1G3SA

Cys102ser dtxr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
212
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 64
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3sA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3sA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3sA03
2LX9A 1XD7A 4UUVA 1KA8A 1FT9A 3WE2A 4HZFA 2K7LA 5DCFA 2Y0MA 3P9KA 1ZGAA 3IKTA 2GAUA 3ELKA 1ZH5A 2OQGA 3I4PA 3RPUA 3GLXA 2RC4A 1I5ZA 2JRTA 1DPRA 4Z2YA 2XUBA 3FMQA 3I53A 2VBWA 1FBQA 1SD4A 3M8EA 4LK1F 4WXCA 4L18B 5IT9Z 3B02A 1BI3A 4YIFA 1GVJA 2FBHA 1RUOA 2FSWA 3KZZA 1D3YA 2P4WA 2VONA 3ZMZA 3IHUA 2QBYB 1MDMB 1XDSA 4G7HF 2D1HA 2VXZA 2GIVA 4EV0A 4OIQF 2KKOA 1I6XA 4OMZA 5LEJA 3LA3A 2ZBKA 3PQJA 2OD5A 2XAQA 2JT1A 1FC3A 4UVBA 2W25A 2UXNA 1K7AA 5F1RA 2H6BA 1TW3A 2ADUA 2EA2A 1LVAA 3E3VA 4ESJA 1K78B 3N4MA 4EMSA 1IN4A 3CJNA 1Y0UA 2H09A 3R0AA 4RB0A 2GXGA 3BJ6A 3LAJA 3J80K 5ICCA 3KP3A 3BJOA 3F8MA 2HEOA 4A12A 3EYYA 1MJ9A 1HW1A 1HSTA 2VN2A 3IRQA 5KVRA 4ASNA 1U5TC 2NYXA 1FYMA 3RKXA 1BI1A 1PP8F 3IWZA 2IVMA 4I98B 2IJLA 2EK5A 5FLXZ 3ABTA 2K02A 4FHTA 5DYMA 1B59A 2L54A 4S04A 2ZMEA 2W84A 4HYEA 5D5VB 1TQPA 1BI0A 5HDKA 1OR7A 4XSZF 4RAYA 2ZKZA 2V1DA 1L0OC 1SAXA 1XCBA 3Q9SA 1BI2A 1WRJA 4G6QA 2M5WA 4LK0F 3E5XA 1B1BA 3ERED 3F8CA 3EYIA 1BC8C 2GQQA 3KEQA 1T0FA 1D8JA 1IUYA 3V7RA 2PFBA 2ZO4A 3E5UA 2VBXA 2C6YA 2H27A 3QPHA 3O2PE 4HA8A 3TQNA 4YFNF 1SMTA 3QP5A 4N9IA 1A04A 3V8JA 4AIKA 4HQMA 5D8LB 4U0WA 5FFXA 2VE9A 2O3FA 1R1TA 1BYMA 3RTRA 2XVCA 1XDUA 4HLXA 3WTWC 3L09A 3RKWA 5BPIA 2L4AA 2XIGA 2YU3A 3K1NA 4ZYHA 5ERIA 2J5OA 2Q2EA 2A3SA 4MNUA 4OIRF 3WTSC 1W4MA 3ZMTA 4Y13A 3DFGA 1GXPA 2CG4A 3HOSA 4P9FA 4U0VA 3F8BA 4KIBA 1T6SA 1FP2A 5D4SA 5CJ9A 1DP7P 2FF4A 4NQWA 5HLGA 4PGGA 1LQ1A 4P55A 2DAOA 4A0XA 5HS9A 5L3GA 1ZYRF 4HX8A 4OINF 1G6NA 2ZFWA 2JPCA 1TNSA 3DPLC 2K4YA 2XROA 1PDNC 2OQRA 4DNCA 2NAZA 1HKQA 5EEGA 5DCMA 3REOA 1R00A 1OYWA 2YX4A 1BOAA 1HKSA 1W7PA 4MHGA 5ILVA 3PQKA 4GGGA 2ZJ2A 5E20A 1QQIA 4M71A 3W6KB 3DXJF 4BHCA 4JK1X 3GZ5A 3K1PA 2PEXA 5HS7A 2YSRA 2AS5F 1KU9A 3HOTA 1KQ9A 3T8RA 2L02A 5L3BA 2EFQA 3DPTA 1W5SA 3O3KA 2OZ6A 2HYGD 4F7ZA 1EV7A 4P96A 1O7FA 1FY7A 4ETSA 4LB5A 1P4WA 2P6TA 1U5TA 4M9ZA 1QW1A 3V4GA 3HTUA 4OIPF 4LLNA 3ABUA 5E8GA 1J75A 2QUFA 1YFHA 5JVTA 4ENMA 5LRSA 4ZYGA 5D8KB 1MD0A 3E6CC 2K5FA 4LG0A 5LHGA 3J81K 4I02A 5J8FA 1S8NA 4ZYDA 1I1GA 2L01A 2KJBA 3WTUC 3IL2A 5HLHA 3F21A 3LA2A 4WWCA 1QGPA 1ZN2A 4JQFA 4GCVA 4BNCA 2PG4A 2MLKA 2XAJA 3BROA 4OOIA 2FQ3A 1R5GA 1WKMA 3J7AO 2ACJA 1TBXA 1QNTA 3CUQC 3GUDA 4L9NA 4RGSA 4HOBA 4EQQA 4NB5A 1IN8A 3E97A 4B09A 1ZHFA 2KIMA 3GFLA 2HFHA 2UWMA 2DW4A 1TNTA 3JSPA 2MA3A 2A68F 3F22A 5E17F 2ZXJA 2VODA 2VOPA 1IXCA 2VBYA 2L3DA 1AWCA 2Q8KA 3K1MA 3ULQB 2DU9A 1EH7A 4UV8A 3BJAA 3LFKA 1U6GA 3GEZA 2F5FA 2PI0A 1P4XA 2VC0A 4WF2A 5H6QA 1FPQA 1IXSB 3KP4A 1B9MA 4CDGA 1DPUA 1E17A 3IWFA 1R36A 5LRRA 3I64A 2HQNA 1KU2A 5LGUA 3KCCA 2DLLA 1YW8A 3W6JB 1R5HA 1LEAA 2RQPA 3RYPA 5LHHA 1FX7A 5F6FA 4RAZA 2DI3A 1UCRA 4WK8F 3F8NA 3BZ6A 2RV8A 2E1CA 3C7JA 5FB2A 2DT5A 4ESFA 3HIFA 4EJTA 1I1SA 3WGGA 1F4KA 3EQLF 4UHTA 5DD8A 3NEUA 4E70A 3DP7A 4Y15A 3ZMDA 2GZWA 2HOEA 3WGIA 3CUQB 2QBYA 4HLYA 3TGNA 4BXUA 2WWYA 4G7OF 3GF2A 1RNLA 1UFMA 2ZNZA 6PAXA 1FNNA 2K5LA 1JHFA 1XMKA 4XBFA 1SD7A 3U1DA 2DK8A 2UXXA 2Z9OA 3JSOA 2Z3YA 3JTHA 1FYLA 1TW2A 3V8LA 2G7HA 3L7WA 1HBXG 1UHMA 3TO9A 4ZYEA 4MGRA 2OA4A 3BOQA 3LAPA 2OU2A 3K2ZA 2W57A 2ESHA 4TV7A 4CHUA 4PDKA 2CSOA 4ESBA 3JTGA 1JE8A 3DKWA 1W7PD 1QPMA 2PQ8A 5LBQA 5IT3A 2QQBA 4Y17A 3F6OA 3KZYA 2LF7A 4AIHA 1FOKA 1T98A 4KUMA 1ON2A 1FSEA 4A2UA 3WTTC 3L2CA 1CGPA 1O3RA 3CUQA 3GYHX 3WTVC 4A6EA 3HHHA 4U88A 3I59A 2A07F 4XLNF 2P5KA 4EM1A 4G8XA 3NRVA 1WWXA 1Z9CA 2FOKA 1Z6RA 4AWXB 1PUEE 4KICA 2HYFA 1YIOA 1H0MA 1RI7A 2QQAA 1RUNA 4MQ9F 5JFRA 1R1UA 5LGNA 2A61A 2K4BA 1K79A 4HX7A 3E19A 2FNPA 2DTRA 2LSOA 1WI9A 5DUIA 2NRAC 3FXRA 3IRRA 5TJJA 2HR3A 4BYYA 1FBSA 4A0YA 3KLOA 3C3WA 1TQMA 1P2FA 4ZZDA 4U7BA 5D5WB 2KRFA 3I0TA 1USSA 1J5YA 4HQEA 5JI6A 3V8KA 1YYVA 1Z1DA 5CVIA 1CF7B 3BPXA 1USTA 2AXLA 4XSXF 4I0AA 1J59A 2V1XA 3L9FA 4EGZA 4B8XA 5K1YA 1YLFA 2O0YA 1F9NA 2H3JA 1ON1A 4EM0B 1XGMA 3M7GA 1T38A 5E1XA 1LB2A 5K5RA 1KYWA 3QU3A 5A2QZ 1REPC 2XAFA 4YIIA 1ZARA 3DQVC 2ETHA 2O6GE 4MTEA 4ENNA 4LG0B 3TDUC 2KJCA 3RPQA 1YG2A 3VODA 5LEKA 3K9TA 5CVJA 1XSVA 4XLPF 3FX3A 3E6MA 2QVOA 4UVAA 2PJPA 4M6YA 1R22A 1EH8A 1BN5A 3CUOA 3SXYA 3BY6A 2G7UA 2OBPA 3LA7A 2HKXA 1C0WA 3QAHA 3GO5A 3GWZA 1OMIA 1FBUA 4G6DA 2BYVE 3OV8A 1IW7F 3H3ZA 5LLQA 1QO0D 4IVNA 3FM5A 2WV0A 4IXAA 2EB7A 3TO6A 3GX4X 4I09A 2CQKA 1ZAOA 5E18F 1QVPA 3BWGA 4I0BA 2NNNA 4IRIA 2R7DA 5DCMB 3S2WA 4M6XA 1ZGJA 1XSDA 1SD5A 3ZN1A 4EGYA 2F5CA 1KU7A 4FT8A 2D45A 3MQ0A 1I27A 1U5TB 3R0JA 1HW2A 1XCVA 5E8IA 3G3ZA 2O03A 5J6XA 3SFZA 1W5TA 2MBFA 1O3SA 1Q1HA 4GYGA 4IF4A 4O6JA 5L3DA 4LB6B 2DQLA 3QOPA 3T8TA 4HBLA 4RS8A 2FMLA 1TTYA 1K6OA 3ZQ7A 4WCGA 2XAGA 1P4AA 3F8FA 2P5VA 1P6RA 3VEPA 2Z99A 2MC3A 4KIGA 3E6DA 1U8RA 3MFKA 3J80Z 4MTDA 3T0YA 2K4JA 3VFZA 2FBIA 5KK1A 4S05A 3ROUA 1KGSA 2DBBA 3ZMVA 3H3UA 4OMYA 2O61A 1IRGA 3LSTA 5CVVA 4MEXF 