1G3SA

Cys102ser dtxr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
212
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 64
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3sA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3sA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3sA03
4LGWA 3HYIA 1YW8A 5LHGA 1DUXC 4UUVA 3HHGA 1XCBA 3V7SA 5HLGA 4ESFA 3FF5A 3TOAA 3ECOA 5CVUA 1SFEA 4NB5A 3KE2A 4CZZA 5DYMA 5K5OA 1MJ9A 1ZGJA 4BHPA 5H20A 3WGHA 4KMFA 1FP1D 1FSEA 1WRJA 3R4KA 1G4DA 1KYZA 1KU9A 3HUGA 3IHUA 1GXPA 5CVVA 5ED4A 2IA0A 3QAHA 1LQ1A 3FZVA 1P4AA 2FF4A 3LSTA 5FO5A 3K9TA 4GGGA 3MFKA 2EA4A 1BC7C 3JTHA 4BHCA 4OINF 3H92A 5E1XA 4HX4A 5FLXK 3O2PE 4DNCA 3LWFA 3RDIA 4EQQA 2XAGA 1XSVA 3FX3A 3GF2A 2R7DA 1XMKA 4OIOF 1JGSA 2D1VA 3IWFA 2PLYA 3REOA 1IRGA 1GVJA 4KIBA 3FXQA 4KIFA 5DD8A 5JR3A 3DP7A 1EH6A 4HA8A 4S05A 1MGTA 4WXDA 4UVAA 4CXFA 4OMZA 5LBQA 1FYLA 3JSPA 1RZ4A 2BGCA 3LQQA 2EV5A 2O03A 4YIFA 5K5RA 1IRFA 1KGSA 2MC3A 3DQVC 3C1DA 5LLQA 3FMSA 4LG0A 1REPC 2MBFA 2XHKA 1D3YA 3CUQA 2M5WA 2O6GE 2TDXA 4HBLA 4HQMA 5L3FA 2PJPA 1BIAA 1IXCA 1SD4A 3FMRA 2P7VB 1J59A 1IAWA 2NS0A 1RI7A 3MWMA 3ML6A 1FWZA 1XCVA 4I0AA 4AWXB 5H6RA 4HOBA 3E97A 2L4AA 3WE2A 1IZ1A 3M9AA 3HOSA 1JXSA 4CDGA 2VBXA 5ICGA 4U0YA 6PAXA 3R0JA 1K6OA 4MHGA 1W4MA 1HW5A 2M45A 2Z3YA 2X4HA 3I64A 4AIKA 2EFQA 4G7ZF 4PCQA 3KETA 4LB6B 4YIIA 2OQRA 4KUMA 3IKTA 5FD6A 4WCGA 4EM0B 1D5VA 2W57A 3D5LA 1TQMA 2CO5A 3KZYA 1B59A 1ZH5A 3CLOA 2XROA 1KYWA 1I27A 1FLIA 4LMYA 4PDKA 4OIPF 2VBYA 2FEZA 2CW0F 3ZMVA 1S6LA 3WTXC 2LNBA 1U78A 1HQCA 2ELHA 2QYOA 1BM9A 1XGNA 4H0EA 4KT5C 1Q1HA 3V8LA 2QBYB 4MQVA 1PP8F 3ISPA 3QP6A 5FFXA 1ZG3A 2P8TA 3QRFF 1E2XA 3GO5A 2ZKZA 1ZN2A 4HYEA 4OIQF 1B9NA 1B9MA 3T8TA 1K7AA 5HS9A 4UXNA 4UVBA 3PQKA 5JFRA 2DU9A 2IJLA 2CWEA 1R00A 1USTA 3I59A 5L3BA 2VBZA 3P9CA 5F6FA 3TQNA 4Y17A 1LNWA 2J5PA 3ULQB 4K2EA 3HRMA 2UZKA 4ZYDA 1SD5A 3FMQA 2P4WA 1HKQA 1UCRA 4AIHA 2XGXA 4M72A 1DP7P 4M9SA 3ECHA 1YLFA 5CVJA 1HSJA 4FX0A 2WTEA 4KYWA 3I71A 4HF1A 3P9IA 2KJCA 1B6AA 1RNLA 2FBHA 3CUQC 2HYFA 1TLHB 3R0AA 1E17A 1J2XA 5DV5A 3LA2A 3ELKA 2IRFG 5D6EA 1W7PA 1OYIA 2ISZA 2KIFA 4ZH4F 1O7FA 4ENNA 4PZJA 2IT0A 3VB2A 4ENMA 1Z7UA 2ZNZA 3BJOA 4WF2A 1QGPA 3WTSC 2RNJA 2MLKA 3LAJA 4ZZDA 5D5VB 5DDGA 1CF7A 3GFIA 2EFWA 4L0ZB 4HLXA 4IXAA 5D5UB 2XAJA 1U3EM 5HOOA 4XLPF 3ZPLA 2P5KA 4HAMA 2WWYA 1K78A 2EA2A 2Q2EA 2UWMA 4NHJA 3WTZA 3N97A 1UHWA 3N4MA 1RUNA 1O7LA 1YG2A 2XIGA 5L3CA 4U7DA 1ON2A 4IRGA 1FPQA 5CLSA 3FWEA 2QWWA 3WTYC 1YQAA 5IT9Z 3IKVA 5AONA 1MD0A 1U5TA 3CUOA 2ISYA 5BOXA 4S04A 2VXZA 5JI6A 4BYYA 2GA1A 5HS8A 2JPCA 1AWCA 2VC0A 4M9XA 3KFWX 3LAPA 1FBSA 5TRDA 1XSDA 4MGRA 1TW3A 2XRNA 1FT9A 1JE8A 2R7FA 1HW1A 3HSEA 1G3WA 2AXLA 5LHIA 4IRIA 4G7OF 5AIQA 2GQQA 1BOAA 1R1UA 3T8RA 2GCXA 3WTUC 3EETA 1FYKA 1XMAA 3MHXA 2DTRA 5DCMB 2NRAC 3SXYA 3M1EA 1K79A 2EJRA 4P96A 4R8HA 4XLNF 4CO8A 1FZPB 2EK5A 1SD6A 3G73A 4R79A 5L3EA 2P5VA 1BI0A 1L3LA 4UVCA 3GFLA 4BXUA 3HRUA 4IJAA 4YG2F 2QVOA 1IUYA 2VOPA 1ZG1A 3GYHX 4RAYA 3VEPA 4HF0A 1XD7A 1FSHA 3BZ6A 1C0WA 4L5IA 4Z2YA 3I5UA 5DCFA 1WKMA 3GX4X 3G3ZA 4L9TA 1ZAOA 1EH8A 1LB2A 3BOQA 2XVCA 4ESBA 4ZZLA 1FBQA 1L0OC 2W85A 4N9IA 1RIOH 3RKXA 4AD9A 1SMTA 2G7HA 2RC4A 3RKWA 2Q0OA 4EJVA 2V1XA 2WC2A 3GLXA 4N9HA 3F3XA 3MZYA 2O0YA 1R58A 1R36A 5HS7A 4RGXA 1YS7A 1XB4A 2XKPA 1J9IA 5FFZA 1XN7A 3TDUC 3RYPA 1YTYA 3E5QA 2RDPA 1W7PB 1HSTA 2H6CA 1W7PD 4I98B 1SAXA 2PN6A 4G8XA 1U8RA 2ZMEB 3TO6A 3FM3A 1IXSB 3QU6A 2BEOA 4HX7A 4HLYA 1OKRA 2EFNA 5BS6A 1F4KA 4KICA 3HRSA 5E18F 2BV6A 4OIRF 2ADUA 5HDGA 2IA1A 1O3SA 1O3RA 1ZARA 3BPXA 4RGSA 1YYVA 2E1NA 5ILUA 1WWXA 4EJUA 1SD7A 4EM2A 1PP7U 2C6YA 3HTUA 3V7CA 2BYVE 4I2OA 5BPIA 1I1GA 2H09A 2H3JA 2PG4A 3GVAA 3MCZA 3V7RA 3F6VA 4GXOA 2A07F 1ZG5A 4OMYA 3TO7A 2STWA 1P6RA 2NYXA 3T0YA 2F5FA 3GFMA 4CHUA 4PGGA 3S2WA 1OYYA 3C7JA 4I01A 3IL2A 5AIPA 2JT1A 4KN7X 3TKYA 2DPUA 3HHHA 2PQ8A 2XASA 3ABTA 4L9NA 1QZYA 2K5LA 4D0PA 2P6SA 2V1UA 2VT2A 1VTNC 1U2WA 2K27A 4M71A 3E5UA 4MEXF 2LX9A 4KA4A 2JZYA 4I02A 2ZXJA 3JW4A 2DI3A 1FY7A 5HVQC 2DQRA 1IW7F 2DK5A 5HDNA 2L02A 5CJ9A 3LA3A 3K1MA 4ENKA 2A3SA 4QLCU 4GYGA 2K02A 3E3VA 4YFNF 4IHTA 4HW0A 4AVPA 3GW2A 3RPQA 2KRFA 3HTSB 4MTDA 3SFZA 3WODF 2J5OA 1D8KA 2OA4A 3HRTA 1KQ8A 4I0BA 2KKOA 1STZA 5DUKA 1SFUA 4FT8A 5F64A 3JSOA 1Z1DA 2K5IA 2QM3A 1I5ZA 4GO1A 3RTRA 1KQ9A 1OPCA 4WXHA 1MDMA 2F5CA 5E1WA 2K4JA 5CVRA 1ODDA 2FRHA 3VFZA 4HZFA 1XSXA 2WV0A 2FBKA 1Z91A 4IF4A 5D4RA 3KP2A 2IA2A 2HOEA 3KP6A 1MKMA 3FXRA 1S3JA 1U5TC 4N0BA 2ETHA 4EMSA 3F22A 5J8FA 4TV7A 2H27A 3U9GA 1EV7A 4P9FA 1TNTA 2GIVA 3WTTC 4A5MA 4A6DA 3ABUA 3PQJA 1T6SA 3DF8A 4B09A 4LG0B 3C3WA 2VC1A 4EM1A 1UFMA 3BROA 3I59B 2Z5UA 2PMUA 3MEXA 5BPDA 2F2EA 1PDNC 4LJZF 5K5QA 4FHTA 1XGSA 2UXNA 1H9TA 1ZRDA 1GXQA 3HSRA 4A0YA 4ON0A 1FOKA 1IN8A 3DKWA 1BC8C 3I54A 4EGZA 3FHZA 1QW1A 3E6DA 4M6XA 2GXBA 2YPRA 4LK1F 3DEUA 1YFHA 1R7JA 1ZRFA 5ICCA 5LEKA 1AOYA 3BDDA 2VT3A 5J6XA 4WX9A 3WE3A 2XAHA 1T0FA 3V4GA 4M73A 1ULYA 3DPTA 2DLLA 4R1HA 4B8XA 1O3TA 1J75A 3TO9A 1FNNA 2ZCWA 1KU2A 4P9UA 2CYYA 4WXCA 3KP4A 2GA2A 4KIGA 2FE3A 3BY6A 