2QQAA

Crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
218
Chain Sequence
DLVDTTAMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the N-Terminal Helix in the Metal Ion-Induced Activation of the Diphtheria Toxin Repressor DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription regulator
molecule keywords Diphtheria toxin repressor
total genus 66
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qqaA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2qqaA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qqaA03
2VBYA 3LQQA 3M1EA 5CVVA 3TO9A 3QOPA 3RDIA 4KMFA 4N9IA 3LAPA 3ZMZA 1P4WA 2P5KA 3WTSC 2O6GE 4ESJA 1KQ0A 5DD4A 4XBFA 2F5CA 2Y48A 1MGTA 2LF8A 2G9WA 2NYXA 4LFUA 1WSUA 1Y0UA 5F6FA 5BPDA 3OV8A 2L01A 1X3UA 1O3RA 2W85A 3EYIA 2Z9OA 3I0TA 2H94A 4TV7A 2FMLA 4U88A 2L54A 4M6YA 2ETHA 4RGSA 3HSRA 4RB0A 4AWXB 3F8NA 4KN4X 2A5YB 2J5OA 5LGTA 3V7SA 3EETA 2JPCA 3HTUA 4OIRF 2P4WA 1SAXA 4O5VA 3U9GA 4RGRA 5LHGA 1Z7UA 2O61A 3FM3A 2FU4A 3WTTC 3L00A 1V4RA 1ZG3A 3P9CA 1S29A 4EV0A 3EUHA 2LSOA 2V1UA 3I4PA 3RIRA 1T2KA 1J9IA 3JTGA 2GXGA 3RTRA 1Q1HA 1OKRA 4U0WA 2P5VA 1IAWA 3BZ6A 3W6JB 2DAOA 3BOQA 1VTNC 1YYVA 3E97A 1OYIA 1MJ9A 1SD7A 1HBXG 4F7ZA 3REOA 1CF7B 1FYKA 3GF2A 3QRFF 4EJVA 2EV5A 1J75A 2BYVE 1T98A 4EJUA 3LWFA 1T0FA 4P5OA 2QM3A 2Z99A 2DFIA 4YFXF 2E1CA 1R7JA 1BC7C 2CO5A 4HX4A 2OZ6A 1W7PA 4A2UA 3FZVA 4I7HA 5E18F 2L4MA 2DLLA 1BI1A 3G3ZA 1XMKA 5ICGA 2K7LA 4WK8F 1UB9A 2QQAA 4KUMA 3B02A 1I1GA 2R3SA 1A04A 3MAJA 4LK0F 4HF0A 4A6DA 3F8MA 1EV7A 4I2OA 2JRTA 1B4AA 4HLXA 1ZGAA 1SD6A 3I59A 3LA2A 1MD0A 1FP1D 1E2XA 3MFKA 2K5FA 3CJNA 2CGPA 3F8BA 4KICA 4EJTA 2O03A 3RPQA 4BH9A 5HLHA 1D8JA 4CGZA 3RYRA 5D6FA 3CUQA 3BWGA 3ML6A 3SFZA 4U7BA 2V1XA 3VFZA 2K27A 4LK1F 4YFKF 2FXAA 3ABTA 2R7FA 2C6YA 2A07F 2EJRA 4ZYHA 4G94A 4L18B 5TJJA 4KFCA 1R1VA 5L3GA 2K4YA 5E8IA 2ZO4A 5HLIA 1W5TA 3QP5A 3NEUA 2V79A 2FA5A 5L3CA 4E70A 1G3TA 2IT0A 2BGCA 3FMSA 4RAYA 2HDCA 1TQIA 3BY6A 2WTEA 2ZMEB 5J8FA 1USTA 1YIOA 3KP7A 5EEGA 3NQOA 1U2WA 2HTSA 4HBLA 2DU9A 4MHGA 2O0YA 3J80Z 3KP5A 3WU1B 1T39A 5CYVA 2ZKZA 3ULQB 1FWZA 3V8LA 2PQ8A 4DQ2A 2VN2A 1O3QA 1FBQA 1K6OA 2FSWA 3DQVC 2HQNA 4HX8A 3MCZA 4MEYF 4OIOF 2XIGA 4PCQA 2BV6A 2HQRA 3O3KA 4ZYEA 1STZA 3CUQB 1DDNA 2Q2EA 3QU3A 3K1MA 1FYLA 2VC0A 2EFQA 2PG4A 2AXLA 4BAYA 3KZYA 1YLFA 3HIFA 1EH8A 3BJ6A 1R23A 3E5XA 4OINF 1FT9A 1SD4A 1XDSA 3KEQA 2PEXA 3GFJA 1TLHB 1K78B 1P92A 3GFMA 3L9FA 2OZUA 5J6XA 2YSRA 5ICCA 1T6SA 2AS5F 2RN7A 5CVJA 3IKVA 2UZKA 1MDMA 4PDKA 1U5TA 1BI3A 5DYMA 5FO5A 1Z91A 4OMYA 3GEZA 5LRRA 2PMHA 1XB4A 2DW4A 4R1HA 4A0ZA 3ZMTA 1T38A 3MWMA 2A3SA 5HS9A 2D1VA 3ZN1A 2DK8A 1TQMA 2M5WA 1FSEA 4EJWA 2M8EA 4OMZA 2JT1A 4GO1A 3E6DA 5FLXZ 1Z6TA 1XD7A 3TDZC 1U3EM 4IRGA 2HS5A 4RAZA 2K4BA 4HLYA 4HQEA 3CDHA 2XHKA 4A0YA 1FP2A 4ZYDA 3KFWX 2M1BA 4AVPA 1XMAA 5LRSA 3FXUA 1GXPA 4UVBA 1U6GA 1B9NA 2YU3A 2EFWA 1IXCA 1WRJA 2QQBA 4EJOA 5JI6A 3VOEA 2KKOA 1REPC 1QVPA 3HOTA 1C0WA 4MGRA 5F1RA 2ELHA 4ENNA 3WGGA 3JTHA 2H09A 5L3DA 2IW5A 1FBSA 1AOYA 2OQRA 1FOKA 4ESFA 1SMYF 1HSTA 2Y75A 4ZZDA 2XVCA 3S2WA 1RUOA 1SFUA 5F64A 2L02A 1FPQA 2VT2A 3RI4A 2KIMA 4Q5SF 2E7WA 3D5LA 1KGSA 2ZJ2A 3JSOA 1LDJA 4ETSA 1JE8A 2DBBA 2PJPA 5BPIA 5A2QK 4M9ZA 4A12A 2DT5A 5FLXK 3CO6C 2EFOA 1PUEE 1D8KA 5ILVA 2G7HA 1P6RA 3ISPA 3K2ZA 2COMA 1L3LA 1KA8A 2NNYA 4K2EA 2V1DA 2IP2A 4ESBA 3WE3A 1U8RA 2L4AA 3SXYA 1S7AA 1HQCA 3DXJF 2VE8A 1U5TB 5E17F 1R5GA 1QQIA 3K69A 4YFNF 4RGUA 1IRGA 1D3YA 3R0AA 1R1TA 1BC8C 2IVMA 3HRMA 3KLOA 3VODA 2FOKA 4B09A 2P6TA 1K79A 1MKMA 1ZG1A 4UV8A 4NQWA 4S05A 3V8KA 1LJ9A 1ZH5A 3KP2A 3ZMUA 3IWZA 3F6OA 1BN5A 2DQLA 1JHFA 3BDDA 4UUVA 3KZZA 1KQ8A 4MNUA 1ZGJA 4LLGF 2TDXA 4KA4A 2PN6A 1OMIA 5AONA 2LKPA 1Z6RA 3IKTA 1ZN2A 1H0MA 1J5YA 1YW7A 5ICFA 2GZWA 3ZN0A 3F22A 2K02A 1R58A 5LGNA 3GVAA 4I02A 4PZJA 2J5PA 3COAC 4KDPA 4M74A 5CVIA 3K1NA 3WE2A 4EGZA 4IRIA 2RV8A 2GWRA 1MDMB 2P8TA 2EV0A 5K5OA 2D2WA 2RKHA 1P2FA 4OIPF 2JSCA 1SFEA 3ZMVA 3IWFA 3GYHX 3I5UA 4MQ9F 5JR3A 2XAGA 3K9TA 3M8EA 1H9GA 1XDUA 2B0LA 2GIVA 3WODF 2MH2A 1QO0D 1YTYA 3GLXA 1BIBA 3IHUA 3PFIA 2HKOA 3HHGA 1QPMA 1WKMA 1QNTA 1RUNA 2MLGA 1IXSB 3N4MA 5EEHA 2EA4A 3CTAA 2IRFG 5JVTA 2STWA 4HQMA 4PGGA 4XSXF 4G6DA 2CQKA 1WQ2A 2PMUA 3I71A 2ESHA 5HS8A 1XSVA 1HW1A 4HDVA 4HV6A 1E17A 1OR7A 1F1ZA 4M71A 1XCBA 3IRRA 4M9XA 3N97A 1LQ1A 2M45A 3U2RA 1NHAA 3TO7A 1ZLKA 1XGNA 2KJCA 3J81Z 2H3JA 1UHWA 2WC2A 5H6RA 4EM1A 4MTDA 4YG2F 1LDKB 2ZCWA 3ECOA 3LA3A 5IT9Z 2X0LA 4KYWA 4MQVA 4G7ZF 4Y13A 1BI0A 1ZHFA 4EVIA 1JGSA 4RB2C 1IN8A 1G3SA 4LLLA 3TKYA 2ZBKA 1XGOA 1ZARA 3NRVA 5D5WB 1FC3A 2MLKA 5D6EA 4HDUA 2QUFA 3KLNA 2FRHA 1R00A 2A61A 3KP3A 4BHPA 2OU2A 3DEUA 1W7PD 1BOAA 3CO7C 3WGIA 1FY7A 2H6BA 2QBYA 1U5TC 2UXNA 1YO5C 1G4DA 5HDNA 1O3TA 4UVCA 4Q47A 1RI7A 2HZTA 2KIUA 1TTYA 3IRQA 1FYMA 2FBHA 2KRFA 2LX9A 2OQGA 2P7VB 4CZZA 4L0ZB 1QW1A 2FBIA 3T5XA 1ZG5A 4N0BA 5E1ZB 2ADUA 2X4HA 3BP8A 5DCMA 2W25A 3Q5FA 1TNTA 3SZPA 2D45A 5D5XB 3T1BA 5JHUA 1K78A 1ON2A 1YG2A 3ZQ7A 3TO6A 2UXXA 5E20A 1PP7U 2K86A 3RKYA 4CYDA 3KE2A 5JFRA 2GQQA 2Q0OA 2NRAC 1B9MA 3FM5A 4QLCU 5CJ9A 4EM2A 4IJAA 2BE5F 3F72A 3I58A 