2ISZA

Crystal structure of a two-domain ider-dna complex crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA/mbtB operator strand 1
publication title Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
total genus 51
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2iszA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2iszA02
2IP2A 5HS9A 3CO6C 5L3DA 3KCCA 3QAHA 1F1ZA 1TQMA 2P6SA 3T0YA 4CDGA 3CUQC 3I5UA 2K86A 4OIRF 4K2EA 1IZ1A 3WTSC 2XAFA 3D5LA 4KT5C 2O61A 1FC3A 3RKYA 2F2EA 3GW2A 4ON0A 3TQNA 4IHTA 1G6NA 1KU3A 2XUBA 3RYPA 4KIBA 3JSOA 1S7OA 4G94A 5IT9Z 3L7WA 2VODA 2IT0A 3V8KA 3IHUA 5EEGA 2C6YA 1IRGA 3GEZA 3E6DA 3QRFF 1B6AA 4I0BA 4EM2A 3SXYA 3HHGA 2KJCA 2A5YB 4EV0A 4HQMA 1EH8A 1YW7A 3ROUA 4GXOA 5KVRA 4AIKA 3FXQA 4P55A 1W7PA 4UNOA 3HSFA 3WTVC 1LDJA 1HKQA 2CWEA 1VTNC 3DXJF 5E1XA 1S29A 4RGUA 2L01A 2M30A 3E3VA 2G7UA 3E97A 3TDUC 3MEXA 2ZBKA 4EVIA 1JHHA 2QWWA 1MZBA 1Y0UA 3K2ZA 3GFIA 3BP8A 2FSWA 3J81K 1KQ0A 3HOTA 2D1HA 3OV8A 4B09A 1SMTA 1ON2A 3JTGA 1PP7U 5DD8A 5ICFA 2A61A 2VOOA 2ZFWA 1ZARA 2KIFA 3HUGA 2L4AA 5HS8A 2E1CA 2O0YA 3M8EA 3H3UA 2BBYA 4F7ZA 3U9GA 2Z33A 4LMYA 2GXGA 3C7JA 1G3WA 3SHFA 2M5WA 2XHKA 3E6MA 1TNSA 2IA1A 3IRRA 2BYVE 3ZMTA 2HR3A 3QP5A 2WWYA 3ELKA 2DBBA 1DUXC 2KIMA 5F1RA 4KICA 3ZQ7A 3KE2A 5JVTA 4FX4A 1P6RA 3FXUA 3VOEA 4UV9A 2ADUA 1WQ2A 4DNCA 2QVOA 3R0AA 1SD7A 1LEAA 5ICEA 1ZG3A 2R7FA 1B4AA 2DFIA 2VT3A 4WX9A 3R6SA 4EM1A 3I64A 4HX8A 2O8XA 1IXCA 4GO1A 1IN4A 5D5WB 4R1HA 1FZPB 1DPUA 2DQLA 2H09A 1BC8C 2R3SA 4CICA 3ZPLA 4R79A 4U0VA 4IF4A 1XSDA 2Y75A 1J5YA 1OR7A 2F5CA 2EFWA 2ZCWA 1RI7A 5LGNA 2FNPA 4P9FA 3HSEA 3G3ZA 3W6JB 3H3ZA 4A6EA 2ETHA 3CUOA 1BOAA 4KDPA 4U0YA 2NRAC 4EJTA 3V8JA 5DDGA 1KYWA 2QBYB 1SFXA 3Q9SA 3KLNA 1KQ9A 2HWVA 3O6BB 1MDMA 2A6HF 2K4JA 1R1UA 3M1EA 3MFKA 2L3DA 3I59A 3EUHA 2Q0OA 3WTZA 2RNJA 4RB0A 2COMA 4LK1F 3P9KA 3WTTC 2Z9OA 1FWZA 1ZAOA 4RGXA 1I6XA 5L3FA 4RAZA 3WGGA 4E70A 3TO9A 5DYMA 3VODA 5ILVA 1Z6RA 3F8MA 4L0ZB 1IN6A 5CYVA 4N0BA 3E5UA 1YO5C 4O3MA 2VT2A 3D0SA 5JHUA 2QZ8A 2XV4S 2GZWA 2YX4A 1JXSA 4M6YA 1STZA 3F21A 1XDUA 4G9YA 2A6EF 3E5QA 3GFLA 5JI6A 2MLKA 4HF0A 4A2UA 1JHFA 3RPUA 4WXCA 3GF2A 2F5DA 3R4KA 2AXLA 4XSZF 2HOEA 5JR3A 4KN4X 5BMZA 3ML6A 4HAMA 1F5TA 2YSRA 1KYZA 4FT8A 1FP1D 2JPBA 5L3EA 1FPQA 2A07F 2O3FA 4QLCU 2DO7A 3M8FA 2RV8A 3PQJA 4EMSA 3V8LA 1K6OA 3I58A 3L00A 4EGYA 2W85A 3DFGA 2ZNZA 1IN7A 5E1WA 4AD9A 2F5FA 2WV0A 3EQLF 1P2FA 1PUEE 1O7LA 1OKRA 1ZRCA 5CVUA 5H6QA 1JGSA 4NHJA 4M9XA 2QQ9A 4IRGA 1MKMA 2FRHA 2YU3A 2PFBA 1P4WA 1IF1A 3QP6A 5BPIA 1HKTA 1LEBA 2JTVA 4QWQA 3FXRA 2HKXA 2EV5A 2HYGD 4IXAA 4PCQA 5DCFA 4S05A 1WKMA 4HF1A 5F6FA 3ZMSA 4O5VA 4ZZLA 4BXUA 3PFIA 2OAZA 3SZPA 1UB9A 1J7KA 5J8FA 1D8KA 2DQRA 2E1NA 5FB2A 3WTXC 5A2QZ 2MLGA 4GGGA 1HQCA 3GYHX 2BV6A 3PQKA 1LVAA 4LGWA 4D0PA 1IRFA 3IKVA 4I0AA 3WE2A 4HDUA 2PMUA 5K5RA 1FX7A 1P4AA 4L9TA 2V1DA 3KP6A 2HYFA 4CZZA 2M1BA 2KJBA 5CVVA 2OQRA 2PEXA 2NAZA 2RKHA 1UHWA 2MD5A 3I59B 3DKWA 1AWCA 4BHPA 1BIAA 1G3YA 2OQGA 3HIFA 5CLSA 1YIOA 2ZXJA 4ESJA 1U5TC 2V6CA 5FD5A 1MGTA 3F8BA 2DI3A 5LHGA 2EK5A 1RZ4A 4CO8A 5DD4A 4L0YB 2Y48A 2UXXA 1XB4A 3I71A 3FMRA 2ZKZA 1O7FA 1TW2A 2IW5A 4JK1X 5FLXZ 1TLHB 3V4GA 2IA2A 3WGIA 3MQ0A 4KA4A 4NB5A 5E8IA 3TO6A 4B8XA 4KMFA 5FO5A 3B02A 4G7ZF 1ODDA 4HV6A 4XRFA 1FT9A 4LLGF 1R1TA 3BOQA 5ERIA 1XN7A 3F6VA 4UV8A 3F6OA 1YW9A 2X0LA 1V4RA 2EWNA 2EFOA 3BY6A 2PN6A 3BPVA 1WSUA 4LD5A 5HDKA 4M74A 2EJRA 2Q8KA 4I09A 5LGUA 5ILSA 5D6FA 1K7AA 4KNYA 5J8CA 1O3TA 4UVAA 5DCMA 4PGGA 1EH7A 1YW8A 3K69A 2HTSA 1FNNA 2DK8A 2YPRA 3T8RA 4ZYGA 3BWGA 3HRUA 2UWMA 3KFWX 4WK8F 1RNLA 4LK0F 3ZP5A 4I2OA 3C1DA 1DPRA 3T8TA 1J75A 2ZMEB 2XAQA 3ISPA 3WE3A 3F8NA 3U1DA 3EYYA 3L2CA 4EM0B 2IPQX 4EJUA 3MZHA 1B59A 4HF2A 4RB1A 2DU9A 1ULYA 3WTWC 5D5XB 4HQEA 1XDSA 5DUIA 2VONA 1K78B 4OIPF 1TNTA 5D4RA 3J81Z 2PLYA 5CVRA 2JT1A 4RB2C 4LJZF 4KIFA 4BHCA 4G8XA 2FU4A 4EGZA 5F64A 4OINF 3DF8A 1U78A 1G3TA 3RIRA 2PJPA 3P9CA 5ICGA 4R8HA 1L0OC 1DP7P 5LRRA 2XIGA 4L18B 4Q4ZF 1HBXG 3KP7A 3E6BA 1LDKB 4MHGA 3ERED 1DDNA 1U5TA 1FYLA 1P4XA 2GIVA 2JPCA 5TJJA 2IA0A 3GLXA 5LBQA 1B1BA 4TV7A 2QM3A 2H6BA 4WCGA 5HVQC 2LKPA 3Q5FA 4RAYA 2Z99A 3RKXA 1IUYA 2OBPA 1BI3A 3WTUC 1F4KA 1ZHFA 2DTRA 1FBUA 1UHMA 2GA1A 4U88A 5JFRA 2BEOA 1XGMA 3BJAA 5HOOA 2L4MA 3T1BA 1H0MA 5HLGA 5ED4A 1ZN2A 2KRFA 2GQQA 3R61A 3VFZA 1WRJA 2JRTA 3CUQA 1EV7A 1W5TA 4MTEA 2KIUA 3GWZA 4ETSA 4HZFA 5D8LB 1QO0D 4LB5A 3LAJA 2P5LC 5HS7A 1ZLJA 4XLPF 3ZN0A 2PMHA 3RTRA 3K1PA 2JSCA 3ABTA 1NHAA 5LHIA 3KEOA 5LRSA 1TQPA 1QPMA 4Q48A 2XASA 2R7DA 3GX4X 3DQVC 2XAGA 1I5ZA 5FGMA 1RUOA 1OYIA 3L9FA 2V1UA 4IRHA 4ZYHA 4BHBA 1OPCA 1BM9A 1I1SA 3G73A 1BBYA 1HKSA 1PP8F 2DPDA 2K27A 1O57A 4PDKA 3SQNA 1J2XA 5DV5A 4KUMA 3IWFA 2OZUA 1S7AA 3IRQA 2MH2A 2IJLA 4KIGA 4AWXB 2VE8A 4HA8A 1ZGAA 3K1NA 3RYRA 1Z1DA 2XVCA 2FF4A 3GUDA 1Z91A 4MQVA 2E7WA 3MWMA 3I0TA 3KETA 1U8RA 1J0RA 3TOBA 2HQNA 1W7PB 4LLNA 4UXNA 1FLIA 3E6CC 2EV6A 5E1ZB 1ZRDA 2L54A 4ASNA 1YFHA 4KMUX 3TDZC 2ESNA 2CYYA 5L3CA 4L9NA 2PQ8A 1OYYA 2STWA 4UUVA 2GA2A 2KKOA 2VBZA 3RDIA 2HZTA 2LSOA 3T5XA 2MA3A 1ZGJA 1KGSA 4L5IA 2HDCA 2M45A 3RPQA 3W6KB 2NS0A 4UHTA 4M71A 2EA4A 3RI4A 1FY7A 3KEQA 3R0JA 1OMIA 4CHUA 5LGTA 1R5GA 4LG0A 2P7VB 4HV5A 2XRNA 4ZZDA 4ENJA 3DP7A 1BN5A 3EYIA 2FXAA 2ACJA 4RGSA 4EJWA 1Z6TA 3KP5A 5HDNA 3MCZA 3WODF 1ZLKA 1R23A 3K1MA 1WWXA 3LQQA 4NQWA 2B0LA 2UXNA 2RGVA 5BPDA 3K0LA 2X4HA 1MJ9A 3HSRA 4L5JA 3SFZA 2P4WA 1Q1HA 3ZN1A 5CVJA 2XKPA 5DEQA 5D5VB 2OU2A 3CUQB 1YS6A 1BI0A 4A12A 2FE3A 4P9UA 3WU1B 5FFZA 2D45A 3JSPA 2FMLA 2FQ3A 1G4DA 4G7OF 1GHCA 1QZZA 1QZYA 4RS8A 1S8NA 1D5VA 2A68F 1BI2A 5J6XA 4A5NA 3BJOA 5ICCA 4MQ9F 3S2WA 4CGZA 2FOKA 1K79A 5BS6A 4JQFA 3HTUA 3NQOA 5EEHA 3V7CA 1V3FA 2CO5A 3K9TA 2YR2A 2DAOA 1QGPA 4LLLA 1AOYA 3TO7A 3NRVA 1TW3A 2W25A 2CW0F 2V79A 3BPXA 2RC4A 3H92A 3SZTA 4IRIA 1RIOH 1R58A 3ABUA 2GAUA 1BI1A 2ESHA 4Y15A 2K7LA 3HOSA 2VOPA 3F8CA 1SMYF 3FM3A 4U0WA 4BNCA 1E2XA 1USTA 1MDMB 1YG2A 3EETA 2H27A 4EJOA 4ZYDA 2OA4A 1IN8A 3J80K 3BROA 4M72A 2HQRA 1G3SA 2DT5A 4Q47A 1ZH5A 1U3EM 4U7BA 3HTSB 2XAHA 5HLHA 2P6TA 5FD6A 1SD5A 1ONVA 4A5MA 3GFMA 4FHTA 3RKWA 2P5VA 1B9NA 3ECHA 2K02A 1XCBA 4ENKA 3LSTA 4GYIA 3LAPA 3GZ6A 3WG9A 4UVBA 5LEKA 1KU7A 3ECOA 3CDHA 2Z5UA 4WF2A 1HW1A 4IJAA 2STTA 3HRMA 1J9IA 4ESBA 1T38A 4IPAA 3O2PE 4HBLA 5FFXA 4ZH4F 1GXPA 3V7SA 2XAJA 3GVAA 3LA7A 2H94A 2EA2A 1FSHA 1LQ1A 2RN7A 4BH9A 1YLFA 4AIHA 4LG0B 1T2KA 4DQ2A 4EJVA 1R00A 1R5HA 4OMZA 3MZYA 1W4MA 5HLIA 1REPC 3COAC 3O3KA 4L9VA 4OIOF 1CGPA 2P5KA 1UFMA 1ZYRF 5D6EA 2QBYA 4G7HF 3R60A 1ZRFA 2BE5F 3IL2A 2M87A 4RB3C 1SAXA 3F23A 4PGHA 1ON1A 1YYVA 3TOAA 5H20A 1RUNA 3B73A 5IT9K 2Z3YA 1BC7C 2DK5A 1XSVA 4ZYEA 1CF7A 2Q2EA 3LQRA 1EH6A 5LEJA 2W24A 2CG4A 2HGCA 1HW5A 4WXHA 3HRTA 3WU0A 3OOPA 5L3GA 4CXFA 4YIIA 1YS7A 2QQAA 5LHHA 2V1XA 3KP2A 5H6RA 1IAWA 1FYKA 3IKTA 3KZZA 2ZO4A 3QPTA 3JAMZ 1FBSA 1KQ8A 1XGSA 1I1GA 1R1VA 4HLYA 1MD0A 3JAMK 4AIJA 1R7JA 5AIPA 1YTYA 1FOKA 3P9IA 3TKYA 2JZYA 2VN2A 2A3SA 2A69F 2XROA 4EQQA 2ISZA 2J5PA 4I02A 4WWCA 1D8JA 1H9TA 2D1VA 5D4SA 2DW4A 1HXDA 3GXOA 4ENNA 1QBJA 2HEOA 1BIBA 4HDVA 3Q9VA 5D5UB 4S04A 1FYMA 1U2WA 2HTJA 4BAYA 1P92A 3TGNA 4YIFA 3KP3A 3FMSA 2XGXA 3C18A 2QQBA 3ULQB 3IC7A 3KP4A 1HSJA 2IVMA 1WI9A 3KZYA 3I4PA 3FF5A 2VBWA 3DEUA 4N9IA 1IXRC 1HW2A 1B9MA 4O6JA 4HX4A 1S3JA 3WGHA 3JTHA 1XSXA 4RGRA 4M73A 3DPTA 1T6SA 1XD7A 4KFCA 4XSXF 2PBIA 5LLQA 4OOIA 4XBFA 2AS5F 5TRDA 2M8EA 1ZREA 3GO5A 3J7AO 2NYXA 1LB2A 3CO7C 2GWRA 2YX7A 4WXDA 2UZKA 2WC2A 3HYIA 4LFUA 5E18F 1GVJA 1SFEA 1Z9CA 2OZ6A 2QENA 2FNAA 2G7HA 3GZ5A 2W57A 4ESFA 4MGRA 4FX0A 4GCVA 4I01A 3CTAA 1LNWA 2HFHA 3L09A 1LDDA 2QUFA 2VE9A 3FHZA 1XMKA 4IVNA 3ZMDA 6PAXA 2RVCA 1O3SA 3NEUA 5L3BA 3QU3A 4GYGA 2QYOA 2EFPA 5DCMB 2VC1A 1TQIA 3C3WA 5BQTA 5K1YA 2FBKA 4PZJA 2E7XA 1KU9A 1LJ9A 1SD4A 1BJAA 3HRSA 2MBFA 3FWEA 1ZG5A 2P8TA 2LF8A 5BOXA 1HSTA 3I53A 1J59A 2PI0A 4CYDA 4JBAA 3IWZA 3F22A 4Q5SF 4Y13A 2EV0A 1T0FA 4OU0A 2PG4A 4P5OA 1Z05A 2ISYA 1XCVA 1MJBA 4BYYA 2CQKA 1FBQA 1CF7B 2IRFG 1FP2A 3F3XA 3CJNA 4IHSA 1USSA 4H0EA 2VBXA 4U7DA 4MTDA 3QPHA 1F9NA 2K4BA 3HHHA 1OYWA 3LWFA 3BDDA 1MJAA 1QNTA 1O3QA 2WTEA 1H9GA 1QQIA 4HW0A 1SD6A 2W84A 5CJ9A 2DLLA 1I27A 4YFXF 1KA8A 1S6LA 3I54A 1UCRA 3LA2A 2BGCA 3M7GA 2OD5A 5AIQA 1O3RA 4M6XA 5KK1A 5D8KB 1W5SA 3E5XA 3ZMZA 4KYWA 2L02A 2FEZA 3RJPA 3BJ6A 1XGNA 2LDUA 1FSEA 4LB6B 2EB7A 1U5TB 5HDGA 4UVCA 4HX7A 1GXQA 4A6DA 4AVPA 3VEPA 2EFNA 3LA3A 3N4MA 4BQAA 4MEYF 3EDPA 4N9HA 4L9JA 5E8GA 4MNUA 5E20A 1KU2A 3N97A 3DV8A 2DPUA 2MC3A 2ZMEA 3FX3A 3REOA 5ILUA 1T98A 3CLOA 2FA5A 2O6GE 3QOPA 1R36A 3U2RA 3ZMUA 2D2WA 4Z2YA 4OIQF 3LFKA 3FMQA 4Y17A 4I98B 1K78A 3M9AA 2EFQA 1C0WA 2TDXA 2VXZA 5CVIA 2RQPA 3KLOA 5K5QA 1R22A 4HOBA 1X3UA 2GXBA 2MH9A 3F8FA 3JW4A 1TBXA 1XMAA 4A0YA 2LNBA 3BZ6A 4A0XA 1U6GA 2FMYA 3DPLC 3VB2A 1T39A 2CFXA 2P7CB 4G6QA 3V7RA 2LF7A 3FM5A 5A2QK 2ZNYA 4P96A 1SFUA 1XGOA 1IW7F 1YQAA 1D3YA 3QU6A 4MEXF 5DUKA 3J80Z 2FBIA 2HKOA 2CGPA 1E17A 4ENMA 1PDNC 2NNYA 2Y0MA 1JE8A 4A0ZA 2V9VA 1IN5A 4M9ZA 4HLXA 2H6CA 4YFKF 3FZVA 2F5EA 2RDPA 2XKOA 3ZMVA 5AONA 2O03A 2J5OA 2CSOA 4G6DA 4HYEA 4XLNF 4YG2F 5IT3A 1L3LA 2QLZA 4M9SA 2HS5A 2FBHA 4OMYA 3AAFA 1ZG1A 2VC0A 3GFJA 4I7HA 2NNNA 1A04A 3MAJA 4YFNF 1Z7UA 4KN7X 5E17F 2ELHA 5FLXK 1IXSB 2ZJ2A 5K5OA 1W7PD 2G9WA 3P7NA 3F72A 2VBYA 3WTYC 1TTYA
chains in the Genus database with same CATH superfamily
2DT6A 3VPRA 4A3FJ 2IP2A 5HS9A 3K70D 3CO6C 1N75A 5L3DA 5K7HA 3KCCA 1TWAJ 3QAHA 1F1ZA 1B72B 1TQMA 3GTPJ 2XDVA 5J1YA 4BBRJ 2P6SA 3T0YA 4CDGA 3CUQC 3G2BA 1D1CA 1QVTA 3S1MJ 2IGNA 3I5UA 2R7ZJ 2K86A 4IHYA 4BXFA 2GM4A 2FJ1A 4OIRF 4OWRB 4K2EA 1IZ1A 2M4GA 3WTSC 3HOZJ 2XAFA 3D5LA 4KT5C 2CJJA 2O61A 1FC3A 5IYDJ 4YIRX 1CQTA 2OCEA 3RKYA 2F2EA 3GW2A 4ON0A 2PJRA 1JI8A 2DOEA 3TQNA 4IHTA 1N78A 1G6NA 1KU3A 1T8IA 3K10A 4NQWB 4N4NB 1MBHA 2XUBA 2K9QA 3RYPA 1HDDC 4KIBA 1KZHA 3JSOA 3S1QJ 1S7OA 4G94A 5IT9Z 4OAZA 3L7WA 2VODA 2IT0A 1LE8B 1RC9A 1DGWY 2MUNA 4XORA 3V8KA 3IHUA 5EEGA 2C6YA 3I55I 4FASD 1IRGA 3BR3A 3GEZA 3E6DA 2GIZA 4XONA 3QRFF 1B6AA 4I0BA 4AVZA 3CC4I 1UHSA 4EM2A 5M5WJ 3SXYA 3HHGA 2KJCA 3OS1A 1ENHA 2A5YB 4EV0A 4HQMA 1VQNI 3KPHA 1EH8A 1P7JA 2QQ8A 1YW7A 3ROUA 5J4YA 1D1AA 2X48A 1PUFB 4B1RA 1SEUA 4GXOA 3DCFA 2OC6A 1MSFC 5KVRA 4AIKA 3FXQA 4P55A 1W7PA 4UNOA 3J7AY 4IQ4A 3HSFA 3WTVC 1LDJA 3G1LA 3OR2C 1HKQA 2EPFA 1TZLA 4XRMA 2CWEA 3DLLF 1VTNC 3DXJF 5E1XA 1JKQC 1S29A 3OWTA 1A5JA 4XK4A 4RGUA 3FBNB 5F08A 2L01A 2M30A 3E3VA 3CZ6A 2G7UA 3E97A 3BCBA 3TDUC 3MEXA 2HQAA 4KISA 2ME6A 2ZBKA 1YIJI 2DA1A 4EVIA 1JHHA 5IOZA 2MD0A 2QWWA 2X6OA 3NARA 1MZBA 2HXOA 1Y0UA 1VI0A 3K2ZA 5M3MJ 4JOMA 3GFIA 3BP8A 2FSWA 2QKMB 3J81K 2XPVA 3CD6I 2E36A 3M8JA 5JLXA 3BG6A 1KQ0A 3BTJA 3HOTA 2D1HA 1PVEA 3OV8A 4B09A 1A6IA 1SMTA 1ZR4A 3CCQI 1ON2A 2GBYA 2OUMA 3JTGA 4Y4RA 1PP7U 4GRIA 4UB8C 1JUSA 3CC7I 5DD8A 1IDYA 2VQLA 5ICFA 2BW3B 3CDLA 2UUZA 4CYCA 1K6YA 2A61A 2HDDA 2VOOA 4Y3OA 4JX5A 2VJJA 2ZFWA 4JX6A 4AYBN 1ZARA 2KIFA 3BLYA 3HUGA 2L4AA 1ETKA 4BY7J 5HS8A 1NK2P 1BW6A 2LREA 2O0YA 3FISA 3M8EA 3OYBA 2E1CA 3H3UA 3VYTB 2BBYA 2EH3A 4F7ZA 3U9GA 1B8IB 2BHZA 5KAFC 1SC7A 3G6EI 1X1CA 3MZ8A 2E1MB 2ME0A 2XF7A 4LMYA 4HNTA 2GXGA 2Z33A 3MD2A 2E5ZA 3C7JA 3E1SA 1G3WA 3S16J 3SHFA 2M5WA 3TW7A 2XHKA 1E3HA 3E6MA 4P1WA 1TNSA 2IA1A 3H9JA 1OISA 3IRRA 2O5RA 2BYVE 3TL4X 3ZMTA 1EJ9A 2CUEA 4Y7NJ 2HR3A 3QP5A 4LIUA 2WWYA 1QZEA 3ELKA 2DBBA 1DUXC 4PSWA 1X3ZB 2KIMA 5F1RA 4KICA 3ZQ7A 1F43A 1P9QC 3KE2A 3ZCOA 5JVTA 3CF5F 2LBFB 4XN0A 3PO3J 4FX4A 1P6RA 3HC7A 3FXUA 3VOEA 4UV9A 2ADUA 1WQ2A 4DNCA 2QVOA 3IAS2 2MC4A 3R0AA 1A36A 1SD7A 2V6EA 4MLOA 1LEAA 5ICEA 1ZG3A 2R7FA 1B4AA 1YRNB 2DFIA 2VT3A 4XRSA 1WCMJ 1TWCJ 4PJNA 1W5CC 4WX9A 4C2TA 4CA0A 3R6SA 3HPGA 4EM1A 3FXMA 1Q1VA 3I64A 2LR8A 