1F5TA

Diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
120
structure length
120
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Methyl groups of thymine bases are important for nucleic acid recognition by DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription/dna
molecule keywords 43MER DNA CONTAINING DXTR CONSENSUS BINDING SEQUENCE
total genus 45
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f5tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1f5tA02
2WC2A 3JAMZ 4ASNA 3HSFA 4AD9A 2HQRA 3O6BB 4PCQA 2GXBA 1H9GA 4BHPA 1K78B 1BC8C 4Q5SF 5L3FA 4LGWA 2DAOA 4B8XA 4WX9A 5BPDA 4O3MA 2LNBA 5ILVA 1G3TA 3MWMA 1SMYF 4LD5A 3RPUA 1FT9A 1XCVA 2XVCA 5E20A 4S05A 1SMTA 3J7AO 2HFHA 1JE8A 2PFBA 3LA7A 3L7WA 2FBHA 1OYYA 3TGNA 4KIFA 4OINF 4HV5A 3CUOA 5HVQC 2P4WA 5FO5A 3ZMVA 1V4RA 4LLGF 1GXPA 3HSEA 5HS7A 1BIBA 1EH8A 5DD8A 2HDCA 2VBXA 4ZYHA 2A6EF 3KZZA 3L9FA 1J5YA 4A0YA 1P92A 2RGVA 2UZKA 4FX4A 2HYFA 5EEHA 3MAJA 1WSUA 2ZKZA 2HKOA 3CUQC 4M72A 4RGSA 4A5MA 2KIUA 1XSVA 3JTGA 2NYXA 4ZZLA 5E8IA 2O8XA 2P8TA 5LRSA 1F5TA 4ESFA 3MFKA 1T38A 1R22A 1OPCA 3HRMA 3IWZA 5K5RA 1UCRA 4CGZA 1MJAA 2W84A 1W7PA 3T0YA 3SHFA 1MKMA 3D5LA 4OIQF 2IRFG 4EV0A 1SAXA 1SD6A 3ZP5A 2RNJA 2GWRA 4XLNF 5E1WA 5K1YA 4U88A 4AVPA 2LDUA 4G8XA 1XGMA 3FMRA 3CTAA 2RV8A 4KUMA 4MEYF 1L3LA 5FFXA 1G3SA 4LJZF 2Y48A 1G3WA 1FYLA 1U5TC 1TQMA 4MQ9F 3DEUA 4GYIA 4ON0A 5D5WB 3VFZA 3K9TA 1ULYA 3KP6A 4IF4A 5DD4A 4AWXB 1P4WA 4ENNA 3F6VA 1QPMA 3Q9SA 4KYWA 4LB6B 3QP5A 3V7CA 2JTVA 2GA1A 5FGMA 2R3SA 4IHSA 4UVCA 5D8LB 1Z05A 1Z9CA 3JSOA 3M9AA 2STTA 3F3XA 3WTUC 4M9ZA 2DTRA 2W25A 4P96A 3ERED 1HKSA 3S2WA 2J5OA 1J75A 3HRSA 4D0PA 4CHUA 3I59A 3T5XA 3ZMZA 1U3EM 3ZQ7A 1R23A 4R8HA 3I58A 3GW2A 1FX7A 1BOAA 1UFMA 2FNAA 3GO5A 4M9XA 1UHMA 2YPRA 2M8EA 3H92A 2PN6A 4L5JA 2L4AA 1JXSA 2DI3A 1DDNA 1Z7UA 4HOBA 3TDUC 3WTXC 4Z2YA 1SD7A 2TDXA 1W7PD 1YW9A 2FE3A 1ZLJA 1STZA 2FOKA 3OV8A 1B9NA 3BZ6A 3GZ5A 3N4MA 5F6FA 4E70A 4G94A 4Y17A 3CO7C 4Q47A 3GYHX 5EEGA 3DV8A 2FQ3A 1I6XA 3RYPA 4YIFA 4RB3C 5JI6A 5BPIA 4F7ZA 1IW7F 5AONA 2DLLA 3HTUA 1O7LA 3E5QA 2F5FA 2PI0A 3HRTA 2HS5A 1BI1A 2A6HF 3E6CC 1O3TA 3WTWC 4AIJA 5CVUA 1D8JA 2VBWA 2R7DA 2F2EA 2ZNYA 2JT1A 1P2FA 1FWZA 1JGSA 1MDMB 4LG0A 3W6KB 4L18B 4A6EA 1XSDA 3U1DA 3TQNA 3LAJA 2QQBA 1CGPA 3KETA 3HOSA 5CLSA 5BS6A 4M9SA 4XSXF 3HOTA 2FA5A 5HDNA 2GAUA 5TJJA 2ZXJA 3ROUA 2O6GE 2P6SA 1IXSB 2DQLA 2FU4A 2A61A 1F9NA 2W24A 1ZRCA 1U5TB 1IN8A 1U6GA 1ZG1A 3BROA 1YYVA 2K27A 2JZYA 3U2RA 3WE2A 1QNTA 2KJCA 3KE2A 1ZYRF 3GEZA 5JFRA 2M5WA 3KZYA 3KP7A 4WXCA 4EMSA 2QQAA 4OIOF 1XGNA 5LHHA 2M1BA 2EWNA 2QBYB 2HEOA 4KDPA 1TTYA 4ZYGA 3QPHA 5H20A 4A0ZA 2CQKA 5A2QZ 2XHKA 4KNYA 3QOPA 4ENKA 2EK5A 4RGXA 5DCMA 3TOAA 3GFIA 2V9VA 2CYYA 1QQIA 2QENA 2RKHA 2Y75A 2XGXA 1OMIA 3E3VA 3JAMK 4P9UA 1RI7A 3MZHA 4MEXF 1O7FA 1QGPA 4ENJA 1USTA 2EA4A 4EM2A 3FMQA 4EJUA 1G6NA 1J2XA 4OMZA 1LB2A 2VC1A 4IRHA 2STWA 3B73A 3G3ZA 5FD6A 2ZBKA 5KK1A 3RDIA 3EQLF 5CVVA 1RZ4A 2BBYA 1T98A 3AAFA 3Q9VA 5ICEA 5DEQA 2EFNA 4L5IA 4CDGA 1ON2A 2P5KA 1KYWA 5E8GA 2H09A 4RAZA 1YFHA 2Q0OA 5K5OA 3T8RA 1S7AA 3IHUA 2XROA 3FMSA 1A04A 2FMLA 2PBIA 4O5VA 3HYIA 4YFKF 5DUIA 4HLXA 3J80Z 3F8BA 3FF5A 1TNSA 3IRRA 1E2XA 1WRJA 2DW4A 2CW0F 4N9IA 4CICA 3GZ6A 1XGOA 3E6MA 2MA3A 1YS6A 1B1BA 2XAGA 4G7ZF 2K4BA 4I2OA 4UXNA 1FYMA 1W5TA 1R5GA 2OBPA 1LNWA 4UVBA 1RNLA 3WODF 1WQ2A 1XN7A 2PMUA 1T39A 2M30A 4MGRA 2EV5A 4HF2A 2IA1A 1PP7U 3QU6A 5FLXK 3RKWA 1MDMA 4LG0B 4LFUA 2OA4A 4WF2A 2GXGA 5L3GA 1R1VA 2FBKA 3NEUA 1OYIA 1LJ9A 2HGCA 5CJ9A 3JSPA 4B09A 3O2PE 4TV7A 5D6EA 5DCFA 2L01A 1TQPA 2PEXA 3EDPA 3FX3A 4O6JA 4CXFA 3C3WA 2HWVA 1ZRDA 1K79A 2QLZA 4EVIA 4M74A 2P7VB 3V7SA 2Z3YA 4ZYDA 4BHCA 1U5TA 3GFLA 4WK8F 4LMYA 1HW2A 1RIOH 5TRDA 3DQVC 4EJWA 1U8RA 2X0LA 3WGGA 1WWXA 3TKYA 1XCBA 4A5NA 2W85A 1KQ0A 1BI2A 2VBYA 2FF4A 5D4RA 1Q1HA 2A07F 2ZJ2A 3H3ZA 4N9HA 3TDZC 3F23A 2BE5F 3KP3A 3V8KA 3V8LA 2O0YA 2DT5A 4ZYEA 5L3CA 4HX8A 2WTEA 2P5LC 3I5UA 5HS9A 5BQTA 1D5VA 2XAQA 2LSOA 5LLQA 1KYZA 5CYVA 2PJPA 1REPC 4ENMA 1B59A 4BYYA 4Q4ZF 1BI0A 4HX4A 4Y13A 4WXHA 5KVRA 5AIPA 2QVOA 3ZPLA 4LK0F 1G4DA 2E1NA 1IXCA 1TW3A 1KA8A 2LF7A 2IP2A 2UXNA 2ZCWA 5JHUA 4R1HA 4I0BA 4S04A 2J5PA 3KCCA 5LRRA 3DFGA 4G7OF 3N97A 1S7OA 4LLLA 2YX7A 2HKXA 3KP4A 1NHAA 3IKVA 4PDKA 4L0YB 1ZG3A 2G7HA 2O03A 5H6RA 1BM9A 1W4MA 4UHTA 3EETA 2MBFA 3DKWA 1DP7P 5K5QA 1IN4A 5ICFA 4OIPF 4EGYA 2Z99A 1W5SA 3WGHA 5HLHA 3DXJF 4U0YA 5D4SA 4G6DA 1ZG5A 2K86A 1ZH5A 1HXDA 2RVCA 4L9VA 4U0VA 1JHFA 1EH6A 3ZMSA 2KIFA 3R0JA 2BEOA 2VXZA 2L54A 3QRFF 1AWCA 4KMUX 1H9TA 3KP5A 1YS7A 5L3EA 1XDSA 2JRTA 3FM5A 3U9GA 3M8EA 2VODA 5HOOA 2HTSA 2XUBA 4HF0A 4DQ2A 3E6BA 2EB7A 3ZMTA 2VOPA 3HHHA 2HR3A 2HQNA 2YU3A 2DBBA 1FYKA 1IN6A 1XMAA 5LGTA 4WCGA 2WWYA 3HTSB 2DK5A 1HW1A 1O3QA 4I01A 2QYOA 1ZAOA 4IRGA 4HZFA 3VODA 2Y0MA 5J8FA 1ZARA 5FB2A 5D8KB 4EJVA 5HS8A 1U2WA 2D1HA 2X4HA 3V8JA 2D45A 1ZGJA 1CF7A 3F72A 1TW2A 1HSTA 4YIIA 2FRHA 2FNPA 4GGGA 3G73A 2ZNZA 2QZ8A 5ICCA 2H6CA 2RQPA 5DCMB 5HDGA 2XAHA 3KP2A 2M87A 1Z1DA 5J8CA 4I98B 1KQ8A 2MH2A 1E17A 4JK1X 4EJOA 4EGZA 1W7PB 1B6AA 2COMA 2ZMEB 2EFWA 2G9WA 2F5EA 1D8KA 3RTRA 1J59A 1SFEA 2NRAC 3SXYA 2FXAA 1R36A 3BP8A 4EJTA 2H94A 1R7JA 1IF1A 6PAXA 1QBJA 4KT5C 3Q5FA 3TOBA 3MZYA 1J0RA 3BJ6A 3IL2A 3GFMA 1EV7A 5LGUA 1O3SA 4K2EA 2CSOA 1B9MA 1IXRC 1P6RA 4LLNA 4L0ZB 4QWQA 4UUVA 2Z33A 3RPQA 1R00A 3MEXA 2E7WA 2UXXA 1TBXA 2KJBA 2JPCA 4KMFA 5H6QA 1OR7A 4HQMA 2XAFA 3V7RA 2AXLA 1KU7A 3E6DA 3SZTA 3J80K 1ZGAA 4I0AA 1UB9A 2ZO4A 1K78A 1LDDA 3WTYC 1I1GA 5DV5A 5HLGA 4U7BA 1EH7A 3ISPA 4XSZF 2CGPA 1GXQA 1GHCA 1IRFA 2NNYA 1BIAA 1IN7A 1RUNA 1Z6TA 2IJLA 4MHGA 4IXAA 1FBSA 3IRQA 3GUDA 4U0WA 3JW4A 3WTVC 3PFIA 4ZZDA 3BPVA 3F8NA 1C0WA 1YG2A 3QAHA 4RS8A 1FPQA 2LKPA 3LA3A 1AOYA 4GXOA 1FBUA 2PG4A 1U78A 2M45A 2Q2EA 1LDJA 5E18F 1MZBA 2IW5A 1TQIA 3ECOA 3LAPA 1QZZA 4KFCA 3EYYA 1HKQA 3LQRA 1DPRA 3COAC 1ONVA 1YIOA 3C7JA 3FXQA 5FD5A 1FBQA 2H6BA 4CZZA 1SFXA 2VE8A 3E97A 2VE9A 4NB5A 4M6YA 3ULQB 1R58A 2OZ6A 2VT3A 4KIBA 3I4PA 4A0XA 5D5UB 5DUKA 3CDHA 2EFPA 1YW8A 2OQGA 3K1PA 3OOPA 5IT9Z 4JBAA 5LHIA 4RGUA 1I5ZA 2L02A 1YQAA 4IVNA 1CF7B 3FWEA 1FP2A 2BV6A 3ABUA 2XASA 2YR2A 2XAJA 4IRIA 2VN2A 3M1EA 5IT9K 5ILSA 2DK8A 5HDKA 1KU9A 2H27A 4UVAA 2XIGA 2HZTA 1IZ1A 2PMHA 1ON1A 2K4JA 4RGRA 2QQ9A 5E17F 3EUHA 2HYGD 2AS5F 2CO5A 4FHTA 1BBYA 5J6XA 2E1CA 4OU0A 3K69A 2KIMA 2DPUA 4IPAA 4WXDA 1ODDA 1PP8F 3F8CA 1I1SA 2KKOA 4HQEA 3J81K 4P5OA 3RKYA 2EA2A 2YSRA 2GQQA 5ICGA 2OD5A 2HOEA 1GVJA 4RB2C 4WWCA 1J9IA 2A3SA 3LQQA 2IPQX 2QWWA 3TO7A 4JQFA 3R6SA 2UWMA 2CWEA 4UV9A 3FZVA 2FBIA 1MD0A 4MTDA 1H0MA 2MLGA 1R1TA 1OYWA 3WU0A 4LK1F 5BOXA 4YFXF 1LDKB 5ED4A 4PGHA 2IA2A 5BMZA 1T6SA 2G7UA 4IHTA 4AIKA 2ZMEA 3K0LA 2DQRA 2EV6A 3CO6C 3K1MA 2E7XA 2Z5UA 1K7AA 3E5XA 4BH9A 3I59B 3WE3A 4MNUA 4I09A 3F8MA 1IRGA 4LB5A 1SD4A 4UV8A 2A69F 5E1XA 2P6TA 2OU2A 3FM3A 1WI9A 3BJAA 1WKMA 4XRFA 1Z6RA 4PZJA 2ELHA 1FC3A 1TNTA 1FY7A 2K02A 4OMYA 5LGNA 4KN7X 3BY6A 3O3KA 3DP7A 3I54A 2VOOA 5HLIA 3FHZA 1ZLKA 4L9NA 1KGSA 2HTJA 2DPDA 3F6OA 1HBXG 3L00A 1OKRA 1PUEE 3IC7A 5D5VB 3VOEA 2NS0A 1FZPB 3DF8A 1ZHFA 2V1UA 5JR3A 2RC4A 3QPTA 3WTTC 4CYDA 4XLPF 1SD5A 3F22A 5ILUA 4A6DA 3ZN1A 4HV6A 4I02A 1P4XA 2EFQA 1MGTA 2JPBA 1IN5A 3ABTA 3KFWX 3KLOA 3R61A 5E1ZB 4EM0B 3JTHA 3WGIA 5CVRA 4HA8A 3KEQA 3SQNA 2V79A 3QP6A 1O3RA 2F5DA 2DFIA 2QM3A 3R60A 1YLFA 3K1NA 3VEPA 3F8FA 4GCVA 5D5XB 3T1BA 1Y0UA 2ACJA 1XB4A 4M71A 3BPXA 3REOA 1BI3A 2V1XA 3WU1B 3WTSC 2FMYA 1S6LA 5DDGA 2D1VA 2A68F 2XRNA 1YTYA 1DUXC 4ESJA 3BOQA 1F4KA 3SZPA 3J81Z 1XSXA 4P55A 4NHJA 3ELKA 2VONA 1S3JA 1L0OC 4RAYA 2OAZA 3I64A 2XV4S 1J7KA 2P5VA 3D0SA 3K2ZA 2EFOA 3L09A 1XD7A 3C18A 3V4GA 2MH9A 2VC0A 2D2WA 4G6QA 4DNCA 1XGSA 3R4KA 4HF1A 4AIHA 2A5YB 1VTNC 4Y15A 2QBYA 4BQAA 4OOIA 3WTZA 4GYGA 2R7FA 4IJAA 1I27A 4XBFA 3T8TA 5FFZA 4HBLA 1LQ1A 2OZUA 1HSJA 1LEAA 1HW5A 1QZYA 5L3BA 3H3UA 1HKTA 2GA2A 2C6YA 4HX7A 4MTEA 2QUFA 3NQOA 2CG4A 3RKXA 3RI4A 3CJNA 2V1DA 5JVTA 3MQ0A 4G7HF 2L3DA 2EV0A 1T0FA 4N0BA 3CUQA 2O61A 3LFKA 4PGGA 1IUYA 3PQJA 3F21A 3KLNA 4H0EA 4U7DA 1SFUA 4KN4X 4EM1A 1BC7C 1ZRFA 2CFXA 1HQCA 1ZREA 3MCZA 5IT3A 3EYIA 2GZWA 2Q8KA 1FNNA 2JSCA 2WV0A 4KICA 3NRVA 4HW0A 1UHWA 4BHBA 1Z91A 5LEJA 1USSA 2PQ8A 4MQVA 1DPUA 2ETHA 2ESNA 3IKTA 4Q48A 3ML6A 3QU3A 4M6XA 4OIRF 3B02A 4EQQA 3GFJA 3TO6A 2IVMA 1LEBA 3I0TA 3M7GA 3GF2A 2ISYA 4P9FA 2PLYA 1QO0D 1ZN2A 1FSEA 3RYRA 3LA2A 4L9JA 2FSWA 4ZH4F 3WG9A 1P4AA 4FX0A 4I7HA 2IT0A 3GLXA 5L3DA 2NAZA 3GXOA 2Z9OA 3L2CA 1BN5A 4HAMA 2VT2A 1KU2A 3W6JB 3P7NA 1R1UA 2ISZA 1YO5C 1JHHA 4G9YA 5F1RA 3I71A 1YW7A 2MLKA 5LHGA 4FT8A 2OQRA 4KA4A 1R5HA 4BXUA 2O3FA 4A12A 3BWGA 2LF8A 3BDDA 3HSRA 3P9CA 1IAWA 2B0LA 3FXRA 1FP1D 2NNNA 4YG2F 1S29A 3ZMUA 3DPLC 3LWFA 5LBQA 4QLCU 4A2UA 3HIFA 2IA0A 2RN7A 3ECHA 4R79A 4L9TA 1G3YA 3ZMDA 3VB2A 3IWFA 2XKOA 4UNOA 3HHGA 2YX4A 5AIQA 2EJRA 3DPTA 4BAYA 3P9IA 4HLYA 4YFNF 3RJPA 2P7CB 2DO7A 3SFZA 3ZN0A 1MJBA 2V6CA 2F5CA 3GWZA 1T2KA 5CVJA 4CO8A 3FXUA 5F64A 2BGCA 3GVAA 3C1DA 1PDNC 1FLIA 1XMKA 4GO1A 2L4MA 3LSTA 3R0AA 4BNCA 4KIGA 2W57A 5DYMA 3TO9A 3HUGA 1F1ZA 3CLOA 4RB1A 1KU3A 4ESBA 1MJ9A 4RB0A 5LEKA 3BJOA 4NQWA 4M73A 1LVAA 2DU9A 3I53A 2MD5A 2ADUA 3GX4X 5D6FA 3RIRA 1K6OA 3P9KA 3PQKA 1D3YA 1TLHB 5FLXZ 2XKPA 3E5UA 2K7LA 2RDPA 4ETSA 1FSHA 2VBZA 1X3UA 4HDVA 2KRFA 3HRUA 2BYVE 2FEZA 3M8FA 2MC3A 5CVIA 1FOKA 2ZFWA 2ESHA 3KEOA 1V3FA 5A2QK 1BJAA 1KQ9A 4HYEA 2GIVA 1B4AA 1O57A 1S8NA 1RUOA 1XDUA 3CUQB 5ERIA 4HDUA
chains in the Genus database with same CATH superfamily
3TP3A 4KITB 2WC2A 3JAMZ 3MKZA 2O7OA 4ASNA 3Q3SA 2Y30A 3HSFA 1MBFA 1GV5A 4AD9A 2HQRA 3O6BB 2AHQA 4PCQA 4XR6A 2GXBA 1H9GA 4BHPA 1K78B 1BC8C 4Q5SF 1IV8A 5L3FA 2X6YA 4HSRA 4LGWA 2DAOA 4B8XA 4WX9A 4XOTA 5BPDA 3MMYB 2LNBA 4O3MA 2BW3B 1G3TA 3MWMA 5J40A 5ILVA 1HLVA 1SMYF 2HDWA 3BR2A 4LD5A 3RPUA 2ECCA 2XB5A 1FT9A 1XCVA 2XVCA 2OUMA 2L9SA 5E20A 4S05A 1SMTA 3J7AO 1P9QC 2HFHA 1MSFC 1JE8A 2PFBA 2CJJA 2X1DA 3OYLA 3LA7A 3L7WA 2FBHA 3OL3A 3S16J 3LSJA 1PJRA 1Y0NA 1E3HA 3HEFA 4XN3A 2F4OB 1OYYA 1NK3P 3TGNA 4HRIA 4KIFA 4OINF 4HV5A 3CUOA 4IOAF 3BTJA 2P4WA 5HVQC 4XLHA 5FO5A 2XRLA 3ZMVA 1V4RA 2NOJB 4LLGF 3JRCA 1GXPA 2XGEA 3HSEA 3A02A 5HS7A 2VQHA 3V42A 3A01B 1BIBA 2KZVA 3OR2C 1EH8A 3DLAA 3H5AA 5DD8A 1Y1WJ 3KEYA 5EGOA 1T56A 2O5RA 2HDCA 2VBXA 4ZYHA 2A6EF 1YOVB 2PMZA 3KZZA 3G2BA 3L9FA 3DPUA 1ZGWA 4DJAA 5EF6A 3MVPA 1J5YA 2KLOA 4A0YA 5GTHC 1P92A 3QOEA 1NH3A 2RGVA 2UZKA 2KISA 4FX4A 2MW8A 2HYFA 5LD2C 3EUKL 3QODA 5EEHA 1NG7A 3MAJA 4NNJA 5E3MA 4B47A 3VWBA 1WSUA 2ICWG 2ZKZA 2QCOA 1LE8A 2HKOA 3CUQC 4M72A 2VASA 4RGSA 4A5MA 4U87A 2BOLA 3ZQCA 2KIUA 1XSVA 3JTGA 2NYXA 2OTLI 4ZZLA 3G71I 5E8IA 2O8XA 2P8TA 5LRSA 1F5TA 4ESFA 3MFKA 3CF5F 3B6AA 1KZHA 1T38A 4XRMA 1R22A 2WB1A 1OPCA 3SJMA 1OCOH 3HRMA 2P81A 2LH9A 2DFHA 2BY0A 3IWZA 3ZRGA 2DJIA 5M3FJ 1I6HJ 5K5RA 1UCRA 2DA2A 4CGZA 1WJFA 4BU2A 1MJAA 2W84A 1W7PA 3OS2A 3T0YA 3M1CA 3SHFA 3H35A 1VQ6I 1MKMA 3D5LA 4OIQF 4XKVA 1KONA 4EV0A 2IRFG 1SAXA 1SD6A 3ZP5A 2RNJA 3CF2A 2GWRA 2MG4A 4XLNF 5E1WA 3CCMI 2L5QA 5KHDA 5K1YA 3K70C 2K9MA 2ID3A 4U88A 1WHUA 4AVPA 1BR1A 5F08A 2LDUA 4DGWB 1W0TA 2GIZA 1O4XA 4G8XA 3PSIA 2CV1A 1XGMA 3FMRA 3TEDA 2HNHA 3CTAA 2RV8A 3HUGB 3QYBA 4KUMA 3JRHA 1P7JA 2VJ4A 3L2RA 4ITVA 1E3PA 1TP4A 1XMXA 2DA5A 2V9KA 3U1KA 4DYRA 2M4KA 2R7WA 1ITYA 1ETXA 1I50J 1YJWI 2EINH 4MEYF 1L3LA 5FFXA 1G3SA 3BR6A 5FJ8J 4LJZF 2Y48A 1G3WA 1FYLA 1U5TC 1NK2P 1TQMA 4MQ9F 1OQYA 4B3XA 1QA6A 3H5RA 3TW6A 3JRDA 3K4NA 3DEUA 4GYIA 4ON0A 3CC7I 5D5WB 3VFZA 2ELJA 3K9TA 3BCAA 1LVKA 1VQKI 2VLAA 1ULYA 1GDTA 3KP6A 3PIOF 3NAUA 1D0XA 4IF4A 2ECBA 5DD4A 1P4WA 4AWXB 4ENNA 3F6VA 3CCSI 1QPMA 3Q9SA 4KYWA 3TMOA 4LB6B 3QP5A 3V7CA 3W2WA 2JTVA 2GA1A 4CUGA 4A3FJ 5FGMA 4A3LJ 4BE1A 2R3SA 4Y33A 