1C0WA

Crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
173
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVIVQINEIFQVETDQFTQLLDAVELLDDLAHTIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*AP*TP*TP*AP*GP*GP*TP*TP*AP*GP*CP*CP*TP*AP*CP*CP*
publication title Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation/dna
total genus 63
structure length 173
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1c0wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1c0wA02
3D5LA 1IW7F 2QBYB 2EV6A 2X0LA 2A6EF 3FHZA 2HS5A 4G7HF 3RPUA 3ERED 3CUOA 2CO5A 2Y48A 1J0RA 3KP6A 1SD6A 3LA2A 3K1PA 3K9TA 1IRFA 3G3ZA 1BI3A 4KN4X 1MJAA 2M30A 4WK8F 2LKPA 3LAPA 1FX7A 1MD0A 5CVUA 5CVJA 2GWRA 1Z05A 4EV0A 1KYZA 3VB2A 2MC3A 2PBIA 1YYVA 2XVCA 3I59B 1D3YA 3L7WA 4NQWA 1IUYA 2RC4A 2DPUA 4A5NA 4OMYA 3SZPA 1U5TA 3WU0A 2KKOA 4CDGA 2HQRA 2ZNZA 4LFUA 4BYYA 2OZUA 1FC3A 4HV6A 5JFRA 1LNWA 1YW9A 5IT9K 1S6LA 2Q2EA 3BPVA 2BE5F 5HS9A 2EK5A 5H6QA 4Q5SF 3RKWA 5LGTA 2F5FA 4NHJA 2H09A 2HFHA 2DQLA 4EJWA 3BJ6A 4L9TA 3I5UA 2YR2A 3GX4X 1K78A 2F5DA 3F8MA 3TDUC 4FX0A 1BI2A 3TGNA 4IF4A 4OIPF 1OMIA 1YS6A 1G3TA 1U3EM 1XD7A 2V79A 5E1ZB 1FYKA 3GO5A 4O6JA 2D2WA 2UXXA 3LQQA 3GW2A 4YIIA 2LDUA 4B8XA 1FSHA 2E7XA 3B02A 3CUQC 3FMSA 5A2QK 2F5EA 1UB9A 3ZPLA 4ZYHA 1O7LA 2NRAC 2XAHA 1WSUA 2MLGA 3REOA 1MZBA 2VT3A 2LF8A 2Y0MA 3G73A 4ENNA 1SFUA 3JSPA 2IA2A 4M71A 2HQNA 2FXAA 2Y75A 2W85A 3KP2A 2FU4A 3FMRA 2DPDA 1LB2A 3SXYA 3MFKA 4S04A 4BH9A 3OOPA 5DYMA 4RGSA 3EYIA 4F7ZA 2PMHA 2ETHA 2J5OA 2QQBA 4ESJA 1IN5A 3FF5A 1ULYA 3DPLC 4RB3C 4MGRA 1P4WA 2EWNA 3Q9VA 5F6FA 4Q47A 4WWCA 4LLLA 4CGZA 2V1DA 1SFXA 1U78A 4G9YA 5CVRA 4EVIA 2XRNA 4WF2A 3GYHX 1LEBA 3TOBA 1BIBA 3FWEA 1MDMB 1AOYA 2A3SA 3GVAA 1TW2A 3LA7A 3J81Z 1XN7A 3JAMK 2ADUA 5DD4A 1OPCA 5LRRA 2UZKA 4EM2A 2Z3YA 3O2PE 1XMAA 1PP8F 3WGHA 2D45A 2HKXA 2L3DA 3FXUA 2IA1A 2GXBA 1S8NA 1X3UA 4I2OA 1BI1A 3K69A 4IVNA 4B09A 1F5TA 5FGMA 2WC2A 3HSFA 3ZP5A 5FO5A 2QLZA 4HQEA 4GYIA 2OD5A 4IHTA 5LHGA 1H9GA 3TO6A 1J7KA 2ESHA 2O6GE 3HHGA 2MLKA 4P55A 4N9HA 2EFOA 4OIQF 3FM3A 4EM1A 5HS7A 1XB4A 5D6FA 3OV8A 5LLQA 1AWCA 4RGUA 2ZXJA 2CG4A 1BOAA 4HOBA 1JE8A 1NHAA 2XGXA 2D1HA 4MEYF 2MA3A 4LG0A 3HRTA 2DK8A 5K5RA 1CF7A 3RPQA 4XRFA 3BZ6A 4MHGA 4DNCA 4G6QA 3DEUA 1LEAA 1SD7A 4ENKA 2IA0A 2K4JA 2DO7A 5FD6A 3WODF 4L0YB 1ZH5A 3ZMVA 1MGTA 5JR3A 2L54A 4ENMA 1I27A 3J80Z 2RNJA 1D8JA 2STWA 2FEZA 4HYEA 4LG0B 2O03A 4I98B 2QENA 1U8RA 2JPCA 3TKYA 3WE2A 2KIFA 2AXLA 2HYGD 2IP2A 3O3KA 2EA2A 1O7FA 1R58A 3JW4A 4M73A 1EH7A 2JT1A 4S05A 3ROUA 1FP2A 2WWYA 2WV0A 1BC7C 2K7LA 4P9UA 1QNTA 3V7RA 2K27A 2NNNA 2Z9OA 3KCCA 4IPAA 1IN7A 1G4DA 2CW0F 4NB5A 2VOPA 4ETSA 2CQKA 2FMYA 3PQKA 3MWMA 2PI0A 2STTA 1U2WA 4Q4ZF 3DKWA 2VT2A 1PDNC 5ICGA 5BMZA 5LGNA 1YW7A 5CLSA 1QZYA 5H6RA 3GFJA 3E3VA 4CHUA 2W57A 4ESBA 1W7PB 1LVAA 3I53A 2IVMA 3JTGA 3GF2A 1EV7A 2EJRA 3U1DA 2BV6A 1ZG5A 1TW3A 5D4RA 2QWWA 2L4AA 2F5CA 5ERIA 4O3MA 1QO0D 2VE8A 3IC7A 3FZVA 3F72A 1TNTA 1KQ9A 2DI3A 1P92A 1W5TA 1RUOA 2BEOA 3F23A 2KIMA 4QWQA 3KE2A 2VBWA 3CTAA 2LNBA 4PGGA 1EH6A 3WTSC 2G9WA 2QBYA 4IRHA 1FYLA 4HX4A 4I09A 2AS5F 1WWXA 1OYYA 5L3DA 3IHUA 1QPMA 3ML6A 3EETA 4UHTA 4XSZF 3FX3A 2QM3A 3QP5A 3J7AO 1FYMA 3I59A 4HLXA 1XDUA 4A0YA 1WQ2A 3NEUA 5CJ9A 3PQJA 5HDGA 5EEGA 3I54A 1KYWA 4EJVA 2R7FA 3BJOA 4G8XA 4U7BA 3V4GA 4UV8A 3F8BA 3T0YA 3HTSB 3BPXA 1XCBA 2PG4A 1HSJA 3WU1B 4XLPF 3V7SA 1V4RA 1HSTA 3HYIA 2FNPA 5F64A 3VFZA 5E1XA 2J5PA 2QYOA 2NNYA 3FXRA 3COAC 3H3ZA 1HW1A 1SD5A 4U88A 3BWGA 2CSOA 4LLNA 5AIQA 3WTYC 2OU2A 3ZMZA 2K02A 2E1CA 3QP6A 1RI7A 3MZYA 1YLFA 1IN4A 4UVAA 1OR7A 3RTRA 3I58A 3WTZA 1U6GA 3KZYA 1ONVA 1STZA 1S29A 4AIJA 2FOKA 4HV5A 2RDPA 2GIVA 1ZRDA 3P9CA 4AIHA 2QQ9A 1WKMA 5E17F 2M1BA 2RN7A 3LFKA 5H20A 4KIFA 4RAYA 3E6DA 5E8IA 1BI0A 2GAUA 3ECHA 4AWXB 4OIRF 5ILVA 1JGSA 1ODDA 1GXPA 1QQIA 4LJZF 2R7DA 4HLYA 2FRHA 2JTVA 5DDGA 1XSXA 3KETA 4M72A 4L0ZB 3SQNA 1BN5A 5J6XA 1HW2A 3K0LA 2JZYA 4MNUA 4BNCA 5K1YA 1LJ9A 1W4MA 3U9GA 4CZZA 1HKQA 3MEXA 4HA8A 2P5LC 1F9NA 1B9MA 1E2XA 4U0VA 1IAWA 5FLXZ 1MJBA 1BM9A 1T2KA 4XSXF 4HQMA 5K5QA 2DW4A 2H6BA 1ZYRF 3R6SA 4EJOA 5HS8A 2V1UA 5LHHA 4Y15A 5IT3A 3V8JA 2EB7A 4MQVA 3HIFA 4M9XA 4Y13A 4KMUX 2O8XA 4WXDA 1MDMA 3ABUA 3E6CC 1IN8A 2A68F 1KQ0A 3BJAA 1UHMA 4AVPA 4P96A 4WX9A 2XASA 1LDJA 5HDKA 4Q48A 1R23A 3GFLA 1FNNA 4ZYDA 4I0BA 3E6BA 4PGHA 2PQ8A 1ON1A 3L09A 5AIPA 2VXZA 5L3FA 3DXJF 2VONA 5JI6A 1BBYA 2PN6A 5LRSA 3P9KA 1W5SA 5D5XB 3PFIA 1TBXA 3IRQA 4LB5A 2HWVA 1OKRA 3QRFF 2P5KA 3T5XA 3DFGA 1Z9CA 3IWZA 3E97A 1VTNC 4EGZA 1T98A 4L5JA 1Z91A 2VODA 5BS6A 4AD9A 2BBYA 3KEQA 3WTVC 1PUEE 2EFPA 1YO5C 3CDHA 1TQPA 1IZ1A 2YU3A 4A6DA 1S7OA 4BAYA 3BOQA 3F6VA 5LEKA 4BHBA 4HF1A 1A04A 2IW5A 4UUVA 5LEJA 3DQVC 1RUNA 4Y17A 1P6RA 3DV8A 4R8HA 3EYYA 3ZMTA 2XUBA 4I01A 3FM5A 4YFXF 4EGYA 4YFNF 4CICA 4KYWA 5CVIA 2IJLA 3ABTA 2ISYA 1WI9A 3V8LA 1EH8A 2BGCA 4L18B 4KICA 2QVOA 5KK1A 4EJUA 4KMFA 1P4AA 2W84A 4TV7A 2A6HF 1XGOA 2M8EA 4E70A 3KLOA 2JRTA 5D4SA 3WGGA 1IF1A 5HLHA 2Q8KA 1ZRCA 3WGIA 3KP4A 4L5IA 4M9SA 5BPIA 2PJPA 4P5OA 5D6EA 1BIAA 4ENJA 2A61A 1F4KA 1ZN2A 3M7GA 5LGUA 3HOSA 1O3SA 6PAXA 3RYPA 2YPRA 4M74A 1G3WA 2MH9A 5CYVA 2UWMA 4JQFA 1IXSB 1B59A 2ZBKA 2HDCA 2FQ3A 3P9IA 1HQCA 5EEHA 2FNAA 2B0LA 1K79A 2NS0A 2X4HA 4R1HA 3F22A 3I4PA 2ZKZA 3MZHA 3F8FA 5TJJA 3H3UA 5F1RA 4G6DA 1LDKB 3KFWX 1XSDA 1BC8C 5K5OA 5DUIA 2P6SA 1LDDA 5IT9Z 2FBIA 1R36A 3MQ0A 2R3SA 1FLIA 1FZPB 3RIRA 3L00A 1ZAOA 2HZTA 1ZHFA 2XROA 3TO7A 1W7PA 3HRSA 5HDNA 2DBBA 2M87A 2KJCA 2CYYA 1IXRC 2Z5UA 4PDKA 1PP7U 2DQRA 3CO7C 1IXCA 1XDSA 2O3FA 3ZN0A 4GCVA 2IPQX 3W6KB 4O5VA 1UCRA 3C3WA 1J5YA 4LD5A 4DQ2A 1C0WA 4RB2C 3KP7A 4IXAA 1SMYF 1TQMA 2EFQA 1ZARA 2A07F 1D5VA 4BQAA 4MEXF 3WE3A 3R61A 3RJPA 3BROA 1XSVA 1W7PD 1TTYA 4K2EA 3RKYA 3JSOA 4EJTA 2EFWA 4LK0F 2XKPA 5BPDA 3TOAA 2YX7A 4OU0A 5A2QZ 4BHCA 5KVRA 1R7JA 4L9NA 2PMUA 4CO8A 2HTSA 2KIUA 2ZJ2A 1UHWA 4JK1X 2DT5A 3FMQA 4RB0A 3HRUA 5D8KB 3F8NA 3QU6A 3D0SA 1BJAA 4G94A 3DP7A 3J81K 2L01A 1USTA 2VN2A 2EV0A 2Z33A 2JSCA 4CYDA 1KU2A 3E6MA 3ZMDA 3GXOA 2TDXA 4A2UA 4G7OF 2QQAA 3NRVA 4A0XA 1ZG3A 3ZN1A 3LWFA 3TDZC 3KP3A 1I1SA 4HDUA 2OQRA 4PZJA 2O0YA 2RV8A 4KIGA 5JHUA 4HX7A 1GXQA 3EDPA 4N0BA 1LQ1A 1TNSA 3EQLF 1YW8A 2LSOA 5HLIA 3JAMZ 4R79A 3N4MA 5HLGA 3GZ5A 1YQAA 5CVVA 2CWEA 2ZFWA 4P9FA 2YX4A 4EMSA 1E17A 1WRJA 2VBXA 2Q0OA 1RIOH 1HW5A 5DD8A 1SFEA 2OBPA 4RGRA 1T0FA 1XGSA 1H9TA 3LA3A 3R0AA 5ILSA 1R22A 5ED4A 4HBLA 2FBHA 2WTEA 5L3GA 2H27A 5E20A 2P8TA 5DV5A 2GA2A 2PFBA 2IT0A 1G3YA 2HYFA 3IKVA 5D5UB 3KZZA 4JBAA 4IRGA 2V1XA 3T8RA 2GXGA 3KLNA 4GXOA 4U7DA 4EQQA 2EA4A 4LLGF 3M8FA 2IRFG 1KGSA 5LBQA 1FBUA 3IRRA 2ZMEB 1USSA 2HEOA 3L9FA 5ILUA 1D8KA 3SHFA 2XV4S 3M9AA 3U2RA 4MTDA 5FD5A 3J80K 4CXFA 1R1VA 1F1ZA 4EM0B 3C1DA 4LK1F 1R5GA 3HSRA 4WXCA 5FFZA 3CO6C 1G3SA 1K7AA 3MAJA 2GQQA 3C18A 1ZREA 2H6CA 3R4KA 4MQ9F 1ZGJA 2VBYA 4ZH4F 2COMA 2FSWA 4ZYGA 4YG2F 4XBFA 2VC0A 1Z6TA 1JHHA 1KU7A 4OINF 1I6XA 3E5UA 1ZRFA 2P7VB 2V6CA 3SZTA 4A5MA 3RKXA 2L02A 4HF2A 2FBKA 5BOXA 1U5TB 5D5WB 2RGVA 4PCQA 4RS8A 2V9VA 2HGCA 4KA4A 1R5HA 4HZFA 2ZNYA 2EFNA 4GGGA 2ZO4A 3ECOA 2BYVE 3QAHA 2VE9A 4GYGA 3RDIA 3QOPA 3ULQB 4Z2YA 1HKTA 3F3XA 2RVCA 3VOEA 4A12A 2HOEA 2JPBA 4YFKF 1Z7UA 1TLHB 3EUHA 1REPC 4U0YA 1K78B 3CJNA 4OOIA 4G7ZF 3ZMUA 4QLCU 1RZ4A 3L2CA 2C6YA 1ZG1A 3R60A 5ICEA 2RKHA 1L0OC 2E7WA 1B1BA 1O3QA 1HXDA 1KU3A 2Z99A 4LGWA 3MCZA 4UV9A 2MD5A 3FXQA 1FPQA 4ESFA 2ACJA 4LB6B 1H0MA 2DAOA 5ICFA 2LF7A 3S2WA 2E1NA 3GFIA 1Q1HA 5LHIA 3Q5FA 4IHSA 5TRDA 2OAZA 4XLNF 3ZMSA 1S7AA 2ELHA 2DK5A 2W25A 1SAXA 1QZZA 5D5VB 4OMZA 2KRFA 2ISZA 2HKOA 3HSEA 1P4XA 4WCGA 1ZGAA 4AIKA 1GVJA 1O3TA 2MH2A 5E8GA 3HUGA 4M6XA 1FSEA 1B9NA 2G7HA 3ZQ7A 1Z1DA 1Y0UA 5FB2A 4GO1A 4UNOA 2G7UA 1MJ9A 1MKMA 4BXUA 1XGMA 4M6YA 2HTJA 1RNLA 1KQ8A 3LQRA 3O6BB 3QPHA 4FT8A 3I0TA 1YG2A 3NQOA 3SFZA 1YTYA 2OQGA 4LMYA 4H0EA 3V7CA 3GZ6A 2UXNA 2ZCWA 2FA5A 1ON2A 4HX8A 5HOOA 2P6TA 3BDDA 4L9VA 2FF4A 3IKTA 5J8FA 2QZ8A 3VEPA 3CUQA 2H94A 1HBXG 3DPTA 4RGXA 2PLYA 4A6EA 4HF0A 5E1WA 1SD4A 1R00A 1T39A 1SMTA 2DFIA 5AONA 2GZWA 2NAZA 2XAGA 1O3RA 2YSRA 4I0AA 4YIFA 2M5WA 5L3EA 2W24A 1KU9A 1L3LA 2XHKA 3N97A 4OIOF 1ZLKA 4A0ZA 1J59A 1XCVA 1K6OA 1G6NA 2M45A 2K86A 1DDNA 1P2FA 3CUQB 3HTUA 3I64A 1XGNA 2FE3A 2DTRA 5DUKA 4ASNA 2OZ6A 2A69F 2GA1A 1FP1D 1T38A 1FBQA 2EV5A 4FX4A 1HKSA 5DCFA 4UVBA 3LAJA 4U0WA 1GHCA 1FOKA 3IWFA 3WTWC 3K1NA 3GFMA 2DU9A 1R1UA 4L9JA 3F8CA 2PEXA 3W6JB 1DUXC 5BQTA 2VC1A 1IN6A 4D0PA 3I71A 4KT5C 5FLXK 2XAFA 1JXSA 1B6AA 1CF7B 5L3BA 5J8CA 5DEQA 3F21A 2P5VA 5L3CA 4HAMA 1B4AA 3BY6A 4WXHA 1I5ZA 1KA8A 3WTUC 3T8TA 1J2XA 3M8EA 3QU3A 4KIBA 4MTEA 3VODA 4UXNA 2P7CB 3HHHA 3E5XA 1DP7P 3WTXC 5ICCA 4N9IA 3AAFA 4RAZA 3KEOA 4I02A 1FT9A 2ESNA 2HR3A 4FHTA 1R1TA 2QUFA 3WG9A 3ISPA 3RYRA 4HW0A 5DCMA 4ON0A 2A5YB 2KJBA 3ELKA 1YFHA 2XKOA 4KN7X 4KUMA 1I1GA 4ZYEA 3H92A 1J75A 2O61A 3K2ZA 2MBFA 1J9IA 3BP8A 3QPTA 4IJAA 1U5TC 3GUDA 2K4BA 2XIGA 1T6SA 1UFMA 3LSTA 5JVTA 2F2EA 1FWZA 1O57A 1XMKA 3F6OA 1DPUA 4I7HA 1V3FA 5HVQC 2P4WA 2XAQA 3V8KA 1OYWA 3RI4A 1Z6RA 1FY7A 1TQIA 2CFXA 1JHFA 3CLOA 3P7NA 5DCMB 2VBZA 3GWZA 4UVCA 3WTTC 3GLXA 1FBSA 4KNYA 2OA4A 5FFXA 4KFCA 4ZZLA 1YIOA 2CGPA 3TO9A 4BHPA 1CGPA 1YS7A 2DLLA 1QGPA 3HRMA 3DF8A 3KP5A 3IL2A 4HDVA 3T1BA 4ZZDA 4M9ZA 3Q9SA 2L4MA 3K1MA 4IRIA 1S3JA 5D8LB 3E5QA 2XAJA 3M1EA 2D1VA 3HOTA 2NYXA 2RQPA 2FMLA 2ZMEA 4RB1A 5E18F 3GEZA 3TQNA 4KDPA 3C7JA 2VOOA 3B73A 3R0JA 1ZLJA 1IRGA 1QBJA 3JTHA 1OYIA 1DPRA
chains in the Genus database with same CATH superfamily
3D5LA 1IW7F 1LFBA 2JUGA 2R0QC 2QBYB 2EV6A 2X0LA 2A6EF 3TW6A 4JYKA 3FHZA 2HS5A 4Y3OA 4G7HF 3RPUA 3ERED 3CUOA 4JX5A 1MMDA 3L1PA 5J4YA 2CO5A 2Y48A 1J0RA 3GTMJ 3KP6A 3HOZJ 1ETKA 3HG9A 3ZQIA 2FD5A 1SD6A 3LA2A 3K1PA 4KJZA 2H8WA 1IRFA 3G3ZA 3K9TA 3W3CA 4D9JA 2BY3A 3JR9A 1JUPA 4BE1A 1BI3A 4KN4X 1MJAA 5IP7J 2M30A 3BR1A 4WK8F 3BC8A 3FIWA 2LKPA 3ZQQA 3LAPA 1FX7A 1MD0A 5CVUA 5CVJA 1EKEA 2NVUB 2LY1A 5B5EC 2WAQA 2GWRA 1Z05A 2IGKA 2F4MB 2Y0SA 4EV0A 1KYZA 3VB2A 2MC3A 2PBIA 2R7SA 1YYVA 3OS0A 2R5YA 2BOLA 2XVCA 3I59B 1D3YA 1V5GA 3L7WA 4NQWA 2XF7A 2RC4A 1IUYA 2EZLA 2MGQA 2DPUA 4A5NA 4OMYA 3SZPA 5EJCA 2IS2A 5FLXR 1U5TA 3WU0A 1Z3XA 3OIOA 4A3KJ 2KKOA 4CDGA 2DT7B 2HQRA 2ZNZA 4LFUA 4BYYA 2OZUA 1FC3A 1Y56A 5EEAA 4HV6A 5JFRA 5J1UA 1LNWA 1YW9A 2L7ZA 3RPUD 5IT9K 1S6LA 2Q2EA 2B9SA 3BPVA 2BE5F 3JCUC 2DA2A 3MVPA 1ETQA 1RKTA 5HS9A 3TBIA 2EK5A 5H6QA 4Q5SF 5E3NA 3RKWA 2JRMA 1F43A 4CSWA 5H2FC 5LGTA 4A3IJ 2IS1A 4I76A 3HOYJ 3D5RC 4NDLA 2GXAA 2F5FA 4XM3A 3DU6A 4NHJA 4CH7A 2H09A 4AYBA 2HFHA 2DQLA 4EJWA 2LOOA 3BJ6A 1S72I 3IP4B 4ZDPA 4L9TA 4XORA 3BR2A 3H36A 3I5UA 3PUBA 2XPVA 1WJCA 2YR2A 3A0HC 3GX4X 1K78A 4BGDA 1KZHA 2BW3B 2F5DA 3F8MA 4OAZA 1IC8A 3Q0WA 1JT6A 3TDUC 4FX0A 5CPRB 1BI2A 2JJ7A 2XF6A 3Q3SA 3TGNA 4IF4A 4OIPF 1OMIA 1YS6A 4FE4A 3S2DJ 1G3TA 1U3EM 1XD7A 4DIQA 1D0YA 2V79A 2MZ4A 1MNMC 5E1ZB 1FYKA 3GO5A 4O6JA 2XGEA 2L9VA 4GDFA 2D2WA 2UXXA 2JWTA 3OL4A 3OR1C 3I56I 3LNQA 3LQQA 3DBRB 1OCPA 3ASOH 3GW2A 5CQGA 1Z0XA 4YIIA 2LDUA 3FXLA 1NG6A 4B8XA 2LBFA 1FSHA 2AQEA 1X3ZB 3KX2A 2E7XA 3B02A 3LMMA 2FJ1A 1UAAA 3CUQC 2KFDA 2F4IA 3EUKL 2F5EA 3FMSA 5A2QK 1UB9A 3ZPLA 3ZGKA 4ZYHA 3KPHA 1O7LA 5FLVA 3W2VA 2NRAC 2XAHA 1WSUA 2K85A 2MLGA 3MD2A 3REOA 4XONA 1MZBA 3CMMA 4XRMA 1FMVA 2VT3A 3FXOA 2LF8A 1IRXA 2Y0MA 2ECCA 2CH0A 3A4CA 3G73A 1T56A 4ENNA 1SFUA 3JSPA 4C2TA 2IA2A 2R7WA 4M71A 4QTRA 2HQNA 2FXAA 2A6TA 2Y75A 2W85A 1YITI 3Q0VA 2GIZA 3KP2A 2FU4A 3FMRA 2DPDA 1LB2A 4KT6A 3TMOA 3CLQA 3SXYA 3MFKA 5M5XJ 1DQUA 1WJFA 1Y6IA 4S04A 2HOTA 4BH9A 3OOPA 3JREA 1DU6A 1WJDA 5DYMA 4RGSA 2LMDA 3EYIA 2E2IJ 4F7ZA 2PMHA 2ETHA 2J5OA 2QQBA 2O9LA 2X1DA 1JKOC 4ESJA 3K4MA 3JRBA 1IN5A 3FF5A 1ULYA 4BBSJ 3DPLC 4RB3C 3F9KA 4MGRA 1OCOH 