1C0WA

Crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
173
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVIVQINEIFQVETDQFTQLLDAVELLDDLAHTIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*TP*TP*AP*GP*GP*TP*TP*AP*GP*CP*CP*TP*AP*CP*CP*
publication title Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 63
structure length 173
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1c0wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1c0wA02
1TW2A 2FBIA 1I27A 2RVCA 2DQLA 4ZYGA 4G7ZF 4MTDA 4L18B 1F5TA 1YS7A 4XLNF 1RUNA 1F4KA 1OR7A 1YW8A 3KZYA 1WKMA 5ICEA 1GXQA 1Z7UA 1O3SA 4Y13A 1S3JA 4HZFA 4NQWA 1HW5A 3O3KA 3RKXA 1GHCA 2CGPA 1DPRA 1KYZA 3HRUA 3LQRA 2BBYA 3L09A 1HSTA 4HF2A 2G7HA 1KQ8A 4O3MA 2HYFA 3QAHA 3ULQB 1K7AA 4AWXB 3RTRA 1FLIA 5DYMA 4AIJA 3F22A 5D8LB 3LAPA 2CW0F 1QQIA 4WXCA 1S6LA 1B9MA 1H0MA 2QENA 1XCBA 3D5LA 3LA7A 2HQNA 4G7OF 1MJ9A 2D1VA 2OQRA 5CVUA 1HBXG 2XHKA 2D2WA 2R3SA 1ODDA 4MHGA 5LGTA 3E5QA 3TDZC 3U9GA 2IVMA 2ZFWA 1PDNC 4FX0A 4MEYF 4MQVA 2O3FA 2JT1A 4EM1A 1J5YA 2HTSA 5CLSA 4HDVA 2XVCA 2VBWA 3LAJA 5L3BA 5H20A 4HV6A 4OMZA 3FZVA 1OPCA 2FOKA 4M6YA 3GFIA 2IJLA 3B02A 2BV6A 2O6GE 1U78A 5FFXA 1I1GA 1YTYA 2RDPA 3TO7A 3IL2A 2L3DA 2BEOA 3DF8A 1R22A 2JRTA 2HZTA 2K02A 1BOAA 1OYWA 3HRTA 4Q48A 1HKSA 5D5XB 1BIBA 4RB2C 4OMYA 2YU3A 4ENKA 2GXBA 3Q9SA 1QO0D 3QP5A 1FP1D 3Q9VA 4HBLA 5HS9A 3HYIA 2E7WA 3E97A 1G4DA 3BJ6A 1FX7A 3GVAA 1QBJA 3P9CA 2FU4A 3E6DA 1RI7A 3E6MA 4OIOF 3GZ5A 3M7GA 2GWRA 1PP7U 1R23A 2MH2A 3PQJA 3V7CA 1U5TC 2Y48A 1T98A 4UXNA 2LSOA 2BE5F 5LLQA 1G3TA 1W4MA 2FMLA 4KIBA 2VE9A 1FP2A 1P4XA 5IT9Z 3FX3A 3K69A 3HOSA 4UVAA 1YW9A 1SD6A 3T1BA 4GCVA 2ADUA 4HX7A 1G3WA 2Y75A 5E20A 2HYGD 4L9NA 1ZRFA 2AXLA 3DQVC 5A2QK 4LG0B 4RS8A 4EMSA 3ML6A 3WTUC 1UCRA 2NS0A 2L4AA 2V1UA 4LGWA 4MTEA 3WE2A 2FQ3A 4A0XA 2STWA 4XRFA 1ULYA 3T8TA 3DFGA 3C3WA 1ZG3A 4G94A 4JBAA 3R6SA 1TQPA 1G3YA 1W5SA 2UZKA 2GA1A 1ZLJA 3GF2A 5HLGA 4LG0A 5DCFA 1IXRC 3DKWA 4YFNF 3V7RA 5K1YA 1SAXA 2Q8KA 4LLGF 1KU7A 4LLNA 1P92A 4A6DA 3TOBA 1Z91A 2DI3A 1XMKA 3O2PE 3V7SA 4ETSA 1V3FA 1J59A 2VODA 2J5OA 1YIOA 4P55A 2IRFG 1FWZA 1W7PD 1IN6A 3FWEA 4YFXF 4OIQF 1FYKA 4BHCA 3WTYC 5F6FA 5D4RA 3C1DA 1K6OA 1T6SA 1Z1DA 2YX7A 3RKWA 4KT5C 1XGMA 2F5FA 2GZWA 1JXSA 1IN5A 2OD5A 2FSWA 4G7HF 2IP2A 3SXYA 4HQMA 1IXCA 1T38A 3GWZA 4PDKA 3TOAA 2YPRA 2ZCWA 2D45A 3MEXA 5BS6A 3KP5A 1MD0A 4EV0A 2IPQX 4A5MA 2L02A 3I64A 3JSPA 3REOA 2DK5A 3CUQB 3BP8A 4G9YA 5K5OA 4ENMA 5E18F 4KFCA 4WCGA 2Z3YA 4M71A 1R5HA 1YG2A 1L0OC 2HKOA 2LNBA 1ZN2A 3BROA 3VODA 3KCCA 4D0PA 1F9NA 5CVJA 1YLFA 4BHPA 2LKPA 5D4SA 5JHUA 5TJJA 2EV5A 5DEQA 2F5DA 4O5VA 2EFNA 2XASA 1VTNC 1G6NA 4G6DA 3LFKA 1U5TB 3MZYA 2L54A 3OV8A 1XB4A 4EM0B 2VXZA 3E3VA 1IW7F 2IA0A 3CUQA 1KU2A 3BJOA 2RKHA 3VFZA 2P7VB 1EH7A 1KU3A 3OOPA 5CVVA 2XAJA 5LEJA 4N0BA 4QLCU 2VT3A 4EJVA 2NRAC 2Z9OA 5DUKA 1FC3A 4L5JA 1R1TA 1MZBA 4Q47A 3TKYA 5AIPA 1XDSA 4LD5A 4U7BA 1R00A 3VOEA 2M8EA 4HLXA 3I54A 4IRHA 2RNJA 2Q2EA 1YO5C 2K4JA 2DU9A 3SZPA 2QBYB 5DV5A 2FBHA 1RUOA 4HX4A 4A0YA 4NHJA 2P6SA 2EK5A 1DP7P 5HDGA 3CO7C 4Q4ZF 1JE8A 3WTWC 4M74A 3BJAA 4MEXF 4WF2A 4HOBA 4RAZA 3HHHA 3WU0A 5F1RA 5ICGA 1U8RA 3FXUA 5LRSA 1B59A 2OQGA 5BQTA 4U0VA 1S8NA 3RKYA 2DLLA 4I09A 1WRJA 4FT8A 3JTHA 3H3ZA 2CYYA 2HWVA 4EGYA 1W7PB 3SHFA 1MJAA 3WGGA 3I59B 1Z6TA 4EGZA 5H6QA 4IVNA 2EFQA 1Z05A 5FO5A 3AAFA 1XD7A 3ZN1A 2YR2A 2KIMA 4L9VA 1MDMA 3LA3A 2K27A 4BHBA 3J80K 2VC1A 4ON0A 4XSXF 3FMSA 4LLLA 1TTYA 3RJPA 4KDPA 5BMZA 1I1SA 2XAFA 4EJOA 1HQCA 2XKPA 2QZ8A 2JSCA 3K1PA 3F8FA 2MBFA 2VN2A 3DEUA 2O0YA 1G3SA 4CDGA 2M45A 2VBYA 2ZNZA 3HTUA 2XUBA 3EDPA 5A2QZ 1FNNA 3R0AA 2XRNA 1CF7B 3V8LA 1R1VA 3HRSA 2PQ8A 1BI2A 3EQLF 4LFUA 3T8RA 3FHZA 2XAHA 1QNTA 5FFZA 4HYEA 3MZHA 2E1NA 2LF8A 2XV4S 2YSRA 2M1BA 1PP8F 3HSEA 5E1WA 2FEZA 1P6RA 1Q1HA 2DW4A 4S04A 3BPXA 3QOPA 1ZG5A 4H0EA 2BGCA 5EEGA 2PFBA 5BPDA 3Q5FA 4Q5SF 1XDUA 4QWQA 3WGIA 1V4RA 2O03A 1WWXA 2Y0MA 3ZMUA 4KUMA 1USSA 5D5VB 3FMRA 1HSJA 5KK1A 3I53A 4S05A 3V8JA 4WX9A 1KU9A 3W6KB 2PLYA 2V6CA 4CHUA 2FBKA 4OIPF 2GQQA 3F72A 5LBQA 4RGRA 1FOKA 2V79A 1XSVA 2PG4A 2R7DA 3GLXA 3HIFA 1REPC 2EFWA 4HV5A 4GXOA 3B73A 2DT5A 4A2UA 1U3EM 4YIIA 3ZP5A 2QLZA 2EJRA 4UV8A 3ELKA 2L4MA 2ACJA 1DDNA 3IWZA 2R7FA 2EV6A 2OZUA 1OMIA 2JPCA 1JHHA 5D6EA 2VT2A 2XKOA 5DCMB 3I71A 2M5WA 5HLHA 4RAYA 3K1MA 2W24A 1KQ9A 4KMUX 4MQ9F 1YW7A 4KN4X 5D6FA 2ZMEB 3N97A 3IC7A 2W84A 4FHTA 4K2EA 3FF5A 2EFPA 1S7AA 4KICA 1EH8A 2DFIA 1FY7A 1O57A 2A3SA 2PMUA 1YS6A 3H92A 4EVIA 3F23A 4A0ZA 1J9IA 4RGUA 1B4AA 2Z5UA 3QPHA 3E5XA 2CQKA 1XSDA 2QQAA 2NAZA 3WE3A 4L5IA 4ZYDA 2XAQA 2ZMEA 3FMQA 3S2WA 1FBQA 1TQMA 2QQ9A 4UUVA 1HW1A 3PFIA 2F5EA 3J81K 1FYLA 1SFUA 1H9GA 1SD4A 4MGRA 2ZNYA 2NNYA 5L3DA 4EJUA 3ZMSA 4I2OA 2CSOA 5CJ9A 2DQRA 4GYGA 3MFKA 1HXDA 1XN7A 4E70A 3M8FA 1AOYA 2NNNA 3KP3A 3WTVC 3F3XA 4I01A 5JVTA 4PZJA 1P2FA 5HDKA 2ESNA 3BZ6A 3VEPA 4IJAA 1BI3A 1AWCA 2MA3A 3K9TA 1ZREA 1D8JA 3IKTA 1FSEA 5HLIA 5ILUA 5TRDA 1IRGA 2HOEA 2GA2A 4GGGA 5L3CA 5LGNA 4RB3C 1ZYRF 1XGNA 4I02A 3IRQA 2VE8A 4M9XA 2QVOA 5JFRA 3F8BA 3PQKA 1O7FA 2A69F 4IPAA 2V9VA 2WV0A 1B9NA 2FMYA 2KKOA 2DK8A 1BBYA 2M87A 4M73A 3E6CC 4HLYA 1O3QA 2G7UA 3V4GA 4EQQA 1QZZA 3C7JA 2RN7A 3GFJA 1XGSA 2AS5F 2OBPA 3K2ZA 4ZH4F 5J8FA 3TDUC 5JR3A 5LGUA 1UHWA 2YX4A 2IT0A 2HEOA 4WXHA 2K7LA 5L3GA 3COAC 2X0LA 3M1EA 4PGGA 3SQNA 2HQRA 5H6RA 4LK0F 2FRHA 1ZRDA 3TO6A 2ZKZA 4L0ZB 3KP7A 4U0WA 5J6XA 4KA4A 5J8CA 2C6YA 3DP7A 2GIVA 1KA8A 3N4MA 2ISYA 4EM2A 4RGXA 3M9AA 3KLNA 2WC2A 1LVAA 3KFWX 1QPMA 3F8CA 1ZRCA 4OOIA 1D8KA 1EH6A 2HGCA 5E1XA 3TGNA 3ZPLA 4HX8A 1ZH5A 1E17A 1FBSA 4N9HA 2JPBA 3KP2A 2EA4A 3LA2A 1I5ZA 1S7OA 4U88A 2X4HA 2VOOA 4TV7A 1IUYA 1ZLKA 3DPLC 4NB5A 3BPVA 4BYYA 4A5NA 4CZZA 5HVQC 4LJZF 3P9KA 4Y17A 1DUXC 2PN6A 2F2EA 4ZYHA 5DUIA 1OYYA 4L9JA 3QU6A 1OKRA 2A61A 3KETA 2HDCA 3G3ZA 4L9TA 4KIGA 2K4BA 3RYRA 2PBIA 1U5TA 3WTSC 3HUGA 3F8NA 3KEQA 4KIFA 4ASNA 3FXQA 4CXFA 3ECHA 1HKTA 2XAGA 3JAMK 5KVRA 1RZ4A 2GAUA 3J7AO 4M9SA 3GYHX 3HHGA 4OU0A 5F64A 1BI1A 1X3UA 2FXAA 2W25A 1Z6RA 5ICCA 5D5WB 2PJPA 3IHUA 3MAJA 1ZG1A 5FGMA 2QQBA 2E1CA 3ROUA 5CVRA 1KYWA 4BH9A 2EV0A 4XSZF 2A07F 4UVCA 2A6EF 4EJTA 3NQOA 3K1NA 2QBYA 2B0LA 3LSTA 4AIHA 1LQ1A 1I6XA 1RNLA 2CWEA 1ZGJA 4LK1F 2UXXA 2XIGA 1P4WA 2A68F 4I0BA 4MNUA 5E8GA 3CO6C 3MWMA 1P4AA 3R60A 2P6TA 2FNPA 3HSFA 3P7NA 4YIFA 1XMAA 2P4WA 3QRFF 4IF4A 1SD5A 1QGPA 3GFLA 2W57A 1IRFA 4IHTA 2NYXA 1ZARA 3T5XA 2MLGA 4LMYA 2A5YB 2MC3A 5LEKA 3HSRA 3MQ0A 3JW4A 4RB1A 1W7PA 1OYIA 1FSHA 3KP4A 3I59A 1ONVA 1T2KA 1TQIA 4EJWA 4PCQA 3RPUA 3KP6A 4P9FA 2OA4A 1LEBA 5FLXK 3RYPA 1K78B 1BC8C 2CFXA 2KIUA 5E1ZB 4HF0A 3J81Z 1O3RA 2HFHA 2JZYA 1IAWA 3T0YA 1USTA 1J0RA 4FX4A 1DPUA 4IXAA 2Z33A 3GEZA 4WK8F 1JGSA 2Q0OA 1XCVA 1J7KA 1ZAOA 5E17F 2UXNA 3LQQA 2D1HA 1KQ0A 4XBFA 2TDXA 1TW3A 2J5PA 2H27A 4N9IA 3EYYA 5D8KB 2K86A 2P8TA 4RGSA 4U0YA 3L7WA 4A12A 1HW2A 3HTSB 1W5TA 1K78A 3ZMZA 1R58A 1FYMA 1ZGAA 2ZXJA 2KJCA 1T0FA 4WWCA 1CF7A 1UHMA 3IKVA 1WI9A 3RI4A 4HW0A 5L3EA 3WODF 2DO7A 2RGVA 1HKQA 1YYVA 3M8EA 1STZA 4M9ZA 1C0WA 4GYIA 1FPQA 1BI0A 3GXOA 3MCZA 4ZYEA 3BDDA 5ILSA 3I4PA 4RB0A 5BPIA 1SMYF 3BWGA 4UHTA 1B6AA 1IN7A 1F1ZA 1MKMA 1H9TA 5K5QA 1D5VA 2ETHA 3QU3A 2HTJA 3GO5A 3HOTA 4HDUA 1IN4A 2O8XA 3QP6A 6PAXA 3WTZA 3P9IA 1U6GA 4LB6B 4IRGA 3ZMDA 2CO5A 2H6BA 1JHFA 2DPUA 3TQNA 1SD7A 2QWWA 1CGPA 3E6BA 3C18A 2P5KA 3HRMA 1R1UA 2KJBA 2EWNA 3IWFA 2IA1A 1NHAA 2FA5A 3CUQC 5LHHA 3DXJF 3GX4X 2PI0A 5AIQA 2E7XA 1BN5A 1FZPB 2STTA 1GXPA 2ELHA 5FD5A 2OZ6A 1GVJA 3EYIA 1R36A 3F8MA 3G73A 4ESFA 1FT9A 4LB5A 4WXDA 3L00A 5ED4A 1A04A 3E5UA 2OAZA 1MGTA 2RQPA 2VBXA 5AONA 3IRRA 2WTEA 1ON2A 3RIRA 3W6JB 4KMFA 1SFXA 5DCMA 3O6BB 3DV8A 4YG2F 3BOQA 1LJ9A 4HF1A 1LEAA 2L01A 2FF4A 3ISPA 2VOPA 3ECOA 1LDDA 4R79A 4IHSA 3I5UA 2V1XA 1Y0UA 3R61A 3WGHA 4P9UA 5BOXA 1J75A 2CG4A 4CO8A 2ISZA 2QUFA 2HS5A 2G9WA 5HDNA 1S29A 5DD4A 5L3FA 3JAMZ 5LHIA 1IZ1A 2V1DA 1YQAA 2QYOA 5FB2A 5HS7A 1EV7A 4R8HA 2EB7A 4DNCA 2DPDA 5FD6A 2UWMA 5HS8A 4G8XA 2KIFA 1R5GA 1IXSB 3ZMVA 4B8XA 1LNWA 2LF7A 2QM3A 4L0YB 3WTTC 4HQEA 2ESHA 1KGSA 1BM9A 2F5CA 2XROA 4BXUA 2DBBA 3F21A 2OU2A 5CVIA 2RV8A 3QPTA 1J2XA 1LDKB 3CTAA 1E2XA 4JQFA 2P7CB 1QZYA 3FM3A 1SMTA 4A6EA 5DD8A 1R7JA 3CJNA 3CUOA 3KZZA 1TNSA 4HAMA 2COMA 3EETA 1ON1A 3J80Z 1FBUA 2IW5A 1MJBA 2PMHA 3TO9A 2JTVA 1K79A 2MLKA 3NRVA 2HR3A 3U2RA 4UVBA 2VONA 4AVPA 4KNYA 1TLHB 5ILVA 2EFOA 3L2CA 1PUEE 3LWFA 3KE2A 4P5OA 2H09A 1XGOA 1D3YA 5FLXZ 4ZZDA 5ERIA 4ESBA 3RPQA 1TBXA 3L9FA 4ENJA 5IT3A 1TNTA 2BYVE 5DDGA 5LHGA 2PEXA 3KEOA 1UFMA 2DTRA 3K0LA 1U2WA 4F7ZA 2VC0A 3RDIA 1LB2A 1UB9A 3GFMA 1IF1A 2HKXA 3BY6A 3VB2A 1T39A 5ICFA 1IN8A 1XSXA 3CLOA 2GXGA 2H6CA 3V8KA 4OINF 2WWYA 3R0JA 2DAOA 5D5UB 3I58A 3GW2A 4Z2YA 2KRFA 4G6QA 4ENNA 5IT9K 3ZQ7A 2ZBKA 3F6VA 3KLOA 1BIAA 3WTXC 2IA2A 1BJAA 1RIOH 2ZJ2A 4JK1X 4DQ2A 1SFEA 3GUDA 3ERED 2O61A 4M72A 5CYVA 1WQ2A 5JI6A 4UNOA 3R4KA 2MD5A 4BNCA 5LRRA 4CICA 3H3UA 3ABTA 1O7LA 3DPTA 2EA2A 2XGXA 3ZMTA 1Z9CA 3SZTA 4AIKA 4UV9A 4M6XA 1ZHFA 4I98B 3D0SA 2Z99A 4KN7X 3GZ6A 3NEUA 4O6JA 2P5LC 3JTGA 2ZO4A 2A6HF 4I7HA 2H94A 4YFKF 3I0TA 4I0AA 5HOOA 4R1HA 5E8IA 2FNAA 4KYWA 4IRIA 4GO1A 4Y15A 1O3TA 1MDMB 2RC4A 5K5RA 5EEHA 4AD9A 3CDHA 4B09A 3JSOA 3SFZA 1L3LA 3WU1B 3FXRA 3F6OA 3EUHA 3ZN0A 4P96A 3WG9A 1B1BA 4BQAA 4ZZLA 3ABUA 4PGHA 1LDJA 2M30A 3FM5A 2VBZA 4CGZA 4CYDA 2FE3A 1WSUA 4ESJA 4HA8A 4XLPF 4OIRF 2P5VA 1BC7C 3U1DA 4U7DA 2W85A 2LDUA 4BAYA 2MH9A 1YFHA
chains in the Genus database with same CATH superfamily
4FE4A 5J1RA 1QZEA 1TW2A 2OUMA 2FBIA 1EF4A 1I27A 2RVCA 5E3OA 2M0MA 4HNUA 2DQLA 3OMYA 4ZYGA 4J19A 4G7ZF 4MTDA 4L18B 3OR1C 1F5TA 3UR3C 1YS7A 4XLNF 1RUNA 3K2AA 1SAUA 1F4KA 3CCVI 1OR7A 2HZDA 1YW8A 4U87A 4AYBN 1S5LC 3KZYA 1WKMA 5ICEA 1GXQA 1IO2A 1Z7UA 1O3SA 1YX3A 4Y13A 1GUUA 1S3JA 4HZFA 3GTPJ 4NQWA 1HW5A 3O3KA 2VKDA 3RKXA 3Q0UA 1OQYA 4YIRX 1GHCA 2CGPA 1DPRA 2Z2SB 4CH7A 2HQ5A 1KYZA 3HRUA 3LQRA 1MW7A 2E60A 1V54H 5EZGA 2BBYA 3L09A 4JX4A 1HSTA 4HF2A 2G7HA 1KQ8A 4O3MA 3GTLJ 2ID3A 4CUGA 4LITA 2HYFA 3QAHA 2H8RA 1LFBA 3ULQB 1K7AA 3K4MA 3CC2I 4AWXB 3RTRA 2R7WA 5IPAA 3NWTA 4LG3A 1FLIA 5DYMA 4AIJA 3F22A 5D8LB 3LAPA 4UY8I 2CW0F 1QQIA 2NOJB 4WXCA 1S6LA 1B9MA 5B1AH 1H0MA 2QENA 1XCBA 3D5LA 3LA7A 4PSWA 3KPHA 2HQNA 1I39A 3GTKJ 4G7OF 2BY0A 1MJ9A 2D1VA 4PJLA 2OQRA 3OS1A 1RPWA 4LIVA 5CVUA 1HBXG 2XHKA 4NNJA 1G59A 2D2WA 4YELA 3W6VA 2PMZN 2R3SA 1ODDA 2GOMA 3MKLA 3K4BA 4MHGA 2LK2A 1F36A 1XC5A 5LGTA 4ABZA 1R49A 3E5QA 3JR9A 3TDZC 4XK4A 3BQZA 3U9GA 2L9SA 2IVMA 2ZFWA 1PDNC 4FX0A 5BNGA 4MEYF 3DKXA 4MQVA 4Y7NJ 2H8WA 2O3FA 2JT1A 3JRDA 4V19K 4EM1A 1J5YA 2FJ1A 2HTSA 3GBGA 5CLSA 2DMNA 4HDVA 2XVCA 1BW6A 2VBWA 2DOFA 3OIQA 3LAJA 3BTIA 5L3BA 4A3DJ 2R7TA 5H20A 4HV6A 5KHDA 3VYRB 1NG6A 1TC3C 4OMZA 4JOMA 2E5ZA 3SEQA 5EEAA 3FZVA 1OPCA 2FOKA 4M6YA 1BL0A 3GFIA 2IJLA 3S16J 2WAFA 3LSIA 3L2VA 3B02A 2IS6A 2BV6A 3A01A 1PUFB 5HNFA 2IBDA 2O6GE 3N05A 2HPIA 1U78A 5KCMA 5FFXA 1I1GA 4PJ0C 1YTYA 2RDPA 2L9RA 4J00A 3S2DJ 3TO7A 2AHQA 3OYEA 3IL2A 2L3DA 2BEOA 3DF8A 3I55I 5M5WJ 3BG6A 1WFXA 4HNVA 1R22A 2DA7A 2JRTA 1CQTA 3PM1A 5FKKA 1FTTA 3S8PA 2HZTA 2K02A 2Y0SN 3OYCA 1BOAA 1OYWA 3A0HC 2LRDA 4KITB 3HRTA 4Q48A 3W2VA 1HKSA 5D5XB 2E1MC 4II3A 1BIBA 1D0XA 3BC8A 4RB2C 4OMYA 2R92J 3HG9A 2WBMA 1NK3P 2IXSA 2YU3A 1POGA 4ENKA 3CCMI 2GXBA 4XLCA 4JX5A 1K6YA 3Q9SA 2MSYA 1QO0D 3FXLA 3QP5A 2CW7A 2ZXWH 2GLOA 2MYSA 2JWTA 1FP1D 3S3MA 2I8DA 4KJZA 3Q9VA 3S1QJ 2VPLA 3H0GJ 2DODA 4HBLA 1M1EB 5HS9A 3BR2A 3E0JB 3HYIA 2E7WA 1ETOA 5CQGA 1V5FA 3E97A 4MLOA 1G4DA 1IG7A 2ME6A 3BJ6A 1FX7A 3DKYA 2QSFX 3DTKA 1MBJA 3GVAA 3P9CA 4PJNA 4D7NA 1QBJA 3RCOA 2JRMA 4BS9A 2CV2A 2FU4A 3E6DA 1RI7A 3E6MA 2R5ZB 2EPFA 2WADA 1NG7A 3GZ5A 4OIOF 3M7GA 3ZQQA 3PUBA 2W48A 1B8IA 2GWRA 1PP7U 