2F5FA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ac conformation, ph 8.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
133
structure length
133
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 52
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5fA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5fA02
4JBAA 1TW3A 4AD9A 1MKMA 4KIBA 2IA0A 1R00A 1FYLA 3TO9A 3FXUA 3WU0A 5BPDA 1FPQA 1IW7F 3JAMK 3E6BA 4HDVA 2R7DA 1XDUA 3JTHA 2FMYA 3R0JA 4EVIA 3WE2A 1O57A 3HUGA 4HX7A 3CDHA 4PZJA 3TO6A 4EJTA 3WTYC 5DUKA 1QNTA 5HLHA 3CJNA 1PDNC 4KMFA 4KN4X 5FLXK 4QWQA 3RKYA 3QPTA 1Z9CA 2CW0F 1W7PB 4ASNA 1YG2A 1FX7A 1JHFA 2VT3A 1KGSA 1K78B 3HRTA 4UVBA 5BS6A 3C18A 3G73A 1BJAA 5DYMA 1XGNA 2ZO4A 5J8CA 1YS6A 2IP2A 2L3DA 1QPMA 2XAQA 3SZPA 1R23A 4LGWA 4RAYA 1SD7A 1KU2A 1BN5A 2HQRA 3RJPA 2JZYA 1XGMA 1JGSA 5DV5A 1ZRFA 4ZH4F 1OKRA 2NNNA 5H6QA 4YIFA 2KIUA 4XSZF 2Z9OA 4CGZA 3PQJA 4XLPF 1KYZA 1OYIA 2LF7A 5ICEA 2NNYA 3QPHA 2XASA 1O7FA 2K27A 1RIOH 2LNBA 4ZYEA 5JFRA 1BI1A 4GO1A 2ZKZA 4BH9A 3I71A 2E7WA 4EJVA 3KETA 4G7HF 3LWFA 2FE3A 2ETHA 3DEUA 3GW2A 2FA5A 2VONA 1QZZA 3D0SA 3K1MA 4D0PA 5E1ZB 2QWWA 4RGXA 3FM5A 2HTSA 3LA2A 1K7AA 2PEXA 3T1BA 2KJCA 1ZG1A 5D5XB 4O6JA 4F7ZA 2ESHA 4JQFA 1JXSA 3J80Z 1MDMA 5FFXA 3F72A 1HXDA 2L02A 2DPUA 1QO0D 1EH6A 4FX4A 2EFOA 1F4KA 3WG9A 3IHUA 2HR3A 4L5IA 3BPVA 1EV7A 4LG0A 2M8EA 1HSTA 2V1UA 1I27A 1V3FA 2VBXA 2QLZA 4ENMA 2P5KA 4G6DA 3WE3A 4G8XA 4MEYF 3E5XA 1BIAA 4I01A 3KP4A 1J0RA 2CG4A 3B02A 3E97A 4P9FA 4CYDA 2M1BA 2HDCA 1TW2A 4KT5C 4EMSA 1HKSA 4CDGA 2GA1A 4Q5SF 3WTWC 5LRSA 5FB2A 1S6LA 4R79A 1MD0A 1R5GA 1USSA 3GWZA 2PI0A 2DK8A 4KIFA 2DU9A 5D5UB 3ZN0A 2DQRA 2PLYA 3KFWX 1W7PD 2YSRA 5K5OA 3WU1B 3T8TA 3F23A 2QYOA 2R3SA 2DT5A 4S04A 3JSOA 4HF2A 3K1PA 3GLXA 3F8MA 2EV6A 4LMYA 4HYEA 1XB4A 5JHUA 1TBXA 2BV6A 4DNCA 1C0WA 2JPBA 2PFBA 2HGCA 2F5DA 1T2KA 1DPRA 3KP7A 2A6EF 2HYFA 3P9IA 2EFPA 3J81Z 3TOBA 2TDXA 4Q47A 2P8TA 2VXZA 4OIPF 4ZYHA 1ZGJA 3FXQA 2HWVA 2ADUA 2MLGA 1OYYA 1V4RA 3FMQA 3GFIA 2O8XA 1BBYA 1HQCA 2PMUA 3ML6A 3ELKA 3CUQC 3FXRA 3MZYA 1G3SA 2RQPA 2FBKA 4MHGA 1KU7A 3FM3A 3LAPA 3BDDA 4ESJA 1XDSA 2FRHA 3F3XA 2A61A 5AIQA 5ICGA 4I2OA 4RGUA 4A5MA 4PCQA 1JHHA 3KEQA 3EDPA 1UCRA 1TQIA 5EEGA 2XHKA 2K7LA 2MBFA 2NAZA 4N9HA 3DF8A 1HW2A 3KE2A 1G3TA 4WCGA 1ON1A 4M71A 4EGZA 2HEOA 3C1DA 2RGVA 3L9FA 3ZMTA 3KP6A 3KZZA 4L9NA 4YG2F 4EJUA 3E5QA 1J75A 4KIGA 2FSWA 1ZLJA 2LDUA 4ENJA 1P4XA 4HOBA 2F5CA 4RB1A 4FT8A 2A5YB 4A0XA 1FBUA 1FYKA 3SXYA 5E20A 1XD7A 2HOEA 3HYIA 3LA7A 4WXCA 1ZHFA 3RI4A 4I02A 3FMSA 5AIPA 4U7BA 4I7HA 5CVUA 1R5HA 5F64A 3CLOA 4FHTA 4HW0A 3DPTA 1REPC 5K5RA 3HHGA 3H3ZA 3I59A 3CO6C 3K0LA 4N9IA 3RKWA 1P6RA 1H0MA 1MDMB 1IAWA 3RYRA 1TQMA 2CO5A 2FU4A 3GUDA 3K2ZA 3W6KB 3T8RA 4N0BA 4KA4A 3J80K 1UHMA 5E18F 1LDJA 3IC7A 3HOTA 3WTZA 2O6GE 3GEZA 4M72A 2QZ8A 4E70A 4QLCU 2KIMA 1D8JA 1ZLKA 1Z6TA 2VOOA 1XGOA 1FP1D 4AIHA 2FNPA 1R1TA 3KZYA 4IRHA 4RGSA 1B6AA 1XMAA 3ECHA 4K2EA 2CWEA 3M8EA 5D5VB 4XRFA 3I58A 4BXUA 1FWZA 3LFKA 2PQ8A 3D5LA 2W24A 1KQ0A 3ISPA 2X4HA 5ED4A 2QQBA 4HV6A 2QBYA 2F5FA 3BPXA 1FBQA 2ZNYA 3GZ5A 4DQ2A 4IRGA 2E7XA 1I1SA 1HKTA 3COAC 1IRFA 3LA3A 3E6DA 1W4MA 3HRSA 3WGGA 1S29A 1ON2A 4MTDA 4B8XA 3I64A 2K86A 4ZYGA 1B9MA 2VBYA 3ZQ7A 5ICCA 1SD6A 2CGPA 1W5TA 3ZPLA 3IKTA 2UZKA 2LSOA 3WGIA 1ZYRF 2QUFA 2H27A 5K1YA 3ERED 1PUEE 1X3UA 3QOPA 2FQ3A 2XAFA 4LD5A 3N97A 3F8FA 3BOQA 3RKXA 2BYVE 4UV8A 2ZFWA 2K4JA 2HYGD 1WWXA 3JW4A 4NB5A 3ZP5A 1KU3A 3RPQA 1MJAA 3J81K 3J7AO 4LLGF 1IN6A 2COMA 3JSPA 4MEXF 1RNLA 1J9IA 4OMYA 1ZG3A 1R1VA 5E17F 3ULQB 4WWCA 2WC2A 4RS8A 2MH2A 2MC3A 3L00A 4HBLA 2P5VA 2DTRA 3DFGA 4S05A 3E6MA 3K9TA 2ISZA 2DBBA 2NRAC 5ILUA 1OYWA 2W85A 2P4WA 2O03A 2JSCA 3HSEA 3V7CA 2XV4S 2Y0MA 4LB6B 4CXFA 1U2WA 5L3EA 3L09A 4WF2A 5ILVA 4EQQA 4JK1X 3HOSA 3E5UA 4OINF 3ZN1A 1IN5A 2VE8A 2GXBA 4UHTA 3JTGA 2ELHA 2JT1A 1YW7A 3O6BB 2V9VA 4M73A 1MJBA 1O3RA 2QVOA 2DW4A 4P96A 3R0AA 3U2RA 3R6SA 2E1NA 4RB0A 4RAZA 3V8LA 4U0YA 1K79A 3ABTA 3I53A 1UHWA 2KIFA 1I1GA 2W84A 2BGCA 3TGNA 3R60A 5J8FA 3LQQA 3GVAA 3M1EA 1TQPA 1SFEA 2O61A 2ZBKA 1I6XA 2A68F 1STZA 2A6HF 3IRQA 2M30A 3U9GA 4HDUA 3QAHA 1U5TA 4YFXF 2GQQA 1XSDA 5L3GA 1FNNA 1JE8A 4RB3C 1FT9A 3TDZC 2MH9A 5LHGA 1YW9A 2DFIA 2XUBA 2VBWA 4IHSA 1ONVA 1ZG5A 4OIOF 3VODA 3SFZA 4OU0A 2AS5F 2ZXJA 3I59B 1GXPA 2YU3A 1Y0UA 4HA8A 3F8BA 2UXNA 4Q48A 1E2XA 3QU3A 1B1BA 3VB2A 1G3WA 2IPQX 2NYXA 2XROA 4PGHA 1VTNC 1J2XA 1K6OA 1T6SA 1ZRDA 1IXSB 4IHTA 3RDIA 3Q5FA 4B09A 2VE9A 1LDDA 3F8CA 5CLSA 4KICA 1CGPA 2IW5A 5IT3A 3KLOA 5E8GA 4RB2C 3MCZA 5L3BA 3GX4X 1RUOA 4HQMA 1F1ZA 4WXDA 1Z1DA 3DKWA 2HKXA 4M6YA 4HLXA 1HBXG 4MGRA 3MAJA 4U7DA 2CFXA 2G7UA 1FSHA 4WXHA 4GXOA 2MLKA 2QBYB 2G9WA 3F6OA 4A6DA 2XRNA 2H6BA 3H92A 4IF4A 4KN7X 3FMRA 5D6EA 3V4GA 1FYMA 1TLHB 1U8RA 3KP5A 4G7ZF 3GFLA 1Z6RA 1HW5A 1LJ9A 3QU6A 1KYWA 1YS7A 1FLIA 3VOEA 1ZAOA 3ROUA 4OIQF 4NHJA 2P6SA 1WKMA 1T98A 3MZHA 3QRFF 2IRFG 5LGTA 1Q1HA 1ODDA 4AIKA 1IUYA 1CF7A 4LK1F 1FBSA 5HLGA 3ECOA 1HKQA 1ULYA 3MFKA 4KNYA 2FBIA 2KKOA 5DD8A 1U3EM 4IXAA 3FF5A 2VC0A 1EH8A 3DV8A 5BPIA 1SMYF 5HS8A 3VFZA 2IVMA 2G7HA 4UUVA 2GA2A 2P7VB 2W57A 4UVAA 3REOA 4M9ZA 2V1XA 5D8LB 5CYVA 3V8KA 4ESFA 2FBHA 2OA4A 3MEXA 5HDKA 3EETA 3S2WA 1XCVA 1XCBA 1IXCA 3OV8A 2Z5UA 3NQOA 3PFIA 2FXAA 2HKOA 5F6FA 3DP7A 2QQ9A 1BOAA 3FX3A 5DD4A 3TQNA 1AOYA 1LVAA 2JTVA 3CUOA 3T5XA 2OZ6A 4LLLA 3G3ZA 4BNCA 1YYVA 4ZYDA 4A6EA 4YIIA 5ICFA 2FOKA 2P5LC 3R61A 1A04A 3F8NA 4Y13A 1R58A 5FFZA 5JR3A 1E17A 3IRRA 3RPUA 1NHAA 5EEHA 2J5OA 4L9TA 1WRJA 4EJOA 1DUXC 1WI9A 5TRDA 2XIGA 2DAOA 2ISYA 3LSTA 4L5JA 1USTA 2B0LA 3RIRA 3FZVA 4AVPA 2ESNA 3EYIA 2UXXA 4WK8F 1F9NA 2IA1A 2QQAA 1O3QA 2D45A 3HIFA 2OU2A 1U5TB 4LB5A 5K5QA 4YFKF 4GYIA 3WTXC 1KA8A 5FD5A 2E1CA 3HRUA 1BI3A 1I5ZA 5J6XA 1U78A 2M87A 4M6XA 1T38A 1O3TA 2F5EA 2STTA 1ZREA 3HTSB 4P5OA 1XSXA 4GCVA 2YR2A 5CVIA 2RKHA 4L9JA 1Z05A 2BEOA 4G94A 2GXGA 4PGGA 1IRGA 4OMZA 1SFUA 1FP2A 3K1NA 5HLIA 1O3SA 4RGRA 1H9GA 4ON0A 2C6YA 2IT0A 2VOPA 2EB7A 2STWA 2GAUA 1FOKA 1SFXA 4R1HA 3WTTC 5ERIA 1S7AA 1SAXA 4XSXF 5LEKA 4HF0A 5DCMA 4EM0B 1QGPA 1U6GA 2O3FA 4CICA 2K4BA 3I54A 5BQTA 4M74A 1IZ1A 1DDNA 1YLFA 3Q9VA 5HS9A 2ZNZA 3RYPA 2A3SA 1W5SA 4HX8A 4Y17A 3I0TA 2DK5A 5CVRA 2VBZA 3CUQA 3L2CA 4L0YB 2HTJA 3RTRA 2GWRA 3LAJA 4MNUA 1YQAA 2L54A 2Y48A 4R8HA 2J5PA 1BIBA 3AAFA 4CHUA 2M5WA 5LGUA 1TTYA 3BP8A 3F22A 3BJOA 1QBJA 1CF7B 4Y15A 3TO7A 1L0OC 3IKVA 5JVTA 2Y75A 2OD5A 4XLNF 5H20A 3HHHA 3BROA 2CSOA 1LB2A 2HS5A 5H6RA 4LLNA 2XKPA 4Q4ZF 2XGXA 3C7JA 1G4DA 3BJAA 4ESBA 3SQNA 1D5VA 3GXOA 3Q9SA 2O0YA 3I5UA 4Z2YA 2H6CA 3BWGA 5LHHA 2ZCWA 2YX4A 4L9VA 4O5VA 5F1RA 3ZMDA 2EV0A 2P7CB 2X0LA 3E6CC 1GVJA 5ILSA 1UFMA 2XAHA 2Q0OA 5A2QZ 4H0EA 2M45A 4IPAA 4KUMA 3GFMA 2HZTA 5IT9Z 2FEZA 2XKOA 5TJJA 1TNTA 3GYHX 1OR7A 4G7OF 3EUHA 3ZMZA 2XAGA 3U1DA 1LQ1A 1KU9A 1J5YA 2GZWA 4EM1A 1YO5C 2K02A 3ZMVA 1OMIA 3H3UA 2QENA 1YTYA 2ACJA 1FC3A 2EFWA 4KDPA 5CVVA 2EWNA 1RZ4A 4A2UA 2L01A 1T39A 1R7JA 3V7SA 1PP8F 2DLLA 1QQIA 4PDKA 2UWMA 3O3KA 1YW8A 4CZZA 3DQVC 1KQ8A 5E8IA 2PJPA 1BM9A 5E1XA 5D4RA 3P9KA 4AIJA 2BBYA 5DCFA 2DI3A 1Z91A 4BHPA 3MWMA 4BAYA 4HZFA 1YFHA 6PAXA 5DEQA 1HSJA 4LFUA 1R22A 4P55A 4G9YA 3R4KA 4YFNF 3F21A 1BC8C 2H09A 1IF1A 3PQKA 4MQVA 3WGHA 3HSFA 4A0YA 2RC4A 1GXQA 2AXLA 5HDNA 4LK0F 5LRRA 3K69A 1IN7A 1MJ9A 2L4AA 4KMUX 2A07F 1FZPB 3WTSC 1P2FA 4G6QA 2ZJ2A 1ZARA 2EFNA 1IN8A 2RNJA 5FD6A 4L18B 4U0VA 2H94A 2LF8A 2ZMEA 3BZ6A 3N4MA 4EJWA 2EA4A 4CO8A 3M9AA 3O2PE 2FNAA 3KLNA 2OQGA 2DQLA 2IJLA 2PN6A 1S7OA 2EJRA 3KEOA 1ZGAA 4OOIA 2RDPA 4XBFA 1RUNA 3MQ0A 4OIRF 2PG4A 4IVNA 5BMZA 2DO7A 4UVCA 2CQKA 1P92A 1S3JA 4HV5A 1HW1A 1XN7A 4I0AA 3KP3A 1IN4A 2OBPA 3DPLC 2FMLA 4KYWA 1MZBA 3FWEA 5D6FA 5DCMB 5FGMA 4UXNA 1LNWA 3GFJA 1AWCA 4U88A 3ZMSA 2F2EA 1O7LA 3GZ6A 5LLQA 1SD4A 1LEBA 2GIVA 3CUQB 1D3YA 1XGSA 4ENKA 1WSUA 5D4SA 3JAMZ 4I09A 2Q8KA 3GF2A 5LHIA 2NS0A 5E1WA 2DPDA 2IA2A 3ZMUA 1QZYA 2QM3A 3I4PA 3IWZA 4HLYA 4IJAA 5HVQC 2EA2A 4GYGA 2KRFA 1KQ9A 3SZTA 1DPUA 5FLXZ 1FY7A 1R36A 1IXRC 1H9TA 4BQAA 2RVCA 3V8JA 3WODF 5L3CA 5CVJA 2OZUA 1DP7P 1P4WA 3QP5A 1LDKB 4AWXB 1ZN2A 4P9UA 2KJBA 2WTEA 1SMTA 1W7PA 1G6NA 3B73A 3HTUA 3CTAA 2EFQA 4EM2A 4I0BA 4HAMA 1K78A 2Z99A 2D1VA 2VODA 2A69F 3VEPA 2HQNA 2Z33A 2JRTA 4L0ZB 2WWYA 5D5WB 5HOOA 5A2QK 4IRIA 1B59A 1BI0A 3FHZA 1UB9A 1Z7UA 1XSVA 3IL2A 4HQEA 4WX9A 1B4AA 3OOPA 4ETSA 5KK1A 5IT9K 2OAZA 3M8FA 1B9NA 4ENNA 1L3LA 2BE5F 4UV9A 2PBIA 4MQ9F 2LKPA 1T0FA 4U0WA 3HSRA 2Q2EA 3C3WA 2EV5A 4EGYA 3TOAA 2MA3A 1WQ2A 1TNSA 1J7KA 4O3MA 1MGTA 2YX7A 3P9CA 4I98B 2R7FA 4HF1A 3TDUC 4BHCA 1GHCA 3QP6A 4ZZDA 3T0YA 2V79A 1BC7C 3KCCA 2D2WA 4FX0A 3LQRA 3KP2A 1EH7A 4A5NA 5AONA 1LEAA 2FF4A 2PMHA 1RI7A 3NRVA 4A0ZA 1J59A 4NQWA 5LBQA 4UNOA 5CJ9A 4M9SA 2OQRA 3TKYA 2V6CA 1R1UA 3F6VA 5FO5A 5KVRA 5D8KB 4GGGA 4M9XA 1S8NA 2VN2A 4HX4A 2CYYA 3CO7C 2RN7A 1XMKA 4ZZLA 3DXJF 2ZMEB 2L4MA 3GO5A 2P6TA 3E3VA 2HFHA 1D8KA 3WTVC 3EQLF 4MTEA 3WTUC 1F5TA 2WV0A 2VC1A 3SHFA 2JPCA 1PP7U 2XVCA 1OPCA 1P4AA 4KFCA 4LG0B 2MD5A 3P7NA 2EK5A 5DUIA 1U5TC 2VT2A 1SD5A 3M7GA 2D1HA 3L7WA 1G3YA 5L3FA 1YIOA 1FSEA 5L3DA 4BYYA 2V1DA 2RV8A 5JI6A 5HS7A 5LGNA 4EV0A 3NEUA 5BOXA 3EYYA 2YPRA 2Z3YA 3HRMA 1ZH5A 1BI2A 5LEJA 1ZRCA 3V7RA 2W25A 2XAJA 3IWFA 4A12A 5HDGA 4LJZF 3BY6A 5DDGA 3ABUA 4TV7A 3BJ6A 4BHBA 3W6JB
chains in the Genus database with same CATH superfamily
3FKJA 4JBAA 1TW3A 4AD9A 1MKMA 4CCJA 4KIBA 2LOOA 2M2EA 4D7MA 3BTIA 3CDIA 2IA0A 1R00A 2XF6A 3SZGA 3NWSA 1FYLA 3TO9A 3FXUA 3WU0A 3HL2A 5BPDA 2DT6A 4AIDA 1FPQA 1IW7F 3ZQHA 4KISA 3KIOA 2DJNA 1WJAA 2CJJA 2M7AA 3MKLA 3JAMK 1T8IA 3E6BA 4HDVA 2CU7A 3DCFA 2R7DA 1I3QJ 3GTMJ 1POGA 1XDUA 4Z6YA 1ETKA 2W00A 4C30A 3JTHA 2FMYA 3R0JA 4EVIA 3K4MA 3WE2A 1H88C 1O57A 3HUGA 4HX7A 3CDHA 4PZJA 5EYRA 3TO6A 4B47A 5E3NA 2BVMA 3OYNA 4EJTA 3WTYC 3LFUA 5DUKA 1JGGA 1QNTA 5HLHA 3A2KA 3CJNA 1PDNC 1B8IA 4KMFA 2EIKH 4KN4X 4AUXA 5FLXK 4QWQA 3RKYA 2VQLA 3DU5A 1HOMA 3QPTA 1P9QC 2MW8A 1Z9CA 2JRMA 1VQ5I 3ONQA 2CW0F 1W7PB 2WV1A 3KPHA 5F04A 4ASNA 4FISA 1YG2A 4V2GA 1FX7A 3QODA 1JHFA 2VT3A 1KGSA 1VI0A 1S9HA 1K78B 2MVTA 1XS9A 3HRTA 4F52A 4UVBA 3U1KA 5BS6A 3C18A 2VI6A 3LSRA 2X98A 2M3AA 3G73A 5M5XJ 1BJAA 1QHHD 2CUJA 1J09A 2LG4A 5DYMA 1XGNA 2ZO4A 5J8CA 2HVRA 1YS6A 4MFDA 2IP2A 2L3DA 1QPMA 2XAQA 2Y69H 3SZPA 1GDTA 1R23A 4LGWA 4RAYA 2I10A 4A3LJ 3S3NA 1SD7A 3RQIA 2IGMA 1UZCA 3EUKL 3OS1A 1KU2A 1BN5A 2E5NA 2HQRA 2LY2A 3RJPA 2JZYA 1XGMA 1JGSA 2P0WA 5DV5A 1ZRFA 1Y0NA 4ZH4F 5E79C 1OKRA 2NNNA 4XOPA 5H6QA 1Z67A 2DTZA 3G6EI 2KISA 3HGYA 4RBOA 1B72B 3HJEA 4YIFA 1MMSA 3MMYB 2KIUA 2HPIA 4XSZF 2CV1A 3LSHA 2Z9OA 1Y1WJ 4CGZA 4G12A 3OYDA 2JA7J 3PQJA 1TP4A 2HYJA 3QPLA 3CC7I 2ELKA 4XLPF 1KYZA 1OYIA 2LF7A 4XRSG 5ICEA 1OISA 3OOUA 3FKIJ 1D1CA 2NNYA 3AG3H 3QPHA 3S17J 2XASA 1W0TA 1E0EA 1O7FA 4NUBA 4ZC3A 2K27A 1D0XA 1YJWI 4A3BJ 1RIOH 2LNBA 4ZYEA 5JFRA 2HXOA 2V7FA 2CW8A 4FE7A 1MBFA 3GMEA 2JVHA 1BI1A 4GO1A 2AHQA 2ZKZA 4BH9A 3I71A 2DCEA 2E7WA 4EJVA 4FETA 3QPSA 3KETA 3K4BA 4G7HF 3U21A 1LFPA 2EIMH 1O4XA 2DA5A 2FE3A 3LWFA 2ETHA 2W4SA 3DEUA 3GW2A 2FA5A 2RREA 2VONA 1QZZA 3A52A 3D0SA 3K1MA 4D0PA 5E1ZB 4XRMA 4NQWB 2KHMA 2QWWA 4ZTJA 2QSGX 4RGXA 3I4MJ 1BOBA 2E1OA 4E7HA 3FM5A 4LITA 4PJLA 2HTSA 3LA2A 5B5EC 1SFKA 1K7AA 2PEXA 3T1BA 2L9SA 3L2UA 2KJCA 2W82A 3SDGA 1ZG1A 2XGEA 2TCTA 1MNEA 5D5XB 4O6JA 4F7ZA 2ESHA 4JQFA 4B3AA 2XPVA 2OPTA 1JXSA 3J80Z 1MDMA 2EILH 1V55H 2X9DA 3RZDJ 3H35A 5FFXA 3F72A 3ZGKA 1QZEA 1HXDA 2L02A 2HQAA 1ZGWA 2DPUA 1QO0D 1WH5A 1EH6A 4FX4A 2G0EA 3ERMA 4GRIA 3A4CA 2EFOA 3CCEI 1F4KA 3WG9A 1VQMI 3AL0C 1GV2A 3IHUA 3HOUJ 1G59A 1X4OA 2HR3A 4L5IA 3BPVA 4A3KJ 4HSRA 1EV7A 4LG0A 2M8EA 1HSTA 4D5FA 1TL8A 2V1UA 1I27A 1V3FA 3HZJA 5FKMA 4C3HJ 3GTJJ 2O8KA 2VBXA 1OCTC 