4XRFA 3CO7C 5IT3A 2UXXA 1MJBA 1LDDA 1I6XA 3HSFA 3HIFA 5ILVA 1NHAA 3O6BB 5ILSA 4IVNA 1V3FA 2H94A 2HTJA 4M9ZA 2HWVA 3QP5A 3ZN0A 3EQLF 2GXGA 3ZMDA 4G7HF 4O3MA 4Q47A 3MAJA 5BMZA 4CGZA 2B0LA 2FSWA 2BBYA 3WTVC 2DPDA 2K5FA 4EJTA 2D1HA 2ZO4A 5LRRA 2M8EA 2DW4A 1IXRC 5J8CA 1SFXA 3DXJF 2H6BA 2W24A 1XDUA 3P9KA 4JK1X 4LD5A 3L09A 3T5XA 5LGNA 3M7GA 1RUOA 1QZZA 2HGCA 1BJAA 3CUQB 4GCVA 3RIRA 2Z33A 2OZUA 1R1TA 3KZZA 1FP2A 2QENA 4KNYA 2ESHA 2STTA 5D8LB 1UB9A 4RGUA 4BNCA 4A0ZA 3RJPA 4G6DA 3P7NA 2D45A 3RPUA 3E5XA 4ZYHA 2HEOA 2QQBA 5ICFA 3EYYA 5HLIA 3BJ6A 2RV8A 3ZMSA 1HW2A 4KDPA 1DPUA 3V8JA 4XSZF 1KU3A 1TQIA 3CO6C 1H9GA 2K7LA 5L3DA 2FNAA 1P4WA 4O5VA 3IRQA 1G3YA 2ACJA 1WI9A 2CG4A 1YW9A 2MLGA 2PEXA 4HDVA 2L54A 1QO0D 1F1ZA 2FQ3A 4A12A 2HR3A 2A6EF 3O3KA 4RAZA 2VODA 3WTWC 2ZJ2A 5FLXZ 3K69A 1I1SA 4LLNA 2P6TA 1J0RA 1A04A 3WG9A 1BBYA 4EV0A 3E6CC 1D8JA 3R6SA 2NNYA 4QWQA 3KLNA 3E6MA 3Q5FA 4CICA 4HQEA 3IWZA 2OD5A 1QNTA 4U88A 4HV5A 2AS5F 3GXOA 4KMUX 1BN5A 1O3QA 2HS5A 2Z9OA 2A5YB 4A6EA 1CF7B 1TBXA 2IP2A 2G9WA 4HV6A 2W84A 3CTAA 2M87A 2DFIA 1ZRCA 2FU4A 2V9VA 2Y75A 1WSUA 2QUFA 3KP3A 1HKSA 2R3SA 1T98A 3LQRA 3ZMZA 3U2RA 5DCMA 3WGIA 1KU7A 2FXAA 1ZLJA 1IN6A 4UNOA 5D8KB 2MH2A 1LJ9A 3EYIA 2A61A 2NAZA 2YX7A 4BAYA 3I58A 1BI2A 4JQFA 2MA3A 1HXDA 5FGMA 2A68F 3DFGA 2D2WA 1LEBA 1LDKB 3NQOA 1FC3A 2A6HF 5BQTA 1IN4A 4Q4ZF 3RYRA 3GZ6A 2FNPA 2F5EA 3ZQ7A 1GHCA 5KK1A 3MZHA 3R60A 3QPTA 1PUEE 3LA7A 4LB5A 4Y15A 2DO7A 5FD5A 2YR2A 3H3UA 2JTVA 2LSOA 1S7OA 1MZBA 4A0XA 2HDCA 2PBIA 4CYDA 3GWZA 1MJAA 2PMHA 2K4YA 1LVAA 3KLOA 4WWCA 3RI4A 4U7BA 2XAFA 1ON1A 1JHFA 2HKOA 4KFCA 1JHHA 1T38A 3KCCA 2M1BA 2OQGA 1S8NA 2E1CA 2RVCA 1P92A 4IHSA 4RGRA 1YS6A 2ZMEA 3F8FA 2VBWA 4G6QA 2O8XA 2L4MA 2W25A 3MQ0A 1ZLKA 2X0LA 1G3TA 3GZ5A 1U5TB 1X3UA 1HBXG 1UHMA 4RS8A 2OZ6A 3GUDA 3SHFA 4MEYF 2IVMA 2VN2A 4G94A 3K2ZA 3F72A 4KN4X 1FX7A 2OU2A 4EVIA 1IN7A 2HZTA 3GEZA 3BJAA 1T2KA 1XGMA 2FOKA 1OMIA 3COAC 4EJOA 1EH7A 2YU3A 2FBIA 4UV9A 2ESNA 2P5LC 3K0LA 1F5TA 2V6CA 1DDNA 3F8MA 3QU3A 1LEAA 5D4SA 3ZMTA 3F8BA 3Q9VA 1Z6RA 5E1ZB 3QPHA 5TJJA 3R61A 2CFXA 3DPLC 2JRTA 2QLZA 1FBUA 3FM5A 1F9NA 3SZTA 3WU1B 3I0TA 3I4PA 2IPQX 3T1BA 1W5TA 1U6GA 3CJNA 2EFOA 4F7ZA 2MH9A 4AIJA 2Q8KA 2FMLA 3ZN1A 3NRVA 2EWNA 2Z99A 4P55A 4IRHA 5EEGA 3LFKA 1TW2A 4MTEA 1BYMA 2Y0MA 2GZWA 1TTYA 5DUIA 1R23A 3HOTA 3D0SA 4L18B 2L3DA 5LRSA 1W5SA 4BQAA 1QVPA 4L9JA 4Q5SF 3W6KB 1ZHFA 2CGPA 2JSCA 2L01A 4RB2C 5E8IA 3K1PA 4IPAA 2E7WA 1ZREA 1YW7A 5H6QA 1O57A 3B02A 5ICEA 3J7AO 4JBAA 1QBJA 2YX4A 2EV6A 4M6YA 5E17F 3OV8A 2FMYA 2VOOA 3ZP5A 2XKOA 3DV8A 3M8FA 2M30A 3TDZC 3J80Z 5DEQA 4L9VA 2XUBA 3E19A 2EFPA 2G7UA 3SZPA 2DBBA 3F23A 1CGPA 1T39A 2KIUA 1ONVA 4LK0F 5KVRA 1B1BA 5JHUA 1TNSA 3ZMUA 2RGVA 3PFIA 3ROUA 3C18A 1Z9CA 4XSXF 2F5DA 2LF7A 4L0YB 1QQIA 4HDUA 3TGNA 3B73A 3M8EA 3VOEA 3EUHA 3J80K 2Y48A 4MQ9F 3J81K 1FYMA 1Z05A 2PI0A 4WK8F 5FB2A 5EEHA 3KP5A 5HLHA 2V79A 3V8KA 5LGTA 4A2UA 2OBPA 3I53A 1S7AA 2A69F 5CVIA 2VE9A 3J81Z 2COMA 2XV4S 3QOPA 1QPMA 4Y13A 3Q9SA 4RB3C 2KJBA 4PGHA 4BHBA 3K1NA 4I09A 1B4AA 1BIBA 5LHHA 2VONA 3WU0A 1G3SA 2HQRA 3F8CA 5HDKA 2HFHA 2ZFWA 3SQNA 4MNUA 4EJWA 2K4BA 1H0MA 1USSA 2RN7A 5LGUA 3IRRA 2DAOA 3F8NA 3IC7A 2LF8A 5E8GA 5LEJA 1KA8A 2O61A 2VE8A 2ZNYA 2BE5F 3EDPA 3BP8A 1ZGAA 3KEOA 4E70A 1DPRA 4UV8A 5A2QK 1BI1A 3BPVA 2MD5A 1SMYF 2LDUA 2O3FA 1LDJA 4HF2A 4BH9A 3GFJA 1R5GA 1P2FA 1TQPA 4I7HA 4YFXF 4ZYGA 4FX4A 2GWRA 4OOIA 3RKYA 4XBFA 4UHTA 3AAFA 2EV0A 3CDHA 4G9YA 1R22A 4L5JA 3W6JB 2QQAA 2HKXA 4ENJA 5D6FA 1KQ0A 3JAMZ 2DQLA 3KEQA 1J7KA 3OOPA 1IN5A 2CSOA 1MDMB 1IF1A 5IT9K 1BI3A 2LKPA 1OR7A 2RQPA 3H3ZA 4GYIA 4ETSA 2K86A 2P7CB 3ERED 2QZ8A 1YO5C 4EGYA 1Z6TA 4ESJA 3L00A 3KP7A 3VODA 5E20A 2PFBA 1G6NA 3BWGA 1Y0UA 2HTSA 2QBYA 2V1DA 5A2QZ 2IW5A 1J5YA 5JVTA 4O6JA 2RKHA 5F1RA 2DT5A 3F21A 1S29A 2EB7A 1WQ2A 5D5WB 2JPBA 3L7WA 3F6OA 3L9FA 3JAMK 4RB1A 4DQ2A 2DK8A 4ZYEA 1XDSA 4A5NA 1OYWA 5DD4A 2KIMA 4Q48A 4M74A 4LLLA 5L3GA 2FA5A 3E6BA 2NNNA 5CYVA 4NQWA 5D5XB 2ZBKA 2E7XA 3WGGA 4LFUA 1V4RA 4YFKF 1HKTA 4LLGF 4U0WA 3L2CA 2OAZA 4HX8A 1K78B 3FXUA 4P5OA 1YIOA 4ASNA 2QQ9A 1R5HA 1ZYRF 3JTGA 4RB0A 2HYGD 4U0VA 3U1DA 2CQKA 5K1YA 1P4XA 3TOBA 4OU0A 2XAQA 1XGOA 2YSRA 2HQNA 5ERIA 3NEUA 1R1VA 2GAUA
chains in the Genus database with same CATH superfamily
4LGWA 2K6DA 3LYIA 5C4JJ 3SEMA 1WHLA 5FU7C 2DMQA 3HYIA 3CBMA 5C0MA 4LUEA 3VRZA 1YW8A 2HPIA 4C2MJ 1V5EA 2LKSA 5LHGA 1DUXC 3HHGA 4UUVA 2IS1A 2LCCA 1XCBA 3CLQA 3V7SA 5HLGA 2QQRA 2LRDA 2BY3A 4ESFA 3FF5A 1RQ6A 1RAAB 3TOAA 4J9EA 5A2QE 4LD9K 1M30A 3ECOA 2WY8Q 3CC2T 3CD6T 5CVUA 4MFDA 3B6CA 2M16A 1SFEA 2CH4A 2GTJA 4C8QA 2OTLI 4NC6A 4NB5A 3KE2A 1I0CA 1VIFA 4CZZA 1V1CA 3CC4A 2M4GA 4JP0A 5DYMA 2AQEA 2JVVA 5K5OA 2QA4Q 4XMYA 2QQSA 4FYWB 1MJ9A 1ZGJA 3QWLA 4EDUA 3EHQA 5GAN4 4BHPA 5H20A 3WGHA 4KMFA 5LJ3e 2DXBA 2RA2A 3WVEB 1FP1D 3LSIA 1FSEA 2AO9A 1G2BA 1JXOA 5DLOA 2E5QA 1WRJA 5DS9A 3KYDB 2EZHA 2R58A 4PJNA 3R4KA 4F7UG 2K85A 1V5GA 4ANJA 5IHNA 1G4DA 1KYZA 1KU9A 3HUGA 3OS0A 3IHUA 1GXPA 5CVVA 2M4KA 4HVUA 3JB9H 2K9NA 4OMNA 2QKMB 2H1LA 2IA0A 5ED4A 5FKKA 3QAHA 