1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
2MLKA 1YS6A 4A5MA 3E5QA 4HX4A 2JRTA 4BHPA 5IT9Z 2DFIA 2EFNA 1I1GA 5DD8A 3RIRA 2W84A 1FC3A 1LEBA 3WU1B 1R36A 1FZPB 1HSJA 3SZPA 1W7PA 5LRSA 2MA3A 3RPQA 5E1ZB 4GXOA 2DQRA 4KIFA 3JSOA 2QZ8A 4E70A 4M6XA 5BMZA 5L3EA 5ICCA 2C6YA 2Q2EA 2BYVE 4L18B 4MGRA 3U9GA 4CYDA 4Q48A 2VBZA 1LJ9A 2GCXA 4AIHA 3HHGA 3CDHA 5D8LB 2DI3A 1H9TA 1DUXC 1BI2A 3VFZA 2IA2A 4LK0F 4R1HA 1LEAA 4XSXF 5ICFA 2P6SA 4ZYGA 5K5RA 2ISZA 3SQNA 1CGPA 3TDZC 3K1MA 4ASNA 3BJOA 2OQGA 4HX7A 2B0LA 1QPMA 1JE8A 4CZZA 2RC4A 3O3KA 1FY7A 2FMYA 2J5OA 2H94A 5E8GA 3L9FA 4FHTA 2K4BA 1TQMA 4RAZA 4A0YA 1TW2A 4O6JA 1K79A 2XV4S 4M9ZA 1BN5A 2OA4A 4OU0A 5FB2A 3PQKA 3ZMVA 5K1YA 3ML6A 5HS8A 3I59A 1FPQA 2E1CA 3KP7A 1ZH5A 4U7BA 2E1NA 2KIMA 4OIQF 5BS6A 3LFKA 2ELHA 4M6YA 3KP4A 2RQPA 4P5OA 2W24A 3NEUA 1ZHFA 4KDPA 4KMFA 3QU6A 3LAJA 3EDPA 2XAFA 2DT5A 2HQRA 5EEHA 3EQLF 2FNPA 2X4HA 4MHGA 2O3FA 3C18A 3ZMTA 1IN4A 4L0ZB 1USSA 3CUOA 3WTYC 1SD4A 3FXRA 5HLIA 2RGVA 3RJPA 2ETHA 3OOPA 2EWNA 3TDUC 1TQPA 2XAGA 3N4MA 1XSXA 2LSOA 5D5UB 4WXCA 4NQWA 1Z6RA 3QPHA 2Z33A 3O6BB 3E5UA 2ISYA 4LJZF 1FBQA 3WG9A 1MDMA 4HAMA 4LLNA 5D4RA 3R0AA 2ZFWA 2HKXA 1SD7A 3GUDA 5D5VB 4EVIA 3JAMK 1HKSA 4M71A 1EH8A 2K4YA 4HA8A 3U2RA 2PEXA 3IC7A 1QO0D 2L4MA 3H3UA 4GGGA 4EGYA 3U1DA 3MEXA 3TGNA 4HLYA 5ED4A 1KU3A 4ETSA 2V9VA 5E1WA 3WE2A 1L0OC 2EFPA 3J81Z 3GZ5A 1BYMA 2H6CA 1U3EM 1B6AA 3ABTA 1SD6A 1RUNA 5IT9K 2IA1A 3WTTC 2BGCA 3EYIA 4IXAA 3GFIA 2PQ8A 1KU7A 1KGSA 1OYWA 2ZO4A 3DXJF 2D1HA 4OMZA 5JR3A 4L0YB 1B59A 3VOEA 2QM3A 5JFRA 5K5QA 4OINF 1SFUA 5D8KB 1WSUA 1KQ9A 2M30A 1DPRA 3TOBA 1YTYA 3I59B 4M74A 2WV0A 4QWQA 3RDIA 3R60A 4ENKA 2A3SA 2DK8A 2XAQA 1FBSA 4OIPF 1WKMA 4OIRF 2QENA 2ZXJA 3COAC 2CWEA 2PFBA 4P9UA 1HW5A 3KLNA 5L3BA 3TQNA 2UWMA 1U6GA 1LDDA 2OZUA 1R1UA 3E6MA 3TOAA 2YX4A 1FSHA 2OZ6A 4PGGA 4UUVA 4UV8A 1YW7A 3GFJA 4BYYA 2W85A 4RGUA 5FGMA 2CYYA 2HKOA 1OPCA 4FX0A 3IKVA 2MC3A 3KCCA 3M9AA 3JTHA 1T6SA 1T98A 4LD5A 5F6FA 4LLGF 2O8XA 2XKOA 2QQBA 2HGCA 2WC2A 1IF1A 4MEYF 2DW4A 3RYRA 4XLPF 3BP8A 5CVUA 4CGZA 4A0XA 5DCMB 1KU2A 5LHIA 1QZZA 4I2OA 2L3DA 3KZZA 5H20A 1T38A 5CVIA 1K7AA 2DPDA 3ROUA 1SMTA 1BBYA 3T8TA 4EGZA 3ZMDA 4HDUA 3BZ6A 1HW2A 4DNCA 2M8EA 3JTGA 3IRRA 2HYGD 2K5LA 3P9CA 1F4KA 1E17A 3QRFF 1CF7A 1FLIA 2K27A 2LKPA 2IA0A 2JTVA 5CJ9A 3CTAA 2X0LA 5FO5A 5LGTA 5LBQA 4YFNF 1W7PD 2NYXA 2O03A 3NQOA 1J7KA 2LX9A 4B09A 3CUQA 1F9NA 4OIOF 3GXOA 1QZYA 5DV5A 1OKRA 3CJNA 4AWXB 1QNTA 2Q8KA 3IRQA 2HTJA 5AIQA 3DQVC 4BHBA 2MD5A 4IHSA 2P5VA 4ENNA 1ZLKA 3I71A 3ECHA 4H0EA 3IL2A 2R3SA 2OBPA 5DYMA 1IUYA 3HOSA 4WX9A 4G6DA 3M7GA 2LDUA 1U2WA 4UXNA 4D0PA 3BPXA 3P9IA 4UVBA 3K69A 4I98B 2YPRA 2VBWA 5FD6A 5FLXZ 1J59A 3J81K 5BPDA 1FWZA 2QQ9A 1Z7UA 1K78B 1UFMA 5HDNA 2Z3YA 3IHUA 1SD5A 2YU3A 2CSOA 5D6EA 2GZWA 5KK1A 3FX3A 4JK1X 4Y17A 3E97A 2XRNA 2P4WA 3RKYA 3PQJA 3GO5A 2OD5A 1ZAOA 3SHFA 4PGHA 5L3CA 4G7OF 4TV7A 4F7ZA 1MZBA 1R58A 2PI0A 5ILUA 4Q47A 1TW3A 4ENMA 2BEOA 3E6CC 4HDVA 3V7CA 1I6XA 2GAUA 2DU9A 3KP2A 1R00A 1HQCA 1XDUA 4I01A 4JQFA 4ESFA 1HXDA 2PMUA 3BJAA 3KEOA 3IKTA 3HTUA 4EMSA 1KU9A 4G6QA 3CO6C 2HFHA 5DCFA 1JGSA 4Q4ZF 1ON1A 4RGSA 1O7FA 3ABUA 2HDCA 4IF4A 3GYHX 4B8XA 5L3DA 3I54A 5LLQA 1B9MA 2KRFA 2CFXA 1J0RA 1SMYF 2R7DA 4A6DA 4ZZLA 5H6RA 2ESHA 4HOBA 4NHJA 3Q5FA 1CF7B 2V1XA 3QAHA 3ZMSA 2WWYA 3RI4A 4KT5C 4RB0A 1F1ZA 4EQQA 2VC1A 4S04A 4GO1A 3DFGA 2F5EA 4I0BA 1LQ1A 1J75A 2EJRA 3JW4A 1D8JA 2CGPA 2H27A 1I5ZA 2FF4A 2H09A 3NRVA 1ZGAA 2P8TA 3KLOA 2XASA 5AIPA 4FT8A 2K7LA 2AS5F 1H0MA 3K1PA 1RUOA 5J8CA 1GVJA 1PDNC 2F5FA 4UVCA 1S6LA 2HOEA 5LGUA 4XRFA 1UB9A 3WTUC 2MLGA 3SXYA 2YX7A 2STTA 2DK5A 5E8IA 2RNJA 2W57A 2JSCA 2A68F 3HOTA 5HDGA 1P2FA 3CLOA 4Y13A 2V6CA 1XCVA 2EV0A 4M9XA 5J6XA 1QQIA 1OR7A 1ZARA 2J5PA 1USTA 4BNCA 3JSPA 2OU2A 3M8EA 2RKHA 2H3JA 3T0YA 4LG0B 4Q5SF 3VODA 2DPUA 2QBYB 4EM0B 3GFMA 1L3LA 2L4AA 4JBAA 3MFKA 5LHHA 2VODA 2BBYA 1EV7A 3D0SA 2DLLA 4I02A 3MZYA 2F5DA 4ZYEA 2IRFG 1RI7A 1FNNA 1W7PB 3R0JA 2H6BA 1ZREA 2IP2A 5LHGA 2IT0A 2O6GE 1XGNA 2HQNA 3MQ0A 1YO5C 2FBKA 3IWFA 3WODF 3W6JB 4L5IA 2V79A 2RV8A 2UXXA 5FLXK 3MAJA 4ZZDA 5CYVA 2FSWA 3FHZA 3ZN0A 3KZYA 4CXFA 1DP7P 1XGSA 2FRHA 4LB5A 2JPCA 4HZFA 1ON2A 3EETA 2JPBA 2LF7A 3V8JA 4I09A 1FSEA 2VN2A 4PDKA 4EJVA 1G3TA 1WQ2A 5ILVA 1OMIA 2YSRA 4MNUA 3MHXA 1Z1DA 3ZMUA 1SAXA 1O3QA 4DQ2A 3HHHA 4HV5A 4G7ZF 5HVQC 5K5OA 2MBFA 3HUGA 5FFXA 2FBIA 2HTSA 2QYOA 2K86A 4P96A 1G3WA 3DPLC 1IN5A 3RYPA 5LGNA 3KEQA 2STWA 1GHCA 1MJ9A 2IPQX 4G8XA 2HYFA 2FU4A 3BWGA 2WTEA 4OOIA 1REPC 1BI1A 3LQQA 3K9TA 3Q9VA 1HKTA 2EV5A 1YIOA 3LAPA 4Y15A 3B73A 3FMQA 4ON0A 1D3YA 4GYGA 3GLXA 4L5JA 1IN8A 2VE8A 2PMHA 4IPAA 5CLSA 4ESJA 4BH9A 3F6VA 3E6BA 4I0AA 2P7CB 1YQAA 2IVMA 1XMAA 2XUBA 5HOOA 1IN7A 4KNYA 5L3FA 1HSTA 1ZGJA 4LK1F 1O3RA 1HBXG 4L9TA 1XGMA 2VC0A 1C0WA 4AIKA 3HRTA 1FP1D 5ILSA 1J2XA 3ELKA 2ZMEA 2Z5UA 2P6TA 1XSDA 1XGOA 3CO7C 5E17F 1FBUA 1TQIA 1MJAA 4LFUA 4A6EA 4IRHA 4K2EA 2M1BA 1R1TA 1S3JA 3BROA 1U5TA 3I53A 2A6HF 2ACJA 3K1NA 2ESNA 2RDPA 5HS9A 1IXRC 2EV6A 3F22A 1H9GA 2XIGA 2QLZA 