3SZGA 4E7KA 2CV2A 4HX8A 2KZGA 4BUPA 4NC8A 2O8XA 4BKXA 3CCVI 1VZ0A 1IXCA 4GO1A 1IN4A 5D5WB 3J7ZI 4R1HA 1FZPB 1V5EA 1DPUA 1NTCA 1U0JA 3HGGA 2DQLA 2H09A 3QYFA 2FD5A 1BC8C 2DOFA 1ETQA 2Y0SN 1E3OC 2R3SA 4CICA 2H8RA 3L2RA 3ZPLA 4R79A 1K61A 2DJNA 4XKCA 3MKZA 4U0VA 4BGDA 1YITI 4IF4A 1IRXA 1XSDA 5F27A 2HNHA 2Y75A 3BQYA 3OY9A 1J5YA 1OR7A 2F5CA 2EFWA 2ZCWA 1ZQ3P 1RI7A 4FTHA 5LGNA 3ZQQA 2WAQA 2FNPA 4DBQA 5E3NA 4P9FA 1DU6A 1RPWA 3HSEA 2BHYA 3G3ZA 3W6JB 3H3ZA 4A6EA 5GPCA 1MMSA 4D7MA 2AQFA 3CCLI 2ETHA 2E1OA 3CUOA 3MKYB 1BOAA 2JA6J 2FOWA 5LFAA 4KDPA 5GP9A 4U0YA 3PUFA 2NRAC 5KCMA 4EJTA 3V8JA 5DDGA 2M9HA 1KYWA 2QBYB 3BG3A 2EZKA 1SFXA 3RPUD 2PJRB 1ETXA 1FIAA 3Q9SA 3KLNA 1KQ9A 1N25A 2HWVA 1GLNA 3O6BB 1MDMA 3S14J 2A6HF 2K4JA 1R1UA 3M1EA 3MFKA 2L3DA 3I59A 3EUHA 2Q0OA 3DWLE 3WTZA 5LD2C 2RNJA 4RB0A 2COMA 2H1KA 4LG3A 4LK1F 2K9SA 3P9KA 3IH2A 4XKBA 3WTTC 2Z9OA 2XAUA 1FWZA 1ZAOA 4RGXA 3AG1H 1I6XA 5L3FA 4RAZA 3WGGA 1MH4A 4E70A 3FKJA 2KDZA 3TO9A 2HQ5A 5FKLA 2R7XA 1R49A 5DYMA 5E3OA 3VODA 5ILVA 5JVGF 1Z6RA 3F8MA 4C3IJ 4L0ZB 1IN6A 4FE4A 4DYCA 3A0HC 3K4BA 2IS6A 3OMYA 1Z3YA 5CYVA 4E7LA 5C4JJ 2F5VA 4N0BA 3S15J 3E5UA 1TWHJ 4RBOA 2NVTJ 1YO5C 2L0KA 2VJIA 3H35A 4O3MA 2VT2A 3D0SA 3PNYA 5JHUA 2QZ8A 3G71I 2XV4S 3CC2I 2GZWA 2YX4A 4CCMA 2XGEA 1JXSA 3RCOA 5JHFA 4M6YA 1STZA 3OYJA 3F21A 4HNUA 3JCUC 1XDUA 5IT9R 2F4MB 1TP4A 4A3GJ 4A3KJ 1LUJB 4G9YA 3CP2A 2A6EF 4NNJA 4M3GA 4G6TB 3E5QA 3GFLA 3SDBA 3L2WA 3S93A 4F92B 5JI6A 2MLKA 3FDYA 2K9NA 4HF0A 4A2UA 1QHGA 1JHFA 2ZJQF 3RPUA 1XMXA 3H36A 4WXCA 1R71A 3ZGKA 2DCEA 1WJFA 1X2NA 2XPUA 3GF2A 3VSLA 4DZJA 2F5DA 1VQ4I 3R4KA 4PJMA 3BR5A 4DGWB 2AXLA 2JA2A 3ONQA 2HOEA 4XSZF 3U1KA 5JR3A 1OFCX 1Z67A 3DEWA 1Y6IA 4KN4X 3ML6A 5HNFA 4F91B 4HAMA 5BMZA 1F5TA 1FTTA 2LP0A 3UR3C 3S3MA 9ANTA 3HUGB 2YSRA 1KYZA 5EG0A 3BZCA 4FT8A 2L9VA 3JRIA 1FP1D 1OCPA 2D5VA 3HDDA 2JPBA 5L3EA 1FPQA 3SYTA 1Y1VJ 2A07F 2O3FA 4QLCU 2DO7A 3DEEA 2V9PA 2DJIA 1SFKA 2DTZA 1HF0A 3M8FA 3HOVJ 3FIWA 2RV8A 4CCJA 2NVXJ 3PQJA 4EMSA 3V8LA 1K6OA 3I58A 5EGOA 4EATA 2VPLA 3L00A 4KT6A 3DU5A 3JAMR 2VL8A 2Z16A 3JR9A 2W85A 3DFGA 2ZNZA 1IN7A 4EGYA 3ZQCA 1YJWI 2IS4A 5E1WA 4AD9A 1UELB 2F5FA 1GV5A 1YX3A 2WV0A 3PSIA 2BY0A 3EQLF 2HVSA 2RAEA 1P2FA 4B44A 1BW5A 1PUEE 4QPQA 1O7LA 1SVMA 1YJNI 3HZJA 1OKRA 1ZRCA 1HLVA 1P7IA 5CVUA 5H6QA 4J01A 1OCTC 3LSRA 1V5FA 1JGSA 4NHJA 4FISA 4M9XA 4IO9F 2QQ9A 4IRGA 1MKMA 1APLC 2FRHA 2YU3A 2JMWA 2PFBA 4AIDA 2EZLA 1P4WA 1IF1A 3QP6A 2E19A 5BPIA 4PK4A 3OL3A 1HKTA 1LEBA 1WVRA 3IH3A 1I3QJ 2JTVA 4QWQA 3S1RJ 3FXRA 2HKXA 2EV5A 2HYGD 1IG7A 2O7OA 2HPMA 2LY2A 4IHXA 4IXAA 4PCQA 5DCFA 4S05A 1R6RA 1WKMA 4HF1A 5F6FA 3ZMSA 2R93J 4O5VA 4ZZLA 2XF5A 2KFDA 1XC5A 4BXUA 3PFIA 2OAZA 5E3LA 1LPQA 3SZPA 1UB9A 4BE1A 3AL0C 1J7KA 2ECCA 1R4MB 5J8FA 2VPRA 1WZ2A 1D8KA 2DQRA 2Y30A 3TEDA 2E1NA 3VYUB 5FB2A 2MFZA 2BXZA 3WTXC 5A2QZ 4HNVA 2MLGA 4J19A 4GGGA 1HQCA 2IXSA 3GYHX 2L2OA 1VF9A 2BV6A 3PQKA 1LVAA 4LGWA 4D0PA 1TC3C 1IRFA 3WHCA 3IKVA 2MVTA 1VQOI 4B3AA 4I0AA 2G0EA 2KRCA 1NK3P 4BACA 1R5ID 4YELA 1IO2A 3SEQA 4F93B 4XOTA 2A5WA 3WE2A 3O8GA 5F0CA 1A31A 2MG4A 4HDUA 2ID6A 2PMUA 2HYJA 2WAQN 5K5RA 1FX7A 3K2AA 1P4AA 2OV7A 4L9TA 1MMDA 2V1DA 2AO9A 3KP6A 2HYFA 4CZZA 2M1BA 2IGMA 1BR2A 2KJBA 4RM3A 2LKXA 4CUGA 3OYFA 5CVVA 2OQRA 2PEXA 2NAZA 4PJJA 2RKHA 1UHWA 2MD5A 5IPAA 3I59B 3DKWA 1AWCA 4BHPA 2Q1ZB 1BIAA 4AM3A 5GAGJ 1LFUP 3HEFA 1G3YA 2HXIA 2OQGA 3HIFA 1X1BA 2L7FP 5CLSA 1YIOA 2ZXJA 4ESJA 2KQRA 5GTHC 3JRBA 2X85A 3DTKA 1U5TC 2V6CA 5FD5A 1MGTA 3F8BA 2DI3A 5LHGA 2EK5A 2WAFA 3GCMA 1RZ4A 4CO8A 4QTRA 2LMDA 5CPRB 5DD4A 4L0YB 2Y48A 3CF2A 2UXXA 1XB4A 3I71A 3FMRA 2ZKZA 1O7FA 1TW2A 1X4PA 2IW5A 4JK1X 3BCAA 5FLXZ 1TLHB 4BU2A 3PIOF 3V4GA 2R7RA 2IA2A 2B7EA 1Y39A 3M1CA 3WGIA 4A3JJ 2X51A 4GDFA 3MQ0A 1T95A 2EIMH 1OLTA 3LL7A 3ZQHA 4KA4A 2XC7A 4NB5A 5E8IA 3BR1A 4M3EA 4Y52J 3I3LA 3TO6A 4B8XA 3HKZA 4KMFA 5FO5A 3B02A 1BR4A 2OF7A 2X1CA 4C3HJ 4BDYA 4G7ZF 1IDZA 1ODDA 1AHDP 4HV6A 2BVLA 1RKTA 1VQ7I 4XRFA 2LD5A 1FT9A 3K4NA 4LLGF 1R1TA 2OTJI 3BOQA 5ERIA 1XN7A 3F6VA 4UV8A 4GFBA 3E0JB 3F6OA 5J1UA 1YW9A 2X0LA 1V4RA 2EWNA 2EFOA 2PMZA 2R7QA 5IY5H 3BY6A 5HODA 2PN6A 4ZYAA 2H8WA 3S17J 1X58A 3BPVA 1WSUA 3B6AA 2B63J 3HOUJ 1AU7A 4LD5A 1GV2A 5HDKA 1JJ6C 4M74A 2EJRA 2KPMA 3BR0A 2EBIA 4I09A 2Q8KA 5K7FA 3DKYA 5LGUA 2AXTC 5DM6F 3PNTA 5ILSA 5D6FA 5FRMA 2DMQA 1JKOC 3HM5A 3ZQFA 1ETWA 3CMEI 3QOEA 5FKOA 1T08B 1K7AA 4KNYA 3FXOA 4H4KC 3PUBA 1VQKI 3ABMH 5J8CA 2WBMA 3TP3A 5EG0B 1O3TA 4UVAA 2CU7A 1EH7A 4PGGA 1YW8A 3K69A 5DCMA 2HTSA 1FNNA 3GTJJ 2DK8A 2YPRA 3T8RA 4ZYGA 2E35A 3BWGA 3HRUA 1TT5B 3SFIA 2UWMA 3KFWX 5EZGA 5GAEJ 4WK8F 2VKVA 1RNLA 3FHNA 4LK0F 3ZP5A 3HGYA 4I2OA 3C1DA 4M3DA 1DPRA 3T8TA 1J75A 5EGOB 2ZMEB 2OPTA 2XAQA 3DBLB 2V1NA 3ESWB 3ISPA 3WE3A 2ZFUA 2M7AA 3F8NA 3U1DA 1Y8RB 3EYYA 3KYCB 3QODA 3L2CA 3CCSI 4IHWA 4EM0B 2IPQX 3JRAA 3A0BC 2P0WA 4EJUA 3MZHA 1B59A 4HF2A 2DMUA 4UUSA 1FMWA 4RB1A 3CJTB 4V2GA 5F1JA 2DU9A 2W7NA 1ULYA 1IJWC 3GTGJ 5B1AH 3WTWC 5D5XB 4HQEA 1XDSA 3ZOBA 3H0GJ 3CDIA 5DUIA 2VONA 1K78B 1GDTA 1X1AA 4CSWA 1SVLA 4OIPF 2K5CA 1TNTA 4F3QA 4E7JA 2VI6A 5D4RA 2VJ4A 2JVHA 3J81Z 4BDZA 1YI2I 3MN2A 2PLYA 3VDXA 5CVRA 2JT1A 4RB2C 1W0TA 2DN0A 3H5NA 4HPQA 4LJZF 1BL0A 4KIFA 4BHCA 4XICA 4G8XA 2FU4A 4EGZA 2P0TA 5F64A 4OINF 3W6VA 2L7KA 3DF8A 1QRYA 1T0FC 4XNFA 1U78A 1G3TA 1I6HJ 3I9V2 3RIRA 2PJPA 1WH7A 4BQNA 3P9CA 5ICGA 4R8HA 1L0OC 1DP7P 1UAAA 3J7YJ 1MBJA 5LRRA 1FJLA 2XIGA 6PAXA 1Z7LA 3DBHB 3FKIJ 4UY8I 2ZB9A 4L18B 2LVSA 4Q4ZF 2JK3A 2CQQA 1HBXG 2TCTA 3KP7A 1NG6A 2X9DA 2V9KA 3E6BA 3LMMA 3JREA 3CCJI 1LDKB 4MHGA 1Z21A 3ERED 2L9RA 2DA5A 2DFHA 1DDNA 1U5TA 1FYLA 1P4XA 2QKLB 2GIVA 5K7ZA 1A35A 2JPCA 2M3AA 5TJJA 3ZQLA 2IA0A 2M35A 3H5AA 3GLXA 5LBQA 3S3OA 1B1BA 4PSXA 2L9NA 1VFCA 4TV7A 1DP3A 1MNEA 2QM3A 4X6AJ 2E34A 2H6BA 4BQQA 4WCGA 3GTKJ 5HVQC 1D1BA 2LKPA 3Q5FA 1MMAA 4RAYA 2Z99A 4C3JJ 1VQ9I 3PJRA 3RKXA 1IUYA 2OBPA 4JYKA 1BI3A 2LY9A 1DGRM 1V5GA 3WTUC 5IYCJ 2E2HJ 1RESA 1F4KA 1FOWA 1ZHFA 3NWTA 2DTRA 1FBUA 1UHMA 2IS1A 2CW7A 4RAFA 2GA1A 4U88A 1Y56A 1G59A 5JFRA 3L2QA 4DJAA 2BEOA 1XGMA 2OCCH 3BJAA 5HOOA 3AFHA 2L4MA 3SJMA 1ZELA 2XSJC 3T1BA 5TGTA 4DZPA 1H0MA 4ZDPA 1VQMI 5EDNA 5HLGA 5ED4A 1WI3A 1ZN2A 1OCCH 2KRFA 3MMYB 1TWFJ 2P81A 2GQQA 3R61A 3VFZA 1MNMC 2YS9A 1D0YA 1WRJA 2JRTA 3CUQA 3A52A 1EV7A 5FKKA 3IAM2 1W5TA 4MTEA 2BY1A 4ANJA 1RRJA 1E3PA 3Q0WA 2KIUA 3GWZA 4DOZA 4ETSA 4E7IA 4HZFA 1EKEA 3J80R 4PJ0C 2MGQA 5D8LB 1QO0D 4LB5A 1HC8A 5F0HA 3LAJA 2P5LC 3LSMA 5HS7A 1JT0A 1ZLJA 4D7NA 4XLPF 2ZXWH 3HPHA 2R7WA 3ZN0A 1W36C 3CMYA 2RNGA 3G1OA 3HOWJ 2PMHA 4M3FA 3H9GA 3KYDB 3OL4A 3K1PA 3RTRA 2JSCA 3BG5A 2KMUA 1NHAA 3ABTA 3KEOA 5CKTA 3S8PA 5LHIA 3HKZN 4AU7A 5LRSA 1WHUA 3JRGA 3ZRGA 3CCEI 5IP9J 1TQPA 1QPMA 3D1NI 4Q48A 1ERDA 2XASA 4M3BA 3MKLA 2R7DA 2GXAA 3QWLA 5M3FJ 3GX4X 2CH0A 3DQVC 2XAGA 3Q0VA 1I5ZA 4X1EA 4A3CJ 2K9MA 1QPIA 5FGMA 1RUOA 1OYIA 2X6WA 3L9FA 3TW6A 2V1UA 3GTLJ 2PMZN 2R92J 4IRHA 4ZYHA 4BHBA 5M5XJ 4FETA 1OPCA 1BM9A 2VB6A 3HBLA 4RLQA 2R7UA 1I1SA 1MMGA 3G73A 1BBYA 1Z3XA 2WADA 2HDWA 3I4NJ 1HKSA 3VYRB 2CFOA 1PP8F 3DTIA 4ABZA 1SFOJ 4XMYA 2GOXB 2DPDA 1MBEA 2K27A 1O57A 3K4JA 4PDKA 3SQNA 1J2XA 5DV5A 4KUMA 4CCKA 3IWFA 2OZUA 2L7ZA 2WAEA 1S7AA 3M07A 3IRQA 3BTIA 3EPZA 4MFDA 2MH2A 2IJLA 3KYLA 5FRNA 4KIGA 4AWXB 2VE8A 4HA8A 1G2HA 4BE2A 1ZGAA 4B47A 3K1NA 1XG1A 3RYRA 1DU0A 1Z1DA 2GLOA 2XVCA 4FE7A 1VQ5I 2FF4A 3GUDA 3CJRB 1YX5A 1Z91A 4MQVA 2E7WA 3MWMA 3I0TA 3KETA 1U8RA 1J0RA 3TOBA 2HQNA 1W7PB 2M7BA 4LLNA 4UXNA 4UUSB 2E1MC 1FLIA 3LSGA 3E6CC 2EV6A 3SEZA 5E1ZB 4BL0B 3OS2A 1ZRDA 1IRZA 2XRLA 2YUSA 3S32A 2L54A 4ASNA 1YFHA 4KMUX 2F6CA 3QPSA 2KLOA 3TDZC 2ESNA 4IZZA 1MW7A 2XPWA 2CYYA 5L3CA 4L9NA 4XLHA 2PQ8A 1OYYA 3CMAI 2ZSHB 2STWA 4UUVA 2GA2A 1JTXA 2KKOA 2VBZA 5HLTA 1WJCA 3RDIA 4A3BJ 2HZTA 2LSOA 3T5XA 3H5RA 2MA3A 1ZGJA 1U8BA 4QIWN 2E5NA 1KGSA 4E7ZA 4L5IA 2HDCA 2JVGA 2M45A 3RPQA 1OCOH 2NS0A 3W6KB 4UHTA 2ELJA 4II3A 4M71A 2EA4A 2JA8J 3RI4A 1FY7A 2VUMJ 5DM7F 3KEQA 3HOYJ 3R0JA 1OMIA 5EZHA 4CHUA 2EZHA 5TISC 5LGTA 2JSPA 4CYCB 1R5GA 4LG0A 2LTPA 3HOXJ 1TL8A 2P7VB 4HV5A 4IQJA 1JTYA 2XRNA 2ZSIB 4ZZDA 2OJED 4ENJA 3DP7A 1BN5A 5IOYA 3EYIA 2FXAA 3IV5A 2ACJA 3S1NJ 4NC6A 1ETVA 1JUPA 4RGSA 4ZC3A 1K4TA 4EJWA 1Z6TA 3L2VA 3KP5A 2QCOA 3A01A 5HDNA 4NBQA 3MCZA 3A2KA 5IP7J 4II2A 2UV1A 1XX5A 4LOCA 3WODF 3G4SI 2V4JC 2M0MA 1ZLKA 1R23A 3K1MA 2X98A 1WWXA 3LQQA 2MABA 4NQWA 2B0LA 2UXNA 2M2EA 5E79C 1LFPA 1RR7A 5EJCA 2RGVA 3BQZA 3W3CA 3CCMI 5BPDA 3OYAA 2LK2A 4XLAA 3J81R 3K0LA 2X4HA 3J7AW 3BR2A 1MJ9A 5GAHJ 2JN6A 2E71A 1DQUA 3HSRA 4FCYA 2V26A 4XN3A 3GLLA 3Q0UA 2M8GX 4L5JA 5J4VA 5FROA 3SFZA 3IH4A 3OR1C 2JJ7A 2P4WA 1X4OA 5EYRA 2LFBA 1Q1HA 4C30A 2NXNB 3W2WA 2EILH 1UMQA 2LRDA 1G8XA 5EF6A 2CQ7A 5E3MA 3JRFA 2ELKA 4MFEA 3ZN1A 5CVJA 3UKGA 2XKPA 5DEQA 5D5VB 4BJ6C 2OU2A 1NG7A 2QSHX 3M4OJ 3CUQB 2WA0A 1YS6A 2I10A 1BI0A 4A12A 2FE3A 2K85A 4P9UA 3WU1B 5FFZA 2D45A 3I56I 3JSPA 2FMLA 2KP6A 2Y9ZA 2FQ3A 2DFFA 1G4DA 4G7OF 1GHCA 1QZZA 1QZYA 5FLVA 1MBGA 4RS8A 3PNVA 1S8NA 1OQYA 2A68F 1D5VA 1BI2A 5J6XA 3EUAA 4A5NA 3BJOA 5ICCA 4MQ9F 4XM3A 4Z6YA 3GZNB 2W4SA 3S2WA 1H8AC 4CGZA 2I5UA 1T56A 2FOKA 4BXXJ 1K79A 5DS9A 3OYMA 2AHQA 1YOVB 4FQGA 2ECBA 3D5RC 2IS2A 5BS6A 1XS9A 1LKXA 3PM1A 4JQFA 3HTUA 2TRTA 3NQOA 5EEHA 4B3XA 3V7CA 1V3FA 2JA5J 4BBSJ 2CO5A 3K9TA 1X2MA 2YR2A 2DAOA 1QGPA 5F04A 1WJAA 3CCRI 4LLLA 1AOYA 3CESA 3OIQA 3TO7A 1U9NA 2OTLI 2M34A 3NRVA 1TW3A 2XB0X 2MYSA 5KNLA 2W25A 2R5YA 2CW0F 2L9SA 2V79A 2RC4A 3BPXA 3H92A 3SZTA 2BW3A 5B5EC 2XSDC 4IRIA 3HG9A 3V42A 3QYEA 2CQNA 4ITVA 4XR6A 3K70C 1RIOH 1R58A 3ABUA 1WGXA 2GAUA 1BI1A 2ESHA 4Y15A 1JUMA 2K7LA 3LSHA 3HOSA 2VOPA 3F8CA 1SMYF 3FM3A 4U0WA 1W0UA 1B8IA 3ZR8X 3RQIA 4BNCA 1E2XA 1USTA 1MDMB 2DA6A 1YG2A 3EETA 2H27A 2BY3A 2KISA 4I99C 3BTLA 2DDAA 4EJOA 4ZYDA 2CV1A 2OA4A 1IN8A 3X2QH 3J80K 3BROA 4DIQA 4NC7A 3W2AA 2VKEA 4M72A 2HQRA 3D5SC 3OYGA 1G3SA 2A6TA 2JA7J 2DT5A 4Q47A 1ZH5A 3PFYA 1U3EM 2QSFX 3GTQJ 2CUZA 2DYSH 3OSGA 1VQLI 2VJ5A 4U7BA 3HTSB 2XAHA 1OCZH 1WPKA 2IAIA 2QSGX 3K4LA 5HLHA 2P6TA 5FD6A 1SD5A 2LBFA 3ASNH 1ONVA 4PFPA 4A5MA 2Y9YA 2BOLA 3NWSA 4D5FA 1S7EA 1RR8C 3GFMA 4FHTA 3RKWA 2P5VA 1B9NA 2CS3A 3ECHA 5M5YJ 3BG7A 2DOAA 2K02A 1XCBA 4ENKA 4E7SA 3LSTA 4GYIA 3LAPA 4BY1J 4D5CA 3GZ6A 3WG9A 4UVBA 3CMMA 5FKMA 5LEKA 1KU7A 1M1EB 1X1PA 3ECOA 3CDHA 4A3EJ 4G12A 2BVMA 1K83J 2Z5UA 1R9TJ 4JP0A 5GTIC 2W48A 3DTEA 4WF2A 1HW1A 3E7LA 2YU9J 3P5JA 1JKPC 4CH7A 4IJAA 3LSKA 2BXYA 2M0CA 2KRHA 4XRSG 2STTA 2E60A 3HRMA 2CQXA 1J9IA 4PFOA 4ESBA 4I6ZA 2EIJH 1T38A 4IPAA 3O2PE 4HBLA 5FFXA 1IC8A 4ZH4F 1GXPA 3V7SA 4C2UA 2XAJA 3QYBA 2Y69H 2WB1A 3FBIB 3GVAA 3F9KA 3LA7A 5FJ8J 2H94A 2EA2A 3JRHA 4ZTJA 3A03A 1FSHA 1LQ1A 2RN7A 4BH9A 1YLFA 4AIHA 2FUG2 1Z0XA 1IGNA 4LG0B 3EUKL 3DU6A 3RKQA 2M4KA 1T2KA 4DQ2A 3BC8A 4EJVA 5FLMJ 2MZ4A 3GBGA 1MBKA 4UUTA 2CUJA 1R00A 2K9LA 3BT9A 4D9JA 1R5HA 3ASOH 2K40A 3AG2H 2F4OB 4OMZA 3MZYA 1W4MA 2BZTA 5HLIA 3WU2C 1REPC 3COAC 3O3KA 4L9VA 3KZIC 3AKZA 1MNDA 4OIOF 1PJRA 1CGPA 2P5KA 3A01B 1UFMA 1ZYRF 3W2VA 5D6EA 3NAUA 2AQEA 2QBYA 4G7HF 3CQZJ 3R60A 3OS0A 1ZRFA 2BE5F 3IL2A 2GOMA 4ZDLA 1NH3A 1XTAA 4EEFG 2M87A 1A6QA 4RB3C 2ZXHA 3KIOA 1SAXA 1IUFA 3F23A 3CLQA 4PJLA 1VQ6I 4PGHA 4RLFA 2CUFA 5IYBJ 1ON1A 4XKVA 1YYVA 1OR7C 4CCOA 2NOGA 3WHBA 3A1YA 1X1DA 3TOAA 2R0QC 1S9HA 5H20A 1RUNA 2VQGA 3B73A 5IT9K 1WH5A 4A3IJ 2Z3YA 1BC7C 2DK5A 1XSVA 4ZYEA 1CF7A 2DA7A 2Q2EA 3LQRA 3N05A 3HL2A 1V54H 1ITYA 1EH6A 3K4MA 4F52A 5LEJA 3K7AJ 2JQ7A 2W24A 4YEJA 1K4SA 2CG4A 2HGCA 2L5QA 1HW5A 4WXHA 3HRTA 3WU0A 5C3EJ 3OOPA 2LY1A 2VIXA 5L3GA 4CXFA 1FOYA 1W1WE 1GT0C 1ETYA 4CCNA 4YIIA 2VQCA 2E2IJ 5HNHA 4CCLA 1YS7A 2QQAA 5LHHA 3EUHC 3H1CA 2V1XA 2LYCA 3KP2A 5H6RA 1IAWA 1OCRH 2VKHA 1FYKA 4D1QA 4BE0A 