1ON2A

Bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
135
structure length
135
Chain Sequence
TTPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structure of the Manganese-Bound Manganese Transport Regulator of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 49
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1on2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1on2A02
3IHUA 2J5OA 5EEGA 1OPCA 3OV8A 4BYYA 3KP5A 1W5SA 4IF4A 2EB7A 5BS6A 1ZRCA 5LHIA 3RYPA 4UUVA 3DV8A 2DU9A 2O03A 4RGXA 4EM1A 5D5XB 3FF5A 5CJ9A 5IT3A 2G7HA 4G7ZF 2PFBA 1LQ1A 1FSHA 5J6XA 5DUIA 1A04A 2MH2A 3MZYA 1T0FA 4RGRA 3NEUA 2HYFA 1XGNA 3E6MA 2D45A 1ZH5A 3DF8A 2XROA 5CLSA 1BI2A 1R7JA 2IA2A 5L3CA 4AVPA 3U2RA 4WK8F 3IRQA 4WWCA 4KT5C 4UV8A 1HW1A 3AAFA 4UVCA 4ZYGA 2FXAA 4O5VA 2KJBA 1UHWA 4GYIA 4HA8A 1QQIA 3WGIA 1XGMA 1J0RA 4EQQA 3CUQA 4MQ9F 4M74A 1I5ZA 2DQLA 1C0WA 1KGSA 5FLXZ 3CUQB 3QAHA 1TNTA 1IN7A 4BHCA 4A12A 3TOAA 2B0LA 4OU0A 1V4RA 5LLQA 3BJAA 4LJZF 3KP2A 3REOA 4U0WA 1T98A 4EM2A 2RKHA 2K7LA 4WXCA 2QLZA 4Q47A 4RGSA 1R1VA 1K78A 2Z99A 4KDPA 4A0XA 2VT2A 4LD5A 1S8NA 2BGCA 2CSOA 2HTSA 2QYOA 1K78B 4ZZDA 3L2CA 1REPC 3RKXA 3TQNA 2K4BA 3QOPA 5ILUA 5ILVA 4A6DA 3N97A 1TNSA 2ESHA 4FX0A 2HGCA 4I0AA 4NB5A 1B9NA 3SFZA 5D8KB 3ML6A 1ZG3A 3T1BA 1SD6A 5K5OA 3V8JA 3E97A 1QBJA 5JVTA 1W4MA 4BH9A 2W85A 1V3FA 2HQNA 2F5CA 3GWZA 3HTUA 1K7AA 5E8IA 1S3JA 3ZMTA 3HTSB 3WGHA 5DDGA 1G4DA 1J75A 1XSVA 4HX7A 2GAUA 3MFKA 1FBSA 2HR3A 2V1XA 4U88A 2BV6A 5EEHA 1P4WA 4EJOA 4I09A 4UVAA 2H27A 1HKTA 5LRSA 2DI3A 3WU0A 2IRFG 1YTYA 1MGTA 1FP1D 3JTGA 1ZREA 4LK1F 3N4MA 1IW7F 3I64A 1EH6A 1UFMA 3EDPA 5H6QA 1RI7A 4CDGA 2CWEA 3RI4A 2STTA 4XLPF 4ESFA 3V7CA 4CHUA 4LB5A 3DEUA 5JI6A 2G7UA 5DCMA 5CVIA 2FF4A 2GZWA 4ZZLA 1G3TA 4S04A 4G6QA 4EJUA 4UV9A 2Y0MA 5FLXK 5DCMB 3GFJA 5KK1A 4U0YA 3JSPA 4IJAA 1DPRA 1K6OA 1Z1DA 3MZHA 5FO5A 1ZAOA 1ZARA 4UNOA 1XGOA 4MHGA 4RB0A 1XD7A 2XGXA 2RQPA 4L5IA 2ZMEA 1YIOA 2P8TA 3ISPA 1R5HA 4Q4ZF 4I0BA 3U9GA 5D5VB 2ZMEB 3R4KA 2ZO4A 3IC7A 5J8CA 3GUDA 3ZP5A 2E7WA 2M87A 1QZYA 3TKYA 3FXQA 4IPAA 3KP6A 1G6NA 2CYYA 1MJBA 2IVMA 3DPLC 1L0OC 3PQJA 1RUNA 2W25A 3CTAA 2ZKZA 3FMQA 3F8BA 1GHCA 2CQKA 1TTYA 4D0PA 4I02A 1FC3A 1IF1A 4HF1A 2A5YB 1IN5A 5FB2A 3K69A 1B1BA 4JBAA 1TBXA 1FZPB 3KE2A 2EFPA 2EWNA 5LGTA 4L9TA 1I1GA 5HS8A 3ZMDA 1S7AA 3NRVA 3QP6A 4OIPF 1GXPA 2JPBA 1R00A 2O61A 2L01A 2F5DA 3E5QA 2PI0A 2X4HA 4QLCU 4RB1A 4AIHA 1P4AA 2H6BA 3O6BB 3E6CC 3EYIA 4U7DA 4OOIA 3DFGA 3VFZA 1FYMA 2VBYA 2VE9A 4YG2F 3M8FA 5HDKA 1BI0A 3GFIA 1PP8F 1ZRFA 2ACJA 1O3RA 2O6GE 5IT9Z 3F21A 3RKYA 4HF2A 2EA2A 4MEXF 2V1DA 2L02A 4A0YA 4M9ZA 5L3FA 4K2EA 3BWGA 4UHTA 2V6CA 3ECHA 1O57A 4L9VA 4M71A 3GVAA 2ETHA 1ZYRF 3KZYA 2FBHA 3VEPA 1KU9A 2M45A 2XAJA 3RDIA 3FMRA 2QM3A 2EV0A 1BJAA 1H9TA 5DUKA 4Q5SF 4IHTA 4E70A 3RPQA 4XSZF 1WI9A 2XAHA 2AXLA 5HLHA 2NAZA 2RDPA 5LGUA 5K1YA 5HDGA 2UWMA 1JHHA 2DTRA 1R23A 6PAXA 4HX4A 5CVVA 2WC2A 4I7HA 1DPUA 5DEQA 3MEXA 1XSXA 2R7DA 5JHUA 2VOOA 2ISZA 2KJCA 2IW5A 1BM9A 1YS7A 4RB2C 4EGZA 4DQ2A 2WTEA 4KUMA 3CUQC 3KETA 2XRNA 3ZN0A 2VODA 3CDHA 5JR3A 4XBFA 4G7OF 1CGPA 1FT9A 3COAC 4N0BA 1TQPA 3IRRA 1SD7A 1JGSA 1JE8A 1FY7A 4M6YA 4BAYA 1J7KA 4I01A 3I71A 1G3WA 4HF0A 5LBQA 4AD9A 2WWYA 2ADUA 1S7OA 1ZHFA 2KKOA 2PN6A 2C6YA 4P96A 2V1UA 1MKMA 3JAMZ 4WXHA 5HS7A 3SZPA 4KICA 2OAZA 3ZN1A 1B59A 2CG4A 3CUOA 1P6RA 5E8GA 2ZXJA 4OIOF 2YX4A 5TRDA 1RNLA 4N9HA 4G94A 2FQ3A 1B6AA 5IT9K 2LDUA 3VODA 1QPMA 3JSOA 1FSEA 3TOBA 4PZJA 2A68F 2FE3A 4HBLA 3O2PE 4OMZA 2A69F 4ZYHA 2R3SA 3DQVC 4G8XA 1KU3A 3RJPA 1BI3A 2XVCA 2EFQA 3K2ZA 1SAXA 1EV7A 2KIMA 1KA8A 2UXNA 1BC7C 2HKOA 1HXDA 3BJ6A 1F5TA 2FMLA 2VC1A 4AIJA 1YO5C 1ONVA 5JFRA 1KYWA 3D0SA 2JRTA 1BBYA 3LAJA 1FYLA 3LA3A 5TJJA 2FNAA 1UCRA 4BXUA 2JPCA 3C3WA 3WTVC 1LB2A 3K0LA 4YFXF 3HSEA 2KRFA 3T5XA 3BPVA 5A2QZ 1PUEE 1XN7A 4Y17A 1HSTA 2RNJA 3WTYC 3GLXA 2P5VA 1IXCA 4BQAA 1YLFA 1U3EM 3U1DA 2KIFA 1D8JA 3PFIA 2P5LC 4L18B 2BE5F 2VONA 2PEXA 3B02A 3H92A 1OKRA 4RGUA 2O3FA 4PGGA 1ZGJA 4Y13A 4M6XA 5CVUA 1O3QA 2HS5A 3W6KB 1AWCA 1ON2A 2OZ6A 4BHBA 3F3XA 1T6SA 3RKWA 2VXZA 1IN8A 1T39A 1K79A 3P9KA 3V8LA 2DW4A 3I5UA 3JAMK 2A61A 3SHFA 4WF2A 3P9IA 5D6EA 1YW7A 1QZZA 1SFXA 5DYMA 2QZ8A 2UXXA 1X3UA 3CO6C 3ZMSA 1IAWA 3J80Z 3HYIA 5BPDA 2A3SA 1SFUA 3DP7A 1I6XA 2G9WA 4WXDA 1LDJA 4ASNA 1I27A 4I2OA 1TW3A 1EH7A 1PP7U 5LRRA 2LF8A 4PGHA 4XSXF 3HRTA 5H6RA 2CW0F 2V9VA 3GEZA 2EFWA 3C7JA 2FRHA 4ZYEA 1UB9A 1D3YA 2RN7A 1RIOH 3M7GA 4EM0B 3R61A 4IRHA 5FFXA 1VTNC 2PBIA 3KCCA 1XGSA 3RPUA 5H20A 1B9MA 3VB2A 2XV4S 3KFWX 2A6HF 2OQRA 4HDUA 4ENJA 5LEJA 3OOPA 2OA4A 1XCVA 2M30A 1ZN2A 2Z9OA 1BIBA 1NHAA 2XKOA 1IXSB 3I53A 5E17F 3F8MA 1PDNC 5ICCA 4ZYDA 3TO7A 1ODDA 5LHGA 2DLLA 1MZBA 5A2QK 4ETSA 4GO1A 4L0ZB 2DK5A 3QP5A 3BPXA 4EJWA 1SFEA 4CO8A 1P4XA 3LA2A 3WTUC 1ZGAA 2ZNZA 2Q2EA 3G73A 2YU3A 3HOTA 1FYKA 4U0VA 1O7LA 4P9UA 3Q5FA 4MQVA 2IT0A 1DUXC 2E7XA 1E2XA 1SD4A 4L9JA 5F1RA 4HQMA 1O3SA 3ULQB 2L4MA 2P4WA 3WGGA 1IRFA 3E6DA 1EH8A 3H3UA 3SXYA 1Z91A 2RGVA 3ZPLA 4MTEA 4HX8A 1U6GA 3DKWA 2FNPA 3KZZA 3FXUA 1LEBA 3P7NA 5BMZA 5HLIA 2D1HA 1TQMA 2QUFA 1R1UA 2LKPA 5CVRA 1F1ZA 1XMKA 3MWMA 3J80K 2F5EA 3K1NA 2E1CA 2W84A 1LEAA 3WE2A 1FNNA 2IP2A 5FFZA 1Q1HA 1W7PA 1HKSA 2Q0OA 5BPIA 1MJ9A 4HW0A 3BROA 3DXJF 1IN6A 1WWXA 2R7FA 3I0TA 3ZQ7A 1BC8C 3F23A 4EMSA 2AS5F 1FLIA 4TV7A 3IL2A 3FM5A 2MC3A 3I59A 5CYVA 2GWRA 5D5UB 1JHFA 3EETA 1DP7P 5L3DA 2VT3A 4B8XA 1Y0UA 3I59B 2OZUA 2ELHA 5HOOA 5LGNA 1E17A 5ED4A 1F9NA 2HEOA 3GFMA 5CVJA 3RTRA 1ZG5A 4CGZA 4RAYA 4O3MA 3K1MA 1ZLJA 2W24A 4ENNA 3KEOA 3KLOA 2K27A 1LDDA 3SZTA 2J5PA 1YS6A 4S05A 2ZBKA 2GXBA 2HZTA 2PMUA 5AONA 5E1ZB 3PQKA 1U5TA 1ZG1A 2IA0A 3WU1B 1LVAA 1U2WA 3FM3A 2K86A 2M5WA 2OU2A 4I98B 4RS8A 4EJVA 1YW9A 2FA5A 5BQTA 1LDKB 4A5MA 4M9SA 3JTHA 3IWFA 2OQGA 3C18A 3WTSC 3FHZA 5D8LB 3ZMZA 4OMYA 1GVJA 2V79A 1R22A 3V7RA 3DPTA 3JW4A 2VBXA 1TLHB 1R1TA 2P5KA 2FMYA 3EUHA 3K1PA 1HBXG 2IPQX 2XAQA 4L5JA 2ESNA 2P6SA 2XASA 4XRFA 5LHHA 2VC0A 4GXOA 1WKMA 4LLLA 2FBIA 3BOQA 2Z5UA 1S29A 3ROUA 5FD6A 1I1SA 2HOEA 1YQAA 5E1XA 1AOYA 1UHMA 4LK0F 1FBUA 2MH9A 4YFKF 4YFNF 3WTTC 2LSOA 2TDXA 1IN4A 3Q9SA 5E1WA 2NNNA 4P5OA 3GF2A 3F8FA 3I4PA 2MD5A 3LWFA 1H9GA 2A07F 5LEKA 4B09A 2D2WA 3V7SA 1FOKA 1XCBA 3QPTA 4A5NA 1RUOA 2Q8KA 2L3DA 4CZZA 5ICGA 2UZKA 3BDDA 1YG2A 2VOPA 1ZLKA 4NHJA 1MJAA 1F4KA 5D5WB 4PDKA 3F8CA 1G3SA 1YFHA 1J9IA 3L00A 2VBZA 2STWA 3KEQA 1BOAA 1J2XA 2QWWA 5AIQA 3R0AA 3LQQA 2O8XA 1KU2A 1FX7A 3M9AA 4P9FA 2EJRA 3WE3A 2H94A 4LG0A 5K5QA 4HQEA 1FPQA 1IXRC 2EV5A 3HHHA 4HV5A 3ELKA 3S2WA 4N9IA 4LG0B 1OYWA 2CO5A 4HOBA 2PQ8A 2QBYA 3RIRA 1KQ0A 3LQRA 2NYXA 3CLOA 3R6SA 2Y48A 2CFXA 3WTWC 3TDZC 5BOXA 2QBYB 1W5TA 1LJ9A 2O0YA 5D4RA 4LMYA 5HDNA 5E18F 3Q9VA 3B73A 4GYGA 2MLKA 2YSRA 3M1EA 3GO5A 2ZFWA 2H09A 5D4SA 4IRIA 2FSWA 3FWEA 5K5RA 4KFCA 3QU3A 4MEYF 4YIIA 2YR2A 3GXOA 5ILSA 4EVIA 2DPDA 1ZRDA 2F5FA 4U7BA 2CGPA 4JK1X 3CJNA 3MCZA 2XHKA 3QU6A 1QNTA 5F6FA 2RV8A 3HIFA 4IHSA 1WQ2A 3ZMUA 1Z6RA 4RAZA 4LFUA 4QWQA 2L4AA 2ZJ2A 1FBQA 4KIFA 1STZA 2IA1A 3O3KA 4HV6A 4DNCA 3ERED 5J8FA 4KMUX 4R8HA 1BIAA 1USTA 2GA1A 2H6CA 1XB4A 1MDMA 2VBWA 2MLGA 1Z05A 3WTZA 3VOEA 3R60A 2GXGA 4MTDA 2PLYA 2A6EF 4G7HF 1MDMB 4MNUA 2Z3YA 3D5LA 4UXNA 2XUBA 1SMYF 3E5UA 4HDVA 1KQ9A 2ISYA 2L54A 4EV0A 5DV5A 2DK8A 5HS9A 3T8RA 2VN2A 4Z2YA 1D8KA 4LGWA 3T8TA 2OBPA 4OIQF 4AWXB 3BJOA 2VE8A 1SMTA 3FX3A 4HAMA 3F22A 3M8EA 1FWZA 2E1NA 2DFIA 3ZMVA 4BNCA 5E20A 3HRMA 1H0MA 4EJTA 2HWVA 2PG4A 2W57A 3I58A 3J7AO 3V8KA 1TQIA 1R36A 1OMIA 4ON0A 3T0YA 2YX7A 3HOSA 4M72A 4YIFA 3FMSA 2LNBA 1ON1A 3F6VA 2EFOA 4GCVA 1QGPA 4HLXA 1WSUA 5L3GA 3HRSA 1OYIA 4AIKA 3V4GA 3R0JA 2GA2A 4KMFA 4ESJA 3QRFF 1IZ1A 2HQRA 4A0ZA 1USSA 3GFLA 1KQ8A 1Z7UA 4HZFA 4Y15A 3KP7A 1WRJA 2COMA 4KYWA 4ENKA 4L9NA 1LNWA 4KIGA 3MAJA 4KNYA 5ICEA 4WX9A 1T2KA 4L0YB 4G6DA 3E3VA 2PJPA 4ESBA 4A6EA 1O3TA 3F8NA 1B4AA 1U78A 1U5TC 2MA3A 2YPRA 2QENA 4WCGA 3IKTA 3IWZA 1R58A 5DD4A 4MGRA 4R1HA 2P7CB 3TDUC 2EFNA 2QQBA 4KN4X 1GXQA 2P6TA 4EGYA 4ENMA 1L3LA 2F2EA 2QVOA 3WG9A 1BI1A 1KU7A 2BYVE 2JSCA 3WTXC 1HKQA 4IRGA 2HDCA 4PCQA 4Q48A 2DO7A 4RB3C 4LLNA 3TO9A 1HW5A 1JXSA 1TW2A 1XDSA 1S6LA 2OD5A 4ZH4F 2NNYA 4KA4A 5L3EA 4BHPA 2EA4A 4G9YA 2QQAA 1DDNA 3FXRA 4FT8A 5ICFA 2XKPA 5DCFA 5AIPA 3LFKA 3L09A 1IRGA 1KYZA 1HW2A 1XMAA 1W7PB 3GX4X 4M9XA 2PMHA 3KP3A 2NS0A 1MD0A 3BZ6A 4HLYA 2JZYA 2JT1A 3J81Z 1Z9CA 2DBBA 1P2FA 3L7WA 3HRUA 3FZVA 2DQRA 4O6JA 3G3ZA 4LLGF 1XDUA 3ECOA 4UVBA 4KIBA 2DPUA 2ZNYA 1HSJA 4R79A 4LB6B 2XIGA 1P92A 3GW2A 5DD8A 3E6BA 2EV6A 1U8RA 3W6JB 2HTJA 2P7VB 3H3ZA 4IVNA 3GZ6A 4CICA 1OYYA 2QQ9A 1QO0D 2HYGD 2IJLA 3EQLF 4FHTA 1ULYA 2WV0A 2RVCA 3HSFA 2LF7A 3LAPA 3NQOA 1FP2A 3ABTA 4OINF 2FBKA 1YYVA 1U5TB 2DAOA 3I54A 3GYHX 3WODF 4NQWA 5F64A 2FOKA 3F72A 3BP8A 2KIUA 3CO7C 4FX4A 2Z33A 5L3BA 3RYRA 3MQ0A 2X0LA 3EYYA 2XAFA 2EK5A 2DT5A 2BBYA 2Y75A 2RC4A 3TGNA 1RZ4A 5ERIA 1OR7A 5D6FA 1IUYA 1W7PD 1R5GA 5HVQC 1J5YA 2MBFA 1BN5A 5FGMA 2K4JA 1HQCA 1SD5A 1CF7A 3P9CA 3LA7A 3BY6A 3C1DA 2M8EA 2K02A 2XAGA 4M73A 2HKXA 2M1BA 3LSTA 3QPHA 4CXFA 2GQQA 3K9TA 2JTVA 4IXAA 3E5XA 1CF7B 4F7ZA 3SQNA 5HLGA 3L9FA 1G3YA 3GZ5A 4H0EA 1Z6TA 4JQFA 2FEZA 4CYDA 3HHGA 5KVRA 3HSRA 2D1VA 3ABUA 4P55A 2HFHA 3TO6A 1YW8A 5FD5A 4XLNF 3F6OA 1J59A 4KN7X 2FU4A 4GGGA 1T38A 1XSDA 3KLNA 2GIVA 3HUGA 4HYEA 3J81K 3IKVA 2NRAC 4OIRF 2BEOA 2ZCWA 4A2UA 1D5VA 1O7FA 3KP4A
chains in the Genus database with same CATH superfamily
4HNUA 1XTAA 2XGDA 3IHUA 4XN0A 2J5OA 3CP2A 5EEGA 1OPCA 1SVLA 3ABLH 3OV8A 2E2HJ 4Y4RA 4BYYA 2LFBA 1NK2P 4UB6C 3NWSA 3JRAA 3KP5A 1W5SA 4IF4A 2EB7A 5BS6A 2LOOA 2LLKA 3CP8A 3GTKJ 1ZRCA 4PSXA 5LHIA 2EZKA 3RYPA 3TEDA 2Y9ZA 4UUVA 1WH5A 3DV8A 2DU9A 3BLYA 2O03A 1QA6A 4RGXA 4EM1A 2DMUA 5D5XB 3FF5A 5IP9J 2E2IJ 5CJ9A 2K9SA 2X6WA 5IT3A 3M8JA 3K70C 1UMQA 5EJCA 3GTLJ 4E4HA 2G7HA 4G7ZF 2PFBA 1LQ1A 1N25A 4BDYA 1FSHA 5J6XA 3BTLA 5DUIA 4XLEA 1D0ZA 4BE0A 1A04A 3CC4I 2MH2A 2VQHA 1T0FA 3MZYA 1TZLA 3GTGJ 2DA7A 4RGRA 3NEUA 1K6YA 2HYFA 1XGNA 3E6MA 1X2NA 2D45A 1X1BA 2NS7A 2RQQA 3DEEA 1ZH5A 1VQ8I 4HPQA 3DF8A 2XROA 5CLSA 1BI2A 1R7JA 5B1BH 5IP6A 2IA2A 5L3CA 2KLOA 4AVPA 3U2RA 4WK8F 3IRQA 1SANA 4WWCA 1H89C 4KT5C 1ETOA 1HW1A 4UV8A 3AAFA 4UVCA 2EILH 4ZYGA 2FXAA 2MFZA 4O5VA 1X4PA 2R7TA 3ZR8X 1GT0C 5KHDA 4KISA 5J1RA 3CJRB 5CQEA 3OR2C 3FXLA 2KJBA 5EZHA 1UHWA 4GYIA 3PNYA 3BZCA 4HA8A 1QQIA 3WGIA 1S72I 5LD2C 2L2OA 1XGMA 1J0RA 2KISA 3K10A 3DTIA 3W2WA 2M3AA 4EQQA 3CUQA 5C44J 4MQ9F 3EUKL 4M74A 3H3VK 4XM3A 3J7AY 1I5ZA 2DQLA 1IJWC 1C0WA 3C2BA 1KGSA 3GLLA 5FLXZ 2V6EA 3CUQB 2I10A 5FRNA 3BZKA 4M3EA 3LNQA 2E2JJ 3QAHA 1TNTA 1IN7A 2ICWG 4BHCA 5E3MA 4A12A 3TOAA 2B0LA 2VUMJ 3I3LA 1M1EB 1MW7A 1P7JA 4OU0A 1V4RA 3OSGA 3CF2A 5LLQA 3BJAA 4LJZF 1Z21A 1SVMA 3KP2A 4C9YA 4DYRA 1ETYA 3REOA 2B9SA 1MH3A 2X48A 4U0WA 1T98A 4EM2A 2RKHA 2L7MP 2R7WA 2CJJA 2IEKA 2K7LA 4WXCA 2QLZA 4Q47A 4FE7A 1AHDP 2DFHA 3QWLA 4RGSA 1R1VA 4BDZA 2Z99A 1K78A 2F4OB 4KDPA 3HGYA 3L2VA 1HLVA 4A0XA 2VT2A 4LD5A 1VQ9I 1S8NA 3M1CA 2BGCA 3OY9A 2CSOA 2DJNA 2HTSA 2QYOA 3HZJA 4ZZDA 1K78B 3L2CA 1REPC 1LFBA 3DTEA 3RKXA 3TQNA 5E79C 2CRGA 3LOCA 2K4BA 3QOPA 5ILUA 5ILVA 4B3XA 2M7AA 4A6DA 3N97A 3CCQI 1TNSA 2M9HA 2ESHA 4FX0A 4A3CJ 2HGCA 4I0AA 4NB5A 4ZC3A 1B9NA 3SFZA 2DOFA 3GCMA 5D8KB 2IGNA 4E7LA 3ML6A 1ZG3A 3CDLA 3T1BA 3ASNH 1FEXA 1SD6A 1HDDC 2R7ZJ 1WPKA 5K5OA 3V8JA 2DYRH 3E97A 1QBJA 1MIJA 5JVTA 2IGMA 1W4MA 3ZQGA 3DU6A 4BH9A 2W85A 1V3FA 2HQNA 3EUAA 4C2UA 1IV6A 2F5CA 1IC8A 3GWZA 4JOMA 2WB1N 3HTUA 1K7AA 4XLFA 5E8IA 1S3JA 3ZMTA 3A2KA 2KT0A 3FXKA 3HTSB 3WGHA 5DDGA 1G4DA 1J75A 1XSVA 2V26A 4IOCF 4HX7A 1TT0A 2GAUA 3MFKA 3A03A 3Q3SA 3A0BC 2Y30A 1FBSA 2HR3A 1MBJA 1NTCA 4BKXA 3VPRA 2V1XA 4U88A 2BV6A 1X19A 2VL8A 5EEHA 2QSHX 1P4WA 4EJOA 4I09A 