1F5TA

Diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
120
structure length
120
Chain Sequence
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 43MER DNA CONTAINING DXTR CONSENSUS BINDING SEQUENCE
publication title Methyl groups of thymine bases are important for nucleic acid recognition by DtxR.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 45
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f5tA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1f5tA02
1XDUA 2ETHA 5DUIA 2EFWA 4L9VA 4N9IA 3F72A 1ZG3A 3VEPA 2P7VB 5JVTA 2R7DA 3FMRA 1YW7A 1XCVA 3I58A 1FZPB 4Y15A 5K5QA 1B59A 4HAMA 4XSZF 1SAXA 5E17F 1ZGJA 3WU0A 3DEUA 3TO9A 1IN6A 2JSCA 3IRQA 1GXPA 5DDGA 5BOXA 1RNLA 3L9FA 3KEQA 3KP6A 4ASNA 5LHGA 1IXSB 3TDUC 2OA4A 4KT5C 1R00A 3MEXA 4ZYDA 4GYGA 4JBAA 3GUDA 1FP2A 4OIQF 4WXHA 4Z2YA 1LEBA 4FX4A 3WTTC 5D8LB 1BC7C 3RPQA 1TW3A 4HBLA 2A6EF 3ULQB 4I0AA 1KU7A 2BGCA 4LB5A 2ADUA 2ZMEA 3U1DA 4OOIA 4L9JA 3C1DA 4U0WA 1P4AA 4MTDA 5CVJA 2ELHA 5BMZA 2L4MA 2QYOA 2DT5A 2VOPA 4WWCA 2DI3A 1WQ2A 2HKXA 3TDZC 3GWZA 3SFZA 2FBKA 4BHPA 5H20A 2LF8A 2EB7A 4G7ZF 3BY6A 2HOEA 1XGMA 2Q0OA 2A5YB 3VFZA 4PDKA 3T8TA 2KIMA 5AIPA 5J6XA 3LAJA 2O6GE 2GWRA 2MH9A 3K1MA 3WU1B 2H27A 2RQPA 3U2RA 5LLQA 1ZGAA 4GCVA 2A6HF 2V6CA 2H94A 2XV4S 3WGHA 5LBQA 4LFUA 1U5TB 4IRIA 5DCMA 4M74A 2IA1A 2H6CA 3T0YA 2XAHA 1XGSA 3ZP5A 1BM9A 4R8HA 2HWVA 1HSJA 2BV6A 2FEZA 4M9XA 1O7FA 2EV5A 1D3YA 1HW2A 2QM3A 3H92A 4ENJA 3DF8A 3K0LA 4FT8A 3E6BA 4KIFA 4KA4A 3E6CC 3J80Z 1MDMA 1LEAA 4CXFA 3TOAA 5K5RA 5LEJA 2DFIA 3SQNA 4I09A 1IN5A 1GXQA 1HW5A 1J9IA 4TV7A 3JAMK 1U3EM 2TDXA 3BPXA 4CDGA 3P7NA 4G8XA 3S2WA 1E17A 4M9SA 5L3EA 2F5CA 4CICA 3LWFA 3FZVA 3ZN0A 2M45A 1ULYA 4IRHA 3HSFA 2PI0A 1R1TA 1ZAOA 3ZN1A 5DV5A 1D5VA 5BQTA 3JSPA 4CZZA 3NEUA 2P4WA 3F8MA 5FB2A 5KK1A 1SFUA 1Z7UA 1K79A 5CVUA 2Z33A 3DPTA 2XAJA 2ZKZA 2W85A 3ELKA 4I0BA 4KN4X 3RYRA 3G73A 4YFNF 4GO1A 1WRJA 2RVCA 4AD9A 2P5KA 3OV8A 4D0PA 3MQ0A 2GAUA 4ENKA 1P6RA 2OU2A 2MC3A 2QVOA 2AXLA 4KICA 2DQRA 3HHHA 5BS6A 1U8RA 2P5VA 3DXJF 1H9GA 2GA2A 2JTVA 1Z05A 1Q1HA 4QWQA 4WF2A 3VODA 5E8IA 4ZH4F 4B09A 4RAYA 2HTJA 2DLLA 2K86A 1U6GA 3KP5A 3WG9A 3LFKA 4L9NA 4M6XA 2IA0A 4HDVA 5HLHA 5CVIA 3F8FA 3QAHA 1J7KA 3BROA 5L3DA 4EV0A 2HR3A 3RKYA 5AONA 2VE8A 1KA8A 1PP7U 3ECOA 3CLOA 2K4JA 1BIBA 1YG2A 3EYIA 5DYMA 3TOBA 3LA7A 3JW4A 4NQWA 5HS7A 1OKRA 3VOEA 1FY7A 2XKOA 3QP5A 4LG0A 4KIGA 1LB2A 2NRAC 4O6JA 4AIHA 4UXNA 2CYYA 3P9IA 2HS5A 1IAWA 1HKQA 1ONVA 3QU6A 2VBYA 1DP7P 1U5TC 4EGZA 1K7AA 4AIJA 2H09A 4LD5A 4DNCA 3D0SA 3F6VA 1SD7A 4XSXF 1R1UA 1SMTA 3IKVA 3OOPA 2O61A 1FNNA 2DK8A 3FHZA 3SHFA 3SXYA 4KFCA 1OMIA 1EH8A 5HS9A 1XSDA 4GXOA 4P55A 2FF4A 1S7AA 2HDCA 1S8NA 3FM5A 2OQRA 3ABUA 2RKHA 1G3SA 3WTWC 2G7UA 2O03A 3RPUA 1V4RA 3RI4A 1FX7A 3MWMA 4H0EA 4ZZDA 2XROA 2IW5A 1BJAA 3NQOA 5H6RA 2UZKA 3WTZA 1MGTA 2GA1A 3TGNA 4ETSA 3WE2A 4E70A 1G6NA 2IT0A 3DV8A 2XIGA 3KE2A 1G3WA 3DKWA 4UVBA 3RKWA 4EJUA 3LQQA 4UNOA 1F5TA 2C6YA 5F6FA 3HTSB 2HYGD 5L3FA 2Y75A 4BAYA 3V8LA 4A0YA 5IT3A 4S04A 4G7OF 2EFPA 2QUFA 1PUEE 1TLHB 2GZWA 1ODDA 1I1GA 4A5MA 3CO6C 4CGZA 3KETA 2RDPA 3F8CA 4MHGA 1XD7A 1IRGA 3RKXA 1FPQA 2FBHA 4WCGA 1TNSA 1FYMA 1TQPA 3V7CA 1E2XA 1D8KA 1O3SA 3I59B 2STWA 2UXNA 4XRFA 3TO7A 4HQEA 5FLXZ 1R5HA 5D6EA 1YO5C 2A07F 1XB4A 3HTUA 1IF1A 3W6KB 4YFXF 2NNNA 5D5UB 4WXCA 2P6SA 1KGSA 5E18F 2HTSA 5D4SA 4I01A 2PLYA 1HW1A 5H6QA 2BYVE 3WE3A 2YX4A 1KU3A 1BI0A 3L7WA 2W25A 5HLGA 2NNYA 2JT1A 4YG2F 2UXXA 2D1HA 1FP1D 3M8FA 4IF4A 3CTAA 1OYIA 1XDSA 3SZTA 3GFJA 1KYZA 3HSEA 1W7PA 1B9NA 1OYYA 4Q4ZF 2DPUA 4F7ZA 4Q47A 2HEOA 4IXAA 2G7HA 2XKPA 2VT3A 4IJAA 1QPMA 2CFXA 3Q9SA 4HV5A 3GZ5A 4LK0F 3RJPA 1BN5A 1USSA 3HHGA 2XAGA 3JTHA 5D5VB 5J8FA 2LKPA 3GFLA 3FXRA 1ZN2A 5JFRA 5LGUA 1ZRCA 3T8RA 3QP6A 5E1ZB 5LGNA 1FYLA 1OR7A 3MFKA 2P7CB 2YU3A 2PJPA 1BI1A 4ESJA 3EYYA 2VC0A 1C0WA 1PP8F 4UHTA 3J81K 3LAPA 2NS0A 2O0YA 3SZPA 3E6DA 5ED4A 4A0ZA 2FOKA 1MJBA 1K78A 2VONA 3FM3A 4HOBA 5IT9Z 5EEGA 3Q9VA 3NRVA 2FSWA 1YW9A 2D2WA 3FWEA 2CQKA 2BE5F 2PQ8A 2V9VA 1ON2A 1U2WA 2FMYA 2KRFA 2CO5A 3BDDA 4UV9A 1V3FA 1JGSA 4I2OA 2Z5UA 1J5YA 4RB3C 1ZG1A 4AWXB 1ZREA 4A6DA 1F1ZA 2KIUA 4YIFA 4EJOA 3JSOA 3K1PA 4MNUA 5A2QZ 3BZ6A 2XAFA 4GYIA 1R36A 4RGXA 3T1BA 2ZCWA 1FBUA 2JPCA 1T2KA 5FFXA 4P96A 3HYIA 2LF7A 1BI2A 4B8XA 2OZ6A 5TRDA 4HLXA 2VC1A 2M30A 4A12A 2WTEA 5LHIA 3F8BA 4GGGA 1KQ9A 1QZZA 2HQRA 3GF2A 1IN7A 5DCFA 1ZARA 4IVNA 2HKOA 3GFIA 1FLIA 1J75A 1AOYA 1XMKA 4M71A 1YTYA 1VTNC 1B4AA 3U9GA 2FNAA 4CHUA 1G4DA 2EK5A 4YFKF 1Y0UA 2CGPA 1WKMA 4HF0A 4K2EA 1QBJA 2OBPA 3P9CA 3O3KA 1X3UA 1FBSA 4XBFA 3CUQB 2GXGA 2FXAA 2W57A 4EGYA 1CF7A 4HX7A 2J5OA 4RAZA 2FNPA 2YR2A 3QPTA 2RNJA 2LNBA 3LA3A 4Y17A 4HDUA 5LRRA 4KN7X 4P9FA 3GFMA 4KUMA 4LLLA 4EM2A 4WK8F 2L4AA 5ICGA 2IJLA 1EH6A 5E8GA 2M8EA 2FE3A 3E97A 2D45A 3KP3A 3IRRA 1WWXA 5KVRA 4U7DA 2IVMA 1XSXA 2MLGA 2EV0A 1UCRA 3E5XA 4L18B 1L3LA 1S29A 1I5ZA 3I54A 3RIRA 5E1WA 3T5XA 1RIOH 3ABTA 3DPLC 3FF5A 1LDDA 4G6QA 2AS5F 3V7RA 4CO8A 2F5FA 3GO5A 3BPVA 1MKMA 1DPRA 1UFMA 4HW0A 3IC7A 1EV7A 1UHMA 3BJ6A 1W7PD 3HOSA 4L0ZB 4ZYGA 2A69F 3F22A 1P2FA 4R79A 3EDPA 2IRFG 2VE9A 1U78A 4KDPA 5IT9K 4PGHA 1G3YA 2XRNA 4FHTA 1RI7A 3AAFA 1TW2A 4PZJA 3IL2A 1T38A 3D5LA 4JK1X 2QWWA 2EV6A 3CJNA 2BEOA 1S3JA 4WXDA 1H0MA 2PBIA 2PMHA 3EQLF 1IXRC 5DUKA 1REPC 2JZYA 2ZMEB 2A61A 4BHBA 4EJVA 2CW0F 1HXDA 3GXOA 2DPDA 3KFWX 4A0XA 3PFIA 3DFGA 2IPQX 2W84A 3HRSA 1IN8A 2YX7A 2WWYA 2Y48A 3V7SA 1FSHA 1SD4A 3E6MA 5DD8A 3MAJA 2YPRA 1H9TA 2L3DA 4ZYEA 4RB2C 2COMA 1ZHFA 1P4XA 2IA2A 3F21A 1CGPA 5HS8A 1KQ0A 1R22A 2DAOA 3EETA 1TQIA 1STZA 2CG4A 4UVCA 1I27A 4LK1F 4U0VA 1EH7A 4G9YA 1A04A 2PMUA 3J80K 1O3TA 2DO7A 2OD5A 3Q5FA 4MQVA 5DCMB 4JQFA 3PQKA 1G3TA 1Z6TA 3V4GA 3LA2A 2P5LC 2JPBA 2KIFA 2L02A 2QQBA 4KIBA 3F6OA 3BOQA 2M1BA 2ACJA 4Q48A 5TJJA 2PEXA 3MZHA 3QU3A 5JI6A 1R58A 3R60A 5F1RA 3CUQC 4QLCU 4MTEA 1MDMB 3EUHA 3FXQA 4P9UA 2XUBA 2DW4A 3WGGA 3CO7C 5ILSA 5D4RA 2DU9A 1JE8A 2MLKA 4ZYHA 5L3GA 4LJZF 4HYEA 1XN7A 5HVQC 4KYWA 1SFEA 1K6OA 4N9HA 1U5TA 2QZ8A 1ZLJA 4L0YB 2CSOA 4HV6A 1IUYA 1W4MA 2ZFWA 1P92A 3GLXA 1AWCA 2GXBA 2DBBA 4U88A 3ZMSA 1I6XA 4L5IA 3TO6A 4OIPF 4I98B 5CVVA 1BOAA 3V8JA 1FC3A 1SFXA 5JHUA 3K9TA 4OIRF 2EJRA 4HZFA 4XLPF 2P8TA 4O5VA 1S7OA 3ROUA 1XGNA 2KKOA 4KMFA 1T0FA 4UUVA 4MEXF 2VOOA 1UB9A 4MQ9F 1JHFA 3KZZA 2V1XA 2Q8KA 2G9WA 2QQAA 4G7HF 3LSTA 1B6AA 3F8NA 4PCQA 1T39A 4PGGA 2X4HA 2XAQA 2MA3A 2Q2EA 5LRSA 1ZRFA 2STTA 3KP7A 4NHJA 1HKSA 4P5OA 3M9AA 1O57A 2QQ9A 1R7JA 2VBZA 1LDJA 5HOOA 3WTXC 2ZBKA 3M1EA 4RGRA 4AVPA 2IP2A 3BJAA 3I71A 1J59A 2P6TA 2HQNA 4L5JA 4BQAA 2E7XA 4LMYA 2LSOA 1IN4A 3L00A 2ZJ2A 3JTGA 2K7LA 5ILVA 5LEKA 2A3SA 3WODF 3DP7A 1HQCA 1ZYRF 4N0BA 1LNWA 1USTA 3O6BB 5D5XB 3I0TA 5L3BA 4LG0B 1XMAA 1KU2A 1DDNA 2UWMA 4OMYA 2BBYA 3KLOA 4YIIA 2MBFA 3V8KA 3BJOA 4OINF 1BI3A 4RB0A 3WTYC 3C18A 4A5NA 1XSVA 3F23A 4HQMA 3I53A 3B02A 3RDIA 2H6BA 4LLNA 1B1BA 4L9TA 1ZG5A 3FMQA 1J0RA 4HF1A 5E1XA 1YFHA 3CDHA 1IXCA 3PQJA 1HKTA 5ICEA 2ESNA 1KU9A 4A2UA 5CJ9A 4LB6B 4RGUA 1FBQA 1T6SA 1L0OC 2Z3YA 3KCCA 1GVJA 4O3MA 1KYWA 3KZYA 4M72A 3LQRA 2FQ3A 1Z9CA 2OQGA 4MGRA 3R0JA 2A68F 5AIQA 1GHCA 4M9ZA 1YLFA 1XCBA 2QENA 4ESFA 3BWGA 2PG4A 1Z91A 1R5GA 4OIOF 2XHKA 4RS8A 3R61A 4LLGF 3BP8A 4Y13A 2V79A 1ZRDA 2HGCA 6PAXA 4HX8A 2DTRA 4S05A 4UVAA 3N4MA 3ZMTA 5FO5A 2K27A 4FX0A 1JXSA 4ON0A 4EM1A 4AIKA 3M8EA 2HYFA 2FA5A 3WGIA 1WSUA 1S6LA 3ECHA 5D6FA 1YIOA 4ESBA 5FLXK 4MEYF 2VBWA 3HIFA 1ZH5A 5BPIA 2F2EA 2LDUA 2X0LA 1FT9A 1BBYA 3ZMDA 4KNYA 1LJ9A 3RTRA 4RGSA 2RN7A 3C7JA 3W6JB 2VBXA 4NB5A 1O3QA 4G6DA 2VXZA 4DQ2A 3HRUA 2KJCA 2XGXA 4EJTA 5D8KB 3ISPA 4ZZLA 2VN2A 3GYHX 3L09A 4R1HA 3FMSA 1HSTA 2Y0MA 3C3WA 1IZ1A 5L3CA 3E5QA 3HOTA 2D1VA 3P9KA 5FFZA 1YS7A 4BYYA 5ILUA 2OZUA 2M87A 2RGVA 5HDNA 3GX4X 1IRFA 4UV8A 2E1NA 1O7LA 3FXUA 2DK5A 1RZ4A 2WC2A 1YS6A 3IKTA 3IWFA 1T98A 3QPHA 2XASA 3G3ZA 2Z99A 2OAZA 1QNTA 1QO0D 3TQNA 2EWNA 1W7PB 2HFHA 5BPDA 1WI9A 5FD6A 3QOPA 2EFOA 5HLIA 4IRGA 1KQ8A 4HF2A 3F3XA 3TKYA 3I59A 1UHWA 5ERIA 2NAZA 5F64A 1SD6A 3GVAA 5HDKA 4U7BA 1LVAA 5ICCA 2J5PA 3HRMA 2VODA 3R0AA 4EM0B 1TBXA 2WV0A 2PN6A 1TQMA 2F5EA 3K2ZA 3M7GA 3WTVC 2QBYA 2YSRA 1ZLKA 3VB2A 2QLZA 2K4BA 2MH2A 3I5UA 1QGPA 1K78B 3B73A 1QQIA 1J2XA 5DEQA 1DPUA 5A2QK 1TTYA 4KMUX 1R23A 5JR3A 4Q5SF 2K02A 4A6EA 1RUNA 1ON1A 3I64A 2EFNA 2ESHA 3IWZA 1LQ1A 3K1NA 1OYWA 5CVRA 1F9NA 2NYXA 3I4PA 1BIAA 1JHHA 2L54A 4WX9A 4CYDA 3ZMVA 2B0LA 3KP4A 3HRTA 5J8CA 3FX3A 4U0YA 1PDNC 2JRTA 1Z6RA 1YQAA 3CUOA 2CWEA 2V1DA 3O2PE 3MCZA 3WTSC 5E20A 3GZ6A 2EFQA 3KP2A 3ZMZA 1D8JA 4I7HA 2ISYA 1Z1DA 2FBIA 2L01A 2W24A 1HBXG 3J81Z 2ZNZA 4IPAA 3H3UA 4IHSA 1YYVA 3R6SA 5EEHA 1FWZA 5K1YA 4HA8A 2R3SA 3N97A 2ZXJA 2E7WA 3WTUC 1MJ9A 2VT2A 2Z9OA 3QRFF 3RYPA 2GQQA 2XVCA 1P4WA 2RV8A 4ENNA 1SD5A 1RUOA 3ZMUA 3H3ZA 2MD5A 4EMSA 1B9MA 5ICFA 1CF7B 2R7FA 1I1SA 3ZPLA 5LGTA 4BXUA 3K69A 4BH9A 5LHHA 1W5SA 3E3VA 4OU0A 4LGWA 2E1CA 5D5WB 1OPCA 3DQVC 3R4KA 5FD5A 1W5TA 3E5UA 4EVIA 1BC8C 1MZBA 3ZQ7A 4M73A 5FGMA 1MJAA 5CLSA 4EQQA 4OMZA 4BHCA 1IW7F 2FRHA 5DD4A 3COAC 2KJBA 3IHUA 3ERED 4HX4A 5CYVA 3GEZA 1FOKA 3MZYA 4M6YA 3L2CA 1XGOA 3CUQA 2GIVA 4ENMA 1MD0A 1F4KA 4RB1A 3HUGA 1QZYA 4XLNF 2O3FA 2V1UA 2EA2A 2FU4A 3KLNA 1SMYF 3ML6A 2HZTA 4G94A 2ZO4A 1FSEA 1R1VA 2RC4A 5HDGA 2O8XA 3JAMZ 2ZNYA 2DQLA 4EJWA 1YW8A 2F5DA 1TNTA 2EA4A 3HSRA 2M5WA 4BNCA 4IHTA 1FYKA 4HLYA 5K5OA 3KEOA 3REOA 1O3RA 1NHAA 1LDKB 1DUXC 2PFBA 2QBYB 2ISZA 3J7AO 3GW2A 4I02A 2FMLA
chains in the Genus database with same CATH superfamily
1ETWA 1XDUA 2ETHA 5DUIA 1VQ5I 4CA0A 2EFWA 4L9VA 4N9IA 3BZCA 5EG0B 3F72A 1ZG3A 3VEPA 1OISA 2DDBA 2P7VB 3ZQLA 3LSKA 5JVTA 2R7DA 3FMRA 1YW7A 1XCVA 4IHVA 3CESA 1LFBA 3I58A 1FZPB 4C2UA 4OWRB 3DBRB 4Y15A 5BNGA 3MMYB 5K5QA 1B59A 4HAMA 4XSZF 1SAXA 5E17F 1ZGJA 3WU0A 2BW3B 2EZLA 3DEUA 2KRHA 3TO9A 1IN6A 4M3DA 1Z3YA 2JSCA 3IRQA 3BR2A 2ID3A 3TW6A 4H4KC 1GXPA 5DDGA 5BOXA 1RNLA 3JRIA 2JQ7A 3L9FA 5JLWA 4IX7A 3KEQA 3KP6A 4ASNA 5LHGA 1X1AA 1IXSB 3TDUC 2OA4A 3S8PA 4IHXA 3QWLA 4KT5C 1R00A 3MEXA 4ZYDA 2VASA 2HVQA 4GYGA 3HXLA 3SFIA 4JBAA 1Z77A 2ZSIB 3GUDA 4S0HB 1FP2A 4KISA 1WJCA 4WXHA 4OIQF 4Z2YA 1MMSA 1LEBA 4FX4A 5E3LA 2ID6A 1OCOH 3BT9A 3WTTC 5D8LB 1MNMC 2A05A 1HLVA 1BC7C 5EYRA 3RPQA 2B9SA 1TW3A 4HBLA 3FBIB 2A6EF 3ULQB 4I0AA 2FD5A 1KU7A 2BGCA 2K85A 3K4JA 1IGNA 4LB5A 2ADUA 2ZB9A 2ZMEA 3U1DA 4NDLA 5CQGA 2MG4A 4OOIA 4ZYAA 2X1CA 4L9JA 3G1OA 4B4CA 3C1DA 4CSWA 4U0WA 5F08A 3IUOA 1P4AA 4MTDA 3AKZA 5CVJA 2EZIA 5F0FA 2ELHA 2KISA 2FOWA 3CLQA 1GVDA 2ELKA 5BMZA 2L4MA 2QYOA 4A3JJ 2DT5A 3MKZA 3BCAA 2VOPA 3L2WA 4WWCA 2DI3A 1WQ2A 2HKXA 3TDZC 3GWZA 2BXYA 3SFZA 2K9NA 5J1UA 2FBKA 4BHPA 2MW8A 5H20A 2LF8A 4M3EA 2EB7A 5CPRB 1F43A 1BR4A 4G7ZF 3BY6A 2HOEA 1XGMA 2Q0OA 2A5YB 3VFZA 5C4JJ 4PDKA 3T8TA 2BZTA 4DZJA 2KIMA 1VFCA 2Z2SB 5AIPA 2LH9A 3M07A 1OCTC 3FXJA 5J6XA 2IGNA 3LAJA 4DGWB 4CCOA 3QODA 2GWRA 3AG3H 4XNFA 1IRXA 2O6GE 4UB8C 1TP4A 2MH9A 4FASD 2W7NA 3K1MA 3WU1B 1IUFA 2H27A 3LSHA 2VQHA 2P0WA 1VQNI 3HOZJ 2RQPA 3FXLA 3U2RA 5LLQA 1OFCX 1ZGAA 3HG9A 1GV5A 4ANJA 2CU7A 4GCVA 3RPUD 2A6HF 2NVYJ 2V6CA 2H94A 1MMGA 1NG6A 2XV4S 1V54H 5J4VA 3WGHA 3QYFA 5LBQA 4LFUA 1U5TB 2R7RA 4IRIA 2LYCA 3ZQCA 5DCMA 4M74A 3ZQFA 2IA1A 2H6CA 3T0YA 2XAHA 1XGSA 2KDZA 3ZP5A 1BM9A 4R8HA 2HWVA 1HSJA 2BV6A 2FEZA 4M9XA 2CV0A 1O7FA 2EV5A 1SAUA 2LBFB 1D3YA 4AC0A 2DCEA 3E7LA 4XIDA 1HW2A 2QM3A 1MMAA 3C2BA 3DWLE 3FISA 3H92A 1J09A 4ENJA 2XSDC 3DF8A 4RLFA 3K0LA 5F27A 4NBQA 2F4IA 1JGGA 4FT8A 3E6BA 4PSWA 4KIFA 3K10A 2R5ZA 2E36A 4KA4A 4BE0A 1WI3A 3E6CC 3BQZA 2HOAA 3J80Z 1A5JA 4PJMA 1LEAA 1MDMA 4CXFA 3TOAA 5K5RA 3M1CA 5LEJA 2DFIA 3SQNA 2I8DA 4I09A 4E7KA 4IOCF 1IN5A 1GXQA 4FE7A 4QTRA 1HW5A 2OUMA 3HOWJ 2GOMA 2DA6A 1J9IA 4TV7A 3JAMK 1U3EM 4Y4RA 