1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
b'DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPHTHERIA TOXIN REPRESSOR
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
4NQWA 1I1SA 5DV5A 4FX0A 3FXQA 5A2QZ 4GCVA 2UZKA 4OU0A 5ILSA 3E5XA 3KP7A 2DW4A 2PEXA 3HTUA 4OIQF 1W7PB 2IRFG 5LHHA 2FOKA 4HW0A 2STTA 3BROA 2ZBKA 1P4WA 4EM0B 5H20A 2DT5A 3Q5FA 2K86A 2CSOA 3F8CA 3JAMZ 5BOXA 1YS6A 1BIBA 1B6AA 5J6XA 2XAHA 4A6DA 2RNJA 3GFIA 1YIOA 4PDKA 3V7RA 5D5WB 5CVJA 1Z6RA 3QRFF 3GFLA 1QO0D 2OU2A 3RI4A 3N4MA 1FBSA 3P9KA 1JE8A 3J7AO 1KGSA 4MTDA 2PFBA 4N0BA 1BI0A 5AIPA 2HOEA 1SFEA 2HTJA 2E7WA 5KVRA 4LK0F 4BQAA 3ZMZA 3LQQA 2K02A 2JPCA 4L0ZB 3I64A 2GXBA 4MHGA 1BI1A 4L9VA 5KK1A 4L18B 4IRIA 1F9NA 2A69F 1P2FA 4U7BA 2PBIA 4HX8A 1L3LA 2HS5A 1FBUA 4U0VA 3V8JA 3E97A 1S6LA 2P4WA 3LA2A 1GXQA 4KICA 2G9WA 4O3MA 2E1CA 2KJCA 1AOYA 4HF2A 1R22A 3GO5A 2LSOA 2K5IA 3M9AA 5EEGA 4ESFA 2W25A 2RGVA 2EK5A 3BP8A 1HBXG 4UUVA 2QBYA 1FNNA 4HDVA 4G7ZF 3GLXA 3F23A 2VBYA 3WG9A 2ZO4A 3F8BA 2VBXA 1ULYA 3N97A 1IZ1A 3JTHA 2RVCA 4KFCA 3I71A 3I0TA 4XSXF 1F4KA 3HIFA 1KYWA 3U2RA 2KIFA 4EM1A 3KZZA 1GVJA 2ZMEA 2L54A 2UXNA 4M9XA 3MCZA 5DD4A 5LBQA 2PJPA 1S3JA 5CVUA 3DP7A 2XGXA 5ED4A 2IVMA 3K1MA 5LGTA 3DKWA 5D6FA 1PP7U 1BI2A 1MD0A 1MZBA 1CGPA 4N9IA 5E1XA 3MWMA 3TOAA 2FSWA 4I7HA 3ZMUA 3BZ6A 1IAWA 1J2XA 1XN7A 5LGUA 4AIHA 4L0YB 3RTRA 3VEPA 3F21A 2VE9A 2NAZA 5LRRA 4RGUA 4Y13A 2CWEA 3HOTA 2P6TA 2DQRA 4WK8F 4LG0A 1IN5A 5L3GA 2ZJ2A 3J80K 2IA2A 4HAMA 3ULQB 4UV9A 3TO7A 5HDGA 2OZUA 1MJBA 1R23A 2EV6A 4EGYA 5ILVA 1Z6TA 5F1RA 3HRTA 1PDNC 3QPTA 1J59A 4P55A 2J5PA 4GYGA 1ZLJA 1B59A 5E8IA 2IPQX 3KEOA 2QM3A 1YTYA 3SZTA 4RB0A 4Q48A 2V79A 3GW2A 2JPBA 1HW5A 3EDPA 1O7FA 4XSZF 5D4RA 4G7OF 2K5FA 3KP5A 4LB5A 5HS7A 5LHGA 1U78A 4KT5C 2DQLA 1D5VA 1BIAA 1YS7A 2XHKA 3I58A 1FSHA 3MEXA 3GZ6A 4ZZDA 4I09A 2AS5F 1R7JA 2G7UA 1XB4A 2A07F 2FMYA 4ESBA 1ZG3A 1LDJA 2PG4A 3GFJA 3EUHA 4HQEA 1PP8F 4EMSA 1P92A 1U5TA 1UB9A 2D45A 3GXOA 2CW0F 3R0JA 4EJWA 2H27A 4RB1A 5E18F 4I0AA 1SAXA 5FD5A 2FEZA 1R5HA 5DCMB 1ZAOA 2HKXA 4YIIA 2EFNA 4HF0A 4QLCU 1WI9A 2Z9OA 2DO7A 4AVPA 1SMYF 2EV0A 1YO5C 1GHCA 3ABUA 3T5XA 4R8HA 4RGXA 4E70A 2EA2A 3CTAA 3HYIA 3TGNA 4Z2YA 3F8NA 4EV0A 1TQIA 1BOAA 1LEBA 1SMTA 2WWYA 4HV6A 3WGGA 5ICEA 1D8KA 1D8JA 2ELHA 4A5NA 5D8LB 4BH9A 4N9HA 2FBHA 4HX4A 3IKVA 2CFXA 2XRNA 3WTVC 1ZN2A 2A5YB 1Z05A 2KKOA 4CXFA 1T0FA 