1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
5DEQA 3ZN0A 4HW0A 4UVBA 3K1MA 5FD5A 2MBFA 1ZRDA 4ZYHA 1QNTA 4GCVA 4G8XA 4MGRA 2DU9A 3F21A 1FYLA 3E97A 3P9CA 3TKYA 1FBUA 3I59A 3WE3A 2EA2A 3I4PA 2B0LA 2HKXA 1YFHA 1QO0D 3MEXA 2FE3A 2A6EF 3IL2A 4OIOF 1KU2A 4RS8A 1H9TA 1D8JA 2HS5A 3E5XA 1WSUA 4EJTA 1R7JA 3OV8A 2P8TA 3CUQA 3HRTA 3HYIA 2RN7A 4ZYDA 2EJRA 4B8XA 4ZZLA 3FMSA 3J7AO 3V7SA 3HRMA 1EH6A 1S6LA 2W25A 3TO7A 1BJAA 4CICA 5ICCA 2EWNA 1AWCA 3TQNA 2HDCA 4S05A 1YIOA 1HW5A 2HFHA 3L00A 2HZTA 3MZYA 1FSEA 4HV6A 2PQ8A 2Z99A 3LA3A 4MTDA 4WXCA 4G7OF 4Y17A 2Q0OA 4B09A 2EV6A 1W5SA 3B73A 1ZYRF 4RB1A 3K0LA 4LLNA 1W4MA 5BMZA 3ECHA 1I27A 2FMLA 4ESJA 2VOOA 6PAXA 4LK1F 1TTYA 1JHFA 4ZH4F 1REPC 5FB2A 4PCQA 4PGGA 3RKYA 5HOOA 1XN7A 3WTSC 2K02A 1FZPB 3LQRA 4I7HA 3CO6C 3WODF 1BC8C 3HIFA 4ENKA 2OZUA 1ZRCA 2E1NA 1P4WA 2M45A 2A5YB 1U8RA 4GYIA 3ZMVA 3RIRA 4XSZF 1J0RA 1MDMB 3OOPA 1MJBA 1MJAA 2NRAC 3BY6A 5EEGA 4S04A 2XAHA 3VEPA 5EEHA 3BDDA 2E7XA 2JT1A 5D8LB 1YS6A 3H92A 2CGPA 3FWEA 3HSFA 2KIFA 3R60A 4UXNA 3R0JA 3RPUA 1J7KA 1J5YA 2H6CA 5LHIA 1B9NA 2K4YA 4MTEA 3ERED 3COAC 5DCMB 4Q48A 5HDNA 3SXYA 3KE2A 2LF7A 1B4AA 2PLYA 2PFBA 1T38A 2J5OA 4CGZA 3TOAA 3HTUA 4HOBA 2VBYA 3HRUA 1XMAA 4LFUA 1BYMA 3ISPA 3GYHX 1SAXA 2DQRA 4Q47A 2LDUA 2A68F 2OA4A 2UXXA 3V8LA 1IN4A 3CJNA 3MFKA 4LB5A 5CJ9A 4BHPA 4CYDA 2XRNA 2FBKA 1XGNA 4PGHA 1QQIA 1G3YA 1XDUA 1USTA 3TOBA 2NNNA 1L0OC 1QGPA 3GEZA 4Y15A 3R0AA 1S7AA 1E2XA 1OKRA 1DP7P 1K7AA 4R1HA 1ZREA 4ETSA 1Q1HA 2M30A 4MEYF 2BE5F 1R1TA 4RAYA 3F3XA 5ICFA 5JVTA 3GFMA 2QWWA 1YQAA 4YIIA 2D1HA 4CO8A 3WU0A 1Z6RA 3MHXA 2QQ9A 4JQFA 5L3DA 4RGXA 3L2CA 4G7HF 1QVPA 4HQEA 3J80Z 1Y0UA 4LMYA 5ED4A 4KN4X 2EFWA 1FBQA 2GXGA 3G73A 4H0EA 3JW4A 3F6OA 4BYYA 2CG4A 2OQRA 1GHCA 2ELHA 1KYZA 3REOA 1HXDA 2FXAA 3GFLA 1G3WA 3BROA 3BPXA 3J81K 2FQ3A 5E18F 4K2EA 2IJLA 1OYWA 4O3MA 2BYVE 1RNLA 4BHCA 1G6NA 2H6BA 1FP1D 2VE9A 2KIMA 2R3SA 5LGNA 2HGCA 4MQVA 4ENJA 1IRFA 3FF5A 4M73A 4DNCA 1BIBA 3HTSB 1H9GA 4A2UA 2MA3A 4HX7A 3M9AA 4RB2C 2DBBA 2P5KA 1O7FA 3NQOA 4U0VA 2RNJA 2W57A 2UZKA 4KIBA 4BH9A 3WE2A 4WX9A 3VOEA 1CGPA 4Z2YA 2QYOA 1OYYA 4EGYA 3BJ6A 1Z1DA 2YR2A 2V9VA 1HBXG 2BV6A 5HLIA 1IZ1A 3HSRA 4L9VA 4HAMA 4U0WA 4WXHA 3WTZA 1J75A 4AWXB 1BM9A 1W7PD 5LBQA 3FXUA 4GXOA 3E6MA 2HTJA 2PN6A 4KFCA 3K1PA 4UVCA 4U7DA 1P4XA 2XAGA 3BWGA 3L09A 4KN7X 3HSEA 1ZG1A 1ZLKA 4LK0F 5HDKA 2ISZA 1RUNA 2Y48A 3U9GA 1DPRA 1T2KA 3BOQA 4TV7A 1XMKA 2IA2A 3DFGA 3DF8A 2H09A 2VE8A 3ZP5A 2Q8KA 1ULYA 1I1SA 4IHSA 5HDGA 2YU3A 2JRTA 1YW8A 3EDPA 2ZBKA 1MDMA 1Z6TA 1U6GA 2M1BA 2V1DA 3KEOA 4LD5A 2EFPA 4GYGA 3F8CA 3F22A 1JGSA 3P9KA 2L4MA 4M6YA 1ONVA 4HA8A 1FWZA 4FHTA 1ON2A 5J8CA 4D0PA 2ISYA 5DCMA 5LEJA 3M8EA 4ZZDA 3V8JA 1R22A 2FU4A 5L3BA 3GFJA 4WXDA 3AAFA 1UCRA 2KKOA 4IRIA 4F7ZA 3GF2A 4AIHA 4OMYA 2VXZA 4NQWA 2L02A 3JSOA 5E1WA 1IF1A 3KP2A 3K69A 5E1XA 3JAMZ 2V1UA 4IXAA 4LLLA 3LWFA 1ZN2A 1SD5A 2H27A 2F5CA 3IWZA 4L9NA 4MEXF 3NEUA 4YFKF 2L4AA 4U88A 3TO6A 2DLLA 3C3WA 3LA7A 5E8GA 5AIQA 3F72A 2ZFWA 4XBFA 3ULQB 1R1VA 1YLFA 4A6DA 2C6YA 1S3JA 3O2PE 4YG2F 1KU3A 3VFZA 2CFXA 2R7FA 1K6OA 1C0WA 3KP5A 4ENMA 3EYYA 3IKTA 2V1XA 1GVJA 2W84A 4JK1X 1A04A 5HS9A 4GGGA 1QPMA 4A6EA 2HYFA 1HKSA 4FX0A 2O3FA 5A2QZ 3GX4X 2Y75A 3C7JA 1S29A 2GQQA 3G3ZA 3HUGA 3Q5FA 5H6RA 5HS8A 5E8IA 4N0BA 4PDKA 5IT9K 5LLQA 3ZMSA 3L7WA 3LFKA 1XGSA 1ZRFA 1HW1A 2OU2A 3PFIA 3NRVA 3SQNA 1U2WA 4LG0B 4EMSA 4RGSA 2DPDA 1TQMA 2GXBA 2QVOA 2DT5A 1B1BA 5IT3A 2X0LA 3DKWA 4XRFA 2BBYA 3ROUA 3F8FA 1O57A 1PUEE 4MNUA 3ZMZA 5LHGA 5J8FA 4IPAA 5ILUA 1LEAA 2OZ6A 4OU0A 2G9WA 4M71A 2FNAA 1MJ9A 5FD6A 2GA1A 3DP7A 4BXUA 2EFOA 2ZO4A 2UWMA 1WWXA 2K27A 4EJWA 1TW3A 3F8MA 3HOSA 1BI2A 4L5JA 4RGUA 5ILSA 2M87A 2DO7A 3TO9A 1Z7UA 1Z9CA 2PI0A 1ZARA 4I0BA 1XD7A 2LX9A 2L54A 4M9ZA 3D0SA 5D8KB 1LQ1A 1J9IA 2QUFA 1S7OA 3KLNA 4O5VA 2XKOA 1YW9A 4LJZF 4HDVA 2QBYB 4M74A 2KJBA 1LJ9A 1XDSA 4WCGA 1EH8A 2XAFA 4G6QA 4IJAA 5D4RA 1NHAA 4CXFA 1GXQA 1HQCA 1KA8A 3SZPA 2IA1A 1BBYA 2R7DA 3CLOA 3O6BB 4I01A 2G7UA 4AIJA 1O3TA 1J2XA 5DYMA 2OQGA 4QLCU 5L3CA 4R8HA 3HHHA 5CVIA 1P4AA 2IRFG 3LAJA 1SMYF 1K78B 1IW7F 2YX4A 2NYXA 4P5OA 4RGRA 2CSOA 5E17F 2K4BA 2OAZA 5HLGA 2YX7A 1LDJA 3ZPLA 4HBLA 1TNTA 1USSA 4KMUX 5DD4A 3KP4A 1IUYA 3FX3A 5K5RA 4L0ZB 4P96A 5DDGA 3GXOA 2F5DA 3R4KA 1O3SA 1K79A 3V4GA 1X3UA 2CQKA 3D5LA 2PBIA 5CLSA 1FYKA 1D3YA 2ZMEB 2AS5F 3FM3A 2OBPA 1WKMA 3BPVA 4QWQA 3FM5A 3E5QA 2J5PA 4HX8A 3GW2A 1R58A 2V79A 3KP7A 3GO5A 1UHWA 4I0AA 5J6XA 2F5FA 3T5XA 4ASNA 2KRFA 2QENA 3PQJA 3GVAA 2HR3A 3RPQA 4KYWA 3FMRA 2DPUA 2QZ8A 3KETA 1EH7A 5KK1A 1FOKA 1W7PB 1IN5A 3GLXA 4BHBA 3H3UA 2XUBA 3I0TA 2CW0F 3I53A 2P5LC 2STWA 1E17A 4KIFA 1F5TA 4GO1A 4P9FA 4EJOA 3GZ5A 2PG4A 1DPUA 3IC7A 1LEBA 2E7WA 2HOEA 1IN7A 1BN5A 2PMHA 1ODDA 3U2RA 3M8FA 3BP8A 2DW4A 1FC3A 2RQPA 5D5WB 3I58A 2O03A 3CUOA 2XV4S 3LA2A 2BGCA 2HQNA 1GXPA 1OR7A 5D5VB 2ETHA 2ZKZA 2MD5A 2D45A 3KLOA 5D5XB 2RDPA 1KU9A 2TDXA 4HLYA 2XHKA 2ZNZA 3MZHA 2VC1A 4IF4A 4YFXF 2RKHA 1F4KA 3HHGA 1ZG5A 1KQ0A 2A61A 1YG2A 4FX4A 4CDGA 1ZGJA 3P7NA 5D5UB 2VN2A 