1C0WA

Crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
173
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVIVQINEIFQVETDQFTQLLDAVELLDDLAHTIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*TP*TP*AP*GP*GP*TP*TP*AP*GP*CP*CP*TP*AP*CP*CP*
total genus 63
structure length 173
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1c0wA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1c0wA02
2YSRA 3CLOA 1FP1D 3H92A 2L01A 3ABUA 2EV6A 4K2EA 1HBXG 1T2KA 2IA0A 1QZZA 4YG2F 2XAQA 1USTA 3EDPA 3VFZA 4CGZA 4G6QA 1G3YA 5E17F 2CFXA 2P5LC 1QBJA 5K5RA 3FX3A 1AOYA 2VT2A 3Q9SA 1R22A 3H3UA 3D0SA 3JTHA 2BYVE 4CICA 3F22A 4EGYA 2RGVA 1ZN2A 3O3KA 1S29A 3E5QA 4RGXA 3IRQA 3M7GA 1H0MA 3KFWX 3GFMA 3BOQA 3VOEA 5FLXZ 3CTAA 4LLGF 1QO0D 3RKWA 4OMZA 2ACJA 3LSTA 4O6JA 1XGSA 5D4RA 1EH6A 1Z1DA 1F5TA 1ZGAA 3T5XA 3HOSA 2Z99A 3O6BB 2O61A 3J80Z 3E6CC 4I02A 2FRHA 3MEXA 4IVNA 1YQAA 5LRRA 1I1GA 4U0WA 1ZAOA 5DCMA 4OMYA 1O3TA 2G7UA 2PG4A 3KP4A 1DUXC 1D5VA 3QP5A 1HSJA 2O8XA 3WU0A 3KZYA 1P4AA 4KUMA 2EV0A 1UB9A 4PGHA 1NHAA 3J81Z 1OYYA 3V8JA 3GFIA 3RPUA 1W7PA 4FX0A 1WRJA 4G6DA 4EJTA 2BV6A 3NQOA 4BAYA 3N97A 1GXQA 3FXRA 3K9TA 4OIOF 4MQ9F 2CQKA 1HW1A 4DNCA 1PP7U 3E6MA 1REPC 2QLZA 3I4PA 5DD4A 1V4RA 1IN5A 1L0OC 3F8MA 4EM1A 2M1BA 3H3ZA 1MDMA 5CLSA 5BPDA 4ZZDA 2DPDA 4KN7X 2XUBA 1I5ZA 1KQ0A 2STTA 3KP6A 2ZMEB 3J80K 4RGRA 3RPQA 4A0XA 1XMKA 3IL2A 3DV8A 3COAC 4A0ZA 3KCCA 3I58A 3O2PE 2V9VA 1Z6RA 1R00A 2VE9A 3B02A 1BJAA 3MAJA 2Z3YA 1JE8A 4HYEA 1ON1A 1BC7C 4IRGA 4L9JA 1HSTA 3K0LA 2LKPA 3EETA 3V8LA 2UZKA 3LA7A 1DDNA 5DUKA 1SD6A 2DI3A 2KIFA 4WX9A 2CGPA 2EK5A 1I27A 3U9GA 2QWWA 5HLIA 1TW3A 2KJBA 3R4KA 2EFOA 1YYVA 2WC2A 4I0BA 4HF1A 2OAZA 5D5VB 1FPQA 2V79A 4XLNF 2MD5A 4ZH4F 2ZJ2A 2IA1A 3RJPA 3DEUA 4CYDA 1FYMA 2DU9A 5BMZA 4G7HF 5D5XB 5H20A 1TQMA 3KP3A 2K86A 4YIFA 3EQLF 1FBUA 2PN6A 2HWVA 4ENKA 2VBWA 5HDNA 2LSOA 4L9NA 1B9MA 4LLNA 2H6BA 2FF4A 2O3FA 4RS8A 4LD5A 4KIBA 3MCZA 4M9SA 1O7FA 1FBQA 2YU3A 2IPQX 2GWRA 2WWYA 2H09A 2OBPA 2RVCA 3M8EA 4EGZA 2FXAA 2P6TA 1V3FA 3L9FA 2MBFA 1RIOH 3RI4A 1B9NA 1R36A 1S7AA 5H6RA 4UNOA 4EQQA 3GF2A 1D8KA 1Z7UA 4IXAA 2R3SA 1EV7A 5LBQA 2GIVA 4GCVA 1S7OA 3FMSA 3C3WA 4KT5C 2MLGA 1J75A 3BPVA 3GLXA 1A04A 3ZQ7A 1LQ1A 1MDMB 1CGPA 1W5TA 4XSZF 2OA4A 5EEGA 3R60A 1FOKA 5DUIA 2R7FA 3BY6A 2Q8KA 2OU2A 4CO8A 3F8FA 1ZRCA 2L02A 2OQRA 1G4DA 1W4MA 3L09A 3EUHA 4LG0B 3NEUA 1S6LA 3BWGA 2COMA 1YO5C 2KRFA 4P9FA 4MHGA 1KU7A 1J9IA 4AIKA 2YR2A 2F5EA 1J7KA 2Y48A 1F9NA 1QZYA 2K4JA 4GXOA 4KNYA 1T6SA 1W5SA 1USSA 2JSCA 2A61A 5ERIA 3Q9VA 4M72A 1SAXA 3K1PA 3C1DA 3I59A 1S8NA 4TV7A 3F8BA 5DCFA 5HDGA 3GXOA 4RGSA 1ONVA 1XMAA 4LMYA 4XLPF 1D3YA 3BDDA 3E6DA 2O6GE 2HYFA 4ESJA 2DT5A 5D5UB 1K79A 3LQQA 1G3WA 4L5JA 2P5VA 4IPAA 1HQCA 4MTDA 1W7PD 3F23A 3F21A 3SXYA 2LDUA 1P4WA 2EFWA 4OINF 1BC8C 1GXPA 2F5DA 2V1XA 1JHHA 4R1HA 1ZYRF 3CUQB 1I1SA 2K4BA 2FSWA 5ILVA 4HDUA 1T39A 5LEJA 5LGTA 3ZN0A 2KIUA 2DK5A 1TW2A 3HUGA 1JHFA 4L18B 2IJLA 2UXNA 2PFBA 2BE5F 2QQAA 2G7HA 1R23A 2F5CA 2O03A 3IKTA 1HKSA 3T8RA 1U5TC 2FEZA 3I59B 4EJWA 3WE2A 1BIAA 3IKVA 5KVRA 4KDPA 2CWEA 1R1TA 3L7WA 2ZMEA 3DQVC 4EM2A 5K5OA 5D6FA 2V1DA 3GFJA 1BI2A 3FMRA 2NNYA 4WCGA 4KMFA 1SD5A 1HW5A 2A6HF 1RI7A 4D0PA 2GXBA 1ON2A 4ZYEA 3GZ5A 1XGNA 5F6FA 3TOBA 1YLFA 4BHCA 1Y0UA 2HKOA 1XSDA 3LAPA 2GA1A 3WODF 3DF8A 1ZHFA 2XROA 3U2RA 2L54A 3WGGA 3I64A 4PZJA 3CJNA 1FNNA 1UHWA 4XRFA 4HV5A 2MH2A 1U5TA 5FFZA 5BPIA 3FHZA 3MWMA 4UUVA 1EH8A 4H0EA 4A6DA 4Q48A 2E1NA 4N0BA 3HOTA 3BROA 1HXDA 5HS9A 3ZMVA 2XKPA 5DEQA 4ENNA 3G3ZA 2JT1A 2DTRA 2Z5UA 1SFXA 1KYWA 3KP5A 2LNBA 4Y13A 2Z9OA 4M6XA 4NB5A 2A5YB 3P9KA 3ZP5A 2QM3A 2XV4S 1ZLKA 1JGSA 1XB4A 4EMSA 3KP7A 4LJZF 1R58A 5FFXA 3ZN1A 1CF7B 4KMUX 1FZPB 3CUQA 3WU1B 3E3VA 4L5IA 3DFGA 5BOXA 2HYGD 4EJUA 4ON0A 1R7JA 4Q4ZF 4KA4A 3ML6A 1U78A 2M5WA 2HQRA 4RAYA 4BH9A 3HYIA 3RDIA 1Z91A 5ICCA 1LNWA 1T0FA 1OPCA 1BM9A 1PUEE 4M9XA 2VC1A 1X3UA 2IP2A 2YPRA 3HSRA 4I0AA 3QU3A 1LB2A 2A69F 3EYYA 1K78B 4BNCA 2GQQA 3JTGA 3DXJF 3TO9A 5L3CA 5FLXK 1O3RA 3HHGA 2XAJA 3DPLC 1B6AA 4HOBA 3WGHA 5CVRA 3QOPA 2CSOA 3ZMDA 5HDKA 5JFRA 4I09A 1J5YA 4N9HA 4U0YA 4RAZA 4P5OA 4XBFA 4I01A 3FM5A 1KU2A 1YW9A 1BI3A 2QUFA 2EFQA 2D45A 1STZA 4YIIA 2L4MA 4Y15A 5HVQC 4GO1A 4I7HA 3MZHA 4YFXF 1KQ9A 4Z2YA 4CZZA 1U5TB 4A5NA 2HOEA 2H94A 3ROUA 4LLLA 2V1UA 3Q5FA 3WG9A 5L3DA 1H9TA 5ED4A 3F8NA 2MLKA 2XASA 1Z05A 3GEZA 2K02A 2W25A 3KEOA 4IHTA 3QPTA 1J59A 2FE3A 5CVJA 2HGCA 2YX7A 3BP8A 1HKQA 3LWFA 2STWA 2Z33A 5J8FA 2DAOA 2QENA 2QQ9A 4UHTA 2DQLA 1ZG5A 5D4SA 3KLNA 1BI1A 3SZTA 5IT9K 3MFKA 1SFEA 2JPBA 4ENMA 5AIPA 4MEYF 3N4MA 1YG2A 1LDJA 3G73A 3I53A 4B8XA 3KLOA 1IN6A 1Z6TA 2RDPA 2VBXA 5D8KB 2M45A 2A07F 3WTXC 1IXSB 5JHUA 2E7XA 3ERED 4FT8A 3V8KA 2W84A 4IF4A 4LK0F 1B59A 3LA3A 4NQWA 1K6OA 3TOAA 4AD9A 2FA5A 4FHTA 4HX8A 4A6EA 5LGUA 1ZREA 4U7BA 4CHUA 2BBYA 2RV8A 3WE3A 2E7WA 1YTYA 4AIHA 4OIRF 3BJOA 1ZG1A 3W6JB 3R0JA 2XVCA 3SZPA 1IXRC 3FZVA 1ZGJA 3HIFA 4I2OA 5ILSA 4CXFA 3DP7A 5LLQA 1XGMA 2W24A 3CUOA 3V7CA 1G3TA 1U2WA 4PGGA 4QLCU 2KKOA 3SQNA 1XGOA 4GYGA 1GVJA 3LAJA 1J0RA 4L9VA 1TLHB 4WXDA 1U3EM 4FX4A 5L3GA 3WTTC 1H9GA 6PAXA 2BEOA 1D8JA 3RTRA 2Q0OA 2XAGA 3ECHA 4KN4X 2DBBA 2DLLA 2K27A 5HOOA 5HLHA 1WQ2A 4S05A 4LB6B 4HW0A 3I54A 2VE8A 4JQFA 4UVBA 2ZKZA 1WKMA 2JZYA 2ELHA 2FBHA 3F6OA 3E97A 3RYPA 3MZYA 2QVOA 1OR7A 2PEXA 3VODA 1TQIA 1G3SA 2FBKA 2UWMA 2ZCWA 3WTSC 2D1HA 2G9WA 1KA8A 2NS0A 1QGPA 3GUDA 3CO7C 1Z9CA 2GXGA 2UXXA 1FBSA 3SHFA 5E8IA 3R6SA 1RNLA 4PCQA 4HLYA 5ILUA 2VONA 3RIRA 1L3LA 1S3JA 4HZFA 5E8GA 1ZARA 4QWQA 1O3SA 4A0YA 2EWNA 4O3MA 4HLXA 3T0YA 1XDSA 5TJJA 2GA2A 1UCRA 3ELKA 4UVCA 3LFKA 3D5LA 1B4AA 2XGXA 4R79A 1BIBA 2FOKA 2P4WA 1RUNA 1IUYA 4HBLA 5BS6A 2GZWA 4WF2A 2ISZA 3FF5A 4A5MA 3C18A 4GGGA 1MD0A 5F1RA 3P9CA 4KIGA 4KIFA 3AAFA 2P7CB 4BQAA 5HS8A 4M74A 5D6EA 4LK1F 3QAHA 4KFCA 3JAMK 1G6NA 4XSXF 2H27A 4YFKF 4P9UA 3T1BA 1SMTA 2VC0A 1MZBA 1LDKB 3T8TA 3QPHA 4BHPA 5D8LB 1MJ9A 4ENJA 3WTWC 2L3DA 2NYXA 2P5KA 5ICEA 1TBXA 2KIMA 1IRFA 1FYLA 4R8HA 2HR3A 4Y17A 2VT3A 2QQBA 1KU9A 4ESBA 2HDCA 2RC4A 4LB5A 1MJAA 3J7AO 1FX7A 5AONA 3BJAA 3P7NA 2PQ8A 4G9YA 3OV8A 3HRMA 2RQPA 2HFHA 1XN7A 2DO7A 4L9TA 3B73A 2NAZA 3M1EA 4ESFA 1YS7A 3ISPA 4BHBA 1IW7F 4LFUA 2XKOA 4KICA 1AWCA 2R7DA 3KETA 4GYIA 1TNTA 3TGNA 2E1CA 4AIJA 2Q2EA 1SMYF 5FD6A 2GAUA 1SD7A 2VODA 2EFNA 1BBYA 1ODDA 2DK8A 5KK1A 4ZZLA 2IVMA 2TDXA 4HX4A 3E5XA 3WTUC 4HAMA 2RN7A 2YX4A 2A6EF 4PDKA 1WWXA 1YW8A 1E17A 1XCBA 5E1ZB 1DPUA 3IRRA 5A2QZ 3ZMSA 2MC3A 2ISYA 1QPMA 2OZUA 1UHMA 3WTYC 4OIPF 1XDUA 3GX4X 2XIGA 3P9IA 4G8XA 4RB1A 2QZ8A 4G7OF 2PBIA 4HA8A 3RKYA 2D2WA 4F7ZA 4ZYGA 2CG4A 4RB3C 1ZLJA 4BYYA 3E6BA 1XD7A 2VXZA 1F4KA 2AXLA 1P4XA 3BPXA 2VOPA 3RKXA 3GWZA 4EJVA 4Q5SF 4RGUA 4P55A 4E70A 4OU0A 1FWZA 3C7JA 5E18F 2F5FA 2WV0A 3HSEA 2ZNZA 2VOOA 3DPTA 3GYHX 2XHKA 3L2CA 3PQJA 1MJBA 1IN8A 2WTEA 2FBIA 3FM3A 4EM0B 5L3BA 3GZ6A 3ZPLA 1U6GA 1LEAA 3W6KB 5JVTA 3S2WA 1XSXA 1K7AA 2A3SA 3ZMUA 5E20A 3JW4A 5LEKA 2X4HA 2W57A 1MGTA 3EYIA 1FYKA 1OYWA 5CYVA 4Q47A 4MGRA 4ASNA 4M9ZA 3HSFA 2QBYB 4HDVA 1LDDA 2JRTA 3TKYA 2EA4A 2HQNA 2ZO4A 1CF7A 3TDZC 1KU3A 1FP2A 5K5QA 5FGMA 2HEOA 4AVPA 3U1DA 2J5OA 4MEXF 2IA2A 2ESHA 2QYOA 5K1YA 1WI9A 4ZYDA 1F1ZA 1BN5A 3GVAA 3FMQA 2MH9A 4UV9A 3NRVA 5DDGA 3I0TA 2M8EA 3GFLA 5E1XA 1JXSA 2VBYA 2F2EA 2FMYA 4B09A 3HTUA 4OIQF 4WXCA 5E1WA 3WTVC 4M71A 3TDUC 4G94A 1TNSA 4RB0A 3QP6A 1P6RA 5J8CA 4WWCA 3MQ0A 4YFNF 3TO7A 2XAHA 5L3FA 3I71A 3K1MA 4I98B 4HX7A 1DP7P 1YFHA 2MA3A 3K2ZA 1ZG3A 1XCVA 3M9AA 5DD8A 3REOA 3RYRA 4U7DA 4S04A 1KQ8A 5TRDA 1R5GA 5ICGA 5J6XA 2RNJA 3BZ6A 2VN2A 3GW2A 4M6YA 3HHHA 2P7VB 5AIQA 2JPCA 3V7RA 1P92A 1IN4A 3QU6A 3HTSB 2M30A 2PJPA 2CYYA 4ZYHA 4IHSA 2LF8A 3K1NA 3K69A 2PI0A 2M87A 4MQVA 1PDNC 2RKHA 3ZMZA 5CVVA 3ZMTA 2ADUA 2PLYA 4UV8A 2IRFG 2W85A 2EA2A 1P2FA 4WK8F 1BI0A 2ZNYA 3WGIA 4HQEA 3OOPA 2HTJA 3V7SA 1RUOA 2QBYA 1I6XA 3HRUA 1R1UA 1FSEA 2CO5A 5EEHA 5LHGA 4EVIA 3F72A 3FXQA 3ECOA 4LGWA 2IW5A 3FWEA 3JSOA 2NNNA 1R1VA 2L4AA 3L00A 1J2XA 1IAWA 2O0YA 3VB2A 5DYMA 2X0LA 2DW4A 1KYZA 3ABTA 5FB2A 4IRHA 1FT9A 5CVUA 4RB2C 3F6VA 5IT9Z 4JBAA 1IRGA 2FNAA 2LF7A 2P6SA 3QRFF 2Y75A 5F64A 3I5UA 3R0AA 2AS5F 1FY7A 1SD4A 4P96A 1QQIA 5IT3A 1IF1A 2DQRA 1O57A 4HV6A 4U88A 2HKXA 4G7ZF 1U8RA 2FQ3A 2EV5A 2DPUA 2H6CA 3ULQB 2XAFA 1ULYA 4M73A 5LGNA 1TTYA 4MTEA 4WXHA 2J5PA 1BOAA 2EFPA 3CUQC 4UVAA 2HS5A 3V4GA 1QNTA 1VTNC 4BXUA 5H6QA 2NRAC 2JTVA 5D5WB 5LHHA 3LQRA 2VBZA 2ZBKA 1O7LA 3KE2A 4O5VA 2KJCA 3R61A 4ETSA 3HRSA 4JK1X 2IT0A 4A2UA 1HKTA 2PMUA 1RZ4A 1ZRFA 2BGCA 2ESNA 5HS7A 3FXUA 2ETHA 4L0ZB 1O3QA 3CDHA 1TQPA 4CDGA 1OKRA 2FNPA 4KYWA 3F8CA 1FSHA 1FLIA 4L0YB 4EJOA 1HW2A 2D1VA 4AWXB 5HLGA 1WSUA 3J81K 1GHCA 1YW7A 4U0VA 4MNUA 4DQ2A 1LEBA 3VEPA 5DV5A 4NHJA 3TQNA 4LG0A 3PFIA 2CW0F 3GO5A 1T98A 3F3XA 2PMHA 3M8FA 2OZ6A 3LA2A 4A12A 3IC7A 4IRIA 3WTZA 3KP2A 1SFUA 1YIOA 2B0LA 2FU4A 2P8TA 1OMIA 2A68F 4UXNA 4HQMA 1DPRA 1T38A 2FMLA 2OQGA 5FD5A 2OD5A 3PQKA 2ZXJA 1K78A 4OOIA 1ZH5A 1IN7A 3SFZA 5FO5A 3TO6A 5L3EA 3IWFA 5A2QK 1KGSA 5JI6A 2V6CA 1IZ1A 1XSVA 5DCMB 1C0WA 3E5UA 1IXCA 2XRNA 1OYIA 2EJRA 1PP8F 2ZFWA 4N9IA 3KEQA 1UFMA 4HF2A 1MKMA 3DKWA 3JSPA 4IJAA 1E2XA 3BJ6A 3IWZA 1B1BA 1Q1HA 3HRTA 2HTSA 3IHUA 2C6YA 2K7LA 1W7PB 3JAMZ 2DFIA 5CVIA 1R5HA 5CJ9A 1YS6A 4HF0A 4EV0A 5BQTA 1EH7A 1LVAA 3KZZA 2HZTA 5LRSA 5LHIA 5ICFA 1FC3A 2EB7A 1LJ9A 3CO6C 2Y0MA 1ZRDA 5JR3A
chains in the Genus database with same CATH superfamily
5E3OA 3AG2H 2YSRA 4LIUA 3W2AA 2DMNA 3CLOA 5B5EC 1FP1D 2KMUA 3CC7I 3GTOJ 3H92A 2L01A 3ABUA 2EV6A 4K2EA 1HBXG 1T2KA 3DBLB 2IA0A 1QZZA 4UB8C 3L1PA 3IP4B 4NDLA 4YG2F 1R6RA 4X1EA 3MKLA 2XAQA 1USTA 3EDPA 3VFZA 4CGZA 4G6QA 1G3YA 2EZHA 3A01A 3FKJA 5IP9J 1HA8A 5E17F 2CFXA 3BTCA 3O8HA 3V42A 1Y1VJ 2LY1A 3I56I 2P5LC 1QBJA 5K5RA 3FX3A 1AOYA 2VT2A 3ZQHA 5IOYA 3Q9SA 1R22A 3A01B 3H3UA 3D0SA 1ZKGA 3JTHA 4P1WA 2BYVE 4CICA 4F3QA 3F22A 4EGYA 2RGVA 1ZN2A 3O3KA 1S29A 4BQNA 3E5QA 4RGXA 1FOWA 3IRQA 3M7GA 1X2NA 1YOVB 2X1DA 1H0MA 3KFWX 3BR5A 3H0DA 2L7KA 3BR6A 5JR3A 3GFMA 3CCEI 2E71A 1E3PA 3BOQA 3QOEA 4M3BA 3J7ZI 4G6TB 1VFCA 3VOEA 2HQAA 5FLXZ 3CTAA 4PJJA 4CH7A 4LLGF 2PJRA 1QO0D 3RKWA 3UKGA 1UELB 3JRDA 1MH3A 1JTYA 3TL4X 1G2HA 2CV0A 2O5RA 5H2FC 1GLNA 4OMZA 2NXNB 2ACJA 4BE1A 3LSTA 4XRSG 4O6JA 2RREA 1XGSA 2F48A 2QSFX 1AU7A 2B9SA 5D4RA 1EH6A 1Z1DA 1WI3A 3TP3A 2AHQA 5B1BH 1F5TA 2ZMEC 3BR3A 2K9LA 1IV6A 1ZGAA 3T5XA 2IGMA 3HOSA 2Z99A 3M1CA 3O6BB 2O61A 1IRXA 3J80Z 4JX5A 3E6CC 4I02A 4IHWA 2FRHA 2O9LA 3MEXA 4IVNA 1GDTA 1YQAA 5LRRA 2CV2A 1I1GA 3CCMI 2I10A 4U0WA 3H36A 1ZAOA 3RSNA 2OCCH 5DCMA 4PSWA 1T08B 4OMYA 1O3TA 3M4OJ 2G7UA 4HRIA 2PG4A 3H5NA 3KP4A 1R4NB 1DUXC 1D5VA 2OF7A 3QP5A 1NH3A 1HSJA 3S8PA 2O8XA 5LD2C 2R93J 3WU0A 3M3YJ 3KZYA 1P4AA 4KUMA 2EV0A 2XF5A 1UB9A 4PGHA 1QHHD 3D5SC 2VQHA 2L7ZA 2XPUA 2BW3A 1NHAA 3A2KA 1WJEA 3IAS2 3J81Z 1QA6A 2FX0A 4AM3A 1OYYA 1FOYA 2HU9A 3V8JA 3GFIA 3L2UA 3RPUA 1W7PA 3PL8A 3OS2A 4FX0A 1WRJA 3CQZJ 4G6DA 4EJTA 2BV6A 2LOOA 3ZXSA 2IEKA 5F04A 3NQOA 3FIWA 4BAYA 2HQ5A 1WJBA 3ABMH 3N97A 3LMMA 2QF7A 1GXQA 2YU9J 3FXRA 3DTKA 3OYEA 3J81R 4M3FA 3K9TA 4UUSB 4OIOF 4MQ9F 2GIZA 1RESA 2CQKA 1HW1A 1B8IB 4DNCA 1PP7U 4JX6A 3E6MA 2BXYA 4XM3A 1REPC 3ONQA 4JP0A 2QLZA 3FHNA 3I4PA 5DD4A 1V4RA 1BW5A 1IN5A 1L0OC 3F8MA 1RPWA 1X58A 4EM1A 2M1BA 3H3ZA 1MDMA 5CLSA 5BPDA 4Y7NJ 4ZZDA 3AL0B 2JA6J 2DPDA 4KN7X 3JREA 5JLWA 2XUBA 1MBGA 1I5ZA 3KYDB 1KQ0A 2STTA 3KP6A 1U9NA 2ZMEB 3J80K 1MBKA 2ID6A 2WAFA 2Z2SB 4RGRA 3RPQA 4A0XA 3CCQI 1A36A 1XMKA 3ZQGA 3QPLA 2RNGA 2PX9A 4XOTA 3IL2A 2JJ7A 5IP6A 2HZDA 2WV1A 2BHYA 2LREA 3DV8A 2Y69H 5FKLA 3COAC 4A0ZA 3KCCA 5CQGA 1B72B 5BNGA 1SFKA 4IZZA 2BY3A 2ME0A 3UNGC 3TEDA 3I58A 1T8IA 3GTKJ 3AL0C 1GT0C 3O2PE 2V9VA 1Z6RA 5KAFC 4RAFA 