1G3SA

Cys102ser dtxr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
222
structure length
212
Chain Sequence
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 64
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3sA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3sA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3sA03
1FYKA 4XSXF 3VEPA 2LSOA 5JVTA 2A3SA 1YS6A 1TNSA 3EDPA 2V79A 1S3JA 2XAQA 1T38A 1Z7UA 3TKYA 1CF7A 3BPXA 4P9FA 2XASA 3VB2A 4HA8A 2VBZA 1FP1D 4LG0A 3FZVA 3JTHA 2NAZA 5FFZA 2HTSA 2M30A 1E17A 2DBBA 3SXYA 5F1RA 5L3FA 4IRGA 1ON2A 2L54A 3WGHA 1XSVA 3CO6C 2PQ8A 3J80Z 2HKXA 2Q2EA 4F7ZA 4BHPA 3R0JA 2P5KA 1U5TC 1D3YA 3FHZA 2GCXA 4B8XA 4PGGA 3BPVA 5IT9Z 1ZREA 4NB5A 3DP7A 4KN4X 3I5UA 4CO8A 3IRQA 4IVNA 4Q47A 1B6AA 2ZNZA 3MAJA 4RB3C 4G7ZF 3DKWA 3HUGA 4RGUA 1YYVA 3U2RA 1J5YA 4HLXA 3RJPA 1KYWA 2HQNA 2Q0OA 2LF7A 2VE8A 4EM2A 3WGGA 3WTTC 4HLYA 1P4WA 4KNYA 1XDSA 1EH7A 2D2WA 3BROA 3V7CA 1O57A 1J75A 3IHUA 3KFWX 3L7WA 2QWWA 1QPMA 2VT2A 4IHSA 3F6VA 2EA2A 2ZMEA 1QVPA 1LJ9A 2E1CA 3JAMK 4UV8A 4Y13A 4HZFA 3KP6A 5LHHA 4OMYA 1ZH5A 3ROUA 1XCVA 4WXHA 1ONVA 1D8KA 1W4MA 3I59A 2XV4S 1P6RA 3HSFA 4ZYHA 4M9ZA 3MZHA 4A0ZA 5K5OA 1XSDA 1I1SA 4IRHA 2QQAA 3CTAA 2MLGA 3F8NA 3V8JA 4YFNF 3GFJA 1TQIA 4YG2F 4P5OA 4QWQA 1TLHB 5JI6A 2Y48A 3HOTA 4A5MA 2YU3A 4ASNA 5LRRA 4I02A 1XSXA 1I27A 2PN6A 1X3UA 1RUNA 3ZMUA 5DUKA 1PUEE 5D8KB 2W25A 4OU0A 3GW2A 3GLXA 1IUYA 5DCMA 2PEXA 5L3CA 4I0AA 2K4JA 2VOOA 1LB2A 2EV5A 2DQRA 4EJUA 4M74A 1B1BA 3PQKA 3I64A 5E1ZB 2Y75A 2OD5A 4L0ZB 5CJ9A 2F5EA 2FOKA 2FBKA 1XGSA 2RN7A 1MDMA 1F4KA 2VBWA 2VC0A 2RV8A 5HDGA 4A12A 4U7DA 3FWEA 1KU3A 1HKQA 3V4GA 3KEQA 2A69F 2GA2A 2MBFA 2RDPA 4EJVA 4ZZLA 1AWCA 2R7DA 2NYXA 3ISPA 1FWZA 1QQIA 3H3ZA 2X4HA 3H3UA 1E2XA 3K1MA 3SHFA 4BQAA 1JE8A 3WTVC 4JQFA 4A5NA 4A6DA 1G3YA 1QNTA 2EFQA 1HW1A 1S8NA 3L00A 4EGYA 1YTYA 4LMYA 5FLXK 3RTRA 4S05A 4EM0B 3ZMDA 3L2CA 3T8RA 2G7UA 3HHGA 4HYEA 3LQQA 5LGNA 2QLZA 4ENNA 1IRGA 2GXBA 1FBUA 3QPHA 2UWMA 5L3EA 2FXAA 1OYIA 4A2UA 1R1VA 5LHIA 3BOQA 3LAPA 2V1XA 1HQCA 2PBIA 4M9SA 1ODDA 3P9IA 3HOSA 2GIVA 2M87A 4LK1F 2KRFA 3BWGA 2JPCA 1IN5A 5ILUA 5L3BA 1W5TA 4MEXF 1R5HA 3HSRA 5FGMA 2G9WA 2ZCWA 1ZAOA 4AVPA 2PFBA 2P8TA 4KIGA 1AOYA 3MWMA 1YW9A 4EJOA 4IF4A 4LFUA 1GXPA 5JR3A 2L4MA 2DQLA 3LWFA 4Y17A 3FMSA 4LD5A 1U3EM 2IT0A 3M1EA 4EQQA 4GYGA 4Z2YA 3RKXA 1T2KA 3GUDA 4E70A 4U0WA 4UNOA 2UXXA 4BYYA 2FBHA 3M8EA 1DPUA 3M7GA 1QW1A 1KU7A 2HGCA 2QBYB 2IW5A 4MTDA 1HKSA 3LSTA 5JFRA 5LHGA 4WCGA 2EWNA 3GFIA 1BM9A 5CVRA 2COMA 6PAXA 4PCQA 4A0YA 3ZMVA 3GFLA 3MFKA 3WU0A 2V9VA 1BI3A 4G6QA 3O6BB 2STWA 1ULYA 1W7PB 4R8HA 3QP5A 2XAGA 3HTSB 5HS9A 5CLSA 4UV9A 4G7HF 3GZ5A 2VXZA 2O8XA 1QBJA 5D5VB 5BPDA 3ZMTA 4KA4A 1EH6A 2HTJA 2YPRA 5H6RA 1P4XA 2FU4A 1R1UA 3PQJA 1XGOA 2YX7A 1J59A 2K27A 4BAYA 5FB2A 3GYHX 1BYMA 5DD8A 1F9NA 5D4RA 3F72A 2EFNA 4RGRA 4CXFA 4KICA 4LLLA 1NHAA 3FXQA 1MJAA 3C1DA 1TTYA 3KE2A 1YQAA 5DV5A 2PG4A 4M9XA 2CQKA 3F3XA 3TOAA 3DPTA 2D1VA 3HYIA 4KYWA 2IA2A 1UB9A 2Z3YA 4ZYDA 2FEZA 3MQ0A 2ZO4A 1LEAA 5FLXZ 2QUFA 1XMKA 2KIFA 4HQMA 1LDJA 2O6GE 2XKOA 1G3SA 1T39A 3J7AO 3F8MA 5FFXA 3DV8A 3GWZA 3RPQA 1BI1A 4HDVA 4JK1X 3I0TA 4RB2C 1G4DA 3GEZA 2DPUA 2OQGA 3ULQB 1RIOH 1FP2A 2XKPA 4YIIA 4R1HA 1FOKA 4HF2A 2RQPA 4EV0A 2W24A 2P7CB 2DK5A 3TO6A 1K7AA 2E1NA 3DEUA 3F21A 1KU9A 3D5LA 5LGUA 1BBYA 3Q5FA 3OV8A 3L9FA 5HLGA 4BXUA 2WWYA 4ETSA 1S7AA 2MA3A 2EJRA 2XRNA 3SZTA 5AIQA 1XMAA 2O3FA 4KDPA 2M5WA 1HKTA 3HRMA 4WWCA 5K5QA 4Q48A 4L5IA 2EFWA 4M73A 5HDNA 3MCZA 3LQRA 1ZGJA 1FPQA 3K2ZA 1KGSA 2LX9A 5HOOA 2DT5A 1EV7A 3M8FA 2W84A 1C0WA 1TBXA 4UVAA 2HYFA 1XCBA 3IWFA 1K6OA 2QQ9A 3TDUC 4GXOA 4XLPF 1Z9CA 1ZYRF 4HAMA 2KJCA 2AXLA 1OPCA 4ENJA 4G8XA 4IHTA 5J6XA 1Y0UA 2G7HA 2FMLA 2QBYA 3R61A 1IN4A 4L18B 3W6JB 1S6LA 1F5TA 1LNWA 3WTUC 2HDCA 4L9NA 5FD5A 1XGNA 5LEKA 1J7KA 1FBSA 1ZG5A 1KA8A 1REPC 2ZJ2A 3GO5A 1W7PA 5BPIA 2DAOA 1JGSA 1LVAA 4OIOF 3CUQB 3JW4A 2VE9A 5IT3A 3BP8A 4O3MA 3MZYA 3RKWA 2QQBA 3E6CC 4UUVA 4U0VA 4R79A 1S29A 3FXRA 1MKMA 1LEBA 2BYVE 4LJZF 5HDKA 3WGIA 3O2PE 3SFZA 4OMZA 4N0BA 3CO7C 3E6DA 1V3FA 1KU2A 3EUHA 3V7SA 4A0XA 1R00A 3CDHA 3E3VA 1MJ9A 4O6JA 1MD0A 3KP3A 5F64A 5LRSA 3ZPLA 1LQ1A 3N97A 3OOPA 4KMFA 3DQVC 1ZRDA 2PMHA 2GZWA 2VBXA 4AIKA 1ZRFA 3ABUA 3CJNA 2L3DA 1YG2A 2ESHA 5ICEA 2STTA 1R23A 3J81K 3TOBA 1TW3A 4ZYGA 4Y15A 1DP7P 3GFMA 3RKYA 2BGCA 2DFIA 5E8IA 3KETA 4HX4A 5LLQA 2K5LA 2EB7A 3KP2A 2P5VA 3REOA 5D4SA 3WU1B 4WXDA 2KIUA 4BHBA 2QZ8A 4AWXB 4YIFA 3RIRA 2Z33A 2EV6A 2P6SA 3M9AA 2B0LA 3CUOA 4G94A 4BHCA 4EJWA 5CVVA 3F8FA 5D5WB 2D45A 5E17F 1HXDA 3T0YA 2XIGA 1T0FA 3FX3A 4U7BA 2JT1A 3QP6A 3ECHA 1D5VA 1BC8C 4I01A 2FBIA 1CGPA 5HVQC 2A6EF 2PLYA 1BJAA 3R4KA 3HRUA 3HRSA 4RB0A 3BDDA 3IKVA 4KUMA 4MTEA 2W85A 2QYOA 1JHFA 2HR3A 3LAJA 1B59A 2K7LA 2F5DA 3EYYA 1P92A 2VC1A 2XAFA 1T98A 3ZN1A 2ZXJA 4XSZF 5D8LB 1GVJA 4KIBA 4XBFA 5HS7A 4CGZA 2MH2A 5DD4A 2XVCA 4HX7A 3WTZA 1YIOA 1ZLKA 3K1PA 1ZG3A 1RUOA 2OU2A 4A6EA 3EYIA 3T5XA 4CDGA 1ON1A 1DDNA 4L9VA 1DUXC 1XD7A 4WX9A 3SZPA 2VOPA 1STZA 3WODF 2KIMA 3QAHA 4MQ9F 3GF2A 2RGVA 2LKPA 4HBLA 