1C0WA

Crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
173
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVIVQINEIFQVETDQFTQLLDAVELLDDLAHTIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*AP*TP*TP*AP*GP*GP*TP*TP*AP*GP*CP*CP*TP*AP*CP*CP*
publication title Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation/dna
total genus 63
structure length 173
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1c0wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1c0wA02
1L0OC 3D0SA 1UCRA 5K5OA 1MJAA 3J81Z 5H6QA 1LQ1A 3ZMUA 3EQLF 3J7AO 1BOAA 5IT9K 3WG9A 1DUXC 2XAFA 4L18B 2CO5A 4UUVA 4ENMA 4HDVA 2LNBA 4GGGA 5L3CA 4EJTA 2HTJA 5ED4A 1FX7A 3GX4X 4I7HA 2WWYA 3F8BA 2QVOA 1XCVA 3N4MA 4PGHA 3KP3A 5ICGA 1BBYA 3COAC 1B9NA 1DPRA 1MDMA 1U5TA 2ZJ2A 3JAMK 3I58A 2W25A 3RKXA 3L9FA 3ZQ7A 4D0PA 1Z05A 3TGNA 3RI4A 1BIAA 4ASNA 3GWZA 3M1EA 2A61A 2FQ3A 3CO7C 4O3MA 2PMHA 2UXXA 4NHJA 3HSFA 2V1DA 4DQ2A 5JR3A 1FZPB 2HGCA 2EA4A 3EYIA 1IN6A 2JSCA 4G94A 1ZHFA 4HZFA 4OIQF 3B73A 1GXQA 2IA2A 3DFGA 2DQRA 1B4AA 2RNJA 3BY6A 4ENJA 1SFXA 1U78A 4H0EA 2G7HA 2P7VB 1FBSA 2ZO4A 1ZLKA 3E5UA 1Z7UA 5DYMA 4KYWA 4WXHA 2FBKA 1KU7A 2FMLA 1T98A 5FFXA 3Q9SA 2W84A 2H6BA 1X3UA 1J59A 1MDMB 1U5TB 2J5PA 4LLLA 1ZGAA 2VE8A 4RAZA 2XHKA 2KRFA 4LMYA 1SD5A 5L3BA 3KP7A 1F1ZA 4IJAA 1TBXA 3KLOA 4Y17A 2CG4A 1K7AA 1VTNC 1CF7A 2OU2A 4CZZA 3IWFA 1W7PA 3ZN0A 4BH9A 2PMUA 2QLZA 2FE3A 1XB4A 3WTSC 5HS8A 1FYMA 3NRVA 2HKOA 1FWZA 1XGNA 4IF4A 1W5SA 3FHZA 3ABUA 1KGSA 4KN7X 4Y15A 4BHBA 2EB7A 1SD7A 4A12A 2HZTA 5CLSA 2FA5A 1OPCA 4KMFA 1S8NA 4GYIA 1J75A 1BI0A 2XASA 3KETA 2IP2A 3U9GA 1BM9A 2OQGA 3WGHA 2O8XA 2WV0A 5HS7A 1T0FA 3CLOA 2Z9OA 3F23A 1CF7B 4ESFA 1R1UA 4YFXF 2E7XA 4P9FA 4HBLA 5D5VB 1SMYF 2KIMA 3R60A 4UVBA 2VXZA 2GIVA 4G7ZF 4WF2A 1GVJA 2C6YA 3QU6A 4CYDA 5D5UB 2VOPA 4EM2A 1ZGJA 5LGUA 3NQOA 4DNCA 2GQQA 3GEZA 4CHUA 1DPUA 3GF2A 5LEJA 5HDKA 4CDGA 2FRHA 1RIOH 1XMAA 4I98B 2YPRA 2EFOA 4HX8A 3IC7A 5CVVA 4Q5SF 1GHCA 2P5KA 5LHGA 4M71A 1ZH5A 3OOPA 3ZMZA 2NNYA 3IL2A 1BI2A 1HW5A 2MH9A 3BWGA 2BBYA 2O61A 4WK8F 4IRGA 1HSTA 1LEBA 2LDUA 4A5NA 1P4AA 4YFNF 4R79A 1O3SA 5FD6A 2KJBA 1G4DA 2DK5A 2EV0A 3HRSA 4EJVA 2K7LA 3P9KA 5E1ZB 4HV6A 4YG2F 1XCBA 3RPQA 4JQFA 1T38A 2X0LA 3KE2A 3GVAA 4TV7A 1SD4A 1G3YA 3F6VA 4MNUA 2DPUA 4LJZF 2JT1A 2MD5A 3T8RA 3PQJA 1IN7A 3ELKA 1TNSA 4XBFA 1G3SA 1BI1A 3I5UA 5BPDA 5CVUA 3VODA 1T2KA 4FX4A 1IXCA 1YW9A 1HXDA 3F8CA 2L3DA 1PUEE 2YX4A 2CQKA 4LD5A 1F4KA 5BQTA 3ZN1A 2V9VA 1FP2A 1UFMA 2P5VA 2QZ8A 2XRNA 1EH8A 1KU9A 2KJCA 2F5FA 3TOBA 2L01A 2QQBA 1IXSB 4HF1A 4XSZF 5CVIA 1IF1A 3BPXA 2V79A 1I27A 3BJOA 2FXAA 5LBQA 3LQRA 4IXAA 1YTYA 2QUFA 1FT9A 3MWMA 5E17F 1OR7A 2MLKA 5D6FA 2QBYA 3IWZA 1WWXA 1YYVA 3ECOA 4UHTA 3ZMTA 3HHHA 2VBZA 4HQEA 2A6HF 3PFIA 4ZYHA 4M9ZA 2O3FA 1IRGA 2EA2A 4E70A 3E6CC 3ROUA 4M74A 2ESHA 4KMUX 3RDIA 4RGXA 2P5LC 3LA3A 1UHMA 1TLHB 1ONVA 2O0YA 1XSXA 3K9TA 4BQAA 5E1WA 2JRTA 1P2FA 3KP2A 1TNTA 3BPVA 4HDUA 4EGZA 3V4GA 4Y13A 2Q8KA 1ZG3A 1QO0D 3GYHX 4HF0A 1FSEA 5F6FA 4MTEA 1DP7P 2BGCA 3RIRA 3F8FA 4P5OA 4KIGA 3TDZC 4B09A 1Z6RA 5HLIA 4PDKA 1LB2A 2ISYA 3BP8A 2IT0A 2PFBA 1B1BA 2MH2A 2A07F 5DV5A 2VOOA 2XVCA 4EVIA 4U7BA 5CJ9A 3GXOA 2ZNZA 4AIJA 2PBIA 1PP7U 4BAYA 1Z6TA 2X4HA 2DT5A 2MC3A 3GZ6A 4N9HA 1R00A 4B8XA 2VE9A 4LB6B 3SZTA 3KZYA 1XDUA 4MEYF 2Q0OA 2XKPA 3QP6A 4LB5A 3JSOA 2QQ9A 1W4MA 4WWCA 4I09A 4LLGF 4U7DA 5K1YA 1IN5A 5H20A 1R58A 4LFUA 3DF8A 4F7ZA 1W7PD 1HKQA 2TDXA 3GZ5A 2PG4A 5DUIA 2CWEA 3CUQB 3E97A 4AD9A 3WE3A 2NS0A 2VT2A 4KICA 1L3LA 4ZYDA 3DEUA 5L3EA 2K4BA 1A04A 2ZFWA 5CYVA 4N0BA 3S2WA 2UXNA 3GFJA 3H92A 5HVQC 1U8RA 3RYPA 2L4MA 2ACJA 1QZYA 3T0YA 3ABTA 1FPQA 3CUOA 1K78A 1DDNA 1Q1HA 1YG2A 2D2WA 3T1BA 1UHWA 1O3QA 1R36A 2COMA 5FGMA 2V1UA 1Y0UA 2NNNA 1WKMA 3GO5A 2VONA 1SAXA 3KFWX 1ZARA 1W5TA 2JTVA 5KVRA 3BJAA 2Z5UA 4HA8A 1EV7A 4QLCU 4LG0A 3EUHA 5E20A 4FT8A 1MD0A 5J6XA 1D5VA 4AWXB 4AIHA 1WQ2A 4BNCA 2Z33A 2F5EA 3I0TA 1KQ9A 1YS6A 2E1CA 4A0XA 3E6DA 3K0LA 5E1XA 3RTRA 5DDGA 4KFCA 5DCMA 4ZZDA 1FP1D 4CXFA 1I1SA 1MJBA 1RI7A 5ERIA 3DPLC 1V4RA 1K78B 1LNWA 1H0MA 2M8EA 1ZAOA 3FMQA 3RYRA 1R23A 3B02A 2K4JA 1RUNA 4G7OF 2K27A 4M6XA 1P4WA 2DW4A 2Y0MA 4G6QA 5JVTA 3G73A 2EK5A 5F1RA 1D3YA 3P9IA 4ZYGA 4P55A 1XMKA 1HW1A 3F8MA 4ZH4F 4S04A 1FBQA 3HRUA 2IW5A 5CVRA 2FSWA 2R7DA 3DXJF 2VC0A 2ELHA 5FLXK 4CO8A 1S7OA 3QOPA 5D8LB 3I54A 3HSRA 3QAHA 1S29A 2A6EF 2DPDA 1O7LA 5LGNA 2M5WA 1YFHA 1WI9A 2RDPA 2LF8A 4KUMA 3R0JA 2Z99A 4HX4A 5F64A 3QRFF 1R1VA 1RNLA 5DCMB 4BHCA 3U2RA 2FF4A 2L54A 2XIGA 1ZYRF 1ULYA 3FX3A 5HLGA 3F21A 4MHGA 3SHFA 2A69F 3MAJA 3GLXA 3KEQA 3HSEA 3WTYC 4L9JA 2PLYA 2OAZA 3DQVC 4G8XA 4IRHA 3WGGA 3FF5A 2GXBA 3HYIA 1S6LA 4AIKA 2F5CA 2H27A 1NHAA 4HYEA 4P9UA 1U6GA 5ILVA 3SXYA 2G9WA 1W7PB 4KT5C 3QU3A 3SZPA 4A0ZA 2H09A 1U2WA 5HLHA 1G3WA 4RAYA 3CTAA 2IRFG 1XGSA 2IVMA 4R1HA 4Q4ZF 3P9CA 3HTUA 1OYWA 4UVCA 3DP7A 3WGIA 3E5XA 2A5YB 2ZCWA 2LSOA 3IKTA 1F5TA 2PI0A 3EDPA 4UV8A 4BXUA 1H9GA 3OV8A 3IRQA 3L09A 5D8KB 2KKOA 1U3EM 1I6XA 2YSRA 1BI3A 2RV8A 2OA4A 3CJNA 1CGPA 2EV5A 5ILSA 2HTSA 2J5OA 1H9TA 3L00A 2QYOA 3I53A 1BC7C 3FXUA 3VB2A 2M1BA 2DQLA 4EJWA 2K02A 1USTA 3LWFA 2STTA 3LQQA 2EJRA 3C18A 4ON0A 4IVNA 1TQMA 1YW8A 5D4RA 4L9TA 1J2XA 2IA1A 2FNAA 3KP4A 3EYYA 1Z1DA 3DV8A 5H6RA 1B6AA 1JGSA 3KP5A 4HX7A 3U1DA 2FEZA 1WSUA 4L9VA 2FOKA 1AWCA 4CGZA 3M8FA 2VBWA 4M9SA 3WODF 1EH7A 5D4SA 1HW2A 2XUBA 2HS5A 2Z3YA 5L3DA 4UXNA 1FOKA 2IPQX 5AIPA 3K2ZA 1T39A 3JTGA 4JK1X 2HWVA 3ECHA 3ZP5A 5EEHA 4EM1A 1KU2A 4FHTA 3L7WA 2O6GE 4KNYA 3FZVA 1ZLJA 3BJ6A 4OIPF 2EV6A 2HOEA 4HW0A 3QP5A 1JHHA 3FXQA 5LRRA 4XLNF 2HQNA 4OMYA 3ZMSA 1ZRDA 4A6EA 2EWNA 2OBPA 3WTXC 4HAMA 4LLNA 4KIBA 2E7WA 2RQPA 1HBXG 3C1DA 1IW7F 2BV6A 5A2QZ 2EFQA 2QENA 2PJPA 3M8EA 5HDGA 3HTSB 3SQNA 1PP8F 2H94A 2ZMEA 3GUDA 3O3KA 4EM0B 1JXSA 2P8TA 3REOA 1ZG1A 2YR2A 3GFMA 4WXDA 1XGOA 1IUYA 4WCGA 3WTWC 3VOEA 1GXPA 2D1VA 3K1PA 2VT3A 3F6OA 2G7UA 3LSTA 1U5TC 1TTYA 1HQCA 2XAQA 4I02A 2BEOA 2GZWA 5AIQA 2PQ8A 3VFZA 1O57A 5K5RA 2L4AA 3KEOA 3W6JB 5D6EA 4Q47A 4GXOA 5FB2A 5L3GA 2NRAC 2VBYA 1E17A 2FMYA 3H3UA 2W57A 3J81K 2QBYB 3IRRA 5L3FA 2HDCA 4EV0A 3RPUA 3I59A 3HUGA 3SFZA 4RGSA 1J5YA 1V3FA 5JI6A 4EMSA 2ZMEB 4UVAA 3BDDA 4XRFA 3KCCA 5EEGA 4OINF 2HR3A 3J80Z 5IT3A 3ERED 1TW3A 4IPAA 1OYYA 1TW2A 1O3TA 1I1GA 4A2UA 3F3XA 5FO5A 2WTEA 2GXGA 4G6DA 3HIFA 2RVCA 2DO7A 2GAUA 1RUOA 1J7KA 4A6DA 1HKSA 4GYGA 1Z9CA 2B0LA 3K1NA 4OU0A 3GFIA 2QQAA 3M9AA 4ESJA 4OOIA 4LK1F 3R61A 2DK8A 2Y75A 1FSHA 2L02A 2NYXA 2OZ6A 3WTTC 3Q5FA 3DPTA 4KA4A 5K5QA 5TRDA 3LAPA 2QM3A 4M6YA 2ZXJA 3CDHA 5ICFA 2DFIA 3MZYA 2VN2A 2H6CA 3I59B 4GO1A 2XAGA 4L0ZB 1HSJA 4YFKF 1FYKA 1J9IA 2XAJA 4HLYA 1FC3A 4OIRF 2F5DA 3F8NA 3IHUA 4G9YA 3I64A 5DUKA 4HLXA 3TO9A 3O6BB 2HEOA 3FXRA 2KIUA 2K86A 4IHSA 1MJ9A 1YW7A 3L2CA 1P4XA 4YIFA 2YU3A 2P7CB 4WXCA 4U0WA 4NQWA 3E5QA 4YIIA 3V7RA 2KIFA 2CFXA 2OZUA 5BS6A 3FMSA 1JE8A 2BE5F 4M72A 5FD5A 3AAFA 3HOSA 1YQAA 1FNNA 2RC4A 3R0AA 1KYWA 3TKYA 5LEKA 2JZYA 4FX0A 3ULQB 2E1NA 5IT9Z 3HRMA 1LVAA 1RZ4A 2LF7A 2AXLA 4N9IA 4HOBA 2W85A 4HV5A 4U0YA 1LDKB 2XV4S 4LGWA 2OD5A 1KQ0A 2IA0A 2ZNYA 4R8HA 3G3ZA 3LA7A 2HKXA 2VC1A 1J0RA 1ZG5A 2BYVE 1C0WA 2CSOA 5HOOA 3P7NA 2A68F 1R5HA 2LKPA 3JAMZ 4WX9A 3QPTA 1ZREA 3W6KB 4RGRA 5BMZA 4LG0B 1D8JA 1YLFA 1IN4A 1KQ8A 4PCQA 4OMZA 3EETA 1YIOA 3RJPA 1F9NA 3VEPA 3K1MA 5CVJA 3I71A 3T5XA 3TQNA 3V8KA 1STZA 2R7FA 2GA2A 4UV9A 5KK1A 2ETHA 2HYFA 1SD6A 2XAHA 4MTDA 1YS7A 3RKWA 3H3ZA 3MEXA 1E2XA 3ZPLA 5LGTA 2FU4A 4G7HF 5FFZA 1JHFA 4O5VA 4MGRA 2QWWA 4ENKA 3R4KA 3E6MA 1Z91A 1K79A 1IAWA 4RB3C 2V6CA 3O2PE 4XSXF 5DEQA 2EFWA 1IRFA 2DU9A 4RB0A 2P6TA 1P92A 4A5MA 1MKMA 4L5JA 4I2OA 1IZ1A 1FBUA 4A0YA 3NEUA 3TO6A 1QQIA 4KN4X 1IN8A 1KA8A 2P4WA 1XSDA 4RB2C 1BC8C 2MLGA 3WU0A 4EJUA 4O6JA 4S05A 4HQMA 1FY7A 3M7GA 5FLXZ 2Y48A 5D5XB 3ZMDA 2HYGD 3FMRA 1BJAA 3T8TA 5LLQA 5TJJA 1QPMA 3ISPA 1XGMA 2GWRA 4I01A 1B59A 4K2EA 1D8KA 1WRJA 4KIFA 1KU3A 1S7AA 4LK0F 3R6SA 4I0AA 5HDNA 3KP6A 2M30A 6PAXA 1LEAA 4IHTA 2VODA 1QGPA 4UNOA 5DCFA 1AOYA 3MZHA 1OYIA 3MFKA 4I0BA 3FM3A 2M87A 3V8LA 1I5ZA 4AVPA 5JFRA 3V7CA 3E3VA 1USSA 3BROA 3K69A 1XD7A 3F72A 1K6OA 4BHPA 4NB5A 4L9NA 3WE2A 3V8JA 5J8CA 2V1XA 5ICEA 3MQ0A 1TQIA 5D5WB 3LAJA 1S3JA 1G6NA 2EFNA 3CUQC 3HHGA 5E8IA 1PDNC 5LHHA 3JW4A 3ZMVA 4EQQA 2HQRA 1BN5A 1XN7A 1P6RA 1B9MA 1BIBA 5A2QK 5DD4A 4JBAA 4OIOF 3WU1B 4U88A 1ZN2A 4ETSA 3V7SA 3WTUC 1ZRCA 2OQRA 2MA3A 3QPHA 1XDSA 4PZJA 1R1TA 4RGUA 2DI3A 2VBXA 5JHUA 2WC2A 2DAOA 3RKYA 2XROA 1QBJA 1R22A 4M9XA 4EJOA 2ISZA 5LHIA 2XKOA 2AS5F 4RS8A 3IKVA 4ESBA 1O7FA 1UB9A 3JSPA 2PEXA 1MGTA 5LRSA 5BPIA 2MBFA 2FBHA 4ENNA 3GFLA 2O03A 2IJLA 2F2EA 3PQKA 2CYYA 4IRIA 1QZZA 2EFPA 4U0VA 1EH6A 1R5GA 3I4PA 4MQVA 4Q48A 1FLIA 5BOXA 1ZRFA 1SFUA 3D5LA 5ICCA 3ML6A 2GA1A 1TQPA 2ADUA 2RKHA 5E8GA 2ESNA 3DKWA 2M45A 4XLPF 2D1HA 1IXRC 3JTHA 1R7JA 5E18F 3BZ6A 2JPCA 3KZZA 4EGYA 1XSVA 4CICA 2CGPA 3FM5A 3C3WA 1LJ9A 2XGXA 3J80K 3HOTA 2HFHA 3BOQA 1T6SA 4MEXF 2RGVA 4PGGA 5DD8A 3C7JA 1LDJA 5AONA 2DTRA 3KLNA 3F22A 3LA2A 1OKRA 1ON2A 2FBIA 1SMTA 3GW2A 3WTVC 1REPC 4L0YB 1KYZA 2FNPA 4Z2YA 2NAZA 4ZYEA 1G3TA 4QWQA 3CO6C 3FWEA 2ZKZA 2P6SA 3MCZA 2W24A 3CUQA 4GCVA 3LFKA 1HKTA 1O3RA 3N97A 1QNTA 5ILUA 2YX7A 2DBBA 4M73A 5J8FA 1LDDA 2Q2EA 5HS9A 2ZBKA 2STWA 2UZKA 3TO7A 2DLLA 1MZBA 1ODDA 1OMIA 2CW0F 2UWMA 2R3SA 4P96A 4L5IA 1YO5C 4BYYA 2D45A 3TOAA 4MQ9F 1ON1A 3HRTA 2JPBA 2RN7A 3Q9VA 3TDUC 1SFEA 2PN6A 4HF2A 4KDPA 3WTZA 1FYLA 2A3SA 3E6BA 4ZZLA 4RB1A
chains in the Genus database with same CATH superfamily
2KRCA 1L0OC 3D0SA 3Q3SA 3S16J 2KHMA 1NK2P 5IPAA 2KP6A 1FMWA 5C4JJ 1UCRA 2ELKA 5K5OA 2A5WA 3J7YJ 1MJAA 1WJ5A 4HG2A 4NC7A 2W00A 3J81Z 3H9GA 2HU9A 5H6QA 3G4SI 2L7FP 1LQ1A 3ZMUA 3EQLF 2M0MA 3J7AO 3UR3C 1BOAA 5IT9K 1LFUP 3D5SC 1R49A 3WG9A 2DN0A 3TW7A 1DUXC 2XAFA 4L18B 1JT0A 2CO5A 4UUVA 4ENMA 4HDVA 2LNBA 3GTOJ 2DYSH 4GGGA 5L3CA 4EJTA 2HTJA 4BQQA 5ED4A 4E7SA 1VQ7I 4DOZA 1FX7A 2F4OB 2IGKA 2CH0A 2DOEA 4I7HA 3GX4X 2WWYA 1VQMI 1ZGWA 3F8BA 2DA2A 1TWFJ 2QVOA 1XCVA 3ABMH 4V19K 2HPMA 2X85A 1Z21A 3N4MA 4PGHA 1ZR4A 3KP3A 5ICGA 5EGOB 2R7WA 4FE7A 2DA4A 1BBYA 1I3QJ 1SVMA 3COAC 1B9NA 1DPRA 4P1WA 4ABZA 2I5UA 4QIWN 1MDMA 5DM7F 3K7AJ 1U5TA 2ZJ2A 3JAMK 3I58A 2W25A 4XONA 2ZB9A 3RKXA 1B72B 1VQNI 3L9FA 1T0FC 1AA7A 3ZQ7A 1MH3A 4D0PA 2MUNA 1ZK8A 1JKQC 2WV1A 1Z05A 3TGNA 3J81R 3RI4A 2V1NA 2G0EA 1BIAA 4ASNA 3FXLA 3GWZA 3M1EA 4F93B 2A61A 2FQ3A 3CO7C 2Y30A 3S8PA 4O3MA 3KYCB 2PMHA 2FUG2 2ZJPF 2UXXA 4A3KJ 2M4KA 2X6YA 1K6YA 1Q1VA 1FOYA 3DLAA 1W1WE 3HSFA 4NHJA 2BXZA 4A3EJ 2V1DA 3MD2A 1M1EB 3RSNA 4DQ2A 5JR3A 3S1RJ 1FZPB 2HGCA 3KPHA 2EA4A 4RAFA 4XIDA 3EYIA 3BZKA 1IN6A 2JSCA 4G94A 2Z2SB 1ZHFA 4HZFA 4OIQF 3HOWJ 3B73A 1GXQA 2IA2A 3DFGA 1GLNA 2NVQJ 1GDTA 3FXMA 2BHZA 2DQRA 2K9QA 1B4AA 5M5XJ 4RLFA 2RNJA 3LSIA 3BY6A 4OWRB 1SFXA 4ENJA 1U78A 4JX5A 4H0EA 2G7HA 2P7VB 3E7LA 1WVRA 1FBSA 2ZO4A 3CCVI 3TP3A 1ZLKA 3ABKH 3E5UA 3K4NA 4UB6C 5LD2C 1Z7UA 1PUFA 5DYMA 4EEFG 4KYWA 3KX2A 4WXHA 1QU3A 2V7FA 2FBKA 2LG4A 3MKLA 4JOMA 1KU7A 2FMLA 1WJBA 2ZXIA 2GIZA 1T98A 4BE2A 5FFXA 4BS9A 3G2BA 3Q9SA 2OTLI 3HZJA 2W84A 3GZNB 2H6BA 3SDGA 4JYKA 4NQWB 3GBGA 1A36A 1X3UA 2H1LA 1SEUA 2VPLA 1J59A 2A05A 4XNFA 4F92B 1MDMB 5F0FA 1U5TB 5GADJ 4PFPA 2J5PA 3PFYA 4LLLA 1Y0NA 1ZGAA 3DWLE 3K4CA 2VE8A 4RAZA 2XHKA 2KRFA 4LMYA 1SD5A 1MBGA 1P7JA 2LFBA 5L3BA 3KP7A 1FMVA 1F1ZA 2DMPA 2KLOA 2RQQA 1RRJA 3CZ6A 4IJAA 1TBXA 3KLOA 4Y17A 2CG4A 4EATA 1K7AA 3VYRB 1JKRC 1VTNC 1NH3A 1CF7A 3MN2A 1F43A 3RQIA 4LITA 3BCBA 2AO9A 2OU2A 4CZZA 3OYDA 3IWFA 3BTIA 1W7PA 2XF5A 3ZN0A 4BH9A 3JRHA 2M7AA 2PMUA 2OPTA 2QCOA 4BBSJ 5DM6F 3PIPF 2AHQA 2FE3A 2QLZA 1XB4A 3WTSC 3ZRGA 5HS8A 1FYMA 3NRVA 2HKOA 2L9VA 5FKNA 2CV1A 2LLKA 3G6EI 3QWLA 1FWZA 1XGNA 1RKWA 4IF4A 1W5SA 