2F5FA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, ac conformation, ph 8.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
133
structure length
133
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 52
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5fA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5fA02
1U3EM 4IJAA 2VT3A 1SFXA 2OZUA 4LB5A 2G7UA 3E97A 4JK1X 1XGMA 1FPQA 1HKQA 4UVAA 3F6OA 3G3ZA 4I01A 2J5OA 3BPXA 1IUYA 3GXOA 3DF8A 4WWCA 1HXDA 3Q9VA 3U9GA 4HLYA 1E17A 3RYRA 3BOQA 1B6AA 1ON2A 5ICFA 1HSJA 4QLCU 2DPUA 1QBJA 3F72A 4ZZLA 2PFBA 2IVMA 3I53A 4YIFA 5CJ9A 2EA2A 4Q5SF 4I0BA 3V7SA 5ICEA 4XLPF 3HRUA 1BBYA 2L01A 4CHUA 2JRTA 3CUQA 2STWA 1NHAA 1G3TA 4D0PA 2DPDA 3TDZC 2QQ9A 4WX9A 1MKMA 1ZYRF 3J7AO 1IN4A 2COMA 1KU7A 1SD4A 1LEAA 2PEXA 2BEOA 1K7AA 1XSDA 5CVRA 2G9WA 4HBLA 4B09A 5KK1A 1IN7A 2DBBA 3V4GA 2D1HA 5H6RA 2ACJA 3WE2A 4O5VA 4I2OA 3I4PA 2ESHA 2JTVA 3F8FA 3NEUA 4I0AA 3HRMA 1OR7A 5JFRA 4PCQA 5FB2A 2FOKA 4CO8A 1O3RA 2KKOA 1O7FA 4NQWA 1S6LA 4FHTA 4JQFA 2ZMEA 1HW5A 3O2PE 4OU0A 3FXUA 3KP4A 1WI9A 2DK8A 5EEHA 5L3FA 2MLGA 1XCVA 5DCMB 4WXDA 1BOAA 4ZH4F 4H0EA 1OYWA 2DQLA 3T8TA 3FMRA 4OIRF 1BC8C 3V8LA 4GO1A 4U0WA 4LG0B 5LRRA 5J6XA 3WTSC 2QQBA 4G94A 5LHGA 4NHJA 2RKHA 1FY7A 1T98A 2EFOA 3JTGA 5HDNA 1U5TB 1J75A 2LDUA 3J80Z 5DYMA 2PMUA 2GA1A 1TNTA 1K78A 3M8FA 5L3EA 3KFWX 2QVOA 1FZPB 2Y48A 2V9VA 5HLGA 5FD6A 2YSRA 3GWZA 3MCZA 4MQ9F 1QGPA 1YIOA 4M9ZA 2NS0A 3I71A 3ABTA 1JGSA 3I59A 1J7KA 3RKWA 4P9FA 3R60A 1P92A 1Z6TA 4M73A 1QZYA 3F6VA 5BS6A 1O3TA 1I5ZA 3GYHX 3WTYC 4BH9A 5DUIA 2OQRA 1FSHA 2EJRA 5IT9Z 3RTRA 3P7NA 3F22A 4PGHA 2P5VA 4BXUA 4UV9A 3KLOA 1RZ4A 1DPRA 3G73A 1R58A 2MBFA 4JBAA 1IN8A 3KP7A 3M7GA 1ZGAA 1WSUA 4ZYEA 3KP3A 1ZRFA 1H0MA 1JHFA 1X3UA 1RUOA 1ZRCA 4BHPA 5BPDA 3CUOA 3WTXC 1FX7A 3DV8A 4L9TA 2O8XA 2HWVA 1FSEA 1GXPA 2WV0A 1R00A 3WE3A 3R0JA 3ZMDA 2GQQA 3JTHA 3L09A 5FLXK 2VBXA 4YFKF 3BWGA 4A5NA 3DXJF 2RDPA 2QQAA 2X4HA 1IN6A 4LLLA 2A69F 4GYIA 3HTUA 1IXCA 3K0LA 4R8HA 5D6EA 1V4RA 4A0ZA 1R1UA 2E7WA 4YFNF 2R7FA 2EK5A 2FMLA 1YTYA 2EWNA 2M8EA 5CVVA 1BI3A 4GXOA 4G7OF 1QPMA 1S29A 3BJ6A 3EUHA 3GF2A 3E6DA 1B9NA 2M30A 1W7PA 1SMTA 5TRDA 4KFCA 3F8CA 2Y0MA 2HFHA 1LDDA 5LRSA 3M1EA 4HV5A 4G6QA 4RB3C 4G9YA 4RAZA 5HLIA 2HKOA 2PLYA 2HOEA 3GUDA 4I7HA 1XCBA 3HOSA 1F5TA 2WTEA 1LEBA 3K1NA 1FNNA 4O6JA 1YFHA 1AOYA 1KQ8A 3JAMK 3KETA 2LF8A 4UHTA 1I27A 2STTA 4O3MA 1JXSA 4OIQF 2A3SA 2AXLA 4CYDA 1T39A 2RGVA 3IRQA 3B73A 1F9NA 4HDVA 5K5QA 4HX7A 1IN5A 3F3XA 3EETA 3L9FA 1W5SA 2EV5A 3ELKA 3MWMA 3T5XA 4ESFA 2BBYA 1OYYA 5LGTA 3TO7A 2VC0A 2V6CA 3WU1B 1FWZA 3K9TA 4E70A 4ZZDA 1ZAOA 3ZMZA 2LKPA 1OYIA 4HAMA 2EFPA 1W4MA 3FF5A 1PDNC 4U0YA 1Z91A 1I1SA 3FMSA 2HGCA 5L3GA 3FWEA 4EMSA 4N9HA 3ZPLA 5E17F 2K86A 1YW8A 3GVAA 1DP7P 2FBKA 5EEGA 4EM2A 2PJPA 3TQNA 2V1UA 4HW0A 2CWEA 3L2CA 4L5JA 2VONA 3WGGA 2QBYB 3F8BA 2IP2A 2A68F 1F1ZA 4XBFA 3V8KA 5FD5A 2QZ8A 3COAC 5F6FA 2CW0F 2W85A 3QOPA 2OAZA 5JVTA 3DPTA 2XROA 5F1RA 2JT1A 5IT3A 4K2EA 1L3LA 3B02A 2ZXJA 4TV7A 1BIBA 1T38A 2FBHA 4ON0A 1LQ1A 2CQKA 1FYKA 3MQ0A 4GCVA 1YW9A 3RYPA 3LQRA 1HKTA 1B4AA 4A6DA 1XGNA 3E5QA 5LLQA 3FM5A 4A12A 2YPRA 4LJZF 2F5FA 4L9NA 3SQNA 3DKWA 4M71A 1PP8F 3FX3A 2BE5F 4L18B 4HQEA 2PN6A 2XKOA 4KMFA 1EH7A 1YS7A 1CF7B 3E5UA 4L0ZB 2HQRA 1KU9A 1B59A 4UV8A 4U7DA 2UZKA 5F64A 2FQ3A 1TQPA 3I5UA 3FXRA 1XD7A 2A5YB 1SD6A 1HKSA 2OU2A 5CVJA 5LGUA 4IF4A 2F5CA 1S8NA 2L54A 3SHFA 2GIVA 3IC7A 2KIFA 3LFKA 2UXXA 3GZ5A 1U78A 1KA8A 1R5HA 2DO7A 2L02A 1T2KA 3ZN1A 5HLHA 3CUQC 3GFIA 4YG2F 2E1CA 1AWCA 1G3SA 3ECOA 4OIPF 1QQIA 3QAHA 3L00A 1HW2A 2ADUA 3BJAA 4R79A 1ZG3A 4R1HA 2V79A 4XSXF 3CO6C 2DLLA 1SAXA 5H20A 4RGXA 1MZBA 1BI1A 1KYZA 3MZYA 3JSOA 2XUBA 2A07F 4ETSA 5ICGA 2VBZA 1HQCA 2EV6A 4LK1F 5BPIA 2ELHA 4EJOA 2P6SA 3ECHA 3PFIA 1B9MA 3KE2A 3PQKA 1W7PD 4KICA 5DEQA 3I64A 1OKRA 3W6KB 1Z6RA 4ZYHA 5HOOA 1G6NA 1P2FA 2M87A 1FP1D 2K02A 1KYWA 3J81K 2YU3A 2VBWA 1O7LA 2CO5A 2LSOA 1P6RA 4P55A 1LDJA 5D5WB 5CVIA 3H3UA 5CVUA 2JPBA 1I1GA 2JPCA 3GEZA 2D2WA 5J8CA 1WKMA 1R22A 2HDCA 3AAFA 1LDKB 2HKXA 1FOKA 3IWZA 4OIOF 1IF1A 2E1NA 2R7DA 1GHCA 1O57A 1ZRDA 5DV5A 1TNSA 1G3WA 4LLGF 2GXBA 2OQGA 4Y15A 1H9TA 2ZNZA 4L0YB 3M9AA 2YX4A 2A6HF 2HEOA 2ISZA 1ULYA 5LEJA 1WWXA 5CLSA 2XAFA 4IHTA 1R7JA 2ZNYA 2FNAA 5LHHA 2E7XA 3R0AA 4G7ZF 4RB2C 2M45A 2QENA 5ED4A 1T0FA 3F8MA 4BHBA 2H6BA 1IZ1A 3Q9SA 3KCCA 4AWXB 5FFXA 1U6GA 5L3BA 2FA5A 3DEUA 2LNBA 5ERIA 5BMZA 3KZZA 3U2RA 2FNPA 3WODF 1TTYA 2ZJ2A 2F5DA 2XAGA 1USTA 4F7ZA 1KU2A 2QUFA 2H27A 3E6BA 4CICA 3IKVA 3KP5A 1ZG1A 5BQTA 5A2QZ 2CSOA 2M1BA 4HYEA 4MNUA 5HVQC 2HTSA 2RVCA 2PG4A 1Z7UA 3F23A 5JR3A 5CYVA 1BN5A 3ZP5A 2XAHA 5DCMA 3FM3A 2DI3A 2H6CA 2RNJA 3C7JA 4IHSA 4EGYA 4MQVA 4P9UA 4CZZA 4L9VA 3GZ6A 3QP5A 3R6SA 4DNCA 4YFXF 4LG0A 3WGIA 5E20A 3PQJA 2V1XA 3KEOA 1YQAA 1PUEE 4P5OA 4KT5C 1FYMA 2P8TA 3ZMVA 3E6MA 2DAOA 1U5TA 2GXGA 1ZREA 1IXRC 1EH6A 2DU9A 3HHGA 2Z3YA 5D4RA 6PAXA 1XDSA 2FEZA 3FXQA 3HRTA 1USSA 3BP8A 3L7WA 1MJBA 1XSXA 1SFUA 3QRFF 2NNYA 1S3JA 2ZO4A 2C6YA 1FP2A 4WXHA 5D6FA 3CO7C 3TKYA 3WG9A 1WRJA 2OBPA 2L3DA 4S05A 4LK0F 3GFMA 2GWRA 2A6EF 3HSFA 3CJNA 4RAYA 2K7LA 3RDIA 1BIAA 4MEXF 2L4MA 3T8RA 4WCGA 3F8NA 3Q5FA 2Q0OA 2FXAA 1IW7F 5DCFA 4CXFA 4KMUX 5LHIA 1YW7A 2GA2A 3HTSB 3R61A 4YIIA 3WTVC 1TW2A 3K2ZA 4ZYGA 1BJAA 4N0BA 1MJ9A 3MEXA 1UB9A 5D5VB 1D5VA 3NQOA 3EYYA 3NRVA 3I0TA 4EQQA 3SFZA 4BHCA 2UWMA 3CLOA 2XVCA 3DFGA 1FBUA 1ZN2A 4KIGA 2QM3A 1P4WA 2QWWA 1L0OC 4UVCA 5D8LB 4EV0A 4KA4A 1EH8A 3K1PA 3LAJA 3T0YA 2P7CB 1KU3A 1KGSA 1P4XA 4I09A 5TJJA 2XGXA 4UXNA 2D45A 4WF2A 2XIGA 1U8RA 3J80K 3C3WA 4AIHA 3BROA 2RC4A 2XKPA 4U7BA 1G4DA 4IPAA 4M9XA 4A0XA 3I58A 2MD5A 1UHWA 4MHGA 2Q8KA 1DUXC 2IPQX 3P9IA 4KNYA 4EM0B 2HQNA 4XRFA 5BOXA 3TDUC 1C0WA 3BJOA 2BV6A 1FT9A 3HHHA 1JE8A 2FU4A 2H09A 3KLNA 1LB2A 2DQRA 2ZCWA 3ISPA 2OD5A 1QNTA 3QU3A 5HDGA 3LQQA 3WTUC 2NAZA 3KZYA 2VE8A 3EDPA 2BYVE 3RPUA 5IT9K 3DP7A 2LF7A 3JW4A 1XN7A 2DT5A 5K1YA 4UNOA 1HW1A 4EJWA 3CUQB 1ZGJA 1TBXA 4Q4ZF 3VODA 2HR3A 4XSZF 2OZ6A 4M72A 1BI2A 5A2QK 4ZYDA 2JSCA 1R23A 4Q48A 5AONA 4MGRA 4ESBA 5DDGA 5AIPA 3K69A 5ILSA 1A04A 4GGGA 1Q1HA 1TQMA 2MLKA 1LVAA 4WK8F 3GFJA 1FYLA 2ZBKA 2P5LC 4RGUA 3H92A 4WXCA 2XHKA 1R5GA 4LB6B 3IL2A 1J59A 4MTEA 4HQMA 5HS9A 1SMYF 1SD5A 2ZMEB 5DD4A 5E8GA 5ILVA 4DQ2A 4IRHA 4Z2YA 1ON1A 2X0LA 4HX4A 5E8IA 1XGSA 3OV8A 3GX4X 3I54A 4UUVA 2YX7A 3E3VA 4M6YA 1U2WA 4AD9A 2HTJA 1ODDA 2UXNA 2RN7A 1HBXG 4L5IA 3HUGA 1J9IA 3ZQ7A 3TOBA 3QPHA 4EJVA 2QBYA 4A5MA 1VTNC 2O3FA 3LSTA 5FLXZ 2PMHA 2IA1A 1UHMA 1DDNA 4QWQA 1KQ0A 3SZPA 3BDDA 4EJTA 1Y0UA 1XB4A 5E1XA 4M9SA 1K78B 1OMIA 2D1VA 1MDMA 1CGPA 2O0YA 2VBYA 4OOIA 1B1BA 2FMYA 2IW5A 4HDUA 5DUKA 5D5XB 2PI0A 1FBSA 3E5XA 1QZZA 1ZLJA 4N9IA 4FT8A 4HOBA 3ZMTA 1E2XA 3I59B 1IRFA 2VOPA 2EFNA 4KIFA 4NB5A 3GO5A 3IKTA 1ONVA 2P7VB 3RIRA 3CTAA 4IVNA 3C18A 1ZG5A 4RB0A 3IHUA 1BC7C 1CF7A 4U88A 5LGNA 2EFWA 3LA3A 3LA2A 1RI7A 1KQ9A 1O3SA 4G8XA 2P5KA 4OMYA 4RS8A 3M8EA 5L3DA 1IXSB 2L4AA 5AIQA 2KJCA 2MH9A 4AVPA 4P96A 5LEKA 3ULQB 1YG2A 3ZN0A 4ENNA 4BAYA 1YLFA 4MEYF 5J8FA 2MH2A 2NYXA 3RKXA 1TW3A 1T6SA 1D8KA 1J0RA 4Y17A 5ILUA 3JAMZ 2GZWA 1UCRA 4PZJA 3LA7A 3BZ6A 4ENKA 1XSVA 1GXQA 4M74A 2ISYA 3C1DA 1Z9CA 4UVBA 2P4WA 2IRFG 1QO0D 3VFZA 3ABUA 2VN2A 3ZMSA 1H9GA 4ASNA 1W5TA 5D8KB 3TO6A 3O3KA 2PBIA 2CFXA 3LWFA 2EB7A 1R1VA 2FE3A 5K5RA 2B0LA 3KP2A 3N4MA 2EA4A 5JI6A 4A6EA 1XGOA 3IRRA 4LLNA 4BNCA 1W7PB 2A61A 4ENJA 4RB1A 2W24A 1IAWA 2O61A 1G3YA 5FGMA 2FSWA 2W84A 3ML6A 3ZMUA 3GFLA 4FX4A 3VB2A 2EV0A 2V1DA 4EGZA 2XRNA 3F21A 2G7HA 2VC1A 2W57A 1LNWA 2IA0A 2WC2A 1GVJA 2XV4S 4ESJA 2YR2A 5H6QA 3WTZA 1XDUA 4G7HF 3HSRA 5DD8A 2IA2A 3HOTA 1STZA 1O3QA 1ZLKA 3K1MA 4LD5A 3GLXA 2FF4A 5FFZA 3LAPA 1LJ9A 3RKYA 4OMZA 2K27A 3MZHA 4BYYA 3BPVA 2FBIA 4B8XA 2XAJA 2DTRA 2Z5UA 4HF2A 1U5TC 2VODA 3OOPA 3RJPA 3V7CA 4HF1A 2ETHA 4AIJA 2H94A 4ENMA 1P4AA 1V3FA 4EVIA 5E18F 1TLHB 2BGCA 1DPUA 3T1BA 3R4KA 5E1ZB 5D4SA 4IRGA 1UFMA 3REOA 1I6XA 4M6XA 1ZH5A 4G6DA 2O03A 2K4JA 2AS5F 4RGSA 1J5YA 2NNNA 5K5OA 4FX0A 4A2UA 3DPLC 4KDPA 4PGGA 3QPTA 2F2EA 1YS6A 4KIBA 1MD0A 2VT2A 1WQ2A 4IXAA 1J2XA 2GAUA 3TOAA 1HSTA 1Z1DA 2WWYA 2EFQA 2OA4A 4RGRA 4LFUA 2ESNA 2M5WA 4U0VA 4LGWA 4LMYA 1R36A 2QLZA 5HS7A 2XASA 1REPC 3WTWC 3WTTC 1MGTA 5LBQA 1RNLA 4I98B 2IJLA 3WU0A 3FHZA 2KIUA 3GW2A 2IT0A 1F4KA 1XMKA 4A0YA 4Y13A 3E6CC 4XLNF 1S7OA 2NRAC 3SZTA 2F5EA 4IRIA 1YYVA 3RPQA 1ZHFA 4KN4X 2TDXA 1OPCA 1BI0A 3D0SA 3O6BB 4BQAA 3HIFA 3TGNA 2K4BA 3MAJA 3J81Z 1K79A 2Z99A 3MFKA 2Z9OA 4CDGA 3JSPA 3WGHA 1FBQA 2XAQA 2VOOA 2Y75A 1R1TA 1K6OA 3VOEA 3S2WA 2Q2EA 4GYGA 2ZKZA 3HSEA 4HLXA 2ZFWA 4KN7X 4AIKA 3VEPA 4Q47A 3TO9A 2HYGD 3SXYA 2QYOA 1JHHA 2RV8A 2HS5A 4EM1A 1TQIA 4HA8A 1D8JA 3IWFA 5FO5A 3ROUA 3QU6A 1S7AA 2KRFA 1YO5C 3KP6A 3RI4A 1PP7U 5HDKA 2PQ8A 1MJAA 4HX8A 3U1DA 5ICCA 1EV7A 5JHUA 2J5PA 4EJUA 4I02A 2CGPA 3P9CA 3DQVC 3V7RA 2MA3A 1SFEA 2MC3A 3BY6A 4MTDA 3HRSA 3P9KA 4KYWA 3HYIA 1FLIA 1FC3A 2O6GE 2HYFA 3W6JB 2KIMA 2W25A 4OINF 3EQLF 1IRGA 4HV6A 3H3ZA 1MDMB 2R3SA 3KEQA 3FZVA 3V8JA 1ZARA 4HZFA 5D5UB 3CDHA 3QP6A 1Z05A 4CGZA 5L3CA 4PDKA 2FRHA 4L9JA 2VE9A 3D5LA 1RUNA 2DW4A 4S04A 1SD7A 5HS8A 2KJBA 3FMQA 4KUMA 4HF0A 3N97A 2Z33A 3ERED 5KVRA 2RQPA 5E1WA 1XMAA 2P6TA 1BM9A 1D3YA 3EYIA 1RIOH 2JZYA 2DFIA 2VXZA 2CYYA 2DK5A 2HZTA 2CG4A
chains in the Genus database with same CATH superfamily
1U3EM 4B3AA 2L9SA 4IJAA 2VT3A 4X6AJ 3S2DJ 1SFXA 2VKHA 2OZUA 5IY5H 4LB5A 2G7UA 3GBGA 3E97A 3FBNB 1P9QC 2ID3A 4JK1X 1ZR4A 1XGMA 1FPQA 1HKQA 2IGMA 4UVAA 3F6OA 2HU9A 4ZTFA 2CQNA 3G3ZA 4CUGA 4A3DJ 3QWLA 3L1PA 1JT6A 3X2QH 4I01A 2J5OA 5EDNA 3BPXA 1IUYA 4LIUA 2KZGA 4XN3A 2PJRB 2L7ZA 3GXOA 3DF8A 4WWCA 4PJLA 1X2NA 1HXDA 3Q9VA 3U9GA 4HLYA 1E17A 3RYRA 4AC0A 3BOQA 1VQ6I 4XKBA 1B6AA 1ON2A 3ERMA 5ICFA 3WHBA 1HSJA 4QLCU 2DPUA 2CV2A 1OLTA 1QBJA 3F72A 1RPWA 1SANA 3AL0C 2QA4I 4ZZLA 1A6IA 2PFBA 1LE8A 3UR3C 2IVMA 1YRNA 3E1SA 1T8IA 3I53A 4YIFA 5CJ9A 2EA2A 4XQFA 4Q5SF 1IUFA 4I0BA 3V7SA 5ICEA 3HGGA 4XLPF 3HRUA 4AUXA 2XPUA 1BBYA 2L01A 5IPAA 4CHUA 1TWFJ 2JRTA 3CUQA 5IYCJ 1J09A 1IO2A 1X3ZB 2STWA 1NHAA 1G3TA 4D0PA 2DPDA 3V42A 3TDZC 2KRCA 2QQ9A 4DBRA 4WX9A 1MKMA 1ZYRF 3J7AO 1IN4A 3RZOJ 2LH9A 2COMA 3A02A 1KU7A 1SD4A 2BHZA 4J00A 1LEAA 3RKQA 2PEXA 1D1BA 1X4PA 2BEOA 2DA5A 1K7AA 1XSDA 4PSWA 1WZ2A 5CVRA 4J19A 1ETWA 4LOCA 2W4SA 1WGXA 1JJ8C 2G9WA 2DOFA 3ESWB 5FLMJ 4HBLA 4B09A 4M3GA 5KK1A 5F27A 4IX7A 3GTLJ 3S2HJ 1IN7A 2DBBA 3V4GA 4HNVA 1JGGA 2D1HA 1D0ZA 1X3WB 5H6RA 2ACJA 3WE2A 4DGWB 4O5VA 4I2OA 3I4PA 4D7NA 1Z21A 1AKHB 2ESHA 2JTVA 3F8FA 3NEUA 4RAGA 2M2EA 3DTKA 4I0AA 3HRMA 2VQCA 1OR7A 1WJDA 2OJED 3I3LA 5JFRA 4XRMA 4PCQA 5FB2A 4D1QA 5EZHA 1YX3A 2FOKA 3CCVI 1LFBA 4CO8A 4V19K 1O3RA 4M6VA 2KKOA 2IAIA 3BQYA 1O7FA 5DTDA 4NQWA 1S6LA 4FHTA 4JQFA 5C4JJ 1JJ6C 1Q1VA 4MLOA 2ZMEA 3NAUA 4DIQA 4J01A 3ZQIA 3E7LA 3MKWB 2JWTA 1HW5A 3O2PE 3AG2H 4OU0A 3FXUA 2QF7A 3FXOA 5HNFA 2R0QC 3KP4A 1WI9A 2DK8A 3EUAA 5EEHA 5L3FA 1GV5A 1XCVA 2MLGA 2BY2A 4IO9F 5DCMB 4WXDA 1BOAA 4ZH4F 4H0EA 1W5CC 5FKOA 3CJRB 1IRZA 3L2WA 4BACA 1QVUA 3WG7H 1TP4A 1GV2A 2LRDA 1OYWA 2Z2SB 2DQLA 4XRSA 3T8TA 2OCCH 4NDLA 3FMRA 3HGYA 2EIKH 4OIRF 1BC8C 2HNHA 3TW7A 3K4LA 3V8LA 4GO1A 4U0WA 4LG0B 5LRRA 5J6XA 1D1AA 3WTSC 4BE1A 4KJZA 3S93A 2QCOA 4X0GA 3GCMA 2QSFX 2QQBA 4G94A 5LHGA 4NHJA 2W48A 2K9MA 2RKHA 1FY7A 1T98A 1VF9A 2EFOA 2MW8A 3JTGA 3GTQJ 5GTIC 4AYBA 5HDNA 3OS1A 1D5YA 1U5TB 1RETA 3IH4A 1J75A 2LDUA 3J80Z 4BEHA 3KPHA 1UMQA 1SEUA 5DYMA 2ECBA 3HJEA 2PMUA 3G1LA 2L9VA 1IDZA 2X1CA 3GZNB 2GA1A 3CC4I 4FISA 1TNTA 1K78A 1EA3A 2W82A 3M8FA 5IOYA 4RM3A 5L3EA 5EG0B 2A6TA 3KFWX 1FMVA 5E3LA 2QVOA 5JLWA 1FZPB 1X58A 2Y48A 2V9VA 1K61A 4BE2A 5HLGA 5FD6A 1T33A 2YSRA 3GWZA 1K4TA 3MD2A 3MCZA 4MQ9F 