4IHSA 4UVCA 1MNEA 2XB0X 5GTIC 3ZXSA 3PM1A 5D8LB 4G12A 1Z05A 2DT7B 2BY3A 2CS3A 1MMNA 1Z9CA 2HZDA 4II2A 3JSOA 3M9AA 5IP9J 2STTA 3MKYB 3F3XA 3WTUC 4M9ZA 2DTRA 2W25A 2VKVA 4B3AA 3S3MA 1Z67A 4CA0A 4P96A 4NQWB 3QYEA 3ERED 1OJLA 1HKSA 3OYHA 3S2WA 2J5OA 1J75A 2IS6A 3HRSA 4D0PA 2AXTC 3DU6A 4CHUA 3I59A 1GVDA 1JJ8C 1R71A 2DMUA 2QQ8A 4IQ4A 1VNDA 2JK3A 2LBFB 3T5XA 3ZMZA 1U3EM 3S3OA 1A36A 2QSFX 4UUSA 3JRFA 2LC2A 5IT9R 2DYRH 3ZQ7A 1R23A 4R8HA 3I58A 2ZMEC 3BG7A 3GW2A 4OWRB 4ZDOA 3MN2A 1FX7A 2B7EA 1BOAA 1UFMA 1IG7A 2FNAA 3GO5A 4PJLA 4M9XA 5JLWA 1UHMA 2YPRA 1ETYA 3GTMJ 2DMPA 2M8EA 3H92A 2HYJA 2PN6A 4NC7A 4L5JA 2L4AA 4LG3A 2CUZA 2Z2SB 1JXSA 2DI3A 3HBLA 1DDNA 1Z7UA 4HOBA 3TDUC 3ASOH 5M5YJ 3WTXC 4QPOA 4XMYA 4Z2YA 1SD7A 2TDXA 1W7PD 1YW9A 2FE3A 4PFOA 3AL0C 3FHNA 1ZLJA 1STZA 1ZKGA 2FOKA 2Y9YA 3OV8A 2KMUA 1B9NA 3HGGA 1V54H 3BZ6A 3GZ5A 3N4MA 5F6FA 3LSKA 4QTRA 4BEHB 4E70A 3VSKA 4G94A 3J81R 2GBYA 4Y17A 3CO7C 2JA2A 4Q47A 3A01A 5GPCA 3GYHX 4XIDA 5EEGA 3DV8A 2FQ3A 1I6XA 3RYPA 4YIFA 5HODA 3AFHA 4RB3C 3D5SC 5JI6A 1PYVA 5BPIA 4F7ZA 3B6CA 1IW7F 3PNTA 1QZEA 2LFBA 3W6VA 2WADA 5AONA 4D7MA 2DLLA 2M34A 3BTIA 1D5YA 3HTUA 1O7LA 3E5QA 3LSGA 4V2GA 5IP7J 2OCEA 1B8IA 2F5FA 2PI0A 2LMDA 5IYBJ 3HRTA 4LIVA 4XKWA 2HS5A 2CW8A 1BI1A 3ZR8X 2R7SA 1WH5A 2UUZA 2A6HF 3E6CC 1O3TA 3ESWB 3WTWC 4AIJA 5CVUA 2JVHA 3BR5A 2EIKH 2A6TA 1D8JA 2ZNYA 2VBWA 1WJEA 2F2EA 2R7DA 4MO7A 2JT1A 1P2FA 4N4OB 3O8GA 5C44J 3FXJA 1FWZA 1JGSA 1MDMB 4LG0A 3GBGA 3W6KB 2BHYA 4L18B 1VQPI 4W1UA 4A6EA 1X3WB 3OYDA 1XSDA 3G1MA 3U1DA 3TQNA 2ZFUA 3LAJA 4X0GA 2QQBA 1VQ7I 1CGPA 2M9HA 3DTEA 1MMGA 4JX4A 5C4XJ 2K40A 1WVRA 3KETA 3HOSA 5CLSA 4AVZA 2FOWA 3K10A 1OCTC 5BS6A 4M9SA 4XSXF 5LFAA 3HOTA 2FA5A 5M3MJ 2KDOA 2AO9A 4XOPA 5HDNA 2GAUA 5TJJA 3Q0VA 3DCFA 1RC9A 2ZXJA 3DBRB 1N25A 3ROUA 1G8XA 2VKHA 2O6GE 2P6SA 1IXSB 2DQLA 3HOUJ 2FU4A 4S0HB 2A61A 1JI8A 1F9NA 1NTCA 3G1OA 2W24A 1FTTA 1ZRCA 1U5TB 1IN8A 1MMAA 1U6GA 1ZG1A 3BROA 1YYVA 4DYQA 4FETA 2K27A 2JZYA 1JT0A 3U2RA 3WE2A 1QNTA 2KJCA 2Y2ZA 3KE2A 4BXXJ 1ZYRF 2P0TA 4ZDPA 4G6TB 4UUTA 3GEZA 3S14J 2KRHA 2GLOA 3W2VA 1ZK8A 5JFRA 2M5WA 3KZYA 3KP7A 4WXCA 2RREA 2QQAA 4EMSA 1JKOC 1XGNA 2H8RA 4OIOF 1SVMA 2M1BA 5LHHA 2EWNA 2QBYB 4PFPA 2R7XA 4RBOA 2HEOA 1BW6A 4KDPA 3AG4H 1TTYA 4ZYGA 3QPHA 5H20A 1AU7A 2L7MP 3VYUB 4A0ZA 4GRIA 1X58A 1ORKA 2CQKA 3ONQA 5HLTA 5A2QZ 3BLYA 2XHKA 4XLEA 4KNYA 1VI0A 3QOPA 4ENKA 2EK5A 4RGXA 5DCMA 1K83J 2X48A 3TOAA 4IHWA 3GFIA 2HXIA 1TC3C 2DODA 5EYRA 2V9VA 2XSJC 2CYYA 1QQIA 2GOMA 2QENA 4LIUA 2RKHA 3OSGA 1NG6A 1T08B 2Y75A 1MH4A 2XGXA 1OMIA 1B72A 3IH2A 5KNLA 3E3VA 3JAMK 3SDGA 4P9UA 1RI7A 2R4GA 1X3ZB 3MZHA 4MEXF 1O7FA 1QGPA 4ENJA 1USTA 2EA4A 4EM2A 1VFCA 3FMQA 1SFKA 2CMPA 3CC4I 4EJUA 2DXIA 1G6NA 1N78A 4Y52J 1J2XA 1QVTA 4OMZA 1LB2A 2VC1A 2LBFA 4IRHA 2STWA 3B73A 3G3ZA 2I10A 5FD6A 2JSPA 2ZBKA 3A52A 5E3OA 5KK1A 3RDIA 3EQLF 4M3DA 3EPZA 4BBRJ 5DS9A 4PUSA 5CVVA 5FLXR 1RZ4A 2BBYA 1T98A 5JHFA 3AAFA 1ETVA 5M5WJ 3Q9VA 5ICEA 4CCKA 2KRCA 5DEQA 3GTLJ 2EFNA 4L5IA 4CDGA 1ON2A 2P5KA 2KFDA 2MSYA 1KYWA 2EIJH 5E8GA 2H09A 3OWTA 1ETWA 2VQGA 1FMWA 3E1SA 3CCQI 3GTPJ 4RAZA 3OL4A 1YFHA 1AKHB 1U9NA 2Q0OA 3C2BA 4CZCA 5K5OA 3T8RA 3OR1C 1S7AA 1TT0A 3IHUA 2XROA 2O9LA 3FMSA 1A04A 2FMLA 2PBIA 4O5VA 1Y8QB 1ETQA 1H8AC 3HYIA 1VF9A 4YFKF 5DUIA 4HLXA 3J80Z 1HF0A 3F8BA 3HPGA 1UG2A 3FF5A 4B44A 4B48A 2IGMA 1TNSA 1XG1A 3IRRA 1E2XA 1WRJA 2DW4A 2CW0F 3A03A 4CH7A 5HNHA 4N9IA 4F55A 5EG0A 3I55I 4CICA 3VYRB 3DEWA 2VL8A 3GZ6A 1XGOA 3K4LA 2NVUB 3E6MA 3A0HC 2MA3A 1YS6A 1B1BA 2XAGA 4G7ZF 5K7FA 2K4BA 2VKDA 4I2OA 4UXNA 3O8HA 3OOUA 1FYMA 1XTAA 1W5TA 1R5GA 3CDIA 2XF6A 2OBPA 4RA2A 1LNWA 2E19A 4UUSB 3FKIJ 4UVBA 4IQJA 1RNLA 3WODF 1WQ2A 3DKXA 2LG4A 2H1LA 3ZQFA 1XN7A 2PMUA 2DOEA 1SAUA 1B8IB 3ABKH 3S17J 4UB6C 2VJJA 2LLKA 1T39A 3OIQA 2IS1A 2K5CA 2M30A 5BNGA 4F52A 1OR7C 4DOZA 2HOSA 4MGRA 2EV5A 1PP7U 2IA1A 4HF2A 2Z1DA 1EF4A 1XC5A 1RR8C 3QU6A 4ABZA 5FLXK 3J7AW 3RKWA 1MDMA 3VPRA 3LNQA 1QU3A 4LG0B 1ETOA 4LFUA 4PJJA 5J4YA 2R7VA 3HKZN 4BDYA 2OA4A 3I9V2 2GXGA 2WBMA 4WF2A 4C2MJ 2DN0A 4FE4A 1R1VA 2FBKA 5L3GA 3NEUA 3CCVI 1UELB 3J7YJ 1OYIA 1LJ9A 1WJDA 2HGCA 3DU5A 3QWLA 4PJ0C 4XL9A 5CJ9A 5J1RA 3JSPA 2X98A 4B09A 1V55H 3O2PE 4TV7A 2CUJA 1JUMA 5D6EA 3RZOJ 1R6RA 1D1BA 5DCFA 2WA0A 2L01A 1TQPA 1X1AA 4ZTFA 5M5XJ 2PEXA 3EDPA 3FX3A 4O6JA 1WH7A 3A4CA 4CXFA 2CQNA 3C3WA 2HWVA 1ZRDA 3J7AY 2MVTA 4JP0A 1Y1VJ 1K79A 3FDYA 2QEXI 1MH3A 4BKXA 2Y9ZA 2MZ4A 2QLZA 4EVIA 4M74A 2NS8A 2P7VB 3V7SA 2M0CA 1GLNA 2Z3YA 4BHCA 4ZYDA 1JKQC 4YRVA 4AU7A 4A3DJ 1FOYA 2W4SA 1U5TA 2W7NA 1GUUA 5B3SH 2KQRA 2GXAA 4JYKA 3GFLA 4WK8F 2W82A 4LMYA 3RCOA 1HW2A 1RIOH 5TRDA 3ZQIA 3DQVC 4EJWA 1U8RA 5FKKA 2X0LA 4DBRA 3HOXJ 2E5ZA 4MFEA 3WGGA 2X9DA 4DIQA 1WWXA 3TKYA 1XCBA 2JN6A 2COBA 3S1QJ 3TL4X 4A5NA 3S15J 2W85A 1KQ0A 2VQCA 2YU9J 1OLTA 1BI2A 1Z3YA 4A93J 1F43A 1EKEA 2VBYA 2FF4A 5D4RA 1Q1HA 2AQEA 1U9OA 3MKWB 2A07F 3HJEA 2ZJ2A 3H3ZA 2HPMA 4NC8A 4N9HA 3TDZC 1BR4A 3F23A 2BE5F 3KP3A 3M8JA 4YIRX 1ZR4A 2JMWA 2R93J 2HOAA 3DEEA 3V8KA 2D5VA 3V8LA 1RQ6A 2O0YA 1GV2A 2DT5A 2X6XA 4ZYEA 5L3CA 1G59A 2MFZA 4HX8A 2WTEA 4QIWN 2P5LC 2XGDA 3I5UA 4HNUA 5HS9A 3FKJA 5BQTA 1D5VA 2XAQA 2LSOA 2HU9A 3I3LA 2DJNA 5LLQA 1KYZA 1W1WE 5CYVA 1VZ0A 2QKLB 1REPC 2PJPA 2Z16A 5CKTA 4ENMA 1VQMI 1B59A 3GMEA 4BYYA 4Q4ZF 1BI0A 4HX4A 2W00A 2L9NA 2E60A 3K4JA 4Y13A 4RMNA 4WXHA 5AIPA 5KVRA 3PIPF 1T8IA 2QVOA 3ZPLA 1DGRM 4LK0F 5IOYA 1G4DA 2PX9A 3KPHA 1Y6IA 2E1NA 5C4JJ 1IXCA 4CYCB 1WZ2A 1TW3A 1UHSA 1KA8A 2K9LA 2LF7A 2IP2A 2UXNA 2ZCWA 3CMEI 5JHUA 4GDFA 2DDBA 2LVSA 4R1HA 4I0BA 4S04A 5FKOA 5J4VA 2J5PA 3KCCA 5LRRA 4KISA 3DFGA 5JLXA 4G7OF 3RQIA 2MUNA 3N97A 1S7OA 4LLLA 2YX7A 2HKXA 3KP4A 1NHAA 3IKVA 4PDKA 4L0YB 1ZG3A 1K4SA 2G7HA 2F5VA 2VKEA 2O03A 2R7QA 3CC2I 5H6RA 1BM9A 1W4MA 4UHTA 3EETA 4XN0A 2MBFA 2VB6A 4N4NB 2Q2EB 3DKWA 3KIOA 2RQQA 1DP7P 5K5QA 1IN4A 1IC8A 1XS9A 1WI3A 5ICFA 3JCUC 4OIPF 3HOVJ 2CUEA 2VQLA 3BTLA 4BUPA 3W3CA 3RQ4A 4EGYA 2Z99A 4C9YA 2WAQA 1JKRC 2LTPA 2E1OA 2E35A 3OYEA 2IXSA 1W5SA 1QRYA 2B9SA 3LL7A 3S1NJ 1W36D 2LR8A 3WGHA 5FLVA 4ZYAA 5HLHA 3DXJF 4U0YA 1FIAA 3K4CA 5D4SA 1B72B 4BXFA 4G6DA 2LRDA 1SC7A 1ZG5A 3HGYA 2K86A 1A31A 1ZH5A 1HXDA 1Y39A 2RVCA 1U0JA 4L9VA 4U0VA 1JHFA 4JX5A 1FIPA 1EH6A 3ZMSA 3PUFA 2ZC2A 3KYCB 2KIFA 3R0JA 2BEOA 3K2AA 2VXZA 2L54A 2LYCA 3QRFF 1AWCA 3CCRI 4PJNA 3K4MA 3KX2A 4KMUX 1R5ID 2X6WA 1K61A 3J80R 1H9TA 3KP5A 2DA7A 1UMQA 1YS7A 5B66C 5L3EA 4XLAA 1XDSA 2DYSH 2JRTA 3FM5A 3U9GA 2JVGA 3M8EA 2KDZA 3H3VK 2VODA 1WCMJ 1QPIA 3TW7A 1YIJI 5HOOA 1AKHA 2HTSA 3HXLA 2XUBA 2HQAA 4HF0A 1P7IA 4DQ2A 3E6BA 5EEAA 3CESA 4LITA 4RLFA 2EB7A 2TCTA 1V5FA 3OYFA 3ZMTA 1OFCX 2VOPA 3AG2H 1J09A 3HHHA 4IHYA 3KYLA 2HR3A 1V5GA 1R49A 3K4KA 3HDDA 2HQNA 1JT6A 3PNYA 3AL0B 2YU3A 4H4KC 3FXMA 4P1WA 2DBBA 3CQZJ 3OSFA 2EH3A 4XRSA 1IN6A 1FYKA 1ZELA 1XMAA 5LGTA 2Y31A 4D1QA 4WCGA 2WWYA 3HTSB 2DK5A 3GTOJ 2LKSA 4A3JJ 4UY8I 1HW1A 4DZJA 5B1AH 1O3QA 9ANTA 2K3FA 3ABLH 4I01A 3LMMA 3HM5A 4RAGA 3OYGA 4M3EA 2QYOA 1ZAOA 4IRGA 4HZFA 3VODA 4IX7A 2Y0MA 3J7ZI 5J8FA 4M3GA 5JVGF 2K9QA 1ZARA 1BJZA 2HVQA 2M8GX 4M3BA 5FB2A 5D8KB 4EJVA 5HS8A 1U2WA 2WV1A 2D1HA 2X4HA 3V8JA 4DZPA 3BC8A 2E1MB 1ZGJA 5GADJ 2D45A 1PVEA 3EUAA 3F72A 1CF7A 1A5JA 1TW2A 1HSTA 2XF7A 2KL4A 4BQOA 4YIIA 4HNTA 2FRHA 2FNPA 4GGGA 4M6VA 1DQUA 3G73A 2ZNZA 2QZ8A 5ICCA 1MMDA 2H6CA 3LSRA 2R5ZA 2RQPA 5DCMB 5HDGA 2NVQJ 2OF7A 2XAHA 4IZZA 1X19A 3KP2A 2M87A 4XKBA 1XPXA 1Z1DA 3OYAA 5J8CA 4I98B 3NWSA 1YITI 1KQ8A 4BQQA 2E36A 2EILH 2MH2A 1E17A 4JK1X 4EJOA 4EGZA 1W7PB 5IYDJ 2Y0SN 1B6AA 2COMA 2ZJQF 4IOCF 1ZR2A 3F9KA 2ZMEB 2EFWA 1UJ8A 4M3FA 2G9WA 2TRTA 2F5EA 3HG9A 1D8KA 2JA7J 3RTRA 1J59A 3IV5A 1SFEA 2FQ4A 2EZLA 2NRAC 3SXYA 2ZXHA 2FXAA 1IGNA 3BR3A 1MSEC 2JUGA 4C2UA 2LKXA 1R36A 3BP8A 2A5WA 4EJTA 1A6IA 2H94A 1EJ9A 1YJ9I 4FASD 2VXDA 4IL6C 1R7JA 3S93A 3CP2A 4OAYA 2OV7A 1MNMC 1UAAA 5FKLA 1IF1A 2QSHX 2DT6A 6PAXA 3QQAA 1QBJA 4FE7A 4KT5C 4BY7J 2HI3A 1DU6A 3Q5FA 1Y8RB 1BR2A 2ZJRF 2BZTA 3TOBA 1WPKA 3MZYA 1J0RA 3BJ6A 1G2HA 2V26A 2DOAA 3IL2A 4IKFA 2DFFA 2OCCH 3GFMA 3D5RC 1EV7A 2DMTA 5LGUA 1O3SA 4K2EA 3CCYA 2CSOA 2RAEA 1YJNI 1B9MA 4E6KG 1IXRC 1P6RA 2GM4A 4LLNA 4L0ZB 2R7UA 1I3AA 2JA6J 4QWQA 1SVOA 3RZDJ 4UUVA 2Z33A 2DTZA 3RPQA 3NWTA 1R00A 4FISA 3MEXA 4KT6A 4NC6A 2E7WA 4XORA 4XRSG 3OYCA 2UXXA 1TBXA 1IRXA 4E7HA 2FJ1A 2BY2A 2BVMA 2DA4A 2KJBA 2WY7Q 1X4PA 3H5NA 4BJTA 2JPCA 5IOZA 4KMFA 5H6QA 3G6EI 1OR7A 4HQMA 4PSXA 4KJZA 2EQRA 3K70D 4BE0A 2XAFA 2WAEA 3V7RA 1RPWA 2DMQA 2EZHA 2XGCA 2AXLA 3ERMA 4HG2A 4B1RA 5B1BH 1KU7A 3E6DA 3SZTA 2V9PA 3J80K 1XX5A 3PO3J 1ZGAA 2R7ZJ 1BA5A 4I0AA 4RM3A 1UB9A 4I99C 5F0FA 2ZO4A 1K78A 1LDDA 4JX6A 3WTYC 4E7JA 5E3NA 1VQ4I 1UZCA 4E7ZA 1I1GA 5DV5A 5HLGA 5KAFC 3HB9A 4MLOA 4U7BA 1EH7A 3ISPA 3UR3C 4XSZF 2CGPA 1GXQA 4X1EA 1GHCA 2IGKA 1IRFA 2NNYA 1BIAA 1IN7A 1RUNA 1Z6TA 5IY5H 2FX0A 2IJLA 4MHGA 2CU7A 4IXAA 1JJ6C 4E7KA 1FBSA 3IRQA 3GUDA 1Z0XA 4U0WA 2CQXA 3JW4A 3WTVC 3PFIA 5B5EC 3F8NA 3BPVA 4ZZDA 1C0WA 1YG2A 3QAHA 4RS8A 1FPQA 2LKPA 3LA3A 3DKYA 1AOYA 2DA1A 4GXOA 1WJBA 1FBUA 3JR9A 1TZLA 2H1KA 2PG4A 3BR1A 4MFDA 4C3JJ 1U78A 2HQ5A 3H9GA 2M45A 4XQFA 1ZTRA 4A69C 2Q2EA 3FK6A 3CJQB 1LDJA 4CSWA 3GTQJ 3S3NA 2MC4A 3I4NJ 3OIOA 5E18F 1MZBA 2IW5A 1TQIA 3RPUD 1IJWC 3ECOA 3PUBA 3LAPA 1QZZA 4KFCA 5EGOB 2KIQA 2X1CA 3EYYA 1HKQA 3LQRA 1DPRA 2L9VA 3COAC 2HVSA 1ONVA 4F91B 1YIOA 1RRJA 4IHVA 3C7JA 1F36A 3BQYA 3BG9A 1OCPA 2CW7A 3JREA 2K9NA 3BTCA 1YHQI 3FXQA 1TWHJ 5FD5A 1FBQA 2H6BA 2LY2A 4CZZA 4Y4RA 1SFXA 2VE8A 3E97A 5FKMA 2VE9A 4ZTJA 4NB5A 3FXLA 2DFEA 4M6YA 1H88C 3ULQB 2Q1ZB 2E2JJ 1ERDA 1R58A 2OZ6A 1M1EB 2L0KA 2UV1A 4HNVA 1LE8B 2IS2A 2A05A 5CPRB 3ZGKA 4AIDA 3SFIA 1Z21A 2VT3A 4KIBA 3I4PA 4A0XA 5D5UB 5DUKA 3CDHA 2EFPA 3GLLA 1YW8A 1MBEA 3FK7A 2OQGA 3K1PA 3OOPA 5IT9Z 4JBAA 1I39A 5F1JA 1TL8A 4E7LA 2ZXIA 2DOFA 3SZGA 5LHIA 4RGUA 2V1NA 1MBKA 1I5ZA 5J1UA 2L02A 1UG0A 1YQAA 4IVNA 1CF7B 2HXOA 2HVRA 3FWEA 1FP2A 3Q0UA 1BOBA 3CCJI 2BV6A 3ABUA 2XASA 2YR2A 4XLFA 2XAJA 1T0FC 3PFYA 4NBQA 4IRIA 2MD0A 4BQNA 2VN2A 3M1EA 2R5ZB 4CCOA 4B4CA 2NVTJ 3OYNA 5IT9K 4BL0B 2WAQN 3GTGJ 5ILSA 2DK8A 5F27A 5HDKA 2DA3A 1KU9A 2H27A 4UVAA 2XIGA 2HZTA 1IZ1A 2ME6A 2X1EA 4X6AJ 2PMHA 3K4BA 1ON1A 2K4JA 1BW5A 3G4SI 4RGRA 2IGOA 2EPFA 4CCJA 1E0EA 2QQ9A 3BCBA 5E17F 3EUHA 2HYGD 5GP9A 2AS5F 2CO5A 4FHTA 1BBYA 5H2FC 5J6XA 2E1CA 4OU0A 3K69A 2KIMA 5DTDA 2F6CA 4PK4A 2DPUA 4IPAA 3HPHA 4E4HA 4WXDA 1MBJA 1K6YA 1ODDA 5EDNA 4ZJZA 1PP8F 3W2AA 3WU2C 3F8CA 1YRNA 2CH0A 1I1SA 2QKMB 2KKOA 2XC7A 4HQEA 3J81K 4P5OA 3RKYA 2EA2A 2ME0A 2YSRA 2GQQA 5ICGA 2LY1A 5TISC 3S2DJ 3FBNB 1YX3A 2OD5A 3K6GA 2HOEA 1GVJA 4RB2C 2JA8J 4WWCA 1J9IA 4BS9A 4V2FA 3OYBA 2A3SA 3LQQA 3JRBA 2IPQX 1DGWY 2QWWA 3TO7A 5EZGA 3DTKA 2M35A 4JQFA 3HOWJ 3PO2J 3R6SA 4HEA2 4A3GJ 3NARA 3HOYJ 3AG3H 1JUSA 2UWMA 2CWEA 4UV9A 3FZVA 2X6OA 2FBIA 1MD0A 3VDXA 4MTDA 1TT5B 1H0MA 2MLGA 4MIMA 2OC6A 1R1TA 3L2VA 1A6QA 1OYWA 2W1OA 1APLC 3WU0A 3S1RJ 4LK1F 5BOXA 2IGNA 4YFXF 4FCYA 3HL2A 3JRGA 1LDKB 3S1MJ 5ED4A 4PGHA 2IA2A 5EZHA 1T6SA 5BMZA 2G7UA 1A35A 4IHTA 4AIKA 2ZMEA 3GZNB 3K0LA 4GFBA 2DQRA 2WB1N 2EV6A 2QGUA 2B63J 3CO6C 3K1MA 4QSHA 2E7XA 2Z5UA 3FISA 1K7AA 3E5XA 3SEZA 4BH9A 3CMYA 3I59B 1D1CA 2BY1A 3OYMA 3CMMA 3WE3A 4MNUA 2OJED 4I09A 2VPRA 3F8MA 2WY8Q 1OCZH 4LB5A 1SD4A 4Y3OA 5HNFA 1IRGA 4UV8A 2A69F 2BHZA 5E1XA 2P6TA 2VUMJ 2OU2A 3FM3A 4A3EJ 1WI9A 3JAMR 3BJAA 1WKMA 4XRFA 1Z6RA 4PZJA 2ELHA 3G1LA 4XK4A 3Q0WA 2Y0SA 1FC3A 1TNTA 1FY7A 2MYSA 2QSGX 1JGGA 2K02A 4OMYA 3L2WA 4ANJA 4KN7X 5LGNA 3OYKA 3CMAI 3BY6A 1PUFB 3O3KA 4IO9F 4C3HJ 3JRIA 2P0WA 2DA6A 3OY9A 3DP7A 1U8BA 3I54A 2VOOA 5HLIA 5TGTA 1VQ5I 3FHZA 1ZLKA 1T33A 2R92J 3DLLF 2JQ7A 4L9NA 1LFBA 1KGSA 1X1CA 2HTJA 3QYFA 2DPDA 3F6OA 1HBXG 3L00A 1OKRA 1PUEE 3OS0A 