1ON2A

Bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
135
structure length
135
Chain Sequence
TTPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Manganese-Bound Manganese Transport Regulator of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulator mntR
total genus 49
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1on2A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1on2A02
4AD9A 4XSXF 4RB2C 3H92A 1IXRC 2VN2A 5D4SA 4CYDA 4U88A 4KICA 1YYVA 1S3JA 1U8RA 4RGRA 2Z33A 2J5PA 3WE3A 4A5NA 1KU2A 4M9XA 5D8KB 4Q5SF 5A2QZ 3RPQA 3E6DA 1D8KA 3QPTA 4LFUA 4PGHA 3MFKA 2ADUA 4WXHA 2UXXA 2EK5A 3LA7A 1TQIA 4P96A 5E18F 1O3SA 2MLKA 4ZYHA 2COMA 3DV8A 3F8MA 3J81K 1W7PD 4OMYA 1BC7C 3RKWA 2DPUA 4BH9A 1BI2A 3LFKA 3FM5A 1IZ1A 4F7ZA 5FLXZ 4EM0B 2KIFA 3ABUA 1R00A 4CO8A 5LGNA 5TRDA 2CW0F 4Q47A 3FZVA 3QOPA 4ZYEA 2FXAA 4BHCA 3BJAA 3SZPA 1KU7A 1W5TA 3BROA 1I5ZA 4CZZA 2QWWA 3MCZA 4ETSA 1UFMA 3GLXA 1S29A 3F8NA 1IUYA 1YTYA 4IVNA 1B9MA 2JSCA 3T0YA 1ZGAA 4HW0A 3RIRA 4OMZA 4Y17A 4XBFA 3E5UA 2P6SA 2MBFA 2PN6A 3CTAA 2EV5A 3Q5FA 4ASNA 2UWMA 3IWFA 1UHWA 1KQ9A 5K5QA 3WTUC 4GYGA 5JHUA 5BPDA 3I59B 2WV0A 1FNNA 1RUOA 3VB2A 1IN4A 2Z5UA 2H09A 3E6CC 1SD5A 2ZCWA 1W7PA 3E6BA 2ISZA 4BYYA 3PQKA 2EFNA 4HDVA 3B73A 3ZP5A 5BS6A 2H6BA 4HAMA 5E1ZB 5F1RA 3HOSA 3GFJA 1AOYA 4I01A 1IXSB 3F8BA 3I4PA 3V7CA 2OA4A 2HKXA 3F21A 2P5LC 2DK5A 3FXUA 2B0LA 1Z7UA 2A3SA 2E7XA 3M8FA 4I02A 1IN5A 4UHTA 4OOIA 2K7LA 4ESBA 1P4WA 1FZPB 1QGPA 3VOEA 1KA8A 2V6CA 4HF0A 3CUOA 1LDKB 4LK0F 4OU0A 3QU6A 1BOAA 2EA2A 2LF7A 3CO7C 3LA3A 1XGMA 4CHUA 4B09A 2IA0A 2D2WA 3WTSC 2XUBA 3BDDA 4A0ZA 3BWGA 4LLNA 2FNAA 2EJRA 1S8NA 1FBSA 4BAYA 2F2EA 1SD4A 3ZMUA 2Y0MA 3M8EA 2ISYA 2IW5A 3BPXA 4GCVA 3TDUC 2VBYA 1IN7A 2ZO4A 1U5TC 4MGRA 3GZ5A 3G3ZA 4A2UA 4ON0A 3ZN1A 3E3VA 3TKYA 1B59A 2NYXA 2JT1A 2HWVA 4IJAA 4ESFA 1QBJA 4KA4A 2FQ3A 4U0WA 2ZNZA 1YS7A 5FD5A 2E7WA 3T1BA 1XDSA 1YW8A 4LLGF 1ZG5A 3R60A 4AVPA 5HLHA 1MZBA 4K2EA 3RJPA 1ZRDA 1ODDA 1ZARA 1FSEA 3V8JA 4XRFA 3I64A 2BBYA 3L09A 1P4AA 2LSOA 1U78A 2OQRA 2L54A 5HLIA 3QU3A 2V1DA 3WGHA 3K69A 1L0OC 1HXDA 3DFGA 1FOKA 4CDGA 4ENMA 5FGMA 3R0JA 3GFIA 1T98A 3KLNA 2R7FA 4AIKA 5HS7A 1JHHA 1HKTA 5D5VB 2W85A 2CYYA 3R6SA 5BPIA 4HDUA 2FRHA 4UUVA 1FPQA 3CDHA 4LD5A 3ZN0A 2ACJA 5K5RA 4M71A 2JTVA 1XGNA 4M6XA 1GXQA 1LEBA 2XRNA 4HF1A 1FBQA 1PP8F 5DCFA 2GXGA 3V7SA 1RZ4A 2VBZA 1QZZA 5D4RA 1K7AA 4YFNF 1GVJA 3IKTA 2FBHA 5EEHA 4MNUA 1S7AA 4U7BA 4GXOA 4QLCU 3QPHA 2ZKZA 1HW1A 2XROA 1XGSA 1PP7U 4IXAA 2PJPA 2HFHA 2G9WA 4EM2A 1FLIA 4RAZA 4D0PA 1H9TA 5LRRA 2CFXA 1A04A 3HTSB 1G4DA 2E1NA 1DP7P 3HHHA 5H6QA 2QQAA 5LRSA 3V8KA 1HSJA 4KN7X 1YIOA 3SHFA 1B9NA 5KVRA 4A0YA 3TO7A 3GEZA 1CGPA 3V8LA 3W6JB 1REPC 2MD5A 5HVQC 3KEOA 2GQQA 4Q4ZF 1SFEA 1JHFA 3WG9A 1XDUA 2P4WA 1MJAA 4EQQA 2VC1A 5ILUA 3HRUA 1EH7A 5CVIA 2LKPA 4S04A 2FNPA 3BP8A 4BHPA 3J7AO 1HW5A 2KJCA 1ON2A 3MQ0A 3K1MA 1S6LA 1TBXA 2W24A 4KDPA 1XD7A 3GF2A 3JSPA 3TDZC 3QRFF 1LDJA 2M8EA 2Z9OA 1Z05A 2L01A 2C6YA 3S2WA 4R1HA 4LMYA 4JBAA 1FX7A 5D5XB 4L5IA 4HQMA 4MTEA 4HX4A 3F22A 3SXYA 3EQLF 2DQRA 6PAXA 2QBYB 4L0ZB 4LLLA 1I1SA 5ICGA 2DBBA 1ZREA 3GW2A 2JPBA 1D5VA 3CLOA 4L9JA 1HSTA 4RGXA 3T8RA 1GXPA 4M74A 4GO1A 3CUQC 1Z1DA 3VFZA 2MA3A 4QWQA 3FM3A 4MTDA 3V7RA 3EDPA 1SMTA 1R1UA 4IPAA 1LDDA 3H3ZA 5LHHA 3L9FA 3MZYA 1K79A 3KP4A 1ZAOA 5FD6A 4I98B 2DAOA 2JZYA 1BI3A 3RDIA 1NHAA 4Z2YA 1O3QA 4A6EA 2EB7A 1ONVA 2Q2EA 3O3KA 4G6DA 2YX7A 2BYVE 3GWZA 4WCGA 3Q9VA 1QZYA 1U2WA 2A69F 4ZZDA 3HOTA 3WTXC 3TO6A 2DK8A 1FSHA 1XB4A 4M73A 3KFWX 4PDKA 4ZYGA 2YU3A 1LJ9A 1KYZA 3I58A 4WWCA 4YFKF 2LNBA 1F4KA 2X4HA 4N0BA 1ZYRF 2P5VA 2L4MA 2IP2A 4MHGA 2PEXA 4KIGA 4EJUA 2G7UA 2HZTA 4PZJA 3GXOA 1OPCA 4KNYA 2V1UA 3HRTA 3ERED 2RDPA 3P9CA 3E6MA 2L4AA 2EFOA 2P7VB 4I0AA 1SAXA 5L3FA 3K2ZA 2IPQX 2K02A 2QLZA 3ZMZA 2MC3A 5DD4A 2CSOA 3KLOA 2ZXJA 3EUHA 4P55A 1J7KA 1ZG1A 1BI0A 1B1BA 3TGNA 1T39A 2VXZA 1YLFA 5LEKA 4Y13A 2GZWA 1UB9A 5E8IA 1KU3A 3DPLC 1XMKA 5CYVA 5E8GA 2M30A 2XAHA 5A2QK 1R1VA 1T2KA 2PLYA 2VONA 4AIHA 2OBPA 3RYPA 2L3DA 4XLPF 3I54A 4I0BA 2YPRA 4EM1A 3IL2A 3KEQA 2YX4A 4UV9A 1XCBA 3F8CA 2VT3A 1W4MA 3JW4A 1BM9A 4NQWA 1BIBA 1MD0A 2O8XA 2QM3A 1P4XA 3N97A 1EH6A 2CQKA 2XAFA 5ICCA 3COAC 1VTNC 4ENKA 4RAYA 2QBYA 4LG0B 1TQMA 4G6QA 2VBXA 2M45A 2M5WA 1R5HA 4I7HA 1Z6RA 4KIBA 5E20A 4RB1A 1FYLA 1P6RA 2R3SA 1KQ8A 3DF8A 4G8XA 4M9ZA 1K78B 2XHKA 2VC0A 4YG2F 4KT5C 3J80Z 1EH8A 3WTYC 4L5JA 1Z9CA 2O3FA 1TTYA 2WWYA 1TNTA 3BPVA 3P7NA 2OD5A 2GIVA 2XIGA 1MJBA 1AWCA 3E97A 2QVOA 3SFZA 2IJLA 1O57A 1HQCA 2PMHA 2W25A 2JPCA 3F3XA 3TO9A 1QO0D 1ZLKA 2F5DA 4XLNF 5AIPA 3CUQB 1MDMB 4LK1F 5BQTA 2XKPA 4EMSA 5JR3A 4EJVA 3JSOA 4RB3C 2HGCA 1DDNA 5AIQA 4IRHA 1WSUA 4NHJA 4UVAA 5D5UB 5LGTA 2HKOA 3WTVC 1X3UA 3B02A 2F5EA 2DI3A 1R58A 5JVTA 1CF7B 2P6TA 1LB2A 2Z99A 3F6VA 4HV5A 1D3YA 1MKMA 3W6KB 5LLQA 1ZLJA 3J81Z 2ZBKA 1IRGA 4G94A 5CLSA 3TOBA 4HA8A 3ELKA 3IRQA 2D1VA 1J9IA 2O61A 2IA1A 3ABTA 4WXDA 2YSRA 3BJ6A 2OZ6A 1FYKA 5FLXK 3BOQA 1YW9A 2Y48A 2V9VA 2PFBA 3HSFA 4HLYA 5F6FA 1XSVA 1R22A 1J5YA 1TW3A 4IHSA 1BN5A 2IVMA 2OZUA 2XVCA 4U0YA 2Q0OA 5EEGA 2HTJA 2HYGD 3MAJA 3ZMTA 2BGCA 2KIMA 3KP5A 1Z91A 1H0MA 3R61A 4UVBA 1T38A 1Z6TA 1F5TA 3I0TA 1HKSA 1XMAA 4G9YA 2QZ8A 1LVAA 4ENJA 3HTUA 3RKYA 1FY7A 5FB2A 2XKOA 3ZQ7A 3TOAA 3WE2A 2QENA 3LA2A 4KFCA 4HX7A 2P8TA 4L0YB 4TV7A 3PQJA 2FBKA 5K1YA 5E1XA 3ECOA 1MJ9A 1G3YA 1DUXC 4LG0A 4KMFA 1DPRA 5ICFA 4Y15A 4I2OA 1RI7A 3C18A 3KP2A 1YQAA 1JXSA 3JTGA 4CICA 3WGIA 4OINF 3GO5A 1K78A 1IF1A 2IRFG 3T8TA 4L9VA 4JK1X 1RNLA 2DTRA 1WI9A 5DUIA 3JTHA 3WTTC 2DQLA 3EYIA 4DNCA 3R4KA 1J59A 2XV4S 3FWEA 4R8HA 4BNCA 3BJOA 1FYMA 4R79A 2K86A 3CUQA 1MDMA 1FC3A 1OYWA 3FXQA 2TDXA 2RN7A 3M9AA 2VT2A 4MEXF 3FMSA 1XGOA 1XSXA 3K1NA 1L3LA 4M9SA 2P7CB 1XCVA 3DKWA 2JRTA 3IKVA 3WTZA 4WF2A 1CF7A 4HX8A 1D8JA 3FMRA 4MQ9F 1J2XA 3FHZA 1V4RA 3U1DA 2CGPA 4H0EA 2NRAC 2RC4A 3FF5A 2UZKA 2DO7A 3SQNA 2A5YB 5TJJA 4WXCA 5AONA 4A12A 4L9TA 3KZYA 1QPMA 3P9KA 3ZPLA 2ELHA 4M72A 4N9HA 3GYHX 4IF4A 3MEXA 3Q9SA 1KQ0A 2RKHA 4OIPF 3IWZA 5L3CA 2HR3A 2ZNYA 3ROUA 3KZZA 1IW7F 3KP6A 1KYWA 2BE5F 1U3EM 4WK8F 2RNJA 5J8CA 4ZYDA 4LB5A 3GUDA 1OYIA 3HRSA 3IRRA 3V4GA 5ICEA 3OOPA 2G7HA 5CJ9A 2STWA 5L3BA 2UXNA 4L9NA 2HYFA 4LGWA 1G3SA 2LDUA 5D6EA 4ZH4F 1PUEE 1I27A 4XSZF 2MLGA 4BXUA 2GA2A 5DUKA 3QP6A 2A61A 3E5XA 1E2XA 3C7JA 2XASA 1MGTA 1SFUA 4O6JA 2J5OA 1RUNA 3ZMVA 1UCRA 1TLHB 2RQPA 3PFIA 1SD7A 4PGGA 2EFQA 3GX4X 4O5VA 4UVCA 3K1PA 3F8FA 5JFRA 1R7JA 5CVUA 2L02A 1DPUA 4GYIA 4G7OF 1R23A 4OIQF 2OQGA 1O7LA 3NRVA 3L00A 4HQEA 2ESNA 5L3GA 2H27A 3LQRA 2KJBA 3DPTA 2FA5A 1YS6A 4UXNA 2F5FA 3HYIA 4KYWA 4U0VA 1P92A 2K4BA 2MH2A 2NNNA 4KMUX 2ZFWA 3KE2A 2WC2A 1IN6A 1EV7A 4AIJA 2CWEA 4U7DA 3WODF 3BY6A 2VOOA 5DV5A 2V79A 3HIFA 2O03A 2QYOA 1IAWA 3ULQB 2FBIA 1IRFA 3I5UA 3D5LA 2E1CA 3HSEA 4YIIA 4I09A 5LHGA 4HYEA 2FF4A 5BMZA 1OYYA 4KUMA 2VODA 3OV8A 2Q8KA 1I6XA 1U5TA 3QAHA 4B8XA 4S05A 2STTA 4A0XA 1LNWA 1F1ZA 4MQVA 2ZMEA 4P9FA 3WU1B 4RB0A 3D0SA 2RV8A 3RPUA 5E17F 2EWNA 2A68F 1W5SA 2ETHA 2D1HA 2VE8A 4NB5A 2MH9A 1PDNC 2NNYA 3DQVC 3ZMDA 4ESJA 5IT9Z 3HUGA 5JI6A 3VODA 4L18B 2PG4A 2FMYA 4IRIA 3K0LA 2FSWA 1ON1A 3DXJF 3GZ6A 3DEUA 1O7FA 3ZMSA 5FFXA 3K9TA 4HZFA 1FWZA 1IN8A 2YR2A 1JE8A 2ZJ2A 1BJAA 2FU4A 1QQIA 4HBLA 2XAQA 2VE9A 1ZRCA 3I53A 2KIUA 1J75A 4UV8A 2HQNA 4A6DA 3FX3A 2RVCA 3RTRA 1E17A 2DT5A 1UHMA 1LQ1A 4P9UA 2XAJA 4HLXA 2DFIA 2HS5A 4PCQA 1BC8C 1G6NA 1V3FA 4EJWA 3ML6A 3O6BB 2HQRA 4AWXB 3FMQA 5D6FA 3CJNA 4G7HF 4CGZA 3E5QA 3ECHA 3LAPA 3I71A 1IXCA 2KKOA 2F5CA 1YFHA 2PMUA 4P5OA 2GWRA 3LQQA 5H6RA 3JAMZ 4UNOA 2EV0A 2O6GE 1OKRA 1HKQA 4BQAA 1XN7A 1Y0UA 2W57A 2M87A 2PQ8A 5ED4A 2HDCA 1K6OA 4MEYF 3TQNA 3WTWC 4Q48A 1FP2A 2EFPA 5DCMB 1C0WA 4ZZLA 2A6HF 3U2RA 3J80K 2A07F 4JQFA 4IRGA 4A5MA 5D8LB 1I1GA 1P2FA 4KN4X 3N4MA 4RGUA 1ZGJA 2LF8A 3HSRA 5D5WB 1YW7A 2EV6A 1GHCA 2QQ9A 2GAUA 1B4AA 4HV6A 5DDGA 5J6XA 2V1XA 3IC7A 2VOPA 1FP1D 3AAFA 5HS8A 2EFWA 2OAZA 2KRFA 1USTA 2K27A 4EGZA 2W84A 5HDKA 5L3EA 3WU0A 1U5TB 1YG2A 2H94A 3MWMA 5CVJA 5DD8A 2ZMEB 1BI1A 3LAJA 4YIFA 3MZHA 2GXBA 3NEUA 1QNTA 5KK1A 2DPDA 3L7WA 1WRJA 2D45A 2WTEA 3F6OA 3FXRA 1SFXA 5CVVA 4RGSA 4ENNA 3QP5A 2DW4A 4CXFA 2DLLA 4FT8A 4BHBA 2XAGA 1TQPA 1R36A 1SD6A 4M6YA 2QQBA 2K4JA 3DP7A 3BZ6A 5K5OA 5F64A 2X0LA 2H6CA 2M1BA 5ILVA 1U6GA 4FX0A 4KIFA 5DYMA 2FMLA 2O0YA 5HS9A 2FOKA 1ZN2A 2NS0A 3GFMA 1F9NA 3KETA 3G73A 4OIOF 2A6EF 3LSTA 2BEOA 3WGGA 5J8FA 1O3RA 1FT9A 3RKXA 1ULYA 5HOOA 1HW2A 5H20A 3LWFA 4FHTA 2P5KA 2AS5F 4EJTA 1R5GA 1ZHFA 1USSA 3U9GA 3C1DA 3P9IA 3RYRA 1R1TA 5IT9K 4LJZF 3F23A 5IT3A 1WQ2A 5ILSA 3HHGA 3KP3A 5BOXA 3H3UA 5E1WA 3VEPA 3C3WA 3REOA 2PI0A 1B6AA 1KGSA 2Z3YA 4OIRF 2QUFA 3T5XA 1OMIA 5DEQA 2XGXA 3R0AA 2CG4A 4IHTA 2RGVA 5DCMA 1T6SA 4LB6B 1HBXG 2Y75A 3IHUA 5FFZA 3KP7A 4HF2A 1FBUA 5CVRA 2PBIA 3L2CA 5FO5A 2CO5A 1LEAA 2IT0A 3GVAA 4WX9A 5HLGA 1TNSA 5ERIA 5LEJA 2AXLA 3M1EA 3M7GA 3I59A 1KU9A 2FE3A 3EETA 2BV6A 4YFXF 1ZH5A 1W7PB 2HOEA 1BBYA 1SMYF 1G3WA 1S7OA 2HTSA 4EVIA 1TW2A 4EJOA 4EGYA 4O3MA 3ISPA 2IA2A 4DQ2A 1O3TA 1YO5C 3CO6C 5HDGA 3KCCA 5LHIA 1WKMA 3JAMK 4FX4A 2VBWA 5L3DA 3F72A 2HEOA 1G3TA 1Q1HA 3SZTA 4E70A 1JGSA 4HOBA 1ZRFA 5HDNA 3EYYA 2FEZA 2NAZA 1BIAA 2R7DA 4GGGA 3RI4A 2GA1A 3GFLA 3HRMA 5LGUA 1XSDA 1J0RA 1WWXA 3NQOA 2EA4A 1OR7A 4RS8A 4G7ZF 1RIOH 1STZA 2DU9A 2ESHA 3O2PE 4EV0A 2OU2A 1H9GA 4N9IA 1ZG3A 1T0FA 5LBQA
chains in the Genus database with same CATH superfamily
2LD5A 1P7JA 4AD9A 3ZXSA 1ETQA 4XSXF 3ZQIA 4RB2C 2JQ7A 3H92A 4M3DA 1IXRC 2VN2A 4I76A 1W0TA 5D4SA 4CYDA 4U88A 1I6HJ 2QCOA 4KICA 5EDNA 2LY9A 1YYVA 1QVUA 1K61A 3HM5A 5JLWA 1WGXA 1S3JA 1U8RA 3G1OA 1K83J 4RGRA 3I4NJ 4PK4A 2E35A 1TL8A 2Z33A 3ZQGA 2J5PA 3WE3A 3HKZA 4A5NA 4NNJA 1KU2A 2N8GA 4M9XA 5D8KB 4Q5SF 1UAAA 5A2QZ 3RPQA 3E6DA 1QHGA 1D8KA 3QPTA 2DJNA 4LFUA 2DA3A 4PGHA 2KISA 3MFKA 2ADUA 2MFZA 5J40A 3PNVA 2UXXA 4WXHA 3W2VA 2EK5A 3LA7A 1TQIA 4P96A 2MW8A 5E18F 3MZ8A 1O3SA 3HOWJ 1V54H 2MLKA 4ZYHA 4BS9A 2COMA 3CQZJ 3DV8A 3F8MA 3J81K 3OYLA 1X2MA 5IP7J 1W7PD 4OMYA 1BC7C 3RKWA 2DPUA 4V2GA 4BH9A 4DYCA 1BI2A 3LFKA 1YX5A 3FM5A 1IZ1A 4F7ZA 2R7OA 5FLXZ 3S3MA 2KLOA 2L7KA 2OCEA 1RR7A 2OPTA 4EM0B 3H9JA 3RQ4A 2KIFA 3ABUA 4GFBA 4BQOA 1R00A 4CO8A 4BQQA 2EPFA 5LGNA 5TRDA 2CW0F 3BQZA 3CJRB 4Q47A 3FZVA 2PJRA 3QOPA 3VYUB 3TEDA 2KPMA 4IKFA 2HDDA 3HZJA 4ZYEA 2FXAA 3N05A 1R4NB 4BHCA 2M34A 3BJAA 3SZPA 1KU7A 1W5TA 3BROA 2M9HA 2DMUA 1D5YA 1I5ZA 2AQEA 2HVSA 4CZZA 4C3HJ 1GVDA 5F08A 2QWWA 3MCZA 4ETSA 1P7IA 4CSWA 4XKWA 4V2FA 1UFMA 3GLXA 4E7ZA 2FD5A 1S29A 3TP3A 3F8NA 1IUYA 3QODA 4PSWA 2DMTA 1YTYA 4IVNA 1B9MA 2JSCA 3T0YA 1ZGAA 4HW0A 2EIJH 2ME6A 3RIRA 5K7FA 4LG3A 1XMXA 2EIMH 1OR7C 4OMZA 4Y17A 4XBFA 2R7VA 3OSFA 5FKLA 4DYRA 3E5UA 2P6SA 2MBFA 1SFKA 1ORKA 4F52A 2PN6A 3CTAA 1X3WB 2BVMA 4RBOA 2M35A 3CCJI 3JRCA 2EV5A 1OCPA 3Q5FA 2DYSH 4ASNA 2UWMA 1D1AA 2ELKA 4JYKA 2M7BA 2LTPA 3IWFA 1UHWA 1KQ9A 2V1NA 4ZYAA 5K5QA 3H5AA 3WTUC 4XK4A 3BG5A 1I3QJ 4P1WA 4GYGA 5JHUA 5BPDA 3I59B 3L2UA 2B9SA 2WV0A 3BG6A 3S2DJ 5CQEA 1FNNA 2OV7A 4FE4A 1RUOA 3VB2A 1IN4A 3MKYB 2Z5UA 1AKHA 2H09A 3E6CC 1SD5A 2ZCWA 1X4OA 1W7PA 3E6BA 2ISZA 4BYYA 4BE1A 3W2AA 3W3CA 3PQKA 1ZK8A 2EFNA 4F55A 2XF7A 4PFOA 3B73A 3ZP5A 3OYBA 4HDVA 1VQPI 5BS6A 3PJRA 1RKTA 1EJ9A 2H6BA 2X1CA 4HAMA 5E1ZB 5F1RA 3DU6A 3HOSA 3QYEA 3AG3H 3GFJA 5TGTA 1X1AA 4I01A 2CW7A 3CC7I 1AOYA 1GV5A 1IXSB 3AFHA 3F8BA 3I4PA 3V7CA 2OA4A 2HKXA 4CYCB 3F21A 1NH3A 2P5LC 2DK5A 3FXUA 3I56I 1P9QC 2NOGA 2H8RA 2B0LA 1Z7UA 3G6EI 2A3SA 2E7XA 2QQ8A 3BCBA 3M8FA 1JT0A 1QPIA 4I02A 1IN5A 4NC7A 2XF6A 4CCKA 3ABKH 4UHTA 4OOIA 4E7JA 3SDGA 2Y31A 2GOXB 3OR1C 4XKVA 4FASD 1K4TA 2K7LA 4ESBA 3BR3A 1P4WA 1FZPB 3J7ZI 3PIPF 3RZOJ 1QGPA 2X9DA 3UNGC 3VOEA 3OOUA 2DA5A 2L0KA 1KA8A 