1QGPA 3ZQQA 3CF5F 1YIOA 4M9ZA 3OS0A 1A31A 2NS0A 3I71A 1TC3C 3ABTA 4G6TB 2CV0A 2FD5A 3RPUD 4BS9A 4HEA2 2JJ7A 1JGSA 2DDAA 3I59A 2OTLI 1J7KA 3QPLA 2ME6A 3RKWA 4P9FA 3R60A 2E1MC 2K40A 1P92A 3S1NJ 1Z6TA 4M73A 3GTKJ 3F9KA 1T08B 1QZYA 3F6VA 3IP4B 5BS6A 4IZZA 5E3MA 1I5ZA 1O3TA 1RC9A 3GYHX 3WTYC 1W1WE 2FUG2 4BH9A 5DUIA 2OQRA 2KMUA 3JRDA 2MGQA 3HOUJ 1FSHA 2EJRA 2HXIA 5IT9Z 3RTRA 1BR2A 3B6AA 3W3CA 3ABLH 3OY9A 3P7NA 3LMMA 4CCJA 3F22A 3PNTA 2QEXI 2H1LA 4PGHA 2EZHA 2M34A 2P5VA 4QTRA 4Z6YA 4BXUA 1A6QA 4UV9A 3S16J 3KLOA 4BU2A 1RZ4A 1DPRA 3G73A 1R58A 2MBFA 4JBAA 3HOWJ 1Y1VJ 1YE9A 2PMZA 2QKLB 1IN8A 3KP7A 2Z1DA 1WCMJ 3M7GA 1ZGAA 4X1EA 4XKWA 2DOEA 2HI3A 1WSUA 4ZYEA 2HDDA 2JN6A 3ZOBA 3KP3A 2IS1A 2Y0SA 1ZRFA 1PUFA 2YUSA 1H0MA 1JHFA 1X3UA 1RUOA 1LVKA 4F55A 1X1AA 4IHVA 3BLYA 4V2GA 1ZRCA 2RQQA 3VWBA 1BJZA 5J4VA 4BHPA 4C3IJ 5BPDA 3CUOA 3WTXC 1FX7A 3PO3J 3DV8A 3J80R 4L9TA 3ZGKA 2O8XA 2DMNA 1FIPA 2HWVA 1FSEA 3BR0A 4G12A 1P7IA 1GXPA 3OYLA 2WV0A 1GT0C 4OAZA 2XSDC 1R00A 2W7NA 3WE3A 1JUPA 4UB6C 2LY9A 3TMOA 3R0JA 2JUGA 3ZMDA 2GQQA 3JTHA 3L09A 5FLXK 3S17J 1HA8A 2VBXA 3BTLA 4YFKF 3BWGA 4A5NA 1VQMI 3DXJF 1BOBA 2CQQA 2RDPA 2QQAA 2X4HA 1IN6A 4LLLA 1QPIA 5J1YA 3JRAA 2A69F 4GYIA 4XOPA 2XF7A 3HTUA 4UUTA 4E7HA 1IXCA 4BY7J 3K0LA 2K9SA 2WY8Q 3JRGA 4R8HA 2WB1N 5D6EA 1V4RA 5J3LA 4A0ZA 1MH3A 1R1UA 2E7WA 4CYCA 4YFNF 1YOVB 3DBLB 1ETOA 2R7FA 2EK5A 2FMLA 1YTYA 2EWNA 3KZIC 5IYBJ 1ORKA 1SVOA 3W2WA 2M8EA 2CQXA 2Z16A 3OYFA 1OCRH 5CVVA 1NK2P 1X19A 1BI3A 3TL4X 4XN0A 4GXOA 2R5YA 3HPHA 4IQJA 4HRIA 4F3QA 5IT9R 2LFBA 3LSRA 4XORA 3H0DA 4PSXA 1AA7A 4G7OF 2VLAA 1QPMA 3DWLE 1S29A 3BJ6A 3EUHA 3GF2A 3E6DA 1B9NA 3LSHA 3GTPJ 5M5XJ 2M30A 1VQLI 1W7PA 5C44J 4RMNA 1SMTA 3PNVA 2ZSHB 1M1EB 5TRDA 4KFCA 3F8CA 4C30A 2Y0MA 1U8BA 2HFHA 1LDDA 5LRSA 3M1EA 4HV5A 2E5ZA 1QRYA 3LSJA 2M35A 4G6QA 4RB3C 1WJFA 4G9YA 2KZVA 2VKDA 1NG7A 1W0TA 1ZGWA 1Z0XA 4RAZA 3G6EI 5HLIA 2HKOA 2L2OA 2PLYA 2HOEA 3GUDA 4I7HA 1XCBA 4B47A 1IG7A 1XS9A 1Z67A 3I56I 3HOSA 1F5TA 2F48A 2WTEA 1LEBA 3CESA 3G1MA 1YX5A 3CDLA 2F6CA 3A52A 3K1NA 1FNNA 4O6JA 2LR8A 4HPQA 2E5NA 2FOWA 1Y8QB 5K7ZA 4JOMA 1YFHA 1AOYA 1KQ8A 3JAMK 3KETA 2LF8A 4UHTA 1I27A 2STTA 1FEXA 3H9JA 4O3MA 1VFCA 1JXSA 4OIQF 2A3SA 2AXLA 4XLCA 4CYDA 1T39A 2X85A 2RGVA 3IRQA 3B73A 2JK3A 1F9NA 1UELB 3BZCA 4HDVA 5K5QA 4HX7A 1IN5A 1FTTA 3F3XA 3EETA 4A3FJ 3L9FA 1W5SA 2EV5A 4II2A 3ELKA 4C2MJ 2KRHA 3MWMA 3T5XA 4ESFA 2JA6J 2BBYA 1DP3A 1OYYA 1HC8A 1S7EA 5LGTA 3QOEA 3TO7A 3OYNA 2VC0A 2V6CA 4YRVA 3WU1B 1FWZA 3K9TA 4E70A 5B1AH 4ZZDA 1ZAOA 3ZMZA 1SFKA 2LKPA 2P81A 3PSIA 3BG3A 1OYIA 4HAMA 3CP2A 4BY1J 2EFPA 4M3EA 1W4MA 3FF5A 1PDNC 4U0YA 4JP0A 4LIVA 2R5ZA 2R7TA 1Z91A 1MW7A 2EILH 1ACIA 1I1SA 3FMSA 3ONQA 2HGCA 1FJLA 4LITA 5L3GA 3FWEA 4EMSA 4AIDA 2G0EA 4N9HA 3VDXA 3ZPLA 2MZ4A 1YITI 2GBYA 5E17F 2K86A 3LSIA 3HKZN 1YW8A 3GVAA 2EINH 1DP7P 2FBKA 2OF7A 5EEGA 4EM2A 3TEDA 4DZPA 2PJPA 3TQNA 2XGEA 3L2QA 2V1UA 2VI6A 2NVQJ 4HW0A 1Z77A 2CWEA 3HUGB 3A01A 3L2CA 1HDDC 4L5JA 3S32A 3ZQFA 1ETQA 3WGGA 2VONA 3BG6A 3SEQA 2JA7J 4PJMA 2QBYB 3F8BA 4A3GJ 1N78A 1ZK8A 2IP2A 2A68F 1F1ZA 4XBFA 5B3SH 3V8KA 4ZTJA 5FD5A 2ELJA 2QZ8A 1SVLA 3HEFA 3COAC 5F6FA 2CW0F 4DOZA 2EZKA 2W85A 1LE8B 3PIOF 3QOPA 3Q3SA 2OAZA 5JVTA 3DPTA 3E0JB 3C2BA 2XROA 2VKVA 2QKMB 5F1RA 2JT1A 1B8IB 5IT3A 2R7QA 3AL0B 5FKNA 4K2EA 1L3LA 3B02A 2ZXJA 4TV7A 1BIBA 2X1EA 2F4MB 5TGTA 3SDBA 2JA5J 1MNEA 2KIQA 4BXFA 1SFOJ 4AU7A 1I39A 1WI3A 1T38A 2FBHA 4V2FA 4ON0A 2E1OA 3BTIA 2TCTA 1LQ1A 4BDYA 4E7ZA 3FK6A 2CQKA 1FYKA 4UY8I 3LSKA 3MQ0A 4GCVA 1YW9A 1WJCA 3RYPA 3LQRA 1HKTA 3OIOA 1H8AC 1B4AA 4A6DA 1D0XA 1XGNA 3E5QA 5LLQA 4FCYA 3FM5A 3FK7A 4A12A 1WFXA 2YPRA 4LJZF 2F5FA 4QIWN 4CA0A 2Q1ZB 3PJRA 4E7KA 2K85A 4W1UA 4L9NA 1O4XA 3CCQI 2Y9ZA 2DMQA 3CF2A 2VJJA 4B3XA 1FOXA 3SQNA 1OJLA 3DKWA 4M71A 3W6VA 2LY1A 4NC7A 1PP8F 3J7YJ 3FX3A 2EBIA 3S3MA 2BE5F 2LK2A 4L18B 4HQEA 2R7SA 4BQOA 2IS6A 2PN6A 2HQAA 1W0UA 1MSEC 2XKOA 4KMFA 2XSJC 4Y3OA 1EH7A 3BG5A 1YS7A 2OUMA 3IV5A 1CF7B 3E5UA 3TBIA 2HQRA 4L0ZB 1VQ5I 1KU9A 2FX0A 2GLOA 1B59A 4UV8A 3FDYA 4U7DA 2M3AA 1V55H 2LBFA 2UZKA 2FJ1A 1IC8A 5F64A 2FQ3A 2KPMA 1VQ9I 2H8RA 1BR4A 1TQPA 3I5UA 3FXRA 1XD7A 3U1KA 2CV1A 3LSPA 2A5YB 1SD6A 2L7KA 3FHNA 3HZJA 1HKSA 2OU2A 4CCKA 2V9PA 3CC2I 1WJEA 1TT0A 2K9LA 2CFOA 5CVJA 5LGUA 4IF4A 2F5CA 1S8NA 2L54A 3CCUI 3SHFA 1TL8A 2OC6A 2GIVA 3BR3A 1HF0A 2LC2A 3IC7A 2KIFA 3LFKA 2UXXA 3GZ5A 3K4NA 2ZJPF 3ZQCA 1U78A 1KA8A 1R5HA 2DO7A 4DYCA 2L02A 1T2KA 1TWGJ 3ZN1A 2WAQN 1ETXA 5GAEJ 5HLHA 3J7AY 2X9DA 3VYRB 1Y0NA 3CUQC 3GFIA 4YG2F 2DJIA 1MIJA 2IGOA 1AWCA 2E1CA 1G3SA 3ECOA 5FKLA 1MBGA 1E3OC 4OIPF 1QQIA 3QAHA 1NG6A 1TWCJ 4BBRJ 3L00A 1HW2A 2ADUA 3BJAA 2X6YA 3JCUC 1ZG3A 4R79A 4R1HA 2V79A 4XSXF 3FXMA 3CO6C 3S3NA 2DLLA 4XLEA 2KT0A 2XDVA 2E60A 2VB6A 1SAXA 5H20A 4RGXA 1MZBA 1BI1A 1KYZA 2VL8A 3MZYA 2XUBA 3JSOA 2A07F 4ETSA 4DJAA 5ICGA 4XNFA 2VBZA 1HQCA 2EV6A 4LK1F 5BPIA 2ELHA 4EJOA 2P6SA 3ECHA 1A5JA 3PFIA 4BJTA 3JRIA 1UAAA 1B9MA 2LKXA 3KE2A 3PQKA 1GUUA 2XGCA 2Y30A 4Y52J 1W7PD 3BR5A 1JUSA 4KICA 4A3KJ 5DEQA 2HVRA 1R71A 3I64A 1Y1WJ 4BL0B 1OKRA 1R4NB 3W6KB 1OR7C 1Z6RA 3MKZA 4E4HA 1XX5A 4ZYHA 5HOOA 2VPRA 3K6GA 2UV1A 3HBLA 4CH7A 1G6NA 1P2FA 4A3BJ 1I50J 4MFEA 2IS2A 2ZMEC 2BOLA 2M87A 4F93B 1FP1D 2K02A 2JUCA 1KYWA 1S72I 2E1MB 3J81K 1D0YA 2BY0A 2AO9A 2YU3A 3TP0A 2VBWA 2O9LA 2NVTJ 3GTMJ 1O7LA 2DT6A 4CCLA 2GOXB 1XG1A 2CO5A 2LSOA 4CCOA 2TRTA 4D7MA 1P6RA 1OCOH 4P55A 4HSTA 4HG2A 3WU2C 1LDJA 2LY2A 4NNJA 5D5WB 5CVIA 3H3UA 1WJ5A 3PO2J 5CVUA 2JPBA 1I1GA 2JPCA 3GEZA 3JRBA 2D2WA 5J8CA 1WKMA 1N75A 1R22A 3AKZA 2HDCA 3AAFA 1LDKB 2HKXA 1FOKA 5HODA 1RR8C 3IWZA 4OIOF 2IXSA 2NOGA 5FRMA 2PJRA 5GPAA 1IF1A 1OFCX 2AQEA 2E1NA 2R7DA 3DBHB 1GHCA 1O57A 3BCAA 1ZRDA 2E2JJ 1V5GA 1YJWI 3J7ZI 5DV5A 2X1DA 3H5NA 3O8GA 5F1JA 1CQTA 1TNSA 4RLQA 1G3WA 4LLGF 2ME0A 2IGNA 3PFYA 4M3DA 3HDDA 4E7SA 1JKOC 2GXBA 1TZLA 2OQGA 5J47A 4Y15A 1H9TA 2ZNZA 3BR6A 1JKPC 4A3LJ 4L0YB 5KCMA 5FLVA 3M9AA 4IEJA 4RAFA 2YX4A 2A6HF 4A3IJ 2HEOA 2E19A 2ISZA 1V54H 1ULYA 4S0HB 5J1UA 5LEJA 1WWXA 5CLSA 3OSGA 2R7UA 2XAFA 4YELA 4IHTA 1R7JA 2JQ7A 4PJNA 1RRJA 2ZNYA 2V4JC 4F92B 4XK4A 1KONA 1MMAA 1FOWA 1RKWA 2BVLA 2FNAA 5LHHA 3P5JA 2E7XA 3R0AA 4G7ZF 1B72B 2E2HJ 4RB2C 2M45A 2QENA 3DCFA 5ED4A 1T0FA 4XMYA 1IV8A 2MD0A 2XC7A 3F8MA 3RSNA 1OCZH 2L0KA 4BHBA 3CJTB 3CCRI 2H6BA 3K4CA 5M5YJ 1IZ1A 2HQ5A 3Q9SA 4BQQA 3KCCA 4AWXB 5FFXA 1U6GA 4ZJZA 5GAHJ 5L3BA 2FA5A 3DEUA 2WV1A 1QZEA 4PFOA 1XTAA 2O7OA 2LNBA 3K4MA 1RQ6A 3HPGA 2XB0X 4GFBA 5ERIA 1KZHA 2LKSA 5BMZA 3KZZA 1ETKA 1AKHA 4FETA 3U2RA 1AHDP 5EYRA 2FNPA 4RDUA 2HOAA 2X48A 3WODF 1TTYA 2ZJ2A 2F5DA 2XAGA 1USTA 3OYCA 4F7ZA 1KU2A 2QUFA 2ZXHA 1WPKA 4UUSA 3CMEI 2H27A 3E6BA 2KP6A 2EH3A 5KAFC 1IV6A 5B1BH 3GMEA 2BVMA 2O8KA 4CICA 3IKVA 1JT0A 3KP5A 3MKLA 1ZG1A 2JVHA 2B7EA 5BQTA 5A2QZ 2Y0SN 2CSOA 1BW5A 2M1BA 2L7FP 4HYEA 4MNUA 4U87A 2DFFA 2JA2A 4C2TA 5HVQC 2HTSA 2RVCA 2PG4A 3M1CA 4DYRA 2E35A 3NWTA 3QODA 1Z7UA 3F23A 5JR3A 5CYVA 1BN5A 2KL4A 3ZP5A 3H35A 2BZTA 4C3HJ 3CCSI 3S3OA 2XAHA 4IHYA 1XMXA 1MMSA 3D5SC 5DCMA 3FM3A 2DI3A 2H6CA 4XICA 5CKTA 2RNJA 4P1WA 3C7JA 5EGOB 4IHSA 4EGYA 4MQVA 3SFIA 4P9UA 4CZZA 3OYDA 4L9VA 3GZ6A 1PJRA 3QP5A 3R6SA 2LVSA 4DNCA 4YFXF 4L5EA 1V5FA 4E7LA 4LG0A 2DJNA 3WGIA 3ZQHA 5E20A 3PQJA 1X1CA 1MSFC 1QU3A 5F04A 3MN2A 2V1XA 5BNGA 3KEOA 1MBJA 2DXIA 3OSFA 1YQAA 2IEKA 1PUEE 1Y56A 4P5OA 4KT5C 2ZB9A 1WJAA 1FYMA 2Q2EB 2P8TA 2VJ5A 3ZMVA 3E6MA 4DW6A 2DAOA 3Q0VA 2QGUA 1U5TA 2LREA 2GXGA 3OYAA 4A3JJ 5B5EC 1A35A 2V26A 3OYMA 3OWTA 1ZREA 2R7XA 3JREA 1IXRC 1EH6A 3DKYA 5GPCA 2DU9A 4HSRA 2V6EA 2K3FA 2EIMH 3HHGA 1HLVA 2Z3YA 5D4RA 6PAXA 2BW3B 2XGDA 1XDSA 2FEZA 3FXQA 3HRTA 1USSA 3BP8A 3EUHC 3L7WA 1MJBA 5DM6F 1XSXA 2HXOA 1SFUA 3QRFF 1X2MA 2NNYA 1S3JA 2ZO4A 1IGNA 2C6YA 1FP2A 2LLKA 2WB1A 4WXHA 4I76A 5D6FA 4BDZA 3CO7C 4H4KC 2X6XA 2CUFA 3H36A 3TKYA 3A0HC 3WG9A 1U9NA 1WRJA 2OBPA 2L3DA 2BY1A 2DCEA 4S05A 1K4SA 4LK0F 3GFMA 2GWRA 2K9NA 2A6EF 3HSFA 1VQOI 4E7JA 3CJNA 4M3FA 4RAYA 2K7LA 3RDIA 1BIAA 1R9TJ 2CS3A 5A2QR 4MEXF 2L4MA 3T8RA 4WCGA 2COBA 3F8NA 3Q5FA 2Q0OA 2FXAA 5K7FA 1UZCA 1IW7F 3KYDB 5DCFA 1Z3XA 5C4XJ 4CXFA 2VQHA 4NC8A 4KMUX 5LHIA 4XONA 1YW7A 2GA2A 2WBMA 3BR2A 1LFUP 3KEYA 2ZJQF 3HTSB 1LKXA 3R61A 3A1YA 2MABA 2IBDA 4YIIA 2NVUB 3I55I 3WTVC 1TW2A 3K2ZA 4ZYGA 1RKTA 4OAYA 1BJAA 4N0BA 1R4MB 1MJ9A 3MEXA 1UB9A 5D5VB 1D5VA 2DA7A 2ICWG 4KT6A 4BJ6C 3NQOA 3EYYA 3OIPA 3K2AA 3NRVA 4C2UA 3I0TA 4EQQA 1QVTA 1N25A 3JRFA 3SFZA 4BHCA 1V5EA 2UWMA 2DN0A 4XR6A 3CLOA 1DU6A 2WA0A 3DLAA 4Y7NJ 2XVCA 3DFGA 1FBUA 1ZN2A 1X1PA 4YEJA 4KIGA 2QM3A 3OYBA 1P4WA 2VIXA 4M3BA 2KQRA 3M07A 1R5ID 3H1CA 2QWWA 1L0OC 4UVCA 3QYEA 4JX5A 5D8LB 3CLQA 4EV0A 2B63J 2XAUA 4KA4A 1ETVA 3D1NI 1EH8A 3K1PA 1UG0A 3LSGA 3LAJA 5EEAA 1MBFA 3T0YA 2R4GA 3L2UA 2P7CB 3JRHA 3HOZJ 4F52A 1KU3A 1KGSA 3QYBA 4BE0A 1P4XA 2XF6A 3OYJA 4I09A 5TJJA 2XGXA 3OOUA 4W97A 3HOXJ 4XIDA 1H88C 2GM4A 2LD5A 4C3JJ 1R49A 4UXNA 2D45A 4WF2A 2XIGA 1U8RA 3H0GJ 3J80K 3C3WA 4MIMA 4AIHA 3BROA 1F43A 2RC4A 2XKPA 4U7BA 1G4DA 4IPAA 4M9XA 4A0XA 3UKGA 1TWHJ 4BUPA 5FJ8J 4XLHA 2I8DA 3I58A 5DS9A 2M0CA 3S14J 2MD5A 1UHWA 4MHGA 2Q8KA 2DTZA 3HC7A 3G4SI 1DUXC 5JHFA 3M8JA 1OISA 4RM2A 4AVZA 2IPQX 3P9IA 2VASA 2OV7A 4KNYA 4EM0B 2HQNA 4XRFA 5BOXA 3TDUC 1Y8RB 3ZXSA 1LUJB 1C0WA 3BJOA 1IJWC 2BV6A 1FT9A 1H89C 3HHHA 2HVSA 2H1KA 1JE8A 2FU4A 4ZC3A 5GTHC 2H09A 3KLNA 2MG4A 1LB2A 3HKZA 2DQRA 2ZCWA 3SEZA 1YRNB 3ISPA 2OD5A 1QNTA 3QU3A 3VSKA 3OIQA 4B4CA 5HDGA 3LQQA 3WTUC 2NAZA 3G1OA 3KZYA 2VE8A 3EDPA 1FOYA 2BYVE 4QSHA 5HLTA 3RPUA 2HZDA 5IT9K 3DP7A 1POGA 3A2KA 2LF7A 1R6RA 4EATA 3KYCB 3JW4A 1XN7A 2DT5A 4F91B 5K1YA 4UNOA 1HW1A 4EJWA 3CUQB 4A93J 1I3AA 2DA6A 3A03A 2L7MP 1ZGJA 1BA5A 1K6YA 1TBXA 4Q4ZF 2RAEA 3Q0WA 3VODA 2HR3A 4XSZF 1VQ7I 2OZ6A 2X6WA 4M72A 1BI2A 1ETYA 5B66C 5F08A 5A2QK 4ZYDA 3DU5A 2JSCA 3M3YJ 2KLOA 1R23A 2CW7A 4Q48A 1D1CA 5AONA 4MGRA 4ESBA 1WVRA 4E6KG 3M4OJ 5DDGA 2Y2ZA 3U21A 4JYKA 5AIPA 3K69A 2CRGA 5ILSA 3DU6A 2LP0A 1A04A 4II3A 3EUKL 3AG4H 3SZGA 4GGGA 2I10A 1Q1HA 2BXYA 1TQMA 2MLKA 3PUBA 1LVAA 3VPRA 5EZGA 4WK8F 3GFJA 2LTPA 1FYLA 4Y33A 2ZBKA 2ZSIB 1S9HA 3KYLA 1UJ8A 3DPUA 3W2VA 2P5LC 2EZLA 1MMGA 2HYJA 4RGUA 3PSFA 3H92A 4WXCA 2ZXIA 2DYSH 2BY3A 3ABMH 2XHKA 1VQKI 1R5GA 2DDBA 3RQ4A 4LB6B 3IL2A 4NQWB 5IP9J 1J59A 4MTEA 4HQMA 5GAGJ 2KDOA 5HS9A 1Z3YA 3UNGC 1VQ4I 4XL9A 1SMYF 1SD5A 2JSPA 1IDYA 2ZMEB 1HDPA 2DMUA 3DBRB 5KHDA 2CUEA 5DD4A 5E8GA 1E3PA 3OMYA 5IP6A 3IH3A 2HPMA 5ILVA 3FXJA 3KIOA 4DQ2A 1HOMA 3VYSB 2QSHX 4IRHA 2WADA 4B43A 4Z2YA 1XC5A 2EZIA 1ON1A 2X0LA 4HX4A 2MUNA 5E8IA 1XGSA 3OV8A 3OYGA 1UHSA 3I54A 3GX4X 4OWRB 2KDZA 4UUVA 3FXKA 2LMDA 1ERDA 1T95A 1XPXA 3KX2A 3OL3A 5CQEA 3CCEI 5FRNA 2CMPA 3MVPA 2B9SA 3AG1H 3CD6I 2YX7A 2DA3A 4GDFA 1VQNI 3E3VA 4M6YA 1U2WA 1JTYA 4AD9A 2HTJA 3NARA 1ODDA 2NOJB 3H9GA 2VXDA 2W00A 2UXNA 2RN7A 1HBXG 4L5IA 1NH3A 3HUGA 2LG4A 2VJIA 3AG3H 3IH2A 1J9IA 3ZQ7A 3TOBA 3QPHA 1YHQI 4FTHA 4EJVA 3DTIA 3K10A 1MBEA 3ASNH 2QBYA 3LFUA 3BTJA 4A5MA 3CMYA 1VTNC 2O3FA 1SC7A 2VQLA 3GLLA 3LSTA 5FLXZ 2PMHA 2IA1A 1UHMA 3CJQB 3QPSA 4QWQA 1DDNA 3HG9A 2HPIA 3BTCA 1EJ9A 3HOVJ 1KQ0A 3SZPA 3VSLA 1TT5B 3BDDA 3I4NJ 4EJTA 1B8IA 1Y0UA 4BEHB 4FE7A 2CW8A 1XB4A 2A05A 5E1XA 5JLXA 4M9SA 1K78B 1OMIA 4XKVA 2WAQA 2D1VA 3CP8A 4A69C 2GXAA 1MDMA 2N8GA 1CGPA 2O0YA 2EPFA 2VBYA 4OOIA 3S1MJ 1B1BA 2FMYA 2IW5A 4HDUA 5DUKA 5D5XB 2PI0A 1FBSA 3E5XA 1VZ0A 1QZZA 2KHMA 5M5WJ 1ZLJA 3LSMA 5GADJ 2JRMA 2HDWA 4N9IA 4QPOA 3S15J 4FT8A 4HOBA 3OS2A 2A5WA 3ZMTA 4IHXA 1E2XA 3I59B 5CQGA 1MBHA 4CCNA 1IRFA 2VOPA 2EFNA 3HOYJ 4KIFA 4NB5A 3GO5A 5DM7F 3L2VA 4UB8C 3IKTA 1ONVA 2P7VB 1FMWA 5C3EJ 3RIRA 2BHYA 2ID6A 4FASD 3CTAA 1JUMA 4IVNA 3OYIA 1UG2A 3H5AA 5HNHA 4CZCA 1U0JA 1PVEA 