4C3JJ 1E0EA 3FHZA 2KIQA 1WJAA 3ABUA 1V5EA 4A3JJ 1KGSA 4KN7X 4Y15A 4C2MJ 5IOYA 3FBIB 3CCYA 4BHBA 3CP8A 2EB7A 2XPUA 3OWTA 1SD7A 3VDXA 4A12A 2HZTA 1BJZA 1YRNB 3DBRB 2DT7B 5CLSA 3JCUC 3MKZA 4ZDPA 3RKQA 2MYSA 3JRCA 3MMYB 4DYCA 5E3MA 2FA5A 5GP9A 2L9NA 2WY7Q 1OPCA 2VKEA 2JSPA 4KMFA 1S8NA 3RCOA 4GYIA 1J75A 4B48A 1U0JA 1BI0A 2XASA 3KETA 2IP2A 4BEHB 2WY8Q 5HODA 3FKIJ 4YRVA 3U9GA 1BM9A 4HSTA 2OQGA 2VI6A 3HL2A 2WBMA 3WGHA 2O8XA 1QVTA 2XSDC 2WV0A 4XOPA 2M2EA 1T0FA 3BQZA 2QSFX 5HS7A 3CLOA 5E3OA 2Z9OA 3H3VK 5F27A 4LG3A 1K4SA 3CLQA 2HQAA 3F23A 1W36D 2NS7A 1CF7B 2XC7A 4II3A 2GOXB 3RQ4A 1DGWY 4ESFA 1G59A 2BY0A 1Y56A 1R1UA 2LY2A 4M6VA 2CUEA 4YFXF 2E7XA 4P9FA 2DJNA 4HBLA 5D5VB 1SMYF 2OF7A 2L7ZA 1FIPA 3QYBA 3BR0A 2KIMA 3R60A 1OR7C 3H0DA 4UVBA 2K3PA 1IC8A 1ZTRA 2VXZA 1IDZA 2GIVA 3CQZJ 4WF2A 4G7ZF 1GVJA 2C6YA 4W97A 3QU6A 4CYDA 5B66C 4G12A 5D5UB 1E3OC 3OYIA 3CCQI 1I39A 2VOPA 4EM2A 4IHXA 1ZGJA 5EEAA 5LGUA 3K70C 3NQOA 4DNCA 2GQQA 5EYRA 3GEZA 2CFOA 2QKMB 2ZMEC 2VQGA 1JJ8C 4CHUA 1DPUA 3DKXA 2F48A 3GF2A 4QTRA 3K4KA 2EZHA 5LEJA 1UAAA 5HDKA 2DT6A 4FASD 4CDGA 3CMYA 2FRHA 3HC7A 3PSFA 1RIOH 1XMAA 4I98B 2YPRA 2EFOA 2OJED 4HX8A 2LK2A 3IC7A 5CVVA 4Q5SF 1GHCA 2P5KA 5LHGA 4M71A 1ZH5A 1HA8A 3OOPA 2MSYA 3ZMZA 2NNYA 4RM3A 3HPHA 1E3PA 3IL2A 1BI2A 1HW5A 2MH9A 3BWGA 9ANTA 2CW7A 2BBYA 1FEXA 1U8BA 2O61A 4WK8F 2EPFA 4IRGA 1HSTA 1OCRH 3QODA 1LEBA 2LDUA 3OS2A 4A5NA 3HOYJ 1P4AA 3TW6A 4XRSA 3BR5A 4YFNF 3C2BA 4R79A 1O3SA 4RA2A 4C3HJ 2PJRB 5FD6A 2KJBA 1G4DA 1AU7A 1XTAA 2DK5A 2EV0A 3OYLA 3HRSA 2HYJA 3ZGKA 1OCOH 2EIKH 2UUZA 4F91B 1N78A 2GM4A 4EJVA 2K7LA 3P9KA 2IXSA 5E1ZB 4BE0A 3S3OA 4HV6A 3LSJA 4YG2F 1XCBA 2VPRA 1BR2A 3RPQA 4JQFA 4J00A 2BW3A 1T38A 2X51A 1I50J 2X0LA 3ZQIA 3KE2A 3GVAA 3L2VA 3M8JA 4TV7A 1MBEA 1TP4A 1SD4A 1G3YA 3F6VA 3LSMA 4MNUA 2DPUA 4CZCA 3QYEA 4LJZF 4I76A 2JT1A 5EJCA 4A3IJ 1QHHD 1VQ9I 3KYDB 2MABA 2MD5A 4XLCA 2ECBA 3T8RA 5EG0A 3JRAA 3VYTB 3PQJA 1IN7A 1VI0A 2M34A 3ELKA 3ZQQA 1TNSA 4XBFA 1ORKA 1G3SA 4BQNA 1BI1A 3I5UA 1YE9A 5BPDA 5CVUA 1JKPC 3F0CA 2JA2A 2X1EA 3BR6A 3FDYA 3VODA 2VLAA 1T2KA 4FX4A 1IXCA 1YW9A 3DTEA 1JT6A 3Q0UA 5M5YJ 2CMPA 1HXDA 4PJ0C 4J19A 2KZVA 3F8CA 1BR4A 2L3DA 1PUEE 2YX4A 2HZDA 4JX6A 2CQKA 2F4MB 4LD5A 2HNHA 1F4KA 3TL4X 2VQLA 4XOTA 4F3QA 5BQTA 1RQ6A 2E60A 2V9VA 3ZN1A 1A31A 2LVSA 1ZR2A 1N77A 1XG1A 1FP2A 1UFMA 1K83J 2P5VA 4AM3A 3PO3J 2QZ8A 3K4MA 2XRNA 1NK3P 1EH8A 4DYRA 1KU9A 2F4IA 2KJCA 2F5FA 2NVTJ 1X2MA 1X3WB 2DDAA 3TOBA 2L01A 2JVGA 2QQBA 2X48A 4C2TA 2W82A 1SC7A 1IXSB 4HF1A 2W48A 4XSZF 2R7UA 5CVIA 1IF1A 3BPXA 2V79A 3IAS2 1VF9A 1I27A 3BJOA 2FXAA 5LBQA 3I4MJ 3OYCA 1VQ6I 2JA5J 3LQRA 5GTIC 4IXAA 3OYNA 1G2HA 1YTYA 3FXOA 3ESWB 2QUFA 1FT9A 3MWMA 4RBOA 3S15J 4N4OB 4HSRA 3BTCA 5E17F 1OR7A 2MLKA 5D6FA 3JRFA 3IWZA 2QBYA 4Z6YA 5C44J 1WWXA 3GTGJ 5K7ZA 1YYVA 3ECOA 2KDOA 3GMEA 4UHTA 3ZMTA 3HHHA 2HDWA 1N75A 2M8GX 2VBZA 2R7XA 4HQEA 3AL0B 3AG1H 3I55I 1HF0A 3C2HA 1ITYA 2A6HF 4LIVA 4CSWA 1VQ5I 4XLFA 2P0WA 3PFIA 3HOUJ 4ZYHA 4XM3A 3S3MA 2AXTC 2Y69H 3QPSA 4M9ZA 1T8IA 2O3FA 1AKHA 1IRGA 2EA2A 3I9V2 2EIMH 4E70A 3E6CC 2OC6A 3ROUA 4M74A 3LSKA 2ESHA 5JLXA 4KMUX 3RDIA 2QA4I 4RGXA 2P5LC 3LA3A 3CF2A 4A3DJ 2Y9ZA 2JVHA 1UHMA 3TP0A 4LOCA 1TLHB 2KDZA 4NC8A 1ONVA 2O0YA 4IZZA 1IUFA 1X1CA 1XSXA 3EUHC 3PNVA 2ME0A 3K9TA 2ZJRF 4HEA2 3G1MA 2OCCH 3H1CA 3S2HJ 4CCNA 2HQ5A 3S2DJ 4BQAA 5E1WA 2JRTA 1P2FA 2KT0A 3KP2A 1WZ2A 2E1OA 1TNTA 2X1DA 3BPVA 1S9HA 4HDUA 4EGZA 3V4GA 4Y13A 1UZCA 2OUMA 2Q8KA 4B4CA 1ZG3A 1A6IA 2HOAA 2BZTA 1QO0D 3GYHX 1I6HJ 4HF0A 1FSEA 1YITI 1KONA 1RESA 5A2QR 5F6FA 2JWTA 4MTEA 1DP7P 2BGCA 1GV2A 2E36A 2YS9A 3BQYA 3RIRA 3F8FA 4P5OA 3DTKA 4KIGA 5FROA 4ZDOA 3TDZC 1IV6A 4B09A 1Z6RA 2R7RA 5HLIA 4PDKA 2DYRH 1LB2A 2ISYA 2HVQA 4B3XA 1I3AA 3BP8A 2IT0A 2PFBA 1D1AA 1B1BA 3HJEA 2XRLA 4F55A 3HOXJ 2MH2A 2A07F 5DV5A 3J7ZI 3H5AA 3DTIA 4B44A 2VOOA 3GTPJ 2XVCA 4EVIA 4E7IA 2LTPA 3IH4A 4U7BA 5CJ9A 3GXOA 2ZNZA 4Y33A 4AIJA 2MW8A 3CMMA 2PBIA 1PP7U 4BAYA 1GT0C 4GFBA 3OOUA 1Z6TA 2X4HA 2DT5A 2MC3A 3K4LA 5GPAA 3GZ6A 4N9HA 1R00A 4B8XA 3IV5A 2VE9A 2ID3A 4LB6B 3SZTA 1AKHB 2OCEA 3KZYA 1BA5A 1XDUA 4MEYF 1Y8RB 2Q0OA 2XKPA 3QP6A 4LB5A 3JSOA 2QQ9A 1W4MA 2NOJB 3LSRA 1OISA 4WWCA 4I09A 4LLGF 4CH7A 4B47A 2E1MB 4AIDA 3P5JA 5K1YA 4U7DA 1W5CC 2FD5A 1IN5A 5H20A 1T33A 2Y31A 5BNGA 4AYBA 3DPUA 1WJFA 1R58A 2K3FA 4LFUA 2L9SA 2IS2A 3DF8A 4F7ZA 1W7PD 3IH3A 2LY1A 1HKQA 2X9DA 1V5FA 1UG0A 2TDXA 3GZ5A 1Z77A 2PG4A 3HKZN 3EPZA 4IEJA 5DUIA 2CWEA 3CUQB 3E97A 3KEYA 4AD9A 1IRZA 3WE3A 3OL4A 5E3NA 2NS0A 1MMDA 2VT2A 4KICA 1IG7A 2R7ZJ 1L3LA 1JKOC 4ZYDA 4RB1A 3DEUA 1OCPA 5L3EA 4PUSA 2K4BA 4UUSA 4I6ZA 1TT5B 1A04A 2ZFWA 5FKMA 5CYVA 2JUCA 2VKVA 4N0BA 3S2WA 2UXNA 3GFJA 3H92A 2QQ8A 3OIPA 5HVQC 4B3AA 2CU7A 1X3ZB 3GLLA 1U8RA 3RYPA 2L4MA 2IS1A 4M3DA 1B8IA 2ACJA 1QZYA 3T0YA 3J80R 3ABTA 4PSXA 1FPQA 2DFFA 3CUOA 5FJ8J 3CDLA 2Q2EB 1K78A 2K9MA 3OSGA 5KHDA 1DDNA 3SFIA 4DJAA 3OYHA 3D1NI 1Q1HA 1YG2A 2D2WA 5KCMA 3T1BA 1UHWA 2JMWA 1O3QA 2BVMA 1DU0A 1R36A 2COMA 2Y0SN 5FGMA 2V1UA 1R5ID 1Y0UA 4XICA 2NNNA 4PJLA 4M3GA 1WKMA 3GO5A 2NVUB 3ZQFA 2VONA 1SAXA 3KFWX 1ZARA 3V42A 5IP6A 1HDDC 1W5TA 2KISA 2MG4A 2JTVA 5KVRA 3BJAA 2Z5UA 4HA8A 1EV7A 4QLCU 4LG0A 3EUHA 2V9PA 4AVZA 5E20A 4FT8A 2DOFA 1MD0A 5J6XA 4KISA 1D5VA 4AWXB 1MSEC 4AIHA 1WQ2A 2LREA 4BNCA 4B1RA 2R7SA 2Z33A 2F5EA 3KIOA 4Y3OA 1NG6A 3I0TA 1UHSA 1UJ8A 1KQ9A 1YS6A 2E1CA 3K6GA 2R7OA 4M3EA 4A0XA 3E6DA 2R5YA 1WHUA 3K0LA 1T95A 2IGNA 5E1XA 3CESA 3RTRA 1NG7A 1A35A 1X19A 3BR3A 1MNEA 4ZJZA 3ZQLA 2QSGX 3A0HC 4OAYA 5CQEA 5DDGA 4KFCA 1RR7A 4A93J 2WAEA 4GRIA 1ZKGA 5DCMA 2TRTA 4ZZDA 4UB8C 1X2NA 2E35A 3OYEA 4HRIA 3PO2J 3BTJA 5F0CA 1FP1D 4FISA 1GUUA 1MJBA 2BHYA 4CXFA 5J1RA 1I1SA 1RI7A 2Y9YA 1EA3A 5ERIA 3OMYA 3I56I 3DPLC 1V4RA 1IJWC 3OYGA 1TL8A 1K78B 2EZKA 3FKJA 1LNWA 2K85A 3WHCA 4BJTA 1H0MA 4IHVA 1WFXA 4PSWA 2M8EA 1ZAOA 3FMQA 3RYRA 5GAEJ 1R23A 3B02A 2DA5A 2K4JA 1RUNA 4G7OF 2K27A 4M6XA 4BQOA 4CUGA 1P4WA 2LR8A 2DW4A 2Y0MA 4G6QA 3H9QA 5JVTA 3G73A 2EK5A 5F1RA 1D0XA 1D3YA 3P9IA 5KAIC 4ZYGA 2DFHA 4P55A 1XMKA 2HDDA 1HW1A 5J1UA 3F8MA 4ZH4F 4S04A 1FBQA 3C2GA 3HRUA 2IW5A 5CVRA 2FSWA 2DJIA 2R7DA 4RM2A 3DXJF 2VC0A 2ELHA 2HOSA 4Y7NJ 5FLXK 2CQXA 4CO8A 2M3AA 1S7OA 1MIJA 4BUPA 3QOPA 5D8LB 3I54A 4KJZA 3HSRA 5CKTA 3BTLA 3QAHA 4BL0B 1S29A 2A6EF 3NARA 2DPDA 4YEJA 4CCJA 2O8KA 5IT9R 1Y8QB 2ZSIB 4RLQA 2XGEA 1WPKA 1IRXA 1O7LA 3U1KA 3WHBA 3OSFA 5LGNA 2M5WA 2VXDA 1YFHA 1OCCH 1WI9A 2RDPA 2LF8A 2NVYJ 4KUMA 2CRGA 3R0JA 5JLWA 2CQQA 2Z99A 4HX4A 3TBIA 5F64A 3QRFF 5KNLA 3A01A 1D0YA 1R1VA 1RNLA 5DCMB 4IKFA 4BHCA 3GTQJ 3U2RA 4BDYA 2NS8A 2FF4A 5C4XJ 2L54A 1PUFB 2H8WA 1TWGJ 1IO2A 3MKWB 3AG2H 2XIGA 4OAZA 3CCSI 1ZYRF 3G1LA 5CQGA 4KITB 1ULYA 3FX3A 5HLGA 1EF4A 2X6XA 4DZJA 1FOXA 1HDPA 2EH3A 4IX7A 3F21A 4MHGA 3OIQA 3JAMR 2EZIA 3SHFA 1X1AA 2A69F 3MAJA 4BJ6C 4S0HB 4E6KG 3I4NJ 2COBA 4NUBA 1ENHA 3GLXA 2ME6A 1JUMA 3KEQA 3HSEA 3WTYC 4L9JA 3VYUB 3L1PA 2PLYA 2VQHA 3SJMA 2OAZA 3DQVC 3E1SA 4G8XA 4IRHA 3WGGA 3FF5A 2GXBA 3HYIA 4PFOA 1S6LA 1JJ6C 4AIKA 2F5CA 2H27A 1U9OA 1NHAA 4HYEA 4P9UA 3AKZA 1U6GA 5ILVA 3SXYA 1R9TJ 4I99C 2G9WA 1W7PB 4KT5C 3A52A 1A5JA 3NWTA 3HKZA 3QU3A 3CDIA 3SZPA 1YHQI 1TWHJ 4D7MA 4A0ZA 5HNHA 3ERMA 2H09A 2LD5A 1U2WA 1ETOA 1UMQA 5HLHA 3UNGC 1G3WA 4RAYA 3CTAA 3FXKA 5GTHC 2OTJI 2IRFG 2LKSA 1XGSA 2IVMA 4R1HA 2Y2ZA 1YX3A 4Q4ZF 3P9CA 3RZDJ 4BY7J 2P81A 3HTUA 2R4GA 1OYWA 3SYTA 3L2WA 4BBRJ 4UVCA 4D1QA 3LOCA 3K4JA 3A01B 3ZOBA 3DP7A 3HOZJ 2GOMA 2IAIA 3WGIA 3K70D 2HOTA 3E5XA 3CCLI 2A5YB 4X6AJ 3S1NJ 2ZCWA 2LSOA 3IKTA 1F5TA 2IS6A 2RNGA 5TGTA 2LY9A 2PI0A 3PUFA 3EDPA 4Y4RA 3FHNA 4UV8A 4QPOA 4BXUA 1H9GA 3W2VA 1ETXA 3OV8A 1VQKI 1EKEA 3CJQB 3BG6A 3CJRB 3IRQA 1IGNA 2V6EA 1H89C 2E2IJ 3L09A 5D8KB 2KKOA 1U3EM 2YSRA 1I6XA 1BI3A 2RV8A 2OA4A 2CW8A 2RAEA 3CJNA 4DBQA 5F0HA 1CGPA 2EV5A 5M3FJ 2LP0A 3H5NA 4UUTA 2Y0SA 5ILSA 2XF7A 2HTSA 3BZCA 3FXJA 4W1UA 2J5OA 2CQNA 3WG7H 2X98A 3AG3H 4DZPA 3L00A 1H9TA 2QYOA 3I53A 1BC7C 3FXUA 4PJJA 2NVXJ 3BG9A 3L2RA 4A3CJ 4XK4A 4AYBN 3VB2A 1R6RA 2EINH 2MZ4A 2M1BA 3QOEA 4E7JA 2DQLA 4EJWA 4HPQA 2K02A 3MKYB 1USTA 3OYKA 3HPGA 3BC8A 1ETKA 2HI3A 3LWFA 2L5QA 2STTA 3LQQA 2CUFA 3CMEI 2EJRA 4XKVA 1NTCA 3C18A 4ON0A 4IVNA 2CV2A 1TQMA 5C3EJ 1YW8A 2Z16A 1OCTC 5D4RA 3K10A 2E5ZA 4L9TA 1J2XA 2IBDA 4YIRX 4V2FA 2OV7A 2IA1A 4RDUA 4A3LJ 2FNAA 3KP4A 3EYYA 3OR2C 2BXYA 1Z1DA 4RAGA 4XORA 1S7EA 3DV8A 5H6RA 2IGMA 1B6AA 1JGSA 2M0CA 1R71A 3KP5A 2KQRA 4F52A 4HX7A 1X58A 3U1DA 2FEZA 1WSUA 4B43A 5F1JA 4L9VA 2FOKA 3OY9A 1AWCA 4CGZA 3M8FA 5IYCJ 2VBWA 4M9SA 3WODF 1EH7A 5D4SA 1HW2A 1BW6A 2XUBA 2HS5A 2PX9A 2Z3YA 5L3DA 4UXNA 1E3HA 3M1CA 3S1MJ 1SVOA 2IEKA 1FOKA 2IPQX 2JUGA 4BKXA 5AIPA 3IAM2 3OYFA 3A4CA 3H35A 3WU2C 3K2ZA 1MNMC 4D5CA 2X1CA 1T39A 3KYLA 3JTGA 4IQ4A 4JK1X 2HWVA 5KAFC 3ECHA 3ZP5A 5EEHA 2VKDA 4FCYA 1BOBA 1D0ZA 2ICWG 4EM1A 1KU2A 4FHTA 3L7WA 3S93A 2O6GE 3FZVA 1ZLJA 4KNYA 5FKOA 3BJ6A 3ASOH 4H4KC 4OIPF 2EV6A 2HOEA 3DU6A 4HW0A 4IOCF 3O8GA 3QP5A 1JHHA 2L0KA 3LMMA 3CP2A 1QVUA 1MH4A 3FXQA 5LRRA 4XLNF 2HQNA 2MC4A 3CD6I 1YIJI 5B1BH 4OMYA 3ZMSA 1ZRDA 3SEQA 4BDZA 4A6EA 2EWNA 3DEEA 1DGRM 1GV5A 2OBPA 3A2KA 2PMZA 3WTXC 4HAMA 1FTTA 2A6TA 4D9JA 2AQFA 4LLNA 2BW3B 4KIBA 2E7WA 2RQPA 2XAUA 1ETYA 2HVSA 1HBXG 2FOWA 3C1DA 1IW7F 2BV6A 5A2QZ 2EFQA 4A3BJ 1XS9A 2QENA 4IQJA 2PJPA 2JRMA 2WADA 5EG0B 1X4PA 2O9LA 3M8EA 5HDGA 1DQUA 3ZR8X 3HTSB 2LC2A 4DGWB 3SQNA 2KFDA 5FRNA 1PP8F 4ITVA 2FQ4A 2D5VA 3DBLB 2H94A 1T56A 3DKYA 1BL0A 2ZMEA 4XRSG 2BY1A 3GUDA 3O3KA 4EM0B 1JXSA 5J1YA 3GCMA 2P8TA 3J7AW 3ABLH 3REOA 5B3SH 1ZG1A 2YR2A 3S14J 1RC9A 1POGA 3GFMA 4V2GA 1XGOA 4WXDA 4XLAA 1YJWI 1V5GA 1IUYA 4WCGA 3WTWC 3VOEA 1GXPA 4J01A 3CJTB 2D1VA 3JRIA 4E7HA 3K1PA 3HXLA 2VT3A 3BG3A 3F6OA 4M3BA 2G7UA 2IS4A 3LSTA 1U5TC 3OS1A 2M35A 3HDDA 1TTYA 1HQCA 2VIXA 1LE8A 2ELJA 4N4NB 2EIJH 1D1CA 2YUSA 2XAQA 4I02A 2BEOA 2GZWA 5AIQA 1LKXA 2PQ8A 2XGCA 3VFZA 1O57A 2E2HJ 5K5RA 3OS0A 2L4AA 2LOOA 3KEOA 1AHDP 2LBFA 3W6JB 5D6EA 4Q47A 2N8GA 4GXOA 5FB2A 4CYCA 5L3GA 3H5RA 2NRAC 2YU9J 3S17J 4G6TB 2VBYA 3MZ8A 1E17A 1FIAA 4YELA 2FMYA 3H3UA 5FKKA 2W57A 3J81K 1VQ8I 4ZTFA 2QBYB 2WAQN 2RREA 2DTZA 3IRRA 4C30A 5L3FA 5J4YA 1UELB 3IP4B 2HDCA 4EV0A 3RPUA 2HXOA 3I59A 1Y1WJ 4RMNA 3HUGA 3SFZA 1XMXA 2L7KA 2VASA 3OYAA 4RGSA 1J5YA 1T08B 1V3FA 5JI6A 2KRHA 4EMSA 4E7ZA 5DTDA 2ZMEB 4UVAA 3BDDA 4XKWA 4XRFA 3KCCA 5EEGA 1WJCA 3BG7A 2W1OA 2DA6A 4OINF 1P7IA 2WAFA 2HR3A 1W0TA 2M4GA 2K9NA 3J80Z 3GTKJ 5IT3A 1OJLA 2FJ1A 3ERED 1TW3A 4IPAA 1UG2A 1OYYA 1TW2A 1O3TA 1I1GA 1TWCJ 3F3XA 3SDBA 1LFBA 3ZXSA 4A2UA 5CPRB 1FJLA 5EGOA 1RR8C 5FO5A 2WTEA 3RZOJ 2GXGA 4G6DA 3HIFA 2RVCA 2DO7A 2GAUA 3E0JB 1RUOA 2WB1N 1J7KA 4A6DA 3BLYA 1HKSA 2DOAA 2IGOA 2K5CA 2B0LA 2W4SA 3K1NA 4GYGA 3JR9A 1Z9CA 3EUKL 4D5FA 1B72A 3UKGA 4OU0A 5FLMJ 1SAUA 3GFIA 2QQAA 2NOGA 3M9AA 1QA6A 2E2JJ 3JRGA 4ESJA 4OOIA 2DDBA 4LK1F 5M5WJ 3R61A 1X1PA 2DK8A 2Y75A 1FSHA 5E79C 2L02A 2V9KA 1WJDA 2NYXA 2OZ6A 3ZQGA 4NBQA 4NC6A 3WTTC 3Q5FA 3DPTA 4KA4A 5K5QA 5TRDA 4XN0A 3LAPA 2QM3A 4CA0A 4M6YA 2ZXJA 3CDHA 3D5RC 5ICFA 2DFIA 2L2OA 3MZYA 2VN2A 2H6CA 3I59B 1H8AC 1GVDA 2JJ7A 3HUGB 4GO1A 2XAGA 3CCRI 1HSJA 4YFKF 1FYKA 1VQ4I 4L0ZB 2XAJA 1J9IA 4HLYA 1FC3A 1JI8A 2F5DA 3F8NA 3IHUA 1O4XA 4XLHA 4G9YA 3VYSB 3I64A 2VL8A 5DUKA 3N05A 2DMQA 3LFUA 4HLXA 3TO9A 3O6BB 2HEOA 1Z67A 3FXRA 2KIUA 2E71A 4BXFA 5HLTA 2KZGA 2K86A 4XN3A 4IHSA 1MJ9A 1XC5A 1YW7A 1WH5A 3L2CA 4E7LA 2XGDA 1P4XA 4YIFA 2YU3A 2R92J 4IOAF 2P7CB 4WXCA 3SZGA 4U0WA 3PSIA 2WA0A 4NQWA 2CJJA 3E5QA 4YIIA 3V7RA 2KIFA 5F04A 2CFXA 1PJRA 1H88C 2K9LA 3JRDA 2OZUA 2CUZA 2LKXA 2KPMA 1YOVB 3CMAI 4CCLA 5BS6A 4XL9A 4FQGA 3FMSA 1Z7LA 3CCEI 1JE8A 2BE5F 4M72A 2VKHA 4LIUA 4UY8I 5JHFA 5FD5A 3AAFA 5EZHA 1X4OA 3GTJJ 3HOSA 3M07A 4ZC3A 2CS3A 