1P4WA 1X1PA 2ID6A 2DA7A 2EWNA 4B3AA 3Q9VA 5F6FA 1YI2I 2MG4A 2M35A 3ABKH 4Q47A 4WWCA 4LLLA 4CGZA 1XMXA 2V1DA 1SFXA 1U78A 3CF2A 1P7IA 5J47A 5K7HA 4G9YA 5CVRA 1HDPA 4QPOA 1MBHA 4EVIA 2WAEA 2XRNA 3AG2H 2VPRA 4PK4A 1VQ4I 3GBGA 2CV2A 1S9HA 4WF2A 3GYHX 3OS2A 1LEBA 3TOBA 5IP6A 1BIBA 3FWEA 1MDMB 1ETOA 1AOYA 2OV7A 1NK2P 3HOWJ 1EA3A 2A3SA 3GVAA 4N4OB 1FOYA 1TW2A 5EZHA 3LA7A 1BR4A 1DU0A 3SYTA 2L7MP 3J81Z 1QVTA 1XN7A 4D5FA 1NG7A 2R7ZJ 3JAMK 2ADUA 5DD4A 1OPCA 5LRRA 2UZKA 4EM2A 2D5VA 2VB6A 2HXOA 2Z3YA 3O2PE 4G6TB 2CUEA 3HOXJ 2L7KA 3O8GA 1XMAA 3A01A 1PP8F 3WGHA 4NNJA 3LSJA 2DXIA 2D45A 2HKXA 3M4OJ 2L3DA 3FXUA 2IBDA 2IA1A 2GXBA 4A3CJ 1S8NA 4HNTA 4IOCF 1OLTA 3EPZA 3IH2A 3KIOA 4Y52J 1X3UA 2LRDA 2E5ZA 4I2OA 4B4CA 2JN6A 1BI1A 1K4TA 3K69A 4IVNA 4MO7A 2LR8A 4B09A 1F5TA 1R4MB 3E1SA 3KYDB 5FGMA 4M3FA 4F91B 1TT0A 2WC2A 2ZB9A 5J40A 3BR3A 3HSFA 3ZP5A 5K7FA 5FO5A 4F55A 2QLZA 4A3JJ 4HQEA 2QSGX 2AHQA 2DA4A 4GYIA 2DFFA 4ZYAA 4BKXA 1UZCA 3J80R 2Z2SB 4XN3A 2OD5A 4IHTA 5LHGA 1H9GA 3TO6A 3ZQCA 1J7KA 2ESHA 3GTGJ 2O6GE 3UNGC 4CYCB 5E3OA 3HHGA 2XPUA 1JKRC 2MLKA 4LOCA 2ZC2A 4P55A 5IT9R 4N9HA 3LSRA 1MSFC 1EF4A 4B47A 2EFOA 4OIQF 3FM3A 4DOZA 4EM1A 4Y33A 5HS7A 3AL0C 2HVRA 1XB4A 4B3XA 4DBRA 4ZDOA 5D6FA 4E6KG 5F0CA 3BTIA 3OV8A 5LLQA 2M0CA 1AWCA 4RGUA 5F04A 3L2VA 1IO2A 2ZXJA 2WB1N 2CG4A 1BOAA 2A5WA 4HOBA 4BDZA 1JE8A 5BNGA 1NHAA 2XGXA 2D1HA 4MEYF 3CCSI 1YJWI 2KMUA 2MA3A 4LG0A 3HRTA 2DK8A 1R9TJ 1OQYA 5K5RA 3CESA 1CF7A 1NK3P 3RPQA 4XRFA 3BZ6A 1PVEA 1X1BA 4V19K 4MHGA 4DNCA 4G6QA 2X98A 3DEUA 4UUTA 1LEAA 1SD7A 5M3MJ 4ENKA 2IA0A 4M3DA 4HNVA 2E2JJ 1W1WE 2K4JA 2CUJA 2DO7A 5FD6A 2FQ4A 4E7JA 4A3FJ 2XPWA 3WODF 1IGNA 4PJ0C 4PJJA 2E71A 4L0YB 3BCAA 1W0TA 2VIXA 1ZH5A 3ZMVA 1MGTA 2HOAA 3OY9A 1YHQI 5JR3A 1X58A 2MSYA 2L54A 4ENMA 3LSGA 2L7FP 1TWAJ 3A02A 2E1OA 4CCJA 1R49A 1ZTRA 2M3AA 3BZCA 1I27A 2QKLB 3S8PA 3UR3C 5HODA 3D1NI 3J80Z 2KDOA 1ETXA 2RNJA 1GLNA 1D8JA 2STWA 3CJQB 2FEZA 4BEHB 3GLLA 4HYEA 1IV8A 4LG0B 3SJMA 5GPCA 2CUZA 2O03A 2PX9A 3K4CA 1ETVA 4I98B 2QENA 2XRLA 4HPQA 1U8RA 2JPCA 5B1AH 2Y30A 2JQ7A 3VYUB 1A36A 3MN2A 3CJRB 2HU9A 3TKYA 4D5CA 3WE2A 4D7NA 2KIFA 2AXLA 2HYGD 2IP2A 1LE8B 1XC5A 3O3KA 2BXYA 2EA2A 2VXDA 4BACA 1O7FA 3W6VA 1Y8RB 9ANTA 1U0JA 2X48A 4CCNA 1FMWA 1SAUA 1R58A 1GV2A 3JW4A 4M73A 1EH7A 2CV0A 2JT1A 4S05A 2CMPA 2R4GA 3ROUA 1FP2A 2WWYA 2WV0A 2KRCA 3CCQI 1JT0A 1BC7C 1TWFJ 2K7LA 2FX0A 4P9UA 1QNTA 3V7RA 5EGOB 2K27A 2NNNA 2VKEA 2UV1A 3OYNA 2Z9OA 1D1BA 2ZXIA 3TP3A 3KCCA 2I10A 1IN7A 4IPAA 3OSFA 1G4DA 1A5JA 1R71A 3HM5A 2CW0F 4NB5A 2O5RA 2VOPA 4ETSA 2CQKA 4B48A 2FMYA 3CDLA 3PQKA 2KT0A 5F27A 3L2UA 3MWMA 2PI0A 2M0MA 2STTA 4BE0A 1FIAA 1ZKGA 1SANA 1U2WA 4Q4ZF 4M3BA 4CA0A 3DKWA 2VT2A 2VI6A 1PDNC 1TWGJ 4HG2A 1I39A 3QYEA 3A1YA 5ICGA 5HNFA 2XB0X 5BMZA 5LGNA 1GDTA 1YW7A 5CLSA 1QZYA 5EYRA 5H6RA 4IHXA 2WB1A 2DA3A 3GFJA 3E3VA 4CHUA 1MBJA 1ZGWA 2W57A 4ESBA 1W7PB 1LVAA 3I53A 3CCVI 2IVMA 3OS1A 4HSTA 3KYLA 1BOBA 3OIPA 3JTGA 4F3QA 3GF2A 1EV7A 1GV5A 2CFOA 2H1LA 2V26A 2EJRA 1MMSA 3U1DA 2BV6A 2PMZN 2VKDA 5E3MA 1YE9A 3JAMR 3JRHA 1ZG5A 1OR7C 1TW3A 2YUSA 2QWWA 4BS9A 1X1AA 5D4RA 3H35A 2IAIA 2L4AA 4RBOA 3HXLA 2F5CA 4FASD 5ERIA 1HA8A 4O3MA 2HDDA 1FOXA 1QO0D 1QVUA 2VE8A 3IC7A 5E79C 3FZVA 3F72A 3MMYB 1TNTA 2KIQA 3BG6A 4LIVA 4ZTFA 1KQ9A 2DI3A 1P92A 1W5TA 1RUOA 2BEOA 3VYSB 3F23A 2KIMA 5EG0B 4QWQA 5GADJ 4CZCA 3ABLH 3KE2A 5KHDA 2VBWA 3M07A 2KRHA 3L2QA 2OJED 1U9NA 3OYJA 1FTZA 3CTAA 5IY5H 3PO3J 2LNBA 4PGGA 3CCRI 1EH6A 3WTSC 3IAM2 4RM3A 5GAEJ 2VUMJ 2G9WA 2LY2A 2QBYA 2EILH 1DGRM 4IRHA 3E0JB 1FYLA 2E36A 4QPQA 2DTZA 4HX4A 3S3MA 2MC4A 4I09A 2ME6A 2AS5F 3C2HA 1WWXA 1OYYA 5L3DA 2XF5A 2GM4A 3DLAA 2MVTA 2V7FA 1XTAA 3IHUA 1QPMA 3ML6A 3EETA 3FXKA 3G1LA 2CW7A 2F5VA 4UHTA 3RZDJ 4BQQA 4XSZF 1I6HJ 4RM2A 1XS9A 2DCEA 3FX3A 1VQ6I 2DA5A 2LK2A 2QM3A 3QP5A 1IRZA 3J7AO 2ZXHA 1FYMA 3DCFA 3I59A 4HLXA 1XDUA 3IH3A 1WH5A 3S1QJ 3RZOJ 3AFHA 4A0YA 2V6EA 4E7ZA 1WQ2A 1A6IA 1YRNB 3GTLJ 3NEUA 5CJ9A 3HB9A 3PQJA 5HDGA 1XPXA 1TP4A 3AG4H 5EEGA 2H8RA 2E34A 3I54A 3DU5A 2DMQA 5J1YA 1KYWA 4BJTA 2R7FA 2LKSA 4EJVA 5F1JA 3BJOA 4G8XA 3BQZA 4U7BA 1E3PA 1X4OA 3V4GA 4UV8A 1TWCJ 3F8BA 3T0YA 3HTSB 2N8GA 1H89C 4E4HA 3BPXA 1XCBA 2W1OA 2R7OA 2PG4A 5FRNA 1TWHJ 3NWSA 1X3WB 1HSJA 4HEA2 2MYSA 3WU1B 2W7NA 4XLPF 3V7SA 1V4RA 3K70D 3FKIJ 1HSTA 3HYIA 3QPSA 4C2MJ 3PSFA 2FNPA 2M7BA 5F64A 3RQ4A 3VFZA 4AIDA 2X9DA 4C3IJ 5E1XA 2G0EA 3E7LA 1X2NA 2J5PA 2BW3A 2QYOA 2NNYA 3FXRA 3COAC 4A93J 3H3ZA 1HW1A 1SD5A 4U88A 2DYRH 3BWGA 1VQ9I 2CSOA 4LLNA 2EQRA 5AIQA 3WTYC 2OU2A 3ZMZA 2WADA 2K02A 2E1CA 3QP6A 1O4XA 1LFUP 1RI7A 3MZYA 3I4MJ 1K61A 4GFBA 1YLFA 1IN4A 4UVAA 2LTPA 1OR7A 2ZJPF 1POGA 3RTRA 2HOSA 1Y0NA 3I58A 2DFHA 2X1EA 1SFOJ 3WTZA 1U6GA 3PFYA 3KZYA 3CF5F 1ONVA 2X6YA 1STZA 1S29A 4AIJA 4D1QA 2FOKA 1UJ8A 4HV5A 2RDPA 2GIVA 3BLYA 4N4NB 3VYRB 1ZRDA 1HDDC 3P9CA 2X6OA 4AIHA 2QQ9A 1WKMA 5E17F 2M1BA 3WHCA 1VQOI 3HZJA 1KONA 3BTLA 2RN7A 5GTHC 3H9GA 3FK6A 2VASA 3LFKA 5H20A 3CCUI 1W5CC 4YRVA 3GCMA 4KIFA 5EDNA 4RAYA 2L5QA 2EPFA 3E6DA 3ZQFA 2KPMA 2X1CA 5E8IA 1BI0A 1N25A 2GAUA 3ECHA 3RQIA 2DA6A 4AWXB 3NWTA 1LFPA 3IH4A 4OIRF 4CCLA 1JGSA 5ILVA 1ODDA 1PUFB 1SC7A 1GXPA 2Z1DA 1GVDA 1QQIA 2WBMA 4LJZF 3TEDA 2VL8A 2R7DA 4HLYA 2FRHA 2LKXA 2JTVA 4B43A 5DDGA 2Y9ZA 5JLXA 1XSXA 3KETA 3S2HJ 4M72A 4BQOA 4L0ZB 2MW8A 3JRFA 2F6CA 2JA6J 2W00A 3SQNA 1BN5A 4U87A 2V1NA 1FOWA 5J6XA 1HW2A 2K40A 3K0LA 2JZYA 4MNUA 4BNCA 5K1YA 1LJ9A 1W4MA 2HQ5A 3U9GA 4CZZA 1ERDA 1HKQA 1HC8A 2K9LA 2R93J 3MEXA 2M4GA 3L2WA 4X0GA 4HA8A 2P5LC 2E1MB 3PNTA 4NC8A 4MFEA 4EEFG 1F9NA 1VQPI 1B9MA 2XSDC 4A3BJ 1ZR4A 4UY8I 1UMQA 1E2XA 3S14J 1RKWA 1T8IA 3QOEA 4U0VA 1IAWA 5FLXZ 1MJBA 1BM9A 4F93B 1T2KA 1J09A 4XSXF 4HQMA 5K5QA 2DW4A 2H6BA 1ZYRF 3R6SA 5KNLA 1UHSA 2V4JC 3P5JA 5C44J 4EJOA 1BR1A 2R7XA 5HS8A 2V1UA 3J7AW 5LHHA 4Y15A 3H9QA 3G4SI 5IT3A 5M5WJ 1X1CA 3V8JA 2EB7A 1IDYA 4MQVA 3FXMA 3GZNB 4M3GA 3HIFA 4M9XA 4JX4A 4Y13A 4KMUX 2O8XA 4WXDA 2V9PA 1BL0A 1MDMA 3ABUA 3E6CC 1IN8A 4RAFA 2A68F 1KQ0A 3BJAA 1UHMA 4AVPA 4P96A 3CMYA 2OTJI 4WX9A 2FUG2 2XASA 1LDJA 5HDKA 2ZJQF 4IZZA 4CCMA 3S1RJ 3DEEA 1D1AA 4Q48A 1R23A 1DGWY 2LD5A 3GFLA 1FNNA 4ZYDA 4YIRX 3MKYB 1R5ID 2COBA 1FTTA 2BZTA 4I0BA 3E6BA 4PGHA 2PQ8A 1ON1A 3L09A 5AIPA 2VXZA 5FKOA 1S7EA 5L3FA 3DXJF 4RLFA 2VONA 4BUPA 5JI6A 1BBYA 2PN6A 5LRSA 3P9KA 1W5SA 5D5XB 3PFIA 1RR7A 1TBXA 5GPAA 5B3SH 3IAS2 3IRQA 4BY1J 2IS4A 2E5NA 2HXIA 4LB5A 2HWVA 1VQ8I 3JRCA 1OKRA 3QRFF 1RRJA 2P5KA 3T5XA 3DFGA 3OIQA 2DT6A 1Z9CA 4IHWA 3PM1A 3IWZA 1HCRA 3E97A 2CQQA 1VTNC 3K4BA 3BTJA 4EGZA 2HNHA 1T98A 2EZHA 1Z91A 4L5JA 2VODA 5BS6A 4AD9A 2BBYA 2HVSA 2XGDA 3KEQA 3WTVC 1PUEE 2EFPA 3U21A 5DTDA 3KZIC 1YO5C 3CDHA 4CYCA 2I8DA 3H5AA 1YX5A 2V9KA 2VQGA 1QZEA 2DA1A 1TQPA 1IZ1A 3FKJA 3ZRGA 3OYHA 2YU3A 1Z67A 3OR2C 4A6DA 1VQNI 1S7OA 3PSIA 1JTYA 4BAYA 4F52A 3BOQA 3F6VA 3S32A 5LEKA 4BHBA 3NAUA 1AHDP 4ZC3A 4HF1A 1X1DA 1A04A 2IW5A 3FBIB 1I50J 4UUVA 5LEJA 2KQRA 2ZXWH 3DQVC 4DZJA 2VJIA 1RUNA 4Y17A 1P6RA 2LREA 3DV8A 4R8HA 3EYYA 3ZMTA 2XUBA 4I01A 5IPAA 3OMYA 3FM5A 5CQEA 1GUUA 4YFXF 2OPTA 4YFNF 4EGYA 4CICA 4X1EA 5CVIA 2IJLA 4KYWA 3ABTA 1A31A 2ISYA 5DS9A 1WI9A 2B63J 3V8LA 2DJIA 3HKZN 1EH8A 2BGCA 1JGGA 4L18B 1OISA 4KICA 4OAYA 3HOVJ 4PSWA 1MBKA 4II2A 1A35A 3VDXA 2QVOA 5KK1A 4EJUA 4KMFA 2HVQA 2IGMA 2GLOA 1P4AA 3DKXA 1TC3C 2W84A 4TV7A 2A6HF 4NC7A 1XGOA 4XOTA 2M8EA 4E70A 1MMNA 2E19A 3KLOA 2JRTA 5D4SA 3A52A 2R7RA 3WGGA 1IF1A 4BQNA 1JTXA 5HLHA 4C2UA 1Y1VJ 2DMNA 2Q8KA 1ZRCA 3M8JA 2DJNA 2DOEA 3WGIA 3LL7A 2DFEA 3KP4A 4L5IA 4BY7J 3U1KA 4A69C 4M9SA 5BPIA 2PJPA 4BEHA 4P5OA 4BJ6C 5D6EA 1BIAA 3I55I 4ENJA 2A61A 1F4KA 1ZN2A 3M7GA 5LGUA 3HOSA 1O3SA 6PAXA 3RYPA 1N77A 3GTJJ 2YPRA 4XLCA 1S5LC 3VSKA 3X2QH 4MLOA 4M74A 1G3WA 1LE8A 2MH9A 3BR5A 4XOPA 5CKTA 3OYLA 3D5SC 5CYVA 2UWMA 4JQFA 1IXSB 2ZSHB 1B59A 1HOMA 4RDUA 2ZBKA 2HDCA 4E7SA 2DOFA 4AVZA 2FQ3A 4E7HA 2P0TA 2VKHA 4XK4A 2EINH 3P9IA 1BR2A 1HQCA 1MBGA 3JRAA 2NVYJ 2EBIA 3WU2C 5EEHA 4FETA 5M3FJ 1XG1A 4A3LJ 2FNAA 3KYCB 5EGOA 1G8XA 4IKFA 3I9V2 4A3DJ 2TCTA 2B0LA 1K79A 1JKPC 2NS0A 2X4HA 4R1HA 3F22A 3I4PA 2DDAA 2ZKZA 3MZHA 3F8FA 5TJJA 3H3UA 1RR8C 5A2QR 5F1RA 2EH3A 4G6DA 4HSRA 4CCOA 1LDKB 3KFWX 5FRMA 3ABMH 4F92B 1XSDA 1BC8C 5K5OA 5DUIA 2P6SA 1LDDA 2NS8A 3PL8A 5IT9Z 2FBIA 3PNVA 3CQZJ 1R36A 1UELB 4AC0A 3MQ0A 1WVRA 1E0EA 2R3SA 1FLIA 1FZPB 2UUZA 3H5RA 4NC6A 3RIRA 3L00A 1VNDA 2FOWA 1WHUA 3HBLA 3K70C 2LFBA 4ABZA 3BR0A 1ZAOA 4ANJA 3I4NJ 2HZTA 2VQHA 1ZHFA 2GBYA 3LSKA 2XROA 4PFPA 3TO7A 1W7PA 3HRSA 5HDNA 2DBBA 4PUSA 2M87A 4YEJA 4AU7A 2KJCA 1Z3YA 4XIDA 1ITYA 2CYYA 3CCJI 1IXRC 1WCMJ 2Z5UA 4PDKA 3G2BA 2DMTA 1PP7U 2DQRA 3CO7C 1IXCA 1XDSA 2AXTC 2QKMB 4KITB 2O3FA 3ZN0A 4GCVA 3HKZA 2LH9A 2IPQX 2CRGA 3BG7A 4JP0A 3LSPA 3S3OA 3W6KB 4O5VA 1UCRA 3C3WA 3N05A 3DBHB 1J5YA 1T0FC 3CZ6A 2QQ8A 4LD5A 4DQ2A 3CCEI 1C0WA 4RB2C 3AG3H 2ELKA 5DM6F 3KP7A 4IXAA 3ZOBA 1SMYF 1TQMA 2EFQA 1JUSA 1ZARA 1LUJB 2A07F 5EG0A 4XKBA 1D5VA 1JUMA 4BQAA 4MEXF 2M34A 1WJAA 3WE3A 3R61A 2QF7A 1LVKA 3RJPA 3BROA 1XSVA 2BY0A 1W7PD 1TTYA 2X6XA 4K2EA 3RKYA 3JSOA 4EJTA 2DDBA 3SZGA 2M7AA 2EFWA 4LK0F 2XKPA 4HRIA 5BPDA 3H0GJ 3TOAA 2OCCH 2YX7A 4OU0A 5A2QZ 4BHCA 2JA5J 5KVRA 2X6WA 1R7JA 1MH4A 4L9NA 2JSPA 2PMUA 4LG3A 2OTLI 3PNYA 2ZSIB 4CO8A 2A05A 4IO9F 1FIPA 2MABA 2W82A 1RETA 4BXFA 2HTSA 2VKVA 1ZQ3P 3W2AA 2KIUA 3K4KA 4DJAA 4AM3A 1ETYA 2ZJ2A 3CP2A 1UHWA 2E1MC 2QEXI 4JK1X 2NOJB 3OYDA 2DT5A 3FMQA 3SEQA 4RB0A 4BU2A 2H1KA 3HRUA 3HEFA 3DBLB 5D8KB 3F8NA 3QU6A 3FK7A 4LITA 2JVGA 3CC2I 2F48A 1YRNA 3D0SA 1BJAA 4G94A 3CCLI 1Y8QB 3DP7A 3J81K 4PJNA 4W97A 2PJRB 2L01A 1OCZH 1USTA 5F08A 1V55H 4ITVA 2VQLA 3WG7H 2VN2A 3JRDA 3ZCOA 4XLAA 3DTEA 2EV0A 2Z33A 3VWBA 1N75A 2JSCA 3HDDA 2P81A 5JLWA 3K4JA 4CYDA 5LFAA 1KU2A 3BR6A 1Z77A 3RCOA 3E6MA 3ZMDA 3B6AA 4C9YA 2W48A 4PSXA 4DYCA 4XKCA 3RSNA 3GXOA 2TDXA 1JJ8C 2JMWA 4A2UA 2K9SA 2XC7A 4G7OF 1F36A 2QQAA 3DWLE 3NRVA 4A0XA 1ZG3A 3ZN1A 3LWFA 3LSMA 3TDZC 3KP3A 1B8IB 1WH7A 1I1SA 2E60A 4HDUA 2OQRA 4PZJA 2E2HJ 2O0YA 2RV8A 4KIGA 5JHUA 2X51A 4HX7A 2KZVA 4IHYA 1GXQA 1MW7A 1XX5A 2M4KA 3EDPA 2OF7A 2OUMA 4N0BA 5KCMA 1LQ1A 1TNSA 4XKWA 3V42A 3EQLF 4KISA 2CW8A 1YW8A 2LSOA 4ZTJA 5HLIA 3JAMZ 3H1CA 4R79A 3BG5A 5HLGA 3N4MA 3GZ5A 1YQAA 3OYEA 5CVVA 2CWEA 2ZFWA 4P9FA 2QCOA 2HPMA 2YX4A 4EMSA 1E17A 1WRJA 3OL3A 3ZXSA 2VBXA 2Q0OA 2HPIA 1RIOH 1HW5A 2CV1A 4H4KC 3ESWB 5DD8A 2KZGA 4CUGA 3LSHA 1U9OA 3C2BA 1SFEA 2OBPA 4IQ4A 4JOMA 3FISA 4RGRA 1T0FA 1XGSA 1H9TA 1MNDA 3LA3A 3JRGA 3R0AA 2HQAA 1SFKA 5FJ8J 3TP0A 4IOAF 1BA5A 4Y4RA 5ILSA 1V5EA 1R22A 2W4SA 4EATA 5ED4A 4HBLA 1YIJI 1K4SA 1Y1WJ 2FBHA 2WTEA 5L3GA 4E7LA 2H27A 2KL4A 1Q1VA 3EUHC 5E20A 2P8TA 5DV5A 2GA2A 2PFBA 2IT0A 2R92J 2NVXJ 5DM7F 1SVMA 1G3YA 4DGWB 2HYFA 3OYBA 3ZQLA 3IKVA 5D5UB 5IP9J 1P7JA 3KZZA 4JBAA 1UG2A 3FBNB 3SDBA 4IRGA 3BQYA 3L2RA 2V1XA 1H88C 4X6AJ 1PUFA 1RQ6A 3T8RA 1YX3A 2GXGA 3HPGA 3KLNA 1V54H 4GXOA 4U7DA 4RMNA 2PMZA 4EQQA 3SEZA 4UUSB 2EA4A 1JJ6C 5K7ZA 4LLGF 3M8FA 2DMPA 1KGSA 2IRFG 2L0KA 1FBUA 5LBQA 3IRRA 1WZ2A 2ZMEB 4A3MJ 1USSA 2LLKA 2HEOA 4IX7A 5FLMJ 3L9FA 5ILUA 1D8KA 3SHFA 2XV4S 3M9AA 3U2RA 4MTDA 1MH3A 2ZFUA 5FD5A 5FKLA 3J80K 1IV6A 2K3FA 2ELJA 1B72B 3K10A 4CXFA 1R1VA 3OYIA 3IV5A 1F1ZA 5F0HA 4EM0B 2BVMA 2OC6A 4XICA 5IYDJ 3C1DA 4UB8C 2AO9A 3DKYA 3BTCA 4LK1F 1W0UA 1R5GA 3BCBA 3HSRA 4WXCA 1VQ7I 2LG4A 5FFZA 3CO6C 1OCRH 1G3SA 1W36D 1K7AA 1U8BA 5J1RA 3CP8A 2K9QA 3MAJA 3C18A 2GQQA 3OSGA 4PFOA 1ZREA 2H6CA 2DODA 1AKHA 4ZJZA 3M3YJ 4IHVA 3FXJA 3HOUJ 1AU7A 3VYTB 5FKNA 3R4KA 4MQ9F 1HLVA 1ZGJA 2VBYA 4ZH4F 3AKZA 1BJZA 1K6YA 2COMA 2FSWA 1AA7A 2EIMH 2KISA 4ZYGA 4YG2F 1WJ5A 4XBFA 3AG1H 4I6ZA 2K9NA 3H9JA 2VC0A 3QYBA 2CS3A 1Z6TA 2Y31A 1JHHA 1D0XA 1KU7A 4OINF 2R5YB 2JA8J 1JKQC 4FE7A 4HNUA 1I6XA 