2JZYA 1BJAA 3KP5A 2EFOA 4LMYA 2BV6A 4UV9A 3JAMZ 5HOOA 2E7XA 2XRNA 1BM9A 4EM2A 2WC2A 4R1HA 3CO7C 2F2EA 5ICFA 2M8EA 5JR3A 3WGHA 2L4MA 1IXRC 2LKPA 2UZKA 4L0YB 2RNJA 2VE8A 4L5IA 3TDZC 3KETA 2Q0OA 3R6SA 3B73A 1HKTA 2RKHA 3M1EA 3T5XA 1R58A 4IHSA 2MD5A 1SMYF 1RIOH 2HTSA 3P7NA 2CWEA 3WU1B 1G3WA 3BP8A 3M8FA 5D5XB 4BHPA 2IA0A 2STTA 3CTAA 5IT9K 4P5OA 2P7VB 1OPCA 1IZ1A 3MWMA 2ISYA 2EJRA 4HV6A 1MKMA 1LEBA 1YS6A 1J9IA 1IN7A 3C1DA 2BE5F 2IP2A 2ELHA 1YTYA 1G3TA 1ONVA 2K86A 1MZBA 4LJZF 3RKYA 1KQ8A 2F5DA 1S29A 4YG2F 3I5UA 1V3FA 4IRGA 4M72A 3KP7A 2ZNYA 3GW2A 3HUGA 3MZYA 3SZPA 4K2EA 4RGRA 3WE3A 1H9TA 4UVCA 1YO5C 4HF1A 5K5OA 1BBYA 2HKOA 1IN6A 1J2XA 1G3YA 4GO1A 3HSFA 5ILSA 3U2RA 4WXHA 2XHKA 1HSJA 1BIBA 2LNBA 1O57A 5DV5A 4KYWA 2G9WA 2HDCA 1XN7A 3LWFA 2EFWA 2GA2A 4LFUA 1B4AA 2EFPA 2VC1A 4HF0A 3TOBA 2XV4S 3HSEA 4EVIA 3ZPLA 2COMA 3LQQA 1ZRDA 1QZZA 3I59B 3FWEA 4CGZA 4MEYF 2E7WA 3T1BA 1DUXC 2W85A 4MQVA 2EWNA 1ODDA 1T39A 4ZZLA 1LDKB 3CO6C 2TDXA 1O7LA 4I2OA 4RB2C 3C18A 5BOXA 4A6DA 2IA1A 3R61A 2PMUA 1UHWA 3WU0A 5ICEA 1J7KA 2HGCA 4I7HA 2CYYA 3FMRA 2P8TA 4N0BA 2XAHA 3FXQA 1J0RA 1U78A 2GWRA 1MDMA 5TRDA 3DEUA 5CLSA 1IN5A 4KN7X 3CLOA 3J81Z 2XKOA 3BPVA 2CW0F 4CO8A 4O3MA 4WX9A 1MGTA 5HLIA 3HTSB 3L00A 3Q9VA 3V7CA 2Z33A 5FO5A 3P9IA 1BC7C 5ICGA 3R4KA 3F72A 3ZMSA 2IPQX 2K5IA 2PN6A 1KQ0A 4G7ZF 3K69A 2IT0A 4Q4ZF 3HRMA 4AIJA 4U0YA 1ZRCA 5E1WA 2EV5A 1L3LA 3SHFA 4Q5SF 1IRFA 4CXFA 1S3JA 2MLGA 1PP7U 5BPDA 2FXAA 1D5VA 1G3SA 2JSCA 4GYIA 4L5JA 1ZG1A 5HS8A 4RB1A 2CFXA 1DDNA 2OZUA 3KEOA 4KDPA 3JAMK 1ZRFA 3FHZA 2E1NA 1LNWA 1GXQA 1YW9A 2DK5A 3TKYA 5ED4A 4QLCU 2STWA 4HX4A 3D0SA 1FSHA 2JPBA 4PGHA 2CGPA 4KMFA 2KIUA 1MJBA 3LQRA 2HQRA 2IA2A 1O3TA 1R1VA 2M45A 4HDUA 2M30A 2PBIA 5AIQA 5L3CA 1QBJA 4L9JA 2QZ8A 3GXOA 1ZREA 4N9HA 3ZMUA 2Z5UA 4XRFA 2K27A 4HF2A 3MHXA 2RVCA 5HDNA 4QWQA 2R7FA 2GA1A 2RN7A 3RI4A 4EJWA 2P5LC 2X4HA 1G4DA 3WODF 2R3SA 2VBZA 1SFXA 3GFMA 2QENA 4KT5C 5L3FA 1LDDA 2FRHA 2NNYA 2EFNA 2Y75A 5JHUA 3QP6A 3K0LA 4EJOA 3TO7A 2RGVA 1OYIA 2V1UA 3I71A 5LHIA 4CYDA 4IHTA 2XKPA 1U2WA 1HW5A 4R79A 5D4RA 3CDHA 2HTJA 1QZYA 4A5NA 2D2WA 4RB3C 4A0ZA 3MEXA 4AVPA 1XSXA 1UB9A 1XMAA 2A5YB 1MJAA 1FYKA 2RDPA 4OIOF 2FE3A 1S7OA 5AONA 2EV0A 3KLNA 2VOOA 3DF8A 1Z91A 2VT3A 2NS0A 4PCQA 5BS6A 4D0PA 3F6VA 3TOAA 3HRUA 4BQAA 1WSUA 4M74A 5D6FA 3GVAA 3O6BB 3I54A 2H6CA 1GHCA 4RGUA 3FF5A 3KP2A 3KFWX 5EEHA 3D5LA 5ILUA 2B0LA 3ECOA 1F5TA 1Z7UA 3DV8A 2M1BA 1OKRA 2HZTA 3FM3A 4L9VA 1W7PB 3ZN0A 1P92A 5L3EA 1HQCA 5BQTA 2IW5A 2P7CB 1YS7A 2HWVA 1S7AA 1F1ZA 4PZJA 1ZG5A 3ISPA 2VT2A 4G9YA 2FNAA 4KNYA 1X3UA 4LD5A 1FLIA 1U3EM 4LLGF 4IJAA 1Z05A 2ESNA 2P6SA 2A6HF 3GZ6A 4M9SA 2EA4A 2YX7A 1FWZA 4BAYA 2LDUA 5D5UB 3RYRA 2PMHA 1XB4A 4EJVA 1VTNC 1FZPB 3HSRA 4HDVA 1NHAA 3QU6A 2HS5A 3FMSA 1RZ4A 2JTVA 1D8KA 3HHGA 5BMZA 4KA4A 3HRSA 2FMYA 3E5QA 3H92A 5CYVA 5HDGA 3MAJA 4HAMA 3AAFA 3N97A 1ULYA 2DQRA 2LF8A 4RGXA 1YW7A 4FX0A 4UNOA 2WTEA 1TLHB 1KYZA 4U7DA 3VB2A 2GCXA 4KFCA 2DO7A 5LGTA 5K5QA 1STZA 5CVRA 1SD6A 1LJ9A 5DDGA 2BGCA 1XGNA 3KE2A 3Q5FA 1XGOA 1IAWA 3VOEA 1XGSA 1B6AA 3HYIA 3ECHA 3EUHA 2QM3A 2MH9A 2DFIA 4Q48A 3FZVA 1K78A 2ISZA 5DEQA 4ON0A 3ZP5A 5FFZA 4I01A 1ZLJA 4IPAA 2GXBA 3WTYC 5FGMA 2CO5A 5H20A 1BIAA 5DUKA 3SQNA 3M9AA 4GXOA 2FBKA 4YFXF 4H0EA 2W24A 2ZMEB 4A5MA 2YR2A 3F3XA 5CVUA 3ML6A 2V9VA 5HVQC 5E1ZB 3QRFF 2V79A 2EV6A 3NQOA 3COAC 1IF1A 2KIFA 3OOPA 2X0LA 1YQAA 1CF7A 5FLXK 2A6EF 1ZLKA 4AD9A 1OYYA 1SFEA 3GFJA 2FEZA 4KIFA 1TQIA 4FX4A 2O8XA 4HV5A 4ENKA 3U9GA 3MCZA 1T2KA 4BH9A 1B9NA 1R7JA 5F64A 4NHJA 4M9XA 1H9GA 4LGWA 3IKVA 5D6EA 2J5PA 2XGXA 4R8HA 1SFUA 2ZCWA 2IRFG 3R60A 2D1VA 1JGSA 3F23A 4KN4X 3EDPA 1JXSA 5DD4A 3WG9A 4L0ZB 2FU4A 1R23A 4ENJA 3EETA 5H6RA 4KMUX 2YPRA 2FA5A 5FD5A 4OU0A 4EJUA 2QQ9A 4YFKF 1S6LA 4UXNA 4BHBA 2QLZA 3RIRA 2BEOA 2V6CA 3QPTA 1AOYA 4CICA 1FP1D 1V4RA 1JHHA 2Y48A 4CZZA 4O5VA 2DPUA 4M73A 2QWWA 1EH6A 2M87A 2PLYA 3RDIA 4G94A 3GFIA 5AIPA 2BBYA 4IRHA 4Q47A 5J8CA 2XASA 2MH2A 3JW4A 2DPDA 1KU3A 3BDDA 1LDJA 3WTZA 2H94A 2OAZA 3RJPA 2A69F 1WQ2A 4P9UA 3SZTA 4JBAA 3WTXC 1Z6TA 4WXDA 5A2QK 1E2XA 4HW0A 3FXUA 5FD6A 1O3QA 3V7SA 4ZH4F 1HXDA 3P9CA 3IC7A 4LLLA 4DQ2A 1ZG3A 3G73A 3MZHA 3E6BA 3PFIA 3I58A 4L9TA 3KP6A 2QYOA 3HRTA 2F5EA
chains in the Genus database with same CATH superfamily
2KT0A 2O9VA 3MEVA 2LX9A 4NUBA 2JTMA 2BY1A 1YJNI 5GAN3 2E1MB 1CSKA 1XD7A 5FJ8J 1KA8A 3SYTA 1JKQC 4XOPA 4UUVA 3EH2A 4XR6A 1FT9A 3QIIA 3WE2A 4HZFA 3DLLF 3T9NA 2QXFA 3SWNC 1H89C 2K7LA 3CMAT 5DCFA 2Y0MA 3EFOA 3JCMb 3P9KA 1ZGAA 1A6QA 2CW8A 1OISA 2GAUA 3ELKA 3IKTA 1IC8A 3Q0WA 5LJ3e 2DMOA 1VQ8I 2DMQA 5DTDA 1OJLA 1MSFC 2BUDA 2LQWA 1ZH5A 4OMQA 3VUZA 1HD3A 2OQGA 1KC8C 3UT1A 3I4PA 2VC8A 4KUDK 3RPUA 4FT4A 1I81A 2OCEA 3OWTA 4IIOA 3GLXA 1W4SA 3DLMA 1WPKA 2RC4A 1I5ZA 4IHVA 2JRTA 3GF5A 3ZOBA 3MKYB 4OMLA 1DPRA 1WHUA 2CZ7B 1YJWT 3CXCA 4LDWA 1WHMA 4Z2YA 3VPRA 4I76A 4C9YA 2A7YA 4RMNA 2XUBA 3FKJA 4D7NA 1U8BA 1IG7A 1EFNA 2GQVA 2ROLA 3SDBA 2QSGX 5LJ5h 1A5JA 1VQKT 3FMQA 3I53A 3M3YJ 4ZDOA 2YT6A 2R5YB 2VBWA 5IT9E 4ATOA 4C5IA 2BXZA 2MW8A 2RHUA 1FBQA 1R4MB 1SD4A 