2BV6A 3WTSC 3J80Z 1MDMB 4U0WA 5DDGA 2NNYA 1R5HA 1VTNC 2JT1A 2JZYA 1BIAA 2R7FA 1R5GA 1RNLA 2CW0F 1UHWA 5E1XA 3FXQA 1RZ4A 1YG2A 1AOYA 1G3SA 2PN6A 4WXHA 1HW1A 3F8NA 3HRMA 2AXLA 3P7NA 4HF0A 3VB2A 1IRFA 5D5XB 4HX8A 3O2PE 5LRRA 4U88A 3GWZA 1FYMA 4M9SA 1ZG3A 3REOA 3Q9SA 3RTRA 4AIJA 4CO8A 5CVRA 3J7AO 2KKOA 4EM2A 1Z05A 4IJAA 1WRJA 1JHHA 5HDKA 3LQRA 1DDNA 1ZN2A 1S8NA 1Z9CA 2Q0OA 4GCVA 2FNAA 2PLYA 1J5YA 1PP8F 2QWWA 3R4KA 4GYIA 3F8CA 4KYWA 1BJAA 3FMRA 3V7RA 1BC8C 4EJWA 2FXAA 3V8LA 3CUQC 3T5XA 2FOKA 3WTVC 3OV8A 3EYYA 2OAZA 3FM3A 2XAJA 3WGGA 5A2QZ 2VT3A 1IRGA 4N9HA 2E7WA 6PAXA 4O3MA 1R22A 1T39A 2NS0A 1WWXA 2F2EA 3TO9A 2M87A 2D1VA 2XKPA 4KA4A 4YFKF 1LVAA 2VBYA 2BE5F 4I7HA 3F23A 2PJPA 1R23A 1I27A 4HQEA 3WTZA 3LA3A 1I1SA 4EJTA 4UV9A 2KJBA 3JAMZ 2Y75A 3HIFA 3HRSA 3E3VA 4UHTA 3LWFA 3GF2A 4G9YA 3WGIA 2EFOA 2FEZA 5E20A 1BM9A 3TKYA 2KIUA 5ICGA 1ONVA 2DO7A 4ZYDA 1IZ1A 4YFXF 1S29A 5DUIA 3EUHA 3I0TA 4ESBA 1ZLJA 5JHUA 3W6KB 5JVTA 2XAHA 4BQAA 3HSEA 2DBBA 1P4AA 3FZVA 1R1VA 1LDJA 4Z2YA 4A12A 5D6FA 2LNBA 4HBLA 2FA5A 2DAOA 2XHKA 1G3YA 2VE9A 1O7LA 1W5TA 3HTSB 4EV0A 4IRGA 3T8RA 2Y48A 5HLHA 2HR3A 3TO6A 1MKMA 3G3ZA 4KUMA 2ZKZA 4PCQA 3LSTA 1P92A 4A0ZA 2IW5A 4BHCA 2GIVA 2XVCA 2FE3A 3H3ZA 2Y0MA 1Z91A 3DV8A 2GA1A 5CVJA 2UXNA 3CUQB 1YW8A 3P9KA 1KYWA 1DPUA 4G94A 1V3FA 4WXDA 1T2KA 1TTYA 4MEXF 1QGPA 1MD0A 4HYEA 1EH7A 3C1DA 3J80K 5H6QA 1OYIA 3F6OA 2MH2A 4A2UA 4EJOA 2GWRA 4RAYA 1TLHB 1YFHA 2K5FA 3FF5A 1ZG5A 1STZA 2CG4A 5L3GA 3ZPLA 3ULQB 4QLCU 3R6SA 4CHUA 2QUFA 1RIOH 4ZH4F 1ODDA 1W4MA 2ZBKA 3MWMA 1YLFA 3ZN1A 2Z9OA 2QQAA 3GFLA 2L02A 2GA2A 3FXUA 4N9IA 3ZP5A 2VBXA 2UZKA 1BI0A 1ZG1A 3WE3A 2D45A 4R79A 2A5YB 2O0YA 2A07F 3F8FA 1G6NA 2EFQA 3V4GA 1S7AA 4EM1A 3ISPA 2L54A 5E18F 2ZCWA 1XDSA 4N0BA 2ZJ2A 5LEKA 3QPTA 3GZ6A 2TDXA 1A04A 5AONA 5TRDA 3HSRA 2A61A 3E6DA 2KJCA 1KA8A 2HS5A 2XGXA 2HZTA 3WTWC 2XROA 2RN7A 4S05A 2A6EF 1LDKB 2PBIA 3KP5A 2VOPA 2NNNA 5A2QK 4XLNF 1Q1HA 2F5CA 3QOPA 1OYYA 2K4JA 1QBJA 1KYZA 2ZNYA 3F72A 3KP3A 4HW0A 4U0YA 2QVOA 1EH6A 3GW2A 3DP7A 3M1EA 3ERED 3F21A 5DEQA 3ECOA 2M45A 1XCBA 4RS8A 2EK5A 3E19A 5DCMA 1BOAA 4AVPA 1YS7A 5ERIA 4CICA 3I64A 3TO7A 3GVAA 1XN7A 4YIFA 1KQ0A 2K5IA 2MH9A 1IN6A 1XD7A 1BIBA 4O5VA 2OQRA 2FBHA 5CVVA 1B9NA 2GQQA 3FMSA 5BQTA 1IXCA 4XSZF 1YYVA 1MGTA 1ZYRF 3FWEA 4KICA 3RKXA 4M73A 2P7VB 3WGHA 4G7HF 3BPVA 4MQ9F 1PP7U 2EA2A 4LMYA 4U0VA 2G9WA 4HV6A 4IHTA 1Y0UA 2D2WA 1P6RA 3M8FA 1G4DA 4KMUX 2P5KA 2EB7A 4KFCA 3QP6A 1FYKA 4UNOA 1JHFA 1B4AA 5ICEA 3DEUA 3C7JA 1SFEA 5EEGA 4HF1A 3LA7A 4WF2A 5TJJA 3RPUA 1AWCA 3V8KA 1UHMA 5F64A 4R8HA 3HRUA 4RB1A 1LB2A 3HYIA 4L9VA 1R7JA 1S7OA 2CO5A 2L01A 1KQ8A 5FFZA 1LNWA 2FQ3A 2GXBA 4LB6B 4HQMA 4FX4A 3KFWX 1FP2A 4KN4X 1FOKA 2NAZA 4L9JA 3WU0A 3FM5A 1O57A 3IWZA 4RGRA 4RB3C 1T0FA 3KE2A 1K78A 2VT2A 3DF8A 4ENJA 2K02A 1U78A 3L00A 5LEJA 2Z99A 4CDGA 3MCZA 4BXUA 3N97A 4MTEA 1FT9A 3F8MA 3G73A 2IJLA 1D5VA 2LF8A 2ZNZA 3H92A 4ZYHA 2EFWA 1E2XA 2PG4A 4KIGA 1P4XA 4OMYA 2HEOA 1B1BA 5HLGA 3S2WA 5FD5A 3PFIA 3SFZA 1BC7C 1IW7F 4WCGA 3V7SA 4BAYA 4RB2C 2NRAC 3ZQ7A 1U5TC 3R61A 2FMLA 4KN7X 5D5WB 1QVPA 1PUEE 1ULYA 3L09A 4U7DA 3BDDA 3GX4X 3DKWA 2M5WA 1FYLA 3D5LA 2YR2A 1GXQA 2VONA 1K6OA 1V4RA 1MJBA 1IAWA 4MQVA 1O3SA 4LLLA 3LA2A 1XB4A 5IT3A 1IXSB 4P9FA 3RKWA 5KVRA 2P5LC 5JI6A 3KETA 2A69F 2ADUA 1YW9A 4WK8F 4PZJA 1XMKA 3QP5A 2G7UA 2V1UA 1J9IA 4IRIA 2EA4A 5DUKA 3MZHA 1ZRFA 3WTXC 1W5SA 4WWCA 3E5XA 4LGWA 4KIBA 3I5UA 4YG2F 1TNTA 5D4SA 3I58A 3L7WA 3F3XA 2COMA 3GEZA 1TNSA 3F8BA 3K2ZA 1UCRA 1X3UA 5BPIA 4HF2A 4P55A 4RGXA 1F5TA 2VXZA 1D8KA 3L2CA 3ZMZA 3K0LA 2V1DA 2GXGA 1FX7A 1QW1A 3T1BA 3BJ6A 1O3TA 1ZRCA 4EJUA 3KP6A 1NHAA 1JXSA 1U8RA 5HS7A 4NB5A 2VOOA 4MTDA 2DTRA 4HLXA 5J8FA 3BY6A 3C3WA 3HSFA 1ZRDA 1HKQA 2ZMEB 2KIFA 4IVNA 3BOQA 3I4PA 1Z6TA 1XSVA 4UVAA 1GXPA 1WI9A 3QU3A 2RVCA 2W25A 2DQLA 2E7XA 4L9NA 4A5NA 2O61A 1TBXA 3SZTA 5BOXA 4LG0A 3VEPA 3B02A 4M72A 4XBFA 3AAFA 1BI3A 1U5TB 4YIIA 1SFXA 2HWVA 1P4WA 2QBYA 3DPTA 5F1RA 4AD9A 2CQKA 5DD4A 2G7HA
chains in the Genus database with same CATH superfamily
1QCNA 4HT9A 2MLKA 3PFYA 1YS6A 4A5MA 4B44A 3E5QA 4HX4A 2JRTA 3TMOA 3S32A 2JS2A 4BHPA 3HOUJ 5IT9Z 3A8MB 4J8OA 3CCLQ 3I9V2 2L3PA 3LNQA 2DFIA 3OIPA 1WFWA 2DOAA 3RMQA 2EFNA 2HDAA 1I1GA 5DD8A 5LJ3g 4CSWA 4C0DB 2QSGX 2OTJQ 3RIRA 2W84A 3E7LA 5E3LA 2FD5A 1FC3A 2JVGA 4M3BA 1LEBA 3WU1B 1QKXA 1R36A 2O8KA 1U1TA 3L42A 1FZPB 1HSJA 2UUZA 2H1KA 4FE4A 3SZPA 4C92F 1AEYA 1W7PA 5GANg 1QVUA 2V9KA 3HGYA 2YLBA 3I56A 4D9JA 5LRSA 4NC7A 2QF7A 1R5ID 1W6XA 4FU6A 2CMPA 3OMYA 3K4NA 5JLXA 2MA3A 1BW6A 3RPQA 5E1ZB 2BVMA 2DQRA 4GXOA 2E35A 4KIFA 3ZCOA 1K4SA 2KRSA 5GAMf 3CCRT 3JB9D 3JSOA 5CKTA 3UDCA 2Y9ZA 4C30A 2QZ8A 4C92E 4F17A 4C92G 1TT5B 1WCMJ 1B7TA 4E70A 4M6XA 2JTFA 2YHTA 3VRZA 1VQOT 3EUHC 5BMZA 2PVOB 1LFBA 2LP0A 3V42A 1Z9ZA 2E10A 5L3EA 1MH4A 2DOFA 5ICCA 1Q82R 4PL6A 3CMAT 2B63J 2C6YA 1RUWA 4ATOA 3BY7A 2Q2EA 4W97A 3PVQA 3CCVA 1Q81C 2BYVE 3K6GA 1UHCA 1U5SA 3SDZA 3H3VK 4L18B 1GV5A 1WHKA 1N9RA 1ZHIA 2HSPA 2KE9A 4N4HA 1YJ9T 4CI0C 4MGRA 4J19A 3U9GA 4CYDA 1B72A 