2G7HA 5LGUA 3LSTA 3F6VA 2HYGD 5F1RA 1R1UA 4RAZA 2XROA 3J81Z 2X4HA 2YPRA 2A3SA 4HZFA 1TW2A 1KGSA 2WV0A 4A0ZA 2EFQA 1BIAA 2JPCA 3WGGA 3KZYA 1R23A 1ZHFA 3GZ6A 1Z05A 4N9HA 3C18A 5K1YA 3T1BA 1B6AA 2P5VA 4A0XA 5H6QA 3VODA 3E19A 1LDKB 1FT9A 4KUMA 5CVUA 1I5ZA 2MC3A 1ZG3A 4M9XA 1TNSA 1FX7A 3L9FA 1TQPA 1Z91A 3IKVA 1ZLJA 2QBYA 3I54A 4MQ9F 2H94A 1D8KA 5ERIA 3MQ0A 1S8NA 1O3RA 1L3LA 4OIPF 1LDDA 4UVAA 3I64A 4L9JA 3EYIA 3I5UA 1I1GA 3RDIA 3ZMTA 1KYWA 4HYEA 1HSTA 2CO5A 1UHMA 3BJAA 2W24A 1KQ8A 4EM2A 1XGMA 2STTA 5D6EA 2P7CB 5FLXK 1BI1A 2GAUA 2JTVA 1K78A 3DPLC 2NAZA 2HTSA 2K4JA 2XAQA 1IXRC 3QPTA 4KT5C 2IA0A 4A12A 2O61A 2VT3A 4L18B 2EA4A 1B9MA 4EGZA 1J59A 1F1ZA 2XGXA 1V4RA 2FRHA 3N4MA 2L3DA 3V7CA 3WTUC 5ICEA 2ZXJA 3MCZA 4OIQF 1PP7U 2Z33A 1XSVA 2DAOA 2ZMEA 3KZZA 1R36A 2FBHA 4I09A 3LQQA 4P9UA 1F9NA 4UV9A 1U5TB 1ON1A 1ZAOA 2VBXA 4EVIA 3W6KB 4KDPA 3PQKA 2VC0A 1LNWA 4EV0A 4WK8F 5D4SA 2K5FA 4UNOA 2KIUA 4L0YB 3SFZA 5ILVA 2IT0A 4BNCA 3HRSA 1YS7A 3ABUA 1XB4A 3FZVA 5LEKA 4M6XA 3S2WA 3IHUA 2ZCWA 4A0YA 2EFNA 3DEUA 2MLGA 1W7PA 3T0YA 4EM0B 4PZJA 4LGWA 5H20A 4O6JA 3Q9SA 1IN6A 3ECOA 1XCBA 3K2ZA 4AIKA 2F2EA 5BS6A 3KCCA 2PJPA 1SD7A 1ZH5A 1JE8A 3QOPA 1G4DA 4OOIA 2RV8A 2VOPA 4A5MA 1HKTA 2K5IA 2ACJA 5CYVA 4KMFA 5JHUA 3WTYC 1FBSA 1UFMA 4BQAA 3EUHA 3RI4A 1XCVA 4R79A 2HWVA 2PEXA 4JBAA 4EJVA 5BQTA 5FGMA 1RIOH 2MLKA 1KQ9A 3K9TA 2XIGA 2K5LA 3U1DA 2DQLA 2ESHA 2EV5A 2HQRA 3RYPA 3QPHA 5E20A 3JTGA 2P4WA 1QZYA 5BPDA 1U78A 1T39A 5AIPA 2W85A 3KP3A 3T8RA 4HDUA 4ON0A 5HVQC 4P55A 5FO5A 2LSOA 5IT9Z 1YYVA 2JPBA 3ML6A 4WF2A 5JR3A 3DXJF 1XGOA 2P6SA 5F6FA 1XSDA 4HV5A 2Z9OA 1U5TC 4U7BA 2L01A 2KJCA 4KICA 3E3VA 1H0MA 5FFXA 5F64A 1VTNC 5DD8A 3V7RA 2NS0A 2Z5UA 3FMQA 1SFUA 2LF8A 3RTRA 5JFRA 1HSJA 2FF4A 2GIVA 1W5TA 1R5GA 1BI3A 2OD5A 4EQQA 2O0YA 3WTVC 2VODA 1P2FA 1YW7A 1T98A 4IRGA 1R00A 4UV8A 3TGNA 5BOXA 1MGTA 3BJOA 1D5VA 4N9IA 2FOKA 2HEOA 5BPIA 2RGVA 5LHHA 3FHZA 1WRJA 2ZNYA 1STZA 2BEOA 3ZMDA 1LB2A 1ZGAA 1YO5C 4KA4A 2MH9A 3QAHA 2UXNA 3R6SA 3QU3A 2VT2A 3MAJA 3WGHA 4YFNF 4M9SA 3IRRA 2JSCA 4XSXF 4I02A 2A6HF 2M5WA 4IVNA 2M8EA 2Q2EA 3GUDA 2LKPA 2K86A 4Q4ZF 4XLPF 1PDNC 5CVRA 2VONA 2A69F 1OPCA 4UUVA 3E6BA 1SD6A 1AOYA 3J80K 3RKXA 5K5QA 3SHFA 4NHJA 2K7LA 1TBXA 3QRFF 1RUOA 2PMUA 2JZYA 3O3KA 1U5TA 3IWFA 2WC2A 1CF7B 2DI3A 3C1DA 1UB9A 1BI0A 4HX4A 5CVJA 5D6FA 2F5EA 4ESBA 2QQAA 5L3FA 2NNYA 3ZQ7A 1FPQA 4KNYA 3DPTA 1JXSA 2FBIA 2DK8A 1WQ2A 4E70A 4L9TA 4ESFA 3ABTA 2H3JA 4G6DA 3GFIA 2DK5A 5ICGA 3WGIA 2ZJ2A 3K1NA 1B59A 3WTWC 3I59B 2D2WA 3WU1B 2XASA 4M72A 1SFXA 4L5IA 3P9IA 4BAYA 3KP6A 5HLHA 5JI6A 3FXRA 3CTAA 3E6DA 1SFEA 4RB3C 1XSXA 3BZ6A 4EJUA 3CUQB 1YTYA 1R5HA 4OMZA 4U0YA 3Q9VA 3ZN1A 4LG0A 3MWMA 5LRRA 1DDNA 1RZ4A 4HF1A 5DUKA 5DCFA 1IXCA 2WTEA 3JTHA 4UHTA 3B02A 1PP8F 3EQLF 3T8TA 2MH2A 5CVVA 2CYYA 2FA5A 2LNBA 5E1ZB 4AD9A 3SZTA 4LLGF 4I98B 2XAJA 3ELKA 3M7GA 2P6TA 5DUIA 1T6SA 2FNPA 2GA2A 4Q5SF 2IP2A 2XVCA 2IPQX 4MHGA 3CDHA 4IRHA 2Z3YA 2D1VA 4Y13A 1MD0A 4DQ2A 2EK5A 1QW1A 1FSHA 2EB7A 4CZZA 3QU6A 3DV8A 4G9YA 1FYMA 4IHTA 3RKWA 3N97A 2Y0MA 2COMA 1P6RA 3KFWX 2XKPA 3WTTC 2ADUA 1HW2A 1O7LA 1FLIA 2GZWA 3M1EA 4LB6B 2HKOA 3HOTA 3RJPA 1LVAA 5TRDA 3KEQA 2P7VB 2O6GE 5HS7A 1QBJA 3WTXC 1O3QA 3F8NA 3JSPA 3W6JB 4NB5A 1SMTA 3F23A 1IAWA 1DUXC 5LGTA 1RI7A 4AVPA 1SD4A 3JAMK 4I2OA 4OIRF 5TJJA 3CO7C 4YIFA 1FY7A 1JHHA 4G94A 1MKMA 3TDUC 5FFZA 2CWEA 1WI9A 3E6CC 4CHUA 2RVCA 1P92A 4FT8A 3WG9A 1MZBA 4OINF 4HQMA 4EM1A 2V6CA 1EV7A 2RC4A 4ZYGA 1IN8A 1BOAA 1QZZA 2IW5A 4KIGA 2DFIA 2QLZA 2IVMA 3CUQC 3GWZA 2ESNA 5K5OA 3R61A 3QP6A 3RYRA 5DV5A 4A5NA 5KVRA 3FXQA 4XLNF 3QP5A 3F8BA 4ZYEA 1G3TA 2QQBA 4HLXA 1FNNA 5L3GA 1OMIA 3EETA 2AXLA 2E1CA 4ENNA 1TLHB 2VBZA 4HF2A 2GCXA 1HKQA 5L3EA 3V8KA 1IRGA 4G7ZF 2O8XA 4RB0A 1TQIA 2QM3A 2GWRA 5A2QK 2VBWA 1G3SA 2WWYA 3H3ZA 1KU7A 2FEZA 3DQVC 5FLXZ 1IXSB 3VB2A 3IRQA 1U3EM 3E5UA 2DTRA 2YSRA 1T0FA 1CF7A 2FSWA 4HF0A 5LRSA 2EV0A 1FP2A 3ZMUA 3TDZC 1BC7C 1I6XA 3LAPA 1V3FA 2A07F 2FMYA 3I71A 1OYIA 5AONA 4WWCA
chains in the Genus database with same CATH superfamily
2E3IA 2Y4YA 1PKTA 4J9GA 1Y1WJ 4RTTA 4RTUA 2XGDA 3VYUB 2ELJA 1WJFA 3G1OA 5DEQA 2HVRA 1UFFA 1N5ZA 3OYBA 2D8JA 1ZSZB 2QA4I 3ZN0A 1J09A 1D1AA 4C3HJ 2EQJA 4HW0A 1NJIC 4UVBA 3K1MA 3RNJA 5FD5A 1UECA 3OMGA 2MBFA 1MNMC 3I55A 3CC7T 5EF6A 1T8IA 1ZRDA 2PQWA 1GL5A 1GCPA 1H8KA 1PD0A 1NH3A 3PVQA 3MCAB 4HCBA 2DZ9A 1SAUA 1U8BA 4RG8A 2HVSA 4ZYHA 1QNTA 4W97A 1T3SA 5LJ3h 2BIVA 3RZDJ 3M53A 4GCVA 1EJ9A 4G8XA 1WLPB 3GTOJ 1WHKA 3E9FA 5KYUB 4MGRA 1V55H 2DU9A 3HM5A 4JJNK 4GDFA 5J39A 2LVMA 2QTVA 3K2AA 3F21A 1FYLA 1UEBA 2JN0A 4M78G 3E97A 2LY2A 3P9CA 3TKYA 4F7UA 1K0SA 1FBUA 2O88A 3I59A 3EUAA 3I55I 2KT1A 3WE3A 2EA2A 4RLQA 3I4PA 3JCMc 2B0LA 5IT9E 1QHGA 3A2KA 3DTIA 1JT0A 2D0QB 2HKXA 3EFOB 1YFHA 1VIFA 3VUBA 2XDVA 3J7AW 1KQSS 2HXIA 3BG3A 1QO0D 4C92F 1E3OC 3MEXA 2FE3A 2VQCA 1VQLI 2A6EF 2KL4A 2VYTA 4AG1C 3IL2A 4EIKA 1X1PA 4N4OB 4OIOF 2F48A 4FL6A 3VKIA 1Z9QA 4LD6A 3SFMA 4CC3A 3SEZA 3Q0WA 4FASD 1KU2A 4RS8A 1H89C 2L3RA 1IDYA 1GFCA 2PVDB 4A4GA 2DETA 1H9TA 1D8JA 