3E5UA 1ZRFA 2P7VB 4NQWB 2V6CA 1OCCH 2KDZA 3SZTA 5TISC 4A5MA 3RKXA 1P9QC 2L02A 2R7QA 4HF2A 3OOUA 2FBKA 5BOXA 1U5TB 1ZELA 5D5WB 2EZIA 2R7UA 2RGVA 4PCQA 1Z21A 4RS8A 1BW5A 2V9VA 4NUBA 2HGCA 4KA4A 5HLTA 1R5HA 5GAGJ 5GAHJ 4HZFA 1Y39A 2ZNYA 2EFNA 4GGGA 2ZO4A 1WGXA 2BHYA 2B7EA 2R7TA 2X85A 2CQNA 2Q2EB 1D1CA 3ECOA 2BYVE 3QAHA 2VE9A 1APLC 2JA7J 4GYGA 3RDIA 4XLHA 3QOPA 3ULQB 1AKHB 1WI3A 1OCTC 3EUAA 3S15J 4Z2YA 1DP3A 1VI0A 1HKTA 4MIMA 4E7IA 1T33A 3F3XA 1VQLI 4FCYA 2RVCA 2IS6A 5E3LA 1ZK8A 3VOEA 1EJ9A 3J81R 4A12A 2HOEA 2JPBA 4YFKF 1Z7UA 3TL4X 1TLHB 4YELA 2VJJA 3EUHA 1REPC 4U0YA 1K78B 3CJNA 2TRTA 1VQ5I 2JK3A 3CCYA 1ORKA 3QODA 3DTIA 2ME0A 4OOIA 4G7ZF 3ZMUA 2EIKH 3OYAA 4QLCU 1RZ4A 3L2CA 2C6YA 2ID3A 3BG9A 2P0WA 4G12A 1ZG1A 2BHZA 3LSIA 4M3EA 3R60A 4AUXA 2RKHA 5ICEA 3OYCA 2GOXB 3HPHA 1L0OC 1MMAA 2DYSH 1B1BA 2E7WA 1FEXA 3OYGA 2HI3A 3G1MA 1O3QA 1HXDA 4BJ5C 1VZ0A 1KU3A 3HL2A 2VJ5A 3SDGA 4C3JJ 4XMYA 4FTHA 2BY2A 2Z99A 4LGWA 3MCZA 3PJRA 4UV9A 4MFDA 2MD5A 3FXQA 1FPQA 2LBFB 3WHBA 4ESFA 1WFXA 4XKVA 2ACJA 4LB6B 4Y7NJ 1H0MA 2MD0A 1VF9A 2DAOA 1OFCX 3S3NA 5ICFA 2WA0A 2LF7A 3S2WA 2VPLA 2E1NA 1SEUA 3GFIA 1A6QA 1CQTA 1Q1HA 5LHIA 5B66C 2VLAA 3Q5FA 2DOAA 4IHSA 2OAZA 5TRDA 4XLNF 1ENHA 3ZMSA 1S7AA 1QHHD 2IXSA 2ELHA 2DK5A 4GRIA 2W25A 2O8KA 3OYFA 1SAXA 1QZZA 1X19A 5D5VB 4OMZA 3OYMA 3K7AJ 2KRFA 2JA2A 3K4LA 3M1CA 1ZR2A 5JHFA 2ISZA 2HKOA 1QHGA 3HSEA 1RC9A 1T95A 1P4XA 2VJ4A 2ECBA 4WCGA 1ZGAA 4AIKA 4DYRA 1GVJA 1O3TA 2MH2A 5E8GA 3HUGA 2XGCA 1QPIA 2XDVA 1FSEA 2Z16A 1B9NA 4M6XA 2G7HA 3ZR8X 5C4XJ 3DLLF 3ZQ7A 3QQAA 1Z1DA 5KAIC 1YJNI 2Y9YA 2OCEA 1Y0UA 3ASNH 5FB2A 3DTKA 4GO1A 4UNOA 2G7UA 4FISA 3LOCA 3S17J 1MJ9A 3HJEA 1MKMA 4BXUA 2MFZA 1XGMA 4M6YA 2HTJA 1RNLA 1KQ8A 3LQRA 3VSLA 5IYCJ 3O6BB 3QPHA 5B1BH 2K9MA 4FT8A 4J01A 2ZJRF 3I0TA 1YG2A 1MNEA 3NQOA 3SFZA 3Q0UA 3H3VK 1YTYA 2OQGA 1R6RA 3S1NJ 2KP6A 2NOGA 4LMYA 5IOZA 4XNFA 4H0EA 2F4OB 3V7CA 2BXZA 3GZ6A 2UXNA 4DYQA 2ZCWA 2FA5A 3K6GA 1ON2A 4RAGA 4HX8A 5JVGF 2CUFA 1TL8A 5HOOA 2P6TA 3BDDA 3BG3A 2LP0A 3BT9A 3RKQA 1QU3A 4L9VA 2DMUA 1PYVA 5EZGA 2FF4A 3HUGB 3IKTA 5FKKA 1TZLA 5J8FA 5GTIC 2QZ8A 4XLEA 2LYCA 2RQQA 2YU9J 3VEPA 1HF0A 3CUQA 2QSFX 2H94A 1HBXG 3DPTA 2BVLA 3HC7A 4RGXA 2PLYA 4A6EA 3HGYA 4HF0A 1N78A 1ETWA 1RPWA 5E1WA 4BDYA 1SD4A 1VQMI 1R00A 4B44A 1T39A 2LVSA 1SMTA 2DFIA 3FHNA 1MIJA 3A01B 4LIUA 3C2GA 5AONA 2GZWA 2CJJA 2NAZA 2XAGA 1YOVB 1G2HA 2JUCA 4XL9A 4B1RA 4PJMA 4DBQA 2NXNB 3MKWB 4J19A 3ZQHA 2BY1A 3PUFA 1X4PA 2M9HA 1E3OC 1PJRA 1O3RA 2YSRA 2NVTJ 4I0AA 4YIFA 3NARA 2M5WA 3GTOJ 3DEWA 5L3EA 3CCMI 2W24A 1KU9A 1GT0C 1L3LA 1SVOA 2IGNA 2XHKA 3I3LA 2HZDA 2IEKA 1MMGA 3N97A 3A03A 1G59A 4OIOF 1ZLKA 2AQFA 3OWTA 2WY8Q 3FDYA 3PO2J 1TT5B 4RA2A 3PIOF 4A0ZA 2L9SA 1J59A 1XCVA 1K6OA 1G6NA 2M45A 2R5ZA 2K86A 1DDNA 3GTQJ 1P2FA 3CUQB 3HTUA 4A3EJ 2NVQJ 1WJBA 4DW6A 4J00A 3I64A 1XGNA 2FE3A 2DTRA 4P1WA 2XAUA 5DUKA 4ASNA 2OZ6A 2A69F 2GA1A 2MUNA 1FP1D 1NTCA 4CCKA 1FBQA 2EV5A 1T38A 4FX4A 2R7VA 1HKSA 5DCFA 1IJWC 4UVBA 4V2GA 1K83J 3LAJA 4U0WA 4E7KA 1GHCA 1FOKA 1RESA 3K2AA 3CC4I 3IWFA 3WTWC 3K1NA 1SVLA 2E35A 3GFMA 2DU9A 2K5CA 1R1UA 2HYJA 2RNGA 4L9JA 1R4NB 2PEXA 3F8CA 3W6JB 1DUXC 2CQ7A 4PJLA 5BQTA 5HNHA 3IUOA 2VC1A 1IN6A 1MBEA 4D0PA 4A3GJ 3I71A 5FROA 4KT5C 5FLXK 2XAFA 1T08B 1JXSA 2O7OA 1B6AA 1CF7B 5L3BA 5J8CA 3GTPJ 4Z6YA 5DEQA 3F21A 3J7ZI 3O8HA 2P5VA 3CDIA 5L3CA 4HAMA 1B4AA 3BY6A 4IL6C 1I5ZA 4WXHA 4XR6A 3J7AY 3UKGA 2ZMEC 3S1MJ 4BE2A 2M2EA 2ICWG 1V5FA 1KA8A 3WTUC 2R5ZB 1E3HA 3J7YJ 4IEJA 3T8TA 1J2XA 3M8EA 4OWRB 2I5UA 2Y2ZA 3CC7I 3QU3A 4BXXJ 4KIBA 4MTEA 2CQXA 3VODA 4L5EA 4UXNA 2P7CB 3HHHA 4II3A 1H8AC 4I99C 3E5XA 5J3LA 2CU7A 3A0BC 4M6VA 5F0FA 3CD6I 1DP7P 3WTXC 5ICCA 5C3EJ 2Y69H 4N9IA 2PJRA 4QSHA 2RAEA 3AAFA 1W36C 2YS9A 4RAZA 4D7MA 3H0DA 1M1EB 3S16J 4NBQA 1NH3A 2QSHX 3KEOA 4I02A 3QPLA 1FT9A 2ESNA 2HR3A 4FHTA 1R1TA 1LKXA 3G71I 3DPUA 4W1UA 2XB5A 2QUFA 2VQCA 4C30A 1Z7LA 3WG9A 2L9RA 3G1OA 3ISPA 3RYRA 4HW0A 2RREA 5DCMA 4ON0A 3GTKJ 2A5YB 2KJBA 4BBRJ 1LPQA 2QA4I 3ELKA 4S0HB 1YFHA 1I3QJ 2XKOA 4KN7X 4KUMA 3K4NA 1I1GA 3JRIA 5IOYA 4ZYEA 3H92A 4BL0B 1J75A 3VPRA 4ZDLA 2O61A 1B8IA 2WAQN 4XN0A 3K2ZA 2Y0SN 1IDZA 2MBFA 3BZKA 1J9IA 3BP8A 3QPTA 3HGGA 5C4JJ 4IJAA 4RLQA 4QIWN 1U5TC 2M8GX 3B6CA 3GUDA 2K4BA 1BW6A 5IYBJ 1VFCA 3TW7A 5FKMA 2XIGA 4IQJA 1T6SA 1UFMA 3LSTA 5LD2C 5JVTA 2F2EA 1FWZA 1O57A 1XMKA 5TGTA 3F6OA 1FJLA 1DPUA 4FQGA 4I7HA 3OYKA 2KHMA 1V3FA 3CJTB 5HVQC 2QGUA 2P4WA 2IGOA 2XAQA 2XSJC 4XLFA 3V8KA 3MZ8A 2WV1A 1OYWA 2Q1ZB 3RI4A 1Z6RA 4XQFA 2JVHA 1IUFA 1FY7A 1TQIA 2CFXA 1X2MA 4DZPA 1JHFA 3CLOA 3P7NA 3ZQGA 5DCMB 1OJLA 3QYFA 2K3PA 3ONQA 1UG0A 2VBZA 1QRYA 1ACIA 3AL0B 3GWZA 4UVCA 4UB6C 3WTTC 3GLXA 1FBSA 4AYBN 1QA6A 1VQKI 5GP9A 4KNYA 2GOMA 1I3AA 2OA4A 5FFXA 3F0CA 2LY9A 3MKZA 4KFCA 4ZZLA 3G6EI 1YIOA 2CGPA 1D5YA 2NS7A 3TO9A 4BHPA 3H5NA 1CGPA 1YS7A 3SFIA 2DLLA 1JI8A 1QGPA 3HRMA 3DF8A 3KP5A 3IL2A 4HDVA 3T1BA 2EIJH 4ZZDA 3CMAI 1MSEC 4M9ZA 3A2KA 5KAFC 1WJEA 2KLOA 3Q9SA 2L4MA 3K1MA 2LC2A 5M5YJ 4UUSA 4IRIA 1S3JA 2L2OA 5D8LB 5EF6A 3KEYA 3E5QA 2XAJA 3ERMA 3M1EA 4JX6A 2D1VA 3HOTA 2NYXA 2RQPA 2FMLA 2ZMEA 1IG7A 5E18F 3GMEA 4RB1A 3GEZA 3TQNA 5J4VA 3S93A 1MBFA 4XRSA 3W2WA 4KDPA 3C7JA 2VOOA 1WPKA 2DN0A 2EZKA 3B73A 2WAFA 3R0JA 1ZLJA 3MKLA 3PIPF 3LFUA 1IRGA 1YJ9I 2L9NA 1B72A 1QBJA 4V2FA 3JTHA 1OYIA 3QWLA 3CMEI 2WY7Q 1D0ZA 2HDWA 4XRSG 1DPRA 4C3HJ
chains in the Genus database with same CATH topology
3D5LA 1IW7F 2QBYB 2EV6A 2X0LA 2A6EF 3FHZA 2HS5A 4G7HF 3RPUA 3ERED 3CUOA 2CO5A 2Y48A 1J0RA 3KP6A 1SD6A 3LA2A 3K1PA 3K9TA 1IRFA 3G3ZA 1BI3A 4KN4X 1MJAA 2M30A 4WK8F 2LKPA 3LAPA 1FX7A 1MD0A 5CVUA 5CVJA 2GWRA 1Z05A 4EV0A 1KYZA 3VB2A 2MC3A 2PBIA 1YYVA 2XVCA 3I59B 1D3YA 3L7WA 4NQWA 1IUYA 2RC4A 2DPUA 4A5NA 4OMYA 3SZPA 1U5TA 3WU0A 2KKOA 4CDGA 2HQRA 2ZNZA 4LFUA 4BYYA 2OZUA 1FC3A 4HV6A 5JFRA 1LNWA 1YW9A 5IT9K 1S6LA 2Q2EA 3BPVA 2BE5F 5HS9A 2EK5A 5H6QA 4Q5SF 3RKWA 5LGTA 2F5FA 4NHJA 2H09A 2HFHA 2DQLA 4EJWA 3BJ6A 4L9TA 3I5UA 2YR2A 3GX4X 1K78A 2F5DA 3F8MA 3TDUC 4FX0A 1BI2A 3TGNA 4IF4A 4OIPF 1OMIA 1YS6A 1G3TA 1U3EM 1XD7A 2V79A 5E1ZB 1FYKA 3GO5A 4O6JA 2D2WA 2UXXA 3LQQA 3GW2A 4YIIA 2LDUA 4B8XA 1FSHA 2E7XA 3B02A 3CUQC 3FMSA 5A2QK 2F5EA 1UB9A 3ZPLA 4ZYHA 1O7LA 2NRAC 2XAHA 1WSUA 2MLGA 3REOA 1MZBA 2VT3A 2LF8A 2Y0MA 3G73A 4ENNA 1SFUA 3JSPA 2IA2A 4M71A 2HQNA 2FXAA 2Y75A 2W85A 3KP2A 2FU4A 3FMRA 2DPDA 1LB2A 3SXYA 3MFKA 4S04A 4BH9A 3OOPA 5DYMA 4RGSA 3EYIA 4F7ZA 2PMHA 2ETHA 2J5OA 2QQBA 4ESJA 1IN5A 3FF5A 1ULYA 3DPLC 4RB3C 4MGRA 1P4WA 2EWNA 3Q9VA 5F6FA 4Q47A 4WWCA 4LLLA 4CGZA 2V1DA 1SFXA 1U78A 4G9YA 5CVRA 4EVIA 2XRNA 4WF2A 3GYHX 1LEBA 3TOBA 1BIBA 3FWEA 1MDMB 1AOYA 2A3SA 3GVAA 1TW2A 3LA7A 3J81Z 1XN7A 3JAMK 2ADUA 5DD4A 1OPCA 5LRRA 2UZKA 4EM2A 2Z3YA 3O2PE 1XMAA 1PP8F 3WGHA 2D45A 2HKXA 2L3DA 3FXUA 2IA1A 2GXBA 1S8NA 1X3UA 4I2OA 1BI1A 3K69A 4IVNA 4B09A 1F5TA 5FGMA 2WC2A 3HSFA 3ZP5A 5FO5A 2QLZA 4HQEA 4GYIA 2OD5A 4IHTA 5LHGA 1H9GA 3TO6A 1J7KA 2ESHA 2O6GE 3HHGA 2MLKA 4P55A 4N9HA 2EFOA 4OIQF 3FM3A 4EM1A 5HS7A 1XB4A 5D6FA 3OV8A 5LLQA 1AWCA 4RGUA 2ZXJA 2CG4A 1BOAA 4HOBA 1JE8A 1NHAA 2XGXA 2D1HA 4MEYF 2MA3A 4LG0A 3HRTA 2DK8A 5K5RA 1CF7A 3RPQA 4XRFA 3BZ6A 4MHGA 4DNCA 4G6QA 3DEUA 1LEAA 1SD7A 4ENKA 2IA0A 2K4JA 2DO7A 5FD6A 3WODF 4L0YB 1ZH5A 3ZMVA 1MGTA 5JR3A 2L54A 4ENMA 1I27A 3J80Z 2RNJA 1D8JA 2STWA 2FEZA 4HYEA 4LG0B 2O03A 4I98B 2QENA 1U8RA 2JPCA 3TKYA 3WE2A 2KIFA 2AXLA 2HYGD 2IP2A 3O3KA 2EA2A 1O7FA 1R58A 3JW4A 4M73A 1EH7A 2JT1A 4S05A 3ROUA 1FP2A 2WWYA 2WV0A 1BC7C 2K7LA 4P9UA 1QNTA 3V7RA 2K27A 2NNNA 2Z9OA 3KCCA 4IPAA 1IN7A 1G4DA 2CW0F 4NB5A 2VOPA 4ETSA 2CQKA 2FMYA 3PQKA 3MWMA 2PI0A 2STTA 1U2WA 4Q4ZF 3DKWA 2VT2A 1PDNC 5ICGA 5BMZA 5LGNA 1YW7A 5CLSA 1QZYA 5H6RA 3GFJA 3E3VA 4CHUA 2W57A 4ESBA 1W7PB 1LVAA 3I53A 2IVMA 3JTGA 3GF2A 1EV7A 2EJRA 3U1DA 2BV6A 1ZG5A 1TW3A 5D4RA 2QWWA 2L4AA 2F5CA 5ERIA 4O3MA 1QO0D 2VE8A 3IC7A 3FZVA 3F72A 1TNTA 1KQ9A 2DI3A 1P92A 1W5TA 1RUOA 2BEOA 3F23A 2KIMA 4QWQA 3KE2A 2VBWA 3CTAA 2LNBA 4PGGA 1EH6A 3WTSC 2G9WA 2QBYA 4IRHA 1FYLA 4HX4A 4I09A 2AS5F 1WWXA 1OYYA 5L3DA 3IHUA 1QPMA 3ML6A 3EETA 4UHTA 4XSZF 3FX3A 2QM3A 3QP5A 3J7AO 1FYMA 3I59A 4HLXA 1XDUA 4A0YA 1WQ2A 3NEUA 5CJ9A 3PQJA 5HDGA 5EEGA 3I54A 1KYWA 4EJVA 2R7FA 3BJOA 4G8XA 4U7BA 3V4GA 4UV8A 3F8BA 3T0YA 3HTSB 3BPXA 1XCBA 2PG4A 1HSJA 3WU1B 4XLPF 3V7SA 1V4RA 1HSTA 3HYIA 2FNPA 5F64A 3VFZA 5E1XA 2J5PA 2QYOA 2NNYA 3FXRA 3COAC 3H3ZA 1HW1A 1SD5A 4U88A 3BWGA 2CSOA 4LLNA 5AIQA 3WTYC 2OU2A 3ZMZA 2K02A 2E1CA 3QP6A 1RI7A 3MZYA 1YLFA 1IN4A 4UVAA 1OR7A 3RTRA 3I58A 3WTZA 1U6GA 3KZYA 1ONVA 1STZA 1S29A 4AIJA 2FOKA 4HV5A 2RDPA 2GIVA 1ZRDA 3P9CA 4AIHA 2QQ9A 1WKMA 5E17F 2M1BA 2RN7A 3LFKA 5H20A 4KIFA 4RAYA 3E6DA 5E8IA 1BI0A 2GAUA 3ECHA 4AWXB 4OIRF 5ILVA 1JGSA 1ODDA 1GXPA 1QQIA 4LJZF 2R7DA 4HLYA 2FRHA 2JTVA 5DDGA 1XSXA 3KETA 4M72A 4L0ZB 3SQNA 1BN5A 5J6XA 1HW2A 3K0LA 2JZYA 4MNUA 4BNCA 5K1YA 1LJ9A 1W4MA 3U9GA 4CZZA 1HKQA 3MEXA 4HA8A 2P5LC 1F9NA 1B9MA 1E2XA 4U0VA 1IAWA 5FLXZ 1MJBA 1BM9A 1T2KA 4XSXF 4HQMA 5K5QA 2DW4A 2H6BA 1ZYRF 3R6SA 4EJOA 5HS8A 2V1UA 5LHHA 4Y15A 5IT3A 3V8JA 2EB7A 4MQVA 3HIFA 4M9XA 4Y13A 4KMUX 2O8XA 4WXDA 1MDMA 3ABUA 3E6CC 1IN8A 2A68F 1KQ0A 3BJAA 1UHMA 4AVPA 4P96A 4WX9A 2XASA 1LDJA 5HDKA 4Q48A 1R23A 3GFLA 1FNNA 4ZYDA 4I0BA 3E6BA 4PGHA 2PQ8A 1ON1A 3L09A 5AIPA 2VXZA 5L3FA 3DXJF 2VONA 5JI6A 1BBYA 2PN6A 5LRSA 3P9KA 1W5SA 5D5XB 3PFIA 1TBXA 3IRQA 4LB5A 2HWVA 1OKRA 3QRFF 2P5KA 3T5XA 3DFGA 1Z9CA 3IWZA 3E97A 1VTNC 4EGZA 1T98A 4L5JA 1Z91A 2VODA 5BS6A 4AD9A 2BBYA 3KEQA 3WTVC 1PUEE 2EFPA 1YO5C 3CDHA 1TQPA 1IZ1A 2YU3A 4A6DA 1S7OA 4BAYA 3BOQA 3F6VA 5LEKA 4BHBA 4HF1A 1A04A 2IW5A 4UUVA 5LEJA 3DQVC 1RUNA 4Y17A 1P6RA 3DV8A 4R8HA 3EYYA 3ZMTA 2XUBA 4I01A 3FM5A 4YFXF 4EGYA 4YFNF 4CICA 4KYWA 5CVIA 2IJLA 3ABTA 2ISYA 1WI9A 3V8LA 1EH8A 2BGCA 4L18B 4KICA 2QVOA 5KK1A 4EJUA 4KMFA 1P4AA 2W84A 4TV7A 2A6HF 1XGOA 2M8EA 4E70A 3KLOA 2JRTA 5D4SA 3WGGA 1IF1A 5HLHA 2Q8KA 1ZRCA 3WGIA 3KP4A 4L5IA 4M9SA 5BPIA 2PJPA 4P5OA 5D6EA 1BIAA 4ENJA 2A61A 1F4KA 1ZN2A 3M7GA 5LGUA 3HOSA 1O3SA 6PAXA 3RYPA 2YPRA 4M74A 1G3WA 2MH9A 5CYVA 2UWMA 4JQFA 1IXSB 1B59A 2ZBKA 2HDCA 2FQ3A 3P9IA 1HQCA 5EEHA 2FNAA 2B0LA 1K79A 2NS0A 2X4HA 4R1HA 3F22A 3I4PA 2ZKZA 3MZHA 3F8FA 5TJJA 3H3UA 5F1RA 4G6DA 1LDKB 3KFWX 1XSDA 1BC8C 5K5OA 5DUIA 2P6SA 1LDDA 5IT9Z 2FBIA 1R36A 3MQ0A 2R3SA 1FLIA 1FZPB 3RIRA 3L00A 1ZAOA 2HZTA 1ZHFA 2XROA 3TO7A 1W7PA 3HRSA 5HDNA 2DBBA 2M87A 2KJCA 2CYYA 1IXRC 2Z5UA 4PDKA 1PP7U 2DQRA 3CO7C 1IXCA 1XDSA 2O3FA 3ZN0A 4GCVA 2IPQX 3W6KB 4O5VA 1UCRA 3C3WA 1J5YA 4LD5A 4DQ2A 1C0WA 4RB2C 3KP7A 4IXAA 1SMYF 1TQMA 2EFQA 1ZARA 2A07F 1D5VA 4BQAA 4MEXF 3WE3A 3R61A 3RJPA 3BROA 1XSVA 1W7PD 1TTYA 4K2EA 3RKYA 3JSOA 4EJTA 2EFWA 4LK0F 2XKPA 5BPDA 3TOAA 2YX7A 4OU0A 5A2QZ 4BHCA 5KVRA 1R7JA 4L9NA 2PMUA 4CO8A 2HTSA 2KIUA 2ZJ2A 1UHWA 4JK1X 2DT5A 3FMQA 4RB0A 3HRUA 5D8KB 3F8NA 3QU6A 3D0SA 1BJAA 4G94A 3DP7A 3J81K 2L01A 1USTA 2VN2A 2EV0A 2Z33A 2JSCA 4CYDA 1KU2A 3E6MA 3ZMDA 3GXOA 2TDXA 4A2UA 4G7OF 2QQAA 3NRVA 4A0XA 1ZG3A 3ZN1A 3LWFA 3TDZC 3KP3A 1I1SA 4HDUA 2OQRA 4PZJA 2O0YA 2RV8A 4KIGA 5JHUA 4HX7A 1GXQA 3EDPA 4N0BA 1LQ1A 1TNSA 3EQLF 1YW8A 2LSOA 5HLIA 3JAMZ 4R79A 3N4MA 5HLGA 3GZ5A 1YQAA 5CVVA 2CWEA 2ZFWA 4P9FA 2YX4A 4EMSA 1E17A 1WRJA 2VBXA 2Q0OA 1RIOH 1HW5A 5DD8A 1SFEA 2OBPA 4RGRA 1T0FA 1XGSA 1H9TA 3LA3A 3R0AA 5ILSA 1R22A 5ED4A 4HBLA 2FBHA 2WTEA 5L3GA 2H27A 5E20A 2P8TA 5DV5A 2GA2A 2PFBA 2IT0A 1G3YA 2HYFA 3IKVA 5D5UB 3KZZA 4JBAA 4IRGA 2V1XA 3T8RA 2GXGA 3KLNA 4GXOA 4U7DA 4EQQA 2EA4A 4LLGF 3M8FA 2IRFG 1KGSA 5LBQA 1FBUA 3IRRA 2ZMEB 1USSA 2HEOA 3L9FA 5ILUA 1D8KA 3SHFA 2XV4S 3M9AA 3U2RA 4MTDA 5FD5A 3J80K 4CXFA 1R1VA 1F1ZA 4EM0B 3C1DA 4LK1F 1R5GA 3HSRA 4WXCA 5FFZA 3CO6C 1G3SA 1K7AA 3MAJA 