4ITVA 2QLZA 2P0TA 4XKBA 4J00A 5J1YA 2X1DA 3KYDB 5GAEJ 4ENMA 2P5KA 3MN2A 1W0UA 4G6DA 3WE3A 2K9MA 2LBFA 3K70C 2WB1N 4G8XA 4E7IA 4BGDA 1GT0C 2DMQA 4MEYF 5CQGA 3E5XA 2LY1A 1BIAA 5DS9A 1NG6A 3CQZJ 4I01A 3KP4A 1J0RA 2CG4A 3B02A 3E97A 4P9FA 5CQEA 2X51A 4CYDA 2M1BA 4GFBA 2HDCA 3ZQGA 2X6XA 1Y6IA 1TW2A 4KT5C 4EMSA 1Y8QB 1HKSA 1FIAA 2GA1A 1ETOA 4CDGA 4Q5SF 3WTWC 5A2QR 5LRSA 3ZRGA 5FB2A 1S6LA 3LSKA 4R79A 1MD0A 2PMZA 2ZJQF 1R5GA 2XDVA 2DA4A 1FOXA 1USSA 3GWZA 3PIOF 1WCMJ 5F1JA 2BY0A 2PI0A 2DK8A 2LR8A 2CUFA 1YE9A 1AA7A 4KIFA 5GPAA 3IUOA 1BA5A 2DU9A 4BQQA 3ZN0A 5D5UB 2M7BA 2DQRA 2PLYA 3CCRI 3S3MA 3KFWX 3IH4A 4D1QA 1W7PD 2YSRA 1F36A 2R7TA 5K5OA 3WU1B 4XR6A 3T8TA 1OCOH 3F23A 2IEKA 2QYOA 2R3SA 2DT5A 4S04A 3HKZN 3TW6A 3JSOA 4HF2A 3K1PA 2YS9A 3GLXA 5GADJ 3F8MA 2EV6A 4F93B 4LMYA 2F4OB 3C2BA 4HYEA 1XB4A 1XMXA 5JHUA 4RLFA 1TBXA 1WFXA 2CW7A 3EUAA 3L2QA 1WJBA 2BV6A 4DNCA 1C0WA 3QYBA 2JPBA 2PFBA 3ESWB 2HGCA 4E6KG 2F5DA 3CP2A 4HPQA 1T2KA 1N25A 1DPRA 3KP7A 3OR2C 2ME6A 3LSMA 5IYDJ 4PSWA 2A6EF 2HYFA 3P9IA 4Y3OA 3CMMA 2EFPA 3J81Z 2DOFA 4N4OB 4JOMA 3TOBA 1R9TJ 4IHYA 2TDXA 5J47A 4CCMA 4Q47A 2P8TA 2VXZA 1XPXA 4OIPF 4L5EA 3S2DJ 2M9HA 4ZYHA 3MD2A 3VPRA 1ZGJA 3A1YA 5EEAA 3HUGB 3FXQA 3FHNA 4U87A 2HWVA 3OYJA 2ADUA 2MLGA 3TMOA 1OYYA 1V4RA 1B8IB 3FMQA 3GFIA 1HDDC 2KZGA 3OS2A 2O8XA 1BBYA 1HQCA 2PMUA 3ML6A 1APLC 3BR1A 4IX7A 2DA7A 3DU6A 3OYGA 3ELKA 2FQ4A 3CUQC 3FXRA 3MZYA 1FTZA 1G3SA 1SVOA 2LREA 2RQPA 5EZGA 4UB6C 2FBKA 1ITYA 4MHGA 1KU7A 3OYKA 1RKWA 3FM3A 3LAPA 3BDDA 3H0GJ 5DM7F 4ESJA 1XDSA 1Y39A 2FRHA 4BS9A 1PUFB 3FIWA 3F3XA 2A61A 4A93J 5AIQA 5ICGA 4I2OA 4RGUA 3GTKJ 4A5MA 4BBSJ 4PCQA 1JHHA 3KEQA 3TW7A 3DEEA 3EDPA 3DLAA 1UCRA 5EDNA 1TQIA 5EEGA 4XICA 1T08B 1JKRC 2XHKA 2K7LA 2MGQA 2MBFA 2NAZA 3CF2A 1VQ9I 3CJTB 4HNTA 1U0JA 1W5CC 5J3LA 2KDZA 4N9HA 3DF8A 1PJRA 3H3VK 1A35A 1HW2A 3NWTA 3CC4I 2VQCA 3KE2A 2GXAA 3BR6A 4XLCA 4LG3A 2X1EA 1G3TA 4WCGA 1ON1A 4M71A 2BW3A 4EGZA 2ZXWH 1ZR2A 2BY1A 2CFOA 2HEOA 3C1DA 1MBGA 4ZDOA 2E2JJ 4PJ0C 3OL3A 2RGVA 2VJ5A 2X48A 3L9FA 1N77A 2LP0A 3ZMTA 3KP6A 3KZZA 4L9NA 5IYBJ 1IG7A 4FE4A 4YG2F 4EJUA 1W36C 1FTTA 1DU6A 3E5QA 2WAFA 1J75A 4KIGA 2FSWA 1ZLJA 4AM3A 2LDUA 4ENJA 1P4XA 1EA3A 2AQEA 4HOBA 2E36A 2F5CA 4YEJA 4BXFA 3UKGA 1WJCA 4RB1A 4FT8A 2LK2A 2R4GA 1OCPA 2A5YB 2TRTA 4A0XA 1FBUA 1UG0A 4XONA 1VQ7I 1FYKA 3SXYA 4E7SA 4FASD 2WA0A 5E20A 3RSNA 1XD7A 2HOEA 5KAIC 1OR7C 1FOWA 3EUHC 3HYIA 3LA7A 4WXCA 2HDWA 1ZHFA 3RI4A 4NBQA 3PO3J 1FMVA 3J7ZI 4I02A 2W48A 3AG4H 3FMSA 5AIPA 1I6HJ 4U7BA 4I7HA 3DKYA 5CVUA 1R5HA 2LH9A 5F64A 3CLOA 2IS1A 4FHTA 4HW0A 3DPTA 1REPC 4PK4A 2CQXA 5K5RA 3HHGA 3SYTA 5HNHA 3HPHA 1LFBA 4V2FA 2DDBA 3H3ZA 3I59A 3K4LA 4BE0A 1JTYA 2DMPA 5M5YJ 4ZDPA 2DODA 1JKQC 4M3EA 3CO6C 3MKYB 3K0LA 4N9IA 3RKWA 3SDBA 1HA8A 1P6RA 1YOVB 4HSTA 2LVSA 5B3SH 1H0MA 3HOWJ 1MDMB 1IAWA 3UR3C 3ZXSA 3RYRA 1TQMA 3HOXJ 2CO5A 2H1KA 2FU4A 3GUDA 2CRGA 3K2ZA 2M0CA 2M0MA 3LSJA 3W6KB 1S72I 3T8RA 4N0BA 4KA4A 3JRCA 5EGOB 3S16J 3J80K 1UHMA 1XC5A 3A03A 5E18F 3FXOA 1LDJA 3H9GA 1VQ4I 3IC7A 4XNFA 3HOTA 5FLXR 2AXTC 3WTZA 5JLXA 2O6GE 3GEZA 4M72A 2QZ8A 4E70A 4QLCU 3PJRA 2KIMA 1MW7A 2XB5A 1D8JA 1ZLKA 1Z6TA 5J1UA 2DJIA 2VOOA 1XGOA 3S1MJ 3H9QA 1FP1D 4AIHA 3BTLA 2F4MB 2FNPA 1R1TA 3KZYA 4IRHA 1EJ9A 4RGSA 2XF5A 2VKEA 1B6AA 1R4MB 1XMAA 1T33A 2QQ8A 3ECHA 4K2EA 4UB8C 2LBFB 2CWEA 3M8EA 4BBRJ 2EIJH 4XRFA 5D5VB 3I58A 1DQUA 4BXUA 2XSJC 1FWZA 3LFKA 2PQ8A 1WJDA 3D5LA 2W24A 2I8DA 2DFHA 3OWTA 1KQ0A 2K40A 3ISPA 2X4HA 5ED4A 2QQBA 3TBIA 4DZPA 1JT6A 4HV6A 5K7ZA 2QBYA 2F5FA 2IXSA 3PL8A 1X4PA 2ZMEC 2F6CA 4NNJA 5C3EJ 5GTHC 2NVXJ 3BPXA 2E1MB 1FBQA 1PVEA 2ZNYA 3GZ5A 3OYHA 2R93J 2OJED 4DQ2A 4IRGA 2E7XA 1I1SA 1HKTA 3COAC 1IRFA 2FOWA 3LA3A 4C3JJ 2VQHA 3E6DA 1W4MA 3HRSA 3WGGA 3OIQA 4F91B 1S29A 2NXNB 1K61A 1ON2A 5IYCJ 1V5GA 2KFDA 3BG9A 3Q3SA 4MTDA 3CC2I 4B8XA 3I64A 2K86A 1MH3A 4AC0A 4ZYGA 1B9MA 2VBYA 5B1BH 3VYSB 3ZQ7A 1G8XA 2R5YA 5ICCA 5DM6F 1I3AA 2R7WA 4RM3A 1SD6A 2CGPA 1Q1VA 1W5TA 3ABLH 3ZPLA 3IKTA 2UZKA 2LSOA 3WGIA 1ZYRF 4XL9A 2QUFA 2H27A 5K1YA 3ERED 1PUEE 1X3UA 5DTDA 3QOPA 2FQ3A 2XAFA 3OYMA 2PJRA 4LD5A 3Q0VA 3N97A 3F8FA 4RA2A 3BOQA 2VJ4A 3RKXA 2BYVE 3I3LA 2X85A 2ZFWA 4UV8A 1P7IA 2ZB9A 2K4JA 3PUFA 1RR7A 1BL0A 2HYGD 1WWXA 3ZOBA 1P7JA 3JW4A 5M3FJ 4A3GJ 4NB5A 2WY8Q 3ZP5A 1KU3A 3BR0A 3RPQA 1MJAA 1ENHA 3J81K 3J7AO 3CCVI 3JCUC 1IN6A 2COMA 3ASOH 4LLGF 3JSPA 4CCNA 4IZZA 4MEXF 1LPQA 1RNLA 4PJNA 1J9IA 4C9YA 4OMYA 3OIOA 1ZG3A 2ZFUA 2X6YA 1YX3A 1R1VA 1RESA 3ULQB 4WWCA 4A3JJ 5E17F 2WC2A 2OV7A 4RS8A 1PUFA 2MH2A 2MC3A 3L00A 1TT5B 4HBLA 2QSFX 2P5VA 2ECCA 4I6ZA 1A31A 2DTRA 4NDLA 5C4JJ 3DFGA 2NS7A 4S05A 3E6MA 3K9TA 5F0HA 5K7HA 2ISZA 2DBBA 2NRAC 4XKCA 5ILUA 3BTJA 1OYWA 1X1BA 2W85A 2P4WA 4BJ6C 2VB6A 2O03A 2F5VA 2JSCA 2KZVA 3HSEA 3V7CA 1TWAJ 2XV4S 2Y0MA 1HDPA 2L9VA 4LB6B 1K6YA 4CXFA 2EINH 1U2WA 5L3EA 1SC7A 3L09A 4WF2A 4NC7A 1MMDA 5ILVA 4EQQA 4JK1X 3HOSA 2KP6A 3E5UA 5FKNA 4OINF 2NOGA 3RZOJ 3NARA 3ZN1A 1M1EB 1IN5A 3ABKH 2VE8A 2GXBA 2VKVA 4UHTA 3JTGA 2ELHA 4DBRA 2JT1A 1YW7A 3O6BB 2V9VA 3M1CA 4M73A 1MJBA 2BW3B 4YRVA 3JREA 1UG2A 1O3RA 4XLHA 1BW6A 2HVQA 2QVOA 3G2BA 3LSPA 2E2IJ 4ZTFA 2DW4A 4A3FJ 1IUFA 4P96A 4IOCF 4EATA 3R0AA 3U2RA 5FKOA 3ZCOA 3R6SA 2E1NA 1TC3C 4RB0A 4RAZA 2DOAA 1K4TA 3V8LA 4U0YA 4F92B 3MKWB 1K79A 3KEYA 3ABTA 2B63J 2KDOA 3I53A 1UHWA 3GTLJ 2KIFA 1I1GA 2RQQA 4I99C 2W84A 3OS0A 2BGCA 2K9SA 3R60A 3TGNA 5J8FA 1MBKA 3LQQA 3GVAA 3M1EA 1TQPA 2FX0A 2WY7Q 1SFEA 1AKHB 3GTGJ 2ZBKA 2O61A 2Q1ZB 1I6XA 2A68F 2XGCA 4XMYA 4DW6A 1STZA 5H2FC 2XF7A 1LVKA 2A6HF 3IRQA 3OYEA 2M30A 3K10A 4HG2A 3U9GA 3BLYA 4HDUA 3QAHA 2NVQJ 1U5TA 4YFXF 2XSDC 3OSFA 2GQQA 2O5RA 4IHVA 3BT9A 3BQZA 3K4KA 1XSDA 3S8PA 5L3GA 4Y7NJ 3H1CA 5IP9J 1FNNA 3GBGA 1JE8A 4RB3C 4E7ZA 1FT9A 5FKKA 3TDZC 5FROA 1RRJA 2MH9A 5LHGA 1YW9A 2DFIA 4RM2A 3RCOA 2XUBA 2VBWA 4BKXA 4IKFA 3IAS2 4IHSA 2DN0A 1IC8A 1ONVA 1ZG5A 4OIOF 3VODA 3SFZA 1T0FC 4OU0A 2HZDA 2AS5F 2ZXJA 3I59B 1MMGA 1GXPA 1IGNA 1W1WE 1WI3A 1Y0UA 2YU3A 4HA8A 4Y52J 3ZQLA 3F8BA 2HI3A 1V5EA 5EGOA 4BACA 2UXNA 4Q48A 3K4JA 1E2XA 1OQYA 1CQTA 3QU3A 1YRNA 5JHFA 1B1BA 3A02A 4IQ4A 5EJCA 3VB2A 4CCKA 1G3WA 2IPQX 2JVGA 2NYXA 1AU7A 2H8RA 2XROA 4PGHA 1VTNC 2R7UA 1J2XA 2HOSA 3CCUI 1K6OA 2OCCH 1T6SA 1ZRDA 1IXSB 4IHTA 3BG3A 3RDIA 2KRHA 2L9RA 3Q5FA 4XKWA 2UUZA 4B09A 4PJJA 4M3DA 1JUSA 1T56A 3S15J 2IS6A 2ME0A 2VE9A 3DBHB 1HC8A 1LDDA 3F8CA 5F27A 5CLSA 4KICA 3OL4A 2E34A 2KL4A 1K83J 5KNLA 3FBNB 4IL6C 1D0ZA 1CGPA 2IW5A 5IT3A 3OR1C 3KLOA 5E8GA 3H0DA 3JRHA 4A3MJ 2X1CA 4RB2C 4II3A 3HPGA 2XC7A 1TWHJ 4BY1J 3MCZA 4FCYA 5L3BA 3A01A 3GX4X 1RUOA 4HQMA 1F1ZA 4WXDA 1Z1DA 2VKDA 3DKWA 2VPLA 1YJ9I 2HKXA 4M6YA 4HLXA 4C2UA 1HBXG 4MGRA 3H5NA 5TGTA 5IT9R 1QHGA 3CCYA 3MAJA 4B3XA 4HNUA 4U7DA 1BR4A 2CFXA 2G7UA 4AYBN 3MKZA 3DKXA 1JJ8C 2QGUA 4CUGA 1FSHA 4WXHA 1QU3A 1VNDA 1ETQA 4GXOA 2MLKA 2QBYB 2G9WA 3SJMA 3F6OA 4A6DA 2XRNA 2H6BA 3H92A 4IF4A 2ZSIB 4KN7X 3FMRA 4KJZA 5D6EA 3V4GA 1HLVA 1FYMA 1TLHB 1WVRA 1U8RA 1IO2A 4M3GA 3KP5A 4G7ZF 1IRXA 4J19A 1VQKI 2Y2ZA 3GFLA 1Z6RA 2A5WA 1HW5A 2ID6A 2LMDA 1LJ9A 3QU6A 2V26A 1KYWA 1YS7A 1FLIA 3S14J 3VOEA 1ZAOA 4B44A 1JUPA 3ROUA 4OIQF 2R5ZA 4NHJA 2P6SA 1WKMA 3E0JB 1QVTA 4IOAF 1T98A 2JK3A 3PIPF 3MZHA 2WB1A 2R5YB 3QRFF 2IRFG 2IS4A 5B1AH 5LGTA 1Q1HA 1ODDA 4AIKA 3HDDA 2IGOA 1IUYA 3TP0A 1CF7A 2A05A 1DU0A 4B1RA 3H36A 4LK1F 2VUMJ 1FBSA 4XM3A 4PFOA 1NG7A 5HLGA 3GTOJ 3Q0WA 3F9KA 3ECOA 1HKQA 3SEZA 2E71A 5F0FA 2CS3A 2HOTA 1ULYA 2PJRB 3MFKA 2KT0A 4BUPA 4KNYA 3L2VA 2FBIA 1X1DA 2KKOA 5DD8A 1U3EM 4IXAA 2ZSHB 4AYBA 5LD2C 2EZHA 3FF5A 4HRIA 1X1PA 5FLVA 2VC0A 1E3PA 3BCBA 2BHZA 1EH8A 3DV8A 2JSPA 2OC6A 4DGWB 2L5QA 2IBDA 2OCEA 5BPIA 2NOJB 4H4KC 1SMYF 1MMAA 2M34A 5HS8A 3VFZA 2IVMA 2G7HA 4RMNA 4UUVA 3GTPJ 2GA2A 2P7VB 4XLEA 4DOZA 3HKZA 3G71I 2R7XA 2EBIA 1K4SA 2R7QA 2W57A 4UVAA 4BQNA 5JLWA 5GTIC 3REOA 1IV8A 3B6CA 4II2A 4M9ZA 4BU2A 3HBLA 3OYLA 2V1XA 5D8LB 5CYVA 4KITB 2HNHA 3V8KA 4ESFA 2FBHA 2HU9A 1YX5A 1F43A 2OA4A 3MEXA 5HDKA 3EETA 4F3QA 3S2WA 2L9NA 1XCVA 1XCBA 1IXCA 3IH2A 4X1EA 3HGGA 3K6GA 2KQRA 2ID3A 3VYUB 1YIJI 3OV8A 3N05A 2Z5UA 3QWLA 2FUG2 2QCOA 3NQOA 2COBA 3PFIA 2FXAA 4QSHA 2HKOA 3MVPA 3CLQA 2GOXB 1MBHA 5F6FA 3S93A 1A6QA 3PSFA 3DP7A 2QQ9A 2IS2A 1BOAA 3FX3A 3FK7A 2DMNA 5DD4A 3TQNA 4XN0A 1LE8B 1AOYA 4A3DJ 1LVAA 2JTVA 3OYCA 3CUOA 3DBRB 3T5XA 1A36A 2OZ6A 1R4NB 4LLLA 3G3ZA 4BNCA 2CH0A 2BXYA 1YYVA 4ZYDA 4A6EA 3OSGA 1S7EA 1XTAA 4YIIA 2QSHX 5ICFA 2FOKA 2P5LC 4S0HB 3R61A 2GBYA 4JX5A 1A04A 3F8NA 1RKTA 2BVLA 2UV1A 4XIDA 4Y13A 2DOEA 4D5CA 1QRYA 1R58A 5FFZA 5EG0A 3HOZJ 5JR3A 3DTEA 1E17A 1ZKGA 3IRRA 2KPMA 1H89C 3RPUA 1NHAA 4A3CJ 5GP9A 2NVYJ 4C2MJ 5EEHA 1UMQA 5IOZA 2J5OA 4L9TA 4RAGA 1WRJA 3BR5A 4EJOA 1DUXC 1R5ID 1WI9A 5TRDA 1AKHA 4IHXA 3BZKA 2XIGA 3S2HJ 2DA1A 2DAOA 5BNGA 2ISYA 3RKQA 2KLOA 3LSTA 5C44J 4ZJZA 1TWCJ 3FISA 4L5JA 1TZLA 1USTA 1RR8C 3VYTB 1SFOJ 2AO9A 2B0LA 5FKLA 3RIRA 3QYEA 1X19A 3FZVA 4AVPA 2ESNA 2O9LA 3EYIA 4M3FA 2UXXA 4WK8F 1F9NA 1R71A 3O8GA 4I76A 3PSIA 1WJ5A 1XX5A 2IA1A 4BDYA 2B9SA 2QQAA 1O3QA 4QPQA 2D45A 5J1RA 2GIZA 3HIFA 3RQ4A 2OU2A 1U5TB 4ZYAA 2ICWG 2A6TA 4LB5A 1YITI 2EQRA 4IO9F 2NVUB 5K5QA 3DTIA 4YFKF 3CDLA 4PJMA 4DBQA 4GYIA 3WTXC 1KA8A 3JAMR 5FD5A 2E1CA 3J7AY 4BXXJ 3HRUA 1RETA 5E3LA 1BI3A 2F48A 1I5ZA 5J6XA 1U78A 3W2WA 1VQ8I 2M87A 2K85A 2VKHA 4M6XA 1T38A 1O3TA 2F5EA 1VQNI 4X0GA 2STTA 1ZREA 2DT7B 2E35A 3OYAA 3HTSB 4P5OA 1D1BA 1XSXA 4GCVA 2YR2A 5CVIA 1JUMA 3CCQI 1YJNI 4IHWA 2RKHA 4L9JA 3W2AA 1Z05A 2BEOA 1ZQ3P 4G94A 2GXGA 4PGGA 1YRNB 1IRGA 3G1MA 4OMZA 1SFUA 4BDZA 3I56I 3J81R 1NK2P 2XPWA 1FP2A 1OCRH 1V54H 3K1NA 5M5WJ 5HLIA 1O3SA 4RGRA 1H8AC 2JQ7A 4CZCA 2NVTJ 1GVDA 1H9GA 4ON0A 2C6YA 3M8JA 2IT0A 2VOPA 2EB7A 2STWA 2GAUA 1FOKA 2K5CA 2K9NA 2QKLB 1SFXA 4E7LA 2KRCA 3HB9A 2LKXA 2Z16A 3HG9A 4R1HA 4AU7A 2BY2A 2MG4A 5HODA 4CCOA 3WTTC 5ERIA 1S7AA 1Z7LA 1ZELA 1SAXA 4XSXF 3LSIA 5LEKA 4FQGA 1ZR4A 4HF0A 4JYKA 5F08A 4CYCA 2DA3A 5DCMA 3A01B 3CMYA 4EM0B 3JRBA 3L2RA 1QGPA 1U6GA 3CF5F 2O3FA 2BZTA 3FBIB 4CICA 5KHDA 2K4BA 3KX2A 3I54A 1FEXA 5BQTA 4RDUA 2E2HJ 1TT0A 3JR9A 4M74A 3BR3A 1IZ1A 3FXJA 1DDNA 1BR1A 1YLFA 3Q9VA 1NH3A 5HS9A 2EZIA 4OWRB 2ZNZA 3RYPA 4XQFA 1SEUA 2A3SA 1W5SA 4HX8A 4Y17A 3ZR8X 3I0TA 3HOYJ 2DK5A 5CVRA 2OUMA 2VBZA 3CUQA 1FOYA 2Z2SB 3W2VA 3L2CA 3LSGA 4L0YB 3K4CA 3ZQCA 2HTJA 3RTRA 1IDZA 2GWRA 3LAJA 4MNUA 2CUEA 2L0KA 1YQAA 2L54A 2Y48A 4R8HA 1D1AA 1BIBA 2J5PA 3AAFA 4CHUA 2HXIA 1MIJA 2M5WA 2R5ZB 1ORKA 1Z3XA 1ETWA 3DBLB 2QEXI 3CJQB 5LGUA 3MZ8A 3ZQIA 1TTYA 4BY7J 3BP8A 2V9PA 3F22A 3BJOA 3DEWA 1QBJA 1CF7B 4Y15A 3TO7A 1L0OC 1U9OA 3IKVA 5JVTA 2Y75A 2OD5A 4XLNF 5HLTA 5H20A 3HHHA 4DYRA 3BROA 2CSOA 4D9JA 1LB2A 4W1UA 2E19A 2HS5A 3LMMA 4PSXA 2OF7A 5H6RA 4LLNA 2XKPA 4Q4ZF 2BY3A 2XGXA 3C7JA 3BJAA 1G4DA 2N8GA 4ESBA 1KZHA 3SQNA 4BEHB 2QF7A 4MIMA 4CSWA 2VQGA 1D5VA 3GXOA 3Q9SA 2L7KA 2O0YA 3I5UA 4Z2YA 4DIQA 2X6OA 4C3IJ 2FD5A 2H6CA 2LLKA 1TWGJ 1JI8A 1DP3A 1E3HA 3BWGA 2E1MC 5LHHA 2ZCWA 2YX4A 1KONA 4L9VA 4O5VA 5F1RA 2YUSA 3ZMDA 2KIQA 2EV0A 3CCLI 3H5RA 2P7CB 3EPZA 3JRFA 2X0LA 2CQ7A 3E6CC 1QA6A 1GVJA 3K7AJ 4BL0B 5F0CA 3CCJI 2LFBA 5ILSA 3QYFA 1UFMA 3BG7A 2XAHA 3CZ6A 4ZDLA 2Q0OA 5A2QZ 4H0EA 3ZQQA 2M45A 4IPAA 4KUMA 2OTLI 3GFMA 5J40A 3AKZA 4E7KA 2HZTA 5CKTA 2VXDA 1MBEA 3L2WA 3PO2J 4E7JA 4BE1A 5IT9Z 2FEZA 1ZK8A 2XKOA 1IJWC 1IV6A 5TJJA 1TNTA 3DTKA 4UUSA 3GYHX 4MFEA 2R0QC 1OR7A 4G7OF 5M3MJ 3EUHA 3AFHA 3DLLF 1JKOC 3ZMZA 2XAGA 4W97A 1LE8A 4YIRX 3B6AA 3U1DA 1MMNA 1LQ1A 1KU9A 1J5YA 2MZ4A 3AG2H 2GZWA 2K9QA 4EM1A 3A0BC 2VPRA 1YO5C 2K02A 3ZMVA 3LNQA 3K2AA 2BXZA 1VZ0A 1FMWA 1OMIA 2Y9YA 2LY9A 1XG1A 3H3UA 3M3YJ 2QENA 1YTYA 3PNVA 3SEQA 1Y56A 2ACJA 4NC6A 1FC3A 2EFWA 2ELJA 2I5UA 4JP0A 4KDPA 2JWTA 5CVVA 3S32A 