1G3SA

Cys102ser dtxr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
212
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 64
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3sA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3sA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3sA03
2EA4A 2HGCA 2R7DA 4EM2A 2CO5A 3E6CC 1U5TC 3LQQA 1I6XA 2EV5A 2BGCA 1LNWA 3SFZA 5E8IA 2QZ8A 1SD4A 1KQ8A 4G9YA 1FSEA 1UB9A 5E8GA 1LJ9A 1HW1A 1FBSA 1O3RA 2ADUA 3MAJA 2DAOA 3QU3A 1KYZA 3RKXA 2JZYA 4RGXA 1IN8A 3E5XA 3J80K 1YW8A 2CSOA 5BPDA 4P9FA 1F9NA 4FX0A 2Z3YA 3FMRA 1J7KA 3LAJA 1QQIA 4GCVA 4PGHA 3CLOA 2ZCWA 1JXSA 1T2KA 3W6JB 2F5EA 3ULQB 2DBBA 2M45A 4YG2F 4ENKA 1GXQA 2H09A 5D4RA 5ICFA 3E5QA 2FMYA 4HYEA 4L18B 3LA2A 2J5PA 2M5WA 3JAMK 4EM0B 1STZA 4RAYA 2YSRA 5E1XA 3T8TA 5HDGA 2NS0A 4P96A 5D5VB 1J2XA 2H94A 4CO8A 2JTVA 1KU9A 2VN2A 2WV0A 4TV7A 2RVCA 3F8NA 4D0PA 3HTSB 2Y48A 3I5UA 3DQVC 2EFOA 2P6SA 1YFHA 1BC8C 3M7GA 3T8RA 4HW0A 3O3KA 2O61A 4AWXB 1HKSA 3HHHA 1K78B 5E18F 3KP5A 2VC1A 4P55A 4KIBA 2BEOA 5BOXA 3BOQA 5F1RA 5D5UB 3IC7A 5KK1A 1QVPA 5D6FA 4LFUA 2LSOA 2G7HA 1ZRCA 1YG2A 2HDCA 2PFBA 1ZG5A 3F3XA 2E7WA 3IWZA 5L3FA 5TRDA 3AAFA 1K78A 5LHGA 2XAJA 3DKWA 3L00A 5CYVA 4AD9A 1USTA 2M8EA 1FBQA 5HDKA 1ZH5A 4I98B 1R23A 1TQPA 4KIGA 1TNSA 1S7AA 2DQLA 3IWFA 2BBYA 4KA4A 1G3YA 3DEUA 1R1TA 2TDXA 1U78A 2HWVA 5IT3A 3RDIA 3HTUA 2JPBA 3DF8A 3R0JA 5LHIA 1XDSA 1XSXA 2FMLA 1FP2A 4XSZF 1OYYA 1ZRFA 3KLNA 5DEQA 5DYMA 4E70A 3WTSC 1T39A 2GA1A 3EQLF 5LGTA 1Z6TA 1FBUA 5D4SA 3I53A 2V1UA 4NHJA 1RNLA 4M6XA 2XV4S 2K5FA 4L9NA 1YYVA 3G3ZA 2P8TA 4I2OA 1HSJA 3GFLA 1LEBA 4EJVA 4UV8A 2C6YA 4U0YA 1I1GA 5L3DA 1XD7A 4UVBA 1BI3A 4PCQA 4DQ2A 2RC4A 1FOKA 3HRUA 1JHHA 1UFMA 3DV8A 5AONA 2XROA 2GZWA 1BIBA 2LNBA 2LF8A 4BXUA 3JSPA 1R22A 1WWXA 4RB3C 1KU3A 1MDMB 3QPHA 2L4AA 4M9XA 4M9SA 2CW0F 2BE5F 2KRFA 1SD6A 4Y15A 5DV5A 3WTZA 2Q2EA 2V1DA 2IT0A 1ZHFA 3WTVC 3KEOA 4GO1A 1LDJA 2RDPA 4LG0B 2ZNZA 3QP5A 3SZPA 2DPDA 1PDNC 3KCCA 1RIOH 3E5UA 3KP4A 4KFCA 1XB4A 5AIPA 2IP2A 3M8FA 2P5KA 1B59A 3I54A 2HOEA 2ZNYA 4HQMA 1I27A 4ENJA 2L3DA 3TO9A 4CYDA 4FT8A 4ESJA 3ZP5A 2CGPA 1HXDA 2JPCA 5JHUA 3R61A 4GYIA 2K5LA 1DUXC 3IRRA 1YO5C 2NNYA 2RKHA 4BNCA 2PMHA 2RGVA 1W7PB 1X3UA 3Q5FA 4MTDA 4CGZA 3ELKA 4HDVA 1XSDA 3ZMSA 5D5XB 4OMZA 4U7BA 4HLXA 4YFKF 3DXJF 4XLPF 3N97A 3RYPA 1BYMA 4N9HA 2HYGD 4UVAA 3K69A 4N9IA 3EYIA 4WK8F 4M74A 3WGIA 2YX4A 2FSWA 1W7PA 3K0LA 3GF2A 1B6AA 3L9FA 1EV7A 3RPQA 3M8EA 3BJAA 1IN5A 1XCBA 3FM3A 3IKVA 1O3TA 4NQWA 4BHCA 4KIFA 1C0WA 3CUQC 3QOPA 2ESNA 3CUQB 4MGRA 5K1YA 5ICCA 4HX7A 4JQFA 1YW7A 3T5XA 2MD5A 4I0BA 1VTNC 3TGNA 3Q9VA 2COMA 1OMIA 4ESBA 3TKYA 1RUNA 2IVMA 5LEJA 5HLGA 3BPVA 4MNUA 3H3UA 2EFWA 1BC7C 1FX7A 1O3QA 4OIOF 3CUQA 3OOPA 2FQ3A 3FF5A 3C18A 1HKQA 3TO7A 4B09A 4HQEA 3RI4A 2OZ6A 3MHXA 4L0ZB 1BJAA 1FZPB 4XRFA 2XASA 1FT9A 1B1BA 2G9WA 5F64A 1S3JA 4P5OA 2KJBA 1B9NA 1GXPA 4O3MA 1K7AA 4OIPF 4U0VA 3KEQA 2R3SA 2M1BA 2QBYB 3F8MA 2P6TA 1SD7A 3I71A 2VBWA 4BQAA 2MH9A 4EJOA 3ZMTA 4MQ9F 2PMUA 2PLYA 2ZMEA 3VFZA 2FBKA 1QZZA 2PG4A 4WXHA 1DP7P 4XSXF 4OINF 5DD8A 3GLXA 1Q1HA 1J9IA 3SZTA 3I59A 3ZPLA 1IXSB 1O7FA 4M9ZA 3RPUA 4L9JA 5ILVA 1I1SA 1P4XA 2NAZA 2HFHA 4UHTA 4I7HA 4CZZA 2VT2A 3EDPA 3W6KB 4L5IA 2RV8A 3LFKA 2VBZA 3K9TA 1KQ9A 5IT9Z 3N4MA 2FNAA 1S6LA 3KP7A 2X4HA 1G4DA 1XMAA 2LDUA 3R60A 2KIMA 4A0YA 2D1HA 2KIFA 4IRHA 3P9IA 5FD5A 3I0TA 3KE2A 1O7LA 3GWZA 2NRAC 3LAPA 3CO7C 2GAUA 1YS7A 4LD5A 4HBLA 2F5CA 1SAXA 5L3EA 3ZN1A 1K6OA 1PP8F 4EVIA 2QM3A 1UCRA 1ZARA 4GGGA 5DDGA 1FP1D 1LEAA 3F8FA 2XAGA 1OR7A 3C1DA 4U0WA 2V1XA 4ZZLA 1MJBA 3J81Z 2IA2A 4L0YB 4HDUA 2E7XA 2O3FA 3ABUA 1UHWA 5A2QZ 1TNTA 4IPAA 2L01A 3H92A 2XRNA 3ERED 1HSTA 3VB2A 3DPTA 2VBYA 2QQAA 2Q8KA 1H0MA 1D8JA 2CFXA 3ZMUA 3JTGA 1O57A 2EV6A 1IN6A 4EMSA 1XN7A 3U1DA 3D5LA 1MKMA 3U2RA 2DT5A 4M73A 3WU0A 5CVJA 2PBIA 3I4PA 3E19A 2QENA 3E3VA 5LBQA 1I5ZA 3G73A 3JTHA 2A07F 5K5RA 3GFJA 1USSA 4BHBA 2ESHA 3FM5A 1ULYA 4G7HF 1DPRA 4ENMA 1R00A 2P7CB 4Q48A 4RGSA 3WTYC 2ACJA 1BN5A 2EV0A 1OYIA 1ZGAA 2DTRA 5BPIA 4GXOA 3L09A 5EEGA 1IUYA 2PQ8A 3CDHA 1WKMA 3WTTC 2OD5A 4IHTA 2HQNA 4OMYA 1FYKA 3ABTA 4ASNA 4KT5C 2H6BA 3TOBA 3TOAA 4HV6A 1FC3A 3LA3A 2VC0A 4UXNA 4HF1A 1RZ4A 2HQRA 2L54A 2XHKA 4GYGA 3WU1B 3B73A 1XGSA 2MC3A 4IF4A 2JT1A 1XMKA 4OIRF 3P9CA 1KYWA 1QW1A 1S7OA 2EJRA 1NHAA 1G3TA 2L4MA 4O6JA 3IL2A 2M30A 1KU7A 1ON1A 2X0LA 3K2ZA 4RGRA 3GVAA 3MCZA 1JHFA 3ISPA 3RTRA 2PEXA 4LJZF 1SD5A 1WSUA 3FXRA 4ENNA 1ZLKA 1J75A 1EH8A 1U3EM 2VODA 4HZFA 4A5MA 2R7FA 2FRHA 1W5SA 4LB5A 2K4JA 2QVOA 5ERIA 3F23A 4RS8A 2CQKA 3J80Z 5DUIA 1ZLJA 3HSFA 3GX4X 1YTYA 1IXRC 3HSRA 1RI7A 3QAHA 1D8KA 5H20A 2FF4A 4P9UA 4WX9A 1R58A 2E1NA 3TO6A 2XGXA 1LVAA 2QQ9A 2A61A 5TJJA 2HZTA 5FLXK 4Y13A 3KETA 3F6OA 1JE8A 1Z1DA 3FHZA 2CYYA 4Y17A 3JAMZ 2ELHA 2CWEA 3GFIA 3NQOA 2FE3A 3QPTA 1H9TA 2D2WA 1MJAA 4YFXF 1QPMA 3FXQA 1TQIA 1UHMA 3TQNA 1IN7A 1ZGJA 2A6HF 2P5VA 2ISZA 4HOBA 1QBJA 2IA1A 2EFNA 5CVUA 1SMTA 1FPQA 1ZN2A 2DFIA 5CLSA 3BP8A 3CJNA 5FGMA 2HEOA 4MEYF 3GO5A 3HYIA 4RB0A 1BI2A 4L9TA 2H6CA 3V8KA 1T98A 1T38A 4RB1A 