4UVAA 3DU5A 1QVUA 2H27A 1HKTA 5LRSA 2DI3A 1DP3A 2LG4A 3WU0A 2IRFG 1I3QJ 5IYBJ 1YTYA 1MGTA 1FP1D 2DT6A 3JTGA 3PSIA 1ZREA 4IHVA 4LK1F 2HOAA 4CZCA 2OJED 3BG5A 3N4MA 2HU9A 1IW7F 2F48A 2RAEA 3I64A 1JUPA 5FLMJ 1APLC 1EH6A 3J81R 4IEJA 2QSFX 3G6EI 1YJWI 1UFMA 4YEJA 3EDPA 2Z1DA 1SC7A 5H6QA 1RI7A 4CDGA 2CWEA 3TMOA 1RPWA 5K7ZA 2YU9J 3RI4A 1D0YA 2STTA 3QYFA 2M4KA 4ESFA 3FK6A 4XLPF 3V7CA 1B8IA 2WAQA 4BQNA 1MMGA 3PSFA 4CHUA 4LB5A 4H4KC 3DEUA 4BXFA 2JA8J 3OL3A 3W3CA 4D7NA 2QF7A 3OYIA 5JI6A 1NK3P 2IS6A 2G7UA 5DCMA 5CVIA 2FF4A 2GZWA 4ZZLA 2BZTA 1MBEA 1G3TA 4S04A 3HL2A 4G6QA 2XGCA 3G2BA 4UV9A 2Y0MA 4EJUA 4F3QA 1B8IB 2AXTC 2R5ZA 2KPMA 3CESA 5FLXK 5DCMB 3GFJA 5KK1A 4F55A 3I56I 4U0YA 2JVHA 3JSPA 5GP9A 4IJAA 1DPRA 1JT6A 2E5NA 1K6OA 2VLAA 2R5ZB 1Z1DA 3PM1A 3LSMA 3CMMA 1FMWA 3MZHA 1HCRA 4W1UA 3MZ8A 3CCJI 5FO5A 2DA6A 1ZAOA 1ZARA 4UNOA 2E71A 1VQMI 3K70D 1A6QA 1XGOA 2LY2A 4E7SA 1D5YA 1P7IA 4MHGA 2DDAA 4RB0A 1XD7A 2ECBA 1VQOI 2XGXA 3HOYJ 2RQPA 4L5IA 3BG3A 3RCOA 4NUBA 2ZMEA 1YIOA 2P8TA 3OS0A 2R4GA 3ISPA 1R5HA 1Z7LA 4Q4ZF 4I0BA 5M5YJ 3U9GA 5D5VB 2ZMEB 3R4KA 3VSLA 2ZO4A 3JR9A 3IC7A 1FIAA 5J8CA 4AU7A 3GUDA 2F4MB 4B48A 2XC7A 2KRHA 4M3BA 4NC8A 3ZP5A 1IG7A 2E7WA 3VYRB 2VXDA 1OR7C 1QHHD 2M87A 1QZYA 2M4GA 3TKYA 3K7AJ 3FXQA 2E19A 1DGWY 3K4CA 3PJRA 2BHZA 4IPAA 5IY5H 3KP6A 1G6NA 4NNJA 4XNFA 2CYYA 4XORA 1I3AA 5IOZA 5C4XJ 1MJBA 2IVMA 4RDUA 4PJJA 3DPLC 1L0OC 5EYRA 2LK2A 3PQJA 5FROA 2W25A 1RUNA 3CTAA 2ZKZA 3FK7A 3FMQA 2NOGA 3F8BA 2Y69H 1GHCA 2CQKA 1TTYA 2LTPA 2LYCA 2TRTA 4D0PA 3KYCB 4I02A 1FC3A 1IF1A 4HF1A 1UELB 5GAHJ 2A5YB 3K2AA 1IN5A 5FB2A 3K69A 1B1BA 4JBAA 3H1CA 1ENHA 2VB6A 2X6YA 1TBXA 1FZPB 4II3A 2MVTA 3OOUA 3G71I 2LP0A 3KE2A 2EFPA 2EWNA 4CCMA 5LGTA 2R7QA 4L9TA 4JX5A 3HOVJ 2MSYA 5IOYA 1I1GA 3UR3C 5HS8A 4BE2A 3ZMDA 4BY1J 1S7AA 2DODA 2ZB9A 1X1PA 1RKWA 4IO9F 3NRVA 3QP6A 4OIPF 2M7BA 1E3PA 1GXPA 1ZTRA 4XIDA 3JREA 4DGWB 2JPBA 2KP6A 1R00A 1LFUP 2KIQA 2CV0A 3RQIA 2O61A 2IAIA 1XPXA 1BR4A 2L01A 2F5DA 3E5QA 1LVKA 3LSHA 2DJIA 3NARA 1YITI 1RRJA 2X4HA 4QLCU 2PI0A 4RB1A 4AIHA 1P4AA 5J47A 2H6BA 3O6BB 4I99C 2CQ7A 3E6CC 3EYIA 4U7DA 4OOIA 3DFGA 3VFZA 2X51A 5TGTA 1BW6A 5E3OA 1FYMA 4DZPA 2QGUA 2R7RA 1YJNI 5FKOA 2VBYA 3GMEA 4NDLA 4YG2F 2VE9A 1ETXA 3M8FA 5HDKA 4F91B 4GRIA 1BI0A 3GFIA 2HZDA 4DJAA 1PP8F 3FIWA 1ZRFA 3MN2A 1R4MB 2ACJA 5JHFA 3CDIA 4AC0A 1O3RA 1BW5A 2VIXA 2O6GE 5IT9Z 3F21A 3H5RA 2VQGA 3F0CA 3RKYA 4A93J 2XPVA 4HF2A 2DA4A 5K7HA 1JJ8C 2EA2A 4MEXF 1Y8QB 2V1DA 3PIOF 2L02A 4A0YA 1Z67A 4M9ZA 4PSWA 4XOPA 3JAMR 3VSKA 1HDPA 3LSKA 1PUFA 4MO7A 1BOBA 5L3FA 4K2EA 3BWGA 4UHTA 2V6CA 3ECHA 4M6VA 2HOTA 1O57A 2BY3A 1IGNA 4L9VA 3K4JA 4M71A 4LG3A 4J01A 3GVAA 2ETHA 4C3HJ 1PUFB 1TWAJ 1JT0A 1ZYRF 3KZYA 2FBHA 2IS4A 1FOWA 3OSFA 3VEPA 1KU9A 2HPMA 3S1RJ 2M45A 3QOEA 4UUSA 3QYBA 2XAJA 2LKSA 3RDIA 3FMRA 4DZJA 2QM3A 2EV0A 1T0FC 2DCEA 1BJAA 1JKOC 1H9TA 5DUKA 2K9LA 3S16J 4Q5SF 4IHTA 1EKEA 4UUSB 4E70A 1FIPA 3RPQA 2JA5J 4XSZF 2DA3A 1WI9A 2XAHA 3HOXJ 4QPOA 2QQ8A 3DLAA 2AXLA 3OR1C 5HLHA 2NAZA 2RDPA 3BQYA 5F08A 4JP0A 5LGUA 1GV2A 5HDGA 5K1YA 1VF9A 3Q0UA 2UWMA 4UB8C 1JHHA 2VQLA 2DTRA 4E7JA 5GAEJ 2L7ZA 1R23A 3GTOJ 6PAXA 2X1DA 2YUSA 4HX4A 3OYMA 5CVVA 4LOCA 3FBNB 1QHGA 2WC2A 4I7HA 4BE1A 3OWTA 5DEQA 3MEXA 1DPUA 1XSXA 2R7DA 5JHUA 3ZCOA 2VOOA 2IS1A 5B1AH 2ISZA 1MMAA 1R6RA 2KJCA 2IW5A 4AIDA 1BM9A 1YS7A 3MKLA 4RB2C 4EGZA 3HKZA 4DQ2A 2WTEA 5LFAA 4KUMA 3CUQC 4XICA 3KETA 2XRNA 3IH2A 3OIPA 3ZN0A 2DMQA 1YHQI 2VODA 3CDHA 5JR3A 3HXLA 3PO2J 4V2GA 4XBFA 1Y1VJ 3DKXA 3VWBA 2BXYA 2LRDA 4G7OF 3H5NA 1CGPA 4LIVA 1FT9A 1IV8A 2OCCH 3COAC 3BR3A 4XL9A 4N0BA 2O5RA 2H8RA 1TQPA 2IS2A 2ID6A 1X4OA 3IRRA 3HOZJ 2M35A 1JI8A 2HXIA 1SD7A 1JGSA 5J4YA 1JE8A 1FY7A 4M6YA 2VI6A 4BAYA 1J7KA 3HBLA 4CA0A 2DYSH 4I01A 3I71A 3S17J 3FDYA 1G3WA 4HF0A 1YIJI 5LBQA 1D1AA 4AVZA 4E7ZA 4AD9A 5A2QR 2WWYA 2ADUA 3WHBA 2FUG2 1GVDA 1S7OA 2HVRA 1UAAA 1ZHFA 3HPHA 2NVUB 5IP7J 2KKOA 2CU7A 3FBIB 4BU2A 2PN6A 3HUGB 3BR2A 2XF5A 1ZQ3P 3I9V2 3SFIA 2C6YA 4HEA2 4P96A 2H1KA 2V1UA 1IDZA 3S3MA 2DDBA 3DBRB 1Z0XA 1MKMA 2MZ4A 2E36A 3JAMZ 4WXHA 5HS7A 3SZPA 4IZZA 3JRGA 3C2GA 3H0DA 2NVYJ 2JA6J 3JRBA 3S93A 4KICA 2G0EA 2OAZA 3ZN1A 1B59A 3K4KA 2KMUA 2CG4A 3BT9A 1LUJB 3CUOA 1P6RA 5E8GA 2ZXJA 4OIOF 2YX4A 4II2A 4V2FA 5TRDA 2JSPA 2QKLB 1RNLA 1Y1WJ 1BJZA 4N9HA 4CCJA 1X58A 4S0HB 4G94A 2FQ3A 3VYSB 1B6AA 3P5JA 5IT9K 4ABZA 3HGGA 4C2MJ 4HNTA 2LDUA 2E1MB 3BG7A 3VODA 2K9MA 1QPMA 3JSOA 1FSEA 2W1OA 3TOBA 4KT6A 2KHMA 4PZJA 2EIKH 2A68F 1JTXA 4AYBN 2FE3A 4HBLA 3O2PE 4OMZA 1MNMC 2A69F 4ZYHA 2Z2SB 2R3SA 3DQVC 5C4JJ 4G8XA 1KU3A 2JK3A 1TWGJ 3RJPA 1S9HA 1BI3A 2XSDC 2XVCA 2EFQA 3K2ZA 1SAXA 1EV7A 2KIMA 3KYDB 2DOAA 1KA8A 5J1UA 3CCSI 3CZ6A 2UXNA 2BVLA 3ZRGA 4IQJA 1BC7C 2HKOA 1HXDA 3BJ6A 1EJ9A 1F5TA 1EF4A 2FMLA 1G2HA 4Z6YA 2VC1A 4AIJA 1YO5C 1ONVA 5JFRA 1KYWA 1PJRA 2JRTA 1BBYA 3D0SA 3LAJA 1VQKI 4ZDLA 1K4TA 3FISA 1FYLA 4OAYA 1MMNA 3Q0WA 3LA3A 3TW7A 1MBGA 5TJJA 2FNAA 1UCRA 4BXUA 3KPHA 2HYJA 2JPCA 4L5EA 4CSWA 4RBOA 3C3WA 3QODA 3WTVC 1LB2A 3K0LA 2NXNB 4YFXF 5CKTA 3HSEA 2CUEA 2KRFA 1WJBA 5F0HA 2JWTA 3OS1A 2X6OA 3T5XA 3BPVA 1IUFA 1YX3A 1X3WB 5F27A 5A2QZ 1DGRM 1ITYA 1PUEE 1XN7A 4Y17A 4RAFA 4D7MA 1HSTA 2RNJA 3WTYC 1VQNI 2HVQA 2P5VA 2Q1ZB 1IXCA 3GLXA 2CW8A 2ZXIA 3UNGC 4BQAA 4XRMA 1YLFA 1U3EM 2BHYA 4F93B 3U1DA 2KIFA 1S5LC 1D8JA 3PFIA 5EF6A 2P5LC 4AM3A 4QIWN 4BL0B 2VJIA 4L18B 1GUUA 2BE5F 3E7LA 1S7EA 2VONA 2PEXA 3B02A 2JMWA 4FTHA 2QSGX 3H92A 3OYNA 1OKRA 4RGUA 3CCRI 2CFOA 3OIQA 2O3FA 3G1OA 4PGGA 3SEQA 3S1MJ 1OQYA 1IO2A 1ZGJA 4Y13A 1LPQA 4M6XA 5CVUA 1O3QA 2F6CA 2HS5A 2B63J 3W6KB 1AWCA 1ON2A 1OCZH 1MBFA 2EIJH 2OZ6A 1BA5A 1U9NA 4BHBA 3F3XA 4IHXA 1T6SA 3RKWA 5EDNA 4YIRX 2VXZA 1POGA 2HOSA 5FJ8J 5C3EJ 1IN8A 2ZMEC 3KEYA 3D5RC 4IHYA 1FMVA 1P9QC 4XKVA 4BACA 3L2QA 2Y0SN 1T39A 1K79A 3GTMJ 3P9KA 4FQGA 5F1JA 4RA2A 4BBSJ 3V8LA 2DW4A 3ZQIA 3I5UA 2Y31A 2A61A 3JAMK 3SHFA 4WF2A 5GPAA 3P9IA 2E35A 5D6EA 1YW7A 2MYSA 1Z3XA 1QZZA 1SFXA 5DYMA 4AUXA 2QZ8A 2UXXA 1V5GA 1BR2A 1X3UA 3CO6C 3ZMSA 1ETQA 3O8HA 1IAWA 4PJ0C 3J80Z 3HYIA 5BPDA 4CCNA 4MLOA 2A3SA 1SFUA 4V19K 2Y9YA 3DP7A 1I6XA 2G9WA 2MGQA 1WJCA 2L9RA 3S1QJ 2W48A 3DLLF 4WXDA 5E3NA 1LDJA 4ASNA 1I27A 3VDXA 4I2OA 1UG2A 2NVQJ 2R0QC 1TW3A 1EH7A 1W1WE 3QQAA 1OCTC 1RESA 1PP7U 5LRRA 3ESWB 2JRMA 2LF8A 4PGHA 4XSXF 4X0GA 3HRTA 1HA8A 2KFDA 5H6RA 5M3FJ 2EZIA 2CW0F 5J4VA 2V9VA 1MMDA 4NC7A 1VI0A 5J1YA 3ZQLA 3S2HJ 1K83J 3GEZA 2GM4A 3HC7A 3TBIA 2EFWA 4DBRA 2PJRA 4M3FA 3C7JA 3OYBA 2FRHA 4ZYEA 5EGOA 2I5UA 3FXJA 2NVTJ 1UB9A 1D3YA 1PVEA 3LSPA 2RN7A 4NBQA 2NVXJ 1RIOH 3M7GA 4EM0B 3R61A 4IRHA 5DTDA 1A5JA 2JA7J 2F4IA 1JTYA 4RM3A 5FFXA 1VTNC 2PBIA 1TP4A 3BTIA 2YS9A 3KCCA 4DYCA 1XGSA 5H20A 3RPUA 3O8GA 3BR5A 1B9MA 3VB2A 2XV4S 3KFWX 2A6HF 2OQRA 3BTJA 2Y2ZA 4D1QA 4KITB 4HDUA 4ENJA 1GDTA 5LEJA 3OOPA 4RLQA 2DMNA 2X9DA 3ERMA 2OPTA 1VQ4I 3CC2I 3MD2A 4HG2A 1J09A 2OA4A 2JJ7A 2PX9A 1XCVA 4UUTA 2M30A 1ZN2A 2Z9OA 4MIMA 4X6AJ 1BIBA 2HNHA 2WA0A 1NHAA 3PO3J 3IH4A 2XKOA 1IXSB 3I53A 5E17F 1OCOH 3F8MA 1PDNC 2JUGA 5ICCA 2IGOA 4ZYDA 2R92J 1ODDA 3TO7A 2R7VA 5LHGA 2DLLA 1MZBA 5A2QK 2EINH 2XF6A 4ETSA 5IT9R 4GO1A 4L0ZB 2DK5A 1XMXA 3ZQCA 4LITA 4XN3A 3QP5A 3BPXA 4QSHA 4EJWA 2QKMB 1SFEA 3H0GJ 2ME6A 4CO8A 3JRCA 1OFCX 1P4XA 3LA2A 4G6TB 3L1PA 4ZDOA 1TWCJ 3H9QA 1ZGAA 3WTUC 2ZNZA 2DFEA 2FQ4A 2Q2EA 2DXIA 5JVGF 3L2WA 4FCYA 2OF7A 2BY0A 3PUBA 3G73A 2YU3A 3HOTA 1FYKA 1WZ2A 4U0VA 1O7LA 5HNHA 3BR0A 3GZNB 2DMTA 4P9UA 3Q5FA 4MQVA 2E1OA 2IT0A 1DUXC 2E7XA 3K4MA 4RLFA 3IAM2 1Y0NA 4U87A 5IPAA 1VZ0A 5EEAA 3OYFA 4Y52J 1E2XA 4NC6A 1SD4A 4L9JA 4BY7J 5F1RA 4HQMA 1O3SA 3ULQB 2L4MA 5DM7F 3Q0VA 2P4WA 3WGGA 3VYUB 1IRFA 3E6DA 1EH8A 3H3UA 3SXYA 1LE8A 1Z91A 1JUMA 3S14J 1Q1VA 2XRLA 2RGVA 3ZPLA 2R7UA 4M3GA 2AQEA 4CH7A 5FKKA 4IOAF 3TP3A 4MTEA 4HX8A 1U6GA 3DKWA 2FNPA 3KZZA 1LE8B 3FXUA 1LEBA 1ZELA 3P7NA 5BMZA 5IYDJ 3K6GA 5HLIA 1ETVA 2D1HA 1TQMA 2QUFA 1MSEC 2HQAA 2PMZN 1SAUA 1R1UA 2CMPA 2OTJI 4I76A 2DTZA 3PFYA 4JYKA 4BBRJ 1H8AC 2LKPA 5CVRA 2CV1A 1F1ZA 3GTPJ 3BTCA 1XMKA 3MWMA 5H2FC 2F5EA 3FKJA 3K1NA 2W84A 2EZLA 3J80K 1LEAA 4A3IJ 3WE2A 2E1CA 1FNNA 2IP2A 5FFZA 2FD5A 1Q1HA 2XB0X 1W7PA 4IX7A 2CQQA 1HKSA 2Q0OA 3DPUA 5BPIA 1N78A 3W2AA 1T8IA 4IL6C 4B3AA 1MJ9A 2JN6A 4HW0A 3BROA 3DXJF 1IN6A 1WWXA 3IV5A 2R7FA 2LREA 3I0TA 4DBQA 3ZQ7A 2CUJA 4IQ4A 4J00A 4RAGA 1BC8C 1YE9A 3F23A 4EMSA 3S8PA 2WV1A 2AS5F 1FLIA 5GADJ 4CCLA 4TV7A 3IL2A 4BQOA 3SDGA 3FM5A 4PJLA 2MC3A 1PYVA 2R7SA 3I59A 2DT7B 3TW6A 5CYVA 2EZHA 2GWRA 5D5UB 2R7XA 1JHFA 3EETA 1DP7P 2WB1A 2LH9A 5L3DA 3WU2C 2VT3A 4B8XA 1Y0UA 2ID3A 1HOMA 3I59B 2OZUA 2ELHA 4EATA 2X98A 2ZJPF 4BJ5C 5HOOA 5LGNA 1E17A 5ED4A 2O7OA 4A3DJ 1F9NA 2HEOA 3GFMA 5CVJA 3RTRA 1ZG5A 4CGZA 3DCFA 4RAYA 1YI2I 2AHQA 4O3MA 1E0EA 3K1MA 3SEZA 1ZLJA 2W24A 4ENNA 1W5CC 2VJ5A 3KEOA 2K27A 3KLOA 2HI3A 1LDDA 3SZTA 3S3NA 1LFPA 2J5PA 1YS6A 4S05A 2KQRA 2ZBKA 1MH4A 4FE4A 2GXBA 1NG7A 4D5FA 1I6HJ 2H8WA 2HZTA 3H35A 2PMUA 5J3LA 2XPUA 5AONA 3BR6A 2R93J 5E1ZB 3PQKA 3MKWB 1U5TA 1MSFC 2L9SA 1ZG1A 2IA0A 2VQCA 3WU1B 5EZGA 1LVAA 3OYHA 1U2WA 3FM3A 1UG0A 1IRXA 1VNDA 2K86A 2M5WA 3FXOA 1OCCH 2E1MC 1WJAA 4X1EA 4CUGA 1K4SA 3OS2A 2OU2A 2A05A 4I98B 3QPLA 4RS8A 1UZCA 4EJVA 4XKWA 2E34A 2LVSA 1YW9A 2FA5A 5BQTA 3S2DJ 1LDKB 4A5MA 4M9SA 4HSRA 3JTHA 1TL8A 3IWFA 2VJJA 4HRIA 2OQGA 3CD6I 4E7IA 3C18A 2DOEA 3WTSC 2EH3A 5D8LB 3ZMZA 3FHZA 4OMYA 2VJ4A 1GVJA 2V79A 1R22A 3V7RA 3ZGKA 3DPTA 5JLXA 3S15J 4DW6A 5B3SH 1EA3A 2MUNA 2UUZA 3JW4A 2VBXA 1TLHB 1R1TA 2P5KA 2K40A 2FMYA 3EUHA 1W36C 2W82A 3K1PA 1HBXG 1TWHJ 2IPQX 1ACIA 2XAQA 2HVSA 1XC5A 4L5JA 5FLVA 3JCUC 2ESNA 3SZGA 2P6SA 2XASA 1VFCA 1ERDA 4XRFA 2CUZA 3B6AA 3FXMA 5LHHA 2VC0A 3HOUJ 3FHNA 2KDZA 4GXOA 3DEWA 2CQNA 1WKMA 4LLLA 1IDYA 2FBIA 3BOQA 1D0XA 2GBYA 5HNFA 2Z5UA 1S29A 2A5WA 3ROUA 5FD6A 1I1SA 2L7KA 2V1NA 2ZC2A 2HOEA 1YQAA 3RZOJ 1UHSA 4ITVA 1ETKA 5E1XA 4DIQA 1AOYA 1UHMA 4LK0F 1FBUA 1Z77A 3AL0C 3DWLE 2MW8A 3LSGA 2MH9A 4G12A 1FTTA 1X1AA 4YFKF 2NS8A 4F52A 3ASOH 2JUCA 4YFNF 3WTTC 2LSOA 4C30A 2TDXA 1IN4A 3Q9SA 5E1WA 2NNNA 4P5OA 3GF2A 3F8FA 3I4PA 4C2TA 1XS9A 2MD5A 3LWFA 5KAIC 1H9GA 3JRDA 2K3PA 2CS3A 3NWTA 5LEKA 2A07F 4B09A 4A3EJ 2D2WA 3V7SA 1FOKA 1XCBA 1NG6A 3QPTA 4A5NA 1V54H 3HDDA 1RUOA 1UJ8A 2Q8KA 2L3DA 2UV1A 4CZZA 2D5VA 2DA1A 5ICGA 2UZKA 3BDDA 2IXSA 3MVPA 1YG2A 3VYTB 2QCOA 2VOPA 3G4SI 2HQ5A 1ZLKA 4NHJA 1IRZA 1MJAA 2IBDA 1F4KA 1JJ6C 3FKIJ 1R49A 5D5WB 4PDKA 3F8CA 3E1SA 1G3SA 4ANJA 1YFHA 1HC8A 3CMAI 1XX5A 1J9IA 3L00A 2VBZA 2STWA 1E3OC 3KEQA 4XK4A 3OYLA 1BOAA 1V55H 4E7HA 3CLQA 1J2XA 1V5EA 1WH7A 5JLWA 3CF5F 2QWWA 5AIQA 3R0AA 5CQGA 2LR8A 3HB9A 3LQQA 3OIOA 3TP0A 2O8XA 3HOWJ 5TISC 1A36A 1KU2A 3L2RA 1FX7A 3M9AA 4P9FA 2EJRA 3RZDJ 2M0CA 2H94A 4W97A 4LG0A 3WE3A 4BJ6C 4IHWA 5K5QA 4HQEA 1FPQA 1IXRC 1D1BA 5F04A 2EV5A 2VKDA 2R7OA 3HHHA 4EEFG 4HV5A 3ELKA 1O4XA 1MBHA 1D1CA 3S2WA 4N9IA 2COBA 1RQ6A 4LG0B 1OYWA 3LMMA 1XG1A 2CO5A 4HOBA 2PQ8A 2QBYA 4Y3OA 1FOXA 4PUSA 1KQ0A 3RIRA 3LQRA 2RNGA 2NYXA 3ZQHA 1A31A 3CLOA 3R6SA 2Y48A 2CFXA 3WTWC 1JKPC 2W7NA 3TDZC 3PUFA 4Y33A 4CCOA 5BOXA 2XSJC 1QVTA 1W5TA 2WAQN 2JA2A 1LJ9A 2KZVA 2QBYB 2O0YA 5D4RA 2XB5A 4LMYA 3J80R 5HDNA 5E18F 3Q9VA 3B73A 4GYGA 4PFPA 4RMNA 2MLKA 2YSRA 3CJTB 3M1EA 4A3FJ 2GLOA 3GO5A 1Y6IA 2ZFWA 3DKYA 1QU3A 2H09A 5D4SA 4IRIA 2FSWA 3GTQJ 3FWEA 5GPCA 1OCRH 3D1NI 1KONA 5K5RA 2P0TA 4KFCA 4B1RA 4KJZA 3QU3A 4MEYF 2OV7A 3CCUI 2L9NA 4YIIA 2YR2A 3GXOA 5ILSA 4EVIA 2DPDA 1ZRDA 2F5FA 4U7BA 4F92B 2CGPA 1AU7A 4A3MJ 1W0UA 4JK1X 1I50J 3CJNA 2W4SA 3MCZA 2XHKA 1RETA 3B6CA 3QU6A 3JRFA 1QNTA 3X2QH 2DA2A 3LSIA 1SEUA 3W6VA 5F6FA 4DOZA 3ZXSA 2DN0A 2RV8A 3HIFA 4IHSA 1WQ2A 2RREA 3ZMUA 1VQ5I 1WJDA 1Z6RA 4RAZA 1TWFJ 4LFUA 4ZTFA 4QWQA 2L4AA 2L0KA 3E0JB 2ZJ2A 1FBQA 4KIFA 