4HV5A 3RPUA 3ZQ7A 5L3GA 4LB5A 2UZKA 1YW8A 1XN7A 2IA0A 4ZH4F 4IJAA 3NRVA 5H20A 2H6CA 2ZKZA 4OIRF 5LGTA 4BH9A 5JHUA 3E97A 3E5XA 1K79A 1FYLA 5TJJA 1S7OA 2VN2A 2IRFG 2FE3A 1YW7A 2OA4A 2BE5F 4L5JA 1KQ8A 3JAMZ 3F23A 2FNAA 4MHGA 3FM5A 2A07F 4EMSA 5DDGA 1YFHA 2CFXA 2JTVA 4ESBA 2MC3A 4RS8A 4OIPF 3FXUA 1BIBA 1B4AA 1KYZA 2F5FA 2A5YB 1FX7A 2XAHA 3Q9VA 1Z1DA 2P4WA 4N9HA 2UXNA 3ZN0A 3E6BA 5EEHA 4U0YA 3I54A 1HSTA 5D6EA 4RB1A 1FLIA 1A04A 3TQNA 2Y0MA 1IN7A 3CUQA 4Q4ZF 2ZFWA 1I1GA 2ADUA 3J80K 3KLOA 3ML6A 1Z6RA 1UHWA 1TQMA 3FMQA 2EFPA 1IRFA 5BMZA 1Z91A 5ILVA 5DCFA 5IT9K 1TW2A 2MH9A 3I71A 1QO0D 2OAZA 2IP2A 3J81Z 3FM3A 4JBAA 4HV6A 1R58A 3WTSC 2K5FA 2BBYA 2XAJA 2P5LC 2HFHA 2ZMEB 4IXAA 3QRFF 4HF1A 4KFCA 4LK0F 5J8CA 3ERED 4YFKF 2Z99A 4NQWA 1Z6TA 4AIHA 2ZNYA 2MLKA 1RNLA 5BQTA 3D0SA 4HF0A 3BZ6A 1WI9A 1O7FA 4EVIA 4WK8F 1HW2A 4MQVA 2VODA 3IC7A 5E8GA 4UVCA 1MGTA 2ACJA 2FRHA 5KK1A 1BIAA 3WG9A 2O0YA 1FSEA 2RVCA 2Q8KA 2H09A 3P9CA 3ZMZA 3BJAA 4IPAA 3VFZA 1BI0A 2RC4A 2H94A 3K1NA 1FBQA 2VT3A 1U2WA 1BI2A 4FHTA 4KIFA 1JHHA 4OOIA 4L9JA 3JSOA 3GZ6A 1J0RA 4L9TA 2K4YA 2PI0A 4U88A 1I5ZA 3K9TA 2CWEA 4HQEA 2L02A 2H27A 3B02A 3DPLC 2EA4A 5HLIA 1H0MA 2HWVA 1SFUA 2RKHA 2ESNA 3KP5A 1FY7A 3QOPA 2P7VB 4CHUA 4CICA 4RGXA 2LDUA 1K78B 1D8JA 2L01A 1FZPB 3R60A 2XHKA 2R7FA 1SD7A 3I53A 2BEOA 1P4AA 2K02A 4P96A 3COAC 4N9IA 4GO1A 2FA5A 1U5TB 4I98B 3FF5A 1OKRA 2MD5A 2HS5A 2ISZA 4ON0A 3DFGA 3ELKA 1YO5C 3LFKA 3V8KA 2IJLA 4DNCA 2M45A 1XGMA 3LA2A 1USTA 3WTXC 2DO7A 1RZ4A 2DU9A 2GA1A 4G9YA 2ZBKA 1TNTA 3C3WA 2P6TA 4KMUX 1ZN2A 4MEYF 3QPTA 5AIPA 1R7JA 4ESJA 4M72A 1O3RA 1W5SA 2CG4A 2E7WA 2VONA 1L0OC 1QZZA 5ERIA 5E1XA 5DEQA 2A6HF 2JPBA 1FSHA 1LDDA 2A61A 3JSPA 2HKOA 1SD5A 1R36A 3RYRA 1UHMA 1SD6A 5H6QA 1SMYF 2C6YA 1O7LA 5A2QK 2BV6A 1SFXA 1BOAA 2V1UA 1KQ9A 2CSOA 2GWRA 2EV0A 5K5RA 1ZG1A 2YSRA 1T6SA 4OIQF 4P55A 4GYIA 5EEGA 1U8RA 2V1DA 1WQ2A 4I2OA 2X0LA 2HYGD 2GXGA 1ZLJA 3E19A 2XUBA 5CVUA 2K5IA 2KKOA 3TO7A 1U78A 5CYVA 3KCCA 3K69A 3ECOA 3GXOA 4H0EA 1H9GA 3EETA 2Z5UA 1OYYA 5FD6A 1ZARA 2OZUA 2JRTA 1TQPA 1V4RA 2FF4A 2XROA 3IRRA 4P9UA 2ETHA 3RYPA 2H3JA 3T1BA 3HIFA 1BC7C 3H92A 3HSEA 2WC2A 4HDUA 1OMIA 5ICCA 1G6NA 5DYMA 4ESFA 2DTRA 1QZYA 5F6FA 4PDKA 1JXSA 1OYWA 1O3QA 4M71A 2IVMA 3CUQC 4AD9A 1EH8A 1USSA 4HW0A 2JZYA 5ICGA 2K86A 2QM3A 4CZZA 1ZHFA 3LA7A 3KLNA 1WWXA 3RDIA 3W6KB 4GCVA 2OQRA 3CLOA 2NNYA 3K0LA 2DI3A 2J5PA 4LLGF 3VOEA 1O3TA 4MGRA 4LLNA 1WKMA 2RNJA 1PP8F 3WTWC 5ED4A 2ISYA 2O03A 2DLLA 3T8TA 3KZYA 3G3ZA 4RAYA 2H6BA 4BNCA 4EGZA 1IXRC 3FMRA 1IW7F 2EFOA 3P7NA 2OZ6A 1K78A 3U1DA 3KP4A 2FSWA 2TDXA 3U9GA 5ILSA 4HOBA 4FX4A 3R6SA 3WTYC 1HBXG 3L09A 1XB4A 4UXNA 2XGXA 3BY6A 4FT8A 1G3TA 1YLFA 2JSCA 1U5TA 3MHXA 4AIJA 3F8BA 3TO9A 1U6GA 1VTNC 1DPRA 1SD4A 1SAXA 4G7OF 4I09A 2LNBA 2PJPA 5D5XB 1LDKB 5LEJA 4HX8A 4YFXF 3GX4X 3GVAA 3I58A 1IN6A 3F8CA 1OR7A 5FO5A 1R1TA 5A2QZ 5L3DA 3WE3A 2F2EA 4O5VA 2VBYA 1CF7B 2V6CA 2HQRA 3TDZC 1ZRCA 1UFMA 5LBQA 1FT9A 2PMUA 4LG0B 3ABTA 5J8FA 3EQLF 2GQQA 4RGSA 5ICFA 3N4MA 4ZYEA 4MNUA 2L4AA 5TRDA 4G6DA 2IPQX 2KJBA 3TGNA 3G73A 2Z9OA 3S2WA 4S04A 5CVJA 5HS8A 2R3SA 2NNNA 5E1WA 4XRFA 2QENA 3E5QA 2D1HA 3E6MA 3DXJF 2DW4A 1W7PD 1FC3A 3I4PA 4ENMA 3HHHA 3IWZA 3ZMSA 1MJBA 1WSUA 4PGHA 2CO5A 1R5GA 1IZ1A 1MZBA 1ZGAA 2WV0A 5D6FA 2YR2A 3HRTA 3KEOA 4Q5SF 2HEOA 1P2FA 3KZZA 1Q1HA 2W57A 2OBPA 4GGGA 2A68F 1B9MA 2LF8A 4KN7X 4RAZA 1GXQA 1IXSB 2NS0A 1PP7U 5D5UB 3O3KA 4WXCA 3NEUA 3RI4A 4LGWA 2HZTA 3V7RA 4FX0A 1J2XA 1WRJA 4LB6B 3F22A 1UCRA 5KVRA 5CVIA 2YX4A 1BN5A 1KQ0A 3V8LA 3JTGA 1FNNA 1XDUA 1IN8A 1FYMA 1Z05A 2FMYA 2GAUA 3WE2A 3ZP5A 2NRAC 3MEXA 1HSJA 3I59B 3KP7A 3VODA 2J5OA 1SMTA 4XLNF 4QLCU 4OINF 4I7HA 3SQNA 1HW5A 2AS5F 4PZJA 5DUIA 2M1BA 3BJOA 1L3LA 4CYDA 3AAFA 4IRIA 2F5CA 1IXCA 3QU6A 5K1YA 2O61A 5E18F 4NHJA 5BS6A 2FNPA 3PFIA 4I0BA 5BOXA 2CW0F 4WF2A 4KT5C 1IAWA 3DF8A 3P9KA 2DK8A 1O3SA 2QVOA 1PDNC 3QU3A 2DPDA 1F1ZA 3R0AA 5AONA 4M6XA 1H9TA 1YS7A 4EM1A 5DCMB 4D0PA 4UHTA 2FQ3A 1GHCA 2CYYA 1QGPA 2IA1A 3E5UA 2K4BA 1IF1A 2HOEA 2EK5A 3F6OA 1G3WA 1I6XA 5HLHA 4EJTA 2M8EA 2CGPA 4UVBA 2WTEA 4B09A 4K2EA 4ZZDA 3IKTA 1SFEA 3NQOA 3BJ6A 4DQ2A 2ELHA 4M6YA 3C18A 1RI7A 5E20A 2E7XA 1MDMB 1J9IA 3Q9SA 1R22A 4L0YB 1B9NA 3HTUA 4TV7A 3C7JA 4ENKA 3IL2A 3LA3A 3B73A
chains in the Genus database with same CATH superfamily
2K3FA 2FPFA 1FYKA 3HOZJ 1ZLMA 3LGLA 4XSXF 4XOTA 3VEPA 4XU0A 2LSOA 5JVTA 2FL7A 2KGTA 3UA6A 2A3SA 1T8IA 2DBMA 2M0CA 4J9BA 1YS6A 4DBRA 1TNSA 2EQMA 3EDPA 2DYRH 2V79A 5KHDA 1S3JA 1BCOA 5FLVA 4DIQA 2A7YA 4J8OA 2VQCA 4XTUA 2ZB9A 4NL2A 3VU3C 5GMKj 3TREA 4JZ4A 1K73R 1JJ2S 5GANh 4Z6YA 4GFBA 3P5JA 3TBIA 2XAQA 3I3LA 2DXUA 5GAMf 5B1AH 1YIJQ 2R5ZA 5M5XJ 3BR1A 1T38A 4A3KJ 1P7IA 1V55H 1JKOC 2IGMA 3TL4X 1ZK8A 3MKWB 1XC5A 1Q1VA 3SJMA 1Z7UA 2DX1A 3D7SB 4CC2A 2YWWA 2XHCA 4ZGJB 1JTYA 5EF6A 3J7YJ 4RBOA 4EMKA 3TKYA 1CF7A 1N6AA 2X6OA 3BPXA 4P9FA 3EG9B 1YWOA 1I5OB 2XASA 4I99C 1P7JA 3DPUA 4HA8A 3VB2A 4HG2A 2VBZA 1ZUUA 3JAME 1D3BB 1FP1D 4LG0A 2LK2A 3BR5A 3FZVA 3JTHA 1VQ6I 3QO3A 5LJ3g 2NAZA 5FFZA 2KLOA 3QUIA 2FD5A 2HTSA 3H5RA 5DS9A 3GBGA 