3R4KA 1CF7A 3COAC 2V9VA 3CTAA 3T0YA 5AIQA 1D3YA 4R79A 4UVCA 1LDDA 1YLFA 1E17A 1ZG3A 2VBXA 5HS7A 3GZ5A 3DPLC 5D8LB 3E97A 1IF1A 2W57A 4HV5A 3FMSA 1FSHA 5ICEA 2IW5A 3WGHA 2VOOA 2Q0OA 3EUHA 2YR2A 4IRIA 4HLYA 4WF2A 2GIVA 3TDZC 3SXYA 4Q4ZF 3HOTA 2FOKA 1HQCA 2KJCA 2RN7A 2ZJ2A 1KQ0A 2OQGA 3PFIA 1XGOA 2PN6A 4ZH4F 3HUGA 4IVNA 2OU2A 5BMZA 2AXLA 2BYVE 4YIFA 5ILUA 5FD6A 2Z5UA 1R1VA 4OOIA 1L3LA 1MGTA 4BH9A 3GZ6A 1S8NA 3R0AA 2OA4A 2D1VA 4HAMA 1QO0D 1KU2A 3WE3A 2Z33A 4YIIA 4ETSA 3U9GA 2Y75A 4HF0A 1RUOA 3B02A 2EA2A 2DLLA 2HTSA 3P7NA 4HF2A 1BOAA 4F7ZA 4S04A 5JVTA 2EWNA 4HA8A 3GUDA 1P4AA 2NNNA 4L9VA 2XAFA 4JK1X 2K5IA 2XKOA 3WTXC 4I0AA 2P5LC 5EEHA 5FO5A 3GW2A 2GQQA 2ZBKA 3KLOA 1F4KA 2JSCA 1F1ZA 4L5JA 4ZYDA 1K79A 2A5YB 1JGSA 2ZMEB 2JRTA 3IKTA 3BY6A 2HTJA 1IRGA 3OV8A 4QLCU 4Q5SF 1TLHB 2EB7A 3ZMDA 3GXOA 2GA2A 1Z91A 1TTYA 4DNCA 3F8BA 3I59B 5LHHA 3WODF 2LX9A 2ZKZA 2UXXA 1IN4A 4EQQA 5HLHA 4FX4A 2HS5A 4K2EA 2FNPA 1B4AA 2D45A 4EJWA 2Z9OA 4LK1F 3ML6A 1ODDA 3BROA 4CXFA 3KZZA 4EV0A 2F5FA 3NEUA 2IRFG 1LB2A 5LGNA 3L7WA 1P2FA 4OIQF 2J5OA 5DUKA 2XVCA 2H3JA 4AIKA 3KP6A 3MEXA 3MWMA 4KNYA 1EH7A 2P7VB 2WTEA 1HW2A 2K7LA 2KIUA 2HR3A 3SHFA 5L3GA 2W85A 4I02A 1QNTA 2KKOA 5FB2A 4LK0F 1AOYA 2A3SA 3FMQA 3JSOA 1SFUA 5DCMA 1REPC 3BJ6A 3FX3A 3I58A 3J7AO 3WG9A 1CGPA 1FWZA 4KMUX 1OKRA 1U5TB 2VT3A 4NB5A 3T1BA 3LSTA 2HKXA 5ICGA 4S05A 4MTEA 1XGNA 2M87A 1T0FA 2F5DA 5HS9A 4XLNF 2HKOA 2DQRA 4O5VA 2IPQX 2A68F 2MBFA 3SQNA 5JI6A 3WTWC 2P4WA 4A6DA 2DK8A 2K4YA 4G6DA 3F72A 2BV6A 1OPCA 3ZN0A 5DCFA 2VXZA 1U6GA 4WXCA 1FYLA 1U5TA 2K02A 2QUFA 3ROUA 1V3FA 1YIOA 5HLIA 4AIJA 3LWFA 1SFEA 3MZHA 4G6QA 2L02A 1FY7A 2O03A 1DDNA 1P4WA 5ILSA 4R8HA 1IAWA 1OYWA 3BJOA 3K1NA 1WRJA 1YQAA 2XUBA 2LF7A 4MEXF 2O8XA 4A6EA 2STTA 1Z7UA 1KGSA 3F8CA 5J6XA 3FZVA 3KP3A 3F21A 5LLQA 5F6FA 4KMFA 1XSVA 2DU9A 3HRTA 1ZREA 4Q47A 4CDGA 2ZXJA 3V4GA 3RYRA 3BZ6A 2HYFA 1EH6A 1IRFA 3VOEA 4ZYEA 2NYXA 3WE2A 3P9KA 1R36A 1IW7F 3E6BA 4HX8A 4CHUA 2MH2A 1PP7U 1IZ1A 5CVRA 1F5TA 5D8KB 1W4MA 5KVRA 5HOOA 4ZZDA 1J5YA 5J8CA 5LRRA 4EJUA 2CG4A 1ZAOA 3GFMA 2ZO4A 6PAXA 4FHTA 4IHSA 2FBIA 1B9MA 4A12A 1G6NA 1HBXG 5CVIA 4H0EA 4AVPA 1ZRDA 1BBYA 2YU3A 3F22A 1Y0UA 4EGZA 2DPUA 3JW4A 3BDDA 3MZYA 1SMYF 5LEKA 2GXBA 4IRGA 1TW2A 4UNOA 4IXAA 2FU4A 2EFPA 4AIHA 5FFXA 1O3SA 1YW9A 4I01A 3HRSA 3RJPA 1D5VA 2G7UA 1FLIA 1IXCA 4KYWA 3NRVA 2MLGA 3KP2A 1G3WA 2VOPA 5K5QA 5HS8A 2Z99A 3D0SA 4KICA 3EETA 1XDUA 2K86A 3DP7A 4UUVA 3O2PE 1A04A 1BI0A 3LA7A 3C7JA 3KZYA 4ZYGA 1R7JA 4KDPA 4G7OF 3V7CA 5HVQC 4U7DA 1W5TA 3R6SA 4OU0A 4BYYA 2YX7A 1LDKB 1P6RA 3WGGA 5E20A 1V4RA 2GCXA 5D5WB 4PZJA 5JFRA 2XKPA 1XCVA 1BM9A 1HW5A 5FFZA 3V8LA 5L3BA 2GWRA 2DK5A 2VONA 1WQ2A 4RB2C 1CF7B 2WWYA 1R5GA 3HSEA 4EM1A 2MA3A 1HKTA 3QU6A 5LGUA 2ZFWA 3DFGA 2UWMA 1FYMA 5H6RA 5K5OA 1ZG1A 3PQKA 1PUEE 3GEZA 4G8XA 3HIFA 3V8JA 3O6BB 2W25A 3V7SA 1SFXA 3IHUA 1MDMA 2QLZA 1QGPA 3VEPA 2OQRA 2RNJA 3M1EA 4KUMA 1R1UA 2FA5A 1U8RA 5CJ9A 1LQ1A 1ZYRF 4MQVA 5BS6A 4A2UA 4M72A 4N0BA 4BAYA 4U88A 4Z2YA 3VODA 3BPXA 5LRSA 2MLKA 4LG0A 4LLLA 4RGUA 1YS6A 3S2WA 4IJAA 4LB6B 2GXGA 2WC2A 1AWCA 4G94A 1W7PD 2K4BA 3IRQA 3V7RA 2FXAA 4LLNA 3F6VA 4KN4X 3WTUC 4G7ZF 2YPRA 4ESFA 4A0ZA 5IT9K 1T6SA 4CICA 5ED4A 5J8FA 1BIAA 1XGMA 4BHPA 4WCGA 1MD0A 3E6DA 2DW4A 4HX4A 2QQBA 5L3CA 2ETHA 3FWEA 2O6GE 3RKWA 1R5HA 1Z6RA 2FEZA 3FXUA 3ZMVA 4UV9A 1Z9CA 4RAZA 5FLXZ 3ECOA 4MHGA 2ISYA 3REOA 3CO6C 1G3SA 1J59A 3M9AA 2V79A 2UZKA 3GYHX 2V6CA 1QZYA 3PQJA 2XIGA 4A0XA 3L2CA 1ON2A 3K1PA 5E17F 2UXNA 2EFQA 2OZUA 4LLGF 2QWWA 3MQ0A 1GHCA 3J81K 3CUOA 2LKPA 2OBPA 3LQRA 3MFKA 4LMYA 2Y0MA 5D6EA 3RIRA 2W84A 5A2QK 2E1CA 2IJLA 4ON0A 3QRFF 1P92A 2XAHA 2H27A 3QP6A 3Q9SA 4WXDA 2VE8A 3HRMA 4R1HA 4ZYHA 3HHGA 2B0LA 4JBAA 2DI3A 2RQPA 5DD4A 4EGYA 4M71A 5HDNA 2XAQA 1E2XA 2EK5A 5CVVA 4PDKA 2PJPA 1TBXA 3EYYA 5E1ZB 2STWA 5H6QA 2OAZA 3ZQ7A 1FNNA 3ZMZA 1J0RA 5BQTA 1S29A 2VE9A 4PGGA 2DO7A 1WI9A 1L0OC 3H3ZA 3HOSA 2F2EA 4I09A 2QYOA 3C3WA 4LGWA 4QWQA 5DCMB 1BI1A 1GVJA 3ECHA 4KN7X 3TDUC 4A5NA 1DPUA 2FBHA 4XBFA 3I64A 1MZBA 3K1MA 2A6EF 4WWCA 2AS5F 2IA0A 1KA8A 1TW3A 1ONVA 5JR3A 1TQMA 4EJTA 1H9GA 4YFNF 1MJ9A 3BWGA 2QBYA 2O0YA 5E1WA 4B8XA 1Z05A 3RKYA 1U2WA 4M6YA 2A69F 2W24A 3E6MA 2PI0A 2K27A 3KFWX
chains in the Genus database with same CATH superfamily
1IJWC 3VYHB 3MKLA 1K73U 4C5EA 2EA4A 2HGCA 2R7DA 4EM2A 2CO5A 2KDZA 2IS1A 1E0EA 2EH3A 3E6CC 3PVQA 4FYVB 1YI2T 2YUSA 2B63J 1U5TC 1RAAB 1X75C 5GADJ 2AZVA 3LQQA 3TW6A 1I6XA 1NLPC 4F52A 2EV5A 4MO7A 2BGCA 4PJ0C 4XN3A 2LKXA 2ELJA 2ZAEA 4XKVA 1LNWA 3SFZA 5GTHC 2PVDB 2M02A 1M2VB 5IHKA 2EVRA 5FROA 5LL6S 1BKBA 3S3MA 3ZR8X 3JCMV 4ATOA 5E8IA 4LNPA 1T95A 1QVFP 2LQKA 1V54H 2QZ8A 4AVZA 1YX3A 5FRNA 3CCUT 4XLCA 2B9SA 1W2BS 2SRCA 1SD4A 1KQ8A 2XC7A 1JJ6C 4G9YA 3HDDA 1FSEA 4M7DC 1UB9A 4FASD 4OWRB 5E8GA 2NVTJ 2P0WA 3A8OB 4M7DB 1WXUA 1LJ9A 1JRIA 2SEMA 1HW1A 1FBSA 4BGDA 4ZYAA 1PNJA 3EAEA 3OBWA 4FT4A 1O3RA 3EFSA 2ADUA 3M54A 4M7DD 3FXOA 4GRIA 5A0DA 3CCMQ 2KDOA 3MAJA 1TWCJ 2DAOA 1TT0A 3M56A 4FE4A 2CKKA 3PNWC 3QBYA 3QU3A 2DXUA 1KYZA 3PMTA 1N8RU 3RKXA 5JLXA 2JZYA 