1B1BA

Iron dependent regulator
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IRON DEPENDENT REGULATOR)
publication title Crystal structure of the iron-dependent regulator (IdeR) from Mycobacterium tuberculosis shows both metal binding sites fully occupied.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal binding protein
total genus 41
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 1998-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1b1bA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1b1bA02
5AONA 4UVCA 3DEUA 3DP7A 2BYVE 1D3YA 5CVJA 3JTHA 2Q0OA 5ICGA 2ADUA 1BBYA 1B9MA 1MDMB 2ZNYA 3WGGA 2UXXA 2CFXA 2PI0A 2MD5A 1U78A 5LEKA 4R79A 2K27A 5F1RA 2LF7A 4M6XA 5D4SA 1O7LA 3R60A 4IRGA 1OR7A 1GHCA 5BS6A 2XAHA 1QBJA 3WG9A 4LJZF 2DT5A 4IJAA 2DAOA 5JR3A 1KQ0A 1WSUA 1FSEA 3T8RA 1FYLA 1SMTA 4LLGF 3QRFF 1BI2A 4CXFA 2F5FA 2UZKA 4N0BA 3KE2A 2HDCA 5DEQA 1U6GA 5FLXK 4GYIA 3H3UA 1S7AA 3E6BA 5AIPA 2DQLA 4IVNA 3HIFA 2M87A 5HLHA 3BJOA 1U2WA 1IAWA 3CUOA 4WXDA 4BH9A 2X4HA 2G9WA 3FXUA 4KICA 4OMZA 2Y0MA 3F21A 3Q9SA 1HQCA 4KDPA 1OYIA 4UNOA 4AWXB 1LB2A 5JFRA 1U5TA 2P7VB 2JPBA 2HEOA 4IPAA 3HHGA 2E1NA 2RN7A 2IW5A 1KU9A 3E5QA 2DFIA 4M9ZA 3R0AA 5LRSA 2KIMA 4EGZA 4ESBA 4WF2A 3L9FA 4A6DA 1ODDA 3BJ6A 4P55A 5ILVA 2MC3A 2ZCWA 1FOKA 3HRMA 1B1BA 2MBFA 1IUYA 4YIFA 1QPMA 3ABUA 3P7NA 2P5KA 5LRRA 3HUGA 2PJPA 5DUKA 1JHFA 4P9UA 2M1BA 1BC8C 2DTRA 1S29A 4B8XA 1K78A 2K02A 1R1TA 3I53A 1BI1A 4CICA 2FNPA 4ZYHA 3SXYA 4NQWA 4UVAA 1J7KA 1CF7A 4I98B 3SHFA 2PMHA 2QQBA 3QPHA 3ZMZA 5LGUA 1I1SA 3FM3A 2ZMEA 4E70A 2VT3A 3VEPA 1XGNA 3PFIA 4UXNA 3ZMDA 1TW3A 3LSTA 3R6SA 2L4MA 1J2XA 1ZG3A 4QWQA 6PAXA 4GO1A 3IRQA 2W25A 1Q1HA 1S6LA 1R23A 4ZYGA 5HDGA 4OIPF 4L9VA 1IN6A 2OBPA 5HLIA 1ZRFA 1SD5A 2M5WA 3BOQA 2XRNA 3M9AA 4RB0A 4MEYF 2Z3YA 4EVIA 1FYKA 1PUEE 2TDXA 3KP7A 3BJAA 3GFJA 2H6BA 2XKOA 3KEQA 2HWVA 3GEZA 2HTSA 3MCZA 4XRFA 1G3WA 4PGHA 2FEZA 3OV8A 3QAHA 5HDKA 2FRHA 1L3LA 2IP2A 1U8RA 3WE2A 3FX3A 1Z6TA 4KIGA 4HX4A 3BROA 2Z9OA 3KLOA 2NS0A 1YYVA 2E7XA 3L00A 2VC0A 4CZZA 3VOEA 2GA2A 4WX9A 3BZ6A 3LFKA 4EQQA 3V8JA 4KT5C 4HF2A 1OYYA 1XDSA 1RI7A 1KGSA 1ZYRF 5FLXZ 1YQAA 2EFPA 2P8TA 2DW4A 5DD4A 5JI6A 3C1DA 5L3DA 3MFKA 1EH6A 2L54A 1DPUA 1R58A 2FA5A 4Q4ZF 1QZYA 1QNTA 1XGMA 1ZGJA 4L5JA 4RB3C 3HOSA 1FYMA 2ZXJA 2ZBKA 2P6TA 4ZH4F 3WTXC 1W5SA 2DLLA 1F9NA 3U2RA 4I01A 5DUIA 2ZFWA 1B6AA 3KP3A 5LHGA 5E8GA 5JVTA 1WWXA 1JE8A 4RGSA 2XKPA 4G94A 1SFUA 3J80K 2D45A 3F22A 2CG4A 4A0YA 1YS7A 4AIHA 3F8MA 1IZ1A 2ZKZA 3IWFA 1IN4A 3QP6A 1YW7A 2ZNZA 2A68F 3ERED 4G6DA 4ENJA 4OIQF 5D5WB 1PDNC 2D1VA 4I7HA 4LG0B 3H92A 1HW2A 4WK8F 1IN8A 5CJ9A 3TOBA 1G3SA 3WGIA 1P4WA 1IXRC 1GXQA 4F7ZA 3FZVA 1BIAA 2QQ9A 2XAQA 3V8LA 4HX7A 1XGOA 3EQLF 2CWEA 2W24A 1MKMA 3WGHA 4UV8A 1J9IA 4LLNA 4RAZA 1ZRDA 1KYZA 3D5LA 4RGUA 1SMYF 4RB1A 1OPCA 3I58A 1KYWA 2FBIA 3ZPLA 2HQNA 4MNUA 1MD0A 4M71A 5E1ZB 5ICEA 1XN7A 5LLQA 1XMAA 2R3SA 4I0AA 5L3BA 4U0YA 3F6VA 4IF4A 3IKVA 3N97A 1BI3A 1QQIA 1W4MA 4XLPF 3LA3A 1YW8A 2DO7A 2XAFA 5D5UB 1IF1A 3KFWX 1D8KA 2EV6A 3ZMSA 2HKOA 4I2OA 1WRJA 1XCVA 3VFZA 4OOIA 2XGXA 3LQRA 2DK5A 2CGPA 1WQ2A 3E6MA 2EFNA 2PMUA 1YLFA 2NNNA 2GZWA 2XIGA 2MH2A 4ASNA 4HF0A 2STTA 1W5TA 3F8FA 4GXOA 4A0ZA 1NHAA 3GFMA 3E97A 1ZLKA 2WC2A 4JK1X 1RIOH 2CW0F 4XSZF 5K5QA 5FFZA 2EA2A 1TQPA 4IXAA 3ZN0A 3F6OA 3ELKA 2CSOA 5CLSA 5CYVA 1IN7A 3BY6A 2Y75A 3W6JB 1ZH5A 3C18A 4B09A 1P4XA 3EETA 1Z7UA 5LGNA 2F5EA 4MQVA 4XBFA 1H9GA 2XASA 5L3FA 1R5GA 3MZHA 2GIVA 4ENMA 2GQQA 3ZQ7A 4A12A 1IRGA 2LSOA 1Z6RA 2KJBA 4GCVA 3QP5A 4ON0A 3RKYA 4KN7X 1LDJA 1E17A 1W7PA 3J80Z 2A61A 2VN2A 3BPXA 3HYIA 2VOOA 3ROUA 2VC1A 1FZPB 4JQFA 2DPDA 2ISZA 1P92A 1SD7A 4RB2C 3TO9A 3GVAA 1XB4A 4RGRA 3CLOA 3CO6C 4KA4A 1TQMA 3IC7A 4NHJA 3W6KB 1MZBA 3ZMUA 3KCCA 1BIBA 5CVUA 4Q48A 2RC4A 1YFHA 5ILUA 4WXCA 1FBSA 3DXJF 3T1BA 4UV9A 5J6XA 4L9JA 2BBYA 4ESFA 1IN5A 1KU3A 2W85A 3CJNA 4QLCU 2QQAA 2YSRA 3GX4X 2X0LA 5D5XB 2RVCA 3HTUA 5L3GA 4UVBA 3WODF 2QUFA 3B02A 4HOBA 1K6OA 3RPUA 4FX4A 4Y13A 3WTWC 3EDPA 3VODA 2FE3A 2EA4A 4LB6B 3FXRA 2F5DA 2FBHA 4P9FA 2Q2EA 1I5ZA 3GFIA 3V8KA 5HS8A 3G73A 4LGWA 4ZZDA 1HBXG 4Z2YA 2HS5A 2A07F 3DPTA 5HLGA 2XVCA 2HTJA 3F23A 2DK8A 4L9TA 2ELHA 1IXCA 4MQ9F 1TTYA 2HYGD 4G6QA 5FGMA 2O6GE 3F72A 5A2QK 3I59B 1DPRA 3GF2A 3OOPA 4WWCA 3T0YA 4HQMA 5H6QA 1GVJA 3ULQB 1MDMA 1RNLA 2HYFA 3KEOA 2V1UA 2HKXA 5K5OA 1FT9A 3TOAA 1EV7A 2RKHA 4YFXF 2F2EA 2FBKA 4LFUA 4ENNA 2CQKA 3IHUA 2VODA 3FMSA 4HBLA 3M7GA 4RS8A 1SAXA 1AWCA 1XSDA 2XHKA 4ZYEA 3CUQC 3K1NA 1OYWA 1SD4A 1B4AA 2IT0A 4JBAA 2QYOA 3HSEA 4A5NA 2G7UA 2FSWA 5ERIA 4M6YA 5D4RA 3P9KA 4TV7A 2QBYB 1STZA 5D8KB 5D6FA 1VTNC 1RUNA 1LQ1A 4HV5A 2JPCA 2V1DA 2XV4S 4OIRF 1D5VA 3LAJA 2A5YB 1P4AA 3U1DA 1FBQA 2CYYA 3K69A 3G3ZA 1TNTA 5DYMA 3JW4A 1JHHA 2P4WA 3KP4A 4WCGA 3C3WA 5HVQC 2UWMA 4L9NA 2DU9A 3CUQB 5EEHA 5BPDA 1JXSA 4EJOA 1ON1A 2R7DA 2DBBA 4H0EA 2OAZA 3GFLA 5FD5A 4S04A 2L02A 3I4PA 2QLZA 3DF8A 4A6EA 3RTRA 1FY7A 4LLLA 3B73A 3TDZC 3O3KA 4AD9A 3FXQA 3K1MA 1ZG1A 2BGCA 2BV6A 2JTVA 5BPIA 2H6CA 3E3VA 1UHWA 4HV6A 2GXBA 2P7CB 3HRTA 1LNWA 1XGSA 2JSCA 2L4AA 1UFMA 4N9HA 2MLKA 3IWZA 2A6EF 4CHUA 3JAMK 2DI3A 4P5OA 2K4JA 1H9TA 1O3SA 2O8XA 4KNYA 4G7HF 3JSPA 3H3ZA 4CYDA 1S7OA 4ZZLA 2UXNA 5K1YA 1MJ9A 1R7JA 3RI4A 4UUVA 5A2QZ 4U7DA 4OIOF 1TBXA 5E1WA 4P96A 1HSJA 5E8IA 4O6JA 1R5HA 4FX0A 1KQ9A 3ML6A 3R0JA 2Q8KA 4HF1A 2K86A 2RNJA 3S2WA 1T6SA 2EV0A 4HLXA 2HR3A 2YX4A 4I09A 5ED4A 3BWGA 5BQTA 1UCRA 3EYYA 1I1GA 3I5UA 2HZTA 2Y48A 3EYIA 1Y0UA 3K2ZA 1ONVA 4KN4X 4MEXF 2M8EA 5DCMA 2HOEA 2A3SA 2WWYA 2OA4A 2PLYA 5FFXA 2L01A 4PCQA 2OD5A 3CTAA 5L3CA 3T8TA 2OQGA 4IRIA 2NRAC 3RPQA 2DPUA 4CGZA 4PDKA 3HSFA 3ZMTA 2J5OA 3RYPA 3LA2A 4AIJA 1RUOA 4OINF 2VT2A 3R61A 2STWA 1R1VA 4EJWA 1FX7A 3BPVA 2K7LA 1REPC 3WTZA 4M72A 1BM9A 4XSXF 2ZO4A 2QVOA 2M30A 2QENA 4G7OF 4N9IA 1JGSA 1W7PD 2PN6A 3E6DA 4L5IA 1ZG5A 3HOTA 2VBXA 1WI9A 3L7WA 4HW0A 4BAYA 4G7ZF 2V9VA 5DDGA 4U88A 2ACJA 1T0FA 3HHHA 1FLIA 4EM2A 2O3FA 2RV8A 1T98A 2M45A 4MGRA 1F5TA 4ETSA 1U5TC 2H94A 2MLGA 3ZP5A 1L0OC 1FPQA 3J81K 2ESHA 1S8NA 3FF5A 3WTYC 1LEBA 1YW9A 3C7JA 3GLXA 1I27A 3Q5FA 5LHHA 4I0BA 4O3MA 1ZAOA 2V6CA 4R8HA 2O03A 5E18F 4L0YB 1B59A 4EJUA 1O57A 4LG0A 3RYRA 1FP1D 2LNBA 2ISYA 3E6CC 1GXPA 1T38A 2HGCA 5J8FA 1S3JA 1UB9A 2IA1A 2EK5A 3JAMZ 5IT3A 3KLNA 2IA0A 1BC7C 1PP8F 3WTVC 3O2PE 2VBWA 3DQVC 4BHCA 1ZRCA 1U5TB 2E7WA 2W84A 4YG2F 3WTUC 2QWWA 3K0LA 3P9CA 1BI0A 2A6HF 2O0YA 1HW1A 3WU0A 1IW7F 1XSXA 1XD7A 2OZUA 2XAGA 1FNNA 4DQ2A 1V4RA 5LGTA 5D8LB 4MHGA 4LMYA 4R1HA 2LF8A 3TO7A 3I0TA 5TRDA 2VONA 3RDIA 1O7FA 4YFNF 4YFKF 3ZMVA 1OKRA 3GO5A 1K78B 2NYXA 2V79A 3WTTC 4CO8A 4G9YA 1FC3A 4M9SA 1EH7A 3SZTA 1HXDA 1K7AA 4Q47A 4MTDA 1CF7B 1G6NA 1R1UA 3HTSB 5HOOA 1J75A 2ZMEB 2C6YA 2FMLA 1LDDA 4BYYA 5L3EA 3DKWA 2IRFG 2FF4A 4IRHA 3TKYA 2E1CA 2NAZA 3QOPA 2QM3A 2BEOA 4M74A 2RGVA 1MJAA 4KMFA 2EFWA 4D0PA 4Q5SF 4LK0F 4HDVA 2L3DA 5IT9K 3TGNA 5EEGA 2EB7A 3QU6A 2R7FA 3I71A 5E17F 2H27A 3FM5A 4WXHA 2WTEA 5J8CA 4L0ZB 2H09A 3F8NA 3P9IA 1ZARA 2VXZA 4K2EA 4ENKA 3DFGA 4HLYA 3QPTA 4L18B 4KIFA 5TJJA 1B9NA 2KIUA 1R00A 2B0LA 2OU2A 3ABTA 1UHMA 1AOYA 2IA2A 3IL2A 5AIQA 3HRUA 3HRSA 1QZZA 1USSA 3CDHA 1KU2A 5E1XA 1R22A 3J81Z 3U9GA 5DCFA 5D5VB 2OZ6A 2D2WA 1FP2A 2YR2A 1Z91A 3TO6A 1ZGAA 1LJ9A 2GWRA 1XMKA 4RAYA 1F1ZA 3RKWA 2LDUA 2P5LC 1ZHFA 3L2CA 5BOXA 2AXLA 5E20A 3RJPA 3WTSC 5K5RA 1FWZA 5HS9A 5DD8A 2FMYA 2VBZA 4M9XA 2BE5F 2PQ8A 1BOAA 1XSVA 4BHBA 2J5PA 3AAFA 2EV5A 5DV5A 3FHZA 4EM0B 2YPRA 4HZFA 1OMIA 1FSHA 1DDNA 4XLNF 4A5MA 4EM1A 2G7HA 3RKXA 2P6SA 4IHTA 4DNCA 5JHUA 5CVVA 2GAUA 4AIKA 1USTA 2GXGA 1HSTA 1P2FA 4KMUX 1G4DA 4EGYA 2WV0A 1R36A 2K4BA 5LBQA 3K1PA 2VE8A 3LAPA 2P5VA 3KP5A 5FO5A 2XROA 5H6RA 5LHIA 2RDPA 2FNAA 1ULYA 3NRVA 5CVIA 3DPLC 3KETA 3CO7C 1ZLJA 5CVRA 2EFQA 2GA1A 4GGGA 1YO5C 3KZYA 3Q9VA 2Z33A 3ZN1A 3I59A 1HKQA 4Y15A 2FOKA 1CGPA 2VE9A 5DCMB 3HSRA 3ISPA 4S05A 5BMZA 3REOA 3WE3A 4U0WA 4U7BA 2HFHA 1TNSA 1O3RA 3F8BA 2A69F 2AS5F 4FT8A 1J0RA 4HDUA 2KKOA 4M73A 2DQRA 2ESNA 3GUDA 4O5VA 2EFOA 4MTEA 2MH9A 2KIFA 2LKPA 3MZYA 1H0MA 4HYEA 4BXUA 5FB2A 5H20A 2Z5UA 1O3TA 1F4KA 5IT9Z 2O61A 3KP6A 2XUBA 3GWZA 1SFEA 3KZZA 4BHPA 1QGPA 3R4KA 1I6XA 2ETHA 2ZJ2A 2OQRA 3TDUC 3BP8A 4BQAA 3GYHX 4AVPA 3F3XA 3M8FA 4HX8A 2QBYA 4KFCA 1IRFA 4CDGA 4PZJA 3COAC 2D1HA 3SFZA 5ICCA 1Z05A 2JT1A 1TQIA 3GZ5A 3J7AO 4KIBA 3MQ0A 2HQRA 3E5UA 3FWEA 3V7RA 4ZYDA 3E5XA 1KU7A 1J59A 4EMSA 5HDNA 1LDKB 4BNCA 3IKTA 4HA8A 3FMQA 1YG2A 3ECHA 3CUQA 4EV0A 5D6EA 2COMA 2PBIA 4ESJA 3V4GA 4U0VA 3TQNA 4HQEA 1XCBA 3ECOA 4KYWA 3LWFA 1SFXA 2FU4A 5FD6A 1G3TA 1KQ8A 3M1EA 1E2XA 3JTGA 5KVRA 1MJBA 1WKMA 4IHSA 1DP7P 5F64A 3QU3A 3NQOA 2XAJA 4LK1F 3KP2A 1ON2A 3PQJA 1U3EM 1YIOA 4GYGA 3JSOA 3LQQA 2IPQX 2YU3A 5F6FA 2W57A 2KRFA 1X3UA 1W7PB 3F8CA 3MAJA 1HW5A 2JRTA 3D0SA 4HAMA 1BJAA 3VB2A 2KJCA 2RQPA 4FHTA 1P6RA 1K79A 3NEUA 3O6BB 1IXSB 4OU0A 2EJRA 4OMYA 1FBUA 3M8EA 1J5YA 1DUXC 1HKTA 1QO0D 3GZ6A 2MA3A 5ICFA 2IJLA 2VBYA 3GW2A 2QZ8A 1A04A 2V1XA 3RIRA 4YIIA 1O3QA 1G3YA 1TLHB 5HS7A 2PG4A 1XDUA 3EUHA 3K9TA 1KA8A 4UHTA 4KUMA 4LB5A 1ZN2A 1TW2A 3I54A 1LEAA 3L09A 1V3FA 3DV8A 3T5XA 3IRRA 4G8XA 3N4MA 3LA7A 1YS6A 4A2UA 1RZ4A 5ILSA 3PQKA 1C0WA 3FMRA 3V7SA 3MWMA 1Z1DA 2FQ3A 1HKSA 1D8JA 2EWNA 2CO5A 2IVMA 2F5CA 2Z99A 3SQNA 1T39A 2PEXA 3WU1B 1EH8A 4NB5A 4EJVA 2FXAA 1Z9CA 1PP7U 4EJTA 4Y17A 1LVAA 4PGGA 1SD6A 3I64A 1T2KA 1BN5A 1ZREA 3SZPA 4LD5A 4A0XA 5KK1A 4I02A 4RGXA 1MGTA 3GXOA 3MEXA 2PFBA 2VOPA 3BDDA 2NNYA 3V7CA 2YX7A 1YTYA 2JZYA 5LEJA
chains in the Genus database with same CATH superfamily
5AONA 2MVTA 3HM5A 4UVCA 2ELKA 3ZQHA 4OAYA 3DEUA 3DP7A 2BYVE 3L2WA 1D3YA 5CVJA 3JTHA 2Q0OA 1M1EB 3PFYA 5ICGA 2ADUA 2L9SA 1BBYA 1B9MA 1MDMB 1GVDA 3ABLH 2ZNYA 1OJLA 3WGGA 2UXXA 2CFXA 2PI0A 2MD5A 2MFZA 2B63J 1U78A 5LEKA 4R79A 2K27A 5F1RA 2BVMA 2JSPA 3OS1A 3G6EI 2LF7A 3BC8A 4M6XA 5D4SA 1O7LA 3R60A 4IRGA 1U9OA 4B44A 1OR7A 1GHCA 2GOXB 5BS6A 3CF2A 2XAHA 1QBJA 3WG9A 3ABMH 1X1PA 2Y30A 5HNHA 1UG2A 4LJZF 2DT5A 1GUUA 3OR1C 4IJAA 1R4MB 4A3MJ 2DAOA 5JR3A 1KQ0A 3BTLA 3GCMA 1WSUA 4Y3OA 2LVSA 1WJDA 1FSEA 3T8RA 1FYLA 1SMTA 5IYDJ 4LLGF 3QRFF 3IH3A 1BI2A 4A3BJ 4CXFA 1MBGA 2F5FA 3QPSA 4N0BA 2UZKA 3HGGA 3KE2A 1JKPC 2HDCA 5DEQA 1U6GA 2K40A 5FLXK 4GYIA 3H3UA 1FIAA 1S7AA 5JLWA 3E6BA 5AIPA 4IHVA 1A5JA 1JKQC 2DQLA 4RBOA 4IVNA 1GV5A 3HIFA 2M87A 5HLHA 3BJOA 3SEZA 3CDLA 3TP0A 3ASNH 1U2WA 4JOMA 2R7VA 4BEHA 1IAWA 3CUOA 1AKHA 4WXDA 2EQRA 4LG3A 4BH9A 2X4HA 2G9WA 3OIQA 3FXUA 4KICA 4OMZA 2Y0MA 3GTMJ 4B47A 4FE7A 3G4SI 5M5WJ 2KPMA 3F21A 2O5RA 3Q9SA 4XORA 3VWBA 1HQCA 4LIUA 2CUJA 1OYIA 4KDPA 4M3FA 1QPIA 3SJMA 3GTKJ 3CMYA 1D0XA 5TISC 4AWXB 4UNOA 1LB2A 1P7IA 3OMYA 3OWTA 5JFRA 3S1NJ 3W2AA 4D5FA 1U5TA 2P7VB 2JPBA 2BY1A 2WAFA 4MLOA 2HEOA 3A03A 4IPAA 3HHGA 2E1NA 2RN7A 2IW5A 1KU9A 1BR4A 3E5QA 2DFIA 4M9ZA 2IGKA 4DW6A 3H3VK 1LE8B 3R0AA 5LRSA 1I39A 3S1MJ 2KIMA 3KYLA 4HG2A 4ESBA 5GTIC 4EGZA 5F0CA 4WF2A 3ABKH 3L9FA 4A6DA 3CCMI 1ODDA 3BJ6A 4P55A 3C2HA 3K4BA 2CRGA 5ILVA 2TCTA 1JT0A 1VNDA 3OYLA 2MC3A 4A3IJ 4BJ5C 2ZCWA 1FOKA 2X85A 3SEQA 2CS3A 3HRMA 1RR7A 1D1CA 1B1BA 1MMGA 2MBFA 1IUYA 4YIFA 2YU9J 1QPMA 3ABUA 3P7NA 4QIWN 2P5KA 5LRRA 4XLCA 4XKVA 2WY7Q 3HUGA 2PJPA 1A35A 1OCOH 5DUKA 1JHFA 4P9UA 3FDYA 5DS9A 2M1BA 1VQMI 2EZKA 1BC8C 2DTRA 2F48A 2JWTA 1S29A 4B8XA 1K78A 4JX5A 3LFUA 3HEFA 2K02A 1R1TA 3I53A 1BI1A 4ZYAA 1YI2I 5M3MJ 4B43A 4CICA 2FNPA 3AG1H 4IZZA 4ZYHA 4AU7A 3SXYA 4NQWA 2DA7A 3HKZN 1BJZA 1FTZA 4LIVA 4UVAA 5M5XJ 1J7KA 1CF7A 3I4MJ 4I98B 3SHFA 2PMHA 2QQBA 2X1EA 3QPHA 3ZMZA 5LGUA 2LC2A 3CZ6A 4I76A 4NC8A 3ERMA 1I1SA 3PO3J 2KISA 3FM3A 4BXFA 2V6EA 2LFBA 2ZMEA 3W6VA 4E70A 2VT3A 3MKWB 3VEPA 1XGNA 5CQGA 1VQ5I 3PFIA 2B9SA 1SFOJ 4UXNA 3ZMDA 1TW3A 3LSTA 3R6SA 2L4MA 2LMDA 1J2XA 