3BZKA 5LFAA 4DOVA 3J7AF 2AKKA 2X98A 3VDXA 5B3SH 2OC6A 3JREA 1JTXA 1LQ1A 2QK0A 3BLYA 5KYXB 2E64A 3FZVA 1P4AA 3S17J 2FF4A 1OYXA 4RAFA 3LSTA 5FO5A 1ZA1B 3OBWA 1VQ7I 1ZSZB 3K9TA 2FZKB 8AT1B 4GGGA 1DJ7B 3MFKA 2LCSA 2EA4A 4C5IA 1BJZA 3QYFA 1IGQA 2BHYA 4ORZA 3VUZA 3GPLA 2VB6A 1BC7C 4IKFA 3H5NA 2M35A 3EFOA 3JTHA 1RPWA 2KISA 4BHCA 4HRIA 4OINF 2NWMA 4DIQA 3H92A 1VQNQ 2DIGA 5E1XA 2K9SA 4HX4A 3CESA 5FLXK 2YLBA 3O2PE 4DNCA 1H8KA 4C92G 2R7QA 3LWFA 2LP0A 1Y57A 3G4SA 3RDIA 4EQQA 2L9RA 3TSZA 2XAGA 3CCRI 3H9NA 1VQ9T 4CYCB 3M55A 1NBEB 4OB3B 1XSVA 3FX3A 3GF2A 1PD1A 5E3NA 1QMCA 3QDFA 4FSXA 2X6OA 5LJ3j 4JS4A 2R7DA 1AEYA 1FOWA 1XMKA 1RLQC 4OIOF 1JGSA 1U1TA 2D1VA 3IWFA 2CREA 2PLYA 3REOA 1IGUA 1IRGA 4II3A 4E7JA 3NWSA 1GVJA 1OPKA 1OU9A 4HCKA 4MMLA 4JUVA 3WXMB 1BW6A 2KHMA 4KIBA 3FXQA 4KIFA 1KIKA 5DD8A 1D0YA 2X48A 3DP7A 5JR3A 1LNXA 1WYXA 3JB9G 4NBQA 5CCAA 2DODA 2RF0A 1EH6A 4HA8A 4Y3OA 2AXTC 3HL2A 2E41A 3TEEA 5HNHA 4S05A 3M4OJ 1Q82R 1MGTA 3M9QA 3QUIA 1VQMQ 4WXDA 4UVAA 4CXFA 2VJ5A 3OYMA 4OMZA 1OFCX 5LBQA 4HKEA 3M0UA 3CXCA 1FYLA 4F7UF 4M75F 2E34A 3JSPA 2VLAA 3HG9A 2O9VA 1RZ4A 2BGCA 2AZVA 1QKXA 2HKNA 3LQQA 2YXYA 2OJED 3RDVA 2EV5A 5GAMd 2K9QA 2O03A 3PNWC 3EGXA 3LSRA 4XKVA 1QU3A 2FZGB 4YIFA 3S1QJ 5K5RA 1IRFA 1KGSA 2L5QA 1HYOA 2EQJA 1QLYA 4PNOA 4RUGA 1S72Q 2MC3A 4UB8C 3KEYA 2LKXA 1RL2A 2DTOA 2ROTA 3Q0UA 3W3CA 4KT0E 4PJ0C 2YUOA 1VQKA 3DQVC 3C1DA 1Z67A 5LLQA 5GANf 3FMSA 4LG0A 1PD0A 1REPC 4A3GJ 4PSXA 4UUSB 3QYHB 1TZLA 1Y0NA 2MBFA 3CP2A 4OWRB 4XL9A 4IQJA 2GOMA 5CQGA 4A3CJ 1UDLA 1QVGP 1VQ7Q 2XHKA 2E36A 3M57A 5KCOA 2LJ1A 1D3YA 3CUQA 2OJ2A 1Q86U 2E71A 1UTIA 2M5WA 2O6GE 2TDXA 4HBLA 4HQMA 4M3FA 4B3AA 5L3FA 1BIAA 2PJPA 2FRYA 2RMOA 1IXCA 5F04A 1SD4A 2M0OA 1R9TJ 2RJEA 3PMIA 4C5HA 2RPNA 1KQSS 3HOZJ 4Z6YA 4XLAA 1QVFS 3FMRA 1LUJB 5GANh 2P7VB 1J59A 4BEHB 1IAWA 3CPWP 2NS0A 1XQHA 1RI7A 3MWMA 2FOWA 2KQWA 5GANe 3ML6A 3DEWA 5FKMA 1FWZA 4AFSC 1XCVA 2NOJB 4I0AA 3BCBA 1Z0XA 1UHFA 5C6SA 4AWXB 1Y6IA 5H6RA 1R0BG 2DA4A 5GPCA 4HOBA 3E97A 2BZYA 2LMJA 2RI2A 3CCVQ 4F17A 4E7LA 4J6WA 1VQ4T 4BUPA 1OCZH 2L4AA 3M56A 3WE2A 2RK1A 3CCEQ 1IZ1A 4PJOA 1U0JA 3J7AW 3M9AA 1UECA 3HOSA 3CCMA 1JXSA 2VKHA 4CDGA 2VBXA 5ICGA 3FK6A 4U0YA 1X58A 2KDZA 3R0JA 1ZQ3P 6PAXA 5CKFA 2LP5A 1K6OA 4MHGA 3L2ZA 1YHQA 3RCOA 1W4MA 1WI3A 3CMAI 3HL8A 1P9QC 4KISA 1JU5C 3SWNA 1HW5A 2M45A 2Z3YA 2X4HA 3I64A 4AIKA 2EFQA 4G7ZF 4XN3A 3EG1A 4PCQA 4OAZA 3OYCA 2XAUA 3LX7A 3DTIA 2JUCA 2KZGA 3NARA 3KETA 5CQXA 4DOWA 4LB6B 4YIIA 1YJNA 2XB5A 5GANg 2OQRA 3PNYA 1NPRA 2RHUA 4KUMA 3CPFA 3IKTA 3OB9A 4NL3A 5FD6A 1WGXA 3M0QA 4WCGA 4EM0B 1JB0E 1IHWA 1D5VA 2W57A 2ME0A 2GTOA 1YJNQ 3GTQJ 2P84A 3D5LA 1TQMA 4C2UA 5GAOn 2CO5A 1ETXA 5GAOq 3KZYA 3J7AY 3CCSI 2CYZB 2R7UA 2H8HA 5FU7B 2OTJQ 1B59A 4M78A 1ZH5A 4M75B 2LVSA 3CLOA 2YU9J 2XROA 1KYWA 1OX8A 1UEBA 4HNUA 2D5VA 1ZBXA 3LWHA 5KE3A 1I27A 1KHCA 1HOMA 1E3PA 4J9FA 2A36A 1KG1A 1MBGA 2GLOA 2JA5J 1TWHJ 2M0YA 3JB9I 4B1RA 4C8QD 2FUG2 1SAUA 3GZNB 1FLIA 1BKBA 2W7NA 3JCMV 2EIMH 4ESRA 3PUBA 4LMYA 3ERMA 5IAYA 4PDKA 4OIPF 1JRIA 2VBYA 3RZDJ 1NYGA 1SG5A 2KT0A 1IO2A 2CW0F 2FEZA 3DU6A 5EGOA 3NFCA 4LDWA 3VRYA 3ZMVA 3L1AA 5F08A 2V1RA 1S6LA 3H5AA 3WTXC 2JA8J 3MP6A 4XTZA 3FRNA 2LNBA 4DZJA 1U78A 1GFCA 1HQCA 2VKVA 2CSQA 2JS0A 2ELHA 2QYOA 5M5YJ 1BM9A 4FISA 1XGNA 3OS2A 3CCMI 2UV1A 4H0EA 4X1EA 2HDDA 4E6KG 1PYVA 1WHUA 1WJSA 1ZSGA 4FT2A 3CCVT 2JQ7A 4KT5C 2RHZA 1JEGA 3KX2A 2K7AA 1Q1HA 4XK4A 3V8LA 4A3JJ 3CCQT 4BE1A 2QBYB 4MQVA 1PP8F 2DOEA 3K4NA 1G59A 3IAS2 2JM9A 3ISPA 3D7SB 2CQNA 1BR2A 1X1AA 3QP6A 1ACIA 5J47A 1MHNA 5FFXA 1OR7C 2L3SA 3A8HB 3BFMA 5CIUA 1OCTC 5GAN2 3WVDB 5D7UA 2ZFUA 3OIOA 2IVWA 1ZG3A 4IO9F 1ZX6A 1UG2A 3G1MA 5F27A 3X24B 2P8TA 3GTJJ 4C5GA 4M7DB 3QRFF 3CMET 1E2XA 3ULRB 2VQHA 3GO5A 2ZKZA 1ZN2A 4HYEA 4KITB 4OIQF 1YWPA 3LLRA 1VQLA 1VQ6A 1YJ9T 1CSKA 4C0ZA 4XU1A 1XTAA 2RHXA 3HPGA 1B9NA 1B9MA 3T8TA 1K7AA 2EGAA 3CCYA 5HS9A 4UXNA 3S32A 2CDTA 1UFFA 5HK0A 4U87A 4UVBA 5IOYA 3H0DA 2VV5A 4EMKA 4QQGA 2DM1A 3JCMQ 1M90U 3PSIA 3PQKA 3G71I 1X4OA 4RKUE 4C92B 2HAXA 5JFRA 2QXFA 5FU6C 2DU9A 4CSWA 2IJLA 2CWEA 1R00A 1USTA 3I59A 5L3BA 3A0BC 3S1MJ 3H9JA 2DERA 2VBZA 3P9CA 5F6FA 3ER0A 3OA6A 3GOXA 3TL4X 3TQNA 1JTYA 5AYFA 4Y17A 1LNWA 2J5PA 3F70A 3ULQB 4K2EA 3IV5A 4A4EA 3HRMA 3K4LA 2E2HJ 2UZKA 4ZYDA 1YJWA 3RQIA 3THKA 1SD5A 1YJ9I 2FRWA 2LLKA 1IV8A 2P4WA 3FMQA 1HKQA 1UCRA 3QG1A 3VKIA 4AIHA 2XGXA 1UJ8A 5IYDJ 1YX5A 3EHRA 4M72A 7AT1B 1VQLQ 4A53A 3CMYA 1N9SA 4HG2A 2HKQB 4EMGA 1DP7P 4M9SA 2VKEA 1D0ZA 4FW2A 3CXCS 3ECHA 1YLFA 4BJ6C 5CVJA 2IS4A 3MO8A 1HSJA 4QPQA 4FX0A 4PJJA 2WTEA 3I71A 4F93B 4KYWA 4OB0B 1HK9A 5GJWB 1RUWA 4YTLA 3H0GJ 1DQUA 2QA4T 1KC8U 2DEUA 1VQ5T 1IRXA 4GLMA 2CV0A 2KL4A 2VWFA 3BY7A 1TXQA 2O4XA 1T0FC 4HF1A 2K3FA 3P9IA 2KJCA 1B6AA 2L9SA 1RNLA 2FBHA 3KYCB 2CZ1B 1QWEA 3CUQC 3BC8A 3GTPJ 2HYFA 3HFNA 3PM1A 5M5XJ 1TLHB 2R7TA 1YWOA 2LC2A 4JYKA 2LT4A 3R0AA 2HYJA 3L2QA 3I4MJ 1ITYA 1E17A 2E12A 1GCQA 3GTLJ 2KPMA 1J2XA 2BIVA 5DV5A 3LA2A 4AVZA 3ELKA 4BGDA 5D6EA 2IRFG 2EYQA 2QG9B 1W7PA 4J8OA 1OYIA 1WVRA 5DM6F 2ISZA 1Q7YR 1G2HA 1J3TA 1KQSA 2KIFA 