1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
3FM3A 1R22A 1UHMA 2MA3A 4ETSA 1AOYA 4N9HA 5E1ZB 3HIFA 3VOEA 4S05A 1U6GA 1T38A 1BI3A 4N0BA 1RNLA 2Q8KA 4EJOA 1ULYA 3R61A 4Y17A 4YFXF 1O3QA 4NHJA 1YLFA 1STZA 1P6RA 1MDMA 3KP3A 1W7PB 3V7RA 5HS8A 5DUKA 4B09A 1O3TA 1BYMA 1OR7A 1S3JA 5D8KB 3GF2A 1I27A 2WC2A 4BHPA 3RPQA 2PN6A 4Q48A 3BJAA 2BEOA 4M9XA 4ENKA 4PDKA 2OD5A 3HOTA 4L9JA 3IC7A 1FY7A 1MKMA 4I98B 2VOOA 2F2EA 1ZARA 5D4RA 2HDCA 2QQ9A 5CVIA 2ETHA 5JR3A 2ZKZA 1TQIA 1QVPA 1KU7A 5L3CA 5D6EA 2KIFA 4Z2YA 1FBUA 3KEOA 1K78B 1S8NA 2X0LA 1CF7B 3F3XA 3HTUA 2MLGA 1YIOA 4P9FA 3R60A 2B0LA 4RB2C 1GVJA 1R7JA 4LB6B 2HZTA 3HRUA 2OZ6A 4XSZF 2DO7A 4I0BA 1LDDA 2HR3A 4MEYF 4I01A 3JW4A 4EJUA 2FSWA 4L9NA 1IXRC 2NNNA 5HLGA 4XBFA 3K1NA 1I1SA 4O5VA 2JRTA 4XLNF 5FO5A 5BS6A 1T2KA 2FF4A 5F6FA 1QZYA 4KMUX 1FOKA 1JXSA 3CUQB 2YR2A 5L3EA 4UVCA 3J80K 2NYXA 3QPHA 3ABUA 3J80Z 4MTDA 5DD8A 5K1YA 2Z3YA 1LDJA 4G8XA 3TO6A 3HRMA 1B6AA 4EVIA 1FSHA 2D2WA 4IVNA 1ON2A 2LKPA 3MFKA 2AS5F 1B4AA 4MQVA 2MH9A 4BYYA 1USTA 2DI3A 1TW3A 5F1RA 1FX7A 4KMFA 1GHCA 2DT5A 2IA1A 5D5WB 1YW7A 4Q47A 1KQ9A 2CO5A 1R5HA 3CUQC 2R7FA 1G3YA 1XSDA 3FM5A 4EV0A 3P9IA 1BC8C 1DDNA 2IA2A 3IKTA 5CJ9A 1XD7A 1MJ9A 2FNAA 4LD5A 1TW2A 1FYLA 3WU1B 4P55A 1ZG3A 1ZYRF 3FF5A 4CXFA 1TBXA 2K5IA 3BDDA 3K2ZA 2Z99A 4HZFA 4L9VA 1WI9A 4CICA 3R4KA 4M74A 3HHGA 1H0MA 1UFMA 1O3SA 2XAFA 4ESJA 4RB1A 5D5UB 2IA0A 2DU9A 2QBYA 4P96A 3E19A 2EJRA 3QAHA 1ZGJA 1ZRFA 2K4YA 2VODA 2YSRA 4G6DA 2H3JA 1FYMA 3V8LA 3KP7A 4IRGA 3T1BA 2RC4A 5L3FA 1SD5A 1XGMA 3SHFA 2M1BA 1OKRA 1C0WA 2ZMEA 2ZXJA 3SZPA 2HYGD 2RKHA 2HTJA 2L54A 4UUVA 3I5UA 4BNCA 1YYVA 1NHAA 4FX4A 3T0YA 2O03A 4BH9A 1ON1A 4DNCA 3DXJF 1LDKB 1Z05A 3KP2A 1H9GA 3LAPA 1BJAA 3TDUC 3WTSC 4EM0B 1IXSB 2M30A 3V8JA 1FT9A 3CUQA 5HS9A 1ZHFA 1I1GA 1P4WA 1XB4A 3HOSA 2DQLA 1GXPA 4OU0A 4JK1X 4WWCA 3DFGA 5LGNA 3BWGA 1IN7A 1BC7C 4UVBA 2OQRA 2CWEA 2JPBA 5DV5A 2G7UA 4CYDA 1PUEE 2CFXA 4BQAA 4L9TA 3W6KB 3OOPA 4AIJA 1IN6A 1DPRA 1EV7A 1W4MA 2HQRA 3RPUA 1IW7F 3ZMZA 3WGHA 4P9UA 1FSEA 3MCZA 4HLYA 4M72A 3TO9A 1Z6TA 2CW0F 1FNNA 1HW5A 3HTSB 5JFRA 1LNWA 2LDUA 5HDKA 4UXNA 5BOXA 3MZHA 3REOA 2K27A 1TNTA 1D8KA 3M9AA 4BAYA 3MWMA 2IT0A 5CVUA 2K5LA 4O6JA 3CO6C 4QWQA 5ED4A 1TNSA 4B8XA 3NRVA 3GEZA 2EV0A 2C6YA 2QZ8A 2NS0A 4EGYA 3ZN1A 2K86A 1CF7A 1XDSA 2BBYA 3KP4A 5LEJA 4OMZA 3CO7C 1ZH5A 1HBXG 4R8HA 3RI4A 1SFXA 4M9ZA 2QQAA 3C7JA 4YIFA 1D3YA 3FX3A 2XIGA 3HHHA 3KLOA 1JE8A 2HFHA 4MGRA 5F64A 3QU3A 2O61A 3RYRA 2V1UA 2EV6A 3GUDA 4I02A 2PFBA 3R6SA 4ZYDA 2R7DA 2VBZA 3HRTA 3GVAA 2ZFWA 4RGRA 2VBWA 5L3DA 2X4HA 1OYWA 2HOEA 5LBQA 3L7WA 1P92A 2MC3A 3F23A 2OQGA 1WKMA 2EB7A 2LF8A 1D8JA 1KYZA 2K4JA 3R0JA 2V9VA 4YG2F 1KU9A 4Y15A 2E1CA 1Y0UA 2XGXA 2EK5A 3TOAA 1PDNC 1DP7P 1X3UA 2H09A 2WV0A 3F8NA 2E7WA 3CDHA 3WGIA 2F5FA 5FFXA 4XSXF 1LQ1A 2JZYA 3NQOA 2QVOA 4ESBA 1ZAOA 3L09A 1I5ZA 3HSEA 1MDMB 2LX9A 5AIQA 5ILSA 2W84A 1SD7A 2VE8A 3B73A 2ZMEB 2DPUA 2Z33A 1SD6A 4GXOA 4L5JA 4RB3C 3L00A 1HKQA 1HKSA 3KCCA 5KVRA 2M87A 4UHTA 1ZGAA 4A0XA 4OIOF 5L3GA 2FU4A 1FWZA 5FLXZ 3QRFF 5BMZA 4JQFA 4LJZF 5FD6A 1FPQA 2HEOA 2A69F 2A5YB 1I6XA 2RGVA 5HS7A 1G6NA 2O0YA 4PGHA 2G9WA 5DEQA 4YIIA 1W7PD 2FBKA 1XSVA 3J7AO 1BI2A 2L4AA 4AIKA 2F5EA 1W5TA 4MNUA 2IP2A 4BHBA 3P7NA 2NRAC 1BIBA 3BPXA 1U3EM 2P7CB 2P5VA 3B02A 4G7ZF 4U88A 2RDPA 2XAJA 1VTNC 1BIAA 1KU2A 3MAJA 2WWYA 4EM2A 3FXUA 1K6OA 3BJOA 4YFKF 3K69A 1HW1A 3C1DA 4A0ZA 3VFZA 2DPDA 3I54A 2BGCA 3F8FA 1J2XA 5DD4A 1BI1A 1XGOA 1BBYA 3IRRA 2XV4S 3F6VA 3R0AA 2RN7A 4HX4A 3BPVA 3TDZC 4HV5A 2UWMA 5HLHA 5HVQC 3QOPA 2D1VA 3I71A 1W5SA 3QU6A 3ZMSA 1YS7A 3F22A 3DPTA 3E6MA 4ENNA 1J75A 5E8GA 5HOOA 3ULQB 1B59A 4M73A 2M5WA 3TQNA 5E8IA 1B1BA 2XAQA 4HW0A 2KIMA 3KLNA 2P5LC 1IN8A 2Q0OA 4LK0F 2VT2A 1FBSA 2GAUA 2K4BA 3SFZA 4HDUA 1G3WA 2ZNZA 5K5RA 1P2FA 3DQVC 1PP8F 4E70A 2DW4A 2CG4A 3ELKA 1IN4A 3LFKA 2IVMA 4U0WA 3O2PE 2PI0A 4Q4ZF 2RV8A 3L9FA 5AIPA 2P7VB 3T5XA 1ZG1A 4FT8A 2DQRA 3O6BB 4KN4X 4AD9A 3DKWA 2K5FA 4LFUA 4P5OA 4WCGA 4L0YB 4ENMA 4O3MA 2KJCA 2CQKA 1MJBA 5K5QA 3QPTA 3HSRA 3I58A 2W25A 2FOKA 3P9KA 5LEKA 5DCMB 2H27A 4ESFA 1ZG5A 1ZREA 1UCRA 4ZZDA 3ECHA 2VE9A 3BJ6A 2FRHA 2P6TA 3TKYA 4ZYHA 2ACJA 1ZLJA 5A2QK 4KIFA 4MEXF 1ONVA 1RUNA 3AAFA 1RZ4A 2RVCA 3JAMZ 2EFNA 2G7HA 2RNJA 4I0AA 1R36A 3HYIA 3LA3A 5H6RA 1R1UA 4HOBA 2QUFA 3BP8A 4ZZLA 4KA4A 2QM3A 1TQPA 2YX7A 5LRSA 2EFWA 5D8LB 2D45A 1ZRCA 2Y75A 1P4AA 1HQCA 2KRFA 5TJJA 1XDUA 3CUOA 3LA2A 3GW2A 5E1XA 3WE2A 5HLIA 1K79A 5BQTA 1F9NA 2DAOA 3SXYA 1SD4A 3E6CC 3M8EA 2OA4A 3PQKA 1QBJA 1QO0D 2FEZA 2PG4A 2NNYA 1ZRDA 1RIOH 4RGUA 2VBYA 3TOBA 1IF1A 1K7AA 3C18A 3F21A 2J5OA 1J5YA 3JSPA 3IL2A 3CTAA 3FWEA 3IKVA 4PCQA 2VC1A 1LJ9A 5FGMA 3D5LA 2UXXA 5CVVA 1HXDA 4EJTA 2QLZA 1LVAA 2HQNA 3FHZA 2ZCWA 3LQRA 4R79A 1O3RA 4PZJA 1O57A 3KZZA 3RTRA 3DP7A 4EMSA 2FQ3A 2HKXA 4OINF 4OIQF 2XUBA 3EETA 1IRGA 2MLKA 4QLCU 1K78A 5LHGA 5LRRA 3GX4X 1QQIA 2EA2A 2Y0MA 3ZPLA 2A07F 2HWVA 2XAHA 5D5VB 3WGGA 1Z1DA 3I59B 2EFOA 1T0FA 2YX4A 2M8EA 3FXRA 1OYYA 3GFIA 4KUMA 4S04A 4IJAA 4KT5C 1U8RA 4ENJA 3M1EA 