3AL0B 1STZA 4XRSG 3AG1H 2AO9A 2IA1A 3BCAA 3O3KA 4HV6A 4DNCA 3W2VA 5J8FA 3ERED 3H9GA 2LY9A 3CCEI 5CPRB 4KMUX 2JVGA 2WADA 4R8HA 1BIAA 1SFKA 1USTA 2GA1A 2H6CA 1AKHA 2QEXI 4JX6A 1XB4A 4A3JJ 4DYQA 4E6KG 1MDMA 2VBWA 2WY8Q 1RKTA 2MLGA 1Z05A 3WTZA 3VOEA 3AG2H 2E5ZA 3OYCA 4XLAA 5F0FA 1JKRC 3R60A 1AKHB 2GXGA 4MTDA 2PLYA 2A6EF 4G7HF 1MDMB 2ZSHB 4MNUA 2Z3YA 5KAFC 4CYCA 3D5LA 4UXNA 2XUBA 1SMYF 2V9KA 3E5UA 2EBIA 3GTJJ 3ZQFA 4HDVA 2MABA 1KQ9A 2QA4I 1ZK8A 2ISYA 1F36A 4CYCB 2L54A 4EV0A 4BGDA 3BG6A 2ELKA 5DV5A 4BJTA 3A4CA 3CJQB 4N4NB 1WJ5A 1YRNA 3IH3A 1JUSA 1A6IA 3IAS2 4C3IJ 2LBFA 5EG0A 3QPSA 1VQLI 2DK8A 1GLNA 5HS9A 3T8RA 3EPZA 5FKLA 2VN2A 4Z2YA 1YRNB 3PL8A 4P1WA 1D8KA 4LGWA 3T8TA 2M0MA 3CQZJ 1SFOJ 1X3ZB 2K3FA 2LBFB 2OBPA 3OYGA 4OIQF 5EG0B 4AWXB 2LKXA 3BJOA 2VE8A 3DTKA 1SMTA 3A52A 4JX4A 3M07A 4A3KJ 4PFOA 3M3YJ 3FX3A 4HAMA 2K9QA 3M8EA 3F22A 1FWZA 2VPLA 2E1NA 2XDVA 2DFIA 3ZMVA 1W36D 4BNCA 5E20A 3HRMA 2GOXB 1H0MA 3C2HA 4EJTA 2HWVA 5E3LA 4FASD 1ZKGA 4BQQA 2PG4A 4FISA 2W57A 3I58A 1N75A 2FJ1A 3J7AO 4HNVA 3V8KA 3N05A 5M5XJ 1TQIA 1WGXA 2HPIA 2KRCA 1R36A 2ZFUA 3H9JA 5KNLA 1OMIA 4ON0A 5GTHC 3T0YA 4PJNA 2YX7A 3HOSA 4M72A 1FTZA 3V42A 3MKZA 4YIFA 1QPIA 1ZGWA 4ZJZA 3FMSA 4XQFA 2LNBA 3DBLB 3LSRA 3CC7I 4QTRA 1ON1A 4D9JA 3F6VA 2EFOA 4GCVA 1QGPA 4HLXA 1WSUA 9ANTA 2PJRB 3A02A 5L3GA 3HRSA 1OYIA 2LY1A 5EGOB 4AIKA 2ELJA 3V4GA 3R0JA 2OC6A 2GA2A 4XONA 3RSNA 3CCLI 1NH3A 2P81A 4KMFA 2BXZA 3S1NJ 4ESJA 3QRFF 1IZ1A 3KYLA 2BY2A 1BL0A 2HQRA 2ZSIB 4A0ZA 1OISA 1USSA 2CH0A 3GFLA 1CQTA 1Z7UA 1KQ8A 4FETA 5M3MJ 4HZFA 2P0WA 2VKHA 2TCTA 4AYBA 4Y15A 1X2MA 3SYTA 2FX0A 3LSJA 1Z3YA 3GBGA 3KP7A 4XRSA 1WRJA 4MFEA 4A3GJ 2COMA 2OUMA 4PK4A 4KYWA 1VQPI 2VKVA 4ENKA 5FRMA 4L9NA 3BQZA 4B47A 1LNWA 3F9KA 2ME0A 2CQXA 2DA5A 4KIGA 3MAJA 3OL4A 2X6XA 1MBKA 1T08B 1YJ9I 4KNYA 5ICEA 4WX9A 1T2KA 4L0YB 2LC2A 4G6DA 3I55I 3E3VA 2PJPA 5DS9A 1TC3C 4ESBA 4OWRB 1R9TJ 4A6EA 1O3TA 3OMYA 4OAZA 2MG4A 4BUPA 3F8NA 2CUFA 1ORKA 1B4AA 3JRIA 1U78A 5HLTA 1U5TC 2MA3A 5HODA 2BOLA 2YPRA 4RM2A 2AQFA 3QYEA 2L5QA 3SJMA 3CCYA 2QENA 4WCGA 2K5CA 2M2EA 3IKTA 3IWZA 1R58A 5DD4A 3CMEI 5M5WJ 4MGRA 3HKZN 1GV5A 4R1HA 2P7CB 3AFHA 2XAUA 3TDUC 2EFNA 1VQ6I 2QQBA 3KZIC 1RR7A 2ZXWH 3BR1A 2Q2EB 4KN4X 1GXQA 1ZR4A 2V9PA 2P6TA 5FKMA 4EGYA 3J7AW 4ENMA 3HM5A 1T56A 1L3LA 2F2EA 1R71A 2QVOA 3WG9A 1BI1A 1KU7A 2BYVE 2JSCA 3WTXC 1HKQA 2V7FA 4IRGA 2HDCA 4PCQA 3ZOBA 3WG7H 4Q48A 2DO7A 4RB3C 4LLNA 3WHCA 3MMYB 3H5AA 1HW5A 3TO9A 1JXSA 1TW2A 1XDSA 1S6LA 2OD5A 3HPGA 2X1EA 3S32A 4ZH4F 5IYCJ 2NNYA 4KA4A 5L3EA 4ZTJA 3EUHC 4LIUA 4BHPA 2EA4A 4G9YA 2HDWA 5KCMA 1I39A 5GAGJ 1KZHA 1YOVB 2QQAA 2L9VA 1LKXA 1DDNA 3FXRA 1YX5A 4FT8A 5ICFA 1JKQC 4BS9A 1Y56A 2XKPA 5DCFA 5GTIC 2E60A 3BG9A 5AIPA 4CCKA 3RPUD 3LFKA 3SDBA 1WJEA 3I4MJ 1G59A 2BY1A 1MMSA 1DU6A 3UKGA 3L09A 1IRGA 4D5CA 1KYZA 3KIOA 1HW2A 1XMAA 2VKEA 2M8GX 1W7PB 4XKBA 1U9OA 3GX4X 1WVRA 4M9XA 2WBMA 2Y0SA 1AA7A 2PMHA 1FJLA 3KP3A 2NS0A 3G1MA 1MD0A 3LFUA 2WAEA 3BC8A 3BZ6A 3A1YA 4HLYA 2JZYA 2JT1A 3J81Z 2WAFA 4Y7NJ 3D5SC 4HSTA 2F5VA 5BNGA 1Z9CA 2DBBA 1P2FA 3M4OJ 1R4NB 3L7WA 3I4NJ 3HRUA 4MFDA 1A35A 1WHUA 2DQRA 3FZVA 4O6JA 1B72A 2R5YA 3G3ZA 4LLGF 1XDUA 3ECOA 3ONQA 4KIBA 4UVBA 2ZNYA 3MKYB 2DPUA 1HSJA 2V4JC 4XMYA 4R79A 4LB6B 2X85A 4E7KA 2CW7A 3PIPF 2XIGA 4XLCA 1P92A 1B72B 3GW2A 2R5YB 5DD8A 3RQ4A 2ZJQF 3E6BA 2EV6A 1U8RA 5B66C 3K4NA 2GOMA 3W6JB 3LL7A 3DBHB 2HTJA 2P7VB 3H3ZA 3K4BA 4IVNA 3GZ6A 3S3OA 4CICA 3JRHA 3PNTA 4N4OB 1OYYA 3J7YJ 2QQ9A 1QO0D 3ABMH 4YELA 1JGGA 3CCMI 2HYGD 2IJLA 1VQ7I 4BXXJ 1MNEA 1T33A 1U0JA 1HF0A 1BR1A 3EQLF 4FHTA 4XOTA 1ULYA 2WV0A 2RVCA 3HSFA 2LF7A 3LAPA 4A69C 3KX2A 3NQOA 3TL4X 2VASA 4I6ZA 1ZR2A 1FP2A 1X1DA 2ZXHA 3ABTA 2H1LA 4OINF 1V5FA 2ZJRF 1RC9A 2FBKA 2KDOA 2KZGA 1YYVA 1U5TB 2DAOA 1QZEA 4YRVA 2O9LA 3I54A 3GYHX 4B44A 1Y39A 3WODF 5J40A 2DMPA 4NQWA 2NOJB 4B4CA 5K7FA 2MC4A 5F64A 4C3JJ 2FOKA 3F72A 3CMYA 3BP8A 4XR6A 2KIUA 3PNVA 1WFXA 2DFFA 3CO7C 4B43A 1DQUA 1R5ID 3G1LA 2Z33A 4FX4A 2LD5A 5L3BA 4GDFA 4NQWB 3RYRA 3MQ0A 2X0LA 3EYYA 2XAFA 2FOWA 2EK5A 3BCBA 2DT5A 3AKZA 3OYJA 1SVOA 2GXAA 3A0HC 2BBYA 2Y75A 2RC4A 3U1KA 2EQRA 1QRYA 3IP4B 1FOYA 2KL4A 3CCVI 4BEHA 4J19A 3TGNA 1RZ4A 2OCEA 5ERIA 1OR7A 4M3DA 4A3BJ 1ETWA 3AG3H 2HXOA 5D6FA 2K9NA 3HEFA 4PJMA 2IGKA 1WI3A 2W00A 1IUYA 3RKQA 1W7PD 1R5GA 4BEHB 5HVQC 3OYEA 1J5YA 1WJFA 4GFBA 3U21A 4QPQA 2Z16A 2MBFA 1W0TA 2BVMA 1BN5A 5FGMA 1MNDA 1T95A 2EIMH 1H88C 2K4JA 1HQCA 1SD5A 1CF7A 3P9CA 3LA7A 3BY6A 3C1DA 3J7ZI 3HG9A 2CV2A 1Y8RB 4ZDPA 1OJLA 2EPFA 2M8EA 2K02A 2XAGA 3OYAA 4M73A 1OCPA 2HKXA 2M1BA 3LSTA 3QPHA 4CXFA 2GQQA 3K9TA 2JTVA 4IXAA 3L2UA 3E5XA 1CF7B 4F7ZA 3NAUA 1U8BA 4UY8I 2L7FP 3SQNA 2ECCA 2JQ7A 2VPRA 3L9FA 2XPWA 2BW3A 1G3YA 5HLGA 1N77A 1OLTA 3GZ5A 3HJEA 2O8KA 1WCMJ 4H0EA 1RR8C 2HDDA 1Z6TA 3K4LA 1F43A 5DM6F 4JQFA 2FEZA 4CYDA 3HHGA 5KVRA 3HSRA 2BW3B 3A01A 2D1VA 5F0CA 5FKNA 2I8DA 4ZYAA 3H36A 2LMDA 3ABUA 4P55A 2N8GA 2XF7A 5B5EC 1TT5B 2HFHA 1E3HA 4IKFA 5FLXR 2A6TA 3A01B 3OYKA 3ZQQA 3TO6A 2K85A 1YW8A 5FD5A 4XLNF 1G8XA 3IUOA 2XGEA 2M34A 3F6OA 1J59A 4KN7X 2FU4A 2B7EA 4GGGA 1T38A 1XSDA 4XLHA 3KLNA 3ABKH 2WY7Q 2X1CA 1K61A 2GIVA 2MD0A 3HUGA 4HYEA 3J81K 2GIZA 3IKVA 3AG4H 2NRAC 4OIRF 2BEOA 4XKCA 2OTLI 2PMZA 2ZCWA 4A2UA 1X1CA 3OYDA 4A3LJ 1D5VA 1O7FA 1DU0A 3KP4A
chains in the Genus database with same CATH topology
3IHUA 2J5OA 5EEGA 1OPCA 3OV8A 4BYYA 3KP5A 1W5SA 4IF4A 2EB7A 5BS6A 1ZRCA 5LHIA 3RYPA 4UUVA 3DV8A 2DU9A 2O03A 4RGXA 4EM1A 5D5XB 3FF5A 5CJ9A 5IT3A 2G7HA 4G7ZF 2PFBA 1LQ1A 1FSHA 5J6XA 5DUIA 1A04A 2MH2A 3MZYA 1T0FA 4RGRA 3NEUA 2HYFA 1XGNA 3E6MA 2D45A 1ZH5A 3DF8A 2XROA 5CLSA 1BI2A 1R7JA 2IA2A 5L3CA 4AVPA 3U2RA 4WK8F 3IRQA 4WWCA 4KT5C 4UV8A 1HW1A 3AAFA 4UVCA 4ZYGA 2FXAA 4O5VA 2KJBA 1UHWA 4GYIA 4HA8A 1QQIA 3WGIA 1XGMA 1J0RA 4EQQA 3CUQA 4MQ9F 4M74A 1I5ZA 2DQLA 1C0WA 1KGSA 5FLXZ 3CUQB 3QAHA 1TNTA 1IN7A 4BHCA 4A12A 3TOAA 2B0LA 4OU0A 1V4RA 5LLQA 3BJAA 4LJZF 3KP2A 3REOA 4U0WA 1T98A 4EM2A 2RKHA 2K7LA 4WXCA 2QLZA 4Q47A 4RGSA 1R1VA 1K78A 2Z99A 4KDPA 4A0XA 2VT2A 4LD5A 1S8NA 2BGCA 2CSOA 2HTSA 2QYOA 1K78B 4ZZDA 3L2CA 1REPC 3RKXA 3TQNA 2K4BA 3QOPA 5ILUA 5ILVA 4A6DA 3N97A 1TNSA 2ESHA 4FX0A 2HGCA 4I0AA 4NB5A 1B9NA 3SFZA 5D8KB 3ML6A 1ZG3A 3T1BA 1SD6A 5K5OA 3V8JA 3E97A 1QBJA 5JVTA 1W4MA 4BH9A 2W85A 1V3FA 2HQNA 2F5CA 3GWZA 3HTUA 1K7AA 5E8IA 1S3JA 3ZMTA 3HTSB 3WGHA 5DDGA 1G4DA 1J75A 1XSVA 4HX7A 2GAUA 3MFKA 1FBSA 2HR3A 2V1XA 4U88A 2BV6A 5EEHA 1P4WA 4EJOA 4I09A 4UVAA 2H27A 1HKTA 5LRSA 2DI3A 3WU0A 2IRFG 1YTYA 1MGTA 1FP1D 3JTGA 1ZREA 4LK1F 3N4MA 1IW7F 3I64A 1EH6A 1UFMA 3EDPA 5H6QA 1RI7A 4CDGA 2CWEA 3RI4A 2STTA 4XLPF 4ESFA 3V7CA 4CHUA 4LB5A 3DEUA 5JI6A 2G7UA 5DCMA 5CVIA 2FF4A 2GZWA 4ZZLA 1G3TA 4S04A 4G6QA 4EJUA 4UV9A 2Y0MA 5FLXK 5DCMB 3GFJA 5KK1A 4U0YA 3JSPA 4IJAA 1DPRA 1K6OA 1Z1DA 3MZHA 5FO5A 1ZAOA 1ZARA 4UNOA 1XGOA 4MHGA 4RB0A 1XD7A 2XGXA 2RQPA 4L5IA 2ZMEA 1YIOA 2P8TA 3ISPA 1R5HA 4Q4ZF 4I0BA 3U9GA 5D5VB 2ZMEB 3R4KA 2ZO4A 3IC7A 5J8CA 3GUDA 3ZP5A 2E7WA 2M87A 1QZYA 3TKYA 3FXQA 4IPAA 3KP6A 1G6NA 2CYYA 1MJBA 2IVMA 3DPLC 1L0OC 3PQJA 1RUNA 2W25A 3CTAA 2ZKZA 3FMQA 3F8BA 1GHCA 2CQKA 1TTYA 4D0PA 4I02A 1FC3A 1IF1A 4HF1A 2A5YB 1IN5A 5FB2A 3K69A 1B1BA 4JBAA 1TBXA 1FZPB 3KE2A 2EFPA 2EWNA 5LGTA 4L9TA 1I1GA 5HS8A 3ZMDA 1S7AA 3NRVA 3QP6A 4OIPF 1GXPA 2JPBA 1R00A 2O61A 2L01A 2F5DA 3E5QA 2PI0A 2X4HA 4QLCU 4RB1A 4AIHA 1P4AA 2H6BA 3O6BB 3E6CC 3EYIA 4U7DA 4OOIA 3DFGA 3VFZA 1FYMA 2VBYA 2VE9A 4YG2F 3M8FA 5HDKA 1BI0A 3GFIA 1PP8F 1ZRFA 2ACJA 1O3RA 2O6GE 5IT9Z 3F21A 3RKYA 4HF2A 2EA2A 4MEXF 2V1DA 2L02A 4A0YA 4M9ZA 5L3FA 4K2EA 3BWGA 4UHTA 2V6CA 3ECHA 1O57A 4L9VA 4M71A 3GVAA 2ETHA 1ZYRF 3KZYA 2FBHA 3VEPA 1KU9A 2M45A 2XAJA 3RDIA 3FMRA 2QM3A 2EV0A 1BJAA 1H9TA 5DUKA 4Q5SF 4IHTA 4E70A 3RPQA 4XSZF 1WI9A 2XAHA 2AXLA 5HLHA 2NAZA 2RDPA 5LGUA 5K1YA 5HDGA 2UWMA 1JHHA 2DTRA 1R23A 6PAXA 4HX4A 5CVVA 2WC2A 4I7HA 1DPUA 5DEQA 3MEXA 1XSXA 2R7DA 5JHUA 2VOOA 2ISZA 2KJCA 2IW5A 1BM9A 1YS7A 4RB2C 4EGZA 4DQ2A 2WTEA 4KUMA 3CUQC 3KETA 2XRNA 3ZN0A 2VODA 3CDHA 5JR3A 4XBFA 4G7OF 1CGPA 1FT9A 3COAC 4N0BA 1TQPA 3IRRA 1SD7A 1JGSA 1JE8A 1FY7A 4M6YA 4BAYA 1J7KA 4I01A 3I71A 1G3WA 4HF0A 5LBQA 4AD9A 2WWYA 2ADUA 1S7OA 1ZHFA 2KKOA 2PN6A 2C6YA 4P96A 2V1UA 1MKMA 3JAMZ 4WXHA 5HS7A 3SZPA 4KICA 2OAZA 3ZN1A 1B59A 2CG4A 3CUOA 1P6RA 5E8GA 2ZXJA 4OIOF 2YX4A 5TRDA 1RNLA 4N9HA 4G94A 2FQ3A 1B6AA 5IT9K 2LDUA 3VODA 1QPMA 3JSOA 1FSEA 3TOBA 4PZJA 2A68F 2FE3A 4HBLA 3O2PE 4OMZA 2A69F 4ZYHA 2R3SA 3DQVC 4G8XA 1KU3A 3RJPA 1BI3A 2XVCA 2EFQA 3K2ZA 1SAXA 1EV7A 2KIMA 1KA8A 2UXNA 1BC7C 2HKOA 1HXDA 3BJ6A 1F5TA 2FMLA 2VC1A 4AIJA 1YO5C 1ONVA 5JFRA 1KYWA 3D0SA 2JRTA 1BBYA 3LAJA 1FYLA 3LA3A 5TJJA 2FNAA 1UCRA 4BXUA 2JPCA 3C3WA 3WTVC 1LB2A 3K0LA 4YFXF 3HSEA 2KRFA 3T5XA 3BPVA 5A2QZ 1PUEE 1XN7A 4Y17A 1HSTA 2RNJA 3WTYC 3GLXA 2P5VA 1IXCA 4BQAA 1YLFA 1U3EM 3U1DA 2KIFA 1D8JA 3PFIA 2P5LC 4L18B 2BE5F 2VONA 2PEXA 3B02A 3H92A 1OKRA 4RGUA 2O3FA 4PGGA 1ZGJA 4Y13A 4M6XA 5CVUA 1O3QA 2HS5A 3W6KB 1AWCA 1ON2A 2OZ6A 4BHBA 3F3XA 1T6SA 3RKWA 2VXZA 1IN8A 1T39A 1K79A 3P9KA 3V8LA 2DW4A 3I5UA 3JAMK 2A61A 3SHFA 4WF2A 3P9IA 5D6EA 1YW7A 1QZZA 1SFXA 5DYMA 2QZ8A 2UXXA 1X3UA 3CO6C 3ZMSA 1IAWA 3J80Z 3HYIA 5BPDA 2A3SA 1SFUA 3DP7A 1I6XA 2G9WA 4WXDA 1LDJA 4ASNA 1I27A 4I2OA 1TW3A 1EH7A 1PP7U 5LRRA 2LF8A 4PGHA 4XSXF 3HRTA 5H6RA 2CW0F 2V9VA 3GEZA 2EFWA 3C7JA 2FRHA 4ZYEA 1UB9A 1D3YA 2RN7A 1RIOH 3M7GA 4EM0B 3R61A 4IRHA 5FFXA 1VTNC 2PBIA 3KCCA 1XGSA 3RPUA 5H20A 1B9MA 3VB2A 2XV4S 3KFWX 2A6HF 2OQRA 4HDUA 4ENJA 5LEJA 3OOPA 2OA4A 1XCVA 2M30A 1ZN2A 2Z9OA 1BIBA 1NHAA 2XKOA 1IXSB 3I53A 5E17F 3F8MA 1PDNC 5ICCA 4ZYDA 3TO7A 1ODDA 5LHGA 2DLLA 1MZBA 5A2QK 4ETSA 4GO1A 4L0ZB 2DK5A 3QP5A 3BPXA 4EJWA 1SFEA 4CO8A 1P4XA 3LA2A 3WTUC 1ZGAA 2ZNZA 2Q2EA 3G73A 2YU3A 3HOTA 1FYKA 4U0VA 1O7LA 4P9UA 3Q5FA 4MQVA 2IT0A 1DUXC 2E7XA 1E2XA 1SD4A 4L9JA 5F1RA 4HQMA 1O3SA 3ULQB 2L4MA 2P4WA 3WGGA 1IRFA 3E6DA 1EH8A 3H3UA 3SXYA 1Z91A 2RGVA 3ZPLA 4MTEA 4HX8A 1U6GA 3DKWA 2FNPA 3KZZA 3FXUA 1LEBA 3P7NA 5BMZA 5HLIA 2D1HA 1TQMA 2QUFA 1R1UA 2LKPA 5CVRA 1F1ZA 1XMKA 3MWMA 3J80K 2F5EA 3K1NA 2E1CA 2W84A 1LEAA 3WE2A 1FNNA 2IP2A 5FFZA 1Q1HA 1W7PA 1HKSA 2Q0OA 5BPIA 1MJ9A 4HW0A 3BROA 3DXJF 1IN6A 1WWXA 2R7FA 3I0TA 3ZQ7A 1BC8C 3F23A 4EMSA 2AS5F 1FLIA 4TV7A 3IL2A 3FM5A 2MC3A 3I59A 5CYVA 2GWRA 5D5UB 1JHFA 3EETA 1DP7P 5L3DA 2VT3A 4B8XA 1Y0UA 3I59B 2OZUA 2ELHA 5HOOA 5LGNA 1E17A 5ED4A 1F9NA 2HEOA 3GFMA 5CVJA 3RTRA 1ZG5A 4CGZA 4RAYA 4O3MA 3K1MA 1ZLJA 2W24A 4ENNA 3KEOA 3KLOA 2K27A 1LDDA 3SZTA 2J5PA 1YS6A 4S05A 2ZBKA 2GXBA 2HZTA 2PMUA 5AONA 5E1ZB 3PQKA 1U5TA 1ZG1A 2IA0A 3WU1B 1LVAA 1U2WA 3FM3A 2K86A 2M5WA 2OU2A 4I98B 4RS8A 4EJVA 1YW9A 2FA5A 5BQTA 1LDKB 4A5MA 4M9SA 3JTHA 3IWFA 2OQGA 3C18A 3WTSC 3FHZA 5D8LB 3ZMZA 4OMYA 1GVJA 2V79A 1R22A 3V7RA 3DPTA 3JW4A 2VBXA 1TLHB 1R1TA 2P5KA 2FMYA 3EUHA 3K1PA 1HBXG 2IPQX 2XAQA 4L5JA 2ESNA 2P6SA 2XASA 4XRFA 5LHHA 2VC0A 4GXOA 1WKMA 4LLLA 2FBIA 3BOQA 2Z5UA 1S29A 3ROUA 5FD6A 1I1SA 2HOEA 1YQAA 5E1XA 1AOYA 1UHMA 4LK0F 1FBUA 2MH9A 4YFKF 4YFNF 3WTTC 2LSOA 2TDXA 1IN4A 3Q9SA 5E1WA 2NNNA 4P5OA 3GF2A 3F8FA 3I4PA 2MD5A 3LWFA 1H9GA 2A07F 5LEKA 4B09A 2D2WA 3V7SA 1FOKA 1XCBA 3QPTA 4A5NA 1RUOA 2Q8KA 2L3DA 4CZZA 5ICGA 2UZKA 3BDDA 1YG2A 2VOPA 1ZLKA 4NHJA 1MJAA 1F4KA 5D5WB 4PDKA 3F8CA 1G3SA 1YFHA 1J9IA 3L00A 2VBZA 2STWA 3KEQA 1BOAA 1J2XA 2QWWA 5AIQA 3R0AA 3LQQA 2O8XA 1KU2A 1FX7A 3M9AA 4P9FA 2EJRA 3WE3A 2H94A 4LG0A 5K5QA 4HQEA 1FPQA 1IXRC 2EV5A 3HHHA 4HV5A 3ELKA 3S2WA 4N9IA 4LG0B 1OYWA 2CO5A 4HOBA 2PQ8A 2QBYA 3RIRA 1KQ0A 3LQRA 2NYXA 3CLOA 3R6SA 2Y48A 2CFXA 3WTWC 3TDZC 5BOXA 2QBYB 1W5TA 1LJ9A 2O0YA 5D4RA 4LMYA 5HDNA 5E18F 3Q9VA 3B73A 4GYGA 2MLKA 2YSRA 3M1EA 3GO5A 2ZFWA 2H09A 