3RSNA 3IC7A 5D5VB 1I3QJ 4BEHA 2CFOA 1DU0A 2W48A 3VOEA 2NS0A 1FZPB 3VSLA 3DF8A 1ZHFA 2LREA 2XF5A 2V1UA 1H89C 5JR3A 2RC4A 3QPTA 3WTTC 4CYDA 4XLPF 3JRAA 4BDZA 5J1YA 4XKCA 3HC7A 4AYBA 1SD5A 3F22A 4RDUA 5ILUA 4A6DA 3ZN1A 3AG1H 1Q1VA 4HV6A 4I02A 1X2NA 1P4XA 2EFQA 1MGTA 2QF7A 2JPBA 1IN5A 3ABTA 3KFWX 3KLOA 3ZOBA 3R61A 1IO2A 5E1ZB 3OS1A 2ZSIB 4EM0B 2E71A 3JTHA 3WGIA 3H1CA 5CVRA 4HA8A 3KEQA 3U21A 3SQNA 1X4OA 2V79A 3QP6A 5FROA 1O3RA 2F5DA 3CDLA 2DFIA 2QM3A 3R60A 2VJ5A 4CCMA 4E7SA 3VYSB 1Z3XA 2MABA 1YLFA 3K1NA 3VEPA 3F8FA 4PSWA 4GCVA 3L2UA 5D5XB 2CV2A 3T1BA 1Y0UA 4BBSJ 2ACJA 4EATA 5DM6F 1XB4A 3ZQHA 2ZB9A 1YE9A 4M71A 1AA7A 3BPXA 3REOA 1BI3A 2V6EA 5CQGA 2V1XA 2MGQA 3WTSC 3WU1B 2FMYA 1S6LA 5DDGA 5K7ZA 1IUFA 2D1VA 3M4OJ 3RKQA 2A68F 2R5YA 1AHDP 2JWTA 3IH4A 3MZ8A 3CP8A 2XRNA 4BY1J 1YTYA 1DUXC 3ZQQA 1LKXA 5FLMJ 4ESJA 1DP3A 1S9HA 3BOQA 1MBHA 2YS9A 3SYTA 1F4KA 3IH3A 3SZPA 5EJCA 3J81Z 2HPIA 5F0CA 2X85A 2XDVA 4FTHA 4HSTA 4AYBN 2OPTA 1XSXA 3HZJA 4P55A 4NHJA 4RAFA 3ELKA 4J19A 2VONA 2QA4I 1S3JA 1L0OC 4J01A 3H9QA 4RAYA 2OAZA 1RKTA 4BE2A 3GCMA 2WAFA 2XV4S 3I64A 1R9TJ 3BG6A 4BACA 1ETKA 1J7KA 1W0UA 2P5VA 3L1PA 3D0SA 2BVLA 3LOCA 1Z7LA 3WG7H 3K2ZA 2EFOA 2O8KA 3L09A 2EZIA 1XD7A 4A3IJ 3ZQLA 3C18A 3V4GA 1IRZA 2ZJPF 2IAIA 2MH9A 2VC0A 1FMVA 2AQFA 1YRNB 2LP0A 2D2WA 3CCEI 4G6QA 4DNCA 1XGSA 3R4KA 4HF1A 1MMSA 4AIHA 4NDLA 2A5YB 1S7EA 2L2OA 4Y15A 1VTNC 2QBYA 4BQAA 4OOIA 3WTZA 2NVYJ 4GYGA 3K7AJ 1LPQA 2R7FA 5IP6A 4IJAA 1I27A 1QHHD 3N05A 4XBFA 3T8TA 5FFZA 2V7FA 4HBLA 1LQ1A 2OZUA 1WJ5A 1HSJA 2VJIA 1LEAA 1HW5A 1QZYA 1OCRH 5L3BA 3EUHC 1HCRA 1R4MB 3H3UA 1SANA 3LSHA 1Z77A 1HKTA 3LFUA 2GA2A 1E3OC 2C6YA 4HX7A 4MTEA 2R7OA 3KZIC 2QUFA 3NQOA 2DDAA 4UB8C 2CG4A 3RKXA 2PJRB 3RI4A 3CJNA 2V1DA 2XAUA 2ZXWH 2KZGA 5JVTA 4J00A 2K85A 3MQ0A 4G7HF 2L3DA 2N8GA 2EV0A 1T0FA 4N0BA 3CUQA 2O61A 2XPWA 3LFKA 1FJLA 4PGGA 1IUYA 2KT0A 3PQJA 4I6ZA 3F21A 1X2MA 3KLNA 4H0EA 1RR7A 4U7DA 1SFUA 4KN4X 4EM1A 1BC7C 4IEJA 4CCLA 1IDZA 2L7ZA 1ZRFA 1EA3A 2CFXA 2FUG2 1YX5A 1HQCA 1K4TA 1ZREA 3MCZA 2CRGA 5IT3A 1LFUP 2GZWA 3EYIA 1FNNA 2JSCA 2WV0A 2Q8KA 4KICA 3X2QH 3NRVA 4XM3A 2HDDA 1VQ8I 4HW0A 2NXNB 1UHWA 4BHBA 1Z91A 1WGXA 2BW3A 4YEJA 3LSIA 5LEJA 1D0YA 3UNGC 1USSA 4A3CJ 2PQ8A 3IUOA 4QPQA 1S5LC 4MQVA 1DPUA 5E79C 4CYCA 2ETHA 2ESNA 3IKTA 2VPLA 4Q48A 2CV0A 1PUFA 3FIWA 4W97A 1OISA 3ML6A 3GTKJ 2F4IA 3TP0A 3L2QA 1HDDC 3QU3A 3BZKA 4XNFA 1JKPC 4M6XA 4OAZA 3KYDB 5GPAA 4OIRF 3CJTB 3WHBA 4XONA 3B02A 2I5UA 4EQQA 3GFJA 3TO6A 4XICA 1HDPA 2IVMA 3AKZA 4BJ5C 3BZCA 3PL8A 1POGA 3HOZJ 1LEBA 2R7RA 3I0TA 5EG0B 5FRMA 3M7GA 5CQEA 3VYTB 4L5EA 2M4GA 2L7KA 3GF2A 3H0GJ 2ISYA 4P9FA 3MD2A 1S72I 2PLYA 4A3KJ 1QO0D 2M7AA 1ZN2A 4ZDLA 1FSEA 4ZC3A 3RYRA 2X51A 3LA2A 5K7HA 4L9JA 1VQOI 2NVXJ 2FSWA 4ZH4F 4B43A 1OCCH 2IEKA 2LOOA 5GAGJ 1LUJB 3BQZA 3WG9A 1P4AA 3HKZA 3BG5A 4FX0A 4HPQA 4I7HA 1VQ9I 2IT0A 3QPLA 3GLXA 5L3DA 2NAZA 3QPSA 3GXOA 4D5CA 3M07A 2Z9OA 3L2CA 5FRNA 1BN5A 4HAMA 2VT2A 3ASNH 2XPVA 1KU2A 3W6JB 3P7NA 1VQLI 1JTXA 1R1UA 2ISZA 1YO5C 4YELA 3P5JA 5E3LA 1JHHA 4G9YA 5FKNA 1QHGA 3C2HA 1IDYA 2E5NA 3I71A 4LOCA 5F1RA 1YW7A 4D7NA 3I56I 2HOTA 4A3MJ 1MBGA 5J47A 2MLKA 5LHGA 2L9RA 4FT8A 4EEFG 1RKWA 2OQRA 4KA4A 1R5HA 4BXUA 2G0EA 2O3FA 4D9JA 3OYIA 4A12A 3BWGA 5GAHJ 2LF8A 4DBQA 2K9SA 3BDDA 3HSRA 3P9CA 1GT0C 1IAWA 2B0LA 3FXRA 1FP1D 4XLCA 2LY9A 2NNNA 4YG2F 3E0JB 2R0QC 3FBIB 1VQNI 4AUXA 2JRMA 1N77A 3CZ6A 1JTYA 1S29A 2E1MC 3C2GA 3ZMUA 1R4NB 1D0ZA 4DYCA 1TWCJ 2GOXB 3DPLC 1T95A 4F3QA 3LWFA 5LBQA 3BT9A 1TWGJ 1MW7A 4QLCU 3LSMA 4A2UA 3HIFA 2IA0A 2I8DA 2RN7A 2F48A 5C3EJ 3ECHA 3M3YJ 2E2IJ 5F0HA 1HOMA 4R79A 2DMNA 4L9TA 1G3YA 4AC0A 3ZMDA 3VB2A 3IWFA 4F93B 1FOWA 2IBDA 3DBLB 4PJMA 1ENHA 2XKOA 4BJ6C 4UNOA 3BR0A 3HHGA 3SEQA 2H8WA 1SFOJ 1HC8A 1WJCA 2YX4A 5AIQA 4DW6A 2EJRA 1IV6A 3DPTA 3OIPA 3DTIA 2OTJI 4RM2A 2KHMA 1SVLA 4BAYA 2E34A 4AM3A 3P9IA 4HLYA 3CJRB 1FEXA 4YFNF 3RJPA 2P7CB 2DO7A 3ABMH 3SFZA 3S2HJ 2CUFA 2XSDC 1ACIA 4V19K 3ZN0A 2R5YB 3S8PA 1MJBA 2V6CA 2F5CA 3GWZA 5F04A 1T2KA 3DWLE 1TWFJ 2FD5A 2EBIA 3IP4B 5A2QR 5CVJA 4CO8A 3FXUA 3H36A 5F64A 3D1NI 3BG3A 2CQ7A 2K3PA 2BGCA 3SDBA 3GVAA 3ZQGA 3CCLI 1V5EA 4CCNA 1X1PA 3E7LA 3C1DA 4D5FA 3H9JA 2M2EA 2F4MB 1PDNC 1FLIA 2LK2A 2Y69H 2M0MA 1XMKA 4GO1A 2L4MA 2R7TA 2VI6A 2ID6A 3LSTA 3CLQA 3R0AA 4BNCA 1WJAA 4KIGA 2W57A 5DYMA 3TO9A 3I4MJ 3HUGA 4C30A 1W5CC 3PJRA 1F1ZA 3CLOA 1ZQ3P 2NOGA 3OMYA 1W36C 4RB1A 1KU3A 3UKGA 2YUSA 4ESBA 1MJ9A 4RB0A 1BL0A 3A0BC 5LEKA 3BJOA 5KAIC 1FOXA 1QVUA 3F0CA 4NQWA 3OYJA 4M73A 1LVAA 2DU9A 2LD5A 4NUBA 4Z6YA 4C3IJ 3I53A 2MD5A 1D1AA 1TWAJ 2ADUA 3DBHB 3GX4X 1JUPA 5D6FA 3RIRA 1WFXA 5KCMA 4FQGA 2V4JC 4F92B 1K6OA 2JA5J 3P9KA 3H0DA 1RETA 3PQKA 1D3YA 1N75A 3CCUI 2DCEA 3PSFA 1TLHB 5FLXZ 2XKPA 3E5UA 2K7LA 2RDPA 2L7FP 4ETSA 2KPMA 2VBZA 4BGDA 1FSHA 1X3UA 5IYCJ 2M3AA 4HDVA 2IS4A 2E2HJ 2XPUA 2KRFA 2ELKA 3S32A 3HRUA 2BYVE 1LFPA 2CQQA 2FEZA 3M8FA 4JOMA 2MC3A 2RNGA 5CVIA 1RESA 1Y56A 1SEUA 1MIJA 5GAEJ 1FOKA 2ZFWA 2ESHA 4A3BJ 3LSPA 3MKLA 2JUCA 3ZCOA 3KEOA 1MNDA 3FXOA 1CQTA 1V3FA 5A2QK 1HA8A 2BXZA 1BJAA 3IAS2 3CD6I 3TBIA 3IAM2 1KQ9A 4E7IA 4HYEA 2NS7A 5IPAA 1X1DA 1B4AA 2GIVA 3WHCA 4Y7NJ 2EIMH 5J3LA 2PJRA 4RLQA 2ZSHB 1O57A 1S8NA 4II3A 1RUOA 2EZKA 2M7BA 2JJ7A 1X1BA 4C2TA 3FXKA 4I76A 3PNVA 1XDUA 2VIXA 3CUQB 5DM7F 1YI2I 3GTJJ 2KP6A 5ERIA 2BXYA 4HDUA 1FTZA 2PMZN 3A1YA 4IHXA 3A2KA
chains in the Genus database with same CATH topology
2WC2A 3JAMZ 4ASNA 3HSFA 4AD9A 2HQRA 3O6BB 4PCQA 2GXBA 1H9GA 4BHPA 1K78B 1BC8C 4Q5SF 5L3FA 4LGWA 2DAOA 4B8XA 4WX9A 5BPDA 4O3MA 2LNBA 5ILVA 1G3TA 3MWMA 1SMYF 4LD5A 3RPUA 1FT9A 1XCVA 2XVCA 5E20A 4S05A 1SMTA 3J7AO 2HFHA 1JE8A 2PFBA 3LA7A 3L7WA 2FBHA 1OYYA 3TGNA 4KIFA 4OINF 4HV5A 3CUOA 5HVQC 2P4WA 5FO5A 3ZMVA 1V4RA 4LLGF 1GXPA 3HSEA 5HS7A 1BIBA 1EH8A 5DD8A 2HDCA 2VBXA 4ZYHA 2A6EF 3KZZA 3L9FA 1J5YA 4A0YA 1P92A 2RGVA 2UZKA 4FX4A 2HYFA 5EEHA 3MAJA 1WSUA 2ZKZA 2HKOA 3CUQC 4M72A 4RGSA 4A5MA 2KIUA 1XSVA 3JTGA 2NYXA 4ZZLA 5E8IA 2O8XA 2P8TA 5LRSA 1F5TA 4ESFA 3MFKA 1T38A 1R22A 1OPCA 3HRMA 3IWZA 5K5RA 1UCRA 4CGZA 1MJAA 2W84A 1W7PA 3T0YA 3SHFA 1MKMA 3D5LA 4OIQF 2IRFG 4EV0A 1SAXA 1SD6A 3ZP5A 2RNJA 2GWRA 4XLNF 5E1WA 5K1YA 4U88A 4AVPA 2LDUA 4G8XA 1XGMA 3FMRA 3CTAA 2RV8A 4KUMA 4MEYF 1L3LA 5FFXA 1G3SA 4LJZF 2Y48A 1G3WA 1FYLA 1U5TC 1TQMA 4MQ9F 3DEUA 4GYIA 4ON0A 5D5WB 3VFZA 3K9TA 1ULYA 3KP6A 4IF4A 5DD4A 4AWXB 1P4WA 4ENNA 3F6VA 1QPMA 3Q9SA 4KYWA 4LB6B 3QP5A 3V7CA 2JTVA 2GA1A 5FGMA 2R3SA 4IHSA 4UVCA 5D8LB 1Z05A 1Z9CA 3JSOA 3M9AA 2STTA 3F3XA 3WTUC 4M9ZA 2DTRA 2W25A 4P96A 3ERED 1HKSA 3S2WA 2J5OA 1J75A 3HRSA 4D0PA 4CHUA 3I59A 3T5XA 3ZMZA 1U3EM 3ZQ7A 1R23A 4R8HA 3I58A 3GW2A 1FX7A 1BOAA 1UFMA 2FNAA 3GO5A 4M9XA 1UHMA 2YPRA 2M8EA 3H92A 2PN6A 4L5JA 2L4AA 1JXSA 2DI3A 1DDNA 1Z7UA 4HOBA 3TDUC 3WTXC 4Z2YA 1SD7A 2TDXA 1W7PD 1YW9A 2FE3A 1ZLJA 1STZA 2FOKA 3OV8A 1B9NA 3BZ6A 3GZ5A 3N4MA 5F6FA 4E70A 4G94A 4Y17A 3CO7C 4Q47A 3GYHX 5EEGA 3DV8A 2FQ3A 1I6XA 3RYPA 4YIFA 4RB3C 5JI6A 5BPIA 4F7ZA 1IW7F 5AONA 2DLLA 3HTUA 1O7LA 3E5QA 2F5FA 2PI0A 3HRTA 2HS5A 1BI1A 2A6HF 3E6CC 1O3TA 3WTWC 4AIJA 5CVUA 1D8JA 2VBWA 2R7DA 2F2EA 2ZNYA 2JT1A 1P2FA 1FWZA 1JGSA 1MDMB 4LG0A 3W6KB 4L18B 4A6EA 1XSDA 3U1DA 3TQNA 3LAJA 2QQBA 1CGPA 3KETA 3HOSA 5CLSA 5BS6A 4M9SA 4XSXF 3HOTA 2FA5A 5HDNA 2GAUA 5TJJA 2ZXJA 3ROUA 2O6GE 2P6SA 1IXSB 2DQLA 2FU4A 2A61A 1F9NA 2W24A 1ZRCA 1U5TB 1IN8A 1U6GA 1ZG1A 3BROA 1YYVA 2K27A 2JZYA 3U2RA 3WE2A 1QNTA 2KJCA 3KE2A 1ZYRF 3GEZA 5JFRA 2M5WA 3KZYA 3KP7A 4WXCA 4EMSA 2QQAA 4OIOF 1XGNA 5LHHA 2M1BA 2EWNA 2QBYB 2HEOA 4KDPA 1TTYA 4ZYGA 3QPHA 5H20A 4A0ZA 2CQKA 5A2QZ 2XHKA 4KNYA 3QOPA 4ENKA 2EK5A 4RGXA 5DCMA 3TOAA 3GFIA 2V9VA 2CYYA 1QQIA 2QENA 2RKHA 2Y75A 2XGXA 1OMIA 3E3VA 3JAMK 4P9UA 1RI7A 3MZHA 4MEXF 1O7FA 1QGPA 4ENJA 1USTA 2EA4A 4EM2A 3FMQA 4EJUA 1G6NA 1J2XA 4OMZA 1LB2A 2VC1A 4IRHA 2STWA 3B73A 3G3ZA 5FD6A 2ZBKA 5KK1A 3RDIA 3EQLF 5CVVA 1RZ4A 2BBYA 1T98A 3AAFA 3Q9VA 5ICEA 5DEQA 2EFNA 4L5IA 4CDGA 1ON2A 2P5KA 1KYWA 5E8GA 2H09A 4RAZA 1YFHA 2Q0OA 5K5OA 3T8RA 1S7AA 3IHUA 2XROA 3FMSA 1A04A 2FMLA 2PBIA 4O5VA 3HYIA 4YFKF 5DUIA 4HLXA 3J80Z 3F8BA 3FF5A 1TNSA 3IRRA 1E2XA 1WRJA 2DW4A 2CW0F 4N9IA 4CICA 3GZ6A 1XGOA 3E6MA 2MA3A 1YS6A 1B1BA 2XAGA 4G7ZF 2K4BA 4I2OA 4UXNA 1FYMA 1W5TA 1R5GA 2OBPA 1LNWA 4UVBA 1RNLA 3WODF 1WQ2A 1XN7A 2PMUA 1T39A 2M30A 4MGRA 2EV5A 4HF2A 2IA1A 1PP7U 3QU6A 5FLXK 3RKWA 1MDMA 4LG0B 4LFUA 2OA4A 4WF2A 2GXGA 5L3GA 1R1VA 2FBKA 3NEUA 1OYIA 1LJ9A 2HGCA 5CJ9A 3JSPA 4B09A 3O2PE 4TV7A 5D6EA 5DCFA 2L01A 1TQPA 2PEXA 3EDPA 3FX3A 4O6JA 4CXFA 3C3WA 2HWVA 1ZRDA 1K79A 2QLZA 4EVIA 4M74A 2P7VB 3V7SA 2Z3YA 4ZYDA 4BHCA 1U5TA 3GFLA 4WK8F 4LMYA 1HW2A 1RIOH 5TRDA 3DQVC 4EJWA 1U8RA 2X0LA 3WGGA 1WWXA 3TKYA 1XCBA 4A5NA 2W85A 1KQ0A 1BI2A 2VBYA 2FF4A 5D4RA 1Q1HA 2A07F 2ZJ2A 3H3ZA 4N9HA 3TDZC 3F23A 2BE5F 3KP3A 3V8KA 3V8LA 2O0YA 2DT5A 4ZYEA 5L3CA 4HX8A 2WTEA 2P5LC 3I5UA 5HS9A 5BQTA 1D5VA 2XAQA 2LSOA 5LLQA 1KYZA 5CYVA 2PJPA 1REPC 4ENMA 1B59A 4BYYA 4Q4ZF 1BI0A 4HX4A 4Y13A 4WXHA 5KVRA 5AIPA 2QVOA 3ZPLA 4LK0F 1G4DA 2E1NA 1IXCA 1TW3A 1KA8A 2LF7A 2IP2A 2UXNA 2ZCWA 5JHUA 4R1HA 4I0BA 4S04A 2J5PA 3KCCA 5LRRA 3DFGA 4G7OF 3N97A 1S7OA 4LLLA 2YX7A 2HKXA 3KP4A 1NHAA 3IKVA 4PDKA 4L0YB 1ZG3A 2G7HA 2O03A 5H6RA 1BM9A 1W4MA 4UHTA 3EETA 2MBFA 3DKWA 1DP7P 5K5QA 1IN4A 5ICFA 4OIPF 4EGYA 2Z99A 1W5SA 3WGHA 5HLHA 3DXJF 4U0YA 5D4SA 4G6DA 1ZG5A 2K86A 1ZH5A 1HXDA 2RVCA 4L9VA 4U0VA 1JHFA 1EH6A 3ZMSA 2KIFA 3R0JA 2BEOA 2VXZA 2L54A 3QRFF 1AWCA 4KMUX 1H9TA 3KP5A 1YS7A 5L3EA 1XDSA 2JRTA 3FM5A 3U9GA 3M8EA 2VODA 5HOOA 2HTSA 2XUBA 4HF0A 4DQ2A 3E6BA 2EB7A 3ZMTA 2VOPA 3HHHA 2HR3A 2HQNA 2YU3A 2DBBA 1FYKA 1IN6A 1XMAA 5LGTA 4WCGA 2WWYA 3HTSB 2DK5A 1HW1A 1O3QA 4I01A 2QYOA 1ZAOA 4IRGA 4HZFA 3VODA 2Y0MA 5J8FA 1ZARA 5FB2A 5D8KB 4EJVA 5HS8A 1U2WA 2D1HA 2X4HA 3V8JA 2D45A 1ZGJA 1CF7A 3F72A 1TW2A 1HSTA 4YIIA 2FRHA 2FNPA 4GGGA 3G73A 2ZNZA 2QZ8A 5ICCA 2H6CA 2RQPA 5DCMB 5HDGA 2XAHA 3KP2A 2M87A 1Z1DA 5J8CA 4I98B 1KQ8A 2MH2A 1E17A 4JK1X 4EJOA 4EGZA 1W7PB 1B6AA 2COMA 2ZMEB 2EFWA 2G9WA 2F5EA 1D8KA 3RTRA 1J59A 1SFEA 2NRAC 3SXYA 2FXAA 1R36A 3BP8A 4EJTA 2H94A 1R7JA 1IF1A 6PAXA 1QBJA 4KT5C 3Q5FA 3TOBA 3MZYA 1J0RA 3BJ6A 3IL2A 3GFMA 1EV7A 5LGUA 1O3SA 4K2EA 2CSOA 1B9MA 1IXRC 1P6RA 4LLNA 4L0ZB 4QWQA 4UUVA 2Z33A 3RPQA 1R00A 3MEXA 2E7WA 2UXXA 1TBXA 2KJBA 2JPCA 4KMFA 5H6QA 1OR7A 4HQMA 2XAFA 3V7RA 2AXLA 1KU7A 3E6DA 3SZTA 3J80K 1ZGAA 4I0AA 1UB9A 2ZO4A 1K78A 1LDDA 3WTYC 1I1GA 5DV5A 5HLGA 4U7BA 1EH7A 3ISPA 4XSZF 2CGPA 1GXQA 1GHCA 1IRFA 2NNYA 1BIAA 1IN7A 1RUNA 1Z6TA 2IJLA 4MHGA 4IXAA 1FBSA 3IRQA 3GUDA 4U0WA 3JW4A 3WTVC 3PFIA 4ZZDA 3BPVA 3F8NA 1C0WA 1YG2A 3QAHA 4RS8A 1FPQA 2LKPA 3LA3A 1AOYA 4GXOA 1FBUA 2PG4A 1U78A 2M45A 2Q2EA 1LDJA 5E18F 1MZBA 2IW5A 1TQIA 3ECOA 3LAPA 1QZZA 4KFCA 3EYYA 1HKQA 3LQRA 1DPRA 3COAC 1ONVA 1YIOA 3C7JA 3FXQA 5FD5A 1FBQA 2H6BA 4CZZA 1SFXA 2VE8A 3E97A 2VE9A 4NB5A 4M6YA 3ULQB 1R58A 2OZ6A 2VT3A 4KIBA 3I4PA 4A0XA 5D5UB 5DUKA 3CDHA 2EFPA 1YW8A 2OQGA 3K1PA 3OOPA 5IT9Z 4JBAA 5LHIA 4RGUA 1I5ZA 2L02A 1YQAA 4IVNA 1CF7B 3FWEA 1FP2A 2BV6A 3ABUA 2XASA 2YR2A 2XAJA 4IRIA 2VN2A 3M1EA 5IT9K 5ILSA 2DK8A 5HDKA 1KU9A 2H27A 4UVAA 2XIGA 2HZTA 1IZ1A 2PMHA 1ON1A 2K4JA 4RGRA 2QQ9A 5E17F 3EUHA 2HYGD 2AS5F 2CO5A 4FHTA 1BBYA 5J6XA 2E1CA 4OU0A 3K69A 2KIMA 2DPUA 4IPAA 4WXDA 1ODDA 1PP8F 3F8CA 1I1SA 2KKOA 4HQEA 3J81K 4P5OA 3RKYA 2EA2A 2YSRA 2GQQA 5ICGA 2OD5A 2HOEA 1GVJA 4RB2C 4WWCA 1J9IA 2A3SA 3LQQA 2IPQX 2QWWA 3TO7A 4JQFA 3R6SA 2UWMA 2CWEA 4UV9A 3FZVA 2FBIA 1MD0A 4MTDA 1H0MA 2MLGA 1R1TA 1OYWA 3WU0A 4LK1F 5BOXA 4YFXF 1LDKB 5ED4A 4PGHA 2IA2A 5BMZA 1T6SA 2G7UA 4IHTA 4AIKA 2ZMEA 3K0LA 2DQRA 2EV6A 3CO6C 3K1MA 2E7XA 2Z5UA 1K7AA 3E5XA 4BH9A 3I59B 3WE3A 4MNUA 4I09A 3F8MA 