4ZH4F 1O7FA 4ENNA 3FJ5A 2VQCA 1S72T 1D0XA 4PZJA 4B44A 2IT0A 1NYFA 1UMQA 3VB2A 2NVXJ 2DCEA 1H92A 2RQWA 4AG2C 4ENMA 1Z7UA 1XMXA 2ZNZA 3BJOA 4WF2A 2QI2A 3LW5E 3ZQLA 3JCMg 1QGPA 3J7YJ 3WTSC 2ABLA 2RNJA 2ME6A 1VQ6I 3DB3A 2M34A 2MLKA 4BS9A 3LAJA 1WNLA 2A0FB 4UB6C 2EGEA 3MEWA 2MVTA 4JPBW 3VV0A 5EG0B 2VJJA 3E1SA 3DBLB 2A7YA 4AT1B 4OMLA 2YUNA 5GAMg 2XPVA 2R92J 3AL0C 4ZZDA 3OYHA 1QRYA 3LSJA 5D5VB 2XIDA 3CC7Q 2GIZA 5DDGA 1CF7A 3GFIA 2EFWA 4L0ZB 2D1XA 3C95A 2DE0X 2ZJRF 3OSSC 3CMMA 3ZEHA 3CC4Q 4HLXA 4IXAA 4C0GA 5D5UB 2EKOA 2XAJA 1KQ1A 2KT1A 1MBFA 2DD5A 1U3EM 4R56A 4M7DA 3RUXA 2DA6A 4QTRA 4DZPA 2R4GA 2LG4A 2WAQN 5HOOA 4XLPF 2P5KA 3ZPLA 1IO6A 2CT3A 4M7AA 3OYJA 2V8KA 4HAMA 1QVFA 3BR0A 4IHXA 2L89A 1VQ6Q 1N78A 1AZEA 2WWYA 1K78A 3HUGB 3M53A 5LJ5f 4M3EA 5EEAA 2H8RA 2EGCA 5GAOm 1GXIE 2EA2A 3X2QH 1GT0C 2Q2EA 4AU7A 1VQ6T 2UWMA 4NHJA 1NG7A 3HC7A 2MIOA 1YJ9A 1W2BP 5CKDA 3WTZA 2JJ9A 3N97A 1UHWA 3PFYA 5TGTA 4C8QC 1H3ZA 2RO0A 3N4MA 1RUNA 1O7LA 4F04B 1YG2A 1TUCA 2XIGA 5L3CA 2IIMA 3I56T 4U7DA 3MP8A 1ON2A 2DDBA 1M1KC 3GTGJ 4B9XA 3X28B 1MMDA 4IRGA 1FPQA 5GAGJ 2E6ZA 5CLSA 3FWEA 2VI6A 2ELKA 2BE7D 2JSPA 2QWWA 4RA2A 3WTYC 3JRDA 1VNDA 4N4GA 1YQAA 5IT9Z 3A52A 2VUMJ 3IKVA 1NJIU 3PTAA 4LE9A 2HOAA 5AONA 2QAZA 4J19A 1MD0A 1U5TA 3VJPA 5LJ5d 3CUOA 2ISYA 4HPQA 5BOXA 1H641 4W1UA 4S04A 3PUFA 2VXZA 2JJ7A 1V5FA 1WPYA 1PM3A 5JI6A 3JRHA 4AFUC 4BYYA 1JT6A 2TRTA 2GA1A 5HS8A 5IY5H 4JRPA 3I4NJ 1BA5A 5GAMf 2V9PA 2JMAA 3BCAA 2WB1A 2JPCA 1AWCA 3EGUA 2VC0A 5KAFC 5HNFA 4M9XA 3FDRA 3KFWX 1NK3P 3LAPA 1FBSA 5FLXR 3M0RA 4J9GA 2O4XB 5TRDA 4OF1A 3GLLA 1AHDP 1XSDA 2ZJPF 4MGRA 2A05A 1TW3A 1UHSA 2XRNA 2EYZA 3MKLA 1EJ9A 2K3YA 5GADJ 1Y1WJ 2KK4A 3HEFA 2PNIA 3PIOA 3G4SQ 1FT9A 2R7FA 1JE8A 3VS3A 1I07A 3CC7I 1J09A 1HW1A 1G3WA 3HSEA 4LIVA 3S3OA 2CT4A 5B66C 4FIBA 2AXLA 2JRMA 5J4VA 5LHIA 4IRIA 3JRZA 2V9KA 1K6YA 3SFMA 5L23A 4G7OF 4A3EJ 1ARKA 3UNGC 2OV7A 2R7WA 3IQLA 3CD6Q 3ESWB 4JJBA 4C0DC 4P1WA 2GQQA 1BOAA 5AIQA 2RN8A 1EA3A 1R1UA 4FTHA 4KH1B 3T8RA 2K5CA 4XU3A 4IHWA 3JAME 2GCXA 4GFBA 2EBPA 2EYWA 3CMAT 4GRIA 3NAUA 4D5CA 1HDDC 4M7DG 3WTUC 1VQPA 2KXDA 3ASKA 2X1CA 2DYRH 2BVLA 3E2UA 2BOLA 3EETA 1FYKA 1UJ0A 2HXOA 4J7IA 4M7AG 1VYUA 1XMAA 3JRAA 3MHXA 2L2OA 1GL5A 3CCEI 3D5SC 1EZZB 1RR7A 2DTRA 1YI2I 5DCMB 3O8HA 2NRAC 1MGQA 2VKNA 3DWLE 2BXZA 5EF6A 3BG7A 3HOWJ 3SXYA 3OW2S 3M1EA 3JRCA 2FPDA 3CMEQ 1K79A 3PT9A 3OMYA 4LG3A 2EJRA 2H3EB 4OMPA 1M8MA 4P96A 4BI8B 1QVTA 4R8HA 4XLNF 5I2SA 2ED0A 3GBGA 4CO8A 2DD4A 1M1KU 1FZPB 3BTIA 2EK5A 1HA8A 2EJGA 1SD6A 1VQ9Q 3S93A 3PJRA 2LY2A 5IPAA 3G73A 3S3NA 2EJFA 4HXJA 4R79A 3U21A 2ROLA 5L3EA 2L3QA 4J00A 3RESA 2P5VA 4A3FJ 3K70C 1BI0A 2P0QA 4S0HB 2MI6A 2ZJQF 4PLIA 2CP7A 1X2NA 1L3LA 2LZ6B 3EG2A 3CDLA 1IUFA 4UVCA 3GFLA 1R4NB 4QSHA 4ZTFA 2IS6A 3CCQI 4BXUA 3HRUA 5IOZA 3PVLA 2YHTA 5GPAA 3TW7A 4IJAA 4MO7A 3FXMA 4YG2F 2L7FP 2QVOA 1IUYA 2VOPA 1XOVA 2CJJA 3GYHX 1ZG1A 4A3KJ 3G71Q 1MBJA 2CKKA 4RAYA 2LMDA 2AHQA 3VEPA 4UY8I 4HF0A 1XD7A 4BDYA 1N5ZA 1FSHA 3BZ6A 2WSCE 5DM7R 1C0WA 3IH2A 4OVAA 2PJRB 1BBZA 3CCEA 4L5IA 3JR9A 4F7UB 4Z88A 3L2RA 3K4MA 4Z2YA 3LSGA 3I5UA 3RR6A 3BW1A 1GCQC 3LGLA 5DCFA 3H9QA 3BG3A 4KJZA 1AWXA 1WKMA 3GX4X 3G3ZA 1MBHA 4L9TA 1ETVA 1C1AA 1ZAOA 3AG2H 1WX6A 1EH8A 1LB2A 3REBB 1IGNA 2RHIA 2DYIA 1JQQA 2L7MP 2AKLA 1VUBA 3BOQA 3KYLA 2M9UA 4BBSJ 4PJOC 4C92E 4HCBA 3TREA 2XVCA 4ESBA 3SZGA 3S1RJ 4AFQC 3CF2A 2FG0A 4ZZLA 4K11A 1FBQA 1L0OC 3BDUA 1M27C 1IDZA 2W85A 5KNLA 4N9IA 1ZBJA 1Q81U 4J6XA 4F92B 1UGSB 1RIOH 1E6HA 3RKXA 4AD9A 4BEHA 2VXDA 5C4XJ 3EH2A 1SMTA 2G7HA 2RC4A 3H0HA 3RKWA 3U23A 4FYXB 3FBNB 2HPMA 2B86A 1NG6A 2Q0OA 2WACA 4EJVA 2V1XA 3HOYJ 1YNZA 3OS5A 2WC2A 1LFPA 1QCFA 4M7DE 2WV1A 3GLXA 4N9HA 3VYUB 1X1CA 1UB4A 4HSTA 3G1OA 3F3XA 5IP6A 1F43A 1NLPC 1UG0A 3BR6A 1I3AA 3C94A 3M0PA 3LMMA 3MZYA 2BVMA 2O0YA 4D1QA 1W1FA 1P7JA 2JUGA 2MSYA 3EGDB 6AT1B 1Q1VA 2XPUA 5KYYB 2CS7A 3IH4A 1R58A 3GTOJ 1UGQB 2EZIA 4CCJA 4RAGA 1OZ3A 1KONA 1R36A 5HS7A 4RGXA 1XB4A 1YS7A 2XKPA 4MDXA 1J9IA 5FFZA 2FB7A 3JCMX 3EUHC 1EKEA 3R6NA 5LJ5e 1XN7A 2HNHA 3TDUC 1W70A 2ZAEA 3RYPA 3EUKL 2Y9YA 1YTYA 1C6VX 2HI3A 3JCMh 3E5QA 3JCMP 2RDPA 1W7PB 1HSTA 2H6CA 3H41A 2LH9A 1W7PD 4I98B 3HOVJ 1BCMA 4XU2A 2ID3A 4EEFG 1RKWA 1SAXA 2HOSA 2K9MA 3RERA 2PN6A 5GP9A 2NOGA 3GCMA 2CV1A 4G8XA 1U8RA 1K9MC 3KIOA 2ZMEB 2MCNA 1PCXA 3TO6A 2FYKA 1VF9A 4JOMA 2XSJC 2IS2A 1VQOT 3FM3A 4AM3A 4HVVA 1FTTA 3AG3H 2KT8A 3I56I 2DNUA 1IXSB 3IH3A 3QU6A 3UT1A 3OYEA 1UGRB 1X3WB 2BEOA 1T8IA 4HX7A 2LBFA 4XU0A 3S2DJ 3EAEA 4HLYA 1KHIA 3SEQA 2KROA 2DA9A 1OKRA 1S72I 3BR2A 5I22A 2EFNA 1XJWB 1LE8A 1ABQA 5BS6A 1N8RR 5EJCA 1F4KA 3M0SA 2HL5C 2VGMA 4KICA 2P0KA 4OMOA 4XTUA 2GXAA 3HRSA 3PL8A 5E18F 1NPPA 1Y96A 3HKSA 2BV6A 1X6GA 4OIRF 2ADUA 1WQ7A 2CQ7A 2QYZA 2L7ZA 5HDGA 2BUDA 2HZDA 4XRSA 4OP0A 2MABA 3Q1JA 3OOUA 4F55A 2IA1A 3O5ZA 1O3SA 4JZ3A 4C8QE 2D6FA 1O3RA 5EYRA 1ZARA 3H0FA 3BPXA 4RGSA 1YYVA 2E1NA 4BI4A 2K9LA 2I10A 1SVMA 5ILUA 5KCHA 1WH7A 1WWXA 3FLGA 4EJUA 4H4KC 1SD7A 1SSHA 3U1KA 1MBKA 2GQIA 4GLKA 4DA4A 4EM2A 1PP7U 1NH3A 4A4FA 1YITI 4BE0A 2XU8A 2LT1A 2C6YA 2IPOB 2LRQA 