1G3SA

Cys102ser dtxr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
212
Chain Sequence
b'LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 64
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3sA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3sA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3sA03
3I71A 2M87A 3PQKA 3R60A 2O61A 3FWEA 2HOEA 4HDVA 3IRQA 4ENJA 4EGYA 3ABUA 1FPQA 2ZJ2A 2VODA 5E20A 3REOA 1U3EM 4G9YA 2RC4A 3D5LA 1IAWA 3H3ZA 3FMQA 2A68F 4RB2C 3LAJA 3HSFA 3R6SA 2GZWA 5JHUA 3QU3A 3RIRA 1FLIA 4IHSA 3I4PA 1FC3A 2K02A 2PEXA 5LHHA 5H6QA 2CG4A 4FT8A 5HLGA 4HYEA 2XHKA 1D8JA 1ULYA 2OZ6A 3F21A 4Q5SF 5L3FA 4L9NA 2MD5A 5J8FA 1ZAOA 2IA0A 2XAQA 4A5MA 5ICGA 1IW7F 1R1VA 1S3JA 2V1DA 1WSUA 3HOSA 3ZN1A 1OR7A 1LQ1A 4L9VA 4B8XA 1B9NA 5K5QA 3ECOA 1LEBA 1QPMA 3S2WA 2LSOA 1WWXA 2ETHA 2L54A 1W4MA 5E18F 1K78A 2P7CB 1FZPB 4G7HF 3T0YA 2GIVA 2EV6A 2O03A 5BOXA 2P4WA 4P96A 1WI9A 2QM3A 2VT2A 1YFHA 4WXHA 2FQ3A 2OQGA 5D6EA 1J59A 2ELHA 3ISPA 2M8EA 4Q4ZF 2L4AA 4KMUX 3DXJF 4MGRA 3FZVA 1T98A 3NEUA 3L00A 4PGGA 2Z5UA 1G4DA 1W5TA 2R3SA 3GXOA 2Z3YA 4MHGA 1UHWA 4YFXF 3WTWC 2BE5F 4JQFA 1BIAA 4IRIA 3L9FA 4HAMA 3RI4A 2OA4A 3V8LA 5E1ZB 2A61A 3CLOA 4CICA 4L5JA 4O6JA 2NNYA 2WV0A 3TQNA 4IF4A 2P6SA 1R5HA 1KYWA 4Q47A 3RPUA 2EJRA 4LJZF 1P4AA 4PGHA 1ONVA 1ODDA 3HOTA 3EUHA 2ZBKA 3CTAA 3K1MA 2Y48A 2IP2A 1S8NA 2DPDA 4Y15A 3E19A 2K5LA 3LA7A 3QAHA 2R7FA 4AD9A 1AWCA 4P9FA 3COAC 3IKVA 3F3XA 1IN8A 3GFJA 2H27A 5DCFA 2ZO4A 1PDNC 1SD4A 5H20A 2YPRA 3T8TA 1RIOH 4KIGA 5ILVA 4ENNA 3J80Z 4LK1F 5LLQA 3CDHA 3MFKA 2WC2A 4M73A 3F6OA 5HS8A 4ASNA 1WKMA 1BBYA 1F1ZA 1YW9A 3JAMK 1BI1A 3F6VA 2DO7A 3TO9A 1XSXA 1BC8C 1TW3A 2EFNA 4L9JA 1RZ4A 4EM0B 4S04A 2P5KA 1USSA 1O3RA 3FXQA 4UVBA 3K2ZA 5CVIA 4I7HA 1B6AA 3CO7C 4L0ZB 4ZZLA 2PI0A 1RUNA 2CSOA 1F4KA 2EFWA 1QW1A 3GZ6A 1U5TB 1ON2A 5D4SA 2GA1A 2RV8A 4CO8A 4XSZF 3OV8A 2P6TA 1YS7A 1KU3A 3ZMUA 1X3UA 2KJBA 1R1UA 5IT3A 1CGPA 1ON1A 3TDUC 2UXXA 5A2QK 2XKPA 1P2FA 4R8HA 2DU9A 3Q9SA 2EFOA 3L7WA 4IVNA 4M6YA 4KIFA 5IT9Z 2E7XA 4UVCA 1K7AA 2DQLA 1J7KA 3LFKA 3IWZA 3E6DA 3MEXA 2VXZA 1MJ9A 3WTUC 2DT5A 1XCBA 1BC7C 3B73A 2GXGA 2PG4A 1U2WA 1FNNA 1FT9A 2ESHA 5FLXZ 1DPRA 1P92A 4WCGA 1KU9A 4HBLA 4EVIA 4LK0F 3RPQA 1LDDA 1GVJA 2P5VA 4Z2YA 4YFKF 3Q9VA 1ZYRF 1U5TC 2HWVA 4LLLA 4G6QA 2V6CA 3JSOA 3TOBA 4LG0B 1MJAA 2GQQA 1ZRDA 4UV8A 2FMYA 4OIRF 1R58A 2F5FA 2ZMEA 3ELKA 3WTTC 3J81K 1DDNA 3JSPA 5LEKA 4ESJA 1FWZA 2FEZA 2PN6A 2D1VA 1JXSA 1LNWA 5E17F 1W7PA 4G8XA 3FMRA 2OQRA 4U0YA 5ERIA 5D8KB 4I2OA 5CVUA 2VE9A 2OU2A 3K0LA 3WG9A 4TV7A 4P9UA 4IXAA 2AXLA 3ULQB 3EYYA 2K27A 1FYMA 4IPAA 3E97A 5KK1A 1R23A 3TOAA 3QP6A 4RB1A 3BP8A 2DI3A 2K7LA 2FMLA 3V7CA 2YU3A 1J75A 5H6RA 3HUGA 3Q5FA 4AIJA 1T6SA 5BQTA 3F8FA 1OMIA 2JRTA 2IW5A 4LGWA 2FNAA 3FM3A 3GW2A 6PAXA 3FM5A 4KN7X 4HV6A 3KE2A 3KEQA 2KIFA 3HSRA 3HRSA 1GXQA 2A6HF 1MZBA 2MLGA 2XAHA 4BAYA 1YLFA 1O3TA 3GVAA 1FOKA 1OYWA 3F23A 1XDSA 1XMKA 2EWNA 2UWMA 3HHGA 3ZMTA 3W6KB 2IJLA 2EB7A 4KUMA 4ZZDA 2XAFA 1B1BA 2XAGA 5DYMA 1Z1DA 1UFMA 5HS9A 2FBKA 1O3SA 2IVMA 1XB4A 1IN5A 3GO5A 1TLHB 1S29A 3IRRA 1H0MA 1XDUA 3RKYA 3JTGA 5LEJA 2NAZA 1ZG1A 3VFZA 1TNTA 2G7HA 2VBXA 3CUQA 4HX7A 4HF1A 4KA4A 2V1XA 1PP8F 3ML6A 3VODA 4L18B 1KGSA 3FMSA 2XROA 2LF8A 1K78B 3GFMA 5D4RA 2ISYA 1C0WA 4LLGF 5D8LB 2JPCA 1A04A 2A5YB 2HQNA 4WXDA 4AWXB 4KYWA 3KP4A 3WE2A 3WU0A 4EJVA 3WGGA 4M74A 3VOEA 1XCVA 2IPQX 1IN6A 3GWZA 1ZG5A 2P8TA 3ECHA 1YG2A 2ZKZA 5TJJA 3EETA 1I5ZA 2HTJA 5HLIA 2GXBA 2DAOA 2GCXA 1LVAA 5FGMA 2QWWA 3WTZA 2A07F 2E1NA 3CUOA 4A0YA 5TRDA 2ZNZA 2G7UA 1I6XA 4HF2A 2EV5A 2STWA 2ZCWA 1BJAA 1G3YA 5JFRA 4UNOA 4LB5A 3V7SA 3T1BA 4HV5A 5E1XA 1HKQA 5DUIA 2W57A 1IXSB 2P5LC 3NQOA 1K79A 3E5QA 4BXUA 1QBJA 3I64A 4BNCA 2O6GE 2AS5F 2DPUA 2NS0A 2WWYA 1MJBA 3H3UA 5L3BA 5LRRA 4BYYA 2FRHA 3WE3A 5DDGA 3I5UA 1LB2A 5KVRA 2FA5A 4MQVA 1IUYA 2LNBA 2A6EF 4MQ9F 4EGZA 1SFXA 1XSVA 3WGIA 4O3MA 4EM2A 5FFXA 3O3KA 4IJAA 1H9TA 1U8RA 2V9VA 2O3FA 5AIPA 1Z9CA 4ESFA 3U2RA 1IZ1A 2Q0OA 4EJWA 2K4YA 4UXNA 3VEPA 2RDPA 3E6BA 3ZMVA 2A69F 2FF4A 4ENKA 1S7AA 1Z91A 2HGCA 3PFIA 2XRNA 3ZQ7A 2OAZA 1REPC 3CJNA 2K86A 4U7BA 2JTVA 3ZMDA 1XSDA 3LQQA 1LJ9A 3RYRA 1B59A 3U1DA 4HX4A 1Z6RA 2FSWA 3LSTA 5DD8A 3BY6A 2L02A 4HOBA 2PFBA 4JBAA 2VE8A 2Q2EA 4WXCA 1HW5A 3GYHX 1SFUA 2RQPA 4FX0A 2IA2A 4OMZA 2KJCA 1MD0A 1ZGAA 4EM1A 5J6XA 1G6NA 1Y0UA 5JVTA 3DV8A 5FO5A 4RB3C 1FP1D 4KT5C 5D5VB 4UUVA 1B4AA 1D3YA 3E6MA 4MEYF 4BHPA 4MTEA 4F7ZA 1KU7A 4H0EA 1XD7A 2LKPA 2XUBA 3HRUA 4A0XA 3IHUA 4I0BA 3IKTA 2IT0A 4G94A 2V1UA 3F8NA 5FB2A 4EJUA 3G73A 1IRFA 5L3GA 3D0SA 4DNCA 3IWFA 4XLPF 4UV9A 3SZTA 4ZYHA 2PBIA 4S05A 4M9SA 3GF2A 2CFXA 4ZH4F 4ZYEA 4BQAA 1ZRCA 1T2KA 1T0FA 4R1HA 3I59A 4HZFA 2F5CA 4D0PA 4KIBA 2QZ8A 3EDPA 2ZMEB 3P9KA 1YS6A 2MC3A 4EMSA 2QQ9A 2OBPA 4Q48A 3HYIA 3HIFA 3AAFA 1BM9A 2O8XA 1DUXC 3RJPA 3MCZA 4RAYA 1ZG3A 1W7PB 1EH6A 1W5SA 3WU1B 3J7AO 1J5YA 3QOPA 1IN7A 3CO6C 3MZHA 3R0JA 5ICEA 3DPLC 4XBFA 3BJ6A 3VB2A 1QNTA 2DLLA 2FE3A 2O0YA 5LHGA 1EH7A 2EFPA 2BGCA 4JK1X 2QYOA 2CQKA 1P6RA 2E7WA 1XGSA 4A6EA 2QQBA 4RGXA 2VT3A 3I58A 