2W48A 1F1BB 1PSEA 2CH4A 2DXBA 4RGXA 4UB8C 1NYGA 1PCXA 2MOXA 1K9MR 1IN8A 1X58A 3E5XA 3J80K 3OYJA 4Y52J 2G6FX 1TWGJ 2PZ1A 2O9LA 1YW8A 2CSOA 2LC2A 5GPAA 4E7JA 5BPDA 1VIFA 2LT4A 1YJ9I 4P9FA 5M5YJ 2JK3A 1F9NA 2VIXA 4FX0A 1KIKA 2Z3YA 3OSVA 3K6GA 2QA4I 2LREA 3FMRA 2FJ1A 1W2BP 3NWSA 2DIGA 1J7KA 3BG7A 3AG3H 5EZHA 3LAJA 2JZ2A 1FXXA 4N0AA 1QQIA 2EYYA 2EGEA 2FPEA 4RAGA 1NH3A 1WJBA 3H0IA 3PUBA 1EA3A 4GCVA 4PGHA 4ABZA 3CCUI 2M0OA 3JCMW 5GMKm 1JJ2S 2Q1ZB 3CLOA 2ZCWA 2VC8A 1JXSA 1T2KA 3GTLJ 2K6DA 2E1MC 3W6JB 3FB9A 2O31A 1C1AA 2V1RA 4DZJA 4HCKA 2E1MB 4A54A 4FYXB 4M7DA 2F5EA 3ULQB 2DBBA 2M45A 4YG2F 3JRFA 4ENKA 5KYUA 1GXQA 3UA7A 3G6ET 1OJLA 5KE3A 2H09A 2HI3A 4AMCA 5D4RA 1HF0A 4HSTA 5ICFA 4J19A 3E5QA 2QSHX 2FMYA 1PUFB 5GP9A 1I50J 4HYEA 1IB8A 2L3RA 4L18B 4WCIA 3LA2A 1MHNA 2J5PA 2DA2A 5CQGA 3PL8A 2M5WA 1X6OA 3JAMK 1YHQT 4EM0B 2GTOA 3LL7A 2GOXB 1STZA 2I8DA 4RAYA 3H9NA 5EYRA 5B1AH 4IOCF 2ICWG 2V1NA 3GTOJ 1OQKA 2ZPFB 5HNFA 2CV1A 2GNCA 2JVVA 1H8KA 1NJIR 2YSRA 5E1XA 1CKAA 3WVEB 4JJNK 3T8TA 1JJ2P 2EBPA 5GAOm 3EHQA 4E7ZA 1LKXA 4BACA 3MEAA 5IHNA 2LD5A 5HDGA 2NS0A 4KISA 2HQHA 4P96A 2RQRA 2XICA 5D5VB 1J2XA 3CCRI 2KR3A 4OB3B 1YITA 2L5QA 1XG1A 2H94A 2K85A 4CO8A 2NLUA 1YJ9Q 2JTVA 1KU9A 2VN2A 3ONQA 2WV0A 3Q3SA 4X34A 4TV7A 2DA7A 3CPWS 2QA4Q 2RVCA 3ABMH 2DBKA 5J3BA 1YNZA 3CBMA 2CQNA 3TQ7P 2F4IA 3F8NA 4D0PA 1QWEA 1Y1VJ 3HTSB 5CO7A 1I81A 2WV1A 2DFUA 3HKSA 3M9QA 4M78C 2D1XA 2Y48A 3BG6A 3I5UA 4XK4A 1PUFA 1JKQC 1LE8B 4M78B 3DQVC 4ELYC 3CCUQ 1DQUA 2VYTA 4BE2A 2DA4A 3CD6I 4OGCA 2EFOA 5HK3A 3JB9H 2P6SA 1YFHA 1BC8C 4AM3A 2ATCB 4E47A 3FDRA 3M7GA 4BDZA 1YHQI 1U1TA 3K70C 2P0QA 4C92G 3T8RA 4HW0A 4KT6A 3O3KA 2O61A 2AT1B 4AWXB 1VQPT 4XLEA 1VQ4T 1HKSA 4FW2A 2X3WD 4RKUE 2Y0SN 2K7AA 3HHHA 2EZHA 4F55A 1K78B 2HSEB 4C3IJ 5E18F 2PVGB 3KP5A 3EFOB 2VC1A 2JVGA 4Z02A 1LPQA 2MMPA 2W00A 1A6IA 4MZPA 1Q95G 3MMYB 4QSHA 5KCMA 1SEUA 2CV2A 3SZGA 4P55A 2VUBA 2QQ8A 4RMOA 2RM4A 1VQ9I 2JS2A 4XM3A 4KIBA 2BEOA 1H88C 5BOXA 1KQ2A 2H1KA 3BOQA 2CYZB 4IUTA 1HDDC 3J7AW 4LUDA 2VQHA 5GANj 1VQ6T 1ZELA 5F1RA 2NS7A 5K7ZA 5D5UB 3O8GA 2W7NA 4C8QE 1NM7A 3IC7A 5J40A 5KK1A 1QVPA 4LE9A 5IP7J 3BQYA 2Z1DA 5D6FA 4LFUA 4IKFA 1K1ZA 2DZ9A 3S32A 4PLLA 3VS4A 4WTOB 4RTTA 2LSOA 3CCRQ 2G7HA 1ZRCA 1XTDA 2R7XA 1WJQA 1YG2A 2YLCA 2HDCA 2OX7A 2DD5A 4C30A 1YJNT 3TREA 2PFBA 1I3QJ 1ZG5A 3F3XA 4DEYA 2OJ2A 1JI8A 2E7WA 3IWZA 5L3FA 1Z9QA 2WACA 3VSKA 1VQPI 3OBYA 5LJ5g 5TRDA 1I8FA 2JUCA 3AAFA 1K78A 5HK0A 5LHGA 2KP6A 1VUBA 2XAJA 3DKWA 5KAIC 3L00A 5CYVA 3EFOA 3E9FA 4B6MA 1I39A 1U8BA 1UGVA 2CP2A 2HZDA 1MH4A 3PNYA 4P1WA 4AD9A 1USTA 2M8EA 1FBQA 2P0TA 5HDKA 1OZ2A 4DBRA 2C0IA 1VF9A 1ZH5A 4I98B 3OYDA 5GMKh 1R23A 1YHQQ 2QCOA 4IEJA 5C44J 2RO0A 1WHUA 1TQPA 2F1LA 3RMQA 5GAN5 2V26A 1BW6A 2BZYA 4KIGA 1GL5A 5KH6A 4LXCA 1TNSA 2D8HA 1S7AA 2DQLA 2KDSA 1E3OC 3M57A 4J9CA 4Y28E 3IWFA 3KEYA 2BBYA 4KA4A 1UAAA 3FXMA 1G3YA 3DEUA 2WAQA 3FXLA 1R1TA 4M3EA 2ENMA 2RJFA 2TDXA 4C9YA 1UGPB 4J6XA 1U78A 4K11A 1VQ9Q 1SRLA 3M55A 2HWVA 5IT3A 4LN2A 1K0XA 3RDIA 3HTUA 1CKBA 1M1GA 1W70A 4ZGEB 2JPBA 3K4LA 4U87A 3G1JA 3MEWA 3DF8A 3R0JA 5LHIA 1D1AA 3LSPA 2J7IA 4MDWA 3M59A 5JLWA 1XDSA 1XSXA 4J9HA 2FMLA 4DBFA 1FP2A 3M1CA 1OYYA 4XSZF 4BQOA 1ZRFA 2P0PA 5IHIA 4C0DC 3CCVA 3KLNA 4F3QA 2JTFA 3QUIA 4C0DB 5DEQA 5DYMA 2DOEA 2WY8Q 4E70A 4HVUA 3WTSC 4JS4A 1T39A 2GA1A 3EGDB 3JRZA 3EQLF 1M90U 5LGTA 5C0MA 2QTVA 1Z6TA 1FBUA 4LDXA 2M0MA 5D4SA 2DJQA 3I53A 4HT9A 3H0DA 1VQPQ 1SANA 1CSKA 1LFUP 2V1UA 4NHJA 3CP2A 2IS4A 4IUVA 5B5EC 3REBB 4M7AE 5EF6A 2KY9A 1RNLA 4M6XA 2D9TA 2XV4S 2K5FA 1S72A 4L9NA 3TW7A 1B72A 4MZMA 1R77A 3EPZA 1K73R 3SEQA 1YYVA 1QU3A 3G3ZA 1KQ1A 2P8TA 4I2OA 3B6AA 5CR2A 3G4ST 1HSJA 3GFLA 3OS2A 3S1RJ 1R49A 3QWYA 2A5WA 3SEMA 1LEBA 1WHJA 1Z77A 2EZLA 1T0JA 1NG2A 5GAOl 5J1UA 5IYBJ 3DBHB 5M5WJ 1Q81R 4EJVA 1W36D 2OTJQ 1PD0A 1GFDA 2Y2ZA 4UV8A 2C6YA 1ZQ1A 3CQZJ 4U0YA 2M8GX 1I1GA 2HXOA 5L3DA 1XD7A 4UVBA 3HGYA 3GTGJ 1QVTA 3ZFJA 2JUFA 2DMNA 1BI3A 1K61A 2H3EB 5CKTA 3QPLA 4BI8B 1HCRA 1YCYA 4LG3A 4PCQA 5FLXE 1B8IB 4DQ2A 4M77C 5KYWB 3G71T 1OPKA 5IP9J 4M77B 3A0HC 2RC4A 2XPVA 2WADA 2KPMA 2L0KA 3M8JA 1FOKA 2O8KA 3HRUA 4N4NB 1JHHA 1WI7A 1VQ5A 1YJWA 1X3WB 1UFMA 4LIVA 1Z9ZA 4GY5A 3GTMJ 3DV8A 5AONA 2XROA 5KCOA 1I5OB 2DTHA 4FL6A 2PJRB 1NK2P 2HQEA 2GZWA 1ZUUA 2K57A 4LDUA 1BIBA 2LNBA 2LF8A 4BXUA 3G4SI 5GPCA 1R22A 3JSPA 1WWXA 1BL0A 1V5FA 2FZGB 1TSFA 2QDLA 4RB3C 1KU3A 1MDMB 1RR7A 3QPHA 3QQAA 2P81A 2L4AA 4M9XA 3PVLA 4M9SA 4UB6C 4CZCA 2CW0F 2HL5C 1IGUA 1UFFA 4XOTA 1UDLA 3JSCA 2BE5F 2KRFA 1SD6A 4Y15A 1SHGA 2NVUB 5DV5A 3WTZA 4JOMA 2Q2EA 2V1DA 2CREA 4BY6C 1Q7YU 2IT0A 1VQ8T 1ZHFA 4BY6B 2RHXA 2F6CA 1B8IA 4OP0A 2YUPA 2R7UA 1SC7A 2HL3A 3G71I 5KYWA 3SB2A 1IO6A 4M77A 4NL2A 3AT1B 2GM4A 1J09A 1TWHJ 3OYLA 3P8DA 1Y6IA 3CJQB 2HCKA 1I5LA 1UTIA 4IHVA 1XOVA 4HNTA 1Q86R 3WTVC 4Q5WA 2CQ7A 1ZKGA 3KEOA 3HKZN 2PNIA 2M4GA 1LDJA 4GO1A 5M3FJ 1O9SA 2RDPA 4LG0B 5CQEA 2RK1A 2ZNZA 4J8OA 3QP5A 3SZPA 1IC8A 1POGA 1XMXA 1Y8QB 4I99C 1PDNC 2DPDA 3KCCA 2QAZA 3H0HA 1X2QA 1RIOH 2DA1A 3E5UA 1W1FA 3KP4A 2IGOA 1BBZA 4KFCA 3QO3A 1XB4A 2VJJA 