3C18A 1ZG5A 4RB0A 4ZDLA 3WHCA 1TWAJ 3EPZA 3IHUA 2VKEA 1BC7C 1AU7A 4YIRX 1CF7A 4U88A 5FROA 3F0CA 5LGNA 5FKKA 3PUFA 2EFWA 3LA3A 1MMDA 3BC8A 3LA2A 1RI7A 1KQ9A 1O3SA 4UUSB 4G8XA 2P5KA 4B48A 4OMYA 4PJJA 4RS8A 3M8EA 5L3DA 1IXSB 2L4AA 5AIQA 1EF4A 2KJCA 1Y6IA 3C2HA 3K4KA 2MH9A 4AVPA 4P96A 5LEKA 2M4GA 3ULQB 2M0MA 1YG2A 5J40A 4CSWA 3ZN0A 4ENNA 4PUSA 1ITYA 5M3MJ 2MFZA 4BAYA 1YLFA 4MEYF 5J8FA 2MH2A 1X1BA 2NYXA 3DEEA 3RKXA 1TW3A 1T6SA 1PUFB 2R7VA 1D8KA 3JR9A 1ZELA 3ZCOA 5FLXR 1J0RA 4RBOA 4XLFA 3H3VK 9ANTA 3ZQLA 4Y17A 5ILUA 2EQRA 1ENHA 3JAMZ 2GZWA 1UCRA 2AXTC 3CMMA 2XPWA 2Y31A 5TISC 1QA6A 4AYBN 2M8GX 2GOMA 4PZJA 3LA7A 4NBQA 3BZ6A 3I9V2 2VQGA 4ENKA 1XSVA 3FKIJ 1U9OA 1GXQA 3PM1A 1VQ8I 4M74A 3HM5A 3MKYB 1APLC 2ISYA 3C1DA 1Z9CA 2XRLA 4UVBA 3BG9A 1G8XA 2P4WA 2IRFG 3CCYA 1T56A 1QO0D 3VFZA 3ABUA 2R7ZJ 1HCRA 5F0FA 2QQ8A 1T0FC 2VN2A 3ZMSA 3PL8A 1H9GA 4CYCB 4ASNA 2CU7A 1W5TA 5D8KB 3TO6A 3O3KA 2PBIA 1MH4A 2CFXA 1X1DA 1W36C 3LWFA 2L5QA 1GLNA 2DODA 1BL0A 4PFPA 4I99C 3CCLI 3FISA 2EB7A 1R1VA 2FE3A 2R7WA 2R5YB 2ZXWH 5K5RA 5J1RA 3QYFA 2B0LA 3KP2A 3OR1C 5IOZA 3N4MA 2Y9YA 3S1QJ 1SAUA 2EA4A 2IS4A 5JI6A 1LPQA 4A6EA 4HNUA 1XGOA 3IRRA 3K70D 4LLNA 4C9YA 4N4OB 2NVXJ 5M3FJ 3HL2A 2OPTA 3ABKH 4BNCA 5EJCA 1ZKGA 1W7PB 2A61A 4ENJA 4RB1A 2W24A 3C2GA 3DTEA 1IAWA 2O61A 1G3YA 1JKQC 5FGMA 2FSWA 3NWSA 2W84A 1MNDA 2M4KA 3ML6A 1GVDA 5J4YA 1DGWY 3ZMUA 4DBQA 3GFLA 2PMZN 2P0TA 4FX4A 2WAFA 3VB2A 2EV0A 2V1DA 4D5FA 4EGZA 2L9NA 2XRNA 2KFDA 4RA2A 5FKMA 4BXXJ 3F21A 3H5RA 2ZFUA 2G7HA 2MC4A 2VC1A 4ZDOA 1S5LC 2W57A 3W2AA 3JAMR 1LNWA 2IA0A 2NVYJ 2WC2A 4PJ0C 5KNLA 1GVJA 2XV4S 4ESJA 2V9KA 2YR2A 5H6QA 3WTZA 1XDUA 3S8PA 4G7HF 3HSRA 5DD8A 4I6ZA 2IA2A 3HOTA 4BQNA 2NS7A 4ZYAA 5EF6A 4D9JA 1STZA 1O3QA 1ZLKA 3K1MA 4LD5A 3HXLA 1WJBA 2DMTA 3GLXA 2FF4A 1K83J 5FFZA 2M7BA 4BGDA 1BR1A 4PK4A 3LAPA 3DLLF 3RZDJ 2DFHA 2DMPA 3DEWA 1LFPA 1LJ9A 4NC6A 4MFDA 2CUZA 3AFHA 1OCCH 4OMZA 5E79C 5GP9A 3RKYA 2K27A 2ZJRF 3MZHA 4BYYA 3BPVA 2CUJA 2FBIA 4B8XA 2XAJA 2DTRA 2Z5UA 1BW6A 4HF2A 1U5TC 2VODA 4A3EJ 3OOPA 3RJPA 1VNDA 3PNYA 1P7JA 1Y39A 3V7CA 1SVMA 4HF1A 2D5VA 2ETHA 4AIJA 3G2BA 4D5CA 5IYDJ 2V1NA 4B44A 3MMYB 2H94A 4ENMA 1P4AA 1V3FA 4EVIA 3ZRGA 5E18F 5E3OA 5F0CA 2YS9A 3S1RJ 4FE4A 1TLHB 5H2FC 5LFAA 3I4MJ 2BGCA 2HVQA 1DPUA 3T1BA 5EG0A 3R4KA 2R5ZB 1FTZA 5E1ZB 5D4SA 4HNTA 4DZJA 4IRGA 4KITB 2JA8J 1UFMA 3CDIA 3REOA 3ZQGA 2DFEA 1I6XA 4M6XA 1ZH5A 1ZQ3P 4G6DA 2R7OA 1B72A 2O03A 2K4JA 2VUMJ 3BR1A 4IQ4A 1RR7A 1OQYA 3ASOH 4RGSA 2AS5F 2W1OA 1J5YA 2NNNA 5K5OA 4FX0A 4A2UA 3DPLC 3PIPF 5LD2C 2IGKA 3TW6A 4KDPA 4PGGA 3DKXA 3K4BA 3A01B 3QPTA 2DYRH 3FIWA 2F2EA 2NS8A 3SDGA 2X98A 3Q0UA 1YS6A 4KIBA 1MD0A 4RLFA 2YU9J 2VT2A 3BG7A 1N77A 1WQ2A 1YJ9I 3A4CA 4IKFA 2VJ4A 4BKXA 4IXAA 1Z7LA 3A0BC 1WHUA 1J2XA 2HOTA 2GAUA 3TOAA 3B6CA 1GDTA 3BCBA 2RREA 4DYQA 1VI0A 2NXNB 4Y4RA 1HSTA 4AM3A 1MMNA 2AHQA 1Z1DA 4FQGA 1E3HA 2DT7B 2E71A 3BZKA 2WWYA 2EFQA 3OYKA 5JVGF 3FBIB 4ITVA 2OA4A 4RGRA 4LFUA 5CPRB 2ESNA 2M5WA 4U0VA 4LGWA 3JRCA 4LMYA 1R36A 3H9QA 3LL7A 2QLZA 5HS7A 2MVTA 2XASA 1A36A 1REPC 4IOCF 1VQPI 3WTWC 3WTTC 1MGTA 2E36A 5F0HA 5LBQA 4XM3A 3CC7I 3TP3A 1RNLA 4I98B 1MNMC 2IJLA 1WH7A 3WU0A 2X51A 3FHZA 3FXLA 2KIUA 3CCMI 1I6HJ 3GW2A 1QHGA 2IT0A 1F4KA 1NTCA 1XMKA 4A0YA 4Y13A 3E6CC 3N05A 2K3PA 4XLNF 1S7OA 2NRAC 1RESA 2KISA 1EKEA 3SZTA 2R92J 2F5EA 4IRIA 1YYVA 3RPQA 1ZHFA 5EGOA 3BT9A 3GTJJ 4KN4X 1X4OA 2OCEA 2TDXA 4XKCA 1OPCA 1BI0A 4ABZA 3D0SA 3O6BB 4BQAA 3HIFA 3TGNA 3SJMA 1OCTC 1F36A 2FQ4A 1JTXA 2V7FA 2K4BA 3MAJA 3J81Z 2I5UA 2Z99A 3MFKA 1K79A 2Z9OA 2XPVA 1DQUA 4CDGA 2HOSA 1PYVA 3JSPA 3WGHA 4A3MJ 1FBQA 2XAQA 2VOOA 2Y75A 1FIAA 1R1TA 1K6OA 3VOEA 1DGRM 3S2WA 2OTJI 2DA4A 2Q2EA 4GYGA 4XOTA 2X6OA 2LBFB 2L9RA 2ZKZA 3HSEA 1JI8A 4HLXA 2ZFWA 3OL4A 4KN7X 4AIKA 2QSGX 3VEPA 4Q47A 1JKRC 1G59A 1NK3P 1DU0A 3TO9A 2HYGD 3SXYA 2F4IA 2QYOA 3LNQA 2WY7Q 3J7AW 2WAEA 1YJNI 1JHHA 2RV8A 5K7HA 5IP7J 2HS5A 2BW3A 4EM1A 4IL6C 4LG3A 2R93J 1TQIA 4EEFG 4HA8A 2PX9A 4JX4A 3VYUB 1D8JA 3IWFA 5FO5A 3ROUA 3QU6A 2K5CA 2XB5A 3IAM2 1S7AA 2KRFA 1YO5C 3K70C 5E3NA 2E2IJ 3D5RC 2F4OB 2ZC2A 3KP6A 2EIJH 3RI4A 1PP7U 2DOAA 5HDKA 3QQAA 2PQ8A 2H8WA 1MJAA 4QPQA 4HX8A 2LYCA 1ZTRA 3U1DA 5ICCA 1EV7A 5JHUA 2J5PA 4EJUA 4I02A 2CGPA 3K4JA 4ZDPA 3P9CA 2CQ7A 2DA2A 2Y69H 3DQVC 3V7RA 4XRSG 4BBSJ 2MA3A 1SFEA 3OYEA 2MC3A 4KISA 3BY6A 4MTDA 2O5RA 5KAIC 3HRSA 3P9KA 2F5VA 2K9QA 2ELKA 4ANJA 2M9HA 4CCMA 3IUOA 1IRXA 4KYWA 2RNGA 3MZ8A 3L2RA 3HYIA 1FLIA 1FC3A 2P0WA 2O6GE 2HYFA 3W6JB 4BJ5C 1W36D 2KIMA 2W25A 4OINF 2JVGA 4N4NB 3EQLF 1IRGA 4HV6A 3H3ZA 1MDMB 2R3SA 4IOAF 2LOOA 3KEQA 3FZVA 1MBKA 3O8HA 4NUBA 2XF5A 3V8JA 1OCPA 2GIZA 2MYSA 1E0EA 3J81R 1ZARA 4HZFA 3RQIA 5D5UB 3CDHA 2M7AA 3QP6A 1QHHD 3CMAI 1Z05A 3RCOA 2AQFA 3FKJA 2JMWA 2CJJA 3HB9A 1WH5A 3OYHA 4IHWA 4CGZA 2BXZA 2E34A 5L3CA 4PDKA 2FRHA 4L9JA 3BQZA 3SYTA 3CQZJ 2VE9A 1G2HA 3D5LA 1RUNA 2DW4A 4S04A 2CH0A 3CCJI 1SD7A 1ZR2A 5HS8A 2KJBA 1YIJI 2DA1A 2R7RA 3FMQA 4KUMA 4HF0A 3N97A 2Z33A 4XLAA 3ERED 5KVRA 3IAS2 3OR2C 1YI2I 3CZ6A 3LOCA 3VYTB 2RQPA 4MO7A 5E1WA 1XMAA 2P6TA 2ECCA 2UUZA 3G71I 4JX6A 1BM9A 1D3YA 4E7IA 4A3CJ 3EYIA 1RIOH 2MSYA 2JZYA 3GTOJ 3GTGJ 3ZR8X 2VPLA 2DFIA 2VXZA 4B1RA 1I3QJ 2CYYA 2DK5A 4GRIA 2HZTA 2CG4A 3K7AJ
chains in the Genus database with same CATH topology
1U3EM 4IJAA 2VT3A 1SFXA 2OZUA 4LB5A 2G7UA 3E97A 4JK1X 1XGMA 1FPQA 1HKQA 4UVAA 3F6OA 3G3ZA 4I01A 2J5OA 3BPXA 1IUYA 3GXOA 3DF8A 4WWCA 1HXDA 3Q9VA 3U9GA 4HLYA 1E17A 3RYRA 3BOQA 1B6AA 1ON2A 5ICFA 1HSJA 4QLCU 2DPUA 1QBJA 3F72A 4ZZLA 2PFBA 2IVMA 3I53A 4YIFA 5CJ9A 2EA2A 4Q5SF 4I0BA 3V7SA 5ICEA 4XLPF 3HRUA 1BBYA 2L01A 4CHUA 2JRTA 3CUQA 2STWA 1NHAA 1G3TA 4D0PA 2DPDA 3TDZC 2QQ9A 4WX9A 1MKMA 1ZYRF 3J7AO 1IN4A 2COMA 1KU7A 1SD4A 1LEAA 2PEXA 2BEOA 1K7AA 1XSDA 5CVRA 2G9WA 4HBLA 4B09A 5KK1A 1IN7A 2DBBA 3V4GA 2D1HA 5H6RA 2ACJA 3WE2A 4O5VA 4I2OA 3I4PA 2ESHA 2JTVA 3F8FA 3NEUA 4I0AA 3HRMA 1OR7A 5JFRA 4PCQA 5FB2A 2FOKA 4CO8A 1O3RA 2KKOA 1O7FA 4NQWA 1S6LA 4FHTA 4JQFA 2ZMEA 1HW5A 3O2PE 4OU0A 3FXUA 3KP4A 1WI9A 2DK8A 5EEHA 5L3FA 2MLGA 1XCVA 5DCMB 4WXDA 1BOAA 4ZH4F 4H0EA 1OYWA 2DQLA 3T8TA 3FMRA 4OIRF 1BC8C 3V8LA 4GO1A 4U0WA 4LG0B 5LRRA 5J6XA 3WTSC 2QQBA 4G94A 5LHGA 4NHJA 2RKHA 1FY7A 1T98A 2EFOA 3JTGA 5HDNA 1U5TB 1J75A 2LDUA 3J80Z 5DYMA 2PMUA 2GA1A 1TNTA 1K78A 3M8FA 5L3EA 3KFWX 2QVOA 1FZPB 2Y48A 2V9VA 5HLGA 5FD6A 2YSRA 3GWZA 3MCZA 4MQ9F 1QGPA 1YIOA 4M9ZA 2NS0A 3I71A 3ABTA 1JGSA 3I59A 1J7KA 3RKWA 4P9FA 3R60A 1P92A 1Z6TA 4M73A 1QZYA 3F6VA 5BS6A 1O3TA 1I5ZA 3GYHX 3WTYC 4BH9A 5DUIA 2OQRA 1FSHA 2EJRA 5IT9Z 3RTRA 3P7NA 3F22A 4PGHA 2P5VA 4BXUA 4UV9A 3KLOA 1RZ4A 1DPRA 3G73A 1R58A 2MBFA 4JBAA 1IN8A 3KP7A 3M7GA 1ZGAA 1WSUA 4ZYEA 3KP3A 1ZRFA 1H0MA 1JHFA 1X3UA 1RUOA 1ZRCA 4BHPA 5BPDA 3CUOA 3WTXC 1FX7A 3DV8A 4L9TA 2O8XA 2HWVA 1FSEA 1GXPA 2WV0A 1R00A 3WE3A 3R0JA 3ZMDA 2GQQA 3JTHA 3L09A 5FLXK 2VBXA 4YFKF 3BWGA 4A5NA 3DXJF 2RDPA 2QQAA 2X4HA 1IN6A 4LLLA 2A69F 4GYIA 3HTUA 1IXCA 3K0LA 4R8HA 5D6EA 1V4RA 4A0ZA 1R1UA 2E7WA 4YFNF 2R7FA 2EK5A 2FMLA 1YTYA 2EWNA 2M8EA 5CVVA 1BI3A 4GXOA 4G7OF 1QPMA 1S29A 3BJ6A 3EUHA 3GF2A 3E6DA 1B9NA 2M30A 1W7PA 1SMTA 5TRDA 4KFCA 3F8CA 2Y0MA 2HFHA 1LDDA 5LRSA 3M1EA 4HV5A 4G6QA 4RB3C 4G9YA 4RAZA 5HLIA 2HKOA 2PLYA 2HOEA 3GUDA 4I7HA 1XCBA 3HOSA 1F5TA 2WTEA 1LEBA 3K1NA 1FNNA 4O6JA 1YFHA 1AOYA 1KQ8A 3JAMK 3KETA 2LF8A 4UHTA 1I27A 2STTA 4O3MA 1JXSA 4OIQF 2A3SA 2AXLA 4CYDA 1T39A 2RGVA 3IRQA 3B73A 1F9NA 4HDVA 5K5QA 4HX7A 1IN5A 3F3XA 3EETA 3L9FA 1W5SA 2EV5A 3ELKA 3MWMA 3T5XA 4ESFA 2BBYA 1OYYA 5LGTA 3TO7A 2VC0A 2V6CA 3WU1B 1FWZA 3K9TA 4E70A 4ZZDA 1ZAOA 3ZMZA 2LKPA 1OYIA 4HAMA 2EFPA 1W4MA 3FF5A 1PDNC 4U0YA 1Z91A 1I1SA 3FMSA 2HGCA 5L3GA 3FWEA 4EMSA 4N9HA 3ZPLA 5E17F 2K86A 1YW8A 3GVAA 1DP7P 2FBKA 5EEGA 4EM2A 2PJPA 3TQNA 2V1UA 4HW0A 2CWEA 3L2CA 4L5JA 2VONA 3WGGA 2QBYB 3F8BA 2IP2A 2A68F 1F1ZA 4XBFA 3V8KA 5FD5A 2QZ8A 3COAC 5F6FA 2CW0F 2W85A 3QOPA 2OAZA 5JVTA 3DPTA 2XROA 5F1RA 2JT1A 5IT3A 4K2EA 1L3LA 3B02A 2ZXJA 4TV7A 1BIBA 1T38A 2FBHA 4ON0A 1LQ1A 2CQKA 1FYKA 3MQ0A 4GCVA 1YW9A 3RYPA 3LQRA 1HKTA 1B4AA 4A6DA 1XGNA 3E5QA 5LLQA 3FM5A 4A12A 2YPRA 4LJZF 2F5FA 4L9NA 3SQNA 3DKWA 4M71A 1PP8F 3FX3A 2BE5F 4L18B 4HQEA 2PN6A 2XKOA 4KMFA 1EH7A 1YS7A 1CF7B 3E5UA 4L0ZB 2HQRA 1KU9A 1B59A 4UV8A 4U7DA 2UZKA 5F64A 2FQ3A 1TQPA 3I5UA 3FXRA 1XD7A 2A5YB 1SD6A 1HKSA 2OU2A 5CVJA 5LGUA 4IF4A 2F5CA 1S8NA 2L54A 3SHFA 2GIVA 3IC7A 2KIFA 3LFKA 2UXXA 3GZ5A 1U78A 1KA8A 1R5HA 2DO7A 2L02A 1T2KA 3ZN1A 5HLHA 3CUQC 3GFIA 4YG2F 2E1CA 1AWCA 1G3SA 3ECOA 4OIPF 1QQIA 3QAHA 3L00A 1HW2A 2ADUA 3BJAA 4R79A 1ZG3A 4R1HA 2V79A 4XSXF 3CO6C 2DLLA 1SAXA 5H20A 4RGXA 1MZBA 1BI1A 1KYZA 3MZYA 3JSOA 2XUBA 2A07F 4ETSA 5ICGA 2VBZA 1HQCA 2EV6A 4LK1F 5BPIA 2ELHA 4EJOA 2P6SA 3ECHA 3PFIA 1B9MA 3KE2A 3PQKA 1W7PD 4KICA 5DEQA 3I64A 1OKRA 3W6KB 1Z6RA 4ZYHA 5HOOA 1G6NA 1P2FA 2M87A 1FP1D 2K02A 1KYWA 3J81K 2YU3A 2VBWA 1O7LA 2CO5A 2LSOA 1P6RA 4P55A 1LDJA 5D5WB 5CVIA 3H3UA 5CVUA 2JPBA 1I1GA 2JPCA 3GEZA 2D2WA 5J8CA 1WKMA 1R22A 2HDCA 3AAFA 1LDKB 2HKXA 1FOKA 3IWZA 4OIOF 1IF1A 2E1NA 2R7DA 1GHCA 1O57A 1ZRDA 5DV5A 1TNSA 1G3WA 4LLGF 2GXBA 2OQGA 4Y15A 1H9TA 2ZNZA 4L0YB 3M9AA 2YX4A 2A6HF 2HEOA 2ISZA 1ULYA 5LEJA 1WWXA 5CLSA 2XAFA 4IHTA 1R7JA 2ZNYA 2FNAA 5LHHA 2E7XA 3R0AA 4G7ZF 4RB2C 2M45A 2QENA 5ED4A 1T0FA 3F8MA 4BHBA 2H6BA 1IZ1A 3Q9SA 3KCCA 4AWXB 5FFXA 1U6GA 5L3BA 2FA5A 3DEUA 2LNBA 5ERIA 5BMZA 3KZZA 3U2RA 2FNPA 3WODF 1TTYA 2ZJ2A 2F5DA 2XAGA 1USTA 4F7ZA 1KU2A 2QUFA 2H27A 3E6BA 4CICA 3IKVA 3KP5A 1ZG1A 5BQTA 5A2QZ 2CSOA 2M1BA 4HYEA 4MNUA 5HVQC 2HTSA 2RVCA 2PG4A 1Z7UA 3F23A 5JR3A 5CYVA 1BN5A 3ZP5A 2XAHA 5DCMA 3FM3A 2DI3A 2H6CA 2RNJA 3C7JA 4IHSA 4EGYA 4MQVA 4P9UA 4CZZA 4L9VA 3GZ6A 3QP5A 3R6SA 4DNCA 4YFXF 4LG0A 3WGIA 5E20A 3PQJA 2V1XA 3KEOA 1YQAA 1PUEE 4P5OA 4KT5C 1FYMA 2P8TA 3ZMVA 3E6MA 2DAOA 1U5TA 2GXGA 1ZREA 1IXRC 1EH6A 2DU9A 3HHGA 2Z3YA 5D4RA 6PAXA 1XDSA 2FEZA 3FXQA 3HRTA 1USSA 3BP8A 3L7WA 1MJBA 1XSXA 1SFUA 3QRFF 2NNYA 1S3JA 2ZO4A 2C6YA 1FP2A 4WXHA 5D6FA 3CO7C 3TKYA 3WG9A 1WRJA 2OBPA 2L3DA 4S05A 4LK0F 3GFMA 2GWRA 2A6EF 3HSFA 3CJNA 4RAYA 2K7LA 3RDIA 1BIAA 4MEXF 2L4MA 3T8RA 4WCGA 3F8NA 3Q5FA 2Q0OA 2FXAA 1IW7F 5DCFA 4CXFA 4KMUX 5LHIA 1YW7A 2GA2A 3HTSB 3R61A 4YIIA 3WTVC 1TW2A 3K2ZA 4ZYGA 1BJAA 4N0BA 1MJ9A 3MEXA 1UB9A 5D5VB 1D5VA 3NQOA 3EYYA 3NRVA 3I0TA 4EQQA 3SFZA 4BHCA 2UWMA 3CLOA 2XVCA 3DFGA 1FBUA 1ZN2A 4KIGA 2QM3A 1P4WA 2QWWA 1L0OC 4UVCA 5D8LB 4EV0A 4KA4A 1EH8A 3K1PA 3LAJA 3T0YA 2P7CB 1KU3A 1KGSA 1P4XA 4I09A 5TJJA 2XGXA 4UXNA 2D45A 4WF2A 2XIGA 1U8RA 3J80K 3C3WA 4AIHA 3BROA 2RC4A 2XKPA 4U7BA 1G4DA 4IPAA 4M9XA 4A0XA 3I58A 2MD5A 1UHWA 4MHGA 2Q8KA 1DUXC 2IPQX 3P9IA 4KNYA 4EM0B 2HQNA 4XRFA 5BOXA 3TDUC 1C0WA 3BJOA 2BV6A 1FT9A 3HHHA 1JE8A 2FU4A 2H09A 3KLNA 1LB2A 2DQRA 2ZCWA 3ISPA 2OD5A 1QNTA 3QU3A 5HDGA 3LQQA 3WTUC 2NAZA 3KZYA 2VE8A 3EDPA 2BYVE 3RPUA 5IT9K 3DP7A 2LF7A 3JW4A 1XN7A 2DT5A 5K1YA 4UNOA 1HW1A 4EJWA 3CUQB 1ZGJA 1TBXA 4Q4ZF 3VODA 2HR3A 4XSZF 2OZ6A 4M72A 1BI2A 5A2QK 4ZYDA 2JSCA 1R23A 4Q48A 5AONA 4MGRA 4ESBA 5DDGA 5AIPA 3K69A 5ILSA 1A04A 4GGGA 1Q1HA 1TQMA 2MLKA 1LVAA 4WK8F 3GFJA 1FYLA 2ZBKA 2P5LC 4RGUA 3H92A 4WXCA 2XHKA 1R5GA 4LB6B 3IL2A 1J59A 4MTEA 4HQMA 5HS9A 1SMYF 1SD5A 2ZMEB 5DD4A 5E8GA 5ILVA 4DQ2A 4IRHA 4Z2YA 1ON1A 2X0LA 4HX4A 5E8IA 1XGSA 3OV8A 3GX4X 3I54A 4UUVA 2YX7A 3E3VA 4M6YA 1U2WA 4AD9A 2HTJA 1ODDA 2UXNA 2RN7A 1HBXG 4L5IA 3HUGA 1J9IA 3ZQ7A 3TOBA 3QPHA 4EJVA 2QBYA 4A5MA 1VTNC 2O3FA 3LSTA 5FLXZ 2PMHA 2IA1A 1UHMA 1DDNA 4QWQA 1KQ0A 3SZPA 3BDDA 4EJTA 1Y0UA 1XB4A 5E1XA 4M9SA 1K78B 1OMIA 2D1VA 1MDMA 1CGPA 2O0YA 2VBYA 4OOIA 1B1BA 2FMYA 2IW5A 4HDUA 5DUKA 5D5XB 2PI0A 1FBSA 3E5XA 1QZZA 1ZLJA 4N9IA 4FT8A 4HOBA 3ZMTA 1E2XA 