3IKTA 4W1UA 5C4XJ 4YRVA 3KZZA 2ZO4A 4XKWA 3QPTA 1X19A 3JAMZ 3VWBA 2ZC2A 4L5EA 1FBSA 4AUXA 1KQ8A 4X0GA 1XGSA 5B3SH 1I1GA 1R1VA 4HLYA 1MD0A 3RZOJ 3JAMK 3UNGC 4A3DJ 4AIJA 2LKSA 3TP0A 2LLKA 2HU9A 1FMVA 1R7JA 2KZVA 3IP4B 1VQPI 5AIPA 4KITB 2O9LA 1YTYA 1FOKA 3P9IA 3TKYA 5KAIC 2KL4A 2JZYA 2XF6A 2VN2A 2A3SA 2IGOA 2R5YB 2A69F 2XROA 4EQQA 3CP8A 1D0XA 4XLFA 2ISZA 2J5PA 4I02A 2E2JJ 2N8GA 4WWCA 3ZQIA 1D8JA 2X1DA 1H9TA 2D1VA 1HCRA 5D4SA 2DW4A 1HXDA 4QSHA 3GXOA 4ENNA 2HI3A 1QBJA 2HEOA 1BIBA 4HDVA 3Q9VA 4AC0A 5D5UB 1WJDA 3B6CA 2NS8A 4S04A 1FYMA 1U2WA 2HTJA 4BAYA 1P92A 3TGNA 4YIFA 3KP3A 5CQEA 4S0HB 3Q3SA 3FMSA 2XGXA 3C18A 2QQBA 3ULQB 3IC7A 2WV1A 3KP4A 1BA5A 1HSJA 2IVMA 5A2QR 1TT0A 3TBIA 1WI9A 3KZYA 3I4PA 2R7VA 1RKWA 3FF5A 2VBWA 3DEUA 4N9IA 1IXRC 1JJ8C 2DMTA 4IL6C 4BJ5C 1HW2A 3LOCA 1B9MA 4O6JA 2EZIA 3H9QA 3HB9A 1FIPA 4HX4A 1S3JA 3WGHA 3JTHA 2XB5A 1XSXA 4N4OB 4RGRA 4M73A 3DPTA 1T6SA 2QA4I 2DA3A 4ZTFA 2HOTA 4V19K 4E6KG 1XD7A 4KFCA 4XSXF 3VYSB 2PBIA 1FEXA 5LLQA 5J1RA 4OAYA 4OOIA 4XBFA 2AS5F 3IUOA 5TRDA 2M8EA 1ZREA 2Z1DA 3GO5A 3J7AO 2NYXA 1JGGA 2QEXI 2ZMEC 2CW8A 1LB2A 3CO7C 2GWRA 1VNDA 2YX7A 1QU3A 4WXDA 2UZKA 1I39A 2WC2A 3GTOJ 3HYIA 4LFUA 3KX2A 3PSFA 2RQQA 4HSTA 4UB6C 5E18F 1GVJA 1SFEA 1Z9CA 2OZ6A 1ACIA 1I50J 2WY7Q 2DA4A 3ERMA 3BTCA 2QENA 2FX0A 3FXKA 3S3NA 2FNAA 2G7HA 3GZ5A 4MIMA 2KIQA 2W57A 4ESFA 4MGRA 5J47A 1D5YA 4FX0A 1SANA 2ZXIA 4GCVA 4I01A 2R5ZA 3CTAA 1LNWA 4A3LJ 1GUUA 2HFHA 2IGKA 2X6YA 1LDDA 3L09A 1XPXA 3BR6A 2QUFA 3QQAA 2VE9A 1AKHA 3FHZA 1XMKA 4BEHA 4B48A 2EINH 4IVNA 2NVYJ 3ZMDA 3QPLA 2RVCA 2WB1N 3LFUA 1SAUA 4IX7A 1LFBA 3NEUA 5CQGA 1O3SA 5FLXR 5L3BA 3QU3A 4GYGA 4IOAF 1E0EA 2NVUB 2QYOA 2EFPA 3ABKH 4M6VA 5DCMB 4DYRA 2X1EA 2VC1A 4ZDOA 1TQIA 1HDPA 3OYNA 3C3WA 5BQTA 4IOCF 2DT7B 2IEKA 5K1YA 2FBKA 2ICWG 2F48A 1ZGWA 4PZJA 2E7XA 1KU9A 2MW8A 1N77A 1LJ9A 2VKDA 2Y31A 5J40A 1SD4A 1BJAA 3HRSA 3OIOA 2MBFA 3FWEA 3HJEA 2P8TA 1ZG5A 2XGDA 3CCYA 2LF8A 5BOXA 1HSTA 3I53A 1J59A 2PI0A 2DYRH 4CYDA 1RQ6A 4JBAA 2R7OA 3IWZA 3F22A 1EF4A 4Q5SF 2IBDA 4Y13A 2EV0A 3L1PA 1MBFA 2KHMA 1T0FA 4OU0A 3S2DJ 2PG4A 4P5OA 3AL0B 2Z2SB 1Z05A 2ISYA 4F55A 1XCVA 1MJBA 4BYYA 1I3AA 2KDOA 1FBQA 2CQKA 1CF7B 2A05A 2Q2EB 2IRFG 1FP2A 3F3XA 3CJNA 4IHSA 1USSA 1UJ8A 4H0EA 2VBXA 2CMPA 3FXLA 4LIVA 4U7DA 4MTDA 1YJ9I 3QPHA 4NDLA 1F9NA 2DMPA 2K4BA 5FKNA 4C9YA 3CJQB 1W36D 2PX9A 3HHHA 1OYWA 2LH9A 2JRMA 1TWGJ 3LWFA 3BDDA 1MJAA 3C2BA 2LOOA 4RA2A 1QNTA 2VASA 1O3QA 2WTEA 1ORKA 2ID3A 1ETOA 2HPIA 5C44J 3PO2J 1H9GA 1QQIA 1H88C 2DODA 2V7FA 4HW0A 1S5LC 1SD6A 2W84A 3DBRB 5CJ9A 2DLLA 1H89C 1ZKGA 1I27A 3WG7H 4YFXF 2F4IA 3DPUA 4XLCA 1KA8A 1S6LA 3I54A 1JKRC 1UCRA 3LA2A 2B9SA 1ZK8A 2BGCA 4QPOA 3A4CA 2OD5A 3M7GA 5AIQA 1WJEA 1O3RA 1Y8QB 4M6XA 5KK1A 3FXJA 1W5SA 5D8KB 2HZDA 4PUSA 3E5XA 4MO7A 3JRDA 3ZMZA 4KYWA 2L02A 3OSFA 1B72A 1MIJA 2FEZA 1IV8A 3BJ6A 1XGNA 3RJPA 4A93J 2LDUA 1FSEA 4CZCA 4LB6B 1U9OA 2EB7A 2NS7A 2W82A 3LSIA 1U5TB 1RETA 5HDGA 4UVCA 4HX7A 2CRGA 3ZXSA 2L7MP 1GXQA 1VQ8I 5H2FC 1S72I 4A6DA 4AVPA 4E7HA 1Z77A 2DMNA 2H1LA 3VEPA 1AA7A 2EFNA 2XGCA 3PIPF 3LA3A 1UG0A 3N4MA 2RREA 4BQAA 4NUBA 3L2UA 4MEYF 3EDPA 4N9HA 2COBA 3BG9A 4L9JA 5E8GA 5J3LA 4HRIA 4DYQA 4MNUA 2MSYA 2DXIA 1LE8A 3BZKA 1HA8A 1WFXA 5E20A 3RSNA 1KU2A 4XOPA 2W00A 3N97A 3JRCA 3DV8A 3LSJA 1IV6A 2DPUA 1GVDA 2MC3A 4IEJA 2ZMEA 4V2FA 3OIPA 4BQOA 3FX3A 2HVQA 2QGUA 1MSEC 1JT6A 1UZCA 3REOA 5ILUA 1T98A 3CLOA 3F0CA 2JUGA 3MVPA 2W1OA 2BY2A 2EQRA 2FA5A 2O6GE 3AG4H 3QOPA 2R4GA 1PUFA 2Y2ZA 5GADJ 1R36A 4HG2A 2CV0A 3U2RA 5F0FA 3ZMUA 1HOMA 1BJZA 2D2WA 4HSRA 1F36A 4Z2YA 4OIQF 1BR1A 3CCUI 2JUCA 2R7SA 3SDGA 1EA3A 2QF7A 3LFKA 3OYCA 3FMQA 3KEYA 4Y17A 2HOSA 1FTZA 4I98B 1UG2A 4J00A 1K78A 2KT0A 3M9AA 2ZJPF 2HVRA 2EFQA 1WJBA 1QVUA 4B4CA 1C0WA 2TDXA 3LNQA 2VXZA 3ZQGA 5KHDA 5CVIA 4IKFA 2RQPA 3KLOA 4E4HA 5K5QA 3H3VK 1R22A 4HOBA 1X3UA 3PL8A 4XL9A 2GXBA 2K3PA 2LG4A 2MH9A 3F8FA 4RAGA 3JW4A 1TBXA 3S2HJ 1XMAA 1MH3A 3VSKA 4A0YA 2LNBA 3BZ6A 3HXLA 4AYBA 4A0XA 1U6GA 3GTMJ 2VQHA 4RMNA 3AG3H 3DKXA 1ZTRA 2DFEA 2FMYA 3FK7A 2DDBA 1Y0NA 3DPLC 1POGA 4HEA2 3VB2A 3A02A 3RZDJ 3OYEA 2R5ZB 1T39A 3OYHA 2CFXA 2P7CB 3MKWB 4RDUA 4G6QA 3V7RA 2LF7A 2EIKH 4JX4A 5EEAA 1X3WB 3FM5A 5A2QK 1FOXA 2ZNYA 4P96A 1AKHB 1SFUA 4BEHB 4DW6A 4U87A 3LSPA 1QA6A 1OJLA 1XGOA 1IW7F 1YQAA 2NOJB 1D3YA 3QU6A 4MEXF 2O8KA 3TMOA 3K6GA 3O8HA 3C2HA 5DUKA 3J80Z 2FBIA 4A3MJ 2HKOA 3U21A 4W97A 1YHQI 2LC2A 1O4XA 3K4KA 2CGPA 3OYKA 1E17A 4XQFA 2ZJRF 4ENMA 3OYLA 2R7TA 4ZJZA 1PDNC 2FQ4A 1YE9A 2NNYA 2DA2A 3DLAA 3OYDA 1LVKA 1MMNA 2Y0MA 1JE8A 4A0ZA 2V9VA 1IN5A 4M9ZA 4HLXA 2H6CA 4YFKF 3G1MA 1R4NB 1SVOA 1QHHD 1WJ5A 2K3FA 3FZVA 2X6XA 3RQ4A 5B1BH 2F5EA 2RDPA 3M3YJ 2XKOA 3ZMVA 5AONA 1T33A 2O03A 2J5OA 3C2GA 2CSOA 4G6DA 4HYEA 4LITA 4XLEA 5IP6A 1YRNA 4XLNF 4YG2F 5IT3A 3OYIA 2HOAA 1D0ZA 2QLZA 1L3LA 3I4MJ 4M9SA 2HS5A 3K4CA 2FBHA 3FK6A 1J09A 1V55H 4KJZA 1Y1WJ 3AAFA 4OMYA 1ZG1A 4IHVA 4B43A 1BOBA 4Y33A 2WY8Q 5JLWA 5B66C 2VC0A 3GFJA 4I7HA 4BS9A 2NNNA 1A04A 3MAJA 2Y0SA 4BJTA 4YFNF 3H0DA 2VLAA 1Z7UA 2NVQJ 4I76A 4KN7X 5E17F 3GMEA 2ELHA 4A69C 2JWTA 5FLXK 3ABLH 1ZR2A 1IXSB 5DTDA 3OOUA 2ZJ2A 5GPAA 5K5OA 4XIDA 1KONA 1W7PD 5BNGA 2G9WA 4DBRA 2I8DA 3P7NA 3F72A 1PYVA 2VBYA 2VXDA 4C2MJ 3WTYC 4RM2A 1TTYA
chains in the Genus database with same CATH topology
2IP2A 5HS9A 3CO6C 5L3DA 3KCCA 3QAHA 1F1ZA 1TQMA 2P6SA 3T0YA 4CDGA 3CUQC 3I5UA 2K86A 4OIRF 4K2EA 1IZ1A 3WTSC 2XAFA 3D5LA 4KT5C 2O61A 1FC3A 3RKYA 2F2EA 3GW2A 4ON0A 3TQNA 4IHTA 1G6NA 1KU3A 2XUBA 3RYPA 4KIBA 3JSOA 1S7OA 4G94A 5IT9Z 3L7WA 2VODA 2IT0A 3V8KA 3IHUA 5EEGA 2C6YA 1IRGA 3GEZA 3E6DA 3QRFF 1B6AA 4I0BA 4EM2A 3SXYA 3HHGA 2KJCA 2A5YB 4EV0A 4HQMA 1EH8A 1YW7A 3ROUA 4GXOA 5KVRA 4AIKA 3FXQA 4P55A 1W7PA 4UNOA 3HSFA 3WTVC 1LDJA 1HKQA 2CWEA 1VTNC 3DXJF 5E1XA 1S29A 4RGUA 2L01A 2M30A 3E3VA 2G7UA 3E97A 3TDUC 3MEXA 2ZBKA 4EVIA 1JHHA 2QWWA 1MZBA 1Y0UA 3K2ZA 3GFIA 3BP8A 2FSWA 3J81K 1KQ0A 3HOTA 2D1HA 3OV8A 4B09A 1SMTA 1ON2A 3JTGA 1PP7U 5DD8A 5ICFA 2A61A 2VOOA 2ZFWA 1ZARA 2KIFA 3HUGA 2L4AA 5HS8A 2E1CA 2O0YA 3M8EA 3H3UA 2BBYA 4F7ZA 3U9GA 2Z33A 4LMYA 2GXGA 3C7JA 1G3WA 3SHFA 2M5WA 2XHKA 3E6MA 1TNSA 2IA1A 3IRRA 2BYVE 3ZMTA 2HR3A 3QP5A 2WWYA 3ELKA 2DBBA 1DUXC 2KIMA 5F1RA 4KICA 3ZQ7A 3KE2A 5JVTA 4FX4A 1P6RA 3FXUA 3VOEA 4UV9A 2ADUA 1WQ2A 4DNCA 2QVOA 3R0AA 1SD7A 1LEAA 5ICEA 1ZG3A 2R7FA 1B4AA 2DFIA 2VT3A 4WX9A 3R6SA 4EM1A 3I64A 4HX8A 2O8XA 1IXCA 4GO1A 1IN4A 5D5WB 4R1HA 1FZPB 1DPUA 2DQLA 2H09A 1BC8C 2R3SA 4CICA 3ZPLA 4R79A 4U0VA 4IF4A 1XSDA 2Y75A 1J5YA 1OR7A 2F5CA 2EFWA 2ZCWA 1RI7A 5LGNA 2FNPA 4P9FA 3HSEA 3G3ZA 3W6JB 3H3ZA 4A6EA 2ETHA 3CUOA 1BOAA 4KDPA 4U0YA 2NRAC 4EJTA 3V8JA 5DDGA 1KYWA 2QBYB 1SFXA 3Q9SA 3KLNA 1KQ9A 2HWVA 3O6BB 1MDMA 2A6HF 2K4JA 1R1UA 3M1EA 3MFKA 2L3DA 3I59A 3EUHA 2Q0OA 3WTZA 2RNJA 4RB0A 2COMA 4LK1F 3P9KA 3WTTC 2Z9OA 1FWZA 1ZAOA 4RGXA 1I6XA 5L3FA 4RAZA 3WGGA 4E70A 3TO9A 5DYMA 3VODA 5ILVA 1Z6RA 3F8MA 4L0ZB 1IN6A 5CYVA 4N0BA 3E5UA 1YO5C 4O3MA 2VT2A 3D0SA 5JHUA 2QZ8A 2XV4S 2GZWA 2YX4A 1JXSA 4M6YA 1STZA 3F21A 1XDUA 4G9YA 2A6EF 3E5QA 3GFLA 5JI6A 2MLKA 4HF0A 4A2UA 1JHFA 3RPUA 4WXCA 3GF2A 2F5DA 3R4KA 2AXLA 4XSZF 2HOEA 5JR3A 4KN4X 5BMZA 3ML6A 4HAMA 1F5TA 2YSRA 1KYZA 4FT8A 1FP1D 2JPBA 5L3EA 1FPQA 2A07F 2O3FA 4QLCU 2DO7A 3M8FA 2RV8A 3PQJA 4EMSA 3V8LA 1K6OA 3I58A 3L00A 4EGYA 2W85A 3DFGA 2ZNZA 1IN7A 5E1WA 4AD9A 2F5FA 2WV0A 3EQLF 1P2FA 1PUEE 1O7LA 1OKRA 1ZRCA 5CVUA 5H6QA 1JGSA 4NHJA 4M9XA 2QQ9A 4IRGA 1MKMA 2FRHA 2YU3A 2PFBA 1P4WA 1IF1A 3QP6A 5BPIA 1HKTA 1LEBA 2JTVA 4QWQA 3FXRA 2HKXA 2EV5A 2HYGD 4IXAA 4PCQA 5DCFA 4S05A 1WKMA 4HF1A 5F6FA 3ZMSA 4O5VA 4ZZLA 4BXUA 3PFIA 2OAZA 3SZPA 1UB9A 1J7KA 5J8FA 1D8KA 2DQRA 2E1NA 5FB2A 3WTXC 5A2QZ 2MLGA 4GGGA 1HQCA 3GYHX 2BV6A 3PQKA 1LVAA 4LGWA 4D0PA 1IRFA 3IKVA 4I0AA 3WE2A 4HDUA 2PMUA 5K5RA 1FX7A 1P4AA 4L9TA 2V1DA 3KP6A 2HYFA 4CZZA 2M1BA 2KJBA 5CVVA 2OQRA 2PEXA 2NAZA 2RKHA 1UHWA 2MD5A 3I59B 3DKWA 1AWCA 4BHPA 1BIAA 1G3YA 2OQGA 3HIFA 5CLSA 1YIOA 2ZXJA 4ESJA 1U5TC 2V6CA 5FD5A 1MGTA 3F8BA 2DI3A 5LHGA 2EK5A 1RZ4A 4CO8A 5DD4A 4L0YB 2Y48A 2UXXA 1XB4A 3I71A 3FMRA 2ZKZA 1O7FA 1TW2A 2IW5A 4JK1X 5FLXZ 1TLHB 3V4GA 2IA2A 3WGIA 3MQ0A 4KA4A 4NB5A 5E8IA 3TO6A 4B8XA 4KMFA 5FO5A 3B02A 4G7ZF 1ODDA 4HV6A 4XRFA 1FT9A 4LLGF 1R1TA 3BOQA 5ERIA 1XN7A 3F6VA 4UV8A 3F6OA 1YW9A 2X0LA 1V4RA 2EWNA 2EFOA 3BY6A 2PN6A 3BPVA 1WSUA 4LD5A 5HDKA 4M74A 2EJRA 2Q8KA 4I09A 5LGUA 5ILSA 5D6FA 1K7AA 4KNYA 5J8CA 1O3TA 4UVAA 5DCMA 4PGGA 1EH7A 1YW8A 3K69A 2HTSA 1FNNA 2DK8A 2YPRA 3T8RA 4ZYGA 3BWGA 3HRUA 2UWMA 3KFWX 4WK8F 1RNLA 4LK0F 3ZP5A 4I2OA 3C1DA 1DPRA 3T8TA 1J75A 2ZMEB 2XAQA 3ISPA 3WE3A 3F8NA 3U1DA 3EYYA 3L2CA 4EM0B 2IPQX 4EJUA 3MZHA 1B59A 4HF2A 4RB1A 2DU9A 1ULYA 3WTWC 5D5XB 4HQEA 1XDSA 5DUIA 2VONA 1K78B 4OIPF 1TNTA 5D4RA 3J81Z 2PLYA 5CVRA 2JT1A 4RB2C 4LJZF 4KIFA 4BHCA 4G8XA 2FU4A 4EGZA 5F64A 4OINF 3DF8A 1U78A 1G3TA 3RIRA 2PJPA 3P9CA 5ICGA 4R8HA 1L0OC 1DP7P 5LRRA 2XIGA 4L18B 4Q4ZF 1HBXG 3KP7A 3E6BA 1LDKB 4MHGA 3ERED 1DDNA 1U5TA 1FYLA 1P4XA 2GIVA 2JPCA 5TJJA 2IA0A 3GLXA 5LBQA 1B1BA 4TV7A 2QM3A 2H6BA 4WCGA 5HVQC 2LKPA 3Q5FA 4RAYA 2Z99A 3RKXA 1IUYA 2OBPA 1BI3A 3WTUC 1F4KA 1ZHFA 2DTRA 1FBUA 1UHMA 2GA1A 4U88A 5JFRA 2BEOA 1XGMA 3BJAA 5HOOA 2L4MA 3T1BA 1H0MA 5HLGA 5ED4A 1ZN2A 2KRFA 2GQQA 3R61A 3VFZA 1WRJA 2JRTA 3CUQA 1EV7A 1W5TA 4MTEA 2KIUA 3GWZA 4ETSA 4HZFA 5D8LB 1QO0D 4LB5A 3LAJA 2P5LC 5HS7A 1ZLJA 4XLPF 3ZN0A 2PMHA 3RTRA 3K1PA 2JSCA 3ABTA 1NHAA 5LHIA 3KEOA 5LRSA 1TQPA 1QPMA 4Q48A 2XASA 2R7DA 3GX4X 3DQVC 2XAGA 1I5ZA 5FGMA 1RUOA 1OYIA 3L9FA 2V1UA 4IRHA 4ZYHA 4BHBA 1OPCA 1BM9A 1I1SA 3G73A 1BBYA 1HKSA 1PP8F 2DPDA 2K27A 1O57A 4PDKA 3SQNA 1J2XA 5DV5A 4KUMA 3IWFA 2OZUA 1S7AA 3IRQA 2MH2A 2IJLA 4KIGA 4AWXB 2VE8A 4HA8A 1ZGAA 3K1NA 3RYRA 1Z1DA 2XVCA 2FF4A 3GUDA 1Z91A 4MQVA 2E7WA 3MWMA 3I0TA 3KETA 1U8RA 1J0RA 3TOBA 2HQNA 1W7PB 4LLNA 4UXNA 1FLIA 3E6CC 2EV6A 5E1ZB 1ZRDA 2L54A 4ASNA 1YFHA 4KMUX 3TDZC 2ESNA 2CYYA 5L3CA 4L9NA 2PQ8A 1OYYA 2STWA 4UUVA 2GA2A 2KKOA 2VBZA 3RDIA 2HZTA 2LSOA 3T5XA 2MA3A 1ZGJA 1KGSA 4L5IA 2HDCA 2M45A 3RPQA 3W6KB 2NS0A 4UHTA 4M71A 2EA4A 3RI4A 1FY7A 3KEQA 3R0JA 1OMIA 4CHUA 5LGTA 1R5GA 4LG0A 2P7VB 4HV5A 2XRNA 4ZZDA 4ENJA 3DP7A 1BN5A 3EYIA 2FXAA 2ACJA 4RGSA 4EJWA 1Z6TA 3KP5A 5HDNA 3MCZA 3WODF 1ZLKA 1R23A 3K1MA 1WWXA 3LQQA 4NQWA 2B0LA 2UXNA 2RGVA 5BPDA 3K0LA 2X4HA 1MJ9A 3HSRA 4L5JA 3SFZA 2P4WA 1Q1HA 3ZN1A 5CVJA 2XKPA 5DEQA 5D5VB 2OU2A 3CUQB 1YS6A 1BI0A 4A12A 2FE3A 4P9UA 3WU1B 5FFZA 2D45A 3JSPA 2FMLA 2FQ3A 1G4DA 4G7OF 1GHCA 1QZZA 1QZYA 4RS8A 1S8NA 1D5VA 2A68F 1BI2A 5J6XA 4A5NA 3BJOA 5ICCA 4MQ9F 3S2WA 4CGZA 2FOKA 1K79A 5BS6A 4JQFA 3HTUA 3NQOA 5EEHA 3V7CA 1V3FA 2CO5A 3K9TA 2YR2A 2DAOA 1QGPA 4LLLA 1AOYA 3TO7A 3NRVA 1TW3A 2W25A 2CW0F 2V79A 3BPXA 2RC4A 3H92A 3SZTA 4IRIA 1RIOH 1R58A 3ABUA 2GAUA 1BI1A 2ESHA 4Y15A 2K7LA 3HOSA 2VOPA 3F8CA 1SMYF 3FM3A 4U0WA 4BNCA 1E2XA 1USTA 1MDMB 1YG2A 3EETA 2H27A 4EJOA 4ZYDA 2OA4A 1IN8A 3J80K 3BROA 4M72A 2HQRA 1G3SA 2DT5A 4Q47A 1ZH5A 1U3EM 4U7BA 3HTSB 2XAHA 5HLHA 2P6TA 5FD6A 1SD5A 1ONVA 4A5MA 3GFMA 4FHTA 3RKWA 2P5VA 1B9NA 3ECHA 2K02A 1XCBA 4ENKA 3LSTA 4GYIA 3LAPA 3GZ6A 3WG9A 4UVBA 5LEKA 1KU7A 3ECOA 3CDHA 2Z5UA 4WF2A 1HW1A 4IJAA 2STTA 3HRMA 1J9IA 4ESBA 1T38A 4IPAA 3O2PE 4HBLA 5FFXA 4ZH4F 1GXPA 3V7SA 2XAJA 3GVAA 3LA7A 2H94A 2EA2A 1FSHA 1LQ1A 2RN7A 4BH9A 1YLFA 4AIHA 4LG0B 1T2KA 4DQ2A 4EJVA 1R00A 1R5HA 4OMZA 3MZYA 1W4MA 5HLIA 1REPC 3COAC 3O3KA 4L9VA 4OIOF 1CGPA 2P5KA 1UFMA 1ZYRF 5D6EA 2QBYA 4G7HF 3R60A 1ZRFA 2BE5F 3IL2A 2M87A 4RB3C 1SAXA 3F23A 4PGHA 1ON1A 1YYVA 3TOAA 5H20A 1RUNA 3B73A 5IT9K 2Z3YA 1BC7C 2DK5A 1XSVA 4ZYEA 1CF7A 2Q2EA 3LQRA 1EH6A 5LEJA 2W24A 2CG4A 2HGCA 1HW5A 4WXHA 3HRTA 3WU0A 3OOPA 5L3GA 