5F0HA 4A3KJ 2DM1A 2PMZA 4Q48A 5M3MJ 4M7AB 4HRIA 1X19A 3F0CA 5K7HA 2VBZA 2L9VA 4F55A 2WSFE 3NGPA 1LJ9A 3CCQI 2GCXA 1E3PA 2RQTA 4M7DB 5LJ3e 2QQSA 5IN1A 2BOLA 3HHGA 4AIHA 3CDHA 5D8LB 2DI3A 1VF9A 1H9TA 2CSIA 2LCSA 3WVEB 4I99C 1DUXC 1ACIA 3I55Q 1BI2A 3VFZA 1YX5A 4FT4A 2IA2A 4XOTA 1WXBA 2OC6A 1X69A 4LK0F 1FMVA 3IUOA 4R1HA 5C4XJ 2XGEA 2PJRA 2RHYA 1V54H 1WQ7A 1LEAA 3M0SA 4XSXF 5ICFA 2P6SA 3OR1C 3VYRB 4ZYGA 5K5RA 2ISZA 1KONA 2K40A 3SQNA 2VASA 3HM5A 2E3IA 4E7ZA 4EDUA 3FXLA 1CGPA 3TDZC 3K1MA 4ASNA 3MKDA 2V9PA 3BJOA 3K7AJ 2OQGA 4HX7A 1YIJQ 1YITT 2B0LA 1QPMA 2W10A 1JE8A 4CZZA 2RC4A 3O3KA 5KYYA 2O9VA 1FY7A 4M78G 3FXJA 2O5RA 5FU6B 1GUUA 5EG0A 3Q0UA 2FMYA 2J5OA 2QAZA 2LRQA 2EIMH 2H94A 3L9FA 5E8GA 4ZDLA 5KAFC 4FHTA 3OSVA 3BQZA 4C92C 5KYNA 3TU4K 3KXTA 1G8XA 2K4BA 1TQMA 2L3RA 4RAZA 4A0YA 1TW2A 3RSNA 4O6JA 1K79A 1KJWA 2L7FP 2OPTA 1VQ7Q 2XV4S 4RM2A 3I56I 5LJ5e 4XKVA 4KGVB 2KYMA 1GFCA 2VQGA 4M9ZA 1F1BB 3A8OB 1HA8A 2JUGA 3DKYA 2Y0SA 2DXIA 4M78A 4J00A 4HVWA 1BN5A 2XF6A 2QG9B 5DY9A 4EMKB 3JB9F 2L9SA 2Y9YA 4ME7A 1XS9A 3A8HB 4LITA 1BOBA 4KH0B 2OA4A 3I3LA 2IS6A 2GM4A 4OU0A 5FB2A 5HY6A 1Y96B 1LFUP 4IHXA 4ZGJB 3PQKA 3ZMVA 5K1YA 3CBMA 3ML6A 2GLOA 2EQRA 1IXDA 2HBWA 2I8DA 4OMNA 2X4JA 5HS8A 1LOJA 1VQ9T 1X58A 3G1LA 3I59A 1FPQA 1NK3P 3K4JA 2E1CA 2R7XA 2JMWA 5GMKm 4IIMA 3OYLA 1OU9A 1EA3A 2ZAEA 3EFOA 1MHNA 3H0IA 3KP7A 2ENMA 3M53A 3T9NA 3S3OA 1ZH5A 2FHDA 1QVGS 2RAEA 4U7BA 4FSSA 1X6GA 2GF7A 1NZ9A 5EG2A 1IDYA 3LX7A 3JCMW 1OULA 5EF6A 1SVLA 2E1NA 3FIFA 5GANf 5B5EC 4NL2A 2VV5A 2KIMA 3MKWB 4OIQF 1IZ6A 2RNAA 5BS6A 3LFKA 4BE2A 4XTVA 2X3XD 4MZPA 2ELHA 2P4TA 3CC7A 4M6YA 3LOCA 3JCMe 3FKIJ 1ENHA 2KL4A 3KP4A 2LC4A 1SAUA 3E2UA 5FWCA 2DYBA 3OQ5A 2RJCA 2RQPA 1WHMA 1WYXA 1YN8A 4P5OA 2ZPBB 2W24A 3NEUA 5GMKh 1ZHFA 4KDPA 4KMFA 2LKSA 2WV1A 2RJDA 3CCSA 2WB1N 2K3XA 2EBPA 1JJ6C 1RACB 1TWAJ 3D5SC 3QU6A 3U1KA 2YWWA 3OWTA 1WH5A 2E34A 3LAJA 2ROLA 1WLPB 3EDPA 2XAFA 2JWTA 5D6WA 5M5XJ 1M5Q1 4J7IA 2DT5A 3DTIA 1XTAA 3IAM2 1HDDC 1IHVA 2LQNA 2JJ7A 2EH3A 2HQRA 3I4NJ 2MSYA 3RPUD 1IGUA 2FRWA 1DQUA 2OTLA 5EEHA 1QHGA 1KG1A 3EQLF 2FNPA 4AU7A 2F5VA 1ZBXA 2H3EB 3E9GA 4C0ZA 4A3IJ 4EIKA 1UJ8A 4LIVA 3J81R 1YWPA 2X4HA 2E1OA 4MHGA 2ECBA 2O3FA 4J6XA 1QCOA 3MP1A 2WACA 3C18A 3QYEA 1LKXA 3PNVA 3FLGA 4S0HB 2XRLA 3ZMTA 4EPCA 1IN4A 1SEUA 4L0ZB 1USSA 3CUOA 3WTYC 1RADB 3EFRA 3PE0A 1SD4A 4OMFB 2L7KA 3FXRA 2EGCA 4A4HA 4OB0B 3PNWC 3PMIA 5HNFA 5HLIA 4HCCA 1QA6A 2RGVA 3RJPA 1QWFA 2ETHA 3OOPA 4PSXA 3UWNA 2QTXA 4JZ4A 1TUCA 2MVTA 1ETOA 4RMNA 4KGZB 2EWNA 5L23A 1MMGA 3TDUC 1TQPA 5B1AH 2XAGA 2DNUA 2ZPGB 1PUFB 3N4MA 2HXIA 3KIOA 3BCAA 1XSXA 2E1MC 2LSOA 1W2BA 2P0PA 5D5UB 4WXCA 4NQWA 1Z6RA 3QPHA 2Z33A 2HNIA 4RCBA 3O6BB 1HJDA 3E5UA 1W0UA 1OQYA 4UC4A 4C0GA 3P8BB 2ISYA 4BQNA 2F4MB 2R93J 4LJZF 2OI3A 1FBQA 4ZC3A 3WG9A 2E41A 1MDMA 4HAMA 2VIXA 4ITVA 2DA6A 1D1CA 4LLNA 1WPYA 1W5CC 3NPFA 5D4RA 3A01A 1WHJA 3R0AA 2ZFWA 2HKXA 2V8IA 2DFEA 1SD7A 3GUDA 4QVCA 2CP0A 5KE3A 5D5VB 3LSPA 1X1DA 2BIVA 2DILA 4EVIA 3OIOA 2HQXA 1AZEA 3JAMK 2R5AA 1XX5A 1HKSA 2TCTA 4M71A 3JRDA 1TUGB 2XDBA 3ABKH 3H8ZA 2Q1ZB 1EH8A 3LL7A 3ZQFA 1UEBA 1YJNT 3CC7I 3A8LB 2K4YA 3CCVQ 3NWSA 3AFHA 3BQYA 4HA8A 3MEAA 4V2GA 2ICWG 3U2RA 1D3BB 3EG0A 1JTYA 2VKHA 1FXXA 3HOYJ 2E2JJ 2DE0X 3CPWS 1AHDP 2YLCA 2PEXA 4C92B 2LQ8A 3IC7A 1QO0D 1QWEA 3CCSI 4JRPA 3BTCA 2W48A 3PL8A 2L4MA 3H3UA 4GGGA 2R7UA 1ABOA 2E6ZA 1WJRA 3DKMA 3PSIA 4EGYA 3U1DA 1ZA2B 1VQKA 2E71A 2CT3A 1VQPA 3MEXA 3TGNA 4HLYA 3THKA 2QQ8A 4JX5A 1KU3A 4ETSA 5ED4A 3REAB 3VS4A 2V9VA 3C2GA 1YFNA 5E1WA 3C94A 1JUMA 2OTLI 3BT9A 3WE2A 3LSKA 1L0OC 2EFPA 3BLYA 1JQQA 1RABB 2EYXA 1MMDA 5CKHA 3J81Z 2JM8A 3GZ5A 2IIMA 3D7SB 1BYMA 2H6CA 3F70A 5LJ3d 1U3EM 1B6AA 1GL5A 2EZLA 4PJNA 2FL7A 1RKTA 2IGOA 1HF0A 2LNVA 2PUOB 1A36A 3ABTA 2YRDA 3SB2A 5IHNA 2KR3A 1FOWA 2M8GX 3TW7A 1SD6A 1RUNA 3S16J 5IT9K 1QMCA 1YCYA 4RAFA 2IA1A 3WTTC 2EYZA 4A4GA 4IHYA 1VIEA 2BGCA 3EYIA 1WPKA 4IXAA 2J6OA 1ERDA 1QVGA 1WHHA 1IGQA 5KYYB 3GFIA 4XLEA 3EPZA 2PQ8A 1KU7A 8ATCB 1KGSA 1OYWA 3HC7A 2K2MA 1I0CA 3I56T 1T33A 4HNTA 2GFAA 2ZO4A 3DXJF 4AFZC 3FIWA 2D1HA 5EGOB 2CQXA 1KHCA 5AT1B 2CRGA 2DD5A 1YOVB 3VSLA 1QU3A 2R7ZJ 2JMAA 2M16A 5KE2A 3DWLE 1WVRA 2BHYA 3JSCA 4OMZA 5JR3A 4L0YB 1B59A 2LY1A 4Y3OA 4FM4B 3VOEA 1BBZA 2DT7B 2QM3A 5JFRA 5EYRA 5GTIC 2PU9B 3LH5A 1W4SA 5K5QA 5HCKA 4MDXA 3MVPA 4OINF 3JRFA 4A4KA 5FLXE 2VGNA 4XOPA 4BY7J 3R6NA 5GAN4 4QVZA 1SFUA 4C5IA 5LJ5d 5D8KB 4JJCA 5CK9A 1C6VX 2ESWA 3OW2A 1WJSA 1WSUA 1KQ9A 3ZQIA 2EGEA 3QODA 2M30A 2BY0A 1DPRA 5E3OA 4V2FA 5KYUB 3TOBA 5GP9A 2VVKA 1YTYA 3I59B 3P8DA 4M74A 3TQ7P 1U8BA 4M3EA 2WV0A 2HQHA 2NUZA 1EX4A 1QP3A 3OS5A 1Z3YA 2CFOA 5C4JJ 2DJQA 4QWQA 3RDIA 2QDYB 4CC2A 4D6WA 1Q7YR 3GF5A 5GMKj 4CUGA 3GMEA 3DBLB 1HSQA 3R60A 4ENKA 2A3SA 1R0CB 2Z16A 3BZCA 2DK8A 2LC2A 1FBSA 2XAQA 3G1OA 2HOSA 4OIPF 2M35A 1NEBA 1T3LA 8AT1B 1WX6A 3H35A 2RI5A 2DFUA 1YJWQ 3CQZJ 3CC4Q 4ZTFA 4QPOA 1ETVA 2VJ5A 2FPDA 4RTTA 1VQPI 5M9OA 5K7ZA 2GGRA 3BR6A 1P7JA 4JLGA 1WKMA 2JT4A 2K7AA 1X2QA 3S93A 4E2FB 2HEQA 2LX7A 3OSFA 2HVQA 2DERA 