1R23A 3UNGC 1ETKA 1JKQC 2MH2A 3PQJA 3V7CA 4BGDA 1U5TC 3VSKA 2Y48A 1VQ7I 1T98A 3DEEA 1GLNA 3ZQGA 2K9SA 4UXNA 2LSOA 2F6CA 2BE5F 3K4LA 4C3HJ 2JA7J 3SEZA 5LLQA 1G3TA 1W4MA 1JTYA 4F91B 2LFBA 2ZSHB 1UMQA 3HPHA 3L2UA 2QKMB 2QSGX 2DMUA 2FMLA 3CJRB 4DGWB 4KIBA 2VE9A 3OSGA 1ZR4A 1FP2A 4FQGA 1RQ6A 5J4YA 1P4XA 2QA4I 5IT9Z 1OISA 4B43A 2O7OA 2LVSA 2KL4A 2CRGA 3A2KA 3FX3A 3K69A 2L7ZA 5B66C 5HNHA 3HOSA 5EG0B 4UVAA 2XPUA 4NC7A 1A5JA 1YW9A 1SD6A 3VYSB 3ZGKA 3T1BA 2Z16A 2KLOA 2ADUA 4GCVA 4DYQA 2QCOA 4HX7A 5F0CA 1KONA 2K3FA 1G3WA 2Y75A 5E20A 2HYGD 4KT6A 4FTHA 5E3MA 4BEHA 4L9NA 4CCNA 2AXLA 1ZRFA 3CC7I 3DQVC 5A2QK 4LG0B 5A2QR 4RS8A 4EMSA 3CMMA 3ML6A 3WTUC 3CCLI 2R5YA 3HKZN 1UCRA 2NS0A 2L4AA 2B63J 2V1UA 4LGWA 4MTEA 3WE2A 2FQ3A 3M07A 2EH3A 2XGCA 3SZGA 1H89C 2EINH 4A0XA 3K70C 2STWA 4XRFA 3H5AA 3OSFA 1ULYA 3T8TA 4DYRA 3DFGA 3C3WA 1ZG3A 4G94A 2UUZA 1WHUA 2DJIA 4JBAA 1Y6IA 2DA1A 2KT0A 3R6SA 4A3BJ 4CYCB 1TQPA 1J09A 1G3YA 2X1CA 3S32A 4IQ4A 1W5SA 1E3OC 5EG0A 4A3KJ 2UZKA 2GA1A 3CCEI 1ZLJA 2M8GX 4F92B 3FKIJ 2M7AA 3GF2A 3MZ8A 4CA0A 2DN0A 3K70D 5HLGA 1TWFJ 3LSGA 4XLAA 4LG0A 3SDGA 3CDLA 5DCFA 5FKOA 1IXRC 3DKWA 3MKZA 1PJRA 4QIWN 4YFNF 3V7RA 4EATA 1VQLI 5K1YA 1SAXA 2Q8KA 4LLGF 1KU7A 3VWBA 4LLNA 3EUAA 1P92A 4A6DA 3TOBA 3ABMH 1Z91A 1DP3A 2DI3A 1X2NA 1XMKA 3F9KA 3O2PE 1YRNB 3V7SA 4ETSA 1V3FA 1J59A 2VODA 2J5OA 1FMVA 3OYKA 1YIOA 3BCAA 4P55A 2IRFG 2VKVA 1FWZA 1W7PD 2DT6A 1IN6A 3FWEA 4F3QA 1HF0A 4YFXF 4OIQF 1LE8A 1FYKA 4HEA2 4BHCA 3WTYC 5F6FA 5D4RA 3C1DA 1K6OA 3RPUD 1EJ9A 1T6SA 1Z1DA 2YX7A 3MD2A 3RKWA 4KT5C 1XGMA 1H8AC 2F5FA 2VL8A 3H35A 2GZWA 2X9DA 3OS0A 1Z0XA 1Z3XA 2LMDA 1JXSA 1IN5A 2LR8A 2OD5A 2FSWA 2QF7A 4G7HF 2K9LA 3H1CA 2IP2A 1QHGA 3HXLA 3SXYA 3C2HA 4HQMA 1IXCA 3OOUA 3GWZA 4PDKA 1T38A 3TOAA 2G0EA 3H5NA 2YPRA 4FETA 1HA8A 2ZCWA 2D45A 2L7FP 2VASA 3MEXA 5BS6A 3KP5A 3S14J 1MD0A 4E7LA 1IDZA 4EV0A 2DMQA 2IPQX 2E1MB 2L02A 4A5MA 3CC4I 1YRNA 3K4KA 3JCUC 3I64A 3JSPA 3L1PA 1T0FC 4OAYA 3LFUA 3WHBA 4ZDLA 3REOA 3PIOF 2EZIA 4XICA 1AHDP 2DK5A 3CUQB 3BP8A 4G9YA 5K5OA 4ENMA 5TGTA 2AXTC 5E18F 4KFCA 4WCGA 4AU7A 2Z3YA 3ESWB 4M71A 1R5HA 1YG2A 1L0OC 3CCUI 2HKOA 2LNBA 1ZN2A 2K9MA 4A3CJ 5GAGJ 2E2IJ 2VKEA 3G6EI 3DBHB 3BROA 3VODA 3KCCA 4D0PA 1F9NA 5CVJA 1YLFA 4BHPA 2LKPA 1Y8QB 3ZXSA 2F5VA 3ZQLA 5D4SA 5JHUA 3AL0C 1D0ZA 4I76A 5TJJA 2EV5A 5M5XJ 4A3MJ 3PNTA 5DEQA 3QYBA 2F5DA 1K61A 2IS1A 4O5VA 4II2A 2EFNA 3J7ZI 2XASA 3OYIA 1VTNC 1G6NA 2V9KA 2NVXJ 4G6DA 5IP7J 3LFKA 5J4VA 1U5TB 2WB1A 2LY1A 3HUGB 3FK7A 3MZYA 1AA7A 2L54A 3OV8A 1XB4A 3JRAA 4EM0B 2VXZA 3E3VA 1IW7F 2IA0A 3AG2H 3CUQA 1KU2A 3BJOA 3DWLE 2ZJRF 3FXOA 2RKHA 2XC7A 3VFZA 1ETQA 2P7VB 4D1QA 1EH7A 2M34A 1KU3A 3OYDA 3OOPA 2BY2A 2L2OA 5CVVA 2XAJA 5LEJA 4N0BA 2JUCA 4QLCU 2VT3A 4EJVA 1B72A 3ZRGA 2RQQA 2NRAC 1S72I 2Z9OA 5DUKA 4NC8A 5E3NA 1Q1VA 3CF5F 4DZPA 1E0EA 1FC3A 4L5JA 2KRCA 2WB1N 1R1TA 3CF2A 1MZBA 4Q47A 3TKYA 3OL3A 3JRGA 3HOXJ 5AIPA 4ZDOA 2MW8A 2VQCA 1XDSA 4LD5A 2VIXA 4U7BA 3HGYA 1R00A 3VOEA 2M8EA 4HLXA 3I54A 4IRHA 2RNJA 3K4NA 2Q2EA 3FISA 1YO5C 4J01A 2K4JA 4BE2A 2DU9A 3SZPA 2QBYB 5DV5A 3WU2C 4E7KA 2KQRA 3HM5A 2X51A 4BBSJ 2FBHA 1RUOA 4HX4A 4A0YA 4NHJA 2P6SA 2FX0A 4B1RA 2DDAA 2EK5A 3FBNB 3PSFA 2E71A 2JA2A 1WJDA 1DP7P 5HDGA 3FKJA 1SVMA 5GTHC 1MSFC 2TCTA 1DU0A 1JUMA 3CO7C 4IOAF 4Q4ZF 1JE8A 4DIQA 2WAEA 4DZJA 3WTWC 4M74A 3BJAA 4MEXF 4WF2A 4HOBA 4RAZA 1X4OA 3HHHA 3QPSA 3WU0A 5F1RA 5ICGA 1U8RA 3I4NJ 3FXUA 2CFOA 2R7OA 5LRSA 1B59A 2OQGA 5BQTA 4U0VA 1S8NA 2KPMA 3OL4A 4E7JA 3RKYA 2DLLA 4I09A 1IC8A 2FD5A 1DGWY 1WRJA 4BDYA 1Z3YA 2VI6A 4FT8A 2NVUB 2X6OA 2FQ4A 3JTHA 1EKEA 3H3ZA 4RDUA 2CYYA 3C2BA 2HWVA 3EUKL 4X6AJ 4EGYA 1JUSA 1GVDA 1W7PB 3SHFA 1MJAA 3WGGA 4DBQA 3I59B 1Z6TA 4EGZA 1I3QJ 5H6QA 4IVNA 3BR1A 3J7AW 2DDBA 3LSMA 1ETYA 4XRSG 3CD6I 1MMGA 1SVOA 3B6CA 2EFQA 4IO9F 1Y8RB 5F0HA 1IJWC 1FMWA 3RKQA 4IHXA 1FEXA 1P7IA 1Z05A 5FO5A 1FOWA 3AAFA 1XD7A 1GV5A 1T8IA 3ZN1A 1U0JA 2YR2A 1JI8A 2KIMA 3H0DA 2Z1DA 4L9VA 3LNQA 1MDMA 3Q3SA 2CUEA 3LA3A 2K27A 4BHBA 3J80K 2VC1A 1MMNA 1MIJA 3BCBA 4ON0A 4XSXF 3FMSA 4Y3OA 3S3OA 4LLLA 3GLLA 4IHWA 1TTYA 1MBGA 3W2WA 3RJPA 4BDZA 4KDPA 4G12A 5BMZA 2XAFA 1I1SA 2BY1A 3G4SI 1Y56A 3HOWJ 1QHHD 3PNVA 4EJOA 4XQFA 1HQCA 1JT0A 1WGXA 4RAGA 1MBEA 2ECCA 2XKPA 2QZ8A 4E4HA 4E6KG 3H5RA 1MNDA 2VJ4A 2JSCA 4A3JJ 3WHCA 4EEFG 2BVMA 2W00A 2OTJI 3K1PA 3F8FA 1DU6A 2MBFA 4N4OB 2L9NA 2XSDC 5K7HA 2VN2A 3OYMA 1ZQ3P 3DEUA 1MH3A 2O0YA 4Y4RA 3IH4A 1G3SA 4CDGA 4PJJA 5LD2C 1WZ2A 2M45A 2VBYA 2IS2A 5EGOB 2ZNZA 2KZVA 4DW6A 3HTUA 3HOZJ 2XUBA 3EDPA 3X2QH 5A2QZ 1P9QC 2P0TA 1FNNA 3R0AA 2XRNA 1CF7B 5F1JA 3V8LA 4QTRA 1R1VA 3DLAA 3HRSA 4NBQA 3I56I 4XOPA 2PQ8A 5E79C 1JKPC 1BI2A 3EQLF 4C3IJ 2LC2A 4RLFA 3BZCA 4LFUA 2LP0A 1X1BA 3T8RA 3FHZA 5FLVA 2XAHA 2VB6A 1QNTA 5FFZA 4HYEA 3MZHA 4C2MJ 5F27A 2E1NA 2LF8A 2XV4S 2YSRA 2M1BA 1VQNI 4HRIA 1PP8F 3HSEA 3HOVJ 5E1WA 2FEZA 1P6RA 1Q1HA 2DW4A 5J1YA 4S04A 3AL0B 4N4NB 2DOAA 4XLFA 3BPXA 2ZFUA 5K7FA 2MVTA 3QOPA 1JKRC 5CQEA 1ZG5A 4H0EA 2BGCA 5EEGA 3MN2A 2KZGA 2PFBA 5BPDA 3Q5FA 3PUFA 2VUMJ 1QU3A 1SANA 4Q5SF 1XDUA 4QWQA 3GTOJ 3WGIA 5EGOA 1V4RA 2O03A 2E35A 1WWXA 3HGGA 3SFIA 4E7ZA 2Y0MA 2XF7A 3OYLA 3ZMUA 4DJAA 4AIDA 3JRFA 1TWCJ 2ICWG 4KUMA 1MNMC 5B3SH 1USSA 5D5VB 4YEJA 1OCZH 1MBKA 3FMRA 1HSJA 4ZYAA 2CH0A 1BR1A 3PL8A 5KK1A 3I53A 4S05A 2DOEA 2VXDA 2HNHA 3V8JA 1D1CA 4JP0A 4WX9A 2JA5J 4XIDA 1KU9A 3W6KB 2PLYA 2V6CA 4XR6A 2I10A 4XNFA 4CHUA 1G8XA 3OYAA 2FBKA 3JRCA 4OIPF 2GQQA 3F72A 3G1OA 2X6XA 5LBQA 3QPLA 3GMEA 4RGRA 5B1BH 3NWSA 3CMEI 1FOKA 2V79A 1XSVA 1ZGWA 3BTLA 3OWTA 2HXIA 1DQUA 2PG4A 2GM4A 2R7DA 3GLXA 3VSLA 3HIFA 3CQZJ 1REPC 3C2GA 3JRBA 2EFWA 3M1CA 1FTZA 4HV5A 4GXOA 5FROA 1TL8A 2MD0A 3B73A 2DT5A 1WPKA 4A2UA 1U3EM 2R7XA 4YIIA 5GPAA 3ZP5A 2QLZA 2EJRA 4C3JJ 3PIPF 1RC9A 4UV8A 4ZDPA 1WJAA 2OC6A 3ELKA 2L4MA 5F08A 1VI0A 2ACJA 1Y1WJ 1DDNA 5FKNA 2JVGA 1T95A 1HCRA 1UJ8A 2MG4A 3IWZA 2R7FA 3CP2A 2EV6A 4LIUA 5GPCA 1PUFA 3BR3A 2AO9A 2OZUA 5IYBJ 1OMIA 3ASNH 1VQ8I 4PJMA 2JPCA 1JHHA 2ME0A 5D6EA 2XF6A 2VT2A 2XKOA 5DCMB 3I71A 3ABLH 2L7MP 2M5WA 5HLHA 4ZC3A 3ZR8X 4F55A 4RAYA 3K1MA 2W24A 4PSXA 4IQJA 1KQ9A 2X6WA 4KMUX 1SVLA 3AG1H 4MQ9F 1YW7A 1DGRM 4KN4X 1YIJI 5D6FA 2ZMEB 3AG4H 3N97A 3IC7A 2W84A 4FHTA 4K2EA 3FF5A 2F48A 2EFPA 1X1AA 2QEXI 2EZHA 2X85A 2CV1A 1S7AA 3OIOA 4KICA 4RBOA 1EH8A 4HPQA 4X1EA 2LYCA 5IP9J 1UZCA 1V5GA 2LBFB 1MMSA 4PFPA 1NH3A 4E7SA 3ABKH 2DFIA 1FY7A 1O57A 4ITVA 3SDBA 2UV1A 2A3SA 2PMUA 2ZXIA 1WH5A 1YS6A 2V7FA 3H92A 4EVIA 3F23A 3S17J 3A02A 4A0ZA 1IUFA 2BXZA 2NXNB 5IOYA 4C2TA 1J9IA 2BW3B 4RGUA 1B4AA 2M4KA 2Z5UA 3GCMA 3QPHA 4OWRB 3E5XA 3E7LA 5GAHJ 2CQKA 1XSDA 1MNEA 2QQAA 2NAZA 3WE3A 4P1WA 4L5IA 4HG2A 2JA8J 1UG2A 4ZYDA 2R5ZA 2DA3A 3BZKA 4M3EA 2XAQA 4RM2A 2ZMEA 3FMQA 3S1MJ 3RZDJ 3S2WA 1FBQA 1YOVB 1TQMA 2QQ9A 3G1MA 5IYDJ 5EF6A 4UUVA 1HW1A 3RZOJ 3RQIA 2M2EA 5FRNA 3PFIA 1X3ZB 2QSHX 2F5EA 3J81K 3J81R 2MABA 2LTPA 1FYLA 1SFUA 1HDPA 2XSJC 1H9GA 1SD4A 5FRMA 3EUHC 4MGRA 5J47A 2DYSH 3M4OJ 2WA0A 2ZNYA 2NNYA 4XORA 5L3DA 3CCYA 4EJUA 3ZMSA 4I2OA 1VZ0A 2CSOA 5CJ9A 2DQRA 4GYGA 5C3EJ 1S7EA 1HXDA 1XN7A 2BHZA 3MFKA 4E70A 1XTAA 3M8FA 1T08B 1QA6A 2NNNA 5C4XJ 1AOYA 3KP3A 3WTVC 4BL0B 2BW3A 2LG4A 1U8BA 1U9NA 3F3XA 4I01A 5M3FJ 5JVTA 1NK2P 2CQQA 1NTCA 4PZJA 1MBFA 1E3HA 1P2FA 5HDKA 4CCKA 2ESNA 3QOEA 3BZ6A 4MFDA 3VEPA 2KFDA 4IJAA 4CCMA 3BR6A 1BI3A 1AWCA 4BE0A 3DEWA 2MA3A 2GIZA 3K9TA 1ZREA 1D8JA 3EPZA 3IKTA 1FSEA 2F4IA 3K4JA 2EIKH 5HLIA 3BQYA 4RMNA 5ILUA 5TRDA 2DMPA 5C44J 4DOZA 1IRGA 2HOEA 2GA2A 4GGGA 5L3CA 5LGNA 4C2UA 4RB3C 3L2RA 1ZYRF 1WJBA 4FISA 1XGNA 3BLYA 4I02A 2VE8A 4M9XA 3IRQA 2QVOA 3HOYJ 4D7MA 5JFRA 3HEFA 3F8BA 1OR7C 3PQKA 1XG1A 1O7FA 2A69F 4IPAA 2V9VA 4MO7A 2WV0A 3I4MJ 1SEUA 1IV8A 4NDLA 1ERDA 1B9NA 5JVGF 2FMYA 2KKOA 2DK8A 1OCRH 1BBYA 2I5UA 3CESA 1TZLA 2M87A 1X19A 2CMPA 4M73A 4CYCA 3JRIA 3E6CC 9ANTA 3BR5A 4HLYA 1O3QA 2G7UA 3S3NA 3V4GA 2KDOA 4DYCA 1LKXA 4EQQA 1QZZA 1VF9A 2E36A 3C7JA 3TP3A 3KYCB 2RN7A 3GFJA 1XGSA 3W2AA 2K9QA 2AS5F 2OBPA 4D5CA 3K2ZA 3FBIB 1OCPA 4ZH4F 1A6QA 1UELB 5J8FA 1LVKA 2NVTJ 2AQFA 2AQEA 3TDUC 3S1RJ 2O9LA 3A03A 2R7VA 2VPRA 5JR3A 5LGUA 1UHWA 2VKHA 1IV6A 1G2HA 1QVTA 1D0YA 2X1EA 2YX4A 2RAEA 2IT0A 2HEOA 2MC4A 4WXHA 4BKXA 2L0KA 2K7LA 5L3GA 3COAC 2LH9A 2X0LA 2CW8A 2GBYA 3M1EA 4YRVA 4IHYA 4PGGA 3VDXA 1ZR2A 3SQNA 3QQAA 2HQRA 2CS3A 4LK0F 5H6RA 2DA4A 1TWAJ 2FRHA 2OCEA 3L2WA 1ZRDA 3TO6A 2BXYA 2ZKZA 4L0ZB 3KP7A 4U0WA 1YHQI 3KYLA 2QQ8A 3K4CA 5J6XA 1YJ9I 3CCSI 4KA4A 2V4JC 2VJIA 1Y39A 1ZELA 5J8CA 2C6YA 3DP7A 4XN0A 2GIVA 4UUTA 1KA8A 1GV2A 2HXOA 3N4MA 1KZHA 2ISYA 2YU9J 1FOXA 1IGNA 4EM2A 2Y30A 4M6VA 2IEKA 3HL2A 4A93J 4RGXA 3M9AA 4A3LJ 3KLNA 2LD5A 2WC2A 4RAFA 1LVAA 3KFWX 1QPMA 3F8CA 1ZRCA 4OOIA 3KYDB 1D8KA 1EH6A 2HGCA 3FDYA 2DCEA 4GFBA 5E1XA 3TGNA 3ZPLA 2JVHA 4HX8A 1ZH5A 1E17A 1FBSA 4PFOA 5DS9A 2TRTA 4N9HA 2JPBA 3DCFA 2MUNA 3KP2A 5CKTA 2OTLI 1BW5A 1EA3A 5GTIC 3GZNB 2EA4A 3LA2A 1I5ZA 4H4KC 5KAIC 1S7OA 4U88A 2R7QA 3BT9A 3S1NJ 2X4HA 3F0CA 2E2HJ 2VOOA 4TV7A 1IUYA 1ZLKA 3DPLC 4NB5A 4UUSB 3BPVA 4BYYA 3OYNA 4A5NA 3FHNA 4ANJA 4CZZA 5HVQC 4LJZF 2BOLA 1LUJB 3P9KA 2GOXB 4Y17A 1GDTA 1JT6A 2NVYJ 4HNTA 1ETXA 3CMAI 3QYFA 1DUXC 1MMDA 2PN6A 1APLC 1SFKA 2F2EA 3TEDA 2HVQA 2WY8Q 4ZYHA 2JK3A 5DUIA 1RKWA 1OYYA 4L9JA 5F0FA 3QU6A 3PFYA 1JJ8C 1OKRA 5EZHA 2A61A 2VQGA 3KETA 2QKLB 2HDCA 3IAS2 5GAEJ 1MSEC 3G3ZA 4L9TA 4KIGA 2K4BA 4FASD 3RYRA 2PBIA 3J7AY 1U5TA 3K7AJ 3WTSC 3OIPA 2ZJPF 3HUGA 4Y52J 3A1YA 3F8NA 2Q1ZB 3KEQA 4BQNA 4KIFA 4ASNA 4BY7J 3FXQA 4CXFA 3ECHA 1YX5A 4XRMA 1HKTA 2XAGA 3JAMK 3VYUB 5KVRA 1RZ4A 4M3DA 1TWGJ 2L7KA 3JAMR 2GAUA 3J7AO 3OYGA 4M9SA 4BBRJ 1X1PA 3GYHX 3HHGA 3QYEA 4AUXA 1RKTA 1MBHA 2O8KA 3P5JA 2BVLA 2GXAA 2CQXA 4OU0A 5F64A 1BI1A 1X3UA 2DFEA 2FXAA 4D9JA 2W25A 1H88C 1Z6RA 1YITI 5ICCA 1X2MA 5D5WB 2PJPA 1ZK8A 3IHUA 1MH4A 3GTQJ 3MAJA 1ZG1A 5FGMA 2QQBA 2E1CA 1W5CC 3ROUA 4BQQA 1R4MB 5CVRA 2PX9A 2M35A 1W0TA 1KYWA 4BH9A 2EV0A 4XSZF 2A07F 3CCQI 1AKHB 4UVCA 3I9V2 2A6EF 3AG3H 3JREA 3GTJJ 4EJTA 4CCLA 2A05A 3NQOA 4I6ZA 3ONQA 3LSHA 4XM3A 3K1NA 4NUBA 2MGQA 1VNDA 1FIPA 2QBYA 1VQ6I 4FCYA 2B0LA 3LSTA 4AIHA 4GDFA 1LQ1A 1I6XA 5DM7F 1RNLA 2CWEA 4BY1J 1ZGJA 1ENHA 4LK1F 2UXXA 4RLQA 3B6AA 2XIGA 3AKZA 1VQKI 2X1DA 1P4WA 2X48A 2A68F 4I0BA 1A35A 5HLTA 3HC7A 4MNUA 4A3GJ 5E8GA 1MMAA 3CO6C 4BXXJ 3MWMA 1P4AA 3R60A 2HVSA 2KP6A 2P6TA 2FNPA 3HSFA 3P7NA 4YIFA 4A3EJ 2XGDA 1XMAA 2P4WA 4IL6C 4S0HB 1K83J 2XDVA 3QRFF 4NQWB 1I50J 2E34A 4IF4A 2DJNA 1SD5A 1QGPA 3GFLA 1YJWI 2W57A 3CP8A 3FK6A 3J80R 3KIOA 2M7BA 1IRFA 2JJ7A 4IHTA 1BR4A 1PVEA 1X1DA 1ZARA 2NYXA 3T5XA 4AYBA 1RR7A 2MLGA 4BJ5C 2VQHA 5CPRB 3FXKA 5J3LA 2HI3A 2A5YB 2MC3A 4LMYA 3HSRA 5LEKA 3MQ0A 3JW4A 4RB1A 3KX2A 1W7PA 1OYIA 4XKBA 1FSHA 3KP4A 3I59A 2XB5A 1ONVA 1T2KA 2EIMH 1Z77A 1IDYA 1TQIA 1WVRA 2KDZA 4EJWA 2HDWA 1OLTA 1P7JA 4BU2A 2KRHA 4PCQA 2P0WA 3RPUA 3KP6A 4P9FA 3TP0A 2OA4A 2VJJA 5GADJ 1R4NB 3IUOA 5FLXK 1LEBA 3RYPA 5JLXA 5FLXR 3HOUJ 3PJRA 2O5RA 1K78B 2QGUA 1BC8C 2CFXA 2KIUA 3RSNA 3DU5A 5E1ZB 4HF0A 5JHFA 3J81Z 1F43A 1O3RA 2HFHA 2JZYA 4F93B 1IAWA 3J7YJ 3T0YA 1USTA 5FKMA 1J0RA 4FX4A 1DPUA 4IXAA 3OY9A 1ACIA 3FXMA 3LSJA 4XKCA 4G6TB 1N25A 2PMZA 2XGEA 2Z33A 1K4TA 5IP6A 3GEZA 4WK8F 1R6RA 2MZ4A 3DU6A 3M8JA 1JGSA 2Q0OA 4ZTFA 3TW6A 3HBLA 1XCVA 1J7KA 1ZAOA 3ZQHA 5E17F 2UXNA 3LQQA 2D1HA 2FOWA 1KQ0A 2XRLA 4XBFA 2LREA 5FJ8J 2OPTA 2TDXA 1TW3A 1Z7LA 2R7RA 4NC6A 1VQ5I 2J5PA 2H27A 4N9IA 3O8HA 3EYYA 5D8KB 2K86A 3IH3A 2P8TA 2DA6A 4RGSA 4U0YA 3L7WA 3A01B 2V1NA 4A12A 3GTGJ 1HW2A 3TL4X 3HTSB 1X1CA 1W5TA 3IAM2 2RREA 1K78A 3ZMZA 1R58A 1R71A 4IHVA 1FYMA 1ZGAA 4BE1A 2V6EA 2ZXJA 1WJFA 2KJCA 1T0FA 4WWCA 1CF7A 5C4JJ 1OCOH 2DFHA 2HU9A 2OCCH 1UHMA 3HPGA 3CMYA 3IKVA 3M3YJ 4OAZA 3TW7A 1XPXA 1WI9A 3O8GA 