2ISZA

Crystal structure of a two-domain ider-dna complex crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords mbtA/mbtB operator strand 1
publication title Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 51
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2iszA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2iszA02
2ZBKA 3JAMK 5H6RA 2EFOA 4I2OA 4GYIA 1T0FA 4UVBA 2CQKA 4MTDA 1KGSA 4AIJA 4P9UA 5JHUA 1HW2A 3CUQA 3WGHA 2A3SA 1UCRA 2IJLA 3FMQA 2Z5UA 1DDNA 3GEZA 3KETA 3GUDA 4IRIA 1UHMA 2B0LA 2EFPA 2A69F 2V1XA 3E6DA 4LG0A 3R60A 3GXOA 5BOXA 2QBYB 2FQ3A 5HS9A 1EH8A 2QLZA 4KT5C 3SZPA 3CUOA 2P6TA 1MKMA 3W6JB 2V1DA 1R58A 4G6DA 5D8LB 4Q5SF 4ESBA 1SD7A 3VFZA 4ASNA 1ZH5A 2IW5A 2CG4A 3BDDA 4WXCA 1S7OA 4EMSA 1FYMA 3J80K 1FP1D 4RAYA 4N9HA 5DEQA 4BAYA 1DUXC 2EFNA 4ENNA 1J59A 2ZXJA 3NEUA 2XIGA 3DF8A 3HSRA 2DBBA 1HBXG 2QWWA 4I7HA 3COAC 2WV0A 4A6DA 3MEXA 2ZFWA 2ZKZA 4RS8A 4KMUX 1F4KA 1R36A 4ZYDA 3EQLF 4GXOA 4KN7X 2LNBA 3ZMZA 4CGZA 1QZYA 3DKWA 4RB0A 1SD6A 4ESFA 4ZYEA 4Y13A 1HKSA 1OYYA 1USTA 1FOKA 4KIGA 3WTWC 5HS7A 2EB7A 1YS7A 5L3DA 2YU3A 3BOQA 1DPRA 5DDGA 4Y17A 4KIBA 2Q0OA 1KQ0A 3M9AA 3WTUC 5KK1A 2PG4A 1LQ1A 4ZYHA 1MDMA 4IHSA 2O61A 4Z2YA 5A2QZ 4M9ZA 3Q9VA 1S6LA 3BJOA 3ZMTA 4HW0A 2RC4A 1UFMA 4XLNF 2HFHA 4JQFA 3O3KA 1OYWA 2QQBA 3WU0A 3KCCA 1FBUA 2HR3A 4DQ2A 4U0YA 4L9VA 1FBSA 1W5TA 2MC3A 4HV5A 3LA7A 2CFXA 4KNYA 1H9TA 1OPCA 3I0TA 2IPQX 1TW2A 4I0BA 3JAMZ 4U0VA 3DPTA 4HDVA 1W7PD 4M72A 3HRUA 4HQMA 4Q48A 2L4MA 4KN4X 1XD7A 4UV8A 4IXAA 1S8NA 2VBXA 3ZMVA 2FMYA 3R6SA 2RQPA 1L0OC 1E17A 4WWCA 5LRRA 1LEBA 3RYRA 3B73A 3H92A 1Q1HA 4QWQA 5FD6A 2R7DA 5ICEA 2L02A 3K1MA 2DO7A 3J80Z 2WTEA 4Q47A 4P5OA 3TGNA 4IRHA 1OMIA 3KP2A 3KP6A 1XB4A 4D0PA 5D4SA 1ZREA 1HW1A 1JXSA 4JBAA 1P4XA 2FA5A 2M87A 3HTSB 3LA2A 3KFWX 1ZGJA 3JTHA 1TTYA 2QBYA 3RKYA 4DNCA 4G94A 1ZYRF 3DFGA 3IL2A 4RGRA 1YS6A 2M30A 5EEGA 1O3QA 5HLIA 4FX4A 2HQNA 4HYEA 1G6NA 2OQRA 2JTVA 1W5SA 2G7UA 3LAJA 1G3SA 1ZG1A 3F3XA 4L9JA 2HZTA 1KQ9A 5FGMA 2QZ8A 1PDNC 3GVAA 3IRQA 1Z6TA 2D45A 1P6RA 1RNLA 1G3WA 1YW8A 2ZMEB 2EFWA 5ERIA 4HX7A 1K79A 3ECOA 3ZP5A 5E8GA 3HSFA 3L9FA 1J9IA 3O2PE 2AS5F 4HA8A 3EYIA 2MBFA 3K9TA 1G3TA 4QLCU 2MA3A 3F6OA 2O0YA 3FM5A 3OOPA 1SFEA 1XSVA 3ABTA 2XAFA 4U88A 4O5VA 3GFLA 3R0JA 5AIQA 5BMZA 4ZZLA 1XDUA 3GFMA 4A0XA 5FB2A 1FT9A 2IA2A 4HAMA 3RIRA 2FF4A 2ISZA 1QO0D 2KIMA 1IAWA 3RPQA 5IT9K 2YSRA 2KKOA 2PQ8A 2QENA 1QZZA 4G6QA 5F6FA 1WRJA 3ISPA 3CDHA 1SFUA 1RUNA 4FT8A 4PCQA 3SFZA 4KUMA 2A5YB 5E18F 3HRTA 1IW7F 2LSOA 4NB5A 1B59A 3OV8A 2XASA 3EUHA 1BI0A 2DK5A 1FY7A 1W7PB 3IKTA 1MDMB 3ZMUA 1RI7A 1OKRA 4IJAA 3BWGA 1FC3A 1T2KA 2KJCA 1R22A 5K1YA 5H20A 4BHCA 3HOTA 1SFXA 1FYKA 4A2UA 3M1EA 1FP2A 3WTVC 4G7ZF 2M1BA 1IXSB 5DUKA 3V4GA 3HHGA 1WKMA 3RYPA 2XKPA 2IA0A 4EJWA 3FF5A 3J7AO 3V7RA 2NS0A 3WE2A 1O3RA 4BHPA 1R23A 2F2EA 5FLXK 1EH6A 2K02A 4ZZDA 2YX7A 2HYFA 1WI9A 2VC1A 1XGNA 3CO6C 5D6EA 1S29A 3PQKA 3RJPA 1Z6RA 3FXUA 3N4MA 1BM9A 4YIIA 3F8NA 1B9MA 2Q8KA 2JSCA 4OIRF 1BI1A 1F5TA 3JSOA 2PFBA 1SMTA 3GZ6A 2P6SA 4OOIA 5TRDA 3L7WA 4LJZF 5E1ZB 4FHTA 2EFQA 4RGSA 3ZMDA 2RV8A 5D5UB 4HQEA 2R3SA 5D8KB 1TNTA 2JPCA 2K7LA 4UVAA 2QVOA 1BI2A 3SXYA 3T5XA 3WE3A 3FWEA 1ZRCA 2IVMA 4RB3C 3WTXC 1IRGA 4M9SA 1I1SA 1XSDA 1IXRC 4IPAA 2X0LA 5JVTA 3RI4A 3KEOA 1OYIA 1GXQA 3C7JA 2Y75A 4L5IA 2GA1A 2ZO4A 2DI3A 3BROA 4N0BA 1HW5A 2CGPA 4WXDA 1U78A 2VODA 2G9WA 3FMRA 2LDUA 2EV5A 1OR7A 4LLLA 4A6EA 1MGTA 2XAQA 4KMFA 4GO1A 5DD4A 4M73A 4XLPF 4HLXA 1P92A 3I53A 2QQ9A 5IT9Z 2OA4A 2ZMEA 1A04A 1YW7A 1P2FA 4KA4A 3S2WA 3F72A 2DW4A 3I58A 3NQOA 3CUQC 3GFIA 3GWZA 3K1NA 4WX9A 1R00A 3LSTA 4PGHA 1U5TB 5LHIA 1PP7U 1RZ4A 2GWRA 1ZHFA 2QUFA 3T8TA 3E6MA 1O3TA 2W24A 1T38A 1E2XA 4OIOF 4ON0A 3MZHA 2VT2A 5DCFA 2FXAA 1U3EM 5LHGA 2D1VA 3WU1B 3IC7A 1IZ1A 2HKOA 2E7WA 3EETA 1JGSA 3QP5A 4M9XA 1R1TA 3F8FA 3T8RA 2HGCA 4M6XA 4EVIA 4RB1A 2L3DA 2BV6A 4R8HA 2XAHA 2OU2A 3FX3A 1T39A 3Q5FA 1IRFA 1R5HA 5FLXZ 1ONVA 3QP6A 4OU0A 2VC0A 4EGYA 3NRVA 1YTYA 1W7PA 2P5KA 2E1CA 2K86A 3HOSA 3R0AA 4AWXB 1H9GA 4G9YA 1QPMA 2BGCA 3HRMA 2EK5A 1TQPA 3TO6A 3GFJA 2BYVE 1XN7A 4UXNA 3G3ZA 5J8FA 3WTSC 4HDUA 4O6JA 3QPTA 5CLSA 4I98B 1ZARA 2V1UA 2FEZA 2MLKA 4A0ZA 3JW4A 1P4AA 1YIOA 1QQIA 2VOOA 5FD5A 1XSXA 4GCVA 2VE8A 1PUEE 3V7CA 3MAJA 2Q2EA 1I1GA 5LLQA 4Y15A 3KE2A 2UZKA 4UVCA 5E1XA 4KFCA 2VBYA 1J0RA 3GW2A 2A6HF 4IF4A 3V8LA 3FM3A 5AIPA 5DUIA 1R1UA 2EA2A 3TDZC 4HF0A 1G4DA 1LEAA 2HS5A 3F23A 5J6XA 1B1BA 3HSEA 5L3FA 5E17F 1FLIA 2L54A 3TKYA 2ESNA 3GZ5A 3QOPA 1ZRFA 1SD5A 2RVCA 4KYWA 1YG2A 4M71A 1DPUA 3I59B 4P9FA 3HUGA 2YR2A 2J5OA 3E5XA 1VTNC 2HTSA 1SAXA 4MTEA 4CZZA 2XVCA 5HLHA 3K0LA 4AD9A 3HTUA 3J81K 1FNNA 4XSXF 2XGXA 2BE5F 2PN6A 2W25A 4XRFA 1ZG3A 5D5VB 5K5OA 3TQNA 1I5ZA 1K78B 3VODA 4S05A 3U2RA 1J7KA 4YIFA 1BIAA 2DLLA 5D4RA 1STZA 4HBLA 1QNTA 2RGVA 1I27A 3MCZA 3HIFA 1EV7A 1ZRDA 1O7FA 3LQQA 4LB5A 5L3GA 1K7AA 4L0YB 3SHFA 1JHHA 1IF1A 4UV9A 3LFKA 5E20A 1IN8A 2E1NA 4L18B 3JSPA 3EDPA 3CO7C 2VBZA 4HOBA 4LK0F 5CVIA 5L3BA 1HQCA 2H09A 3E5UA 2WC2A 1ON1A 2VT3A 1HSTA 1ZN2A 2ZNZA 1TLHB 3HYIA 2ADUA 3KZYA 4LGWA 5HDKA 1U5TA 2FBKA 1YFHA 2DFIA 4BQAA 3KP3A 2NNYA 3F8BA 1J5YA 4N9IA 4RGUA 3FXQA 4RGXA 3KP7A 1IN5A 4RB2C 5HS8A 1FSEA 5FFZA 3DQVC 2G7HA 4MHGA 1LVAA 3M7GA 2KIFA 3K69A 4MEYF 2DK8A 4CDGA 2P7VB 2GXBA 2EV6A 2HWVA 4LK1F 2W57A 3GX4X 3E6BA 2A68F 3U9GA 2XRNA 1TQIA 5D5WB 1MJAA 5AONA 4P55A 1DP7P 2IRFG 4OIQF 1MJ9A 3F8MA 1F1ZA 2K27A 2KIUA 3TO9A 4ESJA 1GXPA 1B6AA 1YO5C 1ON2A 1XMKA 5E8IA 2IP2A 1FSHA 4IHTA 2A07F 2VOPA 4HV6A 3W6KB 1C0WA 2L4AA 2PEXA 4LD5A 2K4JA 1BI3A 4U7DA 1IN6A 4R79A 4G7OF 4HLYA 3IWZA 1ZLKA 5ED4A 4MGRA 3ZN1A 2UWMA 3ZMSA 1U6GA 4HF2A 2ESHA 5LHHA 2X4HA 2JRTA 3D5LA 3I71A 2KRFA 2V79A 3TOAA 4JK1X 3G73A 1YW9A 4TV7A 4ZH4F 3J81Z 2CWEA 2RNJA 5BQTA 3T1BA 2FOKA 1XGSA 2D1HA 2STTA 2O3FA 1TW3A 4HX8A 3WGGA 5JFRA 2F5FA 4I01A 3F8CA 4BHBA 1V4RA 4CHUA 3CJNA 2PBIA 3MWMA 3I59A 4YFXF 4ZYGA 1MJBA 1P4WA 4A5MA 5K5RA 3WG9A 4R1HA 2Z9OA 3I64A 2PLYA 2RKHA 3P9IA 1BC8C 3V7SA 1O3SA 3JTGA 4UNOA 4OIPF 2Z3YA 2XROA 2FE3A 2YPRA 3FXRA 5EEHA 1FX7A 2BBYA 3FZVA 3DXJF 2NAZA 4I0AA 3PFIA 3WGIA 1LB2A 4H0EA 4A5NA 2F5DA 2OD5A 4LLGF 1K78A 1KU7A 1IUYA 1KYWA 3EYYA 4OMYA 1IXCA 3H3UA 5BS6A 3GLXA 4HZFA 5JI6A 2EWNA 3N97A 4ENKA 3GYHX 2CSOA 4I09A 3FMSA 2P5LC 1K6OA 2LKPA 4EJTA 3KZZA 2UXXA 2FNAA 4EGZA 1D8KA 2ELHA 2HKXA 4KIFA 1AOYA 2HOEA 4EM0B 1X3UA 4WK8F 2AXLA 4KICA 3V8KA 1R1VA 1HSJA 1ZAOA 3MFKA 5FO5A 3P7NA 2OZUA 2O03A 2ZCWA 3M8FA 2GXGA 5LGTA 1LDJA 3C18A 2HTJA 2FNPA 5DV5A 3ROUA 1RUOA 2HDCA 4ETSA 4LB6B 4L0ZB 2R7FA 4OINF 1XGMA 3QAHA 3RKXA 3ABUA 1KA8A 1YQAA 4XBFA 1I6XA 4EJOA 4WF2A 4L9NA 5CVUA 2YX4A 3WTYC 3F21A 3DV8A 2Z99A 2V9VA 3BPVA 1R7JA 1H0MA 3QU3A 3IWFA 1ODDA 1JHFA 2FMLA 5ICGA 5DD8A 1D3YA 4RAZA 1BIBA 5D5XB 1FZPB 4ENJA 3BPXA 4KDPA 1T98A 2CYYA 1EH7A 2XAGA 3ZQ7A 5BPDA 1F9NA 5LBQA 4NHJA 5DYMA 5H6QA 3U1DA 2DAOA 3CLOA 3DEUA 4B09A 4EM1A 1BBYA 3LWFA 3FHZA 3ERED 4CO8A 3IRRA 1XGOA 5E1WA 1Z05A 2FBIA 1MD0A 2F5EA 4CYDA 5ILVA 5HDGA 2ISYA 4MNUA 3F6VA 4PZJA 2O6GE 3D0SA 1TNSA 1WWXA 2FU4A 2QYOA 2RN7A 4NQWA 2A61A 5HLGA 2W85A 1S7AA 4AVPA 2ZJ2A 1XDSA 3LA3A 2PMHA 4CICA 3WODF 3RDIA 1KYZA 3H3ZA 1XMAA 2PJPA 4P96A 3ECHA 1HXDA 4A12A 2MH2A 4ENMA 5HVQC 1Z1DA 4FX0A 4YFKF 5LGUA 2WWYA 4PGGA 1O7LA 2C6YA 4B8XA 3E6CC 2OAZA 4OMZA 2QM3A 2DPDA 2XAJA 2MLGA 3RKWA 2RDPA 1Z91A 3M8EA 3RPUA 4EM2A 3MQ0A 5CVRA 2GZWA 1U2WA 2OZ6A 2K4BA 3K2ZA 2DU9A 4XSZF 2DTRA 2JZYA 3KEQA 2P7CB 1TQMA 1NHAA 1HKTA 4LMYA 4M74A 1BJAA 2E7XA 3ZPLA 2LF7A 3BZ6A 4G7HF 3IKVA 4CXFA 3VB2A 3TDUC 4GGGA 1LNWA 5HOOA 5DCMB 1CF7B 2XUBA 5K5QA 1W4MA 3V8JA 2GAUA 5F1RA 2H6BA 1UHWA 3P9KA 2A6EF 4U0WA 4O3MA 2DQLA 1KU3A 2FSWA 1QBJA 2NRAC 2J5PA 5FFXA 3ULQB 2M8EA 2VE9A 2NNNA 2P4WA 5L3EA 1FPQA 2VN2A 3I4PA 5D6FA 1GHCA 2JPBA 3WTZA 3HHHA 1XCVA 3LQRA 1QGPA 2VBWA 5JR3A 3O6BB 1JE8A 1MZBA 1S3JA 4PDKA 3RTRA 5J8CA 2W84A 3K1PA 4HF1A 2KJBA 1R5GA 1Z9CA 3Q9SA 2IT0A 4EV0A 3ML6A 5LGNA 4BH9A 4MEXF 2EV0A 2H6CA 2F5CA 1REPC 3E97A 1T6SA 3CUQB 1WSUA 4EJVA 1USSA 2V6CA 3GO5A 2ETHA 3BJAA 2HEOA 5F64A 5LEKA 2OQGA 1D5VA 4F7ZA 4LG0B 2JT1A 2NYXA 4MQVA 1BC7C 2PMUA 1IN7A 2Y48A 4HX4A 1SD4A 2XKOA 3DP7A 1HKQA 4EQQA 1L3LA 1G3YA 2EA4A 1YYVA 1KU2A 1UB9A 1J75A 2P8TA 4IRGA 2EJRA 2DPUA 1FYLA 3T0YA 4IVNA 2FBHA 4I02A 4MQ9F 2ZNYA 2STWA 1FWZA 4UHTA 1ZG5A 5IT3A 2XHKA 4U7BA 3QPHA 2H94A 2Z33A 3BY6A 5ICFA 3R4KA 4L5JA 1ULYA 4YG2F 5ILSA 2P5VA 4AIKA 1PP8F 5CJ9A 4WCGA 2VONA 2ACJA 3C3WA 3L2CA 2XV4S 4UUVA 2PI0A 1YLFA 3BJ6A 3SZTA 1U5TC 5TJJA 5LEJA 3B02A 2VXZA 4EJUA 1KU9A 2HYGD 2UXNA 1IN4A 5CVJA 6PAXA 3P9CA 3E3VA 3MZYA 2LF8A 3TOBA 4BXUA 3TO7A 2CO5A 3R61A 3VEPA 5KVRA 1D8JA 1J2XA 4LFUA 3QRFF 1SMYF 1RIOH 4K2EA 3KP5A 1KQ8A 3GF2A 2Y0MA 1BN5A 4E70A 1B9NA 3KLOA 1B4AA 1XCBA 2M5WA 2GA2A 4L9TA 1ZGAA 3L00A 3PQJA 5CYVA 5ICCA 2L01A 3E5QA 1Z7UA 2GIVA 2MH9A 3QU6A 2M45A 1V3FA 4Q4ZF 2DT5A 1LDDA 3C1DA 5LRSA 4GYGA 4M6YA 1O57A 3VOEA 3F22A 3AAFA 2QQAA 2FRHA 3ZN0A 5DCMA 4BYYA 1CF7A 2CW0F 1FBQA 4A0YA 3I54A 3CTAA 3KLNA 5BPIA 5CVVA 2GQQA 2COMA 4LLNA 2HQRA 3I5UA 3LAPA 2MD5A 3DPLC 2TDXA 5A2QK 1CGPA 2H27A 3KP4A 4YFNF 1AWCA 2O8XA 3L09A 4S04A 4G8XA 1Y0UA 1GVJA 3HRSA 1TBXA 5ILUA 2OBPA 3ELKA 4BNCA 1LDKB 3REOA 3SQNA 2DQRA 4AIHA 1U8RA 1BOAA 3WTTC 2BEOA 2IA1A 2D2WA 5L3CA 1WQ2A 3BP8A 1ZLJA 4WXHA 1LJ9A 3IHUA 5HDNA
chains in the Genus database with same CATH superfamily
2JA5J 2ZBKA 2GIZA 3S1NJ 3JAMK 3A1YA 5IP7J 5H6RA 2EFOA 2H8RA 4I2OA 4GYIA 2OTLI 3D1NI 1T0FA 2LVSA 4GDFA 2LBFB 4UVBA 4C3IJ 2CQKA 3AL0C 1OCZH 4MTDA 1KGSA 1ETQA 4AIJA 4P9UA 5JHUA 1Y1VJ 2EBIA 1HW2A 3CUQA 3WGHA 2A3SA 4A3FJ 3KEYA 1UCRA 2IJLA 2LR8A 2LC2A 2EIKH 3FMQA 2Z5UA 1DDNA 3GEZA 3KETA 4J01A 4IOCF 3GUDA 2EIJH 2DTZA 4IRIA 1OCPA 1UHMA 2B0LA 2EFPA 2A69F 2CW7A 2V1XA 3E6DA 4LG0A 3R60A 1TZLA 3H1CA 3GXOA 4ABZA 5BOXA 2QBYB 2FQ3A 5HS9A 1EH8A 2QLZA 4KT5C 3SZPA 3CUOA 3MZ8A 2P6TA 1UAAA 3PUFA 1MKMA 3W6JB 1IDYA 5J1UA 2V1DA 1R58A 4BACA 1YITI 4G6DA 1WJFA 5D8LB 3Q0WA 3QWLA 4Q5SF 4ESBA 1SD7A 1UG0A 3HM5A 3VFZA 2VLAA 3CMEI 2E2JJ 4ASNA 1ZH5A 4FE7A 1PVEA 1R49A 2IW5A 2CG4A 4IHXA 3BDDA 2CUZA 4WXCA 3HOVJ 1S7OA 4EMSA 1FYMA 3J80K 1FP1D 3OL4A 4N9HA 4RAYA 2VL8A 5DEQA 4MIMA 1JT6A 3BG7A 4BAYA 4Y3OA 1DUXC 2EFNA 1HOMA 5GAGJ 4ENNA 1VNDA 4XLAA 5EEAA 1J59A 2ZXJA 3NEUA 1K4SA 2XIGA 3DF8A 3HSRA 3OYHA 2DBBA 2WY7Q 1H89C 3L2VA 1HBXG 2QWWA 4I7HA 3COAC 4ITVA 2WV0A 4A6DA 5IYBJ 3BG3A 1WJEA 2CW8A 3CJTB 3MEXA 2X6YA 2R7XA 1JKPC 2ZFWA 3OYNA 4Z6YA 4JP0A 2XB5A 1POGA 2E1MC 1RPWA 2ZKZA 4RS8A 4KMUX 2LY1A 1F4KA 1ZR2A 1R36A 1R4NB 4ZYDA 3EQLF 1WI3A 4GXOA 4KN7X 2HQAA 2LNBA 4PK4A 1HA8A 5JVGF 3ZMZA 4CGZA 1QZYA 3DKWA 4IHVA 4RB0A 2KIQA 3F0CA 3S2HJ 1SD6A 2BY2A 4W97A 4ESFA 3O8GA 4ZYEA 4Y13A 3J7AY 1HKSA 1OYYA 1USTA 3ONQA 2VKDA 3BTJA 2E5NA 1FOKA 4KIGA 2H1KA 2Q1ZB 4B44A 4C3HJ 3QPLA 3WTWC 4KT6A 5HS7A 1IRXA 2R7VA 4A3CJ 1MW7A 2EB7A 1YS7A 3ASNH 3QODA 4UUSB 5L3DA 2YU3A 1MH3A 3BOQA 4XRSA 5KHDA 1DPRA 1I39A 3ZR8X 5DDGA 4Y17A 1ORKA 5JLWA 4KIBA 3K4KA 2Q0OA 3DU6A 1KQ0A 3SZGA 3M9AA 1U8BA 3WTUC 2JJ7A 5KK1A 3OYGA 2PG4A 3QOEA 1LQ1A 2M35A 4ZYHA 3CCRI 4B48A 2L2OA 1MNEA 1MDMA 4IHSA 2O61A 4Z2YA 1NH3A 5A2QZ 4M9ZA 1P7JA 3Q9VA 4NC7A 1S6LA 2WY8Q 3Q3SA 3BJOA 1RESA 3ZMTA 2AO9A 3JRBA 2P81A 3OOUA 4XORA 2R7WA 4CCNA 3NARA 4HW0A 3CZ6A 4HNTA 2TCTA 3CCMI 2HVRA 2X6OA 2RC4A 1UFMA 3SDGA 5J3LA 2CUJA 4XLNF 2HFHA 4FE4A 4JQFA 1W5CC 2Z16A 1TWCJ 3UNGC 1B72B 3O3KA 1OYWA 4X0GA 3TBIA 2QQBA 3WU0A 3KCCA 1FBUA 2HR3A 2VXDA 2BVLA 4DQ2A 4U0YA 4L9VA 1FBSA 1W5TA 2MC3A 3FK6A 4HV5A 3LA7A 3RQ4A 2JVGA 2CFXA 4KNYA 1H9TA 4C3JJ 4DYCA 1OPCA 1SFKA 3I0TA 3OWTA 2IPQX 1TW2A 2R4GA 2K9NA 4I0BA 1RR7A 4AU7A 3CCQI 3JAMZ 4NC6A 3MKYB 4E7ZA 2IAIA 4BU2A 1JJ8C 2R7UA 4U0VA 1T08B 3LOCA 5TISC 3DPTA 1LFPA 2VASA 3WHCA 