1YQAA 1FNNA 2RC4A 2ZC2A 3R0AA 5M3MJ 1KYWA 4E7KA 4UUSB 3MVPA 1VNDA 4IL6C 3TKYA 5LEKA 2JZYA 1MMAA 4FX0A 4QSHA 3ULQB 2E1NA 1HC8A 5IOZA 4NNJA 3S3NA 5IT9Z 3HRMA 1LVAA 2DMTA 1RZ4A 4XMYA 2LF7A 2AXLA 4N9IA 4HOBA 1B8IB 2JQ7A 2NXNB 1TWAJ 3H9JA 2W85A 2CV0A 2BVLA 1N25A 1V54H 4HV5A 5EDNA 4U0YA 1LDKB 2XV4S 4LGWA 2OD5A 1KQ0A 2IA0A 2MFZA 2AQEA 5IYBJ 4A3GJ 1ACIA 2ZNYA 3DEWA 4R8HA 2Q1ZB 1MBJA 3G3ZA 4A3MJ 1HCRA 1V55H 3LA7A 2HKXA 2VC1A 1R4MB 1J0RA 5DS9A 1WH7A 2L9RA 4DIQA 1ZG5A 2BYVE 4XKBA 2DMUA 1C0WA 2CSOA 2VJ4A 5HOOA 1YRNA 1FOWA 3P7NA 4NDLA 2A68F 1IDYA 1R5HA 2B9SA 2LKPA 2R7VA 3JAMZ 4WX9A 1LFPA 3QPTA 3BCAA 1D5YA 1ZREA 3W6KB 4RGRA 5BMZA 4LG0B 1D8JA 1YLFA 1IN4A 1KQ8A 4MLOA 3VSLA 4PCQA 4ZDLA 4OMZA 3QPLA 1U9NA 1X1BA 4BGDA 3FBNB 3EETA 2H1KA 5EF6A 3ZQCA 2QSHX 1YIOA 5EZGA 3RJPA 1F9NA 2LMDA 1JGGA 3VEPA 3K1MA 5CVJA 3I71A 3T5XA 4BEHA 5HNFA 3QQAA 1A6QA 4HNUA 2O5RA 3TQNA 3ASNH 3Q0VA 3ZCOA 3V8KA 1STZA 2PMZN 1D1BA 3B6AA 1MMGA 2R7FA 2R5YB 1VFCA 2GA2A 4UV9A 5KK1A 2ETHA 2E19A 3S1QJ 2DFEA 2WAQA 4D7NA 5LFAA 2HYFA 1SD6A 1TZLA 4U87A 1K4TA 4BACA 3NAUA 3HBLA 2XAHA 2E5NA 4MTDA 5K7HA 4FE4A 1YS7A 3RKWA 3H3ZA 3MEXA 1E2XA 3BR1A 3PNYA 3ZPLA 4AC0A 1PVEA 5LGTA 2FU4A 2VUMJ 1TC3C 4G7HF 2V26A 4E4HA 3O8HA 5FFZA 2DA3A 3PL8A 1JHFA 1Y1VJ 2DA1A 2DCEA 4XQFA 2GBYA 4O5VA 4MGRA 2QWWA 1LPQA 3EUAA 4GDFA 4ENKA 1WGXA 3R4KA 4KT6A 3E6MA 1LVKA 1Z91A 1K79A 1IAWA 4RB3C 3AL0C 1G8XA 3CCJI 2V6CA 3O2PE 4XSXF 3W2WA 5DEQA 2EFWA 1IRFA 2DU9A 4RB0A 1MNDA 2P6TA 1P92A 4M3FA 4ANJA 1W0UA 4A5MA 1MKMA 4L5JA 4I2OA 1IZ1A 1FBUA 2KL4A 4CCKA 3GTMJ 4A0YA 3NEUA 3TO6A 1QQIA 4KN4X 1IN8A 1RPWA 5IYDJ 1KA8A 2ZXHA 2P4WA 1XSDA 2BY2A 4RB2C 2WB1A 1OFCX 4DBRA 1BC8C 2V4JC 2MLGA 1KZHA 3WU0A 2DXIA 4EJUA 4O6JA 3FISA 2B7EA 4S05A 3TEDA 4HQMA 1FY7A 2F6CA 1YJ9I 3J7AY 3M7GA 3HOVJ 5FLXZ 2Y48A 3AG4H 5D5XB 1VQLI 4AUXA 3LL7A 4XKCA 3ZMDA 2HYGD 3FMRA 1BJAA 4PJMA 4BU2A 4DYQA 3T8TA 5FRMA 1APLC 3M3YJ 5LLQA 5TJJA 1W36C 1QPMA 2K40A 3ISPA 2PJRA 1DP3A 1XGMA 2GWRA 1MMNA 4AU7A 4I01A 1B59A 4K2EA 1D8KA 1LUJB 1WRJA 2JA6J 4KIFA 3HGYA 1KU3A 4XLEA 2CUJA 4PJNA 2JK3A 2EBIA 3IH2A 1S7AA 4LK0F 3R6SA 3OYJA 3HB9A 4I0AA 5HDNA 3KP6A 2VJJA 5IP7J 2VQCA 3VWBA 2M30A 6PAXA 5JVGF 3FK7A 3CCUI 1LEAA 4IHTA 2VODA 1YI2I 1QGPA 3H0GJ 4X1EA 1TT0A 4UNOA 5DCFA 1AOYA 3MZHA 3F9KA 4PK4A 3ZQHA 1OYIA 5GAHJ 2JN6A 3MFKA 4I0BA 3FM3A 2M87A 3V8LA 2K9SA 1MMSA 1ZQ3P 1I5ZA 1WJEA 2I8DA 4AVPA 5JFRA 3V7CA 3HEFA 3PIOF 3G1OA 3CC4I 4C3IJ 3E3VA 4MIMA 5FLXR 1USSA 2XF6A 3SEZA 2TCTA 1YX5A 4IHYA 3BROA 2MVTA 3K69A 1XD7A 3F72A 2P0TA 3I3LA 1K6OA 4BHPA 2E1MC 4NB5A 2R7TA 1PYVA 3H36A 2JA8J 4L9NA 1Y39A 2BY3A 3W6VA 2ID6A 1SFOJ 2JA7J 3WE2A 3V8JA 5J8CA 2V1XA 5ICEA 2QF7A 3MQ0A 1TQIA 3A02A 5D5WB 3LAJA 3W2AA 1S3JA 4FETA 1G6NA 3Q0WA 4MFDA 4DW6A 3RPUD 3A03A 5IP9J 4A69C 3CCMI 2EFNA 2MD0A 3CUQC 3K2AA 3HHGA 5E8IA 1PDNC 1VQOI 5LHHA 3JW4A 3ZMVA 1F36A 4EQQA 3CC7I 2HQRA 3LSPA 1BN5A 1XN7A 4XR6A 5TISC 4X0GA 1P6RA 1B9MA 1BIBA 5A2QK 1MW7A 2R7QA 4MO7A 5DD4A 4JBAA 1EJ9A 4OIOF 3WU1B 4U88A 1ZN2A 4ETSA 3V7SA 3WTUC 1ZRCA 2OQRA 4ZYAA 2MA3A 3QPHA 3CC2I 2X6OA 1S72I 1XDSA 1QHGA 2XB5A 3HG9A 4PZJA 5J4VA 2H8RA 5K7FA 3JREA 1R1TA 4RGUA 2DI3A 2VBXA 2B63J 3DLLF 1ETQA 3LSGA 5JHUA 1Z0XA 2XB0X 3NWSA 2WC2A 2DODA 2DAOA 3PUBA 3RKYA 1R4NB 1MBKA 3L2QA 2VB6A 2ZFUA 2XROA 1QBJA 1R22A 2E34A 3IUOA 4M9XA 4EJOA 2M9HA 2ISZA 5LHIA 1BR1A 2XKOA 3HGGA 2AS5F 4RS8A 3IKVA 4ESBA 2UV1A 1HOMA 2HXIA 1RETA 3DBHB 1HLVA 1OQYA 1O7FA 3LSHA 1UB9A 1DU6A 3DU5A 3VSKA 4QPQA 3JSPA 2PEXA 1MGTA 4A3FJ 4CCOA 5LRSA 5BPIA 2MBFA 2FBHA 2R0QC 4ENNA 2L7MP 3GFLA 2O03A 2IJLA 2F2EA 3PQKA 3A1YA 4FTHA 4IHWA 2CYYA 4XRMA 4JX4A 5FKLA 4IRIA 1QZZA 3U21A 1XX5A 2EFPA 4U0VA 3VPRA 1EH6A 4BY1J 1R5GA 2XPWA 2HPIA 3I4PA 3KZIC 4MQVA 5GAGJ 4Q48A 1FLIA 5BOXA 1ZRFA 1SFUA 3D5LA 5ICCA 2LH9A 3ML6A 3PNTA 3W3CA 2GA1A 1XPXA 1TQPA 1J09A 1FTZA 2ADUA 2RKHA 5E8GA 2ESNA 3DKWA 2M45A 3X2QH 4XLPF 1IXRC 2D1HA 3JTHA 3OL3A 1R7JA 5E18F 1CQTA 1Z3XA 3BZ6A 2R5ZA 2Z1DA 2VJ5A 1MBHA 2JPCA 3KZZA 1BW5A 2R93J 3G71I 1QZEA 1RKTA 4EGYA 1OLTA 1ERDA 2CQ7A 1XSVA 4CICA 2CGPA 3FM5A 3C3WA 3AFHA 1LJ9A 3B6CA 3ONQA 1JUSA 2MGQA 2XGXA 3PJRA 4HNTA 3FIWA 3J80K 3HOTA 3FK6A 2HFHA 3BOQA 1T6SA 2QGUA 4Y52J 4MEXF 2RGVA 4PGGA 5DD8A 2XPVA 3C7JA 4L5EA 1LDJA 3S32A 4ZTJA 1JUPA 1VZ0A 1IV8A 2F5VA 5AONA 2XSJC 2HVRA 2DTRA 2ZJQF 2O7OA 4JP0A 1OCZH 3BR2A 1ETVA 2M7BA 5F08A 3KLNA 3OYBA 2LYCA 5J3LA 3F22A 3LA2A 1OKRA 1ON2A 2FBIA 1SMTA 3GW2A 3WTVC 1REPC 4L0YB 1KYZA 2FNPA 2QKLB 3OIOA 4Z2YA 1ZELA 3HM5A 2NAZA 4ZYEA 3JRBA 1VQPI 1G3TA 3L2UA 4QWQA 3QYFA 4BJ5C 3CO6C 2FX0A 3K4BA 3FWEA 2ZKZA 2P6SA 3GTLJ 3CF5F 1MSFC 2ECCA 1YJNI 3MCZA 2EZLA 2W24A 3CUQA 1SANA 2BOLA 4C9YA 2VJIA 5GPCA 1K61A 4GCVA 3LFKA 5H2FC 2QEXI 1Y6IA 3OYMA 1QPIA 4II2A 1HKTA 1O3RA 4BE1A 3N97A 1QNTA 1JTYA 1SVLA 2ZXWH 1P9QC 1JTXA 2XDVA 5ILUA 2YX7A 2R5ZB 5IY5H 2W7NA 2X6WA 2DBBA 3BG5A 4M73A 2EQRA 1ETWA 2GLOA 2LRDA 1WI3A 5J8FA 5J47A 1LDDA 1S5LC 2ZSHB 2Q2EA 5HS9A 4HNVA 2ZBKA 1SFKA 1X1DA 3M4OJ 4BXXJ 2STWA 2UZKA 2DMNA 3TO7A 2DLLA 1LE8B 4IO9F 1MZBA 1ODDA 1QRYA 1Z3YA 4C2UA 1WCMJ 2DA7A 4MFEA 1OMIA 3BT9A 2CW0F 3OR1C 3LNQA 2UWMA 2R3SA 4P96A 4L5IA 3DCFA 1YO5C 4BYYA 2D45A 5E3LA 5J40A 2I10A 2LBFB 3TOAA 3PM1A 4MQ9F 1ON1A 4CYCB 1MBFA 2EILH 2KMUA 3HRTA 2JPBA 5B1AH 5B5EC 2RN7A 5FLVA 4CCMA 3Q9VA 3TMOA 3TDUC 1SFEA 2PN6A 4HF2A 4KDPA 3WTZA 1FYLA 2A3SA 3E6BA 3A0BC 4ZZLA 4OIRF 2GXAA
chains in the Genus database with same CATH topology
1L0OC 3D0SA 1UCRA 5K5OA 1MJAA 3J81Z 5H6QA 1LQ1A 3ZMUA 3EQLF 3J7AO 1BOAA 5IT9K 3WG9A 1DUXC 2XAFA 4L18B 2CO5A 4UUVA 4ENMA 4HDVA 2LNBA 4GGGA 5L3CA 4EJTA 2HTJA 5ED4A 1FX7A 3GX4X 4I7HA 2WWYA 3F8BA 2QVOA 1XCVA 3N4MA 4PGHA 3KP3A 5ICGA 1BBYA 3COAC 1B9NA 1DPRA 1MDMA 1U5TA 2ZJ2A 3JAMK 3I58A 2W25A 3RKXA 3L9FA 3ZQ7A 4D0PA 1Z05A 3TGNA 3RI4A 1BIAA 4ASNA 3GWZA 3M1EA 2A61A 2FQ3A 3CO7C 4O3MA 2PMHA 2UXXA 4NHJA 3HSFA 2V1DA 4DQ2A 5JR3A 1FZPB 2HGCA 2EA4A 3EYIA 1IN6A 2JSCA 4G94A 1ZHFA 4HZFA 4OIQF 3B73A 1GXQA 2IA2A 3DFGA 2DQRA 1B4AA 2RNJA 3BY6A 4ENJA 1SFXA 1U78A 4H0EA 2G7HA 2P7VB 1FBSA 2ZO4A 1ZLKA 3E5UA 1Z7UA 5DYMA 4KYWA 4WXHA 2FBKA 1KU7A 2FMLA 1T98A 5FFXA 3Q9SA 2W84A 2H6BA 1X3UA 1J59A 1MDMB 1U5TB 2J5PA 4LLLA 1ZGAA 2VE8A 4RAZA 2XHKA 2KRFA 4LMYA 1SD5A 5L3BA 3KP7A 1F1ZA 4IJAA 1TBXA 3KLOA 4Y17A 2CG4A 1K7AA 1VTNC 1CF7A 2OU2A 4CZZA 3IWFA 1W7PA 3ZN0A 4BH9A 2PMUA 2QLZA 2FE3A 1XB4A 3WTSC 5HS8A 1FYMA 3NRVA 2HKOA 1FWZA 1XGNA 4IF4A 1W5SA 3FHZA 3ABUA 1KGSA 4KN7X 4Y15A 4BHBA 2EB7A 1SD7A 4A12A 2HZTA 5CLSA 2FA5A 1OPCA 4KMFA 1S8NA 4GYIA 1J75A 1BI0A 2XASA 3KETA 2IP2A 3U9GA 1BM9A 2OQGA 3WGHA 2O8XA 2WV0A 5HS7A 1T0FA 3CLOA 2Z9OA 3F23A 1CF7B 4ESFA 1R1UA 4YFXF 2E7XA 4P9FA 4HBLA 5D5VB 1SMYF 2KIMA 3R60A 4UVBA 2VXZA 2GIVA 4G7ZF 4WF2A 1GVJA 2C6YA 3QU6A 4CYDA 5D5UB 2VOPA 4EM2A 1ZGJA 5LGUA 3NQOA 4DNCA 2GQQA 3GEZA 4CHUA 1DPUA 3GF2A 5LEJA 5HDKA 4CDGA 2FRHA 1RIOH 1XMAA 4I98B 2YPRA 2EFOA 4HX8A 3IC7A 5CVVA 4Q5SF 1GHCA 2P5KA 5LHGA 4M71A 1ZH5A 3OOPA 3ZMZA 2NNYA 3IL2A 1BI2A 1HW5A 2MH9A 3BWGA 2BBYA 2O61A 4WK8F 4IRGA 1HSTA 1LEBA 2LDUA 4A5NA 1P4AA 4YFNF 4R79A 1O3SA 5FD6A 2KJBA 1G4DA 2DK5A 2EV0A 3HRSA 4EJVA 2K7LA 3P9KA 5E1ZB 4HV6A 4YG2F 1XCBA 3RPQA 4JQFA 1T38A 2X0LA 3KE2A 3GVAA 4TV7A 1SD4A 1G3YA 3F6VA 4MNUA 2DPUA 4LJZF 2JT1A 2MD5A 3T8RA 3PQJA 1IN7A 3ELKA 1TNSA 4XBFA 1G3SA 1BI1A 3I5UA 5BPDA 5CVUA 3VODA 1T2KA 4FX4A 1IXCA 1YW9A 1HXDA 3F8CA 2L3DA 1PUEE 2YX4A 2CQKA 4LD5A 1F4KA 5BQTA 3ZN1A 2V9VA 1FP2A 1UFMA 2P5VA 2QZ8A 2XRNA 1EH8A 1KU9A 2KJCA 2F5FA 3TOBA 2L01A 2QQBA 1IXSB 4HF1A 4XSZF 5CVIA 1IF1A 3BPXA 2V79A 1I27A 3BJOA 2FXAA 5LBQA 3LQRA 4IXAA 1YTYA 2QUFA 1FT9A 3MWMA 5E17F 1OR7A 2MLKA 5D6FA 2QBYA 3IWZA 1WWXA 1YYVA 3ECOA 4UHTA 3ZMTA 3HHHA 2VBZA 4HQEA 2A6HF 3PFIA 4ZYHA 4M9ZA 2O3FA 1IRGA 2EA2A 4E70A 3E6CC 3ROUA 4M74A 2ESHA 4KMUX 3RDIA 4RGXA 2P5LC 3LA3A 1UHMA 1TLHB 1ONVA 2O0YA 1XSXA 3K9TA 4BQAA 5E1WA 2JRTA 1P2FA 3KP2A 1TNTA 3BPVA 4HDUA 4EGZA 3V4GA 4Y13A 2Q8KA 1ZG3A 1QO0D 3GYHX 4HF0A 1FSEA 5F6FA 4MTEA 1DP7P 2BGCA 3RIRA 3F8FA 4P5OA 4KIGA 3TDZC 4B09A 1Z6RA 5HLIA 4PDKA 1LB2A 2ISYA 3BP8A 2IT0A 2PFBA 1B1BA 2MH2A 2A07F 5DV5A 2VOOA 2XVCA 4EVIA 4U7BA 5CJ9A 3GXOA 2ZNZA 4AIJA 2PBIA 1PP7U 4BAYA 1Z6TA 2X4HA 2DT5A 2MC3A 3GZ6A 4N9HA 1R00A 4B8XA 2VE9A 4LB6B 3SZTA 3KZYA 1XDUA 4MEYF 2Q0OA 2XKPA 3QP6A 4LB5A 3JSOA 2QQ9A 1W4MA 4WWCA 4I09A 4LLGF 4U7DA 5K1YA 1IN5A 5H20A 1R58A 4LFUA 3DF8A 4F7ZA 1W7PD 1HKQA 2TDXA 3GZ5A 2PG4A 5DUIA 2CWEA 3CUQB 3E97A 4AD9A 3WE3A 2NS0A 2VT2A 4KICA 1L3LA 4ZYDA 3DEUA 5L3EA 2K4BA 1A04A 2ZFWA 5CYVA 4N0BA 3S2WA 2UXNA 3GFJA 3H92A 5HVQC 1U8RA 3RYPA 2L4MA 2ACJA 1QZYA 3T0YA 3ABTA 1FPQA 3CUOA 1K78A 1DDNA 1Q1HA 1YG2A 2D2WA 3T1BA 1UHWA 1O3QA 1R36A 2COMA 5FGMA 2V1UA 1Y0UA 2NNNA 1WKMA 3GO5A 2VONA 1SAXA 3KFWX 1ZARA 1W5TA 2JTVA 5KVRA 3BJAA 2Z5UA 4HA8A 1EV7A 4QLCU 4LG0A 3EUHA 5E20A 4FT8A 1MD0A 5J6XA 1D5VA 4AWXB 4AIHA 1WQ2A 4BNCA 2Z33A 2F5EA 3I0TA 1KQ9A 1YS6A 2E1CA 4A0XA 3E6DA 3K0LA 5E1XA 3RTRA 5DDGA 4KFCA 5DCMA 4ZZDA 1FP1D 4CXFA 1I1SA 1MJBA 1RI7A 5ERIA 3DPLC 1V4RA 1K78B 1LNWA 1H0MA 2M8EA 1ZAOA 3FMQA 3RYRA 1R23A 3B02A 2K4JA 1RUNA 4G7OF 2K27A 4M6XA 1P4WA 2DW4A 2Y0MA 4G6QA 5JVTA 3G73A 2EK5A 5F1RA 1D3YA 3P9IA 4ZYGA 4P55A 1XMKA 1HW1A 3F8MA 4ZH4F 4S04A 1FBQA 3HRUA 2IW5A 5CVRA 2FSWA 2R7DA 3DXJF 2VC0A 2ELHA 5FLXK 4CO8A 1S7OA 3QOPA 5D8LB 3I54A 3HSRA 3QAHA 1S29A 2A6EF 2DPDA 1O7LA 5LGNA 2M5WA 1YFHA 1WI9A 2RDPA 2LF8A 4KUMA 3R0JA 2Z99A 4HX4A 5F64A 3QRFF 1R1VA 1RNLA 5DCMB 4BHCA 3U2RA 2FF4A 2L54A 2XIGA 1ZYRF 1ULYA 3FX3A 5HLGA 3F21A 4MHGA 3SHFA 2A69F 3MAJA 3GLXA 3KEQA 3HSEA 3WTYC 4L9JA 2PLYA 2OAZA 3DQVC 4G8XA 4IRHA 3WGGA 3FF5A 2GXBA 3HYIA 1S6LA 4AIKA 2F5CA 2H27A 1NHAA 4HYEA 4P9UA 1U6GA 5ILVA 3SXYA 2G9WA 1W7PB 4KT5C 3QU3A 3SZPA 4A0ZA 2H09A 1U2WA 5HLHA 1G3WA 4RAYA 3CTAA 2IRFG 1XGSA 2IVMA 4R1HA 4Q4ZF 3P9CA 3HTUA 1OYWA 4UVCA 3DP7A 3WGIA 3E5XA 2A5YB 2ZCWA 2LSOA 3IKTA 1F5TA 2PI0A 3EDPA 4UV8A 4BXUA 1H9GA 3OV8A 3IRQA 3L09A 5D8KB 2KKOA 1U3EM 1I6XA 2YSRA 1BI3A 2RV8A 2OA4A 3CJNA 1CGPA 2EV5A 5ILSA 2HTSA 2J5OA 1H9TA 3L00A 2QYOA 3I53A 1BC7C 3FXUA 3VB2A 2M1BA 2DQLA 4EJWA 2K02A 1USTA 3LWFA 2STTA 3LQQA 2EJRA 3C18A 4ON0A 4IVNA 1TQMA 1YW8A 5D4RA 4L9TA 1J2XA 2IA1A 2FNAA 3KP4A 3EYYA 1Z1DA 3DV8A 5H6RA 1B6AA 1JGSA 3KP5A 4HX7A 3U1DA 2FEZA 1WSUA 4L9VA 2FOKA 1AWCA 4CGZA 3M8FA 2VBWA 4M9SA 3WODF 1EH7A 5D4SA 1HW2A 2XUBA 2HS5A 2Z3YA 5L3DA 4UXNA 1FOKA 2IPQX 5AIPA 3K2ZA 1T39A 3JTGA 4JK1X 2HWVA 3ECHA 3ZP5A 5EEHA 4EM1A 1KU2A 4FHTA 3L7WA 2O6GE 4KNYA 3FZVA 1ZLJA 3BJ6A 4OIPF 2EV6A 2HOEA 4HW0A 3QP5A 1JHHA 3FXQA 5LRRA 4XLNF 2HQNA 4OMYA 3ZMSA 1ZRDA 4A6EA 2EWNA 2OBPA 3WTXC 4HAMA 4LLNA 4KIBA 2E7WA 2RQPA 1HBXG 3C1DA 1IW7F 2BV6A 5A2QZ 2EFQA 2QENA 2PJPA 3M8EA 5HDGA 3HTSB 3SQNA 1PP8F 2H94A 2ZMEA 3GUDA 3O3KA 4EM0B 1JXSA 2P8TA 3REOA 1ZG1A 2YR2A 3GFMA 4WXDA 1XGOA 1IUYA 4WCGA 3WTWC 3VOEA 1GXPA 2D1VA 3K1PA 2VT3A 3F6OA 2G7UA 3LSTA 1U5TC 1TTYA 1HQCA 2XAQA 4I02A 2BEOA 2GZWA 5AIQA 2PQ8A 3VFZA 1O57A 5K5RA 2L4AA 3KEOA 3W6JB 5D6EA 4Q47A 4GXOA 5FB2A 5L3GA 2NRAC 2VBYA 1E17A 2FMYA 3H3UA 2W57A 3J81K 2QBYB 3IRRA 5L3FA 2HDCA 4EV0A 3RPUA 3I59A 3HUGA 3SFZA 4RGSA 1J5YA 1V3FA 5JI6A 4EMSA 2ZMEB 4UVAA 3BDDA 4XRFA 3KCCA 5EEGA 4OINF 2HR3A 3J80Z 5IT3A 3ERED 1TW3A 4IPAA 1OYYA 1TW2A 1O3TA 1I1GA 4A2UA 3F3XA 5FO5A 2WTEA 2GXGA 4G6DA 3HIFA 2RVCA 2DO7A 2GAUA 1RUOA 1J7KA 4A6DA 1HKSA 4GYGA 1Z9CA 2B0LA 3K1NA 4OU0A 3GFIA 2QQAA 3M9AA 4ESJA 4OOIA 4LK1F 3R61A 2DK8A 2Y75A 1FSHA 2L02A 2NYXA 2OZ6A 3WTTC 3Q5FA 3DPTA 4KA4A 5K5QA 5TRDA 3LAPA 2QM3A 4M6YA 2ZXJA 3CDHA 5ICFA 2DFIA 3MZYA 2VN2A 2H6CA 3I59B 4GO1A 2XAGA 4L0ZB 1HSJA 4YFKF 1FYKA 1J9IA 2XAJA 4HLYA 1FC3A 4OIRF 2F5DA 3F8NA 3IHUA 4G9YA 3I64A 5DUKA 4HLXA 3TO9A 3O6BB 2HEOA 3FXRA 2KIUA 2K86A 4IHSA 1MJ9A 1YW7A 3L2CA 1P4XA 4YIFA 2YU3A 2P7CB 4WXCA 