2K3YA 2HS5A 3E5XA 2I5UA 4XU3A 3BTCA 1WSUA 1R7JA 2NOJB 3OV8A 4EJTA 3AL0B 2F5TX 2NWMA 2V4JC 2JMCA 2P8TA 3CUQA 2O4XA 4RDUA 1XJWB 4KT0E 3HRTA 2JS2A 3EG1A 4Y33A 2TCTA 3TEDA 3HYIA 2RN7A 4ZYDA 3Q0VA 3G6EQ 4BXXJ 3D7SB 4J7IA 4A4EA 2EBPA 3DLLF 2LD5A 4KULA 2EJRA 4B8XA 2LJ3A 2RHUA 2E6ZA 4X1VA 4ZZLA 4XTVA 3CCSA 3FMSA 1VQ9T 3MMYB 4PSXA 1YJWI 3J7AO 5GAOl 3H8ZA 3V7SA 1VQ6I 2K9NA 3HRMA 2HPMA 4JZ3A 1H8AC 3UA7A 1EH6A 2PUOB 1ZQ3P 1GV2A 3HGYA 1S6LA 2HQAA 1M1FA 1WJBA 3VSKA 1JKRC 2E65A 5EG2A 2BY0A 1T0JA 1ZK8A 2W25A 2K7AA 3TO7A 1BJAA 4CICA 3L42A 2WB1A 5ICCA 5GJWB 5C0MA 1K0XA 1LE8B 2J6KA 1FEXA 4RA2A 2CZ7B 3FJPA 2EWNA 4YEJA 3C4SA 2JUGA 2OJED 1AWCA 3S3NA 1IRZA 2GNCA 3M0QA 4B9XA 3CC4T 1WX6A 1GBQA 3TQNA 2M4GA 2HDCA 4XOTA 5EJCA 2IAIA 1N75A 2DEUA 1N9RA 4A3DJ 4NL2A 1Y1VJ 4S05A 1YIOA 4RCCA 4BE0A 1HW5A 3PE0A 2HFHA 1WGSA 3L00A 2YRVA 3LH0A 3MKLA 1FJLA 2HZTA 2GLOA 2MWPA 3MZYA 5F08A 3OW2P 1FSEA 1NJIU 1QA6A 1AT1B 3M0RA 3I55Q 2X6YA 1XC5A 4HV6A 2PQ8A 2R58A 2FVUA 4J9IA 2Z99A 3LA3A 4TVRA 1ZR2A 3KX2A 2R4GA 4C0GA 3CXCS 3NTHA 4PJOD 4LD9K 3L1AA 2ESWA 2CKKA 2LKXA 4MMLA 5FW9A 5LJ3f 1VQLQ 1P7JA 4MTDA 4WXCA 4XRSA 2KDZA 4OMNA 3A02A 4G7OF 4RKUE 4PJMA 1UGVA 4WTOB 2LBFB 1MNDA 2DL8A 2BZYA 2E3HA 4Y17A 4AM3A 5CKEA 1R5ID 3VS7A 3BQZA 3MVPA 2Q0OA 3BC8A 3ZQLA 4JJCA 4B09A 5FU7C 4M75A 4WCIA 2EV6A 1OCCH 3TW6A 1W5SA 3B73A 2CP2A 1ZYRF 4RB1A 3K0LA 1PUFB 3HPHA 1W4MA 5BMZA 4LLNA 2Y4XA 4C5HA 1QWEA 2PTKA 2VJIA 4IUTA 1QVUA 3ECHA 4IKFA 2E70A 2L0AA 2OX7A 1AWOA 1I27A 2L7ZA 2FMLA 4ESJA 2VOOA 3C94A 6PAXA 2RB6A 3K4CA 3QIIA 4LK1F 2PMZN 3SDBA 5BNGA 1X69A 1TTYA 4F04B 5KYXB 5FKNA 3M0UA 4AYBA 1JHFA 4ZH4F 3JRFA 2FHDA 3HL8A 1REPC 3K4MA 1XTAA 5FB2A 4CCLA 4PCQA 3F70A 1JRIA 1YJWQ 4EMGA 2XG8D 4PGGA 1VQ6Q 3S93A 1JJ2P 2M3AA 3RKYA 5HOOA 1SVLA 1XN7A 4ZYAA 3GTKJ 3WTSC 2K02A 2B63J 1ZX6A 1FZPB 4GFBA 3LQRA 1X6GA 4DBFA 2RJCA 4I7HA 2IS1A 3CO6C 3WODF 5GMKh 1BC8C 1D3BB 1MBJA 4XLEA 1ZSGA 4J5YA 2AHJB 3HIFA 4E7HA 2OZUA 4ENKA 1ZRCA 1F43A 2CUZA 2E1NA 4OB3B 1P4WA 3RR6A 1ZSZC 4FM4B 1NK3P 1JXOA 1Z77A 2A5YB 2M45A 3PM1A 1U8RA 4GYIA 2HDAA 3VU3C 4EMHA 1HJDA 3CP8A 3ZMVA 1WZ2A 3RIRA 1SKUB 4MZPA 3EH1A 5GJVB 4XSZF 1AWWA 1F36A 1J0RA 1MDMB 3OOPA 5GAEJ 5GAOm 1MJBA 1MJAA 1R4NB 3OL3A 3HL2A 2CT3A 2DN0A 1GT0C 2NRAC 3BY6A 5EEGA 4S04A 1QQJA 2JTFA 1YJ9A 2XAHA 1VQPA 2EKHA 3VEPA 5EEHA 3BDDA 1DP3A 1OCPA 2E7XA 4N4HA 2JT1A 2E5NA 5IYBJ 2ENMA 5D8LB 3ZQCA 1YS6A 3SDGA 1E3PA 3H92A 1T3LA 3V42A 2CGPA 2BZ8A 3FWEA 3HSFA 2KIFA 2KYBA 3R60A 1YRNB 4UXNA 1RAAB 3R0JA 1WFWA 3RPUA 2DTHA 1J7KA 1J5YA 2WAFA 4DBQA 2JA5J 1SHGA 1OLTA 2KP6A 3CCJT 2H6CA 3MO8A 2X9DA 4M7DC 5FWCA 3M0SA 2E71A 1B9NA 5LHIA 2P4TA 2EJFA 3OMYA 2K4YA 2AT1B 1WFXA 2RA2A 1SEUA 4MTEA 3TEEA 4AVZA 3ERED 1YJ9I 1VQPI 1AKHB 2J6FA 1YITA 3K4BA 3COAC 2Y2ZA 4M78B 4FYXB 5DCMB 2ECZA 2XF7A 4AUXA 3CD6A 1MW7A 4A3KJ 3I5RA 4Q48A 5HDNA 1OCOH 2E2JJ 3HOZJ 2A05A 2K9LA 3SXYA 1R9TJ 3KE2A 2LF7A 3MKYB 5FLVA 2MI6A 3NWSA 1B4AA 3CJTB 2PLYA 2PFBA 1I6HJ 2HMAA 2ZPBB 1OX8A 5HODA 3SWNC 5GANg 4PKCC 2W1OA 3MKWB 4RAGA 4I6ZA 2I8DA 3AL0C 1T38A 2J5OA 1W36D 1YITI 1IXDA 4CGZA 4NQWB 2DPPB 3TOAA 2ED0A 4IQJA 2YDLA 3HTUA 1RESA 2VBYA 4HOBA 3CD6I 2LQ8A 3HRUA 3AT1B 4II3A 1XMAA 2KT0A 4LFUA 4C9YA 1BYMA 3ISPA 4ELYC 3GYHX 1V54H 1X4OA 3MEVA 1SAXA 2MAMA 1MBGA 2DQRA 3WHCA 3CCUT 4Q47A 5EG0B 2LC2A 5C3EJ 2LDUA 3DKMA 2A68F 2OA4A 2UXXA 4QIWN 3BTJA 3V8LA 1IN4A 3CJNA 4XNFA 3MFKA 2V8JA 3CPFA 4N4IA 2CSQA 4LB5A 1QZEA 1G83A 1WZOA 1VQ4I 2XF6A 2V1RA 3CDIA 3CC7A 1P7IA 1K4TA 5CJ9A 3HOWJ 2HKNA 4BHPA 3X24B 4M78E 4CYDA 2XRNA 4M3FA 4HKEA 3UNGC 3WU2C 5GANe 5GAN7 2FBKA 4IOAF 1XGNA 4PGHA 4ZGDB 1I50J 4J19A 1QQIA 4A53A 3CCRA 2ZPHB 1WHLA 4LIUA 3GNFB 1M5Q1 1G3YA 4C3IJ 3LGFA 3NHNA 1XDUA 2BKDN 3CCLT 1USTA 3TOBA 1ZQ1A 2X3WD 2BVMA 1TUGB 1YHQT 2QAZA 2RQUA 4LUDA 2NNNA 5GAMf 3DBRB 2FRWA 2LKSA 2IS2A 3BZKA 1L0OC 3JB9H 3BG9A 1QGPA 5M3FJ 3X20B 3GEZA 4M3EA 3BDLA 4C92E 4BI4A 1YJ9Q 4Y15A 1VQPQ 5H2FC 1YI2A 2PVGB 4X0GA 4PJJA 3R0AA 1S7AA 1E2XA 1OKRA 4EPCA 2F4IA 4NC6A 1DP7P 4C8QD 3GP8A 1I0CA 2LVSA 1K7AA 4R1HA 1ZREA 4ETSA 1U0JA 2YRCA 4NS5A 4HCKA 1Q1HA 2JN6A 2M30A 5EEAA 4MEYF 2BE5F 4M77D 5KYYB 1R1TA 4RAYA 2XIDA 1BJZA 2FG0A 2KMTA 3F3XA 3RZOJ 5ICFA 1BL0A 1YITQ 2IGMA 1B72A 5JVTA 1PHTA 3GFMA 1YI2I 2QWWA 3CD6Q 4PUSA 1YQAA 1BCOA 1VQ9A 2BW3B 4YIIA 2D1HA 4CO8A 4KT6A 3WU0A 1Z6RA 3HJEA 2XU8A 3MHXA 2QQ9A 3GIBA 3I9QA 4JQFA 1BR2A 3FK6A 4MO7A 2RHXA 4RCBA 5AYFA 4CC2A 1LOJA 1U5SA 2EQKA 5L3DA 4RGXA 2MPXC 2VJJA 4MIMA 3L2CA 4G7HF 1JBMA 1WJ5A 1QVPA 1ZUYA 2XMFA 4J9FA 2MF2A 1ZSZA 3GTQJ 1H3ZA 4HQEA 3J80Z 1Y0UA 4LMYA 3VYHB 5ED4A 2M16A 4KN4X 3JRBA 5J3BA 2FOWA 4M7AD 1VQ4Q 2RI2A 2EFWA 1FBQA 2EYXA 2OJ2A 4LE9A 2GXGA 3X26B 2SEMA 3G73A 4DYRA 5CQEA 3CC4A 4LNPA 4H0EA 5CCAA 2HI3A 3JW4A 3F6OA 2W4SA 4ELZC 3ZQIA 4JP0A 1OPKA 4BYYA 3FIFA 3HHTB 2LH9A 3QYEA 1WJAA 2CG4A 2OQRA 1OCTC 1GHCA 2NLUA 3ASKA 2ELHA 2YLCA 3BW1A 1KYZA 5EYRA 3REOA 3S16J 5KCHA 1VIEA 4IURA 5FKLA 3UR3C 1HXDA 2FXAA 2JA2A 1C1AA 2DT7B 2DFUA 3BR0A 3HTRA 2LRDA 3GFLA 3JB9D 3C12A 4JS5A 3DBLB 1G3WA 3BROA 3CC4I 3BPXA 3HFOA 3BLYA 