4OIRF 1OISA 2QENA 2ZXJA 3COAC 2CWEA 5IT9E 2PFBA 4P9UA 1I3QJ 1V5GA 4JOMA 1H88C 3GTPJ 1S72A 4F91B 3JCMd 1HW5A 1EF4A 2XU8A 3KLNA 1S9HA 5L3BA 1YJ9A 1NTCA 2E1MB 3TQNA 2ZCFB 4OVAA 2UWMA 3CD6T 2DJNA 1U6GA 3MD2A 2WAFA 5HLTA 4F7UA 1YRNA 4M4ZA 2X4YA 1LDDA 2OZUA 1R1UA 1E7OA 3BDLA 3BC8A 4A3EJ 1M90R 1U0JA 3E6MA 4XLCA 2KFDA 2YX4A 3TOAA 1FSHA 2OZ6A 1AOJA 4AYBA 4PGGA 2RJEA 2KGTA 1JO8A 4CYCB 4HPQA 4UUVA 3FJPA 4UV8A 1YW7A 3OBWA 1BR1A 1VQ4Q 3GFJA 2G6FX 2E36A 4BYYA 1OI1A 2W85A 2EJFA 3K10A 2C0IA 4RGUA 5FGMA 2C0OA 2CYYA 5JHFA 2LMDA 2HKOA 3HDDA 1OPCA 4FX0A 2CDTA 2EZHA 3OR2C 2DJZA 1MMAA 3IKVA 3AKZA 1OPLA 3TBIA 2L5QA 2MC3A 2DMNA 1T0FC 3KCCA 3M9AA 2CP3A 2JTEA 4GLMA 4RG2A 3JTHA 2OJED 2NUPB 1JKQC 1T6SA 1T98A 3L1PA 2CP6A 4C8QD 4LD5A 5F6FA 3RQ4A 3REBB 4ZDPA 3H5AA 4LLGF 2JQ7A 2MD0A 4KRTA 1K9MU 3M54A 2DMPA 2HI3A 2MK5A 1D1AA 2O8XA 4J9GA 3PNYA 2XKOA 2QQBA 2HGCA 2WC2A 3KYDB 3JRBA 3FBIB 4MEYF 2DW4A 1IF1A 2K9GA 3RYRA 2QSFX 4XLPF 5CKEA 4C9YA 3LGLA 3BP8A 5CVUA 4CGZA 4J6YA 1LCKA 2ATCB 4FIBA 1WIEA 1LPQA 4A0XA 3HOXJ 1E3OC 5DCMB 5I11A 3CCJQ 1T95A 1XQHA 1KU2A 3F9KA 5LHIA 1QZZA 2RD1A 3VS7A 1QVFA 1YI2I 2K3YA 2L3SA 3A01B 5GAOp 4I2OA 2OX7A 2L3DA 2JK3A 2XF5A 3KZZA 5H20A 3CDLA 4AG1C 3DU5A 1T38A 2CH4W 4DOVA 1A6IA 2DA2A 3CC7T 4QQGA 5CVIA 3TEEA 1K7AA 4DGWB 3QYGB 4LD6A 3S2DJ 2DPDA 3ROUA 1H3HA 2CP7A 1SMTA 4RAGA 4AUXA 3BR1A 1BBYA 3T8TA 4EGZA 1MBFA 3DU6A 3ZMDA 3LSGA 1IDZA 4HDUA 2GTOA 2CGHA 2OAUA 2JN6A 2HZYA 3BZ6A 3ZQCA 2E65A 1HW2A 3K4KA 1JT6A 2A6TA 4DNCA 2XIDA 5EDNA 3ABMH 2GQVA 2M8EA 4CC3A 6AT1B 3JTGA 2CZ7B 3IRRA 4DJAA 1VQ8Q 2HYGD 4J83A 1VQ9A 2XKOC 2CV2A 4R56A 2X6YA 3M1CA 2E2IJ 2K5LA 1S72I 2MZ4A 3P9CA 1JKRC 3B6AA 2KDOA 3MKZA 2XB5A 1F4KA 1E17A 1EIFA 2O2OA 3EGDA 1KIKA 1YJ9I 3H0FA 3QRFF 1CF7A 5FLXR 3QJ6A 2V4JC 1VYUA 1FLIA 2L8DA 1VQ5T 2MPXC 3CCRQ 5FRMA 2L7MP 2K27A 3A0HC 2LKPA 2GIZA 2IA0A 4MDWA 2DPPB 2NVUB 4DYCA 5CKFA 1X4PA 4JLIA 2E4HA 2JTVA 5CJ9A 4X1EA 3CTAA 1VQOQ 2DIGA 3ER0A 1WZOA 2X0LA 5FO5A 5LGTA 1ORKA 5LBQA 2LZ6B 1OCRH 1VQ6T 4YFNF 2F2XA 3FBNB 3JRGA 2AQFA 4JPBW 3DTKA 3CMAQ 1W7PD 2NYXA 2O03A 3NQOA 2CJJA 3JCUC 1J7KA 3OL3A 4II2A 4XICA 1X2KA 3JRZA 3DLLA 2KYBA 1H92A 1SVOA 3C0CA 2LX9A 2EZIA 1OCCH 4B09A 3CUQA 1F9NA 1R8OB 2MW8A 2O4XA 3LW5E 3VS3A 4OIOF 5FRNA 2FUG2 3GXOA 2D8HA 1QZYA 5IHKA 2ZXIA 5GAMg 2PVGB 3OA6A 5DV5A 1OKRA 4M7AC 2VPLA 3OMCA 3X2QH 3CJNA 4C8QF 4AWXB 2D9TA 2ZZDA 3VS6A 1QNTA 2H8WA 2Q8KA 3IRQA 2JXBA 2HTJA 3JCMJ 4KBMB 3M8JA 5AIQA 3DQVC 1RL2A 3PUFA 5FKNA 5KYWA 5KYXB 3GTOJ 2M34A 2W1OA 1WGXA 3EGXA 1N8RU 4BHBA 3RESA 5LJ3j 2K3FA 2A37A 2MD5A 1JUPA 4AT1B 2RN8A 4IHSA 3P8HA 2P5VA 4ENNA 1ZLKA 3I71A 2PNIA 4C8QE 2K9MA 3HGGA 3ECHA 4H0EA 3LYIA 1LNXA 2CUBA 1KQSS 2CUFA 3IL2A 2AO9A 2MAMA 1M4ZA 2DMQA 2R3SA 4EMHA 2OBPA 1YX3A 2X1DA 4HNVA 2DMOA 2KDSA 3ULRB 1UG2A 5F1JA 4N4NB 1RI9A 5C6SA 4PLIA 3HPGA 2CS7A 3U23A 5DYMA 3TP0A 1YITQ 1K73R 2BY1A 1ZKGA 2V8JA 2KT1A 2ME6A 1ZUUA 1IUYA 3EHRA 3HOSA 5M3FJ 4WX9A 4D1QA 4UUTA 1B8IA 3ZEHA 2YT6A 4G6DA 3M7GA 1X3ZB 5FWBA 2HOAA 2LDUA 3QYFA 2DL8A 3S6WA 4Y52J 1VQPT 1HCRA 1U2WA 4UXNA 4D0PA 2AZSA 1K8AU 2BY2A 5J1RA 1VQ9I 3BPXA 2DTIA 3FC3A 3P9IA 2MYSA 1ARKA 4UVBA 1Z77A 2F1LA 4DBQA 1MH3A 3DLAA 2A5WA 4RTZA 3K69A 4A63B 4I98B 4N4IA 5GAMe 2YPRA 5IY5H 3JCMX 2LR8A 3J7AW 2VBWA 5FD6A 4LDUA 5FLXZ 4P1WA 1J59A 4A53A 4LDWA 5LJ5j 3J81K 2DEUA 5FROA 2ELKA 4BS9A 1I50J 5BPDA 4A3GJ 2QI2A 1EZZB 1FWZA 2O31A 2OAWA 2QQ9A 3SEQA 2QA4T 1BU1A 1KFZA 1Z7UA 1K78B 3CC2A 1UFMA 2LY2A 2HOTA 2M02A 4KULA 5HDNA 2Z3YA 3IHUA 1SD5A 1YJNA 2YU3A 2CSOA 3KEYA 5D6EA 3RQIA 4LUDA 1X01A 4XU2A 3G4SQ 2GZWA 3OIQA 5CQYA 2IXSA 3C2HA 3VSKA 5KK1A 3FX3A 4JK1X 2ME0A 3PUBA 1Y1WJ 3BG3A 2LJ1A 4C8QC 1I07A 4IQ4A 2RQWA 4Y17A 2EQUA 3ZRGA 3AT1B 4RTXA 4M78D 3LSMA 3E97A 5EZHA 2DA1A 2XICA 2K3PA 3S1QJ 4QQDA 4L5EA 2LH9A 4OMOA 2R92J 2FO0A 4DA4A 2BW3A 4B3AA 3X25B 3KYLA 4RLFA 4XKBA 2XRNA 1IRXA 2P4WA 1LPLA 1YCSB 1U3OA 3RKYA 2E70A 2RPNA 4IURA 3PQJA 2E5QA 3GO5A 2JA6J 2H8HA 3HP9A 2NLUA 2OD5A 4LG3A 3M0RA 1ZAOA 3SHFA 3Q1JA 4ZNXA 4PGHA 5L3CA 2MGQA 1NH3A 2CREA 1TSFA 1WJBA 4G7OF 2BVLA 3HEFA 1UFFA 4TV7A 4F7ZA 2LTOA 1NJIR 1MZBA 1R58A 2VJIA 4AVZA 5ILUA 3D1NI 1JGGA 4Q47A 2PI0A 3QO3A 4AM3A 5GAN7 5J40A 1TW3A 5H2FC 4ENMA 5EZGA 4PFOA 2BEOA 2KK4A 1ZLMA 3E6CC 4HDVA 3V7CA 3MMYB 2ECCA 1I6XA 5IXFA 2GAUA 2DU9A 3KP2A 2R7RA 2OF7A 4ZJZA 1R00A 2CUDA 1HQCA 1XDUA 4I01A 4JQFA 4ESFA 1HXDA 5HNHA 4BI3A 1YI2T 1MNEA 4XTYA 2PMUA 3BJAA 3KEOA 4PSWA 3IKTA 4E4HA 2LQKA 3HTUA 3H5RA 1TWGJ 4EMSA 3EG3A 5GAOr 4J6WA 1VQNA 2VUBA 4L59A 4MFDA 1W1FA 2A0FB 4LNPA 1VYVA 2RH2A 2RHIA 1KU9A 1TT0A 4M75G 4Y92A 2PMZN 4G6QA 2HFHA 1PYVA 5DCFA 3CO6C 1JGSA 1MBGA 1UAAA 4Q4ZF 3G6EA 1SSHA 1ON1A 5GJWB 2AK5A 4IEJA 4RGSA 1AWWA 2CS3A 2XGCA 1Q86U 1O7FA 3ABUA 1IC8A 3J81E 2HDCA 4DOZA 4IOCF 1R4NB 4IF4A 2VQCA 3GTKJ 2D0QB 2LMJA 3I9QA 3GYHX 4XU0A 4B8XA 2NUTA 5L3DA 3I54A 5LLQA 1B9MA 2KIQA 3IV5A 2KRFA 1GDTA 1O9SA 1T0JA 1V29B 2XDDA 1S72T 3OY9A 2CFXA 4DZJA 2YU9J 2CZ6B 1J0RA 1UGSB 1AZGB 1SMYF 2R7DA 2ECZA 2EW3A 4XRMA 4A6DA 4M75A 2CQQA 4OB3B 4ZZLA 5H6RA 1YE9A 4RTWA 3ZL7C 4KUDK 