4BXXJ 2CZ6B 2D0NA 3M0PA 3FXKA 3V42A 2M30A 2ED1A 2EYXA 2CZ0B 5GAN6 1F36A 1PD1A 3FBIB 1E17A 1X43A 4ANJA 4C2MJ 2HNHA 2NVTJ 2DBBA 3SXYA 2EIMH 2CH4W 3EG1A 4M77A 3UPUA 2OTLA 3ZEHA 5F1RA 3VYRB 1X4PA 5L3FA 4CZCA 4PFZA 2Y30A 4IRGA 1ON2A 3FRNA 2L54A 5C6SA 3WGHA 1XSVA 2LQNA 2DTOA 4AG1C 1YHQA 1JTXA 3EH2A 3O5ZA 2EGAA 3ZBDA 3CO6C 2BE9B 3O8VA 2PQ8A 1M1KC 3J80Z 1BK2A 1WCMJ 2NOJB 2LCCA 2HKXA 1RR7A 2LD5A 2Q2EA 3MKLA 4F7ZA 2JZ2A 2D8HA 2XGEA 4BHPA 1I4K1 3UDCA 1KC8C 1SKUB 2IS4A 2AQFA 3R0JA 3IAS2 2ZGWA 5GANj 2DYBA 1V54H 2P5KA 5EGOA 2JS2A 2LC4A 1U5TC 1D3YA 2QTVA 3FHZA 4XU3A 2GCXA 2PJRA 4B8XA 4PGGA 3BPVA 1X58A 5IT9Z 2DMNA 4D7NA 2QTXA 1ZREA 4NB5A 3DP7A 4KN4X 3JCMJ 1BW5A 2VPLA 3I9V2 3AL0B 3I5UA 3OY9A 4CO8A 3IRQA 2CW8A 4IVNA 1I3AA 1Z67A 1B6AA 4Q47A 2Y90A 2ZNZA 3MAJA 1SAUA 1SF9A 4RB3C 2XI9A 4G7ZF 2RJDA 2OTLQ 3DKWA 2M1HA 1WXBA 3HUGA 2N8GA 3JV3A 4MFEA 4RGUA 2QQSA 4JRPA 1YYVA 5FU6B 1WH7A 2LFBA 1F43A 3URGA 4C8QF 4JYKA 3U2RA 1J5YA 2NUPA 4HLXA 3RJPA 1KHCA 3FJPA 1KYWA 2HQNA 2Q0OA 2WAQN 3VUBA 2LF7A 2VE8A 2Z16A 2ME6A 4EM2A 3WGGA 4BE2A 1UGVA 1S72Q 5IP7J 1K8AU 3JSCA 3CCSI 3WTTC 1C0MA 4HLYA 1U1TA 2LQKA 3N5BB 4VUBA 1P4WA 2EKOA 3GTJJ 1OR7C 1S9HA 2FQ4A 4I6ZA 3J81E 2HQ5A 4KNYA 1XDSA 1K9AA 4RTVA 2EZLA 4A3EJ 4IOAF 4KJZA 3LFUA 1BOBA 2ZXWH 2ZC2A 1PRMC 3M0SA 1JJ8C 4OB3B 4Z89A 1EH7A 3K4BA 2EYWA 2D2WA 2ZPIB 3JB9D 2YT6A 3BROA 3V7CA 3MP1A 1O57A 4CC7A 1J75A 2BHZA 3IHUA 3KFWX 1V5GA 1X1CA 3DBLB 3JRGA 1UGSB 2R5AA 5CKHA 3H9NA 3X25B 4EMGA 4M7DB 1W0TA 2YS9A 2KEAA 1GDTA 1WHHA 2NXNB 1B72B 1VQ8Q 2OX7A 2O4XA 1ZGWA 3L7WA 1DU6A 5FKNA 4KITB 2QWWA 5FKOA 2E41A 1QPMA 2VT2A 4XR6A 4IHSA 3P8HA 2C06A 3F6VA 2A05A 2K40A 2EA2A 2ZMEA 3K4NA 5EYRA 1QVPA 2QAZA 5D6YA 1LJ9A 2FO0A 2LH9A 2E1CA 3JAMK 4UV8A 1WJSA 2NLUA 3H6ZA 4PLLA 3TVTA 5A0DA 3CMAA 1VF9A 2CV2A 2R58A 4Y13A 2QA4Q 3AT1B 4HZFA 3KP6A 5LHHA 4OMYA 3ZRGA 5FRMA 1ZH5A 2DD4A 3EGDA 4J9CA 3PFYA 2DKGA 1UGRB 2LP5A 3ROUA 4CYCB 1NPRA 2EJFA 3CD6T 1XCVA 4JLIA 4XLCA 4EATA 1A6QA 4WXHA 4CI0C 2CH0A 1ONVA 2YRCA 2W4SA 1D8KA 1WNLA 1NG6A 2X6XA 1W4MA 2GIZA 1YHQI 1EX4A 2OI3A 4PJNA 4F7UG 4RAFA 3I59A 5FU7C 2XV4S 1P6RA 3HSFA 7AT1B 4XORA 4ZYHA 2V1RA 3MO8A 5KYNA 1N8RU 3QZ9B 4X9DA 3VV0A 3G71A 1IRXA 3DKYA 1AU7A 4M9ZA 5I22A 3MZHA 2GF7A 2LP0A 1LE8A 1I5LA 4A0ZA 1N5ZA 4M77F 1Y6IA 1R77A 1YCYA 5K5OA 1XSDA 2RPNA 3WXMB 4CC4B 1VQMA 1I1SA 2X3XD 3QYGB 1MNEA 3OIPA 4IRHA 2QQAA 4Y28E 3CTAA 4F14A 1GCPA 3CCRT 1TWFJ 2MLGA 3F8NA 2DZCA 3OB9A 1GV5A 1VQOA 3V8JA 2A5WA 5IP6A 1DP3A 4YFNF 5LJ5d 1K0XA 1D0XA 1YI2Q 4BI4A 1ZR2A 2VXEA 3CC7A 3FKIJ 4XL9A 3GFJA 4M7DG 4XKWA 1VQ9T 1TQIA 3CLQA 3GCMA 2CSQA 4BB7A 2X1EA 1Z3XA 3OYFA 1QVFP 3OYEA 2LKXA 5KYXB 4YG2F 4P5OA 1W4SA 4QWQA 1TUCA 1UG2A 4PSXA 3AHUA 4X9CA 2R7VA 1TLHB 3VYHB 4D5CA 2PQWA 2QI2A 2DMTA 2Y48A 4W1UA 5JI6A 2EJ9A 3HOTA 2D5VA 4A5MA 2YU3A 4M3EA 2GLOA 1UJ8A 1N77A 4ASNA 5GJVB 2DOEA 1A5JA 5LRRA 4V19K 1ITYA 3G71Q 4I02A 4NQWB 1XSXA 1I27A 2JMWA 2LVMA 3LSGA 2PN6A 4M7AE 4PJOA 1X3UA 2SEMA 2P0KA 1T95A 4JPBW 2E71A 3ZMUA 1RUNA 5DLQE 5DUKA 1PUEE 1VA7A 5D8KB 2W25A 4OU0A 4MFDA 4B43A 4C0GA 1M8VA 3GW2A 3I56T 2KT8A 2OCCH 3GLXA 4ORZA 1IUYA 5DCMA 4XTZA 4RTXA 1NJIC 2PEXA 1K0SA 2IBDA 5L3CA 2ZPBB 2ZZDA 4I0AA 4FU6A 3EPZA 2K4JA 4DA4A 1KD1R 3CCLT 2B63J 3CC7Q 4C2UA 5GAN5 2ZPFB 3GPLA 2L89A 2CQNA 2O7OA 3G4SI 2VOOA 4S0HB 1LB2A 1D5YA 2EV5A 1ZHIA 3CCMQ 2KIQA 1R71A 4X1VA 2DQRA 4EJUA 2NVUB 1EFNA 2O9SA 5HKCA 2ME0A 2JWTA 2VGMA 4M74A 4ME7A 1B1BA 3PQKA 3CMAI 2RQWA 3I64A 1BR4A 4XU1A 3FBNB 3LSMA 4OAZA 4CCOA 2Z2SB 2OPTA 2XPVA 2KR3A 3A03A 5E1ZB 2Y75A 2OD5A 4QIWN 1FXXA 4L0ZB 4M6VA 5CJ9A 3X28B 4NC8A 1WGXA 2DETA 3ABMH 1YJWI 2V8KA 2P84A 5IN1A 2E5QA 1QVGA 2F5EA 1IREB 4M7AD 2WAEA 1T56A 3VS5A 2FOKA 4LG3A 2FBKA 2ELJA 1XGSA 4HNTA 2BKDN 2DJZA 3MP6A 4IO9F 4E47A 2LTPA 2K6DA 4XMYA 2Q1ZB 3I55A 4ZJZA 3S16J 2XDBA 2RN7A 3FEOA 1MBFA 3H41A 4KT0E 1MDMA 1F4KA 2VBWA 4Y7NJ 2X85A 2AK5A 2R7XA 2VC0A 2KDSA 3EFRA 3JCMc 4XLAA 4FCYA 1WJQA 2RV8A 3DU5A 4A3DJ 1M27C 1X1PA 2I0NA 1Q86C 2E60A 5HDGA 4A12A 1HDDC 4U7DA 3SDZA 5GANg 3FWEA 1KU3A 1VQMI 1HKQA 4QW2A 3VS4A 2R7TA 3V4GA 3OBYA 3I35A 3KEQA 4OP0A 2RDPA 2A69F 2GA2A 2MBFA 4X1EA 4EJVA 4ZZLA 2JJ7A 2EQUA 1AWCA 3OYYA 3HL8A 4OGCA 4AFZC 5J4VA 2EINH 2R7DA 2NYXA 3ISPA 5IHKA 3G6ET 3JCMP 1VQOI 1W5CC 2AHQA 2EIJH 2BE7D 1LUJB 2DF6A 5GTHC 1QLYA 1UTIA 4Y52J 1FWZA 1FEXA 2QQRA 1QQIA 3H3ZA 3L2ZA 2X4HA 5GAOm 2XSJC 1VQ5A 2X48A 3H3UA 1GVDA 3FDRA 4XLFA 4RTWA 1TTHB 1E2XA 2NUZA 3K1MA 2J7IA 3NTIA 3SHFA 4BQAA 2KFDA 4RTTA 2E3HA 3U23A 1JE8A 4GLKA 4HCCA 3WTVC 2ROLA 1Y8RB 3G1LA 4JQFA 4A5NA 2KK4A 2BTTA 3EG9A 1SG5A 2BZTA 2DYIA 1ZSZB 4A6DA 4J9GA 1G3YA 1QNTA 2KVQG 4KGXB 3OW2P 5F1JA 4AYBN 4BL0B 1SHFA 1KG1A 4BE0A 3HHTB 1S1NA 1YN8A 2DT7B 1K6YA 2HVSA 1AZEA 2EFQA 1HW1A 1S8NA 3L00A 4EGYA 1YTYA 2EFIA 4LMYA 5FLXK 1Y1VJ 4IHYA 3RTRA 4PK4A 4EM0B 4S05A 2M0YA 4ATOA 2TCTA 1VQLA 2HNIA 3ZMDA 3L2CA 4RDUA 3T8RA 3BQZA 1TC3C 2A36A 2D0QB 4FYVB 2G7UA 3QWLA 3VUZA 5GAMe 1K73C 3BLYA 1V29B 2QGFB 5FWCA 3LA3A 1ETXA 3PO2J 1SVMA 2DA9A 3HHGA 2JVGA 2KXCA 2YRDA 1M90C 2ZXHA 3H35A 3LQQA 4HYEA 2CJJA 1VQ5Q 5LGNA 2X51A 3KIOA 2CP7A 2KHMA 