2EWNA 1RZ4A 4A2UA 2L01A 2K3FA 1T39A 1R7JA 1S5LC 3V7SA 1PP8F 2DLLA 2JA6J 1QQIA 5IP6A 3O8HA 4PDKA 2UWMA 3O3KA 1YW8A 5EG0B 3H9JA 4CZZA 3DQVC 4QPOA 1WZ2A 2L7FP 1KQ8A 2R7RA 5E8IA 4JX4A 2PJPA 1EF4A 2Q2EB 1BM9A 4C2TA 5E1XA 5D4RA 2PX9A 3P9KA 5FJ8J 4AIJA 2D5VA 2BBYA 2FJ1A 4DYQA 3NAUA 3V42A 3IH3A 3IP4B 5DCFA 2DI3A 3AL0B 1X58A 1Z91A 3JRDA 2HOAA 4BHPA 3KYLA 4IQJA 3MWMA 5KCMA 1Z77A 2XB0X 2VJJA 4BAYA 4HZFA 5GAGJ 1YFHA 6PAXA 5DEQA 1GV5A 2MYSA 2WADA 4CA0A 1HSJA 4LFUA 5EZHA 1R22A 4P55A 4G9YA 3R4KA 4YFNF 1Z0XA 3OYFA 3Q0UA 3F21A 1OLTA 2MABA 1MNMC 1BC8C 1VQLI 4BE2A 2H09A 1IF1A 4MLOA 2IGNA 3PQKA 4MQVA 3WG7H 3WGHA 1LFUP 1HF0A 3HSFA 4A0YA 4F55A 2RC4A 1GXQA 2AXLA 5HDNA 4LK0F 2VLAA 4P1WA 3CESA 4RAFA 5LRRA 4XK4A 3K69A 3JRAA 3CD6I 1IN7A 4HNVA 1MJ9A 2L4AA 1WHUA 4KMUX 4G6TB 3TP3A 2A07F 3JRGA 1FZPB 3WTSC 1P2FA 4G6QA 2ZJ2A 1SAUA 4OAZA 2BHYA 1BR2A 1ZARA 1IN8A 2EFNA 2RNJA 5FD6A 4L18B 4U0VA 2E5ZA 2H94A 2LF8A 2ZMEA 5IP7J 3BZ6A 2R92J 2Y31A 3G1LA 4EJWA 5B66C 3N4MA 2EA4A 2V4JC 3I4NJ 1LKXA 5GAHJ 4LIVA 5K7FA 2JJ7A 4CO8A 2PMZN 3M9AA 3BQYA 3BTCA 3O2PE 4BJ5C 2YU9J 2FNAA 2LKSA 1ETXA 3HXLA 2VIXA 2CMPA 2JUCA 2OQGA 1D0YA 2DQLA 3KLNA 2IJLA 1QVUA 2DA2A 2PN6A 1VF9A 1S7OA 2W7NA 2EJRA 2CUZA 3KEOA 3TEDA 2DMTA 1X1CA 4Y33A 1ZGAA 4OOIA 5GPCA 1WJFA 2RDPA 3IAM2 3D5SC 4XBFA 3S1NJ 1Y1VJ 1RUNA 3MQ0A 4OIRF 2PG4A 3LL7A 4IVNA 5BMZA 4QIWN 2DO7A 4RLQA 4UVCA 2CQKA 3FXLA 1P92A 1ETVA 3GLLA 1ACIA 3PM1A 2DFFA 2JMWA 1S3JA 1MNDA 2E60A 4HV5A 5LFAA 4HEA2 2JUGA 3X2QH 1X3WB 1HW1A 1XN7A 3FK6A 4CCLA 4M3BA 4I0AA 3KP3A 4MO7A 1IN4A 2CQQA 2OBPA 2V9KA 3IV5A 1AHDP 3DPLC 2FMLA 1UJ8A 4KYWA 1MZBA 3A0HC 1BJZA 3BR2A 3FWEA 5D6FA 3BCAA 1N75A 4BQOA 1YI2I 4XOTA 4CYCB 1ZTRA 4LIUA 4B4CA 1Z3YA 1PYVA 5DCMB 5FGMA 5TISC 1T95A 3OMYA 4UXNA 3PNYA 1LNWA 3GFJA 1NTCA 1X1AA 1AWCA 1GLNA 4U88A 3ZMSA 4EEFG 2F2EA 1R49A 3L1PA 3H5AA 1V5FA 1VQ6I 1O7LA 3HC7A 1Y8RB 1MH4A 1IDYA 2DYRH 1RPWA 2EPFA 4AVZA 1TWFJ 3GZ6A 2LYCA 5LLQA 2M4GA 2MFZA 2OTJI 4J01A 1SD4A 1LEBA 2GIVA 3CUQB 1D3YA 1YHQI 1XGSA 2R7OA 4ENKA 2EZKA 4A3EJ 2MSYA 1WSUA 1FJLA 5D4SA 3JAMZ 4I09A 5EF6A 2Y0SN 1X3ZB 3CCMI 1OFCX 2Q8KA 3GF2A 1GUUA 2JA2A 2NS0A 5LHIA 2HVSA 5E1WA 2O7OA 2EH3A 4XLFA 2DPDA 2IA2A 3ZMUA 1QZYA 3DPUA 2QM3A 1G2HA 3I4PA 3IWZA 2GLOA 4E4HA 4HLYA 4IJAA 5HVQC 1NK3P 2EA2A 4GYGA 4BEHA 2KRFA 4DZJA 1JT0A 2RNGA 3CP8A 1KQ9A 3SZTA 4N4NB 1DPUA 3W6VA 4DYCA 4A3IJ 5FLXZ 1FY7A 1R36A 3JRIA 5CPRB 2Y9ZA 1IXRC 1Z21A 1H9TA 3M07A 4BQAA 2RVCA 3V8JA 3SFIA 3S1RJ 3OYIA 3CJRB 3WODF 5L3CA 1UHSA 3KYCB 5CVJA 4JX6A 4DJAA 3S1QJ 2OZUA 3QQAA 1I39A 2VASA 2ZJRF 4ANJA 1DP7P 1P4WA 3QP5A 1LDKB 3ASNH 4CH7A 2P81A 4AWXB 2LD5A 3RPUD 1ZN2A 2DMUA 5IOYA 2WAEA 1JJ6C 2LTPA 4UUTA 2DFEA 3WHBA 2KJBA 4P9UA 2WTEA 1DGWY 2F4IA 2R7SA 1SMTA 1W7PA 2WAQN 1G6NA 2JA5J 3B73A 3ZQFA 4FTHA 5FRNA 1MSEC 3HTUA 3CTAA 2EFQA 4EM2A 1VFCA 4I0BA 4HAMA 1K78A 4XN3A 2Z99A 3FDYA 2Y0SA 2H8WA 2D1VA 2VODA 3HOVJ 2A69F 2ZC2A 3VEPA 2HQNA 2R7ZJ 3VWBA 4XRSA 2Z33A 1WJEA 4A69C 3G4SI 2JRTA 1X2MA 3GZNB 4L0ZB 4BJTA 2XPUA 2EZLA 3PUBA 4Y4RA 4GDFA 3J80R 2WWYA 5D5WB 2KMUA 3ABMH 2DXIA 1N78A 5FRMA 1EKEA 2X6WA 4UUSB 5HOOA 5A2QK 4IRIA 1B59A 1BI0A 3FHZA 3K70D 1UB9A 1Z7UA 1OCZH 1XSVA 3IL2A 4HQEA 1A5JA 4WX9A 1B4AA 1JTXA 3OOPA 4ETSA 5JVGF 2HDDA 5KK1A 5IT9K 2OAZA 3M8FA 1ERDA 2ZXHA 1B9NA 4ENNA 2BOLA 4PUSA 2AQFA 2LC2A 1L3LA 2BE5F 3WHCA 4UV9A 2PBIA 3VYRB 4IEJA 1B72A 1D5YA 4MQ9F 2LKPA 1RQ6A 1T0FA 1R6RA 3W3CA 4U0WA 2GM4A 1ETYA 3HSRA 4XLAA 2Q2EA 3C2HA 2MC4A 3C3WA 2EV5A 4EGYA 2K3PA 3TOAA 2MA3A 1WQ2A 3OIPA 4D7NA 3K4NA 1TNSA 2XRLA 4KT6A 1J7KA 4O3MA 1MGTA 1RC9A 2YX7A 3P9CA 2WAQA 4I98B 3OYBA 2R7FA 4HF1A 1SVMA 3TDUC 3VSLA 4BHCA 3J7AW 1WH7A 3S3OA 1GHCA 3QP6A 4ZZDA 2DYSH 3FXMA 3T0YA 2V79A 5J4YA 1BC7C 2VL8A 4B43A 3KCCA 1FIPA 2ECBA 3J7YJ 2D2WA 2V6EA 4FX0A 3LQRA 3CMAI 2L7MP 3KP2A 3BG6A 1EH7A 1UAAA 1SANA 4A5NA 5AONA 1LEAA 2FF4A 2PMHA 2Y30A 1RI7A 3QOEA 3NRVA 3I55I 3VSKA 2M8GX 3LOCA 3CMEI 2DA6A 1X2NA 4M6VA 2JA8J 3KZIC 4A0ZA 2R7VA 2IGKA 4XORA 5J4VA 1J59A 2M4KA 2B7EA 4NQWA 2XGDA 5LBQA 2WBMA 4UNOA 3BZCA 5CJ9A 1U8BA 2GOMA 2IAIA 4M9SA 2OQRA 3TKYA 2MUNA 2CV0A 2V6CA 2ZXIA 1WPKA 1R1UA 4V19K 4LOCA 3CCSI 2L7ZA 3HM5A 3F6VA 4X6AJ 5FO5A 5KVRA 5D8KB 4GGGA 3FXKA 2L2OA 1UELB 1S8NA 4M9XA 1E3OC 1BW5A 2LRDA 3G1OA 2VN2A 4HX4A 2CYYA 3AG1H 3CO7C 2RN7A 1XMKA 2Z1DA 1WGXA 4ZZLA 2HPMA 3DXJF 5HNFA 2ZMEB 2L4MA 2XAUA 5C4XJ 1U9NA 3PNTA 3D1NI 2MD0A 3GO5A 2M35A 4UY8I 5KAFC 2P6TA 2W1OA 3E3VA 2QA4I 9ANTA 2HFHA 1MBJA 1D8KA 3WTVC 3EQLF 4MTEA 3DWLE 5FLMJ 3WTUC 1F5TA 2JN6A 2WV0A 4B48A 2VC1A 3SHFA 2JPCA 1PP7U 2XVCA 1A6IA 4OAYA 5E3MA 1OPCA 1P4AA 3M4OJ 1OJLA 2QKMB 3VDXA 4KFCA 2CQNA 4NC8A 4LG0B 3OY9A 2MD5A 3P7NA 2EK5A 4XKVA 3BG5A 5DUIA 2HQ5A 2ZJPF 1U5TC 2VT2A 1SD5A 3M7GA 2D1HA 1VQPI 1OCCH 2CV2A 3TL4X 5IY5H 4PFPA 3GTQJ 3E7LA 1SVLA 3L7WA 1G3YA 3PFYA 5L3FA 1YIOA 1FSEA 5L3DA 4BYYA 2V1DA 2RV8A 2V1NA 5JI6A 3HEFA 5HS7A 5LGNA 4EV0A 5IPAA 1I50J 3NEUA 3C2GA 5BOXA 2NS8A 1IRZA 3EYYA 2RAEA 2YPRA 2Z3YA 1MSFC 3HRMA 3GCMA 3D5RC 4QTRA 3BC8A 1ZH5A 5E3OA 4YELA 1VQOI 1W36D 1BI2A 1DGRM 5LEJA 1ZRCA 1HCRA 3V7RA 1LUJB 2W25A 2VJIA 3P5JA 2H1LA 2DDAA 1JKPC 2K9LA 3UNGC 2XAJA 3I9V2 3IWFA 4A12A 3F0CA 5HDGA 4ABZA 1QPIA 4LJZF 3E1SA 3WU2C 3BY6A 5DDGA 3ABUA 4TV7A 3BJ6A 4BHBA 3W6JB
chains in the Genus database with same CATH topology
4JBAA 1TW3A 4AD9A 1MKMA 4KIBA 2IA0A 1R00A 1FYLA 3TO9A 3FXUA 3WU0A 5BPDA 1FPQA 1IW7F 3JAMK 3E6BA 4HDVA 2R7DA 1XDUA 3JTHA 2FMYA 3R0JA 4EVIA 3WE2A 1O57A 3HUGA 4HX7A 3CDHA 4PZJA 3TO6A 4EJTA 3WTYC 5DUKA 1QNTA 5HLHA 3CJNA 1PDNC 4KMFA 4KN4X 5FLXK 4QWQA 3RKYA 3QPTA 1Z9CA 2CW0F 1W7PB 4ASNA 1YG2A 1FX7A 1JHFA 2VT3A 1KGSA 1K78B 3HRTA 4UVBA 5BS6A 3C18A 3G73A 1BJAA 5DYMA 1XGNA 2ZO4A 5J8CA 1YS6A 2IP2A 2L3DA 1QPMA 2XAQA 3SZPA 1R23A 4LGWA 4RAYA 1SD7A 1KU2A 1BN5A 2HQRA 3RJPA 2JZYA 1XGMA 1JGSA 5DV5A 1ZRFA 4ZH4F 1OKRA 2NNNA 5H6QA 4YIFA 2KIUA 4XSZF 2Z9OA 4CGZA 3PQJA 4XLPF 1KYZA 1OYIA 2LF7A 5ICEA 2NNYA 3QPHA 2XASA 1O7FA 2K27A 1RIOH 2LNBA 4ZYEA 5JFRA 1BI1A 4GO1A 2ZKZA 4BH9A 3I71A 2E7WA 4EJVA 3KETA 4G7HF 3LWFA 2FE3A 2ETHA 3DEUA 3GW2A 2FA5A 2VONA 1QZZA 3D0SA 3K1MA 4D0PA 5E1ZB 2QWWA 4RGXA 3FM5A 2HTSA 3LA2A 1K7AA 2PEXA 3T1BA 2KJCA 1ZG1A 5D5XB 4O6JA 4F7ZA 2ESHA 4JQFA 1JXSA 3J80Z 1MDMA 5FFXA 3F72A 1HXDA 2L02A 2DPUA 1QO0D 1EH6A 4FX4A 2EFOA 1F4KA 3WG9A 3IHUA 2HR3A 4L5IA 3BPVA 1EV7A 4LG0A 2M8EA 1HSTA 2V1UA 1I27A 1V3FA 2VBXA 2QLZA 4ENMA 2P5KA 4G6DA 3WE3A 4G8XA 4MEYF 3E5XA 1BIAA 4I01A 3KP4A 1J0RA 2CG4A 3B02A 3E97A 4P9FA 4CYDA 2M1BA 2HDCA 1TW2A 4KT5C 4EMSA 1HKSA 4CDGA 2GA1A 4Q5SF 3WTWC 5LRSA 5FB2A 1S6LA 4R79A 1MD0A 1R5GA 1USSA 3GWZA 2PI0A 2DK8A 4KIFA 2DU9A 5D5UB 3ZN0A 2DQRA 2PLYA 3KFWX 1W7PD 2YSRA 5K5OA 3WU1B 3T8TA 3F23A 2QYOA 2R3SA 2DT5A 4S04A 3JSOA 4HF2A 3K1PA 3GLXA 3F8MA 2EV6A 4LMYA 4HYEA 1XB4A 5JHUA 1TBXA 2BV6A 4DNCA 1C0WA 2JPBA 2PFBA 2HGCA 2F5DA 1T2KA 1DPRA 3KP7A 2A6EF 2HYFA 3P9IA 2EFPA 3J81Z 3TOBA 2TDXA 4Q47A 2P8TA 2VXZA 4OIPF 4ZYHA 1ZGJA 3FXQA 2HWVA 2ADUA 2MLGA 1OYYA 1V4RA 3FMQA 3GFIA 2O8XA 1BBYA 1HQCA 2PMUA 3ML6A 3ELKA 3CUQC 3FXRA 3MZYA 1G3SA 2RQPA 2FBKA 4MHGA 1KU7A 3FM3A 3LAPA 3BDDA 4ESJA 1XDSA 2FRHA 3F3XA 2A61A 5AIQA 5ICGA 4I2OA 4RGUA 4A5MA 4PCQA 1JHHA 3KEQA 3EDPA 1UCRA 1TQIA 5EEGA 2XHKA 2K7LA 2MBFA 2NAZA 4N9HA 3DF8A 1HW2A 3KE2A 1G3TA 4WCGA 1ON1A 4M71A 4EGZA 2HEOA 3C1DA 2RGVA 3L9FA 3ZMTA 3KP6A 3KZZA 4L9NA 4YG2F 4EJUA 3E5QA 1J75A 4KIGA 2FSWA 1ZLJA 2LDUA 4ENJA 1P4XA 4HOBA 2F5CA 4RB1A 4FT8A 2A5YB 4A0XA 1FBUA 1FYKA 3SXYA 5E20A 1XD7A 2HOEA 3HYIA 3LA7A 4WXCA 1ZHFA 3RI4A 4I02A 3FMSA 5AIPA 4U7BA 4I7HA 5CVUA 1R5HA 5F64A 3CLOA 4FHTA 4HW0A 3DPTA 1REPC 5K5RA 3HHGA 3H3ZA 3I59A 3CO6C 3K0LA 4N9IA 3RKWA 1P6RA 1H0MA 1MDMB 1IAWA 3RYRA 1TQMA 2CO5A 2FU4A 3GUDA 3K2ZA 3W6KB 3T8RA 4N0BA 4KA4A 3J80K 1UHMA 5E18F 1LDJA 3IC7A 3HOTA 3WTZA 2O6GE 3GEZA 4M72A 2QZ8A 4E70A 4QLCU 2KIMA 1D8JA 1ZLKA 1Z6TA 2VOOA 1XGOA 1FP1D 4AIHA 2FNPA 1R1TA 3KZYA 4IRHA 4RGSA 1B6AA 1XMAA 3ECHA 4K2EA 2CWEA 3M8EA 5D5VB 4XRFA 3I58A 4BXUA 1FWZA 3LFKA 2PQ8A 3D5LA 2W24A 1KQ0A 3ISPA 2X4HA 5ED4A 2QQBA 4HV6A 2QBYA 2F5FA 3BPXA 1FBQA 2ZNYA 3GZ5A 4DQ2A 4IRGA 2E7XA 1I1SA 1HKTA 3COAC 1IRFA 3LA3A 3E6DA 1W4MA 3HRSA 3WGGA 1S29A 1ON2A 4MTDA 4B8XA 3I64A 2K86A 4ZYGA 1B9MA 2VBYA 3ZQ7A 5ICCA 1SD6A 2CGPA 1W5TA 3ZPLA 3IKTA 2UZKA 2LSOA 3WGIA 1ZYRF 2QUFA 2H27A 5K1YA 3ERED 1PUEE 1X3UA 3QOPA 2FQ3A 2XAFA 4LD5A 3N97A 3F8FA 3BOQA 3RKXA 2BYVE 4UV8A 2ZFWA 2K4JA 2HYGD 1WWXA 3JW4A 4NB5A 3ZP5A 1KU3A 3RPQA 1MJAA 3J81K 3J7AO 4LLGF 1IN6A 2COMA 3JSPA 4MEXF 1RNLA 1J9IA 4OMYA 1ZG3A 1R1VA 5E17F 3ULQB 4WWCA 2WC2A 4RS8A 2MH2A 2MC3A 3L00A 4HBLA 2P5VA 2DTRA 3DFGA 4S05A 3E6MA 3K9TA 2ISZA 2DBBA 2NRAC 5ILUA 1OYWA 2W85A 2P4WA 2O03A 2JSCA 3HSEA 3V7CA 2XV4S 2Y0MA 4LB6B 4CXFA 1U2WA 5L3EA 3L09A 4WF2A 5ILVA 4EQQA 4JK1X 3HOSA 3E5UA 4OINF 3ZN1A 1IN5A 2VE8A 2GXBA 4UHTA 3JTGA 2ELHA 2JT1A 1YW7A 3O6BB 2V9VA 4M73A 1MJBA 1O3RA 2QVOA 2DW4A 4P96A 3R0AA 3U2RA 3R6SA 2E1NA 4RB0A 4RAZA 3V8LA 4U0YA 1K79A 3ABTA 3I53A 1UHWA 2KIFA 1I1GA 2W84A 2BGCA 3TGNA 3R60A 5J8FA 3LQQA 3GVAA 3M1EA 1TQPA 1SFEA 2O61A 2ZBKA 1I6XA 2A68F 1STZA 2A6HF 3IRQA 2M30A 3U9GA 4HDUA 3QAHA 1U5TA 4YFXF 2GQQA 1XSDA 5L3GA 1FNNA 1JE8A 4RB3C 1FT9A 3TDZC 2MH9A 5LHGA 1YW9A 2DFIA 2XUBA 2VBWA 4IHSA 1ONVA 1ZG5A 4OIOF 3VODA 3SFZA 4OU0A 2AS5F 2ZXJA 3I59B 1GXPA 2YU3A 1Y0UA 4HA8A 3F8BA 2UXNA 4Q48A 1E2XA 3QU3A 1B1BA 3VB2A 1G3WA 2IPQX 2NYXA 2XROA 4PGHA 1VTNC 1J2XA 1K6OA 1T6SA 1ZRDA 1IXSB 4IHTA 3RDIA 3Q5FA 4B09A 2VE9A 1LDDA 3F8CA 5CLSA 4KICA 1CGPA 2IW5A 5IT3A 3KLOA 5E8GA 4RB2C 3MCZA 5L3BA 3GX4X 1RUOA 4HQMA 1F1ZA 4WXDA 1Z1DA 3DKWA 2HKXA 4M6YA 4HLXA 1HBXG 4MGRA 3MAJA 4U7DA 2CFXA 2G7UA 1FSHA 4WXHA 4GXOA 2MLKA 2QBYB 2G9WA 3F6OA 4A6DA 2XRNA 2H6BA 3H92A 4IF4A 4KN7X 3FMRA 5D6EA 3V4GA 1FYMA 1TLHB 1U8RA 3KP5A 4G7ZF 3GFLA 1Z6RA 1HW5A 1LJ9A 3QU6A 1KYWA 1YS7A 1FLIA 3VOEA 1ZAOA 3ROUA 4OIQF 4NHJA 2P6SA 1WKMA 1T98A 3MZHA 3QRFF 2IRFG 5LGTA 1Q1HA 1ODDA 4AIKA 1IUYA 1CF7A 4LK1F 1FBSA 5HLGA 3ECOA 1HKQA 1ULYA 3MFKA 4KNYA 2FBIA 2KKOA 5DD8A 1U3EM 4IXAA 3FF5A 2VC0A 1EH8A 3DV8A 5BPIA 1SMYF 5HS8A 3VFZA 2IVMA 2G7HA 4UUVA 2GA2A 2P7VB 2W57A 4UVAA 3REOA 4M9ZA 2V1XA 5D8LB 5CYVA 3V8KA 4ESFA 2FBHA 2OA4A 3MEXA 5HDKA 3EETA 3S2WA 1XCVA 1XCBA 1IXCA 3OV8A 2Z5UA 3NQOA 3PFIA 2FXAA 2HKOA 5F6FA 3DP7A 2QQ9A 1BOAA 3FX3A 5DD4A 3TQNA 1AOYA 1LVAA 2JTVA 3CUOA 3T5XA 2OZ6A 4LLLA 3G3ZA 4BNCA 1YYVA 4ZYDA 4A6EA 4YIIA 5ICFA 2FOKA 2P5LC 3R61A 1A04A 3F8NA 4Y13A 1R58A 5FFZA 5JR3A 1E17A 3IRRA 3RPUA 1NHAA 5EEHA 2J5OA 4L9TA 1WRJA 4EJOA 1DUXC 1WI9A 5TRDA 2XIGA 2DAOA 2ISYA 3LSTA 4L5JA 1USTA 2B0LA 3RIRA 3FZVA 4AVPA 2ESNA 3EYIA 2UXXA 4WK8F 1F9NA 2IA1A 2QQAA 1O3QA 2D45A 3HIFA 2OU2A 1U5TB 4LB5A 5K5QA 4YFKF 4GYIA 3WTXC 1KA8A 5FD5A 2E1CA 3HRUA 1BI3A 1I5ZA 5J6XA 1U78A 2M87A 4M6XA 1T38A 1O3TA 2F5EA 2STTA 1ZREA 3HTSB 4P5OA 1XSXA 4GCVA 2YR2A 5CVIA 2RKHA 4L9JA 1Z05A 2BEOA 4G94A 2GXGA 4PGGA 1IRGA 4OMZA 1SFUA 1FP2A 3K1NA 5HLIA 1O3SA 4RGRA 1H9GA 4ON0A 2C6YA 2IT0A 2VOPA 2EB7A 2STWA 2GAUA 1FOKA 1SFXA 4R1HA 3WTTC 5ERIA 1S7AA 1SAXA 4XSXF 5LEKA 4HF0A 5DCMA 4EM0B 1QGPA 1U6GA 2O3FA 4CICA 2K4BA 3I54A 5BQTA 4M74A 1IZ1A 1DDNA 1YLFA 3Q9VA 5HS9A 2ZNZA 3RYPA 2A3SA 1W5SA 4HX8A 4Y17A 3I0TA 2DK5A 5CVRA 2VBZA 3CUQA 3L2CA 4L0YB 2HTJA 3RTRA 2GWRA 3LAJA 4MNUA 1YQAA 2L54A 2Y48A 4R8HA 2J5PA 1BIBA 3AAFA 4CHUA 2M5WA 5LGUA 1TTYA 3BP8A 3F22A 3BJOA 1QBJA 1CF7B 4Y15A 3TO7A 1L0OC 3IKVA 5JVTA 2Y75A 2OD5A 4XLNF 5H20A 3HHHA 3BROA 2CSOA 1LB2A 2HS5A 5H6RA 4LLNA 2XKPA 4Q4ZF 2XGXA 3C7JA 1G4DA 3BJAA 4ESBA 3SQNA 1D5VA 3GXOA 3Q9SA 2O0YA 3I5UA 4Z2YA 2H6CA 3BWGA 5LHHA 2ZCWA 2YX4A 4L9VA 4O5VA 5F1RA 3ZMDA 2EV0A 2P7CB 2X0LA 3E6CC 1GVJA 5ILSA 1UFMA 2XAHA 2Q0OA 5A2QZ 4H0EA 2M45A 4IPAA 4KUMA 3GFMA 2HZTA 5IT9Z 2FEZA 