5EGOB 1ZG3A 4QWQA 6PAXA 4P1WA 4GO1A 4M6VA 3IRQA 2W25A 4A3FJ 1P7JA 1Q1HA 1S6LA 1R23A 4ZYGA 5HDGA 4OIPF 4L9VA 1IN6A 1WH5A 2OBPA 5HLIA 2YS9A 1N78A 1H8AC 1ZRFA 1SD5A 2M5WA 1B72A 3BOQA 2DMNA 2DT7B 2XRNA 3M9AA 2Z2SB 1VQ7I 4RB0A 1DGRM 2UUZA 4II3A 4N4OB 4EATA 2E34A 4MEYF 1MNDA 3KPHA 3CESA 2Z3YA 1Y0NA 4EVIA 1FYKA 1PUEE 2E35A 2TDXA 3KP7A 3G1MA 2LRDA 4H4KC 3BJAA 3LSPA 3GFJA 1FTTA 4KITB 2H6BA 3DKYA 2XKOA 3KEQA 1X3ZB 2HWVA 3A0BC 3GEZA 2LTPA 2HTSA 1ETKA 1QHHD 4V2GA 3MCZA 1PYVA 2VPLA 1BW5A 4XRFA 1G3WA 4PGHA 2FEZA 3OV8A 4QSHA 4DBRA 3QAHA 5HDKA 2FRHA 2JA8J 1UELB 1L3LA 2IP2A 3MVPA 4XRMA 3AG3H 3S93A 1U8RA 2HDDA 2R92J 3WE2A 3FX3A 4XRSA 1Z6TA 4KIGA 1F36A 2NOJB 2L0KA 1X3WB 2FX0A 2OCEA 4HX4A 4GRIA 3BROA 2Z9OA 2X9DA 2EIJH 1I3QJ 5GAEJ 1B8IB 3KLOA 2NS0A 1Q1VA 2WADA 3BCAA 4W1UA 1EA3A 2XC7A 1T0FC 1YYVA 3S15J 3BR6A 2HQAA 2E7XA 3L00A 2VC0A 4CZZA 3HOXJ 2M34A 3VOEA 2GA2A 3JRIA 4WX9A 1UG0A 4V19K 2JK3A 1MSEC 3TP3A 3BZ6A 3LFKA 4EQQA 3V8JA 2BHZA 4KT5C 4HF2A 3K10A 2OTJI 3JRHA 1WJCA 1BW6A 4PJNA 1OYYA 4MO7A 1XDSA 2DCEA 1RI7A 1KGSA 1ZYRF 1TWCJ 4AVZA 4KJZA 3DU6A 1MBHA 3ONQA 5FLXZ 1YQAA 2R0QC 4CYCA 2EFPA 2P8TA 2DW4A 2HPIA 5DD4A 5JI6A 3CP8A 1X1CA 2VKVA 3C1DA 4Y52J 5L3DA 3IV5A 1WJAA 3MFKA 2D5VA 1EH6A 3GMEA 2L54A 1DPUA 2QCOA 1R58A 1NK2P 1P9QC 1WJ5A 1E3PA 2FA5A 4Q4ZF 1QZYA 1QNTA 1OCTC 3CQZJ 1XGMA 1ZGJA 4L5JA 4RB3C 3HOSA 2N8GA 4ZDLA 3S3NA 2XPVA 1FYMA 2JA7J 2ZXJA 2ZBKA 2P6TA 4ZH4F 4D1QA 1ACIA 3WTXC 1W5SA 2DLLA 1F9NA 3U2RA 3DBLB 4I01A 5DUIA 2KMUA 5HODA 3NWTA 3CC4I 5J1YA 2ZFWA 1B6AA 4Z6YA 3KP3A 4BL0B 3U1KA 5LHGA 3FISA 5E8GA 1Z77A 1IC8A 5B1BH 5JVTA 5GTHC 1MMDA 3FXMA 1WWXA 1JE8A 3OYJA 4RGSA 4UUSB 2M35A 1X2MA 2XKPA 4G94A 1SFUA 3CC7I 2OCCH 3J80K 2D45A 4F55A 3F22A 2CG4A 4A0YA 1N25A 1YS7A 1O4XA 3FKIJ 1PUFB 1JJ6C 4XKWA 3B6CA 1IV6A 4AIHA 3CF5F 2HXIA 5K7HA 3K4JA 4DZPA 2R5YA 3LMMA 3ZQGA 3F8MA 1IZ1A 4M3DA 5LD2C 2ZKZA 3IWFA 4UB8C 3LSIA 3GTQJ 1IN4A 3TMOA 3QP6A 1YW7A 2EINH 2ZNZA 2A68F 3ERED 4G6DA 4ENJA 4OIQF 5D5WB 3H0DA 1PDNC 4QPOA 5LFAA 4JX4A 2D1VA 3OS2A 2JVGA 4I7HA 1TWHJ 4LG0B 2VIXA 3H92A 1HW2A 4WK8F 3S1QJ 1IN8A 5CJ9A 3TOBA 3E1SA 2CJJA 2HU9A 5F27A 1G3SA 2KRHA 3DKXA 3WGIA 1YHQI 1D5YA 1P4WA 1IXRC 1ZTRA 1GXQA 1X58A 3JRBA 2CV1A 3PIOF 1QA6A 4M3BA 2XGDA 1QZEA 4F7ZA 3FZVA 2MW8A 1BIAA 1JUSA 3GBGA 2QQ9A 2XAQA 3V8LA 3ZR8X 4HX7A 1VI0A 3HOVJ 3PNTA 1XGOA 3EQLF 4XR6A 4C3JJ 2MZ4A 2CWEA 2GIZA 2W24A 2WAQN 4XLAA 1RQ6A 1MKMA 3WGHA 4UV8A 2HDWA 1J9IA 2F4OB 2XSDC 2K9SA 2VJ5A 1Z3YA 4BQQA 2ZXIA 4LLNA 4RAZA 1ZRDA 4IOAF 1KYZA 3L2VA 3D5LA 3IH4A 4RGUA 1SMYF 1VF9A 1MMNA 4BJTA 4RB1A 1OPCA 3I58A 1KYWA 2DJIA 2CUZA 3PUBA 3TBIA 3I9V2 3HXLA 4C2UA 3AFHA 2FBIA 2V9KA 4XN3A 3ZPLA 1YRNA 2HQNA 4MNUA 1I50J 1MD0A 4M71A 2XPUA 1V5FA 4F3QA 2Z16A 5E1ZB 4X6AJ 2OUMA 1XN7A 5ICEA 1WJBA 2NS8A 2WAEA 3RQIA 1RETA 3V42A 1XMAA 5LLQA 2R3SA 3A0HC 4I0AA 1JJ8C 5L3BA 4U0YA 1RKTA 1AU7A 2VKEA 2X6WA 3F6VA 3S1RJ 4IF4A 5F0HA 3A02A 3IKVA 3N97A 1VQ4I 1TT5B 1BI3A 1QQIA 1W4MA 3ASOH 3ZGKA 2H1KA 4DJAA 4XLPF 3OR2C 3LA3A 3GLLA 1YW8A 3CJTB 4XL9A 2DO7A 2MD0A 2XAFA 5D5UB 1IRZA 1IF1A 3KFWX 1D8KA 2BHYA 2X6YA 2CQQA 3A1YA 2EV6A 3ZMSA 2HKOA 3EPZA 2PX9A 4I2OA 1WRJA 2L7KA 1XCVA 3VFZA 2IGMA 4OOIA 2XGXA 4BS9A 3LQRA 1BOBA 2DK5A 2CGPA 1WQ2A 3E6MA 2EFNA 1U9NA 2PMUA 1YLFA 3LSGA 3LSRA 2HVRA 5B66C 2NNNA 2GZWA 2XIGA 2MH2A 3H5RA 4ASNA 3FBNB 4HF0A 1NTCA 2STTA 1IG7A 1W5TA 3TEDA 3F8FA 4IEJA 1GT0C 4NDLA 4GXOA 4A0ZA 1NHAA 4XICA 4D5CA 3GFMA 3E97A 5B1AH 1ZLKA 2WC2A 5FRNA 2KT0A 4JK1X 1RIOH 1MH3A 1QVUA 1DQUA 2CW0F 4V2FA 3SDBA 5H2FC 2DA6A 3CJQB 3BR5A 3OIPA 4XSZF 1WHUA 3QYFA 5K5QA 1Y1WJ 3BZCA 5FFZA 3VSLA 2EA2A 2XF6A 1TQPA 4IXAA 3ZN0A 2Y69H 3F6OA 1GV2A 3H5AA 3ELKA 3CCEI 4BEHB 2CSOA 2OC6A 5CLSA 5CYVA 2M4KA 1IN7A 2VQGA 3S14J 2X98A 3BY6A 2Y75A 2KFDA 3W6JB 1ZH5A 2DA2A 2JJ7A 3C18A 4NC6A 4B09A 1R9TJ 4FQGA 3FKJA 1P4XA 1ZELA 3EETA 1JI8A 1Z7UA 3AG2H 5LGNA 2F5EA 4MQVA 4XBFA 1H9GA 2DJNA 4FISA 2XASA 5L3FA 1R5GA 1JTXA 3MZHA 1N77A 2GIVA 4ENMA 3K70C 2GQQA 2W82A 3O8GA 1MBFA 3ZQ7A 4A12A 1IRGA 2LREA 3G71I 3CMEI 4OAZA 4XLHA 2LSOA 1Z6RA 2KJBA 4E7LA 2R7QA 4GCVA 3QP5A 4ON0A 3RKYA 4KN7X 1LDJA 1E17A 1W7PA 3FXJA 3J80Z 4C2MJ 2A61A 2VN2A 3BPXA 3HYIA 1SEUA 2VOOA 5IP7J 2O9LA 3ROUA 2PMZN 2VC1A 1FZPB 1LFPA 3Q0VA 4JQFA 2DPDA 2ISZA 1HC8A 2XSJC 2DDAA 2Y2ZA 1P92A 2OJED 3AKZA 1SD7A 2X1DA 3TW7A 1D1AA 2QF7A 4RB2C 3A52A 3TO9A 3GVAA 4G12A 3S3MA 4CSWA 4A3LJ 3DTEA 1MMAA 1XB4A 4RGRA 2X48A 3CLOA 2VUMJ 3CO6C 4KA4A 1ETYA 2L9VA 1TQMA 3IC7A 3OYNA 4NHJA 3N05A 4XMYA 3ZQFA 3W6KB 1MZBA 4DZJA 3ZMUA 3KCCA 1EJ9A 4A3JJ 4ANJA 1BIBA 3VYUB 5CVUA 4Q48A 2RC4A 1YFHA 1XS9A 1MH4A 2EZLA 2RREA 4HNVA 5ILUA 4XN0A 4WXCA 1VQ8I 2OPTA 1FBSA 3DXJF 4XOPA 3T1BA 2VB6A 4AYBN 4BJ6C 2PMZA 3LL7A 1DU0A 4UV9A 2IS6A 5J6XA 4L9JA 2BBYA 3KEYA 4AM3A 1WJFA 4ESFA 5EJCA 1IN5A 3CCYA 1KU3A 3CDIA 3H5NA 4OWRB 2DFFA 1BA5A 1U0JA 4BXXJ 2W85A 2JRMA 2LKXA 3CJNA 3J80R 5KCMA 2Y9ZA 4QLCU 1SC7A 1VQKI 2QQAA 2YSRA 3GX4X 5FKMA 2H8WA 5DM7F 2K9LA 2M4GA 3W3CA 5CKTA 2X0LA 5D5XB 4HSTA 2RVCA 3HTUA 5L3GA 2NVXJ 1DU6A 4UVBA 3WODF 2QUFA 4XRSG 3B02A 3A01A 4HOBA 4F91B 1ZK8A 1IUFA 4DYRA 2FD5A 2DMTA 1K6OA 1ZKGA 2BY3A 3RPUA 4FX4A 4Y13A 3GZNB 3WTWC 2ELJA 2ICWG 3EDPA 3VODA 2FE3A 2ZB9A 2O7OA 2EA4A 2MG4A 3B6AA 4LB6B 3FXRA 2F5DA 2FBHA 3IAM2 4P9FA 2Q2EA 1I5ZA 3GFIA 3S2HJ 2E2JJ 2JQ7A 2DA3A 1TC3C 3G2BA 3V8KA 5HS8A 3G73A 1HCRA 4LGWA 3C2GA 2L9NA 2XB0X 4XLFA 4ZZDA 1HBXG 1IRXA 4Z2YA 2HS5A 3PUFA 4XLEA 2LD5A 3DPTA 5HLGA 2A07F 2XVCA 2HTJA 3F23A 2DK8A 4L9TA 3X2QH 3ZQCA 1SAUA 3D5SC 2ELHA 1IXCA 1TL8A 2WV1A 4MQ9F 3PSIA 1TTYA 2LLKA 2HYGD 4G6QA 5FGMA 2LY1A 2O6GE 1HOMA 3F72A 5A2QK 2BZTA 4BBSJ 1VQNI 1ZR2A 1UJ8A 3I59B 4CCNA 1DPRA 3GF2A 3OOPA 4WWCA 1D0YA 3T0YA 5GP9A 4HQMA 5H6QA 4Y4RA 1GVJA 5B5EC 4BACA 3ULQB 3WHBA 1RKWA 1T33A 1V5EA 1MDMA 1WFXA 1RNLA 2HYFA 3KEOA 2V1UA 1UMQA 4RA2A 2HKXA 2XGCA 4MFDA 5K5OA 2DTZA 2HQ5A 1FT9A 3TOAA 2QA4I 2CUEA 3HOUJ 1EV7A 2RKHA 2GBYA 1QRYA 4YFXF 1POGA 2F2EA 3AL0B 2FBKA 1WPKA 3SYTA 4LFUA 3JRDA 4ENNA 3HOYJ 3OL3A 2CQKA 1S9HA 1MIJA 1VQPI 3GTOJ 3IHUA 2VODA 3FMSA 3LNQA 5FLMJ 3BR0A 1TWGJ 4HBLA 2R7UA 2M0CA 2MABA 1S7EA 3M7GA 3I3LA 3MMYB 2F6CA 4RS8A 1SAXA 3PL8A 2JA2A 1FMWA 1AWCA 2FUG2 1Z3XA 2NVYJ 2HI3A 1X4PA 1XSDA 2XHKA 4NUBA 4ZYEA 5IOYA 1NG6A 3CUQC 3K1NA 2E1MC 1OYWA 4LITA 2R7SA 2Y9YA 3S3OA 2XF7A 4C3HJ 1Z67A 1IGNA 4ZDPA 1SD4A 5HNFA 1B4AA 2FQ4A 2IT0A 2ID6A 3I56I 3FBIB 2LP0A 2JA6J 4JBAA 2QYOA 3HSEA 4A5NA 4B1RA 1X2NA 2FSWA 2G7UA 4M6YA 5ERIA 5D4RA 4A3CJ 1BL0A 3P9KA 4TV7A 2QBYB 3HKZA 1STZA 5D8KB 5D6FA 1VTNC 4XOTA 1GLNA 2DODA 1RUNA 2DN0A 1V55H 1X1AA 1LQ1A 4HV5A 3JR9A 1R6RA 2JPCA 2ZXWH 3FK7A 2V1DA 2JVHA 1RRJA 4XONA 2XV4S 4OIRF 4RAFA 1D5VA 2F5VA 3JRFA 1UHSA 3K4LA 3LAJA 5JLXA 2A5YB 4BE0A 1P4AA 3U1DA 1K61A 5FRMA 4RLQA 4BQNA 3F0CA 1KONA 1FBQA 2CYYA 3K2AA 3ZRGA 1A6QA 3K69A 3EUAA 3G3ZA 1TNTA 5DYMA 4E7KA 3JW4A 1JHHA 2P4WA 2P0TA 3KP4A 4WCGA 3C3WA 2LOOA 1QVTA 5FKOA 5HVQC 1NH3A 3Q3SA 4L9NA 2UWMA 1ERDA 2DU9A 2EPFA 3CUQB 2R4GA 5EEHA 2NOGA 2E1MB 1JUPA 5BPDA 1JXSA 4C30A 1ORKA 2F4MB 4XKBA 2H8RA 5FKLA 4EJOA 1ON1A 3ZQLA 5BNGA 2R7DA 2DBBA 4H0EA 4IKFA 2OAZA 3KYDB 2VLAA 3GFLA 5FD5A 5EEAA 2VQLA 4S04A 3OYFA 5GPCA 1XTAA 2CQXA 2L02A 1IJWC 3I4PA 5FROA 2QLZA 3DF8A 4A6EA 3PNVA 3RTRA 1FY7A 4LLLA 2DFEA 2CQNA 4FTHA 5C4XJ 5EG0B 3PIPF 4IX7A 3B73A 3TDZC 2DOEA 3O3KA 4AD9A 3FXQA 5EF6A 1ETVA 4ZTFA 3LOCA 3K1MA 1ZG1A 1ZGWA 2BGCA 3NAUA 2BV6A 1LKXA 2HOAA 1D0ZA 3CMMA 3GTPJ 3MKZA 3EUHC 2JTVA 3RZDJ 4ITVA 5BPIA 2H6CA 3E3VA 4IL6C 4S0HB 2LYCA 4M3GA 1UHWA 3CP2A 4HV6A 3L2QA 2GXBA 2P7CB 2FJ1A 3HRTA 4BE2A 1LNWA 1XGSA 2JSCA 2L4AA 1UFMA 4N9HA 2QSFX 3PSFA 2MLKA 3BR3A 3IWZA 2A6EF 4BE1A 1GDTA 2X51A 2QSHX 4CHUA 1Y6IA 3JAMK 2DI3A 1FOXA 4P5OA 4CCOA 4EEFG 2GXAA 3H1CA 2K4JA 1H9TA 5JHFA 1AHDP 4UY8I 3CCSI 1O3SA 1V5GA 2O8XA 5EGOA 4KNYA 2ME0A 4G7HF 3JSPA 3H3ZA 4CYDA 4BKXA 5IOZA 1S7OA 2K9MA 4ZZLA 1W0UA 3ZOBA 2UXNA 2LK2A 1R71A 3K6GA 5K1YA 1JGGA 1YITI 1MJ9A 1R7JA 1T95A 2EZIA 3RI4A 4UUVA 5A2QZ 5C4JJ 4U7DA 4OIOF 1TBXA 2QEXI 2E36A 1E0EA 5E1WA 2R5ZB 4P96A 1HSJA 3OYIA 5E8IA 2PJRB 4O6JA 2HNHA 3C2BA 3D1NI 1R5HA 4FX0A 2KLOA 1KQ9A 1Y39A 3ML6A 3R0JA 2EH3A 4UUTA 2Q8KA 2M0MA 4HF1A 2K86A 1TP4A 2RNJA 3S2WA 1T6SA 2EV0A 4HLXA 5FKNA 1LVKA 3CCUI 1JKOC 2HR3A 1UAAA 2YX4A 4I09A 2BW3B 5ED4A 4D9JA 1TWAJ 2KZGA 3BWGA 3MKLA 2ME6A 5BQTA 1UCRA 3EYYA 4ZTJA 1I1GA 3I5UA 3S16J 1WGXA 2HZTA 2Y48A 4BU2A 1FMVA 2BXYA 5IT9R 3QYBA 3EYIA 1Y0UA 3K2ZA 1ONVA 4KN4X 4MEXF 2M8EA 4PJMA 4II2A 5DCMA 4HNTA 5J4VA 2HOEA 2A3SA 1MMSA 2WWYA 2OA4A 4FETA 3K4NA 1B8IA 2PLYA 5FFXA 5K7ZA 2L01A 4PCQA 2OD5A 1W5CC 4AUXA 3CTAA 1Z21A 3NWSA 5L3CA 5HLTA 3HL2A 3W2WA 3T8TA 2OQGA 4IRIA 1KZHA 3KYCB 2NRAC 1HA8A 1YJWI 3RPQA 1OR7C 2B7EA 2DPUA 4E4HA 4CGZA 2VKHA 1Y8RB 5A2QR 1CQTA 5EZHA 2O8KA 4PDKA 3HSFA 2P0WA 3ZCOA 2MGQA 3JRGA 2QKMB 2LBFB 3UNGC 1D1BA 3OYKA 2FOWA 2LR8A 4NNJA 3ZMTA 3VSKA 2EIMH 2L7ZA 2J5OA 3A4CA 3RYPA 3LA2A 1S72I 4AIJA 5IYCJ 1RUOA 2ZJQF 2V1NA 4OINF 1OQYA 2VT2A 1HDPA 3R61A 2STWA 2AO9A 2WA0A 1R1VA 2LG4A 1WVRA 1K6YA 4EJWA 1AA7A 3OYHA 1A36A 1FX7A 3BPVA 2K7LA 1REPC 1IDYA 3WTZA 2L9RA 3HC7A 1XMXA 4M72A 1BM9A 2HPMA 4XSXF 2NVUB 1XC5A 2X6OA 2ZO4A 2IS2A 3OYGA 2QVOA 2M30A 3MN2A 2JUCA 2QENA 5J40A 4G7OF 1T08B 2NVTJ 4FASD 4N9IA 1JGSA 1W7PD 2PN6A 3E6DA 4L5IA 3M3YJ 2E71A 3IUOA 1ZG5A 2WAQA 3HOTA 2M8GX 2VBXA 2W4SA 1WI9A 3L7WA 4HW0A 1WH7A 4BAYA 4G7ZF 4E7HA 1MBKA 2V9VA 5DDGA 4U88A 4B3AA 2OV7A 1ETQA 4CUGA 2ACJA 1IO2A 1T0FA 3WHCA 5GAGJ 3S2DJ 3HHHA 1Y8QB 4EM2A 4UUSA 3OYCA 2Q1ZB 1FLIA 2CQ7A 2V4JC 2W7NA 2O3FA 3J7AW 2HVQA 2RV8A 1H89C 1T98A 4IQJA 2E60A 1HF0A 5B3SH 2M45A 1W36C 2DOAA 4MGRA 4A69C 4GDFA 2ZJRF 4ETSA 1U5TC 1F5TA 1VQ9I 1PUFA 2H94A 1RESA 3DPUA 4IQ4A 3AG4H 2MLGA 1I6HJ 2LY2A 5E79C 3ZP5A 1L0OC 4JYKA 1FPQA 3J81K 5J4YA 2CV2A 2ESHA 1ENHA 1S8NA 3VDXA 2GOMA 2YUSA 1LFBA 3FF5A 3WTYC 3HBLA 4W97A 5GPAA 2RNGA 3SDGA 3OYAA 4YIRX 1ITYA 1LEBA 1YW9A 5DTDA 3C7JA 4MFEA 2R7XA 4AC0A 3CCLI 2NXNB 1YJ9I 3GLXA 1I27A 3QYEA 4M3EA 3Q5FA 5LHHA 2M2EA 4I0BA 3OYMA 4O3MA 1ZAOA 2V6CA 4R8HA 2WB1N 3KIOA 2O03A 5E18F 4L0YB 3GTGJ 4YELA 1B59A 4FE4A 4EJUA 1O57A 3NARA 4LG0A 1SFKA 3RYRA 1FP1D 2LNBA 4PUSA 2DYRH 3BQYA 2ISYA 1YX5A 2MYSA 3E6CC 1GXPA 3RPUD 2VJJA 1T38A 1OCZH 1NK3P 1AKHB 2HGCA 5J8FA 3CCQI 5CQEA 4Y33A 1S3JA 3RSNA 5DM6F 5M5YJ 4D7MA 2G0EA 4ZJZA 1UB9A 2IA1A 2EK5A 1ZR4A 2DMPA 3JAMZ 3TW6A 5IT3A 2Z1DA 3KLNA 2AXTC 3VYRB 2IA0A 1BC7C 3CCVI 1PP8F 3WTVC 3BG9A 3O2PE 2VBWA 4RM3A 3DQVC 5F0FA 4BHCA 1ZRCA 3DEEA 1U5TB 3VYSB 2E7WA 3K4CA 2W84A 4YG2F 3WTUC 3UR3C 2QWWA 3K0LA 3P9CA 1BI0A 2ZMEC 4A3EJ 1MBEA 2A6HF 2O0YA 1HW1A 3WU0A 1IW7F 2AHQA 2IAIA 1XSXA 3H0GJ 3UKGA 2M9HA 4MIMA 1WI3A 1XD7A 2OZUA 2XAGA 1FNNA 2V9PA 1J09A 3OOUA 3ZQIA 4D7NA 3A2KA 2LH9A 4DQ2A 4PJLA 2HOTA 3BG7A 3L2RA 2K9NA 1V4RA 5LGTA 3G1LA 5D8LB 3LSKA 4MHGA 4LMYA 4R1HA 2HXOA 2IBDA 4NBQA 2LF8A 3TO7A 5M3FJ 1HLVA 1HDDC 5FLVA 1VQ6I 3I0TA 5TRDA 2VONA 3RDIA 5IPAA 3HUGB 2CUFA 3U21A 1O7FA 3HPGA 4YFNF 2ZXHA 4YFKF 2DA5A 3ZMVA 1OKRA 2E19A 3GO5A 2CV0A 1K78B 2NYXA 3JAMR 2V79A 1Y56A 3WTTC 2EILH 2A6TA 4CO8A 1IV8A 5J1UA 4G9YA 1FC3A 4M9SA 1EH7A 3H9GA 1JTYA 3SZTA 1HXDA 3OIOA 1K7AA 4NQWB 4Q47A 3PO2J 4MTDA 1CF7B 2OTLI 3IP4B 5J3LA 5FJ8J 2X6XA 3E0JB 1G6NA 1R1UA 2MC4A 3HTSB 1Z0XA 5HOOA 4PK4A 1J75A 3HOZJ 2ZMEB 2C6YA 2VPRA 3M1CA 2FMLA 2DT6A 1LDDA 3HZJA 4BYYA 5L3EA 3J7ZI 3DKWA 2IRFG 2FF4A 3K70D 3M4OJ 4IRHA 3TKYA 2E1CA 2NAZA 1X1DA 2XRLA 3QOPA 2QM3A 3CCRI 2BEOA 2JA5J 4M74A 2RGVA 2NVQJ 1MJAA 4KMFA 2EFWA 4D0PA 4Q5SF 4LK0F 4HDVA 3AL0C 5EZGA 2R7RA 4AYBA 2H1LA 2L3DA 5IT9K 3DBRB 3TGNA 5EEGA 3DU5A 2EB7A 3QU6A 1B72B 2K3PA 2R7OA 2IGNA 2R7FA 3I71A 2M3AA 5E17F 2H27A 3FM5A 4WXHA 5CPRB 2UV1A 3M8JA 2WTEA 5J8CA 4L0ZB 3TL4X 2M7AA 2RAEA 3CMAI 3QQAA 2XB5A 5IYBJ 2H09A 3F8NA 3K7AJ 3KX2A 3EUKL 3P9IA 