2XRLA 3SEQA 3CC2Q 2QLZA 1WXTA 2H8HA 4DGWB 2E70A 4PJOF 3KBGA 3TCJA 2I10A 1RI9A 3QIIA 2LJ1A 4ENNA 1IRGA 1RC9A 3B6AA 1IB8A 1ZX6A 5C3EJ 5C44J 1PNJA 4UY8I 2GXBA 5CAIA 1FBUA 1WVRA 3QPHA 1HDPA 4FE7A 2UWMA 5L3EA 4IUQA 5CIUA 2X1DA 3L2QA 2FRWA 3D5SC 2HPMA 1MBKA 2FXAA 2VQHA 2JNGA 4C8QC 1OYIA 3FISA 1R1VA 4A2UA 4A3LJ 1UB4A 5LHIA 4CCJA 1JKPC 1OYXA 3X24B 3IAM2 5GAMd 1OCTC 4FE4A 3BOQA 3G7ZA 1WJEA 2A08A 1QVGS 1IO2A 1Z0XA 2V1XA 2CRGA 3LAPA 1RESA 1HQCA 2PBIA 4M9SA 4YEJA 2F5VA 4H4KC 1ODDA 3P9IA 4J6WA 1UAAA 4EDUA 3HOSA 3K2AA 1RI0A 5J40A 4PJ0C 2HDDA 4BBSJ 3H0IA 4M78B 3I55I 5LJ5h 3X26B 2GIVA 2MC4A 1ETVA 1SSHA 3BR2A 2M87A 2W82A 4LK1F 2KRFA 2LJ3A 4E4HA 2NWMA 4IURA 2XU8A 4JJDA 2FG0A 1XPXA 1Y57A 3BWGA 4AC0A 2J6FA 2JPCA 3DCFA 1IN5A 2FOWA 5ILUA 4F7UA 1OQYA 3FKJA 4YIRX 2WB1A 1AWOA 1TP4A 2ZFUA 1XJWB 2PVGB 5E3NA 3S93A 2EQKA 5CK9A 5L3BA 1W5TA 3E1SA 5DM7R 4MEXF 3IH2A 1HC8A 3E7LA 4XNFA 3UNGC 1R5HA 2UV1A 3HSRA 5FROA 3H1CA 1U8BA 3GOXA 1TUDA 3A01B 2V9KA 1QVTA 1YWPA 3DLLA 3W2WA 5FGMA 2G9WA 1IDZA 2ZCWA 3AG1H 1YX5A 2V8IA 2W48A 1ZAOA 3FDYA 1PKSA 5J26A 4EMKC 2NOGA 4AVPA 4XN0A 5K7FA 1E3OC 3PM1A 2CSIA 2PFBA 2LQWA 1KHIA 2P8TA 1XTAA 4PJJA 4KIGA 1VQKA 2M9UA 1AOYA 3MWMA 1YW9A 1YITA 4EJOA 4IF4A 4LFUA 1GXPA 4M7DA 5JR3A 2NUTB 5GJWB 2L4MA 2PZ1A 2DQLA 2MYSA 1B72A 3LWFA 4Y17A 4D9JA 3FMSA 1U9OA 1T0HA 2LNVA 3NARA 1SANA 2JOYA 4LD5A 4QTRA 1U3EM 2IT0A 4C9YA 3M1EA 4EQQA 4GYGA 2HCKA 4Z2YA 3RKXA 2X4JA 3M56A 2M8GX 2QK0A 4J9FA 4XTVA 1VQ7A 1T2KA 3GUDA 4E70A 4U0WA 4M77C 3JCMd 5L23A 1WHKA 1VQLI 4UNOA 2L9NA 1NEGA 4OMNA 5IOZA 2UXXA 4BYYA 3PIOF 1HA8A 2F2WA 4M78G 1IGNA 1GCQA 5CKFA 2FBHA 2K9SA 3M8EA 3SDBA 4CYCA 1R9TJ 1DPUA 2R5MA 3M7GA 3CP2A 4JP0A 4DJAA 2RI2A 5LJ5f 3L1AA 1OISA 1B8IA 4NBQA 3CC4I 1QW1A 4F92B 2RI3A 1KU7A 4DEYA 4RUGA 2XIDA 2HGCA 2Y31A 2QBYB 2P0TA 2IW5A 4MTDA 1H8AC 3HPWA 2LBFB 1V5FA 3ME9A 2E34A 1HKSA 4RA2A 3X2QH 4M75F 2OF7A 3LSTA 4G6TB 3U1KA 5JFRA 5LHGA 1VQKQ 1ZTRA 1SVLA 2EWNA 4WCGA 3VYTB 3GFIA 1TOVA 1BM9A 5LJ3f 1A0NB 3D5RC 2OJED 5CVRA 2DVEA 3M57A 1K9MR 1QZEA 2COMA 2IEKA 2R7QA 1MMNA 6PAXA 4PCQA 2RA2A 3DTEA 2HVQA 2V8JA 3PMIA 2KRSA 5EC7A 2L5QA 4A0YA 2CQ7A 3ZMVA 4M3GA 4ZTJA 1ZBJA 5DY9A 3HOVJ 3GFLA 1PHTA 3MFKA 3WU0A 1ETKA 2V9VA 2SRCA 3CF2A 1BI3A 4G6QA 3O6BB 2STWA 1O4XA 2IPOB 3QBYA 3KZIC 2DMPA 3S1RJ 1ULYA 3OYJA 2PUOB 2GFAA 3S8PA 2ABLA 4OMOA 1W7PB 2XD0A 2A0FB 2X9DA 4IOCF 4R8HA 4E7HA 3QP5A 1KSWA 4QPOA 4MZTA 2XAGA 1LFPA 3HTSB 4JX6A 1WPYA 5HS9A 5IXFA 1WJBA 1WJFA 4FTHA 5CLSA 5KYXA 4IQ4A 2CP0A 1GLNA 4UV9A 2CGHA 3MMYB 4G7HF 1U0JA 5L8RE 1VQPQ 3OS2A 1W2BA 3GZ5A 1XOVA 2DA2A 3SFMA 2VXZA 2O8XA 1QBJA 5D5VB 3CC4T 1NLOC 3HOXJ 5BPDA 2I5UA 3M4OJ 2OTJT 1D1BA 1D0ZA 3ZMTA 2E12A 1EIFA 2VWFA 1WA7A 5HK0A 2JVHA 1WFXA 2KISA 4KA4A 2CUBA 1EH6A 3CCVI 2HAXA 2KP6A 1U5SA 1YNZA 3MEVA 1JO8A 3KPHA 2HTJA 2RAEA 2YPRA 2XC7A 1NG7A 5H6RA 2HI3A 3HOYJ 3JAMR 4CSWA 1P4XA 1VZ0A 1NLPC 1AHDP 2DDBA 2FU4A 3S3OA 4LDVA 1XNIA 1R1UA 5CKEA 3JRZA 1C1AA 1XX5A 2G0EA 3PQJA 1SEMA 4F7UF 2IAIA 1XGOA 2YX7A 2XG8D 3C94A 5KYYB 1J59A 1QQJA 2V7FA 3EG3A 1ZA1B 2K27A 4BAYA 2ZSHB 5FB2A 1YITI 1SEUA 3GYHX 3CPFA 4U87A 5DD8A 1BYMA 3SYTA 1IJWC 3VS3A 1M5Q1 1PKTA 2QEXQ 3QZ5B 1F9NA 4IHVA 2LRQA 5D4RA 3F72A 2ZMEC 3E9FA 1VQNT 2VL8A 2EFNA 4RGRA 4CXFA 1N75A 5F0HA 5GAHJ 1NK3P 3PO3J 9ANTA 1CKAA 3OOUA 3DLLF 2YHTA 4KICA 3OL4A 4LLLA 2E19A 1UJYA 3QHSA 5GAOq 2M2EA 1XS9A 1NHAA 1OCOH 4YTLA 2DODA 3FXQA 1MJAA 1VQ7I 2QSHX 4LDUA 1I39A 4P5NA 3QJ6A 4ELZC 4JJNK 3C1DA 2VV5A 5CKBA 2IVWA 1TTYA 3KE2A 2DAQA 1YJ9I 4M7DF 4LN2A 1YQAA 4Z02A 2I2LA 5DV5A 5J3LA 2NVQJ 1NPPA 2PG4A 1D1CA 4M9XA 2X1CA 1PCXA 1WHGA 3CCUI 1Z21A 2CQKA 3F3XA 3TOAA 1T0JA 4FISA 1FIAA 1RLQC 4LIVA 1M1EB 3PSIA 3U21A 1NZ9A 2RO0A 4KUIA 3DPTA 5JLXA 1ACIA 4M3FA 1RKWA 3JB9J 1KD1C 2JN0A 2D1VA 1WI3A 4XN3A 2RQVA 3HYIA 4KYWA 3CQZJ 2IA2A 1UB9A 5B3SH 4OMLA 2Z3YA 3M53A 5FKLA 3QDFA 4ZYDA 4PJMA 5TISC 2FEZA 3EH1A 3MQ0A 3PNYA 1X2KA 4DYQA 2ZO4A 1LEAA 5ECAA 2DOFA 5FLXZ 2H8RA 2QUFA 1ZQ3P 3S32A 3JCUC 2Y0SA 3QPLA 1XMKA 4YELA 2R7OA 1VQ6Q 2KIFA 3UWNA 4HQMA 1LDJA 2LNHB 3SEZA 2O6GE 4IKFA 2VYTA 2XKOA 1G3SA 1T39A 2GXAA 3J7AO 2DL5A 3LSKA 1AEYA 3HG9A 3F8MA 5FFXA 1ZBXA 3REBB 3FLGA 1AHJB 4M75D 2JUGA 2Z1DA 4JX4A 1YJ9T 3DV8A 2JTEA 3GWZA 3SWNB 2GQIA 4XLHA 5IP9J 1G2HA 3CJRB 4AG2C 2M9HA 2CQXA 1ZSZA 4XRSA 4B3AA 3RPQA 1NYGA 1BI1A 1QHGA 2YUSA 5CQEA 1M1FA 1X2QA 2KT1A 4EMHA 1RETA 4JK1X 4HDVA 1SPKA 4E7IA 4RLFA 3I0TA 2K2MA 3LH5A 4RB2C 3FC3A 2DEUA 2F6CA 1G4DA 4PJOC 1FIPA 3GEZA 3PSFA 4XAXB 2DPUA 5CR2A 2OQGA 5A2QE 3ULQB 1OULA 5LD2C 4WTOB 1JGGA 1RIOH 2NVXJ 1GFCA 1X01A 1FP2A 1RLPC 4OB1B 3GTGJ 2LQ8A 3HOUJ 5KYUB 1MW7A 1K1ZA 5GAMj 2XKPA 1IGUA 2HOAA 4OMQA 4YIIA 4RCCA 4R1HA 3JRBA 1FOKA 3HP9A 1IGQA 4LDWA 3J7AY 4GDFA 4HF2A 1U3OA 2RQPA 2O8KA 1K83J 4EV0A 3CMET 3WHCA 2RNGA 3CMYA 2COWA 5D6WA 1OU8A 3JCMh 2XDDA 1E6GA 2W24A 2KRHA 2DOAA 1M3CA 2DZ9A 2P7CB 2FZKB 4QVZA 2DK5A 3TO6A 1K7AA 4CUGA 4D8DA 1Q81C 3HEFA 2E1NA 4DW6A 2L2OA 2KI7A 3DB4A 3DEUA 4XTYA 1G83A 2VB6A 1QVFS 3CBOA 3F21A 1KU9A 1EKEA 2NS7A 2LCSA 3D5LA 2DL4A 1WGSA 4OWRB 2Y9YA 2HU9A 3CCRA 1UZCA 2EYQA 1BA5A 1HD3A 