2ISZA

Crystal structure of a two-domain ider-dna complex crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA/mbtB operator strand 1
publication title Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
total genus 51
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2iszA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2iszA02
5IT9Z 1XMKA 3GLXA 3ROUA 3BDDA 1ONVA 1DPRA 2ZCWA 3RKXA 3W6KB 5D6EA 4G8XA 4Y15A 1E2XA 1HW2A 1OYIA 1UHWA 4AIHA 1OPCA 3KZYA 3F6OA 4MNUA 1XCVA 2E1CA 5D5WB 1WSUA 1FY7A 2M87A 3LFKA 2HTSA 1LDKB 3LAPA 2DQLA 1BM9A 3ABUA 5BPDA 4ESBA 4UXNA 1E17A 4RS8A 1O7LA 1K78B 3GFLA 2G7UA 1Q1HA 2Q2EA 3QPTA 4BXUA 2ISYA 5EEGA 1CF7B 2IA1A 2Z5UA 1YQAA 3JTHA 1OR7A 5E8IA 5D8KB 1UCRA 3KEOA 5LBQA 1IN6A 1TBXA 5ICCA 2CYYA 4CYDA 2RDPA 3F8NA 2M1BA 3L9FA 2F5DA 1EV7A 3M8FA 5L3BA 3EQLF 3IC7A 1PUEE 2PLYA 2L54A 5ED4A 2FSWA 4G7HF 5K5QA 4RB2C 4ZYDA 3CUQC 2G9WA 5ERIA 4RGUA 3HOTA 3HTUA 1HSTA 4OIRF 5JVTA 1VTNC 1O3RA 5D6FA 4BHCA 2QQBA 1G3SA 4HX4A 4XSZF 1ZHFA 2P7CB 1LVAA 3PFIA 4ZH4F 4I0BA 3KP5A 1G3WA 1W4MA 2OD5A 1U6GA 3DKWA 2A3SA 2Z33A 3U9GA 2QQAA 5J8CA 3I71A 2VE9A 4ENMA 1FP2A 3T1BA 1XSDA 3ELKA 3J81K 3I59A 2EA4A 1STZA 1DPUA 2KJCA 3P9CA 4KFCA 3B02A 3F8MA 2AXLA 3I64A 3IRRA 5BQTA 2L4AA 1ZGJA 1FYKA 5DCMB 4ZYHA 3P9IA 2GA2A 4LJZF 3RPUA 2MC3A 1I27A 2ADUA 5F1RA 4MEYF 4LMYA 4WF2A 5LLQA 2NNYA 1W5TA 1LNWA 1FOKA 2GA1A 1SAXA 4NB5A 5BOXA 3R60A 3DPLC 5HS7A 3V7RA 1O3QA 1O3TA 1P2FA 3PQKA 1FBQA 2XUBA 1R22A 4G94A 1S29A 1J0RA 2QQ9A 4YFKF 1JHHA 2MA3A 3K9TA 4MQVA 2EWNA 1ZRDA 2VBZA 3M8EA 2EK5A 3GFIA 2RV8A 5HDGA 2J5OA 5D5UB 5H6QA 4WCGA 4HBLA 3T5XA 2EFPA 3V4GA 3F22A 4EJUA 4HLXA 5CYVA 4M71A 3M9AA 3DXJF 3BROA 3QP6A 1KU9A 2R3SA 5AIPA 1B9MA 2DPDA 4N0BA 3HHGA 2V1XA 3TDZC 2E1NA 4IHTA 2ACJA 1U5TC 3FMSA 3BPVA 4PGGA 4OIPF 3V7CA 2CWEA 1FZPB 2UXNA 5ICGA 4WXDA 2XASA 4HAMA 3WTZA 2W25A 1FWZA 3HSRA 3NEUA 4IRHA 5DUIA 4EJVA 5FO5A 3JAMZ 1XGNA 4I01A 4L9JA 1R1UA 3TKYA 1FBUA 4N9HA 3I59B 1SFXA 3T8RA 3O2PE 1HW5A 5L3EA 1GXPA 3I5UA 2O8XA 3RPQA 3I58A 4UUVA 5J8FA 1ZG5A 5JHUA 5K5OA 2D2WA 2A6EF 1ON1A 1ZG3A 1YS6A 2CFXA 2YU3A 3H92A 3GZ6A 2YX7A 4R8HA 4IXAA 1B9NA 4B09A 2IA2A 1LEAA 5L3FA 1R5GA 5K1YA 1D8JA 1ZARA 4GYIA 3U2RA 2F2EA 2QUFA 1XB4A 1IN7A 4IRIA 2YSRA 2DLLA 2IT0A 2ELHA 1Z05A 1MD0A 2KIFA 1O3SA 3T8TA 2XAHA 5E1ZB 3GXOA 1BBYA 4HDVA 4RGXA 1HKQA 3E5QA 5FLXZ 2PEXA 2Y48A 1G6NA 3EUHA 4ZYEA 1RNLA 1T2KA 2XHKA 4XLPF 3GZ5A 1IN4A 4P55A 2EJRA 4AWXB 1QNTA 1GXQA 4MGRA 2C6YA 2HQRA 4ZZLA 3KE2A 3HSEA 4ASNA 2L4MA 2PMHA 3NRVA 1L3LA 2DT5A 2ZXJA 2NRAC 2CGPA 2OQGA 4KT5C 4HA8A 1HQCA 4LFUA 1REPC 1ZREA 2LF7A 2CSOA 2DI3A 2ZFWA 2YR2A 3ULQB 5DV5A 2HZTA 2XGXA 3HIFA 1KYWA 4RAYA 2VODA 3ZMSA 2O03A 3RIRA 3L2CA 3J80Z 1PP8F 1ODDA 1QO0D 1ZN2A 2RC4A 3F8BA 3VB2A 4FX0A 4Z2YA 3E6DA 5ICEA 4HX7A 1U8RA 4XLNF 3I54A 4KUMA 4PGHA 3RTRA 3IHUA 1DP7P 2XAGA 2VOPA 2V1DA 3QPHA 4HX8A 4WWCA 3GO5A 2JT1A 2FE3A 4HF0A 5HVQC 3BJ6A 3EDPA 5DCFA 1WRJA 1YW9A 2P6TA 3FM3A 4WXCA 4ON0A 3JW4A 3MQ0A 3ZMUA 1RUNA 2W57A 3ERED 3R0AA 4HV5A 1U2WA 3CJNA 2F5EA 2FOKA 3BWGA 1BI3A 4MTEA 1RUOA 4RAZA 5HLHA 2DK5A 2VONA 2XAJA 1Z1DA 3VFZA 1EH7A 4AIJA 2HQNA 2Y75A 2X4HA 1YTYA 2PI0A 3EETA 2MBFA 5DYMA 3E3VA 3DQVC 3HHHA 2IVMA 4HDUA 2G7HA 3ZMVA 4KIFA 5LHHA 1I5ZA 4KIBA 1SD5A 1T98A 1S3JA 3DF8A 1MZBA 3FM5A 1KU2A 4LGWA 3JAMK 3FXUA 4YFNF 3RYRA 4AIKA 4CGZA 1S7AA 4A2UA 3OOPA 1WWXA 1SFUA 5FD6A 1MGTA 2STTA 2BYVE 3ISPA 5KVRA 1R36A 3QU6A 1BJAA 2KIUA 4EM2A 1XGOA 1IN8A 4I0AA 3L00A 5FB2A 2XIGA 3BZ6A 3WG9A 2JRTA 4EQQA 3J7AO 1BI0A 1Z6TA 1KA8A 3DP7A 2STWA 4JQFA 2GQQA 4LB5A 5JI6A 3N4MA 3Q9VA 4OMYA 2W85A 1TW2A 2HKXA 4I09A 1J59A 4KMUX 1BOAA 1YW7A 3QAHA 2VBYA 1LDDA 2KJBA 3MAJA 4EM0B 2P4WA 1R23A 1AWCA 2FU4A 3K69A 4EV0A 2GZWA 3T0YA 4LLGF 4RB3C 5ICFA 1KQ9A 3E6MA 1FNNA 3MZYA 2VT3A 1OYWA 5HS9A 2DW4A 5CJ9A 2K02A 3FF5A 4ENNA 2A6HF 3VOEA 1MDMA 2DTRA 4U0WA 3EYIA 3WTTC 2YPRA 1SMTA 4Y17A 2M45A 1R1VA 4A5MA 2LF8A 4QWQA 1W7PA 2FMLA 1P6RA 5LGNA 3WE2A 1Y0UA 3LA3A 2CG4A 3CTAA 4O5VA 3QOPA 3LSTA 2ZJ2A 4D0PA 4EJTA 2EV0A 4BYYA 1KYZA 2MLKA 1LB2A 2IPQX 2O0YA 2OBPA 4HV6A 3QP5A 3TOAA 1EH6A 4I2OA 3H3ZA 4QLCU 5K5RA 3GUDA 1IZ1A 2V9VA 3WGIA 3DPTA 4OMZA 2BGCA 1ULYA 4L0YB 1FYLA 2R7FA 2HGCA 4JK1X 4ZZDA 3I0TA 2HKOA 1IXRC 2KRFA 1XCBA 1FSEA 3MEXA 3K0LA 1MJBA 3QRFF 3D0SA 4BHBA 3TOBA 5TRDA 1HSJA 5DD4A 1EH8A 4S04A 3RYPA 5LGUA 1UFMA 2VC1A 4L5JA 4M6XA 4EJWA 4B8XA 3F8CA 4WK8F 2L3DA 1FC3A 4UVCA 5HOOA 2O61A 5LEJA 1ZH5A 1GHCA 1TNTA 2IP2A 1P92A 2OAZA 5E18F 5TJJA 2XAFA 4Q4ZF 5A2QZ 4G6QA 1USSA 2DQRA 1MDMB 6PAXA 3WTYC 3HUGA 4KMFA 5IT9K 3E6CC 3S2WA 4OINF 3IKVA 3JTGA 2QZ8A 4M9SA 2XKOA 5E8GA 2K4BA 2RNJA 4CICA 1GVJA 2IJLA 2RKHA 3HRSA 2P5LC 4Y13A 5BS6A 1T0FA 4YIIA 4L18B 1ZAOA 3REOA 4HZFA 3KP3A 5CLSA 5CVVA 1W7PD 5F64A 3KLNA 4A0XA 1IRGA 1SD7A 3ZQ7A 3ZP5A 1F1ZA 2GWRA 2HOEA 5L3DA 3KP6A 2ZBKA 4IJAA 2RQPA 2GXGA 3HRMA 3F3XA 5HDNA 4L9NA 2M30A 3JSPA 4RGRA 4IRGA 1QZZA 1TQMA 3L7WA 1TQIA 3KETA 1YFHA 1I1SA 1XSVA 2H27A 2HYFA 3IKTA 3RKWA 3P7NA 5FFZA 1J75A 2RN7A 1IW7F 3WTVC 3KP2A 4F7ZA 1FX7A 1X3UA 4RB1A 2JZYA 2K4JA 4P5OA 1IAWA 3WTSC 5ILVA 3LQQA 1SD6A 4GYGA 2D1VA 4LK0F 4S05A 3TGNA 3ZN0A 3IRQA 1ZG1A 1HKTA 5LRSA 2FQ3A 3WE3A 3I4PA 2XVCA 2H6BA 4FT8A 4DNCA 1Z9CA 1LDJA 2VT2A 2PBIA 4KYWA 1ZGAA 4HW0A 4KA4A 2XROA 1IXSB 2MD5A 2BE5F 2LDUA 1JHFA 4UV9A 4TV7A 1SMYF 4LLNA 1OYYA 1OKRA 2HR3A 4XBFA 2PQ8A 1U3EM 3GEZA 1ZLJA 3F8FA 4R1HA 3HSFA 5HDKA 3IWZA 1O7FA 5CVRA 2ZMEA 4GXOA 1R5HA 2JPBA 3FMQA 2VE8A 2DO7A 3I53A 1F9NA 1WKMA 1BI2A 4FX4A 3GW2A 2XV4S 1P4WA 2ZNYA 2FMYA 3KCCA 2IW5A 3C18A 2XRNA 5JR3A 3RJPA 3PQJA 4ESFA 4ENJA 2QENA 3U1DA 4KN7X 2EFNA 5A2QK 2FBHA 3F6VA 4A12A 4CO8A 5HLIA 2A07F 4G7OF 5D5VB 1K78A 1V4RA 1JE8A 1K7AA 1KQ0A 5L3CA 1JXSA 4G7ZF 4MQ9F 4E70A 4M73A 3NQOA 3ZN1A 2UXXA 3K1MA 5JFRA 1QBJA 2A69F 5LRRA 3E97A 1BC7C 1YO5C 2P7VB 2JSCA 3MCZA 3KP4A 3CLOA 2E7WA 3JSOA 1QZYA 2P5KA 1O57A 2E7XA 5DDGA 2NAZA 1LQ1A 1FLIA 2J5PA 4G6DA 1F4KA 4PCQA 2L01A 4UVAA 2QLZA 4N9IA 3VEPA 3RI4A 2FA5A 3G3ZA 1T39A 4P9UA 4OU0A 4BQAA 1ZRCA 1QGPA 2HFHA 3KZZA 1C0WA 1T6SA 2V79A 1P4XA 2M8EA 5FGMA 2W24A 3K1PA 3HRUA 2FBIA 3KEQA 4PZJA 2ESHA 1J7KA 3LWFA 1HKSA 1L0OC 3SQNA 3K1NA 3SHFA 2RGVA 2FNPA 4L9VA 3D5LA 3RKYA 2NS0A 2ZMEB 3WGGA 4P9FA 4LB6B 3ABTA 2Z9OA 5D4SA 2PG4A 1IF1A 1BIBA 3ZPLA 2XKPA 2WV0A 3BOQA 3CUOA 4P96A 2F5CA 3GVAA 2GIVA 2FEZA 3M1EA 3MZHA 3ECOA 5FLXK 4LG0A 2BEOA 2VN2A 2PFBA 3CO7C 4EM1A 5F6FA 3IWFA 1LJ9A 2D1HA 2H94A 2HEOA 4CDGA 2AS5F 3E6BA 4GCVA 2QYOA 1FSHA 1G3TA 2M5WA 2CO5A 4I02A 3FZVA 1FP1D 4A0ZA 1YYVA 2V1UA 2F5FA 1TTYA 3CDHA 3GX4X 2JTVA 4M9ZA 3FWEA 4O6JA 4MHGA 1XDSA 2H6CA 3LA7A 5BPIA 5HLGA 1RI7A 3FHZA 3ZMTA 1S7OA 1YIOA 4ESJA 3BPXA 5CVJA 3J80K 2QVOA 1CGPA 1J2XA 3Q5FA 1U78A 3GFJA 2DFIA 2CQKA 2VC0A 3V8LA 4A6EA 4AVPA 3W6JB 2OQRA 2P8TA 1MJ9A 4ETSA 2FBKA 1PDNC 1D3YA 1TW3A 1ZYRF 1SD4A 2H09A 1T38A 1KQ8A 3BP8A 3GF2A 3C3WA 4L0ZB 4A0YA 3L09A 3N97A 1R00A 5IT3A 3CUQA 5AONA 2X0LA 1Z7UA 1Z6RA 1KU3A 5DD8A 2QBYA 2O3FA 4GO1A 1UB9A 2QM3A 5E1WA 1XD7A 2COMA 1D8KA 5E1XA 3LAJA 1XMAA 5E17F 1IXCA 4LLLA 2MH9A 1LEBA 2DK8A 1ZLKA 4HLYA 2ZNZA 4IVNA 4EJOA 3K2ZA 4EVIA 2GAUA 3LA2A 1JGSA 2BBYA 4YIFA 2DPUA 2VOOA 5LEKA 3M7GA 3TO9A 3KLOA 4Q5SF 4A5NA 1PP7U 4JBAA 2CW0F 2DAOA 4RGSA 4BHPA 3HRTA 4LG0B 1B4AA 2JPCA 5L3GA 1MJAA 4DQ2A 2XAQA 4NHJA 5EEHA 2WWYA 1QPMA 1S6LA 2UZKA 3EYYA 3R61A 4HOBA 4HQMA 3BJAA 1XDUA 2OA4A 4EGYA 2ISZA 1B6AA 5LHIA 1H9GA 5DEQA 1J5YA 2BV6A 3C7JA 3TQNA 4CXFA 4K2EA 2OZUA 4U0YA 3HOSA 5HS8A 1K79A 2HS5A 4WXHA 1W7PB 2K7LA 2P6SA 3DEUA 4LK1F 2EA2A 4KIGA 1Z91A 3BJOA 1ON2A 4LD5A 2ETHA 4AD9A 2ESNA 1YS7A 1AOYA 4IHSA 1D5VA 3OV8A 2HYGD 1G3YA 3ZMZA 3ECHA 4XSXF 1YW8A 3SFZA 4ENKA 1S8NA 2O6GE 1IN5A 5BMZA 2B0LA 4EGZA 3SZTA 4KN4X 3FXQA 2WC2A 3G73A 2EB7A 2ZKZA 3AAFA 2NNNA 3CUQB 4CHUA 2HTJA 1U5TA 1H9TA 4ZYGA 4UV8A 4M6YA 2FF4A 3Q9SA 1RIOH 2QBYB 3DFGA 4Q47A 2Q0OA 4UHTA 1TQPA 4Q48A 4L5IA 2P5VA 3WU0A 3V8JA 1BIAA 2A5YB 2VXZA 2K86A 4FHTA 1FYMA 3FXRA 2D45A 3HYIA 1WI9A 3SZPA 5FFXA 3TO7A 1YG2A 4U0VA 4L9TA 2NYXA 1W5SA 3E5XA 3P9KA 1KU7A 2MLGA 5LHGA 1BI1A 2UWMA 2EV6A 2W84A 2EV5A 2HDCA 3F72A 1QQIA 2DBBA 5CVIA 2MH2A 3KFWX 4IF4A 4G9YA 2TDXA 1BC8C 2OU2A 1NHAA 2PN6A 3R0JA 3FX3A 1H0MA 4BNCA 3LQRA 5CVUA 1XGSA 1IRFA 1TLHB 4M9XA 1TNSA 2Y0MA 1V3FA 2RVCA 1B1BA 4A6DA 2Z99A 2Z3YA 3CO6C 4WX9A 4YG2F 2LKPA 2EFOA 4U7BA 1R1TA 3WTWC 4HQEA 1R7JA 3WODF 2EFWA 4KDPA 4U88A 1YLFA 3O6BB 2K27A 5DUKA 3COAC 4RB0A 4U7DA 3C1DA 4O3MA 4MTDA 2GXBA 4XRFA 4BAYA 1R58A 2V6CA 4H0EA 2L02A 1K6OA 5D5XB 3KP7A 3ML6A 1F5TA 3GYHX 1A04A 2ZO4A 1I1GA 2WTEA 2IRFG 3SXYA 1FPQA 5ILSA 4M74A 3H3UA 3V7SA 5H6RA 4KNYA 4UNOA 3QU3A 4I7HA 4HF1A 1XGMA 1I6XA 2FNAA 2HWVA 3R6SA 2LSOA 1U5TB 5LGTA 4KICA 3TO6A 1HBXG 1DDNA 3J81Z 2FRHA 3GFMA 3WGHA 1SFEA 4OOIA 1WQ2A 4YFXF 2DU9A 1UHMA 1B59A 2IA0A 2VBWA 3E5UA 3WTXC 1CF7A 2A68F 3B73A 1IUYA 2VBXA 3RDIA 2OZ6A 2EFQA 4HF2A 5AIQA 2A61A 4IPAA 4CZZA 2QWWA 3HTSB 3MFKA 1HXDA 3V8KA 5KK1A 1OMIA 2PMUA 4GGGA 1FT9A 1G4DA 1FBSA 4M72A 2Q8KA 1HW1A 3WTUC 5FD5A 3WU1B 3GWZA 1KGSA 2YX4A 1MKMA 5H20A 2PJPA 1P4AA 2KKOA 1XSXA 1RZ4A 3ZMDA 2LNBA 1XN7A 4MEXF 1ZRFA 3F21A 4EMSA 5D8LB 5E20A 1USTA 1J9IA 5ILUA 3VODA 2KIMA 4UVBA 3IL2A 3TDUC 2R7DA 4HYEA 3R4KA 3MWMA 3F23A 2FXAA 4OIOF 5D4RA 4BH9A 5J6XA 4I98B 4OIQF 4PDKA 4NQWA 5DCMA 4R79A 3BY6A 1BN5A 3O3KA 3DV8A 1DUXC 3FMRA
chains in the Genus database with same CATH superfamily
2EINH 1YRNB 5IT9Z 1XMKA 4W97A 3ZQQA 3GLXA 3ROUA 3BDDA 1ONVA 3CDIA 1DPRA 1YE9A 2B9SA 3FK6A 2ZCWA 3RKXA 3D5RC 3W6KB 2COBA 3G1LA 2GIZA 5D6EA 1Y1WJ 2LP0A 4G8XA 2Z1DA 1OISA 4Y15A 5FKKA 1Y8RB 1E2XA 1HW2A 3SDGA 1OYIA 1UHWA 4AIHA 1OPCA 3KZYA 3F6OA 3SEZA 1JT6A 1XCVA 4MNUA 2E1CA 2BHZA 5D5WB 1D0ZA 1WSUA 1FY7A 2M87A 4HG2A 3LFKA 2HTSA 1V5EA 3KZIC 1LDKB 3LAPA 1VFCA 2DQLA 2EZIA 1BM9A 2LBFB 4PFPA 1BA5A 3ABUA 5BPDA 2NOGA 5B1AH 2WV1A 5GP9A 4ESBA 5M5YJ 4UXNA 1E17A 3BCAA 4EATA 4RS8A 3WHCA 1GLNA 5CQEA 1O7LA 5GTIC 1K78B 3VYTB 1IDZA 2B7EA 3GFLA 1BJZA 1Q1HA 2G7UA 5BNGA 2Q2EA 3ZQCA 2MVTA 2WA0A 3QPTA 4BXUA 2ISYA 5EEGA 2XAUA 4RM2A 4D1QA 1CF7B 1NH3A 4BU2A 2IA1A 2Z5UA 1YQAA 3JTHA 1OR7A 5F1JA 3S1RJ 1IC8A 5E8IA 4DJAA 3BQYA 5D8KB 4N4OB 1UCRA 3KEOA 5LBQA 1IN6A 1TBXA 1B72B 5ICCA 2CYYA 4CYDA 1X4OA 5F0CA 2RDPA 5FLMJ 3F8NA 3OS1A 2M1BA 3L9FA 5DTDA 2F5DA 1EV7A 3M8FA 5L3BA 3EQLF 2XPWA 3IC7A 1PUEE 2PLYA 2L54A 5ED4A 2FSWA 2I5UA 3ASNH 4G7HF 5K5QA 4RB2C 4L5EA 4BQOA 4ZYDA 3CUQC 2F48A 2G9WA 4X6AJ 5ERIA 4RGUA 3HOTA 3HTUA 1HSTA 5FKOA 4OIRF 4BE1A 3O8GA 2R5ZB 1YX3A 2L7ZA 5JVTA 1VTNC 3MKZA 1O3RA 3P5JA 5D6FA 1FOWA 1DGWY 2EQRA 2QQBA 4BHCA 1D0YA 1G3SA 4HX4A 4XSZF 5E3OA 1ZHFA 2P7CB 1LVAA 4CCOA 3HB9A 3PFIA 1EJ9A 4V2FA 4ZH4F 4I0BA 5IP9J 3KP5A 1G3WA 2HZDA 1W4MA 2OD5A 3BQZA 1U6GA 3DKWA 2A3SA 2R7XA 4UB8C 3A1YA 2Y0SA 2Z33A 1S7EA 3U9GA 3DKXA 2QQAA 5J8CA 1VQ8I 2E35A 3I71A 2VE9A 3OYHA 3GTJJ 5HNFA 4ENMA 1YJWI 3RZOJ 1FP2A 3T1BA 3N05A 5F04A 2R7OA 1XSDA 3ELKA 1TWCJ 1JGGA 3HXLA 1ETVA 3CC4I 1CQTA 3J81K 3I59A 2EA4A 1V55H 1XPXA 2JVHA 1ETXA 1STZA 2HVQA 4RAFA 1DPUA 2KJCA 3P9CA 4KFCA 3B02A 3F8MA 2B63J 2AXLA 3I64A 3IRRA 1UZCA 5BQTA 2L4AA 2W48A 3GZNB 2DA4A 4XKCA 4NQWB 1ZGJA 1FYKA 2CV1A 5DCMB 4BXFA 2DMPA 5EGOA 3OYLA 4XRSG 4ZYHA 2X51A 3PO3J 3P9IA 1TL8A 4M3FA 2VQLA 2ECBA 3FXOA 4XKBA 2GA2A 1K61A 2CUFA 4LJZF 3RPUA 4E7KA 2MC3A 1I27A 2X1CA 4OAYA 3OIPA 2ADUA 5F1RA 4MEYF 4LMYA 3UKGA 4WF2A 2D5VA 2MD0A 1GV5A 5LLQA 2NNYA 1U0JA 1X1AA 1W5TA 1LNWA 1FOKA 3MVPA 5LD2C 5E79C 2MGQA 2M35A 2GA1A 3TP0A 1SAXA 4NB5A 5BOXA 3R60A 1MW7A 2O5RA 3HOYJ 3DPLC 4BBRJ 3M1CA 1D1AA 5HS7A 3V7RA 1O3QA 1O3TA 4GDFA 1P2FA 1X2MA 3PQKA 5FLXR 1FBQA 2XUBA 2V9PA 2X6WA 1R22A 4G94A 1S29A 2O7OA 1BR4A 1J0RA 3TMOA 2QQ9A 2PMZN 2XDVA 4YFKF 1JHHA 2MA3A 3K9TA 4I99C 1I3QJ 4MQVA 2EWNA 1ZRDA 2M4GA 1W1WE 