4FHTA 2LNBA 2DPDA 4WXHA 2RQPA 1HKQA 2E7XA 3EDPA 4LLNA 3F8CA 3M9AA 3E6MA 3FWEA 1O3SA 3J7AO 1FLIA 4S04A 2A6HF 2HYFA 2QWWA 4I98B 2D1HA 5LHHA 2XASA 2FBKA 3LSTA 3FMRA 3GUDA 5AIPA 1ZLJA 5E8GA 1I1SA 1EH7A 3F23A 1YS7A 1DUXC 1TQPA 4BQAA 4OIQF 2GCXA 5K5RA 5D4SA 1QZZA 1YS6A 3T0YA 4HW0A 4WX9A 5FD5A 1TW2A 3TQNA 3L09A 3QU6A 4BYYA 1KU3A 2JZYA 2QVOA 1AWCA 2HR3A 2EFNA 4YIIA 2VE9A 1RIOH 2ZFWA 4LB5A 3E6BA 2LF7A 1XN7A 3O2PE 1PDNC 5BQTA 3M8FA 3OOPA 4AIJA 2FMYA 5D4RA 1ZYRF 3DPLC 2Q8KA 3DF8A 1R1UA 3C7JA 3TDUC 3WTWC 2L3DA 1EH6A 1DP7P 3P9KA 3K0LA 1R36A 1ULYA 3ZPLA 4PGHA 3V7CA 2GAUA 2E1NA 2XKOA 2MBFA 4XLPF 2NS0A 1SFXA 3I54A 3SHFA 2XAFA 3MZHA 4L9NA 3LQRA 2VT3A 4KIBA 5LHIA 3H92A 1LB2A 3KCCA 3U1DA 1Z05A 3HUGA 4N9HA 5DCFA 5LLQA 4M72A 3W6KB 2F5DA 5D5UB 1BIAA 2DQRA 2K5IA 5CVUA 2ISYA 3I53A 1WI9A 1O7FA 4LGWA 3MEXA 2PI0A 1R5HA 5LGUA 2WV0A 1KU2A 2QLZA 2RDPA 4XRFA 1F4KA 4GYGA 4Z2YA 1WWXA 2M87A 2GXBA 2F2EA 1RNLA 1LEBA 4GYIA 1JXSA 3K1PA 2GA2A 5LEKA 2HOEA 3PQKA 3JSPA 1DPUA 4IXAA 3LAJA 3F8FA 4OU0A 1J0RA 4IHTA 3C18A 1KYWA 3ECHA 4I0BA 2XUBA 1CGPA 3GFIA 1OYWA 4EQQA 2XROA 1ZAOA 5BMZA 4Y17A 4G7OF 3ZP5A 4M6XA 4HF1A 4G9YA 5HVQC 2M30A 3SZTA 3KP4A 1HKSA 3HSEA 3R6SA 4MTEA 4KIFA 3IC7A 3CLOA 4WXDA 2MH9A 4LB6B 2PLYA 5K5QA 5ED4A 1XGSA 5E1WA 3C1DA 1S3JA 2XAQA 1MJAA 5ILUA 3FMQA 5LBQA 1L0OC 2FEZA 3RJPA 4CO8A 2RNJA 1I27A 4HX7A 3T8RA 5DCMB 4AIKA 2EK5A 1S6LA 2HEOA 4JK1X 3LFKA 4I09A 2HFHA 2PBIA 2G7UA 5BOXA 2MA3A 1MJBA 5IT3A 1UHMA 2XAJA 3TGNA 4JBAA 4L9TA 4HA8A 4HAMA 2ACJA 2Z3YA 3FXQA 4H0EA 2RC4A 3GZ5A 4HV5A 1UFMA 4L0YB 2CG4A 3ZMSA 3GO5A 2OAZA 3Q9SA 1F5TA 3QP6A 4UXNA 3BPVA 3WTXC 3VB2A 4EM0B 3ERED 4KNYA 2QENA 4IVNA 2BEOA 3HHHA 5DV5A 2STTA 3HSFA 4LMYA 1IF1A 1USSA 2IA0A 3TOAA 1BBYA 2OD5A 5AIQA 5ICEA 3P7NA 4RB1A 5A2QZ 3GZ6A 4Q4ZF 1B59A 4A6EA 5FFXA 4XLNF 2VBXA 1XCVA 5IT9K 2JTVA 4MEXF 2DTRA 4OOIA 1S8NA 3WTUC 5H20A 3ELKA 2XV4S 3HOSA 5HLGA 5DUIA 3AAFA 2XRNA 2HGCA 1J7KA 4ENMA 4GXOA 4ASNA 5L3FA 1ONVA 5CVRA 1Z9CA 3DFGA 4JQFA 2R7DA 3R4KA 3DP7A 4ZYGA 1O57A 3HRTA 3F21A 3QAHA 2A68F 3QPTA 1P4XA 1YQAA 2DPUA 3BPXA 3DV8A 2XAHA 2DI3A 4ENJA 1GXQA 4CICA 3JAMK 2F5EA 1I6XA 5E1XA 1FX7A 2A69F 4NHJA 3J81K 4R79A 2Y0MA 1S7OA 3HYIA 2EWNA 4AD9A 4Q48A 3RYPA 4KN7X 5H6QA 2ZXJA 2VBZA 4Y15A 2QYOA 2EB7A 4FT8A 2IPQX 3T8TA 3I59B 2FQ3A 3WTZA 3GW2A 4U0YA 1QGPA 4XSZF 4NB5A 3BJAA 1W4MA 4A0XA 3GWZA 3M7GA 4U7DA 1SD5A 3TOBA 2ZNYA 4A5NA 4GCVA 5KVRA 2H27A 2YPRA 4UVAA 1IRFA 1SMTA 1KYZA 2H6CA 3EQLF 3D0SA 1XSXA 3EYYA 2OA4A 2W84A 3FX3A 1FSHA 3R60A 1KU9A 4EGYA 3CUQC 4HF2A 4A5MA 5DD8A 3GXOA 4M9SA 3V7RA 2NAZA 2OBPA 4FX0A 5HDGA 2K5LA 4HZFA 4G7HF 2Z5UA 5FB2A 5D8KB 3CUOA 1ZREA 2CFXA 3Q9VA 1FNNA 2P5LC 4IF4A 2V9VA 1GVJA 1QZYA 4R8HA 1G6NA 5HOOA 3ZMDA 1R22A 2VBWA 3KP6A 1IN5A 5LEJA 3WGHA 1ZRDA 4ON0A 4RGXA 3WTYC 4M73A 4B8XA 3O6BB 1IZ1A 3WTVC 3PQJA 1U78A 4RB3C 1I5ZA 4IHSA 3MZYA 2A6EF 2DO7A 3H3ZA 4FX4A 1LDDA 2HKXA 6PAXA 1YW8A 4L5JA 3P9IA 3VEPA 1JHHA 1ODDA 5L3EA 4WXCA 3BROA 3GFLA 2RVCA 4LG0B 1IN4A 1XSDA 5BS6A 2CYYA 2QZ8A 2CW0F 2CWEA 2NNNA 1J2XA 4GGGA 4BHBA 4BHCA 1FZPB 4UHTA 3MHXA 2EFPA 3L7WA 5K1YA 2ZMEA 3R0JA 2FNPA 1IXRC 2ESNA 4LD5A 5DUKA 4L9JA 2IA2A 1YFHA 3ROUA 1ZRCA 3E3VA 3ABUA 4LJZF 2VOPA 3LA7A 2KIFA 4UV9A 3RKWA 5L3BA 2F5FA 3B73A 1RZ4A 4G8XA 2VOOA 1XGMA 4G6QA 4L5IA 4P9UA 1PP8F 1UCRA 1KU7A 1J59A 2XKPA 1HXDA 2Z33A 4P9FA 4BNCA 4EMSA 1LEAA 3H3UA 1HW2A 4BXUA 1HW5A 3MQ0A 5D8LB 2BBYA 2WWYA 1D5VA 2KJBA 2VXZA 3IL2A 1IUYA 1G3YA 4P55A 2LDUA 4ZH4F 1GHCA 4QWQA 4IRHA 3SQNA 1BYMA 2MC3A 2DK5A 5TRDA 2IJLA 4P96A 2CSOA 1IN6A 1W7PB 4KMUX 2P6SA 2V6CA 4ENKA 2FF4A 1P4AA 3F3XA 4CHUA 3E5QA 2PFBA 2O3FA 1Z1DA 4I01A 4RS8A 1DPRA 4HOBA 5KK1A 1K7AA 2FE3A 5ILSA 4O6JA 2ISZA 2HWVA 1B1BA 2YX4A 2IA1A 4YIFA 1IN7A 3R61A 3HRSA 1BJAA 4D0PA 2W57A 3BJOA 1IW7F 3C3WA 4U0VA 3I64A 2VODA 3E19A 5DDGA 4ZZLA 1LNWA 2EA2A 2QQ9A 2RGVA 3HRUA 2YX7A 4KIGA 3FXRA 5D5VB 4UNOA 4CXFA 5J8CA 1G3WA 1H9TA 3HTSB 1BI2A 1F9NA 4WF2A 1W5SA 5DEQA 3E5UA 3V4GA 4CDGA 4KT5C 2VC1A 1YW9A 1TBXA 3E6CC 3RPUA 3FF5A 1HKTA 5HS7A 1QBJA 1FBUA 3J80K 2P7CB 2EV6A 3QPHA 3FHZA 1ON1A 2MD5A 2YR2A 1ZRFA 1BM9A 2K4JA 3WG9A 4AIHA 3JAMZ 1TW3A 3DKWA 3KETA 1OYYA 3L2CA 2XGXA 2O8XA 4I0AA 2ZNZA 1B6AA 5CLSA 3F6VA 3V8JA 5HDKA 2VONA 2HYGD 1KQ9A 5ERIA 3WU0A 3KEOA 5FGMA 1HSJA 2FNAA 1OPCA 1O7LA 4O3MA 4HYEA 4L9VA 4LG0A 3G73A 2HTJA 4IPAA 2W24A 1CF7A 2QBYB 3DPTA 4WCGA 1MZBA 5FFZA 3GX4X 2UWMA 4DNCA 3RKXA 1V3FA 2JPBA 3JW4A 4WWCA 5FD6A 1TNSA 1LVAA 2GA1A
chains in the Genus database with same CATH superfamily