2XKOA 5TJJA 1TNTA 3GYHX 1OR7A 4G7OF 3EUHA 3ZMZA 2XAGA 3U1DA 1LQ1A 1KU9A 1J5YA 2GZWA 4EM1A 1YO5C 2K02A 3ZMVA 1OMIA 3H3UA 2QENA 1YTYA 2ACJA 1FC3A 2EFWA 4KDPA 5CVVA 2EWNA 1RZ4A 4A2UA 2L01A 1T39A 1R7JA 3V7SA 1PP8F 2DLLA 1QQIA 4PDKA 2UWMA 3O3KA 1YW8A 4CZZA 3DQVC 1KQ8A 5E8IA 2PJPA 1BM9A 5E1XA 5D4RA 3P9KA 4AIJA 2BBYA 5DCFA 2DI3A 1Z91A 4BHPA 3MWMA 4BAYA 4HZFA 1YFHA 6PAXA 5DEQA 1HSJA 4LFUA 1R22A 4P55A 4G9YA 3R4KA 4YFNF 3F21A 1BC8C 2H09A 1IF1A 3PQKA 4MQVA 3WGHA 3HSFA 4A0YA 2RC4A 1GXQA 2AXLA 5HDNA 4LK0F 5LRRA 3K69A 1IN7A 1MJ9A 2L4AA 4KMUX 2A07F 1FZPB 3WTSC 1P2FA 4G6QA 2ZJ2A 1ZARA 2EFNA 1IN8A 2RNJA 5FD6A 4L18B 4U0VA 2H94A 2LF8A 2ZMEA 3BZ6A 3N4MA 4EJWA 2EA4A 4CO8A 3M9AA 3O2PE 2FNAA 3KLNA 2OQGA 2DQLA 2IJLA 2PN6A 1S7OA 2EJRA 3KEOA 1ZGAA 4OOIA 2RDPA 4XBFA 1RUNA 3MQ0A 4OIRF 2PG4A 4IVNA 5BMZA 2DO7A 4UVCA 2CQKA 1P92A 1S3JA 4HV5A 1HW1A 1XN7A 4I0AA 3KP3A 1IN4A 2OBPA 3DPLC 2FMLA 4KYWA 1MZBA 3FWEA 5D6FA 5DCMB 5FGMA 4UXNA 1LNWA 3GFJA 1AWCA 4U88A 3ZMSA 2F2EA 1O7LA 3GZ6A 5LLQA 1SD4A 1LEBA 2GIVA 3CUQB 1D3YA 1XGSA 4ENKA 1WSUA 5D4SA 3JAMZ 4I09A 2Q8KA 3GF2A 5LHIA 2NS0A 5E1WA 2DPDA 2IA2A 3ZMUA 1QZYA 2QM3A 3I4PA 3IWZA 4HLYA 4IJAA 5HVQC 2EA2A 4GYGA 2KRFA 1KQ9A 3SZTA 1DPUA 5FLXZ 1FY7A 1R36A 1IXRC 1H9TA 4BQAA 2RVCA 3V8JA 3WODF 5L3CA 5CVJA 2OZUA 1DP7P 1P4WA 3QP5A 1LDKB 4AWXB 1ZN2A 4P9UA 2KJBA 2WTEA 1SMTA 1W7PA 1G6NA 3B73A 3HTUA 3CTAA 2EFQA 4EM2A 4I0BA 4HAMA 1K78A 2Z99A 2D1VA 2VODA 2A69F 3VEPA 2HQNA 2Z33A 2JRTA 4L0ZB 2WWYA 5D5WB 5HOOA 5A2QK 4IRIA 1B59A 1BI0A 3FHZA 1UB9A 1Z7UA 1XSVA 3IL2A 4HQEA 4WX9A 1B4AA 3OOPA 4ETSA 5KK1A 5IT9K 2OAZA 3M8FA 1B9NA 4ENNA 1L3LA 2BE5F 4UV9A 2PBIA 4MQ9F 2LKPA 1T0FA 4U0WA 3HSRA 2Q2EA 3C3WA 2EV5A 4EGYA 3TOAA 2MA3A 1WQ2A 1TNSA 1J7KA 4O3MA 1MGTA 2YX7A 3P9CA 4I98B 2R7FA 4HF1A 3TDUC 4BHCA 1GHCA 3QP6A 4ZZDA 3T0YA 2V79A 1BC7C 3KCCA 2D2WA 4FX0A 3LQRA 3KP2A 1EH7A 4A5NA 5AONA 1LEAA 2FF4A 2PMHA 1RI7A 3NRVA 4A0ZA 1J59A 4NQWA 5LBQA 4UNOA 5CJ9A 4M9SA 2OQRA 3TKYA 2V6CA 1R1UA 3F6VA 5FO5A 5KVRA 5D8KB 4GGGA 4M9XA 1S8NA 2VN2A 4HX4A 2CYYA 3CO7C 2RN7A 1XMKA 4ZZLA 3DXJF 2ZMEB 2L4MA 3GO5A 2P6TA 3E3VA 2HFHA 1D8KA 3WTVC 3EQLF 4MTEA 3WTUC 1F5TA 2WV0A 2VC1A 3SHFA 2JPCA 1PP7U 2XVCA 1OPCA 1P4AA 4KFCA 4LG0B 2MD5A 3P7NA 2EK5A 5DUIA 1U5TC 2VT2A 1SD5A 3M7GA 2D1HA 3L7WA 1G3YA 5L3FA 1YIOA 1FSEA 5L3DA 4BYYA 2V1DA 2RV8A 5JI6A 5HS7A 5LGNA 4EV0A 3NEUA 5BOXA 3EYYA 2YPRA 2Z3YA 3HRMA 1ZH5A 1BI2A 5LEJA 1ZRCA 3V7RA 2W25A 2XAJA 3IWFA 4A12A 5HDGA 4LJZF 3BY6A 5DDGA 3ABUA 4TV7A 3BJ6A 4BHBA 3W6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBA A;  1TW3 A;  4AD9 A;  1MKM A;  4KIB A;  2IA0 A;  1R00 A;  1FYL A;  3TO9 A;  3FXU A;  3WU0 A;  5BPD A;  1FPQ A;  1IW7 F;  3JAM K;  3E6B A;  4HDV A;  2R7D A;  1XDU A;  3JTH A;  2FMY A;  3R0J A;  4EVI A;  3WE2 A;  1O57 A;  3HUG A;  4HX7 A;  3CDH A;  4PZJ A;  3TO6 A;  4EJT A;  3WTY C;  5DUK A;  1QNT A;  5HLH A;  3CJN A;  1PDN C;  4KMF A;  4KN4 X;  5FLX K;  4QWQ A;  3RKY A;  3QPT A;  1Z9C A;  2CW0 F;  1W7P B;  4ASN A;  1YG2 A;  1FX7 A;  1JHF A;  2VT3 A;  1KGS A;  1K78 B;  3HRT A;  4UVB A;  5BS6 A;  3C18 A;  3G73 A;  1BJA A;  5DYM A;  1XGN A;  2ZO4 A;  5J8C A;  1YS6 A;  2IP2 A;  2L3D A;  1QPM A;  2XAQ A;  3SZP A;  1R23 A;  4LGW A;  4RAY A;  1SD7 A;  1KU2 A;  1BN5 A;  2HQR A;  3RJP A;  2JZY A;  1XGM A;  1JGS A;  5DV5 A;  1ZRF A;  4ZH4 F;  1OKR A;  2NNN A;  5H6Q A;  4YIF A;  2KIU A;  4XSZ F;  2Z9O A;  4CGZ A;  3PQJ A;  4XLP F;  1KYZ A;  1OYI A;  2LF7 A;  5ICE A;  2NNY A;  3QPH A;  2XAS A;  1O7F A;  2K27 A;  1RIO H;  2LNB A;  4ZYE A;  5JFR A;  1BI1 A;  4GO1 A;  2ZKZ A;  4BH9 A;  3I71 A;  2E7W A;  4EJV A;  3KET A;  4G7H F;  3LWF A;  2FE3 A;  2ETH A;  3DEU A;  3GW2 A;  2FA5 A;  2VON A;  1QZZ A;  3D0S A;  3K1M A;  4D0P A;  5E1Z B;  2QWW A;  4RGX A;  3FM5 A;  2HTS A;  3LA2 A;  1K7A A;  2PEX A;  3T1B A;  2KJC A;  1ZG1 A;  5D5X B;  4O6J A;  4F7Z A;  2ESH A;  4JQF A;  1JXS A;  3J80 Z;  1MDM A;  5FFX A;  3F72 A;  1HXD A;  2L02 A;  2DPU A;  1QO0 D;  1EH6 A;  4FX4 A;  2EFO A;  1F4K A;  3WG9 A;  3IHU A;  2HR3 A;  4L5I A;  3BPV A;  1EV7 A;  4LG0 A;  2M8E A;  1HST A;  2V1U A;  1I27 A;  1V3F A;  2VBX A;  2QLZ A;  4ENM A;  2P5K A;  4G6D A;  3WE3 A;  4G8X A;  4MEY F;  3E5X A;  1BIA A;  4I01 A;  3KP4 A;  1J0R A;  2CG4 A;  3B02 A;  3E97 A;  4P9F A;  4CYD A;  2M1B A;  2HDC A;  1TW2 A;  4KT5 C;  4EMS A;  1HKS A;  4CDG A;  2GA1 A;  4Q5S F;  3WTW C;  5LRS A;  5FB2 A;  1S6L A;  4R79 A;  1MD0 A;  1R5G A;  1USS A;  3GWZ A;  2PI0 A;  2DK8 A;  4KIF A;  2DU9 A;  5D5U B;  3ZN0 A;  2DQR A;  2PLY A;  3KFW X;  1W7P D;  2YSR A;  5K5O A;  3WU1 B;  3T8T A;  3F23 A;  2QYO A;  2R3S A;  2DT5 A;  4S04 A;  3JSO A;  4HF2 A;  3K1P A;  3GLX A;  3F8M A;  2EV6 A;  4LMY A;  4HYE A;  1XB4 A;  5JHU A;  1TBX A;  2BV6 A;  4DNC A;  1C0W A;  2JPB A;  2PFB A;  2HGC A;  2F5D A;  1T2K A;  1DPR A;  3KP7 A;  2A6E F;  2HYF A;  3P9I A;  2EFP A;  3J81 Z;  3TOB A;  2TDX A;  4Q47 A;  2P8T A;  2VXZ A;  4OIP F;  4ZYH A;  1ZGJ A;  3FXQ A;  2HWV A;  2ADU A;  2MLG A;  1OYY A;  1V4R A;  3FMQ A;  3GFI A;  2O8X A;  1BBY A;  1HQC A;  2PMU A;  3ML6 A;  3ELK A;  3CUQ C;  3FXR A;  3MZY A;  1G3S A;  2RQP A;  2FBK A;  4MHG A;  1KU7 A;  3FM3 A;  3LAP A;  3BDD A;  4ESJ A;  1XDS A;  2FRH A;  3F3X A;  2A61 A;  5AIQ A;  5ICG A;  4I2O A;  4RGU A;  4A5M A;  4PCQ A;  1JHH A;  3KEQ A;  3EDP A;  1UCR A;  1TQI A;  5EEG A;  2XHK A;  2K7L A;  2MBF A;  2NAZ A;  4N9H A;  3DF8 A;  1HW2 A;  3KE2 A;  1G3T A;  4WCG A;  1ON1 A;  4M71 A;  4EGZ A;  2HEO A;  3C1D A;  2RGV A;  3L9F A;  3ZMT A;  3KP6 A;  3KZZ A;  4L9N A;  4YG2 F;  4EJU A;  3E5Q A;  1J75 A;  4KIG A;  2FSW A;  1ZLJ A;  2LDU A;  4ENJ A;  1P4X A;  4HOB A;  2F5C A;  4RB1 A;  4FT8 A;  2A5Y B;  4A0X A;  1FBU A;  1FYK A;  3SXY A;  5E20 A;  1XD7 A;  2HOE A;  3HYI A;  3LA7 A;  4WXC A;  1ZHF A;  3RI4 A;  4I02 A;  3FMS A;  5AIP A;  4U7B A;  4I7H A;  5CVU A;  1R5H A;  5F64 A;  3CLO A;  4FHT A;  4HW0 A;  3DPT A;  1REP C;  5K5R A;  3HHG A;  3H3Z A;  3I59 A;  3CO6 C;  3K0L A;  4N9I A;  3RKW A;  1P6R A;  1H0M A;  1MDM B;  1IAW A;  3RYR A;  1TQM A;  2CO5 A;  2FU4 A;  3GUD A;  3K2Z A;  3W6K B;  3T8R A;  4N0B A;  4KA4 A;  3J80 K;  1UHM A;  5E18 F;  1LDJ A;  3IC7 A;  3HOT A;  3WTZ A;  2O6G E;  3GEZ A;  4M72 A;  2QZ8 A;  4E70 A;  4QLC U;  2KIM A;  1D8J A;  1ZLK A;  1Z6T A;  2VOO A;  1XGO A;  1FP1 D;  4AIH A;  2FNP A;  1R1T A;  3KZY A;  4IRH A;  4RGS A;  1B6A A;  1XMA A;  3ECH A;  4K2E A;  2CWE A;  3M8E A;  5D5V B;  4XRF A;  3I58 A;  4BXU A;  1FWZ A;  3LFK A;  2PQ8 A;  3D5L A;  2W24 A;  1KQ0 A;  3ISP A;  2X4H A;  5ED4 A;  2QQB A;  4HV6 A;  2QBY A;  2F5F A;  3BPX A;  1FBQ A;  2ZNY A;  3GZ5 A;  4DQ2 A;  4IRG A;  2E7X A;  1I1S A;  1HKT A;  3COA C;  1IRF A;  3LA3 A;  3E6D A;  1W4M A;  3HRS A;  3WGG A;  1S29 A;  1ON2 A;  4MTD A;  4B8X A;  3I64 A;  2K86 A;  4ZYG A;  1B9M A;  2VBY A;  3ZQ7 A;  5ICC A;  1SD6 A;  2CGP A;  1W5T A;  3ZPL A;  3IKT A;  2UZK A;  2LSO A;  3WGI A;  1ZYR F;  2QUF A;  2H27 A;  5K1Y A;  3ERE D;  1PUE E;  1X3U A;  3QOP A;  2FQ3 A;  2XAF A;  4LD5 A;  3N97 A;  3F8F A;  3BOQ A;  3RKX A;  2BYV E;  4UV8 A;  2ZFW A;  2K4J A;  2HYG D;  1WWX A;  3JW4 A;  4NB5 A;  3ZP5 A;  1KU3 A;  3RPQ A;  1MJA A;  3J81 K;  3J7A O;  4LLG F;  1IN6 A;  2COM A;  3JSP A;  4MEX F;  1RNL A;  1J9I A;  4OMY A;  1ZG3 A;  1R1V A;  5E17 F;  3ULQ B;  4WWC A;  2WC2 A;  4RS8 A;  2MH2 A;  2MC3 A;  3L00 A;  4HBL A;  2P5V A;  2DTR A;  3DFG A;  4S05 A;  3E6M A;  3K9T A;  2ISZ A;  2DBB A;  2NRA C;  5ILU A;  1OYW A;  2W85 A;  2P4W A;  2O03 A;  2JSC A;  3HSE A;  3V7C A;  2XV4 S;  2Y0M A;  4LB6 B;  4CXF A;  1U2W A;  5L3E A;  3L09 A;  4WF2 A;  5ILV A;  4EQQ A;  4JK1 X;  3HOS A;  3E5U A;  4OIN F;  3ZN1 A;  1IN5 A;  2VE8 A;  2GXB A;  4UHT A;  3JTG A;  2ELH A;  2JT1 A;  1YW7 A;  3O6B B;  2V9V A;  4M73 A;  1MJB A;  1O3R A;  2QVO A;  2DW4 A;  4P96 A;  3R0A A;  3U2R A;  3R6S A;  2E1N A;  4RB0 A;  4RAZ A;  3V8L A;  4U0Y A;  1K79 A;  3ABT A;  3I53 A;  1UHW A;  2KIF A;  1I1G A;  2W84 A;  2BGC A;  3TGN A;  3R60 A;  5J8F A;  3LQQ A;  3GVA A;  3M1E A;  1TQP A;  1SFE A;  2O61 A;  2ZBK A;  1I6X A;  2A68 F;  1STZ A;  2A6H F;  3IRQ A;  2M30 A;  3U9G A;  4HDU A;  3QAH A;  1U5T A;  4YFX F;  2GQQ A;  1XSD A;  5L3G A;  1FNN A;  1JE8 A;  4RB3 C;  1FT9 A;  3TDZ C;  2MH9 A;  5LHG A;  1YW9 A;  2DFI A;  2XUB A;  2VBW A;  4IHS A;  1ONV A;  1ZG5 A;  4OIO F;  3VOD A;  3SFZ A;  4OU0 A;  2AS5 F;  2ZXJ A;  3I59 B;  1GXP A;  2YU3 A;  1Y0U A;  4HA8 A;  3F8B A;  2UXN A;  4Q48 A;  1E2X A;  3QU3 A;  1B1B A;  3VB2 A;  1G3W A;  2IPQ X;  2NYX A;  2XRO A;  4PGH A;  1VTN C;  1J2X A;  1K6O A;  1T6S A;  1ZRD A;  1IXS B;  4IHT A;  3RDI A;  3Q5F A;  4B09 A;  2VE9 A;  1LDD A;  3F8C A;  5CLS A;  4KIC A;  1CGP A;  2IW5 A;  5IT3 A;  3KLO A;  5E8G A;  4RB2 C;  3MCZ A;  5L3B A;  3GX4 X;  1RUO A;  4HQM A;  1F1Z A;  4WXD A;  1Z1D A;  3DKW A;  2HKX A;  4M6Y A;  4HLX A;  1HBX G;  4MGR A;  3MAJ A;  4U7D A;  2CFX A;  2G7U A;  1FSH A;  4WXH A;  4GXO A;  2MLK A;  2QBY B;  2G9W A;  3F6O A;  4A6D A;  2XRN A;  2H6B A;  3H92 A;  4IF4 A;  4KN7 X;  3FMR A;  5D6E A;  3V4G A;  1FYM A;  1TLH B;  1U8R A;  3KP5 A;  4G7Z F;  3GFL A;  1Z6R A;  1HW5 A;  1LJ9 A;  3QU6 A;  1KYW A;  1YS7 A;  1FLI A;  3VOE A;  1ZAO A;  3ROU A;  4OIQ F;  4NHJ A;  2P6S A;  1WKM A;  1T98 A;  3MZH A;  3QRF F;  2IRF G;  5LGT A;  1Q1H A;  1ODD A;  4AIK A;  1IUY A;  1CF7 A;  4LK1 F;  1FBS A;  5HLG A;  3ECO A;  1HKQ A;  1ULY A;  3MFK A;  4KNY A;  2FBI A;  2KKO A;  5DD8 A;  1U3E M;  4IXA A;  3FF5 A;  2VC0 A;  1EH8 A;  3DV8 A;  5BPI A;  1SMY F;  5HS8 A;  3VFZ A;  2IVM A;  2G7H A;  4UUV A;  2GA2 A;  2P7V B;  2W57 A;  4UVA A;  3REO A;  4M9Z A;  2V1X A;  5D8L B;  5CYV A;  3V8K A;  4ESF A;  2FBH A;  2OA4 A;  3MEX A;  5HDK A;  3EET A;  3S2W A;  1XCV A;  1XCB A;  1IXC A;  3OV8 A;  2Z5U A;  3NQO A;  3PFI A;  2FXA A;  2HKO A;  5F6F A;  3DP7 A;  2QQ9 A;  1BOA A;  3FX3 A;  5DD4 A;  3TQN A;  1AOY A;  1LVA A;  2JTV A;  3CUO A;  3T5X A;  2OZ6 A;  4LLL A;  3G3Z A;  4BNC A;  1YYV A;  4ZYD A;  4A6E A;  4YII A;  5ICF A;  2FOK A;  2P5L C;  3R61 A;  1A04 A;  3F8N A;  4Y13 A;  1R58 A;  5FFZ A;  5JR3 A;  1E17 A;  3IRR A;  3RPU A;  1NHA A;  5EEH A;  2J5O A;  4L9T A;  1WRJ A;  4EJO A;  1DUX C;  1WI9 A;  5TRD A;  2XIG A;  2DAO A;  2ISY A;  3LST A;  4L5J A;  1UST A;  2B0L A;  3RIR A;  3FZV A;  4AVP A;  2ESN A;  3EYI A;  2UXX A;  4WK8 F;  1F9N A;  2IA1 A;  2QQA A;  1O3Q A;  2D45 A;  3HIF A;  2OU2 A;  1U5T B;  4LB5 A;  5K5Q A;  4YFK F;  4GYI A;  3WTX C;  1KA8 A;  5FD5 A;  2E1C A;  3HRU A;  1BI3 A;  1I5Z A;  5J6X A;  1U78 A;  2M87 A;  4M6X A;  1T38 A;  1O3T A;  2F5E A;  2STT A;  1ZRE A;  3HTS B;  4P5O A;  1XSX A;  4GCV A;  2YR2 A;  5CVI A;  2RKH A;  4L9J A;  1Z05 A;  2BEO A;  4G94 A;  2GXG A;  4PGG A;  1IRG A;  4OMZ A;  1SFU A;  1FP2 A;  3K1N A;  5HLI A;  1O3S A;  4RGR A;  1H9G A;  4ON0 A;  2C6Y A;  2IT0 A;  2VOP A;  2EB7 A;  2STW A;  2GAU A;  1FOK A;  1SFX A;  4R1H A;  3WTT C;  5ERI A;  1S7A A;  1SAX A;  4XSX F;  5LEK A;  4HF0 A;  5DCM A;  4EM0 B;  1QGP A;  1U6G A;  2O3F A;  4CIC A;  2K4B A;  3I54 A;  5BQT A;  4M74 A;  1IZ1 A;  1DDN A;  1YLF A;  3Q9V A;  5HS9 A;  2ZNZ A;  3RYP A;  2A3S A;  1W5S A;  4HX8 A;  4Y17 A;  3I0T A;  2DK5 A;  5CVR A;  2VBZ A;  3CUQ A;  3L2C A;  4L0Y B;  2HTJ A;  3RTR A;  2GWR A;  3LAJ A;  4MNU A;  1YQA A;  2L54 A;  2Y48 A;  4R8H A;  2J5P A;  1BIB A;  3AAF A;  4CHU A;  2M5W A;  5LGU A;  1TTY A;  3BP8 A;  3F22 A;  3BJO A;  1QBJ A;  1CF7 B;  4Y15 A;  3TO7 A;  1L0O C;  3IKV A;  5JVT A;  2Y75 A;  2OD5 A;  