1IRGA 4LB5A 1SD4A 4UV8A 2A69F 5E1XA 2P6TA 2OU2A 3FM3A 1WI9A 3BJAA 1WKMA 4XRFA 1Z6RA 4PZJA 2ELHA 1FC3A 1TNTA 1FY7A 2K02A 4OMYA 5LGNA 4KN7X 3BY6A 3O3KA 3DP7A 3I54A 2VOOA 5HLIA 3FHZA 1ZLKA 4L9NA 1KGSA 2HTJA 2DPDA 3F6OA 1HBXG 3L00A 1OKRA 1PUEE 3IC7A 5D5VB 3VOEA 2NS0A 1FZPB 3DF8A 1ZHFA 2V1UA 5JR3A 2RC4A 3QPTA 3WTTC 4CYDA 4XLPF 1SD5A 3F22A 5ILUA 4A6DA 3ZN1A 4HV6A 4I02A 1P4XA 2EFQA 1MGTA 2JPBA 1IN5A 3ABTA 3KFWX 3KLOA 3R61A 5E1ZB 4EM0B 3JTHA 3WGIA 5CVRA 4HA8A 3KEQA 3SQNA 2V79A 3QP6A 1O3RA 2F5DA 2DFIA 2QM3A 3R60A 1YLFA 3K1NA 3VEPA 3F8FA 4GCVA 5D5XB 3T1BA 1Y0UA 2ACJA 1XB4A 4M71A 3BPXA 3REOA 1BI3A 2V1XA 3WU1B 3WTSC 2FMYA 1S6LA 5DDGA 2D1VA 2A68F 2XRNA 1YTYA 1DUXC 4ESJA 3BOQA 1F4KA 3SZPA 3J81Z 1XSXA 4P55A 4NHJA 3ELKA 2VONA 1S3JA 1L0OC 4RAYA 2OAZA 3I64A 2XV4S 1J7KA 2P5VA 3D0SA 3K2ZA 2EFOA 3L09A 1XD7A 3C18A 3V4GA 2MH9A 2VC0A 2D2WA 4G6QA 4DNCA 1XGSA 3R4KA 4HF1A 4AIHA 2A5YB 1VTNC 4Y15A 2QBYA 4BQAA 4OOIA 3WTZA 4GYGA 2R7FA 4IJAA 1I27A 4XBFA 3T8TA 5FFZA 4HBLA 1LQ1A 2OZUA 1HSJA 1LEAA 1HW5A 1QZYA 5L3BA 3H3UA 1HKTA 2GA2A 2C6YA 4HX7A 4MTEA 2QUFA 3NQOA 2CG4A 3RKXA 3RI4A 3CJNA 2V1DA 5JVTA 3MQ0A 4G7HF 2L3DA 2EV0A 1T0FA 4N0BA 3CUQA 2O61A 3LFKA 4PGGA 1IUYA 3PQJA 3F21A 3KLNA 4H0EA 4U7DA 1SFUA 4KN4X 4EM1A 1BC7C 1ZRFA 2CFXA 1HQCA 1ZREA 3MCZA 5IT3A 3EYIA 2GZWA 2Q8KA 1FNNA 2JSCA 2WV0A 4KICA 3NRVA 4HW0A 1UHWA 4BHBA 1Z91A 5LEJA 1USSA 2PQ8A 4MQVA 1DPUA 2ETHA 2ESNA 3IKTA 4Q48A 3ML6A 3QU3A 4M6XA 4OIRF 3B02A 4EQQA 3GFJA 3TO6A 2IVMA 1LEBA 3I0TA 3M7GA 3GF2A 2ISYA 4P9FA 2PLYA 1QO0D 1ZN2A 1FSEA 3RYRA 3LA2A 4L9JA 2FSWA 4ZH4F 3WG9A 1P4AA 4FX0A 4I7HA 2IT0A 3GLXA 5L3DA 2NAZA 3GXOA 2Z9OA 3L2CA 1BN5A 4HAMA 2VT2A 1KU2A 3W6JB 3P7NA 1R1UA 2ISZA 1YO5C 1JHHA 4G9YA 5F1RA 3I71A 1YW7A 2MLKA 5LHGA 4FT8A 2OQRA 4KA4A 1R5HA 4BXUA 2O3FA 4A12A 3BWGA 2LF8A 3BDDA 3HSRA 3P9CA 1IAWA 2B0LA 3FXRA 1FP1D 2NNNA 4YG2F 1S29A 3ZMUA 3DPLC 3LWFA 5LBQA 4QLCU 4A2UA 3HIFA 2IA0A 2RN7A 3ECHA 4R79A 4L9TA 1G3YA 3ZMDA 3VB2A 3IWFA 2XKOA 4UNOA 3HHGA 2YX4A 5AIQA 2EJRA 3DPTA 4BAYA 3P9IA 4HLYA 4YFNF 3RJPA 2P7CB 2DO7A 3SFZA 3ZN0A 1MJBA 2V6CA 2F5CA 3GWZA 1T2KA 5CVJA 4CO8A 3FXUA 5F64A 2BGCA 3GVAA 3C1DA 1PDNC 1FLIA 1XMKA 4GO1A 2L4MA 3LSTA 3R0AA 4BNCA 4KIGA 2W57A 5DYMA 3TO9A 3HUGA 1F1ZA 3CLOA 4RB1A 1KU3A 4ESBA 1MJ9A 4RB0A 5LEKA 3BJOA 4NQWA 4M73A 1LVAA 2DU9A 3I53A 2MD5A 2ADUA 3GX4X 5D6FA 3RIRA 1K6OA 3P9KA 3PQKA 1D3YA 1TLHB 5FLXZ 2XKPA 3E5UA 2K7LA 2RDPA 4ETSA 1FSHA 2VBZA 1X3UA 4HDVA 2KRFA 3HRUA 2BYVE 2FEZA 3M8FA 2MC3A 5CVIA 1FOKA 2ZFWA 2ESHA 3KEOA 1V3FA 5A2QK 1BJAA 1KQ9A 4HYEA 2GIVA 1B4AA 1O57A 1S8NA 1RUOA 1XDUA 3CUQB 5ERIA 4HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC2 A;  3JAM Z;  4ASN A;  3HSF A;  4AD9 A;  2HQR A;  3O6B B;  4PCQ A;  2GXB A;  1H9G A;  4BHP A;  1K78 B;  1BC8 C;  4Q5S F;  5L3F A;  4LGW A;  2DAO A;  4B8X A;  4WX9 A;  5BPD A;  4O3M A;  2LNB A;  5ILV A;  1G3T A;  3MWM A;  1SMY F;  4LD5 A;  3RPU A;  1FT9 A;  1XCV A;  2XVC A;  5E20 A;  4S05 A;  1SMT A;  3J7A O;  2HFH A;  1JE8 A;  2PFB A;  3LA7 A;  3L7W A;  2FBH A;  1OYY A;  3TGN A;  4KIF A;  4OIN F;  4HV5 A;  3CUO A;  5HVQ C;  2P4W A;  5FO5 A;  3ZMV A;  1V4R A;  4LLG F;  1GXP A;  3HSE A;  5HS7 A;  1BIB A;  1EH8 A;  5DD8 A;  2HDC A;  2VBX A;  4ZYH A;  2A6E F;  3KZZ A;  3L9F A;  1J5Y A;  4A0Y A;  1P92 A;  2RGV A;  2UZK A;  4FX4 A;  2HYF A;  5EEH A;  3MAJ A;  1WSU A;  2ZKZ A;  2HKO A;  3CUQ C;  4M72 A;  4RGS A;  4A5M A;  2KIU A;  1XSV A;  3JTG A;  2NYX A;  4ZZL A;  5E8I A;  2O8X A;  2P8T A;  5LRS A;  1F5T A;  4ESF A;  3MFK A;  1T38 A;  1R22 A;  1OPC A;  3HRM A;  3IWZ A;  5K5R A;  1UCR A;  4CGZ A;  1MJA A;  2W84 A;  1W7P A;  3T0Y A;  3SHF A;  1MKM A;  3D5L A;  4OIQ F;  2IRF G;  4EV0 A;  1SAX A;  1SD6 A;  3ZP5 A;  2RNJ A;  2GWR A;  4XLN F;  5E1W A;  5K1Y A;  4U88 A;  4AVP A;  2LDU A;  4G8X A;  1XGM A;  3FMR A;  3CTA A;  2RV8 A;  4KUM A;  4MEY F;  1L3L A;  5FFX A;  1G3S A;  4LJZ F;  2Y48 A;  1G3W A;  1FYL A;  1U5T C;  1TQM A;  4MQ9 F;  3DEU A;  4GYI A;  4ON0 A;  5D5W B;  3VFZ A;  3K9T A;  1ULY A;  3KP6 A;  4IF4 A;  5DD4 A;  4AWX B;  1P4W A;  4ENN A;  3F6V A;  1QPM A;  3Q9S A;  4KYW A;  4LB6 B;  3QP5 A;  3V7C A;  2JTV A;  2GA1 A;  5FGM A;  2R3S A;  4IHS A;  4UVC A;  5D8L B;  1Z05 A;  1Z9C A;  3JSO A;  3M9A A;  2STT A;  3F3X A;  3WTU C;  4M9Z A;  2DTR A;  2W25 A;  4P96 A;  3ERE D;  1HKS A;  3S2W A;  2J5O A;  1J75 A;  3HRS A;  4D0P A;  4CHU A;  3I59 A;  3T5X A;  3ZMZ A;  1U3E M;  3ZQ7 A;  1R23 A;  4R8H A;  3I58 A;  3GW2 A;  1FX7 A;  1BOA A;  1UFM A;  2FNA A;  3GO5 A;  4M9X A;  1UHM A;  2YPR A;  2M8E A;  3H92 A;  2PN6 A;  4L5J A;  2L4A A;  1JXS A;  2DI3 A;  1DDN A;  1Z7U A;  4HOB A;  3TDU C;  3WTX C;  4Z2Y A;  1SD7 A;  2TDX A;  1W7P D;  1YW9 A;  2FE3 A;  1ZLJ A;  1STZ A;  2FOK A;  3OV8 A;  1B9N A;  3BZ6 A;  3GZ5 A;  3N4M A;  5F6F A;  4E70 A;  4G94 A;  4Y17 A;  3CO7 C;  4Q47 A;  3GYH X;  5EEG A;  3DV8 A;  2FQ3 A;  1I6X A;  3RYP A;  4YIF A;  4RB3 C;  5JI6 A;  5BPI A;  4F7Z A;  1IW7 F;  5AON A;  2DLL A;  3HTU A;  1O7L A;  3E5Q A;  2F5F A;  2PI0 A;  3HRT A;  2HS5 A;  1BI1 A;  2A6H F;  3E6C C;  1O3T A;  3WTW C;  4AIJ A;  5CVU A;  1D8J A;  2VBW A;  2R7D A;  2F2E A;  2ZNY A;  2JT1 A;  1P2F A;  1FWZ A;  1JGS A;  1MDM B;  4LG0 A;  3W6K B;  4L18 B;  4A6E A;  1XSD A;  3U1D A;  3TQN A;  3LAJ A;  2QQB A;  1CGP A;  3KET A;  3HOS A;  5CLS A;  5BS6 A;  4M9S A;  4XSX F;  3HOT A;  2FA5 A;  5HDN A;  2GAU A;  5TJJ A;  2ZXJ A;  3ROU A;  2O6G E;  2P6S A;  1IXS B;  2DQL A;  2FU4 A;  2A61 A;  1F9N A;  2W24 A;  1ZRC A;  1U5T B;  1IN8 A;  1U6G A;  1ZG1 A;  3BRO A;  1YYV A;  2K27 A;  2JZY A;  3U2R A;  3WE2 A;  1QNT A;  2KJC A;  3KE2 A;  1ZYR F;  3GEZ A;  5JFR A;  2M5W A;  3KZY A;  3KP7 A;  4WXC A;  4EMS A;  2QQA A;  4OIO F;  1XGN A;  5LHH A;  2M1B A;  2EWN A;  2QBY B;  2HEO A;  4KDP A;  1TTY A;  4ZYG A;  3QPH A;  5H20 A;  4A0Z A;  2CQK A;  5A2Q Z;  2XHK A;  4KNY A;  3QOP A;  4ENK A;  2EK5 A;  4RGX A;  5DCM A;  3TOA A;  3GFI A;  2V9V A;  2CYY A;  1QQI A;  2QEN A;  2RKH A;  2Y75 A;  2XGX A;  1OMI A;  3E3V A;  3JAM K;  4P9U A;  1RI7 A;  3MZH A;  4MEX F;  1O7F A;  1QGP A;  4ENJ A;  1UST A;  2EA4 A;  4EM2 A;  3FMQ A;  4EJU A;  1G6N A;  1J2X A;  4OMZ A;  1LB2 A;  2VC1 A;  4IRH A;  2STW A;  3B73 A;  3G3Z A;  5FD6 A;  2ZBK A;  5KK1 A;  3RDI A;  3EQL F;  5CVV A;  1RZ4 A;  2BBY A;  1T98 A;  3AAF A;  3Q9V A;  5ICE A;  5DEQ A;  2EFN A;  4L5I A;  4CDG A;  1ON2 A;  2P5K A;  1KYW A;  5E8G A;  2H09 A;  4RAZ A;  1YFH A;  2Q0O A;  5K5O A;  3T8R A;  1S7A A;  3IHU A;  2XRO A;  3FMS A;  1A04 A;  2FML A;  2PBI A;  4O5V A;  3HYI A;  4YFK F;  5DUI A;  4HLX A;  3J80 Z;  3F8B A;  3FF5 A;  1TNS A;  3IRR A;  1E2X A;  1WRJ A;  2DW4 A;  2CW0 F;  4N9I A;  4CIC A;  3GZ6 A;  1XGO A;  3E6M A;  2MA3 A;  1YS6 A;  1B1B A;  2XAG A;  4G7Z F;  2K4B A;  4I2O A;  4UXN A;  1FYM A;  1W5T A;  1R5G A;  2OBP A;  1LNW A;  4UVB A;  1RNL A;  3WOD F;  1WQ2 A;  1XN7 A;  2PMU A;  1T39 A;  2M30 A;  4MGR A;  2EV5 A;  4HF2 A;  2IA1 A;  1PP7 U;  3QU6 A;  5FLX K;  3RKW A;  1MDM A;  4LG0 B;  4LFU A;  2OA4 A;  4WF2 A;  2GXG A;  5L3G A;  1R1V A;  2FBK A;  3NEU A;  1OYI A;  1LJ9 A;  2HGC A;  5CJ9 A;  3JSP A;  4B09 A;  3O2P E;  4TV7 A;  5D6E A;  5DCF A;  2L01 A;  1TQP A;  2PEX A;  3EDP A;  3FX3 A;  4O6J A;  4CXF A;  3C3W A;  2HWV A;  1ZRD A;  1K79 A;  2QLZ A;  4EVI A;  4M74 A;  2P7V B;  3V7S A;  2Z3Y A;  4ZYD A;  4BHC A;  1U5T A;  3GFL A;  4WK8 F;  4LMY A;  1HW2 A;  1RIO H;  5TRD A;  3DQV C;  4EJW A;  1U8R A;  2X0L A;  3WGG A;  1WWX A;  3TKY A;  1XCB A;  4A5N A;  2W85 A;  1KQ0 A;  1BI2 A;  2VBY A;  2FF4 A;  5D4R A;  1Q1H A;  2A07 F;  2ZJ2 A;  3H3Z A;  4N9H A;  3TDZ C;  3F23 A;  2BE5 F;  3KP3 A;  3V8K A;  3V8L A;  2O0Y A;  2DT5 A;  4ZYE A;  5L3C A;  4HX8 A;  2WTE A;  2P5L C;  3I5U A;  5HS9 A;  5BQT A;  1D5V A;  2XAQ A;  2LSO A;  5LLQ A;  1KYZ A;  5CYV A;  2PJP A;  1REP C;  4ENM A;  1B59 A;  4BYY A;  4Q4Z F;  1BI0 A;  4HX4 A;  4Y13 A;  4WXH A;  5KVR A;  5AIP A;  2QVO A;  3ZPL A;  4LK0 F;  1G4D A;  2E1N A;  1IXC A;  1TW3 A;  1KA8 A;  2LF7 A;  2IP2 A;  2UXN A;  2ZCW A;  5JHU A;  4R1H A;  4I0B A;  4S04 A;  2J5P A;  3KCC A;  5LRR A;  3DFG A;  4G7O F;  3N97 A;  1S7O A;  4LLL A;  2YX7 A;  2HKX A;  3KP4 A;  1NHA A;  3IKV A;  4PDK A;  4L0Y B;  1ZG3 A;  2G7H A;  2O03 A;  5H6R A;  1BM9 A;  1W4M A;  4UHT A;  3EET A;  2MBF A;  3DKW A;  1DP7 P;  5K5Q A;  1IN4 A;  5ICF A;  4OIP F;  4EGY A;  2Z99 A;  1W5S A;  3WGH A;  5HLH A;  3DXJ F;  4U0Y A;  5D4S A;  4G6D A;  1ZG5 A;  2K86 A;  1ZH5 A;  1HXD A;  2RVC A;  4L9V A;  4U0V A;  1JHF A;  1EH6 A;  3ZMS A;  2KIF A;  3R0J A;  2BEO A;  2VXZ A;  2L54 A;  3QRF F;  1AWC A;  4KMU X;  1H9T A;  3KP5 A;  1YS7 A;  5L3E A;  1XDS A;  2JRT A;  3FM5 A;  3U9G A;  3M8E A;  2VOD A;  5HOO A;  2HTS A;  2XUB A;  4HF0 A;  4DQ2 A;  3E6B A;  2EB7 A;  3ZMT A;  2VOP A;  3HHH A;  2HR3 A;  2HQN A;  2YU3 A;  2DBB A;  1FYK A;  1IN6 A;  1XMA A;  5LGT A;  4WCG A;  2WWY A;  3HTS B;  2DK5 A;  1HW1 A;  1O3Q A;  4I01 A;  2QYO A;  1ZAO A;  4IRG A;  4HZF A;  3VOD A;  2Y0M A;  5J8F A;  1ZAR A;  5FB2 A;  5D8K B;  4EJV A;  5HS8 A;  1U2W A;  2D1H A;  2X4H A;  3V8J A;  2D45 A;  1ZGJ A;  1CF7 A;  3F72 A;  1TW2 A;  1HST A;  4YII A;  2FRH A;  2FNP A;  4GGG A;  3G73 A;  2ZNZ A;  2QZ8 A;  5ICC A;  2H6C A;  2RQP A;  5DCM B;  5HDG A;  2XAH A;  3KP2 A;  2M87 A;  1Z1D A;  5J8C A;  4I98 B;  1KQ8 A;  2MH2 A;  1E17 A;  4JK1 X;  4EJO A;  4EGZ A;  1W7P B;  1B6A A;  2COM A;  2ZME B;  2EFW A;  2G9W A;  2F5E A;  1D8K A;  3RTR A;  1J59 A;  1SFE A;  2NRA C;  3SXY A;  2FXA A;  1R36 A;  3BP8 A;  4EJT A;  2H94 A;  1R7J A;  1IF1 A;  6PAX A;  1QBJ A;  4KT5 C;  3Q5F A;  3TOB A;  3MZY A;  1J0R A;  3BJ6 A;  3IL2 A;  3GFM A;  1EV7 A;  5LGU A;  1O3S A;  4K2E A;  2CSO A;  1B9M A;  1IXR C;  1P6R A;  4LLN A;  4L0Z B;  4QWQ A;  4UUV A;  2Z33 A;  3RPQ A;  1R00 A;  3MEX A;  2E7W A;  2UXX A;  1TBX A;  2KJB A;  2JPC A;  4KMF A;  5H6Q A;  1OR7 A;  4HQM A;  2XAF A;  3V7R A;  2AXL A;  1KU7 A;  3E6D A;  3SZT A;  3J80 K;  1ZGA A;  4I0A A;  1UB9 A;  2ZO4 A;  1K78 A;  1LDD A;  3WTY C;  1I1G A;  5DV5 A;  5HLG A;  4U7B A;  1EH7 A;  3ISP A;  4XSZ F;  2CGP A;  1GXQ A;  1GHC A;  1IRF A;  2NNY A;  1BIA A;  1IN7 A;  1RUN A;  1Z6T A;  2IJL A;  4MHG A;  4IXA A;  1FBS A;  3IRQ A;  3GUD A;  4U0W A;  3JW4 A;  3WTV C;  3PFI A;  4ZZD A;  3BPV A;  3F8N A;  1C0W A;  1YG2 A;  3QAH A;  4RS8 A;  1FPQ A;  2LKP A;  3LA3 A;  1AOY A;  4GXO A;  1FBU A;  2PG4 A;  1U78 A;  2M45 A;  2Q2E A;  1LDJ A;  5E18 F;  1MZB A;  2IW5 A;  1TQI A;  3ECO A;  3LAP A;  1QZZ A;  4KFC A;  3EYY A;  1HKQ A;  3LQR A;  1DPR A;  3COA C;  1ONV A;  1YIO A;  3C7J A;  3FXQ A;  5FD5 A;  1FBQ A;  2H6B A;  4CZZ A;  1SFX A;  2VE8 A;  3E97 A;  2VE9 A;  4NB5 A;  4M6Y A;  3ULQ B;  1R58 A;  2OZ6 A;  2VT3 A;  4KIB A;  3I4P A;  4A0X A;  5D5U B;  5DUK A;  3CDH A;  2EFP A;  1YW8 A;  2OQG A;  3K1P A;  3OOP A;  5IT9 Z;  4JBA A;  5LHI A;  4RGU A;  1I5Z A;  2L02 A;  1YQA A;  4IVN A;  1CF7 B;  3FWE A;  1FP2 A;  2BV6 A;  3ABU A;  2XAS A;  2YR2 A;  2XAJ A;  4IRI A;  2VN2 A;  3M1E A;  5IT9 K;  5ILS A;  2DK8 A;  5HDK A;  1KU9 A;  2H27 A;  4UVA A;  2XIG A;  2HZT A;  1IZ1 A;  2PMH A;  1ON1 A;  2K4J A;  4RGR A;  2QQ9 A;  5E17 F;  3EUH A;  2HYG D;  2AS5 F;  2CO5 A;  4FHT A;  1BBY A;  5J6X A;  2E1C A;  4OU0 A;  3K69 A;  2KIM A;  2DPU A;  4IPA A;  4WXD A;  1ODD A;  1PP8 F;  3F8C A;  1I1S A;  2KKO A;  4HQE A;  3J81 K;  4P5O A;  3RKY A;  2EA2 A;  2YSR A;  2GQQ A;  5ICG A;  2OD5 A;  2HOE A;  1GVJ A;  4RB2 C;  4WWC A;  1J9I A;  2A3S A;  3LQQ A;  2IPQ X;  2QWW A;  3TO7 