4CXFA 4YIIA 1YS7A 2QQAA 5LHHA 2V1XA 3KP2A 5H6RA 1IAWA 1FYKA 3IKTA 3KZZA 2ZO4A 3QPTA 3JAMZ 1FBSA 1KQ8A 1XGSA 1I1GA 1R1VA 4HLYA 1MD0A 3JAMK 4AIJA 1R7JA 5AIPA 1YTYA 1FOKA 3P9IA 3TKYA 2JZYA 2VN2A 2A3SA 2A69F 2XROA 4EQQA 2ISZA 2J5PA 4I02A 4WWCA 1D8JA 1H9TA 2D1VA 5D4SA 2DW4A 1HXDA 3GXOA 4ENNA 1QBJA 2HEOA 1BIBA 4HDVA 3Q9VA 5D5UB 4S04A 1FYMA 1U2WA 2HTJA 4BAYA 1P92A 3TGNA 4YIFA 3KP3A 3FMSA 2XGXA 3C18A 2QQBA 3ULQB 3IC7A 3KP4A 1HSJA 2IVMA 1WI9A 3KZYA 3I4PA 3FF5A 2VBWA 3DEUA 4N9IA 1IXRC 1HW2A 1B9MA 4O6JA 4HX4A 1S3JA 3WGHA 3JTHA 1XSXA 4RGRA 4M73A 3DPTA 1T6SA 1XD7A 4KFCA 4XSXF 2PBIA 5LLQA 4OOIA 4XBFA 2AS5F 5TRDA 2M8EA 1ZREA 3GO5A 3J7AO 2NYXA 1LB2A 3CO7C 2GWRA 2YX7A 4WXDA 2UZKA 2WC2A 3HYIA 4LFUA 5E18F 1GVJA 1SFEA 1Z9CA 2OZ6A 2QENA 2FNAA 2G7HA 3GZ5A 2W57A 4ESFA 4MGRA 4FX0A 4GCVA 4I01A 3CTAA 1LNWA 2HFHA 3L09A 1LDDA 2QUFA 2VE9A 3FHZA 1XMKA 4IVNA 3ZMDA 6PAXA 2RVCA 1O3SA 3NEUA 5L3BA 3QU3A 4GYGA 2QYOA 2EFPA 5DCMB 2VC1A 1TQIA 3C3WA 5BQTA 5K1YA 2FBKA 4PZJA 2E7XA 1KU9A 1LJ9A 1SD4A 1BJAA 3HRSA 2MBFA 3FWEA 1ZG5A 2P8TA 2LF8A 5BOXA 1HSTA 3I53A 1J59A 2PI0A 4CYDA 4JBAA 3IWZA 3F22A 4Q5SF 4Y13A 2EV0A 1T0FA 4OU0A 2PG4A 4P5OA 1Z05A 2ISYA 1XCVA 1MJBA 4BYYA 2CQKA 1FBQA 1CF7B 2IRFG 1FP2A 3F3XA 3CJNA 4IHSA 1USSA 4H0EA 2VBXA 4U7DA 4MTDA 3QPHA 1F9NA 2K4BA 3HHHA 1OYWA 3LWFA 3BDDA 1MJAA 1QNTA 1O3QA 2WTEA 1H9GA 1QQIA 4HW0A 1SD6A 2W84A 5CJ9A 2DLLA 1I27A 4YFXF 1KA8A 1S6LA 3I54A 1UCRA 3LA2A 2BGCA 3M7GA 2OD5A 5AIQA 1O3RA 4M6XA 5KK1A 5D8KB 1W5SA 3E5XA 3ZMZA 4KYWA 2L02A 2FEZA 3RJPA 3BJ6A 1XGNA 2LDUA 1FSEA 4LB6B 2EB7A 1U5TB 5HDGA 4UVCA 4HX7A 1GXQA 4A6DA 4AVPA 3VEPA 2EFNA 3LA3A 3N4MA 4BQAA 4MEYF 3EDPA 4N9HA 4L9JA 5E8GA 4MNUA 5E20A 1KU2A 3N97A 3DV8A 2DPUA 2MC3A 2ZMEA 3FX3A 3REOA 5ILUA 1T98A 3CLOA 2FA5A 2O6GE 3QOPA 1R36A 3U2RA 3ZMUA 2D2WA 4Z2YA 4OIQF 3LFKA 3FMQA 4Y17A 4I98B 1K78A 3M9AA 2EFQA 1C0WA 2TDXA 2VXZA 5CVIA 2RQPA 3KLOA 5K5QA 1R22A 4HOBA 1X3UA 2GXBA 2MH9A 3F8FA 3JW4A 1TBXA 1XMAA 4A0YA 2LNBA 3BZ6A 4A0XA 1U6GA 2FMYA 3DPLC 3VB2A 1T39A 2CFXA 2P7CB 4G6QA 3V7RA 2LF7A 3FM5A 5A2QK 2ZNYA 4P96A 1SFUA 1XGOA 1IW7F 1YQAA 1D3YA 3QU6A 4MEXF 5DUKA 3J80Z 2FBIA 2HKOA 2CGPA 1E17A 4ENMA 1PDNC 2NNYA 2Y0MA 1JE8A 4A0ZA 2V9VA 1IN5A 4M9ZA 4HLXA 2H6CA 4YFKF 3FZVA 2F5EA 2RDPA 2XKOA 3ZMVA 5AONA 2O03A 2J5OA 2CSOA 4G6DA 4HYEA 4XLNF 4YG2F 5IT3A 1L3LA 2QLZA 4M9SA 2HS5A 2FBHA 4OMYA 3AAFA 1ZG1A 2VC0A 3GFJA 4I7HA 2NNNA 1A04A 3MAJA 4YFNF 1Z7UA 4KN7X 5E17F 2ELHA 5FLXK 1IXSB 2ZJ2A 5K5OA 1W7PD 2G9WA 3P7NA 3F72A 2VBYA 3WTYC 1TTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP2 A;  5HS9 A;  3CO6 C;  5L3D A;  3KCC A;  3QAH A;  1F1Z A;  1TQM A;  2P6S A;  3T0Y A;  4CDG A;  3CUQ C;  3I5U A;  2K86 A;  4OIR F;  4K2E A;  1IZ1 A;  3WTS C;  2XAF A;  3D5L A;  4KT5 C;  2O61 A;  1FC3 A;  3RKY A;  2F2E A;  3GW2 A;  4ON0 A;  3TQN A;  4IHT A;  1G6N A;  1KU3 A;  2XUB A;  3RYP A;  4KIB A;  3JSO A;  1S7O A;  4G94 A;  5IT9 Z;  3L7W A;  2VOD A;  2IT0 A;  3V8K A;  3IHU A;  5EEG A;  2C6Y A;  1IRG A;  3GEZ A;  3E6D A;  3QRF F;  1B6A A;  4I0B A;  4EM2 A;  3SXY A;  3HHG A;  2KJC A;  2A5Y B;  4EV0 A;  4HQM A;  1EH8 A;  1YW7 A;  3ROU A;  4GXO A;  5KVR A;  4AIK A;  3FXQ A;  4P55 A;  1W7P A;  4UNO A;  3HSF A;  3WTV C;  1LDJ A;  1HKQ A;  2CWE A;  1VTN C;  3DXJ F;  5E1X A;  1S29 A;  4RGU A;  2L01 A;  2M30 A;  3E3V A;  2G7U A;  3E97 A;  3TDU C;  3MEX A;  2ZBK A;  4EVI A;  1JHH A;  2QWW A;  1MZB A;  1Y0U A;  3K2Z A;  3GFI A;  3BP8 A;  2FSW A;  3J81 K;  1KQ0 A;  3HOT A;  2D1H A;  3OV8 A;  4B09 A;  1SMT A;  1ON2 A;  3JTG A;  1PP7 U;  5DD8 A;  5ICF A;  2A61 A;  2VOO A;  2ZFW A;  1ZAR A;  2KIF A;  3HUG A;  2L4A A;  5HS8 A;  2E1C A;  2O0Y A;  3M8E A;  3H3U A;  2BBY A;  4F7Z A;  3U9G A;  2Z33 A;  4LMY A;  2GXG A;  3C7J A;  1G3W A;  3SHF A;  2M5W A;  2XHK A;  3E6M A;  1TNS A;  2IA1 A;  3IRR A;  2BYV E;  3ZMT A;  2HR3 A;  3QP5 A;  2WWY A;  3ELK A;  2DBB A;  1DUX C;  2KIM A;  5F1R A;  4KIC A;  3ZQ7 A;  3KE2 A;  5JVT A;  4FX4 A;  1P6R A;  3FXU A;  3VOE A;  4UV9 A;  2ADU A;  1WQ2 A;  4DNC A;  2QVO A;  3R0A A;  1SD7 A;  1LEA A;  5ICE A;  1ZG3 A;  2R7F A;  1B4A A;  2DFI A;  2VT3 A;  4WX9 A;  3R6S A;  4EM1 A;  3I64 A;  4HX8 A;  2O8X A;  1IXC A;  4GO1 A;  1IN4 A;  5D5W B;  4R1H A;  1FZP B;  1DPU A;  2DQL A;  2H09 A;  1BC8 C;  2R3S A;  4CIC A;  3ZPL A;  4R79 A;  4U0V A;  4IF4 A;  1XSD A;  2Y75 A;  1J5Y A;  1OR7 A;  2F5C A;  2EFW A;  2ZCW A;  1RI7 A;  5LGN A;  2FNP A;  4P9F A;  3HSE A;  3G3Z A;  3W6J B;  3H3Z A;  4A6E A;  2ETH A;  3CUO A;  1BOA A;  4KDP A;  4U0Y A;  2NRA C;  4EJT A;  3V8J A;  5DDG A;  1KYW A;  2QBY B;  1SFX A;  3Q9S A;  3KLN A;  1KQ9 A;  2HWV A;  3O6B B;  1MDM A;  2A6H F;  2K4J A;  1R1U A;  3M1E A;  3MFK A;  2L3D A;  3I59 A;  3EUH A;  2Q0O A;  3WTZ A;  2RNJ A;  4RB0 A;  2COM A;  4LK1 F;  3P9K A;  3WTT C;  2Z9O A;  1FWZ A;  1ZAO A;  4RGX A;  1I6X A;  5L3F A;  4RAZ A;  3WGG A;  4E70 A;  3TO9 A;  5DYM A;  3VOD A;  5ILV A;  1Z6R A;  3F8M A;  4L0Z B;  1IN6 A;  5CYV A;  4N0B A;  3E5U A;  1YO5 C;  4O3M A;  2VT2 A;  3D0S A;  5JHU A;  2QZ8 A;  2XV4 S;  2GZW A;  2YX4 A;  1JXS A;  4M6Y A;  1STZ A;  3F21 A;  1XDU A;  4G9Y A;  2A6E F;  3E5Q A;  3GFL A;  5JI6 A;  2MLK A;  4HF0 A;  4A2U A;  1JHF A;  3RPU A;  4WXC A;  3GF2 A;  2F5D A;  3R4K A;  2AXL A;  4XSZ F;  2HOE A;  5JR3 A;  4KN4 X;  5BMZ A;  3ML6 A;  4HAM A;  1F5T A;  2YSR A;  1KYZ A;  4FT8 A;  1FP1 D;  2JPB A;  5L3E A;  1FPQ A;  2A07 F;  2O3F A;  4QLC U;  2DO7 A;  3M8F A;  2RV8 A;  3PQJ A;  4EMS A;  3V8L A;  1K6O A;  3I58 A;  3L00 A;  4EGY A;  2W85 A;  3DFG A;  2ZNZ A;  1IN7 A;  5E1W A;  4AD9 A;  2F5F A;  2WV0 A;  3EQL F;  1P2F A;  1PUE E;  1O7L A;  1OKR A;  1ZRC A;  5CVU A;  5H6Q A;  1JGS A;  4NHJ A;  4M9X A;  2QQ9 A;  4IRG A;  1MKM A;  2FRH A;  2YU3 A;  2PFB A;  1P4W A;  1IF1 A;  3QP6 A;  5BPI A;  1HKT A;  1LEB A;  2JTV A;  4QWQ A;  3FXR A;  2HKX A;  2EV5 A;  2HYG D;  4IXA A;  4PCQ A;  5DCF A;  4S05 A;  1WKM A;  4HF1 A;  5F6F A;  3ZMS A;  4O5V A;  4ZZL A;  4BXU A;  3PFI A;  2OAZ A;  3SZP A;  1UB9 A;  1J7K A;  5J8F A;  1D8K A;  2DQR A;  2E1N A;  5FB2 A;  3WTX C;  5A2Q Z;  2MLG A;  4GGG A;  1HQC A;  3GYH X;  2BV6 A;  3PQK A;  1LVA A;  4LGW A;  4D0P A;  1IRF A;  3IKV A;  4I0A A;  3WE2 A;  4HDU A;  2PMU A;  5K5R A;  1FX7 A;  1P4A A;  4L9T A;  2V1D A;  3KP6 A;  2HYF A;  4CZZ A;  2M1B A;  2KJB A;  5CVV A;  2OQR A;  2PEX A;  2NAZ A;  2RKH A;  1UHW A;  2MD5 A;  3I59 B;  3DKW A;  1AWC A;  4BHP A;  1BIA A;  1G3Y A;  2OQG A;  3HIF A;  5CLS A;  1YIO A;  2ZXJ A;  4ESJ A;  1U5T C;  2V6C A;  5FD5 A;  1MGT A;  3F8B A;  2DI3 A;  5LHG A;  2EK5 A;  1RZ4 A;  4CO8 A;  5DD4 A;  4L0Y B;  2Y48 A;  2UXX A;  1XB4 A;  3I71 A;  3FMR A;  2ZKZ A;  1O7F A;  1TW2 A;  2IW5 A;  4JK1 X;  5FLX Z;  1TLH B;  3V4G A;  2IA2 A;  3WGI A;  3MQ0 A;  4KA4 A;  4NB5 A;  5E8I A;  3TO6 A;  4B8X A;  4KMF A;  5FO5 A;  3B02 A;  4G7Z F;  1ODD A;  4HV6 A;  4XRF A;  1FT9 A;  4LLG F;  1R1T A;  3BOQ A;  5ERI A;  1XN7 A;  3F6V A;  4UV8 A;  3F6O A;  1YW9 A;  2X0L A;  1V4R A;  2EWN A;  2EFO A;  3BY6 A;  2PN6 A;  3BPV A;  1WSU A;  4LD5 A;  5HDK A;  4M74 A;  2EJR A;  2Q8K A;  4I09 A;  5LGU A;  5ILS A;  5D6F A;  1K7A A;  4KNY A;  5J8C A;  1O3T A;  4UVA A;  5DCM A;  4PGG A;  1EH7 A;  1YW8 A;  3K69 A;  2HTS A;  1FNN A;  2DK8 A;  2YPR A;  3T8R A;  4ZYG A;  3BWG A;  3HRU A;  2UWM A;  3KFW X;  4WK8 F;  1RNL A;  4LK0 F;  3ZP5 A;  4I2O A;  3C1D A;  1DPR A;  3T8T A;  1J75 A;  2ZME B;  2XAQ A;  3ISP A;  3WE3 A;  3F8N A;  3U1D A;  3EYY A;  3L2C A;  4EM0 B;  2IPQ X;  4EJU A;  3MZH A;  1B59 A;  4HF2 A;  4RB1 A;  2DU9 A;  1ULY A;  3WTW C;  5D5X B;  4HQE A;  1XDS A;  5DUI A;  2VON A;  1K78 B;  4OIP F;  1TNT A;  5D4R A;  3J81 Z;  2PLY A;  5CVR A;  2JT1 A;  4RB2 C;  4LJZ F;  4KIF A;  4BHC A;  4G8X A;  2FU4 A;  4EGZ A;  5F64 A;  4OIN F;  3DF8 A;  1U78 A;  1G3T A;  3RIR A;  2PJP A;  3P9C A;  5ICG A;  4R8H A;  1L0O C;  1DP7 P;  5LRR A;  2XIG A;  4L18 B;  4Q4Z F;  1HBX G;  3KP7 A;  3E6B A;  1LDK B;  4MHG A;  3ERE D;  1DDN A;  1U5T A;  1FYL A;  1P4X A;  2GIV A;  2JPC A;  5TJJ A;  2IA0 A;  3GLX A;  5LBQ A;  1B1B A;  4TV7 A;  2QM3 A;  2H6B A;  4WCG A;  5HVQ C;  2LKP A;  3Q5F A;  4RAY A;  2Z99 A;  3RKX A;  1IUY A;  2OBP A;  1BI3 A;  3WTU C;  1F4K A;  1ZHF A;  2DTR A;  1FBU A;  1UHM A;  2GA1 A;  4U88 A;  5JFR A;  2BEO A;  1XGM A;  3BJA A;  5HOO A;  2L4M A;  3T1B A;  1H0M A;  5HLG A;  5ED4 A;  1ZN2 A;  2KRF A;  2GQQ A;  3R61 A;  3VFZ A;  1WRJ A;  2JRT A;  3CUQ A;  1EV7 A;  1W5T A;  4MTE A;  2KIU A;  3GWZ A;  4ETS A;  4HZF A;  5D8L B;  1QO0 D;  4LB5 A;  3LAJ A;  2P5L C;  5HS7 A;  1ZLJ A;  4XLP F;  3ZN0 A;  2PMH A;  3RTR A;  3K1P A;  2JSC A;  3ABT A;  1NHA A;  5LHI A;  3KEO A;  5LRS A;  1TQP A;  1QPM A;  4Q48 A;  2XAS A;  2R7D A;  3GX4 X;  3DQV C;  2XAG A;  1I5Z A;  5FGM A;  1RUO A;  1OYI A;  3L9F A;  2V1U A;  4IRH A;  4ZYH A;  4BHB A;  1OPC A;  1BM9 A;  1I1S A;  3G73 A;  1BBY A;  1HKS A;  1PP8 F;  2DPD A;  2K27 A;  1O57 A;  4PDK A;  3SQN A;  1J2X A;  5DV5 A;  4KUM A;  3IWF A;  2OZU A;  1S7A A;  3IRQ A;  2MH2 A;  2IJL A;  4KIG A;  4AWX B;  2VE8 A;  4HA8 A;  1ZGA A;  3K1N A;  3RYR A;  1Z1D A;  2XVC A;  2FF4 A;  3GUD A;  1Z91 A;  4MQV A;  2E7W A;  3MWM A;  3I0T A;  3KET A;  1U8R A;  1J0R A;  3TOB A;  2HQN A;  1W7P B;  4LLN A;  4UXN A;  1FLI A;  3E6C C;  2EV6 A;  5E1Z B;  1ZRD A;  2L54 A;  4ASN A;  1YFH A;  4KMU X;  3TDZ C;  2ESN A;  2CYY A;  5L3C A;  4L9N A;  2PQ8 A;  1OYY A;  2STW A;  4UUV A;  2GA2 A;  2KKO A;  2VBZ A;  3RDI A;  2HZT A;  2LSO A;  3T5X A;  2MA3 A;  1ZGJ A;  1KGS A;  4L5I A;  2HDC A;  2M45 A;  3RPQ A;  3W6K B;  2NS0 A;  4UHT A;  4M71 A;  2EA4 A;  3RI4 A;  1FY7 A;  3KEQ A;  3R0J A;  1OMI A;  4CHU A;  5LGT A;  1R5G A;  4LG0 A;  2P7V B;  4HV5 A;  2XRN A;  4ZZD A;  4ENJ A;  3DP7 A;  1BN5 A;  3EYI A;  2FXA A;  2ACJ A;  4RGS A;  4EJW A;  1Z6T A;  3KP5 A;  5HDN A;  3MCZ A;  3WOD F;  1ZLK A;  1R23 A;  3K1M A;  1WWX A;  3LQQ A;  4NQW A;  2B0L A;  2UXN A;  2RGV A;  5BPD A;  3K0L A;  2X4H A;  1MJ9 A;  3HSR A;  4L5J A;  3SFZ A;  2P4W A;  1Q1H A;  3ZN1 A;  5CVJ A;  2XKP A;  5DEQ A;  5D5V B;  2OU2 A;  3CUQ B;  1YS6 A;  1BI0 A;  4A12 A;  2FE3 A;  4P9U A;  3WU1 B;  5FFZ A;  2D45 A;  3JSP A;  2FML A;  2FQ3 A;  1G4D A;  4G7O F;  1GHC A;  1QZZ A;  1QZY A;  4RS8 A;  1S8N A;  1D5V A;  2A68 F;  1BI2 A;  5J6X A;  4A5N A;  3BJO A;  5ICC A;  4MQ9 F;  3S2W A;  4CGZ A;  2FOK A;  1K79 A;  5BS6 A;  4JQF A;  3HTU A;  3NQO A;  5EEH A;  3V7C A;  1V3F A;  2CO5 A;  3K9T A;  2YR2 A;  2DAO A;  1QGP A;  4LLL A;  1AOY A;  3TO7 A;  3NRV A;  1TW3 A;  2W25 A;  2CW0 F;  2V79 A;  3BPX A;  2RC4 A;  3H92 A;  3SZT A;  4IRI A;  1RIO H;  1R58 A;  3ABU A;  2GAU A;  1BI1 A;  2ESH A;  4Y15 A;  2K7L A;  3HOS A;  2VOP A;  3F8C A;  1SMY F;  3FM3 A;  4U0W A;  4BNC A;  1E2X A;  1UST A;  1MDM B;  1YG2 A;  3EET A;  2H27 A;  4EJO A;  4ZYD A;  2OA4 A;  1IN8 A;  3J80 K;  3BRO A;  4M72 A;  2HQR A;  1G3S A;  2DT5 A;  4Q47 A;  1ZH5 A;  1U3E M;  4U7B A;  3HTS B;  2XAH A;  5HLH A;  2P6T A;  5FD6 A;  1SD5 A;  1ONV A;  4A5M A;  3GFM A;  4FHT A;  3RKW A;  2P5V A;  1B9N A;  3ECH A;  2K02 A;  1XCB A;  4ENK A;  3LST A;  4GYI A;  3LAP A;  3GZ6 A;  3WG9 A;  4UVB A;  5LEK A;  1KU7 A;  3ECO A;  3CDH A;  2Z5U A;  4WF2 A;  1HW1 A;  4IJA A;  2STT A;  3HRM A;  1J9I A;  4ESB A;  1T38 A;  4IPA A;  3O2P E;  4HBL A;  5FFX A;  4ZH4 F;  1GXP A;  3V7S A;  2XAJ A;  3GVA A;  3LA7 A;  2H94 A;  2EA2 A;  1FSH A;  1LQ1 A;  2RN7 A;  4BH9 A;  1YLF A;  4AIH A;  4LG0 B;  1T2K A;  4DQ2 A;  4EJV A;  1R00 A;  1R5H A;  4OMZ A;  3MZY