1ON2A

Bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
135
structure length
135
Chain Sequence
b'TTPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structure of the Manganese-Bound Manganese Transport Regulator of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 49
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1on2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1on2A02
3CJNA 4KN7X 2FMLA 4HZFA 4PGGA 4LB5A 1TW2A 1FBUA 2VODA 2XVCA 3T5XA 3J80Z 3OOPA 2Q2EA 4KIGA 2HTJA 1IN4A 1UB9A 2GXBA 4UHTA 1STZA 4FX0A 1P4WA 1SFEA 4CICA 2HFHA 4U88A 4RS8A 1UFMA 3FZVA 5FFZA 2IT0A 1BBYA 3SQNA 1XCVA 2VBZA 1K7AA 1O57A 3KLOA 3I5UA 2BE5F 3CUOA 3KCCA 1J75A 1Z91A 2ISZA 4YIIA 4GYIA 2M5WA 3H3UA 2V1DA 1SMTA 4HOBA 3CUQA 4EVIA 2A6EF 4S05A 2DT5A 3KFWX 1FWZA 3JTGA 1BIAA 1MGTA 3HYIA 1GXPA 3F8MA 5FO5A 3T8RA 4N9IA 3ZP5A 4MHGA 5FD5A 4EJUA 5ERIA 5D6FA 3FMRA 3P9CA 2YSRA 2R7DA 5FD6A 1S29A 2NAZA 1QZYA 2F5FA 4RGRA 1J7KA 2R3SA 2XKOA 2O03A 4ZH4F 2M30A 3CTAA 1LEBA 4EM0B 3GUDA 4AVPA 3M8EA 4ZYEA 3BWGA 3E97A 1FBQA 5E1ZB 4A0YA 3FHZA 1RZ4A 5FFXA 2DK5A 4WX9A 2UZKA 3V4GA 3HRMA 2XRNA 3WU0A 2XROA 2LKPA 1V4RA 2VN2A 2ZFWA 5H20A 4RAYA 2A68F 1EH7A 3F23A 4KT5C 2H27A 1FP1D 3ZMSA 4MQ9F 1ZH5A 2XAFA 4EJTA 3IKTA 3FF5A 1E2XA 3V8LA 2X4HA 3E5XA 3KP4A 4I01A 3KEQA 1B59A 4G7HF 4Q4ZF 1IRGA 1W5SA 1OKRA 5L3BA 3V8JA 5F1RA 1KU3A 1KQ0A 1ZLJA 1XGNA 1QGPA 4HX8A 3C7JA 3K1PA 1JHFA 1QQIA 3HRSA 2VONA 5ICFA 4L9NA 3ULQB 1ZAOA 2EJRA 1XDUA 3EYIA 4HDUA 4GCVA 4TV7A 4UV8A 3TOBA 2K4JA 2HYFA 4YFNF 2YX4A 2HTSA 2OBPA 2QVOA 2HYGD 1O3QA 5ICGA 1XDSA 4KUMA 4AWXB 3SZPA 2KJBA 3Q9SA 1SD4A 1XSXA 3GFMA 3TDUC 3SFZA 1KU9A 3KEOA 2MD5A 4DQ2A 3MZYA 4RB0A 1DUXC 4A5MA 2CGPA 2XV4S 2GQQA 1YTYA 1S7AA 2FBKA 2DQRA 3LA3A 4AIKA 1JE8A 1KQ8A 2NYXA 4R1HA 4CZZA 1FSEA 4R8HA 4A5NA 1TBXA 1JGSA 3MEXA 1MDMA 1JHHA 4RGSA 5DCMA 1MJAA 4G94A 3QU3A 2DTRA 2M8EA 4IXAA 4EM1A 2CFXA 3LSTA 4YFKF 3VB2A 4I2OA 1H9GA 3V7SA 3K9TA 4HBLA 3E6BA 5E18F 1I27A 1D3YA 4M6YA 4LLLA 4EGYA 3DFGA 3ZQ7A 2H6CA 3RPUA 1BC8C 1HQCA 4IRGA 2MBFA 2CYYA 3B02A 2Q8KA 2NNYA 1XSDA 2P7CB 2P6TA 3RKWA 2GIVA 1FC3A 2CG4A 4L9JA 1DPRA 5HDKA 2HEOA 5D4SA 2ZCWA 4WK8F 1T98A 4BH9A 4L5IA 3O3KA 2FA5A 3GWZA 3HSRA 3MFKA 2STTA 4BNCA 2GAUA 5LBQA 2YR2A 2F5EA 3MCZA 3GZ6A 1H9TA 2L4MA 5D5VB 1XN7A 1KGSA 3I53A 2ELHA 1G3SA 2VT3A 3TGNA 3WG9A 2JT1A 1W5TA 2NRAC 1F9NA 1ZN2A 1FLIA 2UXXA 1Y0UA 2OU2A 3WTZA 2BV6A 4LLNA 2FXAA 1BOAA 2FBHA 2PEXA 3GFLA 5BPDA 4RB3C 5LRRA 1TNTA 1HBXG 4UUVA 3I0TA 4U7DA 1J9IA 1SD6A 1K79A 4ETSA 2Z9OA 5BS6A 2CQKA 3H92A 4KIFA 2W24A 3E3VA 5ILUA 3GO5A 3U2RA 5ED4A 4HF0A 3QPTA 2FNPA 2KKOA 4HYEA 3RKXA 5BPIA 1IXSB 1LDKB 5HOOA 2JRTA 4Y17A 5LGNA 1ZGAA 3N4MA 5LGTA 1LEAA 5BMZA 3VOEA 1TLHB 4HA8A 1FX7A 2V1XA 2D1HA 3K69A 3WTTC 3CO7C 1MD0A 3ROUA 1F1ZA 2A6HF 1U3EM 4ENKA 1LJ9A 1ZGJA 3TO7A 3I4PA 2RGVA 1IF1A 2RV8A 4NQWA 1YO5C 3ZPLA 1IN8A 2BEOA 3I54A 2P5LC 1TNSA 1LDDA 1J59A 3BJ6A 3EETA 1BI0A 2PBIA 3WGGA 1BIBA 4A0XA 1L3LA 2COMA 1VTNC 3RIRA 3BY6A 3K1NA 4ZYDA 1UCRA 3R61A 3FMSA 1XMAA 4HX7A 1QBJA 2RC4A 1XGOA 4KMFA 2OZ6A 2P5VA 4MEYF 2DO7A 1D8JA 3T0YA 3DPLC 2E1CA 2RDPA 2EFWA 4I09A 2DAOA 1FY7A 3P7NA 2V6CA 2ADUA 1G3TA 1WWXA 1ZHFA 2XAHA 1USSA 2D45A 1T38A 3ISPA 2RNJA 3VODA 3DQVC 1CF7A 2P6SA 2VC1A 1F4KA 4L0ZB 2JTVA 5D6EA 2CSOA 2O3FA 1R23A 2IPQX 3F6OA 4HX4A 1WI9A 4B8XA 1KYWA 2XIGA 3FM5A 2EFOA 1BI3A 4N0BA 5CVIA 3WGHA 4ZYHA 5D5XB 1PP7U 3EYYA 2DI3A 2MH9A 2G7UA 2ACJA 1I1GA 1ULYA 2EV6A 4OMZA 5FLXZ 2VXZA 3I59A 1E17A 1R00A 3CUQB 4EM2A 1HXDA 4ENMA 3IKVA 2DPDA 4RB2C 1SD5A 1IXRC 2XAJA 4U0YA 2JPBA 5D8KB 3IWFA 4A12A 2RKHA 5A2QZ 3E5QA 2ZMEA 4MTDA 4LK1F 3G3ZA 1CGPA 4FT8A 1YQAA 4A6DA 1HW1A 2IJLA 2VE8A 1ON2A 4IF4A 1UHMA 2ZBKA 3ABTA 3BZ6A 4S04A 1MJ9A 5K5OA 2Y48A 1ZYRF 4M6XA 1SMYF 3LWFA 1YS6A 2MA3A 2FU4A 3MWMA 4M9ZA 3JAMK 1OMIA 4HF1A 1IN7A 1AOYA 3WE3A 3TOAA 1XGMA 5CJ9A 1QPMA 1RUNA 2OQRA 2DW4A 2VBWA 2ZJ2A 5JI6A 4Q5SF 5HS7A 2V1UA 4L9VA 4YG2F 3E6DA 1TQPA 2BGCA 5JR3A 2E1NA 5AIPA 5L3GA 1O7FA 4OIRF 2KIFA 1NHAA 1HKSA 1XMKA 4XBFA 5LEKA 4OINF 3TO9A 2QM3A 1EV7A 1T6SA 3FXQA 3L09A 3ZMZA 5HLGA 3R0JA 3QP5A 2F5DA 1O3RA 4CO8A 2YPRA 2OAZA 1ZG3A 3RJPA 2RQPA 1XD7A 2CW0F 2FEZA 1FBSA 2HQRA 5LEJA 5CVUA 4YFXF 4WXCA 3HRTA 4PDKA 1PP8F 4KA4A 4IJAA 4CHUA 3O6BB 3LAPA 3REOA 1U2WA 1S3JA 3BDDA 3HIFA 2HDCA 1HKTA 4BQAA 3KETA 2H6BA 1FSHA 1U5TC 5HDNA 2G9WA 5EEGA 3U9GA 1FYLA 1FOKA 1R5GA 3LFKA 1OR7A 1EH8A 2K27A 4BHBA 1SFUA 5IT9Z 3D5LA 1Z1DA 4D0PA 1MJBA 2BBYA 2PFBA 5H6RA 4P9UA 4RGUA 2XHKA 1WKMA 3EUHA 1R1TA 1B6AA 1G6NA 3F72A 3DF8A 3BOQA 2GA2A 1K6OA 5F64A 2FF4A 1Z9CA 1R36A 4Z2YA 2R7FA 1U8RA 2VBYA 4BHPA 2PMUA 1Z05A 3G73A 4A2UA 1R22A 1O7LA 5JVTA 1IW7F 5TRDA 1KQ9A 4ESFA 3COAC 4EJOA 4RAZA 1LQ1A 1IUYA 2IA1A 2V9VA 1GHCA 1MDMB 3KP3A 4M74A 2DLLA 4PGHA 2A69F 4HAMA 5DCMB 4KDPA 1D8KA 3V8KA 4L18B 1RNLA 3HSFA 3P9IA 1QNTA 3DKWA 1I1SA 3S2WA 2L4AA 5E17F 3KP7A 2O0YA 4KIBA 3PQJA 3E6MA 4ESBA 1Z6TA 2GZWA 1R1VA 1ZG1A 2W84A 1C0WA 5ICCA 4MNUA 3WODF 4U0WA 2IRFG 4EMSA 3K2ZA 4UVBA 4EJVA 5DCFA 3HUGA 2JSCA 1FPQA 1FT9A 1FZPB 4AD9A 1TQIA 2E7XA 2LNBA 2VE9A 3N97A 3SXYA 4FX4A 4LG0B 3KZZA 3MZHA 3J81Z 2QQ9A 4K2EA 3OV8A 3WTUC 2Z3YA 4I0BA 4LG0A 2Y0MA 3QPHA 1U78A 3F8NA 3M7GA 1BC7C 4NB5A 2IP2A 5KVRA 4L0YB 1REPC 2K4BA 2VC0A 3EQLF 2J5PA 2V79A 3WTYC 2PJPA 4L5JA 1YLFA 2ZKZA 1KU2A 3HHHA 3NQOA 4ENJA 2QZ8A 3F21A 1TQMA 2XAGA 5FB2A 3ECOA 2KJCA 4EQQA 1P2FA 2QBYA 2DFIA 4O6JA 1GXQA 3BJOA 3E6CC 2FMYA 3C18A 5H6QA 2GA1A 4P9FA 3BP8A 1BI1A 3GF2A 3QU6A 3QRFF 3WU1B 4HLYA 4LMYA 5CYVA 4HW0A 2E7WA 5J8FA 2HQNA 3JSOA 1MZBA 3KP5A 2K86A 2HWVA 3O2PE 2WV0A 4KFCA 5E8GA 1YW8A 2EFNA 3RYPA 4CXFA 2Q0OA 2P4WA 3IWZA 2UXNA 4HLXA 2OD5A 1FNNA 1T0FA 3FXRA 4EGZA 4A0ZA 4WCGA 3HTSB 3ZMTA 1HKQA 4BHCA 5L3CA 3BJAA 5TJJA 1LNWA 4P5OA 4ASNA 4MGRA 2KIUA 4UNOA 5LRSA 4RB1A 1J2XA 5E1WA 2PMHA 5HVQC 2L01A 2FE3A 2RVCA 3U1DA 4OIQF 1IRFA 3MQ0A 2DU9A 4MTEA 3RPQA 2ESHA 4XLPF 5CVVA 2EV0A 4XSXF 4GXOA 4WXHA 5AONA 1KU7A 2J5OA 1A04A 4LD5A 4Q47A 2QQAA 2IVMA 2BYVE 2UWMA 4O3MA 2VT2A 1BM9A 1WRJA 4KMUX 3JTHA 2OZUA 3H3ZA 1LVAA 1ONVA 3L9FA 3AAFA 2L02A 4KICA 2FNAA 5ILVA 1ZARA 3R0AA 2FRHA 4ZZDA 1V3FA 5LHHA 3W6KB 3VEPA 5DV5A 3ELKA 3C3WA 3F8CA 3L2CA 3KP2A 3SHFA 1CF7B 1KA8A 4Q48A 1O3SA 2D2WA 3FMQA 3ECHA 2DQLA 1G3WA 1SAXA 5DD4A 5E8IA 3QAHA 5D5UB 3JSPA 3FWEA 3K0LA 2PQ8A 3RKYA 4AIHA 4M72A 2XUBA 1SD7A 4AIJA 2QENA 1Z7UA 3DEUA 3HOTA 4YIFA 1KYZA 1W4MA 3EDPA 4MQVA 1HW5A 1O3TA 4I98B 4WXDA 3I59B 3F8BA 2TDXA 4P55A 2GWRA 2EFQA 3V7CA 3DXJF 3ZMVA 2C6YA 4XRFA 1USTA 1HW2A 2QLZA 3F3XA 4UXNA 2P5KA 3WTWC 1I6XA 2EV5A 3D0SA 3ZMDA 4ENNA 2FOKA 2ZMEB 2EFPA 1T2KA 1XSVA 5K5QA 1ZRDA 1DPUA 2M87A 4KNYA 4QWQA 4LK0F 2ZO4A 4GYGA 5L3FA 3RTRA 5J8CA 3PFIA 1PDNC 3IRRA 4G6DA 3TDZC 2L3DA 1YG2A 3P9KA 1L0OC 3I64A 1J0RA 3R4KA 1D5VA 3FX3A 1JXSA 3I58A 4JQFA 1ON1A 4OOIA 3GFJA 1P4XA 5HLHA 3CDHA 2H09A 2H94A 6PAXA 3ERED 5DUKA 4IRIA 3BPXA 4RGXA 1XB4A 1IN6A 4UVAA 4A6EA 3C1DA 5D8LB 3TKYA 2IA2A 1I5ZA 3SZTA 2B0LA 3ZMUA 1QO0D 1B4AA 1XCBA 2JPCA 1UHWA 3RDIA 3GLXA 4LLGF 1YS7A 2VOPA 3Q5FA 5HS8A 1R7JA 5CVRA 3FM3A 3HOSA 5K5RA 3PQKA 3J7AO 1W7PB 4FHTA 5CLSA 4EV0A 2PN6A 5LHIA 1HSTA 3R60A 1LDJA 1S6LA 4UV9A 3DP7A 3FXUA 1W7PA 2IW5A 1ZREA 3KLNA 3E5UA 4PCQA 1YYVA 3LQRA 1IXCA 2CWEA 5HDGA 2MLGA 2WTEA 3GYHX 1IZ1A 1DDNA 2PLYA 4F7ZA 1PUEE 2O6GE 5L3DA 1B9NA 2MH2A 5LHGA 5K1YA 3GW2A 4KN4X 5E1XA 2GXGA 3W6JB 4M9SA 3IHUA 1LB2A 4N9HA 2XKPA 3KP6A 3BPVA 4HV6A 2P7VB 1P6RA 3M9AA 5DUIA 1WSUA 2DPUA 3ML6A 2MC3A 5ILSA 4G9YA 2ZXJA 1FYKA 4L9TA 4IVNA 5FGMA 3IC7A 5DYMA 3IL2A 2XGXA 1ZG5A 2LF7A 2W57A 3LQQA 5DD8A 1IN5A 4NHJA 4BYYA 3F22A 1OYWA 2Y75A 1B1BA 2ETHA 4ZZLA 2O8XA 1ZRCA 3BROA 1YW9A 4I02A 4JBAA 4PZJA 1QZZA 3J80K 2HKXA 2HKOA 3TO6A 3Q9VA 1GVJA 5EEHA 2A07F 1YFHA 3T1BA 4CYDA 3GVAA 5FLXK 4HF2A 3WTXC 3RI4A 1ZLKA 5LGUA 4HV5A 1BI2A 2K02A 3M1EA 2ZNZA 3IRQA 4HQMA 1R58A 1G4DA 2QUFA 2KRFA 5A2QK 1SFXA 4CDGA 2CO5A 1W7PD 4EJWA 2A61A 3KZYA 1OPCA 2HS5A 1OYYA 4GO1A 1RUOA 5KK1A 5HLIA 2WWYA 4IRHA 1XGSA 3RYRA 1WQ2A 4OIPF 2LF8A 2W25A 2A3SA 2W85A 4MEXF 3NRVA 3ZN0A 2K7LA 2EK5A 3QOPA 3WTSC 3CUQC 2QBYB 3LA7A 1J5YA 4IHSA 3F8FA 4U0VA 2F2EA 3CO6C 4Y15A 2O61A 4G8XA 4ZYGA 1BN5A 1YW7A 5AIQA 1P92A 3GZ5A 3GX4X 5J6XA 3M8FA 4M9XA 5IT3A 5BOXA 3WTVC 2HOEA 4G6QA 2QYOA 4I0AA 2QWWA 2A5YB 4ON0A 2YX7A 4B09A 4QLCU 2EB7A 5D5WB 2EA2A 5LLQA 2D1VA 2EA4A 2IA0A 1TTYA 2RN7A 2QQBA 1RI7A 1X3UA 4JK1X 3TQNA 1IAWA 2DK8A 2LSOA 5F6FA 3CLOA 1FYMA 4M71A 4OIOF 4HQEA 2Z33A 4HDVA 3LA2A 3GEZA 4WWCA 4OMYA 1ZRFA 2HR3A 2JZYA 3K1MA 3KE2A 1S8NA 3JW4A 3HHGA 3T8TA 2NNNA 1TW3A 3QP6A 4GGGA 2Z5UA 4LJZF 2HZTA 4KYWA 4OU0A 1EH6A 3HTUA 5ICEA 4XLNF 3L7WA 5L3EA 4H0EA 5E20A 3V7RA 1YIOA 3JAMZ 2STWA 4BAYA 2XAQA 1OYIA 4P96A 2LDUA 5IT9K 4O5VA 4CGZA 3L00A 3WGIA 2YU3A 2P8TA 1T39A 4M73A 1H0MA 3R6SA 2MLKA 2M45A 2G7HA 1ODDA 2Z99A 2NS0A 4ESJA 3F6VA 4UVCA 1U5TB 5JHUA 2VOOA 2X0LA 4LGWA 5DDGA 1Z6RA 2VBXA 1RIOH 1U5TA 2M1BA 3LAJA 2FQ3A 1AWCA 2DBBA 3B73A 2OA4A 3DV8A 2ISYA 4XSZF 3HSEA 4U7BA 3VFZA 5HS9A 4E70A 4G7ZF 1HSJA 2ESNA 2XASA 4R79A 1R5HA 5BQTA 2FSWA 2WC2A 4IHTA 4LFUA 1R1UA 3DPTA 1P4AA 2HGCA 1Q1HA 2PI0A 5CVJA 2ZNYA 3HRUA 2L54A 1F5TA 3ABUA 2FBIA 1S7OA 3NEUA 1BJAA 4LB6B 4IPAA 3I71A 3GFIA 4BXUA 5D4RA 3J81K 2EWNA 2PG4A 4Y13A 1DP7P 3MAJA 2KIMA 3WE2A 1K78B 1MKMA 1B9MA 3ZN1A 3GXOA 4I7HA 2OQGA 4WF2A 4DNCA 1U6GA 5DEQA 1G3YA 5JFRA 1FP2A 2F5CA 2AS5F 1K78A 2AXLA 4G7OF
chains in the Genus database with same CATH superfamily
2DOAA 3HM5A 3CJNA 4KN7X 4C3HJ 2E1OA 2FMLA 2L9RA 3DPUA 3ZQIA 4HZFA 3MN2A 3A0HC 4PGGA 4LB5A 2EZHA 3S17J 1TW2A 1FBUA 2CS3A 2I8DA 2VODA 3UKGA 1LVKA 4DZPA 5FKMA 2XVCA 2JJ7A 3T5XA 3J80Z 3OOPA 1RKTA 3JAMR 2Q2EA 4KIGA 3S2HJ 2HTJA 1IN4A 1UB9A 2GXBA 4UHTA 1STZA 4FX0A 3OIQA 1P4WA 1SFEA 9ANTA 1MMDA 4CICA 2HFHA 4U88A 3W2AA 2LKXA 4RS8A 1UFMA 3FZVA 5FFZA 2IT0A 1FEXA 3DKXA 1YJWI 1BR2A 3RSNA 5M5WJ 1BBYA 1RESA 2F4OB 3SQNA 1MSEC 4NDLA 1XCVA 4N4OB 1X4OA 1WGXA 2VBZA 2HVQA 1K7AA 1O57A 3KLOA 3I5UA 2BE5F 3CUOA 3F9KA 3KCCA 1J75A 2JRMA 2DA6A 3PFYA 1Z91A 3BG3A 2ISZA 1YJ9I 4YIIA 4GYIA 1PYVA 4I76A 3CC7I 2M5WA 2QSFX 3OYGA 2XPWA 3H3UA 2KRHA 2V1DA 1SMTA 4HOBA 3CUQA 4A3EJ 4EVIA 2A6EF 4S05A 3PUFA 2DT5A 2Y0SA 4XORA 3GTPJ 3KFWX 1FWZA 3JTGA 1BIAA 2H1LA 1MGTA 3HYIA 1RRJA 1GXPA 3F8MA 3G1OA 5FO5A 2ME6A 3T8RA 4N9IA 3ZP5A 2JA7J 4MHGA 1Q1VA 5FD5A 4EJUA 2PX9A 1K4TA 3CQZJ 1P7IA 5ERIA 5D6FA 3FMRA 5EG0B 2UV1A 5HNHA 3QOEA 2VI6A 2ZJPF 4E7HA 5F08A 5HNFA 3P9CA 2YSRA 2M7AA 2OUMA 2R7DA 1W1WE 1HCRA 5FD6A 4E7ZA 2Z1DA 1S29A 1AHDP 1GUUA 3GTMJ 2NAZA 1XMXA 1QZYA 4MIMA 1B8IA 5EG0A 2F5FA 4RGRA 4RMNA 3JRCA 1J7KA 1VQ9I 2R3SA 1FMVA 2O03A 2XKOA 3A2KA 4ZH4F 2M30A 3S1RJ 1VQLI 3CTAA 1LEBA 4QPQA 4EM0B 4A3FJ 5B5EC 3GUDA 4AVPA 3M8EA 4ZYEA 2M2EA 1YJNI 3BWGA 3E97A 4BGDA 1FBQA 3KX2A 3NWTA 5E1ZB 4A0YA 3AKZA 3FHZA 1RZ4A 5FFXA 2DK5A 4WX9A 2FJ1A 2CQQA 2UZKA 2V26A 3CJTB 4BQOA 3L2VA 4UB8C 3V4GA 2KZGA 4HPQA 3HRMA 4B48A 3RCOA 2XRNA 2CUZA 3WHBA 3OS2A 3Q3SA 3WU0A 2XROA 2LKPA 1V4RA 2VN2A 2ZFWA 1ITYA 5H20A 1ZELA 4RAYA 2A68F 3DTKA 3TP0A 1WVRA 3OS0A 1EH7A 3CMMA 1VQ4I 4LIVA 3H5NA 2EPFA 3F23A 2R5ZB 1IUFA 2GXAA 2FX0A 4KT5C 2WV1A 2E35A 2H27A 1FP1D 2CFOA 1AA7A 4MQ9F 3ZMSA 2XAFA 1ZH5A 4EJTA 1OCPA 3IKTA 3FF5A 2QEXI 3AL0C 1E2XA 3V8LA 2E1MB 2X4HA 2OTJI 3E5XA 3K6GA 3G1LA 2H1KA 3KP4A 4I01A 4II2A 3DTIA 2R93J 2ZSIB 2VKEA 2VQLA 3KEQA 1B59A 1QHGA 3GZNB 2R7WA 3BC8A 2DMUA 2X1DA 3L2UA 4G7HF 4QSHA 4Q4ZF 1IRGA 1VQOI 3PO3J 1W5SA 3J80R 1OKRA 2JA2A 4U87A 2VJ5A 5L3BA 2KRCA 2PMZN 3V8JA 3J7YJ 1ETXA 1IRZA 2GM4A 4FQGA 5F1RA 5KAFC 1KU3A 3OR2C 4M3GA 1KQ0A 2XGDA 1ZLJA 2F6CA 1XGNA 1QGPA 4HX8A 3C7JA 3K1PA 3JRBA 1JHFA 1QQIA 2M4KA 1O4XA 3LSRA 3HRSA 5J40A 2VONA 1A36A 5ICFA 4L9NA 2WADA 3ULQB 1ZAOA 2X6YA 2EJRA 1XDUA 2BY2A 3EYIA 2LH9A 2BHZA 