A;  4JQF A;  3R6S A;  2UWM A;  2CWE A;  4UV9 A;  3FZV A;  2FBI A;  1MD0 A;  4MTD A;  1H0M A;  2MLG A;  1R1T A;  1OYW A;  3WU0 A;  4LK1 F;  5BOX A;  4YFX F;  1LDK B;  5ED4 A;  4PGH A;  2IA2 A;  5BMZ A;  1T6S A;  2G7U A;  4IHT A;  4AIK A;  2ZME A;  3K0L A;  2DQR A;  2EV6 A;  3CO6 C;  3K1M A;  2E7X A;  2Z5U A;  1K7A A;  3E5X A;  4BH9 A;  3I59 B;  3WE3 A;  4MNU A;  4I09 A;  3F8M A;  1IRG A;  4LB5 A;  1SD4 A;  4UV8 A;  2A69 F;  5E1X A;  2P6T A;  2OU2 A;  3FM3 A;  1WI9 A;  3BJA A;  1WKM A;  4XRF A;  1Z6R A;  4PZJ A;  2ELH A;  1FC3 A;  1TNT A;  1FY7 A;  2K02 A;  4OMY A;  5LGN A;  4KN7 X;  3BY6 A;  3O3K A;  3DP7 A;  3I54 A;  2VOO A;  5HLI A;  3FHZ A;  1ZLK A;  4L9N A;  1KGS A;  2HTJ A;  2DPD A;  3F6O A;  1HBX G;  3L00 A;  1OKR A;  1PUE E;  3IC7 A;  5D5V B;  3VOE A;  2NS0 A;  1FZP B;  3DF8 A;  1ZHF A;  2V1U A;  5JR3 A;  2RC4 A;  3QPT A;  3WTT C;  4CYD A;  4XLP F;  1SD5 A;  3F22 A;  5ILU A;  4A6D A;  3ZN1 A;  4HV6 A;  4I02 A;  1P4X A;  2EFQ A;  1MGT A;  2JPB A;  1IN5 A;  3ABT A;  3KFW X;  3KLO A;  3R61 A;  5E1Z B;  4EM0 B;  3JTH A;  3WGI A;  5CVR A;  4HA8 A;  3KEQ A;  3SQN A;  2V79 A;  3QP6 A;  1O3R A;  2F5D A;  2DFI A;  2QM3 A;  3R60 A;  1YLF A;  3K1N A;  3VEP A;  3F8F A;  4GCV A;  5D5X B;  3T1B A;  1Y0U A;  2ACJ A;  1XB4 A;  4M71 A;  3BPX A;  3REO A;  1BI3 A;  2V1X A;  3WU1 B;  3WTS C;  2FMY A;  1S6L A;  5DDG A;  2D1V A;  2A68 F;  2XRN A;  1YTY A;  1DUX C;  4ESJ A;  3BOQ A;  1F4K A;  3SZP A;  3J81 Z;  1XSX A;  4P55 A;  4NHJ A;  3ELK A;  2VON A;  1S3J A;  1L0O C;  4RAY A;  2OAZ A;  3I64 A;  2XV4 S;  1J7K A;  2P5V A;  3D0S A;  3K2Z A;  2EFO A;  3L09 A;  1XD7 A;  3C18 A;  3V4G A;  2MH9 A;  2VC0 A;  2D2W A;  4G6Q A;  4DNC A;  1XGS A;  3R4K A;  4HF1 A;  4AIH A;  2A5Y B;  1VTN C;  4Y15 A;  2QBY A;  4BQA A;  4OOI A;  3WTZ A;  4GYG A;  2R7F A;  4IJA A;  1I27 A;  4XBF A;  3T8T A;  5FFZ A;  4HBL A;  1LQ1 A;  2OZU A;  1HSJ A;  1LEA A;  1HW5 A;  1QZY A;  5L3B A;  3H3U A;  1HKT A;  2GA2 A;  2C6Y A;  4HX7 A;  4MTE A;  2QUF A;  3NQO A;  2CG4 A;  3RKX A;  3RI4 A;  3CJN A;  2V1D A;  5JVT A;  3MQ0 A;  4G7H F;  2L3D A;  2EV0 A;  1T0F A;  4N0B A;  3CUQ A;  2O61 A;  3LFK A;  4PGG A;  1IUY A;  3PQJ A;  3F21 A;  3KLN A;  4H0E A;  4U7D A;  1SFU A;  4KN4 X;  4EM1 A;  1BC7 C;  1ZRF A;  2CFX A;  1HQC A;  1ZRE A;  3MCZ A;  5IT3 A;  3EYI A;  2GZW A;  2Q8K A;  1FNN A;  2JSC A;  2WV0 A;  4KIC A;  3NRV A;  4HW0 A;  1UHW A;  4BHB A;  1Z91 A;  5LEJ A;  1USS A;  2PQ8 A;  4MQV A;  1DPU A;  2ETH A;  2ESN A;  3IKT A;  4Q48 A;  3ML6 A;  3QU3 A;  4M6X A;  4OIR F;  3B02 A;  4EQQ A;  3GFJ A;  3TO6 A;  2IVM A;  1LEB A;  3I0T A;  3M7G A;  3GF2 A;  2ISY A;  4P9F A;  2PLY A;  1QO0 D;  1ZN2 A;  1FSE A;  3RYR A;  3LA2 A;  4L9J A;  2FSW A;  4ZH4 F;  3WG9 A;  1P4A A;  4FX0 A;  4I7H A;  2IT0 A;  3GLX A;  5L3D A;  2NAZ A;  3GXO A;  2Z9O A;  3L2C A;  1BN5 A;  4HAM A;  2VT2 A;  1KU2 A;  3W6J B;  3P7N A;  1R1U A;  2ISZ A;  1YO5 C;  1JHH A;  4G9Y A;  5F1R A;  3I71 A;  1YW7 A;  2MLK A;  5LHG A;  4FT8 A;  2OQR A;  4KA4 A;  1R5H A;  4BXU A;  2O3F A;  4A12 A;  3BWG A;  2LF8 A;  3BDD A;  3HSR A;  3P9C A;  1IAW A;  2B0L A;  3FXR A;  1FP1 D;  2NNN A;  4YG2 F;  1S29 A;  3ZMU A;  3DPL C;  3LWF A;  5LBQ A;  4QLC U;  4A2U A;  3HIF A;  2IA0 A;  2RN7 A;  3ECH A;  4R79 A;  4L9T A;  1G3Y A;  3ZMD A;  3VB2 A;  3IWF A;  2XKO A;  4UNO A;  3HHG A;  2YX4 A;  5AIQ A;  2EJR A;  3DPT A;  4BAY A;  3P9I A;  4HLY A;  4YFN F;  3RJP A;  2P7C B;  2DO7 A;  3SFZ A;  3ZN0 A;  1MJB A;  2V6C A;  2F5C A;  3GWZ A;  1T2K A;  5CVJ A;  4CO8 A;  3FXU A;  5F64 A;  2BGC A;  3GVA A;  3C1D A;  1PDN C;  1FLI A;  1XMK A;  4GO1 A;  2L4M A;  3LST A;  3R0A A;  4BNC A;  4KIG A;  2W57 A;  5DYM A;  3TO9 A;  3HUG A;  1F1Z A;  3CLO A;  4RB1 A;  1KU3 A;  4ESB A;  1MJ9 A;  4RB0 A;  5LEK A;  3BJO A;  4NQW A;  4M73 A;  1LVA A;  2DU9 A;  3I53 A;  2MD5 A;  2ADU A;  3GX4 X;  5D6F A;  3RIR A;  1K6O A;  3P9K A;  3PQK A;  1D3Y A;  1TLH B;  5FLX Z;  2XKP A;  3E5U A;  2K7L A;  2RDP A;  4ETS A;  1FSH A;  2VBZ A;  1X3U A;  4HDV A;  2KRF A;  3HRU A;  2BYV E;  2FEZ A;  3M8F A;  2MC3 A;  5CVI A;  1FOK A;  2ZFW A;  2ESH A;  3KEO A;  1V3F A;  5A2Q K;  1BJA A;  1KQ9 A;  4HYE A;  2GIV A;  1B4A A;  1O57 A;  1S8N A;  1RUO A;  1XDU A;  3CUQ B;  5ERI A;  4HDU A; 
#chains in the Genus database with same CATH topology
 3TP3 A;  4KIT B;  2WC2 A;  3JAM Z;  3MKZ A;  2O7O A;  4ASN A;  3Q3S A;  2Y30 A;  3HSF A;  1MBF A;  1GV5 A;  4AD9 A;  2HQR A;  3O6B B;  2AHQ A;  4PCQ A;  4XR6 A;  2GXB A;  1H9G A;  4BHP A;  1K78 B;  1BC8 C;  4Q5S F;  1IV8 A;  5L3F A;  2X6Y A;  4HSR A;  4LGW A;  2DAO A;  4B8X A;  4WX9 A;  4XOT A;  5BPD A;  3MMY B;  2LNB A;  4O3M A;  2BW3 B;  1G3T A;  3MWM A;  5J40 A;  5ILV A;  1HLV A;  1SMY F;  2HDW A;  3BR2 A;  4LD5 A;  3RPU A;  2ECC A;  2XB5 A;  1FT9 A;  1XCV A;  2XVC A;  2OUM A;  2L9S A;  5E20 A;  4S05 A;  1SMT A;  3J7A O;  1P9Q C;  2HFH A;  1MSF C;  1JE8 A;  2PFB A;  2CJJ A;  2X1D A;  3OYL A;  3LA7 A;  3L7W A;  2FBH A;  3OL3 A;  3S16 J;  3LSJ A;  1PJR A;  1Y0N A;  1E3H A;  3HEF A;  4XN3 A;  2F4O B;  1OYY A;  1NK3 P;  3TGN A;  4HRI A;  4KIF A;  4OIN F;  4HV5 A;  3CUO A;  4IOA F;  3BTJ A;  2P4W A;  5HVQ C;  4XLH A;  5FO5 A;  2XRL A;  3ZMV A;  1V4R A;  2NOJ B;  4LLG F;  3JRC A;  1GXP A;  2XGE A;  3HSE A;  3A02 A;  5HS7 A;  2VQH A;  3V42 A;  3A01 B;  1BIB A;  2KZV A;  3OR2 C;  1EH8 A;  3DLA A;  3H5A A;  5DD8 A;  1Y1W J;  3KEY A;  5EGO A;  1T56 A;  2O5R A;  2HDC A;  2VBX A;  4ZYH A;  2A6E F;  1YOV B;  2PMZ A;  3KZZ A;  3G2B A;  3L9F A;  3DPU A;  1ZGW A;  4DJA A;  5EF6 A;  3MVP A;  1J5Y A;  2KLO A;  4A0Y A;  5GTH C;  1P92 A;  3QOE A;  1NH3 A;  2RGV A;  2UZK A;  2KIS A;  4FX4 A;  2MW8 A;  2HYF A;  5LD2 C;  3EUK L;  3QOD A;  5EEH A;  1NG7 A;  3MAJ A;  4NNJ A;  5E3M A;  4B47 A;  3VWB A;  1WSU A;  2ICW G;  2ZKZ A;  2QCO A;  1LE8 A;  2HKO A;  3CUQ C;  4M72 A;  2VAS A;  4RGS A;  4A5M A;  4U87 A;  2BOL A;  3ZQC A;  2KIU A;  1XSV A;  3JTG A;  2NYX A;  2OTL I;  4ZZL A;  3G71 I;  5E8I A;  2O8X A;  2P8T A;  5LRS A;  1F5T A;  4ESF A;  3MFK A;  3CF5 F;  3B6A A;  1KZH A;  1T38 A;  4XRM A;  1R22 A;  2WB1 A;  1OPC A;  3SJM A;  1OCO H;  3HRM A;  2P81 A;  2LH9 A;  2DFH A;  2BY0 A;  3IWZ A;  3ZRG A;  2DJI A;  5M3F J;  1I6H J;  5K5R A;  1UCR A;  2DA2 A;  4CGZ A;  1WJF A;  4BU2 A;  1MJA A;  2W84 A;  1W7P A;  3OS2 A;  3T0Y A;  3M1C A;  3SHF A;  3H35 A;  1VQ6 I;  1MKM A;  3D5L A;  4OIQ F;  4XKV A;  1KON A;  4EV0 A;  2IRF G;  1SAX A;  1SD6 A;  3ZP5 A;  2RNJ A;  3CF2 A;  2GWR A;  2MG4 A;  4XLN F;  5E1W A;  3CCM I;  2L5Q A;  5KHD A;  5K1Y A;  3K70 C;  2K9M A;  2ID3 A;  4U88 A;  1WHU A;  4AVP A;  1BR1 A;  5F08 A;  2LDU A;  4DGW B;  1W0T A;  2GIZ A;  1O4X A;  4G8X A;  3PSI A;  2CV1 A;  1XGM A;  3FMR A;  3TED A;  2HNH A;  3CTA A;  2RV8 A;  3HUG B;  3QYB A;  4KUM A;  3JRH A;  1P7J A;  2VJ4 A;  3L2R A;  4ITV A;  1E3P A;  1TP4 A;  1XMX A;  2DA5 A;  2V9K A;  3U1K A;  4DYR A;  2M4K A;  2R7W A;  1ITY A;  1ETX A;  1I50 J;  1YJW I;  2EIN H;  4MEY F;  1L3L A;  5FFX A;  1G3S A;  3BR6 A;  5FJ8 J;  4LJZ F;  2Y48 A;  1G3W A;  1FYL A;  1U5T C;  1NK2 P;  1TQM A;  4MQ9 F;  1OQY A;  4B3X A;  1QA6 A;  3H5R A;  3TW6 A;  3JRD A;  3K4N A;  3DEU A;  4GYI A;  4ON0 A;  3CC7 I;  5D5W B;  3VFZ A;  2ELJ A;  3K9T A;  3BCA A;  1LVK A;  1VQK I;  2VLA A;  1ULY A;  1GDT A;  3KP6 A;  3PIO F;  3NAU A;  1D0X A;  4IF4 A;  2ECB A;  5DD4 A;  1P4W A;  4AWX B;  4ENN A;  3F6V A;  3CCS I;  1QPM A;  3Q9S A;  4KYW A;  3TMO A;  4LB6 B;  3QP5 A;  3V7C A;  3W2W A;  2JTV A;  2GA1 A;  4CUG A;  4A3F J;  5FGM A;  4A3L J;  4BE1 A;  2R3S A;  4Y33 A;  4IHS A;  4UVC A;  1MNE A;  2XB0 X;  5GTI C;  3ZXS A;  3PM1 A;  5D8L B;  4G12 A;  1Z05 A;  2DT7 B;  2BY3 A;  2CS3 A;  1MMN A;  1Z9C A;  2HZD A;  4II2 A;  3JSO A;  3M9A A;  5IP9 J;  2STT A;  3MKY B;  3F3X A;  3WTU C;  4M9Z A;  2DTR A;  2W25 A;  2VKV A;  4B3A A;  3S3M A;  1Z67 A;  4CA0 A;  4P96 A;  4NQW B;  3QYE A;  3ERE D;  1OJL A;  1HKS A;  3OYH A;  3S2W A;  2J5O A;  1J75 A;  2IS6 A;  3HRS A;  4D0P A;  2AXT C;  3DU6 A;  4CHU A;  3I59 A;  1GVD A;  1JJ8 C;  1R71 A;  2DMU A;  2QQ8 A;  4IQ4 A;  1VND A;  2JK3 A;  2LBF B;  3T5X A;  3ZMZ A;  1U3E M;  3S3O A;  1A36 A;  2QSF X;  4UUS A;  3JRF A;  2LC2 A;  5IT9 R;  2DYR H;  3ZQ7 A;  1R23 A;  4R8H A;  3I58 A;  2ZME C;  3BG7 A;  3GW2 A;  4OWR B;  4ZDO A;  3MN2 A;  1FX7 A;  2B7E A;  1BOA A;  1UFM A;  1IG7 A;  2FNA A;  3GO5 A;  4PJL A;  4M9X A;  5JLW A;  1UHM A;  2YPR A;  1ETY A;  3GTM J;  2DMP A;  2M8E A;  3H92 A;  2HYJ A;  2PN6 A;  4NC7 A;  4L5J A;  2L4A A;  4LG3 A;  2CUZ A;  2Z2S B;  1JXS A;  2DI3 A;  3HBL A;  1DDN A;  1Z7U A;  4HOB A;  3TDU C;  3ASO H;  5M5Y J;  3WTX C;  4QPO A;  4XMY A;  4Z2Y A;  1SD7 A;  2TDX A;  1W7P D;  1YW9 A;  2FE3 A;  4PFO A;  3AL0 C;  3FHN A;  1ZLJ A;  1STZ A;  1ZKG A;  2FOK A;  2Y9Y A;  3OV8 A;  2KMU A;  1B9N A;  3HGG A;  1V54 H;  3BZ6 A;  3GZ5 A;  3N4M A;  5F6F A;  3LSK A;  4QTR A;  4BEH B;  4E70 A;  3VSK A;  4G94 A;  3J81 R;  2GBY A;  4Y17 A;  3CO7 C;  2JA2 A;  4Q47 A;  3A01 A;  5GPC A;  3GYH X;  4XID A;  5EEG A;  3DV8 A;  2FQ3 A;  1I6X A;  3RYP A;  4YIF A;  5HOD A;  3AFH A;  4RB3 C;  3D5S C;  5JI6 A;  1PYV A;  5BPI A;  4F7Z A;  3B6C A;  1IW7 F;  3PNT A;  1QZE A;  2LFB A;  3W6V A;  2WAD A;  5AON A;  4D7M A;  2DLL A;  2M34 A;  3BTI A;  1D5Y A;  3HTU A;  1O7L A;  3E5Q A;  3LSG A;  4V2G A;  5IP7 J;  2OCE A;  1B8I A;  2F5F A;  2PI0 A;  2LMD A;  5IYB J;  3HRT A;  4LIV A;  4XKW A;  2HS5 A;  2CW8 A;  1BI1 A;  3ZR8 X;  2R7S A;  1WH5 A;  2UUZ A;  2A6H F;  3E6C C;  1O3T A;  3ESW B;  3WTW C;  4AIJ A;  5CVU A;  2JVH A;  3BR5 A;  2EIK H;  2A6T A;  1D8J A;  2ZNY A;  2VBW A;  1WJE A;  2F2E A;  2R7D A;  4MO7 A;  2JT1 A;  1P2F A;  4N4O B;  3O8G A;  5C44 J;  3FXJ A;  1FWZ A;  1JGS A;  1MDM B;  4LG0 A;  3GBG A;  3W6K B;  2BHY A;  4L18 B;  1VQP I;  4W1U A;  4A6E A;  1X3W B;  3OYD A;  1XSD A;  3G1M A;  3U1D A;  3TQN A;  2ZFU A;  3LAJ A;  4X0G A;  2QQB A;  1VQ7 I;  1CGP A;  2M9H A;  3DTE A;  1MMG A;  4JX4 A;  5C4X J;  2K40 A;  1WVR A;  3KET A;  3HOS A;  5CLS A;  4AVZ A;  2FOW A;  3K10 A;  1OCT C;  5BS6 A;  4M9S A;  4XSX F;  5LFA A;  3HOT A;  2FA5 A;  5M3M J;  2KDO A;  2AO9 A;  4XOP A;  5HDN A;  2GAU A;  5TJJ A;  3Q0V A;  3DCF A;  1RC9 A;  2ZXJ A;  3DBR B;  1N25 A;  3ROU A;  1G8X A;  2VKH A;  2O6G E;  2P6S A;  1IXS B;  2DQL A;  3HOU J;  2FU4 A;  4S0H B;  2A61 A;  1JI8 A;  1F9N A;  1NTC A;  3G1O A;  2W24 A;  1FTT A;  1ZRC A;  1U5T B;  1IN8 A;  1MMA A;  1U6G A;  1ZG1 A;  3BRO A;  1YYV A;  4DYQ A;  4FET A;  2K27 A;  2JZY A;  1JT0 A;  3U2R A;  3WE2 A;  1QNT A;  2KJC A;  2Y2Z A;  3KE2 A;  4BXX J;  1ZYR F;  2P0T A;  4ZDP A;  4G6T B;  4UUT A;  3GEZ A;  3S14 J;  2KRH A;  2GLO A;  3W2V A;  1ZK8 A;  5JFR A;  2M5W A;  3KZY A;  3KP7 A;  4WXC A;  2RRE A;  2QQA A;  4EMS A;  1JKO C;  1XGN A;  2H8R A;  4OIO F;  1SVM A;  2M1B A;  5LHH A;  2EWN A;  2QBY B;  4PFP A;  2R7X A;  4RBO A;  2HEO A;  1BW6 A;  4KDP A;  3AG4 H;  1TTY A;  4ZYG A;  3QPH A;  5H20 A;  1AU7 A;  2L7M P;  3VYU B;  4A0Z A;  4GRI A;  1X58 A;  1ORK A;  2CQK A;  3ONQ A;  5HLT A;  5A2Q Z;  3BLY A;  2XHK A;  4XLE A;  4KNY A;  1VI0 A;  3QOP A;  4ENK A;  2EK5 A;  4RGX A;  5DCM A;  1K83 J;  2X48 A;  3TOA A;  4IHW A;  3GFI A;  2HXI A;  1TC3 C;  2DOD A;  5EYR A;  2V9V A;  2XSJ C;  2CYY A;  1QQI A;  2GOM A;  2QEN A;  4LIU A;  2RKH A;  3OSG A;  1NG6 A;  1T08 B;  2Y75 A;  1MH4 A;  2XGX A;  1OMI A;  1B72 A;  3IH2 A;  5KNL A;  3E3V A;  3JAM K;  3SDG A;  4P9U A;  1RI7 A;  2R4G A;  1X3Z B;  3MZH