3J81K 4FE4A 1QKXA 2FQ3A 5E18F 3L2VA 1TUCA 4CSWA 2AZVA 4K2EA 1JUSA 3EFOA 1LFUP 1VQMT 2IJLA 1XQHA 1OYWA 4FETA 4O3MA 5C4XJ 1TOVA 5EC7A 1Y7XA 3PIPA 1G8XA 2BYVE 1RNLA 4A93J 2DRMA 4BHCA 1G6NA 1KC8C 3ZQQA 2R7QA 2H6BA 2JA7J 1VQKI 5GAMg 1FP1D 2VE9A 2KIMA 3K10A 2GXAA 4KISA 1ABQA 2F1LA 3SWNA 2G3RA 2R3SA 3ZOBA 3PUBA 2CP6A 3A8LB 4RUGA 3CZ6A 1LUJB 4M78C 4E47A 1JKOC 4AFQC 3A0HC 1MBFA 5LGNA 2HZYA 4A3LJ 3OBYA 2HGCA 4MQVA 3CC2T 3FLGA 4LG3A 3UT1A 2X85A 4ENJA 3H5NA 4RTZA 1YI2Q 2HOTA 1GCQC 1IRFA 3FF5A 4M73A 4XOPA 2DL4A 2YXYA 4DNCA 3MEUA 2A6TA 1BIBA 3HTSB 1ETVA 1H9GA 2DJQA 2DCEA 1UELB 3RSNA 5IP9J 4CCOA 4OMLA 1VQ4A 2K6DA 1NTCA 4A2UA 4C2TA 2MA3A 1PYVA 3QPSA 3OIQA 3SFIA 4A3FJ 3VV0A 2H8WA 2MC4A 4HX7A 1WYXA 2WBMA 3M9AA 5LFAA 2DBBA 4RB2C 2QQSA 2P5KA 1O7FA 3NQOA 2RQVA 2QYZA 4U0VA 2JUCA 2RNJA 2HKQB 2X35A 2W57A 2UZKA 1Q86C 4XLAA 3LLRA 4KIBA 4BH9A 3WE2A 2PU9B 4WX9A 2LDMA 4XTYA 3CCMT 5I21A 3VOEA 4PJOF 2XB5A 1CGPA 2MZ4A 4QPQA 1DQUA 1LE8A 5GAMj 4Z2YA 1N8RU 2QYOA 1OYYA 4I99C 1E6GA 4EGYA 3G2BA 2FPFA 4XLHA 3BJ6A 2XSJC 1VA7A 1Z1DA 1B7TA 2JMWA 2V8KA 1AD5A 2DA7A 1VUBA 2K9QA 2YR2A 4S0HB 3GLLA 1RR8C 3QZ9B 2M7BA 2DA9A 2M0OA 2JM8A 2V9VA 4PJOG 2DYRH 2BV6A 1HBXG 2GFAA 3PO2J 4KRTA 1Q82C 5HLIA 2CREA 1PSEA 1IZ1A 3CCYA 3HSRA 2K9GA 1MH3A 4P1WA 2YT6A 1ZBXA 1W0UA 2VGMA 2XI9A 4L9VA 4HAMA 2DZCA 4AFZC 3CC4Q 4U0WA 2JK3A 2E5ZA 4WXHA 2B8AA 1E6HA 3WTZA 3ZCOA 1J75A 2BY3A 4AWXB 1JUMA 4HSRA 1BM9A 4FT2A 2YU9J 2RNGA 2ZAEA 1UHFA 1W7PD 1OI1A 4ABZA 4NUBA 5LBQA 1PWTA 4P5NA 3FXUA 5DM6F 2R5ZB 3JCMe 3NARA 2LBFA 1QCNA 3I56I 4GXOA 3E6MA 4IIMA 1RR7A 2EIFA 1LPLA 4C0ZA 4RM2A 2R5MA 1VQKQ 4L5GA 4E7IA 1UG1A 4OVAA 4IL6C 3OYIA 2HTJA 2PN6A 1RLPC 1YWOA 3H6ZA 2HSEB 4EMKB 2X6WA 1M2OA 4RMNA 4KFCA 1V1CA 4FTHA 3K1PA 3A03A 3MP8A 4UVCA 1TZLA 2OTJT 4B3XA 4U7DA 1PG5B 2Y31A 2VPLA 1P4XA 2XAGA 2LY1A 3BWGA 2PNIA 3QPLA 4FQGA 1K8AR 3L09A 4KN7X 4Y91A 3HSEA 1WHMA 1ZG1A 1ZLKA 3CMET 2E4HA 4CC7A 4LK0F 5HDKA 1MIJA 2ISZA 1KC8U 1RUNA 2Y48A 1DGWY 3SEQA 3U9GA 3D5SC 1DPRA 3CCEA 2DMQA 2JSPA 4KJZA 1AOJA 5IHIA 1M1KR 5GANd 1T2KA 1BU1A 3BOQA 4LOCA 4TV7A 2HNIA 5I22A 1XMKA 2IA2A 5D6WA 3CCUA 4CYCA 1D5YA 1JJ6C 5E3OA 3DFGA 2UV1A 2V9KA 3DF8A 3OWTA 1X58A 2L3QA 3M57A 2H09A 1Y56A 5AT1B 2VE8A 2ZC2A 5FWBA 3ZP5A 3OBWA 2Q8KA 2DL7A 3PTAA 4J9HA 3R6OA 2LMJA 1W2BS 1ULYA 1F1BB 4JLGA 2EPFA 4RTVA 3MPUB 2M2EA 3EGUA 4J6XA 1I1SA 1XNIA 5GAHJ 4IHSA 1NLPC 5HDGA 2DBMA 2YU3A 2N8GA 3S1MJ 5GADJ 2JRTA 2DTIA 2M34A 1YW8A 3JRGA 3EDPA 1Q82U 3CCUI 2JMAA 1BA5A 3FXKA 2ZBKA 1MDMA 2J7IA 2MOXA 1Z6TA 1U6GA 2M1BA 4IHWA 2LZ6B 4OB0B 3FKIJ 1ERDA 5DS9A 4Y7NJ 2QDYB 2JVGA 2XPVA 1Q86U 3BTIA 1WH5A 1MBHA 2V1DA 2ELKA 3KEOA 4D1QA 2XDBA 2R7RA 4MZMA 4LD5A 1Q81R 3CCLA 5IYDJ 2EFPA 3BQYA 1YRNA 4GYGA 2EZKA 3F8CA 3F22A 3OSFA 3QODA 1YHQA 5F04A 3M54A 1JGSA 2K85A 3P9KA 5FJ8J 3CPWP 3HEFA 2L4MA 4ZN1A 3RQIA 4M6YA 1ONVA 2CW7A 2KRCA 4HA8A 2JTEA 3ZQHA 4OB2B 1X1DA 4DGWB 3I56Q 1FWZA 2IGOA 4FHTA 2C0TA 1GBRA 2VQGA 1ON2A 3ABLH 5J8CA 4D0PA 2ISYA 1FIPA 4MZTA 1VI0A 2HOSA 2KAFA 5DCMA 4M78A 5KH6A 4JRQA 5LEJA 8ATCB 3M8EA 5F0FA 1JT6A 1A6QA 4ZZDA 3K6GA 3V8JA 4OGCA 1R22A 2FU4A 3CP2A 5L3BA 4PLIA 1SSHA 3GFJA 1T56A 2MG4A 4WXDA 3AAFA 1GCQA 1VQNQ 3FJ5A 1M90R 1UCRA 2ZJQF 2KKOA 4IRIA 3JB9I 2E5KA 4F7ZA 2LNHB 1S9HA 4ANJA 1VOMA 3GF2A 4AIHA 3OS0A 2CMPA 2EZIA 3OY9A 4OMYA 5IYCJ 5JVGF 2QASA 2VXZA 4NQWA 2L02A 2EYZA 3JSOA 2Y0SN 1JU5C 5E1WA 2KROA 4DA4A 3ZFJA 2CQQA 1IF1A 4MDWA 3KP2A 1K61A 3K69A 1BR4A 2IS4A 2RI3A 5J4VA 1PD1A 2VUBA 5E1XA 3JAMZ 5HNHA 1XS9A 2D1XA 2LX7A 3PJRA 1K9MC 2XPWA 1OEBA 2YS9A 4FE7A 4IXAA 1K83J 2V1UA 1X01A 4PLLA 3MJXA 2KSSA 2M4KA 1UZCA 2VKVA 1IJWC 1RQ6A 4XU2A 4LLLA 3HFNA 2AO9A 5CAIA 3VJPA 1OV3A 3LWFA 4DBHA 5J26A 1KK7A 3H0FA 6AT1B 1A5JA 1ZN2A 4KUDK 1SSFA 4M75D 4X1EA 1OQKA 2RMOA 2JW4A 2ZXIA 1IGUA 3CCUQ 4MDXA 1FXXA 3VPRA 1WXTA 1SD5A 4E7ZA 3PL8A 2H27A 5CPRB 4RTWA 4OB1B 3NPFA 3R6NA 4C8QF 1Z3XA 2F5CA 1WHHA 2YUPA 5LJ5e 4LDWA 4OAZA 2DIGA 2RK2A 1NPPA 3L2ZA 3JCMW 3IWZA 3GF5A 4OF1A 1E3HA 3DB3A 2GF7A 4L9NA 1FOYA 1NK2P 4MEXF 3LYIA 2AXTC 4HNUA 2FL7A 2KRSA 3CCQT 3NEUA 3HBLA 1VQMA 4YFKF 4C8QG 3X25B 5CQGA 4BEHB 2L4AA 4PFPA 5ECAA 4U88A 3TO6A 4OMQA 3LSMA 1G2HA 2EGAA 2EQIA 3FEOA 2DLLA 5A0DA 2CUBA 2DOAA 4M77G 4BB7A 4BL0B 1IREB 4QVDA 3C3WA 3LA7A 5E8GA 3QYHB 1Y8QB 5AIQA 5J40A 3F72A 2ZFWA 1ZUUA 4J83A 4XBFA 3ULQB 1HDPA 2H1KA 1R1VA 1YLFA 3ABKH 2E36A 4A6DA 5CKTA 2C6YA 3UWNA 3CCVT 1YHQQ 1MMAA 1S3JA 2XKOC 2FJ1A 3O2PE 4OMOA 4HVWA 2JA8J 4YG2F 1VQMI 3G4ST 1YE9A 4YIRX 1KU3A 2HVQA 3M3YJ 2DRKA 3VFZA 3CC2A 2CFXA 2R7FA 3AG2H 3I3LA 3KP5A 1K6OA 1C0WA 3GCMA 2BZXA 2P84A 4M7AF 4CZCA 3TL4X 4ENMA 1ZKGA 3VYSB 3EYYA 1TWAJ 1TWHJ 4AMCA 3A01B 1UG2A 3IKTA 1TSFA 2RI5A 2BW3A 4I76A 2V1XA 5TISC 3VYRB 1GVJA 3JREA 4DEYA 2W84A 4JK1X 1A04A 5HS9A 3L2UA 1RAGB 2RQWA 1NBEB 2QG9B 2OCEA 5F0CA 2VPRA 2R7XA 1RADB 1X75C 4GGGA 1X6BA 1ZUKA 4V2SA 2RQQA 3CC2I 1QPMA 3FISA 4A6EA 2MWOA 2XDDA 4F93B 1M1EB 3CCRT 2HYFA 1HKSA 4FX0A 5JLWA 2O3FA 4XL9A 3JB9F 5A2QZ 4XK8E 2GQIA 3LMMA 3JAMR 2VI6A 3PIOF 3GX4X 3CCMA 2Y75A 4IUUA 2W00A 1SEMA 2HZDA 3C7JA 