5LGUA 1M30A 4ZC3A 1BBYA 5GAN3 3OW2A 3Q5FA 3ZGKA 3OV8A 3T9NA 3PIOA 2L7KA 3L9FA 5HLGA 4BXUA 2WWYA 1BJZA 3OA6A 2KRCA 4ETSA 1S7AA 2MD0A 1TT0A 2MA3A 2EJRA 2W7NA 2XRNA 1GUUA 4UB8C 3BTJA 1K61A 1HSQA 2GGRA 4HXJA 5KCOA 3CCSQ 4L5EA 1UELB 3KUFA 5I21A 3ZQLA 3SZTA 5AIQA 1XMAA 4E7JA 3CPWP 2RREA 2O3FA 4M78A 1OJLA 4KDPA 1MV0B 2M5WA 3IUOA 1HKTA 3HRMA 3NFCA 4WWCA 5K5QA 3H8ZA 4AIDA 4F16A 3BDLA 5IHNA 4Q48A 2QKLB 4L5IA 4E7KA 2CYZB 2EFWA 4HVWA 3SD4A 4M73A 2QDLA 1W36C 2EVRA 5HDNA 1Z77A 3MCZA 3LQRA 2W10A 3A0HC 1W6XA 1I3QJ 2M35A 1PC0A 3KYDB 3WHBA 2ZSIB 1WHMA 2DXTA 3I56A 3M0QA 2Y69H 2J06A 1FPQA 3K2ZA 4LXCA 4QVDA 2BVMA 1KGSA 4EPCA 2E1MB 3LSJA 2LX9A 5HOOA 3JR9A 2GM4A 5J1YA 3A01A 5FLXR 2DT5A 4IUPA 3S6WA 4AYBA 1EV7A 3M8FA 2W84A 1C0WA 3JCMf 3JREA 4MZMA 1TBXA 4UVAA 5IYCJ 3CCJT 3CCLA 1H3ZA 4XM3A 3AKZA 5KNLA 1K8AR 2HYFA 1XCBA 2JK3A 2J6OA 1WH5A 3IWFA 2CKKA 4E7SA 4L6V5 5KCMA 1K6OA 1N27A 2WSEE 1AKHB 2QQ9A 2OJ2A 4B6MA 3TDUC 4GXOA 2NUTA 3MN2A 3SZGA 4IUVA 5CPRB 1OPKA 2VXDA 4DYCA 3GMEA 2K3YA 4KH1B 1YHQQ 4C92F 5AT1B 3VS1A 1Q7YR 1OCCH 2HQEA 1PJRA 4M75C 2JA7J 4XLPF 1Z9CA 2RM4A 1ZYRF 4RCBA 1H88C 4HAMA 2KJCA 2AXLA 2XPUA 4J19A 3S2DJ 3CD6I 1WQ7A 1YJNT 2D6FA 3RR6A 1OPCA 2CMPA 4ENJA 1M3AA 4A3BJ 4LDXA 3VWBA 2FZGB 3I9QA 2KAFA 4G8XA 1HK9A 4IHTA 1MH4A 2KMUA 2F4MB 2VQLA 3A02A 3LMMA 1Y0UA 2G7HA 1WHUA 4PUSA 5J6XA 1RAEB 3A98A 3FIFA 2MOXA 1D1AA 3QYBA 1Y0NA 4PKCC 1Q7YU 2HQXA 3DLMA 5J1UA 1G5VA 3SHWA 2FMLA 2QBYA 2ECCA 3FIWA 3R61A 2FHDA 4ELYC 1IN4A 3D1NI 3S14J 4L18B 4ZDOA 3UATA 1W1FA 3W6JB 1MNMC 3C0CA 1S6LA 4JS5A 1F5TA 2IGOA 1MNDA 1LNWA 3G4SA 4C30A 3WTUC 2HDCA 4L9NA 5FD5A 3JRHA 3CZ6A 3CCRI 2JJ9A 3VS7A 1XGNA 5LEKA 1J7KA 1UG0A 3OW2S 4LNPA 1FBSA 2DRMA 1ZG5A 1KA8A 2F48A 4JRIA 1YIJT 3AL0C 1REPC 1XQHA 4DYRA 4C0DC 3F0CA 1VYVA 3A8HB 2ZJ2A 1VQ9I 3RUXA 1N8RR 3GO5A 3S15J 1W7PA 1SSFA 5LJ5e 1FTTA 3GF5A 4NOYA 5BPIA 2DAOA 1JGSA 1LVAA 4A4HA 2R93J 4OIOF 1B3QA 2DIGA 3F70A 1YJWA 2EQIA 3CUQB 3HZJA 2BHYA 4Y33A 4BY7J 3QG1A 3LSRA 5M5YJ 5FU6C 3JW4A 1ARKA 2LREA 2VE9A 2FYKA 1H92A 5IT3A 2NS8A 3BP8A 2GBYA 4O3MA 3OR1C 3MZYA 3RKWA 2QQBA 3E6CC 3WVDB 4F93B 3CJTB 4U0VA 4UUVA 3GTKJ 2IIMA 4R79A 1S29A 2I8DA 3FXRA 1MKMA 1LEBA 2R57A 1Q82R 2KXDA 3OYMA 2BYVE 2M3AA 4LJZF 3GTQJ 1M2VB 5HDKA 4KRTA 1K9MC 1Z3YA 3CCQI 3FK6A 4RKUE 3WGIA 1PWTA 3O2PE 1U1SA 3ABLH 4OMZA 3SFZA 4N0BA 2M0OA 3M58A 3G4SQ 1JT0A 3I56I 3CO7C 2MVTA 4M78F 3DBHB 4IQJA 4JS4A 1IG7A 2TRTA 2DA7A 4C3IJ 5GAGJ 2DO3A 5FW9A 3E6DA 4J01A 1RABB 1Q82U 1V3FA 2P0PA 4C8QE 2EKHA 4I76A 5J4YA 3CCLI 2O01E 1KU2A 1OZ2A 2RH2A 1GBQA 3EUHA 3V7SA 4A0XA 1R00A 1X3WB 3B6CA 1MJ9A 3CDHA 2DMQA 1MD0A 3E3VA 3KP3A 4O6JA 1OX9A 3UF4A 2K9MA 1Z9QA 3CJQB 5F64A 2BZXA 3FXOA 5LRSA 3ZPLA 2GTJA 1LQ1A 3A2KA 2YUQA 3N97A 4J6XA 3BG3A 3Q0UA 5CQGA 5HLTA 2F69A 3IQLA 1YJWQ 4BUPA 4II1A 1GL5A 5LJ3d 4W97A 1ZA2B 2E1OA 1JJ2P 2WV1A 3OOPA 4KMFA 3DQVC 2PUKB 4M4ZA 4E6KG 1JT6A 1ZRDA 2PMHA 2GZWA 4CA0A 1MBEA 2VBXA 2QCOA 5F08A 4AIKA 4ZGDB 2K3PA 1LPLA 2C0TA 1RUWA 4ZTFA 3EGXB 1GCQC 2VUMJ 3EAEA 3BG9A 4ZN1A 5KYWB 1ZRFA 2F4IA 2ICWG 5GAMg 3ESWB 3ABUA 3CJNA 3EG2A 5GAN7 3CCQT 5CKDA 1VQMQ 2L3DA 1YG2A 1PSFA 2ESHA 5ICEA 5EZHA 1X3ZB 2STTA 1KQSP 2OTLT 1R23A 2BY3A 4IL6C 3TOBA 1TW3A 3J81K 1MHNA 4ZYGA 2XF5A 3MKDA 1JEGA 2FUG2 4Y15A 2XB0X 1DP7P 2KE9A 3PFSA 1VQOQ 3GFMA 3RKYA 2BGCA 2DFIA 3IH4A 4C8QD 2VI6A 1JBMA 5E8IA 3KETA 2VLAA 3AFHA 5M9OA 4HX4A 1TWCJ 2DERA 4II3A 1S72T 2HBWA 5LLQA 2L7ZA 4ZDPA 4A53A 2CP6A 4HCZA 2K5LA 4V2GA 2KZVA 1OCRH 3ER0A 3TU4K 4HNVA 5CQXA 3G6EI 5M3MJ 2EB7A 3G1OA 3KP2A 3OSFA 1GRIA 4IUTA 2P5VA 3TSWA 2CREA 1RR8C 3REOA 4N4NB 5D4SA 2R7ZJ 2K9QA 1SRMA 2XICA 3WU1B 3RMSA 2IS2A 2YUPA 4WXDA 4B47A 3ZFJA 5A0LA 1K4US 4M3DA 4B44A 2KQRA 4BQQA 2KIUA 4IEJA 5TGTA 4BHBA 1BCMA 2QZ8A 2D9TA 4HVUA 1HLVA 4AFSC 1Y96B 4BACA 4AWXB 4YIFA 4HKEA 4XIDA 1N9SA 3RIRA 2Z33A 2G6FX 4M77E 2EV6A 2HKNA 2VXFA 2P6SA 3M9AA 2VC8A 1X2MA 4HNUA 2B0LA 2VJIA 3CUOA 3E2UA 3SWNA 1VQ8T 4G94A 2IG0A 3JB9G 4Y91A 4BHCA 5GAN4 3RNJA 1I0CA 1U06A 4KBMB 4EJWA 4BEHB 4GY5A 3L2UA 3FXLA 2DJQA 5CVVA 1WJ5A 4OMPA 3RKQA 3F8FA 5D5WB 3A52A 4JRKA 3JCMX 5GAN8 4XLEA 2D45A 5E17F 3OSSC 2WY7Q 1HXDA 2YRVA 3T0YA 2QA4T 1DQUA 2XIGA 2VQGA 2MPXC 1T0FA 2BY0A 3ZQCA 1UJ0A 2JUFA 2RJEA 3FX3A 3GNFB 1B7TA 4U7BA 3ABKH 2KQWA 2JT1A 3QP6A 1I6HJ 3PUFA 5KYUA 2JRMA 1A35A 1X69A 3ECHA 1D5VA 4A3GJ 3EFOB 4A4FA 1PVEA 1WJCA 1BC8C 4I01A 2CZ7B 4PL6A 4CCKA 2FBIA 1CGPA 2QSFX 2CP2A 5HVQC 2A6EF 2PLYA 1BJAA 4RG2A 1IC8A 3VDXA 3R4KA 4J9IA 4XRMA 3HRUA 2M4GA 3CP8A 3SDGA 3HRSA 3S3MA 1XTDA 3MCAB 4RB0A 2WSFE 3BDDA 3IKVA 4KUMA 4XOPA 5EDNA 2IGKA 4M77D 1NE8A 3BR0A 4MTEA 1IRZA 2PVOB 2W85A 2MABA 2QYOA 1JHFA 1OFCX 2HEQA 2HR3A 3I55Q 1WJAA 4B48A 3LAJA 1B59A 2K7LA 3QYHB 1D3BA 4BE1A 3BW1A 2F5DA 1ERDA 4C8QB 3EYYA 2BUDA 1MBJA 3EUAA 5DTDA 2C0OA 1P92A 2LZ6B 1YI2T 4PNOA 3QKJA 2VC1A 2XAFA 4BY6B 3ZQGA 2V1QA 3ASNH 1OV3A 1T98A 2L9RA 3ZN1A 2ZXJA 4PFPA 4XSZF 5D8LB 2EBPA 3LX7A 3VJPA 1GVJA 3J80E 4KIBA 4XBFA 4MMLA 1IHWA 2DA3A 5HS7A 4CGZA 5C4XJ 2MH2A 5DD4A 2XVCA 4HX7A 2XDPA 2ZPHB 2R92J 2UUZA 3WTZA 1RADB 1UHCA 3CC4A 1YIOA 2OTJA 3MEAA 1ZLKA 1ABQA 3E0JB 