A;  4MEX F;  1O7F A;  1QGP A;  4ENJ A;  1UST A;  2EA4 A;  4EM2 A;  1VFC A;  3FMQ A;  1SFK A;  2CMP A;  3CC4 I;  4EJU A;  2DXI A;  1G6N A;  1N78 A;  4Y52 J;  1J2X A;  1QVT A;  4OMZ A;  1LB2 A;  2VC1 A;  2LBF A;  4IRH A;  2STW A;  3B73 A;  3G3Z A;  2I10 A;  5FD6 A;  2JSP A;  2ZBK A;  3A52 A;  5E3O A;  5KK1 A;  3RDI A;  3EQL F;  4M3D A;  3EPZ A;  4BBR J;  5DS9 A;  4PUS A;  5CVV A;  5FLX R;  1RZ4 A;  2BBY A;  1T98 A;  5JHF A;  3AAF A;  1ETV A;  5M5W J;  3Q9V A;  5ICE A;  4CCK A;  2KRC A;  5DEQ A;  3GTL J;  2EFN A;  4L5I A;  4CDG A;  1ON2 A;  2P5K A;  2KFD A;  2MSY A;  1KYW A;  2EIJ H;  5E8G A;  2H09 A;  3OWT A;  1ETW A;  2VQG A;  1FMW A;  3E1S A;  3CCQ I;  3GTP J;  4RAZ A;  3OL4 A;  1YFH A;  1AKH B;  1U9N A;  2Q0O A;  3C2B A;  4CZC A;  5K5O A;  3T8R A;  3OR1 C;  1S7A A;  1TT0 A;  3IHU A;  2XRO A;  2O9L A;  3FMS A;  1A04 A;  2FML A;  2PBI A;  4O5V A;  1Y8Q B;  1ETQ A;  1H8A C;  3HYI A;  1VF9 A;  4YFK F;  5DUI A;  4HLX A;  3J80 Z;  1HF0 A;  3F8B A;  3HPG A;  1UG2 A;  3FF5 A;  4B44 A;  4B48 A;  2IGM A;  1TNS A;  1XG1 A;  3IRR A;  1E2X A;  1WRJ A;  2DW4 A;  2CW0 F;  3A03 A;  4CH7 A;  5HNH A;  4N9I A;  4F55 A;  5EG0 A;  3I55 I;  4CIC A;  3VYR B;  3DEW A;  2VL8 A;  3GZ6 A;  1XGO A;  3K4L A;  2NVU B;  3E6M A;  3A0H C;  2MA3 A;  1YS6 A;  1B1B A;  2XAG A;  4G7Z F;  5K7F A;  2K4B A;  2VKD A;  4I2O A;  4UXN A;  3O8H A;  3OOU A;  1FYM A;  1XTA A;  1W5T A;  1R5G A;  3CDI A;  2XF6 A;  2OBP A;  4RA2 A;  1LNW A;  2E19 A;  4UUS B;  3FKI J;  4UVB A;  4IQJ A;  1RNL A;  3WOD F;  1WQ2 A;  3DKX A;  2LG4 A;  2H1L A;  3ZQF A;  1XN7 A;  2PMU A;  2DOE A;  1SAU A;  1B8I B;  3ABK H;  3S17 J;  4UB6 C;  2VJJ A;  2LLK A;  1T39 A;  3OIQ A;  2IS1 A;  2K5C A;  2M30 A;  5BNG A;  4F52 A;  1OR7 C;  4DOZ A;  2HOS A;  4MGR A;  2EV5 A;  1PP7 U;  2IA1 A;  4HF2 A;  2Z1D A;  1EF4 A;  1XC5 A;  1RR8 C;  3QU6 A;  4ABZ A;  5FLX K;  3J7A W;  3RKW A;  1MDM A;  3VPR A;  3LNQ A;  1QU3 A;  4LG0 B;  1ETO A;  4LFU A;  4PJJ A;  5J4Y A;  2R7V A;  3HKZ N;  4BDY A;  2OA4 A;  3I9V 2;  2GXG A;  2WBM A;  4WF2 A;  4C2M J;  2DN0 A;  4FE4 A;  1R1V A;  2FBK A;  5L3G A;  3NEU A;  3CCV I;  1UEL B;  3J7Y J;  1OYI A;  1LJ9 A;  1WJD A;  2HGC A;  3DU5 A;  3QWL A;  4PJ0 C;  4XL9 A;  5CJ9 A;  5J1R A;  3JSP A;  2X98 A;  4B09 A;  1V55 H;  3O2P E;  4TV7 A;  2CUJ A;  1JUM A;  5D6E A;  3RZO J;  1R6R A;  1D1B A;  5DCF A;  2WA0 A;  2L01 A;  1TQP A;  1X1A A;  4ZTF A;  5M5X J;  2PEX A;  3EDP A;  3FX3 A;  4O6J A;  1WH7 A;  3A4C A;  4CXF A;  2CQN A;  3C3W A;  2HWV A;  1ZRD A;  3J7A Y;  2MVT A;  4JP0 A;  1Y1V J;  1K79 A;  3FDY A;  2QEX I;  1MH3 A;  4BKX A;  2Y9Z A;  2MZ4 A;  2QLZ A;  4EVI A;  4M74 A;  2NS8 A;  2P7V B;  3V7S A;  2M0C A;  1GLN A;  2Z3Y A;  4BHC A;  4ZYD A;  1JKQ C;  4YRV A;  4AU7 A;  4A3D J;  1FOY A;  2W4S A;  1U5T A;  2W7N A;  1GUU A;  5B3S H;  2KQR A;  2GXA A;  4JYK A;  3GFL A;  4WK8 F;  2W82 A;  4LMY A;  3RCO A;  1HW2 A;  1RIO H;  5TRD A;  3ZQI A;  3DQV C;  4EJW A;  1U8R A;  5FKK A;  2X0L A;  4DBR A;  3HOX J;  2E5Z A;  4MFE A;  3WGG A;  2X9D A;  4DIQ A;  1WWX A;  3TKY A;  1XCB A;  2JN6 A;  2COB A;  3S1Q J;  3TL4 X;  4A5N A;  3S15 J;  2W85 A;  1KQ0 A;  2VQC A;  2YU9 J;  1OLT A;  1BI2 A;  1Z3Y A;  4A93 J;  1F43 A;  1EKE A;  2VBY A;  2FF4 A;  5D4R A;  1Q1H A;  2AQE A;  1U9O A;  3MKW B;  2A07 F;  3HJE A;  2ZJ2 A;  3H3Z A;  2HPM A;  4NC8 A;  4N9H A;  3TDZ C;  1BR4 A;  3F23 A;  2BE5 F;  3KP3 A;  3M8J A;  4YIR X;  1ZR4 A;  2JMW A;  2R93 J;  2HOA A;  3DEE A;  3V8K A;  2D5V A;  3V8L A;  1RQ6 A;  2O0Y A;  1GV2 A;  2DT5 A;  2X6X A;  4ZYE A;  5L3C A;  1G59 A;  2MFZ A;  4HX8 A;  2WTE A;  4QIW N;  2P5L C;  2XGD A;  3I5U A;  4HNU A;  5HS9 A;  3FKJ A;  5BQT A;  1D5V A;  2XAQ A;  2LSO A;  2HU9 A;  3I3L A;  2DJN A;  5LLQ A;  1KYZ A;  1W1W E;  5CYV A;  1VZ0 A;  2QKL B;  1REP C;  2PJP A;  2Z16 A;  5CKT A;  4ENM A;  1VQM I;  1B59 A;  3GME A;  4BYY A;  4Q4Z F;  1BI0 A;  4HX4 A;  2W00 A;  2L9N A;  2E60 A;  3K4J A;  4Y13 A;  4RMN A;  4WXH A;  5AIP A;  5KVR A;  3PIP F;  1T8I A;  2QVO A;  3ZPL A;  1DGR M;  4LK0 F;  5IOY A;  1G4D A;  2PX9 A;  3KPH A;  1Y6I A;  2E1N A;  5C4J J;  1IXC A;  4CYC B;  1WZ2 A;  1TW3 A;  1UHS A;  1KA8 A;  2K9L A;  2LF7 A;  2IP2 A;  2UXN A;  2ZCW A;  3CME I;  5JHU A;  4GDF A;  2DDB A;  2LVS A;  4R1H A;  4I0B A;  4S04 A;  5FKO A;  5J4V A;  2J5P A;  3KCC A;  5LRR A;  4KIS A;  3DFG A;  5JLX A;  4G7O F;  3RQI A;  2MUN A;  3N97 A;  1S7O A;  4LLL A;  2YX7 A;  2HKX A;  3KP4 A;  1NHA A;  3IKV A;  4PDK A;  4L0Y B;  1ZG3 A;  1K4S A;  2G7H A;  2F5V A;  2VKE A;  2O03 A;  2R7Q A;  3CC2 I;  5H6R A;  1BM9 A;  1W4M A;  4UHT A;  3EET A;  4XN0 A;  2MBF A;  2VB6 A;  4N4N B;  2Q2E B;  3DKW A;  3KIO A;  2RQQ A;  1DP7 P;  5K5Q A;  1IN4 A;  1IC8 A;  1XS9 A;  1WI3 A;  5ICF A;  3JCU C;  4OIP F;  3HOV J;  2CUE A;  2VQL A;  3BTL A;  4BUP A;  3W3C A;  3RQ4 A;  4EGY A;  2Z99 A;  4C9Y A;  2WAQ A;  1JKR C;  2LTP A;  2E1O A;  2E35 A;  3OYE A;  2IXS A;  1W5S A;  1QRY A;  2B9S A;  3LL7 A;  3S1N J;  1W36 D;  2LR8 A;  3WGH A;  5FLV A;  4ZYA A;  5HLH A;  3DXJ F;  4U0Y A;  1FIA A;  3K4C A;  5D4S A;  1B72 B;  4BXF A;  4G6D A;  2LRD A;  1SC7 A;  1ZG5 A;  3HGY A;  2K86 A;  1A31 A;  1ZH5 A;  1HXD A;  1Y39 A;  2RVC A;  1U0J A;  4L9V A;  4U0V A;  1JHF A;  4JX5 A;  1FIP A;  1EH6 A;  3ZMS A;  3PUF A;  2ZC2 A;  3KYC B;  2KIF A;  3R0J A;  2BEO A;  3K2A A;  2VXZ A;  2L54 A;  2LYC A;  3QRF F;  1AWC A;  3CCR I;  4PJN A;  3K4M A;  3KX2 A;  4KMU X;  1R5I D;  2X6W A;  1K61 A;  3J80 R;  1H9T A;  3KP5 A;  2DA7 A;  1UMQ A;  1YS7 A;  5B66 C;  5L3E A;  4XLA A;  1XDS A;  2DYS H;  2JRT A;  3FM5 A;  3U9G A;  2JVG A;  3M8E A;  2KDZ A;  3H3V K;  2VOD A;  1WCM J;  1QPI A;  3TW7 A;  1YIJ I;  5HOO A;  1AKH A;  2HTS A;  3HXL A;  2XUB A;  2HQA A;  4HF0 A;  1P7I A;  4DQ2 A;  3E6B A;  5EEA A;  3CES A;  4LIT A;  4RLF A;  2EB7 A;  2TCT A;  1V5F A;  3OYF A;  3ZMT A;  1OFC X;  2VOP A;  3AG2 H;  1J09 A;  3HHH A;  4IHY A;  3KYL A;  2HR3 A;  1V5G A;  1R49 A;  3K4K A;  3HDD A;  2HQN A;  1JT6 A;  3PNY A;  3AL0 B;  2YU3 A;  4H4K C;  3FXM A;  4P1W A;  2DBB A;  3CQZ J;  3OSF A;  2EH3 A;  4XRS A;  1IN6 A;  1FYK A;  1ZEL A;  1XMA A;  5LGT A;  2Y31 A;  4D1Q A;  4WCG A;  2WWY A;  3HTS B;  2DK5 A;  3GTO J;  2LKS A;  4A3J J;  4UY8 I;  1HW1 A;  4DZJ A;  5B1A H;  1O3Q A;  9ANT A;  2K3F A;  3ABL H;  4I01 A;  3LMM A;  3HM5 A;  4RAG A;  3OYG A;  4M3E A;  2QYO A;  1ZAO A;  4IRG A;  4HZF A;  3VOD A;  4IX7 A;  2Y0M A;  3J7Z I;  5J8F A;  4M3G A;  5JVG F;  2K9Q A;  1ZAR A;  1BJZ A;  2HVQ A;  2M8G X;  4M3B A;  5FB2 A;  5D8K B;  4EJV A;  5HS8 A;  1U2W A;  2WV1 A;  2D1H A;  2X4H A;  3V8J A;  4DZP A;  3BC8 A;  2E1M B;  1ZGJ A;  5GAD J;  2D45 A;  1PVE A;  3EUA A;  3F72 A;  1CF7 A;  1A5J A;  1TW2 A;  1HST A;  2XF7 A;  2KL4 A;  4BQO A;  4YII A;  4HNT A;  2FRH A;  2FNP A;  4GGG A;  4M6V A;  1DQU A;  3G73 A;  2ZNZ A;  2QZ8 A;  5ICC A;  1MMD A;  2H6C A;  3LSR A;  2R5Z A;  2RQP A;  5DCM B;  5HDG A;  2NVQ J;  2OF7 A;  2XAH A;  4IZZ A;  1X19 A;  3KP2 A;  2M87 A;  4XKB A;  1XPX A;  1Z1D A;  3OYA A;  5J8C A;  4I98 B;  3NWS A;  1YIT I;  1KQ8 A;  4BQQ A;  2E36 A;  2EIL H;  2MH2 A;  1E17 A;  4JK1 X;  4EJO A;  4EGZ A;  1W7P B;  5IYD J;  2Y0S N;  1B6A A;  2COM A;  2ZJQ F;  4IOC F;  1ZR2 A;  3F9K A;  2ZME B;  2EFW A;  1UJ8 A;  4M3F A;  2G9W A;  2TRT A;  2F5E A;  3HG9 A;  1D8K A;  2JA7 J;  3RTR A;  1J59 A;  3IV5 A;  1SFE A;  2FQ4 A;  2EZL A;  2NRA C;  3SXY A;  2ZXH A;  2FXA A;  1IGN A;  3BR3 A;  1MSE C;  2JUG A;  4C2U A;  2LKX A;  1R36 A;  3BP8 A;  2A5W A;  4EJT A;  1A6I A;  2H94 A;  1EJ9 A;  1YJ9 I;  4FAS D;  2VXD A;  4IL6 C;  1R7J A;  3S93 A;  3CP2 A;  4OAY A;  2OV7 A;  1MNM C;  1UAA A;  5FKL A;  1IF1 A;  2QSH X;  2DT6 A;  6PAX A;  3QQA A;  1QBJ A;  4FE7 A;  4KT5 C;  4BY7 J;  2HI3 A;  1DU6 A;  3Q5F A;  1Y8R B;  1BR2 A;  2ZJR F;  2BZT A;  3TOB A;  1WPK A;  3MZY A;  1J0R A;  3BJ6 A;  1G2H A;  2V26 A;  2DOA A;  3IL2 A;  4IKF A;  2DFF A;  2OCC H;  3GFM A;  3D5R C;  1EV7 A;  2DMT A;  5LGU A;  1O3S A;  4K2E A;  3CCY A;  2CSO A;  2RAE A;  1YJN I;  1B9M A;  4E6K G;  1IXR C;  1P6R A;  2GM4 A;  4LLN A;  4L0Z B;  2R7U A;  1I3A A;  2JA6 J;  4QWQ A;  1SVO A;  3RZD J;  4UUV A;  2Z33 A;  2DTZ A;  3RPQ A;  3NWT A;  1R00 A;  4FIS A;  3MEX A;  4KT6 A;  4NC6 A;  2E7W A;  4XOR A;  4XRS G;  3OYC A;  2UXX A;  1TBX A;  1IRX A;  4E7H A;  2FJ1 A;  2BY2 A;  2BVM A;  2DA4 A;  2KJB A;  2WY7 Q;  1X4P A;  3H5N A;  4BJT A;  2JPC A;  5IOZ A;  4KMF A;  5H6Q A;  3G6E I;  1OR7 A;  4HQM A;  4PSX A;  4KJZ A;  2EQR A;  3K70 D;  4BE0 A;  2XAF A;  2WAE A;  3V7R A;  1RPW A;  2DMQ A;  2EZH A;  2XGC A;  2AXL A;  3ERM A;  4HG2 A;  4B1R A;  5B1B H;  1KU7 A;  3E6D A;  3SZT A;  2V9P A;  3J80 K;  1XX5 A;  3PO3 J;  1ZGA A;  2R7Z J;  1BA5 A;  4I0A A;  4RM3 A;  1UB9 A;  4I99 C;  5F0F A;  2ZO4 A;  1K78 A;  1LDD A;  4JX6 A;  3WTY C;  4E7J A;  5E3N A;  1VQ4 I;  1UZC A;  4E7Z A;  1I1G A;  5DV5 A;  5HLG A;  5KAF C;  3HB9 A;  4MLO A;  4U7B A;  1EH7 A;  3ISP A;  3UR3 C;  4XSZ F;  2CGP A;  1GXQ A;  4X1E A;  1GHC A;  2IGK A;  1IRF A;  2NNY A;  1BIA A;  1IN7 A;  1RUN A;  1Z6T A;  5IY5 H;  2FX0 A;  2IJL A;  4MHG A;  2CU7 A;  4IXA A;  1JJ6 C;  4E7K A;  1FBS A;  3IRQ A;  3GUD A;  1Z0X A;  4U0W A;  2CQX A;  3JW4 A;  3WTV C;  3PFI A;  5B5E C;  3F8N A;  3BPV A;  4ZZD A;  1C0W A;  1YG2 A;  3QAH A;  4RS8 A;  1FPQ A;  2LKP A;  3LA3 A;  3DKY A;  1AOY A;  2DA1 A;  4GXO A;  1WJB A;  1FBU A;  3JR9 A;  1TZL A;  2H1K A;  2PG4 A;  3BR1 A;  4MFD A;  4C3J J;  1U78 A;  2HQ5 A;  3H9G A;  2M45 A;  4XQF A;  1ZTR A;  4A69 C;  2Q2E A;  3FK6 A;  3CJQ B;  1LDJ A;  4CSW A;  3GTQ J;  3S3N A;  2MC4 A;  3I4N J;  3OIO A;  5E18 F;  1MZB A;  2IW5 A;  1TQI A;  3RPU D;  1IJW C;  3ECO A;  3PUB A;  3LAP A;  1QZZ A;  4KFC A;  5EGO B;  2KIQ A;  2X1C A;  3EYY A;  1HKQ A;  3LQR A;  1DPR A;  2L9V A;  3COA C;  2HVS A;  1ONV A;  4F91 B;  1YIO A;  1RRJ A;  4IHV A;  3C7J A;  1F36 A;  3BQY A;  3BG9 A;  1OCP A;  2CW7 A;  3JRE A;  2K9N A;  3BTC A;  1YHQ I;  3FXQ A;  1TWH J;  5FD5 A;  1FBQ A;  2H6B A;  2LY2 A;  4CZZ A;  4Y4R A;  1SFX A;  2VE8 A;  3E97 A;  5FKM A;  2VE9 A;  4ZTJ A;  4NB5 A;  3FXL A;  2DFE A;  4M6Y A;  1H88 C;  3ULQ B;  2Q1Z B;  2E2J J;  1ERD A;  1R58 A;  2OZ6 A;  1M1E B;  2L0K A;  2UV1 A;  4HNV A;  1LE8 B;  2IS2 A;  2A05 A;  5CPR B;  3ZGK A;  4AID A;  3SFI A;  1Z21 A;  2VT3 A;  4KIB A;  3I4P A;  4A0X A;  5D5U B;  5DUK A;  3CDH A;  2EFP A;  3GLL A;  1YW8 A;  1MBE A;  3FK7 A;  2OQG A;  3K1P A;  3OOP A;  5IT9 Z;  4JBA A;  1I39 A;  5F1J A;  1TL8 A;  4E7L A;  2ZXI A;  2DOF A;  3SZG A;  5LHI A;  4RGU A;  2V1N A;  1MBK A;  1I5Z A;  5J1U A;  2L02 A;  1UG0 A;  1YQA A;  4IVN A;  1CF7 B;  2HXO A;  2HVR A;  3FWE A;  1FP2 A;  3Q0U A;  1BOB A;  3CCJ I;  2BV6 A;  3ABU A;  2XAS A;  2YR2 A;  4XLF A;  2XAJ A;  1T0F C;  3PFY A;  4NBQ A;  4IRI A;  2MD0 A;  4BQN A;  2VN2 A;  3M1E A;  2R5Z B;  4CCO A;  4B4C A;  2NVT J;  3OYN A;  5IT9 K;  4BL0 B;  2WAQ N;  3GTG J;  5ILS A;  2DK8 A;  5F27 A;  5HDK A;  2DA3 A;  1KU9 A;  2H27 A;  4UVA A;  2XIG A;  2HZT A;  1IZ1 A;  2ME6 A;  2X1E A;  4X6A J;  2PMH A;  3K4B A;  1ON1 A;  2K4J A;  1BW5 A;  3G4S I;  4RGR A;  2IGO A;  2EPF A;  4CCJ A;  1E0E A;  2QQ9 A;  3BCB A;  5E17 F;  3EUH A;  2HYG D;  5GP9 A;  2AS5 F;  2CO5 A;  4FHT A;  1BBY A;  5H2F C;  5J6X A;  2E1C A;  4OU0 A;  3K69 A;  2KIM A;  5DTD A;  2F6C A;  4PK4 A;  2DPU A;  4IPA A;  3HPH A;  4E4H A;  4WXD A;  1MBJ A;  1K6Y A;  1ODD A;  5EDN A;  4ZJZ A;  1PP8 F;  3W2A A;  3WU2 C;  3F8C A;  1YRN A;  2CH0 A;  1I1S A;  2QKM