2FB7A 3K70D 2VL8A 3CC2I 2ESHA 2P0TA 1MW7A 2XB0X 4HOBA 1PHTA 2QKMB 4NHJA 1H89C 1YJNI 3EGDB 2E5ZA 4LUEA 4OB2B 2HQ5A 4A3MJ 1NE8A 3SYTA 2CUJA 1VA7A 2BZYA 2W4SA 3Q5FA 1CF7B 2V1XA 1D09B 1H8KA 1KQSA 2L9RA 3QAHA 3OS2A 4YTLA 1TP4A 9ATCB 1W2BS 3S3MA 2WSEE 3ZMSA 2FG0A 3QQAA 3HPWA 1LVKA 3IAS2 2K3BA 1NM7A 3SDGA 1Q81U 4XIDA 3PO3J 4FYVB 4DYQA 2WWYA 5GANe 3CF2A 3DB4A 1I6HJ 4PJLA 4M78F 3H1CA 5GAEJ 3CCMT 1WHUA 3RI4A 4KT5C 4RB0A 3FKJA 4KJZA 2K85A 2IS2A 2RM4A 1A6QA 2DAQA 1NLPC 1F1ZA 4EQQA 4ORZA 3OMGA 5IHIA 4XM3A 1VQKI 2VC1A 2DLPA 1JBMA 3G71T 2V1QA 1I39A 4BQOA 1W36D 1IV8A 2B7EA 4YELA 3CF5F 4S04A 2LT1A 2VGMA 3QOEA 3PMTA 4J9BA 3CCQQ 2DVJA 4PK4A 2PVDB 4GO1A 2Y0SN 2O4XB 3LGFA 4M78E 3CJTB 4UUSB 3DFGA 2F5EA 2QGFB 3CMMA 3PSFA 4I0BA 1LQ1A 4C2UA 5HKCA 3TL4X 2R5ZA 1J75A 3CD6A 2EJRA 1OCPA 4BU2A 3HOVJ 3JW4A 1Y6IA 1M1KR 1D8JA 2HPMA 2CGPA 4PJOE 3BR2A 1BR4A 2VQHA 2H27A 4PJOG 1I5ZA 1KHIA 1N78A 1SKUB 1WNLA 2SEMA 3MO8A 2FF4A 5KYWB 2H09A 3NRVA 3EGXB 1JJ2S 4HCBA 4D8DA 4J01A 1PKTA 1ZGAA 2EJ9A 2P84A 3HL8A 1VQNI 4PJ0C 1Q86R 2VJ4A 1Y0NA 2P8TA 2CQNA 2KZVA 3KLOA 1YWOA 2XASA 5AIPA 1D0YA 3G6EI 4FT8A 3PO2J 2K7LA 2AS5F 1H0MA 4PKCC 4HNUA 3K1PA 2AKKA 4PJOA 4DBRA 3WVDB 4JYKA 5M5WJ 1RUOA 1TWCJ 2L2OA 5J8CA 2D0NA 1GVJA 2JSPA 2WA0A 2JA2A 3A52A 1PC0A 3C95A 2RHUA 2DTHA 4NNJA 1PDNC 1MSFC 3JCMV 3MZ8A 1VNDA 2F5FA 4UVCA 1B34A 5CR2A 4A3CJ 1WXUA 1S6LA 3EG9A 2HOEA 5LGUA 2KT8A 2VKNA 3CBPA 4XRFA 4CC4B 4BEHA 1LE8A 3I56Q 1X1BA 3IH3A 4C8QB 3A8GB 1UB9A 1KD1U 3WTUC 2MLGA 1OPKA 3SXYA 2YX7A 4YIRX 1OCZH 2DK5A 2STTA 3PVLA 1JU5C 2YXYA 5E8IA 4JRKA 2RNJA 2W57A 3GNFB 1VQKT 4E7JA 2DA3A 1PD1A 2DA5A 1UHFA 2JSCA 2LBFA 1T3SA 2L2PA 1PNJA 3A1PA 2A68F 2RREA 3VUZA 1N5ZA 3X28B 2WAQA 3OYYA 1JUSA 3BE3A 3S1NJ 3HOTA 1CKAA 5HDGA 1P2FA 1C0MA 3CLOA 4GY5A 2FPEA 4Y13A 2V6CA 4M78C 1XCVA 2EV0A 3HKZA 4M9XA 1QQJA 2VKEA 5J6XA 1X1AA 1QQIA 2RK2A 1G59A 1OR7A 4E7SA 1ZARA 2J5PA 3QWLA 2JN0A 1QZEA 5C44J 1USTA 2I0NA 4BNCA 4GLKA 3JSPA 2R7VA 2OU2A 3ABLH 3M8EA 1TZLA 2L0KA 2RKHA 2H3JA 1W2BP 2BZ8A 2RO0A 3T0YA 1AT1B 4LG0B 2X4WA 3OS1A 3OW2S 2MABA 3X20B 4Q5SF 4XQ3A 2MF2A 2RJFA 3VODA 4FL6A 2DPUA 1OU8A 4G6TB 3HOZJ 2A05A 1OCOH 1EKEA 2R5YA 3CD6I 3UA7A 2QBYB 4D5FA 4JUVA 1FMKA 3IP4B 2EGAA 4EM0B 1VQ5A 3GFMA 4J9CA 3MEUA 1L3LA 2BXYA 4Y7NJ 2L4AA 4JBAA 4KUIA 1NYFA 4IUVA 3RKQA 1JI8A 4BXFA 3MFKA 1LJOA 2QXFA 5LHHA 2VODA 4XN3A 4Y33A 1D5YA 2BBYA 3EUAA 3OYBA 2MIOA 1VQ6A 2VPRA 2M0MA 1D0ZA 1OR7C 3QDFA 2DMTA 1EV7A 4X0GA 2XI9A 4BDZA 2HDWA 2HXOA 3CDIA 3D0SA 2ZPIB 4FCYA 2DLLA 1SVMA 4I02A 5I21A 5LJ5f 4XU1A 3MZYA 1MV3A 2F5DA 3LMMA 4V19K 1UUEA 4ZYEA 5D7UA 2IRFG 1RI7A 1FNNA 1W7PB 3R0JA 2R57A 4RTYA 3BG6A 2RK1A 1KC8U 3PFSA 1KD1R 2H6BA 2DBMA 1ZREA 5CKBA 2IP2A 5LHGA 2KRHA 2IT0A 4M7AG 2OV7A 2O6GE 1HK9A 1XGNA 3CCEA 4LDXA 3CQTA 4BD3A 2X9HA 2HQNA 3MQ0A 1YO5C 4J9DA 5GMKi 2FBKA 2ZC2A 3IWFA 3WODF 3OYMA 3K70C 4XORA 2NS8A 1Y39A 2BY3A 3W6JB 4L5IA 2LOOA 2V79A 3LSHA 1FTZA 2J6FA 1M3BA 4HEA2 1ZSZA 1KZHA 1G2BA 1U1SA 2RV8A 2UXXA 3RBBB 5FLXK 3CLQA 3BG5A 2CQ7A 3MAJA 4OMQA 4ZZDA 2LKXA 2CV1A 3RUXA 1ETKA 4ANJA 4JS5A 5CYVA 4BL0B 2FSWA 2JRMA 3BR3A 5B3SH 3FHZA 3ZN0A 2NUTB 4QIWN 3CC2T 2Q2EB 3KZYA 4CXFA 1DP7P 2FYKA 1XGSA 2FRHA 4LB5A 2ZJPF 4Z8AA 3CXCS 1RLQC 2XF7A 4WTOB 5CCAA 4FSXA 2JPCA 4HZFA 4BE1A 1UTIA 5GAOm 3NMZC 4FW1A 2XAUA 3MJXA 1B72B 1ON2A 2KQRA 5GAN5 3EETA 3I55T 2CU7A 4NOYA 4V2SA 2JPBA 3K2AA 3NTKA 1JT0A 4II1A 2DXUA 2LF7A 2FZKB 1JJ2A 3V8JA 4I09A 1FSEA 3JCMf 1Q7YC 1VQMA 4C5HA 1W36C 3E1SA 2DF6A 2KSSA 2VN2A 3GIBA 4B3XA 4PDKA 4EJVA 2V7FA 2AHQA 1DJ7B 1G3TA 1WQ2A 1QHHD 1Y56A 5ILVA 3ESWB 1JTXA 1YIJT 1OMIA 1VOMA 4IQJA 3AG2H 2YSRA 4MNUA 1Z7LA 4A3BJ 3FK7A 1Z1DA 3ZMUA 1SAXA 1VZ0A 2PJRB 1OOTA 1O3QA 3MEWA 4DQ2A 3HHHA 4RKUE 4HV5A 3UA6A 1IV6A 3VS2A 4Y28E 4G7ZF 3CC7Q 5HVQC 5K5OA 4BBRJ 1SG5A 2MBFA 3HUGA 5FFXA 1V76A 1QVFS 2FBIA 2HTSA 2QYOA 3EUKL 4CCMA 1VQ5I 2K86A 4P96A 1G3WA 4OAZA 4J9IA 3OYJA 2QA4A 5GANd 3M07A 2YUNA 3DPLC 4HCZA 3CCSQ 1NEGA 3HKSA 2QKLB 4DBFA 1IN5A 2ABLA 3RYPA 2YUQA 2TRTA 4MIMA 5LGNA 3EH1A 3KEQA 3KBGA 4RM3A 2STWA 4XRSG 1WJ5A 1VQ6I 2YUPA 5EG0B 2YSQA 1P7IA 1NG6A 1GHCA 2HNHA 3CP8A 1QPIA 4IUUA 1MJ9A 4PJMA 4B48A 2VB6A 4IL6C 1M90C 4OAYA 5B1BH 1V1CA 2VXEA 1JKPC 2OTLQ 1BA5A 2IPQX 1VQNT 2M51A 4G8XA 2HYFA 2ZSHB 3ERMA 3WU2C 3JV3A 4FE7A 5A2QE 2FU4A 1R0BG 3BWGA 2VI6A 2VXFA 4HCKA 5GMKl 3G6ET 2LYCA 2WTEA 3CEYA 2GXAA 5LL6S 3FXOA 3ZR8X 5K7FA 4OOIA 1REPC 3O8HA 3SHWA 3CCEI 1BI1A 3LQQA 3K9TA 1VIFA 4KH1B 3K4LA 4M78B 4XRSA 2X48A 1KQ1A 3Q9VA 1HKTA 2EKOA 2EV5A 2ZJRF 3JB9H 2EIFA 1YIOA 3LAPA 5CKDA 4C0FA 3JCMb 3CP2A 4Y15A 4PJOB 4IIOA 2MCNA 3OBYA 2E6NA 3MHXA 2Z0WA 2IBDA 1ZR4A 4VUBA 3B73A 2EZKA 1UB4A 4IHVA 3FMQA 4ON0A 1FTTA 1YHQA 2X6OA 2BKDN 1D3YA 4GYGA 3GLXA 4L5JA 2W0ZA 2ZPFB 1UHSA 3EG9B 3LLRA 5LJ3h 1IN8A 2VE8A 2HAXA 1DU6A 1LE8B 5FU7C 2PMHA 3ASNH 4IPAA 3EFOB 4F7UF 2COBA 4Z02A 1YI2A 5CLSA 2JW4A 5DM6F 1OQKA 2KQWA 3JR9A 4ESJA 2BZTA 3ZGKA 2CUEA 3GTMJ 3CMEA 4BH9A 1PKSA 2IS1A 2KEAA 3FB9A 3PIOA 3BTJA 3F6VA 2JZ2A 5J4YA 2BHZA 3OYKA 1K4TA 3E6BA 3DCFA 1VQMI 1WJQA 4I0AA 2P7CB 