3I59B 1IRFA 2VOPA 2EFNA 4KIFA 4NB5A 3GO5A 3IKTA 1ONVA 2P7VB 3RIRA 3CTAA 4IVNA 3C18A 1ZG5A 4RB0A 3IHUA 1BC7C 1CF7A 4U88A 5LGNA 2EFWA 3LA3A 3LA2A 1RI7A 1KQ9A 1O3SA 4G8XA 2P5KA 4OMYA 4RS8A 3M8EA 5L3DA 1IXSB 2L4AA 5AIQA 2KJCA 2MH9A 4AVPA 4P96A 5LEKA 3ULQB 1YG2A 3ZN0A 4ENNA 4BAYA 1YLFA 4MEYF 5J8FA 2MH2A 2NYXA 3RKXA 1TW3A 1T6SA 1D8KA 1J0RA 4Y17A 5ILUA 3JAMZ 2GZWA 1UCRA 4PZJA 3LA7A 3BZ6A 4ENKA 1XSVA 1GXQA 4M74A 2ISYA 3C1DA 1Z9CA 4UVBA 2P4WA 2IRFG 1QO0D 3VFZA 3ABUA 2VN2A 3ZMSA 1H9GA 4ASNA 1W5TA 5D8KB 3TO6A 3O3KA 2PBIA 2CFXA 3LWFA 2EB7A 1R1VA 2FE3A 5K5RA 2B0LA 3KP2A 3N4MA 2EA4A 5JI6A 4A6EA 1XGOA 3IRRA 4LLNA 4BNCA 1W7PB 2A61A 4ENJA 4RB1A 2W24A 1IAWA 2O61A 1G3YA 5FGMA 2FSWA 2W84A 3ML6A 3ZMUA 3GFLA 4FX4A 3VB2A 2EV0A 2V1DA 4EGZA 2XRNA 3F21A 2G7HA 2VC1A 2W57A 1LNWA 2IA0A 2WC2A 1GVJA 2XV4S 4ESJA 2YR2A 5H6QA 3WTZA 1XDUA 4G7HF 3HSRA 5DD8A 2IA2A 3HOTA 1STZA 1O3QA 1ZLKA 3K1MA 4LD5A 3GLXA 2FF4A 5FFZA 3LAPA 1LJ9A 3RKYA 4OMZA 2K27A 3MZHA 4BYYA 3BPVA 2FBIA 4B8XA 2XAJA 2DTRA 2Z5UA 4HF2A 1U5TC 2VODA 3OOPA 3RJPA 3V7CA 4HF1A 2ETHA 4AIJA 2H94A 4ENMA 1P4AA 1V3FA 4EVIA 5E18F 1TLHB 2BGCA 1DPUA 3T1BA 3R4KA 5E1ZB 5D4SA 4IRGA 1UFMA 3REOA 1I6XA 4M6XA 1ZH5A 4G6DA 2O03A 2K4JA 2AS5F 4RGSA 1J5YA 2NNNA 5K5OA 4FX0A 4A2UA 3DPLC 4KDPA 4PGGA 3QPTA 2F2EA 1YS6A 4KIBA 1MD0A 2VT2A 1WQ2A 4IXAA 1J2XA 2GAUA 3TOAA 1HSTA 1Z1DA 2WWYA 2EFQA 2OA4A 4RGRA 4LFUA 2ESNA 2M5WA 4U0VA 4LGWA 4LMYA 1R36A 2QLZA 5HS7A 2XASA 1REPC 3WTWC 3WTTC 1MGTA 5LBQA 1RNLA 4I98B 2IJLA 3WU0A 3FHZA 2KIUA 3GW2A 2IT0A 1F4KA 1XMKA 4A0YA 4Y13A 3E6CC 4XLNF 1S7OA 2NRAC 3SZTA 2F5EA 4IRIA 1YYVA 3RPQA 1ZHFA 4KN4X 2TDXA 1OPCA 1BI0A 3D0SA 3O6BB 4BQAA 3HIFA 3TGNA 2K4BA 3MAJA 3J81Z 1K79A 2Z99A 3MFKA 2Z9OA 4CDGA 3JSPA 3WGHA 1FBQA 2XAQA 2VOOA 2Y75A 1R1TA 1K6OA 3VOEA 3S2WA 2Q2EA 4GYGA 2ZKZA 3HSEA 4HLXA 2ZFWA 4KN7X 4AIKA 3VEPA 4Q47A 3TO9A 2HYGD 3SXYA 2QYOA 1JHHA 2RV8A 2HS5A 4EM1A 1TQIA 4HA8A 1D8JA 3IWFA 5FO5A 3ROUA 3QU6A 1S7AA 2KRFA 1YO5C 3KP6A 3RI4A 1PP7U 5HDKA 2PQ8A 1MJAA 4HX8A 3U1DA 5ICCA 1EV7A 5JHUA 2J5PA 4EJUA 4I02A 2CGPA 3P9CA 3DQVC 3V7RA 2MA3A 1SFEA 2MC3A 3BY6A 4MTDA 3HRSA 3P9KA 4KYWA 3HYIA 1FLIA 1FC3A 2O6GE 2HYFA 3W6JB 2KIMA 2W25A 4OINF 3EQLF 1IRGA 4HV6A 3H3ZA 1MDMB 2R3SA 3KEQA 3FZVA 3V8JA 1ZARA 4HZFA 5D5UB 3CDHA 3QP6A 1Z05A 4CGZA 5L3CA 4PDKA 2FRHA 4L9JA 2VE9A 3D5LA 1RUNA 2DW4A 4S04A 1SD7A 5HS8A 2KJBA 3FMQA 4KUMA 4HF0A 3N97A 2Z33A 3ERED 5KVRA 2RQPA 5E1WA 1XMAA 2P6TA 1BM9A 1D3YA 3EYIA 1RIOH 2JZYA 2DFIA 2VXZA 2CYYA 2DK5A 2HZTA 2CG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3E M;  4IJA A;  2VT3 A;  1SFX A;  2OZU A;  4LB5 A;  2G7U A;  3E97 A;  4JK1 X;  1XGM A;  1FPQ A;  1HKQ A;  4UVA A;  3F6O A;  3G3Z A;  4I01 A;  2J5O A;  3BPX A;  1IUY A;  3GXO A;  3DF8 A;  4WWC A;  1HXD A;  3Q9V A;  3U9G A;  4HLY A;  1E17 A;  3RYR A;  3BOQ A;  1B6A A;  1ON2 A;  5ICF A;  1HSJ A;  4QLC U;  2DPU A;  1QBJ A;  3F72 A;  4ZZL A;  2PFB A;  2IVM A;  3I53 A;  4YIF A;  5CJ9 A;  2EA2 A;  4Q5S F;  4I0B A;  3V7S A;  5ICE A;  4XLP F;  3HRU A;  1BBY A;  2L01 A;  4CHU A;  2JRT A;  3CUQ A;  2STW A;  1NHA A;  1G3T A;  4D0P A;  2DPD A;  3TDZ C;  2QQ9 A;  4WX9 A;  1MKM A;  1ZYR F;  3J7A O;  1IN4 A;  2COM A;  1KU7 A;  1SD4 A;  1LEA A;  2PEX A;  2BEO A;  1K7A A;  1XSD A;  5CVR A;  2G9W A;  4HBL A;  4B09 A;  5KK1 A;  1IN7 A;  2DBB A;  3V4G A;  2D1H A;  5H6R A;  2ACJ A;  3WE2 A;  4O5V A;  4I2O A;  3I4P A;  2ESH A;  2JTV A;  3F8F A;  3NEU A;  4I0A A;  3HRM A;  1OR7 A;  5JFR A;  4PCQ A;  5FB2 A;  2FOK A;  4CO8 A;  1O3R A;  2KKO A;  1O7F A;  4NQW A;  1S6L A;  4FHT A;  4JQF A;  2ZME A;  1HW5 A;  3O2P E;  4OU0 A;  3FXU A;  3KP4 A;  1WI9 A;  2DK8 A;  5EEH A;  5L3F A;  2MLG A;  1XCV A;  5DCM B;  4WXD A;  1BOA A;  4ZH4 F;  4H0E A;  1OYW A;  2DQL A;  3T8T A;  3FMR A;  4OIR F;  1BC8 C;  3V8L A;  4GO1 A;  4U0W A;  4LG0 B;  5LRR A;  5J6X A;  3WTS C;  2QQB A;  4G94 A;  5LHG A;  4NHJ A;  2RKH A;  1FY7 A;  1T98 A;  2EFO A;  3JTG A;  5HDN A;  1U5T B;  1J75 A;  2LDU A;  3J80 Z;  5DYM A;  2PMU A;  2GA1 A;  1TNT A;  1K78 A;  3M8F A;  5L3E A;  3KFW X;  2QVO A;  1FZP B;  2Y48 A;  2V9V A;  5HLG A;  5FD6 A;  2YSR A;  3GWZ A;  3MCZ A;  4MQ9 F;  1QGP A;  1YIO A;  4M9Z A;  2NS0 A;  3I71 A;  3ABT A;  1JGS A;  3I59 A;  1J7K A;  3RKW A;  4P9F A;  3R60 A;  1P92 A;  1Z6T A;  4M73 A;  1QZY A;  3F6V A;  5BS6 A;  1O3T A;  1I5Z A;  3GYH X;  3WTY C;  4BH9 A;  5DUI A;  2OQR A;  1FSH A;  2EJR A;  5IT9 Z;  3RTR A;  3P7N A;  3F22 A;  4PGH A;  2P5V A;  4BXU A;  4UV9 A;  3KLO A;  1RZ4 A;  1DPR A;  3G73 A;  1R58 A;  2MBF A;  4JBA A;  1IN8 A;  3KP7 A;  3M7G A;  1ZGA A;  1WSU A;  4ZYE A;  3KP3 A;  1ZRF A;  1H0M A;  1JHF A;  1X3U A;  1RUO A;  1ZRC A;  4BHP A;  5BPD A;  3CUO A;  3WTX C;  1FX7 A;  3DV8 A;  4L9T A;  2O8X A;  2HWV A;  1FSE A;  1GXP A;  2WV0 A;  1R00 A;  3WE3 A;  3R0J A;  3ZMD A;  2GQQ A;  3JTH A;  3L09 A;  5FLX K;  2VBX A;  4YFK F;  3BWG A;  4A5N A;  3DXJ F;  2RDP A;  2QQA A;  2X4H A;  1IN6 A;  4LLL A;  2A69 F;  4GYI A;  3HTU A;  1IXC A;  3K0L A;  4R8H A;  5D6E A;  1V4R A;  4A0Z A;  1R1U A;  2E7W A;  4YFN F;  2R7F A;  2EK5 A;  2FML A;  1YTY A;  2EWN A;  2M8E A;  5CVV A;  1BI3 A;  4GXO A;  4G7O F;  1QPM A;  1S29 A;  3BJ6 A;  3EUH A;  3GF2 A;  3E6D A;  1B9N A;  2M30 A;  1W7P A;  1SMT A;  5TRD A;  4KFC A;  3F8C A;  2Y0M A;  2HFH A;  1LDD A;  5LRS A;  3M1E A;  4HV5 A;  4G6Q A;  4RB3 C;  4G9Y A;  4RAZ A;  5HLI A;  2HKO A;  2PLY A;  2HOE A;  3GUD A;  4I7H A;  1XCB A;  3HOS A;  1F5T A;  2WTE A;  1LEB A;  3K1N A;  1FNN A;  4O6J A;  1YFH A;  1AOY A;  1KQ8 A;  3JAM K;  3KET A;  2LF8 A;  4UHT A;  1I27 A;  2STT A;  4O3M A;  1JXS A;  4OIQ F;  2A3S A;  2AXL A;  4CYD A;  1T39 A;  2RGV A;  3IRQ A;  3B73 A;  1F9N A;  4HDV A;  5K5Q A;  4HX7 A;  1IN5 A;  3F3X A;  3EET A;  3L9F A;  1W5S A;  2EV5 A;  3ELK A;  3MWM A;  3T5X A;  4ESF A;  2BBY A;  1OYY A;  5LGT A;  3TO7 A;  2VC0 A;  2V6C A;  3WU1 B;  1FWZ A;  3K9T A;  4E70 A;  4ZZD A;  1ZAO A;  3ZMZ A;  2LKP A;  1OYI A;  4HAM A;  2EFP A;  1W4M A;  3FF5 A;  1PDN C;  4U0Y A;  1Z91 A;  1I1S A;  3FMS A;  2HGC A;  5L3G A;  3FWE A;  4EMS A;  4N9H A;  3ZPL A;  5E17 F;  2K86 A;  1YW8 A;  3GVA A;  1DP7 P;  2FBK A;  5EEG A;  4EM2 A;  2PJP A;  3TQN A;  2V1U A;  4HW0 A;  2CWE A;  3L2C A;  4L5J A;  2VON A;  3WGG A;  2QBY B;  3F8B A;  2IP2 A;  2A68 F;  1F1Z A;  4XBF A;  3V8K A;  5FD5 A;  2QZ8 A;  3COA C;  5F6F A;  2CW0 F;  2W85 A;  3QOP A;  2OAZ A;  5JVT A;  3DPT A;  2XRO A;  5F1R A;  2JT1 A;  5IT3 A;  4K2E A;  1L3L A;  3B02 A;  2ZXJ A;  4TV7 A;  1BIB A;  1T38 A;  2FBH A;  4ON0 A;  1LQ1 A;  2CQK A;  1FYK A;  3MQ0 A;  4GCV A;  1YW9 A;  3RYP A;  3LQR A;  1HKT A;  1B4A A;  4A6D A;  1XGN A;  3E5Q A;  5LLQ A;  3FM5 A;  4A12 A;  2YPR A;  4LJZ F;  2F5F A;  4L9N A;  3SQN A;  3DKW A;  4M71 A;  1PP8 F;  3FX3 A;  2BE5 F;  4L18 B;  4HQE A;  2PN6 A;  2XKO A;  4KMF A;  1EH7 A;  1YS7 A;  1CF7 B;  3E5U A;  4L0Z B;  2HQR A;  1KU9 A;  1B59 A;  4UV8 A;  4U7D A;  2UZK A;  5F64 A;  2FQ3 A;  1TQP A;  3I5U A;  3FXR A;  1XD7 A;  2A5Y B;  1SD6 A;  1HKS A;  2OU2 A;  5CVJ A;  5LGU A;  4IF4 A;  2F5C A;  1S8N A;  2L54 A;  3SHF A;  2GIV A;  3IC7 A;  2KIF A;  3LFK A;  2UXX A;  3GZ5 A;  1U78 A;  1KA8 A;  1R5H A;  2DO7 A;  2L02 A;  1T2K A;  3ZN1 A;  5HLH A;  3CUQ C;  3GFI A;  4YG2 F;  2E1C A;  1AWC A;  1G3S A;  3ECO A;  4OIP F;  1QQI A;  3QAH A;  3L00 A;  1HW2 A;  2ADU A;  3BJA A;  4R79 A;  1ZG3 A;  4R1H A;  2V79 A;  4XSX F;  3CO6 C;  2DLL A;  1SAX A;  5H20 A;  4RGX A;  1MZB A;  1BI1 A;  1KYZ A;  3MZY A;  3JSO A;  2XUB A;  2A07 F;  4ETS A;  5ICG A;  2VBZ A;  1HQC A;  2EV6 A;  4LK1 F;  5BPI A;  2ELH A;  4EJO A;  2P6S A;  3ECH A;  3PFI A;  1B9M A;  3KE2 A;  3PQK A;  1W7P D;  4KIC A;  5DEQ A;  3I64 A;  1OKR A;  3W6K B;  1Z6R A;  4ZYH A;  5HOO A;  1G6N A;  1P2F A;  2M87 A;  1FP1 D;  2K02 A;  1KYW A;  3J81 K;  2YU3 A;  2VBW A;  1O7L A;  2CO5 A;  2LSO A;  1P6R A;  4P55 A;  1LDJ A;  5D5W B;  5CVI A;  3H3U A;  5CVU A;  2JPB A;  1I1G A;  2JPC A;  3GEZ A;  2D2W A;  5J8C A;  1WKM A;  1R22 A;  2HDC A;  3AAF A;  1LDK B;  2HKX A;  1FOK A;  3IWZ A;  4OIO F;  1IF1 A;  2E1N A;  2R7D A;  1GHC A;  1O57 A;  1ZRD A;  5DV5 A;  1TNS A;  1G3W A;  4LLG F;  2GXB A;  2OQG A;  4Y15 A;  1H9T A;  2ZNZ A;  4L0Y B;  3M9A A;  2YX4 A;  2A6H F;  2HEO A;  2ISZ A;  1ULY A;  5LEJ A;  1WWX A;  5CLS A;  2XAF A;  4IHT A;  1R7J A;  2ZNY A;  2FNA A;  5LHH A;  2E7X A;  3R0A A;  4G7Z F;  4RB2 C;  2M45 A;  2QEN A;  5ED4 A;  1T0F A;  3F8M A;  4BHB A;  2H6B A;  1IZ1 A;  3Q9S A;  3KCC A;  4AWX B;  5FFX A;  1U6G A;  5L3B A;  2FA5 A;  3DEU A;  2LNB A;  5ERI A;  5BMZ A;  3KZZ A;  3U2R A;  2FNP A;  3WOD F;  1TTY A;  2ZJ2 A;  2F5D A;  2XAG A;  1UST A;  4F7Z A;  1KU2 A;  2QUF A;  2H27 A;  3E6B A;  4CIC A;  3IKV A;  3KP5 A;  1ZG1 A;  5BQT A;  5A2Q Z;  2CSO A;  2M1B A;  4HYE A;  4MNU A;  5HVQ C;  2HTS A;  2RVC A;  2PG4 A;  1Z7U A;  3F23 A;  5JR3 A;  5CYV A;  1BN5 A;  3ZP5 A;  2XAH A;  5DCM A;  3FM3 A;  2DI3 A;  2H6C A;  2RNJ A;  3C7J A;  4IHS A;  4EGY A;  4MQV A;  4P9U A;  4CZZ A;  4L9V A;  3GZ6 A;  3QP5 A;  3R6S A;  4DNC A;  4YFX F;  4LG0 A;  3WGI A;  5E20 A;  3PQJ A;  2V1X A;  3KEO A;  1YQA A;  1PUE E;  4P5O A;  4KT5 C;  1FYM A;  2P8T A;  3ZMV A;  3E6M A;  2DAO A;  1U5T A;  2GXG A;  1ZRE A;  1IXR C;  1EH6 A;  2DU9 A;  3HHG A;  2Z3Y A;  5D4R A;  6PAX A;  1XDS A;  2FEZ A;  3FXQ A;  3HRT A;  1USS A;  3BP8 A;  3L7W A;  1MJB A;  1XSX A;  1SFU A;  3QRF F;  2NNY A;  1S3J A;  2ZO4 A;  2C6Y A;  1FP2 A;  4WXH A;  5D6F A;  3CO7 C;  3TKY A;  3WG9 A;  1WRJ A;  2OBP A;  2L3D A;  4S05 A;  4LK0 F;  3GFM A;  2GWR A;  2A6E F;  3HSF A;  3CJN A;  4RAY A;  2K7L A;  3RDI A;  1BIA A;  4MEX F;  2L4M A;  3T8R A;  4WCG A;  3F8N A;  3Q5F A;  2Q0O A;  2FXA A;  1IW7 F;  5DCF A;  4CXF A;  4KMU X;  5LHI A;  1YW7 A;  2GA2 A;  3HTS B;  3R61 A;  4YII A;  3WTV C;  1TW2 A;  3K2Z A;  4ZYG A;  1BJA A;  4N0B A;  1MJ9 A;  3MEX A;  1UB9 A;  5D5V B;  1D5V A;  3NQO A;  3EYY A;  3NRV A;  3I0T A;  4EQQ A;  3SFZ A;  4BHC A;  2UWM A;  3CLO A;  2XVC A;  3DFG A;  1FBU A;  1ZN2 A;  4KIG A;  2QM3 A;  1P4W A;  2QWW A;  1L0O C;  4UVC A;  5D8L B;  4EV0 A;  4KA4 A;  1EH8 A;  3K1P A;  3LAJ A;  3T0Y A;  2P7C B;  1KU3 A;  1KGS A;  1P4X A;  4I09 A;  5TJJ A;  2XGX A;  4UXN A;  2D45 A;  4WF2 A;  2XIG A;  1U8R A;  3J80 K;  3C3W A;  4AIH A;  3BRO A;  2RC4 A;  2XKP A;  4U7B A;  1G4D A;  4IPA A;  4M9X A;  4A0X A;  3I58 A;  2MD5 A;  1UHW A;  4MHG A;  2Q8K A;  1DUX C;  2IPQ X;  3P9I A;  4KNY A;  4EM0 B;  2HQN A;  4XRF A;  5BOX A;  3TDU C;  1C0W A;  3BJO A;  2BV6 A;  1FT9 A;  3HHH A;  1JE8 A;  2FU4 A;  2H09 A;  3KLN A;  1LB2 A;  2DQR A;  2ZCW A;  3ISP A;  2OD5 A;  1QNT A;  3QU3 A;  5HDG A;  3LQQ A;  3WTU C;  2NAZ A;  3KZY A;  2VE8 A;  3EDP A;  2BYV E;  3RPU A;  5IT9 K;  3DP7 A;  2LF7 A;  3JW4 A;  1XN7 A;  2DT5 A;  5K1Y A;  4UNO A;  1HW1 A;  4EJW A;  3CUQ B;  1ZGJ A;  1TBX A;  4Q4Z F;  3VOD A;  2HR3 A;  4XSZ F;  2OZ6 A;  4M72 A;  1BI2 A;  5A2Q K;  4ZYD A;  2JSC A;  1R23 A;  4Q48 A;  5AON A;  4MGR A;  4ESB A;  5DDG A;  5AIP A;  3K69 A;  5ILS A;  1A04 A;  4GGG A;  1Q1H A;  1TQM A;  2MLK A;  1LVA A;  4WK8 F;  3GFJ A;  1FYL A;  2ZBK A;  2P5L C;  4RGU A;  3H92 A;  4WXC A;  2XHK A;  1R5G A;  4LB6 B;  3IL2 A;  1J59 A;  4MTE A;  4HQM A;  5HS9 A;  1SMY F;  1SD5 A;  2ZME B;  5DD4 A;  5E8G A;  5ILV A;  4DQ2 A;  4IRH A;  4Z2Y A;  1ON1 A;  2X0L A;  4HX4 A;  5E8I A;  1XGS A;  3OV8 A;  3GX4 X;  3I54 A;  4UUV A;  2YX7 A;  3E3V A;  4M6Y A;  1U2W A;  4AD9 A;  2HTJ A;  1ODD A;  2UXN A;  2RN7 A;  1HBX G;  