3DKMA 4ME7A 1KFZA 5I22A 2VBYA 3G4ST 5J1YA 3LQQA 3M1EA 1YITI 5CVVA 1VYVA 2NYSA 2A0FB 3OMYA 2E5ZA 1NH3A 4J9IA 4DGWB 2JNGA 3TO9A 4LDUA 3QOPA 3I9V2 2VL8A 1H8KA 4HT9A 2VJ5A 4XLAA 2KMTA 3PVLA 2EGEA 4DEYA 2MW8A 3BW1A 3RDIA 2G0EA 4KMFA 3OBWA 4N9IA 5A0DA 3LAPA 2WY8Q 1UGPB 4XLFA 3ZMZA 1P4WA 2EVRA 2P5KA 2ESWA 2CQQA 3WTSC 4B43A 2O6GE 3GTPJ 1M8VA 3AG4H 2O9SA 4BU2A 4ESJA 4OGEA 1KQ0A 4V2SA 3QDRB 5DD4A 4XBFA 2F5CA 2M9UA 2Y48A 3J80E 1MGTA 2P0KA 2LF8A 4Q5WA 1E3HA 2G9WA 2NYXA 2DJIA 5JVGF 2YUQA 3HJEA 5HODA 5CKFA 1OULA 2DXCA 4LFUA 2ZSIB 1Y0UA 5DM7F 1WSUA 4X9DA 5F6FA 3ZBDA 2V1QA 2DA2A 5BPDA 4ELYC 3OV8A 1H3HA 3ASKA 1KIKA 1MSFC 2L01A 4LD9K 1X3UA 4XICA 1IG7A 1O3RA 2IEKA 2W85A 2LDMA 2XB0X 4D1QA 3EYIA 4HVWA 2QEXT 6AT1B 3PIPF 2Z9OA 3I0TA 2H94A 2E71A 4JX4A 2XIDA 2FEIA 4TV7A 2KBTA 2FMLA 2R7UA 1UG1A 3M53A 2YHTA 4U88A 5GAHJ 2K9NA 3P5JA 3A5ZB 4EMHA 2RAEA 1ETYA 2L54A 2QTVA 4LDWA 1G5VA 2KQRA 2ETHA 3ONQA 4M6YA 4RGSA 5GTIC 1X43A 2X6OA 3HSRA 2HSPA 2O8KA 4RB0A 2HSEB 4AWXB 3F8NA 4KN4X 4ESRA 5IN1A 2A5YB 2J5OA 5DS9A 1C0MA 1KC8R 3CCSA 5LGTA 3V7SA 3PL8A 1W36D 1QZEA 2E70A 4XTWA 3EETA 2ZJQF 1MBHA 2JPCA 3BR2A 4CC3A 2QGFB 5GMKi 5FW9A 2DO3A 2RM4A 3ZGKA 4FW1A 1Y39A 1Z67A 1N5ZA 3HTUA 2R5AA 4F7UA 3CCRA 4OIRF 2XF5A 3H5NA 2H8WA 2P4WA 4NC7A 5EDNA 3M4GA 1SAXA 2ROTA 1JBMA 3EG2A 4O5VA 3U9GA 4RGRA 1YJNA 5CPRB 5LHGA 3M55A 4DOZA 1HA8A 1Z7UA 3LMMA 2O61A 4C0FA 3FM3A 2FU4A 3WTTC 2FOWA 3L00A 1V4RA 3VSLA 5LJ5h 1ZG3A 2M35A 2VJIA 4FT2A 3P9CA 3EGUA 2L2PA 1GV2A 1AA7A 2HPIA 5CQYA 1S29A 4EV0A 1GCPA 4M78F 1EFNA 1MHNA 2RNAA 4J5YA 2HVQA 2KYBA 3EUHA 2LSOA 3CCJI 1JUMA 4IHVA 2LFBA 3IP4B 4AUXA 2V1UA 1VQ6T 4UUSA 1DU0A 4II1A 4EIKA 4AG1C 2LX7A 3I4PA 2QEXI 3IUOA 3RIRA 3TBIA 1MNEA 2X9HA 1T2KA 1J9IA 3JTGA 1V54H 2OCCH 1OFCX 2GXGA 3MKLA 4BJTA 2R5YB 4OB1B 2VYTA 2F2VA 3RTRA 2GLOA 1Q1HA 2K9QA 3DKYA 1OKRA 4U0WA 5KAIC 2YDLA 2LJ3A 3S3OA 3L2VA 1JTXA 2J7IA 2P5VA 1WLPB 2PVDB 5IAYA 2AXTC 1IAWA 3BZ6A 3W6JB 5LD2C 1Y1WJ 3DEEA 4HPQA 1QVTA 4ORZA 2DAOA 1Z7LA 1BR2A 2KFDA 1DGWY 3CC7A 2H3EB 1YI2I 3BOQA 1DQUA 1VTNC 1H641 2F48A 4B48A 1LPLA 3QOEA 3SEQA 3JB9I 2JUFA 1YYVA 1VQ4A 3E97A 1OYIA 1MJ9A 1SD7A 4ZJZA 1HBXG 2E6NA 4F7ZA 3PGGA 4FE7A 1D0XA 4ZC3A 3REOA 2VUMJ 4ZGEB 3AG2H 4QVZA 2LRQA 2Y9ZA 1CF7B 1GBRA 3HC7A 3AKZA 1YI2T 2CV2A 4F7UF 2DJZA 4OGCA 1FYKA 3GF2A 5GAN3 3KUFA 1GVDA 3QRFF 4EJVA 3CF5F 2EV5A 1KHIA 3M0RA 3ER0A 1YOVB 3QG1A 4M78D 1ENHA 3W2AA 1J75A 2J6KA 2BYVE 4XKWA 3PFYA 3QYBA 4IUQA 1SFOJ 1T98A 4EJUA 4DBRA 3LWFA 3CC4I 3ZEHA 3NWTA 5CKEA 3L2ZA 4LE9A 1T0FA 4P5OA 2QM3A 1SPKA 1R5ID 4RKUE 2Z99A 2DFIA 1BOBA 5GAOl 4YFXF 2E1CA 1R7JA 1BC7C 3NGPA 2CO5A 4Z8AA 1TZLA 1QP3A 2VVKA 2KLOA 4HX4A 1S72Q 2OZ6A 1B72B 4CI0C 1W7PA 4A2UA 1OLTA 3OR2C 4PJLA 4NL2A 1H89C 4JX6A 3FZVA 1T95A 3NARA 2JQ7A 2EQUA 3RMSA 4I7HA 3WXMB 2KAFA 1KZHA 5HLTA 1B7TA 5E18F 5IT9E 2L4MA 1YITQ 3H36A 2DLLA 3BG5A 1V1CA 1BI1A 1QPIA 1GCQC 3QO3A 1MSEC 4QVCA 4R55A 1YJNT 1HLVA 3G3ZA 2P0TA 1XMKA 4N4NB 4KJZA 5ICGA 1RQ6A 3RR6A 4GLKA 1N75A 3EG9B 2KL4A 3QHSA 2CDTA 1Q81C 2K7LA 2DT7B 4WK8F 1UB9A 3QIIA 5KYYA 2QQAA 5LJ3d 1W36C 4KUMA 3NPFA 1E7OA 1SHFA 3LH5A 1MNMC 1RLPC 2BHYA 3B02A 2A3LA 2CT3A 1I1GA 1XMXA 3LX7A 3DPUA 2M7BA 4MFEA 3HXLA 2R3SA 1OX9A 2J06A 3EHQA 5C44J 1A04A 2Z1DA 3MAJA 4FTHA 1Y71A 4LK0F 2EGAA 4HF0A 1M1GA 4A6DA 3F8MA 1EV7A 4IO9F 3OSVA 4CCKA 2EILH 4I2OA 4QSHA 1M27C 2DLPA 2JRTA 2EAYA 1B4AA 4HLXA 1ZGAA 1HSQA 1VQOA 2Y31A 3HG9A 1SD6A 3BFMA 3M0QA 3I59A 3LA2A 1MD0A 2EH3A 5E3NA 2EPDA 5GAN4 1FP1D 2WBMA 3CMAI 1AOJA 1E2XA 3DLMA 3F70A 2KQWA 2L3PA 4PL6A 4C8QD 3MFKA 2K5FA 2RQTA 3CJNA 3S1NJ 1Y07A 3CCEI 2CGPA 1I81A 3F8BA 5FLXE 2FHDA 1WCMJ 4BXXJ 4KICA 1RUWA 1W1FA 3KX2A 4EJTA 3A0HC 2L9NA 3QWXX 2O03A 3OYGA 3RPQA 4BH9A 3CMEQ 4CC4B 4F7UB 3DCFA 1NBEB 2O01E 2OTJQ 5HLHA 2R7TA 1D8JA 4M7AC 1S7EA 4CGZA 1JXOA 3RYRA 2L7MP 3CUQA 5D6FA 4IQJA 1PG5B 3WHCA 3PFSA 4E7IA 3BWGA 3ML6A 3SFZA 2LR8A 4U7BA 3VSKA 3ZQQA 2LP5A 2K5CA 5KCMA 2V1XA 2KISA 2K27A 3MN2A 3VFZA 3LSRA 4Y92A 3DLLA 4LK1F 4YFKF 2FXAA 1TC3C 3ABTA 2DOAA 2R7FA 3M0TA 2BZ8A 4DZJA 2C6YA 1W6XA 1YHQI 4M78G 1UJYA 4BY6C 2A07F 2EJRA 4ZYHA 2BW3B 3QPLA 5CKBA 3FISA 2E36A 3G6EA 3QPSA 4JJCA 4G94A 2RK2A 4L18B 2EJ9A 1QMCA 5TJJA 4KFCA 1R1VA 2WB1A 3MP6A 3GTKJ 2I8DA 3OSGA 1GDTA 1PD1A 1IRZA 2E5NA 5L3GA 3PMTA 3OIPA 4M75D 2K4YA 1K9MR 1LE8B 4LUDA 5E8IA 2EPFA 3I55T 3OYIA 2ZO4A 1FOXA 1WGSA 5HLIA 2O9VA 4PJ0C 1TT5B 3AG3H 1W5TA 3QP5A 4PK4A 2E10A 2RN8A 3NEUA 2V79A 3VV0A 2FA5A 3A8HB 5L3CA 2B9SA 2ZSHB 3W2VA 4C0DB 3ZQHA 4E70A 3LWHA 1I1JA 1G3TA 2IT0A 2BGCA 3FMSA 3JRCA 4RAYA 2HDCA 2IG0A 4C92B 3EFSA 2XGDA 5GANf 1TQIA 1Q82R 3BY6A 2WTEA 3RQIA 2ZMEB 5J8FA 2K57A 3OW2P 2JJ7A 2QYZA 1USTA 1YIOA 3KP7A 3H0FA 3ZQCA 5EEGA 3NQOA 1U2WA 3IH2A 4I6ZA 3SHWA 2JW4A 4BXFA 1BW6A 2HTSA 3NAUA 1WJ5A 2JMWA 4HBLA 3DTEA 2FJ1A 2DU9A 3HZJA 4A3LJ 2HKQB 2JTMA 3Q0UA 2O0YA 4MHGA 3J80Z 1EF4A 2JMAA 4HCKA 3KP5A 2LCLA 3WU1B 1K1ZA 2GOXB 5CYVA 1T39A 2C0IA 2H8HA 2R58A 2ZKZA 4KT6A 2Y0SN 3LW5E 3ULQB 1FWZA 2C0TA 3V8LA 4A4GA 1FTTA 1QVUA 2PQ8A 2XU8A 2CS3A 2CS7A 1E6GA 4HCBA 4DQ2A 2LC4A 2VN2A 1O3QA 1FBQA 2CGHA 2MGQA 1K6OA 2EZKA 2W4SA 2AQEA 2FSWA 2RA2A 2MI6A 3DQVC 1TL8A 1UJ0A 1JTYA 2YXYA 2HQNA 3FK6A 3MCZA 4HX8A 1NG2A 4MEYF 1M3BA 3OYMA 4OIOF 2XIGA 2JS0A 3C2HA 5F0FA 2KI7A 4J6WA 4IKFA 2L89A 5J3BA 4A3MJ 3U23A 4PCQA 2BV6A 1M2OA 1QVGA 3LLRA 4C8QG 3CPWA 1Z9ZA 2HQRA 5GANh 3JSCA 3O3KA 2L9RA 2CREA 2XSDC 1T3SA 4OF1A 4ZYEA 1STZA 2YRCA 4B9WA 3CUQB 2MCNA 3K4LA 2LREA 2Q2EA 3QU3A 1DDNA 1A5JA 3OW2S 4LIUA 3LH0A 5D6YA 2COZA 3CMEA 1Q86C 3K1MA 5JHFA 1ETXA 3HTRA 3UA6A 2IGMA 4ZDLA 1FYLA 1LFPA 2VC0A 4EPCA 5GMKm 2R93J 1VQ5Q 4XR6A 2EFQA 2PG4A 4YTLA 5FKLA 1UEBA 1E3PA 1PVEA 2AXLA 4BAYA 3C2BA 1NK2P 1WI7A 3KZYA 3J7AY 1YLFA 3HIFA 1ABQA 