3M8EA 1X1DA 4LK1F 4WXCA 2HOSA 4A4GA 4L18B 5IT9Z 3PJRA 1BR4A 1EX4A 3L2RA 4NC6A 2LY2A 3B02A 4NNJA 3OYHA 3JRHA 1BI3A 2HQHA 2RN8A 3OW2A 1M90U 2FJ1A 4B1RA 3VS4A 4YIFA 1GVJA 2MK5A 2NS8A 1VQKA 1JKPC 3GIBA 4R56A 1A35A 2FBHA 5GAHJ 1RUOA 2P0TA 5LJ5f 1PJRA 2FSWA 3KZZA 1D3YA 2P4WA 1LFPA 2NVUB 3DKXA 3ZMZA 4IKFA 2VONA 3IHUA 1JU5C 2QBYB 2X4XA 5A2QE 3CCUA 4KGVB 2LCCA 3SD4A 2GOXB 1MDMB 4M6VA 2QTXA 4F93B 2ZJRF 2ABLA 4D8DA 1I3AA 4NDLA 4C0ZA 2KAFA 1XDSA 5L23A 4G7HF 2CS3A 2M0MA 2ME0A 2DFUA 2D1HA 2VXZA 3M4OJ 4FETA 2GIVA 4EV0A 2COZA 2DVEA 2GTJA 4KJZA 1BA5A 1TSFA 4OIQF 1S72T 2KKOA 4BD3A 3CQZJ 1I6XA 4OMZA 1K76A 1DQUA 2GLOA 5LEJA 3LA3A 4M75B 4PL6A 2RHIA 1RKWA 2ZBKA 1IRXA 4OWRB 1WDXA 1Y8RB 3PQJA 3OYLA 2OD5A 3TREA 1Z7LA 1YI2T 4IHXA 2XAQA 2JT1A 1FC3A 4BJ5C 1YITA 4UVBA 2W25A 2COYA 4D8KA 2VUMJ 2RM4A 4J19A 1VQPQ 2UXNA 1YIJI 2BZXA 1K7AA 2LRDA 4B44A 5F1RA 1N9RA 2H6BA 1TW3A 2ADUA 4CUGA 2ED0A 3CC4I 2E3HA 2CGHA 2EA2A 2KROA 2CP0A 4DYQA 3EG3A 3W2AA 4MMLA 5KYXA 3FXMA 1LVAA 3E3VA 4E6RA 4ESJA 2LMJA 1VQ6A 1N27A 1K78B 3N4MA 3S93A 4ZGDB 4EMSA 1IN4A 3CJNA 4JZ3A 1Y0UA 2H09A 2O01E 3R0AA 4C3HJ 2LH9A 1ZKGA 3E1SA 3INZA 1IHWA 4RB0A 5GAMj 3HC7A 2MMPA 2GXGA 4M7AG 3BJ6A 1GCQC 3LAJA 3J80K 5ICCA 4LIUA 3HOUJ 3KP3A 3BJOA 4ITVA 3GBGA 2AKLA 2AIRB 3J81R 2HL5C 4M7DD 3F8MA 4PLIA 1WZOA 2E2JJ 2XPWA 3OR2C 2GF7A 2HEOA 1E3PA 3MKLA 4A12A 3EYYA 1TS9A 1MJ9A 1U9OA 2GBQA 1HW1A 2BVMA 1WHLA 1HSTA 3A8HB 5I2SA 2VN2A 2O88A 3IRQA 3A1PA 4A4HA 5KVRA 4LD9K 4ASNA 4AU7A 1U5TC 2NYXA 1FYMA 4B3XA 3RKXA 1BI1A 3W2VA 1PP8F 2H1LA 3IWZA 2JA5J 4PFOA 5TGTA 2NVTJ 2KT8A 2IVMA 2LRQA 1K9MC 4I98B 1R0CB 2IJLA 1GV5A 2JVGA 5GAEJ 2KIQA 3FLGA 2EK5A 3BT9A 3IAS2 2Y2ZA 3ABTA 5FLXZ 2KK4A 2NUZA 2K02A 4FHTA 5DYMA 1RI0A 1ZUYA 4M7AE 2AHQA 1JBMA 2D0NA 1B59A 2DA5A 4LNPA 2L54A 4S04A 3HL2A 2ZMEA 2HCKA 1R8OB 4NQWB 1LPQA 4DEYA 2W84A 2E1HA 2B9SA 2IBDA 2WACA 4HYEA 5D5VB 1TQPA 1W5CC 2J6FA 1BI0A 5HDKA 4D1QA 1K4SA 1OR7A 4QVCA 3B6CA 1X6OA 2BVLA 4XSZF 4C8QB 4RAYA 2ZKZA 3JRZA 2QA4A 2V1DA 2EGCA 2EINH 5EG0A 1L0OC 1NZ9A 5GMKi 1SAXA 4AFUC 1XCBA 2C0TA 4N4GA 1WGSA 2GTOA 3M57A 3CCYA 1H92A 4JRIA 5KCHA 3Q9SA 1Y1VJ 2KSSA 1M1KU 3R6OA 3NWSA 1BI2A 1WRJA 5B3SH 3CCMI 3FBIB 4G6QA 2QG9B 2M5WA 3J80R 5KYXB 2BKDN 1SEMA 2EPDA 3D5RC 4A4EA 4LK0F 3E5XA 2FPEA 1LE8A 4OMPA 2KQRA 4HNTA 1AOJA 3M0RA 3FIFA 3OMCA 4MZPA 3BR1A 1WIEA 1B1BA 1UGQB 5HCKA 4XTUA 3CMAQ 4BEHA 3ERED 3F8CA 3C0CA 2YUOA 1MBGA 4B43A 3EYIA 1BC8C 2GQQA 3CBPA 4KT6A 3KEQA 2J05A 2VASA 1T0FA 1XTAA 1WHJA 2MAMA 1D8JA 1VQ8A 1ZSZB 1IUYA 4MO7A 3V7RA 2PFBA 2ZO4A 1VQ5T 2VXEA 1RPWA 2BW3A 4C92E 3E5UA 3A01B 3WHCA 1ZX6A 1UMQA 2VBXA 2C6YA 1R71A 2N8GA 3GLLA 2H27A 1WYXA 3OBYA 1VQNQ 3QPHA 3O2PE 2DA9A 4J9FA 2HOTA 4HA8A 3MO8A 3TQNA 4E7LA 4YFNF 1SMTA 3QP5A 2HDWA 4U87A 1QCFA 4N9IA 2H8RA 1A04A 3V8JA 4AIKA 1F36A 3LWIA 5EJCA 3L2WA 4HQMA 5D8LB 4U0WA 2LK2A 4QW2A 3G6EI 4DOWA 2DMTA 4A4KA 5FFXA 2VE9A 2CZ0B 2O3FA 1R1TA 1BYMA 2CUZA 4KULA 5J4VA 1PKSA 3RTRA 2XVCA 1XDUA 2CT4A 2HQXA 2HSEB 2D0QB 4HLXA 2ROTA 2ELJA 3WTWC 1ETWA 4AYBA 1VIFA 3F70A 3LSIA 3MJXA 4HVUA 3L09A 3RKWA 1Q86C 1IZ6A 2E19A 1U9NA 5BPIA 2L4AA 2WBMA 1QP2A 4BS9A 3PVLA 2W82A 3NTKA 3JAME 1T33A 1WCMJ 2XIGA 2YU3A 5M5XJ 2CP2A 2NUTB 3K1NA 2K3PA 4C8QF 2RJEA 4IQJA 5LJ5j 2MIOA 4QQ6A 4ZYHA 3K4BA 2DTZA 1U0JA 5ERIA 2J5OA 4IHWA 3OSVA 2Q2EA 2A3SA 3LSMA 4MNUA 2EQKA 4M75E 4M77E 4BXXJ 3VRZA 4OIRF 3ZXSA 2JUFA 3WTSC 1W4MA 5C44J 3ZMTA 4Y13A 1N77A 2DE0X 3DFGA 2E5ZA 1UG0A 4M3GA 1GXPA 2EQMA 2CG4A 3HOSA 2MWOA 4HCKA 3ZBDA 1ABOA 4P9FA 4U0VA 1XQHA 2O2OA 2ED1A 3BCBA 2DILA 5A2QR 3F8BA 4KIBA 4YELA 4PJOG 2P0PA 2HVSA 1T6SA 2E34A 3UWNA 2YHTA 2Z0WA 3CC2I 3W2WA 1QA6A 1YCSB 1FP2A 1W1FA 3SWNB 2A37A 5L8RE 1I5LA 3GBQA 1AZGB 4XRSA 5E3MA 2QGUA 1ZBJA 1M2VA 5D4SA 5CJ9A 1DP7P 3A2KA 1H8AC 5FU7B 5IHKA 1OOTA 2FRYA 5DM7R 3B6AA 2FF4A 3RCOA 3JB9I 2DFHA 4NQWA 5HLGA 1VQNA 4PGGA 2XD0A 3F0CA 1AWXA 1FXXA 1WZ2A 2L3QA 3M0UA 1LQ1A 1FTZA 1SHFA 4P55A 1TWCJ 2EYWA 1VQ4A 4Y7NJ 2DAOA 2DMPA 4A0XA 5HS9A 4FCYA 1Z3XA 5L3GA 4A54A 3E0JB 1Y8QB 1ZYRF 4HX8A 1BR1A 4OINF 1G6NA 3QBYA 4BI3A 2ZFWA 2R7OA 4DBHA 2JPCA 2EYXA 3JCMh 4FU6A 1KJWA 4AVZA 1TNSA 2FZGB 2WAEA 1TUDA 3DPLC 4V2GA 5IP7J 2JM9A 2W0ZA 2K4YA 5CK9A 2XROA 1PDNC 2OQRA 5GAMh 5GMKh 4BE1A 4DNCA 3BCAA 1OZ3A 2NAZA 1HKQA 2OTLT 2JS0A 4F92B 1MBKA 3CCSI 4S0HB 5EEGA 5DCMA 3M4GA 3REOA 5GAN8 3J7ZI 1NJIC 1R00A 1EIFA 4CYCA 4M78F 1OYWA 2O31A 3GNFB 2YX4A 2CQQA 3HGGA 1BOAA 1MNEA 4A3JJ 2JA7J 3DBHB 4C5GA 4HT9A 1HKSA 2L3SA 1W7PA 3CD6I 2F2WA 2C0OA 2HQAA 2JUCA 2OAUA 2PUOB 1ZR2A 2CH4W 1KQ1A 2DTOA 4MHGA 2KHMA 4DZPA 1Z9ZA 1SKUB 2ZPIB 5IHIA 4CC3A 3W6VA 2RREA 1N75A 4Q5WA 5ILVA 3PQKA 4GGGA 1KC8U 2ZJ2A 1Y6IA 3A4CA 5E20A 1QQIA 3BTLA 3FHNA 3OYMA 2E5QA 3IP4B 4M71A 3CPWP 5J26A 3W6KB 3CC7A 3CXCP 3DXJF 4BHCA 2RK2A 4JK1X 1FJLA 3QUIA 2QF7A 3GZ5A 3K1PA 3CLQA 1M3AA 2A3LA 2PEXA 2DYSH 5HS7A 1OFCX 2BY0A 2ZAEA 4XM3A 3CDIA 1RLQC 3VUBA 3OYYA 2PZ1A 4F16A 2ZMEC 2YSRA 2AS5F 4BY6B 1KU9A 5FKOA 3HOTA 1IUFA 3OIQA 1QHGA 4IEJA 4M75C 2DO3A 1KQ9A 1VQ5Q 2V26A 2VIXA 4C30A 2JVVA 3OMGA 4XTWA 3T8RA 1K61A 2MF2A 2AKKA 1O9SA 2L02A 5B5EC 2OTLQ 