4XLN F;  5H20 A;  3HHH A;  3BRO A;  2CSO A;  1LB2 A;  2HS5 A;  5H6R A;  4LLN A;  2XKP A;  4Q4Z F;  2XGX A;  3C7J A;  1G4D A;  3BJA A;  4ESB A;  3SQN A;  1D5V A;  3GXO A;  3Q9S A;  2O0Y A;  3I5U A;  4Z2Y A;  2H6C A;  3BWG A;  5LHH A;  2ZCW A;  2YX4 A;  4L9V A;  4O5V A;  5F1R A;  3ZMD A;  2EV0 A;  2P7C B;  2X0L A;  3E6C C;  1GVJ A;  5ILS A;  1UFM A;  2XAH A;  2Q0O A;  5A2Q Z;  4H0E A;  2M45 A;  4IPA A;  4KUM A;  3GFM A;  2HZT A;  5IT9 Z;  2FEZ A;  2XKO A;  5TJJ A;  1TNT A;  3GYH X;  1OR7 A;  4G7O F;  3EUH A;  3ZMZ A;  2XAG A;  3U1D A;  1LQ1 A;  1KU9 A;  1J5Y A;  2GZW A;  4EM1 A;  1YO5 C;  2K02 A;  3ZMV A;  1OMI A;  3H3U A;  2QEN A;  1YTY A;  2ACJ A;  1FC3 A;  2EFW A;  4KDP A;  5CVV A;  2EWN A;  1RZ4 A;  4A2U A;  2L01 A;  1T39 A;  1R7J A;  3V7S A;  1PP8 F;  2DLL A;  1QQI A;  4PDK A;  2UWM A;  3O3K A;  1YW8 A;  4CZZ A;  3DQV C;  1KQ8 A;  5E8I A;  2PJP A;  1BM9 A;  5E1X A;  5D4R A;  3P9K A;  4AIJ A;  2BBY A;  5DCF A;  2DI3 A;  1Z91 A;  4BHP A;  3MWM A;  4BAY A;  4HZF A;  1YFH A;  6PAX A;  5DEQ A;  1HSJ A;  4LFU A;  1R22 A;  4P55 A;  4G9Y A;  3R4K A;  4YFN F;  3F21 A;  1BC8 C;  2H09 A;  1IF1 A;  3PQK A;  4MQV A;  3WGH A;  3HSF A;  4A0Y A;  2RC4 A;  1GXQ A;  2AXL A;  5HDN A;  4LK0 F;  5LRR A;  3K69 A;  1IN7 A;  1MJ9 A;  2L4A A;  4KMU X;  2A07 F;  1FZP B;  3WTS C;  1P2F A;  4G6Q A;  2ZJ2 A;  1ZAR A;  2EFN A;  1IN8 A;  2RNJ A;  5FD6 A;  4L18 B;  4U0V A;  2H94 A;  2LF8 A;  2ZME A;  3BZ6 A;  3N4M A;  4EJW A;  2EA4 A;  4CO8 A;  3M9A A;  3O2P E;  2FNA A;  3KLN A;  2OQG A;  2DQL A;  2IJL A;  2PN6 A;  1S7O A;  2EJR A;  3KEO A;  1ZGA A;  4OOI A;  2RDP A;  4XBF A;  1RUN A;  3MQ0 A;  4OIR F;  2PG4 A;  4IVN A;  5BMZ A;  2DO7 A;  4UVC A;  2CQK A;  1P92 A;  1S3J A;  4HV5 A;  1HW1 A;  1XN7 A;  4I0A A;  3KP3 A;  1IN4 A;  2OBP A;  3DPL C;  2FML A;  4KYW A;  1MZB A;  3FWE A;  5D6F A;  5DCM B;  5FGM A;  4UXN A;  1LNW A;  3GFJ A;  1AWC A;  4U88 A;  3ZMS A;  2F2E A;  1O7L A;  3GZ6 A;  5LLQ A;  1SD4 A;  1LEB A;  2GIV A;  3CUQ B;  1D3Y A;  1XGS A;  4ENK A;  1WSU A;  5D4S A;  3JAM Z;  4I09 A;  2Q8K A;  3GF2 A;  5LHI A;  2NS0 A;  5E1W A;  2DPD A;  2IA2 A;  3ZMU A;  1QZY A;  2QM3 A;  3I4P A;  3IWZ A;  4HLY A;  4IJA A;  5HVQ C;  2EA2 A;  4GYG A;  2KRF A;  1KQ9 A;  3SZT A;  1DPU A;  5FLX Z;  1FY7 A;  1R36 A;  1IXR C;  1H9T A;  4BQA A;  2RVC A;  3V8J A;  3WOD F;  5L3C A;  5CVJ A;  2OZU A;  1DP7 P;  1P4W A;  3QP5 A;  1LDK B;  4AWX B;  1ZN2 A;  4P9U A;  2KJB A;  2WTE A;  1SMT A;  1W7P A;  1G6N A;  3B73 A;  3HTU A;  3CTA A;  2EFQ A;  4EM2 A;  4I0B A;  4HAM A;  1K78 A;  2Z99 A;  2D1V A;  2VOD A;  2A69 F;  3VEP A;  2HQN A;  2Z33 A;  2JRT A;  4L0Z B;  2WWY A;  5D5W B;  5HOO A;  5A2Q K;  4IRI A;  1B59 A;  1BI0 A;  3FHZ A;  1UB9 A;  1Z7U A;  1XSV A;  3IL2 A;  4HQE A;  4WX9 A;  1B4A A;  3OOP A;  4ETS A;  5KK1 A;  5IT9 K;  2OAZ A;  3M8F A;  1B9N A;  4ENN A;  1L3L A;  2BE5 F;  4UV9 A;  2PBI A;  4MQ9 F;  2LKP A;  1T0F A;  4U0W A;  3HSR A;  2Q2E A;  3C3W A;  2EV5 A;  4EGY A;  3TOA A;  2MA3 A;  1WQ2 A;  1TNS A;  1J7K A;  4O3M A;  1MGT A;  2YX7 A;  3P9C A;  4I98 B;  2R7F A;  4HF1 A;  3TDU C;  4BHC A;  1GHC A;  3QP6 A;  4ZZD A;  3T0Y A;  2V79 A;  1BC7 C;  3KCC A;  2D2W A;  4FX0 A;  3LQR A;  3KP2 A;  1EH7 A;  4A5N A;  5AON A;  1LEA A;  2FF4 A;  2PMH A;  1RI7 A;  3NRV A;  4A0Z A;  1J59 A;  4NQW A;  5LBQ A;  4UNO A;  5CJ9 A;  4M9S A;  2OQR A;  3TKY A;  2V6C A;  1R1U A;  3F6V A;  5FO5 A;  5KVR A;  5D8K B;  4GGG A;  4M9X A;  1S8N A;  2VN2 A;  4HX4 A;  2CYY A;  3CO7 C;  2RN7 A;  1XMK A;  4ZZL A;  3DXJ F;  2ZME B;  2L4M A;  3GO5 A;  2P6T A;  3E3V A;  2HFH A;  1D8K A;  3WTV C;  3EQL F;  4MTE A;  3WTU C;  1F5T A;  2WV0 A;  2VC1 A;  3SHF A;  2JPC A;  1PP7 U;  2XVC A;  1OPC A;  1P4A A;  4KFC A;  4LG0 B;  2MD5 A;  3P7N A;  2EK5 A;  5DUI A;  1U5T C;  2VT2 A;  1SD5 A;  3M7G A;  2D1H A;  3L7W A;  1G3Y A;  5L3F A;  1YIO A;  1FSE A;  5L3D A;  4BYY A;  2V1D A;  2RV8 A;  5JI6 A;  5HS7 A;  5LGN A;  4EV0 A;  3NEU A;  5BOX A;  3EYY A;  2YPR A;  2Z3Y A;  3HRM A;  1ZH5 A;  1BI2 A;  5LEJ A;  1ZRC A;  3V7R A;  2W25 A;  2XAJ A;  3IWF A;  4A12 A;  5HDG A;  4LJZ F;  3BY6 A;  5DDG A;  3ABU A;  4TV7 A;  3BJ6 A;  4BHB A;  3W6J B; 
#chains in the Genus database with same CATH topology
 3FKJ A;  4JBA A;  1TW3 A;  4AD9 A;  1MKM A;  4CCJ A;  4KIB A;  2LOO A;  2M2E A;  4D7M A;  3BTI A;  3CDI A;  2IA0 A;  1R00 A;  2XF6 A;  3SZG A;  3NWS A;  1FYL A;  3TO9 A;  3FXU A;  3WU0 A;  3HL2 A;  5BPD A;  2DT6 A;  4AID A;  1FPQ A;  1IW7 F;  3ZQH A;  4KIS A;  3KIO A;  2DJN A;  1WJA A;  2CJJ A;  2M7A A;  3MKL A;  3JAM K;  1T8I A;  3E6B A;  4HDV A;  2CU7 A;  3DCF A;  2R7D A;  1I3Q J;  3GTM J;  1POG A;  1XDU A;  4Z6Y A;  1ETK A;  2W00 A;  4C30 A;  3JTH A;  2FMY A;  3R0J A;  4EVI A;  3K4M A;  3WE2 A;  1H88 C;  1O57 A;  3HUG A;  4HX7 A;  3CDH A;  4PZJ A;  5EYR A;  3TO6 A;  4B47 A;  5E3N A;  2BVM A;  3OYN A;  4EJT A;  3WTY C;  3LFU A;  5DUK A;  1JGG A;  1QNT A;  5HLH A;  3A2K A;  3CJN A;  1PDN C;  1B8I A;  4KMF A;  2EIK H;  4KN4 X;  4AUX A;  5FLX K;  4QWQ A;  3RKY A;  2VQL A;  3DU5 A;  1HOM A;  3QPT A;  1P9Q C;  2MW8 A;  1Z9C A;  2JRM A;  1VQ5 I;  3ONQ A;  2CW0 F;  1W7P B;  2WV1 A;  3KPH A;  5F04 A;  4ASN A;  4FIS A;  1YG2 A;  4V2G A;  1FX7 A;  3QOD A;  1JHF A;  2VT3 A;  1KGS A;  1VI0 A;  1S9H A;  1K78 B;  2MVT A;  1XS9 A;  3HRT A;  4F52 A;  4UVB A;  3U1K A;  5BS6 A;  3C18 A;  2VI6 A;  3LSR A;  2X98 A;  2M3A A;  3G73 A;  5M5X J;  1BJA A;  1QHH D;  2CUJ A;  1J09 A;  2LG4 A;  5DYM A;  1XGN A;  2ZO4 A;  5J8C A;  2HVR A;  1YS6 A;  4MFD A;  2IP2 A;  2L3D A;  1QPM A;  2XAQ A;  2Y69 H;  3SZP A;  1GDT A;  1R23 A;  4LGW A;  4RAY A;  2I10 A;  4A3L J;  3S3N A;  1SD7 A;  3RQI A;  2IGM A;  1UZC A;  3EUK L;  3OS1 A;  1KU2 A;  1BN5 A;  2E5N A;  2HQR A;  2LY2 A;  3RJP A;  2JZY A;  1XGM A;  1JGS A;  2P0W A;  5DV5 A;  1ZRF A;  1Y0N A;  4ZH4 F;  5E79 C;  1OKR A;  2NNN A;  4XOP A;  5H6Q A;  1Z67 A;  2DTZ A;  3G6E I;  2KIS A;  3HGY A;  4RBO A;  1B72 B;  3HJE A;  4YIF A;  1MMS A;  3MMY B;  2KIU A;  2HPI A;  4XSZ F;  2CV1 A;  3LSH A;  2Z9O A;  1Y1W J;  4CGZ A;  4G12 A;  3OYD A;  2JA7 J;  3PQJ A;  1TP4 A;  2HYJ A;  3QPL A;  3CC7 I;  2ELK A;  4XLP F;  1KYZ A;  1OYI A;  2LF7 A;  4XRS G;  5ICE A;  1OIS A;  3OOU A;  3FKI J;  1D1C A;  2NNY A;  3AG3 H;  3QPH A;  3S17 J;  2XAS A;  1W0T A;  1E0E A;  1O7F A;  4NUB A;  4ZC3 A;  2K27 A;  1D0X A;  1YJW I;  4A3B J;  1RIO H;  2LNB A;  4ZYE A;  5JFR A;  2HXO A;  2V7F A;  2CW8 A;  4FE7 A;  1MBF A;  3GME A;  2JVH A;  1BI1 A;  4GO1 A;  2AHQ A;  2ZKZ A;  4BH9 A;  3I71 A;  2DCE A;  2E7W A;  4EJV A;  4FET A;  3QPS A;  3KET A;  3K4B A;  4G7H F;  3U21 A;  1LFP A;  2EIM H;  1O4X A;  2DA5 A;  2FE3 A;  3LWF A;  2ETH A;  2W4S A;  3DEU A;  3GW2 A;  2FA5 A;  2RRE A;  2VON A;  1QZZ A;  3A52 A;  3D0S A;  3K1M A;  4D0P A;  5E1Z B;  4XRM A;  4NQW B;  2KHM A;  2QWW A;  4ZTJ A;  2QSG X;  4RGX A;  3I4M J;  1BOB A;  2E1O A;  4E7H A;  3FM5 A;  4LIT A;  4PJL A;  2HTS A;  3LA2 A;  5B5E C;  1SFK A;  1K7A A;  2PEX A;  3T1B A;  2L9S A;  3L2U A;  2KJC A;  2W82 A;  3SDG A;  1ZG1 A;  2XGE A;  2TCT A;  1MNE A;  5D5X B;  4O6J A;  4F7Z A;  2ESH A;  4JQF A;  4B3A A;  2XPV A;  2OPT A;  1JXS A;  3J80 Z;  1MDM A;  2EIL H;  1V55 H;  2X9D A;  3RZD J;  3H35 A;  5FFX A;  3F72 A;  3ZGK A;  1QZE A;  1HXD A;  2L02 A;  2HQA A;  1ZGW A;  2DPU A;  1QO0 D;  1WH5 A;  1EH6 A;  4FX4 A;  2G0E A;  3ERM A;  4GRI A;  3A4C A;  2EFO A;  3CCE I;  1F4K A;  3WG9 A;  1VQM I;  3AL0 C;  1GV2 A;  3IHU A;  3HOU J;  1G59 A;  1X4O A;  2HR3 A;  4L5I A;  3BPV A;  4A3K J;  4HSR A;  1EV7 A;  4LG0 A;  2M8E A;  1HST A;  4D5F A;  1TL8 A;  2V1U A;  1I27 A;  1V3F A;  3HZJ A;  5FKM A;  4C3H J;  3GTJ J;  2O8K A;  2VBX A;  1OCT C;  4ITV A;  2QLZ A;  2P0T A;  4XKB A;  4J00 A;  5J1Y A;  2X1D A;  3KYD B;  5GAE J;  4ENM A;  2P5K A;  3MN2 A;  1W0U A;  4G6D A;  3WE3 A;  2K9M A;  2LBF A;  3K70 C;  2WB1 N;  4G8X A;  4E7I A;  4BGD A;  1GT0 C;  2DMQ A;  4MEY F;  5CQG A;  3E5X A;  2LY1 A;  1BIA A;  5DS9 A;  1NG6 A;  3CQZ J;  4I01 A;  3KP4 A;  1J0R A;  2CG4 A;  3B02 A;  3E97 A;  4P9F A;  5CQE A;  2X51 A;  4CYD A;  2M1B A;  4GFB A;  2HDC A;  3ZQG A;  2X6X A;  1Y6I A;  1TW2 A;  4KT5 C;  4EMS A;  1Y8Q B;  1HKS A;  1FIA A;  2GA1 A;  1ETO A;  4CDG A;  4Q5S F;  3WTW C;  5A2Q R;  5LRS A;  3ZRG A;  5FB2 A;  1S6L A;  3LSK A;  4R79 A;  1MD0 A;  2PMZ A;  2ZJQ F;  1R5G A;  2XDV A;  2DA4 A;  1FOX A;  1USS A;  3GWZ A;  3PIO F;  1WCM J;  5F1J A;  2BY0 A;  2PI0 A;  2DK8 A;  2LR8 A;  2CUF A;  1YE9 A;  1AA7 A;  4KIF A;  5GPA A;  3IUO A;  1BA5 A;  2DU9 A;  4BQQ A;  3ZN0 A;  5D5U B;  2M7B A;  2DQR A;  2PLY A;  3CCR I;  3S3M A;  3KFW X;  3IH4 A;  4D1Q A;  1W7P D;  2YSR A;  1F36 A;  2R7T A;  5K5O A;  3WU1 B;  4XR6 A;  3T8T A;  1OCO H;  3F23 A;  2IEK A;  2QYO A;  2R3S A;  2DT5 A;  4S04 A;  3HKZ N;  3TW6 A;  3JSO A;  4HF2 A;  3K1P A;  2YS9 A;  3GLX A;  5GAD J;  3F8M A;  2EV6 A;  4F93 B;  4LMY A;  2F4O B;  3C2B A;  4HYE A;  1XB4 A;  1XMX A;  5JHU A;  4RLF A;  1TBX A;  1WFX A;  2CW7 A;  3EUA A;  3L2Q A;  1WJB A;  2BV6 A;  4DNC A;  1C0W A;  3QYB A;  2JPB A;  2PFB A;  3ESW B;  2HGC A;  4E6K G;  2F5D A;  3CP2 A;  4HPQ A;  1T2K A;  1N25 A;  1DPR A;  3KP7 A;  3OR2 C;  2ME6 A;  3LSM A;  5IYD J;  4PSW A;  2A6E F;  2HYF A;  3P9I A;  4Y3O A;  3CMM A;  2EFP A;  3J81 Z;  2DOF A;  4N4O B;  4JOM A;  3TOB A;  1R9T J;  4IHY A;  2TDX A;  5J47 A;  4CCM A;  4Q47 A;  2P8T A;  2VXZ A;  1XPX A;  4OIP F;  4L5E A;  3S2D J;  2M9H A;  4ZYH A;  3MD2 A;  3VPR A;  1ZGJ A;  3A1Y A;  5EEA A;  3HUG B;  3FXQ A;  3FHN A;  4U87 A;  2HWV A;  3OYJ A;  2ADU A;  2MLG A;  3TMO A;  1OYY A;  1V4R A;  1B8I B;  3FMQ A;  3GFI A;  1HDD C;  2KZG A;  3OS2 A;  2O8X A;  1BBY A;  1HQC A;  2PMU A;  3ML6 A;  1APL C;  3BR1 A;  4IX7 A;  2DA7 A;  3DU6 A;  3OYG A;  3ELK A;  2FQ4 A;  3CUQ C;  3FXR A;  3MZY A;  1FTZ A;  1G3S A;  1SVO A;  2LRE A;  2RQP A;  5EZG A;  4UB6 C;  2FBK A;  1ITY A;  4MHG A;  1KU7 A;  3OYK A;  1RKW A;  3FM3 A;  3LAP A;  3BDD A;  3H0G J;  5DM7 F;  4ESJ A;  1XDS A;  1Y39 A;  2FRH A;  4BS9 A;  1PUF B;  3FIW A;  3F3X A;  2A61 A;  4A93 J;  5AIQ A;  5ICG A;  4I2O A;  4RGU A;  3GTK J;  4A5M A;  4BBS J;  4PCQ A;  1JHH A;  3KEQ A;  3TW7 A;  3DEE A;  3EDP A;  3DLA A;  1UCR A;  5EDN A;  1TQI A;  5EEG A;  4XIC A;  1T08 B;  1JKR C;  2XHK A;  2K7L A;  2MGQ A;  2MBF A;  2NAZ A;  3CF2 A;  1VQ9 I;  3CJT B;  4HNT A;  1U0J A;  1W5C C;  5J3L A;  2KDZ A;  4N9H A;  3DF8 A;  1PJR A;  3H3V K;  1A35 A;  1HW2 A;  3NWT A;  3CC4 I;  2VQC A;  3KE2 A;  2GXA A;  3BR6 A;  4XLC A;  4LG3 A;  2X1E A;  1G3T A;  4WCG A;  1ON1 A;  4M71 A;  2BW3 A;  4EGZ A;  2ZXW H;  1ZR2 A;  2BY1 A;  2CFO A;  2HEO A;  3C1D A;  1MBG A;  4ZDO A;  2E2J J;  4PJ0 C;  3OL3 A;  2RGV A;  2VJ5 A;  2X48 A;  3L9F A;  1N77 A;  2LP0 A;  3ZMT A;  3KP6 A;  3KZZ A;  4L9N A;  5IYB J;  1IG7 A;  4FE4 A;  4YG2 F;  4EJU A;  1W36 C;  1FTT A;  1DU6 A;  3E5Q A;  2WAF A;  1J75 A;  4KIG A;  2FSW A;  1ZLJ A;  4AM3 A;  2LDU A;  4ENJ A;  1P4X A;  1EA3 A;  2AQE A;  4HOB A;  2E36 A;  2F5C A;  4YEJ A;  4BXF A;  3UKG A;  1WJC A;  4RB1 A;  4FT8 A;  2LK2 A;  2R4G A;  1OCP A;  2A5Y B;  2TRT A;  4A0X A;  1FBU A;  1UG0 A;  4XON A;  1VQ7 I;  1FYK A;  3SXY A;  4E7S A;  4FAS D;  2WA0 A;  5E20 A;  3RSN A;  1XD7 A;  2HOE A;  5KAI C;  1OR7 C;  1FOW A;  3EUH C;  3HYI A;  3LA7 A;  4WXC A;  2HDW A;  1ZHF A;  3RI4 A;  4NBQ A;  3PO3 J;  1FMV A;  3J7Z I;  4I02 A;  2W48 A;  3AG4 H;  3FMS A;  5AIP A;  1I6H J;  4U7B A;  4I7H A;  3DKY A;  