3JR9A 2E1HA 1VQMT 1VQKT 3OYYA 2DRKA 3CCEA 2HI3A 2L0KA 3SEMA 1WJCA 2RD1A 4OB0B 1EH8A 2YUOA 3BJ6A 3LSJA 2LVSA 5EEAA 1LUJB 3CMAA 1R23A 3E5XA 1VQOT 3ZOBA 2DMPA 4OINF 2NLUA 1FT9A 1SD4A 3PJRA 1GFCA 2CZ7B 1XDSA 2EQRA 3KEQA 4C92C 4JDSA 1M1KC 2PEXA 4RMOA 3GFJA 3F0CA 1TLHB 4AYBA 3L2WA 3T9NA 4C0DC 1K78B 3CDIA 1I07A 1P92A 3SDZA 1YJ9A 2NS7A 5KYWB 3GFMA 2GIZA 3L9FA 2A7YA 4Z89A 1TT0A 2OZUA 2M0CA 5J6XA 5FU7B 4PKCC 4RDUA 2YSRA 3K4KA 5ICCA 2P0QA 4L6V5 2DMOA 2GFAA 4PLLA 4PJOE 1K4US 1T6SA 2AS5F 2RN7A 3OSFA 2VWFA 2VASA 3IKVA 5CVJA 1IDYA 2UZKA 3CLQA 3GTGJ 1MDMA 4HXJA 4PDKA 4YEJA 5FU6C 4E7LA 2R5MA 3FKIJ 1I50J 2PMZA 1N77A 3TSZA 2I10A 3QYGB 1U5TA 3C12A 1BI3A 5DYMA 1IZ6A 1K8AC 2L7ZA 2A6TA 5FO5A 7AT1B 1Z91A 5KE3A 1BK2A 4OMYA 4XTYA 3GEZA 5LRRA 5GAN5 2GBQA 4JS5A 2PMHA 1XB4A 2DW4A 4R1HA 4A0ZA 3ZMTA 3I4MJ 2MUNA 1T38A 1D09B 4E6RA 5KCHA 1X1AA 2A3SA 2Y9YA 3DTIA 3MWMA 2QI2A 4IUPA 1YHQQ 5HS9A 2D1VA 1VNDA 2X35A 3ZN1A 3MVPA 3LGLA 1OCZH 3S8PA 1CKBA 1R4MB 2DK8A 1YN8A 1BW5A 1IV8A 2DCEA 2E64A 1JT0A 1TQMA 2PMZN 1VQ8A 4FYYB 4PLIA 4A4FA 2M5WA 1FSEA 3I3LA 2D8JA 5LJ5g 4EJWA 2M8EA 1NEBA 4OMZA 5CCAA 1VQLT 3FDRA 4E7SA 1SVLA 4E2FB 2DMUA 3CXCA 1ZUUA 4C5HA 2AT1B 2BW3A 2WA0A 5FKOA 5GAN7 2JT1A 2K9LA 2M7AA 3BTJA 4C2MJ 4J9BA 2VPRA 2LKSA 4FW2A 4D8DA 4ZDPA 2DJNA 4GO1A 4M6VA 4A3CJ 1QU3A 1ZSZB 3E6DA 4HSTA 1WJSA 2RI5A 4F04B 5FLXZ 1Z6TA 3MKWB 4IOAF 2DA5A 1VQ4I 1XD7A 2AQFA 1PUFB 1Y96B 3TDZC 1AU7A 1U3EM 2GTOA 2NUPB 4IRGA 4X9CA 2HS5A 2NOGA 4JOMA 4RAZA 4DIQA 1VQMI 1UELB 1XJWB 2K4BA 1SC7A 4HLYA 2E3HA 5LJ5e 2R4GA 1QCFA 1X6GA 4HQEA 5I2SA 3CDHA 2XHKA 3CC2T 1PYVA 2EKOA 1SAUA 1VFCA 3VRYA 4A0YA 2V26A 2DRMA 4C8QC 4AC0A 1FP2A 1W2BA 1WHGA 4ZYDA 2CV1A 4CYCB 2IPOB 5K7ZA 2NS8A 3CMMA 1OX8A 3KFWX 1K73C 2M1BA 3FXKA 4AVPA 3CBMA 3FXJA 1EZZB 1XC5A 3GNGA 4X1VA 2ZPFB 4XONA 1XMAA 2TCTA 5LRSA 3FXUA 2QA4T 1GXPA 2VQCA 3MCAB 4UVBA 1RR7A 1U6GA 1MGQA 2YLBA 2ECZA 2DIGA 1B9NA 2YU3A 3CCEQ 2DBKA 1WJBA 3GTLJ 2EFWA 3CPWP 2KE9A 5KH6A 1M90C 1IXCA 1WRJA 2QQBA 1SRMA 3RZDJ 4EJOA 2BOLA 3BTIA 3A03A 3HGGA 5JI6A 2E65A 5TGTA 3CD6I 1OU8A 5D7UA 4IIOA 3VOEA 4A53A 2ZFUA 4D7NA 3PNWC 4C92D 2KKOA 3CCQT 1MW7A 1R8OB 2DFUA 4QW2A 1REPC 2O2OA 1QVPA 2VKNA 2DK3A 3SYTA 5EJCA 3HOTA 1C0WA 4MGRA 2DL5A 1JJ2A 5F1RA 1VQ7T 4LNPA 5ECAA 3TEEA 3VUZA 3OS5A 2ELHA 4ENNA 3WGGA 3ABLH 3JTHA 3AL0C 2X3WD 3QKJA 2ZXWH 1DJ7B 2CUFA 2H09A 5L3DA 2IW5A 2XDDA 3CCUT 3QJYA 1NTCA 1KD1C 1IO2A 3K4CA 2F4OB 3R6OA 4M7AB 3VUBA 2OTJT 2EQMA 3META 1FBSA 3OYKA 4TVRA 2HNIA 2MYSA 2NVYJ 4KGZB 1AOYA 2OQRA 1FOKA 1AWXA 4ESFA 4CCNA 2RHYA 1SMYF 2CFOA 4M77F 1HSTA 2KZGA 1M1KR 2K9MA 2QKMB 3M1CA 2Y75A 3TREA 2DMNA 4ZZDA 2BKDN 2XVCA 3S2WA 1RUOA 1SFUA 4HSRA 2N8GA 5F64A 3JAMR 2A08A 2L02A 1FPQA 1ERDA 3CD6A 2VT2A 3RSNA 3FBNB 2KIMA 3RI4A 4Z6YA 4Q5SF 1QCOA 2E12A 5DLQE 2DTIA 2OJED 3S2DJ 1XQHA 3SWNA 3J81E 2DVJA 2E7WA 2I2LA 1D1CA 1FMKA 3D5LA 1VQ8Q 1X27A 4PJNA 4PJOA 3VJPA 2LVMA 1UTIA 3MMYB 1KGSA 2XGCA 5GAMd 1XX5A 2R57A 4ZTFA 2KROA 2QGGA 4HCCA 1GL5A 1JT6A 2ZJ2A 3PNVA 3JSOA 2DFHA 1LDJA 3O8VA 3CCVT 1WGXA 4ETSA 3G1JA 2QTXA 2FRWA 2E34A 1ABOA 3QXEB 4M77C 3PIOF 1JE8A 2DBBA 5GP9A 2PJPA 3HL2A 5KYXB 5BPIA 5A2QK 4M9ZA 2CZ0B 2RQVA 4A12A 2DT5A 2YUSA 3ABKH 3CO6C 5FLXK 1YIJT 1KQSA 2EFOA 2M4GA 2HDDA 2LZ6B 3CBOA 1PUEE 1QVFA 2K9SA 1N9SA 4HVVA 4QQ6A 4HNVA 1D8KA 5ILVA 3KFVA 2FPEA 5IT9R 2G7HA 3HDDA 2DYSH 1P6RA 5CQGA 1HC8A 1QKWA 3ISPA 3H9GA 2FX0A 4L5GA 3LSHA 3K2ZA 1QQJA 2QA4Q 2COMA 1L3LA 4J9HA 2O88A 4P1WA 2IS2A 3G4SA 1KA8A 4LITA 1F1BB 2EIKH 2NNYA 1NJIR 3P8BB 3CXCP 3BE3A 4K2EA 1YITA 2PUKB 2V1DA 1SFKA 2DKGA 2IP2A 1NZ9A 2L8DA 2VV5A 4ESBA 4C8QA 3WE3A 2NVTJ 1U8RA 1U5SA 2L4AA 2L3SA 3SXYA 4QIWN 2MF2A 1S7AA 2MC4A 5DLOA 4YELA 1HQCA 3DXJF 3JB9J 2RI3A 1LVKA 2F6CA 3VPRA 3A01B 2MVTA 2DE0X 2JMCA 4X1EA 3ZQIA 4KITB 1Z9QA 2KP6A 3FBIB 3H5AA 4XOTA 2VE8A 2Y4XA 3MJXA 1HCRA 1U5TB 5E17F 4JUVA 3PSFA 1R5GA 2X3XD 3F9KA 4MO7A 3VDXA 2CT4A 2WSCE 1Q86U 1QQIA 4DBQA 4XORA 3S17J 1BCMA 3K69A 4CCOA 4YFNF 2CP6A 4RGUA 1OJLA 1UFFA 1IRGA 2M1HA 1D3YA 3R0AA 3HPHA 1R1TA 4JYKA 4YIRX 3CCRT 1HJDA 4J00A 4ELZC 1BC8C 2KK4A 2KSSA 2DPPB 2OV7A 4NC6A 2A05A 3LWIA 2IVMA 2K85A 3HRMA 3H1CA 3KLOA 1PKSA 1RAHB 3VODA 2BE9B 5E3MA 4OMPA 2FOKA 4B09A 3L2UA 2P6TA 1K79A 2EQKA 3JRGA 1MKMA 2R7VA 5FWBA 4CYCA 2PNIA 4OMOA 3CC4Q 1ZG1A 4M7DF 4UV8A 1I8FA 2RHUA 4NQWA 3H9QA 1A6QA 4KUDK 4S05A 5M3FJ 3PTAA 2IXSA 1K6YA 2F1LA 3V8KA 1LJ9A 1I39A 2DA9A 5LJ3e 3S2HJ 1ZH5A 4A3KJ 3G71T 1K0XA 5FKNA 3L1PA 3ESWB 3KP2A 3ZMUA 3M0UA 2E3IA 3X28B 2L9VA 1GT0C 2GQVA 5J4YA 3VKIA 5CAIA 3CCMI 3OS0A 2CQXA 3EGXB 3ZFJA 3IWZA 3F6OA 1BN5A 1X1PA 2D0NA 2DQLA 1JHFA 3SWNB 2F4IA 3I35A 2E35A 5FU6B 2TRTA 2HVSA 3BDDA 3BCAA 5K7FA 4UUVA 2LOOA 2WSEE 3K70C 1ZX6A 3CD6Q 3KZZA 2IGOA 2DZ9A 2V4JC 3OYLA 4MNUA 1KQ8A 1UG2A 1ZGJA 2DL8A 4LLGF 1V5GA 4C0ZA 2TDXA 1A6IA 4KA4A 2FPDA 2PN6A 3G1MA 1OMIA 2PUOB 3FEOA 4ATOA 5AONA 1M9SA 2LKPA 5IOYA 1Z6RA 3IKTA 1TUCA 1S72T 1ZBJA 1ZN2A 1H0MA 1WXBA 1J5YA 4A4EA 2JOYA 3LSMA 5H2FC 3BTCA 2AO9A 1YW7A 3GLLA 2QCOA 5ICFA 1YJWI 2CV0A 2YT6A 4M7DC 2GZWA 4NDLA 3ZN0A 3F22A 4BKXA 2R7XA 1K4TA 2XB5A 2K02A 2QA4I 1R58A 2P0WA 5LGNA 3VWBA 2X4YA 