1LPQA 1AKHB 1DQUA 1R00A 2VE9A 3B02A 3AG4H 1BJAA 3MAJA 2Z3YA 2HVRA 1Z77A 1JE8A 1U0JA 4HYEA 3DEWA 4DW6A 1ON1A 1BC7C 4IRGA 4L9JA 5EZHA 1HSTA 5M3MJ 4PSXA 3K0LA 2LBFA 2LKPA 3EETA 3V8LA 2KDOA 2UZKA 3LA7A 1XPXA 4UY8I 1DDNA 5DUKA 1SD6A 3AKZA 2DI3A 2FJ1A 2KIFA 4WX9A 3K70C 2CGPA 4BE2A 1JKPC 2E36A 2EK5A 1I27A 3U9GA 4BKXA 2QWWA 3PSFA 1A35A 5HLIA 3WHCA 1TW3A 2KJBA 3R4KA 3S2HJ 2EFOA 2IBDA 1YYVA 2WC2A 1SVMA 1QHGA 3ESWB 4I0BA 2CUFA 4HF1A 2CH0A 1I39A 2OAZA 5D5VB 2R5YB 1FPQA 4RMNA 2V79A 4XLHA 4XLNF 2MD5A 2DXIA 4ZH4F 2IAIA 1K61A 3Q3SA 5HNHA 2ZJ2A 4DOZA 2IA1A 3RJPA 4QIWN 4NQWB 1HLVA 3DEUA 4CYDA 3OS0A 1FYMA 4FISA 2DU9A 5BMZA 4G7HF 3KEYA 3HJEA 2XF7A 3OYNA 4M3EA 1S72I 1A5JA 2XDVA 4FQGA 5D5XB 5H20A 2CU7A 2I8DA 2PMZN 1V54H 1TQMA 2W82A 3KP3A 1OCPA 2K86A 4PJ0C 1WCMJ 2W1OA 4YIFA 3EQLF 1FBUA 2PN6A 2HWVA 1N75A 2CQQA 4ENKA 2Y9ZA 5JLXA 1X4PA 1JKOC 2VBWA 5HDNA 3BT9A 2LSOA 4L9NA 1B9MA 5IPAA 4LLNA 2FF4A 2H6BA 2O3FA 4RS8A 4LD5A 4YELA 5EYRA 4KIBA 2R5ZA 3IH2A 3MCZA 4JX4A 1O7FA 4M9SA 1FBQA 2YU3A 2IPQX 2GWRA 3EPZA 2WWYA 2H09A 4E7LA 1U9OA 2OBPA 2RVCA 3M8EA 4EGZA 4E7JA 2FXAA 2P6TA 4BL0B 2COBA 2R7RA 1V3FA 2L9RA 3L9FA 2MBFA 2QKLB 1RIOH 2JA5J 3M8JA 5GAEJ 3RI4A 1B9NA 1RR7A 4ITVA 1R36A 1S7AA 5FROA 4LITA 5H6RA 1MNMC 4UNOA 1JJ8C 1FOXA 2OTLI 5GAGJ 4EQQA 3GF2A 3GLLA 4BDYA 1D8KA 1Z7UA 4BY7J 3OYHA 4IXAA 2R3SA 1EV7A 2XSDC 5LBQA 5EG0A 2GIVA 4XRMA 3BQZA 3JRHA 4GCVA 1S7OA 1OCCH 3FMSA 4AU7A 1VQ5I 1K4SA 3C3WA 3LSRA 2WY8Q 4KT5C 1W0TA 3RQ4A 4B43A 2MLGA 4C3IJ 4YRVA 2BY1A 1TZLA 3BPVA 1J75A 3GLXA 1A04A 1YX5A 4M3GA 3ZQ7A 4CCOA 3CZ6A 5M5WJ 4FASD 4XNFA 1LQ1A 1MDMB 1JUMA 1CGPA 1W5TA 4XSZF 1IV8A 2OA4A 3E1SA 2VPLA 3BCAA 5EEGA 3R60A 4IEJA 1FOKA 5DUIA 2R7FA 3BY6A 2CW7A 3O8GA 2Q8KA 2O8KA 3PNVA 2OU2A 4A69C 4CO8A 1MBJA 1X1BA 5IT9R 3F8FA 2ECBA 3BR0A 4AUXA 1YHQI 1ZRCA 2L02A 2OQRA 1G4DA 3OYKA 1W4MA 3L09A 3EUHA 4B1RA 3HGGA 4LG0B 1JI8A 1YJ9I 4A3IJ 3NEUA 2M8GX 4QTRA 1S6LA 4CYCB 4B44A 3LSPA 3BWGA 2COMA 2XAUA 1R5ID 2KRFA 1YO5C 2GBYA 4BU2A 2MGQA 4P9FA 4MHGA 1KU7A 1J9IA 2ZXHA 1N25A 4AIKA 2YR2A 3F9KA 3LSKA 3S16J 2Y9YA 2F5EA 4D1QA 1J7KA 3MMYB 1IRZA 2Y48A 1F9NA 1QZYA 2K4JA 3OYLA 4GXOA 4BXXJ 3SDGA 3CDLA 4KNYA 1T6SA 1VQ8I 1W5SA 1USSA 2JSPA 2M34A 2X48A 2M4GA 2JSCA 4IHYA 2A61A 5ERIA 2DOAA 1I3QJ 4Y3OA 1BR2A 3Q9VA 4M72A 1DP3A 1SAXA 3HXLA 4HG2A 2R92J 1MH4A 4HEA2 4H4KC 3NAUA 2W48A 3K1PA 5CPRB 3C1DA 3J7YJ 3I59A 1S8NA 2M3AA 2MSYA 4TV7A 4ZYAA 2E5ZA 3QWLA 1IC8A 1W1WE 3F8BA 1IGNA 5DCFA 3CC4I 2ME6A 5HDGA 3GXOA 4RGSA 1JKRC 1ONVA 2W4SA 1XMAA 4LMYA 4XLPF 1XS9A 1D3YA 2LP0A 2YS9A 3BDDA 3E6DA 5FLXR 2QGUA 2O6GE 2G0EA 2DA6A 2QKMB 3GCMA 2HYFA 4ESJA 2DT5A 2NVXJ 1QU3A 2F4OB 5D5UB 1K79A 3LQQA 4BGDA 3CMEI 4NC8A 1G3WA 2EZLA 4L5JA 2E2IJ 2P5VA 4IPAA 1HQCA 1H8AC 3HOUJ 4MTDA 4B48A 1W7PD 3F23A 1Z3YA 4NBQA 3F21A 3SXYA 2LDUA 1P4WA 1X4OA 4OINF 2EFWA 3PO2J 1BC8C 1GXPA 2F5DA 2V1XA 1JHHA 2WBMA 4R1HA 4IOCF 1ZYRF 2Q2EB 3CUQB 1SVOA 1YE9A 2K4BA 1I1SA 2ZXWH 3S2DJ 1S9HA 2FSWA 3A03A 3HPHA 5ILVA 1UG2A 4HDUA 1T39A 2DJIA 5LEJA 5LGTA 3ZN0A 2KIUA 2Y0SN 1WJ5A 2DK5A 1TW2A 1XTAA 3VYTB 3HUGA 2Y30A 5EJCA 2XGDA 2R7QA 1JHFA 4RLFA 3VYUB 1SAUA 2QQ8A 4L18B 1SVLA 2IJLA 2UXNA 3FBNB 3KIOA 2NVTJ 1ZTRA 1YJWI 2PFBA 1Y0NA 3BG3A 2Q1ZB 2BE5F 1MIJA 3OYCA 2NS7A 4S0HB 2DMQA 3S32A 4UB6C 2QQAA 4A3LJ 1WVRA 2G7HA 5KNLA 4XLFA 1R23A 2F5CA 2O03A 3IKTA 3ZQFA 1HKSA 3T8RA 1U5TC 4XR6A 1WFXA 3CF2A 2FEZA 3I59B 3WE2A 4EJWA 1BIAA 3IKVA 5KVRA 5FKNA 4KDPA 2LYCA 3ZQLA 2F4IA 2CWEA 1R1TA 3L7WA 2ZMEA 3RCOA 3BG6A 4DBQA 3DQVC 1GV2A 4EM2A 5K5OA 5D6FA 2V1DA 3GFJA 5C4XJ 5IOZA 2R7TA 2M35A 1BI2A 3CCYA 3FMRA 4WCGA 2NNYA 4KMFA 1SD5A 3FBIB 3Q0VA 4CYCA 1S7EA 3IAM2 1HW5A 3NWTA 1BW6A 2A6HF 2X6OA 3JCUC 3BTLA 1RI7A 5CQEA 4D0PA 3DKXA 2GXBA 1ON2A 4ZYEA 3GZ5A 4HNTA 1XGNA 3DLAA 4BJ5C 5F6FA 1BJZA 3TOBA 1YLFA 3LSIA 4BHCA 2RQQA 2XPWA 1Y0UA 2PJRB 1N77A 2HKOA 1XSDA 3LAPA 2GA1A 3WODF 1D0XA 1MMSA 3DF8A 1ZHFA 3KZIC 2XROA 2DA4A 2OJED 1Z21A 4MLOA 1BR1A 2L54A 3U2RA 2A6TA 4AC0A 4B4CA 3CCUI 3WGGA 1D1CA 1XMXA 3I64A 4OWRB 1X1DA 4PZJA 3CJNA 1FNNA 3ASOH 3PFYA 4XONA 3RQIA 1UHWA 3I3LA 4XRFA 4HV5A 2MH2A 1U5TA 1W36C 1Z67A 4OAYA 2H8WA 2A5WA 5FFZA 1G8XA 5BPIA 3FHZA 2LK2A 3MWMA 1NG7A 4UUVA 1EH8A 4H0EA 4A6DA 4Q48A 2E1NA 4N0BA 3OYDA 3HOTA 3S15J 3CJRB 4E6KG 4JYKA 3K6GA 5FRNA 1E0EA 3BROA 1HXDA 5HS9A 3ZMVA 3S3NA 2XKPA 5DEQA 1IO2A 4ENNA 3G3ZA 2HOAA 2JT1A 2DTRA 3CMYA 5F08A 1MW7A 4PFOA 2E5NA 4C3JJ 2Z5UA 1SFXA 1KYWA 4BS9A 2CUZA 3QQAA 4G12A 3LNQA 3KP5A 3OR1C 3G71I 2LNBA 4D5FA 4Y13A 3VDXA 2Z9OA 2GM4A 4M6XA 4NB5A 2A5YB 2BW3B 3P9KA 1APLC 1R9TJ 2X6XA 3ZP5A 2QM3A 3ERMA 3OS1A 3RPUD 2XV4S 1ZLKA 3WG7H 1JGSA 1XB4A 1D1AA 4EMSA 3KP7A 1IDYA 4LJZF 5IP7J 1I50J 3S1NJ 1R58A 2X51A 3H1CA 5FFXA 4MFDA 3ZN1A 3GTMJ 3FXMA 1TL8A 3H3VK 1CF7B 4KMUX 1FZPB 4DIQA 2VKEA 3CUQA 2DA1A 3WU1B 3E3VA 3JRGA 4L5IA 1OISA 3ASNH 3FKIJ 5E3NA 1YITI 3DFGA 4B3XA 1VNDA 2WAQN 3BTIA 3LSMA 5BOXA 2HYGD 3AG1H 1UJ8A 4A3KJ 4EJUA 4ON0A 2CJJA 1R7JA 1YRNB 4Q4ZF 1ENHA 4KA4A 3ML6A 4HNUA 2NVYJ 1Y8RB 1U78A 1MBFA 2M5WA 2HQRA 4RAYA 4BH9A 3HYIA 3J80R 3RDIA 3KYLA 1Z91A 5ICCA 1LNWA 1T0FA 5F0FA 1OPCA 4BACA 1BM9A 3BQYA 1PUEE 4M9XA 4BEHB 2VC1A 4F93B 2E2JJ 1X3UA 2IP2A 1RKTA 3MN2A 5TISC 1VQ4I 2VL8A 4XK4A 3W2VA 1MBEA 1KZHA 3DKYA 2YPRA 3HSRA 3CP8A 4I0AA 3QU3A 4CA0A 2HDWA 1LB2A 1ZGWA 2NOJB 2A69F 3EYYA 5LFAA 1PUFA 1K78B 4BNCA 2GQQA 3HZJA 2HI3A 4N4OB 3JTGA 3DXJF 2JRMA 2IS4A 4JOMA 3TO9A 5L3CA 1AKHA 5FLXK 1O3RA 4QPOA 3HHGA 2EZIA 1FTZA 2VJ4A 2XAJA 3DPLC 1B6AA 4HOBA 3S14J 3WGHA 1WJDA 3IUOA 5CVRA 2ZC2A 4C3HJ 3QOPA 3ABKH 3K4KA 2E2HJ 2CSOA 1UG0A 3ZMDA 3H35A 5HDKA 2Y2ZA 2KRCA 5JFRA 4I09A 1J5YA 1TT0A 3SEZA 4N9HA 3IH4A 1VI0A 4C2MJ 4U0YA 1S5LC 4RAZA 4P5OA 4XBFA 3DPUA 4I01A 3CC2I 3HOWJ 5GADJ 3FM5A 1KU2A 2GOXB 1YW9A 1BI3A 2QUFA 2EFQA 5B3SH 3BG7A 3Q0UA 2D45A 1POGA 4IQ4A 1STZA 4YIIA 3HOZJ 2L4MA 2WADA 1BOBA 1VQOI 4Y15A 1JT0A 2JQ7A 5HVQC 1ETWA 4GO1A 4I7HA 2JVGA 3MZHA 4YFXF 1VQ7I 1KQ9A 2KL4A 2ZB9A 4Z2YA 4CZZA 1U5TB 4A5NA 2HOEA 2H94A 3ROUA 3L2WA 4CUGA 4LLLA 4N4NB 2V1UA 3Q5FA 3U1KA 3WG9A 1D0YA 2EILH 3SDBA 5L3DA 3JRIA 2CRGA 2CFOA 1H9TA 3QYBA 5ED4A 3F8NA 2MLKA 2XASA 3EUKL 1BA5A 4I99C 1Z05A 3H9GA 1ORKA 4XQFA 1T33A 2ECCA 2K02A 3GEZA 2W25A 1OQYA 3E7LA 3KEOA 4Z6YA 4IHTA 2ZSHB 1TWHJ 2DFEA 3QPTA 1J59A 2HXIA 2FE3A 5CVJA 2HGCA 2YX7A 3BP8A 1HKQA 3LWFA 2STWA 1JJ6C 2F6CA 2WAQA 2EQRA 2XGEA 2Z33A 2K85A 4Y33A 5J8FA 3FISA 1TWGJ 2DAOA 2QENA 2QQ9A 4UHTA 1Y56A 3HOYJ 1ETXA 2DQLA 1ZG5A 5D4SA 3KLNA 1BI1A 3SZTA 2R7ZJ 1HDDC 5IT9K 3MFKA 4QSHA 5EGOB 1SFEA 2DFFA 2Y31A 5M3FJ 3DTIA 2JPBA 2ICWG 4ENMA 4D7MA 3U21A 2X6YA 3VSLA 5AIPA 2RAEA 4MEYF 3N4MA 5J47A 4BQQA 1YG2A 1LDJA 3G73A 3BR1A 3RZDJ 3ZQQA 2DMPA 3I53A 4B8XA 4I76A 3KLOA 4XICA 1IN6A 3LOCA 1Z6TA 3CP2A 4J19A 2RDPA 5JVGF 2VBXA 5HODA 5D8KB 2M45A 3SEQA 2A07F 2QCOA 3WTXC 1OCZH 4FCYA 4NC6A 1IXSB 4M3DA 4XORA 5JHUA 4RM3A 3HG9A 2EPFA 2E7XA 5FKOA 2DJNA 3ERED 4FT8A 3BTJA 3V8KA 1T95A 4B47A 2W84A 4IF4A 4DYQA 2CMPA 2ELKA 3KX2A 4LK0F 3HDDA 4ZTFA 2VKVA 1B59A 2LH9A 5J3LA 3LA3A 3A1YA 4NQWA 2LVSA 5FKMA 2R7WA 1K6OA 3TOAA 4NC7A 4AD9A 2FA5A 1RC9A 3SYTA 4FHTA 1GUUA 3DU6A 4HX8A 1VQ9I 4A6EA 5LGUA 1ZREA 4U7BA 4CHUA 3K4LA 2BBYA 2RV8A 3HPGA 2IS1A 3WE3A 3KPHA 2IGNA 4XKWA 2E7WA 4IQJA 1YTYA 4AIHA 4OIRF 4F52A 2VXDA 3BJOA 1ZG1A 3W6JB 4KITB 2ZJPF 3R0JA 2XVCA 3SZPA 1IXRC 3FZVA 3OL3A 1ZGJA 4V2FA 2WA0A 2EIKH 1VQLI 3HIFA 1OCTC 4A3GJ 4RDUA 4PK4A 4I2OA 5ILSA 4CXFA 3DP7A 2XC7A 5LLQA 3B6AA 1XGMA 2W24A 2VJIA 3OYGA 3CUOA 1WH7A 1W36D 3CF5F 1AA7A 3FDYA 3V7CA 1G3TA 1U2WA 4PGGA 1H89C 5EGOA 4QLCU 2KKOA 3CD6I 3SQNA 3NARA 3S17J 3OWTA 1XGOA 2XSJC 1PVEA 4GYGA 4W97A 4D7NA 4V2GA 1GVJA 3LAJA 1J0RA 4LG3A 3A02A 4L9VA 3GBGA 2MW8A 1TLHB 2DA2A 4WXDA 1EKEA 1U3EM 1K83J 2JN6A 4FX4A 4XKVA 5L3GA 3WTTC 1H9GA 3G2BA 1JUSA 6PAXA 2K5CA 3K4NA 2CQXA 2BEOA 1D8JA 1KONA 3RTRA 4BDZA 2Q0OA 2TRTA 1DU6A 2E19A 2XAGA 1M1EB 3ECHA 4KN4X 2DBBA 2DLLA 2K27A 5HOOA 5HLHA 3MKZA 4PJMA 1WQ2A 2R7XA 4S05A 1BR4A 4LB6B 4HW0A 3I54A 2VE8A 4JQFA 4UVBA 4KJZA 3FXKA 2VJ5A 5FLVA 2ZKZA 1WKMA 2JZYA 5C44J 4CCNA 4XRSA 2ELHA 5HLTA 2FBHA 4I6ZA 3F6OA 3E97A 3RYPA 1SFOJ 3EUHC 3MZYA 2MABA 4MO7A 2QVOA 1B72A 1OR7A 2M0CA 2DOEA 2PEXA 3ZGKA 4D9JA 2VIXA 1TQIA 3VODA 1G3SA 2FBKA 4MIMA 2UWMA 2BVLA 1EJ9A 2ZCWA 1JT6A 3WTSC 2D1HA 3H9QA 2G9WA 3JRBA 1KA8A 2M4KA 2NS0A 1VQKI 1QGPA 2KQRA 4CCMA 3GUDA 2VKHA 3CO7C 1Z9CA 2GXGA 2X1CA 2UXXA 4DYCA 2VPRA 1FBSA 3SHFA 5E8IA 2LKSA 2IGOA 3R6SA 1RNLA 4PCQA 3HB9A 4HLYA 2EH3A 4KT6A 2L7FP 3GTJJ 2CUEA 3OY9A 3VPRA 5ILUA 1P9QC 4U87A 2VONA 2GXAA 3S1QJ 3RIRA 1L3LA 2BY0A 1S3JA 1UHSA 2DFHA 4HZFA 1ZARA 3DBRB 4W1UA 5E8GA 1IUFA 4QWQA 4E7HA 1O3SA 3PO3J 2CS3A 1JGGA 4A0YA 2EWNA 2NVUB 4O3MA 3IV5A 3EUAA 4HLXA 4XLCA 3JRCA 5K7FA 5FLMJ 1YIJI 3T0YA 1LKXA 2L9VA 1XDSA 5TJJA 3DU5A 2M7AA 1ACIA 2GA2A 1UCRA 3A0HC 3ELKA 2LY2A 5C4JJ 1Y39A 4UVCA 2ID3A 3LFKA 3D5LA 4A3BJ 1SC7A 1B4AA 4YIRX 2XGXA 4R79A 5F1JA 3OYBA 2UUZA 1BIBA 2X6WA 3FK6A 2IS6A 3OIQA 2Y0SA 2FOKA 2P4WA 1RUNA 1IUYA 4HBLA 5BS6A 3IH3A 2GZWA 4WF2A 2ISZA 3FF5A 4A5MA 3C2HA 3MZ8A 2HPIA 3C18A 3HKZA 2E1OA 4GGGA 1MD0A 2BHZA 4QPQA 5F1RA 3HOXJ 4V19K 4X0GA 3P9CA 4KIGA 4KIFA 3AAFA 2P7CB 2AXTC 1MNDA 1QPIA 4BQAA 5HS8A 4M74A 3L2RA 2IGKA 5D6EA 4XMYA 4A3DJ 4PFPA 5K7ZA 2DDAA 4LK1F 3QAHA 1IJWC 2IXSA 3OYFA 3JAMK 4KFCA 3OR2C 1G6NA 4C30A 4EATA 2JUGA 1OLTA 4XSXF 2H27A 4YFKF 3L2VA 2Z1DA 4PUSA 4P9UA 3T1BA 1VF9A 2LBFB 1SMTA 2VC0A 1J09A 1MZBA 1LDKB 3T8TA 1GV5A 3QPHA 3TP0A 4BHPA 5GPAA 3I4MJ 5D8LB 1NK3P 2EBIA 1MJ9A 4ENJA 3PIPF 3WTWC 1K6YA 2E35A 2L3DA 3QODA 2NYXA 4E4HA 5DTDA 2P5KA 2MFZA 1V5FA 5ICEA 1TBXA 1ZR2A 4E7KA 2KIMA 1IRFA 4A3MJ 3I4NJ 1FYLA 2HVSA 4R8HA 4DGWB 1QVUA 2HR3A 4Y17A 3CLQA 2VT3A 2QQBA 3AFHA 1KU9A 3MD2A 5FKKA 2CW8A 4ESBA 3DCFA 4GRIA 4AYBN 5J4VA 3MVPA 2HDCA 2RC4A 4LB5A 1MJAA 3A0BC 3J7AO 1FX7A 3HBLA 3GTPJ 5AONA 2AQEA 2QEXI 2KDZA 3BJAA 3P7NA 2PQ8A 1JUPA 2E1MC 4CCKA 3OSGA 4ZDLA 4G9YA 3ZOBA 3OV8A 3HRMA 2KRHA 1ETQA 2RQPA 2HFHA 3S3MA 4J00A 1TC3C 1TWAJ 3SJMA 1XN7A 2DO7A 4L9TA 2DODA 3CCVI 3B73A 4FETA 2NAZA 3M1EA 4ESFA 1YS7A 3ISPA 4BHBA 1IW7F 3JRAA 4LFUA 2EIJH 1X1PA 2XKOA 1F36A 2N8GA 1VQPI 1R49A 4D5CA 4KICA 3K4BA 1AWCA 2L5QA 2R7DA 3KETA 2ZFUA 4CCLA 4GYIA 1TNTA 1TP4A 3TGNA 3OYJA 2E1CA 1Y8QB 2DMTA 2OUMA 4AIJA 1VQNI 2EZKA 2Q2EA 2LMDA 2X1EA 1SMYF 2ZXIA 4M6VA 5FD6A 2GAUA 1SD7A 5CKTA 4ANJA 3W6VA 1WH5A 2VODA 2EFNA 2KISA 3L2QA 1BBYA 4MFEA 3C2BA 1ODDA 2DK8A 2TCTA 4BE0A 5KK1A 3WHBA 4ZZLA 2IVMA 2WB1N 2TDXA 4HX4A 3E5XA 3WTUC 2DA5A 1UZCA 2F5VA 1LFPA 4XN3A 3HOVJ 1WJAA 4HAMA 4IO9F 2RN7A 2YX4A 2A6EF 4PDKA 1WWXA 4AVZA 1YW8A 1E17A 1XCBA 4PJLA 2QSHX 3JAMR 3ZRGA 3BLYA 5E1ZB 3OIOA 1DPUA 3VSKA 3IRRA 5A2QZ 1DGWY 3ZMSA 2MC3A 3VWBA 1VQ6I 2ISYA 1QPMA 9ANTA 1QZEA 1T56A 2OZUA 1UHMA 3WTYC 2WB1A 1OCOH 3FK7A 4XLEA 2K3FA 1ETYA 3ZCOA 1XDUA 3GX4X 2XIGA 3P9IA 4G8XA 4EEFG 4OIPF 4RB1A 2QZ8A 5FRMA 4G7OF 2LC2A 2X85A 2PBIA 4HA8A 3W2WA 4GDFA 1TWFJ 2L0KA 1NK2P 3RKYA 4C2TA 4E7SA 2D2WA 2GOMA 4F7ZA 2XPVA 2ELJA 4ZYGA 1I6HJ 2FQ4A 2CG4A 4RB3C 3BCBA 3G4SI 5J40A 4RAGA 1ZLJA 4BYYA 1WHUA 3E6BA 1XD7A 5HNFA 2VXZA 3GZNB 4A3JJ 5IYBJ 2MVTA 1F4KA 2AXLA 2LRDA 1X2MA 3KYCB 2QA4I 2LKXA 4A3FJ 1P4XA 3TW6A 3BPXA 2VOPA 3RKXA 3GWZA 4EJVA 4Q5SF 4RGUA 4BUPA 4IHVA 3H5RA 4P55A 4E70A 2JWTA 4OU0A 4ZDPA 1FWZA 1JTXA 1CQTA 5J1UA 3C7JA 5E18F 2F5FA 2NVQJ 4BQOA 2MUNA 2WV0A 2XF6A 3HSEA 2ZNZA 1XX5A 2FD5A 3M07A 2VOOA 3DPTA 3UR3C 3G1OA 3GYHX 2ZJQF 2XHKA 4DYRA 1H88C 4XLAA 4IOAF 1OR7C 2VQGA 3LFUA 3ZQIA 3DWLE 3L2CA 4PJNA 5GTIC 3PQJA 1MJBA 3HM5A 1IN8A 1LUJB 2WTEA 3S93A 2FBIA 3FM3A 3QYEA 2H8RA 1W5CC 1Z3XA 3ABLH 1UAAA 4EM0B 3D5RC 2B63J 3BC8A 5L3BA 1RR8C 2LLKA 3GZ6A 3CMMA 3ZPLA 1U6GA 3BZKA 1K4TA 5EG0B 1LEAA 3W6KB 5JVTA 2M0MA 3S2WA 2F4MB 1TT5B 1XSXA 2KP6A 4BJ6C 1VQMI 4L5EA 2E60A 