2M0CA 1UGQB 1VQLA 5AIPA 2IP2A 3QYBA 4XORA 3M8FA 3PSIA 4NUBA 5CQYA 5IAYA 1S5LC 3ZQHA 2P5KA 4M7DE 1B59A 2Y9YA 2V9PA 4M75C 3I54A 1DJ7B 1MUZA 4M75B 2BHZA 2HOEA 3FXJA 2CZ7B 4ZGJB 2ZNYA 2M7AA 1I27A 4HQMA 1OCOH 1WXTA 4ENJA 3JCMP 2RI3A 2L3DA 4M75D 3TO9A 3HSBA 1UECA 4CYDA 4FT8A 1S1NA 2F5KA 3G4SQ 1KQSS 3HOVJ 2RHUA 1ERDA 2Z16A 3LSRA 4ESJA 4VUBA 2EYWA 3ZP5A 1UHCA 1PRMC 4DEXA 2CGPA 2EIFA 1HXDA 2K9GA 5LJ5j 2VQGA 2GFUA 2JPCA 2DX1A 5JHUA 2IXSA 3R61A 5E79C 4MZTA 5FWCA 4OB2B 2ZXHA 4GYIA 5IYCJ 1PHTA 3TBIA 1DUXC 2K5LA 5HY6A 3IRRA 1P9QC 5IT9R 4JRPA 4OAZA 2VKEA 1YO5C 1ZR4A 2LNHB 2NNYA 4LUEA 2RKHA 3HBLA 4C2UA 2JTEA 3HTRA 4C92C 4F7UF 2HVQA 2K3PA 4YRVA 4BNCA 2PMHA 2RGVA 4C92B 3G71Q 1Y8RB 1W7PB 2MVTA 1X3UA 2WB1A 4C92D 3I56A 3QG1A 3Q5FA 3L42A 4CCOA 4XQFA 2XSDC 2M16A 2OI3A 1KQSP 3GTKJ 4MTDA 3C12A 4CGZA 2NXNB 3ELKA 4M75A 4HDVA 3GTQJ 1SKUB 3C2HA 3I3LA 3W2WA 1XSDA 3ZMSA 5D5XB 2CP6A 3HOZJ 2BOLA 2EGCA 1K9MC 4XMYA 3H8ZA 2CUFA 3AG2H 4OMZA 3WG7H 4U7BA 3EFRA 3RDVA 3HJEA 4C5IA 3HFNA 4HLXA 5IOYA 1AHJB 2EYQA 4YFKF 2XDVA 2CP7A 3DXJF 2LTOA 4XLPF 3N97A 3RYPA 2XF6A 1UHFA 1E6HA 5LD2C 1BYMA 4N9HA 2NWMA 3S17J 2L0AA 3NHNA 1I3AA 4EMHA 2HYGD 2DXIA 2M1HA 3OMYA 3SWNA 4UVAA 3K69A 4BU2A 2MIOA 4N9IA 1A35A 1KHCA 5KYYA 3FBNB 3EYIA 4WK8F 4M74A 2HZYA 3CMEA 3WGIA 3O8HA 3BQZA 2YX4A 2COYA 3LOCA 2WY7Q 1RAHB 3M4GA 4C92A 1TC3C 3JB9F 2LR8A 1UJ8A 1HA8A 2FSWA 3IP4B 3MD2A 1W7PA 1VQOT 3K0LA 3GF2A 1B6AA 2OTLA 1TXQA 1N27A 2XDDA 4I76A 4AUXA 4GLMA 1DGWY 2PX9A 4D5FA 2B86A 2VPLA 3L9FA 2QK0A 4LOCA 2FPDA 3TL4X 3H5AA 1EV7A 2AXTC 1G8XA 4RMNA 3RPQA 2CT3A 2FG0A 3M8EA 4JDSA 3BJAA 1IN5A 1XCBA 3FM3A 1W5CC 5IPAA 3J81R 2DEQA 2O9VA 4HXJA 4M78E 3AHUA 2ZJRF 3IKVA 1O3TA 2DCEA 3BFMA 2AQEA 3CCEA 4KJZA 3DTIA 4NQWA 1UJ0A 2PQWA 1RLPC 2HQAA 1QMCA 4BHCA 4C0GA 4KIFA 1C0WA 4C8QC 1NJIU 3ZQFA 2NVXJ 1TZLA 3DBLB 2W82A 3CUQC 3QOPA 1IHVA 2ESNA 3CUQB 5IXBA 4MGRA 2BY1A 2DYRH 5ICCA 5K1YA 1ZBJA 3CMAT 1WH7A 4HX7A 3BG3A 3A8LB 5CKFA 2VXDA 4JQFA 1ABQA 1YW7A 4J9FA 1WJAA 3T5XA 1WZ2A 2MD5A 4I0BA 2DYBA 4S0HB 1AVZC 1VTNC 4II2A 3TGNA 4V2GA 1VQOI 2CZ0B 1WI3A 2E34A 3IQLA 2E5NA 3Q9VA 2XGCA 5DM7F 1T56A 2COMA 2XB5A 4HVWA 1OMIA 4ESBA 2E6ZA 3TEEA 1JUPA 3TKYA 1N78A 4UUTA 1HDPA 4TVRA 1ETYA 4JS5A 2HKNA 3EH2A 4KGZB 1RUNA 2IVMA 3H5NA 1ZR2A 4JX5A 5GAMe 2FO0A 2DTZA 5LEJA 4OMOA 2OUMA 3JR9A 3DBRB 4B4CA 1QLYA 2JWTA 5HLGA 2KT1A 5GAOn 3OYFA 2V8IA 1M90R 1VQNA 3BPVA 3LGLA 2Z2SB 2JJ7A 1UB4A 2FB7A 3M0PA 4MNUA 4FW1A 1WFWA 5C6SA 1VQKT 3H3UA 2EFWA 1BC7C 2K79A 2LJ1A 1FX7A 3E9GA 1O3QA 3JCMb 3OW2A 2DXTA 4OIOF 4XIDA 2CW8A 3CUQA 3VWBA 3OOPA 2FQ3A 2DA6A 3BR5A 3FF5A 3C18A 3H9JA 3P8BB 1HKQA 2CSIA 3HB9A 4DIQA 1SG5A 3E2UA 2K9SA 2K9QA 2PU9B 3O8VA 3TO7A 1JKPC 4B09A 3CCJA 4HQEA 3BC8A 2V1QA 4XAXB 5FU7C 5A2QE 4AYBN 4ZJZA 3RI4A 5FU7B 1M1KU 2OZ6A 3MHXA 3EG0A 3CMMA 3A5ZB 4CC7A 3I4NJ 4OMQA 4L0ZB 3QPSA 3E1SA 1BJAA 1FZPB 4XRFA 2RPNA 1X2KA 5I2SA 2XASA 1FT9A 1B1BA 2ZB9A 1FMVA 2JS0A 2FVUA 2AKLA 3A01B 2G9WA 5F64A 1BA5A 1S3JA 2HSPA 4P5OA 2KJBA 2VWFA 1B9NA 1D0ZA 1GXPA 1VQOQ 4O3MA 2DOFA 1K7AA 4OIPF 2W10A 2Y0SA 3GOXA 4KRTA 1Y96B 2O88A 1X1CA 4U0VA 4RM2A 4KT0E 1ZTRA 3D1NI 1RAEB 3JCUC 3KEQA 9ATCB 3RPUD 4FTHA 1WJEA 1QCOA 2R3SA 1Q86C 3QOEA 4KGXB 2RHZA 4V19K 2JRMA 3SDGA 2KYMA 4JPBW 1GDTA 2LKSA 2M1BA 4IOAF 2CP0A 4XTXA 3CCMT 2QBYB 2QKLB 5EZGA 3EUAA 3F8MA 1KJWA 2P6TA 1SD7A 4B1RA 1LPLA 3SEZA 1RC9A 2F2VA 1O4XA 1Q81U 3I71A 2KRCA 1ENHA 2VBWA 3ZOBA 4BQAA 2MH9A 2MF2A 1JUMA 1YI2A 1VQMA 1ETWA 4EJOA 3ZMTA 4JX4A 4QKUA 4MQ9F 1MH3A 2PMUA 2XD0A 1ZHIA 2XAUA 2PLYA 2PVOB 2CMPA 2HOAA 2ZMEA 3VFZA 2FBKA 1QZZA 2PG4A 3NTIA 4WXHA 4QT7A 1DP7P 3OL3A 4XSXF 3SFIA 4MLOA 1E7OA 1ETQA 3VDXA 2F2XA 3CMAQ 5LFAA 1KONA 2HD0A 2OC6A 2JVHA 4IHYA 4OINF 2QGUA 3GLXA 5DD8A 3TMOA 4GFBA 1WHGA 3CP8A 4IUQA 3CCEQ 3L2UA 2CUZA 1Q1HA 2KRHA 5K7FA 3GTPJ 4L5EA 1I4K1 1Q7YR 1J9IA 3SZTA 3JCMh 5GAMf 2CS3A 3I59A 3I4MJ 3J7AY 3ZPLA 4BJTA 1IXSB 1JB0E 3I9QA 1O7FA 1X4PA 4M9ZA 3RPUA 2HPMA 2COZA 2DD4A 3F0CA 3CCUA 4L9JA 5ILVA 1I1SA 3EG1A 3GZNB 1P4XA 5EG0B 2NAZA 3JRIA 2NVQJ 2HFHA 4UHTA 1RI0A 4UUSB 4OMMA 4N4GA 4XQ3A 1Y0NA 3H1CA 4I7HA 4C5GA 2K2MA 4CZZA 3A8MB 2VT2A 3EDPA 2OCEA 1VQ4A 2M0YA 5F27A 4NC8A 4L5IA 3OOUA 3W6KB 2RV8A 1B07A 2ABLA 2KBTA 3DTEA 2BY2A 1OI1A 3PMIA 3URGA 3LFKA 2VGNA 2VBZA 2QGGA 1VQKQ 3K9TA 5C4JJ 2LH9A 1KQ9A 2EQMA 3QYFA 4M77E 5IT9Z 4A3BJ 2A7YA 2EQIA 4D7MA 4DOZA 1ZSGA 1GBRA 3N4MA 2FNAA 1S6LA 3KP7A 2L2OA 2X4HA 2JM9A 1K73C 1G4DA 1XMAA 4AIDA 2LDUA 3R60A 4EMKB 4J6YA 2KIMA 3DU5A 1KC8U 2R5AA 3DEWA 4A0YA 5DM7R 2XF5A 5FLMJ 2HBPA 2D1HA 2M4KA 2KIFA 1GRIA 4IRHA 3P9IA 5FD5A 1T0HA 2XGEA 3I0TA 3FIFA 3LMMA 3OYYA 5HNHA 3C0CA 4A4GA 4QVDA 3CJRB 1KHIA 1OCTC 2J06A 4PNOA 1D1CA 4F7UG 1YJ9T 4ZDOA 1AOJA 3KE2A 3FIWA 1YN8A 2QXFA 2W0ZA 4KITB 2EFIA 2O9SA 1O7LA 3GWZA 2NRAC 2ZZDA 3SJMA 4PFPA 5EG0A 3LAPA 3CO7C 4A3KJ 2GAUA 1K9AA 3GNGA 1YS7A 5FW9A 4BL0B 3KBGA 4UUSA 3J80R 4LD5A 3ZBDA 4HBLA 4M3FA 1N9RA 3ASKA 4N0AC 1PRLC 2F5CA 4PJOG 3G6EA 3MEUA 4OB0B 3OW2P 3OYAA 5B1BH 1V29B 3GIBA 4HCBA 2ECCA 1QPIA 1SAXA 1QCFA 5L3EA 2X9HA 2Y69H 2JA5J 3ZN1A 1K6OA 3BZCA 2O5RA 3CC4I 4QVCA 