3A01A 3JRBA 2IBDA 3JCMd 2CW7A 3GVAA 4I02A 2BVMA 2J5PA 2JA2A 4PZJA 3COAC 2LNHB 4BQNA 2OI3A 3KXTA 4B4CA 2IS1A 2KMUA 4KDPA 4B6MA 4M74A 2R5ZB 2LCCA 5FKKA 2LQ8A 3CCJQ 4Y3OA 1RABB 2DFEA 2JUCA 5CVIA 5KYUB 3K1NA 3WE2A 4UUSB 4EGZA 4IRIA 2RV8A 2BY2A 3JCMX 2GWRA 3PO3J 3I56Q 1QRYA 2QSGX 1MDMB 2Y69H 3S3NA 4NOYA 2P8TA 2EV0A 5K5OA 2D2WA 5DM7R 2R7SA 1J09A 2RKHA 4A69C 1SSFA 3BY7A 1P2FA 3BQYA 4OIPF 2DL7A 1MBEA 2JSCA 1R0CB 1SFEA 3ZMVA 1WJAA 2BXYA 3IWFA 3GYHX 3I5UA 1R49A 5J3LA 2DIQA 4MQ9F 2FG0A 1VQ9T 4M3GA 3QBYA 3E0JB 5JR3A 2XAGA 3OYJA 1IGUA 3K9TA 5J26A 3N5BB 3M8EA 2VUBA 1H9GA 3AG1H 2E1MB 1TOVA 4X34A 5JLXA 5GAOn 1XDUA 1Z3YA 2K3PA 2B0LA 1VQKI 3B6CA 4HVUA 3TP0A 2GIVA 3WODF 2LY9A 1VQ9I 2LY2A 2MH2A 1Y96A 1QO0D 1X3ZB 2M0OA 1J3TA 3H9JA 3GLXA 1YTYA 1BIBA 1ITYA 2CP5A 2JA5J 4NQWB 1MBKA 2HQHA 2YRDA 3HL8A 3LSPA 1NLOC 2DDAA 3IHUA 4AT1B 3AFHA 5CKTA 2WSFE 3KZIC 3PFIA 2CP2A 4LDXA 2HKOA 4BBSJ 1Y56A 3PUBA 4A3JJ 3HHGA 4MIMA 1BL0A 3JCMf 1ZR4A 3SJMA 1AHDP 1NPRA 4CSWA 4II2A 2DA3A 3PSIA 1QPMA 1WKMA 1ZKGA 1KK7A 1S1NA 3DB4A 1QNTA 3DEWA 1YRNA 3I9QA 1RUNA 4C30A 2EYXA 2MLGA 1Q1VA 1IXSB 5GPCA 3N4MA 1RR8C 5EEHA 2ZJPF 1B8IB 3EH2A 2EA4A 3CTAA 2BUDA 2IRFG 3RQ4A 4B3XA 5JVTA 2STWA 4A4HA 4PJOF 4HQMA 1UHSA 3M07A 4PGGA 3W2WA 3BT9A 2EYWA 4XSXF 4IHXA 3EUHC 2CQKA 2CUJA 4G6DA 3S32A 2CSQA 4M4ZA 3SB2A 1WQ2A 4XIDA 5F27A 2PMUA 3I71A 1WIEA 2E5KA 2QGUA 2ESHA 3REBB 5HS8A 2BVLA 2DEUA 3SD4A 1XSVA 2KR3A 1M90R 1MMSA 2VQHA 1YE9A 2Q1ZB 4RG8A 1HW1A 4HDVA 4HV6A 1M2VB 4M7DE 4JZ4A 1WJFA 1E17A 1G2BA 3UF4A 3MKYB 2IVWA 1VQ7Q 1OR7A 2X51A 2LQWA 2RO0A 1FEXA 1F1ZA 4M71A 3H0HA 4QPOA 1XCBA 3IRRA 3E9FA 4M9XA 5IP9J 3N97A 2OTLI 1JJ8C 3THKA 1LQ1A 2M45A 1AKHA 1R77A 3U2RA 1NHAA 1WH7A 3TO7A 1YNZA 5GJWB 2BY1A 3CJTB 1ZLKA 1WHLA 2FO0A 1XGNA 2XG8D 3VYTB 1M1EB 3RZOJ 2KJCA 3J81Z 1DU6A 5IYCJ 2H3JA 1UHWA 2WC2A 5H6RA 4EM1A 4MTDA 4OP0A 1KQSS 2X9DA 4YG2F 2RH2A 1LDKB 2DA6A 5GANd 3QYHB 4J01A 1OCRH 2ZCWA 3NMZC 3GZNB 3ECOA 2EJFA 2CUDA 4XTVA 1ZHIA 3LA3A 5IT9Z 2X0LA 4BI4A 3A4CA 3GMEA 4KYWA 5LJ3j 4MQVA 1YJ9Q 1PKTA 5J39A 4G7ZF 2A28A 4DZPA 2JK3A 1B8IA 2KRHA 2FZGB 2HEQA 2JZ2A 3VS1A 4B3AA 3BR6A 4Y13A 1ZGWA 3CC4T 3CEYA 1LNXA 2RPNA 3CXCS 3J7AW 1VQLA 3QSUA 3BR3A 2W0ZA 4EATA 1UECA 1BI0A 2F5VA 1ZHFA 2VPLA 2LTOA 2KGTA 3VS7A 4EVIA 1CSKA 1ZUKA 5EG0A 1W70A 3C4SA 2ZZDA 2DFFA 5GPAA 2ECCA 2FB7A 4B1RA 1QP2A 3M0SA 1JGSA 1M8MA 2GTJA 4RB2C 2QXFA 4IL6C 1N27A 1IN8A 1G3SA 4BUPA 5K7HA 4LLLA 2QK0A 1RLQC 2RJFA 2E60A 5FRMA 5C0MA 3TKYA 2ZBKA 1X1BA 1XGOA 1EKEA 1ZARA 3NRVA 4PSXA 1TSFA 1R71A 4Y4RA 3CC2I 3JCMh 1W1WE 4XRSA 3KPHA 3HPGA 3CQZJ 5D5WB 1E0EA 4PJOB 8ATCB 1FC3A 2MLKA 3G71I 2HBPA 4M77G 2HCKA 4XTXA 1K9MC 2HOSA 5D6EA 1PSFA 4Y91A 4HDUA 3ABMH 4OAZA 2QUFA 2ID6A 2X1CA 3V42A 3KLNA 2F2XA 2FRHA 1VQ4T 2DVEA 4XRSG 1R00A 4XU0A 3QWLA 4MFDA 2DA1A 1I3QJ 5B5EC 2A61A 3KP3A 1RETA 4BHPA 2OU2A 3DEUA 3DBLB 4AVZA 3B6AA 5HNHA 1TP4A 1BOAA 1W7PD 3CO7C 2G6FX 2Y2ZA 2WAQA 3K4NA 3LSKA 4W97A 3CP8A 4XMYA 3WGIA 3GTQJ 1FY7A 2H6BA 2KRNA 4LD6A 3OMGA 2QBYA 2IIMA 4JX5A 2XHCA 2F2WA 1U5TC 2UXNA 1YO5C 1AHJB 5FROA 1G4DA 3CP2A 4BBRJ 1Z77A 2WAFA 1M4ZA 1WNLA 1T0JA 5HDNA 5IOZA 1UUEA 1YJWA 2K3FA 1O3TA 3GNFB 4BUGA 1K73R 4XN3A 5C4XJ 1HD3A 3FC3A 4UVCA 1MBJA 4Q47A 5AT1B 1RI7A 1X2NA 2HZTA 2L5QA 2CU7A 2KIUA 3QQAA 1R9TJ 1TTYA 2MZ4A 1FXXA 1X4OA 4BJ6C 1NEGA 2M16A 5IH2A 3IRQA 1FYMA 2FBHA 2KRFA 1ZA2B 2LX9A 2PJRB 2E1MC 1I0CA 2HAXA 2X48A 2OQGA 5DTDA 3G71Q 2P7VB 5IP7J 2ECBA 4CZZA 4C92A 1JKOC 4L0ZB 1QW1A 2FBIA 2M9HA 3T5XA 3BQZA 3WG7H 2ZC2A 1ZG5A 1E6HA 1KHCA 1YHQT 4N0BA 2CP3A 2GOMA 4QKUA 5LJ3h 2OF7A 5E1ZB 2ADUA 2X4HA 3BP8A 4M75E 1MMDA 1UE9A 1KD1U 5DCMA 1K8AR 2W25A 2M34A 2EFIA 3Q5FA 3EFOB 3KBGA 4M75A 1TNTA 3SZPA 1JXMA 5CIUA 1HOMA 3H5RA 2D45A 5D5XB 3RESA 3T1BA 5JHUA 5FLMJ 3CCYA 2GQIA 5LJ5d 1K78A 1ON2A 1YG2A 2DZCA 1RAEB 4JLGA 1K73U 4OMNA 3JCMJ 3ZQ7A 2L3QA 1YWOA 3PM1A 2R7OA 3TO6A 3RUXA 4XQ3A 2D9TA 2HZDA 2CSIA 2ZJRF 3BG3A 4Z88A 2UXXA 1TXQA 5E20A 3CCVI 3S3MA 5FLXR 1PP7U 1ETQA 2K86A 2DM1A 5IXFA 1NYGA 1M3AA 2XC7A 2I5UA 1HDPA 2F4MB 3RKYA 3KE2A 4CYDA 2DYRH 5JFRA 2GQQA 2Q0OA 1A35A 2K3BA 1YJNI 3GTJJ 4N4IA 3S16J 1T3LA 1WQ7A 3EFRA 2X1DA 2NRAC 1B9MA 3FM5A 3MO8A 4J9EA 1SANA 4QLCU 1JB0E 1Z21A 3TQ7P 4PFZA 4D8KA 5CJ9A 5GMKe 4EM2A 2KVQG 3VS2A 4RTUA 4IJAA 3ZRGA 3P8HA 2BE5F 3F72A 3I58A 4FHTA 2ELKA 2LNBA 4E4HA 2R92J 2JM8A 1KD1R 3ASOH 3ZXSA 5EGOA 2DPDA 4WXHA 1XNIA 2RQPA 4M7DG 5F08A 2DODA 1HKQA 2E7XA 2RJDA 3OL3A 3CMYA 4A54A 3EDPA 4NNJA 4LLNA 4G12A 4EMKC 1VQNT 3F8CA 2EZIA 3M9AA 3E6MA 3FWEA 5KCOA 1JQQA 1YP5A 1O3SA 2NUZA 3RPUD 3BCBA 1V55H 3J7AO 1X2KA 5A2QE 1OPLA 3EHRA 5C4JJ 3G4SI 4GFBA 1FLIA 4S04A 1RC9A 1Q7YR 3I4NJ 5GAN6 2ED0A 2A6HF 2DILA 2ENMA 3TP3A 4PJOC 2HMAA 1TWHJ 2HYFA 2QWWA 1G59A 4BB7A 5F04A 4I98B 2OX7A 3CPFA 2D1HA 5LHHA 5FJ8J 2XASA 2MK5A 5LJ3g 3CJQB 4KGXB 2V9KA 3PT9A 4KUIA 2JA8J 2FBKA 3LSTA 4J9FA 2ZAEA 3FMRA 3GUDA 5AIPA 2G3RA 1ZLJA 2DNUA 2EJGA 3PUFA 5E8GA 1MV0B 3OYFA 3U1KA 1I1SA 1EH7A 3HP9A 4IUTA 5HKCA 3F23A 1YS7A 2X6XA 2HPMA 1DUXC 1EJ9A 4PFOA 1CQTA 4GBQA 1TQPA 5J4VA 5DY9A 2KDSA 2Y4YA 4UC4A 3BG7A 2DMQA 4BQAA 4OIQF 1RAAB 2GCXA 4F7UE 2FPFA 4VUBA 