2Q2EB 2VBZA 3M8EA 5FRMA 2EK5A 4J19A 2LC2A 3GFIA 2RV8A 5HDGA 3OYGA 2J5OA 2JMWA 5D5UB 5H6QA 4WCGA 2XGCA 4HBLA 3T5XA 1ERDA 2EFPA 3DU5A 3V4GA 3F22A 3BG7A 2ZFUA 4EJUA 3IAM2 4HLXA 5CYVA 4M71A 5F0HA 3M9AA 3K2AA 3DXJF 1B8IA 2VI6A 3BROA 3CCRI 1I39A 2K85A 3QP6A 2GBYA 3CCVI 3BCBA 3F0CA 1KU9A 2R3SA 5AIPA 1B9MA 1U9NA 2DPDA 4N0BA 3HHGA 2V1XA 1MMDA 4BUPA 4BY7J 3TDZC 5EDNA 2Z16A 2E1NA 4IHTA 2ACJA 4GRIA 3J80R 1U5TC 2NVXJ 3FMSA 3GTGJ 3BPVA 4PGGA 3TW6A 4OIPF 2IS1A 3V7CA 2CWEA 4X1EA 1FZPB 4J01A 2UXNA 2DOFA 5ICGA 3TEDA 4WXDA 2XASA 4HAMA 2CW8A 5FKNA 3WTZA 4LITA 2W25A 1JJ8C 1FWZA 3HSRA 4UUSA 3NEUA 4IRHA 5DUIA 2VLAA 4B47A 3K4JA 4QSHA 1ZGWA 3NARA 4EJVA 5FO5A 3JAMZ 3DTKA 2VQHA 1XGNA 4I01A 4L9JA 1JI8A 1R1UA 1NG6A 1WJCA 4MFEA 3TKYA 1FBUA 2R7QA 5EJCA 1QHGA 4N9HA 3I59B 1SFXA 3ERMA 3T8RA 4PJMA 1X4PA 1NK3P 2VJJA 4NNJA 2Y0SN 1BL0A 4E7ZA 3O2PE 4CZCA 1UELB 2ZSIB 1JKOC 1HW5A 5L3EA 1GXPA 3I5UA 1VQLI 2DTZA 2O8XA 3I58A 3RPQA 4NDLA 4UUVA 4HPQA 3TBIA 2LREA 5J8FA 1ZG5A 5JHUA 5EGOB 5K5OA 5J1RA 2TRTA 4ABZA 2VPLA 3QQAA 1TT0A 2D2WA 2A6EF 1ON1A 1ZG3A 1YS6A 2CFXA 2YU3A 1K6YA 2E1MB 2CV2A 3H92A 3GZ6A 2YX7A 4R8HA 4IXAA 3MKLA 5IOYA 1B9NA 3HKZA 3OL4A 1A35A 4B09A 2IA2A 4EEFG 2FX0A 4OWRB 1WJDA 1JJ6C 3M8JA 4ZTJA 1LEAA 3RPUD 5L3FA 1R5GA 5K1YA 1D8JA 1ZARA 1BW5A 4XLAA 2FOWA 3QYFA 1VQOI 1UG0A 2BY0A 4A93J 4GYIA 4CH7A 3O8HA 1N78A 3U2RA 2DFHA 2A05A 2F2EA 1X3WB 3DTEA 2QUFA 1XB4A 1IN7A 3L2VA 9ANTA 1RQ6A 3L2UA 2FUG2 1LVKA 4IRIA 2YSRA 3E7LA 2DLLA 4M3EA 3RZDJ 4IKFA 3BR6A 2IT0A 1YJNI 2ELHA 1Z05A 1MD0A 2DJIA 4HNUA 2KIFA 5K7HA 4CCKA 1ENHA 1O3SA 2AHQA 3T8TA 2XAHA 1VQ4I 5E1ZB 2R5YA 1FOXA 2EILH 3GXOA 3AFHA 2OV7A 3ABMH 2O9LA 1BBYA 2NS8A 4HDVA 4XR6A 4RGXA 1HKQA 3KIOA 3I9V2 2R7ZJ 3E5QA 3BR0A 5FLXZ 2PEXA 3MN2A 2Y2ZA 2Y48A 1G6NA 3HOWJ 3EUHA 4ZYAA 4ZYEA 1P9QC 1Y56A 2AO9A 1RNLA 3BR3A 4E7JA 1T2KA 3S8PA 2XHKA 4XLPF 3GZ5A 1IN4A 4P55A 4XM3A 2EJRA 4AWXB 1B8IB 1QNTA 1GXQA 4MGRA 2C6YA 2HQRA 4DW6A 4ZZLA 3S1MJ 3I55I 2EIJH 3KE2A 3HSEA 4ASNA 2BY2A 2L4MA 2PMHA 3FISA 3OYKA 3NRVA 1L3LA 2DT5A 2EBIA 2ZXJA 2NRAC 4FCYA 1R6RA 2CGPA 4BL0B 2MABA 2OQGA 4KT5C 4AC0A 4XORA 4M3BA 4HA8A 1HQCA 2M7AA 4LFUA 1REPC 2WADA 1EKEA 1LFPA 2KDZA 1ZREA 2LF7A 2CSOA 2DI3A 2IEKA 2YR2A 2ZFWA 4II3A 3ULQB 4V19K 5DV5A 3RCOA 3LSMA 3VWBA 2HZTA 2XGXA 3HIFA 1KYWA 2JUCA 4RAYA 4CCMA 2VODA 2O03A 3ZMSA 2K3FA 1AA7A 3RSNA 3RIRA 3L2CA 2K5CA 3J80Z 3G6EI 1WFXA 3HEFA 1PP8F 1ODDA 1QO0D 1ZN2A 3DTIA 2RC4A 3F8BA 3VB2A 4XLCA 4FX0A 4Z2YA 4UUSB 2H1KA 3E6DA 1RR8C 1K4SA 5ICEA 4HX7A 1U8RA 5C44J 2VB6A 1KZHA 4XLNF 2NOJB 5KAIC 3L2QA 4BGDA 4NC6A 3I54A 3CCYA 4KUMA 4PGHA 5KNLA 3RTRA 3IHUA 3PIOF 4AU7A 1N75A 1DP7P 2XAGA 2VOPA 2V1DA 4UB6C 2F5VA 3DLLF 2JN6A 1T95A 2DA7A 3QPHA 4HX8A 4WWCA 2ZXWH 4KJZA 3GO5A 2JT1A 1WJ5A 2K40A 2FE3A 2JA5J 3GCMA 4HF0A 4FASD 3BJ6A 5HVQC 2E2IJ 1MMSA 2DFEA 3QPLA 4XL9A 4ANJA 3EDPA 2L7KA 4LIVA 1A6QA 1GDTA 5DCFA 1WRJA 1YW9A 2P6TA 3FM3A 4WXCA 1O4XA 4ON0A 5B1BH 2M0CA 3JW4A 3MQ0A 2OTLI 3ZMUA 3W2VA 1V54H 1RUNA 2W57A 3ERED 2Z2SB 3R0AA 2EPFA 4HV5A 1JT0A 4XLHA 2DA3A 3LSJA 2K9SA 4A3JJ 3KYDB 1U2WA 2IBDA 4B4CA 2XGDA 3CJNA 2F5EA 4IEJA 2FOKA 2V26A 1BI3A 3BWGA 4MTEA 3SYTA 2BZTA 1RUOA 4RAZA 5HLHA 4DZJA 2DK5A 2VONA 2XAJA 1UJ8A 2LMDA 1Z1DA 4U87A 3VFZA 3GTMJ 1EH7A 4AIJA 2HQNA 2Y75A 1VNDA 2JA8J 4A3GJ 2X4HA 1YTYA 2LFBA 2CFOA 2E5ZA 3HGYA 2PI0A 3EETA 2HXOA 4IO9F 2MBFA 5DYMA 3E3VA 3DQVC 3HHHA 2IVMA 5K7ZA 1HDDC 4HDUA 2G7HA 3ZMVA 4KIFA 5LHHA 2FJ1A 3HKZN 1I5ZA 2V7FA 4RLFA 1TT5B 4KIBA 2BVLA 3S2HJ 1SD5A 1T98A 1S3JA 3DF8A 3Q0VA 1MZBA 4Y33A 2DYRH 2KHMA 1MBJA 3FM5A 1RKTA 1KU2A 4LGWA 3JAMK 1H8AC 3FXUA 4YFNF 3RYRA 1IRZA 2QQ8A 2R5YB 3HG9A 4AIKA 4CGZA 4BEHA 1S7AA 1MH4A 4A2UA 4RDUA 3OYDA 2MW8A 3OOPA 2LOOA 1BR1A 1WWXA 2CU7A 5FD6A 1SFUA 1MGTA 1E3OC 2BYVE 2STTA 3ISPA 5KVRA 5J1YA 1R36A 3HL2A 3QU6A 1T56A 2CJJA 1BJAA 4C3IJ 1FMWA 2KIUA 3BLYA 3GTPJ 2XB0X 1R49A 3DKYA 1XGOA 4EM2A 2JWTA 1IN8A 3D5SC 4I0AA 3VSKA 2L9SA 5KCMA 3L00A 5FB2A 2XIGA 1IDYA 3BZ6A 4B48A 4DOZA 1RETA 4XK4A 2WY8Q 3FXLA 3WG9A 4D9JA 2VKEA 2JRTA 4EQQA 1LFUP 4KITB 3J7AO 1WJAA 2VXDA 1BI0A 4E7IA 1Z6TA 2JUGA 1KA8A 2CUZA 3GMEA 1ETOA 4II2A 3NWTA 3QYEA 1OCCH 1W0TA 2W82A 2OJED 3DP7A 2STWA 4JQFA 3HOXJ 2GQQA 4LB5A 5JI6A 2IGMA 3N4MA 1I3AA 3J7ZI 2DT6A 3Q9VA 3S14J 4OMYA 1ZR2A 3CF5F 2W85A 3CCQI 1HCRA 3M3YJ 3JRFA 1TW2A 4XNFA 2HKXA 4MO7A 4I09A 1J59A 3HBLA 2DA6A 4KMUX 1BOAA 1Z77A 2CUEA 1YW7A 3QAHA 3H36A 2M4KA 2VBYA 3OIOA 3M07A 4XOPA 1LDDA 5TGTA 4S0HB 2KJBA 3MAJA 4EM0B 1D1BA 2P4WA 2PX9A 3ASOH 1R23A 1AWCA 1ITYA 1XMXA 3LSIA 4XLEA 5A2QR 3DWLE 2FU4A 1JKPC 3K69A 3OSFA 1QPIA 4EV0A 2GZWA 3ZQFA 3T0YA 1R4MB 4LLGF 1WJBA 4A69C 4RB3C 5ICFA 1KQ9A 3E6MA 1FNNA 1FTTA 3I4NJ 3MZYA 2VT3A 4JX6A 1OYWA 4E7HA 5HS9A 4BJ6C 2LTPA 2DW4A 5CJ9A 2K02A 3X2QH 2L9VA 3FF5A 4N4NB 4ZDLA 4CCLA 3IP4B 4ENNA 2A6HF 3VOEA 2DXIA 2VKVA 1MDMA 2DTRA 4A3EJ 3A52A 2QSFX 4U0WA 3EYIA 3WTTC 2KDOA 5E3NA 4IQ4A 2KL4A 1POGA 1SMTA 1WHUA 2YPRA 4Y17A 2M45A 2V6EA 2BVMA 4F3QA 5GPCA 1R1VA 4A5MA 1FJLA 3BG5A 2LF8A 3BR2A 2HQ5A 2EZKA 3CCUI 4A3FJ 3QODA 2ELKA 4QWQA 3PNTA 1W7PA 2FMLA 3PNYA 1P6RA 3KX2A 1R4NB 4V2GA 4E7LA 1K4TA 3FKJA 3KYLA 5LGNA 3H1CA 3WE2A 1Y0UA 2PJRA 3SFIA 3LA3A 1QVTA 3U1KA 3PIPF 1DP3A 2CG4A 2OF7A 3BC8A 3CTAA 5HLTA 5C4XJ 4O5VA 3QOPA 3S2DJ 5TISC 1Y6IA 3OMYA 4B1RA 3LSHA 4PJ0C 5IYBJ 1PJRA 2BXYA 3CCLI 2EZLA 5B66C 3LSTA 4BEHB 2ZJ2A 4D0PA 3DEWA 4EJTA 2EV0A 4BYYA 2E1MC 1KYZA 5J4VA 2MLKA 1D0XA 1LB2A 2IPQX 2O0YA 2OBPA 2X6OA 1V5FA 4HV6A 3QP5A 2AQFA 2W4SA 1WJEA 3TOAA 2GOMA 2R7TA 1E0EA 1EH6A 3JRAA 3H3ZA 4I2OA 4QLCU 3OIQA 3TP3A 1WJFA 5K5RA 3K70D 3S3NA 3GUDA 1IZ1A 2QKLB 2V9VA 3WGIA 2X85A 2L7FP 3DPTA 4OMZA 2BGCA 1ULYA 2K9QA 4L0YB 1FYLA 2JSPA 2R7FA 3S1QJ 2HVRA 3H9QA 3AG2H 2HGCA 4JK1X 4ZZDA 3I0TA 2HKOA 2LKSA 1SEUA 4E6KG 2JA6J 2L7MP 1WGXA 1IXRC 2Y69H 2KRFA 5K7FA 1XCBA 1FSEA 3MEXA 3E0JB 3K0LA 4XLFA 5F08A 2EH3A 1MJBA 1ORKA 3D0SA 3QRFF 1OCTC 4BHBA 4B43A 3TOBA 2M7BA 1JUPA 1HSJA 5TRDA 2LY2A 5DD4A 1X19A 1LKXA 1EH8A 4S04A 3RYPA 5LGUA 1UFMA 2DODA 2VC1A 3OYAA 4L5JA 3GLLA 3ZXSA 2H8RA 2DN0A 4M6XA 4EJWA 1DU6A 3OR2C 4B8XA 3F8CA 3PL8A 3W3CA 5IYCJ 2GOXB 3E1SA 4ZDOA 3G1OA 5IP6A 4WK8F 1MNEA 2P81A 2L3DA 1FC3A 3H5RA 4UVCA 5HOOA 5LEJA 2O61A 1ZH5A 2K3PA 1GHCA 4FTHA 1ZR4A 1TNTA 2IP2A 1P92A 2OAZA 1AKHA 4JP0A 5E18F 5TJJA 2CQQA 1SVOA 2QF7A 2XAFA 2GM4A 4Q4ZF 5A2QZ 3K10A 4G6QA 5IPAA 2XSDC 2HYJA 1PUFA 3JR9A 1F36A 2Y31A 5B3SH 1LUJB 2VJ5A 1USSA 2DQRA 1YIJI 1MDMB 6PAXA 3WTYC 3HUGA 1FOYA 3AG4H 2R7SA 1X2NA 3LMMA 4KMFA 5IT9K 3E6CC 3S2WA 4OINF 2HXIA 3IKVA 3JTGA 2QZ8A 1Y39A 4DIQA 4AM3A 4CSWA 3HPGA 4M9SA 1TWFJ 2XKOA 4P1WA 5E8GA 1MSEC 2IS6A 2K4BA 2DT7B 2L9NA 2RNJA 3CP2A 4CICA 1GVJA 2IJLA 4UY8I 4IOCF 2RKHA 3HRSA 3S15J 2P5LC 5B5EC 1W36C 2DMNA 3G1MA 4IX7A 2R7WA 5JLXA 5CQGA 4IHWA 4Y13A 5BS6A 1T0FA 2VIXA 1S9HA 2DYSH 4YIIA 5JVGF 4L18B 1N25A 1ZAOA 4UUTA 3REOA 2PJRB 4HSRA 2E5NA 4HZFA 3KP3A 5CLSA 5CVVA 3JRCA 2CH0A 1VF9A 1W7PD 3KLNA 5F64A 1YJ9I 4A0XA 5FLVA 1IGNA 3DBHB 4BY1J 3NWSA 5EEAA 1IRGA 2X1EA 3ZRGA 2A5WA 1SD7A 3BG3A 3ZQ7A 3ZP5A 4BE2A 1F1ZA 2V4JC 1E3PA 3OYBA 2BXZA 2GWRA 4X0GA 2HOEA 5L3DA 3A2KA 3KP6A 2ZBKA 2OTJI 4IJAA 1R9TJ 2LH9A 2RQPA 2GXGA 2L9RA 3HRMA 3F3XA 2BY1A 3J81R 3OYNA 3BTCA 5HDNA 3CCJI 4L9NA 3PM1A 2M30A 3G71I 3JSPA 4RGRA 4IRGA 1ETYA 1QZZA 1TQMA 3LL7A 3L7WA 1TQIA 3KETA 5EG0A 1YFHA 1I1SA 1XSVA 1VQ7I 2H27A 2HYFA 3IKTA 3RKWA 3P7NA 4PJNA 4NBQA 3OR1C 2LVSA 3BTIA 5FFZA 4Z6YA 3OYFA 2E2HJ 4YEJA 4HNVA 2MG4A 1J75A 2RN7A 2HOAA 3NAUA 2EIMH 5EZGA 1IW7F 3WTVC 3KP2A 5FKMA 4F7ZA 3HJEA 3CMYA 2LG4A 1FX7A 1X3UA 1XS9A 4RB1A 2JZYA 2K4JA 3AG1H 4P5OA 1IAWA 3CJQB 3WTSC 5ILVA 3QWLA 3LQQA 1SD6A 2HDDA 2ICWG 2R7VA 3EUHC 3OYMA 4XICA 4GYGA 2D1VA 4LK0F 4S05A 3A0BC 1TP4A 1SC7A 3TGNA 3ZN0A 1X1PA 3IRQA 2EIKH 4FE7A 4XRSA 1ZG1A 4A3IJ 1HKTA 5LRSA 5M3FJ 2FQ3A 2ID6A 3WE3A 4G12A 3I4PA 2XVCA 2ME6A 2M3AA 4YRVA 1HC8A 1XG1A 2QA4I 5JHFA 4LIUA 2H6BA 2X1DA 4FT8A 4DNCA 2BY3A 1Z9CA 1LDJA 1AKHB 1MNMC 1GUUA 4AUXA 4RLQA 2VT2A 1MBEA 2F6CA 2DOEA 2PBIA 1FMVA 2KZGA 2CS3A 4KYWA 3AL0B 1ZGAA 4HW0A 4KA4A 2QEXI 2XROA 2GLOA 1PUFB 1YOVB 1IXSB 3WHBA 2MD5A 2NVTJ 3C2GA 3BZKA 2BE5F 3CQZJ 4XQFA 3HUGB 2LDUA 3CMMA 1JHFA 2MFZA 4UV9A 1A36A 2YU9J 4TV7A 4B3XA 3CCSI 1SMYF 4LLNA 2KMUA 1OYYA 1OKRA 2HR3A 4XBFA 2PQ8A 3CC2I 1U3EM 3GEZA 2KRHA 1G2HA 1ZLJA 2DDBA 3CJRB 3F8FA 2IS4A 1Z0XA 4R1HA 3OS2A 3HSFA 2WAQA 5E3LA 2NVQJ 5HDKA 1F43A 4M3GA 3IWZA 5E3MA 1O7FA 5CVRA 2ZMEA 2VPRA 4GXOA 1RESA 3BTLA 4XN3A 1MMNA 1FEXA 1R5HA 1Z7LA 4XMYA 2JPBA 3FMQA 2VE8A 2DO7A 3I53A 2CUJA 4C2MJ 2KT0A 1F9NA 4Y7NJ 1WKMA 2VKHA 1BI2A 4FX4A 3GW2A 2XV4S 1P4WA 3S93A 1JKRC 4MLOA 2ZSHB 2ZNYA 4JX5A 3WU2C 1HF0A 3SEQA 4XRMA 3FXJA 2FMYA 3KCCA 2OPTA 2IW5A 2HNHA 1TZLA 2IGOA 3CMEI 3C18A 2XRNA 4XOTA 5JR3A 1U8BA 2HOSA 1IG7A 3RJPA 2LR8A 2M8GX 3PQJA 1VQNI 2K9MA 3ZQHA 3H3VK 4ESFA 3RQIA 4ENJA 2QENA 3IAS2 3U1DA 1R5ID 4KN7X 5IOZA 2LY9A 3CJTB 2EFNA 4XONA 5FROA 5A2QK 2FBHA 3F6VA 4BKXA 4A12A 3CC7I 4FE4A 4CO8A 3A4CA 5HLIA 2A07F 1SANA 3LSRA 1FTZA 2DCEA 4G7OF 3B6CA 3K4NA 1ETWA 5D5VB 5EG0B 2RAEA 1BR2A 2KZVA 1K78A 1V4RA 4C3JJ 1JE8A 1K7AA 1KQ0A 4CYCA 2LK2A 5L3CA 1JXSA 3F9KA 4G7ZF 4MQ9F 4E70A 4M73A 3NQOA 3ZN1A 2UXXA 2ELJA 3K1MA 3IUOA 5JFRA 1QBJA 2A69F 2G0EA 5LRRA 3E97A 1IV6A 2LRDA 4FISA 4C3HJ 5KHDA 1BC7C 1YO5C 4QIWN 3OWTA 3A0HC 2P7VB 2JSCA 3MCZA 5GADJ 3KP4A 3CLOA 2E7WA 3JSOA 1QZYA 4AVZA 4A3DJ 2P5KA 3IV5A 2QSHX 1O57A 2E7XA 2WBMA 2NAZA 5DDGA 2XC7A 1VQPI 4HSTA 3S1NJ 1LQ1A 1A5JA 1FLIA 3SJMA 2J5PA 1RPWA 3HGGA 4G6DA 1F4KA 2H8WA 4PCQA 2L01A 2ME0A 4UVAA 2QLZA 4N9IA 1SFKA 3VEPA 1H88C 3AG3H 3JRBA 3RI4A 1MH3A 3DPUA 2FA5A 2KQRA 2M0MA 3G3ZA 3ZR8X 1T39A 4IHXA 4P9UA 4OU0A 4Y4RA 4BQAA 3FXMA 3LSKA 3GBGA 5EZHA 1ZRCA 1QGPA 2HFHA 3KZZA 1IUFA 1C0WA 2UV1A 4BE0A 1T6SA 2HDWA 5C4JJ 2V79A 2X6YA 1P4XA 2M8EA 4HNTA 3S3MA 4C30A 3PFYA 5FGMA 2W24A 1X58A 3K1PA 1MNDA 3K7AJ 3HRUA 3FXKA 2FBIA 4BXXJ 3KEQA 4PZJA 4DBQA 3ZQLA 1MMAA 2ESHA 1J7KA 3JRIA 3LWFA 1HKSA 1L0OC 3SQNA 2I8DA 3CDLA 3K1NA 3SHFA 4BJ5C 2RGVA 2FNPA 2LY1A 4L9VA 3D5LA 2TCTA 4DBRA 3RKYA 3GTQJ 2NS0A 2AQEA 4C2UA 2ZMEB 3WGGA 4P9FA 4LB6B 1QRYA 3ABLH 3ABTA 4D7NA 1H89C 1VQ5I 2Z9OA 1DU0A 2R93J 3GTKJ 5D4SA 3CP8A 2WB1A 4ZTFA 2PG4A 1IF1A 1BIBA 2WAQN 1OR7C 1UMQA 2ZB9A 3JCUC 3ZPLA 3H35A 3GTOJ 2XKPA 2WV0A 3BOQA 2NVUB 3CUOA 4P96A 3OYIA 2F5CA 3H9JA 3BTJA 3GVAA 3DEEA 2GIVA 2FEZA 3M1EA 2PMZA 2V1NA 1Z3YA 3MZHA 4JX4A 2F4MB 3ECOA 5FLXK 2LLKA 2XF6A 1V5GA 4LG0A 3CD6I 2BEOA 2CQNA 3I56I 3BR5A 2VN2A 2PFBA 1MSFC 3J7AW 3CO7C 4EM1A 5F6FA 3IWFA 1OCZH 4CCJA 1LJ9A 2D1HA 3S17J 1JUMA 5HODA 2H94A 3HDDA 1Q1VA 4CDGA 2AS5F 2HEOA 3E6BA 2KRCA 3LSGA 4GCVA 2QYOA 2DFFA 1FSHA 2OUMA 1G3TA 3DBLB 3CF2A 4BDYA 2M5WA 2CO5A 4I02A 3FZVA 1QVUA 4CYCB 1FP1D 3PJRA 4A0ZA 1YYVA 2V1UA 2VASA 4F91B 2F5FA 2JK3A 4AYBA 1TTYA 4A3CJ 3W6VA 5HNHA 3CDHA 3GX4X 3LFUA 1G8XA 1WVRA 2JTVA 2RREA 3VSLA 3HOZJ 4M9ZA 5F0FA 4D7MA 2X98A 1ZK8A 2AXTC 1MBKA 2M34A 3FWEA 4O6JA 4MHGA 1BW6A 3H0DA 1M1EB 1XDSA 2H6CA 3LA7A 5BPIA 5HLGA 4XKVA 1U9OA 1Z3XA 1RI7A 3BZCA 3FHZA 3ZMTA 2DMQA 1S7OA 1YIOA 4W1UA 3W2AA 3K4CA 4JYKA 3BPXA 4ESJA 4IL6C 5CVJA 3J80K 1TWHJ 5IP7J 2QVOA 2CQXA 1J2XA 1CGPA 3H9GA 3Q5FA 1U78A 3GFJA 2DFIA 2CQKA 2VC0A 5FKLA 3V8LA 4A3MJ 1T8IA 4A6EA 4Y52J 4AVPA 1EF4A 1WCMJ 3CLQA 3S16J 4NUBA 2QSGX 2R0QC 4DYRA 3W6JB 1RR7A 2OQRA 2P8TA 1MJ9A 2L5QA 2RQQA 4ETSA 2FBKA 3JAMR 5GTHC 4I6ZA 3FIWA 1PDNC 2NXNB 1D3YA 1TW3A 1ZYRF 4F55A 1SD4A 2E60A 2H09A 1QU3A 1T38A 5IY5H 1KQ8A 1IV8A 3BP8A 3GF2A 3C3WA 5DS9A 2M9HA 4RA2A 4L0ZB 4CUGA 1SVMA 3PUBA 4A0YA 1RC9A 3L09A 3N97A 1MBGA 1R00A 5IT3A 3CUQA 4B3AA 5AONA 1IO2A 2X0LA 3BG9A 2VQCA 3J7AY 5GAEJ 2EZHA 2KP6A 1Z7UA 1Z6RA 1KU3A 5DD8A 2QBYA 2O3FA 2HI3A 1TWGJ 4GO1A 2KIQA 3ZGKA 2Y9YA 1UB9A 3RKQA 4CCNA 2R92J 1VQMI 