2KZVA 1K7AA 2HPMA 1V55H 2A3SA 4NNJA 3ZMUA 5E20A 3JW4A 2MD0A 1IDZA 5LEKA 2X4HA 2MG4A 2W57A 2BXZA 1MGTA 2V26A 1A31A 2BY2A 3EYIA 2L7MP 1FYKA 1OYWA 5CYVA 4IHXA 4Q47A 1D0ZA 1V5GA 3D1NI 1F43A 4MGRA 4ASNA 3PJRA 1WZ2A 4M9ZA 4A3CJ 3Q0WA 3BR2A 3TBIA 2JVHA 3HSFA 3VYSB 3OIPA 5J1RA 3S1RJ 4HDVA 2CV1A 2QBYB 1HDPA 1LDDA 2JRTA 1YRNA 1Z0XA 3TKYA 2EA4A 2HQNA 2ZO4A 2R7UA 5KCMA 2FOWA 2JA8J 2CQ7A 1CF7A 3TDZC 1KU3A 1FP2A 5K5QA 3OMYA 2W7NA 2LG4A 1MBHA 1FJLA 5FGMA 3OYMA 2HEOA 5B66C 2R7SA 3B6CA 3H9JA 3WU2C 1D5YA 4AVPA 1WGXA 3U1DA 4DBRA 1ETKA 2J5OA 3RKQA 5IY5H 4MEXF 3C2GA 2P0TA 5K7HA 1DU0A 2IA2A 5F27A 2ESHA 3CCLI 2HNHA 2QYOA 1E3OC 5K1YA 1MSEC 1WI9A 4ZYDA 1F1ZA 1BN5A 3GVAA 3HGYA 2KHMA 2KFDA 1GVDA 2MH9A 1RETA 3FMQA 1QRYA 4UV9A 1W0UA 3NRVA 5DDGA 3I0TA 2M8EA 2HDDA 3GFLA 1V5EA 5E1XA 4XL9A 3TMOA 1JXSA 4FTHA 2KPMA 2VBYA 2F2EA 2AO9A 2FMYA 2Z16A 4B09A 2OPTA 5EF6A 4BBSJ 3HTUA 5C3EJ 4OIQF 4WXCA 5E1WA 3WTVC 1MMAA 4M71A 3CDIA 1LE8B 1WPKA 1PUFB 2L9NA 3TDUC 4G94A 1TNSA 4XKCA 4XKBA 4RB0A 4DZPA 3QP6A 1P6RA 2XB0X 3H0GJ 5GPCA 2M7BA 5J8CA 4WWCA 3MQ0A 4FE4A 4YFNF 3TO7A 1RKWA 2XAHA 1HCRA 3DEEA 5L3FA 3I71A 5EEAA 3K1MA 3BZCA 4I98B 4HX7A 4A3EJ 1DP7P 1YFHA 5JHFA 1Y6IA 4ZJZA 2MA3A 1X1AA 1ZG3A 3K2ZA 1XCVA 4C9YA 1DGRM 4GFBA 2XB5A 3M9AA 5DD8A 3REOA 3RYRA 2I5UA 4U7DA 3K10A 4S04A 1KQ8A 2JUCA 5TRDA 2ZJRF 5B1AH 1R71A 1NTCA 1JKQC 2V1NA 3GTLJ 1R5GA 3K4CA 5ICGA 5J6XA 2RNJA 1NG6A 1ETOA 3BZ6A 2VN2A 3GW2A 4M6YA 4AIDA 3HHHA 2P7VB 5DM6F 5AIQA 2V7FA 4RA2A 2JPCA 3PM1A 2DDBA 3V7RA 1P92A 1IN4A 3QU6A 2K9NA 3HTSB 2XRLA 5IYCJ 2LFBA 1LVKA 2M30A 2WY7Q 3HC7A 2PJPA 2CYYA 4ZYHA 3OSFA 5EZGA 1A6IA 4IHSA 1ZELA 2LF8A 3K1NA 2JMWA 1OJLA 2DN0A 3K69A 2PI0A 2M87A 4MQVA 2HOSA 1PDNC 4E7ZA 2RKHA 1B8IA 4NUBA 1T0FC 3ZMZA 5CVVA 5J1YA 3ZMTA 2ADUA 2PLYA 4Y52J 4UV8A 3GTGJ 2IRFG 1BL0A 2W85A 2EA2A 2CUJA 1P2FA 4WK8F 4II3A 1BI0A 5DS9A 2BZTA 2ZNYA 4BJTA 3WGIA 3F0CA 4HQEA 2V4JC 1EA3A 2DT7B 3OOPA 4RM2A 3E0JB 2HTJA 3V7SA 1RUOA 2A05A 2R4GA 3PUBA 2QBYA 1I6XA 3BG5A 1XC5A 2QSGX 3HRUA 1R1UA 2R5ZB 1HF0A 1ZK8A 1FSEA 2CO5A 5EEHA 4ZTJA 2YUSA 2EINH 2R7OA 1OCRH 4A93J 5TGTA 5LHGA 4EVIA 1ETVA 2K3PA 3F72A 3FXQA 1D1BA 3ECOA 4LGWA 2IW5A 3FWEA 3JSOA 4ZDOA 1ITYA 2NNNA 2DCEA 2XGCA 1R1VA 2L4AA 3L00A 1J2XA 3I55I 1IAWA 2O0YA 3DBHB 1U8BA 4F92B 3VB2A 5DYMA 1SANA 2X0LA 2DW4A 2H1KA 1KYZA 3ABTA 2HYJA 3K4MA 1RQ6A 2VKDA 5E3MA 4XN0A 5FB2A 4IRHA 3SFIA 2X9DA 2OV7A 1FT9A 5CVUA 2L9SA 4RB2C 3F6VA 2KZGA 5IT9Z 1VZ0A 2FUG2 2E34A 3NWSA 4JBAA 1IRGA 2NS8A 3CCJI 4OAZA 2FNAA 5GP9A 2LF7A 4BXFA 2P6SA 3CCSI 3QRFF 2DTZA 1X19A 2Y75A 4F55A 1A6QA 5F64A 3CJQB 4IKFA 3DLLF 1XG1A 1X1CA 3ZR8X 1P7IA 3I5UA 2R7VA 2VQCA 3R0AA 4ZC3A 2X98A 3K7AJ 2AS5F 1FY7A 1SD4A 4P96A 1LFUP 1QQIA 3HKZN 5IT3A 1IF1A 2DQRA 5FJ8J 3ZQCA 4HSTA 1O57A 3H5AA 4HV6A 4U88A 1X3ZB 3LSGA 4F91B 2HKXA 1EF4A 2LR8A 4G7ZF 1U8RA 2FQ3A 2EV5A 2DPUA 2H6CA 3FXLA 3DTEA 2DMUA 3ULQB 1YJNI 2XAFA 2NOGA 1FEXA 3QYFA 1ULYA 4DJAA 3X2QH 4BY1J 4M73A 5LGNA 1TTYA 5KAIC 3G1LA 3OL4A 4HSRA 4MTEA 4WXHA 2J5PA 1BOAA 2EFPA 3CUQC 1MMGA 4UVAA 2MYSA 3OYIA 1FTTA 4J01A 4CCJA 3HUGB 4HPQA 2HS5A 3V4GA 1QNTA 1VTNC 4BXUA 3G6EI 1UMQA 5H6QA 2K9SA 4KISA 2NRAC 2JTVA 5D5WB 2AQFA 5LHHA 5GAHJ 2P81A 2M9HA 3LQRA 2VBZA 2ZBKA 1O7LA 3A4CA 3KE2A 4O5VA 2DA3A 4Y4RA 2KJCA 1YX3A 3R61A 2VI6A 4ETSA 3HRSA 4JK1X 2MZ4A 2IT0A 4A2UA 2L2OA 3CMAI 1HKTA 2E1MB 2PMUA 1RZ4A 2LD5A 1ZRFA 2DT6A 2DOFA 2BGCA 1QVTA 3PNTA 3HEFA 4XIDA 2ESNA 5HS7A 3FXUA 1WJFA 3K70D 2ETHA 2CQNA 3LL7A 4L0ZB 1O3QA 3CDHA 1TQPA 4CDGA 3OOUA 2R0QC 1ERDA 1OKRA 2FNPA 2HOTA 4KYWA 1Z7LA 3F8CA 1FSHA 3J7AY 2K9MA 2LTPA 2V9KA 2GLOA 2DYSH 2KLOA 3BG9A 5IYDJ 1LFBA 2LY9A 1FLIA 4LOCA 2B7EA 4L0YB 3I9V2 4EJOA 3QPSA 1HW2A 2D1VA 4AWXB 5HLGA 3LSJA 3SZGA 2JA2A 3S1MJ 4CSWA 1WSUA 3S3OA 3CCRI 2OCEA 3G1MA 3J81K 2MC4A 1GHCA 2M2EA 1YW7A 1IG7A 3JRFA 4U0VA 4MNUA 4DQ2A 2HVQA 5E3LA 1LEBA 3VEPA 5DV5A 1MNEA 5DM7F 2V6EA 4X6AJ 4NHJA 1ZQ3P 3TQNA 4LG0A 5J4YA 4DZJA 4HNVA 3N05A 3PFIA 2CW0F 3GO5A 1T98A 3F3XA 1I3AA 2PMHA 3M8FA 3J7AW 2K40A 5M5XJ 2OZ6A 3LA2A 4A12A 3IC7A 4IRIA 3WTZA 3KP2A 4UUTA 3MKWB 3FXJA 2BVMA 2PMZA 3LSHA 1SFUA 1YIOA 2B0LA 2FU4A 2P8TA 1FMWA 3K4JA 2R5YA 4C2UA 2D5VA 1OMIA 2A68F 2KIQA 4UXNA 4HQMA 1DPRA 1T38A 2FMLA 1SEUA 3PUFA 2OQGA 1LE8A 2EIMH 3AG3H 5FD5A 2JA7J 2OD5A 3PQKA 2OC6A 1P7JA 2ZXJA 4ABZA 3PIOF 1K78A 4OOIA 4E7IA 4IX7A 4II2A 1ZH5A 3K2AA 1IN7A 2VQLA 3SFZA 3FXOA 2VB6A 1E3HA 1Q1VA 3PNYA 4XOPA 5FO5A 3TO6A 2DA7A 5L3EA 1YI2I 3IWFA 5A2QK 1KGSA 5JI6A 1N78A 2V6CA 1IZ1A 4RLQA 2BOLA 1XSVA 3GTQJ 3OYAA 3TW7A 5DCMB 1MMNA 5F0HA 4YEJA 1C0WA 1RRJA 1MSFC 2HXOA 3GMEA 3E5UA 2VJJA 1IXCA 2UV1A 5F0CA 2VASA 1AHDP 2H1LA 1OYIA 2EJRA 2XRNA 4IL6C 2DYRH 1PP8F 1OFCX 2ZFWA 1Y1WJ 4N9IA 3KEQA 1HOMA 1UFMA 4HF2A 1MKMA 3DKWA 1FIAA 3JSPA 3HL2A 2JK3A 2K9QA 3PSIA 4IJAA 3A52A 1E2XA 3CESA 4B3AA 2W00A 3BJ6A 1PJRA 3IWZA 2O7OA 1B1BA 5E79C 1Q1HA 2ZSIB 3HRTA 5A2QR 3VYRB 2HTSA 3IHUA 1MMDA 2K7LA 2C6YA 2KT0A 1W7PB 3JAMZ 2VUMJ 5GTHC 2DFIA 4CZCA 3CJTB 1ZR4A 4FE7A 5CVIA 1FMVA 1R5HA 5CJ9A 1HC8A 5EDNA 1YS6A 4HF0A 4EV0A 1O4XA 2IS2A 4RBOA 5BQTA 1TWCJ 1PYVA 4UUSA 4BBRJ 1EH7A 1G59A 4BEHA 3RZOJ 3JR9A 1LVAA 2V9PA 2VLAA 3KZZA 2HZTA 5LRSA 2OTJI 5LHIA 1R4MB 5ICFA 5M5YJ 1FC3A 2EB7A 1WJCA 3W3CA 1LJ9A 2WAEA 3CO6C 1FIPA 3P5JA 2Y0MA 1ZRDA 3MKYB 4AYBA 5KHDA 4LIVA 2P0WA 1X3WB
chains in the Genus database with same CATH topology
2YSRA 3CLOA 1FP1D 3H92A 2L01A 3ABUA 2EV6A 4K2EA 1HBXG 1T2KA 2IA0A 1QZZA 4YG2F 2XAQA 1USTA 3EDPA 3VFZA 4CGZA 4G6QA 1G3YA 5E17F 2CFXA 2P5LC 1QBJA 5K5RA 3FX3A 1AOYA 2VT2A 3Q9SA 1R22A 3H3UA 3D0SA 3JTHA 2BYVE 4CICA 3F22A 4EGYA 2RGVA 1ZN2A 3O3KA 1S29A 3E5QA 4RGXA 3IRQA 3M7GA 1H0MA 3KFWX 3GFMA 3BOQA 3VOEA 5FLXZ 3CTAA 4LLGF 1QO0D 3RKWA 4OMZA 2ACJA 3LSTA 4O6JA 1XGSA 5D4RA 1EH6A 1Z1DA 1F5TA 1ZGAA 3T5XA 3HOSA 2Z99A 3O6BB 2O61A 3J80Z 3E6CC 4I02A 2FRHA 3MEXA 4IVNA 1YQAA 5LRRA 1I1GA 4U0WA 1ZAOA 5DCMA 4OMYA 1O3TA 2G7UA 2PG4A 3KP4A 1DUXC 1D5VA 3QP5A 1HSJA 2O8XA 3WU0A 3KZYA 1P4AA 4KUMA 2EV0A 1UB9A 4PGHA 1NHAA 3J81Z 1OYYA 3V8JA 3GFIA 3RPUA 1W7PA 4FX0A 1WRJA 4G6DA 4EJTA 2BV6A 3NQOA 4BAYA 3N97A 1GXQA 3FXRA 3K9TA 4OIOF 4MQ9F 2CQKA 1HW1A 4DNCA 1PP7U 3E6MA 1REPC 2QLZA 3I4PA 5DD4A 1V4RA 1IN5A 1L0OC 3F8MA 4EM1A 2M1BA 3H3ZA 1MDMA 5CLSA 5BPDA 4ZZDA 2DPDA 4KN7X 2XUBA 1I5ZA 1KQ0A 2STTA 3KP6A 2ZMEB 3J80K 4RGRA 3RPQA 4A0XA 1XMKA 3IL2A 3DV8A 3COAC 4A0ZA 3KCCA 3I58A 3O2PE 2V9VA 1Z6RA 1R00A 2VE9A 3B02A 1BJAA 3MAJA 2Z3YA 1JE8A 4HYEA 1ON1A 1BC7C 4IRGA 4L9JA 1HSTA 3K0LA 2LKPA 3EETA 3V8LA 2UZKA 3LA7A 1DDNA 5DUKA 1SD6A 2DI3A 2KIFA 4WX9A 2CGPA 2EK5A 1I27A 3U9GA 2QWWA 5HLIA 1TW3A 2KJBA 3R4KA 2EFOA 1YYVA 2WC2A 4I0BA 4HF1A 2OAZA 5D5VB 1FPQA 2V79A 4XLNF 2MD5A 4ZH4F 2ZJ2A 2IA1A 3RJPA 3DEUA 4CYDA 1FYMA 2DU9A 5BMZA 4G7HF 5D5XB 5H20A 1TQMA 3KP3A 2K86A 4YIFA 3EQLF 1FBUA 2PN6A 2HWVA 4ENKA 2VBWA 5HDNA 2LSOA 4L9NA 1B9MA 4LLNA 2H6BA 2FF4A 2O3FA 4RS8A 4LD5A 4KIBA 3MCZA 4M9SA 1O7FA 1FBQA 2YU3A 2IPQX 2GWRA 2WWYA 2H09A 2OBPA 2RVCA 3M8EA 4EGZA 2FXAA 2P6TA 1V3FA 3L9FA 2MBFA 1RIOH 3RI4A 1B9NA 1R36A 1S7AA 5H6RA 4UNOA 4EQQA 3GF2A 1D8KA 1Z7UA 4IXAA 2R3SA 1EV7A 5LBQA 2GIVA 4GCVA 1S7OA 3FMSA 3C3WA 4KT5C 2MLGA 1J75A 3BPVA 3GLXA 1A04A 3ZQ7A 1LQ1A 1MDMB 1CGPA 1W5TA 4XSZF 2OA4A 5EEGA 3R60A 1FOKA 5DUIA 2R7FA 3BY6A 2Q8KA 2OU2A 4CO8A 3F8FA 1ZRCA 2L02A 2OQRA 1G4DA 1W4MA 3L09A 3EUHA 4LG0B 3NEUA 1S6LA 3BWGA 2COMA 1YO5C 2KRFA 4P9FA 4MHGA 1KU7A 1J9IA 4AIKA 2YR2A 2F5EA 1J7KA 2Y48A 1F9NA 1QZYA 2K4JA 4GXOA 4KNYA 1T6SA 1W5SA 1USSA 2JSCA 2A61A 5ERIA 3Q9VA 4M72A 1SAXA 3K1PA 3C1DA 3I59A 1S8NA 4TV7A 3F8BA 5DCFA 5HDGA 3GXOA 4RGSA 1ONVA 1XMAA 4LMYA 4XLPF 1D3YA 3BDDA 3E6DA 2O6GE 2HYFA 4ESJA 2DT5A 5D5UB 1K79A 3LQQA 1G3WA 4L5JA 2P5VA 4IPAA 1HQCA 4MTDA 1W7PD 3F23A 3F21A 3SXYA 2LDUA 1P4WA 2EFWA 4OINF 1BC8C 1GXPA 2F5DA 2V1XA 1JHHA 4R1HA 1ZYRF 3CUQB 1I1SA 2K4BA 2FSWA 5ILVA 4HDUA 1T39A 5LEJA 5LGTA 3ZN0A 2KIUA 2DK5A 1TW2A 3HUGA 1JHFA 4L18B 2IJLA 2UXNA 2PFBA 2BE5F 2QQAA 2G7HA 1R23A 2F5CA 2O03A 3IKTA 1HKSA 3T8RA 1U5TC 2FEZA 3I59B 4EJWA 3WE2A 1BIAA 3IKVA 5KVRA 4KDPA 2CWEA 1R1TA 3L7WA 2ZMEA 3DQVC 4EM2A 5K5OA 5D6FA 2V1DA 3GFJA 1BI2A 3FMRA 2NNYA 4WCGA 4KMFA 1SD5A 1HW5A 2A6HF 1RI7A 4D0PA 2GXBA 1ON2A 4ZYEA 3GZ5A 1XGNA 5F6FA 3TOBA 1YLFA 4BHCA 1Y0UA 2HKOA 1XSDA 3LAPA 2GA1A 3WODF 3DF8A 1ZHFA 2XROA 3U2RA 2L54A 3WGGA 3I64A 4PZJA 3CJNA 1FNNA 1UHWA 4XRFA 4HV5A 2MH2A 1U5TA 5FFZA 5BPIA 3FHZA 3MWMA 4UUVA 1EH8A 4H0EA 4A6DA 4Q48A 2E1NA 4N0BA 3HOTA 3BROA 1HXDA 5HS9A 3ZMVA 2XKPA 5DEQA 4ENNA 3G3ZA 2JT1A 2DTRA 2Z5UA 1SFXA 1KYWA 3KP5A 2LNBA 4Y13A 2Z9OA 4M6XA 4NB5A 2A5YB 3P9KA 3ZP5A 2QM3A 2XV4S 1ZLKA 1JGSA 1XB4A 4EMSA 3KP7A 4LJZF 1R58A 5FFXA 3ZN1A 1CF7B 4KMUX 1FZPB 3CUQA 3WU1B 3E3VA 4L5IA 3DFGA 5BOXA 2HYGD 4EJUA 4ON0A 1R7JA 4Q4ZF 4KA4A 3ML6A 1U78A 2M5WA 2HQRA 4RAYA 4BH9A 3HYIA 3RDIA 1Z91A 5ICCA 1LNWA 1T0FA 1OPCA 1BM9A 1PUEE 4M9XA 2VC1A 1X3UA 2IP2A 2YPRA 3HSRA 4I0AA 3QU3A 1LB2A 2A69F 3EYYA 1K78B 4BNCA 2GQQA 3JTGA 3DXJF 3TO9A 5L3CA 5FLXK 1O3RA 3HHGA 2XAJA 3DPLC 1B6AA 4HOBA 3WGHA 5CVRA 3QOPA 2CSOA 3ZMDA 5HDKA 5JFRA 4I09A 1J5YA 4N9HA 4U0YA 4RAZA 4P5OA 4XBFA 4I01A 3FM5A 1KU2A 1YW9A 1BI3A 2QUFA 2EFQA 2D45A 1STZA 4YIIA 2L4MA 4Y15A 5HVQC 4GO1A 4I7HA 3MZHA 4YFXF 1KQ9A 4Z2YA 4CZZA 1U5TB 4A5NA 2HOEA 2H94A 3ROUA 4LLLA 2V1UA 3Q5FA 3WG9A 5L3DA 1H9TA 5ED4A 3F8NA 2MLKA 2XASA 1Z05A 3GEZA 2K02A 2W25A 3KEOA 4IHTA 3QPTA 1J59A 2FE3A 5CVJA 2HGCA 2YX7A 3BP8A 1HKQA 3LWFA 2STWA 2Z33A 5J8FA 2DAOA 2QENA 2QQ9A 4UHTA 2DQLA 1ZG5A 5D4SA 3KLNA 1BI1A 3SZTA 5IT9K 3MFKA 1SFEA 2JPBA 4ENMA 5AIPA 4MEYF 3N4MA 1YG2A 1LDJA 3G73A 3I53A 4B8XA 3KLOA 1IN6A 1Z6TA 2RDPA 2VBXA 5D8KB 2M45A 2A07F 3WTXC 1IXSB 5JHUA 2E7XA 3ERED 4FT8A 3V8KA 2W84A 4IF4A 4LK0F 1B59A 3LA3A 4NQWA 1K6OA 3TOAA 4AD9A 2FA5A 4FHTA 4HX8A 4A6EA 5LGUA 1ZREA 4U7BA 4CHUA 2BBYA 2RV8A 3WE3A 2E7WA 1YTYA 4AIHA 4OIRF 3BJOA 1ZG1A 3W6JB 3R0JA 2XVCA 3SZPA 1IXRC 3FZVA 1ZGJA 3HIFA 4I2OA 5ILSA 4CXFA 3DP7A 5LLQA 1XGMA 2W24A 3CUOA 3V7CA 1G3TA 1U2WA 4PGGA 4QLCU 2KKOA 3SQNA 1XGOA 4GYGA 1GVJA 3LAJA 1J0RA 4L9VA 1TLHB 4WXDA 1U3EM 4FX4A 5L3GA 3WTTC 1H9GA 6PAXA 2BEOA 1D8JA 3RTRA 2Q0OA 2XAGA 3ECHA 4KN4X 2DBBA 2DLLA 2K27A 5HOOA 5HLHA 1WQ2A 4S05A 4LB6B 4HW0A 3I54A 2VE8A 4JQFA 4UVBA 2ZKZA 1WKMA 2JZYA 2ELHA 2FBHA 3F6OA 3E97A 3RYPA 3MZYA 2QVOA 1OR7A 2PEXA 3VODA 1TQIA 1G3SA 2FBKA 2UWMA 2ZCWA 3WTSC 2D1HA 2G9WA 1KA8A 2NS0A 1QGPA 3GUDA 3CO7C 1Z9CA 2GXGA 2UXXA 1FBSA 3SHFA 5E8IA 3R6SA 1RNLA 4PCQA 4HLYA 5ILUA 2VONA 3RIRA 1L3LA 1S3JA 4HZFA 5E8GA 1ZARA 4QWQA 1O3SA 4A0YA 2EWNA 4O3MA 4HLXA 3T0YA 1XDSA 5TJJA 2GA2A 1UCRA 3ELKA 4UVCA 3LFKA 3D5LA 1B4AA 2XGXA 4R79A 1BIBA 2FOKA 2P4WA 1RUNA 1IUYA 4HBLA 5BS6A 2GZWA 4WF2A 2ISZA 3FF5A 4A5MA 3C18A 4GGGA 1MD0A 5F1RA 3P9CA 4KIGA 4KIFA 3AAFA 2P7CB 4BQAA 5HS8A 4M74A 5D6EA 4LK1F 3QAHA 4KFCA 3JAMK 1G6NA 4XSXF 2H27A 4YFKF 4P9UA 3T1BA 1SMTA 2VC0A 1MZBA 1LDKB 3T8TA 3QPHA 4BHPA 5D8LB 1MJ9A 4ENJA 3WTWC 2L3DA 2NYXA 2P5KA 5ICEA 1TBXA 2KIMA 1IRFA 1FYLA 4R8HA 2HR3A 4Y17A 2VT3A 2QQBA 1KU9A 4ESBA 2HDCA 2RC4A 4LB5A 1MJAA 3J7AO 1FX7A 5AONA 3BJAA 3P7NA 2PQ8A 4G9YA 3OV8A 3HRMA 2RQPA 2HFHA 1XN7A 2DO7A 4L9TA 3B73A 2NAZA 3M1EA 4ESFA 1YS7A 3ISPA 4BHBA 1IW7F 4LFUA 2XKOA 4KICA 1AWCA 2R7DA 3KETA 4GYIA 1TNTA 3TGNA 2E1CA 4AIJA 2Q2EA 1SMYF 5FD6A 2GAUA 1SD7A 2VODA 2EFNA 1BBYA 1ODDA 2DK8A 5KK1A 4ZZLA 2IVMA 2TDXA 4HX4A 3E5XA 3WTUC 4HAMA 2RN7A 2YX4A 2A6EF 4PDKA 1WWXA 1YW8A 1E17A 1XCBA 5E1ZB 1DPUA 3IRRA 5A2QZ 3ZMSA 2MC3A 2ISYA 1QPMA 2OZUA 1UHMA 3WTYC 4OIPF 1XDUA 3GX4X 2XIGA 3P9IA 4G8XA 4RB1A 2QZ8A 4G7OF 2PBIA 4HA8A 3RKYA 2D2WA 4F7ZA 4ZYGA 2CG4A 4RB3C 1ZLJA 4BYYA 3E6BA 1XD7A 2VXZA 1F4KA 2AXLA 1P4XA 3BPXA 2VOPA 3RKXA 3GWZA 4EJVA 4Q5SF 4RGUA 4P55A 4E70A 4OU0A 1FWZA 3C7JA 5E18F 2F5FA 2WV0A 