2LX9A 1Z7UA 4BH9A 2COMA 1IRGA 1I27A 4CHUA 3LA3A 2NNNA 4A0ZA 2HR3A 2HYFA 1ZN2A 3GUDA 3DEUA 2A3SA 2NRAC 1IN4A 3F22A 5HS7A 1O7LA 4B09A 4MTDA 4N9HA 4EJTA 5BMZA 5JR3A 3G3ZA 1KU2A 1HSTA 2VBYA 2W25A 2XASA 3BOQA 1XGOA 2RN7A 5ILUA 1KA8A 5K1YA 2BBYA 3KP7A 3RKXA 1YW7A 3LAPA 2E1CA 2YX4A 5HDNA 3DF8A 4GYGA 3BDDA 2HQRA 3BWGA 4OINF 1O7FA 2JZYA 2R7DA 3TKYA 1TQIA 1HBXG 3SFZA 4P55A 1R7JA 2K5FA 5FFZA 2HDCA 5CVVA 2MLKA 3R61A 4AIHA 4YFNF 4UHTA 1DP7P 4LFUA 2X4HA 3CUQB 2QLZA 5K5RA 1D8KA 4MNUA 1SD5A 2STTA 3JW4A 2ISZA 1FBUA 3GX4X 4PDKA 1BYMA 4KNYA 4ENMA 2F5DA 3SZPA 3E5UA 5E8GA 3KP6A 2K4JA 3B02A 3ROUA 1HXDA 3ABTA 1L0OC 2MA3A 3I53A 3ZMSA 4M71A 4HDUA 3WODF 1FSEA 1STZA 3JTHA 1FX7A 4PCQA 2KKOA 3KP3A 4GXOA 3J80K 2D1HA 3DKWA 4KDPA 1R5GA 3F8MA 3T5XA 2HKOA 1LEAA 3M1EA 4M9XA 1OYIA 4GGGA 1IF1A 1R1TA 4U0VA 4PZJA 3KZZA 3DQVC 3V8KA 2XKOA 2IRFG 4M9ZA 2V79A 4KFCA 1P4XA 5DV5A 5D5XB 4RGRA 4K2EA 2NYXA 2JT1A 2FNPA 1QGPA 2VN2A 1J9IA 3CUQC 4KICA 1UB9A 3V4GA 1TTYA 4L9TA 1QO0D 2FXAA 1USTA 2PLYA 3DFGA 1BI2A 1V3FA 2VC1A 1QZYA 3BJAA 1FYLA 4XLNF 1ZH5A 4LLNA 2RKHA 4R79A 1OPCA 3WTSC 1HQCA 2WTEA 4A6DA 3C3WA 2DFIA 2QBYA 1BIBA 5K5OA 5L3DA 4HW0A 3HHHA 4RGSA 3WGHA 4KN4X 3BPXA 1G3TA 1JGSA 3LA2A 1U78A 3JAMZ 3HTSB 5IT9K 1SAXA 1OYYA 4NQWA 3GEZA 2ACJA 2FU4A 1SFEA 3GLXA 2DW4A 1CF7A 1IXCA 2PJPA 1R00A 4ON0A 2J5PA 2RGVA 1QQIA 1YO5C 4RAZA 3F72A 2B0LA 4BHBA 3O6BB 4LMYA 1T39A 5FLXK 4XRFA 3W6JB 5ICFA 4O5VA 2H6BA 3SQNA 4P5OA 3F8BA 2F2EA 5AONA 4U7DA 5ICCA 4U88A 5LGNA 1MGTA 2LDUA 1LDJA 4GO1A 1SMYF 4HQEA 5CYVA 3KZYA 3RTRA 2ESNA 3HTUA 3IC7A 2G9WA 1HKSA 5A2QZ 1TQPA 5F1RA 5DEQA 1FP2A 1F9NA 1FBSA 1T38A 2YX7A 2DBBA 2RVCA 2GA2A 1TW2A 2H3JA 4LD5A 2HFHA 1ZGJA 2TDXA 5EEGA 4WWCA 3EQLF 3QPTA 1MDMA 5DUKA 5HDKA 5CJ9A 4YIIA 2Z33A 4EQQA 5F6FA 1O3QA 2MBFA 5DCMB 3BJOA 2X0LA 3QRFF 2FOKA 4HX8A 3ZPLA 3P9IA 2RNJA 4Y17A 2W24A 2KIMA 4N9IA 3OOPA 4I02A 1JE8A 3FHZA 2LF7A 3K9TA 5L3EA 2KRFA 3FF5A 3KLOA 1MKMA 1HW1A 5CLSA 3I59B 3J81Z 1S6LA 2L3DA 2CO5A 2CWEA 3GFLA 5HVQC 2GAUA 4G6DA 2HEOA 3KEOA 2HZTA 2M45A 2Z9OA 4OIOF 2FBHA 2BYVE 4ESBA 3V8JA 2H94A 3NRVA 2ADUA 2IA1A 4YIFA 3QU6A 1OKRA 4XSXF 2XAJA 4AVPA 2EA2A 2QVOA 4Y13A 1F5TA 4L5IA 2OD5A 2UZKA 2UXNA 5ED4A 2VONA 4CXFA 1G3SA 1ZARA 2FBIA 5HDGA 3N4MA 1I1GA 4CZZA 2PMHA 4GYIA 3N97A 4IRHA 3H92A 1BI3A 1NHAA 5DCMA 2M30A 5BS6A 1ZLKA 3IL2A 3WTXC 2Q8KA 2YR2A 3ZN0A 1SD6A 4G7ZF 5BPDA 3K69A 1BN5A 4MEXF 3KCCA 4RS8A 4U0WA 2ZXJA 2JPBA 1UCRA 2L4MA 3BZ6A 3M8EA 4E70A 1HKTA 4N0BA 3DP7A 1HW2A 3KLNA 3TO7A 1YQAA 1YIOA 4OIQF 4OMYA 4NB5A 2D2WA 3R0AA 4ETSA 1EH8A 3BPVA 2BV6A 2J5OA 2VBWA 1WRJA 3I54A 3BROA 1Z6TA 4IRGA 2D45A 2DK5A 2JSCA 3KETA 3M8FA 1YYVA 2YSRA 1LDKB 5HLHA 2HKXA 3TO6A 4I0AA 2C6YA 3TDZC 1KQ0A 2CGPA 2XGXA 2VBZA 1HSJA 1XGNA 5CVJA 3WTVC 3E6CC 1O57A 2HYGD 4FHTA 3TGNA 1UHMA 1ZHFA 4CGZA 1FSHA 3MHXA 1R22A 2ZFWA 1SMTA 4A2UA 3FXUA 2DTRA 5D6FA 3K1PA 3LQRA 3HSEA 1TBXA 2MH2A 1RNLA 5D5UB 3E5XA 5L3CA 2QENA 3C1DA 5DD4A 3C7JA 1WQ2A 4ZYDA 4HLYA 2Z99A 3GZ5A 4WF2A 5F64A 1E2XA 4I01A 3U9GA 2XIGA 3KP2A 5LGUA 3DPTA 3T8RA 1PUEE 1QVPA 1XN7A 2K4BA 2H6CA 3QPHA 1U6GA 4OOIA 4EV0A 5E1WA 1W7PD 5LHIA 2EA4A 4DQ2A 4EJOA 4LB6B 2GWRA 4ZYGA 1KQ8A 1L3LA 2BEOA 3MWMA 3KFWX 4G7OF 2HS5A 5EEHA 4BHCA 4I09A 2XV4S 2OZUA 3RYPA 4IHTA 3M7GA 3WTYC 5ILSA 2MH9A 5FD6A 1RUOA 4CYDA 1TQMA 4I98B 1YTYA 2DK8A 1VTNC 3KP5A 5LRSA 1FBQA 2W84A 2W85A 3K1NA 3L09A 2EK5A 1Z05A 4OIPF 1U5TA 2PMUA 1GXPA 3HRTA 2ZNYA 5AIQA 2F5EA 3ZMZA 2DQRA 4GCVA 4WX9A 4WK8F 4UVAA 1KYZA 5D5WB 3V7RA 3O2PE 1ZLJA 1KQ9A 2QBYB 4OU0A 4QWQA 2Y75A 1D5VA 4KMFA 2EFQA 4NHJA 1Q1HA 4AIKA 2CYYA 1B9MA 1BOAA 4HQMA 4M72A 3I0TA 3MZYA 1FY7A 1BI0A 1SD7A 5BPIA 5E8IA 1PP7U 3P7NA 3QP5A 2EV0A 4HLXA 1JHHA 2PQ8A 2K5IA 1ZRFA 1TNSA 1CF7B 3PQJA 3LWFA 3C18A 2XVCA 1H9GA 2VC0A 5HOOA 3GFIA 1EV7A 2VOPA 1JHFA 3HRMA 4CDGA 3RKWA 5CVRA 4A5NA 1ZREA 3P9CA 1G3WA 2HTSA 4M6XA 1YW8A 2CW0F 4FX4A 4LG0A 3ERED 2QUFA 4HF0A 1FYKA 1P4WA 3SXYA 1I1SA 1K6OA 4YG2F 1AOYA 3FXRA 3EYIA 4HA8A 4QLCU 1XMAA 1S7OA 4L0YB 2Y0MA 4RB0A 3MQ0A 2L01A 5FD5A 5LGTA 2M1BA 2H09A 5J8CA 5JI6A 2M5WA 2QQAA 2VOOA 1DPUA 5LBQA 1E17A 1RI7A 1J0RA 3MAJA 1MDMB 1XGMA 3FX3A 3M9AA 4A12A 1GHCA 1J2XA 2KIUA 1IXRC 3L2CA 3R4KA 2P7VB 3ZP5A 3RDIA 3E3VA 1QZZA 4RGUA 3F8CA 1V4RA 1R36A 3SHFA
chains in the Genus database with same CATH superfamily
3I71A 5FLXE 3PTAA 2YSQA 2JA6J 2M87A 3PQKA 5FKKA 3R60A 2Y4YA 3A03A 3QO3A 4ZDLA 2O61A 3FWEA 2HOEA 1V5GA 2R7WA 1D3BB 2QK0A 4HDVA 1M5Q1 3NTHA 3CCUT 4J7IA 3CCQT 2BHYA 1VQ9A 4PFPA 3IRQA 2LR8A 4ENJA 3R6NA 3GCMA 4G6TB 4EGYA 3OMYA 1JQQA 3BT9A 5GMKh 2XB0X 3WU2C 3OA6A 4IOAF 3I56Q 3ABUA 4ESRA 1FPQA 3PNWC 3E1SA 4F7UG 5KYYB 5IYCJ 2ZJ2A 2VODA 5E20A 3REOA 1U3EM 3DTEA 2V9KA 2R7SA 1WHLA 1X6OA 5I2MA 4Y52J 4AG1C 1IDYA 3LWHA 3CXCA 4G9YA 2H1LA 2RC4A 3H9GA 1GCQC 2QYZA 3CCVA 1WIEA 2F2XA 3DTIA 2KVQG 4QQGA 2NVTJ 4BBSJ 1VQ5I 2Y69H 3D5LA 1JO8A 2X1CA 3VYHB 4UC4A 1IAWA 3H3ZA 3FMQA 1S72I 1QVUA 3L42A 3IH3A 2A68F 4RB2C 3LAJA 3TW7A 1QVGP 4CCOA 3HSFA 3R6SA 3DEEA 1XG1A 2GZWA 4ZYAA 3ABKH 5JHUA 5EF6A 1G83A 1Q1VA 1WH5A 5D6YA 4YTLA 2ZXIA 3QU3A 1XC5A 2L9SA 2HAXA 