3VPRA 2QM3A 5M5WJ 4BQQA 2K9NA 2KPMA 3Q0UA 4M3DA 4I76A 5E1WA 1XD7A 2WY7Q 3UNGC 2L2OA 3MKWB 4C9YA 2COMA 2MC4A 1D8KA 5E1XA 3LAJA 1XMAA 3C2HA 1IXCA 5E17F 4RMNA 3OYJA 4LLLA 1ZQ3P 2MH9A 4BDZA 1LEBA 2DK8A 1ZLKA 4ZDPA 4HLYA 3OOUA 2ZNZA 4IVNA 4EJOA 3K2ZA 4EVIA 2GAUA 1Z21A 2W7NA 3LA2A 2HPIA 2LKXA 3AL0C 4A3BJ 3DBRB 1JGSA 3CMAI 2BBYA 3LSPA 3ZQGA 1P7JA 4YIFA 2DPUA 5FRNA 2VOOA 5LEKA 3M7GA 3TO9A 1PVEA 2XF7A 5F27A 3KLOA 4Q5SF 4D5CA 4F93B 4A5NA 1K83J 4ITVA 2K9LA 1QZEA 5FJ8J 5CPRB 3ZCOA 2HVSA 1BOBA 5KAFC 1PP7U 4JBAA 4MFDA 1LPQA 2CW0F 2DAOA 4RGSA 4BHPA 1QHHD 1TC3C 3HRTA 4LG0B 2R7RA 4ZJZA 1B4AA 2WB1N 2JPCA 5L3GA 2MZ4A 2KISA 3CCEI 3RQ4A 1MJAA 4DQ2A 3ESWB 1JUSA 2XAQA 4BQNA 4IOAF 3DLAA 4NHJA 1WZ2A 1X3ZB 5EEHA 2WWYA 1AHDP 1QPMA 3JRDA 2XRLA 1S6LA 2L0KA 2MSYA 2UZKA 3EYYA 3R61A 4HOBA 1X1DA 4HQMA 3BJAA 2V9KA 3A03A 1XDUA 1T0FC 3FBNB 3S3OA 2OA4A 1R71A 4EGYA 2ISZA 1XC5A 3LNQA 1B6AA 5LHIA 3IH3A 4KT6A 1H9GA 3OS0A 3MKYB 1Y0NA 2JA2A 4FQGA 2M2EA 3EPZA 5DEQA 4H4KC 1J5YA 3VDXA 4FETA 2BV6A 3C7JA 2O8KA 3TQNA 2F4IA 4CXFA 3OYEA 3G2BA 4K2EA 2OZUA 3QOEA 4U0YA 2VJ4A 3HOSA 5HS8A 4A3LJ 2XSJC 1K79A 2HS5A 2ID3A 4WXHA 1W7PB 5CKTA 2K7LA 2P6SA 1NK2P 2ECCA 1T33A 3DEUA 4LK1F 2ZJQF 4AYBN 2LD5A 2EA2A 4KIGA 1Z91A 2VJIA 3BJOA 1ON2A 1YI2I 3L1PA 4LD5A 1OQYA 2ETHA 2WAFA 4AD9A 2ESNA 2IS2A 1YS7A 2E34A 4DYCA 3IH2A 1J09A 1AOYA 1APLC 4IHSA 1WPKA 5EYRA 4A3KJ 1IJWC 1D5VA 3OV8A 3MZ8A 2UUZA 3HOUJ 2HYGD 1RRJA 1G3YA 3ZMZA 3ECHA 1MBFA 4XSXF 4XIDA 1YW8A 1UHSA 3DU6A 1X1BA 4E7SA 3SFZA 4ENKA 4PFOA 2I10A 2DDAA 2ZJRF 1VQ6I 1S8NA 2O6GE 5GPAA 1IN5A 5LFAA 3L2WA 1JTYA 5BMZA 3HM5A 3B6AA 4OAZA 2B0LA 3VYRB 4EGZA 3K4KA 3SZTA 3OSGA 4KN4X 3FXQA 2WC2A 3G73A 2EB7A 3HPHA 2ZKZA 2DJNA 3K4MA 4IQJA 3W2WA 4C2TA 3TL4X 3AAFA 3KEYA 4BS9A 2X9DA 2NNNA 3CUQB 3FDYA 4LOCA 4CHUA 1XTAA 1ETKA 1U5TA 2HTJA 4D5FA 1H9TA 4ZYGA 4UV8A 4M6YA 3KYCB 2FF4A 1FIAA 3Q9SA 1RIOH 5IYDJ 4ZC3A 2QBYB 1S72I 2E36A 2JVGA 2XPUA 3DFGA 4Q47A 2Q0OA 4UHTA 1LE8A 1TQPA 4Q48A 4L5IA 2P5VA 3WU0A 2DA5A 4BACA 3V8JA 3H5NA 1BIAA 5J3LA 2A5YB 2VXZA 2CMPA 2K86A 4FHTA 1FYMA 3HZJA 3FXRA 2D45A 1A31A 3HYIA 1WI9A 3SZPA 3OY9A 4IZZA 1DQUA 5FFXA 3FK7A 3TO7A 1YG2A 4U0VA 4L9TA 2CV0A 1I50J 5J1UA 2NYXA 1SAUA 1W5SA 3E5XA 3P9KA 3L2RA 1KU7A 3U21A 2MLGA 1G59A 3H5AA 3JREA 2WAEA 5LHGA 3TW7A 1Z67A 1BI1A 2UWMA 3EUAA 1PYVA 2HU9A 5J47A 3ZQIA 1N77A 1ZELA 2EV6A 2W84A 1YX5A 1KONA 5JLWA 4MIMA 2EV5A 2DMUA 2DA1A 2HDCA 3F72A 1DGRM 1QQIA 2DBBA 4G6TB 4QPQA 5CVIA 2MH2A 2E1OA 2NVYJ 3KFWX 3VYSB 3LOCA 4IF4A 4G9YA 1MIJA 2TDXA 2VL8A 1BC8C 2W00A 2OU2A 1NHAA 1WH5A 2PN6A 3R0JA 2A6TA 3FX3A 1H0MA 4BNCA 2XF5A 3LQRA 5CVUA 1XGSA 1IRFA 1TLHB 4HRIA 2X48A 4M9XA 1OCOH 1TNSA 5M5XJ 4PSXA 2HOTA 3IH4A 2Y0MA 4RAGA 1Y8QB 1X1CA 1EA3A 2N8GA 1P7IA 1V3FA 3Q0WA 4BJTA 1W0UA 2RVCA 2R7UA 2ZMEC 1B1BA 5DM6F 2XB5A 4A6DA 2Z99A 2Z3YA 3BG6A 1D5YA 2OCEA 4NC8A 1JKQC 3CO6C 3QPSA 2VKDA 4WX9A 2BW3A 4YG2F 1HLVA 2LKPA 2EFOA 4U7BA 1R1TA 2VUMJ 3WTWC 5EF6A 2IXSA 5IT9R 3PNVA 4HQEA 2F4OB 1RKWA 2H1LA 2IGKA 2OC6A 1R7JA 3WODF 2IAIA 3BR1A 2EFWA 3S32A 2E19A 4KDPA 4U88A 1YLFA 4QPOA 3O6BB 2K27A 3ZOBA 1YHQI 3SZGA 4DZPA 5H2FC 2CQ7A 1I6HJ 5DUKA 4CA0A 3COAC 2BOLA 4RB0A 1VI0A 4U7DA 3A01A 3C1DA 3CESA 3EUKL 3DCFA 4O3MA 4PJLA 4MTDA 1OFCX 2GXBA 2YS9A 1YRNA 4XRFA 4BAYA 1R58A 4QTRA 2V6CA 3VYUB 3V42A 4H0EA 2L02A 5DM7F 3BT9A 1K6OA 1TWAJ 1NG7A 5D5XB 3JRGA 3KP7A 2OCCH 1XX5A 3ML6A 4NC7A 1F5TA 1FIPA 5GAHJ 5J4YA 1D1CA 2RNGA 1MBHA 3G4SI 3GYHX 3Q3SA 1A04A 2ZO4A 3K4LA 1I1GA 3PSIA 2WTEA 2BHYA 2IRFG 3H0GJ 4PSWA 1FPQA 4HEA2 5ILSA 3SXYA 2QKMB 4M74A 3H3UA 1VQKI 2VQGA 3V7SA 5H6RA 4KNYA 3I4MJ 5M3MJ 4UNOA 3QU3A 4I7HA 4HF1A 1XGMA 4JOMA 4XN0A 1I6XA 2FNAA 2JJ7A 3HOVJ 1A6IA 2HWVA 4IHYA 1OCPA 3PSFA 2MUNA 3R6SA 1Y1VJ 2LBFA 4AIDA 1MMGA 2LSOA 1U5TB 4YELA 5LGTA 2HPMA 4KICA 1SFOJ 3TO6A 3ABKH 1QA6A 2E71A 2YUSA 1ZTRA 2W1OA 1HBXG 4DGWB 3C2BA 1WI3A 2P0TA 1DDNA 4RBOA 2XGEA 1LE8B 2FRHA 3OL3A 3GFMA 3WGHA 3ONQA 3J81Z 1SFEA 4OOIA 1WQ2A 4YFXF 3AKZA 2DU9A 1SVLA 1UHMA 1W36D 1B59A 2IA0A 2VBWA 3FBIB 3E5UA 3CCMI 2Y9ZA 3MD2A 1YITI 1OLTA 3WTXC 1CF7A 2A68F 2KLOA 3B73A 1IRXA 1IUYA 2X6XA 1OCRH 2VBXA 2OZ6A 3RDIA 3GTLJ 2EFQA 3K4BA 2GXAA 4HF2A 1VZ0A 4B44A 5AIQA 1AU7A 2A61A 4BBSJ 1OJLA 1HOMA 4IPAA 2ZXHA 1B72A 4LG3A 1T08B 2HQAA 3SDBA 2JQ7A 2CRGA 2JRMA 3KPHA 4CZZA 2JA7J 2Y30A 2XPVA 2QWWA 3HTSB 4F92B 3MFKA 3K70C 1HXDA 2DOAA 2P0WA 2MYSA 3V8KA 5J40A 3OYCA 1ZKGA 1VQ9I 5KK1A 1HDPA 1OMIA 4PUSA 3PO2J 2PMUA 4GGGA 1FT9A 1NTCA 1WH7A 1G4DA 1GV2A 1FBSA 4M72A 2FQ4A 4XKWA 3M4OJ 2R5ZA 1UG2A 4GFBA 2Q8KA 1HW1A 1W5CC 3K6GA 3WTUC 1GT0C 5FD5A 2LYCA 3J7YJ 2R4GA 3WU1B 2QCOA 1UAAA 4PJJA 3GWZA 2DA2A 3HC7A 3D1NI 1KGSA 2YX4A 4DYQA 1MKMA 5H20A 2PJPA 1P4AA 2NS7A 2KKOA 1E3HA 1HA8A 1XSXA 3JRHA 3PUFA 1RZ4A 3I3LA 3ZMDA 4E4HA 1S5LC 1XN7A 2LNBA 4MEXF 3WG7H 3F21A 1ZRFA 4EMSA 2E2JJ 5D8LB 5E20A 1USTA 1J9IA 3MMYB 2Q1ZB 2KFDA 5GAGJ 5ILUA 3VODA 2KIMA 4UVBA 4KISA 2DMTA 3CZ6A 3IL2A 3TDUC 2BW3B 3QYBA 2R7DA 4RM3A 1ETQA 1GVDA 4YIRX 4HYEA 3R4KA 2CW7A 2IGNA 2ZJPF 3MWMA 4F52A 3F23A 2FD5A 3UR3C 2FXAA 4OIOF 5D4RA 4BH9A 1LFBA 5J6XA 4I98B 1ACIA 2ZXIA 5C3EJ 4OIQF 4Y3OA 4M6VA 4PDKA 4NQWA 5DCMA 4R79A 3A02A 4IHVA 3BY6A 3FKIJ 1JTXA 1BN5A 3O3KA 3A01B 3DV8A 3FHNA 4PK4A 2ZC2A 4J00A 2QGUA 1DUXC 3FMRA
chains in the Genus database with same CATH topology
5IT9Z 1XMKA 3GLXA 3ROUA 3BDDA 1ONVA 1DPRA 2ZCWA 3RKXA 3W6KB 5D6EA 4G8XA 4Y15A 1E2XA 1HW2A 1OYIA 1UHWA 4AIHA 1OPCA 3KZYA 3F6OA 4MNUA 1XCVA 2E1CA 5D5WB 1WSUA 1FY7A 2M87A 3LFKA 2HTSA 1LDKB 3LAPA 2DQLA 1BM9A 3ABUA 5BPDA 4ESBA 4UXNA 1E17A 4RS8A 1O7LA 1K78B 3GFLA 2G7UA 1Q1HA 2Q2EA 3QPTA 4BXUA 2ISYA 5EEGA 1CF7B 2IA1A 2Z5UA 1YQAA 3JTHA 1OR7A 5E8IA 5D8KB 1UCRA 3KEOA 5LBQA 1IN6A 1TBXA 5ICCA 2CYYA 4CYDA 2RDPA 3F8NA 2M1BA 3L9FA 2F5DA 1EV7A 3M8FA 5L3BA 3EQLF 3IC7A 1PUEE 2PLYA 2L54A 5ED4A 2FSWA 4G7HF 5K5QA 4RB2C 4ZYDA 3CUQC 2G9WA 5ERIA 4RGUA 3HOTA 3HTUA 1HSTA 4OIRF 5JVTA 1VTNC 1O3RA 5D6FA 4BHCA 2QQBA 1G3SA 4HX4A 4XSZF 1ZHFA 2P7CB 1LVAA 3PFIA 4ZH4F 4I0BA 3KP5A 1G3WA 1W4MA 2OD5A 1U6GA 3DKWA 2A3SA 2Z33A 3U9GA 2QQAA 5J8CA 3I71A 2VE9A 4ENMA 1FP2A 3T1BA 1XSDA 3ELKA 3J81K 3I59A 2EA4A 1STZA 1DPUA 2KJCA 3P9CA 4KFCA 3B02A 3F8MA 2AXLA 3I64A 3IRRA 5BQTA 2L4AA 1ZGJA 1FYKA 5DCMB 4ZYHA 3P9IA 2GA2A 4LJZF 3RPUA 2MC3A 1I27A 2ADUA 5F1RA 4MEYF 4LMYA 4WF2A 5LLQA 2NNYA 1W5TA 1LNWA 1FOKA 2GA1A 1SAXA 4NB5A 5BOXA 3R60A 3DPLC 5HS7A 3V7RA 1O3QA 1O3TA 1P2FA 3PQKA 1FBQA 2XUBA 1R22A 4G94A 1S29A 1J0RA 2QQ9A 4YFKF 1JHHA 2MA3A 3K9TA 4MQVA 2EWNA 1ZRDA 2VBZA 3M8EA 2EK5A 3GFIA 2RV8A 5HDGA 2J5OA 5D5UB 5H6QA 4WCGA 4HBLA 3T5XA 2EFPA 3V4GA 3F22A 4EJUA 4HLXA 5CYVA 4M71A 3M9AA 3DXJF 3BROA 3QP6A 1KU9A 2R3SA 5AIPA 1B9MA 2DPDA 4N0BA 3HHGA 2V1XA 3TDZC 2E1NA 4IHTA 2ACJA 1U5TC 3FMSA 3BPVA 4PGGA 4OIPF 3V7CA 2CWEA 1FZPB 2UXNA 5ICGA 4WXDA 2XASA 4HAMA 3WTZA 2W25A 1FWZA 3HSRA 3NEUA 4IRHA 5DUIA 4EJVA 5FO5A 3JAMZ 1XGNA 4I01A 4L9JA 1R1UA 3TKYA 1FBUA 4N9HA 3I59B 1SFXA 3T8RA 3O2PE 1HW5A 5L3EA 1GXPA 3I5UA 2O8XA 3RPQA 3I58A 4UUVA 5J8FA 1ZG5A 5JHUA 5K5OA 2D2WA 2A6EF 1ON1A 1ZG3A 1YS6A 2CFXA 2YU3A 3H92A 3GZ6A 2YX7A 4R8HA 4IXAA 1B9NA 4B09A 2IA2A 1LEAA 5L3FA 1R5GA 5K1YA 1D8JA 1ZARA 4GYIA 3U2RA 2F2EA 2QUFA 1XB4A 1IN7A 4IRIA 2YSRA 2DLLA 2IT0A 2ELHA 1Z05A 1MD0A 2KIFA 1O3SA 3T8TA 2XAHA 5E1ZB 3GXOA 1BBYA 4HDVA 4RGXA 1HKQA 3E5QA 5FLXZ 2PEXA 2Y48A 1G6NA 3EUHA 4ZYEA 1RNLA 1T2KA 2XHKA 4XLPF 3GZ5A 1IN4A 4P55A 2EJRA 4AWXB 1QNTA 1GXQA 4MGRA 2C6YA 2HQRA 4ZZLA 3KE2A 3HSEA 4ASNA 2L4MA 2PMHA 3NRVA 1L3LA 2DT5A 2ZXJA 2NRAC 2CGPA 2OQGA 4KT5C 4HA8A 1HQCA 4LFUA 1REPC 1ZREA 2LF7A 2CSOA 2DI3A 2ZFWA 2YR2A 3ULQB 5DV5A 2HZTA 2XGXA 3HIFA 1KYWA 4RAYA 2VODA 3ZMSA 2O03A 3RIRA 3L2CA 3J80Z 1PP8F 1ODDA 1QO0D 1ZN2A 2RC4A 3F8BA 3VB2A 4FX0A 4Z2YA 3E6DA 5ICEA 4HX7A 1U8RA 4XLNF 3I54A 4KUMA 4PGHA 3RTRA 3IHUA 1DP7P 2XAGA 2VOPA 2V1DA 3QPHA 4HX8A 4WWCA 3GO5A 2JT1A 2FE3A 4HF0A 5HVQC 3BJ6A 3EDPA 5DCFA 1WRJA 1YW9A 2P6TA 3FM3A 4WXCA 4ON0A 3JW4A 3MQ0A 3ZMUA 1RUNA 2W57A 3ERED 3R0AA 4HV5A 1U2WA 3CJNA 2F5EA 2FOKA 3BWGA 1BI3A 4MTEA 1RUOA 4RAZA 5HLHA 2DK5A 2VONA 2XAJA 1Z1DA 3VFZA 1EH7A 4AIJA 2HQNA 2Y75A 2X4HA 1YTYA 2PI0A 3EETA 2MBFA 5DYMA 3E3VA 3DQVC 3HHHA 2IVMA 4HDUA 2G7HA 3ZMVA 4KIFA 5LHHA 1I5ZA 4KIBA 1SD5A 1T98A 1S3JA 3DF8A 1MZBA 3FM5A 1KU2A 4LGWA 3JAMK 3FXUA 4YFNF 3RYRA 4AIKA 4CGZA 1S7AA 4A2UA 3OOPA 1WWXA 1SFUA 5FD6A 1MGTA 2STTA 2BYVE 3ISPA 5KVRA 1R36A 3QU6A 1BJAA 2KIUA 4EM2A 1XGOA 1IN8A 4I0AA 3L00A 5FB2A 2XIGA 3BZ6A 3WG9A 2JRTA 4EQQA 3J7AO 1BI0A 1Z6TA 1KA8A 3DP7A 2STWA 4JQFA 2GQQA 4LB5A 5JI6A 3N4MA 3Q9VA 4OMYA 2W85A 1TW2A 2HKXA 4I09A 1J59A 4KMUX 1BOAA 1YW7A 3QAHA 2VBYA 1LDDA 2KJBA 3MAJA 4EM0B 2P4WA 1R23A 1AWCA 2FU4A 3K69A 4EV0A 2GZWA 3T0YA 4LLGF 4RB3C 5ICFA 1KQ9A 3E6MA 1FNNA 3MZYA 2VT3A 1OYWA 5HS9A 2DW4A 5CJ9A 2K02A 3FF5A 4ENNA 2A6HF 3VOEA 1MDMA 2DTRA 4U0WA 3EYIA 3WTTC 2YPRA 1SMTA 4Y17A 2M45A 1R1VA 4A5MA 2LF8A 4QWQA 1W7PA 2FMLA 1P6RA 5LGNA 3WE2A 1Y0UA 3LA3A 2CG4A 3CTAA 4O5VA 3QOPA 3LSTA 2ZJ2A 4D0PA 4EJTA 2EV0A 4BYYA 1KYZA 2MLKA 1LB2A 2IPQX 2O0YA 2OBPA 4HV6A 3QP5A 3TOAA 1EH6A 4I2OA 3H3ZA 4QLCU 5K5RA 3GUDA 1IZ1A 2V9VA 3WGIA 3DPTA 4OMZA 2BGCA 1ULYA 4L0YB 1FYLA 2R7FA 2HGCA 4JK1X 4ZZDA 3I0TA 2HKOA 1IXRC 2KRFA 1XCBA 1FSEA 3MEXA 3K0LA 1MJBA 3QRFF 3D0SA 4BHBA 3TOBA 5TRDA 1HSJA 5DD4A 1EH8A 4S04A 3RYPA 5LGUA 1UFMA 2VC1A 4L5JA 4M6XA 4EJWA 4B8XA 3F8CA 4WK8F 2L3DA 1FC3A 4UVCA 5HOOA 2O61A 5LEJA 1ZH5A 1GHCA 1TNTA 2IP2A 1P92A 2OAZA 5E18F 5TJJA 2XAFA 4Q4ZF 5A2QZ 4G6QA 1USSA 2DQRA 1MDMB 6PAXA 3WTYC 3HUGA 4KMFA 5IT9K 3E6CC 3S2WA 4OINF 3IKVA 3JTGA 2QZ8A 4M9SA 2XKOA 5E8GA 2K4BA 2RNJA 4CICA 1GVJA 2IJLA 2RKHA 3HRSA 2P5LC 4Y13A 5BS6A 1T0FA 4YIIA 4L18B 1ZAOA 3REOA 4HZFA 3KP3A 5CLSA 5CVVA 1W7PD 5F64A 3KLNA 4A0XA 1IRGA 1SD7A 3ZQ7A 3ZP5A 1F1ZA 2GWRA 2HOEA 5L3DA 3KP6A 2ZBKA 4IJAA 2RQPA 2GXGA 3HRMA 3F3XA 5HDNA 4L9NA 2M30A 3JSPA 4RGRA 4IRGA 1QZZA 1TQMA 3L7WA 1TQIA 3KETA 1YFHA 1I1SA 1XSVA 2H27A 2HYFA 3IKTA 3RKWA 3P7NA 5FFZA 1J75A 2RN7A 1IW7F 3WTVC 3KP2A 4F7ZA 1FX7A 1X3UA 4RB1A 2JZYA 2K4JA 4P5OA 1IAWA 3WTSC 5ILVA 3LQQA 1SD6A 4GYGA 2D1VA 4LK0F 4S05A 3TGNA 3ZN0A 3IRQA 1ZG1A 1HKTA 5LRSA 2FQ3A 3WE3A 3I4PA 2XVCA 2H6BA 4FT8A 4DNCA 1Z9CA 1LDJA 2VT2A 2PBIA 4KYWA 1ZGAA 4HW0A 4KA4A 2XROA 1IXSB 2MD5A 2BE5F 2LDUA 1JHFA 4UV9A 4TV7A 1SMYF 4LLNA 1OYYA 1OKRA 2HR3A 4XBFA 2PQ8A 1U3EM 3GEZA 1ZLJA 3F8FA 4R1HA 3HSFA 5HDKA 3IWZA 1O7FA 5CVRA 2ZMEA 4GXOA 1R5HA 2JPBA 3FMQA 2VE8A 2DO7A 3I53A 1F9NA 1WKMA 1BI2A 4FX4A 3GW2A 2XV4S 1P4WA 2ZNYA 2FMYA 3KCCA 2IW5A 3C18A 2XRNA 5JR3A 3RJPA 3PQJA 4ESFA 4ENJA 2QENA 3U1DA 4KN7X 2EFNA 5A2QK 2FBHA 3F6VA 4A12A 4CO8A 5HLIA 2A07F 4G7OF 5D5VB 1K78A 1V4RA 1JE8A 1K7AA 1KQ0A 5L3CA 1JXSA 4G7ZF 4MQ9F 4E70A 4M73A 3NQOA 3ZN1A 2UXXA 3K1MA 5JFRA 1QBJA 2A69F 5LRRA 3E97A 1BC7C 1YO5C 2P7VB 2JSCA 3MCZA 3KP4A 3CLOA 2E7WA 3JSOA 1QZYA 2P5KA 1O57A 2E7XA 5DDGA 2NAZA 1LQ1A 1FLIA 2J5PA 4G6DA 1F4KA 4PCQA 2L01A 4UVAA 2QLZA 4N9IA 3VEPA 3RI4A 2FA5A 3G3ZA 1T39A 4P9UA 4OU0A 4BQAA 1ZRCA 1QGPA 2HFHA 3KZZA 1C0WA 1T6SA 2V79A 1P4XA 2M8EA 5FGMA 2W24A 3K1PA 3HRUA 2FBIA 3KEQA 4PZJA 2ESHA 1J7KA 3LWFA 1HKSA 1L0OC 3SQNA 3K1NA 3SHFA 2RGVA 2FNPA 4L9VA 3D5LA 3RKYA 2NS0A 2ZMEB 3WGGA 4P9FA 4LB6B 3ABTA 2Z9OA 5D4SA 2PG4A 1IF1A 1BIBA 3ZPLA 2XKPA 2WV0A 3BOQA 3CUOA 4P96A 2F5CA 3GVAA 2GIVA 2FEZA 3M1EA 3MZHA 3ECOA 5FLXK 4LG0A 2BEOA 2VN2A 2PFBA 3CO7C 4EM1A 5F6FA 3IWFA 1LJ9A 2D1HA 2H94A 2HEOA 4CDGA 2AS5F 3E6BA 4GCVA 2QYOA 1FSHA 1G3TA 2M5WA 2CO5A 4I02A 3FZVA 1FP1D 4A0ZA 1YYVA 2V1UA 2F5FA 1TTYA 3CDHA 3GX4X 2JTVA 4M9ZA 3FWEA 4O6JA 4MHGA 1XDSA 2H6CA 3LA7A 5BPIA 5HLGA 1RI7A 3FHZA 3ZMTA 1S7OA 1YIOA 4ESJA 3BPXA 5CVJA 3J80K 2QVOA 1CGPA 1J2XA 3Q5FA 1U78A 3GFJA 2DFIA 2CQKA 2VC0A 3V8LA 4A6EA 4AVPA 3W6JB 