4YFNF 1U5TB 1GXQA 1J9IA 2D1HA 3K0LA 5K5OA 3WTWC 3SZTA 3IRQA 3F6OA 3LSTA 5AONA 3QP5A 3F8CA 3E6BA 1XCVA 4KICA 3JAMK 3WTTC 1FBQA 4IXAA 5DCMA 2P5KA 3WTUC 3GZ5A 5L3BA 4G7OF 3KETA 1U5TA 4BHCA 3I4PA 5LGTA 2ZO4A 4LLGF 3KZYA 4EM1A 4CDGA 5LLQA 3RDIA 1Z6RA 4HX8A 1SMYF 3MHXA 2DTRA 4KNYA 3BZ6A 4MHGA 2E1NA 5HDGA 3EYIA 3U9GA 3K1PA 4LMYA 1KU3A 3V8KA 4RB0A 4GO1A 4LG0A 5E18F 2ZBKA 5LGUA 5ICCA 2OAZA 4IRIA 2E7XA 4OIPF 4A5NA 1R23A 1LEAA 1SFEA 3EYYA 2VBXA 5FFZA 4A5MA 1V4RA 3H3UA 2A3SA 3BOQA 1E17A 1XN7A 2STTA 1QZZA 3WU0A 5JI6A 1HKTA 2GZWA 1HSJA 1XGSA 4EGZA 4U0VA 3VODA 1WRJA 5CVJA 1R1TA 1SAXA 1UB9A 2L3DA 1L0OC 2MBFA 4HF0A 4EJVA 1PP7U 6PAXA 2P4WA 2GXBA 3M8FA 4U7BA 3GO5A 2RQPA 3COAC 2XAGA 3U1DA 1F4KA 2LNBA 3LWFA 3TGNA 3E6DA 4WX9A 1Z7UA 4IF4A 1U2WA 2O8XA 2MD5A 2PMUA 2P6SA 1IUYA 2F5DA 3GFMA 3BROA 2JSCA 1YFHA 4UV8A 2XROA 2DK8A 3M7GA 3SQNA 3LAJA 4LLLA 1BOAA 3PQJA 4A2UA 2ZJ2A 2EFPA 3L2CA 4I7HA 3O3KA 4HX7A 5DDGA 4WXHA 4OIRF 1LB2A 1F5TA 5FLXK 2FNPA 4A6DA 4WF2A 3RYPA 1ODDA 3ZMTA 2CSOA 4MQ9F 2GA2A 4U7DA 3Q9SA 3DEUA 5TRDA 1OPCA 3G3ZA 1YO5C 4A12A 2QBYB 4RS8A 2ESHA 1ZLKA 4ZH4F 2XVCA 4G9YA 3EQLF 2QWWA 2L4MA 5EEHA 1L3LA 3BY6A 3CJNA 5DUIA 1FZPB 3F72A 1XMAA 1FC3A 2O3FA 2V79A 4OOIA 4ZYEA 1TLHB 1LEBA 3ROUA 5ERIA 1QPMA 3V7SA 1DPUA 5CVRA 2UXNA 2P8TA 4BXUA 4LGWA 2STWA 1MGTA 1R1VA 2A68F 1TQMA 2EV5A 3Q9VA 4KIGA 1P4XA 5ILUA 2PQ8A 3ML6A 1REPC 2BV6A 3DF8A 5IT3A 3ZP5A 1XCBA 3EUHA 4WXDA 3LA7A 2CGPA 2ADUA 4H0EA 4GYGA 1W7PA 2VONA 1D5VA 1HSTA 4L5IA 2HTSA 3HSFA 2L02A 1U5TC 2PEXA 5JHUA 2LF7A 3WG9A 2XRNA 1B9NA 5E20A 4EQQA 2GCXA 1F1ZA 3ABTA 2CYYA 1E2XA 1YG2A 1USSA 1Q1HA 4HQMA 4CHUA 2Q2EA 4LB5A 3JTHA 3KP5A 1MJAA 3GXOA 3N4MA 5LHIA 4KYWA 4HLXA 4DQ2A 1MZBA 2GQQA 3VB2A 1S29A 1IZ1A 1EH8A 4TV7A 3RIRA 5ICGA 1FP1D 3IWZA 4IHSA 5A2QZ 3RKYA 2K7LA 3K9TA 4KIBA 3E97A 3ECOA 1AWCA 2ELHA 2EFQA 4HF1A 1R5GA 2IRFG 2DK5A 5JVTA 3DV8A 2H6BA 4RAZA 4AVPA 3V4GA 1YS6A 2VOPA 2EA4A 4GCVA 4AIHA 5EEGA 4G7HF 3TO7A 3N97A 3WODF 2XKOA 5ICFA 3GFJA 4KN7X 1QW1A 5KK1A 3D0SA 1XGNA 3ZMDA 4IPAA 3GWZA 2Z9OA 3F8BA 2A61A 1T39A 3ZMUA 1KYWA 4PGGA 1G3SA 4GYIA 1JGSA 1J59A 2O6GE 3H3ZA 3I64A 1Z91A 4U0YA 1KA8A 1OYIA 2W24A 4CZZA 2ESNA 3ZQ7A 5J6XA 2KIUA 3U2RA 2MH2A 1RI7A 1G3TA 4I2OA 2EWNA 4GGGA 4LK1F 5D6FA 3ISPA 4MTEA 4M6YA 3E3VA 2A6EF 1FYKA 2KJBA 1IN5A 3T8TA 2DLLA 1YW8A 3QP6A 2TDXA 4Y13A 3J81K 3GYHX 3NEUA 5H6QA 1O7LA 4N9IA 2HGCA 4K2EA 3C3WA 3OV8A 4ZYGA 2ISZA 3IWFA 1IXCA 1IAWA 1T6SA 3S2WA 5E17F 2VC0A 3V7CA 3P9CA 3G73A 1SFUA 4RGSA 1UHWA 2FBHA 3E5QA 1S7OA 2JPCA 4HBLA 2Y48A 3WTZA 1Z9CA 3WTVC 3FXQA 5LHHA 4UVAA 3H92A 3Q5FA 2V6CA 1OMIA 2Z5UA 2LSOA 1BN5A 1IRFA 2VN2A 3EDPA 3KE2A 5ICEA 3J81Z 5CLSA 4OMYA 3VEPA 3HUGA 4HV6A 1R58A 3KP6A 2K02A 5E1WA 4HYEA 2H6CA 2FA5A 4EJWA 3FMQA 4CO8A 3E5XA 5DYMA 3I53A 1WQ2A 4LLNA 4HDVA 3FMSA 1YQAA 2IPQX 5HDNA 1MD0A 4M71A 1EH6A 2FBIA 2FMYA 3GFLA 1YTYA 4XLPF 3T8RA 3RKWA 3RKXA 4ON0A 2PBIA 2GXGA 4LG0B 5IT9Z 3IHUA 3KFWX 4WXCA 3W6JB 5BPIA 2A6HF 2W57A 3WE3A 1R00A 4XRFA 3JTGA 2DBBA 2PMHA 2YPRA 4R1HA 1A04A 3MZYA 4CGZA 2QENA 1QNTA 4HAMA 4G94A 1WSUA 2FXAA 3MQ0A 2BYVE 5DCFA 5D4SA 4ASNA 4FX0A 4NB5A 2QYOA 3PFIA 3WTXC 2HS5A 2V1DA 2UZKA 4HF2A 2IJLA 2VT3A 5ILVA 2FE3A 2ZNYA 3I0TA 1U78A 4M9SA 1FP2A 1O7FA 2M45A 4NQWA 3F8MA 4WK8F 4Q5SF 2FMLA 4HA8A 1SMTA 3GZ6A 3WTYC 1G4DA 1S6LA 4JBAA 2BE5F 2J5PA 2COMA 2XASA 1ZN2A 5CYVA 4FHTA 1BI0A 2PLYA 2OU2A 2JT1A 2GWRA 1YW9A 4AWXB 1EH7A 3ZMVA 1FLIA 2WTEA 3HRSA 1S7AA 1T98A 2GIVA 4KDPA 5D5XB 2OZUA 2YU3A 2ISYA 5FD5A 2XHKA 2HYFA 1XMKA 4I09A 1WWXA 1KQ0A 2V1XA 3I59A 2IW5A 5H20A 4UNOA 4KFCA 1J7KA 3JSOA 4D0PA 1KGSA 2HKOA 4G6QA 5J8CA 2DFIA 3ERED 1H9TA 2NAZA 1QGPA 2W85A 4RGXA 5BPDA 1DUXC 3MEXA 2H94A 2KKOA 3K1MA 2OBPA 1TTYA 1KQ8A 4F7ZA 4L0ZB 3FMRA 1CGPA 2L01A 2JTVA 2VXZA 4A0YA 3GLXA 1JHHA 3FZVA 4UV9A 1HW2A 4HQEA 2QQBA 5IT9K 2GA1A 2PJPA 1V3FA 3E5UA 4IRHA 1BM9A 4IHTA 3RJPA 2F5CA 1RUOA 3DPLC 5FB2A 2AXLA 2R3SA 1XSXA 3KEQA 3ZN0A 1B9MA 1JHFA 1J0RA 4A6EA 3LQQA 5J8FA 4M6XA 3CLOA 4RAYA 4L18B 2XKPA
chains in the Genus database with same CATH superfamily
3FM3A 1R22A 4UUSA 5CK9A 1UHMA 2MA3A 5IY5H 2W82A 1VQ6I 4UB8C 1EF4A 4ETSA 4CYCA 5CQYA 4MDWA 1AOYA 4N9HA 5E1ZB 3HIFA 1OCOH 3VOEA 4KITB 4S05A 1BA5A 3M56A 1GV2A 1U6GA 4ZDLA 5EG0B 1T38A 1VQ4T 5CCAA 1I0CA 1VYUA 4M75B 3RQ4A 1BI3A 4M75A 4BQQA 3OYKA 5A2QE 4N0BA 1RNLA 4A4GA 2Q8KA 4EJOA 1ULYA 3R61A 4Y17A 3A02A 2R5YA 1VQ9I 4IOCF 2F4IA 4YFXF 1O3QA 4GRIA 2E1HA 1OISA 4BY7J 4QQ6A 5M9OA 4NHJA 5IXBA 5IAYA 3HM5A 1YLFA 1STZA 1PNJA 3BDLA 3BQZA 3RKQA 1SPKA 3OBYA 3WVEB 2Z9OA 2KR3A 5CO7A 4KISA 1P6RA 2QSFX 1MDMA 1QPIA 1QKWA 3KP3A 2DRMA 1KQSS 2A08A 2CP2A 3UWNA 5GAN2 1RPWA 2GXAA 1WJEA 5F27A 3ME9A 5E79C 3I55A 2FZCB 1W7PB 5LJ5d 3V7RA 3GTPJ 1UG1A 3G4ST 1UE9A 4RTVA 2RJCA 2W48A 1WJAA 5HS8A 5C3EJ 2DL5A 5DUKA 2AO9A 1VQMQ 2GFUA 1K0XA 2L7ZA 2WY8Q 4B09A 1O3TA 2EJGA 1BYMA 3CCLI 4BGDA 3FB9A 3QHSA 2EYWA 3TEDA 1OR7A 1S3JA 5D8KB 2YHTA 3GF2A 1I27A 1CKAA 1KQSA 1EKEA 4PSWA 3SFIA 1DU0A 1QVGP 3AFHA 2WC2A 4BHPA 2GNCA 2E70A 2PUOB 3RPQA 4XLFA 2PN6A 4Q48A 5GANe 4A4KA 3BJAA 