A;  1W4M A;  5HLI A;  1REP C;  3COA C;  3O3K A;  4L9V A;  4OIO F;  1CGP A;  2P5K A;  1UFM A;  1ZYR F;  5D6E A;  2QBY A;  4G7H F;  3R60 A;  1ZRF A;  2BE5 F;  3IL2 A;  2M87 A;  4RB3 C;  1SAX A;  3F23 A;  4PGH A;  1ON1 A;  1YYV A;  3TOA A;  5H20 A;  1RUN A;  3B73 A;  5IT9 K;  2Z3Y A;  1BC7 C;  2DK5 A;  1XSV A;  4ZYE A;  1CF7 A;  2Q2E A;  3LQR A;  1EH6 A;  5LEJ A;  2W24 A;  2CG4 A;  2HGC A;  1HW5 A;  4WXH A;  3HRT A;  3WU0 A;  3OOP A;  5L3G A;  4CXF A;  4YII A;  1YS7 A;  2QQA A;  5LHH A;  2V1X A;  3KP2 A;  5H6R A;  1IAW A;  1FYK A;  3IKT A;  3KZZ A;  2ZO4 A;  3QPT A;  3JAM Z;  1FBS A;  1KQ8 A;  1XGS A;  1I1G A;  1R1V A;  4HLY A;  1MD0 A;  3JAM K;  4AIJ A;  1R7J A;  5AIP A;  1YTY A;  1FOK A;  3P9I A;  3TKY A;  2JZY A;  2VN2 A;  2A3S A;  2A69 F;  2XRO A;  4EQQ A;  2ISZ A;  2J5P A;  4I02 A;  4WWC A;  1D8J A;  1H9T A;  2D1V A;  5D4S A;  2DW4 A;  1HXD A;  3GXO A;  4ENN A;  1QBJ A;  2HEO A;  1BIB A;  4HDV A;  3Q9V A;  5D5U B;  4S04 A;  1FYM A;  1U2W A;  2HTJ A;  4BAY A;  1P92 A;  3TGN A;  4YIF A;  3KP3 A;  3FMS A;  2XGX A;  3C18 A;  2QQB A;  3ULQ B;  3IC7 A;  3KP4 A;  1HSJ A;  2IVM A;  1WI9 A;  3KZY A;  3I4P A;  3FF5 A;  2VBW A;  3DEU A;  4N9I A;  1IXR C;  1HW2 A;  1B9M A;  4O6J A;  4HX4 A;  1S3J A;  3WGH A;  3JTH A;  1XSX A;  4RGR A;  4M73 A;  3DPT A;  1T6S A;  1XD7 A;  4KFC A;  4XSX F;  2PBI A;  5LLQ A;  4OOI A;  4XBF A;  2AS5 F;  5TRD A;  2M8E A;  1ZRE A;  3GO5 A;  3J7A O;  2NYX A;  1LB2 A;  3CO7 C;  2GWR A;  2YX7 A;  4WXD A;  2UZK A;  2WC2 A;  3HYI A;  4LFU A;  5E18 F;  1GVJ A;  1SFE A;  1Z9C A;  2OZ6 A;  2QEN A;  2FNA A;  2G7H A;  3GZ5 A;  2W57 A;  4ESF A;  4MGR A;  4FX0 A;  4GCV A;  4I01 A;  3CTA A;  1LNW A;  2HFH A;  3L09 A;  1LDD A;  2QUF A;  2VE9 A;  3FHZ A;  1XMK A;  4IVN A;  3ZMD A;  6PAX A;  2RVC A;  1O3S A;  3NEU A;  5L3B A;  3QU3 A;  4GYG A;  2QYO A;  2EFP A;  5DCM B;  2VC1 A;  1TQI A;  3C3W A;  5BQT A;  5K1Y A;  2FBK A;  4PZJ A;  2E7X A;  1KU9 A;  1LJ9 A;  1SD4 A;  1BJA A;  3HRS A;  2MBF A;  3FWE A;  1ZG5 A;  2P8T A;  2LF8 A;  5BOX A;  1HST A;  3I53 A;  1J59 A;  2PI0 A;  4CYD A;  4JBA A;  3IWZ A;  3F22 A;  4Q5S F;  4Y13 A;  2EV0 A;  1T0F A;  4OU0 A;  2PG4 A;  4P5O A;  1Z05 A;  2ISY A;  1XCV A;  1MJB A;  4BYY A;  2CQK A;  1FBQ A;  1CF7 B;  2IRF G;  1FP2 A;  3F3X A;  3CJN A;  4IHS A;  1USS A;  4H0E A;  2VBX A;  4U7D A;  4MTD A;  3QPH A;  1F9N A;  2K4B A;  3HHH A;  1OYW A;  3LWF A;  3BDD A;  1MJA A;  1QNT A;  1O3Q A;  2WTE A;  1H9G A;  1QQI A;  4HW0 A;  1SD6 A;  2W84 A;  5CJ9 A;  2DLL A;  1I27 A;  4YFX F;  1KA8 A;  1S6L A;  3I54 A;  1UCR A;  3LA2 A;  2BGC A;  3M7G A;  2OD5 A;  5AIQ A;  1O3R A;  4M6X A;  5KK1 A;  5D8K B;  1W5S A;  3E5X A;  3ZMZ A;  4KYW A;  2L02 A;  2FEZ A;  3RJP A;  3BJ6 A;  1XGN A;  2LDU A;  1FSE A;  4LB6 B;  2EB7 A;  1U5T B;  5HDG A;  4UVC A;  4HX7 A;  1GXQ A;  4A6D A;  4AVP A;  3VEP A;  2EFN A;  3LA3 A;  3N4M A;  4BQA A;  4MEY F;  3EDP A;  4N9H A;  4L9J A;  5E8G A;  4MNU A;  5E20 A;  1KU2 A;  3N97 A;  3DV8 A;  2DPU A;  2MC3 A;  2ZME A;  3FX3 A;  3REO A;  5ILU A;  1T98 A;  3CLO A;  2FA5 A;  2O6G E;  3QOP A;  1R36 A;  3U2R A;  3ZMU A;  2D2W A;  4Z2Y A;  4OIQ F;  3LFK A;  3FMQ A;  4Y17 A;  4I98 B;  1K78 A;  3M9A A;  2EFQ A;  1C0W A;  2TDX A;  2VXZ A;  5CVI A;  2RQP A;  3KLO A;  5K5Q A;  1R22 A;  4HOB A;  1X3U A;  2GXB A;  2MH9 A;  3F8F A;  3JW4 A;  1TBX A;  1XMA A;  4A0Y A;  2LNB A;  3BZ6 A;  4A0X A;  1U6G A;  2FMY A;  3DPL C;  3VB2 A;  1T39 A;  2CFX A;  2P7C B;  4G6Q A;  3V7R A;  2LF7 A;  3FM5 A;  5A2Q K;  2ZNY A;  4P96 A;  1SFU A;  1XGO A;  1IW7 F;  1YQA A;  1D3Y A;  3QU6 A;  4MEX F;  5DUK A;  3J80 Z;  2FBI A;  2HKO A;  2CGP A;  1E17 A;  4ENM A;  1PDN C;  2NNY A;  2Y0M A;  1JE8 A;  4A0Z A;  2V9V A;  1IN5 A;  4M9Z A;  4HLX A;  2H6C A;  4YFK F;  3FZV A;  2F5E A;  2RDP A;  2XKO A;  3ZMV A;  5AON A;  2O03 A;  2J5O A;  2CSO A;  4G6D A;  4HYE A;  4XLN F;  4YG2 F;  5IT3 A;  1L3L A;  2QLZ A;  4M9S A;  2HS5 A;  2FBH A;  4OMY A;  3AAF A;  1ZG1 A;  2VC0 A;  3GFJ A;  4I7H A;  2NNN A;  1A04 A;  3MAJ A;  4YFN F;  1Z7U A;  4KN7 X;  5E17 F;  2ELH A;  5FLX K;  1IXS B;  2ZJ2 A;  5K5O A;  1W7P D;  2G9W A;  3P7N A;  3F72 A;  2VBY A;  3WTY C;  1TTY A; 
#chains in the Genus database with same CATH topology
 2DT6 A;  3VPR A;  4A3F J;  2IP2 A;  5HS9 A;  3K70 D;  3CO6 C;  1N75 A;  5L3D A;  5K7H A;  3KCC A;  1TWA J;  3QAH A;  1F1Z A;  1B72 B;  1TQM A;  3GTP J;  2XDV A;  5J1Y A;  4BBR J;  2P6S A;  3T0Y A;  4CDG A;  3CUQ C;  3G2B A;  1D1C A;  1QVT A;  3S1M J;  2IGN A;  3I5U A;  2R7Z J;  2K86 A;  4IHY A;  4BXF A;  2GM4 A;  2FJ1 A;  4OIR F;  4OWR B;  4K2E A;  1IZ1 A;  2M4G A;  3WTS C;  3HOZ J;  2XAF A;  3D5L A;  4KT5 C;  2CJJ A;  2O61 A;  1FC3 A;  5IYD J;  4YIR X;  1CQT A;  2OCE A;  3RKY A;  2F2E A;  3GW2 A;  4ON0 A;  2PJR A;  1JI8 A;  2DOE A;  3TQN A;  4IHT A;  1N78 A;  1G6N A;  1KU3 A;  1T8I A;  3K10 A;  4NQW B;  4N4N B;  1MBH A;  2XUB A;  2K9Q A;  3RYP A;  1HDD C;  4KIB A;  1KZH A;  3JSO A;  3S1Q J;  1S7O A;  4G94 A;  5IT9 Z;  4OAZ A;  3L7W A;  2VOD A;  2IT0 A;  1LE8 B;  1RC9 A;  1DGW Y;  2MUN A;  4XOR A;  3V8K A;  3IHU A;  5EEG A;  2C6Y A;  3I55 I;  4FAS D;  1IRG A;  3BR3 A;  3GEZ A;  3E6D A;  2GIZ A;  4XON A;  3QRF F;  1B6A A;  4I0B A;  4AVZ A;  3CC4 I;  1UHS A;  4EM2 A;  5M5W J;  3SXY A;  3HHG A;  2KJC A;  3OS1 A;  1ENH A;  2A5Y B;  4EV0 A;  4HQM A;  1VQN I;  3KPH A;  1EH8 A;  1P7J A;  2QQ8 A;  1YW7 A;  3ROU A;  5J4Y A;  1D1A A;  2X48 A;  1PUF B;  4B1R A;  1SEU A;  4GXO A;  3DCF A;  2OC6 A;  1MSF C;  5KVR A;  4AIK A;  3FXQ A;  4P55 A;  1W7P A;  4UNO A;  3J7A Y;  4IQ4 A;  3HSF A;  3WTV C;  1LDJ A;  3G1L A;  3OR2 C;  1HKQ A;  2EPF A;  1TZL A;  4XRM A;  2CWE A;  3DLL F;  1VTN C;  3DXJ F;  5E1X A;  1JKQ C;  1S29 A;  3OWT A;  1A5J A;  4XK4 A;  4RGU A;  3FBN B;  5F08 A;  2L01 A;  2M30 A;  3E3V A;  3CZ6 A;  2G7U A;  3E97 A;  3BCB A;  3TDU C;  3MEX A;  2HQA A;  4KIS A;  2ME6 A;  2ZBK A;  1YIJ I;  2DA1 A;  4EVI A;  1JHH A;  5IOZ A;  2MD0 A;  2QWW A;  2X6O A;  3NAR A;  1MZB A;  2HXO A;  1Y0U A;  1VI0 A;  3K2Z A;  5M3M J;  4JOM A;  3GFI A;  3BP8 A;  2FSW A;  2QKM B;  3J81 K;  2XPV A;  3CD6 I;  2E36 A;  3M8J A;  5JLX A;  3BG6 A;  1KQ0 A;  3BTJ A;  3HOT A;  2D1H A;  1PVE A;  3OV8 A;  4B09 A;  1A6I A;  1SMT A;  1ZR4 A;  3CCQ I;  1ON2 A;  2GBY A;  2OUM A;  3JTG A;  4Y4R A;  1PP7 U;  4GRI A;  4UB8 C;  1JUS A;  3CC7 I;  5DD8 A;  1IDY A;  2VQL A;  5ICF A;  2BW3 B;  3CDL A;  2UUZ A;  4CYC A;  1K6Y A;  2A61 A;  2HDD A;  2VOO A;  4Y3O A;  4JX5 A;  2VJJ A;  2ZFW A;  4JX6 A;  4AYB N;  1ZAR A;  2KIF A;  3BLY A;  3HUG A;  2L4A A;  1ETK A;  4BY7 J;  5HS8 A;  1NK2 P;  1BW6 A;  2LRE A;  2O0Y A;  3FIS A;  3M8E A;  3OYB A;  2E1C A;  3H3U A;  3VYT B;  2BBY A;  2EH3 A;  4F7Z A;  3U9G A;  1B8I B;  2BHZ A;  5KAF C;  1SC7 A;  3G6E I;  1X1C A;  3MZ8 A;  2E1M B;  2ME0 A;  2XF7 A;  4LMY A;  4HNT A;  2GXG A;  2Z33 A;  3MD2 A;  2E5Z A;  3C7J A;  3E1S A;  1G3W A;  3S16 J;  3SHF A;  2M5W A;  3TW7 A;  2XHK A;  1E3H A;  3E6M A;  4P1W A;  1TNS A;  2IA1 A;  3H9J A;  1OIS A;  3IRR A;  2O5R A;  2BYV E;  3TL4 X;  3ZMT A;  1EJ9 A;  2CUE A;  4Y7N J;  2HR3 A;  3QP5 A;  4LIU A;  2WWY A;  1QZE A;  3ELK A;  2DBB A;  1DUX C;  4PSW A;  1X3Z B;  2KIM A;  5F1R A;  4KIC A;  3ZQ7 A;  1F43 A;  1P9Q C;  3KE2 A;  3ZCO A;  5JVT A;  3CF5 F;  2LBF B;  4XN0 A;  3PO3 J;  4FX4 A;  1P6R A;  3HC7 A;  3FXU A;  3VOE A;  4UV9 A;  2ADU A;  1WQ2 A;  4DNC A;  2QVO A;  3IAS 2;  2MC4 A;  3R0A A;  1A36 A;  1SD7 A;  2V6E A;  4MLO A;  1LEA A;  5ICE A;  1ZG3 A;  2R7F A;  1B4A A;  1YRN B;  2DFI A;  2VT3 A;  4XRS A;  1WCM J;  1TWC J;  4PJN A;  1W5C C;  4WX9 A;  4C2T A;  4CA0 A;  3R6S A;  3HPG A;  4EM1 A;  3FXM A;  1Q1V A;  3I64 A;  2LR8 A;  3SZG A;  4E7K A;  2CV2 A;  4HX8 A;  2KZG A;  4BUP A;  4NC8 A;  2O8X A;  4BKX A;  3CCV I;  1VZ0 A;  1IXC A;  4GO1 A;  1IN4 A;  5D5W B;  3J7Z I;  4R1H A;  1FZP B;  1V5E A;  1DPU A;  1NTC A;  1U0J A;  3HGG A;  2DQL A;  2H09 A;  3QYF A;  2FD5 A;  1BC8 C;  2DOF A;  1ETQ A;  2Y0S N;  1E3O C;  2R3S A;  4CIC A;  2H8R A;  3L2R A;  3ZPL A;  4R79 A;  1K61 A;  2DJN A;  4XKC A;  3MKZ A;  4U0V A;  4BGD A;  1YIT I;  4IF4 A;  1IRX A;  1XSD A;  5F27 A;  2HNH A;  2Y75 A;  3BQY A;  3OY9 A;  1J5Y A;  1OR7 A;  2F5C A;  2EFW A;  2ZCW A;  1ZQ3 P;  1RI7 A;  4FTH A;  5LGN A;  3ZQQ A;  2WAQ A;  2FNP A;  4DBQ A;  5E3N A;  4P9F A;  1DU6 A;  1RPW A;  3HSE A;  2BHY A;  3G3Z A;  3W6J B;  3H3Z A;  4A6E A;  5GPC A;  1MMS A;  4D7M A;  2AQF A;  3CCL I;  2ETH A;  2E1O A;  3CUO A;  3MKY B;  1BOA A;  2JA6 J;  2FOW A;  5LFA A;  4KDP A;  5GP9 A;  4U0Y A;  3PUF A;  2NRA C;  5KCM A;  4EJT A;  3V8J A;  5DDG A;  2M9H A;  1KYW A;  2QBY B;  3BG3 A;  2EZK A;  1SFX A;  3RPU D;  2PJR B;  1ETX A;  1FIA A;  3Q9S A;  3KLN A;  1KQ9 A;  1N25 A;  2HWV A;  1GLN A;  3O6B B;  1MDM A;  3S14 J;  2A6H F;  2K4J A;  1R1U A;  3M1E A;  3MFK A;  2L3D A;  3I59 A;  3EUH A;  2Q0O A;  3DWL E;  3WTZ A;  5LD2 C;  2RNJ A;  4RB0 A;  2COM A;  2H1K A;  4LG3 A;  4LK1 F;  2K9S A;  3P9K A;  3IH2 A;  4XKB A;  3WTT C;  2Z9O A;  2XAU A;  1FWZ A;  1ZAO A;  4RGX A;  3AG1 H;  1I6X A;  5L3F A;  4RAZ A;  3WGG A;  1MH4 A;  4E70 A;  3FKJ A;  2KDZ A;  3TO9 A;  2HQ5 A;  5FKL A;  2R7X A;  1R49 A;  5DYM A;  5E3O A;  3VOD A;  5ILV A;  5JVG F;  1Z6R A;  3F8M A;  4C3I J;  4L0Z B;  1IN6 A;  4FE4 A;  4DYC A;  3A0H C;  3K4B A;  2IS6 A;  3OMY A;  1Z3Y A;  5CYV A;  4E7L A;  5C4J J;  2F5V A;  4N0B A;  3S15 J;  3E5U A;  1TWH J;  4RBO A;  2NVT J;  1YO5 C;  2L0K A;  2VJI A;  3H35 A;  4O3M A;  2VT2 A;  3D0S A;  3PNY A;  5JHU A;  2QZ8 A;  3G71 I;  2XV4 S;  3CC2 I;  2GZW A;  2YX4 A;  4CCM A;  2XGE A;  1JXS A;  3RCO A;  5JHF A;  4M6Y A;  1STZ A;  3OYJ A;  3F21 A;  4HNU A;  3JCU C;  1XDU A;  5IT9 R;  2F4M B;  1TP4 A;  4A3G J;  4A3K J;  1LUJ B;  4G9Y A;  3CP2 A;  2A6E F;  4NNJ A;  4M3G A;  4G6T B;  3E5Q A;  3GFL A;  3SDB A;  3L2W A;  3S93 A;  4F92 B;  5JI6 A;  2MLK A;  3FDY A;  2K9N A;  4HF0 A;  4A2U A;  1QHG A;  1JHF A;  2ZJQ F;  3RPU A;  1XMX A;  3H36 A;  4WXC A;  1R71 A;  3ZGK A;  2DCE A;  1WJF A;  1X2N A;  2XPU A;  3GF2 A;  3VSL A;  4DZJ A;  2F5D A;  1VQ4 I;  3R4K A;  4PJM A;  3BR5 A;  4DGW B;  2AXL A;  2JA2 A;  3ONQ A;  2HOE A;  4XSZ F;  3U1K A;  5JR3 A;  1OFC X;  1Z67 A;  3DEW A;  1Y6I A;  4KN4 X;  3ML6 A;  5HNF A;  4F91 B;  4HAM A;  5BMZ A;  1F5T A;  1FTT A;  2LP0 A;  3UR3 C;  3S3M A;  9ANT A;  3HUG B;  2YSR A;  1KYZ A;  5EG0 A;  3BZC A;  4FT8 A;  2L9V A;  3JRI A;  1FP1 D;  1OCP A;  2D5V A;  3HDD A;  2JPB A;  5L3E A;  1FPQ A;  3SYT A;  1Y1V J;  2A07 F;  2O3F A;  4QLC U;  2DO7 A;  3DEE A;  2V9P A;  2DJI A;  1SFK A;  2DTZ A;  1HF0 A;  3M8F A;  3HOV J;  3FIW A;  2RV8 A;  4CCJ A;  2NVX J;  3PQJ A;  4EMS A;  3V8L A;  1K6O A;  3I58 A;  5EGO A;  4EAT A;  2VPL A;  3L00 A;  4KT6 A;  3DU5 A;  3JAM R;  2VL8 A;  2Z16 A;  3JR9 A;  2W85 A;  3DFG A;  2ZNZ A;  1IN7 A;  4EGY A;  3ZQC A;  1YJW I;  2IS4 A;  5E1W A;  4AD9 A;  1UEL B;  2F5F A;  1GV5 A;  1YX3 A;  2WV0 A;  3PSI A;  2BY0 A;  3EQL F;  2HVS A;  2RAE A;  1P2F A;  4B44 A;  1BW5 A;  1PUE E;  4QPQ A;  1O7L A;  1SVM A;  1YJN I;  3HZJ A;  1OKR A;  1ZRC A;  1HLV A;  1P7I A;  5CVU A;  5H6Q A;  4J01 A;  1OCT C;  3LSR A;  1V5F A;  1JGS A;  4NHJ A;  4FIS A;  4M9X A;  4IO9 F;  2QQ9 A;  4IRG A;  1MKM A;  1APL C;  2FRH A;  2YU3 A;  2JMW A;  2PFB A;  4AID A;  2EZL A;  1P4W A;  1IF1 A;  3QP6 A;  2E19 A;  5BPI A;  4PK4 A;  3OL3 A;  1HKT A;  1LEB A;  1WVR A;  3IH3 A;  1I3Q J;  2JTV A;  4QWQ A;  3S1R J;  3FXR A;  2HKX