1VQ6Q 2X85A 5F04A 3RIRA 4OB2B 2B7EA 1FLIA 4IHSA 1ZUKA 2KBTA 1VQMI 3I4PA 2KAFA 1FC3A 1M3CA 3A8GB 2K02A 1N8RU 2PEXA 2HPMA 1VI0A 5LHHA 5H6QA 4F16A 3MVPA 2DL7A 2CG4A 4FT8A 5GANf 5HLGA 4C0DC 2IIMA 4HYEA 3TEDA 2XHKA 2DFEA 1D8JA 3DU5A 3CCSQ 3FXOA 1QCFA 1ULYA 5HK0A 2LBFA 1UG0A 5CAIA 4OMPA 2OZ6A 3F21A 4Q5SF 4LUEA 5L3FA 2FD5A 2KSSA 4M78B 4L9NA 1NTCA 2DM1A 1YOVB 3H9QA 3CC4A 2MD5A 3NWSA 5J8FA 1BU1A 4LD6A 4A3FJ 1JUSA 3ZFJA 1YJWA 3ZGKA 1ZAOA 2IA0A 1Q95G 2L5QA 2XAQA 4A5MA 4ABZA 5ICGA 1IW7F 2O9SA 1QU3A 5KYUA 2MPXC 4AVZA 1R1VA 3G6EQ 1UFFA 1S3JA 2V1DA 1WSUA 3QWLA 5IY5H 1R71A 1FYNA 3OMGA 4DEXA 4A3KJ 1X1CA 2R7TA 1WNLA 4MDXA 3HOSA 2QKLB 2RQRA 4KT0E 3ZN1A 1OR7A 1F36A 1I3QJ 1LQ1A 1N27A 3INZA 3MEVA 4L9VA 3G71I 1VQ7A 3HZJA 2D0NA 3M4GA 4B8XA 1B9NA 3AG1H 4XK4A 5IP7J 5K5QA 4PSWA 4M7AB 2Y0SN 3ECOA 1LEBA 2RHZA 1QPMA 3S2WA 4II2A 2EYQA 4C92D 2LSOA 1IUFA 1AKHA 1WWXA 2ETHA 1T3SA 2L54A 3EHQA 2IVWA 5GAN3 2HD0A 4C9YA 1W4MA 5E18F 1K78A 4AFQC 4HXJA 2P7CB 5GAN2 2FZCB 3CC2A 3QPLA 1FZPB 4G7HF 3VS6A 3HTRA 3S8PA 3T0YA 3GZNB 1NEGA 2GIVA 4BY6B 2EYZA 2EV6A 3PM1A 4ZGEB 4J6XA 2O03A 4GDFA 2KLOA 2P4WA 5BOXA 3JCMg 1PHTA 4P96A 1WI9A 2QM3A 1IGQA 1RAAB 2K79A 3SEMA 2VT2A 2LCLA 1YFHA 4WXHA 3PSIA 2FQ3A 4DBQA 2XICA 4V19K 1IXDA 1HSQA 2OQGA 3ZQIA 2BZYA 2XDVA 5D6EA 3G4ST 1G5VA 3S93A 1V54H 1PSFA 2AZVA 1J59A 3PVQA 2ELHA 3ISPA 2M8EA 5E3MA 4Q4ZF 2L4AA 4KMUX 3W2VA 3DXJF 3ABMH 2R5ZB 3LL7A 3HBLA 4D7MA 4HVVA 4MGRA 2ZGWA 3FZVA 3GNFB 1T98A 3OSSC 1I6HJ 2A3LA 3NEUA 2VXDA 5DTDA 1ZA2B 3L00A 4PGGA 2KT8A 1M1GA 2Z5UA 3OSFA 4KRTA 1ETXA 3NTKA 2DVEA 4M78C 4XRSG 1W5TA 2R3SA 3GXOA 1G4DA 4M7DD 2Z3YA 4MHGA 3PO3J 5FRNA 3DLLF 1UHWA 2FX0A 4A54A 4J00A 2QQSA 1LVKA 3OL3A 4YFXF 3WTWC 2BE5F 1LOJA 2RJDA 3DB3A 3S1QJ 2LP5A 4JQFA 2ID3A 3H5RA 1BIAA 4IRIA 2COZA 3L9FA 4HAMA 3RI4A 4NL3A 3SJMA 5GTHC 4FYXB 2OA4A 1RACB 4OGEA 2IGNA 3V8LA 2YUSA 1VZ0A 1VQ9I 1YP5A 2EVRA 2VPLA 5E1ZB 3EHRA 4F52A 2A61A 2K5CA 2GOMA 3RQIA 1TOVA 4E6KG 3CLOA 2Z16A 2RMOA 4CICA 3QUIA 4L5JA 5KE2A 3EUHC 4O6JA 2NNYA 1UGVA 1M90R 2AKKA 2LNHB 2WV0A 3TQNA 2KROA 1R4MB 3K2AA 4IF4A 2HQXA 2LJ0A 2P6SA 3M8JA 3PNTA 1DU0A 1IB8A 1R5HA 2A7YA 4LIVA 1X58A 4MIMA 2KY9A 1IHVA 1OCZH 1NYGA 5I21A 4M7AC 1KYWA 1W1WE 4Q47A 3RPUA 3CCVI 2EJRA 1JI8A 3OS2A 3CXCP 1VQLQ 4LJZF 5AT1B 2KQRA 3S14J 1ETOA 1P4AA 1UMQA 4PGHA 2DD5A 1XTAA 1NE8A 3JCMb 3C94A 5F0FA 1ONVA 2XMFA 2DA7A 1YJ9Q 1OFCX 1ODDA 2DOEA 3HOTA 3QJYA 1M1KR 2LVMA 3A01A 1NJIC 1VQ4Q 2L7KA 3EUHA 2V26A 2ZBKA 1WQ7A 3KX2A 3CTAA 3LSPA 2ZB9A 3K1MA 5GAOn 2Y48A 3VUZA 4UB6C 3NPFA 4BJTA 2BUDA 2IP2A 1S8NA 2OAWA 1YHQQ 3FKJA 3MJXA 2DPDA 2O88A 1AVZC 1H8KA 4Y15A 3E19A 2DLPA 2O4XA 3RBBB 2FYKA 4JRPA 2K5LA 3LA7A 3QAHA 3IAS2 3LSHA 4OVAA 4BI4A 3S1NJ 2M4KA 4FYVB 3CZ6A 2R7FA 4AD9A 3L2ZA 1AWCA 1VQMT 4P9FA 2A6TA 3UF4A 3COAC 1N78A 3IKVA 1YRNA 2LZ6B 2LNVA 5IOYA 3F3XA 4B47A 3CC4I 4PLLA 2GNCA 4A4KA 2DYRH 2E12A 1IN8A 5KYNA 3GFJA 3JB9F 2H27A 5DCFA 4EMKB 2CUEA 2ZO4A 1PDNC 1SD4A 5H20A 1TTHB 2CT3A 4KBMB 2YPRA 3T8TA 1RIOH 4BEHB 3CCEA 4KIGA 5IP6A 5ILVA 4ENNA 1Z67A 3J80Z 3HOZJ 5FJ8J 1X2MA 4FTHA 3X20B 2M9HA 3BG7A 4LK1F 3CDHA 5LLQA 3MFKA 2P84A 2WC2A 3UT1A 2RA2A 5CKDA 1YJNQ 4M73A 1NK3P 1M9SA 3KFVA 4C5HA 3F6OA 3CC7T 1WXUA 1M2OA 5HS8A 4ASNA 2O9VA 3W2AA 1WKMA 1BBYA 1MNEA 2GXAA 3OW2A 4OMFB 1F1ZA 1K8AU 1P7IA 3CD6T 1YW9A 3JAMK 2DL4A 1AEYA 2XD0A 1BI1A 3F6VA 2LY2A 2CUZA 3FJPA 4FIBA 1W4SA 2DO7A 3F0CA 3TO9A 1OCTC 3OYBA 5A0GA 1XSXA 4A3EJ 1BC8C 1TW3A 1HYOA 2EFNA 4L9JA 1ETYA 2VYTA 5GAOp 1RZ4A 3VUBA 4JJNK 4EM0B 4PJOD 4KGVB 3SEQA 2AIRB 4S04A 2P5KA 4JZ4A 1USSA 1ZA1B 3E7LA 2ZC2A 2A28A 3OYFA 3CC2I 2DZCA 4KULA 1O3RA 4E47A 5GANg 2LLKA 2M8GX 3HPGA 3I55T 5M3FJ 2EKHA 5GANe 2DERA 3FXQA 4UVBA 2QA4A 1WXTA 2O01E 2EZHA 2D8HA 3K2ZA 1RAGB 4F14A 4M7AG 5CVIA 3VDXA 4I7HA 4C2UA 1B6AA 4BUPA 1ZLMA 3CO7C 5LJ5h 1ZK8A 2M51A 1Q86U 2JUCA 3D7SB 3L1AA 3OSGA 4L0ZB 3M56A 3MKLA 2CS7A 4ZZLA 2PI0A 1RUNA 3DBRB 1UHCA 4BJ6C 1SC7A 2M0MA 2CSOA 2JT4A 1NEBA 1F4KA 3G2BA 4JDSA 4AFZC 2E5NA 2EFWA 5A2QE 5CKTA 2JA7J 1QW1A 1OU8A 3N05A 3GZ6A 2KZGA 2HU9A 5K7FA 3HHTB 1E3PA 4FQGA 1U5TB 1ON2A 4M3EA 2FB7A 2L3SA 1ZQ3P 4RKUE 3SFMA 1Q81U 1KSWA 2EIJH 6AT1B 2QEXT 5D4SA 3BR6A 2IGKA 5FKNA 4CCNA 1YITA 2GA1A 2RV8A 4XORA 4CO8A 1KG1A 4XSZF 3OV8A 1LCKA 1NBEB 2P6TA 2OTJT 2AXTC 2QXFA 1YS7A 2M16A 1KU3A 3ZMUA 4AYBA 1X3UA 2LREA 4MZTA 4GRIA 2KJBA 1R1UA 2AHJB 3VYUB 5IT3A 1CGPA 1HDDC 1ON1A 4EMKC 3LX7A 2OJED 3TDUC 1Y7XA 1X4PA 4A3BJ 2UXXA 2DDAA 5A2QK 4PJ0C 2XKPA 1P2FA 3BG3A 4R8HA 1JBMA 4J9GA 2DU9A 3CCQA 3HM5A 3Q9SA 2R5YA 2E1MC 2VKDA 2AQFA 1YNZA 2DF6A 3FIFA 3O8GA 3SD4A 3LSIA 2XHCA 1FIAA 2EFOA 5M5WJ 2FVUA 2RD1A 3EFOB 4JX5A 5E79C 3HXLA 3L7WA 4IVNA 4M6YA 3QPSA 1VUBA 2CUJA 2KI7A 2LC4A 3EH2A 4KIFA 2E4HA 2WAEA 1JTXA 3KYDB 1T0HA 3H0DA 3C4SA 5IT9Z 1VQNQ 2X4JA 3C2BA 4KUIA 3PNYA 2E7XA 3SDZA 3VS7A 3M59A 2HQ5A 1TWAJ 2EQUA 5LJ5f 4ZTFA 1ZR2A 4UVCA 2VVKA 3EG2A 3HP9A 4A4GA 4IZZA 1K7AA 2XU8A 1Z9QA 4EMKA 1PNJA 3GIBA 1PUFA 2G6FX 4LNPA 4XKVA 2IS2A 2DQLA 1J7KA 3HPHA 3LFKA 4BEHA 1PG5B 3IWZA 2VQHA 3C2HA 1YI2Q 2J6KA 2JQ7A 2BY1A 3E6DA 3MEXA 2X4YA 2VXZA 1DP3A 2SEMA 