1Y1WJ 3HKZA 3JRIA 4XTWA 3K1PA 3DEWA 1ZG3A 3EHRA 1RUOA 4FW1A 5IT9E 1XMXA 3LW5E 2OU2A 2AO9A 3VS6A 4A6EA 3K7AJ 1VQ4I 3EYIA 3G71T 3T5XA 4CDGA 4IZZA 1R5ID 2EIFA 4M7AB 1ON1A 1DDNA 1ABOA 2RHYA 5IAYA 3JCMb 4L9VA 1QCOA 1VYUA 5HK3A 2EQRA 2ZJRF 1DUXC 2EPDA 3BC8A 3L2VA 2RNAA 4HT9A 1XD7A 4WX9A 3SZPA 2VOPA 2F1LA 4C92C 1STZA 3H9QA 3WODF 3TW7A 1IUFA 2KIMA 3QAHA 3GF2A 4MQ9F 4BDYA 3WU2C 1PRLC 1KIKA 2XKOC 2RGVA 2DFUA 2LKPA 1X2NA 4HBLA 3H9GA 4HV5A 3RPUA 3I5SA 3G1MA 4J7IA 2JA2A 3DLAA 3C4SA 3ZQ7A 5GAOp 1HJDA 5L3GA 3ULRB 4LB5A 2UZKA 1YW8A 1RQ6A 1XN7A 3ZOBA 4EMKB 2IA0A 4BJ5C 3CC7T 4ZH4F 2EYZA 1ZSZC 1VQLQ 1BL0A 1VQNA 1MGQA 2EGEA 4IJAA 3NRVA 1YCSB 2YSQA 2LT1A 5H20A 2IXSA 4JJBA 1LPQA 1AKHA 3OYCA 3CPWA 2LTOA 3CCMT 2H6CA 2ZKZA 4OIRF 5LGTA 1I8FA 1YBYA 4UUTA 5CCAA 3CXCP 4BH9A 5JHUA 3CC4Q 3J7ZI 3E97A 3E5XA 1ZUYA 1YJWT 2OTJQ 1K79A 3CCET 2EIKH 2L8DA 2XSDC 1FYLA 3PUBA 4D7MA 5TJJA 1S7OA 3HTRA 2VN2A 2IRFG 1EZZB 5B5EC 2FE3A 1M1KU 3BT9A 1YW7A 3CCVA 2OA4A 2BE5F 4L5JA 1A31A 4C2TA 3A0BC 2K85A 5LJ3h 4HSTA 1KQ8A 1VQ4T 3JAMZ 2CUJA 4KGVB 3ASOH 3F23A 1ZKGA 2FNAA 4MHGA 4BBRJ 1UFFA 3VRZA 1KC8U 3FM5A 3JCMe 4IIOA 4RTZA 3UT1A 1R6RA 1X6GA 1D09B 2X4YA 2DJIA 3M4YA 2A07F 3J7AF 4EMSA 3C2HA 2NVYJ 2IGNA 5DDGA 1YFHA 2CFXA 2DTZA 2JTVA 3PJRA 4ESBA 2MC3A 2ZXIA 1YITT 5EG0B 4RS8A 4OIPF 3W3CA 1Y07A 3FXUA 1K8AC 5FRNA 1BIBA 1B4AA 4BXFA 1QP2A 4M7AG 4BJTA 3L42A 1JUMA 1KYZA 1MBHA 2F5FA 2A5YB 2QSGX 1QU3A 1FX7A 2XAHA 3Q9VA 4Y4RA 1Q95G 1SRLA 2MAMA 4RLQA 4PJOG 1Z1DA 2ED0A 2P4WA 2QGGA 3A8LB 4N9HA 3TMOA 2WSCE 2UXNA 4C5HA 2LYCA 3ZN0A 3QYFA 1YP5A 2PNIA 3E6BA 2ATCB 5GAOn 5EEHA 4U0YA 3I54A 2MFZA 3CESA 1HSTA 4CCNA 1QA6A 3JRDA 2ENMA 5D6EA 1K4TA 3LH0A 1Y56A 4JLGA 3ERMA 1H8KA 2LDMA 1VOMA 2E6NA 3OMGA 4RB1A 1FLIA 1IV8A 3R6NA 3CCVQ 5LJ5j 4PJOE 4M78C 1YJ9A 3M3YJ 2LY2A 4OB0B 1A04A 3TQNA 2G3RA 3DWLE 2Y0MA 1IN7A 3CUQA 4Q4ZF 1X19A 1I1GA 2ZFWA 1X27A 3HUGB 2ADUA 4UC4A 3HXLA 3CCUA 3J80K 3KLOA 2L3RA 4JDSA 2OTJI 3ML6A 1Z6RA 3OYDA 1KK7A 1UHWA 4GRIA 3SB2A 3CQTA 2LG4A 3OSVA 3QPSA 1TQMA 3OS1A 2KDOA 3FMQA 4FW2A 1AWJA 2EFPA 1Y71A 3I5RA 1IRFA 1VIEA 5BMZA 1Z91A 1AZGB 1M2VA 4CRIA 1YITQ 1ORKA 2EZHA 5ILVA 2YUNA 5DCFA 2F5KA 8AT1B 2HXOA 5IT9K 1S5LC 1TW2A 2BW3B 3LGFA 2K9NA 5DM7F 1DU0A 3TEDA 2JTMA 1M1GA 2MIOA 2MH9A 2VPRA 3OR2C 4C5GA 1YX3A 3I71A 1QO0D 4A3CJ 4J6YA 2M51A 2JA6J 1PSEA 2OAZA 2IP2A 2EH3A 3ZQIA 1N8RC 1VQ7Q 3GIBA 1X1DA 2XPWA 4JOMA 1ENHA 2PU9B 2WAQA 3ZR8X 4ABZA 2RJFA 1VQ5T 3J81Z 3FM3A 4JBAA 4HV6A 2RB6A 2RMOA 3SEMA 4UB6C 3CC2T 2JQ7A 1VQNI 4AM3A 4J9HA 1R58A 3WTSC 3H5AA 1YJ9Q 4PJOD 2K5FA 3Q3SA 2BBYA 4UUSB 1A6IA 1QPIA 1QP3A 2XAJA 3CPWS 1J09A 2AZVA 2P5LC 3S2HJ 3MPUB 3LSHA 1R0BG 4BU2A 2HFHA 2L0AA 4B3XA 3CCUQ 1HOMA 4DEXA 3GBQA 2DN0A 2ZMEB 4IXAA 2KNBB 4FSSA 3BZCA 3QRFF 1X6BA 3PNVA 1B34B 4HF1A 4KFCA 4LK0F 3C12A 2ECBA 1QWEA 4EIKA 3EGXA 3OS5A 1MMDA 2FJ1A 5J8CA 3ERED 4YFKF 2X4WA 2Z99A 4NQWA 1Z6TA 6AT1B 4AIHA 5D7UA 5GP9A 2ZNYA 2M7BA 4C3JJ 1FJLA 2X98A 2MLKA 5KYWA 1RNLA 2RK2A 1OEBA 2MWPA 4C8QG 1LOJA 2RHXA 2EYYA 2QQ8A 4B9WA 3M54A 2KL4A 5K7HA 2HBPA 5GPAA 5BQTA 4OB2B 3D0SA 5HNFA 4FT4A 1RAFB 4HF0A 3BZ6A 3A1PA 1RPWA 1WI9A 2DYSH 1O7FA 2KYMA 3M4GA 5KH6A 3OL3A 4EVIA 4WK8F 2OC6A 1HW2A 2E10A 4IIMA 4MQVA 2VODA 1TS9A 1QKWA 3A8MB 4QSHA 3P8BB 3IC7A 3HJEA 5E8GA 4B4CA 2AZSA 4UVCA 2QGUA 2MGQA 3S1QJ 3NGPA 1MGTA 5JVGF 5B1BH 4LUEA 1BU1A 2HVRA 1NM7A 1H3HA 3LL7A 3GZNB 3S1NJ 3TW6A 2ACJA 1UGPB 1KJWA 2COBA 4RMNA 1UEBA 2FRHA 3C95A 5KE2A 5KK1A 1BIAA 1ETOA 1APLC 3O8HA 3WG9A 1SHGA 2CFOA 1VUBA 2DILA 4K11A 9ATCB 2BY2A 2OAWA 3MZ8A 1NJIR 2O0YA 5IYBJ 2LLKA 4L5GA 1GT0C 1FSEA 2PMZN 2RQRA 4M75E 2RVCA 1JXOA 2X9HA 4M7DC 2Q8KA 1Y96A 3G1JA 2H09A 3P9CA 1W70A 3DB3A 3ZMZA 1FOXA 3BJAA 2V26A 3IP4B 4IPAA 3VFZA 1BI0A 1A36A 2VJ5A 2DXCA 5A0GA 1LKXA 1OU9A 5KAIC 2RC4A 1W36D 2K3BA 1TU0B 4R56A 2H94A 3MKZA 3S17J 4AFQC 2YU9J 1VIFA 2L2PA 1F1BB 3K1NA 2DL3A 4AFUC 1FBQA 3M0UA 2DBKA 1KQSA 2VT3A 1U2WA 2K9LA 1BI2A 3RQIA 4EEFG 2M0MA 5J3BA 4ESRA 1NJIU 4FHTA 4BEHA 4KIFA 1JHHA 4OOIA 3VPRA 3HB9A 1BBZA 2EZKA 4L9JA 3JSOA 1PUFB 3GZ6A 3M0RA 2A6TA 2JTFA 1WJDA 1J0RA 2IS6A 2FEIA 2GNCA 4L9TA 2EQJA 2CT4A 1VQPT 2K4YA 5K7ZA 2LRDA 2PI0A 3EFOA 4U88A 4V2FA 3CMEI 4DBHA 3EUHC 2HL5C 3GTMJ 2DLPA 1FMWA 4HEA2 1NK2P 1I5ZA 3K9TA 5J47A 2CWEA 2HDWA 1NYFA 2DMOA 5GMKh 2W00A 2GFUA 4HQEA 2L02A 4M3BA 1Z7LA 2OAUA 3GNGA 1FOYA 5E3LA 2H27A 1Q86R 1B07A 1VQKT 3B02A 3J81R 2ESWA 3DPLC 4F17A 2EA4A 4DZJA 5HLIA 1R49A 1H0MA 1PG5B 2HWVA 1SFUA 2DT6A 2ESNA 2RKHA 3N05A 3KP5A 2GQVA 4HPQA 1BR1A 1QCNA 5CKTA 1FY7A 2CZ1B 3JB9I 4JRQA 3QOPA 2HOSA 5DLOA 3DBRB 3ZQQA 2FZCB 4BGDA 2E36A 4F7UE 2DVJA 4DOZA 3UR3C 2P7VB 4XONA 1M2OA 4CHUA 1Q86U 2LOOA 4CICA 4RGXA 3CD6A 2LDUA 4A3IJ 2CUZA 5LL6S 4MZPA 1K78B 3PVLA 1FMVA 2XGCA 1D8JA 1LFUP 2ECZA 5GAN2 3OYLA 2L01A 1FZPB 3R60A 2XDVA 3IH3A 2XHKA 2ZAEA 2Y9ZA 2R7FA 3JRFA 2RN8A 1JB0E 4X34A 2QASA 2DA1A 3HSBA 2L3QA 1SD7A 2P81A 3TP3A 3JRCA 2KY9A 1TT5B 2LJ0A 1MMGA 3I53A 1KQ2A 3BQYA 3GTOJ 2BEOA 2F5TX 1P4AA 4M7DE 4M77B 4NNJA 2K02A 4P96A 3GTPJ 4M7AA 3QOEA 3WVEB 2DXIA 2KDZA 1GV2A 2E3IA 1TH7A 1JKQC 3VS2A 1T3SA 3COAC 1UECA 