2OQRA 2P8TA 1MJ9A 4ETSA 2FBKA 1PDNC 1D3YA 1TW3A 1ZYRF 1SD4A 2H09A 1T38A 1KQ8A 3BP8A 3GF2A 3C3WA 4L0ZB 4A0YA 3L09A 3N97A 1R00A 5IT3A 3CUQA 5AONA 2X0LA 1Z7UA 1Z6RA 1KU3A 5DD8A 2QBYA 2O3FA 4GO1A 1UB9A 2QM3A 5E1WA 1XD7A 2COMA 1D8KA 5E1XA 3LAJA 1XMAA 5E17F 1IXCA 4LLLA 2MH9A 1LEBA 2DK8A 1ZLKA 4HLYA 2ZNZA 4IVNA 4EJOA 3K2ZA 4EVIA 2GAUA 3LA2A 1JGSA 2BBYA 4YIFA 2DPUA 2VOOA 5LEKA 3M7GA 3TO9A 3KLOA 4Q5SF 4A5NA 1PP7U 4JBAA 2CW0F 2DAOA 4RGSA 4BHPA 3HRTA 4LG0B 1B4AA 2JPCA 5L3GA 1MJAA 4DQ2A 2XAQA 4NHJA 5EEHA 2WWYA 1QPMA 1S6LA 2UZKA 3EYYA 3R61A 4HOBA 4HQMA 3BJAA 1XDUA 2OA4A 4EGYA 2ISZA 1B6AA 5LHIA 1H9GA 5DEQA 1J5YA 2BV6A 3C7JA 3TQNA 4CXFA 4K2EA 2OZUA 4U0YA 3HOSA 5HS8A 1K79A 2HS5A 4WXHA 1W7PB 2K7LA 2P6SA 3DEUA 4LK1F 2EA2A 4KIGA 1Z91A 3BJOA 1ON2A 4LD5A 2ETHA 4AD9A 2ESNA 1YS7A 1AOYA 4IHSA 1D5VA 3OV8A 2HYGD 1G3YA 3ZMZA 3ECHA 4XSXF 1YW8A 3SFZA 4ENKA 1S8NA 2O6GE 1IN5A 5BMZA 2B0LA 4EGZA 3SZTA 4KN4X 3FXQA 2WC2A 3G73A 2EB7A 2ZKZA 3AAFA 2NNNA 3CUQB 4CHUA 2HTJA 1U5TA 1H9TA 4ZYGA 4UV8A 4M6YA 2FF4A 3Q9SA 1RIOH 2QBYB 3DFGA 4Q47A 2Q0OA 4UHTA 1TQPA 4Q48A 4L5IA 2P5VA 3WU0A 3V8JA 1BIAA 2A5YB 2VXZA 2K86A 4FHTA 1FYMA 3FXRA 2D45A 3HYIA 1WI9A 3SZPA 5FFXA 3TO7A 1YG2A 4U0VA 4L9TA 2NYXA 1W5SA 3E5XA 3P9KA 1KU7A 2MLGA 5LHGA 1BI1A 2UWMA 2EV6A 2W84A 2EV5A 2HDCA 3F72A 1QQIA 2DBBA 5CVIA 2MH2A 3KFWX 4IF4A 4G9YA 2TDXA 1BC8C 2OU2A 1NHAA 2PN6A 3R0JA 3FX3A 1H0MA 4BNCA 3LQRA 5CVUA 1XGSA 1IRFA 1TLHB 4M9XA 1TNSA 2Y0MA 1V3FA 2RVCA 1B1BA 4A6DA 2Z99A 2Z3YA 3CO6C 4WX9A 4YG2F 2LKPA 2EFOA 4U7BA 1R1TA 3WTWC 4HQEA 1R7JA 3WODF 2EFWA 4KDPA 4U88A 1YLFA 3O6BB 2K27A 5DUKA 3COAC 4RB0A 4U7DA 3C1DA 4O3MA 4MTDA 2GXBA 4XRFA 4BAYA 1R58A 2V6CA 4H0EA 2L02A 1K6OA 5D5XB 3KP7A 3ML6A 1F5TA 3GYHX 1A04A 2ZO4A 1I1GA 2WTEA 2IRFG 3SXYA 1FPQA 5ILSA 4M74A 3H3UA 3V7SA 5H6RA 4KNYA 4UNOA 3QU3A 4I7HA 4HF1A 1XGMA 1I6XA 2FNAA 2HWVA 3R6SA 2LSOA 1U5TB 5LGTA 4KICA 3TO6A 1HBXG 1DDNA 3J81Z 2FRHA 3GFMA 3WGHA 1SFEA 4OOIA 1WQ2A 4YFXF 2DU9A 1UHMA 1B59A 2IA0A 2VBWA 3E5UA 3WTXC 1CF7A 2A68F 3B73A 1IUYA 2VBXA 3RDIA 2OZ6A 2EFQA 4HF2A 5AIQA 2A61A 4IPAA 4CZZA 2QWWA 3HTSB 3MFKA 1HXDA 3V8KA 5KK1A 1OMIA 2PMUA 4GGGA 1FT9A 1G4DA 1FBSA 4M72A 2Q8KA 1HW1A 3WTUC 5FD5A 3WU1B 3GWZA 1KGSA 2YX4A 1MKMA 5H20A 2PJPA 1P4AA 2KKOA 1XSXA 1RZ4A 3ZMDA 2LNBA 1XN7A 4MEXF 1ZRFA 3F21A 4EMSA 5D8LB 5E20A 1USTA 1J9IA 5ILUA 3VODA 2KIMA 4UVBA 3IL2A 3TDUC 2R7DA 4HYEA 3R4KA 3MWMA 3F23A 2FXAA 4OIOF 5D4RA 4BH9A 5J6XA 4I98B 4OIQF 4PDKA 4NQWA 5DCMA 4R79A 3BY6A 1BN5A 3O3KA 3DV8A 1DUXC 3FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 Z;  1XMK A;  3GLX A;  3ROU A;  3BDD A;  1ONV A;  1DPR A;  2ZCW A;  3RKX A;  3W6K B;  5D6E A;  4G8X A;  4Y15 A;  1E2X A;  1HW2 A;  1OYI A;  1UHW A;  4AIH A;  1OPC A;  3KZY A;  3F6O A;  4MNU A;  1XCV A;  2E1C A;  5D5W B;  1WSU A;  1FY7 A;  2M87 A;  3LFK A;  2HTS A;  1LDK B;  3LAP A;  2DQL A;  1BM9 A;  3ABU A;  5BPD A;  4ESB A;  4UXN A;  1E17 A;  4RS8 A;  1O7L A;  1K78 B;  3GFL A;  2G7U A;  1Q1H A;  2Q2E A;  3QPT A;  4BXU A;  2ISY A;  5EEG A;  1CF7 B;  2IA1 A;  2Z5U A;  1YQA A;  3JTH A;  1OR7 A;  5E8I A;  5D8K B;  1UCR A;  3KEO A;  5LBQ A;  1IN6 A;  1TBX A;  5ICC A;  2CYY A;  4CYD A;  2RDP A;  3F8N A;  2M1B A;  3L9F A;  2F5D A;  1EV7 A;  3M8F A;  5L3B A;  3EQL F;  3IC7 A;  1PUE E;  2PLY A;  2L54 A;  5ED4 A;  2FSW A;  4G7H F;  5K5Q A;  4RB2 C;  4ZYD A;  3CUQ C;  2G9W A;  5ERI A;  4RGU A;  3HOT A;  3HTU A;  1HST A;  4OIR F;  5JVT A;  1VTN C;  1O3R A;  5D6F A;  4BHC A;  2QQB A;  1G3S A;  4HX4 A;  4XSZ F;  1ZHF A;  2P7C B;  1LVA A;  3PFI A;  4ZH4 F;  4I0B A;  3KP5 A;  1G3W A;  1W4M A;  2OD5 A;  1U6G A;  3DKW A;  2A3S A;  2Z33 A;  3U9G A;  2QQA A;  5J8C A;  3I71 A;  2VE9 A;  4ENM A;  1FP2 A;  3T1B A;  1XSD A;  3ELK A;  3J81 K;  3I59 A;  2EA4 A;  1STZ A;  1DPU A;  2KJC A;  3P9C A;  4KFC A;  3B02 A;  3F8M A;  2AXL A;  3I64 A;  3IRR A;  5BQT A;  2L4A A;  1ZGJ A;  1FYK A;  5DCM B;  4ZYH A;  3P9I A;  2GA2 A;  4LJZ F;  3RPU A;  2MC3 A;  1I27 A;  2ADU A;  5F1R A;  4MEY F;  4LMY A;  4WF2 A;  5LLQ A;  2NNY A;  1W5T A;  1LNW A;  1FOK A;  2GA1 A;  1SAX A;  4NB5 A;  5BOX A;  3R60 A;  3DPL C;  5HS7 A;  3V7R A;  1O3Q A;  1O3T A;  1P2F A;  3PQK A;  1FBQ A;  2XUB A;  1R22 A;  4G94 A;  1S29 A;  1J0R A;  2QQ9 A;  4YFK F;  1JHH A;  2MA3 A;  3K9T A;  4MQV A;  2EWN A;  1ZRD A;  2VBZ A;  3M8E A;  2EK5 A;  3GFI A;  2RV8 A;  5HDG A;  2J5O A;  5D5U B;  5H6Q A;  4WCG A;  4HBL A;  3T5X A;  2EFP A;  3V4G A;  3F22 A;  4EJU A;  4HLX A;  5CYV A;  4M71 A;  3M9A A;  3DXJ F;  3BRO A;  3QP6 A;  1KU9 A;  2R3S A;  5AIP A;  1B9M A;  2DPD A;  4N0B A;  3HHG A;  2V1X A;  3TDZ C;  2E1N A;  4IHT A;  2ACJ A;  1U5T C;  3FMS A;  3BPV A;  4PGG A;  4OIP F;  3V7C A;  2CWE A;  1FZP B;  2UXN A;  5ICG A;  4WXD A;  2XAS A;  4HAM A;  3WTZ A;  2W25 A;  1FWZ A;  3HSR A;  3NEU A;  4IRH A;  5DUI A;  4EJV A;  5FO5 A;  3JAM Z;  1XGN A;  4I01 A;  4L9J A;  1R1U A;  3TKY A;  1FBU A;  4N9H A;  3I59 B;  1SFX A;  3T8R A;  3O2P E;  1HW5 A;  5L3E A;  1GXP A;  3I5U A;  2O8X A;  3RPQ A;  3I58 A;  4UUV A;  5J8F A;  1ZG5 A;  5JHU A;  5K5O A;  2D2W A;  2A6E F;  1ON1 A;  1ZG3 A;  1YS6 A;  2CFX A;  2YU3 A;  3H92 A;  3GZ6 A;  2YX7 A;  4R8H A;  4IXA A;  1B9N A;  4B09 A;  2IA2 A;  1LEA A;  5L3F A;  1R5G A;  5K1Y A;  1D8J A;  1ZAR A;  4GYI A;  3U2R A;  2F2E A;  2QUF A;  1XB4 A;  1IN7 A;  4IRI A;  2YSR A;  2DLL A;  2IT0 A;  2ELH A;  1Z05 A;  1MD0 A;  2KIF A;  1O3S A;  3T8T A;  2XAH A;  5E1Z B;  3GXO A;  1BBY A;  4HDV A;  4RGX A;  1HKQ A;  3E5Q A;  5FLX Z;  2PEX A;  2Y48 A;  1G6N A;  3EUH A;  4ZYE A;  1RNL A;  1T2K A;  2XHK A;  4XLP F;  3GZ5 A;  1IN4 A;  4P55 A;  2EJR A;  4AWX B;  1QNT A;  1GXQ A;  4MGR A;  2C6Y A;  2HQR A;  4ZZL A;  3KE2 A;  3HSE A;  4ASN A;  2L4M A;  2PMH A;  3NRV A;  1L3L A;  2DT5 A;  2ZXJ A;  2NRA C;  2CGP A;  2OQG A;  4KT5 C;  4HA8 A;  1HQC A;  4LFU A;  1REP C;  1ZRE A;  2LF7 A;  2CSO A;  2DI3 A;  2ZFW A;  2YR2 A;  3ULQ B;  5DV5 A;  2HZT A;  2XGX A;  3HIF A;  1KYW A;  4RAY A;  2VOD A;  3ZMS A;  2O03 A;  3RIR A;  3L2C A;  3J80 Z;  1PP8 F;  1ODD A;  1QO0 D;  1ZN2 A;  2RC4 A;  3F8B A;  3VB2 A;  4FX0 A;  4Z2Y A;  3E6D A;  5ICE A;  4HX7 A;  1U8R A;  4XLN F;  3I54 A;  4KUM A;  4PGH A;  3RTR A;  3IHU A;  1DP7 P;  2XAG A;  2VOP A;  2V1D A;  3QPH A;  4HX8 A;  4WWC A;  3GO5 A;  2JT1 A;  2FE3 A;  4HF0 A;  5HVQ C;  3BJ6 A;  3EDP A;  5DCF A;  1WRJ A;  1YW9 A;  2P6T A;  3FM3 A;  4WXC A;  4ON0 A;  3JW4 A;  3MQ0 A;  3ZMU A;  1RUN A;  2W57 A;  3ERE D;  3R0A A;  4HV5 A;  1U2W A;  3CJN A;  2F5E A;  2FOK A;  3BWG A;  1BI3 A;  4MTE A;  1RUO A;  4RAZ A;  5HLH A;  2DK5 A;  2VON A;  2XAJ A;  1Z1D A;  3VFZ A;  1EH7 A;  4AIJ A;  2HQN A;  2Y75 A;  2X4H A;  1YTY A;  2PI0 A;  3EET A;  2MBF A;  5DYM A;  3E3V A;  3DQV C;  3HHH A;  2IVM A;  4HDU A;  2G7H A;  3ZMV A;  4KIF A;  5LHH A;  1I5Z A;  4KIB A;  1SD5 A;  1T98 A;  1S3J A;  3DF8 A;  1MZB A;  3FM5 A;  1KU2 A;  4LGW A;  3JAM K;  3FXU A;  4YFN F;  3RYR A;  4AIK A;  4CGZ A;  1S7A A;  4A2U A;  3OOP A;  1WWX A;  1SFU A;  5FD6 A;  1MGT A;  2STT A;  2BYV E;  3ISP A;  5KVR A;  1R36 A;  3QU6 A;  1BJA A;  2KIU A;  4EM2 A;  1XGO A;  1IN8 A;  4I0A A;  3L00 A;  5FB2 A;  2XIG A;  3BZ6 A;  3WG9 A;  2JRT A;  4EQQ A;  3J7A O;  1BI0 A;  1Z6T A;  1KA8 A;  3DP7 A;  2STW A;  4JQF A;  2GQQ A;  4LB5 A;  5JI6 A;  3N4M A;  3Q9V A;  4OMY A;  2W85 A;  1TW2 A;  2HKX A;  4I09 A;  1J59 A;  4KMU X;  1BOA A;  1YW7 A;  3QAH A;  2VBY A;  1LDD A;  2KJB A;  3MAJ A;  4EM0 B;  2P4W A;  1R23 A;  1AWC A;  2FU4 A;  3K69 A;  4EV0 A;  2GZW A;  3T0Y A;  4LLG F;  4RB3 C;  5ICF A;  1KQ9 A;  3E6M A;  1FNN A;  3MZY A;  2VT3 A;  1OYW A;  5HS9 A;  2DW4 A;  5CJ9 A;  2K02 A;  3FF5 A;  4ENN A;  2A6H F;  3VOE A;  1MDM A;  2DTR A;  4U0W A;  3EYI A;  3WTT C;  2YPR A;  1SMT A;  4Y17 A;  2M45 A;  1R1V A;  4A5M A;  2LF8 A;  4QWQ A;  1W7P A;  2FML A;  1P6R A;  5LGN A;  3WE2 A;  1Y0U A;  3LA3 A;  2CG4 A;  3CTA A;  4O5V A;  3QOP A;  3LST A;  2ZJ2 A;  4D0P A;  4EJT A;  2EV0 A;  4BYY A;  1KYZ A;  2MLK A;  1LB2 A;  2IPQ X;  2O0Y A;  2OBP A;  4HV6 A;  3QP5 A;  3TOA A;  1EH6 A;  4I2O A;  3H3Z A;  4QLC U;  5K5R A;  3GUD A;  1IZ1 A;  2V9V A;  3WGI A;  3DPT A;  4OMZ A;  2BGC A;  1ULY A;  4L0Y B;  1FYL A;  2R7F A;  2HGC A;  4JK1 X;  4ZZD A;  3I0T A;  2HKO A;  1IXR C;  2KRF A;  1XCB A;  1FSE A;  3MEX A;  3K0L A;  1MJB A;  3QRF F;  3D0S A;  4BHB A;  3TOB A;  5TRD A;  1HSJ A;  5DD4 A;  1EH8 A;  4S04 A;  3RYP A;  5LGU A;  1UFM A;  2VC1 A;  4L5J A;  4M6X A;  4EJW A;  4B8X A;  3F8C A;  4WK8 F;  2L3D A;  1FC3 A;  4UVC A;  5HOO A;  2O61 A;  5LEJ A;  1ZH5 A;  1GHC A;  1TNT A;  2IP2 A;  1P92 A;  2OAZ A;  5E18 F;  5TJJ A;  2XAF A;  4Q4Z F;  5A2Q Z;  4G6Q A;  1USS A;  2DQR A;  1MDM B;  6PAX A;  3WTY C;  3HUG A;  4KMF A;  5IT9 K;  3E6C C;  3S2W A;  4OIN F;  3IKV A;  3JTG A;  2QZ8 A;  4M9S A;  2XKO A;  5E8G A;  2K4B A;  2RNJ A;  4CIC A;  1GVJ A;  2IJL A;  2RKH A;  3HRS A;  2P5L C;  4Y13 A;  5BS6 A;  1T0F A;  4YII A;  4L18 B;  1ZAO A;  3REO A;  4HZF A;  3KP3 A;  5CLS A;  5CVV A;  1W7P D;  5F64 A;  3KLN A;  4A0X A;  1IRG A;  1SD7 A;  3ZQ7 A;  3ZP5 A;  1F1Z A;  2GWR A;  2HOE A;  5L3D A;  3KP6 A;  2ZBK A;  4IJA A;  2RQP A;  2GXG A;  3HRM A;  3F3X A;  5HDN A;  4L9N A;  2M30 A;  3JSP A;  4RGR A;  4IRG A;  1QZZ A;  1TQM A;  3L7W A;  1TQI A;  3KET A;  1YFH A;  1I1S A;  1XSV A;  2H27 A;  2HYF A;  3IKT A;  3RKW A;  3P7N A;  5FFZ A;  1J75 A;  2RN7 A;  1IW7 F;  3WTV C;  3KP2 A;  4F7Z A;  1FX7 A;  1X3U A;  4RB1 A;  2JZY A;  2K4J A;  4P5O A;  1IAW A;  3WTS C;  5ILV A;  3LQQ A;  1SD6 A;  4GYG A;  2D1V A;  4LK0 F;  4S05 A;  3TGN A;  3ZN0 A;  3IRQ A;  1ZG1 A;  1HKT A;  5LRS A;  2FQ3 A;  3WE3 A;  3I4P A;  2XVC A;  2H6B A;  4FT8 A;  4DNC A;  1Z9C A;  1LDJ A;  2VT2 A;  2PBI A;  4KYW A;  1ZGA A;  4HW0 A;  4KA4 A;  2XRO A;  1IXS B;  2MD5 A;  2BE5 F;  2LDU A;  1JHF A;  4UV9 A;  4TV7 A;  1SMY F;  4LLN A;  1OYY A;  1OKR A;  2HR3 A;  4XBF A;  2PQ8 A;  1U3E M;  3GEZ A;  1ZLJ A;  3F8F A;  4R1H A;  3HSF A;  5HDK A;  3IWZ A;  1O7F A;  5CVR A;  2ZME A;  4GXO A;  1R5H A;  2JPB A;  3FMQ A;  2VE8 A;  2DO7 A;  3I53 A;  1F9N A;  1WKM A;  1BI2 A;  4FX4 A;  3GW2 A;  2XV4 S;  1P4W A;  2ZNY A;  2FMY A;  3KCC A;  2IW5 A;  3C18 A;  2XRN A;  5JR3 A;  3RJP A;  3PQJ A;  4ESF A;  4ENJ A;  2QEN A;  3U1D A;  4KN7 X;  2EFN A;  5A2Q K;  2FBH A;  3F6V A;  4A12 A;  4CO8 A;  5HLI A;  2A07 F;  4G7O F;  5D5V B;  1K78 A;  1V4R A;  1JE8 A;  1K7A A;  1KQ0 A;  5L3C A;  1JXS A;  4G7Z F;  4MQ9 F;  4E70 A;  4M73 A;  3NQO A;  3ZN1 A;  2UXX A;  3K1M A;  5JFR A;  1QBJ A;  2A69 F;  5LRR A;  3E97 A;  1BC7 C;  1YO5 C;  2P7V B;  2JSC A;  3MCZ A;  3KP4 A;  3CLO A;  2E7W A;  3JSO A;  1QZY A;  2P5K A;  1O57 A;  2E7X A;  5DDG A;  2NAZ A;  1LQ1 A;  1FLI A;  2J5P A;  4G6D A;  1F4K A;  4PCQ A;  2L01 A;  4UVA A;  2QLZ A;  4N9I A;  3VEP A;  3RI4 A;  2FA5 A;  3G3Z A;  1T39 A;  4P9U A;  4OU0 A;  4BQA A;  1ZRC A;  1QGP A;  2HFH A;  3KZZ A;  1C0W A;  1T6S A;  2V79 A;  1P4X A;  2M8E A;  5FGM A;  2W24 A;  3K1P A;  3HRU A;  2FBI A;  3KEQ A;  4PZJ A;  2ESH A;  1J7K A;  3LWF A;  1HKS A;  1L0O C;  3SQN A;  3K1N A;  3SHF A;  2RGV A;  2FNP A;  4L9V A;  3D5L A;  3RKY A;  2NS0 A;  2ZME B;  3WGG A;  4P9F A;  4LB6 B;  3ABT A;  2Z9O A;  5D4S A;  2PG4 A;  1IF1 A;  1BIB A;  3ZPL A;  2XKP A;  2WV0 A;  3BOQ A;  3CUO A;  4P96 A;  2F5C A;  3GVA A;  2GIV A;  2FEZ A;  3M1E A;  3MZH A;  3ECO A;  5FLX K;  4LG0 A;  2BEO A;  2VN2 A;  2PFB A;  3CO7 C;  4EM1 A;  5F6F A;  3IWF A;  1LJ9 A;  2D1H A;  2H94 A;  2HEO A;  4CDG A;  2AS5 