4L5I A;  3HUG A;  1J9I A;  3ZQ7 A;  3TOB A;  3QPH A;  4EJV A;  2QBY A;  4A5M A;  1VTN C;  2O3F A;  3LST A;  5FLX Z;  2PMH A;  2IA1 A;  1UHM A;  1DDN A;  4QWQ A;  1KQ0 A;  3SZP A;  3BDD A;  4EJT A;  1Y0U A;  1XB4 A;  5E1X A;  4M9S A;  1K78 B;  1OMI A;  2D1V A;  1MDM A;  1CGP A;  2O0Y A;  2VBY A;  4OOI A;  1B1B A;  2FMY A;  2IW5 A;  4HDU A;  5DUK A;  5D5X B;  2PI0 A;  1FBS A;  3E5X A;  1QZZ A;  1ZLJ A;  4N9I A;  4FT8 A;  4HOB A;  3ZMT A;  1E2X A;  3I59 B;  1IRF A;  2VOP A;  2EFN A;  4KIF A;  4NB5 A;  3GO5 A;  3IKT A;  1ONV A;  2P7V B;  3RIR A;  3CTA A;  4IVN A;  3C18 A;  1ZG5 A;  4RB0 A;  3IHU A;  1BC7 C;  1CF7 A;  4U88 A;  5LGN A;  2EFW A;  3LA3 A;  3LA2 A;  1RI7 A;  1KQ9 A;  1O3S A;  4G8X A;  2P5K A;  4OMY A;  4RS8 A;  3M8E A;  5L3D A;  1IXS B;  2L4A A;  5AIQ A;  2KJC A;  2MH9 A;  4AVP A;  4P96 A;  5LEK A;  3ULQ B;  1YG2 A;  3ZN0 A;  4ENN A;  4BAY A;  1YLF A;  4MEY F;  5J8F A;  2MH2 A;  2NYX A;  3RKX A;  1TW3 A;  1T6S A;  1D8K A;  1J0R A;  4Y17 A;  5ILU A;  3JAM Z;  2GZW A;  1UCR A;  4PZJ A;  3LA7 A;  3BZ6 A;  4ENK A;  1XSV A;  1GXQ A;  4M74 A;  2ISY A;  3C1D A;  1Z9C A;  4UVB A;  2P4W A;  2IRF G;  1QO0 D;  3VFZ A;  3ABU A;  2VN2 A;  3ZMS A;  1H9G A;  4ASN A;  1W5T A;  5D8K B;  3TO6 A;  3O3K A;  2PBI A;  2CFX A;  3LWF A;  2EB7 A;  1R1V A;  2FE3 A;  5K5R A;  2B0L A;  3KP2 A;  3N4M A;  2EA4 A;  5JI6 A;  4A6E A;  1XGO A;  3IRR A;  4LLN A;  4BNC A;  1W7P B;  2A61 A;  4ENJ A;  4RB1 A;  2W24 A;  1IAW A;  2O61 A;  1G3Y A;  5FGM A;  2FSW A;  2W84 A;  3ML6 A;  3ZMU A;  3GFL A;  4FX4 A;  3VB2 A;  2EV0 A;  2V1D A;  4EGZ A;  2XRN A;  3F21 A;  2G7H A;  2VC1 A;  2W57 A;  1LNW A;  2IA0 A;  2WC2 A;  1GVJ A;  2XV4 S;  4ESJ A;  2YR2 A;  5H6Q A;  3WTZ A;  1XDU A;  4G7H F;  3HSR A;  5DD8 A;  2IA2 A;  3HOT A;  1STZ A;  1O3Q A;  1ZLK A;  3K1M A;  4LD5 A;  3GLX A;  2FF4 A;  5FFZ A;  3LAP A;  1LJ9 A;  3RKY A;  4OMZ A;  2K27 A;  3MZH A;  4BYY A;  3BPV A;  2FBI A;  4B8X A;  2XAJ A;  2DTR A;  2Z5U A;  4HF2 A;  1U5T C;  2VOD A;  3OOP A;  3RJP A;  3V7C A;  4HF1 A;  2ETH A;  4AIJ A;  2H94 A;  4ENM A;  1P4A A;  1V3F A;  4EVI A;  5E18 F;  1TLH B;  2BGC A;  1DPU A;  3T1B A;  3R4K A;  5E1Z B;  5D4S A;  4IRG A;  1UFM A;  3REO A;  1I6X A;  4M6X A;  1ZH5 A;  4G6D A;  2O03 A;  2K4J A;  2AS5 F;  4RGS A;  1J5Y A;  2NNN A;  5K5O A;  4FX0 A;  4A2U A;  3DPL C;  4KDP A;  4PGG A;  3QPT A;  2F2E A;  1YS6 A;  4KIB A;  1MD0 A;  2VT2 A;  1WQ2 A;  4IXA A;  1J2X A;  2GAU A;  3TOA A;  1HST A;  1Z1D A;  2WWY A;  2EFQ A;  2OA4 A;  4RGR A;  4LFU A;  2ESN A;  2M5W A;  4U0V A;  4LGW A;  4LMY A;  1R36 A;  2QLZ A;  5HS7 A;  2XAS A;  1REP C;  3WTW C;  3WTT C;  1MGT A;  5LBQ A;  1RNL A;  4I98 B;  2IJL A;  3WU0 A;  3FHZ A;  2KIU A;  3GW2 A;  2IT0 A;  1F4K A;  1XMK A;  4A0Y A;  4Y13 A;  3E6C C;  4XLN F;  1S7O A;  2NRA C;  3SZT A;  2F5E A;  4IRI A;  1YYV A;  3RPQ A;  1ZHF A;  4KN4 X;  2TDX A;  1OPC A;  1BI0 A;  3D0S A;  3O6B B;  4BQA A;  3HIF A;  3TGN A;  2K4B A;  3MAJ A;  3J81 Z;  1K79 A;  2Z99 A;  3MFK A;  2Z9O A;  4CDG A;  3JSP A;  3WGH A;  1FBQ A;  2XAQ A;  2VOO A;  2Y75 A;  1R1T A;  1K6O A;  3VOE A;  3S2W A;  2Q2E A;  4GYG A;  2ZKZ A;  3HSE A;  4HLX A;  2ZFW A;  4KN7 X;  4AIK A;  3VEP A;  4Q47 A;  3TO9 A;  2HYG D;  3SXY A;  2QYO A;  1JHH A;  2RV8 A;  2HS5 A;  4EM1 A;  1TQI A;  4HA8 A;  1D8J A;  3IWF A;  5FO5 A;  3ROU A;  3QU6 A;  1S7A A;  2KRF A;  1YO5 C;  3KP6 A;  3RI4 A;  1PP7 U;  5HDK A;  2PQ8 A;  1MJA A;  4HX8 A;  3U1D A;  5ICC A;  1EV7 A;  5JHU A;  2J5P A;  4EJU A;  4I02 A;  2CGP A;  3P9C A;  3DQV C;  3V7R A;  2MA3 A;  1SFE A;  2MC3 A;  3BY6 A;  4MTD A;  3HRS A;  3P9K A;  4KYW A;  3HYI A;  1FLI A;  1FC3 A;  2O6G E;  2HYF A;  3W6J B;  2KIM A;  2W25 A;  4OIN F;  3EQL F;  1IRG A;  4HV6 A;  3H3Z A;  1MDM B;  2R3S A;  3KEQ A;  3FZV A;  3V8J A;  1ZAR A;  4HZF A;  5D5U B;  3CDH A;  3QP6 A;  1Z05 A;  4CGZ A;  5L3C A;  4PDK A;  2FRH A;  4L9J A;  2VE9 A;  3D5L A;  1RUN A;  2DW4 A;  4S04 A;  1SD7 A;  5HS8 A;  2KJB A;  3FMQ A;  4KUM A;  4HF0 A;  3N97 A;  2Z33 A;  3ERE D;  5KVR A;  2RQP A;  5E1W A;  1XMA A;  2P6T A;  1BM9 A;  1D3Y A;  3EYI A;  1RIO H;  2JZY A;  2DFI A;  2VXZ A;  2CYY A;  2DK5 A;  2HZT A;  2CG4 A; 
#chains in the Genus database with same CATH topology
 1U3E M;  4B3A A;  2L9S A;  4IJA A;  2VT3 A;  4X6A J;  3S2D J;  1SFX A;  2VKH A;  2OZU A;  5IY5 H;  4LB5 A;  2G7U A;  3GBG A;  3E97 A;  3FBN B;  1P9Q C;  2ID3 A;  4JK1 X;  1ZR4 A;  1XGM A;  1FPQ A;  1HKQ A;  2IGM A;  4UVA A;  3F6O A;  2HU9 A;  4ZTF A;  2CQN A;  3G3Z A;  4CUG A;  4A3D J;  3QWL A;  3L1P A;  1JT6 A;  3X2Q H;  4I01 A;  2J5O A;  5EDN A;  3BPX A;  1IUY A;  4LIU A;  2KZG A;  4XN3 A;  2PJR B;  2L7Z A;  3GXO A;  3DF8 A;  4WWC A;  4PJL A;  1X2N A;  1HXD A;  3Q9V A;  3U9G A;  4HLY A;  1E17 A;  3RYR A;  4AC0 A;  3BOQ A;  1VQ6 I;  4XKB A;  1B6A A;  1ON2 A;  3ERM A;  5ICF A;  3WHB A;  1HSJ A;  4QLC U;  2DPU A;  2CV2 A;  1OLT A;  1QBJ A;  3F72 A;  1RPW A;  1SAN A;  3AL0 C;  2QA4 I;  4ZZL A;  1A6I A;  2PFB A;  1LE8 A;  3UR3 C;  2IVM A;  1YRN A;  3E1S A;  1T8I A;  3I53 A;  4YIF A;  5CJ9 A;  2EA2 A;  4XQF A;  4Q5S F;  1IUF A;  4I0B A;  3V7S A;  5ICE A;  3HGG A;  4XLP F;  3HRU A;  4AUX A;  2XPU A;  1BBY A;  2L01 A;  5IPA A;  4CHU A;  1TWF J;  2JRT A;  3CUQ A;  5IYC J;  1J09 A;  1IO2 A;  1X3Z B;  2STW A;  1NHA A;  1G3T A;  4D0P A;  2DPD A;  3V42 A;  3TDZ C;  2KRC A;  2QQ9 A;  4DBR A;  4WX9 A;  1MKM A;  1ZYR F;  3J7A O;  1IN4 A;  3RZO J;  2LH9 A;  2COM A;  3A02 A;  1KU7 A;  1SD4 A;  2BHZ A;  4J00 A;  1LEA A;  3RKQ A;  2PEX A;  1D1B A;  1X4P A;  2BEO A;  2DA5 A;  1K7A A;  1XSD A;  4PSW A;  1WZ2 A;  5CVR A;  4J19 A;  1ETW A;  4LOC A;  2W4S A;  1WGX A;  1JJ8 C;  2G9W A;  2DOF A;  3ESW B;  5FLM J;  4HBL A;  4B09 A;  4M3G A;  5KK1 A;  5F27 A;  4IX7 A;  3GTL J;  3S2H J;  1IN7 A;  2DBB A;  3V4G A;  4HNV A;  1JGG A;  2D1H A;  1D0Z A;  1X3W B;  5H6R A;  2ACJ A;  3WE2 A;  4DGW B;  4O5V A;  4I2O A;  3I4P A;  4D7N A;  1Z21 A;  1AKH B;  2ESH A;  2JTV A;  3F8F A;  3NEU A;  4RAG A;  2M2E A;  3DTK A;  4I0A A;  3HRM A;  2VQC A;  1OR7 A;  1WJD A;  2OJE D;  3I3L A;  5JFR A;  4XRM A;  4PCQ A;  5FB2 A;  4D1Q A;  5EZH A;  1YX3 A;  2FOK A;  3CCV I;  1LFB A;  4CO8 A;  4V19 K;  1O3R A;  4M6V A;  2KKO A;  2IAI A;  3BQY A;  1O7F A;  5DTD A;  4NQW A;  1S6L A;  4FHT A;  4JQF A;  5C4J J;  1JJ6 C;  1Q1V A;  4MLO A;  2ZME A;  3NAU A;  4DIQ A;  4J01 A;  3ZQI A;  3E7L A;  3MKW B;  2JWT A;  1HW5 A;  3O2P E;  3AG2 H;  4OU0 A;  3FXU A;  2QF7 A;  3FXO A;  5HNF A;  2R0Q C;  3KP4 A;  1WI9 A;  2DK8 A;  3EUA A;  5EEH A;  5L3F A;  1GV5 A;  1XCV A;  2MLG A;  2BY2 A;  4IO9 F;  5DCM B;  4WXD A;  1BOA A;  4ZH4 F;  4H0E A;  1W5C C;  5FKO A;  3CJR B;  1IRZ A;  3L2W A;  4BAC A;  1QVU A;  3WG7 H;  1TP4 A;  1GV2 A;  2LRD A;  1OYW A;  2Z2S B;  2DQL A;  4XRS A;  3T8T A;  2OCC H;  4NDL A;  3FMR A;  3HGY A;  2EIK H;  4OIR F;  1BC8 C;  2HNH A;  3TW7 A;  3K4L A;  3V8L A;  4GO1 A;  4U0W A;  4LG0 B;  5LRR A;  5J6X A;  1D1A A;  3WTS C;  4BE1 A;  4KJZ A;  3S93 A;  2QCO A;  4X0G A;  3GCM A;  2QSF X;  2QQB A;  4G94 A;  5LHG A;  4NHJ A;  2W48 A;  2K9M A;  2RKH A;  1FY7 A;  1T98 A;  1VF9 A;  2EFO A;  2MW8 A;  3JTG A;  3GTQ J;  5GTI C;  4AYB A;  5HDN A;  3OS1 A;  1D5Y A;  1U5T B;  1RET A;  3IH4 A;  1J75 A;  2LDU A;  3J80 Z;  4BEH A;  3KPH A;  1UMQ A;  1SEU A;  5DYM A;  2ECB A;  3HJE A;  2PMU A;  3G1L A;  2L9V A;  1IDZ A;  2X1C A;  3GZN B;  2GA1 A;  3CC4 I;  4FIS A;  1TNT A;  1K78 A;  1EA3 A;  2W82 A;  3M8F A;  5IOY A;  4RM3 A;  5L3E A;  5EG0 B;  2A6T A;  3KFW X;  1FMV A;  5E3L A;  2QVO A;  5JLW A;  1FZP B;  1X58 A;  2Y48 A;  2V9V A;  1K61 A;  4BE2 A;  5HLG A;  5FD6 A;  1T33 A;  2YSR A;  3GWZ A;  1K4T A;  3MD2 A;  3MCZ A;  4MQ9 F;  1QGP A;  3ZQQ A;  3CF5 F;  1YIO A;  4M9Z A;  3OS0 A;  1A31 A;  2NS0 A;  3I71 A;  1TC3 C;  3ABT A;  4G6T B;  2CV0 A;  2FD5 A;  3RPU D;  4BS9 A;  4HEA 2;  2JJ7 A;  1JGS A;  2DDA A;  3I59 A;  2OTL I;  1J7K A;  3QPL A;  2ME6 A;  3RKW A;  4P9F A;  3R60 A;  2E1M C;  2K40 A;  1P92 A;  3S1N J;  1Z6T A;  4M73 A;  3GTK J;  3F9K A;  1T08 B;  1QZY A;  3F6V A;  3IP4 B;  5BS6 A;  4IZZ A;  5E3M A;  1I5Z A;  1O3T A;  1RC9 A;  3GYH X;  3WTY C;  1W1W E;  2FUG 2;  4BH9 A;  5DUI A;  2OQR A;  2KMU A;  3JRD A;  2MGQ A;  3HOU J;  1FSH A;  2EJR A;  2HXI A;  5IT9 Z;  3RTR A;  1BR2 A;  3B6A A;  3W3C A;  3ABL H;  3OY9 A;  3P7N A;  3LMM A;  4CCJ A;  3F22 A;  3PNT A;  2QEX I;  2H1L A;  4PGH A;  2EZH A;  2M34 A;  2P5V A;  4QTR A;  4Z6Y A;  4BXU A;  1A6Q A;  4UV9 A;  3S16 J;  3KLO A;  4BU2 A;  1RZ4 A;  1DPR A;  3G73 A;  1R58 A;  2MBF A;  4JBA A;  3HOW J;  1Y1V J;  1YE9 A;  2PMZ A;  2QKL B;  1IN8 A;  3KP7 A;  2Z1D A;  1WCM J;  3M7G A;  1ZGA A;  4X1E A;  4XKW A;  2DOE A;  2HI3 A;  1WSU A;  4ZYE A;  2HDD A;  2JN6 A;  3ZOB A;  3KP3 A;  2IS1 A;  2Y0S A;  1ZRF A;  1PUF A;  2YUS A;  1H0M A;  1JHF A;  1X3U A;  1RUO A;  1LVK A;  4F55 A;  1X1A A;  4IHV A;  3BLY A;  4V2G A;  1ZRC A;  2RQQ A;  3VWB A;  1BJZ A;  5J4V A;  4BHP A;  4C3I J;  5BPD A;  3CUO A;  3WTX C;  1FX7 A;  3PO3 J;  3DV8 A;  3J80 R;  4L9T A;  3ZGK A;  2O8X A;  2DMN A;  1FIP A;  2HWV A;  1FSE A;  3BR0 A;  4G12 A;  1P7I A;  1GXP A;  3OYL A;  2WV0 A;  1GT0 C;  4OAZ A;  2XSD C;  1R00 A;  2W7N A;  3WE3 A;  1JUP A;  4UB6 C;  2LY9 A;  3TMO A;  3R0J A;  2JUG A;  3ZMD A;  2GQQ A;  3JTH A;  3L09 A;  5FLX K;  3S17 J;  1HA8 A;  2VBX A;  3BTL A;  4YFK F;  3BWG A;  4A5N A;  1VQM I;  3DXJ F;  1BOB A;  2CQQ A;  2RDP A;  2QQA A;  2X4H A;  1IN6 A;  4LLL A;  1QPI A;  5J1Y A;  3JRA A;  2A69 F;  4GYI A;  4XOP A;  2XF7 A;  3HTU A;  4UUT A;  4E7H A;  1IXC A;  4BY7 J;  3K0L A;  2K9S A;  2WY8 Q;  3JRG A;  4R8H A;  2WB1 N;  5D6E A;  1V4R A;  5J3L A;  4A0Z A;  1MH3 A;  1R1U A;  2E7W A;  4CYC A;  4YFN F;  1YOV B;  3DBL B;  1ETO A;  2R7F A;  2EK5 A;  2FML A;  1YTY A;  2EWN A;  3KZI C;  5IYB J;  1ORK A;  1SVO A;  3W2W A;  2M8E A;  2CQX A;  2Z16 A;  3OYF A;  1OCR H;  5CVV A;  1NK2 P;  1X19 A;  1BI3 A;  3TL4 X;  4XN0 A;  4GXO A;  2R5Y A;  3HPH A;  4IQJ A;  4HRI A;  4F3Q A;  5IT9 R;  2LFB A;  3LSR A;  4XOR A;  3H0D A;  4PSX A;  1AA7 A;  4G7O F;  2VLA A;  1QPM A;  3DWL E;  1S29 A;  3BJ6 A;  3EUH A;  3GF2 A;  3E6D A;  1B9N A;  3LSH A;  3GTP J;  5M5X J;  2M30 A;  1VQL I;  1W7P A;  5C44 J;  4RMN A;  1SMT A;  3PNV A;  2ZSH B;  1M1E B;  5TRD A;  4KFC A;  3F8C A;  4C30 A;  2Y0M A;  1U8B A;  2HFH A;  1LDD A;  5LRS A;  3M1E A;  4HV5 A;  2E5Z A;  1QRY A;  3LSJ A;  2M35 A;  4G6Q A;  4RB3 C;  1WJF A;  4G9Y A;  2KZV A;  2VKD A;  1NG7 A;  1W0T A;  1ZGW A;  1Z0X A;  4RAZ A;  3G6E I;  5HLI A;  2HKO A;  2L2O A;  2PLY A;  2HOE A;  3GUD A;  4I7H A;  1XCB A;  4B47 A;  1IG7 A;  1XS9 A;  1Z67 A;  3I56 I;  3HOS A;  1F5T A;  2F48 A;  2WTE A;  1LEB A;  3CES A;  3G1M A;  1YX5 A;  3CDL A;  2F6C A;  3A52 A;  3K1N A;  1FNN A;  4O6J A;  2LR8 A;  4HPQ A;  2E5N A;  2FOW A;  1Y8Q B;  5K7Z A;  4JOM A;  1YFH A;  1AOY A;  1KQ8 A;  3JAM K;  3KET A;  2LF8 A;  4UHT A;  1I27 A;  2STT A;  1FEX A;  3H9J A;  4O3M A;  1VFC A;  1JXS A;  4OIQ F;  2A3S A;  2AXL A;  4XLC A;  4CYD A;  1T39 A;  2X85 A;  2RGV A;  3IRQ A;  3B73 A;  2JK3 A;  1F9N A;  1UEL B;  3BZC A;  4HDV A;  5K5Q A;  4HX7 A;  1IN5 A;  1FTT A;  3F3X A;  3EET A;  4A3F J;  3L9F A;  1W5S A;  2EV5 A;  4II2 A;  3ELK A;  4C2M J;  2KRH A;  3MWM A;  3T5X A;  4ESF A;  2JA6 J;  2BBY A;  1DP3 A;  1OYY A;  1HC8 A;  1S7E A;  5LGT A;  3QOE A;  3TO7 A;  3OYN A;  2VC0 A;  2V6C A;  4YRV A;  3WU1 B;  1FWZ A;  3K9T A;  4E70 A;  5B1A H;  4ZZD A;  