5HLTA 2TDXA 3BPXA 5IOYA 4CDGA 3P7NA 4G8XA 3C2GA 3S2WA 2QSFX 2X6OA 4M9SA 2X6XA 3BR5A 1E17A 3OR2C 5L3EA 2F5CA 3VSLA 4CICA 3VWBA 2JVHA 3LWFA 3FZVA 3ZN0A 5GAHJ 2M45A 5HNFA 1VQ4I 3TP0A 1ULYA 4IOAF 4IRHA 1F36A 2KDOA 3GTOJ 3HSFA 4E7HA 2PI0A 1UMQA 3TL4X 1R1TA 1ZAOA 3ZN1A 5DV5A 3W6VA 2E2JJ 1D5VA 5BQTA 3JSPA 4CZZA 1HDDC 5FLXR 3NEUA 2DA1A 2X85A 3Q0WA 3HL2A 2P4WA 1V5FA 4JOMA 2I10A 2HNHA 2Q2EB 2EILH 2BY3A 3F8MA 5EEAA 4Y3OA 5FB2A 5KK1A 4LOCA 1SFUA 1Z7UA 1K79A 1DU0A 2KPMA 5CVUA 4JX4A 2UUZA 2VB6A 2Z33A 3DPTA 2XAJA 1Y6IA 2DJIA 2ZKZA 2CUEA 2W85A 2HZDA 3ELKA 1V55H 4I0BA 4KN4X 3RYRA 3OYHA 3G73A 2E1MB 1QZEA 4YFNF 4N4NB 1S7EA 4B48A 1XMXA 2Y9YA 4GO1A 1WRJA 2RVCA 4AD9A 1SANA 1X2NA 5KAFC 2R7UA 2P5KA 2R7ZJ 1ZTRA 2H1LA 3OV8A 4PSXA 4D0PA 4FE4A 3MQ0A 1FIAA 2GAUA 2NVQJ 4ENKA 1PJRA 4AM3A 4DBRA 4MO7A 1P6RA 2RREA 2OU2A 2MC3A 2EBIA 3OYBA 1GDTA 2BXZA 1T95A 1R4MB 3OYEA 2CV1A 2QVOA 2AXLA 4KICA 2DQRA 4PK4A 4NUBA 3HHHA 5BS6A 1U8RA 1B8IB 2P5VA 1BR2A 2EZKA 3DPUA 3K4CA 4F91B 4BJ6C 3DXJF 4Z6YA 1UHSA 1H9GA 5M5YJ 1ETYA 2GA2A 2JTVA 5HNHA 1Z05A 2LKXA 1Q1HA 2HXIA 4NC6A 4QWQA 4WF2A 3VODA 5K7HA 5E8IA 4ZH4F 3H0GJ 3S1QJ 2KLOA 1YX5A 4B09A 2XF7A 4RAYA 3CMAI 3QPSA 2HTJA 2DLLA 3OSGA 1PUFB 2K86A 1U6GA 3KP5A 3WG9A 3LFKA 2LOOA 2N8GA 3HJEA 4XM3A 4L9NA 4M6XA 3SEQA 2IA0A 4HDVA 4B3AA 3UNGC 5CVIA 5HLHA 3F8FA 4NNJA 3QAHA 1J7KA 3BROA 5L3DA 4BBRJ 2VLAA 4EV0A 2HR3A 2QF7A 2D5VA 1FMWA 3RKYA 4A3LJ 5AONA 3HOYJ 2MZ4A 2M8GX 3OYJA 2DMQA 2VE8A 2XGEA 1KA8A 1PP7U 4ZTJA 2DTZA 1QPIA 1R71A 3ECOA 3LSMA 3CLOA 2K4JA 1BIBA 1YHQI 1XS9A 1YG2A 1Y1WJ 1T33A 3EYIA 5J1RA 5DYMA 3J7AY 3LNQA 3HBLA 2R7VA 4XKWA 3TOBA 1GT0C 3QYBA 2KRCA 3LA7A 3JW4A 1YRNB 2V4JC 3O8HA 2KMUA 4NQWA 5HS7A 3IAM2 3CP2A 1OKRA 1X1BA 3E0JB 3DTIA 3EUHC 4I76A 1RESA 1OLTA 3VOEA 5EJCA 1FY7A 2NOJB 2XKOA 3QP5A 3CCJI 2VPRA 4LG0A 4V2FA 4KIGA 3Q0UA 1LB2A 1Y8QB 4XLAA 4E7ZA 2NRAC 4O6JA 4AIHA 4UXNA 2B63J 2CYYA 2DMUA 3P9IA 2CUFA 5TGTA 3IAS2 2HS5A 3CZ6A 1IAWA 1HKQA 1ONVA 3S1RJ 4UUSA 3QU6A 5IY5H 2VBYA 1DP7P 1U5TC 2KT0A 4EGZA 1K7AA 2VQCA 4AIJA 2WBMA 2H09A 4LD5A 4DNCA 4OAYA 3D0SA 3OYGA 5FROA 2AXTC 1K83J 4IKFA 3F0CA 1WCMJ 3F6VA 1SD7A 4XSXF 1R1UA 2EIMH 2PJRB 1SMTA 2XDVA 3H35A 3EUKL 2Y2ZA 5KAIC 2WAFA 1LFUP 3IKVA 2HOTA 3OOPA 2O61A 2EZHA 3B6AA 1FNNA 3A1YA 2DK8A 3FHZA 2OTLI 1AA7A 5K7FA 1MMDA 3IH2A 3SHFA 3SXYA 5EZHA 4KFCA 1OMIA 1EH8A 2LY1A 5HS9A 3EUAA 2PMZN 3ZQQA 1XSDA 4GXOA 4P1WA 4P55A 1NK3P 2FF4A 4BE2A 3CCEI 3OYAA 2R7XA 1S7AA 2HDCA 1S8NA 3BLYA 3FM5A 2OPTA 2OQRA 2BY0A 3MKWB 3ABUA 2RKHA 1G3SA 3G6EI 2FUG2 3WTWC 2VUMJ 2G7UA 3GCMA 2DOFA 2L0KA 1BW6A 2O03A 3RPUA 3GLLA 1AU7A 1V4RA 3RI4A 1FX7A 1T0FC 3WHBA 5J1YA 2FX0A 3MWMA 2YS9A 1E3OC 2DDAA 1SVOA 4KJZA 2DA7A 4H0EA 4CCJA 4ZZDA 4IQJA 4X0GA 2IW5A 2XROA 1BJAA 3NQOA 5H6RA 4AYBN 1MIJA 2UZKA 5J40A 5KHDA 4ZTFA 1X3ZB 4M3GA 2M9HA 2LG4A 2IEKA 1A6IA 3WTZA 1WJDA 1MGTA 4BEHA 1QVTA 2GA1A 3TGNA 4ETSA 3HOXJ 5E3MA 3WE2A 3MD2A 1R9TJ 2GBYA 4JX6A 2E71A 4E70A 1G6NA 2IT0A 3DV8A 3OSFA 1YI2I 2XIGA 1IC8A 2R4GA 2ZXWH 2L7FP 3KE2A 3M8JA 3OYDA 1LE8B 1MNEA 4CCMA 2E1MC 1G3WA 3I4MJ 3DKWA 1Y39A 2I5UA 4UVBA 3RKWA 1WZ2A 4EJUA 3LQQA 4XLHA 1F5TA 4UNOA 4C2TA 2C6YA 5F6FA 3HTSB 2HYGD 5L3FA 2Y75A 3W2WA 2WAEA 2QSHX 3S3OA 3CMYA 3FK7A 4BAYA 2AQFA 3V8LA 4G12A 4A0YA 2R5YB 3RZDJ 5IT3A 1ITYA 4S04A 4G7OF 2EFPA 2QUFA 1PUEE 1TLHB 1UAAA 2GZWA 1ODDA 1Z21A 4C9YA 1WJBA 5IYDJ 1I1GA 2HQ5A 5JVGF 4A5MA 3CO6C 4CGZA 3KETA 2RDPA 1IG7A 3PNTA 3F8CA 4MHGA 4XN0A 1MSFC 1XD7A 1T8IA 3TW7A 1S9HA 4B47A 3OS0A 1IRGA 1BOBA 2IGKA 1X19A 3RKXA 5FKMA 4N4OB 1FPQA 3H9QA 4RDUA 2XRLA 1RR7A 1TT5B 2ICWG 2FBHA 4WCGA 4L5EA 1TNSA 5J3LA 2ECBA 3CCQI 1I50J 1FYMA 4A3KJ 1ORKA 1TQPA 3V7CA 3VYUB 1E2XA 3ZR8X 1D8KA 1O3SA 1WPKA 4ZDLA 3I59B 2STWA 3OIOA 3I56I 2UXNA 4XRFA 1NTCA 3TO7A 4HQEA 4MLOA 1AKHA 5FLXZ 2LVSA 1E3PA 1CQTA 1IRZA 1R5HA 1RQ6A 3W3CA 5D6EA 3HOUJ 3BR6A 4HSTA 3HEFA 1YO5C 2A07F 3U1KA 1XB4A 4RAFA 3HTUA 2MABA 1IF1A 2JN6A 3W6KB 4YFXF 4D1QA 3DU6A 2NNNA 4W97A 3L2UA 5D5UB 4WXCA 2P6SA 1KGSA 2IS1A 4E7LA 5E18F 1M1EB 5M3MJ 2HTSA 4HPQA 5D4SA 2JRMA 4I01A 1FJLA 2PLYA 1HW1A 5H6QA 2BYVE 3WE3A 2YX4A 1SVLA 3K4BA 1KU3A 1BI0A 3L7WA 2W25A 5HLGA 2NNYA 4BU2A 2JT1A 1TZLA 4YG2F 3DTKA 3JRBA 2KIQA 2UXXA 3W2AA 2D1HA 1FP1D 3M8FA 4X1EA 4IF4A 2EIJH 2Z16A 3CTAA 1OYIA 1XDSA 3SZTA 2EH3A 3GFJA 1KYZA 4II3A 1YJ9I 3HSEA 1DQUA 3HB9A 1W7PA 1B9NA 1OYYA 2QEXI 4Q4ZF 2Y31A 2DPUA 3VYSB 2VPLA 4F7ZA 1JT6A 4CYCA 2VL8A 4Q47A 1Q1VA 3BCBA 2HEOA 2XF5A 4IXAA 3JRAA 2G7HA 1N25A 2XKPA 2VT3A 3FK6A 4C3HJ 1FMVA 1QPMA 4IJAA 5DM7F 4BY1J 3RKQA 2CFXA 2M0CA 3Q9SA 4HV5A 3GZ5A 4LK0F 3RJPA 1BN5A 1USSA 3HHGA 2XAGA 3JTHA 2GIZA 5B66C 5D5VB 1A35A 1FOXA 4BL0B 1WJEA 3GBGA 5J8FA 1JTXA 2JUGA 2LKPA 2M3AA 3OIPA 2L7MP 3GFLA 4A3GJ 3FXRA 3QOEA 1ZN2A 5JFRA 4IHYA 4W1UA 5LGUA 1ZRCA 3T8RA 3K4MA 2L9NA 5GPAA 5M3FJ 3QP6A 5E1ZB 5LGNA 1FYLA 1OR7A 2GLOA 3HPGA 4EEFG 3MFKA 3JRFA 5GP9A 2P7CB 2YU3A 3DEEA 2PJPA 1BI1A 1QHGA 2XB0X 4ESJA 2K3FA 5B3SH 1SC7A 3EYYA 1SFOJ 1TWHJ 1U8BA 2VC0A 1RPWA 1C0WA 3B6CA 1PP8F 1UG0A 4UHTA 5J4YA 1TT0A 4B43A 3J81K 4UUSB 4XKBA 3LAPA 3ZQGA 2MGQA 2NS0A 3DEWA 2O0YA 3SZPA 4ITVA 3TMOA 3E6DA 5ED4A 4A0ZA 2QKLB 3K4NA 3S93A 2AHQA 3OIQA 2FOKA 1MJBA 1K78A 2VONA 3FM3A 1SFKA 4HOBA 1YJNI 5EEGA 5IT9Z 2XAUA 3Q9VA 3NRVA 2FSWA 3GZNB 5EGOB 1YW9A 2D2WA 3FWEA 4E7JA 2CQKA 1VQKI 2BE5F 4E4HA 2PQ8A 2V9VA 1ON2A 2DA2A 1Z3XA 3P5JA 3U21A 1U2WA 1X4OA 3S2HJ 5HODA 2DXIA 2RQQA 2FMYA 2KRFA 2CO5A 3BDDA 1B72A 4UV9A 1V3FA 1JGSA 4I2OA 2Z5UA 1J5YA 4C3JJ 1IV6A 3S2DJ 4RB3C 4V2GA 3A01A 1ZG1A 4AWXB 1ZREA 3DLLF 4NC8A 4A6DA 1F1ZA 2KIUA 4YIFA 2BVMA 4EJOA 3JSOA 1IV8A 4XMYA 4C30A 3K1PA 4MNUA 5A2QZ 1VQ9I 2VQLA 3BZ6A 3H9JA 2XAFA 3OL3A 4FCYA 4GYIA 1R36A 4RGXA 1I3QJ 2F4MB 3T1BA 2ZCWA 1FBUA 2JPCA 1T2KA 5FFXA 1MBFA 2V6EA 3SZGA 4P96A 3HYIA 2YU9J 2NVXJ 2K9MA 2LF7A 2LY2A 1BI2A 4B8XA 5JLXA 2F6CA 3HPHA 4A93J 2OZ6A 5TRDA 1X3WB 4HLXA 2VC1A 2M30A 1X1CA 2HVRA 4A12A 1TWFJ 2WTEA 3HGGA 1TC3C 2LFBA 4I99C 5LHIA 2VXDA 1N75A 3S3NA 3F8BA 4GGGA 2LLKA 1KQ9A 1QZZA 2HQRA 3GF2A 2M4KA 2LP0A 1ETKA 1IN7A 5DCFA 1LPQA 3DU5A 1ZARA 3DKYA 4IVNA 4A3EJ 2WY8Q 2HKOA 3LFUA 3GFIA 1FLIA 2P81A 1R4NB 2R7OA 3HZJA 5B1BH 1J75A 1AOYA 1JKPC 2MD0A 1XMKA 4M71A 1YTYA 1VTNC 1B4AA 3U9GA 4PFPA 2FNAA 3PUBA 2CUJA 4IZZA 3WG7H 5CKTA 4CHUA 3MZ8A 2M35A 1G4DA 1WVRA 2EK5A 2BY1A 1UELB 4XOPA 4YFKF 1H89C 4YEJA 3LSPA 1Y0UA 2CGPA 2JSPA 2XF6A 1WKMA 4F52A 4HF0A 3JR9A 4K2EA 1QBJA 1JKQC 3S1MJ 2O8KA 2CRGA 2OBPA 3OYMA 3P9CA 3O3KA 5C3EJ 1X3UA 1FBSA 4XBFA 3CUQB 2DFEA 3CMMA 2GXGA 3HUGB 2FXAA 2W57A 2RNGA 2QA4I 4XQFA 4EGYA 1CF7A 1QA6A 1ZR2A 3L1PA 4HX7A 2J5OA 2Q1ZB 4RAZA 2FNPA 2E34A 2LTPA 3H5RA 2Z1DA 1QHHD 2YR2A 4X6AJ 1I6HJ 3QPTA 2KFDA 3HM5A 2RNJA 4BKXA 2LNBA 3LA3A 4Y17A 3ZRGA 4HDUA 4LIUA 5LRRA 4KN7X 1E0EA 4P9FA 2VJJA 3K70C 3GFMA 4KUMA 3JAMR 4LLLA 4EM2A 4WK8F 3CF2A 2L4AA 3TBIA 2IJLA 1OJLA 3BG3A 4QIWN 5ICGA 1EH6A 5E8GA 2M8EA 2FE3A 2R7WA 3E97A 2D45A 3KP3A 4RA2A 2AQEA 1WWXA 4DIQA 3IRRA 3CF5F 5KVRA 4U7DA 2IVMA 2FJ1A 2ZC2A 1XSXA 2L9SA 2HQAA 3ZGKA 2E2IJ 2MLGA 2EV0A 2E35A 1VI0A 1X2MA 1UCRA 3ZCOA 3E5XA 4L18B 1EKEA 1L3LA 1S29A 4XL9A 1ZGWA 1I5ZA 2IS4A 3I54A 3MKLA 4XOTA 4RMNA 3RIRA 2CS3A 5E1WA 3T5XA 1RIOH 2F4OB 5TISC 3ABTA 3DPLC 3FF5A 3BR0A 1LDDA 4G6QA 2HXOA 2AS5F 3V7RA 1HCRA 3PJRA 3JRDA 3VPRA 1EJ9A 3OYCA 3IH3A 3GTMJ 4CO8A 2F5FA 1LVKA 3GO5A 3BPVA 2DT6A 3OS1A 4MIMA 3LSRA 1EA3A 4FQGA 1MKMA 4F92B 1DPRA 2GXAA 1UFMA 1YOVB 4BDYA 2JA5J 2HDDA 3DTEA 4HW0A 3IC7A 1EV7A 1UHMA 3BJ6A 1W7PD 3HOSA 4L0ZB 4ZYGA 2A69F 1D1BA 3F22A 1P2FA 4BQOA 4R79A 3EDPA 3W2VA 1K6YA 2IRFG 5EZGA 1PVEA 4PJNA 2VE9A 3BG7A 2X6WA 1U78A 4KDPA 5IYBJ 5F1JA 5IT9K 4PGHA 1G3YA 2XRNA 3I3LA 1QVUA 1RI7A 4FHTA 3AAFA 3LSGA 1TW2A 4PZJA 1APLC 2VJIA 4BXFA 3S14J 3IL2A 2V1NA 1T38A 3CCRI 3UKGA 3D5LA 4JK1X 3HC7A 3OYIA 2QWWA 1JI8A 2EV6A 3CJNA 2BEOA 1S3JA 4WXDA 4XICA 2PBIA 1H0MA 1G59A 2PMHA 3EQLF 1IXRC 5DUKA 1REPC 2HPMA 2JZYA 2ZMEB 1XC5A 2A61A 4BHBA 4EJVA 1OCCH 1HC8A 2CW0F 4BQNA 5EG0A 1HXDA 3GXOA 2DPDA 4F93B 2TCTA 1ETQA 3KFWX 3ZOBA 4A0XA 2CQQA 3RCOA 3PFIA 3DFGA 2W82A 2IPQX 2W84A 1VQ6I 3G71I 3HRSA 1IN8A 2YX7A 2WWYA 2Y48A 2BW3A 5B1AH 3V7SA 1FSHA 2DFHA 1Z0XA 3BG6A 1UJ8A 2F48A 1SD4A 3E6MA 1YJWI 5DD8A 4DJAA 3FHNA 2NXNB 3BQYA 3MAJA 4XRSA 2YPRA 2H8RA 4ZDOA 3PSIA 1H9TA 4HNUA 2L3DA 4ZYEA 3QYEA 4RB2C 3AL0B 2COMA 1ZHFA 1P4XA 2IA2A 3F21A 1CGPA 3SDGA 1Y8RB 5HS8A 1R22A 1KQ0A 2DAOA 3EETA 1TL8A 1TQIA 3HKZN 1STZA 2CG4A 4II2A 4UVCA 2E19A 3NWSA 4JYKA 1N78A 2MVTA 1I27A 1K4SA 4LK1F 4U0VA 1EH7A 4G9YA 2PMZA 5LD2C 2CJJA 2UV1A 1BJZA 1A04A 2L7ZA 3OR1C 3E1SA 2PMUA 3J80K 1O3TA 3N05A 4LITA 1R5ID 2DO7A 2OD5A 4HNVA 1Y56A 3Q5FA 1VZ0A 2JUCA 5E79C 4MQVA 4IO9F 4XN3A 4GFBA 5DCMB 4AU7A 4JQFA 1YE9A 3PQKA 1G3TA 1Z6TA 4UUTA 4M6VA 3V4GA 3LA2A 2P5LC 3RSNA 3ZXSA 2HU9A 1MBKA 3OYFA 2JPBA 2KIFA 3KYCB 2L02A 2QQBA 3AG4H 4KIBA 3F6OA 3S15J 3BOQA 2M1BA 2ACJA 4Q48A 1WHUA 3DKXA 5TJJA 1X1DA 2PEXA 3QU3A 3MZHA 4AYBA 5JI6A 2ECCA 4XRMA 1R58A 2CQNA 3R60A 5F1RA 5FKOA 2R5ZB 3CUQC 4LIVA 4QLCU 2JVGA 4MTEA 1FIPA 1VQ8I 4EATA 1MDMB 3D5RC 3EUHA 3FXQA 4D5CA 1QU3A 4P9UA 3J80R 2V9PA 3BTIA 2XUBA 2DW4A 3WGGA 3CCSI 4PFOA 3AFHA 3CO7C 1V5EA 1IO2A 5ILSA 4C2MJ 3KYDB 5D4RA 3V42A 2X1DA 2DU9A 1JE8A 5IP7J 1W1WE 2MLKA 1I3AA 3NWTA 4ZYHA 5L3GA 1HF0A 4LJZF 4HYEA 1XN7A 1MW7A 5HVQC 2L5QA 3IV5A 4KYWA 1SFEA 4CUGA 2EQRA 1K6OA 4N9HA 4XONA 5EDNA 1U5TA 2HVSA 2X51A 4JX5A 1FTTA 4A3IJ 4MFEA 2VKDA 2ME0A 2LR8A 2QZ8A 1ZK8A 2AO9A 1ZLJA 2V9KA 3KEYA 4L0YB 4JP0A 2HI3A 2CSOA 4U87A 2K3PA 4HV6A 1W36C 1IUYA 1W4MA 4XKCA 1LFPA 4YIRX 2ZFWA 2LBFA 5JHFA 4BGDA 4F3QA 1P92A 4DYQA 2IS6A 3GLXA 3JCUC 4F55A 1AWCA 2LC2A 3RZOJ 2GXBA 3LOCA 3HOTA 2DBBA 4E6KG 2IGMA 2M7AA 4U88A 3ZMSA 4PJLA 1T08B 1I6XA 1AHDP 4C3IJ 4L5IA 1ZKGA 2DOAA 3TO6A 4OIPF 2BHYA 4XK4A 4I98B 5CVVA 3RQ4A 1BOAA 1HA8A 3V8JA 3O8GA 4BBSJ 1FC3A 1TWAJ 1SFXA 2VJ5A 3J7ZI 5JHUA 3K9TA 3LMMA 3PFYA 2R7TA 4OIRF 3Q3SA 2EJRA 4HZFA 4XLPF 2P8TA 4O5VA 5E3NA 5EF6A 3G4SI 1S7OA 3ROUA 4HG2A 1XGNA 4D9JA 2KKOA 3A02A 3TP3A 2EINH 5M5XJ 2DFFA 4KMFA 1T0FA 4UUVA 4MEXF 2KZVA 2VOOA 1BW5A 2BHZA 2G0EA 4XRSG 5C44J 5DTDA 4ABZA 5J47A 1UB9A 2X9DA 3FXMA 3KZIC 1JHFA 4MQ9F 2LD5A 1U9NA 1GUUA 2V1XA 3KZZA 2Q8KA 2G9WA 2QQAA 4G7HF 3LSTA 1B6AA 1D0XA 1WGXA 3F8NA 4PCQA 1T39A 4PGGA 2X4HA 3NAUA 2XAQA 2OV7A 2MA3A 1R6RA 2CQ7A 2Q2EA 1JUPA 3D5SC 5LRSA 1ZRFA 2STTA 3KP7A 5KCMA 4DYCA 4QPOA 4J01A 2MC4A 4NHJA 1HKSA 1OCRH 1WJFA 4M3FA 3CCUI 4UY8I 4P5OA 2CH0A 4NC7A 2JA2A 3M9AA 2ZMEC 4QPQA 1O57A 2QQ9A 1R7JA 2VBZA 1LDJA 5HOOA 3J7YJ 3WTXC 3BTCA 2ZBKA 3GTPJ 3M1EA 4RGRA 4AVPA 1SEUA 1UG2A 4BY7J 3NARA 2IP2A 2LKSA 3BJAA 3CCYA 1K4TA 4FETA 3I71A 3CCMI 4DOZA 2LY9A 1J59A 1NG7A 2P6TA 2HQNA 1W5CC 4DW6A 2F5VA 2W1OA 4L5JA 4BQAA 2E7XA 4LMYA 2O5RA 2LSOA 1IN4A 3L00A 2ZJ2A 1QRYA 1XPXA 4HNTA 3JTGA 3L2QA 2LREA 2K7LA 3K70D 2DA5A 5ILVA 2WB1N 5LEKA 2A3SA 5FLVA 3WODF 2DYRH 2LRDA 3DP7A 5GTHC 1HQCA 4NQWB 3AL0C 2WAQA 2M4GA 5FKLA 1B8IA 3BTLA 1ZYRF 2H1KA 4N0BA 4DZPA 3CC2I 1LNWA 1USTA 3O6BB 5D5XB 3I0TA 1ETOA 2NS8A 4A3CJ 2L7KA 5L3BA 3D1NI 1RETA 1VF9A 3OL4A 4LG0B 1XMAA 3CCLI 1KU2A 2R93J 2WAQN 1DDNA 2UWMA 5GADJ 1RR8C 4CCKA 2IGOA 4OMYA 2ZJPF 2BBYA 3KLOA 3K7AJ 2MBFA 4YIIA 1X1PA 1PUFA 3V8KA 3BJOA 2XPVA 4OINF 3PM1A 1BI3A 3CJQB 3VSKA 3A52A 4RB0A 3WTYC 3C18A 3WHCA 1BA5A 1DGWY 4A5NA 1XSVA 4D7MA 4KITB 3F23A 4HQMA 5IPAA 3I53A 1XTAA 3B02A 3RDIA 5DM6F 3BZKA 3CD6I 2H6BA 2JWTA 2K9QA 2W00A 3LSJA 5DS9A 4RM2A 2ZJQF 2EPFA 1B1BA 1E3HA 4L9TA 1ZG5A 3FMQA 4LLNA 4PJ0C 1RKWA 3AG2H 4OAZA 1J0RA 4XR6A 3L2RA 4IL6C 5E1XA 4HF1A 3SEZA 2HOSA 3LL7A 3HOVJ 2CMPA 1YRNA 1YFHA 4Y7NJ 3CDHA 4J00A 2R92J 1IXCA 1D1CA 3S32A 3J81R 3PQJA 1HKTA 4A3DJ 5LFAA 5ICEA 4UB6C 2ESNA 2DOEA 1ENHA 1KU9A 1MBJA 1UZCA 4HSRA 5CJ9A 4LB6B 4A2UA 1H8AC 4RGUA 1FBQA 4CCLA 1T6SA 