F;  3E6B A;  4GCV A;  2QYO A;  1FSH A;  1G3T A;  2M5W A;  2CO5 A;  4I02 A;  3FZV A;  1FP1 D;  4A0Z A;  1YYV A;  2V1U A;  2F5F A;  1TTY A;  3CDH A;  3GX4 X;  2JTV A;  4M9Z A;  3FWE A;  4O6J A;  4MHG A;  1XDS A;  2H6C A;  3LA7 A;  5BPI A;  5HLG A;  1RI7 A;  3FHZ A;  3ZMT A;  1S7O A;  1YIO A;  4ESJ A;  3BPX A;  5CVJ A;  3J80 K;  2QVO A;  1CGP A;  1J2X A;  3Q5F A;  1U78 A;  3GFJ A;  2DFI A;  2CQK A;  2VC0 A;  3V8L A;  4A6E A;  4AVP A;  3W6J B;  2OQR A;  2P8T A;  1MJ9 A;  4ETS A;  2FBK A;  1PDN C;  1D3Y A;  1TW3 A;  1ZYR F;  1SD4 A;  2H09 A;  1T38 A;  1KQ8 A;  3BP8 A;  3GF2 A;  3C3W A;  4L0Z B;  4A0Y A;  3L09 A;  3N97 A;  1R00 A;  5IT3 A;  3CUQ A;  5AON A;  2X0L A;  1Z7U A;  1Z6R A;  1KU3 A;  5DD8 A;  2QBY A;  2O3F A;  4GO1 A;  1UB9 A;  2QM3 A;  5E1W A;  1XD7 A;  2COM A;  1D8K A;  5E1X A;  3LAJ A;  1XMA A;  5E17 F;  1IXC A;  4LLL A;  2MH9 A;  1LEB A;  2DK8 A;  1ZLK A;  4HLY A;  2ZNZ A;  4IVN A;  4EJO A;  3K2Z A;  4EVI A;  2GAU A;  3LA2 A;  1JGS A;  2BBY A;  4YIF A;  2DPU A;  2VOO A;  5LEK A;  3M7G A;  3TO9 A;  3KLO A;  4Q5S F;  4A5N A;  1PP7 U;  4JBA A;  2CW0 F;  2DAO A;  4RGS A;  4BHP A;  3HRT A;  4LG0 B;  1B4A A;  2JPC A;  5L3G A;  1MJA A;  4DQ2 A;  2XAQ A;  4NHJ A;  5EEH A;  2WWY A;  1QPM A;  1S6L A;  2UZK A;  3EYY A;  3R61 A;  4HOB A;  4HQM A;  3BJA A;  1XDU A;  2OA4 A;  4EGY A;  2ISZ A;  1B6A A;  5LHI A;  1H9G A;  5DEQ A;  1J5Y A;  2BV6 A;  3C7J A;  3TQN A;  4CXF A;  4K2E A;  2OZU A;  4U0Y A;  3HOS A;  5HS8 A;  1K79 A;  2HS5 A;  4WXH A;  1W7P B;  2K7L A;  2P6S A;  3DEU A;  4LK1 F;  2EA2 A;  4KIG A;  1Z91 A;  3BJO A;  1ON2 A;  4LD5 A;  2ETH A;  4AD9 A;  2ESN A;  1YS7 A;  1AOY A;  4IHS A;  1D5V A;  3OV8 A;  2HYG D;  1G3Y A;  3ZMZ A;  3ECH A;  4XSX F;  1YW8 A;  3SFZ A;  4ENK A;  1S8N A;  2O6G E;  1IN5 A;  5BMZ A;  2B0L A;  4EGZ A;  3SZT A;  4KN4 X;  3FXQ A;  2WC2 A;  3G73 A;  2EB7 A;  2ZKZ A;  3AAF A;  2NNN A;  3CUQ B;  4CHU A;  2HTJ A;  1U5T A;  1H9T A;  4ZYG A;  4UV8 A;  4M6Y A;  2FF4 A;  3Q9S A;  1RIO H;  2QBY B;  3DFG A;  4Q47 A;  2Q0O A;  4UHT A;  1TQP A;  4Q48 A;  4L5I A;  2P5V A;  3WU0 A;  3V8J A;  1BIA A;  2A5Y B;  2VXZ A;  2K86 A;  4FHT A;  1FYM A;  3FXR A;  2D45 A;  3HYI A;  1WI9 A;  3SZP A;  5FFX A;  3TO7 A;  1YG2 A;  4U0V A;  4L9T A;  2NYX A;  1W5S A;  3E5X A;  3P9K A;  1KU7 A;  2MLG A;  5LHG A;  1BI1 A;  2UWM A;  2EV6 A;  2W84 A;  2EV5 A;  2HDC A;  3F72 A;  1QQI A;  2DBB A;  5CVI A;  2MH2 A;  3KFW X;  4IF4 A;  4G9Y A;  2TDX A;  1BC8 C;  2OU2 A;  1NHA A;  2PN6 A;  3R0J A;  3FX3 A;  1H0M A;  4BNC A;  3LQR A;  5CVU A;  1XGS A;  1IRF A;  1TLH B;  4M9X A;  1TNS A;  2Y0M A;  1V3F A;  2RVC A;  1B1B A;  4A6D A;  2Z99 A;  2Z3Y A;  3CO6 C;  4WX9 A;  4YG2 F;  2LKP A;  2EFO A;  4U7B A;  1R1T A;  3WTW C;  4HQE A;  1R7J A;  3WOD F;  2EFW A;  4KDP A;  4U88 A;  1YLF A;  3O6B B;  2K27 A;  5DUK A;  3COA C;  4RB0 A;  4U7D A;  3C1D A;  4O3M A;  4MTD A;  2GXB A;  4XRF A;  4BAY A;  1R58 A;  2V6C A;  4H0E A;  2L02 A;  1K6O A;  5D5X B;  3KP7 A;  3ML6 A;  1F5T A;  3GYH X;  1A04 A;  2ZO4 A;  1I1G A;  2WTE A;  2IRF G;  3SXY A;  1FPQ A;  5ILS A;  4M74 A;  3H3U A;  3V7S A;  5H6R A;  4KNY A;  4UNO A;  3QU3 A;  4I7H A;  4HF1 A;  1XGM A;  1I6X A;  2FNA A;  2HWV A;  3R6S A;  2LSO A;  1U5T B;  5LGT A;  4KIC A;  3TO6 A;  1HBX G;  1DDN A;  3J81 Z;  2FRH A;  3GFM A;  3WGH A;  1SFE A;  4OOI A;  1WQ2 A;  4YFX F;  2DU9 A;  1UHM A;  1B59 A;  2IA0 A;  2VBW A;  3E5U A;  3WTX C;  1CF7 A;  2A68 F;  3B73 A;  1IUY A;  2VBX A;  3RDI A;  2OZ6 A;  2EFQ A;  4HF2 A;  5AIQ A;  2A61 A;  4IPA A;  4CZZ A;  2QWW A;  3HTS B;  3MFK A;  1HXD A;  3V8K A;  5KK1 A;  1OMI A;  2PMU A;  4GGG A;  1FT9 A;  1G4D A;  1FBS A;  4M72 A;  2Q8K A;  1HW1 A;  3WTU C;  5FD5 A;  3WU1 B;  3GWZ A;  1KGS A;  2YX4 A;  1MKM A;  5H20 A;  2PJP A;  1P4A A;  2KKO A;  1XSX A;  1RZ4 A;  3ZMD A;  2LNB A;  1XN7 A;  4MEX F;  1ZRF A;  3F21 A;  4EMS A;  5D8L B;  5E20 A;  1UST A;  1J9I A;  5ILU A;  3VOD A;  2KIM A;  4UVB A;  3IL2 A;  3TDU C;  2R7D A;  4HYE A;  3R4K A;  3MWM A;  3F23 A;  2FXA A;  4OIO F;  5D4R A;  4BH9 A;  5J6X A;  4I98 B;  4OIQ F;  4PDK A;  4NQW A;  5DCM A;  4R79 A;  3BY6 A;  1BN5 A;  3O3K A;  3DV8 A;  1DUX C;  3FMR A; 
#chains in the Genus database with same CATH topology
 2EIN H;  1YRN B;  5IT9 Z;  1XMK A;  4W97 A;  3ZQQ A;  3GLX A;  3ROU A;  3BDD A;  1ONV A;  3CDI A;  1DPR A;  1YE9 A;  2B9S A;  3FK6 A;  2ZCW A;  3RKX A;  3D5R C;  3W6K B;  2COB A;  3G1L A;  2GIZ A;  5D6E A;  1Y1W J;  2LP0 A;  4G8X A;  2Z1D A;  1OIS A;  4Y15 A;  5FKK A;  1Y8R B;  1E2X A;  1HW2 A;  3SDG A;  1OYI A;  1UHW A;  4AIH A;  1OPC A;  3KZY A;  3F6O A;  3SEZ A;  1JT6 A;  1XCV A;  4MNU A;  2E1C A;  2BHZ A;  5D5W B;  1D0Z A;  1WSU A;  1FY7 A;  2M87 A;  4HG2 A;  3LFK A;  2HTS A;  1V5E A;  3KZI C;  1LDK B;  3LAP A;  1VFC A;  2DQL A;  2EZI A;  1BM9 A;  2LBF B;  4PFP A;  1BA5 A;  3ABU A;  5BPD A;  2NOG A;  5B1A H;  2WV1 A;  5GP9 A;  4ESB A;  5M5Y J;  4UXN A;  1E17 A;  3BCA A;  4EAT A;  4RS8 A;  3WHC A;  1GLN A;  5CQE A;  1O7L A;  5GTI C;  1K78 B;  3VYT B;  1IDZ A;  2B7E A;  3GFL A;  1BJZ A;  1Q1H A;  2G7U A;  5BNG A;  2Q2E A;  3ZQC A;  2MVT A;  2WA0 A;  3QPT A;  4BXU A;  2ISY A;  5EEG A;  2XAU A;  4RM2 A;  4D1Q A;  1CF7 B;  1NH3 A;  4BU2 A;  2IA1 A;  2Z5U A;  1YQA A;  3JTH A;  1OR7 A;  5F1J A;  3S1R J;  1IC8 A;  5E8I A;  4DJA A;  3BQY A;  5D8K B;  4N4O B;  1UCR A;  3KEO A;  5LBQ A;  1IN6 A;  1TBX A;  1B72 B;  5ICC A;  2CYY A;  4CYD A;  1X4O A;  5F0C A;  2RDP A;  5FLM J;  3F8N A;  3OS1 A;  2M1B A;  3L9F A;  5DTD A;  2F5D A;  1EV7 A;  3M8F A;  5L3B A;  3EQL F;  2XPW A;  3IC7 A;  1PUE E;  2PLY A;  2L54 A;  5ED4 A;  2FSW A;  2I5U A;  3ASN H;  4G7H F;  5K5Q A;  4RB2 C;  4L5E A;  4BQO A;  4ZYD A;  3CUQ C;  2F48 A;  2G9W A;  4X6A J;  5ERI A;  4RGU A;  3HOT A;  3HTU A;  1HST A;  5FKO A;  4OIR F;  4BE1 A;  3O8G A;  2R5Z B;  1YX3 A;  2L7Z A;  5JVT A;  1VTN C;  3MKZ A;  1O3R A;  3P5J A;  5D6F A;  1FOW A;  1DGW Y;  2EQR A;  2QQB A;  4BHC A;  1D0Y A;  1G3S A;  4HX4 A;  4XSZ F;  5E3O A;  1ZHF A;  2P7C B;  1LVA A;  4CCO A;  3HB9 A;  3PFI A;  1EJ9 A;  4V2F A;  4ZH4 F;  4I0B A;  5IP9 J;  3KP5 A;  1G3W A;  2HZD A;  1W4M A;  2OD5 A;  3BQZ A;  1U6G A;  3DKW A;  2A3S A;  2R7X A;  4UB8 C;  3A1Y A;  2Y0S A;  2Z33 A;  1S7E A;  3U9G A;  3DKX A;  2QQA A;  5J8C A;  1VQ8 I;  2E35 A;  3I71 A;  2VE9 A;  3OYH A;  3GTJ J;  5HNF A;  4ENM A;  1YJW I;  3RZO J;  1FP2 A;  3T1B A;  3N05 A;  5F04 A;  2R7O A;  1XSD A;  3ELK A;  1TWC J;  1JGG A;  3HXL A;  1ETV A;  3CC4 I;  1CQT A;  3J81 K;  3I59 A;  2EA4 A;  1V55 H;  1XPX A;  2JVH A;  1ETX A;  1STZ A;  2HVQ A;  4RAF A;  1DPU A;  2KJC A;  3P9C A;  4KFC A;  3B02 A;  3F8M A;  2B63 J;  2AXL A;  3I64 A;  3IRR A;  1UZC A;  5BQT A;  2L4A A;  2W48 A;  3GZN B;  2DA4 A;  4XKC A;  4NQW B;  1ZGJ A;  1FYK A;  2CV1 A;  5DCM B;  4BXF A;  2DMP A;  5EGO A;  3OYL A;  4XRS G;  4ZYH A;  2X51 A;  3PO3 J;  3P9I A;  1TL8 A;  4M3F A;  2VQL A;  2ECB A;  3FXO A;  4XKB A;  2GA2 A;  1K61 A;  2CUF A;  4LJZ F;  3RPU A;  4E7K A;  2MC3 A;  1I27 A;  2X1C A;  4OAY A;  3OIP A;  2ADU A;  5F1R A;  4MEY F;  4LMY A;  3UKG A;  4WF2 A;  2D5V A;  2MD0 A;  1GV5 A;  5LLQ A;  2NNY A;  1U0J A;  1X1A A;  1W5T A;  1LNW A;  1FOK A;  3MVP A;  5LD2 C;  5E79 C;  2MGQ A;  2M35 A;  2GA1 A;  3TP0 A;  1SAX A;  4NB5 A;  5BOX A;  3R60 A;  1MW7 A;  2O5R A;  3HOY J;  3DPL C;  4BBR J;  3M1C A;  1D1A A;  5HS7 A;  3V7R A;  1O3Q A;  1O3T A;  4GDF A;  1P2F A;  1X2M A;  3PQK A;  5FLX R;  1FBQ A;  2XUB A;  2V9P A;  2X6W A;  1R22 A;  4G94 A;  1S29 A;  2O7O A;  1BR4 A;  1J0R A;  3TMO A;  2QQ9 A;  2PMZ N;  2XDV A;  4YFK F;  1JHH A;  2MA3 A;  3K9T A;  4I99 C;  1I3Q J;  4MQV A;  2EWN A;  1ZRD A;  2M4G A;  1W1W E;  2Q2E B;  2VBZ A;  3M8E A;  5FRM A;  2EK5 A;  4J19 A;  2LC2 A;  3GFI A;  2RV8 A;  5HDG A;  3OYG A;  2J5O A;  2JMW A;  5D5U B;  5H6Q A;  4WCG A;  2XGC A;  4HBL A;  3T5X A;  1ERD A;  2EFP A;  3DU5 A;  3V4G A;  3F22 A;  3BG7 A;  2ZFU A;  4EJU A;  3IAM 2;  4HLX A;  5CYV A;  4M71 A;  5F0H A;  3M9A A;  3K2A A;  3DXJ F;  1B8I A;  2VI6 A;  3BRO A;  3CCR I;  1I39 A;  2K85 A;  3QP6 A;  2GBY A;  3CCV I;  3BCB A;  3F0C A;  1KU9 A;  2R3S A;  5AIP A;  1B9M A;  1U9N A;  2DPD A;  4N0B A;  3HHG A;  2V1X A;  1MMD A;  4BUP A;  4BY7 J;  3TDZ C;  5EDN A;  2Z16 A;  2E1N A;  4IHT A;  2ACJ A;  4GRI A;  3J80 R;  1U5T C;  2NVX J;  3FMS A;  3GTG J;  3BPV A;  4PGG A;  3TW6 A;  4OIP F;  2IS1 A;  3V7C A;  2CWE A;  4X1E A;  1FZP B;  4J01 A;  2UXN A;  2DOF A;  5ICG A;  3TED A;  4WXD A;  2XAS A;  4HAM A;  2CW8 A;  5FKN A;  3WTZ A;  4LIT A;  2W25 A;  1JJ8 C;  1FWZ A;  3HSR A;  4UUS A;  3NEU A;  4IRH A;  5DUI A;  2VLA A;  4B47 A;  3K4J A;  4QSH A;  1ZGW A;  3NAR A;  4EJV A;  5FO5 A;  3JAM Z;  3DTK A;  2VQH A;  1XGN A;  4I01 A;  4L9J A;  1JI8 A;  1R1U A;  1NG6 A;  1WJC A;  4MFE A;  3TKY A;  1FBU A;  2R7Q A;  5EJC A;  1QHG A;  4N9H A;  3I59 B;  1SFX A;  3ERM A;  3T8R A;  4PJM A;  1X4P A;  1NK3 P;  2VJJ A;  4NNJ A;  2Y0S N;  1BL0 A;  4E7Z A;  3O2P E;  4CZC A;  1UEL B;  2ZSI B;  1JKO C;  1HW5 A;  5L3E A;  1GXP A;  3I5U A;  1VQL I;  2DTZ A;  2O8X A;  3I58 A;  3RPQ A;  4NDL A;  4UUV A;  4HPQ A;  3TBI A;  2LRE A;  5J8F A;  1ZG5 A;  5JHU A;  5EGO B;  5K5O A;  5J1R A;  2TRT A;  4ABZ A;  2VPL A;  3QQA A;  1TT0 A;  2D2W A;  2A6E F;  1ON1 A;  1ZG3 A;  1YS6 A;  2CFX A;  2YU3 A;  1K6Y A;  2E1M B;  2CV2 A;  3H92 A;  3GZ6 A;  2YX7 A;  4R8H A;  4IXA A;  3MKL A;  5IOY A;  1B9N A;  3HKZ A;  3OL4 A;  1A35 A;  4B09 A;  2IA2 A;  4EEF G;  2FX0 A;  4OWR B;  1WJD A;  1JJ6 C;  3M8J A;  4ZTJ A;  1LEA A;  3RPU D;  5L3F A;  1R5G A;  5K1Y A;  1D8J A;  1ZAR A;  1BW5 A;  4XLA A;  2FOW A;  3QYF A;  1VQO I;  1UG0 A;  2BY0 A;  4A93 J;  4GYI A;  4CH7 A;  3O8H A;  1N78 A;  3U2R A;  2DFH A;  2A05 A;  2F2E A;  1X3W B;  3DTE A;  2QUF A;  1XB4 A;  1IN7 A;  3L2V A;  9ANT A;  1RQ6 A;  3L2U A;  2FUG 2;  1LVK A;  4IRI A;  2YSR A;  3E7L A;  2DLL A;  4M3E A;  3RZD J;  4IKF A;  3BR6 A;  2IT0 A;  1YJN I;  2ELH A;  1Z05 A;  1MD0 A;  2DJI A;  4HNU A;  2KIF A;  5K7H A;  4CCK A;  1ENH A;  1O3S A;  2AHQ A;  3T8T A;  2XAH A;  1VQ4 I;  5E1Z B;  2R5Y A;  1FOX A;  2EIL H;  3GXO A;  3AFH A;  2OV7 A;  3ABM H;  2O9L A;  1BBY A;  2NS8 A;  4HDV A;  4XR6 A;  4RGX A;  1HKQ A;  3KIO A;  3I9V 2;  2R7Z J;  3E5Q A;  3BR0 A;  5FLX Z;  2PEX A;  3MN2 A;  2Y2Z A;  2Y48 A;  1G6N A;  3HOW J;  3EUH A;  4ZYA A;  4ZYE A;  1P9Q C;  1Y56 A;  2AO9 A;  1RNL A;  3BR3 A;  4E7J A;  1T2K A;  3S8P A;  2XHK A;  4XLP F;  3GZ5 A;  1IN4 A;  4P55 A;  4XM3 A;  2EJR A;  4AWX B;  1B8I B;  1QNT A;  1GXQ A;  4MGR A;  2C6Y A;  2HQR A;  4DW6 A;  4ZZL A;  3S1M J;  3I55 I;  2EIJ H;  3KE2 A;  3HSE A;  4ASN A;  2BY2 A;  2L4M A;  2PMH A;  3FIS A;  3OYK A;  3NRV A;  1L3L A;  2DT5 A;  2EBI A;  2ZXJ A;  2NRA C;  4FCY A;  1R6R A;  2CGP A;  4BL0 B;  2MAB A;  2OQG A;  4KT5 C;  4AC0 A;  4XOR A;  4M3B A;  4HA8 A;  1HQC A;  2M7A A;  4LFU A;  1REP C;  2WAD A;  1EKE A;  1LFP A;  2KDZ A;  1ZRE A;  2LF7 A;  2CSO A;  2DI3 A;  2IEK A;  2YR2 A;  2ZFW A;  4II3 A;  3ULQ B;  4V19 K;  5DV5 A;  3RCO A;  3LSM A;  3VWB A;  2HZT A;  2XGX A;  3HIF A;  1KYW A;  2JUC A;  4RAY A;  4CCM A;  2VOD A;  2O03 A;  3ZMS A;  2K3F A;  1AA7 A;  3RSN A;  3RIR A;  3L2C A;  2K5C A;  3J80 Z;  3G6E I;  1WFX A;  3HEF A;  1PP8 F;  1ODD A;  1QO0 D;  1ZN2 A;  3DTI A;  2RC4 A;  3F8B A;  3VB2 A;  4XLC A;  4FX0 A;  4Z2Y A;  4UUS B;  2H1K A;  3E6D A;  1RR8 C;  1K4S A;  5ICE A;  4HX7 A;  1U8R A;  5C44 J;  2VB6 A;  1KZH A;  4XLN