1ZAO A;  3ZMZ A;  1SFK A;  2LKP A;  2P81 A;  3PSI A;  3BG3 A;  1OYI A;  4HAM A;  3CP2 A;  4BY1 J;  2EFP A;  4M3E A;  1W4M A;  3FF5 A;  1PDN C;  4U0Y A;  4JP0 A;  4LIV A;  2R5Z A;  2R7T A;  1Z91 A;  1MW7 A;  2EIL H;  1ACI A;  1I1S A;  3FMS A;  3ONQ A;  2HGC A;  1FJL A;  4LIT A;  5L3G A;  3FWE A;  4EMS A;  4AID A;  2G0E A;  4N9H A;  3VDX A;  3ZPL A;  2MZ4 A;  1YIT I;  2GBY A;  5E17 F;  2K86 A;  3LSI A;  3HKZ N;  1YW8 A;  3GVA A;  2EIN H;  1DP7 P;  2FBK A;  2OF7 A;  5EEG A;  4EM2 A;  3TED A;  4DZP A;  2PJP A;  3TQN A;  2XGE A;  3L2Q A;  2V1U A;  2VI6 A;  2NVQ J;  4HW0 A;  1Z77 A;  2CWE A;  3HUG B;  3A01 A;  3L2C A;  1HDD C;  4L5J A;  3S32 A;  3ZQF A;  1ETQ A;  3WGG A;  2VON A;  3BG6 A;  3SEQ A;  2JA7 J;  4PJM A;  2QBY B;  3F8B A;  4A3G J;  1N78 A;  1ZK8 A;  2IP2 A;  2A68 F;  1F1Z A;  4XBF A;  5B3S H;  3V8K A;  4ZTJ A;  5FD5 A;  2ELJ A;  2QZ8 A;  1SVL A;  3HEF A;  3COA C;  5F6F A;  2CW0 F;  4DOZ A;  2EZK A;  2W85 A;  1LE8 B;  3PIO F;  3QOP A;  3Q3S A;  2OAZ A;  5JVT A;  3DPT A;  3E0J B;  3C2B A;  2XRO A;  2VKV A;  2QKM B;  5F1R A;  2JT1 A;  1B8I B;  5IT3 A;  2R7Q A;  3AL0 B;  5FKN A;  4K2E A;  1L3L A;  3B02 A;  2ZXJ A;  4TV7 A;  1BIB A;  2X1E A;  2F4M B;  5TGT A;  3SDB A;  2JA5 J;  1MNE A;  2KIQ A;  4BXF A;  1SFO J;  4AU7 A;  1I39 A;  1WI3 A;  1T38 A;  2FBH A;  4V2F A;  4ON0 A;  2E1O A;  3BTI A;  2TCT A;  1LQ1 A;  4BDY A;  4E7Z A;  3FK6 A;  2CQK A;  1FYK A;  4UY8 I;  3LSK A;  3MQ0 A;  4GCV A;  1YW9 A;  1WJC A;  3RYP A;  3LQR A;  1HKT A;  3OIO A;  1H8A C;  1B4A A;  4A6D A;  1D0X A;  1XGN A;  3E5Q A;  5LLQ A;  4FCY A;  3FM5 A;  3FK7 A;  4A12 A;  1WFX A;  2YPR A;  4LJZ F;  2F5F A;  4QIW N;  4CA0 A;  2Q1Z B;  3PJR A;  4E7K A;  2K85 A;  4W1U A;  4L9N A;  1O4X A;  3CCQ I;  2Y9Z A;  2DMQ A;  3CF2 A;  2VJJ A;  4B3X A;  1FOX A;  3SQN A;  1OJL A;  3DKW A;  4M71 A;  3W6V A;  2LY1 A;  4NC7 A;  1PP8 F;  3J7Y J;  3FX3 A;  2EBI A;  3S3M A;  2BE5 F;  2LK2 A;  4L18 B;  4HQE A;  2R7S A;  4BQO A;  2IS6 A;  2PN6 A;  2HQA A;  1W0U A;  1MSE C;  2XKO A;  4KMF A;  2XSJ C;  4Y3O A;  1EH7 A;  3BG5 A;  1YS7 A;  2OUM A;  3IV5 A;  1CF7 B;  3E5U A;  3TBI A;  2HQR A;  4L0Z B;  1VQ5 I;  1KU9 A;  2FX0 A;  2GLO A;  1B59 A;  4UV8 A;  3FDY A;  4U7D A;  2M3A A;  1V55 H;  2LBF A;  2UZK A;  2FJ1 A;  1IC8 A;  5F64 A;  2FQ3 A;  2KPM A;  1VQ9 I;  2H8R A;  1BR4 A;  1TQP A;  3I5U A;  3FXR A;  1XD7 A;  3U1K A;  2CV1 A;  3LSP A;  2A5Y B;  1SD6 A;  2L7K A;  3FHN A;  3HZJ A;  1HKS A;  2OU2 A;  4CCK A;  2V9P A;  3CC2 I;  1WJE A;  1TT0 A;  2K9L A;  2CFO A;  5CVJ A;  5LGU A;  4IF4 A;  2F5C A;  1S8N A;  2L54 A;  3CCU I;  3SHF A;  1TL8 A;  2OC6 A;  2GIV A;  3BR3 A;  1HF0 A;  2LC2 A;  3IC7 A;  2KIF A;  3LFK A;  2UXX A;  3GZ5 A;  3K4N A;  2ZJP F;  3ZQC A;  1U78 A;  1KA8 A;  1R5H A;  2DO7 A;  4DYC A;  2L02 A;  1T2K A;  1TWG J;  3ZN1 A;  2WAQ N;  1ETX A;  5GAE J;  5HLH A;  3J7A Y;  2X9D A;  3VYR B;  1Y0N A;  3CUQ C;  3GFI A;  4YG2 F;  2DJI A;  1MIJ A;  2IGO A;  1AWC A;  2E1C A;  1G3S A;  3ECO A;  5FKL A;  1MBG A;  1E3O C;  4OIP F;  1QQI A;  3QAH A;  1NG6 A;  1TWC J;  4BBR J;  3L00 A;  1HW2 A;  2ADU A;  3BJA A;  2X6Y A;  3JCU C;  1ZG3 A;  4R79 A;  4R1H A;  2V79 A;  4XSX F;  3FXM A;  3CO6 C;  3S3N A;  2DLL A;  4XLE A;  2KT0 A;  2XDV A;  2E60 A;  2VB6 A;  1SAX A;  5H20 A;  4RGX A;  1MZB A;  1BI1 A;  1KYZ A;  2VL8 A;  3MZY A;  2XUB A;  3JSO A;  2A07 F;  4ETS A;  4DJA A;  5ICG A;  4XNF A;  2VBZ A;  1HQC A;  2EV6 A;  4LK1 F;  5BPI A;  2ELH A;  4EJO A;  2P6S A;  3ECH A;  1A5J A;  3PFI A;  4BJT A;  3JRI A;  1UAA A;  1B9M A;  2LKX A;  3KE2 A;  3PQK A;  1GUU A;  2XGC A;  2Y30 A;  4Y52 J;  1W7P D;  3BR5 A;  1JUS A;  4KIC A;  4A3K J;  5DEQ A;  2HVR A;  1R71 A;  3I64 A;  1Y1W J;  4BL0 B;  1OKR A;  1R4N B;  3W6K B;  1OR7 C;  1Z6R A;  3MKZ A;  4E4H A;  1XX5 A;  4ZYH A;  5HOO A;  2VPR A;  3K6G A;  2UV1 A;  3HBL A;  4CH7 A;  1G6N A;  1P2F A;  4A3B J;  1I50 J;  4MFE A;  2IS2 A;  2ZME C;  2BOL A;  2M87 A;  4F93 B;  1FP1 D;  2K02 A;  2JUC A;  1KYW A;  1S72 I;  2E1M B;  3J81 K;  1D0Y A;  2BY0 A;  2AO9 A;  2YU3 A;  3TP0 A;  2VBW A;  2O9L A;  2NVT J;  3GTM J;  1O7L A;  2DT6 A;  4CCL A;  2GOX B;  1XG1 A;  2CO5 A;  2LSO A;  4CCO A;  2TRT A;  4D7M A;  1P6R A;  1OCO H;  4P55 A;  4HST A;  4HG2 A;  3WU2 C;  1LDJ A;  2LY2 A;  4NNJ A;  5D5W B;  5CVI A;  3H3U A;  1WJ5 A;  3PO2 J;  5CVU A;  2JPB A;  1I1G A;  2JPC A;  3GEZ A;  3JRB A;  2D2W A;  5J8C A;  1WKM A;  1N75 A;  1R22 A;  3AKZ A;  2HDC A;  3AAF A;  1LDK B;  2HKX A;  1FOK A;  5HOD A;  1RR8 C;  3IWZ A;  4OIO F;  2IXS A;  2NOG A;  5FRM A;  2PJR A;  5GPA A;  1IF1 A;  1OFC X;  2AQE A;  2E1N A;  2R7D A;  3DBH B;  1GHC A;  1O57 A;  3BCA A;  1ZRD A;  2E2J J;  1V5G A;  1YJW I;  3J7Z I;  5DV5 A;  2X1D A;  3H5N A;  3O8G A;  5F1J A;  1CQT A;  1TNS A;  4RLQ A;  1G3W A;  4LLG F;  2ME0 A;  2IGN A;  3PFY A;  4M3D A;  3HDD A;  4E7S A;  1JKO C;  2GXB A;  1TZL A;  2OQG A;  5J47 A;  4Y15 A;  1H9T A;  2ZNZ A;  3BR6 A;  1JKP C;  4A3L J;  4L0Y B;  5KCM A;  5FLV A;  3M9A A;  4IEJ A;  4RAF A;  2YX4 A;  2A6H F;  4A3I J;  2HEO A;  2E19 A;  2ISZ A;  1V54 H;  1ULY A;  4S0H B;  5J1U A;  5LEJ A;  1WWX A;  5CLS A;  3OSG A;  2R7U A;  2XAF A;  4YEL A;  4IHT A;  1R7J A;  2JQ7 A;  4PJN A;  1RRJ A;  2ZNY A;  2V4J C;  4F92 B;  4XK4 A;  1KON A;  1MMA A;  1FOW A;  1RKW A;  2BVL A;  2FNA A;  5LHH A;  3P5J A;  2E7X A;  3R0A A;  4G7Z F;  1B72 B;  2E2H J;  4RB2 C;  2M45 A;  2QEN A;  3DCF A;  5ED4 A;  1T0F A;  4XMY A;  1IV8 A;  2MD0 A;  2XC7 A;  3F8M A;  3RSN A;  1OCZ H;  2L0K A;  4BHB A;  3CJT B;  3CCR I;  2H6B A;  3K4C A;  5M5Y J;  1IZ1 A;  2HQ5 A;  3Q9S A;  4BQQ A;  3KCC A;  4AWX B;  5FFX A;  1U6G A;  4ZJZ A;  5GAH J;  5L3B A;  2FA5 A;  3DEU A;  2WV1 A;  1QZE A;  4PFO A;  1XTA A;  2O7O A;  2LNB A;  3K4M A;  1RQ6 A;  3HPG A;  2XB0 X;  4GFB A;  5ERI A;  1KZH A;  2LKS A;  5BMZ A;  3KZZ A;  1ETK A;  1AKH A;  4FET A;  3U2R A;  1AHD P;  5EYR A;  2FNP A;  4RDU A;  2HOA A;  2X48 A;  3WOD F;  1TTY A;  2ZJ2 A;  2F5D A;  2XAG A;  1UST A;  3OYC A;  4F7Z A;  1KU2 A;  2QUF A;  2ZXH A;  1WPK A;  4UUS A;  3CME I;  2H27 A;  3E6B A;  2KP6 A;  2EH3 A;  5KAF C;  1IV6 A;  5B1B H;  3GME A;  2BVM A;  2O8K A;  4CIC A;  3IKV A;  1JT0 A;  3KP5 A;  3MKL A;  1ZG1 A;  2JVH A;  2B7E A;  5BQT A;  5A2Q Z;  2Y0S N;  2CSO A;  1BW5 A;  2M1B A;  2L7F P;  4HYE A;  4MNU A;  4U87 A;  2DFF A;  2JA2 A;  4C2T A;  5HVQ C;  2HTS A;  2RVC A;  2PG4 A;  3M1C A;  4DYR A;  2E35 A;  3NWT A;  3QOD A;  1Z7U A;  3F23 A;  5JR3 A;  5CYV A;  1BN5 A;  2KL4 A;  3ZP5 A;  3H35 A;  2BZT A;  4C3H J;  3CCS I;  3S3O A;  2XAH A;  4IHY A;  1XMX A;  1MMS A;  3D5S C;  5DCM A;  3FM3 A;  2DI3 A;  2H6C A;  4XIC A;  5CKT A;  2RNJ A;  4P1W A;  3C7J A;  5EGO B;  4IHS A;  4EGY A;  4MQV A;  3SFI A;  4P9U A;  4CZZ A;  3OYD A;  4L9V A;  3GZ6 A;  1PJR A;  3QP5 A;  3R6S A;  2LVS A;  4DNC A;  4YFX F;  4L5E A;  1V5F A;  4E7L A;  4LG0 A;  2DJN A;  3WGI A;  3ZQH A;  5E20 A;  3PQJ A;  1X1C A;  1MSF C;  1QU3 A;  5F04 A;  3MN2 A;  2V1X A;  5BNG A;  3KEO A;  1MBJ A;  2DXI A;  3OSF A;  1YQA A;  2IEK A;  1PUE E;  1Y56 A;  4P5O A;  4KT5 C;  2ZB9 A;  1WJA A;  1FYM A;  2Q2E B;  2P8T A;  2VJ5 A;  3ZMV A;  3E6M A;  4DW6 A;  2DAO A;  3Q0V A;  2QGU A;  1U5T A;  2LRE A;  2GXG A;  3OYA A;  4A3J J;  5B5E C;  1A35 A;  2V26 A;  3OYM A;  3OWT A;  1ZRE A;  2R7X A;  3JRE A;  1IXR C;  1EH6 A;  3DKY A;  5GPC A;  2DU9 A;  4HSR A;  2V6E A;  2K3F A;  2EIM H;  3HHG A;  1HLV A;  2Z3Y A;  5D4R A;  6PAX A;  2BW3 B;  2XGD A;  1XDS A;  2FEZ A;  3FXQ A;  3HRT A;  1USS A;  3BP8 A;  3EUH C;  3L7W A;  1MJB A;  5DM6 F;  1XSX A;  2HXO A;  1SFU A;  3QRF F;  1X2M A;  2NNY A;  1S3J A;  2ZO4 A;  1IGN A;  2C6Y A;  1FP2 A;  2LLK A;  2WB1 A;  4WXH A;  4I76 A;  5D6F A;  4BDZ A;  3CO7 C;  4H4K C;  2X6X A;  2CUF A;  3H36 A;  3TKY A;  3A0H C;  3WG9 A;  1U9N A;  1WRJ A;  2OBP A;  2L3D A;  2BY1 A;  2DCE A;  4S05 A;  1K4S A;  4LK0 F;  3GFM A;  2GWR A;  2K9N A;  2A6E F;  3HSF A;  1VQO I;  4E7J A;  3CJN A;  4M3F A;  4RAY A;  2K7L A;  3RDI A;  1BIA A;  1R9T J;  2CS3 A;  5A2Q R;  4MEX F;  2L4M A;  3T8R A;  4WCG A;  2COB A;  3F8N A;  3Q5F A;  2Q0O A;  2FXA A;  5K7F A;  1UZC A;  1IW7 F;  3KYD B;  5DCF A;  1Z3X A;  5C4X J;  4CXF A;  2VQH A;  4NC8 A;  4KMU X;  5LHI A;  4XON A;  1YW7 A;  2GA2 A;  2WBM A;  3BR2 A;  1LFU P;  3KEY A;  2ZJQ F;  3HTS B;  1LKX A;  3R61 A;  3A1Y A;  2MAB A;  2IBD A;  4YII A;  2NVU B;  3I55 I;  3WTV C;  1TW2 A;  3K2Z A;  4ZYG A;  1RKT A;  4OAY A;  1BJA A;  4N0B A;  1R4M B;  1MJ9 A;  3MEX A;  1UB9 A;  5D5V B;  1D5V A;  2DA7 A;  2ICW G;  4KT6 A;  4BJ6 C;  3NQO A;  3EYY A;  3OIP A;  3K2A A;  3NRV A;  4C2U A;  3I0T A;  4EQQ A;  1QVT A;  1N25 A;  3JRF A;  3SFZ A;  4BHC A;  1V5E A;  2UWM A;  2DN0 A;  4XR6 A;  3CLO A;  1DU6 A;  2WA0 A;  3DLA A;  4Y7N J;  2XVC A;  3DFG A;  1FBU A;  1ZN2 A;  1X1P A;  4YEJ A;  4KIG A;  2QM3 A;  3OYB A;  1P4W A;  2VIX A;  4M3B A;  2KQR A;  3M07 A;  1R5I D;  3H1C A;  2QWW A;  1L0O C;  4UVC A;  3QYE A;  4JX5 A;  5D8L B;  3CLQ A;  4EV0 A;  2B63 J;  2XAU A;  4KA4 A;  1ETV A;  3D1N I;  1EH8 A;  3K1P A;  1UG0 A;  3LSG A;  3LAJ A;  5EEA A;  1MBF A;  3T0Y A;  2R4G A;  3L2U A;  2P7C B;  3JRH A;  3HOZ J;  4F52 A;  1KU3 A;  1KGS A;  3QYB A;  4BE0 A;  1P4X A;  2XF6 A;  3OYJ A;  4I09 A;  5TJJ A;  2XGX A;  3OOU A;  4W97 A;  3HOX J;  4XID A;  1H88 C;  2GM4 A;  2LD5 A;  4C3J J;  1R49 A;  4UXN A;  2D45 A;  4WF2 A;  2XIG A;  1U8R A;  3H0G J;  3J80 K;  3C3W A;  4MIM A;  4AIH A;  3BRO A;  1F43 A;  2RC4 A;  2XKP A;  4U7B A;  1G4D A;  4IPA A;  4M9X A;  4A0X A;  3UKG A;  1TWH J;  4BUP A;  5FJ8 J;  4XLH A;  2I8D A;  3I58 A;  5DS9 A;  2M0C A;  3S14 J;  2MD5 A;  1UHW A;  4MHG A;  2Q8K A;  2DTZ A;  3HC7 A;  3G4S I;  1DUX C;  5JHF A;  3M8J A;  1OIS A;  4RM2 A;  4AVZ A;  2IPQ X;  3P9I A;  2VAS A;  2OV7 A;  4KNY A;  4EM0 B;  2HQN A;  4XRF A;  5BOX A;  3TDU C;  1Y8R B;  3ZXS A;  1LUJ B;  1C0W A;  3BJO A;  1IJW C;  2BV6 A;  1FT9 A;  1H89 C;  3HHH A;  2HVS A;  2H1K A;  1JE8 A;  2FU4 A;  4ZC3 A;  5GTH C;  2H09 A;  3KLN A;  2MG4 A;  1LB2 A;  3HKZ A;  2DQR A;  2ZCW A;  3SEZ A;  1YRN B;  3ISP A;  2OD5 A;  1QNT A;  3QU3 A;  3VSK A;  3OIQ A;  4B4C A;  5HDG A;  3LQQ A;  3WTU C;  2NAZ A;  3G1O A;  3KZY A;  2VE8 A;  3EDP A;  1FOY A;  2BYV E;  4QSH A;  5HLT A;  3RPU A;  2HZD A;  5IT9 K;  3DP7 A;  1POG A;  3A2K A;  2LF7 A;  1R6R A;  4EAT A;  3KYC B;  3JW4 A;  1XN7 A;  2DT5 A;  4F91 B;  5K1Y A;  4UNO A;  1HW1 A;  4EJW A;  3CUQ B;  4A93 J;  1I3A A;  2DA6 A;  3A03 A;  2L7M P;  1ZGJ A;  1BA5 A;  1K6Y A;  1TBX A;  4Q4Z F;  2RAE A;  3Q0W A;  3VOD A;  2HR3 A;  4XSZ F;  1VQ7 I;  2OZ6 A;  2X6W A;  4M72 A;  1BI2 A;  1ETY A;  5B66 C;  5F08 A;  5A2Q K;  4ZYD A;  3DU5 A;  2JSC A;  3M3Y J;  2KLO A;  1R23 A;  2CW7 A;  4Q48 A;  1D1C A;  5AON A;  4MGR A;  4ESB A;  1WVR A;  4E6K G;  3M4O J;  5DDG A;  2Y2Z A;  3U21 A;  4JYK A;  5AIP A;  3K69 A;  2CRG A;  5ILS A;  3DU6 A;  2LP0 A;  1A04 A;  4II3 A;  3EUK L;  3AG4 H;  3SZG A;  4GGG A;  2I10 A;  1Q1H A;  2BXY A;  1TQM A;  2MLK A;  3PUB A;  1LVA A;  3VPR A;  5EZG A;  4WK8 F;  3GFJ A;  2LTP A;  1FYL A;  4Y33 A;  2ZBK A;  2ZSI B;  1S9H A;  3KYL A;  1UJ8 A;  3DPU A;  3W2V A;  2P5L C;  2EZL A;  1MMG A;  2HYJ A;  4RGU A;  3PSF A;  3H92 A;  4WXC A;  2ZXI A;  2DYS H;  2BY3 A;  3ABM H;  2XHK A;  1VQK I;  1R5G A;  2DDB A;  3RQ4 A;  4LB6 B;  3IL2 A;  4NQW B;  5IP9 J;  1J59 A;  4MTE A;  4HQM A;  5GAG J;  2KDO A;  5HS9 A;  1Z3Y A;  3UNG C;  1VQ4 I;  4XL9 A;  1SMY F;  1SD5 A;  2JSP