A;  2EV5 A;  2HYG D;  1IG7 A;  2O7O A;  2HPM A;  2LY2 A;  4IHX A;  4IXA A;  4PCQ A;  5DCF A;  4S05 A;  1R6R A;  1WKM A;  4HF1 A;  5F6F A;  3ZMS A;  2R93 J;  4O5V A;  4ZZL A;  2XF5 A;  2KFD A;  1XC5 A;  4BXU A;  3PFI A;  2OAZ A;  5E3L A;  1LPQ A;  3SZP A;  1UB9 A;  4BE1 A;  3AL0 C;  1J7K A;  2ECC A;  1R4M B;  5J8F A;  2VPR A;  1WZ2 A;  1D8K A;  2DQR A;  2Y30 A;  3TED A;  2E1N A;  3VYU B;  5FB2 A;  2MFZ A;  2BXZ A;  3WTX C;  5A2Q Z;  4HNV A;  2MLG A;  4J19 A;  4GGG A;  1HQC A;  2IXS A;  3GYH X;  2L2O A;  1VF9 A;  2BV6 A;  3PQK A;  1LVA A;  4LGW A;  4D0P A;  1TC3 C;  1IRF A;  3WHC A;  3IKV A;  2MVT A;  1VQO I;  4B3A A;  4I0A A;  2G0E A;  2KRC A;  1NK3 P;  4BAC A;  1R5I D;  4YEL A;  1IO2 A;  3SEQ A;  4F93 B;  4XOT A;  2A5W A;  3WE2 A;  3O8G A;  5F0C A;  1A31 A;  2MG4 A;  4HDU A;  2ID6 A;  2PMU A;  2HYJ A;  2WAQ N;  5K5R A;  1FX7 A;  3K2A A;  1P4A A;  2OV7 A;  4L9T A;  1MMD A;  2V1D A;  2AO9 A;  3KP6 A;  2HYF A;  4CZZ A;  2M1B A;  2IGM A;  1BR2 A;  2KJB A;  4RM3 A;  2LKX A;  4CUG A;  3OYF A;  5CVV A;  2OQR A;  2PEX A;  2NAZ A;  4PJJ A;  2RKH A;  1UHW A;  2MD5 A;  5IPA A;  3I59 B;  3DKW A;  1AWC A;  4BHP A;  2Q1Z B;  1BIA A;  4AM3 A;  5GAG J;  1LFU P;  3HEF A;  1G3Y A;  2HXI A;  2OQG A;  3HIF A;  1X1B A;  2L7F P;  5CLS A;  1YIO A;  2ZXJ A;  4ESJ A;  2KQR A;  5GTH C;  3JRB A;  2X85 A;  3DTK A;  1U5T C;  2V6C A;  5FD5 A;  1MGT A;  3F8B A;  2DI3 A;  5LHG A;  2EK5 A;  2WAF A;  3GCM A;  1RZ4 A;  4CO8 A;  4QTR A;  2LMD A;  5CPR B;  5DD4 A;  4L0Y B;  2Y48 A;  3CF2 A;  2UXX A;  1XB4 A;  3I71 A;  3FMR A;  2ZKZ A;  1O7F A;  1TW2 A;  1X4P A;  2IW5 A;  4JK1 X;  3BCA A;  5FLX Z;  1TLH B;  4BU2 A;  3PIO F;  3V4G A;  2R7R A;  2IA2 A;  2B7E A;  1Y39 A;  3M1C A;  3WGI A;  4A3J J;  2X51 A;  4GDF A;  3MQ0 A;  1T95 A;  2EIM H;  1OLT A;  3LL7 A;  3ZQH A;  4KA4 A;  2XC7 A;  4NB5 A;  5E8I A;  3BR1 A;  4M3E A;  4Y52 J;  3I3L A;  3TO6 A;  4B8X A;  3HKZ A;  4KMF A;  5FO5 A;  3B02 A;  1BR4 A;  2OF7 A;  2X1C A;  4C3H J;  4BDY A;  4G7Z F;  1IDZ A;  1ODD A;  1AHD P;  4HV6 A;  2BVL A;  1RKT A;  1VQ7 I;  4XRF A;  2LD5 A;  1FT9 A;  3K4N A;  4LLG F;  1R1T A;  2OTJ I;  3BOQ A;  5ERI A;  1XN7 A;  3F6V A;  4UV8 A;  4GFB A;  3E0J B;  3F6O A;  5J1U A;  1YW9 A;  2X0L A;  1V4R A;  2EWN A;  2EFO A;  2PMZ A;  2R7Q A;  5IY5 H;  3BY6 A;  5HOD A;  2PN6 A;  4ZYA A;  2H8W A;  3S17 J;  1X58 A;  3BPV A;  1WSU A;  3B6A A;  2B63 J;  3HOU J;  1AU7 A;  4LD5 A;  1GV2 A;  5HDK A;  1JJ6 C;  4M74 A;  2EJR A;  2KPM A;  3BR0 A;  2EBI A;  4I09 A;  2Q8K A;  5K7F A;  3DKY A;  5LGU A;  2AXT C;  5DM6 F;  3PNT A;  5ILS A;  5D6F A;  5FRM A;  2DMQ A;  1JKO C;  3HM5 A;  3ZQF A;  1ETW A;  3CME I;  3QOE A;  5FKO A;  1T08 B;  1K7A A;  4KNY A;  3FXO A;  4H4K C;  3PUB A;  1VQK I;  3ABM H;  5J8C A;  2WBM A;  3TP3 A;  5EG0 B;  1O3T A;  4UVA A;  2CU7 A;  1EH7 A;  4PGG A;  1YW8 A;  3K69 A;  5DCM A;  2HTS A;  1FNN A;  3GTJ J;  2DK8 A;  2YPR A;  3T8R A;  4ZYG A;  2E35 A;  3BWG A;  3HRU A;  1TT5 B;  3SFI A;  2UWM A;  3KFW X;  5EZG A;  5GAE J;  4WK8 F;  2VKV A;  1RNL A;  3FHN A;  4LK0 F;  3ZP5 A;  3HGY A;  4I2O A;  3C1D A;  4M3D A;  1DPR A;  3T8T A;  1J75 A;  5EGO B;  2ZME B;  2OPT A;  2XAQ A;  3DBL B;  2V1N A;  3ESW B;  3ISP A;  3WE3 A;  2ZFU A;  2M7A A;  3F8N A;  3U1D A;  1Y8R B;  3EYY A;  3KYC B;  3QOD A;  3L2C A;  3CCS I;  4IHW A;  4EM0 B;  2IPQ X;  3JRA A;  3A0B C;  2P0W A;  4EJU A;  3MZH A;  1B59 A;  4HF2 A;  2DMU A;  4UUS A;  1FMW A;  4RB1 A;  3CJT B;  4V2G A;  5F1J A;  2DU9 A;  2W7N A;  1ULY A;  1IJW C;  3GTG J;  5B1A H;  3WTW C;  5D5X B;  4HQE A;  1XDS A;  3ZOB A;  3H0G J;  3CDI A;  5DUI A;  2VON A;  1K78 B;  1GDT A;  1X1A A;  4CSW A;  1SVL A;  4OIP F;  2K5C A;  1TNT A;  4F3Q A;  4E7J A;  2VI6 A;  5D4R A;  2VJ4 A;  2JVH A;  3J81 Z;  4BDZ A;  1YI2 I;  3MN2 A;  2PLY A;  3VDX A;  5CVR A;  2JT1 A;  4RB2 C;  1W0T A;  2DN0 A;  3H5N A;  4HPQ A;  4LJZ F;  1BL0 A;  4KIF A;  4BHC A;  4XIC A;  4G8X A;  2FU4 A;  4EGZ A;  2P0T A;  5F64 A;  4OIN F;  3W6V A;  2L7K A;  3DF8 A;  1QRY A;  1T0F C;  4XNF A;  1U78 A;  1G3T A;  1I6H J;  3I9V 2;  3RIR A;  2PJP A;  1WH7 A;  4BQN A;  3P9C A;  5ICG A;  4R8H A;  1L0O C;  1DP7 P;  1UAA A;  3J7Y J;  1MBJ A;  5LRR A;  1FJL A;  2XIG A;  6PAX A;  1Z7L A;  3DBH B;  3FKI J;  4UY8 I;  2ZB9 A;  4L18 B;  2LVS A;  4Q4Z F;  2JK3 A;  2CQQ A;  1HBX G;  2TCT A;  3KP7 A;  1NG6 A;  2X9D A;  2V9K A;  3E6B A;  3LMM A;  3JRE A;  3CCJ I;  1LDK B;  4MHG A;  1Z21 A;  3ERE D;  2L9R A;  2DA5 A;  2DFH A;  1DDN A;  1U5T A;  1FYL A;  1P4X A;  2QKL B;  2GIV A;  5K7Z A;  1A35 A;  2JPC A;  2M3A A;  5TJJ A;  3ZQL A;  2IA0 A;  2M35 A;  3H5A A;  3GLX A;  5LBQ A;  3S3O A;  1B1B A;  4PSX A;  2L9N A;  1VFC A;  4TV7 A;  1DP3 A;  1MNE A;  2QM3 A;  4X6A J;  2E34 A;  2H6B A;  4BQQ A;  4WCG A;  3GTK J;  5HVQ C;  1D1B A;  2LKP A;  3Q5F A;  1MMA A;  4RAY A;  2Z99 A;  4C3J J;  1VQ9 I;  3PJR A;  3RKX A;  1IUY A;  2OBP A;  4JYK A;  1BI3 A;  2LY9 A;  1DGR M;  1V5G A;  3WTU C;  5IYC J;  2E2H J;  1RES A;  1F4K A;  1FOW A;  1ZHF A;  3NWT A;  2DTR A;  1FBU A;  1UHM A;  2IS1 A;  2CW7 A;  4RAF A;  2GA1 A;  4U88 A;  1Y56 A;  1G59 A;  5JFR A;  3L2Q A;  4DJA A;  2BEO A;  1XGM A;  2OCC H;  3BJA A;  5HOO A;  3AFH A;  2L4M A;  3SJM A;  1ZEL A;  2XSJ C;  3T1B A;  5TGT A;  4DZP A;  1H0M A;  4ZDP A;  1VQM I;  5EDN A;  5HLG A;  5ED4 A;  1WI3 A;  1ZN2 A;  1OCC H;  2KRF A;  3MMY B;  1TWF J;  2P81 A;  2GQQ A;  3R61 A;  3VFZ A;  1MNM C;  2YS9 A;  1D0Y A;  1WRJ A;  2JRT A;  3CUQ A;  3A52 A;  1EV7 A;  5FKK A;  3IAM 2;  1W5T A;  4MTE A;  2BY1 A;  4ANJ A;  1RRJ A;  1E3P A;  3Q0W A;  2KIU A;  3GWZ A;  4DOZ A;  4ETS A;  4E7I A;  4HZF A;  1EKE A;  3J80 R;  4PJ0 C;  2MGQ A;  5D8L B;  1QO0 D;  4LB5 A;  1HC8 A;  5F0H A;  3LAJ A;  2P5L C;  3LSM A;  5HS7 A;  1JT0 A;  1ZLJ A;  4D7N A;  4XLP F;  2ZXW H;  3HPH A;  2R7W A;  3ZN0 A;  1W36 C;  3CMY A;  2RNG A;  3G1O A;  3HOW J;  2PMH A;  4M3F A;  3H9G A;  3KYD B;  3OL4 A;  3K1P A;  3RTR A;  2JSC A;  3BG5 A;  2KMU A;  1NHA A;  3ABT A;  3KEO A;  5CKT A;  3S8P A;  5LHI A;  3HKZ N;  4AU7 A;  5LRS A;  1WHU A;  3JRG A;  3ZRG A;  3CCE I;  5IP9 J;  1TQP A;  1QPM A;  3D1N I;  4Q48 A;  1ERD A;  2XAS A;  4M3B A;  3MKL A;  2R7D A;  2GXA A;  3QWL A;  5M3F J;  3GX4 X;  2CH0 A;  3DQV C;  2XAG A;  3Q0V A;  1I5Z A;  4X1E A;  4A3C J;  2K9M A;  1QPI A;  5FGM A;  1RUO A;  1OYI A;  2X6W A;  3L9F A;  3TW6 A;  2V1U A;  3GTL J;  2PMZ N;  2R92 J;  4IRH A;  4ZYH A;  4BHB A;  5M5X J;  4FET A;  1OPC A;  1BM9 A;  2VB6 A;  3HBL A;  4RLQ A;  2R7U A;  1I1S A;  1MMG A;  3G73 A;  1BBY A;  1Z3X A;  2WAD A;  2HDW A;  3I4N J;  1HKS A;  3VYR B;  2CFO A;  1PP8 F;  3DTI A;  4ABZ A;  1SFO J;  4XMY A;  2GOX B;  2DPD A;  1MBE A;  2K27 A;  1O57 A;  3K4J A;  4PDK A;  3SQN A;  1J2X A;  5DV5 A;  4KUM A;  4CCK A;  3IWF A;  2OZU A;  2L7Z A;  2WAE A;  1S7A A;  3M07 A;  3IRQ A;  3BTI A;  3EPZ A;  4MFD A;  2MH2 A;  2IJL A;  3KYL A;  5FRN A;  4KIG A;  4AWX B;  2VE8 A;  4HA8 A;  1G2H A;  4BE2 A;  1ZGA A;  4B47 A;  3K1N A;  1XG1 A;  3RYR A;  1DU0 A;  1Z1D A;  2GLO A;  2XVC A;  4FE7 A;  1VQ5 I;  2FF4 A;  3GUD A;  3CJR B;  1YX5 A;  1Z91 A;  4MQV A;  2E7W A;  3MWM A;  3I0T A;  3KET A;  1U8R A;  1J0R A;  3TOB A;  2HQN A;  1W7P B;  2M7B A;  4LLN A;  4UXN A;  4UUS B;  2E1M C;  1FLI A;  3LSG A;  3E6C C;  2EV6 A;  3SEZ A;  5E1Z B;  4BL0 B;  3OS2 A;  1ZRD A;  1IRZ A;  2XRL A;  2YUS A;  3S32 A;  2L54 A;  4ASN A;  1YFH A;  4KMU X;  2F6C A;  3QPS A;  2KLO A;  3TDZ C;  2ESN A;  4IZZ A;  1MW7 A;  2XPW A;  2CYY A;  5L3C A;  4L9N A;  4XLH A;  2PQ8 A;  1OYY A;  3CMA I;  2ZSH B;  2STW A;  4UUV A;  2GA2 A;  1JTX A;  2KKO A;  2VBZ A;  5HLT A;  1WJC A;  3RDI A;  4A3B J;  2HZT A;  2LSO A;  3T5X A;  3H5R A;  2MA3 A;  1ZGJ A;  1U8B A;  4QIW N;  2E5N A;  1KGS A;  4E7Z A;  4L5I A;  2HDC A;  2JVG A;  2M45 A;  3RPQ A;  1OCO H;  2NS0 A;  3W6K B;  4UHT A;  2ELJ A;  4II3 A;  4M71 A;  2EA4 A;  2JA8 J;  3RI4 A;  1FY7 A;  2VUM J;  5DM7 F;  3KEQ A;  3HOY J;  3R0J A;  1OMI A;  5EZH A;  4CHU A;  2EZH A;  5TIS C;  5LGT A;  2JSP A;  4CYC B;  1R5G A;  4LG0 A;  2LTP A;  3HOX J;  1TL8 A;  2P7V B;  4HV5 A;  4IQJ A;  1JTY A;  2XRN A;  2ZSI B;  4ZZD A;  2OJE D;  4ENJ A;  3DP7 A;  1BN5 A;  5IOY A;  3EYI A;  2FXA A;  3IV5 A;  2ACJ A;  3S1N J;  4NC6 A;  1ETV A;  1JUP A;  4RGS A;  4ZC3 A;  1K4T A;  4EJW A;  1Z6T A;  3L2V A;  3KP5 A;  2QCO A;  3A01 A;  5HDN A;  4NBQ A;  3MCZ A;  3A2K A;  5IP7 J;  4II2 A;  2UV1 A;  1XX5 A;  4LOC A;  3WOD F;  3G4S I;  2V4J C;  2M0M A;  1ZLK A;  1R23 A;  3K1M A;  2X98 A;  1WWX A;  3LQQ A;  2MAB A;  4NQW A;  2B0L A;  2UXN A;  2M2E A;  5E79 C;  1LFP A;  1RR7 A;  5EJC A;  2RGV A;  3BQZ A;  3W3C A;  3CCM I;  5BPD A;  3OYA A;  2LK2 A;  4XLA A;  3J81 R;  3K0L A;  2X4H A;  3J7A W;  3BR2 A;  1MJ9 A;  5GAH J;  2JN6 A;  2E71 A;  1DQU A;  3HSR A;  4FCY A;  2V26 A;  4XN3 A;  3GLL A;  3Q0U A;  2M8G X;  4L5J A;  5J4V A;  5FRO A;  3SFZ A;  3IH4 A;  3OR1 C;  2JJ7 A;  2P4W A;  1X4O A;  5EYR A;  2LFB A;  1Q1H A;  4C30 A;  2NXN B;  3W2W A;  2EIL H;  1UMQ A;  2LRD A;  1G8X A;  5EF6 A;  2CQ7 A;  5E3M A;  3JRF A;  2ELK A;  4MFE A;  3ZN1 A;  5CVJ A;  3UKG A;  2XKP A;  5DEQ A;  5D5V B;  4BJ6 C;  2OU2 A;  1NG7 A;  2QSH X;  3M4O J;  3CUQ B;  2WA0 A;  1YS6 A;  2I10 A;  1BI0 A;  4A12 A;  2FE3 A;  2K85 A;  4P9U A;  3WU1 B;  5FFZ A;  2D45 A;  3I56 I;  3JSP A;  2FML A;  2KP6 A;  2Y9Z A;  2FQ3 A;  2DFF A;  1G4D A;  4G7O F;  1GHC A;  1QZZ A;  1QZY A;  5FLV A;  1MBG A;  4RS8 A;  3PNV A;  1S8N A;  1OQY A;  2A68 F;  1D5V A;  1BI2 A;  5J6X A;  3EUA A;  4A5N A;  3BJO A;  5ICC A;  4MQ9 F;  4XM3 A;  4Z6Y A;  3GZN B;  2W4S A;  3S2W A;  1H8A C;  4CGZ A;  2I5U A;  1T56 A;  2FOK A;  4BXX J;  1K79 A;  5DS9 A;  3OYM A;  2AHQ A;  1YOV B;  4FQG A;  2ECB A;  3D5R C;  2IS2 A;  5BS6 A;  1XS9 A;  1LKX A;  3PM1 A;  4JQF A;  3HTU A;  2TRT A;  3NQO A;  5EEH A;  4B3X A;  3V7C A;  1V3F A;  2JA5 J;  4BBS J;  2CO5 A;  3K9T A;  1X2M A;  2YR2 A;  2DAO A;  1QGP A;  5F04 A;  1WJA A;  3CCR I;  4LLL A;  1AOY A;  3CES A;  3OIQ A;  3TO7 A;  1U9N A;  2OTL I;  2M34 A;  3NRV A;  1TW3 A;  2XB0 X;  2MYS A;  5KNL A;  2W25 A;  2R5Y A;  2CW0 F;  2L9S A;  2V79 A;  2RC4 A;  3BPX A;  3H92 A;  3SZT A;  2BW3 A;  5B5E C;  2XSD C;  4IRI A;  3HG9 A;  3V42 A;  3QYE A;  2CQN A;  4ITV A;  4XR6 A;  3K70 C;  1RIO H;  1R58 A;  3ABU A;  1WGX A;  2GAU A;  1BI1 A;  2ESH A;  4Y15 A;  1JUM A;  2K7L A;  3LSH A;  3HOS A;  2VOP A;  3F8C A;  1SMY F;  3FM3 A;  4U0W A;  1W0U A;  1B8I A;  3ZR8 X;  3RQI A;  4BNC A;  1E2X A;  1UST A;  1MDM B;  2DA6 A;  1YG2 A;  3EET A;  2H27 A;  2BY3 A;  2KIS A;  4I99 C;  3BTL A;  2DDA A;  4EJO A;  4ZYD A;  2CV1 A;  2OA4 A;  1IN8 A;  3X2Q H;  3J80 K;  3BRO A;  4DIQ A;  4NC7 A;  3W2A A;  2VKE A;  4M72 A;  2HQR A;  3D5S C;  3OYG A;  1G3S A;  2A6T A;  2JA7 J;  2DT5 A;  4Q47 A;  1ZH5 A;  3PFY A;  1U3E M;  2QSF X;  3GTQ J;  2CUZ A;  2DYS H;  3OSG A;  1VQL I;  2VJ5 A;  4U7B A;  3HTS B;  2XAH A;  1OCZ H;  1WPK A;  2IAI A;  2QSG X;  3K4L A;  5HLH A;  2P6T A;  5FD6 A;  1SD5 A;  2LBF A;  3ASN H;  1ONV A;  4PFP A;  4A5M A;  2Y9Y A;  2BOL A;  3NWS A;  4D5F A;  1S7E A;  1RR8 C;  3GFM A;  4FHT A;  3RKW A;  2P5V A;  1B9N A;  2CS3 A;  3ECH A;  5M5Y J;  3BG7 A;  2DOA A;  2K02 A;  1XCB A;  4ENK A;  4E7S A;  3LST A;  4GYI A;  3LAP A;  4BY1 J;  4D5C A;  3GZ6 A;  3WG9 A;  4UVB A;  3CMM A;  5FKM A;  5LEK A;  1KU7 A;  1M1E B;  1X1P A;  3ECO A;  3CDH A;  4A3E J;  4G12 A;  2BVM A;  1K83 J;  2Z5U A;  1R9T J;  4JP0 A;  5GTI C;  2W48 A;  3DTE