1ZARA 2VXZA 4K2EA 4ENKA 2IS1A 2DXIA 2IXSA 3DFGA 2I5UA 4HLYA 3QPTA 4L18B 4KIFA 5TJJA 3BLYA 1B9NA 2KIUA 1R00A 2B0LA 2OU2A 1EKEA 3ABTA 1UHMA 3CCJI 1AOYA 4A3DJ 3S17J 1WJEA 2L5QA 4RMNA 1F43A 2IA2A 2K85A 3BR1A 5C44J 3IL2A 2XF5A 4XIDA 5AIQA 2EBIA 2R7TA 4CCMA 3BT9A 3HRUA 3G1OA 2E2IJ 3OYBA 3HRSA 2IEKA 2LKSA 2HVSA 1QZZA 4ZDOA 1USSA 3CDHA 4HNUA 1KU2A 5E1XA 1R22A 3J81Z 3U9GA 3GTJJ 4FCYA 3P5JA 1S5LC 3HG9A 3ESWB 5DCFA 5D5VB 2EIKH 1Y1VJ 2OZ6A 2BVLA 1W0TA 3O8HA 2D2WA 1FP2A 1SVLA 2YR2A 3LSJA 1Z91A 3TO6A 1ZGAA 1LJ9A 4PFOA 2GWRA 2VKDA 1XMKA 4RAYA 1F1ZA 2DMUA 2Y31A 2LDUA 3RKWA 4CA0A 1OLTA 2L2OA 4CYCB 2P5LC 1XX5A 1WCMJ 1ZHFA 3L2CA 4BDZA 5BOXA 4J01A 2AXLA 5E20A 3RJPA 3WTSC 5F04A 5K5RA 1FWZA 2VQCA 5HS9A 2VI6A 2FMYA 5DD8A 2VBZA 4M9XA 4A3KJ 2CW7A 2BE5F 2KHMA 2BY0A 4BY1J 2KIQA 2PQ8A 2QKLB 2ZSHB 1BOAA 3HJEA 2GM4A 1XSVA 4BHBA 3K4KA 2CU7A 1X19A 3Q0UA 1PVEA 2J5PA 3RQ4A 3AAFA 2EV5A 2QGUA 3FXOA 2JUGA 2OF7A 5DV5A 3ZXSA 3FHZA 3DLLF 4EM0B 2R7WA 1MW7A 2YPRA 4I99C 4RM2A 1FEXA 4HZFA 4NC7A 1OMIA 2I8DA 1FSHA 1DDNA 3J81R 4XLNF 4A5MA 4EM1A 1JUMA 2G7HA 2VJ4A 3RKXA 2HZDA 2P6SA 4IHTA 5E3LA 4DNCA 5JHUA 5CVVA 3S8PA 2DA4A 2GAUA 2VJIA 4AIKA 1USTA 2GXGA 1WZ2A 1HSTA 2LY9A 1P2FA 3RKQA 4KMUX 4C2TA 2K9QA 1VZ0A 1ETXA 1G4DA 4EGYA 2WV0A 1OCRH 5KNLA 2F4IA 1R36A 2CH0A 2K4BA 5LBQA 1VQLI 3K1PA 1G8XA 2VE8A 4F92B 3LAPA 3OYDA 5C3EJ 2P5VA 3KP5A 5FO5A 3DEWA 2XROA 5H6RA 2R5YB 3LSHA 2X1CA 5LHIA 3L2UA 2RDPA 2FNAA 3BG3A 1LE8A 1ULYA 3NRVA 2HOSA 5CVIA 3DPLC 4CCKA 3KETA 4IOCF 3CO7C 1APLC 3HDDA 2V26A 1JT6A 4IO9F 1TZLA 1ZLJA 5CVRA 4B3XA 2EFQA 3QWLA 5J47A 1OFCX 1G59A 2GA1A 4GGGA 4IHWA 3FK6A 2KDOA 1YO5C 4Y7NJ 1U8BA 3KZYA 3Q9VA 5K7FA 2Z33A 3ZN1A 4XK4A 3I59A 4IHXA 1HKQA 1ZQ3P 4Y15A 2FOKA 1CGPA 3SFIA 4A3GJ 3OY9A 2VE9A 2ZC2A 5DCMB 1K4TA 3JREA 3HSRA 1LFUP 4A93J 1ETOA 3LSMA 3DTKA 3ISPA 4E7ZA 1RPWA 4S05A 5BMZA 1FIPA 3REOA 3WE3A 1SANA 4DYCA 4U0WA 1YIJI 1FOWA 3RZOJ 2KL4A 4PSXA 3SZGA 4U7BA 2HFHA 1TNSA 1RR8C 1O3RA 4I6ZA 3F8BA 2A69F 2WBMA 2AS5F 4FT8A 2E2HJ 1J0RA 5JVGF 3BG6A 2V7FA 3JRCA 2KKOA 4HDUA 4M73A 4HEA2 5TGTA 3KZIC 4CZCA 2DQRA 2ZFUA 1R5ID 2ESNA 3OS0A 3GUDA 4O5VA 5KHDA 2EFOA 4MTEA 2MH9A 3VYTB 2KIFA 2LKPA 2KZVA 3I55I 3MZYA 4DGWB 1H0MA 1DP3A 4HYEA 4BXUA 5FB2A 5EYRA 5H20A 2Z5UA 1O3TA 1F4KA 3WU2C 2JMWA 3BZKA 5IT9Z 4DIQA 2O61A 3KP6A 2AQFA 2XUBA 3GWZA 1YRNB 3GTLJ 1SFEA 4L5EA 3JRAA 3KZZA 3CLQA 2EZHA 4BHPA 4XQFA 1LPQA 1QGPA 4U87A 5IP6A 4F52A 3R4KA 1I6XA 3CD6I 2ETHA 2ZJ2A 2OQRA 4ZC3A 3TDUC 1YOVB 4BGDA 3CJRB 4PFPA 4F93B 3BP8A 1A31A 4BQAA 2Y0SN 3HPHA 2K5CA 3GYHX 4AVPA 3F3XA 4C9YA 1ETWA 1DGWY 3DTIA 1PJRA 3M8FA 1UZCA 4HX8A 2QBYA 4KFCA 1IRFA 2DMQA 2R7ZJ 4CDGA 2KQRA 2M7BA 2W1OA 4PZJA 3COAC 4JX6A 4BQOA 2D1HA 3SFZA 5EDNA 4J19A 2MUNA 5ICCA 1Z05A 3HOWJ 1G2HA 4N4NB 2WY8Q 1TT0A 2JT1A 4BUPA 5E3OA 1TQIA 3GZ5A 3J7AO 4KIBA 3MQ0A 2HQRA 3E5UA 3DWLE 3FWEA 2DFHA 4JP0A 5FLXR 3BTIA 3V7RA 2E5NA 1X4OA 4ZYDA 3E5XA 1QU3A 2ZSIB 4CCJA 1BR1A 1KU7A 3FXKA 1Z7LA 2DDBA 3Q0WA 1J59A 2Y0SA 3FXLA 4EMSA 3BTCA 5HDNA 1LDKB 3H35A 5J1RA 2IS4A 4BNCA 3IKTA 1XG1A 3H36A 4BDYA 3DCFA 4HA8A 5KAFC 1QHGA 3FMQA 1YG2A 3ECHA 1K4SA 3CUQA 4EV0A 2K3FA 5D6EA 2COMA 3PJRA 2PBIA 2I10A 4PJJA 2VXDA 4ESJA 3V4GA 4HSRA 4U0VA 3TQNA 4HQEA 2CMPA 1XCBA 1JKRC 2AQEA 3ECOA 4CCLA 2E1OA 3OYEA 3VPRA 2VQHA 2XPWA 1OCCH 4KYWA 3LWFA 5GAHJ 2HYJA 3F9KA 3D5RC 1SFXA 2FU4A 4HPQA 1T8IA 3H9QA 5FD6A 1G3TA 1KQ8A 3M1EA 3ZQQA 2P81A 4DBQA 1E2XA 4KT6A 3QPLA 3JTGA 1R4NB 5EG0A 2TRTA 5KVRA 2COBA 1MJBA 1WKMA 4E7SA 4LOCA 3DLAA 2W48A 4IHSA 3K4MA 2KRCA 2DYSH 4G6TB 5F64A 3QU3A 1DP7P 3OL4A 1T56A 3NQOA 5E3NA 2XAJA 3J7AY 2E5ZA 4LK1F 3KP2A 3BR2A 1ON2A 3PQJA 1E3HA 1U3EM 1YIOA 4C3IJ 4GYGA 3FHNA 3LQQA 3JSOA 3MKYB 2IPQX 2YU3A 5F6FA 1YJNI 2R93J 4IHYA 1FOYA 2W57A 3E7LA 4XKCA 2KRFA 1X3UA 4BBRJ 3OSGA 1W7PB 1MNMC 3F8CA 3MAJA 4CH7A 4E7IA 1HW5A 5KAIC 4X1EA 3OSFA 2JRTA 3BTJA 4B4CA 4X0GA 3CC2I 2KP6A 1X1BA 3D0SA 4QPQA 4HAMA 1BJAA 2VL8A 1OISA 2W00A 1R49A 2MSYA 1BR2A 2QQ8A 3VB2A 2KJCA 3PNYA 2A05A 2RQPA 4FHTA 5F08A 1P6RA 3BCBA 3FIWA 1K79A 1E3OC 3NEUA 1V54H 2BXZA 1YX3A 3O6BB 1IXSB 1MBJA 4OU0A 1VFCA 2EJRA 5F1JA 4OMYA 4HRIA 1FBUA 3M8EA 1J5YA 1DUXC 1HKTA 1IDZA 1QO0D 3GZ6A 2MA3A 5ICFA 2IJLA 2VBYA 3GW2A 1RC9A 2R5ZA 2L7MP 2QZ8A 2PJRA 1A04A 2A5WA 2V1XA 3DBHB 4YIIA 1SVMA 3RIRA 1O3QA 3HGYA 5IP9J 1TWFJ 1G3YA 1TLHB 5HS7A 1K83J 2PG4A 4XM3A 1XDUA 3EUHA 4DYQA 3K9TA 1KA8A 2ID3A 1I3AA 4PJ0C 4J00A 4UHTA 4UB6C 2BW3A 3M07A 4KUMA 3RCOA 4E6KG 4LB5A 1ZN2A 1TW2A 2ECCA 3I54A 4RAGA 1LEAA 3L09A 1V3FA 3DV8A 3T5XA 3IRRA 4G8XA 4RLFA 3N4MA 4KISA 3LA7A 1YS6A 4A2UA 1RZ4A 4RDUA 5ILSA 3PQKA 1SVOA 2XDVA 1C0WA 2CFOA 4GFBA 4B48A 5E3MA 3FMRA 3BQZA 3J7YJ 3A01B 2IGOA 2JN6A 2RQQA 4E7JA 3V7SA 2ECBA 1Z1DA 3MWMA 5FKKA 1A6IA 1FJLA 2BY2A 2FQ3A 1HKSA 4BY7J 3H9JA 1XPXA 3S32A 2ZJPF 4AIDA 3WG7H 1D8JA 2EWNA 2CO5A 3JCUC 2DA1A 2GLOA 5IY5H 2IVMA 2F5CA 2XGEA 2Z99A 3SQNA 3HB9A 1T39A 4YRVA 1LUJB 4DOZA 2PEXA 3WU1B 1YE9A 2Q2EB 1EH8A 4QTRA 4NB5A 5GADJ 4EJVA 2FXAA 3PM1A 3IAS2 1Z9CA 2LBFA 2KDZA 1PP7U 2QSGX 4EJTA 4Y17A 1LVAA 1SD6A 3I64A 4PGGA 4YEJA 1T2KA 1BN5A 2DOFA 1ZREA 1MNEA 2WB1A 3MZ8A 3I4NJ 2BOLA 1MSFC 3SZPA 4LD5A 4A0XA 5KK1A 3BG5A 4PSWA 4I02A 2VASA 4RGXA 1MGTA 2NS7A 3L1PA 3GXOA 3MEXA 2PFBA 2VOPA 1N75A 1H88C 3BDDA 2NNYA 3QODA 1W36D 9ANTA 1W1WE 4ABZA 4XNFA 3IH2A 2XAUA 3V7CA 1OCPA 2YX7A 1YTYA 1NG7A 3QOEA 2JZYA 3W2VA 2CW8A 3MD2A 5LEJA 2L7FP 1VQOI 1EF4A
chains in the Genus database with same CATH topology
5AONA 4UVCA 3DEUA 3DP7A 2BYVE 1D3YA 5CVJA 3JTHA 2Q0OA 5ICGA 2ADUA 1BBYA 1B9MA 1MDMB 2ZNYA 3WGGA 2UXXA 2CFXA 2PI0A 2MD5A 1U78A 5LEKA 4R79A 2K27A 5F1RA 2LF7A 4M6XA 5D4SA 1O7LA 3R60A 4IRGA 1OR7A 1GHCA 5BS6A 2XAHA 1QBJA 3WG9A 4LJZF 2DT5A 4IJAA 2DAOA 5JR3A 1KQ0A 1WSUA 1FSEA 3T8RA 1FYLA 1SMTA 4LLGF 3QRFF 1BI2A 4CXFA 2F5FA 2UZKA 4N0BA 3KE2A 2HDCA 5DEQA 1U6GA 5FLXK 4GYIA 3H3UA 1S7AA 3E6BA 5AIPA 2DQLA 4IVNA 3HIFA 2M87A 5HLHA 3BJOA 1U2WA 1IAWA 3CUOA 4WXDA 4BH9A 2X4HA 2G9WA 3FXUA 4KICA 4OMZA 2Y0MA 3F21A 3Q9SA 1HQCA 4KDPA 1OYIA 4UNOA 4AWXB 1LB2A 5JFRA 1U5TA 2P7VB 2JPBA 2HEOA 4IPAA 3HHGA 2E1NA 2RN7A 2IW5A 1KU9A 3E5QA 2DFIA 4M9ZA 3R0AA 5LRSA 2KIMA 4EGZA 4ESBA 4WF2A 3L9FA 4A6DA 1ODDA 3BJ6A 4P55A 5ILVA 2MC3A 2ZCWA 1FOKA 3HRMA 1B1BA 2MBFA 1IUYA 4YIFA 1QPMA 3ABUA 3P7NA 2P5KA 5LRRA 3HUGA 2PJPA 5DUKA 1JHFA 4P9UA 2M1BA 1BC8C 2DTRA 1S29A 4B8XA 1K78A 2K02A 1R1TA 3I53A 1BI1A 4CICA 2FNPA 4ZYHA 3SXYA 4NQWA 4UVAA 1J7KA 1CF7A 4I98B 3SHFA 2PMHA 2QQBA 3QPHA 3ZMZA 5LGUA 1I1SA 3FM3A 2ZMEA 4E70A 2VT3A 3VEPA 1XGNA 3PFIA 4UXNA 3ZMDA 1TW3A 3LSTA 3R6SA 2L4MA 1J2XA 1ZG3A 4QWQA 6PAXA 4GO1A 3IRQA 2W25A 1Q1HA 1S6LA 1R23A 4ZYGA 5HDGA 4OIPF 4L9VA 1IN6A 2OBPA 5HLIA 1ZRFA 1SD5A 2M5WA 3BOQA 2XRNA 3M9AA 4RB0A 4MEYF 2Z3YA 4EVIA 1FYKA 1PUEE 2TDXA 3KP7A 3BJAA 3GFJA 2H6BA 2XKOA 3KEQA 2HWVA 3GEZA 2HTSA 3MCZA 4XRFA 1G3WA 4PGHA 2FEZA 3OV8A 3QAHA 5HDKA 2FRHA 1L3LA 2IP2A 1U8RA 3WE2A 3FX3A 1Z6TA 4KIGA 4HX4A 3BROA 2Z9OA 3KLOA 2NS0A 1YYVA 2E7XA 3L00A 2VC0A 4CZZA 3VOEA 2GA2A 4WX9A 3BZ6A 3LFKA 4EQQA 3V8JA 4KT5C 4HF2A 1OYYA 1XDSA 1RI7A 1KGSA 1ZYRF 5FLXZ 1YQAA 2EFPA 2P8TA 2DW4A 5DD4A 5JI6A 3C1DA 5L3DA 3MFKA 1EH6A 2L54A 1DPUA 1R58A 2FA5A 4Q4ZF 1QZYA 1QNTA 1XGMA 1ZGJA 4L5JA 4RB3C 3HOSA 1FYMA 2ZXJA 2ZBKA 2P6TA 4ZH4F 3WTXC 1W5SA 2DLLA 1F9NA 3U2RA 4I01A 5DUIA 2ZFWA 1B6AA 3KP3A 5LHGA 5E8GA 5JVTA 1WWXA 1JE8A 4RGSA 2XKPA 4G94A 1SFUA 3J80K 2D45A 3F22A 2CG4A 4A0YA 1YS7A 4AIHA 3F8MA 1IZ1A 2ZKZA 3IWFA 1IN4A 3QP6A 1YW7A 2ZNZA 2A68F 3ERED 4G6DA 4ENJA 4OIQF 5D5WB 1PDNC 2D1VA 4I7HA 4LG0B 3H92A 1HW2A 4WK8F 1IN8A 5CJ9A 3TOBA 1G3SA 3WGIA 1P4WA 1IXRC 1GXQA 4F7ZA 3FZVA 1BIAA 2QQ9A 2XAQA 3V8LA 4HX7A 1XGOA 3EQLF 2CWEA 2W24A 1MKMA 3WGHA 4UV8A 1J9IA 4LLNA 4RAZA 1ZRDA 1KYZA 3D5LA 4RGUA 1SMYF 4RB1A 1OPCA 3I58A 1KYWA 2FBIA 3ZPLA 2HQNA 4MNUA 1MD0A 4M71A 5E1ZB 5ICEA 1XN7A 5LLQA 1XMAA 2R3SA 4I0AA 5L3BA 4U0YA 3F6VA 4IF4A 3IKVA 3N97A 1BI3A 1QQIA 1W4MA 4XLPF 3LA3A 1YW8A 2DO7A 2XAFA 5D5UB 1IF1A 3KFWX 1D8KA 2EV6A 3ZMSA 2HKOA 4I2OA 1WRJA 1XCVA 3VFZA 4OOIA 2XGXA 3LQRA 2DK5A 2CGPA 1WQ2A 3E6MA 2EFNA 2PMUA 1YLFA 2NNNA 2GZWA 2XIGA 2MH2A 4ASNA 4HF0A 2STTA 1W5TA 3F8FA 4GXOA 4A0ZA 1NHAA 3GFMA 3E97A 1ZLKA 2WC2A 4JK1X 1RIOH 2CW0F 4XSZF 5K5QA 5FFZA 2EA2A 1TQPA 4IXAA 3ZN0A 3F6OA 3ELKA 2CSOA 5CLSA 5CYVA 1IN7A 3BY6A 2Y75A 3W6JB 1ZH5A 3C18A 4B09A 1P4XA 3EETA 1Z7UA 5LGNA 2F5EA 4MQVA 4XBFA 1H9GA 2XASA 5L3FA 1R5GA 3MZHA 2GIVA 4ENMA 2GQQA 3ZQ7A 4A12A 1IRGA 2LSOA 1Z6RA 2KJBA 4GCVA 3QP5A 4ON0A 3RKYA 4KN7X 1LDJA 1E17A 1W7PA 3J80Z 2A61A 2VN2A 3BPXA 3HYIA 2VOOA 3ROUA 2VC1A 1FZPB 4JQFA 2DPDA 2ISZA 1P92A 1SD7A 4RB2C 3TO9A 3GVAA 1XB4A 4RGRA 3CLOA 3CO6C 4KA4A 1TQMA 3IC7A 4NHJA 3W6KB 1MZBA 3ZMUA 3KCCA 1BIBA 5CVUA 4Q48A 2RC4A 1YFHA 5ILUA 4WXCA 1FBSA 3DXJF 3T1BA 4UV9A 5J6XA 4L9JA 2BBYA 4ESFA 1IN5A 1KU3A 2W85A 3CJNA 4QLCU 2QQAA 2YSRA 3GX4X 2X0LA 5D5XB 2RVCA 3HTUA 5L3GA 4UVBA 3WODF 2QUFA 3B02A 4HOBA 1K6OA 3RPUA 4FX4A 4Y13A 3WTWC 3EDPA 3VODA 2FE3A 2EA4A 4LB6B 3FXRA 2F5DA 2FBHA 4P9FA 2Q2EA 1I5ZA 3GFIA 3V8KA 5HS8A 3G73A 4LGWA 4ZZDA 1HBXG 4Z2YA 2HS5A 2A07F 3DPTA 5HLGA 2XVCA 2HTJA 3F23A 2DK8A 4L9TA 2ELHA 1IXCA 4MQ9F 1TTYA 2HYGD 4G6QA 5FGMA 2O6GE 3F72A 5A2QK 3I59B 1DPRA 3GF2A 3OOPA 4WWCA 3T0YA 4HQMA 5H6QA 1GVJA 3ULQB 1MDMA 1RNLA 2HYFA 3KEOA 2V1UA 2HKXA 5K5OA 1FT9A 3TOAA 1EV7A 2RKHA 4YFXF 2F2EA 2FBKA 4LFUA 4ENNA 2CQKA 3IHUA 2VODA 3FMSA 4HBLA 3M7GA 4RS8A 1SAXA 1AWCA 1XSDA 2XHKA 4ZYEA 3CUQC 3K1NA 1OYWA 1SD4A 1B4AA 2IT0A 4JBAA 2QYOA 3HSEA 4A5NA 2G7UA 2FSWA 5ERIA 4M6YA 5D4RA 3P9KA 4TV7A 2QBYB 1STZA 5D8KB 5D6FA 1VTNC 1RUNA 1LQ1A 4HV5A 2JPCA 2V1DA 2XV4S 4OIRF 1D5VA 3LAJA 2A5YB 1P4AA 3U1DA 1FBQA 2CYYA 3K69A 3G3ZA 1TNTA 5DYMA 3JW4A 1JHHA 2P4WA 3KP4A 4WCGA 3C3WA 5HVQC 2UWMA 4L9NA 2DU9A 3CUQB 5EEHA 5BPDA 1JXSA 4EJOA 1ON1A 2R7DA 2DBBA 4H0EA 2OAZA 3GFLA 5FD5A 4S04A 2L02A 3I4PA 2QLZA 3DF8A 4A6EA 3RTRA 1FY7A 4LLLA 3B73A 3TDZC 3O3KA 4AD9A 3FXQA 3K1MA 1ZG1A 2BGCA 2BV6A 2JTVA 5BPIA 2H6CA 3E3VA 1UHWA 4HV6A 2GXBA 2P7CB 3HRTA 1LNWA 1XGSA 2JSCA 2L4AA 1UFMA 4N9HA 2MLKA 3IWZA 2A6EF 4CHUA 3JAMK 2DI3A 4P5OA 2K4JA 1H9TA 1O3SA 2O8XA 4KNYA 4G7HF 3JSPA 3H3ZA 4CYDA 1S7OA 4ZZLA 2UXNA 5K1YA 1MJ9A 1R7JA 3RI4A 4UUVA 5A2QZ 4U7DA 4OIOF 1TBXA 5E1WA 4P96A 1HSJA 5E8IA 4O6JA 1R5HA 4FX0A 1KQ9A 3ML6A 3R0JA 2Q8KA 4HF1A 2K86A 2RNJA 3S2WA 1T6SA 2EV0A 4HLXA 2HR3A 2YX4A 4I09A 5ED4A 3BWGA 5BQTA 1UCRA 3EYYA 1I1GA 3I5UA 2HZTA 2Y48A 3EYIA 1Y0UA 3K2ZA 1ONVA 4KN4X 4MEXF 2M8EA 5DCMA 2HOEA 2A3SA 2WWYA 2OA4A 2PLYA 5FFXA 2L01A 4PCQA 2OD5A 3CTAA 5L3CA 3T8TA 2OQGA 4IRIA 2NRAC 3RPQA 2DPUA 4CGZA 4PDKA 3HSFA 3ZMTA 2J5OA 3RYPA 3LA2A 4AIJA 1RUOA 4OINF 2VT2A 3R61A 2STWA 1R1VA 4EJWA 1FX7A 3BPVA 2K7LA 1REPC 3WTZA 4M72A 1BM9A 4XSXF 2ZO4A 2QVOA 2M30A 2QENA 4G7OF 4N9IA 1JGSA 1W7PD 2PN6A 3E6DA 4L5IA 1ZG5A 3HOTA 2VBXA 1WI9A 3L7WA 4HW0A 4BAYA 4G7ZF 2V9VA 5DDGA 4U88A 2ACJA 1T0FA 3HHHA 1FLIA 4EM2A 2O3FA 2RV8A 1T98A 2M45A 4MGRA 1F5TA 4ETSA 1U5TC 2H94A 2MLGA 3ZP5A 1L0OC 1FPQA 3J81K 2ESHA 1S8NA 3FF5A 3WTYC 1LEBA 1YW9A 3C7JA 3GLXA 1I27A 3Q5FA 5LHHA 4I0BA 4O3MA 1ZAOA 2V6CA 4R8HA 2O03A 5E18F 4L0YB 1B59A 4EJUA 1O57A 4LG0A 3RYRA 1FP1D 2LNBA 2ISYA 3E6CC 1GXPA 1T38A 2HGCA 5J8FA 1S3JA 1UB9A 2IA1A 2EK5A 3JAMZ 5IT3A 3KLNA 2IA0A 1BC7C 1PP8F 3WTVC 3O2PE 2VBWA 3DQVC 4BHCA 1ZRCA 1U5TB 2E7WA 2W84A 4YG2F 3WTUC 2QWWA 3K0LA 3P9CA 1BI0A 2A6HF 2O0YA 1HW1A 3WU0A 1IW7F 1XSXA 1XD7A 2OZUA 2XAGA 1FNNA 4DQ2A 1V4RA 5LGTA 5D8LB 4MHGA 4LMYA 4R1HA 2LF8A 3TO7A 3I0TA 5TRDA 2VONA 3RDIA 1O7FA 4YFNF 4YFKF 3ZMVA 1OKRA 3GO5A 1K78B 2NYXA 2V79A 3WTTC 4CO8A 4G9YA 1FC3A 4M9SA 1EH7A 3SZTA 1HXDA 1K7AA 4Q47A 4MTDA 1CF7B 1G6NA 1R1UA 3HTSB 5HOOA 1J75A 2ZMEB 2C6YA 2FMLA 1LDDA 4BYYA 5L3EA 3DKWA 2IRFG 2FF4A 4IRHA 3TKYA 2E1CA 2NAZA 3QOPA 2QM3A 