1PYVA 2V6CA 2LC2A 1H88C 4HF0A 3G4SI 2V9KA 1A6IA 3CUOA 1LDKB 4LK0F 4OU0A 2EH3A 3QU6A 3RZDJ 1QU3A 1BOAA 2EA2A 4U87A 2LF7A 4XICA 4CCOA 3OYKA 3CO7C 3LA3A 1XGMA 1MMDA 4XMYA 4XOTA 4CHUA 4B09A 4BKXA 2IA0A 2D2WA 2WB1N 3PM1A 3WTSC 2E1MC 1BL0A 2XUBA 2MZ4A 3BDDA 4A93J 4A0ZA 3BWGA 4LLNA 2FNAA 1EF4A 1XTAA 2O8KA 2BW3B 2K3FA 1KONA 1BW6A 2EJRA 1S8NA 1Z0XA 2G0EA 1FBSA 2L7MP 3HBLA 4BAYA 2F2EA 2XPWA 4AUXA 5HLTA 1W1WE 1SD4A 1TWGJ 4JX5A 4HPQA 3QPLA 3ZMUA 2Y0MA 3M8EA 1VNDA 2ISYA 1X1CA 2IW5A 1XG1A 1Y1WJ 4XN3A 3BPXA 3NARA 4GCVA 3TDUC 1WZ2A 2VBYA 1IN7A 2ZO4A 1U5TC 4KT6A 4MGRA 5M3MJ 3GZ5A 2WAFA 3G3ZA 4A2UA 2X6XA 4ON0A 3CZ6A 1R9TJ 3BTCA 3ZN1A 3E3VA 3TKYA 1NG7A 3G71I 1B59A 4B48A 2DMPA 4XKCA 2NYXA 3QQAA 2JT1A 2HWVA 4IJAA 5F1JA 3WU2C 2IGOA 3D5SC 4ESFA 4KA4A 2FQ3A 1QBJA 4U0WA 2VPRA 2ZNZA 1YS7A 4Y3OA 4XLCA 5FD5A 2XPUA 1GV2A 1T8IA 2E7WA 3T1BA 2Z1DA 2K5CA 1XDSA 1OQYA 1YW8A 3KYCB 4A3BJ 4LLGF 4RM3A 3QYFA 2NS8A 2PJRB 1ZG5A 3R60A 4AVPA 5HLHA 1MZBA 4K2EA 3PIOF 3ZQQA 1LFPA 3J7YJ 1JUSA 3RJPA 1W5CC 1SFOJ 1ZRDA 1SVLA 4HNTA 1IV8A 1ODDA 1ZARA 1FSEA 5LFAA 4IOCF 3J7AY 2K9NA 3V8JA 4LIVA 4XRFA 3I64A 2VB6A 2BBYA 1CQTA 4A3DJ 3L09A 1P4AA 2LSOA 1U78A 2EQRA 2OQRA 2W7NA 2IS6A 2L54A 2R7WA 5HLIA 4D7NA 1PVEA 3OYCA 3QU3A 2V1DA 3WGHA 3K69A 1L0OC 3CCVI 1RR8C 2ME0A 3FBIB 1HXDA 3OS2A 3DFGA 2NOJB 4HSRA 1FOKA 3MD2A 1IRZA 4CDGA 1GLNA 4ENMA 2A05A 5FGMA 3R0JA 5M5XJ 3GFIA 2DODA 4C9YA 1T98A 5M5YJ 3KLNA 1W36C 2R7FA 3HL2A 4AIKA 3BZKA 5HS7A 1JHHA 1HKTA 4B43A 5D5VB 2W85A 1SANA 2CYYA 2GIZA 5E3LA 3R6SA 3ZR8X 5BPIA 4HDUA 2FRHA 4UUVA 1FPQA 3CDHA 3DLLF 4LD5A 1TWCJ 1X19A 3ZN0A 1X3ZB 4AYBN 4M71A 5K5RA 2ACJA 2JTVA 1XGNA 2Q2EB 4M6XA 1GXQA 3TW7A 1LEBA 5FLXR 2XRNA 4HF1A 2JK3A 2R5YB 1FBQA 3GTLJ 1TT5B 1FIPA 1PP8F 5DCFA 4A3IJ 5FKNA 2GXGA 2Z2SB 3V7SA 3DBLB 1AKHB 1J09A 2K3PA 1RZ4A 3C2BA 2VBZA 1QZZA 5D4RA 1K7AA 4YFNF 2GXAA 1GVJA 3IKTA 2E2JJ 4XLAA 2FBHA 5JHFA 5EEHA 1MMAA 4MNUA 4E7IA 3VSLA 1S7AA 4U7BA 1WJDA 1GT0C 1U8BA 4GXOA 3IUOA 4QLCU 5J1UA 3QPHA 4G6TB 2ZKZA 3IP4B 1HW1A 3I9V2 2XROA 1XGSA 1PP7U 4IXAA 2EILH 2JN6A 3CC2I 1XS9A 1IV6A 3BR1A 2PJPA 1T33A 2HFHA 2ZXWH 2XC7A 2G9WA 3KX2A 4EM2A 4PJ0C 3ERMA 1FLIA 4RAZA 4D0PA 2P0WA 5LRRA 1VQOI 1H9TA 3I55I 2CFXA 4BQNA 3BT9A 1A04A 4D5FA 3HTSB 2PMZN 1G4DA 2BXZA 2E1NA 1DP7P 3HHHA 2CRGA 5H6QA 3Q0VA 2RAEA 1BR4A 1LUJB 2M2EA 2QQAA 2FOWA 2JJ7A 2LKSA 5LRSA 1GDTA 3BR2A 3V8KA 5J1YA 4ZDOA 1HSJA 4KN7X 1YIOA 2B63J 1T08B 2LLKA 1B9NA 3SHFA 5KVRA 4A0YA 3TO7A 2YU9J 3GEZA 2X98A 1CGPA 1WI3A 3V8LA 4CH7A 1TWFJ 5IP6A 1MMSA 3W6JB 1REPC 2MD5A 5HVQC 3E0JB 2KQRA 2UV1A 3KEOA 5A2QR 1U0JA 2GQQA 2VIXA 3WHCA 1SVMA 1UG2A 4Q4ZF 3DU5A 1VQMI 3DBRB 1SFEA 1JHFA 3WG9A 1RQ6A 1XDUA 2BW3A 1SVOA 2P4WA 1B72A 1MJAA 1X1PA 4EQQA 2VC1A 5ILUA 3HRUA 1EH7A 2K40A 2EZLA 2P81A 5CVIA 2K85A 3UR3C 2LY2A 2LKPA 4S04A 1X2NA 2VKVA 1MMNA 2FNPA 2KRHA 2M7AA 4MLOA 3BP8A 4BHPA 3M8JA 2R7RA 3J7AO 1HW5A 1BR1A 1ON2A 2KJCA 2IXSA 3GTQJ 3MQ0A 3K1MA 4M3GA 1S6LA 1TBXA 2W24A 5EEAA 4KDPA 1XD7A 1RPWA 2XSDC 2WBMA 2HOSA 3GF2A 3JSPA 3KYDB 3TDZC 3QRFF 1LDJA 2M8EA 1MMGA 3JRGA 2Z9OA 3H3VK 3IAS2 1NK3P 1Z05A 3CD6I 2L01A 3A02A 2C6YA 3S2WA 4R1HA 4LMYA 4JBAA 2ID3A 1FX7A 2X1EA 3VYTB 5D5XB 2BY3A 4L5IA 3DPUA 4HQMA 4MTEA 4HX4A 3F22A 1IDYA 3SXYA 3EQLF 2DQRA 1H89C 3CCRI 2QEXI 2COBA 6PAXA 2QBYB 4L0ZB 2CH0A 4LLLA 1I1SA 5ICGA 2DBBA 5B3SH 4X6AJ 2MABA 2R7UA 3FXMA 3MN2A 1ZREA 2YS9A 1JJ8C 3GW2A 2JPBA 1D5VA 2LK2A 1E3HA 2VKEA 3CLOA 2XDVA 1E0EA 3W6VA 4L9JA 1HSTA 4E7SA 4RGXA 5TISC 4ZTFA 3T8RA 1YIJI 1GXPA 4M74A 4GO1A 3CUQC 3ASNH 3K4MA 1FTZA 1Z1DA 3H0GJ 3VFZA 1WH7A 2MA3A 3M4OJ 1BW5A 4QWQA 1O4XA 4CCMA 5IT9R 1N78A 3FM3A 3VPRA 4C2MJ 4MTDA 1X1DA 2LFBA 2R0QC 3V7RA 3EDPA 2R7XA 1SMTA 1R1UA 2LVSA 4IPAA 3MMYB 1LDDA 2WB1A 1T56A 3H3ZA 5LHHA 3L9FA 3MZYA 3OS0A 4ZDLA 3U1KA 1K79A 3KP4A 2L5QA 1ZAOA 2MYSA 2R7ZJ 3MKWB 1D0YA 2PMZA 1YJWI 4OAZA 2VKHA 4I98B 2DAOA 2HPIA 2X51A 5FD6A 3S17J 2JZYA 1BI3A 2M4KA 1NHAA 1ZKGA 4Z2YA 3RDIA 1O3QA 2HQAA 4A6EA 2EB7A 4BEHA 3ONQA 1ONVA 2DA1A 3CC4I 2DDBA 2Q2EA 4XQFA 2LREA 3O3KA 4G6DA 2DT7B 2YX7A 2IS4A 2LOOA 2BYVE 3GWZA 3O8GA 5E79C 4WCGA 3GTKJ 2R5YA 2NVQJ 3OIPA 3Q9VA 2MVTA 1QZYA 3H5NA 3EPZA 3BR6A 1U2WA 2A69F 3FXJA 1ERDA 4ZZDA 3HOTA 2M3AA 4A3CJ 2M4GA 4ZC3A 3WTXC 3DLAA 3TO6A 1QHHD 2DK8A 1FSHA 3BQYA 1XB4A 4M73A 3KFWX 4PDKA 4ZDPA 4ZYGA 2YU3A 4EEFG 1LJ9A 1KYZA 1Z3YA 3I58A 4WWCA 1Z7LA 4YFKF 2LNBA 3I4MJ 2KHMA 1FEXA 2ZXHA 1F4KA 4XLHA 2X4HA 4D9JA 2R5ZB 4N0BA 1ZYRF 5KCMA 4B1RA 2P5VA 2L4MA 3CJQB 1XPXA 2L7FP 1IJWC 2WAQA 2XRLA 5GAHJ 2IP2A 4MHGA 2PEXA 4KIGA 4PUSA 4CA0A 4EJUA 2G7UA 1WH5A 2HZTA 3I3LA 4RDUA 3H9QA 4PZJA 3GXOA 1OPCA 2E1OA 4W97A 3H35A 2HXOA 4KNYA 3DCFA 2V1UA 3HRTA 3ERED 1DU0A 2K9MA 1JKOC 3ASOH 2RDPA 3P9CA 1VQ8I 3E6MA 1FOWA 2L4AA 3G1MA 2EFOA 2P7VB 4I0AA 2GLOA 1MBFA 1MBKA 1SAXA 2FQ4A 3LSPA 5L3FA 4BACA 3GTMJ 3K2ZA 4LOCA 2IPQX 2K02A 2HYJA 2QLZA 4QSHA 3ZMZA 2DOAA 2MC3A 5DD4A 2CSOA 3KLOA 2ZXJA 4PJJA 3RQIA 2JUGA 3IH4A 3EUHA 4P55A 1J7KA 1ZG1A 1W36D 1BI0A 1B1BA 3S8PA 2DFFA 1EA3A 2F5VA 4DZJA 3DEWA 4B4CA 3TGNA 2RQQA 1T39A 2VXZA 3SFIA 1B72B 1YLFA 2DT6A 4RMNA 3S32A 5LEKA 4Y13A 5IY5H 2GZWA 1UB9A 5E8IA 3CF2A 4A3JJ 1KU3A 3DPLC 1XMKA 5CYVA 5E8GA 2M30A 1ZGWA 2XAHA 5A2QK 1R1VA 1T2KA 2A5WA 1WJFA 2PLYA 3QYBA 2VQHA 2VONA 4AIHA 2OBPA 3RYPA 1NK2P 2L3DA 1SEUA 4XLPF 5EG0B 3I54A 3CF5F 1WPKA 1WFXA 4HEA2 1A31A 3CP8A 4I0BA 4XKBA 4IL6C 2YPRA 3K4JA 3KPHA 4EM1A 3IL2A 3KEQA 1I3AA 3OYGA 4YELA 2L9VA 2YX4A 4UV9A 1XCBA 3F8CA 5KHDA 3KEYA 2VT3A 4A3FJ 3IAM2 1W4MA 2VPLA 3JW4A 1BM9A 5F0CA 2EZKA 1F36A 3BTIA 4NQWA 1BIBA 3L2WA 1UMQA 1MD0A 2O8XA 2QM3A 3Q0UA 1P4XA 4IQ4A 3N97A 1EH6A 2CQKA 4AU7A 2XAFA 3FISA 4E7HA 5ICCA 2QSHX 5GADJ 4JX4A 3COAC 1VTNC 4OWRB 1JUPA 4ENKA 4RAYA 2QBYA 4LG0B 1TQMA 4G6QA 2VBXA 2M45A 2VKDA 3DEEA 2M5WA 1ZR2A 1R5HA 4I7HA 1Z6RA 1VQ7I 3FDYA 4KIBA 5E20A 4B3AA 4RB1A 1FYLA 3ZRGA 1P6RA 1A6QA 2R3SA 5EYRA 3S93A 1Y0NA 1KQ8A 3DF8A 5F04A 4G8XA 4M9ZA 5H2FC 1K78B 2XHKA 3K6GA 2VC0A 4YG2F 4IHXA 4KT5C 3PO3J 3CMEI 1GUUA 4PFPA 2XF5A 1A5JA 1H8AC 2RNGA 3J80Z 1OCTC 1EH8A 1SC7A 2Y69H 2JA2A 3WTYC 4L5JA 3K7AJ 9ANTA 1Z9CA 3HGYA 2CQNA 3B6AA 2O3FA 1TTYA 3PO2J 2H1LA 4HNUA 1TNTA 3BPVA 2WWYA 4PJNA 3P7NA 4F3QA 2OD5A 2GIVA 3K10A 2XIGA 3QPSA 1APLC 1TT0A 1V5GA 1MJBA 1AWCA 3E97A 3HXLA 2QVOA 3SFZA 2IJLA 3GCMA 1O57A 1HQCA 5B1AH 4KISA 2E5NA 2PMHA 2W25A 2DTZA 2JPCA 1NTCA 2TRTA 2H8WA 3F3XA 2IS2A 4Y52J 3TO9A 1QO0D 1YRNA 1ZLKA 3JRDA 2F5DA 4RM2A 4XLNF 5AIPA 4C3JJ 3CUQB 5GTIC 1MDMB 4LK1F 5BQTA 2XKPA 4EMSA 3BTLA 4BEHB 3PSFA 4EJVA 5JR3A 4HSTA 3JSOA 3ZCOA 4RB3C 2HGCA 2Y0SN 1HCRA 1DDNA 5AIQA 4NDLA 1ZELA 4BBSJ 3CCYA 3CMYA 2Z16A 4IRHA 5M3FJ 1WSUA 4NHJA 1VFCA 4UVAA 5D5UB 2F4IA 5LGTA 2KT0A 4NUBA 4XRSA 2MUNA 4BE0A 3K4CA 2HKOA 4C30A 1X3UA 3WTVC 5FLVA 2KL4A 2AO9A 2CU7A 4ZTJA 3B02A 2F5EA 2E1MB 2DI3A 3PNTA 1R71A 3JRBA 1R58A 5JVTA 2LMDA 4BU2A 1CF7B 2P6TA 5EF6A 1LB2A 2RREA 3DTIA 4CCNA 2Z99A 2VJ5A 3F6VA 4F93B 1QZEA 4HV5A 5GP9A 1D3YA 1K4SA 1MKMA 3W6KB 5LLQA 2X1DA 1V55H 2R5ZA 1ZLJA 3C2GA 3K4NA 4A69C 4XM3A 1HA8A 3J81Z 2ZBKA 1IRGA 5C3EJ 4G94A 1IRXA 1ETOA 1D0ZA 5CLSA 3TOBA 4HA8A 2DMQA 3ELKA 3IRQA 2D1VA 1LVKA 5EJCA 1J9IA 2HVQA 2O61A 2IA1A 2OUMA 4NC6A 3RCOA 4J01A 3ABTA 3A03A 4WXDA 4DBRA 2NVTJ 2YSRA 2PX9A 3BJ6A 2OZ6A 1FYKA 1HDPA 3A2KA 3AL0C 2EINH 4D7MA 3DBHB 3FHNA 3H5RA 5FLXK 2XGCA 3BOQA 4DOZA 1IDZA 3D5RC 5HODA 1YW9A 2Y48A 2V9VA 2PFBA 3HSFA 3OYNA 3L2RA 4HLYA 5F6FA 3JRIA 4F92B 1IUFA 1HLVA 1XSVA 1R22A 2F4MB 1J5YA 3FKIJ 3TP0A 3OYDA 2DA4A 4OAYA 1TW3A 4DBQA 4IHSA 1RETA 1ITYA 2JA8J 1BN5A 2IVMA 2OZUA 3O8HA 2XVCA 4XL9A 4U0YA 3BR5A 2X6OA 2Q0OA 1JJ6C 2KDZA 3E7LA 5EEGA 4J00A 2HTJA 2HYGD 3MAJA 2L2OA 4BY1J 3PSIA 4M6VA 2CQ7A 3ZMTA 3QWLA 2BY2A 1PJRA 2BGCA 2KIMA 4DW6A 5EG0A 3KP5A 3PNYA 3TBIA 3FK7A 3K4BA 1Z91A 1H0MA 3R61A 4UVBA 5EGOA 1Z6TA 1T38A 2JVHA 1F5TA 3I0TA 1HKSA 1XMAA 4G9YA 1BA5A 1Z21A 5K7ZA 5F27A 2QZ8A 1LVAA 4ENJA 3S3OA 2LY1A 3HTUA 3RKYA 1FY7A 3LOCA 5FB2A 2XKOA 3ZQ7A 4CZCA 1I50J 3G2BA 5GTHC 3TOAA 3WE2A 2QENA 1FOXA 1Y56A 4NQWB 2E36A 3LA2A 4KFCA 4HX7A 2LR8A 3SJMA 1W0UA 2OCCH 5FKMA 2P8TA 4L0YB 4BXFA 1ETYA 3PQJA 4TV7A 1OISA 4B47A 2FBKA 5K1YA 4J19A 5E1XA 3ECOA 1S72I 1MJ9A 1G3YA 1OCRH 5F0FA 2AXTC 1DUXC 3AL0B 4LG0A 5CQGA 4D1QA 4KMFA 3CCMI 1DPRA 5ICFA 4Y15A 3AG4H 4AIDA 4I2OA 4FQGA 3KZIC 1RI7A 3C18A 3LSJA 3HPGA 2CS3A 3AG2H 3KP2A 3JRHA 1YQAA 1JXSA 2V9PA 3OL4A 2BVLA 4PJLA 1IC8A 3JTGA 4B44A 5C44J 5IYDJ 4CICA 2L7ZA 2QSGX 2Q1ZB 2WY8Q 5F0HA 3WGIA 4OINF 3GO5A 4ITVA 2K9QA 1K78A 1IF1A 2IRFG 3S1RJ 3T8TA 3HOUJ 4I6ZA 1ZQ3P 1LE8B 4L9VA 4JK1X 1RNLA 5JLXA 4EATA 3HOYJ 3CP2A 2VJIA 4IHWA 2DTRA 2JWTA 1WI9A 2X85A 2EBIA 3S14J 5DUIA 3JTHA 2ZC2A 2DXIA 3CLQA 3WTTC 1TC3C 4A3KJ 1BOBA 2IAIA 3BG9A 2DQLA 4NBQA 3EYIA 2LH9A 2QKLB 4DNCA 3R4KA 1J59A 2XV4S 5B66C 3FWEA 4R8HA 4BNCA 3BJOA 1R6RA 4I99C 1YRNB 3HG9A 1FYMA 4AM3A 4R79A 2K86A 3CUQA 1MDMA 1FC3A 1D1BA 1WJCA 1X1BA 3LFUA 1OYWA 3FXQA 2TDXA 2RN7A 2JVGA 3FK6A 2JSPA 3K4KA 2VT2A 3M9AA 3FMSA 4MEXF 2JMWA 5GPAA 1XGOA 3ESWB 1M1EB 1XSXA 3K1NA 1L3LA 3JREA 4L5EA 4M9SA 2GOMA 2P7CB 1XCVA 3CDIA 3ZGKA 3DKWA 4BY7J 2JRTA 4FISA 5LD2C 5J4YA 3IKVA 3WTZA 5DS9A 2OTJI 1VQ9I 3S15J 1A36A 4WF2A 1UZCA 1CF7A 2VI6A 3LSMA 1VQ5I 4HX8A 2ZJRF 1YI2I 1D8JA 3FMRA 4MQ9F 3X2QH 1Y1VJ 1J2XA 5FKKA 3HOVJ 3FHZA 2VQLA 4MFDA 1V4RA 1XX5A 3U1DA 2CGPA 1JKRC 3FXOA 2Y0SA 3MKLA 4H0EA 2QSFX 2NRAC 2L9NA 2VUMJ 1RRJA 2RC4A 3FF5A 5KAFC 2E60A 2UZKA 1A35A 2DO7A 2TCTA 3SQNA 1UJ8A 2A5YB 1YJNI 5HNFA 1FMWA 1KZHA 5TJJA 1LFBA 2HDWA 4WXCA 4G12A 2HVRA 5AONA 4A12A 1AHDP 4L9TA 1Y8RB 3KZYA 1QPMA 4QPOA 3GTOJ 3ABLH 3P9KA 3ZPLA 2ELHA 4M72A 1V5FA 4M3FA 2ICWG 1LPQA 4YRVA 3Q0WA 4N9HA 3GYHX 4IF4A 1BR2A 4QPQA 3HUGB 3MEXA 3Q9SA 4M3BA 5CPRB 2FJ1A 1KQ0A 2RKHA 4QIWN 3S1MJ 4OIPF 3IWZA 1IGNA 5L3CA 2WY7Q 4MO7A 2HR3A 2ZNYA 3ROUA 3MKZA 4E6KG 3KZZA 2I10A 1IW7F 1Y6IA 2VQGA 3KP6A 1QVTA 1KYWA 3H1CA 2BE5F 1U3EM 4WK8F 2RNJA 5J8CA 4ZYDA 3GTGJ 4LB5A 4JOMA 1ZTRA 1WHUA 4E7LA 3GUDA 1OYIA 3HRSA 1ACIA 3IRRA 3V4GA 5ICEA 3OOPA 3F9KA 3TMOA 1F43A 3LSKA 2G7HA 5CJ9A 4XNFA 2HQ5A 3L1PA 3M3YJ 5L3BA 2STWA 2UXNA 4L9NA 2R7QA 4Y33A 1MNDA 2HYFA 3DTKA 4BBRJ 4LGWA 1G3SA 2LDUA 3JRAA 1EKEA 2DA7A 4X0GA 4XOPA 1UG0A 5D6EA 5EGOB 4ZH4F 2DFEA 1PUEE 5FRNA 4XRSG 2ECBA 4UUTA 1I27A 4XSZF 2MLGA 2V26A 4BXUA 2GA2A 2VXDA 2P0TA 5DUKA 3QP6A 4PJMA 3BCAA 4HRIA 1WJ5A 3GZNB 2A61A 4CUGA 4IX7A 3E5XA 1E2XA 3C7JA 5IOZA 3JR9A 2XASA 1MGTA 2HNHA 4O6JA 1SFUA 2J5OA 1I39A 2XSJC 1YITI 1RUNA 3ZMVA 1UCRA 3HGGA 4B3XA 1Q1VA 1TLHB 2RQPA 1QRYA 1LFUP 3BR0A 3PFIA 1SD7A 3L2VA 4PGGA 2EFQA 3GX4X 1DGRM 3A01B 3OYEA 4KITB 2O7OA 4O5VA 1VQLI 4UVCA 2H1KA 3K1PA 3F8FA 5JFRA 3SEQA 2WV1A 1R7JA 5CVUA 2L02A 2BZTA 1DPUA 4GYIA 5FROA 3K4LA 2A6TA 4G7OF 1R23A 1U9OA 2GM4A 4OIQF 1RESA 2OQGA 3LL7A 1O7LA 3OWTA 2K9LA 5B5EC 3NRVA 2EZHA 5BNGA 4XRMA 3L00A 2AHQA 4HQEA 2ESNA 2IEKA 3GTJJ 2EIKH 5IPAA 5L3GA 2H27A 1MW7A 1UELB 3BC8A 3LQRA 2KJBA 2K9SA 3AG1H 1LE8A 3DPTA 2DYRH 3H36A 2FA5A 4M3EA 2X6YA 1YS6A 2CUZA 2M0CA 4UXNA 1N77A 3VWBA 2F5FA 3HYIA 3JAMR 4AC0A 3CDLA 4KYWA 4U0VA 1P92A 2K4BA 3Q3SA 3IV5A 2MH2A 2E71A 2NNNA 4KMUX 2Y9ZA 2NVXJ 3J81R 3C2HA 3KYLA 1FOYA 2ZFWA 3KE2A 4DYQA 5KAIC 2WC2A 1IN6A 1EV7A 4AIJA 4RLQA 2CWEA 2KMUA 4U7DA 3WODF 3OYAA 2W1OA 5E3OA 1VQNI 3OYMA 1WCMJ 3BY6A 4IHVA 2VOOA 4IO9F 5DV5A 4RA2A 4E7KA 1HDDC 2XPVA 2V79A 3HIFA 4LIUA 2O03A 2QYOA 1IAWA 3ULQB 4F91B 2FBIA 1IRFA 1JKQC 1VQKI 1TWAJ 3I5UA 2ELJA 3D5LA 3S1NJ 2E1CA 5FRMA 3HSEA 4YIIA 1XC5A 4I09A 4HYEA 5LHGA 2FF4A 2XGDA 2D5VA 5C4JJ 5BMZA 1OYYA 4KUMA 2LBFA 5DM7F 2CW8A 2VODA 3OV8A 3MVPA 2Q8KA 2YUSA 4FTHA 2DCEA 1I6XA 1U5TA 3QAHA 4N4OB 4XN0A 5E3NA 4B8XA 1IG7A 1MBHA 3EUAA 4S05A 2STTA 4A0XA 1LNWA 3OYFA 3LSGA 1F1ZA 1VF9A 4XONA 4C3IJ 4MQVA 2ZMEA 5B1BH 1JI8A 1SAUA 3OMYA 4P9FA 