4HDUA 5C3EJ 4GCVA 2VKHA 1NK3P 4F55A 4TV7A 4D1QA 4UV8A 2E34A 3TOBA 4NUBA 1VZ0A 3W2VA 2K4JA 2HYFA 3VSLA 4YFNF 3WU2C 1OCCH 2YX4A 2HTSA 4XRMA 4HEA2 4AVZA 4B47A 4A3CJ 2OBPA 2QVOA 4EATA 2HYGD 1O3QA 1TL8A 1XG1A 5ICGA 1H89C 3JRHA 1XDSA 1QHHD 2GLOA 3S1MJ 1U0JA 4KUMA 2VL8A 4AWXB 5M3FJ 3SZPA 1TWCJ 2KJBA 3Q9SA 1SD4A 2P81A 1XSXA 3GFMA 4IKFA 2JVGA 3SFZA 3TDUC 3OYLA 2WAEA 1KU9A 3KEOA 1B72A 2MD5A 4DQ2A 4DZJA 3MZYA 1R5ID 2ZB9A 1LUJB 4RB0A 5FRNA 2Y0SN 1DUXC 4A5MA 2CGPA 3ZQHA 2XV4S 2OC6A 3TL4X 2GQQA 3CCVI 1YTYA 5DTDA 1S7AA 2FBKA 2HOAA 5F0CA 2VKDA 4PJLA 3TW7A 2DQRA 3LA3A 4AIKA 1JE8A 1KQ8A 3E0JB 2NYXA 4R1HA 4CZZA 1FSEA 4R8HA 4A5NA 2HVRA 1TBXA 4A3BJ 1JGSA 3PL8A 3GTGJ 3MEXA 4FASD 3G2BA 1MDMA 2ID3A 1JHHA 4RGSA 1K61A 4FISA 5DCMA 1MJAA 1W36C 3PUBA 3FXJA 4G94A 3QU3A 3H36A 3K70D 2DTRA 2M8EA 3K4NA 4IXAA 4EM1A 2DYRH 2CFXA 3DU5A 2LD5A 3LSTA 3FIWA 4YFKF 2KQRA 1MW7A 3VB2A 4I2OA 1NTCA 5CQGA 1H9GA 3V7SA 3JRAA 1RPWA 3K9TA 4HBLA 3CCEI 3E6BA 1POGA 1UELB 5E18F 1SFOJ 1I27A 1IO2A 1D3YA 4YRVA 4M6YA 4LLLA 4C30A 4EGYA 1D0XA 3BT9A 3DFGA 2M0CA 3ZQ7A 1OCRH 1Y39A 2H6CA 4XN0A 3RPUA 1BC8C 1HQCA 2EIJH 1ZTRA 3H5RA 3K4MA 2NXNB 2BW3B 4CCMA 3GTOJ 3ZGKA 1FOWA 4IRGA 3OYKA 2MBFA 2CYYA 3B02A 2Q8KA 2NNYA 1XSDA 4UUTA 4DW6A 2DXIA 2P7CB 2P6TA 1E3HA 5KHDA 2QQ8A 3RKWA 2GIVA 1FC3A 2CG4A 2MD0A 4L9JA 2BW3A 2DA7A 2XPVA 1DPRA 2LOOA 1N25A 1OFCX 5HDKA 2HEOA 2ZMEC 3CCSI 2CQXA 5D4SA 2ZCWA 4WK8F 2QSHX 1T98A 4BH9A 2AQEA 3HGGA 4L5IA 3O3KA 2FA5A 1ETQA 3HG9A 1MBGA 3GWZA 3HSRA 1WI3A 3MFKA 2STTA 4BNCA 3CCQI 2GAUA 5LBQA 3M3YJ 2YR2A 2F5EA 4EEFG 3PM1A 3MCZA 3PNVA 4AU7A 2KZVA 3GZ6A 4AM3A 1H9TA 2L4MA 5D5VB 1Z3YA 4DIQA 1XN7A 1MBFA 1QZEA 3GBGA 1KGSA 3I53A 2HDWA 2ELHA 1G3SA 2VT3A 3TGNA 4ZTJA 3WG9A 3RKQA 3G4SI 2JT1A 1W5TA 1YE9A 1QPIA 2NRAC 3K2AA 1ETOA 1F9NA 1UAAA 4NC7A 1ZN2A 1FLIA 3LSKA 4V2FA 4A3JJ 2HZDA 2UXXA 4B43A 1Y0UA 5DM7F 2OU2A 3WTZA 4IO9F 2BV6A 4LLNA 2FXAA 1BOAA 2FBHA 2PEXA 3GFLA 5BPDA 4BY1J 4RB3C 2L7FP 2OF7A 3OIPA 5LRRA 2R7RA 1YX3A 1U8BA 4P1WA 4J00A 4C2TA 1TNTA 2JA6J 5GPAA 1HBXG 4XN3A 2WB1A 4BEHB 2LR8A 4UUVA 2Y30A 3I0TA 4XKWA 4U7DA 1JGGA 2L9VA 1JKOC 4XIDA 1J9IA 1BR1A 4GDFA 1SD6A 1K79A 4ETSA 2Z9OA 3CDIA 5BS6A 2D5VA 4BJ6C 3V42A 2HQAA 1JKRC 2CQKA 3H92A 3DEEA 4KIFA 4JYKA 2L7KA 2W24A 3E3VA 4AUXA 2CJJA 1NG6A 3RZDJ 3OMYA 3KIOA 4E6KG 5ILUA 1GVDA 3GO5A 3MVPA 3U2RA 5ED4A 4HF0A 3QPTA 2FNPA 2KKOA 2E5ZA 2Y9YA 1Y1VJ 2MZ4A 4HYEA 1WHUA 3RKXA 3MD2A 3H9GA 2E19A 2K3PA 5BPIA 2CMPA 1IXSB 3A1YA 3BG7A 1LDKB 5HOOA 4DBRA 1Y8RB 2JRTA 4LIUA 4Y17A 4DJAA 5FKLA 1ETVA 4B3XA 5LGNA 4A3DJ 1ZGAA 2VIXA 5GTIC 3N4MA 2CV1A 5LGTA 1LEAA 5BMZA 3VOEA 1TLHB 3OYBA 4HA8A 3ERMA 4NQWB 4PSXA 1FX7A 2V1XA 1YHQI 2D1HA 3K69A 3WTTC 3CO7C 1MD0A 3ROUA 1F1ZA 3RPUD 3MMYB 3BCBA 1D5YA 1E3OC 3ZRGA 2A6HF 1U3EM 1NG7A 4ENKA 4A3LJ 1LJ9A 2Y31A 1ZGJA 1FOYA 1V54H 3TO7A 3I4PA 2RGVA 1HLVA 5TISC 2RV8A 3QPSA 4NQWA 1YO5C 1IF1A 3ZPLA 3JCUC 1IN8A 2BEOA 2O8KA 1OR7C 3I54A 2P5LC 1T08B 1WJBA 2LBFB 1TNSA 2M4GA 1MMAA 1LDDA 1X1CA 4XOTA 2X6OA 1J59A 4GRIA 4PFPA 3BJ6A 2IBDA 3EETA 1IDYA 1BI0A 2F4MB 2PBIA 3WGGA 1BIBA 4A0XA 1L3LA 2COMA 5IYBJ 2DMPA 1VTNC 3CJRB 3RIRA 3BY6A 2HNHA 3DU6A 1UCRA 3K1NA 4ZYDA 2EILH 1LE8B 3R61A 3L2RA 3FMSA 1XMAA 3BTLA 2E5NA 1PUFA 3AFHA 4HX7A 4MO7A 1QBJA 3BLYA 2XGEA 1RQ6A 2RC4A 1XGOA 3QYBA 4KMFA 2R7UA 2OZ6A 4ABZA 2P5VA 4MEYF 2VQHA 1AKHA 4OAZA 1DU6A 2DO7A 4CCKA 1D8JA 1FJLA 3T0YA 3DPLC 2E1CA 2MSYA 5KAIC 3D1NI 2LK2A 2RDPA 2EFWA 2R7OA 4Z6YA 4I09A 4RA2A 3H0DA 2DAOA 5E79C 5E3MA 1FY7A 3P7NA 2V6CA 2GBYA 1WWXA 1G3TA 2ADUA 1ZHFA 2XAHA 1USSA 2D45A 3HZJA 1T38A 3LFUA 3ISPA 2RNJA 4CA0A 5C4XJ 3VODA 3SDBA 4KISA 3DQVC 3CESA 4W1UA 1VQNI 1HA8A 1CF7A 2P6SA 2E2JJ 2VC1A 1ETYA 4RDUA 1JT6A 1JJ8C 1ZK8A 1F4KA 4L0ZB 2JTVA 5D6EA 4AIDA 3EUKL 2CSOA 2Y9ZA 3AG3H 1Z21A 2Y69H 2O3FA 2LY9A 1R23A 2IPQX 3F6OA 4HX4A 2Q2EB 1WI9A 4B8XA 1FOXA 1KYWA 2XIGA 3FM5A 3HGYA 3QYFA 2K9QA 3DWLE 1W0TA 2EFOA 1BW6A 2NOGA 1BI3A 3ABMH 4N0BA 5J4VA 4CYCB 1HDDC 5CVIA 2IS6A 3WGHA 4ZYHA 4NBQA 5D5XB 1PP7U 1IV6A 2HOTA 3FHNA 3EYYA 2LFBA 2DI3A 2VUMJ 3CZ6A 2MH9A 5TGTA 2G7UA 3K10A 3ONQA 3JRFA 2ACJA 2XSJC 2K85A 3BG5A 2LMDA 2M0MA 2WB1N 4XKBA 4CYCA 3X2QH 1I1GA 1ULYA 2EV6A 2IEKA 4OMZA 2CU7A 5FLXZ 2VXZA 4CCNA 4IL6C 3O8HA 2R7XA 1H8AC 3I59A 1E17A 5EF6A 1X1DA 1LFUP 1R00A 3BCAA 3CUQB 4EM2A 3UNGC 3A02A 3FKJA 1HXDA 1OQYA 3OYNA 2ICWG 4ENMA 1WJCA 3IKVA 2A6TA 2K9LA 3BR5A 4B4CA 2DPDA 3HBLA 2BY1A 4RB2C 3K4LA 2Z2SB 1SD5A 1IXRC 4BJ5C 1YI2I 1N78A 3D5SC 2XAJA 2AXTC 4XRSA 4U0YA 2JPBA 3CDLA 5D8KB 3H35A 5J3LA 2DA3A 2V9KA 3IWFA 1HOMA 4A12A 5E3NA 2RKHA 4HSTA 4FE4A 5A2QZ 2M34A 3E5QA 2ZMEA 1TP4A 4MTDA 4LK1F 1OCOH 3G3ZA 3CCLI 3ESWB 1CGPA 4FT8A 1YQAA 3TBIA 2BY3A 4A6DA 5FLMJ 2MGQA 3CMYA 3KZIC 1P7JA 1IRXA 2ELJA 4YEJA 1E0EA 1HW1A 1MBKA 2IJLA 2VE8A 1ON2A 4IF4A 4MFEA 4CSWA 5H2FC 1MMNA 5E3OA 4J01A 1ZGWA 1RR8C 3OOUA 1B8IB 1F36A 1UHMA 3OSFA 3JRGA 1PUFB 2ZBKA 3ABTA 2NS8A 2R7TA 3BZ6A 4S04A 1V5FA 1MJ9A 3CF2A 2CW8A 2Y48A 5K5OA 1ZYRF 4M6XA 5JLWA 4A3MJ 4BDYA 4M3FA 1SMYF 4CH7A 2DT6A 3LWFA 1YS6A 4II3A 2MA3A 3I3LA 2W00A 2BHYA 1ETWA 2FU4A 2JN6A 2JWTA 1DGWY 3BR2A 3MWMA 4M9ZA 1KONA 1XC5A 3RQ4A 4DYCA 1OMIA 3PNTA 3QODA 3JAMK 3HOUJ 5J4YA 4HF1A 4ANJA 1IN7A 1ERDA 3OY9A 3VYRB 1AOYA 3WE3A 2R5YB 3TOAA 1XGMA 5CJ9A 1QPMA 1RUNA 2OQRA 2DW4A 4M3DA 2X1CA 2VBWA 2IGOA 2ZJ2A 5JI6A 4Q5SF 5HS7A 2V1UA 4V2GA 1TWHJ 4L9VA 4DOZA 4YG2F 2R5YA 2B7EA 1ZR4A 3GCMA 4J19A 3ZR8X 3M8JA 2WAQN 3E6DA 1ENHA 4RAFA 1EJ9A 2EZKA 3BQYA 1TQPA 2BGCA 4F3QA 4KT6A 3LSGA 5JR3A 2E1NA 5AIPA 1I50J 1R6RA 5L3GA 4XLFA 1T0FC 1O7FA 4OIRF 3VPRA 2KIFA 1NHAA 4DBQA 1HKSA 3VSKA 1XMKA 4XBFA 1MBEA 2M3AA 5LEKA 4OINF 3TO9A 2QM3A 1K4SA 1X19A 2JK3A 2LRDA 2Q1ZB 3A01A 1EV7A 3FXKA 1DGRM 5GPCA 1MH4A 1QRYA 5IP7J 1I3AA 1T6SA 3FXQA 3DKYA 4OWRB 2X6XA 1AU7A 4BBSJ 3L09A 3ZMZA 4I6ZA 5HLGA 2VXDA 3QP5A 2F5DA 3R0JA 1O3RA 4CO8A 2YPRA 5B1BH 2OAZA 3GTJJ 1OJLA 1ZG3A 3E1SA 2RQPA 3RJPA 1XD7A 2CW0F 2FEZA 2WY8Q 1FBSA 2HQRA 3CCRI 5LEJA 5CVUA 4YFXF 4WXCA 3QQAA 3HRTA 2KLOA 4PDKA 4Y52J 1ORKA 1PP8F 4KA4A 1SAUA 5M5XJ 3DLAA 4IJAA 1MNDA 4Y3OA 4CHUA 3O6BB 1YOVB 4Y4RA 3LAPA 4C3IJ 2HQ5A 3REOA 1U2WA 1S3JA 5FLXR 3BDDA 3HIFA 2ZJRF 2HDCA 1HKTA 1Z77A 2K40A 2R92J 4BQAA 4KITB 3KETA 2H6BA 1FSHA 1U5TC 5HDNA 2G9WA 5EEGA 3U9GA 2BXZA 1T33A 4BL0B 1DU0A 1FYLA 1FOKA 1R5GA 3WHCA 3LFKA 1OR7A 1EH8A 2K27A 4BHBA 1SFUA 2E2HJ 1MBJA 5IT9Z 2L7ZA 3D5LA 1Z1DA 4D0PA 1RETA 3ZOBA 1MNEA 1MJBA 2BBYA 2PFBA 5H6RA 4P9UA 4RGUA 2XHKA 1WKMA 5EZGA 3EUHA 2EH3A 1TT0A 4UUSA 4PSWA 1R1TA 1B6AA 1BR4A 1MBHA 5A2QR 2DMNA 1G6NA 5FKNA 1B72B 4QPOA 3F72A 3DF8A 3BOQA 2GA2A 4A93J 5B3SH 1S72I 1K6OA 5F64A 2FF4A 3BR1A 1Z9CA 1JTXA 2VLAA 1R36A 4Z2YA 2R7FA 1JTYA 1U8RA 2F4IA 1X2MA 3AG2H 2VBYA 4BHPA 2PMUA 2M9HA 2VKVA 3DEWA 1Z05A 3G73A 1S9HA 2TCTA 2CRGA 1UMQA 2NS7A 1TWGJ 1R22A 4A2UA 1O7LA 5JVTA 3TEDA 1IW7F 5TRDA 3OYFA 3QWLA 2DA4A 1KQ9A 4E7SA 4ESFA 3H1CA 1MH3A 2WAFA 2QGUA 3COAC 1X1AA 1WJ5A 4EJOA 4RAZA 1LQ1A 1IUYA 5IYDJ 1DP3A 1K6YA 2IA1A 1MIJA 2V9VA 2HOSA 1MDMB 1GHCA 3KP3A 4M74A 2ZJQF 2DLLA 4PGHA 2A69F 5F0HA 4HAMA 5DCMB 4KDPA 2AHQA 1D8KA 3J7AY 3FXLA 4XKCA 2M8GX 4BKXA 3V8KA 4L18B 1SVOA 3J7AW 1RNLA 1BJZA 3HSFA 3P9IA 1QNTA 2O7OA 2LY2A 3DKWA 1I1SA 3S2WA 2L4AA 1VQ6I 4OAYA 2LTPA 2ZC2A 3KP7A 1PJRA 2O0YA 4KIBA 3PQJA 4C9YA 5E17F 3FKIJ 3E6MA 2ZXWH 4ESBA 2K9MA 1Z6TA 2AQFA 2EIMH 2GZWA 3FDYA 2DYSH 1VQ7I 1R1VA 3B6CA 1ZG1A 2W84A 1C0WA 1IDZA 5ICCA 4MNUA 3WODF 4PJMA 3PO2J 2W4SA 4U0WA 2IRFG 1GDTA 4EMSA 2K5CA 3K2ZA 2IGNA 3VDXA 4UVBA 3OYDA 4EJVA 5DCFA 3HUGA 2JSCA 3BR3A 1D1CA 1FPQA 3BQZA 3HJEA 4BE2A 1FT9A 3ZQLA 2LKSA 4LOCA 1TQIA 4AD9A 1FZPB 2E7XA 2LNBA 2XDVA 2VQGA 4PUSA 4HSRA 3SXYA 4RBOA 2DJIA 2VE9A 4FX4A 4C2UA 1G59A 1WJFA 4LG0B 3KZZA 3O8GA 2OV7A 3MZHA 5IOYA 3H3VK 5GAEJ 3J81Z 2E36A 2MABA 2QQ9A 2MYSA 1A31A 3M07A 4QTRA 3CCUI 4HRIA 2CW7A 4K2EA 3OV8A 2KISA 3A4CA 1ZKGA 4QIWN 3AG1H 3BTIA 3VWBA 3WTUC 2Z3YA 4I0BA 5GAGJ 4LG0A 2Y0MA 1D0ZA 3QPHA 1U78A 3F8NA 1BOBA 2X51A 2R7VA 3M7GA 1BC7C 2YU9J 1VNDA 2BOLA 4NB5A 2IP2A 2PJRA 4XRSG 4RM2A 3ZQCA 2ELKA 5KVRA 1SANA 3OSGA 4L0YB 1RR7A 2RAEA 4BJTA 1TT5B 1FIAA 1VFCA 2DCEA 1REPC 2K4BA 3HDDA 2VC0A 1I3QJ 2NVYJ 2IS2A 3EQLF 2J5PA 5F04A 1ETKA 2V79A 3WTYC 2PJPA 3GTQJ 4L5JA 1YLFA 2ZKZA 1KU2A 2YUSA 3HHHA 3AG4H 3NQOA 2HDDA 4ENJA 2QZ8A 4XK4A 3F21A 1TQMA 2XAGA 5FB2A 5IYCJ 3ECOA 2KJCA 2W48A 1U9NA 4XMYA 4EQQA 1P2FA 1W5CC 3HB9A 1KZHA 5IT9R 3H0GJ 2QBYA 2DFIA 2XGCA 4O6JA 1IGNA 1GXQA 4IQ4A 2CUEA 3BJOA 3E6CC 2L0KA 4XLCA 1EA3A 2FMYA 3C18A 5H6QA 1JJ6C 2GA1A 4E7LA 2NVXJ 5IP9J 4P9FA 3BP8A 4F52A 4IEJA 3S93A 1BI1A 1WPKA 5BNGA 2HXOA 2OJED 3GF2A 3QU6A 2LREA 3QRFF 3WU1B 4HLYA 2DODA 1Z0XA 4LMYA 5CYVA 4HW0A 4DYQA 2E7WA 3EPZA 2COBA 5J8FA 3LSHA 3C2HA 2HQNA 3JSOA 1MZBA 3OWTA 2L5QA 2IGKA 2M35A 3KP5A 1XTAA 4F93B 2K86A 4YIRX 3CC2I 4PK4A 2HWVA 3O2PE 4PFOA 2WV0A 3LSPA 4KFCA 5E8GA 1YW8A 3HKZA 2EFNA 2RREA 3HPGA 4BE1A 1XS9A 3RYPA 3GTKJ 2VJ4A 4NC6A 3C2GA 2Q0OA 4CXFA 3K70C 2P4WA 4ZTFA 3IWZA 1WJDA 2UXNA 4HLXA 3ASNH 3AL0B 2G0EA 2OD5A 3S2DJ 1FNNA 1T0FA 3FXRA 4PJJA 4XKVA 4EGZA 4A0ZA 5DS9A 4WCGA 3HTSB 2FUG2 3ZMTA 1HKQA 4BHCA 5L3CA 3W3CA 1NH3A 3BJAA 1M1EB 5TJJA 1LNWA 4P5OA 4ASNA 4MGRA 2KIUA 1LPQA 4UNOA 3SEQA 4XNFA 1P9QC 4FTHA 4XOPA 5LRSA 4RB1A 1OLTA 3FBIB 1J2XA 2A05A 2PMHA 4LITA 2W1OA 5E1WA 5HVQC 2L01A 1GV2A 1OCZH 1V5GA 1FMWA 2R4GA 3H5AA 3OYAA 2FE3A 2RVCA 4JX6A 2NVQJ 3U1DA 4OIQF 1IRFA 3J81R 4C3JJ 2E1MC 3I56I 2KFDA 3MQ0A 4IOCF 2DJNA 2MC4A 2DU9A 4MTEA 3RPQA 5EGOB 2ESHA 4XLPF 5CVVA 2EV0A 3L2QA 4XSXF 4GXOA 1DQUA 4B44A 4WXHA 5AONA 2MW8A 1KU7A 2J5OA 2XPUA 1A04A 4D7MA 3IUOA 4LD5A 2CQNA 3Q0UA 1J09A 2WBMA 2QF7A 4Q47A 1WH7A 2QQAA 2IVMA 2KL4A 2LY1A 5EGOA 4BY7J 2BYVE 5EYRA 4DGWB 2UWMA 4O3MA 4ZDOA 5KNLA 3FXOA 2VT2A 1BM9A 1WRJA 4KMUX 3JTHA 2EIKH 1FTTA 1AKHB 5JHFA 2OZUA 2YS9A 3H3ZA 1LVAA 4M3BA 1ONVA 1WJAA 3NARA 2WAQA 3CF5F 3L9FA 3VYTB 3AAFA 3KYCB 3IV5A 3I4NJ 2H8RA 2CQ7A 2L02A 1MNMC 4KICA 3SYTA 3HOZJ 3U1KA 3U21A 3OYEA 2FNAA 2F5VA 1ZARA 5ILVA 3R0AA 2FRHA 4ZZDA 1V3FA 5LHHA 2M7BA 3W6KB 3VEPA 5DV5A 4BXXJ 1N77A 2X85A 3S3OA 3ELKA 3C3WA 3FK6A 2X6WA 3F8CA 3RZOJ 3I9V2 4I99C 3KP2A 3SHFA 3L2CA 1CF7B 2LYCA 1KA8A 3M1CA 3K4JA 4Q48A 1O3SA 3HXLA 2D2WA 1G8XA 3FK7A 3FMQA 2XAUA 3ECHA 2DQLA 4PJNA 1G3WA 5F0FA 4BACA 2HI3A 1SAXA 5K7FA 4RAGA 3OR1C 5DD4A 2BXYA 4A3GJ 1N75A 5E8IA 3QAHA 5D5UB 4NNJA 1YRNA 4G6TB 3JSPA 3FWEA 2DFHA 3K4BA 4JX5A 3K0LA 4BXFA 2PQ8A 3MKZA 3KYDB 5M3MJ 3RKYA 2IGMA 1A5JA 4E7IA 1D1AA 4M72A 4AIHA 4CCLA 2XUBA 1OISA 1SD7A 4FETA 1Z67A 3G1MA 4IHVA 5K7HA 1MMGA 1CQTA 4AIJA 2QENA 3MZ8A 1Z7UA 3DEUA 3Q0VA 3S15J 3HOTA 4H4KC 5M5YJ 4YIFA 1KYZA 1W4MA 3EDPA 4MQVA 1HW5A 3TP3A 4DYRA 5IPAA 1O3TA 3BG6A 2JA8J 3VYUB 4I98B 2DDAA 4WXDA 1W0UA 4CCOA 2JMWA 1YIJI 2HYJA 3I59B 1Z3XA 4FCYA 5EJCA 3CMEI 3KEYA 3F8BA 2TDXA 4P55A 2GWRA 2EFQA 2JQ7A 3K4KA 3V7CA 3DXJF 3E7LA 3ZMVA 1E3PA 1F43A 2C6YA 4XRFA 1USTA 3OYIA 1HW2A 2QLZA 3F3XA 3PSIA 3K4CA 4MLOA 4L5EA 4ZJZA 4UXNA 2B63J 2HU9A 3HKZN 2P5KA 3WTWC 1I6XA 2EV5A 1GLNA 3D0SA 3ZMDA 2OPTA 2LP0A 2FOKA 2ZMEB 4ENNA 2EFPA 1T2KA 1XSVA 5K5QA 1ZRDA 1WFXA 1R4MB 4D5CA 3OYHA 2M87A 1DPUA 4KNYA 2R7QA 4QWQA 4LK0F 1V5EA 2ZO4A 3PJRA 2JSPA 1BL0A 5FKOA 5E3LA 4GYGA 1Y6IA 3LMMA 4IHWA 3S14J 5L3FA 2LLKA 3RTRA 5J8CA 1A35A 3PFIA 4X0GA 1PDNC 3IRRA 1ZQ3P 4G6DA 2K9SA 2ZXHA 3LL7A 1Z7LA 3TDZC 2L3DA 1YG2A 2R0QC 3P9KA 1L0OC 3I64A 2LG4A 1J0RA 3ABLH 3R4KA 2DN0A 1D5VA 3MKYB 3FX3A 1V55H 1JXSA 3I58A 1RKWA 4JQFA 2DTZA 2OCEA 1ON1A 4BS9A 4OOIA 3PNYA 3GFJA 1P4XA 1X4PA 5HLHA 3SZGA 3S3MA 3CP8A 3DLLF 1SFKA 3CDHA 3BTJA 2H09A 2ECCA 2H94A 6PAXA 3F0CA 2JVHA 3ERED 5DUKA 3IH4A 1JUSA 4IRIA 3BPXA 4RGXA 4N4NB 1XB4A 1IN6A 2ECBA 4M6VA 4UVAA 4A6EA 3LNQA 3C1DA 3L1PA 1X58A 5D8LB 3TKYA 3HOWJ 4IHXA 4MFDA 1HC8A 2IA2A 1I5ZA 4D9JA 