2V8KA 2L3RA 4FM4B 2HCKA 2BEOA 4M9XA 3KPHA 4ENKA 4PDKA 1LE8B 4XAXB 4RTXA 2OD5A 4BEHA 2K9SA 2K9LA 4ZC3A 1YIJI 2ED1A 5KYXB 4L9JA 5GTIC 3HOTA 3IC7A 2VQGA 1AWOA 4Y92A 1FY7A 1MKMA 1GLNA 2NOJB 2OCCH 2YUSA 4I98B 2VOOA 2F2EA 3REAB 4LD6A 4M77F 2W4SA 1ZARA 3QOEA 1R6RA 5D4RA 3DLAA 2QQ9A 2HDCA 4LUEA 3HBLA 3PNTA 4ZDOA 4N4HA 4DYRA 4RTTA 4HNUA 2CP6A 2CT4A 1AEYA 5CVIA 2ETHA 1BB9A 4B44A 4ZGEB 5JR3A 4IEJA 2GOXB 2ZKZA 1XJWB 2WAQN 1I39A 1VQ7I 4OMNA 3MN2A 2X6WA 3GTOJ 1OOTA 1TQIA 4C0GA 1P7JA 1D1AA 2JUGA 1ZR4A 1QVPA 5CQXA 1KU7A 1RKWA 4JYKA 1Q81C 4RTZA 3OL3A 1TWBA 1VQPI 3SWNC 1Q82C 3ZQGA 5L3CA 3E2UA 4M77G 5D6EA 4IURA 2KIFA 3H0DA 3QXEB 1KC8R 1PKSA 3JV3A 4Y3OA 4CZCA 5KCHA 3BW1A 1JXMA 3HKZA 1TSFA 4Z2YA 3X26B 3PTAA 4C92E 1GBRA 4AMCA 1FBUA 5IP6A 1OU9A 3KEOA 3NTKA 3VYUB 1K78B 3TCJA 4CCNA 1S8NA 4FSSA 2X0LA 3HKZN 1CF7B 5TGTA 2KQWA 2V8IA 3RDVA 4A3KJ 5KYWB 3EGUA 2X6OA 3F3XA 1VQNQ 3HTUA 1HJDA 1QZEA 2MLGA 3IQLA 4JDSA 3MKLA 1YIOA 4XKVA 3MEUA 2LJ0A 4P9FA 2JS0A 2E19A 3R60A 4IO9F 3BR2A 2B0LA 4RB2C 1PSEA 1GVJA 4M78G 1K8AC 1R7JA 4LB6B 1V1CA 1QVUA 3PMTA 1K0SA 2HZTA 3HRUA 4AT1B 3LWHA 2OZ6A 4JOMA 1SVLA 4XSZF 4M78C 1A6IA 2DO7A 4I0BA 2A0FB 4UC4A 1LDDA 2HR3A 2ZSIB 2VUBA 4MEYF 3CMAA 1RC9A 2LP0A 2MW8A 3BG9A 1HCRA 3D1NI 1K9AA 1SVMA 4I01A 2ELKA 2ZXWH 1LPQA 2HU9A 2XB5A 3U1KA 4RUGA 2DYRH 3JW4A 4RA2A 1YWOA 3GNGA 4EJUA 2FSWA 2VGNA 4L9NA 3HFOA 1QVFP 3CXCS 1IXRC 1S5LC 2X98A 3K4MA 3VPRA 5KH6A 3AG4H 4XONA 4RCCA 3QDFA 3LL7A 5HK0A 3EGXB 2QDLA 2NNNA 4IL6C 5HLGA 1MHNA 2L8DA 3JCMP 4XBFA 1IC8A 3K1NA 1I1SA 1DGWY 3KFVA 3BG3A 1OULA 2P84A 3FXLA 4O5VA 5M5XJ 1F43A 2JRTA 4XLNF 5HLTA 2BVLA 5FO5A 5IXFA 4DZPA 2VPRA 1SF9A 1T08B 3RESA 4ELYC 4RM2A 1IRZA 1J09A 5BS6A 2E2IJ 1JBMA 4Z02A 1T2KA 2FF4A 2QTXA 4RMNA 3HOXJ 3JRHA 1NEBA 2F69A 4B48A 3CCSQ 3OYLA 1UHCA 1Z0XA 5F6FA 1QZYA 2JJ7A 1RR7A 1MUZA 2LCCA 4KMUX 4MMKA 1MH3A 4C2TA 2WBMA 4RTWA 1NBEB 3BDUA 3CQTA 1M1EB 1X4PA 1OX8A 1FOKA 1JXSA 3M53A 1ZR2A 3X2QH 1WJRA 3CUQB 2YR2A 5L3EA 2JTEA 3JAME 4UVCA 1GT0C 1FMWA 3CESA 1JKPC 4JZ4A 1VQ4Q 3J80K 2AQEA 4II1A 2NYXA 3CC2T 3QPHA 3DBHB 1IZ6A 3ABUA 3J80Z 4MTDA 2Y4YA 3PIPF 4C8QA 4BE0A 1FTZA 3CJRB 3K4LA 4FASD 1R49A 4XMYA 5DD8A 5F0CA 1OCRH 4V2FA 5K1YA 3I56I 1OQYA 2Z3YA 2CMPA 2V6EA 4AFSC 1LDJA 3JCMe 4G8XA 3TO6A 4IKFA 4V2SA 3HRMA 3VS4A 1B6AA 2JA2A 4EVIA 2D2WA 1FSHA 1IGQA 2JN0A 4IVNA 2EAYA 1B34B 4F16A 1ON2A 4CI0C 2LKPA 4PFPA 3MFKA 3G71I 1WJDA 3QIIA 2AS5F 1B4AA 4IQ4A 4MQVA 2MH9A 4BS9A 4KUDK 4BYYA 3D5SC 2AQFA 1USTA 2DI3A 2LQ8A 1UGPB 2QSGX 4C9YA 5DS9A 4B3XA 2XPUA 1TW3A 2BHYA 2CKKA 1A6QA 3EFOB 5F1RA 1FX7A 2B86A 3JCMf 2M9UA 2AHQA 1G59A 4KMFA 2DT5A 1GHCA 1NE8A 2ESWA 2NUPB 5IN1A 5KYNA 2IA1A 4M7DE 5D5WB 3OYGA 1NK2P 3VS0A 1K73R 1YW7A 1R0BG 2M7BA 3A8OB 1XNIA 1VQ4A 3M0SA 4Q47A 1IJWC 1YRNB 4X6AJ 1KQ9A 4C92D 4FETA 2DDBA 2CO5A 3K4KA 1R5HA 3CUQC 4LIUA 1KC8C 2R7FA 3CCSI 3M8JA 1G3YA 2X6XA 3BZKA 2HBPA 3A5ZB 2CJJA 1XSDA 4KT0E 3FM5A 1VQOQ 3QYFA 2RO0A 1OX9A 2HDDA 4EV0A 3P9IA 2F6CA 3V42A 1BC8C 1JU5C 2FO0A 1DDNA 4RG8A 2IA2A 2DZCA 3CCQA 3IH2A 4FISA 1YJ9Q 3IKTA 2RB6A 5CJ9A 5IP7J 2VKVA 2CYZB 2GF7A 4M7DA 3E1SA 1XD7A 2HPMA 4HVWA 4J9GA 3DBRB 3S16J 3CCUA 2QA4T 1XS9A 4ESRA 3I3LA 2FNAA 1MJ9A 3I55I 2BZYA 4LD5A 1TW2A 1WCMJ 1FYLA 3JB9I 3WU1B 1D3BA 3H0IA 1M90U 2J06A 1ZG3A 1ZYRF 4P55A 3OW2S 3FF5A 2Z16A 5C44J 3MPUB 4CXFA 2CS3A 1BBZA 1VQ5T 2GIZA 3W2AA 4AU7A 4IUQA 3QWLA 1ZQ3P 1XQHA 3I56A 4A3JJ 3DTEA 2R5ZB 4BKXA 1TBXA 1Y6IA 2K5IA 4CC4B 1MBHA 2KAFA 3VYSB 1KQ2A 2IXSA 4XOPA 2IS4A 1AWJA 3BDDA 1D09B 2F2XA 3NTIA 4HKEA 4HXJA 1B72B 2RNAA 4XIDA 2VKEA 3K2ZA 3QPSA 2Z99A 2KT8A 4Z8AA 4C0ZA 5M3FJ 1AKHA 1JUSA 3CP2A 2OV7A 5GMKe 4PJMA 5FWCA 4HZFA 2EIMH 1WI9A 4L9VA 4CICA 2RMOA 4DOWA 3QYGB 3AG3H 3RZDJ 2FHDA 4IIOA 4J9FA 1M3AA 3R4KA 4M74A 3HL2A 3HHGA 3K2AA 5FU6B 3X24B 3E9FA 1UFMA 1H0MA 3G6EA 1O3SA 1FMKA 1KJWA 3CCLA 2XAFA 4ESJA 4RB1A 2X9DA 2IA0A 5D5UB 2DU9A 2QBYA 4P96A 3KYLA 3K70C 3E19A 3EUHC 2FB7A 5C4JJ 1K4TA 1OEBA 1S72Q 2N8GA 5GAN5 5KYWA 2IBDA 2EJRA 3QAHA 2K3PA 1TWCJ 2CS7A 2CV2A 1VQ8Q 1G5VA 1Y39A 4A69C 4BD3A 2CGHA 1VUBA 2O4XB 2DPPB 1TP4A 1ZGJA 1ZRFA 3MP6A 5GAOn 2ZZDA 2K4YA 4LITA 1PM3A 2YS9A 4FCYA 1VQLI 2YSRA 1TWHJ 4G6DA 3CC4I 2VODA 2OTJI 1VQPA 4QVCA 4NDLA 2MOXA 3LSGA 1F1BB 1GFCA 2H3JA 3CCVT 4ZNXA 2B7EA 4YELA 5K7HA 1B3QA 1FYMA 2VQLA 2XF5A 3V8LA 2E5QA 3KP7A 4IRGA 4W97A 2P4RA 5IHKA 1YJNT 3T1BA 2RC4A 5L3FA 3OS1A 4IHVA 4RG2A 3I55Q 5FU7C 3SWNB 4XKWA 4BY6C 1YITI 2FQ4A 5M5YJ 2EQMA 2DMPA 3LX7A 4F52A 1AZGB 2RK1A 4LXCA 1VQ8I 1SD5A 2M34A 3GBQA 3M59A 1XGMA 3SHFA 3CJTB 2M1BA 5HODA 5LJ3j 3CCRT 1OKRA 2A6TA 1ZHIA 1C0WA 4DW6A 4M7AF 2YRVA 2ZMEA 4BU2A 4PJOF 2YWWA 4NL3A 2ZXJA 3SZPA 1D0ZA 2WSEE 2HYGD 4E7IA 4B6MA 3TU4K 2RKHA 2QKMB 4E6KG 3VYGA 2LQWA 2HTJA 1U9NA 5DM7R 3OSFA 2L54A 4UUVA 2R7SA 2M51A 2R57A 4CH7A 3I5UA 4BNCA 1G2BA 3PNWC 1YYVA 2F5KA 3WVDB 1YJWT 1NHAA 3RERA 3HG9A 2DYIA 4FX4A 5J3BA 4AFZC 3EPZA 1M8VA 2DE0X 1QP3A 4F04B 3T0YA 2O03A 3META 4BH9A 3G4SQ 1ON1A 4XM3A 1ZA1B 1X58A 5GAN3 1VQKT 4DNCA 4PJOG 5J39A 1PSFA 3H9QA 3DXJF 2LTOA 4M7DC 1LDKB 1JGGA 1Z05A 