3HSEA 2ZNZA 2VOOA 3DPTA 3GYHX 2XHKA 3L2CA 3PQJA 1MJBA 1IN8A 2WTEA 2FBIA 3FM3A 4EM0B 5L3BA 3GZ6A 3ZPLA 1U6GA 1LEAA 3W6KB 5JVTA 3S2WA 1XSXA 1K7AA 2A3SA 3ZMUA 5E20A 3JW4A 5LEKA 2X4HA 2W57A 1MGTA 3EYIA 1FYKA 1OYWA 5CYVA 4Q47A 4MGRA 4ASNA 4M9ZA 3HSFA 2QBYB 4HDVA 1LDDA 2JRTA 3TKYA 2EA4A 2HQNA 2ZO4A 1CF7A 3TDZC 1KU3A 1FP2A 5K5QA 5FGMA 2HEOA 4AVPA 3U1DA 2J5OA 4MEXF 2IA2A 2ESHA 2QYOA 5K1YA 1WI9A 4ZYDA 1F1ZA 1BN5A 3GVAA 3FMQA 2MH9A 4UV9A 3NRVA 5DDGA 3I0TA 2M8EA 3GFLA 5E1XA 1JXSA 2VBYA 2F2EA 2FMYA 4B09A 3HTUA 4OIQF 4WXCA 5E1WA 3WTVC 4M71A 3TDUC 4G94A 1TNSA 4RB0A 3QP6A 1P6RA 5J8CA 4WWCA 3MQ0A 4YFNF 3TO7A 2XAHA 5L3FA 3I71A 3K1MA 4I98B 4HX7A 1DP7P 1YFHA 2MA3A 3K2ZA 1ZG3A 1XCVA 3M9AA 5DD8A 3REOA 3RYRA 4U7DA 4S04A 1KQ8A 5TRDA 1R5GA 5ICGA 5J6XA 2RNJA 3BZ6A 2VN2A 3GW2A 4M6YA 3HHHA 2P7VB 5AIQA 2JPCA 3V7RA 1P92A 1IN4A 3QU6A 3HTSB 2M30A 2PJPA 2CYYA 4ZYHA 4IHSA 2LF8A 3K1NA 3K69A 2PI0A 2M87A 4MQVA 1PDNC 2RKHA 3ZMZA 5CVVA 3ZMTA 2ADUA 2PLYA 4UV8A 2IRFG 2W85A 2EA2A 1P2FA 4WK8F 1BI0A 2ZNYA 3WGIA 4HQEA 3OOPA 2HTJA 3V7SA 1RUOA 2QBYA 1I6XA 3HRUA 1R1UA 1FSEA 2CO5A 5EEHA 5LHGA 4EVIA 3F72A 3FXQA 3ECOA 4LGWA 2IW5A 3FWEA 3JSOA 2NNNA 1R1VA 2L4AA 3L00A 1J2XA 1IAWA 2O0YA 3VB2A 5DYMA 2X0LA 2DW4A 1KYZA 3ABTA 5FB2A 4IRHA 1FT9A 5CVUA 4RB2C 3F6VA 5IT9Z 4JBAA 1IRGA 2FNAA 2LF7A 2P6SA 3QRFF 2Y75A 5F64A 3I5UA 3R0AA 2AS5F 1FY7A 1SD4A 4P96A 1QQIA 5IT3A 1IF1A 2DQRA 1O57A 4HV6A 4U88A 2HKXA 4G7ZF 1U8RA 2FQ3A 2EV5A 2DPUA 2H6CA 3ULQB 2XAFA 1ULYA 4M73A 5LGNA 1TTYA 4MTEA 4WXHA 2J5PA 1BOAA 2EFPA 3CUQC 4UVAA 2HS5A 3V4GA 1QNTA 1VTNC 4BXUA 5H6QA 2NRAC 2JTVA 5D5WB 5LHHA 3LQRA 2VBZA 2ZBKA 1O7LA 3KE2A 4O5VA 2KJCA 3R61A 4ETSA 3HRSA 4JK1X 2IT0A 4A2UA 1HKTA 2PMUA 1RZ4A 1ZRFA 2BGCA 2ESNA 5HS7A 3FXUA 2ETHA 4L0ZB 1O3QA 3CDHA 1TQPA 4CDGA 1OKRA 2FNPA 4KYWA 3F8CA 1FSHA 1FLIA 4L0YB 4EJOA 1HW2A 2D1VA 4AWXB 5HLGA 1WSUA 3J81K 1GHCA 1YW7A 4U0VA 4MNUA 4DQ2A 1LEBA 3VEPA 5DV5A 4NHJA 3TQNA 4LG0A 3PFIA 2CW0F 3GO5A 1T98A 3F3XA 2PMHA 3M8FA 2OZ6A 3LA2A 4A12A 3IC7A 4IRIA 3WTZA 3KP2A 1SFUA 1YIOA 2B0LA 2FU4A 2P8TA 1OMIA 2A68F 4UXNA 4HQMA 1DPRA 1T38A 2FMLA 2OQGA 5FD5A 2OD5A 3PQKA 2ZXJA 1K78A 4OOIA 1ZH5A 1IN7A 3SFZA 5FO5A 3TO6A 5L3EA 3IWFA 5A2QK 1KGSA 5JI6A 2V6CA 1IZ1A 1XSVA 5DCMB 1C0WA 3E5UA 1IXCA 2XRNA 1OYIA 2EJRA 1PP8F 2ZFWA 4N9IA 3KEQA 1UFMA 4HF2A 1MKMA 3DKWA 3JSPA 4IJAA 1E2XA 3BJ6A 3IWZA 1B1BA 1Q1HA 3HRTA 2HTSA 3IHUA 2C6YA 2K7LA 1W7PB 3JAMZ 2DFIA 5CVIA 1R5HA 5CJ9A 1YS6A 4HF0A 4EV0A 5BQTA 1EH7A 1LVAA 3KZZA 2HZTA 5LRSA 5LHIA 5ICFA 1FC3A 2EB7A 1LJ9A 3CO6C 2Y0MA 1ZRDA 5JR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSR A;  3CLO A;  1FP1 D;  3H92 A;  2L01 A;  3ABU A;  2EV6 A;  4K2E A;  1HBX G;  1T2K A;  2IA0 A;  1QZZ A;  4YG2 F;  2XAQ A;  1UST A;  3EDP A;  3VFZ A;  4CGZ A;  4G6Q A;  1G3Y A;  5E17 F;  2CFX A;  2P5L C;  1QBJ A;  5K5R A;  3FX3 A;  1AOY A;  2VT2 A;  3Q9S A;  1R22 A;  3H3U A;  3D0S A;  3JTH A;  2BYV E;  4CIC A;  3F22 A;  4EGY A;  2RGV A;  1ZN2 A;  3O3K A;  1S29 A;  3E5Q A;  4RGX A;  3IRQ A;  3M7G A;  1H0M A;  3KFW X;  3GFM A;  3BOQ A;  3VOE A;  5FLX Z;  3CTA A;  4LLG F;  1QO0 D;  3RKW A;  4OMZ A;  2ACJ A;  3LST A;  4O6J A;  1XGS A;  5D4R A;  1EH6 A;  1Z1D A;  1F5T A;  1ZGA A;  3T5X A;  3HOS A;  2Z99 A;  3O6B B;  2O61 A;  3J80 Z;  3E6C C;  4I02 A;  2FRH A;  3MEX A;  4IVN A;  1YQA A;  5LRR A;  1I1G A;  4U0W A;  1ZAO A;  5DCM A;  4OMY A;  1O3T A;  2G7U A;  2PG4 A;  3KP4 A;  1DUX C;  1D5V A;  3QP5 A;  1HSJ A;  2O8X A;  3WU0 A;  3KZY A;  1P4A A;  4KUM A;  2EV0 A;  1UB9 A;  4PGH A;  1NHA A;  3J81 Z;  1OYY A;  3V8J A;  3GFI A;  3RPU A;  1W7P A;  4FX0 A;  1WRJ A;  4G6D A;  4EJT A;  2BV6 A;  3NQO A;  4BAY A;  3N97 A;  1GXQ A;  3FXR A;  3K9T A;  4OIO F;  4MQ9 F;  2CQK A;  1HW1 A;  4DNC A;  1PP7 U;  3E6M A;  1REP C;  2QLZ A;  3I4P A;  5DD4 A;  1V4R A;  1IN5 A;  1L0O C;  3F8M A;  4EM1 A;  2M1B A;  3H3Z A;  1MDM A;  5CLS A;  5BPD A;  4ZZD A;  2DPD A;  4KN7 X;  2XUB A;  1I5Z A;  1KQ0 A;  2STT A;  3KP6 A;  2ZME B;  3J80 K;  4RGR A;  3RPQ A;  4A0X A;  1XMK A;  3IL2 A;  3DV8 A;  3COA C;  4A0Z A;  3KCC A;  3I58 A;  3O2P E;  2V9V A;  1Z6R A;  1R00 A;  2VE9 A;  3B02 A;  1BJA A;  3MAJ A;  2Z3Y A;  1JE8 A;  4HYE A;  1ON1 A;  1BC7 C;  4IRG A;  4L9J A;  1HST A;  3K0L A;  2LKP A;  3EET A;  3V8L A;  2UZK A;  3LA7 A;  1DDN A;  5DUK A;  1SD6 A;  2DI3 A;  2KIF A;  4WX9 A;  2CGP A;  2EK5 A;  1I27 A;  3U9G A;  2QWW A;  5HLI A;  1TW3 A;  2KJB A;  3R4K A;  2EFO A;  1YYV A;  2WC2 A;  4I0B A;  4HF1 A;  2OAZ A;  5D5V B;  1FPQ A;  2V79 A;  4XLN F;  2MD5 A;  4ZH4 F;  2ZJ2 A;  2IA1 A;  3RJP A;  3DEU A;  4CYD A;  1FYM A;  2DU9 A;  5BMZ A;  4G7H F;  5D5X B;  5H20 A;  1TQM A;  3KP3 A;  2K86 A;  4YIF A;  3EQL F;  1FBU A;  2PN6 A;  2HWV A;  4ENK A;  2VBW A;  5HDN A;  2LSO A;  4L9N A;  1B9M A;  4LLN A;  2H6B A;  2FF4 A;  2O3F A;  4RS8 A;  4LD5 A;  4KIB A;  3MCZ A;  4M9S A;  1O7F A;  1FBQ A;  2YU3 A;  2IPQ X;  2GWR A;  2WWY A;  2H09 A;  2OBP A;  2RVC A;  3M8E A;  4EGZ A;  2FXA A;  2P6T A;  1V3F A;  3L9F A;  2MBF A;  1RIO H;  3RI4 A;  1B9N A;  1R36 A;  1S7A A;  5H6R A;  4UNO A;  4EQQ A;  3GF2 A;  1D8K A;  1Z7U A;  4IXA A;  2R3S A;  1EV7 A;  5LBQ A;  2GIV A;  4GCV A;  1S7O A;  3FMS A;  3C3W A;  4KT5 C;  2MLG A;  1J75 A;  3BPV A;  3GLX A;  1A04 A;  3ZQ7 A;  1LQ1 A;  1MDM B;  1CGP A;  1W5T A;  4XSZ F;  2OA4 A;  5EEG A;  3R60 A;  1FOK A;  5DUI A;  2R7F A;  3BY6 A;  2Q8K A;  2OU2 A;  4CO8 A;  3F8F A;  1ZRC A;  2L02 A;  2OQR A;  1G4D A;  1W4M A;  3L09 A;  3EUH A;  4LG0 B;  3NEU A;  1S6L A;  3BWG A;  2COM A;  1YO5 C;  2KRF A;  4P9F A;  4MHG A;  1KU7 A;  1J9I A;  4AIK A;  2YR2 A;  2F5E A;  1J7K A;  2Y48 A;  1F9N A;  1QZY A;  2K4J A;  4GXO A;  4KNY A;  1T6S A;  1W5S A;  1USS A;  2JSC A;  2A61 A;  5ERI A;  3Q9V A;  4M72 A;  1SAX A;  3K1P A;  3C1D A;  3I59 A;  1S8N A;  4TV7 A;  3F8B A;  5DCF A;  5HDG A;  3GXO A;  4RGS A;  1ONV A;  1XMA A;  4LMY A;  4XLP F;  1D3Y A;  3BDD A;  3E6D A;  2O6G E;  2HYF A;  4ESJ A;  2DT5 A;  5D5U B;  1K79 A;  3LQQ A;  1G3W A;  4L5J A;  2P5V A;  4IPA A;  1HQC A;  4MTD A;  1W7P D;  3F23 A;  3F21 A;  3SXY A;  2LDU A;  1P4W A;  2EFW A;  4OIN F;  1BC8 C;  1GXP A;  2F5D A;  2V1X A;  1JHH A;  4R1H A;  1ZYR F;  3CUQ B;  1I1S A;  2K4B A;  2FSW A;  5ILV A;  4HDU A;  1T39 A;  5LEJ A;  5LGT A;  3ZN0 A;  2KIU A;  2DK5 A;  1TW2 A;  3HUG A;  1JHF A;  4L18 B;  2IJL A;  2UXN A;  2PFB A;  2BE5 F;  2QQA A;  2G7H A;  1R23 A;  2F5C A;  2O03 A;  3IKT A;  1HKS A;  3T8R A;  1U5T C;  2FEZ A;  3I59 B;  4EJW A;  3WE2 A;  1BIA A;  3IKV A;  5KVR A;  4KDP A;  2CWE A;  1R1T A;  3L7W A;  2ZME A;  3DQV C;  4EM2 A;  5K5O A;  5D6F A;  2V1D A;  3GFJ A;  1BI2 A;  3FMR A;  2NNY A;  4WCG A;  4KMF A;  1SD5 A;  1HW5 A;  2A6H F;  1RI7 A;  4D0P A;  2GXB A;  1ON2 A;  4ZYE A;  3GZ5 A;  1XGN A;  5F6F A;  3TOB A;  1YLF A;  4BHC A;  1Y0U A;  2HKO A;  1XSD A;  3LAP A;  2GA1 A;  3WOD F;  3DF8 A;  1ZHF A;  2XRO A;  3U2R A;  2L54 A;  3WGG A;  3I64 A;  4PZJ A;  3CJN A;  1FNN A;  1UHW A;  4XRF A;  4HV5 A;  2MH2 A;  1U5T A;  5FFZ A;  5BPI A;  3FHZ A;  3MWM A;  4UUV A;  1EH8 A;  4H0E A;  4A6D A;  4Q48 A;  2E1N A;  4N0B A;  3HOT A;  3BRO A;  1HXD A;  5HS9 A;  3ZMV A;  2XKP A;  5DEQ A;  4ENN A;  3G3Z A;  2JT1 A;  2DTR A;  2Z5U A;  1SFX A;  1KYW A;  3KP5 A;  2LNB A;  4Y13 A;  2Z9O A;  4M6X A;  4NB5 A;  2A5Y B;  3P9K A;  3ZP5 A;  2QM3 A;  2XV4 S;  1ZLK A;  1JGS A;  1XB4 A;  4EMS A;  3KP7 A;  4LJZ F;  1R58 A;  5FFX A;  3ZN1 A;  1CF7 B;  4KMU X;  1FZP B;  3CUQ A;  3WU1 B;  3E3V A;  4L5I A;  3DFG A;  5BOX A;  2HYG D;  4EJU A;  4ON0 A;  1R7J A;  4Q4Z F;  4KA4 A;  3ML6 A;  1U78 A;  2M5W A;  2HQR A;  4RAY A;  4BH9 A;  3HYI A;  3RDI A;  1Z91 A;  5ICC A;  1LNW A;  1T0F A;  1OPC A;  1BM9 A;  1PUE E;  4M9X A;  2VC1 A;  1X3U A;  2IP2 A;  2YPR A;  3HSR A;  4I0A A;  3QU3 A;  1LB2 A;  2A69 F;  3EYY A;  1K78 B;  4BNC A;  2GQQ A;  3JTG A;  3DXJ F;  3TO9 A;  5L3C A;  5FLX K;  1O3R A;  3HHG A;  2XAJ A;  3DPL C;  1B6A A;  4HOB A;  3WGH A;  5CVR A;  3QOP A;  2CSO A;  3ZMD A;  5HDK A;  5JFR A;  4I09 A;  1J5Y A;  4N9H A;  4U0Y A;  4RAZ A;  4P5O A;  4XBF A;  4I01 A;  3FM5 A;  1KU2 A;  1YW9 A;  1BI3 A;  2QUF A;  2EFQ A;  2D45 A;  1STZ A;  4YII A;  2L4M A;  4Y15 A;  5HVQ C;  4GO1 A;  4I7H A;  3MZH A;  4YFX F;  1KQ9 A;  4Z2Y A;  4CZZ A;  1U5T B;  4A5N A;  2HOE A;  2H94 A;  3ROU A;  4LLL A;  2V1U A;  3Q5F A;  3WG9 A;  5L3D A;  1H9T A;  5ED4 A;  3F8N A;  2MLK A;  2XAS A;  1Z05 A;  3GEZ A;  2K02 A;  2W25 A;  3KEO A;  4IHT A;  3QPT A;  1J59 A;  2FE3 A;  5CVJ A;  2HGC A;  2YX7 A;  3BP8 A;  1HKQ A;  3LWF A;  2STW A;  2Z33 A;  5J8F A;  2DAO A;  2QEN A;  2QQ9 A;  4UHT A;  2DQL A;  1ZG5 A;  5D4S A;  3KLN A;  1BI1 A;  3SZT A;  5IT9 K;  3MFK A;  1SFE A;  2JPB A;  4ENM A;  5AIP A;  4MEY F;  3N4M A;  1YG2 A;  1LDJ A;  3G73 A;  3I53 A;  4B8X A;  3KLO A;  1IN6 A;  1Z6T A;  2RDP A;  2VBX A;  5D8K B;  2M45 A;  2A07 F;  3WTX C;  1IXS B;  5JHU A;  2E7X A;  3ERE D;  4FT8 A;  3V8K A;  2W84 A;  4IF4 A;  4LK0 F;  1B59 A;  3LA3 A;  4NQW A;  1K6O A;  3TOA A;  4AD9 A;  2FA5 A;  4FHT A;  4HX8 A;  4A6E A;  5LGU A;  1ZRE A;  4U7B A;  4CHU A;  2BBY A;  2RV8 A;  3WE3 A;  2E7W A;  1YTY A;  4AIH A;  4OIR F;  3BJO A;  1ZG1 A;  3W6J B;  3R0J A;  2XVC A;  3SZP A;  1IXR C;  3FZV A;  1ZGJ A;  3HIF A;  4I2O A;  5ILS A;  4CXF A;  3DP7 A;  5LLQ A;  1XGM A;  2W24 A;  3CUO A;  3V7C A;  1G3T A;  1U2W A;  4PGG A;  4QLC U;  2KKO A;  3SQN A;  1XGO A;  4GYG A;  1GVJ A;  3LAJ A;  1J0R A;  4L9V A;  1TLH B;  4WXD A;  1U3E M;  4FX4 A;  5L3G A;  3WTT C;  1H9G A;  6PAX A;  2BEO A;  1D8J A;  3RTR A;  2Q0O A;  2XAG A;  3ECH A;  4KN4 X;  2DBB A;  2DLL A;  2K27 A;  5HOO A;  5HLH A;  1WQ2 A;  4S05 A;  4LB6 B;  4HW0 A;  3I54 A;  2VE8 A;  4JQF A;  4UVB A;  2ZKZ A;  1WKM A;  2JZY A;  2ELH A;  2FBH A;  3F6O A;  3E97 A;  3RYP A;  3MZY A;  2QVO A;  1OR7 A;  2PEX A;  3VOD A;  1TQI A;  1G3S A;  2FBK A;  2UWM A;  2ZCW A;  3WTS C;  2D1H A;  2G9W A;  1KA8 A;  2NS0 A;  1QGP A;  3GUD A;  3CO7 C;  1Z9C A;  2GXG A;  2UXX A;  1FBS A;  3SHF A;  5E8I A;  3R6S A;  1RNL A;  4PCQ A;  4HLY A;  5ILU A;  2VON A;  3RIR A;  1L3L A;  1S3J A;  4HZF A;  5E8G A;  1ZAR A;  4QWQ A;  1O3S A;  4A0Y A;  2EWN A;  4O3M A;  4HLX A;  3T0Y A;  1XDS A;  5TJJ A;  2GA2 A;  1UCR A;  3ELK A;  4UVC A;  3LFK A;  3D5L A;  1B4A A;  2XGX A;  4R79 A;  1BIB A;  2FOK A;  2P4W A;  1RUN A;  1IUY A;  4HBL A;  5BS6 A;  2GZW A;  4WF2 A;  2ISZ A;  3FF5 A;  4A5M A;  3C18 A;  4GGG A;  1MD0 A;  5F1R A;  3P9C A;  4KIG A;  4KIF A;  3AAF A;  2P7C B;  4BQA A;  5HS8 A;  4M74 A;  5D6E A;  4LK1 F;  3QAH A;  4KFC A;  3JAM K;  1G6N A;  4XSX F;  2H27 A;  4YFK F;  4P9U A;  3T1B A;  1SMT A;  2VC0 A;  1MZB A;  1LDK B;  3T8T A;  3QPH A;  4BHP A;  5D8L B;  1MJ9 A;  4ENJ A;  3WTW C;  2L3D A;  2NYX A;  2P5K A;  5ICE A;  1TBX A;  2KIM A;  1IRF A;  1FYL A;  4R8H A;  2HR3 A;  4Y17 A;  2VT3 A;  2QQB A;  1KU9 A;  4ESB A;  2HDC A;  2RC4 A;  4LB5 A;  1MJA A;  3J7A O;  1FX7 A;  5AON A;  3BJA A;  3P7N A;  2PQ8 A;  4G9Y A;  3OV8 A;  3HRM A;  2RQP A;  2HFH A;  1XN7 A;  2DO7 A;  4L9T A;  3B73 A;  2NAZ A;  3M1E A;  4ESF A;  1YS7 A;  3ISP A;  4BHB A;  1IW7 F;  4LFU A;  2XKO A;  4KIC A;  1AWC A;  2R7D A;  3KET A;  4GYI A;  1TNT A;  3TGN A;  2E1C A;  4AIJ A;  2Q2E A;  1SMY F;  5FD6 A;  2GAU A;  1SD7 A;  2VOD A;  2EFN A;  1BBY A;  1ODD A;  2DK8 A;  5KK1 A;  4ZZL A;  2IVM A;  2TDX A;  4HX4 A;  3E5X A;  3WTU C;  4HAM A;  2RN7 A;  2YX4 A;  2A6E F;  4PDK A;  1WWX A;  1YW8 A;  1E17 A;  1XCB A;  5E1Z B;  1DPU A;  3IRR A;  5A2Q Z;  3ZMS A;  