B;  2KKO A;  2XC7 A;  4HQE A;  3J81 K;  4P5O A;  3RKY A;  2EA2 A;  2ME0 A;  2YSR A;  2GQQ A;  5ICG A;  2LY1 A;  5TIS C;  3S2D J;  3FBN B;  1YX3 A;  2OD5 A;  3K6G A;  2HOE A;  1GVJ A;  4RB2 C;  2JA8 J;  4WWC A;  1J9I A;  4BS9 A;  4V2F A;  3OYB A;  2A3S A;  3LQQ A;  3JRB A;  2IPQ X;  1DGW Y;  2QWW A;  3TO7 A;  5EZG A;  3DTK A;  2M35 A;  4JQF A;  3HOW J;  3PO2 J;  3R6S A;  4HEA 2;  4A3G J;  3NAR A;  3HOY J;  3AG3 H;  1JUS A;  2UWM A;  2CWE A;  4UV9 A;  3FZV A;  2X6O A;  2FBI A;  1MD0 A;  3VDX A;  4MTD A;  1TT5 B;  1H0M A;  2MLG A;  4MIM A;  2OC6 A;  1R1T A;  3L2V A;  1A6Q A;  1OYW A;  2W1O A;  1APL C;  3WU0 A;  3S1R J;  4LK1 F;  5BOX A;  2IGN A;  4YFX F;  4FCY A;  3HL2 A;  3JRG A;  1LDK B;  3S1M J;  5ED4 A;  4PGH A;  2IA2 A;  5EZH A;  1T6S A;  5BMZ A;  2G7U A;  1A35 A;  4IHT A;  4AIK A;  2ZME A;  3GZN B;  3K0L A;  4GFB A;  2DQR A;  2WB1 N;  2EV6 A;  2QGU A;  2B63 J;  3CO6 C;  3K1M A;  4QSH A;  2E7X A;  2Z5U A;  3FIS A;  1K7A A;  3E5X A;  3SEZ A;  4BH9 A;  3CMY A;  3I59 B;  1D1C A;  2BY1 A;  3OYM A;  3CMM A;  3WE3 A;  4MNU A;  2OJE D;  4I09 A;  2VPR A;  3F8M A;  2WY8 Q;  1OCZ H;  4LB5 A;  1SD4 A;  4Y3O A;  5HNF A;  1IRG A;  4UV8 A;  2A69 F;  2BHZ A;  5E1X A;  2P6T A;  2VUM J;  2OU2 A;  3FM3 A;  4A3E J;  1WI9 A;  3JAM R;  3BJA A;  1WKM A;  4XRF A;  1Z6R A;  4PZJ A;  2ELH A;  3G1L A;  4XK4 A;  3Q0W A;  2Y0S A;  1FC3 A;  1TNT A;  1FY7 A;  2MYS A;  2QSG X;  1JGG A;  2K02 A;  4OMY A;  3L2W A;  4ANJ A;  4KN7 X;  5LGN A;  3OYK A;  3CMA I;  3BY6 A;  1PUF B;  3O3K A;  4IO9 F;  4C3H J;  3JRI A;  2P0W A;  2DA6 A;  3OY9 A;  3DP7 A;  1U8B A;  3I54 A;  2VOO A;  5HLI A;  5TGT A;  1VQ5 I;  3FHZ A;  1ZLK A;  1T33 A;  2R92 J;  3DLL F;  2JQ7 A;  4L9N A;  1LFB A;  1KGS A;  1X1C A;  2HTJ A;  3QYF A;  2DPD A;  3F6O A;  1HBX G;  3L00 A;  1OKR A;  1PUE E;  3OS0 A;  3RSN A;  3IC7 A;  5D5V B;  1I3Q J;  4BEH A;  2CFO A;  1DU0 A;  2W48 A;  3VOE A;  2NS0 A;  1FZP B;  3VSL A;  3DF8 A;  1ZHF A;  2LRE A;  2XF5 A;  2V1U A;  1H89 C;  5JR3 A;  2RC4 A;  3QPT A;  3WTT C;  4CYD A;  4XLP F;  3JRA A;  4BDZ A;  5J1Y A;  4XKC A;  3HC7 A;  4AYB A;  1SD5 A;  3F22 A;  4RDU A;  5ILU A;  4A6D A;  3ZN1 A;  3AG1 H;  1Q1V A;  4HV6 A;  4I02 A;  1X2N A;  1P4X A;  2EFQ A;  1MGT A;  2QF7 A;  2JPB A;  1IN5 A;  3ABT A;  3KFW X;  3KLO A;  3ZOB A;  3R61 A;  1IO2 A;  5E1Z B;  3OS1 A;  2ZSI B;  4EM0 B;  2E71 A;  3JTH A;  3WGI A;  3H1C A;  5CVR A;  4HA8 A;  3KEQ A;  3U21 A;  3SQN A;  1X4O A;  2V79 A;  3QP6 A;  5FRO A;  1O3R A;  2F5D A;  3CDL A;  2DFI A;  2QM3 A;  3R60 A;  2VJ5 A;  4CCM A;  4E7S A;  3VYS B;  1Z3X A;  2MAB A;  1YLF A;  3K1N A;  3VEP A;  3F8F A;  4PSW A;  4GCV A;  3L2U A;  5D5X B;  2CV2 A;  3T1B A;  1Y0U A;  4BBS J;  2ACJ A;  4EAT A;  5DM6 F;  1XB4 A;  3ZQH A;  2ZB9 A;  1YE9 A;  4M71 A;  1AA7 A;  3BPX A;  3REO A;  1BI3 A;  2V6E A;  5CQG A;  2V1X A;  2MGQ A;  3WTS C;  3WU1 B;  2FMY A;  1S6L A;  5DDG A;  5K7Z A;  1IUF A;  2D1V A;  3M4O J;  3RKQ A;  2A68 F;  2R5Y A;  1AHD P;  2JWT A;  3IH4 A;  3MZ8 A;  3CP8 A;  2XRN A;  4BY1 J;  1YTY A;  1DUX C;  3ZQQ A;  1LKX A;  5FLM J;  4ESJ A;  1DP3 A;  1S9H A;  3BOQ A;  1MBH A;  2YS9 A;  3SYT A;  1F4K A;  3IH3 A;  3SZP A;  5EJC A;  3J81 Z;  2HPI A;  5F0C A;  2X85 A;  2XDV A;  4FTH A;  4HST A;  4AYB N;  2OPT A;  1XSX A;  3HZJ A;  4P55 A;  4NHJ A;  4RAF A;  3ELK A;  4J19 A;  2VON A;  2QA4 I;  1S3J A;  1L0O C;  4J01 A;  3H9Q A;  4RAY A;  2OAZ A;  1RKT A;  4BE2 A;  3GCM A;  2WAF A;  2XV4 S;  3I64 A;  1R9T J;  3BG6 A;  4BAC A;  1ETK A;  1J7K A;  1W0U A;  2P5V A;  3L1P A;  3D0S A;  2BVL A;  3LOC A;  1Z7L A;  3WG7 H;  3K2Z A;  2EFO A;  2O8K A;  3L09 A;  2EZI A;  1XD7 A;  4A3I J;  3ZQL A;  3C18 A;  3V4G A;  1IRZ A;  2ZJP F;  2IAI A;  2MH9 A;  2VC0 A;  1FMV A;  2AQF A;  1YRN B;  2LP0 A;  2D2W A;  3CCE I;  4G6Q A;  4DNC A;  1XGS A;  3R4K A;  4HF1 A;  1MMS A;  4AIH A;  4NDL A;  2A5Y B;  1S7E A;  2L2O A;  4Y15 A;  1VTN C;  2QBY A;  4BQA A;  4OOI A;  3WTZ A;  2NVY J;  4GYG A;  3K7A J;  1LPQ A;  2R7F A;  5IP6 A;  4IJA A;  1I27 A;  1QHH D;  3N05 A;  4XBF A;  3T8T A;  5FFZ A;  2V7F A;  4HBL A;  1LQ1 A;  2OZU A;  1WJ5 A;  1HSJ A;  2VJI A;  1LEA A;  1HW5 A;  1QZY A;  1OCR H;  5L3B A;  3EUH C;  1HCR A;  1R4M B;  3H3U A;  1SAN A;  3LSH A;  1Z77 A;  1HKT A;  3LFU A;  2GA2 A;  1E3O C;  2C6Y A;  4HX7 A;  4MTE A;  2R7O A;  3KZI C;  2QUF A;  3NQO A;  2DDA A;  4UB8 C;  2CG4 A;  3RKX A;  2PJR B;  3RI4 A;  3CJN A;  2V1D A;  2XAU A;  2ZXW H;  2KZG A;  5JVT A;  4J00 A;  2K85 A;  3MQ0 A;  4G7H F;  2L3D A;  2N8G A;  2EV0 A;  1T0F A;  4N0B A;  3CUQ A;  2O61 A;  2XPW A;  3LFK A;  1FJL A;  4PGG A;  1IUY A;  2KT0 A;  3PQJ A;  4I6Z A;  3F21 A;  1X2M A;  3KLN A;  4H0E A;  1RR7 A;  4U7D A;  1SFU A;  4KN4 X;  4EM1 A;  1BC7 C;  4IEJ A;  4CCL A;  1IDZ A;  2L7Z A;  1ZRF A;  1EA3 A;  2CFX A;  2FUG 2;  1YX5 A;  1HQC A;  1K4T A;  1ZRE A;  3MCZ A;  2CRG A;  5IT3 A;  1LFU P;  2GZW A;  3EYI A;  1FNN A;  2JSC A;  2WV0 A;  2Q8K A;  4KIC A;  3X2Q H;  3NRV A;  4XM3 A;  2HDD A;  1VQ8 I;  4HW0 A;  2NXN B;  1UHW A;  4BHB A;  1Z91 A;  1WGX A;  2BW3 A;  4YEJ A;  3LSI A;  5LEJ A;  1D0Y A;  3UNG C;  1USS A;  4A3C J;  2PQ8 A;  3IUO A;  4QPQ A;  1S5L C;  4MQV A;  1DPU A;  5E79 C;  4CYC A;  2ETH A;  2ESN A;  3IKT A;  2VPL A;  4Q48 A;  2CV0 A;  1PUF A;  3FIW A;  4W97 A;  1OIS A;  3ML6 A;  3GTK J;  2F4I A;  3TP0 A;  3L2Q A;  1HDD C;  3QU3 A;  3BZK A;  4XNF A;  1JKP C;  4M6X A;  4OAZ A;  3KYD B;  5GPA A;  4OIR F;  3CJT B;  3WHB A;  4XON A;  3B02 A;  2I5U A;  4EQQ A;  3GFJ A;  3TO6 A;  4XIC A;  1HDP A;  2IVM A;  3AKZ A;  4BJ5 C;  3BZC A;  3PL8 A;  1POG A;  3HOZ J;  1LEB A;  2R7R A;  3I0T A;  5EG0 B;  5FRM A;  3M7G A;  5CQE A;  3VYT B;  4L5E A;  2M4G A;  2L7K A;  3GF2 A;  3H0G J;  2ISY A;  4P9F A;  3MD2 A;  1S72 I;  2PLY A;  4A3K J;  1QO0 D;  2M7A A;  1ZN2 A;  4ZDL A;  1FSE A;  4ZC3 A;  3RYR A;  2X51 A;  3LA2 A;  5K7H A;  4L9J A;  1VQO I;  2NVX J;  2FSW A;  4ZH4 F;  4B43 A;  1OCC H;  2IEK A;  2LOO A;  5GAG J;  1LUJ B;  3BQZ A;  3WG9 A;  1P4A A;  3HKZ A;  3BG5 A;  4FX0 A;  4HPQ A;  4I7H A;  1VQ9 I;  2IT0 A;  3QPL A;  3GLX A;  5L3D A;  2NAZ A;  3QPS A;  3GXO A;  4D5C A;  3M07 A;  2Z9O A;  3L2C A;  5FRN A;  1BN5 A;  4HAM A;  2VT2 A;  3ASN H;  2XPV A;  1KU2 A;  3W6J B;  3P7N A;  1VQL I;  1JTX A;  1R1U A;  2ISZ A;  1YO5 C;  4YEL A;  3P5J A;  5E3L A;  1JHH A;  4G9Y A;  5FKN A;  1QHG A;  3C2H A;  1IDY A;  2E5N A;  3I71 A;  4LOC A;  5F1R A;  1YW7 A;  4D7N A;  3I56 I;  2HOT A;  4A3M J;  1MBG A;  5J47 A;  2MLK A;  5LHG A;  2L9R A;  4FT8 A;  4EEF G;  1RKW A;  2OQR A;  4KA4 A;  1R5H A;  4BXU A;  2G0E A;  2O3F A;  4D9J A;  3OYI A;  4A12 A;  3BWG A;  5GAH J;  2LF8 A;  4DBQ A;  2K9S A;  3BDD A;  3HSR A;  3P9C A;  1GT0 C;  1IAW A;  2B0L A;  3FXR A;  1FP1 D;  4XLC A;  2LY9 A;  2NNN A;  4YG2 F;  3E0J B;  2R0Q C;  3FBI B;  1VQN I;  4AUX A;  2JRM A;  1N77 A;  3CZ6 A;  1JTY A;  1S29 A;  2E1M C;  3C2G A;  3ZMU A;  1R4N B;  1D0Z A;  4DYC A;  1TWC J;  2GOX B;  3DPL C;  1T95 A;  4F3Q A;  3LWF A;  5LBQ A;  3BT9 A;  1TWG J;  1MW7 A;  4QLC U;  3LSM A;  4A2U A;  3HIF A;  2IA0 A;  2I8D A;  2RN7 A;  2F48 A;  5C3E J;  3ECH A;  3M3Y J;  2E2I J;  5F0H A;  1HOM A;  4R79 A;  2DMN A;  4L9T A;  1G3Y A;  4AC0 A;  3ZMD A;  3VB2 A;  3IWF A;  4F93 B;  1FOW A;  2IBD A;  3DBL B;  4PJM A;  1ENH A;  2XKO A;  4BJ6 C;  4UNO A;  3BR0 A;  3HHG A;  3SEQ A;  2H8W A;  1SFO J;  1HC8 A;  1WJC A;  2YX4 A;  5AIQ A;  4DW6 A;  2EJR A;  1IV6 A;  3DPT A;  3OIP A;  3DTI A;  2OTJ I;  4RM2 A;  2KHM A;  1SVL A;  4BAY A;  2E34 A;  4AM3 A;  3P9I A;  4HLY A;  3CJR B;  1FEX A;  4YFN F;  3RJP A;  2P7C B;  2DO7 A;  3ABM H;  3SFZ A;  3S2H J;  2CUF A;  2XSD C;  1ACI A;  4V19 K;  3ZN0 A;  2R5Y B;  3S8P A;  1MJB A;  2V6C A;  2F5C A;  3GWZ A;  5F04 A;  1T2K A;  3DWL E;  1TWF J;  2FD5 A;  2EBI A;  3IP4 B;  5A2Q R;  5CVJ A;  4CO8 A;  3FXU A;  3H36 A;  5F64 A;  3D1N I;  3BG3 A;  2CQ7 A;  2K3P A;  2BGC A;  3SDB A;  3GVA A;  3ZQG A;  3CCL I;  1V5E A;  4CCN A;  1X1P A;  3E7L A;  3C1D A;  4D5F A;  3H9J A;  2M2E A;  2F4M B;  1PDN C;  1FLI A;  2LK2 A;  2Y69 H;  2M0M A;  1XMK A;  4GO1 A;  2L4M A;  2R7T A;  2VI6 A;  2ID6 A;  3LST A;  3CLQ A;  3R0A A;  4BNC A;  1WJA A;  4KIG A;  2W57 A;  5DYM A;  3TO9 A;  3I4M J;  3HUG A;  4C30 A;  1W5C C;  3PJR A;  1F1Z A;  3CLO A;  1ZQ3 P;  2NOG A;  3OMY A;  1W36 C;  4RB1 A;  1KU3 A;  3UKG A;  2YUS A;  4ESB A;  1MJ9 A;  4RB0 A;  1BL0 A;  3A0B C;  5LEK A;  3BJO A;  5KAI C;  1FOX A;  1QVU A;  3F0C A;  4NQW A;  3OYJ A;  4M73 A;  1LVA A;  2DU9 A;  2LD5 A;  4NUB A;  4Z6Y A;  4C3I J;  3I53 A;  2MD5 A;  1D1A A;  1TWA J;  2ADU A;  3DBH B;  3GX4 X;  1JUP A;  5D6F A;  3RIR A;  1WFX A;  5KCM A;  4FQG A;  2V4J C;  4F92 B;  1K6O A;  2JA5 J;  3P9K A;  3H0D A;  1RET A;  3PQK A;  1D3Y A;  1N75 A;  3CCU I;  2DCE A;  3PSF A;  1TLH B;  5FLX Z;  2XKP A;  3E5U A;  2K7L A;  2RDP A;  2L7F P;  4ETS A;  2KPM A;  2VBZ A;  4BGD A;  1FSH A;  1X3U A;  5IYC J;  2M3A A;  4HDV A;  2IS4 A;  2E2H J;  2XPU A;  2KRF A;  2ELK A;  3S32 A;  3HRU A;  2BYV E;  1LFP A;  2CQQ A;  2FEZ A;  3M8F A;  4JOM A;  2MC3 A;  2RNG A;  5CVI A;  1RES A;  1Y56 A;  1SEU A;  1MIJ A;  5GAE J;  1FOK A;  2ZFW A;  2ESH A;  4A3B J;  3LSP A;  3MKL A;  2JUC A;  3ZCO A;  3KEO A;  1MND A;  3FXO A;  1CQT A;  1V3F A;  5A2Q K;  1HA8 A;  2BXZ A;  1BJA A;  3IAS 2;  3CD6 I;  3TBI A;  3IAM 2;  1KQ9 A;  4E7I A;  4HYE A;  2NS7 A;  5IPA A;  1X1D A;  1B4A A;  2GIV A;  3WHC A;  4Y7N J;  2EIM H;  5J3L A;  2PJR A;  4RLQ A;  2ZSH B;  1O57 A;  1S8N A;  4II3 A;  1RUO A;  2EZK A;  2M7B A;  2JJ7 A;  1X1B A;  4C2T A;  3FXK A;  4I76 A;  3PNV A;  1XDU A;  2VIX A;  3CUQ B;  5DM7 F;  1YI2 I;  3GTJ J;  2KP6 A;  5ERI A;  2BXY A;  4HDU A;  1FTZ A;  2PMZ N;  3A1Y A;  4IHX A;  3A2K A; 
#chains in the Genus database with same CATH homology