2BEOA 4M74A 2RGVA 1MJAA 4KMFA 2EFWA 4D0PA 4Q5SF 4LK0F 4HDVA 2L3DA 5IT9K 3TGNA 5EEGA 2EB7A 3QU6A 2R7FA 3I71A 5E17F 2H27A 3FM5A 4WXHA 2WTEA 5J8CA 4L0ZB 2H09A 3F8NA 3P9IA 1ZARA 2VXZA 4K2EA 4ENKA 3DFGA 4HLYA 3QPTA 4L18B 4KIFA 5TJJA 1B9NA 2KIUA 1R00A 2B0LA 2OU2A 3ABTA 1UHMA 1AOYA 2IA2A 3IL2A 5AIQA 3HRUA 3HRSA 1QZZA 1USSA 3CDHA 1KU2A 5E1XA 1R22A 3J81Z 3U9GA 5DCFA 5D5VB 2OZ6A 2D2WA 1FP2A 2YR2A 1Z91A 3TO6A 1ZGAA 1LJ9A 2GWRA 1XMKA 4RAYA 1F1ZA 3RKWA 2LDUA 2P5LC 1ZHFA 3L2CA 5BOXA 2AXLA 5E20A 3RJPA 3WTSC 5K5RA 1FWZA 5HS9A 5DD8A 2FMYA 2VBZA 4M9XA 2BE5F 2PQ8A 1BOAA 1XSVA 4BHBA 2J5PA 3AAFA 2EV5A 5DV5A 3FHZA 4EM0B 2YPRA 4HZFA 1OMIA 1FSHA 1DDNA 4XLNF 4A5MA 4EM1A 2G7HA 3RKXA 2P6SA 4IHTA 4DNCA 5JHUA 5CVVA 2GAUA 4AIKA 1USTA 2GXGA 1HSTA 1P2FA 4KMUX 1G4DA 4EGYA 2WV0A 1R36A 2K4BA 5LBQA 3K1PA 2VE8A 3LAPA 2P5VA 3KP5A 5FO5A 2XROA 5H6RA 5LHIA 2RDPA 2FNAA 1ULYA 3NRVA 5CVIA 3DPLC 3KETA 3CO7C 1ZLJA 5CVRA 2EFQA 2GA1A 4GGGA 1YO5C 3KZYA 3Q9VA 2Z33A 3ZN1A 3I59A 1HKQA 4Y15A 2FOKA 1CGPA 2VE9A 5DCMB 3HSRA 3ISPA 4S05A 5BMZA 3REOA 3WE3A 4U0WA 4U7BA 2HFHA 1TNSA 1O3RA 3F8BA 2A69F 2AS5F 4FT8A 1J0RA 4HDUA 2KKOA 4M73A 2DQRA 2ESNA 3GUDA 4O5VA 2EFOA 4MTEA 2MH9A 2KIFA 2LKPA 3MZYA 1H0MA 4HYEA 4BXUA 5FB2A 5H20A 2Z5UA 1O3TA 1F4KA 5IT9Z 2O61A 3KP6A 2XUBA 3GWZA 1SFEA 3KZZA 4BHPA 1QGPA 3R4KA 1I6XA 2ETHA 2ZJ2A 2OQRA 3TDUC 3BP8A 4BQAA 3GYHX 4AVPA 3F3XA 3M8FA 4HX8A 2QBYA 4KFCA 1IRFA 4CDGA 4PZJA 3COAC 2D1HA 3SFZA 5ICCA 1Z05A 2JT1A 1TQIA 3GZ5A 3J7AO 4KIBA 3MQ0A 2HQRA 3E5UA 3FWEA 3V7RA 4ZYDA 3E5XA 1KU7A 1J59A 4EMSA 5HDNA 1LDKB 4BNCA 3IKTA 4HA8A 3FMQA 1YG2A 3ECHA 3CUQA 4EV0A 5D6EA 2COMA 2PBIA 4ESJA 3V4GA 4U0VA 3TQNA 4HQEA 1XCBA 3ECOA 4KYWA 3LWFA 1SFXA 2FU4A 5FD6A 1G3TA 1KQ8A 3M1EA 1E2XA 3JTGA 5KVRA 1MJBA 1WKMA 4IHSA 1DP7P 5F64A 3QU3A 3NQOA 2XAJA 4LK1F 3KP2A 1ON2A 3PQJA 1U3EM 1YIOA 4GYGA 3JSOA 3LQQA 2IPQX 2YU3A 5F6FA 2W57A 2KRFA 1X3UA 1W7PB 3F8CA 3MAJA 1HW5A 2JRTA 3D0SA 4HAMA 1BJAA 3VB2A 2KJCA 2RQPA 4FHTA 1P6RA 1K79A 3NEUA 3O6BB 1IXSB 4OU0A 2EJRA 4OMYA 1FBUA 3M8EA 1J5YA 1DUXC 1HKTA 1QO0D 3GZ6A 2MA3A 5ICFA 2IJLA 2VBYA 3GW2A 2QZ8A 1A04A 2V1XA 3RIRA 4YIIA 1O3QA 1G3YA 1TLHB 5HS7A 2PG4A 1XDUA 3EUHA 3K9TA 1KA8A 4UHTA 4KUMA 4LB5A 1ZN2A 1TW2A 3I54A 1LEAA 3L09A 1V3FA 3DV8A 3T5XA 3IRRA 4G8XA 3N4MA 3LA7A 1YS6A 4A2UA 1RZ4A 5ILSA 3PQKA 1C0WA 3FMRA 3V7SA 3MWMA 1Z1DA 2FQ3A 1HKSA 1D8JA 2EWNA 2CO5A 2IVMA 2F5CA 2Z99A 3SQNA 1T39A 2PEXA 3WU1B 1EH8A 4NB5A 4EJVA 2FXAA 1Z9CA 1PP7U 4EJTA 4Y17A 1LVAA 4PGGA 1SD6A 3I64A 1T2KA 1BN5A 1ZREA 3SZPA 4LD5A 4A0XA 5KK1A 4I02A 4RGXA 1MGTA 3GXOA 3MEXA 2PFBA 2VOPA 3BDDA 2NNYA 3V7CA 2YX7A 1YTYA 2JZYA 5LEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AON A;  4UVC A;  3DEU A;  3DP7 A;  2BYV E;  1D3Y A;  5CVJ A;  3JTH A;  2Q0O A;  5ICG A;  2ADU A;  1BBY A;  1B9M A;  1MDM B;  2ZNY A;  3WGG A;  2UXX A;  2CFX A;  2PI0 A;  2MD5 A;  1U78 A;  5LEK A;  4R79 A;  2K27 A;  5F1R A;  2LF7 A;  4M6X A;  5D4S A;  1O7L A;  3R60 A;  4IRG A;  1OR7 A;  1GHC A;  5BS6 A;  2XAH A;  1QBJ A;  3WG9 A;  4LJZ F;  2DT5 A;  4IJA A;  2DAO A;  5JR3 A;  1KQ0 A;  1WSU A;  1FSE A;  3T8R A;  1FYL A;  1SMT A;  4LLG F;  3QRF F;  1BI2 A;  4CXF A;  2F5F A;  2UZK A;  4N0B A;  3KE2 A;  2HDC A;  5DEQ A;  1U6G A;  5FLX K;  4GYI A;  3H3U A;  1S7A A;  3E6B A;  5AIP A;  2DQL A;  4IVN A;  3HIF A;  2M87 A;  5HLH A;  3BJO A;  1U2W A;  1IAW A;  3CUO A;  4WXD A;  4BH9 A;  2X4H A;  2G9W A;  3FXU A;  4KIC A;  4OMZ A;  2Y0M A;  3F21 A;  3Q9S A;  1HQC A;  4KDP A;  1OYI A;  4UNO A;  4AWX B;  1LB2 A;  5JFR A;  1U5T A;  2P7V B;  2JPB A;  2HEO A;  4IPA A;  3HHG A;  2E1N A;  2RN7 A;  2IW5 A;  1KU9 A;  3E5Q A;  2DFI A;  4M9Z A;  3R0A A;  5LRS A;  2KIM A;  4EGZ A;  4ESB A;  4WF2 A;  3L9F A;  4A6D A;  1ODD A;  3BJ6 A;  4P55 A;  5ILV A;  2MC3 A;  2ZCW A;  1FOK A;  3HRM A;  1B1B A;  2MBF A;  1IUY A;  4YIF A;  1QPM A;  3ABU A;  3P7N A;  2P5K A;  5LRR A;  3HUG A;  2PJP A;  5DUK A;  1JHF A;  4P9U A;  2M1B A;  1BC8 C;  2DTR A;  1S29 A;  4B8X A;  1K78 A;  2K02 A;  1R1T A;  3I53 A;  1BI1 A;  4CIC A;  2FNP A;  4ZYH A;  3SXY A;  4NQW A;  4UVA A;  1J7K A;  1CF7 A;  4I98 B;  3SHF A;  2PMH A;  2QQB A;  3QPH A;  3ZMZ A;  5LGU A;  1I1S A;  3FM3 A;  2ZME A;  4E70 A;  2VT3 A;  3VEP A;  1XGN A;  3PFI A;  4UXN A;  3ZMD A;  1TW3 A;  3LST A;  3R6S A;  2L4M A;  1J2X A;  1ZG3 A;  4QWQ A;  6PAX A;  4GO1 A;  3IRQ A;  2W25 A;  1Q1H A;  1S6L A;  1R23 A;  4ZYG A;  5HDG A;  4OIP F;  4L9V A;  1IN6 A;  2OBP A;  5HLI A;  1ZRF A;  1SD5 A;  2M5W A;  3BOQ A;  2XRN A;  3M9A A;  4RB0 A;  4MEY F;  2Z3Y A;  4EVI A;  1FYK A;  1PUE E;  2TDX A;  3KP7 A;  3BJA A;  3GFJ A;  2H6B A;  2XKO A;  3KEQ A;  2HWV A;  3GEZ A;  2HTS A;  3MCZ A;  4XRF A;  1G3W A;  4PGH A;  2FEZ A;  3OV8 A;  3QAH A;  5HDK A;  2FRH A;  1L3L A;  2IP2 A;  1U8R A;  3WE2 A;  3FX3 A;  1Z6T A;  4KIG A;  4HX4 A;  3BRO A;  2Z9O A;  3KLO A;  2NS0 A;  1YYV A;  2E7X A;  3L00 A;  2VC0 A;  4CZZ A;  3VOE A;  2GA2 A;  4WX9 A;  3BZ6 A;  3LFK A;  4EQQ A;  3V8J A;  4KT5 C;  4HF2 A;  1OYY A;  1XDS A;  1RI7 A;  1KGS A;  1ZYR F;  5FLX Z;  1YQA A;  2EFP A;  2P8T A;  2DW4 A;  5DD4 A;  5JI6 A;  3C1D A;  5L3D A;  3MFK A;  1EH6 A;  2L54 A;  1DPU A;  1R58 A;  2FA5 A;  4Q4Z F;  1QZY A;  1QNT A;  1XGM A;  1ZGJ A;  4L5J A;  4RB3 C;  3HOS A;  1FYM A;  2ZXJ A;  2ZBK A;  2P6T A;  4ZH4 F;  3WTX C;  1W5S A;  2DLL A;  1F9N A;  3U2R A;  4I01 A;  5DUI A;  2ZFW A;  1B6A A;  3KP3 A;  5LHG A;  5E8G A;  5JVT A;  1WWX A;  1JE8 A;  4RGS A;  2XKP A;  4G94 A;  1SFU A;  3J80 K;  2D45 A;  3F22 A;  2CG4 A;  4A0Y A;  1YS7 A;  4AIH A;  3F8M A;  1IZ1 A;  2ZKZ A;  3IWF A;  1IN4 A;  3QP6 A;  1YW7 A;  2ZNZ A;  2A68 F;  3ERE D;  4G6D A;  4ENJ A;  4OIQ F;  5D5W B;  1PDN C;  2D1V A;  4I7H A;  4LG0 B;  3H92 A;  1HW2 A;  4WK8 F;  1IN8 A;  5CJ9 A;  3TOB A;  1G3S A;  3WGI A;  1P4W A;  1IXR C;  1GXQ A;  4F7Z A;  3FZV A;  1BIA A;  2QQ9 A;  2XAQ A;  3V8L A;  4HX7 A;  1XGO A;  3EQL F;  2CWE A;  2W24 A;  1MKM A;  3WGH A;  4UV8 A;  1J9I A;  4LLN A;  4RAZ A;  1ZRD A;  1KYZ A;  3D5L A;  4RGU A;  1SMY F;  4RB1 A;  1OPC A;  3I58 A;  1KYW A;  2FBI A;  3ZPL A;  2HQN A;  4MNU A;  1MD0 A;  4M71 A;  5E1Z B;  5ICE A;  1XN7 A;  5LLQ A;  1XMA A;  2R3S A;  4I0A A;  5L3B A;  4U0Y A;  3F6V A;  4IF4 A;  3IKV A;  3N97 A;  1BI3 A;  1QQI A;  1W4M A;  4XLP F;  3LA3 A;  1YW8 A;  2DO7 A;  2XAF A;  5D5U B;  1IF1 A;  3KFW X;  1D8K A;  2EV6 A;  3ZMS A;  2HKO A;  4I2O A;  1WRJ A;  1XCV A;  3VFZ A;  4OOI A;  2XGX A;  3LQR A;  2DK5 A;  2CGP A;  1WQ2 A;  3E6M A;  2EFN A;  2PMU A;  1YLF A;  2NNN A;  2GZW A;  2XIG A;  2MH2 A;  4ASN A;  4HF0 A;  2STT A;  1W5T A;  3F8F A;  4GXO A;  4A0Z A;  1NHA A;  3GFM A;  3E97 A;  1ZLK A;  2WC2 A;  4JK1 X;  1RIO H;  2CW0 F;  4XSZ F;  5K5Q A;  5FFZ A;  2EA2 A;  1TQP A;  4IXA A;  3ZN0 A;  3F6O A;  3ELK A;  2CSO A;  5CLS A;  5CYV A;  1IN7 A;  3BY6 A;  2Y75 A;  3W6J B;  1ZH5 A;  3C18 A;  4B09 A;  1P4X A;  3EET A;  1Z7U A;  5LGN A;  2F5E A;  4MQV A;  4XBF A;  1H9G A;  2XAS A;  5L3F A;  1R5G A;  3MZH A;  2GIV A;  4ENM A;  2GQQ A;  3ZQ7 A;  4A12 A;  1IRG A;  2LSO A;  1Z6R A;  2KJB A;  4GCV A;  3QP5 A;  4ON0 A;  3RKY A;  4KN7 X;  1LDJ A;  1E17 A;  1W7P A;  3J80 Z;  2A61 A;  2VN2 A;  3BPX A;  3HYI A;  2VOO A;  3ROU A;  2VC1 A;  1FZP B;  4JQF A;  2DPD A;  2ISZ A;  1P92 A;  1SD7 A;  4RB2 C;  3TO9 A;  3GVA A;  1XB4 A;  4RGR A;  3CLO A;  3CO6 C;  4KA4 A;  1TQM A;  3IC7 A;  4NHJ A;  3W6K B;  1MZB A;  3ZMU A;  3KCC A;  1BIB A;  5CVU A;  4Q48 A;  2RC4 A;  1YFH A;  5ILU A;  4WXC A;  1FBS A;  3DXJ F;  3T1B A;  4UV9 A;  5J6X A;  4L9J A;  2BBY A;  4ESF A;  1IN5 A;  1KU3 A;  2W85 A;  3CJN A;  4QLC U;  2QQA A;  2YSR A;  3GX4 X;  2X0L A;  5D5X B;  2RVC A;  3HTU A;  5L3G A;  4UVB A;  3WOD F;  2QUF A;  3B02 A;  4HOB A;  1K6O A;  3RPU A;  4FX4 A;  4Y13 A;  3WTW C;  3EDP A;  3VOD A;  2FE3 A;  2EA4 A;  4LB6 B;  3FXR A;  2F5D A;  2FBH A;  4P9F A;  2Q2E A;  1I5Z A;  3GFI A;  3V8K A;  5HS8 A;  3G73 A;  4LGW A;  4ZZD A;  1HBX G;  4Z2Y A;  2HS5 A;  2A07 F;  3DPT A;  5HLG A;  2XVC A;  2HTJ A;  3F23 A;  2DK8 A;  4L9T A;  2ELH A;  1IXC A;  4MQ9 F;  1TTY A;  2HYG D;  4G6Q A;  5FGM A;  2O6G E;  3F72 A;  5A2Q K;  3I59 B;  1DPR A;  3GF2 A;  3OOP A;  4WWC A;  3T0Y A;  4HQM A;  5H6Q A;  1GVJ A;  3ULQ B;  1MDM A;  1RNL A;  2HYF A;  3KEO A;  2V1U A;  2HKX A;  5K5O A;  1FT9 A;  3TOA A;  1EV7 A;  2RKH A;  4YFX F;  2F2E A;  2FBK A;  4LFU A;  4ENN A;  2CQK A;  3IHU A;  2VOD A;  3FMS A;  4HBL A;  3M7G A;  4RS8 A;  1SAX A;  1AWC A;  1XSD A;  2XHK A;  4ZYE A;  3CUQ C;  3K1N A;  1OYW A;  1SD4 A;  1B4A A;  2IT0 A;  4JBA A;  2QYO A;  3HSE A;  4A5N A;  2G7U A;  2FSW A;  5ERI A;  4M6Y A;  5D4R A;  3P9K A;  4TV7 A;  2QBY B;  1STZ A;  5D8K B;  5D6F A;  1VTN C;  1RUN A;  1LQ1 A;  4HV5 A;  2JPC A;  2V1D A;  2XV4 S;  4OIR F;  1D5V A;  3LAJ A;  2A5Y B;  1P4A A;  3U1D A;  1FBQ A;  2CYY A;  3K69 A;  3G3Z A;  1TNT A;  5DYM A;  3JW4 A;  1JHH A;  2P4W A;  3KP4 A;  4WCG A;  3C3W A;  5HVQ C;  2UWM A;  4L9N A;  2DU9 A;  3CUQ B;  5EEH A;  5BPD A;  1JXS A;  4EJO A;  1ON1 A;  2R7D A;  2DBB A;  4H0E A;  2OAZ A;  3GFL A;  5FD5 A;  4S04 A;  2L02 A;  3I4P A;  2QLZ A;  3DF8 A;  4A6E A;  3RTR A;  1FY7 A;  4LLL A;  3B73 A;  3TDZ C;  3O3K A;  4AD9 A;  3FXQ A;  3K1M A;  1ZG1 A;  2BGC A;  2BV6 A;  2JTV A;  5BPI A;  2H6C A;  3E3V A;  1UHW A;  4HV6 A;  2GXB A;  2P7C B;  3HRT A;  1LNW A;  1XGS A;  2JSC A;  2L4A A;  1UFM A;  4N9H A;  2MLK A;  3IWZ A;  2A6E F;  4CHU A;  3JAM K;  2DI3 A;  4P5O A;  2K4J A;  1H9T A;  1O3S A;  2O8X A;  4KNY A;  4G7H F;  3JSP A;  3H3Z A;  4CYD A;  1S7O A;  4ZZL A;  2UXN A;  5K1Y A;  1MJ9 A;  1R7J A;  3RI4 A;  4UUV A;  5A2Q Z;  4U7D A;  4OIO F;  1TBX A;  5E1W A;  4P96 A;  1HSJ A;  5E8I A;  4O6J A;  1R5H A;  4FX0 A;  1KQ9 A;  3ML6 A;  3R0J A;  2Q8K A;  4HF1 A;  2K86 A;  2RNJ A;  3S2W A;  1T6S A;  2EV0 A;  4HLX A;  2HR3 A;  2YX4 A;  4I09 A;  5ED4 A;  3BWG A;  5BQT A;  1UCR A;  3EYY A;  1I1G A;  3I5U A;  2HZT A;  2Y48 A;  3EYI A;  1Y0U A;  3K2Z A;  1ONV A;  4KN4 X;  4MEX F;  2M8E A;  5DCM A;  2HOE A;  2A3S A;  2WWY A;  2OA4 A;  2PLY A;  5FFX A;  2L01 A;  4PCQ A;  2OD5 A;  3CTA A;  5L3C A;  3T8T A;  2OQG A;  4IRI A;  2NRA C;  3RPQ A;  2DPU A;  4CGZ A;  4PDK A;  3HSF A;  3ZMT A;  2J5O A;  3RYP A;  3LA2 A;  4AIJ A;  1RUO A;  4OIN F;  2VT2 A;  3R61 A;  2STW A;  1R1V A;  4EJW A;  1FX7 A;  3BPV A;  2K7L A;  1REP C;  3WTZ A;  4M72 A;  1BM9 A;  4XSX F;  2ZO4 A;  2QVO A;  2M30 A;  2QEN A;  4G7O F;  4N9I A;  1JGS A;  1W7P D;  2PN6 A;  3E6D A;  4L5I A;  1ZG5 A;  3HOT A;  2VBX A;  1WI9 A;  3L7W A;  4HW0 A;  4BAY A;  4G7Z F;  2V9V A;  5DDG A;  4U88 A;  2ACJ A;  1T0F A;  3HHH A;  1FLI A;  4EM2 A;  2O3F A;  2RV8 A;  1T98 A;  2M45 A;  4MGR A;  1F5T A;  4ETS A;  1U5T C;  2H94 A;  2MLG A;  3ZP5 A;  1L0O C;  1FPQ A;  3J81 K;  2ESH A;  1S8N A;  3FF5 A;  3WTY C;  1LEB A;  1YW9 A;  3C7J A;  3GLX A;  1I27 A;  3Q5F A;  5LHH A;  4I0B A;  4O3M A;  1ZAO A;  2V6C A;  4R8H A;  2O03 A;  5E18 F;  4L0Y B;  1B59 A;  4EJU A;  1O57 A;  4LG0 A;  3RYR A;  1FP1 D;  2LNB A;  2ISY A;  3E6C C;  1GXP A;  1T38 A;  2HGC A;  5J8F A;  1S3J A;  1UB9 A;  2IA1 A;  2EK5 A;  3JAM Z;  5IT3 A;  3KLN A;  2IA0 A;  1BC7 C;  1PP8 F;  3WTV C;  3O2P E;  2VBW A;  3DQV C;  4BHC A;  1ZRC A;  1U5T B;  2E7W A;  2W84 A;  4YG2 F;  3WTU C;  2QWW A;  3K0L A;  3P9C A;  1BI0 A;  2A6H F;  2O0Y A;  1HW1 A;  3WU0 A;  1IW7 F;  1XSX A;  1XD7 A;  2OZU A;  2XAG A;  1FNN A;  4DQ2 A;  1V4R A;  5LGT A;  5D8L B;  4MHG A;  4LMY A;  4R1H A;  2LF8 A;  3TO7 A;  3I0T A;  5TRD A;  2VON A;  3RDI A;  