1MJ9A 3WTUC 2XK0A 2DT5A 3CCRT 1BOBA 1GFCA 3M9QA 1XCBA 1BC7C 1ORKA 3JCMJ 1RAEB 2MZ4A 3B73A 1R49A 1X1PA 3BW1A 1I0CA 2GXGA 3M58A 2PG4A 3HUGB 1GRIA 1KD1R 4NNJA 4LDWA 1U2WA 2O7OA 4AMCA 2KPMA 1FNNA 1FT9A 3BTLA 2ATCB 2ESHA 4DJAA 5FLXZ 2D9TA 1DPRA 1KJWA 1P92A 4WCGA 1LPQA 2CJJA 4EIKA 1KU9A 4HBLA 2EGEA 3WXMB 4VUBA 1WVRA 3H8ZA 2R92J 8AT1B 4EVIA 4LK0F 2VGMA 2R4GA 3OS5A 3J81E 3RPQA 1LDDA 2NUPA 1GVJA 2R7OA 2P5VA 4Z2YA 1JKOC 2CSIA 4YFKF 3C0CA 3C95A 2MW8A 3QYBA 5CQGA 5J40A 4L5GA 5GAN8 1Y56A 1R4NB 4RTXA 3HGGA 3Q9VA 3OYAA 2R7UA 1ZYRF 4M75B 1Z3YA 1U5TC 1SAUA 4M7DG 2HWVA 2YUOA 3KPHA 3RESA 4LLLA 1A6IA 4G6QA 2XSDC 4M77C 2D0QB 1XPXA 1YJWQ 1RLPC 1T33A 4DOVA 2V6CA 4R56A 3TOBA 3JSOA 2NVXJ 1MJAA 2GQQA 3ZQCA 4LG0B 1N8RR 3CCEI 1ZRDA 4UV8A 2FRYA 2FMYA 2M0OA 4OIRF 2CP3A 1R58A 2F5FA 2ZMEA 1M3BA 3ELKA 3VYTB 3WTTC 3K70C 1AWJA 4F17A 3ZRGA 3J81K 2QSGX 2J6FA 4RUGA 4XLHA 4D9JA 2ROTA 1OULA 2BY2A 2JA8J 1VQ5Q 1HD3A 4QIWN 1PKSA 1DDNA 2R5AA 3M57A 2PUOB 1S72Q 3JSPA 1LNXA 4NS5A 2JWTA 5LEKA 1B3QA 1VA7A 3HKZN 1K0SA 2DAQA 2X35A 2KZVA 3JCMP 2IBDA 1FWZA 3DPUA 2FEZA 4ESJA 3JRHA 1AT1B 2CYZB 2DTOA 1UHSA 3FXJA 2WB1N 3MZ8A 2PN6A 1PRLC 3SWNC 4C8QF 3JCMX 2JJ9A 3KUFA 2D1VA 1JXSA 1W6XA 3M0RA 1VQMQ 1LNWA 5GP9A 3HC7A 1YHQI 5E17F 1W7PA 2YDLA 1I5LA 2R7RA 4G8XA 2DRMA 1Y71A 3FMRA 3NAUA 2OQRA 2KE9A 4RTYA 2HPIA 3H35A 2W0ZA 3DLLA 4KH1B 4U0YA 2E2JJ 5ERIA 3SDGA 1E6HA 4IUPA 4MMKA 1M4ZA 2CW7A 1RI0A 3H1CA 5D8KB 4I2OA 1AOJA 3HJEA 3A1PA 5CVUA 3CQZJ 2QA4I 1VQOT 2EQMA 2VE9A 2OU2A 3K0LA 3WG9A 3ZCOA 4TV7A 3M5AA 2L9VA 2WAQN 1ZELA 4P9UA 5LJ3d 3EFSA 2CKKA 4IXAA 3EFOA 3TSZA 2AXLA 1GXIE 1SANA 3GMEA 1VYTA 3ZL7C 4BY1J 5KCHA 1B34A 3ULQB 2MK5A 3G4SA 1YJNI 1KQ1A 4HT9A 3EYYA 2QCOA 1SHFA 3HEFA 3BR1A 1TC3C 1HCRA 3K4BA 4F55A 4EEFG 1QPIA 5CKBA 2K27A 2KDSA 1W2BS 4NC8A 1FYMA 4IPAA 1EKEA 2DA3A 4CI0C 5KYUB 1WHUA 4IHXA 2CU7A 3E97A 3K4CA 2ECZA 5KK1A 1R23A 3TOAA 2NUTB 2RQVA 2CQNA 2VKNA 4L6V5 2A0FB 2X3XD 4A3GJ 3QP6A 2DA2A 4J7FA 4KISA 5F0HA 3K6GA 1T56A 4RB1A 2WADA 4E7JA 1YITI 1TUCA 2UUZA 5FRMA 1WXBA 2EZKA 3BZCA 3BP8A 2DI3A 2K7LA 4D5FA 3G71Q 4KGZB 5GAMd 2FMLA 1VQOA 3V7CA 1WZ2A 2D1XA 3UA6A 4C92F 2YU3A 1J75A 4M75C 4C92E 1Z3XA 5H6RA 1FOWA 3B6CA 1AZEA 3RSNA 4PNOA 3HUGA 1RR7A 4QPQA 3Q5FA 1MBHA 1Y07A 1X69A 2JOYA 1RAFB 4N0AC 5IXBA 5KCOA 2BY0A 2Y2ZA 4AIJA 2BKDN 1T6SA 1K0XA 2M4GA 5BQTA 2CP0A 2FPDA 2WACA 2F69A 3F8FA 1OMIA 2JRTA 3CCQI 2EYXA 3JCMf 2IW5A 4LGWA 2KRNA 2FNAA 1IDZA 3FM3A 3GW2A 6PAXA 3FM5A 1K76A 4KN7X 3CJRB 2GTOA 5GAMe 4HV6A 1ACIA 2GGRA 2FQ4A 2VC8A 3KE2A 2PU9B 2ZXHA 3KEQA 2KIFA 2M0YA 3K4KA 3HSRA 2OAUA 2QGUA 3HRSA 2ZPHB 1GXQA 2A36A 5B1BH 1NH3A 2A6HF 1MZBA 2MLGA 4B48A 2E5QA 2XAHA 3TW6A 4ATOA 4D1QA 4BAYA 2FO0A 5F27A 3CQTA 3OW2S 1YLFA 1NPRA 1S5LC 2DN0A 1X75C 2BIVA 1O3TA 2NS8A 3EGXA 4IKFA 4JX4A 3GVAA 3P5JA 3HOXJ 1FOKA 4M78E 5EJCA 3X25B 1OI1A 5CCAA 3MEUA 1OYWA 3F23A 2OTLT 1PVEA 1XDSA 1XMKA 1WJ5A 5EYRA 2K40A 2EWNA 1UAAA 1MHNA 1FMKA 3M0PA 3SB2A 4M7DF 1OCOH 2E41A 2UWMA 2YRVA 4M7DE 1IRXA 3HHGA 3JRGA 3VS5A 1Q86C 4YEJA 2HDDA 1VQLT 1HJDA 2BVLA 3Q0WA 2HXIA 3ZMTA 3ZQLA 3W6KB 3OB9A 4B44A 2IJLA 2R7QA 2LBFB 2WA0A 2EB7A 2XF5A 4KUMA 4B4CA 4ZZDA 1W0UA 4C0FA 4A3DJ 4RTTA 2XAFA 2LFBA 1B1BA 2XAGA 2KP6A 3BG9A 4OF1A 4R55A 3KXTA 3G1OA 3PL8A 3OSVA 5DYMA 1Z1DA 1UFMA 1F1BB 4HVWA 4XL9A 5K7ZA 1UDLA 5A0DA 1Q81C 2EGCA 5HS9A 1ZGWA 2FBKA 3JSCA 3NFCA 3FKIJ 2E60A 2IVMA 1A6QA 1XB4A 2MGQA 2ZSIB 3DWLE 2F4MB 1O3SA 4IUVA 1VQ8A 4J01A 1VQ9Q 1IN5A 1NJIU 3UWNA 5IHNA 3GO5A 4JOMA 1TLHB 1S29A 3BC8A 3MEAA 4M7AE 4AM3A 3IRRA 1H0MA 1XDUA 4BE1A 2F2WA 5KYWA 3RKYA 1QVFS 2GBYA 5J1RA 3S3MA 2K57A 1TZLA 4AC0A 3JTGA 3KYCB 5GAOq 1K73R 5LEJA 2NAZA 1ZG1A 3VWBA 2EJFA 2KYBA 3BR5A 3VFZA 1TNTA 2G7HA 2VBXA 2XPUA 3CUQA 1VOMA 1Y0MA 4HX7A 2O8KA 3CCVQ 5LJ5g 4HF1A 1AHDP 4KA4A 1UJ0A 2V1XA 3VYSB 2R5MA 4EATA 3A8HB 1PP8F 2AZSA 3META 3ML6A 2EYWA 4DGWB 3VODA 2LG4A 2LK2A 4OAYA 3CD6A 4HPQA 4L18B 2BW3A 1KGSA 1YCSB 2E35A 3FMSA 4X9DA 3OS1A 3S16J 4Y92A 3ZQGA 1AKHB 2XROA 4Y28E 2LF8A 3RQ4A 2DJNA 4C8QB 3P8HA 1K1ZA 2JUFA 1K78B 1GCPA 3GFMA 5D4RA 2DO3A 5K7HA 2JMAA 2JTEA 4LDUA 4PFZA 2ISYA 1C0WA 1XOVA 2CUBA 4E6RA 3CMAT 1F43A 4LLGF 3GTPJ 5D8LB 2JPCA 2EZLA 4C2TA 1WJSA 1A04A 2CV2A 3RZOJ 3K7AJ 2A5YB 2HQNA 4WXDA 4RCBA 3VRYA 4AWXB 4KYWA 3KP4A 1MV0B 3WE2A 4NC6A 1RRJA 1KC8R 3I55A 3WU0A 3DLMA 2O31A 3A02A 2VIXA 4EJVA 3QIIA 1RUWA 3WGGA 2YRCA 2DILA 1Z9ZA 1GDTA 4LUDA 4M74A 4E4HA 3VOEA 1XCVA 5EGOA 4R0KA 3HDDA 2IPQX 1IN6A 4BQNA 2MF2A 4OWRB 3GWZA 1ZG5A 1JXMA 2COWA 1T95A 4MFDA 2P8TA 4PLIA 3CC4Q 2M02A 2EFIA 3ECHA 1YE9A 4F93B 1BBZA 1YG2A 2DA5A 2ZKZA 1OISA 5TJJA 3EETA 4XQFA 2R7VA 1I5ZA 2HTJA 3BDUA 5HLIA 2GXBA 2DAOA 2PMZA 2GCXA 4QSHA 3S17J 1WJQA 1LVAA 3G4SI 5FGMA 3EAEA 2QWWA 3WTZA 3EPZA 2DT7B 1SHGA 2A07F 5DLQE 1VFCA 2O2OA 1M90C 4GLMA 2E1NA 2XF7A 4CRIA 2QEXA 3CUOA 4A0YA 5TRDA 3ZQFA 5GAN5 2ZNZA 3TMOA 2G7UA 1I6XA 5J47A 2X6WA 4LG3A 4HF2A 1WI3A 2EV5A 4DA4A 2STWA 2OTJA 3W6VA 1FXXA 3TP0A 3HFOA 4LE9A 3L2WA 4LDYA 1X27A 3OBWA 1RKTA 2ZCWA 1BW5A 1X2NA 1BJAA 4UUSA 1U1SA 1VYVA 1G3YA 2VV5A 3I5RA 1CKBA 5J1UA 2JA2A 2CZ6B 5JFRA 4IOCF 