2BXYA 3HTUA 3V7CA 2BYVE 3HM5A 1Q86C 3CCMT 4XKWA 2CFOA 4I2OA 4XQ3A 5BPIA 3M4GA 1I1GA 4M77F 8ATCB 2KRMA 2H09A 2H3JA 2PU9B 2PG4A 1I39A 3GVAA 4CCLA 3MCZA 3CCET 3V7RA 3F6VA 3CC7T 4C92C 4LDUA 4GXOA 2A07F 1ZUUA 1Q95G 2HQHA 4BXXJ 3AKZA 4WCIA 2V6EA 4XQFA 4C0DB 4HCZA 4NUBA 3CMEA 1ZG5A 3OR1C 4OB2B 4OMYA 4M78D 5LJ5j 3TO7A 1RI0A 1TSFA 2STWA 4C2TA 4F7UE 1M90C 3H9GA 4KUDK 2A37A 1P6RA 1IC8A 2NYXA 1OCCH 3T0YA 4PKCC 1MV3A 2F5FA 4V2FA 3V42A 2XSDC 3GFMA 1S7EA 4PGGA 3S2WA 4CHUA 4M75D 1OYYA 1VI0A 1RC9A 3C7JA 3SYTA 4I01A 1QHGA 3IL2A 5AIPA 2JT1A 4KN7X 4L5EA 4CCOA 4FL6A 4RM2A 3MEVA 3TKYA 1TUGB 4AC0A 2RQQA 1MMGA 1IRZA 2DPUA 3HHHA 2PQ8A 2XASA 3DU5A 3QYGB 3ABTA 5B1BH 1Q81R 4L9NA 1M90R 1JO8A 4LITA 1QZYA 3ZQGA 4D0PA 4BE2A 1MMSA 2CRGA 2K5LA 2P6SA 2GQVA 2M51A 1YIJT 3EGDA 2MWOA 3QBYA 3CCLA 1NTCA 2V1UA 1TWAJ 2VT2A 2DVJA 1VTNC 1U2WA 2M8GX 5LL6S 1IXDA 3K10A 4FM4B 2K27A 3ZQFA 4BDZA 1LPLA 4Z8AA 4M71A 3E5UA 4N0AA 2ICWG 4B9WA 2DYSH 2E10A 4PJOF 5F0CA 4MEXF 1K1ZA 5F0FA 2LX9A 4IUUA 2BZXA 4KA4A 3QKJA 2JZYA 4I02A 3X20B 2WAQA 2ZXJA 3QJYA 4BI3A 1PC0A 3QJ6A 3CJQB 5JLXA 3AHUA 2DYBA 4RG8A 1M1EB 3JW4A 2EQRA 3SJMA 2JVHA 2CUDA 2MAMA 3C0CA 3QYBA 2C0OA 5IHIA 2DI3A 5M9OA 1K76A 3NPFA 3QZ9B 4EMKB 1FY7A 2KMUA 5HVQC 5J39A 2DEQA 2DQRA 2XC7A 1IW7F 2DK5A 4NC8A 5HDNA 3JCMb 1MMAA 1R6RA 2L02A 5CJ9A 1BCOA 4J9IA 3LA3A 2JUFA 2YSQA 3K1MA 4ENKA 2O5RA 2A3SA 3BG5A 4C30A 4QLCU 1QWFA 1QVGA 2YRVA 2LFBA 3RZOJ 4GYGA 4XOPA 2K02A 3AG4H 3E3VA 4YFNF 2KFDA 4GDFA 3D5RC 2ZCFB 4IHTA 3DKXA 4DBQA 1TP4A 1JKPC 4HW0A 1M1FA 4AVPA 2OAWA 3SWNC 3GW2A 5FLXE 3UWNA 3G4ST 3RPQA 2KRFA 1SF9A 5D6WA 3E0JB 3HTSB 1MUZA 3O8VA 1VQ9A 2EIKH 4MLOA 4MTDA 3SFZA 4ZYAA 5EC7A 3UATA 3WODF 4XK8E 2J5OA 2ZPBB 2QEXA 4IEJA 3ZFJA 2R5YB 1D8KA 4DJAA 2OA4A 3HRTA 1KQ8A 1PSEA 2DLPA 4I0BA 1YOVB 3W2VA 1VQ5I 2CV2A 2COWA 2I0NA 2JNGA 2KKOA 5FWCA 4ITVA 1B07A 1STZA 2PMZA 5DUKA 4CA0A 2DT7B 2RJCA 2ZZDA 4L6V5 1VQMT 1SFUA 2KY9A 2EZLA 4FT8A 5F64A 3JSOA 2ATCB 1Z1DA 2K5IA 2QM3A 3H3VK 3KFVA 2L3PA 2E2JJ 2LX7A 2YWWA 3QZ5B 3X25B 1YI2T 3PNTA 1A6QA 3VS1A 1I5ZA 1SRMA 3IAM2 4JX5A 2CP2A 4GO1A 4F91B 2DZ9A 4ZN3A 2EQMA 4M4ZA 3RTRA 1KQ9A 1SPKA 3FJPA 3INZA 3LNQA 2JA2A 2XF7A 2EIJH 2LOOA 1RLPC 3FC3A 1GBRA 5IP7J 1OPCA 4WXHA 2F5CA 1MDMA 5E1WA 2K4JA 1P7IA 5CVRA 1ODDA 2FRHA 2W1OA 3VFZA 2HBWA 3TQ7P 5GMKe 4HZFA 1RRJA 5HCKA 3HJEA 3MD2A 4CRIA 5E79C 1XSXA 1HCRA 4KGZB 4IUQA 1U9NA 5KYUB 2WV0A 2FBKA 2E1MB 1Y8RB 3ZBDA 2EQUA 2HXIA 2CH0A 1Z91A 4E7HA 1VQKT 4JRIA 2LCLA 4X0GA 2PMZN 4IF4A 1VQPI 4A54A 2A5WA 5D4RA 3KP2A 3M5AA 3A1YA 4MZPA 3TBIA 2IA2A 4QT7A 4F3QA 2HOEA 4G6TB 3KP6A 1MKMA 3OR2C 1JJ8C 3FXRA 1VQ9I 1FEXA 1S3JA 1AA7A 1U5TC 4JDSA 4B3XA 2RQRA 5KCMA 1TH7A 5IT9R 3JRGA 3W6VA 2J7IA 4N0BA 3M54A 2OTLA 2ETHA 1NM7A 2K3PA 4EMSA 3F22A 4J6YA 5J8FA 4TV7A 2FJ1A 2F4IA 3H36A 5H2FC 4XTWA 4A4KA 3OW2A 5FLMJ 3S6WA 2FPFA 2OPTA 2KXCA 1T3SA 2JXBA 5GAOr 4NQWB 1I3QJ 2Y2ZA 4M3BA 3VSKA 2H27A 1S72A 2K2VA 3U9GA 1WXTA 2EQIA 1VQ4I 2Y9ZA 1K9AA 1EV7A 1K83J 1TNTA 2GIVA 3QPSA 4P9FA 4Y33A 3SDBA 3WTTC 4IIOA 2VASA 4A5MA 4A6DA 4FYVB 2IG0A 3ABUA 3VYTB 3A8LB 3PQJA 1WIEA 1NZ9A 1T6SA 3W2AA 5FRMA 4MDWA 1W4SA 4J9HA 2P81A 2QGGA 5GAN3 3CCSA 3DF8A 2LNHB 4B09A 1Q82C 2DFUA 4LG0B 1Y7XA 1IHVA 4PFOA 2DJNA 2F2XA 2XK0A 1KC8C 5CQYA 3JAMR 1YJ9Q 4XNFA 1PRMC 3CEYA 1B34A 4Z02A 5I2MA 3VS2A 1UZCA 2JA6J 2DL8A 2ZSIB 5L8RE 4ZGDB 1W2BS 1VQ8Q 3C3WA 1ENHA 2EH3A 5GAN7 4ZN1A 2TCTA 2VC1A 3N5BB 3DTEA 4EM1A 4C9YA 1ORKA 1UFMA 3OYKA 1PUFB 4AUXA 1VQ8T 3BROA 2GOXB 2Z1DA 5GAEJ 1MSEC 4V2GA 4QIWN 1LE8B 2KIQA 1QQJA 3ZQHA 1O75A 3CCJT 3I59B 4XLFA 3PE0A 1VQOI 3CCUI 4IUVA 4RTYA 1K0SA 1JJ2A 5KYXA 2RAEA 2Z5UA 2DRKA 2PMUA 3MEXA 5BPDA 4M78G 2LJ3A 3MP1A 5IN1A 3CC4T 4IQ4A 4J9BA 3BR3A 3M8JA 2R7RA 2NUTB 2HOTA 3PFSA 3CQTA 2F2EA 1PDNC 2QTXA 2RB6A 4LJZF 5J3BA 2SEMA 2QEXT 5K5QA 1GCPA 1M9SA 2CZ7B 5C3EJ 3H8ZA 4FHTA 2H1KA 1XGSA 2UXNA 3QIIA 4XICA 4VUBA 2E6NA 1KFZA 1H9TA 1ZRDA 2DRMA 1GXQA 3OWTA 1TTHB 3LSKA 5GAN8 1VFCA 5GAMh 5M3FJ 3HSRA 4A0YA 3L2VA 1LJOA 1MMNA 2BW3A 1PHTA 4ON0A 3FIFA 3ABKH 4N0AC 2BHZA 2XKOC 4BU2A 1SANA 3ZQCA 1IN8A 3DKWA 1BC8C 1YHQI 1FOKA 2KVQG 1UG1A 3VUBA 1M1KR 1X27A 3I54A 5M3MJ 1XTDA 4EGZA 2DAQA 3FHZA 1YJWI 2MOXA 2GNCA 3I9QA 3G7ZA 4L5GA 5J1RA 3F0CA 3HGGA 1DU6A 1RAEB 3PIPA 3QPLA 1JJ2P 2WY7Q 3VYRB 3OYGA 2V1QA 3M0TA 3SD4A 4RDUA 1QW1A 4L59A 3NWTA 4Y4RA 3E6DA 4PSWA 2Z0WA 1I8FA 3I35A 4JLIA 4XORA 3WHBA 3I56Q 1Y1VJ 4M6XA 2GXBA 4AFZC 2YPRA 4LK1F 3DEUA 3OYBA 1VOMA 1OPLA 1YFHA 4JZ4A 3META 1HDPA 1WJFA 3ZCOA 5B5EC 4QVZA 1XNIA 4M75A 4BD3A 3GTMJ 1WJDA 1R7JA 2M1HA 4C0FA 1ZRFA 4ATOA 2XPWA 5ICCA 5LEKA 1AOYA 2X6YA 3BDDA 2VT3A 3QWXX 2VYTA 4ELZC 4FQGA 2HVSA 2E4HA 5J6XA 4KGVB 1QP2A 4E47A 2VPLA 3WE3A 4WX9A 3SDZA 1EF4A 2HDWA 1WHMA 2PUKB 1VQ7T 1N8RC 1XPXA 2XAHA 2LYCA 1T0FA 3V4GA 4M73A 3EFOB 1ULYA 1U5SA 2VQLA 3DPTA 4M78F 2IGKA 5HY6A 1K8AR 1D3BA 1GFDA 5JVGF 2DLLA 4BQOA 5TISC 4R1HA 4BB7A 2HQEA 3OYYA 4B8XA 1LPQA 2DTIA 2WSEE 3EG9B 1O3TA 1T95A 1PKTA 4ME7A 3CMAQ 2R0QC 1J75A 1IG7A 2OUMA 3UKGA 3C12A 3TO9A 4Q5WA 1IZ6A 3TMOA 2EAYA 1FNNA 2ZCWA 1KU2A 3VPRA 4P9UA 2CYYA 5CKBA 4WXCA 1PG5B 