2GQQA 3C18A 1ZREA 2H6CA 3R4KA 4MQ9F 1ZGJA 2VBYA 4ZH4F 2COMA 2FSWA 4ZYGA 4YG2F 4XBFA 2VC0A 1Z6TA 1JHHA 1KU7A 4OINF 1I6XA 3E5UA 1ZRFA 2P7VB 2V6CA 3SZTA 4A5MA 3RKXA 2L02A 4HF2A 2FBKA 5BOXA 1U5TB 5D5WB 2RGVA 4PCQA 4RS8A 2V9VA 2HGCA 4KA4A 1R5HA 4HZFA 2ZNYA 2EFNA 4GGGA 2ZO4A 3ECOA 2BYVE 3QAHA 2VE9A 4GYGA 3RDIA 3QOPA 3ULQB 4Z2YA 1HKTA 3F3XA 2RVCA 3VOEA 4A12A 2HOEA 2JPBA 4YFKF 1Z7UA 1TLHB 3EUHA 1REPC 4U0YA 1K78B 3CJNA 4OOIA 4G7ZF 3ZMUA 4QLCU 1RZ4A 3L2CA 2C6YA 1ZG1A 3R60A 5ICEA 2RKHA 1L0OC 2E7WA 1B1BA 1O3QA 1HXDA 1KU3A 2Z99A 4LGWA 3MCZA 4UV9A 2MD5A 3FXQA 1FPQA 4ESFA 2ACJA 4LB6B 1H0MA 2DAOA 5ICFA 2LF7A 3S2WA 2E1NA 3GFIA 1Q1HA 5LHIA 3Q5FA 4IHSA 5TRDA 2OAZA 4XLNF 3ZMSA 1S7AA 2ELHA 2DK5A 2W25A 1SAXA 1QZZA 5D5VB 4OMZA 2KRFA 2ISZA 2HKOA 3HSEA 1P4XA 4WCGA 1ZGAA 4AIKA 1GVJA 1O3TA 2MH2A 5E8GA 3HUGA 4M6XA 1FSEA 1B9NA 2G7HA 3ZQ7A 1Z1DA 1Y0UA 5FB2A 4GO1A 4UNOA 2G7UA 1MJ9A 1MKMA 4BXUA 1XGMA 4M6YA 2HTJA 1RNLA 1KQ8A 3LQRA 3O6BB 3QPHA 4FT8A 3I0TA 1YG2A 3NQOA 3SFZA 1YTYA 2OQGA 4LMYA 4H0EA 3V7CA 3GZ6A 2UXNA 2ZCWA 2FA5A 1ON2A 4HX8A 5HOOA 2P6TA 3BDDA 4L9VA 2FF4A 3IKTA 5J8FA 2QZ8A 3VEPA 3CUQA 2H94A 1HBXG 3DPTA 4RGXA 2PLYA 4A6EA 4HF0A 5E1WA 1SD4A 1R00A 1T39A 1SMTA 2DFIA 5AONA 2GZWA 2NAZA 2XAGA 1O3RA 2YSRA 4I0AA 4YIFA 2M5WA 5L3EA 2W24A 1KU9A 1L3LA 2XHKA 3N97A 4OIOF 1ZLKA 4A0ZA 1J59A 1XCVA 1K6OA 1G6NA 2M45A 2K86A 1DDNA 1P2FA 3CUQB 3HTUA 3I64A 1XGNA 2FE3A 2DTRA 5DUKA 4ASNA 2OZ6A 2A69F 2GA1A 1FP1D 1T38A 1FBQA 2EV5A 4FX4A 1HKSA 5DCFA 4UVBA 3LAJA 4U0WA 1GHCA 1FOKA 3IWFA 3WTWC 3K1NA 3GFMA 2DU9A 1R1UA 4L9JA 3F8CA 2PEXA 3W6JB 1DUXC 5BQTA 2VC1A 1IN6A 4D0PA 3I71A 4KT5C 5FLXK 2XAFA 1JXSA 1B6AA 1CF7B 5L3BA 5J8CA 5DEQA 3F21A 2P5VA 5L3CA 4HAMA 1B4AA 3BY6A 4WXHA 1I5ZA 1KA8A 3WTUC 3T8TA 1J2XA 3M8EA 3QU3A 4KIBA 4MTEA 3VODA 4UXNA 2P7CB 3HHHA 3E5XA 1DP7P 3WTXC 5ICCA 4N9IA 3AAFA 4RAZA 3KEOA 4I02A 1FT9A 2ESNA 2HR3A 4FHTA 1R1TA 2QUFA 3WG9A 3ISPA 3RYRA 4HW0A 5DCMA 4ON0A 2A5YB 2KJBA 3ELKA 1YFHA 2XKOA 4KN7X 4KUMA 1I1GA 4ZYEA 3H92A 1J75A 2O61A 3K2ZA 2MBFA 1J9IA 3BP8A 3QPTA 4IJAA 1U5TC 3GUDA 2K4BA 2XIGA 1T6SA 1UFMA 3LSTA 5JVTA 2F2EA 1FWZA 1O57A 1XMKA 3F6OA 1DPUA 4I7HA 1V3FA 5HVQC 2P4WA 2XAQA 3V8KA 1OYWA 3RI4A 1Z6RA 1FY7A 1TQIA 2CFXA 1JHFA 3CLOA 3P7NA 5DCMB 2VBZA 3GWZA 4UVCA 3WTTC 3GLXA 1FBSA 4KNYA 2OA4A 5FFXA 4KFCA 4ZZLA 1YIOA 2CGPA 3TO9A 4BHPA 1CGPA 1YS7A 2DLLA 1QGPA 3HRMA 3DF8A 3KP5A 3IL2A 4HDVA 3T1BA 4ZZDA 4M9ZA 3Q9SA 2L4MA 3K1MA 4IRIA 1S3JA 5D8LB 3E5QA 2XAJA 3M1EA 2D1VA 3HOTA 2NYXA 2RQPA 2FMLA 2ZMEA 4RB1A 5E18F 3GEZA 3TQNA 4KDPA 3C7JA 2VOOA 3B73A 3R0JA 1ZLJA 1IRGA 1QBJA 3JTHA 1OYIA 1DPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5L A;  1IW7 F;  2QBY B;  2EV6 A;  2X0L A;  2A6E F;  3FHZ A;  2HS5 A;  4G7H F;  3RPU A;  3ERE D;  3CUO A;  2CO5 A;  2Y48 A;  1J0R A;  3KP6 A;  1SD6 A;  3LA2 A;  3K1P A;  3K9T A;  1IRF A;  3G3Z A;  1BI3 A;  4KN4 X;  1MJA A;  2M30 A;  4WK8 F;  2LKP A;  3LAP A;  1FX7 A;  1MD0 A;  5CVU A;  5CVJ A;  2GWR A;  1Z05 A;  4EV0 A;  1KYZ A;  3VB2 A;  2MC3 A;  2PBI A;  1YYV A;  2XVC A;  3I59 B;  1D3Y A;  3L7W A;  4NQW A;  1IUY A;  2RC4 A;  2DPU A;  4A5N A;  4OMY A;  3SZP A;  1U5T A;  3WU0 A;  2KKO A;  4CDG A;  2HQR A;  2ZNZ A;  4LFU A;  4BYY A;  2OZU A;  1FC3 A;  4HV6 A;  5JFR A;  1LNW A;  1YW9 A;  5IT9 K;  1S6L A;  2Q2E A;  3BPV A;  2BE5 F;  5HS9 A;  2EK5 A;  5H6Q A;  4Q5S F;  3RKW A;  5LGT A;  2F5F A;  4NHJ A;  2H09 A;  2HFH A;  2DQL A;  4EJW A;  3BJ6 A;  4L9T A;  3I5U A;  2YR2 A;  3GX4 X;  1K78 A;  2F5D A;  3F8M A;  3TDU C;  4FX0 A;  1BI2 A;  3TGN A;  4IF4 A;  4OIP F;  1OMI A;  1YS6 A;  1G3T A;  1U3E M;  1XD7 A;  2V79 A;  5E1Z B;  1FYK A;  3GO5 A;  4O6J A;  2D2W A;  2UXX A;  3LQQ A;  3GW2 A;  4YII A;  2LDU A;  4B8X A;  1FSH A;  2E7X A;  3B02 A;  3CUQ C;  3FMS A;  5A2Q K;  2F5E A;  1UB9 A;  3ZPL A;  4ZYH A;  1O7L A;  2NRA C;  2XAH A;  1WSU A;  2MLG A;  3REO A;  1MZB A;  2VT3 A;  2LF8 A;  2Y0M A;  3G73 A;  4ENN A;  1SFU A;  3JSP A;  2IA2 A;  4M71 A;  2HQN A;  2FXA A;  2Y75 A;  2W85 A;  3KP2 A;  2FU4 A;  3FMR A;  2DPD A;  1LB2 A;  3SXY A;  3MFK A;  4S04 A;  4BH9 A;  3OOP A;  5DYM A;  4RGS A;  3EYI A;  4F7Z A;  2PMH A;  2ETH A;  2J5O A;  2QQB A;  4ESJ A;  1IN5 A;  3FF5 A;  1ULY A;  3DPL C;  4RB3 C;  4MGR A;  1P4W A;  2EWN A;  3Q9V A;  5F6F A;  4Q47 A;  4WWC A;  4LLL A;  4CGZ A;  2V1D A;  1SFX A;  1U78 A;  4G9Y A;  5CVR A;  4EVI A;  2XRN A;  4WF2 A;  3GYH X;  1LEB A;  3TOB A;  1BIB A;  3FWE A;  1MDM B;  1AOY A;  2A3S A;  3GVA A;  1TW2 A;  3LA7 A;  3J81 Z;  1XN7 A;  3JAM K;  2ADU A;  5DD4 A;  1OPC A;  5LRR A;  2UZK A;  4EM2 A;  2Z3Y A;  3O2P E;  1XMA A;  1PP8 F;  3WGH A;  2D45 A;  2HKX A;  2L3D A;  3FXU A;  2IA1 A;  2GXB A;  1S8N A;  1X3U A;  4I2O A;  1BI1 A;  3K69 A;  4IVN A;  4B09 A;  1F5T A;  5FGM A;  2WC2 A;  3HSF A;  3ZP5 A;  5FO5 A;  2QLZ A;  4HQE A;  4GYI A;  2OD5 A;  4IHT A;  5LHG A;  1H9G A;  3TO6 A;  1J7K A;  2ESH A;  2O6G E;  3HHG A;  2MLK A;  4P55 A;  4N9H A;  2EFO A;  4OIQ F;  3FM3 A;  4EM1 A;  5HS7 A;  1XB4 A;  5D6F A;  3OV8 A;  5LLQ A;  1AWC A;  4RGU A;  2ZXJ A;  2CG4 A;  1BOA A;  4HOB A;  1JE8 A;  1NHA A;  2XGX A;  2D1H A;  4MEY F;  2MA3 A;  4LG0 A;  3HRT A;  2DK8 A;  5K5R A;  1CF7 A;  3RPQ A;  4XRF A;  3BZ6 A;  4MHG A;  4DNC A;  4G6Q A;  3DEU A;  1LEA A;  1SD7 A;  4ENK A;  2IA0 A;  2K4J A;  2DO7 A;  5FD6 A;  3WOD F;  4L0Y B;  1ZH5 A;  3ZMV A;  1MGT A;  5JR3 A;  2L54 A;  4ENM A;  1I27 A;  3J80 Z;  2RNJ A;  1D8J A;  2STW A;  2FEZ A;  4HYE A;  4LG0 B;  2O03 A;  4I98 B;  2QEN A;  1U8R A;  2JPC A;  3TKY A;  3WE2 A;  2KIF A;  2AXL A;  2HYG D;  2IP2 A;  3O3K A;  2EA2 A;  1O7F A;  1R58 A;  3JW4 A;  4M73 A;  1EH7 A;  2JT1 A;  4S05 A;  3ROU A;  1FP2 A;  2WWY A;  2WV0 A;  1BC7 C;  2K7L A;  4P9U A;  1QNT A;  3V7R A;  2K27 A;  2NNN A;  2Z9O A;  3KCC A;  4IPA A;  1IN7 A;  1G4D A;  2CW0 F;  4NB5 A;  2VOP A;  4ETS A;  2CQK A;  2FMY A;  3PQK A;  3MWM A;  2PI0 A;  2STT A;  1U2W A;  4Q4Z F;  3DKW A;  2VT2 A;  1PDN C;  5ICG A;  5BMZ A;  5LGN A;  1YW7 A;  5CLS A;  1QZY A;  5H6R A;  3GFJ A;  3E3V A;  4CHU A;  2W57 A;  4ESB A;  1W7P B;  1LVA A;  3I53 A;  2IVM A;  3JTG A;  3GF2 A;  1EV7 A;  2EJR A;  3U1D A;  2BV6 A;  1ZG5 A;  1TW3 A;  5D4R A;  2QWW A;  2L4A A;  2F5C A;  5ERI A;  4O3M A;  1QO0 D;  2VE8 A;  3IC7 A;  3FZV A;  3F72 A;  1TNT A;  1KQ9 A;  2DI3 A;  1P92 A;  1W5T A;  1RUO A;  2BEO A;  3F23 A;  2KIM A;  4QWQ A;  3KE2 A;  2VBW A;  3CTA A;  2LNB A;  4PGG A;  1EH6 A;  3WTS C;  2G9W A;  2QBY A;  4IRH A;  1FYL A;  4HX4 A;  4I09 A;  2AS5 F;  1WWX A;  1OYY A;  5L3D A;  3IHU A;  1QPM A;  3ML6 A;  3EET A;  4UHT A;  4XSZ F;  3FX3 A;  2QM3 A;  3QP5 A;  3J7A O;  1FYM A;  3I59 A;  4HLX A;  1XDU A;  4A0Y A;  1WQ2 A;  3NEU A;  5CJ9 A;  3PQJ A;  5HDG A;  5EEG A;  3I54 A;  1KYW A;  4EJV A;  2R7F A;  3BJO A;  4G8X A;  4U7B A;  3V4G A;  4UV8 A;  3F8B A;  3T0Y A;  3HTS B;  3BPX A;  1XCB A;  2PG4 A;  1HSJ A;  3WU1 B;  4XLP F;  3V7S A;  1V4R A;  1HST A;  3HYI A;  2FNP A;  5F64 A;  3VFZ A;  5E1X A;  2J5P A;  2QYO A;  2NNY A;  3FXR A;  3COA C;  3H3Z A;  1HW1 A;  1SD5 A;  4U88 A;  3BWG A;  2CSO A;  4LLN A;  5AIQ A;  3WTY C;  2OU2 A;  3ZMZ A;  2K02 A;  2E1C A;  3QP6 A;  1RI7 A;  3MZY A;  1YLF A;  1IN4 A;  4UVA A;  1OR7 A;  3RTR A;  3I58 A;  3WTZ A;  1U6G A;  3KZY A;  1ONV A;  1STZ A;  1S29 A;  4AIJ A;  2FOK A;  4HV5 A;  2RDP A;  2GIV A;  1ZRD A;  3P9C A;  4AIH A;  2QQ9 A;  1WKM A;  5E17 F;  2M1B A;  2RN7 A;  3LFK A;  5H20 A;  4KIF A;  4RAY A;  3E6D A;  5E8I A;  1BI0 A;  2GAU A;  3ECH A;  4AWX B;  4OIR F;  5ILV A;  1JGS A;  1ODD A;  1GXP A;  1QQI A;  4LJZ F;  2R7D A;  4HLY A;  2FRH A;  2JTV A;  5DDG A;  1XSX A;  3KET A;  4M72 A;  4L0Z B;  3SQN A;  1BN5 A;  5J6X A;  1HW2 A;  3K0L A;  2JZY A;  4MNU A;  4BNC A;  5K1Y A;  1LJ9 A;  1W4M A;  3U9G A;  4CZZ A;  1HKQ A;  3MEX A;  4HA8 A;  2P5L C;  1F9N A;  1B9M A;  1E2X A;  4U0V A;  1IAW A;  5FLX Z;  1MJB A;  1BM9 A;  1T2K A;  4XSX F;  4HQM A;  5K5Q A;  2DW4 A;  2H6B A;  1ZYR F;  3R6S A;  4EJO A;  5HS8 A;  2V1U A;  5LHH A;  4Y15 A;  5IT3 A;  3V8J A;  2EB7 A;  4MQV A;  3HIF A;  4M9X A;  4Y13 A;  4KMU X;  2O8X A;  4WXD A;  1MDM A;  3ABU A;  3E6C C;  1IN8 A;  2A68 F;  1KQ0 A;  3BJA A;  1UHM A;  4AVP A;  4P96 A;  4WX9 A;  2XAS A;  1LDJ A;  5HDK A;  4Q48 A;  1R23 A;  3GFL A;  1FNN A;  4ZYD A;  4I0B A;  3E6B A;  4PGH A;  2PQ8 A;  1ON1 A;  3L09 A;  5AIP A;  2VXZ A;  5L3F A;  3DXJ F;  2VON A;  5JI6 A;  1BBY A;  2PN6 A;  5LRS A;  3P9K A;  1W5S A;  5D5X B;  3PFI A;  1TBX A;  3IRQ A;  4LB5 A;  2HWV A;  1OKR A;  3QRF F;  2P5K A;  3T5X A;  3DFG A;  1Z9C A;  3IWZ A;  3E97 A;  1VTN C;  4EGZ A;  1T98 A;  4L5J A;  1Z91 A;  2VOD A;  5BS6 A;  4AD9 A;  2BBY A;  3KEQ A;  3WTV C;  1PUE E;  2EFP A;  1YO5 C;  3CDH A;  1TQP A;  1IZ1 A;  2YU3 A;  4A6D A;  1S7O A;  4BAY A;  3BOQ A;  3F6V A;  5LEK A;  4BHB A;  4HF1 A;  1A04 A;  2IW5 A;  4UUV A;  5LEJ A;  3DQV C;  1RUN A;  4Y17 A;  1P6R A;  3DV8 A;  4R8H A;  3EYY A;  3ZMT A;  2XUB A;  4I01 A;  3FM5 A;  4YFX F;  4EGY A;  4YFN F;  4CIC A;  4KYW A;  5CVI A;  2IJL A;  3ABT A;  2ISY A;  1WI9 A;  3V8L A;  1EH8 A;  2BGC A;  4L18 B;  4KIC A;  2QVO A;  5KK1 A;  4EJU A;  4KMF A;  1P4A A;  2W84 A;  4TV7 A;  2A6H F;  1XGO A;  2M8E A;  4E70 A;  3KLO A;  2JRT A;  5D4S A;  3WGG A;  1IF1 A;  5HLH A;  2Q8K A;  1ZRC A;  3WGI A;  3KP4 A;  4L5I A;  4M9S A;  5BPI A;  2PJP A;  4P5O A;  5D6E A;  1BIA A;  4ENJ A;  2A61 A;  1F4K A;  1ZN2 A;  3M7G A;  5LGU A;  3HOS A;  1O3S A;  6PAX A;  3RYP A;  2YPR A;  4M74 A;  1G3W A;  2MH9 A;  5CYV A;  2UWM A;  4JQF A;  1IXS B;  1B59 A;  2ZBK A;  2HDC A;  2FQ3 A;  3P9I A;  1HQC A;  5EEH A;  2FNA A;  2B0L A;  1K79 A;  2NS0 A;  2X4H A;  4R1H A;  3F22 A;  3I4P A;  2ZKZ A;  3MZH A;  3F8F A;  5TJJ A;  3H3U A;  5F1R A;  4G6D A;  1LDK B;  3KFW X;  1XSD A;  1BC8 C;  5K5O A;  5DUI A;  2P6S A;  1LDD A;  5IT9 Z;  2FBI A;  1R36 A;  3MQ0 A;  2R3S A;  1FLI A;  1FZP B;  3RIR A;  3L00 A;  1ZAO A;  2HZT A;  1ZHF A;  2XRO A;  3TO7 A;  1W7P A;  3HRS A;  5HDN A;  2DBB A;  2M87 A;  2KJC A;  2CYY A;  1IXR C;  2Z5U A;  4PDK A;  1PP7 U;  2DQR A;  3CO7 C;  1IXC A;  1XDS A;  2O3F A;  3ZN0 A;  4GCV A;  2IPQ X;  3W6K B;  4O5V A;  1UCR A;  3C3W A;  1J5Y A;  4LD5 A;  4DQ2 A;  1C0W A;  4RB2 C;  3KP7 A;  4IXA A;  1SMY F;  1TQM A;  2EFQ A;  1ZAR A;  2A07 F;  1D5V A;  4BQA A;  4MEX F;  3WE3 A;  3R61 A;  3RJP A;  3BRO A;  1XSV A;  1W7P D;  1TTY A;  4K2E A;  3RKY A;  3JSO A;  4EJT A;  2EFW A;  4LK0 F;  2XKP A;  5BPD A;  3TOA A;  2YX7 A;  4OU0 A;  5A2Q Z;  4BHC A;  5KVR A;  1R7J A;  4L9N A;  2PMU A;  4CO8 A;  2HTS A;  2KIU A;  2ZJ2 A;  1UHW A;  4JK1 X;  2DT5 A;  3FMQ A;  4RB0 A;  3HRU A;  5D8K B;  3F8N A;  3QU6 A;  3D0S A;  1BJA A;  4G94 A;  3DP7 A;  3J81 K;  2L01 A;  1UST A;  2VN2 A;  2EV0 A;  2Z33 A;  2JSC A;  4CYD A;  1KU2 A;  3E6M A;  3ZMD A;  3GXO A;  2TDX A;  4A2U A;  4G7O F;  2QQA A;  3NRV A;  4A0X A;  1ZG3 A;  3ZN1 A;  3LWF A;  3TDZ C;  3KP3 A;  1I1S A;  4HDU A;  2OQR A;  4PZJ A;  2O0Y A;  2RV8 A;  4KIG A;  5JHU A;  4HX7 A;  1GXQ A;  3EDP A;  4N0B A;  1LQ1 A;  1TNS A;  3EQL F;  1YW8 A;  2LSO A;  5HLI A;  3JAM Z;  4R79 A;  3N4M A;  5HLG A;  3GZ5 A;  1YQA A;  5CVV A;  2CWE A;  2ZFW A;  4P9F A;  2YX4 A;  4EMS A;  1E17 A;  1WRJ A;  2VBX A;  2Q0O A;  1RIO H;  1HW5 A;  5DD8 A;  1SFE A;  2OBP A;  4RGR A;  1T0F A;  1XGS A;  1H9T A;  3LA3 A;  3R0A A;  5ILS A;  1R22 A;  5ED4 A;  4HBL A;  2FBH A;  2WTE A;  5L3G A;  2H27 A;  5E20 A;  2P8T A;  5DV5 A;  2GA2 A;  2PFB A;  2IT0 A;  1G3Y A;  2HYF A;  3IKV A;  5D5U B;  3KZZ A;  4JBA A;  