4U0WA 4NQWA 3E5QA 4YIIA 3V7RA 2KIFA 2CFXA 2OZUA 5BS6A 3FMSA 1JE8A 2BE5F 4M72A 5FD5A 3AAFA 3HOSA 1YQAA 1FNNA 2RC4A 3R0AA 1KYWA 3TKYA 5LEKA 2JZYA 4FX0A 3ULQB 2E1NA 5IT9Z 3HRMA 1LVAA 1RZ4A 2LF7A 2AXLA 4N9IA 4HOBA 2W85A 4HV5A 4U0YA 1LDKB 2XV4S 4LGWA 2OD5A 1KQ0A 2IA0A 2ZNYA 4R8HA 3G3ZA 3LA7A 2HKXA 2VC1A 1J0RA 1ZG5A 2BYVE 1C0WA 2CSOA 5HOOA 3P7NA 2A68F 1R5HA 2LKPA 3JAMZ 4WX9A 3QPTA 1ZREA 3W6KB 4RGRA 5BMZA 4LG0B 1D8JA 1YLFA 1IN4A 1KQ8A 4PCQA 4OMZA 3EETA 1YIOA 3RJPA 1F9NA 3VEPA 3K1MA 5CVJA 3I71A 3T5XA 3TQNA 3V8KA 1STZA 2R7FA 2GA2A 4UV9A 5KK1A 2ETHA 2HYFA 1SD6A 2XAHA 4MTDA 1YS7A 3RKWA 3H3ZA 3MEXA 1E2XA 3ZPLA 5LGTA 2FU4A 4G7HF 5FFZA 1JHFA 4O5VA 4MGRA 2QWWA 4ENKA 3R4KA 3E6MA 1Z91A 1K79A 1IAWA 4RB3C 2V6CA 3O2PE 4XSXF 5DEQA 2EFWA 1IRFA 2DU9A 4RB0A 2P6TA 1P92A 4A5MA 1MKMA 4L5JA 4I2OA 1IZ1A 1FBUA 4A0YA 3NEUA 3TO6A 1QQIA 4KN4X 1IN8A 1KA8A 2P4WA 1XSDA 4RB2C 1BC8C 2MLGA 3WU0A 4EJUA 4O6JA 4S05A 4HQMA 1FY7A 3M7GA 5FLXZ 2Y48A 5D5XB 3ZMDA 2HYGD 3FMRA 1BJAA 3T8TA 5LLQA 5TJJA 1QPMA 3ISPA 1XGMA 2GWRA 4I01A 1B59A 4K2EA 1D8KA 1WRJA 4KIFA 1KU3A 1S7AA 4LK0F 3R6SA 4I0AA 5HDNA 3KP6A 2M30A 6PAXA 1LEAA 4IHTA 2VODA 1QGPA 4UNOA 5DCFA 1AOYA 3MZHA 1OYIA 3MFKA 4I0BA 3FM3A 2M87A 3V8LA 1I5ZA 4AVPA 5JFRA 3V7CA 3E3VA 1USSA 3BROA 3K69A 1XD7A 3F72A 1K6OA 4BHPA 4NB5A 4L9NA 3WE2A 3V8JA 5J8CA 2V1XA 5ICEA 3MQ0A 1TQIA 5D5WB 3LAJA 1S3JA 1G6NA 2EFNA 3CUQC 3HHGA 5E8IA 1PDNC 5LHHA 3JW4A 3ZMVA 4EQQA 2HQRA 1BN5A 1XN7A 1P6RA 1B9MA 1BIBA 5A2QK 5DD4A 4JBAA 4OIOF 3WU1B 4U88A 1ZN2A 4ETSA 3V7SA 3WTUC 1ZRCA 2OQRA 2MA3A 3QPHA 1XDSA 4PZJA 1R1TA 4RGUA 2DI3A 2VBXA 5JHUA 2WC2A 2DAOA 3RKYA 2XROA 1QBJA 1R22A 4M9XA 4EJOA 2ISZA 5LHIA 2XKOA 2AS5F 4RS8A 3IKVA 4ESBA 1O7FA 1UB9A 3JSPA 2PEXA 1MGTA 5LRSA 5BPIA 2MBFA 2FBHA 4ENNA 3GFLA 2O03A 2IJLA 2F2EA 3PQKA 2CYYA 4IRIA 1QZZA 2EFPA 4U0VA 1EH6A 1R5GA 3I4PA 4MQVA 4Q48A 1FLIA 5BOXA 1ZRFA 1SFUA 3D5LA 5ICCA 3ML6A 2GA1A 1TQPA 2ADUA 2RKHA 5E8GA 2ESNA 3DKWA 2M45A 4XLPF 2D1HA 1IXRC 3JTHA 1R7JA 5E18F 3BZ6A 2JPCA 3KZZA 4EGYA 1XSVA 4CICA 2CGPA 3FM5A 3C3WA 1LJ9A 2XGXA 3J80K 3HOTA 2HFHA 3BOQA 1T6SA 4MEXF 2RGVA 4PGGA 5DD8A 3C7JA 1LDJA 5AONA 2DTRA 3KLNA 3F22A 3LA2A 1OKRA 1ON2A 2FBIA 1SMTA 3GW2A 3WTVC 1REPC 4L0YB 1KYZA 2FNPA 4Z2YA 2NAZA 4ZYEA 1G3TA 4QWQA 3CO6C 3FWEA 2ZKZA 2P6SA 3MCZA 2W24A 3CUQA 4GCVA 3LFKA 1HKTA 1O3RA 3N97A 1QNTA 5ILUA 2YX7A 2DBBA 4M73A 5J8FA 1LDDA 2Q2EA 5HS9A 2ZBKA 2STWA 2UZKA 3TO7A 2DLLA 1MZBA 1ODDA 1OMIA 2CW0F 2UWMA 2R3SA 4P96A 4L5IA 1YO5C 4BYYA 2D45A 3TOAA 4MQ9F 1ON1A 3HRTA 2JPBA 2RN7A 3Q9VA 3TDUC 1SFEA 2PN6A 4HF2A 4KDPA 3WTZA 1FYLA 2A3SA 3E6BA 4ZZLA 4RB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0O C;  3D0S A;  1UCR A;  5K5O A;  1MJA A;  3J81 Z;  5H6Q A;  1LQ1 A;  3ZMU A;  3EQL F;  3J7A O;  1BOA A;  5IT9 K;  3WG9 A;  1DUX C;  2XAF A;  4L18 B;  2CO5 A;  4UUV A;  4ENM A;  4HDV A;  2LNB A;  4GGG A;  5L3C A;  4EJT A;  2HTJ A;  5ED4 A;  1FX7 A;  3GX4 X;  4I7H A;  2WWY A;  3F8B A;  2QVO A;  1XCV A;  3N4M A;  4PGH A;  3KP3 A;  5ICG A;  1BBY A;  3COA C;  1B9N A;  1DPR A;  1MDM A;  1U5T A;  2ZJ2 A;  3JAM K;  3I58 A;  2W25 A;  3RKX A;  3L9F A;  3ZQ7 A;  4D0P A;  1Z05 A;  3TGN A;  3RI4 A;  1BIA A;  4ASN A;  3GWZ A;  3M1E A;  2A61 A;  2FQ3 A;  3CO7 C;  4O3M A;  2PMH A;  2UXX A;  4NHJ A;  3HSF A;  2V1D A;  4DQ2 A;  5JR3 A;  1FZP B;  2HGC A;  2EA4 A;  3EYI A;  1IN6 A;  2JSC A;  4G94 A;  1ZHF A;  4HZF A;  4OIQ F;  3B73 A;  1GXQ A;  2IA2 A;  3DFG A;  2DQR A;  1B4A A;  2RNJ A;  3BY6 A;  4ENJ A;  1SFX A;  1U78 A;  4H0E A;  2G7H A;  2P7V B;  1FBS A;  2ZO4 A;  1ZLK A;  3E5U A;  1Z7U A;  5DYM A;  4KYW A;  4WXH A;  2FBK A;  1KU7 A;  2FML A;  1T98 A;  5FFX A;  3Q9S A;  2W84 A;  2H6B A;  1X3U A;  1J59 A;  1MDM B;  1U5T B;  2J5P A;  4LLL A;  1ZGA A;  2VE8 A;  4RAZ A;  2XHK A;  2KRF A;  4LMY A;  1SD5 A;  5L3B A;  3KP7 A;  1F1Z A;  4IJA A;  1TBX A;  3KLO A;  4Y17 A;  2CG4 A;  1K7A A;  1VTN C;  1CF7 A;  2OU2 A;  4CZZ A;  3IWF A;  1W7P A;  3ZN0 A;  4BH9 A;  2PMU A;  2QLZ A;  2FE3 A;  1XB4 A;  3WTS C;  5HS8 A;  1FYM A;  3NRV A;  2HKO A;  1FWZ A;  1XGN A;  4IF4 A;  1W5S A;  3FHZ A;  3ABU A;  1KGS A;  4KN7 X;  4Y15 A;  4BHB A;  2EB7 A;  1SD7 A;  4A12 A;  2HZT A;  5CLS A;  2FA5 A;  1OPC A;  4KMF A;  1S8N A;  4GYI A;  1J75 A;  1BI0 A;  2XAS A;  3KET A;  2IP2 A;  3U9G A;  1BM9 A;  2OQG A;  3WGH A;  2O8X A;  2WV0 A;  5HS7 A;  1T0F A;  3CLO A;  2Z9O A;  3F23 A;  1CF7 B;  4ESF A;  1R1U A;  4YFX F;  2E7X A;  4P9F A;  4HBL A;  5D5V B;  1SMY F;  2KIM A;  3R60 A;  4UVB A;  2VXZ A;  2GIV A;  4G7Z F;  4WF2 A;  1GVJ A;  2C6Y A;  3QU6 A;  4CYD A;  5D5U B;  2VOP A;  4EM2 A;  1ZGJ A;  5LGU A;  3NQO A;  4DNC A;  2GQQ A;  3GEZ A;  4CHU A;  1DPU A;  3GF2 A;  5LEJ A;  5HDK A;  4CDG A;  2FRH A;  1RIO H;  1XMA A;  4I98 B;  2YPR A;  2EFO A;  4HX8 A;  3IC7 A;  5CVV A;  4Q5S F;  1GHC A;  2P5K A;  5LHG A;  4M71 A;  1ZH5 A;  3OOP A;  3ZMZ A;  2NNY A;  3IL2 A;  1BI2 A;  1HW5 A;  2MH9 A;  3BWG A;  2BBY A;  2O61 A;  4WK8 F;  4IRG A;  1HST A;  1LEB A;  2LDU A;  4A5N A;  1P4A A;  4YFN F;  4R79 A;  1O3S A;  5FD6 A;  2KJB A;  1G4D A;  2DK5 A;  2EV0 A;  3HRS A;  4EJV A;  2K7L A;  3P9K A;  5E1Z B;  4HV6 A;  4YG2 F;  1XCB A;  3RPQ A;  4JQF A;  1T38 A;  2X0L A;  3KE2 A;  3GVA A;  4TV7 A;  1SD4 A;  1G3Y A;  3F6V A;  4MNU A;  2DPU A;  4LJZ F;  2JT1 A;  2MD5 A;  3T8R A;  3PQJ A;  1IN7 A;  3ELK A;  1TNS A;  4XBF A;  1G3S A;  1BI1 A;  3I5U A;  5BPD A;  5CVU A;  3VOD A;  1T2K A;  4FX4 A;  1IXC A;  1YW9 A;  1HXD A;  3F8C A;  2L3D A;  1PUE E;  2YX4 A;  2CQK A;  4LD5 A;  1F4K A;  5BQT A;  3ZN1 A;  2V9V A;  1FP2 A;  1UFM A;  2P5V A;  2QZ8 A;  2XRN A;  1EH8 A;  1KU9 A;  2KJC A;  2F5F A;  3TOB A;  2L01 A;  2QQB A;  1IXS B;  4HF1 A;  4XSZ F;  5CVI A;  1IF1 A;  3BPX A;  2V79 A;  1I27 A;  3BJO A;  2FXA A;  5LBQ A;  3LQR A;  4IXA A;  1YTY A;  2QUF A;  1FT9 A;  3MWM A;  5E17 F;  1OR7 A;  2MLK A;  5D6F A;  2QBY A;  3IWZ A;  1WWX A;  1YYV A;  3ECO A;  4UHT A;  3ZMT A;  3HHH A;  2VBZ A;  4HQE A;  2A6H F;  3PFI A;  4ZYH A;  4M9Z A;  2O3F A;  1IRG A;  2EA2 A;  4E70 A;  3E6C C;  3ROU A;  4M74 A;  2ESH A;  4KMU X;  3RDI A;  4RGX A;  2P5L C;  3LA3 A;  1UHM A;  1TLH B;  1ONV A;  2O0Y A;  1XSX A;  3K9T A;  4BQA A;  5E1W A;  2JRT A;  1P2F A;  3KP2 A;  1TNT A;  3BPV A;  4HDU A;  4EGZ A;  3V4G A;  4Y13 A;  2Q8K A;  1ZG3 A;  1QO0 D;  3GYH X;  4HF0 A;  1FSE A;  5F6F A;  4MTE A;  1DP7 P;  2BGC A;  3RIR A;  3F8F A;  4P5O A;  4KIG A;  3TDZ C;  4B09 A;  1Z6R A;  5HLI A;  4PDK A;  1LB2 A;  2ISY A;  3BP8 A;  2IT0 A;  2PFB A;  1B1B A;  2MH2 A;  2A07 F;  5DV5 A;  2VOO A;  2XVC A;  4EVI A;  4U7B A;  5CJ9 A;  3GXO A;  2ZNZ A;  4AIJ A;  2PBI A;  1PP7 U;  4BAY A;  1Z6T A;  2X4H A;  2DT5 A;  2MC3 A;  3GZ6 A;  4N9H A;  1R00 A;  4B8X A;  2VE9 A;  4LB6 B;  3SZT A;  3KZY A;  1XDU A;  4MEY F;  2Q0O A;  2XKP A;  3QP6 A;  4LB5 A;  3JSO A;  2QQ9 A;  1W4M A;  4WWC A;  4I09 A;  4LLG F;  4U7D A;  5K1Y A;  1IN5 A;  5H20 A;  1R58 A;  4LFU A;  3DF8 A;  4F7Z A;  1W7P D;  1HKQ A;  2TDX A;  3GZ5 A;  2PG4 A;  5DUI A;  2CWE A;  3CUQ B;  3E97 A;  4AD9 A;  3WE3 A;  2NS0 A;  2VT2 A;  4KIC A;  1L3L A;  4ZYD A;  3DEU A;  5L3E A;  2K4B A;  1A04 A;  2ZFW A;  5CYV A;  4N0B A;  3S2W A;  2UXN A;  3GFJ A;  3H92 A;  5HVQ C;  1U8R A;  3RYP A;  2L4M A;  2ACJ A;  1QZY A;  3T0Y A;  3ABT A;  1FPQ A;  3CUO A;  1K78 A;  1DDN A;  1Q1H A;  1YG2 A;  2D2W A;  3T1B A;  1UHW A;  1O3Q A;  1R36 A;  2COM A;  5FGM A;  2V1U A;  1Y0U A;  2NNN A;  1WKM A;  3GO5 A;  2VON A;  1SAX A;  3KFW X;  1ZAR A;  1W5T A;  2JTV A;  5KVR A;  3BJA A;  2Z5U A;  4HA8 A;  1EV7 A;  4QLC U;  4LG0 A;  3EUH A;  5E20 A;  4FT8 A;  1MD0 A;  5J6X A;  1D5V A;  4AWX B;  4AIH A;  1WQ2 A;  4BNC A;  2Z33 A;  2F5E A;  3I0T A;  1KQ9 A;  1YS6 A;  2E1C A;  4A0X A;  3E6D A;  3K0L A;  5E1X A;  3RTR A;  5DDG A;  4KFC A;  5DCM A;  4ZZD A;  1FP1 D;  4CXF A;  1I1S A;  1MJB A;  1RI7 A;  5ERI A;  3DPL C;  1V4R A;  1K78 B;  1LNW A;  1H0M A;  2M8E A;  1ZAO A;  3FMQ A;  3RYR A;  1R23 A;  3B02 A;  2K4J A;  1RUN A;  4G7O F;  2K27 A;  4M6X A;  1P4W A;  2DW4 A;  2Y0M A;  4G6Q A;  5JVT A;  3G73 A;  2EK5 A;  5F1R A;  1D3Y A;  3P9I A;  4ZYG A;  4P55 A;  1XMK A;  1HW1 A;  3F8M A;  4ZH4 F;  4S04 A;  1FBQ A;  3HRU A;  2IW5 A;  5CVR A;  2FSW A;  2R7D A;  3DXJ F;  2VC0 A;  2ELH A;  5FLX K;  4CO8 A;  1S7O A;  3QOP A;  5D8L B;  3I54 A;  3HSR A;  3QAH A;  1S29 A;  2A6E F;  2DPD A;  1O7L A;  5LGN A;  2M5W A;  1YFH A;  1WI9 A;  2RDP A;  2LF8 A;  4KUM A;  3R0J A;  2Z99 A;  4HX4 A;  5F64 A;  3QRF F;  1R1V A;  1RNL A;  5DCM B;  4BHC A;  3U2R A;  2FF4 A;  2L54 A;  2XIG A;  1ZYR F;  1ULY A;  3FX3 A;  5HLG A;  3F21 A;  4MHG A;  3SHF A;  2A69 F;  3MAJ A;  3GLX A;  3KEQ A;  3HSE A;  3WTY C;  4L9J A;  2PLY A;  2OAZ A;  3DQV C;  4G8X A;  4IRH A;  3WGG A;  3FF5 A;  2GXB A;  3HYI A;  1S6L A;  4AIK A;  2F5C A;  2H27 A;  1NHA A;  4HYE A;  4P9U A;  1U6G A;  5ILV A;  3SXY A;  2G9W A;  1W7P B;  4KT5 C;  3QU3 A;  3SZP A;  4A0Z A;  2H09 A;  1U2W A;  5HLH A;  1G3W A;  4RAY A;  3CTA A;  2IRF G;  1XGS A;  2IVM A;  4R1H A;  4Q4Z F;  3P9C A;  3HTU A;  1OYW A;  4UVC A;  3DP7 A;  3WGI A;  3E5X A;  2A5Y B;  2ZCW A;  2LSO A;  3IKT A;  1F5T A;  2PI0 A;  3EDP A;  4UV8 A;  4BXU A;  1H9G A;  3OV8 A;  3IRQ A;  3L09 A;  5D8K B;  2KKO A;  1U3E M;  1I6X A;  2YSR A;  1BI3 A;  2RV8 A;  2OA4 A;  3CJN A;  1CGP A;  2EV5 A;  5ILS A;  2HTS A;  2J5O A;  1H9T A;  3L00 A;  2QYO A;  3I53 A;  1BC7 C;  3FXU A;  3VB2 A;  2M1B A;  2DQL A;  4EJW A;  2K02 A;  1UST A;  3LWF A;  2STT A;  3LQQ A;  2EJR A;  3C18 A;  4ON0 A;  4IVN A;  1TQM A;  1YW8 A;  5D4R A;  4L9T A;  1J2X A;  2IA1 A;  2FNA A;  3KP4 A;  3EYY A;  1Z1D A;  3DV8 A;  5H6R A;  1B6A A;  1JGS A;  3KP5 A;  4HX7 A;  3U1D A;  2FEZ A;  1WSU A;  4L9V A;  2FOK A;  1AWC A;  4CGZ A;  3M8F A;  2VBW A;  4M9S A;  3WOD F;  1EH7 A;  5D4S A;  1HW2 A;  2XUB A;  2HS5 A;  2Z3Y A;  5L3D A;  4UXN A;  1FOK A;  2IPQ X;  5AIP A;  3K2Z A;  1T39 A;  3JTG A;  4JK1 X;  2HWV A;  3ECH A;  3ZP5 A;  5EEH A;  4EM1 A;  1KU2 A;  4FHT A;  3L7W A;  2O6G E;  4KNY A;  3FZV A;  1ZLJ A;  3BJ6 A;  4OIP F;  2EV6 A;  2HOE A;  4HW0 A;  3QP5 A;  1JHH A;  3FXQ A;  5LRR A;  4XLN F;  2HQN A;  4OMY A;  3ZMS A;  1ZRD A;  4A6E A;  2EWN A;  2OBP A;  3WTX C;  4HAM A;  4LLN A;  4KIB A;  2E7W A;  2RQP A;  1HBX G;  3C1D A;  1IW7 F;  2BV6 A;  5A2Q Z;  2EFQ A;  2QEN A;  2PJP A;  3M8E A;  5HDG A;  3HTS B;  3SQN A;  1PP8 F;  2H94 A;  2ZME A;  3GUD A;  3O3K A;  4EM0 B;  1JXS A;  2P8T A;  3REO A;  1ZG1 A;  2YR2 A;  3GFM A;  4WXD A;  1XGO A;  1IUY A;  4WCG A;  3WTW C;  3VOE A;  1GXP A;  2D1V A;  3K1P A;  2VT3 A;  3F6O A;  2G7U A;  3LST A;  1U5T C;  1TTY A;  1HQC A;  2XAQ A;  4I02 A;  2BEO A;  2GZW A;  5AIQ A;  2PQ8 A;  3VFZ A;  1O57 A;  5K5R A;  2L4A A;  3KEO A;  3W6J B;  5D6E A;  4Q47 A;  4GXO A;  5FB2 A;  5L3G A;  2NRA C;  2VBY A;  1E17 A;  2FMY A;  3H3U A;  2W57 A;  3J81 K;  2QBY B;  3IRR A;  5L3F A;  2HDC A;  4EV0 A;  3RPU A;  3I59 A;  3HUG A;  3SFZ A;  4RGS A;  1J5Y A;  1V3F A;  5JI6 A;  4EMS A;  2ZME B;  4UVA A;  3BDD A;  4XRF A;  3KCC A;  5EEG A;  4OIN F;  2HR3 A;  3J80 Z;  5IT3 A;  3ERE D;  1TW3 A;  4IPA A;  1OYY A;  1TW2 A;  1O3T A;  1I1G A;  4A2U A;  3F3X A;  5FO5 A;  2WTE A;  2GXG A;  4G6D A;  3HIF A;  2RVC A;  2DO7 A;  2GAU A;  1RUO A;  1J7K A;  4A6D A;  1HKS A;  4GYG A;  1Z9C A;  2B0L A;  3K1N A;  4OU0 A;  3GFI A;  2QQA A;  3M9A A;  4ESJ A;  4OOI A;  4LK1 F;  3R61 A;  2DK8 A;  2Y75 A;  1FSH A;  2L02 A;  2NYX A;  2OZ6 A;  3WTT C;  3Q5F A;  3DPT A;  4KA4 A;  5K5Q A;  5TRD A;  3LAP A;  