2MC3 A;  2ISY A;  1QPM A;  2OZU A;  1UHM A;  3WTY C;  4OIP F;  1XDU A;  3GX4 X;  2XIG A;  3P9I A;  4G8X A;  4RB1 A;  2QZ8 A;  4G7O F;  2PBI A;  4HA8 A;  3RKY A;  2D2W A;  4F7Z A;  4ZYG A;  2CG4 A;  4RB3 C;  1ZLJ A;  4BYY A;  3E6B A;  1XD7 A;  2VXZ A;  1F4K A;  2AXL A;  1P4X A;  3BPX A;  2VOP A;  3RKX A;  3GWZ A;  4EJV A;  4Q5S F;  4RGU A;  4P55 A;  4E70 A;  4OU0 A;  1FWZ A;  3C7J A;  5E18 F;  2F5F A;  2WV0 A;  3HSE A;  2ZNZ A;  2VOO A;  3DPT A;  3GYH X;  2XHK A;  3L2C A;  3PQJ A;  1MJB A;  1IN8 A;  2WTE A;  2FBI A;  3FM3 A;  4EM0 B;  5L3B A;  3GZ6 A;  3ZPL A;  1U6G A;  1LEA A;  3W6K B;  5JVT A;  3S2W A;  1XSX A;  1K7A A;  2A3S A;  3ZMU A;  5E20 A;  3JW4 A;  5LEK A;  2X4H A;  2W57 A;  1MGT A;  3EYI A;  1FYK A;  1OYW A;  5CYV A;  4Q47 A;  4MGR A;  4ASN A;  4M9Z A;  3HSF A;  2QBY B;  4HDV A;  1LDD A;  2JRT A;  3TKY A;  2EA4 A;  2HQN A;  2ZO4 A;  1CF7 A;  3TDZ C;  1KU3 A;  1FP2 A;  5K5Q A;  5FGM A;  2HEO A;  4AVP A;  3U1D A;  2J5O A;  4MEX F;  2IA2 A;  2ESH A;  2QYO A;  5K1Y A;  1WI9 A;  4ZYD A;  1F1Z A;  1BN5 A;  3GVA A;  3FMQ A;  2MH9 A;  4UV9 A;  3NRV A;  5DDG A;  3I0T A;  2M8E A;  3GFL A;  5E1X A;  1JXS A;  2VBY A;  2F2E A;  2FMY A;  4B09 A;  3HTU A;  4OIQ F;  4WXC A;  5E1W A;  3WTV C;  4M71 A;  3TDU C;  4G94 A;  1TNS A;  4RB0 A;  3QP6 A;  1P6R A;  5J8C A;  4WWC A;  3MQ0 A;  4YFN F;  3TO7 A;  2XAH A;  5L3F A;  3I71 A;  3K1M A;  4I98 B;  4HX7 A;  1DP7 P;  1YFH A;  2MA3 A;  3K2Z A;  1ZG3 A;  1XCV A;  3M9A A;  5DD8 A;  3REO A;  3RYR A;  4U7D A;  4S04 A;  1KQ8 A;  5TRD A;  1R5G A;  5ICG A;  5J6X A;  2RNJ A;  3BZ6 A;  2VN2 A;  3GW2 A;  4M6Y A;  3HHH A;  2P7V B;  5AIQ A;  2JPC A;  3V7R A;  1P92 A;  1IN4 A;  3QU6 A;  3HTS B;  2M30 A;  2PJP A;  2CYY A;  4ZYH A;  4IHS A;  2LF8 A;  3K1N A;  3K69 A;  2PI0 A;  2M87 A;  4MQV A;  1PDN C;  2RKH A;  3ZMZ A;  5CVV A;  3ZMT A;  2ADU A;  2PLY A;  4UV8 A;  2IRF G;  2W85 A;  2EA2 A;  1P2F A;  4WK8 F;  1BI0 A;  2ZNY A;  3WGI A;  4HQE A;  3OOP A;  2HTJ A;  3V7S A;  1RUO A;  2QBY A;  1I6X A;  3HRU A;  1R1U A;  1FSE A;  2CO5 A;  5EEH A;  5LHG A;  4EVI A;  3F72 A;  3FXQ A;  3ECO A;  4LGW A;  2IW5 A;  3FWE A;  3JSO A;  2NNN A;  1R1V A;  2L4A A;  3L00 A;  1J2X A;  1IAW A;  2O0Y A;  3VB2 A;  5DYM A;  2X0L A;  2DW4 A;  1KYZ A;  3ABT A;  5FB2 A;  4IRH A;  1FT9 A;  5CVU A;  4RB2 C;  3F6V A;  5IT9 Z;  4JBA A;  1IRG A;  2FNA A;  2LF7 A;  2P6S A;  3QRF F;  2Y75 A;  5F64 A;  3I5U A;  3R0A A;  2AS5 F;  1FY7 A;  1SD4 A;  4P96 A;  1QQI A;  5IT3 A;  1IF1 A;  2DQR A;  1O57 A;  4HV6 A;  4U88 A;  2HKX A;  4G7Z F;  1U8R A;  2FQ3 A;  2EV5 A;  2DPU A;  2H6C A;  3ULQ B;  2XAF A;  1ULY A;  4M73 A;  5LGN A;  1TTY A;  4MTE A;  4WXH A;  2J5P A;  1BOA A;  2EFP A;  3CUQ C;  4UVA A;  2HS5 A;  3V4G A;  1QNT A;  1VTN C;  4BXU A;  5H6Q A;  2NRA C;  2JTV A;  5D5W B;  5LHH A;  3LQR A;  2VBZ A;  2ZBK A;  1O7L A;  3KE2 A;  4O5V A;  2KJC A;  3R61 A;  4ETS A;  3HRS A;  4JK1 X;  2IT0 A;  4A2U A;  1HKT A;  2PMU A;  1RZ4 A;  1ZRF A;  2BGC A;  2ESN A;  5HS7 A;  3FXU A;  2ETH A;  4L0Z B;  1O3Q A;  3CDH A;  1TQP A;  4CDG A;  1OKR A;  2FNP A;  4KYW A;  3F8C A;  1FSH A;  1FLI A;  4L0Y B;  4EJO A;  1HW2 A;  2D1V A;  4AWX B;  5HLG A;  1WSU A;  3J81 K;  1GHC A;  1YW7 A;  4U0V A;  4MNU A;  4DQ2 A;  1LEB A;  3VEP A;  5DV5 A;  4NHJ A;  3TQN A;  4LG0 A;  3PFI A;  2CW0 F;  3GO5 A;  1T98 A;  3F3X A;  2PMH A;  3M8F A;  2OZ6 A;  3LA2 A;  4A12 A;  3IC7 A;  4IRI A;  3WTZ A;  3KP2 A;  1SFU A;  1YIO A;  2B0L A;  2FU4 A;  2P8T A;  1OMI A;  2A68 F;  4UXN A;  4HQM A;  1DPR A;  1T38 A;  2FML A;  2OQG A;  5FD5 A;  2OD5 A;  3PQK A;  2ZXJ A;  1K78 A;  4OOI A;  1ZH5 A;  1IN7 A;  3SFZ A;  5FO5 A;  3TO6 A;  5L3E A;  3IWF A;  5A2Q K;  1KGS A;  5JI6 A;  2V6C A;  1IZ1 A;  1XSV A;  5DCM B;  1C0W A;  3E5U A;  1IXC A;  2XRN A;  1OYI A;  2EJR A;  1PP8 F;  2ZFW A;  4N9I A;  3KEQ A;  1UFM A;  4HF2 A;  1MKM A;  3DKW A;  3JSP A;  4IJA A;  1E2X A;  3BJ6 A;  3IWZ A;  1B1B A;  1Q1H A;  3HRT A;  2HTS A;  3IHU A;  2C6Y A;  2K7L A;  1W7P B;  3JAM Z;  2DFI A;  5CVI A;  1R5H A;  5CJ9 A;  1YS6 A;  4HF0 A;  4EV0 A;  5BQT A;  1EH7 A;  1LVA A;  3KZZ A;  2HZT A;  5LRS A;  5LHI A;  5ICF A;  1FC3 A;  2EB7 A;  1LJ9 A;  3CO6 C;  2Y0M A;  1ZRD A;  5JR3 A; 
#chains in the Genus database with same CATH topology
 5E3O A;  3AG2 H;  2YSR A;  4LIU A;  3W2A A;  2DMN A;  3CLO A;  5B5E C;  1FP1 D;  2KMU A;  3CC7 I;  3GTO J;  3H92 A;  2L01 A;  3ABU A;  2EV6 A;  4K2E A;  1HBX G;  1T2K A;  3DBL B;  2IA0 A;  1QZZ A;  4UB8 C;  3L1P A;  3IP4 B;  4NDL A;  4YG2 F;  1R6R A;  4X1E A;  3MKL A;  2XAQ A;  1UST A;  3EDP A;  3VFZ A;  4CGZ A;  4G6Q A;  1G3Y A;  2EZH A;  3A01 A;  3FKJ A;  5IP9 J;  1HA8 A;  5E17 F;  2CFX A;  3BTC A;  3O8H A;  3V42 A;  1Y1V J;  2LY1 A;  3I56 I;  2P5L C;  1QBJ A;  5K5R A;  3FX3 A;  1AOY A;  2VT2 A;  3ZQH A;  5IOY A;  3Q9S A;  1R22 A;  3A01 B;  3H3U A;  3D0S A;  1ZKG A;  3JTH A;  4P1W A;  2BYV E;  4CIC A;  4F3Q A;  3F22 A;  4EGY A;  2RGV A;  1ZN2 A;  3O3K A;  1S29 A;  4BQN A;  3E5Q A;  4RGX A;  1FOW A;  3IRQ A;  3M7G A;  1X2N A;  1YOV B;  2X1D A;  1H0M A;  3KFW X;  3BR5 A;  3H0D A;  2L7K A;  3BR6 A;  5JR3 A;  3GFM A;  3CCE I;  2E71 A;  1E3P A;  3BOQ A;  3QOE A;  4M3B A;  3J7Z I;  4G6T B;  1VFC A;  3VOE A;  2HQA A;  5FLX Z;  3CTA A;  4PJJ A;  4CH7 A;  4LLG F;  2PJR A;  1QO0 D;  3RKW A;  3UKG A;  1UEL B;  3JRD A;  1MH3 A;  1JTY A;  3TL4 X;  1G2H A;  2CV0 A;  2O5R A;  5H2F C;  1GLN A;  4OMZ A;  2NXN B;  2ACJ A;  4BE1 A;  3LST A;  4XRS G;  4O6J A;  2RRE A;  1XGS A;  2F48 A;  2QSF X;  1AU7 A;  2B9S A;  5D4R A;  1EH6 A;  1Z1D A;  1WI3 A;  3TP3 A;  2AHQ A;  5B1B H;  1F5T A;  2ZME C;  3BR3 A;  2K9L A;  1IV6 A;  1ZGA A;  3T5X A;  2IGM A;  3HOS A;  2Z99 A;  3M1C A;  3O6B B;  2O61 A;  1IRX A;  3J80 Z;  4JX5 A;  3E6C C;  4I02 A;  4IHW A;  2FRH A;  2O9L A;  3MEX A;  4IVN A;  1GDT A;  1YQA A;  5LRR A;  2CV2 A;  1I1G A;  3CCM I;  2I10 A;  4U0W A;  3H36 A;  1ZAO A;  3RSN A;  2OCC H;  5DCM A;  4PSW A;  1T08 B;  4OMY A;  1O3T A;  3M4O J;  2G7U A;  4HRI A;  2PG4 A;  3H5N A;  3KP4 A;  1R4N B;  1DUX C;  1D5V A;  2OF7 A;  3QP5 A;  1NH3 A;  1HSJ A;  3S8P A;  2O8X A;  5LD2 C;  2R93 J;  3WU0 A;  3M3Y J;  3KZY A;  1P4A A;  4KUM A;  2EV0 A;  2XF5 A;  1UB9 A;  4PGH A;  1QHH D;  3D5S C;  2VQH A;  2L7Z A;  2XPU A;  2BW3 A;  1NHA A;  3A2K A;  1WJE A;  3IAS 2;  3J81 Z;  1QA6 A;  2FX0 A;  4AM3 A;  1OYY A;  1FOY A;  2HU9 A;  3V8J A;  3GFI A;  3L2U A;  3RPU A;  1W7P A;  3PL8 A;  3OS2 A;  4FX0 A;  1WRJ A;  3CQZ J;  4G6D A;  4EJT A;  2BV6 A;  2LOO A;  3ZXS A;  2IEK A;  5F04 A;  3NQO A;  3FIW A;  4BAY A;  2HQ5 A;  1WJB A;  3ABM H;  3N97 A;  3LMM A;  2QF7 A;  1GXQ A;  2YU9 J;  3FXR A;  3DTK A;  3OYE A;  3J81 R;  4M3F A;  3K9T A;  4UUS B;  4OIO F;  4MQ9 F;  2GIZ A;  1RES A;  2CQK A;  1HW1 A;  1B8I B;  4DNC A;  1PP7 U;  4JX6 A;  3E6M A;  2BXY A;  4XM3 A;  1REP C;  3ONQ A;  4JP0 A;  2QLZ A;  3FHN A;  3I4P A;  5DD4 A;  1V4R A;  1BW5 A;  1IN5 A;  1L0O C;  3F8M A;  1RPW A;  1X58 A;  4EM1 A;  2M1B A;  3H3Z A;  1MDM A;  5CLS A;  5BPD A;  4Y7N J;  4ZZD A;  3AL0 B;  2JA6 J;  2DPD A;  4KN7 X;  3JRE A;  5JLW A;  2XUB A;  1MBG A;  1I5Z A;  3KYD B;  1KQ0 A;  2STT A;  3KP6 A;  1U9N A;  2ZME B;  3J80 K;  1MBK A;  2ID6 A;  2WAF A;  2Z2S B;  4RGR A;  3RPQ A;  4A0X A;  3CCQ I;  1A36 A;  1XMK A;  3ZQG A;  3QPL A;  2RNG A;  2PX9 A;  4XOT A;  3IL2 A;  2JJ7 A;  5IP6 A;  2HZD A;  2WV1 A;  2BHY A;  2LRE A;  3DV8 A;  2Y69 H;  5FKL A;  3COA C;  4A0Z A;  3KCC A;  5CQG A;  1B72 B;  5BNG A;  1SFK A;  4IZZ A;  2BY3 A;  2ME0 A;  3UNG C;  3TED A;  3I58 A;  1T8I A;  3GTK J;  3AL0 C;  1GT0 C;  3O2P E;  2V9V A;  1Z6R A;  5KAF C;  4RAF A;  1LPQ A;  1AKH B;  1DQU A;  1R00 A;  2VE9 A;  3B02 A;  3AG4 H;  1BJA A;  3MAJ A;  2Z3Y A;  2HVR A;  1Z77 A;  1JE8 A;  1U0J A;  4HYE A;  3DEW A;  4DW6 A;  1ON1 A;  1BC7 C;  4IRG A;  4L9J A;  5EZH A;  1HST A;  5M3M J;  4PSX A;  3K0L A;  2LBF A;  2LKP A;  3EET A;  3V8L A;  2KDO A;  2UZK A;  3LA7 A;  1XPX A;  4UY8 I;  1DDN A;  5DUK A;  1SD6 A;  3AKZ A;  2DI3 A;  2FJ1 A;  2KIF A;  4WX9 A;  3K70 C;  2CGP A;  4BE2 A;  1JKP C;  2E36 A;  2EK5 A;  1I27 A;  3U9G A;  4BKX A;  2QWW A;  3PSF A;  1A35 A;  5HLI A;  3WHC A;  1TW3 A;  2KJB A;  3R4K A;  3S2H J;  2EFO A;  2IBD A;  1YYV A;  2WC2 A;  1SVM A;  1QHG A;  3ESW B;  4I0B A;  2CUF A;  4HF1 A;  2CH0 A;  1I39 A;  2OAZ A;  5D5V B;  2R5Y B;  1FPQ A;  4RMN A;  2V79 A;  4XLH A;  4XLN F;  2MD5 A;  2DXI A;  4ZH4 F;  2IAI A;  1K61 A;  3Q3S A;  5HNH A;  2ZJ2 A;  4DOZ A;  2IA1 A;  3RJP A;  4QIW N;  4NQW B;  1HLV A;  3DEU A;  4CYD A;  3OS0 A;  1FYM A;  4FIS A;  2DU9 A;  5BMZ A;  4G7H F;  3KEY A;  3HJE A;  2XF7 A;  3OYN A;  4M3E A;  1S72 I;  1A5J A;  2XDV A;  4FQG A;  5D5X B;  5H20 A;  2CU7 A;  2I8D A;  2PMZ N;  1V54 H;  1TQM A;  2W82 A;  3KP3 A;  1OCP A;  2K86 A;  4PJ0 C;  1WCM J;  2W1O A;  4YIF A;  3EQL F;  1FBU A;  2PN6 A;  2HWV A;  1N75 A;  2CQQ A;  4ENK A;  2Y9Z A;  5JLX A;  1X4P A;  1JKO C;  2VBW A;  5HDN A;  3BT9 A;  2LSO A;  4L9N A;  1B9M A;  5IPA A;  4LLN A;  2FF4 A;  2H6B A;  2O3F A;  4RS8 A;  4LD5 A;  4YEL A;  5EYR A;  4KIB A;  2R5Z A;  3IH2 A;  3MCZ A;  4JX4 A;  1O7F A;  4M9S A;  1FBQ A;  2YU3 A;  2IPQ X;  2GWR A;  3EPZ A;  2WWY A;  2H09 A;  4E7L A;  1U9O A;  2OBP A;  2RVC A;  3M8E A;  4EGZ A;  4E7J A;  2FXA A;  2P6T A;  4BL0 B;  2COB A;  2R7R A;  1V3F A;  2L9R A;  3L9F A;  2MBF A;  2QKL B;  1RIO H;  2JA5 J;  3M8J A;  5GAE J;  3RI4 A;  1B9N A;  1RR7 A;  4ITV A;  1R36 A;  1S7A A;  5FRO A;  4LIT A;  5H6R A;  1MNM C;  4UNO A;  1JJ8 C;  1FOX A;  2OTL I;  5GAG J;  4EQQ A;  3GF2 A;  3GLL A;  4BDY A;  1D8K A;  1Z7U A;  4BY7 J;  3OYH A;  4IXA A;  2R3S A;  1EV7 A;  2XSD C;  5LBQ A;  5EG0 A;  2GIV A;  4XRM A;  3BQZ A;  3JRH A;  4GCV A;  1S7O A;  1OCC H;  3FMS A;  4AU7 A;  1VQ5 I;  1K4S A;  3C3W A;  3LSR A;  2WY8 Q;  4KT5 C;  1W0T A;  3RQ4 A;  4B43 A;  2MLG A;  4C3I J;  4YRV A;  2BY1 A;  1TZL A;  3BPV A;  1J75 A;  3GLX A;  1A04 A;  1YX5 A;  4M3G A;  3ZQ7 A;  4CCO A;  3CZ6 A;  5M5W J;  4FAS D;  4XNF A;  1LQ1 A;  1MDM B;  1JUM A;  1CGP A;  1W5T A;  4XSZ F;  1IV8 A;  2OA4 A;  3E1S A;  2VPL A;  3BCA A;  5EEG A;  3R60 A;  4IEJ A;  1FOK A;  5DUI A;  2R7F A;  3BY6 A;  2CW7 A;  3O8G A;  2Q8K A;  2O8K A;  3PNV A;  2OU2 A;  4A69 C;  4CO8 A;  1MBJ A;  1X1B A;  5IT9 R;  3F8F A;  2ECB A;  3BR0 A;  4AUX A;  1YHQ I;  1ZRC A;  2L02 A;  2OQR A;  1G4D A;  3OYK A;  1W4M A;  3L09 A;  3EUH A;  4B1R A;  3HGG A;  4LG0 B;  1JI8 A;  1YJ9 I;  4A3I J;  3NEU A;  2M8G X;  4QTR A;  1S6L A;  4CYC B;  4B44 A;  3LSP A;  3BWG A;  2COM A;  2XAU A;  1R5I D;  2KRF A;  1YO5 C;  2GBY A;  4BU2 A;  2MGQ A;  4P9F A;  4MHG A;  1KU7 A;  1J9I A;  2ZXH A;  1N25 A;  4AIK A;  2YR2 A;  3F9K A;  3LSK A;  3S16 J;  2Y9Y A;  2F5E A;  4D1Q A;  1J7K A;  3MMY B;  1IRZ A;  2Y48 A;  1F9N A;  1QZY A;  2K4J A;  3OYL A;  4GXO A;  4BXX J;  3SDG A;  3CDL A;  4KNY A;  1T6S A;  1VQ8 I;  1W5S A;  1USS A;  2JSP A;  2M34 A;  2X48 A;  2M4G A;  2JSC A;  4IHY A;  2A61 A;  5ERI A;  2DOA A;  1I3Q J;  4Y3O A;  1BR2 A;  3Q9V A;  4M72 A;  1DP3 A;  1SAX A;  3HXL A;  4HG2 A;  2R92 J;  1MH4 A;  4HEA 2;  4H4K C;  3NAU A;  2W48 A;  3K1P A;  5CPR B;  3C1D A;  3J7Y J;  3I59 A;  1S8N A;  2M3A A;  2MSY A;  4TV7 A;  4ZYA A;  2E5Z A;  3QWL A;  1IC8 A;  1W1W E;  3F8B A;  1IGN A;  5DCF A;  3CC4 I;  2ME6 A;  5HDG A;  3GXO A;  4RGS A;  1JKR C;  1ONV A;  2W4S A;  1XMA A;  4LMY A;  4XLP F;  1XS9 A;  1D3Y A;  2LP0 A;  2YS9 A;  3BDD A;  3E6D A;  5FLX R;  2QGU A;  2O6G