2NUPB 4KH1B 3LNQA 4BS9A 2DIQA 1YIJT 1S29A 4MFDA 2R7TA 4Z6YA 5B3SH 1R0CB 2GQQA 4PJOE 3G3ZA 3HUGA 1Q95G 5JLXA 1QMCA 3WVDB 3JCMd 3Q5FA 2GFUA 2K57A 5H6RA 1XOVA 2HBWA 4XMYA 5HS8A 5E8IA 1W2BA 2MYSA 4N0BA 4PDKA 4AT1B 2R7WA 2IG0A 5IT9K 4L6V5 5LLQA 4A69C 4JYKA 3CCMI 3ZMSA 3L7WA 5FLXR 1WI7A 5DLOA 5EZGA 2E2IJ 2P81A 3LFKA 1XGSA 1HF0A 1JB0E 5FROA 3A8MB 3QHSA 3HG9A 4C92G 4DZPA 1ZRFA 1IGNA 1HW1A 1IUFA 2OU2A 3EPZA 3A8GB 3TVTA 4BY6B 3PFIA 3GTLJ 4BE2A 3HOVJ 3NRVA 1H92A 3SQNA 1U2WA 3G1MA 4LG0B 4EMSA 3OB9A 4RGSA 2WACA 3EG2A 1TWCJ 2GGRA 2VVKA 1NJIR 4F14A 2E41A 2KY9A 1M30A 1MHNA 5LJ5d 3LOCA 2DPDA 1TQMA 1C0MA 3I9V2 2GXBA 2L3SA 2X1CA 1ETXA 2DA1A 2LR8A 2QVOA 2VXDA 2DEQA 3F0CA 2A7YA 2X4JA 2DT5A 3VS1A 2CW8A 3GTPJ 4J7FA 1VQMQ 1B1BA 2OTJA 1QP2A 2ED1A 2JZ2A 3JRHA 2E19A 5IT3A 1S72T 2X0LA 3DKWA 4XRFA 2BBYA 3ASNH 1IB8A 1KFZA 3M55A 1ZR4A 1VZ0A 4FCYA 3ROUA 2PX9A 5FKMA 3CMEA 3F8FA 1O57A 1PUEE 4MNUA 3ZMZA 2FD5A 3CCSI 2L9SA 5LHGA 1Y0MA 1UG0A 3DKXA 2CDTA 3E0JB 1QKWA 5J8FA 2VC8A 3L2RA 3LSHA 2HDWA 1X4PA 2EBIA 4E7SA 1E7OA 1EZZB 4UUTA 4XU1A 4PJ0C 4IPAA 1JUPA 5ILUA 1Y71A 2RK1A 3KBGA 2OTJI 1LEAA 2OZ6A 3NAUA 4OU0A 2ZCFB 3CC2Q 2KDOA 1IV8A 2G9WA 3FHNA 4M71A 4YRVA 2CGHA 4FSXA 2FNAA 2L9VA 1MJ9A 4BJ6C 5FD6A 2KT8A 2VXEA 4QKUA 2GA1A 3DP7A 2JT4A 3GTGJ 4BXUA 4CI0C 2HPIA 1DJ7B 3CBPA 5CKBA 2EFOA 2ZO4A 2UWMA 1JTYA 4A3IJ 4V2FA 1WWXA 1M2VB 3LSIA 1KQ1A 2K27A 4EJWA 2V7FA 1TW3A 4IX7A 4ZTFA 3F8MA 2LC4A 3BR3A 3HOSA 1HSQA 2DXTA 1IRXA 1BI2A 1MMDA 4L5JA 1IZ6A 3GNGA 4ORZA 4RGUA 1O75A 3HXLA 1FMKA 3M59A 4ME7A 4E7LA 3CCMQ 5ILSA 2M87A 4DYCA 5EGOB 2DO7A 3TO9A 2X98A 1M4ZA 1Z7UA 1GFDA 5KCOA 2M0CA 1ZBJA 2O5RA 4HNVA 1Z9CA 1SF9A 5B1AH 4HT9A 3CDLA 2NVQJ 2PI0A 1N27A 1ZARA 3TSWA 4I0BA 3P8BB 1XD7A 2LX9A 2L54A 3W6VA 1HOMA 4F55A 4M9ZA 1PRLC 3D0SA 3LSJA 5D8KB 4KITB 1LQ1A 1PM3A 1J9IA 3AG1H 1HDDC 2R5ZA 1YX3A 2P0WA 1K1ZA 2QUFA 4QTRA 1S7OA 1RUWA 3CJQB 3KLNA 1XX5A 2XKOA 4M3GA 4O5VA 3RQ4A 4F7UF 1WGXA 2LTPA 1YW9A 3VYTB 1BBZA 3PO3J 2CH4W 3REBB 2M0YA 1U3OA 4LJZF 4HDVA 2FZCB 3ZRGA 2QBYB 4ZGJB 4LITA 4M74A 4R55A 1T33A 2KJBA 2VKNA 1LJ9A 3CMYA 4X6AJ 1XDSA 4D6WA 4LDVA 4X9CA 1ABOA 4WCGA 4C8QB 3OR1C 2DXCA 3EFSA 1EH8A 3OYDA 1E0EA 4XTXA 4F7UG 2XAFA 1GDTA 3CCSQ 4DYQA 4G6QA 4IJAA 2QI2A 3BDUA 1UJ0A 3E9GA 4M77B 5J47A 5D4RA 3Q1JA 5A0GA 1BR1A 1NHAA 1FOXA 1N9SA 4X34A 1X3ZB 4UB6C 2A5WA 4CXFA 3CCVQ 1GXQA 2GBYA 2X1EA 5HCKA 1HQCA 2WV1A 4H4KC 2QEXT 2OTJQ 1KA8A 3SZPA 4M7DD 2IA1A 1S7EA 3OIPA 1JKQC 5K7FA 3HGGA 3G7ZA 3AHUA 3MP6A 1BBYA 2R7DA 3CLOA 3O6BB 4I01A 1HK9A 5KE2A 2BE7D 2G7UA 4AIJA 4LDUA 2HQEA 1TT0A 3CQZJ 4C0DB 3DTEA 1MV0B 1O3TA 3HB9A 1J2XA 2DXBA 4X9DA 4M3BA 5DYMA 3M9QA 3OS5A 1QRYA 2OQGA 3M0TA 4IIOA 2XAUA 3ZGKA 4QLCU 2CZ0B 3H0DA 2FQ4A 2FB7A 5L3CA 4Z8AA 4QVZA 4R8HA 1B8IB 3HHHA 5CVIA 2E2HJ 3BG7A 3S1NJ 2XD0A 1KQSA 1P4AA 4ZNXA 1V5FA 1D0YA 5GAOp 2IRFG 3LAJA 5LJ3g 1SMYF 1K78B 4C8QE 2RH2A 1IW7F 2OCCH 2HYJA 4B48A 2FEIA 1OR7C 2FZKB 2KE9A 5GAN2 2YX4A 3TW7A 2NYXA 2MW8A 4M77E 1KD1R 1WVRA 3HC7A 4P5OA 1YN8A 2C0IA 3CCQA 3OYJA 3F9KA 2JS0A 2ECCA 4RGRA 2RD1A 4JJBA 2RJDA 1WH7A 4J6WA 3EGDB 1IDZA 4LXCA 2CSOA 5E17F 4BY6C 4ZC3A 2E1MB 2K4BA 2OAZA 5HLGA 2XHCA 5IHNA 5E3MA 2ZZDA 2C06A 2YX7A 4LDXA 2WAEA 2PMZA 1LDJA 5GTHC 3CCET 3K70C 1V5EA 4HBLA 2NVXJ 4CCNA 3ZPLA 1TNTA 1USSA 4KMUX 2EYYA 5B66C 5DD4A 3KP4A 4D5FA 4HNTA 1IUYA 3NTKA 4C92B 2K2VA 3FX3A 1VQOT 4D5CA 2HAXA 5K5RA 4L0ZB 4P96A 2LJ1A 1GLNA 3CCQI 3M4OJ 1OJLA 1QU3A 4LDYA 4QQ6A 3G4SA 5DDGA 4Z89A 1WNLA 3EG9B 1T08B 3OSSC 2VKHA 3GXOA 2NUTB 2F5DA 2IBDA 4IHVA 1ORKA 4HRIA 4II2A 5L8RE 1W2BP 1A0NB 3R4KA 1O3SA 1K79A 3EGXB 3V4GA 1ACIA 1X3UA 4QT7A 4EDUA 1TL8A 4A4HA 4F17A 5LJ3j 5LJ3e 4M75F 2CQKA 1N25A 4G12A 3D5LA 1OPLA 2VJ5A 2PBIA 2LYCA 4JOMA 5CLSA 1MSEC 1UGPB 3J80E 4PFZA 4Y92A 5LJ5h 1FYKA 3G4SI 1D3YA 2ZMEB 3FXMA 2ABLA 2E6NA 2AS5F 2OAUA 3FM3A 1PCXA 2OBPA 1WKMA 4M75G 2W7NA 2KBTA 3BPVA 3HPGA 3FB9A 4QWQA 3CC7I 3FM5A 4E4HA 1HCRA 3A8HB 3E5QA 1RAHB 3PVLA 2J5PA 1YIJA 5EDNA 4HX8A 1M3BA 3GW2A 1WIEA 3VS5A 1R58A 1FOWA 4B3AA 4OAYA 4HVUA 1Q7YR 2DD5A 4JX4A 4D7NA 2V79A 3KP7A 1YCYA 2WAQN 1YI2T 3GO5A 1UHWA 3LFUA 4I0AA 5J6XA 2F5FA 2IPOB 1TWGJ 1XPXA 3CXCA 4PJLA 3T5XA 3CCRI 1BCMA 1NG7A 2EZLA 3M0PA 3VS2A 4JRPA 5DM7F 4J00A 1YBYA 4JRIA 5E79C 4ASNA 2DBKA 2P0KA 2KRFA 2QENA 3QYFA 3PQJA 4OMMA 2XGEA 2LNVA 3GVAA 2HR3A 3S8PA 1YIJI 1U1SA 3X2QH 2MD0A 3RPQA 4KYWA 2LT4A 2DODA 2RHIA 2QKLB 2KRMA 1VQ5T 2CZ1B 3SYTA 4JRKA 4E7KA 3FMRA 1YNZA 5GAOn 3KPHA 3OOUA 4BEHA 3QZ5B 1AWJA 4XICA 2ROLA 2DPUA 2DK3A 2X3XD 2QZ8A 1IC8A 3KETA 1EH7A 5KK1A 1FOKA 2KXCA 1W7PB 3AG3H 2V8IA 3M5AA 3IP4B 1IN5A 3TMOA 3CCQQ 2ECBA 1X43A 3GLXA 2BHZA 4BHBA 4N0AC 2MFZA 3H3UA 2HOAA 2XUBA 3LSRA 1S72A 3I0TA 3FKJA 2CW0F 2L7MP 3I53A 3S32A 3TP0A 1ZELA 2D5VA 3S1RJ 3K4NA 2EINH 2P5LC 2STWA 2W0ZA 1JXMA 1E17A 1VQ9I 1K9AA 3VSLA 3HKZN 3A01A 4KIFA 5K7ZA 1ETYA 1F5TA 4RMOA 4GO1A 2R5YB 3MP1A 1K4SA 4P9FA 3FK7A 4DOWA 4EJOA 5DLQE 1XMXA 4M77C 3GZ5A 1WHGA 3JR9A 2XB0X 3VRZA 2PG4A 4HG2A 1DPUA 1SRLA 1OCZH 4V19K 3IC7A 1LEBA 2WSEE 2E7WA 1S72I 1PC0A 2HOEA 2RF0A 8AT1B 1IN7A 