4IRG A;  2V1X A;  3T8R A;  2GXG A;  3KLN A;  4GXO A;  4U7D A;  4EQQ A;  2EA4 A;  4LLG F;  3M8F A;  2IRF G;  1KGS A;  5LBQ A;  1FBU A;  3IRR A;  2ZME B;  1USS A;  2HEO A;  3L9F A;  5ILU A;  1D8K A;  3SHF A;  2XV4 S;  3M9A A;  3U2R A;  4MTD A;  5FD5 A;  3J80 K;  4CXF A;  1R1V A;  1F1Z A;  4EM0 B;  3C1D A;  4LK1 F;  1R5G A;  3HSR A;  4WXC A;  5FFZ A;  3CO6 C;  1G3S A;  1K7A A;  3MAJ A;  2GQQ A;  3C18 A;  1ZRE A;  2H6C A;  3R4K A;  4MQ9 F;  1ZGJ A;  2VBY A;  4ZH4 F;  2COM A;  2FSW A;  4ZYG A;  4YG2 F;  4XBF A;  2VC0 A;  1Z6T A;  1JHH A;  1KU7 A;  4OIN F;  1I6X A;  3E5U A;  1ZRF A;  2P7V B;  2V6C A;  3SZT A;  4A5M A;  3RKX A;  2L02 A;  4HF2 A;  2FBK A;  5BOX A;  1U5T B;  5D5W B;  2RGV A;  4PCQ A;  4RS8 A;  2V9V A;  2HGC A;  4KA4 A;  1R5H A;  4HZF A;  2ZNY A;  2EFN A;  4GGG A;  2ZO4 A;  3ECO A;  2BYV E;  3QAH A;  2VE9 A;  4GYG A;  3RDI A;  3QOP A;  3ULQ B;  4Z2Y A;  1HKT A;  3F3X A;  2RVC A;  3VOE A;  4A12 A;  2HOE A;  2JPB A;  4YFK F;  1Z7U A;  1TLH B;  3EUH A;  1REP C;  4U0Y A;  1K78 B;  3CJN A;  4OOI A;  4G7Z F;  3ZMU A;  4QLC U;  1RZ4 A;  3L2C A;  2C6Y A;  1ZG1 A;  3R60 A;  5ICE A;  2RKH A;  1L0O C;  2E7W A;  1B1B A;  1O3Q A;  1HXD A;  1KU3 A;  2Z99 A;  4LGW A;  3MCZ A;  4UV9 A;  2MD5 A;  3FXQ A;  1FPQ A;  4ESF A;  2ACJ A;  4LB6 B;  1H0M A;  2DAO A;  5ICF A;  2LF7 A;  3S2W A;  2E1N A;  3GFI A;  1Q1H A;  5LHI A;  3Q5F A;  4IHS A;  5TRD A;  2OAZ A;  4XLN F;  3ZMS A;  1S7A A;  2ELH A;  2DK5 A;  2W25 A;  1SAX A;  1QZZ A;  5D5V B;  4OMZ A;  2KRF A;  2ISZ A;  2HKO A;  3HSE A;  1P4X A;  4WCG A;  1ZGA A;  4AIK A;  1GVJ A;  1O3T A;  2MH2 A;  5E8G A;  3HUG A;  4M6X A;  1FSE A;  1B9N A;  2G7H A;  3ZQ7 A;  1Z1D A;  1Y0U A;  5FB2 A;  4GO1 A;  4UNO A;  2G7U A;  1MJ9 A;  1MKM A;  4BXU A;  1XGM A;  4M6Y A;  2HTJ A;  1RNL A;  1KQ8 A;  3LQR A;  3O6B B;  3QPH A;  4FT8 A;  3I0T A;  1YG2 A;  3NQO A;  3SFZ A;  1YTY A;  2OQG A;  4LMY A;  4H0E A;  3V7C A;  3GZ6 A;  2UXN A;  2ZCW A;  2FA5 A;  1ON2 A;  4HX8 A;  5HOO A;  2P6T A;  3BDD A;  4L9V A;  2FF4 A;  3IKT A;  5J8F A;  2QZ8 A;  3VEP A;  3CUQ A;  2H94 A;  1HBX G;  3DPT A;  4RGX A;  2PLY A;  4A6E A;  4HF0 A;  5E1W A;  1SD4 A;  1R00 A;  1T39 A;  1SMT A;  2DFI A;  5AON A;  2GZW A;  2NAZ A;  2XAG A;  1O3R A;  2YSR A;  4I0A A;  4YIF A;  2M5W A;  5L3E A;  2W24 A;  1KU9 A;  1L3L A;  2XHK A;  3N97 A;  4OIO F;  1ZLK A;  4A0Z A;  1J59 A;  1XCV A;  1K6O A;  1G6N A;  2M45 A;  2K86 A;  1DDN A;  1P2F A;  3CUQ B;  3HTU A;  3I64 A;  1XGN A;  2FE3 A;  2DTR A;  5DUK A;  4ASN A;  2OZ6 A;  2A69 F;  2GA1 A;  1FP1 D;  1T38 A;  1FBQ A;  2EV5 A;  4FX4 A;  1HKS A;  5DCF A;  4UVB A;  3LAJ A;  4U0W A;  1GHC A;  1FOK A;  3IWF A;  3WTW C;  3K1N A;  3GFM A;  2DU9 A;  1R1U A;  4L9J A;  3F8C A;  2PEX A;  3W6J B;  1DUX C;  5BQT A;  2VC1 A;  1IN6 A;  4D0P A;  3I71 A;  4KT5 C;  5FLX K;  2XAF A;  1JXS A;  1B6A A;  1CF7 B;  5L3B A;  5J8C A;  5DEQ A;  3F21 A;  2P5V A;  5L3C A;  4HAM A;  1B4A A;  3BY6 A;  4WXH A;  1I5Z A;  1KA8 A;  3WTU C;  3T8T A;  1J2X A;  3M8E A;  3QU3 A;  4KIB A;  4MTE A;  3VOD A;  4UXN A;  2P7C B;  3HHH A;  3E5X A;  1DP7 P;  3WTX C;  5ICC A;  4N9I A;  3AAF A;  4RAZ A;  3KEO A;  4I02 A;  1FT9 A;  2ESN A;  2HR3 A;  4FHT A;  1R1T A;  2QUF A;  3WG9 A;  3ISP A;  3RYR A;  4HW0 A;  5DCM A;  4ON0 A;  2A5Y B;  2KJB A;  3ELK A;  1YFH A;  2XKO A;  4KN7 X;  4KUM A;  1I1G A;  4ZYE A;  3H92 A;  1J75 A;  2O61 A;  3K2Z A;  2MBF A;  1J9I A;  3BP8 A;  3QPT A;  4IJA A;  1U5T C;  3GUD A;  2K4B A;  2XIG A;  1T6S A;  1UFM A;  3LST A;  5JVT A;  2F2E A;  1FWZ A;  1O57 A;  1XMK A;  3F6O A;  1DPU A;  4I7H A;  1V3F A;  5HVQ C;  2P4W A;  2XAQ A;  3V8K A;  1OYW A;  3RI4 A;  1Z6R A;  1FY7 A;  1TQI A;  2CFX A;  1JHF A;  3CLO A;  3P7N A;  5DCM B;  2VBZ A;  3GWZ A;  4UVC A;  3WTT C;  3GLX A;  1FBS A;  4KNY A;  2OA4 A;  5FFX A;  4KFC A;  4ZZL A;  1YIO A;  2CGP A;  3TO9 A;  4BHP A;  1CGP A;  1YS7 A;  2DLL A;  1QGP A;  3HRM A;  3DF8 A;  3KP5 A;  3IL2 A;  4HDV A;  3T1B A;  4ZZD A;  4M9Z A;  3Q9S A;  2L4M A;  3K1M A;  4IRI A;  1S3J A;  5D8L B;  3E5Q A;  2XAJ A;  3M1E A;  2D1V A;  3HOT A;  2NYX A;  2RQP A;  2FML A;  2ZME A;  4RB1 A;  5E18 F;  3GEZ A;  3TQN A;  4KDP A;  3C7J A;  2VOO A;  3B73 A;  3R0J A;  1ZLJ A;  1IRG A;  1QBJ A;  3JTH A;  1OYI A;  1DPR A; 
#chains in the Genus database with same CATH topology
 3D5L A;  1IW7 F;  1LFB A;  2JUG A;  2R0Q C;  2QBY B;  2EV6 A;  2X0L A;  2A6E F;  3TW6 A;  4JYK A;  3FHZ A;  2HS5 A;  4Y3O A;  4G7H F;  3RPU A;  3ERE D;  3CUO A;  4JX5 A;  1MMD A;  3L1P A;  5J4Y A;  2CO5 A;  2Y48 A;  1J0R A;  3GTM J;  3KP6 A;  3HOZ J;  1ETK A;  3HG9 A;  3ZQI A;  2FD5 A;  1SD6 A;  3LA2 A;  3K1P A;  4KJZ A;  2H8W A;  1IRF A;  3G3Z A;  3K9T A;  3W3C A;  4D9J A;  2BY3 A;  3JR9 A;  1JUP A;  4BE1 A;  1BI3 A;  4KN4 X;  1MJA A;  5IP7 J;  2M30 A;  3BR1 A;  4WK8 F;  3BC8 A;  3FIW A;  2LKP A;  3ZQQ A;  3LAP A;  1FX7 A;  1MD0 A;  5CVU A;  5CVJ A;  1EKE A;  2NVU B;  2LY1 A;  5B5E C;  2WAQ A;  2GWR A;  1Z05 A;  2IGK A;  2F4M B;  2Y0S A;  4EV0 A;  1KYZ A;  3VB2 A;  2MC3 A;  2PBI A;  2R7S A;  1YYV A;  3OS0 A;  2R5Y A;  2BOL A;  2XVC A;  3I59 B;  1D3Y A;  1V5G A;  3L7W A;  4NQW A;  2XF7 A;  2RC4 A;  1IUY A;  2EZL A;  2MGQ A;  2DPU A;  4A5N A;  4OMY A;  3SZP A;  5EJC A;  2IS2 A;  5FLX R;  1U5T A;  3WU0 A;  1Z3X A;  3OIO A;  4A3K J;  2KKO A;  4CDG A;  2DT7 B;  2HQR A;  2ZNZ A;  4LFU A;  4BYY A;  2OZU A;  1FC3 A;  1Y56 A;  5EEA A;  4HV6 A;  5JFR A;  5J1U A;  1LNW A;  1YW9 A;  2L7Z A;  3RPU D;  5IT9 K;  1S6L A;  2Q2E A;  2B9S A;  3BPV A;  2BE5 F;  3JCU C;  2DA2 A;  3MVP A;  1ETQ A;  1RKT A;  5HS9 A;  3TBI A;  2EK5 A;  5H6Q A;  4Q5S F;  5E3N A;  3RKW A;  2JRM A;  1F43 A;  4CSW A;  5H2F C;  5LGT A;  4A3I J;  2IS1 A;  4I76 A;  3HOY J;  3D5R C;  4NDL A;  2GXA A;  2F5F A;  4XM3 A;  3DU6 A;  4NHJ A;  4CH7 A;  2H09 A;  4AYB A;  2HFH A;  2DQL A;  4EJW A;  2LOO A;  3BJ6 A;  1S72 I;  3IP4 B;  4ZDP A;  4L9T A;  4XOR A;  3BR2 A;  3H36 A;  3I5U A;  3PUB A;  2XPV A;  1WJC A;  2YR2 A;  3A0H C;  3GX4 X;  1K78 A;  4BGD A;  1KZH A;  2BW3 B;  2F5D A;  3F8M A;  4OAZ A;  1IC8 A;  3Q0W A;  1JT6 A;  3TDU C;  4FX0 A;  5CPR B;  1BI2 A;  2JJ7 A;  2XF6 A;  3Q3S A;  3TGN A;  4IF4 A;  4OIP F;  1OMI A;  1YS6 A;  4FE4 A;  3S2D J;  1G3T A;  1U3E M;  1XD7 A;  4DIQ A;  1D0Y A;  2V79 A;  2MZ4 A;  1MNM C;  5E1Z B;  1FYK A;  3GO5 A;  4O6J A;  2XGE A;  2L9V A;  4GDF A;  2D2W A;  2UXX A;  2JWT A;  3OL4 A;  3OR1 C;  3I56 I;  3LNQ A;  3LQQ A;  3DBR B;  1OCP A;  3ASO H;  3GW2 A;  5CQG A;  1Z0X A;  4YII A;  2LDU A;  3FXL A;  1NG6 A;  4B8X A;  2LBF A;  1FSH A;  2AQE A;  1X3Z B;  3KX2 A;  2E7X A;  3B02 A;  3LMM A;  2FJ1 A;  1UAA A;  3CUQ C;  2KFD A;  2F4I A;  3EUK L;  2F5E A;  3FMS A;  5A2Q K;  1UB9 A;  3ZPL A;  3ZGK A;  4ZYH A;  3KPH A;  1O7L A;  5FLV A;  3W2V A;  2NRA C;  2XAH A;  1WSU A;  2K85 A;  2MLG A;  3MD2 A;  3REO A;  4XON A;  1MZB A;  3CMM A;  4XRM A;  1FMV A;  2VT3 A;  3FXO A;  2LF8 A;  1IRX A;  2Y0M A;  2ECC A;  2CH0 A;  3A4C A;  3G73 A;  1T56 A;  4ENN A;  1SFU A;  3JSP A;  4C2T A;  2IA2 A;  2R7W A;  4M71 A;  4QTR A;  2HQN A;  2FXA A;  2A6T A;  2Y75 A;  2W85 A;  1YIT I;  3Q0V A;  2GIZ A;  3KP2 A;  2FU4 A;  3FMR A;  2DPD A;  1LB2 A;  4KT6 A;  3TMO A;  3CLQ A;  3SXY A;  3MFK A;  5M5X J;  1DQU A;  1WJF A;  1Y6I A;  4S04 A;  2HOT A;  4BH9 A;  3OOP A;  3JRE A;  1DU6 A;  1WJD A;  5DYM A;  4RGS A;  2LMD A;  3EYI A;  2E2I J;  4F7Z A;  2PMH A;  2ETH A;  2J5O A;  2QQB A;  2O9L A;  2X1D A;  1JKO C;  4ESJ A;  3K4M A;  3JRB A;  1IN5 A;  3FF5 A;  1ULY A;  4BBS J;  3DPL C;  4RB3 C;  3F9K A;  4MGR A;  1OCO H;  1P4W A;  1X1P A;  2ID6 A;  2DA7 A;  2EWN A;  4B3A A;  3Q9V A;  5F6F A;  1YI2 I;  2MG4 A;  2M35 A;  3ABK H;  4Q47 A;  4WWC A;  4LLL A;  4CGZ A;  1XMX A;  2V1D A;  1SFX A;  1U78 A;  3CF2 A;  1P7I A;  5J47 A;  5K7H A;  4G9Y A;  5CVR A;  1HDP A;  4QPO A;  1MBH A;  4EVI A;  2WAE A;  2XRN A;  3AG2 H;  2VPR A;  4PK4 A;  1VQ4 I;  3GBG A;  2CV2 A;  1S9H A;  4WF2 A;  3GYH X;  3OS2 A;  1LEB A;  3TOB A;  5IP6 A;  1BIB A;  3FWE A;  1MDM B;  1ETO A;  1AOY A;  2OV7 A;  1NK2 P;  3HOW J;  1EA3 A;  2A3S A;  3GVA A;  4N4O B;  1FOY A;  1TW2 A;  5EZH A;  3LA7 A;  1BR4 A;  1DU0 A;  3SYT A;  2L7M P;  3J81 Z;  1QVT A;  1XN7 A;  4D5F A;  1NG7 A;  2R7Z J;  3JAM K;  2ADU A;  5DD4 A;  1OPC A;  5LRR A;  2UZK A;  4EM2 A;  2D5V A;  2VB6 A;  2HXO A;  2Z3Y A;  3O2P E;  4G6T B;  2CUE A;  3HOX J;  2L7K A;  3O8G A;  1XMA A;  3A01 A;  1PP8 F;  3WGH A;  4NNJ A;  3LSJ A;  2DXI A;  2D45 A;  2HKX A;  3M4O J;  2L3D A;  3FXU A;  2IBD A;  2IA1 A;  2GXB A;  4A3C J;  1S8N A;  4HNT A;  4IOC F;  1OLT A;  3EPZ A;  3IH2 A;  3KIO A;  4Y52 J;  1X3U A;  2LRD A;  2E5Z A;  4I2O A;  4B4C A;  2JN6 A;  1BI1 A;  1K4T A;  3K69 A;  4IVN A;  4MO7 A;  2LR8 A;  4B09 A;  1F5T A;  1R4M B;  3E1S A;  3KYD B;  5FGM A;  4M3F A;  4F91 B;  1TT0 A;  2WC2 A;  2ZB9 A;  5J40 A;  3BR3 A;  3HSF A;  3ZP5 A;  5K7F A;  5FO5 A;  4F55 A;  2QLZ A;  4A3J J;  4HQE A;  2QSG X;  2AHQ A;  2DA4 A;  4GYI A;  2DFF A;  4ZYA A;  4BKX A;  1UZC A;  3J80 R;  2Z2S B;  4XN3 A;  2OD5 A;  4IHT A;  5LHG A;  1H9G A;  3TO6 A;  3ZQC A;  1J7K A;  2ESH A;  3GTG J;  2O6G E;  3UNG C;  4CYC B;  5E3O A;  3HHG A;  2XPU A;  1JKR C;  2MLK A;  4LOC A;  2ZC2 A;  4P55 A;  5IT9 R;  4N9H A;  3LSR A;  1MSF C;  1EF4 A;  4B47 A;  2EFO A;  4OIQ F;  3FM3 A;  4DOZ A;  4EM1 A;  4Y33 A;  5HS7 A;  3AL0 C;  2HVR A;  1XB4 A;  4B3X A;  4DBR A;  4ZDO A;  5D6F A;  4E6K G;  5F0C A;  3BTI A;  3OV8 A;  5LLQ A;  2M0C A;  1AWC A;  4RGU A;  5F04 A;  3L2V A;  1IO2 A;  2ZXJ A;  2WB1 N;  2CG4 A;  1BOA A;  2A5W A;  4HOB A;  4BDZ A;  1JE8 A;  5BNG A;  1NHA A;  2XGX A;  2D1H A;  4MEY F;  3CCS I;  1YJW I;  2KMU A;  2MA3 A;  4LG0 A;  3HRT A;  2DK8 A;  1R9T J;  1OQY A;  5K5R A;  3CES A;  1CF7 A;  1NK3 P;  3RPQ A;  4XRF A;  3BZ6 A;  1PVE A;  1X1B A;  4V19 K;  4MHG A;  4DNC A;  4G6Q A;  2X98 A;  3DEU A;  4UUT A;  1LEA A;  1SD7 A;  5M3M J;  4ENK A;  2IA0 A;  4M3D A;  4HNV A;  2E2J J;  1W1W E;  2K4J A;  2CUJ A;  2DO7 A;  5FD6 A;  2FQ4 A;  4E7J A;  4A3F J;  2XPW A;  3WOD F;  1IGN A;  4PJ0 C;  4PJJ A;  2E71 A;  4L0Y B;  3BCA A;  1W0T A;  2VIX A;  1ZH5 A;  3ZMV A;  1MGT A;  2HOA A;  3OY9 A;  1YHQ I;  5JR3 A;  1X58 A;  2MSY A;  2L54 A;  4ENM A;  3LSG A;  2L7F P;  1TWA J;  3A02 A;  2E1O A;  4CCJ A;  1R49 A;  1ZTR A;  2M3A A;  3BZC A;  1I27 A;  2QKL B;  3S8P A;  3UR3 C;  5HOD A;  3D1N I;  3J80 Z;  2KDO A;  1ETX A;  2RNJ A;  1GLN A;  1D8J A;  2STW A;  3CJQ B;  2FEZ A;  4BEH B;  3GLL A;  4HYE A;  1IV8 A;  4LG0 B;  3SJM A;  5GPC A;  2CUZ A;  2O03 A;  2PX9 A;  3K4C A;  1ETV A;  4I98 B;  2QEN A;  2XRL A;  4HPQ A;  1U8R A;  2JPC A;  5B1A H;  2Y30 A;  2JQ7 A;  3VYU B;  1A36 A;  3MN2 A;  3CJR B;  2HU9 A;  3TKY A;  4D5C A;  3WE2 A;  4D7N A;  2KIF A;  2AXL A;  2HYG D;  2IP2 A;  1LE8 B;  1XC5 A;  3O3K A;  2BXY A;  2EA2 A;  2VXD A;  4BAC A;  1O7F A;  3W6V A;  1Y8R B;  9ANT A;  1U0J A;  2X48 A;  4CCN A;  1FMW A;  1SAU A;  1R58 A;  1GV2 A;  3JW4 A;  4M73 A;  1EH7 A;  2CV0 A;  2JT1 A;  4S05 A;  2CMP A;  2R4G A;  3ROU A;  1FP2 A;  2WWY A;  2WV0 A;  2KRC A;  3CCQ I;  1JT0 A;  1BC7 C;  1TWF J;  2K7L A;  2FX0 A;  4P9U A;  1QNT A;  3V7R A;  5EGO B;  2K27 A;  2NNN A;  2VKE A;  2UV1 A;  3OYN A;  2Z9O A;  1D1B A;  2ZXI A;  3TP3 A;  3KCC A;  2I10 A;  1IN7 A;  4IPA A;  3OSF A;  1G4D A;  1A5J A;  1R71 A;  3HM5 A;  2CW0 F;  4NB5 A;  2O5R A;  2VOP A;  4ETS A;  2CQK A;  4B48 A;  2FMY A;  3CDL A;  3PQK A;  2KT0 A;  5F27 A;  3L2U A;  3MWM A;  2PI0 A;  2M0M A;  2STT