E;  2G0E A;  2DA6 A;  2QKM B;  3GCM A;  2HYF A;  4ESJ A;  2DT5 A;  2NVX J;  1QU3 A;  2F4O B;  5D5U B;  1K79 A;  3LQQ A;  4BGD A;  3CME I;  4NC8 A;  1G3W A;  2EZL A;  4L5J A;  2E2I J;  2P5V A;  4IPA A;  1HQC A;  1H8A C;  3HOU J;  4MTD A;  4B48 A;  1W7P D;  3F23 A;  1Z3Y A;  4NBQ A;  3F21 A;  3SXY A;  2LDU A;  1P4W A;  1X4O A;  4OIN F;  2EFW A;  3PO2 J;  1BC8 C;  1GXP A;  2F5D A;  2V1X A;  1JHH A;  2WBM A;  4R1H A;  4IOC F;  1ZYR F;  2Q2E B;  3CUQ B;  1SVO A;  1YE9 A;  2K4B A;  1I1S A;  2ZXW H;  3S2D J;  1S9H A;  2FSW A;  3A03 A;  3HPH A;  5ILV A;  1UG2 A;  4HDU A;  1T39 A;  2DJI A;  5LEJ A;  5LGT A;  3ZN0 A;  2KIU A;  2Y0S N;  1WJ5 A;  2DK5 A;  1TW2 A;  1XTA A;  3VYT B;  3HUG A;  2Y30 A;  5EJC A;  2XGD A;  2R7Q A;  1JHF A;  4RLF A;  3VYU B;  1SAU A;  2QQ8 A;  4L18 B;  1SVL A;  2IJL A;  2UXN A;  3FBN B;  3KIO A;  2NVT J;  1ZTR A;  1YJW I;  2PFB A;  1Y0N A;  3BG3 A;  2Q1Z B;  2BE5 F;  1MIJ A;  3OYC A;  2NS7 A;  4S0H B;  2DMQ A;  3S32 A;  4UB6 C;  2QQA A;  4A3L J;  1WVR A;  2G7H A;  5KNL A;  4XLF A;  1R23 A;  2F5C A;  2O03 A;  3IKT A;  3ZQF A;  1HKS A;  3T8R A;  1U5T C;  4XR6 A;  1WFX A;  3CF2 A;  2FEZ A;  3I59 B;  3WE2 A;  4EJW A;  1BIA A;  3IKV A;  5KVR A;  5FKN A;  4KDP A;  2LYC A;  3ZQL A;  2F4I A;  2CWE A;  1R1T A;  3L7W A;  2ZME A;  3RCO A;  3BG6 A;  4DBQ A;  3DQV C;  1GV2 A;  4EM2 A;  5K5O A;  5D6F A;  2V1D A;  3GFJ A;  5C4X J;  5IOZ A;  2R7T A;  2M35 A;  1BI2 A;  3CCY A;  3FMR A;  4WCG A;  2NNY A;  4KMF A;  1SD5 A;  3FBI B;  3Q0V A;  4CYC A;  1S7E A;  3IAM 2;  1HW5 A;  3NWT A;  1BW6 A;  2A6H F;  2X6O A;  3JCU C;  3BTL A;  1RI7 A;  5CQE A;  4D0P A;  3DKX A;  2GXB A;  1ON2 A;  4ZYE A;  3GZ5 A;  4HNT A;  1XGN A;  3DLA A;  4BJ5 C;  5F6F A;  1BJZ A;  3TOB A;  1YLF A;  3LSI A;  4BHC A;  2RQQ A;  2XPW A;  1Y0U A;  2PJR B;  1N77 A;  2HKO A;  1XSD A;  3LAP A;  2GA1 A;  3WOD F;  1D0X A;  1MMS A;  3DF8 A;  1ZHF A;  3KZI C;  2XRO A;  2DA4 A;  2OJE D;  1Z21 A;  4MLO A;  1BR1 A;  2L54 A;  3U2R A;  2A6T A;  4AC0 A;  4B4C A;  3CCU I;  3WGG A;  1D1C A;  1XMX A;  3I64 A;  4OWR B;  1X1D A;  4PZJ A;  3CJN A;  1FNN A;  3ASO H;  3PFY A;  4XON A;  3RQI A;  1UHW A;  3I3L A;  4XRF A;  4HV5 A;  2MH2 A;  1U5T A;  1W36 C;  1Z67 A;  4OAY A;  2H8W A;  2A5W A;  5FFZ A;  1G8X A;  5BPI A;  3FHZ A;  2LK2 A;  3MWM A;  1NG7 A;  4UUV A;  1EH8 A;  4H0E A;  4A6D A;  4Q48 A;  2E1N A;  4N0B A;  3OYD A;  3HOT A;  3S15 J;  3CJR B;  4E6K G;  4JYK A;  3K6G A;  5FRN A;  1E0E A;  3BRO A;  1HXD A;  5HS9 A;  3ZMV A;  3S3N A;  2XKP A;  5DEQ A;  1IO2 A;  4ENN A;  3G3Z A;  2HOA A;  2JT1 A;  2DTR A;  3CMY A;  5F08 A;  1MW7 A;  4PFO A;  2E5N A;  4C3J J;  2Z5U A;  1SFX A;  1KYW A;  4BS9 A;  2CUZ A;  3QQA A;  4G12 A;  3LNQ A;  3KP5 A;  3OR1 C;  3G71 I;  2LNB A;  4D5F A;  4Y13 A;  3VDX A;  2Z9O A;  2GM4 A;  4M6X A;  4NB5 A;  2A5Y B;  2BW3 B;  3P9K A;  1APL C;  1R9T J;  2X6X A;  3ZP5 A;  2QM3 A;  3ERM A;  3OS1 A;  3RPU D;  2XV4 S;  1ZLK A;  3WG7 H;  1JGS A;  1XB4 A;  1D1A A;  4EMS A;  3KP7 A;  1IDY A;  4LJZ F;  5IP7 J;  1I50 J;  3S1N J;  1R58 A;  2X51 A;  3H1C A;  5FFX A;  4MFD A;  3ZN1 A;  3GTM J;  3FXM A;  1TL8 A;  3H3V K;  1CF7 B;  4KMU X;  1FZP B;  4DIQ A;  2VKE A;  3CUQ A;  2DA1 A;  3WU1 B;  3E3V A;  3JRG A;  4L5I A;  1OIS A;  3ASN H;  3FKI J;  5E3N A;  1YIT I;  3DFG A;  4B3X A;  1VND A;  2WAQ N;  3BTI A;  3LSM A;  5BOX A;  2HYG D;  3AG1 H;  1UJ8 A;  4A3K J;  4EJU A;  4ON0 A;  2CJJ A;  1R7J A;  1YRN B;  4Q4Z F;  1ENH A;  4KA4 A;  3ML6 A;  4HNU A;  2NVY J;  1Y8R B;  1U78 A;  1MBF A;  2M5W A;  2HQR A;  4RAY A;  4BH9 A;  3HYI A;  3J80 R;  3RDI A;  3KYL A;  1Z91 A;  5ICC A;  1LNW A;  1T0F A;  5F0F A;  1OPC A;  4BAC A;  1BM9 A;  3BQY A;  1PUE E;  4M9X A;  4BEH B;  2VC1 A;  4F93 B;  2E2J J;  1X3U A;  2IP2 A;  1RKT A;  3MN2 A;  5TIS C;  1VQ4 I;  2VL8 A;  4XK4 A;  3W2V A;  1MBE A;  1KZH A;  3DKY A;  2YPR A;  3HSR A;  3CP8 A;  4I0A A;  3QU3 A;  4CA0 A;  2HDW A;  1LB2 A;  1ZGW A;  2NOJ B;  2A69 F;  3EYY A;  5LFA A;  1PUF A;  1K78 B;  4BNC A;  2GQQ A;  3HZJ A;  2HI3 A;  4N4O B;  3JTG A;  3DXJ F;  2JRM A;  2IS4 A;  4JOM A;  3TO9 A;  5L3C A;  1AKH A;  5FLX K;  1O3R A;  4QPO A;  3HHG A;  2EZI A;  1FTZ A;  2VJ4 A;  2XAJ A;  3DPL C;  1B6A A;  4HOB A;  3S14 J;  3WGH A;  1WJD A;  3IUO A;  5CVR A;  2ZC2 A;  4C3H J;  3QOP A;  3ABK H;  3K4K A;  2E2H J;  2CSO A;  1UG0 A;  3ZMD A;  3H35 A;  5HDK A;  2Y2Z A;  2KRC A;  5JFR A;  4I09 A;  1J5Y A;  1TT0 A;  3SEZ A;  4N9H A;  3IH4 A;  1VI0 A;  4C2M J;  4U0Y A;  1S5L C;  4RAZ A;  4P5O A;  4XBF A;  3DPU A;  4I01 A;  3CC2 I;  3HOW J;  5GAD J;  3FM5 A;  1KU2 A;  2GOX B;  1YW9 A;  1BI3 A;  2QUF A;  2EFQ A;  5B3S H;  3BG7 A;  3Q0U A;  2D45 A;  1POG A;  4IQ4 A;  1STZ A;  4YII A;  3HOZ J;  2L4M A;  2WAD A;  1BOB A;  1VQO I;  4Y15 A;  1JT0 A;  2JQ7 A;  5HVQ C;  1ETW A;  4GO1 A;  4I7H A;  2JVG A;  3MZH A;  4YFX F;  1VQ7 I;  1KQ9 A;  2KL4 A;  2ZB9 A;  4Z2Y A;  4CZZ A;  1U5T B;  4A5N A;  2HOE A;  2H94 A;  3ROU A;  3L2W A;  4CUG A;  4LLL A;  4N4N B;  2V1U A;  3Q5F A;  3U1K A;  3WG9 A;  1D0Y A;  2EIL H;  3SDB A;  5L3D A;  3JRI A;  2CRG A;  2CFO A;  1H9T A;  3QYB A;  5ED4 A;  3F8N A;  2MLK A;  2XAS A;  3EUK L;  1BA5 A;  4I99 C;  1Z05 A;  3H9G A;  1ORK A;  4XQF A;  1T33 A;  2ECC A;  2K02 A;  3GEZ A;  2W25 A;  1OQY A;  3E7L A;  3KEO A;  4Z6Y A;  4IHT A;  2ZSH B;  1TWH J;  2DFE A;  3QPT A;  1J59 A;  2HXI A;  2FE3 A;  5CVJ A;  2HGC A;  2YX7 A;  3BP8 A;  1HKQ A;  3LWF A;  2STW A;  1JJ6 C;  2F6C A;  2WAQ A;  2EQR A;  2XGE A;  2Z33 A;  2K85 A;  4Y33 A;  5J8F A;  3FIS A;  1TWG J;  2DAO A;  2QEN A;  2QQ9 A;  4UHT A;  1Y56 A;  3HOY J;  1ETX A;  2DQL A;  1ZG5 A;  5D4S A;  3KLN A;  1BI1 A;  3SZT A;  2R7Z J;  1HDD C;  5IT9 K;  3MFK A;  4QSH A;  5EGO B;  1SFE A;  2DFF A;  2Y31 A;  5M3F J;  3DTI A;  2JPB A;  2ICW G;  4ENM A;  4D7M A;  3U21 A;  2X6Y A;  3VSL A;  5AIP A;  2RAE A;  4MEY F;  3N4M A;  5J47 A;  4BQQ A;  1YG2 A;  1LDJ A;  3G73 A;  3BR1 A;  3RZD J;  3ZQQ A;  2DMP A;  3I53 A;  4B8X A;  4I76 A;  3KLO A;  4XIC A;  1IN6 A;  3LOC A;  1Z6T A;  3CP2 A;  4J19 A;  2RDP A;  5JVG F;  2VBX A;  5HOD A;  5D8K B;  2M45 A;  3SEQ A;  2A07 F;  2QCO A;  3WTX C;  1OCZ H;  4FCY A;  4NC6 A;  1IXS B;  4M3D A;  4XOR A;  5JHU A;  4RM3 A;  3HG9 A;  2EPF A;  2E7X A;  5FKO A;  2DJN A;  3ERE D;  4FT8 A;  3BTJ A;  3V8K A;  1T95 A;  4B47 A;  2W84 A;  4IF4 A;  4DYQ A;  2CMP A;  2ELK A;  3KX2 A;  4LK0 F;  3HDD A;  4ZTF A;  2VKV A;  1B59 A;  2LH9 A;  5J3L A;  3LA3 A;  3A1Y A;  4NQW A;  2LVS A;  5FKM A;  2R7W A;  1K6O A;  3TOA A;  4NC7 A;  4AD9 A;  2FA5 A;  1RC9 A;  3SYT A;  4FHT A;  1GUU A;  3DU6 A;  4HX8 A;  1VQ9 I;  4A6E A;  5LGU A;  1ZRE A;  4U7B A;  4CHU A;  3K4L A;  2BBY A;  2RV8 A;  3HPG A;  2IS1 A;  3WE3 A;  3KPH A;  2IGN A;  4XKW A;  2E7W A;  4IQJ A;  1YTY A;  4AIH A;  4OIR F;  4F52 A;  2VXD A;  3BJO A;  1ZG1 A;  3W6J B;  4KIT B;  2ZJP F;  3R0J A;  2XVC A;  3SZP A;  1IXR C;  3FZV A;  3OL3 A;  1ZGJ A;  4V2F A;  2WA0 A;  2EIK H;  1VQL I;  3HIF A;  1OCT C;  4A3G J;  4RDU A;  4PK4 A;  4I2O A;  5ILS A;  4CXF A;  3DP7 A;  2XC7 A;  5LLQ A;  3B6A A;  1XGM A;  2W24 A;  2VJI A;  3OYG A;  3CUO A;  1WH7 A;  1W36 D;  3CF5 F;  1AA7 A;  3FDY A;  3V7C A;  1G3T A;  1U2W A;  4PGG A;  1H89 C;  5EGO A;  4QLC U;  2KKO A;  3CD6 I;  3SQN A;  3NAR A;  3S17 J;  3OWT A;  1XGO A;  2XSJ C;  1PVE A;  4GYG A;  4W97 A;  4D7N A;  4V2G A;  1GVJ A;  3LAJ A;  1J0R A;  4LG3 A;  3A02 A;  4L9V A;  3GBG A;  2MW8 A;  1TLH B;  2DA2 A;  4WXD A;  1EKE A;  1U3E M;  1K83 J;  2JN6 A;  4FX4 A;  4XKV A;  5L3G A;  3WTT C;  1H9G A;  3G2B A;  1JUS A;  6PAX A;  2K5C A;  3K4N A;  2CQX A;  2BEO A;  1D8J A;  1KON A;  3RTR A;  4BDZ A;  2Q0O A;  2TRT A;  1DU6 A;  2E19 A;  2XAG A;  1M1E B;  3ECH A;  4KN4 X;  2DBB A;  2DLL A;  2K27 A;  5HOO A;  5HLH A;  3MKZ A;  4PJM A;  1WQ2 A;  2R7X A;  4S05 A;  1BR4 A;  4LB6 B;  4HW0 A;  3I54 A;  2VE8 A;  4JQF A;  4UVB A;  4KJZ A;  3FXK A;  2VJ5 A;  5FLV A;  2ZKZ A;  1WKM A;  2JZY A;  5C44 J;  4CCN A;  4XRS A;  2ELH A;  5HLT A;  2FBH A;  4I6Z A;  3F6O A;  3E97 A;  3RYP A;  1SFO J;  3EUH C;  3MZY A;  2MAB A;  4MO7 A;  2QVO A;  1B72 A;  1OR7 A;  2M0C A;  2DOE A;  2PEX A;  3ZGK A;  4D9J A;  2VIX A;  1TQI A;  3VOD A;  1G3S A;  2FBK A;  4MIM A;  2UWM A;  2BVL A;  1EJ9 A;  2ZCW A;  1JT6 A;  3WTS C;  2D1H A;  3H9Q A;  2G9W A;  3JRB A;  1KA8 A;  2M4K A;  2NS0 A;  1VQK I;  1QGP A;  2KQR A;  4CCM A;  3GUD A;  2VKH A;  3CO7 C;  1Z9C A;  2GXG A;  2X1C A;  2UXX A;  4DYC A;  2VPR A;  1FBS A;  3SHF A;  5E8I A;  2LKS A;  2IGO A;  3R6S A;  1RNL A;  4PCQ A;  3HB9 A;  4HLY A;  2EH3 A;  4KT6 A;  2L7F P;  3GTJ J;  2CUE A;  3OY9 A;  3VPR A;  5ILU A;  1P9Q C;  4U87 A;  2VON A;  2GXA A;  3S1Q J;  3RIR A;  1L3L A;  2BY0 A;  1S3J A;  1UHS A;  2DFH A;  4HZF A;  1ZAR A;  3DBR B;  4W1U A;  5E8G A;  1IUF A;  4QWQ A;  4E7H A;  1O3S A;  3PO3 J;  2CS3 A;  1JGG A;  4A0Y A;  2EWN A;  2NVU B;  4O3M A;  3IV5 A;  3EUA A;  4HLX A;  4XLC A;  3JRC A;  5K7F A;  5FLM J;  1YIJ I;  3T0Y A;  1LKX A;  2L9V A;  1XDS A;  5TJJ A;  3DU5 A;  2M7A A;  1ACI A;  2GA2 A;  1UCR A;  3A0H C;  3ELK A;  2LY2 A;  5C4J J;  1Y39 A;  4UVC A;  2ID3 A;  3LFK A;  3D5L A;  4A3B J;  1SC7 A;  1B4A A;  4YIR X;  2XGX A;  4R79 A;  5F1J A;  3OYB A;  2UUZ A;  1BIB A;  2X6W A;  3FK6 A;  2IS6 A;  3OIQ A;  2Y0S A;  2FOK A;  2P4W A;  1RUN A;  1IUY A;  4HBL A;  5BS6 A;  3IH3 A;  2GZW A;  4WF2 A;  2ISZ A;  3FF5 A;  4A5M A;  3C2H A;  3MZ8 A;  2HPI A;  3C18 A;  3HKZ A;  2E1O A;  4GGG A;  1MD0 A;  2BHZ A;  4QPQ A;  5F1R A;  3HOX J;  4V19 K;  4X0G A;  3P9C A;  4KIG A;  4KIF A;  3AAF A;  2P7C B;  2AXT C;  1MND A;  1QPI A;  4BQA A;  5HS8 A;  4M74 A;  3L2R A;  2IGK A;  5D6E A;  4XMY A;  4A3D J;  4PFP A;  5K7Z A;  2DDA A;  4LK1 F;  3QAH A;  1IJW C;  2IXS A;  3OYF A;  3JAM K;  4KFC A;  3OR2 C;  1G6N A;  4C30 A;  4EAT A;  2JUG A;  1OLT A;  4XSX F;  2H27 A;  4YFK F;  3L2V A;  2Z1D A;  4PUS A;  4P9U A;  3T1B A;  1VF9 A;  2LBF B;  1SMT A;  2VC0 A;  1J09 A;  1MZB A;  1LDK B;  3T8T A;  1GV5 A;  3QPH A;  3TP0 A;  4BHP A;  5GPA A;  3I4M J;  5D8L B;  1NK3 P;  2EBI A;  1MJ9 A;  4ENJ A;  3PIP F;  3WTW C;  1K6Y A;  2E35 A;  2L3D A;  3QOD A;  2NYX A;  4E4H A;  5DTD A;  2P5K A;  2MFZ A;  1V5F A;  5ICE A;  1TBX A;  1ZR2 A;  4E7K A;  2KIM A;  1IRF A;  4A3M J;  3I4N J;  1FYL A;  2HVS A;  4R8H A;  4DGW B;  1QVU A;  2HR3 A;  4Y17 A;  3CLQ A;  2VT3 A;  2QQB A;  3AFH A;  1KU9 A;  3MD2 A;  5FKK A;  2CW8 A;  4ESB A;  3DCF A;  4GRI A;  4AYB N;  5J4V A;  3MVP A;  2HDC A;  2RC4 A;  4LB5 A;  1MJA A;  3A0B C;  3J7A O;  1FX7 A;  3HBL A;  3GTP J;  5AON A;  2AQE A;  2QEX I;  2KDZ A;  3BJA A;  3P7N A;  2PQ8 A;  1JUP A;  2E1M C;  4CCK A;  3OSG A;  4ZDL A;  4G9Y A;  3ZOB A;  3OV8 A;  3HRM A;  2KRH A;  1ETQ A;  2RQP A;  2HFH A;  3S3M A;  4J00 A;  1TC3 C;  1TWA J;  3SJM A;  1XN7 A;  2DO7 A;  4L9T A;  2DOD A;  3CCV I;  3B73 A;  4FET A;  2NAZ A;  3M1E A;  4ESF A;  1YS7 A;  3ISP A;  4BHB A;  1IW7 F;  3JRA A;  4LFU A;  2EIJ H;  1X1P A;  2XKO A;  1F36 A;  2N8G A;  1VQP I;  1R49 A;  4D5C A;  4KIC A;  3K4B A;  1AWC A;  2L5Q A;  2R7D A;  3KET A;  2ZFU A;  4CCL A;  4GYI A;  1TNT A;  1TP4 A;  3TGN A;  3OYJ A;  2E1C A;  1Y8Q B;  2DMT A;  2OUM A;  4AIJ A;  1VQN I;  2EZK A;  2Q2E A;  2LMD A;  2X1E A;  1SMY F;  2ZXI A;  4M6V A;  5FD6 A;  2GAU A;  1SD7 A;  5CKT A;  4ANJ A;  3W6V A;  1WH5 A;  2VOD A;  2EFN A;  2KIS A;  3L2Q A;  1BBY A;  4MFE A;  3C2B A;  1ODD A;  2DK8 A;  2TCT A;  4BE0 A;  5KK1 A;  3WHB A;  4ZZL A;  2IVM A;  2WB1 