4ZTJA 4F7UE 2V1RA 2HPIA 4F7UG 4B9WA 1M8VA 1MMNA 1OZ3A 3OYCA 1YQAA 2IVMA 2LLKA 1XMAA 3CPWP 2XUBA 1I4K1 5HOOA 1IN7A 4AYBN 5L3FA 4KNYA 2L0AA 1TC3C 2JMCA 3SD4A 1HSTA 1ZGJA 1N6AA 4LK1F 4QSHA 1O3RA 1HBXG 1ZTRA 3C2BA 4L9TA 2BZXA 3OL4A 4Z6YA 1XGMA 2P4RA 2X6WA 4M3DA 4BJ6C 2VC0A 4XK4A 1C0WA 2QTVA 2YS9A 4AIKA 1HLVA 3HRTA 4RBOA 5FKOA 1FP1D 2RQQA 2QA4I 5ILSA 1UGQB 1BW5A 1J2XA 1R6RA 3ELKA 1GT0C 4OF1A 4QQ6A 4OP0A 1WFXA 2LD5A 3VU3C 5LJ5h 3SWNA 2ZMEA 2Z5UA 2P6TA 1XSDA 1XGOA 3M9QA 2DRMA 1M1EB 2NYSA 1VQPQ 3CO7C 4GDFA 4BKXA 1A5JA 2DL7A 4A3LJ 1XNIA 5E17F 3VS5A 4ZGEB 1QVFP 2HQAA 1FBUA 1TQIA 2EPDA 3IH2A 3ZBDA 1MJAA 5J4VA 2RB6A 4ABZA 5CQGA 1ZX6A 2LDMA 4LFUA 4X6AJ 4A6EA 2NWMA 3CXCA 3OB9A 2COWA 4JDSA 5J1YA 4IRHA 1ETQA 2EQMA 2JA7J 1TTHB 4K2EA 4QPQA 2M1BA 1AWJA 1JJ8C 4DBHA 3CCMA 1R1TA 1S3JA 3BROA 2DDAA 2ID6A 2NVXJ 3META 2O9SA 3QBYA 1RAEB 4E6KG 5CQXA 3PT9A 1U5TA 3I53A 2LP5A 2PTKA 3G71A 2A6HF 3X24B 2ACJA 1RC9A 3K1NA 2ESNA 2KZGA 2RDPA 1N77A 3PM1A 5HS9A 1IXRC 4NQWB 4N4GA 2EV6A 1YHQI 2NS7A 1FOXA 2IVWA 3M59A 1PD0A 2COYA 3F22A 1H9GA 2XIGA 2QK0A 2QLZA 2BV6A 3WTSC 3J80Z 1MDMB 2AKLA 3HFOA 3U21A 4U0WA 2M3AA 5IOYA 1JB0E 1LUJB 4R0KA 3CESA 5DDGA 3H6ZA 3JCMh 1ZR2A 2NNYA 4AFSC 1R5HA 1VTNC 2JT1A 5CAIA 5EJCA 4D7MA 2JZYA 3CMEI 1RQ6A 1ZSZB 1IUFA 1V5EA 1S7EA 2KRMA 2C06A 1ABQA 1BIAA 2RQUA 3CD6Q 3KPHA 1ZQ1A 4RTVA 2R7FA 1R5GA 1RNLA 2CW0F 2XSJC 3DBRB 4IO9F 2A7YA 1QKWA 1GFDA 4C2MJ 3PIPA 1UHWA 4JJNK 3DLLF 5E1XA 3FXKA 2X98A 3FXQA 1N25A 3H0GJ 1GBQA 3LWHA 1K73C 1RLPC 1RZ4A 1YG2A 1AOYA 2DRKA 3OSGA 2MC4A 2QASA 5KAIC 4FW2A 1TXQA 3HOWJ 2EBIA 5A2QR 1G3SA 2CUZA 1TOVA 2X3WD 2QGGA 3X26B 1WJEA 5J47A 2F2WA 2PN6A 1UELB 4WXHA 1YI2Q 1HW1A 3F8NA 3HRMA 1G83A 2AXLA 3P7NA 3QWYA 4HF0A 1XMXA 4M7DG 1OCTC 2IAIA 3VB2A 1IRFA 5D5XB 5DM7F 2KRCA 2P81A 4XQFA 1RRJA 4HX8A 3O2PE 1P9QC 1F43A 4F16A 5F27A 5LRRA 4U88A 2DEQA 4AFQC 3C12A 2EILH 3UT1A 4N0AA 3GWZA 1FYMA 1E0EA 3RNJA 4M9SA 5IH2A 1ZG3A 3J7YJ 3REOA 1BB9A 3EGUA 1T56A 3Q9SA 3RTRA 4GRIA 2X35A 4AIJA 1Z21A 4CCJA 3S15J 3M3YJ 3S14J 4BUPA 2VUMJ 1S72Q 2VJJA 4M7DA 4M3GA 2K9QA 4CO8A 3CCMI 2DT6A 2KPMA 5CVRA 2C0TA 3H0DA 1K9MR 1YJ9Q 3M5AA 1X3WB 2QEXA 4ZDOA 2M0YA 2OCEA 3TP3A 5FU7B 2M0CA 4RA2A 3G71I 3J7AO 2KKOA 2E12A 2OJ2A 4EM2A 1SANA 4CZCA 2QQRA 4JZ3A 1A0NB 1Z05A 3CCET 1N27A 3D5RC 1WRJA 4IJAA 1TWFJ 1N9SA 5GPCA 1N8RC 1JHHA 5HDKA 5LFAA 3LQRA 1XC5A 3OOUA 1T8IA 1DDNA 3CCLA 1ZN2A 3K4CA 2F5TX 1S8NA 5DLQE 3ONQA 1Z9CA 2Q0OA 4GCVA 3Q0WA 2DFFA 2FNAA 2VWFA 2PLYA 1YP5A 1J5YA 1PP8F 3M58A 2AIRB 2QWWA 2X51A 1Y57A 4B9XA 2XPWA 3VUBA 3R4KA 4GYIA 1UMQA 4M75D 3F8CA 1NJIC 1WQWA 5GANj 1AD5A 4KYWA 4JRQA 1BJAA 3FMRA 2J6KA 5CQEA 3V7RA 5GAHJ 3RZDJ 1BC8C 2EYQA 3PNTA 4EJWA 2FXAA 2DFHA 1TG0A 1BKBA 2A08A 3V8LA 3CUQC 2OCCH 3T5XA 3QZ9B 3BTLA 1RR8C 2FOKA 3MN2A 3WTVC 3OV8A 1TH7A 4LDVA 3EYYA 4E7HA 3CC4T 1JEGA 2D8JA 3K4MA 2DO3A 2HL5C 2OAZA 1VQMT 4RLQA 3FM3A 2CH4A 2XAJA 1I81A 3WGGA 1K8AC 4CRIA 3M57A 1IREB 5A2QZ 3L2QA 2VT3A 3L2ZA 2VXDA 2B8AA 3AG3H 2JUCA 4CCNA 4EMKA 2ID3A 3AG1H 2GOXB 2RI2A 3JREA 4XKWA 5L8RE 3FHNA 1IRGA 3MKLA 1U9OA 4N9HA 3M0QA 4FT2A 1B3QA 3CCUI 2E7WA 6PAXA 4FTHA 1IGNA 1Y96A 1X1CA 1AU7A 4O3MA 2RI3A 1R22A 3OYFA 2IGMA 1Y0MA 1T39A 1RR7A 4A3FJ 5KCMA 1I8FA 2AZVA 1MNDA 4IKFA 3JRIA 5GAOq 2NS0A 1WWXA 2F2EA 3TO9A 2M87A 5IP9J 3QUIA 2D1VA 2XKPA 4KA4A 4YFKF 2I10A 1WI7A 1X43A 1LVAA 2VBYA 1BL0A 4E7LA 1VQLI 1Y07A 2BE5F 2CH0A 1XPXA 2ZXHA 4I7HA 4AIDA 1GCQA 3QZ5B 4C3JJ 3F23A 2PJPA 2R7SA 3ASOH 4F52A 1R23A 2VC8A 1I27A 1VQ9Q 3CJQB 4HVVA 4HQEA 3GTLJ 3I55A 3WTZA 3LA3A 3WHBA 4DZPA 5IP7J 5EEAA 5F0FA 4BDYA 3S2HJ 1I1SA 1YRNB 4EJTA 1O75A 2X1CA 4UV9A 4F7UB 1RAGB 4A3DJ 2K6DA 3VJPA 2KLOA 2KJBA 4DW6A 3JAMZ 2QEXI 1I5LA 4IUPA 2Y75A 5GAN3 3HIFA 3HRSA 3SFMA 3E3VA 1Q82U 1ETXA 1N8RR 4JX4A 4UHTA 5J3LA 3ZFJA 3LWFA 1GVDA 2M2EA 4PJOD 3MCAB 3GTJJ 1YIJA 1OYXA 3GF2A 4G9YA 1UE9A 3PTAA 4U87A 2CYZB 3CCLI 2XG8D 2R7QA 2XGDA 1QVGP 3Q0VA 1T08B 3VKIA 3OYNA 3WGIA 1ZUKA 1PCXA 2EFOA 2OTJI 2FEZA 5E20A 1ZQ3P 1EJ9A 2VKDA 3KYCB 1ITYA 1SRLA 4LIUA 1BM9A 1YHQT 1RAHB 4BJTA 1MV0B 3LSJA 3CCJT 3TKYA 2HVSA 2ZB9A 2L3QA 4PJJA 4M75F 3ZXSA 2KIUA 5IYCJ 5ICGA 3QPLA 1VQ7A 1ONVA 1WJFA 1S5LC 2DO7A 4ZYDA 1PM3A 2MMPA 4FYYB 5C0MA 1IZ1A 2EIJH 4YFXF 4XLHA 1M1KC 4ZGDB 4BUGA 1S29A 3J7AF 2SRCA 5DUIA 1RAAB 3VYHB 4AG2C 3EUHA 3I0TA 4ESBA 2L89A 4DOWA 3CMET 2V6EA 1K8AR 1ZLJA 5JHUA 1KQSP 1M1GA 1K0SA 2DD4A 3J7ZI 1CSKA 4Z89A 3FJ5A 4M75E 5DM7R 4UB6C 3HSBA 4QVDA 3W2AA 1BK2A 4J9EA 3W6KB 5JVTA 3TSWA 1A35A 2XAHA 2JS0A 2DZ9A 2X1EA 4BQAA 3HSEA 2DBBA 4C3IJ 1P4AA 1PSEA 1X6OA 3FZVA 1Q86C 1R1VA 1VQ8T 1PUFA 1LDJA 2H8RA 1XJWB 2LCLA 3BDUA 4EMGA 3RMSA 1AVZC 2KP6A 4GFBA 2ZGWA 4Z2YA 4A12A 5D6FA 3VYTB 3CMYA 1UJ0A 2LNBA 2O7OA 3G2BA 3TCJA 2HYJA 3JCMP 1Z67A 1KK7A 2DKGA 4HBLA 1Y8QB 2FA5A 2DXCA 4AC0A 2DBKA 2J7IA 2R0QC 2DAOA 2MFZA 2XHKA 5AYFA 1RAFB 1SF9A 1G3YA 2JOYA 3DLMA 2HKQB 2VE9A 1O7LA 1D0XA 4XTXA 3B6CA 2DN0A 3FRNA 3OYGA 1W5TA 3HTSB 2R4GA 4EV0A 1HD3A 1K9AA 4IRGA 3T8RA 4C5GA 2Y48A 5HLHA 1MNMC 2HR3A 1H641 1FEXA 5I2MA 3I55I 3HFNA 5FLMJ 1OJLA 1MKMA 2NXNB 