4M7AB 2CUEA 3KP4A 1QVGS 2GA2A 2DMPA 4KIGA 5FWBA 1EIFA 5HK3A 2FE3A 1QCNA 3DKYA 3BY6A 2DXTA 3M3YJ 2B8AA 1NJIR 4XRFA 5KHDA 2LNVA 2DTZA 1E3HA 2K40A 3OIPA 3K2AA 3CCVI 3CO7C 2OTJI 2MYSA 1JUMA 5IT3A 4IOAF 2V1NA 1Y07A 2KYMA 2UXXA 2BE9B 5KH6A 1XC5A 1M2VA 1MJBA 1FIAA 3J80R 1BOBA 4BY6C 2ZXHA 1LDDA 2K57A 4CC3A 4E4HA 1SKUB 3MCAB 1I6XA 3HSFA 3HIFA 4CCMA 5ILVA 1NHAA 5IYBJ 3G6ET 4HSRA 4XTYA 2QASA 3O6BB 1X2QA 2R5MA 5LJ5g 4YRVA 1U06A 4M3GA 3CCJA 3K4KA 5K7ZA 1X4PA 2E1MC 1K9MU 3LL7A 5ILSA 4IVNA 1YRNA 2VL8A 2R7SA 2CS3A 1V3FA 2H94A 3PVQA 2HTJA 3D1NI 1FMKA 4M9ZA 5LJ3d 2HWVA 4CCKA 1VYTA 3QP5A 2CW8A 3ZGKA 1K4SA 4XTXA 1NG2A 2MK5A 2O9SA 2PX9A 1QZEA 2ESWA 3ZN0A 2N8GA 4BKXA 4F14A 1X01A 3EQLF 4A3IJ 3FB9A 4E7SA 1YX3A 2GXGA 3ZMDA 4G7HF 4O3MA 2OCEA 1E0EA 3HP9A 1CKBA 3QHSA 4Q47A 3CMEI 1B8IB 1KD1C 1M4ZA 3MAJA 4CC4B 3BTJA 3HOXJ 1WFWA 1YFNA 2ZC2A 4M77D 2CMPA 3FXJA 3CCLQ 3OYAA 5BMZA 4DGWB 1D09B 4CGZA 1K61A 2B0LA 2FSWA 3HFOA 3A01B 2BBYA 3WTVC 2DPDA 2K5FA 1X75C 4ZC3A 1YE9A 2D1HA 4EJTA 2R7XA 5JLWA 2ZO4A 1OCRH 5LRRA 2LBFB 5B1AH 1ZHIA 2CUBA 2M8EA 2E1HA 4DBHA 2DW4A 3G71T 3NTIA 1IXRC 2QGUA 2DVEA 5GAOl 5J8CA 1SFXA 3OYDA 2E2IJ 1FMWA 3DXJF 1PJRA 3EH1A 1X69A 5LJ3g 2OTJA 4LN2A 2H6BA 5GANd 1WZOA 4HT8A 2W24A 1NK2P 2FL7A 1XDUA 3P9KA 4CUGA 1OISA 4JK1X 4LD5A 2KSSA 3L09A 2F5TX 4I6ZA 1B3QA 2RH2A 2YDLA 4Y28E 3FHNA 5DY9A 1T08B 5KAIC 2CUZA 3ZR8X 3T5XA 5LGNA 2XDVA 3CCRQ 1K8AC 4D8KA 3M7GA 1SEUA 1RUOA 2XF6A 1ZQ1A 5LJ3h 3C4SA 4RLQA 4A4GA 1QZZA 2HGCA 5IXFA 4JRQA 5I21A 2DO3A 1FMVA 3ZL7C 2AK5A 5J40A 4AYBN 1BJAA 1Y39A 5FJ8J 1ETWA 3CUQB 4GCVA 3RIRA 1AKHA 4BUGA 2HBPA 2WADA 2Z33A 5DTDA 1R0CB 5CPRB 4PK4A 2IGMA 2OZUA 2YUQA 1K73R 5CKEA 5KYUA 5GAN5 4I99C 2M9HA 2EQKA 1R1TA 2WB1N 3BZCA 3KZZA 1W36C 1FP2A 2QENA 3UR3C 4F52A 2JMWA 4KNYA 2EVRA 5CK9A 5GAHJ 2RJDA 5GAN6 4LOCA 2ESHA 3GMEA 3VYSB 2L0KA 2STTA 5D8LB 2K79A 4A3LJ 1UB9A 1VQOA 1W2BA 4RGUA 4KT6A 4BJ5C 4A0ZA 5K7HA 1QA6A 3HDDA 4BNCA 2E3HA 3CXCP 4XN0A 4X9CA 3UA7A 3RJPA 4G6DA 2OX7A 3P8DA 3P7NA 2X4YA 4CC2A 1YCSB 2D45A 3RPUA 4B4CA 3S3MA 4NS5A 3K4CA 2HQAA 3E5XA 4ZYHA 2KR3A 2JA7J 2ZSHB 5CAIA 2RI5A 2HEOA 9ANTA 2W00A 2ZGWA 2QQBA 2V7FA 5ICFA 4BQQA 3MKYB 2R57A 4J9CA 3CPWS 1E7OA 3WHCA 3EYYA 5HLIA 3BJ6A 3EGXB 2RV8A 3AG1H 3K7AJ 3ZMSA 1HW2A 4KDPA 3V8JA 2R5YA 3C2GA 1DPUA 3L42A 3R6OA 3PGGA 3VYGA 1SC7A 2VJ4A 2DDAA 3I55T 3TEDA 1BK2A 4XSZF 4LD6A 1KU3A 2OTLQ 1TQIA 4I76A 4NOYA 3M58A 3FDYA 2EBIA 3CO6C 1H9GA 3MKWB 2W0ZA 4JJCA 3M07A 2CZ6B 2K7LA 2CUFA 2HSPA 2JN0A 4LDYA 1UGVA 2GBQA 2XDDA 2QDLA 5L3DA 2FNAA 3DLAA 5HLTA 1P4WA 2A6TA 4O5VA 3FISA 3HGYA 1G3YA 5EGOB 3IRQA 2CZ0B 1OCOH 2KEAA 2EFIA 2NUZA 2D8JA 1OI1A 1ZK8A 2HVQA 3UDCA 4JS5A 2O88A 2HL3A 1R4MB 2ACJA 2R7OA 3CCUA 1WI9A 2CG4A 1YW9A 2MLGA 2PEXA 4HDVA 2A28A 1UELB 2L54A 3M59A 1QO0D 3B6AA 2DA1A 4CYCA 1F1ZA 2FQ3A 2R5ZB 3MPUB 3EG9A 4A12A 3C2BA 3MMYB 3GIBA 2LTOA 2HU9A 4RM3A 3DLMA 3QOEA 3PIOF 2HR3A 2LVMA 2A6EF 1FOYA 2E1OA 3O3KA 4RAZA 3K4JA 2C0IA 2EW3A 3A8MB 2YT6A 1W0UA 2VODA 3BG6A 3LWIA 1JXMA 3WTWC 2ZJ2A 5FLXZ 1SHGA 3K69A 3PSFA 5KYNA 2LQWA 1SEMA 1I1SA 1JUPA 4LLNA 2P6TA 4A3DJ 1RABB 1PNJA 1J0RA 1A04A 3WG9A 4F16A 2VUBA 3VYHB 2VKDA 4J83A 1BBYA 3LFUA 4EV0A 3CCRA 3WG7H 4TVRA 3FK7A 1TWFJ 2J06A 3E6CC 1D8JA 3R6SA 2NNYA 3REAB 1WDXA 2ZMEC 2E60A 4QWQA 1O9SA 1TWBA 3KLNA 3E6MA 2HVRA 2O01E 3OMGA 2DMUA 3BR1A 1FYNA 3Q5FA 2DF6A 4X1VA 1VQKQ 4CICA 4HQEA 4C92F 3CPWA 1OQYA 3IWZA 2OD5A 1QNTA 2X9DA 2R7VA 4MFEA 4U88A 4XRMA 4HV5A 4ZGJB 2AS5F 1LKXA 4FU6A 3GXOA 3BE3A 1U9OA 3CC7A 4KMUX 3CCLT 3CC2Q 1BN5A 1O3QA 2HS5A 1JT0A 1G8XA 4ABZA 2UUZA 2P0PA 3RMSA 2DL3A 3BT9A 1VQLI 2HQ5A 2XGDA 2Z9OA 3J80E 1TU0B 1D1BA 3HPWA 4X9DA 1JKOC 1R8OB 1GDTA 1WJ5A 2A5YB 1C0MA 3MEUA 3MZ8A 1WCMJ 4A6EA 5DM7F 4J9DA 4BY6B 2VIXA 3M4YA 1JI8A 1Y0MA 1HD3A 2CH4W 4DYRA 1A35A 1Z9QA 1CF7B 4HVWA 1W36D 1TBXA 2IP2A 1YI2Q 1Q7YU 2G9WA 2KQRA 2F6CA 4HV6A 3J81R 3NGPA 2E70A 1VQMI 1Y8QB 1M1GA 3IP4B 2W84A 3OYLA 3GP8A 3HXLA 1YHQQ 4M7DD 1T0HA 4FE7A 1WHGA 2IXSA 2L9NA 3ZOBA 1GV5A 1ZLMA 3CTAA 1T3LA 4C92A 1ZR2A 2M87A 2FZCB 2DFIA 1R77A 3NTHA 2IAIA 2JN6A 1ZRCA 3ASOH 2KDSA 1DU0A 5AT1B 2C0TA 2NXNB 1SVLA 2K3XA 2FU4A 2V9VA 2Y75A 5J26A 1WSUA 1TL8A 1LVKA 2QUFA 1S9HA 4A93J 3FBIB 2KGTA 4J5YA 5GANj 3KP3A 2MC4A 2L0AA 2GF7A 4II1A 3CC2A 1HKSA 3OL3A 4RTUA 3CD6A 4PJOD 1BR1A 1T98A 2YUSA 1MNEA 2R3SA 1X43A 3L2WA 2XDBA 1W0TA 3I9V2 1VYVA 3HHTB 2O8KA 1M3CA 2I5UA 2Y0SN 4ZTJA 3LQRA 1APLC 1ETKA 3H6ZA 3ZMZA 2WAFA 3U2RA 3SHWA 2X51A 2XG8D 5DCMA 1X2KA 2M3AA 3SWNB 3WGIA 2DOAA 3K70D 1R5ID 1UUEA 4AIDA 1KU7A 2F5VA 1CKAA 1OZ2A 2FXAA 1AKHB 3P8HA 3CD6I 1RAGB 2L7KA 2AIRB 3HTRA 4A4HA 1ZLJA 4KGXB 2LQNA 1IN6A 4MZMA 4UNOA 4PL6A 3ABMH 1IV6A 2CQXA 5D8KB 2D0QB 2NS8A 3CDIA 5M5WJ 2JZ2A 1KQSP 2MF2A 2MH2A 2CQQA 4PUSA 1LJ9A 3EYIA 2A61A 4ZDPA 3JV3A 2NAZA 3VS4A 3JCMW 4EIKA 1YI2A 1KD1R 2YX7A 4BAYA 3I58A 1BI2A 4JQFA 2LD5A 1I6HJ 2FX0A 2DBKA 4D8DA 4DBFA 2M7AA 2K2MA 2ZXIA 2MA3A 4M77C 1LCKA 4XIDA 3EUAA 1HXDA 5FGMA 1QCOA 2A68F 2KAFA 3DB4A 3CCVA 1MW7A 3DFGA 3L2UA 1SRLA 1YCYA 4CCNA 4IUPA 2O9LA 3CCQA 3G4SI 2D2WA 1Q7YC 1N9RA 1B8IA 1LEBA 4UC4A 3DKMA 3BTLA 