4HDVA 4XLFA 1W7PD 3PSIA 4M72A 2V1NA 4DZPA 2HOSA 1MMAA 3QYBA 4ANJA 2K40A 3HRUA 3PL8A 4HQMA 3UR3C 2CUFA 4Q48A 1XMXA 2YS9A 2JUCA 2L4MA 3BQYA 2BOLA 4KN4X 5J4YA 1XD7A 4UV8A 5M5WJ 4IXAA 2AXTC 1S8NA 2VBXA 3ZMVA 2FMYA 3R6SA 2XAUA 2LYCA 4BS9A 2RQPA 1L0OC 1E17A 4WWCA 2JA2A 3OYAA 2CJJA 1DGRM 5LRRA 2W00A 2JMWA 1LEBA 4BY7J 3H5AA 1VFCA 3RYRA 3B73A 3O8HA 1IC8A 3H92A 4Y4RA 1LUJB 1YOVB 2XF5A 3OYEA 1Q1HA 4QWQA 2LRDA 3M3YJ 4II2A 3GBGA 5FD6A 2R7DA 3OYBA 2Y9YA 3FISA 1GV2A 3CMMA 2K9SA 3DKYA 4XIDA 5ICEA 1QPIA 2L02A 2LBFA 3K1MA 1ETWA 3QPSA 3ZQFA 2Y30A 2DO7A 3J80Z 4A3MJ 2WTEA 1XS9A 4Q47A 2RNGA 3MKWB 4P5OA 3TGNA 4IRHA 1OMIA 3KP2A 3KP6A 1XB4A 4D0PA 5D4SA 1ZREA 2L7MP 2YU9J 1HW1A 4A3LJ 1JXSA 5GPCA 5IP6A 4JBAA 1P4XA 2FA5A 4LIVA 3P5JA 2M87A 4F52A 3LSJA 3LSIA 3HTSB 3LA2A 3KFWX 1ZGJA 3DU5A 3JTHA 1TTYA 2QBYA 3SEZA 3RKYA 5IT9R 5EDNA 4DNCA 3DPUA 4G94A 1ZYRF 3DFGA 3QYEA 3IL2A 1J09A 3ZRGA 4RGRA 2JVHA 1YS6A 3FIWA 3OYKA 2CMPA 4J00A 2JQ7A 2M30A 5EEGA 1RETA 1O3QA 5HLIA 4X6AJ 3BTLA 2CV1A 3A02A 3JRGA 4Y33A 4FX4A 2HQNA 2GOXB 4HYEA 1G6NA 2LFBA 1TP4A 3LSHA 3ZQIA 1YJNI 4ZYAA 1MBJA 2OQRA 2JTVA 1W5SA 1MMNA 1VQ6I 3GTJJ 2G7UA 3LAJA 2OC6A 1G3SA 2YUSA 1QRYA 1ZG1A 3F3XA 2X85A 4L9JA 3G6EI 2HZTA 4E7LA 3H9JA 2QSHX 1R5ID 1KQ9A 2HXOA 1W1WE 2ID6A 5FGMA 3IH2A 1RQ6A 1OJLA 2QZ8A 1PDNC 1WZ2A 3H35A 3GVAA 3FXJA 3IRQA 1Z6TA 2D45A 2HVQA 3DBHB 1P6RA 1RNLA 3S17J 1G3WA 2ID3A 1YW8A 3TMOA 2ZMEB 2EFWA 2ZB9A 4HX7A 5ERIA 4PFOA 1SFOJ 1OCCH 2E71A 1K79A 2PMZN 3ECOA 3ZP5A 1MBEA 5E8GA 2X48A 1JUSA 2X98A 3HSFA 3L9FA 2VJJA 1J9IA 3O2PE 3CC7I 2AS5F 1HF0A 4HA8A 2O7OA 3EYIA 2WBMA 1VQMI 2MBFA 3K9TA 1G3TA 4QLCU 1X58A 2MA3A 1ETVA 2KQRA 3ERMA 3F6OA 3AFHA 4BBSJ 2O0YA 3FM5A 3K4CA 3OOPA 1SFEA 1SVOA 2IGOA 1XSVA 1E0EA 1TWFJ 3ABTA 3RZOJ 2XAFA 2FQ4A 3IH4A 4U88A 4O5VA 3GFLA 3R0JA 5AIQA 5BMZA 4ZZLA 5FLXR 5EF6A 1XDUA 3GFMA 4A0XA 4DBQA 1GT0C 4Y7NJ 5FB2A 1FT9A 2IA2A 4HAMA 1SEUA 3RIRA 2FF4A 4AVZA 2ISZA 1X3ZB 1PJRA 1T33A 2JUGA 3RCOA 1QO0D 2EIMH 4PJLA 1HLVA 1NK3P 2KIMA 2ELKA 3RPQA 1IAWA 5IT9K 3W2VA 2V7FA 3DTIA 2P0TA 3MKZA 2YSRA 5H2FC 2KKOA 2CV0A 1BR4A 3GMEA 3PSFA 2PX9A 2PQ8A 2QENA 1QZZA 4G6QA 5F6FA 4RLQA 4HNUA 1D0XA 1WRJA 4II3A 3ISPA 2JA7J 1FIPA 3CDHA 2G0EA 3AG2H 3BZKA 1SFUA 1RUNA 2DFEA 2HNHA 4A3BJ 4FT8A 3JREA 3BCBA 3FBNB 4PCQA 3SFZA 4KUMA 2A5YB 3IV5A 4BQNA 5E18F 4CH7A 3CCEI 3OYCA 3LSRA 3HRTA 4B4CA 1IW7F 1V5GA 2MYSA 2DODA 1H88C 1OISA 2M2EA 2LSOA 1WCMJ 2M4KA 4NB5A 2X1EA 1B59A 3OV8A 3S3NA 4C2TA 5IYDJ 1DP3A 1VZ0A 2XASA 3EUHA 5M3MJ 1B8IB 1HDDC 1BI0A 1UELB 3BR3A 2DK5A 1FY7A 1W7PB 3IKTA 1MDMB 5IP9J 3ZMUA 1RI7A 4PFPA 1OKRA 4B1RA 4IJAA 1B72A 3BWGA 1FC3A 3OIQA 1TWHJ 4BJ6C 1T2KA 1WVRA 3LSKA 4ZTFA 3C2BA 2KJCA 1R22A 1K83J 3N05A 4IEJA 2GBYA 3CJQB 5K1YA 1Y39A 5H20A 4BHCA 3HOTA 1SFXA 1FYKA 3HGGA 2CV2A 3S14J 4A2UA 3M1EA 1FP2A 5GTHC 3GLLA 3IUOA 3ABMH 3WTVC 4G7ZF 2M1BA 1IXSB 5DUKA 3V4GA 1X1BA 3HHGA 4A69C 2WAEA 1WKMA 3RYPA 1QHGA 2R5YB 2XKPA 2IA0A 4EJWA 2IGKA 4A3IJ 1IG7A 3FF5A 4C2UA 3J7AO 2K9LA 4UB6C 3V7RA 2NS0A 3Q0UA 5DS9A 3EUKL 4FCYA 1Y0NA 3WE2A 1O3RA 2M4GA 3PIPF 4BXFA 4BHPA 1R23A 4XONA 1ETYA 2F2EA 2L9VA 5FLXK 2FOWA 1EH6A 2Q2EB 2K02A 4ZZDA 2YX7A 4BJ5C 3BQZA 2HYFA 1RRJA 2KISA 3W2WA 1WI9A 2VC1A 1XGNA 3CO6C 5D6EA 4HPQA 3I56I 1S29A 2PJRB 3PQKA 3ZXSA 1SC7A 4N4NB 2P0WA 3E7LA 3BR6A 3RJPA 4HRIA 1SAUA 1Z6RA 3FXUA 3N4MA 1BM9A 3S32A 1ERDA 4YIIA 3F8NA 1B9MA 3GTQJ 3K70C 2Q8KA 2DT6A 2JSCA 4OIRF 1BI1A 3WG7H 4JX4A 1F5TA 5CQGA 3JSOA 2PFBA 1SMTA 3GZ6A 4EEFG 3JRAA 2P6SA 5EZHA 3ABKH 4OOIA 5TRDA 1DQUA 3L7WA 4LJZF 5GPAA 3G4SI 5E1ZB 3BR5A 3G1OA 1UG2A 4FHTA 3OL3A 3MVPA 2EFQA 4RGSA 3ZMDA 2RV8A 3HUGB 5D5UB 4HQEA 1Z3YA 3K70D 3L2UA 2R3SA 3B6AA 5D8KB 1TNTA 2JPCA 3G1LA 2K7LA 4UVAA 3VYRB 1BOBA 4J19A 2QVOA 1BI2A 1WJDA 3SXYA 3T5XA 3WE3A 3FWEA 1NK2P 1ZRCA 2IVMA 2CQQA 4RB3C 3WTXC 1IRGA 5EJCA 4M9SA 1I1SA 3AG1H 1XSDA 4HG2A 3SDBA 5DM6F 3H5NA 1IXRC 4IPAA 2X0LA 3BG9A 5JVTA 3RI4A 3KEOA 2FUG2 2HOTA 2OJED 1OYIA 1GXQA 3C7JA 2ICWG 3D5RC 2Y75A 4RAFA 4L5IA 2GA1A 3G1MA 2ZO4A 2DI3A 3BROA 4N0BA 1HW5A 2DOEA 2CGPA 4WXDA 1U78A 2VODA 2G9WA 1BR2A 2LY9A 2XRLA 4A3EJ 3FMRA 2LDUA 2EV5A 5F0HA 3TP0A 1OR7A 3OSFA 2EZHA 3ESWB 3S3OA 3BG5A 4LLLA 4A6EA 4CCOA 1D1BA 1W36C 2VQHA 3S3MA 2RAEA 1MGTA 2XAQA 3JRCA 4KMFA 4GO1A 5DD4A 4M73A 2MFZA 4XLPF 2NVUB 4HLXA 1P92A 3I53A 2QQ9A 5IT9Z 2OA4A 4NBQA 5EZGA 2ZMEA 1A04A 1YW7A 1YIJI 3L2QA 5B1AH 4RA2A 1P2FA 4KA4A 1T0FC 1Y6IA 1W36D 1XC5A 3S2WA 1MMDA 1NTCA 1K4TA 3F72A 2ZFUA 5CPRB 2DA2A 2DW4A 2Y31A 2KT0A 5F0CA 3I58A 3NQOA 3CUQC 3WU2C 4CCJA 2WADA 1Y8RB 3GFIA 3KX2A 2M0MA 3GWZA 3K1NA 4BDZA 1JUPA 2BVMA 5FROA 2VPLA 3RQIA 4WX9A 1MNDA 1R00A 2MGQA 2DYRH 2I10A 4A3DJ 3W3CA 4UY8I 2M7BA 3LSTA 1Z7LA 4PGHA 1U5TB 4XMYA 2WAFA 2I5UA 5LHIA 1PP7U 1RZ4A 2GWRA 4XKCA 1ZHFA 3NWTA 2DOFA 2QUFA 2LY2A 3T8TA 3E6MA 2IS2A 4XN0A 1O3TA 1WJBA 4DGWB 3OY9A 2BY0A 2DA1A 2W24A 4NUBA 1TT0A 1HCRA 1T38A 1RKWA 2ZXHA 2NVXJ 1E2XA 3NAUA 4OIOF 4ON0A 3MZHA 1YRNB 1LVKA 2LREA 3SJMA 1FEXA 3HOYJ 2VT2A 3KPHA 5DCFA 2MVTA 2K9QA 2FXAA 1AU7A 1U3EM 5F04A 2ELJA 5LHGA 3KIOA 2ME0A 3F9KA 3I9V2 2D1VA 2Y0SN 5TGTA 1Z21A 3WU1B 3TEDA 1ZR4A 3IC7A 2PMZA 3SEQA 1IZ1A 1Y56A 2HKOA 1P7IA 1X3WB 2X51A 3DLLF 2E7WA 3EETA 1JGSA 3QP5A 4M9XA 1R1TA 3F8FA 3T8RA 2HGCA 3DEEA 4M6XA 4OWRB 2RREA 4EVIA 4UB8C 2IEKA 1CQTA 4RB1A 1VQ8I 1OCTC 3HL2A 4XOTA 2L3DA 2BV6A 4R8HA 3OYLA 3PFYA 3CCUI 2XAHA 2TRTA 1WH7A 4AYBN 2F6CA 2XF6A 2OU2A 2E36A 3CJRB 3FX3A 4QPQA 3Q5FA 1T39A 2L5QA 1IRFA 1SVLA 1R5HA 1JKQC 5FLXZ 3FKIJ 1JKOC 1B8IA 1WJ5A 1ONVA 3QP6A 3VYSB 4OU0A 2VC0A 4EGYA 1AKHB 4LG3A 3NRVA 1YTYA 1W7PA 2P5KA 3J7AW 2E1CA 2WA0A 2K86A 3HOSA 2MABA 3ZGKA 5FLMJ 3R0AA 4AWXB 4XM3A 3J81R 1H9GA 1OQYA 4YIRX 2DJNA 2LP0A 5JHFA 4G9YA 1QPMA 2BGCA 3HRMA 5IPAA 2K3PA 2EK5A 4BEHB 1TQPA 2DMPA 3TO6A 3GFJA 1MBFA 5B3SH 2BYVE 1XN7A 2IGNA 4UXNA 1LKXA 3G3ZA 2XB0X 2A5WA 4GFBA 5J8FA 3WTSC 4IOAF 1G8XA 4HDUA 4O6JA 3QPTA 1VQNI 5CLSA 4I98B 1GV5A 1IJWC 2R5YA 1BL0A 1ZARA 3QQAA 2V1UA 2FEZA 2MLKA 4A0ZA 2LMDA 3JW4A 1P4AA 1YIOA 1QQIA 2VOOA 5FD5A 1TC3C 1R6RA 3SYTA 1XSXA 4GCVA 2VE8A 1PUEE 3V7CA 3MAJA 4BBRJ 1QVTA 2Q2EA 2EPFA 1I1GA 5LLQA 4Y15A 5JLXA 3KE2A 4PSWA 1O4XA 2VQLA 4D5FA 2UZKA 4UVCA 1HC8A 5E1XA 3K4LA 4KFCA 1ZKGA 1DGWY 1PYVA 2VBYA 3HXLA 1J0RA 3GW2A 2BY1A 3K2AA 2PJRA 2E34A 3TP3A 2B9SA 2A6HF 4IF4A 2E19A 3V8LA 3FM3A 2XSJC 5AIPA 2ZSHB 5DUIA 1R1UA 2EA2A 4HF0A 3TDZC 1G4DA 1LEAA 2HS5A 3CESA 3F23A 5J6XA 1AA7A 1B1BA 3HSEA 5L3FA 5E17F 3AG4H 4XR6A 1FLIA 2L54A 3TKYA 2ESNA 3GZ5A 2KDZA 3QOPA 1T56A 1YI2I 1Z3XA 1ZRFA 1SD5A 2L9SA 1ACIA 1ETKA 2Y69H 2F4IA 2RVCA 4JYKA 3JCUC 4KYWA 3VDXA 1YG2A 3G2BA 4M71A 2KRCA 3I59B 1DPUA 4P9FA 3HUGA 2RQQA 1V55H 1EKEA 4I99C 4D7NA 5FKNA 5M5XJ 4KITB 2YR2A 5GAEJ 3AL0B 2J5OA 4B47A 4LIUA 2E5ZA 3E5XA 3JR9A 2ZXIA 4YRVA 3KZIC 4IX7A 1VTNC 2HTSA 1SAXA 2OV7A 1RC9A 4KJZA 4MTEA 1XTAA 4CZZA 2KLOA 2O8KA 2R7SA 2XVCA 5HLHA 3K0LA 4AD9A 3HTUA 4M3EA 3RPUD 3J81K 2KRHA 2VJ5A 1V5EA 1FNNA 4C9YA 4XSXF 4BQQA 1WGXA 4L5EA 2XGXA 3M8JA 2BE5F 2PN6A 1BW6A 1BA5A 2W25A 4XRFA 1ZG3A 2CS3A 1MBKA 5D5VB 5K5OA 4XQFA 2MC4A 3ZQHA 1IV8A 2DT7B 3NWSA 2WAQN 2B7EA 3TQNA 2DDBA 1I5ZA 1K78B 3VODA 5F0FA 4XLEA 4S05A 3U2RA 1FJLA 1J7KA 4YIFA 1BIAA 2DLLA 4RBOA 2CFOA 5D4RA 3DCFA 3J7ZI 3TL4X 1STZA 4HBLA 1QNTA 2K3FA 2RGVA 1I27A 3MCZA 1ZTRA 3HIFA 1EV7A 4G6TB 1ZRDA 5IOYA 2XPWA 4BE0A 2I8DA 3H3VK 1O7FA 4PJNA 2E35A 3LQQA 4A3JJ 4LB5A 2W1OA 5L3GA 5F27A 4A93J 3KYDB 1K7AA 4RAGA 2DXIA 2QKMB 4L0YB 3CCSI 3SHFA 1JHHA 5FKLA 3CCVI 1IF1A 4UV9A 3LFKA 5E20A 1IN8A 2MZ4A 3HPHA 2HDWA 3H0GJ 1SVMA 2V4JC 2E1NA 2BZTA 4L18B 2L0KA 3JSPA 3EDPA 3CO7C 3PO3J 2LH9A 1TWAJ 2A05A 2VBZA 2X9DA 1GLNA 2DDAA 3DBRB 4HOBA 4LK0F 5CVIA 5L3BA 1HQCA 2H09A 1R9TJ 3E5UA 1IGNA 2WC2A 5IYCJ 1ON1A 2VT3A 3AG3H 1OCRH 1HSTA 2EH3A 3FBIB 5DM7F 4BE2A 1ZN2A 2ZNZA 4V2GA 4A3KJ 1TLHB 5F08A 3HYIA 4V19K 3PJRA 2V9PA 1VQOI 2ADUA 3KZYA 2E1MB 4LGWA 3BT9A 5HDKA 1FMWA 2VKHA 1U5TA 4AIDA 2FBKA 1WJCA 1M1EB 1YFHA 3BZCA 2DFIA 2KMUA 1X19A 1R4MB 4BQAA 1A36A 2KP6A 3KP3A 3FKJA 2E1OA 3F8BA 1J5YA 2NNYA 1SANA 4N9IA 4RGUA 3GTPJ 3FXQA 3A0BC 5B5EC 4RGXA 3A2KA 3KP7A 1IN5A 4RB2C 3I4MJ 1YRNA 5HS8A 1FSEA 5FFZA 3DQVC 2G7HA 4MHGA 1LVAA 4BE1A 3M7GA 2KIFA 3BR2A 3K69A 4MEYF 4JOMA 3RSNA 2DK8A 2R5ZB 1EF4A 2DA7A 1XG1A 4CDGA 2P7VB 2GXBA 1Z67A 2EV6A 2FD5A 2JRMA 2HWVA 3L2RA 4XLHA 2HU9A 1X4OA 3EUAA 4LK1F 2W57A 3GX4X 3E6BA 4E7IA 1I3AA 2FJ1A 2A68F 4FASD 2QEXI 2LG4A 3BG6A 3FXLA 2COBA 3U9GA 2XRNA 1TQIA 5D5WB 1MJAA 2HDDA 2KFDA 3K4BA 5AONA 2NVTJ 3DBLB 4P55A 1Y1WJ 2ZJRF 3VSLA 4BJTA 1DP7P 2IRFG 4OIQF 5LFAA 4CCMA 1MJ9A 3F8MA 1F1ZA 2K27A 2KIUA 4X1EA 3TO9A 1AKHA 1NG7A 4ESJA 1GXPA 1VQPI 2BXYA 1B6AA 1YO5C 3GZNB 1R71A 3PM1A 1ON2A 1XMKA 2DMTA 4V2FA 1G2HA 5E8IA 3M4OJ 4HSTA 2IP2A 2LLKA 1FSHA 3OIPA 3CDIA 4BEHA 1WPKA 4IHTA 2A07F 2DFFA 2VOPA 3C2HA 4HV6A 3W6KB 4E7JA 1C0WA 2X1DA 2Y0SA 2MD0A 2L4AA 2PEXA 2E2HJ 4LD5A 2K4JA 1BI3A 3FXMA 4H4KC 4U7DA 3H9QA 1IN6A 3S8PA 4R79A 2DFHA 3HOZJ 4G7OF 4HLYA 3IWZA 1P9QC 4NQWB 1YJ9I 4I6ZA 1ZLKA 5ED4A 4MGRA 1S5LC 3ZN1A 2UWMA 1X1PA 3ZMSA 4AYBA 2A6TA 1HDPA 1U6GA 2QSGX 3A52A 2OCEA 4HF2A 2VB6A 2ESHA 5BNGA 5LHHA 2X4HA 2JRTA 1T95A 2EINH 5K7ZA 1WJAA 2NS7A 3D5LA 3I71A 2KRFA 2V79A 3TOAA 1QZEA 2VI6A 4JK1X 1VQLI 1JTXA 3G73A 2DJIA 1A35A 1YW9A 3K7AJ 2DA4A 4TV7A 4ZH4F 2DOAA 2UV1A 3J81Z 2KPMA 2CWEA 2RNJA 5BQTA 3T1BA 2FOKA 3CCJI 1XGSA 2D1HA 2STTA 4XOPA 2DMNA 2R92J 3EPZA 4OAZA 2O3FA 1TW3A 1K61A 3HGYA 3DTKA 4HX8A 1WFXA 3HOUJ 3WGGA 5JFRA 2F5FA 2UUZA 1JGGA 1YX5A 3F8CA 4I01A 4XICA 4BHBA 1X1AA 3EUHC 1KZHA 1V4RA 3OSGA 4CHUA 3MKLA 2ZC2A 3CJNA 1D1AA 2M9HA 2PBIA 3MWMA 4XRMA 2OF7A 3I59A 5GP9A 2XPUA 4YFXF 4ZYGA 2XC7A 1MJBA 1P4WA 4A5MA 5K5RA 4DJAA 3WG9A 1ITYA 1IUFA 2VQCA 4R1HA 2LOOA 3I64A 2PLYA 2Z9OA 1S9HA 2Z1DA 2GXAA 2RKHA 4MFEA 3P9IA 2CQ7A 1BC8C 3V7SA 2EZLA 2ECBA 3G71I 1O3SA 3HG9A 3JTGA 1WHUA 4UNOA 4OIPF 4DYQA 2DA3A 3S1RJ 2Z3YA 3K4MA 3JRFA 3BR1A 2MW8A 2XPVA 2AQEA 2FX0A 2XROA 3AKZA 2FE3A 2LK2A 2YPRA 3FXRA 5EGOB 2N8GA 3HOXJ 3J80R 4CCKA 5EEHA 1FX7A 2BBYA 3FZVA 5C3EJ 4CSWA 5EYRA 3DXJF 1D0ZA 4EATA 2NAZA 2NOGA 3ZOBA 2BHZA 4I0AA 3PFIA 3WGIA 4LITA 1LB2A 4RM2A 2VJ4A 1FMVA 4H0EA 4A5NA 3B6CA 3RKQA 4QIWN 2DYSH 2F5DA 2OD5A 4AC0A 4LLGF 1K78A 1KU7A 1IUYA 1KYWA 3EYYA 4OMYA 3LFUA 1IXCA 3H3UA 4IQJA 1YHQI 2VUMJ 2ZSIB 5BS6A 3GLXA 4HZFA 1D5YA 5JI6A 3PO2J 1F43A 2EWNA 2NS8A 3N97A 1X1DA 4ZDOA 4ENKA 3V42A 3GYHX 2CSOA 1ZGWA 4I09A 3FMSA 2P5LC 2EILH 1QU3A 2F4OB 4D9JA 3KYLA 3OR2C 4CA0A 1K6OA 2LKPA 3K10A 5FRNA 2DCEA 4BKXA 1IV6A 5J1YA 4F55A 4EJTA 3KZZA 1LFUP 4DBRA 2UXXA 1JKRC 2FNAA 1E3HA 2W7NA 4EGZA 1D8KA 2ELHA 4E7KA 2HKXA 4KIFA 3DTEA 1AOYA 2HOEA 4EM0B 1X3UA 4WK8F 2AXLA 4N4OB 2IGMA 4KICA 3V8KA 3HOWJ 1R1VA 4M3GA 1HSJA 1ZAOA 3MFKA 5FO5A 3P7NA 5B1BH 2OZUA 2WAQA 2XSDC 4XLCA 3M07A 1MSEC 4BQOA 3WHBA 2O03A 2ZCWA 3M8FA 4PSXA 2GXGA 4XNFA 5CQEA 4HNVA 5J1RA 5LGTA 3C18A 1LDJA 2HTJA 1OFCX 2FNPA 3I3LA 1LE8B 2QCOA 5DV5A 2QKLB 1V5FA 4ZDPA 3ROUA 1RUOA 2HDCA 4ETSA 5GTIC 2DA5A 4LB6B 4L0ZB 2QA4I 2R7FA 2MG4A 4YELA 4OINF 1XGMA 2JN6A 3QAHA 3LSPA 2L7ZA 3TW6A 2R93J 1XX5A 2CH0A 3RKXA 3ABUA 5EG0B 3LSMA 1KA8A 3I55I 1YQAA 1DU6A 2Z2SB 5FKKA 1I6XA 4XBFA 2CUEA 3OS0A 2R7RA 2X6XA 1VQ5I 4EJOA 4WF2A 4L9NA 5CVUA 2L7FP 2YX4A 3WTYC 3DV8A 2VQGA 4DOZA 3F21A 2Z99A 3CP2A 2V9VA 3BPVA 1R7JA 4NC8A 5IY5H 1H0MA 3BC8A 1JTYA 3QU3A 2R5ZA 3DLAA 3IWFA 1ODDA 1JHFA 4D1QA 2FMLA 5ICGA 2GLOA 2O9LA 4MFDA 5DD8A 1D3YA 4RAZA 1BIBA 4HSRA 2ME6A 1EA3A 1APLC 1OR7C 3Q0VA 3S15J 5D5XB 1FZPB 4IHWA 2BHYA 4ENJA 3BPXA 1DU0A 4KDPA 1T98A 4KISA 2CYYA 1EH7A 2XAGA 3ZQ7A 3MMYB 5HNFA 5BPDA 1F9NA 5LBQA 3GTOJ 4NHJA 5DYMA 5H6QA 3U1DA 2DAOA 3CLOA 3FHNA 3DEUA 3H5RA 4B09A 1H8AC 1T8IA 4EM1A 5CKTA 1BBYA 4FQGA 2O5RA 2HOAA 2M0CA 2HYJA 2ZMEC 3LWFA 5K7FA 3FHZA 3ERED 