1DU6A 3WU1B 4RB0A 3D0SA 2RV8A 3RPUA 1YOVB 5E17F 4XR6A 1VI0A 2E2IJ 3GTPJ 2EWNA 4X1EA 4XLFA 1ZR4A 2W82A 2A68F 2ZXIA 4GRIA 1RKWA 1W5SA 2ETHA 1OFCX 2D1HA 3A1YA 4CCLA 2VE8A 1QA6A 3HOXJ 5KNLA 1JUMA 1X4PA 2QF7A 2DMNA 2OJED 3E1SA 5FKOA 4JX6A 3M07A 4NB5A 1BJZA 3D1NI 2MH9A 4AYBA 4XIDA 1G8XA 1PDNC 2NNYA 1Z67A 3DQVC 1WVRA 3CCUI 3ZMDA 3AKZA 3OIQA 4ESJA 5IT9Z 3HUGA 1MBJA 5JI6A 3BTJA 5E3MA 3VODA 1POGA 2ID6A 3RSNA 4L18B 2WAQN 2CUJA 4UB8C 3SEZA 2PG4A 4UY8I 4BJTA 2FMYA 4IRIA 3K0LA 2FSWA 2WADA 1ON1A 2IBDA 1AA7A 1G2HA 4DIQA 3DXJF 3GZ6A 3DEUA 4D5CA 2XAUA 1O7FA 3ZMSA 5FFXA 2ZSHB 3K9TA 2Y30A 4HZFA 1FWZA 1IN8A 3S16J 1FJLA 2YR2A 1JE8A 1WJBA 3LSHA 2CMPA 2HOAA 3M1CA 1OCCH 4XLEA 2ZJ2A 1BJAA 4YEJA 2CV0A 2FU4A 3S1QJ 1QQIA 4HBLA 2BY0A 3TL4X 2XAQA 3CCLI 2VE9A 1ZRCA 5JVGF 3I53A 1UHSA 3VYRB 2BHYA 2KIUA 1J75A 2HOTA 1B8IA 4UV8A 2HQNA 1PUFA 4H4KC 4A6DA 3FX3A 2RVCA 1S9HA 3RTRA 1E17A 3OS1A 1K6YA 3RPUD 1HOMA 2DT5A 1UHMA 1LQ1A 2W00A 4P9UA 2XAJA 4HLXA 2DFIA 2HS5A 4PCQA 1BC8C 1G6NA 1V3FA 2LYCA 5M5WJ 4IEJA 4EJWA 1Y39A 3ML6A 4DJAA 3O6BB 4II3A 2HQRA 4AWXB 3FMQA 5D6FA 3VSKA 2KP6A 5CKTA 3CJNA 1Y8QB 4G7HF 4CGZA 3E5QA 4A3LJ 3IH3A 4PSXA 3LSRA 3ECHA 3LAPA 3A01A 1R4MB 3I71A 1IXCA 1MH3A 2DJIA 5GPCA 3FBNB 2KKOA 4CCJA 1AU7A 3HEFA 1T95A 2LRDA 1VQ6I 3G1LA 2WA0A 2F5CA 4RAGA 1YFHA 2PMUA 3BG7A 2ZB9A 4P5OA 2GWRA 3LQQA 2MC4A 2X48A 5H6RA 3JAMZ 4UNOA 1S7EA 2LG4A 2EV0A 2O6GE 2ZJQF 4IZZA 1OKRA 3VDXA 2JA7J 1HKQA 4BDYA 1FTTA 2X6WA 1XN7A 4BQAA 2I8DA 2EZIA 1Y0UA 1WJAA 2W57A 3CCQI 1JGGA 2M87A 4DZPA 2PQ8A 5ED4A 3OYHA 4BDZA 2HDCA 3V42A 2HXIA 2V4JC 1K6OA 4Y7NJ 4MEYF 3CESA 3TQNA 1R49A 2WAEA 1MBEA 3WTWC 4Q48A 2GBYA 3S2HJ 1FP2A 2KRCA 1ETVA 2F6CA 2EFPA 3CMMA 5DCMB 3CMAI 3LMMA 3NAUA 4ZZLA 1C0WA 2A6HF 3U2RA 1YHQI 2KZVA 3J80K 3K70D 2A07F 2OC6A 3PFYA 4JQFA 4MFEA 2VLAA 4IRGA 4A5MA 1OCOH 2CV1A 4FCYA 2Y9YA 5D8LB 2FUG2 1I1GA 1P2FA 2M8GX 4II2A 3GLLA 4KN4X 1WJEA 4RGUA 1ZGJA 2LF8A 2L9RA 3HSRA 3HB9A 1Z77A 3N4MA 5D5WB 3CJTB 5HNHA 5EZHA 2E34A 1YW7A 4ABZA 2EV6A 1GHCA 1D0XA 1JTYA 2QQ9A 3U21A 2GAUA 1B4AA 4HV6A 2QA4I 5DDGA 2ZSIB 2BY1A 5GAEJ 5J6XA 2CV2A 2LP0A 2V1XA 3IC7A 1YJ9I 3PUFA 2JA5J 5IYBJ 5FLMJ 2VOPA 1FP1D 3NWSA 5DTDA 5HS8A 5K7HA 3AAFA 3LNQA 1YX3A 1MSEC 2EFWA 2OAZA 2HPMA 2CUEA 2KRFA 1USTA 2K27A 3TW6A 1T0FC 2LBFB 4EGZA 2W84A 1E3PA 5HDKA 5L3EA 3CCEI 3WU0A 4MIMA 1OJLA 4BXXJ 1U5TB 1YG2A 4FETA 1DGWY 2H94A 3MWMA 1ETXA 5CVJA 5DD8A 2ZMEB 2L9SA 2LKXA 1BI1A 3LAJA 4YIFA 4E4HA 3MZHA 3OL3A 3WHBA 3HPHA 2GXBA 3NEUA 1ETWA 3A0BC 1MBGA 3EUKL 2Y2ZA 1QNTA 2V7FA 2MSYA 4AVZA 2IGNA 5KK1A 4XORA 4BJ5C 2DPDA 3L7WA 1WRJA 2D45A 3FIWA 2IGMA 1JT6A 4UUSA 3EUHC 2ZMEC 3QOEA 5EZGA 2KIQA 2WTEA 3F6OA 2ZFUA 3FXRA 3ZQFA 1SFXA 5CVVA 1ENHA 4RGSA 2IS1A 4ENNA 2V6EA 3QP5A 2DW4A 3P5JA 3BLYA 1MNMC 4CXFA 2DLLA 4FT8A 3JRFA 3H9GA 3ZQCA 4C2UA 2E2HJ 2CFOA 2MGQA 4RAFA 1VZ0A 4IHYA 4BHBA 4NC8A 2XAGA 1TQPA 1VQ4I 1R36A 1SD6A 2O9LA 4M6YA 5DM6F 3DKYA 3ZQHA 4DGWB 2QQBA 1TZLA 3W2WA 4W1UA 2BHZA 1LKXA 2K4JA 2XB5A 3DP7A 1DQUA 3BZ6A 4FE7A 2DFHA 5K5OA 1HF0A 1G59A 5F64A 4V19K 2FX0A 2X0LA 2H6CA 2M1BA 5ILVA 2VJJA 4C2TA 1U6GA 4FX0A 4KIFA 3BZCA 2NVUB 2HU9A 3SDBA 3OYJA 2O5RA 2R4GA 5DYMA 2KZGA 1D1CA 2FMLA 2ZJPF 3HJEA 1DP3A 2O0YA 1JTXA 5HS9A 2OTLI 2FOKA 1ZN2A 2NS0A 1B8IB 3LSIA 3GFMA 1F9NA 1MIJA 2DOFA 3KETA 1PUFB 1U9NA 3UKGA 5C4XJ 3G73A 4OIOF 1NG6A 4QTRA 1FMVA 2A6EF 2R93J 3LSTA 2BEOA 3WGGA 5J8FA 1MH4A 1O3RA 1FT9A 3RKXA 1ULYA 3VYSB 3GMEA 3RKQA 5HOOA 1HW2A 1OLTA 4LITA 5H20A 3LWFA 2R7SA 1YE9A 4FHTA 4BL0B 2P5KA 1E3OC 2AS5F 4Y4RA 3WG7H 1TWHJ 4EJTA 3KIOA 1R5GA 1ZHFA 3SZGA 1USSA 3OYIA 2MG4A 3A0HC 1N75A 3U9GA 2CUFA 3FXLA 3A4CA 3ABMH 3A52A 2DA2A 3C1DA 3P9IA 3RYRA 1R1TA 3HC7A 1FIAA 5IT9K 2KDOA 4LJZF 3F23A 2E19A 1TP4A 5IT3A 1WQ2A 4RLFA 5ILSA 5IP9J 3OY9A 2BOLA 4N4NB 3HHGA 5J4VA 4IQJA 3KP3A 1X58A 5BOXA 1IO2A 4ANJA 2XGEA 2KFDA 3H3UA 5E1WA 2VL8A 4A3MJ 3VEPA 3C3WA 3SYTA 3REOA 2PI0A 2W48A 3K2AA 1B6AA 1KGSA 2Z3YA 3K70C 4ZJZA 2VQCA 4OIRF 5J3LA 3J80R 3HKZN 2DOEA 3F0CA 2QUFA 3T5XA 1OMIA 2QGUA 2JRMA 2XGXA 5DEQA 3R0AA 2CG4A 2JA6J 4A3GJ 5IOYA 3J7AW 3OR2C 3S3NA 4IHTA 2RGVA 3PUBA 2E5ZA 5DCMA 1T6SA 4LB6B 3L2QA 1HBXG 5IYCJ 2Y75A 2F48A 1ETKA 2NS7A 3IHUA 3KP7A 5FFZA 3H0DA 4HF2A 1FBUA 5CVRA 4BGDA 2PBIA 3L2CA 5FO5A 2CO5A 3BG3A 2CJJA 3DTEA 1LEAA 5J1RA 2IT0A 3GVAA 3DKXA 4WX9A 4BUPA 5HLGA 1TNSA 5ERIA 2QKMB 3B6CA 4BE2A 5LEJA 2AXLA 3M1EA 2W4SA 3M7GA 4GDFA 2DN0A 3I59A 2NVYJ 1KU9A 3HOZJ 2BXYA 2FE3A 3EETA 1Z3XA 2BV6A 2OF7A 4JP0A 1MNEA 3GBGA 1N25A 1S5LC 2MD0A 4YFXF 4A3EJ 1RC9A 3HDDA 1ZH5A 3FXKA 1W7PB 2HOEA 1BBYA 4HG2A 1SMYF 1G3WA 1S7OA 2HI3A 2HTSA 4EVIA 2M0MA 1TW2A 4EJOA 4EGYA 3FKJA 4O3MA 2DDAA 3OIOA 2UUZA 4YIRX 3ISPA 2IA2A 2R7TA 4UB6C 1R5ID 4DQ2A 1O3TA 2ECCA 1YO5C 1MSFC 3CO6C 5HDGA 3KCCA 4IOAF 3CCSI 5LHIA 1WKMA 3NWTA 3JAMK 1HC8A 1V5EA 4FX4A 2VBWA 5L3DA 2XB0X 4Z6YA 3F72A 2HEOA 1G3TA 1Q1HA 2DA6A 4CYCA 3SZTA 4E70A 1JGSA 4HOBA 3ZOBA 1ZRFA 5HDNA 3EYYA 2FEZA 2NAZA 1BIAA 2VASA 1OCZH 2AQFA 2F4OB 3IH2A 5GAGJ 4HNVA 5J47A 2R7DA 4GGGA 3RI4A 2GA1A 3GFLA 2I5UA 3HRMA 4UUSB 2B7EA 2JUCA 5LGUA 1XSDA 2IGKA 1J0RA 3PL8A 2NXNB 3JCUC 1WWXA 3DWLE 3NQOA 2EA4A 1OR7A 2CQQA 4KJZA 4RS8A 2VJ4A 4G7ZF 1RIOH 1STZA 2DU9A 2ESHA 3O2PE 4BJ6C 2HZDA 4EV0A 2OU2A 2CQXA 2R92J 1H9GA 5FJ8J 1JKPC 4N9IA 1ZG3A 4S0HB 3ZQLA 1T0FA 3OSGA 5LBQA
chains in the Genus database with same CATH topology
4AD9A 4XSXF 4RB2C 3H92A 1IXRC 2VN2A 5D4SA 4CYDA 4U88A 4KICA 1YYVA 1S3JA 1U8RA 4RGRA 2Z33A 2J5PA 3WE3A 4A5NA 1KU2A 4M9XA 5D8KB 4Q5SF 5A2QZ 3RPQA 3E6DA 1D8KA 3QPTA 4LFUA 4PGHA 3MFKA 2ADUA 4WXHA 2UXXA 2EK5A 3LA7A 1TQIA 4P96A 5E18F 1O3SA 2MLKA 4ZYHA 2COMA 3DV8A 3F8MA 3J81K 1W7PD 4OMYA 1BC7C 3RKWA 2DPUA 4BH9A 1BI2A 3LFKA 3FM5A 1IZ1A 4F7ZA 5FLXZ 4EM0B 2KIFA 3ABUA 1R00A 4CO8A 5LGNA 5TRDA 2CW0F 4Q47A 3FZVA 3QOPA 4ZYEA 2FXAA 4BHCA 3BJAA 3SZPA 1KU7A 1W5TA 3BROA 1I5ZA 4CZZA 2QWWA 3MCZA 4ETSA 1UFMA 3GLXA 1S29A 3F8NA 1IUYA 1YTYA 4IVNA 1B9MA 2JSCA 3T0YA 1ZGAA 4HW0A 3RIRA 4OMZA 4Y17A 4XBFA 3E5UA 2P6SA 2MBFA 2PN6A 3CTAA 2EV5A 3Q5FA 4ASNA 2UWMA 3IWFA 1UHWA 1KQ9A 5K5QA 3WTUC 4GYGA 5JHUA 5BPDA 3I59B 2WV0A 1FNNA 1RUOA 3VB2A 1IN4A 2Z5UA 2H09A 3E6CC 1SD5A 2ZCWA 1W7PA 3E6BA 2ISZA 4BYYA 3PQKA 2EFNA 4HDVA 3B73A 3ZP5A 5BS6A 2H6BA 4HAMA 5E1ZB 5F1RA 3HOSA 3GFJA 1AOYA 4I01A 1IXSB 3F8BA 3I4PA 3V7CA 2OA4A 2HKXA 3F21A 2P5LC 2DK5A 3FXUA 2B0LA 1Z7UA 2A3SA 2E7XA 3M8FA 4I02A 1IN5A 4UHTA 4OOIA 2K7LA 4ESBA 1P4WA 1FZPB 1QGPA 3VOEA 1KA8A 2V6CA 4HF0A 3CUOA 1LDKB 4LK0F 4OU0A 3QU6A 1BOAA 2EA2A 2LF7A 3CO7C 3LA3A 1XGMA 4CHUA 4B09A 2IA0A 2D2WA 3WTSC 2XUBA 3BDDA 4A0ZA 3BWGA 4LLNA 2FNAA 2EJRA 1S8NA 1FBSA 4BAYA 2F2EA 1SD4A 3ZMUA 2Y0MA 3M8EA 2ISYA 2IW5A 3BPXA 4GCVA 3TDUC 2VBYA 1IN7A 2ZO4A 1U5TC 4MGRA 3GZ5A 3G3ZA 4A2UA 4ON0A 3ZN1A 3E3VA 3TKYA 1B59A 2NYXA 2JT1A 2HWVA 4IJAA 4ESFA 1QBJA 4KA4A 2FQ3A 4U0WA 2ZNZA 1YS7A 5FD5A 2E7WA 3T1BA 1XDSA 1YW8A 4LLGF 1ZG5A 3R60A 4AVPA 5HLHA 1MZBA 4K2EA 3RJPA 1ZRDA 1ODDA 1ZARA 1FSEA 3V8JA 4XRFA 3I64A 2BBYA 3L09A 1P4AA 2LSOA 1U78A 2OQRA 2L54A 5HLIA 3QU3A 2V1DA 3WGHA 3K69A 1L0OC 1HXDA 3DFGA 1FOKA 4CDGA 4ENMA 5FGMA 3R0JA 3GFIA 1T98A 3KLNA 2R7FA 4AIKA 5HS7A 1JHHA 1HKTA 5D5VB 2W85A 2CYYA 3R6SA 5BPIA 4HDUA 2FRHA 4UUVA 1FPQA 3CDHA 4LD5A 3ZN0A 2ACJA 5K5RA 4M71A 2JTVA 1XGNA 4M6XA 1GXQA 1LEBA 2XRNA 4HF1A 1FBQA 1PP8F 5DCFA 2GXGA 3V7SA 1RZ4A 2VBZA 1QZZA 5D4RA 1K7AA 4YFNF 1GVJA 3IKTA 2FBHA 5EEHA 4MNUA 1S7AA 4U7BA 4GXOA 4QLCU 3QPHA 2ZKZA 1HW1A 2XROA 1XGSA 1PP7U 4IXAA 2PJPA 2HFHA 2G9WA 4EM2A 1FLIA 4RAZA 4D0PA 1H9TA 5LRRA 2CFXA 1A04A 3HTSB 1G4DA 2E1NA 1DP7P 3HHHA 5H6QA 2QQAA 5LRSA 3V8KA 1HSJA 4KN7X 1YIOA 3SHFA 1B9NA 5KVRA 4A0YA 3TO7A 3GEZA 1CGPA 3V8LA 3W6JB 1REPC 2MD5A 5HVQC 3KEOA 2GQQA 4Q4ZF 1SFEA 1JHFA 3WG9A 1XDUA 2P4WA 1MJAA 4EQQA 2VC1A 5ILUA 3HRUA 1EH7A 5CVIA 2LKPA 4S04A 2FNPA 3BP8A 4BHPA 3J7AO 1HW5A 2KJCA 1ON2A 3MQ0A 3K1MA 1S6LA 1TBXA 2W24A 4KDPA 1XD7A 3GF2A 3JSPA 3TDZC 3QRFF 1LDJA 2M8EA 2Z9OA 1Z05A 2L01A 2C6YA 3S2WA 4R1HA 4LMYA 4JBAA 1FX7A 5D5XB 4L5IA 4HQMA 4MTEA 4HX4A 3F22A 3SXYA 3EQLF 2DQRA 6PAXA 2QBYB 4L0ZB 4LLLA 1I1SA 5ICGA 2DBBA 1ZREA 3GW2A 2JPBA 1D5VA 3CLOA 4L9JA 1HSTA 4RGXA 3T8RA 1GXPA 4M74A 4GO1A 3CUQC 1Z1DA 3VFZA 2MA3A 4QWQA 3FM3A 4MTDA 3V7RA 3EDPA 1SMTA 1R1UA 4IPAA 1LDDA 3H3ZA 5LHHA 3L9FA 3MZYA 1K79A 3KP4A 1ZAOA 5FD6A 4I98B 2DAOA 2JZYA 1BI3A 3RDIA 1NHAA 4Z2YA 1O3QA 4A6EA 2EB7A 1ONVA 2Q2EA 3O3KA 4G6DA 2YX7A 2BYVE 3GWZA 4WCGA 3Q9VA 1QZYA 1U2WA 2A69F 4ZZDA 3HOTA 3WTXC 3TO6A 2DK8A 1FSHA 1XB4A 4M73A 3KFWX 4PDKA 4ZYGA 2YU3A 1LJ9A 1KYZA 3I58A 4WWCA 4YFKF 2LNBA 1F4KA 2X4HA 4N0BA 1ZYRF 2P5VA 2L4MA 2IP2A 4MHGA 2PEXA 4KIGA 4EJUA 2G7UA 2HZTA 4PZJA 3GXOA 1OPCA 4KNYA 2V1UA 3HRTA 3ERED 2RDPA 3P9CA 3E6MA 2L4AA 2EFOA 2P7VB 4I0AA 1SAXA 5L3FA 3K2ZA 2IPQX 2K02A 2QLZA 3ZMZA 2MC3A 5DD4A 2CSOA 3KLOA 2ZXJA 3EUHA 4P55A 1J7KA 1ZG1A 1BI0A 1B1BA 3TGNA 1T39A 2VXZA 1YLFA 5LEKA 4Y13A 2GZWA 1UB9A 5E8IA 1KU3A 3DPLC 1XMKA 5CYVA 5E8GA 2M30A 2XAHA 5A2QK 1R1VA 1T2KA 2PLYA 2VONA 4AIHA 2OBPA 3RYPA 2L3DA 4XLPF 3I54A 4I0BA 2YPRA 4EM1A 3IL2A 3KEQA 2YX4A 4UV9A 1XCBA 3F8CA 2VT3A 1W4MA 3JW4A 1BM9A 4NQWA 1BIBA 1MD0A 2O8XA 2QM3A 1P4XA 3N97A 1EH6A 2CQKA 2XAFA 5ICCA 3COAC 1VTNC 4ENKA 4RAYA 2QBYA 4LG0B 1TQMA 4G6QA 2VBXA 2M45A 2M5WA 1R5HA 4I7HA 1Z6RA 4KIBA 5E20A 4RB1A 1FYLA 1P6RA 2R3SA 1KQ8A 3DF8A 4G8XA 4M9ZA 1K78B 2XHKA 2VC0A 4YG2F 4KT5C 3J80Z 1EH8A 3WTYC 4L5JA 1Z9CA 2O3FA 1TTYA 2WWYA 1TNTA 3BPVA 3P7NA 2OD5A 2GIVA 2XIGA 1MJBA 1AWCA 3E97A 2QVOA 3SFZA 2IJLA 1O57A 1HQCA 2PMHA 2W25A 2JPCA 3F3XA 3TO9A 1QO0D 1ZLKA 2F5DA 4XLNF 5AIPA 3CUQB 1MDMB 4LK1F 5BQTA 2XKPA 4EMSA 5JR3A 4EJVA 3JSOA 4RB3C 2HGCA 1DDNA 5AIQA 4IRHA 1WSUA 4NHJA 4UVAA 5D5UB 5LGTA 2HKOA 3WTVC 1X3UA 3B02A 2F5EA 2DI3A 1R58A 5JVTA 1CF7B 2P6TA 1LB2A 2Z99A 3F6VA 4HV5A 1D3YA 1MKMA 3W6KB 5LLQA 1ZLJA 3J81Z 2ZBKA 1IRGA 4G94A 5CLSA 3TOBA 4HA8A 3ELKA 3IRQA 2D1VA 1J9IA 2O61A 2IA1A 3ABTA 4WXDA 2YSRA 3BJ6A 2OZ6A 1FYKA 5FLXK 3BOQA 1YW9A 2Y48A 2V9VA 2PFBA 3HSFA 4HLYA 5F6FA 1XSVA 1R22A 1J5YA 1TW3A 4IHSA 1BN5A 2IVMA 2OZUA 2XVCA 4U0YA 2Q0OA 5EEGA 2HTJA 2HYGD 3MAJA 3ZMTA 2BGCA 2KIMA 3KP5A 1Z91A 1H0MA 3R61A 4UVBA 1T38A 1Z6TA 1F5TA 3I0TA 1HKSA 1XMAA 4G9YA 2QZ8A 1LVAA 4ENJA 3HTUA 3RKYA 1FY7A 5FB2A 2XKOA 3ZQ7A 3TOAA 3WE2A 2QENA 3LA2A 4KFCA 4HX7A 2P8TA 4L0YB 4TV7A 3PQJA 2FBKA 5K1YA 5E1XA 3ECOA 1MJ9A 1G3YA 1DUXC 4LG0A 4KMFA 1DPRA 5ICFA 4Y15A 4I2OA 1RI7A 3C18A 3KP2A 1YQAA 1JXSA 3JTGA 4CICA 3WGIA 4OINF 3GO5A 1K78A 1IF1A 2IRFG 3T8TA 4L9VA 4JK1X 1RNLA 2DTRA 1WI9A 5DUIA 3JTHA 3WTTC 2DQLA 3EYIA 4DNCA 3R4KA 1J59A 2XV4S 3FWEA 4R8HA 4BNCA 3BJOA 1FYMA 4R79A 2K86A 3CUQA 1MDMA 1FC3A 1OYWA 3FXQA 2TDXA 2RN7A 3M9AA 2VT2A 4MEXF 3FMSA 1XGOA 1XSXA 3K1NA 1L3LA 4M9SA 2P7CB 1XCVA 3DKWA 2JRTA 3IKVA 3WTZA 4WF2A 1CF7A 4HX8A 1D8JA 3FMRA 4MQ9F 1J2XA 3FHZA 1V4RA 3U1DA 2CGPA 4H0EA 2NRAC 2RC4A 3FF5A 2UZKA 2DO7A 3SQNA 2A5YB 5TJJA 4WXCA 5AONA 4A12A 4L9TA 3KZYA 1QPMA 3P9KA 3ZPLA 2ELHA 4M72A 4N9HA 3GYHX 4IF4A 3MEXA 3Q9SA 1KQ0A 2RKHA 4OIPF 3IWZA 5L3CA 2HR3A 2ZNYA 3ROUA 3KZZA 1IW7F 3KP6A 1KYWA 2BE5F 1U3EM 4WK8F 2RNJA 5J8CA 4ZYDA 4LB5A 3GUDA 1OYIA 3HRSA 3IRRA 3V4GA 5ICEA 3OOPA 2G7HA 5CJ9A 2STWA 5L3BA 2UXNA 4L9NA 2HYFA 4LGWA 1G3SA 2LDUA 5D6EA 4ZH4F 1PUEE 1I27A 4XSZF 2MLGA 4BXUA 2GA2A 5DUKA 3QP6A 2A61A 3E5XA 1E2XA 3C7JA 2XASA 1MGTA 1SFUA 4O6JA 2J5OA 1RUNA 3ZMVA 1UCRA 1TLHB 2RQPA 3PFIA 1SD7A 4PGGA 2EFQA 3GX4X 4O5VA 4UVCA 3K1PA 3F8FA 5JFRA 1R7JA 5CVUA 2L02A 1DPUA 4GYIA 4G7OF 1R23A 4OIQF 2OQGA 1O7LA 3NRVA 3L00A 4HQEA 2ESNA 5L3GA 2H27A 3LQRA 2KJBA 3DPTA 2FA5A 1YS6A 4UXNA 2F5FA 3HYIA 4KYWA 4U0VA 1P92A 2K4BA 2MH2A 2NNNA 4KMUX 2ZFWA 3KE2A 2WC2A 1IN6A 1EV7A 4AIJA 2CWEA 4U7DA 3WODF 3BY6A 2VOOA 5DV5A 2V79A 3HIFA 2O03A 2QYOA 1IAWA 3ULQB 2FBIA 