F;  2NOJ B;  5KAI C;  3L2Q A;  4BGD A;  4NC6 A;  3I54 A;  3CCY A;  4KUM A;  4PGH A;  5KNL A;  3RTR A;  3IHU A;  3PIO F;  4AU7 A;  1N75 A;  1DP7 P;  2XAG A;  2VOP A;  2V1D A;  4UB6 C;  2F5V A;  3DLL F;  2JN6 A;  1T95 A;  2DA7 A;  3QPH A;  4HX8 A;  4WWC A;  2ZXW H;  4KJZ A;  3GO5 A;  2JT1 A;  1WJ5 A;  2K40 A;  2FE3 A;  2JA5 J;  3GCM A;  4HF0 A;  4FAS D;  3BJ6 A;  5HVQ C;  2E2I J;  1MMS A;  2DFE A;  3QPL A;  4XL9 A;  4ANJ A;  3EDP A;  2L7K A;  4LIV A;  1A6Q A;  1GDT A;  5DCF A;  1WRJ A;  1YW9 A;  2P6T A;  3FM3 A;  4WXC A;  1O4X A;  4ON0 A;  5B1B H;  2M0C A;  3JW4 A;  3MQ0 A;  2OTL I;  3ZMU A;  3W2V A;  1V54 H;  1RUN A;  2W57 A;  3ERE D;  2Z2S B;  3R0A A;  2EPF A;  4HV5 A;  1JT0 A;  4XLH A;  2DA3 A;  3LSJ A;  2K9S A;  4A3J J;  3KYD B;  1U2W A;  2IBD A;  4B4C A;  2XGD A;  3CJN A;  2F5E A;  4IEJ A;  2FOK A;  2V26 A;  1BI3 A;  3BWG A;  4MTE A;  3SYT A;  2BZT A;  1RUO A;  4RAZ A;  5HLH A;  4DZJ A;  2DK5 A;  2VON A;  2XAJ A;  1UJ8 A;  2LMD A;  1Z1D A;  4U87 A;  3VFZ A;  3GTM J;  1EH7 A;  4AIJ A;  2HQN A;  2Y75 A;  1VND A;  2JA8 J;  4A3G J;  2X4H A;  1YTY A;  2LFB A;  2CFO A;  2E5Z A;  3HGY A;  2PI0 A;  3EET A;  2HXO A;  4IO9 F;  2MBF A;  5DYM A;  3E3V A;  3DQV C;  3HHH A;  2IVM A;  5K7Z A;  1HDD C;  4HDU A;  2G7H A;  3ZMV A;  4KIF A;  5LHH A;  2FJ1 A;  3HKZ N;  1I5Z A;  2V7F A;  4RLF A;  1TT5 B;  4KIB A;  2BVL A;  3S2H J;  1SD5 A;  1T98 A;  1S3J A;  3DF8 A;  3Q0V A;  1MZB A;  4Y33 A;  2DYR H;  2KHM A;  1MBJ A;  3FM5 A;  1RKT A;  1KU2 A;  4LGW A;  3JAM K;  1H8A C;  3FXU A;  4YFN F;  3RYR A;  1IRZ A;  2QQ8 A;  2R5Y B;  3HG9 A;  4AIK A;  4CGZ A;  4BEH A;  1S7A A;  1MH4 A;  4A2U A;  4RDU A;  3OYD A;  2MW8 A;  3OOP A;  2LOO A;  1BR1 A;  1WWX A;  2CU7 A;  5FD6 A;  1SFU A;  1MGT A;  1E3O C;  2BYV E;  2STT A;  3ISP A;  5KVR A;  5J1Y A;  1R36 A;  3HL2 A;  3QU6 A;  1T56 A;  2CJJ A;  1BJA A;  4C3I J;  1FMW A;  2KIU A;  3BLY A;  3GTP J;  2XB0 X;  1R49 A;  3DKY A;  1XGO A;  4EM2 A;  2JWT A;  1IN8 A;  3D5S C;  4I0A A;  3VSK A;  2L9S A;  5KCM A;  3L00 A;  5FB2 A;  2XIG A;  1IDY A;  3BZ6 A;  4B48 A;  4DOZ A;  1RET A;  4XK4 A;  2WY8 Q;  3FXL A;  3WG9 A;  4D9J A;  2VKE A;  2JRT A;  4EQQ A;  1LFU P;  4KIT B;  3J7A O;  1WJA A;  2VXD A;  1BI0 A;  4E7I A;  1Z6T A;  2JUG A;  1KA8 A;  2CUZ A;  3GME A;  1ETO A;  4II2 A;  3NWT A;  3QYE A;  1OCC H;  1W0T A;  2W82 A;  2OJE D;  3DP7 A;  2STW A;  4JQF A;  3HOX J;  2GQQ A;  4LB5 A;  5JI6 A;  2IGM A;  3N4M A;  1I3A A;  3J7Z I;  2DT6 A;  3Q9V A;  3S14 J;  4OMY A;  1ZR2 A;  3CF5 F;  2W85 A;  3CCQ I;  1HCR A;  3M3Y J;  3JRF A;  1TW2 A;  4XNF A;  2HKX A;  4MO7 A;  4I09 A;  1J59 A;  3HBL A;  2DA6 A;  4KMU X;  1BOA A;  1Z77 A;  2CUE A;  1YW7 A;  3QAH A;  3H36 A;  2M4K A;  2VBY A;  3OIO A;  3M07 A;  4XOP A;  1LDD A;  5TGT A;  4S0H B;  2KJB A;  3MAJ A;  4EM0 B;  1D1B A;  2P4W A;  2PX9 A;  3ASO H;  1R23 A;  1AWC A;  1ITY A;  1XMX A;  3LSI A;  4XLE A;  5A2Q R;  3DWL E;  2FU4 A;  1JKP C;  3K69 A;  3OSF A;  1QPI A;  4EV0 A;  2GZW A;  3ZQF A;  3T0Y A;  1R4M B;  4LLG F;  1WJB A;  4A69 C;  4RB3 C;  5ICF A;  1KQ9 A;  3E6M A;  1FNN A;  1FTT A;  3I4N J;  3MZY A;  2VT3 A;  4JX6 A;  1OYW A;  4E7H A;  5HS9 A;  4BJ6 C;  2LTP A;  2DW4 A;  5CJ9 A;  2K02 A;  3X2Q H;  2L9V A;  3FF5 A;  4N4N B;  4ZDL A;  4CCL A;  3IP4 B;  4ENN A;  2A6H F;  3VOE A;  2DXI A;  2VKV A;  1MDM A;  2DTR A;  4A3E J;  3A52 A;  2QSF X;  4U0W A;  3EYI A;  3WTT C;  2KDO A;  5E3N A;  4IQ4 A;  2KL4 A;  1POG A;  1SMT A;  1WHU A;  2YPR A;  4Y17 A;  2M45 A;  2V6E A;  2BVM A;  4F3Q A;  5GPC A;  1R1V A;  4A5M A;  1FJL A;  3BG5 A;  2LF8 A;  3BR2 A;  2HQ5 A;  2EZK A;  3CCU I;  4A3F J;  3QOD A;  2ELK A;  4QWQ A;  3PNT A;  1W7P A;  2FML A;  3PNY A;  1P6R A;  3KX2 A;  1R4N B;  4V2G A;  4E7L A;  1K4T A;  3FKJ A;  3KYL A;  5LGN A;  3H1C A;  3WE2 A;  1Y0U A;  2PJR A;  3SFI A;  3LA3 A;  1QVT A;  3U1K A;  3PIP F;  1DP3 A;  2CG4 A;  2OF7 A;  3BC8 A;  3CTA A;  5HLT A;  5C4X J;  4O5V A;  3QOP A;  3S2D J;  5TIS C;  1Y6I A;  3OMY A;  4B1R A;  3LSH A;  4PJ0 C;  5IYB J;  1PJR A;  2BXY A;  3CCL I;  2EZL A;  5B66 C;  3LST A;  4BEH B;  2ZJ2 A;  4D0P A;  3DEW A;  4EJT A;  2EV0 A;  4BYY A;  2E1M C;  1KYZ A;  5J4V A;  2MLK A;  1D0X A;  1LB2 A;  2IPQ X;  2O0Y A;  2OBP A;  2X6O A;  1V5F A;  4HV6 A;  3QP5 A;  2AQF A;  2W4S A;  1WJE A;  3TOA A;  2GOM A;  2R7T A;  1E0E A;  1EH6 A;  3JRA A;  3H3Z A;  4I2O A;  4QLC U;  3OIQ A;  3TP3 A;  1WJF A;  5K5R A;  3K70 D;  3S3N A;  3GUD A;  1IZ1 A;  2QKL B;  2V9V A;  3WGI A;  2X85 A;  2L7F P;  3DPT A;  4OMZ A;  2BGC A;  1ULY A;  2K9Q A;  4L0Y B;  1FYL A;  2JSP A;  2R7F A;  3S1Q J;  2HVR A;  3H9Q A;  3AG2 H;  2HGC A;  4JK1 X;  4ZZD A;  3I0T A;  2HKO A;  2LKS A;  1SEU A;  4E6K G;  2JA6 J;  2L7M P;  1WGX A;  1IXR C;  2Y69 H;  2KRF A;  5K7F A;  1XCB A;  1FSE A;  3MEX A;  3E0J B;  3K0L A;  4XLF A;  5F08 A;  2EH3 A;  1MJB A;  1ORK A;  3D0S A;  3QRF F;  1OCT C;  4BHB A;  4B43 A;  3TOB A;  2M7B A;  1JUP A;  1HSJ A;  5TRD A;  2LY2 A;  5DD4 A;  1X19 A;  1LKX A;  1EH8 A;  4S04 A;  3RYP A;  5LGU A;  1UFM A;  2DOD A;  2VC1 A;  3OYA A;  4L5J A;  3GLL A;  3ZXS A;  2H8R A;  2DN0 A;  4M6X A;  4EJW A;  1DU6 A;  3OR2 C;  4B8X A;  3F8C A;  3PL8 A;  3W3C A;  5IYC J;  2GOX B;  3E1S A;  4ZDO A;  3G1O A;  5IP6 A;  4WK8 F;  1MNE A;  2P81 A;  2L3D A;  1FC3 A;  3H5R A;  4UVC A;  5HOO A;  5LEJ A;  2O61 A;  1ZH5 A;  2K3P A;  1GHC A;  4FTH A;  1ZR4 A;  1TNT A;  2IP2 A;  1P92 A;  2OAZ A;  1AKH A;  4JP0 A;  5E18 F;  5TJJ A;  2CQQ A;  1SVO A;  2QF7 A;  2XAF A;  2GM4 A;  4Q4Z F;  5A2Q Z;  3K10 A;  4G6Q A;  5IPA A;  2XSD C;  2HYJ A;  1PUF A;  3JR9 A;  1F36 A;  2Y31 A;  5B3S H;  1LUJ B;  2VJ5 A;  1USS A;  2DQR A;  1YIJ I;  1MDM B;  6PAX A;  3WTY C;  3HUG A;  1FOY A;  3AG4 H;  2R7S A;  1X2N A;  3LMM A;  4KMF A;  5IT9 K;  3E6C C;  3S2W A;  4OIN F;  2HXI A;  3IKV A;  3JTG A;  2QZ8 A;  1Y39 A;  4DIQ A;  4AM3 A;  4CSW A;  3HPG A;  4M9S A;  1TWF J;  2XKO A;  4P1W A;  5E8G A;  1MSE C;  2IS6 A;  2K4B A;  2DT7 B;  2L9N A;  2RNJ A;  3CP2 A;  4CIC A;  1GVJ A;  2IJL A;  4UY8 I;  4IOC F;  2RKH A;  3HRS A;  3S15 J;  2P5L C;  5B5E C;  1W36 C;  2DMN A;  3G1M A;  4IX7 A;  2R7W A;  5JLX A;  5CQG A;  4IHW A;  4Y13 A;  5BS6 A;  1T0F A;  2VIX A;  1S9H A;  2DYS H;  4YII A;  5JVG F;  4L18 B;  1N25 A;  1ZAO A;  4UUT A;  3REO A;  2PJR B;  4HSR A;  2E5N A;  4HZF A;  3KP3 A;  5CLS A;  5CVV A;  3JRC A;  2CH0 A;  1VF9 A;  1W7P D;  3KLN A;  5F64 A;  1YJ9 I;  4A0X A;  5FLV A;  1IGN A;  3DBH B;  4BY1 J;  3NWS A;  5EEA A;  1IRG A;  2X1E A;  3ZRG A;  2A5W A;  1SD7 A;  3BG3 A;  3ZQ7 A;  3ZP5 A;  4BE2 A;  1F1Z A;  2V4J C;  1E3P A;  3OYB A;  2BXZ A;  2GWR A;  4X0G A;  2HOE A;  5L3D A;  3A2K A;  3KP6 A;  2ZBK A;  2OTJ I;  4IJA A;  1R9T J;  2LH9 A;  2RQP A;  2GXG A;  2L9R A;  3HRM A;  3F3X A;  2BY1 A;  3J81 R;  3OYN A;  3BTC A;  5HDN A;  3CCJ I;  4L9N A;  3PM1 A;  2M30 A;  3G71 I;  3JSP A;  4RGR A;  4IRG A;  1ETY A;  1QZZ A;  1TQM A;  3LL7 A;  3L7W A;  1TQI A;  3KET A;  5EG0 A;  1YFH A;  1I1S A;  1XSV A;  1VQ7 I;  2H27 A;  2HYF A;  3IKT A;  3RKW A;  3P7N A;  4PJN A;  4NBQ A;  3OR1 C;  2LVS A;  3BTI A;  5FFZ A;  4Z6Y A;  3OYF A;  2E2H J;  4YEJ A;  4HNV A;  2MG4 A;  1J75 A;  2RN7 A;  2HOA A;  3NAU A;  2EIM H;  5EZG A;  1IW7 F;  3WTV C;  3KP2 A;  5FKM A;  4F7Z A;  3HJE A;  3CMY A;  2LG4 A;  1FX7 A;  1X3U A;  1XS9 A;  4RB1 A;  2JZY A;  2K4J A;  3AG1 H;  4P5O A;  1IAW A;  3CJQ B;  3WTS C;  5ILV A;  3QWL A;  3LQQ A;  1SD6 A;  2HDD A;  2ICW G;  2R7V A;  3EUH C;  3OYM A;  4XIC A;  4GYG A;  2D1V A;  4LK0 F;  4S05 A;  3A0B C;  1TP4 A;  1SC7 A;  3TGN A;  3ZN0 A;  1X1P A;  3IRQ A;  2EIK H;  4FE7 A;  4XRS A;  1ZG1 A;  4A3I J;  1HKT A;  5LRS A;  5M3F J;  2FQ3 A;  2ID6 A;  3WE3 A;  4G12 A;  3I4P A;  2XVC A;  2ME6 A;  2M3A A;  4YRV A;  1HC8 A;  1XG1 A;  2QA4 I;  5JHF A;  4LIU A;  2H6B A;  2X1D A;  4FT8 A;  4DNC A;  2BY3 A;  1Z9C A;  1LDJ A;  1AKH B;  1MNM C;  1GUU A;  4AUX A;  4RLQ A;  2VT2 A;  1MBE A;  2F6C A;  2DOE A;  2PBI A;  1FMV A;  2KZG A;  2CS3 A;  4KYW A;  3AL0 B;  1ZGA A;  4HW0 A;  4KA4 A;  2QEX I;  2XRO A;  2GLO A;  1PUF B;  1YOV B;  1IXS B;  3WHB A;  2MD5 A;  2NVT J;  3C2G A;  3BZK A;  2BE5 F;  3CQZ J;  4XQF A;  3HUG B;  2LDU A;  3CMM A;  1JHF A;  2MFZ A;  4UV9 A;  1A36 A;  2YU9 J;  4TV7 A;  4B3X A;  3CCS I;  1SMY F;  4LLN A;  2KMU A;  1OYY A;  1OKR A;  2HR3 A;  4XBF A;  2PQ8 A;  3CC2 I;  1U3E M;  3GEZ A;  2KRH A;  1G2H A;  1ZLJ A;  2DDB A;  3CJR B;  3F8F A;  2IS4 A;  1Z0X A;  4R1H A;  3OS2 A;  3HSF A;  2WAQ A;  5E3L A;  2NVQ J;  5HDK A;  1F43 A;  4M3G A;  3IWZ A;  5E3M A;  1O7F A;  5CVR A;  2ZME A;  2VPR A;  4GXO A;  1RES A;  3BTL A;  4XN3 A;  1MMN A;  1FEX A;  1R5H A;  1Z7L A;  4XMY A;  2JPB A;  3FMQ A;  2VE8 A;  2DO7 A;  3I53 A;  2CUJ A;  4C2M J;  2KT0 A;  1F9N A;  4Y7N J;  1WKM A;  2VKH A;  1BI2 A;  4FX4 A;  3GW2 A;  2XV4 S;  1P4W A;  3S93 A;  1JKR C;  4MLO A;  2ZSH B;  2ZNY A;  4JX5 A;  3WU2 C;  1HF0 A;  3SEQ A;  4XRM A;  3FXJ A;  2FMY A;  3KCC A;  2OPT A;  2IW5 A;  2HNH A;  1TZL A;  2IGO A;  3CME I;  3C18 A;  2XRN A;  4XOT A;  5JR3 A;  1U8B A;  2HOS A;  1IG7 A;  3RJP A;  2LR8 A;  2M8G X;  3PQJ A;  1VQN I;  2K9M A;  3ZQH A;  3H3V K;  4ESF A;  3RQI A;  4ENJ A;  2QEN A;  3IAS 2;  3U1D A;  1R5I D;  4KN7 X;  5IOZ A;  2LY9 A;  3CJT B;  2EFN A;  4XON A;  5FRO A;  5A2Q K;  2FBH A;  3F6V A;  4BKX A;  4A12 A;  3CC7 I;  4FE4 A;  4CO8 A;  3A4C A;  5HLI A;  2A07 F;  1SAN A;  3LSR A;  1FTZ A;  2DCE A;  4G7O F;  3B6C A;  3K4N A;  1ETW A;  5D5V B;  5EG0 B;  2RAE A;  1BR2 A;  2KZV A;  1K78 A;  1V4R A;  4C3J J;  1JE8 A;  1K7A A;  1KQ0 A;  4CYC A;  2LK2 A;  5L3C A;  1JXS A;  3F9K A;  4G7Z F;  4MQ9 F;  4E70 A;  4M73 A;  3NQO A;  3ZN1 A;  2UXX A;  2ELJ A;  3K1M A;  3IUO A;  5JFR A;  1QBJ A;  2A69 F;  2G0E A;  5LRR A;  3E97 A;  1IV6 A;  2LRD A;  4FIS A;  4C3H J;  5KHD A;  1BC7 C;  1YO5 C;  4QIW N;  3OWT A;  3A0H C;  2P7V B;  2JSC A;  3MCZ A;  5GAD J;  3KP4 A;  3CLO A;  2E7W A;  3JSO A;  1QZY A;  4AVZ A;  4A3D J;  2P5K A;  3IV5 A;  2QSH X;  1O57 A;  2E7X A;  2WBM A;  2NAZ A;  5DDG A;  2XC7 A;  1VQP I;  4HST A;  3S1N J;  1LQ1 A;  1A5J A;  1FLI A;  3SJM A;  2J5P A;  1RPW A;  3HGG A;  4G6D A;  1F4K A;  2H8W A;  4PCQ A;  2L01 A;  2ME0 A;  4UVA A;  2QLZ A;  4N9I A;  1SFK A;  3VEP A;  1H88 C;  3AG3 H;  3JRB A;  3RI4 A;  1MH3 A;  3DPU A;  2FA5 A;  2KQR A;  2M0M A;  3G3Z A;  3ZR8 X;  1T39 A;  4IHX A;  4P9U A;  4OU0 A;  4Y4R A;  4BQA A;  3FXM A;  3LSK A;  3GBG A;  5EZH A;  1ZRC A;  1QGP A;  2HFH A;  3KZZ A;  1IUF A;  1C0W A;  2UV1 A;  4BE0 A;  1T6S A;  2HDW A;  5C4J J;  2V79 A;  2X6Y A;  1P4X A;  2M8E A;  4HNT A;  3S3M A;  4C30 A;  3PFY A;  5FGM A;  2W24 A;  1X58 A;  3K1P A;  1MND A;  3K7A J;  3HRU A;  3FXK A;  2FBI A;  4BXX J;  3KEQ A;  4PZJ A;  4DBQ A;  3ZQL A;  1MMA A;  2ESH A;  1J7K A;  3JRI A;  3LWF A;  1HKS A;  1L0O C;  3SQN A;  2I8D A;  3CDL A;  3K1N A;  3SHF A;  4BJ5 C;  2RGV A;  2FNP A;  2LY1 A;  4L9V A;  3D5L A;  2TCT A;  4DBR A;  3RKY A;  3GTQ J;  2NS0 A;  2AQE A;  4C2U A;  2ZME B;  3WGG A;  4P9F A;  4LB6 B;  1QRY A;  3ABL H;  3ABT A;  4D7N A;  1H89 C;  1VQ5 I;  2Z9O A;  1DU0 A;  2R93 J;  3GTK J;  5D4S A;  3CP8 A;  2WB1 A;  4ZTF A;  2PG4 A;  1IF1 A;  1BIB A;  2WAQ N;  1OR7 C;  1UMQ A;  2ZB9 A;  3JCU C;  3ZPL A;  3H35 A;  3GTO J;  2XKP A;  2WV0 A;  3BOQ A;  2NVU B;  3CUO A;  4P96 A;  3OYI A;  2F5C A;  3H9J A;  3BTJ A;  3GVA A;  3DEE A;  2GIV A;  2FEZ A;  3M1E A;  2PMZ A;  2V1N A;  1Z3Y A;  3MZH A;  4JX4 A;  2F4M B;  3ECO