1O7F A;  4YFN F;  4YFK F;  3ZMV A;  1OKR A;  3GO5 A;  1K78 B;  2NYX A;  2V79 A;  3WTT C;  4CO8 A;  4G9Y A;  1FC3 A;  4M9S A;  1EH7 A;  3SZT A;  1HXD A;  1K7A A;  4Q47 A;  4MTD A;  1CF7 B;  1G6N A;  1R1U A;  3HTS B;  5HOO A;  1J75 A;  2ZME B;  2C6Y A;  2FML A;  1LDD A;  4BYY A;  5L3E A;  3DKW A;  2IRF G;  2FF4 A;  4IRH A;  3TKY A;  2E1C A;  2NAZ A;  3QOP A;  2QM3 A;  2BEO A;  4M74 A;  2RGV A;  1MJA A;  4KMF A;  2EFW A;  4D0P A;  4Q5S F;  4LK0 F;  4HDV A;  2L3D A;  5IT9 K;  3TGN A;  5EEG A;  2EB7 A;  3QU6 A;  2R7F A;  3I71 A;  5E17 F;  2H27 A;  3FM5 A;  4WXH A;  2WTE A;  5J8C A;  4L0Z B;  2H09 A;  3F8N A;  3P9I A;  1ZAR A;  2VXZ A;  4K2E A;  4ENK A;  3DFG A;  4HLY A;  3QPT A;  4L18 B;  4KIF A;  5TJJ A;  1B9N A;  2KIU A;  1R00 A;  2B0L A;  2OU2 A;  3ABT A;  1UHM A;  1AOY A;  2IA2 A;  3IL2 A;  5AIQ A;  3HRU A;  3HRS A;  1QZZ A;  1USS A;  3CDH A;  1KU2 A;  5E1X A;  1R22 A;  3J81 Z;  3U9G A;  5DCF A;  5D5V B;  2OZ6 A;  2D2W A;  1FP2 A;  2YR2 A;  1Z91 A;  3TO6 A;  1ZGA A;  1LJ9 A;  2GWR A;  1XMK A;  4RAY A;  1F1Z A;  3RKW A;  2LDU A;  2P5L C;  1ZHF A;  3L2C A;  5BOX A;  2AXL A;  5E20 A;  3RJP A;  3WTS C;  5K5R A;  1FWZ A;  5HS9 A;  5DD8 A;  2FMY A;  2VBZ A;  4M9X A;  2BE5 F;  2PQ8 A;  1BOA A;  1XSV A;  4BHB A;  2J5P A;  3AAF A;  2EV5 A;  5DV5 A;  3FHZ A;  4EM0 B;  2YPR A;  4HZF A;  1OMI A;  1FSH A;  1DDN A;  4XLN F;  4A5M A;  4EM1 A;  2G7H A;  3RKX A;  2P6S A;  4IHT A;  4DNC A;  5JHU A;  5CVV A;  2GAU A;  4AIK A;  1UST A;  2GXG A;  1HST A;  1P2F A;  4KMU X;  1G4D A;  4EGY A;  2WV0 A;  1R36 A;  2K4B A;  5LBQ A;  3K1P A;  2VE8 A;  3LAP A;  2P5V A;  3KP5 A;  5FO5 A;  2XRO A;  5H6R A;  5LHI A;  2RDP A;  2FNA A;  1ULY A;  3NRV A;  5CVI A;  3DPL C;  3KET A;  3CO7 C;  1ZLJ A;  5CVR A;  2EFQ A;  2GA1 A;  4GGG A;  1YO5 C;  3KZY A;  3Q9V A;  2Z33 A;  3ZN1 A;  3I59 A;  1HKQ A;  4Y15 A;  2FOK A;  1CGP A;  2VE9 A;  5DCM B;  3HSR A;  3ISP A;  4S05 A;  5BMZ A;  3REO A;  3WE3 A;  4U0W A;  4U7B A;  2HFH A;  1TNS A;  1O3R A;  3F8B A;  2A69 F;  2AS5 F;  4FT8 A;  1J0R A;  4HDU A;  2KKO A;  4M73 A;  2DQR A;  2ESN A;  3GUD A;  4O5V A;  2EFO A;  4MTE A;  2MH9 A;  2KIF A;  2LKP A;  3MZY A;  1H0M A;  4HYE A;  4BXU A;  5FB2 A;  5H20 A;  2Z5U A;  1O3T A;  1F4K A;  5IT9 Z;  2O61 A;  3KP6 A;  2XUB A;  3GWZ A;  1SFE A;  3KZZ A;  4BHP A;  1QGP A;  3R4K A;  1I6X A;  2ETH A;  2ZJ2 A;  2OQR A;  3TDU C;  3BP8 A;  4BQA A;  3GYH X;  4AVP A;  3F3X A;  3M8F A;  4HX8 A;  2QBY A;  4KFC A;  1IRF A;  4CDG A;  4PZJ A;  3COA C;  2D1H A;  3SFZ A;  5ICC A;  1Z05 A;  2JT1 A;  1TQI A;  3GZ5 A;  3J7A O;  4KIB A;  3MQ0 A;  2HQR A;  3E5U A;  3FWE A;  3V7R A;  4ZYD A;  3E5X A;  1KU7 A;  1J59 A;  4EMS A;  5HDN A;  1LDK B;  4BNC A;  3IKT A;  4HA8 A;  3FMQ A;  1YG2 A;  3ECH A;  3CUQ A;  4EV0 A;  5D6E A;  2COM A;  2PBI A;  4ESJ A;  3V4G A;  4U0V A;  3TQN A;  4HQE A;  1XCB A;  3ECO A;  4KYW A;  3LWF A;  1SFX A;  2FU4 A;  5FD6 A;  1G3T A;  1KQ8 A;  3M1E A;  1E2X A;  3JTG A;  5KVR A;  1MJB A;  1WKM A;  4IHS A;  1DP7 P;  5F64 A;  3QU3 A;  3NQO A;  2XAJ A;  4LK1 F;  3KP2 A;  1ON2 A;  3PQJ A;  1U3E M;  1YIO A;  4GYG A;  3JSO A;  3LQQ A;  2IPQ X;  2YU3 A;  5F6F A;  2W57 A;  2KRF A;  1X3U A;  1W7P B;  3F8C A;  3MAJ A;  1HW5 A;  2JRT A;  3D0S A;  4HAM A;  1BJA A;  3VB2 A;  2KJC A;  2RQP A;  4FHT A;  1P6R A;  1K79 A;  3NEU A;  3O6B B;  1IXS B;  4OU0 A;  2EJR A;  4OMY A;  1FBU A;  3M8E A;  1J5Y A;  1DUX C;  1HKT A;  1QO0 D;  3GZ6 A;  2MA3 A;  5ICF A;  2IJL A;  2VBY A;  3GW2 A;  2QZ8 A;  1A04 A;  2V1X A;  3RIR A;  4YII A;  1O3Q A;  1G3Y A;  1TLH B;  5HS7 A;  2PG4 A;  1XDU A;  3EUH A;  3K9T A;  1KA8 A;  4UHT A;  4KUM A;  4LB5 A;  1ZN2 A;  1TW2 A;  3I54 A;  1LEA A;  3L09 A;  1V3F A;  3DV8 A;  3T5X A;  3IRR A;  4G8X A;  3N4M A;  3LA7 A;  1YS6 A;  4A2U A;  1RZ4 A;  5ILS A;  3PQK A;  1C0W A;  3FMR A;  3V7S A;  3MWM A;  1Z1D A;  2FQ3 A;  1HKS A;  1D8J A;  2EWN A;  2CO5 A;  2IVM A;  2F5C A;  2Z99 A;  3SQN A;  1T39 A;  2PEX A;  3WU1 B;  1EH8 A;  4NB5 A;  4EJV A;  2FXA A;  1Z9C A;  1PP7 U;  4EJT A;  4Y17 A;  1LVA A;  4PGG A;  1SD6 A;  3I64 A;  1T2K A;  1BN5 A;  1ZRE A;  3SZP A;  4LD5 A;  4A0X A;  5KK1 A;  4I02 A;  4RGX A;  1MGT A;  3GXO A;  3MEX A;  2PFB A;  2VOP A;  3BDD A;  2NNY A;  3V7C A;  2YX7 A;  1YTY A;  2JZY A;  5LEJ A; 
#chains in the Genus database with same CATH topology
 5AON A;  2MVT A;  3HM5 A;  4UVC A;  2ELK A;  3ZQH A;  4OAY A;  3DEU A;  3DP7 A;  2BYV E;  3L2W A;  1D3Y A;  5CVJ A;  3JTH A;  2Q0O A;  1M1E B;  3PFY A;  5ICG A;  2ADU A;  2L9S A;  1BBY A;  1B9M A;  1MDM B;  1GVD A;  3ABL H;  2ZNY A;  1OJL A;  3WGG A;  2UXX A;  2CFX A;  2PI0 A;  2MD5 A;  2MFZ A;  2B63 J;  1U78 A;  5LEK A;  4R79 A;  2K27 A;  5F1R A;  2BVM A;  2JSP A;  3OS1 A;  3G6E I;  2LF7 A;  3BC8 A;  4M6X A;  5D4S A;  1O7L A;  3R60 A;  4IRG A;  1U9O A;  4B44 A;  1OR7 A;  1GHC A;  2GOX B;  5BS6 A;  3CF2 A;  2XAH A;  1QBJ A;  3WG9 A;  3ABM H;  1X1P A;  2Y30 A;  5HNH A;  1UG2 A;  4LJZ F;  2DT5 A;  1GUU A;  3OR1 C;  4IJA A;  1R4M B;  4A3M J;  2DAO A;  5JR3 A;  1KQ0 A;  3BTL A;  3GCM A;  1WSU A;  4Y3O A;  2LVS A;  1WJD A;  1FSE A;  3T8R A;  1FYL A;  1SMT A;  5IYD J;  4LLG F;  3QRF F;  3IH3 A;  1BI2 A;  4A3B J;  4CXF A;  1MBG A;  2F5F A;  3QPS A;  4N0B A;  2UZK A;  3HGG A;  3KE2 A;  1JKP C;  2HDC A;  5DEQ A;  1U6G A;  2K40 A;  5FLX K;  4GYI A;  3H3U A;  1FIA A;  1S7A A;  5JLW A;  3E6B A;  5AIP A;  4IHV A;  1A5J A;  1JKQ C;  2DQL A;  4RBO A;  4IVN A;  1GV5 A;  3HIF A;  2M87 A;  5HLH A;  3BJO A;  3SEZ A;  3CDL A;  3TP0 A;  3ASN H;  1U2W A;  4JOM A;  2R7V A;  4BEH A;  1IAW A;  3CUO A;  1AKH A;  4WXD A;  2EQR A;  4LG3 A;  4BH9 A;  2X4H A;  2G9W A;  3OIQ A;  3FXU A;  4KIC A;  4OMZ A;  2Y0M A;  3GTM J;  4B47 A;  4FE7 A;  3G4S I;  5M5W J;  2KPM A;  3F21 A;  2O5R A;  3Q9S A;  4XOR A;  3VWB A;  1HQC A;  4LIU A;  2CUJ A;  1OYI A;  4KDP A;  4M3F A;  1QPI A;  3SJM A;  3GTK J;  3CMY A;  1D0X A;  5TIS C;  4AWX B;  4UNO A;  1LB2 A;  1P7I A;  3OMY A;  3OWT A;  5JFR A;  3S1N J;  3W2A A;  4D5F A;  1U5T A;  2P7V B;  2JPB A;  2BY1 A;  2WAF A;  4MLO A;  2HEO A;  3A03 A;  4IPA A;  3HHG A;  2E1N A;  2RN7 A;  2IW5 A;  1KU9 A;  1BR4 A;  3E5Q A;  2DFI A;  4M9Z A;  2IGK A;  4DW6 A;  3H3V K;  1LE8 B;  3R0A A;  5LRS A;  1I39 A;  3S1M J;  2KIM A;  3KYL A;  4HG2 A;  4ESB A;  5GTI C;  4EGZ A;  5F0C A;  4WF2 A;  3ABK H;  3L9F A;  4A6D A;  3CCM I;  1ODD A;  3BJ6 A;  4P55 A;  3C2H A;  3K4B A;  2CRG A;  5ILV A;  2TCT A;  1JT0 A;  1VND A;  3OYL A;  2MC3 A;  4A3I J;  4BJ5 C;  2ZCW A;  1FOK A;  2X85 A;  3SEQ A;  2CS3 A;  3HRM A;  1RR7 A;  1D1C A;  1B1B A;  1MMG A;  2MBF A;  1IUY A;  4YIF A;  2YU9 J;  1QPM A;  3ABU A;  3P7N A;  4QIW N;  2P5K A;  5LRR A;  4XLC A;  4XKV A;  2WY7 Q;  3HUG A;  2PJP A;  1A35 A;  1OCO H;  5DUK A;  1JHF A;  4P9U A;  3FDY A;  5DS9 A;  2M1B A;  1VQM I;  2EZK A;  1BC8 C;  2DTR A;  2F48 A;  2JWT A;  1S29 A;  4B8X A;  1K78 A;  4JX5 A;  3LFU A;  3HEF A;  2K02 A;  1R1T A;  3I53 A;  1BI1 A;  4ZYA A;  1YI2 I;  5M3M J;  4B43 A;  4CIC A;  2FNP A;  3AG1 H;  4IZZ A;  4ZYH A;  4AU7 A;  3SXY A;  4NQW A;  2DA7 A;  3HKZ N;  1BJZ A;  1FTZ A;  4LIV A;  4UVA A;  5M5X J;  1J7K A;  1CF7 A;  3I4M J;  4I98 B;  3SHF A;  2PMH A;  2QQB A;  2X1E A;  3QPH A;  3ZMZ A;  5LGU A;  2LC2 A;  3CZ6 A;  4I76 A;  4NC8 A;  3ERM A;  1I1S A;  3PO3 J;  2KIS A;  3FM3 A;  4BXF A;  2V6E A;  2LFB A;  2ZME A;  3W6V A;  4E70 A;  2VT3 A;  3MKW B;  3VEP A;  1XGN A;  5CQG A;  1VQ5 I;  3PFI A;  2B9S A;  1SFO J;  4UXN A;  3ZMD A;  1TW3 A;  3LST A;  3R6S A;  2L4M A;  2LMD A;  1J2X A;  5EGO B;  1ZG3 A;  4QWQ A;  6PAX A;  4P1W A;  4GO1 A;  4M6V A;  3IRQ A;  2W25 A;  4A3F J;  1P7J A;  1Q1H A;  1S6L A;  1R23 A;  4ZYG A;  5HDG A;  4OIP F;  4L9V A;  1IN6 A;  1WH5 A;  2OBP A;  5HLI A;  2YS9 A;  1N78 A;  1H8A C;  1ZRF A;  1SD5 A;  2M5W A;  1B72 A;  3BOQ A;  2DMN A;  2DT7 B;  2XRN A;  3M9A A;  2Z2S B;  1VQ7 I;  4RB0 A;  1DGR M;  2UUZ A;  4II3 A;  4N4O B;  4EAT A;  2E34 A;  4MEY F;  1MND A;  3KPH A;  3CES A;  2Z3Y A;  1Y0N A;  4EVI A;  1FYK A;  1PUE E;  2E35 A;  2TDX A;  3KP7 A;  3G1M A;  2LRD A;  4H4K C;  3BJA A;  3LSP A;  3GFJ A;  1FTT A;  4KIT B;  2H6B A;  3DKY A;  2XKO A;  3KEQ A;  1X3Z B;  2HWV A;  3A0B C;  3GEZ A;  2LTP A;  2HTS A;  1ETK A;  1QHH D;  4V2G A;  3MCZ A;  1PYV A;  2VPL A;  1BW5 A;  4XRF A;  1G3W A;  4PGH A;  2FEZ A;  3OV8 A;  4QSH A;  4DBR A;  3QAH A;  5HDK A;  2FRH A;  2JA8 J;  1UEL B;  1L3L A;  2IP2 A;  3MVP A;  4XRM A;  3AG3 H;  3S93 A;  1U8R A;  2HDD A;  2R92 J;  3WE2 A;  3FX3 A;  4XRS A;  1Z6T A;  4KIG A;  1F36 A;  2NOJ B;  2L0K A;  1X3W B;  2FX0 A;  2OCE A;  4HX4 A;  4GRI A;  3BRO A;  2Z9O A;  2X9D A;  2EIJ H;  1I3Q J;  5GAE J;  1B8I B;  3KLO A;  2NS0 A;  1Q1V A;  2WAD A;  3BCA A;  4W1U A;  1EA3 A;  2XC7 A;  1T0F C;  1YYV A;  3S15 J;  3BR6 A;  2HQA A;  2E7X A;  3L00 A;  2VC0 A;  4CZZ A;  3HOX J;  2M34 A;  3VOE A;  2GA2 A;  3JRI A;  4WX9 A;  1UG0 A;  4V19 K;  2JK3 A;  1MSE C;  3TP3 A;  3BZ6 A;  3LFK A;  4EQQ A;  3V8J A;  2BHZ A;  4KT5 C;  4HF2 A;  3K10 A;  2OTJ I;  3JRH A;  1WJC A;  1BW6 A;  4PJN A;  1OYY A;  4MO7 A;  1XDS A;  2DCE A;  1RI7 A;  1KGS A;  1ZYR F;  1TWC J;  4AVZ A;  4KJZ A;  3DU6 A;  1MBH A;  3ONQ A;  5FLX Z;  1YQA A;  2R0Q C;  4CYC A;  2EFP A;  2P8T A;  2DW4 A;  2HPI A;  5DD4 A;  5JI6 A;  3CP8 A;  1X1C A;  2VKV A;  3C1D A;  4Y52 J;  5L3D A;  3IV5 A;  1WJA A;  3MFK A;  2D5V A;  1EH6 A;  3GME A;  2L54 A;  1DPU A;  2QCO A;  1R58 A;  1NK2 P;  1P9Q C;  1WJ5 A;  1E3P A;  2FA5 A;  4Q4Z F;  1QZY A;  1QNT A;  1OCT C;  3CQZ J;  1XGM A;  1ZGJ A;  4L5J A;  4RB3 C;  3HOS A;  2N8G A;  4ZDL A;  3S3N A;  2XPV A;  1FYM A;  2JA7 J;  2ZXJ A;  2ZBK A;  2P6T A;  4ZH4 F;  4D1Q A;  1ACI A;  3WTX C;  1W5S A;  2DLL A;  1F9N A;  3U2R A;  3DBL B;  4I01 A;  5DUI A;  2KMU A;  5HOD A;  3NWT A;  3CC4 I;  5J1Y A;  2ZFW A;  1B6A A;  4Z6Y A;  3KP3 A;  4BL0 B;  3U1K A;  5LHG A;  3FIS A;  5E8G A;  1Z77 A;  1IC8 A;  5B1B H;  5JVT A;  5GTH C;  1MMD A;  3FXM A;  1WWX A;  1JE8 A;  3OYJ A;  4RGS A;  4UUS B;  2M35 A;  1X2M A;  2XKP A;  4G94 A;  1SFU A;  3CC7 I;  2OCC H;  3J80 K;  2D45 A;  4F55 A;  3F22 A;  2CG4 A;  4A0Y A;  1N25 A;  1YS7 A;  1O4X A;  3FKI J;  1PUF B;  1JJ6 C;  4XKW A;  3B6C A;  1IV6 A;  4AIH A;  3CF5 F;  2HXI A;  5K7H A;  3K4J A;  4DZP A;  2R5Y A;  3LMM A;  3ZQG A;  3F8M A;  1IZ1 A;  4M3D A;  5LD2 C;  2ZKZ A;  3IWF A;  4UB8 C;  3LSI A;  3GTQ J;  1IN4 A;  3TMO A;  3QP6 A;  1YW7 A;  2EIN H;  2ZNZ A;  2A68 F;  3ERE D;  4G6D A;  4ENJ A;  4OIQ F;  5D5W B;  3H0D A;  1PDN C;  4QPO A;  5LFA A;  4JX4 A;  2D1V A;  3OS2 A;  2JVG A;  4I7H A;  1TWH J;  4LG0 B;  2VIX A;  3H92 A;  1HW2 A;  4WK8 F;  3S1Q J;  1IN8 A;  5CJ9 A;  3TOB A;  3E1S A;  2CJJ A;  2HU9 A;  5F27 A;  1G3S A;  2KRH A;  3DKX A;  3WGI A;  1YHQ I;  1D5Y A;  1P4W A;  1IXR C;  1ZTR A;  1GXQ A;  1X58 A;  3JRB A;  2CV1 A;  3PIO F;  1QA6 A;  4M3B A;  2XGD A;  1QZE A;  4F7Z A;  3FZV A;  2MW8 A;  1BIA A;  1JUS A;  3GBG A;  2QQ9 A;  2XAQ A;  3V8L A;  3ZR8 X;  4HX7 A;  1VI0 A;  3HOV J;  3PNT A;  1XGO A;  3EQL F;  4XR6 A;  4C3J J;  2MZ4 A;  2CWE A;  2GIZ A;  2W24 A;  2WAQ N;  4XLA A;  1RQ6 A;  1MKM A;  3WGH A;  4UV8 A;  2HDW A;  1J9I A;  2F4O B;  2XSD C;  2K9S A;  2VJ5 A;  1Z3Y A;  4BQQ A;  2ZXI A;  4LLN A;  4RAZ A;  1ZRD A;  4IOA F;  1KYZ A;  3L2V A;  3D5L A;  3IH4 A;  4RGU A;  1SMY F;  1VF9 A;  1MMN A;  4BJT A;  4RB1 A;  1OPC A;  3I58 A;  1KYW A;  2DJI A;  2CUZ A;  3PUB A;  3TBI A;  3I9V 2;  3HXL A;  4C2U A;  3AFH A;  2FBI A;  2V9K A;  4XN3 