1IRFA 3I5UA 3D5LA 2E1CA 3HSEA 4YIIA 4I09A 5LHGA 4HYEA 2FF4A 5BMZA 1OYYA 4KUMA 2VODA 3OV8A 2Q8KA 1I6XA 1U5TA 3QAHA 4B8XA 4S05A 2STTA 4A0XA 1LNWA 1F1ZA 4MQVA 2ZMEA 4P9FA 3WU1B 4RB0A 3D0SA 2RV8A 3RPUA 5E17F 2EWNA 2A68F 1W5SA 2ETHA 2D1HA 2VE8A 4NB5A 2MH9A 1PDNC 2NNYA 3DQVC 3ZMDA 4ESJA 5IT9Z 3HUGA 5JI6A 3VODA 4L18B 2PG4A 2FMYA 4IRIA 3K0LA 2FSWA 1ON1A 3DXJF 3GZ6A 3DEUA 1O7FA 3ZMSA 5FFXA 3K9TA 4HZFA 1FWZA 1IN8A 2YR2A 1JE8A 2ZJ2A 1BJAA 2FU4A 1QQIA 4HBLA 2XAQA 2VE9A 1ZRCA 3I53A 2KIUA 1J75A 4UV8A 2HQNA 4A6DA 3FX3A 2RVCA 3RTRA 1E17A 2DT5A 1UHMA 1LQ1A 4P9UA 2XAJA 4HLXA 2DFIA 2HS5A 4PCQA 1BC8C 1G6NA 1V3FA 4EJWA 3ML6A 3O6BB 2HQRA 4AWXB 3FMQA 5D6FA 3CJNA 4G7HF 4CGZA 3E5QA 3ECHA 3LAPA 3I71A 1IXCA 2KKOA 2F5CA 1YFHA 2PMUA 4P5OA 2GWRA 3LQQA 5H6RA 3JAMZ 4UNOA 2EV0A 2O6GE 1OKRA 1HKQA 4BQAA 1XN7A 1Y0UA 2W57A 2M87A 2PQ8A 5ED4A 2HDCA 1K6OA 4MEYF 3TQNA 3WTWC 4Q48A 1FP2A 2EFPA 5DCMB 1C0WA 4ZZLA 2A6HF 3U2RA 3J80K 2A07F 4JQFA 4IRGA 4A5MA 5D8LB 1I1GA 1P2FA 4KN4X 3N4MA 4RGUA 1ZGJA 2LF8A 3HSRA 5D5WB 1YW7A 2EV6A 1GHCA 2QQ9A 2GAUA 1B4AA 4HV6A 5DDGA 5J6XA 2V1XA 3IC7A 2VOPA 1FP1D 3AAFA 5HS8A 2EFWA 2OAZA 2KRFA 1USTA 2K27A 4EGZA 2W84A 5HDKA 5L3EA 3WU0A 1U5TB 1YG2A 2H94A 3MWMA 5CVJA 5DD8A 2ZMEB 1BI1A 3LAJA 4YIFA 3MZHA 2GXBA 3NEUA 1QNTA 5KK1A 2DPDA 3L7WA 1WRJA 2D45A 2WTEA 3F6OA 3FXRA 1SFXA 5CVVA 4RGSA 4ENNA 3QP5A 2DW4A 4CXFA 2DLLA 4FT8A 4BHBA 2XAGA 1TQPA 1R36A 1SD6A 4M6YA 2QQBA 2K4JA 3DP7A 3BZ6A 5K5OA 5F64A 2X0LA 2H6CA 2M1BA 5ILVA 1U6GA 4FX0A 4KIFA 5DYMA 2FMLA 2O0YA 5HS9A 2FOKA 1ZN2A 2NS0A 3GFMA 1F9NA 3KETA 3G73A 4OIOF 2A6EF 3LSTA 2BEOA 3WGGA 5J8FA 1O3RA 1FT9A 3RKXA 1ULYA 5HOOA 1HW2A 5H20A 3LWFA 4FHTA 2P5KA 2AS5F 4EJTA 1R5GA 1ZHFA 1USSA 3U9GA 3C1DA 3P9IA 3RYRA 1R1TA 5IT9K 4LJZF 3F23A 5IT3A 1WQ2A 5ILSA 3HHGA 3KP3A 5BOXA 3H3UA 5E1WA 3VEPA 3C3WA 3REOA 2PI0A 1B6AA 1KGSA 2Z3YA 4OIRF 2QUFA 3T5XA 1OMIA 5DEQA 2XGXA 3R0AA 2CG4A 4IHTA 2RGVA 5DCMA 1T6SA 4LB6B 1HBXG 2Y75A 3IHUA 5FFZA 3KP7A 4HF2A 1FBUA 5CVRA 2PBIA 3L2CA 5FO5A 2CO5A 1LEAA 2IT0A 3GVAA 4WX9A 5HLGA 1TNSA 5ERIA 5LEJA 2AXLA 3M1EA 3M7GA 3I59A 1KU9A 2FE3A 3EETA 2BV6A 4YFXF 1ZH5A 1W7PB 2HOEA 1BBYA 1SMYF 1G3WA 1S7OA 2HTSA 4EVIA 1TW2A 4EJOA 4EGYA 4O3MA 3ISPA 2IA2A 4DQ2A 1O3TA 1YO5C 3CO6C 5HDGA 3KCCA 5LHIA 1WKMA 3JAMK 4FX4A 2VBWA 5L3DA 3F72A 2HEOA 1G3TA 1Q1HA 3SZTA 4E70A 1JGSA 4HOBA 1ZRFA 5HDNA 3EYYA 2FEZA 2NAZA 1BIAA 2R7DA 4GGGA 3RI4A 2GA1A 3GFLA 3HRMA 5LGUA 1XSDA 1J0RA 1WWXA 3NQOA 2EA4A 1OR7A 4RS8A 4G7ZF 1RIOH 1STZA 2DU9A 2ESHA 3O2PE 4EV0A 2OU2A 1H9GA 4N9IA 1ZG3A 1T0FA 5LBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AD9 A;  4XSX F;  4RB2 C;  3H92 A;  1IXR C;  2VN2 A;  5D4S A;  4CYD A;  4U88 A;  4KIC A;  1YYV A;  1S3J A;  1U8R A;  4RGR A;  2Z33 A;  2J5P A;  3WE3 A;  4A5N A;  1KU2 A;  4M9X A;  5D8K B;  4Q5S F;  5A2Q Z;  3RPQ A;  3E6D A;  1D8K A;  3QPT A;  4LFU A;  4PGH A;  3MFK A;  2ADU A;  4WXH A;  2UXX A;  2EK5 A;  3LA7 A;  1TQI A;  4P96 A;  5E18 F;  1O3S A;  2MLK A;  4ZYH A;  2COM A;  3DV8 A;  3F8M A;  3J81 K;  1W7P D;  4OMY A;  1BC7 C;  3RKW A;  2DPU A;  4BH9 A;  1BI2 A;  3LFK A;  3FM5 A;  1IZ1 A;  4F7Z A;  5FLX Z;  4EM0 B;  2KIF A;  3ABU A;  1R00 A;  4CO8 A;  5LGN A;  5TRD A;  2CW0 F;  4Q47 A;  3FZV A;  3QOP A;  4ZYE A;  2FXA A;  4BHC A;  3BJA A;  3SZP A;  1KU7 A;  1W5T A;  3BRO A;  1I5Z A;  4CZZ A;  2QWW A;  3MCZ A;  4ETS A;  1UFM A;  3GLX A;  1S29 A;  3F8N A;  1IUY A;  1YTY A;  4IVN A;  1B9M A;  2JSC A;  3T0Y A;  1ZGA A;  4HW0 A;  3RIR A;  4OMZ A;  4Y17 A;  4XBF A;  3E5U A;  2P6S A;  2MBF A;  2PN6 A;  3CTA A;  2EV5 A;  3Q5F A;  4ASN A;  2UWM A;  3IWF A;  1UHW A;  1KQ9 A;  5K5Q A;  3WTU C;  4GYG A;  5JHU A;  5BPD A;  3I59 B;  2WV0 A;  1FNN A;  1RUO A;  3VB2 A;  1IN4 A;  2Z5U A;  2H09 A;  3E6C C;  1SD5 A;  2ZCW A;  1W7P A;  3E6B A;  2ISZ A;  4BYY A;  3PQK A;  2EFN A;  4HDV A;  3B73 A;  3ZP5 A;  5BS6 A;  2H6B A;  4HAM A;  5E1Z B;  5F1R A;  3HOS A;  3GFJ A;  1AOY A;  4I01 A;  1IXS B;  3F8B A;  3I4P A;  3V7C A;  2OA4 A;  2HKX A;  3F21 A;  2P5L C;  2DK5 A;  3FXU A;  2B0L A;  1Z7U A;  2A3S A;  2E7X A;  3M8F A;  4I02 A;  1IN5 A;  4UHT A;  4OOI A;  2K7L A;  4ESB A;  1P4W A;  1FZP B;  1QGP A;  3VOE A;  1KA8 A;  2V6C A;  4HF0 A;  3CUO A;  1LDK B;  4LK0 F;  4OU0 A;  3QU6 A;  1BOA A;  2EA2 A;  2LF7 A;  3CO7 C;  3LA3 A;  1XGM A;  4CHU A;  4B09 A;  2IA0 A;  2D2W A;  3WTS C;  2XUB A;  3BDD A;  4A0Z A;  3BWG A;  4LLN A;  2FNA A;  2EJR A;  1S8N A;  1FBS A;  4BAY A;  2F2E A;  1SD4 A;  3ZMU A;  2Y0M A;  3M8E A;  2ISY A;  2IW5 A;  3BPX A;  4GCV A;  3TDU C;  2VBY A;  1IN7 A;  2ZO4 A;  1U5T C;  4MGR A;  3GZ5 A;  3G3Z A;  4A2U A;  4ON0 A;  3ZN1 A;  3E3V A;  3TKY A;  1B59 A;  2NYX A;  2JT1 A;  2HWV A;  4IJA A;  4ESF A;  1QBJ A;  4KA4 A;  2FQ3 A;  4U0W A;  2ZNZ A;  1YS7 A;  5FD5 A;  2E7W A;  3T1B A;  1XDS A;  1YW8 A;  4LLG F;  1ZG5 A;  3R60 A;  4AVP A;  5HLH A;  1MZB A;  4K2E A;  3RJP A;  1ZRD A;  1ODD A;  1ZAR A;  1FSE A;  3V8J A;  4XRF A;  3I64 A;  2BBY A;  3L09 A;  1P4A A;  2LSO A;  1U78 A;  2OQR A;  2L54 A;  5HLI A;  3QU3 A;  2V1D A;  3WGH A;  3K69 A;  1L0O C;  1HXD A;  3DFG A;  1FOK A;  4CDG A;  4ENM A;  5FGM A;  3R0J A;  3GFI A;  1T98 A;  3KLN A;  2R7F A;  4AIK A;  5HS7 A;  1JHH A;  1HKT A;  5D5V B;  2W85 A;  2CYY A;  3R6S A;  5BPI A;  4HDU A;  2FRH A;  4UUV A;  1FPQ A;  3CDH A;  4LD5 A;  3ZN0 A;  2ACJ A;  5K5R A;  4M71 A;  2JTV A;  1XGN A;  4M6X A;  1GXQ A;  1LEB A;  2XRN A;  4HF1 A;  1FBQ A;  1PP8 F;  5DCF A;  2GXG A;  3V7S A;  1RZ4 A;  2VBZ A;  1QZZ A;  5D4R A;  1K7A A;  4YFN F;  1GVJ A;  3IKT A;  2FBH A;  5EEH A;  4MNU A;  1S7A A;  4U7B A;  4GXO A;  4QLC U;  3QPH A;  2ZKZ A;  1HW1 A;  2XRO A;  1XGS A;  1PP7 U;  4IXA A;  2PJP A;  2HFH A;  2G9W A;  4EM2 A;  1FLI A;  4RAZ A;  4D0P A;  1H9T A;  5LRR A;  2CFX A;  1A04 A;  3HTS B;  1G4D A;  2E1N A;  1DP7 P;  3HHH A;  5H6Q A;  2QQA A;  5LRS A;  3V8K A;  1HSJ A;  4KN7 X;  1YIO A;  3SHF A;  1B9N A;  5KVR A;  4A0Y A;  3TO7 A;  3GEZ A;  1CGP A;  3V8L A;  3W6J B;  1REP C;  2MD5 A;  5HVQ C;  3KEO A;  2GQQ A;  4Q4Z F;  1SFE A;  1JHF A;  3WG9 A;  1XDU A;  2P4W A;  1MJA A;  4EQQ A;  2VC1 A;  5ILU A;  3HRU A;  1EH7 A;  5CVI A;  2LKP A;  4S04 A;  2FNP A;  3BP8 A;  4BHP A;  3J7A O;  1HW5 A;  2KJC A;  1ON2 A;  3MQ0 A;  3K1M A;  1S6L A;  1TBX A;  2W24 A;  4KDP A;  1XD7 A;  3GF2 A;  3JSP A;  3TDZ C;  3QRF F;  1LDJ A;  2M8E A;  2Z9O A;  1Z05 A;  2L01 A;  2C6Y A;  3S2W A;  4R1H A;  4LMY A;  4JBA A;  1FX7 A;  5D5X B;  4L5I A;  4HQM A;  4MTE A;  4HX4 A;  3F22 A;  3SXY A;  3EQL F;  2DQR A;  6PAX A;  2QBY B;  4L0Z B;  4LLL A;  1I1S A;  5ICG A;  2DBB A;  1ZRE A;  3GW2 A;  2JPB A;  1D5V A;  3CLO A;  4L9J A;  1HST A;  4RGX A;  3T8R A;  1GXP A;  4M74 A;  4GO1 A;  3CUQ C;  1Z1D A;  3VFZ A;  2MA3 A;  4QWQ A;  3FM3 A;  4MTD A;  3V7R A;  3EDP A;  1SMT A;  1R1U A;  4IPA A;  1LDD A;  3H3Z A;  5LHH A;  3L9F A;  3MZY A;  1K79 A;  3KP4 A;  1ZAO A;  5FD6 A;  4I98 B;  2DAO A;  2JZY A;  1BI3 A;  3RDI A;  1NHA A;  4Z2Y A;  1O3Q A;  4A6E A;  2EB7 A;  1ONV A;  2Q2E A;  3O3K A;  4G6D A;  2YX7 A;  2BYV E;  3GWZ A;  4WCG A;  3Q9V A;  1QZY A;  1U2W A;  2A69 F;  4ZZD A;  3HOT A;  3WTX C;  3TO6 A;  2DK8 A;  1FSH A;  1XB4 A;  4M73 A;  3KFW X;  4PDK A;  4ZYG A;  2YU3 A;  1LJ9 A;  1KYZ A;  3I58 A;  4WWC A;  4YFK F;  2LNB A;  1F4K A;  2X4H A;  4N0B A;  1ZYR F;  2P5V A;  2L4M A;  2IP2 A;  4MHG A;  2PEX A;  4KIG A;  4EJU A;  2G7U A;  2HZT A;  4PZJ A;  3GXO A;  1OPC A;  4KNY A;  2V1U A;  3HRT A;  3ERE D;  2RDP A;  3P9C A;  3E6M A;  2L4A A;  2EFO A;  2P7V B;  4I0A A;  1SAX A;  5L3F A;  3K2Z A;  2IPQ X;  2K02 A;  2QLZ A;  3ZMZ A;  2MC3 A;  5DD4 A;  2CSO A;  3KLO A;  2ZXJ A;  3EUH A;  4P55 A;  1J7K A;  1ZG1 A;  1BI0 A;  1B1B A;  3TGN A;  1T39 A;  2VXZ A;  1YLF A;  5LEK A;  4Y13 A;  2GZW A;  1UB9 A;  5E8I A;  1KU3 A;  3DPL C;  1XMK A;  5CYV A;  5E8G A;  2M30 A;  2XAH A;  5A2Q K;  1R1V A;  1T2K A;  2PLY A;  2VON A;  4AIH A;  2OBP A;  3RYP A;  2L3D A;  4XLP F;  3I54 A;  4I0B A;  2YPR A;  4EM1 A;  3IL2 A;  3KEQ A;  2YX4 A;  4UV9 A;  1XCB A;  3F8C A;  2VT3 A;  1W4M A;  3JW4 A;  1BM9 A;  4NQW A;  1BIB A;  1MD0 A;  2O8X A;  2QM3 A;  1P4X A;  3N97 A;  1EH6 A;  2CQK A;  2XAF A;  5ICC A;  3COA C;  1VTN C;  4ENK A;  4RAY A;  2QBY A;  4LG0 B;  1TQM A;  4G6Q A;  2VBX A;  2M45 A;  2M5W A;  1R5H A;  4I7H A;  1Z6R A;  4KIB A;  5E20 A;  4RB1 A;  1FYL A;  1P6R A;  2R3S A;  1KQ8 A;  3DF8 A;  4G8X A;  4M9Z A;  1K78 B;  2XHK A;  2VC0 A;  4YG2 F;  4KT5 C;  3J80 Z;  1EH8 A;  3WTY C;  4L5J A;  1Z9C A;  2O3F A;  1TTY A;  2WWY A;  1TNT A;  3BPV A;  3P7N A;  2OD5 A;  2GIV A;  2XIG A;  1MJB A;  1AWC A;  3E97 A;  2QVO A;  3SFZ A;  2IJL A;  1O57 A;  1HQC A;  2PMH A;  2W25 A;  2JPC A;  3F3X A;  3TO9 A;  1QO0 D;  1ZLK A;  2F5D A;  4XLN F;  5AIP A;  3CUQ B;  1MDM B;  4LK1 F;  5BQT A;  2XKP A;  4EMS A;  5JR3 A;  4EJV A;  3JSO A;  4RB3 C;  2HGC A;  1DDN A;  5AIQ A;  4IRH A;  1WSU A;  4NHJ A;  4UVA A;  5D5U B;  5LGT A;  2HKO A;  3WTV C;  1X3U A;  3B02 A;  2F5E A;  2DI3 A;  1R58 A;  5JVT A;  1CF7 B;  2P6T A;  1LB2 A;  2Z99 A;  3F6V A;  4HV5 A;  1D3Y A;  1MKM A;  3W6K B;  5LLQ A;  1ZLJ A;  3J81 Z;  2ZBK A;  1IRG A;  4G94 A;  5CLS A;  3TOB A;  4HA8 A;  3ELK A;  3IRQ A;  2D1V A;  1J9I A;  2O61 A;  2IA1 A;  3ABT A;  4WXD A;  2YSR A;  3BJ6 A;  2OZ6 A;  1FYK A;  5FLX K;  3BOQ A;  1YW9 A;  2Y48 A;  2V9V A;  2PFB A;  3HSF A;  4HLY A;  5F6F A;  1XSV A;  1R22 A;  1J5Y A;  1TW3 A;  4IHS A;  1BN5 A;  2IVM A;  2OZU A;  2XVC A;  4U0Y A;  2Q0O A;  5EEG A;  2HTJ A;  2HYG D;  3MAJ A;  3ZMT A;  2BGC A;  2KIM A;  3KP5 A;  1Z91 A;  1H0M A;  3R61 A;  4UVB A;  1T38 A;  1Z6T A;  1F5T A;  3I0T A;  1HKS A;  1XMA A;  4G9Y A;  2QZ8 A;  1LVA A;  4ENJ A;  3HTU A;  3RKY A;  1FY7 A;  5FB2 A;  2XKO A;  3ZQ7 A;  3TOA A;  3WE2 A;  2QEN A;  3LA2 A;  4KFC A;  4HX7 A;  2P8T A;  4L0Y B;  4TV7 A;  3PQJ A;  2FBK A;  5K1Y A;  5E1X A;  3ECO A;  1MJ9 A;  1G3Y A;  1DUX C;  4LG0 A;  4KMF A;  1DPR A;  5ICF A;  4Y15 A;  4I2O A;  1RI7 A;  3C18 A;  3KP2 A;  1YQA A;  1JXS A;  3JTG A;  4CIC A;  3WGI A;  4OIN F;  3GO5 A;  1K78 A;  1IF1 A;  2IRF G;  3T8T A;  4L9V A;  4JK1 X;  1RNL A;  2DTR A;  1WI9 A;  5DUI A;  3JTH A;  3WTT C;  2DQL A;  3EYI A;  4DNC A;  3R4K A;  1J59 A;  2XV4 S;  3FWE A;  4R8H A;  4BNC A;  3BJO A;  1FYM A;  4R79 A;  2K86 A;  3CUQ A;  1MDM A;  1FC3 A;  1OYW A;  3FXQ A;  2TDX A;  2RN7 A;  3M9A A;  2VT2 A;  4MEX F;  3FMS A;  1XGO A;  1XSX A;  3K1N A;  1L3L A;  4M9S A;  2P7C B;  1XCV A;  3DKW A;  2JRT A;  3IKV A;  3WTZ A;  4WF2 A;  1CF7 A;  4HX8 A;  1D8J A;  3FMR A;  4MQ9 F;  1J2X A;  3FHZ A;  1V4R A;  3U1D A;  2CGP A;  4H0E A;  2NRA C;  2RC4 A;  3FF5 A;  2UZK A;  2DO7 A;  3SQN A;  2A5Y B;  5TJJ A;  4WXC A;  5AON A;  4A12 A;  4L9T A;  3KZY A;  1QPM A;  3P9K A;  3ZPL A;  2ELH A;  4M72 A;  4N9H A;  3GYH X;  4IF4 A;  3MEX A;  3Q9S A;  1KQ0 A;  2RKH A;  4OIP F;  3IWZ A;  5L3C A;  2HR3 A;  2ZNY A;  3ROU A;  3KZZ A;  1IW7 F;  3KP6 A;  1KYW A;  2BE5 F;  1U3E M;  4WK8 F;  2RNJ A;  5J8C A;  4ZYD A;  4LB5 A;  3GUD A;  1OYI A;  3HRS A;  3IRR A;  3V4G A;  5ICE A;  3OOP A;  2G7H A;  5CJ9 A;  2STW A;  5L3B A;  2UXN A;  4L9N A;  2HYF A;  4LGW A;  1G3S A;  2LDU A;  5D6E A;  4ZH4 F;  1PUE E;  1I27 A;  4XSZ F;  2MLG A;  4BXU A;  2GA2 A;  5DUK A;  3QP6 A;  2A61 A;  3E5X A;  1E2X A;  3C7J A;  2XAS A;  1MGT A;  1SFU A;  4O6J A;  2J5O A;  1RUN A;  3ZMV A;  1UCR A;  1TLH B;  2RQP A;  3PFI A;  1SD7 A;  4PGG A;  2EFQ A;  3GX4 X;  4O5V A;  4UVC A;  3K1P A;  3F8F A;  5JFR A;  1R7J A;  5CVU A;  2L02 A;  