1SVMA 2DMPA 1L0OC 2Z3YA 3KCCA 1GVJA 4O3MA 1TWCJ 4G6TB 1KYWA 2X48A 3KZYA 4M72A 3F9KA 5B5EC 1ETXA 3LQRA 2FQ3A 2LK2A 4XKVA 4LG3A 1GV2A 3DCFA 2CW8A 1Z9CA 2OQGA 5GAGJ 4YELA 4MGRA 3R0JA 1ZR4A 3PL8A 3DBHB 3OYLA 3J7AW 2M2EA 3UR3C 2R0QC 2A68F 2PJRA 1X58A 5AIQA 1GHCA 2X98A 4M9ZA 1YLFA 4D7NA 1XCBA 4GRIA 2IS2A 2CW7A 4BEHB 2QENA 3PIOF 4ESFA 2L9RA 3MKYB 3BWGA 3FXKA 2PG4A 4J19A 1Z91A 1R5GA 2LMDA 3K6GA 5F04A 2JK3A 1FTZA 2OJED 4OIOF 2XHKA 4RS8A 1VQ7I 3R61A 4LLGF 3BP8A 4Y13A 3KYLA 2A6TA 2V79A 1ZRDA 2HGCA 5M5WJ 6PAXA 1NH3A 2DJNA 4HX8A 2X6YA 2DTRA 4S05A 1JKRC 4UVAA 4GDFA 2JA6J 3N4MA 1JTYA 3S17J 3ZMTA 2DT7B 5FO5A 3CC7I 2K27A 3GTJJ 3A0BC 4D5FA 3SYTA 4FX0A 2BOLA 2ZXIA 4E7SA 3JRCA 1JXSA 3TEDA 1O4XA 4ON0A 4BE1A 3CDIA 4KT6A 4EM1A 3CP8A 4AIKA 3M8EA 4IQ4A 5K7ZA 2HYFA 1GLNA 5GTIC 2FA5A 3G2BA 3H3VK 4BACA 2Y30A 4QSHA 3WGIA 1WSUA 1S6LA 3H36A 3ECHA 5D6FA 4MFDA 1YIOA 2E1OA 4ESBA 4MEYF 4YRVA 5FLXK 2VBWA 2OCCH 3HIFA 1ZH5A 5BPIA 3VDXA 1I39A 2F2EA 2LDUA 2X0LA 1D0ZA 3RQIA 1FT9A 1BBYA 3ZMDA 4KNYA 1TWGJ 1LJ9A 3RTRA 3PIPF 2MYSA 4RGSA 4BJ5C 2RN7A 3JRHA 3C7JA 3W6JB 2MSYA 2VQGA 3ZQHA 1S72I 2KP6A 2VBXA 4NB5A 2ZJRF 3PNVA 3ONQA 2NVTJ 2EIKH 3VYTB 1O3QA 4G6DA 2H8WA 2VXZA 4DQ2A 2E5NA 3S3MA 3HRUA 4RAGA 2KJCA 2XGXA 4EJTA 3DLAA 5D8KB 1JJ6C 3ISPA 4ZZLA 2W48A 3BG9A 1AKHB 2VN2A 3GYHX 1LE8A 3PUFA 3L09A 4R1HA 3FBNB 3FMSA 3Q0VA 2X1EA 3ABKH 2WA0A 3FKIJ 3K4LA 2M7BA 5IP6A 1ETVA 1HSTA 2Y0MA 1P7IA 1IZ1A 3C3WA 3E5QA 4B44A 3A4CA 2D1VA 3P9KA 5FFZA 3CMEI 1ZELA 2OC6A 1YS7A 3CDLA 4CCNA 4BYYA 5ILUA 2OZUA 2DODA 2M87A 3AG1H 3ASOH 1LKXA 1DP3A 2RGVA 5HDNA 3GX4X 1IRFA 3JREA 2CUZA 1D1AA 4UV8A 2E1NA 2R5YA 1O7LA 5FLMJ 3FXUA 3K4KA 1FOYA 2DK5A 1RZ4A 2WC2A 1YS6A 4ZC3A 4B3XA 3IKTA 1ACIA 3IWFA 1T98A 2E2HJ 3QPHA 3A2KA 1Y1VJ 1Z7LA 5GPCA 2XASA 3G3ZA 2Z99A 2M0MA 2OAZA 4RLQA 1WJAA 1QNTA 4AIDA 5FRMA 1QO0D 1W36D 3TQNA 2EWNA 2L9VA 3BG5A 5FRNA 1X4PA 3KPHA 2QCOA 1W7PB 2HFHA 5BPDA 1WI9A 1MMNA 5FD6A 1W0UA 3QOPA 2EFOA 5HLIA 4CYCB 3H9GA 4IRGA 1KQ8A 3L2VA 4HF2A 3F3XA 3TKYA 3JRGA 3PNYA 3I59A 1UHWA 4I6ZA 5ERIA 1YIJI 1VQOI 2NAZA 5F64A 2QSGX 1JUMA 1SD6A 3ZQIA 3GTKJ 3GVAA 4XLFA 2WADA 4Y52J 3K2AA 2ME6A 5HDKA 4U7BA 1LVAA 5ICCA 2J5PA 3A03A 3HRMA 5L3CA 2VODA 3R0AA 4EM0B 1HOMA 2L2OA 1TBXA 3BR1A 2WV0A 2PN6A 3G1LA 5C4XJ 2CFOA 1TQMA 2OTJI 2F5EA 2YUSA 3K2ZA 2XGDA 1MBGA 2E5ZA 2M34A 3M7GA 5FKKA 2VIXA 4BJTA 3WTVC 2QBYA 2YSRA 1MBEA 3ASNH 3G1MA 2K9SA 1IDZA 1ZLKA 3H5AA 3VB2A 3SJMA 3PO2J 2A5WA 2QLZA 2K4BA 2MH2A 4A3FJ 3I5UA 1QGPA 1K78B 1LUJB 2XGCA 3QQAA 2K40A 2QQ8A 3B73A 3MVPA 1QQIA 1J2XA 5DEQA 2O9LA 1U9OA 1DPUA 5A2QK 5IT9R 1TTYA 4KMUX 1RKTA 2VJ4A 1S5LC 1DU6A 1R23A 1MNDA 5JR3A 3I9V2 1ZQ3P 4HRIA 1R49A 4BS9A 2JMWA 2KZGA 4Q5SF 2K02A 1OCPA 4A6EA 4DBQA 1RUNA 1G2HA 1ON1A 3I64A 2EFNA 3HDDA 1B72B 3LSIA 3GTQJ 2ESHA 2KQRA 3HKZA 4CH7A 3IWZA 1NK2P 1LQ1A 3K1NA 3FXOA 3A01B 2DMNA 4HEA2 1OYWA 5CVRA 1F9NA 2NYXA 5IP9J 2IAIA 4AVZA 1H88C 2BVLA 3I4PA 4PUSA 1BIAA 9ANTA 1JHHA 3GMEA 3FKJA 1JKOC 2L54A 4WX9A 4CYDA 2Y9ZA 3CQZJ 2DYSH 3ZMVA 2VKVA 5A2QR 2B0LA 3KP4A 2RAEA 1OQYA 3HRTA 5J8CA 2R7QA 3FX3A 4B1RA 4U0YA 3SDBA 1PDNC 2JA8J 2V7FA 2JRTA 2WY7Q 2VKEA 2V26A 3GTLJ 1Z6RA 1YQAA 2IBDA 2MUNA 2FQ4A 3CUOA 3CJTB 2ZXHA 5EGOA 2CWEA 2V1DA 5IOZA 3O2PE 3MCZA 4RBOA 2JJ7A 2GM4A 3WTSC 5E20A 3GZ6A 3VYRB 2ELJA 2EFQA 1JUSA 3KP2A 3ZMZA 1D8JA 4I7HA 2ISYA 1Z1DA 2FBIA 2NOGA 3H5NA 1JT0A 2NVUB 2L01A 2W24A 1POGA 2K5CA 1HBXG 2NS7A 2CQXA 2ZNZA 3J81Z 1MSEC 4IPAA 3FIWA 2XSJC 3S16J 3H3UA 3OYKA 4BXXJ 3EPZA 1XX5A 3DBLB 4IHSA 1Z67A 2KHMA 1YYVA 3R6SA 5EEHA 1FOWA 3BC8A 1FWZA 4XORA 5K1YA 3H1CA 4HA8A 2R3SA 3N97A 1JJ8C 2ZXJA 2HDWA 2E7WA 3KX2A 3WTUC 1VQMI 2WV1A 1MJ9A 2VT2A 2B7EA 1BR1A 2QGUA 1XG1A 1RRJA 5FJ8J 2Z9OA 3QRFF 3RYPA 2GQQA 2XVCA 1P4WA 1G8XA 3H0DA 1T56A 3FDYA 1KONA 1PYVA 2RV8A 2HPIA 3OWTA 4ENNA 1SD5A 1EF4A 1K61A 3MN2A 1MH3A 1RUOA 3ZMUA 1YITI 1MH4A 4A3BJ 3H3ZA 2MD5A 4EMSA 4E7IA 2ZFUA 4A69C 1B9MA 5ICFA 3I4NJ 2K9LA 2R7FA 1CF7B 1WFXA 3CC4I 3PO3J 1I1SA 4M3BA 4ZJZA 3ZPLA 4FTHA 1Y0NA 3WU2C 4CZCA 5LGTA 4BXUA 3K69A 2XPWA 2TRTA 2VI6A 4BH9A 4BQQA 5LHHA 1BL0A 2KL4A 1W5SA 5CQEA 3E3VA 4OU0A 2Y69H 3PSFA 2PX9A 1OCZH 4LGWA 5FKNA 3OOUA 5D5WB 1OPCA 3A0HC 2E1CA 5E3OA 3DQVC 3R4KA 5FD5A 4V19K 1W5TA 3E5UA 4EVIA 1BC8C 3ERMA 1P7JA 1RC9A 2OF7A 5KNLA 2DMTA 1MZBA 3ZQ7A 3S1NJ 4M73A 5FGMA 3CJRB 1WJ5A 1VNDA 2XPUA 2GOXB 1MJAA 5CLSA 5IYCJ 1VQLI 2XB5A 2COBA 2IXSA 4EQQA 1DGRM 4OMZA 4RM3A 2E60A 2XC7A 4BUPA 4BHCA 3GTGJ 1IW7F 4AUXA 4DYRA 1A36A 2FRHA 5DD4A 5H2FC 3COAC 2KJBA 1MBHA 3IHUA 1IJWC 2DA4A 3ERED 1D0YA 4HX4A 5CYVA 2P0TA 3GEZA 2Y0SA 2QKMB 1W0TA 1FOKA 2HYJA 3MZYA 1A31A 4M6YA 3M4OJ 3OS2A 3L2CA 3OYNA 1ERDA 2DA3A 3OMYA 1XGOA 1HDPA 3CUQA 1A6QA 2GIVA 1MD0A 4FISA 4ENMA 3ABMH 1F4KA 4RB1A 3HUGA 1QZYA 4XLNF 2O3FA 2OCEA 2Y0SN 2CV2A 2V1UA 2EA2A 1P9QC 1YX3A 2FU4A 3KLNA 1WH7A 2VKHA 1SMYF 2BY2A 4XLCA 3ML6A 2DN0A 4BDZA 1OR7C 2HZTA 4G94A 2ZO4A 3IH4A 3X2QH 1FEXA 1FSEA 3QPLA 1R1VA 2RC4A 3M3YJ 5HDGA 2O8XA 1VQPI 3JAMZ 4IHWA 2W4SA 2ZNYA 5GAEJ 2JA7J 2ZSHB 3HGYA 4A3MJ 2DQLA 3IP4B 3CCVI 4EJWA 1YW8A 2F5DA 3KIOA 5F0HA 4PJJA 3I55I 1D5YA 1TNTA 2EA4A 3HSRA 2M5WA 1IDYA 4BNCA 2O7OA 4IHTA 1FYKA 4HLYA 5K5OA 1V5GA 4XLEA 1WH5A 3KEOA 3REOA 3BTJA 1O3RA 4Y33A 2R7SA 1NHAA 3OY9A 1U0JA 2MFZA 2WB1A 1N77A 1LDKB 1DUXC 2PFBA 2QBYB 2ISZA 3ESWB 1KZHA 3J7AO 4IEJA 3GW2A 4I02A 3ABLH 5F0CA 2FMLA 4ZDPA 3BR3A 3C2HA
chains in the Genus database with same CATH topology
1XDUA 2ETHA 5DUIA 2EFWA 4L9VA 4N9IA 3F72A 1ZG3A 3VEPA 2P7VB 5JVTA 2R7DA 3FMRA 1YW7A 1XCVA 3I58A 1FZPB 4Y15A 5K5QA 1B59A 4HAMA 4XSZF 1SAXA 5E17F 1ZGJA 3WU0A 3DEUA 3TO9A 1IN6A 2JSCA 3IRQA 1GXPA 5DDGA 5BOXA 1RNLA 3L9FA 3KEQA 3KP6A 4ASNA 5LHGA 1IXSB 3TDUC 2OA4A 4KT5C 1R00A 3MEXA 4ZYDA 4GYGA 4JBAA 3GUDA 1FP2A 4OIQF 4WXHA 4Z2YA 1LEBA 4FX4A 3WTTC 5D8LB 1BC7C 3RPQA 1TW3A 4HBLA 2A6EF 3ULQB 4I0AA 1KU7A 2BGCA 4LB5A 2ADUA 2ZMEA 3U1DA 4OOIA 4L9JA 3C1DA 4U0WA 1P4AA 4MTDA 5CVJA 2ELHA 5BMZA 2L4MA 2QYOA 2DT5A 2VOPA 4WWCA 2DI3A 1WQ2A 2HKXA 3TDZC 3GWZA 3SFZA 2FBKA 4BHPA 5H20A 2LF8A 2EB7A 4G7ZF 3BY6A 2HOEA 1XGMA 2Q0OA 2A5YB 3VFZA 4PDKA 3T8TA 2KIMA 5AIPA 5J6XA 3LAJA 2O6GE 2GWRA 2MH9A 3K1MA 3WU1B 2H27A 2RQPA 3U2RA 5LLQA 1ZGAA 4GCVA 2A6HF 2V6CA 2H94A 2XV4S 3WGHA 5LBQA 4LFUA 1U5TB 4IRIA 5DCMA 4M74A 2IA1A 2H6CA 3T0YA 2XAHA 1XGSA 3ZP5A 1BM9A 4R8HA 2HWVA 1HSJA 2BV6A 2FEZA 4M9XA 1O7FA 2EV5A 1D3YA 1HW2A 2QM3A 3H92A 4ENJA 3DF8A 3K0LA 4FT8A 3E6BA 4KIFA 4KA4A 3E6CC 3J80Z 1MDMA 1LEAA 4CXFA 3TOAA 5K5RA 5LEJA 2DFIA 3SQNA 4I09A 1IN5A 1GXQA 1HW5A 1J9IA 4TV7A 3JAMK 1U3EM 2TDXA 3BPXA 4CDGA 3P7NA 4G8XA 3S2WA 1E17A 4M9SA 5L3EA 2F5CA 4CICA 3LWFA 3FZVA 3ZN0A 2M45A 1ULYA 4IRHA 3HSFA 2PI0A 1R1TA 1ZAOA 3ZN1A 5DV5A 1D5VA 5BQTA 3JSPA 4CZZA 3NEUA 2P4WA 3F8MA 5FB2A 5KK1A 1SFUA 1Z7UA 1K79A 5CVUA 2Z33A 3DPTA 2XAJA 2ZKZA 2W85A 3ELKA 4I0BA 4KN4X 3RYRA 3G73A 4YFNF 4GO1A 1WRJA 2RVCA 4AD9A 2P5KA 3OV8A 4D0PA 3MQ0A 2GAUA 4ENKA 1P6RA 2OU2A 2MC3A 2QVOA 2AXLA 4KICA 2DQRA 3HHHA 5BS6A 1U8RA 2P5VA 3DXJF 1H9GA 2GA2A 2JTVA 1Z05A 1Q1HA 4QWQA 4WF2A 3VODA 5E8IA 4ZH4F 4B09A 4RAYA 2HTJA 2DLLA 2K86A 1U6GA 3KP5A 3WG9A 3LFKA 4L9NA 4M6XA 2IA0A 4HDVA 5HLHA 5CVIA 3F8FA 3QAHA 1J7KA 3BROA 5L3DA 4EV0A 2HR3A 3RKYA 5AONA 2VE8A 1KA8A 1PP7U 3ECOA 3CLOA 2K4JA 1BIBA 1YG2A 3EYIA 5DYMA 3TOBA 3LA7A 3JW4A 4NQWA 5HS7A 1OKRA 3VOEA 1FY7A 2XKOA 3QP5A 4LG0A 4KIGA 1LB2A 2NRAC 4O6JA 4AIHA 4UXNA 2CYYA 3P9IA 2HS5A 1IAWA 1HKQA 1ONVA 3QU6A 2VBYA 1DP7P 1U5TC 4EGZA 1K7AA 4AIJA 2H09A 4LD5A 4DNCA 3D0SA 3F6VA 1SD7A 4XSXF 1R1UA 1SMTA 3IKVA 3OOPA 2O61A 1FNNA 2DK8A 3FHZA 3SHFA 3SXYA 4KFCA 1OMIA 1EH8A 5HS9A 1XSDA 4GXOA 4P55A 2FF4A 1S7AA 2HDCA 1S8NA 3FM5A 2OQRA 3ABUA 2RKHA 1G3SA 3WTWC 2G7UA 2O03A 3RPUA 1V4RA 3RI4A 1FX7A 3MWMA 4H0EA 4ZZDA 2XROA 2IW5A 1BJAA 3NQOA 5H6RA 2UZKA 3WTZA 1MGTA 2GA1A 3TGNA 4ETSA 3WE2A 4E70A 1G6NA 2IT0A 3DV8A 2XIGA 3KE2A 1G3WA 3DKWA 4UVBA 3RKWA 4EJUA 3LQQA 4UNOA 1F5TA 2C6YA 5F6FA 3HTSB 2HYGD 5L3FA 2Y75A 4BAYA 3V8LA 4A0YA 5IT3A 4S04A 4G7OF 2EFPA 2QUFA 1PUEE 1TLHB 2GZWA 1ODDA 1I1GA 4A5MA 3CO6C 4CGZA 3KETA 2RDPA 3F8CA 4MHGA 1XD7A 1IRGA 3RKXA 1FPQA 2FBHA 4WCGA 1TNSA 1FYMA 1TQPA 3V7CA 1E2XA 1D8KA 1O3SA 3I59B 2STWA 2UXNA 4XRFA 3TO7A 4HQEA 5FLXZ 1R5HA 5D6EA 1YO5C 2A07F 1XB4A 3HTUA 1IF1A 3W6KB 4YFXF 2NNNA 5D5UB 4WXCA 2P6SA 1KGSA 5E18F 2HTSA 5D4SA 4I01A 2PLYA 1HW1A 5H6QA 2BYVE 3WE3A 2YX4A 1KU3A 1BI0A 3L7WA 2W25A 5HLGA 2NNYA 2JT1A 4YG2F 2UXXA 2D1HA 1FP1D 3M8FA 4IF4A 3CTAA 1OYIA 1XDSA 3SZTA 3GFJA 1KYZA 3HSEA 1W7PA 1B9NA 1OYYA 4Q4ZF 2DPUA 4F7ZA 4Q47A 2HEOA 4IXAA 2G7HA 2XKPA 2VT3A 4IJAA 1QPMA 2CFXA 3Q9SA 4HV5A 3GZ5A 4LK0F 3RJPA 1BN5A 1USSA 3HHGA 2XAGA 3JTHA 5D5VB 5J8FA 2LKPA 3GFLA 3FXRA 1ZN2A 5JFRA 5LGUA 1ZRCA 3T8RA 3QP6A 5E1ZB 5LGNA 1FYLA 1OR7A 3MFKA 2P7CB 2YU3A 2PJPA 1BI1A 4ESJA 3EYYA 2VC0A 1C0WA 1PP8F 4UHTA 3J81K 3LAPA 2NS0A 2O0YA 3SZPA 3E6DA 5ED4A 4A0ZA 2FOKA 1MJBA 1K78A 2VONA 3FM3A 4HOBA 5IT9Z 5EEGA 3Q9VA 3NRVA 2FSWA 1YW9A 2D2WA 3FWEA 2CQKA 2BE5F 2PQ8A 2V9VA 1ON2A 1U2WA 2FMYA 2KRFA 2CO5A 3BDDA 4UV9A 1V3FA 1JGSA 4I2OA 2Z5UA 1J5YA 4RB3C 1ZG1A 4AWXB 1ZREA 4A6DA 1F1ZA 2KIUA 4YIFA 4EJOA 3JSOA 3K1PA 4MNUA 5A2QZ 3BZ6A 2XAFA 4GYIA 1R36A 4RGXA 3T1BA 2ZCWA 1FBUA 2JPCA 1T2KA 5FFXA 4P96A 3HYIA 2LF7A 1BI2A 4B8XA 2OZ6A 5TRDA 4HLXA 2VC1A 2M30A 4A12A 2WTEA 5LHIA 3F8BA 4GGGA 1KQ9A 1QZZA 2HQRA 3GF2A 1IN7A 5DCFA 1ZARA 4IVNA 2HKOA 3GFIA 1FLIA 1J75A 1AOYA 1XMKA 4M71A 1YTYA 1VTNC 1B4AA 3U9GA 2FNAA 4CHUA 1G4DA 2EK5A 4YFKF 1Y0UA 2CGPA 1WKMA 4HF0A 4K2EA 1QBJA 2OBPA 3P9CA 3O3KA 1X3UA 1FBSA 4XBFA 3CUQB 2GXGA 2FXAA 2W57A 4EGYA 1CF7A 4HX7A 2J5OA 4RAZA 2FNPA 2YR2A 3QPTA 2RNJA 2LNBA 3LA3A 4Y17A 4HDUA 5LRRA 4KN7X 4P9FA 3GFMA 4KUMA 4LLLA 4EM2A 4WK8F 2L4AA 5ICGA 2IJLA 1EH6A 5E8GA 2M8EA 2FE3A 3E97A 2D45A 3KP3A 3IRRA 1WWXA 5KVRA 4U7DA 2IVMA 1XSXA 2MLGA 2EV0A 1UCRA 3E5XA 4L18B 1L3LA 1S29A 1I5ZA 3I54A 3RIRA 5E1WA 3T5XA 1RIOH 3ABTA 3DPLC 3FF5A 1LDDA 4G6QA 2AS5F 3V7RA 4CO8A 2F5FA 3GO5A 3BPVA 1MKMA 1DPRA 1UFMA 4HW0A 3IC7A 1EV7A 1UHMA 3BJ6A 1W7PD 3HOSA 4L0ZB 4ZYGA 2A69F 3F22A 1P2FA 4R79A 3EDPA 2IRFG 2VE9A 1U78A 4KDPA 5IT9K 4PGHA 1G3YA 2XRNA 4FHTA 1RI7A 3AAFA 1TW2A 4PZJA 3IL2A 1T38A 3D5LA 4JK1X 2QWWA 2EV6A 3CJNA 2BEOA 1S3JA 4WXDA 1H0MA 2PBIA 2PMHA 3EQLF 1IXRC 5DUKA 1REPC 2JZYA 2ZMEB 2A61A 4BHBA 4EJVA 2CW0F 1HXDA 3GXOA 2DPDA 3KFWX 4A0XA 3PFIA 3DFGA 2IPQX 2W84A 3HRSA 1IN8A 2YX7A 2WWYA 2Y48A 3V7SA 1FSHA 1SD4A 3E6MA 5DD8A 3MAJA 2YPRA 1H9TA 2L3DA 4ZYEA 4RB2C 2COMA 1ZHFA 1P4XA 2IA2A 3F21A 1CGPA 5HS8A 1KQ0A 1R22A 2DAOA 3EETA 1TQIA 1STZA 2CG4A 4UVCA 1I27A 4LK1F 4U0VA 1EH7A 4G9YA 1A04A 2PMUA 3J80K 1O3TA 2DO7A 2OD5A 3Q5FA 4MQVA 5DCMB 4JQFA 3PQKA 1G3TA 1Z6TA 3V4GA 3LA2A 2P5LC 2JPBA 2KIFA 2L02A 2QQBA 4KIBA 3F6OA 3BOQA 2M1BA 2ACJA 4Q48A 5TJJA 2PEXA 3MZHA 3QU3A 5JI6A 1R58A 3R60A 5F1RA 3CUQC 4QLCU 4MTEA 1MDMB 3EUHA 3FXQA 4P9UA 2XUBA 2DW4A 3WGGA 3CO7C 5ILSA 5D4RA 2DU9A 1JE8A 2MLKA 4ZYHA 5L3GA 4LJZF 4HYEA 1XN7A 5HVQC 4KYWA 1SFEA 1K6OA 4N9HA 1U5TA 2QZ8A 1ZLJA 4L0YB 2CSOA 4HV6A 1IUYA 1W4MA 2ZFWA 1P92A 3GLXA 1AWCA 2GXBA 2DBBA 4U88A 3ZMSA 1I6XA 4L5IA 3TO6A 4OIPF 4I98B 5CVVA 1BOAA 3V8JA 1FC3A 1SFXA 5JHUA 3K9TA 4OIRF 2EJRA 4HZFA 4XLPF 2P8TA 4O5VA 1S7OA 3ROUA 1XGNA 2KKOA 4KMFA 1T0FA 4UUVA 4MEXF 2VOOA 1UB9A 4MQ9F 1JHFA 3KZZA 2V1XA 2Q8KA 2G9WA 2QQAA 4G7HF 3LSTA 1B6AA 3F8NA 4PCQA 1T39A 4PGGA 2X4HA 2XAQA 2MA3A 2Q2EA 5LRSA 1ZRFA 2STTA 3KP7A 4NHJA 1HKSA 4P5OA 3M9AA 1O57A 2QQ9A 1R7JA 2VBZA 1LDJA 5HOOA 3WTXC 2ZBKA 3M1EA 4RGRA 4AVPA 2IP2A 3BJAA 3I71A 1J59A 2P6TA 2HQNA 4L5JA 4BQAA 2E7XA 4LMYA 2LSOA 1IN4A 3L00A 2ZJ2A 3JTGA 2K7LA 5ILVA 5LEKA 2A3SA 3WODF 3DP7A 1HQCA 1ZYRF 4N0BA 1LNWA 1USTA 3O6BB 5D5XB 3I0TA 5L3BA 4LG0B 1XMAA 1KU2A 1DDNA 2UWMA 4OMYA 2BBYA 3KLOA 4YIIA 2MBFA 3V8KA 