3RI4A 4HW0A 1Z67A 5L3EA 4W97A 2X6YA 3WODF 3IP4B 2DO7A 1WJEA 2RGVA 1TP4A 3E1SA 1HKQA 1YYVA 3M8EA 2NVQJ 1STZA 4M9ZA 4F52A 1RR8C 1C0WA 4GYIA 1FPQA 2Y0SA 1LFUP 1BI0A 4QPQA 2Y69H 3GXOA 1WI3A 4JX6A 3MCZA 2XB0X 4ZYEA 1ZTRA 4XMYA 3BDDA 4B47A 5ILSA 4IOCF 3I4PA 4RB0A 5BPIA 1SMYF 2KISA 3BWGA 4UHTA 1B6AA 1IN7A 1TT5B 1F1ZA 2HDDA 1D5YA 3BG3A 3SYTA 1MKMA 3HZJA 1H9TA 5K5QA 1D5VA 2ETHA 3QU3A 2HTJA 3GO5A 2IGNA 3HOTA 4HDUA 3A0BC 3CCRI 1IN4A 2O8XA 3QP6A 6PAXA 3WTZA 2W82A 3P9IA 1U6GA 4LB6B 1XMXA 4IRGA 2ZSIB 3D5RC 3ZMDA 4FE7A 1B8IB 2CO5A 3K6GA 2H6BA 3S93A 1JHFA 2DA5A 2DPUA 4UB8C 3TQNA 2VLAA 1SD7A 5IOZA 2QWWA 1W36C 4M3GA 1CGPA 3E6BA 3C18A 2P5KA 2PJRB 3HRMA 4CCJA 2IGOA 1R1UA 2KJBA 2LKSA 1UG0A 2NS8A 2EWNA 4C30A 1FIAA 3H36A 3IWFA 2IA1A 1VQ9I 1NHAA 2FA5A 3CUQC 5LHHA 3DXJF 3GX4X 2PI0A 5AIQA 3K10A 3G71I 3A4CA 2E7XA 1BN5A 1FZPB 2STTA 1ETVA 3MKYB 1GXPA 3I3LA 4XL9A 2KMUA 1W36D 1A36A 2ELHA 2JN6A 5FD5A 3BTCA 4M3FA 3LOCA 3MKWB 2OZ6A 1OCCH 4A3IJ 1GVJA 2EILH 3EYIA 4I99C 1K4SA 1R36A 3PO2J 2CQ7A 3F8MA 2ZB9A 4XLEA 4ESFA 3G73A 2ZXHA 1FT9A 3OS2A 4JYKA 4LB5A 4WXDA 2X98A 3L00A 2FUG2 3G1LA 5ED4A 1A04A 3E5UA 2OAZA 1MGTA 2BHYA 1V5EA 2K3PA 2RQPA 2VBXA 5AONA 5KAFC 1OCTC 3IRRA 2IAIA 2WTEA 1R5ID 4BEHB 1ON2A 1UAAA 3RIRA 3W6JB 2HPMA 2PJRA 4KMFA 3VPRA 3ERMA 1SFXA 5DCMA 3O6BB 2R5YB 3PO3J 2L9VA 3DV8A 2OF7A 4YG2F 3CDIA 1Y1VJ 3ZOBA 3BOQA 2A6TA 2CU7A 1BA5A 1N78A 1PYVA 5H2FC 2ELJA 3DTIA 2JSPA 3BG7A 1GT0C 1N77A 4IKFA 4AM3A 4RM3A 2DA2A 1YI2I 1LJ9A 3PNYA 3HKZA 1ITYA 1QVUA 4HF1A 4BUPA 1LEAA 2L01A 4BJ6C 2FF4A 3ISPA 2VOPA 1QRYA 4CCOA 3ECOA 1LDDA 4R79A 4IHSA 3A52A 2ZJQF 2LBFA 5IYCJ 1SFOJ 3MVPA 2XPVA 3I5UA 2R7UA 4E7HA 2V1XA 5LFAA 3S2HJ 4QPOA 1OJLA 1Y0UA 3R61A 3WGHA 3ZQCA 4HSTA 5EDNA 1WJ5A 2K40A 2V26A 3D5SC 3LMMA 4P9UA 5BOXA 1Y0NA 1J75A 1ZKGA 2CG4A 5M5YJ 2DXIA 3BG5A 3LSKA 4CO8A 2ISZA 3FXJA 2OV7A 2QUFA 3DLLF 2JUGA 3OYBA 2HS5A 1BJZA 2G9WA 5HDNA 1S29A 5DD4A 1I3AA 5L3FA 3U21A 2BY3A 2YUSA 5HODA 1D1AA 3JAMZ 1T33A 1IZ1A 5LHIA 3OYJA 1JUPA 3LSRA 4HSRA 2W7NA 2V1DA 1YQAA 2DTZA 2LY9A 2QYOA 5FB2A 5HS7A 1EV7A 4R8HA 2EB7A 4DNCA 2DPDA 5FD6A 3BTJA 2UWMA 5HS8A 1JKOC 3NAUA 4G8XA 4CSWA 5IY5H 2KIFA 2XPWA 1R5GA 1IXSB 1RESA 3ZMVA 4B8XA 1HOMA 1LNWA 2M3AA 1LE8B 5F04A 1HC8A 2M9HA 4XRSA 2R0QC 2DT7B 2LF7A 4KISA 3JRHA 1T56A 4V2FA 1X4PA 2B9SA 2QM3A 1WCMJ 4L0YB 3CZ6A 3WTTC 5FLMJ 4HQEA 1BOBA 2ESHA 1KGSA 1VQMI 1BM9A 2F5CA 1WH7A 2F4MB 2XROA 4BXUA 2DBBA 3F21A 2OU2A 5CVIA 4XKWA 4X0GA 2XF5A 4Y33A 2RV8A 3QPTA 3S15J 2CV0A 1J2XA 3BG9A 1LDKB 4RA2A 1OFCX 3DTEA 2R7ZJ 3CTAA 1E2XA 5JLWA 4B4CA 2LOOA 3NARA 4JQFA 2NS7A 5DTDA 4ZTJA 3H9QA 1QPIA 2P7CB 1S9HA 1QZYA 3SJMA 2HYJA 3FM3A 3W3CA 4AC0A 3RQ4A 1O4XA 2LKXA 1U9OA 1SMTA 4GRIA 2E5NA 2MFZA 5DD8A 2EBIA 1R7JA 4A6EA 3LL7A 3CJNA 3H9JA 3CUOA 3KZZA 1TNSA 4HAMA 4IX7A 3UKGA 1JGGA 2COMA 3EETA 1ON1A 3U1KA 5DM6F 3J80Z 4W1UA 1FBUA 2IGKA 2IW5A 1MJBA 2PMHA 3TO9A 3ZQFA 1VFCA 2JTVA 3DPUA 1K79A 2MLKA 2WY7Q 2K5CA 3NRVA 4XOTA 2HR3A 2EIJH 3U2RA 3QWLA 1FOYA 1XX5A 4L5EA 4UVBA 1V55H 3HDDA 3V42A 5J40A 2VONA 2Y2ZA 4AVPA 4KNYA 2CQNA 1ETWA 4B3XA 4IZZA 2H1KA 1TLHB 1AU7A 1FJLA 5ILVA 2EFOA 3L2CA 1PUEE 3LWFA 3KE2A 1LFPA 3LSPA 2CJJA 4P5OA 4V2GA 5EYRA 2H09A 2VQLA 5KNLA 3OYHA 1XGOA 1D3YA 5FLXZ 3HJEA 4ZZDA 5ERIA 2ID6A 1IRZA 4ESBA 3RPQA 2R93J 1HDDC 1TBXA 3L9FA 4XN3A 2WV1A 4ENJA 5B5EC 2JQ7A 2ZC2A 3HB9A 5IT3A 1A6IA 1TNTA 2BYVE 2HOAA 3ZQIA 5DDGA 3CJQB 5LHGA 2PEXA 3KEOA 1UFMA 2DTRA 3K0LA 1U2WA 4UB6C 4F7ZA 2VC0A 1JJ6C 3RDIA 1LB2A 1UB9A 5EJCA 3GFMA 1IF1A 5K7ZA 4QSHA 2ELKA 1N75A 1B72B 2HKXA 3BY6A 1UHSA 2LY2A 4MFEA 3VB2A 1YJNI 2H1LA 1T39A 3H3VK 4D5FA 5ICFA 1RRJA 1IN8A 1XSXA 1BR2A 1TWHJ 3CLOA 4PK4A 2GXGA 2H6CA 3V8KA 2CUJA 3ZCOA 5GP9A 4BJTA 4OINF 2LLKA 4C9YA 3L2QA 1VQPI 2WWYA 1D1BA 2M4GA 3QODA 3R0JA 1VQOI 2DAOA 2F4OB 5D5UB 2NOGA 2Q2EB 4A3FJ 2HQAA 2DYRH 2COBA 1VQ4I 3I58A 3GW2A 4Z2YA 3TBIA 2E2JJ 2KRFA 2L5QA 4G6QA 4ENNA 1TT0A 5IT9K 5IT9R 3DBRB 1YE9A 2E1OA 3ZQ7A 4CZCA 3VYTB 2D5VA 3Q0VA 2IS4A 2ZBKA 3F6VA 3KLOA 2N8GA 1LPQA 1BIAA 3WTXC 4M3BA 2IA2A 1BJAA 2R4GA 2Y9ZA 3PSIA 5J1UA 1RIOH 2RNGA 2ZJ2A 4JK1X 3DBLB 4DQ2A 3OYFA 2OJED 1SFEA 3GUDA 3ERED 2O61A 4M72A 5CYVA 3KZIC 1WQ2A 5JI6A 2JA6J 4UNOA 3R4KA 2HOSA 2MD5A 4BNCA 2M0CA 2EQRA 5LRRA 1JTXA 3H3UA 2A5WA 4CICA 3G2BA 1A31A 3GTMJ 3ABTA 5FKLA 2CUFA 1O7LA 3DPTA 2EA2A 2XGXA 2DFFA 3ZMTA 4BXFA 2Y31A 3SZTA 1Z9CA 2HVRA 2CUZA 4AIKA 2V9PA 4UV9A 4M6XA 1W0UA 3FIWA 1ZHFA 4UUSA 2VJ5A 4I98B 3D0SA 1WJCA 2R7SA 2Z99A 2E19A 4KN7X 4A69C 3GZ6A 3NEUA 3OR2C 1SC7A 4O6JA 2P5LC 3CLQA 3JTGA 3H9GA 2ZO4A 1W1WE 2A6HF 4I7HA 4PUSA 4LOCA 3Q0WA 4AVZA 2H94A 4YFKF 4B3AA 3I0TA 4I0AA 2P81A 5HOOA 4B44A 3CCJI 1Z21A 4R1HA 1X58A 4XKVA 2FNAA 5E8IA 4KYWA 4IRIA 4XONA 4GO1A 4Y15A 1O3TA 1MDMB 2RC4A 5K5RA 3MMYB 5EEHA 4AD9A 2B7EA 2EZKA 3CDHA 4B09A 3JSOA 3SFZA 2Y9YA 2WAQA 1L3LA 3CJTB 3FXRA 3WU1B 3F6OA 5TISC 3EUHA 1E3PA 3ZN0A 2ZMEC 4P96A 2W4SA 3IV5A 3WG9A 4IEJA 1B1BA 4BQAA 3ASOH 1XS9A 4MIMA 1X3WB 1RETA 3BR0A 4E7IA 4ZZLA 2EZLA 3ABUA 4PGHA 1LDJA 4BACA 2M30A 3FM5A 4Z6YA 2VBZA 2W1OA 4B48A 4CGZA 4CYDA 4XLHA 2FE3A 2JMWA 1WSUA 2YS9A 2IGMA 3AFHA 5E3LA 4ESJA 4BQOA 1IRXA 1ORKA 4HA8A 3TMOA 4XLPF 2HOTA 3WG7H 4OIRF 1AKHA 5M3MJ 3D1NI 2P5VA 3IH2A 4DBRA 2K85A 2WAQN 2DMTA 1BC7C 2KIQA 3U1DA 4ZJZA 4U7DA 2W85A 2KHMA 2LDUA 2ECBA 3KEYA 2BZTA 4BAYA 2MH9A 1HLVA 1YFHA 2K9NA 1I6HJ 1R9TJ 2XAUA
chains in the Genus database with same CATH topology
1TW2A 2FBIA 1I27A 2RVCA 2DQLA 4ZYGA 4G7ZF 4MTDA 4L18B 1F5TA 1YS7A 4XLNF 1RUNA 1F4KA 1OR7A 1YW8A 3KZYA 1WKMA 5ICEA 1GXQA 1Z7UA 1O3SA 4Y13A 1S3JA 4HZFA 4NQWA 1HW5A 3O3KA 3RKXA 1GHCA 2CGPA 1DPRA 1KYZA 3HRUA 3LQRA 2BBYA 3L09A 1HSTA 4HF2A 2G7HA 1KQ8A 4O3MA 2HYFA 3QAHA 3ULQB 1K7AA 4AWXB 3RTRA 1FLIA 5DYMA 4AIJA 3F22A 5D8LB 3LAPA 2CW0F 1QQIA 4WXCA 1S6LA 1B9MA 1H0MA 2QENA 1XCBA 3D5LA 3LA7A 2HQNA 4G7OF 1MJ9A 2D1VA 2OQRA 5CVUA 1HBXG 2XHKA 2D2WA 2R3SA 1ODDA 4MHGA 5LGTA 3E5QA 3TDZC 3U9GA 2IVMA 2ZFWA 1PDNC 4FX0A 4MEYF 4MQVA 2O3FA 2JT1A 4EM1A 1J5YA 2HTSA 5CLSA 4HDVA 2XVCA 2VBWA 3LAJA 5L3BA 5H20A 4HV6A 4OMZA 3FZVA 1OPCA 2FOKA 4M6YA 3GFIA 2IJLA 3B02A 2BV6A 2O6GE 1U78A 5FFXA 1I1GA 1YTYA 2RDPA 3TO7A 3IL2A 2L3DA 2BEOA 3DF8A 1R22A 2JRTA 2HZTA 2K02A 1BOAA 1OYWA 3HRTA 4Q48A 1HKSA 5D5XB 1BIBA 4RB2C 4OMYA 2YU3A 4ENKA 2GXBA 3Q9SA 1QO0D 3QP5A 1FP1D 3Q9VA 4HBLA 5HS9A 3HYIA 2E7WA 3E97A 1G4DA 3BJ6A 1FX7A 3GVAA 1QBJA 3P9CA 2FU4A 3E6DA 1RI7A 3E6MA 4OIOF 3GZ5A 3M7GA 2GWRA 1PP7U 1R23A 2MH2A 3PQJA 3V7CA 1U5TC 2Y48A 1T98A 4UXNA 2LSOA 2BE5F 5LLQA 1G3TA 1W4MA 2FMLA 4KIBA 2VE9A 1FP2A 1P4XA 5IT9Z 3FX3A 3K69A 3HOSA 4UVAA 1YW9A 1SD6A 3T1BA 4GCVA 2ADUA 4HX7A 1G3WA 2Y75A 5E20A 2HYGD 4L9NA 1ZRFA 2AXLA 3DQVC 5A2QK 4LG0B 4RS8A 4EMSA 3ML6A 3WTUC 1UCRA 2NS0A 2L4AA 2V1UA 4LGWA 4MTEA 3WE2A 2FQ3A 4A0XA 2STWA 4XRFA 1ULYA 3T8TA 3DFGA 3C3WA 1ZG3A 4G94A 4JBAA 3R6SA 1TQPA 1G3YA 1W5SA 2UZKA 2GA1A 1ZLJA 3GF2A 5HLGA 4LG0A 5DCFA 1IXRC 3DKWA 4YFNF 3V7RA 5K1YA 1SAXA 2Q8KA 4LLGF 1KU7A 4LLNA 1P92A 4A6DA 3TOBA 1Z91A 2DI3A 1XMKA 3O2PE 3V7SA 4ETSA 1V3FA 1J59A 2VODA 2J5OA 1YIOA 4P55A 2IRFG 1FWZA 1W7PD 1IN6A 3FWEA 4YFXF 4OIQF 1FYKA 4BHCA 3WTYC 5F6FA 5D4RA 3C1DA 1K6OA 1T6SA 1Z1DA 2YX7A 3RKWA 4KT5C 1XGMA 2F5FA 2GZWA 1JXSA 1IN5A 2OD5A 2FSWA 4G7HF 2IP2A 3SXYA 4HQMA 1IXCA 1T38A 3GWZA 4PDKA 3TOAA 2YPRA 2ZCWA 2D45A 3MEXA 5BS6A 3KP5A 1MD0A 4EV0A 2IPQX 4A5MA 2L02A 3I64A 3JSPA 3REOA 2DK5A 3CUQB 3BP8A 4G9YA 5K5OA 4ENMA 5E18F 4KFCA 4WCGA 2Z3YA 4M71A 1R5HA 1YG2A 1L0OC 2HKOA 2LNBA 1ZN2A 3BROA 3VODA 3KCCA 4D0PA 1F9NA 5CVJA 1YLFA 4BHPA 2LKPA 5D4SA 5JHUA 5TJJA 2EV5A 5DEQA 2F5DA 4O5VA 2EFNA 2XASA 1VTNC 1G6NA 4G6DA 3LFKA 1U5TB 3MZYA 2L54A 3OV8A 1XB4A 4EM0B 2VXZA 3E3VA 1IW7F 2IA0A 3CUQA 1KU2A 3BJOA 2RKHA 3VFZA 2P7VB 1EH7A 1KU3A 3OOPA 5CVVA 2XAJA 5LEJA 4N0BA 4QLCU 2VT3A 4EJVA 2NRAC 2Z9OA 5DUKA 1FC3A 4L5JA 1R1TA 1MZBA 4Q47A 3TKYA 5AIPA 1XDSA 4LD5A 4U7BA 1R00A 3VOEA 2M8EA 4HLXA 3I54A 4IRHA 2RNJA 2Q2EA 1YO5C 2K4JA 2DU9A 3SZPA 2QBYB 5DV5A 2FBHA 1RUOA 4HX4A 4A0YA 4NHJA 2P6SA 2EK5A 1DP7P 5HDGA 3CO7C 4Q4ZF 1JE8A 3WTWC 4M74A 3BJAA 4MEXF 4WF2A 4HOBA 4RAZA 3HHHA 3WU0A 5F1RA 5ICGA 1U8RA 3FXUA 5LRSA 1B59A 2OQGA 5BQTA 4U0VA 1S8NA 3RKYA 2DLLA 4I09A 1WRJA 4FT8A 3JTHA 3H3ZA 2CYYA 2HWVA 4EGYA 1W7PB 3SHFA 1MJAA 3WGGA 3I59B 1Z6TA 4EGZA 5H6QA 4IVNA 2EFQA 1Z05A 5FO5A 3AAFA 1XD7A 3ZN1A 2YR2A 2KIMA 4L9VA 1MDMA 3LA3A 2K27A 4BHBA 3J80K 2VC1A 4ON0A 4XSXF 3FMSA 4LLLA 1TTYA 3RJPA 4KDPA 5BMZA 1I1SA 2XAFA 4EJOA 1HQCA 2XKPA 2QZ8A 2JSCA 3K1PA 3F8FA 2MBFA 2VN2A 3DEUA 2O0YA 1G3SA 4CDGA 2M45A 2VBYA 2ZNZA 3HTUA 2XUBA 3EDPA 5A2QZ 1FNNA 3R0AA 2XRNA 1CF7B 3V8LA 1R1VA 3HRSA 2PQ8A 1BI2A 3EQLF 4LFUA 3T8RA 3FHZA 2XAHA 1QNTA 5FFZA 4HYEA 3MZHA 2E1NA 2LF8A 2XV4S 2YSRA 2M1BA 1PP8F 3HSEA 5E1WA 2FEZA 1P6RA 1Q1HA 2DW4A 4S04A 3BPXA 3QOPA 1ZG5A 4H0EA 2BGCA 5EEGA 2PFBA 5BPDA 3Q5FA 4Q5SF 1XDUA 4QWQA 3WGIA 1V4RA 2O03A 1WWXA 2Y0MA 3ZMUA 4KUMA 1USSA 5D5VB 3FMRA 1HSJA 5KK1A 3I53A 4S05A 3V8JA 4WX9A 1KU9A 3W6KB 2PLYA 2V6CA 4CHUA 2FBKA 4OIPF 2GQQA 3F72A 5LBQA 4RGRA 1FOKA 2V79A 1XSVA 2PG4A 2R7DA 3GLXA 3HIFA 1REPC 2EFWA 4HV5A 4GXOA 3B73A 2DT5A 4A2UA 1U3EM 4YIIA 3ZP5A 2QLZA 2EJRA 4UV8A 3ELKA 2L4MA 2ACJA 1DDNA 3IWZA 2R7FA 2EV6A 2OZUA 1OMIA 2JPCA 1JHHA 5D6EA 2VT2A 2XKOA 5DCMB 3I71A 2M5WA 5HLHA 4RAYA 3K1MA 2W24A 1KQ9A 4KMUX 4MQ9F 1YW7A 4KN4X 5D6FA 2ZMEB 3N97A 3IC7A 2W84A 4FHTA 4K2EA 3FF5A 2EFPA 1S7AA 4KICA 1EH8A 2DFIA 1FY7A 1O57A 2A3SA 2PMUA 1YS6A 3H92A 4EVIA 3F23A 4A0ZA 1J9IA 4RGUA 1B4AA 2Z5UA 3QPHA 3E5XA 2CQKA 1XSDA 2QQAA 2NAZA 3WE3A 4L5IA 4ZYDA 2XAQA 2ZMEA 3FMQA 3S2WA 1FBQA 1TQMA 2QQ9A 4UUVA 1HW1A 3PFIA 2F5EA 3J81K 1FYLA 1SFUA 1H9GA 1SD4A 4MGRA 2ZNYA 2NNYA 5L3DA 4EJUA 3ZMSA 4I2OA 2CSOA 5CJ9A 2DQRA 4GYGA 3MFKA 1HXDA 1XN7A 4E70A 3M8FA 1AOYA 2NNNA 3KP3A 3WTVC 3F3XA 4I01A 5JVTA 4PZJA 1P2FA 5HDKA 2ESNA 3BZ6A 3VEPA 4IJAA 1BI3A 1AWCA 2MA3A 3K9TA 1ZREA 1D8JA 3IKTA 1FSEA 5HLIA 5ILUA 5TRDA 1IRGA 2HOEA 2GA2A 4GGGA 5L3CA 5LGNA 4RB3C 1ZYRF 1XGNA 4I02A 3IRQA 2VE8A 4M9XA 2QVOA 5JFRA 3F8BA 3PQKA 1O7FA 2A69F 4IPAA 2V9VA 2WV0A 1B9NA 2FMYA 2KKOA 2DK8A 1BBYA 2M87A 4M73A 3E6CC 4HLYA 1O3QA 2G7UA 3V4GA 4EQQA 1QZZA 3C7JA 2RN7A 3GFJA 1XGSA 2AS5F 2OBPA 3K2ZA 4ZH4F 5J8FA 3TDUC 5JR3A 5LGUA 1UHWA 2YX4A 2IT0A 2HEOA 4WXHA 2K7LA 5L3GA 3COAC 2X0LA 3M1EA 4PGGA 3SQNA 2HQRA 5H6RA 4LK0F 2FRHA 1ZRDA 3TO6A 2ZKZA 4L0ZB 3KP7A 4U0WA 5J6XA 4KA4A 5J8CA 2C6YA 3DP7A 2GIVA 1KA8A 3N4MA 2ISYA 4EM2A 4RGXA 3M9AA 3KLNA 2WC2A 1LVAA 3KFWX 1QPMA 3F8CA 1ZRCA 4OOIA 1D8KA 1EH6A 2HGCA 5E1XA 3TGNA 3ZPLA 4HX8A 1ZH5A 1E17A 1FBSA 4N9HA 2JPBA 3KP2A 2EA4A 3LA2A 1I5ZA 1S7OA 4U88A 2X4HA 2VOOA 4TV7A 1IUYA 1ZLKA 3DPLC 4NB5A 3BPVA 4BYYA 4A5NA 4CZZA 5HVQC 4LJZF 3P9KA 4Y17A 1DUXC 2PN6A 2F2EA 4ZYHA 5DUIA 1OYYA 4L9JA 3QU6A 1OKRA 2A61A 3KETA 2HDCA 3G3ZA 4L9TA 4KIGA 2K4BA 3RYRA 2PBIA 1U5TA 3WTSC 3HUGA 3F8NA 3KEQA 4KIFA 4ASNA 3FXQA 4CXFA 3ECHA 1HKTA 2XAGA 3JAMK 5KVRA 1RZ4A 2GAUA 3J7AO 4M9SA 3GYHX 3HHGA 4OU0A 5F64A 1BI1A 1X3UA 2FXAA 2W25A 1Z6RA 5ICCA 5D5WB 2PJPA 3IHUA 3MAJA 1ZG1A 5FGMA 2QQBA 2E1CA 3ROUA 5CVRA 1KYWA 4BH9A 2EV0A 4XSZF 2A07F 4UVCA 2A6EF 4EJTA 3NQOA 3K1NA 2QBYA 2B0LA 3LSTA 4AIHA 1LQ1A 1I6XA 1RNLA 2CWEA 1ZGJA 4LK1F 2UXXA 2XIGA 1P4WA 2A68F 4I0BA 4MNUA 5E8GA 3CO6C 3MWMA 1P4AA 3R60A 2P6TA 2FNPA 3HSFA 3P7NA 4YIFA 1XMAA 2P4WA 3QRFF 4IF4A 1SD5A 1QGPA 3GFLA 2W57A 1IRFA 4IHTA 2NYXA 1ZARA 3T5XA 2MLGA 4LMYA 2A5YB 2MC3A 5LEKA 3HSRA 3MQ0A 3JW4A 4RB1A 1W7PA 1OYIA 1FSHA 3KP4A 3I59A 1ONVA 1T2KA 1TQIA 4EJWA 4PCQA 3RPUA 3KP6A 4P9FA 2OA4A 1LEBA 5FLXK 3RYPA 1K78B 1BC8C 2CFXA 2KIUA 5E1ZB 4HF0A 3J81Z 1O3RA 2HFHA 2JZYA 1IAWA 3T0YA 1USTA 1J0RA 4FX4A 1DPUA 4IXAA 2Z33A 3GEZA 4WK8F 1JGSA 2Q0OA 1XCVA 1J7KA 1ZAOA 5E17F 2UXNA 3LQQA 2D1HA 1KQ0A 4XBFA 2TDXA 1TW3A 