A;  4BE0 A;  1FIA A;  1ZKG A;  1SAN A;  1U2W A;  4Q4Z F;  4M3B A;  4CA0 A;  3DKW A;  2VT2 A;  2VI6 A;  1PDN C;  1TWG J;  4HG2 A;  1I39 A;  3QYE A;  3A1Y A;  5ICG A;  5HNF A;  2XB0 X;  5BMZ A;  5LGN A;  1GDT A;  1YW7 A;  5CLS A;  1QZY A;  5EYR A;  5H6R A;  4IHX A;  2WB1 A;  2DA3 A;  3GFJ A;  3E3V A;  4CHU A;  1MBJ A;  1ZGW A;  2W57 A;  4ESB A;  1W7P B;  1LVA A;  3I53 A;  3CCV I;  2IVM A;  3OS1 A;  4HST A;  3KYL A;  1BOB A;  3OIP A;  3JTG A;  4F3Q A;  3GF2 A;  1EV7 A;  1GV5 A;  2CFO A;  2H1L A;  2V26 A;  2EJR A;  1MMS A;  3U1D A;  2BV6 A;  2PMZ N;  2VKD A;  5E3M A;  1YE9 A;  3JAM R;  3JRH A;  1ZG5 A;  1OR7 C;  1TW3 A;  2YUS A;  2QWW A;  4BS9 A;  1X1A A;  5D4R A;  3H35 A;  2IAI A;  2L4A A;  4RBO A;  3HXL A;  2F5C A;  4FAS D;  5ERI A;  1HA8 A;  4O3M A;  2HDD A;  1FOX A;  1QO0 D;  1QVU A;  2VE8 A;  3IC7 A;  5E79 C;  3FZV A;  3F72 A;  3MMY B;  1TNT A;  2KIQ A;  3BG6 A;  4LIV A;  4ZTF A;  1KQ9 A;  2DI3 A;  1P92 A;  1W5T A;  1RUO A;  2BEO A;  3VYS B;  3F23 A;  2KIM A;  5EG0 B;  4QWQ A;  5GAD J;  4CZC A;  3ABL H;  3KE2 A;  5KHD A;  2VBW A;  3M07 A;  2KRH A;  3L2Q A;  2OJE D;  1U9N A;  3OYJ A;  1FTZ A;  3CTA A;  5IY5 H;  3PO3 J;  2LNB A;  4PGG A;  3CCR I;  1EH6 A;  3WTS C;  3IAM 2;  4RM3 A;  5GAE J;  2VUM J;  2G9W A;  2LY2 A;  2QBY A;  2EIL H;  1DGR M;  4IRH A;  3E0J B;  1FYL A;  2E36 A;  4QPQ A;  2DTZ A;  4HX4 A;  3S3M A;  2MC4 A;  4I09 A;  2ME6 A;  2AS5 F;  3C2H A;  1WWX A;  1OYY A;  5L3D A;  2XF5 A;  2GM4 A;  3DLA A;  2MVT A;  2V7F A;  1XTA A;  3IHU A;  1QPM A;  3ML6 A;  3EET A;  3FXK A;  3G1L A;  2CW7 A;  2F5V A;  4UHT A;  3RZD J;  4BQQ A;  4XSZ F;  1I6H J;  4RM2 A;  1XS9 A;  2DCE A;  3FX3 A;  1VQ6 I;  2DA5 A;  2LK2 A;  2QM3 A;  3QP5 A;  1IRZ A;  3J7A O;  2ZXH A;  1FYM A;  3DCF A;  3I59 A;  4HLX A;  1XDU A;  3IH3 A;  1WH5 A;  3S1Q J;  3RZO J;  3AFH A;  4A0Y A;  2V6E A;  4E7Z A;  1WQ2 A;  1A6I A;  1YRN B;  3GTL J;  3NEU A;  5CJ9 A;  3HB9 A;  3PQJ A;  5HDG A;  1XPX A;  1TP4 A;  3AG4 H;  5EEG A;  2H8R A;  2E34 A;  3I54 A;  3DU5 A;  2DMQ A;  5J1Y A;  1KYW A;  4BJT A;  2R7F A;  2LKS A;  4EJV A;  5F1J A;  3BJO A;  4G8X A;  3BQZ A;  4U7B A;  1E3P A;  1X4O A;  3V4G A;  4UV8 A;  1TWC J;  3F8B A;  3T0Y A;  3HTS B;  2N8G A;  1H89 C;  4E4H A;  3BPX A;  1XCB A;  2W1O A;  2R7O A;  2PG4 A;  5FRN A;  1TWH J;  3NWS A;  1X3W B;  1HSJ A;  4HEA 2;  2MYS A;  3WU1 B;  2W7N A;  4XLP F;  3V7S A;  1V4R A;  3K70 D;  3FKI J;  1HST A;  3HYI A;  3QPS A;  4C2M J;  3PSF A;  2FNP A;  2M7B A;  5F64 A;  3RQ4 A;  3VFZ A;  4AID A;  2X9D A;  4C3I J;  5E1X A;  2G0E A;  3E7L A;  1X2N A;  2J5P A;  2BW3 A;  2QYO A;  2NNY A;  3FXR A;  3COA C;  4A93 J;  3H3Z A;  1HW1 A;  1SD5 A;  4U88 A;  2DYR H;  3BWG A;  1VQ9 I;  2CSO A;  4LLN A;  2EQR A;  5AIQ A;  3WTY C;  2OU2 A;  3ZMZ A;  2WAD A;  2K02 A;  2E1C A;  3QP6 A;  1O4X A;  1LFU P;  1RI7 A;  3MZY A;  3I4M J;  1K61 A;  4GFB A;  1YLF A;  1IN4 A;  4UVA A;  2LTP A;  1OR7 A;  2ZJP F;  1POG A;  3RTR A;  2HOS A;  1Y0N A;  3I58 A;  2DFH A;  2X1E A;  1SFO J;  3WTZ A;  1U6G A;  3PFY A;  3KZY A;  3CF5 F;  1ONV A;  2X6Y A;  1STZ A;  1S29 A;  4AIJ A;  4D1Q A;  2FOK A;  1UJ8 A;  4HV5 A;  2RDP A;  2GIV A;  3BLY A;  4N4N B;  3VYR B;  1ZRD A;  1HDD C;  3P9C A;  2X6O A;  4AIH A;  2QQ9 A;  1WKM A;  5E17 F;  2M1B A;  3WHC A;  1VQO I;  3HZJ A;  1KON A;  3BTL A;  2RN7 A;  5GTH C;  3H9G A;  3FK6 A;  2VAS A;  3LFK A;  5H20 A;  3CCU I;  1W5C C;  4YRV A;  3GCM A;  4KIF A;  5EDN A;  4RAY A;  2L5Q A;  2EPF A;  3E6D A;  3ZQF A;  2KPM A;  2X1C A;  5E8I A;  1BI0 A;  1N25 A;  2GAU A;  3ECH A;  3RQI A;  2DA6 A;  4AWX B;  3NWT A;  1LFP A;  3IH4 A;  4OIR F;  4CCL A;  1JGS A;  5ILV A;  1ODD A;  1PUF B;  1SC7 A;  1GXP A;  2Z1D A;  1GVD A;  1QQI A;  2WBM A;  4LJZ F;  3TED A;  2VL8 A;  2R7D A;  4HLY A;  2FRH A;  2LKX A;  2JTV A;  4B43 A;  5DDG A;  2Y9Z A;  5JLX A;  1XSX A;  3KET A;  3S2H J;  4M72 A;  4BQO A;  4L0Z B;  2MW8 A;  3JRF A;  2F6C A;  2JA6 J;  2W00 A;  3SQN A;  1BN5 A;  4U87 A;  2V1N A;  1FOW A;  5J6X A;  1HW2 A;  2K40 A;  3K0L A;  2JZY A;  4MNU A;  4BNC A;  5K1Y A;  1LJ9 A;  1W4M A;  2HQ5 A;  3U9G A;  4CZZ A;  1ERD A;  1HKQ A;  1HC8 A;  2K9L A;  2R93 J;  3MEX A;  2M4G A;  3L2W A;  4X0G A;  4HA8 A;  2P5L C;  2E1M B;  3PNT A;  4NC8 A;  4MFE A;  4EEF G;  1F9N A;  1VQP I;  1B9M A;  2XSD C;  4A3B J;  1ZR4 A;  4UY8 I;  1UMQ A;  1E2X A;  3S14 J;  1RKW A;  1T8I A;  3QOE A;  4U0V A;  1IAW A;  5FLX Z;  1MJB A;  1BM9 A;  4F93 B;  1T2K A;  1J09 A;  4XSX F;  4HQM A;  5K5Q A;  2DW4 A;  2H6B A;  1ZYR F;  3R6S A;  5KNL A;  1UHS A;  2V4J C;  3P5J A;  5C44 J;  4EJO A;  1BR1 A;  2R7X A;  5HS8 A;  2V1U A;  3J7A W;  5LHH A;  4Y15 A;  3H9Q A;  3G4S I;  5IT3 A;  5M5W J;  1X1C A;  3V8J A;  2EB7 A;  1IDY A;  4MQV A;  3FXM A;  3GZN B;  4M3G A;  3HIF A;  4M9X A;  4JX4 A;  4Y13 A;  4KMU X;  2O8X A;  4WXD A;  2V9P A;  1BL0 A;  1MDM A;  3ABU A;  3E6C C;  1IN8 A;  4RAF A;  2A68 F;  1KQ0 A;  3BJA A;  1UHM A;  4AVP A;  4P96 A;  3CMY A;  2OTJ I;  4WX9 A;  2FUG 2;  2XAS A;  1LDJ A;  5HDK A;  2ZJQ F;  4IZZ A;  4CCM A;  3S1R J;  3DEE A;  1D1A A;  4Q48 A;  1R23 A;  1DGW Y;  2LD5 A;  3GFL A;  1FNN A;  4ZYD A;  4YIR X;  3MKY B;  1R5I D;  2COB A;  1FTT A;  2BZT A;  4I0B A;  3E6B A;  4PGH A;  2PQ8 A;  1ON1 A;  3L09 A;  5AIP A;  2VXZ A;  5FKO A;  1S7E A;  5L3F A;  3DXJ F;  4RLF A;  2VON A;  4BUP A;  5JI6 A;  1BBY A;  2PN6 A;  5LRS A;  3P9K A;  1W5S A;  5D5X B;  3PFI A;  1RR7 A;  1TBX A;  5GPA A;  5B3S H;  3IAS 2;  3IRQ A;  4BY1 J;  2IS4 A;  2E5N A;  2HXI A;  4LB5 A;  2HWV A;  1VQ8 I;  3JRC A;  1OKR A;  3QRF F;  1RRJ A;  2P5K A;  3T5X A;  3DFG A;  3OIQ A;  2DT6 A;  1Z9C A;  4IHW A;  3PM1 A;  3IWZ A;  1HCR A;  3E97 A;  2CQQ A;  1VTN C;  3K4B A;  3BTJ A;  4EGZ A;  2HNH A;  1T98 A;  2EZH A;  1Z91 A;  4L5J A;  2VOD A;  5BS6 A;  4AD9 A;  2BBY A;  2HVS A;  2XGD A;  3KEQ A;  3WTV C;  1PUE E;  2EFP A;  3U21 A;  5DTD A;  3KZI C;  1YO5 C;  3CDH A;  4CYC A;  2I8D A;  3H5A A;  1YX5 A;  2V9K A;  2VQG A;  1QZE A;  2DA1 A;  1TQP A;  1IZ1 A;  3FKJ A;  3ZRG A;  3OYH A;  2YU3 A;  1Z67 A;  3OR2 C;  4A6D A;  1VQN I;  1S7O A;  3PSI A;  1JTY A;  4BAY A;  4F52 A;  3BOQ A;  3F6V A;  3S32 A;  5LEK A;  4BHB A;  3NAU A;  1AHD P;  4ZC3 A;  4HF1 A;  1X1D A;  1A04 A;  2IW5 A;  3FBI B;  1I50 J;  4UUV A;  5LEJ A;  2KQR A;  2ZXW H;  3DQV C;  4DZJ A;  2VJI A;  1RUN A;  4Y17 A;  1P6R A;  2LRE A;  3DV8 A;  4R8H A;  3EYY A;  3ZMT A;  2XUB A;  4I01 A;  5IPA A;  3OMY A;  3FM5 A;  5CQE A;  1GUU A;  4YFX F;  2OPT A;  4YFN F;  4EGY A;  4CIC A;  4X1E A;  5CVI A;  2IJL A;  4KYW A;  3ABT A;  1A31 A;  2ISY A;  5DS9 A;  1WI9 A;  2B63 J;  3V8L A;  2DJI A;  3HKZ N;  1EH8 A;  2BGC A;  1JGG A;  4L18 B;  1OIS A;  4KIC A;  4OAY A;  3HOV J;  4PSW A;  1MBK A;  4II2 A;  1A35 A;  3VDX A;  2QVO A;  5KK1 A;  4EJU A;  4KMF A;  2HVQ A;  2IGM A;  2GLO A;  1P4A A;  3DKX A;  1TC3 C;  2W84 A;  4TV7 A;  2A6H F;  4NC7 A;  1XGO A;  4XOT A;  2M8E A;  4E70 A;  1MMN A;  2E19 A;  3KLO A;  2JRT A;  5D4S A;  3A52 A;  2R7R A;  3WGG A;  1IF1 A;  4BQN A;  1JTX A;  5HLH A;  4C2U A;  1Y1V J;  2DMN A;  2Q8K A;  1ZRC A;  3M8J A;  2DJN A;  2DOE A;  3WGI A;  3LL7 A;  2DFE A;  3KP4 A;  4L5I A;  4BY7 J;  3U1K A;  4A69 C;  4M9S A;  5BPI A;  2PJP A;  4BEH A;  4P5O A;  4BJ6 C;  5D6E A;  1BIA A;  3I55 I;  4ENJ A;  2A61 A;  1F4K A;  1ZN2 A;  3M7G A;  5LGU A;  3HOS A;  1O3S A;  6PAX A;  3RYP A;  1N77 A;  3GTJ J;  2YPR A;  4XLC A;  1S5L C;  3VSK A;  3X2Q H;  4MLO A;  4M74 A;  1G3W A;  1LE8 A;  2MH9 A;  3BR5 A;  4XOP A;  5CKT A;  3OYL A;  3D5S C;  5CYV A;  2UWM A;  4JQF A;  1IXS B;  2ZSH B;  1B59 A;  1HOM A;  4RDU A;  2ZBK A;  2HDC A;  4E7S A;  2DOF A;  4AVZ A;  2FQ3 A;  4E7H A;  2P0T A;  2VKH A;  4XK4 A;  2EIN H;  3P9I A;  1BR2 A;  1HQC A;  1MBG A;  3JRA A;  2NVY J;  2EBI A;  3WU2 C;  5EEH A;  4FET A;  5M3F J;  1XG1 A;  4A3L J;  2FNA A;  3KYC B;  5EGO A;  1G8X A;  4IKF A;  3I9V 2;  4A3D J;  2TCT A;  2B0L A;  1K79 A;  1JKP C;  2NS0 A;  2X4H A;  4R1H A;  3F22 A;  3I4P A;  2DDA A;  2ZKZ A;  3MZH A;  3F8F A;  5TJJ A;  3H3U A;  1RR8 C;  5A2Q R;  5F1R A;  2EH3 A;  4G6D A;  4HSR A;  4CCO A;  1LDK B;  3KFW X;  5FRM A;  3ABM H;  4F92 B;  1XSD A;  1BC8 C;  5K5O A;  5DUI A;  2P6S A;  1LDD A;  2NS8 A;  3PL8 A;  5IT9 Z;  2FBI A;  3PNV A;  3CQZ J;  1R36 A;  1UEL B;  4AC0 A;  3MQ0 A;  1WVR A;  1E0E A;  2R3S A;  1FLI A;  1FZP B;  2UUZ A;  3H5R A;  4NC6 A;  3RIR A;  3L00 A;  1VND A;  2FOW A;  1WHU A;  3HBL A;  3K70 C;  2LFB A;  4ABZ A;  3BR0 A;  1ZAO A;  4ANJ A;  3I4N J;  2HZT A;  2VQH A;  1ZHF A;  2GBY A;  3LSK A;  2XRO A;  4PFP A;  3TO7 A;  1W7P A;  3HRS A;  5HDN A;  2DBB A;  4PUS A;  2M87 A;  4YEJ A;  4AU7 A;  2KJC A;  1Z3Y A;  4XID A;  1ITY A;  2CYY A;  3CCJ I;  1IXR C;  1WCM J;  2Z5U A;  4PDK A;  3G2B A;  2DMT A;  1PP7 U;  2DQR A;  3CO7 C;  1IXC A;  1XDS A;  2AXT C;  2QKM B;  4KIT B;  2O3F A;  3ZN0 A;  4GCV A;  3HKZ A;  2LH9 A;  2IPQ X;  2CRG A;  3BG7 A;  4JP0 A;  3LSP A;  3S3O A;  3W6K B;  4O5V A;  1UCR A;  3C3W A;  3N05 A;  3DBH B;  1J5Y A;  1T0F C;  3CZ6 A;  2QQ8 A;  4LD5 A;  4DQ2 A;  3CCE I;  1C0W A;  4RB2 C;  3AG3 H;  2ELK A;  5DM6 F;  3KP7 A;  4IXA A;  3ZOB A;  1SMY F;  1TQM A;  2EFQ A;  1JUS A;  1ZAR A;  1LUJ B;  2A07 F;  5EG0 A;  4XKB A;  1D5V A;  1JUM A;  4BQA A;  4MEX F;  2M34 A;  1WJA A;  3WE3 A;  3R61 A;  2QF7 A;  1LVK A;  3RJP A;  3BRO A;  1XSV A;  2BY0 A;  1W7P D;  1TTY A;  2X6X A;  4K2E A;  3RKY A;  3JSO A;  4EJT A;  2DDB A;  3SZG A;  2M7A A;  2EFW A;  4LK0 F;  2XKP A;  4HRI A;  5BPD A;  3H0G J;  3TOA A;  2OCC H;  2YX7 A;  4OU0 A;  5A2Q Z;  4BHC A;  2JA5 J;  5KVR A;  2X6W A;  1R7J A;  1MH4 A;  4L9N A;  2JSP A;  2PMU A;  4LG3 A;  2OTL I;  3PNY A;  2ZSI B;  4CO8 A;  2A05 A;  4IO9 F;  1FIP A;  2MAB A;  2W82 A;  1RET A;  4BXF A;  2HTS A;  2VKV A;  1ZQ3 P;  3W2A A;  2KIU A;  3K4K A;  4DJA A;  4AM3 A;  1ETY A;  2ZJ2 A;  3CP2 A;  1UHW A;  2E1M C;  2QEX I;  4JK1 X;  2NOJ B;  3OYD A;  2DT5 A;  3FMQ A;  3SEQ A;  4RB0 A;  4BU2 A;  2H1K A;  3HRU A;  3HEF A;  3DBL B;  5D8K B;  3F8N A;  3QU6 A;  3FK7 A;  4LIT A;  2JVG A;  3CC2 I;  2F48 A;  1YRN A;  3D0S A;  1BJA A;  4G94 A;  3CCL I;  1Y8Q B;  3DP7 A;  3J81 K;  4PJN A;  4W97 A;  2PJR B;  2L01 A;  1OCZ H;  1UST A;  5F08 A;  1V55 H;  4ITV A;  2VQL A;  3WG7 H;  2VN2 A;  3JRD A;  3ZCO A;  4XLA A;  3DTE A;  2EV0 A;  2Z33 A;  3VWB A;  1N75 A;  2JSC A;  3HDD A;  2P81 A;  5JLW A;  3K4J A;  4CYD A;  5LFA A;  1KU2 A;  3BR6 A;  1Z77 A;  3RCO A;  3E6M A;  3ZMD A;  3B6A A;  4C9Y A;  2W48 A;  4PSX A;  4DYC A;  4XKC A;  3RSN A;  3GXO A;  2TDX A;  1JJ8 C;  2JMW A;  4A2U A;  2K9S A;  2XC7 A;  4G7O F;  1F36 A;  2QQA A;  3DWL E;  3NRV A;  4A0X A;  1ZG3 A;  3ZN1 A;  3LWF A;  3LSM A;  3TDZ C;  3KP3 A;  1B8I B;  1WH7 A;  1I1S A;  2E60 A;  4HDU A;  2OQR A;  4PZJ A;  2E2H J;  2O0Y A;  2RV8 A;  4KIG A;  5JHU A;  2X51 A;  4HX7 A;  2KZV A;  4IHY A;  1GXQ A;  1MW7 A;  1XX5 A;  2M4K A;  3EDP A;  2OF7 A;  2OUM A;  4N0B A;  5KCM A;  1LQ1 A;  1TNS A;  4XKW A;  3V42 A;  3EQL F;  4KIS A;  2CW8 A;  1YW8 A;  2LSO A;  4ZTJ A;  5HLI A;  3JAM Z;  3H1C A;  4R79 A;  3BG5 A;  5HLG A;  3N4M A;  3GZ5 A;  1YQA A;  3OYE A;  5CVV A;  2CWE A;  2ZFW A;  4P9F A;  2QCO A;  2HPM A;  2YX4 A;  4EMS A;  1E17 A;  1WRJ A;  3OL3 A;  3ZXS A;  2VBX A;  2Q0O A;  2HPI A;  1RIO H;  1HW5 A;  2CV1 A;  4H4K C;  3ESW B;  5DD8 A;  2KZG A;  4CUG A;  3LSH A;  1U9O A;  3C2B A;  1SFE A;  2OBP A;  4IQ4 A;  4JOM A;  3FIS A;  4RGR A;  1T0F A;  1XGS A;  1H9T A;  1MND A;  3LA3 A;  3JRG A;  3R0A A;  2HQA