1PP8F 3N5BB 1BR1A 2KRNA 3QXEB 4EVIA 2QM3A 1Z0XA 1RQ6A 2DKGA 2LP5A 3RESA 1UCRA 1ZARA 1PKTA 4GGGA 5DDGA 2LDMA 3OS1A 1Y71A 4EMKA 4CA0A 1X6GA 1FP1D 1LEAA 2E1OA 3F8FA 2XAGA 3IH2A 1OR7A 2DE0X 2EGAA 4XLAA 3M5AA 1N8RC 3C1DA 1WYXA 2TRTA 5GAOp 4U0WA 1X69A 3JRHA 4CYCA 2V1XA 4ZZLA 4H4KC 1IDYA 2X4YA 3M58A 4JRQA 4M3GA 1MJBA 3VSLA 4BI3A 2HAXA 4M4ZA 3J81Z 3JB9G 1X01A 2IA2A 2NOGA 1APLC 4L0YB 3UT1A 2P4RA 5HODA 1M1FA 4QQ6A 4XK8E 4F92B 4HDUA 3JAMR 5LJ3h 2E7XA 2O3FA 1RR8C 4M75E 3PFYA 3ABUA 4JX6A 4PJLA 3RQIA 2NUTB 1EF4A 2E5KA 1UHWA 4BE0A 1WCMJ 5A2QZ 1TNTA 4IPAA 2CU7A 2VQLA 4A3DJ 1M2OA 2LNVA 2LX7A 3CCRT 4QPOA 2RQQA 3HG9A 3K4CA 2L01A 2BZXA 4A3EJ 4M7AF 1R4MB 2HQXA 2KEAA 3H92A 2XRNA 2CGHA 3ERED 1HSTA 2DAQA 3VB2A 5GJVB 5K7HA 3DPTA 2LYCA 2VBYA 2LVMA 2QQAA 2Q8KA 1H0MA 1D8JA 1WHHA 2JMWA 4A4EA 2CFXA 4B48A 3PE0A 1IDZA 3ZMUA 1WFXA 1OU9A 3JTGA 3RKQA 1NBEB 4KH0B 2K2VA 1O57A 4PJNA 2EV6A 1QVUA 2RQUA 2YRDA 5LJ3f 4AFQC 2DL7A 4OVAA 3FKJA 3LNQA 1Y1WJ 3M3YJ 1MMDA 1IN6A 3HGGA 4NDLA 2R7SA 3CC4Q 4EMSA 3S3NA 1VIEA 4A3MJ 4CUGA 4C92E 1ZK8A 3QIIA 1XN7A 2FOWA 1Z67A 2VJ4A 2AZSA 3GNFB 1JO8A 1MBHA 3U1DA 1M27C 3D5LA 1IG7A 3NTKA 2JUGA 1TTHB 2PMZN 3CJTB 2JW4A 4HRIA 1MKMA 4FSSA 3U2RA 1ETKA 2DT5A 1PKSA 2YUNA 4M73A 2YRVA 3WU0A 5CVJA 1VQ6A 2QF7A 2NUTA 2PBIA 3W2AA 2HYJA 1VQ9T 3I4PA 2OTJA 4B43A 1BK2A 3E19A 5FKKA 2QENA 2MGQA 2DF6A 3QDFA 3DKYA 3CESA 3E3VA 1I5ZA 5LBQA 1ZSZA 2RHIA 3G73A 1JQQA 3JTHA 2A07F 4DOVA 1YJNA 3HKZA 5K5RA 2A36A 3GFJA 1X2NA 3AFHA 1USSA 3PM1A 4BHBA 2EYXA 2VGMA 2CUEA 1UMQA 2ESHA 2UV1A 1ULYA 3FM5A 3QYHB 4PFZA 3MKWB 4G7HF 3LX7A 1DPRA 2KMTA 5GJWB 2KLOA 5BNGA 1TS9A 4XKCA 3Q0UA 4ENMA 1R00A 2P7CB 5GMKe 4Q48A 4RGSA 3CDIA 1UELB 3SDBA 3WTYC 2ACJA 2E6NA 1BN5A 1YE9A 2EV0A 3L1AA 1OYIA 1ZGAA 2DTRA 2CFOA 5BPIA 2O4XA 4GXOA 2ZJQF 2H8RA 3L09A 5EEGA 3BTLA 2L8DA 4E2FB 1IUYA 2BKDN 1WZOA 2K3FA 3BG9A 2PQ8A 3CDHA 3DWLE 2K3BA 1RKWA 2OCCH 4C0FA 2FYKA 2GXAA 1WKMA 3WTTC 2OD5A 3OYKA 4FIBA 4IHTA 4IZZA 2E3IA 2HQNA 3OSGA 2J6KA 4OMYA 3NFCA 1FMKA 1ACMB 2RN8A 4OMFB 2MI6A 1FYKA 2KAFA 3ABTA 3H6ZA 1QHGA 4ASNA 3OL4A 4KT5C 2HOTA 2H6BA 3DKMA 2HEQA 3R6OA 3TOBA 5CPRB 4JRKA 1WQ7A 3TOAA 1LNXA 1GLNA 2WA0A 4QQGA 1XQHA 4HV6A 4A3IJ 4PJMA 2OAUA 3SHWA 1FC3A 2FX0A 4ZC3A 1YIJA 3LA3A 2VC0A 4UXNA 4HF1A 1RZ4A 1K8AR 4JUVA 1TOVA 2L89A 2HQRA 2IG0A 2NUZA 1UG2A 1OX9A 2L54A 2XHKA 1AZEA 4GYGA 4UY8I 3WU1B 2X98A 3B73A 1XGSA 2MC3A 1SVOA 4IF4A 2JT1A 1FJLA 1XMKA 3OIOA 3CD6Q 1A6QA 4X9CA 4OIRF 3VS6A 3S1QJ 3P9CA 1KYWA 1MMGA 1S7OA 1IZ6A 1QW1A 4L59A 4XTUA 4ME7A 3VS7A 4B9XA 2BIVA 3MJXA 4KUIA 2X9DA 1NHAA 1G3TA 1XTAA 2EJRA 2L4MA 4E7SA 2JA7J 2RMOA 2YHTA 4X6AJ 2YLBA 3MCAB 2QEXA 2KMUA 2F69A 4OGEA 4O6JA 4DZPA 3DPUA 3IL2A 5GAMg 2M30A 1KU7A 2DL4A 1ON1A 4A4KA 3K10A 5DTDA 2X0LA 1HD3A 3K2ZA 3NGPA 1B72B 4ORZA 2HVSA 4RGRA 2EINH 3GVAA 3MCZA 1JHFA 3BR1A 3ISPA 1B7TA 3RTRA 2PEXA 4LJZF 1SD5A 1WSUA 8AT1B 3FXRA 4ENNA 1FIPA 4KGVB 1ZLKA 3UKGA 4A3FJ 4XKBA 4ANJA 1J75A 1SHFA 4XTYA 1EH8A 1U3EM 1YX5A 2E4HA 2VODA 4HZFA 4L5GA 4A5MA 2F5TX 1HJDA 4FCYA 2R7FA 3CXCA 1X2MA 2VKVA 2FRHA 2LJ3A 1W5SA 2OF7A 1TWFJ 2KL4A 4LB5A 1RACB 1M90C 4OF1A 1WJRA 2X51A 1OX8A 4II3A 2ID3A 2K4JA 2QVOA 5ERIA 1O75A 4BDYA 2KYBA 3EGUA 4ESRA 3F23A 4RS8A 2CQKA 3J80Z 1UHSA 5DUIA 1M5Q1 3CC7T 3ABKH 1ZLJA 4R0KA 2DEUA 1OZ3A 3HSFA 4ELZC 3GX4X 1YTYA 1IXRC 1P7JA 1AEYA 3CD6T 3P5JA 5H2FC 3CZ6A 5F0HA 2LQ8A 3HSRA 1QVGA 1RI7A 4LD6A 3QAHA 2EQJA 4BEHA 1D8KA 4HNUA 1W0UA 1IREB 1KC8R 4MFEA 5H20A 2EJFA 2FF4A 4IL6C 4P9UA 5GANd 3A4CA 4WX9A 3KFVA 1W36C 3MPUB 1R58A 1AD5A 4F04B 5A0LA 1VQ7T 4CCJA 2D8JA 2E1NA 3ESWB 4MMLA 2DN0A 2L7FP 1VQ8A 3TO6A 4E7KA 1MV3A 8ATCB 2YDLA 2XGXA 1LVAA 2QQ9A 1V55H 2A61A 5TJJA 2HZTA 2A37A 4FQGA 5FLXK 4Y13A 1W1WE 4LDWA 3KETA 3F6OA 4XKWA 2FQ4A 4C2MJ 3PIOF 3JRAA 1U5SA 1WJSA 2KROA 1JE8A 4BQQA 1Z1DA 1VOMA 3M4YA 2Q2EB 1MBJA 4JLIA 4PJOD 3OYIA 2OAWA 4EDUA 3A02A 1FIAA 3S6WA 3FHZA 2RHYA 2CYYA 1E3PA 2W1OA 4Y17A 1BU1A 2X6WA 3JAMZ 1JBMA 3PSFA 1LCKA 2X4WA 1X1DA 3CC7I 2ELHA 4V2SA 2CWEA 3GFIA 4FETA 1NLOC 3NQOA 1FTTA 1Y39A 2DNUA 2GQIA 2RREA 2FE3A 3QPTA 5F0FA 4ZTJA 1H9TA 3PO3J 1Y0MA 2D2WA 2RK2A 1PM3A 3LSGA 2JQ7A 1MJAA 3PNVA 1JKRC 3OR2C 4YFXF 2Y31A 1QPMA 3LFUA 1U06A 3FXQA 1TQIA 1YWPA 2DTOA 2MK5A 1UHMA 1YFNA 4Y4RA 2CV0A 3TQNA 1OV3A 4F7UA 2L7ZA 4NNJA 2YRCA 2N8GA 4AYBA 1IN7A 2M7BA 1VQ7I 1ZGJA 1FEXA 2A6HF 1Z3XA 2P5VA 2ISZA 1TUCA 2XPWA 4HOBA 3JB9D 1T3SA 4M7AG 2WSEE 4OMPA 3S93A 5KYXB 1QBJA 2VKDA 1UGRB 3FJPA 1RADB 3BY7A 3VS3A 2IA1A 4IHXA 4RBOA 2PUKB 2EFNA 2R58A 2ZPEB 4PLIA 3I55A 5CVUA 2GFAA 1SMTA 2RD1A 3MKZA 1Q7YC 1FPQA 3X28B 2DBMA 1ZN2A 3CMYA 2DFIA 1YBYA 2FHDA 2ZXWH 5CLSA 5DM6F 3JRCA 2X6OA 3M4OJ 1X27A 4II1A 3BP8A 1HK9A 3CJNA 4BE1A 3HEFA 3CCQT 5FGMA 3UNGC 2HEOA 4ZTFA 4NOYA 4IIOA 4MEYF 1Q82U 2NS8A 3GO5A 4FT2A 1S9HA 2X6YA 1GT0C 3ZL7C 2IAIA 3HYIA 2F4OB 3GPLA 4E7IA 2KNBB 4B9WA 2R57A 4KH1B 1OCRH 2K9NA 5GANh 3T9NA 4RB0A 3CC7Q 1AT1B 3MKYB 1Z21A 2RJCA 3MVPA 1BI2A 3CC2A 4RTVA 3S2HJ 2JM8A 2L7MP 5KYXA 5KCHA 1HOMA 1QVGS 4L9TA 2EAYA 2RQVA 1ETOA 2H6CA 3V8KA 5B3SH 3PIPF 1JT0A 3G1LA 1T98A 1QP2A 3VYTB 4XLHA 3OYCA 5HLTA 