5D4SA 4IRIA 2FSWA 3FWEA 5K5RA 4KFCA 3QU3A 4MEYF 4YIIA 2YR2A 3GXOA 5ILSA 4EVIA 2DPDA 1ZRDA 2F5FA 4U7BA 2CGPA 4JK1X 3CJNA 3MCZA 2XHKA 3QU6A 1QNTA 5F6FA 2RV8A 3HIFA 4IHSA 1WQ2A 3ZMUA 1Z6RA 4RAZA 4LFUA 4QWQA 2L4AA 2ZJ2A 1FBQA 4KIFA 1STZA 2IA1A 3O3KA 4HV6A 4DNCA 3ERED 5J8FA 4KMUX 4R8HA 1BIAA 1USTA 2GA1A 2H6CA 1XB4A 1MDMA 2VBWA 2MLGA 1Z05A 3WTZA 3VOEA 3R60A 2GXGA 4MTDA 2PLYA 2A6EF 4G7HF 1MDMB 4MNUA 2Z3YA 3D5LA 4UXNA 2XUBA 1SMYF 3E5UA 4HDVA 1KQ9A 2ISYA 2L54A 4EV0A 5DV5A 2DK8A 5HS9A 3T8RA 2VN2A 4Z2YA 1D8KA 4LGWA 3T8TA 2OBPA 4OIQF 4AWXB 3BJOA 2VE8A 1SMTA 3FX3A 4HAMA 3F22A 3M8EA 1FWZA 2E1NA 2DFIA 3ZMVA 4BNCA 5E20A 3HRMA 1H0MA 4EJTA 2HWVA 2PG4A 2W57A 3I58A 3J7AO 3V8KA 1TQIA 1R36A 1OMIA 4ON0A 3T0YA 2YX7A 3HOSA 4M72A 4YIFA 3FMSA 2LNBA 1ON1A 3F6VA 2EFOA 4GCVA 1QGPA 4HLXA 1WSUA 5L3GA 3HRSA 1OYIA 4AIKA 3V4GA 3R0JA 2GA2A 4KMFA 4ESJA 3QRFF 1IZ1A 2HQRA 4A0ZA 1USSA 3GFLA 1KQ8A 1Z7UA 4HZFA 4Y15A 3KP7A 1WRJA 2COMA 4KYWA 4ENKA 4L9NA 1LNWA 4KIGA 3MAJA 4KNYA 5ICEA 4WX9A 1T2KA 4L0YB 4G6DA 3E3VA 2PJPA 4ESBA 4A6EA 1O3TA 3F8NA 1B4AA 1U78A 1U5TC 2MA3A 2YPRA 2QENA 4WCGA 3IKTA 3IWZA 1R58A 5DD4A 4MGRA 4R1HA 2P7CB 3TDUC 2EFNA 2QQBA 4KN4X 1GXQA 2P6TA 4EGYA 4ENMA 1L3LA 2F2EA 2QVOA 3WG9A 1BI1A 1KU7A 2BYVE 2JSCA 3WTXC 1HKQA 4IRGA 2HDCA 4PCQA 4Q48A 2DO7A 4RB3C 4LLNA 3TO9A 1HW5A 1JXSA 1TW2A 1XDSA 1S6LA 2OD5A 4ZH4F 2NNYA 4KA4A 5L3EA 4BHPA 2EA4A 4G9YA 2QQAA 1DDNA 3FXRA 4FT8A 5ICFA 2XKPA 5DCFA 5AIPA 3LFKA 3L09A 1IRGA 1KYZA 1HW2A 1XMAA 1W7PB 3GX4X 4M9XA 2PMHA 3KP3A 2NS0A 1MD0A 3BZ6A 4HLYA 2JZYA 2JT1A 3J81Z 1Z9CA 2DBBA 1P2FA 3L7WA 3HRUA 3FZVA 2DQRA 4O6JA 3G3ZA 4LLGF 1XDUA 3ECOA 4UVBA 4KIBA 2DPUA 2ZNYA 1HSJA 4R79A 4LB6B 2XIGA 1P92A 3GW2A 5DD8A 3E6BA 2EV6A 1U8RA 3W6JB 2HTJA 2P7VB 3H3ZA 4IVNA 3GZ6A 4CICA 1OYYA 2QQ9A 1QO0D 2HYGD 2IJLA 3EQLF 4FHTA 1ULYA 2WV0A 2RVCA 3HSFA 2LF7A 3LAPA 3NQOA 1FP2A 3ABTA 4OINF 2FBKA 1YYVA 1U5TB 2DAOA 3I54A 3GYHX 3WODF 4NQWA 5F64A 2FOKA 3F72A 3BP8A 2KIUA 3CO7C 4FX4A 2Z33A 5L3BA 3RYRA 3MQ0A 2X0LA 3EYYA 2XAFA 2EK5A 2DT5A 2BBYA 2Y75A 2RC4A 3TGNA 1RZ4A 5ERIA 1OR7A 5D6FA 1IUYA 1W7PD 1R5GA 5HVQC 1J5YA 2MBFA 1BN5A 5FGMA 2K4JA 1HQCA 1SD5A 1CF7A 3P9CA 3LA7A 3BY6A 3C1DA 2M8EA 2K02A 2XAGA 4M73A 2HKXA 2M1BA 3LSTA 3QPHA 4CXFA 2GQQA 3K9TA 2JTVA 4IXAA 3E5XA 1CF7B 4F7ZA 3SQNA 5HLGA 3L9FA 1G3YA 3GZ5A 4H0EA 1Z6TA 4JQFA 2FEZA 4CYDA 3HHGA 5KVRA 3HSRA 2D1VA 3ABUA 4P55A 2HFHA 3TO6A 1YW8A 5FD5A 4XLNF 3F6OA 1J59A 4KN7X 2FU4A 4GGGA 1T38A 1XSDA 3KLNA 2GIVA 3HUGA 4HYEA 3J81K 3IKVA 2NRAC 4OIRF 2BEOA 2ZCWA 4A2UA 1D5VA 1O7FA 3KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHU A;  2J5O A;  5EEG A;  1OPC A;  3OV8 A;  4BYY A;  3KP5 A;  1W5S A;  4IF4 A;  2EB7 A;  5BS6 A;  1ZRC A;  5LHI A;  3RYP A;  4UUV A;  3DV8 A;  2DU9 A;  2O03 A;  4RGX A;  4EM1 A;  5D5X B;  3FF5 A;  5CJ9 A;  5IT3 A;  2G7H A;  4G7Z F;  2PFB A;  1LQ1 A;  1FSH A;  5J6X A;  5DUI A;  1A04 A;  2MH2 A;  3MZY A;  1T0F A;  4RGR A;  3NEU A;  2HYF A;  1XGN A;  3E6M A;  2D45 A;  1ZH5 A;  3DF8 A;  2XRO A;  5CLS A;  1BI2 A;  1R7J A;  2IA2 A;  5L3C A;  4AVP A;  3U2R A;  4WK8 F;  3IRQ A;  4WWC A;  4KT5 C;  4UV8 A;  1HW1 A;  3AAF A;  4UVC A;  4ZYG A;  2FXA A;  4O5V A;  2KJB A;  1UHW A;  4GYI A;  4HA8 A;  1QQI A;  3WGI A;  1XGM A;  1J0R A;  4EQQ A;  3CUQ A;  4MQ9 F;  4M74 A;  1I5Z A;  2DQL A;  1C0W A;  1KGS A;  5FLX Z;  3CUQ B;  3QAH A;  1TNT A;  1IN7 A;  4BHC A;  4A12 A;  3TOA A;  2B0L A;  4OU0 A;  1V4R A;  5LLQ A;  3BJA A;  4LJZ F;  3KP2 A;  3REO A;  4U0W A;  1T98 A;  4EM2 A;  2RKH A;  2K7L A;  4WXC A;  2QLZ A;  4Q47 A;  4RGS A;  1R1V A;  1K78 A;  2Z99 A;  4KDP A;  4A0X A;  2VT2 A;  4LD5 A;  1S8N A;  2BGC A;  2CSO A;  2HTS A;  2QYO A;  1K78 B;  4ZZD A;  3L2C A;  1REP C;  3RKX A;  3TQN A;  2K4B A;  3QOP A;  5ILU A;  5ILV A;  4A6D A;  3N97 A;  1TNS A;  2ESH A;  4FX0 A;  2HGC A;  4I0A A;  4NB5 A;  1B9N A;  3SFZ A;  5D8K B;  3ML6 A;  1ZG3 A;  3T1B A;  1SD6 A;  5K5O A;  3V8J A;  3E97 A;  1QBJ A;  5JVT A;  1W4M A;  4BH9 A;  2W85 A;  1V3F A;  2HQN A;  2F5C A;  3GWZ A;  3HTU A;  1K7A A;  5E8I A;  1S3J A;  3ZMT A;  3HTS B;  3WGH A;  5DDG A;  1G4D A;  1J75 A;  1XSV A;  4HX7 A;  2GAU A;  3MFK A;  1FBS A;  2HR3 A;  2V1X A;  4U88 A;  2BV6 A;  5EEH A;  1P4W A;  4EJO A;  4I09 A;  4UVA A;  2H27 A;  1HKT A;  5LRS A;  2DI3 A;  3WU0 A;  2IRF G;  1YTY A;  1MGT A;  1FP1 D;  3JTG A;  1ZRE A;  4LK1 F;  3N4M A;  1IW7 F;  3I64 A;  1EH6 A;  1UFM A;  3EDP A;  5H6Q A;  1RI7 A;  4CDG A;  2CWE A;  3RI4 A;  2STT A;  4XLP F;  4ESF A;  3V7C A;  4CHU A;  4LB5 A;  3DEU A;  5JI6 A;  2G7U A;  5DCM A;  5CVI A;  2FF4 A;  2GZW A;  4ZZL A;  1G3T A;  4S04 A;  4G6Q A;  4EJU A;  4UV9 A;  2Y0M A;  5FLX K;  5DCM B;  3GFJ A;  5KK1 A;  4U0Y A;  3JSP A;  4IJA A;  1DPR A;  1K6O A;  1Z1D A;  3MZH A;  5FO5 A;  1ZAO A;  1ZAR A;  4UNO A;  1XGO A;  4MHG A;  4RB0 A;  1XD7 A;  2XGX A;  2RQP A;  4L5I A;  2ZME A;  1YIO A;  2P8T A;  3ISP A;  1R5H A;  4Q4Z F;  4I0B A;  3U9G A;  5D5V B;  2ZME B;  3R4K A;  2ZO4 A;  3IC7 A;  5J8C A;  3GUD A;  3ZP5 A;  2E7W A;  2M87 A;  1QZY A;  3TKY A;  3FXQ A;  4IPA A;  3KP6 A;  1G6N A;  2CYY A;  1MJB A;  2IVM A;  3DPL C;  1L0O C;  3PQJ A;  1RUN A;  2W25 A;  3CTA A;  2ZKZ A;  3FMQ A;  3F8B A;  1GHC A;  2CQK A;  1TTY A;  4D0P A;  4I02 A;  1FC3 A;  1IF1 A;  4HF1 A;  2A5Y B;  1IN5 A;  5FB2 A;  3K69 A;  1B1B A;  4JBA A;  1TBX A;  1FZP B;  3KE2 A;  2EFP A;  2EWN A;  5LGT A;  4L9T A;  1I1G A;  5HS8 A;  3ZMD A;  1S7A A;  3NRV A;  3QP6 A;  4OIP F;  1GXP A;  2JPB A;  1R00 A;  2O61 A;  2L01 A;  2F5D A;  3E5Q A;  2PI0 A;  2X4H A;  4QLC U;  4RB1 A;  4AIH A;  1P4A A;  2H6B A;  3O6B B;  3E6C C;  3EYI A;  4U7D A;  4OOI A;  3DFG A;  3VFZ A;  1FYM A;  2VBY A;  2VE9 A;  4YG2 F;  3M8F A;  5HDK A;  1BI0 A;  3GFI A;  1PP8 F;  1ZRF A;  2ACJ A;  1O3R A;  2O6G E;  5IT9 Z;  3F21 A;  3RKY A;  4HF2 A;  2EA2 A;  4MEX F;  2V1D A;  2L02 A;  4A0Y A;  4M9Z A;  5L3F A;  4K2E A;  3BWG A;  4UHT A;  2V6C A;  3ECH A;  1O57 A;  4L9V A;  4M71 A;  3GVA A;  2ETH A;  1ZYR F;  3KZY A;  2FBH A;  3VEP A;  1KU9 A;  2M45 A;  2XAJ A;  3RDI A;  3FMR A;  2QM3 A;  2EV0 A;  1BJA A;  1H9T A;  5DUK A;  4Q5S F;  4IHT A;  4E70 A;  3RPQ A;  4XSZ F;  1WI9 A;  2XAH A;  2AXL A;  5HLH A;  2NAZ A;  2RDP A;  5LGU A;  5K1Y A;  5HDG A;  2UWM A;  1JHH A;  2DTR A;  1R23 A;  6PAX A;  4HX4 A;  5CVV A;  2WC2 A;  4I7H A;  1DPU A;  5DEQ A;  3MEX A;  1XSX A;  2R7D A;  5JHU A;  2VOO A;  2ISZ A;  2KJC A;  2IW5 A;  1BM9 A;  1YS7 A;  4RB2 C;  4EGZ A;  4DQ2 A;  2WTE A;  4KUM A;  3CUQ C;  3KET A;  2XRN A;  3ZN0 A;  2VOD A;  3CDH A;  5JR3 A;  4XBF A;  4G7O F;  1CGP A;  1FT9 A;  3COA C;  4N0B A;  1TQP A;  3IRR A;  1SD7 A;  1JGS A;  1JE8 A;  1FY7 A;  4M6Y A;  4BAY A;  1J7K A;  4I01 A;  3I71 A;  1G3W A;  4HF0 A;  5LBQ A;  4AD9 A;  2WWY A;  2ADU A;  1S7O A;  1ZHF A;  2KKO A;  2PN6 A;  2C6Y A;  4P96 A;  2V1U A;  1MKM A;  3JAM Z;  4WXH A;  5HS7 A;  3SZP A;  4KIC A;  2OAZ A;  3ZN1 A;  1B59 A;  2CG4 A;  3CUO A;  1P6R A;  5E8G A;  2ZXJ A;  4OIO F;  2YX4 A;  5TRD A;  1RNL A;  4N9H A;  4G94 A;  2FQ3 A;  1B6A A;  5IT9 K;  2LDU A;  3VOD A;  1QPM A;  3JSO A;  1FSE A;  3TOB A;  4PZJ A;  2A68 F;  2FE3 A;  4HBL A;  3O2P E;  4OMZ A;  2A69 F;  4ZYH A;  2R3S A;  3DQV C;  4G8X A;  1KU3 A;  3RJP A;  1BI3 A;  2XVC A;  2EFQ A;  3K2Z A;  1SAX A;  1EV7 A;  2KIM A;  1KA8 A;  2UXN A;  1BC7 C;  2HKO A;  1HXD A;  3BJ6 A;  1F5T A;  2FML A;  2VC1 A;  4AIJ A;  1YO5 C;  1ONV A;  5JFR A;  1KYW A;  3D0S A;  2JRT A;  1BBY A;  3LAJ A;  1FYL A;  3LA3 A;  5TJJ A;  2FNA A;  1UCR A;  4BXU A;  2JPC A;  3C3W A;  3WTV C;  1LB2 A;  3K0L A;  4YFX F;  3HSE A;  2KRF A;  3T5X A;  3BPV A;  5A2Q Z;  1PUE E;  1XN7 A;  4Y17 A;  1HST A;  2RNJ A;  3WTY C;  3GLX A;  2P5V A;  1IXC A;  4BQA A;  1YLF A;  1U3E M;  3U1D A;  2KIF A;  1D8J A;  3PFI A;  2P5L C;  4L18 B;  2BE5 F;  2VON A;  2PEX A;  3B02 A;  3H92 A;  1OKR A;  4RGU A;  2O3F A;  4PGG A;  1ZGJ A;  4Y13 A;  4M6X A;  5CVU A;  1O3Q A;  2HS5 A;  3W6K B;  1AWC A;  1ON2 A;  2OZ6 A;  4BHB A;  3F3X A;  1T6S A;  3RKW A;  2VXZ A;  1IN8 A;  1T39 A;  1K79 A;  3P9K A;  3V8L A;  2DW4 A;  3I5U A;  3JAM K;  2A61 A;  3SHF A;  4WF2 A;  3P9I A;  5D6E A;  1YW7 A;  1QZZ A;  1SFX A;  5DYM A;  2QZ8 A;  2UXX A;  1X3U A;  3CO6 C;  3ZMS A;  1IAW A;  3J80 Z;  3HYI A;  5BPD A;  2A3S A;  1SFU A;  3DP7 A;  1I6X A;  2G9W A;  4WXD A;  1LDJ A;  4ASN A;  1I27 A;  4I2O A;  1TW3 A;  1EH7 A;  1PP7 U;  5LRR A;  2LF8 A;  4PGH A;  4XSX F;  3HRT A;  5H6R A;  2CW0 F;  2V9V A;  3GEZ A;  2EFW A;  3C7J A;  2FRH A;  4ZYE A;  1UB9 A;  1D3Y A;  2RN7 A;  1RIO H;  3M7G A;  4EM0 B;  3R61 A;  4IRH A;  5FFX A;  1VTN C;  2PBI A;  3KCC A;  1XGS A;  3RPU A;  5H20 A;  1B9M A;  3VB2 A;  2XV4 S;  3KFW X;  2A6H F;  2OQR A;  4HDU A;  4ENJ A;  5LEJ A;  3OOP A;  2OA4 A;  1XCV A;  2M30 A;  1ZN2 A;  2Z9O A;  1BIB A;  1NHA A;  2XKO A;  1IXS B;  3I53 A;  5E17 F;  3F8M A;  1PDN C;  5ICC A;  4ZYD A;  3TO7 A;  1ODD A;  5LHG A;  2DLL A;  1MZB A;  5A2Q K;  4ETS A;  4GO1 A;  4L0Z B;  2DK5 A;  3QP5 A;  3BPX A;  4EJW A;  1SFE A;  4CO8 A;  1P4X A;  3LA2 A;  3WTU C;  1ZGA A;  2ZNZ A;  2Q2E A;  3G73 A;  2YU3 A;  3HOT A;  1FYK A;  4U0V A;  1O7L A;  4P9U A;  3Q5F A;  4MQV A;  2IT0 A;  1DUX C;  2E7X A;  1E2X A;  1SD4 A;  4L9J A;  5F1R A;  4HQM A;  1O3S A;  3ULQ B;  2L4M A;  2P4W A;  3WGG A;  1IRF A;  3E6D A;  1EH8 A;  3H3U A;  3SXY A;  1Z91 A;  2RGV A;  3ZPL A;  4MTE A;  4HX8 A;  1U6G A;  3DKW A;  2FNP A;  3KZZ A;  3FXU A;  1LEB A;  3P7N A;  5BMZ A;  5HLI A;  2D1H A;  1TQM A;  2QUF A;  1R1U A;  2LKP A;  5CVR A;  1F1Z A;  1XMK A;  3MWM A;  3J80 K;  2F5E A;  3K1N A;  2E1C A;  2W84 A;  1LEA A;  3WE2 A;  1FNN A;  2IP2 A;  5FFZ A;  1Q1H A;  1W7P A;  1HKS A;  2Q0O A;  5BPI A;  1MJ9 A;  4HW0 A;  3BRO A;  3DXJ F;  1IN6 A;  1WWX A;  2R7F A;  3I0T A;  3ZQ7 A;  1BC8 C;  3F23 A;  4EMS A;  2AS5 F;  1FLI A;  4TV7 A;  3IL2 A;  3FM5 A;  2MC3 A;  3I59 A;  5CYV A;  2GWR A;  5D5U B;  1JHF A;  3EET A;  1DP7 P;  5L3D A;  2VT3 A;  4B8X A;  1Y0U A;  3I59 B;  2OZU A;  2ELH A;  5HOO A;  5LGN A;  1E17 A;  5ED4 A;  1F9N A;  2HEO A;  3GFM A;  5CVJ A;  3RTR A;  1ZG5 A;  4CGZ A;  4RAY A;  4O3M A;  3K1M A;  1ZLJ A;  2W24 A;  4ENN A;  3KEO A;  3KLO A;  2K27 A;  1LDD A;  3SZT A;  2J5P A;  1YS6 A;  4S05 A;  2ZBK A;  2GXB A;  2HZT A;  2PMU A;  5AON A;  5E1Z B;  3PQK A;  1U5T A;  1ZG1 A;  2IA0 A;  3WU1 B;  1LVA A;  1U2W A;  3FM3 A;  2K86 A;  2M5W A;  2OU2 A;  4I98 B;  4RS8 A;  4EJV A;  1YW9 A;  2FA5 A;  5BQT A;  1LDK B;  4A5M A;  4M9S A;  3JTH A;  3IWF A;  2OQG A;  3C18 A;  3WTS C;  3FHZ A;  5D8L B;  3ZMZ A;  4OMY A;  1GVJ A;  2V79 A;  1R22 A;  3V7R A;  3DPT A;  3JW4 A;  2VBX A;  1TLH B;  1R1T A;  2P5K A;  2FMY A;  3EUH A;  3K1P A;  1HBX G;  2IPQ X;  2XAQ A;  4L5J A;  2ESN A;  2P6S A;  2XAS A;  4XRF A;  5LHH A;  2VC0 A;  4GXO A;  1WKM A;  4LLL A;  2FBI A;  3BOQ A;  2Z5U A;  1S29 A;  3ROU A;  5FD6 A;  1I1S A;  2HOE A;  1YQA A;  5E1X A;  1AOY A;  1UHM A;  4LK0 F;  1FBU A;  2MH9 A;  4YFK F;  4YFN F;  3WTT C;  2LSO A;  2TDX A;  1IN4 A;  3Q9S A;  5E1W A;  2NNN A;  4P5O A;  3GF2 A;  3F8F A;  3I4P A;  2MD5 A;  3LWF A;  1H9G A;  2A07 F;  5LEK A;  4B09 A;  2D2W A;  3V7S A;  1FOK A;  1XCB A;  3QPT A;  4A5N A;  1RUO A;  2Q8K A;  2L3D A;  4CZZ A;  5ICG A;  2UZK A;  3BDD A;  1YG2 A;  2VOP A;  1ZLK A;  4NHJ A;  1MJA A;  1F4K A;  5D5W B;  4PDK A;  3F8C A;  1G3S A;  1YFH A;  1J9I A;  3L00 A;  2VBZ A;  2STW A;  3KEQ A;  1BOA A;  1J2X A;  2QWW A;  5AIQ A;  3R0A A;  3LQQ A;  2O8X A;  1KU2 A;  1FX7 A;  3M9A A;  4P9F A;  2EJR A;  3WE3 