N;  2TDX A;  4HX4 A;  3E5X A;  3WTU C;  2DA5 A;  1UZC A;  2F5V A;  1LFP A;  4XN3 A;  3HOV J;  1WJA A;  4HAM A;  4IO9 F;  2RN7 A;  2YX4 A;  2A6E F;  4PDK A;  1WWX A;  4AVZ A;  1YW8 A;  1E17 A;  1XCB A;  4PJL A;  2QSH X;  3JAM R;  3ZRG A;  3BLY A;  5E1Z B;  3OIO A;  1DPU A;  3VSK A;  3IRR A;  5A2Q Z;  1DGW Y;  3ZMS A;  2MC3 A;  3VWB A;  1VQ6 I;  2ISY A;  1QPM A;  9ANT A;  1QZE A;  1T56 A;  2OZU A;  1UHM A;  3WTY C;  2WB1 A;  1OCO H;  3FK7 A;  4XLE A;  2K3F A;  1ETY A;  3ZCO A;  1XDU A;  3GX4 X;  2XIG A;  3P9I A;  4G8X A;  4EEF G;  4OIP F;  4RB1 A;  2QZ8 A;  5FRM A;  4G7O F;  2LC2 A;  2X85 A;  2PBI A;  4HA8 A;  3W2W A;  4GDF A;  1TWF J;  2L0K A;  1NK2 P;  3RKY A;  4C2T A;  4E7S A;  2D2W A;  2GOM A;  4F7Z A;  2XPV A;  2ELJ A;  4ZYG A;  1I6H J;  2FQ4 A;  2CG4 A;  4RB3 C;  3BCB A;  3G4S I;  5J40 A;  4RAG A;  1ZLJ A;  4BYY A;  1WHU A;  3E6B A;  1XD7 A;  5HNF A;  2VXZ A;  3GZN B;  4A3J J;  5IYB J;  2MVT A;  1F4K A;  2AXL A;  2LRD A;  1X2M A;  3KYC B;  2QA4 I;  2LKX A;  4A3F J;  1P4X A;  3TW6 A;  3BPX A;  2VOP A;  3RKX A;  3GWZ A;  4EJV A;  4Q5S F;  4RGU A;  4BUP A;  4IHV A;  3H5R A;  4P55 A;  4E70 A;  2JWT A;  4OU0 A;  4ZDP A;  1FWZ A;  1JTX A;  1CQT A;  5J1U A;  3C7J A;  5E18 F;  2F5F A;  2NVQ J;  4BQO A;  2MUN A;  2WV0 A;  2XF6 A;  3HSE A;  2ZNZ A;  1XX5 A;  2FD5 A;  3M07 A;  2VOO A;  3DPT A;  3UR3 C;  3G1O A;  3GYH X;  2ZJQ F;  2XHK A;  4DYR A;  1H88 C;  4XLA A;  4IOA F;  1OR7 C;  2VQG A;  3LFU A;  3ZQI A;  3DWL E;  3L2C A;  4PJN A;  5GTI C;  3PQJ A;  1MJB A;  3HM5 A;  1IN8 A;  1LUJ B;  2WTE A;  3S93 A;  2FBI A;  3FM3 A;  3QYE A;  2H8R A;  1W5C C;  1Z3X A;  3ABL H;  1UAA A;  4EM0 B;  3D5R C;  2B63 J;  3BC8 A;  5L3B A;  1RR8 C;  2LLK A;  3GZ6 A;  3CMM A;  3ZPL A;  1U6G A;  3BZK A;  1K4T A;  5EG0 B;  1LEA A;  3W6K B;  5JVT A;  2M0M A;  3S2W A;  2F4M B;  1TT5 B;  1XSX A;  2KP6 A;  4BJ6 C;  1VQM I;  4L5E A;  2E60 A;  2KZV A;  1K7A A;  2HPM A;  1V55 H;  2A3S A;  4NNJ A;  3ZMU A;  5E20 A;  3JW4 A;  2MD0 A;  1IDZ A;  5LEK A;  2X4H A;  2MG4 A;  2W57 A;  2BXZ A;  1MGT A;  2V26 A;  1A31 A;  2BY2 A;  3EYI A;  2L7M P;  1FYK A;  1OYW A;  5CYV A;  4IHX A;  4Q47 A;  1D0Z A;  1V5G A;  3D1N I;  1F43 A;  4MGR A;  4ASN A;  3PJR A;  1WZ2 A;  4M9Z A;  4A3C J;  3Q0W A;  3BR2 A;  3TBI A;  2JVH A;  3HSF A;  3VYS B;  3OIP A;  5J1R A;  3S1R J;  4HDV A;  2CV1 A;  2QBY B;  1HDP A;  1LDD A;  2JRT A;  1YRN A;  1Z0X A;  3TKY A;  2EA4 A;  2HQN A;  2ZO4 A;  2R7U A;  5KCM A;  2FOW A;  2JA8 J;  2CQ7 A;  1CF7 A;  3TDZ C;  1KU3 A;  1FP2 A;  5K5Q A;  3OMY A;  2W7N A;  2LG4 A;  1MBH A;  1FJL A;  5FGM A;  3OYM A;  2HEO A;  5B66 C;  2R7S A;  3B6C A;  3H9J A;  3WU2 C;  1D5Y A;  4AVP A;  1WGX A;  3U1D A;  4DBR A;  1ETK A;  2J5O A;  3RKQ A;  5IY5 H;  4MEX F;  3C2G A;  2P0T A;  5K7H A;  1DU0 A;  2IA2 A;  5F27 A;  2ESH A;  3CCL I;  2HNH A;  2QYO A;  1E3O C;  5K1Y A;  1MSE C;  1WI9 A;  4ZYD A;  1F1Z A;  1BN5 A;  3GVA A;  3HGY A;  2KHM A;  2KFD A;  1GVD A;  2MH9 A;  1RET A;  3FMQ A;  1QRY A;  4UV9 A;  1W0U A;  3NRV A;  5DDG A;  3I0T A;  2M8E A;  2HDD A;  3GFL A;  1V5E A;  5E1X A;  4XL9 A;  3TMO A;  1JXS A;  4FTH A;  2KPM A;  2VBY A;  2F2E A;  2AO9 A;  2FMY A;  2Z16 A;  4B09 A;  2OPT A;  5EF6 A;  4BBS J;  3HTU A;  5C3E J;  4OIQ F;  4WXC A;  5E1W A;  3WTV C;  1MMA A;  4M71 A;  3CDI A;  1LE8 B;  1WPK A;  1PUF B;  2L9N A;  3TDU C;  4G94 A;  1TNS A;  4XKC A;  4XKB A;  4RB0 A;  4DZP A;  3QP6 A;  1P6R A;  2XB0 X;  3H0G J;  5GPC A;  2M7B A;  5J8C A;  4WWC A;  3MQ0 A;  4FE4 A;  4YFN F;  3TO7 A;  1RKW A;  2XAH A;  1HCR A;  3DEE A;  5L3F A;  3I71 A;  5EEA A;  3K1M A;  3BZC A;  4I98 B;  4HX7 A;  4A3E J;  1DP7 P;  1YFH A;  5JHF A;  1Y6I A;  4ZJZ A;  2MA3 A;  1X1A A;  1ZG3 A;  3K2Z A;  1XCV A;  4C9Y A;  1DGR M;  4GFB A;  2XB5 A;  3M9A A;  5DD8 A;  3REO A;  3RYR A;  2I5U A;  4U7D A;  3K10 A;  4S04 A;  1KQ8 A;  2JUC A;  5TRD A;  2ZJR F;  5B1A H;  1R71 A;  1NTC A;  1JKQ C;  2V1N A;  3GTL J;  1R5G A;  3K4C A;  5ICG A;  5J6X A;  2RNJ A;  1NG6 A;  1ETO A;  3BZ6 A;  2VN2 A;  3GW2 A;  4M6Y A;  4AID A;  3HHH A;  2P7V B;  5DM6 F;  5AIQ A;  2V7F A;  4RA2 A;  2JPC A;  3PM1 A;  2DDB A;  3V7R A;  1P92 A;  1IN4 A;  3QU6 A;  2K9N A;  3HTS B;  2XRL A;  5IYC J;  2LFB A;  1LVK A;  2M30 A;  2WY7 Q;  3HC7 A;  2PJP A;  2CYY A;  4ZYH A;  3OSF A;  5EZG A;  1A6I A;  4IHS A;  1ZEL A;  2LF8 A;  3K1N A;  2JMW A;  1OJL A;  2DN0 A;  3K69 A;  2PI0 A;  2M87 A;  4MQV A;  2HOS A;  1PDN C;  4E7Z A;  2RKH A;  1B8I A;  4NUB A;  1T0F C;  3ZMZ A;  5CVV A;  5J1Y A;  3ZMT A;  2ADU A;  2PLY A;  4Y52 J;  4UV8 A;  3GTG J;  2IRF G;  1BL0 A;  2W85 A;  2EA2 A;  2CUJ A;  1P2F A;  4WK8 F;  4II3 A;  1BI0 A;  5DS9 A;  2BZT A;  2ZNY A;  4BJT A;  3WGI A;  3F0C A;  4HQE A;  2V4J C;  1EA3 A;  2DT7 B;  3OOP A;  4RM2 A;  3E0J B;  2HTJ A;  3V7S A;  1RUO A;  2A05 A;  2R4G A;  3PUB A;  2QBY A;  1I6X A;  3BG5 A;  1XC5 A;  2QSG X;  3HRU A;  1R1U A;  2R5Z B;  1HF0 A;  1ZK8 A;  1FSE A;  2CO5 A;  5EEH A;  4ZTJ A;  2YUS A;  2EIN H;  2R7O A;  1OCR H;  4A93 J;  5TGT A;  5LHG A;  4EVI A;  1ETV A;  2K3P A;  3F72 A;  3FXQ A;  1D1B A;  3ECO A;  4LGW A;  2IW5 A;  3FWE A;  3JSO A;  4ZDO A;  1ITY A;  2NNN A;  2DCE A;  2XGC A;  1R1V A;  2L4A A;  3L00 A;  1J2X A;  3I55 I;  1IAW A;  2O0Y A;  3DBH B;  1U8B A;  4F92 B;  3VB2 A;  5DYM A;  1SAN A;  2X0L A;  2DW4 A;  2H1K A;  1KYZ A;  3ABT A;  2HYJ A;  3K4M A;  1RQ6 A;  2VKD A;  5E3M A;  4XN0 A;  5FB2 A;  4IRH A;  3SFI A;  2X9D A;  2OV7 A;  1FT9 A;  5CVU A;  2L9S A;  4RB2 C;  3F6V A;  2KZG A;  5IT9 Z;  1VZ0 A;  2FUG 2;  2E34 A;  3NWS A;  4JBA A;  1IRG A;  2NS8 A;  3CCJ I;  4OAZ A;  2FNA A;  5GP9 A;  2LF7 A;  4BXF A;  2P6S A;  3CCS I;  3QRF F;  2DTZ A;  1X19 A;  2Y75 A;  4F55 A;  1A6Q A;  5F64 A;  3CJQ B;  4IKF A;  3DLL F;  1XG1 A;  1X1C A;  3ZR8 X;  1P7I A;  3I5U A;  2R7V A;  2VQC A;  3R0A A;  4ZC3 A;  2X98 A;  3K7A J;  2AS5 F;  1FY7 A;  1SD4 A;  4P96 A;  1LFU P;  1QQI A;  3HKZ N;  5IT3 A;  1IF1 A;  2DQR A;  5FJ8 J;  3ZQC A;  4HST A;  1O57 A;  3H5A A;  4HV6 A;  4U88 A;  1X3Z B;  3LSG A;  4F91 B;  2HKX A;  1EF4 A;  2LR8 A;  4G7Z F;  1U8R A;  2FQ3 A;  2EV5 A;  2DPU A;  2H6C A;  3FXL A;  3DTE A;  2DMU A;  3ULQ B;  1YJN I;  2XAF A;  2NOG A;  1FEX A;  3QYF A;  1ULY A;  4DJA A;  3X2Q H;  4BY1 J;  4M73 A;  5LGN A;  1TTY A;  5KAI C;  3G1L A;  3OL4 A;  4HSR A;  4MTE A;  4WXH A;  2J5P A;  1BOA A;  2EFP A;  3CUQ C;  1MMG A;  4UVA A;  2MYS A;  3OYI A;  1FTT A;  4J01 A;  4CCJ A;  3HUG B;  4HPQ A;  2HS5 A;  3V4G A;  1QNT A;  1VTN C;  4BXU A;  3G6E I;  1UMQ A;  5H6Q A;  2K9S A;  4KIS A;  2NRA C;  2JTV A;  5D5W B;  2AQF A;  5LHH A;  5GAH J;  2P81 A;  2M9H A;  3LQR A;  2VBZ A;  2ZBK A;  1O7L A;  3A4C A;  3KE2 A;  4O5V A;  2DA3 A;  4Y4R A;  2KJC A;  1YX3 A;  3R61 A;  2VI6 A;  4ETS A;  3HRS A;  4JK1 X;  2MZ4 A;  2IT0 A;  4A2U A;  2L2O A;  3CMA I;  1HKT A;  2E1M B;  2PMU A;  1RZ4 A;  2LD5 A;  1ZRF A;  2DT6 A;  2DOF A;  2BGC A;  1QVT A;  3PNT A;  3HEF A;  4XID A;  2ESN A;  5HS7 A;  3FXU A;  1WJF A;  3K70 D;  2ETH A;  2CQN A;  3LL7 A;  4L0Z B;  1O3Q A;  3CDH A;  1TQP A;  4CDG A;  3OOU A;  2R0Q C;  1ERD A;  1OKR A;  2FNP A;  2HOT A;  4KYW A;  1Z7L A;  3F8C A;  1FSH A;  3J7A Y;  2K9M A;  2LTP A;  2V9K A;  2GLO A;  2DYS H;  2KLO A;  3BG9 A;  5IYD J;  1LFB A;  2LY9 A;  1FLI A;  4LOC A;  2B7E A;  4L0Y B;  3I9V 2;  4EJO A;  3QPS A;  1HW2 A;  2D1V A;  4AWX B;  5HLG A;  3LSJ A;  3SZG A;  2JA2 A;  3S1M J;  4CSW A;  1WSU A;  3S3O A;  3CCR I;  2OCE A;  3G1M A;  3J81 K;  2MC4 A;  1GHC A;  2M2E A;  1YW7 A;  1IG7 A;  3JRF A;  4U0V A;  4MNU A;  4DQ2 A;  2HVQ A;  5E3L A;  1LEB A;  3VEP A;  5DV5 A;  1MNE A;  5DM7 F;  2V6E A;  4X6A J;  4NHJ A;  1ZQ3 P;  3TQN A;  4LG0 A;  5J4Y A;  4DZJ A;  4HNV A;  3N05 A;  3PFI A;  2CW0 F;  3GO5 A;  1T98 A;  3F3X A;  1I3A A;  2PMH A;  3M8F A;  3J7A W;  2K40 A;  5M5X J;  2OZ6 A;  3LA2 A;  4A12 A;  3IC7 A;  4IRI A;  3WTZ A;  3KP2 A;  4UUT A;  3MKW B;  3FXJ A;  2BVM A;  2PMZ A;  3LSH A;  1SFU A;  1YIO A;  2B0L A;  2FU4 A;  2P8T A;  1FMW A;  3K4J A;  2R5Y A;  4C2U A;  2D5V A;  1OMI A;  2A68 F;  2KIQ A;  4UXN A;  4HQM A;  1DPR A;  1T38 A;  2FML A;  1SEU A;  3PUF A;  2OQG A;  1LE8 A;  2EIM H;  3AG3 H;  5FD5 A;  2JA7 J;  2OD5 A;  3PQK A;  2OC6 A;  1P7J A;  2ZXJ A;  4ABZ A;  3PIO F;  1K78 A;  4OOI A;  4E7I A;  4IX7 A;  4II2 A;  1ZH5 A;  3K2A A;  1IN7 A;  2VQL A;  3SFZ A;  3FXO A;  2VB6 A;  1E3H A;  1Q1V A;  3PNY A;  4XOP A;  5FO5 A;  3TO6 A;  2DA7 A;  5L3E A;  1YI2 I;  3IWF A;  5A2Q K;  1KGS A;  5JI6 A;  1N78 A;  2V6C A;  1IZ1 A;  4RLQ A;  2BOL A;  1XSV A;  3GTQ J;  3OYA A;  3TW7 A;  5DCM B;  1MMN A;  5F0H A;  4YEJ A;  1C0W A;  1RRJ A;  1MSF C;  2HXO A;  3GME A;  3E5U A;  2VJJ A;  1IXC A;  2UV1 A;  5F0C A;  2VAS A;  1AHD P;  2H1L A;  1OYI A;  2EJR A;  2XRN A;  4IL6 C;  2DYR H;  1PP8 F;  1OFC X;  2ZFW A;  1Y1W J;  4N9I A;  3KEQ A;  1HOM A;  1UFM A;  4HF2 A;  1MKM A;  3DKW A;  1FIA A;  3JSP A;  3HL2 A;  2JK3 A;  2K9Q A;  3PSI A;  4IJA A;  3A52 A;  1E2X A;  3CES A;  4B3A A;  2W00 A;  3BJ6 A;  1PJR A;  3IWZ A;  2O7O A;  1B1B A;  5E79 C;  1Q1H A;  2ZSI B;  3HRT A;  5A2Q R;  3VYR B;  2HTS A;  3IHU A;  1MMD A;  2K7L A;  2C6Y A;  2KT0 A;  1W7P B;  3JAM Z;  2VUM J;  5GTH C;  2DFI A;  4CZC A;  3CJT B;  1ZR4 A;  4FE7 A;  5CVI A;  1FMV A;  1R5H A;  5CJ9 A;  1HC8 A;  5EDN A;  1YS6 A;  4HF0 A;  4EV0 A;  1O4X A;  2IS2 A;  4RBO A;  5BQT A;  1TWC J;  1PYV A;  4UUS A;  4BBR J;  1EH7 A;  1G59 A;  4BEH A;  3RZO J;  3JR9 A;  1LVA A;  2V9P A;  2VLA A;  3KZZ A;  2HZT A;  5LRS A;  2OTJ I;  5LHI A;  1R4M B;  5ICF A;  5M5Y J;  1FC3 A;  2EB7 A;  1WJC A;  3W3C A;  1LJ9 A;  2WAE A;  3CO6 C;  1FIP A;  3P5J A;  2Y0M A;  1ZRD A;  3MKY B;  4AYB A;  5KHD A;  4LIV A;  2P0W A;  1X3W B; 
#chains in the Genus database with same CATH homology