5L3BA 2PMZN 2VPLA 2EFQA 3DPTA 2OJ2A 3H5RA 4HEA2 2ECZA 1W5SA 3L2ZA 1VYTA 2MFZA 1OQYA 3O3KA 2OZ6A 5GTHC 2HYGD 4F7ZA 1RACB 1EV7A 4P96A 1VYUA 2DKGA 3LGFA 5LL6S 5LFAA 3PIOA 1UEBA 3RZDJ 3CJRB 4A3FJ 3M0QA 3LMMA 3SEMA 5KAIC 1O7FA 1FY7A 4ETSA 4X9DA 5FLMJ 4LB5A 3DTIA 3ZRGA 1P4WA 2P6TA 1U5TA 2JSPA 1UGRB 3C4SA 3J7AW 3CCET 5KYYB 2JA2A 4M9ZA 1QW1A 3H3VK 1OCZH 1X2KA 3LOCA 2KT1A 5LJ3d 1K73C 3V4GA 4B3AA 4F7UB 3HTUA 4OIPF 4LLNA 3CCLT 1GXIE 4V2FA 2VJ5A 4M7DF 3ABUA 2Y0SN 1M1GA 1SG5A 5E8GA 2F2XA 2KE9A 1J75A 2L3RA 2Y31A 3SDGA 3ONQA 2H8WA 2I5UA 1VUBA 2QUFA 5B1AH 1YFHA 3QZ9B 2DT7B 5JVTA 4ENMA 1T95A 5LRSA 4M78B 4ZYGA 5D8KB 2YLCA 1MD0A 3G71I 3E6CC 1RL2A 2K5FA 2WADA 3I56A 1R6RA 2X6YA 4ZTFA 1AD5A 1JRIA 1ZQ1A 1KC8R 2EJFA 4LG0A 3ZQCA 2F2VA 3I5SA 2VYTA 4EDUA 5LHGA 3J81K 1YHQI 2M0YA 2Y4YA 4HVWA 4I02A 3RPUD 5J8FA 4C2UA 1S8NA 2DRMA 2ZCFB 2HAXA 3GOXA 4ZYDA 5GTIC 2FUG2 3EGDB 1LFBA 1I1GA 3CC4Q 3M9QA 3CCVQ 2L01A 1C0MA 2KJBA 3WTUC 3IL2A 2LREA 5HLHA 3F21A 1I6HJ 4J7FA 1P7IA 3LA2A 4E7ZA 3EHRA 4WWCA 2JJ9A 1N6AA 4H4KC 3JV3A 1QGPA 5GAMd 1ZN2A 3TP0A 4JQFA 4GCVA 4E2FB 2KMUA 3OS2A 4BNCA 2DD4A 2F4OB 2PG4A 3BY7A 4HXJA 2MLKA 2XAJA 3BROA 1HJDA 2M4GA 1IV8A 2JWTA 3M53A 4OOIA 1FIPA 2I0NA 3ASKA 2Z2SB 1FOWA 1FIAA 2FQ3A 1M8MA 2GFUA 3RBBB 1R5GA 1WKMA 2PVDB 3BTJA 3J7AO 2Y4XA 4ORZA 2QEXT 2ACJA 3CCRT 4AYBN 1TBXA 1QNTA 3CUQC 2KVQG 4PJOA 5CKTA 1B8IA 2FHDA 2XB5A 3GUDA 4L9NA 4RGSA 4A3CJ 2H1KA 2BOLA 5D6WA 4Z02A 4HOBA 4EQQA 4NB5A 1JJ2A 3OSGA 1IN8A 3E97A 5F0CA 4B09A 1QCNA 2BZTA 4AFQC 1ZHFA 2KIMA 3GFLA 2RAEA 4QIWN 2E4HA 3TSZA 3OW2S 1YIJA 1YJ9T 2H8HA 4NC7A 2RMOA 5GAGJ 2PJRB 2KDSA 3UKGA 2R92J 4M78C 1OV3A 2HFHA 3O8GA 2UWMA 2DW4A 1TNTA 3JSPA 1APLC 2MA3A 2RA2A 2A68F 3F22A 1YJWI 1VQNI 3MZ8A 3M55A 2RQRA 1ENHA 3BG7A 5GAOq 3S1RJ 5E17F 2X1DA 3HOXJ 3I35A 2ZXJA 2CJJA 2JZ2A 1T8IA 3C94A 1VQ4I 3AT1B 5GMKl 2VODA 1BK2A 3CCRI 2VOPA 2J6KA 2DDAA 1IXCA 4PJLA 2CT3A 2DYIA 4J9BA 2VBYA 4CC4B 1MBJA 2RF0A 3JRGA 1AWOA 2L3DA 3GTOJ 1AWCA 2OPTA 1AEYA 3I55I 3CCUQ 2Q8KA 3U23A 3K1MA 3TW7A 5EF6A 3ULQB 2DU9A 1EH7A 2K3YA 5KCMA 3TSWA 2LP5A 3IH3A 1WLPB 4DYCA 4UV8A 3K4JA 3MEUA 3BJAA 3LFKA 1Q81U 3PTAA 1U6GA 3GEZA 2F5FA 1M3CA 3G7ZA 4KRTA 1V5GA 3GTJJ 2DOEA 1X2NA 4BGDA 2ZZDA 3ZQGA 2PI0A 2L9VA 2MSYA 1P4XA 1BCMA 4OGEA 1Q81C 2LKXA 1KD1R 3QODA 4KGZB 3ZL7C 1A0NB 4IOCF 2QKMB 2LC2A 2VVKA 2MGQA 2VC0A 3PFYA 2W7NA 4X6AJ 2LTOA 3NTHA 4BI8B 2QSHX 3CMAI 4WF2A 5H6QA 2MYSA 4FYXB 4IUUA 3ZEHA 2SEMA 1FPQA 1O75A 2HSPA 1IXSB 1NG7A 2DA6A 2MD0A 3KP4A 5KYNA 3JCMX 1B9MA 1FMWA 4CDGA 1UAAA 3BG5A 5GANd 1RABB 1DPUA 1E17A 4OB0B 3IWFA 2OTLA 2OF7A 2XF5A 1R36A 5LRRA 4GDFA 1XX5A 3I64A 2EYZA 4JUVA 4Y92A 2HKNA 2HQNA 3JRDA 2DMNA 1KU2A 5LGUA 2CV1A 3N05A 3KCCA 2DLLA 3OW2P 1YW8A 3W6JB 4PK4A 1R5HA 1LEAA 2KRCA 3K10A 2RQPA 1T3LA 3K70D 2VKHA 4RTXA 3R6NA 2WB1N 3HUGB 2IGNA 2FD5A 3RYPA 2CZ6B 4XU2A 5GJWB 4M75A 4CI0C 4PJOD 5LHHA 1FX7A 5F6FA 4RAZA 4DGWB 2DI3A 3IV5A 3I4MJ 4KH1B 2IS2A 4HT8A 4M7DB 3PGGA 2KBTA 1VQ6Q 2VXDA 5M3MJ 2KRMA 5GADJ 3K6GA 1H3HA 1U06A 3BTIA 1KHCA 3FIWA 2RD1A 1ETOA 2L7ZA 1UCRA 4WK8F 3F8NA 5DM6F 3BZ6A 2DL5A 3K4CA 1LPLA 2RV8A 3EPZA 1VQ9T 4FW2A 1M5Q1 2E1CA 3C7JA 4FE7A 5FB2A 4NL2A 2EVRA 1I3QJ 4ZYAA 1GL5A 2DT5A 4ESFA 2M4KA 1J09A 1D1BA 2VL8A 2ZXIA 3CCEI 1TWBA 4OVAA 4MLOA 4AMCA 4GY5A 4AFSC 1ETQA 4DJAA 3UDCA 2PVOB 3HIFA 3KUFA 1R77A 4EJTA 2K79A 2JN0A 1I1SA 3WGGA 1K8AC 1F4KA 5GANg 1VF9A 3VS7A 2ZJQF 3EQLF 1Z3YA 4UHTA 1B07A 2VJIA 5DD8A 3NEUA 4E70A 3DLLA 3H8ZA 3DP7A 1WHKA 4Y15A 2HXOA 4A53A 5GAN7 3CZ6A 3AHUA 1IRZA 3A0HC 5FKNA 1NYFA 3ZMDA 2JA6J 3HKSA 1I4K1 5EC7A 4F7UE 2QKLB 9ATCB 2OTJT 3MP1A 2Y9YA 5K7FA 2VWFA 4QKUA 2CKKA 2QEXI 2GZWA 2HDAA 2HOEA 3JCMQ 3WGIA 3CUQB 2X48A 2QBYA 3MPUB 1B34B 4HLYA 3TGNA 4C2MJ 2V1QA 4BXUA 3G6EA 3OS5A 1YCYA 2WWYA 2KY9A 4G7OF 3ABMH 2KI7A 3GF2A 2RQWA 1RNLA 4BI4A 2CV2A 3LX7A 3CMYA 1UFMA 2ZNZA 4N4IA 1Y56A 6PAXA 1J3TA 3P8HA 1GFDA 1FNNA 5KAFC 1JHFA 1XMKA 4XBFA 1JJ6C 1JT0A 1XJWB 1SD7A 2K5LA 4RTYA 1JJ2S 4XMYA 2EJ9A 2RQTA 3URGA 1UE9A 1ZUUA 3U1DA 4XKWA 1TWHJ 2R5ZA 3AKZA 1IV6A 2DK8A 1GT0C 2UXXA 4LITA 3RUXA 4D5CA 5HKCA 2Z9OA 2HOAA 2FB7A 3JSOA 2HMAA 4M3BA 4J9CA 2E6NA 3QHSA 2Z1DA 1VQLQ 1UTIA 2HL3A 2MCNA 2Z3YA 5EZGA 1MNMC 3JTHA 2DL4A 2VXFA 1FYLA 1TW2A 3V8LA 2V9PA 2R7TA 2CFOA 2G7HA 4AG2C 3QWLA 4A3KJ 3L7WA 2QEXQ 5LJ5d 2DEUA 5GPAA 1XTDA 1WHHA 1HBXG 3JAMR 2CW7A 5GAN6 1XS9A 1UHMA 1W2BS 1OI1A 3DBLB 3TO9A 4KUIA 4XL9A 4ZYEA 1VI0A 4XNFA 2YDLA 2EAYA 1Y07A 1C1AA 3HOWJ 2O9SA 5GAMg 2JMWA 1OU9A 4HCCA 4IUTA 1D1CA 1YE9A 2OA4A 1R5ID 4MGRA 5K7ZA 1B34A 1UGSB 3VWBA 3BOQA 2F1LA 2M02A 3K4KA 1AWJA 1N8RR 2YWWA 3LAPA 2OU2A 2EILH 3CXCS 4ESRA 3CPWS 3K2ZA 2MUNA 1YJNA 2W57A 2ESHA 2P0WA 4TV7A 1UG1A 1ZSZC 2IEKA 2LFBA 4CHUA 4PDKA 2ZC2A 3JSCA 5GMKm 2NWMA 1GBRA 1SSFA 1WNLA 3CCMA 2CSOA 2E10A 2X3WD 2Y69H 1LCKA 4ESBA 3JTGA 4RCBA 1GRIA 3LH0A 1JE8A 3DKWA 1WVRA 2FOWA 1W7PD 5E3NA 1QHHD 3ER0A 4RLFA 1ITYA 1BOBA 2CU7A 4OMOA 4PKCC 3CCJI 2CP7A 1NYGA 5E3OA 1QPMA 2XGDA 2VKVA 3E2UA 4P5NA 4F14A 5CQYA 1AHJB 2PQ8A 4Y17A 5IT3A 2QQBA 3NARA 5LBQA 1HLVA 3X28B 3F6OA 8AT1B 2E2HJ 1ZA1B 1VQLT 1G83A 2EFIA 