A;  1IDY A;  2ZME B;  1HDP A;  2DMU A;  3DBR B;  5KHD A;  2CUE A;  5DD4 A;  5E8G A;  1E3P A;  3OMY A;  5IP6 A;  3IH3 A;  2HPM A;  5ILV A;  3FXJ A;  3KIO A;  4DQ2 A;  1HOM A;  3VYS B;  2QSH X;  4IRH A;  2WAD A;  4B43 A;  4Z2Y A;  1XC5 A;  2EZI A;  1ON1 A;  2X0L A;  4HX4 A;  2MUN A;  5E8I A;  1XGS A;  3OV8 A;  3OYG A;  1UHS A;  3I54 A;  3GX4 X;  4OWR B;  2KDZ A;  4UUV A;  3FXK A;  2LMD A;  1ERD A;  1T95 A;  1XPX A;  3KX2 A;  3OL3 A;  5CQE A;  3CCE I;  5FRN A;  2CMP A;  3MVP A;  2B9S A;  3AG1 H;  3CD6 I;  2YX7 A;  2DA3 A;  4GDF A;  1VQN I;  3E3V A;  4M6Y A;  1U2W A;  1JTY A;  4AD9 A;  2HTJ A;  3NAR A;  1ODD A;  2NOJ B;  3H9G A;  2VXD A;  2W00 A;  2UXN A;  2RN7 A;  1HBX G;  4L5I A;  1NH3 A;  3HUG A;  2LG4 A;  2VJI A;  3AG3 H;  3IH2 A;  1J9I A;  3ZQ7 A;  3TOB A;  3QPH A;  1YHQ I;  4FTH A;  4EJV A;  3DTI A;  3K10 A;  1MBE A;  3ASN H;  2QBY A;  3LFU A;  3BTJ A;  4A5M A;  3CMY A;  1VTN C;  2O3F A;  1SC7 A;  2VQL A;  3GLL A;  3LST A;  5FLX Z;  2PMH A;  2IA1 A;  1UHM A;  3CJQ B;  3QPS A;  4QWQ A;  1DDN A;  3HG9 A;  2HPI A;  3BTC A;  1EJ9 A;  3HOV J;  1KQ0 A;  3SZP A;  3VSL A;  1TT5 B;  3BDD A;  3I4N J;  4EJT A;  1B8I A;  1Y0U A;  4BEH B;  4FE7 A;  2CW8 A;  1XB4 A;  2A05 A;  5E1X A;  5JLX A;  4M9S A;  1K78 B;  1OMI A;  4XKV A;  2WAQ A;  2D1V A;  3CP8 A;  4A69 C;  2GXA A;  1MDM A;  2N8G A;  1CGP A;  2O0Y A;  2EPF A;  2VBY A;  4OOI A;  3S1M J;  1B1B A;  2FMY A;  2IW5 A;  4HDU A;  5DUK A;  5D5X B;  2PI0 A;  1FBS A;  3E5X A;  1VZ0 A;  1QZZ A;  2KHM A;  5M5W J;  1ZLJ A;  3LSM A;  5GAD J;  2JRM A;  2HDW A;  4N9I A;  4QPO A;  3S15 J;  4FT8 A;  4HOB A;  3OS2 A;  2A5W A;  3ZMT A;  4IHX A;  1E2X A;  3I59 B;  5CQG A;  1MBH A;  4CCN A;  1IRF A;  2VOP A;  2EFN A;  3HOY J;  4KIF A;  4NB5 A;  3GO5 A;  5DM7 F;  3L2V A;  4UB8 C;  3IKT A;  1ONV A;  2P7V B;  1FMW A;  5C3E J;  3RIR A;  2BHY A;  2ID6 A;  4FAS D;  3CTA A;  1JUM A;  4IVN A;  3OYI A;  1UG2 A;  3H5A A;  5HNH A;  4CZC A;  1U0J A;  1PVE A;  3C18 A;  1ZG5 A;  4RB0 A;  4ZDL A;  3WHC A;  1TWA J;  3EPZ A;  3IHU A;  2VKE A;  1BC7 C;  1AU7 A;  4YIR X;  1CF7 A;  4U88 A;  5FRO A;  3F0C A;  5LGN A;  5FKK A;  3PUF A;  2EFW A;  3LA3 A;  1MMD A;  3BC8 A;  3LA2 A;  1RI7 A;  1KQ9 A;  1O3S A;  4UUS B;  4G8X A;  2P5K A;  4B48 A;  4OMY A;  4PJJ A;  4RS8 A;  3M8E A;  5L3D A;  1IXS B;  2L4A A;  5AIQ A;  1EF4 A;  2KJC A;  1Y6I A;  3C2H A;  3K4K A;  2MH9 A;  4AVP A;  4P96 A;  5LEK A;  2M4G A;  3ULQ B;  2M0M A;  1YG2 A;  5J40 A;  4CSW A;  3ZN0 A;  4ENN A;  4PUS A;  1ITY A;  5M3M J;  2MFZ A;  4BAY A;  1YLF A;  4MEY F;  5J8F A;  2MH2 A;  1X1B A;  2NYX A;  3DEE A;  3RKX A;  1TW3 A;  1T6S A;  1PUF B;  2R7V A;  1D8K A;  3JR9 A;  1ZEL A;  3ZCO A;  5FLX R;  1J0R A;  4RBO A;  4XLF A;  3H3V K;  9ANT A;  3ZQL A;  4Y17 A;  5ILU A;  2EQR A;  1ENH A;  3JAM Z;  2GZW A;  1UCR A;  2AXT C;  3CMM A;  2XPW A;  2Y31 A;  5TIS C;  1QA6 A;  4AYB N;  2M8G X;  2GOM A;  4PZJ A;  3LA7 A;  4NBQ A;  3BZ6 A;  3I9V 2;  2VQG A;  4ENK A;  1XSV A;  3FKI J;  1U9O A;  1GXQ A;  3PM1 A;  1VQ8 I;  4M74 A;  3HM5 A;  3MKY B;  1APL C;  2ISY A;  3C1D A;  1Z9C A;  2XRL A;  4UVB A;  3BG9 A;  1G8X A;  2P4W A;  2IRF G;  3CCY A;  1T56 A;  1QO0 D;  3VFZ A;  3ABU A;  2R7Z J;  1HCR A;  5F0F A;  2QQ8 A;  1T0F C;  2VN2 A;  3ZMS A;  3PL8 A;  1H9G A;  4CYC B;  4ASN A;  2CU7 A;  1W5T A;  5D8K B;  3TO6 A;  3O3K A;  2PBI A;  1MH4 A;  2CFX A;  1X1D A;  1W36 C;  3LWF A;  2L5Q A;  1GLN A;  2DOD A;  1BL0 A;  4PFP A;  4I99 C;  3CCL I;  3FIS A;  2EB7 A;  1R1V A;  2FE3 A;  2R7W A;  2R5Y B;  2ZXW H;  5K5R A;  5J1R A;  3QYF A;  2B0L A;  3KP2 A;  3OR1 C;  5IOZ A;  3N4M A;  2Y9Y A;  3S1Q J;  1SAU A;  2EA4 A;  2IS4 A;  5JI6 A;  1LPQ A;  4A6E A;  4HNU A;  1XGO A;  3IRR A;  3K70 D;  4LLN A;  4C9Y A;  4N4O B;  2NVX J;  5M3F J;  3HL2 A;  2OPT A;  3ABK H;  4BNC A;  5EJC A;  1ZKG A;  1W7P B;  2A61 A;  4ENJ A;  4RB1 A;  2W24 A;  3C2G A;  3DTE A;  1IAW A;  2O61 A;  1G3Y A;  1JKQ C;  5FGM A;  2FSW A;  3NWS A;  2W84 A;  1MND A;  2M4K A;  3ML6 A;  1GVD A;  5J4Y A;  1DGW Y;  3ZMU A;  4DBQ A;  3GFL A;  2PMZ N;  2P0T A;  4FX4 A;  2WAF A;  3VB2 A;  2EV0 A;  2V1D A;  4D5F A;  4EGZ A;  2L9N A;  2XRN A;  2KFD A;  4RA2 A;  5FKM A;  4BXX J;  3F21 A;  3H5R A;  2ZFU A;  2G7H A;  2MC4 A;  2VC1 A;  4ZDO A;  1S5L C;  2W57 A;  3W2A A;  3JAM R;  1LNW A;  2IA0 A;  2NVY J;  2WC2 A;  4PJ0 C;  5KNL A;  1GVJ A;  2XV4 S;  4ESJ A;  2V9K A;  2YR2 A;  5H6Q A;  3WTZ A;  1XDU A;  3S8P A;  4G7H F;  3HSR A;  5DD8 A;  4I6Z A;  2IA2 A;  3HOT A;  4BQN A;  2NS7 A;  4ZYA A;  5EF6 A;  4D9J A;  1STZ A;  1O3Q A;  1ZLK A;  3K1M A;  4LD5 A;  3HXL A;  1WJB A;  2DMT A;  3GLX A;  2FF4 A;  1K83 J;  5FFZ A;  2M7B A;  4BGD A;  1BR1 A;  4PK4 A;  3LAP A;  3DLL F;  3RZD J;  2DFH A;  2DMP A;  3DEW A;  1LFP A;  1LJ9 A;  4NC6 A;  4MFD A;  2CUZ A;  3AFH A;  1OCC H;  4OMZ A;  5E79 C;  5GP9 A;  3RKY A;  2K27 A;  2ZJR F;  3MZH A;  4BYY A;  3BPV A;  2CUJ A;  2FBI A;  4B8X A;  2XAJ A;  2DTR A;  2Z5U A;  1BW6 A;  4HF2 A;  1U5T C;  2VOD A;  4A3E J;  3OOP A;  3RJP A;  1VND A;  3PNY A;  1P7J A;  1Y39 A;  3V7C A;  1SVM A;  4HF1 A;  2D5V A;  2ETH A;  4AIJ A;  3G2B A;  4D5C A;  5IYD J;  2V1N A;  4B44 A;  3MMY B;  2H94 A;  4ENM A;  1P4A A;  1V3F A;  4EVI A;  3ZRG A;  5E18 F;  5E3O A;  5F0C A;  2YS9 A;  3S1R J;  4FE4 A;  1TLH B;  5H2F C;  5LFA A;  3I4M J;  2BGC A;  2HVQ A;  1DPU A;  3T1B A;  5EG0 A;  3R4K A;  2R5Z B;  1FTZ A;  5E1Z B;  5D4S A;  4HNT A;  4DZJ A;  4IRG A;  4KIT B;  2JA8 J;  1UFM A;  3CDI A;  3REO A;  3ZQG A;  2DFE A;  1I6X A;  4M6X A;  1ZH5 A;  1ZQ3 P;  4G6D A;  2R7O A;  1B72 A;  2O03 A;  2K4J A;  2VUM J;  3BR1 A;  4IQ4 A;  1RR7 A;  1OQY A;  3ASO H;  4RGS A;  2AS5 F;  2W1O A;  1J5Y A;  2NNN A;  5K5O A;  4FX0 A;  4A2U A;  3DPL C;  3PIP F;  5LD2 C;  2IGK A;  3TW6 A;  4KDP A;  4PGG A;  3DKX A;  3K4B A;  3A01 B;  3QPT A;  2DYR H;  3FIW A;  2F2E A;  2NS8 A;  3SDG A;  2X98 A;  3Q0U A;  1YS6 A;  4KIB A;  1MD0 A;  4RLF A;  2YU9 J;  2VT2 A;  3BG7 A;  1N77 A;  1WQ2 A;  1YJ9 I;  3A4C A;  4IKF A;  2VJ4 A;  4BKX A;  4IXA A;  1Z7L A;  3A0B C;  1WHU A;  1J2X A;  2HOT A;  2GAU A;  3TOA A;  3B6C A;  1GDT A;  3BCB A;  2RRE A;  4DYQ A;  1VI0 A;  2NXN B;  4Y4R A;  1HST A;  4AM3 A;  1MMN A;  2AHQ A;  1Z1D A;  4FQG A;  1E3H A;  2DT7 B;  2E71 A;  3BZK A;  2WWY A;  2EFQ A;  3OYK A;  5JVG F;  3FBI B;  4ITV A;  2OA4 A;  4RGR A;  4LFU A;  5CPR B;  2ESN A;  2M5W A;  4U0V A;  4LGW A;  3JRC A;  4LMY A;  1R36 A;  3H9Q A;  3LL7 A;  2QLZ A;  5HS7 A;  2MVT A;  2XAS A;  1A36 A;  1REP C;  4IOC F;  1VQP I;  3WTW C;  3WTT C;  1MGT A;  2E36 A;  5F0H A;  5LBQ A;  4XM3 A;  3CC7 I;  3TP3 A;  1RNL A;  4I98 B;  1MNM C;  2IJL A;  1WH7 A;  3WU0 A;  2X51 A;  3FHZ A;  3FXL A;  2KIU A;  3CCM I;  1I6H J;  3GW2 A;  1QHG A;  2IT0 A;  1F4K A;  1NTC A;  1XMK A;  4A0Y A;  4Y13 A;  3E6C C;  3N05 A;  2K3P A;  4XLN F;  1S7O A;  2NRA C;  1RES A;  2KIS A;  1EKE A;  3SZT A;  2R92 J;  2F5E A;  4IRI A;  1YYV A;  3RPQ A;  1ZHF A;  5EGO A;  3BT9 A;  3GTJ J;  4KN4 X;  1X4O A;  2OCE A;  2TDX A;  4XKC A;  1OPC A;  1BI0 A;  4ABZ A;  3D0S A;  3O6B B;  4BQA A;  3HIF A;  3TGN A;  3SJM A;  1OCT C;  1F36 A;  2FQ4 A;  1JTX A;  2V7F A;  2K4B A;  3MAJ A;  3J81 Z;  2I5U A;  2Z99 A;  3MFK A;  1K79 A;  2Z9O A;  2XPV A;  1DQU A;  4CDG A;  2HOS A;  1PYV A;  3JSP A;  3WGH A;  4A3M J;  1FBQ A;  2XAQ A;  2VOO A;  2Y75 A;  1FIA A;  1R1T A;  1K6O A;  3VOE A;  1DGR M;  3S2W A;  2OTJ I;  2DA4 A;  2Q2E A;  4GYG A;  4XOT A;  2X6O A;  2LBF B;  2L9R A;  2ZKZ A;  3HSE A;  1JI8 A;  4HLX A;  2ZFW A;  3OL4 A;  4KN7 X;  4AIK A;  2QSG X;  3VEP A;  4Q47 A;  1JKR C;  1G59 A;  1NK3 P;  1DU0 A;  3TO9 A;  2HYG D;  3SXY A;  2F4I A;  2QYO A;  3LNQ A;  2WY7 Q;  3J7A W;  2WAE A;  1YJN I;  1JHH A;  2RV8 A;  5K7H A;  5IP7 J;  2HS5 A;  2BW3 A;  4EM1 A;  4IL6 C;  4LG3 A;  2R93 J;  1TQI A;  4EEF G;  4HA8 A;  2PX9 A;  4JX4 A;  3VYU B;  1D8J A;  3IWF A;  5FO5 A;  3ROU A;  3QU6 A;  2K5C A;  2XB5 A;  3IAM 2;  1S7A A;  2KRF A;  1YO5 C;  3K70 C;  5E3N A;  2E2I J;  3D5R C;  2F4O B;  2ZC2 A;  3KP6 A;  2EIJ H;  3RI4 A;  1PP7 U;  2DOA A;  5HDK A;  3QQA A;  2PQ8 A;  2H8W A;  1MJA A;  4QPQ A;  4HX8 A;  2LYC A;  1ZTR A;  3U1D A;  5ICC A;  1EV7 A;  5JHU A;  2J5P A;  4EJU A;  4I02 A;  2CGP A;  3K4J A;  4ZDP A;  3P9C A;  2CQ7 A;  2DA2 A;  2Y69 H;  3DQV C;  3V7R A;  4XRS G;  4BBS J;  2MA3 A;  1SFE A;  3OYE A;  2MC3 A;  4KIS A;  3BY6 A;  4MTD A;  2O5R A;  5KAI C;  3HRS A;  3P9K A;  2F5V A;  2K9Q A;  2ELK A;  4ANJ A;  2M9H A;  4CCM A;  3IUO A;  1IRX A;  4KYW A;  2RNG A;  3MZ8 A;  3L2R A;  3HYI A;  1FLI A;  1FC3 A;  2P0W A;  2O6G E;  2HYF A;  3W6J B;  4BJ5 C;  1W36 D;  2KIM A;  2W25 A;  4OIN F;  2JVG A;  4N4N B;  3EQL F;  1IRG A;  4HV6 A;  3H3Z A;  1MDM B;  2R3S A;  4IOA F;  2LOO A;  3KEQ A;  3FZV A;  1MBK A;  3O8H A;  4NUB A;  2XF5 A;  3V8J A;  1OCP A;  2GIZ A;  2MYS A;  1E0E A;  3J81 R;  1ZAR A;  4HZF A;  3RQI A;  5D5U B;  3CDH A;  2M7A A;  3QP6 A;  1QHH D;  3CMA I;  1Z05 A;  3RCO A;  2AQF A;  3FKJ A;  2JMW A;  2CJJ A;  3HB9 A;  1WH5 A;  3OYH A;  4IHW A;  4CGZ A;  2BXZ A;  2E34 A;  5L3C A;  4PDK A;  2FRH A;  4L9J A;  3BQZ A;  3SYT A;  3CQZ J;  2VE9 A;  1G2H A;  3D5L A;  1RUN A;  2DW4 A;  4S04 A;  2CH0 A;  3CCJ I;  1SD7 A;  1ZR2 A;  5HS8 A;  2KJB A;  1YIJ I;  2DA1 A;  2R7R A;  3FMQ A;  4KUM A;  4HF0 A;  3N97 A;  2Z33 A;  4XLA A;  3ERE D;  5KVR A;  3IAS 2;  3OR2 C;  1YI2 I;  3CZ6 A;  3LOC A;  3VYT B;  2RQP A;  4MO7 A;  5E1W A;  1XMA A;  2P6T A;  2ECC A;  2UUZ A;  3G71 I;  4JX6 A;  1BM9 A;  1D3Y A;  4E7I A;  4A3C J;  3EYI A;  1RIO H;  2MSY A;  2JZY A;  3GTO J;  3GTG J;  3ZR8 X;  2VPL A;  2DFI A;  2VXZ A;  4B1R A;  1I3Q J;  2CYY A;  2DK5 A;  4GRI A;  2HZT A;  2CG4 A;  3K7A J; 
#chains in the Genus database with same CATH homology