A;  4WF2 A;  1HW1 A;  3E7L A;  2YU9 J;  3P5J A;  1JKP C;  4CH7 A;  4IJA A;  3LSK A;  2BXY A;  2M0C A;  2KRH A;  4XRS G;  2STT A;  2E60 A;  3HRM A;  2CQX A;  1J9I A;  4PFO A;  4ESB A;  4I6Z A;  2EIJ H;  1T38 A;  4IPA A;  3O2P E;  4HBL A;  5FFX A;  1IC8 A;  4ZH4 F;  1GXP A;  3V7S A;  4C2U A;  2XAJ A;  3QYB A;  2Y69 H;  2WB1 A;  3FBI B;  3GVA A;  3F9K A;  3LA7 A;  5FJ8 J;  2H94 A;  2EA2 A;  3JRH A;  4ZTJ A;  3A03 A;  1FSH A;  1LQ1 A;  2RN7 A;  4BH9 A;  1YLF A;  4AIH A;  2FUG 2;  1Z0X A;  1IGN A;  4LG0 B;  3EUK L;  3DU6 A;  3RKQ A;  2M4K A;  1T2K A;  4DQ2 A;  3BC8 A;  4EJV A;  5FLM J;  2MZ4 A;  3GBG A;  1MBK A;  4UUT A;  2CUJ A;  1R00 A;  2K9L A;  3BT9 A;  4D9J A;  1R5H A;  3ASO H;  2K40 A;  3AG2 H;  2F4O B;  4OMZ A;  3MZY A;  1W4M A;  2BZT A;  5HLI A;  3WU2 C;  1REP C;  3COA C;  3O3K A;  4L9V A;  3KZI C;  3AKZ A;  1MND A;  4OIO F;  1PJR A;  1CGP A;  2P5K A;  3A01 B;  1UFM A;  1ZYR F;  3W2V A;  5D6E A;  3NAU A;  2AQE A;  2QBY A;  4G7H F;  3CQZ J;  3R60 A;  3OS0 A;  1ZRF A;  2BE5 F;  3IL2 A;  2GOM A;  4ZDL A;  1NH3 A;  1XTA A;  4EEF G;  2M87 A;  1A6Q A;  4RB3 C;  2ZXH A;  3KIO A;  1SAX A;  1IUF A;  3F23 A;  3CLQ A;  4PJL A;  1VQ6 I;  4PGH A;  4RLF A;  2CUF A;  5IYB J;  1ON1 A;  4XKV A;  1YYV A;  1OR7 C;  4CCO A;  2NOG A;  3WHB A;  3A1Y A;  1X1D A;  3TOA A;  2R0Q C;  1S9H A;  5H20 A;  1RUN A;  2VQG A;  3B73 A;  5IT9 K;  1WH5 A;  4A3I J;  2Z3Y A;  1BC7 C;  2DK5 A;  1XSV A;  4ZYE A;  1CF7 A;  2DA7 A;  2Q2E A;  3LQR A;  3N05 A;  3HL2 A;  1V54 H;  1ITY A;  1EH6 A;  3K4M A;  4F52 A;  5LEJ A;  3K7A J;  2JQ7 A;  2W24 A;  4YEJ A;  1K4S A;  2CG4 A;  2HGC A;  2L5Q A;  1HW5 A;  4WXH A;  3HRT A;  3WU0 A;  5C3E J;  3OOP A;  2LY1 A;  2VIX A;  5L3G A;  4CXF A;  1FOY A;  1W1W E;  1GT0 C;  1ETY A;  4CCN A;  4YII A;  2VQC A;  2E2I J;  5HNH A;  4CCL A;  1YS7 A;  2QQA A;  5LHH A;  3EUH C;  3H1C A;  2V1X A;  2LYC A;  3KP2 A;  5H6R A;  1IAW A;  1OCR H;  2VKH A;  1FYK A;  4D1Q A;  4BE0 A;  3IKT A;  4W1U A;  5C4X J;  4YRV A;  3KZZ A;  2ZO4 A;  4XKW A;  3QPT A;  1X19 A;  3JAM Z;  3VWB A;  2ZC2 A;  4L5E A;  1FBS A;  4AUX A;  1KQ8 A;  4X0G A;  1XGS A;  5B3S H;  1I1G A;  1R1V A;  4HLY A;  1MD0 A;  3RZO J;  3JAM K;  3UNG C;  4A3D J;  4AIJ A;  2LKS A;  3TP0 A;  2LLK A;  2HU9 A;  1FMV A;  1R7J A;  2KZV A;  3IP4 B;  1VQP I;  5AIP A;  4KIT B;  2O9L A;  1YTY A;  1FOK A;  3P9I A;  3TKY A;  5KAI C;  2KL4 A;  2JZY A;  2XF6 A;  2VN2 A;  2A3S A;  2IGO A;  2R5Y B;  2A69 F;  2XRO A;  4EQQ A;  3CP8 A;  1D0X A;  4XLF A;  2ISZ A;  2J5P A;  4I02 A;  2E2J J;  2N8G A;  4WWC A;  3ZQI A;  1D8J A;  2X1D A;  1H9T A;  2D1V A;  1HCR A;  5D4S A;  2DW4 A;  1HXD A;  4QSH A;  3GXO A;  4ENN A;  2HI3 A;  1QBJ A;  2HEO A;  1BIB A;  4HDV A;  3Q9V A;  4AC0 A;  5D5U B;  1WJD A;  3B6C A;  2NS8 A;  4S04 A;  1FYM A;  1U2W A;  2HTJ A;  4BAY A;  1P92 A;  3TGN A;  4YIF A;  3KP3 A;  5CQE A;  4S0H B;  3Q3S A;  3FMS A;  2XGX A;  3C18 A;  2QQB A;  3ULQ B;  3IC7 A;  2WV1 A;  3KP4 A;  1BA5 A;  1HSJ A;  2IVM A;  5A2Q R;  1TT0 A;  3TBI A;  1WI9 A;  3KZY A;  3I4P A;  2R7V A;  1RKW A;  3FF5 A;  2VBW A;  3DEU A;  4N9I A;  1IXR C;  1JJ8 C;  2DMT A;  4IL6 C;  4BJ5 C;  1HW2 A;  3LOC A;  1B9M A;  4O6J A;  2EZI A;  3H9Q A;  3HB9 A;  1FIP A;  4HX4 A;  1S3J A;  3WGH A;  3JTH A;  2XB5 A;  1XSX A;  4N4O B;  4RGR A;  4M73 A;  3DPT A;  1T6S A;  2QA4 I;  2DA3 A;  4ZTF A;  2HOT A;  4V19 K;  4E6K G;  1XD7 A;  4KFC A;  4XSX F;  3VYS B;  2PBI A;  1FEX A;  5LLQ A;  5J1R A;  4OAY A;  4OOI A;  4XBF A;  2AS5 F;  3IUO A;  5TRD A;  2M8E A;  1ZRE A;  2Z1D A;  3GO5 A;  3J7A O;  2NYX A;  1JGG A;  2QEX I;  2ZME C;  2CW8 A;  1LB2 A;  3CO7 C;  2GWR A;  1VND A;  2YX7 A;  1QU3 A;  4WXD A;  2UZK A;  1I39 A;  2WC2 A;  3GTO J;  3HYI A;  4LFU A;  3KX2 A;  3PSF A;  2RQQ A;  4HST A;  4UB6 C;  5E18 F;  1GVJ A;  1SFE A;  1Z9C A;  2OZ6 A;  1ACI A;  1I50 J;  2WY7 Q;  2DA4 A;  3ERM A;  3BTC A;  2QEN A;  2FX0 A;  3FXK A;  3S3N A;  2FNA A;  2G7H A;  3GZ5 A;  4MIM A;  2KIQ A;  2W57 A;  4ESF A;  4MGR A;  5J47 A;  1D5Y A;  4FX0 A;  1SAN A;  2ZXI A;  4GCV A;  4I01 A;  2R5Z A;  3CTA A;  1LNW A;  4A3L J;  1GUU A;  2HFH A;  2IGK A;  2X6Y A;  1LDD A;  3L09 A;  1XPX A;  3BR6 A;  2QUF A;  3QQA A;  2VE9 A;  1AKH A;  3FHZ A;  1XMK A;  4BEH A;  4B48 A;  2EIN H;  4IVN A;  2NVY J;  3ZMD A;  3QPL A;  2RVC A;  2WB1 N;  3LFU A;  1SAU A;  4IX7 A;  1LFB A;  3NEU A;  5CQG A;  1O3S A;  5FLX R;  5L3B A;  3QU3 A;  4GYG A;  4IOA F;  1E0E A;  2NVU B;  2QYO A;  2EFP A;  3ABK H;  4M6V A;  5DCM B;  4DYR A;  2X1E A;  2VC1 A;  4ZDO A;  1TQI A;  1HDP A;  3OYN A;  3C3W A;  5BQT A;  4IOC F;  2DT7 B;  2IEK A;  5K1Y A;  2FBK A;  2ICW G;  2F48 A;  1ZGW A;  4PZJ A;  2E7X A;  1KU9 A;  2MW8 A;  1N77 A;  1LJ9 A;  2VKD A;  2Y31 A;  5J40 A;  1SD4 A;  1BJA A;  3HRS A;  3OIO A;  2MBF A;  3FWE A;  3HJE A;  2P8T A;  1ZG5 A;  2XGD A;  3CCY A;  2LF8 A;  5BOX A;  1HST A;  3I53 A;  1J59 A;  2PI0 A;  2DYR H;  4CYD A;  1RQ6 A;  4JBA A;  2R7O A;  3IWZ A;  3F22 A;  1EF4 A;  4Q5S F;  2IBD A;  4Y13 A;  2EV0 A;  3L1P A;  1MBF A;  2KHM A;  1T0F A;  4OU0 A;  3S2D J;  2PG4 A;  4P5O A;  3AL0 B;  2Z2S B;  1Z05 A;  2ISY A;  4F55 A;  1XCV A;  1MJB A;  4BYY A;  1I3A A;  2KDO A;  1FBQ A;  2CQK A;  1CF7 B;  2A05 A;  2Q2E B;  2IRF G;  1FP2 A;  3F3X A;  3CJN A;  4IHS A;  1USS A;  1UJ8 A;  4H0E A;  2VBX A;  2CMP A;  3FXL A;  4LIV A;  4U7D A;  4MTD A;  1YJ9 I;  3QPH A;  4NDL A;  1F9N A;  2DMP A;  2K4B A;  5FKN A;  4C9Y A;  3CJQ B;  1W36 D;  2PX9 A;  3HHH A;  1OYW A;  2LH9 A;  2JRM A;  1TWG J;  3LWF A;  3BDD A;  1MJA A;  3C2B A;  2LOO A;  4RA2 A;  1QNT A;  2VAS A;  1O3Q A;  2WTE A;  1ORK A;  2ID3 A;  1ETO A;  2HPI A;  5C44 J;  3PO2 J;  1H9G A;  1QQI A;  1H88 C;  2DOD A;  2V7F A;  4HW0 A;  1S5L C;  1SD6 A;  2W84 A;  3DBR B;  5CJ9 A;  2DLL A;  1H89 C;  1ZKG A;  1I27 A;  3WG7 H;  4YFX F;  2F4I A;  3DPU A;  4XLC A;  1KA8 A;  1S6L A;  3I54 A;  1JKR C;  1UCR A;  3LA2 A;  2B9S A;  1ZK8 A;  2BGC A;  4QPO A;  3A4C A;  2OD5 A;  3M7G A;  5AIQ A;  1WJE A;  1O3R A;  1Y8Q B;  4M6X A;  5KK1 A;  3FXJ A;  1W5S A;  5D8K B;  2HZD A;  4PUS A;  3E5X A;  4MO7 A;  3JRD A;  3ZMZ A;  4KYW A;  2L02 A;  3OSF A;  1B72 A;  1MIJ A;  2FEZ A;  1IV8 A;  3BJ6 A;  1XGN A;  3RJP A;  4A93 J;  2LDU A;  1FSE A;  4CZC A;  4LB6 B;  1U9O A;  2EB7 A;  2NS7 A;  2W82 A;  3LSI A;  1U5T B;  1RET A;  5HDG A;  4UVC A;  4HX7 A;  2CRG A;  3ZXS A;  2L7M P;  1GXQ A;  1VQ8 I;  5H2F C;  1S72 I;  4A6D A;  4AVP A;  4E7H A;  1Z77 A;  2DMN A;  2H1L A;  3VEP A;  1AA7 A;  2EFN A;  2XGC A;  3PIP F;  3LA3 A;  1UG0 A;  3N4M A;  2RRE A;  4BQA A;  4NUB A;  3L2U A;  4MEY F;  3EDP A;  4N9H A;  2COB A;  3BG9 A;  4L9J A;  5E8G A;  5J3L A;  4HRI A;  4DYQ A;  4MNU A;  2MSY A;  2DXI A;  1LE8 A;  3BZK A;  1HA8 A;  1WFX A;  5E20 A;  3RSN A;  1KU2 A;  4XOP A;  2W00 A;  3N97 A;  3JRC A;  3DV8 A;  3LSJ A;  1IV6 A;  2DPU A;  1GVD A;  2MC3 A;  4IEJ A;  2ZME A;  4V2F A;  3OIP A;  4BQO A;  3FX3 A;  2HVQ A;  2QGU A;  1MSE C;  1JT6 A;  1UZC A;  3REO A;  5ILU A;  1T98 A;  3CLO A;  3F0C A;  2JUG A;  3MVP A;  2W1O A;  2BY2 A;  2EQR A;  2FA5 A;  2O6G E;  3AG4 H;  3QOP A;  2R4G A;  1PUF A;  2Y2Z A;  5GAD J;  1R36 A;  4HG2 A;  2CV0 A;  3U2R A;  5F0F A;  3ZMU A;  1HOM A;  1BJZ A;  2D2W A;  4HSR A;  1F36 A;  4Z2Y A;  4OIQ F;  1BR1 A;  3CCU I;  2JUC A;  2R7S A;  3SDG A;  1EA3 A;  2QF7 A;  3LFK A;  3OYC A;  3FMQ A;  3KEY A;  4Y17 A;  2HOS A;  1FTZ A;  4I98 B;  1UG2 A;  4J00 A;  1K78 A;  2KT0 A;  3M9A A;  2ZJP F;  2HVR A;  2EFQ A;  1WJB A;  1QVU A;  4B4C A;  1C0W A;  2TDX A;  3LNQ A;  2VXZ A;  3ZQG A;  5KHD A;  5CVI A;  4IKF A;  2RQP A;  3KLO A;  4E4H A;  5K5Q A;  3H3V K;  1R22 A;  4HOB A;  1X3U A;  3PL8 A;  4XL9 A;  2GXB A;  2K3P A;  2LG4 A;  2MH9 A;  3F8F A;  4RAG A;  3JW4 A;  1TBX A;  3S2H J;  1XMA A;  1MH3 A;  3VSK A;  4A0Y A;  2LNB A;  3BZ6 A;  3HXL A;  4AYB A;  4A0X A;  1U6G A;  3GTM J;  2VQH A;  4RMN A;  3AG3 H;  3DKX A;  1ZTR A;  2DFE A;  2FMY A;  3FK7 A;  2DDB A;  1Y0N A;  3DPL C;  1POG A;  4HEA 2;  3VB2 A;  3A02 A;  3RZD J;  3OYE A;  2R5Z B;  1T39 A;  3OYH A;  2CFX A;  2P7C B;  3MKW B;  4RDU A;  4G6Q A;  3V7R A;  2LF7 A;  2EIK H;  4JX4 A;  5EEA A;  1X3W B;  3FM5 A;  5A2Q K;  1FOX A;  2ZNY A;  4P96 A;  1AKH B;  1SFU A;  4BEH B;  4DW6 A;  4U87 A;  3LSP A;  1QA6 A;  1OJL A;  1XGO A;  1IW7 F;  1YQA A;  2NOJ B;  1D3Y A;  3QU6 A;  4MEX F;  2O8K A;  3TMO A;  3K6G A;  3O8H A;  3C2H A;  5DUK A;  3J80 Z;  2FBI A;  4A3M J;  2HKO A;  3U21 A;  4W97 A;  1YHQ I;  2LC2 A;  1O4X A;  3K4K A;  2CGP A;  3OYK A;  1E17 A;  4XQF A;  2ZJR F;  4ENM A;  3OYL A;  2R7T A;  4ZJZ A;  1PDN C;  2FQ4 A;  1YE9 A;  2NNY A;  2DA2 A;  3DLA A;  3OYD A;  1LVK A;  1MMN A;  2Y0M A;  1JE8 A;  4A0Z A;  2V9V A;  1IN5 A;  4M9Z A;  4HLX A;  2H6C A;  4YFK F;  3G1M A;  1R4N B;  1SVO A;  1QHH D;  1WJ5 A;  2K3F A;  3FZV A;  2X6X A;  3RQ4 A;  5B1B H;  2F5E A;  2RDP A;  3M3Y J;  2XKO A;  3ZMV A;  5AON A;  1T33 A;  2O03 A;  2J5O A;  3C2G A;  2CSO A;  4G6D A;  4HYE A;  4LIT A;  4XLE A;  5IP6 A;  1YRN A;  4XLN F;  4YG2 F;  5IT3 A;  3OYI A;  2HOA A;  1D0Z A;  2QLZ A;  1L3L A;  3I4M J;  4M9S A;  2HS5 A;  3K4C A;  2FBH A;  3FK6 A;  1J09 A;  1V55 H;  4KJZ A;  1Y1W J;  3AAF A;  4OMY A;  1ZG1 A;  4IHV A;  4B43 A;  1BOB A;  4Y33 A;  2WY8 Q;  5JLW A;  5B66 C;  2VC0 A;  3GFJ A;  4I7H A;  4BS9 A;  2NNN A;  1A04 A;  3MAJ A;  2Y0S A;  4BJT A;  4YFN F;  3H0D A;  2VLA A;  1Z7U A;  2NVQ J;  4I76 A;  4KN7 X;  5E17 F;  3GME A;  2ELH A;  4A69 C;  2JWT A;  5FLX K;  3ABL H;  1ZR2 A;  1IXS B;  5DTD A;  3OOU A;  2ZJ2 A;  5GPA A;  5K5O A;  4XID A;  1KON A;  1W7P D;  5BNG A;  2G9W A;  4DBR A;  2I8D A;  3P7N A;  3F72 A;  1PYV A;  2VBY A;  2VXD A;  4C2M J;  3WTY C;  4RM2 A;  1TTY A; 
#chains in the Genus database with same CATH homology