A;  2H94 A;  4LG0 A;  5K5Q A;  4HQE A;  1FPQ A;  1IXR C;  2EV5 A;  3HHH A;  4HV5 A;  3ELK A;  3S2W A;  4N9I A;  4LG0 B;  1OYW A;  2CO5 A;  4HOB A;  2PQ8 A;  2QBY A;  3RIR A;  1KQ0 A;  3LQR A;  2NYX A;  3CLO A;  3R6S A;  2Y48 A;  2CFX A;  3WTW C;  3TDZ C;  5BOX A;  2QBY B;  1W5T A;  1LJ9 A;  2O0Y A;  5D4R A;  4LMY A;  5HDN A;  5E18 F;  3Q9V A;  3B73 A;  4GYG A;  2MLK A;  2YSR A;  3M1E A;  3GO5 A;  2ZFW A;  2H09 A;  5D4S A;  4IRI A;  2FSW A;  3FWE A;  5K5R A;  4KFC A;  3QU3 A;  4MEY F;  4YII A;  2YR2 A;  3GXO A;  5ILS A;  4EVI A;  2DPD A;  1ZRD A;  2F5F A;  4U7B A;  2CGP A;  4JK1 X;  3CJN A;  3MCZ A;  2XHK A;  3QU6 A;  1QNT A;  5F6F A;  2RV8 A;  3HIF A;  4IHS A;  1WQ2 A;  3ZMU A;  1Z6R A;  4RAZ A;  4LFU A;  4QWQ A;  2L4A A;  2ZJ2 A;  1FBQ A;  4KIF A;  1STZ A;  2IA1 A;  3O3K A;  4HV6 A;  4DNC A;  3ERE D;  5J8F A;  4KMU X;  4R8H A;  1BIA A;  1UST A;  2GA1 A;  2H6C A;  1XB4 A;  1MDM A;  2VBW A;  2MLG A;  1Z05 A;  3WTZ A;  3VOE A;  3R60 A;  2GXG A;  4MTD A;  2PLY A;  2A6E F;  4G7H F;  1MDM B;  4MNU A;  2Z3Y A;  3D5L A;  4UXN A;  2XUB A;  1SMY F;  3E5U A;  4HDV A;  1KQ9 A;  2ISY A;  2L54 A;  4EV0 A;  5DV5 A;  2DK8 A;  5HS9 A;  3T8R A;  2VN2 A;  4Z2Y A;  1D8K A;  4LGW A;  3T8T A;  2OBP A;  4OIQ F;  4AWX B;  3BJO A;  2VE8 A;  1SMT A;  3FX3 A;  4HAM A;  3F22 A;  3M8E A;  1FWZ A;  2E1N A;  2DFI A;  3ZMV A;  4BNC A;  5E20 A;  3HRM A;  1H0M A;  4EJT A;  2HWV A;  2PG4 A;  2W57 A;  3I58 A;  3J7A O;  3V8K A;  1TQI A;  1R36 A;  1OMI A;  4ON0 A;  3T0Y A;  2YX7 A;  3HOS A;  4M72 A;  4YIF A;  3FMS A;  2LNB A;  1ON1 A;  3F6V A;  2EFO A;  4GCV A;  1QGP A;  4HLX A;  1WSU A;  5L3G A;  3HRS A;  1OYI A;  4AIK A;  3V4G A;  3R0J A;  2GA2 A;  4KMF A;  4ESJ A;  3QRF F;  1IZ1 A;  2HQR A;  4A0Z A;  1USS A;  3GFL A;  1KQ8 A;  1Z7U A;  4HZF A;  4Y15 A;  3KP7 A;  1WRJ A;  2COM A;  4KYW A;  4ENK A;  4L9N A;  1LNW A;  4KIG A;  3MAJ A;  4KNY A;  5ICE A;  4WX9 A;  1T2K A;  4L0Y B;  4G6D A;  3E3V A;  2PJP A;  4ESB A;  4A6E A;  1O3T A;  3F8N A;  1B4A A;  1U78 A;  1U5T C;  2MA3 A;  2YPR A;  2QEN A;  4WCG A;  3IKT A;  3IWZ A;  1R58 A;  5DD4 A;  4MGR A;  4R1H A;  2P7C B;  3TDU C;  2EFN A;  2QQB A;  4KN4 X;  1GXQ A;  2P6T A;  4EGY A;  4ENM A;  1L3L A;  2F2E A;  2QVO A;  3WG9 A;  1BI1 A;  1KU7 A;  2BYV E;  2JSC A;  3WTX C;  1HKQ A;  4IRG A;  2HDC A;  4PCQ A;  4Q48 A;  2DO7 A;  4RB3 C;  4LLN A;  3TO9 A;  1HW5 A;  1JXS A;  1TW2 A;  1XDS A;  1S6L A;  2OD5 A;  4ZH4 F;  2NNY A;  4KA4 A;  5L3E A;  4BHP A;  2EA4 A;  4G9Y A;  2QQA A;  1DDN A;  3FXR A;  4FT8 A;  5ICF A;  2XKP A;  5DCF A;  5AIP A;  3LFK A;  3L09 A;  1IRG A;  1KYZ A;  1HW2 A;  1XMA A;  1W7P B;  3GX4 X;  4M9X A;  2PMH A;  3KP3 A;  2NS0 A;  1MD0 A;  3BZ6 A;  4HLY A;  2JZY A;  2JT1 A;  3J81 Z;  1Z9C A;  2DBB A;  1P2F A;  3L7W A;  3HRU A;  3FZV A;  2DQR A;  4O6J A;  3G3Z A;  4LLG F;  1XDU A;  3ECO A;  4UVB A;  4KIB A;  2DPU A;  2ZNY A;  1HSJ A;  4R79 A;  4LB6 B;  2XIG A;  1P92 A;  3GW2 A;  5DD8 A;  3E6B A;  2EV6 A;  1U8R A;  3W6J B;  2HTJ A;  2P7V B;  3H3Z A;  4IVN A;  3GZ6 A;  4CIC A;  1OYY A;  2QQ9 A;  1QO0 D;  2HYG D;  2IJL A;  3EQL F;  4FHT A;  1ULY A;  2WV0 A;  2RVC A;  3HSF A;  2LF7 A;  3LAP A;  3NQO A;  1FP2 A;  3ABT A;  4OIN F;  2FBK A;  1YYV A;  1U5T B;  2DAO A;  3I54 A;  3GYH X;  3WOD F;  4NQW A;  5F64 A;  2FOK A;  3F72 A;  3BP8 A;  2KIU A;  3CO7 C;  4FX4 A;  2Z33 A;  5L3B A;  3RYR A;  3MQ0 A;  2X0L A;  3EYY A;  2XAF A;  2EK5 A;  2DT5 A;  2BBY A;  2Y75 A;  2RC4 A;  3TGN A;  1RZ4 A;  5ERI A;  1OR7 A;  5D6F A;  1IUY A;  1W7P D;  1R5G A;  5HVQ C;  1J5Y A;  2MBF A;  1BN5 A;  5FGM A;  2K4J A;  1HQC A;  1SD5 A;  1CF7 A;  3P9C A;  3LA7 A;  3BY6 A;  3C1D A;  2M8E A;  2K02 A;  2XAG A;  4M73 A;  2HKX A;  2M1B A;  3LST A;  3QPH A;  4CXF A;  2GQQ A;  3K9T A;  2JTV A;  4IXA A;  3E5X A;  1CF7 B;  4F7Z A;  3SQN A;  5HLG A;  3L9F A;  1G3Y A;  3GZ5 A;  4H0E A;  1Z6T A;  4JQF A;  2FEZ A;  4CYD A;  3HHG A;  5KVR A;  3HSR A;  2D1V A;  3ABU A;  4P55 A;  2HFH A;  3TO6 A;  1YW8 A;  5FD5 A;  4XLN F;  3F6O A;  1J59 A;  4KN7 X;  2FU4 A;  4GGG A;  1T38 A;  1XSD A;  3KLN A;  2GIV A;  3HUG A;  4HYE A;  3J81 K;  3IKV A;  2NRA C;  4OIR F;  2BEO A;  2ZCW A;  4A2U A;  1D5V A;  1O7F A;  3KP4 A; 
#chains in the Genus database with same CATH topology
 4HNU A;  1XTA A;  2XGD A;  3IHU A;  4XN0 A;  2J5O A;  3CP2 A;  5EEG A;  1OPC A;  1SVL A;  3ABL H;  3OV8 A;  2E2H J;  4Y4R A;  4BYY A;  2LFB A;  1NK2 P;  4UB6 C;  3NWS A;  3JRA A;  3KP5 A;  1W5S A;  4IF4 A;  2EB7 A;  5BS6 A;  2LOO A;  2LLK A;  3CP8 A;  3GTK J;  1ZRC A;  4PSX A;  5LHI A;  2EZK A;  3RYP A;  3TED A;  2Y9Z A;  4UUV A;  1WH5 A;  3DV8 A;  2DU9 A;  3BLY A;  2O03 A;  1QA6 A;  4RGX A;  4EM1 A;  2DMU A;  5D5X B;  3FF5 A;  5IP9 J;  2E2I J;  5CJ9 A;  2K9S A;  2X6W A;  5IT3 A;  3M8J A;  3K70 C;  1UMQ A;  5EJC A;  3GTL J;  4E4H A;  2G7H A;  4G7Z F;  2PFB A;  1LQ1 A;  1N25 A;  4BDY A;  1FSH A;  5J6X A;  3BTL A;  5DUI A;  4XLE A;  1D0Z A;  4BE0 A;  1A04 A;  3CC4 I;  2MH2 A;  2VQH A;  1T0F A;  3MZY A;  1TZL A;  3GTG J;  2DA7 A;  4RGR A;  3NEU A;  1K6Y A;  2HYF A;  1XGN A;  3E6M A;  1X2N A;  2D45 A;  1X1B A;  2NS7 A;  2RQQ A;  3DEE A;  1ZH5 A;  1VQ8 I;  4HPQ A;  3DF8 A;  2XRO A;  5CLS A;  1BI2 A;  1R7J A;  5B1B H;  5IP6 A;  2IA2 A;  5L3C A;  2KLO A;  4AVP A;  3U2R A;  4WK8 F;  3IRQ A;  1SAN A;  4WWC A;  1H89 C;  4KT5 C;  1ETO A;  1HW1 A;  4UV8 A;  3AAF A;  4UVC A;  2EIL H;  4ZYG A;  2FXA A;  2MFZ A;  4O5V A;  1X4P A;  2R7T A;  3ZR8 X;  1GT0 C;  5KHD A;  4KIS A;  5J1R A;  3CJR B;  5CQE A;  3OR2 C;  3FXL A;  2KJB A;  5EZH A;  1UHW A;  4GYI A;  3PNY A;  3BZC A;  4HA8 A;  1QQI A;  3WGI A;  1S72 I;  5LD2 C;  2L2O A;  1XGM A;  1J0R A;  2KIS A;  3K10 A;  3DTI A;  3W2W A;  2M3A A;  4EQQ A;  3CUQ A;  5C44 J;  4MQ9 F;  3EUK L;  4M74 A;  3H3V K;  4XM3 A;  3J7A Y;  1I5Z A;  2DQL A;  1IJW C;  1C0W A;  3C2B A;  1KGS A;  3GLL A;  5FLX Z;  2V6E A;  3CUQ B;  2I10 A;  5FRN A;  3BZK A;  4M3E A;  3LNQ A;  2E2J J;  3QAH A;  1TNT A;  1IN7 A;  2ICW G;  4BHC A;  5E3M A;  4A12 A;  3TOA A;  2B0L A;  2VUM J;  3I3L A;  1M1E B;  1MW7 A;  1P7J A;  4OU0 A;  1V4R A;  3OSG A;  3CF2 A;  5LLQ A;  3BJA A;  4LJZ F;  1Z21 A;  1SVM A;  3KP2 A;  4C9Y A;  4DYR A;  1ETY A;  3REO A;  2B9S A;  1MH3 A;  2X48 A;  4U0W A;  1T98 A;  4EM2 A;  2RKH A;  2L7M P;  2R7W A;  2CJJ A;  2IEK A;  2K7L A;  4WXC A;  2QLZ A;  4Q47 A;  4FE7 A;  1AHD P;  2DFH A;  3QWL A;  4RGS A;  1R1V A;  4BDZ A;  2Z99 A;  1K78 A;  2F4O B;  4KDP A;  3HGY A;  3L2V A;  1HLV A;  4A0X A;  2VT2 A;  4LD5 A;  1VQ9 I;  1S8N A;  3M1C A;  2BGC A;  3OY9 A;  2CSO A;  2DJN A;  2HTS A;  2QYO A;  3HZJ A;  4ZZD A;  1K78 B;  3L2C A;  1REP C;  1LFB A;  3DTE A;  3RKX A;  3TQN A;  5E79 C;  2CRG A;  3LOC A;  2K4B A;  3QOP A;  5ILU A;  5ILV A;  4B3X A;  2M7A A;  4A6D A;  3N97 A;  3CCQ I;  1TNS A;  2M9H A;  2ESH A;  4FX0 A;  4A3C J;  2HGC A;  4I0A A;  4NB5 A;  4ZC3 A;  1B9N A;  3SFZ A;  2DOF A;  3GCM A;  5D8K B;  2IGN A;  4E7L A;  3ML6 A;  1ZG3 A;  3CDL A;  3T1B A;  3ASN H;  1FEX A;  1SD6 A;  1HDD C;  2R7Z J;  1WPK A;  5K5O A;  3V8J A;  2DYR H;  3E97 A;  1QBJ A;  1MIJ A;  5JVT A;  2IGM A;  1W4M A;  3ZQG A;  3DU6 A;  4BH9 A;  2W85 A;  1V3F A;  2HQN A;  3EUA A;  4C2U A;  1IV6 A;  2F5C A;  1IC8 A;  3GWZ A;  4JOM A;  2WB1 N;  3HTU A;  1K7A A;  4XLF A;  5E8I A;  1S3J A;  3ZMT A;  3A2K A;  2KT0 A;  3FXK A;  3HTS B;  3WGH A;  5DDG A;  1G4D A;  1J75 A;  1XSV A;  2V26 A;  4IOC F;  4HX7 A;  1TT0 A;  2GAU A;  3MFK A;  3A03 A;  3Q3S A;  3A0B C;  2Y30 A;  1FBS A;  2HR3 A;  1MBJ A;  1NTC A;  4BKX A;  3VPR A;  2V1X A;  4U88 A;  2BV6 A;  1X19 A;  2VL8 A;  5EEH A;  2QSH X;  1P4W A;  4EJO A;  4I09 A;  4UVA A;  3DU5 A;  1QVU A;  2H27 A;  1HKT A;  5LRS A;  2DI3 A;  1DP3 A;  2LG4 A;  3WU0 A;  2IRF G;  1I3Q J;  5IYB J;  1YTY A;  1MGT A;  1FP1 D;  2DT6 A;  3JTG A;  3PSI A;  1ZRE A;  4IHV A;  4LK1 F;  2HOA A;  4CZC A;  2OJE D;  3BG5 A;  3N4M A;  2HU9 A;  1IW7 F;  2F48 A;  2RAE A;  3I64 A;  1JUP A;  5FLM J;  1APL C;  1EH6 A;  3J81 R;  4IEJ A;  2QSF X;  3G6E I;  1YJW I;  1UFM A;  4YEJ A;  3EDP A;  2Z1D A;  1SC7 A;  5H6Q A;  1RI7 A;  4CDG A;  2CWE A;  3TMO A;  1RPW A;  5K7Z A;  2YU9 J;  3RI4 A;  1D0Y A;  2STT A;  3QYF A;  2M4K A;  4ESF A;  3FK6 A;  4XLP F;  3V7C A;  1B8I A;  2WAQ A;  4BQN A;  1MMG A;  3PSF A;  4CHU A;  4LB5 A;  4H4K C;  3DEU A;  4BXF A;  2JA8 J;  3OL3 A;  3W3C A;  4D7N A;  2QF7 A;  3OYI A;  5JI6 A;  1NK3 P;  2IS6 A;  2G7U A;  5DCM A;  5CVI A;  2FF4 A;  2GZW A;  4ZZL A;  2BZT A;  1MBE A;  1G3T A;  4S04 A;  3HL2 A;  4G6Q A;  2XGC A;  3G2B A;  4UV9 A;  2Y0M A;  4EJU A;  4F3Q A;  1B8I B;  2AXT C;  2R5Z A;  2KPM A;  3CES A;  5FLX K;  5DCM B;  3GFJ A;  5KK1 A;  4F55 A;  3I56 I;  4U0Y A;  2JVH A;  3JSP A;  5GP9 A;  4IJA A;  1DPR A;  1JT6 A;  2E5N A;  1K6O A;  2VLA A;  2R5Z B;  1Z1D A;  3PM1 A;  3LSM A;  3CMM A;  1FMW A;  3MZH A;  1HCR A;  4W1U A;  3MZ8 A;  3CCJ I;  5FO5 A;  2DA6 A;  1ZAO A;  1ZAR A;  4UNO A;  2E71 A;  1VQM I;  3K70 D;  1A6Q A;  1XGO A;  2LY2 A;  4E7S A;  1D5Y A;  1P7I A;  4MHG A;  2DDA A;  4RB0 A;  1XD7 A;  2ECB A;  1VQO I;  2XGX A;  3HOY J;  2RQP A;  4L5I A;  3BG3 A;  3RCO A;  4NUB A;  2ZME A;  1YIO A;  2P8T A;  3OS0 A;  2R4G A;  3ISP A;  1R5H A;  1Z7L A;  4Q4Z F;  4I0B A;  5M5Y J;  3U9G A;  5D5V B;  2ZME B;  3R4K A;  3VSL A;  2ZO4 A;  3JR9 A;  3IC7 A;  1FIA A;  5J8C A;  4AU7 A;  3GUD A;  2F4M B;  4B48 A;  2XC7 A;  2KRH A;  4M3B A;  4NC8 A;  3ZP5 A;  1IG7 A;  2E7W A;  3VYR B;  2VXD A;  1OR7 C;  1QHH D;  2M87 A;  1QZY A;  2M4G A;  3TKY A;  3K7A J;  3FXQ A;  2E19 A;  1DGW Y;  3K4C A;  3PJR A;  2BHZ A;  4IPA A;  5IY5 H;  3KP6 A;  1G6N A;  4NNJ A;  4XNF A;  2CYY A;  4XOR A;  1I3A A;  5IOZ A;  5C4X J;  1MJB A;  2IVM A;  4RDU A;  4PJJ A;  3DPL C;  1L0O C;  5EYR A;  2LK2 A;  3PQJ A;  5FRO A;  2W25 A;  1RUN A;  3CTA A;  2ZKZ A;  3FK7 A;  3FMQ A;  2NOG A;  3F8B A;  2Y69 H;  1GHC A;  2CQK A;  1TTY A;  2LTP A;  2LYC A;  2TRT A;  4D0P A;  3KYC B;  4I02 A;  1FC3 A;  1IF1 A;  4HF1 A;  1UEL B;  5GAH J;  2A5Y B;  3K2A A;  1IN5 A;  5FB2 A;  3K69 A;  1B1B A;  4JBA A;  3H1C A;  1ENH A;  2VB6 A;  2X6Y A;  1TBX A;  1FZP B;  4II3 A;  2MVT A;  3OOU A;  3G71 I;  2LP0 A;  3KE2 A;  2EFP A;  2EWN A;  4CCM A;  5LGT A;  2R7Q A;  4L9T A;  4JX5 A;  3HOV J;  2MSY A;  5IOY A;  1I1G A;  3UR3 C;  5HS8 A;  4BE2 A;  3ZMD A;  4BY1 J;  1S7A A;  2DOD A;  2ZB9 A;  1X1P A;  1RKW A;  4IO9 F;  3NRV A;  3QP6 A;  4OIP F;  2M7B A;  1E3P A;  1GXP A;  1ZTR A;  4XID A;  3JRE A;  4DGW B;  2JPB A;  2KP6 A;  1R00 A;  1LFU P;  2KIQ A;  2CV0 A;  3RQI A;  2O61 A;  2IAI A;  1XPX A;  1BR4 A;  2L01 A;  2F5D A;  3E5Q A;  1LVK A;  3LSH A;  2DJI A;  3NAR A;  1YIT I;  1RRJ A;  2X4H A;  4QLC U;  2PI0 A;  4RB1 A;  4AIH A;  1P4A A;  5J47 A;  2H6B A;  3O6B B;  4I99 C;  2CQ7 A;  3E6C C;  3EYI A;  4U7D A;  4OOI A;  3DFG A;  3VFZ A;  2X51 A;  5TGT A;  1BW6 A;  5E3O A;  1FYM A;  4DZP A;  2QGU A;  2R7R A;  1YJN I;  5FKO A;  2VBY A;  3GME A;  4NDL A;  4YG2 F;  2VE9 A;  1ETX A;  3M8F A;  5HDK A;  4F91 B;  4GRI A;  1BI0 A;  3GFI A;  2HZD A;  4DJA A;  1PP8 F;  3FIW A;  1ZRF A;  3MN2 A;  1R4M B;  2ACJ A;  5JHF A;  3CDI A;  4AC0 A;  1O3R A;  1BW5 A;  2VIX A;  2O6G E;  5IT9 Z;  3F21 A;  3H5R A;  2VQG A;  3F0C A;  3RKY A;  4A93 J;  2XPV A;  4HF2 A;  2DA4 A;  5K7H A;  1JJ8 C;  2EA2 A;  4MEX F;  1Y8Q B;  2V1D A;  3PIO F;  2L02 A;  4A0Y A;  1Z67 A;  4M9Z A;  4PSW A;  4XOP A;  3JAM R;  3VSK A;  1HDP A;  3LSK A;  1PUF A;  4MO7 A;  1BOB A;  5L3F A;  