3BJOA 4OINF 1BI3A 4RB0A 3WTYC 3C18A 4A5NA 1XSVA 3F23A 4HQMA 3I53A 3B02A 3RDIA 2H6BA 4LLNA 1B1BA 4L9TA 1ZG5A 3FMQA 1J0RA 4HF1A 5E1XA 1YFHA 3CDHA 1IXCA 3PQJA 1HKTA 5ICEA 2ESNA 1KU9A 4A2UA 5CJ9A 4LB6B 4RGUA 1FBQA 1T6SA 1L0OC 2Z3YA 3KCCA 1GVJA 4O3MA 1KYWA 3KZYA 4M72A 3LQRA 2FQ3A 1Z9CA 2OQGA 4MGRA 3R0JA 2A68F 5AIQA 1GHCA 4M9ZA 1YLFA 1XCBA 2QENA 4ESFA 3BWGA 2PG4A 1Z91A 1R5GA 4OIOF 2XHKA 4RS8A 3R61A 4LLGF 3BP8A 4Y13A 2V79A 1ZRDA 2HGCA 6PAXA 4HX8A 2DTRA 4S05A 4UVAA 3N4MA 3ZMTA 5FO5A 2K27A 4FX0A 1JXSA 4ON0A 4EM1A 4AIKA 3M8EA 2HYFA 2FA5A 3WGIA 1WSUA 1S6LA 3ECHA 5D6FA 1YIOA 4ESBA 5FLXK 4MEYF 2VBWA 3HIFA 1ZH5A 5BPIA 2F2EA 2LDUA 2X0LA 1FT9A 1BBYA 3ZMDA 4KNYA 1LJ9A 3RTRA 4RGSA 2RN7A 3C7JA 3W6JB 2VBXA 4NB5A 1O3QA 4G6DA 2VXZA 4DQ2A 3HRUA 2KJCA 2XGXA 4EJTA 5D8KB 3ISPA 4ZZLA 2VN2A 3GYHX 3L09A 4R1HA 3FMSA 1HSTA 2Y0MA 3C3WA 1IZ1A 5L3CA 3E5QA 3HOTA 2D1VA 3P9KA 5FFZA 1YS7A 4BYYA 5ILUA 2OZUA 2M87A 2RGVA 5HDNA 3GX4X 1IRFA 4UV8A 2E1NA 1O7LA 3FXUA 2DK5A 1RZ4A 2WC2A 1YS6A 3IKTA 3IWFA 1T98A 3QPHA 2XASA 3G3ZA 2Z99A 2OAZA 1QNTA 1QO0D 3TQNA 2EWNA 1W7PB 2HFHA 5BPDA 1WI9A 5FD6A 3QOPA 2EFOA 5HLIA 4IRGA 1KQ8A 4HF2A 3F3XA 3TKYA 3I59A 1UHWA 5ERIA 2NAZA 5F64A 1SD6A 3GVAA 5HDKA 4U7BA 1LVAA 5ICCA 2J5PA 3HRMA 2VODA 3R0AA 4EM0B 1TBXA 2WV0A 2PN6A 1TQMA 2F5EA 3K2ZA 3M7GA 3WTVC 2QBYA 2YSRA 1ZLKA 3VB2A 2QLZA 2K4BA 2MH2A 3I5UA 1QGPA 1K78B 3B73A 1QQIA 1J2XA 5DEQA 1DPUA 5A2QK 1TTYA 4KMUX 1R23A 5JR3A 4Q5SF 2K02A 4A6EA 1RUNA 1ON1A 3I64A 2EFNA 2ESHA 3IWZA 1LQ1A 3K1NA 1OYWA 5CVRA 1F9NA 2NYXA 3I4PA 1BIAA 1JHHA 2L54A 4WX9A 4CYDA 3ZMVA 2B0LA 3KP4A 3HRTA 5J8CA 3FX3A 4U0YA 1PDNC 2JRTA 1Z6RA 1YQAA 3CUOA 2CWEA 2V1DA 3O2PE 3MCZA 3WTSC 5E20A 3GZ6A 2EFQA 3KP2A 3ZMZA 1D8JA 4I7HA 2ISYA 1Z1DA 2FBIA 2L01A 2W24A 1HBXG 3J81Z 2ZNZA 4IPAA 3H3UA 4IHSA 1YYVA 3R6SA 5EEHA 1FWZA 5K1YA 4HA8A 2R3SA 3N97A 2ZXJA 2E7WA 3WTUC 1MJ9A 2VT2A 2Z9OA 3QRFF 3RYPA 2GQQA 2XVCA 1P4WA 2RV8A 4ENNA 1SD5A 1RUOA 3ZMUA 3H3ZA 2MD5A 4EMSA 1B9MA 5ICFA 1CF7B 2R7FA 1I1SA 3ZPLA 5LGTA 4BXUA 3K69A 4BH9A 5LHHA 1W5SA 3E3VA 4OU0A 4LGWA 2E1CA 5D5WB 1OPCA 3DQVC 3R4KA 5FD5A 1W5TA 3E5UA 4EVIA 1BC8C 1MZBA 3ZQ7A 4M73A 5FGMA 1MJAA 5CLSA 4EQQA 4OMZA 4BHCA 1IW7F 2FRHA 5DD4A 3COAC 2KJBA 3IHUA 3ERED 4HX4A 5CYVA 3GEZA 1FOKA 3MZYA 4M6YA 3L2CA 1XGOA 3CUQA 2GIVA 4ENMA 1MD0A 1F4KA 4RB1A 3HUGA 1QZYA 4XLNF 2O3FA 2V1UA 2EA2A 2FU4A 3KLNA 1SMYF 3ML6A 2HZTA 4G94A 2ZO4A 1FSEA 1R1VA 2RC4A 5HDGA 2O8XA 3JAMZ 2ZNYA 2DQLA 4EJWA 1YW8A 2F5DA 1TNTA 2EA4A 3HSRA 2M5WA 4BNCA 4IHTA 1FYKA 4HLYA 5K5OA 3KEOA 3REOA 1O3RA 1NHAA 1LDKB 1DUXC 2PFBA 2QBYB 2ISZA 3J7AO 3GW2A 4I02A 2FMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDU A;  2ETH A;  5DUI A;  2EFW A;  4L9V A;  4N9I A;  3F72 A;  1ZG3 A;  3VEP A;  2P7V B;  5JVT A;  2R7D A;  3FMR A;  1YW7 A;  1XCV A;  3I58 A;  1FZP B;  4Y15 A;  5K5Q A;  1B59 A;  4HAM A;  4XSZ F;  1SAX A;  5E17 F;  1ZGJ A;  3WU0 A;  3DEU A;  3TO9 A;  1IN6 A;  2JSC A;  3IRQ A;  1GXP A;  5DDG A;  5BOX A;  1RNL A;  3L9F A;  3KEQ A;  3KP6 A;  4ASN A;  5LHG A;  1IXS B;  3TDU C;  2OA4 A;  4KT5 C;  1R00 A;  3MEX A;  4ZYD A;  4GYG A;  4JBA A;  3GUD A;  1FP2 A;  4OIQ F;  4WXH A;  4Z2Y A;  1LEB A;  4FX4 A;  3WTT C;  5D8L B;  1BC7 C;  3RPQ A;  1TW3 A;  4HBL A;  2A6E F;  3ULQ B;  4I0A A;  1KU7 A;  2BGC A;  4LB5 A;  2ADU A;  2ZME A;  3U1D A;  4OOI A;  4L9J A;  3C1D A;  4U0W A;  1P4A A;  4MTD A;  5CVJ A;  2ELH A;  5BMZ A;  2L4M A;  2QYO A;  2DT5 A;  2VOP A;  4WWC A;  2DI3 A;  1WQ2 A;  2HKX A;  3TDZ C;  3GWZ A;  3SFZ A;  2FBK A;  4BHP A;  5H20 A;  2LF8 A;  2EB7 A;  4G7Z F;  3BY6 A;  2HOE A;  1XGM A;  2Q0O A;  2A5Y B;  3VFZ A;  4PDK A;  3T8T A;  2KIM A;  5AIP A;  5J6X A;  3LAJ A;  2O6G E;  2GWR A;  2MH9 A;  3K1M A;  3WU1 B;  2H27 A;  2RQP A;  3U2R A;  5LLQ A;  1ZGA A;  4GCV A;  2A6H F;  2V6C A;  2H94 A;  2XV4 S;  3WGH A;  5LBQ A;  4LFU A;  1U5T B;  4IRI A;  5DCM A;  4M74 A;  2IA1 A;  2H6C A;  3T0Y A;  2XAH A;  1XGS A;  3ZP5 A;  1BM9 A;  4R8H A;  2HWV A;  1HSJ A;  2BV6 A;  2FEZ A;  4M9X A;  1O7F A;  2EV5 A;  1D3Y A;  1HW2 A;  2QM3 A;  3H92 A;  4ENJ A;  3DF8 A;  3K0L A;  4FT8 A;  3E6B A;  4KIF A;  4KA4 A;  3E6C C;  3J80 Z;  1MDM A;  1LEA A;  4CXF A;  3TOA A;  5K5R A;  5LEJ A;  2DFI A;  3SQN A;  4I09 A;  1IN5 A;  1GXQ A;  1HW5 A;  1J9I A;  4TV7 A;  3JAM K;  1U3E M;  2TDX A;  3BPX A;  4CDG A;  3P7N A;  4G8X A;  3S2W A;  1E17 A;  4M9S A;  5L3E A;  2F5C A;  4CIC A;  3LWF A;  3FZV A;  3ZN0 A;  2M45 A;  1ULY A;  4IRH A;  3HSF A;  2PI0 A;  1R1T A;  1ZAO A;  3ZN1 A;  5DV5 A;  1D5V A;  5BQT A;  3JSP A;  4CZZ A;  3NEU A;  2P4W A;  3F8M A;  5FB2 A;  5KK1 A;  1SFU A;  1Z7U A;  1K79 A;  5CVU A;  2Z33 A;  3DPT A;  2XAJ A;  2ZKZ A;  2W85 A;  3ELK A;  4I0B A;  4KN4 X;  3RYR A;  3G73 A;  4YFN F;  4GO1 A;  1WRJ A;  2RVC A;  4AD9 A;  2P5K A;  3OV8 A;  4D0P A;  3MQ0 A;  2GAU A;  4ENK A;  1P6R A;  2OU2 A;  2MC3 A;  2QVO A;  2AXL A;  4KIC A;  2DQR A;  3HHH A;  5BS6 A;  1U8R A;  2P5V A;  3DXJ F;  1H9G A;  2GA2 A;  2JTV A;  1Z05 A;  1Q1H A;  4QWQ A;  4WF2 A;  3VOD A;  5E8I A;  4ZH4 F;  4B09 A;  4RAY A;  2HTJ A;  2DLL A;  2K86 A;  1U6G A;  3KP5 A;  3WG9 A;  3LFK A;  4L9N A;  4M6X A;  2IA0 A;  4HDV A;  5HLH A;  5CVI A;  3F8F A;  3QAH A;  1J7K A;  3BRO A;  5L3D A;  4EV0 A;  2HR3 A;  3RKY A;  5AON A;  2VE8 A;  1KA8 A;  1PP7 U;  3ECO A;  3CLO A;  2K4J A;  1BIB A;  1YG2 A;  3EYI A;  5DYM A;  3TOB A;  3LA7 A;  3JW4 A;  4NQW A;  5HS7 A;  1OKR A;  3VOE A;  1FY7 A;  2XKO A;  3QP5 A;  4LG0 A;  4KIG A;  1LB2 A;  2NRA C;  4O6J A;  4AIH A;  4UXN A;  2CYY A;  3P9I A;  2HS5 A;  1IAW A;  1HKQ A;  1ONV A;  3QU6 A;  2VBY A;  1DP7 P;  1U5T C;  4EGZ A;  1K7A A;  4AIJ A;  2H09 A;  4LD5 A;  4DNC A;  3D0S A;  3F6V A;  1SD7 A;  4XSX F;  1R1U A;  1SMT A;  3IKV A;  3OOP A;  2O61 A;  1FNN A;  2DK8 A;  3FHZ A;  3SHF A;  3SXY A;  4KFC A;  1OMI A;  1EH8 A;  5HS9 A;  1XSD A;  4GXO A;  4P55 A;  2FF4 A;  1S7A A;  2HDC A;  1S8N A;  3FM5 A;  2OQR A;  3ABU A;  2RKH A;  1G3S A;  3WTW C;  2G7U A;  2O03 A;  3RPU A;  1V4R A;  3RI4 A;  1FX7 A;  3MWM A;  4H0E A;  4ZZD A;  2XRO A;  2IW5 A;  1BJA A;  3NQO A;  5H6R A;  2UZK A;  3WTZ A;  1MGT A;  2GA1 A;  3TGN A;  4ETS A;  3WE2 A;  4E70 A;  1G6N A;  2IT0 A;  3DV8 A;  2XIG A;  3KE2 A;  1G3W A;  3DKW A;  4UVB A;  3RKW A;  4EJU A;  3LQQ A;  4UNO A;  1F5T A;  2C6Y A;  5F6F A;  3HTS B;  2HYG D;  5L3F A;  2Y75 A;  4BAY A;  3V8L A;  4A0Y A;  5IT3 A;  4S04 A;  4G7O F;  2EFP A;  2QUF A;  1PUE E;  1TLH B;  2GZW A;  1ODD A;  1I1G A;  4A5M A;  3CO6 C;  4CGZ A;  3KET A;  2RDP A;  3F8C A;  4MHG A;  1XD7 A;  1IRG A;  3RKX A;  1FPQ A;  2FBH A;  4WCG A;  1TNS A;  1FYM A;  1TQP A;  3V7C A;  1E2X A;  1D8K A;  1O3S A;  3I59 B;  2STW A;  2UXN A;  4XRF A;  3TO7 A;  4HQE A;  5FLX Z;  1R5H A;  5D6E A;  1YO5 C;  2A07 F;  1XB4 A;  3HTU A;  1IF1 A;  3W6K B;  4YFX F;  2NNN A;  5D5U B;  4WXC A;  2P6S A;  1KGS A;  5E18 F;  2HTS A;  5D4S A;  4I01 A;  2PLY A;  1HW1 A;  5H6Q A;  2BYV E;  3WE3 A;  2YX4 A;  1KU3 A;  1BI0 A;  3L7W A;  2W25 A;  5HLG A;  2NNY A;  2JT1 A;  4YG2 F;  2UXX A;  2D1H A;  1FP1 D;  3M8F A;  4IF4 A;  3CTA A;  1OYI A;  1XDS A;  3SZT A;  3GFJ A;  1KYZ A;  3HSE A;  1W7P A;  1B9N A;  1OYY A;  4Q4Z F;  2DPU A;  4F7Z A;  4Q47 A;  2HEO A;  4IXA A;  2G7H A;  2XKP A;  2VT3 A;  4IJA A;  1QPM A;  2CFX A;  3Q9S A;  4HV5 A;  3GZ5 A;  4LK0 F;  3RJP A;  1BN5 A;  1USS A;  3HHG A;  2XAG A;  3JTH A;  5D5V B;  5J8F A;  2LKP A;  3GFL A;  3FXR A;  1ZN2 A;  5JFR A;  5LGU A;  1ZRC A;  3T8R A;  3QP6 A;  5E1Z B;  5LGN A;  1FYL A;  1OR7 A;  3MFK A;  2P7C B;  2YU3 A;  2PJP A;  1BI1 A;  4ESJ A;  3EYY A;  2VC0 A;  1C0W A;  1PP8 F;  4UHT A;  3J81 K;  3LAP A;  2NS0 A;  2O0Y A;  3SZP A;  3E6D A;  5ED4 A;  4A0Z A;  2FOK A;  1MJB A;  1K78 A;  2VON A;  3FM3 A;  4HOB A;  5IT9 Z;  5EEG A;  3Q9V A;  3NRV A;  2FSW A;  1YW9 A;  2D2W A;  3FWE A;  2CQK A;  2BE5 F;  2PQ8 A;  2V9V A;  1ON2 A;  1U2W A;  2FMY A;  2KRF A;  2CO5 A;  3BDD A;  4UV9 A;  1V3F A;  1JGS A;  4I2O A;  2Z5U A;  1J5Y A;  4RB3 C;  1ZG1 A;  4AWX B;  1ZRE A;  4A6D A;  1F1Z A;  2KIU A;  4YIF A;  4EJO A;  3JSO A;  3K1P A;  4MNU A;  5A2Q Z;  3BZ6 A;  2XAF A;  4GYI A;  1R36 A;  4RGX A;  3T1B A;  2ZCW A;  1FBU A;  2JPC A;  1T2K A;  5FFX A;  4P96 A;  3HYI A;  2LF7 A;  1BI2 A;  4B8X A;  2OZ6 A;  5TRD A;  4HLX A;  2VC1 A;  2M30 A;  4A12 A;  2WTE A;  5LHI A;  3F8B A;  4GGG A;  1KQ9 A;  1QZZ A;  2HQR A;  3GF2 A;  1IN7 A;  5DCF A;  1ZAR A;  4IVN A;  2HKO A;  3GFI A;  1FLI A;  1J75 A;  1AOY A;  1XMK A;  4M71 A;  1YTY A;  1VTN C;  1B4A A;  3U9G A;  2FNA A;  4CHU A;  1G4D A;  2EK5 A;  4YFK F;  1Y0U A;  2CGP A;  1WKM A;  4HF0 A;  4K2E A;  1QBJ A;  2OBP A;  3P9C A;  3O3K A;  1X3U A;  1FBS A;  4XBF A;  3CUQ B;  2GXG A;  2FXA A;  2W57 A;  4EGY A;  1CF7 A;  4HX7 A;  2J5O A;  4RAZ A;  2FNP A;  2YR2 A;  3QPT A;  2RNJ A;  2LNB A;  3LA3 A;  4Y17 A;  4HDU A;  5LRR A;  4KN7 X;  4P9F A;  3GFM A;  4KUM A;  4LLL A;  4EM2 A;  4WK8 F;  2L4A A;  5ICG A;  2IJL A;  1EH6 A;  5E8G A;  2M8E A;  2FE3 A;  3E97 A;  2D45 A;  3KP3 A;  3IRR A;  1WWX A;  5KVR A;  4U7D A;  2IVM A;  1XSX A;  2MLG A;  2EV0 A;  1UCR A;  3E5X A;  4L18 B;  1L3L A;  1S29 A;  1I5Z A;  3I54 A;  3RIR A;  5E1W A;  3T5X A;  1RIO H;  3ABT A;  3DPL C;  3FF5 A;  1LDD A;  4G6Q A;  2AS5 F;  3V7R A;  4CO8 A;  2F5F A;  3GO5 A;  3BPV A;  1MKM A;  1DPR A;  1UFM A;  4HW0 A;  3IC7 A;  1EV7 A;  1UHM A;  3BJ6 A;  1W7P D;  3HOS A;  4L0Z B;  4ZYG A;  2A69 F;  3F22 A;  1P2F A;  4R79 A;  3EDP A;  2IRF G;  2VE9 A;  1U78 A;  4KDP A;  5IT9 K;  4PGH A;  1G3Y A;  2XRN A;  4FHT A;  1RI7 A;  3AAF A;  1TW2 A;  4PZJ A;  3IL2 A;  1T38 A;  3D5L A;  4JK1 X;  2QWW A;  2EV6 A;  3CJN A;  2BEO A;  1S3J A;  4WXD A;  1H0M A;  2PBI A;  2PMH A;  3EQL F;  1IXR C;  5DUK A;  1REP C;  2JZY A;  2ZME B;  2A61 A;  4BHB A;  4EJV A;  2CW0 F;  1HXD A;  3GXO A;  2DPD A;  3KFW X;  4A0X A;  3PFI A;  3DFG A;  2IPQ X;  2W84 A;  3HRS A;  1IN8 A;  2YX7 A;  2WWY A;  2Y48 A;  3V7S A;  1FSH A;  1SD4 A;  3E6M A;  5DD8 A;  3MAJ A;  2YPR A;  1H9T A;  2L3D A;  4ZYE A;  4RB2 C;  2COM A;  1ZHF A;  1P4X A;  2IA2 A;  3F21 A;  1CGP A;  5HS8 A;  1KQ0 A;  1R22 A;  2DAO A;  3EET A;  1TQI A;  1STZ A;  2CG4 A;  4UVC A;  1I27 A;  4LK1 F;  4U0V A;  1EH7 A;  4G9Y A;  1A04 A;  2PMU A;  3J80 K;  1O3T A;  2DO7 A;  2OD5 A;  3Q5F A;  4MQV A;  5DCM B;  4JQF A;  3PQK A;  1G3T A;  1Z6T A;  3V4G A;  3LA2 A;  2P5L C;  2JPB A;  2KIF A;  2L02 A;  2QQB A;  4KIB A;  3F6O A;  3BOQ A;  2M1B A;  2ACJ A;  4Q48 A;  5TJJ A;  2PEX A;  3MZH A;  3QU3 A;  5JI6 A;  1R58 A;  3R60 A;  5F1R A;  3CUQ C;  4QLC U;  4MTE A;  1MDM B;  3EUH A;  3FXQ A;  4P9U A;  2XUB A;  2DW4 A;  3WGG A;  3CO7 C;  5ILS A;  5D4R A;  2DU9 A;  1JE8 A;  2MLK A;  4ZYH A;  5L3G A;  4LJZ F;  4HYE A;  1XN7 A;  5HVQ C;  4KYW A;  1SFE A;  1K6O A;  4N9H A;  1U5T A;  2QZ8 A;  1ZLJ A;  4L0Y B;  2CSO A;  4HV6 A;  1IUY A;  1W4M A;  2ZFW A;  1P92 A;  3GLX A;  1AWC A;  2GXB A;  2DBB A;  4U88 A;  3ZMS A;  1I6X A;  4L5I A;  3TO6 A;  4OIP F;  4I98 B;  5CVV A;  1BOA A;  3V8J A;  1FC3 A;  1SFX A;  5JHU A;  3K9T A;  4OIR F;  2EJR A;  4HZF A;  4XLP F;  2P8T A;  4O5V A;  1S7O A;  3ROU A;  1XGN A;  2KKO A;  4KMF A;  1T0F A;  4UUV A;  4MEX F;  2VOO A;  1UB9 A;  4MQ9 F;  1JHF A;  3KZZ A;  2V1X A;  2Q8K A;  2G9W A;  2QQA A;  4G7H F;  3LST A;  1B6A A;  3F8N A;  4PCQ A;  1T39 A;  4PGG A;  2X4H A;  2XAQ A;  2MA3 A;  2Q2E A;  5LRS A;  1ZRF A;  2STT A;  3KP7 A;  4NHJ A;  1HKS A;  4P5O A;  3M9A A;  1O57 A;  2QQ9 A;  1R7J A;  2VBZ A;  1LDJ A;  5HOO A;  3WTX C;  2ZBK A;  3M1E A;  4RGR