A;  5FLX K;  2LLK A;  2XF6 A;  1V5G A;  4LG0 A;  3CD6 I;  2BEO A;  2CQN A;  3I56 I;  3BR5 A;  2VN2 A;  2PFB A;  1MSF C;  3J7A W;  3CO7 C;  4EM1 A;  5F6F A;  3IWF A;  1OCZ H;  4CCJ A;  1LJ9 A;  2D1H A;  3S17 J;  1JUM A;  5HOD A;  2H94 A;  3HDD A;  1Q1V A;  4CDG A;  2AS5 F;  2HEO A;  3E6B A;  2KRC A;  3LSG A;  4GCV A;  2QYO A;  2DFF A;  1FSH A;  2OUM A;  1G3T A;  3DBL B;  3CF2 A;  4BDY A;  2M5W A;  2CO5 A;  4I02 A;  3FZV A;  1QVU A;  4CYC B;  1FP1 D;  3PJR A;  4A0Z A;  1YYV A;  2V1U A;  2VAS A;  4F91 B;  2F5F A;  2JK3 A;  4AYB A;  1TTY A;  4A3C J;  3W6V A;  5HNH A;  3CDH A;  3GX4 X;  3LFU A;  1G8X A;  1WVR A;  2JTV A;  2RRE A;  3VSL A;  3HOZ J;  4M9Z A;  5F0F A;  4D7M A;  2X98 A;  1ZK8 A;  2AXT C;  1MBK A;  2M34 A;  3FWE A;  4O6J A;  4MHG A;  1BW6 A;  3H0D A;  1M1E B;  1XDS A;  2H6C A;  3LA7 A;  5BPI A;  5HLG A;  4XKV A;  1U9O A;  1Z3X A;  1RI7 A;  3BZC A;  3FHZ A;  3ZMT A;  2DMQ A;  1S7O A;  1YIO A;  4W1U A;  3W2A A;  3K4C A;  4JYK A;  3BPX A;  4ESJ A;  4IL6 C;  5CVJ A;  3J80 K;  1TWH J;  5IP7 J;  2QVO A;  2CQX A;  1J2X A;  1CGP A;  3H9G A;  3Q5F A;  1U78 A;  3GFJ A;  2DFI A;  2CQK A;  2VC0 A;  5FKL A;  3V8L A;  4A3M J;  1T8I A;  4A6E A;  4Y52 J;  4AVP A;  1EF4 A;  1WCM J;  3CLQ A;  3S16 J;  4NUB A;  2QSG X;  2R0Q C;  4DYR A;  3W6J B;  1RR7 A;  2OQR A;  2P8T A;  1MJ9 A;  2L5Q A;  2RQQ A;  4ETS A;  2FBK A;  3JAM R;  5GTH C;  4I6Z A;  3FIW A;  1PDN C;  2NXN B;  1D3Y A;  1TW3 A;  1ZYR F;  4F55 A;  1SD4 A;  2E60 A;  2H09 A;  1QU3 A;  1T38 A;  5IY5 H;  1KQ8 A;  1IV8 A;  3BP8 A;  3GF2 A;  3C3W A;  5DS9 A;  2M9H A;  4RA2 A;  4L0Z B;  4CUG A;  1SVM A;  3PUB A;  4A0Y A;  1RC9 A;  3L09 A;  3N97 A;  1MBG A;  1R00 A;  5IT3 A;  3CUQ A;  4B3A A;  5AON A;  1IO2 A;  2X0L A;  3BG9 A;  2VQC A;  3J7A Y;  5GAE J;  2EZH A;  2KP6 A;  1Z7U A;  1Z6R A;  1KU3 A;  5DD8 A;  2QBY A;  2O3F A;  2HI3 A;  1TWG J;  4GO1 A;  2KIQ A;  3ZGK A;  2Y9Y A;  1UB9 A;  3RKQ A;  4CCN A;  2R92 J;  1VQM I;  3VPR A;  2QM3 A;  5M5W J;  4BQQ A;  2K9N A;  2KPM A;  3Q0U A;  4M3D A;  4I76 A;  5E1W A;  1XD7 A;  2WY7 Q;  3UNG C;  2L2O A;  3MKW B;  4C9Y A;  2COM A;  2MC4 A;  1D8K A;  5E1X A;  3LAJ A;  1XMA A;  3C2H A;  1IXC A;  5E17 F;  4RMN A;  3OYJ A;  4LLL A;  1ZQ3 P;  2MH9 A;  4BDZ A;  1LEB A;  2DK8 A;  1ZLK A;  4ZDP A;  4HLY A;  3OOU A;  2ZNZ A;  4IVN A;  4EJO A;  3K2Z A;  4EVI A;  2GAU A;  1Z21 A;  2W7N A;  3LA2 A;  2HPI A;  2LKX A;  3AL0 C;  4A3B J;  3DBR B;  1JGS A;  3CMA I;  2BBY A;  3LSP A;  3ZQG A;  1P7J A;  4YIF A;  2DPU A;  5FRN A;  2VOO A;  5LEK A;  3M7G A;  3TO9 A;  1PVE A;  2XF7 A;  5F27 A;  3KLO A;  4Q5S F;  4D5C A;  4F93 B;  4A5N A;  1K83 J;  4ITV A;  2K9L A;  1QZE A;  5FJ8 J;  5CPR B;  3ZCO A;  2HVS A;  1BOB A;  5KAF C;  1PP7 U;  4JBA A;  4MFD A;  1LPQ A;  2CW0 F;  2DAO A;  4RGS A;  4BHP A;  1QHH D;  1TC3 C;  3HRT A;  4LG0 B;  2R7R A;  4ZJZ A;  1B4A A;  2WB1 N;  2JPC A;  5L3G A;  2MZ4 A;  2KIS A;  3CCE I;  3RQ4 A;  1MJA A;  4DQ2 A;  3ESW B;  1JUS A;  2XAQ A;  4BQN A;  4IOA F;  3DLA A;  4NHJ A;  1WZ2 A;  1X3Z B;  5EEH A;  2WWY A;  1AHD P;  1QPM A;  3JRD A;  2XRL A;  1S6L A;  2L0K A;  2MSY A;  2UZK A;  3EYY A;  3R61 A;  4HOB A;  1X1D A;  4HQM A;  3BJA A;  2V9K A;  3A03 A;  1XDU A;  1T0F C;  3FBN B;  3S3O A;  2OA4 A;  1R71 A;  4EGY A;  2ISZ A;  1XC5 A;  3LNQ A;  1B6A A;  5LHI A;  3IH3 A;  4KT6 A;  1H9G A;  3OS0 A;  3MKY B;  1Y0N A;  2JA2 A;  4FQG A;  2M2E A;  3EPZ A;  5DEQ A;  4H4K C;  1J5Y A;  3VDX A;  4FET A;  2BV6 A;  3C7J A;  2O8K A;  3TQN A;  2F4I A;  4CXF A;  3OYE A;  3G2B A;  4K2E A;  2OZU A;  3QOE A;  4U0Y A;  2VJ4 A;  3HOS A;  5HS8 A;  4A3L J;  2XSJ C;  1K79 A;  2HS5 A;  2ID3 A;  4WXH A;  1W7P B;  5CKT A;  2K7L A;  2P6S A;  1NK2 P;  2ECC A;  1T33 A;  3DEU A;  4LK1 F;  2ZJQ F;  4AYB N;  2LD5 A;  2EA2 A;  4KIG A;  1Z91 A;  2VJI A;  3BJO A;  1ON2 A;  1YI2 I;  3L1P A;  4LD5 A;  1OQY A;  2ETH A;  2WAF A;  4AD9 A;  2ESN A;  2IS2 A;  1YS7 A;  2E34 A;  4DYC A;  3IH2 A;  1J09 A;  1AOY A;  1APL C;  4IHS A;  1WPK A;  5EYR A;  4A3K J;  1IJW C;  1D5V A;  3OV8 A;  3MZ8 A;  2UUZ A;  3HOU J;  2HYG D;  1RRJ A;  1G3Y A;  3ZMZ A;  3ECH A;  1MBF A;  4XSX F;  4XID A;  1YW8 A;  1UHS A;  3DU6 A;  1X1B A;  4E7S A;  3SFZ A;  4ENK A;  4PFO A;  2I10 A;  2DDA A;  2ZJR F;  1VQ6 I;  1S8N A;  2O6G E;  5GPA A;  1IN5 A;  5LFA A;  3L2W A;  1JTY A;  5BMZ A;  3HM5 A;  3B6A A;  4OAZ A;  2B0L A;  3VYR B;  4EGZ A;  3K4K A;  3SZT A;  3OSG A;  4KN4 X;  3FXQ A;  2WC2 A;  3G73 A;  2EB7 A;  3HPH A;  2ZKZ A;  2DJN A;  3K4M A;  4IQJ A;  3W2W A;  4C2T A;  3TL4 X;  3AAF A;  3KEY A;  4BS9 A;  2X9D A;  2NNN A;  3CUQ B;  3FDY A;  4LOC A;  4CHU A;  1XTA A;  1ETK A;  1U5T A;  2HTJ A;  4D5F A;  1H9T A;  4ZYG A;  4UV8 A;  4M6Y A;  3KYC B;  2FF4 A;  1FIA A;  3Q9S A;  1RIO H;  5IYD J;  4ZC3 A;  2QBY B;  1S72 I;  2E36 A;  2JVG A;  2XPU A;  3DFG A;  4Q47 A;  2Q0O A;  4UHT A;  1LE8 A;  1TQP A;  4Q48 A;  4L5I A;  2P5V A;  3WU0 A;  2DA5 A;  4BAC A;  3V8J A;  3H5N A;  1BIA A;  5J3L A;  2A5Y B;  2VXZ A;  2CMP A;  2K86 A;  4FHT A;  1FYM A;  3HZJ A;  3FXR A;  2D45 A;  1A31 A;  3HYI A;  1WI9 A;  3SZP A;  3OY9 A;  4IZZ A;  1DQU A;  5FFX A;  3FK7 A;  3TO7 A;  1YG2 A;  4U0V A;  4L9T A;  2CV0 A;  1I50 J;  5J1U A;  2NYX A;  1SAU A;  1W5S A;  3E5X A;  3P9K A;  3L2R A;  1KU7 A;  3U21 A;  2MLG A;  1G59 A;  3H5A A;  3JRE A;  2WAE A;  5LHG A;  3TW7 A;  1Z67 A;  1BI1 A;  2UWM A;  3EUA A;  1PYV A;  2HU9 A;  5J47 A;  3ZQI A;  1N77 A;  1ZEL A;  2EV6 A;  2W84 A;  1YX5 A;  1KON A;  5JLW A;  4MIM A;  2EV5 A;  2DMU A;  2DA1 A;  2HDC A;  3F72 A;  1DGR M;  1QQI A;  2DBB A;  4G6T B;  4QPQ A;  5CVI A;  2MH2 A;  2E1O A;  2NVY J;  3KFW X;  3VYS B;  3LOC A;  4IF4 A;  4G9Y A;  1MIJ A;  2TDX A;  2VL8 A;  1BC8 C;  2W00 A;  2OU2 A;  1NHA A;  1WH5 A;  2PN6 A;  3R0J A;  2A6T A;  3FX3 A;  1H0M A;  4BNC A;  2XF5 A;  3LQR A;  5CVU A;  1XGS A;  1IRF A;  1TLH B;  4HRI A;  2X48 A;  4M9X A;  1OCO H;  1TNS A;  5M5X J;  4PSX A;  2HOT A;  3IH4 A;  2Y0M A;  4RAG A;  1Y8Q B;  1X1C A;  1EA3 A;  2N8G A;  1P7I A;  1V3F A;  3Q0W A;  4BJT A;  1W0U A;  2RVC A;  2R7U A;  2ZME C;  1B1B A;  5DM6 F;  2XB5 A;  4A6D A;  2Z99 A;  2Z3Y A;  3BG6 A;  1D5Y A;  2OCE A;  4NC8 A;  1JKQ C;  3CO6 C;  3QPS A;  2VKD A;  4WX9 A;  2BW3 A;  4YG2 F;  1HLV A;  2LKP A;  2EFO A;  4U7B A;  1R1T A;  2VUM J;  3WTW C;  5EF6 A;  2IXS A;  5IT9 R;  3PNV A;  4HQE A;  2F4O B;  1RKW A;  2H1L A;  2IGK A;  2OC6 A;  1R7J A;  3WOD F;  2IAI A;  3BR1 A;  2EFW A;  3S32 A;  2E19 A;  4KDP A;  4U88 A;  1YLF A;  4QPO A;  3O6B B;  2K27 A;  3ZOB A;  1YHQ I;  3SZG A;  4DZP A;  5H2F C;  2CQ7 A;  1I6H J;  5DUK A;  4CA0 A;  3COA C;  2BOL A;  4RB0 A;  1VI0 A;  4U7D A;  3A01 A;  3C1D A;  3CES A;  3EUK L;  3DCF A;  4O3M A;  4PJL A;  4MTD A;  1OFC X;  2GXB A;  2YS9 A;  1YRN A;  4XRF A;  4BAY A;  1R58 A;  4QTR A;  2V6C A;  3VYU B;  3V42 A;  4H0E A;  2L02 A;  5DM7 F;  3BT9 A;  1K6O A;  1TWA J;  1NG7 A;  5D5X B;  3JRG A;  3KP7 A;  2OCC H;  1XX5 A;  3ML6 A;  4NC7 A;  1F5T A;  1FIP A;  5GAH J;  5J4Y A;  1D1C A;  2RNG A;  1MBH A;  3G4S I;  3GYH X;  3Q3S A;  1A04 A;  2ZO4 A;  3K4L A;  1I1G A;  3PSI A;  2WTE A;  2BHY A;  2IRF G;  3H0G J;  4PSW A;  1FPQ A;  4HEA 2;  5ILS A;  3SXY A;  2QKM B;  4M74 A;  3H3U A;  1VQK I;  2VQG A;  3V7S A;  5H6R A;  4KNY A;  3I4M J;  5M3M J;  4UNO A;  3QU3 A;  4I7H A;  4HF1 A;  1XGM A;  4JOM A;  4XN0 A;  1I6X A;  2FNA A;  2JJ7 A;  3HOV J;  1A6I A;  2HWV A;  4IHY A;  1OCP A;  3PSF A;  2MUN A;  3R6S A;  1Y1V J;  2LBF A;  4AID A;  1MMG A;  2LSO A;  1U5T B;  4YEL A;  5LGT A;  2HPM A;  4KIC A;  1SFO J;  3TO6 A;  3ABK H;  1QA6 A;  2E71 A;  2YUS A;  1ZTR A;  2W1O A;  1HBX G;  4DGW B;  3C2B A;  1WI3 A;  2P0T A;  1DDN A;  4RBO A;  2XGE A;  1LE8 B;  2FRH A;  3OL3 A;  3GFM A;  3WGH A;  3ONQ A;  3J81 Z;  1SFE A;  4OOI A;  1WQ2 A;  4YFX F;  3AKZ A;  2DU9 A;  1SVL A;  1UHM A;  1W36 D;  1B59 A;  2IA0 A;  2VBW A;  3FBI B;  3E5U A;  3CCM I;  2Y9Z A;  3MD2 A;  1YIT I;  1OLT A;  3WTX C;  1CF7 A;  2A68 F;  2KLO A;  3B73 A;  1IRX A;  1IUY A;  2X6X A;  1OCR H;  2VBX A;  2OZ6 A;  3RDI A;  3GTL J;  2EFQ A;  3K4B A;  2GXA A;  4HF2 A;  1VZ0 A;  4B44 A;  5AIQ A;  1AU7 A;  2A61 A;  4BBS J;  1OJL A;  1HOM A;  4IPA A;  2ZXH A;  1B72 A;  4LG3 A;  1T08 B;  2HQA A;  3SDB A;  2JQ7 A;  2CRG A;  2JRM A;  3KPH A;  4CZZ A;  2JA7 J;  2Y30 A;  2XPV A;  2QWW A;  3HTS B;  4F92 B;  3MFK A;  3K70 C;  1HXD A;  2DOA A;  2P0W A;  2MYS A;  3V8K A;  5J40 A;  3OYC A;  1ZKG A;  1VQ9 I;  5KK1 A;  1HDP A;  1OMI A;  4PUS A;  3PO2 J;  2PMU A;  4GGG A;  1FT9 A;  1NTC A;  1WH7 A;  1G4D A;  1GV2 A;  1FBS A;  4M72 A;  2FQ4 A;  4XKW A;  3M4O J;  2R5Z A;  1UG2 A;  4GFB A;  2Q8K A;  1HW1 A;  1W5C C;  3K6G A;  3WTU C;  1GT0 C;  5FD5 A;  2LYC A;  3J7Y J;  2R4G A;  3WU1 B;  2QCO A;  1UAA A;  4PJJ A;  3GWZ A;  2DA2 A;  3HC7 A;  3D1N I;  1KGS A;  2YX4 A;  4DYQ A;  1MKM A;  5H20 A;  2PJP A;  1P4A A;  2NS7 A;  2KKO A;  1E3H A;  1HA8 A;  1XSX A;  3JRH A;  3PUF A;  1RZ4 A;  3I3L A;  3ZMD A;  4E4H A;  1S5L C;  1XN7 A;  2LNB A;  4MEX F;  3WG7 H;  3F21 A;  1ZRF A;  4EMS A;  2E2J J;  5D8L B;  5E20 A;  1UST A;  1J9I A;  3MMY B;  2Q1Z B;  2KFD A;  5GAG J;  5ILU A;  3VOD A;  2KIM A;  4UVB A;  4KIS A;  2DMT A;  3CZ6 A;  3IL2 A;  3TDU C;  2BW3 B;  3QYB A;  2R7D A;  4RM3 A;  1ETQ A;  1GVD A;  4YIR X;  4HYE A;  3R4K A;  2CW7 A;  2IGN A;  2ZJP F;  3MWM A;  4F52 A;  3F23 A;  2FD5 A;  3UR3 C;  2FXA A;  4OIO F;  5D4R A;  4BH9 A;  1LFB A;  5J6X A;  4I98 B;  1ACI A;  2ZXI A;  5C3E J;  4OIQ F;  4Y3O A;  4M6V A;  4PDK A;  4NQW A;  5DCM A;  4R79 A;  3A02 A;  4IHV A;  3BY6 A;  3FKI J;  1JTX A;  1BN5 A;  3O3K A;  3A01 B;  3DV8 A;  3FHN A;  4PK4 A;  2ZC2 A;  4J00 A;  2QGU A;  1DUX C;  3FMR A; 
#chains in the Genus database with same CATH homology