1HF0A 5CQEA 2B0LA 3SZTA 3ZMUA 1QO0D 1B4AA 1XCBA 2DDBA 2JPCA 2QA4I 1UHWA 2I10A 3RDIA 1QA6A 3OYCA 3GLXA 4LLGF 1YS7A 2VOPA 3Q5FA 2LVSA 5HS8A 4CZCA 1R7JA 3OS1A 2JUCA 4XQFA 4HNTA 5CVRA 4ZDPA 2DMTA 4RLFA 2R7ZJ 2BY0A 3A01B 1MSFC 1D1BA 3S3NA 3FM3A 3HOSA 1TWFJ 5K5RA 3QPLA 3PQKA 2W82A 3J7AO 1W7PB 4IHYA 2P0TA 1IV8A 1APLC 1T8IA 4FHTA 4B3AA 2ZXIA 2QCOA 2MFZA 4D7NA 5CLSA 4EV0A 2A5WA 3C2BA 2PN6A 5LHIA 1HSTA 3R60A 5FLVA 1LDJA 1S6LA 2DA5A 4UV9A 3CJQB 3DP7A 1W7PA 2IW5A 3FXUA 1JKQC 1ZREA 2VPLA 1W36D 4CUGA 3KLNA 1X3WB 3E5UA 4PCQA 2X98A 4W97A 1YYVA 3LQRA 1IXCA 2CWEA 5HDGA 2MLGA 3EUAA 2WTEA 1GV5A 1IZ1A 3GYHX 1DDNA 2PLYA 3FBNB 1EKEA 4F7ZA 1PUEE 2O6GE 1K83J 5L3DA 1B9NA 2MH2A 5LHGA 3JREA 5K1YA 1I39A 3GW2A 5K7ZA 1TWAJ 4KN4X 4RLQA 3S1NJ 4XLEA 5E1XA 2GXGA 1VQKI 3W6JB 2X1EA 4M9SA 2R5ZA 2V6EA 1I6HJ 2BVMA 3SDGA 1UJ8A 3IHUA 3JRIA 1LB2A 2IAIA 1G2HA 4N9HA 2XKPA 3KP6A 2DA2A 3DBRB 4GFBA 5CPRB 2QKLB 4BUPA 4M3EA 1FIPA 3BPVA 3KPHA 2H8WA 4HV6A 2P7VB 1P6RA 3M9AA 5DUIA 1WSUA 2DPUA 4UUSB 3IP4B 3ML6A 2MC3A 5J47A 5ILSA 4G9YA 1VQ5I 1HDPA 2ZXJA 1FYKA 4IOAF 4L9TA 4IVNA 1BW5A 4IX7A 3NAUA 5FGMA 3IC7A 3IAS2 3Q0WA 1OCTC 5DYMA 3HOXJ 2NVUB 2XGXA 3IL2A 3KYLA 1ZG5A 2LF7A 1IG7A 1S7EA 2W57A 3LQQA 5DD8A 1IN5A 4ZYAA 3M4OJ 4NHJA 2GIZA 3JRDA 3PSFA 3LSJA 4BYYA 3F22A 3ZXSA 1OYWA 1S5LC 2FQ4A 3OIOA 2Y75A 2GOXB 1R49A 2Y2ZA 3S32A 2MG4A 2KIQA 5FJ8J 1B1BA 4E7KA 2ETHA 4ZZLA 2O8XA 1ZRCA 3BROA 2MVTA 1YW9A 2VASA 3DBHB 5GP9A 4I02A 3S1QJ 5KCMA 3OYJA 5FRMA 1UZCA 4JBAA 1X1BA 3A0BC 4PZJA 1QZZA 5LD2C 1JUMA 1Y1WJ 2O5RA 5LFAA 2QKMB 1IJWC 3ZQGA 3J80K 3BTCA 3CC4I 2GOMA 3FISA 1JT0A 2HKXA 2CV2A 2HKOA 2IXSA 1MMSA 3TO6A 2V7FA 1GVJA 3Q9VA 2WA0A 2X48A 3TW6A 5IOZA 3ZQFA 3DCFA 5EEHA 4A3KJ 3N05A 4A3IJ 1XPXA 1QVUA 2BZTA 2A07F 5FROA 2FOWA 1YFHA 2KPMA 3T1BA 4CYDA 4AYBA 1TC3C 3GVAA 5FLXK 4HF2A 3WTXC 1R71A 3JR9A 5J1YA 3HUGB 1JUPA 2KMUA 5HLTA 5DM6F 3RI4A 2OCCH 1SVMA 3P5JA 1FTZA 1VQPI 3ZQQA 1ZLKA 5LGUA 4HNVA 4JP0A 4HV5A 3IH3A 4XL9A 1BI2A 2K02A 3M1EA 2ZNZA 3IRQA 1A6QA 3HEFA 4HQMA 2W7NA 1SC7A 1R58A 1G4DA 2RQQA 2CUFA 2QUFA 2CH0A 2EQRA 2KRFA 3PIOF 5A2QK 5J1RA 2DFEA 1SFXA 4CDGA 2EBIA 2XB0X 4HG2A 5C44J 3W2WA 4UB6C 3I55I 2CO5A 1W7PD 2XRLA 4EJWA 3BR0A 2A61A 2XB5A 2CV0A 3KZYA 2PJRB 1OPCA 2HS5A 2K3FA 4XICA 2MUNA 1OYYA 2KDZA 4GO1A 1RUOA 4E4HA 2VB6A 3VYSB 5KK1A 5B66C 1H88C 3G6EI 2V4JC 5HLIA 3OL4A 4F92B 2WWYA 4XR6A 1X2NA 4IRHA 1XGSA 4CCJA 3RYRA 1WQ2A 4OIPF 2LF8A 2W25A 3CLQA 2A3SA 2V1NA 3PIPF 4BQQA 2W85A 4MEXF 2E60A 2E71A 3NRVA 3D5RC 3ZN0A 4UY8I 1WCMJ 3I4MJ 2ID6A 2EK5A 2K7LA 3QOPA 3G71I 3WTSC 1LFBA 3CUQC 3LA7A 1J5YA 1YITI 2QBYB 4IHSA 2IS1A 3F8FA 1TZLA 3BR6A 4U0VA 5JVGF 1U9OA 4XONA 3GTLJ 2F2EA 3CO6C 3LSMA 4Y15A 4YELA 2O61A 4G8XA 4ZYGA 1BN5A 1YW7A 1VF9A 5AIQA 1P92A 3GZ5A 3GX4X 3J7ZI 2EZIA 5J6XA 3M8FA 4M9XA 5IT3A 5BOXA 2JA5J 2EZLA 3WTVC 1T95A 2HOEA 4G6QA 3BG9A 4G12A 2XF5A 2QYOA 4I0AA 3H9JA 3CCYA 2QWWA 2A5YB 2KP6A 3BZCA 4ON0A 2YX7A 2N8GA 2HPIA 4B09A 5IY5H 4QLCU 2EB7A 5D5WB 1VI0A 2EA2A 5LLQA 2D1VA 2EA4A 5EEAA 2IA0A 1TTYA 2RN7A 2IS4A 3CMAI 3DTEA 1JKPC 2QQBA 3B6AA 3OYMA 1RI7A 1D0YA 1X3UA 4JK1X 3TQNA 2VJJA 2BVLA 3NWSA 1LKXA 1UHSA 2O9LA 3W6VA 1YX5A 1IAWA 2DK8A 2LSOA 1UG2A 5F6FA 2XC7A 3CLOA 2EINH 3IAM2 1FYMA 1UG0A 4M71A 4OIOF 2NVTJ 2X9DA 3QYEA 4HQEA 4X6AJ 2Z33A 3DBLB 4HNUA 5IP6A 4HDVA 3LA2A 2KDOA 3GEZA 2VPRA 2LC2A 4WWCA 2I5UA 4ZC3A 4OMYA 1IC8A 2FD5A 1ZRFA 1VQ8I 2HR3A 5FKKA 3TMOA 5J1UA 2JZYA 3K1MA 4A69C 3KE2A 3K7AJ 4S0HB 1S8NA 4NC8A 3JW4A 3HHGA 5B1AH 1Y0NA 4BBRJ 3LOCA 3T8TA 2NNNA 2L9SA 1TW3A 2B9SA 3QP6A 4GGGA 2DA1A 4V19K 2Z5UA 2DT7B 4LJZF 2HZTA 4KYWA 4ITVA 4OU0A 5C4JJ 1EH6A 3HTUA 3UR3C 4JX4A 5ICEA 4XLNF 3L7WA 5L3EA 4H0EA 5CKTA 5E20A 3V7RA 5HODA 4BEHA 2KT0A 3IH2A 1YIOA 3JAMZ 2STWA 3WG7H 4BAYA 2XAQA 4X1EA 3HPHA 1OYIA 4P96A 4C2MJ 2LDUA 5IT9K 1WZ2A 4O5VA 4CGZA 3L00A 3S16J 3WGIA 2YU3A 2P8TA 4ZDLA 4JOMA 3SFIA 1T39A 4M73A 3S8PA 1H0MA 2QSGX 3R6SA 2Z16A 2MLKA 4AYBN 2M45A 3A03A 3FXMA 4Y7NJ 3N97A 2G7HA 1ODDA 1SEUA 2Z99A 1GT0C 2NS0A 2CUJA 4ESJA 2NOJB 2XSDC 1A6IA 3F6VA 2HVSA 3H9QA 4D5FA 2HXIA 4UVCA 2R7SA 1U5TB 1X3ZB 5GAHJ 5JHUA 1RC9A 2VOOA 2JUGA 3L2WA 4IZZA 2P0WA 2X0LA 4LGWA 3HL2A 4BQNA 1EF4A 2DOFA 5DDGA 3CP2A 1Z6RA 2VBXA 1SVLA 5F27A 1RIOH 4F91B 1BA5A 2ME0A 1VQMI 3RQIA 3CCJI 1Y56A 1U5TA 2M1BA 3MKWB 3LAJA 2FQ3A 3OL3A 1AWCA 3HOVJ 2DBBA 3B73A 5EZHA 1WH5A 5JLXA 4IQJA 4Y33A 2OA4A 4E7JA 2UUZA 3DV8A 3CD6I 2ISYA 4XSZF 2KHMA 3HSEA 2L9NA 4U7BA 1WJEA 3VFZA 1ZR2A 2VJIA 4XM3A 5HS9A 4E70A 3HOYJ 1QVTA 3SJMA 2VQCA 4G7ZF 1HSJA 5GTHC 2AO9A 2ESNA 2XASA 2DMQA 2L7MP 5EDNA 4R79A 1R5HA 2L2OA 3EUHC 3CCMI 5BQTA 4BE0A 2TRTA 2V9PA 4KJZA 2ZSHB 2DFFA 4AC0A 3A52A 2FSWA 2WC2A 1Y8QB 2XF7A 5GADJ 4IHTA 4PJ0C 1XX5A 4LFUA 2LBFA 1R1UA 2OTLI 3DPTA 1P4AA 3GMEA 2HGCA 1Q1HA 2PI0A 4B1RA 1YRNB 3ABKH 5CVJA 3ZCOA 2ZNYA 3HRUA 1T56A 2E2IJ 2L54A 3HC7A 1JI8A 1F5TA 2XF6A 3ABUA 2FBIA 1S7OA 3NEUA 1BJAA 4LB6B 2RNGA 3BZKA 4IPAA 3I71A 1ACIA 1LE8A 3GFIA 2F48A 4BXUA 5D4RA 3J81K 2HPMA 1X1PA 2EWNA 4LG3A 2PG4A 3MKLA 2K9NA 5F1JA 4XLHA 4RM3A 4Y13A 3LSIA 1DP7P 3ASOH 3MAJA 2KIMA 3SEZA 3WE2A 4BDZA 1K78B 1MKMA 1QU3A 1PVEA 1B9MA 3GLLA 3ZN1A 4FE7A 1NK2P 3GXOA 4XLAA 4I7HA 2OQGA 1LFPA 2PMZA 4BU2A 2ZFUA 4WF2A 4DNCA 1R4NB 1U6GA 5DEQA 1G3YA 5JFRA 2WY7Q 1FP2A 1R9TJ 2F5CA 2AS5F 1K78A 2AXLA 2DOEA 4G7OF
chains in the Genus database with same CATH topology
3CJNA 4KN7X 2FMLA 4HZFA 4PGGA 4LB5A 1TW2A 1FBUA 2VODA 2XVCA 3T5XA 3J80Z 3OOPA 2Q2EA 4KIGA 2HTJA 1IN4A 1UB9A 2GXBA 4UHTA 1STZA 4FX0A 1P4WA 1SFEA 4CICA 2HFHA 4U88A 4RS8A 1UFMA 3FZVA 5FFZA 2IT0A 1BBYA 3SQNA 1XCVA 2VBZA 1K7AA 1O57A 3KLOA 3I5UA 2BE5F 3CUOA 3KCCA 1J75A 1Z91A 2ISZA 4YIIA 4GYIA 2M5WA 3H3UA 2V1DA 1SMTA 4HOBA 3CUQA 4EVIA 2A6EF 4S05A 2DT5A 3KFWX 1FWZA 3JTGA 1BIAA 1MGTA 3HYIA 1GXPA 3F8MA 5FO5A 3T8RA 4N9IA 3ZP5A 4MHGA 5FD5A 4EJUA 5ERIA 5D6FA 3FMRA 3P9CA 2YSRA 2R7DA 5FD6A 1S29A 2NAZA 1QZYA 2F5FA 4RGRA 1J7KA 2R3SA 2XKOA 2O03A 4ZH4F 2M30A 3CTAA 1LEBA 4EM0B 3GUDA 4AVPA 3M8EA 4ZYEA 3BWGA 3E97A 1FBQA 5E1ZB 4A0YA 3FHZA 1RZ4A 5FFXA 2DK5A 4WX9A 2UZKA 3V4GA 3HRMA 2XRNA 3WU0A 2XROA 2LKPA 1V4RA 2VN2A 2ZFWA 5H20A 4RAYA 2A68F 1EH7A 3F23A 4KT5C 2H27A 1FP1D 3ZMSA 4MQ9F 1ZH5A 2XAFA 4EJTA 3IKTA 3FF5A 1E2XA 3V8LA 2X4HA 3E5XA 3KP4A 4I01A 3KEQA 1B59A 4G7HF 4Q4ZF 1IRGA 1W5SA 1OKRA 5L3BA 3V8JA 5F1RA 1KU3A 1KQ0A 1ZLJA 1XGNA 1QGPA 4HX8A 3C7JA 3K1PA 1JHFA 1QQIA 3HRSA 2VONA 5ICFA 4L9NA 3ULQB 1ZAOA 2EJRA 1XDUA 3EYIA 4HDUA 4GCVA 4TV7A 4UV8A 3TOBA 2K4JA 2HYFA 4YFNF 2YX4A 2HTSA 2OBPA 2QVOA 2HYGD 1O3QA 5ICGA 1XDSA 4KUMA 4AWXB 3SZPA 2KJBA 3Q9SA 1SD4A 1XSXA 3GFMA 3TDUC 3SFZA 1KU9A 3KEOA 2MD5A 4DQ2A 3MZYA 4RB0A 1DUXC 4A5MA 2CGPA 2XV4S 2GQQA 1YTYA 1S7AA 2FBKA 2DQRA 3LA3A 4AIKA 1JE8A 1KQ8A 2NYXA 4R1HA 4CZZA 1FSEA 4R8HA 4A5NA 1TBXA 1JGSA 3MEXA 1MDMA 1JHHA 4RGSA 5DCMA 1MJAA 4G94A 3QU3A 2DTRA 2M8EA 4IXAA 4EM1A 2CFXA 3LSTA 4YFKF 3VB2A 4I2OA 1H9GA 3V7SA 3K9TA 4HBLA 3E6BA 5E18F 1I27A 1D3YA 4M6YA 4LLLA 4EGYA 3DFGA 3ZQ7A 2H6CA 3RPUA 1BC8C 1HQCA 4IRGA 2MBFA 2CYYA 3B02A 2Q8KA 2NNYA 1XSDA 2P7CB 2P6TA 3RKWA 2GIVA 1FC3A 2CG4A 4L9JA 1DPRA 5HDKA 2HEOA 5D4SA 2ZCWA 4WK8F 1T98A 4BH9A 4L5IA 3O3KA 2FA5A 3GWZA 3HSRA 3MFKA 2STTA 4BNCA 2GAUA 5LBQA 2YR2A 2F5EA 3MCZA 3GZ6A 1H9TA 2L4MA 5D5VB 1XN7A 1KGSA 3I53A 2ELHA 1G3SA 2VT3A 3TGNA 3WG9A 2JT1A 1W5TA 2NRAC 1F9NA 1ZN2A 1FLIA 2UXXA 1Y0UA 2OU2A 3WTZA 2BV6A 4LLNA 2FXAA 1BOAA 2FBHA 2PEXA 3GFLA 5BPDA 4RB3C 5LRRA 1TNTA 1HBXG 4UUVA 3I0TA 4U7DA 1J9IA 1SD6A 1K79A 4ETSA 2Z9OA 5BS6A 2CQKA 3H92A 4KIFA 2W24A 3E3VA 5ILUA 3GO5A 3U2RA 5ED4A 4HF0A 3QPTA 2FNPA 2KKOA 4HYEA 3RKXA 5BPIA 1IXSB 1LDKB 5HOOA 2JRTA 4Y17A 5LGNA 1ZGAA 3N4MA 5LGTA 1LEAA 5BMZA 3VOEA 1TLHB 4HA8A 1FX7A 2V1XA 2D1HA 3K69A 3WTTC 3CO7C 1MD0A 3ROUA 1F1ZA 2A6HF 1U3EM 4ENKA 1LJ9A 1ZGJA 3TO7A 3I4PA 2RGVA 1IF1A 2RV8A 4NQWA 1YO5C 3ZPLA 1IN8A 2BEOA 3I54A 2P5LC 1TNSA 1LDDA 1J59A 3BJ6A 3EETA 1BI0A 2PBIA 3WGGA 1BIBA 4A0XA 1L3LA 2COMA 1VTNC 3RIRA 3BY6A 3K1NA 4ZYDA 1UCRA 3R61A 3FMSA 1XMAA 4HX7A 1QBJA 2RC4A 1XGOA 4KMFA 2OZ6A 2P5VA 4MEYF 2DO7A 1D8JA 3T0YA 3DPLC 2E1CA 2RDPA 2EFWA 4I09A 2DAOA 1FY7A 3P7NA 2V6CA 2ADUA 1G3TA 1WWXA 1ZHFA 2XAHA 1USSA 2D45A 1T38A 3ISPA 2RNJA 3VODA 3DQVC 1CF7A 2P6SA 2VC1A 1F4KA 4L0ZB 2JTVA 5D6EA 2CSOA 2O3FA 1R23A 2IPQX 3F6OA 4HX4A 1WI9A 4B8XA 1KYWA 2XIGA 3FM5A 2EFOA 1BI3A 4N0BA 5CVIA 3WGHA 4ZYHA 5D5XB 1PP7U 3EYYA 2DI3A 2MH9A 2G7UA 2ACJA 1I1GA 1ULYA 2EV6A 4OMZA 5FLXZ 2VXZA 3I59A 1E17A 1R00A 3CUQB 4EM2A 1HXDA 4ENMA 3IKVA 2DPDA 4RB2C 1SD5A 1IXRC 2XAJA 4U0YA 2JPBA 5D8KB 3IWFA 4A12A 2RKHA 5A2QZ 3E5QA 2ZMEA 4MTDA 4LK1F 3G3ZA 1CGPA 4FT8A 1YQAA 4A6DA 1HW1A 2IJLA 2VE8A 1ON2A 4IF4A 1UHMA 2ZBKA 3ABTA 3BZ6A 4S04A 1MJ9A 5K5OA 2Y48A 1ZYRF 4M6XA 1SMYF 3LWFA 1YS6A 2MA3A 2FU4A 3MWMA 4M9ZA 3JAMK 1OMIA 4HF1A 1IN7A 1AOYA 3WE3A 3TOAA 1XGMA 5CJ9A 1QPMA 1RUNA 2OQRA 2DW4A 2VBWA 2ZJ2A 5JI6A 4Q5SF 5HS7A 2V1UA 4L9VA 4YG2F 3E6DA 1TQPA 2BGCA 5JR3A 2E1NA 5AIPA 5L3GA 1O7FA 4OIRF 2KIFA 1NHAA 1HKSA 1XMKA 4XBFA 5LEKA 4OINF 3TO9A 2QM3A 1EV7A 1T6SA 3FXQA 3L09A 3ZMZA 5HLGA 3R0JA 3QP5A 2F5DA 1O3RA 4CO8A 2YPRA 2OAZA 1ZG3A 3RJPA 2RQPA 1XD7A 2CW0F 2FEZA 1FBSA 2HQRA 5LEJA 5CVUA 4YFXF 4WXCA 3HRTA 4PDKA 1PP8F 4KA4A 4IJAA 4CHUA 3O6BB 3LAPA 3REOA 1U2WA 1S3JA 3BDDA 3HIFA 2HDCA 1HKTA 4BQAA 3KETA 2H6BA 1FSHA 1U5TC 5HDNA 2G9WA 5EEGA 3U9GA 1FYLA 1FOKA 1R5GA 3LFKA 1OR7A 1EH8A 2K27A 4BHBA 1SFUA 5IT9Z 3D5LA 1Z1DA 4D0PA 1MJBA 2BBYA 2PFBA 5H6RA 4P9UA 4RGUA 2XHKA 1WKMA 3EUHA 1R1TA 1B6AA 1G6NA 3F72A 3DF8A 3BOQA 2GA2A 1K6OA 5F64A 2FF4A 1Z9CA 1R36A 4Z2YA 2R7FA 1U8RA 2VBYA 4BHPA 2PMUA 1Z05A 3G73A 4A2UA 1R22A 1O7LA 5JVTA 1IW7F 5TRDA 1KQ9A 4ESFA 3COAC 4EJOA 4RAZA 1LQ1A 1IUYA 2IA1A 2V9VA 1GHCA 1MDMB 3KP3A 4M74A 2DLLA 4PGHA 2A69F 4HAMA 5DCMB 4KDPA 1D8KA 3V8KA 4L18B 1RNLA 3HSFA 3P9IA 1QNTA 3DKWA 1I1SA 3S2WA 2L4AA 5E17F 3KP7A 2O0YA 4KIBA 3PQJA 3E6MA 4ESBA 1Z6TA 2GZWA 1R1VA 1ZG1A 2W84A 1C0WA 5ICCA 4MNUA 3WODF 4U0WA 2IRFG 4EMSA 3K2ZA 4UVBA 4EJVA 5DCFA 3HUGA 2JSCA 1FPQA 1FT9A 1FZPB 4AD9A 1TQIA 2E7XA 2LNBA 2VE9A 3N97A 3SXYA 4FX4A 4LG0B 3KZZA 3MZHA 3J81Z 2QQ9A 4K2EA 3OV8A 3WTUC 2Z3YA 4I0BA 4LG0A 2Y0MA 3QPHA 1U78A 3F8NA 3M7GA 1BC7C 4NB5A 2IP2A 5KVRA 4L0YB 1REPC 2K4BA 2VC0A 3EQLF 2J5PA 2V79A 3WTYC 2PJPA 4L5JA 1YLFA 2ZKZA 1KU2A 3HHHA 3NQOA 4ENJA 2QZ8A 3F21A 1TQMA 2XAGA 5FB2A 3ECOA 2KJCA 4EQQA 1P2FA 2QBYA 2DFIA 4O6JA 1GXQA 3BJOA 3E6CC 2FMYA 3C18A 5H6QA 2GA1A 4P9FA 3BP8A 1BI1A 3GF2A 3QU6A 3QRFF 3WU1B 4HLYA 4LMYA 5CYVA 4HW0A 2E7WA 5J8FA 2HQNA 3JSOA 1MZBA 3KP5A 2K86A 2HWVA 3O2PE 2WV0A 4KFCA 5E8GA 1YW8A 2EFNA 3RYPA 4CXFA 2Q0OA 2P4WA 3IWZA 2UXNA 4HLXA 2OD5A 1FNNA 1T0FA 3FXRA 4EGZA 4A0ZA 4WCGA 3HTSB 3ZMTA 1HKQA 4BHCA 5L3CA 3BJAA 5TJJA 1LNWA 4P5OA 4ASNA 4MGRA 2KIUA 4UNOA 5LRSA 4RB1A 1J2XA 5E1WA 2PMHA 5HVQC 2L01A 2FE3A 2RVCA 3U1DA 4OIQF 1IRFA 3MQ0A 2DU9A 4MTEA 3RPQA 2ESHA 4XLPF 5CVVA 2EV0A 4XSXF 4GXOA 4WXHA 5AONA 1KU7A 2J5OA 1A04A 4LD5A 4Q47A 2QQAA 2IVMA 2BYVE 2UWMA 4O3MA 2VT2A 1BM9A 1WRJA 4KMUX 3JTHA 2OZUA 3H3ZA 1LVAA 1ONVA 3L9FA 3AAFA 2L02A 4KICA 2FNAA 5ILVA 1ZARA 3R0AA 2FRHA 4ZZDA 1V3FA 5LHHA 3W6KB 3VEPA 5DV5A 3ELKA 3C3WA 3F8CA 3L2CA 3KP2A 3SHFA 1CF7B 1KA8A 4Q48A 1O3SA 2D2WA 3FMQA 3ECHA 2DQLA 1G3WA 1SAXA 5DD4A 5E8IA 3QAHA 5D5UB 3JSPA 3FWEA 3K0LA 2PQ8A 3RKYA 4AIHA 4M72A 2XUBA 1SD7A 4AIJA 2QENA 1Z7UA 3DEUA 3HOTA 4YIFA 1KYZA 1W4MA 3EDPA 4MQVA 1HW5A 1O3TA 4I98B 4WXDA 3I59B 3F8BA 2TDXA 4P55A 2GWRA 2EFQA 3V7CA 3DXJF 3ZMVA 2C6YA 4XRFA 1USTA 1HW2A 2QLZA 3F3XA 4UXNA 2P5KA 3WTWC 1I6XA 2EV5A 3D0SA 3ZMDA 4ENNA 2FOKA 2ZMEB 2EFPA 1T2KA 1XSVA 5K5QA 1ZRDA 1DPUA 2M87A 4KNYA 4QWQA 4LK0F 2ZO4A 4GYGA 5L3FA 3RTRA 5J8CA 3PFIA 1PDNC 3IRRA 4G6DA 3TDZC 2L3DA 1YG2A 3P9KA 1L0OC 3I64A 1J0RA 3R4KA 1D5VA 3FX3A 1JXSA 