A;  4AVP A;  2IP2 A;  3BJA A;  3I71 A;  1J59 A;  2P6T A;  2HQN A;  4L5J A;  4BQA A;  2E7X A;  4LMY A;  2LSO A;  1IN4 A;  3L00 A;  2ZJ2 A;  3JTG A;  2K7L A;  5ILV A;  5LEK A;  2A3S A;  3WOD F;  3DP7 A;  1HQC A;  1ZYR F;  4N0B A;  1LNW A;  1UST A;  3O6B B;  5D5X B;  3I0T A;  5L3B A;  4LG0 B;  1XMA A;  1KU2 A;  1DDN A;  2UWM A;  4OMY A;  2BBY A;  3KLO A;  4YII A;  2MBF A;  3V8K A;  3BJO A;  4OIN F;  1BI3 A;  4RB0 A;  3WTY C;  3C18 A;  4A5N A;  1XSV A;  3F23 A;  4HQM A;  3I53 A;  3B02 A;  3RDI A;  2H6B A;  4LLN A;  1B1B A;  4L9T A;  1ZG5 A;  3FMQ A;  1J0R A;  4HF1 A;  5E1X A;  1YFH A;  3CDH A;  1IXC A;  3PQJ A;  1HKT A;  5ICE A;  2ESN A;  1KU9 A;  4A2U A;  5CJ9 A;  4LB6 B;  4RGU A;  1FBQ A;  1T6S A;  1L0O C;  2Z3Y A;  3KCC A;  1GVJ A;  4O3M A;  1KYW A;  3KZY A;  4M72 A;  3LQR A;  2FQ3 A;  1Z9C A;  2OQG A;  4MGR A;  3R0J A;  2A68 F;  5AIQ A;  1GHC A;  4M9Z A;  1YLF A;  1XCB A;  2QEN A;  4ESF A;  3BWG A;  2PG4 A;  1Z91 A;  1R5G A;  4OIO F;  2XHK A;  4RS8 A;  3R61 A;  4LLG F;  3BP8 A;  4Y13 A;  2V79 A;  1ZRD A;  2HGC A;  6PAX A;  4HX8 A;  2DTR A;  4S05 A;  4UVA A;  3N4M A;  3ZMT A;  5FO5 A;  2K27 A;  4FX0 A;  1JXS A;  4ON0 A;  4EM1 A;  4AIK A;  3M8E A;  2HYF A;  2FA5 A;  3WGI A;  1WSU A;  1S6L A;  3ECH A;  5D6F A;  1YIO A;  4ESB A;  5FLX K;  4MEY F;  2VBW A;  3HIF A;  1ZH5 A;  5BPI A;  2F2E A;  2LDU A;  2X0L A;  1FT9 A;  1BBY A;  3ZMD A;  4KNY A;  1LJ9 A;  3RTR A;  4RGS A;  2RN7 A;  3C7J A;  3W6J B;  2VBX A;  4NB5 A;  1O3Q A;  4G6D A;  2VXZ A;  4DQ2 A;  3HRU A;  2KJC A;  2XGX A;  4EJT A;  5D8K B;  3ISP A;  4ZZL A;  2VN2 A;  3GYH X;  3L09 A;  4R1H A;  3FMS A;  1HST A;  2Y0M A;  3C3W A;  1IZ1 A;  5L3C A;  3E5Q A;  3HOT A;  2D1V A;  3P9K A;  5FFZ A;  1YS7 A;  4BYY A;  5ILU A;  2OZU A;  2M87 A;  2RGV A;  5HDN A;  3GX4 X;  1IRF A;  4UV8 A;  2E1N A;  1O7L A;  3FXU A;  2DK5 A;  1RZ4 A;  2WC2 A;  1YS6 A;  3IKT A;  3IWF A;  1T98 A;  3QPH A;  2XAS A;  3G3Z A;  2Z99 A;  2OAZ A;  1QNT A;  1QO0 D;  3TQN A;  2EWN A;  1W7P B;  2HFH A;  5BPD A;  1WI9 A;  5FD6 A;  3QOP A;  2EFO A;  5HLI A;  4IRG A;  1KQ8 A;  4HF2 A;  3F3X A;  3TKY A;  3I59 A;  1UHW A;  5ERI A;  2NAZ A;  5F64 A;  1SD6 A;  3GVA A;  5HDK A;  4U7B A;  1LVA A;  5ICC A;  2J5P A;  3HRM A;  2VOD A;  3R0A A;  4EM0 B;  1TBX A;  2WV0 A;  2PN6 A;  1TQM A;  2F5E A;  3K2Z A;  3M7G A;  3WTV C;  2QBY A;  2YSR A;  1ZLK A;  3VB2 A;  2QLZ A;  2K4B A;  2MH2 A;  3I5U A;  1QGP A;  1K78 B;  3B73 A;  1QQI A;  1J2X A;  5DEQ A;  1DPU A;  5A2Q K;  1TTY A;  4KMU X;  1R23 A;  5JR3 A;  4Q5S F;  2K02 A;  4A6E A;  1RUN A;  1ON1 A;  3I64 A;  2EFN A;  2ESH A;  3IWZ A;  1LQ1 A;  3K1N A;  1OYW A;  5CVR A;  1F9N A;  2NYX A;  3I4P A;  1BIA A;  1JHH A;  2L54 A;  4WX9 A;  4CYD A;  3ZMV A;  2B0L A;  3KP4 A;  3HRT A;  5J8C A;  3FX3 A;  4U0Y A;  1PDN C;  2JRT A;  1Z6R A;  1YQA A;  3CUO A;  2CWE A;  2V1D A;  3O2P E;  3MCZ A;  3WTS C;  5E20 A;  3GZ6 A;  2EFQ A;  3KP2 A;  3ZMZ A;  1D8J A;  4I7H A;  2ISY A;  1Z1D A;  2FBI A;  2L01 A;  2W24 A;  1HBX G;  3J81 Z;  2ZNZ A;  4IPA A;  3H3U A;  4IHS A;  1YYV A;  3R6S A;  5EEH A;  1FWZ A;  5K1Y A;  4HA8 A;  2R3S A;  3N97 A;  2ZXJ A;  2E7W A;  3WTU C;  1MJ9 A;  2VT2 A;  2Z9O A;  3QRF F;  3RYP A;  2GQQ A;  2XVC A;  1P4W A;  2RV8 A;  4ENN A;  1SD5 A;  1RUO A;  3ZMU A;  3H3Z A;  2MD5 A;  4EMS A;  1B9M A;  5ICF A;  1CF7 B;  2R7F A;  1I1S A;  3ZPL A;  5LGT A;  4BXU A;  3K69 A;  4BH9 A;  5LHH A;  1W5S A;  3E3V A;  4OU0 A;  4LGW A;  2E1C A;  5D5W B;  1OPC A;  3DQV C;  3R4K A;  5FD5 A;  1W5T A;  3E5U A;  4EVI A;  1BC8 C;  1MZB A;  3ZQ7 A;  4M73 A;  5FGM A;  1MJA A;  5CLS A;  4EQQ A;  4OMZ A;  4BHC A;  1IW7 F;  2FRH A;  5DD4 A;  3COA C;  2KJB A;  3IHU A;  3ERE D;  4HX4 A;  5CYV A;  3GEZ A;  1FOK A;  3MZY A;  4M6Y A;  3L2C A;  1XGO A;  3CUQ A;  2GIV A;  4ENM A;  1MD0 A;  1F4K A;  4RB1 A;  3HUG A;  1QZY A;  4XLN F;  2O3F A;  2V1U A;  2EA2 A;  2FU4 A;  3KLN A;  1SMY F;  3ML6 A;  2HZT A;  4G94 A;  2ZO4 A;  1FSE A;  1R1V A;  2RC4 A;  5HDG A;  2O8X A;  3JAM Z;  2ZNY A;  2DQL A;  4EJW A;  1YW8 A;  2F5D A;  1TNT A;  2EA4 A;  3HSR A;  2M5W A;  4BNC A;  4IHT A;  1FYK A;  4HLY A;  5K5O A;  3KEO A;  3REO A;  1O3R A;  1NHA A;  1LDK B;  1DUX C;  2PFB A;  2QBY B;  2ISZ A;  3J7A O;  3GW2 A;  4I02 A;  2FML A; 
#chains in the Genus database with same CATH topology
 1ETW A;  1XDU A;  2ETH A;  5DUI A;  1VQ5 I;  4CA0 A;  2EFW A;  4L9V A;  4N9I A;  3BZC A;  5EG0 B;  3F72 A;  1ZG3 A;  3VEP A;  1OIS A;  2DDB A;  2P7V B;  3ZQL A;  3LSK A;  5JVT A;  2R7D A;  3FMR A;  1YW7 A;  1XCV A;  4IHV A;  3CES A;  1LFB A;  3I58 A;  1FZP B;  4C2U A;  4OWR B;  3DBR B;  4Y15 A;  5BNG A;  3MMY B;  5K5Q A;  1B59 A;  4HAM A;  4XSZ F;  1SAX A;  5E17 F;  1ZGJ A;  3WU0 A;  2BW3 B;  2EZL A;  3DEU A;  2KRH A;  3TO9 A;  1IN6 A;  4M3D A;  1Z3Y A;  2JSC A;  3IRQ A;  3BR2 A;  2ID3 A;  3TW6 A;  4H4K C;  1GXP A;  5DDG A;  5BOX A;  1RNL A;  3JRI A;  2JQ7 A;  3L9F A;  5JLW A;  4IX7 A;  3KEQ A;  3KP6 A;  4ASN A;  5LHG A;  1X1A A;  1IXS B;  3TDU C;  2OA4 A;  3S8P A;  4IHX A;  3QWL A;  4KT5 C;  1R00 A;  3MEX A;  4ZYD A;  2VAS A;  2HVQ A;  4GYG A;  3HXL A;  3SFI A;  4JBA A;  1Z77 A;  2ZSI B;  3GUD A;  4S0H B;  1FP2 A;  4KIS A;  1WJC A;  4WXH A;  4OIQ F;  4Z2Y A;  1MMS A;  1LEB A;  4FX4 A;  5E3L A;  2ID6 A;  1OCO H;  3BT9 A;  3WTT C;  5D8L B;  1MNM C;  2A05 A;  1HLV A;  1BC7 C;  5EYR A;  3RPQ A;  2B9S A;  1TW3 A;  4HBL A;  3FBI B;  2A6E F;  3ULQ B;  4I0A A;  2FD5 A;  1KU7 A;  2BGC A;  2K85 A;  3K4J A;  1IGN A;  4LB5 A;  2ADU A;  2ZB9 A;  2ZME A;  3U1D A;  4NDL A;  5CQG A;  2MG4 A;  4OOI A;  4ZYA A;  2X1C A;  4L9J A;  3G1O A;  4B4C A;  3C1D A;  4CSW A;  4U0W A;  5F08 A;  3IUO A;  1P4A A;  4MTD A;  3AKZ A;  5CVJ A;  2EZI A;  5F0F A;  2ELH A;  2KIS A;  2FOW A;  3CLQ A;  1GVD A;  2ELK A;  5BMZ A;  2L4M A;  2QYO A;  4A3J J;  2DT5 A;  3MKZ A;  3BCA A;  2VOP A;  3L2W A;  4WWC A;  2DI3 A;  1WQ2 A;  2HKX A;  3TDZ C;  3GWZ A;  2BXY A;  3SFZ A;  2K9N A;  5J1U A;  2FBK A;  4BHP A;  2MW8 A;  5H20 A;  2LF8 A;  4M3E A;  2EB7 A;  5CPR B;  1F43 A;  1BR4 A;  4G7Z F;  3BY6 A;  2HOE A;  1XGM A;  2Q0O A;  2A5Y B;  3VFZ A;  5C4J J;  4PDK A;  3T8T A;  2BZT A;  4DZJ A;  2KIM A;  1VFC A;  2Z2S B;  5AIP A;  2LH9 A;  3M07 A;  1OCT C;  3FXJ A;  5J6X A;  2IGN A;  3LAJ A;  4DGW B;  4CCO A;  3QOD A;  2GWR A;  3AG3 H;  4XNF A;  1IRX A;  2O6G E;  4UB8 C;  1TP4 A;  2MH9 A;  4FAS D;  2W7N A;  3K1M A;  3WU1 B;  1IUF A;  2H27 A;  3LSH A;  2VQH A;  2P0W A;  1VQN I;  3HOZ J;  2RQP A;  3FXL A;  3U2R A;  5LLQ A;  1OFC X;  1ZGA A;  3HG9 A;  1GV5 A;  4ANJ A;  2CU7 A;  4GCV A;  3RPU D;  2A6H F;  2NVY J;  2V6C A;  2H94 A;  1MMG A;  1NG6 A;  2XV4 S;  1V54 H;  5J4V A;  3WGH A;  3QYF A;  5LBQ A;  4LFU A;  1U5T B;  2R7R A;  4IRI A;  2LYC A;  3ZQC A;  5DCM A;  4M74 A;  3ZQF A;  2IA1 A;  2H6C A;  3T0Y A;  2XAH A;  1XGS A;  2KDZ A;  3ZP5 A;  1BM9 A;  4R8H A;  2HWV A;  1HSJ A;  2BV6 A;  2FEZ A;  4M9X A;  2CV0 A;  1O7F A;  2EV5 A;  1SAU A;  2LBF B;  1D3Y A;  4AC0 A;  2DCE A;  3E7L A;  4XID A;  1HW2 A;  2QM3 A;  1MMA A;  3C2B A;  3DWL E;  3FIS A;  3H92 A;  1J09 A;  4ENJ A;  2XSD C;  3DF8 A;  4RLF A;  3K0L A;  5F27 A;  4NBQ A;  2F4I A;  1JGG A;  4FT8 A;  3E6B A;  4PSW A;  4KIF A;  3K10 A;  2R5Z A;  2E36 A;  4KA4 A;  4BE0 A;  1WI3 A;  3E6C C;  3BQZ A;  2HOA A;  3J80 Z;  1A5J A;  4PJM A;  1LEA A;  1MDM A;  4CXF A;  3TOA A;  5K5R A;  3M1C A;  5LEJ A;  2DFI A;  3SQN A;  2I8D A;  4I09 A;  4E7K A;  4IOC F;  1IN5 A;  1GXQ A;  4FE7 A;  4QTR A;  1HW5 A;  2OUM A;  3HOW J;  2GOM A;  2DA6 A;  1J9I A;  4TV7 A;  3JAM K;  1U3E M;  4Y4R A;  5HLT A;  2TDX A;  3BPX A;  5IOY A;  4CDG A;  3P7N A;  4G8X A;  3C2G A;  3S2W A;  2QSF X;  2X6O A;  4M9S A;  2X6X A;  3BR5 A;  1E17 A;  3OR2 C;  5L3E A;  2F5C A;  3VSL A;  4CIC A;  3VWB A;  2JVH A;  3LWF A;  3FZV A;  3ZN0 A;  5GAH J;  2M45 A;  5HNF A;  1VQ4 I;  3TP0 A;  1ULY A;  4IOA F;  4IRH A;  1F36 A;  2KDO A;  3GTO J;  3HSF A;  4E7H A;  2PI0 A;  1UMQ A;  3TL4 X;  1R1T A;  1ZAO A;  3ZN1 A;  5DV5 A;  3W6V A;  2E2J J;  1D5V A;  5BQT A;  3JSP A;  4CZZ A;  1HDD C;  5FLX R;  3NEU A;  2DA1 A;  2X85 A;  3Q0W A;  3HL2 A;  2P4W A;  1V5F A;  4JOM A;  2I10 A;  2HNH A;  2Q2E B;  2EIL H;  2BY3 A;  3F8M A;  5EEA A;  4Y3O A;  5FB2 A;  5KK1 A;  4LOC A;  1SFU A;  1Z7U A;  1K79 A;  1DU0 A;  2KPM A;  5CVU A;  4JX4 A;  2UUZ A;  2VB6 A;  2Z33 A;  3DPT A;  2XAJ A;  1Y6I A;  2DJI A;  2ZKZ A;  2CUE A;  2W85 A;  2HZD A;  3ELK A;  1V55 H;  4I0B A;  4KN4 X;  3RYR A;  3OYH A;  3G73 A;  2E1M B;  1QZE A;  4YFN F;  4N4N B;  1S7E A;  4B48 A;  1XMX A;  2Y9Y A;  4GO1 A;  1WRJ A;  2RVC A;  4AD9 A;  1SAN A;  1X2N A;  5KAF C;  2R7U A;  2P5K A;  2R7Z J;  1ZTR A;  2H1L A;  3OV8 A;  4PSX A;  4D0P A;  4FE4 A;  3MQ0 A;  1FIA A;  2GAU A;  2NVQ J;  4ENK A;  1PJR A;  4AM3 A;  4DBR A;  4MO7 A;  1P6R A;  2RRE A;  2OU2 A;  2MC3 A;  2EBI A;  3OYB A;  1GDT A;  2BXZ A;  1T95 A;  1R4M B;  3OYE A;  2CV1 A;  2QVO A;  2AXL A;  4KIC A;  2DQR A;  4PK4 A;  4NUB A;  3HHH A;  5BS6 A;  1U8R A;  1B8I B;  2P5V A;  1BR2 A;  2EZK A;  3DPU A;  3K4C A;  4F91 B;  4BJ6 C;  3DXJ F;  4Z6Y A;  1UHS A;  1H9G A;  5M5Y J;  1ETY A;  2GA2 A;  2JTV A;  5HNH A;  1Z05 A;  2LKX A;  1Q1H A;  2HXI A;  4NC6 A;  4QWQ A;  4WF2 A;  3VOD A;  5K7H A;  5E8I A;  4ZH4 F;  3H0G J;  3S1Q J;  2KLO A;  1YX5 A;  4B09 A;  2XF7 A;  4RAY A;  3CMA I;  3QPS A;  2HTJ A;  2DLL A;  3OSG A;  1PUF B;  2K86 A;  1U6G A;  3KP5 A;  3WG9 A;  3LFK A;  2LOO A;  2N8G A;  3HJE A;  4XM3 A;  4L9N A;  4M6X A;  3SEQ A;  2IA0 A;  4HDV A;  4B3A A;  3UNG C;  5CVI A;  5HLH A;  3F8F A;  4NNJ A;  3QAH A;  1J7K A;  3BRO A;  5L3D A;  4BBR J;  2VLA A;  4EV0 A;  2HR3 A;  2QF7 A;  2D5V A;  1FMW A;  3RKY A;  4A3L J;  5AON A;  3HOY J;  2MZ4 A;  2M8G X;  3OYJ A;  2DMQ A;  2VE8 A;  2XGE A;  1KA8 A;  1PP7 U;  4ZTJ A;  2DTZ A;  1QPI A;  1R71 A;  3ECO A;  3LSM A;  3CLO A;  2K4J A;  1BIB A;  1YHQ I;  1XS9 A;  1YG2 A;  1Y1W J;  1T33 A;  3EYI A;  5J1R A;  5DYM A;  3J7A Y;  3LNQ A;  3HBL A;  2R7V A;  4XKW A;  3TOB A;  1GT0 C;  3QYB A;  2KRC A;  3LA7 A;  3JW4 A;  1YRN B;  2V4J C;  3O8H A;  2KMU A;  4NQW A;  5HS7 A;  3IAM 2;  3CP2 A;  1OKR A;  1X1B A;  3E0J B;  3DTI A;  3EUH C;  4I76 A;  1RES A;  1OLT A;  3VOE A;  5EJC A;  1FY7 A;  2NOJ B;  2XKO A;  3QP5 A;  3CCJ I;  2VPR A;  4LG0 A;  4V2F A;  4KIG A;  3Q0U A;  1LB2 A;  1Y8Q B;  4XLA A;  4E7Z A;  2NRA C;  4O6J A;  4AIH A;  4UXN A;  2B63 J;  2CYY A;  2DMU A;  3P9I A;  2CUF A;  5TGT A;  3IAS 2;  2HS5 A;  3CZ6 A;  1IAW A;  1HKQ A;  1ONV A;  3S1R J;  4UUS A;  3QU6 A;  5IY5 H;  2VBY A;  1DP7 P;  1U5T C;  2KT0 A;  4EGZ A;  1K7A A;  2VQC A;  4AIJ A;  2WBM A;  2H09 A;  4LD5 A;  4DNC A;  4OAY A;  3D0S A;  3OYG A;  5FRO A;  2AXT C;  1K83 J;  4IKF A;  3F0C A;  1WCM J;  3F6V A;  1SD7 A;  4XSX F;  1R1U A;  2EIM H;  2PJR B;  1SMT A;  2XDV A;  3H35 A;  3EUK L;  2Y2Z A;  5KAI C;  2WAF A;  1LFU P;  3IKV A;  2HOT A;  3OOP A;  2O61 A;  2EZH A;  3B6A A;  1FNN A;  3A1Y A;  2DK8 A;  3FHZ A;  2OTL I;  1AA7 A;  5K7F A;  1MMD A;  3IH2 A;  3SHF A;  3SXY A;  5EZH A;  4KFC A;  1OMI A;  1EH8 A;  2LY1 A;  5HS9 A;  3EUA A;  2PMZ N;  3ZQQ A;  1XSD A;  4GXO A;  4P1W A;  4P55 A;  1NK3 P;  2FF4 A;  4BE2 A;  3CCE I;  3OYA A;  2R7X A;  1S7A A;  2HDC A;  1S8N A;  3BLY A;  3FM5 A;  2OPT A;  2OQR A;  2BY0 A;  3MKW B;  3ABU A;  2RKH A;  1G3S A;  3G6E I;  2FUG 2;  3WTW C;  2VUM J;  2G7U A;  3GCM A;  2DOF A;  2L0K A;  1BW6 A;  2O03 A;  3RPU A;  3GLL A;  1AU7 A;  1V4R A;  3RI4 A;  1FX7 A;  1T0F C;  3WHB