1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
4BH9A 1BYMA 2LNBA 2ZCWA 5L3DA 2EV5A 5K1YA 2VBYA 2DPUA 1ZHFA 1IN5A 2E7WA 4M71A 4PGGA 3IWZA 4IVNA 4CHUA 3ECHA 1OYIA 3IRRA 4UV9A 4FX0A 4Q4ZF 5D8LB 5BQTA 2VODA 2QQBA 2LF7A 2FNPA 1FT9A 5FGMA 3KP7A 1V4RA 5LHGA 3VFZA 3ZN0A 3ZPLA 1O57A 1DPRA 5LGUA 3K0LA 4N9HA 4ZYHA 1TQPA 4ENMA 4UVAA 1TNSA 2P5LC 2FEZA 2FU4A 3VODA 3WGIA 1OYYA 2K86A 1RUOA 3G73A 2P8TA 1K6OA 2LKPA 2J5OA 3GW2A 4ENNA 3CLOA 1P2FA 3LA3A 3CDHA 3LQRA 2VONA 4B8XA 4I0BA 1ZAOA 2EV6A 5K5OA 1HW1A 5HOOA 1FP2A 2M5WA 1R36A 1IF1A 2O6GE 1KQ9A 3GXOA 4G9YA 4OINF 3WTSC 1JGSA 4KA4A 2OBPA 1ZLJA 5D5XB 2X4HA 4PGHA 4F7ZA 2IT0A 2P5KA 4WXDA 4KFCA 4LG0B 1WSUA 2CFXA 4KNYA 1IXCA 1AWCA 3IKTA 4MNUA 1IN6A 2DK5A 5CVUA 3K2ZA 2A6HF 2VOPA 2V1DA 4O3MA 2VOOA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1B6AA 2XHKA 3BWGA 2XAFA 3REOA 1XGNA 2OA4A 1O3TA 2DAOA 5A2QZ 2HTSA 3PQKA 2DI3A 1LEBA 1O3SA 3E5UA 4Y17A 4PDKA 2W84A 3ABTA 3TOAA 4NHJA 4NB5A 2ZJ2A 2O61A 3FXQA 4M9ZA 2STWA 1FYLA 1CF7A 4RGXA 3J7AO 4YG2F 5AIQA 1FSHA 2MLKA 3CO6C 1B9MA 3I58A 4XRFA 4RGSA 2FRHA 3BROA 3EQLF 3Q9VA 1DP7P 1P4XA 2RDPA 2PQ8A 1G3SA 4RB2C 2OAZA 1YG2A 5HLIA 2STTA 2V1XA 5HS9A 4IRIA 4LK0F 5HDGA 1S7OA 1BIAA 2Y0MA 2PN6A 4AIHA 2VXZA 4IJAA 1ONVA 4RAZA 1P4AA 1KA8A 2EA2A 2PMUA 1S6LA 2QQAA 4HBLA 1IXSB 3CUQC 4UHTA 4IF4A 2OZ6A 4EM1A 1MJ9A 1MGTA 2IA1A 2IW5A 1YS6A 1G3WA 2OD5A 1MJAA 1NHAA 2E7XA 2G9WA 5HS8A 1R1UA 2ZNZA 4IHSA 4G7ZF 5E20A 3HHGA 4L9TA 4ZYDA 2F5FA 4U88A 2EK5A 2LF8A 3DXJF 2EB7A 1P92A 2HQNA 4I0AA 3WTTC 2RQPA 5LHIA 1USSA 4HF2A 4ASNA 3RPUA 2PLYA 1TQIA 2E1NA 2VT2A 2PI0A 4MHGA 4P9UA 4WX9A 3V8KA 2WWYA 1QQIA 5DD8A 3HSFA 3E6DA 2RNJA 1XCVA 2DU9A 3T1BA 5BOXA 2ZBKA 4Q5SF 3M9AA 1K7AA 1HSTA 2PG4A 3MCZA 1J0RA 5LLQA 3FMQA 3E3VA 4JK1X 3KP2A 5E1WA 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 1W5TA 1YW7A 5TRDA 4Y15A 4UVCA 3WTWC 1O7LA 1ZN2A 3WE2A 5AIPA 5DCMB 2NAZA 2HTJA 2FXAA 3I59A 4MTDA 1RZ4A 5DUKA 1K79A 3HTSB 1H9TA 3BJ6A 4O6JA 1WKMA 2OQRA 1ZREA 2BBYA 4R1HA 3U1DA 3BY6A 2FNAA 2DT5A 3ZMDA 5F64A 5BPDA 2K7LA 2QZ8A 3NEUA 2L4AA 3L7WA 4A0YA 1OMIA 3GX4X 1C0WA 4L0ZB 4RGRA 3K9TA 1RI7A 3V7RA 2EA4A 4I98B 3E6CC 1B9NA 3K1PA 2JZYA 2MC3A 3VEPA 4A12A 3KFWX 1QVPA 3R4KA 1G3YA 2D1VA 5ICCA 1WRJA 2HR3A 3TKYA 2XAHA 1SAXA 3I5UA 1USTA 2LDUA 3F8FA 3MZYA 3F3XA 4HX4A 3ABUA 2ISZA 2YU3A 3Q5FA 2FMLA 5CVRA 5H20A 3JSPA 3SFZA 2EFNA 2XIGA 2BGCA 2CGPA 1T6SA 5AONA 3KP4A 1TBXA 4IPAA 3ROUA 1FYMA 1ON2A 3SZPA 4YFNF 2NYXA 3C18A 2EWNA 3LAJA 1FWZA 2VE8A 2HZTA 3P7NA 3KZZA 2DLLA 2DQRA 4LG0A 5HLGA 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 2XROA 1BI3A 2BYVE 2BV6A 3E5XA 1D8JA 2H6CA 4BYYA 1YIOA 5ICGA 2P6TA 3EYIA 1ZGJA 3P9CA 3T8RA 5FLXK 2O03A 4QLCU 1HW2A 2OQGA 1K78B 1KU7A 4KMUX 4HV5A 1XGSA 2L02A 2DPDA 4QWQA 3NQOA 2A68F 3GYHX 3IC7A 2K5FA 3WGHA 1ZGAA 1LEAA 2GWRA 3SHFA 1ZRCA 1Z05A 2ZKZA 1Y0UA 2QENA 4L5JA 1J9IA 4A6DA 1V3FA 5H6QA 4RB0A 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 4ENJA 1LQ1A 1EH6A 4EVIA 3N4MA 1D3YA 4UV8A 1OPCA 1BC7C 4YIFA 4MEXF 2GZWA 4R8HA 4HQEA 1X3UA 5D8KB 1FP1D 2RGVA 1R1VA 2VC0A 1LNWA 2M45A 2PJPA 3HRMA 3AAFA 3MEXA 3MQ0A 3ZMSA 1LDKB 2Y75A 4ESBA 2IPQX 2OU2A 1R58A 3V7CA 4LB5A 3ULQB 1TW3A 1KU2A 1SMTA 3CJNA 2Z5UA 4HAMA 3VOEA 1PDNC 4G6DA 1YS7A 1FBSA 1U8RA 1R22A 5K5QA 1CGPA 1SD7A 3ZP5A 2K4YA 1XCBA 1XMAA 5KK1A 1EH7A 1QW1A 2KIMA 3GF2A 5E18F 2XUBA 3O6BB 1G6NA 4MTEA 2A3SA 3NRVA 2DQLA 1ZG5A 1HQCA 1XDSA 1GXPA 2M1BA 3D0SA 4AD9A 5F6FA 1MJBA 2CG4A 4U0WA 1Z91A 2GA1A 3BPXA 1FY7A 1TLHB 4Q48A 1RIOH 3DPTA 3TO7A 3ECOA 1QO0D 3F22A 3FMSA 1ZG1A 5BPIA 1MKMA 1QZZA 3H92A 5HDKA 2FOKA 1FC3A 3VB2A 1F9NA 3HSRA 3FWEA 3I71A 5DV5A 5E17F 4YIIA 2KRFA 1REPC 5ICEA 1UHWA 3K1NA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 3F8CA 3J81K 4HF1A 1T38A 2ISYA 4NQWA 4KDPA 1YYVA 5LHHA 4MQVA 1YQAA 5DCMA 3T5XA 5CLSA 3WU1B 3ZN1A 3TGNA 2UXXA 4I09A 2H94A 3HSEA 4RB1A 3F72A 3QOPA 4Y13A 3GFLA 3EDPA 3IWFA 4KUMA 3JAMK 5BMZA 2QBYB 1B59A 1R7JA 5HS7A 1SD6A 1P4WA 4I01A 3B73A 3LA7A 1QBJA 3ZMVA 3R0AA 2HS5A 2Z3YA 3F8BA 4OU0A 1TNTA 2PFBA 4MQ9F 3TOBA 5CVIA 2YX7A 2GQQA 2XAQA 1R5GA 2D45A 2GAUA 3KE2A 2BE5F 4AWXB 3FXRA 4UUVA 3DQVC 1PUEE 3T8TA 1HBXG 1XSDA 4OIPF 3V8LA 4EM2A 3RI4A 2EFPA 5DUIA 3WTUC 4K2EA 1HW5A 4KIGA 1YLFA 3QRFF 3RYPA 2FSWA 3V8JA 1XMKA 5LBQA 5JR3A 1AOYA 4CXFA 1J2XA 4I2OA 5E8GA 5D5VB 1QZYA 4BXUA 4GYIA 3F8NA 3C3WA 1KQ8A 2HGCA 4LLNA 2XGXA 3IHUA 2KIFA 2Q0OA 2QYOA 3RPQA 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 2KIUA 2RKHA 3R6SA 4B09A 2MH9A 3E6MA 3KZYA 3QAHA 4PZJA 4CICA 3MAJA 1O7FA 2YR2A 5J8FA 4L5IA 4M73A 4U7DA 1IN8A 2OZUA 3O3KA 2XASA 4CYDA 2WC2A 1G4DA 5FFXA 3E19A 2CWEA 3FF5A 2GIVA 3FXUA 1YTYA 3QU6A 1Z6RA 2PMHA 1KYZA 2XAGA 2R3SA 3GFIA 2AXLA 2KJBA 3HOSA 5HLHA 4N0BA 4L9NA 4S05A 1BIBA 1K78A 1MD0A 3FZVA 4G7HF 4KYWA 1SD4A 2CYYA 5L3EA 3WTXC 2YPRA 1SD5A 4HA8A 4P9FA 3HRUA 1G3TA 2EFQA 1W7PB 3I53A 5JFRA 3N97A 1KGSA 3R60A 4ON0A 2P4WA 4U7BA 3KETA 3TO6A 4A2UA 2NNNA 3MFKA 2P7CB 1GXQA 4LD5A 3FM3A 3WU0A 4HDVA 1S7AA 2HDCA 1XGMA 3LAPA 