1LDKB 4DYQA 2P0WA 3NQOA 2R5AA 2X4JA 2JW4A 1FC3A 1RESA 2A6HF 5BQTA 1BL0A 5F1JA 3P8BB 3KBGA 4E6RA 3A02A 4XM3A 1IN4A 4Q4ZF 3DLLA 3RYRA 2PJRA 5GMKh 3OQ5A 4KUIA 4DBRA 3CCRT 2DMNA 2Y30A 3PO3J 3GZ6A 2NUPB 5FW9A 3HKZN 1SSFA 2FNPA 2F5EA 4HNTA 3ZQ7A 1GHCA 2NUTA 5FKNA 1JKQC 2DK3A 1X1DA 4LDXA 2W10A 4DOZA 2HZYA 3HZJA 2RM4A 5KK1A 4M7AD 1WA7A 3VU3C 3MZHA 2J6OA 1RACB 1WFXA 3SDGA 1GRIA 5FKOA 5GAMj 4M7AE 2AQFA 2F69A 1YJNI 3R60A 3QPTA 2RHYA 1T0JA 1PUEE 2DZCA 1K4US 3G2BA 4XRSG 1K73C 3LA7A 4J01A 2RJFA 2XMFA 1KD1U 4LB5A 4Y15A 3JRIA 5A2QR 4R0KA 3JCMJ 1V55H 2DO7A 2BTTA 3DBRB 2X4XA 3K4BA 5FD5A 2CW7A 2YR2A 3H3UA 2HNIA 3MJXA 2DFEA 2JTVA 2LSOA 1YBYA 1S7OA 2X6WA 5FLVA 1CQTA 2QSGX 2MGQA 2F4OB 4RCBA 1YJWT 1MZBA 4UUTA 4A0XA 2PBIA 4CYDA 2HDCA 1AT1B 1A36A 3GWZA 1MJAA 2M0MA 2PMHA 4C3HJ 3A01A 2K4YA 1WXBA 1LVAA 1VQPT 3CCST 1M3AA 2KNBB 3KLOA 4WWCA 3RI4A 4U7BA 3CP8A 1LFUP 2XAFA 1ON1A 1JHFA 1ZKGA 5IH2A 2O7OA 1TG0A 2H8WA 2HKOA 2L9VA 1TT0A 4KFCA 1VQPQ 4M78E 1JHHA 2F4MB 4KBMB 1T38A 2W48A 5LD2C 3KCCA 5E3OA 2M1BA 4Z89A 3JB9F 2OQGA 1T33A 1S8NA 5BNGA 1XG1A 2E1CA 4M75E 1TOVA 1YP5A 2RVCA 1K73U 1P92A 2OCCH 4PFZA 1Y56A 3CJRB 4IHSA 2QDYB 2LY1A 4RGRA 1YS6A 2PTKA 3MEAA 3S8PA 1U1SA 2ZMEA 3F8FA 4M75C 4R55A 3LGFA 1YRNB 2VBWA 2L8DA 1FIPA 5KYWB 3RKQA 2DL7A 4G6QA 4RTXA 1UAAA 2QSFX 1RAFB 2O8XA 4EPCA 1W6XA 1I5LA 2L4MA 2W25A 3MQ0A 1ZLKA 1MSFC 2X3WD 2X0LA 1N77A 2D9TA 2RNGA 2BKDN 3DTKA 1G3TA 2IGNA 1X2MA 3GZ5A 2K3BA 4YIRX 3A03A 4M78B 5GMKi 4V2SA 1U5TB 2COZA 2G0EA 1X3UA 3RPUD 1HBXG 1TS9A 2B7EA 4M3DA 1UHMA 4RS8A 2OZ6A 3GUDA 3SHFA 4MEYF 2IVMA 2VN2A 1Y96B 4G94A 3K2ZA 1PVEA 2Q2EB 3F72A 2R5ZA 4KN4X 2RD1A 3MN2A 2J6KA 3JCUC 2KI7A 4IL6C 1FX7A 2OU2A 2FEIA 4QVDA 1NEBA 4EVIA 2EPDA 4OGEA 4BACA 1IN7A 4PJOE 1VQ8I 3I5RA 3CCQQ 2HZTA 1JJ6C 3GEZA 3BJAA 4OAYA 1T2KA 1XGMA 3OSFA 1RADB 5C44J 2FOKA 2ZPHB 1OMIA 4B43A 4EJOA 1EH7A 2YU3A 3COAC 3TW6A 2RI3A 2QEXQ 4D6WA 1TUDA 1N27A 3NMZC 1POGA 2JT4A 4OGCA 2FBIA 4PFPA 2ESNA 4UV9A 1E3OC 1KSWA 1X6BA 2P5LC 5GMKl 2BY1A 3CCUQ 2KRCA 4Y92A 4M7DC 5LJ5h 1D3BB 1YIJQ 3K0LA 1AU7A 5E3MA 4FETA 3SFIA 1F5TA 2ECZA 1N25A 2V6CA 1DDNA 5KE2A 3CQZJ 3F8MA 3VSLA 4EATA 4PJLA 1OV3A 1Z7LA 3QU3A 4BY1J 2LQKA 5CO7A 1LEAA 5A0GA 5D4SA 5J4YA 3ZMTA 5HKCA 3E9FA 2KP6A 4E7IA 1WHKA 2JOYA 3QDRB 3F8BA 3Q9VA 1Z6RA 5E1ZB 4ZJZA 3S1NJ 2E35A 3QPHA 5TJJA 2B63J 5EG0A 3G1JA 3BDLA 1E6GA 3R61A 4F7UA 2CFXA 3FXOA 4JJDA 1BW5A 4Y91A 3DPLC 2JRTA 2QLZA 3ZRGA 3OSGA 1FBUA 2OF7A 3FM5A 3A4CA 1F9NA 2FO0A 1YIJI 4M77G 1GBQA 3SZTA 2JM8A 1OU8A 3WU1B 3I0TA 2NVTJ 5J3LA 1G83A 1K8AU 2JTMA 2VXFA 3I4PA 1DP3A 2IPQX 1EX4A 2V26A 3T1BA 1WJCA 3TVTA 3J81E 1W5TA 3A98A 1QHHD 1U6GA 3CJNA 1ZGWA 1N6AA 3GF5A 2EFOA 1M2VB 1W1WE 4D9JA 2AHJB 4F7ZA 2CSIA 2MH9A 3W2WA 5J1YA 4AIJA 1RAIB 2DTHA 2Q8KA 2GFAA 2QTVA 2FMLA 3A5ZB 3ZN1A 1HC8A 4AMCA 3NRVA 2XDPA 2EWNA 2IBDA 3RQ4A 2F2VA 1VZ0A 1I1JA 3LH5A 3TP3A 4C3JJ 2Z99A 1KQ2A 3CCJQ 3LSMA 4P55A 4M6VA 2CGHA 2LR8A 4IRHA 2DJZA 1PKSA 2Y69H 3BQYA 2DXIA 2HDAA 2ZPEB 4ZNXA 5EEGA 3LFKA 1TW2A 4MTEA 2MZ4A 1WJAA 5IYCJ 2DMOA 3N05A 1BYMA 5EZGA 2Y0MA 2GZWA 1AWWA 1TTYA 2MW8A 1YITQ 3QSUA 1T56A 1D1AA 1TWCJ 3L1PA 2D0NA 2VC8A 5EG2A 5DUIA 1R23A 3HOTA 1VQKI 3D0SA 1OQKA 2NVYJ 1NJIC 5D6YA 1VQ5Q 1OLTA 5IP9J 4JRKA 1VQLT 1I81A 1LOJA 1JUSA 2COBA 3K6GA 3NTKA 4L18B 3OMCA 2L3DA 2LDMA 1LFBA 2QQ8A 2XRLA 5LRSA 2HQXA 3DEEA 1W5SA 4BQAA 1QP3A 2V8IA 2X35A 1QVPA 2ZPGB 3SB2A 4G12A 1KJWA 4L9JA 4Q5SF 3E9GA 4LDVA 3HSBA 4IHYA 2DXUA 2JMCA 2VVKA 5IXBA 2M7BA 3W6KB 4PJOG 1ZHFA 4IURA 4XTVA 3HB9A 5FRNA 1YITA 3CMAA 2CGPA 2JSCA 2L01A 3OYFA 3JCMd 4RB2C 4X6AJ 5E8IA 2HEQA 3K1PA 2A3LA 4IPAA 3GTKJ 2E7WA 5GMKj 1Z3XA 1ZREA 4A3MJ 2X3XD 1YW7A 1X6OA 2PQWA 4EMHA 5A0LA 3A2KA 5H6QA 3FXLA 3LSPA 3MKDA 3B02A 1O57A 1Z3YA 4XLCA 2DT6A 5ICEA 3J7AO 3QYEA 4JBAA 4N4OB 3EG3A 4MMKA 4KH0B 1QBJA 3PIPF 2YX4A 2EV6A 4M6YA 5E17F 4C8QG 3KXTA 3OV8A 2FMYA 5CKTA 4E7ZA 2X1DA 1SHFA 1WJQA 3QQAA 2KRSA 2MG4A 2VOOA 3RNJA 2ECCA 2LREA 4ZGEB 3ZP5A 1R49A 2XKOA 4BXFA 3DV8A 3M8FA 2DKGA 4NDLA 3OS1A 2M30A 1F36A 5GTIC 4J7FA 4LXCA 3TDZC 1GVDA 2LQ8A 3J80Z 1ZSZA 1U3OA 1AZGB 1NE8A 1ACMB 2HCKA 3O8GA 4RLFA 4EMKC 2F48A 2QA4A 2VXEA 5DEQA 4L9VA 4M7AC 2XUBA 2O2OA 2ZXWH 2DL4A 1VQ5A 4D5FA 2NUPA 1PWTA 1DGWY 3E19A 2EFPA 2G7UA 1WPKA 3ONQA 1OOTA 3I55Q 3SZPA 4NNJA 1Y71A 2EPFA 2DBBA 3F23A 3VS5A 1CGPA 2NS7A 1T39A 1WJRA 3URGA 2KIUA 1NLOC 3TSWA 1QPIA 1ONVA 4LK0F 5KVRA 1OULA 1WXUA 1ZUYA 4P5NA 1B1BA 1AVZC 5JHUA 5EZHA 2O31A 2ZPIB 1TNSA 2CU7A 2RGVA 3ZMUA 3PFIA 2DETA 3ROUA 4II2A 2E65A 1IREB 3C18A 1Z9CA 5GMKm 3GBQA 1MV0B 5IHKA 4XSXF 2F5DA 3CCSQ 2XHCA 2LF7A 2NVQJ 1XS9A 4L0YB 4QPOA 2DX1A 1D1CA 4M77E 1K9MR 2XF5A 4B6MA 1VQ4A 1BR4A 1F1BB 3NHNA 3KZIC 2EINH 1FJLA 1ZA2B 1QQIA 4KRTA 1UJYA 2RQUA 4HDUA 3A8OB 3TGNA 4JJNK 3B73A 3M8EA 3VOEA 3EUHA 3J80K 4CI0C 2Y48A 1B7TA 2FVUA 2DXCA 4MQ9F 3J81K 1H8AC 3A8GB 1UE9A 3F9KA 1FYMA 4B47A 1Z05A 1WHJA 2BZTA 2PI0A 1YHQT 1UGPB 4M7AF 4WK8F 2RK2A 3VS0A 2MFZA 2DA2A 4OMQA 1DGRM 4M78C 1M2OA 5FB2A 5HODA 3RBBB 5EEHA 3KP5A 5HLHA 2V79A 2HD0A 3G6EQ 1JGGA 3V8KA 4FSSA 4N4IA 5LGTA 1GLNA 2K9GA 4C8QF 3EPZA 1H88C 