4K2E A;  3BWG A;  4UHT A;  2V6C A;  3ECH A;  4M6V A;  2HOT A;  1O57 A;  2BY3 A;  1IGN A;  4L9V A;  3K4J A;  4M71 A;  4LG3 A;  4J01 A;  3GVA A;  2ETH A;  4C3H J;  1PUF B;  1TWA J;  1JT0 A;  1ZYR F;  3KZY A;  2FBH A;  2IS4 A;  1FOW A;  3OSF A;  3VEP A;  1KU9 A;  2HPM A;  3S1R J;  2M45 A;  3QOE A;  4UUS A;  3QYB A;  2XAJ A;  2LKS A;  3RDI A;  3FMR A;  4DZJ A;  2QM3 A;  2EV0 A;  1T0F C;  2DCE A;  1BJA A;  1JKO C;  1H9T A;  5DUK A;  2K9L A;  3S16 J;  4Q5S F;  4IHT A;  1EKE A;  4UUS B;  4E70 A;  1FIP A;  3RPQ A;  2JA5 J;  4XSZ F;  2DA3 A;  1WI9 A;  2XAH A;  3HOX J;  4QPO A;  2QQ8 A;  3DLA A;  2AXL A;  3OR1 C;  5HLH A;  2NAZ A;  2RDP A;  3BQY A;  5F08 A;  4JP0 A;  5LGU A;  1GV2 A;  5HDG A;  5K1Y A;  1VF9 A;  3Q0U A;  2UWM A;  4UB8 C;  1JHH A;  2VQL A;  2DTR A;  4E7J A;  5GAE J;  2L7Z A;  1R23 A;  3GTO J;  6PAX A;  2X1D A;  2YUS A;  4HX4 A;  3OYM A;  5CVV A;  4LOC A;  3FBN B;  1QHG A;  2WC2 A;  4I7H A;  4BE1 A;  3OWT A;  5DEQ A;  3MEX A;  1DPU A;  1XSX A;  2R7D A;  5JHU A;  3ZCO A;  2VOO A;  2IS1 A;  5B1A H;  2ISZ A;  1MMA A;  1R6R A;  2KJC A;  2IW5 A;  4AID A;  1BM9 A;  1YS7 A;  3MKL A;  4RB2 C;  4EGZ A;  3HKZ A;  4DQ2 A;  2WTE A;  5LFA A;  4KUM A;  3CUQ C;  4XIC A;  3KET A;  2XRN A;  3IH2 A;  3OIP A;  3ZN0 A;  2DMQ A;  1YHQ I;  2VOD A;  3CDH A;  5JR3 A;  3HXL A;  3PO2 J;  4V2G A;  4XBF A;  1Y1V J;  3DKX A;  3VWB A;  2BXY A;  2LRD A;  4G7O F;  3H5N A;  1CGP A;  4LIV A;  1FT9 A;  1IV8 A;  2OCC H;  3COA C;  3BR3 A;  4XL9 A;  4N0B A;  2O5R A;  2H8R A;  1TQP A;  2IS2 A;  2ID6 A;  1X4O A;  3IRR A;  3HOZ J;  2M35 A;  1JI8 A;  2HXI A;  1SD7 A;  1JGS A;  5J4Y A;  1JE8 A;  1FY7 A;  4M6Y A;  2VI6 A;  4BAY A;  1J7K A;  3HBL A;  4CA0 A;  2DYS H;  4I01 A;  3I71 A;  3S17 J;  3FDY A;  1G3W A;  4HF0 A;  1YIJ I;  5LBQ A;  1D1A A;  4AVZ A;  4E7Z A;  4AD9 A;  5A2Q R;  2WWY A;  2ADU A;  3WHB A;  2FUG 2;  1GVD A;  1S7O A;  2HVR A;  1UAA A;  1ZHF A;  3HPH A;  2NVU B;  5IP7 J;  2KKO A;  2CU7 A;  3FBI B;  4BU2 A;  2PN6 A;  3HUG B;  3BR2 A;  2XF5 A;  1ZQ3 P;  3I9V 2;  3SFI A;  2C6Y A;  4HEA 2;  4P96 A;  2H1K A;  2V1U A;  1IDZ A;  3S3M A;  2DDB A;  3DBR B;  1Z0X A;  1MKM A;  2MZ4 A;  2E36 A;  3JAM Z;  4WXH A;  5HS7 A;  3SZP A;  4IZZ A;  3JRG A;  3C2G A;  3H0D A;  2NVY J;  2JA6 J;  3JRB A;  3S93 A;  4KIC A;  2G0E A;  2OAZ A;  3ZN1 A;  1B59 A;  3K4K A;  2KMU A;  2CG4 A;  3BT9 A;  1LUJ B;  3CUO A;  1P6R A;  5E8G A;  2ZXJ A;  4OIO F;  2YX4 A;  4II2 A;  4V2F A;  5TRD A;  2JSP A;  2QKL B;  1RNL A;  1Y1W J;  1BJZ A;  4N9H A;  4CCJ A;  1X58 A;  4S0H B;  4G94 A;  2FQ3 A;  3VYS B;  1B6A A;  3P5J A;  5IT9 K;  4ABZ A;  3HGG A;  4C2M J;  4HNT A;  2LDU A;  2E1M B;  3BG7 A;  3VOD A;  2K9M A;  1QPM A;  3JSO A;  1FSE A;  2W1O A;  3TOB A;  4KT6 A;  2KHM A;  4PZJ A;  2EIK H;  2A68 F;  1JTX A;  4AYB N;  2FE3 A;  4HBL A;  3O2P E;  4OMZ A;  1MNM C;  2A69 F;  4ZYH A;  2Z2S B;  2R3S A;  3DQV C;  5C4J J;  4G8X A;  1KU3 A;  2JK3 A;  1TWG J;  3RJP A;  1S9H A;  1BI3 A;  2XSD C;  2XVC A;  2EFQ A;  3K2Z A;  1SAX A;  1EV7 A;  2KIM A;  3KYD B;  2DOA A;  1KA8 A;  5J1U A;  3CCS I;  3CZ6 A;  2UXN A;  2BVL A;  3ZRG A;  4IQJ A;  1BC7 C;  2HKO A;  1HXD A;  3BJ6 A;  1EJ9 A;  1F5T A;  1EF4 A;  2FML A;  1G2H A;  4Z6Y A;  2VC1 A;  4AIJ A;  1YO5 C;  1ONV A;  5JFR A;  1KYW A;  1PJR A;  2JRT A;  1BBY A;  3D0S A;  3LAJ A;  1VQK I;  4ZDL A;  1K4T A;  3FIS A;  1FYL A;  4OAY A;  1MMN A;  3Q0W A;  3LA3 A;  3TW7 A;  1MBG A;  5TJJ A;  2FNA A;  1UCR A;  4BXU A;  3KPH A;  2HYJ A;  2JPC A;  4L5E A;  4CSW A;  4RBO A;  3C3W A;  3QOD A;  3WTV C;  1LB2 A;  3K0L A;  2NXN B;  4YFX F;  5CKT A;  3HSE A;  2CUE A;  2KRF A;  1WJB A;  5F0H A;  2JWT A;  3OS1 A;  2X6O A;  3T5X A;  3BPV A;  1IUF A;  1YX3 A;  1X3W B;  5F27 A;  5A2Q Z;  1DGR M;  1ITY A;  1PUE E;  1XN7 A;  4Y17 A;  4RAF A;  4D7M A;  1HST A;  2RNJ A;  3WTY C;  1VQN I;  2HVQ A;  2P5V A;  2Q1Z B;  1IXC A;  3GLX A;  2CW8 A;  2ZXI A;  3UNG C;  4BQA A;  4XRM A;  1YLF A;  1U3E M;  2BHY A;  4F93 B;  3U1D A;  2KIF A;  1S5L C;  1D8J A;  3PFI A;  5EF6 A;  2P5L C;  4AM3 A;  4QIW N;  4BL0 B;  2VJI A;  4L18 B;  1GUU A;  2BE5 F;  3E7L A;  1S7E A;  2VON A;  2PEX A;  3B02 A;  2JMW A;  4FTH A;  2QSG X;  3H92 A;  3OYN A;  1OKR A;  4RGU A;  3CCR I;  2CFO A;  3OIQ A;  2O3F A;  3G1O A;  4PGG A;  3SEQ A;  3S1M J;  1OQY A;  1IO2 A;  1ZGJ A;  4Y13 A;  1LPQ A;  4M6X A;  5CVU A;  1O3Q A;  2F6C A;  2HS5 A;  2B63 J;  3W6K B;  1AWC A;  1ON2 A;  1OCZ H;  1MBF A;  2EIJ H;  2OZ6 A;  1BA5 A;  1U9N A;  4BHB A;  3F3X A;  4IHX A;  1T6S A;  3RKW A;  5EDN A;  4YIR X;  2VXZ A;  1POG A;  2HOS A;  5FJ8 J;  5C3E J;  1IN8 A;  2ZME C;  3KEY A;  3D5R C;  4IHY A;  1FMV A;  1P9Q C;  4XKV A;  4BAC A;  3L2Q A;  2Y0S N;  1T39 A;  1K79 A;  3GTM J;  3P9K A;  4FQG A;  5F1J A;  4RA2 A;  4BBS J;  3V8L A;  2DW4 A;  3ZQI A;  3I5U A;  2Y31 A;  2A61 A;  3JAM K;  3SHF A;  4WF2 A;  5GPA A;  3P9I A;  2E35 A;  5D6E A;  1YW7 A;  2MYS A;  1Z3X A;  1QZZ A;  1SFX A;  5DYM A;  4AUX A;  2QZ8 A;  2UXX A;  1V5G A;  1BR2 A;  1X3U A;  3CO6 C;  3ZMS A;  1ETQ A;  3O8H A;  1IAW A;  4PJ0 C;  3J80 Z;  3HYI A;  5BPD A;  4CCN A;  4MLO A;  2A3S A;  1SFU A;  4V19 K;  2Y9Y A;  3DP7 A;  1I6X A;  2G9W A;  2MGQ A;  1WJC A;  2L9R A;  3S1Q J;  2W48 A;  3DLL F;  4WXD A;  5E3N A;  1LDJ A;  4ASN A;  1I27 A;  3VDX A;  4I2O A;  1UG2 A;  2NVQ J;  2R0Q C;  1TW3 A;  1EH7 A;  1W1W E;  3QQA A;  1OCT C;  1RES A;  1PP7 U;  5LRR A;  3ESW B;  2JRM A;  2LF8 A;  4PGH A;  4XSX F;  4X0G A;  3HRT A;  1HA8 A;  2KFD A;  5H6R A;  5M3F J;  2EZI A;  2CW0 F;  5J4V A;  2V9V A;  1MMD A;  4NC7 A;  1VI0 A;  5J1Y A;  3ZQL A;  3S2H J;  1K83 J;  3GEZ A;  2GM4 A;  3HC7 A;  3TBI A;  2EFW A;  4DBR A;  2PJR A;  4M3F A;  3C7J A;  3OYB A;  2FRH A;  4ZYE A;  5EGO A;  2I5U A;  3FXJ A;  2NVT J;  1UB9 A;  1D3Y A;  1PVE A;  3LSP A;  2RN7 A;  4NBQ A;  2NVX J;  1RIO H;  3M7G A;  4EM0 B;  3R61 A;  4IRH A;  5DTD A;  1A5J A;  2JA7 J;  2F4I A;  1JTY A;  4RM3 A;  5FFX A;  1VTN C;  2PBI A;  1TP4 A;  3BTI A;  2YS9 A;  3KCC A;  4DYC A;  1XGS A;  5H20 A;  3RPU A;  3O8G A;  3BR5 A;  1B9M A;  3VB2 A;  2XV4 S;  3KFW X;  2A6H F;  2OQR A;  3BTJ A;  2Y2Z A;  4D1Q A;  4KIT B;  4HDU A;  4ENJ A;  1GDT A;  5LEJ A;  3OOP A;  4RLQ A;  2DMN A;  2X9D A;  3ERM A;  2OPT A;  1VQ4 I;  3CC2 I;  3MD2 A;  4HG2 A;  1J09 A;  2OA4 A;  2JJ7 A;  2PX9 A;  1XCV A;  4UUT A;  2M30 A;  1ZN2 A;  2Z9O A;  4MIM A;  4X6A J;  1BIB A;  2HNH A;  2WA0 A;  1NHA A;  3PO3 J;  3IH4 A;  2XKO A;  1IXS B;  3I53 A;  5E17 F;  1OCO H;  3F8M A;  1PDN C;  2JUG A;  5ICC A;  2IGO A;  4ZYD A;  2R92 J;  1ODD A;  3TO7 A;  2R7V A;  5LHG A;  2DLL A;  1MZB A;  5A2Q K;  2EIN H;  2XF6 A;  4ETS A;  5IT9 R;  4GO1 A;  4L0Z B;  2DK5 A;  1XMX A;  3ZQC A;  4LIT A;  4XN3 A;  3QP5 A;  3BPX A;  4QSH A;  4EJW A;  2QKM B;  1SFE A;  3H0G J;  2ME6 A;  4CO8 A;  3JRC A;  1OFC X;  1P4X A;  3LA2 A;  4G6T B;  3L1P A;  4ZDO A;  1TWC J;  3H9Q A;  1ZGA A;  3WTU C;  2ZNZ A;  2DFE A;  2FQ4 A;  2Q2E A;  2DXI A;  5JVG F;  3L2W A;  4FCY A;  2OF7 A;  2BY0 A;  3PUB A;  3G73 A;  2YU3 A;  3HOT A;  1FYK A;  1WZ2 A;  4U0V A;  1O7L A;  5HNH A;  3BR0 A;  3GZN B;  2DMT A;  4P9U A;  3Q5F A;  4MQV A;  2E1O A;  2IT0 A;  1DUX C;  2E7X A;  3K4M A;  4RLF A;  3IAM 2;  1Y0N A;  4U87 A;  5IPA A;  1VZ0 A;  5EEA A;  3OYF A;  4Y52 J;  1E2X A;  4NC6 A;  1SD4 A;  4L9J A;  4BY7 J;  5F1R A;  4HQM A;  1O3S A;  3ULQ B;  2L4M A;  5DM7 F;  3Q0V A;  2P4W A;  3WGG A;  3VYU B;  1IRF A;  3E6D A;  1EH8 A;  3H3U A;  3SXY A;  1LE8 A;  1Z91 A;  1JUM A;  3S14 J;  1Q1V A;  2XRL A;  2RGV A;  3ZPL A;  2R7U A;  4M3G A;  2AQE A;  4CH7 A;  5FKK A;  4IOA F;  3TP3 A;  4MTE A;  4HX8 A;  1U6G A;  3DKW A;  2FNP A;  3KZZ A;  1LE8 B;  3FXU A;  1LEB A;  1ZEL A;  3P7N A;  5BMZ A;  5IYD J;  3K6G A;  5HLI A;  1ETV A;  2D1H A;  1TQM A;  2QUF A;  1MSE C;  2HQA A;  2PMZ N;  1SAU A;  1R1U A;  2CMP A;  2OTJ I;  4I76 A;  2DTZ A;  3PFY A;  4JYK A;  4BBR J;  1H8A C;  2LKP A;  5CVR A;  2CV1 A;  1F1Z A;  3GTP J;  3BTC A;  1XMK A;  3MWM A;  5H2F C;  2F5E A;  3FKJ A;  3K1N A;  2W84 A;  2EZL A;  3J80 K;  1LEA A;  4A3I J;  3WE2 A;  2E1C A;  1FNN A;  2IP2 A;  5FFZ A;  2FD5 A;  1Q1H A;  2XB0 X;  1W7P A;  4IX7 A;  2CQQ A;  1HKS A;  2Q0O A;  3DPU A;  5BPI A;  1N78 A;  3W2A A;  1T8I A;  4IL6 C;  4B3A A;  1MJ9 A;  2JN6 A;  4HW0 A;  3BRO A;  3DXJ F;  1IN6 A;  1WWX A;  3IV5 A;  2R7F A;  2LRE A;  3I0T A;  4DBQ A;  3ZQ7 A;  2CUJ A;  4IQ4 A;  4J00 A;  4RAG A;  1BC8 C;  1YE9 A;  3F23 A;  4EMS A;  3S8P A;  2WV1 A;  2AS5 F;  1FLI A;  5GAD J;  4CCL A;  4TV7 A;  3IL2 A;  4BQO A;  3SDG A;  3FM5 A;  4PJL A;  2MC3 A;  1PYV A;  2R7S A;  3I59 A;  2DT7 B;  3TW6 A;  5CYV A;  2EZH A;  2GWR A;  5D5U B;  2R7X A;  1JHF A;  3EET A;  1DP7 P;  2WB1 A;  2LH9 A;  5L3D A;  3WU2 C;  2VT3 A;  4B8X A;  1Y0U A;  2ID3 A;  1HOM A;  3I59 B;  2OZU A;  2ELH A;  4EAT A;  2X98 A;  2ZJP F;  4BJ5 C;  5HOO A;  5LGN A;  1E17 A;  5ED4 A;  2O7O A;  4A3D J;  1F9N A;  2HEO A;  3GFM A;  5CVJ A;  3RTR A;  1ZG5 A;  4CGZ A;  3DCF A;  4RAY A;  1YI2 I;  2AHQ A;  4O3M A;  1E0E A;  3K1M A;  3SEZ A;  1ZLJ A;  2W24 A;  4ENN A;  1W5C C;  2VJ5 A;  3KEO A;  2K27 A;  3KLO A;  2HI3 A;  1LDD A;  3SZT A;  3S3N A;  1LFP A;  2J5P A;  1YS6 A;  4S05 A;  2KQR A;  2ZBK A;  1MH4 A;  4FE4 A;  2GXB A;  1NG7 A;  4D5F A;  1I6H J;  2H8W A;  2HZT A;  3H35 A;  2PMU A;  5J3L A;  2XPU A;  5AON A;  3BR6 A;  2R93 J;  5E1Z B;  3PQK A;  3MKW B;  1U5T A;  1MSF C;  2L9S A;  1ZG1 A;  2IA0 A;  2VQC A;  3WU1 B;  5EZG A;  1LVA A;  3OYH A;  1U2W A;  3FM3 A;  1UG0 A;  1IRX A;  1VND A;  2K86 A;  2M5W A;  3FXO A;  1OCC H;  2E1M C;  1WJA A;  4X1E A;  4CUG A;  1K4S A;  3OS2 A;  2OU2 A;  2A05 A;  4I98 B;  3QPL A;  4RS8 A;  1UZC A;  4EJV A;  4XKW A;  2E34 A;  2LVS A;  1YW9 A;  2FA5 A;  5BQT A;  3S2D J;  1LDK B;  4A5M A;  4M9S A;  4HSR A;  3JTH A;  1TL8 A;  3IWF A;  2VJJ A;  4HRI A;  2OQG A;  3CD6 I;  4E7I A;  3C18 A;  2DOE A;  3WTS C;  2EH3 A;  5D8L B;  3ZMZ A;  3FHZ A;  4OMY A;  2VJ4 A;  1GVJ A;  2V79 A;  1R22 A;  3V7R A;  3ZGK A;  3DPT A;  5JLX A;  3S15 J;  4DW6 A;  5B3S H;  1EA3 A;  2MUN A;  2UUZ A;  3JW4 A;  2VBX A;  1TLH B;  1R1T A;  2P5K A;  2K40 A;  2FMY A;  3EUH A;  1W36 C;  2W82 A;  3K1P A;  1HBX G;  1TWH J;  2IPQ X;  1ACI A;  2XAQ A;  2HVS A;  1XC5 A;  4L5J A;  5FLV A;  3JCU C;  2ESN A;  3SZG A;  2P6S A;  2XAS A;  1VFC A;  1ERD A;  4XRF A;  2CUZ A;  3B6A A;  3FXM A;  5LHH A;  2VC0 A;  3HOU J;  3FHN A;  2KDZ A;  4GXO A;  3DEW A;  2CQN A;  1WKM A;  4LLL A;  1IDY A;  2FBI A;  3BOQ A;  1D0X A;  2GBY A;  5HNF A;  2Z5U A;  1S29 A;  2A5W A;  3ROU A;  5FD6 A;  1I1S A;  2L7K A;  2V1N A;  2ZC2 A;  2HOE A;  1YQA A;  3RZO J;  1UHS A;  4ITV A;  1ETK A;  5E1X A;  4DIQ A;  1AOY A;  1UHM A;  4LK0 F;  1FBU A;  1Z77 A;  3AL0 C;  3DWL E;  2MW8 A;  3LSG A;  2MH9 A;  4G12 A;  1FTT A;  1X1A A;  4YFK F;  2NS8 A;  4F52 A;  3ASO H;  2JUC A;  4YFN F;  3WTT C;  2LSO A;  4C30 A;  2TDX A;  1IN4 A;  3Q9S A;  5E1W A;  2NNN A;  4P5O A;  3GF2 A;  3F8F A;  3I4P A;  4C2T A;  1XS9 A;  2MD5 A;  3LWF A;  5KAI C;  1H9G A;  3JRD A;  2K3P A;  2CS3 A;  3NWT A;  5LEK A;  2A07 F;  4B09 A;  4A3E J;  2D2W A;  3V7S A;  1FOK A;  1XCB A;  1NG6 A;  3QPT A;  4A5N A;  1V54 H;  3HDD A;  1RUO A;  1UJ8 A;  2Q8K A;  2L3D A;  2UV1 A;  4CZZ A;  2D5V A;  2DA1 A;  5ICG A;  2UZK A;  3BDD A;  2IXS A;  3MVP A;  1YG2 A;  3VYT B;  2QCO A;  2VOP A;  3G4S I;  2HQ5 A;  1ZLK A;  4NHJ A;  1IRZ A;  1MJA A;  2IBD A;  1F4K A;  1JJ6 C;  3FKI J;  1R49 A;  5D5W B;  4PDK A;  3F8C A;  3E1S A;  