A;  1SFK A;  5FJ8 J;  3TP0 A;  4IOA F;  1BA5 A;  4Y4R A;  5ILS A;  1V5E A;  1R22 A;  2W4S A;  4EAT A;  5ED4 A;  4HBL A;  1YIJ I;  1K4S A;  1Y1W J;  2FBH A;  2WTE A;  5L3G A;  4E7L A;  2H27 A;  2KL4 A;  1Q1V A;  3EUH C;  5E20 A;  2P8T A;  5DV5 A;  2GA2 A;  2PFB A;  2IT0 A;  2R92 J;  2NVX J;  5DM7 F;  1SVM A;  1G3Y A;  4DGW B;  2HYF A;  3OYB A;  3ZQL A;  3IKV A;  5D5U B;  5IP9 J;  1P7J A;  3KZZ A;  4JBA A;  1UG2 A;  3FBN B;  3SDB A;  4IRG A;  3BQY A;  3L2R A;  2V1X A;  1H88 C;  4X6A J;  1PUF A;  1RQ6 A;  3T8R A;  1YX3 A;  2GXG A;  3HPG A;  3KLN A;  1V54 H;  4GXO A;  4U7D A;  4RMN A;  2PMZ A;  4EQQ A;  3SEZ A;  4UUS B;  2EA4 A;  1JJ6 C;  5K7Z A;  4LLG F;  3M8F A;  2DMP A;  1KGS A;  2IRF G;  2L0K A;  1FBU A;  5LBQ A;  3IRR A;  1WZ2 A;  2ZME B;  4A3M J;  1USS A;  2LLK A;  2HEO A;  4IX7 A;  5FLM J;  3L9F A;  5ILU A;  1D8K A;  3SHF A;  2XV4 S;  3M9A A;  3U2R A;  4MTD A;  1MH3 A;  2ZFU A;  5FD5 A;  5FKL A;  3J80 K;  1IV6 A;  2K3F A;  2ELJ A;  1B72 B;  3K10 A;  4CXF A;  1R1V A;  3OYI A;  3IV5 A;  1F1Z A;  5F0H A;  4EM0 B;  2BVM A;  2OC6 A;  4XIC A;  5IYD J;  3C1D A;  4UB8 C;  2AO9 A;  3DKY A;  3BTC A;  4LK1 F;  1W0U A;  1R5G A;  3BCB A;  3HSR A;  4WXC A;  1VQ7 I;  2LG4 A;  5FFZ A;  3CO6 C;  1OCR H;  1G3S A;  1W36 D;  1K7A A;  1U8B A;  5J1R A;  3CP8 A;  2K9Q A;  3MAJ A;  3C18 A;  2GQQ A;  3OSG A;  4PFO A;  1ZRE A;  2H6C A;  2DOD A;  1AKH A;  4ZJZ A;  3M3Y J;  4IHV A;  3FXJ A;  3HOU J;  1AU7 A;  3VYT B;  5FKN A;  3R4K A;  4MQ9 F;  1HLV A;  1ZGJ A;  2VBY A;  4ZH4 F;  3AKZ A;  1BJZ A;  1K6Y A;  2COM A;  2FSW A;  1AA7 A;  2EIM H;  2KIS A;  4ZYG A;  4YG2 F;  1WJ5 A;  4XBF A;  3AG1 H;  4I6Z A;  2K9N A;  3H9J A;  2VC0 A;  3QYB A;  2CS3 A;  1Z6T A;  2Y31 A;  1JHH A;  1D0X A;  1KU7 A;  4OIN F;  2R5Y B;  2JA8 J;  1JKQ C;  4FE7 A;  4HNU A;  1I6X A;  3E5U A;  1ZRF A;  2P7V B;  4NQW B;  2V6C A;  1OCC H;  2KDZ A;  3SZT A;  5TIS C;  4A5M A;  3RKX A;  1P9Q C;  2L02 A;  2R7Q A;  4HF2 A;  3OOU A;  2FBK A;  5BOX A;  1U5T B;  1ZEL A;  5D5W B;  2EZI A;  2R7U A;  2RGV A;  4PCQ A;  1Z21 A;  4RS8 A;  1BW5 A;  2V9V A;  4NUB A;  2HGC A;  4KA4 A;  5HLT A;  1R5H A;  5GAG J;  5GAH J;  4HZF A;  1Y39 A;  2ZNY A;  2EFN A;  4GGG A;  2ZO4 A;  1WGX A;  2BHY A;  2B7E A;  2R7T A;  2X85 A;  2CQN A;  2Q2E B;  1D1C A;  3ECO A;  2BYV E;  3QAH A;  2VE9 A;  1APL C;  2JA7 J;  4GYG A;  3RDI A;  4XLH A;  3QOP A;  3ULQ B;  1AKH B;  1WI3 A;  1OCT C;  3EUA A;  3S15 J;  4Z2Y A;  1DP3 A;  1VI0 A;  1HKT A;  4MIM A;  4E7I A;  1T33 A;  3F3X A;  1VQL I;  4FCY A;  2RVC A;  2IS6 A;  5E3L A;  1ZK8 A;  3VOE A;  1EJ9 A;  3J81 R;  4A12 A;  2HOE A;  2JPB A;  4YFK F;  1Z7U A;  3TL4 X;  1TLH B;  4YEL A;  2VJJ A;  3EUH A;  1REP C;  4U0Y A;  1K78 B;  3CJN A;  2TRT A;  1VQ5 I;  2JK3 A;  3CCY A;  1ORK A;  3QOD A;  3DTI A;  2ME0 A;  4OOI A;  4G7Z F;  3ZMU A;  2EIK H;  3OYA A;  4QLC U;  1RZ4 A;  3L2C A;  2C6Y A;  2ID3 A;  3BG9 A;  2P0W A;  4G12 A;  1ZG1 A;  2BHZ A;  3LSI A;  4M3E A;  3R60 A;  4AUX A;  2RKH A;  5ICE A;  3OYC A;  2GOX B;  3HPH A;  1L0O C;  1MMA A;  2DYS H;  1B1B A;  2E7W A;  1FEX A;  3OYG A;  2HI3 A;  3G1M A;  1O3Q A;  1HXD A;  4BJ5 C;  1VZ0 A;  1KU3 A;  3HL2 A;  2VJ5 A;  3SDG A;  4C3J J;  4XMY A;  4FTH A;  2BY2 A;  2Z99 A;  4LGW A;  3MCZ A;  3PJR A;  4UV9 A;  4MFD A;  2MD5 A;  3FXQ A;  1FPQ A;  2LBF B;  3WHB A;  4ESF A;  1WFX A;  4XKV A;  2ACJ A;  4LB6 B;  4Y7N J;  1H0M A;  2MD0 A;  1VF9 A;  2DAO A;  1OFC X;  3S3N A;  5ICF A;  2WA0 A;  2LF7 A;  3S2W A;  2VPL A;  2E1N A;  1SEU A;  3GFI A;  1A6Q A;  1CQT A;  1Q1H A;  5LHI A;  5B66 C;  2VLA A;  3Q5F A;  2DOA A;  4IHS A;  2OAZ A;  5TRD A;  4XLN F;  1ENH A;  3ZMS A;  1S7A A;  1QHH D;  2IXS A;  2ELH A;  2DK5 A;  4GRI A;  2W25 A;  2O8K A;  3OYF A;  1SAX A;  1QZZ A;  1X19 A;  5D5V B;  4OMZ A;  3OYM A;  3K7A J;  2KRF A;  2JA2 A;  3K4L A;  3M1C A;  1ZR2 A;  5JHF A;  2ISZ A;  2HKO A;  1QHG A;  3HSE A;  1RC9 A;  1T95 A;  1P4X A;  2VJ4 A;  2ECB A;  4WCG A;  1ZGA A;  4AIK A;  4DYR A;  1GVJ A;  1O3T A;  2MH2 A;  5E8G A;  3HUG A;  2XGC A;  1QPI A;  2XDV A;  1FSE A;  2Z16 A;  1B9N A;  4M6X A;  2G7H A;  3ZR8 X;  5C4X J;  3DLL F;  3ZQ7 A;  3QQA A;  1Z1D A;  5KAI C;  1YJN I;  2Y9Y A;  2OCE A;  1Y0U A;  3ASN H;  5FB2 A;  3DTK A;  4GO1 A;  4UNO A;  2G7U A;  4FIS A;  3LOC A;  3S17 J;  1MJ9 A;  3HJE A;  1MKM A;  4BXU A;  2MFZ A;  1XGM A;  4M6Y A;  2HTJ A;  1RNL A;  1KQ8 A;  3LQR A;  3VSL A;  5IYC J;  3O6B B;  3QPH A;  5B1B H;  2K9M A;  4FT8 A;  4J01 A;  2ZJR F;  3I0T A;  1YG2 A;  1MNE A;  3NQO A;  3SFZ A;  3Q0U A;  3H3V K;  1YTY A;  2OQG A;  1R6R A;  3S1N J;  2KP6 A;  2NOG A;  4LMY A;  5IOZ A;  4XNF A;  4H0E A;  2F4O B;  3V7C A;  2BXZ A;  3GZ6 A;  2UXN A;  4DYQ A;  2ZCW A;  2FA5 A;  3K6G A;  1ON2 A;  4RAG A;  4HX8 A;  5JVG F;  2CUF A;  1TL8 A;  5HOO A;  2P6T A;  3BDD A;  3BG3 A;  2LP0 A;  3BT9 A;  3RKQ A;  1QU3 A;  4L9V A;  2DMU A;  1PYV A;  5EZG A;  2FF4 A;  3HUG B;  3IKT A;  5FKK A;  1TZL A;  5J8F A;  5GTI C;  2QZ8 A;  4XLE A;  2LYC A;  2RQQ A;  2YU9 J;  3VEP A;  1HF0 A;  3CUQ A;  2QSF X;  2H94 A;  1HBX G;  3DPT A;  2BVL A;  3HC7 A;  4RGX A;  2PLY A;  4A6E A;  3HGY A;  4HF0 A;  1N78 A;  1ETW A;  1RPW A;  5E1W A;  4BDY A;  1SD4 A;  1VQM I;  1R00 A;  4B44 A;  1T39 A;  2LVS A;  1SMT A;  2DFI A;  3FHN A;  1MIJ A;  3A01 B;  4LIU A;  3C2G A;  5AON A;  2GZW A;  2CJJ A;  2NAZ A;  2XAG A;  1YOV B;  1G2H A;  2JUC A;  4XL9 A;  4B1R A;  4PJM A;  4DBQ A;  2NXN B;  3MKW B;  4J19 A;  3ZQH A;  2BY1 A;  3PUF A;  1X4P A;  2M9H A;  1E3O C;  1PJR A;  1O3R A;  2YSR A;  2NVT J;  4I0A A;  4YIF A;  3NAR A;  2M5W A;  3GTO J;  3DEW A;  5L3E A;  3CCM I;  2W24 A;  1KU9 A;  1GT0 C;  1L3L A;  1SVO A;  2IGN A;  2XHK A;  3I3L A;  2HZD A;  2IEK A;  1MMG A;  3N97 A;  3A03 A;  1G59 A;  4OIO F;  1ZLK A;  2AQF A;  3OWT A;  2WY8 Q;  3FDY A;  3PO2 J;  1TT5 B;  4RA2 A;  3PIO F;  4A0Z A;  2L9S A;  1J59 A;  1XCV A;  1K6O A;  1G6N A;  2M45 A;  2R5Z A;  2K86 A;  1DDN A;  3GTQ J;  1P2F A;  3CUQ B;  3HTU A;  4A3E J;  2NVQ J;  1WJB A;  4DW6 A;  4J00 A;  3I64 A;  1XGN A;  2FE3 A;  2DTR A;  4P1W A;  2XAU A;  5DUK A;  4ASN A;  2OZ6 A;  2A69 F;  2GA1 A;  2MUN A;  1FP1 D;  1NTC A;  4CCK A;  1FBQ A;  2EV5 A;  1T38 A;  4FX4 A;  2R7V A;  1HKS A;  5DCF A;  1IJW C;  4UVB A;  4V2G A;  1K83 J;  3LAJ A;  4U0W A;  4E7K A;  1GHC A;  1FOK A;  1RES A;  3K2A A;  3CC4 I;  3IWF A;  3WTW C;  3K1N A;  1SVL A;  2E35 A;  3GFM A;  2DU9 A;  2K5C A;  1R1U A;  2HYJ A;  2RNG A;  4L9J A;  1R4N B;  2PEX A;  3F8C A;  3W6J B;  1DUX C;  2CQ7 A;  4PJL A;  5BQT A;  5HNH A;  3IUO A;  2VC1 A;  1IN6 A;  1MBE A;  4D0P A;  4A3G J;  3I71 A;  5FRO A;  4KT5 C;  5FLX K;  2XAF A;  1T08 B;  1JXS A;  2O7O A;  1B6A A;  1CF7 B;  5L3B A;  5J8C A;  3GTP J;  4Z6Y A;  5DEQ A;  3F21 A;  3J7Z I;  3O8H A;  2P5V A;  3CDI A;  5L3C A;  4HAM A;  1B4A A;  3BY6 A;  4IL6 C;  1I5Z A;  4WXH A;  4XR6 A;  3J7A Y;  3UKG A;  2ZME C;  3S1M J;  4BE2 A;  2M2E A;  2ICW G;  1V5F A;  1KA8 A;  3WTU C;  2R5Z B;  1E3H A;  3J7Y J;  4IEJ A;  3T8T A;  1J2X A;  3M8E A;  4OWR B;  2I5U A;  2Y2Z A;  3CC7 I;  3QU3 A;  4BXX J;  4KIB A;  4MTE A;  2CQX A;  3VOD A;  4L5E A;  4UXN A;  2P7C B;  3HHH A;  4II3 A;  1H8A C;  4I99 C;  3E5X A;  5J3L A;  2CU7 A;  3A0B C;  4M6V A;  5F0F A;  3CD6 I;  1DP7 P;  3WTX C;  5ICC A;  5C3E J;  2Y69 H;  4N9I A;  2PJR A;  4QSH A;  2RAE A;  3AAF A;  1W36 C;  2YS9 A;  4RAZ A;  4D7M A;  3H0D A;  1M1E B;  3S16 J;  4NBQ A;  1NH3 A;  2QSH X;  3KEO A;  4I02 A;  3QPL A;  1FT9 A;  2ESN A;  2HR3 A;  4FHT A;  1R1T A;  1LKX A;  3G71 I;  3DPU A;  4W1U A;  2XB5 A;  2QUF A;  2VQC A;  4C30 A;  1Z7L A;  3WG9 A;  2L9R A;  3G1O A;  3ISP A;  3RYR A;  4HW0 A;  2RRE A;  5DCM A;  4ON0 A;  3GTK J;  2A5Y B;  2KJB A;  4BBR J;  1LPQ A;  2QA4 I;  3ELK A;  4S0H B;  1YFH A;  1I3Q J;  2XKO A;  4KN7 X;  4KUM A;  3K4N A;  1I1G A;  3JRI A;  5IOY A;  4ZYE A;  3H92 A;  4BL0 B;  1J75 A;  3VPR A;  4ZDL A;  2O61 A;  1B8I A;  2WAQ N;  4XN0 A;  3K2Z A;  2Y0S N;  1IDZ A;  2MBF A;  3BZK A;  1J9I A;  3BP8 A;  3QPT A;  3HGG A;  5C4J J;  4IJA A;  4RLQ A;  4QIW N;  1U5T C;  2M8G X;  3B6C A;  3GUD A;  2K4B A;  1BW6 A;  5IYB J;  1VFC A;  3TW7 A;  5FKM A;  2XIG A;  4IQJ A;  1T6S A;  1UFM A;  3LST A;  5LD2 C;  5JVT A;  2F2E A;  1FWZ A;  1O57 A;  1XMK A;  5TGT A;  3F6O A;  1FJL A;  1DPU A;  4FQG A;  4I7H A;  3OYK A;  2KHM A;  1V3F A;  3CJT B;  5HVQ C;  2QGU A;  2P4W A;  2IGO A;  2XAQ A;  2XSJ C;  4XLF A;  3V8K A;  3MZ8 A;  2WV1 A;  1OYW A;  2Q1Z B;  3RI4 A;  1Z6R A;  4XQF A;  2JVH A;  1IUF A;  1FY7 A;  1TQI A;  2CFX A;  1X2M A;  4DZP A;  1JHF A;  3CLO A;  3P7N A;  3ZQG A;  5DCM B;  1OJL A;  3QYF A;  2K3P A;  3ONQ A;  1UG0 A;  2VBZ A;  1QRY A;  1ACI A;  3AL0 B;  3GWZ A;  4UVC A;  4UB6 C;  3WTT C;  3GLX A;  1FBS A;  4AYB N;  1QA6 A;  1VQK I;  5GP9 A;  4KNY A;  2GOM A;  1I3A A;  2OA4 A;  5FFX A;  3F0C A;  2LY9 A;  3MKZ A;  4KFC A;  4ZZL A;  3G6E I;  1YIO A;  2CGP A;  1D5Y A;  2NS7 A;  3TO9 A;  4BHP A;  3H5N A;  1CGP A;  1YS7 A;  3SFI A;  2DLL A;  1JI8 A;  1QGP A;  3HRM A;  3DF8 A;  3KP5 A;  3IL2 A;  4HDV A;  3T1B A;  2EIJ H;  4ZZD A;  3CMA I;  1MSE C;  4M9Z A;  3A2K A;  5KAF C;  1WJE A;  2KLO A;  3Q9S A;  2L4M A;  3K1M A;  2LC2 A;  5M5Y J;  4UUS A;  4IRI A;  1S3J A;  2L2O A;  5D8L B;  5EF6 A;  3KEY A;  3E5Q A;  2XAJ A;  3ERM A;  3M1E A;  4JX6 A;  2D1V A;  3HOT A;  2NYX A;  2RQP A;  2FML A;  2ZME A;  1IG7 A;  5E18 F;  3GME A;  4RB1 A;  3GEZ A;  3TQN A;  5J4V A;  3S93 A;  1MBF A;  4XRS A;  3W2W A;  4KDP A;  3C7J A;  2VOO A;  1WPK A;  2DN0 A;  2EZK A;  3B73 A;  2WAF A;  3R0J A;  1ZLJ A;  3MKL A;  3PIP F;  3LFU A;  1IRG A;  1YJ9 I;  2L9N A;  1B72 A;  1QBJ A;  4V2F A;  3JTH A;  1OYI A;  3QWL A;  3CME I;  2WY7 Q;  1D0Z A;  2HDW A;  4XRS G;  1DPR A;  4C3H J; 
#chains in the Genus database with same CATH homology