3G3ZA 4KUMA 5F04A 3TO6A 4C2TA 2ZKZA 1IB8A 4PCQA 1KQ2A 3LSTA 1P92A 4A0ZA 1OX9A 2IW5A 2LTPA 2KBTA 1I5OB 4QKUA 4AFUC 2OUMA 2B9SA 4MO7A 2IEKA 4BHCA 2GIVA 2HVRA 1BCMA 2FPFA 3INZA 1D3BA 5LJ5g 4PNOA 2XVCA 4PUSA 2V8KA 3PJRA 2FE3A 2FEIA 4C92A 2M4KA 3H3ZA 3OYEA 1YIJI 1K6YA 4PJOF 2Y0MA 1MUZA 2WY7Q 3CC2Q 2DXBA 2K9NA 4MMKA 1Z91A 3DV8A 2GA1A 2CT4A 5GAGJ 5CVJA 1YJNQ 2I5UA 2UXNA 3BG9A 3CUQB 1M30A 5HK0A 2QYZA 1YW8A 5IYDJ 3DEEA 3P9KA 4M75C 1KYWA 2FX0A 1DPUA 2BTTA 3ASKA 4G94A 1V3FA 3JCMc 4WXDA 4IUQA 1OLTA 2X6XA 4A4FA 4N4OB 1T2KA 1TTYA 1NLOC 4X34A 4MEXF 3ZQQA 1QGPA 1MD0A 4HYEA 1VQ7I 1POGA 4B6MA 1EH7A 3C1DA 3P5JA 3FK6A 3J80K 2FZGB 4NUBA 5H6QA 4FISA 1CQTA 2BXZA 1GRIA 2COZA 3QXEB 2M4GA 1OYIA 3F6OA 4OGEA 3EG1A 4A69C 1VQKQ 1VUBA 2CW7A 2MH2A 4A2UA 2O01E 1R71A 5I2SA 4EJOA 3GLLA 2GWRA 4BGDA 1XG1A 2Y30A 1GLNA 1TLHB 2DJIA 4RAYA 3VPRA 4XAXB 1YFHA 2K5FA 3C4SA 4E47A 3AL0B 1U9NA 3FF5A 1R77A 1ZG5A 3HXLA 1XTDA 1STZA 4A54A 2CG4A 4I6ZA 3OS0A 5E3NA 2V26A 5L3GA 4A3JJ 5EGOA 3ZPLA 3JCMg 3FDYA 3ULQB 3CBOA 3L2RA 2WAQN 5J3BA 1Z0XA 4M77D 4QLCU 2F4IA 1AWXA 3R6SA 4CHUA 2QUFA 1RIOH 1RAIB 4ZH4F 4DEYA 3M56A 1ODDA 3HKZN 3PGGA 1W4MA 2ZBKA 3MWMA 1B8IB 2RQRA 1K4US 2LCCA 1S1NA 4OMMA 1KD1C 1YLFA 4KT0E 5KH6A 3ZN1A 3FISA 3HL2A 2EAYA 3CCUT 1O4XA 2BUDA 2HKNA 2Y4XA 3TREA 5KCHA 2Z9OA 4BY6C 1VQNQ 1PRLC 3QKJA 3JRHA 4FASD 2DODA 3ZQLA 5HK3A 2KMUA 2P0WA 4PFZA 2XHCA 2EQKA 2RHZA 2QQAA 4LXCA 3GFLA 3G6EQ 2L02A 1Q81R 4BB7A 2KRNA 1TWHJ 2FJ1A 2KY9A 1ETYA 1SPKA 1WDXA 2KVQG 1JXOA 2J05A 2GA2A 5KYUA 3H5NA 3M0UA 3G4ST 1VQLT 3FXUA 1NG7A 2WBMA 4N9IA 2PX9A 3OYAA 3ZP5A 2VBXA 2UZKA 1W70A 1BI0A 2DETA 1OV3A 5A0LA 2J06A 1Y8RB 3SZGA 2P0KA 1ACMB 3MP8A 5IYBJ 3JB9G 1ZG1A 2GOMA 3VS1A 3WE3A 5GAMd 2D45A 4PJOC 4R79A 2A5YB 3H9JA 3DTEA 5LJ3f 4XLFA 2O0YA 4D7NA 4XMYA 1RESA 3F8FA 2A07F 1FYNA 3VV0A 1NBEB 2YRVA 3BFMA 2QEXT 2M1HA 2WADA 1G6NA 2H1LA 5GPAA 2A28A 3JRAA 1TL8A 2EFQA 3H9NA 3A03A 2NVYJ 3V4GA 1WXTA 1S7AA 1WH7A 4EM1A 3ISPA 2L54A 5E18F 4OGCA 5IXBA 4HG2A 4QTRA 2R7OA 4BI4A 2KROA 1WA7A 3W6VA 2ZCWA 4E6RA 4XU3A 1XDSA 2IGNA 2PQWA 1SHGA 4N0BA 4HSRA 2E64A 3CCLT 2LT4A 2BW3B 2X85A 2ZJ2A 5FKKA 1SFKA 2EPFA 5LEKA 1AKHA 5FW9A 3J80E 2LJ3A 2OTJT 3QPTA 4IZZA 3GZ6A 3UKGA 2K2VA 2TDXA 1A04A 5AONA 5TRDA 5IPAA 3HSRA 2DA4A 1D1BA 4KISA 1RKWA 2A61A 4MMLA 2PUKB 3E6DA 1ETWA 1TWBA 4BY1J 2FZCB 2KJCA 2HBPA 4QT7A 5GJVB 1KA8A 2L7ZA 2LRDA 3MPUB 5GAN6 4K11A 1SRMA 2LVSA 2MG4A 1DU0A 2DDBA 3JCMQ 4M7AD 2HS5A 1QCFA 5F08A 2CP5A 2XGXA 4IUTA 3HTRA 2HZTA 3DPUA 3WTWC 2XROA 2E60A 2YDLA 1GCPA 1RETA 3EFSA 4CYCA 3OYIA 2HQEA 2RN7A 1KC8C 4S05A 1JJ2P 3BTIA 4BXXJ 2WB1A 3HPHA 3FEOA 2A6EF 1LDKB 2PBIA 1ZBJA 3L1AA 4H4KC 3QHSA 3EAEA 5D6YA 3HBLA 1B07A 1EFNA 2ZXWH 3KP5A 4D8KA 2VOPA 5GAN2 5GAMh 2NNNA 1JKOC 4HKEA 1X75C 4II3A 4XNFA 3H41A 4M77F 4MZTA 3GPLA 3W2VA 5A2QK 3BW1A 2FVUA 1WJAA 4XLNF 2VQLA 4X9CA 2NUPA 1Q1HA 2A36A 1PJRA 2F5CA 3KUFA 3QOPA 3Q3SA 3VDXA 4NS5A 1K1ZA 1OYYA 2K4JA 4DYRA 3H9GA 4BQQA 3L2VA 1WJCA 4W1UA 1QBJA 4MFEA 4PLLA 1KYZA 2ZNYA 3F72A 3KP3A 1PVEA 4HW0A 4BACA 1K61A 1IRZA 1CKBA 4M77E 4M77G 4U0YA 2HD0A 2QVOA 1EH6A 3GW2A 1N75A 3DP7A 3GTQJ 1UGVA 4NL3A 3M1EA 1ZELA 3BR5A 3CCVI 3ERED 3F21A 2LJ0A 4OWRB 3ECOA 5DEQA 2M45A 1XCBA 2R7WA 4RS8A 1M8MA 1F36A 2EK5A 3E19A 5DCMA 3VS0A 2HU9A 4A4EA 4M75B 1UG0A 2ZPEB 2EQIA 1ZSGA 1BOAA 4AVPA 4B47A 1VFCA 4OMPA 1YS7A 1OX8A 5ERIA 3GCMA 4CICA 1Z9QA 2EYYA 2FRYA 3TSZA 4B1RA 1YJWA 3CC4A 3E0JB 4RG8A 2D5VA 5ECAA 1JRIA 3I64A 3OSSC 3TO7A 2VKVA 1XN7A 3GVAA 1H8AC 1UG1A 4YIFA 2E2HJ 4M77A 2LK2A 1KQ0A 2EKHA 2KXDA 2K5IA 2D6FA 2MH9A 3NAUA 1IN6A 3CJRB 2CP2A 1W1WE 4EATA 2AHJB 1XD7A 3A5ZB 2DXTA 1BIBA 1RI0A 3CCQT 2HL3A 1ZSZC 3A0BC 4O5VA 2OQRA 1MBJA 2AT1B 2A3LA 3GBQA 3DKXA 3JB9I 2EYWA 1SSFA 2FBHA 3O8GA 2IGKA 1LFPA 5CVVA 4XTWA 4ZN1A 1B9NA 1PRMC 4QW2A 2FQ4A 2GQQA 3FMSA 3UATA 2ROTA 3N5BB 3OW2P 5BQTA 1IXCA 5F0CA 4XSZF 1Y1VJ 1YYVA 4XONA 1MMSA 2DX1A 1MGTA 1Q7YU 1MBEA 1ZYRF 3I5RA 4ESRA 3FWEA 4LOCA 3RZOJ 4KICA 3RKXA 2RHXA 4M73A 2LG4A 2P7VB 2GTJA 1VQ7T 2DYRH 3WGHA 1H3ZA 1WJDA 2HZDA 3BPVA 2W7NA 4MQ9F 4G7HF 1I1JA 1VQ4A 2F48A 1IO6A 2IG0A 2R5ZB 1PSFA 1PP7U 1KC8R 3HB9A 4J9HA 2EJGA 2EA2A 1Q95G 4M3FA 1FIAA 4LMYA 4M6VA 4U0VA 3ZQHA 4E7IA 4BY6B 1OEBA 2G9WA 1AWOA 5KNLA 4M77C 3PIOF 4HV6A 4IHTA 3SDBA 3HHTB 1Y0UA 2D2WA 3S1RJ 3CPFA 1P6RA 1TS9A 3M8FA 2LY9A 4BI8B 1VQ5Q 3I5SA 2K9LA 3ME9A 4RMOA 1G4DA 3FDRA 3A2KA 4KMUX 2EVRA 2P5KA 2EB7A 2DA9A 3CCYA 2KDZA 4KFCA 1NYGA 2CKKA 2R5MA 3L2UA 3H36A 3UR3C 4BJ5C 2NVTJ 1M3CA 2PZ1A 3QJYA 4LDYA 1SFOJ 3NTIA 3RR6A 1VQ6Q 3KX2A 2E5NA 3QP6A 4YRVA 4BE0A 1G2HA 2RNGA 5TGTA 4A93J 1NPPA 5E3MA 2R58A 3QYBA 3WHCA 1FYKA 1M90U 4UNOA 2KMTA 2G0EA 1RPWA 1HC8A 2V1NA 5JVGF 1M3AA 4FYXB 4P5NA 2O9LA 3CCJA 1JHFA 1C1AA 1B4AA 1B34B 5KYXA 5ICEA 3DEUA 3M0TA 1G5VA 4XTUA 2X9DA 5GAOn 2ZSIB 3J80R 3C7JA 1SFEA 5EEGA 4BEHB 3LA7A 4HF1A 5J39A 2Z2SB 4WF2A 5TJJA 4XLAA 3RPUA 3M4GA 1AWCA 4J7FA 3V8KA 2E5KA 3CCEQ 3A02A 5GANh 3EG2A 4WCIA 1R4MB 1UHMA 3KFVA 5F64A 4RDUA 1YJWI 1Q1VA 2LBFB 4R8HA 4CCKA 2CZ0B 2VYTA 3NARA 3CC4I 3JAME 3HRUA 3AHUA 