4HX7A 2D1HA 2HYFA 4GCVA 5FD6A 3MZHA 3MWMA 2TDXA 2KKOA 2F5CA 1UHMA 1H9GA 2YSRA 5FLXZ 1HKSA 2CQKA 4ZZDA 3TQNA 2VT3A 4TV7A 2FBIA 2ACJA 1FZPB 2H3JA 4BHBA 2L4MA 4ENKA 1F1ZA 4KMFA 4ZYEA 4HF0A 4HYEA 3G3ZA 2HQRA 5KVRA 2P7VB 2V79A 4FX4A 2G7UA 1JHFA 2K5LA 3MHXA 3KP3A 4RGUA 2Z99A 3R61A 4G8XA 2VBXA 1R1TA 4CZZA 1U2WA 1VTNC 3GZ6A 1L3LA 1I6XA 3WG9A 2D2WA 3GUDA 4YFKF 2DTRA 5DD4A 1RUNA 4WF2A 1J7KA 4EM0B 5ED4A 3HIFA 3K1MA 1FYKA 1I5ZA 1JXSA 2L01A 4RB3C 1XN7A 4BNCA 2R7DA 4FT8A 2UZKA 4IHTA 2W25A 1U5TB 4IRGA 2RVCA 4A6EA 1U3EM 2L3DA 5LRSA 3QPTA 4EV0A 3J80K 2JPCA 3M8EA 3LA2A 5FO5A 2ETHA 4KT5C 4WXHA 1XB4A 5DYMA 2GCXA 3BJOA 2GXGA 1BOAA 1MDMB 2G7HA 1WQ2A 1I1GA 3BDDA 4A0ZA 4OIQF 3M8FA 1FNNA 4EJUA 1T0FA 2F5DA 3BOQA 1DDNA 4OMYA 2Z9OA 1LJ9A 4EGZA 2K5IA 4P5OA 2PBIA 1SFEA 3BP8A 2L54A 3HYIA 3KLOA 1LDJA 2A07F 2QBYA 3GWZA 3CO7C 2VC1A 1Z7UA 3M1EA 4XBFA 4M72A 3ZMTA 5K5RA 1QPMA 5LGTA 2M30A 5LEKA 2MBFA 3PQJA 5L3FA 4L0YB 3DPLC 2ELHA 3C7JA 3OOPA 4HQMA 3K69A 3I0TA 1R00A 1SFXA 3J81Z 2HWVA 2QQ9A 4RS8A 3GVAA 2HKOA 1XD7A 1ZG3A 3EETA 4MGRA 2VBWA 1UB9A 4LMYA 5FD5A 4PCQA 1D8KA 4YFXF 1IN7A 2A5YB 2F2EA 3V4GA 3PFIA 4I7HA 3QPHA 3V7SA 1TQMA 1GVJA 1FX7A 2MH2A 4OMZA 3JAMZ 4IXAA 2Q8KA 1ON1A 3F21A 3RIRA 1BI1A 2RV8A 3HOTA 2FBKA 2A69F 5IT9K 2FE3A 1IN4A 1J75A 2A6EF 4OOIA 2CO5A 4BAYA 3ML6A 2NNYA 5D5WB 4Q47A 3GEZA 1IRGA 1D5VA 5H6RA 4KN4X 4M9XA 4KICA 1DPUA 3I59B 2QM3A 2MD5A 5J8CA 3O2PE 4L9VA 4LJZF 3ERED 2GA2A 1E17A 3WTZA 4D0PA 1R5HA 2RC4A 2JRTA 4EJWA 5L3GA 4HLYA 2IA0A 2P6SA 3HHHA 1IW7F 1LVAA 1OR7A 1SMYF 5FB2A 3OV8A 1ZRDA 3EYYA 2FMYA 2K27A 2HOEA 1Z9CA 5ERIA 3ELKA 1J59A 2V1UA 1TTYA 2Z33A 3JTHA 4WWCA 5DCFA 3WTYC 2ESNA 4M6XA 4P55A 4AIJA 1W7PA 4XSZF 2AS5F 3BZ6A 2O8XA 5TJJA 1I27A 4WXCA 2EJRA 3WGGA 2BEOA 2DO7A 3KEOA 2EFWA 2IRFG 3HUGA 2EFOA 3FX3A 5F1RA 5JHUA 3Q9SA 4R79A 3HRTA 1OYWA 4GXOA 1B1BA 2QWWA 2RN7A 4U0YA 3COAC 1KYWA 3LWFA 3KCCA 4GO1A 1T98A 3CUQB 4M6YA 3L2CA 2M8EA 1KQ0A 2K02A 1FBQA 1RNLA 1B4AA 2ZFWA 3GLXA 2FF4A 3DEUA 4XLPF 3RJPA 1IUYA 2W24A 4S04A 4EJVA 5ILVA 2HKXA 3E97A 4CDGA 5CVVA 1QGPA 5DDGA 4CO8A 4HX8A 4GYGA 1BJAA 2J5PA 5HDNA 4G94A 2H27A 1WWXA 3F6OA 2XV4S 1ZLKA 1HKTA 1YW9A 1KU3A 4XSXF 1ZYRF 5LGNA 2UWMA 4UVBA 2JSCA 2UXNA 2O3FA 1BI2A 2HFHA 2ZMEB 1FSEA 4HOBA 3KP6A 2QLZA 5L3CA 2VBZA 2MLGA 1U5TA 4A5NA 1UFMA 4EMSA 4LLGF 5JVTA 1FBUA 3LFKA 1O3QA 3L9FA 1U78A 2W85A 3LQQA 1MDMA 3IKVA 4H0EA 5ICFA 5D4SA 1IAWA 1ULYA 2F5EA 1P6RA 2LX9A 1S3JA 3B02A 4Z2YA 5ILUA 2CSOA 1Z1DA 4HDUA 3RKYA 1WI9A 2ESHA 2XKPA 2C6YA 1ODDA 3KP5A 5CVJA 1TW2A 4U0VA 3SZTA 1W4MA 2FBHA 4CGZA 4M74A 2ZNYA 2FA5A 3C1DA 4HZFA 2EV0A 2W57A 1Q1HA 1IRFA 4G7OF 4KIBA 6PAXA 2LSOA 5E1ZB 4EGYA 4BHPA 4KN7X 4WCGA 1XSVA 2WTEA 5EEHA 3J80Z 4LGWA 1F4KA 4MEYF 4O5VA 4JBAA 2K4BA 5A2QK 2P5VA 4DNCA 3WODF 3WTVC 5E1XA 1YO5C 5DEQA 1A04A 2DW4A 3E6BA 1ZH5A 3HRSA 2PEXA 4G6QA 3DP7A 3E5QA 3L00A 2V9VA 2A61A 1MZBA 5CJ9A 3GFJA 2E1CA 3R0JA 3TO9A 2JT1A 5L3BA 3DV8A 3T0YA 2DK8A 5BS6A 4WK8F 2Y48A 3L09A 1PP8F 1S8NA 1JHHA 4FHTA 1T39A 2XRNA 1YW8A 4EJOA 4XLNF 1O3RA 1QNTA 2IP2A 4RAYA 5D5UB 2XVCA 4LLLA 3DF8A 3F23A 1IZ1A 1FOKA 1J5YA 2QUFA 2M87A 4HLXA 3GZ5A 1U6GA 5FFZA 3ZMUA 2B0LA 2JTVA 1UCRA 4BQAA 2O0YA 1H0MA 4IRHA 3RYRA 3I4PA 1SFUA 1XDUA 4I02A 3F8MA 5CYVA 1ZRFA 1HXDA 3FMRA 3RDIA 5J6XA 3JTGA 4OIOF 5JI6A 2IA2A 1BN5A 1S29A 2NRAC 3ZQ7A 1GHCA 5IT9Z 1ZARA 1XGOA 2HEOA 3EUHA 4A0XA 1CF7B 2ADUA 3CTAA 5LEJA 4L18B 3GO5A 1L0OC 5IT3A 2NS0A 1F5TA 4M9SA 2Q2EA 5D6EA 3RTRA 4A5MA 4JQFA 4P96A 3SQNA 1EV7A 5EEGA 2KJCA 3IL2A 2HYGD 1BI0A 2ZXJA 3QP5A 5ILSA 2H09A 4BHCA 2V6CA 2ZO4A 3M7GA 3W6JB 2FQ3A 4EJTA 3RKWA 2R7FA 3GFMA 2K4JA 1IXRC 3HTUA 1BM9A 5LRRA 4E70A 3BPVA 4EQQA 3CUQA 4L9JA 3IRQA 2MA3A 4AIKA 3JSOA 2YX4A 3KEQA 4ETSA 3U9GA 4KIFA 3U2RA 3LSTA 1HSJA 1E2XA 3QU3A 1PP7U 2H6BA 4LB6B 1LB2A 4ZH4F 3H3UA 3JW4A 1HKQA 4LK1F 1I1SA 2CW0F 1JE8A 4HW0A 1FLIA 2COMA 2XKOA 1LDDA 2IJLA 4OIRF 5E8IA 3I54A 3P9KA 4HV6A 1BC8C 4ESFA 2GXBA 1EH8A 3DKWA 2DBBA 3DFGA 3I64A 3F6VA 2ZMEA 2IVMA 1BBYA 3S2WA 3H3ZA 1STZA 2DFIA 5HVQC 2WV0A 5D6FA 2JPBA 4DQ2A 1U5TC 5D4RA 1T2KA 4ESJA 1KU9A 3CUOA 1R23A 1XSXA 1FPQA 3BJAA 3P9IA 4ZYGA
chains in the Genus database with same CATH superfamily
2O9VA 4DOWA 5GAN2 2JUGA 4BH9A 2BHZA 5GANg 1BYMA 2LNBA 2K9GA 4M77C 2ZCWA 3V42A 2LMDA 2KIQA 4U87A 1U1SA 2ZPGB 3LSJA 4M7AG 5L3DA 3I56T 4BS9A 4FW2A 9ATCB 2EV5A 2LCCA 3IP4B 2VBYA 5K1YA 3GTPJ 1YIJT 2EPFA 3D7SB 2Y9ZA 4D9JA 2DPUA 2OJ2A 4ZDPA 1NZ9A 1ZHFA 1IN5A 3MD2A 2HAXA 2E7WA 2M7AA 4LE9A 2COBA 1VQOA 4LXCA 2CZ1B 1A6IA 4M71A 4PGGA 3IWZA 4IVNA 9ANTA 1RLQC 1JI8A 5GAN3 2M2EA 3GPLA 2K3BA 4XTUA 3R6NA 1HJDA 4CHUA 1D1AA 5JVGF 3PNYA 1YRNA 1RADB 1RAEB 4PJOF 3FXKA 3ECHA 1OYIA 3IRRA 4UV9A 2L2PA 1F43A 2L0AA 1RLPC 2CH4W 1V29B 1YJ9Q 3ZCOA 3OYEA 4FX0A 4Q4ZF 1NPRA 5M5YJ 1QHGA 4XTWA 1UEBA 4ANJA 1PSEA 5D8LB 5BQTA 2M8GX 2VODA 2QQBA 3VPRA 2LF7A 2FNPA 1BW5A 1FT9A 5FGMA 2JW4A 3KP7A 1Z3YA 4BQQA 1W0UA 1V4RA 5LHGA 5LJ5e 3VFZA 3ZN0A 2MCNA 1OX9A 4HPQA 4AU7A 3ZPLA 2MWOA 2D8JA 1O57A 1CSKA 1DPRA 3GLLA 2P0PA 1M8VA 3OS5A 4F17A 5LGUA 3PL8A 3K0LA 1PVEA 4N9HA 3GNGA 