1WPYA 3KZYA 2LF7A 4AIHA 1FOKA 1ABQA 1Y1WJ 1VOMA 4HCBA 1T98A 4KUMA 5GAOn 1ON2A 1ERDA 2WSFE 1FSEA 9ANTA 3HKZN 4A2UA 3CD6A 3HPGA 4CC7A 4M77D 3WTTC 1BJZA 1G5VA 1I39A 2VKEA 3L2CA 1O3RA 2VJJA 1CGPA 2DJIA 4MDWA 3CUQA 4PJOC 3GYHX 2VGNA 3JCMJ 1VQLA 3L2UA 3WTVC 2L3PA 4E7JA 1FOXA 4A6EA 2IG0A 4PSWA 5J4YA 3HP9A 3HHHA 1CKAA 1T0JA 2L7KA 3J81E 4RBOA 3KIOA 4U88A 3NFCA 3I59A 2PTKA 1CQTA 4XLNF 2A07F 4EMHA 2P5KA 5EDNA 3DB3A 3CCEQ 2XF7A 2NUPA 5HNHA 4EM1A 1OPLA 4G8XA 3NRVA 4XU3A 2VB6A 1WWXA 1KIKA 2OTLI 1ZSZA 1YN8A 1Z9CA 3SHWA 4J7IA 4QQGA 1PUFA 2VPRA 4J6XA 4M7DE 3FJPA 5FLXE 1VQOT 2FOKA 2QQSA 3JCMW 5I21A 3S16J 2AZSA 3X20B 2RQUA 3A0BC 1Z6RA 4AWXB 1PUEE 1VQKI 3S1NJ 4M75G 1D3BA 3CF2A 4C0DB 1PWTA 4KICA 1VQ8Q 5F04A 4LDUA 1GV2A 3FXKA 2HYFA 1YIOA 3S2HJ 1H0MA 1RI7A 2OV7A 2QQAA 2A0FB 2X1CA 2DM1A 3JCMg 3FC3A 1RUNA 2QDLA 4MQ9F 5JFRA 1NLPC 1WJ5A 3S1MJ 4UUSB 2JTEA 1RAHB 4JZ4A 3VYUB 2YSQA 1M2OA 4JS5A 2RNGA 2BZYA 1R1UA 4J9EA 1NPRA 2KYBA 3CMEA 5LGNA 1X58A 2NOJB 1HF0A 2R4GA 4B9WA 2A61A 3E9GA 2K4BA 1K79A 4BB7A 2CP5A 1XNIA 4HX7A 3E19A 3X26B 1OX9A 2FNPA 4HSTA 4YRVA 2ZPEB 3RKQA 3LSJA 2DTRA 2LSOA 4L5EA 1WI9A 5DUIA 3BZKA 2NRAC 2RJFA 3LH5A 3FXRA 3IRRA 2KXCA 2E36A 3LSGA 3CMET 5TJJA 5GAOm 2HR3A 4BYYA 1FBSA 2AXTC 1NJIR 3IH4A 3PIPA 2DZCA 4A0YA 3KLOA 1TT0A 3TEDA 1CKBA 3QXEB 4HNUA 3C3WA 1U1SA 1TQMA 1RAAB 1TZLA 2GOMA 1P2FA 2K9NA 4M7AD 2E12A 3LL7A 2B63J 1VQOQ 4Y3OA 4ZZDA 4U7BA 2HU9A 1HCRA 3A02A 5F27A 3G71A 3G1OA 4XTZA 4AT1B 2LT4A 5D5WB 2KRFA 4JJNK 2LD5A 7AT1B 3I0TA 5IH2A 4IURA 3JCMP 3ZQFA 2X85A 1USSA 5ECAA 1J5YA 2V4JC 3I56Q 2GNCA 4HQEA 2NUTA 1QVTA 1S9HA 3H5NA 1PHTA 4M3EA 5JI6A 1X4PA 1JTXA 3M56A 4FYYB 3V8KA 2X51A 4XQFA 2XK0A 3VKIA 2EKHA 3H9NA 1SVLA 1YYVA 1D1AA 1ORKA 1Z1DA 3DKYA 5CQGA 1VQ5I 1ZSGA 2HQEA 5FU6C 1MW7A 3ZQIA 5CVIA 2IS4A 2BHZA 2K5CA 1X3ZB 3A03A 2LVSA 1CF7B 4JPBW 1YJNT 3BPXA 3QO3A 1USTA 3S32A 1W36C 5LJ5e 2OTJA 2AXLA 2SRCA 2F48A 3WXMB 4ZGJB 3CCMT 4XSXF 1G2HA 1JT6A 4I0AA 1QKXA 1WH5A 4J9DA 5BNGA 1J59A 2ZXHA 4E7IA 2V1XA 3OIPA 2HNIA 3L9FA 4EGZA 4XLAA 2OI3A 1OCPA 3PSFA 1VA7A 4LE9A 4B8XA 3G6ET 4EIKA 1YLFA 2ZFUA 3KYCB 5K1YA 2O0YA 3CPWA 2EQJA 1F9NA 2J6OA 2DXIA 2H3JA 4J9IA 5KYWB 2YRCA 1ON1A 4EM0B 2EZLA 3CCLQ 1XGMA 2LNHB 2X1EA 5IPAA 2DTHA 2MPXC 3M7GA 5EG2A 1T38A 3H0DA 1ZQ3P 1C6VX 5E1XA 1JJ8C 5K5RA 1LB2A 3HL8A 3VS1A 2FEIA 3GNGA 1KYWA 3QU3A 2MABA 5A2QZ 1REPC 1VQPI 2JOYA 2XAFA 4YIIA 2F4MB 1ZARA 4M3DA 1VQ7T 3DQVC 4C8QA 2ETHA 2O6GE 3FB9A 3S2DJ 4MTEA 2JUGA 5JVGF 4F7UF 5CKHA 1E3OC 2EBPA 3TMOA 4ENNA 1NK2P 1WXTA 3H0FA 1ZBXA 1D0YA 4LG0B 4XORA 2KJCA 3TDUC 2XU8A 5GMKe 3DKMA 5E3LA 2EZHA 2L9RA 3NAUA 3RPQA 4LDXA 1YG2A 4JRPA 4PJOF 2KQWA 4FYVB 4DIQA 3VODA 5LEKA 4C92F 2V8KA 3RDVA 3BLYA 1KONA 3K9TA 3E9FA 3MEAA 4BDZA 3KBGA 2DX1A 3CC2T 3VYSB 2KP6A 2XF6A 1VNDA 4OGCA 5CVJA 1UECA 1XSVA 5EEAA 2DF6A 1E3HA 2HYJA 3BE3A 2MVTA 5IXFA 5FKMA 2KZVA 4XLPF 3Q1JA 3FX3A 3E6MA 5EYRA 4PUSA 2QVOA 4DYRA 4UVAA 2PJPA 1FYNA 3ZQHA 2FL7A 2X9DA 3CQTA 4M6YA 1K8AU 2IS1A 3CC7Q 4QPQA 1R22A 1WJBA 2R7QA 1EH8A 1W36D 4J8OA 2Y9ZA 4RA2A 1TP4A 1BN5A 1N8RU 1X43A 4ELZC 4NC8A 4M77F 1UELB 3CUOA 4OB2B 4PJNA 1B72A 1WFXA 3SXYA 2D6FA 3HXLA 3BY6A 1TU0B 2BE9B 2LY1A 2PMZA 3OBWA 5FU6B 4C8QD 4C8QC 1MSEC 2W4SA 4CA0A 1EJ9A 3WHBA 2G7UA 2OBPA 4YIRX 1M1EB 3LA7A 4A63B 2B8AA 5GAN5 2HKXA 4Z6YA 1C0WA 1JUSA 1TWAJ 2PUKB 3EG9B 2DOAA 3QAHA 5C6SA 3FXJA 3GO5A 3H1CA 1PD0A 3MCAB 1Y57A 5B1BH 3GWZA 1OMIA 2HZYA 3M0TA 1FBUA 4G6DA 1AU7A 1S72Q 1YHQA 1AA7A 2BYVE 3F9KA 4YEJA 4XQ3A 3GPLA 2KISA 1VQMQ 3OV8A 2DJNA 2XPVA 2A5WA 5IHNA 4HG2A 1UHCA 2Z16A 4PNOA 5CKEA 1IW7F 1K73U 2L2PA 3H3ZA 5LLQA 1QO0D 4C5HA 3EGDA 4IVNA 4OB1B 1VIEA 1WJRA 1Y39A 2DBMA 2F5TX 3RESA 4Z89A 5CR2A 2V6EA 3ZQLA 2CH0A 5C4XJ 4XLEA 1Y7XA 5FWCA 4C0DC 4BJ6C 3FM5A 2NUPB 2WV0A 1TC3C 2AQFA 5EGOB 4IXAA 2EB7A 1HOMA 1S1NA 3I55Q 1DJ7B 1X1BA 1G2BA 3TO6A 3GX4X 3VS0A 2EQIA 3CCUT 4J6YA 4I09A 2R0QC 2CQKA 4DBFA 1ZAOA 1RUWA 3CC4A 5E18F 2FZKB 2M2EA 2VQLA 1WX6A 1WJDA 2R5ZB 4QVDA 1QVPA 2RNAA 3BWGA 2VQHA 4I0BA 1RC9A 2NNNA 4II1A 1VQOA 3IQLA 1PRMC 2V7FA 2XC7A 4IRIA 1RETA 3X25B 3HFNA 2R7DA 3UA7A 1JJ2P 5DCMB 3S2WA 2LOOA 1ZGJA 3KYDB 1SD5A 4M6XA 3ZN1A 1XSDA 3HDDA 4EGYA 2F5CA 4BEHB 1KU7A 4FT8A 2D45A 1OCOH 3MQ0A 1I27A 3OOUA 1U5TB 1QVGA 3G1LA 3R0JA 4FM4B 3U21A 1K73R 1HW2A 1V5EA 5KCOA 1XCVA 3HG9A 5E8IA 3G3ZA 2KDOA 4C92A 2MZ4A 3BR5A 2ATCB 2LCSA 1SVMA 2O03A 1F1BB 1VQMT 1YI2I 2BE7D 1SRMA 5J6XA 3SFZA 5A0GA 4G12A 3RZOJ 3OIOA 2M34A 1W5TA 2MBFA 1O3SA 3S17J 4FTHA 3CC7T 2ME6A 1PYVA 3V42A 2M16A 1D0XA 3A8LB 5D6XA 3GTKJ 3SDZA 1Q1HA 3S14J 1E6HA 3DU5A 1BU1A 4GYGA 2KRSA 1VQMA 1W0UA 4IF4A 1RAEB 4O6JA 5L3DA 4LB6B 1NBEB 3CCQA 2R57A 1D3BB 3TVTA 2DQLA 3CCVI 3QOPA 1MIJA 3T8TA 2AHJB 2DD5A 4HBLA 4RS8A 2CUBA 3CBMA 4XK4A 2FMLA 2JJ7A 1GDTA 2JMAA 3KEYA 4J83A 1TTYA 1K6OA 3ZQ7A 4WCGA 4M75F 3PNYA 4XOTA 5GAMf 3CF5F 4LXCA 5GPCA 1K0SA 1AWWA 2GXAA 4A3MJ 3BDUA 3G71T 2XAGA 1P4AA 2E71A 2K9QA 2XSJC 3BQZA 5LJ3h 2ELKA 3ZCOA 5KYWA 1WGXA 1YX5A 3F8FA 3EG9A 2P5VA 1P6RA 4II2A 3VEPA 3JREA 5IP9J 3G1JA 5I22A 4FW1A 2DA7A 2XG8D 5AYFA 4RKUE 4D9JA 2IPOB 1YI2Q 2Z99A 2MC3A 