2QM3 A;  4M6Y A;  2ZXJ A;  3CDH A;  5ICF A;  2DFI A;  3MZY A;  2VN2 A;  2H6C A;  3I59 B;  4GO1 A;  2XAG A;  4L0Z B;  1HSJ A;  4YFK F;  1FYK A;  1J9I A;  2XAJ A;  4HLY A;  1FC3 A;  4OIR F;  2F5D A;  3F8N A;  3IHU A;  4G9Y A;  3I64 A;  5DUK A;  4HLX A;  3TO9 A;  3O6B B;  2HEO A;  3FXR A;  2KIU A;  2K86 A;  4IHS A;  1MJ9 A;  1YW7 A;  3L2C A;  1P4X A;  4YIF A;  2YU3 A;  2P7C B;  4WXC A;  4U0W A;  4NQW A;  3E5Q A;  4YII A;  3V7R A;  2KIF A;  2CFX A;  2OZU A;  5BS6 A;  3FMS A;  1JE8 A;  2BE5 F;  4M72 A;  5FD5 A;  3AAF A;  3HOS A;  1YQA A;  1FNN A;  2RC4 A;  3R0A A;  1KYW A;  3TKY A;  5LEK A;  2JZY A;  4FX0 A;  3ULQ B;  2E1N A;  5IT9 Z;  3HRM A;  1LVA A;  1RZ4 A;  2LF7 A;  2AXL A;  4N9I A;  4HOB A;  2W85 A;  4HV5 A;  4U0Y A;  1LDK B;  2XV4 S;  4LGW A;  2OD5 A;  1KQ0 A;  2IA0 A;  2ZNY A;  4R8H A;  3G3Z A;  3LA7 A;  2HKX A;  2VC1 A;  1J0R A;  1ZG5 A;  2BYV E;  1C0W A;  2CSO A;  5HOO A;  3P7N A;  2A68 F;  1R5H A;  2LKP A;  3JAM Z;  4WX9 A;  3QPT A;  1ZRE A;  3W6K B;  4RGR A;  5BMZ A;  4LG0 B;  1D8J A;  1YLF A;  1IN4 A;  1KQ8 A;  4PCQ A;  4OMZ A;  3EET A;  1YIO A;  3RJP A;  1F9N A;  3VEP A;  3K1M A;  5CVJ A;  3I71 A;  3T5X A;  3TQN A;  3V8K A;  1STZ A;  2R7F A;  2GA2 A;  4UV9 A;  5KK1 A;  2ETH A;  2HYF A;  1SD6 A;  2XAH A;  4MTD A;  1YS7 A;  3RKW A;  3H3Z A;  3MEX A;  1E2X A;  3ZPL A;  5LGT A;  2FU4 A;  4G7H F;  5FFZ A;  1JHF A;  4O5V A;  4MGR A;  2QWW A;  4ENK A;  3R4K A;  3E6M A;  1Z91 A;  1K79 A;  1IAW A;  4RB3 C;  2V6C A;  3O2P E;  4XSX F;  5DEQ A;  2EFW A;  1IRF A;  2DU9 A;  4RB0 A;  2P6T A;  1P92 A;  4A5M A;  1MKM A;  4L5J A;  4I2O A;  1IZ1 A;  1FBU A;  4A0Y A;  3NEU A;  3TO6 A;  1QQI A;  4KN4 X;  1IN8 A;  1KA8 A;  2P4W A;  1XSD A;  4RB2 C;  1BC8 C;  2MLG A;  3WU0 A;  4EJU A;  4O6J A;  4S05 A;  4HQM A;  1FY7 A;  3M7G A;  5FLX Z;  2Y48 A;  5D5X B;  3ZMD A;  2HYG D;  3FMR A;  1BJA A;  3T8T A;  5LLQ A;  5TJJ A;  1QPM A;  3ISP A;  1XGM A;  2GWR A;  4I01 A;  1B59 A;  4K2E A;  1D8K A;  1WRJ A;  4KIF A;  1KU3 A;  1S7A A;  4LK0 F;  3R6S A;  4I0A A;  5HDN A;  3KP6 A;  2M30 A;  6PAX A;  1LEA A;  4IHT A;  2VOD A;  1QGP A;  4UNO A;  5DCF A;  1AOY A;  3MZH A;  1OYI A;  3MFK A;  4I0B A;  3FM3 A;  2M87 A;  3V8L A;  1I5Z A;  4AVP A;  5JFR A;  3V7C A;  3E3V A;  1USS A;  3BRO A;  3K69 A;  1XD7 A;  3F72 A;  1K6O A;  4BHP A;  4NB5 A;  4L9N A;  3WE2 A;  3V8J A;  5J8C A;  2V1X A;  5ICE A;  3MQ0 A;  1TQI A;  5D5W B;  3LAJ A;  1S3J A;  1G6N A;  2EFN A;  3CUQ C;  3HHG A;  5E8I A;  1PDN C;  5LHH A;  3JW4 A;  3ZMV A;  4EQQ A;  2HQR A;  1BN5 A;  1XN7 A;  1P6R A;  1B9M A;  1BIB A;  5A2Q K;  5DD4 A;  4JBA A;  4OIO F;  3WU1 B;  4U88 A;  1ZN2 A;  4ETS A;  3V7S A;  3WTU C;  1ZRC A;  2OQR A;  2MA3 A;  3QPH A;  1XDS A;  4PZJ A;  1R1T A;  4RGU A;  2DI3 A;  2VBX A;  5JHU A;  2WC2 A;  2DAO A;  3RKY A;  2XRO A;  1QBJ A;  1R22 A;  4M9X A;  4EJO A;  2ISZ A;  5LHI A;  2XKO A;  2AS5 F;  4RS8 A;  3IKV A;  4ESB A;  1O7F A;  1UB9 A;  3JSP A;  2PEX A;  1MGT A;  5LRS A;  5BPI A;  2MBF A;  2FBH A;  4ENN A;  3GFL A;  2O03 A;  2IJL A;  2F2E A;  3PQK A;  2CYY A;  4IRI A;  1QZZ A;  2EFP A;  4U0V A;  1EH6 A;  1R5G A;  3I4P A;  4MQV A;  4Q48 A;  1FLI A;  5BOX A;  1ZRF A;  1SFU A;  3D5L A;  5ICC A;  3ML6 A;  2GA1 A;  1TQP A;  2ADU A;  2RKH A;  5E8G A;  2ESN A;  3DKW A;  2M45 A;  4XLP F;  2D1H A;  1IXR C;  3JTH A;  1R7J A;  5E18 F;  3BZ6 A;  2JPC A;  3KZZ A;  4EGY A;  1XSV A;  4CIC A;  2CGP A;  3FM5 A;  3C3W A;  1LJ9 A;  2XGX A;  3J80 K;  3HOT A;  2HFH A;  3BOQ A;  1T6S A;  4MEX F;  2RGV A;  4PGG A;  5DD8 A;  3C7J A;  1LDJ A;  5AON A;  2DTR A;  3KLN A;  3F22 A;  3LA2 A;  1OKR A;  1ON2 A;  2FBI A;  1SMT A;  3GW2 A;  3WTV C;  1REP C;  4L0Y B;  1KYZ A;  2FNP A;  4Z2Y A;  2NAZ A;  4ZYE A;  1G3T A;  4QWQ A;  3CO6 C;  3FWE A;  2ZKZ A;  2P6S A;  3MCZ A;  2W24 A;  3CUQ A;  4GCV A;  3LFK A;  1HKT A;  1O3R A;  3N97 A;  1QNT A;  5ILU A;  2YX7 A;  2DBB A;  4M73 A;  5J8F A;  1LDD A;  2Q2E A;  5HS9 A;  2ZBK A;  2STW A;  2UZK A;  3TO7 A;  2DLL A;  1MZB A;  1ODD A;  1OMI A;  2CW0 F;  2UWM A;  2R3S A;  4P96 A;  4L5I A;  1YO5 C;  4BYY A;  2D45 A;  3TOA A;  4MQ9 F;  1ON1 A;  3HRT A;  2JPB A;  2RN7 A;  3Q9V A;  3TDU C;  1SFE A;  2PN6 A;  4HF2 A;  4KDP A;  3WTZ A;  1FYL A;  2A3S A;  3E6B A;  4ZZL A;  4RB1 A; 
#chains in the Genus database with same CATH topology
 2KRC A;  1L0O C;  3D0S A;  3Q3S A;  3S16 J;  2KHM A;  1NK2 P;  5IPA A;  2KP6 A;  1FMW A;  5C4J J;  1UCR A;  2ELK A;  5K5O A;  2A5W A;  3J7Y J;  1MJA A;  1WJ5 A;  4HG2 A;  4NC7 A;  2W00 A;  3J81 Z;  3H9G A;  2HU9 A;  5H6Q A;  3G4S I;  2L7F P;  1LQ1 A;  3ZMU A;  3EQL F;  2M0M A;  3J7A O;  3UR3 C;  1BOA A;  5IT9 K;  1LFU P;  3D5S C;  1R49 A;  3WG9 A;  2DN0 A;  3TW7 A;  1DUX C;  2XAF A;  4L18 B;  1JT0 A;  2CO5 A;  4UUV A;  4ENM A;  4HDV A;  2LNB A;  3GTO J;  2DYS H;  4GGG A;  5L3C A;  4EJT A;  2HTJ A;  4BQQ A;  5ED4 A;  4E7S A;  1VQ7 I;  4DOZ A;  1FX7 A;  2F4O B;  2IGK A;  2CH0 A;  2DOE A;  4I7H A;  3GX4 X;  2WWY A;  1VQM I;  1ZGW A;  3F8B A;  2DA2 A;  1TWF J;  2QVO A;  1XCV A;  3ABM H;  4V19 K;  2HPM A;  2X85 A;  1Z21 A;  3N4M A;  4PGH A;  1ZR4 A;  3KP3 A;  5ICG A;  5EGO B;  2R7W A;  4FE7 A;  2DA4 A;  1BBY A;  1I3Q J;  1SVM A;  3COA C;  1B9N A;  1DPR A;  4P1W A;  4ABZ A;  2I5U A;  4QIW N;  1MDM A;  5DM7 F;  3K7A J;  1U5T A;  2ZJ2 A;  3JAM K;  3I58 A;  2W25 A;  4XON A;  2ZB9 A;  3RKX A;  1B72 B;  1VQN I;  3L9F A;  1T0F C;  1AA7 A;  3ZQ7 A;  1MH3 A;  4D0P A;  2MUN A;  1ZK8 A;  1JKQ C;  2WV1 A;  1Z05 A;  3TGN A;  3J81 R;  3RI4 A;  2V1N A;  2G0E A;  1BIA A;  4ASN A;  3FXL A;  3GWZ A;  3M1E A;  4F93 B;  2A61 A;  2FQ3 A;  3CO7 C;  2Y30 A;  3S8P A;  4O3M A;  3KYC B;  2PMH A;  2FUG 2;  2ZJP F;  2UXX A;  4A3K J;  2M4K A;  2X6Y A;  1K6Y A;  1Q1V A;  1FOY A;  3DLA A;  1W1W E;  3HSF A;  4NHJ A;  2BXZ A;  4A3E J;  2V1D A;  3MD2 A;  1M1E B;  3RSN A;  4DQ2 A;  5JR3 A;  3S1R J;  1FZP B;  2HGC A;  3KPH A;  2EA4 A;  4RAF A;  4XID A;  3EYI A;  3BZK A;  1IN6 A;  2JSC A;  4G94 A;  2Z2S B;  1ZHF A;  4HZF A;  4OIQ F;  3HOW J;  3B73 A;  1GXQ A;  2IA2 A;  3DFG A;  1GLN A;  2NVQ J;  1GDT A;  3FXM A;  2BHZ A;  2DQR A;  2K9Q A;  1B4A A;  5M5X J;  4RLF A;  2RNJ A;  3LSI A;  3BY6 A;  4OWR B;  1SFX A;  4ENJ A;  1U78 A;  4JX5 A;  4H0E A;  2G7H A;  2P7V B;  3E7L A;  1WVR A;  1FBS A;  2ZO4 A;  3CCV I;  3TP3 A;  1ZLK A;  3ABK H;  3E5U A;  3K4N A;  4UB6 C;  5LD2 C;  1Z7U A;  1PUF A;  5DYM A;  4EEF G;  4KYW A;  3KX2 A;  4WXH A;  1QU3 A;  2V7F A;  2FBK A;  2LG4 A;  3MKL A;  4JOM A;  1KU7 A;  2FML A;  1WJB A;  2ZXI A;  2GIZ A;  1T98 A;  4BE2 A;  5FFX A;  4BS9 A;  3G2B A;  3Q9S A;  2OTL I;  3HZJ A;  2W84 A;  3GZN B;  2H6B A;  3SDG A;  4JYK A;  4NQW B;  3GBG A;  1A36 A;  1X3U A;  2H1L A;  1SEU A;  2VPL A;  1J59 A;  2A05 A;  4XNF A;  4F92 B;  1MDM B;  5F0F A;  1U5T B;  5GAD J;  4PFP A;  2J5P A;  3PFY A;  4LLL A;  1Y0N A;  1ZGA A;  3DWL E;  3K4C A;  2VE8 A;  4RAZ A;  2XHK A;  2KRF A;  4LMY A;  1SD5 A;  1MBG A;  1P7J A;  2LFB A;  5L3B A;  3KP7 A;  1FMV A;  1F1Z A;  2DMP A;  2KLO A;  2RQQ A;  1RRJ A;  3CZ6 A;  4IJA A;  1TBX A;  3KLO A;  4Y17 A;  2CG4 A;  4EAT A;  1K7A A;  3VYR B;  1JKR C;  1VTN C;  1NH3 A;  1CF7 A;  3MN2 A;  1F43 A;  3RQI A;  4LIT A;  3BCB A;  2AO9 A;  2OU2 A;  4CZZ A;  3OYD A;  3IWF A;  3BTI A;  1W7P A;  2XF5 A;  3ZN0 A;  4BH9 A;  3JRH A;  2M7A A;  2PMU A;  2OPT A;  2QCO A;  4BBS J;  5DM6 F;  3PIP F;  2AHQ A;  2FE3 A;  2QLZ A;  1XB4 A;  3WTS C;  3ZRG A;  5HS8 A;  1FYM A;  3NRV A;  2HKO A;  2L9V A;  5FKN A;  2CV1 A;  2LLK A;  3G6E I;  3QWL A;  1FWZ A;  1XGN A;  1RKW A;  4IF4 A;  1W5S A;  4C3J J;  1E0E A;  3FHZ A;  2KIQ A;  1WJA A;  3ABU A;  1V5E A;  4A3J J;  1KGS A;  4KN7 X;  4Y15 A;  4C2M J;  5IOY A;  3FBI B;  3CCY A;  4BHB A;  3CP8 A;  2EB7 A;  2XPU A;  3OWT A;  1SD7 A;  3VDX A;  4A12 A;  2HZT A;  1BJZ A;  1YRN B;  3DBR B;  2DT7 B;  5CLS A;  3JCU C;  3MKZ A;  4ZDP A;  3RKQ A;  2MYS A;  3JRC A;  3MMY B;  4DYC A;  5E3M A;  2FA5 A;  5GP9 A;  2L9N A;  2WY7 Q;  1OPC A;  2VKE A;  2JSP A;  4KMF A;  1S8N A;  3RCO A;  4GYI A;  1J75 A;  4B48 A;  1U0J A;  1BI0 A;  2XAS A;  3KET A;  2IP2 A;  4BEH B;  2WY8 Q;  5HOD A;  3FKI J;  4YRV A;  3U9G A;  1BM9 A;  4HST A;  2OQG A;  2VI6 A;  3HL2 A;  2WBM A;  3WGH A;  2O8X A;  1QVT A;  2XSD C;  2WV0 A;  4XOP A;  2M2E A;  1T0F A;  3BQZ A;  2QSF X;  5HS7 A;  3CLO A;  5E3O A;  2Z9O A;  3H3V K;  5F27 A;  4LG3 A;  1K4S A;  3CLQ A;  2HQA A;  3F23 A;  1W36 D;  2NS7 A;  1CF7 B;  2XC7 A;  4II3 A;  2GOX B;  3RQ4 A;  1DGW Y;  4ESF A;  1G59 A;  2BY0 A;  1Y56 A;  1R1U A;  2LY2 A;  4M6V A;  2CUE A;  4YFX F;  2E7X A;  4P9F A;  2DJN A;  4HBL A;  5D5V B;  1SMY F;  2OF7 A;  2L7Z A;  1FIP A;  3QYB A;  3BR0 A;  2KIM A;  3R60 A;  1OR7 C;  3H0D A;  4UVB A;  2K3P A;  1IC8 A;  1ZTR A;  2VXZ A;  1IDZ A;  2GIV A;  3CQZ J;  4WF2 A;  4G7Z F;  1GVJ A;  2C6Y A;  4W97 A;  3QU6 A;  4CYD A;  5B66 C;  4G12 A;  5D5U B;  1E3O C;  3OYI A;  3CCQ I;  1I39 A;  2VOP A;  4EM2 A;  4IHX A;  1ZGJ A;  5EEA A;  5LGU A;  3K70 C;  3NQO A;  4DNC A;  2GQQ A;  5EYR A;  3GEZ A;  2CFO A;  2QKM B;  2ZME C;  2VQG A;  1JJ8 C;  4CHU A;  1DPU A;  3DKX A;  2F48 A;  3GF2 A;  4QTR A;  3K4K A;  2EZH A;  5LEJ A;  1UAA A;  5HDK A;  2DT6 A;  4FAS D;  4CDG A;  3CMY A;  2FRH A;  3HC7 A;  3PSF A;  1RIO H;  1XMA A;  4I98 B;  2YPR A;  2EFO A;  2OJE D;  4HX8 A;  2LK2 A;  3IC7 A;  5CVV A;  4Q5S F;  1GHC A;  2P5K A;  5LHG A;  4M71 A;  1ZH5 A;  1HA8 A;  3OOP A;  2MSY A;  3ZMZ A;  2NNY A;  4RM3 A;  3HPH A;  1E3P A;  3IL2 A;  1BI2 A;  1HW5 A;  2MH9 A;  3BWG A;  9ANT A;  2CW7 A;  2BBY A;  1FEX A;  1U8B A;  2O61 A;  4WK8 F;  2EPF A;  4IRG A;  1HST A;  1OCR H;  3QOD A;  1LEB A;  2LDU A;  3OS2 A;  4A5N A;  3HOY J;  1P4A A;  3TW6 A;  4XRS A;  3BR5 A;  4YFN F;  3C2B A;  4R79 A;  1O3S A;  4RA2 A;  4C3H J;  2PJR B;  5FD6 A;  2KJB A;  1G4D A;  1AU7 A;  1XTA A;  2DK5 A;  2EV0 A;  3OYL A;  3HRS A;  2HYJ A;  3ZGK A;  1OCO H;  2EIK H;  2UUZ A;  4F91 B;  1N78 A;  2GM4 A;  4EJV A;  2K7L A;  3P9K A;  2IXS A;  5E1Z B;  4BE0 A;  3S3O A;  4HV6 A;  3LSJ A;  4YG2 F;  1XCB A;  2VPR A;  1BR2 A;  3RPQ A;  4JQF A;  4J00 A;  2BW3 A;  1T38 A;  2X51 A;  1I50 J;  2X0L A;  3ZQI A;  3KE2 A;  3GVA A;  3L2V A;  3M8J A;  4TV7 A;  1MBE A;  1TP4 A;  1SD4 A;  1G3Y A;  3F6V A;  3LSM A;  4MNU A;  2DPU A;  4CZC A;  3QYE A;  4LJZ F;  4I76 A;  2JT1 A;  5EJC A;  4A3I J;  1QHH D;  1VQ9 I;  3KYD B;  2MAB A;  2MD5 A;  4XLC A;  2ECB A;  3T8R A;  5EG0 A;  3JRA A;  3VYT B;  3PQJ A;  1IN7 A;  1VI0 A;  2M34 A;  3ELK A;  3ZQQ A;  1TNS A;  4XBF A;  1ORK A;  1G3S A;  4BQN A;  1BI1 A;  3I5U A;  1YE9 A;  5BPD A;  5CVU A;  1JKP C;  3F0C A;  2JA2 A;  2X1E A;  3BR6 A;  3FDY A;  3VOD A;  2VLA A;  1T2K A;  4FX4 A;  1IXC A;  1YW9 A;  3DTE A;  1JT6 A;  3Q0U A;  5M5Y J;  2CMP A;  1HXD A;  4PJ0 C;  4J19 A;  2KZV A;  3F8C A;  1BR4 A;  2L3D A;  1PUE E;  2YX4 A;  2HZD A;  4JX6 A;  2CQK A;  2F4M B;  4LD5 A;  2HNH A;  1F4K A;  3TL4 X;  2VQL A;  4XOT A;  4F3Q A;  5BQT A;  1RQ6 A;  2E60 A;  2V9V A;  3ZN1 A;  1A31 A;  2LVS A;  1ZR2 A;  1N77 A;  1XG1 A;  1FP2 A;  1UFM A;  1K83 J;  2P5V A;  4AM3 A;  3PO3 J;  2QZ8 A;  3K4M A;  2XRN A;  1NK3 P;  1EH8 A;  4DYR A;  1KU9 A;  2F4I A;  2KJC A;  2F5F A;  2NVT J;  1X2M A;  1X3W B;  2DDA A;  3TOB A;  2L01 A;  2JVG A;  2QQB A;  2X48 A;  4C2T A;  2W82 A;  1SC7 A;  1IXS B;  4HF1 A;  2W48 A;  4XSZ F;  2R7U A;  5CVI A;  1IF1 A;  3BPX A;  2V79 A;  3IAS 2;  1VF9 A;  1I27 A;  3BJO A;  2FXA A;  5LBQ A;  3I4M J;  3OYC A;  1VQ6 I;  2JA5 J;  3LQR A;  5GTI