5CVU A;  1R5H A;  2LH9 A;  5F64 A;  3CLO A;  2IS1 A;  4FHT A;  4HW0 A;  3DPT A;  1REP C;  4PK4 A;  2CQX A;  5K5R A;  3HHG A;  3SYT A;  5HNH A;  3HPH A;  1LFB A;  4V2F A;  2DDB A;  3H3Z A;  3I59 A;  3K4L A;  4BE0 A;  1JTY A;  2DMP A;  5M5Y J;  4ZDP A;  2DOD A;  1JKQ C;  4M3E A;  3CO6 C;  3MKY B;  3K0L A;  4N9I A;  3RKW A;  3SDB A;  1HA8 A;  1P6R A;  1YOV B;  4HST A;  2LVS A;  5B3S H;  1H0M A;  3HOW J;  1MDM B;  1IAW A;  3UR3 C;  3ZXS A;  3RYR A;  1TQM A;  3HOX J;  2CO5 A;  2H1K A;  2FU4 A;  3GUD A;  2CRG A;  3K2Z A;  2M0C A;  2M0M A;  3LSJ A;  3W6K B;  1S72 I;  3T8R A;  4N0B A;  4KA4 A;  3JRC A;  5EGO B;  3S16 J;  3J80 K;  1UHM A;  1XC5 A;  3A03 A;  5E18 F;  3FXO A;  1LDJ A;  3H9G A;  1VQ4 I;  3IC7 A;  4XNF A;  3HOT A;  5FLX R;  2AXT C;  3WTZ A;  5JLX A;  2O6G E;  3GEZ A;  4M72 A;  2QZ8 A;  4E70 A;  4QLC U;  3PJR A;  2KIM A;  1MW7 A;  2XB5 A;  1D8J A;  1ZLK A;  1Z6T A;  5J1U A;  2DJI A;  2VOO A;  1XGO A;  3S1M J;  3H9Q A;  1FP1 D;  4AIH A;  3BTL A;  2F4M B;  2FNP A;  1R1T A;  3KZY A;  4IRH A;  1EJ9 A;  4RGS A;  2XF5 A;  2VKE A;  1B6A A;  1R4M B;  1XMA A;  1T33 A;  2QQ8 A;  3ECH A;  4K2E A;  4UB8 C;  2LBF B;  2CWE A;  3M8E A;  4BBR J;  2EIJ H;  4XRF A;  5D5V B;  3I58 A;  1DQU A;  4BXU A;  2XSJ C;  1FWZ A;  3LFK A;  2PQ8 A;  1WJD A;  3D5L A;  2W24 A;  2I8D A;  2DFH A;  3OWT A;  1KQ0 A;  2K40 A;  3ISP A;  2X4H A;  5ED4 A;  2QQB A;  3TBI A;  4DZP A;  1JT6 A;  4HV6 A;  5K7Z A;  2QBY A;  2F5F A;  2IXS A;  3PL8 A;  1X4P A;  2ZME C;  2F6C A;  4NNJ A;  5C3E J;  5GTH C;  2NVX J;  3BPX A;  2E1M B;  1FBQ A;  1PVE A;  2ZNY A;  3GZ5 A;  3OYH A;  2R93 J;  2OJE D;  4DQ2 A;  4IRG A;  2E7X A;  1I1S A;  1HKT A;  3COA C;  1IRF A;  2FOW A;  3LA3 A;  4C3J J;  2VQH A;  3E6D A;  1W4M A;  3HRS A;  3WGG A;  3OIQ A;  4F91 B;  1S29 A;  2NXN B;  1K61 A;  1ON2 A;  5IYC J;  1V5G A;  2KFD A;  3BG9 A;  3Q3S A;  4MTD A;  3CC2 I;  4B8X A;  3I64 A;  2K86 A;  1MH3 A;  4AC0 A;  4ZYG A;  1B9M A;  2VBY A;  5B1B H;  3VYS B;  3ZQ7 A;  1G8X A;  2R5Y A;  5ICC A;  5DM6 F;  1I3A A;  2R7W A;  4RM3 A;  1SD6 A;  2CGP A;  1Q1V A;  1W5T A;  3ABL H;  3ZPL A;  3IKT A;  2UZK A;  2LSO A;  3WGI A;  1ZYR F;  4XL9 A;  2QUF A;  2H27 A;  5K1Y A;  3ERE D;  1PUE E;  1X3U A;  5DTD A;  3QOP A;  2FQ3 A;  2XAF A;  3OYM A;  2PJR A;  4LD5 A;  3Q0V A;  3N97 A;  3F8F A;  4RA2 A;  3BOQ A;  2VJ4 A;  3RKX A;  2BYV E;  3I3L A;  2X85 A;  2ZFW A;  4UV8 A;  1P7I A;  2ZB9 A;  2K4J A;  3PUF A;  1RR7 A;  1BL0 A;  2HYG D;  1WWX A;  3ZOB A;  1P7J A;  3JW4 A;  5M3F J;  4A3G J;  4NB5 A;  2WY8 Q;  3ZP5 A;  1KU3 A;  3BR0 A;  3RPQ A;  1MJA A;  1ENH A;  3J81 K;  3J7A O;  3CCV I;  3JCU C;  1IN6 A;  2COM A;  3ASO H;  4LLG F;  3JSP A;  4CCN A;  4IZZ A;  4MEX F;  1LPQ A;  1RNL A;  4PJN A;  1J9I A;  4C9Y A;  4OMY A;  3OIO A;  1ZG3 A;  2ZFU A;  2X6Y A;  1YX3 A;  1R1V A;  1RES A;  3ULQ B;  4WWC A;  4A3J J;  5E17 F;  2WC2 A;  2OV7 A;  4RS8 A;  1PUF A;  2MH2 A;  2MC3 A;  3L00 A;  1TT5 B;  4HBL A;  2QSF X;  2P5V A;  2ECC A;  4I6Z A;  1A31 A;  2DTR A;  4NDL A;  5C4J J;  3DFG A;  2NS7 A;  4S05 A;  3E6M A;  3K9T A;  5F0H A;  5K7H A;  2ISZ A;  2DBB A;  2NRA C;  4XKC A;  5ILU A;  3BTJ A;  1OYW A;  1X1B A;  2W85 A;  2P4W A;  4BJ6 C;  2VB6 A;  2O03 A;  2F5V A;  2JSC A;  2KZV A;  3HSE A;  3V7C A;  1TWA J;  2XV4 S;  2Y0M A;  1HDP A;  2L9V A;  4LB6 B;  1K6Y A;  4CXF A;  2EIN H;  1U2W A;  5L3E A;  1SC7 A;  3L09 A;  4WF2 A;  4NC7 A;  1MMD A;  5ILV A;  4EQQ A;  4JK1 X;  3HOS A;  2KP6 A;  3E5U A;  5FKN A;  4OIN F;  2NOG A;  3RZO J;  3NAR A;  3ZN1 A;  1M1E B;  1IN5 A;  3ABK H;  2VE8 A;  2GXB A;  2VKV A;  4UHT A;  3JTG A;  2ELH A;  4DBR A;  2JT1 A;  1YW7 A;  3O6B B;  2V9V A;  3M1C A;  4M73 A;  1MJB A;  2BW3 B;  4YRV A;  3JRE A;  1UG2 A;  1O3R A;  4XLH A;  1BW6 A;  2HVQ A;  2QVO A;  3G2B A;  3LSP A;  2E2I J;  4ZTF A;  2DW4 A;  4A3F J;  1IUF A;  4P96 A;  4IOC F;  4EAT A;  3R0A A;  3U2R A;  5FKO A;  3ZCO A;  3R6S A;  2E1N A;  1TC3 C;  4RB0 A;  4RAZ A;  2DOA A;  1K4T A;  3V8L A;  4U0Y A;  4F92 B;  3MKW B;  1K79 A;  3KEY A;  3ABT A;  2B63 J;  2KDO A;  3I53 A;  1UHW A;  3GTL J;  2KIF A;  1I1G A;  2RQQ A;  4I99 C;  2W84 A;  3OS0 A;  2BGC A;  2K9S A;  3R60 A;  3TGN A;  5J8F A;  1MBK A;  3LQQ A;  3GVA A;  3M1E A;  1TQP A;  2FX0 A;  2WY7 Q;  1SFE A;  1AKH B;  3GTG J;  2ZBK A;  2O61 A;  2Q1Z B;  1I6X A;  2A68 F;  2XGC A;  4XMY A;  4DW6 A;  1STZ A;  5H2F C;  2XF7 A;  1LVK A;  2A6H F;  3IRQ A;  3OYE A;  2M30 A;  3K10 A;  4HG2 A;  3U9G A;  3BLY A;  4HDU A;  3QAH A;  2NVQ J;  1U5T A;  4YFX F;  2XSD C;  3OSF A;  2GQQ A;  2O5R A;  4IHV A;  3BT9 A;  3BQZ A;  3K4K A;  1XSD A;  3S8P A;  5L3G A;  4Y7N J;  3H1C A;  5IP9 J;  1FNN A;  3GBG A;  1JE8 A;  4RB3 C;  4E7Z A;  1FT9 A;  5FKK A;  3TDZ C;  5FRO A;  1RRJ A;  2MH9 A;  5LHG A;  1YW9 A;  2DFI A;  4RM2 A;  3RCO A;  2XUB A;  2VBW A;  4BKX A;  4IKF A;  3IAS 2;  4IHS A;  2DN0 A;  1IC8 A;  1ONV A;  1ZG5 A;  4OIO F;  3VOD A;  3SFZ A;  1T0F C;  4OU0 A;  2HZD A;  2AS5 F;  2ZXJ A;  3I59 B;  1MMG A;  1GXP A;  1IGN A;  1W1W E;  1WI3 A;  1Y0U A;  2YU3 A;  4HA8 A;  4Y52 J;  3ZQL A;  3F8B A;  2HI3 A;  1V5E A;  5EGO A;  4BAC A;  2UXN A;  4Q48 A;  3K4J A;  1E2X A;  1OQY A;  1CQT A;  3QU3 A;  1YRN A;  5JHF A;  1B1B A;  3A02 A;  4IQ4 A;  5EJC A;  3VB2 A;  4CCK A;  1G3W A;  2IPQ X;  2JVG A;  2NYX A;  1AU7 A;  2H8R A;  2XRO A;  4PGH A;  1VTN C;  2R7U A;  1J2X A;  2HOS A;  3CCU I;  1K6O A;  2OCC H;  1T6S A;  1ZRD A;  1IXS B;  4IHT A;  3BG3 A;  3RDI A;  2KRH A;  2L9R A;  3Q5F A;  4XKW A;  2UUZ A;  4B09 A;  4PJJ A;  4M3D A;  1JUS A;  1T56 A;  3S15 J;  2IS6 A;  2ME0 A;  2VE9 A;  3DBH B;  1HC8 A;  1LDD A;  3F8C A;  5F27 A;  5CLS A;  4KIC A;  3OL4 A;  2E34 A;  2KL4 A;  1K83 J;  5KNL A;  3FBN B;  4IL6 C;  1D0Z A;  1CGP A;  2IW5 A;  5IT3 A;  3OR1 C;  3KLO A;  5E8G A;  3H0D A;  3JRH A;  4A3M J;  2X1C A;  4RB2 C;  4II3 A;  3HPG A;  2XC7 A;  1TWH J;  4BY1 J;  3MCZ A;  4FCY A;  5L3B A;  3A01 A;  3GX4 X;  1RUO A;  4HQM A;  1F1Z A;  4WXD A;  1Z1D A;  2VKD A;  3DKW A;  2VPL A;  1YJ9 I;  2HKX A;  4M6Y A;  4HLX A;  4C2U A;  1HBX G;  4MGR A;  3H5N A;  5TGT A;  5IT9 R;  1QHG A;  3CCY A;  3MAJ A;  4B3X A;  4HNU A;  4U7D A;  1BR4 A;  2CFX A;  2G7U A;  4AYB N;  3MKZ A;  3DKX A;  1JJ8 C;  2QGU A;  4CUG A;  1FSH A;  4WXH A;  1QU3 A;  1VND A;  1ETQ A;  4GXO A;  2MLK A;  2QBY B;  2G9W A;  3SJM A;  3F6O A;  4A6D A;  2XRN A;  2H6B A;  3H92 A;  4IF4 A;  2ZSI B;  4KN7 X;  3FMR A;  4KJZ A;  5D6E A;  3V4G A;  1HLV A;  1FYM A;  1TLH B;  1WVR A;  1U8R A;  1IO2 A;  4M3G A;  3KP5 A;  4G7Z F;  1IRX A;  4J19 A;  1VQK I;  2Y2Z A;  3GFL A;  1Z6R A;  2A5W A;  1HW5 A;  2ID6 A;  2LMD A;  1LJ9 A;  3QU6 A;  2V26 A;  1KYW A;  1YS7 A;  1FLI A;  3S14 J;  3VOE A;  1ZAO A;  4B44 A;  1JUP A;  3ROU A;  4OIQ F;  2R5Z A;  4NHJ A;  2P6S A;  1WKM A;  3E0J B;  1QVT A;  4IOA F;  1T98 A;  2JK3 A;  3PIP F;  3MZH A;  2WB1 A;  2R5Y B;  3QRF F;  2IRF G;  2IS4 A;  5B1A H;  5LGT A;  1Q1H A;  1ODD A;  4AIK A;  3HDD A;  2IGO A;  1IUY A;  3TP0 A;  1CF7 A;  2A05 A;  1DU0 A;  4B1R A;  3H36 A;  4LK1 F;  2VUM J;  1FBS A;  4XM3 A;  4PFO A;  1NG7 A;  5HLG A;  3GTO J;  3Q0W A;  3F9K A;  3ECO A;  1HKQ A;  3SEZ A;  2E71 A;  5F0F A;  2CS3 A;  2HOT A;  1ULY A;  2PJR B;  3MFK A;  2KT0 A;  4BUP A;  4KNY A;  3L2V A;  2FBI A;  1X1D A;  2KKO A;  5DD8 A;  1U3E M;  4IXA A;  2ZSH B;  4AYB A;  5LD2 C;  2EZH A;  3FF5 A;  4HRI A;  1X1P A;  5FLV A;  2VC0 A;  1E3P A;  3BCB A;  2BHZ A;  1EH8 A;  3DV8 A;  2JSP A;  2OC6 A;  4DGW B;  2L5Q A;  2IBD A;  2OCE A;  5BPI A;  2NOJ B;  4H4K C;  1SMY F;  1MMA A;  2M34 A;  5HS8 A;  3VFZ A;  2IVM A;  2G7H A;  4RMN A;  4UUV A;  3GTP J;  2GA2 A;  2P7V B;  4XLE A;  4DOZ A;  3HKZ A;  3G71 I;  2R7X A;  2EBI A;  1K4S A;  2R7Q A;  2W57 A;  4UVA A;  4BQN A;  5JLW A;  5GTI C;  3REO A;  1IV8 A;  3B6C A;  4II2 A;  4M9Z A;  4BU2 A;  3HBL A;  3OYL A;  2V1X A;  5D8L B;  5CYV A;  4KIT B;  2HNH A;  3V8K A;  4ESF A;  2FBH A;  2HU9 A;  1YX5 A;  1F43 A;  2OA4 A;  3MEX A;  5HDK A;  3EET A;  4F3Q A;  3S2W A;  2L9N A;  1XCV A;  1XCB A;  1IXC A;  3IH2 A;  4X1E A;  3HGG A;  3K6G A;  2KQR A;  2ID3 A;  3VYU B;  1YIJ I;  3OV8 A;  3N05 A;  2Z5U A;  3QWL A;  2FUG 2;  2QCO A;  3NQO A;  2COB A;  3PFI A;  2FXA A;  4QSH A;  2HKO A;  3MVP A;  3CLQ A;  2GOX B;  1MBH A;  5F6F A;  3S93 A;  1A6Q A;  3PSF A;  3DP7 A;  2QQ9 A;  2IS2 A;  1BOA A;  3FX3 A;  3FK7 A;  2DMN A;  5DD4 A;  3TQN A;  4XN0 A;  1LE8 B;  1AOY A;  4A3D J;  1LVA A;  2JTV A;  3OYC A;  3CUO A;  3DBR B;  3T5X A;  1A36 A;  2OZ6 A;  1R4N B;  4LLL A;  3G3Z A;  4BNC A;  2CH0 A;  2BXY A;  1YYV A;  4ZYD A;  4A6E A;  3OSG A;  1S7E A;  1XTA A;  4YII A;  2QSH X;  5ICF A;  2FOK A;  2P5L C;  4S0H B;  3R61 A;  2GBY A;  4JX5 A;  1A04 A;  3F8N A;  1RKT A;  2BVL A;  2UV1 A;  4XID A;  4Y13 A;  2DOE A;  4D5C A;  1QRY A;  1R58 A;  5FFZ A;  5EG0 A;  3HOZ J;  5JR3 A;  3DTE A;  1E17 A;  1ZKG A;  3IRR A;  2KPM A;  1H89 C;  3RPU A;  1NHA A;  4A3C J;  5GP9 A;  2NVY J;  4C2M J;  5EEH A;  1UMQ A;  5IOZ A;  2J5O A;  4L9T A;  4RAG A;  1WRJ A;  3BR5 A;  4EJO A;  1DUX C;  1R5I D;  1WI9 A;  5TRD A;  1AKH A;  4IHX A;  3BZK A;  2XIG A;  3S2H J;  2DA1 A;  2DAO A;  5BNG A;  2ISY A;  3RKQ A;  2KLO A;  3LST A;  5C44 J;  4ZJZ A;  1TWC J;  3FIS A;  4L5J A;  1TZL A;  1UST A;  1RR8 C;  3VYT B;  1SFO J;  2AO9 A;  2B0L A;  5FKL A;  3RIR A;  3QYE A;  1X19 A;  3FZV A;  4AVP A;  2ESN A;  2O9L A;  3EYI A;  4M3F A;  2UXX A;  4WK8 F;  1F9N A;  1R71 A;  3O8G A;  4I76 A;  3PSI A;  1WJ5 A;  1XX5 A;  2IA1 A;  4BDY A;  2B9S A;  2QQA A;  1O3Q A;  4QPQ A;  2D45 A;  5J1R A;  2GIZ A;  3HIF A;  3RQ4 A;  2OU2 A;  1U5T B;  4ZYA A;  2ICW G;  2A6T A;  4LB5 A;  1YIT I;  2EQR A;  4IO9 F;  2NVU B;  5K5Q A;  3DTI A;  4YFK F;  3CDL A;  4PJM A;  4DBQ A;  4GYI A;  3WTX C;  1KA8 A;  3JAM R;  5FD5 A;  2E1C A;  3J7A Y;  4BXX J;  3HRU A;  1RET A;  5E3L A;  1BI3 A;  2F48 A;  1I5Z A;  5J6X A;  1U78 A;  3W2W A;  1VQ8 I;  2M87 A;  2K85 A;  2VKH A;  4M6X A;  1T38 A;  1O3T A;  2F5E A;  1VQN I;  4X0G A;  2STT A;  1ZRE A;  2DT7 B;  2E35 A;  3OYA A;  3HTS B;  4P5O A;  1D1B A;  1XSX A;  4GCV A;  2YR2 A;  5CVI A;  1JUM A;  3CCQ I;  1YJN I;  4IHW A;  2RKH A;  4L9J A;  3W2A A;  1Z05 A;  2BEO A;  1ZQ3 P;  4G94 A;  2GXG A;  4PGG A;  1YRN B;  1IRG A;  3G1M A;  4OMZ A;  1SFU A;  4BDZ A;  3I56 I;  3J81 R;  1NK2 P;  2XPW A;  1FP2 A;  1OCR H;  1V54 H;  3K1N A;  5M5W J;  5HLI A;  1O3S A;  4RGR A;  1H8A C;  2JQ7 A;  4CZC A;  2NVT J;  1GVD A;  1H9G A;  4ON0 A;  2C6Y A;  3M8J A;  2IT0 A;  2VOP A;  2EB7 A;  2STW A;  2GAU A;  1FOK A;  2K5C A;  2K9N A;  2QKL B;  1SFX A;  4E7L A;  2KRC A;  3HB9 A;  2LKX A;  2Z16 A;  3HG9 A;  4R1H A;  4AU7 A;  2BY2 A;  2MG4 A;  5HOD A;  4CCO A;  3WTT C;  5ERI A;  1S7A A;  1Z7L A;  1ZEL A;  1SAX A;  4XSX F;  3LSI A;  5LEK A;  4FQG A;  1ZR4 A;  4HF0 A;  4JYK A;  5F08 A;  4CYC A;  2DA3 A;  5DCM A;  3A01 B;  3CMY A;  4EM0 B;  3JRB A;  3L2R A;  1QGP A;  1U6G A;  3CF5 F;  2O3F A;  2BZT A;  3FBI B;  4CIC A;  5KHD A;  2K4B A;  3KX2 A;  3I54 A;  1FEX A;  5BQT A;  4RDU A;  2E2H J;  1TT0 A;  3JR9 A;  4M74 A;  3BR3 A;  1IZ1 A;  3FXJ A;  1DDN A;  1BR1 A;  1YLF A;  3Q9V A;  1NH3 A;  5HS9 A;  2EZI A;  4OWR B;  2ZNZ A;  3RYP A;  4XQF A;  1SEU A;  2A3S A;  1W5S A;  4HX8 A;  4Y17 A;  3ZR8 X;  3I0T A;  3HOY J;  2DK5 A;  5CVR A;  2OUM A;  2VBZ A;  3CUQ A;  1FOY A;  2Z2S B;  3W2V A;  3L2C A;  3LSG A;  4L0Y B;  3K4C A;  3ZQC A;  2HTJ A;  3RTR A;  1IDZ A;  2GWR A;  3LAJ A;  4MNU A;  2CUE A;  2L0K A;  1YQA A;  