4RB1A 3RERA 3CXCP 1LB2A 2GBYA 1AA7A 2DCEA 3HYIA 4L9VA 4Y91A 4M7DD 1R7JA 1S7OA 2FOWA 1FJLA 2CO5A 3SJMA 3LFUA 1Z3XA 5IOZA 2L01A 4UB8C 1KQ8A 1VQ8A 4XKCA 5FFZA 1X2NA 1LNWA 2FQ3A 1MIJA 2LREA 2ZFUA 4XL9A 2GXBA 2LVMA 2QDLA 3IQLA 4HXJA 4LD9K 4LB6B 4HQMA 5J1UA 3UPUA 1M27C 2NOJB 2F4OB 4FX4A 1QVTA 2AQEA 2MOXA 3KFWX 2JTMA 4FYWB 1ZUYA 1FP2A 4KN4X 1X27A 1BCOA 1YNZA 3VYUB 7AT1B 1FOKA 3OYHA 3J7AY 2NAZA 3CCRA 4L9JA 3WU0A 1APLC 2YUSA 4FETA 2ZJQF 9ANTA 4JRIA 3FM5A 3G1MA 4HVUA 1O57A 1VI0A 1VQMQ 2XD0A 3NTHA 3IWZA 3NWTA 4GBQA 2NVQJ 1K76A 3QYHB 1VQOA 2DTZA 4RGRA 3GBGA 2R5YB 4RB3C 1T0FA 3S3NA 1VQ4I 4JX6A 3S1MJ 3CMAA 1QP2A 1AKHB 3KE2A 2M9UA 1X1PA 1ZK8A 1K78A 1M2VA 3M4YA 1IJWC 2JVVA 3QWXX 3HG9A 2BE7D 2VT2A 1KSWA 3DF8A 5GADJ 4ENJA 2K02A 1U78A 1M1KU 1U06A 1K0XA 3HZJA 1WI3A 5CO7A 5GAMj 3L00A 5LEJA 1GV2A 2Z99A 1SC7A 4CDGA 3N05A 1MSEC 2RQVA 2M7BA 3PIPF 3G7ZA 3MCZA 2DYSH 3K4BA 2QA4Q 3UNGC 3DB3A 4BXUA 3LWIA 3VRYA 3N97A 4MTEA 3MP6A 5DS9A 1FT9A 4KT6A 1K9MC 2F6CA 3F8MA 3G73A 2YRCA 5A0DA 2JVHA 2RA2A 5J26A 2JM9A 4NBQA 2ZPHB 2D1XA 5DLOA 1QRYA 2XPUA 1X2MA 1Y7XA 3S8PA 2RF0A 4JJDA 3W2WA 2IJLA 2IS4A 1D5VA 1NG2A 2LF8A 5GAOl 4Q5WA 3SWNC 2ZMEC 2YUOA 2B86A 3CCJI 2ZNZA 3H92A 4ZYHA 2EFWA 5HODA 1E2XA 2PG4A 4KIGA 2DL3A 1P4XA 4JS4A 1DP3A 4OMYA 3M55A 2HEOA 3CPWA 1B1BA 5FJ8J 2CV0A 3VYGA 3GP8A 2XC7A 2LNHB 4F92B 5HLGA 3CCVT 3S2WA 4YEJA 1M2OA 5FD5A 1GXIE 2X4XA 1YITA 4B43A 3PFIA 2MUNA 2KT0A 3SFZA 1BC7C 4Z88A 5B66C 1IW7F 4WCGA 3V7SA 1T0HA 3MEVA 4BAYA 4M7AF 3A1YA 3QPSA 4RB2C 1R49A 2E3HA 4HT8A 1M9SA 2NRAC 3EHQA 4JP0A 2M9HA 3ZQ7A 3A4CA 1E6HA 4LE9A 1U5TC 4M7DF 3R61A 4ELYC 2FMLA 4KN7X 1YHQQ 4TVRA 1VQ8I 3BCBA 1DGRM 5D5WB 2R7TA 2Z1DA 1NPRA 1QVPA 1FIPA 2HDDA 2E19A 5GTHC 2JA8J 1OZ2A 1ZGWA 3OYDA 3IH4A 1PUEE 4I76A 1ULYA 3MKYB 3R6OA 4XTZA 4F14A 4M7AE 3L09A 4U7DA 2MI6A 3A98A 3BDDA 5D6XA 3GX4X 3I4MJ 2GFUA 3BZKA 3H0HA 4KGXB 2DA7A 3TVTA 3JRCA 2XPVA 2DYIA 3CCUA 3CMEQ 4CCOA 4M7DE 3DKWA 2HCKA 4FQGA 4M77B 3W3CA 3CCRI 3M0PA 2M5WA 1FYLA 1UDLA 3D5LA 1M1FA 2QSHX 1HDPA 2YR2A 1GXQA 2ELJA 4NDLA 1UGRB 1MGQA 2XDPA 2W00A 2VONA 1K6OA 2EFIA 1V4RA 3CCST 3I35A 3SEZA 2KHMA 4F93B 1VQOI 1YBYA 3LSIA 1MJBA 4G12A 1IAWA 3RDVA 4C0DC 1K73U 4MQVA 1UZCA 4HSTA 1VQLA 3G4SA 3CMAI 3CZ6A 3HUGB 1O3SA 4LLLA 3LA2A 4X1VA 4M7AA 1XB4A 2F5KA 3NHNA 2QGUA 2ED1A 2OTLT 2DOEA 4NC6A 1HOMA 5IT3A 1IXSB 2DTOA 3G1JA 1SHFA 4J9FA 4P9FA 5BNGA 2EIKH 3RKWA 5KVRA 2QCOA 2P5LC 4IHWA 5JI6A 3KETA 2A69F 2ADUA 4CA0A 3JAMR 2K5CA 1YW9A 3WG7H 4WK8F 4C5EA 4PZJA 1XMKA 1UJYA 3GZNB 2CW8A 3DBHB 4J5YA 1J09A 1BR2A 3QP5A 1FOYA 2G7UA 2Y69H 3VYSB 2V1UA 1WGSA 2DIQA 4OB1B 4BBSJ 3DEWA 1J9IA 3QG1A 1IHWA 5FKMA 4CCLA 1QLYA 2KXCA 4IRIA 2Y4YA 2EA4A 5E79C 4OMLA 3GOXA 3BR0A 5DUKA 3ZQGA 2KAFA 3MZHA 4F3QA 2P0QA 3LSRA 2BE9B 4B4CA 4EEFG 2N8GA 4XN0A 1ZRFA 3S17J 4RUGA 1NK2P 2OTJA 2W82A 2LFBA 1W5SA 2M7AA 3WTXC 4WWCA 2VLAA 4CH7A 1X6BA 4E7KA 4DEXA 1K83J 2RMOA 4N0AC 3GTGJ 4UUSA 1FMWA 3NFCA 4ELZC 3CCMQ 3L2WA 3E5XA 4LGWA 4UY8I 5GMKe 4XR6A 2XDVA 4MZMA 3FXMA 4CC7A 3M4OJ 1SEMA 4KIBA 4ZYAA 3I5UA 4YG2F 5LD2C 1YITI 2JNGA 1TNTA 3G71Q 1DGWY 4M7DC 2F2VA 1IO2A 2E1HA 5D4SA 2DZCA 3I58A 3L7WA 3F3XA 4R55A 2COMA 3ZOBA 3GEZA 2WY8Q 1TNSA 1V5FA 3GNGA 1UECA 3F8BA 1YJWT 3TEDA 2JA5J 5IAYA 3O8VA 3K2ZA 5IT9R 5KCOA 1UCRA 4D5CA 2KNBB 4NC8A 3LH0A 1IG7A 1VYTA 5KHDA 1V55H 4RCCA 3UF4A 1X3UA 3HJEA 2K79A 4C8QG 5BPIA 5FLVA 2Y2ZA 4P55A 4RGXA 4HF2A 1TUDA 1WHLA 5EC7A 1X4OA 3SFIA 5C3EJ 1UGPB 1F5TA 2VXZA 2UV1A 1D8KA 3L2CA 2EQJA 2K57A 4JJBA 1NJIU 4C92D 3ZMZA 3K0LA 1BJZA 2JJ9A 5JLWA 2WSCE 2GNCA 2V1DA 2GXGA 3RCOA 1FX7A 3KZIC 5A0GA 2DMUA 4DIQA 4IOAF 4Y4RA 4X9DA 1QW1A 3T1BA 5FU6C 1E3HA 2L9NA 3BJ6A 1O3TA 2GBQA 1ZRCA 2HMAA 2I2LA 4EJUA 3VWBA 3AL0C 2M0OA 3KP6A 1NHAA 1JXSA 1PWTA 2ED0A 1JXMA 1U8RA 4C8QA 3QSUA 2K9SA 5HS7A 2KISA 1E6GA 2O88A 2XMFA 2DVEA 1J3TA 2Y31A 2XK0A 4NB5A 3G4SI 1WHGA 2DL5A 1PG5B 3SEMA 2WAEA 2MWPA 2VOOA 2EINH 1Y71A 4MTDA 4ZN3A 1VQ4T 5GAN8 1MBKA 2DTRA 4HLXA 5J8FA 3BY6A 3C3WA 3HSFA 1MBHA 1HKQA 5M5YJ 1ZRDA 2ZMEB 2KIFA 2G3RA 5FKLA 1R9TJ 1HYOA 3O5ZA 3SWNB 3CCUQ 4IVNA 3BOQA 1Q82C 3I4PA 1Z6TA 1XSVA 4UVAA 1GXPA 2Y90A 4MLOA 4EMKC 1TU0B 2NOGA 4L6V5 1WI9A 4KITB 3QU3A 2RVCA 2KI7A 1M2VB 4LN2A 4AMCA 4XK8E 3TW6A 2W25A 4L5GA 3EH2A 2HSEB 3URGA 2DQLA 2E7XA 3H9QA 4L9NA 5CPRB 2CZ1B 3QDRB 4A5NA 2O61A 1TBXA 3QIIA 3CCQA 3SZTA 3E9FA 1VQLQ 1AHJB 5BOXA 4C3HJ 4IX7A 4LG0A 1GBRA 1A31A 3JB9J 3VEPA 1I3AA 3B02A 1OFCX 5CIUA 4M72A 4XBFA 5TISC 5I22A 3AG4H 3AAFA 1BI3A 1U5TB 5IP6A 3BG7A 4PFPA 4YIIA 1WZ2A 2MWOA 3WXMB 2IPOB 2XSDC 1SFXA 4RTUA 1GCQC 2HWVA 1XOVA 2QEXQ 1P4WA 2LQWA 2JUFA 2AXTC 1W0TA 2QBYA 1ZA1B 2DL4A 3DPTA 5DTDA 2GQIA 2CSQA 2F69A 5F1RA 4F04B 4AD9A 2CQKA 2DK3A 5DD4A 2G7HA
chains in the Genus database with same CATH topology
4HT9A 2MLKA 1YS6A 4A5MA 3E5QA 4HX4A 2JRTA 3A8MB 4J8OA 4BHPA 5IT9Z 2DFIA 3RMQA 2EFNA 1I1GA 5DD8A 5LJ3g 4C0DB 3RIRA 2W84A 1FC3A 1LEBA 3WU1B 1R36A 1U1TA 3L42A 1FZPB 1HSJA 3SZPA 4C92F 1W7PA 5GANg 2YLBA 3I56A 5LRSA 1M1KU 4FU6A 2MA3A 3RPQA 5E1ZB 4GXOA 2DQRA 4KIFA 3JB9D 3CCRT 5GAMf