C;  4IXA A;  3OYN A;  1G2H A;  1YTY A;  3FXO A;  3ESW B;  2QUF A;  1FT9 A;  3MWM A;  4RBO A;  3S15 J;  4N4O B;  4HSR A;  3BTC A;  5E17 F;  1OR7 A;  2MLK A;  5D6F A;  3JRF A;  3IWZ A;  2QBY A;  4Z6Y A;  5C44 J;  1WWX A;  3GTG J;  5K7Z A;  1YYV A;  3ECO A;  2KDO A;  3GME A;  4UHT A;  3ZMT A;  3HHH A;  2HDW A;  1N75 A;  2M8G X;  2VBZ A;  2R7X A;  4HQE A;  3AL0 B;  3AG1 H;  3I55 I;  1HF0 A;  3C2H A;  1ITY A;  2A6H F;  4LIV A;  4CSW A;  1VQ5 I;  4XLF A;  2P0W A;  3PFI A;  3HOU J;  4ZYH A;  4XM3 A;  3S3M A;  2AXT C;  2Y69 H;  3QPS A;  4M9Z A;  1T8I A;  2O3F A;  1AKH A;  1IRG A;  2EA2 A;  3I9V 2;  2EIM H;  4E70 A;  3E6C C;  2OC6 A;  3ROU A;  4M74 A;  3LSK A;  2ESH A;  5JLX A;  4KMU X;  3RDI A;  2QA4 I;  4RGX A;  2P5L C;  3LA3 A;  3CF2 A;  4A3D J;  2Y9Z A;  2JVH A;  1UHM A;  3TP0 A;  4LOC A;  1TLH B;  2KDZ A;  4NC8 A;  1ONV A;  2O0Y A;  4IZZ A;  1IUF A;  1X1C A;  1XSX A;  3EUH C;  3PNV A;  2ME0 A;  3K9T A;  2ZJR F;  4HEA 2;  3G1M A;  2OCC H;  3H1C A;  3S2H J;  4CCN A;  2HQ5 A;  3S2D J;  4BQA A;  5E1W A;  2JRT A;  1P2F A;  2KT0 A;  3KP2 A;  1WZ2 A;  2E1O A;  1TNT A;  2X1D A;  3BPV A;  1S9H A;  4HDU A;  4EGZ A;  3V4G A;  4Y13 A;  1UZC A;  2OUM A;  2Q8K A;  4B4C A;  1ZG3 A;  1A6I A;  2HOA A;  2BZT A;  1QO0 D;  3GYH X;  1I6H J;  4HF0 A;  1FSE A;  1YIT I;  1KON A;  1RES A;  5A2Q R;  5F6F A;  2JWT A;  4MTE A;  1DP7 P;  2BGC A;  1GV2 A;  2E36 A;  2YS9 A;  3BQY A;  3RIR A;  3F8F A;  4P5O A;  3DTK A;  4KIG A;  5FRO A;  4ZDO A;  3TDZ C;  1IV6 A;  4B09 A;  1Z6R A;  2R7R A;  5HLI A;  4PDK A;  2DYR H;  1LB2 A;  2ISY A;  2HVQ A;  4B3X A;  1I3A A;  3BP8 A;  2IT0 A;  2PFB A;  1D1A A;  1B1B A;  3HJE A;  2XRL A;  4F55 A;  3HOX J;  2MH2 A;  2A07 F;  5DV5 A;  3J7Z I;  3H5A A;  3DTI A;  4B44 A;  2VOO A;  3GTP J;  2XVC A;  4EVI A;  4E7I A;  2LTP A;  3IH4 A;  4U7B A;  5CJ9 A;  3GXO A;  2ZNZ A;  4Y33 A;  4AIJ A;  2MW8 A;  3CMM A;  2PBI A;  1PP7 U;  4BAY A;  1GT0 C;  4GFB A;  3OOU A;  1Z6T A;  2X4H A;  2DT5 A;  2MC3 A;  3K4L A;  5GPA A;  3GZ6 A;  4N9H A;  1R00 A;  4B8X A;  3IV5 A;  2VE9 A;  2ID3 A;  4LB6 B;  3SZT A;  1AKH B;  2OCE A;  3KZY A;  1BA5 A;  1XDU A;  4MEY F;  1Y8R B;  2Q0O A;  2XKP A;  3QP6 A;  4LB5 A;  3JSO A;  2QQ9 A;  1W4M A;  2NOJ B;  3LSR A;  1OIS A;  4WWC A;  4I09 A;  4LLG F;  4CH7 A;  4B47 A;  2E1M B;  4AID A;  3P5J A;  5K1Y A;  4U7D A;  1W5C C;  2FD5 A;  1IN5 A;  5H20 A;  1T33 A;  2Y31 A;  5BNG A;  4AYB A;  3DPU A;  1WJF A;  1R58 A;  2K3F A;  4LFU A;  2L9S A;  2IS2 A;  3DF8 A;  4F7Z A;  1W7P D;  3IH3 A;  2LY1 A;  1HKQ A;  2X9D A;  1V5F A;  1UG0 A;  2TDX A;  3GZ5 A;  1Z77 A;  2PG4 A;  3HKZ N;  3EPZ A;  4IEJ A;  5DUI A;  2CWE A;  3CUQ B;  3E97 A;  3KEY A;  4AD9 A;  1IRZ A;  3WE3 A;  3OL4 A;  5E3N A;  2NS0 A;  1MMD A;  2VT2 A;  4KIC A;  1IG7 A;  2R7Z J;  1L3L A;  1JKO C;  4ZYD A;  4RB1 A;  3DEU A;  1OCP A;  5L3E A;  4PUS A;  2K4B A;  4UUS A;  4I6Z A;  1TT5 B;  1A04 A;  2ZFW A;  5FKM A;  5CYV A;  2JUC A;  2VKV A;  4N0B A;  3S2W A;  2UXN A;  3GFJ A;  3H92 A;  2QQ8 A;  3OIP A;  5HVQ C;  4B3A A;  2CU7 A;  1X3Z B;  3GLL A;  1U8R A;  3RYP A;  2L4M A;  2IS1 A;  4M3D A;  1B8I A;  2ACJ A;  1QZY A;  3T0Y A;  3J80 R;  3ABT A;  4PSX A;  1FPQ A;  2DFF A;  3CUO A;  5FJ8 J;  3CDL A;  2Q2E B;  1K78 A;  2K9M A;  3OSG A;  5KHD A;  1DDN A;  3SFI A;  4DJA A;  3OYH A;  3D1N I;  1Q1H A;  1YG2 A;  2D2W A;  5KCM A;  3T1B A;  1UHW A;  2JMW A;  1O3Q A;  2BVM A;  1DU0 A;  1R36 A;  2COM A;  2Y0S N;  5FGM A;  2V1U A;  1R5I D;  1Y0U A;  4XIC A;  2NNN A;  4PJL A;  4M3G A;  1WKM A;  3GO5 A;  2NVU B;  3ZQF A;  2VON A;  1SAX A;  3KFW X;  1ZAR A;  3V42 A;  5IP6 A;  1HDD C;  1W5T A;  2KIS A;  2MG4 A;  2JTV A;  5KVR A;  3BJA A;  2Z5U A;  4HA8 A;  1EV7 A;  4QLC U;  4LG0 A;  3EUH A;  2V9P A;  4AVZ A;  5E20 A;  4FT8 A;  2DOF A;  1MD0 A;  5J6X A;  4KIS A;  1D5V A;  4AWX B;  1MSE C;  4AIH A;  1WQ2 A;  2LRE A;  4BNC A;  4B1R A;  2R7S A;  2Z33 A;  2F5E A;  3KIO A;  4Y3O A;  1NG6 A;  3I0T A;  1UHS A;  1UJ8 A;  1KQ9 A;  1YS6 A;  2E1C A;  3K6G A;  2R7O A;  4M3E A;  4A0X A;  3E6D A;  2R5Y A;  1WHU A;  3K0L A;  1T95 A;  2IGN A;  5E1X A;  3CES A;  3RTR A;  1NG7 A;  1A35 A;  1X19 A;  3BR3 A;  1MNE A;  4ZJZ A;  3ZQL A;  2QSG X;  3A0H C;  4OAY A;  5CQE A;  5DDG A;  4KFC A;  1RR7 A;  4A93 J;  2WAE A;  4GRI A;  1ZKG A;  5DCM A;  2TRT A;  4ZZD A;  4UB8 C;  1X2N A;  2E35 A;  3OYE A;  4HRI A;  3PO2 J;  3BTJ A;  5F0C A;  1FP1 D;  4FIS A;  1GUU A;  1MJB A;  2BHY A;  4CXF A;  5J1R A;  1I1S A;  1RI7 A;  2Y9Y A;  1EA3 A;  5ERI A;  3OMY A;  3I56 I;  3DPL C;  1V4R A;  1IJW C;  3OYG A;  1TL8 A;  1K78 B;  2EZK A;  3FKJ A;  1LNW A;  2K85 A;  3WHC A;  4BJT A;  1H0M A;  4IHV A;  1WFX A;  4PSW A;  2M8E A;  1ZAO A;  3FMQ A;  3RYR A;  5GAE J;  1R23 A;  3B02 A;  2DA5 A;  2K4J A;  1RUN A;  4G7O F;  2K27 A;  4M6X A;  4BQO A;  4CUG A;  1P4W A;  2LR8 A;  2DW4 A;  2Y0M A;  4G6Q A;  3H9Q A;  5JVT A;  3G73 A;  2EK5 A;  5F1R A;  1D0X A;  1D3Y A;  3P9I A;  5KAI C;  4ZYG A;  2DFH A;  4P55 A;  1XMK A;  2HDD A;  1HW1 A;  5J1U A;  3F8M A;  4ZH4 F;  4S04 A;  1FBQ A;  3C2G A;  3HRU A;  2IW5 A;  5CVR A;  2FSW A;  2DJI A;  2R7D A;  4RM2 A;  3DXJ F;  2VC0 A;  2ELH A;  2HOS A;  4Y7N J;  5FLX K;  2CQX A;  4CO8 A;  2M3A A;  1S7O A;  1MIJ A;  4BUP A;  3QOP A;  5D8L B;  3I54 A;  4KJZ A;  3HSR A;  5CKT A;  3BTL A;  3QAH A;  4BL0 B;  1S29 A;  2A6E F;  3NAR A;  2DPD A;  4YEJ A;  4CCJ A;  2O8K A;  5IT9 R;  1Y8Q B;  2ZSI B;  4RLQ A;  2XGE A;  1WPK A;  1IRX A;  1O7L A;  3U1K A;  3WHB A;  3OSF A;  5LGN A;  2M5W A;  2VXD A;  1YFH A;  1OCC H;  1WI9 A;  2RDP A;  2LF8 A;  2NVY J;  4KUM A;  2CRG A;  3R0J A;  5JLW A;  2CQQ A;  2Z99 A;  4HX4 A;  3TBI A;  5F64 A;  3QRF F;  5KNL A;  3A01 A;  1D0Y A;  1R1V A;  1RNL A;  5DCM B;  4IKF A;  4BHC A;  3GTQ J;  3U2R A;  4BDY A;  2NS8 A;  2FF4 A;  5C4X J;  2L54 A;  1PUF B;  2H8W A;  1TWG J;  1IO2 A;  3MKW B;  3AG2 H;  2XIG A;  4OAZ A;  3CCS I;  1ZYR F;  3G1L A;  5CQG A;  4KIT B;  1ULY A;  3FX3 A;  5HLG A;  1EF4 A;  2X6X A;  4DZJ A;  1FOX A;  1HDP A;  2EH3 A;  4IX7 A;  3F21 A;  4MHG A;  3OIQ A;  3JAM R;  2EZI A;  3SHF A;  1X1A A;  2A69 F;  3MAJ A;  4BJ6 C;  4S0H B;  4E6K G;  3I4N J;  2COB A;  4NUB A;  1ENH A;  3GLX A;  2ME6 A;  1JUM A;  3KEQ A;  3HSE A;  3WTY C;  4L9J A;  3VYU B;  3L1P A;  2PLY A;  2VQH A;  3SJM A;  2OAZ A;  3DQV C;  3E1S A;  4G8X A;  4IRH A;  3WGG A;  3FF5 A;  2GXB A;  3HYI A;  4PFO A;  1S6L A;  1JJ6 C;  4AIK A;  2F5C A;  2H27 A;  1U9O A;  1NHA A;  4HYE A;  4P9U A;  3AKZ A;  1U6G A;  5ILV A;  3SXY A;  1R9T J;  4I99 C;  2G9W A;  1W7P B;  4KT5 C;  3A52 A;  1A5J A;  3NWT A;  3HKZ A;  3QU3 A;  3CDI A;  3SZP A;  1YHQ I;  1TWH J;  4D7M A;  4A0Z A;  5HNH A;  3ERM A;  2H09 A;  2LD5 A;  1U2W A;  1ETO A;  1UMQ A;  5HLH A;  3UNG C;  1G3W A;  4RAY A;  3CTA A;  3FXK A;  5GTH C;  2OTJ I;  2IRF G;  2LKS A;  1XGS A;  2IVM A;  4R1H A;  2Y2Z A;  1YX3 A;  4Q4Z F;  3P9C A;  3RZD J;  4BY7 J;  2P81 A;  3HTU A;  2R4G A;  1OYW A;  3SYT A;  3L2W A;  4BBR J;  4UVC A;  4D1Q A;  3LOC A;  3K4J A;  3A01 B;  3ZOB A;  3DP7 A;  3HOZ J;  2GOM A;  2IAI A;  3WGI A;  3K70 D;  2HOT A;  3E5X A;  3CCL I;  2A5Y B;  4X6A J;  3S1N J;  2ZCW A;  2LSO A;  3IKT A;  1F5T A;  2IS6 A;  2RNG A;  5TGT A;  2LY9 A;  2PI0 A;  3PUF A;  3EDP A;  4Y4R A;  3FHN A;  4UV8 A;  4QPO A;  4BXU A;  1H9G A;  3W2V A;  1ETX A;  3OV8 A;  1VQK I;  1EKE A;  3CJQ B;  3BG6 A;  3CJR B;  3IRQ A;  1IGN A;  2V6E A;  1H89 C;  2E2I J;  3L09 A;  5D8K B;  2KKO A;  1U3E M;  2YSR A;  1I6X A;  1BI3 A;  2RV8 A;  2OA4 A;  2CW8 A;  2RAE A;  3CJN A;  4DBQ A;  5F0H A;  1CGP A;  2EV5 A;  5M3F J;  2LP0 A;  3H5N A;  4UUT A;  2Y0S A;  5ILS A;  2XF7 A;  2HTS A;  3BZC A;  3FXJ A;  4W1U A;  2J5O A;  2CQN A;  3WG7 H;  2X98 A;  3AG3 H;  4DZP A;  3L00 A;  1H9T A;  2QYO A;  3I53 A;  1BC7 C;  3FXU A;  4PJJ A;  2NVX J;  3BG9 A;  3L2R A;  4A3C J;  4XK4 A;  4AYB N;  3VB2 A;  1R6R A;  2EIN H;  2MZ4 A;  2M1B A;  3QOE A;  4E7J A;  2DQL A;  4EJW A;  4HPQ A;  2K02 A;  3MKY B;  1UST A;  3OYK A;  3HPG A;  3BC8 A;  1ETK A;  2HI3 A;  3LWF A;  2L5Q A;  2STT A;  3LQQ A;  2CUF A;  3CME I;  2EJR A;  4XKV A;  1NTC A;  3C18 A;  4ON0 A;  4IVN A;  2CV2 A;  1TQM A;  5C3E J;  1YW8 A;  2Z16 A;  1OCT C;  5D4R A;  3K10 A;  2E5Z A;  4L9T A;  1J2X A;  2IBD A;  4YIR X;  4V2F A;  2OV7 A;  2IA1 A;  4RDU A;  4A3L J;  2FNA A;  3KP4 A;  3EYY A;  3OR2 C;  2BXY A;  1Z1D A;  4RAG A;  4XOR A;  1S7E A;  3DV8 A;  5H6R A;  2IGM A;  1B6A A;  1JGS A;  2M0C A;  1R71 A;  3KP5 A;  2KQR A;  4F52 A;  4HX7 A;  1X58 A;  3U1D A;  2FEZ A;  1WSU A;  4B43 A;  5F1J A;  4L9V A;  2FOK A;  3OY9 A;  1AWC A;  4CGZ A;  3M8F A;  5IYC J;  2VBW A;  4M9S A;  3WOD F;  1EH7 A;  5D4S A;  1HW2 A;  1BW6 A;  2XUB A;  2HS5 A;  2PX9 A;  2Z3Y A;  5L3D A;  4UXN A;  1E3H A;  3M1C A;  3S1M J;  1SVO A;  2IEK A;  1FOK A;  2IPQ X;  2JUG A;  4BKX A;  5AIP A;  3IAM 2;  3OYF A;  3A4C A;  3H35 A;  3WU2 C;  3K2Z A;  1MNM C;  4D5C A;  2X1C A;  1T39 A;  3KYL A;  3JTG A;  4IQ4 A;  4JK1 X;  2HWV A;  5KAF C;  3ECH A;  3ZP5 A;  5EEH A;  2VKD A;  4FCY A;  1BOB A;  1D0Z A;  2ICW G;  4EM1 A;  1KU2 A;  4FHT A;  3L7W A;  3S93 A;  2O6G E;  3FZV A;  1ZLJ A;  4KNY A;  5FKO A;  3BJ6 A;  3ASO H;  4H4K C;  4OIP F;  2EV6 A;  2HOE A;  3DU6 A;  4HW0 A;  4IOC F;  3O8G A;  3QP5 A;  1JHH A;  2L0K A;  3LMM A;  3CP2 A;  1QVU A;  1MH4 A;  3FXQ A;  5LRR A;  4XLN F;  2HQN A;  2MC4 A;  3CD6 I;  1YIJ I;  5B1B H;  4OMY A;  3ZMS A;  1ZRD A;  3SEQ A;  4BDZ A;  4A6E A;  2EWN A;  3DEE A;  1DGR M;  1GV5 A;  2OBP A;  3A2K A;  2PMZ A;  3WTX C;  4HAM A;  1FTT A;  2A6T A;  4D9J A;  2AQF A;  4LLN A;  2BW3 B;  4KIB A;  2E7W A;  2RQP A;  2XAU A;  1ETY A;  2HVS A;  1HBX G;  2FOW A;  3C1D A;  1IW7 F;  2BV6 A;  5A2Q Z;  2EFQ A;  4A3B J;  1XS9 A;  2QEN A;  4IQJ A;  2PJP A;  2JRM A;  2WAD A;  5EG0 B;  1X4P A;  2O9L A;  3M8E A;  5HDG A;  1DQU A;  3ZR8 X;  3HTS B;  2LC2 A;  4DGW B;  3SQN A;  2KFD A;  5FRN A;  1PP8 F;  4ITV A;  2FQ4 A;  2D5V A;  3DBL B;  2H94 A;  1T56 A;  3DKY A;  1BL0 A;  2ZME A;  4XRS G;  2BY1 A;  3GUD A;  3O3K A;  4EM0 B;  1JXS A;  5J1Y A;  3GCM A;  2P8T A;  3J7A W;  3ABL H;  3REO A;  5B3S H;  1ZG1 A;  2YR2 A;  3S14 J;  1RC9 A;  1POG A;  3GFM A;  4V2G A;  1XGO A;  4WXD A;  4XLA A;  1YJW I;  1V5G A;  1IUY A;  4WCG A;  3WTW C;  3VOE A;  1GXP A;  4J01 A;  3CJT B;  2D1V A;  3JRI A;  4E7H A;  3K1P A;  3HXL A;  2VT3 A;  3BG3 A;  3F6O A;  4M3B A;  2G7U A;  2IS4 A;  3LST A;  1U5T C;  3OS1 A;  2M35 A;  3HDD A;  1TTY A;  1HQC A;  2VIX A;  1LE8 A;  2ELJ A;  4N4N B;  2EIJ H;  1D1C A;  2YUS A;  2XAQ A;  4I02 A;  2BEO A;  2GZW A;  5AIQ A;  1LKX A;  2PQ8 A;  2XGC A;  3VFZ A;  1O57 A;  2E2H J;  5K5R A;  3OS0 A;  2L4A A;  2LOO A;  3KEO A;  1AHD P;  2LBF A;  3W6J B;  5D6E A;  4Q47 A;  2N8G A;  4GXO A;  5FB2 A;  4CYC A;  5L3G A;  3H5R A;  2NRA C;  2YU9 J;  3S17 J;  4G6T B;  2VBY A;  3MZ8 A;  1E17 A;  1FIA A;  4YEL A;  2FMY A;  3H3U A;  5FKK A;  2W57 A;  3J81 K;  1VQ8 I;  4ZTF A;  2QBY B;  2WAQ N;  2RRE A;  2DTZ A;  3IRR A;  4C30 A;  5L3F A;  5J4Y A;  1UEL B;  3IP4 B;  2HDC A;  4EV0 A;  3RPU A;  2HXO A;  3I59 A;  1Y1W J;  4RMN A;  3HUG A;  3SFZ A;  1XMX A;  2L7K A;  2VAS A;  3OYA A;  4RGS A;  1J5Y A;  1T08 B;  1V3F A;  5JI6 A;  2KRH A;  4EMS A;  4E7Z A;  5DTD A;  2ZME B;  4UVA A;  3BDD A;  4XKW A;  4XRF A;  3KCC A;  5EEG A;  1WJC A;  3BG7 A;  2W1O A;  2DA6 A;  4OIN F;  1P7I A;  2WAF A;  2HR3 A;  1W0T A;  2M4G A;  2K9N A;  3J80 Z;  3GTK J;  5IT3 A;  1OJL A;  2FJ1 A;  3ERE D;  1TW3 A;  4IPA A;  1UG2 A;  1OYY