1WJCA 3KP2A 2B63J 1H9GA 1NPPA 5CIUA 3LAPA 1NJIU 1NJIR 1BJAA 3TDUC 2XF7A 3WTSC 1QVGS 3GTGJ 4J83A 2DA6A 3H9JA 2E64A 1OPLA 4EM0B 4C0DB 1IXSB 2QA4A 2M30A 3V8JA 1Y1WJ 2FOWA 2WACA 3QZ5B 1LVKA 4LD9K 2PQWA 3CCET 1FT9A 3CUQA 5HS9A 1ZHFA 2VKNA 1POGA 2BZXA 3VS7A 1I1GA 1Q82R 1UDLA 1X2MA 3QG1A 2JRMA 1P4WA 1MSEC 2AHJB 3LSPA 3LGLA 1K8AU 4PNOA 2BW3B 5FKLA 3ZQIA 3CMAT 5EG0A 1XB4A 2M7AA 4RMOA 1Q7YR 2HSPA 3HOSA 2JTMA 3HZJA 2HYJA 1V76A 3GTKJ 3R6OA 1IB8A 2DQLA 1GXPA 4OU0A 1Y57A 3QKJA 2KEAA 2PVGB 5CKFA 3VYTB 4JK1X 3JCMc 2VYTA 2L5QA 1QA6A 1WZ2A 2DMUA 2CZ6B 3M0QA 5HCKA 2EYXA 1IHVA 4WWCA 1CSKA 4LDXA 3DFGA 5LGNA 1PRLC 3BWGA 1IN7A 2E1MB 3EFOA 2K2VA 1BC7C 2MFZA 4UVBA 2OQRA 1MMAA 3VDXA 3SJMA 2HBWA 2CWEA 3HKSA 2BZTA 3OS5A 2JPBA 4B47A 1OCPA 5DV5A 2G7UA 2L7KA 3IAM2 4EEFG 2RI2A 3I35A 1QLYA 2CH4A 3K7AJ 4KJZA 4MO7A 2I10A 4CYDA 4XOTA 2CFXA 1PUEE 1OPKA 4BQAA 3PIOA 1SKUB 1OU8A 4L9TA 3W6KB 3DWLE 3OOPA 1RAEB 1IN6A 4AIJA 2I0NA 1DPRA 2XPVA 1WI3A 4M78B 1LUJB 1EV7A 4B43A 1W5CC 2XK0A 3BTJA 3QUIA 3ZFJA 1W4MA 2HQRA 4DZJA 1RETA 3RPUA 4XTYA 2P81A 1Q86C 4N4IA 2E5NA 2LG4A 2AZVA 2RJDA 4CC2A 1IW7F 3ZMZA 2LRQA 2DFUA 3PNVA 3WGHA 2XIDA 4P9UA 1FSEA 1VNDA 3MCZA 1PUFA 4PSXA 2CUEA 1UEBA 4HLYA 4M72A 2TRTA 3TO9A 3S1QJ 1M8MA 2COWA 4CC7A 1Z6TA 5JVGF 1LFPA 2CW0F 2BIVA 1FNNA 1HW5A 5LJ5j 1N27A 1LNWA 2F5VA 2LDUA 5HDKA 5JFRA 4BDZA 2FUG2 3HTSB 3J80R 4LDWA 5GANj 4UXNA 2KMUA 5BOXA 3VWBA 4I76A 5E3LA 3MZHA 1X1CA 2ZMEC 1F36A 3REOA 3OYNA 4A3MJ 3QYEA 5GMKm 2L89A 4A54A 2K27A 4F14A 1WHMA 1TNTA 2DJIA 1D8KA 2ID3A 3VUBA 1YIJQ 4QKUA 2A05A 3M9AA 5EEAA 2IS1A 1VA7A 4BAYA 2MWOA 2FYKA 4C8QG 5J1RA 3CCSA 2RNGA 3MWMA 4C30A 5CVUA 2IT0A 3A52A 2K5LA 5I11A 2HXIA 1AKHB 1WQWA 4O6JA 3CO6C 2LC2A 2QF7A 2XMFA 4QWQA 2QCOA 4DBFA 3CXCA 1K9MU 2DT6A 5ED4A 1U06A 2ZXIA 3CCVQ 4OMQA 2CUZA 2HAXA 2GBYA 1G83A 2EKHA 2Y90A 1TNSA 4M78D 4B8XA 2QQSA 2DMNA 3GBGA 3UPUA 1AWWA 2NXNB 3NRVA 3GEZA 5IYDJ 2COYA 3CMEI 4C8QF 3BR5A 1NK3P 3PIPA 2EV0A 4MFDA 2C6YA 4LOCA 3TQ7P 2X4XA 4M78E 2QZ8A 2XSJC 1I3QJ 3CPWS 2NS0A 1YI2Q 3ESWB 5DY9A 5CAIA 2RQTA 4EGYA 3ZN1A 2GFAA 5F0FA 2K86A 3HGGA 4BBRJ 2M0OA 4M7AB 4BI3A 1CF7A 1EZZB 1VQPT 1NTCA 3Q0UA 2X4WA 3WU2C 1JJ2P 1XDSA 2V7FA 2M0CA 4RM3A 2BBYA 3KP4A 5LEJA 4XQ3A 4OMZA 3CO7C 1ZH5A 3NAUA 4B4CA 3S3NA 1HBXG 3PNYA 3VSKA 2R7VA 2BTTA 3JCMb 4RTUA 4R8HA 3ASNH 5F08A 4XLAA 5EGOA 3RI4A 2E3IA 2MABA 1M1KC 1K73C 2L9RA 3CCUT 1SFXA 4F92B 4M9ZA 2XD0A 4C92A 2QQAA 1VFCA 2H8RA 1MBEA 2COZA 3C7JA 4C0DC 1SSHA 2CUBA 4YIFA 4XTZA 4EMKA 4HNVA 1VQKI 1R8OB 1D3YA 5IPAA 3JCMd 3FX3A 4KRTA 4J9HA 1HD3A 4XLHA 2CREA 2FX0A 2F5TX 2XIGA 3TL4X 3HHHA 3KLOA 1JE8A 1YRNA 2HL5C 4A4FA 2HFHA 1YI2T 3CC2Q 1OJLA 4I6ZA 1HDDC 4MGRA 5F64A 3A8LB 2JXBA 3QU3A 1PVEA 2O61A 4JX5A 5FKOA 4Z6YA 2NUZA 3TVTA 5LJ5e 3CCMA 1TUGB 4M3BA 3RYRA 2V1UA 2EV6A 2E5KA 2K7AA 4XORA 5EF6A 5GJWB 3GUDA 4I02A 1AOJA 1I1JA 1YI2I 2PFBA 3R6SA 4DBHA 4ZYDA 1Q95G 1ZSZB 2R7DA 2CP3A 1N78A 1ERDA 2VBZA 3HRTA 5CKHA 3GVAA 2IGKA 3H9NA 2ZFWA 3UKGA 4LNPA 3A8MB 5I2MA 4CA0A 4JRPA 4RGRA 3BZCA 2GLOA 2DILA 2X9HA 2WA0A 3SDBA 1B34A 2DT7B 2MD0A 2VBWA 2OI3A 2F2WA 2FRWA 1K83J 2W10A 5L3DA 1W0TA 3GLLA 1QQJA 1NYGA 2IIMA 4HSRA 2X4HA 2HQAA 4PL6A 1OYWA 3CCEQ 2HOEA 5LBQA 3L7WA 2WSFE 1P92A 2OPTA 2D9TA 3JRZA 1IXDA 2MC3A 2OTLI 3F23A 2X35A 4D7MA 3N05A 2OQGA 1WKMA 2EB7A 2LF8A 2QQRA 1D8JA 4M75G 1M90R 1KYZA 2K4JA 3R0JA 3BR1A 2V9VA 4YG2F 2HQ5A 5EC7A 1LE8A 4KT6A 3EH1A 4N0AA 5IH2A 4M78F 1RABB 1KU9A 4Y15A 3VU3C 2E1CA 5F1JA 3H3VK 2XGEA 1Y0UA 1VQ6A 5GAOm 2XGXA 2EK5A 3TOAA 1PDNC 2FRYA 2NYSA 2JQ7A 2ZPEB 3EUAA 2FPFA 1DP7P 2Z2SB 1X3UA 2H8HA 2H09A 2WV0A 3F8NA 5J40A 3CPFA 1K6YA 2RAEA 2E7WA 2DMTA 1VZ0A 3CDHA 3WGIA 4J00A 2CP7A 2J6KA 2EIFA 3OS0A 4OB1B 3S1NJ 1WXBA 1O75A 3JB9G 2MSYA 2EVRA 2BHZA 2F5FA 1Y56A 4X1EA 3SEQA 5FFXA 5IOYA 4D7NA 2CUDA 3PVLA 1WPKA 4XSXF 3CD6T 3OYYA 1LQ1A 2JZYA 2LD5A 2DM1A 5FU6C 3G7ZA 3NQOA 1GCPA 2QVOA 2DXUA 2J05A 3SHWA 4ESBA 1ZAOA 5FRMA 4JPBW 1TZLA 4YIRX 3L09A 2BY0A 1OQKA 4FYYB 1I5ZA 4RCBA 3HSEA 1MDMB 2LX9A 5AIQA 4L5GA 5ILSA 4H4KC 1VQKA 2W84A 4CSWA 1SD7A 2LR8A 3VS2A 1YHQT 2VE8A 3H36A 1SG5A 3B73A 2ZMEB 3CMEA 1NH3A 2DPUA 1YJNA 2Z33A 1SD6A 2DXCA 2FVUA 4GXOA 4L5JA 1ITYA 5B66C 4RB3C 3L00A 3ASKA 1X6OA 3ZEHA 4N4NB 5GJVB 3CCMI 2NVQJ 1HKQA 2RF0A 5LL6S 1HKSA 2EQUA 1J3TA 3KCCA 3FK6A 5KVRA 5KE3A 4E7JA 2M87A 5EG2A 4UHTA 1ZGAA 2DTZA 2VASA 1ZSZA 4LIVA 4A0XA 1UGQB 1YJ9T 1PJRA 3S2HJ 2TCTA 4AYBN 4OIOF 5GAGJ 3ZQQA 5L3GA 3CCST 1T8IA 2FU4A 4BJ6C 3OYMA 3HOVJ 1W6XA 4CRIA 2MGQA 2KDZA 4ZTFA 1JKOC 1GCQC 1FWZA 2DK3A 2ZC2A 2XI9A 5FLXZ 2QI2A 4GLMA 3QRFF 4B9XA 4ELZC 1YJWA 5GPCA 5BMZA 3H6ZA 2CUJA 4JQFA 4LJZF 5FD6A 2X1EA 1KONA 1FPQA 4II3A 2A69F 2HEOA 1U3OA 2OUMA 2A5YB 1I6XA 2RGVA 5HS7A 1G6NA 5C4XJ 2O0YA 2OF7A 4PGHA 4BACA 4E6RA 2G9WA 1ORKA 1ZBJA 3RSNA 3J81E 5DEQA 4YIIA 3LWIA 3BG5A 5J1UA 2IEKA 1W7PD 2LCLA 2FBKA 1ETKA 3DLMA 3C12A 3LLRA 1XX5A 1XSVA 1H8AC 3J7AO 3SWNA 3J7AF 1X2KA 4JLGA 1BI2A 2L4AA 2F5EA 4MNUA 1W5TA 4NC7A 2IP2A 4AIKA 3S14J 3A1PA 3EHRA 4JRIA 4F17A 2WAFA 4BHBA 4QT7A 2K9QA 3P7NA 3CC7T 1KQ1A 2NRAC 4XQFA 