1JT0A 2E60A 3ZQLA 4CO8A 3IAM2 2AHQA 3IRRA 1XGOA 2VIXA 5E1WA 4CCLA 3CF5F 1EJ9A 1YE9A 3CD6I 1Z05A 1ETOA 2FBIA 4NDLA 1TL8A 1MD0A 2F5EA 2D5VA 3CCYA 1MBGA 1Q1VA 4CYDA 5ILVA 2X6WA 4MO7A 4CYCB 2XDVA 5HDGA 2ISYA 4MNUA 4BY1J 2B63J 3CF2A 5DTDA 4XK4A 1A6IA 3F6VA 3H36A 4PZJA 2O6GE 3D0SA 2OTJI 4XKWA 1TNSA 1WWXA 2L7KA 2FU4A 2QYOA 2RN7A 4NQWA 2A61A 5HLGA 1YX3A 2W85A 2Y9ZA 2R7ZJ 1S7AA 4AVPA 2ZJ2A 1XDSA 3LA3A 3VPRA 5FRMA 2PMHA 4BL0B 4CICA 2OCCH 3LMMA 3WODF 3RDIA 2CRGA 1KYZA 2ZJPF 5E79C 4DW6A 1MNMC 3JRIA 3H3ZA 1XMAA 4E6KG 4A3GJ 2PJPA 1I50J 4P96A 4CUGA 4ZJZA 3ECHA 1HXDA 4IZZA 4A12A 1N78A 3U21A 2MH2A 2HI3A 5C4JJ 4ENMA 5HVQC 5M3FJ 1Z1DA 2HQ5A 3FXOA 4FX0A 4YFKF 5LGUA 3GTKJ 2WWYA 4PGGA 4QTRA 1O7LA 2F5VA 1JJ6C 2C6YA 1YJWI 3GTMJ 4B8XA 3CC4I 3E6CC 2WB1N 5E3OA 5KNLA 5J47A 1X2NA 2OAZA 1OLTA 2WV1A 3M1CA 2M8GX 2QM3A 4OMZA 4XRSG 4C30A 2DPDA 1X4PA 2XAJA 2MLGA 1K6YA 3HBLA 3RKWA 3CLQA 2DN0A 3VYUB 2IS1A 2RDPA 1Z91A 3M8EA 3RPUA 4EM2A 3MQ0A 5CVRA 2GZWA 1U2WA 2OZ6A 1F36A 2K4BA 3K2ZA 4AUXA 4F91B 2DU9A 4XSZF 3CMYA 4PJ0C 2DTRA 3HPGA 2JWTA 2K9MA 1JI8A 2JZYA 4IO9F 3KEQA 1W0TA 1FOWA 2P7CB 2LKSA 2LKXA 3CP8A 2EZKA 3H9GA 1TQMA 1NHAA 2H1LA 3OYJA 1HKTA 4LMYA 4M6VA 2QF7A 4M74A 1BJAA 2E7XA 3ZPLA 2LF7A 3BZ6A 4G7HF 2Y2ZA 5FJ8J 3IKVA 4CXFA 4IKFA 3RZDJ 2ZXWH 2OPTA 3HKZN 3VB2A 1U9NA 3IAS2 3TDUC 3LSGA 4F92B 4GGGA 4M3FA 2V26A 1GUUA 2XGEA 1LNWA 2BW3A 5HOOA 5EGOA 2L9RA 5DCMB 5C44J 1CF7B 2XUBA 2R0QC 5K5QA 2EQRA 1W4MA 1VI0A 1UMQA 3V8JA 2GAUA 5F1RA 4C2MJ 2H6BA 2DMQA 2ZJQF 1UHWA 2NVYJ 3P9KA 4DZJA 3GTGJ 2A6EF 4U0WA 4O3MA 1PUFB 2DQLA 3VSKA 1FTZA 1KU3A 1FTTA 2FSWA 1QBJA 3PUBA 1GVDA 2F48A 2J5PA 3A01B 5FFXA 2NRAC 2JK3A 3IP4B 2E2IJ 3D5SC 1MIJA 3CC2I 3ULQB 2XGDA 1FOXA 2M8EA 2VE9A 4FISA 1LPQA 4XL9A 3PNYA 2NNNA 2M3AA 4P1WA 2P4WA 2DA6A 4Y52J 3BTCA 5L3EA 1FPQA 3OYFA 2VN2A 3I4PA 1ETXA 5D6FA 1GHCA 2JPBA 4W1UA 1D0YA 1Z0XA 3WTZA 3HHHA 1XCVA 3LQRA 1QGPA 2KL4A 5F1JA 2VBWA 4RM3A 5JR3A 4AM3A 1Z77A 3FDYA 1ZK8A 3BR0A 2XF7A 3K6GA 4RLFA 2W48A 1E3PA 3O6BB 1MZBA 4LOCA 2IXSA 1JE8A 1ZQ3P 3GTLJ 1S3JA 4PDKA 4B3XA 5J4VA 3RTRA 3OMYA 5J8CA 2W84A 1BJZA 3K1PA 4OAYA 3ABLH 2QGUA 4HF1A 2VKEA 2KJBA 1X2MA 1R5GA 1MMSA 4ZTJA 3SFIA 1G59A 1RKTA 3OYDA 3OS1A 3ZQQA 1Z9CA 1U9OA 3A0HC 5E3LA 3Q9SA 2IT0A 1FOYA 3MN2A 4EV0A 1VQ4I 3K4NA 3ML6A 4DIQA 2F4MB 5LGNA 4MLOA 4BH9A 2IS4A 2DMUA 4BXXJ 4MEXF 2EV0A 2H6CA 2F5CA 2BY3A 4PJMA 3H0DA 1REPC 3E97A 1LE8A 1Y8QB 1T6SA 2KZGA 3CUQB 2IBDA 3E1SA 4XN3A 1WSUA 4EJVA 1USSA 2V6CA 3GO5A 2ETHA 1A6QA 2LD5A 3W6VA 3BJAA 2HEOA 5EG0A 3BTIA 5FKMA 4D5CA 5LD2C 5F64A 5LEKA 2OQGA 1D5VA 1RR8C 4F7ZA 2R7TA 4LG0B 2JT1A 1AHDP 4E7SA 2X1CA 4GRIA 3VYTB 2NYXA 4MQVA 3OS2A 3OYIA 1UZCA 2PMUA 1BC7C 3ZQCA 1IN7A 5KAIC 3HZJA 2NVQJ 2Y48A 4D7MA 4HX4A 1SD4A 5KCMA 2XKOA 4RMNA 3DP7A 3UKGA 1VQKI 2EZIA 1HKQA 1QHHD 1S7EA 4EQQA 1L3LA 1G3YA 2CU7A 1IO2A 3VWBA 2EA4A 3BCAA 1YYVA 1KU2A 1UB9A 3ASOH 4I76A 4JX5A 1J75A 3S93A 1NG6A 1OCOH 2P8TA 4IRGA 5GAHJ 2GOMA 2EJRA 4F3QA 2DPUA 1FYLA 3T0YA 3PNTA 4IVNA 2FBHA 2HVSA 4I02A 4MQ9F 2ZNYA 2STWA 3ZQGA 1FWZA 4UHTA 1ZG5A 2H8WA 5IT3A 2XHKA 1TT5B 2KHMA 5K7HA 4S0HB 4U7BA 3QPHA 4XKBA 2H94A 2Z33A 2HPMA 3BY6A 5ICFA 3R4KA 3A4CA 4L5JA 1ULYA 4DYRA 1VQ7I 4YG2F 2JA8J 5ILSA 2P5VA 3HEFA 3JRDA 4AIKA 2BXZA 5C4XJ 1PP8F 5CJ9A 4ZC3A 4WCGA 4UUTA 3LNQA 2JA6J 4IHYA 2VONA 2MSYA 2R7QA 3FXKA 3OR1C 2ACJA 3C3WA 3L2CA 3ZCOA 1GDTA 2XV4S 1MH4A 4UUVA 3CDLA 4ZDLA 2PI0A 1N77A 9ANTA 5HLTA 4CYCA 1N25A 1YLFA 4XKVA 3BJ6A 3SZTA 1BW5A 1U5TC 1XPXA 1QA6A 2XGCA 3HB9A 5B66C 1FIAA 2IS6A 5TJJA 5LEJA 5IOZA 3PNVA 1X1CA 1KONA 2VXZA 3B02A 4EJUA 5A2QR 4UUSA 1KU9A 1QVUA 2HYGD 2UXNA 1IN4A 4U87A 5CVJA 6PAXA 1N75A 4PUSA 3P9CA 3U1KA 1MMGA 3E3VA 5KAFC 3MZYA 2LF8A 3TOBA 4BXUA 4BDYA 5FLVA 3TO7A 2M34A 2CO5A 3R61A 3VEPA 5KVRA 1D8JA 1ENHA 1J2XA 3C2GA 4LFUA 3QRFF 1SMYF 1RIOH 2NOJB 5GADJ 1U0JA 4B43A 2JSPA 4K2EA 3KP5A 3CMAI 2CQNA 5M5YJ 3LL7A 1KQ8A 3GF2A 4F93B 2Y0MA 1BN5A 4M3DA 4E70A 1MSFC 3S1MJ 1B9NA 3KLOA 1B4AA 2V6EA 1TWGJ 3S2DJ 2W4SA 1XCBA 3I4NJ 2M5WA 2GA2A 4L9TA 4IL6C 1ZGAA 3BLYA 3L00A 3PQJA 1W0UA 5CYVA 4FTHA 5HODA 2VJIA 2W82A 2QQ8A 5ICCA 4PJJA 3HJEA 3MD2A 2L01A 3E5QA 5E3NA 3KYCB 3K4JA 1Z7UA 1IDZA 2GIVA 2MH9A 3JAMR 2OUMA 3QYFA 4NNJA 3QU6A 2M45A 1MBHA 1V3FA 2HXIA 3TW7A 4Q4ZF 3L2WA 1UHSA 2DT5A 1LDDA 2MUNA 1V54H 3C1DA 3FK7A 3A03A 3DKXA 4YEJA 5J40A 5LRSA 4BUPA 3E0JB 2NXNB 1A5JA 3X2QH 4GYGA 4M6YA 1ZELA 1O57A 4E4HA 3VOEA 5FKOA 1IRZA 4QPOA 3F22A 3S1QJ 3AAFA 1A31A 2QQAA 3IH3A 2CQXA 2FRHA 5DCMA 3ZN0A 4BYYA 1CF7A 2CW0F 1FBQA 1D1CA 2L9NA 4G12A 4A0YA 3I54A 3CQZJ 3L1PA 2LTPA 3CTAA 2WB1A 1S72I 1UJ8A 3KLNA 3S16J 5BPIA 4JX6A 5CVVA 2GQQA 2COMA 1JUMA 1PUFA 4LLNA 1WH5A 2HQRA 3OYMA 3I5UA 3LAPA 4BGDA 3DWLE 2MD5A 3GCMA 3A01A 4FETA 2HPIA 3HC7A 3DEWA 2KZVA 3DPLC 1BR1A 2VKVA 2TDXA 2KDOA 5A2QK 4CZCA 3CCLI 1CGPA 2H27A 1LFBA 2K85A 3KP4A 4YFNF 1AWCA 2O8XA 3L09A 4IQ4A 4S04A 4G8XA 4HEA2 4RDUA 1I3QJ 2BW3B 1Y0UA 1GVJA 3HRSA 3J7YJ 4M3BA 3OIOA 1TBXA 5ILUA 2OBPA 2VPRA 1E3OC 4QSHA 3ELKA 2AQFA 4BNCA 1LDKB 2ECCA 3REOA 3SQNA 4B3AA 3HDDA 2DQRA 4AIHA 2GM4A 2R7OA 1U8RA 4E7HA 3HKZA 2M7AA 1VQ9I 1BOAA 2V9KA 3WTTC 2HZDA 5E3MA 2BEOA 3JRHA 2IA1A 3PIOF 2D2WA 5L3CA 1VF9A 3W2AA 1WQ2A 3BP8A 1ZLJA 4WXHA 1I6HJ 1LJ9A 5HNHA 3IHUA 2QSFX 5HDNA 2K5CA
chains in the Genus database with same CATH topology
2ZBKA 3JAMK 5H6RA 2EFOA 4I2OA 4GYIA 1T0FA 4UVBA 2CQKA 4MTDA 1KGSA 4AIJA 4P9UA 5JHUA 1HW2A 3CUQA 3WGHA 2A3SA 1UCRA 2IJLA 3FMQA 2Z5UA 1DDNA 3GEZA 3KETA 3GUDA 4IRIA 1UHMA 2B0LA 2EFPA 2A69F 2V1XA 3E6DA 4LG0A 3R60A 3GXOA 5BOXA 2QBYB 2FQ3A 5HS9A 1EH8A 2QLZA 4KT5C 3SZPA 3CUOA 2P6TA 1MKMA 3W6JB 2V1DA 1R58A 4G6DA 5D8LB 4Q5SF 4ESBA 1SD7A 3VFZA 4ASNA 1ZH5A 2IW5A 2CG4A 3BDDA 4WXCA 1S7OA 4EMSA 1FYMA 3J80K 1FP1D 4RAYA 4N9HA 5DEQA 4BAYA 1DUXC 2EFNA 4ENNA 1J59A 2ZXJA 3NEUA 2XIGA 3DF8A 3HSRA 2DBBA 1HBXG 2QWWA 4I7HA 3COAC 2WV0A 4A6DA 3MEXA 2ZFWA 2ZKZA 4RS8A 4KMUX 1F4KA 1R36A 4ZYDA 3EQLF 4GXOA 4KN7X 2LNBA 3ZMZA 4CGZA 1QZYA 3DKWA 4RB0A 1SD6A 4ESFA 4ZYEA 4Y13A 1HKSA 1OYYA 1USTA 1FOKA 4KIGA 3WTWC 5HS7A 2EB7A 1YS7A 5L3DA 2YU3A 3BOQA 1DPRA 5DDGA 4Y17A 4KIBA 2Q0OA 1KQ0A 3M9AA 3WTUC 5KK1A 2PG4A 1LQ1A 4ZYHA 1MDMA 4IHSA 2O61A 4Z2YA 5A2QZ 4M9ZA 3Q9VA 1S6LA 3BJOA 3ZMTA 4HW0A 2RC4A 1UFMA 4XLNF 2HFHA 4JQFA 3O3KA 1OYWA 2QQBA 3WU0A 3KCCA 1FBUA 2HR3A 4DQ2A 4U0YA 4L9VA 1FBSA 1W5TA 2MC3A 4HV5A 3LA7A 2CFXA 4KNYA 1H9TA 1OPCA 3I0TA 2IPQX 1TW2A 4I0BA 3JAMZ 4U0VA 3DPTA 4HDVA 1W7PD 4M72A 3HRUA 4HQMA 4Q48A 2L4MA 4KN4X 1XD7A 4UV8A 4IXAA 1S8NA 2VBXA 3ZMVA 2FMYA 3R6SA 2RQPA 1L0OC 1E17A 4WWCA 5LRRA 1LEBA 3RYRA 3B73A 3H92A 1Q1HA 4QWQA 5FD6A 2R7DA 5ICEA 2L02A 3K1MA 2DO7A 3J80Z 2WTEA 4Q47A 4P5OA 3TGNA 4IRHA 1OMIA 3KP2A 3KP6A 1XB4A 4D0PA 5D4SA 1ZREA 1HW1A 1JXSA 4JBAA 1P4XA 2FA5A 2M87A 3HTSB 3LA2A 3KFWX 1ZGJA 3JTHA 1TTYA 2QBYA 3RKYA 4DNCA 4G94A 1ZYRF 3DFGA 3IL2A 4RGRA 1YS6A 2M30A 5EEGA 1O3QA 5HLIA 4FX4A 2HQNA 4HYEA 1G6NA 2OQRA 2JTVA 1W5SA 2G7UA 3LAJA 1G3SA 1ZG1A 3F3XA 4L9JA 2HZTA 1KQ9A 5FGMA 2QZ8A 1PDNC 3GVAA 3IRQA 1Z6TA 2D45A 1P6RA 1RNLA 1G3WA 1YW8A 2ZMEB 2EFWA 5ERIA 4HX7A 1K79A 3ECOA 3ZP5A 5E8GA 3HSFA 3L9FA 1J9IA 3O2PE 2AS5F 4HA8A 3EYIA 2MBFA 3K9TA 1G3TA 4QLCU 2MA3A 3F6OA 2O0YA 3FM5A 3OOPA 1SFEA 1XSVA 3ABTA 2XAFA 4U88A 4O5VA 3GFLA 3R0JA 5AIQA 5BMZA 4ZZLA 1XDUA 3GFMA 4A0XA 5FB2A 1FT9A 2IA2A 4HAMA 3RIRA 2FF4A 2ISZA 1QO0D 2KIMA 1IAWA 3RPQA 5IT9K 2YSRA 2KKOA 2PQ8A 2QENA 1QZZA 4G6QA 5F6FA 1WRJA 3ISPA 3CDHA 1SFUA 1RUNA 4FT8A 4PCQA 3SFZA 4KUMA 2A5YB 5E18F 3HRTA 1IW7F 2LSOA 4NB5A 1B59A 3OV8A 2XASA 3EUHA 1BI0A 2DK5A 1FY7A 1W7PB 3IKTA 1MDMB 3ZMUA 1RI7A 1OKRA 4IJAA 3BWGA 1FC3A 1T2KA 2KJCA 1R22A 5K1YA 5H20A 4BHCA 3HOTA 1SFXA 1FYKA 4A2UA 3M1EA 1FP2A 3WTVC 4G7ZF 2M1BA 1IXSB 5DUKA 3V4GA 3HHGA 1WKMA 3RYPA 2XKPA 2IA0A 4EJWA 3FF5A 3J7AO 3V7RA 2NS0A 3WE2A 1O3RA 4BHPA 1R23A 2F2EA 5FLXK 1EH6A 2K02A 4ZZDA 2YX7A 2HYFA 1WI9A 2VC1A 1XGNA 3CO6C 5D6EA 1S29A 3PQKA 3RJPA 1Z6RA 3FXUA 3N4MA 1BM9A 4YIIA 3F8NA 1B9MA 2Q8KA 2JSCA 4OIRF 1BI1A 1F5TA 3JSOA 2PFBA 1SMTA 3GZ6A 2P6SA 4OOIA 5TRDA 3L7WA 4LJZF 5E1ZB 4FHTA 2EFQA 4RGSA 3ZMDA 2RV8A 5D5UB 4HQEA 2R3SA 5D8KB 1TNTA 2JPCA 2K7LA 4UVAA 2QVOA 1BI2A 3SXYA 3T5XA 3WE3A 3FWEA 1ZRCA 2IVMA 4RB3C 3WTXC 1IRGA 4M9SA 1I1SA 1XSDA 1IXRC 4IPAA 2X0LA 5JVTA 3RI4A 3KEOA 1OYIA 1GXQA 3C7JA 2Y75A 4L5IA 2GA1A 2ZO4A 2DI3A 3BROA 4N0BA 1HW5A 2CGPA 4WXDA 1U78A 2VODA 2G9WA 3FMRA 2LDUA 2EV5A 1OR7A 4LLLA 4A6EA 1MGTA 2XAQA 4KMFA 4GO1A 5DD4A 4M73A 4XLPF 4HLXA 1P92A 3I53A 2QQ9A 5IT9Z 2OA4A 2ZMEA 1A04A 1YW7A 1P2FA 4KA4A 3S2WA 3F72A 2DW4A 3I58A 3NQOA 3CUQC 3GFIA 3GWZA 3K1NA 4WX9A 1R00A 3LSTA 4PGHA 1U5TB 5LHIA 1PP7U 1RZ4A 2GWRA 1ZHFA 2QUFA 3T8TA 3E6MA 1O3TA 2W24A 1T38A 1E2XA 4OIOF 4ON0A 3MZHA 2VT2A 5DCFA 2FXAA 1U3EM 5LHGA 2D1VA 3WU1B 3IC7A 1IZ1A 2HKOA 2E7WA 3EETA 1JGSA 3QP5A 4M9XA 1R1TA 3F8FA 3T8RA 2HGCA 4M6XA 4EVIA 4RB1A 2L3DA 2BV6A 4R8HA 2XAHA 2OU2A 3FX3A 1T39A 3Q5FA 1IRFA 1R5HA 5FLXZ 1ONVA 3QP6A 4OU0A 2VC0A 4EGYA 3NRVA 1YTYA 1W7PA 2P5KA 2E1CA 2K86A 3HOSA 3R0AA 4AWXB 1H9GA 4G9YA 1QPMA 2BGCA 3HRMA 2EK5A 1TQPA 3TO6A 3GFJA 2BYVE 1XN7A 4UXNA 3G3ZA 5J8FA 3WTSC 4HDUA 4O6JA 3QPTA 5CLSA 4I98B 1ZARA 2V1UA 2FEZA 2MLKA 4A0ZA 3JW4A 1P4AA 1YIOA 1QQIA 2VOOA 5FD5A 1XSXA 4GCVA 2VE8A 1PUEE 3V7CA 3MAJA 2Q2EA 1I1GA 5LLQA 4Y15A 3KE2A 2UZKA 4UVCA 5E1XA 4KFCA 2VBYA 1J0RA 3GW2A 2A6HF 4IF4A 3V8LA 3FM3A 5AIPA 5DUIA 1R1UA 2EA2A 3TDZC 4HF0A 1G4DA 1LEAA 2HS5A 3F23A 5J6XA 1B1BA 3HSEA 5L3FA 5E17F 1FLIA 2L54A 3TKYA 2ESNA 3GZ5A 3QOPA 1ZRFA 1SD5A 2RVCA 4KYWA 1YG2A 4M71A 1DPUA 3I59B 4P9FA 3HUGA 2YR2A 2J5OA 3E5XA 1VTNC 2HTSA 1SAXA 4MTEA 4CZZA 2XVCA 5HLHA 3K0LA 4AD9A 3HTUA 3J81K 1FNNA 4XSXF 2XGXA 2BE5F 2PN6A 2W25A 4XRFA 1ZG3A 5D5VB 5K5OA 3TQNA 1I5ZA 1K78B 3VODA 4S05A 3U2RA 1J7KA 4YIFA 1BIAA 2DLLA 5D4RA 1STZA 4HBLA 1QNTA 2RGVA 1I27A 3MCZA 3HIFA 1EV7A 1ZRDA 1O7FA 3LQQA 4LB5A 5L3GA 1K7AA 4L0YB 3SHFA 1JHHA 1IF1A 4UV9A 3LFKA 5E20A 1IN8A 2E1NA 4L18B 3JSPA 3EDPA 3CO7C 2VBZA 4HOBA 4LK0F 5CVIA 5L3BA 1HQCA 2H09A 3E5UA 2WC2A 1ON1A 2VT3A 1HSTA 1ZN2A 2ZNZA 1TLHB 3HYIA 2ADUA 3KZYA 4LGWA 5HDKA 1U5TA 2FBKA 1YFHA 2DFIA 4BQAA 3KP3A 2NNYA 3F8BA 1J5YA 4N9IA 4RGUA 3FXQA 4RGXA 3KP7A 1IN5A 4RB2C 5HS8A 1FSEA 5FFZA 3DQVC 2G7HA 4MHGA 1LVAA 3M7GA 2KIFA 3K69A 4MEYF 2DK8A 4CDGA 2P7VB 2GXBA 2EV6A 2HWVA 4LK1F 2W57A 3GX4X 3E6BA 2A68F 3U9GA 2XRNA 1TQIA 5D5WB 1MJAA 5AONA 4P55A 1DP7P 2IRFG 4OIQF 1MJ9A 3F8MA 1F1ZA 2K27A 2KIUA 3TO9A 4ESJA 1GXPA 1B6AA 1YO5C 1ON2A 1XMKA 5E8IA 2IP2A 1FSHA 4IHTA 2A07F 2VOPA 4HV6A 3W6KB 1C0WA 2L4AA 2PEXA 4LD5A 2K4JA 1BI3A 4U7DA 1IN6A 4R79A 4G7OF 4HLYA 3IWZA 1ZLKA 5ED4A 4MGRA 3ZN1A 2UWMA 3ZMSA 1U6GA 4HF2A 2ESHA 5LHHA 2X4HA 2JRTA 3D5LA 3I71A 2KRFA 2V79A 3TOAA 4JK1X 3G73A 1YW9A 4TV7A 4ZH4F 3J81Z 2CWEA 2RNJA 5BQTA 3T1BA 2FOKA 1XGSA 2D1HA 2STTA 2O3FA 1TW3A 4HX8A 3WGGA 5JFRA 2F5FA 4I01A 3F8CA 4BHBA 1V4RA 4CHUA 3CJNA 2PBIA 3MWMA 3I59A 4YFXF 4ZYGA 1MJBA 1P4WA 4A5MA 5K5RA 3WG9A 4R1HA 2Z9OA 3I64A 2PLYA 2RKHA 3P9IA 1BC8C 3V7SA 1O3SA 3JTGA 4UNOA 4OIPF 2Z3YA 2XROA 2FE3A 2YPRA 3FXRA 5EEHA 1FX7A 2BBYA 3FZVA 3DXJF 2NAZA 4I0AA 3PFIA 3WGIA 1LB2A 4H0EA 4A5NA 2F5DA 2OD5A 4LLGF 1K78A 1KU7A 1IUYA 1KYWA 3EYYA 4OMYA 1IXCA 3H3UA 5BS6A 3GLXA 4HZFA 5JI6A 2EWNA 3N97A 4ENKA 3GYHX 2CSOA 4I09A 3FMSA 2P5LC 1K6OA 2LKPA 4EJTA 3KZZA 2UXXA 2FNAA 4EGZA 1D8KA 2ELHA 2HKXA 4KIFA 1AOYA 2HOEA 4EM0B 1X3UA 4WK8F 2AXLA 4KICA 3V8KA 1R1VA 1HSJA 1ZAOA 3MFKA 5FO5A 3P7NA 2OZUA 2O03A 2ZCWA 3M8FA 2GXGA 5LGTA 1LDJA 3C18A 2HTJA 2FNPA 5DV5A 3ROUA 1RUOA 2HDCA 4ETSA 4LB6B 4L0ZB 2R7FA 4OINF 1XGMA 3QAHA 3RKXA 3ABUA 1KA8A 1YQAA 4XBFA 1I6XA 4EJOA 4WF2A 4L9NA 5CVUA 2YX4A 3WTYC 3F21A 3DV8A 2Z99A 2V9VA 3BPVA 1R7JA 1H0MA 3QU3A 3IWFA 1ODDA 1JHFA 2FMLA 5ICGA 5DD8A 1D3YA 