1Q86R 2OTJA 5K5RA 2DTZA 5D4SA 3HKSA 1QZZA 1YS6A 1ACIA 3T0YA 1PM3A 4HW0A 4C8QB 1WVRA 4WX9A 5EYRA 3H6ZA 5FD5A 2EZHA 1TW2A 3TQNA 3JAME 4LN2A 4XU3A 1SSHA 3BLYA 5EGOB 3TMOA 4CCMA 5KAFC 3L09A 4IUVA 3CPWS 1UHFA 2BIVA 4M78E 4OB3B 3QU6A 9ANTA 4BYYA 1Y8RB 1KU3A 4D6WA 1WJRA 4RTYA 5A0LA 5J47A 2JZYA 2QVOA 1AWCA 2V6EA 5FRNA 2MMPA 2HVRA 2HR3A 4BGDA 2KRMA 2V1NA 2CUZA 3TU4K 2EFNA 3EAEA 4YIIA 3GIBA 2VE9A 1OZ2A 5GANg 2OAWA 3MZ8A 1ZSZA 1RIOH 2ZFWA 4HRIA 4LB5A 2O4XB 1LJOA 1K4SA 5IY5H 3E6BA 4BQQA 2JUGA 1VQPT 2LF7A 1XN7A 2JTFA 3O2PE 3DU6A 1PDNC 2B8AA 5KYNA 1KQSP 1VQ7A 2GGRA 4RM3A 5BQTA 1QWFA 3HM5A 3G2BA 4PSWA 3M8FA 3RERA 3OOPA 2JRMA 2FMYA 4AIJA 5D4RA 1ZYRF 2HQEA 1MMAA 1R0BG 2BY3A 1UGRB 3RDVA 3DPLC 1OR7C 1WA7A 2Q8KA 3DF8A 4A3BJ 2BXZA 3G4SQ 3LOCA 1R1UA 3C7JA 3DBRB 1UB4A 2Y90A 3KEYA 5I11A 4IX7A 3PE0A 3TDUC 3K7AJ 3WTWC 1WPYA 4JJBA 3D1NI 1WHUA 3AT1B 5GAOr 4BL0B 4A3EJ 2L3DA 4MDWA 1EH6A 3BR5A 3P9KA 3K0LA 4D5CA 1DP7P 3HOUJ 3IH3A 1X69A 5HK0A 1R36A 1Y0MA 1BCOA 3U21A 3O5ZA 3GF5A 1ULYA 3ZPLA 4PGHA 3V7CA 4AIDA 1X2QA 2GAUA 2E1NA 2XKOA 1OU9A 2LG4A 2VKDA 4LIVA 2MBFA 1VQ8T 4XLPF 1H3ZA 4HEA2 3IQLA 2NS0A 1SFXA 2QDYB 1X01A 1UG0A 2AHJB 2ZCFB 3I54A 2UV1A 1ETWA 2LMJA 2MWPA 4N4HA 4H4KC 2R7WA 1AWOA 4M7AA 1SRLA 3SHFA 1P7JA 2DOEA 1NK3P 2XAFA 3S6WA 2PU9B 2JWTA 2VI6A 3CMET 4V2GA 3UA7A 3MZHA 1M5Q1 4L9NA 3LQRA 5JLWA 4RBOA 2E6ZA 2OCEA 2VT3A 4XKCA 3QZ5B 3A8MB 3LYIA 1NG6A 1TWBA 4KIBA 4J9GA 4C8QF 2NWMA 4F93B 5LFAA 5GAMh 3C95A 1VQMA 2VKEA 1U8BA 5LHIA 4A93J 3H92A 2DF6A 1LB2A 5L8RE 1WXTA 2RJCA 2K3XA 3CCST 3KCCA 3U1DA 1Z05A 1TUDA 1OOTA 5C3EJ 3JRAA 3HUGA 2DMTA 5FWCA 2RMOA 4C5IA 3HHTB 3GP8A 2YUPA 1X6OA 1Q7YC 4N9HA 3CCMQ 5DCFA 5LLQA 4M72A 3W6KB 3J7YJ 2F5DA 3A52A 3E2UA 4KULA 5D5UB 4UY8I 2QAZA 3L2QA 1VQOQ 2Q2EB 1Y1VJ 3H41A 3D5SC 3EG9A 4LG3A 1ARKA 1Q95G 1YJ9T 2YRVA 4XOPA 1BIAA 2DQRA 2EQJA 4MZMA 1AZEA 1YFNA 2LT1A 2K5IA 5CVUA 2EIFA 2AIRB 2ISYA 1UAAA 1BA5A 3FIFA 1A0NB 3PO2J 5GMKl 3I53A 1JI8A 2VKVA 1WI9A 1O7FA 5HNFA 1VQ6Q 4LGWA 2J6OA 3MEXA 4RA2A 2LYCA 2PI0A 1OCOH 1R5HA 1XTAA 1Y8QB 2NVUB 5LGUA 3C94A 2WV0A 1FJLA 1KU2A 2QLZA 1VQ8I 2CQNA 3KYDB 2M0YA 2MWOA 3MKDA 2RDPA 4F16A 1P9QC 4XRFA 1F4KA 3RCOA 2X1EA 4M75F 3JRZA 4J83A 3CCLA 3EUKL 1XTDA 2W1OA 4GYGA 4Z2YA 3PIPA 1WWXA 1X2MA 2M87A 2GXBA 3HBLA 2DTHA 3OA6A 1Z3XA 1QHHD 4CCLA 4DW6A 3M0PA 1Q82U 2F2EA 3IH4A 1RAIB 4AFSC 4FSSA 5GAN8 3FDYA 5GADJ 1BR1A 1RNLA 1BBZA 1R4NB 4J9DA 2MSYA 4RLFA 1MMGA 2X98A 1WFWA 3K4MA 4C9YA 3M9QA 4XLEA 2AZVA 3VU3C 4RM2A 4RTTA 4PJOG 3FJ5A 2RQRA 4FE4A 3PVQA 1LEBA 3N05A 4GYIA 3KYLA 1SEUA 2PX9A 1QA6A 4C2UA 3S1MJ 3QUIA 2W82A 3K1PA 2GA2A 1IJWC 1JXSA 3MD2A 2GF7A 2H8RA 4J9CA 4PNOA 5LEKA 5GAOq 2HOEA 1IXDA 2V8JA 3PQKA 4DYCA 3M3YJ 2VXEA 3JCMc 1VQ4Q 3K4JA 2LJ0A 3JSPA 4RMNA 5M5XJ 1DPUA 1UDLA 3VS6A 4IXAA 2B63J 1D0ZA 1DP3A 3PNTA 4N4OB 3LAJA 2CQ7A 3I5RA 4AFUC 2RHZA 1XG1A 2B7EA 1WPKA 2M4KA 3HFOA 1N8RR 4M7AD 2QDLA 1BKBA 1UHCA 3F8FA 1OCTC 4OU0A 5CR2A 2XI9A 1K9MU 3CDLA 4XTZA 2JA6J 1J0RA 2RK1A 4AMCA 1PWTA 1WI3A 1KJWA 1PC0A 3WHBA 4DOVA 4IHTA 3HUGB 1A31A 1T0FC 3C18A 2VKHA 4KH0B 1KYWA 5M9OA 4NL3A 3JCMV 3JCUC 3ECHA 4DOWA 4I0BA 2K3YA 4GY5A 2XGEA 2XUBA 4M77E 4F14A 1CGPA 1VUBA 2HQAA 4BE0A 3JRDA 4RTZA 3GFIA 2P0PA 1M90U 1OYWA 4EQQA 1V5FA 1ZAOA 2XROA 2PZ1A 3NTKA 3O8GA 1WQWA 1UMQA 5M3MJ 2W7NA 3EGDB 5BMZA 4Y17A 1NE8A 3TSWA 2HXIA 2R0QC 4AFQC 2OTLA 1QWEA 4G7OF 2RB6A 1OCCH 3ZP5A 2HD0A 2KNBB 2VJ4A 1IHWA 3VYUB 1N9RA 2LY1A 4M6XA 2JVVA 1KQ1A 1TS9A 4NC8A 2BTTA 2KY9A 3PMIA 4HF1A 4M3FA 1MV3A 3RMQA 4G9YA 5HVQC 1Q82C 4OMQA 3VS5A 3CCQA 2M30A 4ZDOA 2DD5A 2O4XA 3SWNC 3SZTA 3KP4A 1HKSA 2OUMA 1BJZA 3HSEA 3FXOA 4MTEA 3R6SA 5F1JA 4QVDA 4R56A 4KIFA 3IC7A 3HSBA 3CLOA 4WXDA 3M58A 2VIXA 2EINH 4FU6A 1MIJA 5A2QR 2HYJA 1FTZA 4GDFA 2GBYA 2MH9A 1MMNA 2DXTA 2NUTB 4LB6B 2PLYA 4PJJA 3BG6A 2XDVA 2LH9A 4I76A 4EEFG 5ED4A 5K5QA 3RBBB 1TWGJ 1FOWA 1XGSA 5E1WA 4AFZC 3EGXA 3C1DA 2ZPGB 2YLCA 3OQ5A 1S3JA 5LJ3f 2XAQA 4BEHA 4C8QE 3LSGA 1X1DA 2YS9A 4GRIA 4M78B 3UR3C 4M7AF 1GFDA 3IAM2 5FU7C 1MJAA 2AZSA 5ILUA 3HOWJ 1LCKA 3FMQA 2DXUA 5LBQA 1L0OC 2FEZA 5GAGJ 3H3VK 5BNGA 4E7JA 1QKXA 2CH4W 1OCPA 2HXOA 4BD3A 3SZGA 3OYBA 1G8XA 3RJPA 4CO8A 3GBQA 2GFUA 2DDBA 4BACA 1IGQA 1VQPA 2RNJA 2AKLA 1I27A 1Q81R 1D3BB 1SF9A 3REAB 1VQ5A 1VQ9A 2R7ZJ 2NVQJ 4P5NA 4HX7A 2LQNA 1IUFA 2RREA 3T8RA 5CKHA 3HOZJ 1VQKA 5DCMB 5GTHC 4AIKA 3OYCA 5KYUA 1HYOA 2QKLB 4EMKA 1VQPI 2EK5A 1S6LA 2HEOA 3SDGA 2HQ5A 2LLKA 4JK1X 1JU5C 3Q1JA 1YWPA 3VYHB 3CCUI 1FIPA 1UGQB 2SRCA 1JUSA 2XF7A 3OWTA 2I0NA 1KG1A 3LFKA 4KH1B 1D5YA 1V29B 3I55A 2ABLA 4I09A 2HFHA 2PBIA 2R5ZA 2G7UA 1GRIA 2BY0A 3ME9A 5CQEA 3NFCA 5BOXA 2MA3A 1ETOA 1ORKA 1MJBA 4FYXB 1T08B 3NTHA 3H0DA 5IT3A 1UHMA 1VYTA 2JVGA 5KYYB 2XAJA 4M75G 1KC8C 1GLNA 3L42A 2VB6A 2O31A 3X25B 1LKXA 2MIOA 2ICWG 3G1LA 4FQGA 2E2JJ 3TGNA 1LE8A 4BY1J 4JBAA 4FIBA 1D3BA 4L9TA 4ZNXA 3SDBA 4HA8A 4HAMA 3H9NA 2ACJA 2M8GX 2HBWA 3MEAA 1VQ6A 2Z3YA 5IYBJ 3UDCA 3FK7A 2WY7Q 4XQFA 2J05A 1YITT 1ZA1B 3FXQA 4H0EA 2RC4A 3GZ5A 3I56A 1T8IA 4HT8A 4HV5A 4FM4B 5EZHA 3KYCB 1UFMA 3HOXJ 4L0YB 2CG4A 2QA4A 2YSQA 4PFPA 2DJQA 3ZMSA 3GO5A 1RPWA 2OAZA 3Q9SA 