4JJDA 1U0JA 1BIBA 2KYBA 4PLIA 3BPXA 2O9LA 2VPLA 1WXUA 2VWFA 5KYXA 1Q86U 1U3EM 3OR2C 2P7CB 2P5VA 3B02A 1AWXA 4G7ZF 4U88A 2O4XA 3FRNA 3SB2A 1QHGA 1IHWA 1WA7A 4DOZA 2RDPA 2DFHA 2XAJA 1VTNC 2CH0A 4II2A 1BIAA 1KU2A 5EYRA 5LFAA 2JJ9A 2YLBA 3MAJA 2WWYA 4EM2A 3FXUA 1K6OA 5E3MA 2M3AA 3BJOA 2M4KA 1N5ZA 1PC0A 1HF0A 3ABLH 2NVUB 1BR1A 4YFKF 2NWMA 3O8HA 3AHUA 4UY8I 3HOZJ 1RL2A 3K69A 3TSZA 2JMCA 1HW1A 2MK5A 3C1DA 4A0ZA 1NEGA 2BY2A 3VFZA 4ZJZA 2KISA 1QCNA 3CF5F 2DPDA 2P0TA 3W2WA 2KIQA 4BY1J 1U5SA 3ERMA 3I54A 4ZYAA 3MKZA 2JOYA 3FLGA 2BGCA 3HUGB 1KHIA 4EMGA 2V8JA 3DTKA 3CBPA 4N0AC 2VGMA 3F8FA 3RUXA 2MWPA 4X34A 2V1RA 2V4JC 1VQ7A 1SSFA 1J2XA 5DD4A 1RRJA 1R4MB 4OVAA 1BI1A 1TXQA 2VC8A 1ZGWA 2RQVA 3BCAA 1XC5A 2DAQA 2ICWG 1MW7A 1GDTA 1C1AA 1XGOA 1VYVA 5GMKj 1BBYA 3IRRA 2XV4S 5K7ZA 2RQWA 3F6VA 2L3PA 3ER0A 3R0AA 2RN7A 2VKHA 3BPVA 4HX4A 3SYTA 3CMMA 1ZUYA 3TDZC 4HV5A 1FIAA 2ZGWA 3CDIA 2I5UA 2UWMA 4Y7NJ 3OYJA 4FL6A 2JUCA 5HLHA 1G2HA 5HVQC 2EQJA 3X20B 3QOPA 2D1VA 3CD6I 1QKXA 3I71A 2XG8D 1A35A 4L59A 1W5SA 3QU6A 3GTMJ 2CH4W 3ZMSA 2RHUA 5GAEJ 3TREA 1YS7A 3F22A 3S17J 2FZKB 3DPTA 3E6MA 2YUNA 2K9GA 2DODA 3UA7A 1U1SA 2DL3A 2WB1N 2COBA 3PO2J 1HC8A 7AT1B 2VVKA 4ENNA 1J75A 4ITVA 1HYOA 5E8GA 5HOOA 3ULQB 1N75A 1BKBA 3CBMA 1B59A 1ETYA 4M73A 3F9KA 1T3SA 2E2JJ 3Q0WA 2ECCA 2M5WA 3TQNA 5E8IA 1B1BA 2BKDN 2E35A 4XN0A 1FJLA 1S1NA 3GP8A 2XAQA 4HW0A 4JJCA 2E12A 1D1CA 3M9QA 2HI3A 3OMYA 2KIMA 1JKRC 1W70A 1Y96B 3P8DA 3KLNA 2P5LC 1YP5A 1IN8A 2LY1A 2P0PA 4CC3A 2DDAA 2Q0OA 3AG1H 5IP9J 2XDDA 4LK0F 5LJ5g 3JRAA 2VT2A 1JRIA 1FBSA 2R7QA 2GAUA 4Y28E 1Z3YA 5LJ3f 2K4BA 1UJYA 3SFZA 2XKOC 4HDUA 3DEEA 5FKMA 2XSDC 1QHHD 2YRDA 5CKDA 2KRHA 4IUPA 4FYXB 1G3WA 2WY7Q 4OAZA 4J19A 2ZNZA 2X3XD 4EDUA 1SVOA 3TSWA 4M7AG 6AT1B 5K5RA 1R77A 2J6FA 4AIDA 1P2FA 3DQVC 1YHQA 3C94A 5EZHA 5EGOB 1PP8F 3M0UA 2K5CA 4E70A 5J4VA 3A2KA 2JM9A 3SEZA 2DTIA 2EGAA 1H88C 5AYFA 2DW4A 4PFOA 2CG4A 2DFEA 3OOUA 1E0EA 2NUTA 3UA6A 5LJ3e 3I55T 3K4BA 2NS8A 3ELKA 2JVVA 2RQUA 3JRCA 1IN4A 2UUZA 1GUUA 3H1CA 3LFKA 2V1NA 2PX9A 4IUVA 1JTXA 2IVMA 2J7IA 4BJTA 4G12A 4U0WA 2GTOA 2J6OA 3O8VA 5AT1B 1RAFB 3JREA 1WVRA 2LBFA 2CP0A 3O2PE 5F0HA 2PI0A 4Q4ZF 2RV8A 3L9FA 5AIPA 2P7VB 1YI2A 3T5XA 1ZG1A 1JJ2S 2DMQA 2MCNA 4FT8A 2DQRA 3O6BB 1HLVA 3OSGA 4KN4X 4AD9A 2DZ9A 2V1QA 3DKWA 3J7AY 2K3YA 3ZOBA 1I5OB 1XOVA 4CUGA 3KIOA 5M5WJ 2K5FA 2SRCA 1IREB 2Y31A 4BQNA 4LFUA 4MIMA 2EKOA 4P5OA 5GADJ 4YEJA 4D5CA 5E3OA 3HXLA 1JO8A 2F2VA 2EZLA 4WCGA 4L0YB 3KUFA 3L42A 3OS2A 2GQIA 1E6HA 4ENMA 3G6EQ 1VQ8T 4MDXA 2LK2A 2LMJA 2E71A 4FIBA 4M7AC 1FIPA 4O3MA 3OB9A 2KJCA 4M3EA 3JRIA 2CQKA 2K9NA 4XTXA 2CZ7B 2EGCA 2QDYB 4XU0A 3AG2H 3FKJA 3PM1A 1MJBA 2PZ1A 2DL7A 5K5QA 3J7AW 2DA4A 3QPTA 2VI6A 4OMPA 5FJ8J 4QTRA 2KQRA 2JMAA 3HSRA 4PUSA 5KCMA 4N4GA 2IG0A 1NLOC 3FBNB 3CC4T 1ZK8A 1UMQA 3I58A 2W25A 5FKNA 3H35A 2FOKA 3P9KA 5LEKA 2DIGA 5DCMB 3HL8A 4E2FB 5FU7B 5GAOp 2H27A 5DTDA 4EMKB 2D0NA 3CMAQ 1VI0A 4XKBA 1OCCH 1ZTRA 4ESFA 1ZG5A 3HOYJ 1ZREA 4EPCA 3I56T 1UCRA 1VQ9T 3M57A 3LSJA 1VQOT 3JCUC 4ZZDA 3ECHA 2JWTA 2VE9A 2LX7A 3M55A 5GAOr 4M7DF 1R9TJ 3CMET 1VQ4I 3BJ6A 2FRHA 4A3DJ 2QASA 1TWFJ 1HSQA 4FT2A 3FISA 1EIFA 2P6TA 2ZB9A 2ECZA 1I50J 1ZELA 2CQQA 2KXCA 2HVSA 3BR3A 1HOMA 1KD1C 2D0QB 3TKYA 1JQQA 1PKTA 1OCZH 4ZYHA 1WHLA 4AG1C 2ACJA 2Y4XA 3TEEA 1UHFA 4M75C 4DEXA 4XN3A 2D5VA 1ZLJA 3MKWB 3WG7H 2CV1A 1H8KA 5A2QK 2Y0SN 4KIFA 2VXFA 4MEXF 1ONVA 1CQTA 2A36A 2AKKA 2DBKA 4QVZA 1RUNA 3ZXSA 3AAFA 1BU1A 3O5ZA 1RZ4A 2RVCA 3JAMZ 2L9SA 3A0HC 4LUDA 1X43A 3CCRQ 5GMKh 1WLPB 2W7NA 2EFNA 2LVMA 2G7HA 5L23A 2RNJA 5D6YA 4I0AA 3CPWP 1R36A 1RAIB 3HDDA 1C6VX 3HYIA 3LA3A 3BTIA 3LSKA 5H6RA 4J9BA 1R1UA 2R7ZJ 5GAOq 4HOBA 1KG1A 1XG1A 2C06A 2QUFA 3BP8A 4M77D 4ZZLA 1A36A 4KA4A 2QM3A 1WX6A 4DEYA 3QSUA 1TQPA 2YX7A 3VSLA 5LRSA 4VUBA 2QEXQ 2EFWA 5D8LB 2D45A 1ZRCA 3HOWJ 1EA3A 3CLQA 4YTLA 2H1LA 4M75D 2QGFB 2GOMA 1OI1A 2Y75A 3I9V2 4MZTA 3CCUQ 2YSQA 1P4AA 2L9NA 1HQCA 2KRFA 5TJJA 3LW5E 4Y91A 1XDUA 3M0RA 4HT9A 5KE2A 3CUOA 2NOGA 3LA2A 3GW2A 2HL3A 1ETVA 2ZPFB 4J9DA 4C8QC 5E1XA 2HNIA 1GL5A 3WE2A 5HLIA 4QVDA 3CCQQ 1K79A 1YJ9A 2VJ4A 5BQTA 4ABZA 1AA7A 1GCQA 1F9NA 2O8KA 2PTKA 2DAOA 3SXYA 1T0JA 1VQ6Q 1PWTA 1SD4A 2KVQG 1M2VB 3E6CC 3M8EA 2OA4A 3PQKA 1QBJA 3RMQA 1QO0D 2FEZA 4M3DA 2LY2A 2PG4A 1R5ID 3DB4A 1SAUA 2NNYA 3AL0C 1OZ3A 4HSTA 1VQMT 1ZRDA 1RIOH 3NARA 3HJEA 4RGUA 4AUXA 1R71A 4A3LJ 2VBYA 2DOEA 3FBIB 1ZA2B 3TOBA 4E47A 1IF1A 1GV5A 1X2NA 3CZ6A 3H5AA 1K7AA 1M1GA 1EJ9A 5DLOA 3DU5A 2OTLQ 2HOAA 3C18A 3F21A 3VJPA 2KNBB 2DETA 2J5OA 4XRSG 4BJ5C 3QJYA 2LFBA 1QMCA 2O9SA 1J5YA 3IAS2 3QPLA 3EG9A 2KZVA 1Z9QA 3NGPA 4JRKA 3JSPA 5BNGA 2CV0A 2MI6A 2R7TA 4FSXA 1EX4A 3EGDA 1Y96A 3LH5A 3BTCA 3IL2A 3HSBA 1R0CB 3CTAA 3FWEA 3IKVA 4PCQA 4OAYA 3LNQA 2VC1A 1LJ9A 3VYHB 4C8QE 4JS4A 5FGMA 2JW4A 3D5LA 1OV3A 2UXXA 5CVVA 1HXDA 2CQ7A 4BEHB 4Y52J 3UT1A 3WXMB 1YOVB 1VQ7T 4EJTA 2QLZA 1LVAA 2HQNA 3RR6A 1WJ5A 1CKBA 5GANd 3JAMR 2M9HA 3FHZA 1LOJA 1BR2A 1C0MA 2KL4A 4PFZA 2M02A 2ZCWA 3LQRA 4UUTA 4E7ZA 1BCOA 1SHFA 1U8BA 3OYHA 4WCIA 1O9SA 1VQ5A 