A;  5J1Y A;  2FX0 A;  3MWM A;  2YS9 A;  1E3O C;  2DDA A;  1SVO A;  4KJZ A;  2DA7 A;  4H0E A;  4CCJ A;  4ZZD A;  4IQJ A;  4X0G A;  2IW5 A;  2XRO A;  1BJA A;  3NQO A;  5H6R A;  4AYB N;  1MIJ A;  2UZK A;  5J40 A;  5KHD A;  4ZTF A;  1X3Z B;  4M3G A;  2M9H A;  2LG4 A;  2IEK A;  1A6I A;  3WTZ A;  1WJD A;  1MGT A;  4BEH A;  1QVT A;  2GA1 A;  3TGN A;  4ETS A;  3HOX J;  5E3M A;  3WE2 A;  3MD2 A;  1R9T J;  2GBY A;  4JX6 A;  2E71 A;  4E70 A;  1G6N A;  2IT0 A;  3DV8 A;  3OSF A;  1YI2 I;  2XIG A;  1IC8 A;  2R4G A;  2ZXW H;  2L7F P;  3KE2 A;  3M8J A;  3OYD A;  1LE8 B;  1MNE A;  4CCM A;  2E1M C;  1G3W A;  3I4M J;  3DKW A;  1Y39 A;  2I5U A;  4UVB A;  3RKW A;  1WZ2 A;  4EJU A;  3LQQ A;  4XLH A;  1F5T A;  4UNO A;  4C2T A;  2C6Y A;  5F6F A;  3HTS B;  2HYG D;  5L3F A;  2Y75 A;  3W2W A;  2WAE A;  2QSH X;  3S3O A;  3CMY A;  3FK7 A;  4BAY A;  2AQF A;  3V8L A;  4G12 A;  4A0Y A;  2R5Y B;  3RZD J;  5IT3 A;  1ITY A;  4S04 A;  4G7O F;  2EFP A;  2QUF A;  1PUE E;  1TLH B;  1UAA A;  2GZW A;  1ODD A;  1Z21 A;  4C9Y A;  1WJB A;  5IYD J;  1I1G A;  2HQ5 A;  5JVG F;  4A5M A;  3CO6 C;  4CGZ A;  3KET A;  2RDP A;  1IG7 A;  3PNT A;  3F8C A;  4MHG A;  4XN0 A;  1MSF C;  1XD7 A;  1T8I A;  3TW7 A;  1S9H A;  4B47 A;  3OS0 A;  1IRG A;  1BOB A;  2IGK A;  1X19 A;  3RKX A;  5FKM A;  4N4O B;  1FPQ A;  3H9Q A;  4RDU A;  2XRL A;  1RR7 A;  1TT5 B;  2ICW G;  2FBH A;  4WCG A;  4L5E A;  1TNS A;  5J3L A;  2ECB A;  3CCQ I;  1I50 J;  1FYM A;  4A3K J;  1ORK A;  1TQP A;  3V7C A;  3VYU B;  1E2X A;  3ZR8 X;  1D8K A;  1O3S A;  1WPK A;  4ZDL A;  3I59 B;  2STW A;  3OIO A;  3I56 I;  2UXN A;  4XRF A;  1NTC A;  3TO7 A;  4HQE A;  4MLO A;  1AKH A;  5FLX Z;  2LVS A;  1E3P A;  1CQT A;  1IRZ A;  1R5H A;  1RQ6 A;  3W3C A;  5D6E A;  3HOU J;  3BR6 A;  4HST A;  3HEF A;  1YO5 C;  2A07 F;  3U1K A;  1XB4 A;  4RAF A;  3HTU A;  2MAB A;  1IF1 A;  2JN6 A;  3W6K B;  4YFX F;  4D1Q A;  3DU6 A;  2NNN A;  4W97 A;  3L2U A;  5D5U B;  4WXC A;  2P6S A;  1KGS A;  2IS1 A;  4E7L A;  5E18 F;  1M1E B;  5M3M J;  2HTS A;  4HPQ A;  5D4S A;  2JRM A;  4I01 A;  1FJL A;  2PLY A;  1HW1 A;  5H6Q A;  2BYV E;  3WE3 A;  2YX4 A;  1SVL A;  3K4B A;  1KU3 A;  1BI0 A;  3L7W A;  2W25 A;  5HLG A;  2NNY A;  4BU2 A;  2JT1 A;  1TZL A;  4YG2 F;  3DTK A;  3JRB A;  2KIQ A;  2UXX A;  3W2A A;  2D1H A;  1FP1 D;  3M8F A;  4X1E A;  4IF4 A;  2EIJ H;  2Z16 A;  3CTA A;  1OYI A;  1XDS A;  3SZT A;  2EH3 A;  3GFJ A;  1KYZ A;  4II3 A;  1YJ9 I;  3HSE A;  1DQU A;  3HB9 A;  1W7P A;  1B9N A;  1OYY A;  2QEX I;  4Q4Z F;  2Y31 A;  2DPU A;  3VYS B;  2VPL A;  4F7Z A;  1JT6 A;  4CYC A;  2VL8 A;  4Q47 A;  1Q1V A;  3BCB A;  2HEO A;  2XF5 A;  4IXA A;  3JRA A;  2G7H A;  1N25 A;  2XKP A;  2VT3 A;  3FK6 A;  4C3H J;  1FMV A;  1QPM A;  4IJA A;  5DM7 F;  4BY1 J;  3RKQ A;  2CFX A;  2M0C A;  3Q9S A;  4HV5 A;  3GZ5 A;  4LK0 F;  3RJP A;  1BN5 A;  1USS A;  3HHG A;  2XAG A;  3JTH A;  2GIZ A;  5B66 C;  5D5V B;  1A35 A;  1FOX A;  4BL0 B;  1WJE A;  3GBG A;  5J8F A;  1JTX A;  2JUG A;  2LKP A;  2M3A A;  3OIP A;  2L7M P;  3GFL A;  4A3G J;  3FXR A;  3QOE A;  1ZN2 A;  5JFR A;  4IHY A;  4W1U A;  5LGU A;  1ZRC A;  3T8R A;  3K4M A;  2L9N A;  5GPA A;  5M3F J;  3QP6 A;  5E1Z B;  5LGN A;  1FYL A;  1OR7 A;  2GLO A;  3HPG A;  4EEF G;  3MFK A;  3JRF A;  5GP9 A;  2P7C B;  2YU3 A;  3DEE A;  2PJP A;  1BI1 A;  1QHG A;  2XB0 X;  4ESJ A;  2K3F A;  5B3S H;  1SC7 A;  3EYY A;  1SFO J;  1TWH J;  1U8B A;  2VC0 A;  1RPW A;  1C0W A;  3B6C A;  1PP8 F;  1UG0 A;  4UHT A;  5J4Y A;  1TT0 A;  4B43 A;  3J81 K;  4UUS B;  4XKB A;  3LAP A;  3ZQG A;  2MGQ A;  2NS0 A;  3DEW A;  2O0Y A;  3SZP A;  4ITV A;  3TMO A;  3E6D A;  5ED4 A;  4A0Z A;  2QKL B;  3K4N A;  3S93 A;  2AHQ A;  3OIQ A;  2FOK A;  1MJB A;  1K78 A;  2VON A;  3FM3 A;  1SFK A;  4HOB A;  1YJN I;  5EEG A;  5IT9 Z;  2XAU A;  3Q9V A;  3NRV A;  2FSW A;  3GZN B;  5EGO B;  1YW9 A;  2D2W A;  3FWE A;  4E7J A;  2CQK A;  1VQK I;  2BE5 F;  4E4H A;  2PQ8 A;  2V9V A;  1ON2 A;  2DA2 A;  1Z3X A;  3P5J A;  3U21 A;  1U2W A;  1X4O A;  3S2H J;  5HOD A;  2DXI A;  2RQQ A;  2FMY A;  2KRF A;  2CO5 A;  3BDD A;  1B72 A;  4UV9 A;  1V3F A;  1JGS A;  4I2O A;  2Z5U A;  1J5Y A;  4C3J J;  1IV6 A;  3S2D J;  4RB3 C;  4V2G A;  3A01 A;  1ZG1 A;  4AWX B;  1ZRE A;  3DLL F;  4NC8 A;  4A6D A;  1F1Z A;  2KIU A;  4YIF A;  2BVM A;  4EJO A;  3JSO A;  1IV8 A;  4XMY A;  4C30 A;  3K1P A;  4MNU A;  5A2Q Z;  1VQ9 I;  2VQL A;  3BZ6 A;  3H9J A;  2XAF A;  3OL3 A;  4FCY A;  4GYI A;  1R36 A;  4RGX A;  1I3Q J;  2F4M B;  3T1B A;  2ZCW A;  1FBU A;  2JPC A;  1T2K A;  5FFX A;  1MBF A;  2V6E A;  3SZG A;  4P96 A;  3HYI A;  2YU9 J;  2NVX J;  2K9M A;  2LF7 A;  2LY2 A;  1BI2 A;  4B8X A;  5JLX A;  2F6C A;  3HPH A;  4A93 J;  2OZ6 A;  5TRD A;  1X3W B;  4HLX A;  2VC1 A;  2M30 A;  1X1C A;  2HVR A;  4A12 A;  1TWF J;  2WTE A;  3HGG A;  1TC3 C;  2LFB A;  4I99 C;  5LHI A;  2VXD A;  1N75 A;  3S3N A;  3F8B A;  4GGG A;  2LLK A;  1KQ9 A;  1QZZ A;  2HQR A;  3GF2 A;  2M4K A;  2LP0 A;  1ETK A;  1IN7 A;  5DCF A;  1LPQ A;  3DU5 A;  1ZAR A;  3DKY A;  4IVN A;  4A3E J;  2WY8 Q;  2HKO A;  3LFU A;  3GFI A;  1FLI A;  2P81 A;  1R4N B;  2R7O A;  3HZJ A;  5B1B H;  1J75 A;  1AOY A;  1JKP C;  2MD0 A;  1XMK A;  4M71 A;  1YTY A;  1VTN C;  1B4A A;  3U9G A;  4PFP A;  2FNA A;  3PUB A;  2CUJ A;  4IZZ A;  3WG7 H;  5CKT A;  4CHU A;  3MZ8 A;  2M35 A;  1G4D A;  1WVR A;  2EK5 A;  2BY1 A;  1UEL B;  4XOP A;  4YFK F;  1H89 C;  4YEJ A;  3LSP A;  1Y0U A;  2CGP A;  2JSP A;  2XF6 A;  1WKM A;  4F52 A;  4HF0 A;  3JR9 A;  4K2E A;  1QBJ A;  1JKQ C;  3S1M J;  2O8K A;  2CRG A;  2OBP A;  3OYM A;  3P9C A;  3O3K A;  5C3E J;  1X3U A;  1FBS A;  4XBF A;  3CUQ B;  2DFE A;  3CMM A;  2GXG A;  3HUG B;  2FXA A;  2W57 A;  2RNG A;  2QA4 I;  4XQF A;  4EGY A;  1CF7 A;  1QA6 A;  1ZR2 A;  3L1P A;  4HX7 A;  2J5O A;  2Q1Z B;  4RAZ A;  2FNP A;  2E34 A;  2LTP A;  3H5R A;  2Z1D A;  1QHH D;  2YR2 A;  4X6A J;  1I6H J;  3QPT A;  2KFD A;  3HM5 A;  2RNJ A;  4BKX A;  2LNB A;  3LA3 A;  4Y17 A;  3ZRG A;  4HDU A;  4LIU A;  5LRR A;  4KN7 X;  1E0E A;  4P9F A;  2VJJ A;  3K70 C;  3GFM A;  4KUM A;  3JAM R;  4LLL A;  4EM2 A;  4WK8 F;  3CF2 A;  2L4A A;  3TBI A;  2IJL A;  1OJL A;  3BG3 A;  4QIW N;  5ICG A;  1EH6 A;  5E8G A;  2M8E A;  2FE3 A;  2R7W A;  3E97 A;  2D45 A;  3KP3 A;  4RA2 A;  2AQE A;  1WWX A;  4DIQ A;  3IRR A;  3CF5 F;  5KVR A;  4U7D A;  2IVM A;  2FJ1 A;  2ZC2 A;  1XSX A;  2L9S A;  2HQA A;  3ZGK A;  2E2I J;  2MLG A;  2EV0 A;  2E35 A;  1VI0 A;  1X2M A;  1UCR A;  3ZCO A;  3E5X A;  4L18 B;  1EKE A;  1L3L A;  1S29 A;  4XL9 A;  1ZGW A;  1I5Z A;  2IS4 A;  3I54 A;  3MKL A;  4XOT A;  4RMN A;  3RIR A;  2CS3 A;  5E1W A;  3T5X A;  1RIO H;  2F4O B;  5TIS C;  3ABT A;  3DPL C;  3FF5 A;  3BR0 A;  1LDD A;  4G6Q A;  2HXO A;  2AS5 F;  3V7R A;  1HCR A;  3PJR A;  3JRD A;  3VPR A;  1EJ9 A;  3OYC A;  3IH3 A;  3GTM J;  4CO8 A;  2F5F A;  1LVK A;  3GO5 A;  3BPV A;  2DT6 A;  3OS1 A;  4MIM A;  3LSR A;  1EA3 A;  4FQG A;  1MKM A;  4F92 B;  1DPR A;  2GXA A;  1UFM A;  1YOV B;  4BDY A;  2JA5 J;  2HDD A;  3DTE A;  4HW0 A;  3IC7 A;  1EV7 A;  1UHM A;  3BJ6 A;  1W7P D;  3HOS A;  4L0Z B;  4ZYG A;  2A69 F;  1D1B A;  3F22 A;  1P2F A;  4BQO A;  4R79 A;  3EDP A;  3W2V A;  1K6Y A;  2IRF G;  5EZG A;  1PVE A;  4PJN A;  2VE9 A;  3BG7 A;  2X6W A;  1U78 A;  4KDP A;  5IYB J;  5F1J A;  5IT9 K;  4PGH A;  1G3Y A;  2XRN A;  3I3L A;  1QVU A;  1RI7 A;  4FHT A;  3AAF A;  3LSG A;  1TW2 A;  4PZJ A;  1APL C;  2VJI A;  4BXF A;  3S14 J;  3IL2 A;  2V1N A;  1T38 A;  3CCR I;  3UKG A;  3D5L A;  4JK1 X;  3HC7 A;  3OYI A;  2QWW A;  1JI8 A;  2EV6 A;  3CJN A;  2BEO A;  1S3J A;  4WXD A;  4XIC A;  2PBI A;  1H0M A;  1G59 A;  2PMH A;  3EQL F;  1IXR C;  5DUK A;  1REP C;  2HPM A;  2JZY A;  2ZME B;  1XC5 A;  2A61 A;  4BHB A;  4EJV A;  1OCC H;  1HC8 A;  2CW0 F;  4BQN A;  5EG0 A;  1HXD A;  3GXO A;  2DPD A;  4F93 B;  2TCT A;  1ETQ A;  3KFW X;  3ZOB A;  4A0X A;  2CQQ A;  3RCO A;  3PFI A;  3DFG A;  2W82 A;  2IPQ X;  2W84 A;  1VQ6 I;  3G71 I;  3HRS A;  1IN8 A;  2YX7 A;  2WWY A;  2Y48 A;  2BW3 A;  5B1A H;  3V7S A;  1FSH A;  2DFH A;  1Z0X A;  3BG6 A;  1UJ8 A;  2F48 A;  1SD4 A;  3E6M A;  1YJW I;  5DD8 A;  4DJA A;  3FHN A;  2NXN B;  3BQY A;  3MAJ A;  4XRS A;  2YPR A;  2H8R A;  4ZDO A;  3PSI A;  1H9T A;  4HNU A;  2L3D A;  4ZYE A;  3QYE A;  4RB2 C;  3AL0 B;  2COM A;  1ZHF A;  1P4X A;  2IA2 A;  3F21 A;  1CGP A;  3SDG A;  1Y8R B;  5HS8 A;  1R22 A;  1KQ0 A;  2DAO A;  3EET A;  1TL8 A;  1TQI A;  3HKZ N;  1STZ A;  2CG4 A;  4II2 A;  4UVC A;  2E19 A;  3NWS A;  4JYK A;  1N78 A;  2MVT A;  1I27 A;  1K4S A;  4LK1 F;  4U0V A;  1EH7 A;  4G9Y A;  2PMZ A;  5LD2 C;  2CJJ A;  2UV1 A;  1BJZ A;  1A04 A;  2L7Z A;  3OR1 C;  3E1S A;  2PMU A;  3J80 K;  1O3T A;  3N05 A;  4LIT A;  1R5I D;  2DO7 A;  2OD5 A;  4HNV A;  1Y56 A;  3Q5F A;  1VZ0 A;  2JUC A;  5E79 C;  4MQV A;  4IO9 F;  4XN3 A;  4GFB A;  5DCM B;  4AU7 A;  4JQF A;  1YE9 A;  3PQK A;  1G3T A;  1Z6T A;  4UUT A;  4M6V A;  3V4G A;  3LA2 A;  2P5L C;  3RSN A;  3ZXS A;  2HU9 A;  1MBK A;  3OYF A;  2JPB A;  2KIF A;  3KYC B;  2L02 A;  2QQB A;  3AG4 H;  4KIB A;  3F6O A;  3S15 J;  3BOQ A;  2M1B A;  2ACJ A;  4Q48 A;  1WHU A;  3DKX A;  5TJJ A;  1X1D A;  2PEX A;  3QU3 A;  3MZH A;  4AYB A;  5JI6 A;  2ECC A;  4XRM A;  1R58 A;  2CQN A;  3R60 A;  5F1R A;  5FKO A;  2R5Z B;  3CUQ C;  4LIV A;  4QLC U;  2JVG A;  4MTE A;  1FIP A;  1VQ8 I;  4EAT A;  1MDM B;  3D5R C;  3EUH A;  3FXQ A;  4D5C A;  1QU3 A;  4P9U A;  3J80 R;  2V9P A;  3BTI A;  2XUB A;  2DW4 A;  3WGG A;  3CCS I;  4PFO A;  3AFH A;  3CO7 C;  1V5E A;  1IO2 A;  5ILS A;  4C2M J;  3KYD B;  5D4R A;  3V42 A;  2X1D A;  2DU9 A;  1JE8 A;  5IP7 J;  1W1W E;  2MLK A;  1I3A A;  3NWT A;  4ZYH A;  5L3G A;  1HF0 A;  4LJZ F;  4HYE A;  1XN7 A;  1MW7 A;  5HVQ C;  2L5Q A;  3IV5 A;  4KYW A;  1SFE A;  4CUG A;  2EQR A;  1K6O A;  4N9H A;  4XON A;  5EDN A;  1U5T A;  2HVS A;  2X51 A;  4JX5 A;  1FTT A;  4A3I J;  4MFE A;  2VKD A;  2ME0 A;  2LR8 A;  2QZ8 A;  1ZK8 A;  2AO9 A;  1ZLJ A;  2V9K A;  3KEY A;  4L0Y B;  4JP0 A;  2HI3 A;  2CSO A;  4U87 A;  2K3P A;  4HV6 A;  1W36 C;  1IUY A;  1W4M A;  4XKC A;  1LFP A;  4YIR X;  2ZFW A;  2LBF A;  5JHF A;  4BGD A;  4F3Q A;  1P92 A;  4DYQ A;  2IS6 A;  3GLX A;  3JCU C;  4F55 A;  1AWC A;  2LC2 A;  3RZO J;  2GXB A;  3LOC A;  3HOT A;  2DBB A;  4E6K G;  2IGM A;  2M7A A;  4U88 A;  3ZMS A;  4PJL A;  1T08 B;  1I6X A;  1AHD P;  4C3I J;  4L5I A;  1ZKG A;  2DOA A;  3TO6 A;  4OIP F;  2BHY A;  4XK4 A;  4I98 B;  5CVV A;  3RQ4 A;  1BOA A;  1HA8 A;  3V8J A;  3O8G A;  4BBS J;  1FC3 A;  1TWA J;  1SFX A;  2VJ5 A;  3J7Z I;  5JHU A;  3K9T A;  3LMM A;  3PFY A;  2R7T A;  4OIR F;  3Q3S A;  2EJR A;  4HZF A;  4XLP F;  2P8T A;  4O5V A;  5E3N A;  5EF6 A;  3G4S I;  1S7O A;  3ROU A;  4HG2 A;  1XGN A;  4D9J A;  2KKO A;  3A02 A;  3TP3 A;  2EIN H;  5M5X J;  2DFF A;  4KMF A;  1T0F A;  4UUV A;  4MEX F;  2KZV A;  2VOO A;  1BW5 A;  2BHZ A;  2G0E A;  4XRS G;  5C44 J;  5DTD A;  4ABZ A;  5J47 A;  1UB9 A;  2X9D A;  3FXM A;  3KZI C;  1JHF A;  4MQ9 F;  2LD5 A;  1U9N A;  1GUU A;  2V1X A;  3KZZ A;  2Q8K A;  2G9W A;  2QQA A;  4G7H F;  3LST A;  1B6A A;  1D0X A;  1WGX A;  3F8N A;  4PCQ A;  1T39 A;  4PGG A;  2X4H A;  3NAU A;  2XAQ A;  2OV7 A;  2MA3 A;  1R6R A;  2CQ7 A;  2Q2E A;  1JUP A;  3D5S C;  5LRS A;  1ZRF A;  2STT A;  3KP7 A;  5KCM A;  4DYC A;  4QPO A;  4J01 A;  2MC4 A;  4NHJ A;  1HKS A;  1OCR H;  1WJF A;  4M3F A;  3CCU I;  4UY8 I;  4P5O A;  2CH0 A;  4NC7 A;  2JA2 A;  3M9A A;  2ZME C;  4QPQ A;  1O57 A;  2QQ9 A;  1R7J A;  2VBZ A;  1LDJ A;  5HOO