2AQFA 2VB6A 4XN3A 4HXJA 1APLC 2E5QA 1BN5A 1GUUA 2QCOA 2PMHA 2YSQA 4F7UB 3CC7Q 1ODDA 3U2RA 5D6XA 3M8FA 2HXOA 1V5GA 5M3MJ 1TH7A 2LLKA 2NUPA 3BP8A 2HD0A 3C95A 4BUGA 2ID3A 2DW4A 1FC3A 2RQPA 5F1JA 2JOYA 3OR2C 2W48A 4CCJA 5D5WB 3I58A 2O03A 3CUOA 2XV4S 2CH4A 3LA2A 1OFCX 2MMPA 3GPLA 1PVEA 4GLMA 2BGCA 2HQNA 1GXPA 1QLYA 3CCRQ 4DOZA 3J7AF 4A3GJ 1W1WE 4DJAA 1N8RR 1U9NA 2E10A 3ZBDA 1OR7A 1SANA 5D5VB 2ETHA 1N77A 2DA5A 1PJRA 2MD5A 2ZKZA 2D45A 2LTOA 3OW2S 3KLOA 3AKZA 2DE0X 1YIJQ 1X2KA 5D5XB 2RDPA 2SRCA 1KU9A 1WCMJ 2ICWG 2TDXA 4L5EA 4HLYA 3REAB 5GAN5 2XHKA 2BOLA 1C6VX 2ZNZA 3JCMP 2O8KA 3BTLA 2VXFA 3MZHA 2VC1A 1X3WB 2QA4T 3HOYJ 4IF4A 3OYCA 4IUVA 4YFXF 2F5VA 1T0HA 2H3EB 1LFPA 2RKHA 2RREA 1F4KA 3HHGA 1ZG5A 1HLVA 3CCJA 3HSBA 1KQ0A 5CO7A 2I0NA 3LSKA 2D8HA 2A61A 3EUKL 3TQ7P 5GTIC 2OUMA 4J6YA 1YG2A 4FX4A 2OTLT 4CDGA 2JA6J 4F7UE 2KEAA 2D9TA 1WDXA 5GMKj 5GMKe 4JLIA 2DOEA 5KCMA 4BBRJ 3KYDB 1ZGJA 1W6XA 4C92C 2NYSA 3P7NA 1EKEA 1K73R 2NS7A 2PJRB 5D5UB 3VS3A 2CSIA 2CV0A 4R56A 2VN2A 1VQ9Q 2G7HA 2TRTA 5LGUA 3CCJI 5GAMe 3LSTA 4E7JA 3PT9A 1KQSP 1D1BA 2GQVA 3J80R 2L7KA 4FIBA 1D0XA 2KRNA 3F6VA 3HP9A 3I35A 4C0FA 1KJWA 2QEXA 4J9EA 2X51A 2HYGD 4ZDLA 1SFKA 1UTIA 3FRNA 4F16A 2HQ5A 3UA6A 5F1RA 1R1UA 1YJNT 1S72Q 4XORA 4RAZA 4JJDA 1OU8A 1I07A 1Z9ZA 2XROA 3CMAA 1JI8A 2X6XA 1A31A 2D0NA 3LX7A 3J81Z 2ZMEC 2X4HA 3UPUA 3DCFA 2YPRA 3BR5A 5F0HA 2A3SA 3CPWS 4JS4A 4HZFA 1TW2A 1KGSA 2DA3A 2WV0A 4ZJZA 3PNYA 3IH3A 4A0ZA 1BKBA 2QEXI 2AKLA 2EFQA 1M2VA 4XONA 3RMQA 3A8OB 1BIAA 5HNFA 2JPCA 4PL6A 2BY1A 3WGGA 3KZYA 1R23A 1ZHFA 2X48A 2XPUA 1JKPC 3GZ6A 4QW2A 2MSYA 2CZ6B 1Z05A 4N9HA 3C18A 3O5ZA 2LCLA 4M3DA 5K1YA 3KEYA 3T1BA 4KUIA 4M75B 5EGOA 4C5IA 1B6AA 2P5VA 5J1UA 3SJMA 4CUGA 1MSFC 5IN1A 3S17J 2QQRA 4XM3A 1PUFA 1YJWT 1WI3A 1S5LC 3QQAA 3WHBA 2Y9YA 4NC7A 4A0XA 1CQTA 4IO9F 5H6QA 1WA7A 3VODA 3IAS2 3E19A 5KYXA 3TBIA 2BTTA 3K7AJ 1LDKB 1VQ7T 1FT9A 1X1AA 4KUMA 5CVUA 3L2QA 4OWRB 2Z0WA 2M1HA 4IUPA 2OPTA 1I5ZA 2IEKA 2MC3A 2QQ8A 4AIDA 2HNHA 2O9LA 2DTOA 1ZG3A 2KZGA 1TNSA 1FX7A 1RKTA 4M9XA 2RHYA 3DU5A 2ZPGB 4N4GA 4N0AA 3VS0A 4M7DF 3L9FA 1MBEA 1VQOA 3C2HA 1TQPA 2LCCA 2AK5A 3GBQA 3G71T 1Z91A 1Q81C 3IKVA 4A3BJ 1ZLJA 2QBYA 2J05A 4E2FB 3OYMA 3I54A 4C2MJ 5HY6A 4Y52J 4IEJA 4MQ9F 4Y3OA 4JX6A 1UAAA 2E60A 2H94A 1HA8A 1PRMC 1D8KA 2ZSIB 4G6TB 2NVYJ 3MQ0A 4GRIA 2MABA 5ERIA 3PIPF 1D3BA 1S8NA 3FDYA 3DTKA 4XQFA 1O3RA 1L3LA 2NUZA 4OIPF 3CXCP 3NGPA 3CCJQ 3JCMJ 2K3XA 3QDRB 1LDDA 4UVAA 4M7DG 4DEXA 3CCEI 3I64A 4L9JA 4M77A 3JAME 2R57A 1MMNA 1G59A 3EYIA 1ETQA 1VQOI 2A0FB 4M75E 3I5UA 1RL2A 2F2XA 1I1GA 3FIWA 3RDIA 1MH4A 2DFEA 3ZMTA 1JGGA 1KYWA 2DYSH 4HYEA 1AHDP 4XU0A 3OYEA 4NL3A 2DFHA 3NFCA 3QWLA 4EATA 3URGA 4BU2A 1HSTA 2CO5A 2GBQA 3RUXA 1I4K1 3DLMA 2BE9B 5I11A 1M90C 1UHMA 3BJAA 3CLQA 2PVOB 1Z0XA 3IUOA 1OYXA 3OYKA 2W24A 3QBYA 5FLXE 2XDPA 1KQ8A 1RABB 5CIUA 3JRIA 4EM2A 2QEXQ 1M9SA 4BI8B 1XGMA 3J7YJ 4HEA2 2STTA 3M07A 5D6EA 5M5YJ 2RN8A 3VS6A 3EUHC 2UUZA 2JNGA 2I10A 5EZHA 1G2BA 2ZPEB 4L59A 7AT1B 2QKMB 2JVHA 3LSGA 1K4US 2P7CB 2YUOA 1AKHA 4BQQA 5FLXK 1M8VA 4BJ5C 1BI1A 4Z02A 4J9BA 2BHYA 3H9QA 3O8VA 1GVDA 2GAUA 4B6MA 3M1CA 2XC7A 2EPDA 3CCLI 2JTVA 1K78A 3DPLC 2NAZA 4BKXA 1VF9A 2HTSA 2K4JA 4B4CA 3A5ZB 1IO6A 1YHQI 1SC7A 4MLOA 5E3LA 1QVTA 4IHYA 2XAQA 2M9HA 1VQ5A 1IXRC 3KFVA 3S3MA 2DTZA 3QPTA 2BY2A 3BCAA 1IG7A 3EGDA 5FLMJ 3H0GJ 4KT5C 3VRYA 2IA0A 4A12A 1LVKA 4W1UA 2O61A 1I8FA 2EIMH 2VT3A 2CS3A 3IV5A 4L18B 2CYZB 3NMZC 2EA4A 1FTZA 1WJEA 2KIQA 3LWHA 1B9MA 3S1QJ 2Q2EB 2F2WA 5LJ5j 4EGZA 4XTZA 2KMUA 1J59A 2FRYA 1F1ZA 4C92A 2P0TA 2E34A 2XGXA 3KUFA 1V4RA 3GMEA 2FRHA 2NXNB 5EG0A 3N4MA 1UGSB 2L3DA 2EJ9A 4NBQA 5IPAA 1VQ5I 3EFRA 3V7CA 2DA4A 1B34B 1SRMA 1P9QC 1Q1VA 1YX5A 4NC8A 2YHTA 3EG9A 4M7AG 3WTUC 1ITYA 3H1CA 1ACMB 3INZA 2O31A 3MEWA 5ICEA 2E64A 3CCEQ 1QWFA 2ZXJA 3LW5E 3MCZA 2QTXA 1NYGA 2LP0A 3I5SA 4D8KA 5I2SA 2V6EA 1VQOQ 3BG5A 4C3JJ 4OIQF 1W5CC 1PP7U 2R92J 2CUDA 1NEGA 1DGRM 1KONA 2Z33A 3JV3A 2K2MA 1XSVA 2DAOA 3MKDA 1Q81U 2ZMEA 3KZZA 1R36A 3W2VA 2FBHA 4I09A 1LNXA 1WJSA 2DJZA 2VUMJ 3LQQA 4P9UA 3DLLA 1F9NA 2ME0A 1U5TB 3FXJA 4UV9A 1ON1A 3H36A 1ZAOA 3HZJA 3E2UA 2VBXA 2WY8Q 2KQRA 4EVIA 3CF5F 1X6OA 4XKCA 3W6KB 4KDPA 1CKBA 5FRMA 3PQKA 2CV1A 2VC0A 2EGEA 1V76A 2RNAA 5GAN8 1LKXA 4PFOA 1LNWA 4EV0A 3H5AA 4FYVB 5GAGJ 4XKBA 3PUFA 1I3AA 4WK8F 4KGZB 5D4SA 1V29B 4UNOA 2K5FA 2OAWA 5FU7B 1A6IA 2AZSA 2KIUA 3K4KA 2CP5A 2EILH 2EQMA 4L0YB 3OQ5A 2DYBA 2QGGA 3RKQA 2O2OA 2X4YA 3G6EA 5CKHA 3SFZA 4PJOB 3UDCA 5ILVA 1M90U 2IT0A 3DWLE 3BT9A 1IHWA 2DMUA 5A0LA 3L1PA 4BNCA 3CCLQ 3HRSA 2ZGWA 1VYVA 5L23A 5GMKi 1YS7A 3SDZA 1I5LA 3ABUA 2F5KA 2ME6A 4IQ4A 2MIOA 1UJ8A 4AU7A 1XB4A 3FZVA 2ROTA 1OCRH 5LEKA 1X1CA 3PFYA 2DDAA 5KYYA 2DT6A 1H3HA 1WHUA 4AFUC 4M6XA 4EMKC 2XICA 1ZGWA 2X4XA 3S2WA 2EW3A 2X4WA 5GAMd 2QA4A 1RPWA 2D6FA 4BI3A 2LK2A 3IHUA 2ZCWA 4A0YA 5HLTA 4JPBW 2EFNA 3DEUA 1G5VA 3JRDA 1R49A 1RAFB 4XR6A 2MLGA 5J4YA 5FRNA 3QDFA 1W7PA 2OTLA 5DY9A 3T0YA 4B44A 4EM0B 2GTJA 2J06A 4FU6A 3JCMh 4PZJA 3FXLA 4LGWA 5H20A 4O6JA 3OYAA 2Y0SA 1WJRA 