4R79A 4KGVB 2E65A 2LJ3A 1MSFC 1IDZA 5E3NA 2KDOA 1O3RA 1R4NB 4PZJA 2VJ5A 3PJRA 1ZUUA 4JLIA 3AKZA 3RBBB 1O57A 3KZZA 5A0DA 4BI4A 4JJNK 3RTRA 4UUSB 2E10A 3DP7A 3DCFA 4EMSA 4CYCB 4J5YA 3BG7A 4HCZA 3JCMQ 2FQ3A 2HKXA 4OINF 1SEMA 1FOXA 4OIQF 2L3SA 3LSRA 2A28A 1YJ9I 2XUBA 1KFZA 4E4HA 3EETA 1I6HJ 4R0KA 1V29B 1TUCA 4F7UE 1IRGA 1JUPA 2MLKA 1MMSA 3EG0A 4QLCU 1K78A 1BL0A 3ZL7C 5LHGA 5LRRA 2LRDA 3LOCA 3QWXX 4A63B 2I2LA 3MEAA 2QQ8A 3NWTA 3LH0A 3VRYA 2EBIA 4M75F 3S6WA 2M4GA 3QYHB 1V54H 2FPDA 3EGDB 3PSFA 3ZRGA 4NOYA 3GX4X 4PJOC 2YUOA 3SEMA 1QQIA 2EA2A 2WAQA 3G4SI 2Y0MA 3ZPLA 5GMKl 1YITT 1W2BA 2XDBA 2CW7A 2GBQA 3PUFA 3FEOA 3EG3A 3UDCA 5GAMj 2A07F 4BXXJ 3G1MA 2W1OA 3CCRA 2HWVA 1N77A 3A03A 2XAHA 1SANA 4U87A 1RQ6A 5D5VB 3WGGA 1X19A 2VKDA 2DJNA 3QZ9B 3M3YJ 4BBSJ 9ATCB 1Z1DA 3I59B 2EFOA 1T0FA 4M77E 2YX4A 2M8EA 2EQRA 4B1RA 1MV0B 3HPGA 3FXRA 1OYYA 3BTLA 1ABQA 4G6TB 3GFIA 3ZQFA 2E34A 2EYYA 1JUMA 4J9IA 1X1PA 4KUMA 2PJRB 2VJIA 4CCOA 2QGUA 4S04A 1B8IB 2MPXC 4B9WA 2CSIA 1S7EA 5DLQE 4C92G 4NC8A 1PD0A 3VYRB 3GZNB 3JB9F 4IJAA 2KRSA 4UB6C 4E7SA 4KT5C 1U8RA 1VQPQ 2X85A 3KEYA 2VLAA 2RREA 1AHDP 5GAN8 4ENJA 3M1EA 3S8PA 4YFNF 5IT9R 3OMGA 1A0NB 1BCMA 1YCYA 3I5SA 1U5TB 1LPLA 2R58A 1GXQA 3QWYA 5K7FA 1J9IA 2OTJT 2D1HA 2O31A 5D6XA 4M7AA 4J7FA 4Q5WA 4X9CA 1YIJA 4EMKC 4DYCA 3K0LA 5K5OA 3A8HB 3WTWC 1I5LA 2KGTA 5KYYB 3FXOA 4PJ0C 3M1CA 3SZTA 3IRQA 4C92F 3F6OA 3LSTA 2HMAA 2KZGA 1K1ZA 5AONA 4PJOD 2Y0SA 3FK7A 3QP5A 1QVGA 2R5ZA 3F8CA 3E6BA 3P5JA 2NUTB 3CCEI 1UFFA 1XCVA 1MBJA 4KICA 5GAOl 3JAMK 1TG0A 2ZPBB 3NTHA 5KCOA 2OJ2A 1RAHB 2DX1A 4JX6A 2E4HA 1VQ5I 1ETOA 1VQ8A 1A31A 1WFXA 3WTTC 3BE3A 1X1AA 4D6WA 1FBQA 4IXAA 1YJNQ 3RCOA 2E60A 2PMZN 1X1DA 1YHQQ 4NBQA 5DCMA 2P5KA 4V19K 2Z1DA 4HVUA 3WTUC 2EZKA 5HKCA 3HEFA 1LKXA 2P0QA 4D8DA 4C5HA 2ZJPF 1ZSGA 3MEVA 2JTFA 2VXEA 5KYYA 3GZ5A 2YXYA 1IO2A 5ECAA 5L3BA 4GY5A 1JB0E 4G7OF 2EYZA 3A98A 5GAMd 2DIQA 3H0HA 2HQEA 3KETA 2ROLA 1U5TA 4W1UA 3OBWA 2VQHA 4BHCA 1RLQC 1Y71A 1MH4A 3HTRA 4IUTA 1UTIA 3I4PA 2LLKA 5LGTA 2ZO4A 4LLGF 3KZYA 1Y07A 4EM1A 3JSCA 4CDGA 4XU3A 3L1AA 2P0KA 5LLQA 3RDIA 2R93J 4DBRA 2ROTA 3W6VA 3MKDA 1Y8QB 1Z6RA 2R92J 5LJ3h 2HSEB 4HX8A 4ME7A 3PVQA 1SMYF 3MHXA 3CCYA 1IG7A 1VQKQ 2DTRA 3CCJI 4KNYA 1JJ6C 1NZ9A 1M27C 3FJPA 1UAAA 4BUPA 4OB0B 3JRDA 2E5ZA 3RPUD 2L3QA 3BZ6A 4MHGA 1M3BA 3U23A 4GLKA 3CCUI 2E1NA 4IHXA 3SDZA 3SFMA 3JRGA 1Y8RB 5HDGA 4QQDA 3Q1JA 2CQNA 3OY9A 2CDTA 3EYIA 2LBFB 3U9GA 1N8RC 1MV3A 1T33A 3C2GA 4P1WA 2QTVA 3K1PA 3HHTB 2E36A 2KLOA 1D0YA 3BR6A 4LMYA 4XTUA 1KU3A 5FKKA 3V8KA 2R4GA 4RB0A 3J7ZI 4GO1A 1VQLT 2OTLA 4M7DB 1YITQ 1XPXA 3S32A 1PHTA 3VKIA 4LG0A 3CCEA 2RM4A 5E18F 2ID6A 2ZBKA 1QWEA 2QAZA 2RJEA 4MZMA 5LGUA 3FDYA 5ICCA 2K3XA 1WGXA 2OAZA 2MMPA 4IRIA 4XKCA 4CCKA 3L2RA 2E7XA 2WAEA 4BDYA 4OIPF 2NS7A 3SD4A 2E41A 3G4SA 3S2DJ 4A5NA 3G71Q 5FW9A 1R23A 1LEAA 3OYIA 2IGMA 1SFEA 3EYYA 2VBXA 2HVQA 5FFZA 3C95A 4A5MA 4KGZB 1GXIE 1V4RA 2JA7J 1E6GA 4OB2B 3H3UA 2A3SA 2O5RA 3BOQA 4S0HB 1E17A 1XN7A 1RAGB 3B6CA 2STTA 4X9DA 1QZZA 3WU0A 2JSPA 5JI6A 2GZWA 1HSJA 5FROA 1HKTA 1GBQA 1VIFA 2EPDA 2LQNA 2QEXT 3E0JB 3UNGC 4CCMA 4A4HA 1XGSA 1OYXA 2L2OA 4EGZA 2QKLB 4U0VA 2DNUA 2VV5A 3FIWA 3KXTA 4OP0A 2LH9A 3VODA 3CPWA 1WRJA 3W3CA 4C5GA 2PUKB 1KC8U 4JRQA 1TU0B 3GTQJ 5J4YA 5J1YA 5CVJA 1R1TA 2CQXA 1SAXA 4QW2A 1UB9A 2L3DA 3A01A 4C3HJ 1L0OC 2MBFA 5CR2A 1LFBA 4HF0A 2QA4I 4XTWA 4EJVA 1PP7U 2K3BA 6PAXA 4NNJA 1JT0A 2BE9B 2IVWA 3OWTA 2P4WA 4DJAA 4V2GA 2GXBA 2JA6J 3BQYA 2HQHA 4LDYA 3OYEA 2DXIA 1WNLA 3NHNA 2JN6A 3MVPA 3M8FA 2QSHX 2Y30A 1BR4A 3GO5A 4U7BA 1ZUKA 2AZSA 3UATA 2ABLA 3HP9A 2RQPA 4ZN3A 1AZEA 3IUOA 1LNXA 2KXDA 2RHYA 3A8GB 2LREA 2O2OA 3COAC 3B6AA 1U1TA 4M75E 4C92B 2XAGA 3U1DA 1F4KA 2LNBA 3LWFA 5B5EC 3A4CA 3TGNA 2IS2A 3E6DA 1YCSB 4WX9A 3TW6A 1Z7UA 5HK3A 4IF4A 1WPYA 2DVJA 4PJOB 3CD6Q 2F4OB 1U2WA 3OSSC 1K4US 2O8XA 3H9GA 1Z67A 2MD5A 1P9QC 2XB0X 2PMUA 2P6SA 2HXOA 3O8GA 2KRCA 3K70D 1WJSA 2EPFA 4F3QA 4F7UG 3ONQA 1IUYA 2HEQA 4XTVA 2F5DA 3GFMA 1ETXA 3KYCB 3BROA 3X28B 2JSCA 1YFHA 4A3FJ 4UV8A 3OIOA 3G1OA 2RA2A 3KYDB 2XROA 1VQNI 8ATCB 5KAFC 2PJRA 2KDSA 1VQNT 3GPLA 5KNLA 3QBYA 2L0KA 2DK8A 3M7GA 5CKEA 5EJCA 3SQNA 1Y0NA 3LAJA 2IGOA 3LSHA 4LLLA 2HZDA 4M3FA 1Y1VJ 1BOAA 3EHQA 4LDVA 2KK4A 3PQJA 3CMAI 4A2UA 3S15J 3CC7I 2AIRB 5C6SA 2ZJ2A 2G3RA 4OMOA 5GANg 2EFPA 3L2CA 4I7HA 3O3KA 4HX7A 5DDGA 4WXHA 1M90C 4OIRF 1LB2A 1F5TA 1W1FA 5FLXK 5GPAA 3UR3C 1UB4A 1X2QA 4M78A 3OA6A 2FNPA 4A6DA 4WF2A 1UECA 3RYPA 1NJIC 1ODDA 3CC4Q 2OTJQ 4IHWA 3ZMTA 5FLXR 2ZJQF 5GAMg 1PRMC 2CSOA 4MQ9F 2KFDA 4DYQA 2LKXA 2GA2A 4U7DA 4EATA 1IDYA 3Q9SA 2L7FP 1UGSB 3DEUA 4XNFA 5TRDA 1OPCA 2M35A 3G3ZA 2WSCE 4KH1B 4KUIA 4R56A 1YO5C 4RBOA 4A12A 2QBYB 1JEGA 4PJOA 4A53A 4RS8A 1YFNA 1YIJT 3IV5A 1X27A 4B3AA 1WYXA 3CQZJ 2ESHA 4HCBA 1ZLKA 4ZH4F 4Y33A 2XVCA 4RAGA 4G9YA 2BXZA 3EQLF 4F91B 2MUNA 2C0OA 4JZ3A 1VOMA 3RQIA 1Q7YC 2AXTC 5LJ5f 2QWWA 3D5RC 5IT9E 2K2MA 2L4MA 5EEHA 3OYAA 3BY6A 2V26A 1L3LA 3WHBA 3CJNA 2R7XA 5DUIA 1E7OA 3REBB 2I8DA 5IYBJ 3JCMg 1FZPB 2E2HJ 3CD6A 1V5FA 3F72A 