2VJ4A 1GUUA 1O75A 4PJOE 2EH3A 2X4WA 1KIKA 1E7OA 4UNOA 1S7EA 1D1BA 1X3ZB 4DIQA 2I10A 2OCEA 4DYRA 4LB5A 1XNIA 1OR7C 3V7SA 2XC7A 4IHVA 3T1BA 1BKBA 3H6ZA 5HNFA 3CC2Q 1A35A 4QT7A 4HV5A 2DPPB 3JB9H 1VQPT 3JCUC 5E1XA 1WGXA 1WFWA 5JVGF 4CSWA 4AIDA 3MP8A 3X26B 2EIFA 1HKQA 3CCLT 4RLFA 5DUIA 2W57A 2QGFB 3IH2A 2G3RA 1IXSB 2P5LC 1G59A 5CKFA 3NQOA 1SEUA 3JV3A 1K8AR 4RLQA 2Q2EB 3A0BC 3TBIA 3E5QA 1K79A 4BXUA 2L8DA 3JB9I 4C8QC 2DMQA 2OX7A 1QBJA 1MH3A 3I64A 4CCJA 3OYGA 3J7AW 4BNCA 4NC7A 2O6GE 1Q7YU 2AS5F 2LMDA 2EAYA 2DPUA 2NS0A 5CQXA 3T9NA 1X43A 3A01B 3DBHB 2WWYA 3UATA 2V8JA 2ZAEA 5IHIA 3CCRA 1SEMA 5JHFA 1MJBA 3J7ZI 3H3UA 2KL4A 4F04B 1RESA 2RPNA 5L3BA 4EMHA 5LRRA 4BYYA 4XTUA 2FRHA 3WE3A 3JCMd 1WFXA 1QA6A 5A2QR 1WYXA 2LTPA 5EDNA 5FWBA 2O4XB 1T8IA 3H9JA 3LSKA 5DDGA 4E7HA 3GTOJ 3DEWA 3I5UA 1LB2A 5KVRA 2FA5A 4CCLA 4MQVA 1XJWB 4GBQA 2PZ1A 1V29B 2IS1A 1IUYA 1I8FA 4C8QA 1SVMA 2LNBA 2A6EF 5KH6A 1VQKT 1YRNB 2XG8D 3RMQA 2XGDA 1LJOA 1RLQC 4MQ9F 5GPAA 1ZKGA 1MBEA 4EGZA 1VIEA 1SFXA 1XSVA 1OCRH 3WGIA 2RK2A 4X1VA 1W2BA 2ZXWH 1UHFA 4O3MA 4JS5A 4EM2A 3I9V2 5FFXA 3O3KA 1VQ8I 2L2PA 1E3HA 4IJAA 1RAHB 1H9TA 3GTQJ 4F3QA 1BCOA 1GLNA 1U8RA 3JCMe 2V9VA 2P0PA 2O3FA 3BTCA 1T3LA 4S0HB 5AIPA 2ED0A 1Z9CA 3LH0A 2HNHA 4ESFA 1NLPC 4JJCA 2CQXA 2RJEA 4MDWA 5F08A 3U2RA 5GMKl 3OYHA 1IZ1A 2SRCA 1EA3A 4BB7A 3SFIA 1UJYA 1SVLA 3MP1A 1QVTA 2Q0OA 4EJWA 2YUNA 1QRYA 1W5CC 2E3HA 1TUGB 2LT1A 4A53A 2BXYA 2K4YA 2VKEA 4BACA 1SSFA 2KIQA 2MIOA 4UXNA 2HOAA 2KRHA 1QKXA 3VEPA 2RDPA 3E6BA 2E5KA 2NUZA 1X6BA 1Q82U 3CD6I 3ZMVA 2A69F 2BZTA 2EW3A 2FF4A 3S32A 3QXEB 3L2VA 4ENKA 4M78D 1S7AA 2IPOB 3BDLA 4M4ZA 1Z91A 4IL6C 4XTZA 1OU9A 2HGCA 4XONA 4BU2A 2PJRB 3PFIA 2QF7A 2XRNA 3ZQ7A 2OAZA 9ATCB 2CH4W 2A5WA 1REPC 3CJNA 1X1DA 2K86A 1O4XA 4J9IA 1M27C 4U7BA 4C92A 2JTVA 3ZMDA 2C0TA 2M0CA 4Z6YA 1XSDA 2ZCFB 2ME0A 3LQQA 1LJ9A 2E70A 2NS7A 2PX9A 3RYRA 3Q3SA 1B59A 3I55I 2RJCA 2DX1A 3U1DA 2NOGA 4HX4A 4A3CJ 2CRGA 3LFUA 4N4NB 2MI6A 2EIMH 3CP8A 3LMMA 5DM7F 3OYDA 4M77E 1Z6RA 4RG2A 4C8QG 2FSWA 1PC0A 2P0WA 3LSTA 2O9LA 1XS9A 1LFPA 1QCNA 2MSYA 3LSJA 5DD8A 1I81A 1NYFA 2JM9A 3CEYA 2XGCA 2A08A 4V2SA 1N9SA 2LY9A 4XOTA 3J81R 3BY6A 4M7AD 1K9MR 1U5SA 2XAUA 2BOLA 2L02A 4HOBA 2PFBA 4JBAA 2DJQA 2XDDA 4Z8AA 3CCEQ 2HXOA 1ZUUA 4FW1A 4NUBA 1JJ6C 2VE8A 2Q2EA 2M7BA 4WXCA 2HEQA 1HW5A 1RQ6A 2QEXI 4HCKA 4KITB 4XIDA 3K4NA 3GYHX 5J3LA 2DEUA 4A3IJ 1SFUA 1X1BA 2RQPA 4FX0A 3JCMQ 2IA2A 2OTJI 4OMZA 5EEAA 3VKIA 2KJCA 1N6AA 4BY6C 2KEAA 1BCMA 3EGDA 1MD0A 2K9NA 5LJ3h 4M3DA 1AWXA 2Y4XA 4M7DA 1RKWA 2R5YB 2TCTA 1NG6A 1ZGAA 1TWFJ 2E19A 2HVQA 4EM1A 1UGPB 4J6YA 1RADB 1QVFA 5J6XA 3SZGA 1IREB 1G6NA 4B3XA 1Y0UA 5JVTA 5CK9A 3ULRB 2MCNA 1D0YA 1I50J 3DV8A 2J05A 5FO5A 4RB3C 1R77A 1VIFA 3FDRA 1TU0B 4MZPA 1FP1D 2M3AA 5KHDA 4KT5C 2WSFE 5J26A 5LJ3j 5D5VB 1E3OC 1B4AA 4UUVA 2JZ2A 5FU7B 4A63B 5M5YJ 2M35A 4IUTA 3JAME 1IO2A 1AA7A 1D3YA 3ZQQA 3E6MA 1Y0NA 1K9AA 4FM4B 2QKMB 3FJ5A 1YJWI 4MEYF 1J09A 2MUNA 1PUFB 4A4EA 4H4KC 1HOMA 2DTZA 3ZBDA 4BHPA 4MTEA 3J7AY 4F7ZA 4RCCA 3A0HC 1KU7A 3ASOH 3D1NI 3FEOA 2DA1A 1T08B 1FMVA 3IUOA 1XD7A 2LKPA 3GTJJ 4H0EA 4J9FA 2XUBA 3HRUA 4A0XA 1KHIA 5GAOm 3IHUA 4I0BA 3IKTA 4LITA 1K4US 2Y31A 2VASA 2IT0A 2E10A 3ESWB 4G94A 5FKMA 3VYRB 3F8NA 5FB2A 2V1UA 1E0EA 5KCMA 5FWCA 4EJUA 5GAMj 2IGOA 3CCRI 4FE4A 1HLVA 3CMET 3DLAA 5GANd 3TREA 1ETWA 2OTLA 4Z89A 1IRFA 3G73A 1VQ7I 2CV0A 5L3GA 1JU5C 4M75E 3VSKA 1TH7A 2MC4A 3H5AA 3D0SA 4BDYA 4DNCA 5IYDJ 4OMQA 3IWFA 5GMKm 1YITQ 3P8DA 4XLPF 1VQLA 4RA2A 4UV9A 3SZTA 4ZDOA 4BQQA 4ZYHA 5IAYA 2NUPB 3H9NA 2GOXB 3VJPA 2PBIA 5DLOA 2H3EB 4S05A 4OB0B 5ECAA 4M9SA 2KMUA 3GF2A 1QHGA 2CFXA 2CV1A 4OAZA 2PJRA 4I99C 3CCMT 2GBQA 3PFSA 3EG1A 4ZH4F 4ZYEA 4BQAA 1ZBJA 1WHJA 5CIUA 4A4HA 1ZRCA 1T2KA 2HKQB 3PNVA 1T0FA 2IS4A 4R1HA 3CCQQ 3I59A 3ERMA 2F5CA 3H0GJ 4HZFA 2E5ZA 1C0MA 2DKGA 4FL6A 1W2BP 4D0PA 4KIBA 5JLXA 3DKXA 2DXBA 3LYIA 1TT0A 2QZ8A 3EDPA 3VS4A 4JLGA 3CCUA 2JS2A 2ZMEB 3P9KA 1JT0A 1YS6A 4GLKA 4JYKA 1IV8A 2GTJA 2MC3A 4EMSA 2QQ9A 3L1PA 2OBPA 4Q48A 4XOPA 4F7UF 3JRAA 3HYIA 3HIFA 5C4JJ 1SRMA 2DBKA 3AAFA 4F7UE 1BM9A 2DNUA 2O8XA 1DUXC 3R6OA 5GMKe 3RJPA 2X6XA 1WHKA 3MCZA 1VQ9T 1V76A 5IH2A 1B8IA 3CBPA 2BE9B 3PE0A 3BLYA 1WDXA 4JRKA 4RAYA 1ZG3A 2LT4A 3M07A 3EG9A 2ZJRF 2E6NA 2MMPA 3VYGA 1D09B 2X4XA 1W7PB 3S2HJ 4OMLA 1EH6A 5IYBJ 1W5SA 4F91B 3AG2H 3WU1B 1J5YA 2KDZA 3J7AO 1ZUYA 3QOPA 1IN7A 3CO6C 3MZHA 2L3QA 5GJWB 3R0JA 3FXMA 5ICEA 5EG2A 3DPLC 4XBFA 3CMAA 4HNTA 2V4JC 4RMOA 5CKEA 3OYYA 3BJ6A 1WJEA 3VB2A 1QNTA 4HSRA 2DLLA 3AL0B 2FE3A 3WG7H 2CP7A 3CCJT 2O0YA 5LHGA 2EKOA 1EH7A 2EFPA 4JP0A 4Q5WA 4PJOA 1MV3A 1U06A 1Q7YC 2F1LA 1MBGA 4FCYA 2BGCA 5L8RE 2PVGB 2GLOA 4RTZA 4D5CA 1FOXA 4JK1X 2HBWA 2QYOA 4DBRA 5GMKi 4V2FA 2CQKA 1P6RA 2JMWA 4E7IA 3OW2P 2E7WA 1B34B 1YIJT 3RCOA 1XGSA 4A6EA 2QQBA 4RGXA 4A3MJ 3JRZA 4J83A 4PJMA 4J19A 2VT3A 1Y96B 4XTVA 3I58A 2CQ7A 2NVQJ 2AKLA 2KYMA 2LX9A 4C5EA 1Z7UA 4A3LJ 2CT4A 2DEQA 4BH9A 2LP0A 2COMA 1IRGA 1R0BG 1QCOA 1UGQB 3NARA 2F4IA 4HNUA 1JTYA 4FYYB 4EDUA 1OCPA 1I27A 4JJDA 4CHUA 3LA3A 2I5UA 1RPWA 2DL8A 2NNNA 3WHCA 4A0ZA 3OYMA 