3VSLA 2KLOA 4FSXA 2ID6A 4KIGA 3X2QH 3CC7I 2KXDA 2TCTA 4BE2A 2VKNA 3CPFA 4C92C 3E6DA 1U8RA 1TG0A 3P8BB 3IUOA 1SC7A 3MFKA 3J80Z 2EBIA 1GFCA 2QGFB 4I6ZA 2VV5A 4J5YA 4VUBA 4MTDA 1Q86U 3T0YA 3NPFA 5IYBJ 1PNJA 5FKKA 2K4JA 4B9XA 5F1JA 2LP0A 3VFZA 4PFPA 2FBIA 2XRLA 1YRNA 2XI9A 1HYOA 1I0CA 1WJAA 3SWNA 5KK1A 3BG3A 3S15J 1JUMA 4XU0A 3DEEA 4S05A 1UUEA 3UR3C 3ROUA 3S3NA 4M77A 2F6CA 4WCIA 1KGSA 3H9QA 1Y0MA 2DBBA 3CCJQ 2EPFA 3WU2C 3H3UA 3ZMVA 4F91B 2HD0A 4OMYA 2O61A 2LY9A 1IRGA 2W10A 4HSRA 2M7BA 4RAFA 3VRYA 5IXBA 3A5ZB 5LJ3j 3DBRB 2WY7Q 3M1CA 1V76A 3LSTA 2DERA 1RQ6A 5CVVA 4MEXF 2ZSHB 4BJTA 5C0MA 4IHYA 3CESA 2JZYA 1YHQT 5DLOA 2A36A 3H0GJ 1YIJT 5IYDJ 1BJAA 3KP5A 5J1UA 3QYFA 2DEQA 2DYRH 1UGPB 3KZIC 1AKHA 4PFZA 2EFOA 4LMYA 2K9SA 1VQ7A 3I4NJ 2BV6A 4UV9A 3JAMZ 1P7JA 1OEBA 1EF4A 4LDYA 5HOOA 1LUJB 1SAUA 2E7XA 2XRNA 5IT9R 4J01A 1BM9A 2BXYA 4EM2A 1U1TA 2VQGA 2F4IA 3OSSC 1B7TA 1K1ZA 2WC2A 1GVDA 4R1HA 1Y96B 3RR6A 1VQ9A 3CO7C 4A3EJ 2F2EA 2PVGB 2L9SA 2O4XB 2AQEA 5ICFA 2M8EA 2E1OA 5JR3A 3WGHA 5I2MA 2L4MA 1IXRC 1JGGA 2LKPA 2CRGA 2B7EA 3VJPA 3META 3HOVJ 4JOMA 3TW6A 2UZKA 4L0YB 2ECBA 1V1CA 1RLPC 2RNJA 2E6ZA 4LUDA 1M1KR 3JCUC 2KFDA 2VE8A 1QWFA 3C95A 1VQ6I 4L5GA 5JLWA 4PJ0C 4L5IA 3PO3J 1TT5B 3TDZC 5FRNA 2LX7A 4IQ4A 3KETA 2Q0OA 3EFSA 4J9HA 3R6SA 4LIVA 4DW6A 1WQWA 2WAFA 3B73A 2DVJA 4L59A 3A01A 1HKTA 2QEXA 2RKHA 3ZFJA 1SANA 3H36A 3M1EA 2PQWA 4MFEA 1JEGA 4N4OB 2YRDA 3A8GB 3QPLA 3T5XA 1R58A 2QQRA 4BBRJ 2XKOC 1Y0NA 3DLAA 4IHSA 3PIPF 1R0BG 2MD5A 1WXBA 2FZCB 1SMYF 2GFAA 1UDLA 1RIOH 2YUQA 1YJNQ 4JJCA 2HTSA 3P7NA 4JJBA 3CCMQ 1QVFS 2CWEA 3WU1B 1G3WA 3BP8A 1YWOA 2CYZB 3M8FA 2R5YA 1BW5A 5D5XB 1S7EA 2D1XA 4ZNXA 1LKXA 4BHPA 1R49A 2R7XA 2IA0A 4QQDA 1ETXA 5E79C 2STTA 1PCXA 3D7SB 4M7AC 3CTAA 5IT9K 4OB3B 1P9QC 4P5OA 1MH3A 2P7VB 2XGCA 3EG1A 4OMMA 1OPCA 1IZ1A 4AFZC 3HEFA 5FWBA 3MWMA 2ISYA 2EJRA 2ZSIB 2M1HA 3L1AA 1VQOI 1KQSP 1M27C 1D0ZA 3P8DA 5GANh 3PVQA 4CC2A 5EG0B 3JRFA 3CC2A 4HV6A 4IZZA 1S72I 4N0AC 4KT0E 2RI5A 2DCEA 1MKMA 2A6TA 2AO9A 3ABKH 3HM5A 1LEBA 1YS6A 1J9IA 2XPUA 1IN7A 4LG3A 4ANJA 3BQYA 3C1DA 2ECCA 2BE5F 2IP2A 4XKVA 4XICA 2R7UA 1GCQA 2ELHA 2EIKH 1K9AA 1UJ8A 1YTYA 2JXBA 4C0FA 3JB9H 1G3TA 1MMSA 2FPDA 1ONVA 2NVYJ 2DZ9A 3PIOF 4BBSJ 2RB6A 2K86A 1MZBA 1NPPA 2XB0X 4LJZF 5TISC 4IOAF 2WSEE 3PT9A 1YJWA 3RKYA 3Q0UA 3PMTA 4QVZA 1NTCA 1KQ8A 1M1FA 2QDYB 2F5DA 8ATCB 1S29A 3OYGA 3HB9A 1XOVA 2Y90A 3K4LA 3LW5E 3LWHA 4YG2F 4A3IJ 2R7VA 3D5SC 3I5UA 4BQQA 3GZNB 1M9SA 1R4NB 2X4YA 1V3FA 4B48A 1TOVA 4IRGA 4M72A 4C92D 2H3EB 2JMCA 4HKEA 2K9MA 3KP7A 4XN3A 1Y96A 1JKOC 2IGMA 2ZB9A 4CCOA 2ZNYA 3GW2A 3HUGA 3MZYA 3SZPA 4K2EA 3C2HA 4RGRA 2HVRA 1WJQA 3WE3A 3GTMJ 2RQVA 3I3LA 4HRIA 1H9TA 4UVCA 1YO5C 3JCMc 1WFWA 4HF1A 4DBRA 5K5OA 1EZZB 2A28A 1BBYA 4GRIA 3HZJA 2HKOA 2NXNB 3A52A 1HK9A 2LQ8A 5J3BA 5GANe 1IN6A 1J2XA 1G3YA 2RQQA 4GO1A 3HSFA 1SSHA 2JT4A 3TEEA 5ILSA 2K40A 4Z8AA 1IDYA 1OX8A 1BR2A 4FSSA 3M54A 2DFEA 2DA3A 3U2RA 2DL8A 1Q95G 3O5ZA 4JS4A 3CMMA 2DETA 1U3OA 4WXHA 2XDDA 2XHKA 1IGNA 1HSJA 3BG6A 1BIBA 1WJEA 1T08B 3PUFA 1N9SA 5CIUA 2LNBA 3H6ZA 4EMKA 3GTGJ 1O57A 1I50J 5DV5A 5DS9A 4KYWA 4PJOE 2G9WA 2EGEA 2HDCA 1K9MR 4F55A 2MI6A 4X0GA 1XN7A 3LWFA 2EFWA 1O4XA 1OULA 3CC2Q 2GA2A 4LFUA 5F08A 1B4AA 3PNVA 3TBIA 2EIFA 3LLRA 2EFPA 2X9HA 2E65A 2VC1A 1YRNB 4HF0A 3TOBA 2XV4S 2RPNA 3HSEA 3UF4A 4EVIA 2CDTA 4F3QA 5J47A 1UG2A 1RAGB 3ZPLA 2COMA 3LQQA 1ZRDA 3UATA 1QZZA 5GAN2 3EUKL 4J6WA 4XK8E 3I59B 1ETKA 4MFDA 3FWEA 1YX3A 4CGZA 2EZKA 2E7WA 4MEYF 3T1BA 1DUXC 3OMYA 1UJ0A 2W85A 4MQVA 2FPFA 3UPUA 3JB9G 3LYIA 1Q7YR 4JX6A 2E5NA 2YUPA 2EWNA 1ODDA 3Q0VA 1T39A 2CH4A 4ZZLA 3WVEB 1LDKB 3CO6C 1LJOA 4RTVA 1QVFA 5LJ3g 1V5FA 2XGEA 3AG4H 2TDXA 3QQAA 1MMAA 5GMKj 1O7LA 4I2OA 4RB2C 2LQNA 3C18A 5BOXA 4A6DA 3OYKA 2L89A 2IA1A 3R61A 3DTEA 2PMUA 3ZGKA 1RR8C 1IGQA 1WI3A 3SFMA 1IXDA 1HSQA 1UHWA 3HHTB 1YITI 2LQKA 3OYIA 3OYNA 3WU0A 1X3WB 5ICEA 2GQIA 1BL0A 3CCEA 2HZDA 1J7KA 2HGCA 3OYEA 4I7HA 3QYGB 1KQ2A 1FTTA 2M9HA 4MIMA 3FK7A 2CYYA 4IL6C 4A69C 2EQRA 1QCOA 3REBB 4PSXA 1QMCA 3FMRA 2P8TA 3CCLA 2K57A 4N0BA 4BL0B 1NEGA 2EGAA 1JTYA 2IXSA 1KK7A 3M07A 2QTVA 3EGXA 2V1RA 2XAHA 2R7ZJ 3I55T 3FXQA 1J0RA 4UUSA 4MMKA 4XTXA 1U78A 4WTOB 2O9LA 2LMDA 3FKIJ 4M7DA 2GWRA 1MDMA 5TRDA 2IGKA 4V2SA 3DEUA 5CLSA 2M0OA 5CQXA 1QVFP 2M3AA 4G6TB 3KXTA 3TP3A 3G4SA 1ZHIA 1IN5A 1ETYA 4F52A 3EUAA 4KN7X 3CLOA 1IO6A 2K6DA 2YU9J 3FK6A 3J81Z 2KNBB 1VQNT 4UUTA 2CS7A 4M78G 4C0GA 2W48A 1RRJA 4HPQA 1Z21A 2XKOA 4Y52J 2HQ5A 4EEFG 5GAN4 3CCSA 2F5VA 1UFFA 2QAZA 3BPVA 2CW0F 4CO8A 4O3MA 1X6BA 4WX9A 1MGTA 5F0HA 3EH1A 4M7AB 1TWGJ 3SEQA 5HLIA 1SF9A 5DLQE 3HTSB 4DOZA 2QA4Q 2DN0A 1MV3A 3L00A 3J80E 2CV0A 2HI3A 3AL0C 3Q9VA 3V7CA 5IY5H 2Z33A 2DOFA 5FO5A 3UNGC 3J7YJ 1JB0E 1N78A 1K0XA 2EH3A 2GIZA 3P9IA 1MV0B 1QKWA 2CSQA 3GTLJ 1RADB 2LYCA 1BC7C 4DEXA 1TWFJ 2LVMA 5ICGA 1PG5B 3R4KA 4DA4A 3F72A 2CQNA 4BE0A 1M90R 3ZMSA 1Z77A 1ZTRA 2DDBA 2IPQX 4IUPA 2K5IA 2PN6A 3VS6A 3C2GA 1KQ0A 2NLUA 4GLMA 1YFNA 2P84A 3CCRQ 2XIDA 4G7ZF 1DGWY 1OPKA 2ESWA 3K69A 3H41A 1MUZA 2IT0A 4Q4ZF 2WY8Q 3HRMA 4ABZA 4B4CA 1WA7A 