4XICA 4ZYHA 1TQPA 3OS2A 1QP3A 1O4XA 1RAHB 1SAUA 5DY9A 2VQGA 1Q7YC 4XRSG 2EZKA 4ENMA 2EQRA 4F7UF 2E64A 4M78E 1AZEA 1WPYA 1VQ6Q 2OTJQ 4UVAA 4QPOA 1S1NA 4RCCA 2EYZA 3VYHB 1B8IB 3QYGB 4N4NB 5FLMJ 2DX1A 2LT1A 1TNSA 4TVRA 2YUSA 2P5LC 1OULA 2FEZA 2MW8A 1XTDA 3VS2A 2XSJC 1ZGWA 1QP2A 2FU4A 3NFCA 3RERA 3VODA 4J6WA 3BR6A 3WGIA 3J7ZI 2OTLA 2R5YA 5J1RA 3EG9A 1OYYA 2K86A 2DFUA 3PMIA 3CCMT 1VQ8I 4JS4A 1RUOA 3G73A 2EFIA 5EG2A 2E2HJ 5M9OA 2CRGA 1F36A 2P8TA 2WAEA 4KITB 2LKPA 1K6OA 3MP6A 3FKIJ 3VRZA 4J9DA 3J80E 2M4GA 2J5OA 3GW2A 1GLNA 4ENNA 2ZB9A 3CLOA 4NL3A 1VFCA 1IDZA 1P2FA 3CCRI 3LA3A 3CDHA 4CA0A 4AFUC 3A8GB 3LQRA 2VONA 3PO2J 3U21A 4B8XA 3U23A 3LSRA 3W2AA 2LLKA 4RTUA 2M7BA 5EZHA 5GAMd 4M7AE 1MSFC 4I0BA 1XNIA 1G5VA 4X6AJ 5KYNA 1G2HA 4L6V5 2MAMA 1K1ZA 2SRCA 2CQNA 5KYYB 1NJIC 1ZAOA 2EV6A 3JR9A 2HD0A 4PK4A 5K5OA 2VYTA 2A0FB 2YRVA 4PUSA 3ZEHA 1X1PA 1Q81U 1VQLQ 2IEKA 1HW1A 5E3LA 3CMMA 4DYQA 5HOOA 3CC4I 2JS0A 2WBMA 1HYOA 1FP2A 3CLQA 4A3MJ 1KQSS 2LTOA 1XS9A 4II1A 1GT0C 2EGCA 1UE9A 2Z2SB 1M30A 2DMOA 2M5WA 1R36A 1IF1A 3PIPF 2EQJA 2O6GE 1KQ9A 1W1FA 1VQ4T 2BW3A 3DTEA 4A3LJ 3M07A 3GXOA 4G9YA 3S1QJ 1SKUB 1JU5C 3H0IA 5GAMf 4OINF 2ESWA 3GOXA 1EA3A 2XPWA 3WTSC 1JGSA 4KA4A 1SFKA 3BR1A 3F70A 2OBPA 1ORKA 3MKDA 1ZLJA 4IIOA 3HBLA 5D5XB 2X4HA 1MUZA 2DLPA 3EG2A 3RQ4A 3MKZA 3M53A 3CF5F 4PGHA 5DS9A 2K3FA 4F7ZA 2IT0A 2R92J 2FPEA 2P5KA 4D5CA 2FQ4A 3VJPA 4WXDA 1Z9ZA 3MEUA 2L3QA 4A4EA 4KFCA 4LG0B 3L2WA 1WSUA 2CFXA 3L2VA 3UKGA 3OYHA 4KNYA 3JCMW 1QVUA 1IXCA 1AWCA 2VKDA 3S8PA 3IKTA 4JS5A 4MNUA 2VB6A 1IN6A 2DK5A 3BT9A 2X48A 4E7LA 2LT4A 4BI8B 1AEYA 1X1CA 5CVUA 3K2ZA 5CR2A 2A6HF 2VOPA 4FW1A 2V1DA 2WY8Q 4CC3A 2MUNA 1UGRB 3OR1C 4O3MA 2VOOA 4C0DB 1OLTA 4RDUA 4ITVA 3PVQA 2Z1DA 4JJDA 1NK3P 4M75D 3CMEQ 4ORZA 4GY5A 4A3CJ 3HKZN 3K6GA 2X0LA 3D5LA 1Z6TA 4GGGA 3TDZC 4UNOA 1E0EA 1YN8A 4NBQA 5I2SA 1B6AA 2XHKA 3BWGA 2LD5A 2XF6A 3CD6A 2RMOA 1Z3XA 4MZMA 2XAFA 3REOA 3G71I 1XGNA 2DOEA 2OA4A 2HNHA 1P7JA 1O3TA 2YUQA 2YDLA 2DAOA 2W0ZA 5A2QZ 3EGDA 3CCEA 2VKVA 2HTSA 2QF7A 2QAZA 4NC6A 2ENMA 4C3HJ 1VQ5T 5EJCA 3PQKA 1GDTA 2VUMJ 4GLKA 4JJNK 2DI3A 2KLOA 2MVTA 2PTKA 3HHTB 3CF2A 2F6CA 1LEBA 1O3SA 1D09B 3I9QA 4M78D 1VQ7T 3E5UA 2FJ1A 5KCMA 4HVVA 1JTXA 4Y17A 5AT1B 4C5GA 5L23A 5LFAA 3D5RC 1IUFA 4IL6C 3CPWS 3FK6A 3ZQCA 3G2BA 4PDKA 2OTLI 2W84A 2VXEA 4IUVA 1YJNT 3DLAA 5E3MA 4QVZA 1BA5A 4D8KA 5DM7F 4NS5A 1N8RR 4BJTA 1MMDA 1RL2A 3ABTA 3CZ6A 3GTJJ 2RM4A 3Q0UA 4QQGA 3TCJA 3TOAA 1B72B 1QVFS 2NVUB 2FD5A 4NHJA 2JZ2A 4AT1B 4NB5A 2ZJ2A 4XKWA 3FXQA 2O61A 5F08A 1WNLA 2A7YA 2RJFA 3QUIA 4BXXJ 3FIWA 1YP5A 2F5TX 4M9ZA 3QOEA 2HKQB 2STWA 1JKPC 2DMTA 1XX5A 3K2AA 1FYLA 2V9PA 4RGXA 1CF7A 4YG2F 3AFHA 3ZRGA 3J7AO 1DJ7B 2QEXI 1M5Q1 5AIQA 1UG1A 4XONA 3LGFA 1I50J 4M7AD 2EQUA 3BCAA 2QXFA 1FSHA 5KNLA 1WYXA 2MLKA 1AVZC 3CO6C 2D1XA 4BD3A 5GANj 1B9MA 1WGXA 2NLUA 3OYAA 4XU3A 2P4TA 1MV0B 3I58A 4BY6B 3CXCA 2LRQA 2KT8A 2KNBB 1Q95G 4UB8C 4XRFA 4RGSA 1UB4A 4XKVA 2FRHA 1MV3A 3BROA 1AA7A 2RO0A 2XG8D 3QXEB 3EQLF 4C92A 3Q9VA 3R6OA 1N8RU 5GAOm 4BQOA 3MZ8A 1DP7P 1X58A 1HC8A 1P4XA 2RDPA 2O5RA 2PQ8A 4B1RA 2L8DA 1G3SA 4RB2C 3DLLA 4D7MA 3F0CA 2JUCA 2OAZA 3KEYA 3LSIA 2JUFA 2JVVA 2LJ0A 1I3AA 2O31A 1YG2A 2AZSA 5HLIA 2STTA 2V1XA 5HS9A 5GAN4 4IRIA 1FIPA 5J1YA 2JA2A 4LK0F 2XAUA 5HDGA 5GAOr 4Y4RA 2J05A 1OX8A 4LOCA 5C4XJ 1S7OA 1IO6A 2BZYA 1BIAA 4C9YA 3UPUA 2Y0MA 2PN6A 2QCOA 3G71Q 4AIHA 3P8DA 1K8AR 3DU5A 1OJLA 5EYRA 2VXZA 4F14A 5J4YA 2A05A 3CCQA 4IJAA 1AWXA 3PNTA 1FOYA 4M75F 1W2BA 3FLGA 2IS2A 1RI0A 1ONVA 1TWHJ 4RAZA 1P4AA 3SYTA 1QLYA 3MCAB 2X4YA 3RMSA 3KXTA 2EH3A 1Q86C 1AKHA 5CKHA 3W6VA 1KA8A 2EZIA 2P0WA 1C1AA 1WFXA 3GTKJ 3J7AY 3DKXA 2HL5C 4HSTA 3H0FA 3DBHB 2X85A 2EA2A 6AT1B 2PMUA 3TW7A 1R0BG 2PMZN 1M8MA 1S6LA 4C2TA 2DXCA 3M4YA 2HYJA 4XR6A 4QT7A 2QQAA 1H92A 3OA6A 4HBLA 1IXSB 4ELZC 3VUBA 1M4ZA 3JCMc 3CUQC 4UHTA 3S1NJ 2XICA 1WVRA 3MPUB 4M7DG 4IF4A 4C2MJ 2OZ6A 4EM1A 2O4XB 1VQMQ 1ETOA 3OIOA 4WCIA 1U5SA 1MJ9A 1MGTA 3CCEI 1M3BA 1WQ7A 2IA1A 5LD2C 1WA7A 4J9IA 4C5IA 2IW5A 1YS6A 1GVDA 1G3WA 2OD5A 3W3CA 1MJAA 1UJ8A 3G6EQ 3GIBA 1GFDA 1NHAA 4HCKA 2DMPA 2E7XA 4QIWN 4XIDA 4XN3A 5GPAA 3A8LB 2G9WA 4E6RA 5EGOA 2QEXQ 5HS8A 1R1UA 1I3QJ 2ZNZA 1RAGB 2VXFA 4EMGA 2D6FA 4IHSA 3FDRA 4G7ZF 5E20A 2HSEB 1BOBA 4C0DC 3HEFA 3HHGA 2LQWA 3CC7T 4L9TA 4ZYDA 4X0GA 2F5FA 4U88A 2HVQA 1D1BA 3A03A 1QKXA 3ZQQA 1HOMA 4PSXA 2EK5A 2LF8A 2CP5A 2KRCA 3A02A 3PIOF 4X9CA 1R4MB 2L9NA 3DXJF 5LJ3f 3S32A 1S72A 1R77A 2EB7A 5IP7J 4XK4A 4C8QC 4YTLA 2X4XA 1P92A 4M7AF 5A0GA 2HQNA 4I0AA 2DXBA 3WTTC 1Z77A 2RQPA 5LHIA 3BQYA 1USSA 4GRIA 3X2QH 4HF2A 1H641 1R4NB 1UDLA 3BG5A 4ASNA 1TH7A 3RPUA 2PLYA 2JWTA 2WAQN 4KT6A 1TQIA 1FMKA 2K57A 3KUFA 2E1NA 3CCVA 1M3CA 2IGMA 2VT2A 3CCJI 2PI0A 1N25A 4MHGA 3H9GA 2GTJA 2W1OA 4P9UA 1W0TA 4WX9A 2PUKB 1KQSP 2F5VA 3C2BA 3V8KA 5LJ3h 2WWYA 4D7NA 5GMKl 1QQIA 5DD8A 3HSFA 3E6DA 3HOYJ 3G1JA 4EMKC 3K4JA 1Q82R 2RNJA 1T3LA 4C3IJ 1WHUA 1XCVA 3BG9A 2DU9A 2XDPA 4A53A 1PYVA 3H9JA 3OMYA 3T1BA 5BNGA 2QASA 2L7MP 4AFZC 3CEYA 5BOXA 4LD9K 2ZBKA 3L1PA 3QJ6A 5GAEJ 2JK3A 2DO3A 