4RAZA 1BIBA 5D5XB 1FZPB 4ENJA 3BPXA 4KDPA 1T98A 2CYYA 1EH7A 2XAGA 3ZQ7A 5BPDA 1F9NA 5LBQA 4NHJA 5DYMA 5H6QA 3U1DA 2DAOA 3CLOA 3DEUA 4B09A 4EM1A 1BBYA 3LWFA 3FHZA 3ERED 4CO8A 3IRRA 1XGOA 5E1WA 1Z05A 2FBIA 1MD0A 2F5EA 4CYDA 5ILVA 5HDGA 2ISYA 4MNUA 3F6VA 4PZJA 2O6GE 3D0SA 1TNSA 1WWXA 2FU4A 2QYOA 2RN7A 4NQWA 2A61A 5HLGA 2W85A 1S7AA 4AVPA 2ZJ2A 1XDSA 3LA3A 2PMHA 4CICA 3WODF 3RDIA 1KYZA 3H3ZA 1XMAA 2PJPA 4P96A 3ECHA 1HXDA 4A12A 2MH2A 4ENMA 5HVQC 1Z1DA 4FX0A 4YFKF 5LGUA 2WWYA 4PGGA 1O7LA 2C6YA 4B8XA 3E6CC 2OAZA 4OMZA 2QM3A 2DPDA 2XAJA 2MLGA 3RKWA 2RDPA 1Z91A 3M8EA 3RPUA 4EM2A 3MQ0A 5CVRA 2GZWA 1U2WA 2OZ6A 2K4BA 3K2ZA 2DU9A 4XSZF 2DTRA 2JZYA 3KEQA 2P7CB 1TQMA 1NHAA 1HKTA 4LMYA 4M74A 1BJAA 2E7XA 3ZPLA 2LF7A 3BZ6A 4G7HF 3IKVA 4CXFA 3VB2A 3TDUC 4GGGA 1LNWA 5HOOA 5DCMB 1CF7B 2XUBA 5K5QA 1W4MA 3V8JA 2GAUA 5F1RA 2H6BA 1UHWA 3P9KA 2A6EF 4U0WA 4O3MA 2DQLA 1KU3A 2FSWA 1QBJA 2NRAC 2J5PA 5FFXA 3ULQB 2M8EA 2VE9A 2NNNA 2P4WA 5L3EA 1FPQA 2VN2A 3I4PA 5D6FA 1GHCA 2JPBA 3WTZA 3HHHA 1XCVA 3LQRA 1QGPA 2VBWA 5JR3A 3O6BB 1JE8A 1MZBA 1S3JA 4PDKA 3RTRA 5J8CA 2W84A 3K1PA 4HF1A 2KJBA 1R5GA 1Z9CA 3Q9SA 2IT0A 4EV0A 3ML6A 5LGNA 4BH9A 4MEXF 2EV0A 2H6CA 2F5CA 1REPC 3E97A 1T6SA 3CUQB 1WSUA 4EJVA 1USSA 2V6CA 3GO5A 2ETHA 3BJAA 2HEOA 5F64A 5LEKA 2OQGA 1D5VA 4F7ZA 4LG0B 2JT1A 2NYXA 4MQVA 1BC7C 2PMUA 1IN7A 2Y48A 4HX4A 1SD4A 2XKOA 3DP7A 1HKQA 4EQQA 1L3LA 1G3YA 2EA4A 1YYVA 1KU2A 1UB9A 1J75A 2P8TA 4IRGA 2EJRA 2DPUA 1FYLA 3T0YA 4IVNA 2FBHA 4I02A 4MQ9F 2ZNYA 2STWA 1FWZA 4UHTA 1ZG5A 5IT3A 2XHKA 4U7BA 3QPHA 2H94A 2Z33A 3BY6A 5ICFA 3R4KA 4L5JA 1ULYA 4YG2F 5ILSA 2P5VA 4AIKA 1PP8F 5CJ9A 4WCGA 2VONA 2ACJA 3C3WA 3L2CA 2XV4S 4UUVA 2PI0A 1YLFA 3BJ6A 3SZTA 1U5TC 5TJJA 5LEJA 3B02A 2VXZA 4EJUA 1KU9A 2HYGD 2UXNA 1IN4A 5CVJA 6PAXA 3P9CA 3E3VA 3MZYA 2LF8A 3TOBA 4BXUA 3TO7A 2CO5A 3R61A 3VEPA 5KVRA 1D8JA 1J2XA 4LFUA 3QRFF 1SMYF 1RIOH 4K2EA 3KP5A 1KQ8A 3GF2A 2Y0MA 1BN5A 4E70A 1B9NA 3KLOA 1B4AA 1XCBA 2M5WA 2GA2A 4L9TA 1ZGAA 3L00A 3PQJA 5CYVA 5ICCA 2L01A 3E5QA 1Z7UA 2GIVA 2MH9A 3QU6A 2M45A 1V3FA 4Q4ZF 2DT5A 1LDDA 3C1DA 5LRSA 4GYGA 4M6YA 1O57A 3VOEA 3F22A 3AAFA 2QQAA 2FRHA 3ZN0A 5DCMA 4BYYA 1CF7A 2CW0F 1FBQA 4A0YA 3I54A 3CTAA 3KLNA 5BPIA 5CVVA 2GQQA 2COMA 4LLNA 2HQRA 3I5UA 3LAPA 2MD5A 3DPLC 2TDXA 5A2QK 1CGPA 2H27A 3KP4A 4YFNF 1AWCA 2O8XA 3L09A 4S04A 4G8XA 1Y0UA 1GVJA 3HRSA 1TBXA 5ILUA 2OBPA 3ELKA 4BNCA 1LDKB 3REOA 3SQNA 2DQRA 4AIHA 1U8RA 1BOAA 3WTTC 2BEOA 2IA1A 2D2WA 5L3CA 1WQ2A 3BP8A 1ZLJA 4WXHA 1LJ9A 3IHUA 5HDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBK A;  3JAM K;  5H6R A;  2EFO A;  4I2O A;  4GYI A;  1T0F A;  4UVB A;  2CQK A;  4MTD A;  1KGS A;  4AIJ A;  4P9U A;  5JHU A;  1HW2 A;  3CUQ A;  3WGH A;  2A3S A;  1UCR A;  2IJL A;  3FMQ A;  2Z5U A;  1DDN A;  3GEZ A;  3KET A;  3GUD A;  4IRI A;  1UHM A;  2B0L A;  2EFP A;  2A69 F;  2V1X A;  3E6D A;  4LG0 A;  3R60 A;  3GXO A;  5BOX A;  2QBY B;  2FQ3 A;  5HS9 A;  1EH8 A;  2QLZ A;  4KT5 C;  3SZP A;  3CUO A;  2P6T A;  1MKM A;  3W6J B;  2V1D A;  1R58 A;  4G6D A;  5D8L B;  4Q5S F;  4ESB A;  1SD7 A;  3VFZ A;  4ASN A;  1ZH5 A;  2IW5 A;  2CG4 A;  3BDD A;  4WXC A;  1S7O A;  4EMS A;  1FYM A;  3J80 K;  1FP1 D;  4RAY A;  4N9H A;  5DEQ A;  4BAY A;  1DUX C;  2EFN A;  4ENN A;  1J59 A;  2ZXJ A;  3NEU A;  2XIG A;  3DF8 A;  3HSR A;  2DBB A;  1HBX G;  2QWW A;  4I7H A;  3COA C;  2WV0 A;  4A6D A;  3MEX A;  2ZFW A;  2ZKZ A;  4RS8 A;  4KMU X;  1F4K A;  1R36 A;  4ZYD A;  3EQL F;  4GXO A;  4KN7 X;  2LNB A;  3ZMZ A;  4CGZ A;  1QZY A;  3DKW A;  4RB0 A;  1SD6 A;  4ESF A;  4ZYE A;  4Y13 A;  1HKS A;  1OYY A;  1UST A;  1FOK A;  4KIG A;  3WTW C;  5HS7 A;  2EB7 A;  1YS7 A;  5L3D A;  2YU3 A;  3BOQ A;  1DPR A;  5DDG A;  4Y17 A;  4KIB A;  2Q0O A;  1KQ0 A;  3M9A A;  3WTU C;  5KK1 A;  2PG4 A;  1LQ1 A;  4ZYH A;  1MDM A;  4IHS A;  2O61 A;  4Z2Y A;  5A2Q Z;  4M9Z A;  3Q9V A;  1S6L A;  3BJO A;  3ZMT A;  4HW0 A;  2RC4 A;  1UFM A;  4XLN F;  2HFH A;  4JQF A;  3O3K A;  1OYW A;  2QQB A;  3WU0 A;  3KCC A;  1FBU A;  2HR3 A;  4DQ2 A;  4U0Y A;  4L9V A;  1FBS A;  1W5T A;  2MC3 A;  4HV5 A;  3LA7 A;  2CFX A;  4KNY A;  1H9T A;  1OPC A;  3I0T A;  2IPQ X;  1TW2 A;  4I0B A;  3JAM Z;  4U0V A;  3DPT A;  4HDV A;  1W7P D;  4M72 A;  3HRU A;  4HQM A;  4Q48 A;  2L4M A;  4KN4 X;  1XD7 A;  4UV8 A;  4IXA A;  1S8N A;  2VBX A;  3ZMV A;  2FMY A;  3R6S A;  2RQP A;  1L0O C;  1E17 A;  4WWC A;  5LRR A;  1LEB A;  3RYR A;  3B73 A;  3H92 A;  1Q1H A;  4QWQ A;  5FD6 A;  2R7D A;  5ICE A;  2L02 A;  3K1M A;  2DO7 A;  3J80 Z;  2WTE A;  4Q47 A;  4P5O A;  3TGN A;  4IRH A;  1OMI A;  3KP2 A;  3KP6 A;  1XB4 A;  4D0P A;  5D4S A;  1ZRE A;  1HW1 A;  1JXS A;  4JBA A;  1P4X A;  2FA5 A;  2M87 A;  3HTS B;  3LA2 A;  3KFW X;  1ZGJ A;  3JTH A;  1TTY A;  2QBY A;  3RKY A;  4DNC A;  4G94 A;  1ZYR F;  3DFG A;  3IL2 A;  4RGR A;  1YS6 A;  2M30 A;  5EEG A;  1O3Q A;  5HLI A;  4FX4 A;  2HQN A;  4HYE A;  1G6N A;  2OQR A;  2JTV A;  1W5S A;  2G7U A;  3LAJ A;  1G3S A;  1ZG1 A;  3F3X A;  4L9J A;  2HZT A;  1KQ9 A;  5FGM A;  2QZ8 A;  1PDN C;  3GVA A;  3IRQ A;  1Z6T A;  2D45 A;  1P6R A;  1RNL A;  1G3W A;  1YW8 A;  2ZME B;  2EFW A;  5ERI A;  4HX7 A;  1K79 A;  3ECO A;  3ZP5 A;  5E8G A;  3HSF A;  3L9F A;  1J9I A;  3O2P E;  2AS5 F;  4HA8 A;  3EYI A;  2MBF A;  3K9T A;  1G3T A;  4QLC U;  2MA3 A;  3F6O A;  2O0Y A;  3FM5 A;  3OOP A;  1SFE A;  1XSV A;  3ABT A;  2XAF A;  4U88 A;  4O5V A;  3GFL A;  3R0J A;  5AIQ A;  5BMZ A;  4ZZL A;  1XDU A;  3GFM A;  4A0X A;  5FB2 A;  1FT9 A;  2IA2 A;  4HAM A;  3RIR A;  2FF4 A;  2ISZ A;  1QO0 D;  2KIM A;  1IAW A;  3RPQ A;  5IT9 K;  2YSR A;  2KKO A;  2PQ8 A;  2QEN A;  1QZZ A;  4G6Q A;  5F6F A;  1WRJ A;  3ISP A;  3CDH A;  1SFU A;  1RUN A;  4FT8 A;  4PCQ A;  3SFZ A;  4KUM A;  2A5Y B;  5E18 F;  3HRT A;  1IW7 F;  2LSO A;  4NB5 A;  1B59 A;  3OV8 A;  2XAS A;  3EUH A;  1BI0 A;  2DK5 A;  1FY7 A;  1W7P B;  3IKT A;  1MDM B;  3ZMU A;  1RI7 A;  1OKR A;  4IJA A;  3BWG A;  1FC3 A;  1T2K A;  2KJC A;  1R22 A;  5K1Y A;  5H20 A;  4BHC A;  3HOT A;  1SFX A;  1FYK A;  4A2U A;  3M1E A;  1FP2 A;  3WTV C;  4G7Z F;  2M1B A;  1IXS B;  5DUK A;  3V4G A;  3HHG A;  1WKM A;  3RYP A;  2XKP A;  2IA0 A;  4EJW A;  3FF5 A;  3J7A O;  3V7R A;  2NS0 A;  3WE2 A;  1O3R A;  4BHP A;  1R23 A;  2F2E A;  5FLX K;  1EH6 A;  2K02 A;  4ZZD A;  2YX7 A;  2HYF A;  1WI9 A;  2VC1 A;  1XGN A;  3CO6 C;  5D6E A;  1S29 A;  3PQK A;  3RJP A;  1Z6R A;  3FXU A;  3N4M A;  1BM9 A;  4YII A;  3F8N A;  1B9M A;  2Q8K A;  2JSC A;  4OIR F;  1BI1 A;  1F5T A;  3JSO A;  2PFB A;  1SMT A;  3GZ6 A;  2P6S A;  4OOI A;  5TRD A;  3L7W A;  4LJZ F;  5E1Z B;  4FHT A;  2EFQ A;  4RGS A;  3ZMD A;  2RV8 A;  5D5U B;  4HQE A;  2R3S A;  5D8K B;  1TNT A;  2JPC A;  2K7L A;  4UVA A;  2QVO A;  1BI2 A;  3SXY A;  3T5X A;  3WE3 A;  3FWE A;  1ZRC A;  2IVM A;  4RB3 C;  3WTX C;  1IRG A;  4M9S A;  1I1S A;  1XSD A;  1IXR C;  4IPA A;  2X0L A;  5JVT A;  3RI4 A;  3KEO A;  1OYI A;  1GXQ A;  3C7J A;  2Y75 A;  4L5I A;  2GA1 A;  2ZO4 A;  2DI3 A;  3BRO A;  4N0B A;  1HW5 A;  2CGP A;  4WXD A;  1U78 A;  2VOD A;  2G9W A;  3FMR A;  2LDU A;  2EV5 A;  1OR7 A;  4LLL A;  4A6E A;  1MGT A;  2XAQ A;  4KMF A;  4GO1 A;  5DD4 A;  4M73 A;  4XLP F;  4HLX A;  1P92 A;  3I53 A;  2QQ9 A;  5IT9 Z;  2OA4 A;  2ZME A;  1A04 A;  1YW7 A;  1P2F A;  4KA4 A;  3S2W A;  3F72 A;  2DW4 A;  3I58 A;  3NQO A;  3CUQ C;  3GFI A;  3GWZ A;  3K1N A;  4WX9 A;  1R00 A;  3LST A;  4PGH A;  1U5T B;  5LHI A;  1PP7 U;  1RZ4 A;  2GWR A;  1ZHF A;  2QUF A;  3T8T A;  3E6M A;  1O3T A;  2W24 A;  1T38 A;  1E2X A;  4OIO F;  4ON0 A;  3MZH A;  2VT2 A;  5DCF A;  2FXA A;  1U3E M;  5LHG A;  2D1V A;  3WU1 B;  3IC7 A;  1IZ1 A;  2HKO A;  2E7W A;  3EET A;  1JGS A;  3QP5 A;  4M9X A;  1R1T A;  3F8F A;  3T8R A;  2HGC A;  4M6X A;  4EVI A;  4RB1 A;  2L3D A;  2BV6 A;  4R8H A;  2XAH A;  2OU2 A;  3FX3 A;  1T39 A;  3Q5F A;  1IRF A;  1R5H A;  5FLX Z;  1ONV A;  3QP6 A;  4OU0 A;  2VC0 A;  4EGY A;  3NRV A;  1YTY A;  1W7P A;  2P5K A;  2E1C A;  2K86 A;  3HOS A;  3R0A A;  4AWX B;  1H9G A;  4G9Y A;  1QPM A;  2BGC A;  3HRM A;  2EK5 A;  1TQP A;  3TO6 A;  3GFJ A;  2BYV E;  1XN7 A;  4UXN A;  3G3Z A;  5J8F A;  3WTS C;  4HDU A;  4O6J A;  3QPT A;  5CLS A;  4I98 B;  1ZAR A;  2V1U A;  2FEZ A;  2MLK A;  4A0Z A;  3JW4 A;  1P4A A;  1YIO A;  1QQI A;  2VOO A;  5FD5 A;  1XSX A;  4GCV A;  2VE8 A;  1PUE E;  3V7C A;  3MAJ A;  2Q2E A;  1I1G A;  5LLQ A;  4Y15 A;  3KE2 A;  2UZK A;  4UVC A;  5E1X A;  4KFC A;  2VBY A;  1J0R A;  3GW2 A;  2A6H F;  4IF4 A;  3V8L A;  3FM3 A;  5AIP A;  5DUI A;  1R1U A;  2EA2 A;  3TDZ C;  4HF0 A;  1G4D A;  1LEA A;  2HS5 A;  3F23 A;  5J6X A;  1B1B A;  3HSE A;  5L3F A;  5E17 F;  1FLI A;  2L54 A;  3TKY A;  2ESN A;  3GZ5 A;  3QOP A;  1ZRF A;  1SD5 A;  2RVC A;  4KYW A;  1YG2 A;  4M71 A;  1DPU A;  3I59 B;  4P9F A;  3HUG A;  2YR2 A;  2J5O A;  3E5X A;  1VTN C;  2HTS A;  1SAX A;  4MTE A;  4CZZ A;  2XVC A;  5HLH A;  3K0L A;  4AD9 A;  3HTU A;  3J81 K;  1FNN A;  4XSX F;  2XGX A;  2BE5 F;  2PN6 A;  2W25 A;  4XRF A;  1ZG3 A;  5D5V B;  5K5O A;  3TQN A;  1I5Z A;  1K78 B;  3VOD A;  4S05 A;  3U2R A;  1J7K A;  4YIF A;  1BIA A;  2DLL A;  5D4R A;  1STZ A;  4HBL A;  1QNT A;  2RGV A;  1I27 A;  3MCZ A;  3HIF A;  1EV7 A;  1ZRD A;  1O7F A;  3LQQ A;  4LB5 A;  5L3G A;  1K7A A;  4L0Y B;  3SHF A;  1JHH A;  1IF1 A;  4UV9 A;  3LFK A;  5E20 A;  1IN8 A;  2E1N A;  4L18 B;  3JSP A;  3EDP A;  3CO7 C;  2VBZ A;  4HOB A;  4LK0 F;  5CVI A;  5L3B A;  1HQC A;  2H09 A;  3E5U A;  2WC2 A;  1ON1 A;  2VT3 A;  1HST A;  1ZN2 A;  2ZNZ A;  1TLH B;  3HYI A;  2ADU A;  3KZY A;  4LGW A;  5HDK A;  1U5T A;  2FBK A;  1YFH A;  2DFI A;  4BQA A;  3KP3 A;  2NNY A;  3F8B A;  1J5Y A;  4N9I A;  4RGU A;  3FXQ A;  4RGX A;  3KP7 A;  1IN5 A;  4RB2 C;  5HS8 A;  1FSE A;  5FFZ A;  3DQV C;  2G7H A;  4MHG A;  1LVA A;  3M7G A;  2KIF A;  3K69 A;  4MEY F;  2DK8 A;  4CDG A;  2P7V B;  2GXB A;  2EV6 A;  2HWV A;  4LK1 F;  2W57 A;  3GX4 X;  3E6B A;  2A68 F;  3U9G A;  2XRN A;  1TQI A;  5D5W B;  1MJA A;  5AON A;  4P55 A;  1DP7 P;  2IRF G;  4OIQ F;  1MJ9 A;  3F8M A;  1F1Z A;  2K27 A;  2KIU A;  3TO9 A;  4ESJ A;  1GXP A;  1B6A A;  1YO5 C;  1ON2 A;  1XMK A;  5E8I A;  2IP2 A;  1FSH A;  4IHT A;  2A07 F;  2VOP A;  4HV6 A;  3W6K B;  1C0W A;  2L4A A;  2PEX A;  4LD5 A;  2K4J A;  1BI3 A;  4U7D A;  1IN6 A;  4R79 A;  4G7O F;  4HLY A;  3IWZ A;  1ZLK A;  5ED4 A;  4MGR A;  3ZN1 A;  2UWM A;  3ZMS A;  1U6G A;  4HF2 A;  2ESH A;  5LHH A;  2X4H A;  2JRT A;  3D5L A;  3I71 A;  2KRF A;  2V79 A;  3TOA A;  4JK1 X;  3G73 A;  1YW9 A;  4TV7 A;  4ZH4 F;  3J81 Z;  2CWE A;  2RNJ A;  5BQT A;  3T1B A;  2FOK A;  1XGS A;  2D1H A;  2STT A;  2O3F A;  1TW3 A;  4HX8 A;  3WGG A;  5JFR A;  2F5F A;  4I01 A;  3F8C A;  4BHB A;  1V4R A;  4CHU A;  3CJN A;  2PBI A;  3MWM A;  3I59 A;  4YFX F;  4ZYG A;  1MJB A;  1P4W A;  4A5M A;  5K5R A;  3WG9 A;  4R1H A;  2Z9O A;  3I64 A;  2PLY A;  2RKH A;  3P9I A;  1BC8 C;  3V7S A;  1O3S A;  3JTG A;  4UNO A;  4OIP F;  2Z3Y A;  2XRO A;  2FE3 A;  2YPR A;  3FXR A;  5EEH A;  1FX7 A;  2BBY A;  3FZV A;  3DXJ F;  2NAZ A;  4I0A A;  3PFI A;  3WGI A;  1LB2 A;  4H0E A;  4A5N A;  2F5D A;  2OD5 A;  4LLG F;  1K78 A;  1KU7 A;  1IUY A;  1KYW A;  3EYY A;  4OMY A;  1IXC A;  3H3U A;  5BS6 A;  3GLX A;  4HZF A;  5JI6 A;  2EWN A;  3N97 A;  4ENK A;  3GYH X;  2CSO A;  4I09 A;  3FMS A;  2P5L C;  1K6O A;  2LKP A;  4EJT A;  3KZZ A;  2UXX A;  2FNA A;  4EGZ A;  1D8K A;  2ELH A;  2HKX A;  4KIF A;  1AOY A;  2HOE A;  4EM0 B;  1X3U A;  4WK8 F;  2AXL A;  4KIC A;  3V8K A;  1R1V A;  1HSJ A;  1ZAO A;  3MFK A;  5FO5 A;  3P7N A;  2OZU A;  2O03 A;  2ZCW A;  3M8F A;  2GXG A;  5LGT A;  1LDJ A;  3C18 A;  2HTJ A;  2FNP A;  5DV5 A;  3ROU A;  1RUO A;  2HDC A;  4ETS A;  4LB6 B;  4L0Z B;  2R7F A;  4OIN F;  1XGM A;  3QAH A;  3RKX A;  3ABU A;  1KA8 A;  1YQA A;  4XBF A;  1I6X A;  4EJO A;  4WF2 A;  4L9N A;  5CVU A;  2YX4 A;  3WTY C;  3F21 A;  3DV8 A;  2Z99 A;  2V9V A;  3BPV A;  1R7J A;  1H0M A;  3QU3 A;  3IWF A;  1ODD A;  1JHF A;  2FML A;  5ICG A;  5DD8 A;  1D3Y A;  4RAZ A;  1BIB A;  5D5X B;  1FZP B;  4ENJ A;  3BPX A;  4KDP A;  1T98 A;  2CYY A;  1EH7 A;  2XAG A;  3ZQ7 A;  5BPD A;  1F9N A;  5LBQ A;  4NHJ A;  5DYM A;  5H6Q A;  3U1D A;  2DAO A;  3CLO A;  3DEU A;  4B09 A;  4EM1 A;  1BBY A;  3LWF A;  3FHZ A;  3ERE D;  4CO8 A;  3IRR A;  1XGO A;  5E1W A;  1Z05 A;  2FBI A;  1MD0 A;  2F5E A;  4CYD A;  5ILV A;  5HDG A;  2ISY A;  4MNU A;  3F6V A;  4PZJ A;  2O6G E;  3D0S A;  1TNS A;  1WWX A;  2FU4 A;  2QYO A;  2RN7 A;  4NQW A;  2A61 A;  5HLG A;  2W85 A;  1S7A A;  4AVP A;  2ZJ2 A;  1XDS A;  3LA3 A;  2PMH A;  4CIC A;  3WOD F;  3RDI A;  1KYZ A;  3H3Z A;  1XMA A;  2PJP A;  4P96 A;  3ECH A;  1HXD A;  4A12 A;  2MH2 A;  4ENM A;  5HVQ C;  1Z1D A;  4FX0 A;  4YFK F;  5LGU A;  2WWY A;  4PGG A;  1O7L A;  2C6Y A;  4B8X A;  3E6C C;  2OAZ A;  4OMZ A;  2QM3 A;  2DPD A;  2XAJ A;  2MLG A;  3RKW A;  2RDP A;  1Z91 A;  3M8E A;  3RPU A;  4EM2 A;  3MQ0 A;  5CVR A;  2GZW A;  1U2W A;  2OZ6 A;  2K4B A;  3K2Z A;  2DU9 A;  4XSZ F;  2DTR A;  2JZY A;  3KEQ A;  2P7C B;  1TQM A;  1NHA A;  1HKT A;  4LMY A;  4M74 A;  1BJA A;  2E7X A;  3ZPL A;  2LF7 A;  3BZ6 A;  4G7H F;  3IKV A;  4CXF A;  3VB2 A;  3TDU C;  4GGG A;  1LNW A;  5HOO A;  5DCM B;  1CF7 B;  2XUB A;  5K5Q A;  1W4M A;  3V8J A;  2GAU A;  5F1R A;  2H6B A;  1UHW A;  3P9K A;  2A6E F;  4U0W A;  4O3M A;  2DQL A;  1KU3 A;  2FSW A;  1QBJ A;  2NRA C;  2J5P A;  5FFX A;  3ULQ B;  2M8E A;  2VE9 A;  2NNN A;  2P4W A;  5L3E A;  1FPQ A;  2VN2 A;  3I4P A;  5D6F A;  1GHC A;  2JPB A;  3WTZ A;  3HHH A;  1XCV A;  3LQR A;  1QGP A;  2VBW A;  5JR3 A;  3O6B B;  1JE8 A;  1MZB A;  1S3J A;  4PDK A;  3RTR A;  5J8C A;  2W84 A;  3K1P A;  4HF1 A;  2KJB A;  1R5G A;  1Z9C A;  3Q9S A;  2IT0 A;  4EV0 A;  3ML6 A;  5LGN A;  4BH9 A;  4MEX F;  2EV0 A;  2H6C A;  2F5C A;  1REP C;  3E97 A;  1T6S A;  3CUQ B;  1WSU A;  4EJV A;  1USS A;  2V6C A;  3GO5 A;  2ETH A;  3BJA A;  2HEO A;  5F64 A;  5LEK A;  2OQG A;  1D5V A;  4F7Z A;  4LG0 B;  2JT1 A;  2NYX A;  4MQV A;  1BC7 C;  2PMU A;  1IN7 A;  2Y48 A;  4HX4 A;  1SD4 A;  2XKO A;  3DP7 A;  1HKQ A;  4EQQ A;  1L3L A;  1G3Y A;  2EA4 A;  1YYV A;  1KU2 A;  1UB9 A;  1J75 A;  2P8T A;  4IRG A;  2EJR A;  2DPU A;  1FYL A;  3T0Y A;  4IVN A;  2FBH A;  4I02 A;  4MQ9 F;  2ZNY A;  2STW A;  1FWZ A;  4UHT A;  1ZG5 A;  5IT3 A;  2XHK A;  4U7B A;  3QPH A;  2H94 A;  2Z33 A;  3BY6 A;  5ICF A;  3R4K A;  4L5J A;  1ULY A;  4YG2 F;  5ILS A;  2P5V A;  4AIK A;  1PP8 F;  5CJ9 A;  4WCG A;  2VON A;  2ACJ A;  3C3W A;  3L2C A;  2XV4 S;  4UUV A;  2PI0 A;  1YLF A;  3BJ6 A;  3SZT A;  1U5T C;  5TJJ A;  5LEJ A;  3B02 A;  2VXZ A;  4EJU A;  1KU9 A;  2HYG D;  2UXN A;  1IN4 A;  5CVJ A;  6PAX A;  3P9C A;  3E3V A;  3MZY A;  2LF8 A;  3TOB A;  4BXU A;  3TO7 A;  2CO5 A;  3R61 A;  3VEP A;  5KVR A;  1D8J A;  1J2X A;  4LFU A;  3QRF F;  1SMY F;  1RIO H;  4K2E A;  3KP5 A;  1KQ8 A;  3GF2 A;  2Y0M A;  1BN5 A;  4E70 A;  1B9N A;  3KLO A;  1B4A A;  1XCB A;  2M5W A;  2GA2 A;  4L9T A;  1ZGA A;  3L00 A;  3PQJ A;  5CYV A;  5ICC A;  2L01 A;  3E5Q A;  1Z7U A;  2GIV A;  2MH9 A;  3QU6 A;  2M45 A;  1V3F A;  4Q4Z F;  2DT5 A;  1LDD A;  3C1D A;  5LRS A;  4GYG A;  4M6Y A;  1O57 A;  3VOE A;  3F22 A;  3AAF A;  2QQA A;  2FRH A;  3ZN0 A;  5DCM A;  4BYY A;  1CF7 A;  2CW0 F;  1FBQ A;  4A0Y A;  3I54 A;  3CTA A;  3KLN A;  5BPI A;  5CVV A;  2GQQ A;  2COM A;  4LLN A;  2HQR A;  3I5U A;  3LAP A;  2MD5 A;  3DPL C;  2TDX A;  5A2Q K;  1CGP A;  2H27 A;  3KP4 A;  4YFN F;  1AWC A;  2O8X A;  3L09 A;  4S04 A;  4G8X A;  1Y0U A;  1GVJ A;  3HRS A;  1TBX A;  5ILU A;  2OBP A;  3ELK A;  4BNC A;  1LDK B;  3REO A;  3SQN A;  2DQR A;  4AIH A;  1U8R A;  1BOA A;  3WTT C;  2BEO A;  2IA1 A;  2D2W A;  5L3C A;  1WQ2 A;  3BP8 A;  1ZLJ A;  4WXH A;  1LJ9 A;  3IHU A;  5HDN A; 
#chains in the Genus database with same CATH topology
 2JA5 J;  2ZBK A;  2GIZ A;  3S1N J;  3JAM K;  3A1Y A;  5IP7 J;  5H6R A;  2EFO A;  2H8R A;  4I2O A;  4GYI A;  2OTL I;  3D1N I;  1T0F A;  2LVS A;  4GDF A;  2LBF B;  4UVB A;  4C3I J;  2CQK A;  3AL0 C;  1OCZ H;  4MTD A;  1KGS A;  1ETQ A;  4AIJ A;  4P9U A;  5JHU A;  1Y1V J;  2EBI A;  1HW2 A;  3CUQ A;  3WGH A;  2A3S A;  4A3F J;  3KEY A;  1UCR A;  2IJL A;  2LR8 A;  2LC2 A;  2EIK H;  3FMQ A;  2Z5U A;  1DDN A;  3GEZ A;  3KET A;  4J01 A;  4IOC F;  3GUD A;  2EIJ H;  2DTZ A;  4IRI A;  1OCP A;  1UHM A;  2B0L A;  2EFP A;  2A69 F;  2CW7 A;  2V1X A;  3E6D A;  4LG0 A;  3R60 A;  1TZL A;  3H1C A;  3GXO A;  4ABZ A;  5BOX A;  2QBY B;  2FQ3 A;  5HS9 A;  1EH8 A;  2QLZ A;  4KT5 C;  3SZP A;  3CUO A;  3MZ8 A;  2P6T A;  1UAA A;  3PUF A;  1MKM A;  3W6J B;  1IDY A;  5J1U A;  2V1D A;  1R58 A;  4BAC A;  1YIT I;  4G6D A;  1WJF A;  5D8L B;  3Q0W A;  3QWL A;  4Q5S F;  4ESB A;  1SD7 A;  1UG0 A;  3HM5 A;  3VFZ A;  2VLA A;  3CME I;  2E2J J;  4ASN A;  1ZH5 A;  4FE7 A;  1PVE A;  1R49 A;  2IW5 A;  2CG4 A;  4IHX A;  3BDD A;  2CUZ A;  4WXC A;  3HOV J;  1S7O A;  4EMS A;  1FYM A;  3J80 K;  1FP1 D;  3OL4 A;  4N9H A;  4RAY A;  2VL8 A;  5DEQ A;  4MIM A;  1JT6 A;  3BG7 A;  4BAY A;  4Y3O A;  1DUX C;  2EFN A;  1HOM A;  5GAG J;  4ENN A;  1VND A;  4XLA A;  5EEA A;  1J59 A;  2ZXJ A;  3NEU A;  1K4S A;  2XIG A;  3DF8 A;  3HSR A;  3OYH A;  2DBB A;  2WY7 Q;  1H89 C;  3L2V A;  1HBX G;  2QWW A;  4I7H A;  3COA C;  4ITV A;  2WV0 A;  4A6D A;  5IYB J;  3BG3 A;  1WJE A;  2CW8 A;  3CJT B;  3MEX A;  2X6Y A;  2R7X A;  1JKP C;  2ZFW A;  3OYN A;  4Z6Y A;  4JP0 A;  2XB5 A;  1POG A;  2E1M C;  1RPW A;  2ZKZ A;  4RS8 A;  4KMU X;  2LY1 A;  1F4K A;  1ZR2 A;  1R36 A;  1R4N B;  4ZYD A;  3EQL F;  1WI3 A;  4GXO A;  4KN7 X;  2HQA A;  2LNB A;  4PK4 A;  1HA8 A;  5JVG F;  3ZMZ A;  4CGZ A;  1QZY A;  3DKW A;  4IHV A;  4RB0 A;  2KIQ A;  3F0C A;  3S2H J;  1SD6 A;  2BY2 A;  4W97 A;  4ESF A;  3O8G A;  4ZYE A;  4Y13 A;  3J7A Y;  1HKS A;  1OYY A;  1UST A;  3ONQ A;  2VKD A;  3BTJ A;  2E5N A;  1FOK A;  4KIG A;  2H1K A;  2Q1Z B;  4B44 A;  4C3H J;  3QPL A;  3WTW C;  4KT6 A;  5HS7 A;  1IRX A;  2R7V A;  4A3C J;  1MW7 A;  2EB7 A;  1YS7 A;  3ASN H;  3QOD A;  4UUS B;  5L3D A;  2YU3 A;  1MH3 A;  3BOQ A;  4XRS A;  5KHD A;  1DPR A;  1I39 A;  3ZR8 X;  5DDG A;  4Y17 A;  1ORK A;  5JLW A;  4KIB A;  3K4K A;  2Q0O A;  3DU6 A;  1KQ0 A;  3SZG A;  3M9A A;  1U8B A;  3WTU C;  2JJ7 A;  5KK1 A;  3OYG A;  2PG4 A;  3QOE A;  1LQ1 A;  2M35 A;  4ZYH A;  3CCR I;  4B48 A;  2L2O A;  1MNE A;  1MDM A;  4IHS A;  2O61 A;  4Z2Y A;  1NH3 A;  5A2Q Z;  4M9Z A;  1P7J A;  3Q9V A;  4NC7 A;  1S6L A;  2WY8 Q;  3Q3S A;  3BJO A;  1RES A;  3ZMT A;  2AO9 A;  3JRB A;  2P81 A;  3OOU A;  4XOR A;  2R7W A;  4CCN A;  3NAR A;  4HW0 A;  3CZ6 A;  4HNT A;  2TCT A;  3CCM I;  2HVR A;  2X6O A;  2RC4 A;  1UFM A;  3SDG A;  5J3L A;  2CUJ A;  4XLN F;  2HFH A;  4FE4 A;  4JQF A;  1W5C C;  2Z16 A;  1TWC J;  3UNG C;  1B72 B;  3O3K A;  1OYW A;  4X0G A;  3TBI A;  2QQB A;  3WU0 A;  3KCC A;  1FBU A;  2HR3 A;  2VXD A;  2BVL A;  4DQ2 A;  4U0Y A;  4L9V A;  1FBS A;  1W5T A;  2MC3 A;  3FK6 A;  4HV5 A;  3LA7 A;  3RQ4 A;  2JVG A;  2CFX A;  4KNY A;  1H9T A;  4C3J J;  4DYC A;  1OPC A;  1SFK A;  3I0T A;  3OWT A;  2IPQ X;  1TW2 A;  2R4G A;  2K9N A;  4I0B A;  1RR7 A;  4AU7 A;  3CCQ I;  3JAM Z;  4NC6 A;  3MKY B;  4E7Z A;  2IAI A;  4BU2 A;  1JJ8 C;  2R7U A;  4U0V A;  1T08 B;  3LOC A;  5TIS C;  3DPT A;  1LFP A;  2VAS A;  3WHC A;  4HDV A;  4XLF A;  1W7P D;  3PSI A;  4M72 A;  2V1N A;  4DZP A;  2HOS A;  1MMA A;  3QYB A;  4ANJ A;  2K40 A;  3HRU A;  3PL8 A;  4HQM A;  3UR3 C;  2CUF A;  4Q48 A;  1XMX A;  2YS9 A;  2JUC A;  2L4M A;  3BQY A;  2BOL A;  4KN4 X;  5J4Y A;  1XD7 A;  4UV8 A;  5M5W J;  4IXA A;  2AXT C;  1S8N A;  2VBX A;  3ZMV A;  2FMY A;  3R6S A;  2XAU A;  2LYC A;  4BS9 A;  2RQP A;  1L0O C;  1E17 A;  4WWC A;  2JA2 A;  3OYA A;  2CJJ A;  1DGR M;  5LRR A;  2W00 A;  2JMW A;  1LEB A;  4BY7 J;  3H5A A;  1VFC A;  3RYR A;  3B73 A;  3O8H A;  1IC8 A;  3H92 A;  4Y4R A;  1LUJ B;  1YOV B;  2XF5 A;  3OYE A;  1Q1H A;  4QWQ A;  2LRD A;  3M3Y J;  4II2 A;  3GBG A;  5FD6 A;  2R7D A;  3OYB A;  2Y9Y A;  3FIS A;  1GV2 A;  3CMM A;  2K9S A;  3DKY A;  4XID A;  5ICE A;  1QPI A;  2L02 A;  2LBF A;  3K1M A;  1ETW A;  3QPS A;  3ZQF A;  2Y30 A;  2DO7 A;  3J80 Z;  4A3M J;  2WTE A;  1XS9 A;  4Q47 A;  2RNG A;  3MKW B;  4P5O A;  3TGN A;  4IRH A;  1OMI A;  3KP2 A;  3KP6 A;  1XB4 A;  4D0P A;  5D4S A;  1ZRE A;  2L7M P;  2YU9 J;  1HW1 A;  4A3L J;  1JXS A;  5GPC A;  5IP6 A;  4JBA A;  1P4X A;  2FA5 A;  4LIV A;  3P5J A;  2M87 A;  4F52 A;  3LSJ A;  3LSI A;  3HTS B;  3LA2 A;  3KFW X;  1ZGJ A;  3DU5 A;  3JTH A;  1TTY A;  2QBY A;  3SEZ A;  3RKY A;  5IT9 R;  5EDN A;  4DNC A;  3DPU A;  4G94 A;  1ZYR F;  3DFG A;  3QYE A;  3IL2 A;  1J09 A;  3ZRG A;  4RGR A;  2JVH A;  1YS6 A;  3FIW A;  3OYK A;  2CMP A;  4J00 A;  2JQ7 A;  2M30 A;  5EEG A;  1RET A;  1O3Q A;  5HLI A;  4X6A J;  3BTL A;  2CV1 A;  3A02 A;  3JRG A;  4Y33 A;  4FX4 A;  2HQN A;  2GOX B;  4HYE A;  1G6N A;  2LFB A;  1TP4 A;  3LSH A;  3ZQI A;  1YJN I;  4ZYA A;  1MBJ A;  2OQR A;  2JTV A;  1W5S A;  1MMN A;  1VQ6 I;  3GTJ J;  2G7U A;  3LAJ A;  2OC6 A;  1G3S A;  2YUS A;  1QRY A;  1ZG1 A;  3F3X A;  2X85 A;  4L9J A;  3G6E I;  2HZT A;  4E7L A;  3H9J A;  2QSH X;  1R5I D;  1KQ9 A;  2HXO A;  1W1W E;  2ID6 A;  5FGM A;  3IH2 A;  1RQ6 A;  1OJL A;  2QZ8 A;  1PDN C;  1WZ2 A;  3H35 A;  3GVA A;  3FXJ A;  3IRQ A;  1Z6T A;  2D45 A;  2HVQ A;  3DBH B;  1P6R A;  1RNL A;  3S17 J;  1G3W A;  2ID3 A;  1YW8 A;  3TMO A;  2ZME B;  2EFW A;  2ZB9 A;  4HX7 A;  5ERI A;  4PFO A;  1SFO J;  1OCC H;  2E71 A;  1K79 A;  2PMZ N;  3ECO A;  3ZP5 A;  1MBE A;  5E8G A;  2X48 A;  1JUS A;  2X98 A;  3HSF A;  3L9F A;  2VJJ A;  1J9I A;  3O2P E;  3CC7 I;  2AS5 F;  1HF0 A;  4HA8 A;  2O7O A;  3EYI A;  2WBM A;  1VQM I;  2MBF A;  3K9T A;  1G3T A;  4QLC U;  1X58 A;  2MA3 A;  1ETV A;  2KQR A;  3ERM A;  3F6O A;  3AFH A;  4BBS J;  2O0Y A;  3FM5 A;  3K4C A;  3OOP A;  1SFE A;  1SVO A;  2IGO A;  1XSV A;  1E0E A;  1TWF J;  3ABT A;  3RZO J;  2XAF A;  2FQ4 A;  3IH4 A;  4U88 A;  4O5V A;  3GFL A;  3R0J A;  5AIQ A;  5BMZ A;  4ZZL A;  5FLX R;  5EF6 A;  1XDU A;  3GFM A;  4A0X A;  4DBQ A;  1GT0 C;  4Y7N J;  5FB2 A;  1FT9 A;  2IA2 A;  4HAM A;  1SEU A;  3RIR A;  2FF4 A;  4AVZ A;  2ISZ A;  1X3Z B;  1PJR A;  1T33 A;  2JUG A;  3RCO A;  1QO0 D;  2EIM H;  4PJL A;  1HLV A;  1NK3 P;  2KIM A;  2ELK A;  3RPQ A;  1IAW A;  5IT9 K;  3W2V A;  2V7F A;  3DTI A;  2P0T A;  3MKZ A;  2YSR A;  5H2F C;  2KKO A;  2CV0 A;  1BR4 A;  3GME A;  3PSF A;  2PX9 A;  2PQ8 A;  2QEN A;  1QZZ A;  4G6Q A;  5F6F A;  4RLQ A;  4HNU A;  1D0X A;  1WRJ A;  4II3 A;  3ISP A;  2JA7 J;  1FIP A;  3CDH A;  2G0E A;  3AG2 H;  3BZK A;  1SFU A;  1RUN A;  2DFE A;  2HNH A;  4A3B J;  4FT8 A;  3JRE A;  3BCB A;  3FBN B;  4PCQ A;  3SFZ A;  4KUM A;  2A5Y B;  3IV5 A;  4BQN A;  5E18 F;  4CH7 A;  3CCE I;  3OYC A;  3LSR A;  3HRT A;  4B4C A;  1IW7 F;  1V5G A;  2MYS A;  2DOD A;  1H88 C;  1OIS A;  2M2E A;  2LSO A;  1WCM J;  2M4K A;  4NB5 A;  2X1E A;  1B59 A;  3OV8 A;  3S3N A;  4C2T A;  5IYD J;  1DP3 A;  1VZ0 A;  2XAS A;  3EUH A;  5M3M J;  1B8I B;  1HDD C;  1BI0 A;  1UEL B;  3BR3 A;  2DK5 A;  1FY7 