A;  3J7Y J;  3WTX C;  3BTC A;  2ZBK A;  3GTP J;  3M1E A;  4RGR A;  4AVP A;  1SEU A;  1UG2 A;  4BY7 J;  3NAR A;  2IP2 A;  2LKS A;  3BJA A;  3CCY A;  1K4T A;  4FET A;  3I71 A;  3CCM I;  4DOZ A;  2LY9 A;  1J59 A;  1NG7 A;  2P6T A;  2HQN A;  1W5C C;  4DW6 A;  2F5V A;  2W1O A;  4L5J A;  4BQA A;  2E7X A;  4LMY A;  2O5R A;  2LSO A;  1IN4 A;  3L00 A;  2ZJ2 A;  1QRY A;  1XPX A;  4HNT A;  3JTG A;  3L2Q A;  2LRE A;  2K7L A;  3K70 D;  2DA5 A;  5ILV A;  2WB1 N;  5LEK A;  2A3S A;  5FLV A;  3WOD F;  2DYR H;  2LRD A;  3DP7 A;  5GTH C;  1HQC A;  4NQW B;  3AL0 C;  2WAQ A;  2M4G A;  5FKL A;  1B8I A;  3BTL A;  1ZYR F;  2H1K A;  4N0B A;  4DZP A;  3CC2 I;  1LNW A;  1UST A;  3O6B B;  5D5X B;  3I0T A;  1ETO A;  2NS8 A;  4A3C J;  2L7K A;  5L3B A;  3D1N I;  1RET A;  1VF9 A;  3OL4 A;  4LG0 B;  1XMA A;  3CCL I;  1KU2 A;  2R93 J;  2WAQ N;  1DDN A;  2UWM A;  5GAD J;  1RR8 C;  4CCK A;  2IGO A;  4OMY A;  2ZJP F;  2BBY A;  3KLO A;  3K7A J;  2MBF A;  4YII A;  1X1P A;  1PUF A;  3V8K A;  3BJO A;  2XPV A;  4OIN F;  3PM1 A;  1BI3 A;  3CJQ B;  3VSK A;  3A52 A;  4RB0 A;  3WTY C;  3C18 A;  3WHC A;  1BA5 A;  1DGW Y;  4A5N A;  1XSV A;  4D7M A;  4KIT B;  3F23 A;  4HQM A;  5IPA A;  3I53 A;  1XTA A;  3B02 A;  3RDI A;  5DM6 F;  3BZK A;  3CD6 I;  2H6B A;  2JWT A;  2K9Q A;  2W00 A;  3LSJ A;  5DS9 A;  4RM2 A;  2ZJQ F;  2EPF A;  1B1B A;  1E3H A;  4L9T A;  1ZG5 A;  3FMQ A;  4LLN A;  4PJ0 C;  1RKW A;  3AG2 H;  4OAZ A;  1J0R A;  4XR6 A;  3L2R A;  4IL6 C;  5E1X A;  4HF1 A;  3SEZ A;  2HOS A;  3LL7 A;  3HOV J;  2CMP A;  1YRN A;  1YFH A;  4Y7N J;  3CDH A;  4J00 A;  2R92 J;  1IXC A;  1D1C A;  3S32 A;  3J81 R;  3PQJ A;  1HKT A;  4A3D J;  5LFA A;  5ICE A;  4UB6 C;  2ESN A;  2DOE A;  1ENH A;  1KU9 A;  1MBJ A;  1UZC A;  4HSR A;  5CJ9 A;  4LB6 B;  4A2U A;  1H8A C;  4RGU A;  1FBQ A;  4CCL A;  1T6S A;  1SVM A;  2DMP A;  1L0O C;  2Z3Y A;  3KCC A;  1GVJ A;  4O3M A;  1TWC J;  4G6T B;  1KYW A;  2X48 A;  3KZY A;  4M72 A;  3F9K A;  5B5E C;  1ETX A;  3LQR A;  2FQ3 A;  2LK2 A;  4XKV A;  4LG3 A;  1GV2 A;  3DCF A;  2CW8 A;  1Z9C A;  2OQG A;  5GAG J;  4YEL A;  4MGR A;  3R0J A;  1ZR4 A;  3PL8 A;  3DBH B;  3OYL A;  3J7A W;  2M2E A;  3UR3 C;  2R0Q C;  2A68 F;  2PJR A;  1X58 A;  5AIQ A;  1GHC A;  2X98 A;  4M9Z A;  1YLF A;  4D7N A;  1XCB A;  4GRI A;  2IS2 A;  2CW7 A;  4BEH B;  2QEN A;  3PIO F;  4ESF A;  2L9R A;  3MKY B;  3BWG A;  3FXK A;  2PG4 A;  4J19 A;  1Z91 A;  1R5G A;  2LMD A;  3K6G A;  5F04 A;  2JK3 A;  1FTZ A;  2OJE D;  4OIO F;  2XHK A;  4RS8 A;  1VQ7 I;  3R61 A;  4LLG F;  3BP8 A;  4Y13 A;  3KYL A;  2A6T A;  2V79 A;  1ZRD A;  2HGC A;  5M5W J;  6PAX A;  1NH3 A;  2DJN A;  4HX8 A;  2X6Y A;  2DTR A;  4S05 A;  1JKR C;  4UVA A;  4GDF A;  2JA6 J;  3N4M A;  1JTY A;  3S17 J;  3ZMT A;  2DT7 B;  5FO5 A;  3CC7 I;  2K27 A;  3GTJ J;  3A0B C;  4D5F A;  3SYT A;  4FX0 A;  2BOL A;  2ZXI A;  4E7S A;  3JRC A;  1JXS A;  3TED A;  1O4X A;  4ON0 A;  4BE1 A;  3CDI A;  4KT6 A;  4EM1 A;  3CP8 A;  4AIK A;  3M8E A;  4IQ4 A;  5K7Z A;  2HYF A;  1GLN A;  5GTI C;  2FA5 A;  3G2B A;  3H3V K;  4BAC A;  2Y30 A;  4QSH A;  3WGI A;  1WSU A;  1S6L A;  3H36 A;  3ECH A;  5D6F A;  4MFD A;  1YIO A;  2E1O A;  4ESB A;  4MEY F;  4YRV A;  5FLX K;  2VBW A;  2OCC H;  3HIF A;  1ZH5 A;  5BPI A;  3VDX A;  1I39 A;  2F2E A;  2LDU A;  2X0L A;  1D0Z A;  3RQI A;  1FT9 A;  1BBY A;  3ZMD A;  4KNY A;  1TWG J;  1LJ9 A;  3RTR A;  3PIP F;  2MYS A;  4RGS A;  4BJ5 C;  2RN7 A;  3JRH A;  3C7J A;  3W6J B;  2MSY A;  2VQG A;  3ZQH A;  1S72 I;  2KP6 A;  2VBX A;  4NB5 A;  2ZJR F;  3PNV A;  3ONQ A;  2NVT J;  2EIK H;  3VYT B;  1O3Q A;  4G6D A;  2H8W A;  2VXZ A;  4DQ2 A;  2E5N A;  3S3M A;  3HRU A;  4RAG A;  2KJC A;  2XGX A;  4EJT A;  3DLA A;  5D8K B;  1JJ6 C;  3ISP A;  4ZZL A;  2W48 A;  3BG9 A;  1AKH B;  2VN2 A;  3GYH X;  1LE8 A;  3PUF A;  3L09 A;  4R1H A;  3FBN B;  3FMS A;  3Q0V A;  2X1E A;  3ABK H;  2WA0 A;  3FKI J;  3K4L A;  2M7B A;  5IP6 A;  1ETV A;  1HST A;  2Y0M A;  1P7I A;  1IZ1 A;  3C3W A;  3E5Q A;  4B44 A;  3A4C A;  2D1V A;  3P9K A;  5FFZ A;  3CME I;  1ZEL A;  2OC6 A;  1YS7 A;  3CDL A;  4CCN A;  4BYY A;  5ILU A;  2OZU A;  2DOD A;  2M87 A;  3AG1 H;  3ASO H;  1LKX A;  1DP3 A;  2RGV A;  5HDN A;  3GX4 X;  1IRF A;  3JRE A;  2CUZ A;  1D1A A;  4UV8 A;  2E1N A;  2R5Y A;  1O7L A;  5FLM J;  3FXU A;  3K4K A;  1FOY A;  2DK5 A;  1RZ4 A;  2WC2 A;  1YS6 A;  4ZC3 A;  4B3X A;  3IKT A;  1ACI A;  3IWF A;  1T98 A;  2E2H J;  3QPH A;  3A2K A;  1Y1V J;  1Z7L A;  5GPC A;  2XAS A;  3G3Z A;  2Z99 A;  2M0M A;  2OAZ A;  4RLQ A;  1WJA A;  1QNT A;  4AID A;  5FRM A;  1QO0 D;  1W36 D;  3TQN A;  2EWN A;  2L9V A;  3BG5 A;  5FRN A;  1X4P A;  3KPH A;  2QCO A;  1W7P B;  2HFH A;  5BPD A;  1WI9 A;  1MMN A;  5FD6 A;  1W0U A;  3QOP A;  2EFO A;  5HLI A;  4CYC B;  3H9G A;  4IRG A;  1KQ8 A;  3L2V A;  4HF2 A;  3F3X A;  3TKY A;  3JRG A;  3PNY A;  3I59 A;  1UHW A;  4I6Z A;  5ERI A;  1YIJ I;  1VQO I;  2NAZ A;  5F64 A;  2QSG X;  1JUM A;  1SD6 A;  3ZQI A;  3GTK J;  3GVA A;  4XLF A;  2WAD A;  4Y52 J;  3K2A A;  2ME6 A;  5HDK A;  4U7B A;  1LVA A;  5ICC A;  2J5P A;  3A03 A;  3HRM A;  5L3C A;  2VOD A;  3R0A A;  4EM0 B;  1HOM A;  2L2O A;  1TBX A;  3BR1 A;  2WV0 A;  2PN6 A;  3G1L A;  5C4X J;  2CFO A;  1TQM A;  2OTJ I;  2F5E A;  2YUS A;  3K2Z A;  2XGD A;  1MBG A;  2E5Z A;  2M34 A;  3M7G A;  5FKK A;  2VIX A;  4BJT A;  3WTV C;  2QBY A;  2YSR A;  1MBE A;  3ASN H;  3G1M A;  2K9S A;  1IDZ A;  1ZLK A;  3H5A A;  3VB2 A;  3SJM A;  3PO2 J;  2A5W A;  2QLZ A;  2K4B A;  2MH2 A;  4A3F J;  3I5U A;  1QGP A;  1K78 B;  1LUJ B;  2XGC A;  3QQA A;  2K40 A;  2QQ8 A;  3B73 A;  3MVP A;  1QQI A;  1J2X A;  5DEQ A;  2O9L A;  1U9O A;  1DPU A;  5A2Q K;  5IT9 R;  1TTY A;  4KMU X;  1RKT A;  2VJ4 A;  1S5L C;  1DU6 A;  1R23 A;  1MND A;  5JR3 A;  3I9V 2;  1ZQ3 P;  4HRI A;  1R49 A;  4BS9 A;  2JMW A;  2KZG A;  4Q5S F;  2K02 A;  1OCP A;  4A6E A;  4DBQ A;  1RUN A;  1G2H A;  1ON1 A;  3I64 A;  2EFN A;  3HDD A;  1B72 B;  3LSI A;  3GTQ J;  2ESH A;  2KQR A;  3HKZ A;  4CH7 A;  3IWZ A;  1NK2 P;  1LQ1 A;  3K1N A;  3FXO A;  3A01 B;  2DMN A;  4HEA 2;  1OYW A;  5CVR A;  1F9N A;  2NYX A;  5IP9 J;  2IAI A;  4AVZ A;  1H88 C;  2BVL A;  3I4P A;  4PUS A;  1BIA A;  9ANT A;  1JHH A;  3GME A;  3FKJ A;  1JKO C;  2L54 A;  4WX9 A;  4CYD A;  2Y9Z A;  3CQZ J;  2DYS H;  3ZMV A;  2VKV A;  5A2Q R;  2B0L A;  3KP4 A;  2RAE A;  1OQY A;  3HRT A;  5J8C A;  2R7Q A;  3FX3 A;  4B1R A;  4U0Y A;  3SDB A;  1PDN C;  2JA8 J;  2V7F A;  2JRT A;  2WY7 Q;  2VKE A;  2V26 A;  3GTL J;  1Z6R A;  1YQA A;  2IBD A;  2MUN A;  2FQ4 A;  3CUO A;  3CJT B;  2ZXH A;  5EGO A;  2CWE A;  2V1D A;  5IOZ A;  3O2P E;  3MCZ A;  4RBO A;  2JJ7 A;  2GM4 A;  3WTS C;  5E20 A;  3GZ6 A;  3VYR B;  2ELJ A;  2EFQ A;  1JUS A;  3KP2 A;  3ZMZ A;  1D8J A;  4I7H A;  2ISY A;  1Z1D A;  2FBI A;  2NOG A;  3H5N A;  1JT0 A;  2NVU B;  2L01 A;  2W24 A;  1POG A;  2K5C A;  1HBX G;  2NS7 A;  2CQX A;  2ZNZ A;  3J81 Z;  1MSE C;  4IPA A;  3FIW A;  2XSJ C;  3S16 J;  3H3U A;  3OYK A;  4BXX J;  3EPZ A;  1XX5 A;  3DBL B;  4IHS A;  1Z67 A;  2KHM A;  1YYV A;  3R6S A;  5EEH A;  1FOW A;  3BC8 A;  1FWZ A;  4XOR A;  5K1Y A;  3H1C A;  4HA8 A;  2R3S A;  3N97 A;  1JJ8 C;  2ZXJ A;  2HDW A;  2E7W A;  3KX2 A;  3WTU C;  1VQM I;  2WV1 A;  1MJ9 A;  2VT2 A;  2B7E A;  1BR1 A;  2QGU A;  1XG1 A;  1RRJ A;  5FJ8 J;  2Z9O A;  3QRF F;  3RYP A;  2GQQ A;  2XVC A;  1P4W A;  1G8X A;  3H0D A;  1T56 A;  3FDY A;  1KON A;  1PYV A;  2RV8 A;  2HPI A;  3OWT A;  4ENN A;  1SD5 A;  1EF4 A;  1K61 A;  3MN2 A;  1MH3 A;  1RUO A;  3ZMU A;  1YIT I;  1MH4 A;  4A3B J;  3H3Z A;  2MD5 A;  4EMS A;  4E7I A;  2ZFU A;  4A69 C;  1B9M A;  5ICF A;  3I4N J;  2K9L A;  2R7F A;  1CF7 B;  1WFX A;  3CC4 I;  3PO3 J;  1I1S A;  4M3B A;  4ZJZ A;  3ZPL A;  4FTH A;  1Y0N A;  3WU2 C;  4CZC A;  5LGT A;  4BXU A;  3K69 A;  2XPW A;  2TRT A;  2VI6 A;  4BH9 A;  4BQQ A;  5LHH A;  1BL0 A;  2KL4 A;  1W5S A;  5CQE A;  3E3V A;  4OU0 A;  2Y69 H;  3PSF A;  2PX9 A;  1OCZ H;  4LGW A;  5FKN A;  3OOU A;  5D5W B;  1OPC A;  3A0H C;  2E1C A;  5E3O A;  3DQV C;  3R4K A;  5FD5 A;  4V19 K;  1W5T A;  3E5U A;  4EVI A;  1BC8 C;  3ERM A;  1P7J A;  1RC9 A;  2OF7 A;  5KNL A;  2DMT A;  1MZB A;  3ZQ7 A;  3S1N J;  4M73 A;  5FGM A;  3CJR B;  1WJ5 A;  1VND A;  2XPU A;  2GOX B;  1MJA A;  5CLS A;  5IYC J;  1VQL I;  2XB5 A;  2COB A;  2IXS A;  4EQQ A;  1DGR M;  4OMZ A;  4RM3 A;  2E60 A;  2XC7 A;  4BUP A;  4BHC A;  3GTG J;  1IW7 F;  4AUX A;  4DYR A;  1A36 A;  2FRH A;  5DD4 A;  5H2F C;  3COA C;  2KJB A;  1MBH A;  3IHU A;  1IJW C;  2DA4 A;  3ERE D;  1D0Y A;  4HX4 A;  5CYV A;  2P0T A;  3GEZ A;  2Y0S A;  2QKM B;  1W0T A;  1FOK A;  2HYJ A;  3MZY A;  1A31 A;  4M6Y A;  3M4O J;  3OS2 A;  3L2C A;  3OYN A;  1ERD A;  2DA3 A;  3OMY A;  1XGO A;  1HDP A;  3CUQ A;  1A6Q A;  2GIV A;  1MD0 A;  4FIS A;  4ENM A;  3ABM H;  1F4K A;  4RB1 A;  3HUG A;  1QZY A;  4XLN F;  2O3F A;  2OCE A;  2Y0S N;  2CV2 A;  2V1U A;  2EA2 A;  1P9Q C;  1YX3 A;  2FU4 A;  3KLN A;  1WH7 A;  2VKH A;  1SMY F;  2BY2 A;  4XLC A;  3ML6 A;  2DN0 A;  4BDZ A;  1OR7 C;  2HZT A;  4G94 A;  2ZO4 A;  3IH4 A;  3X2Q H;  1FEX A;  1FSE A;  3QPL A;  1R1V A;  2RC4 A;  3M3Y J;  5HDG A;  2O8X A;  1VQP I;  3JAM Z;  4IHW A;  2W4S A;  2ZNY A;  5GAE J;  2JA7 J;  2ZSH B;  3HGY A;  4A3M J;  2DQL A;  3IP4 B;  3CCV I;  4EJW A;  1YW8 A;  2F5D A;  3KIO A;  5F0H A;  4PJJ A;  3I55 I;  1D5Y A;  1TNT A;  2EA4 A;  3HSR A;  2M5W A;  1IDY A;  4BNC A;  2O7O A;  4IHT A;  1FYK A;  4HLY A;  5K5O A;  1V5G A;  4XLE A;  1WH5 A;  3KEO A;  3REO A;  3BTJ A;  1O3R A;  4Y33 A;  2R7S A;  1NHA A;  3OY9 A;  1U0J A;  2MFZ A;  2WB1 A;  1N77 A;  1LDK B;  1DUX C;  2PFB A;  2QBY B;  2ISZ A;  3ESW B;  1KZH A;  3J7A O;  4IEJ A;  3GW2 A;  4I02 A;  3ABL H;  5F0C A;  2FML A;  4ZDP A;  3BR3 A;  3C2H A; 
#chains in the Genus database with same CATH homology