1G3S A;  4ANJ A;  1YFH A;  1HC8 A;  3CMA I;  1XX5 A;  1J9I A;  3L00 A;  2VBZ A;  2STW A;  1E3O C;  3KEQ A;  4XK4 A;  3OYL A;  1BOA A;  1V55 H;  4E7H A;  3CLQ A;  1J2X A;  1V5E A;  1WH7 A;  5JLW A;  3CF5 F;  2QWW A;  5AIQ A;  3R0A A;  5CQG A;  2LR8 A;  3HB9 A;  3LQQ A;  3OIO A;  3TP0 A;  2O8X A;  3HOW J;  5TIS C;  1A36 A;  1KU2 A;  3L2R A;  1FX7 A;  3M9A A;  4P9F A;  2EJR A;  3RZD J;  2M0C A;  2H94 A;  4W97 A;  4LG0 A;  3WE3 A;  4BJ6 C;  4IHW A;  5K5Q A;  4HQE A;  1FPQ A;  1IXR C;  1D1B A;  5F04 A;  2EV5 A;  2VKD A;  2R7O A;  3HHH A;  4EEF G;  4HV5 A;  3ELK A;  1O4X A;  1MBH A;  1D1C A;  3S2W A;  4N9I A;  2COB A;  1RQ6 A;  4LG0 B;  1OYW A;  3LMM A;  1XG1 A;  2CO5 A;  4HOB A;  2PQ8 A;  2QBY A;  4Y3O A;  1FOX A;  4PUS A;  1KQ0 A;  3RIR A;  3LQR A;  2RNG A;  2NYX A;  3ZQH A;  1A31 A;  3CLO A;  3R6S A;  2Y48 A;  2CFX A;  3WTW C;  1JKP C;  2W7N A;  3TDZ C;  3PUF A;  4Y33 A;  4CCO A;  5BOX A;  2XSJ C;  1QVT A;  1W5T A;  2WAQ N;  2JA2 A;  1LJ9 A;  2KZV A;  2QBY B;  2O0Y A;  5D4R A;  2XB5 A;  4LMY A;  3J80 R;  5HDN A;  5E18 F;  3Q9V A;  3B73 A;  4GYG A;  4PFP A;  4RMN A;  2MLK A;  2YSR A;  3CJT B;  3M1E A;  4A3F J;  2GLO A;  3GO5 A;  1Y6I A;  2ZFW A;  3DKY A;  1QU3 A;  2H09 A;  5D4S A;  4IRI A;  2FSW A;  3GTQ J;  3FWE A;  5GPC A;  1OCR H;  3D1N I;  1KON A;  5K5R A;  2P0T A;  4KFC A;  4B1R A;  4KJZ A;  3QU3 A;  4MEY F;  2OV7 A;  3CCU I;  2L9N A;  4YII A;  2YR2 A;  3GXO A;  5ILS A;  4EVI A;  2DPD A;  1ZRD A;  2F5F A;  4U7B A;  4F92 B;  2CGP A;  1AU7 A;  4A3M J;  1W0U A;  4JK1 X;  1I50 J;  3CJN A;  2W4S A;  3MCZ A;  2XHK A;  1RET A;  3B6C A;  3QU6 A;  3JRF A;  1QNT A;  3X2Q H;  2DA2 A;  3LSI A;  1SEU A;  3W6V A;  5F6F A;  4DOZ A;  3ZXS A;  2DN0 A;  2RV8 A;  3HIF A;  4IHS A;  1WQ2 A;  2RRE A;  3ZMU A;  1VQ5 I;  1WJD A;  1Z6R A;  4RAZ A;  1TWF J;  4LFU A;  4ZTF A;  4QWQ A;  2L4A A;  2L0K A;  3E0J B;  2ZJ2 A;  1FBQ A;  4KIF A;  3AL0 B;  1STZ A;  4XRS G;  3AG1 H;  2AO9 A;  2IA1 A;  3BCA A;  3O3K A;  4HV6 A;  4DNC A;  3W2V A;  5J8F A;  3ERE D;  3H9G A;  2LY9 A;  3CCE I;  5CPR B;  4KMU X;  2JVG A;  2WAD A;  4R8H A;  1BIA A;  1SFK A;  1UST A;  2GA1 A;  2H6C A;  1AKH A;  2QEX I;  4JX6 A;  1XB4 A;  4A3J J;  4DYQ A;  4E6K G;  1MDM A;  2VBW A;  2WY8 Q;  1RKT A;  2MLG A;  1Z05 A;  3WTZ A;  3VOE A;  3AG2 H;  2E5Z A;  3OYC A;  4XLA A;  5F0F A;  1JKR C;  3R60 A;  1AKH B;  2GXG A;  4MTD A;  2PLY A;  2A6E F;  4G7H F;  1MDM B;  2ZSH B;  4MNU A;  2Z3Y A;  5KAF C;  4CYC A;  3D5L A;  4UXN A;  2XUB A;  1SMY F;  2V9K A;  3E5U A;  2EBI A;  3GTJ J;  3ZQF A;  4HDV A;  2MAB A;  1KQ9 A;  2QA4 I;  1ZK8 A;  2ISY A;  1F36 A;  4CYC B;  2L54 A;  4EV0 A;  4BGD A;  3BG6 A;  2ELK A;  5DV5 A;  4BJT A;  3A4C A;  3CJQ B;  4N4N B;  1WJ5 A;  1YRN A;  3IH3 A;  1JUS A;  1A6I A;  3IAS 2;  4C3I J;  2LBF A;  5EG0 A;  3QPS A;  1VQL I;  2DK8 A;  1GLN A;  5HS9 A;  3T8R A;  3EPZ A;  5FKL A;  2VN2 A;  4Z2Y A;  1YRN B;  3PL8 A;  4P1W A;  1D8K A;  4LGW A;  3T8T A;  2M0M A;  3CQZ J;  1SFO J;  1X3Z B;  2K3F A;  2LBF B;  2OBP A;  3OYG A;  4OIQ F;  5EG0 B;  4AWX B;  2LKX A;  3BJO A;  2VE8 A;  3DTK A;  1SMT A;  3A52 A;  4JX4 A;  3M07 A;  4A3K J;  4PFO A;  3M3Y J;  3FX3 A;  4HAM A;  2K9Q A;  3M8E A;  3F22 A;  1FWZ A;  2VPL A;  2E1N A;  2XDV A;  2DFI A;  3ZMV A;  1W36 D;  4BNC A;  5E20 A;  3HRM A;  2GOX B;  1H0M A;  3C2H A;  4EJT A;  2HWV A;  5E3L A;  4FAS D;  1ZKG A;  4BQQ A;  2PG4 A;  4FIS A;  2W57 A;  3I58 A;  1N75 A;  2FJ1 A;  3J7A O;  4HNV A;  3V8K A;  3N05 A;  5M5X J;  1TQI A;  1WGX A;  2HPI A;  2KRC A;  1R36 A;  2ZFU A;  3H9J A;  5KNL A;  1OMI A;  4ON0 A;  5GTH C;  3T0Y A;  4PJN A;  2YX7 A;  3HOS A;  4M72 A;  1FTZ A;  3V42 A;  3MKZ A;  4YIF A;  1QPI A;  1ZGW A;  4ZJZ A;  3FMS A;  4XQF A;  2LNB A;  3DBL B;  3LSR A;  3CC7 I;  4QTR A;  1ON1 A;  4D9J A;  3F6V A;  2EFO A;  4GCV A;  1QGP A;  4HLX A;  1WSU A;  9ANT A;  2PJR B;  3A02 A;  5L3G A;  3HRS A;  1OYI A;  2LY1 A;  5EGO B;  4AIK A;  2ELJ A;  3V4G A;  3R0J A;  2OC6 A;  2GA2 A;  4XON A;  3RSN A;  3CCL I;  1NH3 A;  2P81 A;  4KMF A;  2BXZ A;  3S1N J;  4ESJ A;  3QRF F;  1IZ1 A;  3KYL A;  2BY2 A;  1BL0 A;  2HQR A;  2ZSI B;  4A0Z A;  1OIS A;  1USS A;  2CH0 A;  3GFL A;  1CQT A;  1Z7U A;  1KQ8 A;  4FET A;  5M3M J;  4HZF A;  2P0W A;  2VKH A;  2TCT A;  4AYB A;  4Y15 A;  1X2M A;  3SYT A;  2FX0 A;  3LSJ A;  1Z3Y A;  3GBG A;  3KP7 A;  4XRS A;  1WRJ A;  4MFE A;  4A3G J;  2COM A;  2OUM A;  4PK4 A;  4KYW A;  1VQP I;  2VKV A;  4ENK A;  5FRM A;  4L9N A;  3BQZ A;  4B47 A;  1LNW A;  3F9K A;  2ME0 A;  2CQX A;  2DA5 A;  4KIG A;  3MAJ A;  3OL4 A;  2X6X A;  1MBK A;  1T08 B;  1YJ9 I;  4KNY A;  5ICE A;  4WX9 A;  1T2K A;  4L0Y B;  2LC2 A;  4G6D A;  3I55 I;  3E3V A;  2PJP A;  5DS9 A;  1TC3 C;  4ESB A;  4OWR B;  1R9T J;  4A6E A;  1O3T A;  3OMY A;  4OAZ A;  2MG4 A;  4BUP A;  3F8N A;  2CUF A;  1ORK A;  1B4A A;  3JRI A;  1U78 A;  5HLT A;  1U5T C;  2MA3 A;  5HOD A;  2BOL A;  2YPR A;  4RM2 A;  2AQF A;  3QYE A;  2L5Q A;  3SJM A;  3CCY A;  2QEN A;  4WCG A;  2K5C A;  2M2E A;  3IKT A;  3IWZ A;  1R58 A;  5DD4 A;  3CME I;  5M5W J;  4MGR A;  3HKZ N;  1GV5 A;  4R1H A;  2P7C B;  3AFH A;  2XAU A;  3TDU C;  2EFN A;  1VQ6 I;  2QQB A;  3KZI C;  1RR7 A;  2ZXW H;  3BR1 A;  2Q2E B;  4KN4 X;  1GXQ A;  1ZR4 A;  2V9P A;  2P6T A;  5FKM A;  4EGY A;  3J7A W;  4ENM A;  3HM5 A;  1T56 A;  1L3L A;  2F2E A;  1R71 A;  2QVO A;  3WG9 A;  1BI1 A;  1KU7 A;  2BYV E;  2JSC A;  3WTX C;  1HKQ A;  2V7F A;  4IRG A;  2HDC A;  4PCQ A;  3ZOB A;  3WG7 H;  4Q48 A;  2DO7 A;  4RB3 C;  4LLN A;  3WHC A;  3MMY B;  3H5A A;  1HW5 A;  3TO9 A;  1JXS A;  1TW2 A;  1XDS A;  1S6L A;  2OD5 A;  3HPG A;  2X1E A;  3S32 A;  4ZH4 F;  5IYC J;  2NNY A;  4KA4 A;  5L3E A;  4ZTJ A;  3EUH C;  4LIU A;  4BHP A;  2EA4 A;  4G9Y A;  2HDW A;  5KCM A;  1I39 A;  5GAG J;  1KZH A;  1YOV B;  2QQA A;  2L9V A;  1LKX A;  1DDN A;  3FXR A;  1YX5 A;  4FT8 A;  5ICF A;  1JKQ C;  4BS9 A;  1Y56 A;  2XKP A;  5DCF A;  5GTI C;  2E60 A;  3BG9 A;  5AIP A;  4CCK A;  3RPU D;  3LFK A;  3SDB A;  1WJE A;  3I4M J;  1G59 A;  2BY1 A;  1MMS A;  1DU6 A;  3UKG A;  3L09 A;  1IRG A;  4D5C A;  1KYZ A;  3KIO A;  1HW2 A;  1XMA A;  2VKE A;  2M8G X;  1W7P B;  4XKB A;  1U9O A;  3GX4 X;  1WVR A;  4M9X A;  2WBM A;  2Y0S A;  1AA7 A;  2PMH A;  1FJL A;  3KP3 A;  2NS0 A;  3G1M A;  1MD0 A;  3LFU A;  2WAE A;  3BC8 A;  3BZ6 A;  3A1Y A;  4HLY A;  2JZY A;  2JT1 A;  3J81 Z;  2WAF A;  4Y7N J;  3D5S C;  4HST A;  2F5V A;  5BNG A;  1Z9C A;  2DBB A;  1P2F A;  3M4O J;  1R4N B;  3L7W A;  3I4N J;  3HRU A;  4MFD A;  1A35 A;  1WHU A;  2DQR A;  3FZV A;  4O6J A;  1B72 A;  2R5Y A;  3G3Z A;  4LLG F;  1XDU A;  3ECO A;  3ONQ A;  4KIB A;  4UVB A;  2ZNY A;  3MKY B;  2DPU A;  1HSJ A;  2V4J C;  4XMY A;  4R79 A;  4LB6 B;  2X85 A;  4E7K A;  2CW7 A;  3PIP F;  2XIG A;  4XLC A;  1P92 A;  1B72 B;  3GW2 A;  2R5Y B;  5DD8 A;  3RQ4 A;  2ZJQ F;  3E6B A;  2EV6 A;  1U8R A;  5B66 C;  3K4N A;  2GOM A;  3W6J B;  3LL7 A;  3DBH B;  2HTJ A;  2P7V B;  3H3Z A;  3K4B A;  4IVN A;  3GZ6 A;  3S3O A;  4CIC A;  3JRH A;  3PNT A;  4N4O B;  1OYY A;  3J7Y J;  2QQ9 A;  1QO0 D;  3ABM H;  4YEL A;  1JGG A;  3CCM I;  2HYG D;  2IJL A;  1VQ7 I;  4BXX J;  1MNE A;  1T33 A;  1U0J A;  1HF0 A;  1BR1 A;  3EQL F;  4FHT A;  4XOT A;  1ULY A;  2WV0 A;  2RVC A;  3HSF A;  2LF7 A;  3LAP A;  4A69 C;  3KX2 A;  3NQO A;  3TL4 X;  2VAS A;  4I6Z A;  1ZR2 A;  1FP2 A;  1X1D A;  2ZXH A;  3ABT A;  2H1L A;  4OIN F;  1V5F A;  2ZJR F;  1RC9 A;  2FBK A;  2KDO A;  2KZG A;  1YYV A;  1U5T B;  2DAO A;  1QZE A;  4YRV A;  2O9L A;  3I54 A;  3GYH X;  4B44 A;  1Y39 A;  3WOD F;  5J40 A;  2DMP A;  4NQW A;  2NOJ B;  4B4C A;  5K7F A;  2MC4 A;  5F64 A;  4C3J J;  2FOK A;  3F72 A;  3CMY A;  3BP8 A;  4XR6 A;  2KIU A;  3PNV A;  1WFX A;  2DFF A;  3CO7 C;  4B43 A;  1DQU A;  1R5I D;  3G1L A;  2Z33 A;  4FX4 A;  2LD5 A;  5L3B A;  4GDF A;  4NQW B;  3RYR A;  3MQ0 A;  2X0L A;  3EYY A;  2XAF A;  2FOW A;  2EK5 A;  3BCB A;  2DT5 A;  3AKZ A;  3OYJ A;  1SVO A;  2GXA A;  3A0H C;  2BBY A;  2Y75 A;  2RC4 A;  3U1K A;  2EQR A;  1QRY A;  3IP4 B;  1FOY A;  2KL4 A;  3CCV I;  4BEH A;  4J19 A;  3TGN A;  1RZ4 A;  2OCE A;  5ERI A;  1OR7 A;  4M3D A;  4A3B J;  1ETW A;  3AG3 H;  2HXO A;  5D6F A;  2K9N A;  3HEF A;  4PJM A;  2IGK A;  1WI3 A;  2W00 A;  1IUY A;  3RKQ A;  1W7P D;  1R5G A;  4BEH B;  5HVQ C;  3OYE A;  1J5Y A;  1WJF A;  4GFB A;  3U21 A;  4QPQ A;  2Z16 A;  2MBF A;  1W0T A;  2BVM A;  1BN5 A;  5FGM A;  1MND A;  1T95 A;  2EIM H;  1H88 C;  2K4J A;  1HQC A;  1SD5 A;  1CF7 A;  3P9C A;  3LA7 A;  3BY6 A;  3C1D A;  3J7Z I;  3HG9 A;  2CV2 A;  1Y8R B;  4ZDP A;  1OJL A;  2EPF A;  2M8E A;  2K02 A;  2XAG A;  3OYA A;  4M73 A;  1OCP A;  2HKX A;  2M1B A;  3LST A;  3QPH A;  4CXF A;  2GQQ A;  3K9T A;  2JTV A;  4IXA A;  3L2U A;  3E5X A;  1CF7 B;  4F7Z A;  3NAU A;  1U8B A;  4UY8 I;  2L7F P;  3SQN A;  2ECC A;  2JQ7 A;  2VPR A;  3L9F A;  2XPW A;  2BW3 A;  1G3Y A;  5HLG A;  1N77 A;  1OLT A;  3GZ5 A;  3HJE A;  2O8K A;  1WCM J;  4H0E A;  1RR8 C;  2HDD A;  1Z6T A;  3K4L A;  1F43 A;  5DM6 F;  4JQF A;  2FEZ A;  4CYD A;  3HHG A;  5KVR A;  3HSR A;  2BW3 B;  3A01 A;  2D1V A;  5F0C A;  5FKN A;  2I8D A;  4ZYA A;  3H36 A;  2LMD A;  3ABU A;  4P55 A;  2N8G A;  2XF7 A;  5B5E C;  1TT5 B;  2HFH A;  1E3H A;  4IKF A;  5FLX R;  2A6T A;  3A01 B;  3OYK A;  3ZQQ A;  3TO6 A;  2K85 A;  1YW8 A;  5FD5 A;  4XLN F;  1G8X A;  3IUO A;  2XGE A;  2M34 A;  3F6O A;  1J59 A;  4KN7 X;  2FU4 A;  2B7E A;  4GGG A;  1T38 A;  1XSD A;  4XLH A;  3KLN A;  3ABK H;  2WY7 Q;  2X1C A;  1K61 A;  2GIV A;  2MD0 A;  3HUG A;  4HYE A;  3J81 K;  2GIZ A;  3IKV A;  3AG4 H;  2NRA C;  4OIR F;  2BEO A;  4XKC A;  2OTL I;  2PMZ A;  2ZCW A;  4A2U A;  1X1C A;  3OYD A;  4A3L J;  1D5V A;  1O7F A;  1DU0 A;  3KP4 A; 
#chains in the Genus database with same CATH homology