3I58A 4JQFA 1ON1A 4OOIA 3GFJA 1P4XA 5HLHA 3CDHA 2H09A 2H94A 6PAXA 3ERED 5DUKA 4IRIA 3BPXA 4RGXA 1XB4A 1IN6A 4UVAA 4A6EA 3C1DA 5D8LB 3TKYA 2IA2A 1I5ZA 3SZTA 2B0LA 3ZMUA 1QO0D 1B4AA 1XCBA 2JPCA 1UHWA 3RDIA 3GLXA 4LLGF 1YS7A 2VOPA 3Q5FA 5HS8A 1R7JA 5CVRA 3FM3A 3HOSA 5K5RA 3PQKA 3J7AO 1W7PB 4FHTA 5CLSA 4EV0A 2PN6A 5LHIA 1HSTA 3R60A 1LDJA 1S6LA 4UV9A 3DP7A 3FXUA 1W7PA 2IW5A 1ZREA 3KLNA 3E5UA 4PCQA 1YYVA 3LQRA 1IXCA 2CWEA 5HDGA 2MLGA 2WTEA 3GYHX 1IZ1A 1DDNA 2PLYA 4F7ZA 1PUEE 2O6GE 5L3DA 1B9NA 2MH2A 5LHGA 5K1YA 3GW2A 4KN4X 5E1XA 2GXGA 3W6JB 4M9SA 3IHUA 1LB2A 4N9HA 2XKPA 3KP6A 3BPVA 4HV6A 2P7VB 1P6RA 3M9AA 5DUIA 1WSUA 2DPUA 3ML6A 2MC3A 5ILSA 4G9YA 2ZXJA 1FYKA 4L9TA 4IVNA 5FGMA 3IC7A 5DYMA 3IL2A 2XGXA 1ZG5A 2LF7A 2W57A 3LQQA 5DD8A 1IN5A 4NHJA 4BYYA 3F22A 1OYWA 2Y75A 1B1BA 2ETHA 4ZZLA 2O8XA 1ZRCA 3BROA 1YW9A 4I02A 4JBAA 4PZJA 1QZZA 3J80K 2HKXA 2HKOA 3TO6A 3Q9VA 1GVJA 5EEHA 2A07F 1YFHA 3T1BA 4CYDA 3GVAA 5FLXK 4HF2A 3WTXC 3RI4A 1ZLKA 5LGUA 4HV5A 1BI2A 2K02A 3M1EA 2ZNZA 3IRQA 4HQMA 1R58A 1G4DA 2QUFA 2KRFA 5A2QK 1SFXA 4CDGA 2CO5A 1W7PD 4EJWA 2A61A 3KZYA 1OPCA 2HS5A 1OYYA 4GO1A 1RUOA 5KK1A 5HLIA 2WWYA 4IRHA 1XGSA 3RYRA 1WQ2A 4OIPF 2LF8A 2W25A 2A3SA 2W85A 4MEXF 3NRVA 3ZN0A 2K7LA 2EK5A 3QOPA 3WTSC 3CUQC 2QBYB 3LA7A 1J5YA 4IHSA 3F8FA 4U0VA 2F2EA 3CO6C 4Y15A 2O61A 4G8XA 4ZYGA 1BN5A 1YW7A 5AIQA 1P92A 3GZ5A 3GX4X 5J6XA 3M8FA 4M9XA 5IT3A 5BOXA 3WTVC 2HOEA 4G6QA 2QYOA 4I0AA 2QWWA 2A5YB 4ON0A 2YX7A 4B09A 4QLCU 2EB7A 5D5WB 2EA2A 5LLQA 2D1VA 2EA4A 2IA0A 1TTYA 2RN7A 2QQBA 1RI7A 1X3UA 4JK1X 3TQNA 1IAWA 2DK8A 2LSOA 5F6FA 3CLOA 1FYMA 4M71A 4OIOF 4HQEA 2Z33A 4HDVA 3LA2A 3GEZA 4WWCA 4OMYA 1ZRFA 2HR3A 2JZYA 3K1MA 3KE2A 1S8NA 3JW4A 3HHGA 3T8TA 2NNNA 1TW3A 3QP6A 4GGGA 2Z5UA 4LJZF 2HZTA 4KYWA 4OU0A 1EH6A 3HTUA 5ICEA 4XLNF 3L7WA 5L3EA 4H0EA 5E20A 3V7RA 1YIOA 3JAMZ 2STWA 4BAYA 2XAQA 1OYIA 4P96A 2LDUA 5IT9K 4O5VA 4CGZA 3L00A 3WGIA 2YU3A 2P8TA 1T39A 4M73A 1H0MA 3R6SA 2MLKA 2M45A 2G7HA 1ODDA 2Z99A 2NS0A 4ESJA 3F6VA 4UVCA 1U5TB 5JHUA 2VOOA 2X0LA 4LGWA 5DDGA 1Z6RA 2VBXA 1RIOH 1U5TA 2M1BA 3LAJA 2FQ3A 1AWCA 2DBBA 3B73A 2OA4A 3DV8A 2ISYA 4XSZF 3HSEA 4U7BA 3VFZA 5HS9A 4E70A 4G7ZF 1HSJA 2ESNA 2XASA 4R79A 1R5HA 5BQTA 2FSWA 2WC2A 4IHTA 4LFUA 1R1UA 3DPTA 1P4AA 2HGCA 1Q1HA 2PI0A 5CVJA 2ZNYA 3HRUA 2L54A 1F5TA 3ABUA 2FBIA 1S7OA 3NEUA 1BJAA 4LB6B 4IPAA 3I71A 3GFIA 4BXUA 5D4RA 3J81K 2EWNA 2PG4A 4Y13A 1DP7P 3MAJA 2KIMA 3WE2A 1K78B 1MKMA 1B9MA 3ZN1A 3GXOA 4I7HA 2OQGA 4WF2A 4DNCA 1U6GA 5DEQA 1G3YA 5JFRA 1FP2A 2F5CA 2AS5F 1K78A 2AXLA 4G7OF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJN A;  4KN7 X;  2FML A;  4HZF A;  4PGG A;  4LB5 A;  1TW2 A;  1FBU A;  2VOD A;  2XVC A;  3T5X A;  3J80 Z;  3OOP A;  2Q2E A;  4KIG A;  2HTJ A;  1IN4 A;  1UB9 A;  2GXB A;  4UHT A;  1STZ A;  4FX0 A;  1P4W A;  1SFE A;  4CIC A;  2HFH A;  4U88 A;  4RS8 A;  1UFM A;  3FZV A;  5FFZ A;  2IT0 A;  1BBY A;  3SQN A;  1XCV A;  2VBZ A;  1K7A A;  1O57 A;  3KLO A;  3I5U A;  2BE5 F;  3CUO A;  3KCC A;  1J75 A;  1Z91 A;  2ISZ A;  4YII A;  4GYI A;  2M5W A;  3H3U A;  2V1D A;  1SMT A;  4HOB A;  3CUQ A;  4EVI A;  2A6E F;  4S05 A;  2DT5 A;  3KFW X;  1FWZ A;  3JTG A;  1BIA A;  1MGT A;  3HYI A;  1GXP A;  3F8M A;  5FO5 A;  3T8R A;  4N9I A;  3ZP5 A;  4MHG A;  5FD5 A;  4EJU A;  5ERI A;  5D6F A;  3FMR A;  3P9C A;  2YSR A;  2R7D A;  5FD6 A;  1S29 A;  2NAZ A;  1QZY A;  2F5F A;  4RGR A;  1J7K A;  2R3S A;  2XKO A;  2O03 A;  4ZH4 F;  2M30 A;  3CTA A;  1LEB A;  4EM0 B;  3GUD A;  4AVP A;  3M8E A;  4ZYE A;  3BWG A;  3E97 A;  1FBQ A;  5E1Z B;  4A0Y A;  3FHZ A;  1RZ4 A;  5FFX A;  2DK5 A;  4WX9 A;  2UZK A;  3V4G A;  3HRM A;  2XRN A;  3WU0 A;  2XRO A;  2LKP A;  1V4R A;  2VN2 A;  2ZFW A;  5H20 A;  4RAY A;  2A68 F;  1EH7 A;  3F23 A;  4KT5 C;  2H27 A;  1FP1 D;  3ZMS A;  4MQ9 F;  1ZH5 A;  2XAF A;  4EJT A;  3IKT A;  3FF5 A;  1E2X A;  3V8L A;  2X4H A;  3E5X A;  3KP4 A;  4I01 A;  3KEQ A;  1B59 A;  4G7H F;  4Q4Z F;  1IRG A;  1W5S A;  1OKR A;  5L3B A;  3V8J A;  5F1R A;  1KU3 A;  1KQ0 A;  1ZLJ A;  1XGN A;  1QGP A;  4HX8 A;  3C7J A;  3K1P A;  1JHF A;  1QQI A;  3HRS A;  2VON A;  5ICF A;  4L9N A;  3ULQ B;  1ZAO A;  2EJR A;  1XDU A;  3EYI A;  4HDU A;  4GCV A;  4TV7 A;  4UV8 A;  3TOB A;  2K4J A;  2HYF A;  4YFN F;  2YX4 A;  2HTS A;  2OBP A;  2QVO A;  2HYG D;  1O3Q A;  5ICG A;  1XDS A;  4KUM A;  4AWX B;  3SZP A;  2KJB A;  3Q9S A;  1SD4 A;  1XSX A;  3GFM A;  3TDU C;  3SFZ A;  1KU9 A;  3KEO A;  2MD5 A;  4DQ2 A;  3MZY A;  4RB0 A;  1DUX C;  4A5M A;  2CGP A;  2XV4 S;  2GQQ A;  1YTY A;  1S7A A;  2FBK A;  2DQR A;  3LA3 A;  4AIK A;  1JE8 A;  1KQ8 A;  2NYX A;  4R1H A;  4CZZ A;  1FSE A;  4R8H A;  4A5N A;  1TBX A;  1JGS A;  3MEX A;  1MDM A;  1JHH A;  4RGS A;  5DCM A;  1MJA A;  4G94 A;  3QU3 A;  2DTR A;  2M8E A;  4IXA A;  4EM1 A;  2CFX A;  3LST A;  4YFK F;  3VB2 A;  4I2O A;  1H9G A;  3V7S A;  3K9T A;  4HBL A;  3E6B A;  5E18 F;  1I27 A;  1D3Y A;  4M6Y A;  4LLL A;  4EGY A;  3DFG A;  3ZQ7 A;  2H6C A;  3RPU A;  1BC8 C;  1HQC A;  4IRG A;  2MBF A;  2CYY A;  3B02 A;  2Q8K A;  2NNY A;  1XSD A;  2P7C B;  2P6T A;  3RKW A;  2GIV A;  1FC3 A;  2CG4 A;  4L9J A;  1DPR A;  5HDK A;  2HEO A;  5D4S A;  2ZCW A;  4WK8 F;  1T98 A;  4BH9 A;  4L5I A;  3O3K A;  2FA5 A;  3GWZ A;  3HSR A;  3MFK A;  2STT A;  4BNC A;  2GAU A;  5LBQ A;  2YR2 A;  2F5E A;  3MCZ A;  3GZ6 A;  1H9T A;  2L4M A;  5D5V B;  1XN7 A;  1KGS A;  3I53 A;  2ELH A;  1G3S A;  2VT3 A;  3TGN A;  3WG9 A;  2JT1 A;  1W5T A;  2NRA C;  1F9N A;  1ZN2 A;  1FLI A;  2UXX A;  1Y0U A;  2OU2 A;  3WTZ A;  2BV6 A;  4LLN A;  2FXA A;  1BOA A;  2FBH A;  2PEX A;  3GFL A;  5BPD A;  4RB3 C;  5LRR A;  1TNT A;  1HBX G;  4UUV A;  3I0T A;  4U7D A;  1J9I A;  1SD6 A;  1K79 A;  4ETS A;  2Z9O A;  5BS6 A;  2CQK A;  3H92 A;  4KIF A;  2W24 A;  3E3V A;  5ILU A;  3GO5 A;  3U2R A;  5ED4 A;  4HF0 A;  3QPT A;  2FNP A;  2KKO A;  4HYE A;  3RKX A;  5BPI A;  1IXS B;  1LDK B;  5HOO A;  2JRT A;  4Y17 A;  5LGN A;  1ZGA A;  3N4M A;  5LGT A;  1LEA A;  5BMZ A;  3VOE A;  1TLH B;  4HA8 A;  1FX7 A;  2V1X A;  2D1H A;  3K69 A;  3WTT C;  3CO7 C;  1MD0 A;  3ROU A;  1F1Z A;  2A6H F;  1U3E M;  4ENK A;  1LJ9 A;  1ZGJ A;  3TO7 A;  3I4P A;  2RGV A;  1IF1 A;  2RV8 A;  4NQW A;  1YO5 C;  3ZPL A;  1IN8 A;  2BEO A;  3I54 A;  2P5L C;  1TNS A;  1LDD A;  1J59 A;  3BJ6 A;  3EET A;  1BI0 A;  2PBI A;  3WGG A;  1BIB A;  4A0X A;  1L3L A;  2COM A;  1VTN C;  3RIR A;  3BY6 A;  3K1N A;  4ZYD A;  1UCR A;  3R61 A;  3FMS A;  1XMA A;  4HX7 A;  1QBJ A;  2RC4 A;  1XGO A;  4KMF A;  2OZ6 A;  2P5V A;  4MEY F;  2DO7 A;  1D8J A;  3T0Y A;  3DPL C;  2E1C A;  2RDP A;  2EFW A;  4I09 A;  2DAO A;  1FY7 A;  3P7N A;  2V6C A;  2ADU A;  1G3T A;  1WWX A;  1ZHF A;  2XAH A;  1USS A;  2D45 A;  1T38 A;  3ISP A;  2RNJ A;  3VOD A;  3DQV C;  1CF7 A;  2P6S A;  2VC1 A;  1F4K A;  4L0Z B;  2JTV A;  5D6E A;  2CSO A;  2O3F A;  1R23 A;  2IPQ X;  3F6O A;  4HX4 A;  1WI9 A;  4B8X A;  1KYW A;  2XIG A;  3FM5 A;  2EFO A;  1BI3 A;  4N0B A;  5CVI A;  3WGH A;  4ZYH A;  5D5X B;  1PP7 U;  3EYY A;  2DI3 A;  2MH9 A;  2G7U A;  2ACJ A;  1I1G A;  1ULY A;  2EV6 A;  4OMZ A;  5FLX Z;  2VXZ A;  3I59 A;  1E17 A;  1R00 A;  3CUQ B;  4EM2 A;  1HXD A;  4ENM A;  3IKV A;  2DPD A;  4RB2 C;  1SD5 A;  1IXR C;  2XAJ A;  4U0Y A;  2JPB A;  5D8K B;  3IWF A;  4A12 A;  2RKH A;  5A2Q Z;  3E5Q A;  2ZME A;  4MTD A;  4LK1 F;  3G3Z A;  1CGP A;  4FT8 A;  1YQA A;  4A6D A;  1HW1 A;  2IJL A;  2VE8 A;  1ON2 A;  4IF4 A;  1UHM A;  2ZBK A;  3ABT A;  3BZ6 A;  4S04 A;  1MJ9 A;  5K5O A;  2Y48 A;  1ZYR F;  4M6X A;  1SMY F;  3LWF A;  1YS6 A;  2MA3 A;  2FU4 A;  3MWM A;  4M9Z A;  3JAM K;  1OMI A;  4HF1 A;  1IN7 A;  1AOY A;  3WE3 A;  3TOA A;  1XGM A;  5CJ9 A;  1QPM A;  1RUN A;  2OQR A;  2DW4 A;  2VBW A;  2ZJ2 A;  5JI6 A;  4Q5S F;  5HS7 A;  2V1U A;  4L9V A;  4YG2 F;  3E6D A;  1TQP A;  2BGC A;  5JR3 A;  2E1N A;  5AIP A;  5L3G A;  1O7F A;  4OIR F;  2KIF A;  1NHA A;  1HKS A;  1XMK A;  4XBF A;  5LEK A;  4OIN F;  3TO9 A;  2QM3 A;  1EV7 A;  1T6S A;  3FXQ A;  3L09 A;  3ZMZ A;  5HLG A;  3R0J A;  3QP5 A;  2F5D A;  1O3R A;  4CO8 A;  2YPR A;  2OAZ A;  1ZG3 A;  3RJP A;  2RQP A;  1XD7 A;  2CW0 F;  2FEZ A;  1FBS A;  2HQR A;  5LEJ A;  5CVU A;  4YFX F;  4WXC A;  3HRT A;  4PDK A;  1PP8 F;  4KA4 A;  4IJA A;  4CHU A;  3O6B B;  3LAP A;  3REO A;  1U2W A;  1S3J A;  3BDD A;  3HIF A;  2HDC A;  1HKT A;  4BQA A;  3KET A;  2H6B A;  1FSH A;  1U5T C;  5HDN A;  2G9W A;  5EEG A;  3U9G A;  1FYL A;  1FOK A;  1R5G A;  3LFK A;  1OR7 A;  1EH8 A;  2K27 A;  4BHB A;  1SFU A;  5IT9 Z;  3D5L A;  1Z1D A;  4D0P A;  1MJB A;  2BBY A;  2PFB A;  5H6R A;  4P9U A;  4RGU A;  2XHK A;  1WKM A;  3EUH A;  1R1T A;  1B6A A;  1G6N A;  3F72 A;  3DF8 A;  3BOQ A;  2GA2 A;  1K6O A;  5F64 A;  2FF4 A;  1Z9C A;  1R36 A;  4Z2Y A;  2R7F A;  1U8R A;  2VBY A;  4BHP A;  2PMU A;  1Z05 A;  3G73 A;  4A2U A;  1R22 A;  1O7L A;  5JVT A;  1IW7 F;  5TRD A;  1KQ9 A;  4ESF A;  3COA C;  4EJO A;  4RAZ A;  1LQ1 A;  1IUY A;  2IA1 A;  2V9V A;  1GHC A;  1MDM B;  3KP3 A;  4M74 A;  2DLL A;  4PGH A;  2A69 F;  4HAM A;  5DCM B;  4KDP A;  1D8K A;  3V8K A;  4L18 B;  1RNL A;  3HSF A;  3P9I A;  1QNT A;  3DKW A;  1I1S A;  3S2W A;  2L4A A;  5E17 F;  3KP7 A;  2O0Y A;  4KIB A;  3PQJ A;  3E6M A;  4ESB A;  1Z6T A;  2GZW A;  1R1V A;  1ZG1 A;  2W84 A;  1C0W A;  5ICC A;  4MNU A;  3WOD F;  4U0W A;  2IRF G;  4EMS A;  3K2Z A;  4UVB A;  4EJV A;  5DCF A;  3HUG A;  2JSC A;  1FPQ A;  1FT9 A;  1FZP B;  4AD9 A;  1TQI A;  2E7X A;  2LNB A;  2VE9 A;  3N97 A;  3SXY A;  4FX4 A;  4LG0 B;  3KZZ A;  3MZH A;  3J81 Z;  2QQ9 A;  4K2E A;  3OV8 A;  3WTU C;  2Z3Y A;  4I0B A;  4LG0 A;  2Y0M A;  3QPH A;  1U78 A;  3F8N A;  3M7G A;  1BC7 C;  4NB5 A;  2IP2 A;  5KVR A;  4L0Y B;  1REP C;  2K4B A;  2VC0 A;  3EQL F;  2J5P A;  2V79 A;  3WTY C;  2PJP A;  4L5J A;  1YLF A;  2ZKZ A;  1KU2 A;  3HHH A;  3NQO A;  4ENJ A;  2QZ8 A;  3F21 A;  1TQM A;  2XAG A;  5FB2 A;  3ECO A;  2KJC A;  4EQQ A;  1P2F A;  2QBY A;  2DFI A;  4O6J A;  1GXQ A;  3BJO A;  3E6C C;  2FMY A;  3C18 A;  5H6Q A;  2GA1 A;  4P9F A;  3BP8 A;  1BI1 A;  3GF2 A;  3QU6 A;  3QRF F;  3WU1 B;  4HLY A;  4LMY A;  5CYV A;  4HW0 A;  2E7W A;  5J8F A;  2HQN A;  3JSO A;  1MZB A;  3KP5 A;  2K86 A;  2HWV A;  3O2P E;  2WV0 A;  4KFC A;  5E8G A;  1YW8 A;  2EFN A;  3RYP A;  4CXF A;  2Q0O A;  2P4W A;  3IWZ A;  2UXN A;  4HLX A;  2OD5 A;  1FNN A;  1T0F A;  3FXR A;  4EGZ A;  4A0Z A;  4WCG A;  3HTS B;  3ZMT A;  1HKQ A;  4BHC A;  5L3C A;  3BJA A;  5TJJ A;  1LNW A;  4P5O A;  4ASN A;  4MGR A;  2KIU A;  4UNO A;  5LRS A;  4RB1 A;  1J2X A;  5E1W A;  2PMH A;  5HVQ C;  2L01 A;  2FE3 A;  2RVC A;  3U1D A;  4OIQ F;  1IRF A;  3MQ0 A;  2DU9 A;  4MTE A;  3RPQ A;  2ESH A;  4XLP F;  5CVV A;  2EV0 A;  4XSX F;  4GXO A;  4WXH A;  5AON A;  1KU7 A;  2J5O A;  1A04 A;  4LD5 A;  4Q47 A;  2QQA A;  2IVM A;  2BYV E;  2UWM A;  4O3M A;  2VT2 A;  1BM9 A;  1WRJ A;  4KMU X;  3JTH A;  2OZU A;  3H3Z A;  1LVA A;  1ONV A;  3L9F A;  3AAF A;  2L02 A;  4KIC A;  2FNA A;  5ILV A;  1ZAR A;  3R0A A;  2FRH A;  4ZZD A;  1V3F A;  5LHH A;  3W6K B;  3VEP A;  5DV5 A;  3ELK A;  3C3W A;  3F8C A;  3L2C A;  3KP2 A;  3SHF A;  1CF7 B;  1KA8 A;  4Q48 A;  1O3S A;  2D2W A;  3FMQ A;  3ECH A;  2DQL A;  1G3W A;  1SAX A;  5DD4 A;  5E8I A;  3QAH A;  5D5U B;  3JSP A;  3FWE A;  3K0L A;  2PQ8 A;  3RKY A;  4AIH A;  4M72 A;  2XUB A;  1SD7 A;  4AIJ A;  2QEN A;  1Z7U A;  3DEU A;  3HOT A;  4YIF A;  1KYZ A;  1W4M A;  3EDP A;  4MQV A;  1HW5 A;  1O3T A;  4I98 B;  4WXD A;  3I59 B;  3F8B A;  2TDX A;  4P55 A;  2GWR A;  2EFQ A;  3V7C A;  3DXJ F;  3ZMV A;  2C6Y A;  4XRF A;  1UST A;  1HW2 A;  2QLZ A;  3F3X A;  4UXN A;  2P5K A;  3WTW C;  1I6X A;  2EV5 A;  3D0S A;  3ZMD A;  4ENN A;  2FOK A;  2ZME B;  2EFP A;  1T2K A;  1XSV A;  5K5Q A;  1ZRD A;  1DPU A;  2M87 A;  4KNY A;  4QWQ A;  4LK0 F;  2ZO4 A;  4GYG A;  5L3F A;  3RTR A;  5J8C A;  3PFI A;  1PDN C;  3IRR A;  4G6D A;  3TDZ C;  2L3D A;  1YG2 A;  3P9K A;  1L0O C;  3I64 A;  1J0R A;  3R4K A;  1D5V A;  3FX3 A;  1JXS A;  3I58 A;  4JQF A;  1ON1 A;  4OOI A;  3GFJ A;  1P4X A;  5HLH A;  3CDH A;  2H09 A;  2H94 A;  6PAX A;  3ERE D;  5DUK A;  4IRI A;  3BPX A;  4RGX A;  1XB4 A;  1IN6 A;  4UVA A;  4A6E A;  3C1D A;  5D8L B;  3TKY A;  2IA2 A;  1I5Z A;  3SZT A;  2B0L A;  3ZMU A;  1QO0 D;  1B4A A;  1XCB A;  2JPC A;  1UHW A;  3RDI A;  3GLX A;  4LLG F;  1YS7 A;  2VOP A;  3Q5F A;  5HS8 A;  1R7J A;  5CVR A;  3FM3 A;  3HOS A;  5K5R A;  3PQK A;  3J7A O;  1W7P B;  4FHT A;  5CLS A;  4EV0 A;  2PN6 A;  5LHI A;  1HST A;  3R60 A;  1LDJ A;  1S6L A;  4UV9 A;  3DP7 A;  3FXU A;  1W7P A;  2IW5 A;  1ZRE A;  3KLN A;  3E5U A;  4PCQ A;  1YYV A;  3LQR A;  1IXC A;  2CWE A;  5HDG A;  2MLG A;  2WTE A;  3GYH X;  1IZ1 A;  1DDN A;  2PLY A;  4F7Z A;  1PUE E;  2O6G E;  5L3D A;  1B9N A;  2MH2 A;  5LHG A;  5K1Y A;  3GW2 A;  4KN4 X;  5E1X A;  2GXG A;  3W6J B;  4M9S A;  3IHU A;  1LB2 A;  4N9H A;  2XKP A;  3KP6 A;  3BPV A;  4HV6 A;  2P7V B;  1P6R A;  3M9A A;  5DUI A;  1WSU A;  2DPU A;  3ML6 A;  2MC3 A;  5ILS A;  4G9Y A;  2ZXJ A;  1FYK A;  4L9T A;  4IVN A;  5FGM A;  3IC7 A;  5DYM A;  3IL2 A;  2XGX A;  1ZG5 A;  2LF7 A;  2W57 A;  3LQQ A;  5DD8 A;  1IN5 A;  4NHJ A;  4BYY A;  3F22 A;  1OYW A;  2Y75 A;  1B1B A;  2ETH A;  4ZZL A;  2O8X A;  1ZRC A;  3BRO A;  1YW9 A;  4I02 A;  4JBA A;  4PZJ A;  1QZZ A;  3J80 K;  2HKX A;  2HKO A;  3TO6 A;  3Q9V A;  1GVJ A;  5EEH A;  2A07 F;  1YFH A;  3T1B A;  4CYD A;  3GVA A;  5FLX K;  4HF2 A;  3WTX C;  3RI4 A;  1ZLK A;  5LGU A;  4HV5 A;  1BI2 A;  2K02 A;  3M1E A;  2ZNZ A;  3IRQ A;  4HQM A;  1R58 A;  1G4D A;  2QUF A;  2KRF A;  5A2Q K;  1SFX A;  4CDG A;  2CO5 A;  1W7P D;  4EJW A;  2A61 A;  3KZY A;  1OPC A;  2HS5 A;  1OYY A;  4GO1 A;  1RUO A;  5KK1 A;  5HLI A;  2WWY A;  4IRH A;  1XGS A;  3RYR A;  1WQ2 A;  4OIP F;  2LF8 A;  2W25 A;  2A3S A;  2W85 A;  4MEX F;  3NRV A;  3ZN0 A;  2K7L A;  2EK5 A;  3QOP A;  3WTS C;  3CUQ C;  2QBY B;  3LA7 A;  1J5Y A;  4IHS A;  3F8F A;  4U0V A;  2F2E A;  3CO6 C;  4Y15 A;  2O61 A;  4G8X A;  4ZYG A;  1BN5 A;  1YW7 A;  5AIQ A;  1P92 A;  3GZ5 A;  3GX4 X;  5J6X A;  3M8F A;  4M9X A;  5IT3 A;  5BOX A;  3WTV C;  2HOE A;  4G6Q A;  2QYO A;  4I0A A;  2QWW A;  2A5Y B;  4ON0 A;  2YX7 A;  4B09 A;  4QLC U;  2EB7 A;  5D5W B;  2EA2 A;  5LLQ A;  2D1V A;  2EA4 A;  2IA0 A;  1TTY A;  2RN7 A;  2QQB A;  1RI7 A;  1X3U A;  4JK1 X;  3TQN A;  1IAW A;  2DK8 A;  2LSO A;  5F6F A;  3CLO A;  1FYM A;  4M71 A;  4OIO F;  4HQE A;  2Z33 A;  4HDV A;  3LA2 A;  3GEZ A;  4WWC A;  4OMY A;  1ZRF A;  2HR3 A;  2JZY A;  3K1M A;  3KE2 A;  1S8N A;  3JW4 A;  3HHG A;  3T8T A;  2NNN A;  1TW3 A;  3QP6 A;  4GGG A;  2Z5U A;  4LJZ F;  2HZT A;  4KYW A;  4OU0 A;  1EH6 A;  3HTU A;  5ICE A;  4XLN F;  3L7W A;  5L3E A;  4H0E A;  5E20 A;  3V7R A;  1YIO A;  3JAM Z;  2STW A;  4BAY A;  2XAQ A;  1OYI A;  4P96 A;  2LDU A;  5IT9 K;  4O5V A;  4CGZ A;  3L00 A;  3WGI A;  2YU3 A;  2P8T A;  1T39 A;  4M73 A;  1H0M A;  3R6S A;  2MLK A;  2M45 A;  2G7H A;  1ODD A;  2Z99 A;  2NS0 A;  4ESJ A;  3F6V A;  4UVC A;  1U5T B;  5JHU A;  2VOO A;  2X0L A;  4LGW A;  5DDG A;  1Z6R A;  2VBX A;  1RIO H;  1U5T A;  2M1B A;  3LAJ A;  2FQ3 A;  1AWC A;  2DBB A;  3B73 A;  2OA4 A;  3DV8 A;  2ISY A;  4XSZ F;  3HSE A;  4U7B A;  3VFZ A;  5HS9 A;  4E70 A;  4G7Z F;  1HSJ A;  2ESN A;  2XAS A;  4R79 A;  1R5H A;  5BQT A;  2FSW A;  2WC2 A;  4IHT A;  4LFU A;  1R1U A;  3DPT A;  1P4A A;  2HGC A;  1Q1H A;  2PI0 A;  5CVJ A;  2ZNY A;  3HRU A;  2L54 A;  1F5T A;  3ABU A;  2FBI A;  1S7O A;  3NEU A;  1BJA A;  4LB6 B;  4IPA A;  3I71 A;  3GFI A;  4BXU A;  5D4R A;  3J81 K;  2EWN A;  2PG4 A;  4Y13 A;  1DP7 P;  3MAJ A;  2KIM A;  3WE2 A;  1K78 B;  1MKM A;  1B9M A;  3ZN1 A;  3GXO A;  4I7H A;  2OQG A;  4WF2 A;  4DNC A;  1U6G A;  5DEQ A;  1G3Y A;  5JFR A;  1FP2 A;  2F5C A;  2AS5 F;  1K78 A;  2AXL A;  4G7O F; 
#chains in the Genus database with same CATH topology
 2DOA A;  3HM5 A;  3CJN A;  4KN7 X;  4C3H J;  2E1O A;  2FML A;  2L9R A;  3DPU A;  3ZQI A;  4HZF A;  3MN2 A;  3A0H C;  4PGG A;  4LB5 A;  2EZH A;  3S17 J;  1TW2 A;  1FBU A;  2CS3 A;  2I8D A;  2VOD A;  3UKG A;  1LVK A;  4DZP A;  5FKM A;  2XVC A;  2JJ7 A;  3T5X A;  3J80 Z;  3OOP A;  1RKT A;  3JAM R;  2Q2E A;  4KIG A;  3S2H J;  2HTJ A;  1IN4 A;  1UB9 A;  2GXB A;  4UHT A;  1STZ A;  4FX0 A;  3OIQ A;  1P4W A;  1SFE A;  9ANT A;  1MMD A;  4CIC A;  2HFH A;  4U88 A;  3W2A A;  2LKX A;  4RS8 A;  1UFM A;  3FZV A;  5FFZ A;  2IT0 A;  1FEX A;  3DKX A;  1YJW I;  1BR2 A;  3RSN A;  5M5W J;  1BBY A;  1RES A;  2F4O B;  3SQN A;  1MSE C;  4NDL A;  1XCV A;  4N4O B;  1X4O A;  1WGX A;  2VBZ A;  2HVQ A;  1K7A A;  1O57 A;  3KLO A;  3I5U A;  2BE5 F;  3CUO A;  3F9K A;  3KCC A;  1J75 A;  2JRM A;  2DA6 A;  3PFY A;  1Z91 A;  3BG3 A;  2ISZ A;  1YJ9 I;  4YII A;  4GYI A;  1PYV A;  4I76 A;  3CC7 I;  2M5W A;  2QSF X;  3OYG A;  2XPW A;  3H3U A;  2KRH A;  2V1D A;  1SMT A;  4HOB A;  3CUQ A;  4A3E J;  4EVI A;  2A6E F;  4S05 A;  3PUF A;  2DT5 A;  2Y0S A;  4XOR A;  3GTP J;  3KFW X;  1FWZ A;  3JTG A;  1BIA A;  2H1L A;  1MGT A;  3HYI A;  1RRJ A;  1GXP A;  3F8M A;  3G1O A;  5FO5 A;  2ME6 A;  3T8R A;  4N9I A;  3ZP5 A;  2JA7 J;  4MHG A;  1Q1V A;  5FD5 A;  4EJU A;  2PX9 A;  1K4T A;  3CQZ J;  1P7I A;  5ERI A;  5D6F A;  3FMR A;  5EG0 B;  2UV1 A;  5HNH A;  3QOE A;  2VI6 A;  2ZJP F;  4E7H A;  5F08 A;  5HNF A;  3P9C A;  2YSR A;  2M7A A;  2OUM A;  2R7D A;  1W1W E;  1HCR A;  5FD6 A;  4E7Z A;  2Z1D A;  1S29 A;  1AHD P;  1GUU A;  3GTM J;  2NAZ A;  1XMX A;  1QZY A;  4MIM A;  1B8I A;  5EG0 A;  2F5F A;  4RGR A;  4RMN A;  3JRC A;  1J7K A;  1VQ9 I;  2R3S A;  1FMV A;  2O03 A;  2XKO A;  3A2K A;  4ZH4 F;  2M30 A;  3S1R J;  1VQL I;  3CTA A;  1LEB A;  4QPQ A;  4EM0 B;  4A3F J;  5B5E C;  3GUD A;  4AVP A;  3M8E A;  4ZYE A;  2M2E A;  1YJN I;  3BWG A;  3E97 A;  4BGD A;  1FBQ A;  3KX2 A;  3NWT A;  5E1Z B;  4A0Y A;  3AKZ A;  3FHZ A;  1RZ4 A;  5FFX A;  2DK5 A;  4WX9 A;  2FJ1 A;  2CQQ A;  2UZK A;  2V26 A;  3CJT B;  4BQO A;  3L2V A;  4UB8 C;  3V4G A;  2KZG A;  4HPQ A;  3HRM A;  4B48 A;  3RCO A;  2XRN A;  2CUZ A;  3WHB A;  3OS2 A;  3Q3S A;  3WU0 A;  2XRO A;  2LKP A;  1V4R A;  2VN2 A;  2ZFW A;  1ITY A;  5H20 A;  1ZEL A;  4RAY A;  2A68 F;  3DTK A;  3TP0 A;  1WVR A;  3OS0 A;  1EH7 A;  3CMM A;  1VQ4 I;  4LIV A;  3H5N A;  2EPF A;  3F23 A;  2R5Z B;  1IUF A;  2GXA A;  2FX0 A;  4KT5 C;  2WV1 A;  2E35 A;  2H27 A;  1FP1 D;  2CFO A;  1AA7 A;  4MQ9 F;  3ZMS A;  2XAF A;  1ZH5 A;  4EJT A;  1OCP A;  3IKT A;  3FF5 A;  2QEX I;  3AL0 C;  1E2X A;  3V8L A;  2E1M B;  2X4H A;  2OTJ I;  3E5X A;  3K6G A;  3G1L A;  2H1K A;  3KP4 A;  4I01 A;  4II2 A;  3DTI A;  2R93 J;  2ZSI B;  2VKE A;  2VQL A;  3KEQ A;  1B59 A;  1QHG A;  3GZN B;  2R7W A;  3BC8 A;  2DMU A;  2X1D A;  3L2U A;  4G7H F;  4QSH A;  4Q4Z F;  1IRG A;  1VQO I;  3PO3 J;  1W5S A;  3J80 R;  1OKR A;  2JA2 A;  4U87 A;  2VJ5 A;  5L3B A;  2KRC A;  2PMZ N;  3V8J A;  3J7Y J;  1ETX A;  1IRZ A;  2GM4 A;  4FQG A;  5F1R A;  5KAF C;  1KU3 A;  3OR2 C;  4M3G A;  1KQ0 A;  2XGD A;  1ZLJ A;  2F6C A;  1XGN A;  1QGP A;  4HX8 A;  3C7J A;  3K1P A;  3JRB A;  1JHF A;  1QQI A;  2M4K A;  1O4X A;  3LSR A;  3HRS A;  5J40 A;  2VON A;  1A36 A;  5ICF A;  4L9N A;  2WAD A;  3ULQ B;  1ZAO A;  2X6Y A;  2EJR A;  1XDU A;  2BY2 A;  3EYI A;  2LH9 A;  2BHZ A;  4HDU A;  5C3E J;  4GCV A;  2VKH A;  1NK3 P;  4F55 A;  4TV7 A;  4D1Q A;  4UV8 A;  2E34 A;  3TOB A;  4NUB A;  1VZ0 A;  3W2V A;  2K4J A;  2HYF A;  3VSL A;  4YFN F;  3WU2 C;  1OCC H;  2YX4 A;  2HTS A;  4XRM A;  4HEA 2;  4AVZ A;  4B47 A;  4A3C J;  2OBP A;  2QVO A;  4EAT A;  2HYG D;  1O3Q A;  1TL8 A;  1XG1 A;  5ICG A;  1H89 C;  3JRH A;  1XDS A;  1QHH D;  2GLO A;  3S1M J;  1U0J A;  4KUM A;  2VL8 A;  4AWX B;  5M3F J;  3SZP A;  1TWC J;  2KJB A;  3Q9S A;  1SD4 A;  2P81 A;  1XSX A;  3GFM A;  4IKF A;  2JVG A;  3SFZ A;  3TDU C;  3OYL A;  2WAE A;  1KU9 A;  3KEO A;  1B72 A;  2MD5 A;  4DQ2 A;  4DZJ A;  3MZY A;  1R5I D;  2ZB9 A;  1LUJ B;  4RB0 A;  5FRN A;  2Y0S N;  1DUX C;  4A5M A;  2CGP A;  3ZQH A;  2XV4 S;  2OC6 A;  3TL4 X;  2GQQ A;  3CCV I;  1YTY A;  5DTD A;  1S7A A;  2FBK A;  2HOA A;  5F0C A;  2VKD A;  4PJL A;  3TW7 A;  2DQR A;  3LA3 A;  4AIK A;  1JE8 A;  1KQ8 A;  3E0J B;  2NYX A;  4R1H A;  4CZZ A;  1FSE A;  4R8H A;  4A5N A;  2HVR A;  1TBX A;  4A3B J;  1JGS A;  3PL8 A;  3GTG J;  3MEX A;  4FAS D;  3G2B A;  1MDM A;  2ID3 A;  1JHH A;  4RGS A;  1K61 A;  4FIS A;  5DCM A;  1MJA A;  1W36 C;  3PUB A;  3FXJ A;  4G94 A;  3QU3 A;  3H36 A;  3K70 D;  2DTR A;  2M8E A;  3K4N A;  4IXA A;  4EM1 A;  2DYR H;  2CFX A;  3DU5 A;  2LD5 A;  3LST A;  3FIW A;  4YFK F;  2KQR A;  1MW7 A;  3VB2 A;  4I2O A;  1NTC A;  5CQG A;  1H9G A;  3V7S A;  3JRA A;  1RPW A;  3K9T A;  4HBL A;  3CCE I;  3E6B A;  1POG A;  1UEL B;  5E18 F;  1SFO J;  1I27 A;  1IO2 A;  1D3Y A;  4YRV A;  4M6Y A;  4LLL A;  4C30 A;  4EGY A;  1D0X A;  3BT9 A;  3DFG A;  2M0C A;  3ZQ7 A;  1OCR H;  1Y39 A;  2H6C A;  4XN0 A;  3RPU A;  1BC8 C;  1HQC A;  2EIJ H;  1ZTR A;  3H5R A;  3K4M A;  2NXN B;  2BW3 B;  4CCM A;  3GTO J;  3ZGK A;  1FOW A;  4IRG A;  3OYK A;  2MBF A;  2CYY A;  3B02 A;  2Q8K A;  2NNY A;  1XSD A;  4UUT A;  4DW6 A;  2DXI A;  2P7C B;  2P6T A;  1E3H A;  5KHD A;  2QQ8 A;  3RKW A;  2GIV A;  1FC3 A;  2CG4 A;  2MD0 A;  4L9J A;  2BW3 A;  2DA7 A;  2XPV A;  1DPR A;  2LOO A;  1N25 A;  1OFC X;  5HDK A;  2HEO A;  2ZME C;  3CCS I;  2CQX A;  5D4S A;  2ZCW A;  4WK8 F;  2QSH X;  1T98 A;  4BH9 A;  2AQE A;  3HGG A;  4L5I A;  3O3K A;  2FA5 A;  1ETQ A;  3HG9 A;  1MBG A;  3GWZ A;  3HSR A;  1WI3 A;  3MFK A;  2STT A;  4BNC A;  3CCQ I;  2GAU A;  5LBQ A;  3M3Y J;  2YR2 A;  2F5E A;  4EEF G;  3PM1 A;  3MCZ A;  3PNV A;  4AU7 A;  2KZV A;  3GZ6 A;  4AM3 A;  1H9T A;  2L4M A;  5D5V B;  1Z3Y A;  4DIQ A;  1XN7 A;  1MBF A;  1QZE A;  3GBG A;  1KGS A;  3I53 A;  2HDW A;  2ELH A;  1G3S A;  2VT3 A;  3TGN A;  4ZTJ A;  3WG9 A;  3RKQ A;  3G4S I;  2JT1 A;  1W5T A;  1YE9 A;  1QPI A;  2NRA C;  3K2A A;  1ETO A;  1F9N A;  1UAA A;  4NC7 A;  1ZN2 A;  1FLI A;  3LSK A;  4V2F A;  4A3J J;  2HZD A;  2UXX A;  4B43 A;  1Y0U A;  5DM7 F;  2OU2 A;  3WTZ A;  4IO9 F;  2BV6 A;  4LLN A;  2FXA A;  1BOA A;  2FBH A;  2PEX A;  3GFL A;  5BPD A;  4BY1 J;  4RB3 C;  2L7F P;  2OF7 A;  3OIP A;  5LRR A;  2R7R A;  1YX3 A;  1U8B A;  4P1W A;  4J00 A;  4C2T A;  1TNT A;  2JA6 J;  5GPA A;  1HBX G;  4XN3 A;  2WB1 A;  4BEH B;  2LR8 A;  4UUV A;  2Y30 A;  3I0T A;  4XKW A;  4U7D A;  1JGG A;  2L9V A;  1JKO C;  4XID A;  1J9I A;  1BR1 A;  4GDF A;  1SD6 A;  1K79 A;  4ETS A;  2Z9O A;  3CDI A;  5BS6 A;  2D5V A;  4BJ6 C;  3V42 A;  2HQA A;  1JKR C;  2CQK A;  3H92 A;  3DEE A;  4KIF A;  4JYK A;  2L7K A;  2W24 A;  3E3V A;  4AUX A;  2CJJ A;  1NG6 A;  3RZD J;  3OMY A;  3KIO A;  4E6K G;  5ILU A;  1GVD A;  3GO5 A;  3MVP A;  3U2R A;  5ED4 A;  4HF0 A;  3QPT A;  2FNP A;  2KKO A;  2E5Z A;  2Y9Y A;  1Y1V J;  2MZ4 A;  4HYE A;  1WHU A;  3RKX A;  3MD2 A;  3H9G A;  2E19 A;  2K3P A;  5BPI A;  2CMP A;  1IXS B;  3A1Y A;  3BG7 A;  1LDK B;  5HOO A;  4DBR A;  1Y8R B;  2JRT A;  4LIU A;  4Y17 A;  4DJA A;  5FKL A;  1ETV A;  4B3X A;  5LGN A;  4A3D J;  1ZGA A;  2VIX A;  5GTI C;  