A;  1W7P B;  3IKT A;  1MDM B;  5IP9 J;  3ZMU A;  1RI7 A;  4PFP A;  1OKR A;  4B1R A;  4IJA A;  1B72 A;  3BWG A;  1FC3 A;  3OIQ A;  1TWH J;  4BJ6 C;  1T2K A;  1WVR A;  3LSK A;  4ZTF A;  3C2B A;  2KJC A;  1R22 A;  1K83 J;  3N05 A;  4IEJ A;  2GBY A;  3CJQ B;  5K1Y A;  1Y39 A;  5H20 A;  4BHC A;  3HOT A;  1SFX A;  1FYK A;  3HGG A;  2CV2 A;  3S14 J;  4A2U A;  3M1E A;  1FP2 A;  5GTH C;  3GLL A;  3IUO A;  3ABM H;  3WTV C;  4G7Z F;  2M1B A;  1IXS B;  5DUK A;  3V4G A;  1X1B A;  3HHG A;  4A69 C;  2WAE A;  1WKM A;  3RYP A;  1QHG A;  2R5Y B;  2XKP A;  2IA0 A;  4EJW A;  2IGK A;  4A3I J;  1IG7 A;  3FF5 A;  4C2U A;  3J7A O;  2K9L A;  4UB6 C;  3V7R A;  2NS0 A;  3Q0U A;  5DS9 A;  3EUK L;  4FCY A;  1Y0N A;  3WE2 A;  1O3R A;  2M4G A;  3PIP F;  4BXF A;  4BHP A;  1R23 A;  4XON A;  1ETY A;  2F2E A;  2L9V A;  5FLX K;  2FOW A;  1EH6 A;  2Q2E B;  2K02 A;  4ZZD A;  2YX7 A;  4BJ5 C;  3BQZ A;  2HYF A;  1RRJ A;  2KIS A;  3W2W A;  1WI9 A;  2VC1 A;  1XGN A;  3CO6 C;  5D6E A;  4HPQ A;  3I56 I;  1S29 A;  2PJR B;  3PQK A;  3ZXS A;  1SC7 A;  4N4N B;  2P0W A;  3E7L A;  3BR6 A;  3RJP A;  4HRI A;  1SAU A;  1Z6R A;  3FXU A;  3N4M A;  1BM9 A;  3S32 A;  1ERD A;  4YII A;  3F8N A;  1B9M A;  3GTQ J;  3K70 C;  2Q8K A;  2DT6 A;  2JSC A;  4OIR F;  1BI1 A;  3WG7 H;  4JX4 A;  1F5T A;  5CQG A;  3JSO A;  2PFB A;  1SMT A;  3GZ6 A;  4EEF G;  3JRA A;  2P6S A;  5EZH A;  3ABK H;  4OOI A;  5TRD A;  1DQU A;  3L7W A;  4LJZ F;  5GPA A;  3G4S I;  5E1Z B;  3BR5 A;  3G1O A;  1UG2 A;  4FHT A;  3OL3 A;  3MVP A;  2EFQ A;  4RGS A;  3ZMD A;  2RV8 A;  3HUG B;  5D5U B;  4HQE A;  1Z3Y A;  3K70 D;  3L2U A;  2R3S A;  3B6A A;  5D8K B;  1TNT A;  2JPC A;  3G1L A;  2K7L A;  4UVA A;  3VYR B;  1BOB A;  4J19 A;  2QVO A;  1BI2 A;  1WJD A;  3SXY A;  3T5X A;  3WE3 A;  3FWE A;  1NK2 P;  1ZRC A;  2IVM A;  2CQQ A;  4RB3 C;  3WTX C;  1IRG A;  5EJC A;  4M9S A;  1I1S A;  3AG1 H;  1XSD A;  4HG2 A;  3SDB A;  5DM6 F;  3H5N A;  1IXR C;  4IPA A;  2X0L A;  3BG9 A;  5JVT A;  3RI4 A;  3KEO A;  2FUG 2;  2HOT A;  2OJE D;  1OYI A;  1GXQ A;  3C7J A;  2ICW G;  3D5R C;  2Y75 A;  4RAF A;  4L5I A;  2GA1 A;  3G1M A;  2ZO4 A;  2DI3 A;  3BRO A;  4N0B A;  1HW5 A;  2DOE A;  2CGP A;  4WXD A;  1U78 A;  2VOD A;  2G9W A;  1BR2 A;  2LY9 A;  2XRL A;  4A3E J;  3FMR A;  2LDU A;  2EV5 A;  5F0H A;  3TP0 A;  1OR7 A;  3OSF A;  2EZH A;  3ESW B;  3S3O A;  3BG5 A;  4LLL A;  4A6E A;  4CCO A;  1D1B A;  1W36 C;  2VQH A;  3S3M A;  2RAE A;  1MGT A;  2XAQ A;  3JRC A;  4KMF A;  4GO1 A;  5DD4 A;  4M73 A;  2MFZ A;  4XLP F;  2NVU B;  4HLX A;  1P92 A;  3I53 A;  2QQ9 A;  5IT9 Z;  2OA4 A;  4NBQ A;  5EZG A;  2ZME A;  1A04 A;  1YW7 A;  1YIJ I;  3L2Q A;  5B1A H;  4RA2 A;  1P2F A;  4KA4 A;  1T0F C;  1Y6I A;  1W36 D;  1XC5 A;  3S2W A;  1MMD A;  1NTC A;  1K4T A;  3F72 A;  2ZFU A;  5CPR B;  2DA2 A;  2DW4 A;  2Y31 A;  2KT0 A;  5F0C A;  3I58 A;  3NQO A;  3CUQ C;  3WU2 C;  4CCJ A;  2WAD A;  1Y8R B;  3GFI A;  3KX2 A;  2M0M A;  3GWZ A;  3K1N A;  4BDZ A;  1JUP A;  2BVM A;  5FRO A;  2VPL A;  3RQI A;  4WX9 A;  1MND A;  1R00 A;  2MGQ A;  2DYR H;  2I10 A;  4A3D J;  3W3C A;  4UY8 I;  2M7B A;  3LST A;  1Z7L A;  4PGH A;  1U5T B;  4XMY A;  2WAF A;  2I5U A;  5LHI A;  1PP7 U;  1RZ4 A;  2GWR A;  4XKC A;  1ZHF A;  3NWT A;  2DOF A;  2QUF A;  2LY2 A;  3T8T A;  3E6M A;  2IS2 A;  4XN0 A;  1O3T A;  1WJB A;  4DGW B;  3OY9 A;  2BY0 A;  2DA1 A;  2W24 A;  4NUB A;  1TT0 A;  1HCR A;  1T38 A;  1RKW A;  2ZXH A;  2NVX J;  1E2X A;  3NAU A;  4OIO F;  4ON0 A;  3MZH A;  1YRN B;  1LVK A;  2LRE A;  3SJM A;  1FEX A;  3HOY J;  2VT2 A;  3KPH A;  5DCF A;  2MVT A;  2K9Q A;  2FXA A;  1AU7 A;  1U3E M;  5F04 A;  2ELJ A;  5LHG A;  3KIO A;  2ME0 A;  3F9K A;  3I9V 2;  2D1V A;  2Y0S N;  5TGT A;  1Z21 A;  3WU1 B;  3TED A;  1ZR4 A;  3IC7 A;  2PMZ A;  3SEQ A;  1IZ1 A;  1Y56 A;  2HKO A;  1P7I A;  1X3W B;  2X51 A;  3DLL F;  2E7W A;  3EET A;  1JGS A;  3QP5 A;  4M9X A;  1R1T A;  3F8F A;  3T8R A;  2HGC A;  3DEE A;  4M6X A;  4OWR B;  2RRE A;  4EVI A;  4UB8 C;  2IEK A;  1CQT A;  4RB1 A;  1VQ8 I;  1OCT C;  3HL2 A;  4XOT A;  2L3D A;  2BV6 A;  4R8H A;  3OYL A;  3PFY A;  3CCU I;  2XAH A;  2TRT A;  1WH7 A;  4AYB N;  2F6C A;  2XF6 A;  2OU2 A;  2E36 A;  3CJR B;  3FX3 A;  4QPQ A;  3Q5F A;  1T39 A;  2L5Q A;  1IRF A;  1SVL A;  1R5H A;  1JKQ C;  5FLX Z;  3FKI J;  1JKO C;  1B8I A;  1WJ5 A;  1ONV A;  3QP6 A;  3VYS B;  4OU0 A;  2VC0 A;  4EGY A;  1AKH B;  4LG3 A;  3NRV A;  1YTY A;  1W7P A;  2P5K A;  3J7A W;  2E1C A;  2WA0 A;  2K86 A;  3HOS A;  2MAB A;  3ZGK A;  5FLM J;  3R0A A;  4AWX B;  4XM3 A;  3J81 R;  1H9G A;  1OQY A;  4YIR X;  2DJN A;  2LP0 A;  5JHF A;  4G9Y A;  1QPM A;  2BGC A;  3HRM A;  5IPA A;  2K3P A;  2EK5 A;  4BEH B;  1TQP A;  2DMP A;  3TO6 A;  3GFJ A;  1MBF A;  5B3S H;  2BYV E;  1XN7 A;  2IGN A;  4UXN A;  1LKX A;  3G3Z A;  2XB0 X;  2A5W A;  4GFB A;  5J8F A;  3WTS C;  4IOA F;  1G8X A;  4HDU A;  4O6J A;  3QPT A;  1VQN I;  5CLS A;  4I98 B;  1GV5 A;  1IJW C;  2R5Y A;  1BL0 A;  1ZAR A;  3QQA A;  2V1U A;  2FEZ A;  2MLK A;  4A0Z A;  2LMD A;  3JW4 A;  1P4A A;  1YIO A;  1QQI A;  2VOO A;  5FD5 A;  1TC3 C;  1R6R A;  3SYT A;  1XSX A;  4GCV A;  2VE8 A;  1PUE E;  3V7C A;  3MAJ A;  4BBR J;  1QVT A;  2Q2E A;  2EPF A;  1I1G A;  5LLQ A;  4Y15 A;  5JLX A;  3KE2 A;  4PSW A;  1O4X A;  2VQL A;  4D5F A;  2UZK A;  4UVC A;  1HC8 A;  5E1X A;  3K4L A;  4KFC A;  1ZKG A;  1DGW Y;  1PYV A;  2VBY A;  3HXL A;  1J0R A;  3GW2 A;  2BY1 A;  3K2A A;  2PJR A;  2E34 A;  3TP3 A;  2B9S A;  2A6H F;  4IF4 A;  2E19 A;  3V8L A;  3FM3 A;  2XSJ C;  5AIP A;  2ZSH B;  5DUI A;  1R1U A;  2EA2 A;  4HF0 A;  3TDZ C;  1G4D A;  1LEA A;  2HS5 A;  3CES A;  3F23 A;  5J6X A;  1AA7 A;  1B1B A;  3HSE A;  5L3F A;  5E17 F;  3AG4 H;  4XR6 A;  1FLI A;  2L54 A;  3TKY A;  2ESN A;  3GZ5 A;  2KDZ A;  3QOP A;  1T56 A;  1YI2 I;  1Z3X A;  1ZRF A;  1SD5 A;  2L9S A;  1ACI A;  1ETK A;  2Y69 H;  2F4I A;  2RVC A;  4JYK A;  3JCU C;  4KYW A;  3VDX A;  1YG2 A;  3G2B A;  4M71 A;  2KRC A;  3I59 B;  1DPU A;  4P9F A;  3HUG A;  2RQQ A;  1V55 H;  1EKE A;  4I99 C;  4D7N A;  5FKN A;  5M5X J;  4KIT B;  2YR2 A;  5GAE J;  3AL0 B;  2J5O A;  4B47 A;  4LIU A;  2E5Z A;  3E5X A;  3JR9 A;  2ZXI A;  4YRV A;  3KZI C;  4IX7 A;  1VTN C;  2HTS A;  1SAX A;  2OV7 A;  1RC9 A;  4KJZ A;  4MTE A;  1XTA A;  4CZZ A;  2KLO A;  2O8K A;  2R7S A;  2XVC A;  5HLH A;  3K0L A;  4AD9 A;  3HTU A;  4M3E A;  3RPU D;  3J81 K;  2KRH A;  2VJ5 A;  1V5E A;  1FNN A;  4C9Y A;  4XSX F;  4BQQ A;  1WGX A;  4L5E A;  2XGX A;  3M8J A;  2BE5 F;  2PN6 A;  1BW6 A;  1BA5 A;  2W25 A;  4XRF A;  1ZG3 A;  2CS3 A;  1MBK A;  5D5V B;  5K5O A;  4XQF A;  2MC4 A;  3ZQH A;  1IV8 A;  2DT7 B;  3NWS A;  2WAQ N;  2B7E A;  3TQN A;  2DDB A;  1I5Z A;  1K78 B;  3VOD A;  5F0F A;  4XLE A;  4S05 A;  3U2R A;  1FJL A;  1J7K A;  4YIF A;  1BIA A;  2DLL A;  4RBO A;  2CFO A;  5D4R A;  3DCF A;  3J7Z I;  3TL4 X;  1STZ A;  4HBL A;  1QNT A;  2K3F A;  2RGV A;  1I27 A;  3MCZ A;  1ZTR A;  3HIF A;  1EV7 A;  4G6T B;  1ZRD A;  5IOY A;  2XPW A;  4BE0 A;  2I8D A;  3H3V K;  1O7F A;  4PJN A;  2E35 A;  3LQQ A;  4A3J J;  4LB5 A;  2W1O A;  5L3G A;  5F27 A;  4A93 J;  3KYD B;  1K7A A;  4RAG A;  2DXI A;  2QKM B;  4L0Y B;  3CCS I;  3SHF A;  1JHH A;  5FKL A;  3CCV I;  1IF1 A;  4UV9 A;  3LFK A;  5E20 A;  1IN8 A;  2MZ4 A;  3HPH A;  2HDW A;  3H0G J;  1SVM A;  2V4J C;  2E1N A;  2BZT A;  4L18 B;  2L0K A;  3JSP A;  3EDP A;  3CO7 C;  3PO3 J;  2LH9 A;  1TWA J;  2A05 A;  2VBZ A;  2X9D A;  1GLN A;  2DDA A;  3DBR B;  4HOB A;  4LK0 F;  5CVI A;  5L3B A;  1HQC A;  2H09 A;  1R9T J;  3E5U A;  1IGN A;  2WC2 A;  5IYC J;  1ON1 A;  2VT3 A;  3AG3 H;  1OCR H;  1HST A;  2EH3 A;  3FBI B;  5DM7 F;  4BE2 A;  1ZN2 A;  2ZNZ A;  4V2G A;  4A3K J;  1TLH B;  5F08 A;  3HYI A;  4V19 K;  3PJR A;  2V9P A;  1VQO I;  2ADU A;  3KZY A;  2E1M B;  4LGW A;  3BT9 A;  5HDK A;  1FMW A;  2VKH A;  1U5T A;  4AID A;  2FBK A;  1WJC A;  1M1E B;  1YFH A;  3BZC A;  2DFI A;  2KMU A;  1X19 A;  1R4M B;  4BQA A;  1A36 A;  2KP6 A;  3KP3 A;  3FKJ A;  2E1O A;  3F8B A;  1J5Y A;  2NNY A;  1SAN A;  4N9I A;  4RGU A;  3GTP J;  3FXQ A;  3A0B C;  5B5E C;  4RGX A;  3A2K A;  3KP7 A;  1IN5 A;  4RB2 C;  3I4M J;  1YRN A;  5HS8 A;  1FSE A;  5FFZ A;  3DQV C;  2G7H A;  4MHG A;  1LVA A;  4BE1 A;  3M7G A;  2KIF A;  3BR2 A;  3K69 A;  4MEY F;  4JOM A;  3RSN A;  2DK8 A;  2R5Z B;  1EF4 A;  2DA7 A;  1XG1 A;  4CDG A;  2P7V B;  2GXB A;  1Z67 A;  2EV6 A;  2FD5 A;  2JRM A;  2HWV A;  3L2R A;  4XLH A;  2HU9 A;  1X4O A;  3EUA A;  4LK1 F;  2W57 A;  3GX4 X;  3E6B A;  4E7I A;  1I3A A;  2FJ1 A;  2A68 F;  4FAS D;  2QEX I;  2LG4 A;  3BG6 A;  3FXL A;  2COB A;  3U9G A;  2XRN A;  1TQI A;  5D5W B;  1MJA A;  2HDD A;  2KFD A;  3K4B A;  5AON A;  2NVT J;  3DBL B;  4P55 A;  1Y1W J;  2ZJR F;  3VSL A;  4BJT A;  1DP7 P;  2IRF G;  4OIQ F;  5LFA A;  4CCM A;  1MJ9 A;  3F8M A;  1F1Z A;  2K27 A;  2KIU A;  4X1E A;  3TO9 A;  1AKH A;  1NG7 A;  4ESJ A;  1GXP A;  1VQP I;  2BXY A;  1B6A A;  1YO5 C;  3GZN B;  1R71 A;  3PM1 A;  1ON2 A;  1XMK A;  2DMT A;  4V2F A;  1G2H A;  5E8I A;  3M4O J;  4HST A;  2IP2 A;  2LLK A;  1FSH A;  3OIP A;  3CDI A;  4BEH A;  1WPK A;  4IHT A;  2A07 F;  2DFF A;  2VOP A;  3C2H A;  4HV6 A;  3W6K B;  4E7J A;  1C0W A;  2X1D A;  2Y0S A;  2MD0 A;  2L4A A;  2PEX A;  2E2H J;  4LD5 A;  2K4J A;  1BI3 A;  3FXM A;  4H4K C;  4U7D A;  3H9Q A;  1IN6 A;  3S8P A;  4R79 A;  2DFH A;  3HOZ J;  4G7O F;  4HLY A;  3IWZ A;  1P9Q C;  4NQW B;  1YJ9 I;  4I6Z A;  1ZLK A;  5ED4 A;  4MGR A;  1S5L C;  3ZN1 A;  2UWM A;  1X1P A;  3ZMS A;  4AYB A;  2A6T A;  1HDP A;  1U6G A;  2QSG X;  3A52 A;  2OCE A;  4HF2 A;  2VB6 A;  2ESH A;  5BNG A;  5LHH A;  2X4H A;  2JRT A;  1T95 A;  2EIN H;  5K7Z A;  1WJA A;  2NS7 A;  3D5L A;  3I71 A;  2KRF A;  2V79 A;  3TOA A;  1QZE A;  2VI6 A;  4JK1 X;  1VQL I;  1JTX A;  3G73 A;  2DJI A;  1A35 A;  1YW9 A;  3K7A J;  2DA4 A;  4TV7 A;  4ZH4 F;  2DOA A;  2UV1 A;  3J81 Z;  2KPM A;  2CWE A;  2RNJ A;  5BQT A;  3T1B A;  2FOK A;  3CCJ I;  1XGS A;  2D1H A;  2STT A;  4XOP A;  2DMN A;  2R92 J;  3EPZ A;  4OAZ A;  2O3F A;  1TW3 A;  1K61 A;  3HGY A;  3DTK A;  4HX8 A;  1WFX A;  3HOU J;  3WGG A;  5JFR A;  2F5F A;  2UUZ A;  1JGG A;  1YX5 A;  3F8C A;  4I01 A;  4XIC A;  4BHB A;  1X1A A;  3EUH C;  1KZH A;  1V4R A;  3OSG A;  4CHU A;  3MKL A;  2ZC2 A;  3CJN A;  1D1A A;  2M9H A;  2PBI A;  3MWM A;  4XRM A;  2OF7 A;  3I59 A;  5GP9 A;  2XPU A;  4YFX F;  4ZYG A;  2XC7 A;  1MJB A;  1P4W A;  4A5M A;  5K5R A;  4DJA A;  3WG9 A;  1ITY A;  1IUF A;  2VQC A;  4R1H A;  2LOO A;  3I64 A;  2PLY A;  2Z9O A;  1S9H A;  2Z1D A;  2GXA A;  2RKH A;  4MFE A;  3P9I A;  2CQ7 A;  1BC8 C;  3V7S A;  2EZL A;  2ECB A;  3G71 I;  1O3S A;  3HG9 A;  3JTG A;  1WHU A;  4UNO A;  4OIP F;  4DYQ A;  2DA3 A;  3S1R J;  2Z3Y A;  3K4M A;  3JRF A;  3BR1 A;  2MW8 A;  2XPV A;  2AQE A;  2FX0 A;  2XRO A;  3AKZ A;  2FE3 A;  2LK2 A;  2YPR A;  3FXR A;  5EGO B;  2N8G A;  3HOX J;  3J80 R;  4CCK A;  5EEH A;  1FX7 A;  2BBY A;  3FZV A;  5C3E J;  4CSW A;  5EYR A;  3DXJ F;  1D0Z A;  4EAT A;  2NAZ A;  2NOG A;  3ZOB A;  2BHZ A;  4I0A A;  3PFI A;  3WGI A;  4LIT A;  1LB2 A;  4RM2 A;  2VJ4 A;  1FMV A;  4H0E A;  4A5N A;  3B6C A;  3RKQ A;  4QIW N;  2DYS H;  2F5D A;  2OD5 A;  4AC0 A;  4LLG F;  1K78 A;  1KU7 A;  1IUY A;  1KYW A;  3EYY A;  4OMY A;  3LFU A;  1IXC A;  3H3U A;  4IQJ A;  1YHQ I;  2VUM J;  2ZSI B;  5BS6 A;  3GLX A;  4HZF A;  1D5Y A;  5JI6 A;  3PO2 J;  1F43 A;  2EWN A;  2NS8 A;  3N97 A;  1X1D A;  4ZDO A;  4ENK A;  3V42 A;  3GYH X;  2CSO A;  1ZGW A;  4I09 A;  3FMS