2LQWA 2O9SA 2WB1N 3MEAA 3Q9SA 1VQ5Q 3RPUD 3MKZA 1IN6A 3BE3A 2GTOA 3ECOA 1LFBA 3ZXSA 2HQHA 2B9SA 3P8HA 3LH5A 1XCBA 3T9NA 3CBMA 2V1NA 3K2ZA 1AWXA 4AIKA 2K79A 3Q0UA 2F2EA 4M78F 5BS6A 3KCCA 2PJPA 2OTLI 2CT4A 1SD7A 5J1RA 2R5YA 1FMVA 1OQYA 2R93J 1ZH5A 1JE8A 2DMNA 3MD2A 1D1CA 2DXIA 3QOPA 1G4DA 2IVWA 5KYWB 3JB9G 1U06A 2HL3A 1YJNA 2QGUA 1K9MU 1WJCA 2LT1A 4OOIA 2RV8A 2VOPA 4A5MA 1HKTA 1Z7LA 2KFDA 1AU7A 2K5IA 2ACJA 5GANh 5CYVA 4KMFA 5JHUA 3WTYC 1FBSA 4FW2A 4GY5A 4UUSB 1UFMA 4BQAA 2EGCA 3BR1A 4HPQA 4M7DB 5GAN3 2KISA 2L7FP 3EUHA 1X1BA 3RI4A 5KE3A 2KZVA 2WY7Q 2DYIA 2R0QC 2HCKA 2LQKA 2L5QA 2E35A 1XCVA 3QSUA 2HQXA 3J7ZI 1YJNI 2GOMA 2HWVA 4R79A 5C44J 5KAIC 2M8GX 1ETOA 9ANTA 2PEXA 1ZLMA 5DM7R 4JBAA 4EJVA 4VUBA 3H9JA 2DLPA 5BQTA 5LD2C 1K76A 1UJYA 3EG3A 2R7VA 2YUNA 2A36A 2H8HA 5CQXA 1NE8A 3DKYA 1YJWA 4LN2A 3SWNB 2FPEA 5FGMA 1VQ6A 1RIOH 2VWFA 2DOFA 2MLKA 4ZGEB 2QSGX 2B7EA 4AYBN 2MGQA 4HCCA 1KQ9A 2COZA 3H0HA 3K9TA 4FT4A 2L9RA 2R5AA 2BXYA 3OYGA 2AHQA 4IZZA 1AA7A 2XIGA 3AFHA 2QSFX 2VGNA 2K5LA 2DMPA 2WA0A 1VQ7A 3OYLA 3N05A 4PSWA 3U1DA 2DVJA 2FYKA 3C2GA 3DU6A 1QCFA 2O9VA 2DQLA 3QOEA 2ESHA 2EV5A 2HQRA 3RYPA 4BXFA 1M8MA 4A4FA 4RM3A 1WJDA 9ATCB 3QPHA 3ZEHA 1ZTRA 2L0KA 3G71A 5E20A 3RMSA 1TS9A 4M7DE 2KR3A 3JTGA 3MZ8A 3DLAA 1SVOA 1Y39A 4OMFB 2P4WA 3RCOA 4D8DA 3TU4K 2LFBA 1QZYA 2JJ9A 2QA4Q 1NLOC 2C0OA 5B5EC 5BPDA 1U78A 3CMEI 3K4JA 1T39A 1MGQA 1WQ7A 2PJRA 2K9SA 2OC6A 3DEWA 5AIPA 4E6KG 1VQ7I 1T95A 2W85A 3KP3A 3T8RA 5CK9A 4DZJA 1BW5A 4HDUA 4ON0A 1OULA 3CQTA 2OTLQ 5GPAA 4A3CJ 4EEFG 5HVQC 4P55A 5A2QR 2KXDA 3META 5IAYA 5FO5A 3PFSA 2LSOA 1ZHIA 4OP0A 3G71I 4BBSJ 2IGNA 5IXFA 5IT9Z 1YYVA 2JPBA 3ML6A 4WF2A 5JR3A 3H3VK 2P0QA 4OMPA 2E12A 5IXBA 3DXJF 1Y96B 2COWA 3CJRB 3TSZA 1NG6A 1XGOA 2P6SA 1TC3C 4LIVA 5F6FA 3CBOA 1XSDA 4FSSA 3JCMb 4B9WA 3GTMJ 4HV5A 1VQKT 2QDLA 1NM7A 2Z9OA 3H41A 1U5TC 4YELA 1LJOA 4IUQA 4U7BA 1R71A 2L01A 1SG5A 2KJCA 2K3FA 1WPKA 2DO3A 1YJNQ 1KIKA 2IS6A 1N78A 4KICA 2A37A 5TGTA 2DD4A 1M3AA 2LREA 3ERMA 1IHVA 4FYYB 2DMOA 2FZGB 4JDSA 2IGKA 5GANf 4XQ3A 3A0BC 3E3VA 1H0MA 5FFXA 1JO8A 3TCJA 4ZN3A 4EMKA 1TUDA 4PJOC 2VIXA 4CA0A 5F64A 1X19A 1VTNC 5DD8A 3OS1A 3V7RA 4A63B 2JQ7A 5GP9A 2KYMA 2NS0A 2Z5UA 2EIKH 1MUZA 4U87A 2AIRB 2EQRA 4NNJA 3FMQA 1SFUA 3QJYA 2LF8A 1AHJB 3RTRA 2DILA 5J3LA 2F2VA 5I2MA 1EFNA 2B86A 3LSPA 5JFRA 1HSJA 4GBQA 2MUNA 4BE1A 2FF4A 2R7OA 1R8OB 2GIVA 2KK4A 2FO0A 1RAEB 1W5TA 4JZ4A 1Y0NA 5KAFC 4CYCB 1R5GA 1BI3A 3KYCB 4PJNA 3DB4A 2OD5A 2CJJA 1KD1C 3CMAT 4EQQA 3HKSA 3CMEQ 3BFMA 1VQ7Q 2O0YA 1XG1A 3WTVC 2WSCE 4C5EA 3G1LA 1HD3A 2HSPA 2EH3A 2VODA 1P2FA 2JUFA 1YW7A 2QXFA 3DPUA 1T98A 3HOXJ 4IRGA 2CP0A 2FPDA 1R00A 4UV8A 1X2MA 1ZA2B 3TGNA 3G71Q 5GAOr 5GAMh 3OYFA 5BOXA 4XKWA 1MGTA 2ZXWH 2E1OA 3BJOA 3I4MJ 2ZSHB 2HL5C 2VLAA 4M7AB 2JJ7A 1D5VA 2NS8A 4N9IA 3S14J 3VYGA 1R6RA 2FOKA 3MN2A 5K7HA 3QYGB 2HEOA 3I56T 1NEBA 5BPIA 2RGVA 3DBHB 4F3QA 5LHHA 4N4NB 3FHZA 5IT9R 1K6YA 1H88C 3ZL7C 1WRJA 2ZNYA 3K70D 1I1JA 1QVGS 2EKOA 3H9NA 1STZA 3THKA 2Z16A 2BEOA 2EVRA 3ZMDA 4CH7A 1LB2A 1ZGAA 2CP7A 2O4XB 1YO5C 3FXOA 1BB9A 1TWBA 2Y90A 1SHFA 3RBBB 3U23A 1OZ2A 3LGLA 2CQ7A 3BR6A 5HK0A 4KA4A 3HDDA 1HYOA 2MH9A 3QAHA 2DKGA 3UF4A 4QVCA 2UXNA 1IO2A 3R6SA 2PUKB 1QHHD 2VT2A 3QU3A 3MAJA 4BD3A 3M58A 1JTXA 2WSFE 2RPNA 3WGHA 1KZHA 4YFNF 3JB9J 1VQ8T 1RRJA 4M9SA 1UUEA 3KYLA 1UMQA 3IRRA 2X1DA 4BACA 2O7OA 3FBNB 2KLOA 4Y4RA 2JSCA 4BUPA 1Q7YC 4XSXF 2DAQA 4I02A 3WVEB 3PSFA 1N6AA 4XTUA 2A6HF 2M5WA 4F91B 4M7AE 2AKKA 4IVNA 4C5GA 5J1YA 1W1FA 2EYQA 5D7UA 2GOXB 2M8EA 2Q2EA 3GUDA 3QYBA 2DJIA 1QVFS 4XRSG 2LKPA 3PNWC 4ZTJA 1O9SA 2K86A 4Q4ZF 4XLPF 1PDNC 2XF5A 5CVRA 2VONA 1VQNT 2A69F 2RO0A 1W36C 3CESA 3JRCA 1B34A 1OPCA 1FYNA 4UUVA 2LJ0A 3E6BA 2I2LA 2DFFA 3SHWA 2XSDC 2Z2SB 1SD6A 2CQXA 3BZCA 4AFSC 2ZFUA 5FKOA 2GIZA 3LL7A 3FBIB 3J80K 1AOYA 3EH2A 1NPRA 3W2AA 1NYFA 3RKXA 3JCMQ 3B6AA 2G0EA 2GM4A 4DOVA 4HSTA 5K5QA 3SHFA 1ENHA 4NHJA 2K7LA 1TBXA 1AZGB 2K9MA 2KPMA 3QRFF 3S6WA 1RUOA 1AVZC 2PMUA 4XLFA 3ZR8X 4B43A 3ASOH 2M02A 2F4MB 5GANj 1Y6IA 4KH0B 4E6RA 3OSGA 2DXUA 2CFOA 2JZYA 3O3KA 1KD1U 1U5TA 4KGXB 3D1NI 1J3TA 3IWFA 2WC2A 2JRMA 2EIJH 1CF7B 2DI3A 1PNJA 3C1DA 1UB9A 1TXQA 1BI0A 2Z1DA 1UGQB 1I39A 1VYUA 4XK4A 4HX4A 5CVJA 5D6FA 1S1NA 2DX1A 1JEGA 1WXBA 3Q3SA 3KXTA 2F5EA 2RJFA 1TU0B 2VQLA 3EAEA 2VKEA 4NOYA 2R7SA 3M4YA 4ESBA 3K4LA 3WG7H 4IOCF 4AC0A 2EFIA 3FC3A 4KBMB 1X2QA 1EF4A 4ATOA 2QQAA 3OIOA 1WQWA 5L3FA 4BQNA 2NNYA 5FU6B 4PJOA 2Y9ZA 4IHXA 1KQ2A 3ME9A 1XTDA 2DF6A 3ZQ7A 1FPQA 5GPCA 3W3CA 2H1LA 2DL5A 2MK5A 2QGFB 4KNYA 4QQDA 1R4MB 1D09B 2V1QA 2ZPFB 3DPTA 2HBPA 3EHQA 1JXSA 5CKDA 2P0PA 1KHCA 3NTIA 3OSVA 2FBIA 3N5BB 2DA6A 1WQ2A 2DK8A 2VASA 4L9TA 4E70A 1YCSB 1MBKA 3W2WA 4ESFA 2IXSA 1IGQA 4Z88A 3D5RC 3NWTA 3ABTA 4B47A 5IY5H 2R7UA 2H3JA 2YRDA 4RLFA 4YTLA 2L8DA 5IOYA 2VV5A 1FTTA 4G6DA 4PNOA 2CRGA 4C8QC 1N8RC 3H35A 4RBOA 3JCMf 4AG2C 1CSKA 2HU9A 1MMSA 4M4ZA 3GFIA 2DK5A 3ER0A 4Q5WA 2DM1A 2FUG2 4XN0A 3OYHA 1YP5A 5ICGA 3PMTA 4GLKA 3WGIA 1H641 4ITVA 1UGRB 1W70A 3ABMH 1B07A 2ZJ2A 3K1NA 1Q7YU 1MV3A 