A;  1TW2 A;  1O3T A;  1I1G A;  1TWC J;  3F3X A;  3SDB A;  1LFB A;  3ZXS A;  4A2U A;  5CPR B;  1FJL A;  5EGO A;  1RR8 C;  5FO5 A;  2WTE A;  3RZO J;  2GXG A;  4G6D A;  3HIF A;  2RVC A;  2DO7 A;  2GAU A;  3E0J B;  1RUO A;  2WB1 N;  1J7K A;  4A6D A;  3BLY A;  1HKS A;  2DOA A;  2IGO A;  2K5C A;  2B0L A;  2W4S A;  3K1N A;  4GYG A;  3JR9 A;  1Z9C A;  3EUK L;  4D5F A;  1B72 A;  3UKG A;  4OU0 A;  5FLM J;  1SAU A;  3GFI A;  2QQA A;  2NOG A;  3M9A A;  1QA6 A;  2E2J J;  3JRG A;  4ESJ A;  4OOI A;  2DDB A;  4LK1 F;  5M5W J;  3R61 A;  1X1P A;  2DK8 A;  2Y75 A;  1FSH A;  5E79 C;  2L02 A;  2V9K A;  1WJD A;  2NYX A;  2OZ6 A;  3ZQG A;  4NBQ A;  4NC6 A;  3WTT C;  3Q5F A;  3DPT A;  4KA4 A;  5K5Q A;  5TRD A;  4XN0 A;  3LAP A;  2QM3 A;  4CA0 A;  4M6Y A;  2ZXJ A;  3CDH A;  3D5R C;  5ICF A;  2DFI A;  2L2O A;  3MZY A;  2VN2 A;  2H6C A;  3I59 B;  1H8A C;  1GVD A;  2JJ7 A;  3HUG B;  4GO1 A;  2XAG A;  3CCR I;  1HSJ A;  4YFK F;  1FYK A;  1VQ4 I;  4L0Z B;  2XAJ A;  1J9I A;  4HLY A;  1FC3 A;  1JI8 A;  2F5D A;  3F8N A;  3IHU A;  1O4X A;  4XLH A;  4G9Y A;  3VYS B;  3I64 A;  2VL8 A;  5DUK A;  3N05 A;  2DMQ A;  3LFU A;  4HLX A;  3TO9 A;  3O6B B;  2HEO A;  1Z67 A;  3FXR A;  2KIU A;  2E71 A;  4BXF A;  5HLT A;  2KZG A;  2K86 A;  4XN3 A;  4IHS A;  1MJ9 A;  1XC5 A;  1YW7 A;  1WH5 A;  3L2C A;  4E7L A;  2XGD A;  1P4X A;  4YIF A;  2YU3 A;  2R92 J;  4IOA F;  2P7C B;  4WXC A;  3SZG A;  4U0W A;  3PSI A;  2WA0 A;  4NQW A;  2CJJ A;  3E5Q A;  4YII A;  3V7R A;  2KIF A;  5F04 A;  2CFX A;  1PJR A;  1H88 C;  2K9L A;  3JRD A;  2OZU A;  2CUZ A;  2LKX A;  2KPM A;  1YOV B;  3CMA I;  4CCL A;  5BS6 A;  4XL9 A;  4FQG A;  3FMS A;  1Z7L A;  3CCE I;  1JE8 A;  2BE5 F;  4M72 A;  2VKH A;  4LIU A;  4UY8 I;  5JHF A;  5FD5 A;  3AAF A;  5EZH A;  1X4O A;  3GTJ J;  3HOS A;  3M07 A;  4ZC3 A;  2CS3 A;  1YQA A;  1FNN A;  2RC4 A;  2ZC2 A;  3R0A A;  5M3M J;  1KYW A;  4E7K A;  4UUS B;  3MVP A;  1VND A;  4IL6 C;  3TKY A;  5LEK A;  2JZY A;  1MMA A;  4FX0 A;  4QSH A;  3ULQ B;  2E1N A;  1HC8 A;  5IOZ A;  4NNJ A;  3S3N A;  5IT9 Z;  3HRM A;  1LVA A;  2DMT A;  1RZ4 A;  4XMY A;  2LF7 A;  2AXL A;  4N9I A;  4HOB A;  1B8I B;  2JQ7 A;  2NXN B;  1TWA J;  3H9J A;  2W85 A;  2CV0 A;  2BVL A;  1N25 A;  1V54 H;  4HV5 A;  5EDN A;  4U0Y A;  1LDK B;  2XV4 S;  4LGW A;  2OD5 A;  1KQ0 A;  2IA0 A;  2MFZ A;  2AQE A;  5IYB J;  4A3G J;  1ACI A;  2ZNY A;  3DEW A;  4R8H A;  2Q1Z B;  1MBJ A;  3G3Z A;  4A3M J;  1HCR A;  1V55 H;  3LA7 A;  2HKX A;  2VC1 A;  1R4M B;  1J0R A;  5DS9 A;  1WH7 A;  2L9R A;  4DIQ A;  1ZG5 A;  2BYV E;  4XKB A;  2DMU A;  1C0W A;  2CSO A;  2VJ4 A;  5HOO A;  1YRN A;  1FOW A;  3P7N A;  4NDL A;  2A68 F;  1IDY A;  1R5H A;  2B9S A;  2LKP A;  2R7V A;  3JAM Z;  4WX9 A;  1LFP A;  3QPT A;  3BCA A;  1D5Y A;  1ZRE A;  3W6K B;  4RGR A;  5BMZ A;  4LG0 B;  1D8J A;  1YLF A;  1IN4 A;  1KQ8 A;  4MLO A;  3VSL A;  4PCQ A;  4ZDL A;  4OMZ A;  3QPL A;  1U9N A;  1X1B A;  4BGD A;  3FBN B;  3EET A;  2H1K A;  5EF6 A;  3ZQC A;  2QSH X;  1YIO A;  5EZG A;  3RJP A;  1F9N A;  2LMD A;  1JGG A;  3VEP A;  3K1M A;  5CVJ A;  3I71 A;  3T5X A;  4BEH A;  5HNF A;  3QQA A;  1A6Q A;  4HNU A;  2O5R A;  3TQN A;  3ASN H;  3Q0V A;  3ZCO A;  3V8K A;  1STZ A;  2PMZ N;  1D1B A;  3B6A A;  1MMG A;  2R7F A;  2R5Y B;  1VFC A;  2GA2 A;  4UV9 A;  5KK1 A;  2ETH A;  2E19 A;  3S1Q J;  2DFE A;  2WAQ A;  4D7N A;  5LFA A;  2HYF A;  1SD6 A;  1TZL A;  4U87 A;  1K4T A;  4BAC A;  3NAU A;  3HBL A;  2XAH A;  2E5N A;  4MTD A;  5K7H A;  4FE4 A;  1YS7 A;  3RKW A;  3H3Z A;  3MEX A;  1E2X A;  3BR1 A;  3PNY A;  3ZPL A;  4AC0 A;  1PVE A;  5LGT A;  2FU4 A;  2VUM J;  1TC3 C;  4G7H F;  2V26 A;  4E4H A;  3O8H A;  5FFZ A;  2DA3 A;  3PL8 A;  1JHF A;  1Y1V J;  2DA1 A;  2DCE A;  4XQF A;  2GBY A;  4O5V A;  4MGR A;  2QWW A;  1LPQ A;  3EUA A;  4GDF A;  4ENK A;  1WGX A;  3R4K A;  4KT6 A;  3E6M A;  1LVK A;  1Z91 A;  1K79 A;  1IAW A;  4RB3 C;  3AL0 C;  1G8X A;  3CCJ I;  2V6C A;  3O2P E;  4XSX F;  3W2W A;  5DEQ A;  2EFW A;  1IRF A;  2DU9 A;  4RB0 A;  1MND A;  2P6T A;  1P92 A;  4M3F A;  4ANJ A;  1W0U A;  4A5M A;  1MKM A;  4L5J A;  4I2O A;  1IZ1 A;  1FBU A;  2KL4 A;  4CCK A;  3GTM J;  4A0Y A;  3NEU A;  3TO6 A;  1QQI A;  4KN4 X;  1IN8 A;  1RPW A;  5IYD J;  1KA8 A;  2ZXH A;  2P4W A;  1XSD A;  2BY2 A;  4RB2 C;  2WB1 A;  1OFC X;  4DBR A;  1BC8 C;  2V4J C;  2MLG A;  1KZH A;  3WU0 A;  2DXI A;  4EJU A;  4O6J A;  3FIS A;  2B7E A;  4S05 A;  3TED A;  4HQM A;  1FY7 A;  2F6C A;  1YJ9 I;  3J7A Y;  3M7G A;  3HOV J;  5FLX Z;  2Y48 A;  3AG4 H;  5D5X B;  1VQL I;  4AUX A;  3LL7 A;  4XKC A;  3ZMD A;  2HYG D;  3FMR A;  1BJA A;  4PJM A;  4BU2 A;  4DYQ A;  3T8T A;  5FRM A;  1APL C;  3M3Y J;  5LLQ A;  5TJJ A;  1W36 C;  1QPM A;  2K40 A;  3ISP A;  2PJR A;  1DP3 A;  1XGM A;  2GWR A;  1MMN A;  4AU7 A;  4I01 A;  1B59 A;  4K2E A;  1D8K A;  1LUJ B;  1WRJ A;  2JA6 J;  4KIF A;  3HGY A;  1KU3 A;  4XLE A;  2CUJ A;  4PJN A;  2JK3 A;  2EBI A;  3IH2 A;  1S7A A;  4LK0 F;  3R6S A;  3OYJ A;  3HB9 A;  4I0A A;  5HDN A;  3KP6 A;  2VJJ A;  5IP7 J;  2VQC A;  3VWB A;  2M30 A;  6PAX A;  5JVG F;  3FK7 A;  3CCU I;  1LEA A;  4IHT A;  2VOD A;  1YI2 I;  1QGP A;  3H0G J;  4X1E A;  1TT0 A;  4UNO A;  5DCF A;  1AOY A;  3MZH A;  3F9K A;  4PK4 A;  3ZQH A;  1OYI A;  5GAH J;  2JN6 A;  3MFK A;  4I0B A;  3FM3 A;  2M87 A;  3V8L A;  2K9S A;  1MMS A;  1ZQ3 P;  1I5Z A;  1WJE A;  2I8D A;  4AVP A;  5JFR A;  3V7C A;  3HEF A;  3PIO F;  3G1O A;  3CC4 I;  4C3I J;  3E3V A;  4MIM A;  5FLX R;  1USS A;  2XF6 A;  3SEZ A;  2TCT A;  1YX5 A;  4IHY A;  3BRO A;  2MVT A;  3K69 A;  1XD7 A;  3F72 A;  2P0T A;  3I3L A;  1K6O A;  4BHP A;  2E1M C;  4NB5 A;  2R7T A;  1PYV A;  3H36 A;  2JA8 J;  4L9N A;  1Y39 A;  2BY3 A;  3W6V A;  2ID6 A;  1SFO J;  2JA7 J;  3WE2 A;  3V8J A;  5J8C A;  2V1X A;  5ICE A;  2QF7 A;  3MQ0 A;  1TQI A;  3A02 A;  5D5W B;  3LAJ A;  3W2A A;  1S3J A;  4FET A;  1G6N A;  3Q0W A;  4MFD A;  4DW6 A;  3RPU D;  3A03 A;  5IP9 J;  4A69 C;  3CCM I;  2EFN A;  2MD0 A;  3CUQ C;  3K2A A;  3HHG A;  5E8I A;  1PDN C;  1VQO I;  5LHH A;  3JW4 A;  3ZMV A;  1F36 A;  4EQQ A;  3CC7 I;  2HQR A;  3LSP A;  1BN5 A;  1XN7 A;  4XR6 A;  5TIS C;  4X0G A;  1P6R A;  1B9M A;  1BIB A;  5A2Q K;  1MW7 A;  2R7Q A;  4MO7 A;  5DD4 A;  4JBA A;  1EJ9 A;  4OIO F;  3WU1 B;  4U88 A;  1ZN2 A;  4ETS A;  3V7S A;  3WTU C;  1ZRC A;  2OQR A;  4ZYA A;  2MA3 A;  3QPH A;  3CC2 I;  2X6O A;  1S72 I;  1XDS A;  1QHG A;  2XB5 A;  3HG9 A;  4PZJ A;  5J4V A;  2H8R A;  5K7F A;  3JRE A;  1R1T A;  4RGU A;  2DI3 A;  2VBX A;  2B63 J;  3DLL F;  1ETQ A;  3LSG A;  5JHU A;  1Z0X A;  2XB0 X;  3NWS A;  2WC2 A;  2DOD A;  2DAO A;  3PUB A;  3RKY A;  1R4N B;  1MBK A;  3L2Q A;  2VB6 A;  2ZFU A;  2XRO A;  1QBJ A;  1R22 A;  2E34 A;  3IUO A;  4M9X A;  4EJO A;  2M9H A;  2ISZ A;  5LHI A;  1BR1 A;  2XKO A;  3HGG A;  2AS5 F;  4RS8 A;  3IKV A;  4ESB A;  2UV1 A;  1HOM A;  2HXI A;  1RET A;  3DBH B;  1HLV A;  1OQY A;  1O7F A;  3LSH A;  1UB9 A;  1DU6 A;  3DU5 A;  3VSK A;  4QPQ A;  3JSP A;  2PEX A;  1MGT A;  4A3F J;  4CCO A;  5LRS A;  5BPI A;  2MBF A;  2FBH A;  2R0Q C;  4ENN A;  2L7M P;  3GFL A;  2O03 A;  2IJL A;  2F2E A;  3PQK A;  3A1Y A;  4FTH A;  4IHW A;  2CYY A;  4XRM A;  4JX4 A;  5FKL A;  4IRI A;  1QZZ A;  3U21 A;  1XX5 A;  2EFP A;  4U0V A;  3VPR A;  1EH6 A;  4BY1 J;  1R5G A;  2XPW A;  2HPI A;  3I4P A;  3KZI C;  4MQV A;  5GAG J;  4Q48 A;  1FLI A;  5BOX A;  1ZRF A;  1SFU A;  3D5L A;  5ICC A;  2LH9 A;  3ML6 A;  3PNT A;  3W3C A;  2GA1 A;  1XPX A;  1TQP A;  1J09 A;  1FTZ A;  2ADU A;  2RKH A;  5E8G A;  2ESN A;  3DKW A;  2M45 A;  3X2Q H;  4XLP F;  1IXR C;  2D1H A;  3JTH A;  3OL3 A;  1R7J A;  5E18 F;  1CQT A;  1Z3X A;  3BZ6 A;  2R5Z A;  2Z1D A;  2VJ5 A;  1MBH A;  2JPC A;  3KZZ A;  1BW5 A;  2R93 J;  3G71 I;  1QZE A;  1RKT A;  4EGY A;  1OLT A;  1ERD A;  2CQ7 A;  1XSV A;  4CIC A;  2CGP A;  3FM5 A;  3C3W A;  3AFH A;  1LJ9 A;  3B6C A;  3ONQ A;  1JUS A;  2MGQ A;  2XGX A;  3PJR A;  4HNT A;  3FIW A;  3J80 K;  3HOT A;  3FK6 A;  2HFH A;  3BOQ A;  1T6S A;  2QGU A;  4Y52 J;  4MEX F;  2RGV A;  4PGG A;  5DD8 A;  2XPV A;  3C7J A;  4L5E A;  1LDJ A;  3S32 A;  4ZTJ A;  1JUP A;  1VZ0 A;  1IV8 A;  2F5V A;  5AON A;  2XSJ C;  2HVR A;  2DTR A;  2ZJQ F;  2O7O A;  4JP0 A;  1OCZ H;  3BR2 A;  1ETV A;  2M7B A;  5F08 A;  3KLN A;  3OYB A;  2LYC A;  5J3L A;  3F22 A;  3LA2 A;  1OKR A;  1ON2 A;  2FBI A;  1SMT A;  3GW2 A;  3WTV C;  1REP C;  4L0Y B;  1KYZ A;  2FNP A;  2QKL B;  3OIO A;  4Z2Y A;  1ZEL A;  3HM5 A;  2NAZ A;  4ZYE A;  3JRB A;  1VQP I;  1G3T A;  3L2U A;  4QWQ A;  3QYF A;  4BJ5 C;  3CO6 C;  2FX0 A;  3K4B A;  3FWE A;  2ZKZ A;  2P6S A;  3GTL J;  3CF5 F;  1MSF C;  2ECC A;  1YJN I;  3MCZ A;  2EZL A;  2W24 A;  3CUQ A;  1SAN A;  2BOL A;  4C9Y A;  2VJI A;  5GPC A;  1K61 A;  4GCV A;  3LFK A;  5H2F C;  2QEX I;  1Y6I A;  3OYM A;  1QPI A;  4II2 A;  1HKT A;  1O3R A;  4BE1 A;  3N97 A;  1QNT A;  1JTY A;  1SVL A;  2ZXW H;  1P9Q C;  1JTX A;  2XDV A;  5ILU A;  2YX7 A;  2R5Z B;  5IY5 H;  2W7N A;  2X6W A;  2DBB A;  3BG5 A;  4M73 A;  2EQR A;  1ETW A;  2GLO A;  2LRD A;  1WI3 A;  5J8F A;  5J47 A;  1LDD A;  1S5L C;  2ZSH B;  2Q2E A;  5HS9 A;  4HNV A;  2ZBK A;  1SFK A;  1X1D A;  3M4O J;  4BXX J;  2STW A;  2UZK A;  2DMN A;  3TO7 A;  2DLL A;  1LE8 B;  4IO9 F;  1MZB A;  1ODD A;  1QRY A;  1Z3Y A;  4C2U A;  1WCM J;  2DA7 A;  4MFE A;  1OMI A;  3BT9 A;  2CW0 F;  3OR1 C;  3LNQ A;  2UWM A;  2R3S A;  4P96 A;  4L5I A;  3DCF A;  1YO5 C;  4BYY A;  2D45 A;  5E3L A;  5J40 A;  2I10 A;  2LBF B;  3TOA A;  3PM1 A;  4MQ9 F;  1ON1 A;  4CYC B;  1MBF A;  2EIL H;  2KMU A;  3HRT A;  2JPB A;  5B1A H;  5B5E C;  2RN7 A;  5FLV A;  4CCM A;  3Q9V A;  3TMO A;  3TDU C;  1SFE A;  2PN6 A;  4HF2 A;  4KDP A;  3WTZ A;  1FYL A;  2A3S A;  3E6B A;  3A0B C;  4ZZL A;  4OIR F;  2GXA A; 
#chains in the Genus database with same CATH homology