1DPU A;  4GYI A;  4G7O F;  1R23 A;  4OIQ F;  2OQG A;  1O7L A;  3NRV A;  3L00 A;  4HQE A;  2ESN A;  5L3G A;  2H27 A;  3LQR A;  2KJB A;  3DPT A;  2FA5 A;  1YS6 A;  4UXN A;  2F5F A;  3HYI A;  4KYW A;  4U0V A;  1P92 A;  2K4B A;  2MH2 A;  2NNN A;  4KMU X;  2ZFW A;  3KE2 A;  2WC2 A;  1IN6 A;  1EV7 A;  4AIJ A;  2CWE A;  4U7D A;  3WOD F;  3BY6 A;  2VOO A;  5DV5 A;  2V79 A;  3HIF A;  2O03 A;  2QYO A;  1IAW A;  3ULQ B;  2FBI A;  1IRF A;  3I5U A;  3D5L A;  2E1C A;  3HSE A;  4YII A;  4I09 A;  5LHG A;  4HYE A;  2FF4 A;  5BMZ A;  1OYY A;  4KUM A;  2VOD A;  3OV8 A;  2Q8K A;  1I6X A;  1U5T A;  3QAH A;  4B8X A;  4S05 A;  2STT A;  4A0X A;  1LNW A;  1F1Z A;  4MQV A;  2ZME A;  4P9F A;  3WU1 B;  4RB0 A;  3D0S A;  2RV8 A;  3RPU A;  5E17 F;  2EWN A;  2A68 F;  1W5S A;  2ETH A;  2D1H A;  2VE8 A;  4NB5 A;  2MH9 A;  1PDN C;  2NNY A;  3DQV C;  3ZMD A;  4ESJ A;  5IT9 Z;  3HUG A;  5JI6 A;  3VOD A;  4L18 B;  2PG4 A;  2FMY A;  4IRI A;  3K0L A;  2FSW A;  1ON1 A;  3DXJ F;  3GZ6 A;  3DEU A;  1O7F A;  3ZMS A;  5FFX A;  3K9T A;  4HZF A;  1FWZ A;  1IN8 A;  2YR2 A;  1JE8 A;  2ZJ2 A;  1BJA A;  2FU4 A;  1QQI A;  4HBL A;  2XAQ A;  2VE9 A;  1ZRC A;  3I53 A;  2KIU A;  1J75 A;  4UV8 A;  2HQN A;  4A6D A;  3FX3 A;  2RVC A;  3RTR A;  1E17 A;  2DT5 A;  1UHM A;  1LQ1 A;  4P9U A;  2XAJ A;  4HLX A;  2DFI A;  2HS5 A;  4PCQ A;  1BC8 C;  1G6N A;  1V3F A;  4EJW A;  3ML6 A;  3O6B B;  2HQR A;  4AWX B;  3FMQ A;  5D6F A;  3CJN A;  4G7H F;  4CGZ A;  3E5Q A;  3ECH A;  3LAP A;  3I71 A;  1IXC A;  2KKO A;  2F5C A;  1YFH A;  2PMU A;  4P5O A;  2GWR A;  3LQQ A;  5H6R A;  3JAM Z;  4UNO A;  2EV0 A;  2O6G E;  1OKR A;  1HKQ A;  4BQA A;  1XN7 A;  1Y0U A;  2W57 A;  2M87 A;  2PQ8 A;  5ED4 A;  2HDC A;  1K6O A;  4MEY F;  3TQN A;  3WTW C;  4Q48 A;  1FP2 A;  2EFP A;  5DCM B;  1C0W A;  4ZZL A;  2A6H F;  3U2R A;  3J80 K;  2A07 F;  4JQF A;  4IRG A;  4A5M A;  5D8L B;  1I1G A;  1P2F A;  4KN4 X;  3N4M A;  4RGU A;  1ZGJ A;  2LF8 A;  3HSR A;  5D5W B;  1YW7 A;  2EV6 A;  1GHC A;  2QQ9 A;  2GAU A;  1B4A A;  4HV6 A;  5DDG A;  5J6X A;  2V1X A;  3IC7 A;  2VOP A;  1FP1 D;  3AAF A;  5HS8 A;  2EFW A;  2OAZ A;  2KRF A;  1UST A;  2K27 A;  4EGZ A;  2W84 A;  5HDK A;  5L3E A;  3WU0 A;  1U5T B;  1YG2 A;  2H94 A;  3MWM A;  5CVJ A;  5DD8 A;  2ZME B;  1BI1 A;  3LAJ A;  4YIF A;  3MZH A;  2GXB A;  3NEU A;  1QNT A;  5KK1 A;  2DPD A;  3L7W A;  1WRJ A;  2D45 A;  2WTE A;  3F6O A;  3FXR A;  1SFX A;  5CVV A;  4RGS A;  4ENN A;  3QP5 A;  2DW4 A;  4CXF A;  2DLL A;  4FT8 A;  4BHB A;  2XAG A;  1TQP A;  1R36 A;  1SD6 A;  4M6Y A;  2QQB A;  2K4J A;  3DP7 A;  3BZ6 A;  5K5O A;  5F64 A;  2X0L A;  2H6C A;  2M1B A;  5ILV A;  1U6G A;  4FX0 A;  4KIF A;  5DYM A;  2FML A;  2O0Y A;  5HS9 A;  2FOK A;  1ZN2 A;  2NS0 A;  3GFM A;  1F9N A;  3KET A;  3G73 A;  4OIO F;  2A6E F;  3LST A;  2BEO A;  3WGG A;  5J8F A;  1O3R A;  1FT9 A;  3RKX A;  1ULY A;  5HOO A;  1HW2 A;  5H20 A;  3LWF A;  4FHT A;  2P5K A;  2AS5 F;  4EJT A;  1R5G A;  1ZHF A;  1USS A;  3U9G A;  3C1D A;  3P9I A;  3RYR A;  1R1T A;  5IT9 K;  4LJZ F;  3F23 A;  5IT3 A;  1WQ2 A;  5ILS A;  3HHG A;  3KP3 A;  5BOX A;  3H3U A;  5E1W A;  3VEP A;  3C3W A;  3REO A;  2PI0 A;  1B6A A;  1KGS A;  2Z3Y A;  4OIR F;  2QUF A;  3T5X A;  1OMI A;  5DEQ A;  2XGX A;  3R0A A;  2CG4 A;  4IHT A;  2RGV A;  5DCM A;  1T6S A;  4LB6 B;  1HBX G;  2Y75 A;  3IHU A;  5FFZ A;  3KP7 A;  4HF2 A;  1FBU A;  5CVR A;  2PBI A;  3L2C A;  5FO5 A;  2CO5 A;  1LEA A;  2IT0 A;  3GVA A;  4WX9 A;  5HLG A;  1TNS A;  5ERI A;  5LEJ A;  2AXL A;  3M1E A;  3M7G A;  3I59 A;  1KU9 A;  2FE3 A;  3EET A;  2BV6 A;  4YFX F;  1ZH5 A;  1W7P B;  2HOE A;  1BBY A;  1SMY F;  1G3W A;  1S7O A;  2HTS A;  4EVI A;  1TW2 A;  4EJO A;  4EGY A;  4O3M A;  3ISP A;  2IA2 A;  4DQ2 A;  1O3T A;  1YO5 C;  3CO6 C;  5HDG A;  3KCC A;  5LHI A;  1WKM A;  3JAM K;  4FX4 A;  2VBW A;  5L3D A;  3F72 A;  2HEO A;  1G3T A;  1Q1H A;  3SZT A;  4E70 A;  1JGS A;  4HOB A;  1ZRF A;  5HDN A;  3EYY A;  2FEZ A;  2NAZ A;  1BIA A;  2R7D A;  4GGG A;  3RI4 A;  2GA1 A;  3GFL A;  3HRM A;  5LGU A;  1XSD A;  1J0R A;  1WWX A;  3NQO A;  2EA4 A;  1OR7 A;  4RS8 A;  4G7Z F;  1RIO H;  1STZ A;  2DU9 A;  2ESH A;  3O2P E;  4EV0 A;  2OU2 A;  1H9G A;  4N9I A;  1ZG3 A;  1T0F A;  5LBQ A; 
#chains in the Genus database with same CATH topology
 2LD5 A;  1P7J A;  4AD9 A;  3ZXS A;  1ETQ A;  4XSX F;  3ZQI A;  4RB2 C;  2JQ7 A;  3H92 A;  4M3D A;  1IXR C;  2VN2 A;  4I76 A;  1W0T A;  5D4S A;  4CYD A;  4U88 A;  1I6H J;  2QCO A;  4KIC A;  5EDN A;  2LY9 A;  1YYV A;  1QVU A;  1K61 A;  3HM5 A;  5JLW A;  1WGX A;  1S3J A;  1U8R A;  3G1O A;  1K83 J;  4RGR A;  3I4N J;  4PK4 A;  2E35 A;  1TL8 A;  2Z33 A;  3ZQG A;  2J5P A;  3WE3 A;  3HKZ A;  4A5N A;  4NNJ A;  1KU2 A;  2N8G A;  4M9X A;  5D8K B;  4Q5S F;  1UAA A;  5A2Q Z;  3RPQ A;  3E6D A;  1QHG A;  1D8K A;  3QPT A;  2DJN A;  4LFU A;  2DA3 A;  4PGH A;  2KIS A;  3MFK A;  2ADU A;  2MFZ A;  5J40 A;  3PNV A;  2UXX A;  4WXH A;  3W2V A;  2EK5 A;  3LA7 A;  1TQI A;  4P96 A;  2MW8 A;  5E18 F;  3MZ8 A;  1O3S A;  3HOW J;  1V54 H;  2MLK A;  4ZYH A;  4BS9 A;  2COM A;  3CQZ J;  3DV8 A;  3F8M A;  3J81 K;  3OYL A;  1X2M A;  5IP7 J;  1W7P D;  4OMY A;  1BC7 C;  3RKW A;  2DPU A;  4V2G A;  4BH9 A;  4DYC A;  1BI2 A;  3LFK A;  1YX5 A;  3FM5 A;  1IZ1 A;  4F7Z A;  2R7O A;  5FLX Z;  3S3M A;  2KLO A;  2L7K A;  2OCE A;  1RR7 A;  2OPT A;  4EM0 B;  3H9J A;  3RQ4 A;  2KIF A;  3ABU A;  4GFB A;  4BQO A;  1R00 A;  4CO8 A;  4BQQ A;  2EPF A;  5LGN A;  5TRD A;  2CW0 F;  3BQZ A;  3CJR B;  4Q47 A;  3FZV A;  2PJR A;  3QOP A;  3VYU B;  3TED A;  2KPM A;  4IKF A;  2HDD A;  3HZJ A;  4ZYE A;  2FXA A;  3N05 A;  1R4N B;  4BHC A;  2M34 A;  3BJA A;  3SZP A;  1KU7 A;  1W5T A;  3BRO A;  2M9H A;  2DMU A;  1D5Y A;  1I5Z A;  2AQE A;  2HVS A;  4CZZ A;  4C3H J;  1GVD A;  5F08 A;  2QWW A;  3MCZ A;  4ETS A;  1P7I A;  4CSW A;  4XKW A;  4V2F A;  1UFM A;  3GLX A;  4E7Z A;  2FD5 A;  1S29 A;  3TP3 A;  3F8N A;  1IUY A;  3QOD A;  4PSW A;  2DMT A;  1YTY A;  4IVN A;  1B9M A;  2JSC A;  3T0Y A;  1ZGA A;  4HW0 A;  2EIJ H;  2ME6 A;  3RIR A;  5K7F A;  4LG3 A;  1XMX A;  2EIM H;  1OR7 C;  4OMZ A;  4Y17 A;  4XBF A;  2R7V A;  3OSF A;  5FKL A;  4DYR A;  3E5U A;  2P6S A;  2MBF A;  1SFK A;  1ORK A;  4F52 A;  2PN6 A;  3CTA A;  1X3W B;  2BVM A;  4RBO A;  2M35 A;  3CCJ I;  3JRC A;  2EV5 A;  1OCP A;  3Q5F A;  2DYS H;  4ASN A;  2UWM A;  1D1A A;  2ELK A;  4JYK A;  2M7B A;  2LTP A;  3IWF A;  1UHW A;  1KQ9 A;  2V1N A;  4ZYA A;  5K5Q A;  3H5A A;  3WTU C;  4XK4 A;  3BG5 A;  1I3Q J;  4P1W A;  4GYG A;  5JHU A;  5BPD A;  3I59 B;  3L2U A;  2B9S A;  2WV0 A;  3BG6 A;  3S2D J;  5CQE A;  1FNN A;  2OV7 A;  4FE4 A;  1RUO A;  3VB2 A;  1IN4 A;  3MKY B;  2Z5U A;  1AKH A;  2H09 A;  3E6C C;  1SD5 A;  2ZCW A;  1X4O A;  1W7P A;  3E6B A;  2ISZ A;  4BYY A;  4BE1 A;  3W2A A;  3W3C A;  3PQK A;  1ZK8 A;  2EFN A;  4F55 A;  2XF7 A;  4PFO A;  3B73 A;  3ZP5 A;  3OYB A;  4HDV A;  1VQP I;  5BS6 A;  3PJR A;  1RKT A;  1EJ9 A;  2H6B A;  2X1C A;  4HAM A;  5E1Z B;  5F1R A;  3DU6 A;  3HOS A;  3QYE A;  3AG3 H;  3GFJ A;  5TGT A;  1X1A A;  4I01 A;  2CW7 A;  3CC7 I;  1AOY A;  1GV5 A;  1IXS B;  3AFH A;  3F8B A;  3I4P A;  3V7C A;  2OA4 A;  2HKX A;  4CYC B;  3F21 A;  1NH3 A;  2P5L C;  2DK5 A;  3FXU A;  3I56 I;  1P9Q C;  2NOG A;  2H8R A;  2B0L A;  1Z7U A;  3G6E I;  2A3S A;  2E7X A;  2QQ8 A;  3BCB A;  3M8F A;  1JT0 A;  1QPI A;  4I02 A;  1IN5 A;  4NC7 A;  2XF6 A;  4CCK A;  3ABK H;  4UHT A;  4OOI A;  4E7J A;  3SDG A;  2Y31 A;  2GOX B;  3OR1 C;  4XKV A;  4FAS D;  1K4T A;  2K7L A;  4ESB A;  3BR3 A;  1P4W A;  1FZP B;  3J7Z I;  3PIP F;  3RZO J;  1QGP A;  2X9D A;  3UNG C;  3VOE A;  3OOU A;  2DA5 A;  2L0K A;  1KA8 A;  1PYV A;  2V6C A;  2LC2 A;  1H88 C;  4HF0 A;  3G4S I;  2V9K A;  1A6I A;  3CUO A;  1LDK B;  4LK0 F;  4OU0 A;  2EH3 A;  3QU6 A;  3RZD J;  1QU3 A;  1BOA A;  2EA2 A;  4U87 A;  2LF7 A;  4XIC A;  4CCO A;  3OYK A;  3CO7 C;  3LA3 A;  1XGM A;  1MMD A;  4XMY A;  4XOT A;  4CHU A;  4B09 A;  4BKX A;  2IA0 A;  2D2W A;  2WB1 N;  3PM1 A;  3WTS C;  2E1M C;  1BL0 A;  2XUB A;  2MZ4 A;  3BDD A;  4A93 J;  4A0Z A;  3BWG A;  4LLN A;  2FNA A;  1EF4 A;  1XTA A;  2O8K A;  2BW3 B;  2K3F A;  1KON A;  1BW6 A;  2EJR A;  1S8N A;  1Z0X A;  2G0E A;  1FBS A;  2L7M P;  3HBL A;  4BAY A;  2F2E A;  2XPW A;  4AUX A;  5HLT A;  1W1W E;  1SD4 A;  1TWG J;  4JX5 A;  4HPQ A;  3QPL A;  3ZMU A;  2Y0M A;  3M8E A;  1VND A;  2ISY A;  1X1C A;  2IW5 A;  1XG1 A;  1Y1W J;  4XN3 A;  3BPX A;  3NAR A;  4GCV A;  3TDU C;  1WZ2 A;  2VBY A;  1IN7 A;  2ZO4 A;  1U5T C;  4KT6 A;  4MGR A;  5M3M J;  3GZ5 A;  2WAF A;  3G3Z A;  4A2U A;  2X6X A;  4ON0 A;  3CZ6 A;  1R9T J;  3BTC A;  3ZN1 A;  3E3V A;  3TKY A;  1NG7 A;  3G71 I;  1B59 A;  4B48 A;  2DMP A;  4XKC A;  2NYX A;  3QQA A;  2JT1 A;  2HWV A;  4IJA A;  5F1J A;  3WU2 C;  2IGO A;  3D5S C;  4ESF A;  4KA4 A;  2FQ3 A;  1QBJ A;  4U0W A;  2VPR A;  2ZNZ A;  1YS7 A;  4Y3O A;  4XLC A;  5FD5 A;  2XPU A;  1GV2 A;  1T8I A;  2E7W A;  3T1B A;  2Z1D A;  2K5C A;  1XDS A;  1OQY A;  1YW8 A;  3KYC B;  4A3B J;  4LLG F;  4RM3 A;  3QYF A;  2NS8 A;  2PJR B;  1ZG5 A;  3R60 A;  4AVP A;  5HLH A;  1MZB A;  4K2E A;  3PIO F;  3ZQQ A;  1LFP A;  3J7Y J;  1JUS A;  3RJP A;  1W5C C;  1SFO J;  1ZRD A;  1SVL A;  4HNT A;  1IV8 A;  1ODD A;  1ZAR A;  1FSE A;  5LFA A;  4IOC F;  3J7A Y;  2K9N A;  3V8J A;  4LIV A;  4XRF A;  3I64 A;  2VB6 A;  2BBY A;  1CQT A;  4A3D J;  3L09 A;  1P4A A;  2LSO A;  1U78 A;  2EQR A;  2OQR A;  2W7N A;  2IS6 A;  2L54 A;  2R7W A;  5HLI A;  4D7N A;  1PVE A;  3OYC A;  3QU3 A;  2V1D A;  3WGH A;  3K69 A;  1L0O C;  3CCV I;  1RR8 C;  2ME0 A;  3FBI B;  1HXD A;  3OS2 A;  3DFG A;  2NOJ B;  4HSR A;  1FOK A;  3MD2 A;  1IRZ A;  4CDG A;  1GLN A;  4ENM A;  2A05 A;  5FGM A;  3R0J A;  5M5X J;  3GFI A;  2DOD A;  4C9Y A;  1T98 A;  5M5Y J;  3KLN A;  1W36 C;  2R7F A;  3HL2 A;  4AIK A;  3BZK A;  5HS7 A;  1JHH A;  1HKT A;  4B43 A;  5D5V B;  2W85 A;  1SAN A;  2CYY A;  2GIZ A;  5E3L A;  3R6S A;  3ZR8 X;  5BPI A;  4HDU A;  2FRH A;  4UUV A;  1FPQ A;  3CDH A;  3DLL F;  4LD5 A;  1TWC J;  1X19 A;  3ZN0 A;  1X3Z B;  4AYB N;  4M71 A;  5K5R A;  2ACJ A;  2JTV A;  1XGN A;  2Q2E B;  4M6X A;  1GXQ A;  3TW7 A;  1LEB A;  5FLX R;  2XRN A;  4HF1 A;  2JK3 A;  2R5Y B;  1FBQ A;  3GTL J;  1TT5 B;  1FIP A;  1PP8 F;  5DCF A;  4A3I J;  5FKN A;  2GXG A;  2Z2S B;  3V7S A;  3DBL B;  1AKH B;  1J09 A;  2K3P A;  1RZ4 A;  3C2B A;  2VBZ A;  1QZZ A;  5D4R A;  1K7A A;  4YFN F;  2GXA A;  1GVJ A;  3IKT A;  2E2J J;  4XLA A;  2FBH A;  5JHF A;  5EEH A;  1MMA A;  4MNU A;  4E7I A;  3VSL A;  1S7A A;  4U7B A;  1WJD A;  1GT0 C;  1U8B A;  4GXO A;  3IUO A;  4QLC U;  5J1U A;  3QPH A;  4G6T B;  2ZKZ A;  3IP4 B;  1HW1 A;  3I9V 2;  2XRO A;  1XGS A;  1PP7 U;  4IXA A;  2EIL H;  2JN6 A;  3CC2 I;  1XS9 A;  1IV6 A;  3BR1 A;  2PJP A;  1T33 A;  2HFH A;  2ZXW H;  2XC7 A;  2G9W A;  3KX2 A;  4EM2 A;  4PJ0 C;  3ERM A;  1FLI A;  4RAZ A;  4D0P A;  2P0W A;  5LRR A;  1VQO I;  1H9T A;  3I55 I;  2CFX A;  4BQN A;  3BT9 A;  1A04 A;  4D5F A;  3HTS B;  2PMZ N;  1G4D A;  2BXZ A;  2E1N A;  1DP7 P;  3HHH A;  2CRG A;  5H6Q A;  3Q0V A;  2RAE A;  1BR4 A;  1LUJ B;  2M2E A;  2QQA A;  2FOW A;  2JJ7 A;  2LKS A;  5LRS A;  1GDT A;  3BR2 A;  3V8K A;  5J1Y A;  4ZDO A;  1HSJ A;  4KN7 X;  1YIO A;  2B63 J;  1T08 B;  2LLK A;  1B9N A;  3SHF A;  5KVR A;  4A0Y A;  3TO7 A;  2YU9 J;  3GEZ A;  2X98 A;  1CGP A;  1WI3 A;  3V8L A;  4CH7 A;  1TWF J;  5IP6 A;  1MMS A;  3W6J B;  1REP C;  2MD5 A;  5HVQ C;  3E0J B;  2KQR A;  2UV1 A;  3KEO A;  5A2Q R;  