3N4M A;  2CV1 A;  5LGT A;  1LEA A;  5BMZ A;  3VOE A;  1TLH B;  3OYB A;  4HA8 A;  3ERM A;  4NQW B;  4PSX A;  1FX7 A;  2V1X A;  1YHQ I;  2D1H A;  3K69 A;  3WTT C;  3CO7 C;  1MD0 A;  3ROU A;  1F1Z A;  3RPU D;  3MMY B;  3BCB A;  1D5Y A;  1E3O C;  3ZRG A;  2A6H F;  1U3E M;  1NG7 A;  4ENK A;  4A3L J;  1LJ9 A;  2Y31 A;  1ZGJ A;  1FOY A;  1V54 H;  3TO7 A;  3I4P A;  2RGV A;  1HLV A;  5TIS C;  2RV8 A;  3QPS A;  4NQW A;  1YO5 C;  1IF1 A;  3ZPL A;  3JCU C;  1IN8 A;  2BEO A;  2O8K A;  1OR7 C;  3I54 A;  2P5L C;  1T08 B;  1WJB A;  2LBF B;  1TNS A;  2M4G A;  1MMA A;  1LDD A;  1X1C A;  4XOT A;  2X6O A;  1J59 A;  4GRI A;  4PFP A;  3BJ6 A;  2IBD A;  3EET A;  1IDY A;  1BI0 A;  2F4M B;  2PBI A;  3WGG A;  1BIB A;  4A0X A;  1L3L A;  2COM A;  5IYB J;  2DMP A;  1VTN C;  3CJR B;  3RIR A;  3BY6 A;  2HNH A;  3DU6 A;  1UCR A;  3K1N A;  4ZYD A;  2EIL H;  1LE8 B;  3R61 A;  3L2R A;  3FMS A;  1XMA A;  3BTL A;  2E5N A;  1PUF A;  3AFH A;  4HX7 A;  4MO7 A;  1QBJ A;  3BLY A;  2XGE A;  1RQ6 A;  2RC4 A;  1XGO A;  3QYB A;  4KMF A;  2R7U A;  2OZ6 A;  4ABZ A;  2P5V A;  4MEY F;  2VQH A;  1AKH A;  4OAZ A;  1DU6 A;  2DO7 A;  4CCK A;  1D8J A;  1FJL A;  3T0Y A;  3DPL C;  2E1C A;  2MSY A;  5KAI C;  3D1N I;  2LK2 A;  2RDP A;  2EFW A;  2R7O A;  4Z6Y A;  4I09 A;  4RA2 A;  3H0D A;  2DAO A;  5E79 C;  5E3M A;  1FY7 A;  3P7N A;  2V6C A;  2GBY A;  1WWX A;  1G3T A;  2ADU A;  1ZHF A;  2XAH A;  1USS A;  2D45 A;  3HZJ A;  1T38 A;  3LFU A;  3ISP A;  2RNJ A;  4CA0 A;  5C4X J;  3VOD A;  3SDB A;  4KIS A;  3DQV C;  3CES A;  4W1U A;  1VQN I;  1HA8 A;  1CF7 A;  2P6S A;  2E2J J;  2VC1 A;  1ETY A;  4RDU A;  1JT6 A;  1JJ8 C;  1ZK8 A;  1F4K A;  4L0Z B;  2JTV A;  5D6E A;  4AID A;  3EUK L;  2CSO A;  2Y9Z A;  3AG3 H;  1Z21 A;  2Y69 H;  2O3F A;  2LY9 A;  1R23 A;  2IPQ X;  3F6O A;  4HX4 A;  2Q2E B;  1WI9 A;  4B8X A;  1FOX A;  1KYW A;  2XIG A;  3FM5 A;  3HGY A;  3QYF A;  2K9Q A;  3DWL E;  1W0T A;  2EFO A;  1BW6 A;  2NOG A;  1BI3 A;  3ABM H;  4N0B A;  5J4V A;  4CYC B;  1HDD C;  5CVI A;  2IS6 A;  3WGH A;  4ZYH A;  4NBQ A;  5D5X B;  1PP7 U;  1IV6 A;  2HOT A;  3FHN A;  3EYY A;  2LFB A;  2DI3 A;  2VUM J;  3CZ6 A;  2MH9 A;  5TGT A;  2G7U A;  3K10 A;  3ONQ A;  3JRF A;  2ACJ A;  2XSJ C;  2K85 A;  3BG5 A;  2LMD A;  2M0M A;  2WB1 N;  4XKB A;  4CYC A;  3X2Q H;  1I1G A;  1ULY A;  2EV6 A;  2IEK A;  4OMZ A;  2CU7 A;  5FLX Z;  2VXZ A;  4CCN A;  4IL6 C;  3O8H A;  2R7X A;  1H8A C;  3I59 A;  1E17 A;  5EF6 A;  1X1D A;  1LFU P;  1R00 A;  3BCA A;  3CUQ B;  4EM2 A;  3UNG C;  3A02 A;  3FKJ A;  1HXD A;  1OQY A;  3OYN A;  2ICW G;  4ENM A;  1WJC A;  3IKV A;  2A6T A;  2K9L A;  3BR5 A;  4B4C A;  2DPD A;  3HBL A;  2BY1 A;  4RB2 C;  3K4L A;  2Z2S B;  1SD5 A;  1IXR C;  4BJ5 C;  1YI2 I;  1N78 A;  3D5S C;  2XAJ A;  2AXT C;  4XRS A;  4U0Y A;  2JPB A;  3CDL A;  5D8K B;  3H35 A;  5J3L A;  2DA3 A;  2V9K A;  3IWF A;  1HOM A;  4A12 A;  5E3N A;  2RKH A;  4HST A;  4FE4 A;  5A2Q Z;  2M34 A;  3E5Q A;  2ZME A;  1TP4 A;  4MTD A;  4LK1 F;  1OCO H;  3G3Z A;  3CCL I;  3ESW B;  1CGP A;  4FT8 A;  1YQA A;  3TBI A;  2BY3 A;  4A6D A;  5FLM J;  2MGQ A;  3CMY A;  3KZI C;  1P7J A;  1IRX A;  2ELJ A;  4YEJ A;  1E0E A;  1HW1 A;  1MBK A;  2IJL A;  2VE8 A;  1ON2 A;  4IF4 A;  4MFE A;  4CSW A;  5H2F C;  1MMN A;  5E3O A;  4J01 A;  1ZGW A;  1RR8 C;  3OOU A;  1B8I B;  1F36 A;  1UHM A;  3OSF A;  3JRG A;  1PUF B;  2ZBK A;  3ABT A;  2NS8 A;  2R7T A;  3BZ6 A;  4S04 A;  1V5F A;  1MJ9 A;  3CF2 A;  2CW8 A;  2Y48 A;  5K5O A;  1ZYR F;  4M6X A;  5JLW A;  4A3M J;  4BDY A;  4M3F A;  1SMY F;  4CH7 A;  2DT6 A;  3LWF A;  1YS6 A;  4II3 A;  2MA3 A;  3I3L A;  2W00 A;  2BHY A;  1ETW A;  2FU4 A;  2JN6 A;  2JWT A;  1DGW Y;  3BR2 A;  3MWM A;  4M9Z A;  1KON A;  1XC5 A;  3RQ4 A;  4DYC A;  1OMI A;  3PNT A;  3QOD A;  3JAM K;  3HOU J;  5J4Y A;  4HF1 A;  4ANJ A;  1IN7 A;  1ERD A;  3OY9 A;  3VYR B;  1AOY A;  3WE3 A;  2R5Y B;  3TOA A;  1XGM A;  5CJ9 A;  1QPM A;  1RUN A;  2OQR A;  2DW4 A;  4M3D A;  2X1C A;  2VBW A;  2IGO A;  2ZJ2 A;  5JI6 A;  4Q5S F;  5HS7 A;  2V1U A;  4V2G A;  1TWH J;  4L9V A;  4DOZ A;  4YG2 F;  2R5Y A;  2B7E A;  1ZR4 A;  3GCM A;  4J19 A;  3ZR8 X;  3M8J A;  2WAQ N;  3E6D A;  1ENH A;  4RAF A;  1EJ9 A;  2EZK A;  3BQY A;  1TQP A;  2BGC A;  4F3Q A;  4KT6 A;  3LSG A;  5JR3 A;  2E1N A;  5AIP A;  1I50 J;  1R6R A;  5L3G A;  4XLF A;  1T0F C;  1O7F A;  4OIR F;  3VPR A;  2KIF A;  1NHA A;  4DBQ A;  1HKS A;  3VSK A;  1XMK A;  4XBF A;  1MBE A;  2M3A A;  5LEK A;  4OIN F;  3TO9 A;  2QM3 A;  1K4S A;  1X19 A;  2JK3 A;  2LRD A;  2Q1Z B;  3A01 A;  1EV7 A;  3FXK A;  1DGR M;  5GPC A;  1MH4 A;  1QRY A;  5IP7 J;  1I3A A;  1T6S A;  3FXQ A;  3DKY A;  4OWR B;  2X6X A;  1AU7 A;  4BBS J;  3L09 A;  3ZMZ A;  4I6Z A;  5HLG A;  2VXD A;  3QP5 A;  2F5D A;  3R0J A;  1O3R A;  4CO8 A;  2YPR A;  5B1B H;  2OAZ A;  3GTJ J;  1OJL A;  1ZG3 A;  3E1S A;  2RQP A;  3RJP A;  1XD7 A;  2CW0 F;  2FEZ A;  2WY8 Q;  1FBS A;  2HQR A;  3CCR I;  5LEJ A;  5CVU A;  4YFX F;  4WXC A;  3QQA A;  3HRT A;  2KLO A;  4PDK A;  4Y52 J;  1ORK A;  1PP8 F;  4KA4 A;  1SAU A;  5M5X J;  3DLA A;  4IJA A;  1MND A;  4Y3O A;  4CHU A;  3O6B B;  1YOV B;  4Y4R A;  3LAP A;  4C3I J;  2HQ5 A;  3REO A;  1U2W A;  1S3J A;  5FLX R;  3BDD A;  3HIF A;  2ZJR F;  2HDC A;  1HKT A;  1Z77 A;  2K40 A;  2R92 J;  4BQA A;  4KIT B;  3KET A;  2H6B A;  1FSH A;  1U5T C;  5HDN A;  2G9W A;  5EEG A;  3U9G A;  2BXZ A;  1T33 A;  4BL0 B;  1DU0 A;  1FYL A;  1FOK A;  1R5G A;  3WHC A;  3LFK A;  1OR7 A;  1EH8 A;  2K27 A;  4BHB A;  1SFU A;  2E2H J;  1MBJ A;  5IT9 Z;  2L7Z A;  3D5L A;  1Z1D A;  4D0P A;  1RET A;  3ZOB A;  1MNE A;  1MJB A;  2BBY A;  2PFB A;  5H6R A;  4P9U A;  4RGU A;  2XHK A;  1WKM A;  5EZG A;  3EUH A;  2EH3 A;  1TT0 A;  4UUS A;  4PSW A;  1R1T A;  1B6A A;  1BR4 A;  1MBH A;  5A2Q R;  2DMN A;  1G6N A;  5FKN A;  1B72 B;  4QPO A;  3F72 A;  3DF8 A;  3BOQ A;  2GA2 A;  4A93 J;  5B3S H;  1S72 I;  1K6O A;  5F64 A;  2FF4 A;  3BR1 A;  1Z9C A;  1JTX A;  2VLA A;  1R36 A;  4Z2Y A;  2R7F A;  1JTY A;  1U8R A;  2F4I A;  1X2M A;  3AG2 H;  2VBY A;  4BHP A;  2PMU A;  2M9H A;  2VKV A;  3DEW A;  1Z05 A;  3G73 A;  1S9H A;  2TCT A;  2CRG A;  1UMQ A;  2NS7 A;  1TWG J;  1R22 A;  4A2U A;  1O7L A;  5JVT A;  3TED A;  1IW7 F;  5TRD A;  3OYF A;  3QWL A;  2DA4 A;  1KQ9 A;  4E7S A;  4ESF A;  3H1C A;  1MH3 A;  2WAF A;  2QGU A;  3COA C;  1X1A A;  1WJ5 A;  4EJO A;  4RAZ A;  1LQ1 A;  1IUY A;  5IYD J;  1DP3 A;  1K6Y A;  2IA1 A;  1MIJ A;  2V9V A;  2HOS A;  1MDM B;  1GHC A;  3KP3 A;  4M74 A;  2ZJQ F;  2DLL A;  4PGH A;  2A69 F;  5F0H A;  4HAM A;  5DCM B;  4KDP A;  2AHQ A;  1D8K A;  3J7A Y;  3FXL A;  4XKC A;  2M8G X;  4BKX A;  3V8K A;  4L18 B;  1SVO A;  3J7A W;  1RNL A;  1BJZ A;  3HSF A;  3P9I A;  1QNT A;  2O7O A;  2LY2 A;  3DKW A;  1I1S A;  3S2W A;  2L4A A;  1VQ6 I;  4OAY A;  2LTP A;  2ZC2 A;  3KP7 A;  1PJR A;  2O0Y A;  4KIB A;  3PQJ A;  4C9Y A;  5E17 F;  3FKI J;  3E6M A;  2ZXW H;  4ESB A;  2K9M A;  1Z6T A;  2AQF A;  2EIM H;  2GZW A;  3FDY A;  2DYS H;  1VQ7 I;  1R1V A;  3B6C A;  1ZG1 A;  2W84 A;  1C0W A;  1IDZ A;  5ICC A;  4MNU A;  3WOD F;  4PJM A;  3PO2 J;  2W4S A;  4U0W A;  2IRF G;  1GDT A;  4EMS A;  2K5C A;  3K2Z A;  2IGN A;  3VDX A;  4UVB A;  3OYD A;  4EJV A;  5DCF A;  3HUG A;  2JSC A;  3BR3 A;  1D1C A;  1FPQ A;  3BQZ A;  3HJE A;  4BE2 A;  1FT9 A;  3ZQL A;  2LKS A;  4LOC A;  1TQI A;  4AD9 A;  1FZP B;  2E7X A;  2LNB A;  2XDV A;  2VQG A;  4PUS A;  4HSR A;  3SXY A;  4RBO A;  2DJI A;  2VE9 A;  4FX4 A;  4C2U A;  1G59 A;  1WJF A;  4LG0 B;  3KZZ A;  3O8G A;  2OV7 A;  3MZH A;  5IOY A;  3H3V K;  5GAE J;  3J81 Z;  2E36 A;  2MAB A;  2QQ9 A;  2MYS A;  1A31 A;  3M07 A;  4QTR A;  3CCU I;  4HRI A;  2CW7 A;  4K2E A;  3OV8 A;  2KIS A;  3A4C A;  1ZKG A;  4QIW N;  3AG1 H;  3BTI A;  3VWB A;  3WTU C;  2Z3Y A;  4I0B A;  5GAG J;  4LG0 A;  2Y0M A;  1D0Z A;  3QPH A;  1U78 A;  3F8N A;  1BOB A;  2X51 A;  2R7V A;  3M7G A;  1BC7 C;  2YU9 J;  1VND A;  2BOL A;  4NB5 A;  2IP2 A;  2PJR A;  4XRS G;  4RM2 A;  3ZQC A;  2ELK A;  5KVR A;  1SAN A;  3OSG A;  4L0Y B;  1RR7 A;  2RAE A;  4BJT A;  1TT5 B;  1FIA A;  1VFC A;  2DCE A;  1REP C;  2K4B A;  3HDD A;  2VC0 A;  1I3Q J;  2NVY J;  2IS2 A;  3EQL F;  2J5P A;  5F04 A;  1ETK A;  2V79 A;  3WTY C;  2PJP A;  3GTQ J;  4L5J A;  1YLF A;  2ZKZ A;  1KU2 A;  2YUS A;  3HHH A;  3AG4 H;  3NQO A;  2HDD A;  4ENJ A;  2QZ8 A;  4XK4 A;  3F21 A;  1TQM A;  2XAG A;  5FB2 A;  5IYC J;  3ECO A;  2KJC A;  2W48 A;  1U9N A;  4XMY A;  4EQQ A;  1P2F A;  1W5C C;  3HB9 A;  1KZH A;  5IT9 R;  3H0G J;  2QBY A;  2DFI A;  2XGC A;  4O6J A;  1IGN A;  1GXQ A;  4IQ4 A;  2CUE A;  3BJO A;  3E6C C;  2L0K A;  4XLC A;  1EA3 A;  2FMY A;  3C18 A;  5H6Q A;  1JJ6 C;  2GA1 A;  4E7L A;  2NVX J;  5IP9 J;  4P9F A;  3BP8 A;  4F52 A;  4IEJ A;  3S93 A;  1BI1 A;  1WPK A;  5BNG A;  2HXO A;  2OJE D;  3GF2 A;  3QU6 A;  2LRE A;  3QRF F;  3WU1 B;  4HLY A;  2DOD A;  1Z0X A;  4LMY A;  5CYV A;  4HW0 A;  4DYQ A;  2E7W A;  3EPZ A;  2COB A;  5J8F A;  3LSH A;  3C2H A;  2HQN A;  3JSO A;  1MZB A;  3OWT A;  2L5Q A;  2IGK A;  2M35 A;  3KP5 A;  1XTA A;  4F93 B;  2K86 A;  4YIR X;  3CC2 I;  4PK4 A;  2HWV A;  3O2P E;  4PFO A;  2WV0 A;  3LSP A;  4KFC A;  5E8G A;  1YW8 A;  3HKZ A;  2EFN A;  2RRE A;  3HPG A;  4BE1 A;  1XS9 A;  3RYP A;  3GTK J;  2VJ4 A;  4NC6 A;  3C2G A;  2Q0O A;  4CXF A;  3K70 C;  2P4W A;  4ZTF A;  3IWZ A;  1WJD A;  2UXN A;  4HLX A;  3ASN H;  3AL0 B;  2G0E A;  2OD5 A;  3S2D J;  1FNN A;  1T0F A;  3FXR A;  4PJJ A;  4XKV A;  4EGZ A;  4A0Z A;  5DS9 A;  4WCG A;  3HTS B;  2FUG 2;  3ZMT A;  1HKQ A;  4BHC A;  5L3C A;  3W3C A;  1NH3 A;  3BJA A;  1M1E B;  5TJJ A;  1LNW A;  4P5O A;  4ASN A;  4MGR A;  2KIU A;  1LPQ A;  4UNO A;  3SEQ A;  4XNF A;  1P9Q C;  4FTH A;  4XOP A;  5LRS A;  4RB1 A;  1OLT A;  3FBI B;  1J2X A;  2A05 A;  2PMH A;  4LIT A;  2W1O A;  5E1W A;  5HVQ C;  2L01 A;  1GV2 A;  1OCZ H;  1V5G A;  1FMW A;  2R4G A;  3H5A A;  3OYA A;  2FE3 A;  2RVC A;  4JX6 A;  2NVQ J;  3U1D A;  4OIQ F;  1IRF A;  3J81 R;  4C3J J;  2E1M C;  3I56 I;  2KFD A;  3MQ0 A;  4IOC F;  2DJN A;  2MC4 A;  2DU9 A;  4MTE A;  3RPQ A;  5EGO B;  2ESH A;  4XLP F;  5CVV A;  2EV0 A;  3L2Q A;  4XSX F;  4GXO A;  1DQU A;  4B44 A;  4WXH A;  5AON A;  2MW8 A;  1KU7 A;  2J5O A;  2XPU A;  1A04 A;  4D7M A;  3IUO A;  4LD5 A;  2CQN A;  3Q0U A;  1J09 A;  2WBM A;  2QF7 A;  4Q47 A;  1WH7 A;  2QQA A;  2IVM A;  2KL4 A;  2LY1 A;  5EGO A;  4BY7 J;  2BYV E;  5EYR A;  4DGW B;  2UWM A;  4O3M A;  4ZDO A;  5KNL A;  3FXO A;  2VT2 A;  1BM9 A;  1WRJ A;  4KMU X;  3JTH A;  2EIK H;  1FTT A;  1AKH B;  5JHF A;  2OZU A;  2YS9 A;  3H3Z A;  1LVA A;  4M3B A;  1ONV A;  1WJA A;  3NAR A;  2WAQ A;  3CF5 F;  3L9F A;  3VYT B;  3AAF A;  3KYC B;  3IV5 A;  3I4N J;  2H8R A;  2CQ7 A;  2L02 A;  1MNM C;  4KIC A;  3SYT A;  3HOZ J;  3U1K A;  3U21 A;  3OYE A;  2FNA A;  2F5V A;  1ZAR A;  5ILV A;  3R0A A;  2FRH A;  4ZZD A;  1V3F A;  5LHH A;  2M7B A;  3W6K B;  3VEP A;  5DV5 A;  4BXX J;  1N77 A;  2X85 A;  3S3O A;  3ELK A;  3C3W A;  3FK6 A;  2X6W A;  3F8C A;  3RZO J;  3I9V 2;  4I99 C;  3KP2 A;  3SHF A;  3L2C A;  1CF7 B;  2LYC A;  1KA8 A;  3M1C A;  3K4J A;  4Q48 A;  1O3S A;  3HXL A;  2D2W A;  1G8X A;  3FK7 A;  3FMQ A;  2XAU A;  3ECH A;  2DQL A;  4PJN A;  1G3W A;  5F0F A;  4BAC A;  2HI3 A;  1SAX A;  5K7F A;  4RAG A;  3OR1 C;  5DD4 A;  2BXY A;  4A3G J;  1N75 A;  5E8I A;  3QAH A;  5D5U B;  4NNJ A;  1YRN A;  4G6T B;  3JSP A;  3FWE A;  2DFH A;  3K4B A;  4JX5 A;  3K0L A;  4BXF A;  2PQ8 A;  3MKZ A;  3KYD B;  5M3M J;  3RKY A;  2IGM A;  1A5J A;  