1XMAA 1FC3A 2O3FA 2V79A 3S1RJ 2XHCA 4AFQC 4J9CA 4OOIA 2QEXI 3JB9D 1KD1U 1SC7A 3CC7Q 4PJOE 1X1BA 4ZYEA 3J81R 5KAIC 3CCRI 1TLHB 3AT1B 2Q2EB 4ORZA 3URGA 2D8HA 2CP5A 1D1BA 3IP4B 1LEBA 1WGSA 2MIOA 3GTLJ 2CU7A 3ROUA 1YHQI 5ERIA 3OYBA 2RHZA 4HCKA 3I9QA 1QPMA 1TL8A 1YJNI 1S9HA 1M30A 4M7DG 4BI8B 1YITA 3V7SA 2LTPA 1DPUA 4MMLA 5CVRA 2UXNA 1SRMA 2P8TA 1YBYA 3QDRB 3LGFA 3MO8A 2HDWA 4BXUA 1Z3XA 1KIKA 3ASOH 4LGWA 3M4GA 5IHNA 2DJQA 3X25B 3JB9J 2STWA 1SFKA 3AL0B 1MGTA 2H8WA 1ACMB 1N9RA 2D6FA 1Y0MA 5CQEA 3I56Q 2DJZA 1R1VA 4I99C 1JI8A 4IUUA 3TP3A 2A68F 1K4SA 2KHMA 3INZA 1TQMA 1UHSA 3GNFB 2DA7A 2EV5A 1QRYA 3Q9VA 4AYBA 2NLUA 4BXFA 2JVHA 4KIGA 3S3MA 2AK5A 2EW3A 3VS5A 5GANf 1P4XA 5ILUA 1Q86R 2PQ8A 2KRMA 3GCMA 3CCJA 3ML6A 2KT0A 1REPC 1VQ6T 2BV6A 1ZQ1A 3DF8A 4M6VA 4E7HA 5IT3A 1UG2A 3ZP5A 1I8FA 5CKBA 1XCBA 1E3PA 4A3GJ 3ZQLA 3EUHA 1WFWA 2JVGA 4WXDA 3HB9A 3LA7A 4HEA2 3OIQA 3ZCOA 2ADUA 4H0EA 2CGPA 4GYGA 1RACB 2M1HA 1W7PA 2VONA 1D5VA 2BE7D 1HSTA 1S72T 1UJ0A 4XLCA 2EJ9A 1VQLA 2OTLT 4L5IA 2HTSA 3HSFA 2ME0A 3CP8A 2L02A 2X4YA 1U5TC 2PEXA 5JHUA 2K3FA 3GMEA 1SRLA 2PNIA 3IH3A 2LF7A 2BW3A 2ZFUA 3WG9A 4MLOA 1WXTA 2XRNA 1B9NA 2RQQA 2CW8A 2YDLA 3EFSA 5E20A 4XLEA 4EQQA 1W36D 2GCXA 1F1ZA 1UGRB 3CEYA 3BG6A 4BL0B 1WHKA 2WV1A 1KQSP 2GQVA 3ABTA 1RI0A 2CYYA 5B1BH 2ZPIB 1Q82U 1UG0A 5GAN4 2CSQA 1TUDA 3OL4A 5CQGA 2NVXJ 2V9KA 1E2XA 1TH7A 1WHHA 3HGYA 1YG2A 2FD5A 5IYCJ 1USSA 1Q1HA 4HQMA 3I4NJ 4QPOA 1DQUA 2R7OA 2JA5J 2DRKA 4J9EA 2QEXA 3L2VA 4CHUA 4Z89A 3CBOA 3H41A 2Q2EA 4LB5A 1T95A 1ZLMA 3DKXA 4FT4A 4F7UB 3WHCA 2VB6A 2E3HA 2R5MA 3JTHA 3KP5A 1TOVA 2UV1A 1MJAA 2QGGA 3GXOA 4A4EA 3N4MA 3A0BC 2DEQA 2ENMA 5LHIA 3M5AA 8AT1B 2MVTA 4OWRB 2MZ4A 5GMKi 4HCCA 1W1WE 5GANh 4KYWA 4HLXA 2EINH 2W00A 2EYQA 2RHIA 3CCLT 5GAN7 2KP6A 4DQ2A 1VQLQ 4FU6A 1QVFS 1X6BA 4AM3A 3DLLA 1FTTA 1Z7LA 3C2BA 4ZGDB 1MZBA 2GQQA 3VB2A 2LQKA 1FYNA 1B72A 1S29A 1IZ1A 1EH8A 4TV7A 3RIRA 5ICGA 1ARKA 3F70A 1FP1D 3IWZA 4IHSA 1X69A 3MP1A 2ZAEA 2A3LA 4ZGJB 2EH3A 1MNDA 2LMDA 4J6YA 5A2QZ 2X4JA 2DA3A 2EIKH 3E7LA 4QQGA 3RKYA 3J80E 3CC2A 2K7LA 3N5BB 3G71T 2MAMA 3GOXA 3K9TA 4KIBA 3E97A 3ECOA 3JCMX 2DERA 2VXDA 1PG5B 1AWCA 3FJ5A 2ELHA 2EFQA 2G6FX 4HF1A 1PUFB 2EQKA 1R5GA 5CPRB 3OYCA 2AKLA 1TWAJ 1I81A 2LJ1A 3OR1C 1W2BS 2IRFG 1V5EA 1N8RR 2KPMA 1RI9A 2DK5A 2GTJA 1IO6A 5LD2C 1A5JA 1YE9A 2XC7A 3LFUA 2DL8A 5JVTA 2OAUA 4FYVB 4IX7A 2HVRA 3DV8A 4A3BJ 4KH0B 2H6BA 1HK9A 4TVRA 4RAZA 3Q0VA 3CC2I 2NVTJ 1UGVA 4OF1A 3M07A 3P8BB 4AVPA 3BT9A 3BCBA 3V4GA 2ZJRF 2OAWA 1YS6A 3G2BA 2VOPA 2RQRA 3FC3A 4PLLA 4A3CJ 3NMZC 2EA4A 4NQWB 3G6ET 2OJED 3ABMH 4GCVA 2L9VA 1Q1VA 2Y9YA 1U9OA 3MKYB 1Y7XA 4AIHA 3KBGA 1VQNA 1G8XA 4CCLA 1QCFA 1WJQA 4J8OA 5KHDA 4BE2A 5EEGA 3CCVA 1TWGJ 4JS5A 4XR6A 4FW1A 1OLTA 4PJLA 1MMDA 4G7HF 2LCSA 3TO7A 3N97A 3WODF 1XTDA 2XKOA 1K73U 2M0MA 4IQJA 5ICFA 5J26A 3K10A 5KYUA 5I22A 4R55A 2DEUA 2FEIA 3GFJA 2ZCFB 4KN7X 1I07A 1QW1A 2LP5A 4X1VA 2QYZA 5D7UA 1VQ5Q 5KK1A 4RAFA 2RD1A 3D0SA 2ZPHB 3C0CA 1XGNA 1Q7YU 3ZMDA 1AVZC 4IPAA 3GWZA 4DBQA 3L2ZA 1P7IA 4OMFB 2X1DA 3F8BA 1YX5A 2A61A 2XAUA 3ZMUA 3S93A 1FMVA 3OYFA 1T39A 1KYWA 2KMTA 2MYSA 2EFIA 3CCJQ 1B7TA 5B1AH 4PGGA 2XU8A 3FKIJ 3MD2A 1G3SA 2XPWA 1MMGA 4GYIA 3OMCA 1RKTA 2R7WA 1JGSA 5FWBA 3U21A 3G6EI 4EMHA 1J59A 1QVFA 2OC6A 1WJFA 2O6GE 3H3ZA 5FLMJ 1N25A 2NUPA 4K11A 3I64A 1ACIA 1Z91A 1AU7A 4U0YA 2VQCA 3PO3J 1OFCX 2BVMA 1KA8A 1ABOA 1HA8A 1DJ7B 1LJOA 1KSWA 1OYIA 4HNTA 1I4K1 3PE0A 2W24A 2L0AA 3M54A 2CUFA 1APLC 4CZZA 1E3HA 4LDUA 2RK2A 1BOBA 2ESNA 9ANTA 2DA9A 1VQOA 1JJ2A 3ZQ7A 3JRBA 5J6XA 3Q3SA 2KIUA 2XICA 4OB3B 2DKGA 3U2RA 2MH2A 1RI7A 1G3TA 2CRGA 2EWNA 3A01B 2Y9ZA 2H1KA 4I2OA 1WZOA 3VV0A 1I3AA 3H5NA 4GGGA 2HOTA 5GAMf 1FEXA 4DA4A 4LK1F 1T0HA 4HRIA 2BY1A 2CFOA 3K6GA 3M4OJ 4XU1A 1MBGA 5D6FA 3E9GA 3ISPA 4MTEA 2LDMA 2SEMA 1M1KR 2XRLA 1DP3A 4M6YA 3ULRB 2DXTA 3EGXA 3E3VA 3DBLB 4L5EA 5I21A 1W2BP 2FG0A 2Y2ZA 2A6EF 1K61A 2CZ1B 4XL9A 3M58A 1FYKA 3EG9B 2KJBA 1JJ8C 5LJ3d 5LJ3g 2KT1A 1Q81R 2X48A 4HVVA 1IN5A 3OIPA 3T8TA 3FHNA 2DLLA 3G1LA 4ZDPA 2FL7A 3CCMQ 1YW8A 3CDLA 1NYFA 3QP6A 2TDXA 4Y13A 1TT5B 3J81K 2VJJA 2DD4A 2L2PA 1JTYA 3GYHX 3BFMA 3R6NA 3NEUA 4J6XA 5C0MA 3VUZA 2M8GX 3CMYA 4M3GA 1LCKA 1K76A 3HFNA 5H6QA 1O7LA 4N9IA 2P4TA 2HGCA 1WQ7A 3M0TA 2GGRA 3EUKL 2RN8A 4K2EA 4AFUC 3EG2A 2M0YA 3ZR8X 4J01A 3C3WA 1TTHB 1YWPA 2F1LA 3FDRA 3OV8A 1WI7A 4AG2C 2WADA 2DXBA 4C3JJ 1BW6A 4JP0A 1MNMC 2M2EA 4ZYGA 2ISZA 2ZSHB 4C0FA 3IWFA 1IXCA 4C92C 1IAWA 3EG1A 1T6SA 4DOVA 1UUEA 2X51A 3S2WA 4C2MJ 4CCJA 5E17F 1X3WB 2VC0A 3TW7A 1BJZA 5GTHC 3V7CA 3P9CA 3G73A 1SFUA 1WHJA 3JRFA 4RGSA 1YJWI 1IV8A 1H3ZA 3I4MJ 1UHWA 2FBHA 3E5QA 5TISC 4DIQA 2K85A 1VF9A 5JHFA 3L2QA 5H2FC 2R7RA 1M2OA 2JNGA 2CZ0B 2LOOA 1S7OA 2JPCA 2KRNA 2YUPA 2MG4A 4HBLA 2B9SA 1WIEA 1BW5A 3H8ZA 1GVDA 1M4ZA 2ZXHA 4Y4RA 2Z0WA 4C5EA 3BLYA 1S72A 2ZPGB 2Y48A 4LN2A 3WTZA 1Z9CA 3JB9H 3JCMJ 2P0WA 3WTVC 2OX7A 2LVSA 2C0TA 3FXQA 1ETWA 3DLLF 5LHHA 3CF2A 1LFUP 2K57A 4UVAA 1QCOA 2QXFA 3CCLQ 4QIWN 3H92A 3L1PA 1GRIA 2JS2A 2DBMA 3Q5FA 2V6CA 2BUDA 1OMIA 2VL8A 4JUVA 