1SFKA 4AIJA 1YJ9A 5B66C 4U0YA 3UA6A 1ZRCA 2HNHA 5E1WA 1HDDC 2WAQN 1BW6A 1UHSA 2M8GX 2EV5A 1E6GA 4Y33A 4ZJZA 1L3LA 3CC4T 3SHFA 2JN6A 4KITB 4LDVA 4Q5SF 3M4YA 1Q1VA 2Q2EB 2HXIA 4AG1C 1IRFA 1X1PA 4CXFA 2DJZA 1MGQA 4CCJA 1ZK8A 1S3JA 4CCLA 2MLGA 1NE8A 2KYMA 1PP7U 1K4TA 4BY1J 1SRLA 4RTWA 4A4FA 1IB8A 1KQSA 5BPDA 4XTVA 4BQOA 2P0QA 2FXAA 2ENMA 3QKJA 1D5VA 4UY8I 3VDXA 1G3SA 4XLFA 2X6XA 4C5EA 1KSWA 2JSCA 3DPUA 4GYIA 4L5JA 1OQKA 3OL3A 2GM4A 3DWLE 1ZG1A 1GCPA 2CQXA 2LLKA 4W1UA 3MP6A 5HS8A 4RB1A 1T0FC 1WH7A 4RCCA 3REAB 1VQ4T 1Q7YC 2CFXA 3OS1A 2K2MA 1DDNA 1H8KA 5KH6A 2FQ4A 3MD2A 5DY9A 2OZUA 2WB1A 3KEOA 3CCJT 4KDPA 5CCAA 3N5BB 3JAMK 1DGRM 1LOJA 2M0CA 2E60A 1ZRFA 2JRMA 3FHZA 4KGXB 2E1NA 2EZIA 2VUBA 5LD2C 1LNWA 1GXQA 5C4JJ 1YW9A 5LJ3f 5M3FJ 1VFCA 2AK5A 2DK5A 2Y30A 5GJVB 3ULRB 2DT6A 3TKYA 4V19K 2CREA 3MKWB 3PO2J 1M1KC 3OYAA 3L2QA 1RR7A 1Z9QA 1I8FA 2YLBA 1PD1A 5ED4A 3SB2A 2L5QA 2LTPA 4QSHA 3RQ4A 4QLCU 3ME9A 2STWA 2I10A 3D0SA 4HX4A 3H0HA 1QVGS 5F0FA 1WQ7A 3RERA 1S5LC 3CCST 1FSHA 3EHQA 1X75C 2K85A 4BDYA 2JPBA 4PGHA 1JO8A 4NL3A 1UJYA 4EMGA 2CGPA 4KMFA 2KIUA 3H5AA 1MJBA 4QPOA 3LQRA 2HQRA 2VLAA 2EIJH 3LSHA 2IA2A 4FASD 2COWA 1O3TA 1HC8A 4K11A 4E7KA 3L1PA 1R1VA 3M0PA 2XDVA 1YP5A 2M45A 5IYCJ 2IS6A 2EKOA 2CP6A 2L0AA 3CCQQ 4HDUA 2M30A 3SZGA 2PBIA 5AIQA 1OZ2A 2YUNA 5L3CA 1QBJA 2WSCE 3NHNA 4L9JA 2QZ8A 3GXOA 4N9HA 1ZREA 2E2IJ 5A0DA 2R5MA 4FISA 3ZMUA 2Z5UA 4E6KG 1H88C 1B72B 4XRFA 1VQ7I 3HFOA 2K27A 3H9JA 4IO9F 4HF2A 3X24B 4F7UA 2NVXJ 1YHQQ 3PFSA 4A3GJ 2FYKA 3M58A 4OAYA 4EATA 1X01A 3MHXA 2RVCA 4BU2A 3BR0A 3M8JA 5HDNA 3JR9A 1E7OA 1PSEA 1VQ9I 4QWQA 2R7FA 4C92G 3TU4K 5KYUA 2DL3A 4MZMA 2GA1A 2RN7A 1ETVA 2UUZA 4C3IJ 1EKEA 3RI4A 4JP0A 2BHYA 4EJWA 3IAM2 5M5WJ 2P5LC 2X4HA 2FO0A 4C8QG 1JUPA 4Y4RA 3WODF 1G4DA 2V8JA 2JVHA 2CMPA 3MMYB 1YI2A 4M7AF 2R3SA 2BZ8A 2IVWA 2VBZA 4F7UG 4BKXA 1AVZC 1SFXA 3GFMA 5KNLA 1HDPA 1OCTC 3KFVA 2CUFA 4D6WA 2QENA 4Z88A 4KT5C 2KMTA 1GLNA 5L3FA 4RTTA 1MBEA 1R9TJ 1LDDA 2DA2A 2FRHA 3JRCA 2CP3A 4JLIA 2NNYA 3HJEA 2PJRA 5KYUB 2EFNA 2Y75A 5JHUA 4FQGA 1TXQA 3CCJA 3QP6A 3G4SI 3K0LA 4EJOA 2RH2A 2RJCA 3THKA 2JK3A 3TO7A 2RGVA 2DPPB 3HPHA 2HDDA 3GTQJ 1OYIA 2V1UA 3I71A 5LHIA 2HBPA 2V8IA 2WAQA 4A3DJ 4CCKA 1MH4A 4CYDA 2M35A 2EW3A 2KGTA 2OTJI 3QYEA 1MMDA 3EFRA 3JRIA 2UV1A 1T3SA 4F04B 4IHTA 2XKPA 2P81A 3OL4A 2VI6A 4RG8A 3QDRB 2FRWA 1XMXA 1GBQA 1U2WA 3CBOA 1HW5A 4R55A 4OAZA 2EQUA 4PLLA 1K6YA 4ZC3A 4R79A 5D4RA 3OY9A 1KHIA 4M78A 3CDHA 3SEZA 1Q82U 2EIMH 3FBNB 2HTJA 3QYBA 1QZYA 5GAOr 3GTPJ 4P1WA 3S8PA 3VU3C 4A5NA 2ZGWA 2D2WA 3Q3SA 5KHDA 2A05A 3OYCA 2LJ0A 4RB3C 2RI2A 3EAEA 4JYKA 4A0ZA 5FU7C 4IUVA 3MEXA 1YWPA 2X4WA 3JB9D 3K4MA 2K3FA 3DU6A 3GMEA 4AVPA 2QSFX 4TVRA 3FJ5A 3JCMV 2HKQB 1XSXA 2Y0SA 4IIMA 1MMGA 1YITQ 4M7DG 3AG1H 5GANj 1UB9A 3KPHA 3JCMf 1YBYA 4AIDA 2P4TA 1XMAA 2EYQA 4CSWA 2A5YB 3FISA 3VYHB 1VQPA 1W2BA 2X4JA 1MJAA 1FYKA 3MKZA 1VQ8T 2RDPA 2MOXA 2M9UA 4RLQA 4OIOF 2FE3A 1KQSS 4M7DC 3VS2A 1S7OA 5AONA 4D7MA 4E7HA 2EV0A 1BKBA 3KLNA 1QQJA 3ZR8X 2VOOA 1NG6A 4M77C 4PJOB 2JS2A 4ELYC 2WV1A 3DF8A 5FLVA 5CPRB 1Z91A 3QJYA 3VYRB 3VSKA 2JM8A 1KD1C 2VT3A 1HA8A 2IIMA 3K7AJ 2NS0A 2ZPHB 3M59A 4XKCA 1Q86R 3CJTB 4PCQA 2VQCA 5BS6A 2E41A 3RMQA 4D0PA 2OCCH 1FEXA 3F6VA 3TOAA 1IREB 3HRUA 4BQAA 1WSUA 3QWXX 4M74A 1MMNA 1X2QA 5D6FA 5EZHA 2R7WA 2K7AA 3FDRA 3GVAA 1OCRH 1GUUA 1Z67A 3AG3H 3O6BB 4LD6A 1QVUA 3I54A 3JB9F 4CCMA 2H6CA 1ZLMA 2PU9B 1X1AA 1XC5A 1PRLC 1TUGB 2XICA 4J00A 1ACMB 3HPWA 1GHCA 3H0IA 1K8AR 3AL0B 4RGUA 1PUFB 4M4ZA 2LJ3A 1QP3A 2CZ1B 3PUBA 4RDUA 3FF5A 5J3LA 4DZJA 5JHFA 1JQQA 2DMUA 3IH2A 3KP2A 2E64A 3KFWX 2K9GA 5EEHA 2OX7A 3BC8A 3D5LA 5ILUA 2K2VA 2B0LA 3ECOA 1V29B 2LBFA 1VQLI 1F5TA 3NGPA 2IGOA 3M5AA 1Z7UA 3QYHB 3DV8A 5GANf 2DLPA 3OA6A 1YOVB 3I56I 2M1BA 1W6XA 2CUDA 5LJ5g 4PJMA 1OKRA 2HZTA 3FM3A 3HOZJ 2J06A 4F17A 4C8QE 1TH7A 5EGOA 3I9QA 1ZUKA 2QK0A 3TQ7P 4M3FA 4RUGA 1H3ZA 4L9VA 4DBQA 2D8JA 1G8XA 1W7PB 2K3BA 2ZPGB 1X4OA 3ZN0A 3S3MA 1P92A 5L3EA 1MBFA 3ZQQA 1QU3A 1U5SA 1VYVA 1SVOA 2CSIA 3QWYA 5IN1A 1HQCA 1QLYA 2LZ6B 5BQTA 3S6WA 1QZEA 2K9LA 2IW5A 3H35A 1FMKA 2FVUA 3G2BA 3OS0A 4II3A 1YJWQ 2P7CB 4NOYA 5HODA 3PNTA 2JNGA 1PKTA 4ZTJA 1YNZA 1YS7A 2HWVA 1MNDA 3HTRA 1S7AA 1F1ZA 2BY3A 2C0IA 4PZJA 1ZG5A 2DJQA 3QPSA 2O7OA 4B47A 4ZGEB 3QDFA 3ISPA 2VT2A 3BDLA 1V54H 4G9YA 3U1KA 3CMAA 2M7AA 1PSFA 2RI3A 2KEAA 2FNAA 4KNYA 3SFIA 1M4ZA 4C3JJ 1X3UA 2HPIA 4LD5A 1U3EM 4XN0A 1FLIA 4B6MA 5GAOp 4M7AA 3BR3A 2D9TA 1XG1A 4LLGF 5M5YJ 2LT1A 4IJAA 2LJ1A 1BB9A 4JRKA 2W00A 4CRIA 1Z05A 4RG2A 4QTRA 4CYCB 1QWEA 2ESNA 1RAFB 1OR7C 3G1MA 2P6SA 3EGUA 1ZGWA 2DAQA 2A6HF 4EPCA 3J7AF 2OTJQ 3PE0A 3GZ6A 4M9SA 4CCNA 2FX0A 1SEUA 2DIGA 2EA4A 2YX7A 4UB6C 2DA4A 2YXYA 4ZN1A 1FWZA 5KYYA 4N0AA 2DXTA 3EFOB 2XAUA 4BAYA 1M30A 2XMFA 1LNXA 3FRNA 5J39A 1T56A 1RKTA 2Q1ZB 2I2LA 2LDUA 5D5UB 2XDPA 3RYRA 2PMHA 2F69A 4L6V5 4X1VA 5J40A 1A6IA 4KISA 2IAIA 1X6GA 1UZCA 4Y28E 1XB4A 3VV0A 5FW9A 3JCMd 1N5ZA 3S3OA 5CO7A 3DEWA 2YUSA 1OCCH 4EJVA 1QRYA 2L0KA 4M77G 1Z0XA 3JRBA 1VTNC 3TCJA 3CD6T 5IOYA 2QYZA 3OYBA 2KRHA 1I07A 1FZPB 3HSRA 3LFUA 