4E7I A;  1D1A A;  4M72 A;  4AIH A;  4CCL A;  2XUB A;  1OIS A;  1SD7 A;  4FET A;  1Z67 A;  3G1M A;  4IHV A;  5K7H A;  1MMG A;  1CQT A;  4AIJ A;  2QEN A;  3MZ8 A;  1Z7U A;  3DEU A;  3Q0V A;  3S15 J;  3HOT A;  4H4K C;  5M5Y J;  4YIF A;  1KYZ A;  1W4M A;  3EDP A;  4MQV A;  1HW5 A;  3TP3 A;  4DYR A;  5IPA A;  1O3T A;  3BG6 A;  2JA8 J;  3VYU B;  4I98 B;  2DDA A;  4WXD A;  1W0U A;  4CCO A;  2JMW A;  1YIJ I;  2HYJ A;  3I59 B;  1Z3X A;  4FCY A;  5EJC A;  3CME I;  3KEY A;  3F8B A;  2TDX A;  4P55 A;  2GWR A;  2EFQ A;  2JQ7 A;  3K4K A;  3V7C A;  3DXJ F;  3E7L A;  3ZMV A;  1E3P A;  1F43 A;  2C6Y A;  4XRF A;  1UST A;  3OYI A;  1HW2 A;  2QLZ A;  3F3X A;  3PSI A;  3K4C A;  4MLO A;  4L5E A;  4ZJZ A;  4UXN A;  2B63 J;  2HU9 A;  3HKZ N;  2P5K A;  3WTW C;  1I6X A;  2EV5 A;  1GLN A;  3D0S A;  3ZMD A;  2OPT A;  2LP0 A;  2FOK A;  2ZME B;  4ENN A;  2EFP A;  1T2K A;  1XSV A;  5K5Q A;  1ZRD A;  1WFX A;  1R4M B;  4D5C A;  3OYH A;  2M87 A;  1DPU A;  4KNY A;  2R7Q A;  4QWQ A;  4LK0 F;  1V5E A;  2ZO4 A;  3PJR A;  2JSP A;  1BL0 A;  5FKO A;  5E3L A;  4GYG A;  1Y6I A;  3LMM A;  4IHW A;  3S14 J;  5L3F A;  2LLK A;  3RTR A;  5J8C A;  1A35 A;  3PFI A;  4X0G A;  1PDN C;  3IRR A;  1ZQ3 P;  4G6D A;  2K9S A;  2ZXH A;  3LL7 A;  1Z7L A;  3TDZ C;  2L3D A;  1YG2 A;  2R0Q C;  3P9K A;  1L0O C;  3I64 A;  2LG4 A;  1J0R A;  3ABL H;  3R4K A;  2DN0 A;  1D5V A;  3MKY B;  3FX3 A;  1V55 H;  1JXS A;  3I58 A;  1RKW A;  4JQF A;  2DTZ A;  2OCE A;  1ON1 A;  4BS9 A;  4OOI A;  3PNY A;  3GFJ A;  1P4X A;  1X4P A;  5HLH A;  3SZG A;  3S3M A;  3CP8 A;  3DLL F;  1SFK A;  3CDH A;  3BTJ A;  2H09 A;  2ECC A;  2H94 A;  6PAX A;  3F0C A;  2JVH A;  3ERE D;  5DUK A;  3IH4 A;  1JUS A;  4IRI A;  3BPX A;  4RGX A;  4N4N B;  1XB4 A;  1IN6 A;  2ECB A;  4M6V A;  4UVA A;  4A6E A;  3LNQ A;  3C1D A;  3L1P A;  1X58 A;  5D8L B;  3TKY A;  3HOW J;  4IHX A;  4MFD A;  1HC8 A;  2IA2 A;  1I5Z A;  4D9J A;  1HF0 A;  5CQE A;  2B0L A;  3SZT A;  3ZMU A;  1QO0 D;  1B4A A;  1XCB A;  2DDB A;  2JPC A;  2QA4 I;  1UHW A;  2I10 A;  3RDI A;  1QA6 A;  3OYC A;  3GLX A;  4LLG F;  1YS7 A;  2VOP A;  3Q5F A;  2LVS A;  5HS8 A;  4CZC A;  1R7J A;  3OS1 A;  2JUC A;  4XQF A;  4HNT A;  5CVR A;  4ZDP A;  2DMT A;  4RLF A;  2R7Z J;  2BY0 A;  3A01 B;  1MSF C;  1D1B A;  3S3N A;  3FM3 A;  3HOS A;  1TWF J;  5K5R A;  3QPL A;  3PQK A;  2W82 A;  3J7A O;  1W7P B;  4IHY A;  2P0T A;  1IV8 A;  1APL C;  1T8I A;  4FHT A;  4B3A A;  2ZXI A;  2QCO A;  2MFZ A;  4D7N A;  5CLS A;  4EV0 A;  2A5W A;  3C2B A;  2PN6 A;  5LHI A;  1HST A;  3R60 A;  5FLV A;  1LDJ A;  1S6L A;  2DA5 A;  4UV9 A;  3CJQ B;  3DP7 A;  1W7P A;  2IW5 A;  3FXU A;  1JKQ C;  1ZRE A;  2VPL A;  1W36 D;  4CUG A;  3KLN A;  1X3W B;  3E5U A;  4PCQ A;  2X98 A;  4W97 A;  1YYV A;  3LQR A;  1IXC A;  2CWE A;  5HDG A;  2MLG A;  3EUA A;  2WTE A;  1GV5 A;  1IZ1 A;  3GYH X;  1DDN A;  2PLY A;  3FBN B;  1EKE A;  4F7Z A;  1PUE E;  2O6G E;  1K83 J;  5L3D A;  1B9N A;  2MH2 A;  5LHG A;  3JRE A;  5K1Y A;  1I39 A;  3GW2 A;  5K7Z A;  1TWA J;  4KN4 X;  4RLQ A;  3S1N J;  4XLE A;  5E1X A;  2GXG A;  1VQK I;  3W6J B;  2X1E A;  4M9S A;  2R5Z A;  2V6E A;  1I6H J;  2BVM A;  3SDG A;  1UJ8 A;  3IHU A;  3JRI A;  1LB2 A;  2IAI A;  1G2H A;  4N9H A;  2XKP A;  3KP6 A;  2DA2 A;  3DBR B;  4GFB A;  5CPR B;  2QKL B;  4BUP A;  4M3E A;  1FIP A;  3BPV A;  3KPH A;  2H8W A;  4HV6 A;  2P7V B;  1P6R A;  3M9A A;  5DUI A;  1WSU A;  2DPU A;  4UUS B;  3IP4 B;  3ML6 A;  2MC3 A;  5J47 A;  5ILS A;  4G9Y A;  1VQ5 I;  1HDP A;  2ZXJ A;  1FYK A;  4IOA F;  4L9T A;  4IVN A;  1BW5 A;  4IX7 A;  3NAU A;  5FGM A;  3IC7 A;  3IAS 2;  3Q0W A;  1OCT C;  5DYM A;  3HOX J;  2NVU B;  2XGX A;  3IL2 A;  3KYL A;  1ZG5 A;  2LF7 A;  1IG7 A;  1S7E A;  2W57 A;  3LQQ A;  5DD8 A;  1IN5 A;  4ZYA A;  3M4O J;  4NHJ A;  2GIZ A;  3JRD A;  3PSF A;  3LSJ A;  4BYY A;  3F22 A;  3ZXS A;  1OYW A;  1S5L C;  2FQ4 A;  3OIO A;  2Y75 A;  2GOX B;  1R49 A;  2Y2Z A;  3S32 A;  2MG4 A;  2KIQ A;  5FJ8 J;  1B1B A;  4E7K A;  2ETH A;  4ZZL A;  2O8X A;  1ZRC A;  3BRO A;  2MVT A;  1YW9 A;  2VAS A;  3DBH B;  5GP9 A;  4I02 A;  3S1Q J;  5KCM A;  3OYJ A;  5FRM A;  1UZC A;  4JBA A;  1X1B A;  3A0B C;  4PZJ A;  1QZZ A;  5LD2 C;  1JUM A;  1Y1W J;  2O5R A;  5LFA A;  2QKM B;  1IJW C;  3ZQG A;  3J80 K;  3BTC A;  3CC4 I;  2GOM A;  3FIS A;  1JT0 A;  2HKX A;  2CV2 A;  2HKO A;  2IXS A;  1MMS A;  3TO6 A;  2V7F A;  1GVJ A;  3Q9V A;  2WA0 A;  2X48 A;  3TW6 A;  5IOZ A;  3ZQF A;  3DCF A;  5EEH A;  4A3K J;  3N05 A;  4A3I J;  1XPX A;  1QVU A;  2BZT A;  2A07 F;  5FRO A;  2FOW A;  1YFH A;  2KPM A;  3T1B A;  4CYD A;  4AYB A;  1TC3 C;  3GVA A;  5FLX K;  4HF2 A;  3WTX C;  1R71 A;  3JR9 A;  5J1Y A;  3HUG B;  1JUP A;  2KMU A;  5HLT A;  5DM6 F;  3RI4 A;  2OCC H;  1SVM A;  3P5J A;  1FTZ A;  1VQP I;  3ZQQ A;  1ZLK A;  5LGU A;  4HNV A;  4JP0 A;  4HV5 A;  3IH3 A;  4XL9 A;  1BI2 A;  2K02 A;  3M1E A;  2ZNZ A;  3IRQ A;  1A6Q A;  3HEF A;  4HQM A;  2W7N A;  1SC7 A;  1R58 A;  1G4D A;  2RQQ A;  2CUF A;  2QUF A;  2CH0 A;  2EQR A;  2KRF A;  3PIO F;  5A2Q K;  5J1R A;  2DFE A;  1SFX A;  4CDG A;  2EBI A;  2XB0 X;  4HG2 A;  5C44 J;  3W2W A;  4UB6 C;  3I55 I;  2CO5 A;  1W7P D;  2XRL A;  4EJW A;  3BR0 A;  2A61 A;  2XB5 A;  2CV0 A;  3KZY A;  2PJR B;  1OPC A;  2HS5 A;  2K3F A;  4XIC A;  2MUN A;  1OYY A;  2KDZ A;  4GO1 A;  1RUO A;  4E4H A;  2VB6 A;  3VYS B;  5KK1 A;  5B66 C;  1H88 C;  3G6E I;  2V4J C;  5HLI A;  3OL4 A;  4F92 B;  2WWY A;  4XR6 A;  1X2N A;  4IRH A;  1XGS A;  4CCJ A;  3RYR A;  1WQ2 A;  4OIP F;  2LF8 A;  2W25 A;  3CLQ A;  2A3S A;  2V1N A;  3PIP F;  4BQQ A;  2W85 A;  4MEX F;  2E60 A;  2E71 A;  3NRV A;  3D5R C;  3ZN0 A;  4UY8 I;  1WCM J;  3I4M J;  2ID6 A;  2EK5 A;  2K7L A;  3QOP A;  3G71 I;  3WTS C;  1LFB A;  3CUQ C;  3LA7 A;  1J5Y A;  1YIT I;  2QBY B;  4IHS A;  2IS1 A;  3F8F A;  1TZL A;  3BR6 A;  4U0V A;  5JVG F;  1U9O A;  4XON A;  3GTL J;  2F2E A;  3CO6 C;  3LSM A;  4Y15 A;  4YEL A;  2O61 A;  4G8X A;  4ZYG A;  1BN5 A;  1YW7 A;  1VF9 A;  5AIQ A;  1P92 A;  3GZ5 A;  3GX4 X;  3J7Z I;  2EZI A;  5J6X A;  3M8F A;  4M9X A;  5IT3 A;  5BOX A;  2JA5 J;  2EZL A;  3WTV C;  1T95 A;  2HOE A;  4G6Q A;  3BG9 A;  4G12 A;  2XF5 A;  2QYO A;  4I0A A;  3H9J A;  3CCY A;  2QWW A;  2A5Y B;  2KP6 A;  3BZC A;  4ON0 A;  2YX7 A;  2N8G A;  2HPI A;  4B09 A;  5IY5 H;  4QLC U;  2EB7 A;  5D5W B;  1VI0 A;  2EA2 A;  5LLQ A;  2D1V A;  2EA4 A;  5EEA A;  2IA0 A;  1TTY A;  2RN7 A;  2IS4 A;  3CMA I;  3DTE A;  1JKP C;  2QQB A;  3B6A A;  3OYM A;  1RI7 A;  1D0Y A;  1X3U A;  4JK1 X;  3TQN A;  2VJJ A;  2BVL A;  3NWS A;  1LKX A;  1UHS A;  2O9L A;  3W6V A;  1YX5 A;  1IAW A;  2DK8 A;  2LSO A;  1UG2 A;  5F6F A;  2XC7 A;  3CLO A;  2EIN H;  3IAM 2;  1FYM A;  1UG0 A;  4M71 A;  4OIO F;  2NVT J;  2X9D A;  3QYE A;  4HQE A;  4X6A J;  2Z33 A;  3DBL B;  4HNU A;  5IP6 A;  4HDV A;  3LA2 A;  2KDO A;  3GEZ A;  2VPR A;  2LC2 A;  4WWC A;  2I5U A;  4ZC3 A;  4OMY A;  1IC8 A;  2FD5 A;  1ZRF A;  1VQ8 I;  2HR3 A;  5FKK A;  3TMO A;  5J1U A;  2JZY A;  3K1M A;  4A69 C;  3KE2 A;  3K7A J;  4S0H B;  1S8N A;  4NC8 A;  3JW4 A;  3HHG A;  5B1A H;  1Y0N A;  4BBR J;  3LOC A;  3T8T A;  2NNN A;  2L9S A;  1TW3 A;  2B9S A;  3QP6 A;  4GGG A;  2DA1 A;  4V19 K;  2Z5U A;  2DT7 B;  4LJZ F;  2HZT A;  4KYW A;  4ITV A;  4OU0 A;  5C4J J;  1EH6 A;  3HTU A;  3UR3 C;  4JX4 A;  5ICE A;  4XLN F;  3L7W A;  5L3E A;  4H0E A;  5CKT A;  5E20 A;  3V7R A;  5HOD A;  4BEH A;  2KT0 A;  3IH2 A;  1YIO A;  3JAM Z;  2STW A;  3WG7 H;  4BAY A;  2XAQ A;  4X1E A;  3HPH A;  1OYI A;  4P96 A;  4C2M J;  2LDU A;  5IT9 K;  1WZ2 A;  4O5V A;  4CGZ A;  3L00 A;  3S16 J;  3WGI A;  2YU3 A;  2P8T A;  4ZDL A;  4JOM A;  3SFI A;  1T39 A;  4M73 A;  3S8P A;  1H0M A;  2QSG X;  3R6S A;  2Z16 A;  2MLK A;  4AYB N;  2M45 A;  3A03 A;  3FXM A;  4Y7N J;  3N97 A;  2G7H A;  1ODD A;  1SEU A;  2Z99 A;  1GT0 C;  2NS0 A;  2CUJ A;  4ESJ A;  2NOJ B;  2XSD C;  1A6I A;  3F6V A;  2HVS A;  3H9Q A;  4D5F A;  2HXI A;  4UVC A;  2R7S A;  1U5T B;  1X3Z B;  5GAH J;  5JHU A;  1RC9 A;  2VOO A;  2JUG A;  3L2W A;  4IZZ A;  2P0W A;  2X0L A;  4LGW A;  3HL2 A;  4BQN A;  1EF4 A;  2DOF A;  5DDG A;  3CP2 A;  1Z6R A;  2VBX A;  1SVL A;  5F27 A;  1RIO H;  4F91 B;  1BA5 A;  2ME0 A;  1VQM I;  3RQI A;  3CCJ I;  1Y56 A;  1U5T A;  2M1B A;  3MKW B;  3LAJ A;  2FQ3 A;  3OL3 A;  1AWC A;  3HOV J;  2DBB A;  3B73 A;  5EZH A;  1WH5 A;  5JLX A;  4IQJ A;  4Y33 A;  2OA4 A;  4E7J A;  2UUZ A;  3DV8 A;  3CD6 I;  2ISY A;  4XSZ F;  2KHM A;  3HSE A;  2L9N A;  4U7B A;  1WJE A;  3VFZ A;  1ZR2 A;  2VJI A;  4XM3 A;  5HS9 A;  4E70 A;  3HOY J;  1QVT A;  3SJM A;  2VQC A;  4G7Z F;  1HSJ A;  5GTH C;  2AO9 A;  2ESN A;  2XAS A;  2DMQ A;  2L7M P;  5EDN A;  4R79 A;  1R5H A;  2L2O A;  3EUH C;  3CCM I;  5BQT A;  4BE0 A;  2TRT A;  2V9P A;  4KJZ A;  2ZSH B;  2DFF A;  4AC0 A;  3A52 A;  2FSW A;  2WC2 A;  1Y8Q B;  2XF7 A;  5GAD J;  4IHT A;  4PJ0 C;  1XX5 A;  4LFU A;  2LBF A;  1R1U A;  2OTL I;  3DPT A;  1P4A A;  3GME A;  2HGC A;  1Q1H A;  2PI0 A;  4B1R A;  1YRN B;  3ABK H;  5CVJ A;  3ZCO A;  2ZNY A;  3HRU A;  1T56 A;  2E2I J;  2L54 A;  3HC7 A;  1JI8 A;  1F5T A;  2XF6 A;  3ABU A;  2FBI A;  1S7O A;  3NEU A;  1BJA A;  4LB6 B;  2RNG A;  3BZK A;  4IPA A;  3I71 A;  1ACI A;  1LE8 A;  3GFI A;  2F48 A;  4BXU A;  5D4R A;  3J81 K;  2HPM A;  1X1P A;  2EWN A;  4LG3 A;  2PG4 A;  3MKL A;  2K9N A;  5F1J A;  4XLH A;  4RM3 A;  4Y13 A;  3LSI A;  1DP7 P;  3ASO H;  3MAJ A;  2KIM A;  3SEZ A;  3WE2 A;  4BDZ A;  1K78 B;  1MKM A;  1QU3 A;  1PVE A;  1B9M A;  3GLL A;  3ZN1 A;  4FE7 A;  1NK2 P;  3GXO A;  4XLA A;  4I7H A;  2OQG A;  1LFP A;  2PMZ A;  4BU2 A;  2ZFU A;  4WF2 A;  4DNC A;  1R4N B;  1U6G A;  5DEQ A;  1G3Y A;  5JFR A;  2WY7 Q;  1FP2 A;  1R9T J;  2F5C A;  2AS5 F;  1K78 A;  2AXL A;  2DOE A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3CJN A;  4KN7 X;  2FML A;  4HZF A;  4PGG A;  4LB5 A;  1TW2 A;  1FBU A;  2VOD A;  2XVC A;  3T5X A;  3J80 Z;  3OOP A;  2Q2E A;  4KIG A;  2HTJ A;  1IN4 A;  1UB9 A;  2GXB A;  4UHT A;  1STZ A;  4FX0 A;  1P4W A;  1SFE A;  4CIC A;  2HFH A;  4U88 A;  4RS8 A;  1UFM A;  3FZV A;  5FFZ A;  2IT0 A;  1BBY A;  3SQN A;  1XCV A;  2VBZ A;  1K7A A;  1O57 A;  3KLO A;  3I5U A;  2BE5 F;  3CUO A;  3KCC A;  1J75 A;  1Z91 A;  2ISZ A;  4YII A;  4GYI A;  2M5W A;  3H3U A;  2V1D A;  1SMT A;  4HOB A;  3CUQ A;  4EVI A;  2A6E F;  4S05 A;  2DT5 A;  3KFW X;  1FWZ A;  3JTG A;  1BIA A;  1MGT A;  3HYI A;  1GXP A;  3F8M A;  5FO5 A;  3T8R A;  4N9I A;  3ZP5 A;  4MHG A;  5FD5 A;  4EJU A;  5ERI A;  5D6F A;  3FMR A;  3P9C A;  2YSR A;  2R7D A;  5FD6 A;  1S29 A;  2NAZ A;  1QZY A;  2F5F A;  4RGR A;  1J7K A;  2R3S A;  2XKO A;  2O03 A;  4ZH4 F;  2M30 A;  3CTA A;  1LEB A;  4EM0 B;  3GUD A;  4AVP A;  3M8E A;  4ZYE A;  3BWG A;  3E97 A;  1FBQ A;  5E1Z B;  4A0Y A;  3FHZ A;  1RZ4 A;  5FFX A;  2DK5 A;  4WX9 A;  2UZK A;  3V4G A;  3HRM A;  2XRN A;  3WU0 A;  2XRO A;  2LKP A;  1V4R A;  2VN2 A;  2ZFW A;  5H20 A;  4RAY A;  2A68 F;  1EH7 A;  3F23 A;  4KT5 C;  2H27 A;  1FP1 D;  3ZMS A;  4MQ9 F;  1ZH5 A;  2XAF A;  4EJT A;  3IKT A;  3FF5 A;  1E2X A;  3V8L A;  2X4H A;  3E5X A;  3KP4 A;  4I01 A;  3KEQ A;  1B59 A;  4G7H F;  4Q4Z F;  1IRG A;  1W5S A;  1OKR A;  5L3B A;  3V8J A;  5F1R A;  1KU3 A;  1KQ0 A;  1ZLJ A;  1XGN A;  1QGP A;  4HX8 A;  3C7J A;  3K1P A;  1JHF A;  1QQI A;  3HRS A;  2VON A;  5ICF A;  4L9N A;  3ULQ B;  1ZAO A;  2EJR A;  1XDU A;  3EYI A;  4HDU A;  4GCV A;  4TV7 A;  4UV8 A;  3TOB A;  2K4J A;  2HYF A;  4YFN F;  2YX4 A;  2HTS A;  2OBP A;  2QVO A;  2HYG D;  1O3Q A;  