2L54 A;  2Y48 A;  4R8H A;  1D1A A;  1BIB A;  2J5P A;  3AAF A;  4CHU A;  2HXI A;  1MIJ A;  2M5W A;  2R5Z B;  1ORK A;  1Z3X A;  1ETW A;  3DBL B;  2QEX I;  3CJQ B;  5LGU A;  3MZ8 A;  3ZQI A;  1TTY A;  4BY7 J;  3BP8 A;  2V9P A;  3F22 A;  3BJO A;  3DEW A;  1QBJ A;  1CF7 B;  4Y15 A;  3TO7 A;  1L0O C;  1U9O A;  3IKV A;  5JVT A;  2Y75 A;  2OD5 A;  4XLN F;  5HLT A;  5H20 A;  3HHH A;  4DYR A;  3BRO A;  2CSO A;  4D9J A;  1LB2 A;  4W1U A;  2E19 A;  2HS5 A;  3LMM A;  4PSX A;  2OF7 A;  5H6R A;  4LLN A;  2XKP A;  4Q4Z F;  2BY3 A;  2XGX A;  3C7J A;  3BJA A;  1G4D A;  2N8G A;  4ESB A;  1KZH A;  3SQN A;  4BEH B;  2QF7 A;  4MIM A;  4CSW A;  2VQG A;  1D5V A;  3GXO A;  3Q9S A;  2L7K A;  2O0Y A;  3I5U A;  4Z2Y A;  4DIQ A;  2X6O A;  4C3I J;  2FD5 A;  2H6C A;  2LLK A;  1TWG J;  1JI8 A;  1DP3 A;  1E3H A;  3BWG A;  2E1M C;  5LHH A;  2ZCW A;  2YX4 A;  1KON A;  4L9V A;  4O5V A;  5F1R A;  2YUS A;  3ZMD A;  2KIQ A;  2EV0 A;  3CCL I;  3H5R A;  2P7C B;  3EPZ A;  3JRF A;  2X0L A;  2CQ7 A;  3E6C C;  1QA6 A;  1GVJ A;  3K7A J;  4BL0 B;  5F0C A;  3CCJ I;  2LFB A;  5ILS A;  3QYF A;  1UFM A;  3BG7 A;  2XAH A;  3CZ6 A;  4ZDL A;  2Q0O A;  5A2Q Z;  4H0E A;  3ZQQ A;  2M45 A;  4IPA A;  4KUM A;  2OTL I;  3GFM A;  5J40 A;  3AKZ A;  4E7K A;  2HZT A;  5CKT A;  2VXD A;  1MBE A;  3L2W A;  3PO2 J;  4E7J A;  4BE1 A;  5IT9 Z;  2FEZ A;  1ZK8 A;  2XKO A;  1IJW C;  1IV6 A;  5TJJ A;  1TNT A;  3DTK A;  4UUS A;  3GYH X;  4MFE A;  2R0Q C;  1OR7 A;  4G7O F;  5M3M J;  3EUH A;  3AFH A;  3DLL F;  1JKO C;  3ZMZ A;  2XAG A;  4W97 A;  1LE8 A;  4YIR X;  3B6A A;  3U1D A;  1MMN A;  1LQ1 A;  1KU9 A;  1J5Y A;  2MZ4 A;  3AG2 H;  2GZW A;  2K9Q A;  4EM1 A;  3A0B C;  2VPR A;  1YO5 C;  2K02 A;  3ZMV A;  3LNQ A;  3K2A A;  2BXZ A;  1VZ0 A;  1FMW A;  1OMI A;  2Y9Y A;  2LY9 A;  1XG1 A;  3H3U A;  3M3Y J;  2QEN A;  1YTY A;  3PNV A;  3SEQ A;  1Y56 A;  2ACJ A;  4NC6 A;  1FC3 A;  2EFW A;  2ELJ A;  2I5U A;  4JP0 A;  4KDP A;  2JWT A;  5CVV A;  3S32 A;  2EWN A;  1RZ4 A;  4A2U A;  2L01 A;  2K3F A;  1T39 A;  1R7J A;  1S5L C;  3V7S A;  1PP8 F;  2DLL A;  2JA6 J;  1QQI A;  5IP6 A;  3O8H A;  4PDK A;  2UWM A;  3O3K A;  1YW8 A;  5EG0 B;  3H9J A;  4CZZ A;  3DQV C;  4QPO A;  1WZ2 A;  2L7F P;  1KQ8 A;  2R7R A;  5E8I A;  4JX4 A;  2PJP A;  1EF4 A;  2Q2E B;  1BM9 A;  4C2T A;  5E1X A;  5D4R A;  2PX9 A;  3P9K A;  5FJ8 J;  4AIJ A;  2D5V A;  2BBY A;  2FJ1 A;  4DYQ A;  3NAU A;  3V42 A;  3IH3 A;  3IP4 B;  5DCF A;  2DI3 A;  3AL0 B;  1X58 A;  1Z91 A;  3JRD A;  2HOA A;  4BHP A;  3KYL A;  4IQJ A;  3MWM A;  5KCM A;  1Z77 A;  2XB0 X;  2VJJ A;  4BAY A;  4HZF A;  5GAG J;  1YFH A;  6PAX A;  5DEQ A;  1GV5 A;  2MYS A;  2WAD A;  4CA0 A;  1HSJ A;  4LFU A;  5EZH A;  1R22 A;  4P55 A;  4G9Y A;  3R4K A;  4YFN F;  1Z0X A;  3OYF A;  3Q0U A;  3F21 A;  1OLT A;  2MAB A;  1MNM C;  1BC8 C;  1VQL I;  4BE2 A;  2H09 A;  1IF1 A;  4MLO A;  2IGN A;  3PQK A;  4MQV A;  3WG7 H;  3WGH A;  1LFU P;  1HF0 A;  3HSF A;  4A0Y A;  4F55 A;  2RC4 A;  1GXQ A;  2AXL A;  5HDN A;  4LK0 F;  2VLA A;  4P1W A;  3CES A;  4RAF A;  5LRR A;  4XK4 A;  3K69 A;  3JRA A;  3CD6 I;  1IN7 A;  4HNV A;  1MJ9 A;  2L4A A;  1WHU A;  4KMU X;  4G6T B;  3TP3 A;  2A07 F;  3JRG A;  1FZP B;  3WTS C;  1P2F A;  4G6Q A;  2ZJ2 A;  1SAU A;  4OAZ A;  2BHY A;  1BR2 A;  1ZAR A;  1IN8 A;  2EFN A;  2RNJ A;  5FD6 A;  4L18 B;  4U0V A;  2E5Z A;  2H94 A;  2LF8 A;  2ZME A;  5IP7 J;  3BZ6 A;  2R92 J;  2Y31 A;  3G1L A;  4EJW A;  5B66 C;  3N4M A;  2EA4 A;  2V4J C;  3I4N J;  1LKX A;  5GAH J;  4LIV A;  5K7F A;  2JJ7 A;  4CO8 A;  2PMZ N;  3M9A A;  3BQY A;  3BTC A;  3O2P E;  4BJ5 C;  2YU9 J;  2FNA A;  2LKS A;  1ETX A;  3HXL A;  2VIX A;  2CMP A;  2JUC A;  2OQG A;  1D0Y A;  2DQL A;  3KLN A;  2IJL A;  1QVU A;  2DA2 A;  2PN6 A;  1VF9 A;  1S7O A;  2W7N A;  2EJR A;  2CUZ A;  3KEO A;  3TED A;  2DMT A;  1X1C A;  4Y33 A;  1ZGA A;  4OOI A;  5GPC A;  1WJF A;  2RDP A;  3IAM 2;  3D5S C;  4XBF A;  3S1N J;  1Y1V J;  1RUN A;  3MQ0 A;  4OIR F;  2PG4 A;  3LL7 A;  4IVN A;  5BMZ A;  4QIW N;  2DO7 A;  4RLQ A;  4UVC A;  2CQK A;  3FXL A;  1P92 A;  1ETV A;  3GLL A;  1ACI A;  3PM1 A;  2DFF A;  2JMW A;  1S3J A;  1MND A;  2E60 A;  4HV5 A;  5LFA A;  4HEA 2;  2JUG A;  3X2Q H;  1X3W B;  1HW1 A;  1XN7 A;  3FK6 A;  4CCL A;  4M3B A;  4I0A A;  3KP3 A;  4MO7 A;  1IN4 A;  2CQQ A;  2OBP A;  2V9K A;  3IV5 A;  1AHD P;  3DPL C;  2FML A;  1UJ8 A;  4KYW A;  1MZB A;  3A0H C;  1BJZ A;  3BR2 A;  3FWE A;  5D6F A;  3BCA A;  1N75 A;  4BQO A;  1YI2 I;  4XOT A;  4CYC B;  1ZTR A;  4LIU A;  4B4C A;  1Z3Y A;  1PYV A;  5DCM B;  5FGM A;  5TIS C;  1T95 A;  3OMY A;  4UXN A;  3PNY A;  1LNW A;  3GFJ A;  1NTC A;  1X1A A;  1AWC A;  1GLN A;  4U88 A;  3ZMS A;  4EEF G;  2F2E A;  1R49 A;  3L1P A;  3H5A A;  1V5F A;  1VQ6 I;  1O7L A;  3HC7 A;  1Y8R B;  1MH4 A;  1IDY A;  2DYR H;  1RPW A;  2EPF A;  4AVZ A;  1TWF J;  3GZ6 A;  2LYC A;  5LLQ A;  2M4G A;  2MFZ A;  2OTJ I;  4J01 A;  1SD4 A;  1LEB A;  2GIV A;  3CUQ B;  1D3Y A;  1YHQ I;  1XGS A;  2R7O A;  4ENK A;  2EZK A;  4A3E J;  2MSY A;  1WSU A;  1FJL A;  5D4S A;  3JAM Z;  4I09 A;  5EF6 A;  2Y0S N;  1X3Z B;  3CCM I;  1OFC X;  2Q8K A;  3GF2 A;  1GUU A;  2JA2 A;  2NS0 A;  5LHI A;  2HVS A;  5E1W A;  2O7O A;  2EH3 A;  4XLF A;  2DPD A;  2IA2 A;  3ZMU A;  1QZY A;  3DPU A;  2QM3 A;  1G2H A;  3I4P A;  3IWZ A;  2GLO A;  4E4H A;  4HLY A;  4IJA A;  5HVQ C;  1NK3 P;  2EA2 A;  4GYG A;  4BEH A;  2KRF A;  4DZJ A;  1JT0 A;  2RNG A;  3CP8 A;  1KQ9 A;  3SZT A;  4N4N B;  1DPU A;  3W6V A;  4DYC A;  4A3I J;  5FLX Z;  1FY7 A;  1R36 A;  3JRI A;  5CPR B;  2Y9Z A;  1IXR C;  1Z21 A;  1H9T A;  3M07 A;  4BQA A;  2RVC A;  3V8J A;  3SFI A;  3S1R J;  3OYI A;  3CJR B;  3WOD F;  5L3C A;  1UHS A;  3KYC B;  5CVJ A;  4JX6 A;  4DJA A;  3S1Q J;  2OZU A;  3QQA A;  1I39 A;  2VAS A;  2ZJR F;  4ANJ A;  1DP7 P;  1P4W A;  3QP5 A;  1LDK B;  3ASN H;  4CH7 A;  2P81 A;  4AWX B;  2LD5 A;  3RPU D;  1ZN2 A;  2DMU A;  5IOY A;  2WAE A;  1JJ6 C;  2LTP A;  4UUT A;  2DFE A;  3WHB A;  2KJB A;  4P9U A;  2WTE A;  1DGW Y;  2F4I A;  2R7S A;  1SMT A;  1W7P A;  2WAQ N;  1G6N A;  2JA5 J;  3B73 A;  3ZQF A;  4FTH A;  5FRN A;  1MSE C;  3HTU A;  3CTA A;  2EFQ A;  4EM2 A;  1VFC A;  4I0B A;  4HAM A;  1K78 A;  4XN3 A;  2Z99 A;  3FDY A;  2Y0S A;  2H8W A;  2D1V A;  2VOD A;  3HOV J;  2A69 F;  2ZC2 A;  3VEP A;  2HQN A;  2R7Z J;  3VWB A;  4XRS A;  2Z33 A;  1WJE A;  4A69 C;  3G4S I;  2JRT A;  1X2M A;  3GZN B;  4L0Z B;  4BJT A;  2XPU A;  2EZL A;  3PUB A;  4Y4R A;  4GDF A;  3J80 R;  2WWY A;  5D5W B;  2KMU A;  3ABM H;  2DXI A;  1N78 A;  5FRM A;  1EKE A;  2X6W A;  4UUS B;  5HOO A;  5A2Q K;  4IRI A;  1B59 A;  1BI0 A;  3FHZ A;  3K70 D;  1UB9 A;  1Z7U A;  1OCZ H;  1XSV A;  3IL2 A;  4HQE A;  1A5J A;  4WX9 A;  1B4A A;  1JTX A;  3OOP A;  4ETS A;  5JVG F;  2HDD A;  5KK1 A;  5IT9 K;  2OAZ A;  3M8F A;  1ERD A;  2ZXH A;  1B9N A;  4ENN A;  2BOL A;  4PUS A;  2AQF A;  2LC2 A;  1L3L A;  2BE5 F;  3WHC A;  4UV9 A;  2PBI A;  3VYR B;  4IEJ A;  1B72 A;  1D5Y A;  4MQ9 F;  2LKP A;  1RQ6 A;  1T0F A;  1R6R A;  3W3C A;  4U0W A;  2GM4 A;  1ETY A;  3HSR A;  4XLA A;  2Q2E A;  3C2H A;  2MC4 A;  3C3W A;  2EV5 A;  4EGY A;  2K3P A;  3TOA A;  2MA3 A;  1WQ2 A;  3OIP A;  4D7N A;  3K4N A;  1TNS A;  2XRL A;  4KT6 A;  1J7K A;  4O3M A;  1MGT A;  1RC9 A;  2YX7 A;  3P9C A;  2WAQ A;  4I98 B;  3OYB A;  2R7F A;  4HF1 A;  1SVM A;  3TDU C;  3VSL A;  4BHC A;  3J7A W;  1WH7 A;  3S3O A;  1GHC A;  3QP6 A;  4ZZD A;  2DYS H;  3FXM A;  3T0Y A;  2V79 A;  5J4Y A;  1BC7 C;  2VL8 A;  4B43 A;  3KCC A;  1FIP A;  2ECB A;  3J7Y J;  2D2W A;  2V6E A;  4FX0 A;  3LQR A;  3CMA I;  2L7M P;  3KP2 A;  3BG6 A;  1EH7 A;  1UAA A;  1SAN A;  4A5N A;  5AON A;  1LEA A;  2FF4 A;  2PMH A;  2Y30 A;  1RI7 A;  3QOE A;  3NRV A;  3I55 I;  3VSK A;  2M8G X;  3LOC A;  3CME I;  2DA6 A;  1X2N A;  4M6V A;  2JA8 J;  3KZI C;  4A0Z A;  2R7V A;  2IGK A;  4XOR A;  5J4V A;  1J59 A;  2M4K A;  2B7E A;  4NQW A;  2XGD A;  5LBQ A;  2WBM A;  4UNO A;  3BZC A;  5CJ9 A;  1U8B A;  2GOM A;  2IAI A;  4M9S A;  2OQR A;  3TKY A;  2MUN A;  2CV0 A;  2V6C A;  2ZXI A;  1WPK A;  1R1U A;  4V19 K;  4LOC A;  3CCS I;  2L7Z A;  3HM5 A;  3F6V A;  4X6A J;  5FO5 A;  5KVR A;  5D8K B;  4GGG A;  3FXK A;  2L2O A;  1UEL B;  1S8N A;  4M9X A;  1E3O C;  1BW5 A;  2LRD A;  3G1O A;  2VN2 A;  4HX4 A;  2CYY A;  3AG1 H;  3CO7 C;  2RN7 A;  1XMK A;  2Z1D A;  1WGX A;  4ZZL A;  2HPM A;  3DXJ F;  5HNF A;  2ZME B;  2L4M A;  2XAU A;  5C4X J;  1U9N A;  3PNT A;  3D1N I;  2MD0 A;  3GO5 A;  2M35 A;  4UY8 I;  5KAF C;  2P6T A;  2W1O A;  3E3V A;  2QA4 I;  9ANT A;  2HFH A;  1MBJ A;  1D8K A;  3WTV C;  3EQL F;  4MTE A;  3DWL E;  5FLM J;  3WTU C;  1F5T A;  2JN6 A;  2WV0 A;  4B48 A;  2VC1 A;  3SHF A;  2JPC A;  1PP7 U;  2XVC A;  1A6I A;  4OAY A;  5E3M A;  1OPC A;  1P4A A;  3M4O J;  1OJL A;  2QKM B;  3VDX A;  4KFC A;  2CQN A;  4NC8 A;  4LG0 B;  3OY9 A;  2MD5 A;  3P7N A;  2EK5 A;  4XKV A;  3BG5 A;  5DUI A;  2HQ5 A;  2ZJP F;  1U5T C;  2VT2 A;  1SD5 A;  3M7G A;  2D1H A;  1VQP I;  1OCC H;  2CV2 A;  3TL4 X;  5IY5 H;  4PFP A;  3GTQ J;  3E7L A;  1SVL A;  3L7W A;  1G3Y A;  3PFY A;  5L3F A;  1YIO A;  1FSE A;  5L3D A;  4BYY A;  2V1D A;  2RV8 A;  2V1N A;  5JI6 A;  3HEF A;  5HS7 A;  5LGN A;  4EV0 A;  5IPA A;  1I50 J;  3NEU A;  3C2G A;  5BOX A;  2NS8 A;  1IRZ A;  3EYY A;  2RAE A;  2YPR A;  2Z3Y A;  1MSF C;  3HRM A;  3GCM A;  3D5R C;  4QTR A;  3BC8 A;  1ZH5 A;  5E3O A;  4YEL A;  1VQO I;  1W36 D;  1BI2 A;  1DGR M;  5LEJ A;  1ZRC A;  1HCR A;  3V7R A;  1LUJ B;  2W25 A;  2VJI A;  3P5J A;  2H1L A;  2DDA A;  1JKP C;  2K9L A;  3UNG C;  2XAJ A;  3I9V 2;  3IWF A;  4A12 A;  3F0C A;  5HDG A;  4ABZ A;  1QPI A;  4LJZ F;  3E1S A;  3WU2 C;  3BY6 A;  5DDG A;  3ABU A;  4TV7 A;  3BJ6 A;  4BHB A;  3W6J B; 
#chains in the Genus database with same CATH homology