3SFIA 1F5TA 2ATCB 3EPZA 3QP6A 4UXNA 2ZGWA 4NUBA 2FVUA 2C06A 4F17A 3BPVA 3WTXC 4KRTA 2ZXHA 3IAS2 4RAGA 3VB2A 1X6BA 1K9AA 5AYFA 5CQXA 1N8RC 1ZSZC 1W5CC 4EM0B 3ERED 4CUGA 3OYAA 4KNYA 1BU1A 3K4BA 3OL4A 5GAOp 2QENA 4IVNA 2BEOA 3HHHA 5DV5A 5E3OA 2STTA 4OMMA 3HSFA 4LMYA 1B07A 4IURA 3ZQFA 1IF1A 2YWWA 4ZN1A 1USSA 3Q0VA 3CCQQ 1HK9A 2IA0A 3TOAA 2XICA 5GAN2 3W3CA 2NXNB 4Y7NJ 2Z0WA 3QYEA 2KEAA 1BBYA 5D6XA 2OD5A 5AIQA 5CK9A 1GV5A 5ICEA 2EIJH 1VQOI 3P7NA 4RB1A 3CC7T 5A2QZ 1Y0NA 1RESA 1IRXA 4Q4ZF 2KHMA 3GZ6A 1B59A 4A6EA 1VYUA 2LTPA 5FFXA 2FRYA 5IHNA 4CH7A 4C2TA 1JGGA 4XLNF 3TW7A 4JZ3A 2VBXA 1XCVA 3X2QH 2EW3A 5IT9K 1VQ5T 1W0TA 5CO7A 2JTVA 4MEXF 2DTRA 2KRCA 4OOIA 3M56A 1S8NA 1WJQA 3OYEA 1T0HA 1GUUA 1C1AA 3WTUC 2E2HJ 1EA3A 3ELKA 3FKJA 5H20A 5KE2A 1WHMA 3R6NA 2XV4S 2JSPA 2QSHX 2XMFA 2IS4A 3HOSA 4ITVA 1MBGA 1ZK8A 5EZGA 5HLGA 1MBFA 1XS9A 3EG1A 3OSSC 2ED1A 4JRPA 5DUIA 3AAFA 1UGSB 2XKOC 3QWYA 3QODA 2XRNA 4ANJA 2LC2A 2BHZA 1AVZC 2VGMA 3GOXA 1VQ9Q 2DA7A 2HGCA 1J7KA 1NG7A 4GXOA 4PUSA 4ENMA 5B1BH 3CCLI 3CESA 1YIJI 4ASNA 1O4XA 1VQKQ 2OTLQ 5L3FA 1ONVA 4HCZA 2COBA 3VRZA 3LFUA 1Y6IA 2AHQA 2X6WA 5CVRA 3VYRB 1GCQA 2DD4A 1Z9CA 1AD5A 3BDLA 5EF6A 3DFGA 2O7OA 3ZQLA 4JQFA 3CCSQ 2R7DA 1H8AC 2DXBA 3CC4A 3R4KA 2KDZA 3DP7A 3DU5A 1PD0A 2M51A 4MZPA 4ZYGA 3DKXA 4C92G 4CC7A 5FKMA 3ULRB 1O57A 3HRTA 3F21A 3QAHA 5KNLA 2A68F 1NM7A 2X6YA 3M8JA 1JO8A 3OW2A 1W4SA 3QPTA 1FOYA 1P4XA 4N0AA 4KT0E 5IHIA 5IHKA 2CUBA 4JLIA 1YQAA 2DPUA 3BPXA 3AL0B 3HOVJ 5I21A 4JPBW 2K2VA 3DV8A 4M77A 2XAHA 1U06A 2ZPHB 2DI3A 2OTLT 4ENJA 1GXQA 2MPXC 2IAIA 3A8GB 1IHVA 2IGKA 1YI2A 1QCNA 4CICA 3K70D 3JAMK 4BDYA 1RI0A 2F5EA 1I6XA 3PNYA 5E1XA 1FX7A 2EYYA 5GANe 2A69F 4XN0A 3DLLF 2V9PA 4NHJA 3J81K 2F5TX 2KRSA 4ZN3A 4RUGA 3QYFA 4R79A 2Y0MA 1R6RA 3BTLA 1S7OA 3HYIA 3MEWA 5GMKj 2LD5A 1I3AA 5DM6F 1ZTRA 4XU2A 2FD5A 4F7UG 4W1UA 2EWNA 4S0HB 4AD9A 1AWWA 2WAEA 1PRMC 3JCMe 4Q48A 2CP0A 2Y30A 2QEXA 4BJ5C 1F43A 2L7KA 2HZYA 4M75C 1KC8U 2RHIA 3RYPA 3MP8A 2E4HA 5IPAA 4KN7X 5J1RA 2WV1A 5H6QA 1AKHB 3G6EQ 2ZXJA 2VBZA 3ERMA 4Y15A 2F5KA 2QYOA 3MEUA 2EB7A 3OB9A 2XPUA 2E5QA 4E47A 3C0CA 3CC7Q 4FT8A 1YIJQ 1TTHB 1S72I 2IPQX 1X19A 5GAMe 2WADA 2L9SA 3I59B 4RAFA 3T8TA 1PCXA 1M2VA 2A36A 4KGVB 1VIEA 2FQ3A 4LUEA 2OJ2A 3WTZA 3ZCOA 3OS1A 3GW2A 2XRLA 3TW6A 3CQTA 4U0YA 3CCVQ 1JUPA 1QGPA 1PHTA 4XSZF 3JV3A 4NB5A 3MP1A 2E1OA 1K61A 1X1CA 3BJAA 4V2FA 1WHHA 1MH3A 2Z2SB 1SVMA 1I5LA 4MMLA 1EIFA 4L5EA 1JJ6C 1ZLMA 1W4MA 3JCMg 3CCRI 4BI3A 4A0XA 3GWZA 3M7GA 1ACMB 4A3GJ 4YRVA 2JM9A 1RI9A 4FL6A 4U7DA 2FYKA 1TUGB 4OMLA 2JJ9A 1SD5A 3TOBA 2X4WA 3QZ9B 2KDOA 3M59A 2ZNYA 5LJ5f 3M4OJ 1OEBA 2CP7A 4A5NA 3ZR8X 2KT0A 4UB6C 2D1XA 4I99C 2DA4A 3A02A 4GCVA 1WYXA 5KVRA 3ZQGA 4II3A 2H27A 2YPRA 4UVAA 2IS6A 4LDYA 1IRFA 1S72A 1V76A 2JN0A 1SMTA 1RACB 2CYZB 1KYZA 2H6CA 2W48A 4JRKA 4M7DD 3EQLF 5KYWA 2QQRA 4DA4A 3D0SA 1XSXA 3HOYJ 3EYYA 2OA4A 3S14J 5C6SA 1SVOA 2W84A 4FETA 4HNTA 3JRFA 4CRIA 3BZCA 4BDZA 3FX3A 3J7ZI 1BR4A 3K2AA 4OAYA 2HDWA 3Q0WA 1FSHA 2MFZA 3J80R 3R60A 4J8OA 3LNQA 2OTJI 2YUNA 1OYXA 2BZTA 1KU9A 3FXMA 2LP0A 4EGYA 1TG0A 3A98A 3CUQC 1ZR2A 1KSWA 2C0OA 4HF2A 5D6WA 2A5WA 1H88C 1QLYA 1Q81U 4A5MA 2Z16A 3K10A 3GXOA 4M9SA 5DD8A 3V7RA 2JA7J 2NAZA 1IV6A 2OBPA 3EG3A 4FX0A 5HDGA 2R7RA 2BZXA 2XDBA 2J6FA 4C5EA 2K5LA 4HZFA 4G7HF 2JVHA 4V19K 4N0AC 5GAMg 1UJ8A 4M75B 1TWAJ 1O9SA 3CCJT 4AG2C 3G6ET 2HOAA 2Z5UA 1GBQA 4XK8E 2XPVA 5IYDJ 4XU1A 5F0CA 5EG2A 3W6VA 3CF2A 4DYQA 1WHKA 2CMPA 5FB2A 5GJVB 5D8KB 3FRNA 4C0GA 4DEXA 3CUOA 1ZREA 4CZCA 3NHNA 2A37A 1VQNQ 5B3SH 2CFXA 2KPMA 1WHJA 2QASA 3KIOA 3Q9VA 1FNNA 2P5LC 4IF4A 2V9VA 1OV3A 4QPQA 4XLHA 2D0QB 4J6YA 1K8AU 1GVJA 5GAOm 3FHNA 3C2GA 1QZYA 4MLOA 5KHDA 1I6HJ 4R8HA 1G6NA 2VQGA 5HOOA 3HFNA 2DTOA 3ZMDA 1UZCA 3EG0A 4C92F 1R22A 2VBWA 4OWRB 4HG2A 2OAUA 3CC2Q 4AYBN 2QF7A 3DLAA 3KP6A 1U0JA 4XKVA 4KISA 3M5AA 1IN5A 3JB9H 5A0GA 3WVEB 3CMAQ 5LEJA 1K0SA 3GBGA 3WGHA 1NYFA 3L1AA 3VS3A 1ZELA 2ZMEC 1ZRDA 2XPWA 4ON0A 1D0YA 4IQ4A 4RGXA 5IXBA 3WTYC 2RI2A 4GLMA 4M73A 2W00A 1YIJA 4B8XA 3O6BB 2CH4A 1IZ1A 3J81R 4N4GA 4F55A 3WTVC 1WJDA 3GTMJ 3PQJA 1YRNB 1U78A 4RB3C 1I5ZA 2P81A 2MOXA 3CCVA 4IHSA 1QVGS 3WU2C 2KYMA 2X4XA 2X4JA 3MZYA 1LFUP 2WB1N 1PSEA 2A6EF 3O8HA 1APLC 5EC7A 1M1FA 2DO7A 3HKZN 2FUG2 3H3ZA 1TWFJ 4FX4A 1LDDA 2HKXA 6PAXA 2DX1A 3PIOA 1YW8A 4L5JA 3P9IA 4LOCA 3JCMQ 4QT7A 3VEPA 3D5RC 1NJIU 1JHHA 1ODDA 5L3EA 5GAEJ 4C5GA 1OQYA 3URGA 1YI2Q 4WXCA 3BROA 3EFOA 2OPTA 5CKDA 3S15J 2RF0A 4QQGA 2DAQA 3FJPA 4FYWB 3GFLA 2RVCA 1ZBXA 2NUTA 4LG0B 2DOFA 4BS9A 4E6KG 3GCMA 2ELJA 3NTIA 1IN4A 1XSDA 5BS6A 3MKZA 2CYYA 2NOJB 2QZ8A 3FXLA 3DTKA 4F52A 4IEJA 2COYA 2CW0F 5F0HA 1YJ9I 2V8IA 3CCLQ 2CWEA 2NNNA 4JRIA 1J2XA 1IC8A 4WCIA 4GGGA 4BHBA 2VXDA 2DBMA 2DL4A 3JCMP 3CBPA 5E3LA 4BHCA 2HOTA 1FZPB 2FQ4A 2COWA 4J19A 4UHTA 2GM4A 4JJDA 4E7ZA 2XAUA 2JT4A 2LQKA 3BR0A 3MHXA 2EFPA 3L7WA 5K1YA 1RKTA 2WACA 3M54A 5LL6S 4LXCA 1G2HA 4QQDA 2ZMEA 1WJEA 3R0JA 3OYNA 4ZYAA 4D5FA 2FNPA 1IXRC 2ESNA 1TH7A 4F3QA 4RG2A 3J7AF 2M0MA 3JB9F 4PJOD 4LD5A 4C3IJ 1SEMA 3CMEI 5DUKA 3SFMA 4L9JA 4F92B 2IA2A 2VLAA 1YFHA 4L59A 3UKGA 4IHYA 3ROUA 