 2YSR A;  3CLO A;  1FP1 D;  3H92 A;  2L01 A;  3ABU A;  2EV6 A;  4K2E A;  1HBX G;  1T2K A;  2IA0 A;  1QZZ A;  4YG2 F;  2XAQ A;  1UST A;  3EDP A;  3VFZ A;  4CGZ A;  4G6Q A;  1G3Y A;  5E17 F;  2CFX A;  2P5L C;  1QBJ A;  5K5R A;  3FX3 A;  1AOY A;  2VT2 A;  3Q9S A;  1R22 A;  3H3U A;  3D0S A;  3JTH A;  2BYV E;  4CIC A;  3F22 A;  4EGY A;  2RGV A;  1ZN2 A;  3O3K A;  1S29 A;  3E5Q A;  4RGX A;  3IRQ A;  3M7G A;  1H0M A;  3KFW X;  3GFM A;  3BOQ A;  3VOE A;  5FLX Z;  3CTA A;  4LLG F;  1QO0 D;  3RKW A;  4OMZ A;  2ACJ A;  3LST A;  4O6J A;  1XGS A;  5D4R A;  1EH6 A;  1Z1D A;  1F5T A;  1ZGA A;  3T5X A;  3HOS A;  2Z99 A;  3O6B B;  2O61 A;  3J80 Z;  3E6C C;  4I02 A;  2FRH A;  3MEX A;  4IVN A;  1YQA A;  5LRR A;  1I1G A;  4U0W A;  1ZAO A;  5DCM A;  4OMY A;  1O3T A;  2G7U A;  2PG4 A;  3KP4 A;  1DUX C;  1D5V A;  3QP5 A;  1HSJ A;  2O8X A;  3WU0 A;  3KZY A;  1P4A A;  4KUM A;  2EV0 A;  1UB9 A;  4PGH A;  1NHA A;  3J81 Z;  1OYY A;  3V8J A;  3GFI A;  3RPU A;  1W7P A;  4FX0 A;  1WRJ A;  4G6D A;  4EJT A;  2BV6 A;  3NQO A;  4BAY A;  3N97 A;  1GXQ A;  3FXR A;  3K9T A;  4OIO F;  4MQ9 F;  2CQK A;  1HW1 A;  4DNC A;  1PP7 U;  3E6M A;  1REP C;  2QLZ A;  3I4P A;  5DD4 A;  1V4R A;  1IN5 A;  1L0O C;  3F8M A;  4EM1 A;  2M1B A;  3H3Z A;  1MDM A;  5CLS A;  5BPD A;  4ZZD A;  2DPD A;  4KN7 X;  2XUB A;  1I5Z A;  1KQ0 A;  2STT A;  3KP6 A;  2ZME B;  3J80 K;  4RGR A;  3RPQ A;  4A0X A;  1XMK A;  3IL2 A;  3DV8 A;  3COA C;  4A0Z A;  3KCC A;  3I58 A;  3O2P E;  2V9V A;  1Z6R A;  1R00 A;  2VE9 A;  3B02 A;  1BJA A;  3MAJ A;  2Z3Y A;  1JE8 A;  4HYE A;  1ON1 A;  1BC7 C;  4IRG A;  4L9J A;  1HST A;  3K0L A;  2LKP A;  3EET A;  3V8L A;  2UZK A;  3LA7 A;  1DDN A;  5DUK A;  1SD6 A;  2DI3 A;  2KIF A;  4WX9 A;  2CGP A;  2EK5 A;  1I27 A;  3U9G A;  2QWW A;  5HLI A;  1TW3 A;  2KJB A;  3R4K A;  2EFO A;  1YYV A;  2WC2 A;  4I0B A;  4HF1 A;  2OAZ A;  5D5V B;  1FPQ A;  2V79 A;  4XLN F;  2MD5 A;  4ZH4 F;  2ZJ2 A;  2IA1 A;  3RJP A;  3DEU A;  4CYD A;  1FYM A;  2DU9 A;  5BMZ A;  4G7H F;  5D5X B;  5H20 A;  1TQM A;  3KP3 A;  2K86 A;  4YIF A;  3EQL F;  1FBU A;  2PN6 A;  2HWV A;  4ENK A;  2VBW A;  5HDN A;  2LSO A;  4L9N A;  1B9M A;  4LLN A;  2H6B A;  2FF4 A;  2O3F A;  4RS8 A;  4LD5 A;  4KIB A;  3MCZ A;  4M9S A;  1O7F A;  1FBQ A;  2YU3 A;  2IPQ X;  2GWR A;  2WWY A;  2H09 A;  2OBP A;  2RVC A;  3M8E A;  4EGZ A;  2FXA A;  2P6T A;  1V3F A;  3L9F A;  2MBF A;  1RIO H;  3RI4 A;  1B9N A;  1R36 A;  1S7A A;  5H6R A;  4UNO A;  4EQQ A;  3GF2 A;  1D8K A;  1Z7U A;  4IXA A;  2R3S A;  1EV7 A;  5LBQ A;  2GIV A;  4GCV A;  1S7O A;  3FMS A;  3C3W A;  4KT5 C;  2MLG A;  1J75 A;  3BPV A;  3GLX A;  1A04 A;  3ZQ7 A;  1LQ1 A;  1MDM B;  1CGP A;  1W5T A;  4XSZ F;  2OA4 A;  5EEG A;  3R60 A;  1FOK A;  5DUI A;  2R7F A;  3BY6 A;  2Q8K A;  2OU2 A;  4CO8 A;  3F8F A;  1ZRC A;  2L02 A;  2OQR A;  1G4D A;  1W4M A;  3L09 A;  3EUH A;  4LG0 B;  3NEU A;  1S6L A;  3BWG A;  2COM A;  1YO5 C;  2KRF A;  4P9F A;  4MHG A;  1KU7 A;  1J9I A;  4AIK A;  2YR2 A;  2F5E A;  1J7K A;  2Y48 A;  1F9N A;  1QZY A;  2K4J A;  4GXO A;  4KNY A;  1T6S A;  1W5S A;  1USS A;  2JSC A;  2A61 A;  5ERI A;  3Q9V A;  4M72 A;  1SAX A;  3K1P A;  3C1D A;  3I59 A;  1S8N A;  4TV7 A;  3F8B A;  5DCF A;  5HDG A;  3GXO A;  4RGS A;  1ONV A;  1XMA A;  4LMY A;  4XLP F;  1D3Y A;  3BDD A;  3E6D A;  2O6G E;  2HYF A;  4ESJ A;  2DT5 A;  5D5U B;  1K79 A;  3LQQ A;  1G3W A;  4L5J A;  2P5V A;  4IPA A;  1HQC A;  4MTD A;  1W7P D;  3F23 A;  3F21 A;  3SXY A;  2LDU A;  1P4W A;  2EFW A;  4OIN F;  1BC8 C;  1GXP A;  2F5D A;  2V1X A;  1JHH A;  4R1H A;  1ZYR F;  3CUQ B;  1I1S A;  2K4B A;  2FSW A;  5ILV A;  4HDU A;  1T39 A;  5LEJ A;  5LGT A;  3ZN0 A;  2KIU A;  2DK5 A;  1TW2 A;  3HUG A;  1JHF A;  4L18 B;  2IJL A;  2UXN A;  2PFB A;  2BE5 F;  2QQA A;  2G7H A;  1R23 A;  2F5C A;  2O03 A;  3IKT A;  1HKS A;  3T8R A;  1U5T C;  2FEZ A;  3I59 B;  4EJW A;  3WE2 A;  1BIA A;  3IKV A;  5KVR A;  4KDP A;  2CWE A;  1R1T A;  3L7W A;  2ZME A;  3DQV C;  4EM2 A;  5K5O A;  5D6F A;  2V1D A;  3GFJ A;  1BI2 A;  3FMR A;  2NNY A;  4WCG A;  4KMF A;  1SD5 A;  1HW5 A;  2A6H F;  1RI7 A;  4D0P A;  2GXB A;  1ON2 A;  4ZYE A;  3GZ5 A;  1XGN A;  5F6F A;  3TOB A;  1YLF A;  4BHC A;  1Y0U A;  2HKO A;  1XSD A;  3LAP A;  2GA1 A;  3WOD F;  3DF8 A;  1ZHF A;  2XRO A;  3U2R A;  2L54 A;  3WGG A;  3I64 A;  4PZJ A;  3CJN A;  1FNN A;  1UHW A;  4XRF A;  4HV5 A;  2MH2 A;  1U5T A;  5FFZ A;  5BPI A;  3FHZ A;  3MWM A;  4UUV A;  1EH8 A;  4H0E A;  4A6D A;  4Q48 A;  2E1N A;  4N0B A;  3HOT A;  3BRO A;  1HXD A;  5HS9 A;  3ZMV A;  2XKP A;  5DEQ A;  4ENN A;  3G3Z A;  2JT1 A;  2DTR A;  2Z5U A;  1SFX A;  1KYW A;  3KP5 A;  2LNB A;  4Y13 A;  2Z9O A;  4M6X A;  4NB5 A;  2A5Y B;  3P9K A;  3ZP5 A;  2QM3 A;  2XV4 S;  1ZLK A;  1JGS A;  1XB4 A;  4EMS A;  3KP7 A;  4LJZ F;  1R58 A;  5FFX A;  3ZN1 A;  1CF7 B;  4KMU X;  1FZP B;  3CUQ A;  3WU1 B;  3E3V A;  4L5I A;  3DFG A;  5BOX A;  2HYG D;  4EJU A;  4ON0 A;  1R7J A;  4Q4Z F;  4KA4 A;  3ML6 A;  1U78 A;  2M5W A;  2HQR A;  4RAY A;  4BH9 A;  3HYI A;  3RDI A;  1Z91 A;  5ICC A;  1LNW A;  1T0F A;  1OPC A;  1BM9 A;  1PUE E;  4M9X A;  2VC1 A;  1X3U A;  2IP2 A;  2YPR A;  3HSR A;  4I0A A;  3QU3 A;  1LB2 A;  2A69 F;  3EYY A;  1K78 B;  4BNC A;  2GQQ A;  3JTG A;  3DXJ F;  3TO9 A;  5L3C A;  5FLX K;  1O3R A;  3HHG A;  2XAJ A;  3DPL C;  1B6A A;  4HOB A;  3WGH A;  5CVR A;  3QOP A;  2CSO A;  3ZMD A;  5HDK A;  5JFR A;  4I09 A;  1J5Y A;  4N9H A;  4U0Y A;  4RAZ A;  4P5O A;  4XBF A;  4I01 A;  3FM5 A;  1KU2 A;  1YW9 A;  1BI3 A;  2QUF A;  2EFQ A;  2D45 A;  1STZ A;  4YII A;  2L4M A;  4Y15 A;  5HVQ C;  4GO1 A;  4I7H A;  3MZH A;  4YFX F;  1KQ9 A;  4Z2Y A;  4CZZ A;  1U5T B;  4A5N A;  2HOE A;  2H94 A;  3ROU A;  4LLL A;  2V1U A;  3Q5F A;  3WG9 A;  5L3D A;  1H9T A;  5ED4 A;  3F8N A;  2MLK A;  2XAS A;  1Z05 A;  3GEZ A;  2K02 A;  2W25 A;  3KEO A;  4IHT A;  3QPT A;  1J59 A;  2FE3 A;  5CVJ A;  2HGC A;  2YX7 A;  3BP8 A;  1HKQ A;  3LWF A;  2STW A;  2Z33 A;  5J8F A;  2DAO A;  2QEN A;  2QQ9 A;  4UHT A;  2DQL A;  1ZG5 A;  5D4S A;  3KLN A;  1BI1 A;  3SZT A;  5IT9 K;  3MFK A;  1SFE A;  2JPB A;  4ENM A;  5AIP A;  4MEY F;  3N4M A;  1YG2 A;  1LDJ A;  3G73 A;  3I53 A;  4B8X A;  3KLO A;  1IN6 A;  1Z6T A;  2RDP A;  2VBX A;  5D8K B;  2M45 A;  2A07 F;  3WTX C;  1IXS B;  5JHU A;  2E7X A;  3ERE D;  4FT8 A;  3V8K A;  2W84 A;  4IF4 A;  4LK0 F;  1B59 A;  3LA3 A;  4NQW A;  1K6O A;  3TOA A;  4AD9 A;  2FA5 A;  4FHT A;  4HX8 A;  4A6E A;  5LGU A;  1ZRE A;  4U7B A;  4CHU A;  2BBY A;  2RV8 A;  3WE3 A;  2E7W A;  1YTY A;  4AIH A;  4OIR F;  3BJO A;  1ZG1 A;  3W6J B;  3R0J A;  2XVC A;  3SZP A;  1IXR C;  3FZV A;  1ZGJ A;  3HIF A;  4I2O A;  5ILS A;  4CXF A;  3DP7 A;  5LLQ A;  1XGM A;  2W24 A;  3CUO A;  3V7C A;  1G3T A;  1U2W A;  4PGG A;  4QLC U;  2KKO A;  3SQN A;  1XGO A;  4GYG A;  1GVJ A;  3LAJ A;  1J0R A;  4L9V A;  1TLH B;  4WXD A;  1U3E M;  4FX4 A;  5L3G A;  3WTT C;  1H9G A;  6PAX A;  2BEO A;  1D8J A;  3RTR A;  2Q0O A;  2XAG A;  3ECH A;  4KN4 X;  2DBB A;  2DLL A;  2K27 A;  5HOO A;  5HLH A;  1WQ2 A;  4S05 A;  4LB6 B;  4HW0 A;  3I54 A;  2VE8 A;  4JQF A;  4UVB A;  2ZKZ A;  1WKM A;  2JZY A;  2ELH A;  2FBH A;  3F6O A;  3E97 A;  3RYP A;  3MZY A;  2QVO A;  1OR7 A;  2PEX A;  3VOD A;  1TQI A;  1G3S A;  2FBK A;  2UWM A;  2ZCW A;  3WTS C;  2D1H A;  2G9W A;  1KA8 A;  2NS0 A;  1QGP A;  3GUD A;  3CO7 C;  1Z9C A;  2GXG A;  2UXX A;  1FBS A;  3SHF A;  5E8I A;  3R6S A;  1RNL A;  4PCQ A;  4HLY A;  5ILU A;  2VON A;  3RIR A;  1L3L A;  1S3J A;  4HZF A;  5E8G A;  1ZAR A;  4QWQ A;  1O3S A;  4A0Y A;  2EWN A;  4O3M A;  4HLX A;  3T0Y A;  1XDS A;  5TJJ A;  2GA2 A;  1UCR A;  3ELK A;  4UVC A;  3LFK A;  3D5L A;  1B4A A;  2XGX A;  4R79 A;  1BIB A;  2FOK A;  2P4W A;  1RUN A;  1IUY A;  4HBL A;  5BS6 A;  2GZW A;  4WF2 A;  2ISZ A;  3FF5 A;  4A5M A;  3C18 A;  4GGG A;  1MD0 A;  5F1R A;  3P9C A;  4KIG A;  4KIF A;  3AAF A;  2P7C B;  4BQA A;  5HS8 A;  4M74 A;  5D6E A;  4LK1 F;  3QAH A;  4KFC A;  3JAM K;  1G6N A;  4XSX F;  2H27 A;  4YFK F;  4P9U A;  3T1B A;  1SMT A;  2VC0 A;  1MZB A;  1LDK B;  3T8T A;  3QPH A;  4BHP A;  5D8L B;  1MJ9 A;  4ENJ A;  3WTW C;  2L3D A;  2NYX A;  2P5K A;  5ICE A;  1TBX A;  2KIM A;  1IRF A;  1FYL A;  4R8H A;  2HR3 A;  4Y17 A;  2VT3 A;  2QQB A;  1KU9 A;  4ESB A;  2HDC A;  2RC4 A;  4LB5 A;  1MJA A;  3J7A O;  1FX7 A;  5AON A;  3BJA A;  3P7N A;  2PQ8 A;  4G9Y A;  3OV8 A;  3HRM A;  2RQP A;  2HFH A;  1XN7 A;  2DO7 A;  4L9T A;  3B73 A;  2NAZ A;  3M1E A;  4ESF A;  1YS7 A;  3ISP A;  4BHB A;  1IW7 F;  4LFU A;  2XKO A;  4KIC A;  1AWC A;  2R7D A;  3KET A;  4GYI A;  1TNT A;  3TGN A;  2E1C A;  4AIJ A;  2Q2E A;  1SMY F;  5FD6 A;  2GAU A;  1SD7 A;  2VOD A;  2EFN A;  1BBY A;  1ODD A;  2DK8 A;  5KK1 A;  4ZZL A;  2IVM A;  2TDX A;  4HX4 A;  3E5X A;  3WTU C;  4HAM A;  2RN7 A;  2YX4 A;  2A6E F;  4PDK A;  1WWX A;  1YW8 A;  1E17 A;  1XCB A;  5E1Z B;  1DPU A;  3IRR A;  5A2Q Z;  3ZMS A;  2MC3 A;  2ISY A;  1QPM A;  2OZU A;  1UHM A;  3WTY C;  4OIP F;  1XDU A;  3GX4 X;  2XIG A;  3P9I A;  4G8X A;  4RB1 A;  2QZ8 A;  4G7O F;  2PBI A;  4HA8 A;  3RKY A;  2D2W A;  4F7Z A;  4ZYG A;  2CG4 A;  4RB3 C;  1ZLJ A;  4BYY A;  3E6B A;  1XD7 A;  2VXZ A;  1F4K A;  2AXL A;  1P4X A;  3BPX A;  2VOP A;  3RKX A;  3GWZ A;  4EJV A;  4Q5S F;  4RGU A;  4P55 A;  4E70 A;  4OU0 A;  1FWZ A;  3C7J A;  5E18 F;  2F5F A;  2WV0 A;  3HSE A;  2ZNZ A;  2VOO A;  3DPT A;  3GYH X;  2XHK A;  3L2C A;  3PQJ A;  1MJB A;  1IN8 A;  2WTE A;  2FBI A;  3FM3 A;  4EM0 B;  5L3B A;  3GZ6 A;  3ZPL A;  1U6G A;  1LEA A;  3W6K B;  5JVT A;  3S2W A;  1XSX A;  1K7A A;  2A3S A;  3ZMU A;  5E20 A;  3JW4 A;  5LEK A;  2X4H A;  2W57 A;  1MGT A;  3EYI A;  1FYK A;  1OYW A;  5CYV A;  4Q47 A;  4MGR A;  4ASN A;  4M9Z A;  3HSF A;  2QBY B;  4HDV A;  1LDD A;  2JRT A;  3TKY A;  2EA4 A;  2HQN A;  2ZO4 A;  1CF7 A;  3TDZ C;  1KU3 A;  1FP2 A;  5K5Q A;  5FGM A;  2HEO A;  4AVP A;  3U1D A;  2J5O A;  4MEX F;  2IA2 A;  2ESH A;  2QYO A;  5K1Y A;  1WI9 A;  4ZYD A;  1F1Z A;  1BN5 A;  3GVA A;  3FMQ A;  2MH9 A;  4UV9 A;  3NRV A;  5DDG A;  3I0T A;  2M8E A;  3GFL A;  5E1X A;  1JXS A;  2VBY A;  2F2E A;  2FMY A;  4B09 A;  3HTU A;  4OIQ F;  4WXC A;  5E1W A;  3WTV C;  4M71 A;  3TDU C;  4G94 A;  1TNS A;  4RB0 A;  3QP6 A;  1P6R A;  5J8C A;  4WWC A;  3MQ0 A;  4YFN F;  3TO7 A;  2XAH A;  5L3F A;  3I71 A;  3K1M A;  4I98 B;  4HX7 A;  1DP7 P;  1YFH A;  2MA3 A;  3K2Z A;  1ZG3 A;  1XCV A;  3M9A A;  5DD8 A;  3REO A;  3RYR A;  4U7D A;  4S04 A;  1KQ8 A;  5TRD A;  1R5G A;  5ICG A;  5J6X A;  2RNJ A;  3BZ6 A;  2VN2 A;  3GW2 A;  4M6Y A;  3HHH A;  2P7V B;  5AIQ A;  2JPC A;  3V7R A;  1P92 A;  1IN4 A;  3QU6 A;  3HTS B;  2M30 A;  2PJP A;  2CYY A;  4ZYH A;  4IHS A;  2LF8 A;  3K1N A;  3K69 A;  2PI0 A;  2M87 A;  4MQV A;  1PDN C;  2RKH A;  3ZMZ A;  5CVV A;  3ZMT A;  2ADU A;  2PLY A;  4UV8 A;  2IRF G;  2W85 A;  2EA2 A;  1P2F A;  4WK8 F;  1BI0 A;  2ZNY A;  3WGI A;  4HQE A;  3OOP A;  2HTJ A;  3V7S A;  1RUO A;  2QBY A;  1I6X A;  3HRU A;  1R1U A;  1FSE A;  2CO5 A;  5EEH A;  5LHG A;  4EVI A;  3F72 A;  3FXQ A;  3ECO A;  4LGW A;  2IW5 A;  3FWE A;  3JSO A;  2NNN A;  1R1V A;  2L4A A;  3L00 A;  1J2X A;  1IAW A;  2O0Y A;  3VB2 A;  5DYM A;  2X0L A;  2DW4 A;  1KYZ A;  3ABT A;  5FB2 A;  4IRH A;  1FT9 A;  5CVU A;  4RB2 C;  3F6V A;  5IT9 Z;  4JBA A;  1IRG A;  2FNA A;  2LF7 A;  2P6S A;  3QRF F;  2Y75 A;  5F64 A;  3I5U A;  3R0A A;  2AS5 F;  1FY7 A;  1SD4 A;  4P96 A;  1QQI A;  5IT3 A;  1IF1 A;  2DQR A;  1O57 A;  4HV6 A;  4U88 A;  2HKX A;  4G7Z F;  1U8R A;  2FQ3 A;  2EV5 A;  2DPU A;  2H6C A;  3ULQ B;  2XAF A;  1ULY A;  4M73 A;  5LGN A;  1TTY A;  4MTE A;  4WXH A;  2J5P A;  1BOA A;  2EFP A;  3CUQ C;  4UVA A;  2HS5 A;  3V4G A;  1QNT A;  1VTN C;  4BXU A;  5H6Q A;  2NRA C;  2JTV A;  5D5W B;  5LHH A;  3LQR A;  2VBZ A;  2ZBK A;  1O7L A;  3KE2 A;  4O5V A;  2KJC A;  3R61 A;  4ETS A;  3HRS A;  4JK1 X;  2IT0 A;  4A2U A;  1HKT A;  2PMU A;  1RZ4 A;  1ZRF A;  2BGC A;  2ESN A;  5HS7 A;  3FXU A;  2ETH A;  4L0Z B;  1O3Q A;  3CDH A;  1TQP A;  4CDG A;  1OKR A;  2FNP A;  4KYW A;  3F8C A;  1FSH A;  1FLI A;  4L0Y B;  4EJO A;  1HW2 A;  2D1V A;  4AWX B;  5HLG A;  1WSU A;  3J81 K;  1GHC A;  1YW7 A;  4U0V A;  4MNU A;  4DQ2 A;  1LEB A;  3VEP A;  5DV5 A;  4NHJ A;  3TQN A;  4LG0 A;  3PFI A;  2CW0 F;  3GO5 A;  1T98 A;  3F3X A;  2PMH A;  3M8F A;  2OZ6 A;  3LA2 A;  4A12 A;  3IC7 A;  4IRI A;  3WTZ A;  3KP2 A;  1SFU A;  1YIO A;  2B0L A;  2FU4 A;  2P8T A;  1OMI A;  2A68 F;  4UXN A;  4HQM A;  1DPR A;  1T38 A;  2FML A;  2OQG A;  5FD5 A;  2OD5 A;  3PQK A;  2ZXJ A;  1K78 A;  4OOI A;  1ZH5 A;  1IN7 A;  3SFZ A;  5FO5 A;  3TO6 A;  5L3E A;  3IWF A;  5A2Q K;  1KGS A;  5JI6 A;  2V6C A;  1IZ1 A;  1XSV A;  5DCM B;  1C0W A;  3E5U A;  1IXC A;  2XRN A;  1OYI A;  2EJR A;  1PP8 F;  2ZFW A;  4N9I A;  3KEQ A;  1UFM A;  4HF2 A;  1MKM A;  3DKW A;  3JSP A;  4IJA A;  1E2X A;  3BJ6 A;  3IWZ A;  1B1B A;  1Q1H A;  3HRT A;  2HTS A;  3IHU A;  2C6Y A;  2K7L A;  1W7P B;  3JAM Z;  2DFI A;  5CVI A;  1R5H A;  5CJ9 A;  1YS6 A;  4HF0 A;  4EV0 A;  5BQT A;  1EH7 A;  1LVA A;  3KZZ A;  2HZT A;  5LRS A;  5LHI A;  5ICF A;  1FC3 A;  2EB7 A;  1LJ9 A;  3CO6 C;  2Y0M A;  1ZRD A;  5JR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...