 3IHU A;  2J5O A;  5EEG A;  1OPC A;  3OV8 A;  4BYY A;  3KP5 A;  1W5S A;  4IF4 A;  2EB7 A;  5BS6 A;  1ZRC A;  5LHI A;  3RYP A;  4UUV A;  3DV8 A;  2DU9 A;  2O03 A;  4RGX A;  4EM1 A;  5D5X B;  3FF5 A;  5CJ9 A;  5IT3 A;  2G7H A;  4G7Z F;  2PFB A;  1LQ1 A;  1FSH A;  5J6X A;  5DUI A;  1A04 A;  2MH2 A;  3MZY A;  1T0F A;  4RGR A;  3NEU A;  2HYF A;  1XGN A;  3E6M A;  2D45 A;  1ZH5 A;  3DF8 A;  2XRO A;  5CLS A;  1BI2 A;  1R7J A;  2IA2 A;  5L3C A;  4AVP A;  3U2R A;  4WK8 F;  3IRQ A;  4WWC A;  4KT5 C;  4UV8 A;  1HW1 A;  3AAF A;  4UVC A;  4ZYG A;  2FXA A;  4O5V A;  2KJB A;  1UHW A;  4GYI A;  4HA8 A;  1QQI A;  3WGI A;  1XGM A;  1J0R A;  4EQQ A;  3CUQ A;  4MQ9 F;  4M74 A;  1I5Z A;  2DQL A;  1C0W A;  1KGS A;  5FLX Z;  3CUQ B;  3QAH A;  1TNT A;  1IN7 A;  4BHC A;  4A12 A;  3TOA A;  2B0L A;  4OU0 A;  1V4R A;  5LLQ A;  3BJA A;  4LJZ F;  3KP2 A;  3REO A;  4U0W A;  1T98 A;  4EM2 A;  2RKH A;  2K7L A;  4WXC A;  2QLZ A;  4Q47 A;  4RGS A;  1R1V A;  1K78 A;  2Z99 A;  4KDP A;  4A0X A;  2VT2 A;  4LD5 A;  1S8N A;  2BGC A;  2CSO A;  2HTS A;  2QYO A;  1K78 B;  4ZZD A;  3L2C A;  1REP C;  3RKX A;  3TQN A;  2K4B A;  3QOP A;  5ILU A;  5ILV A;  4A6D A;  3N97 A;  1TNS A;  2ESH A;  4FX0 A;  2HGC A;  4I0A A;  4NB5 A;  1B9N A;  3SFZ A;  5D8K B;  3ML6 A;  1ZG3 A;  3T1B A;  1SD6 A;  5K5O A;  3V8J A;  3E97 A;  1QBJ A;  5JVT A;  1W4M A;  4BH9 A;  2W85 A;  1V3F A;  2HQN A;  2F5C A;  3GWZ A;  3HTU A;  1K7A A;  5E8I A;  1S3J A;  3ZMT A;  3HTS B;  3WGH A;  5DDG A;  1G4D A;  1J75 A;  1XSV A;  4HX7 A;  2GAU A;  3MFK A;  1FBS A;  2HR3 A;  2V1X A;  4U88 A;  2BV6 A;  5EEH A;  1P4W A;  4EJO A;  4I09 A;  4UVA A;  2H27 A;  1HKT A;  5LRS A;  2DI3 A;  3WU0 A;  2IRF G;  1YTY A;  1MGT A;  1FP1 D;  3JTG A;  1ZRE A;  4LK1 F;  3N4M A;  1IW7 F;  3I64 A;  1EH6 A;  1UFM A;  3EDP A;  5H6Q A;  1RI7 A;  4CDG A;  2CWE A;  3RI4 A;  2STT A;  4XLP F;  4ESF A;  3V7C A;  4CHU A;  4LB5 A;  3DEU A;  5JI6 A;  2G7U A;  5DCM A;  5CVI A;  2FF4 A;  2GZW A;  4ZZL A;  1G3T A;  4S04 A;  4G6Q A;  4EJU A;  4UV9 A;  2Y0M A;  5FLX K;  5DCM B;  3GFJ A;  5KK1 A;  4U0Y A;  3JSP A;  4IJA A;  1DPR A;  1K6O A;  1Z1D A;  3MZH A;  5FO5 A;  1ZAO A;  1ZAR A;  4UNO A;  1XGO A;  4MHG A;  4RB0 A;  1XD7 A;  2XGX A;  2RQP A;  4L5I A;  2ZME A;  1YIO A;  2P8T A;  3ISP A;  1R5H A;  4Q4Z F;  4I0B A;  3U9G A;  5D5V B;  2ZME B;  3R4K A;  2ZO4 A;  3IC7 A;  5J8C A;  3GUD A;  3ZP5 A;  2E7W A;  2M87 A;  1QZY A;  3TKY A;  3FXQ A;  4IPA A;  3KP6 A;  1G6N A;  2CYY A;  1MJB A;  2IVM A;  3DPL C;  1L0O C;  3PQJ A;  1RUN A;  2W25 A;  3CTA A;  2ZKZ A;  3FMQ A;  3F8B A;  1GHC A;  2CQK A;  1TTY A;  4D0P A;  4I02 A;  1FC3 A;  1IF1 A;  4HF1 A;  2A5Y B;  1IN5 A;  5FB2 A;  3K69 A;  1B1B A;  4JBA A;  1TBX A;  1FZP B;  3KE2 A;  2EFP A;  2EWN A;  5LGT A;  4L9T A;  1I1G A;  5HS8 A;  3ZMD A;  1S7A A;  3NRV A;  3QP6 A;  4OIP F;  1GXP A;  2JPB A;  1R00 A;  2O61 A;  2L01 A;  2F5D A;  3E5Q A;  2PI0 A;  2X4H A;  4QLC U;  4RB1 A;  4AIH A;  1P4A A;  2H6B A;  3O6B B;  3E6C C;  3EYI A;  4U7D A;  4OOI A;  3DFG A;  3VFZ A;  1FYM A;  2VBY A;  2VE9 A;  4YG2 F;  3M8F A;  5HDK A;  1BI0 A;  3GFI A;  1PP8 F;  1ZRF A;  2ACJ A;  1O3R A;  2O6G E;  5IT9 Z;  3F21 A;  3RKY A;  4HF2 A;  2EA2 A;  4MEX F;  2V1D A;  2L02 A;  4A0Y A;  4M9Z A;  5L3F A;  4K2E A;  3BWG A;  4UHT A;  2V6C A;  3ECH A;  1O57 A;  4L9V A;  4M71 A;  3GVA A;  2ETH A;  1ZYR F;  3KZY A;  2FBH A;  3VEP A;  1KU9 A;  2M45 A;  2XAJ A;  3RDI A;  3FMR A;  2QM3 A;  2EV0 A;  1BJA A;  1H9T A;  5DUK A;  4Q5S F;  4IHT A;  4E70 A;  3RPQ A;  4XSZ F;  1WI9 A;  2XAH A;  2AXL A;  5HLH A;  2NAZ A;  2RDP A;  5LGU A;  5K1Y A;  5HDG A;  2UWM A;  1JHH A;  2DTR A;  1R23 A;  6PAX A;  4HX4 A;  5CVV A;  2WC2 A;  4I7H A;  1DPU A;  5DEQ A;  3MEX A;  1XSX A;  2R7D A;  5JHU A;  2VOO A;  2ISZ A;  2KJC A;  2IW5 A;  1BM9 A;  1YS7 A;  4RB2 C;  4EGZ A;  4DQ2 A;  2WTE A;  4KUM A;  3CUQ C;  3KET A;  2XRN A;  3ZN0 A;  2VOD A;  3CDH A;  5JR3 A;  4XBF A;  4G7O F;  1CGP A;  1FT9 A;  3COA C;  4N0B A;  1TQP A;  3IRR A;  1SD7 A;  1JGS A;  1JE8 A;  1FY7 A;  4M6Y A;  4BAY A;  1J7K A;  4I01 A;  3I71 A;  1G3W A;  4HF0 A;  5LBQ A;  4AD9 A;  2WWY A;  2ADU A;  1S7O A;  1ZHF A;  2KKO A;  2PN6 A;  2C6Y A;  4P96 A;  2V1U A;  1MKM A;  3JAM Z;  4WXH A;  5HS7 A;  3SZP A;  4KIC A;  2OAZ A;  3ZN1 A;  1B59 A;  2CG4 A;  3CUO A;  1P6R A;  5E8G A;  2ZXJ A;  4OIO F;  2YX4 A;  5TRD A;  1RNL A;  4N9H A;  4G94 A;  2FQ3 A;  1B6A A;  5IT9 K;  2LDU A;  3VOD A;  1QPM A;  3JSO A;  1FSE A;  3TOB A;  4PZJ A;  2A68 F;  2FE3 A;  4HBL A;  3O2P E;  4OMZ A;  2A69 F;  4ZYH A;  2R3S A;  3DQV C;  4G8X A;  1KU3 A;  3RJP A;  1BI3 A;  2XVC A;  2EFQ A;  3K2Z A;  1SAX A;  1EV7 A;  2KIM A;  1KA8 A;  2UXN A;  1BC7 C;  2HKO A;  1HXD A;  3BJ6 A;  1F5T A;  2FML A;  2VC1 A;  4AIJ A;  1YO5 C;  1ONV A;  5JFR A;  1KYW A;  3D0S A;  2JRT A;  1BBY A;  3LAJ A;  1FYL A;  3LA3 A;  5TJJ A;  2FNA A;  1UCR A;  4BXU A;  2JPC A;  3C3W A;  3WTV C;  1LB2 A;  3K0L A;  4YFX F;  3HSE A;  2KRF A;  3T5X A;  3BPV A;  5A2Q Z;  1PUE E;  1XN7 A;  4Y17 A;  1HST A;  2RNJ A;  3WTY C;  3GLX A;  2P5V A;  1IXC A;  4BQA A;  1YLF A;  1U3E M;  3U1D A;  2KIF A;  1D8J A;  3PFI A;  2P5L C;  4L18 B;  2BE5 F;  2VON A;  2PEX A;  3B02 A;  3H92 A;  1OKR A;  4RGU A;  2O3F A;  4PGG A;  1ZGJ A;  4Y13 A;  4M6X A;  5CVU A;  1O3Q A;  2HS5 A;  3W6K B;  1AWC A;  1ON2 A;  2OZ6 A;  4BHB A;  3F3X A;  1T6S A;  3RKW A;  2VXZ A;  1IN8 A;  1T39 A;  1K79 A;  3P9K A;  3V8L A;  2DW4 A;  3I5U A;  3JAM K;  2A61 A;  3SHF A;  4WF2 A;  3P9I A;  5D6E A;  1YW7 A;  1QZZ A;  1SFX A;  5DYM A;  2QZ8 A;  2UXX A;  1X3U A;  3CO6 C;  3ZMS A;  1IAW A;  3J80 Z;  3HYI A;  5BPD A;  2A3S A;  1SFU A;  3DP7 A;  1I6X A;  2G9W A;  4WXD A;  1LDJ A;  4ASN A;  1I27 A;  4I2O A;  1TW3 A;  1EH7 A;  1PP7 U;  5LRR A;  2LF8 A;  4PGH A;  4XSX F;  3HRT A;  5H6R A;  2CW0 F;  2V9V A;  3GEZ A;  2EFW A;  3C7J A;  2FRH A;  4ZYE A;  1UB9 A;  1D3Y A;  2RN7 A;  1RIO H;  3M7G A;  4EM0 B;  3R61 A;  4IRH A;  5FFX A;  1VTN C;  2PBI A;  3KCC A;  1XGS A;  3RPU A;  5H20 A;  1B9M A;  3VB2 A;  2XV4 S;  3KFW X;  2A6H F;  2OQR A;  4HDU A;  4ENJ A;  5LEJ A;  3OOP A;  2OA4 A;  1XCV A;  2M30 A;  1ZN2 A;  2Z9O A;  1BIB A;  1NHA A;  2XKO A;  1IXS B;  3I53 A;  5E17 F;  3F8M A;  1PDN C;  5ICC A;  4ZYD A;  3TO7 A;  1ODD A;  5LHG A;  2DLL A;  1MZB A;  5A2Q K;  4ETS A;  4GO1 A;  4L0Z B;  2DK5 A;  3QP5 A;  3BPX A;  4EJW A;  1SFE A;  4CO8 A;  1P4X A;  3LA2 A;  3WTU C;  1ZGA A;  2ZNZ A;  2Q2E A;  3G73 A;  2YU3 A;  3HOT A;  1FYK A;  4U0V A;  1O7L A;  4P9U A;  3Q5F A;  4MQV A;  2IT0 A;  1DUX C;  2E7X A;  1E2X A;  1SD4 A;  4L9J A;  5F1R A;  4HQM A;  1O3S A;  3ULQ B;  2L4M A;  2P4W A;  3WGG A;  1IRF A;  3E6D A;  1EH8 A;  3H3U A;  3SXY A;  1Z91 A;  2RGV A;  3ZPL A;  4MTE A;  4HX8 A;  1U6G A;  3DKW A;  2FNP A;  3KZZ A;  3FXU A;  1LEB A;  3P7N A;  5BMZ A;  5HLI A;  2D1H A;  1TQM A;  2QUF A;  1R1U A;  2LKP A;  5CVR A;  1F1Z A;  1XMK A;  3MWM A;  3J80 K;  2F5E A;  3K1N A;  2E1C A;  2W84 A;  1LEA A;  3WE2 A;  1FNN A;  2IP2 A;  5FFZ A;  1Q1H A;  1W7P A;  1HKS A;  2Q0O A;  5BPI A;  1MJ9 A;  4HW0 A;  3BRO A;  3DXJ F;  1IN6 A;  1WWX A;  2R7F A;  3I0T A;  3ZQ7 A;  1BC8 C;  3F23 A;  4EMS A;  2AS5 F;  1FLI A;  4TV7 A;  3IL2 A;  3FM5 A;  2MC3 A;  3I59 A;  5CYV A;  2GWR A;  5D5U B;  1JHF A;  3EET A;  1DP7 P;  5L3D A;  2VT3 A;  4B8X A;  1Y0U A;  3I59 B;  2OZU A;  2ELH A;  5HOO A;  5LGN A;  1E17 A;  5ED4 A;  1F9N A;  2HEO A;  3GFM A;  5CVJ A;  3RTR A;  1ZG5 A;  4CGZ A;  4RAY A;  4O3M A;  3K1M A;  1ZLJ A;  2W24 A;  4ENN A;  3KEO A;  3KLO A;  2K27 A;  1LDD A;  3SZT A;  2J5P A;  1YS6 A;  4S05 A;  2ZBK A;  2GXB A;  2HZT A;  2PMU A;  5AON A;  5E1Z B;  3PQK A;  1U5T A;  1ZG1 A;  2IA0 A;  3WU1 B;  1LVA A;  1U2W A;  3FM3 A;  2K86 A;  2M5W A;  2OU2 A;  4I98 B;  4RS8 A;  4EJV A;  1YW9 A;  2FA5 A;  5BQT A;  1LDK B;  4A5M A;  4M9S A;  3JTH A;  3IWF A;  2OQG A;  3C18 A;  3WTS C;  3FHZ A;  5D8L B;  3ZMZ A;  4OMY A;  1GVJ A;  2V79 A;  1R22 A;  3V7R A;  3DPT A;  3JW4 A;  2VBX A;  1TLH B;  1R1T A;  2P5K A;  2FMY A;  3EUH A;  3K1P A;  1HBX G;  2IPQ X;  2XAQ A;  4L5J A;  2ESN A;  2P6S A;  2XAS A;  4XRF A;  5LHH A;  2VC0 A;  4GXO A;  1WKM A;  4LLL A;  2FBI A;  3BOQ A;  2Z5U A;  1S29 A;  3ROU A;  5FD6 A;  1I1S A;  2HOE A;  1YQA A;  5E1X A;  1AOY A;  1UHM A;  4LK0 F;  1FBU A;  2MH9 A;  4YFK F;  4YFN F;  3WTT C;  2LSO A;  2TDX A;  1IN4 A;  3Q9S A;  5E1W A;  2NNN A;  4P5O A;  3GF2 A;  3F8F A;  3I4P A;  2MD5 A;  3LWF A;  1H9G A;  2A07 F;  5LEK A;  4B09 A;  2D2W A;  3V7S A;  1FOK A;  1XCB A;  3QPT A;  4A5N A;  1RUO A;  2Q8K A;  2L3D A;  4CZZ A;  5ICG A;  2UZK A;  3BDD A;  1YG2 A;  2VOP A;  1ZLK A;  4NHJ A;  1MJA A;  1F4K A;  5D5W B;  4PDK A;  3F8C A;  1G3S A;  1YFH A;  1J9I A;  3L00 A;  2VBZ A;  2STW A;  3KEQ A;  1BOA A;  1J2X A;  2QWW A;  5AIQ A;  3R0A A;  3LQQ A;  2O8X A;  1KU2 A;  1FX7 A;  3M9A A;  4P9F A;  2EJR A;  3WE3 A;  2H94 A;  4LG0 A;  5K5Q A;  4HQE A;  1FPQ A;  1IXR C;  2EV5 A;  3HHH A;  4HV5 A;  3ELK A;  3S2W A;  4N9I A;  4LG0 B;  1OYW A;  2CO5 A;  4HOB A;  2PQ8 A;  2QBY A;  3RIR A;  1KQ0 A;  3LQR A;  2NYX A;  3CLO A;  3R6S A;  2Y48 A;  2CFX A;  3WTW C;  3TDZ C;  5BOX A;  2QBY B;  1W5T A;  1LJ9 A;  2O0Y A;  5D4R A;  4LMY A;  5HDN A;  5E18 F;  3Q9V A;  3B73 A;  4GYG A;  2MLK A;  2YSR A;  3M1E A;  3GO5 A;  2ZFW A;  2H09 A;  5D4S A;  4IRI A;  2FSW A;  3FWE A;  5K5R A;  4KFC A;  3QU3 A;  4MEY F;  4YII A;  2YR2 A;  3GXO A;  5ILS A;  4EVI A;  2DPD A;  1ZRD A;  2F5F A;  4U7B A;  2CGP A;  4JK1 X;  3CJN A;  3MCZ A;  2XHK A;  3QU6 A;  1QNT A;  5F6F A;  2RV8 A;  3HIF A;  4IHS A;  1WQ2 A;  3ZMU A;  1Z6R A;  4RAZ A;  4LFU A;  4QWQ A;  2L4A A;  2ZJ2 A;  1FBQ A;  4KIF A;  1STZ A;  2IA1 A;  3O3K A;  4HV6 A;  4DNC A;  3ERE D;  5J8F A;  4KMU X;  4R8H A;  1BIA A;  1UST A;  2GA1 A;  2H6C A;  1XB4 A;  1MDM A;  2VBW A;  2MLG A;  1Z05 A;  3WTZ A;  3VOE A;  3R60 A;  2GXG A;  4MTD A;  2PLY A;  2A6E F;  4G7H F;  1MDM B;  4MNU A;  2Z3Y A;  3D5L A;  4UXN A;  2XUB A;  1SMY F;  3E5U A;  4HDV A;  1KQ9 A;  2ISY A;  2L54 A;  4EV0 A;  5DV5 A;  2DK8 A;  5HS9 A;  3T8R A;  2VN2 A;  4Z2Y A;  1D8K A;  4LGW A;  3T8T A;  2OBP A;  4OIQ F;  4AWX B;  3BJO A;  2VE8 A;  1SMT A;  3FX3 A;  4HAM A;  3F22 A;  3M8E A;  1FWZ A;  2E1N A;  2DFI A;  3ZMV A;  4BNC A;  5E20 A;  3HRM A;  1H0M A;  4EJT A;  2HWV A;  2PG4 A;  2W57 A;  3I58 A;  3J7A O;  3V8K A;  1TQI A;  1R36 A;  1OMI A;  4ON0 A;  3T0Y A;  2YX7 A;  3HOS A;  4M72 A;  4YIF A;  3FMS A;  2LNB A;  1ON1 A;  3F6V A;  2EFO A;  4GCV A;  1QGP A;  4HLX A;  1WSU A;  5L3G A;  3HRS A;  1OYI A;  4AIK A;  3V4G A;  3R0J A;  2GA2 A;  4KMF A;  4ESJ A;  3QRF F;  1IZ1 A;  2HQR A;  4A0Z A;  1USS A;  3GFL A;  1KQ8 A;  1Z7U A;  4HZF A;  4Y15 A;  3KP7 A;  1WRJ A;  2COM A;  4KYW A;  4ENK A;  4L9N A;  1LNW A;  4KIG A;  3MAJ A;  4KNY A;  5ICE A;  4WX9 A;  1T2K A;  4L0Y B;  4G6D A;  3E3V A;  2PJP A;  4ESB A;  4A6E A;  1O3T A;  3F8N A;  1B4A A;  1U78 A;  1U5T C;  2MA3 A;  2YPR A;  2QEN A;  4WCG A;  3IKT A;  3IWZ A;  1R58 A;  5DD4 A;  4MGR A;  4R1H A;  2P7C B;  3TDU C;  2EFN A;  2QQB A;  4KN4 X;  1GXQ A;  2P6T A;  4EGY A;  4ENM A;  1L3L A;  2F2E A;  2QVO A;  3WG9 A;  1BI1 A;  1KU7 A;  2BYV E;  2JSC A;  3WTX C;  1HKQ A;  4IRG A;  2HDC A;  4PCQ A;  4Q48 A;  2DO7 A;  4RB3 C;  4LLN A;  3TO9 A;  1HW5 A;  1JXS A;  1TW2 A;  1XDS A;  1S6L A;  2OD5 A;  4ZH4 F;  2NNY A;  4KA4 A;  5L3E A;  4BHP A;  2EA4 A;  4G9Y A;  2QQA A;  1DDN A;  3FXR A;  4FT8 A;  5ICF A;  2XKP A;  5DCF A;  5AIP A;  3LFK A;  3L09 A;  1IRG A;  1KYZ A;  1HW2 A;  1XMA A;  1W7P B;  3GX4 X;  4M9X A;  2PMH A;  3KP3 A;  2NS0 A;  1MD0 A;  3BZ6 A;  4HLY A;  2JZY A;  2JT1 A;  3J81 Z;  1Z9C A;  2DBB A;  1P2F A;  3L7W A;  3HRU A;  3FZV A;  2DQR A;  4O6J A;  3G3Z A;  4LLG F;  1XDU A;  3ECO A;  4UVB A;  4KIB A;  2DPU A;  2ZNY A;  1HSJ A;  4R79 A;  4LB6 B;  2XIG A;  1P92 A;  3GW2 A;  5DD8 A;  3E6B A;  2EV6 A;  1U8R A;  3W6J B;  2HTJ A;  2P7V B;  3H3Z A;  4IVN A;  3GZ6 A;  4CIC A;  1OYY A;  2QQ9 A;  1QO0 D;  2HYG D;  2IJL A;  3EQL F;  4FHT A;  1ULY A;  2WV0 A;  2RVC A;  3HSF A;  2LF7 A;  3LAP A;  3NQO A;  1FP2 A;  3ABT A;  4OIN F;  2FBK A;  1YYV A;  1U5T B;  2DAO A;  3I54 A;  3GYH X;  3WOD F;  4NQW A;  5F64 A;  2FOK A;  3F72 A;  3BP8 A;  2KIU A;  3CO7 C;  4FX4 A;  2Z33 A;  5L3B A;  3RYR A;  3MQ0 A;  2X0L A;  3EYY A;  2XAF A;  2EK5 A;  2DT5 A;  2BBY A;  2Y75 A;  2RC4 A;  3TGN A;  1RZ4 A;  5ERI A;  1OR7 A;  5D6F A;  1IUY A;  1W7P D;  1R5G A;  5HVQ C;  1J5Y A;  2MBF A;  1BN5 A;  5FGM A;  2K4J A;  1HQC A;  1SD5 A;  1CF7 A;  3P9C A;  3LA7 A;  3BY6 A;  3C1D A;  2M8E A;  2K02 A;  2XAG A;  4M73 A;  2HKX A;  2M1B A;  3LST A;  3QPH A;  4CXF A;  2GQQ A;  3K9T A;  2JTV A;  4IXA A;  3E5X A;  1CF7 B;  4F7Z A;  3SQN A;  5HLG A;  3L9F A;  1G3Y A;  3GZ5 A;  4H0E A;  1Z6T A;  4JQF A;  2FEZ A;  4CYD A;  3HHG A;  5KVR A;  3HSR A;  2D1V A;  3ABU A;  4P55 A;  2HFH A;  3TO6 A;  1YW8 A;  5FD5 A;  4XLN F;  3F6O A;  1J59 A;  4KN7 X;  2FU4 A;  4GGG A;  1T38 A;  1XSD A;  3KLN A;  2GIV A;  3HUG A;  4HYE A;  3J81 K;  3IKV A;  2NRA C;  4OIR F;  2BEO A;  2ZCW A;  4A2U A;  1D5V A;  1O7F A;  3KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...