2QQSA 5IYBJ 4XU1A 2DJIA 2F4MB 1GRIA 3EUKL 1N5ZA 2RB6A 3VYUB 7AT1B 5HNHA 3OBYA 4Q5SF 3M9AA 1K7AA 4IHVA 3L42A 1HSTA 1WIEA 2PG4A 1VQ9A 3MCZA 5GANd 1AHDP 1ZR2A 4JDSA 4A3IJ 1J0RA 5LLQA 4JLGA 3MN2A 4B43A 3FMQA 3E3VA 4Y3OA 2YRDA 3C12A 4DBHA 4PJOB 2MF2A 3JB9I 4JK1X 2G3RA 2WSCE 4DEXA 4QW2A 3GTOJ 3KP2A 5E1WA 2CW8A 2ZCFB 1DUXC 3SXYA 4AVPA 2XAJA 3FHZA 1OEBA 3TSWA 4EPCA 1XQHA 3S1RJ 1ZSZC 1Q82U 1GL5A 1I0CA 4HEA2 1W5TA 1YW7A 3OYNA 1N77A 3QJYA 5TRDA 2R5MA 4BY6C 4NQWB 3M8JA 4Y15A 1QRYA 2HOTA 5FRMA 3A2KA 4UVCA 4BDYA 3DEEA 5FU6B 3G4SA 3GP8A 3WTWC 1O7LA 1ZN2A 3C4SA 1AWWA 1UGPB 4RM2A 3WE2A 5AIPA 1W70A 5DCMB 2NAZA 2AHJB 2VQHA 2Z16A 1GCPA 2HTJA 3M0PA 1RABB 2FXAA 3I59A 1E7OA 4MTDA 1RZ4A 2P81A 5DUKA 1K79A 2X4JA 3FB9A 4CC7A 1ZKGA 2FRWA 3HTSB 4F7UB 2X3XD 4HCCA 1H9TA 3EG1A 2JS2A 4RCBA 1YI2A 3BJ6A 4YELA 2L3SA 4LDUA 2YU9J 1ZUUA 4IO9F 3HXLA 4PJMA 2F48A 2WSFE 1D0ZA 2F4IA 3OOUA 3RSNA 2LY9A 1WKMA 4O6JA 3MEWA 2FZGB 2OQRA 1ZREA 5IYDJ 2BBYA 2RQQA 4JOMA 2WADA 5ECAA 1H88C 4R1HA 4G6TB 1KSWA 3U1DA 3BY6A 4W1UA 3H1CA 3CPWP 2BY2A 3CCJQ 1YJWT 2DE0X 2FNAA 2DT5A 2GFAA 1TT5B 3LH0A 3P8HA 3ZMDA 5F64A 5LJ3e 5GMKi 2K9MA 5BPDA 4BDZA 2VJ5A 3QIIA 3BG3A 1NBEB 2K7LA 8ATCB 3LWIA 2QZ8A 4BY7J 4XAXB 3NEUA 1QVFP 1SEUA 2JJ9A 1K6YA 4YRVA 2L4AA 3L7WA 4L5GA 4A0YA 1OMIA 1MBEA 1OISA 5HK3A 3K10A 1S72I 3NAUA 4PSWA 3GX4X 1UMQA 3BFMA 1C0WA 4L0ZB 3LL7A 4RGRA 3K9TA 2MPXC 1RI7A 2ZZDA 1PSFA 5M3FJ 3V7RA 2RK1A 3M56A 2EA4A 2LCLA 2EINH 2PMZA 2KEAA 1VI0A 4HRIA 1X1AA 2IIMA 4I98B 4KH0B 3E6CC 1B9NA 3K1PA 5IH2A 2JZYA 5GAOq 2MC3A 3VEPA 4A12A 1M1KC 2RH2A 2BE9B 1KZHA 3KFWX 1Y39A 2HDDA 3BG6A 3R4KA 1B8IA 1QVPA 3CDLA 1G3YA 1XTAA 2LBFB 4LITA 2D1VA 1PC0A 2DJQA 2KQWA 3CC2T 2DETA 2DT7B 3AG1H 4Z6YA 1ZA1B 2EGAA 4BI4A 5ICCA 3PSFA 1ITYA 2DEQA 2CU7A 2CV2A 2EGEA 1WRJA 2J06A 4X1EA 2MIOA 2DTHA 2HR3A 3TKYA 1Q1VA 1K9MC 2XAHA 2GBYA 1K9AA 1MBHA 1SAXA 3I5UA 1USTA 2LDUA 1D0YA 3F8FA 3MZYA 4OMPA 3RDVA 1KJWA 2KT1A 2AQEA 3F3XA 4HX4A 1OZ2A 2NWMA 2R7QA 2IS1A 1YHQQ 3ABUA 4II2A 3GBGA 4M3GA 2X6XA 2ISZA 3HL8A 4RA2A 2YU3A 3Q5FA 2DL5A 2FMLA 5CVRA 1OFCX 2KMTA 5KYYA 2E65A 5H20A 2O9LA 2Y4YA 4ZTFA 4MLOA 3JSPA 3SFZA 3H6ZA 4M77G 1YITA 2KVQG 2EFNA 2XIGA 3EPZA 2WAQA 1HLVA 1YJ9T 2RJEA 3LLRA 2ME6A 2L5QA 3JB9G 2E71A 3S3MA 1H89C 4B9WA 3TBIA 1VF9A 2BGCA 1VQ9I 2CGPA 1T6SA 3G4SI 1K76A 3URGA 2PVOB 4M7DD 1LKXA 1BCOA 2VIXA 1TWAJ 5AONA 2ZPEB 3KP4A 1TBXA 4IPAA 3ROUA 2KRSA 2RREA 4FM4B 3VS5A 1VYVA 1FYMA 3I4MJ 2P0QA 1ON2A 4OF1A 1OCPA 3SZPA 4LDYA 4YFNF 1U0JA 3TL4X 3M3YJ 3PFSA 4J9HA 3L2RA 2CGHA 2COWA 3L1AA 2EQIA 2V4JC 3KX2A 2NYXA 1JJ8C 4IZZA 2DPPB 1R6RA 2W7NA 4CH7A 2QKMB 3C18A 2HXIA 1JXOA 3OMCA 1X1BA 2EWNA 3VYTB 3LAJA 1QCFA 5I2MA 5GAN6 1FWZA 2N8GA 2VE8A 2HZTA 1JJ6C 1SHFA 3P7NA 3KZZA 1VQ6T 2OTJT 1HF0A 3CCSA 2VKEA 3B6AA 1AD5A 1K73C 5A0LA 2DLLA 2DQRA 4LG0A 2E5NA 1I5LA 2K2VA 5HLGA 4HVUA 2A28A 1W5SA 1W7PD 2QVOA 2VE9A 3WE3A 1DQUA 1BI3A 2DA7A 2XROA 1JKOC 2LVMA 2BYVE 4FTHA 2BV6A 3E5XA 4BBSJ 1D8JA 2H6CA 4BYYA 1YIOA 1JUPA 2EQKA 5ICGA 1D3BB 3VS0A 4AFQC 4F04B 4ZGDB 1A31A 5KYXB 2HKNA 3J7YJ 2P6TA 3EYIA 1ZGJA 4OP0A 2R7RA 3P9CA 1NLPC 4QQ6A 3T8RA 3JRCA 1HSQA 5I22A 5FLXK 2O88A 1M90R 1QCOA 2O03A 1Z21A 1W36D 4QLCU 1HW2A 1LFPA 4EDUA 2OI3A 1ARKA 2OQGA 2B9SA 1ZTRA 2NYSA 1K78B 1KU7A 4KMUX 3A98A 1I6HJ 3CPFA 2DMNA 1E6GA 3JCMQ 1VQPQ 1Y0MA 4HV5A 5K7ZA 2LC4A 2F5KA 1XGSA 1RAAB 3REAB 2L02A 2DPDA 3I5SA 5LJ3g 4JJBA 3MKWB 3PE0A 5C0MA 4QWQA 1VQLT 3ZQFA 2VC8A 4AFSC 4C92E 5LJ5f 1VIFA 3NQOA 2A68F 2ATCB 4MO7A 2BHYA 5A2QE 3GYHX 5F04A 1LFUP 1GBQA 3IC7A 1WHJA 1KHCA 2B63J 2KP6A 3WGHA 2CQ7A 1ZGAA 2K5FA 4B6MA 4A93J 3NTIA 1LEAA 3FBIB 2L7KA 2GWRA 3SHFA 1M90U 1ZRCA 2V6EA 1OCRH 1Z05A 2K5CA 3VYRB 4R56A 3MKYB 1T95A 1IJWC 2ZKZA 4FYYB 1Y0UA 4XKCA 2QENA 4L5JA 5J1UA 1QQJA 1J9IA 5HKCA 1B72A 3QQAA 5GAMj 2H8WA 5TISC 2K6DA 4MZPA 4A6DA 4D1QA 1VQNT 3WVDB 2RQVA 4A54A 2BOLA 2AKKA 2BZXA 1DU6A 1V3FA 1WPKA 5H6QA 3CCLI 4RB0A 2DTIA 4N9IA 3FM5A 3ISPA 4LFUA 1OKRA 2AZVA 3NPFA 4M75B 2EQMA 3ZFJA 4M7DF 4KUDK 4ENJA 1M2VB 2O7OA 3HP9A 5CO7A 4A63B 1W6XA 1LQ1A 3OBWA 1EH6A 2XPVA 1MIJA 4EVIA 1I4K1 1TUGB 2DA9A 3ESWB 1YITI 2LK2A 5EG0B 3CESA 3FBNB 1N6AA 2OUMA 3D1NI 3N4MA 1D3YA 4UV8A 5M5XJ 1OPCA 2IPOB 1Q7YU 1BC7C 3QODA 1X75C 3ZR8X 1EFNA 1H3ZA 1GV2A 4YIFA 4MEXF 2GZWA 2KROA 4R8HA 4HQEA 1UZCA 1ZHIA 1X3UA 4RM3A 1VQ8T 2DYRH 1T0JA 1M27C 2DTOA 2OC6A 2KZVA 5D8KB 1FP1D 1AT1B 1HCRA 4C92C 1FEXA 1YWPA 2RGVA 3I56A 1M1EB 1R1VA 2VC0A 5IY5H 1AHJB 2KHMA 1LNWA 1YIJA 2I5UA 2M45A 2XRLA 3OYLA 2PJPA 2JMAA 2VUBA 4RTVA 4Y91A 3HRMA 3CCRT 4OMFB 3VS1A 3AAFA 3AT1B 1RRJA 3MEXA 2BVLA 3MQ0A 1UELB 2VVKA 3ZMSA 2A08A 1LDKB 2Y75A 3VSKA 4ESBA 2NS8A 3CCSI 2IPQX 2OU2A 2EIMH 1R58A 4KGZB 3V7CA 4CCLA 3BZKA 3HOUJ 4DBFA 2IAIA 4A3EJ 4LB5A 3ULQB 1TW3A 3QSUA 1KU2A 1SMTA 3K4LA 4RAFA 3CCUI 1N9SA 3CJNA 4RKUE 3S6WA 2Z5UA 3FJPA 4HAMA 3DPUA 2R5ZA 1G83A 2RPNA 2RHUA 2JN0A 5GAGJ 3VOEA 2QGGA 2RI5A 2NVXJ 5GAOl 1K0XA 1PDNC 1JJ2S 1TWFJ 4G6DA 2M35A 2R57A 1AOJA 1YS7A 1D0XA 1FBSA 3SDZA 2JM8A 3HKSA 3K4CA 4DOZA 1U8RA 1R22A 2CT3A 5K5QA 1CGPA 1SD7A 3ZP5A 2CUJA 4I99C 1B34B 1XCBA 