4A2UA 2I2LA 3IUOA 2WBMA 2OBPA 4AG1C 2QCOA 3HBLA 1YJNT 3I53A 3A0HC 2DJIA 1WHHA 2CUJA 3LOCA 1S7AA 2Y4XA 4M75G 1ZTRA 3I55A 2A69F 2LY9A 4PLLA 2MUNA 5CVIA 5GJVB 2VE9A 1JKRC 1A31A 3OSVA 3J81Z 2P4RA 2AT1B 5EDNA 3QWYA 2COMA 2DJQA 3PMTA 4GY5A 2RQTA 3P5JA 3BR5A 2E5NA 3ZQQA 4D7MA 4RMNA 3VS7A 2XV4S 2Z16A 4XLHA 2B9SA 3VWBA 3EFRA 3QOPA 3CCUT 1QPMA 3I3LA 4Y13A 3I56A 5GTHC 4ZDLA 1AHJB 3Q9SA 4RB3C 3CCLI 2E5KA 2KRNA 2KJBA 4E2FB 1VQ4Q 1K4TA 4QKUA 1AWOA 4PGHA 1YITT 2ID6A 1VQMA 2Y0SA 4A3BJ 4BHBA 3K1NA 3LH0A 4ELYC 4I09A 1B4AA 1BIBA 1A5JA 2QKLB 5LHHA 2VONA 4CZCA 3WU0A 2L2PA 5JHFA 1G3SA 2HQRA 3F8CA 2ELJA 4KULA 3JCMf 1V76A 3ZXSA 2HFHA 5HDKA 3FKIJ 4C3IJ 5KYYA 1GV2A 2ZFWA 3SQNA 1PRLC 1HJDA 3JCMc 4MNUA 4EJWA 3Q0VA 2EKHA 2XD0A 1ZELA 1RI9A 4RCCA 2SRCA 4M77B 2QEXI 4RTZA 2K4BA 2PUOB 3H5RA 3SEZA 1BB9A 1H0MA 1USSA 3QODA 2DIQA 2RN7A 3QXEB 2W82A 4BY7J 1AD5A 5LGUA 3IRRA 4LUDA 1RETA 1WGSA 4HCCA 1I50J 1A0NB 1UHCA 2DAOA 1VQNT 2Q1ZB 3JRFA 2VQGA 3JCMe 2C06A 3F8NA 2XB0X 4RMOA 3IC7A 2LF8A 5E8GA 5LEJA 1KA8A 2EYYA 2MPXC 4NL2A 3PNVA 2CP3A 3QO3A 3S16J 2O61A 1A6IA 1SFKA 1AOJA 2VE8A 2ZNYA 3LSHA 3FXKA 2BE5F 4UUSA 5CQEA 1B72A 3EDPA 1ETYA 2IEKA 1KZHA 3G6EI 1X1PA 3BP8A 2PVDB 3I5SA 3KPHA 3FEOA 4MZTA 3G1LA 1ZGAA 2KZVA 2X1EA 4A63B 5GAOp 3KEOA 1MNMC 1I4K1 1BU1A 3RMQA 2NVUB 4RTTA 3AT1B 4E70A 2PVGB 3UA6A 1DPRA 4UV8A 3HOUJ 1KC8R 1YJWQ 5A2QK 2LK2A 1IB8A 1Z9ZA 3VS6A 1W5CC 2JWTA 4HT9A 1BI1A 3DPUA 5A0DA 3BPVA 2WA0A 4BQNA 3OYNA 1VQNI 3OL4A 1I5OB 2GBYA 2MD5A 4IUTA 1SMYF 4C92D 2I8DA 1SFOJ 4CC7A 2LDUA 2O3FA 4QVCA 1GUUA 1LDJA 3HKZA 3AL0B 4HF2A 1M3BA 4BH9A 2QSHX 4IHVA 3GFJA 2R7ZJ 2FHDA 1R5GA 1P2FA 1TQPA 2QA4I 4PJOB 4I7HA 4JX6A 4YFXF 2YRCA 4ZYGA 3ZQIA 4FX4A 1ABOA 4MIMA 1FXXA 2X6XA 4YELA 2IGOA 3A1PA 1WJBA 4LNPA 5CKHA 3ASNH 2GWRA 3CZ6A 4OOIA 3RKYA 2QGFB 4XBFA 3MKZA 1WQWA 2ZB9A 2XICA 2KBTA 3BTCA 1ETQA 4QQDA 3Q3SA 4UHTA 1G5VA 2CP0A 5LJ3f 1RKTA 3AAFA 3S14J 2CP6A 2EV0A 3CDHA 2DPPB 3G71A 3OY9A 4G9YA 1R71A 1FOXA 3JSCA 3CC2I 5CR2A 1R22A 3OIQA 1QVUA 4W97A 4QW2A 1IDYA 5GAMe 2D8HA 4L5JA 3W6JB 3UF4A 2OTJT 1X3ZB 4M7DF 3H1CA 3UPUA 2BY2A 2HKXA 2QQAA 3KUFA 4ENJA 2PZ1A 4FW1A 2W4SA 4C8QB 1YIJA 5D6FA 1SVOA 1KQ0A 1VQ8A 3JAMZ 2ENMA 2DQLA 3S2HJ 3KEQA 2GM4A 2RNAA 4RTWA 1ZSZC 4Y52J 3HPHA 3WU2C 2FPEA 1J7KA 1X19A 2BY0A 3C2HA 3OOPA 1IN5A 2CSOA 2FQ4A 4LIUA 3DLLF 1WLPB 4X34A 1Z77A 4FYYB 1MDMB 2G6FX 4XR6A 4IOCF 1IF1A 2MWPA 1MBEA 5IT9K 1BI3A 2YLCA 3RSNA 2J05A 2LKPA 1OR7A 2ED1A 4JLGA 2RQPA 3H3ZA 4ZDOA 2YRDA 4GYIA 3OYIA 4FT4A 4ETSA 1TC3C 2WAEA 5I11A 4DW6A 1MIJA 1MH4A 1WH5A 2K86A 1KK7A 2JTEA 2DA5A 2ZPFB 1MNDA 2P7CB 3ERED 1VQOQ 4HNVA 2QZ8A 1YO5C 2DA3A 4EGYA 2RQVA 2X9HA 4RG2A 1V54H 4XKBA 5F0HA 1Z6TA 2M0CA 3CCJI 4ESJA 3CJTB 5D6XA 1Z21A 1QVFP 1RR8C 2XGCA 4BL0B 2VPRA 1QKWA 2EJ9A 3FIWA 3CC4I 1WZ2A 3PO2J 3L00A 2YUPA 2DOFA 3BG9A 1VA7A 1ZUKA 3KP7A 4XOTA 3VODA 3CBOA 2V4JC 4JX4A 1N8RU 4C5EA 3JB9D 4XKCA 3DBHB 5E20A 2PFBA 2YS9A 1O4XA 1S5LC 1OJLA 2ECBA 1HLVA 1AWJA 1G6NA 4IIMA 3EFSA 4BJTA 3BWGA 1Y0UA 5FROA 2HTSA 2QBYA 1NEGA 2GFUA 3TU4K 2V1DA 3H35A 2BW3B 3GNGA 2KRHA 2V8JA 4RTVA 5FU6B 5A2QZ 5IT9E 1B72B 2MD0A 2X85A 4PJMA 2XI9A 3GNFB 5DLQE 2KDOA 2JTFA 1YN8A 2IW5A 1VQNA 2Y31A 4GBQA 2DL5A 3M1CA 1J5YA 2EYXA 2WSFE 1WJEA 5JVTA 1ERDA 4D7NA 4IX7A 2JVGA 2EILH 2OI3A 4O6JA 2RKHA 2DN0A 3DCFA 4NC7A 2F1LA 4V19K 1K0XA 5F1RA 2DT5A 3CBPA 3F21A 1EFNA 3Q0WA 1M5Q1 1V29B 1N75A 1ETOA 1VQ7A 1S29A 5E3LA 4A69C 1RAHB 2EB7A 2J6FA 1WQ2A 1IJWC 2E19A 5D5WB 2JPBA 3J7ZI 3L7WA 2HSEB 2MMPA 2R93J 3CCMQ 2HMAA 1B34B 2DILA 4AYBA 2DFHA 3F6OA 4YEJA 4FCYA 2GGRA 2LC4A 3L9FA 2M2EA 3JAMK 4RB1A 4DQ2A 2DK8A 1MH3A 2E5ZA 4ZYEA 4OMFB 3EG0A 1XDSA 4DEYA 3H0IA 3FKJA 2BZ8A 5KYWA 2DBMA 1OCPA 4M77A 4A5NA 2FD5A 1OYWA 5DD4A 3JRBA 2QF7A 2KE9A 3ABLH 2KIMA 3E7LA 4Q48A 4M74A 4LLLA 3OBYA 5L3GA 2G3RA 9ATCB 1Q86R 4WTOB 2RREA 1U8BA 2EIFA 5J1UA 1VIEA 2VGNA 4HEA2 5ECAA 2FA5A 3E6BA 2NNNA 1XX5A 5CYVA 5FKLA 4NQWA 4FE4A 5D5XB 4IZZA 1PSFA 2KMTA 2PVOB 2NLUA 2NYSA 2ZBKA 2E7XA 3BQZA 1X1BA 2JS2A 2LJ0A 3ME9A 2KLOA 1S1NA 1TT5B 3AFHA 3WGGA 1FTZA 1M8VA 2XGEA 4LFUA 1V4RA 4YFKF 1JJ2S 4CH7A 1HKTA 4FASD 4BBRJ 4LLGF 2AZSA 2OTLT 3MVPA 4U0WA 3L2CA 2M02A 2EZKA 2OAZA 4HX8A 4B48A 1K78B 3FXUA 2A08A 2CP5A 2P0TA 2F5KA 3CF5F 3G6EA 4OMMA 2KYBA 1HSQA 2P4TA 2Y4YA 4P5OA 3I55I 3OW2P 1YIOA 4ASNA 2QQ9A 1R5HA 2DFFA 2DMTA 4XAXB 1ZYRF 4N4HA 3TP0A 3S15J 2COYA 5K7FA 4RB0A 3JTGA 2DA7A 2Z2SB 4E7KA 3TCJA 2HYGD 1TWGJ 1JBMA 4U0VA 2VJIA 3U1DA 2CQKA 1Q82U 1Q81C 4N4NB 5K1YA 1P4XA 1D5YA 4DYCA 4XONA 1PUFA 3X26B 3TOBA 4OU0A 1HF0A 1H3HA 2XAQA 4DEXA 1XGOA 2LTPA 2YSRA 1ZR4A 2L3RA 1WI7A 2HQNA 3JB9J 5ERIA 4Y7NJ 1OX9A 1OEBA 3T9NA 4QQ6A 4RBOA 4OB1B 2E3IA 2JK3A 3NEUA 1H89C 2Y90A 2OAUA 2X4WA 2F2WA 4XLEA 1R1VA 2GAUA
chains in the Genus database with same CATH topology
4LGWA 3LYIA 5FU7C 3HYIA 3CBMA 5C0MA 1YW8A 5LHGA 1DUXC 2LCCA 4UUVA 5A0LA 3HHGA 5KH6A 1XCBA 3V7SA 5HLGA 2QQRA 4LD9K 4ESFA 3FF5A 3TOAA 5A2QE 3ECOA 3CC2T 3CD6T 5CVUA 2M16A 1SFEA 4C8QA 4NB5A 3KE2A 1VIFA 4CZZA 3CC4A 5DYMA 2JVVA 5K5OA 2QQSA 1MJ9A 1ZGJA 4EDUA 5GAN4 4BHPA 5H20A 3WGHA 4KMFA