2J5PA 2H27A 4N9IA 3EYYA 5D8KB 2K86A 2P8TA 4RGSA 4U0YA 3L7WA 4A12A 1HW2A 3HTSB 1W5TA 1K78A 3ZMZA 1R58A 1FYMA 1ZGAA 2ZXJA 2KJCA 1T0FA 4WWCA 1CF7A 1UHMA 3IKVA 1WI9A 3RI4A 4HW0A 5L3EA 3WODF 2DO7A 2RGVA 1HKQA 1YYVA 3M8EA 1STZA 4M9ZA 1C0WA 4GYIA 1FPQA 1BI0A 3GXOA 3MCZA 4ZYEA 3BDDA 5ILSA 3I4PA 4RB0A 5BPIA 1SMYF 3BWGA 4UHTA 1B6AA 1IN7A 1F1ZA 1MKMA 1H9TA 5K5QA 1D5VA 2ETHA 3QU3A 2HTJA 3GO5A 3HOTA 4HDUA 1IN4A 2O8XA 3QP6A 6PAXA 3WTZA 3P9IA 1U6GA 4LB6B 4IRGA 3ZMDA 2CO5A 2H6BA 1JHFA 2DPUA 3TQNA 1SD7A 2QWWA 1CGPA 3E6BA 3C18A 2P5KA 3HRMA 1R1UA 2KJBA 2EWNA 3IWFA 2IA1A 1NHAA 2FA5A 3CUQC 5LHHA 3DXJF 3GX4X 2PI0A 5AIQA 2E7XA 1BN5A 1FZPB 2STTA 1GXPA 2ELHA 5FD5A 2OZ6A 1GVJA 3EYIA 1R36A 3F8MA 3G73A 4ESFA 1FT9A 4LB5A 4WXDA 3L00A 5ED4A 1A04A 3E5UA 2OAZA 1MGTA 2RQPA 2VBXA 5AONA 3IRRA 2WTEA 1ON2A 3RIRA 3W6JB 4KMFA 1SFXA 5DCMA 3O6BB 3DV8A 4YG2F 3BOQA 1LJ9A 4HF1A 1LEAA 2L01A 2FF4A 3ISPA 2VOPA 3ECOA 1LDDA 4R79A 4IHSA 3I5UA 2V1XA 1Y0UA 3R61A 3WGHA 4P9UA 5BOXA 1J75A 2CG4A 4CO8A 2ISZA 2QUFA 2HS5A 2G9WA 5HDNA 1S29A 5DD4A 5L3FA 3JAMZ 5LHIA 1IZ1A 2V1DA 1YQAA 2QYOA 5FB2A 5HS7A 1EV7A 4R8HA 2EB7A 4DNCA 2DPDA 5FD6A 2UWMA 5HS8A 4G8XA 2KIFA 1R5GA 1IXSB 3ZMVA 4B8XA 1LNWA 2LF7A 2QM3A 4L0YB 3WTTC 4HQEA 2ESHA 1KGSA 1BM9A 2F5CA 2XROA 4BXUA 2DBBA 3F21A 2OU2A 5CVIA 2RV8A 3QPTA 1J2XA 1LDKB 3CTAA 1E2XA 4JQFA 2P7CB 1QZYA 3FM3A 1SMTA 4A6EA 5DD8A 1R7JA 3CJNA 3CUOA 3KZZA 1TNSA 4HAMA 2COMA 3EETA 1ON1A 3J80Z 1FBUA 2IW5A 1MJBA 2PMHA 3TO9A 2JTVA 1K79A 2MLKA 3NRVA 2HR3A 3U2RA 4UVBA 2VONA 4AVPA 4KNYA 1TLHB 5ILVA 2EFOA 3L2CA 1PUEE 3LWFA 3KE2A 4P5OA 2H09A 1XGOA 1D3YA 5FLXZ 4ZZDA 5ERIA 4ESBA 3RPQA 1TBXA 3L9FA 4ENJA 5IT3A 1TNTA 2BYVE 5DDGA 5LHGA 2PEXA 3KEOA 1UFMA 2DTRA 3K0LA 1U2WA 4F7ZA 2VC0A 3RDIA 1LB2A 1UB9A 3GFMA 1IF1A 2HKXA 3BY6A 3VB2A 1T39A 5ICFA 1IN8A 1XSXA 3CLOA 2GXGA 2H6CA 3V8KA 4OINF 2WWYA 3R0JA 2DAOA 5D5UB 3I58A 3GW2A 4Z2YA 2KRFA 4G6QA 4ENNA 5IT9K 3ZQ7A 2ZBKA 3F6VA 3KLOA 1BIAA 3WTXC 2IA2A 1BJAA 1RIOH 2ZJ2A 4JK1X 4DQ2A 1SFEA 3GUDA 3ERED 2O61A 4M72A 5CYVA 1WQ2A 5JI6A 4UNOA 3R4KA 2MD5A 4BNCA 5LRRA 4CICA 3H3UA 3ABTA 1O7LA 3DPTA 2EA2A 2XGXA 3ZMTA 1Z9CA 3SZTA 4AIKA 4UV9A 4M6XA 1ZHFA 4I98B 3D0SA 2Z99A 4KN7X 3GZ6A 3NEUA 4O6JA 2P5LC 3JTGA 2ZO4A 2A6HF 4I7HA 2H94A 4YFKF 3I0TA 4I0AA 5HOOA 4R1HA 5E8IA 2FNAA 4KYWA 4IRIA 4GO1A 4Y15A 1O3TA 1MDMB 2RC4A 5K5RA 5EEHA 4AD9A 3CDHA 4B09A 3JSOA 3SFZA 1L3LA 3WU1B 3FXRA 3F6OA 3EUHA 3ZN0A 4P96A 3WG9A 1B1BA 4BQAA 4ZZLA 3ABUA 4PGHA 1LDJA 2M30A 3FM5A 2VBZA 4CGZA 4CYDA 2FE3A 1WSUA 4ESJA 4HA8A 4XLPF 4OIRF 2P5VA 1BC7C 3U1DA 4U7DA 2W85A 2LDUA 4BAYA 2MH9A 1YFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW2 A;  2FBI A;  1I27 A;  2RVC A;  2DQL A;  4ZYG A;  4G7Z F;  4MTD A;  4L18 B;  1F5T A;  1YS7 A;  4XLN F;  1RUN A;  1F4K A;  1OR7 A;  1YW8 A;  3KZY A;  1WKM A;  5ICE A;  1GXQ A;  1Z7U A;  1O3S A;  4Y13 A;  1S3J A;  4HZF A;  4NQW A;  1HW5 A;  3O3K A;  3RKX A;  1GHC A;  2CGP A;  1DPR A;  1KYZ A;  3HRU A;  3LQR A;  2BBY A;  3L09 A;  1HST A;  4HF2 A;  2G7H A;  1KQ8 A;  4O3M A;  2HYF A;  3QAH A;  3ULQ B;  1K7A A;  4AWX B;  3RTR A;  1FLI A;  5DYM A;  4AIJ A;  3F22 A;  5D8L B;  3LAP A;  2CW0 F;  1QQI A;  4WXC A;  1S6L A;  1B9M A;  1H0M A;  2QEN A;  1XCB A;  3D5L A;  3LA7 A;  2HQN A;  4G7O F;  1MJ9 A;  2D1V A;  2OQR A;  5CVU A;  1HBX G;  2XHK A;  2D2W A;  2R3S A;  1ODD A;  4MHG A;  5LGT A;  3E5Q A;  3TDZ C;  3U9G A;  2IVM A;  2ZFW A;  1PDN C;  4FX0 A;  4MEY F;  4MQV A;  2O3F A;  2JT1 A;  4EM1 A;  1J5Y A;  2HTS A;  5CLS A;  4HDV A;  2XVC A;  2VBW A;  3LAJ A;  5L3B A;  5H20 A;  4HV6 A;  4OMZ A;  3FZV A;  1OPC A;  2FOK A;  4M6Y A;  3GFI A;  2IJL A;  3B02 A;  2BV6 A;  2O6G E;  1U78 A;  5FFX A;  1I1G A;  1YTY A;  2RDP A;  3TO7 A;  3IL2 A;  2L3D A;  2BEO A;  3DF8 A;  1R22 A;  2JRT A;  2HZT A;  2K02 A;  1BOA A;  1OYW A;  3HRT A;  4Q48 A;  1HKS A;  5D5X B;  1BIB A;  4RB2 C;  4OMY A;  2YU3 A;  4ENK A;  2GXB A;  3Q9S A;  1QO0 D;  3QP5 A;  1FP1 D;  3Q9V A;  4HBL A;  5HS9 A;  3HYI A;  2E7W A;  3E97 A;  1G4D A;  3BJ6 A;  1FX7 A;  3GVA A;  1QBJ A;  3P9C A;  2FU4 A;  3E6D A;  1RI7 A;  3E6M A;  4OIO F;  3GZ5 A;  3M7G A;  2GWR A;  1PP7 U;  1R23 A;  2MH2 A;  3PQJ A;  3V7C A;  1U5T C;  2Y48 A;  1T98 A;  4UXN A;  2LSO A;  2BE5 F;  5LLQ A;  1G3T A;  1W4M A;  2FML A;  4KIB A;  2VE9 A;  1FP2 A;  1P4X A;  5IT9 Z;  3FX3 A;  3K69 A;  3HOS A;  4UVA A;  1YW9 A;  1SD6 A;  3T1B A;  4GCV A;  2ADU A;  4HX7 A;  1G3W A;  2Y75 A;  5E20 A;  2HYG D;  4L9N A;  1ZRF A;  2AXL A;  3DQV C;  5A2Q K;  4LG0 B;  4RS8 A;  4EMS A;  3ML6 A;  3WTU C;  1UCR A;  2NS0 A;  2L4A A;  2V1U A;  4LGW A;  4MTE A;  3WE2 A;  2FQ3 A;  4A0X A;  2STW A;  4XRF A;  1ULY A;  3T8T A;  3DFG A;  3C3W A;  1ZG3 A;  4G94 A;  4JBA A;  3R6S A;  1TQP A;  1G3Y A;  1W5S A;  2UZK A;  2GA1 A;  1ZLJ A;  3GF2 A;  5HLG A;  4LG0 A;  5DCF A;  1IXR C;  3DKW A;  4YFN F;  3V7R A;  5K1Y A;  1SAX A;  2Q8K A;  4LLG F;  1KU7 A;  4LLN A;  1P92 A;  4A6D A;  3TOB A;  1Z91 A;  2DI3 A;  1XMK A;  3O2P E;  3V7S A;  4ETS A;  1V3F A;  1J59 A;  2VOD A;  2J5O A;  1YIO A;  4P55 A;  2IRF G;  1FWZ A;  1W7P D;  1IN6 A;  3FWE A;  4YFX F;  4OIQ F;  1FYK A;  4BHC A;  3WTY C;  5F6F A;  5D4R A;  3C1D A;  1K6O A;  1T6S A;  1Z1D A;  2YX7 A;  3RKW A;  4KT5 C;  1XGM A;  2F5F A;  2GZW A;  1JXS A;  1IN5 A;  2OD5 A;  2FSW A;  4G7H F;  2IP2 A;  3SXY A;  4HQM A;  1IXC A;  1T38 A;  3GWZ A;  4PDK A;  3TOA A;  2YPR A;  2ZCW A;  2D45 A;  3MEX A;  5BS6 A;  3KP5 A;  1MD0 A;  4EV0 A;  2IPQ X;  4A5M A;  2L02 A;  3I64 A;  3JSP A;  3REO A;  2DK5 A;  3CUQ B;  3BP8 A;  4G9Y A;  5K5O A;  4ENM A;  5E18 F;  4KFC A;  4WCG A;  2Z3Y A;  4M71 A;  1R5H A;  1YG2 A;  1L0O C;  2HKO A;  2LNB A;  1ZN2 A;  3BRO A;  3VOD A;  3KCC A;  4D0P A;  1F9N A;  5CVJ A;  1YLF A;  4BHP A;  2LKP A;  5D4S A;  5JHU A;  5TJJ A;  2EV5 A;  5DEQ A;  2F5D A;  4O5V A;  2EFN A;  2XAS A;  1VTN C;  1G6N A;  4G6D A;  3LFK A;  1U5T B;  3MZY A;  2L54 A;  3OV8 A;  1XB4 A;  4EM0 B;  2VXZ A;  3E3V A;  1IW7 F;  2IA0 A;  3CUQ A;  1KU2 A;  3BJO A;  2RKH A;  3VFZ A;  2P7V B;  1EH7 A;  1KU3 A;  3OOP A;  5CVV A;  2XAJ A;  5LEJ A;  4N0B A;  4QLC U;  2VT3 A;  4EJV A;  2NRA C;  2Z9O A;  5DUK A;  1FC3 A;  4L5J A;  1R1T A;  1MZB A;  4Q47 A;  3TKY A;  5AIP A;  1XDS A;  4LD5 A;  4U7B A;  1R00 A;  3VOE A;  2M8E A;  4HLX A;  3I54 A;  4IRH A;  2RNJ A;  2Q2E A;  1YO5 C;  2K4J A;  2DU9 A;  3SZP A;  2QBY B;  5DV5 A;  2FBH A;  1RUO A;  4HX4 A;  4A0Y A;  4NHJ A;  2P6S A;  2EK5 A;  1DP7 P;  5HDG A;  3CO7 C;  4Q4Z F;  1JE8 A;  3WTW C;  4M74 A;  3BJA A;  4MEX F;  4WF2 A;  4HOB A;  4RAZ A;  3HHH A;  3WU0 A;  5F1R A;  5ICG A;  1U8R A;  3FXU A;  5LRS A;  1B59 A;  2OQG A;  5BQT A;  4U0V A;  1S8N A;  3RKY A;  2DLL A;  4I09 A;  1WRJ A;  4FT8 A;  3JTH A;  3H3Z A;  2CYY A;  2HWV A;  4EGY A;  1W7P B;  3SHF A;  1MJA A;  3WGG A;  3I59 B;  1Z6T A;  4EGZ A;  5H6Q A;  4IVN A;  2EFQ A;  1Z05 A;  5FO5 A;  3AAF A;  1XD7 A;  3ZN1 A;  2YR2 A;  2KIM A;  4L9V A;  1MDM A;  3LA3 A;  2K27 A;  4BHB A;  3J80 K;  2VC1 A;  4ON0 A;  4XSX F;  3FMS A;  4LLL A;  1TTY A;  3RJP A;  4KDP A;  5BMZ A;  1I1S A;  2XAF A;  4EJO A;  1HQC A;  2XKP A;  2QZ8 A;  2JSC A;  3K1P A;  3F8F A;  2MBF A;  2VN2 A;  3DEU A;  2O0Y A;  1G3S A;  4CDG A;  2M45 A;  2VBY A;  2ZNZ A;  3HTU A;  2XUB A;  3EDP A;  5A2Q Z;  1FNN A;  3R0A A;  2XRN A;  1CF7 B;  3V8L A;  1R1V A;  3HRS A;  2PQ8 A;  1BI2 A;  3EQL F;  4LFU A;  3T8R A;  3FHZ A;  2XAH A;  1QNT A;  5FFZ A;  4HYE A;  3MZH A;  2E1N A;  2LF8 A;  2XV4 S;  2YSR A;  2M1B A;  1PP8 F;  3HSE A;  5E1W A;  2FEZ A;  1P6R A;  1Q1H A;  2DW4 A;  4S04 A;  3BPX A;  3QOP A;  1ZG5 A;  4H0E A;  2BGC A;  5EEG A;  2PFB A;  5BPD A;  3Q5F A;  4Q5S F;  1XDU A;  4QWQ A;  3WGI A;  1V4R A;  2O03 A;  1WWX A;  2Y0M A;  3ZMU A;  4KUM A;  1USS A;  5D5V B;  3FMR A;  1HSJ A;  5KK1 A;  3I53 A;  4S05 A;  3V8J A;  4WX9 A;  1KU9 A;  3W6K B;  2PLY A;  2V6C A;  4CHU A;  2FBK A;  4OIP F;  2GQQ A;  3F72 A;  5LBQ A;  4RGR A;  1FOK A;  2V79 A;  1XSV A;  2PG4 A;  2R7D A;  3GLX A;  3HIF A;  1REP C;  2EFW A;  4HV5 A;  4GXO A;  3B73 A;  2DT5 A;  4A2U A;  1U3E M;  4YII A;  3ZP5 A;  2QLZ A;  2EJR A;  4UV8 A;  3ELK A;  2L4M A;  2ACJ A;  1DDN A;  3IWZ A;  2R7F A;  2EV6 A;  2OZU A;  1OMI A;  2JPC A;  1JHH A;  5D6E A;  2VT2 A;  2XKO A;  5DCM B;  3I71 A;  2M5W A;  5HLH A;  4RAY A;  3K1M A;  2W24 A;  1KQ9 A;  4KMU X;  4MQ9 F;  1YW7 A;  4KN4 X;  5D6F A;  2ZME B;  3N97 A;  3IC7 A;  2W84 A;  4FHT A;  4K2E A;  3FF5 A;  2EFP A;  1S7A A;  4KIC A;  1EH8 A;  2DFI A;  1FY7 A;  1O57 A;  2A3S A;  2PMU A;  1YS6 A;  3H92 A;  4EVI A;  3F23 A;  4A0Z A;  1J9I A;  4RGU A;  1B4A A;  2Z5U A;  3QPH A;  3E5X A;  2CQK A;  1XSD A;  2QQA A;  2NAZ A;  3WE3 A;  4L5I A;  4ZYD A;  2XAQ A;  2ZME A;  3FMQ A;  3S2W A;  1FBQ A;  1TQM A;  2QQ9 A;  4UUV A;  1HW1 A;  3PFI A;  2F5E A;  3J81 K;  1FYL A;  1SFU A;  1H9G A;  1SD4 A;  4MGR A;  2ZNY A;  2NNY A;  5L3D A;  4EJU A;  3ZMS A;  4I2O A;  2CSO A;  5CJ9 A;  2DQR A;  4GYG A;  3MFK A;  1HXD A;  1XN7 A;  4E70 A;  3M8F A;  1AOY A;  2NNN A;  3KP3 A;  3WTV C;  3F3X A;  4I01 A;  5JVT A;  4PZJ A;  1P2F A;  5HDK A;  2ESN A;  3BZ6 A;  3VEP A;  4IJA A;  1BI3 A;  1AWC A;  2MA3 A;  3K9T A;  1ZRE A;  1D8J A;  3IKT A;  1FSE A;  5HLI A;  5ILU A;  5TRD A;  1IRG A;  2HOE A;  2GA2 A;  4GGG A;  5L3C A;  5LGN A;  4RB3 C;  1ZYR F;  1XGN A;  4I02 A;  3IRQ A;  2VE8 A;  4M9X A;  2QVO A;  5JFR A;  3F8B A;  3PQK A;  1O7F A;  2A69 F;  4IPA A;  2V9V A;  2WV0 A;  1B9N A;  2FMY A;  2KKO A;  2DK8 A;  1BBY A;  2M87 A;  4M73 A;  3E6C C;  4HLY A;  1O3Q A;  2G7U A;  3V4G A;  4EQQ A;  1QZZ A;  3C7J A;  2RN7 A;  3GFJ A;  1XGS A;  2AS5 F;  2OBP A;  3K2Z A;  4ZH4 F;  5J8F A;  3TDU C;  5JR3 A;  5LGU A;  1UHW A;  2YX4 A;  2IT0 A;  2HEO A;  4WXH A;  2K7L A;  5L3G A;  3COA C;  2X0L A;  3M1E A;  4PGG A;  3SQN A;  2HQR A;  5H6R A;  4LK0 F;  2FRH A;  1ZRD A;  3TO6 A;  2ZKZ A;  4L0Z B;  3KP7 A;  4U0W A;  5J6X A;  4KA4 A;  5J8C A;  2C6Y A;  3DP7 A;  2GIV A;  1KA8 A;  3N4M A;  2ISY A;  4EM2 A;  4RGX A;  3M9A A;  3KLN A;  2WC2 A;  1LVA A;  3KFW X;  1QPM A;  3F8C A;  1ZRC A;  4OOI A;  1D8K A;  1EH6 A;  2HGC A;  5E1X A;  3TGN A;  3ZPL A;  4HX8 A;  1ZH5 A;  1E17 A;  1FBS A;  4N9H A;  2JPB A;  3KP2 A;  2EA4 A;  3LA2 A;  1I5Z A;  1S7O A;  4U88 A;  2X4H A;  2VOO A;  4TV7 A;  1IUY A;  1ZLK A;  3DPL C;  4NB5 A;  3BPV A;  4BYY A;  4A5N A;  4CZZ A;  5HVQ C;  4LJZ F;  3P9K A;  4Y17 A;  1DUX C;  2PN6 A;  2F2E A;  4ZYH A;  5DUI A;  1OYY A;  4L9J A;  3QU6 A;  1OKR A;  2A61 A;  3KET A;  2HDC A;  3G3Z A;  4L9T A;  4KIG A;  2K4B A;  3RYR A;  2PBI A;  1U5T A;  3WTS C;  3HUG A;  3F8N A;  3KEQ A;  4KIF A;  4ASN A;  3FXQ A;  4CXF A;  3ECH A;  1HKT A;  2XAG A;  3JAM K;  5KVR A;  1RZ4 A;  2GAU A;  3J7A O;  4M9S A;  3GYH X;  3HHG A;  4OU0 A;  5F64 A;  1BI1 A;  1X3U A;  2FXA A;  2W25 A;  1Z6R A;  5ICC A;  5D5W B;  2PJP A;  3IHU A;  3MAJ A;  1ZG1 A;  5FGM A;  2QQB A;  2E1C A;  3ROU A;  5CVR A;  1KYW A;  4BH9 A;  2EV0 A;  4XSZ F;  2A07 F;  4UVC A;  2A6E F;  4EJT A;  3NQO A;  3K1N A;  2QBY A;  2B0L A;  3LST A;  4AIH A;  1LQ1 A;  1I6X A;  1RNL A;  2CWE A;  1ZGJ A;  4LK1 F;  2UXX A;  2XIG A;  1P4W A;  2A68 F;  4I0B A;  4MNU A;  5E8G A;  3CO6 C;  3MWM A;  1P4A A;  3R60 A;  2P6T A;  2FNP A;  3HSF A;  3P7N A;  4YIF A;  1XMA A;  2P4W A;  3QRF F;  4IF4 A;  1SD5 A;  1QGP A;  3GFL A;  2W57 A;  1IRF A;  4IHT A;  2NYX A;  1ZAR A;  3T5X A;  2MLG A;  4LMY A;  2A5Y B;  2MC3 A;  5LEK A;  3HSR A;  3MQ0 A;  3JW4 A;  4RB1 A;  1W7P A;  1OYI A;  1FSH A;  3KP4 A;  3I59 A;  1ONV A;  1T2K