5ICG A;  1XDS A;  4KUM A;  4AWX B;  3SZP A;  2KJB A;  3Q9S A;  1SD4 A;  1XSX A;  3GFM A;  3TDU C;  3SFZ A;  1KU9 A;  3KEO A;  2MD5 A;  4DQ2 A;  3MZY A;  4RB0 A;  1DUX C;  4A5M A;  2CGP A;  2XV4 S;  2GQQ A;  1YTY A;  1S7A A;  2FBK A;  2DQR A;  3LA3 A;  4AIK A;  1JE8 A;  1KQ8 A;  2NYX A;  4R1H A;  4CZZ A;  1FSE A;  4R8H A;  4A5N A;  1TBX A;  1JGS A;  3MEX A;  1MDM A;  1JHH A;  4RGS A;  5DCM A;  1MJA A;  4G94 A;  3QU3 A;  2DTR A;  2M8E A;  4IXA A;  4EM1 A;  2CFX A;  3LST A;  4YFK F;  3VB2 A;  4I2O A;  1H9G A;  3V7S A;  3K9T A;  4HBL A;  3E6B A;  5E18 F;  1I27 A;  1D3Y A;  4M6Y A;  4LLL A;  4EGY A;  3DFG A;  3ZQ7 A;  2H6C A;  3RPU A;  1BC8 C;  1HQC A;  4IRG A;  2MBF A;  2CYY A;  3B02 A;  2Q8K A;  2NNY A;  1XSD A;  2P7C B;  2P6T A;  3RKW A;  2GIV A;  1FC3 A;  2CG4 A;  4L9J A;  1DPR A;  5HDK A;  2HEO A;  5D4S A;  2ZCW A;  4WK8 F;  1T98 A;  4BH9 A;  4L5I A;  3O3K A;  2FA5 A;  3GWZ A;  3HSR A;  3MFK A;  2STT A;  4BNC A;  2GAU A;  5LBQ A;  2YR2 A;  2F5E A;  3MCZ A;  3GZ6 A;  1H9T A;  2L4M A;  5D5V B;  1XN7 A;  1KGS A;  3I53 A;  2ELH A;  1G3S A;  2VT3 A;  3TGN A;  3WG9 A;  2JT1 A;  1W5T A;  2NRA C;  1F9N A;  1ZN2 A;  1FLI A;  2UXX A;  1Y0U A;  2OU2 A;  3WTZ A;  2BV6 A;  4LLN A;  2FXA A;  1BOA A;  2FBH A;  2PEX A;  3GFL A;  5BPD A;  4RB3 C;  5LRR A;  1TNT A;  1HBX G;  4UUV A;  3I0T A;  4U7D A;  1J9I A;  1SD6 A;  1K79 A;  4ETS A;  2Z9O A;  5BS6 A;  2CQK A;  3H92 A;  4KIF A;  2W24 A;  3E3V A;  5ILU A;  3GO5 A;  3U2R A;  5ED4 A;  4HF0 A;  3QPT A;  2FNP A;  2KKO A;  4HYE A;  3RKX A;  5BPI A;  1IXS B;  1LDK B;  5HOO A;  2JRT A;  4Y17 A;  5LGN A;  1ZGA A;  3N4M A;  5LGT A;  1LEA A;  5BMZ A;  3VOE A;  1TLH B;  4HA8 A;  1FX7 A;  2V1X A;  2D1H A;  3K69 A;  3WTT C;  3CO7 C;  1MD0 A;  3ROU A;  1F1Z A;  2A6H F;  1U3E M;  4ENK A;  1LJ9 A;  1ZGJ A;  3TO7 A;  3I4P A;  2RGV A;  1IF1 A;  2RV8 A;  4NQW A;  1YO5 C;  3ZPL A;  1IN8 A;  2BEO A;  3I54 A;  2P5L C;  1TNS A;  1LDD A;  1J59 A;  3BJ6 A;  3EET A;  1BI0 A;  2PBI A;  3WGG A;  1BIB A;  4A0X A;  1L3L A;  2COM A;  1VTN C;  3RIR A;  3BY6 A;  3K1N A;  4ZYD A;  1UCR A;  3R61 A;  3FMS A;  1XMA A;  4HX7 A;  1QBJ A;  2RC4 A;  1XGO A;  4KMF A;  2OZ6 A;  2P5V A;  4MEY F;  2DO7 A;  1D8J A;  3T0Y A;  3DPL C;  2E1C A;  2RDP A;  2EFW A;  4I09 A;  2DAO A;  1FY7 A;  3P7N A;  2V6C A;  2ADU A;  1G3T A;  1WWX A;  1ZHF A;  2XAH A;  1USS A;  2D45 A;  1T38 A;  3ISP A;  2RNJ A;  3VOD A;  3DQV C;  1CF7 A;  2P6S A;  2VC1 A;  1F4K A;  4L0Z B;  2JTV A;  5D6E A;  2CSO A;  2O3F A;  1R23 A;  2IPQ X;  3F6O A;  4HX4 A;  1WI9 A;  4B8X A;  1KYW A;  2XIG A;  3FM5 A;  2EFO A;  1BI3 A;  4N0B A;  5CVI A;  3WGH A;  4ZYH A;  5D5X B;  1PP7 U;  3EYY A;  2DI3 A;  2MH9 A;  2G7U A;  2ACJ A;  1I1G A;  1ULY A;  2EV6 A;  4OMZ A;  5FLX Z;  2VXZ A;  3I59 A;  1E17 A;  1R00 A;  3CUQ B;  4EM2 A;  1HXD A;  4ENM A;  3IKV A;  2DPD A;  4RB2 C;  1SD5 A;  1IXR C;  2XAJ A;  4U0Y A;  2JPB A;  5D8K B;  3IWF A;  4A12 A;  2RKH A;  5A2Q Z;  3E5Q A;  2ZME A;  4MTD A;  4LK1 F;  3G3Z A;  1CGP A;  4FT8 A;  1YQA A;  4A6D A;  1HW1 A;  2IJL A;  2VE8 A;  1ON2 A;  4IF4 A;  1UHM A;  2ZBK A;  3ABT A;  3BZ6 A;  4S04 A;  1MJ9 A;  5K5O A;  2Y48 A;  1ZYR F;  4M6X A;  1SMY F;  3LWF A;  1YS6 A;  2MA3 A;  2FU4 A;  3MWM A;  4M9Z A;  3JAM K;  1OMI A;  4HF1 A;  1IN7 A;  1AOY A;  3WE3 A;  3TOA A;  1XGM A;  5CJ9 A;  1QPM A;  1RUN A;  2OQR A;  2DW4 A;  2VBW A;  2ZJ2 A;  5JI6 A;  4Q5S F;  5HS7 A;  2V1U A;  4L9V A;  4YG2 F;  3E6D A;  1TQP A;  2BGC A;  5JR3 A;  2E1N A;  5AIP A;  5L3G A;  1O7F A;  4OIR F;  2KIF A;  1NHA A;  1HKS A;  1XMK A;  4XBF A;  5LEK A;  4OIN F;  3TO9 A;  2QM3 A;  1EV7 A;  1T6S A;  3FXQ A;  3L09 A;  3ZMZ A;  5HLG A;  3R0J A;  3QP5 A;  2F5D A;  1O3R A;  4CO8 A;  2YPR A;  2OAZ A;  1ZG3 A;  3RJP A;  2RQP A;  1XD7 A;  2CW0 F;  2FEZ A;  1FBS A;  2HQR A;  5LEJ A;  5CVU A;  4YFX F;  4WXC A;  3HRT A;  4PDK A;  1PP8 F;  4KA4 A;  4IJA A;  4CHU A;  3O6B B;  3LAP A;  3REO A;  1U2W A;  1S3J A;  3BDD A;  3HIF A;  2HDC A;  1HKT A;  4BQA A;  3KET A;  2H6B A;  1FSH A;  1U5T C;  5HDN A;  2G9W A;  5EEG A;  3U9G A;  1FYL A;  1FOK A;  1R5G A;  3LFK A;  1OR7 A;  1EH8 A;  2K27 A;  4BHB A;  1SFU A;  5IT9 Z;  3D5L A;  1Z1D A;  4D0P A;  1MJB A;  2BBY A;  2PFB A;  5H6R A;  4P9U A;  4RGU A;  2XHK A;  1WKM A;  3EUH A;  1R1T A;  1B6A A;  1G6N A;  3F72 A;  3DF8 A;  3BOQ A;  2GA2 A;  1K6O A;  5F64 A;  2FF4 A;  1Z9C A;  1R36 A;  4Z2Y A;  2R7F A;  1U8R A;  2VBY A;  4BHP A;  2PMU A;  1Z05 A;  3G73 A;  4A2U A;  1R22 A;  1O7L A;  5JVT A;  1IW7 F;  5TRD A;  1KQ9 A;  4ESF A;  3COA C;  4EJO A;  4RAZ A;  1LQ1 A;  1IUY A;  2IA1 A;  2V9V A;  1GHC A;  1MDM B;  3KP3 A;  4M74 A;  2DLL A;  4PGH A;  2A69 F;  4HAM A;  5DCM B;  4KDP A;  1D8K A;  3V8K A;  4L18 B;  1RNL A;  3HSF A;  3P9I A;  1QNT A;  3DKW A;  1I1S A;  3S2W A;  2L4A A;  5E17 F;  3KP7 A;  2O0Y A;  4KIB A;  3PQJ A;  3E6M A;  4ESB A;  1Z6T A;  2GZW A;  1R1V A;  1ZG1 A;  2W84 A;  1C0W A;  5ICC A;  4MNU A;  3WOD F;  4U0W A;  2IRF G;  4EMS A;  3K2Z A;  4UVB A;  4EJV A;  5DCF A;  3HUG A;  2JSC A;  1FPQ A;  1FT9 A;  1FZP B;  4AD9 A;  1TQI A;  2E7X A;  2LNB A;  2VE9 A;  3N97 A;  3SXY A;  4FX4 A;  4LG0 B;  3KZZ A;  3MZH A;  3J81 Z;  2QQ9 A;  4K2E A;  3OV8 A;  3WTU C;  2Z3Y A;  4I0B A;  4LG0 A;  2Y0M A;  3QPH A;  1U78 A;  3F8N A;  3M7G A;  1BC7 C;  4NB5 A;  2IP2 A;  5KVR A;  4L0Y B;  1REP C;  2K4B A;  2VC0 A;  3EQL F;  2J5P A;  2V79 A;  3WTY C;  2PJP A;  4L5J A;  1YLF A;  2ZKZ A;  1KU2 A;  3HHH A;  3NQO A;  4ENJ A;  2QZ8 A;  3F21 A;  1TQM A;  2XAG A;  5FB2 A;  3ECO A;  2KJC A;  4EQQ A;  1P2F A;  2QBY A;  2DFI A;  4O6J A;  1GXQ A;  3BJO A;  3E6C C;  2FMY A;  3C18 A;  5H6Q A;  2GA1 A;  4P9F A;  3BP8 A;  1BI1 A;  3GF2 A;  3QU6 A;  3QRF F;  3WU1 B;  4HLY A;  4LMY A;  5CYV A;  4HW0 A;  2E7W A;  5J8F A;  2HQN A;  3JSO A;  1MZB A;  3KP5 A;  2K86 A;  2HWV A;  3O2P E;  2WV0 A;  4KFC A;  5E8G A;  1YW8 A;  2EFN A;  3RYP A;  4CXF A;  2Q0O A;  2P4W A;  3IWZ A;  2UXN A;  4HLX A;  2OD5 A;  1FNN A;  1T0F A;  3FXR A;  4EGZ A;  4A0Z A;  4WCG A;  3HTS B;  3ZMT A;  1HKQ A;  4BHC A;  5L3C A;  3BJA A;  5TJJ A;  1LNW A;  4P5O A;  4ASN A;  4MGR A;  2KIU A;  4UNO A;  5LRS A;  4RB1 A;  1J2X A;  5E1W A;  2PMH A;  5HVQ C;  2L01 A;  2FE3 A;  2RVC A;  3U1D A;  4OIQ F;  1IRF A;  3MQ0 A;  2DU9 A;  4MTE A;  3RPQ A;  2ESH A;  4XLP F;  5CVV A;  2EV0 A;  4XSX F;  4GXO A;  4WXH A;  5AON A;  1KU7 A;  2J5O A;  1A04 A;  4LD5 A;  4Q47 A;  2QQA A;  2IVM A;  2BYV E;  2UWM A;  4O3M A;  2VT2 A;  1BM9 A;  1WRJ A;  4KMU X;  3JTH A;  2OZU A;  3H3Z A;  1LVA A;  1ONV A;  3L9F A;  3AAF A;  2L02 A;  4KIC A;  2FNA A;  5ILV A;  1ZAR A;  3R0A A;  2FRH A;  4ZZD A;  1V3F A;  5LHH A;  3W6K B;  3VEP A;  5DV5 A;  3ELK A;  3C3W A;  3F8C A;  3L2C A;  3KP2 A;  3SHF A;  1CF7 B;  1KA8 A;  4Q48 A;  1O3S A;  2D2W A;  3FMQ A;  3ECH A;  2DQL A;  1G3W A;  1SAX A;  5DD4 A;  5E8I A;  3QAH A;  5D5U B;  3JSP A;  3FWE A;  3K0L A;  2PQ8 A;  3RKY A;  4AIH A;  4M72 A;  2XUB A;  1SD7 A;  4AIJ A;  2QEN A;  1Z7U A;  3DEU A;  3HOT A;  4YIF A;  1KYZ A;  1W4M A;  3EDP A;  4MQV A;  1HW5 A;  1O3T A;  4I98 B;  4WXD A;  3I59 B;  3F8B A;  2TDX A;  4P55 A;  2GWR A;  2EFQ A;  3V7C A;  3DXJ F;  3ZMV A;  2C6Y A;  4XRF A;  1UST A;  1HW2 A;  2QLZ A;  3F3X A;  4UXN A;  2P5K A;  3WTW C;  1I6X A;  2EV5 A;  3D0S A;  3ZMD A;  4ENN A;  2FOK A;  2ZME B;  2EFP A;  1T2K A;  1XSV A;  5K5Q A;  1ZRD A;  1DPU A;  2M87 A;  4KNY A;  4QWQ A;  4LK0 F;  2ZO4 A;  4GYG A;  5L3F A;  3RTR A;  5J8C A;  3PFI A;  1PDN C;  3IRR A;  4G6D A;  3TDZ C;  2L3D A;  1YG2 A;  3P9K A;  1L0O C;  3I64 A;  1J0R A;  3R4K A;  1D5V A;  3FX3 A;  1JXS A;  3I58 A;  4JQF A;  1ON1 A;  4OOI A;  3GFJ A;  1P4X A;  5HLH A;  3CDH A;  2H09 A;  2H94 A;  6PAX A;  3ERE D;  5DUK A;  4IRI A;  3BPX A;  4RGX A;  1XB4 A;  1IN6 A;  4UVA A;  4A6E A;  3C1D A;  5D8L B;  3TKY A;  2IA2 A;  1I5Z A;  3SZT A;  2B0L A;  3ZMU A;  1QO0 D;  1B4A A;  1XCB A;  2JPC A;  1UHW A;  3RDI A;  3GLX A;  4LLG F;  1YS7 A;  2VOP A;  3Q5F A;  5HS8 A;  1R7J A;  5CVR A;  3FM3 A;  3HOS A;  5K5R A;  3PQK A;  3J7A O;  1W7P B;  4FHT A;  5CLS A;  4EV0 A;  2PN6 A;  5LHI A;  1HST A;  3R60 A;  1LDJ A;  1S6L A;  4UV9 A;  3DP7 A;  3FXU A;  1W7P A;  2IW5 A;  1ZRE A;  3KLN A;  3E5U A;  4PCQ A;  1YYV A;  3LQR A;  1IXC A;  2CWE A;  5HDG A;  2MLG A;  2WTE A;  3GYH X;  1IZ1 A;  1DDN A;  2PLY A;  4F7Z A;  1PUE E;  2O6G E;  5L3D A;  1B9N A;  2MH2 A;  5LHG A;  5K1Y A;  3GW2 A;  4KN4 X;  5E1X A;  2GXG A;  3W6J B;  4M9S A;  3IHU A;  1LB2 A;  4N9H A;  2XKP A;  3KP6 A;  3BPV A;  4HV6 A;  2P7V B;  1P6R A;  3M9A A;  5DUI A;  1WSU A;  2DPU A;  3ML6 A;  2MC3 A;  5ILS A;  4G9Y A;  2ZXJ A;  1FYK A;  4L9T A;  4IVN A;  5FGM A;  3IC7 A;  5DYM A;  3IL2 A;  2XGX A;  1ZG5 A;  2LF7 A;  2W57 A;  3LQQ A;  5DD8 A;  1IN5 A;  4NHJ A;  4BYY A;  3F22 A;  1OYW A;  2Y75 A;  1B1B A;  2ETH A;  4ZZL A;  2O8X A;  1ZRC A;  3BRO A;  1YW9 A;  4I02 A;  4JBA A;  4PZJ A;  1QZZ A;  3J80 K;  2HKX A;  2HKO A;  3TO6 A;  3Q9V A;  1GVJ A;  5EEH A;  2A07 F;  1YFH A;  3T1B A;  4CYD A;  3GVA A;  5FLX K;  4HF2 A;  3WTX C;  3RI4 A;  1ZLK A;  5LGU A;  4HV5 A;  1BI2 A;  2K02 A;  3M1E A;  2ZNZ A;  3IRQ A;  4HQM A;  1R58 A;  1G4D A;  2QUF A;  2KRF A;  5A2Q K;  1SFX A;  4CDG A;  2CO5 A;  1W7P D;  4EJW A;  2A61 A;  3KZY A;  1OPC A;  2HS5 A;  1OYY A;  4GO1 A;  1RUO A;  5KK1 A;  5HLI A;  2WWY A;  4IRH A;  1XGS A;  3RYR A;  1WQ2 A;  4OIP F;  2LF8 A;  2W25 A;  2A3S A;  2W85 A;  4MEX F;  3NRV A;  3ZN0 A;  2K7L A;  2EK5 A;  3QOP A;  3WTS C;  3CUQ C;  2QBY B;  3LA7 A;  1J5Y A;  4IHS A;  3F8F A;  4U0V A;  2F2E A;  3CO6 C;  4Y15 A;  2O61 A;  4G8X A;  4ZYG A;  1BN5 A;  1YW7 A;  5AIQ A;  1P92 A;  3GZ5 A;  3GX4 X;  5J6X A;  3M8F A;  4M9X A;  5IT3 A;  5BOX A;  3WTV C;  2HOE A;  4G6Q A;  2QYO A;  4I0A A;  2QWW A;  2A5Y B;  4ON0 A;  2YX7 A;  4B09 A;  4QLC U;  2EB7 A;  5D5W B;  2EA2 A;  5LLQ A;  2D1V A;  2EA4 A;  2IA0 A;  1TTY A;  2RN7 A;  2QQB A;  1RI7 A;  1X3U A;  4JK1 X;  3TQN A;  1IAW A;  2DK8 A;  2LSO A;  5F6F A;  3CLO A;  1FYM A;  4M71 A;  4OIO F;  4HQE A;  2Z33 A;  4HDV A;  3LA2 A;  3GEZ A;  4WWC A;  4OMY A;  1ZRF A;  2HR3 A;  2JZY A;  3K1M A;  3KE2 A;  1S8N A;  3JW4 A;  3HHG A;  3T8T A;  2NNN A;  1TW3 A;  3QP6 A;  4GGG A;  2Z5U A;  4LJZ F;  2HZT A;  4KYW A;  4OU0 A;  1EH6 A;  3HTU A;  5ICE A;  4XLN F;  3L7W A;  5L3E A;  4H0E A;  5E20 A;  3V7R A;  1YIO A;  3JAM Z;  2STW A;  4BAY A;  2XAQ A;  1OYI A;  4P96 A;  2LDU A;  5IT9 K;  4O5V A;  4CGZ A;  3L00 A;  3WGI A;  2YU3 A;  2P8T A;  1T39 A;  4M73 A;  1H0M A;  3R6S A;  2MLK A;  2M45 A;  2G7H A;  1ODD A;  2Z99 A;  2NS0 A;  4ESJ A;  3F6V A;  4UVC A;  1U5T B;  5JHU A;  2VOO A;  2X0L A;  4LGW A;  5DDG A;  1Z6R A;  2VBX A;  1RIO H;  1U5T A;  2M1B A;  3LAJ A;  2FQ3 A;  1AWC A;  2DBB A;  3B73 A;  2OA4 A;  3DV8 A;  2ISY A;  4XSZ F;  3HSE A;  4U7B A;  3VFZ A;  5HS9 A;  4E70 A;  4G7Z F;  1HSJ A;  2ESN A;  2XAS A;  4R79 A;  1R5H A;  5BQT A;  2FSW A;  2WC2 A;  4IHT A;  4LFU A;  1R1U A;  3DPT A;  1P4A A;  2HGC A;  1Q1H A;  2PI0 A;  5CVJ A;  2ZNY A;  3HRU A;  2L54 A;  1F5T A;  3ABU A;  2FBI A;  1S7O A;  3NEU A;  1BJA A;  4LB6 B;  4IPA A;  3I71 A;  3GFI A;  4BXU A;  5D4R A;  3J81 K;  2EWN A;  2PG4 A;  4Y13 A;  1DP7 P;  3MAJ A;  2KIM A;  3WE2 A;  1K78 B;  1MKM A;  1B9M A;  3ZN1 A;  3GXO A;  4I7H A;  2OQG A;  4WF2 A;  4DNC A;  1U6G A;  5DEQ A;  1G3Y A;  5JFR A;  1FP2 A;  2F5C A;  2AS5 F;  1K78 A;  2AXL A;  4G7O F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...