A;  3ZPL A;  1YRN A;  2HQN A;  4MNU A;  1I50 J;  1MD0 A;  4M71 A;  2XPU A;  1V5F A;  4F3Q A;  2Z16 A;  5E1Z B;  4X6A J;  2OUM A;  1XN7 A;  5ICE A;  1WJB A;  2NS8 A;  2WAE A;  3RQI A;  1RET A;  3V42 A;  1XMA A;  5LLQ A;  2R3S A;  3A0H C;  4I0A A;  1JJ8 C;  5L3B A;  4U0Y A;  1RKT A;  1AU7 A;  2VKE A;  2X6W A;  3F6V A;  3S1R J;  4IF4 A;  5F0H A;  3A02 A;  3IKV A;  3N97 A;  1VQ4 I;  1TT5 B;  1BI3 A;  1QQI A;  1W4M A;  3ASO H;  3ZGK A;  2H1K A;  4DJA A;  4XLP F;  3OR2 C;  3LA3 A;  3GLL A;  1YW8 A;  3CJT B;  4XL9 A;  2DO7 A;  2MD0 A;  2XAF A;  5D5U B;  1IRZ A;  1IF1 A;  3KFW X;  1D8K A;  2BHY A;  2X6Y A;  2CQQ A;  3A1Y A;  2EV6 A;  3ZMS A;  2HKO A;  3EPZ A;  2PX9 A;  4I2O A;  1WRJ A;  2L7K A;  1XCV A;  3VFZ A;  2IGM A;  4OOI A;  2XGX A;  4BS9 A;  3LQR A;  1BOB A;  2DK5 A;  2CGP A;  1WQ2 A;  3E6M A;  2EFN A;  1U9N A;  2PMU A;  1YLF A;  3LSG A;  3LSR A;  2HVR A;  5B66 C;  2NNN A;  2GZW A;  2XIG A;  2MH2 A;  3H5R A;  4ASN A;  3FBN B;  4HF0 A;  1NTC A;  2STT A;  1IG7 A;  1W5T A;  3TED A;  3F8F A;  4IEJ A;  1GT0 C;  4NDL A;  4GXO A;  4A0Z A;  1NHA A;  4XIC A;  4D5C A;  3GFM A;  3E97 A;  5B1A H;  1ZLK A;  2WC2 A;  5FRN A;  2KT0 A;  4JK1 X;  1RIO H;  1MH3 A;  1QVU A;  1DQU A;  2CW0 F;  4V2F A;  3SDB A;  5H2F C;  2DA6 A;  3CJQ B;  3BR5 A;  3OIP A;  4XSZ F;  1WHU A;  3QYF A;  5K5Q A;  1Y1W J;  3BZC A;  5FFZ A;  3VSL A;  2EA2 A;  2XF6 A;  1TQP A;  4IXA A;  3ZN0 A;  2Y69 H;  3F6O A;  1GV2 A;  3H5A A;  3ELK A;  3CCE I;  4BEH B;  2CSO A;  2OC6 A;  5CLS A;  5CYV A;  2M4K A;  1IN7 A;  2VQG A;  3S14 J;  2X98 A;  3BY6 A;  2Y75 A;  2KFD A;  3W6J B;  1ZH5 A;  2DA2 A;  2JJ7 A;  3C18 A;  4NC6 A;  4B09 A;  1R9T J;  4FQG A;  3FKJ A;  1P4X A;  1ZEL A;  3EET A;  1JI8 A;  1Z7U A;  3AG2 H;  5LGN A;  2F5E A;  4MQV A;  4XBF A;  1H9G A;  2DJN A;  4FIS A;  2XAS A;  5L3F A;  1R5G A;  1JTX A;  3MZH A;  1N77 A;  2GIV A;  4ENM A;  3K70 C;  2GQQ A;  2W82 A;  3O8G A;  1MBF A;  3ZQ7 A;  4A12 A;  1IRG A;  2LRE A;  3G71 I;  3CME I;  4OAZ A;  4XLH A;  2LSO A;  1Z6R A;  2KJB A;  4E7L A;  2R7Q A;  4GCV A;  3QP5 A;  4ON0 A;  3RKY A;  4KN7 X;  1LDJ A;  1E17 A;  1W7P A;  3FXJ A;  3J80 Z;  4C2M J;  2A61 A;  2VN2 A;  3BPX A;  3HYI A;  1SEU A;  2VOO A;  5IP7 J;  2O9L A;  3ROU A;  2PMZ N;  2VC1 A;  1FZP B;  1LFP A;  3Q0V A;  4JQF A;  2DPD A;  2ISZ A;  1HC8 A;  2XSJ C;  2DDA A;  2Y2Z A;  1P92 A;  2OJE D;  3AKZ A;  1SD7 A;  2X1D A;  3TW7 A;  1D1A A;  2QF7 A;  4RB2 C;  3A52 A;  3TO9 A;  3GVA A;  4G12 A;  3S3M A;  4CSW A;  4A3L J;  3DTE A;  1MMA A;  1XB4 A;  4RGR A;  2X48 A;  3CLO A;  2VUM J;  3CO6 C;  4KA4 A;  1ETY A;  2L9V A;  1TQM A;  3IC7 A;  3OYN A;  4NHJ A;  3N05 A;  4XMY A;  3ZQF A;  3W6K B;  1MZB A;  4DZJ A;  3ZMU A;  3KCC A;  1EJ9 A;  4A3J J;  4ANJ A;  1BIB A;  3VYU B;  5CVU A;  4Q48 A;  2RC4 A;  1YFH A;  1XS9 A;  1MH4 A;  2EZL A;  2RRE A;  4HNV A;  5ILU A;  4XN0 A;  4WXC A;  1VQ8 I;  2OPT A;  1FBS A;  3DXJ F;  4XOP A;  3T1B A;  2VB6 A;  4AYB N;  4BJ6 C;  2PMZ A;  3LL7 A;  1DU0 A;  4UV9 A;  2IS6 A;  5J6X A;  4L9J A;  2BBY A;  3KEY A;  4AM3 A;  1WJF A;  4ESF A;  5EJC A;  1IN5 A;  3CCY A;  1KU3 A;  3CDI A;  3H5N A;  4OWR B;  2DFF A;  1BA5 A;  1U0J A;  4BXX J;  2W85 A;  2JRM A;  2LKX A;  3CJN A;  3J80 R;  5KCM A;  2Y9Z A;  4QLC U;  1SC7 A;  1VQK I;  2QQA A;  2YSR A;  3GX4 X;  5FKM A;  2H8W A;  5DM7 F;  2K9L A;  2M4G A;  3W3C A;  5CKT A;  2X0L A;  5D5X B;  4HST A;  2RVC A;  3HTU A;  5L3G A;  2NVX J;  1DU6 A;  4UVB A;  3WOD F;  2QUF A;  4XRS G;  3B02 A;  3A01 A;  4HOB A;  4F91 B;  1ZK8 A;  1IUF A;  4DYR A;  2FD5 A;  2DMT A;  1K6O A;  1ZKG A;  2BY3 A;  3RPU A;  4FX4 A;  4Y13 A;  3GZN B;  3WTW C;  2ELJ A;  2ICW G;  3EDP A;  3VOD A;  2FE3 A;  2ZB9 A;  2O7O A;  2EA4 A;  2MG4 A;  3B6A A;  4LB6 B;  3FXR A;  2F5D A;  2FBH A;  3IAM 2;  4P9F A;  2Q2E A;  1I5Z A;  3GFI A;  3S2H J;  2E2J J;  2JQ7 A;  2DA3 A;  1TC3 C;  3G2B A;  3V8K A;  5HS8 A;  3G73 A;  1HCR A;  4LGW A;  3C2G A;  2L9N A;  2XB0 X;  4XLF A;  4ZZD A;  1HBX G;  1IRX A;  4Z2Y A;  2HS5 A;  3PUF A;  4XLE A;  2LD5 A;  3DPT A;  5HLG A;  2A07 F;  2XVC A;  2HTJ A;  3F23 A;  2DK8 A;  4L9T A;  3X2Q H;  3ZQC A;  1SAU A;  3D5S C;  2ELH A;  1IXC A;  1TL8 A;  2WV1 A;  4MQ9 F;  3PSI A;  1TTY A;  2LLK A;  2HYG D;  4G6Q A;  5FGM A;  2LY1 A;  2O6G E;  1HOM A;  3F72 A;  5A2Q K;  2BZT A;  4BBS J;  1VQN I;  1ZR2 A;  1UJ8 A;  3I59 B;  4CCN A;  1DPR A;  3GF2 A;  3OOP A;  4WWC A;  1D0Y A;  3T0Y A;  5GP9 A;  4HQM A;  5H6Q A;  4Y4R A;  1GVJ A;  5B5E C;  4BAC A;  3ULQ B;  3WHB A;  1RKW A;  1T33 A;  1V5E A;  1MDM A;  1WFX A;  1RNL A;  2HYF A;  3KEO A;  2V1U A;  1UMQ A;  4RA2 A;  2HKX A;  2XGC A;  4MFD A;  5K5O A;  2DTZ A;  2HQ5 A;  1FT9 A;  3TOA A;  2QA4 I;  2CUE A;  3HOU J;  1EV7 A;  2RKH A;  2GBY A;  1QRY A;  4YFX F;  1POG A;  2F2E A;  3AL0 B;  2FBK A;  1WPK A;  3SYT A;  4LFU A;  3JRD A;  4ENN A;  3HOY J;  3OL3 A;  2CQK A;  1S9H A;  1MIJ A;  1VQP I;  3GTO J;  3IHU A;  2VOD A;  3FMS A;  3LNQ A;  5FLM J;  3BR0 A;  1TWG J;  4HBL A;  2R7U A;  2M0C A;  2MAB A;  1S7E A;  3M7G A;  3I3L A;  3MMY B;  2F6C A;  4RS8 A;  1SAX A;  3PL8 A;  2JA2 A;  1FMW A;  1AWC A;  2FUG 2;  1Z3X A;  2NVY J;  2HI3 A;  1X4P A;  1XSD A;  2XHK A;  4NUB A;  4ZYE A;  5IOY A;  1NG6 A;  3CUQ C;  3K1N A;  2E1M C;  1OYW A;  4LIT A;  2R7S A;  2Y9Y A;  3S3O A;  2XF7 A;  4C3H J;  1Z67 A;  1IGN A;  4ZDP A;  1SD4 A;  5HNF A;  1B4A A;  2FQ4 A;  2IT0 A;  2ID6 A;  3I56 I;  3FBI B;  2LP0 A;  2JA6 J;  4JBA A;  2QYO A;  3HSE A;  4A5N A;  4B1R A;  1X2N A;  2FSW A;  2G7U A;  4M6Y A;  5ERI A;  5D4R A;  4A3C J;  1BL0 A;  3P9K A;  4TV7 A;  2QBY B;  3HKZ A;  1STZ A;  5D8K B;  5D6F A;  1VTN C;  4XOT A;  1GLN A;  2DOD A;  1RUN A;  2DN0 A;  1V55 H;  1X1A A;  1LQ1 A;  4HV5 A;  3JR9 A;  1R6R A;  2JPC A;  2ZXW H;  3FK7 A;  2V1D A;  2JVH A;  1RRJ A;  4XON A;  2XV4 S;  4OIR F;  4RAF A;  1D5V A;  2F5V A;  3JRF A;  1UHS A;  3K4L A;  3LAJ A;  5JLX A;  2A5Y B;  4BE0 A;  1P4A A;  3U1D A;  1K61 A;  5FRM A;  4RLQ A;  4BQN A;  3F0C A;  1KON A;  1FBQ A;  2CYY A;  3K2A A;  3ZRG A;  1A6Q A;  3K69 A;  3EUA A;  3G3Z A;  1TNT A;  5DYM A;  4E7K A;  3JW4 A;  1JHH A;  2P4W A;  2P0T A;  3KP4 A;  4WCG A;  3C3W A;  2LOO A;  1QVT A;  5FKO A;  5HVQ C;  1NH3 A;  3Q3S A;  4L9N A;  2UWM A;  1ERD A;  2DU9 A;  2EPF A;  3CUQ B;  2R4G A;  5EEH A;  2NOG A;  2E1M B;  1JUP A;  5BPD A;  1JXS A;  4C30 A;  1ORK A;  2F4M B;  4XKB A;  2H8R A;  5FKL A;  4EJO A;  1ON1 A;  3ZQL A;  5BNG A;  2R7D A;  2DBB A;  4H0E A;  4IKF A;  2OAZ A;  3KYD B;  2VLA A;  3GFL A;  5FD5 A;  5EEA A;  2VQL A;  4S04 A;  3OYF A;  5GPC A;  1XTA A;  2CQX A;  2L02 A;  1IJW C;  3I4P A;  5FRO A;  2QLZ A;  3DF8 A;  4A6E A;  3PNV A;  3RTR A;  1FY7 A;  4LLL A;  2DFE A;  2CQN A;  4FTH A;  5C4X J;  5EG0 B;  3PIP F;  4IX7 A;  3B73 A;  3TDZ C;  2DOE A;  3O3K A;  4AD9 A;  3FXQ A;  5EF6 A;  1ETV A;  4ZTF A;  3LOC A;  3K1M A;  1ZG1 A;  1ZGW A;  2BGC A;  3NAU A;  2BV6 A;  1LKX A;  2HOA A;  1D0Z A;  3CMM A;  3GTP J;  3MKZ A;  3EUH C;  2JTV A;  3RZD J;  4ITV A;  5BPI A;  2H6C A;  3E3V A;  4IL6 C;  4S0H B;  2LYC A;  4M3G A;  1UHW A;  3CP2 A;  4HV6 A;  3L2Q A;  2GXB A;  2P7C B;  2FJ1 A;  3HRT A;  4BE2 A;  1LNW A;  1XGS A;  2JSC A;  2L4A A;  1UFM A;  4N9H A;  2QSF X;  3PSF A;  2MLK A;  3BR3 A;  3IWZ A;  2A6E F;  4BE1 A;  1GDT A;  2X51 A;  2QSH X;  4CHU A;  1Y6I A;  3JAM K;  2DI3 A;  1FOX A;  4P5O A;  4CCO A;  4EEF G;  2GXA A;  3H1C A;  2K4J A;  1H9T A;  5JHF A;  1AHD P;  4UY8 I;  3CCS I;  1O3S A;  1V5G A;  2O8X A;  5EGO A;  4KNY A;  2ME0 A;  4G7H F;  3JSP A;  3H3Z A;  4CYD A;  4BKX A;  5IOZ A;  1S7O A;  2K9M A;  4ZZL A;  1W0U A;  3ZOB A;  2UXN A;  2LK2 A;  1R71 A;  3K6G A;  5K1Y A;  1JGG A;  1YIT I;  1MJ9 A;  1R7J A;  1T95 A;  2EZI A;  3RI4 A;  4UUV A;  5A2Q Z;  5C4J J;  4U7D A;  4OIO F;  1TBX A;  2QEX I;  2E36 A;  1E0E A;  5E1W A;  2R5Z B;  4P96 A;  1HSJ A;  3OYI A;  5E8I A;  2PJR B;  4O6J A;  2HNH A;  3C2B A;  3D1N I;  1R5H A;  4FX0 A;  2KLO A;  1KQ9 A;  1Y39 A;  3ML6 A;  3R0J A;  2EH3 A;  4UUT A;  2Q8K A;  2M0M A;  4HF1 A;  2K86 A;  1TP4 A;  2RNJ A;  3S2W A;  1T6S A;  2EV0 A;  4HLX A;  5FKN A;  1LVK A;  3CCU I;  1JKO C;  2HR3 A;  1UAA A;  2YX4 A;  4I09 A;  2BW3 B;  5ED4 A;  4D9J A;  1TWA J;  2KZG A;  3BWG A;  3MKL A;  2ME6 A;  5BQT A;  1UCR A;  3EYY A;  4ZTJ A;  1I1G A;  3I5U A;  3S16 J;  1WGX A;  2HZT A;  2Y48 A;  4BU2 A;  1FMV A;  2BXY A;  5IT9 R;  3QYB A;  3EYI A;  1Y0U A;  3K2Z A;  1ONV A;  4KN4 X;  4MEX F;  2M8E A;  4PJM A;  4II2 A;  5DCM A;  4HNT A;  5J4V A;  2HOE A;  2A3S A;  1MMS A;  2WWY A;  2OA4 A;  4FET A;  3K4N A;  1B8I A;  2PLY A;  5FFX A;  5K7Z A;  2L01 A;  4PCQ A;  2OD5 A;  1W5C C;  4AUX A;  3CTA A;  1Z21 A;  3NWS A;  5L3C A;  5HLT A;  3HL2 A;  3W2W A;  3T8T A;  2OQG A;  4IRI A;  1KZH A;  3KYC B;  2NRA C;  1HA8 A;  1YJW I;  3RPQ A;  1OR7 C;  2B7E A;  2DPU A;  4E4H A;  4CGZ A;  2VKH A;  1Y8R B;  5A2Q R;  1CQT A;  5EZH A;  2O8K A;  4PDK A;  3HSF A;  2P0W A;  3ZCO A;  2MGQ A;  3JRG A;  2QKM B;  2LBF B;  3UNG C;  1D1B A;  3OYK A;  2FOW A;  2LR8 A;  4NNJ A;  3ZMT A;  3VSK A;  2EIM H;  2L7Z A;  2J5O A;  3A4C A;  3RYP A;  3LA2 A;  1S72 I;  4AIJ A;  5IYC J;  1RUO A;  2ZJQ F;  2V1N A;  4OIN F;  1OQY A;  2VT2 A;  1HDP A;  3R61 A;  2STW A;  2AO9 A;  2WA0 A;  1R1V A;  2LG4 A;  1WVR A;  1K6Y A;  4EJW A;  1AA7 A;  3OYH A;  1A36 A;  1FX7 A;  3BPV A;  2K7L A;  1REP C;  1IDY A;  3WTZ A;  2L9R A;  3HC7 A;  1XMX A;  4M72 A;  1BM9 A;  2HPM A;  4XSX F;  2NVU B;  1XC5 A;  2X6O A;  2ZO4 A;  2IS2 A;  3OYG A;  2QVO A;  2M30 A;  3MN2 A;  2JUC A;  2QEN A;  5J40 A;  4G7O F;  1T08 B;  2NVT J;  4FAS D;  4N9I A;  1JGS A;  1W7P D;  2PN6 A;  3E6D A;  4L5I A;  3M3Y J;  2E71 A;  3IUO A;  1ZG5 A;  2WAQ A;  3HOT A;  2M8G X;  2VBX A;  2W4S A;  1WI9 A;  3L7W A;  4HW0 A;  1WH7 A;  4BAY A;  4G7Z F;  4E7H A;  1MBK A;  2V9V A;  5DDG A;  4U88 A;  4B3A A;  2OV7 A;  1ETQ A;  4CUG A;  2ACJ A;  1IO2 A;  1T0F A;  3WHC A;  5GAG J;  3S2D J;  3HHH A;  1Y8Q B;  4EM2 A;  4UUS A;  3OYC A;  2Q1Z B;  1FLI A;  2CQ7 A;  2V4J C;  2W7N A;  2O3F A;  3J7A W;  2HVQ A;  2RV8 A;  1H89 C;  1T98 A;  4IQJ A;  2E60 A;  1HF0 A;  5B3S H;  2M45 A;  1W36 C;  2DOA A;  4MGR A;  4A69 C;  4GDF A;  2ZJR F;  4ETS A;  1U5T C;  1F5T A;  1VQ9 I;  1PUF A;  2H94 A;  1RES A;  3DPU A;  4IQ4 A;  3AG4 H;  2MLG A;  1I6H J;  2LY2 A;  5E79 C;  3ZP5 A;  1L0O C;  4JYK A;  1FPQ A;  3J81 K;  5J4Y A;  2CV2 A;  2ESH A;  1ENH A;  1S8N A;  3VDX A;  2GOM A;  2YUS A;  1LFB A;  3FF5 A;  3WTY C;  3HBL A;  4W97 A;  5GPA A;  2RNG A;  3SDG A;  3OYA A;  4YIR X;  1ITY A;  1LEB A;  1YW9 A;  5DTD A;  3C7J A;  4MFE A;  2R7X A;  4AC0 A;  3CCL I;  2NXN B;  1YJ9 I;  3GLX A;  1I27 A;  3QYE A;  4M3E A;  3Q5F A;  5LHH A;  2M2E A;  4I0B A;  3OYM A;  4O3M A;  1ZAO A;  2V6C A;  4R8H A;  2WB1 N;  3KIO A;  2O03 A;  5E18 F;  4L0Y B;  3GTG J;  4YEL A;  1B59 A;  4FE4 A;  4EJU A;  1O57 A;  3NAR A;  4LG0 A;  1SFK A;  3RYR A;  1FP1 D;  2LNB A;  4PUS A;  2DYR H;  3BQY A;  2ISY A;  1YX5 A;  2MYS A;  3E6C C;  1GXP A;  3RPU D;  2VJJ A;  1T38 A;  1OCZ H;  1NK3 P;  1AKH B;  2HGC A;  5J8F A;  3CCQ I;  5CQE A;  4Y33 A;  1S3J A;  3RSN A;  5DM6 F;  5M5Y J;  4D7M A;  2G0E A;  4ZJZ A;  1UB9 A;  2IA1 A;  2EK5 A;  1ZR4 A;  2DMP A;  3JAM Z;  3TW6 A;  5IT3 A;  2Z1D A;  3KLN A;  2AXT C;  3VYR B;  2IA0 A;  1BC7 C;  3CCV I;  1PP8 F;  3WTV C;  3BG9 A;  3O2P E;  2VBW A;  4RM3 A;  3DQV C;  5F0F A;  4BHC A;  1ZRC A;  3DEE A;  1U5T B;  3VYS B;  2E7W A;  3K4C A;  2W84 A;  4YG2 F;  3WTU C;  3UR3 C;  2QWW A;  3K0L A;  3P9C