1RLPC 3PGGA 2Z5UA 3GF5A 1M3CA 2EZIA 2K6DA 1NM7A 4PK4A 2LSOA 1BN5A 3MMYB 4KGXB 1IRFA 1W4SA 1Z9ZA 1TT0A 1Z77A 2HQXA 3DB3A 1IRXA 5GP9A 3RNJA 3NFCA 2EIJH 2VN2A 3EDPA 2XDVA 5FLVA 2LT1A 3KE2A 5ICEA 1AD5A 2O01E 3DTIA 4XK8E 2KROA 3MEWA 1VQOI 2PMZA 1QP2A 5DM6F 3G1JA 4A3EJ 3J81Z 4RLQA 4E7KA 4F93B 1BK2A 3M0PA 1V5GA 1N6AA 2JZ2A 2F48A 2JUFA 5CLSA 1T0FC 3T9NA 1ZSZC 3OW2P 3MZ8A 4OMYA 3CC4A 2OTJA 4L6V5 3VEPA 3HUGA 4HV6A 3M4YA 1KZHA 4C5IA 3W2VA 1RADB 1R58A 1V55H 2K40A 1D3BB 3KP6A 1JXOA 1X3ZB 2K02A 3PT9A 1VQ9A 5E1WA 4HYEA 3CXCP 1W0UA 3MJXA 5HY6A 2M16A 2H6CA 3C4SA 2FA5A 2LZ6B 3DU6A 4D9JA 3LSIA 4EJWA 1MGQA 3FMQA 4Z88A 2DA1A 4ZN1A 3S3OA 3HC7A 4FW2A 3A1YA 4CO8A 4GBQA 3E5XA 5DYMA 2YRCA 4DGWB 3LMMA 3I53A 2K79A 3KX2A 1SEUA 2KYMA 4YRVA 1WQ2A 3DKMA 1FOWA 4OGCA 3CCJT 3K4NA 4XRSA 4LLNA 3HPWA 4HDVA 2ELJA 3FMSA 2RI5A 4M4ZA 1YQAA 2YLCA 2IPQX 2LNHB 5HDNA 1H3HA 1RESA 4BY6B 1MD0A 4M71A 4MFEA 1EH6A 4FYWB 2FBIA 2RH2A 3OSVA 2GM4A 2FMYA 3GFLA 2HD0A 1YTYA 5M3MJ 4XLPF 4XK4A 3T8RA 2YUQA 1M1KU 1KHCA 3RKWA 3RKXA 3VS6A 1ZBXA 4JJBA 4ON0A 3FIFA 2ME6A 1MBFA 3NWSA 2PBIA 4XRMA 3MCAB 1QWFA 3F0CA 2GXGA 3PSIA 2C0IA 3BR0A 2JT4A 2HOSA 4LG0B 2W0ZA 4PJJA 5IT9Z 3IHUA 3KFWX 4WXCA 3EH2A 3W6JB 1FOYA 1WJBA 1XMXA 2A5WA 3SZGA 2A6HF 2W57A 3JR9A 3WE3A 4BE1A 5J3LA 5BPIA 1NG2A 3PFSA 1UZCA 2QA4Q 5EDNA 1R00A 4F7UF 4XRFA 3JTGA 2LC4A 2DBBA 2PMHA 3IH4A 2YPRA 2ECBA 3LSMA 4LE9A 4R1HA 1A04A 2KE9A 1ETQA 1QVTA 2YU9J 4D8KA 3MZYA 2Y69H 1YJWQ 4CGZA 1PYVA 2EILH 3TMOA 2DVEA 2QENA 1QNTA 2KI7A 3OW2A 1M5Q1 1AT1B 4HAMA 3PL8A 4WTOB 1S72I 3GTJJ 4IHYA 4G94A 2RPNA 1DU6A 1WSUA 2HZYA 2O7OA 5D6WA 1K9MC 5GAN6 1UELB 2FXAA 2R7UA 5L8RE 1K8AR 1MIJA 3MQ0A 2BYVE 5DCFA 1FXXA 5D4SA 4GFBA 3K4CA 2DLPA 3ABKH 4M77C 4ASNA 4FE4A 4HT8A 4FX0A 2E1OA 4NB5A 2QYOA 3PFIA 3HOUJ 3WTXC 2HS5A 1T56A 2V1DA 2UZKA 2FPEA 4KBMB 2DF6A 2XGCA 2R5YB 4N4OB 4MZPA 3P8HA 2D1XA 4XICA 4HF2A 3OQ5A 3ZBDA 2IJLA 2VIXA 4RTYA 5A0LA 2D8JA 4NL2A 1WH7A 5A2QR 2VT3A 1VQMA 2EJFA 2CT3A 5ILVA 3THKA 2FE3A 2DYSH 3ZQHA 2ZNYA 4IOAF 1M1FA 2IAIA 3I0TA 1U78A 2ATCB 5JLWA 3CCMT 2EBPA 3H5RA 3EFRA 4M9SA 3ZGKA 2DO3A 2LNVA 2F4MB 2VUMJ 3VRZA 3G71A 4RKUE 2XGDA 2E1MC 1FP2A 1O7FA 2M45A 4J7IA 1EFNA 3PFYA 3I5RA 3HPHA 1SFOJ 4NQWA 3F8MA 1YX3A 2DL4A 1HDPA 4XU2A 1PD1A 4WK8F 3OYDA 4Q5SF 1AHJB 5HNFA 3RZOJ 3UF4A 2A7YA 2FMLA 1B07A 2O9VA 1DGRM 2XF6A 4HA8A 4ZTJA 1MBKA 1SMTA 4AC0A 1OZ2A 1D5YA 3JCMV 3GZ6A 3CCQT 1VQ7Q 1JKQC 4C8QD 4M7AE 2MC4A 3WTYC 1G4DA 1RUWA 1S6LA 2DFFA 4HPQA 4JBAA 2BE5F 5CKTA 2HNHA 2J5PA 2R5AA 2COMA 1RAAB 1KK7A 2DD5A 2XASA 2PVOB 3D7SB 4P5NA 1N8RU 1ZN2A 5CYVA 1OR7C 4M7AD 3PUBA 4FHTA 1TS9A 2ED0A 1BI0A 1T3LA 2PLYA 2G0EA 3S1MJ 2MF2A 3L2UA 4OMLA 2OU2A 2X1CA 3H0GJ 4J6WA 2JT1A 4C2UA 1IUFA 2EZHA 4E7LA 2GWRA 2RJFA 5HNHA 2R0QC 1KD1R 2HKNA 4BUGA 1YW9A 2QK0A 5KYUB 3GIBA 4NUBA 1NG6A 4AWXB 5EZGA 4FTHA 1IV6A 2DN0A 1EH7A 2WB1A 3BC8A 4C3IJ 1WDXA 3ZMVA 1FLIA 3DEWA 4A3IJ 2JM8A 1H92A 1ENHA 1D0XA 2JMWA 2LY9A 1IGUA 3PMIA 4BQOA 4IZZA 4M7DD 2DCEA 4QSHA 2YT6A 2WTEA 1O4XA 2KSSA 3HRSA 1M2VA 1WHUA 3QODA 1S7AA 2FJ1A 1WHGA 2IPOB 4NS5A 2IS6A 1T98A 2DA5A 4RDUA 2DYBA 2GIVA 4KDPA 2O88A 2JA8J 4PJNA 5D5XB 4F55A 4F7UA 3QYBA 4NC6A 3C2HA 2OZUA 1MNEA 2HDAA 5I2SA 2YU3A 2ISYA 2FZGB 5FD5A 3JCMh 4C8QB 4FE7A 2XHKA 3VS1A 2HYFA 2BZ8A 2DOAA 1XMKA 2OCEA 1GFDA 5IHIA 4I09A 1W36C 1WWXA 1KQ0A 2BXYA 1NG7A 2V1XA 3I59A 5GAHJ 1YN8A 2IW5A 2DMOA 3SDGA 3QQAA 5FRNA 3CC7A 5H20A 4FQGA 1VYTA 2X3WD 4UNOA 2X6YA 4KFCA 1J7KA 2PU9B 3JSOA 1B8IA 4D0PA 3EAEA 4OGEA 1JT6A 5F04A 2EQIA 1X6GA 4JX4A 1KGSA 4M77A 2HKOA 4G6QA 3TBIA 1X75C 4M77B 1Z21A 4ANJA 4ATOA 3FXJA 5DM7F 4LG3A 1VQMI 5J8CA 2DFIA 3ZQCA 3JCMW 3ERED 1H9TA 2KY9A 1RR8C 3QO3A 2NAZA 5GAMh 3PIOF 5B3SH 1QGPA 1PCXA 2W85A 1XTAA 3BY7A 1SHGA 4RGXA 1N9SA 3LYIA 4OMMA 4D5FA 5BPDA 1DUXC 1NPRA 1E3OC 3NPFA 1UJ8A 2PVDB 2Q1ZB 3MEXA 2K9MA 3H0FA 2H94A 4X0GA 3VS3A 2KKOA 1QU3A 3K1MA 3DPUA 4AVZA 1VQ9Q 5A0GA 2OBPA 1TTYA 1KQ8A 3J7YJ 4GDFA 4F7ZA 4L0ZB 1NLPC 3FMRA 1CGPA 3CMEQ 2L01A 2H3EB 5GAMe 1TC3C 4A93J 1VIEA 4EIKA 2JTVA 2LYCA 2VXZA 4A0YA 2LT4A 3RMSA 1Q81U 3GLXA 1JHHA 3FXKA 2DA2A 2L7MP 3L2WA 2HPIA 3DKYA 3FZVA 3TP0A 3MP8A 1WH5A 2NVYJ 2IGNA 2JK3A 4UV9A 1HW2A 4HQEA 2E6ZA 2DOFA 2RI3A 2QQBA 5IT9K 2GA1A 4QPQA 5IOZA 3CCQI 1V3FA 3E5UA 4IRHA 3KZIC 2PJPA 2RHXA 4PKCC 1BM9A 2HKQB 3QJ6A 4KULA 4IHTA 2XDPA 2AT1B 3RJPA 2F5CA 1ZX6A 2LKSA 1X01A 2DTHA 3K4JA 4D1QA 1RUOA 2E6NA 1X4OA 2BY3A 3DPLC 5JLXA 4RLFA 5J47A 1IGNA 4HG2A 1YNZA 5FB2A 2AXLA 2BOLA 2R3SA 1M9SA 2B8AA 4BB7A 3CJQB 1ZKGA 1XSXA 3FXMA 4IIMA 1K9MR 3KEQA 3ZN0A 1B9MA 2A37A 1JHFA 1J0RA 4A6EA 1OCTC 1MMNA 3LQQA 2DTOA 2V9PA 5J8FA 1H641 2KBTA 4M6XA 5FLXE 3CLOA 3CCVI 2EGEA 1H89C 4RAYA 2QG9B 4L18B 5LJ5h 2XKPA
chains in the Genus database with same CATH topology
3FM3A 1R22A 5CK9A 1UHMA 2MA3A 4ETSA 5CQYA 4MDWA 1AOYA 4N9HA 5E1ZB 3HIFA 3VOEA 4S05A 3M56A 1U6GA 1T38A 1VQ4T 5CCAA 4M75B 1BI3A 4M75A 3OYKA 5A2QE 4N0BA 1RNLA 4A4GA 2Q8KA 4EJOA 1ULYA 3R61A 4Y17A 4YFXF 1O3QA 2E1HA 4QQ6A 4NHJA 5IAYA 1YLFA 1STZA 3BDLA 3OBYA 3WVEB 5CO7A 1P6RA 1MDMA 3KP3A