1GFCA 1ZBJA 1X4PA 2K4YA 2KXCA 3Q3SA 2O4XA 3PT9A 5M5WJ 1V54H 1GUUA 2OX7A 4E7SA 1XMAA 2WB1N 5KK1A 2HQAA 2ZFUA 2COZA 2DYIA 2QG9B 3EGUA 3CCLQ 4CUGA 2H1KA 1EH7A 2RJCA 1QW1A 2HQXA 1XG1A 2KIMA 3O8VA 4OGCA 3W2VA 2KPMA 3GF2A 2XUBA 5E18F 1M9SA 2IXSA 3O6BB 2V26A 4ZC3A 3OY9A 2CP6A 2DL8A 1G6NA 4MTEA 2A3SA 1DP3A 3RESA 3NRVA 2DQLA 5CKEA 1QWEA 5EF6A 3CCMA 2DRMA 1ZG5A 2NS7A 1HQCA 4B48A 1JB0E 1XDSA 2HDWA 1GXPA 2QTXA 4M77D 4Y33A 1Q81R 2M1BA 5GMKm 3D0SA 1X6OA 2BE7D 4AD9A 5F6FA 1KC8C 3RMQA 5FLXR 4N4IA 2JQ7A 1MJBA 3JB9D 3RKQA 4B3AA 3TP3A 2CG4A 2FOWA 1X2KA 2LFBA 4U0WA 4W97A 1Z91A 2GA1A 3BPXA 8AT1B 1FY7A 1UJ0A 2QTVA 1TLHB 4Q48A 3WHCA 3M5AA 5C4JJ 1RIOH 1WDXA 3PGGA 2JA7J 3DPTA 4R55A 3G71T 3TO7A 2XGDA 2UV1A 2QDYB 5A0DA 1V55H 3ECOA 1QO0D 2MFZA 3F22A 4QTRA 2X6YA 1OYXA 3FMSA 5GAOp 3E7LA 4AYBN 1R49A 2Y0SN 1WHHA 2AO9A 3H41A 1ZG1A 2H3EB 4C2UA 2MOXA 1IRZA 2GQVA 4IEJA 5BPIA 1MKMA 1BBZA 1QZZA 3QPSA 1VQ4A 5J47A 1VZ0A 3H92A 2V7FA 2HBPA 1VQPT 2HOSA 3QBYA 5D6WA 4HNUA 4C0GA 3CCUQ 3EFOB 5HDKA 4BUGA 2FOKA 2CZ0B 4X34A 3I56I 3OYBA 1AZGB 1FC3A 3VB2A 3EHQA 1KHIA 1UGSB 1F9NA 3HSRA 1YIJI 3FWEA 3I71A 5DV5A 4XORA 5E17F 4PJOA 1YX5A 2WSEE 2DCEA 3CJRB 1HDDC 4YIIA 1VQMT 2KRFA 4ELYC 1REPC 2I0NA 4KT0E 2QGFB 1UHWA 3K1NA 5ICEA 4N4GA 3WVEB 2LTPA 3QP6A 2VN2A 3W6KB 1YFHA 3KLNA 1JXMA 2M1HA 3F8CA 3G6ET 2D8HA 3VU3C 3CCYA 3J81K 4HF1A 3OSFA 1T38A 5FLVA 1WI3A 5CKBA 2QEXT 3H9NA 2XDVA 2ISYA 3ZGKA 3RZOJ 4NQWA 1PM3A 3JB9H 1VQOI 4KDPA 1YYVA 4XOPA 1LE8B 2Y31A 5LHHA 2K3XA 1GV5A 4MQVA 1YQAA 2W48A 2K3YA 4J19A 3E1SA 5DCMA 2K9SA 3T5XA 3GTQJ 2DDAA 5CLSA 2YT6A 4OB3B 3WU1B 4OGEA 3UATA 2M9HA 3ZN1A 3TP0A 2DAQA 3OQ5A 2K9QA 3HG9A 1OCZH 3TGNA 2UXXA 2HDAA 4I09A 2H94A 3HSEA 3F9KA 4RB1A 3OYGA 3CBPA 4F7UA 3F72A 5B66C 1X27A 5LJ3j 2AT1B 2CV1A 2Y90A 2VJIA 3QOPA 4AIDA 4Y13A 1X2MA 3GFLA 3EDPA 4DGWB 3IWFA 4KUMA 3DU6A 1T3SA 2X6OA 3JAMK 1UHCA 2YRCA 2GFUA 4FYVB 4FQGA 5BMZA 2M0YA 4C0FA 2K40A 2R7WA 2QBYB 1VQ8Q 1IG7A 4CCNA 2W00A 3JRFA 2JT4A 2DTZA 4M3DA 3MP1A 5J4VA 4PNOA 2PJRB 1B59A 1R7JA 1VUBA 1U8BA 5HS7A 1VQ5A 2A37A 2F1LA 5E3OA 2YS9A 3M0UA 1GXIE 1IREB 1SD6A 4M77F 1TZLA 1QZEA 1P4WA 1YX3A 1PG5B 1OPLA 4I01A 1X6BA 2LQKA 3CCRQ 4XOTA 1VQ7A 3B73A 3K7AJ 3LA7A 1QBJA 1C0MA 1XPXA 1WX6A 3JB9F 3ZMVA 4LNPA 3R0AA 4RTZA 2HS5A 2C06A 3CCMI 1YJNA 2VWFA 2FG0A 4XNFA 3DBRB 2Z3YA 4XLFA 1TXQA 2CZ6B 4JJCA 3F8BA 5LJ5g 1IV6A 4J9BA 1BJZA 1KIKA 4OU0A 3QYEA 5GAN7 1Q86U 4Y92A 1TNTA 2PFBA 3SB2A 5KYWB 3CC4Q 1RR7A 3GCMA 4MQ9F 1N9RA 3TOBA 5CVIA 2YX7A 1Y07A 2GQQA 2XAQA 1R5GA 3BR2A 3HPGA 2D45A 1O9SA 2ID6A 4BEHB 1UTIA 1EF4A 1Z9QA 2GAUA 4ZYAA 4HCZA 1K0SA 4FASD 3KE2A 2BE5F 4Q5WA 4AWXB 3FXRA 5DM6F 4UUVA 5GAN5 1VQNA 5CQYA 3DQVC 1GCQC 4XLAA 1LPQA 3T8TA 4AUXA 1PUEE 2RHZA 1HBXG 1XSDA 2ECZA 4S0HB 1BU1A 3ZQLA 2R5AA 2QGUA 2LBFA 1Z7LA 4OIPF 3V8LA 4EM2A 3RI4A 3DB4A 1BL0A 2NXNB 3A1PA 2EFPA 4JP0A 5DUIA 3MEAA 5HCKA 1RKWA 4C5EA 2IS4A 4A4HA 3DTKA 4OMMA 3BG7A 2ZJRF 3HGGA 5IXFA 4J6XA 3WTUC 5IT9E 3PVLA 1XOVA 1VQOQ 1WFWA 4K2EA 1VQ4I 4JX5A 1HW5A 4RG8A 3MKLA 1OI1A 4KIGA 1QKWA 2TRTA 1YLFA 2HQ5A 1DGRM 2DBMA 3QRFF 1X19A 3RYPA 2HEQA 2VL8A 2L3RA 3M55A 2R58A 1KQSA 2FSWA 3V8JA 1R0CB 5B3SH 2K7AA 4OAZA 3LSGA 1N27A 1XMKA 5LBQA 2E5QA 5JR3A 2JTMA 1AOYA 1RPWA 4CXFA 1J2XA 2CP0A 1PRMC 3S16J 4I2OA 2CS3A 5E8GA 1G8XA 3C2GA 5D5VB 1QZYA 3NTHA 4BXUA 1Y1WJ 2E35A 2KYMA 4HKEA 2CMPA 3CCJT 4GYIA 2EKHA 1LCKA 3F8NA 2NUTB 3C3WA 3DWLE 1IGUA 2DOAA 1NEBA 1O75A 3H35A 2VGMA 1KQ8A 2LJ3A 2HGCA 3K4BA 2DBKA 4LLNA 2XGXA 3ASOH 3IHUA 1ETXA 1UGVA 3OL3A 4KJZA 2CS7A 5FWCA 3PTAA 2KIFA 2Q0OA 2QYOA 3K4KA 3RPQA 3I3LA 3VYGA 1JJ2P 4ZZLA 3RKXA 3TDUC 4UXNA 3ZMZA 1V1CA 4N0AC 1MMAA 4C8QE 2Y0SA 2DDBA 3O5ZA 2KIUA 1G2BA 2RKHA 2JOYA 1TWCJ 3R6SA 4B09A 2M0MA 4HNTA 2MH9A 1K61A 3E6MA 3KZYA 2BUDA 3AHUA 3QAHA 4PZJA 2G6FX 3A1YA 4CICA 3MAJA 1O7FA 2M0CA 2YR2A 1JEGA 2M3AA 5J8FA 2LP5A 3Q1JA 3RNJA 2K79A 4L5IA 4NL2A 4M73A 4U7DA 3QHSA 4YEJA 1NYFA 1IN8A 2OZUA 2OTLQ 4NNJA 1SRMA 2CKKA 4RMOA 2ECCA 4RLQA 3O3KA 1TP4A 4J7IA 2XASA 4LG3A 2WC2A 4CYDA 3CD6I 1VQ5I 3ONQA 5FFXA 1G4DA 1I07A 1JBMA 3G1LA 3C0CA 3E19A 3QDFA 4A3DJ 4M78F 3VRYA 2CWEA 3FF5A 3MMYB 3J81R 1FOXA 2GIVA 3BE3A 3NARA 3FXUA 5LJ3d 3GF5A 1YTYA 1VQ7I 1K83J 1OU9A 2DF6A 3QU6A 1Z6RA 1D1CA 4ZNXA 2PMHA 1YRNB 1D3BA 5IYCJ 1Y7XA 2DFEA 1KYZA 5KYXA 1WJ5A 2EW3A 2XAGA 2R3SA 2AIRB 3CC7A 3GFIA 4ZN1A 2AXLA 4E2FB 5LL6S 2KJBA 2DRKA 3HOSA 1ERDA 2DD4A 4PFZA 5HLHA 3LW5E 5CK9A 4N0BA 1MNDA 1N75A 2O9SA 2JXBA 5F1JA 4M7DB 4L9NA 4S05A 5B5EC 1BIBA 1K78A 5KCOA 2PVDB 1YHQT 3TMOA 2CSQA 4IHXA 4P5NA 3X24B 1MD0A 3CPWA 2V1RA 2E34A 2GOMA 3MEVA 4M3BA 2MSYA 3FZVA 4G7HF 3JAMR 4KYWA 1VQNI 1SD4A 5DLQE 1ENHA 4J9CA 3QKJA 2CYYA 2ECBA 1QVFA 3TSZA 5L3EA 1OCTC 3OYIA 3HKZA 2LP0A 3WTXC 3BR0A 2YPRA 1SD5A 1CKBA 1IB8A 4HA8A 1N8RC 4JYKA 3M0TA 4P9FA 2EKOA 2VLAA 1JT0A 2MD0A 5M3MJ 3A8MB 2DA2A 3HRUA 1G3TA 2EFQA 2VKHA 2LMJA 1W7PB 3I53A 5JFRA 1MH3A 5KAIC 3N97A 3QYBA 1KGSA 1PKSA 2IGNA 4OWRB 2V8KA 3JREA 3HSBA 3GBQA 2VV5A 1ZBXA 1QWFA 1F1BB 2X4WA 1T56A 3R60A 5DTDA 4ON0A 3OYKA 5J40A 4H4KC 2P4WA 4EATA 1I5OB 4U7BA 3VKIA 2DZ9A 