4N9IA 4GO1A 2FA5A 1U5TB 4I98B 3CCJI 4KH0B 3FF5A 3BTCA 1YRNB 3LSPA 2HOTA 1OKRA 2MD5A 2HS5A 4F91B 1K4SA 1WIEA 3BDUA 5LJ5g 1M90R 2HXIA 3M07A 2R7RA 2WB1N 1WJRA 2JMAA 1LNXA 4BY1J 1W0UA 3SWNC 3OMYA 2K9GA 3CD6Q 2ISZA 2AKKA 4Y92A 4ON0A 3DFGA 3ELKA 2JXBA 2RI5A 2BZYA 3LWIA 2QEXT 2MUNA 3CCYA 2EAYA 1YO5C 1WDXA 1K73U 3LFKA 3NMZC 1KQSS 3V8KA 2IJLA 1CQTA 3ONQA 2MSYA 1BKBA 2K79A 2RD1A 2E4HA 3QWXX 3PE0A 1KFZA 4P1WA 4DNCA 1R8OB 2M45A 3JCMQ 1T0FC 3EG0A 1X75C 2FVUA 4RTYA 1M90U 1XGMA 3DTIA 1USTA 3LA2A 3WTXC 1YJNI 2V9PA 3OIOA 1Y0MA 2DO7A 1RZ4A 3K10A 4RAGA 2DU9A 1AT1B 4M75B 1W2BP 3H3VK 2GA1A 3CCQA 1MBGA 1E3HA 3PGGA 4J83A 4G9YA 2ZBKA 4M7DD 2DM1A 1TNTA 3CCRQ 1WHLA 3C3WA 2P6TA 2J6KA 1BW6A 4KMUX 2CW7A 3RZDJ 1RAAB 4E7ZA 2GBQA 2MK5A 5GMKi 4MDXA 2ZCFB 1ZN2A 4MEYF 3QPTA 1OI1A 1V1CA 2CU7A 5AIPA 1R7JA 4ESJA 4M72A 5EG0A 1S72A 1O3RA 1JJ6C 1W5SA 3CF5F 5CO7A 3ZL7C 1VQ9Q 2FB7A 2CG4A 4FYXB 4QQGA 2KZGA 3CMMA 2E7WA 4JX5A 1TZLA 2HZDA 2VONA 1L0OC 1QZZA 4A3FJ 5ERIA 2CT3A 3LYIA 4DOVA 5E1XA 5DEQA 2ZPEB 2A6HF 2JPBA 3G2BA 3W6VA 1LDDA 2A61A 1FSHA 2ROTA 2JN6A 3CBPA 3KYCB 3K70C 3HM5A 1VQ9A 5GANf 1E3PA 1YIJI 1NG2A 2CH4A 3CXCA 3JSPA 1VNDA 2HKOA 1SD5A 3M59A 2R7WA 1UMQA 2L7MP 2JW4A 3E9GA 1ETYA 3FJ5A 3REAB 3CMAQ 1R36A 1VQ6T 2BZ8A 1TWBA 3RYRA 3VSKA 1UHMA 1SD6A 3H0HA 1X4OA 5H6QA 4BQNA 1IHVA 1SMYF 1OCZH 2C6YA 8ATCB 4WCIA 5M5WJ 4C0DB 1O7LA 5A2QK 3CCQQ 4OGEA 4BI3A 2L7FP 3A1YA 1OLTA 2BV6A 2DDAA 1VQ8A 2EGCA 3I56Q 3BG6A 5HCKA 2OCEA 3CCSA 1SFXA 1BOAA 2V1UA 3BCBA 1NEBA 2COZA 2L3PA 5EG2A 1G59A 1NTCA 2JVVA 2QA4A 3LLRA 5IHIA 1KQ9A 1O75A 2CSOA 1WYXA 4M75G 5IPAA 2GWRA 2EV0A 2LBFA 5K5RA 1ACMB 2QXFA 3CCLQ 4FYWB 4ZDLA 1ZG1A 2WADA 3A5ZB 5FU7B 2DFFA 1T6SA 2YSRA 1IO6A 3HOWJ 3BG5A 2DL8A 4OIQF 4P55A 4GYIA 5EEGA 1U8RA 2V1DA 5BNGA 4X0GA 2O2OA 1GBRA 1WQ2A 5GTIC 2E1MC 2BW3A 4I2OA 3K4JA 3M0TA 3G6EA 1NBEB 3TQ7P 2X0LA 2HYGD 2GXGA 2LCLA 3PL8A 3K4LA 1ZLJA 3E19A 1RAGB 2QDYB 2XUBA 5CVUA 2K5IA 2CS3A 2KKOA 3NPFA 3TO7A 2CQQA 1U78A 4C5IA 2O31A 3WG7H 2H8WA 5CYVA 1EA3A 3KCCA 4A4EA 2DA4A 2X6WA 2PTKA 4KISA 5AYFA 3NWSA 5DM6F 4FQGA 4M7AF 5GMKl 1SFKA 2BOLA 3K69A 3ECOA 4UUSA 5IXBA 2HL3A 4ZNXA 4QQDA 4JJCA 2JT4A 4FYYB 3GXOA 4H0EA 2E35A 4DBFA 1H9GA 3EETA 2LVSA 4Z88A 1YOVB 4XKVA 1TSFA 1WXUA 2Z5UA 5LJ3e 2W1OA 2E64A 4BJ6C 1OYYA 1YI2A 5FD6A 1B34A 3PMTA 2W0ZA 1ZARA 2OZUA 1EJ9A 1UUEA 4XKBA 2JRTA 1Z9ZA 1RAIB 4G12A 3QXEB 1TQPA 3L2WA 3OQ5A 1V4RA 1WX6A 4NL3A 3CCST 2JUCA 1FMKA 3OYBA 3P8DA 2OTLI 4AU7A 2FF4A 2XROA 1JUSA 3IRRA 2J05A 4P9UA 2RK1A 2ETHA 3M1CA 1B8IB 4KGZB 3G6EQ 4PLIA 2VKNA 3RYPA 2R5YB 2ZJQF 3UKGA 2H3JA 3T1BA 2HQHA 2LT4A 4HCKA 4C92E 3HIFA 1BC7C 3H92A 4Q5WA 2M4KA 5J1RA 3HSEA 1S72I 2WC2A 4DZPA 1OMIA 4HDUA 3HFNA 2VGNA 2JA5J 3FXMA 4PSWA 1QHHD 3O8GA 3CDIA 1G6NA 2ID6A 3M8JA 5ICCA 3A8OB 3J80R 4QT7A 3CBMA 5DYMA 3OWTA 1T33A 4ESFA 1PD0A 1FOWA 2DTRA 5H2FC 4IHWA 1QZYA 1TWGJ 4QQ6A 4JZ3A 2BXYA 5F6FA 3PTAA 2KYBA 2QKMB 4PDKA 3CXCS 1JXSA 3TSZA 1OYWA 5EEAA 1O3QA 2RJCA 2LMJA 3ASKA 3BG7A 3OYAA 5CQYA 2AT1B 3OBWA 2O9LA 4J9EA 4CC3A 3PT9A 5IT9R 1BB9A 1T08B 2K5CA 4M71A 5JLWA 1MUZA 2IVMA 4XU2A 3CUQC 2COYA 4AD9A 3KEYA 1EH8A 2X4XA 1USSA 4FM4B 4HW0A 2JZYA 1MSEC 2EZIA 3RDVA 2R7UA 1ZR4A 1VQ8I 1VI0A 3CCMA 2CUEA 2MG4A 2H1LA 3RBBB 2PX9A 5ICGA 1HYOA 2Y0SN 4N0AA 2CUFA 2K86A 2QM3A 1XG1A 3OYNA 4CZZA 5JHFA 2DK3A 5KCHA 3CCEA 5GAOr 5IOYA 1YHQT 4DBQA 2RQUA 1ZHFA 3LA7A 2QA4I 5FLXE 1IXDA 4IUUA 4C92D 3KLNA 1I07A 1WWXA 3RDIA 1PUFA 1UGQB 3W6KB 4A3JJ 4GCVA 2XMFA 1KZHA 4XK8E 1VQ4A 2OQRA 3ZQFA 3CLOA 2JA8J 3Q1JA 2NNYA 1X6OA 3K0LA 2BIVA 3J7AW 3BY7A 1OPLA 3OS0A 4ZN3A 4CCMA 3EGUA 2DI3A 4TVRA 1FTZA 2J5PA 4LLGF 3VOEA 4YRVA 2O5RA 5C4JJ 1O3TA 4MGRA 4LLNA 1E6HA 1V76A 2CS7A 1WKMA 3IV5A 2RNJA 3OMCA 2KPMA 1PP8F 2RF0A 5I11A 1MH3A 3WTWC 1I81A 2Z0WA 2HSPA 4PFOA 5ED4A 4HRIA 2PVDB 2P4TA 3I4MJ 5FLMJ 3M5AA 2LMDA 4MDWA 2P0QA 2ISYA 2O03A 5F04A 2DLLA 4FASD 4M78E 1NH3A 2A3LA 3T8TA 4AVZA 2VKEA 3KZYA 3C2GA 3G3ZA 4RAYA 5I2MA 1UE9A 2H6BA 4BNCA 5D6XA 3CCEQ 4EGZA 1YI2I 3META 5J39A 1JU5C 3QODA 1IXRC 2AXTC 1AOJA 2DEQA 4A4GA 1KD1U 1X1BA 4J00A 3FHNA 1MV3A 3FMRA 2CP3A 3S3NA 4A3MJ 3THKA 1GFDA 4D1QA 1IW7F 1R4NB 2EFOA 1M3BA 1VQ4Q 3P7NA 3PNTA 3TP0A 4F3QA 3JCMg 4X6AJ 3HBLA 1MMSA 2OZ6A 1K78A 3U1DA 1TL8A 2A37A 3NAUA 3KP4A 4N4OB 2FSWA 2TDXA 1UDLA 3U9GA 4MO7A 3HKSA 4JUVA 2LC2A 5ILSA 4HOBA 4XTXA 3VS0A 4FX4A 4F04B 1RAHB 5KE3A 4LOCA 2BY1A 2VKHA 3R6SA 4AUXA 1ZUKA 2FPEA 3G71I 2NYSA 3DKMA 4FSXA 4C5EA 1QRYA 3WTYC 1HBXG 2PMZA 1Y39A 3M55A 3PIPA 1U9NA 2LR8A 1XB4A 3L09A 1WFWA 3VRYA 4UXNA 2RQTA 3FK7A 2XGXA 4GBQA 1D0YA 1TWHJ 3BY6A 1RRJA 1K76A 4Z8AA 2DMUA 3SFIA 5GPCA 3DKXA 2DNUA 4FT8A 3G4ST 2K2VA 1G3TA 4M78D 1YLFA 3H5NA 2JSCA 4NS5A 4C0FA 2E2JJ 2M02A 1ZELA 1U5TA 2B86A 4C92B 1OX8A 1I1JA 3MHXA 4GLMA 4AIJA 3F8BA 1AWWA 3TO9A 1YRNA 3CC7I 3CC2A 2OUMA 1U6GA 3MKYB 5M3FJ 1VTNC 1EF4A 1OOTA 1SC7A 2JS0A 3CMAT 2FX0A 3VYUB 4D5FA 2MWOA 1HCRA 2X35A 1R4MB 2VUBA 1Q81R 5F0CA 1DPRA 2MI6A 4RM3A 2BVLA 1SD4A 1JI8A 2V4JC 3CCMI 1SAXA 5EJCA 4G7OF 1AD5A 1LCKA 4LDYA 1OZ3A 2X3WD 4N4GA 3Q0VA 4D6WA 5IH2A 2XF7A 4I09A 2LNBA 1QKXA 2PJPA 3H0FA 