9ATCB 1ZRCA 2V7FA 2MG4A 2ID3A 3ABUA 3E3VA 4LJZF 2VOPA 3LA7A 3S93A 2LNVA 1EX4A 1K83J 1MUZA 2EBPA 4OVAA 2KIFA 3Q3SA 4UV9A 3RKWA 5L3BA 4M3EA 5FLVA 2F5FA 1X58A 3A2KA 2LK2A 4M3BA 3B73A 1RZ4A 4G8XA 4XL9A 3I56I 5TISC 3H0GJ 2VOOA 1AWJA 1AZGB 2K6DA 2HL5C 4CCJA 1N8RU 1RAGB 1VQ6I 1XGMA 4G6QA 4L5IA 4P9UA 1PP8F 1UCRA 3UNGC 3S1RJ 1KU7A 2KXDA 3HKZA 2HU9A 2XSJC 1J59A 3CCMT 4ABZA 4CA0A 3G7ZA 2WAQN 4DBHA 2XKPA 2LBFB 1AEYA 1HXDA 2Z33A 5J40A 2K79A 4P9FA 4BNCA 1QVFS 3OIOA 2GXAA 4EMSA 1LEAA 2EZLA 3G71A 3H3UA 4JJNK 2EBIA 2Y0SA 1W2BS 4LDVA 3MPUB 2RQQA 1HW2A 4ZGJB 1M1KU 4QTRA 2O5RA 1B3QA 3I55I 2PVGB 3OBYA 3JREA 3CC2A 1MH4A 3X20B 3E1SA 4BXUA 1HW5A 3MQ0A 5D8LB 2BBYA 2QSFX 2WWYA 1D5VA 5IP6A 4A3DJ 4RTXA 2KJBA 2VXZA 3IL2A 4E7KA 1IUYA 3A8OB 4EMKB 1G3YA 4P55A 3CCUA 1FMWA 3L2RA 2QG9B 2LDUA 4NS5A 1E3OC 4ZH4F 5B66C 1VIFA 2DN0A 1GHCA 2XF6A 4C3HJ 4IOCF 1Y7XA 3UT1A 4QWQA 3VYGA 1Y57A 3JB9D 2XD0A 4IRHA 1IREB 3G1OA 3SQNA 2OC6A 1VQLI 1KQ2A 1BYMA 2MC3A 3JCMW 3OS2A 2DK5A 3TEDA 1ZQ1A 5TRDA 1VQ5I 2IJLA 4P96A 3OY9A 1ETVA 2CSOA 2P4TA 1ZUYA 1IN6A 1S9HA 3BR1A 2ZB9A 1W7PB 1POGA 1YX5A 2DYBA 2QQSA 2VC8A 4KMUX 5EG0B 2H1KA 4B9XA 2JN6A 3DWLE 2DXIA 2P6SA 2M2EA 3P8DA 2K40A 2V6CA 3M4YA 3VS0A 4ENKA 2CJJA 3S1QJ 2RQWA 5HK3A 2QQ8A 2F69A 4A4KA 1CKAA 2KXCA 1VQNA 4BE2A 2VJJA 2FF4A 1P4AA 1U9OA 3F3XA 2NUPA 1JKPC 3K6GA 4CHUA 1QVFP 3E5QA 2L7FP 2R7QA 2YU9J 2DT6A 4D9JA 1VQPQ 2PFBA 3FIWA 1RL2A 3CZ6A 1RADB 4A3FJ 4MZTA 2O3FA 1Z1DA 4I01A 1X4PA 3LL7A 4RS8A 3OR1C 1MNDA 1IDZA 1SG5A 2FZKB 2DETA 1O75A 3G6EI 4M78C 1DPRA 4HOBA 2HKNA 2KIQA 2EKHA 4EMGA 1YHQA 4E7HA 5KK1A 3CCQI 1K7AA 1ZQ3P 2FE3A 4RLQA 1VOMA 4BQOA 2R5YA 3OYDA 3RNJA 3H35A 5ILSA 4O6JA 2GNCA 2ISZA 1U9NA 2CKKA 2HWVA 1B1BA 2YX4A 3EGDA 1D1AA 1TU0B 2IA1A 4YIFA 2LBFA 1WZ2A 4Y33A 1IB8A 3LGFA 4HKEA 4R0KA 1IN7A 4XAXB 1IO6A 1JJ2S 4M7AG 3R61A 4IZZA 3HRSA 3I55Q 1HF0A 1JRIA 2RQUA 1BJAA 4XNFA 1WXUA 4Z02A 2D8HA 3OMCA 2MAMA 3E7LA 4D0PA 3IV5A 2W57A 2W10A 3BJOA 1W0UA 2P4RA 4M77D 2ME6A 1YCSB 2SEMA 1IW7F 3TVTA 1NPPA 3C3WA 4U0VA 2H1LA 1VQNI 2MABA 1VI0A 2CZ1B 4M7DB 4DBFA 1T56A 3I64A 4HNUA 1K76A 3D7SB 3AHUA 2VODA 3E19A 3FLGA 1JEGA 1DGRM 5DDGA 2AKKA 4ZZLA 1LNWA 2EA2A 4KBMB 4RTVA 2QQ9A 2RGVA 3HRUA 2KZVA 1WDXA 3MEVA 1VQLQ 2YX7A 4KIGA 1YJWQ 3FXRA 2O9LA 5D5VB 4UNOA 4C92E 2D6FA 4FT4A 4CXFA 2CRGA 5J1UA 4Y28E 3HGYA 2X85A 1H92A 2RNGA 3CJRB 1G3WA 5J8CA 4DYRA 1YCYA 1H9TA 2MD0A 2EYQA 3A0BC 3HTSB 3JCMb 2KT8A 5GMKh 4M77B 1VF9A 1U1SA 3JB9G 4IIMA 2ZPEB 5M5WJ 4XLCA 3H0IA 3BZKA 4IHWA 1BI2A 1F9NA 4WF2A 1W5SA 5GANj 5DEQA 2DEQA 2V8KA 3E5UA 2LJ1A 2PVOB 3V4GA 3BDUA 4CDGA 2CZ6B 2D5VA 5GAMj 4MMKA 2HNHA 3INZA 5E79C 4KT5C 3DB3A 3CCUQ 4C3JJ 2LMDA 4FISA 2VC1A 2K2MA 1YW9A 2M3AA 2HDAA 3UWNA 1PRLC 4K11A 1I5OB 4M78A 3UATA 3LSIA 3I5SA 1TBXA 3E6CC 3RPUA 2DYIA 4XKBA 1JJ2P 1PJRA 3FF5A 4UUTA 3RKQA 1HKTA 5HS7A 1RAFB 1X75C 4BI8B 2BE7D 2XK0A 2E19A 1FBUA 4DJAA 3J80K 1PUFA 1QBJA 2L2OA 4FCYA 2FL7A 2DERA 3UPUA 2EV6A 3QPHA 2P7CB 1JKQC 4NBQA 3FHZA 1B72A 1ON1A 1N78A 4J7IA 2MD5A 1Z0XA 2YR2A 1QVGP 1ZRFA 1BM9A 2K4JA 4XM3A 3HPWA 1SKUB 1M3CA 4XTUA 4EDUA 2JXBA 3VS4A 1FIAA 2CUEA 4A63B 4B44A 1HDDC 1X3WB 3CCET 1PNJA 1B34B 4G6TB 1N25A 2JS2A 4J7FA 1YJNQ 3HB9A 3OIQA 2PQWA 2V1RA 3FB9A 4IUUA 5B1AH 1IGNA 3ASNH 1OQKA 3JRHA 2EYZA 3M57A 4B47A 1JKRC 3WG9A 4AIHA 1OISA 2VGNA 1XPXA 2P84A 1W2BP 1V5EA 2UUZA 3BG9A 4AU7A 2LKXA 1VA7A 2JTEA 3TL4X 2CW8A 3A1YA 3JAMZ 1TW3A 1OI1A 3H8ZA 3DKWA 3KETA 1OYYA 1NJIC 3L2CA 2XGXA 2O8XA 1FYNA 1M30A 3OOUA 1ZSGA 2PTKA 4UB8C 3A1PA 4I0AA 2ZNZA 5KYXA 3CCLT 3GTOJ 1WZOA 2EQIA 1B6AA 2RJEA 5GAMf 3CC7I 2IGNA 5CLSA 1TWCJ 4CC2A 1YBYA 3GPLA 2NVXJ 2E41A 2KT1A 4RTWA 3F6VA 1SHGA 2ZXIA 1VQMQ 3V8JA 1KONA 4AM3A 5HDKA 1RRJA 2L0AA 2VONA 2HYGD 3TCJA 5I2MA 4J6XA 4Y52J 1KQ9A 4U87A 5ERIA 3WU0A 2HL3A 3KEOA 1I4K1 5FGMA 2E2IJ 3ZL7C 1HSJA 4BY7J 2FNAA 1B34A 3QJ6A 3NWSA 1OPCA 2DL3A 4RCCA 8AT1B 5L23A 3CCMA 2CH0A 1O7LA 1QHGA 4BEHB 1P7IA 4JP0A 1NLPC 3EH1A 1AT1B 4O3MA 2QEXQ 3I56T 1RKWA 4HYEA 1C6VX 1S5LC 1G83A 4L9VA 1FMVA 1VZ0A 1UGVA 2K7AA 2L3RA 4ZGDB 4LG0A 3G73A 2B86A 3A8LB 1LFBA 1WFXA 1WH5A 3CCJA 3CCRQ 4BE1A 2ROLA 4XRMA 1U3OA 3DBHB 4FYVB 1YJWT 2HTJA 4IPAA 2W24A 2AK5A 3HEFA 1CF7A 1LOJA 3X26B 4ZTJA 4WTOB 5HY6A 4PJMA 1N6AA 2QBYB 1F36A 2VXFA 3DPTA 2LCSA 2VQLA 3SEZA 3JRIA 4WCGA 1GXIE 2PJRA 2M02A 3CMAT 1MZBA 1D1BA 1OPKA 4M7DA 4A3IJ 4OMFB 4MDXA 2EGCA 5FFZA 4BY6B 1U1TA 3WVDB 4F91B 3VYSB 1ETKA 2LRDA 2ZPBB 2XDPA 3GX4X 2K9GA 5LJ5j 1T33A 4JS4A 2UWMA 2BZYA 4OB2B 2EIMH 4XK4A 2ME0A 4FASD 1VQ7I 4DNCA 2LT4A 3QDFA 4FSXA 1LPQA 3BC8A 1Q7YU 4M3DA 3RKXA 3E9GA 1V3FA 4D7MA 4X0GA 4JRQA 1YX3A 3X24B 4X6AJ 2JPBA 2FZCB 3JW4A 1WX6A 2ZPIB 5HCKA 4WWCA 5FD6A 1TNSA 3CCSI 2HQXA 1BB9A 1LVAA 3EUAA 3OYHA 4RCBA 3CD6T 1XOVA 1OZ3A 5M5YJ 4M7AE 2RHXA 2GA1A 1A36A
chains in the Genus database with same CATH topology
3DKMA 4ME7A 2VBYA 3G4ST 3LQQA 3M1EA 5CVVA 2JNGA 4LDUA 3TO9A 3QOPA 4HT9A 3RDIA 4KMFA 3OBWA 4N9IA 5A0DA 3LAPA 1UGPB 3ZMZA 1P4WA 2P5KA 3WTSC 2O6GE 1M8VA 4OGEA 4ESJA 1KQ0A 4V2SA 3QDRB 5DD4A 4XBFA 2F5CA 2M9UA 2Y48A 3J80E 1MGTA 2P0KA 2LF8A 4Q5WA 2G9WA 2NYXA 5CKFA 2DXCA 4LFUA 1WSUA