 1U3E M;  4IJA A;  2VT3 A;  1SFX A;  2OZU A;  4LB5 A;  2G7U A;  3E97 A;  4JK1 X;  1XGM A;  1FPQ A;  1HKQ A;  4UVA A;  3F6O A;  3G3Z A;  4I01 A;  2J5O A;  3BPX A;  1IUY A;  3GXO A;  3DF8 A;  4WWC A;  1HXD A;  3Q9V A;  3U9G A;  4HLY A;  1E17 A;  3RYR A;  3BOQ A;  1B6A A;  1ON2 A;  5ICF A;  1HSJ A;  4QLC U;  2DPU A;  1QBJ A;  3F72 A;  4ZZL A;  2PFB A;  2IVM A;  3I53 A;  4YIF A;  5CJ9 A;  2EA2 A;  4Q5S F;  4I0B A;  3V7S A;  5ICE A;  4XLP F;  3HRU A;  1BBY A;  2L01 A;  4CHU A;  2JRT A;  3CUQ A;  2STW A;  1NHA A;  1G3T A;  4D0P A;  2DPD A;  3TDZ C;  2QQ9 A;  4WX9 A;  1MKM A;  1ZYR F;  3J7A O;  1IN4 A;  2COM A;  1KU7 A;  1SD4 A;  1LEA A;  2PEX A;  2BEO A;  1K7A A;  1XSD A;  5CVR A;  2G9W A;  4HBL A;  4B09 A;  5KK1 A;  1IN7 A;  2DBB A;  3V4G A;  2D1H A;  5H6R A;  2ACJ A;  3WE2 A;  4O5V A;  4I2O A;  3I4P A;  2ESH A;  2JTV A;  3F8F A;  3NEU A;  4I0A A;  3HRM A;  1OR7 A;  5JFR A;  4PCQ A;  5FB2 A;  2FOK A;  4CO8 A;  1O3R A;  2KKO A;  1O7F A;  4NQW A;  1S6L A;  4FHT A;  4JQF A;  2ZME A;  1HW5 A;  3O2P E;  4OU0 A;  3FXU A;  3KP4 A;  1WI9 A;  2DK8 A;  5EEH A;  5L3F A;  2MLG A;  1XCV A;  5DCM B;  4WXD A;  1BOA A;  4ZH4 F;  4H0E A;  1OYW A;  2DQL A;  3T8T A;  3FMR A;  4OIR F;  1BC8 C;  3V8L A;  4GO1 A;  4U0W A;  4LG0 B;  5LRR A;  5J6X A;  3WTS C;  2QQB A;  4G94 A;  5LHG A;  4NHJ A;  2RKH A;  1FY7 A;  1T98 A;  2EFO A;  3JTG A;  5HDN A;  1U5T B;  1J75 A;  2LDU A;  3J80 Z;  5DYM A;  2PMU A;  2GA1 A;  1TNT A;  1K78 A;  3M8F A;  5L3E A;  3KFW X;  2QVO A;  1FZP B;  2Y48 A;  2V9V A;  5HLG A;  5FD6 A;  2YSR A;  3GWZ A;  3MCZ A;  4MQ9 F;  1QGP A;  1YIO A;  4M9Z A;  2NS0 A;  3I71 A;  3ABT A;  1JGS A;  3I59 A;  1J7K A;  3RKW A;  4P9F A;  3R60 A;  1P92 A;  1Z6T A;  4M73 A;  1QZY A;  3F6V A;  5BS6 A;  1O3T A;  1I5Z A;  3GYH X;  3WTY C;  4BH9 A;  5DUI A;  2OQR A;  1FSH A;  2EJR A;  5IT9 Z;  3RTR A;  3P7N A;  3F22 A;  4PGH A;  2P5V A;  4BXU A;  4UV9 A;  3KLO A;  1RZ4 A;  1DPR A;  3G73 A;  1R58 A;  2MBF A;  4JBA A;  1IN8 A;  3KP7 A;  3M7G A;  1ZGA A;  1WSU A;  4ZYE A;  3KP3 A;  1ZRF A;  1H0M A;  1JHF A;  1X3U A;  1RUO A;  1ZRC A;  4BHP A;  5BPD A;  3CUO A;  3WTX C;  1FX7 A;  3DV8 A;  4L9T A;  2O8X A;  2HWV A;  1FSE A;  1GXP A;  2WV0 A;  1R00 A;  3WE3 A;  3R0J A;  3ZMD A;  2GQQ A;  3JTH A;  3L09 A;  5FLX K;  2VBX A;  4YFK F;  3BWG A;  4A5N A;  3DXJ F;  2RDP A;  2QQA A;  2X4H A;  1IN6 A;  4LLL A;  2A69 F;  4GYI A;  3HTU A;  1IXC A;  3K0L A;  4R8H A;  5D6E A;  1V4R A;  4A0Z A;  1R1U A;  2E7W A;  4YFN F;  2R7F A;  2EK5 A;  2FML A;  1YTY A;  2EWN A;  2M8E A;  5CVV A;  1BI3 A;  4GXO A;  4G7O F;  1QPM A;  1S29 A;  3BJ6 A;  3EUH A;  3GF2 A;  3E6D A;  1B9N A;  2M30 A;  1W7P A;  1SMT A;  5TRD A;  4KFC A;  3F8C A;  2Y0M A;  2HFH A;  1LDD A;  5LRS A;  3M1E A;  4HV5 A;  4G6Q A;  4RB3 C;  4G9Y A;  4RAZ A;  5HLI A;  2HKO A;  2PLY A;  2HOE A;  3GUD A;  4I7H A;  1XCB A;  3HOS A;  1F5T A;  2WTE A;  1LEB A;  3K1N A;  1FNN A;  4O6J A;  1YFH A;  1AOY A;  1KQ8 A;  3JAM K;  3KET A;  2LF8 A;  4UHT A;  1I27 A;  2STT A;  4O3M A;  1JXS A;  4OIQ F;  2A3S A;  2AXL A;  4CYD A;  1T39 A;  2RGV A;  3IRQ A;  3B73 A;  1F9N A;  4HDV A;  5K5Q A;  4HX7 A;  1IN5 A;  3F3X A;  3EET A;  3L9F A;  1W5S A;  2EV5 A;  3ELK A;  3MWM A;  3T5X A;  4ESF A;  2BBY A;  1OYY A;  5LGT A;  3TO7 A;  2VC0 A;  2V6C A;  3WU1 B;  1FWZ A;  3K9T A;  4E70 A;  4ZZD A;  1ZAO A;  3ZMZ A;  2LKP A;  1OYI A;  4HAM A;  2EFP A;  1W4M A;  3FF5 A;  1PDN C;  4U0Y A;  1Z91 A;  1I1S A;  3FMS A;  2HGC A;  5L3G A;  3FWE A;  4EMS A;  4N9H A;  3ZPL A;  5E17 F;  2K86 A;  1YW8 A;  3GVA A;  1DP7 P;  2FBK A;  5EEG A;  4EM2 A;  2PJP A;  3TQN A;  2V1U A;  4HW0 A;  2CWE A;  3L2C A;  4L5J A;  2VON A;  3WGG A;  2QBY B;  3F8B A;  2IP2 A;  2A68 F;  1F1Z A;  4XBF A;  3V8K A;  5FD5 A;  2QZ8 A;  3COA C;  5F6F A;  2CW0 F;  2W85 A;  3QOP A;  2OAZ A;  5JVT A;  3DPT A;  2XRO A;  5F1R A;  2JT1 A;  5IT3 A;  4K2E A;  1L3L A;  3B02 A;  2ZXJ A;  4TV7 A;  1BIB A;  1T38 A;  2FBH A;  4ON0 A;  1LQ1 A;  2CQK A;  1FYK A;  3MQ0 A;  4GCV A;  1YW9 A;  3RYP A;  3LQR A;  1HKT A;  1B4A A;  4A6D A;  1XGN A;  3E5Q A;  5LLQ A;  3FM5 A;  4A12 A;  2YPR A;  4LJZ F;  2F5F A;  4L9N A;  3SQN A;  3DKW A;  4M71 A;  1PP8 F;  3FX3 A;  2BE5 F;  4L18 B;  4HQE A;  2PN6 A;  2XKO A;  4KMF A;  1EH7 A;  1YS7 A;  1CF7 B;  3E5U A;  4L0Z B;  2HQR A;  1KU9 A;  1B59 A;  4UV8 A;  4U7D A;  2UZK A;  5F64 A;  2FQ3 A;  1TQP A;  3I5U A;  3FXR A;  1XD7 A;  2A5Y B;  1SD6 A;  1HKS A;  2OU2 A;  5CVJ A;  5LGU A;  4IF4 A;  2F5C A;  1S8N A;  2L54 A;  3SHF A;  2GIV A;  3IC7 A;  2KIF A;  3LFK A;  2UXX A;  3GZ5 A;  1U78 A;  1KA8 A;  1R5H A;  2DO7 A;  2L02 A;  1T2K A;  3ZN1 A;  5HLH A;  3CUQ C;  3GFI A;  4YG2 F;  2E1C A;  1AWC A;  1G3S A;  3ECO A;  4OIP F;  1QQI A;  3QAH A;  3L00 A;  1HW2 A;  2ADU A;  3BJA A;  4R79 A;  1ZG3 A;  4R1H A;  2V79 A;  4XSX F;  3CO6 C;  2DLL A;  1SAX A;  5H20 A;  4RGX A;  1MZB A;  1BI1 A;  1KYZ A;  3MZY A;  3JSO A;  2XUB A;  2A07 F;  4ETS A;  5ICG A;  2VBZ A;  1HQC A;  2EV6 A;  4LK1 F;  5BPI A;  2ELH A;  4EJO A;  2P6S A;  3ECH A;  3PFI A;  1B9M A;  3KE2 A;  3PQK A;  1W7P D;  4KIC A;  5DEQ A;  3I64 A;  1OKR A;  3W6K B;  1Z6R A;  4ZYH A;  5HOO A;  1G6N A;  1P2F A;  2M87 A;  1FP1 D;  2K02 A;  1KYW A;  3J81 K;  2YU3 A;  2VBW A;  1O7L A;  2CO5 A;  2LSO A;  1P6R A;  4P55 A;  1LDJ A;  5D5W B;  5CVI A;  3H3U A;  5CVU A;  2JPB A;  1I1G A;  2JPC A;  3GEZ A;  2D2W A;  5J8C A;  1WKM A;  1R22 A;  2HDC A;  3AAF A;  1LDK B;  2HKX A;  1FOK A;  3IWZ A;  4OIO F;  1IF1 A;  2E1N A;  2R7D A;  1GHC A;  1O57 A;  1ZRD A;  5DV5 A;  1TNS A;  1G3W A;  4LLG F;  2GXB A;  2OQG A;  4Y15 A;  1H9T A;  2ZNZ A;  4L0Y B;  3M9A A;  2YX4 A;  2A6H F;  2HEO A;  2ISZ A;  1ULY A;  5LEJ A;  1WWX A;  5CLS A;  2XAF A;  4IHT A;  1R7J A;  2ZNY A;  2FNA A;  5LHH A;  2E7X A;  3R0A A;  4G7Z F;  4RB2 C;  2M45 A;  2QEN A;  5ED4 A;  1T0F A;  3F8M A;  4BHB A;  2H6B A;  1IZ1 A;  3Q9S A;  3KCC A;  4AWX B;  5FFX A;  1U6G A;  5L3B A;  2FA5 A;  3DEU A;  2LNB A;  5ERI A;  5BMZ A;  3KZZ A;  3U2R A;  2FNP A;  3WOD F;  1TTY A;  2ZJ2 A;  2F5D A;  2XAG A;  1UST A;  4F7Z A;  1KU2 A;  2QUF A;  2H27 A;  3E6B A;  4CIC A;  3IKV A;  3KP5 A;  1ZG1 A;  5BQT A;  5A2Q Z;  2CSO A;  2M1B A;  4HYE A;  4MNU A;  5HVQ C;  2HTS A;  2RVC A;  2PG4 A;  1Z7U A;  3F23 A;  5JR3 A;  5CYV A;  1BN5 A;  3ZP5 A;  2XAH A;  5DCM A;  3FM3 A;  2DI3 A;  2H6C A;  2RNJ A;  3C7J A;  4IHS A;  4EGY A;  4MQV A;  4P9U A;  4CZZ A;  4L9V A;  3GZ6 A;  3QP5 A;  3R6S A;  4DNC A;  4YFX F;  4LG0 A;  3WGI A;  5E20 A;  3PQJ A;  2V1X A;  3KEO A;  1YQA A;  1PUE E;  4P5O A;  4KT5 C;  1FYM A;  2P8T A;  3ZMV A;  3E6M A;  2DAO A;  1U5T A;  2GXG A;  1ZRE A;  1IXR C;  1EH6 A;  2DU9 A;  3HHG A;  2Z3Y A;  5D4R A;  6PAX A;  1XDS A;  2FEZ A;  3FXQ A;  3HRT A;  1USS A;  3BP8 A;  3L7W A;  1MJB A;  1XSX A;  1SFU A;  3QRF F;  2NNY A;  1S3J A;  2ZO4 A;  2C6Y A;  1FP2 A;  4WXH A;  5D6F A;  3CO7 C;  3TKY A;  3WG9 A;  1WRJ A;  2OBP A;  2L3D A;  4S05 A;  4LK0 F;  3GFM A;  2GWR A;  2A6E F;  3HSF A;  3CJN A;  4RAY A;  2K7L A;  3RDI A;  1BIA A;  4MEX F;  2L4M A;  3T8R A;  4WCG A;  3F8N A;  3Q5F A;  2Q0O A;  2FXA A;  1IW7 F;  5DCF A;  4CXF A;  4KMU X;  5LHI A;  1YW7 A;  2GA2 A;  3HTS B;  3R61 A;  4YII A;  3WTV C;  1TW2 A;  3K2Z A;  4ZYG A;  1BJA A;  4N0B A;  1MJ9 A;  3MEX A;  1UB9 A;  5D5V B;  1D5V A;  3NQO A;  3EYY A;  3NRV A;  3I0T A;  4EQQ A;  3SFZ A;  4BHC A;  2UWM A;  3CLO A;  2XVC A;  3DFG A;  1FBU A;  1ZN2 A;  4KIG A;  2QM3 A;  1P4W A;  2QWW A;  1L0O C;  4UVC A;  5D8L B;  4EV0 A;  4KA4 A;  1EH8 A;  3K1P A;  3LAJ A;  3T0Y A;  2P7C B;  1KU3 A;  1KGS A;  1P4X A;  4I09 A;  5TJJ A;  2XGX A;  4UXN A;  2D45 A;  4WF2 A;  2XIG A;  1U8R A;  3J80 K;  3C3W A;  4AIH A;  3BRO A;  2RC4 A;  2XKP A;  4U7B A;  1G4D A;  4IPA A;  4M9X A;  4A0X A;  3I58 A;  2MD5 A;  1UHW A;  4MHG A;  2Q8K A;  1DUX C;  2IPQ X;  3P9I A;  4KNY A;  4EM0 B;  2HQN A;  4XRF A;  5BOX A;  3TDU C;  1C0W A;  3BJO A;  2BV6 A;  1FT9 A;  3HHH A;  1JE8 A;  2FU4 A;  2H09 A;  3KLN A;  1LB2 A;  2DQR A;  2ZCW A;  3ISP A;  2OD5 A;  1QNT A;  3QU3 A;  5HDG A;  3LQQ A;  3WTU C;  2NAZ A;  3KZY A;  2VE8 A;  3EDP A;  2BYV E;  3RPU A;  5IT9 K;  3DP7 A;  2LF7 A;  3JW4 A;  1XN7 A;  2DT5 A;  5K1Y A;  4UNO A;  1HW1 A;  4EJW A;  3CUQ B;  1ZGJ A;  1TBX A;  4Q4Z F;  3VOD A;  2HR3 A;  4XSZ F;  2OZ6 A;  4M72 A;  1BI2 A;  5A2Q K;  4ZYD A;  2JSC A;  1R23 A;  4Q48 A;  5AON A;  4MGR A;  4ESB A;  5DDG A;  5AIP A;  3K69 A;  5ILS A;  1A04 A;  4GGG A;  1Q1H A;  1TQM A;  2MLK A;  1LVA A;  4WK8 F;  3GFJ A;  1FYL A;  2ZBK A;  2P5L C;  4RGU A;  3H92 A;  4WXC A;  2XHK A;  1R5G A;  4LB6 B;  3IL2 A;  1J59 A;  4MTE A;  4HQM A;  5HS9 A;  1SMY F;  1SD5 A;  2ZME B;  5DD4 A;  5E8G A;  5ILV A;  4DQ2 A;  4IRH A;  4Z2Y A;  1ON1 A;  2X0L A;  4HX4 A;  5E8I A;  1XGS A;  3OV8 A;  3GX4 X;  3I54 A;  4UUV A;  2YX7 A;  3E3V A;  4M6Y A;  1U2W A;  4AD9 A;  2HTJ A;  1ODD A;  2UXN A;  2RN7 A;  1HBX G;  4L5I A;  3HUG A;  1J9I A;  3ZQ7 A;  3TOB A;  3QPH A;  4EJV A;  2QBY A;  4A5M A;  1VTN C;  2O3F A;  3LST A;  5FLX Z;  2PMH A;  2IA1 A;  1UHM A;  1DDN A;  4QWQ A;  1KQ0 A;  3SZP A;  3BDD A;  4EJT A;  1Y0U A;  1XB4 A;  5E1X A;  4M9S A;  1K78 B;  1OMI A;  2D1V A;  1MDM A;  1CGP A;  2O0Y A;  2VBY A;  4OOI A;  1B1B A;  2FMY A;  2IW5 A;  4HDU A;  5DUK A;  5D5X B;  2PI0 A;  1FBS A;  3E5X A;  1QZZ A;  1ZLJ A;  4N9I A;  4FT8 A;  4HOB A;  3ZMT A;  1E2X A;  3I59 B;  1IRF A;  2VOP A;  2EFN A;  4KIF A;  4NB5 A;  3GO5 A;  3IKT A;  1ONV A;  2P7V B;  3RIR A;  3CTA A;  4IVN A;  3C18 A;  1ZG5 A;  4RB0 A;  3IHU A;  1BC7 C;  1CF7 A;  4U88 A;  5LGN A;  2EFW A;  3LA3 A;  3LA2 A;  1RI7 A;  1KQ9 A;  1O3S A;  4G8X A;  2P5K A;  4OMY A;  4RS8 A;  3M8E A;  5L3D A;  1IXS B;  2L4A A;  5AIQ A;  2KJC A;  2MH9 A;  4AVP A;  4P96 A;  5LEK A;  3ULQ B;  1YG2 A;  3ZN0 A;  4ENN A;  4BAY A;  1YLF A;  4MEY F;  5J8F A;  2MH2 A;  2NYX A;  3RKX A;  1TW3 A;  1T6S A;  1D8K A;  1J0R A;  4Y17 A;  5ILU A;  3JAM Z;  2GZW A;  1UCR A;  4PZJ A;  3LA7 A;  3BZ6 A;  4ENK A;  1XSV A;  1GXQ A;  4M74 A;  2ISY A;  3C1D A;  1Z9C A;  4UVB A;  2P4W A;  2IRF G;  1QO0 D;  3VFZ A;  3ABU A;  2VN2 A;  3ZMS A;  1H9G A;  4ASN A;  1W5T A;  5D8K B;  3TO6 A;  3O3K A;  2PBI A;  2CFX A;  3LWF A;  2EB7 A;  1R1V A;  2FE3 A;  5K5R A;  2B0L A;  3KP2 A;  3N4M A;  2EA4 A;  5JI6 A;  4A6E A;  1XGO A;  3IRR A;  4LLN A;  4BNC A;  1W7P B;  2A61 A;  4ENJ A;  4RB1 A;  2W24 A;  1IAW A;  2O61 A;  1G3Y A;  5FGM A;  2FSW A;  2W84 A;  3ML6 A;  3ZMU A;  3GFL A;  4FX4 A;  3VB2 A;  2EV0 A;  2V1D A;  4EGZ A;  2XRN A;  3F21 A;  2G7H A;  2VC1 A;  2W57 A;  1LNW A;  2IA0 A;  2WC2 A;  1GVJ A;  2XV4 S;  4ESJ A;  2YR2 A;  5H6Q A;  3WTZ A;  1XDU A;  4G7H F;  3HSR A;  5DD8 A;  2IA2 A;  3HOT A;  1STZ A;  1O3Q A;  1ZLK A;  3K1M A;  4LD5 A;  3GLX A;  2FF4 A;  5FFZ A;  3LAP A;  1LJ9 A;  3RKY A;  4OMZ A;  2K27 A;  3MZH A;  4BYY A;  3BPV A;  2FBI A;  4B8X A;  2XAJ A;  2DTR A;  2Z5U A;  4HF2 A;  1U5T C;  2VOD A;  3OOP A;  3RJP A;  3V7C A;  4HF1 A;  2ETH A;  4AIJ A;  2H94 A;  4ENM A;  1P4A A;  1V3F A;  4EVI A;  5E18 F;  1TLH B;  2BGC A;  1DPU A;  3T1B A;  3R4K A;  5E1Z B;  5D4S A;  4IRG A;  1UFM A;  3REO A;  1I6X A;  4M6X A;  1ZH5 A;  4G6D A;  2O03 A;  2K4J A;  2AS5 F;  4RGS A;  1J5Y A;  2NNN A;  5K5O A;  4FX0 A;  4A2U A;  3DPL C;  4KDP A;  4PGG A;  3QPT A;  2F2E A;  1YS6 A;  4KIB A;  1MD0 A;  2VT2 A;  1WQ2 A;  4IXA A;  1J2X A;  2GAU A;  3TOA A;  1HST A;  1Z1D A;  2WWY A;  2EFQ A;  2OA4 A;  4RGR A;  4LFU A;  2ESN A;  2M5W A;  4U0V A;  4LGW A;  4LMY A;  1R36 A;  2QLZ A;  5HS7 A;  2XAS A;  1REP C;  3WTW C;  3WTT C;  1MGT A;  5LBQ A;  1RNL A;  4I98 B;  2IJL A;  3WU0 A;  3FHZ A;  2KIU A;  3GW2 A;  2IT0 A;  1F4K A;  1XMK A;  4A0Y A;  4Y13 A;  3E6C C;  4XLN F;  1S7O A;  2NRA C;  3SZT A;  2F5E A;  4IRI A;  1YYV A;  3RPQ A;  1ZHF A;  4KN4 X;  2TDX A;  1OPC A;  1BI0 A;  3D0S A;  3O6B B;  4BQA A;  3HIF A;  3TGN A;  2K4B A;  3MAJ A;  3J81 Z;  1K79 A;  2Z99 A;  3MFK A;  2Z9O A;  4CDG A;  3JSP A;  3WGH A;  1FBQ A;  2XAQ A;  2VOO A;  2Y75 A;  1R1T A;  1K6O A;  3VOE A;  3S2W A;  2Q2E A;  4GYG A;  2ZKZ A;  3HSE A;  4HLX A;  2ZFW A;  4KN7 X;  4AIK A;  3VEP A;  4Q47 A;  3TO9 A;  2HYG D;  3SXY A;  2QYO A;  1JHH A;  2RV8 A;  2HS5 A;  4EM1 A;  1TQI A;  4HA8 A;  1D8J A;  3IWF A;  5FO5 A;  3ROU A;  3QU6 A;  1S7A A;  2KRF A;  1YO5 C;  3KP6 A;  3RI4 A;  1PP7 U;  5HDK A;  2PQ8 A;  1MJA A;  4HX8 A;  3U1D A;  5ICC A;  1EV7 A;  5JHU A;  2J5P A;  4EJU A;  4I02 A;  2CGP A;  3P9C A;  3DQV C;  3V7R A;  2MA3 A;  1SFE A;  2MC3 A;  3BY6 A;  4MTD A;  3HRS A;  3P9K A;  4KYW A;  3HYI A;  1FLI A;  1FC3 A;  2O6G E;  2HYF A;  3W6J B;  2KIM A;  2W25 A;  4OIN F;  3EQL F;  1IRG A;  4HV6 A;  3H3Z A;  1MDM B;  2R3S A;  3KEQ A;  3FZV A;  3V8J A;  1ZAR A;  4HZF A;  5D5U B;  3CDH A;  3QP6 A;  1Z05 A;  4CGZ A;  5L3C A;  4PDK A;  2FRH A;  4L9J A;  2VE9 A;  3D5L A;  1RUN A;  2DW4 A;  4S04 A;  1SD7 A;  5HS8 A;  2KJB A;  3FMQ A;  4KUM A;  4HF0 A;  3N97 A;  2Z33 A;  3ERE D;  5KVR A;  2RQP A;  5E1W A;  1XMA A;  2P6T A;  1BM9 A;  1D3Y A;  3EYI A;  1RIO H;  2JZY A;  2DFI A;  2VXZ A;  2CYY A;  2DK5 A;  2HZT A;  2CG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...