 4JBA A;  1TW3 A;  4AD9 A;  1MKM A;  4KIB A;  2IA0 A;  1R00 A;  1FYL A;  3TO9 A;  3FXU A;  3WU0 A;  5BPD A;  1FPQ A;  1IW7 F;  3JAM K;  3E6B A;  4HDV A;  2R7D A;  1XDU A;  3JTH A;  2FMY A;  3R0J A;  4EVI A;  3WE2 A;  1O57 A;  3HUG A;  4HX7 A;  3CDH A;  4PZJ A;  3TO6 A;  4EJT A;  3WTY C;  5DUK A;  1QNT A;  5HLH A;  3CJN A;  1PDN C;  4KMF A;  4KN4 X;  5FLX K;  4QWQ A;  3RKY A;  3QPT A;  1Z9C A;  2CW0 F;  1W7P B;  4ASN A;  1YG2 A;  1FX7 A;  1JHF A;  2VT3 A;  1KGS A;  1K78 B;  3HRT A;  4UVB A;  5BS6 A;  3C18 A;  3G73 A;  1BJA A;  5DYM A;  1XGN A;  2ZO4 A;  5J8C A;  1YS6 A;  2IP2 A;  2L3D A;  1QPM A;  2XAQ A;  3SZP A;  1R23 A;  4LGW A;  4RAY A;  1SD7 A;  1KU2 A;  1BN5 A;  2HQR A;  3RJP A;  2JZY A;  1XGM A;  1JGS A;  5DV5 A;  1ZRF A;  4ZH4 F;  1OKR A;  2NNN A;  5H6Q A;  4YIF A;  2KIU A;  4XSZ F;  2Z9O A;  4CGZ A;  3PQJ A;  4XLP F;  1KYZ A;  1OYI A;  2LF7 A;  5ICE A;  2NNY A;  3QPH A;  2XAS A;  1O7F A;  2K27 A;  1RIO H;  2LNB A;  4ZYE A;  5JFR A;  1BI1 A;  4GO1 A;  2ZKZ A;  4BH9 A;  3I71 A;  2E7W A;  4EJV A;  3KET A;  4G7H F;  3LWF A;  2FE3 A;  2ETH A;  3DEU A;  3GW2 A;  2FA5 A;  2VON A;  1QZZ A;  3D0S A;  3K1M A;  4D0P A;  5E1Z B;  2QWW A;  4RGX A;  3FM5 A;  2HTS A;  3LA2 A;  1K7A A;  2PEX A;  3T1B A;  2KJC A;  1ZG1 A;  5D5X B;  4O6J A;  4F7Z A;  2ESH A;  4JQF A;  1JXS A;  3J80 Z;  1MDM A;  5FFX A;  3F72 A;  1HXD A;  2L02 A;  2DPU A;  1QO0 D;  1EH6 A;  4FX4 A;  2EFO A;  1F4K A;  3WG9 A;  3IHU A;  2HR3 A;  4L5I A;  3BPV A;  1EV7 A;  4LG0 A;  2M8E A;  1HST A;  2V1U A;  1I27 A;  1V3F A;  2VBX A;  2QLZ A;  4ENM A;  2P5K A;  4G6D A;  3WE3 A;  4G8X A;  4MEY F;  3E5X A;  1BIA A;  4I01 A;  3KP4 A;  1J0R A;  2CG4 A;  3B02 A;  3E97 A;  4P9F A;  4CYD A;  2M1B A;  2HDC A;  1TW2 A;  4KT5 C;  4EMS A;  1HKS A;  4CDG A;  2GA1 A;  4Q5S F;  3WTW C;  5LRS A;  5FB2 A;  1S6L A;  4R79 A;  1MD0 A;  1R5G A;  1USS A;  3GWZ A;  2PI0 A;  2DK8 A;  4KIF A;  2DU9 A;  5D5U B;  3ZN0 A;  2DQR A;  2PLY A;  3KFW X;  1W7P D;  2YSR A;  5K5O A;  3WU1 B;  3T8T A;  3F23 A;  2QYO A;  2R3S A;  2DT5 A;  4S04 A;  3JSO A;  4HF2 A;  3K1P A;  3GLX A;  3F8M A;  2EV6 A;  4LMY A;  4HYE A;  1XB4 A;  5JHU A;  1TBX A;  2BV6 A;  4DNC A;  1C0W A;  2JPB A;  2PFB A;  2HGC A;  2F5D A;  1T2K A;  1DPR A;  3KP7 A;  2A6E F;  2HYF A;  3P9I A;  2EFP A;  3J81 Z;  3TOB A;  2TDX A;  4Q47 A;  2P8T A;  2VXZ A;  4OIP F;  4ZYH A;  1ZGJ A;  3FXQ A;  2HWV A;  2ADU A;  2MLG A;  1OYY A;  1V4R A;  3FMQ A;  3GFI A;  2O8X A;  1BBY A;  1HQC A;  2PMU A;  3ML6 A;  3ELK A;  3CUQ C;  3FXR A;  3MZY A;  1G3S A;  2RQP A;  2FBK A;  4MHG A;  1KU7 A;  3FM3 A;  3LAP A;  3BDD A;  4ESJ A;  1XDS A;  2FRH A;  3F3X A;  2A61 A;  5AIQ A;  5ICG A;  4I2O A;  4RGU A;  4A5M A;  4PCQ A;  1JHH A;  3KEQ A;  3EDP A;  1UCR A;  1TQI A;  5EEG A;  2XHK A;  2K7L A;  2MBF A;  2NAZ A;  4N9H A;  3DF8 A;  1HW2 A;  3KE2 A;  1G3T A;  4WCG A;  1ON1 A;  4M71 A;  4EGZ A;  2HEO A;  3C1D A;  2RGV A;  3L9F A;  3ZMT A;  3KP6 A;  3KZZ A;  4L9N A;  4YG2 F;  4EJU A;  3E5Q A;  1J75 A;  4KIG A;  2FSW A;  1ZLJ A;  2LDU A;  4ENJ A;  1P4X A;  4HOB A;  2F5C A;  4RB1 A;  4FT8 A;  2A5Y B;  4A0X A;  1FBU A;  1FYK A;  3SXY A;  5E20 A;  1XD7 A;  2HOE A;  3HYI A;  3LA7 A;  4WXC A;  1ZHF A;  3RI4 A;  4I02 A;  3FMS A;  5AIP A;  4U7B A;  4I7H A;  5CVU A;  1R5H A;  5F64 A;  3CLO A;  4FHT A;  4HW0 A;  3DPT A;  1REP C;  5K5R A;  3HHG A;  3H3Z A;  3I59 A;  3CO6 C;  3K0L A;  4N9I A;  3RKW A;  1P6R A;  1H0M A;  1MDM B;  1IAW A;  3RYR A;  1TQM A;  2CO5 A;  2FU4 A;  3GUD A;  3K2Z A;  3W6K B;  3T8R A;  4N0B A;  4KA4 A;  3J80 K;  1UHM A;  5E18 F;  1LDJ A;  3IC7 A;  3HOT A;  3WTZ A;  2O6G E;  3GEZ A;  4M72 A;  2QZ8 A;  4E70 A;  4QLC U;  2KIM A;  1D8J A;  1ZLK A;  1Z6T A;  2VOO A;  1XGO A;  1FP1 D;  4AIH A;  2FNP A;  1R1T A;  3KZY A;  4IRH A;  4RGS A;  1B6A A;  1XMA A;  3ECH A;  4K2E A;  2CWE A;  3M8E A;  5D5V B;  4XRF A;  3I58 A;  4BXU A;  1FWZ A;  3LFK A;  2PQ8 A;  3D5L A;  2W24 A;  1KQ0 A;  3ISP A;  2X4H A;  5ED4 A;  2QQB A;  4HV6 A;  2QBY A;  2F5F A;  3BPX A;  1FBQ A;  2ZNY A;  3GZ5 A;  4DQ2 A;  4IRG A;  2E7X A;  1I1S A;  1HKT A;  3COA C;  1IRF A;  3LA3 A;  3E6D A;  1W4M A;  3HRS A;  3WGG A;  1S29 A;  1ON2 A;  4MTD A;  4B8X A;  3I64 A;  2K86 A;  4ZYG A;  1B9M A;  2VBY A;  3ZQ7 A;  5ICC A;  1SD6 A;  2CGP A;  1W5T A;  3ZPL A;  3IKT A;  2UZK A;  2LSO A;  3WGI A;  1ZYR F;  2QUF A;  2H27 A;  5K1Y A;  3ERE D;  1PUE E;  1X3U A;  3QOP A;  2FQ3 A;  2XAF A;  4LD5 A;  3N97 A;  3F8F A;  3BOQ A;  3RKX A;  2BYV E;  4UV8 A;  2ZFW A;  2K4J A;  2HYG D;  1WWX A;  3JW4 A;  4NB5 A;  3ZP5 A;  1KU3 A;  3RPQ A;  1MJA A;  3J81 K;  3J7A O;  4LLG F;  1IN6 A;  2COM A;  3JSP A;  4MEX F;  1RNL A;  1J9I A;  4OMY A;  1ZG3 A;  1R1V A;  5E17 F;  3ULQ B;  4WWC A;  2WC2 A;  4RS8 A;  2MH2 A;  2MC3 A;  3L00 A;  4HBL A;  2P5V A;  2DTR A;  3DFG A;  4S05 A;  3E6M A;  3K9T A;  2ISZ A;  2DBB A;  2NRA C;  5ILU A;  1OYW A;  2W85 A;  2P4W A;  2O03 A;  2JSC A;  3HSE A;  3V7C A;  2XV4 S;  2Y0M A;  4LB6 B;  4CXF A;  1U2W A;  5L3E A;  3L09 A;  4WF2 A;  5ILV A;  4EQQ A;  4JK1 X;  3HOS A;  3E5U A;  4OIN F;  3ZN1 A;  1IN5 A;  2VE8 A;  2GXB A;  4UHT A;  3JTG A;  2ELH A;  2JT1 A;  1YW7 A;  3O6B B;  2V9V A;  4M73 A;  1MJB A;  1O3R A;  2QVO A;  2DW4 A;  4P96 A;  3R0A A;  3U2R A;  3R6S A;  2E1N A;  4RB0 A;  4RAZ A;  3V8L A;  4U0Y A;  1K79 A;  3ABT A;  3I53 A;  1UHW A;  2KIF A;  1I1G A;  2W84 A;  2BGC A;  3TGN A;  3R60 A;  5J8F A;  3LQQ A;  3GVA A;  3M1E A;  1TQP A;  1SFE A;  2O61 A;  2ZBK A;  1I6X A;  2A68 F;  1STZ A;  2A6H F;  3IRQ A;  2M30 A;  3U9G A;  4HDU A;  3QAH A;  1U5T A;  4YFX F;  2GQQ A;  1XSD A;  5L3G A;  1FNN A;  1JE8 A;  4RB3 C;  1FT9 A;  3TDZ C;  2MH9 A;  5LHG A;  1YW9 A;  2DFI A;  2XUB A;  2VBW A;  4IHS A;  1ONV A;  1ZG5 A;  4OIO F;  3VOD A;  3SFZ A;  4OU0 A;  2AS5 F;  2ZXJ A;  3I59 B;  1GXP A;  2YU3 A;  1Y0U A;  4HA8 A;  3F8B A;  2UXN A;  4Q48 A;  1E2X A;  3QU3 A;  1B1B A;  3VB2 A;  1G3W A;  2IPQ X;  2NYX A;  2XRO A;  4PGH A;  1VTN C;  1J2X A;  1K6O A;  1T6S A;  1ZRD A;  1IXS B;  4IHT A;  3RDI A;  3Q5F A;  4B09 A;  2VE9 A;  1LDD A;  3F8C A;  5CLS A;  4KIC A;  1CGP A;  2IW5 A;  5IT3 A;  3KLO A;  5E8G A;  4RB2 C;  3MCZ A;  5L3B A;  3GX4 X;  1RUO A;  4HQM A;  1F1Z A;  4WXD A;  1Z1D A;  3DKW A;  2HKX A;  4M6Y A;  4HLX A;  1HBX G;  4MGR A;  3MAJ A;  4U7D A;  2CFX A;  2G7U A;  1FSH A;  4WXH A;  4GXO A;  2MLK A;  2QBY B;  2G9W A;  3F6O A;  4A6D A;  2XRN A;  2H6B A;  3H92 A;  4IF4 A;  4KN7 X;  3FMR A;  5D6E A;  3V4G A;  1FYM A;  1TLH B;  1U8R A;  3KP5 A;  4G7Z F;  3GFL A;  1Z6R A;  1HW5 A;  1LJ9 A;  3QU6 A;  1KYW A;  1YS7 A;  1FLI A;  3VOE A;  1ZAO A;  3ROU A;  4OIQ F;  4NHJ A;  2P6S A;  1WKM A;  1T98 A;  3MZH A;  3QRF F;  2IRF G;  5LGT A;  1Q1H A;  1ODD A;  4AIK A;  1IUY A;  1CF7 A;  4LK1 F;  1FBS A;  5HLG A;  3ECO A;  1HKQ A;  1ULY A;  3MFK A;  4KNY A;  2FBI A;  2KKO A;  5DD8 A;  1U3E M;  4IXA A;  3FF5 A;  2VC0 A;  1EH8 A;  3DV8 A;  5BPI A;  1SMY F;  5HS8 A;  3VFZ A;  2IVM A;  2G7H A;  4UUV A;  2GA2 A;  2P7V B;  2W57 A;  4UVA A;  3REO A;  4M9Z A;  2V1X A;  5D8L B;  5CYV A;  3V8K A;  4ESF A;  2FBH A;  2OA4 A;  3MEX A;  5HDK A;  3EET A;  3S2W A;  1XCV A;  1XCB A;  1IXC A;  3OV8 A;  2Z5U A;  3NQO A;  3PFI A;  2FXA A;  2HKO A;  5F6F A;  3DP7 A;  2QQ9 A;  1BOA A;  3FX3 A;  5DD4 A;  3TQN A;  1AOY A;  1LVA A;  2JTV A;  3CUO A;  3T5X A;  2OZ6 A;  4LLL A;  3G3Z A;  4BNC A;  1YYV A;  4ZYD A;  4A6E A;  4YII A;  5ICF A;  2FOK A;  2P5L C;  3R61 A;  1A04 A;  3F8N A;  4Y13 A;  1R58 A;  5FFZ A;  5JR3 A;  1E17 A;  3IRR A;  3RPU A;  1NHA A;  5EEH A;  2J5O A;  4L9T A;  1WRJ A;  4EJO A;  1DUX C;  1WI9 A;  5TRD A;  2XIG A;  2DAO A;  2ISY A;  3LST A;  4L5J A;  1UST A;  2B0L A;  3RIR A;  3FZV A;  4AVP A;  2ESN A;  3EYI A;  2UXX A;  4WK8 F;  1F9N A;  2IA1 A;  2QQA A;  1O3Q A;  2D45 A;  3HIF A;  2OU2 A;  1U5T B;  4LB5 A;  5K5Q A;  4YFK F;  4GYI A;  3WTX C;  1KA8 A;  5FD5 A;  2E1C A;  3HRU A;  1BI3 A;  1I5Z A;  5J6X A;  1U78 A;  2M87 A;  4M6X A;  1T38 A;  1O3T A;  2F5E A;  2STT A;  1ZRE A;  3HTS B;  4P5O A;  1XSX A;  4GCV A;  2YR2 A;  5CVI A;  2RKH A;  4L9J A;  1Z05 A;  2BEO A;  4G94 A;  2GXG A;  4PGG A;  1IRG A;  4OMZ A;  1SFU A;  1FP2 A;  3K1N A;  5HLI A;  1O3S A;  4RGR A;  1H9G A;  4ON0 A;  2C6Y A;  2IT0 A;  2VOP A;  2EB7 A;  2STW A;  2GAU A;  1FOK A;  1SFX A;  4R1H A;  3WTT C;  5ERI A;  1S7A A;  1SAX A;  4XSX F;  5LEK A;  4HF0 A;  5DCM A;  4EM0 B;  1QGP A;  1U6G A;  2O3F A;  4CIC A;  2K4B A;  3I54 A;  5BQT A;  4M74 A;  1IZ1 A;  1DDN A;  1YLF A;  3Q9V A;  5HS9 A;  2ZNZ A;  3RYP A;  2A3S A;  1W5S A;  4HX8 A;  4Y17 A;  3I0T A;  2DK5 A;  5CVR A;  2VBZ A;  3CUQ A;  3L2C A;  4L0Y B;  2HTJ A;  3RTR A;  2GWR A;  3LAJ A;  4MNU A;  1YQA A;  2L54 A;  2Y48 A;  4R8H A;  2J5P A;  1BIB A;  3AAF A;  4CHU A;  2M5W A;  5LGU A;  1TTY A;  3BP8 A;  3F22 A;  3BJO A;  1QBJ A;  1CF7 B;  4Y15 A;  3TO7 A;  1L0O C;  3IKV A;  5JVT A;  2Y75 A;  2OD5 A;  4XLN F;  5H20 A;  3HHH A;  3BRO A;  2CSO A;  1LB2 A;  2HS5 A;  5H6R A;  4LLN A;  2XKP A;  4Q4Z F;  2XGX A;  3C7J A;  1G4D A;  3BJA A;  4ESB A;  3SQN A;  1D5V A;  3GXO A;  3Q9S A;  2O0Y A;  3I5U A;  4Z2Y A;  2H6C A;  3BWG A;  5LHH A;  2ZCW A;  2YX4 A;  4L9V A;  4O5V A;  5F1R A;  3ZMD A;  2EV0 A;  2P7C B;  2X0L A;  3E6C C;  1GVJ A;  5ILS A;  1UFM A;  2XAH A;  2Q0O A;  5A2Q Z;  4H0E A;  2M45 A;  4IPA A;  4KUM A;  3GFM A;  2HZT A;  5IT9 Z;  2FEZ A;  2XKO A;  5TJJ A;  1TNT A;  3GYH X;  1OR7 A;  4G7O F;  3EUH A;  3ZMZ A;  2XAG A;  3U1D A;  1LQ1 A;  1KU9 A;  1J5Y A;  2GZW A;  4EM1 A;  1YO5 C;  2K02 A;  3ZMV A;  1OMI A;  3H3U A;  2QEN A;  1YTY A;  2ACJ A;  1FC3 A;  2EFW A;  4KDP A;  5CVV A;  2EWN A;  1RZ4 A;  4A2U A;  2L01 A;  1T39 A;  1R7J A;  3V7S A;  1PP8 F;  2DLL A;  1QQI A;  4PDK A;  2UWM A;  3O3K A;  1YW8 A;  4CZZ A;  3DQV C;  1KQ8 A;  5E8I A;  2PJP A;  1BM9 A;  5E1X A;  5D4R A;  3P9K A;  4AIJ A;  2BBY A;  5DCF A;  2DI3 A;  1Z91 A;  4BHP A;  3MWM A;  4BAY A;  4HZF A;  1YFH A;  6PAX A;  5DEQ A;  1HSJ A;  4LFU A;  1R22 A;  4P55 A;  4G9Y A;  3R4K A;  4YFN F;  3F21 A;  1BC8 C;  2H09 A;  1IF1 A;  3PQK A;  4MQV A;  3WGH A;  3HSF A;  4A0Y A;  2RC4 A;  1GXQ A;  2AXL A;  5HDN A;  4LK0 F;  5LRR A;  3K69 A;  1IN7 A;  1MJ9 A;  2L4A A;  4KMU X;  2A07 F;  1FZP B;  3WTS C;  1P2F A;  4G6Q A;  2ZJ2 A;  1ZAR A;  2EFN A;  1IN8 A;  2RNJ A;  5FD6 A;  4L18 B;  4U0V A;  2H94 A;  2LF8 A;  2ZME A;  3BZ6 A;  3N4M A;  4EJW A;  2EA4 A;  4CO8 A;  3M9A A;  3O2P E;  2FNA A;  3KLN A;  2OQG A;  2DQL A;  2IJL A;  2PN6 A;  1S7O A;  2EJR A;  3KEO A;  1ZGA A;  4OOI A;  2RDP A;  4XBF A;  1RUN A;  3MQ0 A;  4OIR F;  2PG4 A;  4IVN A;  5BMZ A;  2DO7 A;  4UVC A;  2CQK A;  1P92 A;  1S3J A;  4HV5 A;  1HW1 A;  1XN7 A;  4I0A A;  3KP3 A;  1IN4 A;  2OBP A;  3DPL C;  2FML A;  4KYW A;  1MZB A;  3FWE A;  5D6F A;  5DCM B;  5FGM A;  4UXN A;  1LNW A;  3GFJ A;  1AWC A;  4U88 A;  3ZMS A;  2F2E A;  1O7L A;  3GZ6 A;  5LLQ A;  1SD4 A;  1LEB A;  2GIV A;  3CUQ B;  1D3Y A;  1XGS A;  4ENK A;  1WSU A;  5D4S A;  3JAM Z;  4I09 A;  2Q8K A;  3GF2 A;  5LHI A;  2NS0 A;  5E1W A;  2DPD A;  2IA2 A;  3ZMU A;  1QZY A;  2QM3 A;  3I4P A;  3IWZ A;  4HLY A;  4IJA A;  5HVQ C;  2EA2 A;  4GYG A;  2KRF A;  1KQ9 A;  3SZT A;  1DPU A;  5FLX Z;  1FY7 A;  1R36 A;  1IXR C;  1H9T A;  4BQA A;  2RVC A;  3V8J A;  3WOD F;  5L3C A;  5CVJ A;  2OZU A;  1DP7 P;  1P4W A;  3QP5 A;  1LDK B;  4AWX B;  1ZN2 A;  4P9U A;  2KJB A;  2WTE A;  1SMT A;  1W7P A;  1G6N A;  3B73 A;  3HTU A;  3CTA A;  2EFQ A;  4EM2 A;  4I0B A;  4HAM A;  1K78 A;  2Z99 A;  2D1V A;  2VOD A;  2A69 F;  3VEP A;  2HQN A;  2Z33 A;  2JRT A;  4L0Z B;  2WWY A;  5D5W B;  5HOO A;  5A2Q K;  4IRI A;  1B59 A;  1BI0 A;  3FHZ A;  1UB9 A;  1Z7U A;  1XSV A;  3IL2 A;  4HQE A;  4WX9 A;  1B4A A;  3OOP A;  4ETS A;  5KK1 A;  5IT9 K;  2OAZ A;  3M8F A;  1B9N A;  4ENN A;  1L3L A;  2BE5 F;  4UV9 A;  2PBI A;  4MQ9 F;  2LKP A;  1T0F A;  4U0W A;  3HSR A;  2Q2E A;  3C3W A;  2EV5 A;  4EGY A;  3TOA A;  2MA3 A;  1WQ2 A;  1TNS A;  1J7K A;  4O3M A;  1MGT A;  2YX7 A;  3P9C A;  4I98 B;  2R7F A;  4HF1 A;  3TDU C;  4BHC A;  1GHC A;  3QP6 A;  4ZZD A;  3T0Y A;  2V79 A;  1BC7 C;  3KCC A;  2D2W A;  4FX0 A;  3LQR A;  3KP2 A;  1EH7 A;  4A5N A;  5AON A;  1LEA A;  2FF4 A;  2PMH A;  1RI7 A;  3NRV A;  4A0Z A;  1J59 A;  4NQW A;  5LBQ A;  4UNO A;  5CJ9 A;  4M9S A;  2OQR A;  3TKY A;  2V6C A;  1R1U A;  3F6V A;  5FO5 A;  5KVR A;  5D8K B;  4GGG A;  4M9X A;  1S8N A;  2VN2 A;  4HX4 A;  2CYY A;  3CO7 C;  2RN7 A;  1XMK A;  4ZZL A;  3DXJ F;  2ZME B;  2L4M A;  3GO5 A;  2P6T A;  3E3V A;  2HFH A;  1D8K A;  3WTV C;  3EQL F;  4MTE A;  3WTU C;  1F5T A;  2WV0 A;  2VC1 A;  3SHF A;  2JPC A;  1PP7 U;  2XVC A;  1OPC A;  1P4A A;  4KFC A;  4LG0 B;  2MD5 A;  3P7N A;  2EK5 A;  5DUI A;  1U5T C;  2VT2 A;  1SD5 A;  3M7G A;  2D1H A;  3L7W A;  1G3Y A;  5L3F A;  1YIO A;  1FSE A;  5L3D A;  4BYY A;  2V1D A;  2RV8 A;  5JI6 A;  5HS7 A;  5LGN A;  4EV0 A;  3NEU A;  5BOX A;  3EYY A;  2YPR A;  2Z3Y A;  3HRM A;  1ZH5 A;  1BI2 A;  5LEJ A;  1ZRC A;  3V7R A;  2W25 A;  2XAJ A;  3IWF A;  4A12 A;  5HDG A;  4LJZ F;  3BY6 A;  5DDG A;  3ABU A;  4TV7 A;  3BJ6 A;  4BHB A;  3W6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...