 1XDU A;  2ETH A;  5DUI A;  2EFW A;  4L9V A;  4N9I A;  3F72 A;  1ZG3 A;  3VEP A;  2P7V B;  5JVT A;  2R7D A;  3FMR A;  1YW7 A;  1XCV A;  3I58 A;  1FZP B;  4Y15 A;  5K5Q A;  1B59 A;  4HAM A;  4XSZ F;  1SAX A;  5E17 F;  1ZGJ A;  3WU0 A;  3DEU A;  3TO9 A;  1IN6 A;  2JSC A;  3IRQ A;  1GXP A;  5DDG A;  5BOX A;  1RNL A;  3L9F A;  3KEQ A;  3KP6 A;  4ASN A;  5LHG A;  1IXS B;  3TDU C;  2OA4 A;  4KT5 C;  1R00 A;  3MEX A;  4ZYD A;  4GYG A;  4JBA A;  3GUD A;  1FP2 A;  4OIQ F;  4WXH A;  4Z2Y A;  1LEB A;  4FX4 A;  3WTT C;  5D8L B;  1BC7 C;  3RPQ A;  1TW3 A;  4HBL A;  2A6E F;  3ULQ B;  4I0A A;  1KU7 A;  2BGC A;  4LB5 A;  2ADU A;  2ZME A;  3U1D A;  4OOI A;  4L9J A;  3C1D A;  4U0W A;  1P4A A;  4MTD A;  5CVJ A;  2ELH A;  5BMZ A;  2L4M A;  2QYO A;  2DT5 A;  2VOP A;  4WWC A;  2DI3 A;  1WQ2 A;  2HKX A;  3TDZ C;  3GWZ A;  3SFZ A;  2FBK A;  4BHP A;  5H20 A;  2LF8 A;  2EB7 A;  4G7Z F;  3BY6 A;  2HOE A;  1XGM A;  2Q0O A;  2A5Y B;  3VFZ A;  4PDK A;  3T8T A;  2KIM A;  5AIP A;  5J6X A;  3LAJ A;  2O6G E;  2GWR A;  2MH9 A;  3K1M A;  3WU1 B;  2H27 A;  2RQP A;  3U2R A;  5LLQ A;  1ZGA A;  4GCV A;  2A6H F;  2V6C A;  2H94 A;  2XV4 S;  3WGH A;  5LBQ A;  4LFU A;  1U5T B;  4IRI A;  5DCM A;  4M74 A;  2IA1 A;  2H6C A;  3T0Y A;  2XAH A;  1XGS A;  3ZP5 A;  1BM9 A;  4R8H A;  2HWV A;  1HSJ A;  2BV6 A;  2FEZ A;  4M9X A;  1O7F A;  2EV5 A;  1D3Y A;  1HW2 A;  2QM3 A;  3H92 A;  4ENJ A;  3DF8 A;  3K0L A;  4FT8 A;  3E6B A;  4KIF A;  4KA4 A;  3E6C C;  3J80 Z;  1MDM A;  1LEA A;  4CXF A;  3TOA A;  5K5R A;  5LEJ A;  2DFI A;  3SQN A;  4I09 A;  1IN5 A;  1GXQ A;  1HW5 A;  1J9I A;  4TV7 A;  3JAM K;  1U3E M;  2TDX A;  3BPX A;  4CDG A;  3P7N A;  4G8X A;  3S2W A;  1E17 A;  4M9S A;  5L3E A;  2F5C A;  4CIC A;  3LWF A;  3FZV A;  3ZN0 A;  2M45 A;  1ULY A;  4IRH A;  3HSF A;  2PI0 A;  1R1T A;  1ZAO A;  3ZN1 A;  5DV5 A;  1D5V A;  5BQT A;  3JSP A;  4CZZ A;  3NEU A;  2P4W A;  3F8M A;  5FB2 A;  5KK1 A;  1SFU A;  1Z7U A;  1K79 A;  5CVU A;  2Z33 A;  3DPT A;  2XAJ A;  2ZKZ A;  2W85 A;  3ELK A;  4I0B A;  4KN4 X;  3RYR A;  3G73 A;  4YFN F;  4GO1 A;  1WRJ A;  2RVC A;  4AD9 A;  2P5K A;  3OV8 A;  4D0P A;  3MQ0 A;  2GAU A;  4ENK A;  1P6R A;  2OU2 A;  2MC3 A;  2QVO A;  2AXL A;  4KIC A;  2DQR A;  3HHH A;  5BS6 A;  1U8R A;  2P5V A;  3DXJ F;  1H9G A;  2GA2 A;  2JTV A;  1Z05 A;  1Q1H A;  4QWQ A;  4WF2 A;  3VOD A;  5E8I A;  4ZH4 F;  4B09 A;  4RAY A;  2HTJ A;  2DLL A;  2K86 A;  1U6G A;  3KP5 A;  3WG9 A;  3LFK A;  4L9N A;  4M6X A;  2IA0 A;  4HDV A;  5HLH A;  5CVI A;  3F8F A;  3QAH A;  1J7K A;  3BRO A;  5L3D A;  4EV0 A;  2HR3 A;  3RKY A;  5AON A;  2VE8 A;  1KA8 A;  1PP7 U;  3ECO A;  3CLO A;  2K4J A;  1BIB A;  1YG2 A;  3EYI A;  5DYM A;  3TOB A;  3LA7 A;  3JW4 A;  4NQW A;  5HS7 A;  1OKR A;  3VOE A;  1FY7 A;  2XKO A;  3QP5 A;  4LG0 A;  4KIG A;  1LB2 A;  2NRA C;  4O6J A;  4AIH A;  4UXN A;  2CYY A;  3P9I A;  2HS5 A;  1IAW A;  1HKQ A;  1ONV A;  3QU6 A;  2VBY A;  1DP7 P;  1U5T C;  4EGZ A;  1K7A A;  4AIJ A;  2H09 A;  4LD5 A;  4DNC A;  3D0S A;  3F6V A;  1SD7 A;  4XSX F;  1R1U A;  1SMT A;  3IKV A;  3OOP A;  2O61 A;  1FNN A;  2DK8 A;  3FHZ A;  3SHF A;  3SXY A;  4KFC A;  1OMI A;  1EH8 A;  5HS9 A;  1XSD A;  4GXO A;  4P55 A;  2FF4 A;  1S7A A;  2HDC A;  1S8N A;  3FM5 A;  2OQR A;  3ABU A;  2RKH A;  1G3S A;  3WTW C;  2G7U A;  2O03 A;  3RPU A;  1V4R A;  3RI4 A;  1FX7 A;  3MWM A;  4H0E A;  4ZZD A;  2XRO A;  2IW5 A;  1BJA A;  3NQO A;  5H6R A;  2UZK A;  3WTZ A;  1MGT A;  2GA1 A;  3TGN A;  4ETS A;  3WE2 A;  4E70 A;  1G6N A;  2IT0 A;  3DV8 A;  2XIG A;  3KE2 A;  1G3W A;  3DKW A;  4UVB A;  3RKW A;  4EJU A;  3LQQ A;  4UNO A;  1F5T A;  2C6Y A;  5F6F A;  3HTS B;  2HYG D;  5L3F A;  2Y75 A;  4BAY A;  3V8L A;  4A0Y A;  5IT3 A;  4S04 A;  4G7O F;  2EFP A;  2QUF A;  1PUE E;  1TLH B;  2GZW A;  1ODD A;  1I1G A;  4A5M A;  3CO6 C;  4CGZ A;  3KET A;  2RDP A;  3F8C A;  4MHG A;  1XD7 A;  1IRG A;  3RKX A;  1FPQ A;  2FBH A;  4WCG A;  1TNS A;  1FYM A;  1TQP A;  3V7C A;  1E2X A;  1D8K A;  1O3S A;  3I59 B;  2STW A;  2UXN A;  4XRF A;  3TO7 A;  4HQE A;  5FLX Z;  1R5H A;  5D6E A;  1YO5 C;  2A07 F;  1XB4 A;  3HTU A;  1IF1 A;  3W6K B;  4YFX F;  2NNN A;  5D5U B;  4WXC A;  2P6S A;  1KGS A;  5E18 F;  2HTS A;  5D4S A;  4I01 A;  2PLY A;  1HW1 A;  5H6Q A;  2BYV E;  3WE3 A;  2YX4 A;  1KU3 A;  1BI0 A;  3L7W A;  2W25 A;  5HLG A;  2NNY A;  2JT1 A;  4YG2 F;  2UXX A;  2D1H A;  1FP1 D;  3M8F A;  4IF4 A;  3CTA A;  1OYI A;  1XDS A;  3SZT A;  3GFJ A;  1KYZ A;  3HSE A;  1W7P A;  1B9N A;  1OYY A;  4Q4Z F;  2DPU A;  4F7Z A;  4Q47 A;  2HEO A;  4IXA A;  2G7H A;  2XKP A;  2VT3 A;  4IJA A;  1QPM A;  2CFX A;  3Q9S A;  4HV5 A;  3GZ5 A;  4LK0 F;  3RJP A;  1BN5 A;  1USS A;  3HHG A;  2XAG A;  3JTH A;  5D5V B;  5J8F A;  2LKP A;  3GFL A;  3FXR A;  1ZN2 A;  5JFR A;  5LGU A;  1ZRC A;  3T8R A;  3QP6 A;  5E1Z B;  5LGN A;  1FYL A;  1OR7 A;  3MFK A;  2P7C B;  2YU3 A;  2PJP A;  1BI1 A;  4ESJ A;  3EYY A;  2VC0 A;  1C0W A;  1PP8 F;  4UHT A;  3J81 K;  3LAP A;  2NS0 A;  2O0Y A;  3SZP A;  3E6D A;  5ED4 A;  4A0Z A;  2FOK A;  1MJB A;  1K78 A;  2VON A;  3FM3 A;  4HOB A;  5IT9 Z;  5EEG A;  3Q9V A;  3NRV A;  2FSW A;  1YW9 A;  2D2W A;  3FWE A;  2CQK A;  2BE5 F;  2PQ8 A;  2V9V A;  1ON2 A;  1U2W A;  2FMY A;  2KRF A;  2CO5 A;  3BDD A;  4UV9 A;  1V3F A;  1JGS A;  4I2O A;  2Z5U A;  1J5Y A;  4RB3 C;  1ZG1 A;  4AWX B;  1ZRE A;  4A6D A;  1F1Z A;  2KIU A;  4YIF A;  4EJO A;  3JSO A;  3K1P A;  4MNU A;  5A2Q Z;  3BZ6 A;  2XAF A;  4GYI A;  1R36 A;  4RGX A;  3T1B A;  2ZCW A;  1FBU A;  2JPC A;  1T2K A;  5FFX A;  4P96 A;  3HYI A;  2LF7 A;  1BI2 A;  4B8X A;  2OZ6 A;  5TRD A;  4HLX A;  2VC1 A;  2M30 A;  4A12 A;  2WTE A;  5LHI A;  3F8B A;  4GGG A;  1KQ9 A;  1QZZ A;  2HQR A;  3GF2 A;  1IN7 A;  5DCF A;  1ZAR A;  4IVN A;  2HKO A;  3GFI A;  1FLI A;  1J75 A;  1AOY A;  1XMK A;  4M71 A;  1YTY A;  1VTN C;  1B4A A;  3U9G A;  2FNA A;  4CHU A;  1G4D A;  2EK5 A;  4YFK F;  1Y0U A;  2CGP A;  1WKM A;  4HF0 A;  4K2E A;  1QBJ A;  2OBP A;  3P9C A;  3O3K A;  1X3U A;  1FBS A;  4XBF A;  3CUQ B;  2GXG A;  2FXA A;  2W57 A;  4EGY A;  1CF7 A;  4HX7 A;  2J5O A;  4RAZ A;  2FNP A;  2YR2 A;  3QPT A;  2RNJ A;  2LNB A;  3LA3 A;  4Y17 A;  4HDU A;  5LRR A;  4KN7 X;  4P9F A;  3GFM A;  4KUM A;  4LLL A;  4EM2 A;  4WK8 F;  2L4A A;  5ICG A;  2IJL A;  1EH6 A;  5E8G A;  2M8E A;  2FE3 A;  3E97 A;  2D45 A;  3KP3 A;  3IRR A;  1WWX A;  5KVR A;  4U7D A;  2IVM A;  1XSX A;  2MLG A;  2EV0 A;  1UCR A;  3E5X A;  4L18 B;  1L3L A;  1S29 A;  1I5Z A;  3I54 A;  3RIR A;  5E1W A;  3T5X A;  1RIO H;  3ABT A;  3DPL C;  3FF5 A;  1LDD A;  4G6Q A;  2AS5 F;  3V7R A;  4CO8 A;  2F5F A;  3GO5 A;  3BPV A;  1MKM A;  1DPR A;  1UFM A;  4HW0 A;  3IC7 A;  1EV7 A;  1UHM A;  3BJ6 A;  1W7P D;  3HOS A;  4L0Z B;  4ZYG A;  2A69 F;  3F22 A;  1P2F A;  4R79 A;  3EDP A;  2IRF G;  2VE9 A;  1U78 A;  4KDP A;  5IT9 K;  4PGH A;  1G3Y A;  2XRN A;  4FHT A;  1RI7 A;  3AAF A;  1TW2 A;  4PZJ A;  3IL2 A;  1T38 A;  3D5L A;  4JK1 X;  2QWW A;  2EV6 A;  3CJN A;  2BEO A;  1S3J A;  4WXD A;  1H0M A;  2PBI A;  2PMH A;  3EQL F;  1IXR C;  5DUK A;  1REP C;  2JZY A;  2ZME B;  2A61 A;  4BHB A;  4EJV A;  2CW0 F;  1HXD A;  3GXO A;  2DPD A;  3KFW X;  4A0X A;  3PFI A;  3DFG A;  2IPQ X;  2W84 A;  3HRS A;  1IN8 A;  2YX7 A;  2WWY A;  2Y48 A;  3V7S A;  1FSH A;  1SD4 A;  3E6M A;  5DD8 A;  3MAJ A;  2YPR A;  1H9T A;  2L3D A;  4ZYE A;  4RB2 C;  2COM A;  1ZHF A;  1P4X A;  2IA2 A;  3F21 A;  1CGP A;  5HS8 A;  1KQ0 A;  1R22 A;  2DAO A;  3EET A;  1TQI A;  1STZ A;  2CG4 A;  4UVC A;  1I27 A;  4LK1 F;  4U0V A;  1EH7 A;  4G9Y A;  1A04 A;  2PMU A;  3J80 K;  1O3T A;  2DO7 A;  2OD5 A;  3Q5F A;  4MQV A;  5DCM B;  4JQF A;  3PQK A;  1G3T A;  1Z6T A;  3V4G A;  3LA2 A;  2P5L C;  2JPB A;  2KIF A;  2L02 A;  2QQB A;  4KIB A;  3F6O A;  3BOQ A;  2M1B A;  2ACJ A;  4Q48 A;  5TJJ A;  2PEX A;  3MZH A;  3QU3 A;  5JI6 A;  1R58 A;  3R60 A;  5F1R A;  3CUQ C;  4QLC U;  4MTE A;  1MDM B;  3EUH A;  3FXQ A;  4P9U A;  2XUB A;  2DW4 A;  3WGG A;  3CO7 C;  5ILS A;  5D4R A;  2DU9 A;  1JE8 A;  2MLK A;  4ZYH A;  5L3G A;  4LJZ F;  4HYE A;  1XN7 A;  5HVQ C;  4KYW A;  1SFE A;  1K6O A;  4N9H A;  1U5T A;  2QZ8 A;  1ZLJ A;  4L0Y B;  2CSO A;  4HV6 A;  1IUY A;  1W4M A;  2ZFW A;  1P92 A;  3GLX A;  1AWC A;  2GXB A;  2DBB A;  4U88 A;  3ZMS A;  1I6X A;  4L5I A;  3TO6 A;  4OIP F;  4I98 B;  5CVV A;  1BOA A;  3V8J A;  1FC3 A;  1SFX A;  5JHU A;  3K9T A;  4OIR F;  2EJR A;  4HZF A;  4XLP F;  2P8T A;  4O5V A;  1S7O A;  3ROU A;  1XGN A;  2KKO A;  4KMF A;  1T0F A;  4UUV A;  4MEX F;  2VOO A;  1UB9 A;  4MQ9 F;  1JHF A;  3KZZ A;  2V1X A;  2Q8K A;  2G9W A;  2QQA A;  4G7H F;  3LST A;  1B6A A;  3F8N A;  4PCQ A;  1T39 A;  4PGG A;  2X4H A;  2XAQ A;  2MA3 A;  2Q2E A;  5LRS A;  1ZRF A;  2STT A;  3KP7 A;  4NHJ A;  1HKS A;  4P5O A;  3M9A A;  1O57 A;  2QQ9 A;  1R7J A;  2VBZ A;  1LDJ A;  5HOO A;  3WTX C;  2ZBK A;  3M1E A;  4RGR A;  4AVP A;  2IP2 A;  3BJA A;  3I71 A;  1J59 A;  2P6T A;  2HQN A;  4L5J A;  4BQA A;  2E7X A;  4LMY A;  2LSO A;  1IN4 A;  3L00 A;  2ZJ2 A;  3JTG A;  2K7L A;  5ILV A;  5LEK A;  2A3S A;  3WOD F;  3DP7 A;  1HQC A;  1ZYR F;  4N0B A;  1LNW A;  1UST A;  3O6B B;  5D5X B;  3I0T A;  5L3B A;  4LG0 B;  1XMA A;  1KU2 A;  1DDN A;  2UWM A;  4OMY A;  2BBY A;  3KLO A;  4YII A;  2MBF A;  3V8K A;  3BJO A;  4OIN F;  1BI3 A;  4RB0 A;  3WTY C;  3C18 A;  4A5N A;  1XSV A;  3F23 A;  4HQM A;  3I53 A;  3B02 A;  3RDI A;  2H6B A;  4LLN A;  1B1B A;  4L9T A;  1ZG5 A;  3FMQ A;  1J0R A;  4HF1 A;  5E1X A;  1YFH A;  3CDH A;  1IXC A;  3PQJ A;  1HKT A;  5ICE A;  2ESN A;  1KU9 A;  4A2U A;  5CJ9 A;  4LB6 B;  4RGU A;  1FBQ A;  1T6S A;  1L0O C;  2Z3Y A;  3KCC A;  1GVJ A;  4O3M A;  1KYW A;  3KZY A;  4M72 A;  3LQR A;  2FQ3 A;  1Z9C A;  2OQG A;  4MGR A;  3R0J A;  2A68 F;  5AIQ A;  1GHC A;  4M9Z A;  1YLF A;  1XCB A;  2QEN A;  4ESF A;  3BWG A;  2PG4 A;  1Z91 A;  1R5G A;  4OIO F;  2XHK A;  4RS8 A;  3R61 A;  4LLG F;  3BP8 A;  4Y13 A;  2V79 A;  1ZRD A;  2HGC A;  6PAX A;  4HX8 A;  2DTR A;  4S05 A;  4UVA A;  3N4M A;  3ZMT A;  5FO5 A;  2K27 A;  4FX0 A;  1JXS A;  4ON0 A;  4EM1 A;  4AIK A;  3M8E A;  2HYF A;  2FA5 A;  3WGI A;  1WSU A;  1S6L A;  3ECH A;  5D6F A;  1YIO A;  4ESB A;  5FLX K;  4MEY F;  2VBW A;  3HIF A;  1ZH5 A;  5BPI A;  2F2E A;  2LDU A;  2X0L A;  1FT9 A;  1BBY A;  3ZMD A;  4KNY A;  1LJ9 A;  3RTR A;  4RGS A;  2RN7 A;  3C7J A;  3W6J B;  2VBX A;  4NB5 A;  1O3Q A;  4G6D A;  2VXZ A;  4DQ2 A;  3HRU A;  2KJC A;  2XGX A;  4EJT A;  5D8K B;  3ISP A;  4ZZL A;  2VN2 A;  3GYH X;  3L09 A;  4R1H A;  3FMS A;  1HST A;  2Y0M A;  3C3W A;  1IZ1 A;  5L3C A;  3E5Q A;  3HOT A;  2D1V A;  3P9K A;  5FFZ A;  1YS7 A;  4BYY A;  5ILU A;  2OZU A;  2M87 A;  2RGV A;  5HDN A;  3GX4 X;  1IRF A;  4UV8 A;  2E1N A;  1O7L A;  3FXU A;  2DK5 A;  1RZ4 A;  2WC2 A;  1YS6 A;  3IKT A;  3IWF A;  1T98 A;  3QPH A;  2XAS A;  3G3Z A;  2Z99 A;  2OAZ A;  1QNT A;  1QO0 D;  3TQN A;  2EWN A;  1W7P B;  2HFH A;  5BPD A;  1WI9 A;  5FD6 A;  3QOP A;  2EFO A;  5HLI A;  4IRG A;  1KQ8 A;  4HF2 A;  3F3X A;  3TKY A;  3I59 A;  1UHW A;  5ERI A;  2NAZ A;  5F64 A;  1SD6 A;  3GVA A;  5HDK A;  4U7B A;  1LVA A;  5ICC A;  2J5P A;  3HRM A;  2VOD A;  3R0A A;  4EM0 B;  1TBX A;  2WV0 A;  2PN6 A;  1TQM A;  2F5E A;  3K2Z A;  3M7G A;  3WTV C;  2QBY A;  2YSR A;  1ZLK A;  3VB2 A;  2QLZ A;  2K4B A;  2MH2 A;  3I5U A;  1QGP A;  1K78 B;  3B73 A;  1QQI A;  1J2X A;  5DEQ A;  1DPU A;  5A2Q K;  1TTY A;  4KMU X;  1R23 A;  5JR3 A;  4Q5S F;  2K02 A;  4A6E A;  1RUN A;  1ON1 A;  3I64 A;  2EFN A;  2ESH A;  3IWZ A;  1LQ1 A;  3K1N A;  1OYW A;  5CVR A;  1F9N A;  2NYX A;  3I4P A;  1BIA A;  1JHH A;  2L54 A;  4WX9 A;  4CYD A;  3ZMV A;  2B0L A;  3KP4 A;  3HRT A;  5J8C A;  3FX3 A;  4U0Y A;  1PDN C;  2JRT A;  1Z6R A;  1YQA A;  3CUO A;  2CWE A;  2V1D A;  3O2P E;  3MCZ A;  3WTS C;  5E20 A;  3GZ6 A;  2EFQ A;  3KP2 A;  3ZMZ A;  1D8J A;  4I7H A;  2ISY A;  1Z1D A;  2FBI A;  2L01 A;  2W24 A;  1HBX G;  3J81 Z;  2ZNZ A;  4IPA A;  3H3U A;  4IHS A;  1YYV A;  3R6S A;  5EEH A;  1FWZ A;  5K1Y A;  4HA8 A;  2R3S A;  3N97 A;  2ZXJ A;  2E7W A;  3WTU C;  1MJ9 A;  2VT2 A;  2Z9O A;  3QRF F;  3RYP A;  2GQQ A;  2XVC A;  1P4W A;  2RV8 A;  4ENN A;  1SD5 A;  1RUO A;  3ZMU A;  3H3Z A;  2MD5 A;  4EMS A;  1B9M A;  5ICF A;  1CF7 B;  2R7F A;  1I1S A;  3ZPL A;  5LGT A;  4BXU A;  3K69 A;  4BH9 A;  5LHH A;  1W5S A;  3E3V A;  4OU0 A;  4LGW A;  2E1C A;  5D5W B;  1OPC A;  3DQV C;  3R4K A;  5FD5 A;  1W5T A;  3E5U A;  4EVI A;  1BC8 C;  1MZB A;  3ZQ7 A;  4M73 A;  5FGM A;  1MJA A;  5CLS A;  4EQQ A;  4OMZ A;  4BHC A;  1IW7 F;  2FRH A;  5DD4 A;  3COA C;  2KJB A;  3IHU A;  3ERE D;  4HX4 A;  5CYV A;  3GEZ A;  1FOK A;  3MZY A;  4M6Y A;  3L2C A;  1XGO A;  3CUQ A;  2GIV A;  4ENM A;  1MD0 A;  1F4K A;  4RB1 A;  3HUG A;  1QZY A;  4XLN F;  2O3F A;  2V1U A;  2EA2 A;  2FU4 A;  3KLN A;  1SMY F;  3ML6 A;  2HZT A;  4G94 A;  2ZO4 A;  1FSE A;  1R1V A;  2RC4 A;  5HDG A;  2O8X A;  3JAM Z;  2ZNY A;  2DQL A;  4EJW A;  1YW8 A;  2F5D A;  1TNT A;  2EA4 A;  3HSR A;  2M5W A;  4BNC A;  4IHT A;  1FYK A;  4HLY A;  5K5O A;  3KEO A;  3REO A;  1O3R A;  1NHA A;  1LDK B;  1DUX C;  2PFB A;  2QBY B;  2ISZ A;  3J7A O;  3GW2 A;  4I02 A;  2FML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...