3PJRA 1WJDA 2HR3A 3DCFA 4ZNXA 2HYFA 2GQIA 1ZN2A 3GUDA 2JN0A 3DEUA 2VLAA 2EPFA 4CC4B 2E1OA 1ETQA 1UELB 2HYJA 1MMDA 2A3SA 3PUFA 5CPRB 2NRAC 2DYIA 4BE2A 2JK3A 1IN4A 2X48A 1SFOJ 2K9MA 3I56T 3F22A 2GFUA 3A8OB 2WY8Q 3BTIA 5HS7A 2JA5J 1O7LA 3LLRA 4PJLA 1T0JA 1W70A 4B09A 2A37A 4ZN1A 3FDYA 4ITVA 1NJIR 4MTDA 4N9HA 4U87A 4CUGA 2E2HJ 2QDYB 4KUDK 1POGA 2ZMEC 4EJTA 1RAIB 5BMZA 2W7NA 4XTYA 2XPVA 1M90U 1PSEA 2DCEA 2LRDA 1QVFP 5M5XJ 3S6WA 5JR3A 3CBOA 2DK3A 2DA6A 2HDAA 2YUQA 1VQ6T 1J3TA 1Y1VJ 4JRIA 1KONA 3G3ZA 1KU2A 2DMPA 3OYNA 1VQPA 3KEYA 2DXIA 1Q82C 1RR8C 2HVRA 4UB8C 1AZGB 4M77D 4N4IA 1HSTA 2VBYA 5IN1A 3CCLA 2CP5A 4J8OA 1ARKA 2W25A 2XASA 4DZJA 2ZPEB 3M53A 3BFMA 1RABB 3BOQA 2RNAA 2Y0SA 1XGOA 2FUG2 2RK1A 3I35A 3ME9A 2RHIA 2BXZA 2RN7A 2HOSA 4ZJZA 5ILUA 2CSQA 1OCCH 3K70D 3TCJA 5C3EJ 1KA8A 5K1YA 2BBYA 5EZGA 2DXUA 5C0MA 3CCST 4XKWA 3VS1A 2RJFA 1JEGA 4N4OB 3KP7A 3RKXA 3EGXB 1D0XA 1M1KU 2DIQA 3G4SQ 2LCCA 5DM6F 1EFNA 3AL0C 1YW7A 3LAPA 3GTMJ 2L3RA 1FTTA 3CDIA 4C3HJ 2KDOA 3QYGB 1UG2A 2E1CA 2IXSA 1QVGA 4IEJA 2YX4A 1K73C 3OBYA 1JKPC 4KJZA 3AG4H 5HDNA 4ZC3A 2OTLI 3HSBA 3DF8A 4GYGA 3QSUA 3G6ET 1IJWC 2RF0A 3VS0A 2DMNA 3BDDA 1O9SA 4BQOA 2HQRA 2QQ8A 3BWGA 2XGEA 1TWBA 2YWWA 1OV3A 5FLMJ 2V1QA 4M6VA 5LL6S 4AU7A 1LE8A 1VQKA 4OINF 1RETA 1R9TJ 1O7FA 2I8DA 5GJVB 3TVTA 2JZYA 2ED1A 2OF7A 3I3LA 2LQ8A 4L5EA 1NLOC 4FT4A 3OYEA 5HCKA 2R7DA 2Y30A 3TKYA 1TQIA 3RZDJ 1HBXG 3SFZA 2EINH 1SF9A 2OC6A 5KYWB 4P55A 3REBB 5M9OA 1CSKA 3QDRB 5KAIC 1R7JA 2LC2A 2K5FA 5FFZA 2HDCA 2LJ1A 5CVVA 1ZR4A 1DGWY 2MLKA 5EC7A 3R61A 2NOJB 4AIHA 1MMSA 4YFNF 4V2GA 3CCUI 4UHTA 3JR9A 1DP7P 3FISA 4LFUA 2X4HA 3CUQB 3E2UA 3DU6A 1KC8C 2DMTA 2D5VA 2QLZA 2JN6A 1D8KA 4MNUA 5K5RA 2QTXA 1QWFA 1SD5A 3BR0A 2YXYA 4RTUA 2DYSH 1PYVA 1YX5A 2CZ7B 1Y96A 2JS0A 4QW2A 1QLYA 3QODA 2FZGB 2BW3B 2STTA 3JW4A 3CMMA 1WLPB 5F0CA 2ISZA 1U9OA 4BBRJ 1FBUA 1HC8A 2CDTA 2G0EA 2DXTA 3ASKA 2BY3A 3GX4X 1AD5A 1MBKA 1FMWA 3OOUA 4PDKA 5GADJ 1Y57A 2FPFA 1MIJA 4M3FA 2E36A 4KNYA 1BYMA 4ENMA 2F5DA 4M75D 1U3OA 4BXFA 3SZPA 1FTZA 1U0JA 3E5UA 2L7ZA 5E8GA 3KP6A 2KNBB 2K4JA 3PUBA 3QOEA 3B02A 2GQVA 3UDCA 3J80E 3ROUA 1ETKA 2X1DA 1K61A 2A05A 3PIPF 3RNJA 2DMOA 1HXDA 3ABTA 1VYUA 2X9HA 1L0OC 2MA3A 2YS9A 2C06A 2CZ1B 5EGOB 3CPWS 3I53A 3ZMSA 4A69C 1ZTRA 4M71A 2B63J 4HDUA 2Y9YA 1TT5B 3JCMV 3DKYA 2HNIA 2YT6A 4NQWB 2RHUA 3A8LB 3AFHA 3WODF 2V1RA 1JUPA 1FSEA 1STZA 3JTHA 1OJLA 1BA5A 1I5OB 3M54A 1FX7A 1VQ8Q 2KQWA 2DMUA 1IO6A 4BJ5C 4PCQA 2K3BA 2KKOA 5J1YA 2RN8A 4KH0B 4JLIA 3KP3A 4GXOA 3J80K 1K4TA 3K4MA 3M4YA 5FKLA 1CKAA 2R58A 1M2VA 2NVUB 3TP3A 3ZQHA 2C0OA 2D1HA 3DKWA 2KT1A 3AT1B 4KDPA 4J9HA 1R5GA 3F8MA 3T5XA 3J7AF 3HB9A 2HKOA 1N77A 1LEAA 2WAFA 3ZR8X 2DE0X 3M1EA 4M9XA 1OYIA 4GGGA 3UNGC 1IF1A 1R1TA 4NBQA 5A0LA 4U0VA 2EBIA 3KZZA 1MH4A 3DQVC 4PZJA 2XKOA 3V8KA 2RB6A 2HBPA 4C5GA 2IRFG 3A2KA 4UUSB 4M78F 2BVMA 2OI3A 2KT0A 1R8OB 1UUEA 4M9ZA 5KYXA 2V79A 2K9SA 2KXDA 1W36C 4KFCA 3CD6Q 3GLLA 2DFFA 1P4XA 2BZXA 4AFUC 2CP6A 2MAMA 5DV5A 1ZSZB 5D5XB 4AUXA 4RGRA 4K2EA 4LD9K 1M1EB 1OPLA 2HDWA 3CCET 5H2FC 3SYTA 3RERA 1ZSGA 2NYXA 3JCMc 4ZTJA 2HSEB 4FSSA 4CC7A 3AHUA 4CA0A 2JT1A 5TISC 1Z21A 2FNPA 1QGPA 2OCCH 2K7AA 4KT6A 1WJRA 2VN2A 1J9IA 1UGRB 1VQNA 3CUQC 3S2DJ 2MYSA 4KICA 1UB9A 2V8IA 3A52A 2DOFA 3HOVJ 3V4GA 2XPWA 4LDXA 1YJ9T 2K3PA 5EG0A 1NK2P 4LIUA 2M7AA 5LJ5d 1TTYA 4L9TA 1QO0D 3I55Q 1PWTA 1VQ4T 2FXAA 1USTA 2CFOA 2PLYA 3W2WA 3CCLI 3I5SA 2KISA 2CS3A 4M7AF 2D6FA 1NPPA 4PK4A 3DFGA 2L9NA 1IGUA 1BI2A 1YHQT 4RM3A 2ROLA 1V3FA 2VC1A 5HNHA 1QZYA 3BJAA 1FYLA 1ZBXA 2KGTA 3ER0A 3H0FA 1K83J 1GV2A 3O8VA 4XLNF 1ZH5A 4LLNA 4X9CA 4XAXB 2UV1A 3CC7A 4LN2A 2RKHA 5DM7R 4R79A 1KD1U 1OPCA 2R57A 2P0TA 1IHWA 3WTSC 4F7UA 1HQCA 4XKBA 1WHMA 5LJ5e 3LSMA 4XU3A 3M0TA 3CMEA 2WTEA 3JB9G 4A6DA 1I3AA 3C3WA 2E1HA 2JTMA 4DYCA 2DFIA 2QEXQ 2GF7A 5IP9J 4IURA 4PUSA 3DBLB 2QBYA 5IT9E 4C0DB 1BK2A 1BIBA 3OQ5A 1UECA 2FRWA 3S1RJ 3FC3A 5F1JA 5J39A 3KZIC 5K5OA 2R7ZJ 2OTJQ 5L3DA 4HW0A 3ZEHA 3HHHA 3HOYJ 1B07A 2VI6A 3GBQA 1YJNT 2ZPGB 2H8WA 3IQLA 4RGSA 2AT1B 3BG6A 1CQTA 2RM4A 4MZMA 3WGHA 1VQKI 2VQGA 1OZ2A 3S3OA 1UG1A 3OY9A 2DBMA 3CCMA 3GBGA 1SFKA 3OWTA 1GBQA 2LRQA 4RMNA 1SKUB 3M55A 4KN4X 4IQJA 4D6WA 3FK6A 3FRNA 4D8DA 1D5YA 3BPXA 2DRKA 2VWFA 2WSCE 3M0QA 4XQ3A 1G3TA 1JGSA 3LA2A 1U78A 2EJGA 2HCKA 2ZPFB 3JAMZ 1MSFC 2DJZA 3HTSB 4BDZA 3FXKA 1SAXA 5IT9K 1TUDA 5GANh 4I6ZA 1KHCA 4TVRA 4ELZC 1OYYA 1I39A 5J4YA 3RKQA 2L7FP 2EPDA 1FJLA 1WI7A 4NQWA 2F4OB 1A36A 3GEZA 2ACJA 2FU4A 1SFEA 2M2EA 3GLXA 4DW6A 1BW6A 3UKGA 4DBFA 7AT1B 2LY1A 1C6VX 3JB9J 1ZSZC 1PJRA 1QZEA 2DW4A 3TL4X 1CF7A 2P0QA 3MMYB 1IXCA 2PJPA 5GANj 2BHZA 4PFOA 3JAMR 5TGTA 3URGA 1R00A 1Z0XA 3C2GA 2J5PA 4ON0A 4CH7A 2KXCA 2RGVA 1QQIA 2Y9ZA 1ITYA 2VKHA 1TP4A 4RAZA 1YO5C 4X6AJ 1TS9A 3HFNA 3MCAB 5LD2C 1K9MC 2DOAA 3OIQA 3ZXSA 5FLVA 3QKJA 2WBMA 3CCRQ 3F72A 2YRDA 4NL2A 2B0LA 1WHGA 1X6GA 4AYBN 4C92B 4BHBA 3O6BB 3CCYA 4LMYA 2E65A 1VQ7Q 1T39A 5FLXK 4XRFA 3QZ5B 3W6JB 1Y6IA 3HGYA 3A5ZB 3HL8A 4FT2A 4PJOF 1NM7A 5HODA 1WGSA 2IGMA 1YX3A 3EG0A 1A31A 3CCJA 1H3HA 3RDVA 5GMKj 2L3PA 5ICFA 1ZSZA 