A;  2P5L C;  2EIL H;  1QU3 A;  2F4O B;  4D9J A;  3KYL A;  3OR2 C;  4CA0 A;  1K6O A;  2LKP A;  3K10 A;  5FRN A;  2DCE A;  4BKX A;  1IV6 A;  5J1Y A;  4F55 A;  4EJT A;  3KZZ A;  1LFU P;  4DBR A;  2UXX A;  1JKR C;  2FNA A;  1E3H A;  2W7N A;  4EGZ A;  1D8K A;  2ELH A;  4E7K A;  2HKX A;  4KIF A;  3DTE A;  1AOY A;  2HOE A;  4EM0 B;  1X3U A;  4WK8 F;  2AXL A;  4N4O B;  2IGM A;  4KIC A;  3V8K A;  3HOW J;  1R1V A;  4M3G A;  1HSJ A;  1ZAO A;  3MFK A;  5FO5 A;  3P7N A;  5B1B H;  2OZU A;  2WAQ A;  2XSD C;  4XLC A;  3M07 A;  1MSE C;  4BQO A;  3WHB A;  2O03 A;  2ZCW A;  3M8F A;  4PSX A;  2GXG A;  4XNF A;  5CQE A;  4HNV A;  5J1R A;  5LGT A;  3C18 A;  1LDJ A;  2HTJ A;  1OFC X;  2FNP A;  3I3L A;  1LE8 B;  2QCO A;  5DV5 A;  2QKL B;  1V5F A;  4ZDP A;  3ROU A;  1RUO A;  2HDC A;  4ETS A;  5GTI C;  2DA5 A;  4LB6 B;  4L0Z B;  2QA4 I;  2R7F A;  2MG4 A;  4YEL A;  4OIN F;  1XGM A;  2JN6 A;  3QAH A;  3LSP A;  2L7Z A;  3TW6 A;  2R93 J;  1XX5 A;  2CH0 A;  3RKX A;  3ABU A;  5EG0 B;  3LSM A;  1KA8 A;  3I55 I;  1YQA A;  1DU6 A;  2Z2S B;  5FKK A;  1I6X A;  4XBF A;  2CUE A;  3OS0 A;  2R7R A;  2X6X A;  1VQ5 I;  4EJO A;  4WF2 A;  4L9N A;  5CVU A;  2L7F P;  2YX4 A;  3WTY C;  3DV8 A;  2VQG A;  4DOZ A;  3F21 A;  2Z99 A;  3CP2 A;  2V9V A;  3BPV A;  1R7J A;  4NC8 A;  5IY5 H;  1H0M A;  3BC8 A;  1JTY A;  3QU3 A;  2R5Z A;  3DLA A;  3IWF A;  1ODD A;  1JHF A;  4D1Q A;  2FML A;  5ICG A;  2GLO A;  2O9L A;  4MFD A;  5DD8 A;  1D3Y A;  4RAZ A;  1BIB A;  4HSR A;  2ME6 A;  1EA3 A;  1APL C;  1OR7 C;  3Q0V A;  3S15 J;  5D5X B;  1FZP B;  4IHW A;  2BHY A;  4ENJ A;  3BPX A;  1DU0 A;  4KDP A;  1T98 A;  4KIS A;  2CYY A;  1EH7 A;  2XAG A;  3ZQ7 A;  3MMY B;  5HNF A;  5BPD A;  1F9N A;  5LBQ A;  3GTO J;  4NHJ A;  5DYM A;  5H6Q A;  3U1D A;  2DAO A;  3CLO A;  3FHN A;  3DEU A;  3H5R A;  4B09 A;  1H8A C;  1T8I A;  4EM1 A;  5CKT A;  1BBY A;  4FQG A;  2O5R A;  2HOA A;  2M0C A;  2HYJ A;  2ZME C;  3LWF A;  5K7F A;  3FHZ A;  3ERE D;  1JT0 A;  2E60 A;  3ZQL A;  4CO8 A;  3IAM 2;  2AHQ A;  3IRR A;  1XGO A;  2VIX A;  5E1W A;  4CCL A;  3CF5 F;  1EJ9 A;  1YE9 A;  3CD6 I;  1Z05 A;  1ETO A;  2FBI A;  4NDL A;  1TL8 A;  1MD0 A;  2F5E A;  2D5V A;  3CCY A;  1MBG A;  1Q1V A;  4CYD A;  5ILV A;  2X6W A;  4MO7 A;  4CYC B;  2XDV A;  5HDG A;  2ISY A;  4MNU A;  4BY1 J;  2B63 J;  3CF2 A;  5DTD A;  4XK4 A;  1A6I A;  3F6V A;  3H36 A;  4PZJ A;  2O6G E;  3D0S A;  2OTJ I;  4XKW A;  1TNS A;  1WWX A;  2L7K A;  2FU4 A;  2QYO A;  2RN7 A;  4NQW A;  2A61 A;  5HLG A;  1YX3 A;  2W85 A;  2Y9Z A;  2R7Z J;  1S7A A;  4AVP A;  2ZJ2 A;  1XDS A;  3LA3 A;  3VPR A;  5FRM A;  2PMH A;  4BL0 B;  4CIC A;  2OCC H;  3LMM A;  3WOD F;  3RDI A;  2CRG A;  1KYZ A;  2ZJP F;  5E79 C;  4DW6 A;  1MNM C;  3JRI A;  3H3Z A;  1XMA A;  4E6K G;  4A3G J;  2PJP A;  1I50 J;  4P96 A;  4CUG A;  4ZJZ A;  3ECH A;  1HXD A;  4IZZ A;  4A12 A;  1N78 A;  3U21 A;  2MH2 A;  2HI3 A;  5C4J J;  4ENM A;  5HVQ C;  5M3F J;  1Z1D A;  2HQ5 A;  3FXO A;  4FX0 A;  4YFK F;  5LGU A;  3GTK J;  2WWY A;  4PGG A;  4QTR A;  1O7L A;  2F5V A;  1JJ6 C;  2C6Y A;  1YJW I;  3GTM J;  4B8X A;  3CC4 I;  3E6C C;  2WB1 N;  5E3O A;  5KNL A;  5J47 A;  1X2N A;  2OAZ A;  1OLT A;  2WV1 A;  3M1C A;  2M8G X;  2QM3 A;  4OMZ A;  4XRS G;  4C30 A;  2DPD A;  1X4P A;  2XAJ A;  2MLG A;  1K6Y A;  3HBL A;  3RKW A;  3CLQ A;  2DN0 A;  3VYU B;  2IS1 A;  2RDP A;  1Z91 A;  3M8E A;  3RPU A;  4EM2 A;  3MQ0 A;  5CVR A;  2GZW A;  1U2W A;  2OZ6 A;  1F36 A;  2K4B A;  3K2Z A;  4AUX A;  4F91 B;  2DU9 A;  4XSZ F;  3CMY A;  4PJ0 C;  2DTR A;  3HPG A;  2JWT A;  2K9M A;  1JI8 A;  2JZY A;  4IO9 F;  3KEQ A;  1W0T A;  1FOW A;  2P7C B;  2LKS A;  2LKX A;  3CP8 A;  2EZK A;  3H9G A;  1TQM A;  1NHA A;  2H1L A;  3OYJ A;  1HKT A;  4LMY A;  4M6V A;  2QF7 A;  4M74 A;  1BJA A;  2E7X A;  3ZPL A;  2LF7 A;  3BZ6 A;  4G7H F;  2Y2Z A;  5FJ8 J;  3IKV A;  4CXF A;  4IKF A;  3RZD J;  2ZXW H;  2OPT A;  3HKZ N;  3VB2 A;  1U9N A;  3IAS 2;  3TDU C;  3LSG A;  4F92 B;  4GGG A;  4M3F A;  2V26 A;  1GUU A;  2XGE A;  1LNW A;  2BW3 A;  5HOO A;  5EGO A;  2L9R A;  5DCM B;  5C44 J;  1CF7 B;  2XUB A;  2R0Q C;  5K5Q A;  2EQR A;  1W4M A;  1VI0 A;  1UMQ A;  3V8J A;  2GAU A;  5F1R A;  4C2M J;  2H6B A;  2DMQ A;  2ZJQ F;  1UHW A;  2NVY J;  3P9K A;  4DZJ A;  3GTG J;  2A6E F;  4U0W A;  4O3M A;  1PUF B;  2DQL A;  3VSK A;  1FTZ A;  1KU3 A;  1FTT A;  2FSW A;  1QBJ A;  3PUB A;  1GVD A;  2F48 A;  2J5P A;  3A01 B;  5FFX A;  2NRA C;  2JK3 A;  3IP4 B;  2E2I J;  3D5S C;  1MIJ A;  3CC2 I;  3ULQ B;  2XGD A;  1FOX A;  2M8E A;  2VE9 A;  4FIS A;  1LPQ A;  4XL9 A;  3PNY A;  2NNN A;  2M3A A;  4P1W A;  2P4W A;  2DA6 A;  4Y52 J;  3BTC A;  5L3E A;  1FPQ A;  3OYF A;  2VN2 A;  3I4P A;  1ETX A;  5D6F A;  1GHC A;  2JPB A;  4W1U A;  1D0Y A;  1Z0X A;  3WTZ A;  3HHH A;  1XCV A;  3LQR A;  1QGP A;  2KL4 A;  5F1J A;  2VBW A;  4RM3 A;  5JR3 A;  4AM3 A;  1Z77 A;  3FDY A;  1ZK8 A;  3BR0 A;  2XF7 A;  3K6G A;  4RLF A;  2W48 A;  1E3P A;  3O6B B;  1MZB A;  4LOC A;  2IXS A;  1JE8 A;  1ZQ3 P;  3GTL J;  1S3J A;  4PDK A;  4B3X A;  5J4V A;  3RTR A;  3OMY A;  5J8C A;  2W84 A;  1BJZ A;  3K1P A;  4OAY A;  3ABL H;  2QGU A;  4HF1 A;  2VKE A;  2KJB A;  1X2M A;  1R5G A;  1MMS A;  4ZTJ A;  3SFI A;  1G59 A;  1RKT A;  3OYD A;  3OS1 A;  3ZQQ A;  1Z9C A;  1U9O A;  3A0H C;  5E3L A;  3Q9S A;  2IT0 A;  1FOY A;  3MN2 A;  4EV0 A;  1VQ4 I;  3K4N A;  3ML6 A;  4DIQ A;  2F4M B;  5LGN A;  4MLO A;  4BH9 A;  2IS4 A;  2DMU A;  4BXX J;  4MEX F;  2EV0 A;  2H6C A;  2F5C A;  2BY3 A;  4PJM A;  3H0D A;  1REP C;  3E97 A;  1LE8 A;  1Y8Q B;  1T6S A;  2KZG A;  3CUQ B;  2IBD A;  3E1S A;  4XN3 A;  1WSU A;  4EJV A;  1USS A;  2V6C A;  3GO5 A;  2ETH A;  1A6Q A;  2LD5 A;  3W6V A;  3BJA A;  2HEO A;  5EG0 A;  3BTI A;  5FKM A;  4D5C A;  5LD2 C;  5F64 A;  5LEK A;  2OQG A;  1D5V A;  1RR8 C;  4F7Z A;  2R7T A;  4LG0 B;  2JT1 A;  1AHD P;  4E7S A;  2X1C A;  4GRI A;  3VYT B;  2NYX A;  4MQV A;  3OS2 A;  3OYI A;  1UZC A;  2PMU A;  1BC7 C;  3ZQC A;  1IN7 A;  5KAI C;  3HZJ A;  2NVQ J;  2Y48 A;  4D7M A;  4HX4 A;  1SD4 A;  5KCM A;  2XKO A;  4RMN A;  3DP7 A;  3UKG A;  1VQK I;  2EZI A;  1HKQ A;  1QHH D;  1S7E A;  4EQQ A;  1L3L A;  1G3Y A;  2CU7 A;  1IO2 A;  3VWB A;  2EA4 A;  3BCA A;  1YYV A;  1KU2 A;  1UB9 A;  3ASO H;  4I76 A;  4JX5 A;  1J75 A;  3S93 A;  1NG6 A;  1OCO H;  2P8T A;  4IRG A;  5GAH J;  2GOM A;  2EJR A;  4F3Q A;  2DPU A;  1FYL A;  3T0Y A;  3PNT A;  4IVN A;  2FBH A;  2HVS A;  4I02 A;  4MQ9 F;  2ZNY A;  2STW A;  3ZQG A;  1FWZ A;  4UHT A;  1ZG5 A;  2H8W A;  5IT3 A;  2XHK A;  1TT5 B;  2KHM A;  5K7H A;  4S0H B;  4U7B A;  3QPH A;  4XKB A;  2H94 A;  2Z33 A;  2HPM A;  3BY6 A;  5ICF A;  3R4K A;  3A4C A;  4L5J A;  1ULY A;  4DYR A;  1VQ7 I;  4YG2 F;  2JA8 J;  5ILS A;  2P5V A;  3HEF A;  3JRD A;  4AIK A;  2BXZ A;  5C4X J;  1PP8 F;  5CJ9 A;  4ZC3 A;  4WCG A;  4UUT A;  3LNQ A;  2JA6 J;  4IHY A;  2VON A;  2MSY A;  2R7Q A;  3FXK A;  3OR1 C;  2ACJ A;  3C3W A;  3L2C A;  3ZCO A;  1GDT A;  2XV4 S;  1MH4 A;  4UUV A;  3CDL A;  4ZDL A;  2PI0 A;  1N77 A;  9ANT A;  5HLT A;  4CYC A;  1N25 A;  1YLF A;  4XKV A;  3BJ6 A;  3SZT A;  1BW5 A;  1U5T C;  1XPX A;  1QA6 A;  2XGC A;  3HB9 A;  5B66 C;  1FIA A;  2IS6 A;  5TJJ A;  5LEJ A;  5IOZ A;  3PNV A;  1X1C A;  1KON A;  2VXZ A;  3B02 A;  4EJU A;  5A2Q R;  4UUS A;  1KU9 A;  1QVU A;  2HYG D;  2UXN A;  1IN4 A;  4U87 A;  5CVJ A;  6PAX A;  1N75 A;  4PUS A;  3P9C A;  3U1K A;  1MMG A;  3E3V A;  5KAF C;  3MZY A;  2LF8 A;  3TOB A;  4BXU A;  4BDY A;  5FLV A;  3TO7 A;  2M34 A;  2CO5 A;  3R61 A;  3VEP A;  5KVR A;  1D8J A;  1ENH A;  1J2X A;  3C2G A;  4LFU A;  3QRF F;  1SMY F;  1RIO H;  2NOJ B;  5GAD J;  1U0J A;  4B43 A;  2JSP A;  4K2E A;  3KP5 A;  3CMA I;  2CQN A;  5M5Y J;  3LL7 A;  1KQ8 A;  3GF2 A;  4F93 B;  2Y0M A;  1BN5 A;  4M3D A;  4E70 A;  1MSF C;  3S1M J;  1B9N A;  3KLO A;  1B4A A;  2V6E A;  1TWG J;  3S2D J;  2W4S A;  1XCB A;  3I4N J;  2M5W A;  2GA2 A;  4L9T A;  4IL6 C;  1ZGA A;  3BLY A;  3L00 A;  3PQJ A;  1W0U A;  5CYV A;  4FTH A;  5HOD A;  2VJI A;  2W82 A;  2QQ8 A;  5ICC A;  4PJJ A;  3HJE A;  3MD2 A;  2L01 A;  3E5Q A;  5E3N A;  3KYC B;  3K4J A;  1Z7U A;  1IDZ A;  2GIV A;  2MH9 A;  3JAM R;  2OUM A;  3QYF A;  4NNJ A;  3QU6 A;  2M45 A;  1MBH A;  1V3F A;  2HXI A;  3TW7 A;  4Q4Z F;  3L2W A;  1UHS A;  2DT5 A;  1LDD A;  2MUN A;  1V54 H;  3C1D A;  3FK7 A;  3A03 A;  3DKX A;  4YEJ A;  5J40 A;  5LRS A;  4BUP A;  3E0J B;  2NXN B;  1A5J A;  3X2Q H;  4GYG A;  4M6Y A;  1ZEL A;  1O57 A;  4E4H A;  3VOE A;  5FKO A;  1IRZ A;  4QPO A;  3F22 A;  3S1Q J;  3AAF A;  1A31 A;  2QQA A;  3IH3 A;  2CQX A;  2FRH A;  5DCM A;  3ZN0 A;  4BYY A;  1CF7 A;  2CW0 F;  1FBQ A;  1D1C A;  2L9N A;  4G12 A;  4A0Y A;  3I54 A;  3CQZ J;  3L1P A;  2LTP A;  3CTA A;  2WB1 A;  1S72 I;  1UJ8 A;  3KLN A;  3S16 J;  5BPI A;  4JX6 A;  5CVV A;  2GQQ A;  2COM A;  1JUM A;  1PUF A;  4LLN A;  1WH5 A;  2HQR A;  3OYM A;  3I5U A;  3LAP A;  4BGD A;  3DWL E;  2MD5 A;  3GCM A;  3A01 A;  4FET A;  2HPI A;  3HC7 A;  3DEW A;  2KZV A;  3DPL C;  1BR1 A;  2VKV A;  2TDX A;  2KDO A;  5A2Q K;  4CZC A;  3CCL I;  1CGP A;  2H27 A;  1LFB A;  2K85 A;  3KP4 A;  4YFN F;  1AWC A;  2O8X A;  3L09 A;  4IQ4 A;  4S04 A;  4G8X A;  4HEA 2;  4RDU A;  1I3Q J;  2BW3 B;  1Y0U A;  1GVJ A;  3HRS A;  3J7Y J;  4M3B A;  3OIO A;  1TBX A;  5ILU A;  2OBP A;  2VPR A;  1E3O C;  4QSH A;  3ELK A;  2AQF A;  4BNC A;  1LDK B;  2ECC A;  3REO A;  3SQN A;  4B3A A;  3HDD A;  2DQR A;  4AIH A;  2GM4 A;  2R7O A;  1U8R A;  4E7H A;  3HKZ A;  2M7A A;  1VQ9 I;  1BOA A;  2V9K A;  3WTT C;  2HZD A;  5E3M A;  2BEO A;  3JRH A;  2IA1 A;  3PIO F;  2D2W A;  5L3C A;  1VF9 A;  3W2A A;  1WQ2 A;  3BP8 A;  1ZLJ A;  4WXH A;  1I6H J;  1LJ9 A;  5HNH A;  3IHU A;  2QSF X;  5HDN A;  2K5C A; 
#chains in the Genus database with same CATH homology