1U0J A;  2GQQ A;  2VIX A;  3WHC A;  1SVM A;  1UG2 A;  4Q4Z F;  3DU5 A;  1VQM I;  3DBR B;  1SFE A;  1JHF A;  3WG9 A;  1RQ6 A;  1XDU A;  2BW3 A;  1SVO A;  2P4W A;  1B72 A;  1MJA A;  1X1P A;  4EQQ A;  2VC1 A;  5ILU A;  3HRU A;  1EH7 A;  2K40 A;  2EZL A;  2P81 A;  5CVI A;  2K85 A;  3UR3 C;  2LY2 A;  2LKP A;  4S04 A;  1X2N A;  2VKV A;  1MMN A;  2FNP A;  2KRH A;  2M7A A;  4MLO A;  3BP8 A;  4BHP A;  3M8J A;  2R7R A;  3J7A O;  1HW5 A;  1BR1 A;  1ON2 A;  2KJC A;  2IXS A;  3GTQ J;  3MQ0 A;  3K1M A;  4M3G A;  1S6L A;  1TBX A;  2W24 A;  5EEA A;  4KDP A;  1XD7 A;  1RPW A;  2XSD C;  2WBM A;  2HOS A;  3GF2 A;  3JSP A;  3KYD B;  3TDZ C;  3QRF F;  1LDJ A;  2M8E A;  1MMG A;  3JRG A;  2Z9O A;  3H3V K;  3IAS 2;  1NK3 P;  1Z05 A;  3CD6 I;  2L01 A;  3A02 A;  2C6Y A;  3S2W A;  4R1H A;  4LMY A;  4JBA A;  2ID3 A;  1FX7 A;  2X1E A;  3VYT B;  5D5X B;  2BY3 A;  4L5I A;  3DPU A;  4HQM A;  4MTE A;  4HX4 A;  3F22 A;  1IDY A;  3SXY A;  3EQL F;  2DQR A;  1H89 C;  3CCR I;  2QEX I;  2COB A;  6PAX A;  2QBY B;  4L0Z B;  2CH0 A;  4LLL A;  1I1S A;  5ICG A;  2DBB A;  5B3S H;  4X6A J;  2MAB A;  2R7U A;  3FXM A;  3MN2 A;  1ZRE A;  2YS9 A;  1JJ8 C;  3GW2 A;  2JPB A;  1D5V A;  2LK2 A;  1E3H A;  2VKE A;  3CLO A;  2XDV A;  1E0E A;  3W6V A;  4L9J A;  1HST A;  4E7S A;  4RGX A;  5TIS C;  4ZTF A;  3T8R A;  1YIJ I;  1GXP A;  4M74 A;  4GO1 A;  3CUQ C;  3ASN H;  3K4M A;  1FTZ A;  1Z1D A;  3H0G J;  3VFZ A;  1WH7 A;  2MA3 A;  3M4O J;  1BW5 A;  4QWQ A;  1O4X A;  4CCM A;  5IT9 R;  1N78 A;  3FM3 A;  3VPR A;  4C2M J;  4MTD A;  1X1D A;  2LFB A;  2R0Q C;  3V7R A;  3EDP A;  2R7X A;  1SMT A;  1R1U A;  2LVS A;  4IPA A;  3MMY B;  1LDD A;  2WB1 A;  1T56 A;  3H3Z A;  5LHH A;  3L9F A;  3MZY A;  3OS0 A;  4ZDL A;  3U1K A;  1K79 A;  3KP4 A;  2L5Q A;  1ZAO A;  2MYS A;  2R7Z J;  3MKW B;  1D0Y A;  2PMZ A;  1YJW I;  4OAZ A;  2VKH A;  4I98 B;  2DAO A;  2HPI A;  2X51 A;  5FD6 A;  3S17 J;  2JZY A;  1BI3 A;  2M4K A;  1NHA A;  1ZKG A;  4Z2Y A;  3RDI A;  1O3Q A;  2HQA A;  4A6E A;  2EB7 A;  4BEH A;  3ONQ A;  1ONV A;  2DA1 A;  3CC4 I;  2DDB A;  2Q2E A;  4XQF A;  2LRE A;  3O3K A;  4G6D A;  2DT7 B;  2YX7 A;  2IS4 A;  2LOO A;  2BYV E;  3GWZ A;  3O8G A;  5E79 C;  4WCG A;  3GTK J;  2R5Y A;  2NVQ J;  3OIP A;  3Q9V A;  2MVT A;  1QZY A;  3H5N A;  3EPZ A;  3BR6 A;  1U2W A;  2A69 F;  3FXJ A;  1ERD A;  4ZZD A;  3HOT A;  2M3A A;  4A3C J;  2M4G A;  4ZC3 A;  3WTX C;  3DLA A;  3TO6 A;  1QHH D;  2DK8 A;  1FSH A;  3BQY A;  1XB4 A;  4M73 A;  3KFW X;  4PDK A;  4ZDP A;  4ZYG A;  2YU3 A;  4EEF G;  1LJ9 A;  1KYZ A;  1Z3Y A;  3I58 A;  4WWC A;  1Z7L A;  4YFK F;  2LNB A;  3I4M J;  2KHM A;  1FEX A;  2ZXH A;  1F4K A;  4XLH A;  2X4H A;  4D9J A;  2R5Z B;  4N0B A;  1ZYR F;  5KCM A;  4B1R A;  2P5V A;  2L4M A;  3CJQ B;  1XPX A;  2L7F P;  1IJW C;  2WAQ A;  2XRL A;  5GAH J;  2IP2 A;  4MHG A;  2PEX A;  4KIG A;  4PUS A;  4CA0 A;  4EJU A;  2G7U A;  1WH5 A;  2HZT A;  3I3L A;  4RDU A;  3H9Q A;  4PZJ A;  3GXO A;  1OPC A;  2E1O A;  4W97 A;  3H35 A;  2HXO A;  4KNY A;  3DCF A;  2V1U A;  3HRT A;  3ERE D;  1DU0 A;  2K9M A;  1JKO C;  3ASO H;  2RDP A;  3P9C A;  1VQ8 I;  3E6M A;  1FOW A;  2L4A A;  3G1M A;  2EFO A;  2P7V B;  4I0A A;  2GLO A;  1MBF A;  1MBK A;  1SAX A;  2FQ4 A;  3LSP A;  5L3F A;  4BAC A;  3GTM J;  3K2Z A;  4LOC A;  2IPQ X;  2K02 A;  2HYJ A;  2QLZ A;  4QSH A;  3ZMZ A;  2DOA A;  2MC3 A;  5DD4 A;  2CSO A;  3KLO A;  2ZXJ A;  4PJJ A;  3RQI A;  2JUG A;  3IH4 A;  3EUH A;  4P55 A;  1J7K A;  1ZG1 A;  1W36 D;  1BI0 A;  1B1B A;  3S8P A;  2DFF A;  1EA3 A;  2F5V A;  4DZJ A;  3DEW A;  4B4C A;  3TGN A;  2RQQ A;  1T39 A;  2VXZ A;  3SFI A;  1B72 B;  1YLF A;  2DT6 A;  4RMN A;  3S32 A;  5LEK A;  4Y13 A;  5IY5 H;  2GZW A;  1UB9 A;  5E8I A;  3CF2 A;  4A3J J;  1KU3 A;  3DPL C;  1XMK A;  5CYV A;  5E8G A;  2M30 A;  1ZGW A;  2XAH A;  5A2Q K;  1R1V A;  1T2K A;  2A5W A;  1WJF A;  2PLY A;  3QYB A;  2VQH A;  2VON A;  4AIH A;  2OBP A;  3RYP A;  1NK2 P;  2L3D A;  1SEU A;  4XLP F;  5EG0 B;  3I54 A;  3CF5 F;  1WPK A;  1WFX A;  4HEA 2;  1A31 A;  3CP8 A;  4I0B A;  4XKB A;  4IL6 C;  2YPR A;  3K4J A;  3KPH A;  4EM1 A;  3IL2 A;  3KEQ A;  1I3A A;  3OYG A;  4YEL A;  2L9V A;  2YX4 A;  4UV9 A;  1XCB A;  3F8C A;  5KHD A;  3KEY A;  2VT3 A;  4A3F J;  3IAM 2;  1W4M A;  2VPL A;  3JW4 A;  1BM9 A;  5F0C A;  2EZK A;  1F36 A;  3BTI A;  4NQW A;  1BIB A;  3L2W A;  1UMQ A;  1MD0 A;  2O8X A;  2QM3 A;  3Q0U A;  1P4X A;  4IQ4 A;  3N97 A;  1EH6 A;  2CQK A;  4AU7 A;  2XAF A;  3FIS A;  4E7H A;  5ICC A;  2QSH X;  5GAD J;  4JX4 A;  3COA C;  1VTN C;  4OWR B;  1JUP A;  4ENK A;  4RAY A;  2QBY A;  4LG0 B;  1TQM A;  4G6Q A;  2VBX A;  2M45 A;  2VKD A;  3DEE A;  2M5W A;  1ZR2 A;  1R5H A;  4I7H A;  1Z6R A;  1VQ7 I;  3FDY A;  4KIB A;  5E20 A;  4B3A A;  4RB1 A;  1FYL A;  3ZRG A;  1P6R A;  1A6Q A;  2R3S A;  5EYR A;  3S93 A;  1Y0N A;  1KQ8 A;  3DF8 A;  5F04 A;  4G8X A;  4M9Z A;  5H2F C;  1K78 B;  2XHK A;  3K6G A;  2VC0 A;  4YG2 F;  4IHX A;  4KT5 C;  3PO3 J;  3CME I;  1GUU A;  4PFP A;  2XF5 A;  1A5J A;  1H8A C;  2RNG A;  3J80 Z;  1OCT C;  1EH8 A;  1SC7 A;  2Y69 H;  2JA2 A;  3WTY C;  4L5J A;  3K7A J;  9ANT A;  1Z9C A;  3HGY A;  2CQN A;  3B6A A;  2O3F A;  1TTY A;  3PO2 J;  2H1L A;  4HNU A;  1TNT A;  3BPV A;  2WWY A;  4PJN A;  3P7N A;  4F3Q A;  2OD5 A;  2GIV A;  3K10 A;  2XIG A;  3QPS A;  1APL C;  1TT0 A;  1V5G A;  1MJB A;  1AWC A;  3E97 A;  3HXL A;  2QVO A;  3SFZ A;  2IJL A;  3GCM A;  1O57 A;  1HQC A;  5B1A H;  4KIS A;  2E5N A;  2PMH A;  2W25 A;  2DTZ A;  2JPC A;  1NTC A;  2TRT A;  2H8W A;  3F3X A;  2IS2 A;  4Y52 J;  3TO9 A;  1QO0 D;  1YRN A;  1ZLK A;  3JRD A;  2F5D A;  4RM2 A;  4XLN F;  5AIP A;  4C3J J;  3CUQ B;  5GTI C;  1MDM B;  4LK1 F;  5BQT A;  2XKP A;  4EMS A;  3BTL A;  4BEH B;  3PSF A;  4EJV A;  5JR3 A;  4HST A;  3JSO A;  3ZCO A;  4RB3 C;  2HGC A;  2Y0S N;  1HCR A;  1DDN A;  5AIQ A;  4NDL A;  1ZEL A;  4BBS J;  3CCY A;  3CMY A;  2Z16 A;  4IRH A;  5M3F J;  1WSU A;  4NHJ A;  1VFC A;  4UVA A;  5D5U B;  2F4I A;  5LGT A;  2KT0 A;  4NUB A;  4XRS A;  2MUN A;  4BE0 A;  3K4C A;  2HKO A;  4C30 A;  1X3U A;  3WTV C;  5FLV A;  2KL4 A;  2AO9 A;  2CU7 A;  4ZTJ A;  3B02 A;  2F5E A;  2E1M B;  2DI3 A;  3PNT A;  1R71 A;  3JRB A;  1R58 A;  5JVT A;  2LMD A;  4BU2 A;  1CF7 B;  2P6T A;  5EF6 A;  1LB2 A;  2RRE A;  3DTI A;  4CCN A;  2Z99 A;  2VJ5 A;  3F6V A;  4F93 B;  1QZE A;  4HV5 A;  5GP9 A;  1D3Y A;  1K4S A;  1MKM A;  3W6K B;  5LLQ A;  2X1D A;  1V55 H;  2R5Z A;  1ZLJ A;  3C2G A;  3K4N A;  4A69 C;  4XM3 A;  1HA8 A;  3J81 Z;  2ZBK A;  1IRG A;  5C3E J;  4G94 A;  1IRX A;  1ETO A;  1D0Z A;  5CLS A;  3TOB A;  4HA8 A;  2DMQ A;  3ELK A;  3IRQ A;  2D1V A;  1LVK A;  5EJC A;  1J9I A;  2HVQ A;  2O61 A;  2IA1 A;  2OUM A;  4NC6 A;  3RCO A;  4J01 A;  3ABT A;  3A03 A;  4WXD A;  4DBR A;  2NVT J;  2YSR A;  2PX9 A;  3BJ6 A;  2OZ6 A;  1FYK A;  1HDP A;  3A2K A;  3AL0 C;  2EIN H;  4D7M A;  3DBH B;  3FHN A;  3H5R A;  5FLX K;  2XGC A;  3BOQ A;  4DOZ A;  1IDZ A;  3D5R C;  5HOD A;  1YW9 A;  2Y48 A;  2V9V A;  2PFB A;  3HSF A;  3OYN A;  3L2R A;  4HLY A;  5F6F A;  3JRI A;  4F92 B;  1IUF A;  1HLV A;  1XSV A;  1R22 A;  2F4M B;  1J5Y A;  3FKI J;  3TP0 A;  3OYD A;  2DA4 A;  4OAY A;  1TW3 A;  4DBQ A;  4IHS A;  1RET A;  1ITY A;  2JA8 J;  1BN5 A;  2IVM A;  2OZU A;  3O8H A;  2XVC A;  4XL9 A;  4U0Y A;  3BR5 A;  2X6O A;  2Q0O A;  1JJ6 C;  2KDZ A;  3E7L A;  5EEG A;  4J00 A;  2HTJ A;  2HYG D;  3MAJ A;  2L2O A;  4BY1 J;  3PSI A;  4M6V A;  2CQ7 A;  3ZMT A;  3QWL A;  2BY2 A;  1PJR A;  2BGC A;  2KIM A;  4DW6 A;  5EG0 A;  3KP5 A;  3PNY A;  3TBI A;  3FK7 A;  3K4B A;  1Z91 A;  1H0M A;  3R61 A;  4UVB A;  5EGO A;  1Z6T A;  1T38 A;  2JVH A;  1F5T A;  3I0T A;  1HKS A;  1XMA A;  4G9Y A;  1BA5 A;  1Z21 A;  5K7Z A;  5F27 A;  2QZ8 A;  1LVA A;  4ENJ A;  3S3O A;  2LY1 A;  3HTU A;  3RKY A;  1FY7 A;  3LOC A;  5FB2 A;  2XKO A;  3ZQ7 A;  4CZC A;  1I50 J;  3G2B A;  5GTH C;  3TOA A;  3WE2 A;  2QEN A;  1FOX A;  1Y56 A;  4NQW B;  2E36 A;  3LA2 A;  4KFC A;  4HX7 A;  2LR8 A;  3SJM A;  1W0U A;  2OCC H;  5FKM A;  2P8T A;  4L0Y B;  4BXF A;  1ETY A;  3PQJ A;  4TV7 A;  1OIS A;  4B47 A;  2FBK A;  5K1Y A;  4J19 A;  5E1X A;  3ECO A;  1S72 I;  1MJ9 A;  1G3Y A;  1OCR H;  5F0F A;  2AXT C;  1DUX C;  3AL0 B;  4LG0 A;  5CQG A;  4D1Q A;  4KMF A;  3CCM I;  1DPR A;  5ICF A;  4Y15 A;  3AG4 H;  4AID A;  4I2O A;  4FQG A;  3KZI C;  1RI7 A;  3C18 A;  3LSJ A;  3HPG A;  2CS3 A;  3AG2 H;  3KP2 A;  3JRH A;  1YQA A;  1JXS A;  2V9P A;  3OL4 A;  2BVL A;  4PJL A;  1IC8 A;  3JTG A;  4B44 A;  5C44 J;  5IYD J;  4CIC A;  2L7Z A;  2QSG X;  2Q1Z B;  2WY8 Q;  5F0H A;  3WGI A;  4OIN F;  3GO5 A;  4ITV A;  2K9Q A;  1K78 A;  1IF1 A;  2IRF G;  3S1R J;  3T8T A;  3HOU J;  4I6Z A;  1ZQ3 P;  1LE8 B;  4L9V A;  4JK1 X;  1RNL A;  5JLX A;  4EAT A;  3HOY J;  3CP2 A;  2VJI A;  4IHW A;  2DTR A;  2JWT A;  1WI9 A;  2X85 A;  2EBI A;  3S14 J;  5DUI A;  3JTH A;  2ZC2 A;  2DXI A;  3CLQ A;  3WTT C;  1TC3 C;  4A3K J;  1BOB A;  2IAI A;  3BG9 A;  2DQL A;  4NBQ A;  3EYI A;  2LH9 A;  2QKL B;  4DNC A;  3R4K A;  1J59 A;  2XV4 S;  5B66 C;  3FWE A;  4R8H A;  4BNC A;  3BJO A;  1R6R A;  4I99 C;  1YRN B;  3HG9 A;  1FYM A;  4AM3 A;  4R79 A;  2K86 A;  3CUQ A;  1MDM A;  1FC3 A;  1D1B A;  1WJC A;  1X1B A;  3LFU A;  1OYW A;  3FXQ A;  2TDX A;  2RN7 A;  2JVG A;  3FK6 A;  2JSP A;  3K4K A;  2VT2 A;  3M9A A;  3FMS A;  4MEX F;  2JMW A;  5GPA A;  1XGO A;  3ESW B;  1M1E B;  1XSX A;  3K1N A;  1L3L A;  3JRE A;  4L5E A;  4M9S A;  2GOM A;  2P7C B;  1XCV A;  3CDI A;  3ZGK A;  3DKW A;  4BY7 J;  2JRT A;  4FIS A;  5LD2 C;  5J4Y A;  3IKV A;  3WTZ A;  5DS9 A;  2OTJ I;  1VQ9 I;  3S15 J;  1A36 A;  4WF2 A;  1UZC A;  1CF7 A;  2VI6 A;  3LSM A;  1VQ5 I;  4HX8 A;  2ZJR F;  1YI2 I;  1D8J A;  3FMR A;  4MQ9 F;  3X2Q H;  1Y1V J;  1J2X A;  5FKK A;  3HOV J;  3FHZ A;  2VQL A;  4MFD A;  1V4R A;  1XX5 A;  3U1D A;  2CGP A;  1JKR C;  3FXO A;  2Y0S A;  3MKL A;  4H0E A;  2QSF X;  2NRA C;  2L9N A;  2VUM J;  1RRJ A;  2RC4 A;  3FF5 A;  5KAF C;  2E60 A;  2UZK A;  1A35 A;  2DO7 A;  2TCT A;  3SQN A;  1UJ8 A;  2A5Y B;  1YJN I;  5HNF A;  1FMW A;  1KZH A;  5TJJ A;  1LFB A;  2HDW A;  4WXC A;  4G12 A;  2HVR A;  5AON A;  4A12 A;  1AHD P;  4L9T A;  1Y8R B;  3KZY A;  1QPM A;  4QPO A;  3GTO J;  3ABL H;  3P9K A;  3ZPL A;  2ELH A;  4M72 A;  1V5F A;  4M3F A;  2ICW G;  1LPQ A;  4YRV A;  3Q0W A;  4N9H A;  3GYH X;  4IF4 A;  1BR2 A;  4QPQ A;  3HUG B;  3MEX A;  3Q9S A;  4M3B A;  5CPR B;  2FJ1 A;  1KQ0 A;  2RKH A;  4QIW N;  3S1M J;  4OIP F;  3IWZ A;  1IGN A;  5L3C A;  2WY7 Q;  4MO7 A;  2HR3 A;  2ZNY A;  3ROU A;  3MKZ A;  4E6K G;  3KZZ A;  2I10 A;  1IW7 F;  1Y6I A;  2VQG A;  3KP6 A;  1QVT A;  1KYW A;  3H1C A;  2BE5 F;  1U3E M;  4WK8 F;  2RNJ A;  5J8C A;  4ZYD A;  3GTG J;  4LB5 A;  4JOM A;  1ZTR A;  1WHU A;  4E7L A;  3GUD A;  1OYI A;  3HRS A;  1ACI A;  3IRR A;  3V4G A;  5ICE A;  3OOP A;  3F9K A;  3TMO A;  1F43 A;  3LSK A;  2G7H A;  5CJ9 A;  4XNF A;  2HQ5 A;  3L1P A;  3M3Y J;  5L3B A;  2STW A;  2UXN A;  4L9N A;  2R7Q A;  4Y33 A;  1MND A;  2HYF A;  3DTK A;  4BBR J;  4LGW A;  1G3S A;  2LDU A;  3JRA A;  1EKE A;  2DA7 A;  4X0G A;  4XOP A;  1UG0 A;  5D6E A;  5EGO B;  4ZH4 F;  2DFE A;  1PUE E;  5FRN A;  4XRS G;  2ECB A;  4UUT A;  1I27 A;  4XSZ F;  2MLG A;  2V26 A;  4BXU A;  2GA2 A;  2VXD A;  2P0T A;  5DUK A;  3QP6 A;  4PJM A;  3BCA A;  4HRI A;  1WJ5 A;  3GZN B;  2A61 A;  4CUG A;  4IX7 A;  3E5X A;  1E2X A;  3C7J A;  5IOZ A;  3JR9 A;  2XAS A;  1MGT A;  2HNH A;  4O6J A;  1SFU A;  2J5O A;  1I39 A;  2XSJ C;  1YIT