2LJ0A 1D09B 1GCQC 1D0XA 3EUHC 2A05A 4YEJA 1T38A 2Y4XA 4RB1A 3R4KA 1Y57A 1VQ7Q 1CF7A 2JTMA 1VQ5T 3PNTA 2LCCA 1WHLA 1YJWT 1SF9A 1NG6A 4R55A 4RTUA 1KFZA 1MV0B 3JRDA 3EHRA 3COAC 2V9VA 3CTAA 3RSNA 1S72I 3MP6A 3CCQI 5CK9A 4GBQA 3SWNC 3FEOA 2XHCA 4FM4B 3T0YA 5AIQA 1D3YA 2MFZA 3QYEA 3S1MJ 4R79A 3SWNB 5KNLA 2JJ9A 5FJ8J 1JJ8C 5KYYB 4UVCA 1RAFB 4LDVA 3A52A 3TSWA 1LDDA 1YLFA 1E17A 2DILA 2RNGA 1ZG3A 2LTPA 3RNJA 2XU8A 1GBQA 2NOJB 2VBXA 1QVGP 3S2DJ 5HS7A 4MIMA 1Y7XA 3GZ5A 3DPLC 5D8LB 3E97A 1IF1A 1K6YA 1Q1VA 3F70A 5GAMj 2GBQA 5EG2A 2L9RA 3HUGB 2W57A 5J4YA 4BKXA 3C95A 4HV5A 2YSQA 4IUUA 4L6V5 4RDUA 1R71A 3FMSA 2V6EA 2FD5A 2R92J 1FSHA 2RQWA 4M3DA 5ICEA 3CBPA 2IW5A 3H9GA 3WGHA 4EEFG 3OS0A 3HPWA 2DDAA 5A0GA 2VOOA 5JVGF 3KXTA 1FOXA 4DBHA 3OQ5A 3A8HB 3VV0A 2Q0OA 1GCQA 4NQWB 2QQRA 3AG1H 3EUHA 3S8PA 1BR4A 4F17A 3JCMQ 2YU9J 1VQ5I 3CMAA 3CCST 2LRQA 2RA2A 1YJWI 5CIUA 3SFMA 4J9IA 7AT1B 1I0CA 2YR2A 2R7QA 5IOZA 4IRIA 2LP0A 3BTJA 4HLYA 4WF2A 1K0SA 4BB7A 3I35A 5F04A 2GIVA 4M7DG 3TDZC 3ABLH 4I6ZA 2DVEA 4X9DA 4XOPA 3SXYA 4A69C 4D1QA 4Q4ZF 3HOTA 2D5VA 1M8VA 2FOKA 3OMGA 1HQCA 1ZLMA 2KJCA 3A98A 1VQLT 1T3LA 5J4VA 4XU2A 2RN7A 1ZUKA 2CUJA 2YT6A 3UWNA 2ZJ2A 1CQTA 1ZGWA 1KQ0A 2OQGA 3PFIA 3BTCA 3RZDJ 2ZPGB 1XGOA 2D0QB 3FXKA 3OA6A 1G2BA 3CCQQ 2PN6A 4ZH4F 4IX7A 2KIQA 2K3XA 1P7IA 3HUGA 1FOYA 1S7EA 4IVNA 3LSHA 1MMNA 2OU2A 4HVVA 5BMZA 1AHDP 5KYNA 1VQKA 1X4OA 1W0TA 1G5VA 1SVLA 2AXLA 2BYVE 2XPUA 4YIFA 5ILUA 5FD6A 4JYKA 2Z5UA 5DLQE 5IT9E 1R1VA 1WXBA 1K4TA 1YRNB 4OOIA 3META 3OWTA 1L3LA 1XJWB 1LFPA 2VL8A 5GAN8 3DLLF 1A36A 1MGTA 4BH9A 3CCSI 3GZ6A 2XKOC 1NPRA 1S8NA 1NJIC 4A4HA 3R0AA 2OA4A 2YXYA 2D1VA 4HAMA 3VYSB 1QO0D 1KU2A 3WE3A 2Z33A 4YIIA 4ETSA 3ZRGA 1AKHB 3U9GA 2GOMA 2Y75A 4HF0A 2ZJPF 2DL8A 4EMGA 1AWOA 3ZQQA 1VQLI 3EG9B 1SSHA 1RUOA 1D3BA 3B02A 1M1KR 3KIOA 1VQ5Q 2EA2A 1ETXA 2ME6A 2DLLA 1HSQA 1YJWQ 3HPHA 5KHDA 5LJ5d 2HTSA 4FSXA 3P7NA 3WU2C 4HF2A 3EG2A 2JSPA 2A28A 1BCOA 1BOAA 4RG2A 4F7ZA 5GAN3 4S04A 2QGFB 2KRMA 4HNVA 4D8DA 3OR1C 5JVTA 2MAMA 2CZ1B 2EWNA 3BT9A 2ECBA 2MC4A 3GBGA 1KK7A 1ZX6A 2R0QC 1QQJA 2KGTA 2X35A 4HA8A 3GUDA 2R7OA 2WAEA 3L2WA 4PSXA 1BCMA 4IURA 1P4AA 2NNNA 4C5HA 1YRNA 5EC7A 2XIDA 4L9VA 1WDXA 1M3CA 2XAFA 4JK1X 2K5IA 4PKCC 3CCMA 1OOTA 5D7UA 3FBIB 2DO3A 1N75A 4CRIA 2QTXA 2XKOA 4NBQA 1V1CA 2OV7A 2PMZA 1XS9A 2BE7D 2ZSHB 3M07A 3BR6A 3WTXC 4I0AA 4CCNA 2E65A 2IS6A 3C4SA 3OMCA 3OSSC 4RCBA 4J6WA 2P5LC 3CF2A 1AKHA 1U3OA 3PJRA 5EEHA 5FO5A 3OY9A 1D5YA 3M0SA 2A3LA 2E70A 4AT1B 3GW2A 3J81E 2GQQA 3V42A 3UPUA 3OYNA 3EG9A 2ZBKA 5TISC 2VJIA 3AL0C 1TWBA 1SPKA 3CEYA 1YOVB 2GBYA 2MG4A 3KLOA 1F4KA 3AL0B 2JSCA 1QP3A 2F48A 2KK4A 3M53A 4M78G 1F1ZA 3ZQCA 3JCMe 4L5JA 1GV2A 2JA6J 4ZYDA 1K79A 2ZMEC 2A5YB 1M1KC 1JGSA 2ZMEB 2KZVA 1ZA2B 2JRTA 3IKTA 1I07A 3I5RA 3BY6A 5J3LA 1PJRA 4PK4A 4XU1A 2HTJA 4BD3A 1IRGA 3OV8A 1QVFA 4QLCU 1VQLQ 3ZXSA 4Q5SF 2XSJC 4IO9F 1JTXA 4IQJA 2KI7A 1TLHB 1WGXA 3KPHA 2EB7A 3ZMDA 2EKOA 3GXOA 5CKBA 3FRNA 2YUQA 2GA2A 5J39A 1K8AU 1Z91A 3LH0A 1TTYA 1JTYA 4DNCA 1RPWA 4CC4B 3F8BA 3I59B 2HU9A 5LHHA 3WODF 3IAS2 2HNHA 3DLAA 4BQNA 2IGKA 2G0EA 4E7LA 2JA8J 1IGQA 1WPKA 2O01E 4E6RA 4M78F 2LX9A 2XB0X 3CLQA 6AT1B 4BY7J 2ZKZA 3CMEI 2UXXA 4E7HA 4CCKA 3OYHA 1IN4A 2KXCA 1MBKA 4RTZA 5F0CA 1WA7A 2JXBA 3IUOA 1F43A 1N9SA 4N4HA 1V76A 4A63B 4EQQA 4NC6A 1TL8A 1RAGB 2V8JA 1H3HA 5GAHJ 5HLHA 4FX4A 2V8KA 2DMOA 3KUFA 5LJ5h 3RUXA 1DU6A 2OTLI 2HS5A 2X1EA 4QPQA 4ITVA 1SVMA 1M3AA 4K2EA 3A1YA 5IP6A 1IUFA 1K4US 2C0TA 2E64A 4ZGDB 1VQMQ 2DK3A 2FNPA 4M7AD 2AIRB 4AG1C 3E7LA 1YJ9A 2BVLA 2AK5A 1B4AA 3HL8A 2J6FA 2QSFX 4RM3A 2B8AA 2VLAA 2MW8A 2D45A 4J9GA 2QA4A 1VQNT 2QDYB 3ASNH 3K4KA 4EJWA 2Z9OA 4LK1F 3ML6A 4J83A 4AG2C 1ODDA 2YS9A 3BROA 4CXFA 3GMEA 2EBIA 3KZZA 2F5FA 2VQCA 3VPRA 4EV0A 1TWAJ 2E2HJ 5FRMA 3NEUA 2IRFG 1VI0A 3LH5A 4C3JJ 4QQDA 1E3HA 2NUPB 1LB2A 5LGNA 1X43A 3K7AJ 3AKZA 2KZGA 3L7WA 4XL9A 2DYSH 3I9V2 3S14J 1SRMA 2M51A 4FYWB 4EIKA 1YCSB 1P2FA 2YWWA 2X4XA 2QI2A 4OIQF 1NPPA 2KE9A 2CQQA 1TG0A 2J5OA 5DUKA 2DMPA 2XVCA 3MN2A 2H1LA 2X85A 2OPTA 2MZ4A 1EFNA 3MP1A 3CCJT 1Q82R 1KD1U 2H3JA 3RCOA 4XU0A 2ZXIA 2XDPA 4HPQA 4PJJA 3CC4T 3A8GB 4AIKA 1TP4A 1R4NB 4XR6A 3KP6A 3MEXA 3MWMA 5GTIC 1LOJA 2E2JJ 4KNYA 2WBMA 2DOAA 4C8QF 3OW2S 5CAIA 2DZCA 1EH7A 4NC7A 3BDUA 3JCMf 2BZ8A 2X4JA 3ULRB 4X1EA 5EGOA 2P7VB 2WTEA 4HG2A 1HW2A 2K7LA 1T0FC 2KIUA 4EMKC 4Z6YA 1RRJA 5LJ3e 1ARKA 4W1UA 1OR7C 3QZ5B 2RAEA 3D5RC 2HR3A 2DXCA 3SHFA 2ESWA 2MSYA 3EGXA 3REAB 3DU6A 1KC8C 2K9LA 1VQNI 2D0NA 3LYIA 2XG8D 2ZCFB 2OTLQ 5M9OA 5L3GA 2W85A 2KT0A 1XC5A 4I02A 3ER0A 4YTLA 1QNTA 4CYCB 2KKOA 1XNIA 5FB2A 1VA7A 5IH2A 2DT7B 2EILH 2XRLA 4LK0F 1AOYA 1RI9A 2A3SA 3PO2J 2HMAA 3PTAA 3FMQA 3JSOA 2NUPA 2HPIA 1SFUA 2ED1A 3QYGB 5DCMA 4P5NA 1BOBA 3BJ6A 3FX3A 1MIJA 2M9HA 3I58A 1REPC 1TUDA 3J7AO 3RMSA 2KRSA 3WG9A 1CGPA 2CQXA 2IIMA 3QJ6A 1FWZA 3S3OA 4KMUX 1UG0A 4XONA 1VQMT 3CCJI 1SFOJ 2VI6A 1GCPA 2BY3A 2O7OA 3QJYA 2X3XD 1OKRA 1U5TB 2TCTA 3ZEHA 2VT3A 2GGRA 3HXLA 4NB5A 3T1BA 3LSTA 5IN1A 2HKXA 5FU6C 3CD6A 2R5MA 5ICGA 2RB6A 1DP3A 3S15J 5FU6B 5GMKj 3JCMX 4S05A 