4Z89A 3KETA 3B6CA 4DYCA 4F52A 4M75A 3TO6A 3NWSA 5FKNA 2VPLA 1PWTA 2ZPIB 3KPHA 2ID3A 4A2UA 2NNNA 1M2VA 4XTXA 5D6YA 3ZBDA 3MFKA 1VQKA 2XD0A 1AWOA 2KDOA 2GGRA 4FYWB 2P7CB 2DL7A 4IUUA 1GXQA 4LD5A 3HPHA 3DEWA 3GZNB 3FM3A 3SDBA 3WU0A 1S7AA 5EG0A 4HDVA 2FZKB 3PMTA 5I21A 2ZSIB 2HDCA 1XGMA 3A8HB 5E79C 3LAPA 3UT1A 3DBLB 2HQEA 4MIMA 1B07A 3I55A 4HX7A 3CD6Q 2D1HA 2HYFA 2OF7A 2X98A 4GCVA 3HUGB 5FD6A 1M1KU 2HI3A 3MZHA 3I4NJ 1UUEA 4LDXA 1FMWA 3MWMA 2PQWA 2TDXA 1N78A 4E47A 2DODA 3CCQI 3QWYA 5IXBA 3CCEQ 2KKOA 3BCBA 2CYZB 2F5CA 3GTLJ 3LFUA 1JT6A 2LREA 1H9GA 1UHMA 2YSRA 3J7AW 5FLXZ 2RD1A 1E3PA 3LSKA 1MSEC 2YUNA 4C8QD 1WJBA 4JRQA 4J5YA 3M54A 4FYXB 5J3LA 1RUWA 1HKSA 1WHGA 2CQKA 2A6TA 3BZCA 4ZZDA 1K8AC 4RBOA 4BY1J 4V2FA 3TQNA 2BTTA 2UUZA 3JRBA 2VT3A 1EZZB 1OQKA 2JTFA 4TV7A 2FBIA 2E60A 2ZXWH 5K7FA 2ACJA 3TEEA 1FZPB 4FSXA 1OV3A 2H3JA 3BR5A 4BHBA 4QVDA 4XU2A 2ROLA 2L7ZA 3SD4A 3MO8A 5LJ5j 2L4MA 4ENKA 3PIOA 3ZQGA 1SSFA 3S93A 3M4OJ 4C5HA 5J3BA 1F1ZA 3FDYA 2KT0A 3AG4H 5KE3A 1PRLC 4A4FA 2V9KA 1MH4A 4KMFA 4ZYEA 1H8AC 4HF0A 4IHWA 1WJSA 4XQ3A 1TWGJ 4HYEA 2RK2A 4JUVA 3WXMB 2XMFA 3G3ZA 1SFOJ 2HQRA 5KVRA 2P7VB 2V79A 1X2QA 3T9NA 1WJFA 4A3KJ 1RETA 4FX4A 2DOFA 3N05A 1PKTA 4CRIA 2G7UA 4XN0A 1B34A 2KDZA 1JHFA 2EZHA 2KAFA 5D7UA 4CI0C 2K5LA 1YBYA 2PZ1A 2BY3A 1RKTA 1MMSA 3KP3A 4RGUA 1B7TA 2Z99A 4IOAF 3M0QA 2W4SA 3R61A 4G8XA 3JRDA 2VBXA 1R1TA 3VDXA 1GCQA 2FPFA 2DMQA 3CMAA 1MGQA 4CZZA 2CUDA 2EYWA 5FU7B 1U2WA 2LNVA 1VTNC 2XF5A 3OL4A 3GZ6A 2OCCH 1L3LA 2MZ4A 2EBIA 4HXJA 4M3FA 2R7ZJ 3CC2A 3CCVI 4MDXA 2ROTA 1BB9A 2F2WA 4HT9A 2BVMA 1I6XA 2E36A 1U1TA 4RTWA 1HK9A 5KYUB 4E7HA 2QYZA 3ER0A 4D8DA 1J09A 3WG9A 4BE0A 2DXIA 3DKMA 2D2WA 1Y57A 5EDNA 4CYCB 3HL2A 4OMOA 4PJOE 1KK7A 2NUPB 3GUDA 2OJED 5KE2A 4YFKF 4FSSA 3ABLH 2DTRA 2E1MB 5GMKh 5DD4A 1RUNA 2RQWA 4HG2A 1OR7C 4WF2A 2F2VA 2HSPA 1J7KA 1LJOA 1A35A 1WZ2A 3CCQQ 4EM0B 5ED4A 1KD1R 3HIFA 4XRSA 3K1MA 1FYKA 4LN2A 1I5ZA 1WHLA 3ZQIA 3HOZJ 1JXSA 2YLCA 4PFOA 1ZUKA 3MJXA 2L01A 2HU9A 1P9QC 1Q82C 4RB3C 1TUDA 1Y6IA 2NOGA 1VQKI 2CH0A 3PJRA 3JCMf 1XN7A 4BNCA 2R7DA 2VGNA 5CQEA 3THKA 1IRXA 3M0SA 4FT8A 2UZKA 4C92G 3JCMP 2K9NA 1RESA 1QVGS 4IHTA 2FPDA 1YJ9A 3MVPA 2ZC2A 4F55A 2W25A 5JLWA 1K4SA 5IPAA 1APLC 4PLLA 1U5TB 2A5WA 3OYDA 4IRGA 3I55I 4C8QF 4F7UE 5C6SA 1UAAA 2GNCA 1ZR4A 4L59A 2LG4A 2X9DA 2LNHB 2RVCA 4A6EA 2X9HA 2M4KA 2MGQA 2FZCB 4RMNA 3L2QA 3BLYA 1U3EM 4CCOA 4N0AA 3EFOA 2L7FP 3JCMh 2L3DA 1NG6A 5LRSA 1A0NB 1KD1U 3JRZA 5FRNA 3QPTA 5GP9A 1MBGA 4EV0A 3J80K 4LDVA 3UWNA 1SVMA 1MBKA 2JPCA 3M8EA 1FOWA 1MW7A 2CJJA 2QK0A 3CMET 1VNDA 2FRYA 3LA2A 5FO5A 5IOZA 2ETHA 1ETWA 5D6XA 4Z02A 2K2MA 4KT5C 4OB1B 4M77B 3M58A 4WXHA 4IUTA 4XLEA 1I81A 1M3AA 1XB4A 1ABQA 4Z88A 3TREA 5DYMA 2QSGX 3CCLT 3OW2S 4KULA 2GCXA 1VQ6A 3BJOA 4C30A 5B1AH 2GXGA 1YI2I 5GJVB 4PJOC 5GANe 2OTJA 3FJ5A 2DFFA 1BOAA 2VJ4A 2G7HA 1MDMB 2DVEA 1WQ2A 2ZGWA 1I1GA 2EILH 3BDDA 5A2QR 1RC9A 4MFDA 4A0ZA 1RAFB 1S72Q 4OIQF 2L0KA 3M8FA 1FNNA 2R7TA 3I35A 4EJUA 1T0FA 4CZCA 1LVKA 1LE8A 1BCMA 3RCOA 1V5GA 2F5DA 3QG1A 4Z8AA 5J26A 3WHBA 3BOQA 3HB9A 1AU7A 1DDNA 4OMYA 2Z9OA 1WJDA 1YCSB 1OZ3A 4FE7A 2FB7A 4QPQA 2L9RA 1RACB 1LJ9A 1M1FA 4XRMA 3E9FA 3P8BB 2F4OB 1JUSA 4EGZA 5FU6C 3CCVQ 3X26B 3EG0A 2K5IA 3NGPA 4P5OA 3HFNA 3OS0A 4LUDA 3SEQA 3K70C 1PUFB 4KUIA 2X51A 1FXXA 1PD1A 2PBIA 1SFEA 3BP8A 3RZDJ 2L54A 2E41A 2MI6A 5LJ5d 5CKDA 3PFYA 3HYIA 4BB7A 3KLOA 4J01A 5GMKe 3OYFA 1LDJA 1JUMA 2A07F 3S2DJ 4QQDA 2QBYA 4LIVA 2BXZA 1TL8A 3GWZA 3CO7C 2PJRA 2VC1A 1PHTA 4C3JJ 4ZDOA 1IHWA 4PFPA 3JRAA 2HVRA 1VQLA 4JRKA 3OS1A 3CMAI 3CP2A 3HGYA 3IH2A 1Z7UA 5HNFA 3PSIA 4M6VA 1R9TJ 4IUQA 1X3ZB 3M1EA 1QU3A 4XBFA 2RHYA 1VQKQ 3CC2I 3H5RA 4IIMA 2X1CA 4M72A 4XKBA 5CKTA 3ZMTA 3X28B 5HK0A 1X6GA 2L3PA 5K5RA 4J9GA 1QPMA 3IAS2 2J6KA 2KRMA 1KG1A 1UJYA 3K4MA 5LGTA 1D5YA 2O2OA 3CCUT 1ZUYA 5CKFA 2M30A 3I55Q 2R7OA 5LEKA 2MBFA 3PQJA 4RAGA 5IP6A 2CQQA 2HPMA 4MMLA 2NUZA 1WJEA 3H0GJ 1YCYA 4NOYA 5L3FA 4L0YB 2M0OA 5KYWA 1Q7YR 3QZ5B 2LX7A 3W2WA 3DPLC 3S17J 4J6YA 2ELHA 3C7JA 4CC4B 3JCMe 1VQ9Q 2ELKA 4BEHA 4XTVA 3I9V2 3G4SQ 2G0EA 3OIQA 2DA5A 2R7XA 3AKZA 2P0TA 1BKBA 3OOPA 4HQMA 1B3QA 2QQRA 3K69A 1ACIA 5KH6A 3I0TA 2WAFA 1WHMA 1R5ID 4MMKA 5FU7C 1R00A 1SFXA 4CCMA 1C6VX 1IGNA 1HA8A 2CSIA 2MWPA 1BR1A 2TCTA 2W82A 3PM1A 3J81Z 3A01B 1IHVA 2V8IA 3OSGA 2ZPBB 2HWVA 4B9XA 2QQ9A 1YI2Q 1YJ9I 4KISA 3EH2A 3EFSA 1KFZA 4RS8A 1JKRC 2NVQJ 3GVAA 1Y0NA 2HKOA 2DILA 1X1DA 1SG5A 1ZK8A 1XD7A 3UDCA 1YE9A 2DIQA 4B3XA 1U3OA 1ZG3A 3EETA 1H3HA 4MGRA 2VBWA 3ZQHA 4ME7A 2WA0A 1UB9A 3JCMX 3A0HC 2P4RA 4LMYA 2E6NA 2WACA 2H1LA 2X1EA 2LOOA 4PCQA 5FD5A 1X2NA 3ZXSA 2Y4XA 4B44A 3SWNB 1NPPA 2QSHX 1D8KA 3S3OA 1NLOC 4YFXF 1NJIR 1IN7A 2A5YB 2F2EA 3PFIA 4I7HA 3V4GA 2EJ9A 2JRMA 3QPHA 4ZGEB 2DYSH 3V7SA 1OCOH 1TQMA 1Z0XA 1TS9A 4M78B 1GVJA 3S2HJ 1FX7A 2MH2A 4OMZA 2JM9A 4XLHA 3JAMZ 4BJ6C 4IXAA 1KC8U 3SEZA 2Q8KA 1ON1A 4DBRA 1VQ6I 1LOJA 2IBDA 3F21A 2OTJI 2IGOA 3RIRA 1TWBA 1BI1A 2WY7Q 1AWJA 2RQRA 1WGSA 2RV8A 5CQXA 2NUTA 3HOTA 3SJMA 2FBKA 2A69F 2VPRA 1R71A 5IT9K 2X3WD 2FE3A 1IN4A 1J75A 2A6EF 4IHYA 