 2IP2 A;  5HS9 A;  3CO6 C;  5L3D A;  3KCC A;  3QAH A;  1F1Z A;  1TQM A;  2P6S A;  3T0Y A;  4CDG A;  3CUQ C;  3I5U A;  2K86 A;  4OIR F;  4K2E A;  1IZ1 A;  3WTS C;  2XAF A;  3D5L A;  4KT5 C;  2O61 A;  1FC3 A;  3RKY A;  2F2E A;  3GW2 A;  4ON0 A;  3TQN A;  4IHT A;  1G6N A;  1KU3 A;  2XUB A;  3RYP A;  4KIB A;  3JSO A;  1S7O A;  4G94 A;  5IT9 Z;  3L7W A;  2VOD A;  2IT0 A;  3V8K A;  3IHU A;  5EEG A;  2C6Y A;  1IRG A;  3GEZ A;  3E6D A;  3QRF F;  1B6A A;  4I0B A;  4EM2 A;  3SXY A;  3HHG A;  2KJC A;  2A5Y B;  4EV0 A;  4HQM A;  1EH8 A;  1YW7 A;  3ROU A;  4GXO A;  5KVR A;  4AIK A;  3FXQ A;  4P55 A;  1W7P A;  4UNO A;  3HSF A;  3WTV C;  1LDJ A;  1HKQ A;  2CWE A;  1VTN C;  3DXJ F;  5E1X A;  1S29 A;  4RGU A;  2L01 A;  2M30 A;  3E3V A;  2G7U A;  3E97 A;  3TDU C;  3MEX A;  2ZBK A;  4EVI A;  1JHH A;  2QWW A;  1MZB A;  1Y0U A;  3K2Z A;  3GFI A;  3BP8 A;  2FSW A;  3J81 K;  1KQ0 A;  3HOT A;  2D1H A;  3OV8 A;  4B09 A;  1SMT A;  1ON2 A;  3JTG A;  1PP7 U;  5DD8 A;  5ICF A;  2A61 A;  2VOO A;  2ZFW A;  1ZAR A;  2KIF A;  3HUG A;  2L4A A;  5HS8 A;  2E1C A;  2O0Y A;  3M8E A;  3H3U A;  2BBY A;  4F7Z A;  3U9G A;  2Z33 A;  4LMY A;  2GXG A;  3C7J A;  1G3W A;  3SHF A;  2M5W A;  2XHK A;  3E6M A;  1TNS A;  2IA1 A;  3IRR A;  2BYV E;  3ZMT A;  2HR3 A;  3QP5 A;  2WWY A;  3ELK A;  2DBB A;  1DUX C;  2KIM A;  5F1R A;  4KIC A;  3ZQ7 A;  3KE2 A;  5JVT A;  4FX4 A;  1P6R A;  3FXU A;  3VOE A;  4UV9 A;  2ADU A;  1WQ2 A;  4DNC A;  2QVO A;  3R0A A;  1SD7 A;  1LEA A;  5ICE A;  1ZG3 A;  2R7F A;  1B4A A;  2DFI A;  2VT3 A;  4WX9 A;  3R6S A;  4EM1 A;  3I64 A;  4HX8 A;  2O8X A;  1IXC A;  4GO1 A;  1IN4 A;  5D5W B;  4R1H A;  1FZP B;  1DPU A;  2DQL A;  2H09 A;  1BC8 C;  2R3S A;  4CIC A;  3ZPL A;  4R79 A;  4U0V A;  4IF4 A;  1XSD A;  2Y75 A;  1J5Y A;  1OR7 A;  2F5C A;  2EFW A;  2ZCW A;  1RI7 A;  5LGN A;  2FNP A;  4P9F A;  3HSE A;  3G3Z A;  3W6J B;  3H3Z A;  4A6E A;  2ETH A;  3CUO A;  1BOA A;  4KDP A;  4U0Y A;  2NRA C;  4EJT A;  3V8J A;  5DDG A;  1KYW A;  2QBY B;  1SFX A;  3Q9S A;  3KLN A;  1KQ9 A;  2HWV A;  3O6B B;  1MDM A;  2A6H F;  2K4J A;  1R1U A;  3M1E A;  3MFK A;  2L3D A;  3I59 A;  3EUH A;  2Q0O A;  3WTZ A;  2RNJ A;  4RB0 A;  2COM A;  4LK1 F;  3P9K A;  3WTT C;  2Z9O A;  1FWZ A;  1ZAO A;  4RGX A;  1I6X A;  5L3F A;  4RAZ A;  3WGG A;  4E70 A;  3TO9 A;  5DYM A;  3VOD A;  5ILV A;  1Z6R A;  3F8M A;  4L0Z B;  1IN6 A;  5CYV A;  4N0B A;  3E5U A;  1YO5 C;  4O3M A;  2VT2 A;  3D0S A;  5JHU A;  2QZ8 A;  2XV4 S;  2GZW A;  2YX4 A;  1JXS A;  4M6Y A;  1STZ A;  3F21 A;  1XDU A;  4G9Y A;  2A6E F;  3E5Q A;  3GFL A;  5JI6 A;  2MLK A;  4HF0 A;  4A2U A;  1JHF A;  3RPU A;  4WXC A;  3GF2 A;  2F5D A;  3R4K A;  2AXL A;  4XSZ F;  2HOE A;  5JR3 A;  4KN4 X;  5BMZ A;  3ML6 A;  4HAM A;  1F5T A;  2YSR A;  1KYZ A;  4FT8 A;  1FP1 D;  2JPB A;  5L3E A;  1FPQ A;  2A07 F;  2O3F A;  4QLC U;  2DO7 A;  3M8F A;  2RV8 A;  3PQJ A;  4EMS A;  3V8L A;  1K6O A;  3I58 A;  3L00 A;  4EGY A;  2W85 A;  3DFG A;  2ZNZ A;  1IN7 A;  5E1W A;  4AD9 A;  2F5F A;  2WV0 A;  3EQL F;  1P2F A;  1PUE E;  1O7L A;  1OKR A;  1ZRC A;  5CVU A;  5H6Q A;  1JGS A;  4NHJ A;  4M9X A;  2QQ9 A;  4IRG A;  1MKM A;  2FRH A;  2YU3 A;  2PFB A;  1P4W A;  1IF1 A;  3QP6 A;  5BPI A;  1HKT A;  1LEB A;  2JTV A;  4QWQ A;  3FXR A;  2HKX A;  2EV5 A;  2HYG D;  4IXA A;  4PCQ A;  5DCF A;  4S05 A;  1WKM A;  4HF1 A;  5F6F A;  3ZMS A;  4O5V A;  4ZZL A;  4BXU A;  3PFI A;  2OAZ A;  3SZP A;  1UB9 A;  1J7K A;  5J8F A;  1D8K A;  2DQR A;  2E1N A;  5FB2 A;  3WTX C;  5A2Q Z;  2MLG A;  4GGG A;  1HQC A;  3GYH X;  2BV6 A;  3PQK A;  1LVA A;  4LGW A;  4D0P A;  1IRF A;  3IKV A;  4I0A A;  3WE2 A;  4HDU A;  2PMU A;  5K5R A;  1FX7 A;  1P4A A;  4L9T A;  2V1D A;  3KP6 A;  2HYF A;  4CZZ A;  2M1B A;  2KJB A;  5CVV A;  2OQR A;  2PEX A;  2NAZ A;  2RKH A;  1UHW A;  2MD5 A;  3I59 B;  3DKW A;  1AWC A;  4BHP A;  1BIA A;  1G3Y A;  2OQG A;  3HIF A;  5CLS A;  1YIO A;  2ZXJ A;  4ESJ A;  1U5T C;  2V6C A;  5FD5 A;  1MGT A;  3F8B A;  2DI3 A;  5LHG A;  2EK5 A;  1RZ4 A;  4CO8 A;  5DD4 A;  4L0Y B;  2Y48 A;  2UXX A;  1XB4 A;  3I71 A;  3FMR A;  2ZKZ A;  1O7F A;  1TW2 A;  2IW5 A;  4JK1 X;  5FLX Z;  1TLH B;  3V4G A;  2IA2 A;  3WGI A;  3MQ0 A;  4KA4 A;  4NB5 A;  5E8I A;  3TO6 A;  4B8X A;  4KMF A;  5FO5 A;  3B02 A;  4G7Z F;  1ODD A;  4HV6 A;  4XRF A;  1FT9 A;  4LLG F;  1R1T A;  3BOQ A;  5ERI A;  1XN7 A;  3F6V A;  4UV8 A;  3F6O A;  1YW9 A;  2X0L A;  1V4R A;  2EWN A;  2EFO A;  3BY6 A;  2PN6 A;  3BPV A;  1WSU A;  4LD5 A;  5HDK A;  4M74 A;  2EJR A;  2Q8K A;  4I09 A;  5LGU A;  5ILS A;  5D6F A;  1K7A A;  4KNY A;  5J8C A;  1O3T A;  4UVA A;  5DCM A;  4PGG A;  1EH7 A;  1YW8 A;  3K69 A;  2HTS A;  1FNN A;  2DK8 A;  2YPR A;  3T8R A;  4ZYG A;  3BWG A;  3HRU A;  2UWM A;  3KFW X;  4WK8 F;  1RNL A;  4LK0 F;  3ZP5 A;  4I2O A;  3C1D A;  1DPR A;  3T8T A;  1J75 A;  2ZME B;  2XAQ A;  3ISP A;  3WE3 A;  3F8N A;  3U1D A;  3EYY A;  3L2C A;  4EM0 B;  2IPQ X;  4EJU A;  3MZH A;  1B59 A;  4HF2 A;  4RB1 A;  2DU9 A;  1ULY A;  3WTW C;  5D5X B;  4HQE A;  1XDS A;  5DUI A;  2VON A;  1K78 B;  4OIP F;  1TNT A;  5D4R A;  3J81 Z;  2PLY A;  5CVR A;  2JT1 A;  4RB2 C;  4LJZ F;  4KIF A;  4BHC A;  4G8X A;  2FU4 A;  4EGZ A;  5F64 A;  4OIN F;  3DF8 A;  1U78 A;  1G3T A;  3RIR A;  2PJP A;  3P9C A;  5ICG A;  4R8H A;  1L0O C;  1DP7 P;  5LRR A;  2XIG A;  4L18 B;  4Q4Z F;  1HBX G;  3KP7 A;  3E6B A;  1LDK B;  4MHG A;  3ERE D;  1DDN A;  1U5T A;  1FYL A;  1P4X A;  2GIV A;  2JPC A;  5TJJ A;  2IA0 A;  3GLX A;  5LBQ A;  1B1B A;  4TV7 A;  2QM3 A;  2H6B A;  4WCG A;  5HVQ C;  2LKP A;  3Q5F A;  4RAY A;  2Z99 A;  3RKX A;  1IUY A;  2OBP A;  1BI3 A;  3WTU C;  1F4K A;  1ZHF A;  2DTR A;  1FBU A;  1UHM A;  2GA1 A;  4U88 A;  5JFR A;  2BEO A;  1XGM A;  3BJA A;  5HOO A;  2L4M A;  3T1B A;  1H0M A;  5HLG A;  5ED4 A;  1ZN2 A;  2KRF A;  2GQQ A;  3R61 A;  3VFZ A;  1WRJ A;  2JRT A;  3CUQ A;  1EV7 A;  1W5T A;  4MTE A;  2KIU A;  3GWZ A;  4ETS A;  4HZF A;  5D8L B;  1QO0 D;  4LB5 A;  3LAJ A;  2P5L C;  5HS7 A;  1ZLJ A;  4XLP F;  3ZN0 A;  2PMH A;  3RTR A;  3K1P A;  2JSC A;  3ABT A;  1NHA A;  5LHI A;  3KEO A;  5LRS A;  1TQP A;  1QPM A;  4Q48 A;  2XAS A;  2R7D A;  3GX4 X;  3DQV C;  2XAG A;  1I5Z A;  5FGM A;  1RUO A;  1OYI A;  3L9F A;  2V1U A;  4IRH A;  4ZYH A;  4BHB A;  1OPC A;  1BM9 A;  1I1S A;  3G73 A;  1BBY A;  1HKS A;  1PP8 F;  2DPD A;  2K27 A;  1O57 A;  4PDK A;  3SQN A;  1J2X A;  5DV5 A;  4KUM A;  3IWF A;  2OZU A;  1S7A A;  3IRQ A;  2MH2 A;  2IJL A;  4KIG A;  4AWX B;  2VE8 A;  4HA8 A;  1ZGA A;  3K1N A;  3RYR A;  1Z1D A;  2XVC A;  2FF4 A;  3GUD A;  1Z91 A;  4MQV A;  2E7W A;  3MWM A;  3I0T A;  3KET A;  1U8R A;  1J0R A;  3TOB A;  2HQN A;  1W7P B;  4LLN A;  4UXN A;  1FLI A;  3E6C C;  2EV6 A;  5E1Z B;  1ZRD A;  2L54 A;  4ASN A;  1YFH A;  4KMU X;  3TDZ C;  2ESN A;  2CYY A;  5L3C A;  4L9N A;  2PQ8 A;  1OYY A;  2STW A;  4UUV A;  2GA2 A;  2KKO A;  2VBZ A;  3RDI A;  2HZT A;  2LSO A;  3T5X A;  2MA3 A;  1ZGJ A;  1KGS A;  4L5I A;  2HDC A;  2M45 A;  3RPQ A;  3W6K B;  2NS0 A;  4UHT A;  4M71 A;  2EA4 A;  3RI4 A;  1FY7 A;  3KEQ A;  3R0J A;  1OMI A;  4CHU A;  5LGT A;  1R5G A;  4LG0 A;  2P7V B;  4HV5 A;  2XRN A;  4ZZD A;  4ENJ A;  3DP7 A;  1BN5 A;  3EYI A;  2FXA A;  2ACJ A;  4RGS A;  4EJW A;  1Z6T A;  3KP5 A;  5HDN A;  3MCZ A;  3WOD F;  1ZLK A;  1R23 A;  3K1M A;  1WWX A;  3LQQ A;  4NQW A;  2B0L A;  2UXN A;  2RGV A;  5BPD A;  3K0L A;  2X4H A;  1MJ9 A;  3HSR A;  4L5J A;  3SFZ A;  2P4W A;  1Q1H A;  3ZN1 A;  5CVJ A;  2XKP A;  5DEQ A;  5D5V B;  2OU2 A;  3CUQ B;  1YS6 A;  1BI0 A;  4A12 A;  2FE3 A;  4P9U A;  3WU1 B;  5FFZ A;  2D45 A;  3JSP A;  2FML A;  2FQ3 A;  1G4D A;  4G7O F;  1GHC A;  1QZZ A;  1QZY A;  4RS8 A;  1S8N A;  1D5V A;  2A68 F;  1BI2 A;  5J6X A;  4A5N A;  3BJO A;  5ICC A;  4MQ9 F;  3S2W A;  4CGZ A;  2FOK A;  1K79 A;  5BS6 A;  4JQF A;  3HTU A;  3NQO A;  5EEH A;  3V7C A;  1V3F A;  2CO5 A;  3K9T A;  2YR2 A;  2DAO A;  1QGP A;  4LLL A;  1AOY A;  3TO7 A;  3NRV A;  1TW3 A;  2W25 A;  2CW0 F;  2V79 A;  3BPX A;  2RC4 A;  3H92 A;  3SZT A;  4IRI A;  1RIO H;  1R58 A;  3ABU A;  2GAU A;  1BI1 A;  2ESH A;  4Y15 A;  2K7L A;  3HOS A;  2VOP A;  3F8C A;  1SMY F;  3FM3 A;  4U0W A;  4BNC A;  1E2X A;  1UST A;  1MDM B;  1YG2 A;  3EET A;  2H27 A;  4EJO A;  4ZYD A;  2OA4 A;  1IN8 A;  3J80 K;  3BRO A;  4M72 A;  2HQR A;  1G3S A;  2DT5 A;  4Q47 A;  1ZH5 A;  1U3E M;  4U7B A;  3HTS B;  2XAH A;  5HLH A;  2P6T A;  5FD6 A;  1SD5 A;  1ONV A;  4A5M A;  3GFM A;  4FHT A;  3RKW A;  2P5V A;  1B9N A;  3ECH A;  2K02 A;  1XCB A;  4ENK A;  3LST A;  4GYI A;  3LAP A;  3GZ6 A;  3WG9 A;  4UVB A;  5LEK A;  1KU7 A;  3ECO A;  3CDH A;  2Z5U A;  4WF2 A;  1HW1 A;  4IJA A;  2STT A;  3HRM A;  1J9I A;  4ESB A;  1T38 A;  4IPA A;  3O2P E;  4HBL A;  5FFX A;  4ZH4 F;  1GXP A;  3V7S A;  2XAJ A;  3GVA A;  3LA7 A;  2H94 A;  2EA2 A;  1FSH A;  1LQ1 A;  2RN7 A;  4BH9 A;  1YLF A;  4AIH A;  4LG0 B;  1T2K A;  4DQ2 A;  4EJV A;  1R00 A;  1R5H A;  4OMZ A;  3MZY A;  1W4M A;  5HLI A;  1REP C;  3COA C;  3O3K A;  4L9V A;  4OIO F;  1CGP A;  2P5K A;  1UFM A;  1ZYR F;  5D6E A;  2QBY A;  4G7H F;  3R60 A;  1ZRF A;  2BE5 F;  3IL2 A;  2M87 A;  4RB3 C;  1SAX A;  3F23 A;  4PGH A;  1ON1 A;  1YYV A;  3TOA A;  5H20 A;  1RUN A;  3B73 A;  5IT9 K;  2Z3Y A;  1BC7 C;  2DK5 A;  1XSV A;  4ZYE A;  1CF7 A;  2Q2E A;  3LQR A;  1EH6 A;  5LEJ A;  2W24 A;  2CG4 A;  2HGC A;  1HW5 A;  4WXH A;  3HRT A;  3WU0 A;  3OOP A;  5L3G A;  4CXF A;  4YII A;  1YS7 A;  2QQA A;  5LHH A;  2V1X A;  3KP2 A;  5H6R A;  1IAW A;  1FYK A;  3IKT A;  3KZZ A;  2ZO4 A;  3QPT A;  3JAM Z;  1FBS A;  1KQ8 A;  1XGS A;  1I1G A;  1R1V A;  4HLY A;  1MD0 A;  3JAM K;  4AIJ A;  1R7J A;  5AIP A;  1YTY A;  1FOK A;  3P9I A;  3TKY A;  2JZY A;  2VN2 A;  2A3S A;  2A69 F;  2XRO A;  4EQQ A;  2ISZ A;  2J5P A;  4I02 A;  4WWC A;  1D8J A;  1H9T A;  2D1V A;  5D4S A;  2DW4 A;  1HXD A;  3GXO A;  4ENN A;  1QBJ A;  2HEO A;  1BIB A;  4HDV A;  3Q9V A;  5D5U B;  4S04 A;  1FYM A;  1U2W A;  2HTJ A;  4BAY A;  1P92 A;  3TGN A;  4YIF A;  3KP3 A;  3FMS A;  2XGX A;  3C18 A;  2QQB A;  3ULQ B;  3IC7 A;  3KP4 A;  1HSJ A;  2IVM A;  1WI9 A;  3KZY A;  3I4P A;  3FF5 A;  2VBW A;  3DEU A;  4N9I A;  1IXR C;  1HW2 A;  1B9M A;  4O6J A;  4HX4 A;  1S3J A;  3WGH A;  3JTH A;  1XSX A;  4RGR A;  4M73 A;  3DPT A;  1T6S A;  1XD7 A;  4KFC A;  4XSX F;  2PBI A;  5LLQ A;  4OOI A;  4XBF A;  2AS5 F;  5TRD A;  2M8E A;  1ZRE A;  3GO5 A;  3J7A O;  2NYX A;  1LB2 A;  3CO7 C;  2GWR A;  2YX7 A;  4WXD A;  2UZK A;  2WC2 A;  3HYI A;  4LFU A;  5E18 F;  1GVJ A;  1SFE A;  1Z9C A;  2OZ6 A;  2QEN A;  2FNA A;  2G7H A;  3GZ5 A;  2W57 A;  4ESF A;  4MGR A;  4FX0 A;  4GCV A;  4I01 A;  3CTA A;  1LNW A;  2HFH A;  3L09 A;  1LDD A;  2QUF A;  2VE9 A;  3FHZ A;  1XMK A;  4IVN A;  3ZMD A;  6PAX A;  2RVC A;  1O3S A;  3NEU A;  5L3B A;  3QU3 A;  4GYG A;  2QYO A;  2EFP A;  5DCM B;  2VC1 A;  1TQI A;  3C3W A;  5BQT A;  5K1Y A;  2FBK A;  4PZJ A;  2E7X A;  1KU9 A;  1LJ9 A;  1SD4 A;  1BJA A;  3HRS A;  2MBF A;  3FWE A;  1ZG5 A;  2P8T A;  2LF8 A;  5BOX A;  1HST A;  3I53 A;  1J59 A;  2PI0 A;  4CYD A;  4JBA A;  3IWZ A;  3F22 A;  4Q5S F;  4Y13 A;  2EV0 A;  1T0F A;  4OU0 A;  2PG4 A;  4P5O A;  1Z05 A;  2ISY A;  1XCV A;  1MJB A;  4BYY A;  2CQK A;  1FBQ A;  1CF7 B;  2IRF G;  1FP2 A;  3F3X A;  3CJN A;  4IHS A;  1USS A;  4H0E A;  2VBX A;  4U7D A;  4MTD A;  3QPH A;  1F9N A;  2K4B A;  3HHH A;  1OYW A;  3LWF A;  3BDD A;  1MJA A;  1QNT A;  1O3Q A;  2WTE A;  1H9G A;  1QQI A;  4HW0 A;  1SD6 A;  2W84 A;  5CJ9 A;  2DLL A;  1I27 A;  4YFX F;  1KA8 A;  1S6L A;  3I54 A;  1UCR A;  3LA2 A;  2BGC A;  3M7G A;  2OD5 A;  5AIQ A;  1O3R A;  4M6X A;  5KK1 A;  5D8K B;  1W5S A;  3E5X A;  3ZMZ A;  4KYW A;  2L02 A;  2FEZ A;  3RJP A;  3BJ6 A;  1XGN A;  2LDU A;  1FSE A;  4LB6 B;  2EB7 A;  1U5T B;  5HDG A;  4UVC A;  4HX7 A;  1GXQ A;  4A6D A;  4AVP A;  3VEP A;  2EFN A;  3LA3 A;  3N4M A;  4BQA A;  4MEY F;  3EDP A;  4N9H A;  4L9J A;  5E8G A;  4MNU A;  5E20 A;  1KU2 A;  3N97 A;  3DV8 A;  2DPU A;  2MC3 A;  2ZME A;  3FX3 A;  3REO A;  5ILU A;  1T98 A;  3CLO A;  2FA5 A;  2O6G E;  3QOP A;  1R36 A;  3U2R A;  3ZMU A;  2D2W A;  4Z2Y A;  4OIQ F;  3LFK A;  3FMQ A;  4Y17 A;  4I98 B;  1K78 A;  3M9A A;  2EFQ A;  1C0W A;  2TDX A;  2VXZ A;  5CVI A;  2RQP A;  3KLO A;  5K5Q A;  1R22 A;  4HOB A;  1X3U A;  2GXB A;  2MH9 A;  3F8F A;  3JW4 A;  1TBX A;  1XMA A;  4A0Y A;  2LNB A;  3BZ6 A;  4A0X A;  1U6G A;  2FMY A;  3DPL C;  3VB2 A;  1T39 A;  2CFX A;  2P7C B;  4G6Q A;  3V7R A;  2LF7 A;  3FM5 A;  5A2Q K;  2ZNY A;  4P96 A;  1SFU A;  1XGO A;  1IW7 F;  1YQA A;  1D3Y A;  3QU6 A;  4MEX F;  5DUK A;  3J80 Z;  2FBI A;  2HKO A;  2CGP A;  1E17 A;  4ENM A;  1PDN C;  2NNY A;  2Y0M A;  1JE8 A;  4A0Z A;  2V9V A;  1IN5 A;  4M9Z A;  4HLX A;  2H6C A;  4YFK F;  3FZV A;  2F5E A;  2RDP A;  2XKO A;  3ZMV A;  5AON A;  2O03 A;  2J5O A;  2CSO A;  4G6D A;  4HYE A;  4XLN F;  4YG2 F;  5IT3 A;  1L3L A;  2QLZ A;  4M9S A;  2HS5 A;  2FBH A;  4OMY A;  3AAF A;  1ZG1 A;  2VC0 A;  3GFJ A;  4I7H A;  2NNN A;  1A04 A;  3MAJ A;  4YFN F;  1Z7U A;  4KN7 X;  5E17 F;  2ELH A;  5FLX K;  1IXS B;  2ZJ2 A;  5K5O A;  1W7P D;  2G9W A;  3P7N A;  3F72 A;  2VBY A;  3WTY C;  1TTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...