3ERMA 3KYDB 3QZ9B 2NYSA 1KZHA 3FLGA 1YHQA 5DY9A 4JJDA 5EJCA 4MTEA 1XGNA 2DMQA 2M87A 2QASA 1T0FA 2F5DA 2K9MA 3G2BA 5HS9A 1T33A 4XLNF 2BTTA 3CPWA 3HC7A 3DLMA 3C94A 1X1PA 3H0GJ 5FKOA 1ZA1B 2HKOA 2VXFA 1OPLA 2DQRA 4O5VA 2IPQX 2A68F 2MBFA 1X19A 1IV6A 3SQNA 2X6XA 5JI6A 2R5YB 4EATA 1VYUA 4MDXA 1HLVA 2MUNA 3WTWC 1A0NB 4D8KA 2P4WA 1VQ9A 4A6DA 5D6YA 1TUGB 3SD4A 3JV3A 1MMAA 2DJNA 2IGMA 3GLLA 4M77G 2DK8A 1PVEA 3WHCA 2K4YA 4G6DA 3QWXX 4CSWA 3F72A 2COBA 2E19A 2BV6A 3GTJJ 1OPCA 3OSFA 1AU7A 1ITYA 2C0OA 3ZN0A 1EX4A 2A08A 2J05A 1VQNQ 1H3ZA 1U0JA 4CH7A 5DCFA 2MYSA 1N77A 2VXZA 1SSFA 1U6GA 1YI2I 4DOWA 1VQMI 5HKCA 4WXCA 4YELA 2X48A 2RNAA 1FYLA 1JU5C 1U5TA 2K02A 2QUFA 1ZSZC 4Y91A 2HQ5A 3HM5A 3ROUA 1ZSZB 2DMTA 4PFOA 1V3FA 5CCAA 2Y90A 2XF7A 1YIOA 2R93J 2ZPIB 3LWHA 1IRZA 2EKHA 1EKEA 5HLIA 4AIJA 4BJ5C 3OYGA 3J80E 3LWFA 4RLFA 1SFEA 2R7VA 1M2VA 2M2EA 3MZHA 1VQPA 2L9VA 4G6QA 2PUOB 2L02A 2VPRA 1FY7A 3CCJQ 2V7FA 3KZIC 5TGTA 2O03A 3BTIA 3ZGKA 5JHFA 1PWTA 3BW1A 1LUJB 2BY0A 3CF5F 2R5YA 1DDNA 4J5YA 1PSFA 2RJDA 1P4WA 4RAFA 2O4XB 4XU3A 1QRYA 3PGGA 4CC2A 5ILSA 1VYVA 1R5ID 4RUGA 1OCZH 3W6VA 1OEBA 2DM1A 2KISA 4R8HA 1J3TA 4F91B 1VQ4I 1I6HJ 1IAWA 1OYWA 3BJOA 1RL2A 5F08A 3CQTA 3K1NA 3H36A 3FJ5A 1ABOA 1B3QA 1WRJA 1YQAA 1WX6A 2KVQG 3H0FA 3H3VK 2XUBA 2LF7A 2CUBA 4MEXF 4HCZA 2E12A 4W97A 2Y30A 2O8XA 4A6EA 4BBRJ 1WHMA 2BXYA 2MWOA 2L9SA 2STTA 2LLKA 2E1HA 3O5ZA 5CQXA 1Z7UA 1KGSA 3F8CA 1RESA 1H641 2FPFA 2F4MB 3JAME 5J6XA 3FZVA 1YI2Q 4ZN1A 3KP3A 3F21A 2AKKA 4MMKA 3BR2A 1GVDA 5F6FA 2L9NA 5LLQA 4KMFA 3CCRA 4M75G 4XTWA 1AZGB 1XSVA 2DU9A 3BG5A 5KYUB 3HRTA 1JT6A 2L7KA 3A03A 3WXMB 4C0ZA 4Z88A 1ZREA 4Q47A 2I2LA 5FWBA 4CDGA 3VUBA 2ZXJA 5FKNA 2HDWA 3V4GA 2CP5A 3RYRA 2BE9B 4BJ6C 1LFBA 3BZ6A 1X1BA 2HYFA 2DT6A 2ZC2A 4DW6A 5D6WA 2YUOA 3G6EI 2LY2A 1EH6A 1VNDA 4A3LJ 1MW7A 2QA4T 4AU7A 2LRDA 1EIFA 1QZEA 3M0QA 4JJCA 1IRFA 1U1SA 3VOEA 1W4SA 4ZYEA 2LY1A 2WAFA 2ROTA 3VYUB 2NYXA 3WE2A 3P9KA 1R36A 2I5UA 1WGSA 4M78D 3CCLT 3OYBA 4OMLA 2EZIA 1H92A 4N4IA 1IW7F 3E6BA 2MCNA 5DS9A 2EJGA 2E71A 4HX8A 3UF4A 4CHUA 1VQ4Q 2MH2A 1PP7U 2AO9A 1IZ1A 1G2HA 3K70D 1NK3P 2GTJA 3DB4A 4J9BA 5E3NA 2MPXC 5CVRA 3K4BA 1F5TA 2DODA 4J9EA 2DJZA 5D8KB 1W4MA 4Z89A 5KVRA 2E3HA 3BCBA 2H8HA 2MWPA 5HOOA 1V5EA 3CPWP 4ZZDA 4Y3OA 2DTIA 1J5YA 2L3QA 3P8HA 4M7DF 4B47A 1QA6A 2K3YA 5I2MA 5J8CA 4A93J 5LRRA 4EJUA 2DA9A 2CG4A 1ZAOA 2W4SA 3GFMA 4KUDK 4Y7NJ 2ZO4A 4KBMB 1BR2A 6PAXA 2JMCA 1LJOA 2O2OA 3CC7A 1EZZB 4FHTA 4AFSC 3ZQGA 3U23A 4NL3A 1WJCA 3BLYA 1YITT 2KQRA 2FZCB 4IHSA 4M78A 2FBIA 1B9MA 4A12A 1LE8A 3PIOA 3W3CA 1G6NA 4A3JJ 1DGRM 5CVIA 1HBXG 1N6AA 1OULA 2L3SA 2BVMA 2IGNA 3ZCOA 3CCLI 4H0EA 4BY1J 4J7FA 4AVPA 3VJPA 1NTCA 4CCMA 2R7RA 1ZRDA 1BBYA 2EZKA 2YU3A 1OCPA 3F22A 2JT4A 1WPYA 1OQYA 1Y0UA 3G4SA 2DERA 3VRZA 4JP0A 4EGZA 3JW4A 3BDDA 3MZYA 2DPUA 1FYNA 1SMYF 4LDYA 3G6EQ 4J01A 2LC4A 5LEKA 3NTHA 3C2GA 1VQ7A 1PD1A 2EYZA 4NS5A 3GF5A 1IV8A 2GXBA 1Z7LA 4PL6A 4XRSG 5EEAA 3TU4K 4BEHB 1ACIA 3H35A 4IRGA 1TW2A 1GV5A 4UNOA 4M6VA 3BE3A 3VU3C 4IXAA 3BR3A 3NARA 4X0GA 2FU4A 3NWTA 1AWJA 3FKIJ 2FZKB 1RETA 2DJIA 4Y92A 2EFPA 4AIHA 5J47A 1TH7A 1WHKA 5FFXA 1O3SA 1MSFC 2HXIA 1YW9A 4ZDLA 3G71A 3FHNA 4I01A 3JCMg 1VQ6I 4E4HA 4AFZC 3HRSA 3DKXA 3RJPA 4C8QG 1D5VA 3LLRA 2G7UA 2OTJI 1YITI 2ME0A 5J26A 1M3BA 4DYQA 1NYFA 1GUUA 2FUG2 4D5CA 1TT5B 1FLIA 1IXCA 1KD1R 1YJNI 5FLXR 2HDDA 1HC8A 2IPOB 5IYDJ 4KYWA 2VXEA 1NEBA 3NRVA 1H8AC 2MLGA 3KP2A 5GMKi 3TCJA 3Q0VA 4CI0C 1YIJT 2FRWA 1G3WA 2VOPA 5CKHA 3VUZA 5K5QA 5M3MJ 4IUPA 5ECAA 5HS8A 1XPXA 2Z99A 3I5SA 1ZQ3P 3D0SA 2JNGA 1G59A 5GMKl 2F5VA 1RLQC 2LMDA 4JLGA 4KICA 3UATA 3CCLQ 3HL2A 5C4XJ 3EETA 4D7NA 2LOOA 3MP8A 1XDUA 4F7UB 2K86A 3JB9J 4JRIA 2CZ6B 2LFBA 3DP7A 4UUVA 1OU8A 1U9NA 3O2PE 3THKA 1AA7A 3LGFA 3VYGA 1A04A 1BI0A 4JZ3A 3LA7A 3C7JA 3KZYA 3WVDB 5FKLA 2EQRA 4PJOC 2XGDA 1UZCA 1H89C 1MSEC 2ZGWA 4PJOB 4JJBA 3RR6A 1OISA 4ZYGA 5IXFA 5KE2A 1VZ0A 2DMUA 1R7JA 5E3MA 3CCQA 3NPFA 4KDPA 2BW3B 2HDAA 3PIPA 2QEXT 1MGQA 5D6XA 4G7OF 3CCLA 4F16A 5GANe 3V7CA 4BUPA 4XTZA 3DEEA 5HVQC 2LQWA 1DU0A 2Y9ZA 3LSJA 1KQSA 4U7DA 3NMZC 4FISA 3QSUA 1W5TA 1VQ6Q 2XMFA 3R6SA 3RBBB 4OU0A 2E10A 3OS5A 4BYYA 1I1JA 1WJDA 1YIJI 5EDNA 2YX7A 5FKMA 1LDKB 1YITQ 1P6RA 3VKIA 3WGGA 3K4MA 5HCKA 5E20A 1V4RA 2GCXA 4HSRA 5D5WB 2X1DA 1B34B 3EGDA 1K76A 3J7YJ 1YJNQ 4PZJA 5JFRA 2XKPA 1UGSB 3B6CA 3CCVT 1XCVA 2BUDA 2K40A 4OAYA 3LSKA 1BM9A 3G1OA 3L2QA 3E0JB 4M77D 2RF0A 1HW5A 5FFZA 1MBFA 2HOSA 3V8LA 4M7AA 5L3BA 2GWRA 3JREA 1NEGA 1D0YA 4PJOA 2DK5A 3SYTA 3H9QA 4D9JA 1JXMA 2A0FB 2VONA 3MO8A 2I0NA 2BW3A 1WQ2A 5GAN6 2KXDA 3QODA 4RB2C 5KAFC 2QEXI 5LJ3g 4G12A 1MNMC 1C0MA 1CF7B 1WQWA 2EIMH 2CP3A 4HT8A 2WWYA 1R5GA 2KQWA 2QG9B 1OFCX 2QQSA 3HSEA 4EM1A 3CXCS 4GDFA 2FEIA 1S72T 3KYCB 1QKXA 4F93B 3KYLA 3CCYA 3LWIA 4RG8A 1UEBA 1IRXA 1NG7A 2MA3A 2A6TA 3INZA 1HKTA 1WNLA 1Q82C 4HKEA 3QU6A 5LGUA 3IH3A 2HBWA 3UR3C 1OLTA 1WJ5A 4B3XA 2E5QA 2RI2A 1QKWA 3H41A 1B34A 4DA4A 2ZFWA 1U9OA 3DFGA 2DL3A 3IAM2 3HOXJ 2E36A 3CCVI 2UWMA 1FYMA 3ZQLA 5H6RA 4J7IA 4G6TB 2R5ZB 2VKNA 5K5OA 1YIJQ 1ZG1A 4B44A 1SEMA 2E41A 