4OOIA 2CO5A 3H5AA 3CMAQ 3JB9J 4DZJA 3LSHA 2ZJQF 3G1OA 4F91B 1QVTA 2BKDN 2VASA 3ABKH 3ASNH 3ML6A 4BAYA 2NNYA 5D5WB 5IN1A 2QSFX 3LNQA 2PX9A 4Q47A 3OSSC 2XB0X 2HBWA 3GEZA 1IRGA 2FO0A 4B4CA 3CC4T 1NJIU 2XF7A 1D5VA 4VUBA 5H6RA 5HY6A 4M7AB 4KN4X 1V5EA 4M9XA 1R8OB 2K3PA 5GTHC 4KICA 2DKGA 1DPUA 3I59B 3J80R 2QM3A 2MD5A 5GAHJ 5J8CA 1YFNA 4II3A 4KH1B 5JHFA 1RAIB 1EKEA 3O2PE 2KY9A 2Y9YA 2OPTA 4L9VA 4LJZF 4DW6A 1SF9A 5KCHA 4ESRA 3ERED 2GA2A 1E17A 1ZQ1A 2MMPA 2E5ZA 3TVTA 2JA5J 5CAIA 3WTZA 2DYBA 2CUFA 1VQLI 4KGXB 3GMEA 2B8AA 3L2UA 1SSHA 4D0PA 3M0RA 2LR8A 3S15J 4DA4A 1R5HA 5E3NA 5JLXA 3ABMH 3P5JA 1M90C 1SC7A 2RC4A 5AYFA 1VQOT 2LKSA 2JA6J 2JRTA 5F0CA 4EJWA 1QPIA 5L3GA 3LOCA 3FKJA 4HLYA 1TUCA 2IA0A 1YWOA 2P6SA 4M75E 1WCMJ 3HHHA 2Q1ZB 4C92D 1KONA 5GAOn 1YITQ 4HT8A 4M7DA 1IW7F 1LUJB 1LVAA 3INZA 1ETKA 1OR7A 1SMYF 3IAM2 5FB2A 3JRHA 2KRNA 3UA6A 3OV8A 2PNIA 3BQZA 1ZRDA 1SRLA 2LDMA 3H5NA 3EYYA 1POGA 3CQZJ 2FMYA 2K27A 1W1WE 3G71A 1QVGP 2CW7A 2HOEA 4MFEA 4BE1A 3U1KA 3EGXB 1Z9CA 3IV5A 5ERIA 4UY8I 3ELKA 1J59A 2ME0A 2V1UA 1TTYA 2Z33A 3JTHA 2RN8A 3LGLA 4AVZA 4F92B 4WWCA 5EZGA 5DCFA 1BK2A 4AG1C 2YXYA 3WTYC 4RTXA 2ESNA 2DN0A 3QDRB 3I5RA 1IXDA 3LMMA 4M6XA 3QYFA 3BY7A 4P55A 4AIJA 3JCMg 2RAEA 1W7PA 2CFOA 4XSZF 4BKXA 2E5KA 4KGVB 2JA8J 3CCSQ 4BGDA 2AS5F 1DGWY 4LIUA 3HZJA 1JRIA 3BZ6A 2CUBA 2O8XA 1PCXA 2DIGA 1ZX6A 1SEMA 2MG4A 3PNVA 5TJJA 4D5FA 3RR6A 3OW2P 2OTLT 3X20B 3HM5A 4JZ3A 1NG7A 2MYSA 3TW6A 1IZ6A 2Q2EB 4EEFG 1VQMA 1I27A 1EX4A 4WXCA 2EJRA 2Y69H 5K7HA 3WGGA 2BEOA 4MDWA 2DO7A 4HVWA 4PKCC 3J7AF 3G6EA 4A4KA 4RG2A 3JCMJ 4M75C 3KEOA 4M3EA 2EFWA 2KZGA 4JX4A 3E2UA 3MP8A 2QEXA 2V8JA 2IRFG 1OPKA 3CXCS 3EUAA 3HUGA 1WJRA 2I8DA 3VWBA 2EFOA 3FX3A 1TG0A 4JRIA 5F1RA 1Y71A 3SHWA 2IVWA 2LY2A 5JHUA 4ABZA 3Q9SA 3SWNC 4R79A 3HRTA 5B1BH 1NK2P 1OYWA 2AXTC 2HXOA 1IV8A 1JGGA 4MZTA 4RLFA 4GXOA 2L9SA 1B1BA 1FTZA 2KE9A 3DB3A 2QWWA 4M78C 4Y52J 2KISA 2DT6A 1UGQB 4ZTJA 2LZ6B 2RN7A 4U0YA 3COAC 3ERMA 3H36A 1U9OA 4KRTA 1KYWA 2DFHA 2KRHA 4OVAA 5FLXE 3LWFA 4BU2A 4ATOA 1VA7A 2BZ8A 3KCCA 1Y96B 1JO8A 4GO1A 3RPUD 2GTOA 3A0BC 1ZQ3P 1Q86R 1T98A 3S1MJ 1JJ2A 3CUQB 4M6YA 3L2CA 4A3FJ 4D6WA 2M8EA 1WLPB 2LY1A 2HVSA 1KQ0A 3UF4A 3VS3A 3VS4A 4DYRA 3M9QA 4C92F 5GAMh 4DIQA 2K02A 1W2BS 1FBQA 1RNLA 2DJNA 2GXAA 4A3GJ 2CP7A 1B4AA 5IT9R 2ZFWA 3GTMJ 3DLLF 3PNWC 4EMHA 3LYIA 2FF4A 1NTCA 3GLXA 2DD5A 4BE2A 3H8ZA 4GBQA 1WHKA 2LRDA 3JCUC 3CBMA 4J7FA 4X1VA 3VV0A 3LX7A 3DEUA 4BUPA 4XLPF 4M7AC 4IX7A 2KGTA 4EIKA 3RJPA 4QSHA 3FRNA 1IUYA 2VKNA 2W24A 3E0JB 3WU2C 4XLCA 3RQIA 4S04A 4AG2C 4V2SA 1XC5A 4EJVA 3LH5A 5ILVA 3H9QA 2P0KA 1IC8A 2QA4A 2HKXA 2CREA 4OB2B 3E97A 2LVSA 5HODA 2LH9A 4CDGA 5KAFC 1PD0A 4C8QB 5CVVA 1FJLA 2E4HA 4IUPA 1QGPA 1PJRA 2AQFA 5DDGA 3EFRA 1U9NA 4ZGJB 4CO8A 3C95A 4HX8A 4GYGA 1MNMC 3FXLA 1BW6A 2DJZA 2DXTA 1BJAA 5GADJ 3I56Q 3CD6T 1Y8RB 2GOXB 2J5PA 3QWLA 1YIJQ 1T8IA 3NMZC 1Q81C 4A3BJ 3M1CA 3BTJA 4G94A 5HDNA 1WWXA 4E7KA 3F6OA 2KL4A 2H27A 2J6OA 2OAUA 3PIPA 4NDLA 3CCET 5CQGA 2XV4S 4CYCA 2NUPA 4IURA 2JN6A 3FISA 4DJAA 4EMKB 1QHHD 2WB1A 1DU0A 1VQPI 1ZLKA 1HKTA 1JQQA 2IG0A 1YW9A 2ZXHA 3MHXA 2CP3A 1KU3A 4XSXF 2RQTA 1ZYRF 1MBJA 5LGNA 3KBGA 3CJTB 4UVBA 2UWMA 4JPBW 1CQTA 2JSCA 1NM7A 3ASKA 2QA4T 4BQNA 2KI7A 2UXNA 5IHNA 2O3FA 2FX0A 3ME9A 3FC3A 1BI2A 1VQMI 2HFHA 1NYGA 3DKYA 1VOMA 2L2OA 3PO3J 4JRPA 2ZMEB 1OQYA 3G6EI 2M51A 1FSEA 3A4CA 1WJQA 1V76A 4UUSB 4OMQA 4DOVA 4HOBA 2DNUA 2EJFA 3KP6A 3QYHB 1X01A 2EIJH 3CCJA 2DERA 2QLZA 5L3CA 2VBZA 2XSDC 2JVGA 2MLGA 3LSMA 1U5TA 3EUHC 4FCYA 3HFOA 2RJDA 1J3TA 2A3LA 5FW9A 4A5NA 3CMYA 1ZSZB 1WXTA 1UECA 1UFMA 4XL9A 5GAMe 4QVCA 2YUOA 3VSLA 4EMSA 2L9VA 2BZTA 1UG2A 4JX6A 4Y7NJ 5GPCA 4LLGF 5JVTA 1FBUA 3LFKA 4L5EA 5C44J 4UC4A 1O3QA 2HZDA 5FJ8J 3QO3A 3JCMV 2X35A 1IO2A 2XC7A 4AYBA 3A5ZB 2NVYJ 3FK7A 3L9FA 4BXFA 2CT4A 2ZSHB 2LC2A 2KFDA 2Y2ZA 2CH4A 4M77A 1U78A 5FKOA 2EPDA 2V1QA 2W85A 3QPLA 2SEMA 3CCMQ 4BL0B 3LQQA 4IOCF 4HNVA 2PU9B 1MDMA 3IKVA 3BW1A 3OYMA 1FTTA 2K85A 4H0EA 2AHQA 5ICFA 5D4SA 1IAWA 3FIFA 5GMKj 1YNZA 4J8OA 1ULYA 4DEYA 1A6QA 1WH7A 4AC0A 2W10A 3JV3A 2DEUA 2F5EA 1P6RA 1WH5A 2LX9A 1S3JA 3B02A 3IH4A 1Y1VJ 1TC3C 3L2ZA 2Y30A 2D0NA 2E1HA 4Z2YA 2ZJPF 3AG3H 5ILUA 1T0FC 1XMXA 4KBMB 3S14J 3HDDA 2CSOA 3HJEA 1RI9A 4X9DA 2OCEA 1PUFA 1Z1DA 2BY0A 4HDUA 1Y56A 2JMCA 3CCQT 2XI9A 2R5ZB 1W5CC 1BR2A 3CCST 2HNIA 3RKYA 1WI7A 3QZ9B 1YHQA 4I6ZA 1YJNI 1WI9A 2EYQA 2ESHA 1UFFA 2XKPA 4FE4A 5CPRB 4A69C 1ODDA 1IDYA 2C6YA 3KP5A 4G12A 5CVJA 2R7SA 4OMLA 2QKLB 5FWBA 1TW2A 2QA4I 1ZLMA 2OAWA 3KYLA 1VQ4Q 1G59A 1IGQA 1VQPA 3D5SC 5IAYA 1LNXA 4U0VA 2QQ8A 4AM3A 2PVGB 2P84A 3FHNA 1RR8C 3M57A 1UHFA 3SZTA 1W4MA 1RQ6A 2FBHA 4CGZA 4M74A 2ZNYA 2FA5A 3C1DA 4HZFA 2FL7A 2B86A 2Z0WA 5I11A 4CCKA 1T08B 4IQ4A 2HL3A 2HMAA 2RQUA 3HTRA 2EV0A 2KMUA 4XK8E 2KQRA 3RUXA 2W57A 1Q1HA 1IRFA 4G7OF 3C94A 4KIBA 2DXUA 2K9LA 3OYYA 6PAXA 3G7ZA 5H2FC 2LSOA 5E1ZB 4EGYA 2BIVA 4BHPA 2XHCA 2AK5A 2HCKA 4FT2A 1VYUA 4KN7X 4WCGA 1XSVA 2DA4A 4PL6A 1TSFA 1M1KR 2WTEA 5EEHA 3BTLA 3J80Z 4LGWA 1VIEA 3EG3A 2RI3A 2R5YB 3EG9B 1F4KA 4E6KG 2XKOC 