 2ZBK A;  3JAM K;  5H6R A;  2EFO A;  4I2O A;  4GYI A;  1T0F A;  4UVB A;  2CQK A;  4MTD A;  1KGS A;  4AIJ A;  4P9U A;  5JHU A;  1HW2 A;  3CUQ A;  3WGH A;  2A3S A;  1UCR A;  2IJL A;  3FMQ A;  2Z5U A;  1DDN A;  3GEZ A;  3KET A;  3GUD A;  4IRI A;  1UHM A;  2B0L A;  2EFP A;  2A69 F;  2V1X A;  3E6D A;  4LG0 A;  3R60 A;  3GXO A;  5BOX A;  2QBY B;  2FQ3 A;  5HS9 A;  1EH8 A;  2QLZ A;  4KT5 C;  3SZP A;  3CUO A;  2P6T A;  1MKM A;  3W6J B;  2V1D A;  1R58 A;  4G6D A;  5D8L B;  4Q5S F;  4ESB A;  1SD7 A;  3VFZ A;  4ASN A;  1ZH5 A;  2IW5 A;  2CG4 A;  3BDD A;  4WXC A;  1S7O A;  4EMS A;  1FYM A;  3J80 K;  1FP1 D;  4RAY A;  4N9H A;  5DEQ A;  4BAY A;  1DUX C;  2EFN A;  4ENN A;  1J59 A;  2ZXJ A;  3NEU A;  2XIG A;  3DF8 A;  3HSR A;  2DBB A;  1HBX G;  2QWW A;  4I7H A;  3COA C;  2WV0 A;  4A6D A;  3MEX A;  2ZFW A;  2ZKZ A;  4RS8 A;  4KMU X;  1F4K A;  1R36 A;  4ZYD A;  3EQL F;  4GXO A;  4KN7 X;  2LNB A;  3ZMZ A;  4CGZ A;  1QZY A;  3DKW A;  4RB0 A;  1SD6 A;  4ESF A;  4ZYE A;  4Y13 A;  1HKS A;  1OYY A;  1UST A;  1FOK A;  4KIG A;  3WTW C;  5HS7 A;  2EB7 A;  1YS7 A;  5L3D A;  2YU3 A;  3BOQ A;  1DPR A;  5DDG A;  4Y17 A;  4KIB A;  2Q0O A;  1KQ0 A;  3M9A A;  3WTU C;  5KK1 A;  2PG4 A;  1LQ1 A;  4ZYH A;  1MDM A;  4IHS A;  2O61 A;  4Z2Y A;  5A2Q Z;  4M9Z A;  3Q9V A;  1S6L A;  3BJO A;  3ZMT A;  4HW0 A;  2RC4 A;  1UFM A;  4XLN F;  2HFH A;  4JQF A;  3O3K A;  1OYW A;  2QQB A;  3WU0 A;  3KCC A;  1FBU A;  2HR3 A;  4DQ2 A;  4U0Y A;  4L9V A;  1FBS A;  1W5T A;  2MC3 A;  4HV5 A;  3LA7 A;  2CFX A;  4KNY A;  1H9T A;  1OPC A;  3I0T A;  2IPQ X;  1TW2 A;  4I0B A;  3JAM Z;  4U0V A;  3DPT A;  4HDV A;  1W7P D;  4M72 A;  3HRU A;  4HQM A;  4Q48 A;  2L4M A;  4KN4 X;  1XD7 A;  4UV8 A;  4IXA A;  1S8N A;  2VBX A;  3ZMV A;  2FMY A;  3R6S A;  2RQP A;  1L0O C;  1E17 A;  4WWC A;  5LRR A;  1LEB A;  3RYR A;  3B73 A;  3H92 A;  1Q1H A;  4QWQ A;  5FD6 A;  2R7D A;  5ICE A;  2L02 A;  3K1M A;  2DO7 A;  3J80 Z;  2WTE A;  4Q47 A;  4P5O A;  3TGN A;  4IRH A;  1OMI A;  3KP2 A;  3KP6 A;  1XB4 A;  4D0P A;  5D4S A;  1ZRE A;  1HW1 A;  1JXS A;  4JBA A;  1P4X A;  2FA5 A;  2M87 A;  3HTS B;  3LA2 A;  3KFW X;  1ZGJ A;  3JTH A;  1TTY A;  2QBY A;  3RKY A;  4DNC A;  4G94 A;  1ZYR F;  3DFG A;  3IL2 A;  4RGR A;  1YS6 A;  2M30 A;  5EEG A;  1O3Q A;  5HLI A;  4FX4 A;  2HQN A;  4HYE A;  1G6N A;  2OQR A;  2JTV A;  1W5S A;  2G7U A;  3LAJ A;  1G3S A;  1ZG1 A;  3F3X A;  4L9J A;  2HZT A;  1KQ9 A;  5FGM A;  2QZ8 A;  1PDN C;  3GVA A;  3IRQ A;  1Z6T A;  2D45 A;  1P6R A;  1RNL A;  1G3W A;  1YW8 A;  2ZME B;  2EFW A;  5ERI A;  4HX7 A;  1K79 A;  3ECO A;  3ZP5 A;  5E8G A;  3HSF A;  3L9F A;  1J9I A;  3O2P E;  2AS5 F;  4HA8 A;  3EYI A;  2MBF A;  3K9T A;  1G3T A;  4QLC U;  2MA3 A;  3F6O A;  2O0Y A;  3FM5 A;  3OOP A;  1SFE A;  1XSV A;  3ABT A;  2XAF A;  4U88 A;  4O5V A;  3GFL A;  3R0J A;  5AIQ A;  5BMZ A;  4ZZL A;  1XDU A;  3GFM A;  4A0X A;  5FB2 A;  1FT9 A;  2IA2 A;  4HAM A;  3RIR A;  2FF4 A;  2ISZ A;  1QO0 D;  2KIM A;  1IAW A;  3RPQ A;  5IT9 K;  2YSR A;  2KKO A;  2PQ8 A;  2QEN A;  1QZZ A;  4G6Q A;  5F6F A;  1WRJ A;  3ISP A;  3CDH A;  1SFU A;  1RUN A;  4FT8 A;  4PCQ A;  3SFZ A;  4KUM A;  2A5Y B;  5E18 F;  3HRT A;  1IW7 F;  2LSO A;  4NB5 A;  1B59 A;  3OV8 A;  2XAS A;  3EUH A;  1BI0 A;  2DK5 A;  1FY7 A;  1W7P B;  3IKT A;  1MDM B;  3ZMU A;  1RI7 A;  1OKR A;  4IJA A;  3BWG A;  1FC3 A;  1T2K A;  2KJC A;  1R22 A;  5K1Y A;  5H20 A;  4BHC A;  3HOT A;  1SFX A;  1FYK A;  4A2U A;  3M1E A;  1FP2 A;  3WTV C;  4G7Z F;  2M1B A;  1IXS B;  5DUK A;  3V4G A;  3HHG A;  1WKM A;  3RYP A;  2XKP A;  2IA0 A;  4EJW A;  3FF5 A;  3J7A O;  3V7R A;  2NS0 A;  3WE2 A;  1O3R A;  4BHP A;  1R23 A;  2F2E A;  5FLX K;  1EH6 A;  2K02 A;  4ZZD A;  2YX7 A;  2HYF A;  1WI9 A;  2VC1 A;  1XGN A;  3CO6 C;  5D6E A;  1S29 A;  3PQK A;  3RJP A;  1Z6R A;  3FXU A;  3N4M A;  1BM9 A;  4YII A;  3F8N A;  1B9M A;  2Q8K A;  2JSC A;  4OIR F;  1BI1 A;  1F5T A;  3JSO A;  2PFB A;  1SMT A;  3GZ6 A;  2P6S A;  4OOI A;  5TRD A;  3L7W A;  4LJZ F;  5E1Z B;  4FHT A;  2EFQ A;  4RGS A;  3ZMD A;  2RV8 A;  5D5U B;  4HQE A;  2R3S A;  5D8K B;  1TNT A;  2JPC A;  2K7L A;  4UVA A;  2QVO A;  1BI2 A;  3SXY A;  3T5X A;  3WE3 A;  3FWE A;  1ZRC A;  2IVM A;  4RB3 C;  3WTX C;  1IRG A;  4M9S A;  1I1S A;  1XSD A;  1IXR C;  4IPA A;  2X0L A;  5JVT A;  3RI4 A;  3KEO A;  1OYI A;  1GXQ A;  3C7J A;  2Y75 A;  4L5I A;  2GA1 A;  2ZO4 A;  2DI3 A;  3BRO A;  4N0B A;  1HW5 A;  2CGP A;  4WXD A;  1U78 A;  2VOD A;  2G9W A;  3FMR A;  2LDU A;  2EV5 A;  1OR7 A;  4LLL A;  4A6E A;  1MGT A;  2XAQ A;  4KMF A;  4GO1 A;  5DD4 A;  4M73 A;  4XLP F;  4HLX A;  1P92 A;  3I53 A;  2QQ9 A;  5IT9 Z;  2OA4 A;  2ZME A;  1A04 A;  1YW7 A;  1P2F A;  4KA4 A;  3S2W A;  3F72 A;  2DW4 A;  3I58 A;  3NQO A;  3CUQ C;  3GFI A;  3GWZ A;  3K1N A;  4WX9 A;  1R00 A;  3LST A;  4PGH A;  1U5T B;  5LHI A;  1PP7 U;  1RZ4 A;  2GWR A;  1ZHF A;  2QUF A;  3T8T A;  3E6M A;  1O3T A;  2W24 A;  1T38 A;  1E2X A;  4OIO F;  4ON0 A;  3MZH A;  2VT2 A;  5DCF A;  2FXA A;  1U3E M;  5LHG A;  2D1V A;  3WU1 B;  3IC7 A;  1IZ1 A;  2HKO A;  2E7W A;  3EET A;  1JGS A;  3QP5 A;  4M9X A;  1R1T A;  3F8F A;  3T8R A;  2HGC A;  4M6X A;  4EVI A;  4RB1 A;  2L3D A;  2BV6 A;  4R8H A;  2XAH A;  2OU2 A;  3FX3 A;  1T39 A;  3Q5F A;  1IRF A;  1R5H A;  5FLX Z;  1ONV A;  3QP6 A;  4OU0 A;  2VC0 A;  4EGY A;  3NRV A;  1YTY A;  1W7P A;  2P5K A;  2E1C A;  2K86 A;  3HOS A;  3R0A A;  4AWX B;  1H9G A;  4G9Y A;  1QPM A;  2BGC A;  3HRM A;  2EK5 A;  1TQP A;  3TO6 A;  3GFJ A;  2BYV E;  1XN7 A;  4UXN A;  3G3Z A;  5J8F A;  3WTS C;  4HDU A;  4O6J A;  3QPT A;  5CLS A;  4I98 B;  1ZAR A;  2V1U A;  2FEZ A;  2MLK A;  4A0Z A;  3JW4 A;  1P4A A;  1YIO A;  1QQI A;  2VOO A;  5FD5 A;  1XSX A;  4GCV A;  2VE8 A;  1PUE E;  3V7C A;  3MAJ A;  2Q2E A;  1I1G A;  5LLQ A;  4Y15 A;  3KE2 A;  2UZK A;  4UVC A;  5E1X A;  4KFC A;  2VBY A;  1J0R A;  3GW2 A;  2A6H F;  4IF4 A;  3V8L A;  3FM3 A;  5AIP A;  5DUI A;  1R1U A;  2EA2 A;  3TDZ C;  4HF0 A;  1G4D A;  1LEA A;  2HS5 A;  3F23 A;  5J6X A;  1B1B A;  3HSE A;  5L3F A;  5E17 F;  1FLI A;  2L54 A;  3TKY A;  2ESN A;  3GZ5 A;  3QOP A;  1ZRF A;  1SD5 A;  2RVC A;  4KYW A;  1YG2 A;  4M71 A;  1DPU A;  3I59 B;  4P9F A;  3HUG A;  2YR2 A;  2J5O A;  3E5X A;  1VTN C;  2HTS A;  1SAX A;  4MTE A;  4CZZ A;  2XVC A;  5HLH A;  3K0L A;  4AD9 A;  3HTU A;  3J81 K;  1FNN A;  4XSX F;  2XGX A;  2BE5 F;  2PN6 A;  2W25 A;  4XRF A;  1ZG3 A;  5D5V B;  5K5O A;  3TQN A;  1I5Z A;  1K78 B;  3VOD A;  4S05 A;  3U2R A;  1J7K A;  4YIF A;  1BIA A;  2DLL A;  5D4R A;  1STZ A;  4HBL A;  1QNT A;  2RGV A;  1I27 A;  3MCZ A;  3HIF A;  1EV7 A;  1ZRD A;  1O7F A;  3LQQ A;  4LB5 A;  5L3G A;  1K7A A;  4L0Y B;  3SHF A;  1JHH A;  1IF1 A;  4UV9 A;  3LFK A;  5E20 A;  1IN8 A;  2E1N A;  4L18 B;  3JSP A;  3EDP A;  3CO7 C;  2VBZ A;  4HOB A;  4LK0 F;  5CVI A;  5L3B A;  1HQC A;  2H09 A;  3E5U A;  2WC2 A;  1ON1 A;  2VT3 A;  1HST A;  1ZN2 A;  2ZNZ A;  1TLH B;  3HYI A;  2ADU A;  3KZY A;  4LGW A;  5HDK A;  1U5T A;  2FBK A;  1YFH A;  2DFI A;  4BQA A;  3KP3 A;  2NNY A;  3F8B A;  1J5Y A;  4N9I A;  4RGU A;  3FXQ A;  4RGX A;  3KP7 A;  1IN5 A;  4RB2 C;  5HS8 A;  1FSE A;  5FFZ A;  3DQV C;  2G7H A;  4MHG A;  1LVA A;  3M7G A;  2KIF A;  3K69 A;  4MEY F;  2DK8 A;  4CDG A;  2P7V B;  2GXB A;  2EV6 A;  2HWV A;  4LK1 F;  2W57 A;  3GX4 X;  3E6B A;  2A68 F;  3U9G A;  2XRN A;  1TQI A;  5D5W B;  1MJA A;  5AON A;  4P55 A;  1DP7 P;  2IRF G;  4OIQ F;  1MJ9 A;  3F8M A;  1F1Z A;  2K27 A;  2KIU A;  3TO9 A;  4ESJ A;  1GXP A;  1B6A A;  1YO5 C;  1ON2 A;  1XMK A;  5E8I A;  2IP2 A;  1FSH A;  4IHT A;  2A07 F;  2VOP A;  4HV6 A;  3W6K B;  1C0W A;  2L4A A;  2PEX A;  4LD5 A;  2K4J A;  1BI3 A;  4U7D A;  1IN6 A;  4R79 A;  4G7O F;  4HLY A;  3IWZ A;  1ZLK A;  5ED4 A;  4MGR A;  3ZN1 A;  2UWM A;  3ZMS A;  1U6G A;  4HF2 A;  2ESH A;  5LHH A;  2X4H A;  2JRT A;  3D5L A;  3I71 A;  2KRF A;  2V79 A;  3TOA A;  4JK1 X;  3G73 A;  1YW9 A;  4TV7 A;  4ZH4 F;  3J81 Z;  2CWE A;  2RNJ A;  5BQT A;  3T1B A;  2FOK A;  1XGS A;  2D1H A;  2STT A;  2O3F A;  1TW3 A;  4HX8 A;  3WGG A;  5JFR A;  2F5F A;  4I01 A;  3F8C A;  4BHB A;  1V4R A;  4CHU A;  3CJN A;  2PBI A;  3MWM A;  3I59 A;  4YFX F;  4ZYG A;  1MJB A;  1P4W A;  4A5M A;  5K5R A;  3WG9 A;  4R1H A;  2Z9O A;  3I64 A;  2PLY A;  2RKH A;  3P9I A;  1BC8 C;  3V7S A;  1O3S A;  3JTG A;  4UNO A;  4OIP F;  2Z3Y A;  2XRO A;  2FE3 A;  2YPR A;  3FXR A;  5EEH A;  1FX7 A;  2BBY A;  3FZV A;  3DXJ F;  2NAZ A;  4I0A A;  3PFI A;  3WGI A;  1LB2 A;  4H0E A;  4A5N A;  2F5D A;  2OD5 A;  4LLG F;  1K78 A;  1KU7 A;  1IUY A;  1KYW A;  3EYY A;  4OMY A;  1IXC A;  3H3U A;  5BS6 A;  3GLX A;  4HZF A;  5JI6 A;  2EWN A;  3N97 A;  4ENK A;  3GYH X;  2CSO A;  4I09 A;  3FMS A;  2P5L C;  1K6O A;  2LKP A;  4EJT A;  3KZZ A;  2UXX A;  2FNA A;  4EGZ A;  1D8K A;  2ELH A;  2HKX A;  4KIF A;  1AOY A;  2HOE A;  4EM0 B;  1X3U A;  4WK8 F;  2AXL A;  4KIC A;  3V8K A;  1R1V A;  1HSJ A;  1ZAO A;  3MFK A;  5FO5 A;  3P7N A;  2OZU A;  2O03 A;  2ZCW A;  3M8F A;  2GXG A;  5LGT A;  1LDJ A;  3C18 A;  2HTJ A;  2FNP A;  5DV5 A;  3ROU A;  1RUO A;  2HDC A;  4ETS A;  4LB6 B;  4L0Z B;  2R7F A;  4OIN F;  1XGM A;  3QAH A;  3RKX A;  3ABU A;  1KA8 A;  1YQA A;  4XBF A;  1I6X A;  4EJO A;  4WF2 A;  4L9N A;  5CVU A;  2YX4 A;  3WTY C;  3F21 A;  3DV8 A;  2Z99 A;  2V9V A;  3BPV A;  1R7J A;  1H0M A;  3QU3 A;  3IWF A;  1ODD A;  1JHF A;  2FML A;  5ICG A;  5DD8 A;  1D3Y A;  4RAZ A;  1BIB A;  5D5X B;  1FZP B;  4ENJ A;  3BPX A;  4KDP A;  1T98 A;  2CYY A;  1EH7 A;  2XAG A;  3ZQ7 A;  5BPD A;  1F9N A;  5LBQ A;  4NHJ A;  5DYM A;  5H6Q A;  3U1D A;  2DAO A;  3CLO A;  3DEU A;  4B09 A;  4EM1 A;  1BBY A;  3LWF A;  3FHZ A;  3ERE D;  4CO8 A;  3IRR A;  1XGO A;  5E1W A;  1Z05 A;  2FBI A;  1MD0 A;  2F5E A;  4CYD A;  5ILV A;  5HDG A;  2ISY A;  4MNU A;  3F6V A;  4PZJ A;  2O6G E;  3D0S A;  1TNS A;  1WWX A;  2FU4 A;  2QYO A;  2RN7 A;  4NQW A;  2A61 A;  5HLG A;  2W85 A;  1S7A A;  4AVP A;  2ZJ2 A;  1XDS A;  3LA3 A;  2PMH A;  4CIC A;  3WOD F;  3RDI A;  1KYZ A;  3H3Z A;  1XMA A;  2PJP A;  4P96 A;  3ECH A;  1HXD A;  4A12 A;  2MH2 A;  4ENM A;  5HVQ C;  1Z1D A;  4FX0 A;  4YFK F;  5LGU A;  2WWY A;  4PGG A;  1O7L A;  2C6Y A;  4B8X A;  3E6C C;  2OAZ A;  4OMZ A;  2QM3 A;  2DPD A;  2XAJ A;  2MLG A;  3RKW A;  2RDP A;  1Z91 A;  3M8E A;  3RPU A;  4EM2 A;  3MQ0 A;  5CVR A;  2GZW A;  1U2W A;  2OZ6 A;  2K4B A;  3K2Z A;  2DU9 A;  4XSZ F;  2DTR A;  2JZY A;  3KEQ A;  2P7C B;  1TQM A;  1NHA A;  1HKT A;  4LMY A;  4M74 A;  1BJA A;  2E7X A;  3ZPL A;  2LF7 A;  3BZ6 A;  4G7H F;  3IKV A;  4CXF A;  3VB2 A;  3TDU C;  4GGG A;  1LNW A;  5HOO A;  5DCM B;  1CF7 B;  2XUB A;  5K5Q A;  1W4M A;  3V8J A;  2GAU A;  5F1R A;  2H6B A;  1UHW A;  3P9K A;  2A6E F;  4U0W A;  4O3M A;  2DQL A;  1KU3 A;  2FSW A;  1QBJ A;  2NRA C;  2J5P A;  5FFX A;  3ULQ B;  2M8E A;  2VE9 A;  2NNN A;  2P4W A;  5L3E A;  1FPQ A;  2VN2 A;  3I4P A;  5D6F A;  1GHC A;  2JPB A;  3WTZ A;  3HHH A;  1XCV A;  3LQR A;  1QGP A;  2VBW A;  5JR3 A;  3O6B B;  1JE8 A;  1MZB A;  1S3J A;  4PDK A;  3RTR A;  5J8C A;  2W84 A;  3K1P A;  4HF1 A;  2KJB A;  1R5G A;  1Z9C A;  3Q9S A;  2IT0 A;  4EV0 A;  3ML6 A;  5LGN A;  4BH9 A;  4MEX F;  2EV0 A;  2H6C A;  2F5C A;  1REP C;  3E97 A;  1T6S A;  3CUQ B;  1WSU A;  4EJV A;  1USS A;  2V6C A;  3GO5 A;  2ETH A;  3BJA A;  2HEO A;  5F64 A;  5LEK A;  2OQG A;  1D5V A;  4F7Z A;  4LG0 B;  2JT1 A;  2NYX A;  4MQV A;  1BC7 C;  2PMU A;  1IN7 A;  2Y48 A;  4HX4 A;  1SD4 A;  2XKO A;  3DP7 A;  1HKQ A;  4EQQ A;  1L3L A;  1G3Y A;  2EA4 A;  1YYV A;  1KU2 A;  1UB9 A;  1J75 A;  2P8T A;  4IRG A;  2EJR A;  2DPU A;  1FYL A;  3T0Y A;  4IVN A;  2FBH A;  4I02 A;  4MQ9 F;  2ZNY A;  2STW A;  1FWZ A;  4UHT A;  1ZG5 A;  5IT3 A;  2XHK A;  4U7B A;  3QPH A;  2H94 A;  2Z33 A;  3BY6 A;  5ICF A;  3R4K A;  4L5J A;  1ULY A;  4YG2 F;  5ILS A;  2P5V A;  4AIK A;  1PP8 F;  5CJ9 A;  4WCG A;  2VON A;  2ACJ A;  3C3W A;  3L2C A;  2XV4 S;  4UUV A;  2PI0 A;  1YLF A;  3BJ6 A;  3SZT A;  1U5T C;  5TJJ A;  5LEJ A;  3B02 A;  2VXZ A;  4EJU A;  1KU9 A;  2HYG D;  2UXN A;  1IN4 A;  5CVJ A;  6PAX A;  3P9C A;  3E3V A;  3MZY A;  2LF8 A;  3TOB A;  4BXU A;  3TO7 A;  2CO5 A;  3R61 A;  3VEP A;  5KVR A;  1D8J A;  1J2X A;  4LFU A;  3QRF F;  1SMY F;  1RIO H;  4K2E A;  3KP5 A;  1KQ8 A;  3GF2 A;  2Y0M A;  1BN5 A;  4E70 A;  1B9N A;  3KLO A;  1B4A A;  1XCB A;  2M5W A;  2GA2 A;  4L9T A;  1ZGA A;  3L00 A;  3PQJ A;  5CYV A;  5ICC A;  2L01 A;  3E5Q A;  1Z7U A;  2GIV A;  2MH9 A;  3QU6 A;  2M45 A;  1V3F A;  4Q4Z F;  2DT5 A;  1LDD A;  3C1D A;  5LRS A;  4GYG A;  4M6Y A;  1O57 A;  3VOE A;  3F22 A;  3AAF A;  2QQA A;  2FRH A;  3ZN0 A;  5DCM A;  4BYY A;  1CF7 A;  2CW0 F;  1FBQ A;  4A0Y A;  3I54 A;  3CTA A;  3KLN A;  5BPI A;  5CVV A;  2GQQ A;  2COM A;  4LLN A;  2HQR A;  3I5U A;  3LAP A;  2MD5 A;  3DPL C;  2TDX A;  5A2Q K;  1CGP A;  2H27 A;  3KP4 A;  4YFN F;  1AWC A;  2O8X A;  3L09 A;  4S04 A;  4G8X A;  1Y0U A;  1GVJ A;  3HRS A;  1TBX A;  5ILU A;  2OBP A;  3ELK A;  4BNC A;  1LDK B;  3REO A;  3SQN A;  2DQR A;  4AIH A;  1U8R A;  1BOA A;  3WTT C;  2BEO A;  2IA1 A;  2D2W A;  5L3C A;  1WQ2 A;  3BP8 A;  1ZLJ A;  4WXH A;  1LJ9 A;  3IHU A;  5HDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...