A;  1TQI A;  4EJW A;  4PCQ A;  3RPU A;  3KP6 A;  4P9F A;  2OA4 A;  1LEB A;  5FLX K;  3RYP A;  1K78 B;  1BC8 C;  2CFX A;  2KIU A;  5E1Z B;  4HF0 A;  3J81 Z;  1O3R A;  2HFH A;  2JZY A;  1IAW A;  3T0Y A;  1UST A;  1J0R A;  4FX4 A;  1DPU A;  4IXA A;  2Z33 A;  3GEZ A;  4WK8 F;  1JGS A;  2Q0O A;  1XCV A;  1J7K A;  1ZAO A;  5E17 F;  2UXN A;  3LQQ A;  2D1H A;  1KQ0 A;  4XBF A;  2TDX A;  1TW3 A;  2J5P A;  2H27 A;  4N9I A;  3EYY A;  5D8K B;  2K86 A;  2P8T A;  4RGS A;  4U0Y A;  3L7W A;  4A12 A;  1HW2 A;  3HTS B;  1W5T A;  1K78 A;  3ZMZ A;  1R58 A;  1FYM A;  1ZGA A;  2ZXJ A;  2KJC A;  1T0F A;  4WWC A;  1CF7 A;  1UHM A;  3IKV A;  1WI9 A;  3RI4 A;  4HW0 A;  5L3E A;  3WOD F;  2DO7 A;  2RGV A;  1HKQ A;  1YYV A;  3M8E A;  1STZ A;  4M9Z A;  1C0W A;  4GYI A;  1FPQ A;  1BI0 A;  3GXO A;  3MCZ A;  4ZYE A;  3BDD A;  5ILS A;  3I4P A;  4RB0 A;  5BPI A;  1SMY F;  3BWG A;  4UHT A;  1B6A A;  1IN7 A;  1F1Z A;  1MKM A;  1H9T A;  5K5Q A;  1D5V A;  2ETH A;  3QU3 A;  2HTJ A;  3GO5 A;  3HOT A;  4HDU A;  1IN4 A;  2O8X A;  3QP6 A;  6PAX A;  3WTZ A;  3P9I A;  1U6G A;  4LB6 B;  4IRG A;  3ZMD A;  2CO5 A;  2H6B A;  1JHF A;  2DPU A;  3TQN A;  1SD7 A;  2QWW A;  1CGP A;  3E6B A;  3C18 A;  2P5K A;  3HRM A;  1R1U A;  2KJB A;  2EWN A;  3IWF A;  2IA1 A;  1NHA A;  2FA5 A;  3CUQ C;  5LHH A;  3DXJ F;  3GX4 X;  2PI0 A;  5AIQ A;  2E7X A;  1BN5 A;  1FZP B;  2STT A;  1GXP A;  2ELH A;  5FD5 A;  2OZ6 A;  1GVJ A;  3EYI A;  1R36 A;  3F8M A;  3G73 A;  4ESF A;  1FT9 A;  4LB5 A;  4WXD A;  3L00 A;  5ED4 A;  1A04 A;  3E5U A;  2OAZ A;  1MGT A;  2RQP A;  2VBX A;  5AON A;  3IRR A;  2WTE A;  1ON2 A;  3RIR A;  3W6J B;  4KMF A;  1SFX A;  5DCM A;  3O6B B;  3DV8 A;  4YG2 F;  3BOQ A;  1LJ9 A;  4HF1 A;  1LEA A;  2L01 A;  2FF4 A;  3ISP A;  2VOP A;  3ECO A;  1LDD A;  4R79 A;  4IHS A;  3I5U A;  2V1X A;  1Y0U A;  3R61 A;  3WGH A;  4P9U A;  5BOX A;  1J75 A;  2CG4 A;  4CO8 A;  2ISZ A;  2QUF A;  2HS5 A;  2G9W A;  5HDN A;  1S29 A;  5DD4 A;  5L3F A;  3JAM Z;  5LHI A;  1IZ1 A;  2V1D A;  1YQA A;  2QYO A;  5FB2 A;  5HS7 A;  1EV7 A;  4R8H A;  2EB7 A;  4DNC A;  2DPD A;  5FD6 A;  2UWM A;  5HS8 A;  4G8X A;  2KIF A;  1R5G A;  1IXS B;  3ZMV A;  4B8X A;  1LNW A;  2LF7 A;  2QM3 A;  4L0Y B;  3WTT C;  4HQE A;  2ESH A;  1KGS A;  1BM9 A;  2F5C A;  2XRO A;  4BXU A;  2DBB A;  3F21 A;  2OU2 A;  5CVI A;  2RV8 A;  3QPT A;  1J2X A;  1LDK B;  3CTA A;  1E2X A;  4JQF A;  2P7C B;  1QZY A;  3FM3 A;  1SMT A;  4A6E A;  5DD8 A;  1R7J A;  3CJN A;  3CUO A;  3KZZ A;  1TNS A;  4HAM A;  2COM A;  3EET A;  1ON1 A;  3J80 Z;  1FBU A;  2IW5 A;  1MJB A;  2PMH A;  3TO9 A;  2JTV A;  1K79 A;  2MLK A;  3NRV A;  2HR3 A;  3U2R A;  4UVB A;  2VON A;  4AVP A;  4KNY A;  1TLH B;  5ILV A;  2EFO A;  3L2C A;  1PUE E;  3LWF A;  3KE2 A;  4P5O A;  2H09 A;  1XGO A;  1D3Y A;  5FLX Z;  4ZZD A;  5ERI A;  4ESB A;  3RPQ A;  1TBX A;  3L9F A;  4ENJ A;  5IT3 A;  1TNT A;  2BYV E;  5DDG A;  5LHG A;  2PEX A;  3KEO A;  1UFM A;  2DTR A;  3K0L A;  1U2W A;  4F7Z A;  2VC0 A;  3RDI A;  1LB2 A;  1UB9 A;  3GFM A;  1IF1 A;  2HKX A;  3BY6 A;  3VB2 A;  1T39 A;  5ICF A;  1IN8 A;  1XSX A;  3CLO A;  2GXG A;  2H6C A;  3V8K A;  4OIN F;  2WWY A;  3R0J A;  2DAO A;  5D5U B;  3I58 A;  3GW2 A;  4Z2Y A;  2KRF A;  4G6Q A;  4ENN A;  5IT9 K;  3ZQ7 A;  2ZBK A;  3F6V A;  3KLO A;  1BIA A;  3WTX C;  2IA2 A;  1BJA A;  1RIO H;  2ZJ2 A;  4JK1 X;  4DQ2 A;  1SFE A;  3GUD A;  3ERE D;  2O61 A;  4M72 A;  5CYV A;  1WQ2 A;  5JI6 A;  4UNO A;  3R4K A;  2MD5 A;  4BNC A;  5LRR A;  4CIC A;  3H3U A;  3ABT A;  1O7L A;  3DPT A;  2EA2 A;  2XGX A;  3ZMT A;  1Z9C A;  3SZT A;  4AIK A;  4UV9 A;  4M6X A;  1ZHF A;  4I98 B;  3D0S A;  2Z99 A;  4KN7 X;  3GZ6 A;  3NEU A;  4O6J A;  2P5L C;  3JTG A;  2ZO4 A;  2A6H F;  4I7H A;  2H94 A;  4YFK F;  3I0T A;  4I0A A;  5HOO A;  4R1H A;  5E8I A;  2FNA A;  4KYW A;  4IRI A;  4GO1 A;  4Y15 A;  1O3T A;  1MDM B;  2RC4 A;  5K5R A;  5EEH A;  4AD9 A;  3CDH A;  4B09 A;  3JSO A;  3SFZ A;  1L3L A;  3WU1 B;  3FXR A;  3F6O A;  3EUH A;  3ZN0 A;  4P96 A;  3WG9 A;  1B1B A;  4BQA A;  4ZZL A;  3ABU A;  4PGH A;  1LDJ A;  2M30 A;  3FM5 A;  2VBZ A;  4CGZ A;  4CYD A;  2FE3 A;  1WSU A;  4ESJ A;  4HA8 A;  4XLP F;  4OIR F;  2P5V A;  1BC7 C;  3U1D A;  4U7D A;  2W85 A;  2LDU A;  4BAY A;  2MH9 A;  1YFH A; 
#chains in the Genus database with same CATH topology
 4FE4 A;  5J1R A;  1QZE A;  1TW2 A;  2OUM A;  2FBI A;  1EF4 A;  1I27 A;  2RVC A;  5E3O A;  2M0M A;  4HNU A;  2DQL A;  3OMY A;  4ZYG A;  4J19 A;  4G7Z F;  4MTD A;  4L18 B;  3OR1 C;  1F5T A;  3UR3 C;  1YS7 A;  4XLN F;  1RUN A;  3K2A A;  1SAU A;  1F4K A;  3CCV I;  1OR7 A;  2HZD A;  1YW8 A;  4U87 A;  4AYB N;  1S5L C;  3KZY A;  1WKM A;  5ICE A;  1GXQ A;  1IO2 A;  1Z7U A;  1O3S A;  1YX3 A;  4Y13 A;  1GUU A;  1S3J A;  4HZF A;  3GTP J;  4NQW A;  1HW5 A;  3O3K A;  2VKD A;  3RKX A;  3Q0U A;  1OQY A;  4YIR X;  1GHC A;  2CGP A;  1DPR A;  2Z2S B;  4CH7 A;  2HQ5 A;  1KYZ A;  3HRU A;  3LQR A;  1MW7 A;  2E60 A;  1V54 H;  5EZG A;  2BBY A;  3L09 A;  4JX4 A;  1HST A;  4HF2 A;  2G7H A;  1KQ8 A;  4O3M A;  3GTL J;  2ID3 A;  4CUG A;  4LIT A;  2HYF A;  3QAH A;  2H8R A;  1LFB A;  3ULQ B;  1K7A A;  3K4M A;  3CC2 I;  4AWX B;  3RTR A;  2R7W A;  5IPA A;  3NWT A;  4LG3 A;  1FLI A;  5DYM A;  4AIJ A;  3F22 A;  5D8L B;  3LAP A;  4UY8 I;  2CW0 F;  1QQI A;  2NOJ B;  4WXC A;  1S6L A;  1B9M A;  5B1A H;  1H0M A;  2QEN A;  1XCB A;  3D5L A;  3LA7 A;  4PSW A;  3KPH A;  2HQN A;  1I39 A;  3GTK J;  4G7O F;  2BY0 A;  1MJ9 A;  2D1V A;  4PJL A;  2OQR A;  3OS1 A;  1RPW A;  4LIV A;  5CVU A;  1HBX G;  2XHK A;  4NNJ A;  1G59 A;  2D2W A;  4YEL A;  3W6V A;  2PMZ N;  2R3S A;  1ODD A;  2GOM A;  3MKL A;  3K4B A;  4MHG A;  2LK2 A;  1F36 A;  1XC5 A;  5LGT A;  4ABZ A;  1R49 A;  3E5Q A;  3JR9 A;  3TDZ C;  4XK4 A;  3BQZ A;  3U9G A;  2L9S A;  2IVM A;  2ZFW A;  1PDN C;  4FX0 A;  5BNG A;  4MEY F;  3DKX A;  4MQV A;  4Y7N J;  2H8W A;  2O3F A;  2JT1 A;  3JRD A;  4V19 K;  4EM1 A;  1J5Y A;  2FJ1 A;  2HTS A;  3GBG A;  5CLS A;  2DMN A;  4HDV A;  2XVC A;  1BW6 A;  2VBW A;  2DOF A;  3OIQ A;  3LAJ A;  3BTI A;  5L3B A;  4A3D J;  2R7T A;  5H20 A;  4HV6 A;  5KHD A;  3VYR B;  1NG6 A;  1TC3 C;  4OMZ A;  4JOM A;  2E5Z A;  3SEQ A;  5EEA A;  3FZV A;  1OPC A;  2FOK A;  4M6Y A;  1BL0 A;  3GFI A;  2IJL A;  3S16 J;  2WAF A;  3LSI A;  3L2V A;  3B02 A;  2IS6 A;  2BV6 A;  3A01 A;  1PUF B;  5HNF A;  2IBD A;  2O6G E;  3N05 A;  2HPI A;  1U78 A;  5KCM A;  5FFX A;  1I1G A;  4PJ0 C;  1YTY A;  2RDP A;  2L9R A;  4J00 A;  3S2D J;  3TO7 A;  2AHQ A;  3OYE A;  3IL2 A;  2L3D A;  2BEO A;  3DF8 A;  3I55 I;  5M5W J;  3BG6 A;  1WFX A;  4HNV A;  1R22 A;  2DA7 A;  2JRT A;  1CQT A;  3PM1 A;  5FKK A;  1FTT A;  3S8P A;  2HZT A;  2K02 A;  2Y0S N;  3OYC A;  1BOA A;  1OYW A;  3A0H C;  2LRD A;  4KIT B;  3HRT A;  4Q48 A;  3W2V A;  1HKS A;  5D5X B;  2E1M C;  4II3 A;  1BIB A;  1D0X A;  3BC8 A;  4RB2 C;  4OMY A;  2R92 J;  3HG9 A;  2WBM A;  1NK3 P;  2IXS A;  2YU3 A;  1POG A;  4ENK A;  3CCM I;  2GXB A;  4XLC A;  4JX5 A;  1K6Y A;  3Q9S A;  2MSY A;  1QO0 D;  3FXL A;  3QP5 A;  2CW7 A;  2ZXW H;  2GLO A;  2MYS A;  2JWT A;  1FP1 D;  3S3M A;  2I8D A;  4KJZ A;  3Q9V A;  3S1Q J;  2VPL A;  3H0G J;  2DOD A;  4HBL A;  1M1E B;  5HS9 A;  3BR2 A;  3E0J B;  3HYI A;  2E7W A;  1ETO A;  5CQG A;  1V5F A;  3E97 A;  4MLO A;  1G4D A;  1IG7 A;  2ME6 A;  3BJ6 A;  1FX7 A;  3DKY A;  2QSF X;  3DTK A;  1MBJ A;  3GVA A;  3P9C A;  4PJN A;  4D7N A;  1QBJ A;  3RCO A;  2JRM A;  4BS9 A;  2CV2 A;  2FU4 A;  3E6D A;  1RI7 A;  3E6M A;  2R5Z B;  2EPF A;  2WAD A;  1NG7 A;  3GZ5 A;  4OIO F;  3M7G A;  3ZQQ A;  3PUB A;  2W48 A;  1B8I A;  2GWR A;  1PP7 U;  1R23 A;  3UNG C;  1ETK A;  1JKQ C;  2MH2 A;  3PQJ A;  3V7C A;  4BGD A;  1U5T C;  3VSK A;  2Y48 A;  1VQ7 I;  1T98 A;  3DEE A;  1GLN A;  3ZQG A;  2K9S A;  4UXN A;  2LSO A;  2F6C A;  2BE5 F;  3K4L A;  4C3H J;  2JA7 J;  3SEZ A;  5LLQ A;  1G3T A;  1W4M A;  1JTY A;  4F91 B;  2LFB A;  2ZSH B;  1UMQ A;  3HPH A;  3L2U A;  2QKM B;  2QSG X;  2DMU A;  2FML A;  3CJR B;  4DGW B;  4KIB A;  2VE9 A;  3OSG A;  1ZR4 A;  1FP2 A;  4FQG A;  1RQ6 A;  5J4Y A;  1P4X A;  2QA4 I;  5IT9 Z;  1OIS A;  4B43 A;  2O7O A;  2LVS A;  2KL4 A;  2CRG A;  3A2K A;  3FX3 A;  3K69 A;  2L7Z A;  5B66 C;  5HNH A;  3HOS A;  5EG0 B;  4UVA A;  2XPU A;  4NC7 A;  1A5J A;  1YW9 A;  1SD6 A;  3VYS B;  3ZGK A;  3T1B A;  2Z16 A;  2KLO A;  2ADU A;  4GCV A;  4DYQ A;  2QCO A;  4HX7 A;  5F0C A;  1KON A;  2K3F A;  1G3W A;  2Y75 A;  5E20 A;  2HYG D;  4KT6 A;  4FTH A;  5E3M A;  4BEH A;  4L9N A;  4CCN A;  2AXL A;  1ZRF A;  3CC7 I;  3DQV C;  5A2Q K;  4LG0 B;  5A2Q R;  4RS8 A;  4EMS A;  3CMM A;  3ML6 A;  3WTU C;  3CCL I;  2R5Y A;  3HKZ N;  1UCR A;  2NS0 A;  2L4A A;  2B63 J;  2V1U A;  4LGW A;  4MTE A;  3WE2 A;  2FQ3 A;  3M07 A;  2EH3 A;  2XGC A;  3SZG A;  1H89 C;  2EIN H;  4A0X A;  3K70 C;  2STW A;  4XRF A;  3H5A A;  3OSF A;  1ULY A;  3T8T A;  4DYR A;  3DFG A;  3C3W A;  1ZG3 A;  4G94 A;  2UUZ A;  1WHU A;  2DJI A;  4JBA A;  1Y6I A;  2DA1 A;  2KT0 A;  3R6S A;  4A3B J;  4CYC B;  1TQP A;  1J09 A;  1G3Y A;  2X1C A;  3S32 A;  4IQ4 A;  1W5S A;  1E3O C;  5EG0 A;  4A3K J;  2UZK A;  2GA1 A;  3CCE I;  1ZLJ A;  2M8G X;  4F92 B;  3FKI J;  2M7A A;  3GF2 A;  3MZ8 A;  4CA0 A;  2DN0 A;  3K70 D;  5HLG A;  1TWF J;  3LSG A;  4XLA A;  4LG0 A;  3SDG A;  3CDL A;  5DCF A;  5FKO A;  1IXR C;  3DKW A;  3MKZ A;  1PJR A;  4QIW N;  4YFN F;  3V7R A;  4EAT A;  1VQL I;  5K1Y A;  1SAX A;  2Q8K A;  4LLG F;  1KU7 A;  3VWB A;  4LLN A;  3EUA A;  1P92 A;  4A6D A;  3TOB A;  3ABM H;  1Z91 A;  1DP3 A;  2DI3 A;  1X2N A;  1XMK A;  3F9K A;  3O2P E;  1YRN B;  3V7S A;  4ETS A;  1V3F A;  1J59 A;  2VOD A;  2J5O A;  1FMV A;  3OYK A;  1YIO A;  3BCA A;  4P55 A;  2IRF G;  2VKV A;  1FWZ A;  1W7P D;  2DT6 A;  1IN6 A;  3FWE A;  4F3Q A;  1HF0 A;  4YFX F;  4OIQ F;  1LE8 A;  1FYK A;  4HEA 2;  4BHC A;  3WTY C;  5F6F A;  5D4R A;  3C1D A;  1K6O A;  3RPU D;  1EJ9 A;  1T6S A;  1Z1D A;  2YX7 A;  3MD2 A;  3RKW A;  4KT5 C;  1XGM A;  1H8A C;  2F5F A;  2VL8 A;  3H35 A;  2GZW A;  2X9D A;  3OS0 A;  1Z0X A;  1Z3X A;  2LMD A;  1JXS A;  1IN5 A;  2LR8 A;  2OD5 A;  2FSW A;  2QF7 A;  4G7H F;  2K9L A;  3H1C A;  2IP2 A;  1QHG A;  3HXL A;  3SXY A;  3C2H A;  4HQM A;  1IXC A;  3OOU A;  3GWZ A;  4PDK A;  1T38 A;  3TOA A;  2G0E A;  3H5N A;  2YPR A;  4FET A;  1HA8 A;  2ZCW A;  2D45 A;  2L7F P;  2VAS A;  3MEX A;  5BS6 A;  3KP5 A;  3S14 J;  1MD0 A;  4E7L A;  1IDZ A;  4EV0 A;  2DMQ A;  2IPQ X;  2E1M B;  2L02 A;  4A5M A;  3CC4 I;  1YRN A;  3K4K A;  3JCU C;  3I64 A;  3JSP A;  3L1P A;  1T0F C;  4OAY A;  3LFU A;  3WHB A;  4ZDL A;  3REO A;  3PIO F;  2EZI A;  4XIC A;  1AHD P;  2DK5 A;  3CUQ B;  3BP8 A;  4G9Y A;  5K5O A;  4ENM A;  5TGT A;  2AXT C;  5E18 F;  4KFC A;  4WCG A;  4AU7 A;  2Z3Y A;  3ESW B;  4M71 A;  1R5H A;  1YG2 A;  1L0O C;  3CCU I;  2HKO A;  2LNB A;  1ZN2 A;  2K9M A;  4A3C J;  5GAG J;  2E2I J;  2VKE A;  3G6E I;  3DBH B;  3BRO A;  3VOD A;  3KCC A;  4D0P A;  1F9N A;  5CVJ A;  1YLF A;  4BHP A;  2LKP A;  1Y8Q B;  3ZXS A;  2F5V A;  3ZQL A;  5D4S A;  5JHU A;  3AL0 C;  1D0Z A;  4I76 A;  5TJJ A;  2EV5 A;  5M5X J;  4A3M J;  3PNT A;  5DEQ A;  3QYB A;  2F5D A;  1K61 A;  2IS1 A;  4O5V A;  4II2 A;  2EFN A;  3J7Z I;  2XAS A;  3OYI A;  1VTN C;  1G6N A;  2V9K A;  2NVX J;  4G6D A;  5IP7 J;  3LFK A;  5J4V A;  1U5T B;  2WB1 A;  2LY1 A;  3HUG B;  3FK7 A;  3MZY A;  1AA7 A;  2L54 A;  3OV8 A;  1XB4 A;  3JRA A;  4EM0 B;  2VXZ A;  3E3V A;  1IW7 F;  2IA0 A;  3AG2 H;  3CUQ A;  1KU2 A;  3BJO A;  3DWL E;  2ZJR F;  3FXO A;  2RKH