 2WC2 A;  3JAM Z;  4ASN A;  3HSF A;  4AD9 A;  2HQR A;  3O6B B;  4PCQ A;  2GXB A;  1H9G A;  4BHP A;  1K78 B;  1BC8 C;  4Q5S F;  5L3F A;  4LGW A;  2DAO A;  4B8X A;  4WX9 A;  5BPD A;  4O3M A;  2LNB A;  5ILV A;  1G3T A;  3MWM A;  1SMY F;  4LD5 A;  3RPU A;  1FT9 A;  1XCV A;  2XVC A;  5E20 A;  4S05 A;  1SMT A;  3J7A O;  2HFH A;  1JE8 A;  2PFB A;  3LA7 A;  3L7W A;  2FBH A;  1OYY A;  3TGN A;  4KIF A;  4OIN F;  4HV5 A;  3CUO A;  5HVQ C;  2P4W A;  5FO5 A;  3ZMV A;  1V4R A;  4LLG F;  1GXP A;  3HSE A;  5HS7 A;  1BIB A;  1EH8 A;  5DD8 A;  2HDC A;  2VBX A;  4ZYH A;  2A6E F;  3KZZ A;  3L9F A;  1J5Y A;  4A0Y A;  1P92 A;  2RGV A;  2UZK A;  4FX4 A;  2HYF A;  5EEH A;  3MAJ A;  1WSU A;  2ZKZ A;  2HKO A;  3CUQ C;  4M72 A;  4RGS A;  4A5M A;  2KIU A;  1XSV A;  3JTG A;  2NYX A;  4ZZL A;  5E8I A;  2O8X A;  2P8T A;  5LRS A;  1F5T A;  4ESF A;  3MFK A;  1T38 A;  1R22 A;  1OPC A;  3HRM A;  3IWZ A;  5K5R A;  1UCR A;  4CGZ A;  1MJA A;  2W84 A;  1W7P A;  3T0Y A;  3SHF A;  1MKM A;  3D5L A;  4OIQ F;  2IRF G;  4EV0 A;  1SAX A;  1SD6 A;  3ZP5 A;  2RNJ A;  2GWR A;  4XLN F;  5E1W A;  5K1Y A;  4U88 A;  4AVP A;  2LDU A;  4G8X A;  1XGM A;  3FMR A;  3CTA A;  2RV8 A;  4KUM A;  4MEY F;  1L3L A;  5FFX A;  1G3S A;  4LJZ F;  2Y48 A;  1G3W A;  1FYL A;  1U5T C;  1TQM A;  4MQ9 F;  3DEU A;  4GYI A;  4ON0 A;  5D5W B;  3VFZ A;  3K9T A;  1ULY A;  3KP6 A;  4IF4 A;  5DD4 A;  4AWX B;  1P4W A;  4ENN A;  3F6V A;  1QPM A;  3Q9S A;  4KYW A;  4LB6 B;  3QP5 A;  3V7C A;  2JTV A;  2GA1 A;  5FGM A;  2R3S A;  4IHS A;  4UVC A;  5D8L B;  1Z05 A;  1Z9C A;  3JSO A;  3M9A A;  2STT A;  3F3X A;  3WTU C;  4M9Z A;  2DTR A;  2W25 A;  4P96 A;  3ERE D;  1HKS A;  3S2W A;  2J5O A;  1J75 A;  3HRS A;  4D0P A;  4CHU A;  3I59 A;  3T5X A;  3ZMZ A;  1U3E M;  3ZQ7 A;  1R23 A;  4R8H A;  3I58 A;  3GW2 A;  1FX7 A;  1BOA A;  1UFM A;  2FNA A;  3GO5 A;  4M9X A;  1UHM A;  2YPR A;  2M8E A;  3H92 A;  2PN6 A;  4L5J A;  2L4A A;  1JXS A;  2DI3 A;  1DDN A;  1Z7U A;  4HOB A;  3TDU C;  3WTX C;  4Z2Y A;  1SD7 A;  2TDX A;  1W7P D;  1YW9 A;  2FE3 A;  1ZLJ A;  1STZ A;  2FOK A;  3OV8 A;  1B9N A;  3BZ6 A;  3GZ5 A;  3N4M A;  5F6F A;  4E70 A;  4G94 A;  4Y17 A;  3CO7 C;  4Q47 A;  3GYH X;  5EEG A;  3DV8 A;  2FQ3 A;  1I6X A;  3RYP A;  4YIF A;  4RB3 C;  5JI6 A;  5BPI A;  4F7Z A;  1IW7 F;  5AON A;  2DLL A;  3HTU A;  1O7L A;  3E5Q A;  2F5F A;  2PI0 A;  3HRT A;  2HS5 A;  1BI1 A;  2A6H F;  3E6C C;  1O3T A;  3WTW C;  4AIJ A;  5CVU A;  1D8J A;  2VBW A;  2R7D A;  2F2E A;  2ZNY A;  2JT1 A;  1P2F A;  1FWZ A;  1JGS A;  1MDM B;  4LG0 A;  3W6K B;  4L18 B;  4A6E A;  1XSD A;  3U1D A;  3TQN A;  3LAJ A;  2QQB A;  1CGP A;  3KET A;  3HOS A;  5CLS A;  5BS6 A;  4M9S A;  4XSX F;  3HOT A;  2FA5 A;  5HDN A;  2GAU A;  5TJJ A;  2ZXJ A;  3ROU A;  2O6G E;  2P6S A;  1IXS B;  2DQL A;  2FU4 A;  2A61 A;  1F9N A;  2W24 A;  1ZRC A;  1U5T B;  1IN8 A;  1U6G A;  1ZG1 A;  3BRO A;  1YYV A;  2K27 A;  2JZY A;  3U2R A;  3WE2 A;  1QNT A;  2KJC A;  3KE2 A;  1ZYR F;  3GEZ A;  5JFR A;  2M5W A;  3KZY A;  3KP7 A;  4WXC A;  4EMS A;  2QQA A;  4OIO F;  1XGN A;  5LHH A;  2M1B A;  2EWN A;  2QBY B;  2HEO A;  4KDP A;  1TTY A;  4ZYG A;  3QPH A;  5H20 A;  4A0Z A;  2CQK A;  5A2Q Z;  2XHK A;  4KNY A;  3QOP A;  4ENK A;  2EK5 A;  4RGX A;  5DCM A;  3TOA A;  3GFI A;  2V9V A;  2CYY A;  1QQI A;  2QEN A;  2RKH A;  2Y75 A;  2XGX A;  1OMI A;  3E3V A;  3JAM K;  4P9U A;  1RI7 A;  3MZH A;  4MEX F;  1O7F A;  1QGP A;  4ENJ A;  1UST A;  2EA4 A;  4EM2 A;  3FMQ A;  4EJU A;  1G6N A;  1J2X A;  4OMZ A;  1LB2 A;  2VC1 A;  4IRH A;  2STW A;  3B73 A;  3G3Z A;  5FD6 A;  2ZBK A;  5KK1 A;  3RDI A;  3EQL F;  5CVV A;  1RZ4 A;  2BBY A;  1T98 A;  3AAF A;  3Q9V A;  5ICE A;  5DEQ A;  2EFN A;  4L5I A;  4CDG A;  1ON2 A;  2P5K A;  1KYW A;  5E8G A;  2H09 A;  4RAZ A;  1YFH A;  2Q0O A;  5K5O A;  3T8R A;  1S7A A;  3IHU A;  2XRO A;  3FMS A;  1A04 A;  2FML A;  2PBI A;  4O5V A;  3HYI A;  4YFK F;  5DUI A;  4HLX A;  3J80 Z;  3F8B A;  3FF5 A;  1TNS A;  3IRR A;  1E2X A;  1WRJ A;  2DW4 A;  2CW0 F;  4N9I A;  4CIC A;  3GZ6 A;  1XGO A;  3E6M A;  2MA3 A;  1YS6 A;  1B1B A;  2XAG A;  4G7Z F;  2K4B A;  4I2O A;  4UXN A;  1FYM A;  1W5T A;  1R5G A;  2OBP A;  1LNW A;  4UVB A;  1RNL A;  3WOD F;  1WQ2 A;  1XN7 A;  2PMU A;  1T39 A;  2M30 A;  4MGR A;  2EV5 A;  4HF2 A;  2IA1 A;  1PP7 U;  3QU6 A;  5FLX K;  3RKW A;  1MDM A;  4LG0 B;  4LFU A;  2OA4 A;  4WF2 A;  2GXG A;  5L3G A;  1R1V A;  2FBK A;  3NEU A;  1OYI A;  1LJ9 A;  2HGC A;  5CJ9 A;  3JSP A;  4B09 A;  3O2P E;  4TV7 A;  5D6E A;  5DCF A;  2L01 A;  1TQP A;  2PEX A;  3EDP A;  3FX3 A;  4O6J A;  4CXF A;  3C3W A;  2HWV A;  1ZRD A;  1K79 A;  2QLZ A;  4EVI A;  4M74 A;  2P7V B;  3V7S A;  2Z3Y A;  4ZYD A;  4BHC A;  1U5T A;  3GFL A;  4WK8 F;  4LMY A;  1HW2 A;  1RIO H;  5TRD A;  3DQV C;  4EJW A;  1U8R A;  2X0L A;  3WGG A;  1WWX A;  3TKY A;  1XCB A;  4A5N A;  2W85 A;  1KQ0 A;  1BI2 A;  2VBY A;  2FF4 A;  5D4R A;  1Q1H A;  2A07 F;  2ZJ2 A;  3H3Z A;  4N9H A;  3TDZ C;  3F23 A;  2BE5 F;  3KP3 A;  3V8K A;  3V8L A;  2O0Y A;  2DT5 A;  4ZYE A;  5L3C A;  4HX8 A;  2WTE A;  2P5L C;  3I5U A;  5HS9 A;  5BQT A;  1D5V A;  2XAQ A;  2LSO A;  5LLQ A;  1KYZ A;  5CYV A;  2PJP A;  1REP C;  4ENM A;  1B59 A;  4BYY A;  4Q4Z F;  1BI0 A;  4HX4 A;  4Y13 A;  4WXH A;  5KVR A;  5AIP A;  2QVO A;  3ZPL A;  4LK0 F;  1G4D A;  2E1N A;  1IXC A;  1TW3 A;  1KA8 A;  2LF7 A;  2IP2 A;  2UXN A;  2ZCW A;  5JHU A;  4R1H A;  4I0B A;  4S04 A;  2J5P A;  3KCC A;  5LRR A;  3DFG A;  4G7O F;  3N97 A;  1S7O A;  4LLL A;  2YX7 A;  2HKX A;  3KP4 A;  1NHA A;  3IKV A;  4PDK A;  4L0Y B;  1ZG3 A;  2G7H A;  2O03 A;  5H6R A;  1BM9 A;  1W4M A;  4UHT A;  3EET A;  2MBF A;  3DKW A;  1DP7 P;  5K5Q A;  1IN4 A;  5ICF A;  4OIP F;  4EGY A;  2Z99 A;  1W5S A;  3WGH A;  5HLH A;  3DXJ F;  4U0Y A;  5D4S A;  4G6D A;  1ZG5 A;  2K86 A;  1ZH5 A;  1HXD A;  2RVC A;  4L9V A;  4U0V A;  1JHF A;  1EH6 A;  3ZMS A;  2KIF A;  3R0J A;  2BEO A;  2VXZ A;  2L54 A;  3QRF F;  1AWC A;  4KMU X;  1H9T A;  3KP5 A;  1YS7 A;  5L3E A;  1XDS A;  2JRT A;  3FM5 A;  3U9G A;  3M8E A;  2VOD A;  5HOO A;  2HTS A;  2XUB A;  4HF0 A;  4DQ2 A;  3E6B A;  2EB7 A;  3ZMT A;  2VOP A;  3HHH A;  2HR3 A;  2HQN A;  2YU3 A;  2DBB A;  1FYK A;  1IN6 A;  1XMA A;  5LGT A;  4WCG A;  2WWY A;  3HTS B;  2DK5 A;  1HW1 A;  1O3Q A;  4I01 A;  2QYO A;  1ZAO A;  4IRG A;  4HZF A;  3VOD A;  2Y0M A;  5J8F A;  1ZAR A;  5FB2 A;  5D8K B;  4EJV A;  5HS8 A;  1U2W A;  2D1H A;  2X4H A;  3V8J A;  2D45 A;  1ZGJ A;  1CF7 A;  3F72 A;  1TW2 A;  1HST A;  4YII A;  2FRH A;  2FNP A;  4GGG A;  3G73 A;  2ZNZ A;  2QZ8 A;  5ICC A;  2H6C A;  2RQP A;  5DCM B;  5HDG A;  2XAH A;  3KP2 A;  2M87 A;  1Z1D A;  5J8C A;  4I98 B;  1KQ8 A;  2MH2 A;  1E17 A;  4JK1 X;  4EJO A;  4EGZ A;  1W7P B;  1B6A A;  2COM A;  2ZME B;  2EFW A;  2G9W A;  2F5E A;  1D8K A;  3RTR A;  1J59 A;  1SFE A;  2NRA C;  3SXY A;  2FXA A;  1R36 A;  3BP8 A;  4EJT A;  2H94 A;  1R7J A;  1IF1 A;  6PAX A;  1QBJ A;  4KT5 C;  3Q5F A;  3TOB A;  3MZY A;  1J0R A;  3BJ6 A;  3IL2 A;  3GFM A;  1EV7 A;  5LGU A;  1O3S A;  4K2E A;  2CSO A;  1B9M A;  1IXR C;  1P6R A;  4LLN A;  4L0Z B;  4QWQ A;  4UUV A;  2Z33 A;  3RPQ A;  1R00 A;  3MEX A;  2E7W A;  2UXX A;  1TBX A;  2KJB A;  2JPC A;  4KMF A;  5H6Q A;  1OR7 A;  4HQM A;  2XAF A;  3V7R A;  2AXL A;  1KU7 A;  3E6D A;  3SZT A;  3J80 K;  1ZGA A;  4I0A A;  1UB9 A;  2ZO4 A;  1K78 A;  1LDD A;  3WTY C;  1I1G A;  5DV5 A;  5HLG A;  4U7B A;  1EH7 A;  3ISP A;  4XSZ F;  2CGP A;  1GXQ A;  1GHC A;  1IRF A;  2NNY A;  1BIA A;  1IN7 A;  1RUN A;  1Z6T A;  2IJL A;  4MHG A;  4IXA A;  1FBS A;  3IRQ A;  3GUD A;  4U0W A;  3JW4 A;  3WTV C;  3PFI A;  4ZZD A;  3BPV A;  3F8N A;  1C0W A;  1YG2 A;  3QAH A;  4RS8 A;  1FPQ A;  2LKP A;  3LA3 A;  1AOY A;  4GXO A;  1FBU A;  2PG4 A;  1U78 A;  2M45 A;  2Q2E A;  1LDJ A;  5E18 F;  1MZB A;  2IW5 A;  1TQI A;  3ECO A;  3LAP A;  1QZZ A;  4KFC A;  3EYY A;  1HKQ A;  3LQR A;  1DPR A;  3COA C;  1ONV A;  1YIO A;  3C7J A;  3FXQ A;  5FD5 A;  1FBQ A;  2H6B A;  4CZZ A;  1SFX A;  2VE8 A;  3E97 A;  2VE9 A;  4NB5 A;  4M6Y A;  3ULQ B;  1R58 A;  2OZ6 A;  2VT3 A;  4KIB A;  3I4P A;  4A0X A;  5D5U B;  5DUK A;  3CDH A;  2EFP A;  1YW8 A;  2OQG A;  3K1P A;  3OOP A;  5IT9 Z;  4JBA A;  5LHI A;  4RGU A;  1I5Z A;  2L02 A;  1YQA A;  4IVN A;  1CF7 B;  3FWE A;  1FP2 A;  2BV6 A;  3ABU A;  2XAS A;  2YR2 A;  2XAJ A;  4IRI A;  2VN2 A;  3M1E A;  5IT9 K;  5ILS A;  2DK8 A;  5HDK A;  1KU9 A;  2H27 A;  4UVA A;  2XIG A;  2HZT A;  1IZ1 A;  2PMH A;  1ON1 A;  2K4J A;  4RGR A;  2QQ9 A;  5E17 F;  3EUH A;  2HYG D;  2AS5 F;  2CO5 A;  4FHT A;  1BBY A;  5J6X A;  2E1C A;  4OU0 A;  3K69 A;  2KIM A;  2DPU A;  4IPA A;  4WXD A;  1ODD A;  1PP8 F;  3F8C A;  1I1S A;  2KKO A;  4HQE A;  3J81 K;  4P5O A;  3RKY A;  2EA2 A;  2YSR A;  2GQQ A;  5ICG A;  2OD5 A;  2HOE A;  1GVJ A;  4RB2 C;  4WWC A;  1J9I A;  2A3S A;  3LQQ A;  2IPQ X;  2QWW A;  3TO7 A;  4JQF A;  3R6S A;  2UWM A;  2CWE A;  4UV9 A;  3FZV A;  2FBI A;  1MD0 A;  4MTD A;  1H0M A;  2MLG A;  1R1T A;  1OYW A;  3WU0 A;  4LK1 F;  5BOX A;  4YFX F;  1LDK B;  5ED4 A;  4PGH A;  2IA2 A;  5BMZ A;  1T6S A;  2G7U A;  4IHT A;  4AIK A;  2ZME A;  3K0L A;  2DQR A;  2EV6 A;  3CO6 C;  3K1M A;  2E7X A;  2Z5U A;  1K7A A;  3E5X A;  4BH9 A;  3I59 B;  3WE3 A;  4MNU A;  4I09 A;  3F8M A;  1IRG A;  4LB5 A;  1SD4 A;  4UV8 A;  2A69 F;  5E1X A;  2P6T A;  2OU2 A;  3FM3 A;  1WI9 A;  3BJA A;  1WKM A;  4XRF A;  1Z6R A;  4PZJ A;  2ELH A;  1FC3 A;  1TNT A;  1FY7 A;  2K02 A;  4OMY A;  5LGN A;  4KN7 X;  3BY6 A;  3O3K A;  3DP7 A;  3I54 A;  2VOO A;  5HLI A;  3FHZ A;  1ZLK A;  4L9N A;  1KGS A;  2HTJ A;  2DPD A;  3F6O A;  1HBX G;  3L00 A;  1OKR A;  1PUE E;  3IC7 A;  5D5V B;  3VOE A;  2NS0 A;  1FZP B;  3DF8 A;  1ZHF A;  2V1U A;  5JR3 A;  2RC4 A;  3QPT A;  3WTT C;  4CYD A;  4XLP F;  1SD5 A;  3F22 A;  5ILU A;  4A6D A;  3ZN1 A;  4HV6 A;  4I02 A;  1P4X A;  2EFQ A;  1MGT A;  2JPB A;  1IN5 A;  3ABT A;  3KFW X;  3KLO A;  3R61 A;  5E1Z B;  4EM0 B;  3JTH A;  3WGI A;  5CVR A;  4HA8 A;  3KEQ A;  3SQN A;  2V79 A;  3QP6 A;  1O3R A;  2F5D A;  2DFI A;  2QM3 A;  3R60 A;  1YLF A;  3K1N A;  3VEP A;  3F8F A;  4GCV A;  5D5X B;  3T1B A;  1Y0U A;  2ACJ A;  1XB4 A;  4M71 A;  3BPX A;  3REO A;  1BI3 A;  2V1X A;  3WU1 B;  3WTS C;  2FMY A;  1S6L A;  5DDG A;  2D1V A;  2A68 F;  2XRN A;  1YTY A;  1DUX C;  4ESJ A;  3BOQ A;  1F4K A;  3SZP A;  3J81 Z;  1XSX A;  4P55 A;  4NHJ A;  3ELK A;  2VON A;  1S3J A;  1L0O C;  4RAY A;  2OAZ A;  3I64 A;  2XV4 S;  1J7K A;  2P5V A;  3D0S A;  3K2Z A;  2EFO A;  3L09 A;  1XD7 A;  3C18 A;  3V4G A;  2MH9 A;  2VC0 A;  2D2W A;  4G6Q A;  4DNC A;  1XGS A;  3R4K A;  4HF1 A;  4AIH A;  2A5Y B;  1VTN C;  4Y15 A;  2QBY A;  4BQA A;  4OOI A;  3WTZ A;  4GYG A;  2R7F A;  4IJA A;  1I27 A;  4XBF A;  3T8T A;  5FFZ A;  4HBL A;  1LQ1 A;  2OZU A;  1HSJ A;  1LEA A;  1HW5 A;  1QZY A;  5L3B A;  3H3U A;  1HKT A;  2GA2 A;  2C6Y A;  4HX7 A;  4MTE A;  2QUF A;  3NQO A;  2CG4 A;  3RKX A;  3RI4 A;  3CJN A;  2V1D A;  5JVT A;  3MQ0 A;  4G7H F;  2L3D A;  2EV0 A;  1T0F A;  4N0B A;  3CUQ A;  2O61 A;  3LFK A;  4PGG A;  1IUY A;  3PQJ A;  3F21 A;  3KLN A;  4H0E A;  4U7D A;  1SFU A;  4KN4 X;  4EM1 A;  1BC7 C;  1ZRF A;  2CFX A;  1HQC A;  1ZRE A;  3MCZ A;  5IT3 A;  3EYI A;  2GZW A;  2Q8K A;  1FNN A;  2JSC A;  2WV0 A;  4KIC A;  3NRV A;  4HW0 A;  1UHW A;  4BHB A;  1Z91 A;  5LEJ A;  1USS A;  2PQ8 A;  4MQV A;  1DPU A;  2ETH A;  2ESN A;  3IKT A;  4Q48 A;  3ML6 A;  3QU3 A;  4M6X A;  4OIR F;  3B02 A;  4EQQ A;  3GFJ A;  3TO6 A;  2IVM A;  1LEB A;  3I0T A;  3M7G A;  3GF2 A;  2ISY A;  4P9F A;  2PLY A;  1QO0 D;  1ZN2 A;  1FSE A;  3RYR A;  3LA2 A;  4L9J A;  2FSW A;  4ZH4 F;  3WG9 A;  1P4A A;  4FX0 A;  4I7H A;  2IT0 A;  3GLX A;  5L3D A;  2NAZ A;  3GXO A;  2Z9O A;  3L2C A;  1BN5 A;  4HAM A;  2VT2 A;  1KU2 A;  3W6J B;  3P7N A;  1R1U A;  2ISZ A;  1YO5 C;  1JHH A;  4G9Y A;  5F1R A;  3I71 A;  1YW7 A;  2MLK A;  5LHG A;  4FT8 A;  2OQR A;  4KA4 A;  1R5H A;  4BXU A;  2O3F A;  4A12 A;  3BWG A;  2LF8 A;  3BDD A;  3HSR A;  3P9C A;  1IAW A;  2B0L A;  3FXR A;  1FP1 D;  2NNN A;  4YG2 F;  1S29 A;  3ZMU A;  3DPL C;  3LWF A;  5LBQ A;  4QLC U;  4A2U A;  3HIF A;  2IA0 A;  2RN7 A;  3ECH A;  4R79 A;  4L9T A;  1G3Y A;  3ZMD A;  3VB2 A;  3IWF A;  2XKO A;  4UNO A;  3HHG A;  2YX4 A;  5AIQ A;  2EJR A;  3DPT A;  4BAY A;  3P9I A;  4HLY A;  4YFN F;  3RJP A;  2P7C B;  2DO7 A;  3SFZ A;  3ZN0 A;  1MJB A;  2V6C A;  2F5C A;  3GWZ A;  1T2K A;  5CVJ A;  4CO8 A;  3FXU A;  5F64 A;  2BGC A;  3GVA A;  3C1D A;  1PDN C;  1FLI A;  1XMK A;  4GO1 A;  2L4M A;  3LST A;  3R0A A;  4BNC A;  4KIG A;  2W57 A;  5DYM A;  3TO9 A;  3HUG A;  1F1Z A;  3CLO A;  4RB1 A;  1KU3 A;  4ESB A;  1MJ9 A;  4RB0 A;  5LEK A;  3BJO A;  4NQW A;  4M73 A;  1LVA A;  2DU9 A;  3I53 A;  2MD5 A;  2ADU A;  3GX4 X;  5D6F A;  3RIR A;  1K6O A;  3P9K A;  3PQK A;  1D3Y A;  1TLH B;  5FLX Z;  2XKP A;  3E5U A;  2K7L A;  2RDP A;  4ETS A;  1FSH A;  2VBZ A;  1X3U A;  4HDV A;  2KRF A;  3HRU A;  2BYV E;  2FEZ A;  3M8F A;  2MC3 A;  5CVI A;  1FOK A;  2ZFW A;  2ESH A;  3KEO A;  1V3F A;  5A2Q K;  1BJA A;  1KQ9 A;  4HYE A;  2GIV A;  1B4A A;  1O57 A;  1S8N A;  1RUO A;  1XDU A;  3CUQ B;  5ERI A;  4HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...