3FXJA 4PZJA 4CDGA 1PUEE 2LBFA 2VODA 1JBMA 3JB9I 2FPFA 1U78A 1RABB 2FOKA 1ZG1A 2DF6A 1D3YA 4LDWA 2VASA 2DK8A 4DBRA 1N77A 2BTTA 2RJCA 2SEMA 2CQKA 4RGXA 3I59B 4IRIA 4NC7A 1SD4A 2V4JC 1BOAA 1IO2A 2PMZN 1MBHA 2E2JJ 2RHZA 3I56A 2XAUA 4N0AC 1D8JA 3A52A 5HDNA 3PFSA 1HDPA 1KQ0A 1X1AA 4F52A 1WJRA 3SD4A 2E2IJ 1DPRA 2COMA 4U7BA 2KBTA 4F04B 1T8IA 2EV5A 3HUGB 3IRQA 2H3EB 3M4OJ 2IW5A 2PX9A 4M75E 1X1BA 2CH4A 1BW5A 4FETA 2YS9A 3MCAB 1VQ9A 2ISYA 2KPMA 2HWVA 1M1KR 3OL4A 4XN0A 3TKYA 3CC2T 1VQ7I 4HVUA 2RK1A 5FROA 1EH7A 3K0LA 3QODA 2KK4A 2IGNA 2ZNZA 1TBXA 2VWFA 1TSFA 4HDUA 3A03A 3OV8A 1OX8A 2QI2A 2SRCA 3H0IA 1ZG5A 1VQLA 1R6RA 3CCLA 3WTVC 4HDVA 1U3EM 4P9FA 1RAAB 3G6ET 1JE8A 3HTRA 3PSFA 4LNPA 3VYTB 1TP4A 5L23A 1Z9CA 2JPBA 3GTLJ 4PFOA 3MP6A 3SFMA 1WQ2A 2M35A 1FNNA 1R22A 2JA6J 3L1AA 3ZL7C 2W00A 2DVEA 2XDBA 3F9KA 1TW3A 3GNGA 1WPKA 2QASA 3VS1A 1SD6A 2QAZA 4MFEA 4HV6A 2M8GX 2Q8KA 3I5UA 3ZQGA 2NNYA 3D5LA 1A04A 4B48A 5J40A 5K5QA 4IQJA 4D8DA 2I5UA 4DBFA 1JQQA 3LW5E 3CCVT 3M9AA 3RPUA 2F4OB 1XSDA 4LB5A 1G2HA 2MC4A 2M1HA 4M7AA 2P4TA 2R5YA 1I50J 5EEAA 2JOYA 4VUBA 3WU1B 3KETA 1W0UA 3N5BB 2BZTA 2RNGA 1EKEA 3EUHA 1IHVA 2H6CA 4E70A 2VKVA 2JRTA 2FZGB 1FY7A 4DZPA 3OYKA 2FNPA 2Q2EB 2PI0A 2ECCA 2PUOB 1M5Q1 4ZC3A 3WGIA 4HSTA 2VKEA 1KQSS 3CMMA 3IAS2 3BR6A 1QVUA 1WGSA 3JRBA 2DXIA 5FLMJ 2VONA 1DP3A 3ELKA 4UB6C 2ZJQF 1FTZA 3FXOA 2H1LA 4RB2C 2CKKA 2QEXI 1G3YA 3G71A 4PJOG 2DFHA 5KE2A 1JRIA 2ELKA 3V8JA 1VTNC 3VOEA 2ZCWA 1EH8A 1U5TA 3FC3A 1VQOQ 1D0XA 1IV6A 3TDUC 2X4XA 1K83J 2AT1B 2CZ7B 4C0GA 5LJ5d 1KD1C 1W5TA 1D0ZA 4N4IA 4QVCA 2QA4T 5EG2A 1P7JA 3E7LA 2W25A 4B3AA 2KLOA 2R7XA 1OKRA 1SD7A 2L9SA 2DVJA 3BC8A 1BKBA 3TCJA 2HZTA 3EYYA 2ED1A 3A8HB 3P7NA 4F14A 2M5WA 3QKJA 5CKHA 1BJAA 1LFPA 1XPXA 1BBZA 4J8OA 4RTXA 3S32A 2DXBA 2YHTA 4J7FA 3EHRA 2KGTA 3O3KA 1M8VA 2DTIA 3HG9A 1YE9A 1QP2A 3ECHA 2EJ9A 3U9GA 3WVEB 2LDUA 1M90C 4DBQA 2HPIA 2ATCB 3ZCOA 2MH2A 3J81K 1SVMA 1LQ1A 3CCRT 2EPDA 2YUNA 5BPDA 2KYBA 4ZDPA 3UPUA 2PLYA 1U6GA 3ABTA 4M72A 5AIPA 4DOZA 4AIKA 1HKSA 5HLGA 2P7CB 4V2SA 5LJ5e 1H9TA 4O5VA 4YFXF 4OB0B 2VC8A 1LNWA 4ORZA 4XIDA 3LA3A 1OZ3A 2ABLA 1YJWT 3IH3A 2XB5A 2D1HA
chains in the Genus database with same CATH topology
5L3EA 1OYWA 1YW9A 3CLOA 2BV6A 4LLLA 4BDYA 2PMUA 3PMTA 5GAOn 1IREB 1BIAA 1Z6TA 4M9XA 5H20A 1S7OA 3V8KA 1MD0A 5IT3A 2VOOA 4FX4A 4WK8F 2RI3A 1IAWA 3R6OA 2VXFA 4BI4A 2DW4A 4E7HA 3SZPA 2L4MA 1QVPA 4A53A 4QVDA 3FHZA 1DP7P 2DEQA 2FEZA 4BHPA 1R00A 3O6BB 3X25B 4XU3A 2DTRA 3MWMA 1J9IA