A;  2XC7 A;  3VFZ A;  1ETQ A;  2P7V B;  4D1Q A;  1EH7 A;  2M34 A;  1KU3 A;  3OYD A;  3OOP A;  2BY2 A;  2L2O A;  5CVV A;  2XAJ A;  5LEJ A;  4N0B A;  2JUC A;  4QLC U;  2VT3 A;  4EJV A;  1B72 A;  3ZRG A;  2RQQ A;  2NRA C;  1S72 I;  2Z9O A;  5DUK A;  4NC8 A;  5E3N A;  1Q1V A;  3CF5 F;  4DZP A;  1E0E A;  1FC3 A;  4L5J A;  2KRC A;  2WB1 N;  1R1T A;  3CF2 A;  1MZB A;  4Q47 A;  3TKY A;  3OL3 A;  3JRG A;  3HOX J;  5AIP A;  4ZDO A;  2MW8 A;  2VQC A;  1XDS A;  4LD5 A;  2VIX A;  4U7B A;  3HGY A;  1R00 A;  3VOE A;  2M8E A;  4HLX A;  3I54 A;  4IRH A;  2RNJ A;  3K4N A;  2Q2E A;  3FIS A;  1YO5 C;  4J01 A;  2K4J A;  4BE2 A;  2DU9 A;  3SZP A;  2QBY B;  5DV5 A;  3WU2 C;  4E7K A;  2KQR A;  3HM5 A;  2X51 A;  4BBS J;  2FBH A;  1RUO A;  4HX4 A;  4A0Y A;  4NHJ A;  2P6S A;  2FX0 A;  4B1R A;  2DDA A;  2EK5 A;  3FBN B;  3PSF A;  2E71 A;  2JA2 A;  1WJD A;  1DP7 P;  5HDG A;  3FKJ A;  1SVM A;  5GTH C;  1MSF C;  2TCT A;  1DU0 A;  1JUM A;  3CO7 C;  4IOA F;  4Q4Z F;  1JE8 A;  4DIQ A;  2WAE A;  4DZJ A;  3WTW C;  4M74 A;  3BJA A;  4MEX F;  4WF2 A;  4HOB A;  4RAZ A;  1X4O A;  3HHH A;  3QPS A;  3WU0 A;  5F1R A;  5ICG A;  1U8R A;  3I4N J;  3FXU A;  2CFO A;  2R7O A;  5LRS A;  1B59 A;  2OQG A;  5BQT A;  4U0V A;  1S8N A;  2KPM A;  3OL4 A;  4E7J A;  3RKY A;  2DLL A;  4I09 A;  1IC8 A;  2FD5 A;  1DGW Y;  1WRJ A;  4BDY A;  1Z3Y A;  2VI6 A;  4FT8 A;  2NVU B;  2X6O A;  2FQ4 A;  3JTH A;  1EKE A;  3H3Z A;  4RDU A;  2CYY A;  3C2B A;  2HWV A;  3EUK L;  4X6A J;  4EGY A;  1JUS A;  1GVD A;  1W7P B;  3SHF A;  1MJA A;  3WGG A;  4DBQ A;  3I59 B;  1Z6T A;  4EGZ A;  1I3Q J;  5H6Q A;  4IVN A;  3BR1 A;  3J7A W;  2DDB A;  3LSM A;  1ETY A;  4XRS G;  3CD6 I;  1MMG A;  1SVO A;  3B6C A;  2EFQ A;  4IO9 F;  1Y8R B;  5F0H A;  1IJW C;  1FMW A;  3RKQ A;  4IHX A;  1FEX A;  1P7I A;  1Z05 A;  5FO5 A;  1FOW A;  3AAF A;  1XD7 A;  1GV5 A;  1T8I A;  3ZN1 A;  1U0J A;  2YR2 A;  1JI8 A;  2KIM A;  3H0D A;  2Z1D A;  4L9V A;  3LNQ A;  1MDM A;  3Q3S A;  2CUE A;  3LA3 A;  2K27 A;  4BHB A;  3J80 K;  2VC1 A;  1MMN A;  1MIJ A;  3BCB A;  4ON0 A;  4XSX F;  3FMS A;  4Y3O A;  3S3O A;  4LLL A;  3GLL A;  4IHW A;  1TTY A;  1MBG A;  3W2W A;  3RJP A;  4BDZ A;  4KDP A;  4G12 A;  5BMZ A;  2XAF A;  1I1S A;  2BY1 A;  3G4S I;  1Y56 A;  3HOW J;  1QHH D;  3PNV A;  4EJO A;  4XQF A;  1HQC A;  1JT0 A;  1WGX A;  4RAG A;  1MBE A;  2ECC A;  2XKP A;  2QZ8 A;  4E4H A;  4E6K G;  3H5R A;  1MND A;  2VJ4 A;  2JSC A;  4A3J J;  3WHC A;  4EEF G;  2BVM A;  2W00 A;  2OTJ I;  3K1P A;  3F8F A;  1DU6 A;  2MBF A;  4N4O B;  2L9N A;  2XSD C;  5K7H A;  2VN2 A;  3OYM A;  1ZQ3 P;  3DEU A;  1MH3 A;  2O0Y A;  4Y4R A;  3IH4 A;  1G3S A;  4CDG A;  4PJJ A;  5LD2 C;  1WZ2 A;  2M45 A;  2VBY A;  2IS2 A;  5EGO B;  2ZNZ A;  2KZV A;  4DW6 A;  3HTU A;  3HOZ J;  2XUB A;  3EDP A;  3X2Q H;  5A2Q Z;  1P9Q C;  2P0T A;  1FNN A;  3R0A A;  2XRN A;  1CF7 B;  5F1J A;  3V8L A;  4QTR A;  1R1V A;  3DLA A;  3HRS A;  4NBQ A;  3I56 I;  4XOP A;  2PQ8 A;  5E79 C;  1JKP C;  1BI2 A;  3EQL F;  4C3I J;  2LC2 A;  4RLF A;  3BZC A;  4LFU A;  2LP0 A;  1X1B A;  3T8R A;  3FHZ A;  5FLV A;  2XAH A;  2VB6 A;  1QNT A;  5FFZ A;  4HYE A;  3MZH A;  4C2M J;  5F27 A;  2E1N A;  2LF8 A;  2XV4 S;  2YSR A;  2M1B A;  1VQN I;  4HRI A;  1PP8 F;  3HSE A;  3HOV J;  5E1W A;  2FEZ A;  1P6R A;  1Q1H A;  2DW4 A;  5J1Y A;  4S04 A;  3AL0 B;  4N4N B;  2DOA A;  4XLF A;  3BPX A;  2ZFU A;  5K7F A;  2MVT A;  3QOP A;  1JKR C;  5CQE A;  1ZG5 A;  4H0E A;  2BGC A;  5EEG A;  3MN2 A;  2KZG A;  2PFB A;  5BPD A;  3Q5F A;  3PUF A;  2VUM J;  1QU3 A;  1SAN A;  4Q5S F;  1XDU A;  4QWQ A;  3GTO J;  3WGI A;  5EGO A;  1V4R A;  2O03 A;  2E35 A;  1WWX A;  3HGG A;  3SFI A;  4E7Z A;  2Y0M A;  2XF7 A;  3OYL A;  3ZMU A;  4DJA A;  4AID A;  3JRF A;  1TWC J;  2ICW G;  4KUM A;  1MNM C;  5B3S H;  1USS A;  5D5V B;  4YEJ A;  1OCZ H;  1MBK A;  3FMR A;  1HSJ A;  4ZYA A;  2CH0 A;  1BR1 A;  3PL8 A;  5KK1 A;  3I53 A;  4S05 A;  2DOE A;  2VXD A;  2HNH A;  3V8J A;  1D1C A;  4JP0 A;  4WX9 A;  2JA5 J;  4XID A;  1KU9 A;  3W6K B;  2PLY A;  2V6C A;  4XR6 A;  2I10 A;  4XNF A;  4CHU A;  1G8X A;  3OYA A;  2FBK A;  3JRC A;  4OIP F;  2GQQ A;  3F72 A;  3G1O A;  2X6X A;  5LBQ A;  3QPL A;  3GME A;  4RGR A;  5B1B H;  3NWS A;  3CME I;  1FOK A;  2V79 A;  1XSV A;  1ZGW A;  3BTL A;  3OWT A;  2HXI A;  1DQU A;  2PG4 A;  2GM4 A;  2R7D A;  3GLX A;  3VSL A;  3HIF A;  3CQZ J;  1REP C;  3C2G A;  3JRB A;  2EFW A;  3M1C A;  1FTZ A;  4HV5 A;  4GXO A;  5FRO A;  1TL8 A;  2MD0 A;  3B73 A;  2DT5 A;  1WPK A;  4A2U A;  1U3E M;  2R7X A;  4YII A;  5GPA A;  3ZP5 A;  2QLZ A;  2EJR A;  4C3J J;  3PIP F;  1RC9 A;  4UV8 A;  4ZDP A;  1WJA A;  2OC6 A;  3ELK A;  2L4M A;  5F08 A;  1VI0 A;  2ACJ A;  1Y1W J;  1DDN A;  5FKN A;  2JVG A;  1T95 A;  1HCR A;  1UJ8 A;  2MG4 A;  3IWZ A;  2R7F A;  3CP2 A;  2EV6 A;  4LIU A;  5GPC A;  1PUF A;  3BR3 A;  2AO9 A;  2OZU A;  5IYB J;  1OMI A;  3ASN H;  1VQ8 I;  4PJM A;  2JPC A;  1JHH A;  2ME0 A;  5D6E A;  2XF6 A;  2VT2 A;  2XKO A;  5DCM B;  3I71 A;  3ABL H;  2L7M P;  2M5W A;  5HLH A;  4ZC3 A;  3ZR8 X;  4F55 A;  4RAY A;  3K1M A;  2W24 A;  4PSX A;  4IQJ A;  1KQ9 A;  2X6W A;  4KMU X;  1SVL A;  3AG1 H;  4MQ9 F;  1YW7 A;  1DGR M;  4KN4 X;  1YIJ I;  5D6F A;  2ZME B;  3AG4 H;  3N97 A;  3IC7 A;  2W84 A;  4FHT A;  4K2E A;  3FF5 A;  2F48 A;  2EFP A;  1X1A A;  2QEX I;  2EZH A;  2X85 A;  2CV1 A;  1S7A A;  3OIO A;  4KIC A;  4RBO A;  1EH8 A;  4HPQ A;  4X1E A;  2LYC A;  5IP9 J;  1UZC A;  1V5G A;  2LBF B;  1MMS A;  4PFP A;  1NH3 A;  4E7S A;  3ABK H;  2DFI A;  1FY7 A;  1O57 A;  4ITV A;  3SDB A;  2UV1 A;  2A3S A;  2PMU A;  2ZXI A;  1WH5 A;  1YS6 A;  2V7F A;  3H92 A;  4EVI A;  3F23 A;  3S17 J;  3A02 A;  4A0Z A;  1IUF A;  2BXZ A;  2NXN B;  5IOY A;  4C2T A;  1J9I A;  2BW3 B;  4RGU A;  1B4A A;  2M4K A;  2Z5U A;  3GCM A;  3QPH A;  4OWR B;  3E5X A;  3E7L A;  5GAH J;  2CQK A;  1XSD A;  1MNE A;  2QQA A;  2NAZ A;  3WE3 A;  4P1W A;  4L5I A;  4HG2 A;  2JA8 J;  1UG2 A;  4ZYD A;  2R5Z A;  2DA3 A;  3BZK A;  4M3E A;  2XAQ A;  4RM2 A;  2ZME A;  3FMQ A;  3S1M J;  3RZD J;  3S2W A;  1FBQ A;  1YOV B;  1TQM A;  2QQ9 A;  3G1M A;  5IYD J;  5EF6 A;  4UUV A;  1HW1 A;  3RZO J;  3RQI A;  2M2E A;  5FRN A;  3PFI A;  1X3Z B;  2QSH X;  2F5E A;  3J81 K;  3J81 R;  2MAB A;  2LTP A;  1FYL A;  1SFU A;  1HDP A;  2XSJ C;  1H9G A;  1SD4 A;  5FRM A;  3EUH C;  4MGR A;  5J47 A;  2DYS H;  3M4O J;  2WA0 A;  2ZNY A;  2NNY A;  4XOR A;  5L3D A;  3CCY A;  4EJU A;  3ZMS A;  4I2O A;  1VZ0 A;  2CSO A;  5CJ9 A;  2DQR A;  4GYG A;  5C3E J;  1S7E A;  1HXD A;  1XN7 A;  2BHZ A;  3MFK A;  4E70 A;  1XTA A;  3M8F A;  1T08 B;  1QA6 A;  2NNN A;  5C4X J;  1AOY A;  3KP3 A;  3WTV C;  4BL0 B;  2BW3 A;  2LG4 A;  1U8B A;  1U9N A;  3F3X A;  4I01 A;  5M3F J;  5JVT A;  1NK2 P;  2CQQ A;  1NTC A;  4PZJ A;  1MBF A;  1E3H A;  1P2F A;  5HDK A;  4CCK A;  2ESN A;  3QOE A;  3BZ6 A;  4MFD A;  3VEP A;  2KFD A;  4IJA A;  4CCM A;  3BR6 A;  1BI3 A;  1AWC A;  4BE0 A;  3DEW A;  2MA3 A;  2GIZ A;  3K9T A;  1ZRE A;  1D8J A;  3EPZ A;  3IKT A;  1FSE A;  2F4I A;  3K4J A;  2EIK H;  5HLI A;  3BQY A;  4RMN A;  5ILU A;  5TRD A;  2DMP A;  5C44 J;  4DOZ A;  1IRG A;  2HOE A;  2GA2 A;  4GGG A;  5L3C A;  5LGN A;  4C2U A;  4RB3 C;  3L2R A;  1ZYR F;  1WJB A;  4FIS A;  1XGN A;  3BLY A;  4I02 A;  2VE8 A;  4M9X A;  3IRQ A;  2QVO A;  3HOY J;  4D7M A;  5JFR A;  3HEF A;  3F8B A;  1OR7 C;  3PQK A;  1XG1 A;  1O7F A;  2A69 F;  4IPA A;  2V9V A;  4MO7 A;  2WV0 A;  3I4M J;  1SEU A;  1IV8 A;  4NDL A;  1ERD A;  1B9N A;  5JVG F;  2FMY A;  2KKO A;  2DK8 A;  1OCR H;  1BBY A;  2I5U A;  3CES A;  1TZL A;  2M87 A;  1X19 A;  2CMP A;  4M73 A;  4CYC A;  3JRI A;  3E6C C;  9ANT A;  3BR5 A;  4HLY A;  1O3Q A;  2G7U A;  3S3N A;  3V4G A;  2KDO A;  4DYC A;  1LKX A;  4EQQ A;  1QZZ A;  1VF9 A;  2E36 A;  3C7J A;  3TP3 A;  3KYC B;  2RN7 A;  3GFJ A;  1XGS A;  3W2A A;  2K9Q A;  2AS5 F;  2OBP A;  4D5C A;  3K2Z A;  3FBI B;  1OCP A;  4ZH4 F;  1A6Q A;  1UEL B;  5J8F A;  1LVK A;  2NVT J;  2AQF A;  2AQE A;  3TDU C;  3S1R J;  2O9L A;  3A03 A;  2R7V A;  2VPR A;  5JR3 A;  5LGU A;  1UHW A;  2VKH A;  1IV6 A;  1G2H A;  1QVT A;  1D0Y A;  2X1E A;  2YX4 A;  2RAE A;  2IT0 A;  2HEO A;  2MC4 A;  4WXH A;  4BKX A;  2L0K A;  2K7L A;  5L3G A;  3COA C;  2LH9 A;  2X0L A;  2CW8 A;  2GBY A;  3M1E A;  4YRV A;  4IHY A;  4PGG A;  3VDX A;  1ZR2 A;  3SQN A;  3QQA A;  2HQR A;  2CS3 A;  4LK0 F;  5H6R A;  2DA4 A;  1TWA J;  2FRH A;  2OCE A;  3L2W A;  1ZRD A;  3TO6 A;  2BXY A;  2ZKZ A;  4L0Z B;  3KP7 A;  4U0W A;  1YHQ I;  3KYL A;  2QQ8 A;  3K4C A;  5J6X A;  1YJ9 I;  3CCS I;  4KA4 A;  2V4J C;  2VJI A;  1Y39 A;  1ZEL A;  5J8C A;  2C6Y A;  3DP7 A;  4XN0 A;  2GIV A;  4UUT A;  1KA8 A;  1GV2 A;  2HXO A;  3N4M A;  1KZH A;  2ISY A;  2YU9 J;  1FOX A;  1IGN A;  4EM2 A;  2Y30 A;  4M6V A;  2IEK A;  3HL2 A;  4A93 J;  4RGX A;  3M9A A;  4A3L J;  3KLN A;  2LD5 A;  2WC2 A;  4RAF A;  1LVA A;  3KFW X;  1QPM A;  3F8C A;  1ZRC A;  4OOI A;  3KYD B;  1D8K A;  1EH6 A;  2HGC A;  3FDY A;  2DCE A;  4GFB A;  5E1X A;  3TGN A;  3ZPL A;  2JVH A;  4HX8 A;  1ZH5 A;  1E17 A;  1FBS A;  4PFO A;  5DS9 A;  2TRT A;  4N9H A;  2JPB A;  3DCF A;  2MUN A;  3KP2 A;  5CKT A;  2OTL I;  1BW5 A;  1EA3 A;  5GTI C;  3GZN B;  2EA4 A;  3LA2 A;  1I5Z A;  4H4K C;  5KAI C;  1S7O A;  4U88 A;  2R7Q A;  3BT9 A;  3S1N J;  2X4H A;  3F0C A;  2E2H J;  2VOO A;  4TV7 A;  1IUY A;  1ZLK A;  3DPL C;  4NB5 A;  4UUS B;  3BPV A;  4BYY A;  3OYN A;  4A5N A;  3FHN A;  4ANJ A;  4CZZ A;  5HVQ C;  4LJZ F;  2BOL A;  1LUJ B;  3P9K A;  2GOX B;  4Y17 A;  1GDT A;  1JT6 A;  2NVY J;  4HNT A;  1ETX A;  3CMA I;  3QYF A;  1DUX C;  1MMD A;  2PN6 A;  1APL C;  1SFK A;  2F2E A;  3TED A;  2HVQ A;  2WY8 Q;  4ZYH A;  2JK3 A;  5DUI A;  1RKW A;  1OYY A;  4L9J A;  5F0F A;  3QU6 A;  3PFY A;  1JJ8 C;  1OKR A;  5EZH A;  2A61 A;  2VQG A;  3KET A;  2QKL B;  2HDC A;  3IAS 2;  5GAE J;  1MSE C;  3G3Z A;  4L9T A;  4KIG A;  2K4B A;  4FAS D;  3RYR A;  2PBI A;  3J7A Y;  1U5T A;  3K7A J;  3WTS C;  3OIP A;  2ZJP F;  3HUG A;  4Y52 J;  3A1Y A;  3F8N A;  2Q1Z B;  3KEQ A;  4BQN A;  4KIF A;  4ASN A;  4BY7 J;  3FXQ A;  4CXF A;  3ECH A;  1YX5 A;  4XRM A;  1HKT A;  2XAG A;  3JAM K;  3VYU B;  5KVR A;  1RZ4 A;  4M3D A;  1TWG J;  2L7K A;  3JAM R;  2GAU A;  3J7A O;  3OYG A;  4M9S A;  4BBR J;  1X1P A;  3GYH X;  3HHG A;  3QYE A;  4AUX A;  1RKT A;  1MBH A;  2O8K A;  3P5J A;  2BVL A;  2GXA A;  2CQX A;  4OU0 A;  5F64 A;  1BI1 A;  1X3U A;  2DFE A;  2FXA A;  4D9J A;  2W25 A;  1H88 C;  1Z6R A;  1YIT I;  5ICC A;  1X2M A;  5D5W B;  2PJP A;  1ZK8 A;  3IHU A;  1MH4 A;  3GTQ J;  3MAJ A;  1ZG1 A;  5FGM A;  2QQB A;  2E1C A;  1W5C C;  3ROU A;  4BQQ A;  1R4M B;  5CVR A;  2PX9 A;  2M35 A;  1W0T A;  1KYW A;  4BH9 A;  2EV0 A;  4XSZ F;  2A07 F;  3CCQ I;  1AKH B;  4UVC A;  3I9V 2;  2A6E F;  3AG3 H;  3JRE A;  3GTJ J;  4EJT A;  4CCL A;  2A05 A;  3NQO A;  4I6Z A;  3ONQ A;  3LSH A;  4XM3 A;  3K1N A;  4NUB A;  2MGQ A;  1VND A;  1FIP A;  2QBY A;  1VQ6 I;  4FCY A;  2B0L A;  3LST A;  4AIH A;  4GDF A;  1LQ1 A;  1I6X A;  5DM7 F;  1RNL A;  2CWE A;  4BY1 J;  1ZGJ A;  1ENH A;  4LK1 F;  2UXX A;  4RLQ A;  3B6A A;  2XIG A;  3AKZ A;  1VQK I;  2X1D A;  1P4W A;  2X48 A;  2A68 F;  4I0B A;  1A35 A;  5HLT A;  3HC7 A;  4MNU A;  4A3G J;  5E8G A;  1MMA A;  3CO6 C;  4BXX J;  3MWM A;  1P4A A;  3R60 A;  2HVS A;  2KP6 A;  2P6T A;  2FNP A;  3HSF A;  3P7N A;  4YIF A;  4A3E J;  2XGD A;  1XMA A;  2P4W A;  4IL6 C;  4S0H B;  1K83 J;  2XDV A;  3QRF F;  4NQW B;  1I50 J;  2E34 A;  4IF4 A;  2DJN A;  1SD5 A;  1QGP A;  