5KYYA 3FXJA 3CCEI 1YE9A 2MW8A 2E2IJ 1WZOA 4QVCA 2HMAA 3DU6A 2JSPA 3EUKL 2GOMA 4NUBA 5D5XB 1MSFC 4A63B 1LDKB 5LEJA 3RMQA 2DXBA 3A4CA 2F2VA 2HZYA 4HX8A 3JRAA 1Q81U 4M75A 3OSGA 3QQAA 2P4RA 3QJYA 4F7UB 2LY1A 2KBTA 4KUDK 4YFXF 1H89C 4FT2A 3K4MA 3GX4X 1VQMT 1X1AA 3H9JA 3GVAA 5GMKe 3I58A 2AKLA 4E6RA 1IN6A 4HCBA 3F8CA 1OR7A 5FO5A 2VVKA 1R1TA 5A2QZ 2R5ZB 1JXMA 1PYVA 3I4NJ 1ETQA 5L3DA 2QG9B 1VQOT 3WE3A 2F2EA 2DTIA 4ZYAA 5E79C 3BTIA 1TXQA 4O5VA 2VBYA 2WAFA 1POGA 1M1KR 2KRNA 1CF7B 2V6CA 2JMCA 2HQRA 3HGGA 3TDZC 1ZRCA 2YXYA 3M9QA 1WLPB 3NWTA 3MJXA 3VYGA 1KC8R 1UFMA 5LBQA 1FT9A 2DFEA 2L9SA 2PMUA 4LG0B 2HQAA 3ABTA 3EQLF 4NC7A 2GQQA 5FKMA 3RCOA 5J8FA 4E7LA 2E6ZA 3HL2A 4RGSA 3HFOA 4C92G 5ICFA 3AG3H 4F55A 4ZYEA 2VKDA 3N4MA 4HT8A 2VIXA 2DTHA 4KULA 2DRKA 4MNUA 4BY6C 3JB9H 2L4AA 5TRDA 3GLLA 4Y3OA 5E3OA 3GTLJ 3L1PA 2HDAA 3ZQHA 1RKTA 2DJNA 2IPQX 2KJBA 4G6DA 4XK4A 3TGNA 3G73A 3S2WA 2CV0A 2Z9OA 3W2AA 1N9RA 1JRIA 2EW3A 4S04A 5CVJA 2K7AA 5HS8A 3QDRB 2R3SA 2L3SA 4XRSG 2MCNA 2NNNA 4D8KA 5E1WA 1WQWA 4XRFA 2KROA 4LE9A 4BS9A 4BUGA 4ITVA 3LSIA 1M9SA 2QENA 5IYDJ 1DGWY 3E5QA 2D1HA 2KMTA 3INZA 3MEUA 3E6MA 3X20B 2DD5A 3MD2A 3K4CA 3DXJF 2XB5A 5F27A 3RERA 4M7AC 2WBMA 2DW4A 2HYJA 2Q2EB 2LX7A 1W7PD 1FC3A 3HC7A 3I4PA 5E3MA 1VQNQ 5GANe 3KFVA 4C0ZA 1WHJA 3ZXSA 3S1MJ 1VQPA 5EGOB 3OYGA 3PNWC 4PJLA 5GADJ 1T3LA 4ENMA 3HHHA 3ZCOA 2DA6A 2RHUA 2PJRB 1G8XA 1SFOJ 3IWZA 1VFCA 2FRYA 3ZMSA 2P0WA 1MJBA 2Y4XA 1Q7YC 4XICA 2YUOA 3K6GA 3LOCA 1VQ5I 3AG2H 3VSLA 1WSUA 2ELKA 3CC2I 1DJ7B 2E1HA 2E5NA 1AWXA 3PIPF 4PGHA 2CO5A 1TUGB 3LWHA 1R5GA 4IX7A 2VJ4A 1IZ1A 1MZBA 1ZGAA 1UHFA 2EJGA 3NTKA 3RSNA 2WACA 2WV0A 3CDLA 4II2A 1MMAA 5HODA 2DE0X 5D6FA 2YR2A 2K57A 2MF2A 2R4GA 3HRTA 3KEOA 1CSKA 2JM8A 2WA0A 4OMFB 2D1XA 4Q5SF 3I55T 2XF6A 2HEOA 3HPHA 1R0CB 2E5KA 3OYIA 2NUPB 1P2FA 5GANd 2B9SA 5LJ3j 1TG0A 1VYTA 1QVUA 3KZZA 3BE3A 2ZJPF 2F2XA 1Q1HA 1QVFA 3GP8A 2EBIA 3HPGA 2W57A 4M77G 1UHSA 2OBPA 1WPKA 3DEEA 1FYNA 1ETWA 4GGGA 2B7EA 4MMKA 2XAUA 4N4IA 2KRMA 2A68F 1W1WE 1B9MA 2EILH 2LF8A 1ZSGA 4NC6A 4KN7X 4RAZA 4BD3A 1GXQA 1IXSB 2NS0A 4LIUA 2MMPA 1PP7U 3CMEA 4NDLA 2CV1A 5D5UB 2EPFA 3NHNA 5I2SA 4LD9K 3O3KA 2R5YA 2DA5A 2R0QC 2QYZA 4J9DA 5FWBA 2L0KA 4WXCA 3NEUA 5HNHA 3RI4A 4LGWA 2HZTA 3VYSB 5A2QR 3RESA 4A54A 1O9SA 3V7RA 4FX0A 1J2XA 3C2BA 1JKRC 1WRJA 1OQKA 3VKIA 4LB6B 3F22A 1UCRA 5GMKm 2BXZA 2RHIA 2O4XB 4KT6A 5KVRA 5CVIA 2YX4A 4XQ3A 3DTKA 1BN5A 1KQ0A 4R55A 3KXTA 2E5ZA 4AMCA 3V8LA 4FL6A 3JTGA 1MIJA 1Q82C 1FNNA 2H1KA 2E65A 3KYLA 4BQOA 3W2VA 4DOWA 1XDUA 2O88A 2WY8Q 1IN8A 4OAYA 2HSEB 4AT1B 4N4HA 2K3XA 1FYMA 1G2BA 1Z05A 2FMYA 3EGDB 2GAUA 2DFHA 3BR3A 4RTUA 1W2BS 3LNQA 1AA7A 4FETA 5F0FA 1K9MU 3WE2A 3ZP5A 1M8MA 2M16A 2QEXA 1VQLT 4B1RA 1KQ1A 4IHXA 2C0IA 2VJJA 4XQFA 2KSSA 2NRAC 2ID3A 3H0DA 2XGDA 1HSJA 1JUPA 3MEXA 3CMEQ 2KT0A 4MIMA 3I59B 4A69C 3KP7A 3VODA 5KAFC 2DL7A 2JM9A 2M7AA 2LKSA 2J5OA 1SMTA 3BZKA 3A8GB 5FKKA 4OMMA 4XLNF 1YFNA 4CCLA 1LE8B 1LVKA 4OINF 4QLCU 4I7HA 3SQNA 2F4OB 1HW5A 4MLOA 1UG1A 1IDYA 2D8JA 3AG4H 2AS5F 4RG8A 4OF1A 4PZJA 1VQPI 2GOXB 5DUIA 2Y4YA 3K4KA 2M1BA 2AIRB 4J7FA 5IY5H 1IV6A 2YLCA 1P9QC 1JJ2A 3BJOA 1L3LA 1DGRM 4XKCA 4CYDA 2CP5A 1N78A 3AAFA 3UA7A 3CCJA 4L59A 3OIQA 2VASA 4IRIA 1QWFA 2F5CA 3HDDA 4RM2A 1IXCA 2AHJB 3PVQA 1OCPA 3QU6A 3OYHA 3HGYA 1VQKI 5K1YA 2IS1A 2O61A 4E2FB 1BR2A 1AVZC 5E18F 4NHJA 1E0EA 5BS6A 3NTHA 5C0MA 2FNPA 3OYKA 3PFIA 4I0BA 4BKXA 5BOXA 2E2HJ 1RL2A 4J5YA 2LY9A 3L2RA 2CW0F 4WF2A 1M4ZA 2B8AA 1SVOA 4QKUA 3F9KA 4KT5C 2V1NA 1WZ2A 1IAWA 3DF8A 3P9KA 4LUDA 1VQ6A 1CKBA 2DPPB 2DK8A 1O3SA 3CEYA 2QVOA 5EZGA 2HD0A 1PDNC 1YJNA 2OV7A 2YDLA 4A93J 4PJOB 4BI8B 1QVGP 3TEEA 3QU3A 2DPDA 4HSRA 2HPIA 4RMOA 1S7EA 3CCVT 1F1ZA 3R0AA 2XK0A 2DCEA 1LFBA 5AONA 4M6XA 2M34A 2R7SA 2QF7A 4QPQA 1H9TA 1YS7A 1ZQ1A 4LITA 3H0GJ 3BCAA 3RZOJ 1Y7XA 4EM1A 2X6YA 4C3HJ 5DCMB 4LD6A 4D0PA 4UHTA 1JQQA 2H3EB 4ZGEB 1C6VX 1V5EA 2MZ4A 5GAEJ 5GAMh 3BFMA 4B9XA 2FQ3A 3CCJQ 1J3TA 3BTLA 3K70D 1GHCA 2CYYA 4A4KA 1QGPA 1TWAJ 5FJ8J 2IA1A 5B66C 2L9VA 1PM3A 3E5UA 2AQEA 3QYEA 4BDZA 3QSUA 2K4BA 1I50J 1IF1A 2ZPGB 3EHQA 2HOEA 3QWYA 2EK5A 3F6OA 3MVPA 1G3WA 1I6XA 2HKQB 3RQ4A 3JCMW 4F52A 1WI7A 5HLHA 3Q0WA 2Y2ZA 1N25A 4EJTA 2M8EA 1H641 2FPDA 3FB9A 3EFSA 2CGPA 4OVAA 1YIJA 4CH7A 3MP8A 2RHZA 5GAOl 3MEWA 3HKZN 4UVBA 2WTEA 1IZ6A 4B09A 1QCFA 4R0KA 4K2EA 4C8QA 2V6EA 4C92A 3JCMV 2YLBA 5LFAA 4ZZDA 1KONA 3IKTA 2O9VA 4HVVA 1YJNQ 1VQ7T 2GTOA 2RQQA 1SFEA 3NQOA 2QEXI 3KX2A 2A28A 1GXIE 1LJOA 2CDTA 2VKVA 4N0AC 4V2SA 3BJ6A 1HF0A 4DQ2A 2ELHA 4M6YA 1QMCA 1RACB 4FIBA 3C18A 1RI7A 3H36A 1Y8QB 5E20A 2E7XA 1E7OA 2DIQA 3JB9F 1MDMB 5HY6A 1J9IA 3Q9SA 1R22A 4L0YB 3R6OA 3CCUT 1B9NA 3BR6A 3HTUA 4TV7A 3C7JA 3RPUD 3IL2A 4ENKA 1ZGJA 2CUDA 3B73A
chains in the Genus database with same CATH topology
1FYKA 3LGLA 4XU0A 4XSXF 3VEPA 2LSOA 5JVTA 2FL7A 2A3SA 1YS6A 2EQMA 1TNSA 3EDPA 2V79A 4XTUA 1S3JA 4J8OA 2A7YA 3VU3C 4NL2A 5GMKj 1JJ2S 3TREA 5GANh 2XAQA 2DXUA 5GAMf 1T38A 1Z7UA 2XHCA 4ZGJB 4EMKA 3TKYA 1CF7A 1N6AA 3BPXA 4P9FA 2XASA 3VB2A 4HA8A 2VBZA 3JAME 1D3BB 1FP1D 4LG0A 3FZVA 3JTHA</