2FEIA 4O5VA 2H6BA 1M1KC 4HCCA 3SQNA 1GL5A 4P5OA 3F8BA 4PJNA 4LDVA 2ME6A 5FU7C 4HEA2 3QWXX 5I22A 4FW2A 2F2EA 2IS6A 3WVDB 5AONA 1JRIA 3E9GA 2X51A 3Q1JA 4CCKA 1MMGA 2CMPA 1X19A 2DT6A 5ICCA 4U7DA 3GTLJ 2NYSA 1YIJA 4XTXA 5FW9A 4U88A 4BGDA 2K9GA 2CUFA 1MGTA 4XN0A 5LGNA 4HCZA 2L0KA 2LDUA 1LDJA 2O5RA 1SMYF 4GO1A 4HQEA 4C8QD 1MBJA 5CYVA 5E3OA 3KZYA 5IOZA 1JXOA 1UTIA 5GAHJ 2ELJA 2DXCA 3IP4B 3NGPA 4BI8B 3RTRA 2ESNA 3HTUA 1GCQA 4M3BA 4ZDPA 1WJCA 3IC7A 4J9DA 2CQQA 1HKSA 2G9WA 5A2QZ 2LJ3A 1Z77A 3GF5A 1TQPA 3VU3C 3S3NA 5F1RA 1GBRA 5DEQA 1FP2A 1F9NA 3BCAA 2X98A 3EGDB 1VQNT 1FBSA 1T38A 3OIPA 4M7DB 2YX7A 2DBBA 2P81A 2GA2A 2K9QA 2RVCA 2GIZA 1BL0A 1ERDA 3QWYA 3I56A 2FPEA 2AHQA 1TW2A 4MO7A 2ESWA 2RQWA 2H3JA 4AFSC 4LD5A 3PIOF 3REAB 2R7XA 1QP2A 2HFHA 3MP6A 1ZGJA 2TDXA 5EEGA 4WWCA 1OYXA 3FXLA 2KK4A 1KQSS 3EQLF 3QPTA 1D1AA 1UJ8A 1MDMA 2EQRA 1YFNA 2VXFA 5DUKA 5HDKA 1M30A 2BE7D 2VXEA 4DOWA 4JUVA 1YI2T 4DOZA 2K3YA 1Q86R 5HY6A 1YN8A 5GAOr 2LMJA 5CJ9A 2VQCA 2LKSA 4XMYA 5GPCA 4YIIA 4XRSA 1AHJB 2X3WD 3ABLH 5FROA 2H8RA 4PKCC 4W97A 2Z33A 1VQ6A 4EQQA 5F6FA 3SDBA 1O3QA 4HVUA 2MBFA 3FBIB 3QYEA 5DCMB 2RI2A 3BJOA 3K4JA 1JJ2S 2X1EA 3HOWJ 4DEYA 2X0LA 3HKZA 3QRFF 1VQOQ 4IUUA 1UE9A 2FOKA 4JZ3A 2CW8A 1H8AC 2JMCA 1Q81R 4HX8A 3PMIA 2WB1A 3ZPLA 3JRBA 3GNGA 2OJ2A 1BR2A 1OZ3A 4RTWA 3P9IA 3CCSA 2RNJA 4Y17A 1ACMB 1WJBA 1OQKA 2ZPIB 1N25A 1MMNA 1QWEA 4C92C 2W24A 3Q0UA 2KIMA 4N9IA 1H89C 2F48A 3CC7I 3OOPA 1QQJA 5CQYA 4ANJA 3O8HA 1TXQA 2L89A 2MOXA 2ZZDA 4I02A 3FIWA 2V7FA 3FHZA 1JE8A 1SSHA 2XDBA 1FEXA 4WTOB 1HA8A 2LF7A 2DJIA 3CMEI 2OPTA 2F5TX 4Z02A 2XI9A 1D3BA 2XF6A 2ZFUA 4Y91A 3K9TA 4C5IA 2RREA 3CPWA 3G6EA 2X6OA 1ABOA 2J06A 5L3EA 2NLUA 1AU7A 3CJQB 2EQKA 2HI3A 3MEWA 2KRFA 2WAQA 4J9BA 1FOYA 4D8KA 1WH7A 3FF5A 2Z0WA 4C3IJ 3CF2A 3RPUD 3KLOA 1MKMA 3DKMA 2DETA 3BR3A 1HW1A 3AKZA 1WQWA 1NG2A 5CLSA 2GFAA 3A98A 4RTVA 2DL3A 1VQ5T 2EJ9A 4C0GA 3I59B 5KYYA 3CCMI 2HL3A 3NMZC 4ZN3A 3J81Z 1S6LA 2LVSA 3JCMW 1HDPA 2L3DA 1MMAA 4XLFA 5GTIC 2LQKA 3PIPA 1S72T 1N75A 4P1WA 2PQWA 2CO5A 4BS9A 2CWEA 1X4OA 4M77F 1K73U 1IZ6A 3AG3H 3GFLA 1SRLA 5HVQC 4D7NA 2GAUA 4G6DA 2V1NA 2HEOA 1G2HA 3G7ZA 1GV5A 3KEOA 4HNVA 3UA7A 2HZTA 4E7LA 3U23A 2JVVA 2M45A 2Z9OA 4OIOF 3EUKL 2FBHA 3BE3A 2BYVE 4ESBA 3V8JA 3BZKA 4M7DC 1QVGS 2H94A 4XU2A 4HT8A 1WCMJ 1PD1A 2LOOA 1B8IB 1OLTA 3CP2A 4P5NA 4N4GA 2LTOA 1XQHA 2W10A 3K4LA 4CYCB 3EG9B 3NRVA 4MLOA 2ADUA 2P0KA 2IA1A 4YIFA 4Z88A 2COBA 1RC9A 2DIGA 2LCSA 1I4K1 4E2FB 3KBGA 5J4VA 3QU6A 4JPBW 2E71A 3JRIA 1OKRA 3EG3A 3OS0A 3LSRA 4ELYC 4BY7J 4XSXF 3E9FA 4XKCA 2HVSA 3BR2A 2XAJA 4AVPA 2OTLQ 4M78A 1KC8U 3OYCA 2EA2A 3M0SA 2QVOA 1OPKA 4QPOA 3D5SC 4PJOB 4Y4RA 5IPAA 2RI3A 1OQYA 4Y13A 2RHXA 1F5TA 3A4CA 4L5IA 5GAEJ 2OD5A 1H88C 2UZKA 3MKDA 4OGCA 3SWNA 3CCJI 2OUMA 2UXNA 5ED4A 3PVLA 2VONA 4CXFA 2ID6A 2B9SA 1VNDA 3WVEB 5LFAA 1G3SA 1ZARA 1Y1WJ 1KD1C 4RM2A 4N4HA 2FBIA 5HDGA 2VGNA 4CCMA 4MFEA 1TG0A 1LPLA 2JM8A 3G71T 4XTWA 1MW7A 1QP3A 3N4MA 1I1GA 4C92G 2HSPA 2XDPA 1YIJI 4CZZA 2PMHA 4RDUA 3H36A 3HG9A 2Q1ZB 4GYIA 2OV7A 2ZJPF 3N97A 4IRHA 3L2RA 3H92A 2JXBA 4OMNA 1XX5A 3PT9A 1BI3A 1NHAA 4XR6A 5KAFC 3LNQA 5DCMA 2CP2A 2YHTA 3IV5A 5GAMh 1OEBA 3BG5A 2JTFA 3CCUQ 2M30A 5BS6A 4OP0A 3A1YA 4Y33A 4M7AA 1ZLKA 3OL4A 2FG0A 3IL2A 9ANTA 4B43A 3WTXC 2Q8KA 2YR2A 2KMTA 3VS3A 3ZN0A 1SD6A 3IAM2 1X2KA 3BCBA 2L0AA 4G7ZF 8ATCB 1M8VA 3I4NJ 2E34A 1JKRC 1T0FC 5BPDA 2FZKB 2HL5C 2KR3A 3K69A 1ZQ1A 1BN5A 2E64A 4MEXF 2QAZA 1N8RC 1VQ8T 2CUDA 1I1JA 4QVCA 4M75F 4NOYA 2XRLA 3KCCA 4RS8A 4U0WA 2ZXJA 3H3VK 3NHNA 5I11A 2EGAA 1YCYA 1AWOA 2CH0A 2JPBA 3I56I 1NZ9A 1UCRA 4XICA 3H0HA 2L4MA 3BZ6A 1RI9A 1APLC 2M34A 2ENMA 1MBFA 1JGGA 3DB4A 3LW5E 2E1MB 2Z1DA 2DFUA 3G1MA 3MO8A 5HKCA 3CMAQ 4HG2A 4EPCA 2F6CA 1V5EA 3M8EA 5IHKA 4E70A 4J5YA 5IXFA 1JB0E 3PO2J 4PL6A 2K3XA 1HKTA 2CH4A 3OYIA 3HPWA 4M78G 5LJ3f 2F5VA 1YJ9A 4N0BA 1D1CA 3G1LA 2IG0A 3MD2A 2N8GA 1VQ6I 3HKSA 1MSEC 1TWHJ 3DP7A 1VQ4A 3X2QH 1HW2A 3MPUB 1GT0C 3KLNA 3TO7A 3J80R 3GTGJ 1YQAA 1YIOA 2R5ZA 4OIQF 4OMYA 3QBYA 4C0ZA 2NWMA 4NB5A 2VKVA 2D2WA 3R0AA 2HMAA 3TU4K 1YHQA 4ETSA 2HQHA 1Y8RB 1EH8A 3BPVA 4RAFA 2BV6A 2YLBA 3LGFA 2J5OA 2VBWA 1N5ZA 5GAGJ 1WRJA 3CCSI 1YWPA 4XLCA 2K6DA 2QI2A 5B66C 3EFRA 2M9UA 3I54A 5GAMf 3P8BB 3BROA 4OB3B 2JNGA 2E3IA 2RH2A 4PJOC 1Z6TA 4B3AA 1C1AA 1PD0A 4IHYA 4FASD 4IRGA 2D45A 2DK5A 2JSCA 4ME7A 2RHYA 5KNLA 1WX6A 1BB9A 4DZPA 3KETA 2FJ1A 2DTIA 2QASA 4XK8E 3M8FA 3QJ6A 1PRMC 4CYCA 1YYVA 2YSRA 1LDKB 5HLHA 2DA4A 4RG8A 3G6EI 2HKXA 3TO6A 3RUXA 3CPWP 2QGGA 1LE8B 4I0AA 5DS9A 2C6YA 1X01A 4RBOA 2LQWA 1TWGJ 4ORZA 1BR1A 4EMGA 3JRCA 3TDZC 1KQ0A 1YJNA 4A93J 2CGPA 1DJ7B 1X2QA 2D8JA 2XGXA 3QQAA 2VBZA 2DVJA 3QHSA 3CCVT 2DZ9A 2NVYJ 1HSJA 4QTRA 3QG1A 1XGNA 5CVJA 5C44J 3WTVC 3E6CC 2B86A 1O57A 1NG7A 5LJ5j 2HYGD 4BXXJ 3LSGA 1ABQA 1TSFA 4M77B 2KRMA 2KFDA 2RI5A 4FHTA 3TGNA 1UHMA 1ZHFA 1VQOI 1H641 4CGZA 1FSHA 2F2VA 3MHXA 1R22A 4HCBA 3UR3C 3LOCA 4PJJA 2ZFWA 1SMTA 3WHBA 5CQEA 4A2UA 3LH5A 3FXUA 3GPLA 4OMMA 2DTRA 2E6ZA 5D6FA 5M3MJ 4XU0A 4AG2C 1VQPQ 1EJ9A 2PMZN 4FETA 3K1PA 3THKA 3CCLQ 2P4RA 3LQRA 2WY7Q 