2YHTA 1S72T 4MEYF 4XQFA 1A5JA 3CXCP 2BY1A 3A01A 4O5VA 2D9TA 2XK0A 1K9MR 4JBAA 3AL0B 3CP8A 5IHKA 1PNJA 2K4BA 2MC4A 4HCBA 2RHXA 5A2QK 1ZELA 2P5VA 4DNCA 2GM4A 2C0OA 2JMWA 3WODF 3HOVJ 1X3WB 3H3VK 2GF7A 3WTVC 2RF0A 3KFVA 3J81E 3CCVT 4Y28E 2DK3A 4PJOG 3O8HA 4OMNA 5E1XA 3M59A 2KDSA 1YO5C 2CZ7B 5DEQA 1VQ5Q 3SWNA 1WXUA 2ICWG 4XU0A 1A04A 1LPLA 1QMCA 3OYJA 2LQNA 2DW4A 3E6BA 2YUPA 4F3QA 1ZH5A 1VQ7Q 3BDLA 3GTGJ 4M78A 1X69A 2GIZA 3HRSA 1MMGA 2PEXA 2X1DA 5FKLA 2A36A 4G6QA 2ZMEC 3DP7A 3KZIC 3E5QA 3L00A 2V9VA 4NC7A 2A61A 2M9UA 1LFBA 1MZBA 1T33A 2BW3B 1I1JA 2ZAEA 3N5BB 1YJNQ 3OIPA 5CJ9A 5HLTA 1K8AU 2E2IJ 1W2BP 1K9MU 1OCCH 3GFJA 3HOXJ 1KQ1A 4UB6C 2E1CA 2ZXIA 2C0IA 3OB9A 3BTCA 3R0JA 1K4US 5GAMg 1M1GA 2QA4Q 1VQKT 3JAME 3TO9A 1A36A 3OSVA 2JT1A 5L3BA 3DV8A 3T0YA 3UNGC 4V19K 2MK5A 4F7UG 2CP2A 4M7DE 4PLIA 2CUZA 4PJLA 3SDGA 1ABOA 2DMUA 2EJGA 2OV7A 2IS6A 2DK8A 2KSSA 5BS6A 3I55T 3BTIA 1VQNQ 2EYYA 2KYBA 1YJWA 4WK8F 2Y48A 2GQIA 5FKMA 3RBBB 1TT0A 3VUZA 3L09A 2COYA 4JZ4A 5GANf 1PP8F 3EHRA 4M7AA 4FL6A 1S8NA 1JHHA 1I39A 3DCFA 1VQ9T 4FHTA 3G4ST 1K73R 3CC7I 4CSWA 1T39A 2JVHA 1YHQI 2XRNA 3BC8A 3HPWA 1YW8A 1JTYA 3BR3A 4EJOA 4XLNF 1O3RA 1QNTA 3FXJA 4OAYA 2XDDA 3TU4K 2IP2A 4RAYA 2E1OA 5IOYA 2YWWA 1NEGA 5D5UB 4NC8A 2CV0A 5GANh 2XVCA 4LLLA 3DF8A 1MMNA 1YI2T 3F23A 2KK4A 1IZ1A 3FXMA 4LUEA 2V1NA 1J5YA 1FOKA 2QUFA 2M87A 2VI6A 3VYSB 2FYKA 5EC7A 4HLXA 2E3IA 3GZ5A 3JRGA 2GLOA 3HOWJ 1FYNA 2HQHA 1U6GA 5FFZA 3ZMUA 2B0LA 2JTVA 3EGDB 1FIAA 1UCRA 1EIFA 3K4NA 4BQAA 1QA6A 2AKLA 2PUOB 1K73U 2O0YA 3JCMd 1H0MA 4IRHA 3SFIA 2DZCA 2XU8A 3RYRA 2DA3A 3I4PA 1SFUA 2DL4A 2JTEA 4M7DC 1XDUA 1E6HA 2X6WA 4E7JA 1WQWA 4XM3A 2D0QB 3FEOA 5CCAA 4I02A 3F8MA 1TOVA 5CYVA 1ZRFA 1WJAA 2DA1A 3QWXX 2EBPA 3OWTA 2H8RA 4J9FA 2R7VA 2R4GA 3EGXA 2JJ7A 5F27A 1HXDA 4YIRX 3FMRA 3RDIA 5J6XA 3JTGA 5F0FA 4OIOF 3DTIA 4P1WA 2M02A 5JI6A 1NH3A 2IA2A 3EAEA 2I2LA 1S29A 1BN5A 1S9HA 2WV1A 2NRAC 3CMAT 2ZPHB 2E3HA 3X25B 2NVTJ 3ZQ7A 1GHCA 5IT9Z 1ZARA 3SZGA 1XGOA 2HEOA 4DBQA 3EUHA 2EIFA 1U06A 2YSQA 2R93J 2F2XA 4LDWA 4A0XA 1WZOA 1CF7B 2KBTA 2ADUA 3CTAA 4OB0B 5LEJA 4J00A 4L18B 4JLIA 2RHIA 3GO5A 2M34A 1ACMB 3NWTA 5C3EJ 4IKFA 3GNFB 3H0HA 1L0OC 5IT3A 2XIDA 2NS0A 3REBB 2EIKH 2LQ8A 5KYUA 2ABLA 3CMEA 4E4HA 1F5TA 2EVRA 4M9SA 3SFMA 2Q2EA 4UUTA 5D6EA 1MHNA 3RTRA 4A5MA 2HOAA 2EAYA 3TQ7P 3UA7A 4C92B 3CC7Q 3CCLA 2RA2A 1SHGA 2F69A 1Z67A 4JQFA 2JSPA 4P96A 3AL0C 3M4GA 3SQNA 1WJCA 1EV7A 3KYDB 1WXBA 2GBQA 1BR4A 4BBRJ 1W36C 1ETQA 2KJCA 5EEGA 3IL2A 2VQCA 4BJ5C 1X43A 1E3HA 2E12A 4BACA 2YLBA 5J39A 1UG0A 4ZJZA 2HYGD 1OOTA 1BI0A 1QCNA 2ZXJA 3UR3C 5KHDA 3LSPA 4AMCA 3QP5A 2JNGA 4E7ZA 5ILSA 1JKQC 2H09A 3E9GA 1YITT 4BHCA 1YJWI 1UHSA 2V6CA 3CJQB 3CQTA 2ZO4A 3OMGA 4R0KA 2B7EA 1GBRA 4I76A 3M7GA 4PJNA 2ED0A 3KYCB 3W6JB 4PJ0C 5FROA 3H0DA 2FQ3A 2LKXA 4EJTA 5GJWB 2LJ1A 1E3OC 3RKWA 2R7FA 2IGKA 3IQLA 5CIUA 3GFMA 2K4JA 4IQJA 1K4TA 3S3NA 1IXRC 2O8KA 1H8KA 3HTUA 1AKHB 1BM9A 2I10A 3IH3A 2FUG2 4J9EA 4RUGA 2DM1A 2XPUA 5LRRA 4E70A 1Y96A 3NTKA 1KQ2A 2DVJA 3BPVA 4EQQA 4FU6A 3CUQA 1T0HA 4ZN3A 2XB5A 3FXOA 4L9JA 3IRQA 2VQLA 2MA3A 3JCMb 4AIKA 3JSOA 2YX4A 4ZDLA 3KEQA 4ETSA 2O01E 1NE8A 4BI3A 1HDPA 3U9GA 4KIFA 1NG2A 3HC7A 3U2RA 4F93B 3LSTA 4CCJA 1HSJA 1E2XA 3QU3A 4FETA 5GTIC 3JRIA 2E2JJ 2LYCA 4GDFA 1PP7U 3WG7H 2H6BA 4CC2A 2NOJB 3Q0VA 4LB6B 1I8FA 1LB2A 3DLMA 3CCUA 4FISA 3IUOA 4ZH4F 2J7IA 2RNAA 1MBFA 1TU0B 1VYTA 2BXYA 3H3UA 3JW4A 3JSCA 5DLOA 2XGEA 4N4HA 1HKQA 2QDLA 5EEAA 4LK1F 1I1SA 2E10A 2CW0F 4B47A 5EGOB 3O8GA 1EJ9A 1ETVA 3OR2C 3LWHA 1SVOA 2H8HA 4GLMA 1M2OA 1JE8A 5DM7R 4HW0A 2R7UA 4M4ZA 3G1MA 1FLIA 4XMYA 4DZPA 1OU8A 2J6FA 4A4GA 4PJOD 4C8QA 1V5FA 2COMA 3CDIA 1HD3A 3EH1A 2XKOA 1LDDA 2IJLA 4XTYA 4OIRF 4GFBA 2HZYA 2E19A 5E8IA 5F0HA 2ED1A 3ZL7C 2CQXA 3I54A 3P9KA 4HV6A 2VJJA 1KC8R 1BC8C 4ESFA 2R0QC 2GXBA 2E70A 1TTHB 3A8OB 1S5LC 1EH8A 4QKUA 1P7IA 2DA6A 2MABA 3TEDA 4EMKA 2FHDA 1XJWB 2QI2A 1KD1C 2XDBA 1CKAA 4M77E 3K70D 4M75G 4LD6A 4V2GA 1ZA2B 3C2HA 3NHNA 3DKWA 1QVGA 1FMVA 2DBBA 3META 3SEMA 2ZPFB 1YJWQ 2E1MC 3DFGA 3I64A 2EZLA 3F6VA 2XGCA 1ETYA 3CMEI 5LJ5h 1VQ8A 2LCSA 5IP9J 2HPIA 3CBOA 4FIBA 3VS7A 4F16A 1SVLA 2ZMEA 3PUFA 2DL3A 4XTZA 2E6ZA 4UUSA 2IVMA 1W4SA 2M16A 4E7IA 3KIOA 5GAN8 3CCRA 1BBYA 1Y8QB 2FEIA 3S2WA 3ZOBA 2L89A 2RI2A 4A3JJ 3H3ZA 4HSRA 4K11A 4M78G 4C8QG 1STZA 2DFIA 5HVQC 4RTTA 2EYXA 4WTOB 1YOVB 5FKKA 2ELJA 4N4OB 1ZSGA 2CUEA 2WV0A 2FVUA 1ZSZA 5L8RE 1SANA 3Q0WA 4NUBA 4PJJA 5D6FA 3A52A 2JPBA 4FT4A 4J83A 4C0ZA 4DQ2A 3OW2A 1U5TC 5D4RA 2KXDA 1T2KA 2RNGA 4ESJA 1KU9A 3CUOA 5TGTA 3BDUA 3VS6A 1R23A 3OYCA 2C0TA 3CC4A 5IHIA 1S7EA 1SPKA 2VXDA 3PUBA 2CDTA 4RTYA 1MNEA 1XSXA 3CC2Q 1FPQA 3BJAA 3P9IA 2D5VA 4ZYGA 3ULRB 3AG2H 2KR3A 1X4OA
chains in the Genus database with same CATH topology
4DOWA 5GAN2 4BH9A 5GANg 1BYMA 2LNBA 4M77C 2ZCWA 2ZPGB 4M7AG 1U1SA 5L3DA 3I56T 2EV5A 2LCCA 5K1YA 2VBYA 1YIJT 2DPUA 1NZ9A 1ZHFA 1IN5A 2HAXA 2E7WA 1VQOA 2CZ1B 4M71A 4PGGA 3IWZA 4IVNA 5GAN3 3GPLA 4XTUA 4CHUA 4PJOF 3ECHA 1OYIA 3IRRA 4UV9A 1V29B 3OYEA 4XTWA 4FX0A 4Q4ZF 1NPRA 1UEBA 1PSEA