I;  1RUN A;  3ZMV A;  1UCR A;  3HGG A;  4B3X A;  1Q1V A;  1TLH B;  2RQP A;  1QRY A;  1LFU P;  3BR0 A;  3PFI A;  1SD7 A;  3L2V A;  4PGG A;  2EFQ A;  3GX4 X;  1DGR M;  3A01 B;  3OYE A;  4KIT B;  2O7O A;  4O5V A;  1VQL I;  4UVC A;  2H1K A;  3K1P A;  3F8F A;  5JFR A;  3SEQ A;  2WV1 A;  1R7J A;  5CVU A;  2L02 A;  2BZT A;  1DPU A;  4GYI A;  5FRO A;  3K4L A;  2A6T A;  4G7O F;  1R23 A;  1U9O A;  2GM4 A;  4OIQ F;  1RES A;  2OQG A;  3LL7 A;  1O7L A;  3OWT A;  2K9L A;  5B5E C;  3NRV A;  2EZH A;  5BNG A;  4XRM A;  3L00 A;  2AHQ A;  4HQE A;  2ESN A;  2IEK A;  3GTJ J;  2EIK H;  5IPA A;  5L3G A;  2H27 A;  1MW7 A;  1UEL B;  3BC8 A;  3LQR A;  2KJB A;  2K9S A;  3AG1 H;  1LE8 A;  3DPT A;  2DYR H;  3H36 A;  2FA5 A;  4M3E A;  2X6Y A;  1YS6 A;  2CUZ A;  2M0C A;  4UXN A;  1N77 A;  3VWB A;  2F5F A;  3HYI A;  3JAM R;  4AC0 A;  3CDL A;  4KYW A;  4U0V A;  1P92 A;  2K4B A;  3Q3S A;  3IV5 A;  2MH2 A;  2E71 A;  2NNN A;  4KMU X;  2Y9Z A;  2NVX J;  3J81 R;  3C2H A;  3KYL A;  1FOY A;  2ZFW A;  3KE2 A;  4DYQ A;  5KAI C;  2WC2 A;  1IN6 A;  1EV7 A;  4AIJ A;  4RLQ A;  2CWE A;  2KMU A;  4U7D A;  3WOD F;  3OYA A;  2W1O A;  5E3O A;  1VQN I;  3OYM A;  1WCM J;  3BY6 A;  4IHV A;  2VOO A;  4IO9 F;  5DV5 A;  4RA2 A;  4E7K A;  1HDD C;  2XPV A;  2V79 A;  3HIF A;  4LIU A;  2O03 A;  2QYO A;  1IAW A;  3ULQ B;  4F91 B;  2FBI A;  1IRF A;  1JKQ C;  1VQK I;  1TWA J;  3I5U A;  2ELJ A;  3D5L A;  3S1N J;  2E1C A;  5FRM A;  3HSE A;  4YII A;  1XC5 A;  4I09 A;  4HYE A;  5LHG A;  2FF4 A;  2XGD A;  2D5V A;  5C4J J;  5BMZ A;  1OYY A;  4KUM A;  2LBF A;  5DM7 F;  2CW8 A;  2VOD A;  3OV8 A;  3MVP A;  2Q8K A;  2YUS A;  4FTH A;  2DCE A;  1I6X A;  1U5T A;  3QAH A;  4N4O B;  4XN0 A;  5E3N A;  4B8X A;  1IG7 A;  1MBH A;  3EUA A;  4S05 A;  2STT A;  4A0X A;  1LNW A;  3OYF A;  3LSG A;  1F1Z A;  1VF9 A;  4XON A;  4C3I J;  4MQV A;  2ZME A;  5B1B H;  1JI8 A;  1SAU A;  3OMY A;  4P9F A;  1DU6 A;  3WU1 B;  4RB0 A;  3D0S A;  2RV8 A;  3RPU A;  1YOV B;  5E17 F;  4XR6 A;  1VI0 A;  2E2I J;  3GTP J;  2EWN A;  4X1E A;  4XLF A;  1ZR4 A;  2W82 A;  2A68 F;  2ZXI A;  4GRI A;  1RKW A;  1W5S A;  2ETH A;  1OFC X;  2D1H A;  3A1Y A;  4CCL A;  2VE8 A;  1QA6 A;  3HOX J;  5KNL A;  1JUM A;  1X4P A;  2QF7 A;  2DMN A;  2OJE D;  3E1S A;  5FKO A;  4JX6 A;  3M07 A;  4NB5 A;  1BJZ A;  3D1N I;  2MH9 A;  4AYB A;  4XID A;  1G8X A;  1PDN C;  2NNY A;  1Z67 A;  3DQV C;  1WVR A;  3CCU I;  3ZMD A;  3AKZ A;  3OIQ A;  4ESJ A;  5IT9 Z;  3HUG A;  1MBJ A;  5JI6 A;  3BTJ A;  5E3M A;  3VOD A;  1POG A;  2ID6 A;  3RSN A;  4L18 B;  2WAQ N;  2CUJ A;  4UB8 C;  3SEZ A;  2PG4 A;  4UY8 I;  4BJT A;  2FMY A;  4IRI A;  3K0L A;  2FSW A;  2WAD A;  1ON1 A;  2IBD A;  1AA7 A;  1G2H A;  4DIQ A;  3DXJ F;  3GZ6 A;  3DEU A;  4D5C A;  2XAU A;  1O7F A;  3ZMS A;  5FFX A;  2ZSH B;  3K9T A;  2Y30 A;  4HZF A;  1FWZ A;  1IN8 A;  3S16 J;  1FJL A;  2YR2 A;  1JE8 A;  1WJB A;  3LSH A;  2CMP A;  2HOA A;  3M1C A;  1OCC H;  4XLE A;  2ZJ2 A;  1BJA A;  4YEJ A;  2CV0 A;  2FU4 A;  3S1Q J;  1QQI A;  4HBL A;  2BY0 A;  3TL4 X;  2XAQ A;  3CCL I;  2VE9 A;  1ZRC A;  5JVG F;  3I53 A;  1UHS A;  3VYR B;  2BHY A;  2KIU A;  1J75 A;  2HOT A;  1B8I A;  4UV8 A;  2HQN A;  1PUF A;  4H4K C;  4A6D A;  3FX3 A;  2RVC A;  1S9H A;  3RTR A;  1E17 A;  3OS1 A;  1K6Y A;  3RPU D;  1HOM A;  2DT5 A;  1UHM A;  1LQ1 A;  2W00 A;  4P9U A;  2XAJ A;  4HLX A;  2DFI A;  2HS5 A;  4PCQ A;  1BC8 C;  1G6N A;  1V3F A;  2LYC A;  5M5W J;  4IEJ A;  4EJW A;  1Y39 A;  3ML6 A;  4DJA A;  3O6B B;  4II3 A;  2HQR A;  4AWX B;  3FMQ A;  5D6F A;  3VSK A;  2KP6 A;  5CKT A;  3CJN A;  1Y8Q B;  4G7H F;  4CGZ A;  3E5Q A;  4A3L J;  3IH3 A;  4PSX A;  3LSR A;  3ECH A;  3LAP A;  3A01 A;  1R4M B;  3I71 A;  1IXC A;  1MH3 A;  2DJI A;  5GPC A;  3FBN B;  2KKO A;  4CCJ A;  1AU7 A;  3HEF A;  1T95 A;  2LRD A;  1VQ6 I;  3G1L A;  2WA0 A;  2F5C A;  4RAG A;  1YFH A;  2PMU A;  3BG7 A;  2ZB9 A;  4P5O A;  2GWR A;  3LQQ A;  2MC4 A;  2X48 A;  5H6R A;  3JAM Z;  4UNO A;  1S7E A;  2LG4 A;  2EV0 A;  2O6G E;  2ZJQ F;  4IZZ A;  1OKR A;  3VDX A;  2JA7 J;  1HKQ A;  4BDY A;  1FTT A;  2X6W A;  1XN7 A;  4BQA A;  2I8D A;  2EZI A;  1Y0U A;  1WJA A;  2W57 A;  3CCQ I;  1JGG A;  2M87 A;  4DZP A;  2PQ8 A;  5ED4 A;  3OYH A;  4BDZ A;  2HDC A;  3V42 A;  2HXI A;  2V4J C;  1K6O A;  4Y7N J;  4MEY F;  3CES A;  3TQN A;  1R49 A;  2WAE A;  1MBE A;  3WTW C;  4Q48 A;  2GBY A;  3S2H J;  1FP2 A;  2KRC A;  1ETV A;  2F6C A;  2EFP A;  3CMM A;  5DCM B;  3CMA I;  3LMM A;  3NAU A;  4ZZL A;  1C0W A;  2A6H F;  3U2R A;  1YHQ I;  2KZV A;  3J80 K;  3K70 D;  2A07 F;  2OC6 A;  3PFY A;  4JQF A;  4MFE A;  2VLA A;  4IRG A;  4A5M A;  1OCO H;  2CV1 A;  4FCY A;  2Y9Y A;  5D8L B;  2FUG 2;  1I1G A;  1P2F A;  2M8G X;  4II2 A;  3GLL A;  4KN4 X;  1WJE A;  4RGU A;  1ZGJ A;  2LF8 A;  2L9R A;  3HSR A;  3HB9 A;  1Z77 A;  3N4M A;  5D5W B;  3CJT B;  5HNH A;  5EZH A;  2E34 A;  1YW7 A;  4ABZ A;  2EV6 A;  1GHC A;  1D0X A;  1JTY A;  2QQ9 A;  3U21 A;  2GAU A;  1B4A A;  4HV6 A;  2QA4 I;  5DDG A;  2ZSI B;  2BY1 A;  5GAE J;  5J6X A;  2CV2 A;  2LP0 A;  2V1X A;  3IC7 A;  1YJ9 I;  3PUF A;  2JA5 J;  5IYB J;  5FLM J;  2VOP A;  1FP1 D;  3NWS A;  5DTD A;  5HS8 A;  5K7H A;  3AAF A;  3LNQ A;  1YX3 A;  1MSE C;  2EFW A;  2OAZ A;  2HPM A;  2CUE A;  2KRF A;  1UST A;  2K27 A;  3TW6 A;  1T0F C;  2LBF B;  4EGZ A;  2W84 A;  1E3P A;  5HDK A;  5L3E A;  3CCE I;  3WU0 A;  4MIM A;  1OJL A;  4BXX J;  1U5T B;  1YG2 A;  4FET A;  1DGW Y;  2H94 A;  3MWM A;  1ETX A;  5CVJ A;  5DD8 A;  2ZME B;  2L9S A;  2LKX A;  1BI1 A;  3LAJ A;  4YIF A;  4E4H A;  3MZH A;  3OL3 A;  3WHB A;  3HPH A;  2GXB A;  3NEU A;  1ETW A;  3A0B C;  1MBG A;  3EUK L;  2Y2Z A;  1QNT A;  2V7F A;  2MSY A;  4AVZ A;  2IGN A;  5KK1 A;  4XOR A;  4BJ5 C;  2DPD A;  3L7W A;  1WRJ A;  2D45 A;  3FIW A;  2IGM A;  1JT6 A;  4UUS A;  3EUH C;  2ZME C;  3QOE A;  5EZG A;  2KIQ A;  2WTE A;  3F6O A;  2ZFU A;  3FXR A;  3ZQF A;  1SFX A;  5CVV A;  1ENH A;  4RGS A;  2IS1 A;  4ENN A;  2V6E A;  3QP5 A;  2DW4 A;  3P5J A;  3BLY A;  1MNM C;  4CXF A;  2DLL A;  4FT8 A;  3JRF A;  3H9G A;  3ZQC A;  4C2U A;  2E2H J;  2CFO A;  2MGQ A;  4RAF A;  1VZ0 A;  4IHY A;  4BHB A;  4NC8 A;  2XAG A;  1TQP A;  1VQ4 I;  1R36 A;  1SD6 A;  2O9L A;  4M6Y A;  5DM6 F;  3DKY A;  3ZQH A;  4DGW B;  2QQB A;  1TZL A;  3W2W A;  4W1U A;  2BHZ A;  1LKX A;  2K4J A;  2XB5 A;  3DP7 A;  1DQU A;  3BZ6 A;  4FE7 A;  2DFH A;  5K5O A;  1HF0 A;  1G59 A;  5F64 A;  4V19 K;  2FX0 A;  2X0L A;  2H6C A;  2M1B A;  5ILV A;  2VJJ A;  4C2T A;  1U6G A;  4FX0 A;  4KIF A;  3BZC A;  2NVU B;  2HU9 A;  3SDB A;  3OYJ A;  2O5R A;  2R4G A;  5DYM A;  2KZG A;  1D1C A;  2FML A;  2ZJP F;  3HJE A;  1DP3 A;  2O0Y A;  1JTX A;  5HS9 A;  2OTL I;  2FOK A;  1ZN2 A;  2NS0 A;  1B8I B;  3LSI A;  3GFM A;  1F9N A;  1MIJ A;  2DOF A;  3KET A;  1PUF B;  1U9N A;  3UKG A;  5C4X J;  3G73 A;  4OIO F;  1NG6 A;  4QTR A;  1FMV A;  2A6E F;  2R93 J;  3LST A;  2BEO A;  3WGG A;  5J8F A;  1MH4 A;  1O3R A;  1FT9 A;  3RKX A;  1ULY A;  3VYS B;  3GME A;  3RKQ A;  5HOO A;  1HW2 A;  1OLT A;  4LIT A;  5H20 A;  3LWF A;  2R7S A;  1YE9 A;  4FHT A;  4BL0 B;  2P5K A;  1E3O C;  2AS5 F;  4Y4R A;  3WG7 H;  1TWH J;  4EJT A;  3KIO A;  1R5G A;  1ZHF A;  3SZG A;  1USS A;  3OYI A;  2MG4 A;  3A0H C;  1N75 A;  3U9G A;  2CUF A;  3FXL A;  3A4C A;  3ABM H;  3A52 A;  2DA2 A;  3C1D A;  3P9I A;  3RYR A;  1R1T A;  3HC7 A;  1FIA A;  5IT9 K;  2KDO A;  4LJZ F;  3F23 A;  2E19 A;  1TP4 A;  5IT3 A;  1WQ2 A;  4RLF A;  5ILS A;  5IP9 J;  3OY9 A;  2BOL A;  4N4N B;  3HHG A;  5J4V A;  4IQJ A;  3KP3 A;  1X58 A;  5BOX A;  1IO2 A;  4ANJ A;  2XGE A;  2KFD A;  3H3U A;  5E1W A;  2VL8 A;  4A3M J;  3VEP A;  3C3W A;  3SYT A;  3REO A;  2PI0 A;  2W48 A;  3K2A A;  1B6A A;  1KGS A;  2Z3Y A;  3K70 C;  4ZJZ A;  2VQC A;  4OIR F;  5J3L A;  3J80 R;  3HKZ N;  2DOE A;  3F0C A;  2QUF A;  3T5X A;  1OMI A;  2QGU A;  2JRM A;  2XGX A;  5DEQ A;  3R0A A;  2CG4 A;  2JA6 J;  4A3G J;  5IOY A;  3J7A W;  3OR2 C;  3S3N A;  4IHT A;  2RGV A;  3PUB A;  2E5Z A;  5DCM A;  1T6S A;  4LB6 B;  3L2Q A;  1HBX G;  5IYC J;  2Y75 A;  2F48 A;  1ETK A;  2NS7 A;  3IHU A;  3KP7 A;  5FFZ A;  3H0D A;  4HF2 A;  1FBU A;  5CVR A;  4BGD A;  2PBI A;  3L2C A;  5FO5 A;  2CO5 A;  3BG3 A;  2CJJ A;  3DTE A;  1LEA A;  5J1R A;  2IT0 A;  3GVA A;  3DKX A;  4WX9 A;  4BUP A;  5HLG A;  1TNS A;  5ERI A;  2QKM B;  3B6C A;  4BE2 A;  5LEJ A;  2AXL A;  3M1E A;  2W4S A;  3M7G A;  4GDF A;  2DN0 A;  3I59 A;  2NVY J;  1KU9 A;  3HOZ J;  2BXY A;  2FE3 A;  3EET A;  1Z3X A;  2BV6 A;  2OF7 A;  4JP0 A;  1MNE A;  3GBG A;  1N25 A;  1S5L C;  2MD0 A;  4YFX F;  4A3E J;  1RC9 A;  3HDD A;  1ZH5 A;  3FXK A;  1W7P B;  2HOE A;  1BBY A;  4HG2 A;  1SMY F;  1G3W A;  1S7O A;  2HI3 A;  2HTS A;  4EVI A;  2M0M A;  1TW2 A;  4EJO A;  4EGY A;  3FKJ A;  4O3M A;  2DDA A;  3OIO A;  2UUZ A;  4YIR X;  3ISP A;  2IA2 A;  2R7T A;  4UB6 C;  1R5I D;  4DQ2 A;  1O3T A;  2ECC A;  1YO5 C;  1MSF C;  3CO6 C;  5HDG A;  3KCC A;  4IOA F;  3CCS I;  5LHI A;  1WKM A;  3NWT A;  3JAM K;  1HC8 A;  1V5E A;  4FX4 A;  2VBW A;  5L3D A;  2XB0 X;  4Z6Y A;  3F72 A;  2HEO A;  1G3T A;  1Q1H A;  2DA6 A;  4CYC A;  3SZT A;  4E70 A;  1JGS A;  4HOB A;  3ZOB A;  1ZRF A;  5HDN A;  3EYY A;  2FEZ A;  2NAZ A;  1BIA A;  2VAS A;  1OCZ H;  2AQF A;  2F4O B;  3IH2 A;  5GAG J;  4HNV A;  5J47 A;  2R7D A;  4GGG A;  3RI4 A;  2GA1 A;  3GFL A;  2I5U A;  3HRM A;  4UUS B;  2B7E A;  2JUC A;  5LGU A;  1XSD A;  2IGK A;  1J0R A;  3PL8 A;  2NXN B;  3JCU C;  1WWX A;  3DWL E;  3NQO A;  2EA4 A;  1OR7 A;  2CQQ A;  4KJZ A;  4RS8 A;  2VJ4 A;  4G7Z F;  1RIO H;  1STZ A;  2DU9 A;  2ESH A;  3O2P E;  4BJ6 C;  2HZD A;  4EV0 A;  2OU2 A;  2CQX A;  2R92 J;  1H9G A;  5FJ8 J;  1JKP C;  4N9I A;  1ZG3 A;  4S0H B;  3ZQL A;  1T0F A;  3OSG A;  5LBQ A; 
#chains in the Genus database with same CATH homology