3GFL A;  1YJW I;  2W57 A;  3CP8 A;  3FK6 A;  3J80 R;  3KIO A;  2M7B A;  1IRF A;  2JJ7 A;  4IHT A;  1BR4 A;  1PVE A;  1X1D A;  1ZAR A;  2NYX A;  3T5X A;  4AYB A;  1RR7 A;  2MLG A;  4BJ5 C;  2VQH A;  5CPR B;  3FXK A;  5J3L A;  2HI3 A;  2A5Y B;  2MC3 A;  4LMY A;  3HSR A;  5LEK A;  3MQ0 A;  3JW4 A;  4RB1 A;  3KX2 A;  1W7P A;  1OYI A;  4XKB A;  1FSH A;  3KP4 A;  3I59 A;  2XB5 A;  1ONV A;  1T2K A;  2EIM H;  1Z77 A;  1IDY A;  1TQI A;  1WVR A;  2KDZ A;  4EJW A;  2HDW A;  1OLT A;  1P7J A;  4BU2 A;  2KRH A;  4PCQ A;  2P0W A;  3RPU A;  3KP6 A;  4P9F A;  3TP0 A;  2OA4 A;  2VJJ A;  5GAD J;  1R4N B;  3IUO A;  5FLX K;  1LEB A;  3RYP A;  5JLX A;  5FLX R;  3HOU J;  3PJR A;  2O5R A;  1K78 B;  2QGU A;  1BC8 C;  2CFX A;  2KIU A;  3RSN A;  3DU5 A;  5E1Z B;  4HF0 A;  5JHF A;  3J81 Z;  1F43 A;  1O3R A;  2HFH A;  2JZY A;  4F93 B;  1IAW A;  3J7Y J;  3T0Y A;  1UST A;  5FKM A;  1J0R A;  4FX4 A;  1DPU A;  4IXA A;  3OY9 A;  1ACI A;  3FXM A;  3LSJ A;  4XKC A;  4G6T B;  1N25 A;  2PMZ A;  2XGE A;  2Z33 A;  1K4T A;  5IP6 A;  3GEZ A;  4WK8 F;  1R6R A;  2MZ4 A;  3DU6 A;  3M8J A;  1JGS A;  2Q0O A;  4ZTF A;  3TW6 A;  3HBL A;  1XCV A;  1J7K A;  1ZAO A;  3ZQH A;  5E17 F;  2UXN A;  3LQQ A;  2D1H A;  2FOW A;  1KQ0 A;  2XRL A;  4XBF A;  2LRE A;  5FJ8 J;  2OPT A;  2TDX A;  1TW3 A;  1Z7L A;  2R7R A;  4NC6 A;  1VQ5 I;  2J5P A;  2H27 A;  4N9I A;  3O8H A;  3EYY A;  5D8K B;  2K86 A;  3IH3 A;  2P8T A;  2DA6 A;  4RGS A;  4U0Y A;  3L7W A;  3A01 B;  2V1N A;  4A12 A;  3GTG J;  1HW2 A;  3TL4 X;  3HTS B;  1X1C A;  1W5T A;  3IAM 2;  2RRE A;  1K78 A;  3ZMZ A;  1R58 A;  1R71 A;  4IHV A;  1FYM A;  1ZGA A;  4BE1 A;  2V6E A;  2ZXJ A;  1WJF A;  2KJC A;  1T0F A;  4WWC A;  1CF7 A;  5C4J J;  1OCO H;  2DFH A;  2HU9 A;  2OCC H;  1UHM A;  3HPG A;  3CMY A;  3IKV A;  3M3Y J;  4OAZ A;  3TW7 A;  1XPX A;  1WI9 A;  3O8G A;  3RI4 A;  4HW0 A;  1Z67 A;  5L3E A;  4W97 A;  2X6Y A;  3WOD F;  3IP4 B;  2DO7 A;  1WJE A;  2RGV A;  1TP4 A;  3E1S A;  1HKQ A;  1YYV A;  3M8E A;  2NVQ J;  1STZ A;  4M9Z A;  4F52 A;  1RR8 C;  1C0W A;  4GYI A;  1FPQ A;  2Y0S A;  1LFU P;  1BI0 A;  4QPQ A;  2Y69 H;  3GXO A;  1WI3 A;  4JX6 A;  3MCZ A;  2XB0 X;  4ZYE A;  1ZTR A;  4XMY A;  3BDD A;  4B47 A;  5ILS A;  4IOC F;  3I4P A;  4RB0 A;  5BPI A;  1SMY F;  2KIS A;  3BWG A;  4UHT A;  1B6A A;  1IN7 A;  1TT5 B;  1F1Z A;  2HDD A;  1D5Y A;  3BG3 A;  3SYT A;  1MKM A;  3HZJ A;  1H9T A;  5K5Q A;  1D5V A;  2ETH A;  3QU3 A;  2HTJ A;  3GO5 A;  2IGN A;  3HOT A;  4HDU A;  3A0B C;  3CCR I;  1IN4 A;  2O8X A;  3QP6 A;  6PAX A;  3WTZ A;  2W82 A;  3P9I A;  1U6G A;  4LB6 B;  1XMX A;  4IRG A;  2ZSI B;  3D5R C;  3ZMD A;  4FE7 A;  1B8I B;  2CO5 A;  3K6G A;  2H6B A;  3S93 A;  1JHF A;  2DA5 A;  2DPU A;  4UB8 C;  3TQN A;  2VLA A;  1SD7 A;  5IOZ A;  2QWW A;  1W36 C;  4M3G A;  1CGP A;  3E6B A;  3C18 A;  2P5K A;  2PJR B;  3HRM A;  4CCJ A;  2IGO A;  1R1U A;  2KJB A;  2LKS A;  1UG0 A;  2NS8 A;  2EWN A;  4C30 A;  1FIA A;  3H36 A;  3IWF A;  2IA1 A;  1VQ9 I;  1NHA A;  2FA5 A;  3CUQ C;  5LHH A;  3DXJ F;  3GX4 X;  2PI0 A;  5AIQ A;  3K10 A;  3G71 I;  3A4C A;  2E7X A;  1BN5 A;  1FZP B;  2STT A;  1ETV A;  3MKY B;  1GXP A;  3I3L A;  4XL9 A;  2KMU A;  1W36 D;  1A36 A;  2ELH A;  2JN6 A;  5FD5 A;  3BTC A;  4M3F A;  3LOC A;  3MKW B;  2OZ6 A;  1OCC H;  4A3I J;  1GVJ A;  2EIL H;  3EYI A;  4I99 C;  1K4S A;  1R36 A;  3PO2 J;  2CQ7 A;  3F8M A;  2ZB9 A;  4XLE A;  4ESF A;  3G73 A;  2ZXH A;  1FT9 A;  3OS2 A;  4JYK A;  4LB5 A;  4WXD A;  2X98 A;  3L00 A;  2FUG 2;  3G1L A;  5ED4 A;  1A04 A;  3E5U A;  2OAZ A;  1MGT A;  2BHY A;  1V5E A;  2K3P A;  2RQP A;  2VBX A;  5AON A;  5KAF C;  1OCT C;  3IRR A;  2IAI A;  2WTE A;  1R5I D;  4BEH B;  1ON2 A;  1UAA A;  3RIR A;  3W6J B;  2HPM A;  2PJR A;  4KMF A;  3VPR A;  3ERM A;  1SFX A;  5DCM A;  3O6B B;  2R5Y B;  3PO3 J;  2L9V A;  3DV8 A;  2OF7 A;  4YG2 F;  3CDI A;  1Y1V J;  3ZOB A;  3BOQ A;  2A6T A;  2CU7 A;  1BA5 A;  1N78 A;  1PYV A;  5H2F C;  2ELJ A;  3DTI A;  2JSP A;  3BG7 A;  1GT0 C;  1N77 A;  4IKF A;  4AM3 A;  4RM3 A;  2DA2 A;  1YI2 I;  1LJ9 A;  3PNY A;  3HKZ A;  1ITY A;  1QVU A;  4HF1 A;  4BUP A;  1LEA A;  2L01 A;  4BJ6 C;  2FF4 A;  3ISP A;  2VOP A;  1QRY A;  4CCO A;  3ECO A;  1LDD A;  4R79 A;  4IHS A;  3A52 A;  2ZJQ F;  2LBF A;  5IYC J;  1SFO J;  3MVP A;  2XPV A;  3I5U A;  2R7U A;  4E7H A;  2V1X A;  5LFA A;  3S2H J;  4QPO A;  1OJL A;  1Y0U A;  3R61 A;  3WGH A;  3ZQC A;  4HST A;  5EDN A;  1WJ5 A;  2K40 A;  2V26 A;  3D5S C;  3LMM A;  4P9U A;  5BOX A;  1Y0N A;  1J75 A;  1ZKG A;  2CG4 A;  5M5Y J;  2DXI A;  3BG5 A;  3LSK A;  4CO8 A;  2ISZ A;  3FXJ A;  2OV7 A;  2QUF A;  3DLL F;  2JUG A;  3OYB A;  2HS5 A;  1BJZ A;  2G9W A;  5HDN A;  1S29 A;  5DD4 A;  1I3A A;  5L3F A;  3U21 A;  2BY3 A;  2YUS A;  5HOD A;  1D1A A;  3JAM Z;  1T33 A;  1IZ1 A;  5LHI A;  3OYJ A;  1JUP A;  3LSR A;  4HSR A;  2W7N A;  2V1D A;  1YQA A;  2DTZ A;  2LY9 A;  2QYO A;  5FB2 A;  5HS7 A;  1EV7 A;  4R8H A;  2EB7 A;  4DNC A;  2DPD A;  5FD6 A;  3BTJ A;  2UWM A;  5HS8 A;  1JKO C;  3NAU A;  4G8X A;  4CSW A;  5IY5 H;  2KIF A;  2XPW A;  1R5G A;  1IXS B;  1RES A;  3ZMV A;  4B8X A;  1HOM A;  1LNW A;  2M3A A;  1LE8 B;  5F04 A;  1HC8 A;  2M9H A;  4XRS A;  2R0Q C;  2DT7 B;  2LF7 A;  4KIS A;  3JRH A;  1T56 A;  4V2F A;  1X4P A;  2B9S A;  2QM3 A;  1WCM J;  4L0Y B;  3CZ6 A;  3WTT C;  5FLM J;  4HQE A;  1BOB A;  2ESH A;  1KGS A;  1VQM I;  1BM9 A;  2F5C A;  1WH7 A;  2F4M B;  2XRO A;  4BXU A;  2DBB A;  3F21 A;  2OU2 A;  5CVI A;  4XKW A;  4X0G A;  2XF5 A;  4Y33 A;  2RV8 A;  3QPT A;  3S15 J;  2CV0 A;  1J2X A;  3BG9 A;  1LDK B;  4RA2 A;  1OFC X;  3DTE A;  2R7Z J;  3CTA A;  1E2X A;  5JLW A;  4B4C A;  2LOO A;  3NAR A;  4JQF A;  2NS7 A;  5DTD A;  4ZTJ A;  3H9Q A;  1QPI A;  2P7C B;  1S9H A;  1QZY A;  3SJM A;  2HYJ A;  3FM3 A;  3W3C A;  4AC0 A;  3RQ4 A;  1O4X A;  2LKX A;  1U9O A;  1SMT A;  4GRI A;  2E5N A;  2MFZ A;  5DD8 A;  2EBI A;  1R7J A;  4A6E A;  3LL7 A;  3CJN A;  3H9J A;  3CUO A;  3KZZ A;  1TNS A;  4HAM A;  4IX7 A;  3UKG A;  1JGG A;  2COM A;  3EET A;  1ON1 A;  3U1K A;  5DM6 F;  3J80 Z;  4W1U A;  1FBU A;  2IGK A;  2IW5 A;  1MJB A;  2PMH A;  3TO9 A;  3ZQF A;  1VFC A;  2JTV A;  3DPU A;  1K79 A;  2MLK A;  2WY7 Q;  2K5C A;  3NRV A;  4XOT A;  2HR3 A;  2EIJ H;  3U2R A;  3QWL A;  1FOY A;  1XX5 A;  4L5E A;  4UVB A;  1V55 H;  3HDD A;  3V42 A;  5J40 A;  2VON A;  2Y2Z A;  4AVP A;  4KNY A;  2CQN A;  1ETW A;  4B3X A;  4IZZ A;  2H1K A;  1TLH B;  1AU7 A;  1FJL A;  5ILV A;  2EFO A;  3L2C A;  1PUE E;  3LWF A;  3KE2 A;  1LFP A;  3LSP A;  2CJJ A;  4P5O A;  4V2G A;  5EYR A;  2H09 A;  2VQL A;  5KNL A;  3OYH A;  1XGO A;  1D3Y A;  5FLX Z;  3HJE A;  4ZZD A;  5ERI A;  2ID6 A;  1IRZ A;  4ESB A;  3RPQ A;  2R93 J;  1HDD C;  1TBX A;  3L9F A;  4XN3 A;  2WV1 A;  4ENJ A;  5B5E C;  2JQ7 A;  2ZC2 A;  3HB9 A;  5IT3 A;  1A6I A;  1TNT A;  2BYV E;  2HOA A;  3ZQI A;  5DDG A;  3CJQ B;  5LHG A;  2PEX A;  3KEO A;  1UFM A;  2DTR A;  3K0L A;  1U2W A;  4UB6 C;  4F7Z A;  2VC0 A;  1JJ6 C;  3RDI A;  1LB2 A;  1UB9 A;  5EJC A;  3GFM A;  1IF1 A;  5K7Z A;  4QSH A;  2ELK A;  1N75 A;  1B72 B;  2HKX A;  3BY6 A;  1UHS A;  2LY2 A;  4MFE A;  3VB2 A;  1YJN I;  2H1L A;  1T39 A;  3H3V K;  4D5F A;  5ICF A;  1RRJ A;  1IN8 A;  1XSX A;  1BR2 A;  1TWH J;  3CLO A;  4PK4 A;  2GXG A;  2H6C A;  3V8K A;  2CUJ A;  3ZCO A;  5GP9 A;  4BJT A;  4OIN F;  2LLK A;  4C9Y A;  3L2Q A;  1VQP I;  2WWY A;  1D1B A;  2M4G A;  3QOD A;  3R0J A;  1VQO I;  2DAO A;  2F4O B;  5D5U B;  2NOG A;  2Q2E B;  4A3F J;  2HQA A;  2DYR H;  2COB A;  1VQ4 I;  3I58 A;  3GW2 A;  4Z2Y A;  3TBI A;  2E2J J;  2KRF A;  2L5Q A;  4G6Q A;  4ENN A;  1TT0 A;  5IT9 K;  5IT9 R;  3DBR B;  1YE9 A;  2E1O A;  3ZQ7 A;  4CZC A;  3VYT B;  2D5V A;  3Q0V A;  2IS4 A;  2ZBK A;  3F6V A;  3KLO A;  2N8G A;  1LPQ A;  1BIA A;  3WTX C;  4M3B A;  2IA2 A;  1BJA A;  2R4G A;  2Y9Z A;  3PSI A;  5J1U A;  1RIO H;  2RNG A;  2ZJ2 A;  4JK1 X;  3DBL B;  4DQ2 A;  3OYF A;  2OJE D;  1SFE A;  3GUD A;  3ERE D;  2O61 A;  4M72 A;  5CYV A;  3KZI C;  1WQ2 A;  5JI6 A;  2JA6 J;  4UNO A;  3R4K A;  2HOS A;  2MD5 A;  4BNC A;  2M0C A;  2EQR A;  5LRR A;  1JTX A;  3H3U A;  2A5W A;  4CIC A;  3G2B A;  1A31 A;  3GTM J;  3ABT A;  5FKL A;  2CUF A;  1O7L A;  3DPT A;  2EA2 A;  2XGX A;  2DFF A;  3ZMT A;  4BXF A;  2Y31 A;  3SZT A;  1Z9C A;  2HVR A;  2CUZ A;  4AIK A;  2V9P A;  4UV9 A;  4M6X A;  1W0U A;  3FIW A;  1ZHF A;  4UUS A;  2VJ5 A;  4I98 B;  3D0S A;  1WJC A;  2R7S A;  2Z99 A;  2E19 A;  4KN7 X;  4A69 C;  3GZ6 A;  3NEU A;  3OR2 C;  1SC7 A;  4O6J A;  2P5L C;  3CLQ A;  3JTG A;  3H9G A;  2ZO4 A;  1W1W E;  2A6H F;  4I7H A;  4PUS A;  4LOC A;  3Q0W A;  4AVZ A;  2H94 A;  4YFK F;  4B3A A;  3I0T A;  4I0A A;  2P81 A;  5HOO A;  4B44 A;  3CCJ I;  1Z21 A;  4R1H A;  1X58 A;  4XKV A;  2FNA A;  5E8I A;  4KYW A;  4IRI A;  4XON A;  4GO1 A;  4Y15 A;  1O3T A;  1MDM B;  2RC4 A;  5K5R A;  3MMY B;  5EEH A;  4AD9 A;  2B7E A;  2EZK A;  3CDH A;  4B09 A;  3JSO A;  3SFZ A;  2Y9Y A;  2WAQ A;  1L3L A;  3CJT B;  3FXR A;  3WU1 B;  3F6O A;  5TIS C;  3EUH A;  1E3P A;  3ZN0 A;  2ZME C;  4P96 A;  2W4S A;  3IV5 A;  3WG9 A;  4IEJ A;  1B1B A;  4BQA A;  3ASO H;  1XS9 A;  4MIM A;  1X3W B;  1RET A;  3BR0 A;  4E7I A;  4ZZL A;  2EZL A;  3ABU A;  4PGH A;  1LDJ A;  4BAC A;  2M30 A;  3FM5 A;  4Z6Y A;  2VBZ A;  2W1O A;  4B48 A;  4CGZ A;  4CYD A;  4XLH A;  2FE3 A;  2JMW A;  1WSU A;  2YS9 A;  2IGM A;  3AFH A;  5E3L A;  4ESJ A;  4BQO A;  1IRX A;  1ORK A;  4HA8 A;  3TMO A;  4XLP F;  2HOT A;  3WG7 H;  4OIR F;  1AKH A;  5M3M J;  3D1N I;  2P5V A;  3IH2 A;  4DBR A;  2K85 A;  2WAQ N;  2DMT A;  1BC7 C;  2KIQ A;  3U1D A;  4ZJZ A;  4U7D A;  2W85 A;  2KHM A;  2LDU A;  2ECB A;  3KEY A;  2BZT A;  4BAY A;  2MH9 A;  1HLV A;  1YFH A;  2K9N A;  1I6H J;  1R9T J;  2XAU A; 
#chains in the Genus database with same CATH homology