A;  1BI0 A;  2ZME C;  4A3E J;  1MBE A;  2A6H F;  2O0Y A;  1HW1 A;  3WU0 A;  1IW7 F;  2AHQ A;  2IAI A;  1XSX A;  3H0G J;  3UKG A;  2M9H A;  4MIM A;  1WI3 A;  1XD7 A;  2OZU A;  2XAG A;  1FNN A;  2V9P A;  1J09 A;  3OOU A;  3ZQI A;  4D7N A;  3A2K A;  2LH9 A;  4DQ2 A;  4PJL A;  2HOT A;  3BG7 A;  3L2R A;  2K9N A;  1V4R A;  5LGT A;  3G1L A;  5D8L B;  3LSK A;  4MHG A;  4LMY A;  4R1H A;  2HXO A;  2IBD A;  4NBQ A;  2LF8 A;  3TO7 A;  5M3F J;  1HLV A;  1HDD C;  5FLV A;  1VQ6 I;  3I0T A;  5TRD A;  2VON A;  3RDI A;  5IPA A;  3HUG B;  2CUF A;  3U21 A;  1O7F A;  3HPG A;  4YFN F;  2ZXH A;  4YFK F;  2DA5 A;  3ZMV A;  1OKR A;  2E19 A;  3GO5 A;  2CV0 A;  1K78 B;  2NYX A;  3JAM R;  2V79 A;  1Y56 A;  3WTT C;  2EIL H;  2A6T A;  4CO8 A;  1IV8 A;  5J1U A;  4G9Y A;  1FC3 A;  4M9S A;  1EH7 A;  3H9G A;  1JTY A;  3SZT A;  1HXD A;  3OIO A;  1K7A A;  4NQW B;  4Q47 A;  3PO2 J;  4MTD A;  1CF7 B;  2OTL I;  3IP4 B;  5J3L A;  5FJ8 J;  2X6X A;  3E0J B;  1G6N A;  1R1U A;  2MC4 A;  3HTS B;  1Z0X A;  5HOO A;  4PK4 A;  1J75 A;  3HOZ J;  2ZME B;  2C6Y A;  2VPR A;  3M1C A;  2FML A;  2DT6 A;  1LDD A;  3HZJ A;  4BYY A;  5L3E A;  3J7Z I;  3DKW A;  2IRF G;  2FF4 A;  3K70 D;  3M4O J;  4IRH A;  3TKY A;  2E1C A;  2NAZ A;  1X1D A;  2XRL A;  3QOP A;  2QM3 A;  3CCR I;  2BEO A;  2JA5 J;  4M74 A;  2RGV A;  2NVQ J;  1MJA A;  4KMF A;  2EFW A;  4D0P A;  4Q5S F;  4LK0 F;  4HDV A;  3AL0 C;  5EZG A;  2R7R A;  4AYB A;  2H1L A;  2L3D A;  5IT9 K;  3DBR B;  3TGN A;  5EEG A;  3DU5 A;  2EB7 A;  3QU6 A;  1B72 B;  2K3P A;  2R7O A;  2IGN A;  2R7F A;  3I71 A;  2M3A A;  5E17 F;  2H27 A;  3FM5 A;  4WXH A;  5CPR B;  2UV1 A;  3M8J A;  2WTE A;  5J8C A;  4L0Z B;  3TL4 X;  2M7A A;  2RAE A;  3CMA I;  3QQA A;  2XB5 A;  5IYB J;  2H09 A;  3F8N A;  3K7A J;  3KX2 A;  3EUK L;  3P9I A;  1ZAR A;  2VXZ A;  4K2E A;  4ENK A;  2IS1 A;  2DXI A;  2IXS A;  3DFG A;  2I5U A;  4HLY A;  3QPT A;  4L18 B;  4KIF A;  5TJJ A;  3BLY A;  1B9N A;  2KIU A;  1R00 A;  2B0L A;  2OU2 A;  1EKE A;  3ABT A;  1UHM A;  3CCJ I;  1AOY A;  4A3D J;  3S17 J;  1WJE A;  2L5Q A;  4RMN A;  1F43 A;  2IA2 A;  2K85 A;  3BR1 A;  5C44 J;  3IL2 A;  2XF5 A;  4XID A;  5AIQ A;  2EBI A;  2R7T A;  4CCM A;  3BT9 A;  3HRU A;  3G1O A;  2E2I J;  3OYB A;  3HRS A;  2IEK A;  2LKS A;  2HVS A;  1QZZ A;  4ZDO A;  1USS A;  3CDH A;  4HNU A;  1KU2 A;  5E1X A;  1R22 A;  3J81 Z;  3U9G A;  3GTJ J;  4FCY A;  3P5J A;  1S5L C;  3HG9 A;  3ESW B;  5DCF A;  5D5V B;  2EIK H;  1Y1V J;  2OZ6 A;  2BVL A;  1W0T A;  3O8H A;  2D2W A;  1FP2 A;  1SVL A;  2YR2 A;  3LSJ A;  1Z91 A;  3TO6 A;  1ZGA A;  1LJ9 A;  4PFO A;  2GWR A;  2VKD A;  1XMK A;  4RAY A;  1F1Z A;  2DMU A;  2Y31 A;  2LDU A;  3RKW A;  4CA0 A;  1OLT A;  2L2O A;  4CYC B;  2P5L C;  1XX5 A;  1WCM J;  1ZHF A;  3L2C A;  4BDZ A;  5BOX A;  4J01 A;  2AXL A;  5E20 A;  3RJP A;  3WTS C;  5F04 A;  5K5R A;  1FWZ A;  2VQC A;  5HS9 A;  2VI6 A;  2FMY A;  5DD8 A;  2VBZ A;  4M9X A;  4A3K J;  2CW7 A;  2BE5 F;  2KHM A;  2BY0 A;  4BY1 J;  2KIQ A;  2PQ8 A;  2QKL B;  2ZSH B;  1BOA A;  3HJE A;  2GM4 A;  1XSV A;  4BHB A;  3K4K A;  2CU7 A;  1X19 A;  3Q0U A;  1PVE A;  2J5P A;  3RQ4 A;  3AAF A;  2EV5 A;  2QGU A;  3FXO A;  2JUG A;  2OF7 A;  5DV5 A;  3ZXS A;  3FHZ A;  3DLL F;  4EM0 B;  2R7W A;  1MW7 A;  2YPR A;  4I99 C;  4RM2 A;  1FEX A;  4HZF A;  4NC7 A;  1OMI A;  2I8D A;  1FSH A;  1DDN A;  3J81 R;  4XLN F;  4A5M A;  4EM1 A;  1JUM A;  2G7H A;  2VJ4 A;  3RKX A;  2HZD A;  2P6S A;  4IHT A;  5E3L A;  4DNC A;  5JHU A;  5CVV A;  3S8P A;  2DA4 A;  2GAU A;  2VJI A;  4AIK A;  1UST A;  2GXG A;  1WZ2 A;  1HST A;  2LY9 A;  1P2F A;  3RKQ A;  4KMU X;  4C2T A;  2K9Q A;  1VZ0 A;  1ETX A;  1G4D A;  4EGY A;  2WV0 A;  1OCR H;  5KNL A;  2F4I A;  1R36 A;  2CH0 A;  2K4B A;  5LBQ A;  1VQL I;  3K1P A;  1G8X A;  2VE8 A;  4F92 B;  3LAP A;  3OYD A;  5C3E J;  2P5V A;  3KP5 A;  5FO5 A;  3DEW A;  2XRO A;  5H6R A;  2R5Y B;  3LSH A;  2X1C A;  5LHI A;  3L2U A;  2RDP A;  2FNA A;  3BG3 A;  1LE8 A;  1ULY A;  3NRV A;  2HOS A;  5CVI A;  3DPL C;  4CCK A;  3KET A;  4IOC F;  3CO7 C;  1APL C;  3HDD A;  2V26 A;  1JT6 A;  4IO9 F;  1TZL A;  1ZLJ A;  5CVR A;  4B3X A;  2EFQ A;  3QWL A;  5J47 A;  1OFC X;  1G59 A;  2GA1 A;  4GGG A;  4IHW A;  3FK6 A;  2KDO A;  1YO5 C;  4Y7N J;  1U8B A;  3KZY A;  3Q9V A;  5K7F A;  2Z33 A;  3ZN1 A;  4XK4 A;  3I59 A;  4IHX A;  1HKQ A;  1ZQ3 P;  4Y15 A;  2FOK A;  1CGP A;  3SFI A;  4A3G J;  3OY9 A;  2VE9 A;  2ZC2 A;  5DCM B;  1K4T A;  3JRE A;  3HSR A;  1LFU P;  4A93 J;  1ETO A;  3LSM A;  3DTK A;  3ISP A;  4E7Z A;  1RPW A;  4S05 A;  5BMZ A;  1FIP A;  3REO A;  3WE3 A;  1SAN A;  4DYC A;  4U0W A;  1YIJ I;  1FOW A;  3RZO J;  2KL4 A;  4PSX A;  3SZG A;  4U7B A;  2HFH A;  1TNS A;  1RR8 C;  1O3R A;  4I6Z A;  3F8B A;  2A69 F;  2WBM A;  2AS5 F;  4FT8 A;  2E2H J;  1J0R A;  5JVG F;  3BG6 A;  2V7F A;  3JRC A;  2KKO A;  4HDU A;  4M73 A;  4HEA 2;  5TGT A;  3KZI C;  4CZC A;  2DQR A;  2ZFU A;  1R5I D;  2ESN A;  3OS0 A;  3GUD A;  4O5V A;  5KHD A;  2EFO A;  4MTE A;  2MH9 A;  3VYT B;  2KIF A;  2LKP A;  2KZV A;  3I55 I;  3MZY A;  4DGW B;  1H0M A;  1DP3 A;  4HYE A;  4BXU A;  5FB2 A;  5EYR A;  5H20 A;  2Z5U A;  1O3T A;  1F4K A;  3WU2 C;  2JMW A;  3BZK A;  5IT9 Z;  4DIQ A;  2O61 A;  3KP6 A;  2AQF A;  2XUB A;  3GWZ A;  1YRN B;  3GTL J;  1SFE A;  4L5E A;  3JRA A;  3KZZ A;  3CLQ A;  2EZH A;  4BHP A;  4XQF A;  1LPQ A;  1QGP A;  4U87 A;  5IP6 A;  4F52 A;  3R4K A;  1I6X A;  3CD6 I;  2ETH A;  2ZJ2 A;  2OQR A;  4ZC3 A;  3TDU C;  1YOV B;  4BGD A;  3CJR B;  4PFP A;  4F93 B;  3BP8 A;  1A31 A;  4BQA A;  2Y0S N;  3HPH A;  2K5C A;  3GYH X;  4AVP A;  3F3X A;  4C9Y A;  1ETW A;  1DGW Y;  3DTI A;  1PJR A;  3M8F A;  1UZC A;  4HX8 A;  2QBY A;  4KFC A;  1IRF A;  2DMQ A;  2R7Z J;  4CDG A;  2KQR A;  2M7B A;  2W1O A;  4PZJ A;  3COA C;  4JX6 A;  4BQO A;  2D1H A;  3SFZ A;  5EDN A;  4J19 A;  2MUN A;  5ICC A;  1Z05 A;  3HOW J;  1G2H A;  4N4N B;  2WY8 Q;  1TT0 A;  2JT1 A;  4BUP A;  5E3O A;  1TQI A;  3GZ5 A;  3J7A O;  4KIB A;  3MQ0 A;  2HQR A;  3E5U A;  3DWL E;  3FWE A;  2DFH A;  4JP0 A;  5FLX R;  3BTI A;  3V7R A;  2E5N A;  1X4O A;  4ZYD A;  3E5X A;  1QU3 A;  2ZSI B;  4CCJ A;  1BR1 A;  1KU7 A;  3FXK A;  1Z7L A;  2DDB A;  3Q0W A;  1J59 A;  2Y0S A;  3FXL A;  4EMS A;  3BTC A;  5HDN A;  1LDK B;  3H35 A;  5J1R A;  2IS4 A;  4BNC A;  3IKT A;  1XG1 A;  3H36 A;  4BDY A;  3DCF A;  4HA8 A;  5KAF C;  1QHG A;  3FMQ A;  1YG2 A;  3ECH A;  1K4S A;  3CUQ A;  4EV0 A;  2K3F A;  5D6E A;  2COM A;  3PJR A;  2PBI A;  2I10 A;  4PJJ A;  2VXD A;  4ESJ A;  3V4G A;  4HSR A;  4U0V A;  3TQN A;  4HQE A;  2CMP A;  1XCB A;  1JKR C;  2AQE A;  3ECO A;  4CCL A;  2E1O A;  3OYE A;  3VPR A;  2VQH A;  2XPW A;  1OCC H;  4KYW A;  3LWF A;  5GAH J;  2HYJ A;  3F9K A;  3D5R C;  1SFX A;  2FU4 A;  4HPQ A;  1T8I A;  3H9Q A;  5FD6 A;  1G3T A;  1KQ8 A;  3M1E A;  3ZQQ A;  2P81 A;  4DBQ A;  1E2X A;  4KT6 A;  3QPL A;  3JTG A;  1R4N B;  5EG0 A;  2TRT A;  5KVR A;  2COB A;  1MJB A;  1WKM A;  4E7S A;  4LOC A;  3DLA A;  2W48 A;  4IHS A;  3K4M A;  2KRC A;  2DYS H;  4G6T B;  5F64 A;  3QU3 A;  1DP7 P;  3OL4 A;  1T56 A;  3NQO A;  5E3N A;  2XAJ A;  3J7A Y;  2E5Z A;  4LK1 F;  3KP2 A;  3BR2 A;  1ON2 A;  3PQJ A;  1E3H A;  1U3E M;  1YIO A;  4C3I J;  4GYG A;  3FHN A;  3LQQ A;  3JSO A;  3MKY B;  2IPQ X;  2YU3 A;  5F6F A;  1YJN I;  2R93 J;  4IHY A;  1FOY A;  2W57 A;  3E7L A;  4XKC A;  2KRF A;  1X3U A;  4BBR J;  3OSG A;  1W7P B;  1MNM C;  3F8C A;  3MAJ A;  4CH7 A;  4E7I A;  1HW5 A;  5KAI C;  4X1E A;  3OSF A;  2JRT A;  3BTJ A;  4B4C A;  4X0G A;  3CC2 I;  2KP6 A;  1X1B A;  3D0S A;  4QPQ A;  4HAM A;  1BJA A;  2VL8 A;  1OIS A;  2W00 A;  1R49 A;  2MSY A;  1BR2 A;  2QQ8 A;  3VB2 A;  2KJC A;  3PNY A;  2A05 A;  2RQP A;  4FHT A;  5F08 A;  1P6R A;  3BCB A;  3FIW A;  1K79 A;  1E3O C;  3NEU A;  1V54 H;  2BXZ A;  1YX3 A;  3O6B B;  1IXS B;  1MBJ A;  4OU0 A;  1VFC A;  2EJR A;  5F1J A;  4OMY A;  4HRI A;  1FBU A;  3M8E A;  1J5Y A;  1DUX C;  1HKT A;  1IDZ A;  1QO0 D;  3GZ6 A;  2MA3 A;  5ICF A;  2IJL A;  2VBY A;  3GW2 A;  1RC9 A;  2R5Z A;  2L7M P;  2QZ8 A;  2PJR A;  1A04 A;  2A5W A;  2V1X A;  3DBH B;  4YII A;  1SVM A;  3RIR A;  1O3Q A;  3HGY A;  5IP9 J;  1TWF J;  1G3Y A;  1TLH B;  5HS7 A;  1K83 J;  2PG4 A;  4XM3 A;  1XDU A;  3EUH A;  4DYQ A;  3K9T A;  1KA8 A;  2ID3 A;  1I3A A;  4PJ0 C;  4J00 A;  4UHT A;  4UB6 C;  2BW3 A;  3M07 A;  4KUM A;  3RCO A;  4E6K G;  4LB5 A;  1ZN2 A;  1TW2 A;  2ECC A;  3I54 A;  4RAG A;  1LEA A;  3L09 A;  1V3F A;  3DV8 A;  3T5X A;  3IRR A;  4G8X A;  4RLF A;  3N4M A;  4KIS A;  3LA7 A;  1YS6 A;  4A2U A;  1RZ4 A;  4RDU A;  5ILS A;  3PQK A;  1SVO A;  2XDV A;  1C0W A;  2CFO A;  4GFB A;  4B48 A;  5E3M A;  3FMR A;  3BQZ A;  3J7Y J;  3A01 B;  2IGO A;  2JN6 A;  2RQQ A;  4E7J A;  3V7S A;  2ECB A;  1Z1D A;  3MWM A;  5FKK A;  1A6I A;  1FJL A;  2BY2 A;  2FQ3 A;  1HKS A;  4BY7 J;  3H9J A;  1XPX A;  3S32 A;  2ZJP F;  4AID A;  3WG7 H;  1D8J A;  2EWN A;  2CO5 A;  3JCU C;  2DA1 A;  2GLO A;  5IY5 H;  2IVM A;  2F5C A;  2XGE A;  2Z99 A;  3SQN A;  3HB9 A;  1T39 A;  4YRV A;  1LUJ B;  4DOZ A;  2PEX A;  3WU1 B;  1YE9 A;  2Q2E B;  1EH8 A;  4QTR A;  4NB5 A;  5GAD J;  4EJV A;  2FXA A;  3PM1 A;  3IAS 2;  1Z9C A;  2LBF A;  2KDZ A;  1PP7 U;  2QSG X;  4EJT A;  4Y17 A;  1LVA A;  1SD6 A;  3I64 A;  4PGG A;  4YEJ A;  1T2K A;  1BN5 A;  2DOF A;  1ZRE A;  1MNE A;  2WB1 A;  3MZ8 A;  3I4N J;  2BOL A;  1MSF C;  3SZP A;  4LD5 A;  4A0X A;  5KK1 A;  3BG5 A;  4PSW A;  4I02 A;  2VAS A;  4RGX A;  1MGT A;  2NS7 A;  3L1P A;  3GXO A;  3MEX A;  2PFB A;  2VOP A;  1N75 A;  1H88 C;  3BDD A;  2NNY A;  3QOD A;  1W36 D;  9ANT A;  1W1W E;  4ABZ A;  4XNF A;  3IH2 A;  2XAU A;  3V7C A;  1OCP A;  2YX7 A;  1YTY A;  1NG7 A;  3QOE A;  2JZY A;  3W2V A;  2CW8 A;  3MD2 A;  5LEJ A;  2L7F P;  1VQO I;  1EF4 A; 
#chains in the Genus database with same CATH homology