 4AD9 A;  4XSX F;  4RB2 C;  3H92 A;  1IXR C;  2VN2 A;  5D4S A;  4CYD A;  4U88 A;  4KIC A;  1YYV A;  1S3J A;  1U8R A;  4RGR A;  2Z33 A;  2J5P A;  3WE3 A;  4A5N A;  1KU2 A;  4M9X A;  5D8K B;  4Q5S F;  5A2Q Z;  3RPQ A;  3E6D A;  1D8K A;  3QPT A;  4LFU A;  4PGH A;  3MFK A;  2ADU A;  4WXH A;  2UXX A;  2EK5 A;  3LA7 A;  1TQI A;  4P96 A;  5E18 F;  1O3S A;  2MLK A;  4ZYH A;  2COM A;  3DV8 A;  3F8M A;  3J81 K;  1W7P D;  4OMY A;  1BC7 C;  3RKW A;  2DPU A;  4BH9 A;  1BI2 A;  3LFK A;  3FM5 A;  1IZ1 A;  4F7Z A;  5FLX Z;  4EM0 B;  2KIF A;  3ABU A;  1R00 A;  4CO8 A;  5LGN A;  5TRD A;  2CW0 F;  4Q47 A;  3FZV A;  3QOP A;  4ZYE A;  2FXA A;  4BHC A;  3BJA A;  3SZP A;  1KU7 A;  1W5T A;  3BRO A;  1I5Z A;  4CZZ A;  2QWW A;  3MCZ A;  4ETS A;  1UFM A;  3GLX A;  1S29 A;  3F8N A;  1IUY A;  1YTY A;  4IVN A;  1B9M A;  2JSC A;  3T0Y A;  1ZGA A;  4HW0 A;  3RIR A;  4OMZ A;  4Y17 A;  4XBF A;  3E5U A;  2P6S A;  2MBF A;  2PN6 A;  3CTA A;  2EV5 A;  3Q5F A;  4ASN A;  2UWM A;  3IWF A;  1UHW A;  1KQ9 A;  5K5Q A;  3WTU C;  4GYG A;  5JHU A;  5BPD A;  3I59 B;  2WV0 A;  1FNN A;  1RUO A;  3VB2 A;  1IN4 A;  2Z5U A;  2H09 A;  3E6C C;  1SD5 A;  2ZCW A;  1W7P A;  3E6B A;  2ISZ A;  4BYY A;  3PQK A;  2EFN A;  4HDV A;  3B73 A;  3ZP5 A;  5BS6 A;  2H6B A;  4HAM A;  5E1Z B;  5F1R A;  3HOS A;  3GFJ A;  1AOY A;  4I01 A;  1IXS B;  3F8B A;  3I4P A;  3V7C A;  2OA4 A;  2HKX A;  3F21 A;  2P5L C;  2DK5 A;  3FXU A;  2B0L A;  1Z7U A;  2A3S A;  2E7X A;  3M8F A;  4I02 A;  1IN5 A;  4UHT A;  4OOI A;  2K7L A;  4ESB A;  1P4W A;  1FZP B;  1QGP A;  3VOE A;  1KA8 A;  2V6C A;  4HF0 A;  3CUO A;  1LDK B;  4LK0 F;  4OU0 A;  3QU6 A;  1BOA A;  2EA2 A;  2LF7 A;  3CO7 C;  3LA3 A;  1XGM A;  4CHU A;  4B09 A;  2IA0 A;  2D2W A;  3WTS C;  2XUB A;  3BDD A;  4A0Z A;  3BWG A;  4LLN A;  2FNA A;  2EJR A;  1S8N A;  1FBS A;  4BAY A;  2F2E A;  1SD4 A;  3ZMU A;  2Y0M A;  3M8E A;  2ISY A;  2IW5 A;  3BPX A;  4GCV A;  3TDU C;  2VBY A;  1IN7 A;  2ZO4 A;  1U5T C;  4MGR A;  3GZ5 A;  3G3Z A;  4A2U A;  4ON0 A;  3ZN1 A;  3E3V A;  3TKY A;  1B59 A;  2NYX A;  2JT1 A;  2HWV A;  4IJA A;  4ESF A;  1QBJ A;  4KA4 A;  2FQ3 A;  4U0W A;  2ZNZ A;  1YS7 A;  5FD5 A;  2E7W A;  3T1B A;  1XDS A;  1YW8 A;  4LLG F;  1ZG5 A;  3R60 A;  4AVP A;  5HLH A;  1MZB A;  4K2E A;  3RJP A;  1ZRD A;  1ODD A;  1ZAR A;  1FSE A;  3V8J A;  4XRF A;  3I64 A;  2BBY A;  3L09 A;  1P4A A;  2LSO A;  1U78 A;  2OQR A;  2L54 A;  5HLI A;  3QU3 A;  2V1D A;  3WGH A;  3K69 A;  1L0O C;  1HXD A;  3DFG A;  1FOK A;  4CDG A;  4ENM A;  5FGM A;  3R0J A;  3GFI A;  1T98 A;  3KLN A;  2R7F A;  4AIK A;  5HS7 A;  1JHH A;  1HKT A;  5D5V B;  2W85 A;  2CYY A;  3R6S A;  5BPI A;  4HDU A;  2FRH A;  4UUV A;  1FPQ A;  3CDH A;  4LD5 A;  3ZN0 A;  2ACJ A;  5K5R A;  4M71 A;  2JTV A;  1XGN A;  4M6X A;  1GXQ A;  1LEB A;  2XRN A;  4HF1 A;  1FBQ A;  1PP8 F;  5DCF A;  2GXG A;  3V7S A;  1RZ4 A;  2VBZ A;  1QZZ A;  5D4R A;  1K7A A;  4YFN F;  1GVJ A;  3IKT A;  2FBH A;  5EEH A;  4MNU A;  1S7A A;  4U7B A;  4GXO A;  4QLC U;  3QPH A;  2ZKZ A;  1HW1 A;  2XRO A;  1XGS A;  1PP7 U;  4IXA A;  2PJP A;  2HFH A;  2G9W A;  4EM2 A;  1FLI A;  4RAZ A;  4D0P A;  1H9T A;  5LRR A;  2CFX A;  1A04 A;  3HTS B;  1G4D A;  2E1N A;  1DP7 P;  3HHH A;  5H6Q A;  2QQA A;  5LRS A;  3V8K A;  1HSJ A;  4KN7 X;  1YIO A;  3SHF A;  1B9N A;  5KVR A;  4A0Y A;  3TO7 A;  3GEZ A;  1CGP A;  3V8L A;  3W6J B;  1REP C;  2MD5 A;  5HVQ C;  3KEO A;  2GQQ A;  4Q4Z F;  1SFE A;  1JHF A;  3WG9 A;  1XDU A;  2P4W A;  1MJA A;  4EQQ A;  2VC1 A;  5ILU A;  3HRU A;  1EH7 A;  5CVI A;  2LKP A;  4S04 A;  2FNP A;  3BP8 A;  4BHP A;  3J7A O;  1HW5 A;  2KJC A;  1ON2 A;  3MQ0 A;  3K1M A;  1S6L A;  1TBX A;  2W24 A;  4KDP A;  1XD7 A;  3GF2 A;  3JSP A;  3TDZ C;  3QRF F;  1LDJ A;  2M8E A;  2Z9O A;  1Z05 A;  2L01 A;  2C6Y A;  3S2W A;  4R1H A;  4LMY A;  4JBA A;  1FX7 A;  5D5X B;  4L5I A;  4HQM A;  4MTE A;  4HX4 A;  3F22 A;  3SXY A;  3EQL F;  2DQR A;  6PAX A;  2QBY B;  4L0Z B;  4LLL A;  1I1S A;  5ICG A;  2DBB A;  1ZRE A;  3GW2 A;  2JPB A;  1D5V A;  3CLO A;  4L9J A;  1HST A;  4RGX A;  3T8R A;  1GXP A;  4M74 A;  4GO1 A;  3CUQ C;  1Z1D A;  3VFZ A;  2MA3 A;  4QWQ A;  3FM3 A;  4MTD A;  3V7R A;  3EDP A;  1SMT A;  1R1U A;  4IPA A;  1LDD A;  3H3Z A;  5LHH A;  3L9F A;  3MZY A;  1K79 A;  3KP4 A;  1ZAO A;  5FD6 A;  4I98 B;  2DAO A;  2JZY A;  1BI3 A;  3RDI A;  1NHA A;  4Z2Y A;  1O3Q A;  4A6E A;  2EB7 A;  1ONV A;  2Q2E A;  3O3K A;  4G6D A;  2YX7 A;  2BYV E;  3GWZ A;  4WCG A;  3Q9V A;  1QZY A;  1U2W A;  2A69 F;  4ZZD A;  3HOT A;  3WTX C;  3TO6 A;  2DK8 A;  1FSH A;  1XB4 A;  4M73 A;  3KFW X;  4PDK A;  4ZYG A;  2YU3 A;  1LJ9 A;  1KYZ A;  3I58 A;  4WWC A;  4YFK F;  2LNB A;  1F4K A;  2X4H A;  4N0B A;  1ZYR F;  2P5V A;  2L4M A;  2IP2 A;  4MHG A;  2PEX A;  4KIG A;  4EJU A;  2G7U A;  2HZT A;  4PZJ A;  3GXO A;  1OPC A;  4KNY A;  2V1U A;  3HRT A;  3ERE D;  2RDP A;  3P9C A;  3E6M A;  2L4A A;  2EFO A;  2P7V B;  4I0A A;  1SAX A;  5L3F A;  3K2Z A;  2IPQ X;  2K02 A;  2QLZ A;  3ZMZ A;  2MC3 A;  5DD4 A;  2CSO A;  3KLO A;  2ZXJ A;  3EUH A;  4P55 A;  1J7K A;  1ZG1 A;  1BI0 A;  1B1B A;  3TGN A;  1T39 A;  2VXZ A;  1YLF A;  5LEK A;  4Y13 A;  2GZW A;  1UB9 A;  5E8I A;  1KU3 A;  3DPL C;  1XMK A;  5CYV A;  5E8G A;  2M30 A;  2XAH A;  5A2Q K;  1R1V A;  1T2K A;  2PLY A;  2VON A;  4AIH A;  2OBP A;  3RYP A;  2L3D A;  4XLP F;  3I54 A;  4I0B A;  2YPR A;  4EM1 A;  3IL2 A;  3KEQ A;  2YX4 A;  4UV9 A;  1XCB A;  3F8C A;  2VT3 A;  1W4M A;  3JW4 A;  1BM9 A;  4NQW A;  1BIB A;  1MD0 A;  2O8X A;  2QM3 A;  1P4X A;  3N97 A;  1EH6 A;  2CQK A;  2XAF A;  5ICC A;  3COA C;  1VTN C;  4ENK A;  4RAY A;  2QBY A;  4LG0 B;  1TQM A;  4G6Q A;  2VBX A;  2M45 A;  2M5W A;  1R5H A;  4I7H A;  1Z6R A;  4KIB A;  5E20 A;  4RB1 A;  1FYL A;  1P6R A;  2R3S A;  1KQ8 A;  3DF8 A;  4G8X A;  4M9Z A;  1K78 B;  2XHK A;  2VC0 A;  4YG2 F;  4KT5 C;  3J80 Z;  1EH8 A;  3WTY C;  4L5J A;  1Z9C A;  2O3F A;  1TTY A;  2WWY A;  1TNT A;  3BPV A;  3P7N A;  2OD5 A;  2GIV A;  2XIG A;  1MJB A;  1AWC A;  3E97 A;  2QVO A;  3SFZ A;  2IJL A;  1O57 A;  1HQC A;  2PMH A;  2W25 A;  2JPC A;  3F3X A;  3TO9 A;  1QO0 D;  1ZLK A;  2F5D A;  4XLN F;  5AIP A;  3CUQ B;  1MDM B;  4LK1 F;  5BQT A;  2XKP A;  4EMS A;  5JR3 A;  4EJV A;  3JSO A;  4RB3 C;  2HGC A;  1DDN A;  5AIQ A;  4IRH A;  1WSU A;  4NHJ A;  4UVA A;  5D5U B;  5LGT A;  2HKO A;  3WTV C;  1X3U A;  3B02 A;  2F5E A;  2DI3 A;  1R58 A;  5JVT A;  1CF7 B;  2P6T A;  1LB2 A;  2Z99 A;  3F6V A;  4HV5 A;  1D3Y A;  1MKM A;  3W6K B;  5LLQ A;  1ZLJ A;  3J81 Z;  2ZBK A;  1IRG A;  4G94 A;  5CLS A;  3TOB A;  4HA8 A;  3ELK A;  3IRQ A;  2D1V A;  1J9I A;  2O61 A;  2IA1 A;  3ABT A;  4WXD A;  2YSR A;  3BJ6 A;  2OZ6 A;  1FYK A;  5FLX K;  3BOQ A;  1YW9 A;  2Y48 A;  2V9V A;  2PFB A;  3HSF A;  4HLY A;  5F6F A;  1XSV A;  1R22 A;  1J5Y A;  1TW3 A;  4IHS A;  1BN5 A;  2IVM A;  2OZU A;  2XVC A;  4U0Y A;  2Q0O A;  5EEG A;  2HTJ A;  2HYG D;  3MAJ A;  3ZMT A;  2BGC A;  2KIM A;  3KP5 A;  1Z91 A;  1H0M A;  3R61 A;  4UVB A;  1T38 A;  1Z6T A;  1F5T A;  3I0T A;  1HKS A;  1XMA A;  4G9Y A;  2QZ8 A;  1LVA A;  4ENJ A;  3HTU A;  3RKY A;  1FY7 A;  5FB2 A;  2XKO A;  3ZQ7 A;  3TOA A;  3WE2 A;  2QEN A;  3LA2 A;  4KFC A;  4HX7 A;  2P8T A;  4L0Y B;  4TV7 A;  3PQJ A;  2FBK A;  5K1Y A;  5E1X A;  3ECO A;  1MJ9 A;  1G3Y A;  1DUX C;  4LG0 A;  4KMF A;  1DPR A;  5ICF A;  4Y15 A;  4I2O A;  1RI7 A;  3C18 A;  3KP2 A;  1YQA A;  1JXS A;  3JTG A;  4CIC A;  3WGI A;  4OIN F;  3GO5 A;  1K78 A;  1IF1 A;  2IRF G;  3T8T A;  4L9V A;  4JK1 X;  1RNL A;  2DTR A;  1WI9 A;  5DUI A;  3JTH A;  3WTT C;  2DQL A;  3EYI A;  4DNC A;  3R4K A;  1J59 A;  2XV4 S;  3FWE A;  4R8H A;  4BNC A;  3BJO A;  1FYM A;  4R79 A;  2K86 A;  3CUQ A;  1MDM A;  1FC3 A;  1OYW A;  3FXQ A;  2TDX A;  2RN7 A;  3M9A A;  2VT2 A;  4MEX F;  3FMS A;  1XGO A;  1XSX A;  3K1N A;  1L3L A;  4M9S A;  2P7C B;  1XCV A;  3DKW A;  2JRT A;  3IKV A;  3WTZ A;  4WF2 A;  1CF7 A;  4HX8 A;  1D8J A;  3FMR A;  4MQ9 F;  1J2X A;  3FHZ A;  1V4R A;  3U1D A;  2CGP A;  4H0E A;  2NRA C;  2RC4 A;  3FF5 A;  2UZK A;  2DO7 A;  3SQN A;  2A5Y B;  5TJJ A;  4WXC A;  5AON A;  4A12 A;  4L9T A;  3KZY A;  1QPM A;  3P9K A;  3ZPL A;  2ELH A;  4M72 A;  4N9H A;  3GYH X;  4IF4 A;  3MEX A;  3Q9S A;  1KQ0 A;  2RKH A;  4OIP F;  3IWZ A;  5L3C A;  2HR3 A;  2ZNY A;  3ROU A;  3KZZ A;  1IW7 F;  3KP6 A;  1KYW A;  2BE5 F;  1U3E M;  4WK8 F;  2RNJ A;  5J8C A;  4ZYD A;  4LB5 A;  3GUD A;  1OYI A;  3HRS A;  3IRR A;  3V4G A;  5ICE A;  3OOP A;  2G7H A;  5CJ9 A;  2STW A;  5L3B A;  2UXN A;  4L9N A;  2HYF A;  4LGW A;  1G3S A;  2LDU A;  5D6E A;  4ZH4 F;  1PUE E;  1I27 A;  4XSZ F;  2MLG A;  4BXU A;  2GA2 A;  5DUK A;  3QP6 A;  2A61 A;  3E5X A;  1E2X A;  3C7J A;  2XAS A;  1MGT A;  1SFU A;  4O6J A;  2J5O A;  1RUN A;  3ZMV A;  1UCR A;  1TLH B;  2RQP A;  3PFI A;  1SD7 A;  4PGG A;  2EFQ A;  3GX4 X;  4O5V A;  4UVC A;  3K1P A;  3F8F A;  5JFR A;  1R7J A;  5CVU A;  2L02 A;  1DPU A;  4GYI A;  4G7O F;  1R23 A;  4OIQ F;  2OQG A;  1O7L A;  3NRV A;  3L00 A;  4HQE A;  2ESN A;  5L3G A;  2H27 A;  3LQR A;  2KJB A;  3DPT A;  2FA5 A;  1YS6 A;  4UXN A;  2F5F A;  3HYI A;  4KYW A;  4U0V A;  1P92 A;  2K4B A;  2MH2 A;  2NNN A;  4KMU X;  2ZFW A;  3KE2 A;  2WC2 A;  1IN6 A;  1EV7 A;  4AIJ A;  2CWE A;  4U7D A;  3WOD F;  3BY6 A;  2VOO A;  5DV5 A;  2V79 A;  3HIF A;  2O03 A;  2QYO A;  1IAW A;  3ULQ B;  2FBI A;  1IRF A;  3I5U A;  3D5L A;  2E1C A;  3HSE A;  4YII A;  4I09 A;  5LHG A;  4HYE A;  2FF4 A;  5BMZ A;  1OYY A;  4KUM A;  2VOD A;  3OV8 A;  2Q8K A;  1I6X A;  1U5T A;  3QAH A;  4B8X A;  4S05 A;  2STT A;  4A0X A;  1LNW A;  1F1Z A;  4MQV A;  2ZME A;  4P9F A;  3WU1 B;  4RB0 A;  3D0S A;  2RV8 A;  3RPU A;  5E17 F;  2EWN A;  2A68 F;  1W5S A;  2ETH A;  2D1H A;  2VE8 A;  4NB5 A;  2MH9 A;  1PDN C;  2NNY A;  3DQV C;  3ZMD A;  4ESJ A;  5IT9 Z;  3HUG A;  5JI6 A;  3VOD A;  4L18 B;  2PG4 A;  2FMY A;  4IRI A;  3K0L A;  2FSW A;  1ON1 A;  3DXJ F;  3GZ6 A;  3DEU A;  1O7F A;  3ZMS A;  5FFX A;  3K9T A;  4HZF A;  1FWZ A;  1IN8 A;  2YR2 A;  1JE8 A;  2ZJ2 A;  1BJA A;  2FU4 A;  1QQI A;  4HBL A;  2XAQ A;  2VE9 A;  1ZRC A;  3I53 A;  2KIU A;  1J75 A;  4UV8 A;  2HQN A;  4A6D A;  3FX3 A;  2RVC A;  3RTR A;  1E17 A;  2DT5 A;  1UHM A;  1LQ1 A;  4P9U A;  2XAJ A;  4HLX A;  2DFI A;  2HS5 A;  4PCQ A;  1BC8 C;  1G6N A;  1V3F A;  4EJW A;  3ML6 A;  3O6B B;  2HQR A;  4AWX B;  3FMQ A;  5D6F A;  3CJN A;  4G7H F;  4CGZ A;  3E5Q A;  3ECH A;  3LAP A;  3I71 A;  1IXC A;  2KKO A;  2F5C A;  1YFH A;  2PMU A;  4P5O A;  2GWR A;  3LQQ A;  5H6R A;  3JAM Z;  4UNO A;  2EV0 A;  2O6G E;  1OKR A;  1HKQ A;  4BQA A;  1XN7 A;  1Y0U A;  2W57 A;  2M87 A;  2PQ8 A;  5ED4 A;  2HDC A;  1K6O A;  4MEY F;  3TQN A;  3WTW C;  4Q48 A;  1FP2 A;  2EFP A;  5DCM B;  1C0W A;  4ZZL A;  2A6H F;  3U2R A;  3J80 K;  2A07 F;  4JQF A;  4IRG A;  4A5M A;  5D8L B;  1I1G A;  1P2F A;  4KN4 X;  3N4M A;  4RGU A;  1ZGJ A;  2LF8 A;  3HSR A;  5D5W B;  1YW7 A;  2EV6 A;  1GHC A;  2QQ9 A;  2GAU A;  1B4A A;  4HV6 A;  5DDG A;  5J6X A;  2V1X A;  3IC7 A;  2VOP A;  1FP1 D;  3AAF A;  5HS8 A;  2EFW A;  2OAZ A;  2KRF A;  1UST A;  2K27 A;  4EGZ A;  2W84 A;  5HDK A;  5L3E A;  3WU0 A;  1U5T B;  1YG2 A;  2H94 A;  3MWM A;  5CVJ A;  5DD8 A;  2ZME B;  1BI1 A;  3LAJ A;  4YIF A;  3MZH A;  2GXB A;  3NEU A;  1QNT A;  5KK1 A;  2DPD A;  3L7W A;  1WRJ A;  2D45 A;  2WTE A;  3F6O A;  3FXR A;  1SFX A;  5CVV A;  4RGS A;  4ENN A;  3QP5 A;  2DW4 A;  4CXF A;  2DLL A;  4FT8 A;  4BHB A;  2XAG A;  1TQP A;  1R36 A;  1SD6 A;  4M6Y A;  2QQB A;  2K4J A;  3DP7 A;  3BZ6 A;  5K5O A;  5F64 A;  2X0L A;  2H6C A;  2M1B A;  5ILV A;  1U6G A;  4FX0 A;  4KIF A;  5DYM A;  2FML A;  2O0Y A;  5HS9 A;  2FOK A;  1ZN2 A;  2NS0 A;  3GFM A;  1F9N A;  3KET A;  3G73 A;  4OIO F;  2A6E F;  3LST A;  2BEO A;  3WGG A;  5J8F A;  1O3R A;  1FT9 A;  3RKX A;  1ULY A;  5HOO A;  1HW2 A;  5H20 A;  3LWF A;  4FHT A;  2P5K A;  2AS5 F;  4EJT A;  1R5G A;  1ZHF A;  1USS A;  3U9G A;  3C1D A;  3P9I A;  3RYR A;  1R1T A;  5IT9 K;  4LJZ F;  3F23 A;  5IT3 A;  1WQ2 A;  5ILS A;  3HHG A;  3KP3 A;  5BOX A;  3H3U A;  5E1W A;  3VEP A;  3C3W A;  3REO A;  2PI0 A;  1B6A A;  1KGS A;  2Z3Y A;  4OIR F;  2QUF A;  3T5X A;  1OMI A;  5DEQ A;  2XGX A;  3R0A A;  2CG4 A;  4IHT A;  2RGV A;  5DCM A;  1T6S A;  4LB6 B;  1HBX G;  2Y75 A;  3IHU A;  5FFZ A;  3KP7 A;  4HF2 A;  1FBU A;  5CVR A;  2PBI A;  3L2C A;  5FO5 A;  2CO5 A;  1LEA A;  2IT0 A;  3GVA A;  4WX9 A;  5HLG A;  1TNS A;  5ERI A;  5LEJ A;  2AXL A;  3M1E A;  3M7G A;  3I59 A;  1KU9 A;  2FE3 A;  3EET A;  2BV6 A;  4YFX F;  1ZH5 A;  1W7P B;  2HOE A;  1BBY A;  1SMY F;  1G3W A;  1S7O A;  2HTS A;  4EVI A;  1TW2 A;  4EJO A;  4EGY A;  4O3M A;  3ISP A;  2IA2 A;  4DQ2 A;  1O3T A;  1YO5 C;  3CO6 C;  5HDG A;  3KCC A;  5LHI A;  1WKM A;  3JAM K;  4FX4 A;  2VBW A;  5L3D A;  3F72 A;  2HEO A;  1G3T A;  1Q1H A;  3SZT A;  4E70 A;  1JGS A;  4HOB A;  1ZRF A;  5HDN A;  3EYY A;  2FEZ A;  2NAZ A;  1BIA A;  2R7D A;  4GGG A;  3RI4 A;  2GA1 A;  3GFL A;  3HRM A;  5LGU A;  1XSD A;  1J0R A;  1WWX A;  3NQO A;  2EA4 A;  1OR7 A;  4RS8 A;  4G7Z F;  1RIO H;  1STZ A;  2DU9 A;  2ESH A;  3O2P E;  4EV0 A;  2OU2 A;  1H9G A;  4N9I A;  1ZG3 A;  1T0F A;  5LBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...