 3D5L A;  1IW7 F;  2QBY B;  2EV6 A;  2X0L A;  2A6E F;  3FHZ A;  2HS5 A;  4G7H F;  3RPU A;  3ERE D;  3CUO A;  2CO5 A;  2Y48 A;  1J0R A;  3KP6 A;  1SD6 A;  3LA2 A;  3K1P A;  3K9T A;  1IRF A;  3G3Z A;  1BI3 A;  4KN4 X;  1MJA A;  2M30 A;  4WK8 F;  2LKP A;  3LAP A;  1FX7 A;  1MD0 A;  5CVU A;  5CVJ A;  2GWR A;  1Z05 A;  4EV0 A;  1KYZ A;  3VB2 A;  2MC3 A;  2PBI A;  1YYV A;  2XVC A;  3I59 B;  1D3Y A;  3L7W A;  4NQW A;  1IUY A;  2RC4 A;  2DPU A;  4A5N A;  4OMY A;  3SZP A;  1U5T A;  3WU0 A;  2KKO A;  4CDG A;  2HQR A;  2ZNZ A;  4LFU A;  4BYY A;  2OZU A;  1FC3 A;  4HV6 A;  5JFR A;  1LNW A;  1YW9 A;  5IT9 K;  1S6L A;  2Q2E A;  3BPV A;  2BE5 F;  5HS9 A;  2EK5 A;  5H6Q A;  4Q5S F;  3RKW A;  5LGT A;  2F5F A;  4NHJ A;  2H09 A;  2HFH A;  2DQL A;  4EJW A;  3BJ6 A;  4L9T A;  3I5U A;  2YR2 A;  3GX4 X;  1K78 A;  2F5D A;  3F8M A;  3TDU C;  4FX0 A;  1BI2 A;  3TGN A;  4IF4 A;  4OIP F;  1OMI A;  1YS6 A;  1G3T A;  1U3E M;  1XD7 A;  2V79 A;  5E1Z B;  1FYK A;  3GO5 A;  4O6J A;  2D2W A;  2UXX A;  3LQQ A;  3GW2 A;  4YII A;  2LDU A;  4B8X A;  1FSH A;  2E7X A;  3B02 A;  3CUQ C;  3FMS A;  5A2Q K;  2F5E A;  1UB9 A;  3ZPL A;  4ZYH A;  1O7L A;  2NRA C;  2XAH A;  1WSU A;  2MLG A;  3REO A;  1MZB A;  2VT3 A;  2LF8 A;  2Y0M A;  3G73 A;  4ENN A;  1SFU A;  3JSP A;  2IA2 A;  4M71 A;  2HQN A;  2FXA A;  2Y75 A;  2W85 A;  3KP2 A;  2FU4 A;  3FMR A;  2DPD A;  1LB2 A;  3SXY A;  3MFK A;  4S04 A;  4BH9 A;  3OOP A;  5DYM A;  4RGS A;  3EYI A;  4F7Z A;  2PMH A;  2ETH A;  2J5O A;  2QQB A;  4ESJ A;  1IN5 A;  3FF5 A;  1ULY A;  3DPL C;  4RB3 C;  4MGR A;  1P4W A;  2EWN A;  3Q9V A;  5F6F A;  4Q47 A;  4WWC A;  4LLL A;  4CGZ A;  2V1D A;  1SFX A;  1U78 A;  4G9Y A;  5CVR A;  4EVI A;  2XRN A;  4WF2 A;  3GYH X;  1LEB A;  3TOB A;  1BIB A;  3FWE A;  1MDM B;  1AOY A;  2A3S A;  3GVA A;  1TW2 A;  3LA7 A;  3J81 Z;  1XN7 A;  3JAM K;  2ADU A;  5DD4 A;  1OPC A;  5LRR A;  2UZK A;  4EM2 A;  2Z3Y A;  3O2P E;  1XMA A;  1PP8 F;  3WGH A;  2D45 A;  2HKX A;  2L3D A;  3FXU A;  2IA1 A;  2GXB A;  1S8N A;  1X3U A;  4I2O A;  1BI1 A;  3K69 A;  4IVN A;  4B09 A;  1F5T A;  5FGM A;  2WC2 A;  3HSF A;  3ZP5 A;  5FO5 A;  2QLZ A;  4HQE A;  4GYI A;  2OD5 A;  4IHT A;  5LHG A;  1H9G A;  3TO6 A;  1J7K A;  2ESH A;  2O6G E;  3HHG A;  2MLK A;  4P55 A;  4N9H A;  2EFO A;  4OIQ F;  3FM3 A;  4EM1 A;  5HS7 A;  1XB4 A;  5D6F A;  3OV8 A;  5LLQ A;  1AWC A;  4RGU A;  2ZXJ A;  2CG4 A;  1BOA A;  4HOB A;  1JE8 A;  1NHA A;  2XGX A;  2D1H A;  4MEY F;  2MA3 A;  4LG0 A;  3HRT A;  2DK8 A;  5K5R A;  1CF7 A;  3RPQ A;  4XRF A;  3BZ6 A;  4MHG A;  4DNC A;  4G6Q A;  3DEU A;  1LEA A;  1SD7 A;  4ENK A;  2IA0 A;  2K4J A;  2DO7 A;  5FD6 A;  3WOD F;  4L0Y B;  1ZH5 A;  3ZMV A;  1MGT A;  5JR3 A;  2L54 A;  4ENM A;  1I27 A;  3J80 Z;  2RNJ A;  1D8J A;  2STW A;  2FEZ A;  4HYE A;  4LG0 B;  2O03 A;  4I98 B;  2QEN A;  1U8R A;  2JPC A;  3TKY A;  3WE2 A;  2KIF A;  2AXL A;  2HYG D;  2IP2 A;  3O3K A;  2EA2 A;  1O7F A;  1R58 A;  3JW4 A;  4M73 A;  1EH7 A;  2JT1 A;  4S05 A;  3ROU A;  1FP2 A;  2WWY A;  2WV0 A;  1BC7 C;  2K7L A;  4P9U A;  1QNT A;  3V7R A;  2K27 A;  2NNN A;  2Z9O A;  3KCC A;  4IPA A;  1IN7 A;  1G4D A;  2CW0 F;  4NB5 A;  2VOP A;  4ETS A;  2CQK A;  2FMY A;  3PQK A;  3MWM A;  2PI0 A;  2STT A;  1U2W A;  4Q4Z F;  3DKW A;  2VT2 A;  1PDN C;  5ICG A;  5BMZ A;  5LGN A;  1YW7 A;  5CLS A;  1QZY A;  5H6R A;  3GFJ A;  3E3V A;  4CHU A;  2W57 A;  4ESB A;  1W7P B;  1LVA A;  3I53 A;  2IVM A;  3JTG A;  3GF2 A;  1EV7 A;  2EJR A;  3U1D A;  2BV6 A;  1ZG5 A;  1TW3 A;  5D4R A;  2QWW A;  2L4A A;  2F5C A;  5ERI A;  4O3M A;  1QO0 D;  2VE8 A;  3IC7 A;  3FZV A;  3F72 A;  1TNT A;  1KQ9 A;  2DI3 A;  1P92 A;  1W5T A;  1RUO A;  2BEO A;  3F23 A;  2KIM A;  4QWQ A;  3KE2 A;  2VBW A;  3CTA A;  2LNB A;  4PGG A;  1EH6 A;  3WTS C;  2G9W A;  2QBY A;  4IRH A;  1FYL A;  4HX4 A;  4I09 A;  2AS5 F;  1WWX A;  1OYY A;  5L3D A;  3IHU A;  1QPM A;  3ML6 A;  3EET A;  4UHT A;  4XSZ F;  3FX3 A;  2QM3 A;  3QP5 A;  3J7A O;  1FYM A;  3I59 A;  4HLX A;  1XDU A;  4A0Y A;  1WQ2 A;  3NEU A;  5CJ9 A;  3PQJ A;  5HDG A;  5EEG A;  3I54 A;  1KYW A;  4EJV A;  2R7F A;  3BJO A;  4G8X A;  4U7B A;  3V4G A;  4UV8 A;  3F8B A;  3T0Y A;  3HTS B;  3BPX A;  1XCB A;  2PG4 A;  1HSJ A;  3WU1 B;  4XLP F;  3V7S A;  1V4R A;  1HST A;  3HYI A;  2FNP A;  5F64 A;  3VFZ A;  5E1X A;  2J5P A;  2QYO A;  2NNY A;  3FXR A;  3COA C;  3H3Z A;  1HW1 A;  1SD5 A;  4U88 A;  3BWG A;  2CSO A;  4LLN A;  5AIQ A;  3WTY C;  2OU2 A;  3ZMZ A;  2K02 A;  2E1C A;  3QP6 A;  1RI7 A;  3MZY A;  1YLF A;  1IN4 A;  4UVA A;  1OR7 A;  3RTR A;  3I58 A;  3WTZ A;  1U6G A;  3KZY A;  1ONV A;  1STZ A;  1S29 A;  4AIJ A;  2FOK A;  4HV5 A;  2RDP A;  2GIV A;  1ZRD A;  3P9C A;  4AIH A;  2QQ9 A;  1WKM A;  5E17 F;  2M1B A;  2RN7 A;  3LFK A;  5H20 A;  4KIF A;  4RAY A;  3E6D A;  5E8I A;  1BI0 A;  2GAU A;  3ECH A;  4AWX B;  4OIR F;  5ILV A;  1JGS A;  1ODD A;  1GXP A;  1QQI A;  4LJZ F;  2R7D A;  4HLY A;  2FRH A;  2JTV A;  5DDG A;  1XSX A;  3KET A;  4M72 A;  4L0Z B;  3SQN A;  1BN5 A;  5J6X A;  1HW2 A;  3K0L A;  2JZY A;  4MNU A;  4BNC A;  5K1Y A;  1LJ9 A;  1W4M A;  3U9G A;  4CZZ A;  1HKQ A;  3MEX A;  4HA8 A;  2P5L C;  1F9N A;  1B9M A;  1E2X A;  4U0V A;  1IAW A;  5FLX Z;  1MJB A;  1BM9 A;  1T2K A;  4XSX F;  4HQM A;  5K5Q A;  2DW4 A;  2H6B A;  1ZYR F;  3R6S A;  4EJO A;  5HS8 A;  2V1U A;  5LHH A;  4Y15 A;  5IT3 A;  3V8J A;  2EB7 A;  4MQV A;  3HIF A;  4M9X A;  4Y13 A;  4KMU X;  2O8X A;  4WXD A;  1MDM A;  3ABU A;  3E6C C;  1IN8 A;  2A68 F;  1KQ0 A;  3BJA A;  1UHM A;  4AVP A;  4P96 A;  4WX9 A;  2XAS A;  1LDJ A;  5HDK A;  4Q48 A;  1R23 A;  3GFL A;  1FNN A;  4ZYD A;  4I0B A;  3E6B A;  4PGH A;  2PQ8 A;  1ON1 A;  3L09 A;  5AIP A;  2VXZ A;  5L3F A;  3DXJ F;  2VON A;  5JI6 A;  1BBY A;  2PN6 A;  5LRS A;  3P9K A;  1W5S A;  5D5X B;  3PFI A;  1TBX A;  3IRQ A;  4LB5 A;  2HWV A;  1OKR A;  3QRF F;  2P5K A;  3T5X A;  3DFG A;  1Z9C A;  3IWZ A;  3E97 A;  1VTN C;  4EGZ A;  1T98 A;  4L5J A;  1Z91 A;  2VOD A;  5BS6 A;  4AD9 A;  2BBY A;  3KEQ A;  3WTV C;  1PUE E;  2EFP A;  1YO5 C;  3CDH A;  1TQP A;  1IZ1 A;  2YU3 A;  4A6D A;  1S7O A;  4BAY A;  3BOQ A;  3F6V A;  5LEK A;  4BHB A;  4HF1 A;  1A04 A;  2IW5 A;  4UUV A;  5LEJ A;  3DQV C;  1RUN A;  4Y17 A;  1P6R A;  3DV8 A;  4R8H A;  3EYY A;  3ZMT A;  2XUB A;  4I01 A;  3FM5 A;  4YFX F;  4EGY A;  4YFN F;  4CIC A;  4KYW A;  5CVI A;  2IJL A;  3ABT A;  2ISY A;  1WI9 A;  3V8L A;  1EH8 A;  2BGC A;  4L18 B;  4KIC A;  2QVO A;  5KK1 A;  4EJU A;  4KMF A;  1P4A A;  2W84 A;  4TV7 A;  2A6H F;  1XGO A;  2M8E A;  4E70 A;  3KLO A;  2JRT A;  5D4S A;  3WGG A;  1IF1 A;  5HLH A;  2Q8K A;  1ZRC A;  3WGI A;  3KP4 A;  4L5I A;  4M9S A;  5BPI A;  2PJP A;  4P5O A;  5D6E A;  1BIA A;  4ENJ A;  2A61 A;  1F4K A;  1ZN2 A;  3M7G A;  5LGU A;  3HOS A;  1O3S A;  6PAX A;  3RYP A;  2YPR A;  4M74 A;  1G3W A;  2MH9 A;  5CYV A;  2UWM A;  4JQF A;  1IXS B;  1B59 A;  2ZBK A;  2HDC A;  2FQ3 A;  3P9I A;  1HQC A;  5EEH A;  2FNA A;  2B0L A;  1K79 A;  2NS0 A;  2X4H A;  4R1H A;  3F22 A;  3I4P A;  2ZKZ A;  3MZH A;  3F8F A;  5TJJ A;  3H3U A;  5F1R A;  4G6D A;  1LDK B;  3KFW X;  1XSD A;  1BC8 C;  5K5O A;  5DUI A;  2P6S A;  1LDD A;  5IT9 Z;  2FBI A;  1R36 A;  3MQ0 A;  2R3S A;  1FLI A;  1FZP B;  3RIR A;  3L00 A;  1ZAO A;  2HZT A;  1ZHF A;  2XRO A;  3TO7 A;  1W7P A;  3HRS A;  5HDN A;  2DBB A;  2M87 A;  2KJC A;  2CYY A;  1IXR C;  2Z5U A;  4PDK A;  1PP7 U;  2DQR A;  3CO7 C;  1IXC A;  1XDS A;  2O3F A;  3ZN0 A;  4GCV A;  2IPQ X;  3W6K B;  4O5V A;  1UCR A;  3C3W A;  1J5Y A;  4LD5 A;  4DQ2 A;  1C0W A;  4RB2 C;  3KP7 A;  4IXA A;  1SMY F;  1TQM A;  2EFQ A;  1ZAR A;  2A07 F;  1D5V A;  4BQA A;  4MEX F;  3WE3 A;  3R61 A;  3RJP A;  3BRO A;  1XSV A;  1W7P D;  1TTY A;  4K2E A;  3RKY A;  3JSO A;  4EJT A;  2EFW A;  4LK0 F;  2XKP A;  5BPD A;  3TOA A;  2YX7 A;  4OU0 A;  5A2Q Z;  4BHC A;  5KVR A;  1R7J A;  4L9N A;  2PMU A;  4CO8 A;  2HTS A;  2KIU A;  2ZJ2 A;  1UHW A;  4JK1 X;  2DT5 A;  3FMQ A;  4RB0 A;  3HRU A;  5D8K B;  3F8N A;  3QU6 A;  3D0S A;  1BJA A;  4G94 A;  3DP7 A;  3J81 K;  2L01 A;  1UST A;  2VN2 A;  2EV0 A;  2Z33 A;  2JSC A;  4CYD A;  1KU2 A;  3E6M A;  3ZMD A;  3GXO A;  2TDX A;  4A2U A;  4G7O F;  2QQA A;  3NRV A;  4A0X A;  1ZG3 A;  3ZN1 A;  3LWF A;  3TDZ C;  3KP3 A;  1I1S A;  4HDU A;  2OQR A;  4PZJ A;  2O0Y A;  2RV8 A;  4KIG A;  5JHU A;  4HX7 A;  1GXQ A;  3EDP A;  4N0B A;  1LQ1 A;  1TNS A;  3EQL F;  1YW8 A;  2LSO A;  5HLI A;  3JAM Z;  4R79 A;  3N4M A;  5HLG A;  3GZ5 A;  1YQA A;  5CVV A;  2CWE A;  2ZFW A;  4P9F A;  2YX4 A;  4EMS A;  1E17 A;  1WRJ A;  2VBX A;  2Q0O A;  1RIO H;  1HW5 A;  5DD8 A;  1SFE A;  2OBP A;  4RGR A;  1T0F A;  1XGS A;  1H9T A;  3LA3 A;  3R0A A;  5ILS A;  1R22 A;  5ED4 A;  4HBL A;  2FBH A;  2WTE A;  5L3G A;  2H27 A;  5E20 A;  2P8T A;  5DV5 A;  2GA2 A;  2PFB A;  2IT0 A;  1G3Y A;  2HYF A;  3IKV A;  5D5U B;  3KZZ A;  4JBA A;  4IRG A;  2V1X A;  3T8R A;  2GXG A;  3KLN A;  4GXO A;  4U7D A;  4EQQ A;  2EA4 A;  4LLG F;  3M8F A;  2IRF G;  1KGS A;  5LBQ A;  1FBU A;  3IRR A;  2ZME B;  1USS A;  2HEO A;  3L9F A;  5ILU A;  1D8K A;  3SHF A;  2XV4 S;  3M9A A;  3U2R A;  4MTD A;  5FD5 A;  3J80 K;  4CXF A;  1R1V A;  1F1Z A;  4EM0 B;  3C1D A;  4LK1 F;  1R5G A;  3HSR A;  4WXC A;  5FFZ A;  3CO6 C;  1G3S A;  1K7A A;  3MAJ A;  2GQQ A;  3C18 A;  1ZRE A;  2H6C A;  3R4K A;  4MQ9 F;  1ZGJ A;  2VBY A;  4ZH4 F;  2COM A;  2FSW A;  4ZYG A;  4YG2 F;  4XBF A;  2VC0 A;  1Z6T A;  1JHH A;  1KU7 A;  4OIN F;  1I6X A;  3E5U A;  1ZRF A;  2P7V B;  2V6C A;  3SZT A;  4A5M A;  3RKX A;  2L02 A;  4HF2 A;  2FBK A;  5BOX A;  1U5T B;  5D5W B;  2RGV A;  4PCQ A;  4RS8 A;  2V9V A;  2HGC A;  4KA4 A;  1R5H A;  4HZF A;  2ZNY A;  2EFN A;  4GGG A;  2ZO4 A;  3ECO A;  2BYV E;  3QAH A;  2VE9 A;  4GYG A;  3RDI A;  3QOP A;  3ULQ B;  4Z2Y A;  1HKT A;  3F3X A;  2RVC A;  3VOE A;  4A12 A;  2HOE A;  2JPB A;  4YFK F;  1Z7U A;  1TLH B;  3EUH A;  1REP C;  4U0Y A;  1K78 B;  3CJN A;  4OOI A;  4G7Z F;  3ZMU A;  4QLC U;  1RZ4 A;  3L2C A;  2C6Y A;  1ZG1 A;  3R60 A;  5ICE A;  2RKH A;  1L0O C;  2E7W A;  1B1B A;  1O3Q A;  1HXD A;  1KU3 A;  2Z99 A;  4LGW A;  3MCZ A;  4UV9 A;  2MD5 A;  3FXQ A;  1FPQ A;  4ESF A;  2ACJ A;  4LB6 B;  1H0M A;  2DAO A;  5ICF A;  2LF7 A;  3S2W A;  2E1N A;  3GFI A;  1Q1H A;  5LHI A;  3Q5F A;  4IHS A;  5TRD A;  2OAZ A;  4XLN F;  3ZMS A;  1S7A A;  2ELH A;  2DK5 A;  2W25 A;  1SAX A;  1QZZ A;  5D5V B;  4OMZ A;  2KRF A;  2ISZ A;  2HKO A;  3HSE A;  1P4X A;  4WCG A;  1ZGA A;  4AIK A;  1GVJ A;  1O3T A;  2MH2 A;  5E8G A;  3HUG A;  4M6X A;  1FSE A;  1B9N A;  2G7H A;  3ZQ7 A;  1Z1D A;  1Y0U A;  5FB2 A;  4GO1 A;  4UNO A;  2G7U A;  1MJ9 A;  1MKM A;  4BXU A;  1XGM A;  4M6Y A;  2HTJ A;  1RNL A;  1KQ8 A;  3LQR A;  3O6B B;  3QPH A;  4FT8 A;  3I0T A;  1YG2 A;  3NQO A;  3SFZ A;  1YTY A;  2OQG A;  4LMY A;  4H0E A;  3V7C A;  3GZ6 A;  2UXN A;  2ZCW A;  2FA5 A;  1ON2 A;  4HX8 A;  5HOO A;  2P6T A;  3BDD A;  4L9V A;  2FF4 A;  3IKT A;  5J8F A;  2QZ8 A;  3VEP A;  3CUQ A;  2H94 A;  1HBX G;  3DPT A;  4RGX A;  2PLY A;  4A6E A;  4HF0 A;  5E1W A;  1SD4 A;  1R00 A;  1T39 A;  1SMT A;  2DFI A;  5AON A;  2GZW A;  2NAZ A;  2XAG A;  1O3R A;  2YSR A;  4I0A A;  4YIF A;  2M5W A;  5L3E A;  2W24 A;  1KU9 A;  1L3L A;  2XHK A;  3N97 A;  4OIO F;  1ZLK A;  4A0Z A;  1J59 A;  1XCV A;  1K6O A;  1G6N A;  2M45 A;  2K86 A;  1DDN A;  1P2F A;  3CUQ B;  3HTU A;  3I64 A;  1XGN A;  2FE3 A;  2DTR A;  5DUK A;  4ASN A;  2OZ6 A;  2A69 F;  2GA1 A;  1FP1 D;  1T38 A;  1FBQ A;  2EV5 A;  4FX4 A;  1HKS A;  5DCF A;  4UVB A;  3LAJ A;  4U0W A;  1GHC A;  1FOK A;  3IWF A;  3WTW C;  3K1N A;  3GFM A;  2DU9 A;  1R1U A;  4L9J A;  3F8C A;  2PEX A;  3W6J B;  1DUX C;  5BQT A;  2VC1 A;  1IN6 A;  4D0P A;  3I71 A;  4KT5 C;  5FLX K;  2XAF A;  1JXS A;  1B6A A;  1CF7 B;  5L3B A;  5J8C A;  5DEQ A;  3F21 A;  2P5V A;  5L3C A;  4HAM A;  1B4A A;  3BY6 A;  4WXH A;  1I5Z A;  1KA8 A;  3WTU C;  3T8T A;  1J2X A;  3M8E A;  3QU3 A;  4KIB A;  4MTE A;  3VOD A;  4UXN A;  2P7C B;  3HHH A;  3E5X A;  1DP7 P;  3WTX C;  5ICC A;  4N9I A;  3AAF A;  4RAZ A;  3KEO A;  4I02 A;  1FT9 A;  2ESN A;  2HR3 A;  4FHT A;  1R1T A;  2QUF A;  3WG9 A;  3ISP A;  3RYR A;  4HW0 A;  5DCM A;  4ON0 A;  2A5Y B;  2KJB A;  3ELK A;  1YFH A;  2XKO A;  4KN7 X;  4KUM A;  1I1G A;  4ZYE A;  3H92 A;  1J75 A;  2O61 A;  3K2Z A;  2MBF A;  1J9I A;  3BP8 A;  3QPT A;  4IJA A;  1U5T C;  3GUD A;  2K4B A;  2XIG A;  1T6S A;  1UFM A;  3LST A;  5JVT A;  2F2E A;  1FWZ A;  1O57 A;  1XMK A;  3F6O A;  1DPU A;  4I7H A;  1V3F A;  5HVQ C;  2P4W A;  2XAQ A;  3V8K A;  1OYW A;  3RI4 A;  1Z6R A;  1FY7 A;  1TQI A;  2CFX A;  1JHF A;  3CLO A;  3P7N A;  5DCM B;  2VBZ A;  3GWZ A;  4UVC A;  3WTT C;  3GLX A;  1FBS A;  4KNY A;  2OA4 A;  5FFX A;  4KFC A;  4ZZL A;  1YIO A;  2CGP A;  3TO9 A;  4BHP A;  1CGP A;  1YS7 A;  2DLL A;  1QGP A;  3HRM A;  3DF8 A;  3KP5 A;  3IL2 A;  4HDV A;  3T1B A;  4ZZD A;  4M9Z A;  3Q9S A;  2L4M A;  3K1M A;  4IRI A;  1S3J A;  5D8L B;  3E5Q A;  2XAJ A;  3M1E A;  2D1V A;  3HOT A;  2NYX A;  2RQP A;  2FML A;  2ZME A;  4RB1 A;  5E18 F;  3GEZ A;  3TQN A;  4KDP A;  3C7J A;  2VOO A;  3B73 A;  3R0J A;  1ZLJ A;  1IRG A;  1QBJ A;  3JTH A;  1OYI A;  1DPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...