 5AON A;  4UVC A;  3DEU A;  3DP7 A;  2BYV E;  1D3Y A;  5CVJ A;  3JTH A;  2Q0O A;  5ICG A;  2ADU A;  1BBY A;  1B9M A;  1MDM B;  2ZNY A;  3WGG A;  2UXX A;  2CFX A;  2PI0 A;  2MD5 A;  1U78 A;  5LEK A;  4R79 A;  2K27 A;  5F1R A;  2LF7 A;  4M6X A;  5D4S A;  1O7L A;  3R60 A;  4IRG A;  1OR7 A;  1GHC A;  5BS6 A;  2XAH A;  1QBJ A;  3WG9 A;  4LJZ F;  2DT5 A;  4IJA A;  2DAO A;  5JR3 A;  1KQ0 A;  1WSU A;  1FSE A;  3T8R A;  1FYL A;  1SMT A;  4LLG F;  3QRF F;  1BI2 A;  4CXF A;  2F5F A;  2UZK A;  4N0B A;  3KE2 A;  2HDC A;  5DEQ A;  1U6G A;  5FLX K;  4GYI A;  3H3U A;  1S7A A;  3E6B A;  5AIP A;  2DQL A;  4IVN A;  3HIF A;  2M87 A;  5HLH A;  3BJO A;  1U2W A;  1IAW A;  3CUO A;  4WXD A;  4BH9 A;  2X4H A;  2G9W A;  3FXU A;  4KIC A;  4OMZ A;  2Y0M A;  3F21 A;  3Q9S A;  1HQC A;  4KDP A;  1OYI A;  4UNO A;  4AWX B;  1LB2 A;  5JFR A;  1U5T A;  2P7V B;  2JPB A;  2HEO A;  4IPA A;  3HHG A;  2E1N A;  2RN7 A;  2IW5 A;  1KU9 A;  3E5Q A;  2DFI A;  4M9Z A;  3R0A A;  5LRS A;  2KIM A;  4EGZ A;  4ESB A;  4WF2 A;  3L9F A;  4A6D A;  1ODD A;  3BJ6 A;  4P55 A;  5ILV A;  2MC3 A;  2ZCW A;  1FOK A;  3HRM A;  1B1B A;  2MBF A;  1IUY A;  4YIF A;  1QPM A;  3ABU A;  3P7N A;  2P5K A;  5LRR A;  3HUG A;  2PJP A;  5DUK A;  1JHF A;  4P9U A;  2M1B A;  1BC8 C;  2DTR A;  1S29 A;  4B8X A;  1K78 A;  2K02 A;  1R1T A;  3I53 A;  1BI1 A;  4CIC A;  2FNP A;  4ZYH A;  3SXY A;  4NQW A;  4UVA A;  1J7K A;  1CF7 A;  4I98 B;  3SHF A;  2PMH A;  2QQB A;  3QPH A;  3ZMZ A;  5LGU A;  1I1S A;  3FM3 A;  2ZME A;  4E70 A;  2VT3 A;  3VEP A;  1XGN A;  3PFI A;  4UXN A;  3ZMD A;  1TW3 A;  3LST A;  3R6S A;  2L4M A;  1J2X A;  1ZG3 A;  4QWQ A;  6PAX A;  4GO1 A;  3IRQ A;  2W25 A;  1Q1H A;  1S6L A;  1R23 A;  4ZYG A;  5HDG A;  4OIP F;  4L9V A;  1IN6 A;  2OBP A;  5HLI A;  1ZRF A;  1SD5 A;  2M5W A;  3BOQ A;  2XRN A;  3M9A A;  4RB0 A;  4MEY F;  2Z3Y A;  4EVI A;  1FYK A;  1PUE E;  2TDX A;  3KP7 A;  3BJA A;  3GFJ A;  2H6B A;  2XKO A;  3KEQ A;  2HWV A;  3GEZ A;  2HTS A;  3MCZ A;  4XRF A;  1G3W A;  4PGH A;  2FEZ A;  3OV8 A;  3QAH A;  5HDK A;  2FRH A;  1L3L A;  2IP2 A;  1U8R A;  3WE2 A;  3FX3 A;  1Z6T A;  4KIG A;  4HX4 A;  3BRO A;  2Z9O A;  3KLO A;  2NS0 A;  1YYV A;  2E7X A;  3L00 A;  2VC0 A;  4CZZ A;  3VOE A;  2GA2 A;  4WX9 A;  3BZ6 A;  3LFK A;  4EQQ A;  3V8J A;  4KT5 C;  4HF2 A;  1OYY A;  1XDS A;  1RI7 A;  1KGS A;  1ZYR F;  5FLX Z;  1YQA A;  2EFP A;  2P8T A;  2DW4 A;  5DD4 A;  5JI6 A;  3C1D A;  5L3D A;  3MFK A;  1EH6 A;  2L54 A;  1DPU A;  1R58 A;  2FA5 A;  4Q4Z F;  1QZY A;  1QNT A;  1XGM A;  1ZGJ A;  4L5J A;  4RB3 C;  3HOS A;  1FYM A;  2ZXJ A;  2ZBK A;  2P6T A;  4ZH4 F;  3WTX C;  1W5S A;  2DLL A;  1F9N A;  3U2R A;  4I01 A;  5DUI A;  2ZFW A;  1B6A A;  3KP3 A;  5LHG A;  5E8G A;  5JVT A;  1WWX A;  1JE8 A;  4RGS A;  2XKP A;  4G94 A;  1SFU A;  3J80 K;  2D45 A;  3F22 A;  2CG4 A;  4A0Y A;  1YS7 A;  4AIH A;  3F8M A;  1IZ1 A;  2ZKZ A;  3IWF A;  1IN4 A;  3QP6 A;  1YW7 A;  2ZNZ A;  2A68 F;  3ERE D;  4G6D A;  4ENJ A;  4OIQ F;  5D5W B;  1PDN C;  2D1V A;  4I7H A;  4LG0 B;  3H92 A;  1HW2 A;  4WK8 F;  1IN8 A;  5CJ9 A;  3TOB A;  1G3S A;  3WGI A;  1P4W A;  1IXR C;  1GXQ A;  4F7Z A;  3FZV A;  1BIA A;  2QQ9 A;  2XAQ A;  3V8L A;  4HX7 A;  1XGO A;  3EQL F;  2CWE A;  2W24 A;  1MKM A;  3WGH A;  4UV8 A;  1J9I A;  4LLN A;  4RAZ A;  1ZRD A;  1KYZ A;  3D5L A;  4RGU A;  1SMY F;  4RB1 A;  1OPC A;  3I58 A;  1KYW A;  2FBI A;  3ZPL A;  2HQN A;  4MNU A;  1MD0 A;  4M71 A;  5E1Z B;  5ICE A;  1XN7 A;  5LLQ A;  1XMA A;  2R3S A;  4I0A A;  5L3B A;  4U0Y A;  3F6V A;  4IF4 A;  3IKV A;  3N97 A;  1BI3 A;  1QQI A;  1W4M A;  4XLP F;  3LA3 A;  1YW8 A;  2DO7 A;  2XAF A;  5D5U B;  1IF1 A;  3KFW X;  1D8K A;  2EV6 A;  3ZMS A;  2HKO A;  4I2O A;  1WRJ A;  1XCV A;  3VFZ A;  4OOI A;  2XGX A;  3LQR A;  2DK5 A;  2CGP A;  1WQ2 A;  3E6M A;  2EFN A;  2PMU A;  1YLF A;  2NNN A;  2GZW A;  2XIG A;  2MH2 A;  4ASN A;  4HF0 A;  2STT A;  1W5T A;  3F8F A;  4GXO A;  4A0Z A;  1NHA A;  3GFM A;  3E97 A;  1ZLK A;  2WC2 A;  4JK1 X;  1RIO H;  2CW0 F;  4XSZ F;  5K5Q A;  5FFZ A;  2EA2 A;  1TQP A;  4IXA A;  3ZN0 A;  3F6O A;  3ELK A;  2CSO A;  5CLS A;  5CYV A;  1IN7 A;  3BY6 A;  2Y75 A;  3W6J B;  1ZH5 A;  3C18 A;  4B09 A;  1P4X A;  3EET A;  1Z7U A;  5LGN A;  2F5E A;  4MQV A;  4XBF A;  1H9G A;  2XAS A;  5L3F A;  1R5G A;  3MZH A;  2GIV A;  4ENM A;  2GQQ A;  3ZQ7 A;  4A12 A;  1IRG A;  2LSO A;  1Z6R A;  2KJB A;  4GCV A;  3QP5 A;  4ON0 A;  3RKY A;  4KN7 X;  1LDJ A;  1E17 A;  1W7P A;  3J80 Z;  2A61 A;  2VN2 A;  3BPX A;  3HYI A;  2VOO A;  3ROU A;  2VC1 A;  1FZP B;  4JQF A;  2DPD A;  2ISZ A;  1P92 A;  1SD7 A;  4RB2 C;  3TO9 A;  3GVA A;  1XB4 A;  4RGR A;  3CLO A;  3CO6 C;  4KA4 A;  1TQM A;  3IC7 A;  4NHJ A;  3W6K B;  1MZB A;  3ZMU A;  3KCC A;  1BIB A;  5CVU A;  4Q48 A;  2RC4 A;  1YFH A;  5ILU A;  4WXC A;  1FBS A;  3DXJ F;  3T1B A;  4UV9 A;  5J6X A;  4L9J A;  2BBY A;  4ESF A;  1IN5 A;  1KU3 A;  2W85 A;  3CJN A;  4QLC U;  2QQA A;  2YSR A;  3GX4 X;  2X0L A;  5D5X B;  2RVC A;  3HTU A;  5L3G A;  4UVB A;  3WOD F;  2QUF A;  3B02 A;  4HOB A;  1K6O A;  3RPU A;  4FX4 A;  4Y13 A;  3WTW C;  3EDP A;  3VOD A;  2FE3 A;  2EA4 A;  4LB6 B;  3FXR A;  2F5D A;  2FBH A;  4P9F A;  2Q2E A;  1I5Z A;  3GFI A;  3V8K A;  5HS8 A;  3G73 A;  4LGW A;  4ZZD A;  1HBX G;  4Z2Y A;  2HS5 A;  2A07 F;  3DPT A;  5HLG A;  2XVC A;  2HTJ A;  3F23 A;  2DK8 A;  4L9T A;  2ELH A;  1IXC A;  4MQ9 F;  1TTY A;  2HYG D;  4G6Q A;  5FGM A;  2O6G E;  3F72 A;  5A2Q K;  3I59 B;  1DPR A;  3GF2 A;  3OOP A;  4WWC A;  3T0Y A;  4HQM A;  5H6Q A;  1GVJ A;  3ULQ B;  1MDM A;  1RNL A;  2HYF A;  3KEO A;  2V1U A;  2HKX A;  5K5O A;  1FT9 A;  3TOA A;  1EV7 A;  2RKH A;  4YFX F;  2F2E A;  2FBK A;  4LFU A;  4ENN A;  2CQK A;  3IHU A;  2VOD A;  3FMS A;  4HBL A;  3M7G A;  4RS8 A;  1SAX A;  1AWC A;  1XSD A;  2XHK A;  4ZYE A;  3CUQ C;  3K1N A;  1OYW A;  1SD4 A;  1B4A A;  2IT0 A;  4JBA A;  2QYO A;  3HSE A;  4A5N A;  2G7U A;  2FSW A;  5ERI A;  4M6Y A;  5D4R A;  3P9K A;  4TV7 A;  2QBY B;  1STZ A;  5D8K B;  5D6F A;  1VTN C;  1RUN A;  1LQ1 A;  4HV5 A;  2JPC A;  2V1D A;  2XV4 S;  4OIR F;  1D5V A;  3LAJ A;  2A5Y B;  1P4A A;  3U1D A;  1FBQ A;  2CYY A;  3K69 A;  3G3Z A;  1TNT A;  5DYM A;  3JW4 A;  1JHH A;  2P4W A;  3KP4 A;  4WCG A;  3C3W A;  5HVQ C;  2UWM A;  4L9N A;  2DU9 A;  3CUQ B;  5EEH A;  5BPD A;  1JXS A;  4EJO A;  1ON1 A;  2R7D A;  2DBB A;  4H0E A;  2OAZ A;  3GFL A;  5FD5 A;  4S04 A;  2L02 A;  3I4P A;  2QLZ A;  3DF8 A;  4A6E A;  3RTR A;  1FY7 A;  4LLL A;  3B73 A;  3TDZ C;  3O3K A;  4AD9 A;  3FXQ A;  3K1M A;  1ZG1 A;  2BGC A;  2BV6 A;  2JTV A;  5BPI A;  2H6C A;  3E3V A;  1UHW A;  4HV6 A;  2GXB A;  2P7C B;  3HRT A;  1LNW A;  1XGS A;  2JSC A;  2L4A A;  1UFM A;  4N9H A;  2MLK A;  3IWZ A;  2A6E F;  4CHU A;  3JAM K;  2DI3 A;  4P5O A;  2K4J A;  1H9T A;  1O3S A;  2O8X A;  4KNY A;  4G7H F;  3JSP A;  3H3Z A;  4CYD A;  1S7O A;  4ZZL A;  2UXN A;  5K1Y A;  1MJ9 A;  1R7J A;  3RI4 A;  4UUV A;  5A2Q Z;  4U7D A;  4OIO F;  1TBX A;  5E1W A;  4P96 A;  1HSJ A;  5E8I A;  4O6J A;  1R5H A;  4FX0 A;  1KQ9 A;  3ML6 A;  3R0J A;  2Q8K A;  4HF1 A;  2K86 A;  2RNJ A;  3S2W A;  1T6S A;  2EV0 A;  4HLX A;  2HR3 A;  2YX4 A;  4I09 A;  5ED4 A;  3BWG A;  5BQT A;  1UCR A;  3EYY A;  1I1G A;  3I5U A;  2HZT A;  2Y48 A;  3EYI A;  1Y0U A;  3K2Z A;  1ONV A;  4KN4 X;  4MEX F;  2M8E A;  5DCM A;  2HOE A;  2A3S A;  2WWY A;  2OA4 A;  2PLY A;  5FFX A;  2L01 A;  4PCQ A;  2OD5 A;  3CTA A;  5L3C A;  3T8T A;  2OQG A;  4IRI A;  2NRA C;  3RPQ A;  2DPU A;  4CGZ A;  4PDK A;  3HSF A;  3ZMT A;  2J5O A;  3RYP A;  3LA2 A;  4AIJ A;  1RUO A;  4OIN F;  2VT2 A;  3R61 A;  2STW A;  1R1V A;  4EJW A;  1FX7 A;  3BPV A;  2K7L A;  1REP C;  3WTZ A;  4M72 A;  1BM9 A;  4XSX F;  2ZO4 A;  2QVO A;  2M30 A;  2QEN A;  4G7O F;  4N9I A;  1JGS A;  1W7P D;  2PN6 A;  3E6D A;  4L5I A;  1ZG5 A;  3HOT A;  2VBX A;  1WI9 A;  3L7W A;  4HW0 A;  4BAY A;  4G7Z F;  2V9V A;  5DDG A;  4U88 A;  2ACJ A;  1T0F A;  3HHH A;  1FLI A;  4EM2 A;  2O3F A;  2RV8 A;  1T98 A;  2M45 A;  4MGR A;  1F5T A;  4ETS A;  1U5T C;  2H94 A;  2MLG A;  3ZP5 A;  1L0O C;  1FPQ A;  3J81 K;  2ESH A;  1S8N A;  3FF5 A;  3WTY C;  1LEB A;  1YW9 A;  3C7J A;  3GLX A;  1I27 A;  3Q5F A;  5LHH A;  4I0B A;  4O3M A;  1ZAO A;  2V6C A;  4R8H A;  2O03 A;  5E18 F;  4L0Y B;  1B59 A;  4EJU A;  1O57 A;  4LG0 A;  3RYR A;  1FP1 D;  2LNB A;  2ISY A;  3E6C C;  1GXP A;  1T38 A;  2HGC A;  5J8F A;  1S3J A;  1UB9 A;  2IA1 A;  2EK5 A;  3JAM Z;  5IT3 A;  3KLN A;  2IA0 A;  1BC7 C;  1PP8 F;  3WTV C;  3O2P E;  2VBW A;  3DQV C;  4BHC A;  1ZRC A;  1U5T B;  2E7W A;  2W84 A;  4YG2 F;  3WTU C;  2QWW A;  3K0L A;  3P9C A;  1BI0 A;  2A6H F;  2O0Y A;  1HW1 A;  3WU0 A;  1IW7 F;  1XSX A;  1XD7 A;  2OZU A;  2XAG A;  1FNN A;  4DQ2 A;  1V4R A;  5LGT A;  5D8L B;  4MHG A;  4LMY A;  4R1H A;  2LF8 A;  3TO7 A;  3I0T A;  5TRD A;  2VON A;  3RDI A;  1O7F A;  4YFN F;  4YFK F;  3ZMV A;  1OKR A;  3GO5 A;  1K78 B;  2NYX A;  2V79 A;  3WTT C;  4CO8 A;  4G9Y A;  1FC3 A;  4M9S A;  1EH7 A;  3SZT A;  1HXD A;  1K7A A;  4Q47 A;  4MTD A;  1CF7 B;  1G6N A;  1R1U A;  3HTS B;  5HOO A;  1J75 A;  2ZME B;  2C6Y A;  2FML A;  1LDD A;  4BYY A;  5L3E A;  3DKW A;  2IRF G;  2FF4 A;  4IRH A;  3TKY A;  2E1C A;  2NAZ A;  3QOP A;  2QM3 A;  2BEO A;  4M74 A;  2RGV A;  1MJA A;  4KMF A;  2EFW A;  4D0P A;  4Q5S F;  4LK0 F;  4HDV A;  2L3D A;  5IT9 K;  3TGN A;  5EEG A;  2EB7 A;  3QU6 A;  2R7F A;  3I71 A;  5E17 F;  2H27 A;  3FM5 A;  4WXH A;  2WTE A;  5J8C A;  4L0Z B;  2H09 A;  3F8N A;  3P9I A;  1ZAR A;  2VXZ A;  4K2E A;  4ENK A;  3DFG A;  4HLY A;  3QPT A;  4L18 B;  4KIF A;  5TJJ A;  1B9N A;  2KIU A;  1R00 A;  2B0L A;  2OU2 A;  3ABT A;  1UHM A;  1AOY A;  2IA2 A;  3IL2 A;  5AIQ A;  3HRU A;  3HRS A;  1QZZ A;  1USS A;  3CDH A;  1KU2 A;  5E1X A;  1R22 A;  3J81 Z;  3U9G A;  5DCF A;  5D5V B;  2OZ6 A;  2D2W A;  1FP2 A;  2YR2 A;  1Z91 A;  3TO6 A;  1ZGA A;  1LJ9 A;  2GWR A;  1XMK A;  4RAY A;  1F1Z A;  3RKW A;  2LDU A;  2P5L C;  1ZHF A;  3L2C A;  5BOX A;  2AXL A;  5E20 A;  3RJP A;  3WTS C;  5K5R A;  1FWZ A;  5HS9 A;  5DD8 A;  2FMY A;  2VBZ A;  4M9X A;  2BE5 F;  2PQ8 A;  1BOA A;  1XSV A;  4BHB A;  2J5P A;  3AAF A;  2EV5 A;  5DV5 A;  3FHZ A;  4EM0 B;  2YPR A;  4HZF A;  1OMI A;  1FSH A;  1DDN A;  4XLN F;  4A5M A;  4EM1 A;  2G7H A;  3RKX A;  2P6S A;  4IHT A;  4DNC A;  5JHU A;  5CVV A;  2GAU A;  4AIK A;  1UST A;  2GXG A;  1HST A;  1P2F A;  4KMU X;  1G4D A;  4EGY A;  2WV0 A;  1R36 A;  2K4B A;  5LBQ A;  3K1P A;  2VE8 A;  3LAP A;  2P5V A;  3KP5 A;  5FO5 A;  2XRO A;  5H6R A;  5LHI A;  2RDP A;  2FNA A;  1ULY A;  3NRV A;  5CVI A;  3DPL C;  3KET A;  3CO7 C;  1ZLJ A;  5CVR A;  2EFQ A;  2GA1 A;  4GGG A;  1YO5 C;  3KZY A;  3Q9V A;  2Z33 A;  3ZN1 A;  3I59 A;  1HKQ A;  4Y15 A;  2FOK A;  1CGP A;  2VE9 A;  5DCM B;  3HSR A;  3ISP A;  4S05 A;  5BMZ A;  3REO A;  3WE3 A;  4U0W A;  4U7B A;  2HFH A;  1TNS A;  1O3R A;  3F8B A;  2A69 F;  2AS5 F;  4FT8 A;  1J0R A;  4HDU A;  2KKO A;  4M73 A;  2DQR A;  2ESN A;  3GUD A;  4O5V A;  2EFO A;  4MTE A;  2MH9 A;  2KIF A;  2LKP A;  3MZY A;  1H0M A;  4HYE A;  4BXU A;  5FB2 A;  5H20 A;  2Z5U A;  1O3T A;  1F4K A;  5IT9 Z;  2O61 A;  3KP6 A;  2XUB A;  3GWZ A;  1SFE A;  3KZZ A;  4BHP A;  1QGP A;  3R4K A;  1I6X A;  2ETH A;  2ZJ2 A;  2OQR A;  3TDU C;  3BP8 A;  4BQA A;  3GYH X;  4AVP A;  3F3X A;  3M8F A;  4HX8 A;  2QBY A;  4KFC A;  1IRF A;  4CDG A;  4PZJ A;  3COA C;  2D1H A;  3SFZ A;  5ICC A;  1Z05 A;  2JT1 A;  1TQI A;  3GZ5 A;  3J7A O;  4KIB A;  3MQ0 A;  2HQR A;  3E5U A;  3FWE A;  3V7R A;  4ZYD A;  3E5X A;  1KU7 A;  1J59 A;  4EMS A;  5HDN A;  1LDK B;  4BNC A;  3IKT A;  4HA8 A;  3FMQ A;  1YG2 A;  3ECH A;  3CUQ A;  4EV0 A;  5D6E A;  2COM A;  2PBI A;  4ESJ A;  3V4G A;  4U0V A;  3TQN A;  4HQE A;  1XCB A;  3ECO A;  4KYW A;  3LWF A;  1SFX A;  2FU4 A;  5FD6 A;  1G3T A;  1KQ8 A;  3M1E A;  1E2X A;  3JTG A;  5KVR A;  1MJB A;  1WKM A;  4IHS A;  1DP7 P;  5F64 A;  3QU3 A;  3NQO A;  2XAJ A;  4LK1 F;  3KP2 A;  1ON2 A;  3PQJ A;  1U3E M;  1YIO A;  4GYG A;  3JSO A;  3LQQ A;  2IPQ X;  2YU3 A;  5F6F A;  2W57 A;  2KRF A;  1X3U A;  1W7P B;  3F8C A;  3MAJ A;  1HW5 A;  2JRT A;  3D0S A;  4HAM A;  1BJA A;  3VB2 A;  2KJC A;  2RQP A;  4FHT A;  1P6R A;  1K79 A;  3NEU A;  3O6B B;  1IXS B;  4OU0 A;  2EJR A;  4OMY A;  1FBU A;  3M8E A;  1J5Y A;  1DUX C;  1HKT A;  1QO0 D;  3GZ6 A;  2MA3 A;  5ICF A;  2IJL A;  2VBY A;  3GW2 A;  2QZ8 A;  1A04 A;  2V1X A;  3RIR A;  4YII A;  1O3Q A;  1G3Y A;  1TLH B;  5HS7 A;  2PG4 A;  1XDU A;  3EUH A;  3K9T A;  1KA8 A;  4UHT A;  4KUM A;  4LB5 A;  1ZN2 A;  1TW2 A;  3I54 A;  1LEA A;  3L09 A;  1V3F A;  3DV8 A;  3T5X A;  3IRR A;  4G8X A;  3N4M A;  3LA7 A;  1YS6 A;  4A2U A;  1RZ4 A;  5ILS A;  3PQK A;  1C0W A;  3FMR A;  3V7S A;  3MWM A;  1Z1D A;  2FQ3 A;  1HKS A;  1D8J A;  2EWN A;  2CO5 A;  2IVM A;  2F5C A;  2Z99 A;  3SQN A;  1T39 A;  2PEX A;  3WU1 B;  1EH8 A;  4NB5 A;  4EJV A;  2FXA A;  1Z9C A;  1PP7 U;  4EJT A;  4Y17 A;  1LVA A;  4PGG A;  1SD6 A;  3I64 A;  1T2K A;  1BN5 A;  1ZRE A;  3SZP A;  4LD5 A;  4A0X A;  5KK1 A;  4I02 A;  4RGX A;  1MGT A;  3GXO A;  3MEX A;  2PFB A;  2VOP A;  3BDD A;  2NNY A;  3V7C A;  2YX7 A;  1YTY A;  2JZY A;  5LEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...