3CCSA 3PQKA 1PUEE 3GEZA 2KHMA 1WLPB 3HPGA 1R6RA 3RQ4A 4G8XA 1UG1A 2EQUA 2K5CA 3HIFA 3V8JA 4V2FA 5M5XJ 1RAIB 5L23A 3CXCP 3FC3A 3O6BB 1ETVA 1MMSA 2LMJA 2GQVA 4A53A 1C6VX 2IBDA 2PJRA 4FYYB 2XDBA 2DIQA 2W25A 3V7SA 4ZN3A 2HVRA 3RERA 4AC0A 2CSQA 1SFXA 3EUKL 2XI9A 3IHUA 1UE9A 5GANf 3DLLA 2BZTA 4CC3A 1MDMA 2COWA 2RJEA 2QLZA 1FOWA 1VQOA 1QGPA 3VEPA 2OQRA 2RNJA 3M1EA 4KUMA 4MFDA 3WHBA 5E3OA 1GFCA 1RABB 2X1CA 2DL5A 3EG3A 1R1UA 2FA5A 4OMNA 2KT8A 4OB1B 2QKMB 2GF7A 2QEXQ 2AHJB 4RTXA 2VASA 1X1AA 3N05A 1BB9A 1U8RA 5CJ9A 5GAGJ 1VQ8I 2EPDA 3HOYJ 2EQKA 3U1KA 1SAUA 4J00A 1LQ1A 1ZYRF 4MQVA 4A2UA 5BS6A 4C2TA 4M72A 4N0BA 4BAYA 3DB3A 2EIKH 2R7WA 1OCCH 4U88A 3IH4A 4Z2YA 3K4NA 3VODA 2R5ZA 3BPXA 3LSMA 2DRKA 5LRSA 3I55T 2MLKA 1JKOC 1X3ZB 4FE7A 2EIJH 5IY5H 3L1PA 3K4JA 3HOUJ 1F36A 4BBSJ 1BW5A 4BUGA 4PUSA 1PYVA 3OIQA 2IEKA 4LG0A 4LLLA 1UJYA 4RGUA 1BJZA 1QCNA 1YS6A 1T08B 3S2WA 1VYTA 2LG4A 1JUSA 1JGGA 5C3EJ 4IJAA 4LB6B 1EJ9A 2CT4A 3VS5A 3CCVQ 2MABA 2GXGA 1WH5A 5J1YA 1UUEA 2L3PA 2P84A 2WC2A 2ECZA 4RCCA 1IHWA 1AWCA 2BXZA 3BR0A 3M0RA 1NZ9A 3Q1JA 2LY9A 4G94A 1W7PD 2K4BA 4F14A 1G83A 1Z3YA 4XN0A 1SFKA 3IRQA 1M8MA 2DLPA 3J7AF 3MZ8A 4DYRA 3GCMA 2FRYA 3V7RA 2P4TA 2E5ZA 2KSSA 2FXAA 2ID6A 4Y33A 3ASOH 4DJAA 4LLNA 3F6VA 4GLKA 1K9MU 1D3BB 4KN4X 5FLVA 3WTUC 4G7ZF 5AT1B 2YPRA 2M35A 4ESFA 3J7ZI 1R8OB 4M77F 2ZPBB 1MBGA 1WJFA 3CC2T 3PFSA 3VS2A 3OYMA 3BDLA 5F1JA 2E2IJ 3CBOA 1S72Q 4A0ZA 3R6NA 4IIMA 4ZNXA 5IT9K 3KX2A 1T6SA 4CICA 3FK7A 1KSWA 2ZPHB 3M0UA 2LVSA 3A2KA 2EW3A 3CCSQ 2IVWA 3L2VA 1A31A 3X26B 3I55I 1M4ZA 2CUDA 2DYIA 3TP3A 5J8FA 5ED4A 4LIUA 2QYZA 1BIAA 4XLFA 2PTKA 1R9TJ 1XGMA 3F9KA 3HOWJ 4BHPA 2DPPB 2WAQN 4WCGA 2JOYA 1MD0A 5DLOA 3E6DA 2CDTA 3EH1A 3LW5E 1VQ8Q 2V9KA 2DW4A 2GIZA 2LBFB 3L2RA 3A1PA 4HX4A 2LT1A 3UDCA 2QQBA 2F2WA 5L3CA 5CKDA 2HNIA 2ETHA 3FWEA 2O6GE 2KFDA 3W2VA 3RKWA 3ME9A 2H8WA 1R5HA 2ED0A 3S16J 1JEGA 1R0BG 1Z6RA 2FEZA 3FXUA 3ZMVA 1A5JA 1NE8A 4UV9A 1Z9CA 4RAZA 5FLXZ 1VFCA 4E6KG 2DFFA 3ECOA 3OIPA 4MHGA 1IXDA 2ZSIB 2ISYA 3G1MA 3HZJA 4QW2A 4UC4A 5L8RE 3REOA 2WSCE 2P0KA 3JB9I 3I56T 1WIEA 3CC2I 3CO6C 3GBQA 3L2ZA 3X20B 2E35A 1MNEA 5B66C 3G7ZA 3H5RA 3JCMc 1G3SA 1V5GA 2G3RA 1J59A 3M9AA 2M9UA 4B3AA 5A2QR 2V79A 3PUFA 4C8QB 2MD0A 2UZKA 4RTYA 3GYHX 2V6CA 1QZYA 4N4OB 4C8QD 5GAOr 3PQJA 2XIGA 4A0XA 2R7TA 4XRMA 4BXXJ 3CDLA 3L2CA 2DDBA 2C06A 1ON2A 3K1PA 4DBQA 1N8RR 2UUZA 5E17F 3TVTA 2LBFA 2UXNA 5AYFA 5GAMd 2EFQA 2R4GA 5LJ5e 1N25A 4FU6A 3K2AA 3VS0A 2OZUA 4LLGF 2QWWA 3MQ0A 4LITA 1GHCA 1M9SA 1Y07A 4D6WA 2EJ9A 1AWXA 3J81K 3Q0WA 5I11A 2IS2A 3FK6A 3CUOA 4BXFA 5GAN7 2LKPA 3I55Q 2OBPA 4M75F 2LK2A 3LQRA 3CMET 3MFKA 3TP0A 3LSIA 4XRSA 3QHSA 4LMYA 2Y0MA 2NVYJ 5D6EA 3RIRA 2L2PA 4DYCA 2W84A 2VUMJ 2RQTA 2Y4YA 2JMAA 5A2QK 3SDZA 3AG4H 2E1CA 2IJLA 3I56I 5LJ3j 5GAOq 2DFEA 4ON0A 1YWOA 3TSZA 2OTLT 3QRFF 3OYEA 1P92A 4C3HJ 2XAHA 2LCSA 3HHTB 4LD9K 4M3BA 5CKEA 3QDRB 1M30A 2H27A 3QP6A 2AHQA 2CW7A 3Q9SA 4WXDA 3JCMd 5GAN4 2VE8A 3HRMA 3C2BA 3D5SC 1T8IA 3S1NJ 1Y56A 4R1HA 4ZYHA 4JZ4A 4C8QA 1IO2A 2B0LA 3HHGA 4JBAA 4RLQA 2DA5A 2DI3A 2CH4W 2CRGA 4R56A 2LCLA 2RQPA 3PT9A 3CCET 3JCMJ 1RUWA 5DD4A 1TU0B 2DVJA 4EGYA 4BI4A 3X24B 4C92F 3CMAI 1QHHD 3CC2Q 2JA2A 1K8AC 4AFUC 3CPFA 2LZ6B 4M71A 2AQFA 4BS9A 3GP8A 3JRBA 3RZOJ 3JRGA 5HDNA 2HKQB 3VS1A 2E60A 4XTVA 2XAQA 4PJOF 3CC4A 2VKHA 4J9DA 1E2XA 2JN0A 2DRMA 4QVZA 1R0CB 2EK5A 5GAN2 1OYXA 2J6OA 1GXIE 3M0TA 5CVVA 2CS7A 4PDKA 1Q81C 2M3AA 2PJPA 3BCAA 3IV5A 3QWLA 4DGWB 9ANTA 1TBXA 3EYYA 3QKJA 2OTJT 1RKTA 3NAUA 5E1ZB 2XK0A 4KULA 4M7AC 2WSFE 1YP5A 3ZQIA 1ZBXA 4M7AB 2STWA 1W6XA 2GLOA 1W2BA 2R7ZJ 3D7SB 5H6QA 2OAZA 3FISA 2ELKA 3DTKA 3ZQ7A 5EGOB 3BZKA 1VQKI 3MKDA 5I21A 1FNNA 3FDYA 3ZMZA 1Q86U 4ZDPA 1J0RA 3DCFA 1FTZA 1PC0A 1ZUYA 3EGXB 3HP9A 3MEVA 5BQTA 2QSGX 3CCEI 1S29A 4IHWA 2ROLA 1WVRA 1MNDA 2VV5A 2VE9A 3I56Q 2CH0A 4PGGA 2CJJA 2DO7A 1WI9A 1AWWA 1L0OC 5GAMh 1MBEA 5GAEJ 3H3ZA 4IQ4A 2RI5A 4RTWA 4A3GJ 4F7UE 3HOSA 2F2EA 4I09A 2QYOA 5LJ5f 4Z8AA 2D6FA 1XX5A 3C3WA 1IGNA 2JN6A 1JXOA 4X1VA 1QWFA 4LGWA 1X6BA 4QWQA 2ZFUA 1BI1A 1GVJA 5DCMB 3ECHA 4KN7X 3TDUC 4A5NA 4XICA 1DPUA 1E6GA 3X25B 1KG1A 2FBHA 4XBFA 2B7EA 3I64A 2I10A 1M1EB 4PJOE 2DFHA 2M34A 3TEDA 1ORKA 2DA3A 5J1RA 1PG5B 4QIWN 1KD1C 4HEA2 3A01A 1K4SA 1MZBA 3A0BC 4QTRA 3K1MA 2LQNA 2A6EF 2V4JC 4WWCA 1K83J 2AS5F 3HFOA 2IA0A 3OB9A 3VRYA 1KA8A 1TW3A 4PSWA 2Z0WA 2DETA 2VB6A 1ONVA 5GANg 4XNFA 1Y96A 3CMEQ 2OJED 1JJ2A 5JR3A 2BHYA 5I22A 1TQMA 2FL7A 3VYRB 2VVKA 1HYOA 4EJTA 2RH2A 1N5ZA 1H9GA 5LJ3d 4A4FA 4YFNF 1MJ9A 3CCMI 3BWGA 2VJ5A 2EPFA 4A3CJ 2QBYA 2O0YA 5E1WA 4B8XA 1Z05A 1LVKA 4RA2A 3RKYA 3U21A 3UA6A 1U2WA 4M6YA 2A69F 2W24A 1FMWA 3X2QH 4EPCA 4YIRX 1D1BA 5E3LA 1QVFS 3E6MA 2WB1N 4HCCA 2PI0A 2K27A 4CCLA 3KFWX
chains in the Genus database with same CATH topology
3VYHB 1K73U 4C5EA 2EA4A 2HGCA 2R7DA 4EM2A 2CO5A 1YI2T 3E6CC 1U5TC 1X75C 3LQQA 1I6XA 2EV5A 2BGCA 1LNWA 3SFZA 2PVDB 5FROA 5LL6S 1BKBA 3S3MA 3JCMV 4ATOA 5E8IA 2LQKA 2QZ8A 3CCUT 5FRNA 1W2BS 1SD4A 1KQ8A 4G9YA 1FSEA 4M7DC 1UB9A 5E8GA 4M7DB 3A8OB 3EAEA 1LJ9A 1JRIA 3OBWA 1HW1A 1FBSA </