 1TW2 A;  2FBI A;  1I27 A;  2RVC A;  2DQL A;  4ZYG A;  4G7Z F;  4MTD A;  4L18 B;  1F5T A;  1YS7 A;  4XLN F;  1RUN A;  1F4K A;  1OR7 A;  1YW8 A;  3KZY A;  1WKM A;  5ICE A;  1GXQ A;  1Z7U A;  1O3S A;  4Y13 A;  1S3J A;  4HZF A;  4NQW A;  1HW5 A;  3O3K A;  3RKX A;  1GHC A;  2CGP A;  1DPR A;  1KYZ A;  3HRU A;  3LQR A;  2BBY A;  3L09 A;  1HST A;  4HF2 A;  2G7H A;  1KQ8 A;  4O3M A;  2HYF A;  3QAH A;  3ULQ B;  1K7A A;  4AWX B;  3RTR A;  1FLI A;  5DYM A;  4AIJ A;  3F22 A;  5D8L B;  3LAP A;  2CW0 F;  1QQI A;  4WXC A;  1S6L A;  1B9M A;  1H0M A;  2QEN A;  1XCB A;  3D5L A;  3LA7 A;  2HQN A;  4G7O F;  1MJ9 A;  2D1V A;  2OQR A;  5CVU A;  1HBX G;  2XHK A;  2D2W A;  2R3S A;  1ODD A;  4MHG A;  5LGT A;  3E5Q A;  3TDZ C;  3U9G A;  2IVM A;  2ZFW A;  1PDN C;  4FX0 A;  4MEY F;  4MQV A;  2O3F A;  2JT1 A;  4EM1 A;  1J5Y A;  2HTS A;  5CLS A;  4HDV A;  2XVC A;  2VBW A;  3LAJ A;  5L3B A;  5H20 A;  4HV6 A;  4OMZ A;  3FZV A;  1OPC A;  2FOK A;  4M6Y A;  3GFI A;  2IJL A;  3B02 A;  2BV6 A;  2O6G E;  1U78 A;  5FFX A;  1I1G A;  1YTY A;  2RDP A;  3TO7 A;  3IL2 A;  2L3D A;  2BEO A;  3DF8 A;  1R22 A;  2JRT A;  2HZT A;  2K02 A;  1BOA A;  1OYW A;  3HRT A;  4Q48 A;  1HKS A;  5D5X B;  1BIB A;  4RB2 C;  4OMY A;  2YU3 A;  4ENK A;  2GXB A;  3Q9S A;  1QO0 D;  3QP5 A;  1FP1 D;  3Q9V A;  4HBL A;  5HS9 A;  3HYI A;  2E7W A;  3E97 A;  1G4D A;  3BJ6 A;  1FX7 A;  3GVA A;  1QBJ A;  3P9C A;  2FU4 A;  3E6D A;  1RI7 A;  3E6M A;  4OIO F;  3GZ5 A;  3M7G A;  2GWR A;  1PP7 U;  1R23 A;  2MH2 A;  3PQJ A;  3V7C A;  1U5T C;  2Y48 A;  1T98 A;  4UXN A;  2LSO A;  2BE5 F;  5LLQ A;  1G3T A;  1W4M A;  2FML A;  4KIB A;  2VE9 A;  1FP2 A;  1P4X A;  5IT9 Z;  3FX3 A;  3K69 A;  3HOS A;  4UVA A;  1YW9 A;  1SD6 A;  3T1B A;  4GCV A;  2ADU A;  4HX7 A;  1G3W A;  2Y75 A;  5E20 A;  2HYG D;  4L9N A;  1ZRF A;  2AXL A;  3DQV C;  5A2Q K;  4LG0 B;  4RS8 A;  4EMS A;  3ML6 A;  3WTU C;  1UCR A;  2NS0 A;  2L4A A;  2V1U A;  4LGW A;  4MTE A;  3WE2 A;  2FQ3 A;  4A0X A;  2STW A;  4XRF A;  1ULY A;  3T8T A;  3DFG A;  3C3W A;  1ZG3 A;  4G94 A;  4JBA A;  3R6S A;  1TQP A;  1G3Y A;  1W5S A;  2UZK A;  2GA1 A;  1ZLJ A;  3GF2 A;  5HLG A;  4LG0 A;  5DCF A;  1IXR C;  3DKW A;  4YFN F;  3V7R A;  5K1Y A;  1SAX A;  2Q8K A;  4LLG F;  1KU7 A;  4LLN A;  1P92 A;  4A6D A;  3TOB A;  1Z91 A;  2DI3 A;  1XMK A;  3O2P E;  3V7S A;  4ETS A;  1V3F A;  1J59 A;  2VOD A;  2J5O A;  1YIO A;  4P55 A;  2IRF G;  1FWZ A;  1W7P D;  1IN6 A;  3FWE A;  4YFX F;  4OIQ F;  1FYK A;  4BHC A;  3WTY C;  5F6F A;  5D4R A;  3C1D A;  1K6O A;  1T6S A;  1Z1D A;  2YX7 A;  3RKW A;  4KT5 C;  1XGM A;  2F5F A;  2GZW A;  1JXS A;  1IN5 A;  2OD5 A;  2FSW A;  4G7H F;  2IP2 A;  3SXY A;  4HQM A;  1IXC A;  1T38 A;  3GWZ A;  4PDK A;  3TOA A;  2YPR A;  2ZCW A;  2D45 A;  3MEX A;  5BS6 A;  3KP5 A;  1MD0 A;  4EV0 A;  2IPQ X;  4A5M A;  2L02 A;  3I64 A;  3JSP A;  3REO A;  2DK5 A;  3CUQ B;  3BP8 A;  4G9Y A;  5K5O A;  4ENM A;  5E18 F;  4KFC A;  4WCG A;  2Z3Y A;  4M71 A;  1R5H A;  1YG2 A;  1L0O C;  2HKO A;  2LNB A;  1ZN2 A;  3BRO A;  3VOD A;  3KCC A;  4D0P A;  1F9N A;  5CVJ A;  1YLF A;  4BHP A;  2LKP A;  5D4S A;  5JHU A;  5TJJ A;  2EV5 A;  5DEQ A;  2F5D A;  4O5V A;  2EFN A;  2XAS A;  1VTN C;  1G6N A;  4G6D A;  3LFK A;  1U5T B;  3MZY A;  2L54 A;  3OV8 A;  1XB4 A;  4EM0 B;  2VXZ A;  3E3V A;  1IW7 F;  2IA0 A;  3CUQ A;  1KU2 A;  3BJO A;  2RKH A;  3VFZ A;  2P7V B;  1EH7 A;  1KU3 A;  3OOP A;  5CVV A;  2XAJ A;  5LEJ A;  4N0B A;  4QLC U;  2VT3 A;  4EJV A;  2NRA C;  2Z9O A;  5DUK A;  1FC3 A;  4L5J A;  1R1T A;  1MZB A;  4Q47 A;  3TKY A;  5AIP A;  1XDS A;  4LD5 A;  4U7B A;  1R00 A;  3VOE A;  2M8E A;  4HLX A;  3I54 A;  4IRH A;  2RNJ A;  2Q2E A;  1YO5 C;  2K4J A;  2DU9 A;  3SZP A;  2QBY B;  5DV5 A;  2FBH A;  1RUO A;  4HX4 A;  4A0Y A;  4NHJ A;  2P6S A;  2EK5 A;  1DP7 P;  5HDG A;  3CO7 C;  4Q4Z F;  1JE8 A;  3WTW C;  4M74 A;  3BJA A;  4MEX F;  4WF2 A;  4HOB A;  4RAZ A;  3HHH A;  3WU0 A;  5F1R A;  5ICG A;  1U8R A;  3FXU A;  5LRS A;  1B59 A;  2OQG A;  5BQT A;  4U0V A;  1S8N A;  3RKY A;  2DLL A;  4I09 A;  1WRJ A;  4FT8 A;  3JTH A;  3H3Z A;  2CYY A;  2HWV A;  4EGY A;  1W7P B;  3SHF A;  1MJA A;  3WGG A;  3I59 B;  1Z6T A;  4EGZ A;  5H6Q A;  4IVN A;  2EFQ A;  1Z05 A;  5FO5 A;  3AAF A;  1XD7 A;  3ZN1 A;  2YR2 A;  2KIM A;  4L9V A;  1MDM A;  3LA3 A;  2K27 A;  4BHB A;  3J80 K;  2VC1 A;  4ON0 A;  4XSX F;  3FMS A;  4LLL A;  1TTY A;  3RJP A;  4KDP A;  5BMZ A;  1I1S A;  2XAF A;  4EJO A;  1HQC A;  2XKP A;  2QZ8 A;  2JSC A;  3K1P A;  3F8F A;  2MBF A;  2VN2 A;  3DEU A;  2O0Y A;  1G3S A;  4CDG A;  2M45 A;  2VBY A;  2ZNZ A;  3HTU A;  2XUB A;  3EDP A;  5A2Q Z;  1FNN A;  3R0A A;  2XRN A;  1CF7 B;  3V8L A;  1R1V A;  3HRS A;  2PQ8 A;  1BI2 A;  3EQL F;  4LFU A;  3T8R A;  3FHZ A;  2XAH A;  1QNT A;  5FFZ A;  4HYE A;  3MZH A;  2E1N A;  2LF8 A;  2XV4 S;  2YSR A;  2M1B A;  1PP8 F;  3HSE A;  5E1W A;  2FEZ A;  1P6R A;  1Q1H A;  2DW4 A;  4S04 A;  3BPX A;  3QOP A;  1ZG5 A;  4H0E A;  2BGC A;  5EEG A;  2PFB A;  5BPD A;  3Q5F A;  4Q5S F;  1XDU A;  4QWQ A;  3WGI A;  1V4R A;  2O03 A;  1WWX A;  2Y0M A;  3ZMU A;  4KUM A;  1USS A;  5D5V B;  3FMR A;  1HSJ A;  5KK1 A;  3I53 A;  4S05 A;  3V8J A;  4WX9 A;  1KU9 A;  3W6K B;  2PLY A;  2V6C A;  4CHU A;  2FBK A;  4OIP F;  2GQQ A;  3F72 A;  5LBQ A;  4RGR A;  1FOK A;  2V79 A;  1XSV A;  2PG4 A;  2R7D A;  3GLX A;  3HIF A;  1REP C;  2EFW A;  4HV5 A;  4GXO A;  3B73 A;  2DT5 A;  4A2U A;  1U3E M;  4YII A;  3ZP5 A;  2QLZ A;  2EJR A;  4UV8 A;  3ELK A;  2L4M A;  2ACJ A;  1DDN A;  3IWZ A;  2R7F A;  2EV6 A;  2OZU A;  1OMI A;  2JPC A;  1JHH A;  5D6E A;  2VT2 A;  2XKO A;  5DCM B;  3I71 A;  2M5W A;  5HLH A;  4RAY A;  3K1M A;  2W24 A;  1KQ9 A;  4KMU X;  4MQ9 F;  1YW7 A;  4KN4 X;  5D6F A;  2ZME B;  3N97 A;  3IC7 A;  2W84 A;  4FHT A;  4K2E A;  3FF5 A;  2EFP A;  1S7A A;  4KIC A;  1EH8 A;  2DFI A;  1FY7 A;  1O57 A;  2A3S A;  2PMU A;  1YS6 A;  3H92 A;  4EVI A;  3F23 A;  4A0Z A;  1J9I A;  4RGU A;  1B4A A;  2Z5U A;  3QPH A;  3E5X A;  2CQK A;  1XSD A;  2QQA A;  2NAZ A;  3WE3 A;  4L5I A;  4ZYD A;  2XAQ A;  2ZME A;  3FMQ A;  3S2W A;  1FBQ A;  1TQM A;  2QQ9 A;  4UUV A;  1HW1 A;  3PFI A;  2F5E A;  3J81 K;  1FYL A;  1SFU A;  1H9G A;  1SD4 A;  4MGR A;  2ZNY A;  2NNY A;  5L3D A;  4EJU A;  3ZMS A;  4I2O A;  2CSO A;  5CJ9 A;  2DQR A;  4GYG A;  3MFK A;  1HXD A;  1XN7 A;  4E70 A;  3M8F A;  1AOY A;  2NNN A;  3KP3 A;  3WTV C;  3F3X A;  4I01 A;  5JVT A;  4PZJ A;  1P2F A;  5HDK A;  2ESN A;  3BZ6 A;  3VEP A;  4IJA A;  1BI3 A;  1AWC A;  2MA3 A;  3K9T A;  1ZRE A;  1D8J A;  3IKT A;  1FSE A;  5HLI A;  5ILU A;  5TRD A;  1IRG A;  2HOE A;  2GA2 A;  4GGG A;  5L3C A;  5LGN A;  4RB3 C;  1ZYR F;  1XGN A;  4I02 A;  3IRQ A;  2VE8 A;  4M9X A;  2QVO A;  5JFR A;  3F8B A;  3PQK A;  1O7F A;  2A69 F;  4IPA A;  2V9V A;  2WV0 A;  1B9N A;  2FMY A;  2KKO A;  2DK8 A;  1BBY A;  2M87 A;  4M73 A;  3E6C C;  4HLY A;  1O3Q A;  2G7U A;  3V4G A;  4EQQ A;  1QZZ A;  3C7J A;  2RN7 A;  3GFJ A;  1XGS A;  2AS5 F;  2OBP A;  3K2Z A;  4ZH4 F;  5J8F A;  3TDU C;  5JR3 A;  5LGU A;  1UHW A;  2YX4 A;  2IT0 A;  2HEO A;  4WXH A;  2K7L A;  5L3G A;  3COA C;  2X0L A;  3M1E A;  4PGG A;  3SQN A;  2HQR A;  5H6R A;  4LK0 F;  2FRH A;  1ZRD A;  3TO6 A;  2ZKZ A;  4L0Z B;  3KP7 A;  4U0W A;  5J6X A;  4KA4 A;  5J8C A;  2C6Y A;  3DP7 A;  2GIV A;  1KA8 A;  3N4M A;  2ISY A;  4EM2 A;  4RGX A;  3M9A A;  3KLN A;  2WC2 A;  1LVA A;  3KFW X;  1QPM A;  3F8C A;  1ZRC A;  4OOI A;  1D8K A;  1EH6 A;  2HGC A;  5E1X A;  3TGN A;  3ZPL A;  4HX8 A;  1ZH5 A;  1E17 A;  1FBS A;  4N9H A;  2JPB A;  3KP2 A;  2EA4 A;  3LA2 A;  1I5Z A;  1S7O A;  4U88 A;  2X4H A;  2VOO A;  4TV7 A;  1IUY A;  1ZLK A;  3DPL C;  4NB5 A;  3BPV A;  4BYY A;  4A5N A;  4CZZ A;  5HVQ C;  4LJZ F;  3P9K A;  4Y17 A;  1DUX C;  2PN6 A;  2F2E A;  4ZYH A;  5DUI A;  1OYY A;  4L9J A;  3QU6 A;  1OKR A;  2A61 A;  3KET A;  2HDC A;  3G3Z A;  4L9T A;  4KIG A;  2K4B A;  3RYR A;  2PBI A;  1U5T A;  3WTS C;  3HUG A;  3F8N A;  3KEQ A;  4KIF A;  4ASN A;  3FXQ A;  4CXF A;  3ECH A;  1HKT A;  2XAG A;  3JAM K;  5KVR A;  1RZ4 A;  2GAU A;  3J7A O;  4M9S A;  3GYH X;  3HHG A;  4OU0 A;  5F64 A;  1BI1 A;  1X3U A;  2FXA A;  2W25 A;  1Z6R A;  5ICC A;  5D5W B;  2PJP A;  3IHU A;  3MAJ A;  1ZG1 A;  5FGM A;  2QQB A;  2E1C A;  3ROU A;  5CVR A;  1KYW A;  4BH9 A;  2EV0 A;  4XSZ F;  2A07 F;  4UVC A;  2A6E F;  4EJT A;  3NQO A;  3K1N A;  2QBY A;  2B0L A;  3LST A;  4AIH A;  1LQ1 A;  1I6X A;  1RNL A;  2CWE A;  1ZGJ A;  4LK1 F;  2UXX A;  2XIG A;  1P4W A;  2A68 F;  4I0B A;  4MNU A;  5E8G A;  3CO6 C;  3MWM A;  1P4A A;  3R60 A;  2P6T A;  2FNP A;  3HSF A;  3P7N A;  4YIF A;  1XMA A;  2P4W A;  3QRF F;  4IF4 A;  1SD5 A;  1QGP A;  3GFL A;  2W57 A;  1IRF A;  4IHT A;  2NYX A;  1ZAR A;  3T5X A;  2MLG A;  4LMY A;  2A5Y B;  2MC3 A;  5LEK A;  3HSR A;  3MQ0 A;  3JW4 A;  4RB1 A;  1W7P A;  1OYI A;  1FSH A;  3KP4 A;  3I59 A;  1ONV A;  1T2K A;  1TQI A;  4EJW A;  4PCQ A;  3RPU A;  3KP6 A;  4P9F A;  2OA4 A;  1LEB A;  5FLX K;  3RYP A;  1K78 B;  1BC8 C;  2CFX A;  2KIU A;  5E1Z B;  4HF0 A;  3J81 Z;  1O3R A;  2HFH A;  2JZY A;  1IAW A;  3T0Y A;  1UST A;  1J0R A;  4FX4 A;  1DPU A;  4IXA A;  2Z33 A;  3GEZ A;  4WK8 F;  1JGS A;  2Q0O A;  1XCV A;  1J7K A;  1ZAO A;  5E17 F;  2UXN A;  3LQQ A;  2D1H A;  1KQ0 A;  4XBF A;  2TDX A;  1TW3 A;  2J5P A;  2H27 A;  4N9I A;  3EYY A;  5D8K B;  2K86 A;  2P8T A;  4RGS A;  4U0Y A;  3L7W A;  4A12 A;  1HW2 A;  3HTS B;  1W5T A;  1K78 A;  3ZMZ A;  1R58 A;  1FYM A;  1ZGA A;  2ZXJ A;  2KJC A;  1T0F A;  4WWC A;  1CF7 A;  1UHM A;  3IKV A;  1WI9 A;  3RI4 A;  4HW0 A;  5L3E A;  3WOD F;  2DO7 A;  2RGV A;  1HKQ A;  1YYV A;  3M8E A;  1STZ A;  4M9Z A;  1C0W A;  4GYI A;  1FPQ A;  1BI0 A;  3GXO A;  3MCZ A;  4ZYE A;  3BDD A;  5ILS A;  3I4P A;  4RB0 A;  5BPI A;  1SMY F;  3BWG A;  4UHT A;  1B6A A;  1IN7 A;  1F1Z A;  1MKM A;  1H9T A;  5K5Q A;  1D5V A;  2ETH A;  3QU3 A;  2HTJ A;  3GO5 A;  3HOT A;  4HDU A;  1IN4 A;  2O8X A;  3QP6 A;  6PAX A;  3WTZ A;  3P9I A;  1U6G A;  4LB6 B;  4IRG A;  3ZMD A;  2CO5 A;  2H6B A;  1JHF A;  2DPU A;  3TQN A;  1SD7 A;  2QWW A;  1CGP A;  3E6B A;  3C18 A;  2P5K A;  3HRM A;  1R1U A;  2KJB A;  2EWN A;  3IWF A;  2IA1 A;  1NHA A;  2FA5 A;  3CUQ C;  5LHH A;  3DXJ F;  3GX4 X;  2PI0 A;  5AIQ A;  2E7X A;  1BN5 A;  1FZP B;  2STT A;  1GXP A;  2ELH A;  5FD5 A;  2OZ6 A;  1GVJ A;  3EYI A;  1R36 A;  3F8M A;  3G73 A;  4ESF A;  1FT9 A;  4LB5 A;  4WXD A;  3L00 A;  5ED4 A;  1A04 A;  3E5U A;  2OAZ A;  1MGT A;  2RQP A;  2VBX A;  5AON A;  3IRR A;  2WTE A;  1ON2 A;  3RIR A;  3W6J B;  4KMF A;  1SFX A;  5DCM A;  3O6B B;  3DV8 A;  4YG2 F;  3BOQ A;  1LJ9 A;  4HF1 A;  1LEA A;  2L01 A;  2FF4 A;  3ISP A;  2VOP A;  3ECO A;  1LDD A;  4R79 A;  4IHS A;  3I5U A;  2V1X A;  1Y0U A;  3R61 A;  3WGH A;  4P9U A;  5BOX A;  1J75 A;  2CG4 A;  4CO8 A;  2ISZ A;  2QUF A;  2HS5 A;  2G9W A;  5HDN A;  1S29 A;  5DD4 A;  5L3F A;  3JAM Z;  5LHI A;  1IZ1 A;  2V1D A;  1YQA A;  2QYO A;  5FB2 A;  5HS7 A;  1EV7 A;  4R8H A;  2EB7 A;  4DNC A;  2DPD A;  5FD6 A;  2UWM A;  5HS8 A;  4G8X A;  2KIF A;  1R5G A;  1IXS B;  3ZMV A;  4B8X A;  1LNW A;  2LF7 A;  2QM3 A;  4L0Y B;  3WTT C;  4HQE A;  2ESH A;  1KGS A;  1BM9 A;  2F5C A;  2XRO A;  4BXU A;  2DBB A;  3F21 A;  2OU2 A;  5CVI A;  2RV8 A;  3QPT A;  1J2X A;  1LDK B;  3CTA A;  1E2X A;  4JQF A;  2P7C B;  1QZY A;  3FM3 A;  1SMT A;  4A6E A;  5DD8 A;  1R7J A;  3CJN A;  3CUO A;  3KZZ A;  1TNS A;  4HAM A;  2COM A;  3EET A;  1ON1 A;  3J80 Z;  1FBU A;  2IW5 A;  1MJB A;  2PMH A;  3TO9 A;  2JTV A;  1K79 A;  2MLK A;  3NRV A;  2HR3 A;  3U2R A;  4UVB A;  2VON A;  4AVP A;  4KNY A;  1TLH B;  5ILV A;  2EFO A;  3L2C A;  1PUE E;  3LWF A;  3KE2 A;  4P5O A;  2H09 A;  1XGO A;  1D3Y A;  5FLX Z;  4ZZD A;  5ERI A;  4ESB A;  3RPQ A;  1TBX A;  3L9F A;  4ENJ A;  5IT3 A;  1TNT A;  2BYV E;  5DDG A;  5LHG A;  2PEX A;  3KEO A;  1UFM A;  2DTR A;  3K0L A;  1U2W A;  4F7Z A;  2VC0 A;  3RDI A;  1LB2 A;  1UB9 A;  3GFM A;  1IF1 A;  2HKX A;  3BY6 A;  3VB2 A;  1T39 A;  5ICF A;  1IN8 A;  1XSX A;  3CLO A;  2GXG A;  2H6C A;  3V8K A;  4OIN F;  2WWY A;  3R0J A;  2DAO A;  5D5U B;  3I58 A;  3GW2 A;  4Z2Y A;  2KRF A;  4G6Q A;  4ENN A;  5IT9 K;  3ZQ7 A;  2ZBK A;  3F6V A;  3KLO A;  1BIA A;  3WTX C;  2IA2 A;  1BJA A;  1RIO H;  2ZJ2 A;  4JK1 X;  4DQ2 A;  1SFE A;  3GUD A;  3ERE D;  2O61 A;  4M72 A;  5CYV A;  1WQ2 A;  5JI6 A;  4UNO A;  3R4K A;  2MD5 A;  4BNC A;  5LRR A;  4CIC A;  3H3U A;  3ABT A;  1O7L A;  3DPT A;  2EA2 A;  2XGX A;  3ZMT A;  1Z9C A;  3SZT A;  4AIK A;  4UV9 A;  4M6X A;  1ZHF A;  4I98 B;  3D0S A;  2Z99 A;  4KN7 X;  3GZ6 A;  3NEU A;  4O6J A;  2P5L C;  3JTG A;  2ZO4 A;  2A6H F;  4I7H A;  2H94 A;  4YFK F;  3I0T A;  4I0A A;  5HOO A;  4R1H A;  5E8I A;  2FNA A;  4KYW A;  4IRI A;  4GO1 A;  4Y15 A;  1O3T A;  1MDM B;  2RC4 A;  5K5R A;  5EEH A;  4AD9 A;  3CDH A;  4B09 A;  3JSO A;  3SFZ A;  1L3L A;  3WU1 B;  3FXR A;  3F6O A;  3EUH A;  3ZN0 A;  4P96 A;  3WG9 A;  1B1B A;  4BQA A;  4ZZL A;  3ABU A;  4PGH A;  1LDJ A;  2M30 A;  3FM5 A;  2VBZ A;  4CGZ A;  4CYD A;  2FE3 A;  1WSU A;  4ESJ A;  4HA8 A;  4XLP F;  4OIR F;  2P5V A;  1BC7 C;  3U1D A;  4U7D A;  2W85 A;  2LDU A;  4BAY A;  2MH9 A;  1YFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...