 1L0O C;  3D0S A;  1UCR A;  5K5O A;  1MJA A;  3J81 Z;  5H6Q A;  1LQ1 A;  3ZMU A;  3EQL F;  3J7A O;  1BOA A;  5IT9 K;  3WG9 A;  1DUX C;  2XAF A;  4L18 B;  2CO5 A;  4UUV A;  4ENM A;  4HDV A;  2LNB A;  4GGG A;  5L3C A;  4EJT A;  2HTJ A;  5ED4 A;  1FX7 A;  3GX4 X;  4I7H A;  2WWY A;  3F8B A;  2QVO A;  1XCV A;  3N4M A;  4PGH A;  3KP3 A;  5ICG A;  1BBY A;  3COA C;  1B9N A;  1DPR A;  1MDM A;  1U5T A;  2ZJ2 A;  3JAM K;  3I58 A;  2W25 A;  3RKX A;  3L9F A;  3ZQ7 A;  4D0P A;  1Z05 A;  3TGN A;  3RI4 A;  1BIA A;  4ASN A;  3GWZ A;  3M1E A;  2A61 A;  2FQ3 A;  3CO7 C;  4O3M A;  2PMH A;  2UXX A;  4NHJ A;  3HSF A;  2V1D A;  4DQ2 A;  5JR3 A;  1FZP B;  2HGC A;  2EA4 A;  3EYI A;  1IN6 A;  2JSC A;  4G94 A;  1ZHF A;  4HZF A;  4OIQ F;  3B73 A;  1GXQ A;  2IA2 A;  3DFG A;  2DQR A;  1B4A A;  2RNJ A;  3BY6 A;  4ENJ A;  1SFX A;  1U78 A;  4H0E A;  2G7H A;  2P7V B;  1FBS A;  2ZO4 A;  1ZLK A;  3E5U A;  1Z7U A;  5DYM A;  4KYW A;  4WXH A;  2FBK A;  1KU7 A;  2FML A;  1T98 A;  5FFX A;  3Q9S A;  2W84 A;  2H6B A;  1X3U A;  1J59 A;  1MDM B;  1U5T B;  2J5P A;  4LLL A;  1ZGA A;  2VE8 A;  4RAZ A;  2XHK A;  2KRF A;  4LMY A;  1SD5 A;  5L3B A;  3KP7 A;  1F1Z A;  4IJA A;  1TBX A;  3KLO A;  4Y17 A;  2CG4 A;  1K7A A;  1VTN C;  1CF7 A;  2OU2 A;  4CZZ A;  3IWF A;  1W7P A;  3ZN0 A;  4BH9 A;  2PMU A;  2QLZ A;  2FE3 A;  1XB4 A;  3WTS C;  5HS8 A;  1FYM A;  3NRV A;  2HKO A;  1FWZ A;  1XGN A;  4IF4 A;  1W5S A;  3FHZ A;  3ABU A;  1KGS A;  4KN7 X;  4Y15 A;  4BHB A;  2EB7 A;  1SD7 A;  4A12 A;  2HZT A;  5CLS A;  2FA5 A;  1OPC A;  4KMF A;  1S8N A;  4GYI A;  1J75 A;  1BI0 A;  2XAS A;  3KET A;  2IP2 A;  3U9G A;  1BM9 A;  2OQG A;  3WGH A;  2O8X A;  2WV0 A;  5HS7 A;  1T0F A;  3CLO A;  2Z9O A;  3F23 A;  1CF7 B;  4ESF A;  1R1U A;  4YFX F;  2E7X A;  4P9F A;  4HBL A;  5D5V B;  1SMY F;  2KIM A;  3R60 A;  4UVB A;  2VXZ A;  2GIV A;  4G7Z F;  4WF2 A;  1GVJ A;  2C6Y A;  3QU6 A;  4CYD A;  5D5U B;  2VOP A;  4EM2 A;  1ZGJ A;  5LGU A;  3NQO A;  4DNC A;  2GQQ A;  3GEZ A;  4CHU A;  1DPU A;  3GF2 A;  5LEJ A;  5HDK A;  4CDG A;  2FRH A;  1RIO H;  1XMA A;  4I98 B;  2YPR A;  2EFO A;  4HX8 A;  3IC7 A;  5CVV A;  4Q5S F;  1GHC A;  2P5K A;  5LHG A;  4M71 A;  1ZH5 A;  3OOP A;  3ZMZ A;  2NNY A;  3IL2 A;  1BI2 A;  1HW5 A;  2MH9 A;  3BWG A;  2BBY A;  2O61 A;  4WK8 F;  4IRG A;  1HST A;  1LEB A;  2LDU A;  4A5N A;  1P4A A;  4YFN F;  4R79 A;  1O3S A;  5FD6 A;  2KJB A;  1G4D A;  2DK5 A;  2EV0 A;  3HRS A;  4EJV A;  2K7L A;  3P9K A;  5E1Z B;  4HV6 A;  4YG2 F;  1XCB A;  3RPQ A;  4JQF A;  1T38 A;  2X0L A;  3KE2 A;  3GVA A;  4TV7 A;  1SD4 A;  1G3Y A;  3F6V A;  4MNU A;  2DPU A;  4LJZ F;  2JT1 A;  2MD5 A;  3T8R A;  3PQJ A;  1IN7 A;  3ELK A;  1TNS A;  4XBF A;  1G3S A;  1BI1 A;  3I5U A;  5BPD A;  5CVU A;  3VOD A;  1T2K A;  4FX4 A;  1IXC A;  1YW9 A;  1HXD A;  3F8C A;  2L3D A;  1PUE E;  2YX4 A;  2CQK A;  4LD5 A;  1F4K A;  5BQT A;  3ZN1 A;  2V9V A;  1FP2 A;  1UFM A;  2P5V A;  2QZ8 A;  2XRN A;  1EH8 A;  1KU9 A;  2KJC A;  2F5F A;  3TOB A;  2L01 A;  2QQB A;  1IXS B;  4HF1 A;  4XSZ F;  5CVI A;  1IF1 A;  3BPX A;  2V79 A;  1I27 A;  3BJO A;  2FXA A;  5LBQ A;  3LQR A;  4IXA A;  1YTY A;  2QUF A;  1FT9 A;  3MWM A;  5E17 F;  1OR7 A;  2MLK A;  5D6F A;  2QBY A;  3IWZ A;  1WWX A;  1YYV A;  3ECO A;  4UHT A;  3ZMT A;  3HHH A;  2VBZ A;  4HQE A;  2A6H F;  3PFI A;  4ZYH A;  4M9Z A;  2O3F A;  1IRG A;  2EA2 A;  4E70 A;  3E6C C;  3ROU A;  4M74 A;  2ESH A;  4KMU X;  3RDI A;  4RGX A;  2P5L C;  3LA3 A;  1UHM A;  1TLH B;  1ONV A;  2O0Y A;  1XSX A;  3K9T A;  4BQA A;  5E1W A;  2JRT A;  1P2F A;  3KP2 A;  1TNT A;  3BPV A;  4HDU A;  4EGZ A;  3V4G A;  4Y13 A;  2Q8K A;  1ZG3 A;  1QO0 D;  3GYH X;  4HF0 A;  1FSE A;  5F6F A;  4MTE A;  1DP7 P;  2BGC A;  3RIR A;  3F8F A;  4P5O A;  4KIG A;  3TDZ C;  4B09 A;  1Z6R A;  5HLI A;  4PDK A;  1LB2 A;  2ISY A;  3BP8 A;  2IT0 A;  2PFB A;  1B1B A;  2MH2 A;  2A07 F;  5DV5 A;  2VOO A;  2XVC A;  4EVI A;  4U7B A;  5CJ9 A;  3GXO A;  2ZNZ A;  4AIJ A;  2PBI A;  1PP7 U;  4BAY A;  1Z6T A;  2X4H A;  2DT5 A;  2MC3 A;  3GZ6 A;  4N9H A;  1R00 A;  4B8X A;  2VE9 A;  4LB6 B;  3SZT A;  3KZY A;  1XDU A;  4MEY F;  2Q0O A;  2XKP A;  3QP6 A;  4LB5 A;  3JSO A;  2QQ9 A;  1W4M A;  4WWC A;  4I09 A;  4LLG F;  4U7D A;  5K1Y A;  1IN5 A;  5H20 A;  1R58 A;  4LFU A;  3DF8 A;  4F7Z A;  1W7P D;  1HKQ A;  2TDX A;  3GZ5 A;  2PG4 A;  5DUI A;  2CWE A;  3CUQ B;  3E97 A;  4AD9 A;  3WE3 A;  2NS0 A;  2VT2 A;  4KIC A;  1L3L A;  4ZYD A;  3DEU A;  5L3E A;  2K4B A;  1A04 A;  2ZFW A;  5CYV A;  4N0B A;  3S2W A;  2UXN A;  3GFJ A;  3H92 A;  5HVQ C;  1U8R A;  3RYP A;  2L4M A;  2ACJ A;  1QZY A;  3T0Y A;  3ABT A;  1FPQ A;  3CUO A;  1K78 A;  1DDN A;  1Q1H A;  1YG2 A;  2D2W A;  3T1B A;  1UHW A;  1O3Q A;  1R36 A;  2COM A;  5FGM A;  2V1U A;  1Y0U A;  2NNN A;  1WKM A;  3GO5 A;  2VON A;  1SAX A;  3KFW X;  1ZAR A;  1W5T A;  2JTV A;  5KVR A;  3BJA A;  2Z5U A;  4HA8 A;  1EV7 A;  4QLC U;  4LG0 A;  3EUH A;  5E20 A;  4FT8 A;  1MD0 A;  5J6X A;  1D5V A;  4AWX B;  4AIH A;  1WQ2 A;  4BNC A;  2Z33 A;  2F5E A;  3I0T A;  1KQ9 A;  1YS6 A;  2E1C A;  4A0X A;  3E6D A;  3K0L A;  5E1X A;  3RTR A;  5DDG A;  4KFC A;  5DCM A;  4ZZD A;  1FP1 D;  4CXF A;  1I1S A;  1MJB A;  1RI7 A;  5ERI A;  3DPL C;  1V4R A;  1K78 B;  1LNW A;  1H0M A;  2M8E A;  1ZAO A;  3FMQ A;  3RYR A;  1R23 A;  3B02 A;  2K4J A;  1RUN A;  4G7O F;  2K27 A;  4M6X A;  1P4W A;  2DW4 A;  2Y0M A;  4G6Q A;  5JVT A;  3G73 A;  2EK5 A;  5F1R A;  1D3Y A;  3P9I A;  4ZYG A;  4P55 A;  1XMK A;  1HW1 A;  3F8M A;  4ZH4 F;  4S04 A;  1FBQ A;  3HRU A;  2IW5 A;  5CVR A;  2FSW A;  2R7D A;  3DXJ F;  2VC0 A;  2ELH A;  5FLX K;  4CO8 A;  1S7O A;  3QOP A;  5D8L B;  3I54 A;  3HSR A;  3QAH A;  1S29 A;  2A6E F;  2DPD A;  1O7L A;  5LGN A;  2M5W A;  1YFH A;  1WI9 A;  2RDP A;  2LF8 A;  4KUM A;  3R0J A;  2Z99 A;  4HX4 A;  5F64 A;  3QRF F;  1R1V A;  1RNL A;  5DCM B;  4BHC A;  3U2R A;  2FF4 A;  2L54 A;  2XIG A;  1ZYR F;  1ULY A;  3FX3 A;  5HLG A;  3F21 A;  4MHG A;  3SHF A;  2A69 F;  3MAJ A;  3GLX A;  3KEQ A;  3HSE A;  3WTY C;  4L9J A;  2PLY A;  2OAZ A;  3DQV C;  4G8X A;  4IRH A;  3WGG A;  3FF5 A;  2GXB A;  3HYI A;  1S6L A;  4AIK A;  2F5C A;  2H27 A;  1NHA A;  4HYE A;  4P9U A;  1U6G A;  5ILV A;  3SXY A;  2G9W A;  1W7P B;  4KT5 C;  3QU3 A;  3SZP A;  4A0Z A;  2H09 A;  1U2W A;  5HLH A;  1G3W A;  4RAY A;  3CTA A;  2IRF G;  1XGS A;  2IVM A;  4R1H A;  4Q4Z F;  3P9C A;  3HTU A;  1OYW A;  4UVC A;  3DP7 A;  3WGI A;  3E5X A;  2A5Y B;  2ZCW A;  2LSO A;  3IKT A;  1F5T A;  2PI0 A;  3EDP A;  4UV8 A;  4BXU A;  1H9G A;  3OV8 A;  3IRQ A;  3L09 A;  5D8K B;  2KKO A;  1U3E M;  1I6X A;  2YSR A;  1BI3 A;  2RV8 A;  2OA4 A;  3CJN A;  1CGP A;  2EV5 A;  5ILS A;  2HTS A;  2J5O A;  1H9T A;  3L00 A;  2QYO A;  3I53 A;  1BC7 C;  3FXU A;  3VB2 A;  2M1B A;  2DQL A;  4EJW A;  2K02 A;  1UST A;  3LWF A;  2STT A;  3LQQ A;  2EJR A;  3C18 A;  4ON0 A;  4IVN A;  1TQM A;  1YW8 A;  5D4R A;  4L9T A;  1J2X A;  2IA1 A;  2FNA A;  3KP4 A;  3EYY A;  1Z1D A;  3DV8 A;  5H6R A;  1B6A A;  1JGS A;  3KP5 A;  4HX7 A;  3U1D A;  2FEZ A;  1WSU A;  4L9V A;  2FOK A;  1AWC A;  4CGZ A;  3M8F A;  2VBW A;  4M9S A;  3WOD F;  1EH7 A;  5D4S A;  1HW2 A;  2XUB A;  2HS5 A;  2Z3Y A;  5L3D A;  4UXN A;  1FOK A;  2IPQ X;  5AIP A;  3K2Z A;  1T39 A;  3JTG A;  4JK1 X;  2HWV A;  3ECH A;  3ZP5 A;  5EEH A;  4EM1 A;  1KU2 A;  4FHT A;  3L7W A;  2O6G E;  4KNY A;  3FZV A;  1ZLJ A;  3BJ6 A;  4OIP F;  2EV6 A;  2HOE A;  4HW0 A;  3QP5 A;  1JHH A;  3FXQ A;  5LRR A;  4XLN F;  2HQN A;  4OMY A;  3ZMS A;  1ZRD A;  4A6E A;  2EWN A;  2OBP A;  3WTX C;  4HAM A;  4LLN A;  4KIB A;  2E7W A;  2RQP A;  1HBX G;  3C1D A;  1IW7 F;  2BV6 A;  5A2Q Z;  2EFQ A;  2QEN A;  2PJP A;  3M8E A;  5HDG A;  3HTS B;  3SQN A;  1PP8 F;  2H94 A;  2ZME A;  3GUD A;  3O3K A;  4EM0 B;  1JXS A;  2P8T A;  3REO A;  1ZG1 A;  2YR2 A;  3GFM A;  4WXD A;  1XGO A;  1IUY A;  4WCG A;  3WTW C;  3VOE A;  1GXP A;  2D1V A;  3K1P A;  2VT3 A;  3F6O A;  2G7U A;  3LST A;  1U5T C;  1TTY A;  1HQC A;  2XAQ A;  4I02 A;  2BEO A;  2GZW A;  5AIQ A;  2PQ8 A;  3VFZ A;  1O57 A;  5K5R A;  2L4A A;  3KEO A;  3W6J B;  5D6E A;  4Q47 A;  4GXO A;  5FB2 A;  5L3G A;  2NRA C;  2VBY A;  1E17 A;  2FMY A;  3H3U A;  2W57 A;  3J81 K;  2QBY B;  3IRR A;  5L3F A;  2HDC A;  4EV0 A;  3RPU A;  3I59 A;  3HUG A;  3SFZ A;  4RGS A;  1J5Y A;  1V3F A;  5JI6 A;  4EMS A;  2ZME B;  4UVA A;  3BDD A;  4XRF A;  3KCC A;  5EEG A;  4OIN F;  2HR3 A;  3J80 Z;  5IT3 A;  3ERE D;  1TW3 A;  4IPA A;  1OYY A;  1TW2 A;  1O3T A;  1I1G A;  4A2U A;  3F3X A;  5FO5 A;  2WTE A;  2GXG A;  4G6D A;  3HIF A;  2RVC A;  2DO7 A;  2GAU A;  1RUO A;  1J7K A;  4A6D A;  1HKS A;  4GYG A;  1Z9C A;  2B0L A;  3K1N A;  4OU0 A;  3GFI A;  2QQA A;  3M9A A;  4ESJ A;  4OOI A;  4LK1 F;  3R61 A;  2DK8 A;  2Y75 A;  1FSH A;  2L02 A;  2NYX A;  2OZ6 A;  3WTT C;  3Q5F A;  3DPT A;  4KA4 A;  5K5Q A;  5TRD A;  3LAP A;  2QM3 A;  4M6Y A;  2ZXJ A;  3CDH A;  5ICF A;  2DFI A;  3MZY A;  2VN2 A;  2H6C A;  3I59 B;  4GO1 A;  2XAG A;  4L0Z B;  1HSJ A;  4YFK F;  1FYK A;  1J9I A;  2XAJ A;  4HLY A;  1FC3 A;  4OIR F;  2F5D A;  3F8N A;  3IHU A;  4G9Y A;  3I64 A;  5DUK A;  4HLX A;  3TO9 A;  3O6B B;  2HEO A;  3FXR A;  2KIU A;  2K86 A;  4IHS A;  1MJ9 A;  1YW7 A;  3L2C A;  1P4X A;  4YIF A;  2YU3 A;  2P7C B;  4WXC A;  4U0W A;  4NQW A;  3E5Q A;  4YII A;  3V7R A;  2KIF A;  2CFX A;  2OZU A;  5BS6 A;  3FMS A;  1JE8 A;  2BE5 F;  4M72 A;  5FD5 A;  3AAF A;  3HOS A;  1YQA A;  1FNN A;  2RC4 A;  3R0A A;  1KYW A;  3TKY A;  5LEK A;  2JZY A;  4FX0 A;  3ULQ B;  2E1N A;  5IT9 Z;  3HRM A;  1LVA A;  1RZ4 A;  2LF7 A;  2AXL A;  4N9I A;  4HOB A;  2W85 A;  4HV5 A;  4U0Y A;  1LDK B;  2XV4 S;  4LGW A;  2OD5 A;  1KQ0 A;  2IA0 A;  2ZNY A;  4R8H A;  3G3Z A;  3LA7 A;  2HKX A;  2VC1 A;  1J0R A;  1ZG5 A;  2BYV E;  1C0W A;  2CSO A;  5HOO A;  3P7N A;  2A68 F;  1R5H A;  2LKP A;  3JAM Z;  4WX9 A;  3QPT A;  1ZRE A;  3W6K B;  4RGR A;  5BMZ A;  4LG0 B;  1D8J A;  1YLF A;  1IN4 A;  1KQ8 A;  4PCQ A;  4OMZ A;  3EET A;  1YIO A;  3RJP A;  1F9N A;  3VEP A;  3K1M A;  5CVJ A;  3I71 A;  3T5X A;  3TQN A;  3V8K A;  1STZ A;  2R7F A;  2GA2 A;  4UV9 A;  5KK1 A;  2ETH A;  2HYF A;  1SD6 A;  2XAH A;  4MTD A;  1YS7 A;  3RKW A;  3H3Z A;  3MEX A;  1E2X A;  3ZPL A;  5LGT A;  2FU4 A;  4G7H F;  5FFZ A;  1JHF A;  4O5V A;  4MGR A;  2QWW A;  4ENK A;  3R4K A;  3E6M A;  1Z91 A;  1K79 A;  1IAW A;  4RB3 C;  2V6C A;  3O2P E;  4XSX F;  5DEQ A;  2EFW A;  1IRF A;  2DU9 A;  4RB0 A;  2P6T A;  1P92 A;  4A5M A;  1MKM A;  4L5J A;  4I2O A;  1IZ1 A;  1FBU A;  4A0Y A;  3NEU A;  3TO6 A;  1QQI A;  4KN4 X;  1IN8 A;  1KA8 A;  2P4W A;  1XSD A;  4RB2 C;  1BC8 C;  2MLG A;  3WU0 A;  4EJU A;  4O6J A;  4S05 A;  4HQM A;  1FY7 A;  3M7G A;  5FLX Z;  2Y48 A;  5D5X B;  3ZMD A;  2HYG D;  3FMR A;  1BJA A;  3T8T A;  5LLQ A;  5TJJ A;  1QPM A;  3ISP A;  1XGM A;  2GWR A;  4I01 A;  1B59 A;  4K2E A;  1D8K A;  1WRJ A;  4KIF A;  1KU3 A;  1S7A A;  4LK0 F;  3R6S A;  4I0A A;  5HDN A;  3KP6 A;  2M30 A;  6PAX A;  1LEA A;  4IHT A;  2VOD A;  1QGP A;  4UNO A;  5DCF A;  1AOY A;  3MZH A;  1OYI A;  3MFK A;  4I0B A;  3FM3 A;  2M87 A;  3V8L A;  1I5Z A;  4AVP A;  5JFR A;  3V7C A;  3E3V A;  1USS A;  3BRO A;  3K69 A;  1XD7 A;  3F72 A;  1K6O A;  4BHP A;  4NB5 A;  4L9N A;  3WE2 A;  3V8J A;  5J8C A;  2V1X A;  5ICE A;  3MQ0 A;  1TQI A;  5D5W B;  3LAJ A;  1S3J A;  1G6N A;  2EFN A;  3CUQ C;  3HHG A;  5E8I A;  1PDN C;  5LHH A;  3JW4 A;  3ZMV A;  4EQQ A;  2HQR A;  1BN5 A;  1XN7 A;  1P6R A;  1B9M A;  1BIB A;  5A2Q K;  5DD4 A;  4JBA A;  4OIO F;  3WU1 B;  4U88 A;  1ZN2 A;  4ETS A;  3V7S A;  3WTU C;  1ZRC A;  2OQR A;  2MA3 A;  3QPH A;  1XDS A;  4PZJ A;  1R1T A;  4RGU A;  2DI3 A;  2VBX A;  5JHU A;  2WC2 A;  2DAO A;  3RKY A;  2XRO A;  1QBJ A;  1R22 A;  4M9X A;  4EJO A;  2ISZ A;  5LHI A;  2XKO A;  2AS5 F;  4RS8 A;  3IKV A;  4ESB A;  1O7F A;  1UB9 A;  3JSP A;  2PEX A;  1MGT A;  5LRS A;  5BPI A;  2MBF A;  2FBH A;  4ENN A;  3GFL A;  2O03 A;  2IJL A;  2F2E A;  3PQK A;  2CYY A;  4IRI A;  1QZZ A;  2EFP A;  4U0V A;  1EH6 A;  1R5G A;  3I4P A;  4MQV A;  4Q48 A;  1FLI A;  5BOX A;  1ZRF A;  1SFU A;  3D5L A;  5ICC A;  3ML6 A;  2GA1 A;  1TQP A;  2ADU A;  2RKH A;  5E8G A;  2ESN A;  3DKW A;  2M45 A;  4XLP F;  2D1H A;  1IXR C;  3JTH A;  1R7J A;  5E18 F;  3BZ6 A;  2JPC A;  3KZZ A;  4EGY A;  1XSV A;  4CIC A;  2CGP A;  3FM5 A;  3C3W A;  1LJ9 A;  2XGX A;  3J80 K;  3HOT A;  2HFH A;  3BOQ A;  1T6S A;  4MEX F;  2RGV A;  4PGG A;  5DD8 A;  3C7J A;  1LDJ A;  5AON A;  2DTR A;  3KLN A;  3F22 A;  3LA2 A;  1OKR A;  1ON2 A;  2FBI A;  1SMT A;  3GW2 A;  3WTV C;  1REP C;  4L0Y B;  1KYZ A;  2FNP A;  4Z2Y A;  2NAZ A;  4ZYE A;  1G3T A;  4QWQ A;  3CO6 C;  3FWE A;  2ZKZ A;  2P6S A;  3MCZ A;  2W24 A;  3CUQ A;  4GCV A;  3LFK A;  1HKT A;  1O3R A;  3N97 A;  1QNT A;  5ILU A;  2YX7 A;  2DBB A;  4M73 A;  5J8F A;  1LDD A;  2Q2E A;  5HS9 A;  2ZBK A;  2STW A;  2UZK A;  3TO7 A;  2DLL A;  1MZB A;  1ODD A;  1OMI A;  2CW0 F;  2UWM A;  2R3S A;  4P96 A;  4L5I A;  1YO5 C;  4BYY A;  2D45 A;  3TOA A;  4MQ9 F;  1ON1 A;  3HRT A;  2JPB A;  2RN7 A;  3Q9V A;  3TDU C;  1SFE A;  2PN6 A;  4HF2 A;  4KDP A;  3WTZ A;  1FYL A;  2A3S A;  3E6B A;  4ZZL A;  4RB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...