3HSEA 2KRSA 1M3AA 3NWTA 4WCIA 1XMXA 2KRCA 1V1CA 1TBXA 1Y8QB 3N5BB 2MH2A 1RNLA 5D5UB 5C6SA 1KQSA 5GAOl 3E5XA 2LQNA 5FU6B 3C12A 3LGLA 2QENA 3C1DA 5L3CA 5DD4A 3C7JA 2EILH 1WQ2A 1SVOA 4ZYDA 4HLYA 2Z99A 3GOXA 4G12A 2R0QC 1QKWA 1R5ID 4LXCA 3CC4T 3GZ5A 4WF2A 5F64A 5I2SA 1E2XA 4I01A 3TQ7P 1YJWT 2ICWG 4QQ6A 3CDLA 3U9GA 2WSEE 1JJ2A 2JVGA 4IIMA 4B9WA 1GFDA 2XIGA 3KP2A 5LGUA 4XU1A 3DPTA 2YU9J 5KE3A 4A3JJ 3PIOA 2AQEA 3T8RA 3GTKJ 5GAN6 5BNGA 1PUEE 3I4MJ 3DTKA 3U1KA 1XN7A 1W0TA 2K4BA 1HF0A 1QVPA 2H6CA 4IUQA 4XN3A 5IT9R 1VQKQ 3QPHA 3GP8A 2EYYA 4XNFA 1U6GA 4AT1B 1V55H 2LDMA 2PTKA 1K9MU 4OOIA 5CO7A 2EQIA 1JT6A 3VPRA 4II3A 4EV0A 1VQ7T 3EGUA 5C4XJ 4IHWA 5E1WA 3CXCS 1M2VB 4JS4A 4PJOG 1G8XA 5B3SH 4C3JJ 4HKEA 1W7PD 2C0IA 4FU6A 1EX4A 2ABLA 5HK3A 5LHIA 2EA4A 4DQ2A 2H1KA 4EJOA 3X24B 2IAIA 3MN2A 4IIOA 3TEEA 2J7IA 4LB6B 4I76A 4FYWB 2HQEA 2GWRA 2RAEA 2RQUA 3PGGA 5FKOA 2DA9A 4E7SA 5KYXB 2HKNA 4ZYGA 3CC2T 3KIOA 2LKXA 1DU6A 2MVTA 2QG9B 1KQ8A 4KGXB 2ZJQF 2DFHA 1L3LA 2K2VA 2BEOA 3A8MB 1A0NB 1K6YA 1V5FA 2COYA 3CPFA 2V9PA 3MWMA 3KFWX 4UUTA 5FLXR 2AO9A 4G7OF 4J6WA 4E7KA 2HS5A 5EEHA 3VS2A 4BHCA 2EIKH 2MG4A 2J6OA 4UY8I 4I09A 5GAN4 2XV4S 2W00A 2OZUA 3RYPA 5E3NA 5JLWA 3M7GA 3WTYC 3KYLA 1LUJB 4IHTA 1DQUA 3SEZA 2EQJA 2RO0A 1VQLI 4HRIA 3FB9A 4FISA 5ILSA 1PKTA 2E2IJ 2MH9A 5FD6A 3MKZA 1RUOA 5EG0B 4CYDA 1YI2A 1WPKA 3VV0A 1TQMA 4I98B 4XRMA 3OYJA 1YTYA 3PSFA 2DK8A 4IO9F 1VTNC 1I07A 1B7TA 1HK9A 2HZYA 2MWOA 3KP5A 1ENHA 2VPRA 5LRSA 1FBQA 1YJ9I 2W84A 2W85A 3FK7A 3K1NA 1TWCJ 3L09A 1XTDA 2P4TA 3O5ZA 1MUZA 2EK5A 4ZGDB 3E0JB 3VRZA 4BUGA 4CZCA 1VQ4I 1Z05A 4OIPF 2QSFX 1U5TA 2JJ7A 2PMUA 1GXPA 5FU6C 3HRTA 2ZNYA 2AK5A 3ONQA 4M77A 2V8KA 2WV1A 4RAGA 5AIQA 5L23A 2F5EA 2QSHX 2LX7A 3ZMZA 2YUPA 4A4FA 3OMCA 4C8QE 1AWWA 1KZHA 4JX6A 4XM3A 2XB5A 3JCMh 1U8BA 4QVDA 4BL0B 1G2BA 4F7UB 2HOTA 2DQRA 4GCVA 4WX9A 2K9LA 2VJ5A 4WK8F 4UVAA 1KYZA 3J7YJ 5D5WB 1QHHD 3V7RA 4X34A 3O2PE 4B6MA 2LH9A 1ZLJA 1KQ9A 5HLTA 4OU0A 1JKQC 2QBYB 1WZOA 1YBYA 5GAN7 4QWQA 2Y75A 1D5VA 3PFYA 4YELA 1WPYA 4KMFA 2DDBA 1S9HA 4GY5A 2EFQA 4BD3A 4NHJA 3QYFA 1PM3A 1Q1HA 2RNGA 4AIKA 2ZPBB 2CYYA 2ELKA 4FSXA 1B72B 1B9MA 3TSWA 3LWIA 1N9RA 3MKWB 3JB9D 4XLEA 2X9DA 4C2MJ 3U21A 2VB6A 4F92B 1X3WB 1K4SA 3CMAI 3SWNB 1BOAA 4HQMA 3B6AA 1OX9A 2Z2SB 1E6GA 1YWOA 4K11A 4DBHA 2ECBA 3M0UA 4M72A 3I0TA 1PCXA 1LFUP 1VQ5A 3MZYA 2VUBA 2CREA 1FY7A 1EF4A 2EBPA 1S72A 2XIDA 2MABA 1BI0A 4CC2A 1P9QC 3ZOBA 2JSPA 3IH4A 1LFBA 1U9NA 2HQAA 3VSLA 4OB1B 1SD7A 3EUAA 5BPIA 3NTIA 5E8IA 2XKOC 3OYKA 1PP7U 2DD4A 4W1UA 3P7NA 5LJ3g 4X0GA 3QP5A 4IQ4A 2EV0A 4HLXA 5LJ3e 1JHHA 1VQMA 2PQ8A 3D5RC 2K5IA 1Q7YR 3OR1C 3RMSA 4JJBA 1ZRFA 5B1AH 2GM4A 4YRVA 1LKXA 1TNSA 2PVDB 1OX8A 2JRMA 4MMLA 3K10A 1CF7B 3PQJA 3W3CA 3LWFA 2DL5A 1JUMA 1WJAA 2KHMA 3C18A 2JVHA 2XVCA 3QZ9B 5D6XA 1H9GA 4BI3A 5DY9A 5CR2A 2VC0A 1W1FA 4QQDA 5HOOA 1MNDA 1DGRM 3GFIA 1KQ2A 1EV7A 1RL2A 3QDFA 1JJ8C 4M77G 4CC3A 2B8AA 2VOPA 1QMCA 2LD5A 1JHFA 2QTVA 3HRMA 3CC7Q 1KQSP 1M1FA 5GAMg 2FOWA 4CDGA 3JREA 2W4SA 3RKWA 1W36D 1K8AC 1ZHIA 3M4OJ 3V42A 5CVRA 3H5NA 2Y90A 4A5NA 3Q0VA 3CMEQ 4Y7NJ 3OYLA 1ZREA 3FBNB 3P9CA 2K2MA 4L59A 2XSJC 2BZ8A 2DODA 2L9RA 2F5KA 2ECCA 1M8MA 1MGQA 4GFBA 4M75A 1G3WA 4IX7A 1UGSB 2JW4A 3CBMA 5J3BA 1JJ2P 2I0NA 1H92A 3FHNA 3JRDA 2HTSA 1MNMC 4M6XA 1YW8A 4DYQA 2CW0F 2PNIA 4FX4A 4N0AA 1VF9A 2RQQA 2BTTA 2L7MP 4J9CA 3CMYA 5D7UA 4LG0A 3ERED 1BR4A 2W82A 2QUFA 4HSTA 4HF0A 1FYKA 4J9EA 2TRTA 3CLQA 2VJIA 2X6YA 3CCMQ 1X1AA 2CGHA 5E3LA 2K3FA 2QA4Q 3G71A 1P4WA 3SXYA 1I1SA 1K6OA 1U1TA 1TL8A 4YG2F 2M1HA 1AOYA 4JRQA 2VJJA 3FXRA 1VQPI 1IRZA 4C30A 3EYIA 4HA8A 4XLAA 1KFZA 4B1RA 1XMAA 4QLCU 1S7OA 1IV6A 4L0YB 1Q82R 5EZHA 1EZZB 2Y0MA 4RB0A 3MQ0A 2L01A 3F70A 2VQLA 2DYBA 4ZGJB 5FD5A 5LGTA 2M1BA 2H09A 5J8CA 1UB4A 3CJTB 4E7ZA 2CZ0B 2RQTA 2DTHA 5JI6A 3BY7A 2M5WA 2QQAA 4M3GA 3L2QA 4B9XA 2VOOA 2PUKB 3S1MJ 3X28B 2V6EA 4NDLA 1DPUA 1A5JA 3UPUA 3OIOA 5AYFA 5LBQA 5B5EC 1E17A 1Z7LA 3I9QA 2QA4T 4Y3OA 1RI7A 1UZCA 1VQNI 1SPKA 2L2OA 1J0RA 2W48A 1WHHA 2QQRA 3G1JA 3CESA 3MAJA 3PMTA 3HL2A 1OOTA 3M1CA 4LOCA 1MDMB 2PVOB 3QYHB 2ZSHB 1XGMA 1GVDA 4PSXA 1SG5A 2H8HA 3FX3A 3M9AA 4A12A 1GHCA 1R6RA 2JUGA 1J2XA 3OR2C 1EIFA 4FE7A 4X1EA 1IC8A 1S1NA 2KIUA 2QDLA 1D0ZA 2NXNB 2FHDA 1Y39A 1IGNA 1KK7A 1ZX6A 1WA7A 3SHWA 1B72A 1IXRC 3HOUJ 4OMOA 3L2CA 1YI2I 2FL7A 2EZIA 5CKHA 3CF5F 3EH1A 3R4KA 3H41A 3CCJQ 2P7VB 4II1A 2HZDA 3MKYB 2MFZA 4M75G 1H3ZA 3ZP5A 1WJFA 2MD0A 1BJZA 3BQYA 3BQZA 2YLCA 3H0IA 3RDIA 3RR6A 2LYCA 2R93J 4BKXA 3L2UA 1R0CB 3E3VA 2I2LA 1QZZA 1ETVA 3JRFA 3S15J 3FLGA 4RGUA 1YITT 1P7JA 4YIRX 2K85A 2VUMJ 1FIPA 3M3YJ 2NUTA 4QVZA 3F8CA 2MWPA 1V4RA 5D6WA 3BTJA 1YIJQ 3F9KA 1UEBA 1R36A 4QKUA 2IEKA 2W1OA 2VL8A 3ASNH 1IG7A 4BE0A 3SHFA
chains in the Genus database with same CATH topology
3I71A 5FLXE 3PTAA 2M87A 3PQKA 2Y4YA 3R60A 3QO3A 2O61A 3FWEA 2HOEA 1D3BB 4HDVA 1M5Q1 3NTHA 4J7IA 3CCQT 1VQ9A 3IRQA 4ENJA 4EGYA 5GMKh 3OA6A 3ABUA 1FPQA 3PNWC 3E1SA 4F7UG 2ZJ2A 2VODA 5E20A 3REOA 1U3EM 1X6OA 5I2MA 3CXCA 3LWHA 3CCVA 4G9YA 2RC4A 4QQGA 2KVQG 3D5LA 3VYHB 4UC4A 1IAWA 3H3