 5IT9 Z;  1XMK A;  3GLX A;  3ROU A;  3BDD A;  1ONV A;  1DPR A;  2ZCW A;  3RKX A;  3W6K B;  5D6E A;  4G8X A;  4Y15 A;  1E2X A;  1HW2 A;  1OYI A;  1UHW A;  4AIH A;  1OPC A;  3KZY A;  3F6O A;  4MNU A;  1XCV A;  2E1C A;  5D5W B;  1WSU A;  1FY7 A;  2M87 A;  3LFK A;  2HTS A;  1LDK B;  3LAP A;  2DQL A;  1BM9 A;  3ABU A;  5BPD A;  4ESB A;  4UXN A;  1E17 A;  4RS8 A;  1O7L A;  1K78 B;  3GFL A;  2G7U A;  1Q1H A;  2Q2E A;  3QPT A;  4BXU A;  2ISY A;  5EEG A;  1CF7 B;  2IA1 A;  2Z5U A;  1YQA A;  3JTH A;  1OR7 A;  5E8I A;  5D8K B;  1UCR A;  3KEO A;  5LBQ A;  1IN6 A;  1TBX A;  5ICC A;  2CYY A;  4CYD A;  2RDP A;  3F8N A;  2M1B A;  3L9F A;  2F5D A;  1EV7 A;  3M8F A;  5L3B A;  3EQL F;  3IC7 A;  1PUE E;  2PLY A;  2L54 A;  5ED4 A;  2FSW A;  4G7H F;  5K5Q A;  4RB2 C;  4ZYD A;  3CUQ C;  2G9W A;  5ERI A;  4RGU A;  3HOT A;  3HTU A;  1HST A;  4OIR F;  5JVT A;  1VTN C;  1O3R A;  5D6F A;  4BHC A;  2QQB A;  1G3S A;  4HX4 A;  4XSZ F;  1ZHF A;  2P7C B;  1LVA A;  3PFI A;  4ZH4 F;  4I0B A;  3KP5 A;  1G3W A;  1W4M A;  2OD5 A;  1U6G A;  3DKW A;  2A3S A;  2Z33 A;  3U9G A;  2QQA A;  5J8C A;  3I71 A;  2VE9 A;  4ENM A;  1FP2 A;  3T1B A;  1XSD A;  3ELK A;  3J81 K;  3I59 A;  2EA4 A;  1STZ A;  1DPU A;  2KJC A;  3P9C A;  4KFC A;  3B02 A;  3F8M A;  2AXL A;  3I64 A;  3IRR A;  5BQT A;  2L4A A;  1ZGJ A;  1FYK A;  5DCM B;  4ZYH A;  3P9I A;  2GA2 A;  4LJZ F;  3RPU A;  2MC3 A;  1I27 A;  2ADU A;  5F1R A;  4MEY F;  4LMY A;  4WF2 A;  5LLQ A;  2NNY A;  1W5T A;  1LNW A;  1FOK A;  2GA1 A;  1SAX A;  4NB5 A;  5BOX A;  3R60 A;  3DPL C;  5HS7 A;  3V7R A;  1O3Q A;  1O3T A;  1P2F A;  3PQK A;  1FBQ A;  2XUB A;  1R22 A;  4G94 A;  1S29 A;  1J0R A;  2QQ9 A;  4YFK F;  1JHH A;  2MA3 A;  3K9T A;  4MQV A;  2EWN A;  1ZRD A;  2VBZ A;  3M8E A;  2EK5 A;  3GFI A;  2RV8 A;  5HDG A;  2J5O A;  5D5U B;  5H6Q A;  4WCG A;  4HBL A;  3T5X A;  2EFP A;  3V4G A;  3F22 A;  4EJU A;  4HLX A;  5CYV A;  4M71 A;  3M9A A;  3DXJ F;  3BRO A;  3QP6 A;  1KU9 A;  2R3S A;  5AIP A;  1B9M A;  2DPD A;  4N0B A;  3HHG A;  2V1X A;  3TDZ C;  2E1N A;  4IHT A;  2ACJ A;  1U5T C;  3FMS A;  3BPV A;  4PGG A;  4OIP F;  3V7C A;  2CWE A;  1FZP B;  2UXN A;  5ICG A;  4WXD A;  2XAS A;  4HAM A;  3WTZ A;  2W25 A;  1FWZ A;  3HSR A;  3NEU A;  4IRH A;  5DUI A;  4EJV A;  5FO5 A;  3JAM Z;  1XGN A;  4I01 A;  4L9J A;  1R1U A;  3TKY A;  1FBU A;  4N9H A;  3I59 B;  1SFX A;  3T8R A;  3O2P E;  1HW5 A;  5L3E A;  1GXP A;  3I5U A;  2O8X A;  3RPQ A;  3I58 A;  4UUV A;  5J8F A;  1ZG5 A;  5JHU A;  5K5O A;  2D2W A;  2A6E F;  1ON1 A;  1ZG3 A;  1YS6 A;  2CFX A;  2YU3 A;  3H92 A;  3GZ6 A;  2YX7 A;  4R8H A;  4IXA A;  1B9N A;  4B09 A;  2IA2 A;  1LEA A;  5L3F A;  1R5G A;  5K1Y A;  1D8J A;  1ZAR A;  4GYI A;  3U2R A;  2F2E A;  2QUF A;  1XB4 A;  1IN7 A;  4IRI A;  2YSR A;  2DLL A;  2IT0 A;  2ELH A;  1Z05 A;  1MD0 A;  2KIF A;  1O3S A;  3T8T A;  2XAH A;  5E1Z B;  3GXO A;  1BBY A;  4HDV A;  4RGX A;  1HKQ A;  3E5Q A;  5FLX Z;  2PEX A;  2Y48 A;  1G6N A;  3EUH A;  4ZYE A;  1RNL A;  1T2K A;  2XHK A;  4XLP F;  3GZ5 A;  1IN4 A;  4P55 A;  2EJR A;  4AWX B;  1QNT A;  1GXQ A;  4MGR A;  2C6Y A;  2HQR A;  4ZZL A;  3KE2 A;  3HSE A;  4ASN A;  2L4M A;  2PMH A;  3NRV A;  1L3L A;  2DT5 A;  2ZXJ A;  2NRA C;  2CGP A;  2OQG A;  4KT5 C;  4HA8 A;  1HQC A;  4LFU A;  1REP C;  1ZRE A;  2LF7 A;  2CSO A;  2DI3 A;  2ZFW A;  2YR2 A;  3ULQ B;  5DV5 A;  2HZT A;  2XGX A;  3HIF A;  1KYW A;  4RAY A;  2VOD A;  3ZMS A;  2O03 A;  3RIR A;  3L2C A;  3J80 Z;  1PP8 F;  1ODD A;  1QO0 D;  1ZN2 A;  2RC4 A;  3F8B A;  3VB2 A;  4FX0 A;  4Z2Y A;  3E6D A;  5ICE A;  4HX7 A;  1U8R A;  4XLN F;  3I54 A;  4KUM A;  4PGH A;  3RTR A;  3IHU A;  1DP7 P;  2XAG A;  2VOP A;  2V1D A;  3QPH A;  4HX8 A;  4WWC A;  3GO5 A;  2JT1 A;  2FE3 A;  4HF0 A;  5HVQ C;  3BJ6 A;  3EDP A;  5DCF A;  1WRJ A;  1YW9 A;  2P6T A;  3FM3 A;  4WXC A;  4ON0 A;  3JW4 A;  3MQ0 A;  3ZMU A;  1RUN A;  2W57 A;  3ERE D;  3R0A A;  4HV5 A;  1U2W A;  3CJN A;  2F5E A;  2FOK A;  3BWG A;  1BI3 A;  4MTE A;  1RUO A;  4RAZ A;  5HLH A;  2DK5 A;  2VON A;  2XAJ A;  1Z1D A;  3VFZ A;  1EH7 A;  4AIJ A;  2HQN A;  2Y75 A;  2X4H A;  1YTY A;  2PI0 A;  3EET A;  2MBF A;  5DYM A;  3E3V A;  3DQV C;  3HHH A;  2IVM A;  4HDU A;  2G7H A;  3ZMV A;  4KIF A;  5LHH A;  1I5Z A;  4KIB A;  1SD5 A;  1T98 A;  1S3J A;  3DF8 A;  1MZB A;  3FM5 A;  1KU2 A;  4LGW A;  3JAM K;  3FXU A;  4YFN F;  3RYR A;  4AIK A;  4CGZ A;  1S7A A;  4A2U A;  3OOP A;  1WWX A;  1SFU A;  5FD6 A;  1MGT A;  2STT A;  2BYV E;  3ISP A;  5KVR A;  1R36 A;  3QU6 A;  1BJA A;  2KIU A;  4EM2 A;  1XGO A;  1IN8 A;  4I0A A;  3L00 A;  5FB2 A;  2XIG A;  3BZ6 A;  3WG9 A;  2JRT A;  4EQQ A;  3J7A O;  1BI0 A;  1Z6T A;  1KA8 A;  3DP7 A;  2STW A;  4JQF A;  2GQQ A;  4LB5 A;  5JI6 A;  3N4M A;  3Q9V A;  4OMY A;  2W85 A;  1TW2 A;  2HKX A;  4I09 A;  1J59 A;  4KMU X;  1BOA A;  1YW7 A;  3QAH A;  2VBY A;  1LDD A;  2KJB A;  3MAJ A;  4EM0 B;  2P4W A;  1R23 A;  1AWC A;  2FU4 A;  3K69 A;  4EV0 A;  2GZW A;  3T0Y A;  4LLG F;  4RB3 C;  5ICF A;  1KQ9 A;  3E6M A;  1FNN A;  3MZY A;  2VT3 A;  1OYW A;  5HS9 A;  2DW4 A;  5CJ9 A;  2K02 A;  3FF5 A;  4ENN A;  2A6H F;  3VOE A;  1MDM A;  2DTR A;  4U0W A;  3EYI A;  3WTT C;  2YPR A;  1SMT A;  4Y17 A;  2M45 A;  1R1V A;  4A5M A;  2LF8 A;  4QWQ A;  1W7P A;  2FML A;  1P6R A;  5LGN A;  3WE2 A;  1Y0U A;  3LA3 A;  2CG4 A;  3CTA A;  4O5V A;  3QOP A;  3LST A;  2ZJ2 A;  4D0P A;  4EJT A;  2EV0 A;  4BYY A;  1KYZ A;  2MLK A;  1LB2 A;  2IPQ X;  2O0Y A;  2OBP A;  4HV6 A;  3QP5 A;  3TOA A;  1EH6 A;  4I2O A;  3H3Z A;  4QLC U;  5K5R A;  3GUD A;  1IZ1 A;  2V9V A;  3WGI A;  3DPT A;  4OMZ A;  2BGC A;  1ULY A;  4L0Y B;  1FYL A;  2R7F A;  2HGC A;  4JK1 X;  4ZZD A;  3I0T A;  2HKO A;  1IXR C;  2KRF A;  1XCB A;  1FSE A;  3MEX A;  3K0L A;  1MJB A;  3QRF F;  3D0S A;  4BHB A;  3TOB A;  5TRD A;  1HSJ A;  5DD4 A;  1EH8 A;  4S04 A;  3RYP A;  5LGU A;  1UFM A;  2VC1 A;  4L5J A;  4M6X A;  4EJW A;  4B8X A;  3F8C A;  4WK8 F;  2L3D A;  1FC3 A;  4UVC A;  5HOO A;  2O61 A;  5LEJ A;  1ZH5 A;  1GHC A;  1TNT A;  2IP2 A;  1P92 A;  2OAZ A;  5E18 F;  5TJJ A;  2XAF A;  4Q4Z F;  5A2Q Z;  4G6Q A;  1USS A;  2DQR A;  1MDM B;  6PAX A;  3WTY C;  3HUG A;  4KMF A;  5IT9 K;  3E6C C;  3S2W A;  4OIN F;  3IKV A;  3JTG A;  2QZ8 A;  4M9S A;  2XKO A;  5E8G A;  2K4B A;  2RNJ A;  4CIC A;  1GVJ A;  2IJL A;  2RKH A;  3HRS A;  2P5L C;  4Y13 A;  5BS6 A;  1T0F A;  4YII A;  4L18 B;  1ZAO A;  3REO A;  4HZF A;  3KP3 A;  5CLS A;  5CVV A;  1W7P D;  5F64 A;  3KLN A;  4A0X A;  1IRG A;  1SD7 A;  3ZQ7 A;  3ZP5 A;  1F1Z A;  2GWR A;  2HOE A;  5L3D A;  3KP6 A;  2ZBK A;  4IJA A;  2RQP A;  2GXG A;  3HRM A;  3F3X A;  5HDN A;  4L9N A;  2M30 A;  3JSP A;  4RGR A;  4IRG A;  1QZZ A;  1TQM A;  3L7W A;  1TQI A;  3KET A;  1YFH A;  1I1S A;  1XSV A;  2H27 A;  2HYF A;  3IKT A;  3RKW A;  3P7N A;  5FFZ A;  1J75 A;  2RN7 A;  1IW7 F;  3WTV C;  3KP2 A;  4F7Z A;  1FX7 A;  1X3U A;  4RB1 A;  2JZY A;  2K4J A;  4P5O A;  1IAW A;  3WTS C;  5ILV A;  3LQQ A;  1SD6 A;  4GYG A;  2D1V A;  4LK0 F;  4S05 A;  3TGN A;  3ZN0 A;  3IRQ A;  1ZG1 A;  1HKT A;  5LRS A;  2FQ3 A;  3WE3 A;  3I4P A;  2XVC A;  2H6B A;  4FT8 A;  4DNC A;  1Z9C A;  1LDJ A;  2VT2 A;  2PBI A;  4KYW A;  1ZGA A;  4HW0 A;  4KA4 A;  2XRO A;  1IXS B;  2MD5 A;  2BE5 F;  2LDU A;  1JHF A;  4UV9 A;  4TV7 A;  1SMY F;  4LLN A;  1OYY A;  1OKR A;  2HR3 A;  4XBF A;  2PQ8 A;  1U3E M;  3GEZ A;  1ZLJ A;  3F8F A;  4R1H A;  3HSF A;  5HDK A;  3IWZ A;  1O7F A;  5CVR A;  2ZME A;  4GXO A;  1R5H A;  2JPB A;  3FMQ A;  2VE8 A;  2DO7 A;  3I53 A;  1F9N A;  1WKM A;  1BI2 A;  4FX4 A;  3GW2 A;  2XV4 S;  1P4W A;  2ZNY A;  2FMY A;  3KCC A;  2IW5 A;  3C18 A;  2XRN A;  5JR3 A;  3RJP A;  3PQJ A;  4ESF A;  4ENJ A;  2QEN A;  3U1D A;  4KN7 X;  2EFN A;  5A2Q K;  2FBH A;  3F6V A;  4A12 A;  4CO8 A;  5HLI A;  2A07 F;  4G7O F;  5D5V B;  1K78 A;  1V4R A;  1JE8 A;  1K7A A;  1KQ0 A;  5L3C A;  1JXS A;  4G7Z F;  4MQ9 F;  4E70 A;  4M73 A;  3NQO A;  3ZN1 A;  2UXX A;  3K1M A;  5JFR A;  1QBJ A;  2A69 F;  5LRR A;  3E97 A;  1BC7 C;  1YO5 C;  2P7V B;  2JSC A;  3MCZ A;  3KP4 A;  3CLO A;  2E7W A;  3JSO A;  1QZY A;  2P5K A;  1O57 A;  2E7X A;  5DDG A;  2NAZ A;  1LQ1 A;  1FLI A;  2J5P A;  4G6D A;  1F4K A;  4PCQ A;  2L01 A;  4UVA A;  2QLZ A;  4N9I A;  3VEP A;  3RI4 A;  2FA5 A;  3G3Z A;  1T39 A;  4P9U A;  4OU0 A;  4BQA A;  1ZRC A;  1QGP A;  2HFH A;  3KZZ A;  1C0W A;  1T6S A;  2V79 A;  1P4X A;  2M8E A;  5FGM A;  2W24 A;  3K1P A;  3HRU A;  2FBI A;  3KEQ A;  4PZJ A;  2ESH A;  1J7K A;  3LWF A;  1HKS A;  1L0O C;  3SQN A;  3K1N A;  3SHF A;  2RGV A;  2FNP A;  4L9V A;  3D5L A;  3RKY A;  2NS0 A;  2ZME B;  3WGG A;  4P9F A;  4LB6 B;  3ABT A;  2Z9O A;  5D4S A;  2PG4 A;  1IF1 A;  1BIB A;  3ZPL A;  2XKP A;  2WV0 A;  3BOQ A;  3CUO A;  4P96 A;  2F5C A;  3GVA A;  2GIV A;  2FEZ A;  3M1E A;  3MZH A;  3ECO A;  5FLX K;  4LG0 A;  2BEO A;  2VN2 A;  2PFB A;  3CO7 C;  4EM1 A;  5F6F A;  3IWF A;  1LJ9 A;  2D1H A;  2H94 A;  2HEO A;  4CDG A;  2AS5 F;  3E6B A;  4GCV A;  2QYO A;  1FSH A;  1G3T A;  2M5W A;  2CO5 A;  4I02 A;  3FZV A;  1FP1 D;  4A0Z A;  1YYV A;  2V1U A;  2F5F A;  1TTY A;  3CDH A;  3GX4 X;  2JTV A;  4M9Z A;  3FWE A;  4O6J A;  4MHG A;  1XDS A;  2H6C A;  3LA7 A;  5BPI A;  5HLG A;  1RI7 A;  3FHZ A;  3ZMT A;  1S7O A;  1YIO A;  4ESJ A;  3BPX A;  5CVJ A;  3J80 K;  2QVO A;  1CGP A;  1J2X A;  3Q5F A;  1U78 A;  3GFJ A;  2DFI A;  2CQK A;  2VC0 A;  3V8L A;  4A6E A;  4AVP A;  3W6J B;  2OQR A;  2P8T A;  1MJ9 A;  4ETS A;  2FBK A;  1PDN C;  1D3Y A;  1TW3 A;  1ZYR F;  1SD4 A;  2H09 A;  1T38 A;  1KQ8 A;  3BP8 A;  3GF2 A;  3C3W A;  4L0Z B;  4A0Y A;  3L09 A;  3N97 A;  1R00 A;  5IT3 A;  3CUQ A;  5AON A;  2X0L A;  1Z7U A;  1Z6R A;  1KU3 A;  5DD8 A;  2QBY A;  2O3F A;  4GO1 A;  1UB9 A;  2QM3 A;  5E1W A;  1XD7 A;  2COM A;  1D8K A;  5E1X A;  3LAJ A;  1XMA A;  5E17 F;  1IXC A;  4LLL A;  2MH9 A;  1LEB A;  2DK8 A;  1ZLK A;  4HLY A;  2ZNZ A;  4IVN A;  4EJO A;  3K2Z A;  4EVI A;  2GAU A;  3LA2 A;  1JGS A;  2BBY A;  4YIF A;  2DPU A;  2VOO A;  5LEK A;  3M7G A;  3TO9 A;  3KLO A;  4Q5S F;  4A5N A;  1PP7 U;  4JBA A;  2CW0 F;  2DAO A;  4RGS A;  4BHP A;  3HRT A;  4LG0 B;  1B4A A;  2JPC A;  5L3G A;  1MJA A;  4DQ2 A;  2XAQ A;  4NHJ A;  5EEH A;  2WWY A;  1QPM A;  1S6L A;  2UZK A;  3EYY A;  3R61 A;  4HOB A;  4HQM A;  3BJA A;  1XDU A;  2OA4 A;  4EGY A;  2ISZ A;  1B6A A;  5LHI A;  1H9G A;  5DEQ A;  1J5Y A;  2BV6 A;  3C7J A;  3TQN A;  4CXF A;  4K2E A;  2OZU A;  4U0Y A;  3HOS A;  5HS8 A;  1K79 A;  2HS5 A;  4WXH A;  1W7P B;  2K7L A;  2P6S A;  3DEU A;  4LK1 F;  2EA2 A;  4KIG A;  1Z91 A;  3BJO A;  1ON2 A;  4LD5 A;  2ETH A;  4AD9 A;  2ESN A;  1YS7 A;  1AOY A;  4IHS A;  1D5V A;  3OV8 A;  2HYG D;  1G3Y A;  3ZMZ A;  3ECH A;  4XSX F;  1YW8 A;  3SFZ A;  4ENK A;  1S8N A;  2O6G E;  1IN5 A;  5BMZ A;  2B0L A;  4EGZ A;  3SZT A;  4KN4 X;  3FXQ A;  2WC2 A;  3G73 A;  2EB7 A;  2ZKZ A;  3AAF A;  2NNN A;  3CUQ B;  4CHU A;  2HTJ A;  1U5T A;  1H9T A;  4ZYG A;  4UV8 A;  4M6Y A;  2FF4 A;  3Q9S A;  1RIO H;  2QBY B;  3DFG A;  4Q47 A;  2Q0O A;  4UHT A;  1TQP A;  4Q48 A;  4L5I A;  2P5V A;  3WU0 A;  3V8J A;  1BIA A;  2A5Y B;  2VXZ A;  2K86 A;  4FHT A;  1FYM A;  3FXR A;  2D45 A;  3HYI A;  1WI9 A;  3SZP A;  5FFX A;  3TO7 A;  1YG2 A;  4U0V A;  4L9T A;  2NYX A;  1W5S A;  3E5X A;  3P9K A;  1KU7 A;  2MLG A;  5LHG A;  1BI1 A;  2UWM A;  2EV6 A;  2W84 A;  2EV5 A;  2HDC A;  3F72 A;  1QQI A;  2DBB A;  5CVI A;  2MH2 A;  3KFW X;  4IF4 A;  4G9Y A;  2TDX A;  1BC8 C;  2OU2 A;  1NHA A;  2PN6 A;  3R0J A;  3FX3 A;  1H0M A;  4BNC A;  3LQR A;  5CVU A;  1XGS A;  1IRF A;  1TLH B;  4M9X A;  1TNS A;  2Y0M A;  1V3F A;  2RVC A;  1B1B A;  4A6D A;  2Z99 A;  2Z3Y A;  3CO6 C;  4WX9 A;  4YG2 F;  2LKP A;  2EFO A;  4U7B A;  1R1T A;  3WTW C;  4HQE A;  1R7J A;  3WOD F;  2EFW A;  4KDP A;  4U88 A;  1YLF A;  3O6B B;  2K27 A;  5DUK A;  3COA C;  4RB0 A;  4U7D A;  3C1D A;  4O3M A;  4MTD A;  2GXB A;  4XRF A;  4BAY A;  1R58 A;  2V6C A;  4H0E A;  2L02 A;  1K6O A;  5D5X B;  3KP7 A;  3ML6 A;  1F5T A;  3GYH X;  1A04 A;  2ZO4 A;  1I1G A;  2WTE A;  2IRF G;  3SXY A;  1FPQ A;  5ILS A;  4M74 A;  3H3U A;  3V7S A;  5H6R A;  4KNY A;  4UNO A;  3QU3 A;  4I7H A;  4HF1 A;  1XGM A;  1I6X A;  2FNA A;  2HWV A;  3R6S A;  2LSO A;  1U5T B;  5LGT A;  4KIC A;  3TO6 A;  1HBX G;  1DDN A;  3J81 Z;  2FRH A;  3GFM A;  3WGH A;  1SFE A;  4OOI A;  1WQ2 A;  4YFX F;  2DU9 A;  1UHM A;  1B59 A;  2IA0 A;  2VBW A;  3E5U A;  3WTX C;  1CF7 A;  2A68 F;  3B73 A;  1IUY A;  2VBX A;  3RDI A;  2OZ6 A;  2EFQ A;  4HF2 A;  5AIQ A;  2A61 A;  4IPA A;  4CZZ A;  2QWW A;  3HTS B;  3MFK A;  1HXD A;  3V8K A;  5KK1 A;  1OMI A;  2PMU A;  4GGG A;  1FT9 A;  1G4D A;  1FBS A;  4M72 A;  2Q8K A;  1HW1 A;  3WTU C;  5FD5 A;  3WU1 B;  3GWZ A;  1KGS A;  2YX4 A;  1MKM A;  5H20 A;  2PJP A;  1P4A A;  2KKO A;  1XSX A;  1RZ4 A;  3ZMD A;  2LNB A;  1XN7 A;  4MEX F;  1ZRF A;  3F21 A;  4EMS A;  5D8L B;  5E20 A;  1UST A;  1J9I A;  5ILU A;  3VOD A;  2KIM A;  4UVB A;  3IL2 A;  3TDU C;  2R7D A;  4HYE A;  3R4K A;  3MWM A;  3F23 A;  2FXA A;  4OIO F;  5D4R A;  4BH9 A;  5J6X A;  4I98 B;  4OIQ F;  4PDK A;  4NQW A;  5DCM A;  4R79 A;  3BY6 A;  1BN5 A;  3O3K A;  3DV8 A;  1DUX C;  3FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...