1B59A 3WTWC 2A28A 2LQNA 2RQRA 3I59B 2D2WA 4ZDPA 3WU1B 1TWFJ 2JVVA 2CS7A 3U1KA 5FKKA 2XASA 5M9OA 5M5WJ 4M72A 4V2GA 1SFXA 4L5IA 4M78D 3HUGB 1JJ8C 3SB2A 4C0DC 5LJ5f 5KYWA 4ZDOA 4HVVA 3J81E 3P9IA 4BAYA 3KP6A 5HLHA 2DDBA 1LCKA 3G6ET 1Z3YA 3U21A 3B6CA 5JI6A 2WAQA 3OYYA 3CCVA 2DA2A 1M3CA 3FXRA 4B1RA 4M7AC 3CTAA 1K73C 3E6DA 4F52A 2QK0A 1AZEA 4UUSA 3QG1A 4CCMA 1SFEA 1VQKA 4M7DA 4RB3C 2KQWA 1KG1A 1NZ9A 1XSXA 3BZ6A 4EJUA 3CUQB 3ZQGA 1R5HA 5KNLA 3L2WA 4OMZA 1YTYA 1TP4A 1W0TA 1I5OB 2EAYA 2KGTA 4U0YA 3Q9VA 2XK0A 4K11A 4XKVA 4A54A 3ZN1A 4LG0A 3MWMA 5LRRA 3HOUJ 4C92D 4DIQA 3BR2A 1DDNA 1RI0A 1PSFA 1QVGA 1RZ4A 3X28B 3CCVI 2LCSA 2VKDA 5M5XJ 4HF1A 5DUKA 5DCFA 4XTWA 1GV5A 1IXCA 2E1MC 2WTEA 3JTHA 4UHTA 3B02A 1PP8F 2L89A 5IOZA 3JSCA 4UB8C 4ESRA 1QVFP 3EQLF 2LRQA 1EX4A 3T8TA 2MH2A 3O8GA 3VDXA 2M7AA 3PMIA 3PNVA 5CVVA 2CYYA 2FA5A 2LNBA 3BG6A 5E1ZB 3SZGA 4AD9A 3RESA 1GXIE 3SZTA 2IIMA 3M4GA 1DU6A 2DERA 4LLGF 2YUSA 1U9OA 3M56A 4I98B 3TP3A 2XAJA 3ELKA 3M7GA 3I55T 2YWWA 1A35A 1QCOA 2P6TA 2ZB9A 1TT5B 5F27A 4BQOA 4DBRA 1RAIB 3H0IA 5DUIA 5CR2A 5IP6A 5CKFA 1T6SA 2FNPA 2GA2A 4Q5SF 5D6YA 3HKZA 5IHKA 1JJ2S 2CUJA 1VQLT 2O01E 2IP2A 2XVCA 1KC8R 5LL6S 2EJGA 1BK2A 2WADA 1Z21A 3OS2A 1NG2A 2IPQX 4BY1J 3JCMg 2OV7A 1X27A 4MHGA 3CDHA 2KVQG 1RKWA 4IRHA 2CU7A 1K8AC 1QVFA 2ZJPF 1VNDA 4XIDA 1OOTA 3VUZA 3AG4H 2Z3YA 2KRHA 2D1VA 4Y13A 1B3QA 3EHRA 1MD0A 1YOVB 5JHFA 1WPYA 2H8RA 1PKSA 2MVTA 4DQ2A 3QKJA 3ZQFA 1M1KC 2EK5A 4D7MA 1QW1A 1ZA1B 5HK3A 1KHIA 1DU0A 2Y69H 1FSHA 1O4XA 2L2PA 3QWXX 2EB7A 1Y96A 4CZZA 3CMAI 4A3JJ 3QU6A 3I56A 3DV8A 4G9YA 5DTDA 3A1YA 2M9UA 1FYMA 2DNUA 1Q82R 4A4KA 2HEQA 4OGEA 4IHTA 3ONQA 2V9PA 3RKWA 3RDVA 4CC4B 4J9DA 1X2NA 5LJ5g 1VQ6T 2M35A 1UHSA 3N97A 2Y0MA 1FIAA 1T0FC 4XLCA 2ZJRF 3JRZA 2COMA 1TTHB 2VQHA 1SVMA 1Q86R 3ULRB 1Y8RB 3QUIA 4NDLA 1P6RA 3KFWX 2L9NA 1W4SA 2XKPA 3WTTC 3QXEB 4RG2A 1POGA 4QSHA 5LJ3d 3OMCA 2ADUA 3A98A 1HW2A 3IQLA 4C30A 1O7LA 1WHJA 1Y07A 3BCBA 1FLIA 3QJ6A 5GAN4 3CCST 2GZWA 1GRIA 3J7AY 3M1EA 2J6OA 4LB6B 1K73U 3HPWA 1ETWA 2HKOA 4J01A 3G1JA 5KHDA 1OISA 3HOTA 1TG0A 1UDLA 2G6FX 2K3BA 2LOOA 2KDSA 1RACB 3RJPA 5FU6C 3LWIA 1VQ8A 1R0BG 4UC4A 1FMWA 2KI7A 3A52A 2DJNA 4C8QA 1LVAA 5TRDA 3GTJJ 3KEQA 2YUQA 2LP5A 2P7VB 2O6GE 3ESWB 1ETKA 2VJ4A 5HS7A 2A08A 2NOGA 2QF7A 1QBJA 1UHCA 3WTXC 1BW6A 2R7ZJ 3A4CA 2LY9A 3F8NA 1O3QA 1WJQA 2Y30A 2PZ1A 4RTYA 5CQYA 2KNBB 2V26A 5IH2A 3JSPA 3W6JB 2K5CA 4NB5A 1SMTA 3F23A 1QPIA 2COBA 1IAWA 2CUFA 1DUXC 1VQ8I 3FDRA 5GMKl 5LGTA 2EQUA 1RI7A 3S2DJ 2E1HA 1VQNA 3RERA 4AVPA 1SD4A 3JAMK 4A3EJ 4I2OA 2X9HA 2RQTA 1JQQA 4OIRF 4PK4A 5TJJA 2NVTJ 3GOXA 1IV6A 3TREA 3CO7C 3PNTA 4YIFA 2OI3A 1HC8A 2RAEA 1FY7A 1JHHA 4G94A 3IH2A 1MKMA 2L3PA 3VWBA 1A36A 4HT8A 3TDUC 5FFZA 2CWEA 1WI9A 3J81R 1OX9A 2COYA 2W10A 3E6CC 4R0KA 3O8HA 2JXBA 4CHUA 2RVCA 1SFOJ 1P92A 4M7AA 1RC9A 4FT8A 3WG9A 4BGDA 5C4JJ 1VQNI 1B8IA 1MZBA 3CMAQ 4OINF 2K3PA 3GZNB 4HQMA 4EM1A 2V6CA 3GBGA 1EV7A 2RC4A 1Z67A 2DMTA 4ZYGA 1VYTA 3SEMA 4M6VA 2L2OA 1IN8A 2CH0A 1BOAA 1K8AU 2BVLA 2DL3A 4FW1A 5HKCA 1QZZA 1CKAA 2IW5A 4KIGA 1D0ZA 2DFIA 2QLZA 5E3NA 4QQGA 2CP3A 3PSIA 2BZTA 3E1SA 1RETA 2IVMA 1M1KU 2Q1ZB 3OA6A 2CUEA 3OW2A 5C6SA 1AEYA 3CUQC 3QWYA 2OF7A 3GWZA 3PIOA 2ESNA 2CV2A 2YLBA 5K5OA 2RJEA 2CQNA 3UATA 2EYWA 3C0CA 1ARKA 3S2HJ 4J9CA 3R61A 1BOBA 3QP6A 4RAFA 3RYRA 4JX5A 2K40A 3C2BA 4F92B 5DV5A 4A5NA 3S3OA 5KVRA 3FXQA 3KIOA 4RTXA 4A3MJ 2AQEA 2W82A 1UE9A 4UY8I 3CMMA 4XLNF 3P8DA 5KYNA 3G4SQ 1QP3A 3QP5A 2X6OA 2KHMA 5IP7J 1SPKA 1YFNA 2NUTA 3F8BA 4CCKA 4ZYEA 2P4RA 1G3TA 2QQBA 4D9JA 3EGXA 4CRIA 4HLXA 4XAXB 2MCNA 1FNNA 2LMDA 5L3GA 4BJTA 3DEEA 1Y57A 2F69A 1OMIA 3EETA 5B1BH 2AXLA 1YWPA 2VL8A 3H5RA 2E1CA 1UB4A 4JUVA 3OL4A 4ENNA 3KZIC 1VQ8Q 1MMGA 4MFEA 2JM9A 1TLHB 1LPQA 2ZPIB 2VBZA 5A2QE 4HF2A 2QSHX 1OZ3A 2GCXA 4FYWB 2RM4A 2LG4A 1HKQA 4Y28E 2BXZA 4DW6A 3BY7A 3M8JA 5L3EA 3V8KA 3CF2A 3JCMV 1YJ9T 1VQPT 4XRMA 1IRGA 1RI9A 4G7ZF 1R77A 1WXUA 2JTMA 2O8XA 4KGVB 1VQLA 4RB0A 1I3QJ 1QVGP 3PGGA 3EG0A 1JJ2A 1TQIA 2JWTA 2QM3A 2GWRA 2ZXHA 5A2QK 1EA3A 2VBWA 2NVUB 1G3SA 3IAM2 2WWYA 2M51A 3A1PA 3H3ZA 1KU7A 3S15J 2FEZA 1I81A 1OU9A 3DQVC 1EIFA 3IH4A 4HCZA 5FLXZ 5GAOq 1MNEA 4MMKA 1IXSB 2XRLA 3VB2A 3IRQA 3UKGA 1U3EM 3E5UA 4J8OA 3WXMB 2DTRA 3CPWA 3QO3A 5GMKm 2FX0A 4FISA 2YSRA 1YITT 5GAN6 3VS4A 3E7LA 2HDDA 1T0FA 4C2UA 1VFCA 3CD6T 1CF7A 2ATCB 2FSWA 4HF0A 2BUDA 5LRSA 4M77F 1KSWA 3P5JA 2F6CA 2EV0A 4M75C 1K9MR 1FP2A 3ZMUA 3TDZC 1BC7C 1M27C 3JRAA 2EZHA 2RHZA 4BDYA 1I6XA 3H9GA 3LAPA 4BDZA 2DVEA 4BY7J 1V3FA 3OYNA 1B72B 4LUEA 5KYUA 3JCUC 4II1A 3JCMX 2M0MA 2A07F 3G6EI 2FMYA 3SD4A 2XGCA 2F4OB 3I71A 1M1GA 1OYIA 5AONA 4WWCA 3CEYA 2ID6A 4QPOA 2A3LA 1VQ4T 1U1TA 1RLQC 3I4NJ
chains in the Genus database with same CATH topology
2Y4YA 5DEQA 3OYBA 3ZN0A 2EQJA 4HW0A 1NJIC 4UVBA 3K1MA 5FD5A 3OMGA 2MBFA 3I55A 3CC7T 1ZRDA 2PQWA 3MCAB 4HCBA 2DZ9A 4RG8A 4ZYHA 1QNTA 5LJ3h 2BIVA 3M53A 4GCVA 1VQLA 4G8XA 3E9FA 4MGRA 2DU9A 4JJNK 5J39A 2LVMA 2JN0A 3F21A 1FYLA 1UEBA 4M78G 3E97A 3P9CA 3TKYA 4F7UA 1FBUA 3I59A 3WE3A 2EA2A