2NVQJ 1EA3A 1D09B 4HDVA 1NHAA 5IAYA 2DXCA 1H641 4A3LJ 3QU6A 3EUHC 2K3XA 3MEWA 3I9V2 2G0EA 3JB9J 1YITT 3JRAA 1AT1B 1LFUP 1IHVA 1VQMI 2HS5A 3FMSA 2KDZA 1RZ4A 2XDBA 2JTVA 3HKZA 1D8KA 5IP6A 3J7AY 4E47A 2L7MP 3HHGA 5BMZA 1WJFA 3HRSA 2QCOA 4KA4A 2FMYA 1NEBA 3E5QA 3H92A 2D5VA 3FEOA 5HLTA 2HPMA 1X69A 4I99C 4RM3A 2L9NA 5CYVA 5HDGA 3MAJA 4JX4A 2AZVA 4HAMA 3AAFA 1TUCA 4XRMA 5FROA 3N97A 2BTTA 1ULYA 4JJDA 2DQRA 2LF8A 4RGXA 1VQ6T 5HNFA 1YW7A 4FX0A 3MP8A 2AT1B 2R93J 2NS7A 4UNOA 1OU8A 2FG0A 5HY6A 3C2BA 4R0KA 1SHGA 5H2FC 3LSPA 1M90C 3BR2A 3ESWB 2LG4A 2WTEA 3CP8A 1TLHB 1KYZA 4XRSG 2GBYA 4AC0A 2KRNA 2KR3A 2R5AA 4OF1A 5IOZA 3L2VA 2X6OA 3A1YA 3VB2A 4U7DA 1ACIA 2GCXA 4KFCA 2DO7A 2JA8J 5LGTA 3AFHA 2NOGA 5FRMA 3GP8A 5K5QA 2YRVA 1STZA 1VQ5A 5CVRA 1SD6A 5FKLA 4E4HA 4LUEA 1SPKA 3E7LA 1LJ9A 5DDGA 2BGCA 3HOYJ 2DRKA 1XGNA 3EG0A 3KE2A 4BACA 1RESA 3Q5FA 1XGOA 3VOEA 1XGSA 1IAWA 1B6AA 3HYIA 4W97A 1FOYA 3ECHA 1MBHA 3BR6A 3QZ5B 3RMSA 3EUHA 1NG2A 4GLKA 4X9CA 1ARKA 2QM3A 2DXUA 2MH9A 2X98A 2DA1A 5GP9A 1IDZA 2DFIA 1K4US 1YJ9I 5JLXA 3AG2H 2DNUA 4EMKB 2ZXWH 4Q48A 4A93J 5CKDA 1E0EA 2LC4A 1VQ4Q 3FZVA 3P5JA 1K78A 2JW4A 4OMNA 1M8VA 4RTUA 4AM3A 3QJ6A 2RHYA 4RTZA 2ISZA 4DOVA 5DEQA 1DP3A 3RQIA 4ON0A 3ZP5A 4MZTA 4BY6C 5FFZA 3VYGA 2DFFA 4I01A 2CUJA 2KPMA 2LBFB 4CH7A 3RNJA 1X19A 1ZLJA 2BW3B 2X6WA 4IPAA 3A8MB 2R7RA 2GXBA 5J1RA 3CCSQ 3WTYC 5FGMA 2RK1A 2CO5A 3PNWC 3G4SQ 1UGVA 3QOEA 5H20A 4RM2A 2ZPFB 2YS9A 1BIAA 5D7UA 2LDMA 3QG1A 1PM3A 5DUKA 5CKBA 2OC6A 3SQNA 1X2MA 4Y91A 3DTKA 3M9AA 4GXOA 4X1EA 2COBA 1W2BP 4HNVA 4HCZA 4XTYA 3VS3A 3G6EQ 2FBKA 2RHXA 1NJIU 3CD6Q 2QA4I 3MVPA 2VJ4A 4YFXF 4H0EA 1RAIB 2L8DA 2W24A 2ZMEB 1PC0A 2ZPBB 4FYWB 4OMFB 3VYTB 3I5RA 1DU6A 4XONA 4A5MA 2W1OA 2YR2A 1TL8A 3F3XA 5CVUA 3OYJA 4JDSA 3ML6A 2V9VA 1T0HA 5HVQC 1X1CA 4GFBA 1ZA2B 5E1ZB 2DBKA 2BY2A 3QRFF 2V79A 2BIVA 4UB8C 2EV6A 1POGA 3BG9A 3NQOA 4UC4A 2QQ8A 2RJDA 4IX7A 3COAC 4XU1A 3CCRA 5C3EJ 2LCLA 1IF1A 2KIFA 3OOPA 4XIDA 2X0LA 1IGUA 5A0LA 5GAOl 1YQAA 2LR8A 4RAGA 2XSDC 2DXBA 2QI2A 3CCQI 1CF7A 1N8RC 5FLXK 2A6EF 3I55A 3PL8A 1JKRC 1NK3P 1ZLKA 4GBQA 2DK3A 4AD9A 1OYYA 2V1NA 2RO0A 3WG7H 1SFEA 1F43A 1I5OB 3W3CA 3GFJA 2FEZA 4KIFA 2O8KA 2LNVA 1TQIA 2RHZA 4FX4A 3NMZC 2JQ7A 2O8XA 4HV5A 4XLHA 3U9GA 2O5RA 4ENKA 5D6YA 1KG1A 3MCZA 4ZN3A 5M9OA 1Y71A 1BBZA 1T2KA 2A08A 2X3XD 4BH9A 1W0TA 3PMIA 4NS5A 1B9NA 1R7JA 1JI8A 2I8DA 5KE3A 1VZ0A 1JXMA 5F64A 3LSRA 2V9KA 4NHJA 4M9XA 3CMEQ 1KFZA 1H9GA 4LGWA 2DL7A 3IKVA 5D6EA 2MWPA 4XKBA 1KZHA 4FE4A 6AT1B 5I11A 2JTFA 3CJQB 3MKDA 2J5PA 2XGXA 3CDLA 4R8HA 2ZCWA 3MN2A 1SFUA 1B3QA 4JLGA 2IRFG 3CCQT 4CZCA 3BW1A 1S72A 3R60A 2D1VA 1JGSA 3F23A 4KN4X 2ZJPF 3ASNH 3EDPA 1JXSA 4XLCA 1RI9A 1TTHB 4RMOA 2P0KA 4JX5A 2HEQA 2KL4A 1FMVA 4ME7A 2F5KA 5DD4A 1WJCA 5DM7F 4JRQA 2CQ7A 3WG9A 4AUXA 3CCUI 3CP2A 1I1JA 2X35A 5CKFA 1IO2A 4C2TA 4HVVA 4BY7J 2R58A 3OSFA 4L0ZB 1AKHB 5K7HA 1ZELA 2L7FP 3FXOA 2E1MC 2FU4A 1R23A 2HBWA 4ENJA 3G71Q 3EETA 2C06A 5H6RA 4KMUX 2R7SA 5CQEA 2YPRA 1XPXA 2FA5A 5FLXR 3EGXB 5FD5A 4OU0A 1LVKA 2ICWG 2CUEA 2OJED 3ERMA 3K4NA 3CMEI 4ZDLA 4ZDPA 4C92B 2P4RA 3JCMe 1Q7YU 1VQKQ 1W70A 2E5KA 4EJUA 2QQ9A 3ASOH 5J1YA 2OUMA 2O4XA 2PNIA 4NBQA 4YFKF 2E3IA 4J9GA 1S6LA 3CCVA 4IUQA 3LSKA 4FL6A 3VS5A 4KBMB 5HK0A 3NWTA 4UXNA 2G6FX 1SFOJ 1WJSA 4M78D 2MC4A 3PM1A 4BHBA 2QLZA 5AT1B 3M0SA 1W1WE 3RIRA 2BEOA 4XAXB 2DYBA 2V6CA 2ID3A 1KD1U 2LKSA 3RSNA 4LOCA 1D5YA 2M51A 3DB4A 3QPTA 2DTIA 3OB9A 2GGRA 5HK3A 4LN2A 3SJMA 1AOYA 1MHNA 4CICA 1AZEA 1FP1D 1V4RA 1JHHA 2Y48A 4CZZA 4E7SA 2QGGA 3NTIA 1WXUA 4O5VA 2DPUA 4M73A 1VQ7Q 2HVQA 2TRTA 2QWWA 3BFMA 4BUGA 5KE2A 3QSUA 1EH6A 3BTCA 1A31A 2M87A 3OYFA 2PLYA 4FIBA 1YJ9Q 3RDIA 2E35A 3BZCA 1PVEA 2PX9A 4G94A 2EYYA 1YIJQ 3HBLA 3GFIA 1WHGA 1VQ9Q 5AIPA 1A36A 2BBYA 4IRHA 4Q47A 5J8CA 2VGMA 2XASA 3TL4X 3S1QJ 4A3BJ 3L42A 2MH2A 3WVDB 3ABLH 3A8OB 1G59A 4D5FA 1K83J 3JW4A 1BCOA 4OP0A 2DPDA 2E70A 4FT2A 2QA4T 1KU3A 3BDDA 1LDJA 3K2AA 3DCFA 2H94A 3WTZA 1JXOA 1NM7A 2OAZA 3RJPA 4QT7A 4PJJA 1VQPT 2A69F 2DODA 1WQ2A 3KX2A 4BXFA 4P9UA 3KYLA 1UHFA 3I56T 3D1NI 3FXLA 3SZTA 2WA0A 3OR1C 4JBAA 4X34A 3WTXC 2L2OA 1NH3A 1WI7A 3LNQA 3H9GA 1OYXA 1Q82R 1Z6TA 4WXDA 2VKDA 3C12A 5A2QK 2MG4A 1ZR4A 1E2XA 4HW0A 3FXUA 1N25A 5FD6A 1O3QA 1Q82C 4BUPA 2D8HA 1K9MU 4MDXA 4M75D 3V7SA 3K70C 1AHDP 2J7IA 2XHCA 1V55H 2B86A 3CEYA 3EG2A 3OYDA 4BQNA 1M2VB 3G4ST 3O8HA 4M78E 4ZH4F 3HGYA 4KH0B 1HXDA 4M77B 4N4HA 3P9CA 5GAMe 2G3RA 3IC7A 4LLLA 1UB4A 2KZGA 5CAIA 4DQ2A 1Q81R 1ZG3A 1IJWC 2QASA 3LGLA 4EMKC 1QVGP 3O8VA 3G73A 3FDYA 1DU0A 2EJGA 4YTLA 1X27A 3MZHA 1OLTA 2NYSA 3E6BA 3PFIA 3I58A 4L9TA 1M3BA 1LE8B 3HSBA 3KP6A 2QYOA 3PSIA 1QPIA 3GCMA 3CCLI 3OQ5A 3A98A 4N4NB 1NLOC 2OAWA 1B8IB 3HRTA 3CCVT 2DIQA 2F5EA
chains in the Genus database with same CATH topology
3MEVA 2LX9A 2JTMA 5GAN3 1XD7A 4UUVA 1KA8A 3QIIA 1FT9A 3WE2A 4HZFA 3T9NA 2QXFA 3SWNC 2K7LA 3CMAT 5DCFA 2Y0MA 3JCMb 3P9KA 1ZGAA 3IKTA 2GAUA 3ELKA 5LJ3e 1H3ZA 2BUDA 1ZH5A 3VUZA 1KC8C 2OQGA 3UT1A 3I4PA 2VC8A 4KUDK 3RPUA 4FT4A 1I81A 3GLXA 1W4SA 3DLMA 2RC4A 1I5ZA 2JRTA 3GF5A 1DPRA 2CZ7B