4YFXF 4IHTA 1QBJA 1BN5A 3RYRA 2Q0OA 4WF2A 2L3DA 3RJPA 2XAQA 1G3TA 1OMIA 1SD7A 4HOBA 1JHFA 3OOPA 3HSEA 1T6SA 5HVQC 1ODDA 4JBAA 3BWGA 1YW7A 5FD6A 3RKXA 2BYVE 2HFHA 4Y17A 4ESJA 1T39A 3TKYA 3O6BB 3GFMA 2H6BA 3CLOA 3SQNA 1IXCA 4M9SA 2VT3A 5FB2A 4MEXF 3RPQA 3EYYA 2QLZA 3ML6A 1YQAA 3IHUA 4KUMA 1FPQA 4KYWA 4I02A 2HYGD 1DPRA 3H3UA 5BS6A 1Z1DA 1UFMA 4I0BA 3FZVA 3CDHA 2ETHA 3KP6A 4CZZA 3RIRA 2DU9A 4M71A 1XSVA 2PLYA 1SD4A 4BXUA 1XDUA 4RB3C 3IRRA 5DCFA 3COAC 1G6NA 5CVVA 4A5MA 2QYOA 1R36A 2FA5A 1I1GA 1S7OA 3TDUC 4AD9A 1G4DA 5ICGA 4ON0A 3ZMDA 3BJOA 1FYMA 3RKYA 3ZPLA 4EVIA 5LEKA 2D1VA 3IWZA 4IRGA 2QENA 4OIRF 3C1DA 1FC3A 2MH9A 2F5EA 2WTEA 3FMRA 2Q2EA 4RAZA 4LFUA 4MTEA 1TTYA 3WTXC 3JTGA 2H6CA 5J8CA 1TQMA 3WTWC 2IA1A 3ECHA 1XMKA 1S29A 2R3SA 1HW2A 2IJLA 4P5OA 1RZ4A 1W5SA 4ENMA 2VC0A 4ZZLA 2O61A 4WCGA 3EETA 3L9FA 2XAFA 2BE5F 4AIJA 4ZYHA 3P9CA 4L9TA 4RS8A 2PMHA 2ZMEB 5HLIA 4WXHA 5IT3A 4OMYA 4HV5A 2PI0A 1EH7A 4LLGF 3R0AA 4RGSA 3GF2A 1QQIA 4PZJA 1BM9A 1XSXA 1G3WA 3W6JB 3HOSA 3F6VA 5FFXA 3BOQA 3DEUA 3CUQC 3WTYC 3T8TA 3DFGA 2QUFA 4MQVA 1PUEE 1KQ9A 1OYIA 5L3CA 1V4RA 1CF7A 1JHHA 2L4MA 3QPHA 3IKTA 1U3EM 2FE3A 5BPIA 2MLKA 1MKMA 1ZHFA 1JGSA 3QU3A 4KNYA 2XV4S 2C6YA 3AAFA 2A6HF 1LEAA 3ELKA 1YG2A 3M7GA 1FYKA 4LG0B 5HLHA 4GYIA 4JQFA 5E17F 3I4PA 2MH2A 2YR2A 1E17A 3HUGA 2EFPA 3DXJF 3CO7C 3IWFA 3L7WA 4O6JA 4U7DA 1K78A 4KN4X 3BY6A 2XKOA 5FLXK 5E1WA 1H9TA 1ONVA 3LWFA 2OBPA 2P6SA 5E8GA 4ZYEA 3DPTA 3KZYA 3G73A 3F72A 3J80Z 1ZG1A 1K6OA 1UCRA 2M30A 2YU3A 2KIMA 2PMUA 2EV5A 3P7NA 4HZFA 1I5ZA 2GA1A 1KQ8A 4ZH4F 1OPCA 5JFRA 4UV8A 2FBIA 1F1ZA 1IN8A 1KU2A 4OOIA 2Y75A 2G7HA 1AWCA 4LGWA 3ZP5A 2RQPA 2CO5A 4CYDA 4FT8A 5JVTA 2M8EA 1E2XA 1KU7A 2GQQA 3HRMA 1QVPA 1TW3A 3TO6A 5DUKA 1U5TB 5ICCA 3C18A 2J5OA 4A6EA 3Q9VA 5DYMA 3WGIA 1FT9A 3U9GA 1R1UA 5TRDA 2PQ8A 2RDPA 5J8FA 3ABTA 2EFQA 2COMA 5L3BA 3K9TA 4S05A 3E6BA 3M8EA 4K2EA 1XDSA 4P96A 3FWEA 4OINF 1DP7P 4FHTA 2K5LA 1VTNC 2LF8A 4S04A 4GGGA 4ZYGA 3V4GA 2RKHA 4KIGA 4UHTA 3DPLC 1YFHA 4WXCA 4MGRA 1Z91A 2MA3A 2O03A 3B02A 1D3YA 3HHHA 1JXSA 1O57A 5DDGA 2JTVA 3J81K 1DPUA 4RAYA 1A04A 3QP5A 1J5YA 2DLLA 2TDXA 4PGHA 3E5UA 1WRJA 1X3UA 1IUYA 4CDGA 3ZMTA 1IW7F 3T8RA 2DI3A 3RYPA 4U0WA 2VOOA 1FBQA 2KRFA 1ZGJA 2HGCA 1LVAA 1XD7A 1TQPA 1FYLA 2DTRA 4BHPA 4YFNF 1TNSA 2L4AA 1R1VA 1HSJA 5D4SA 4MNUA 2HEOA 1HXDA 3H92A 3SZPA 3ERED 4KMFA 2VC1A 1EV7A 4RGRA 1B4AA 2W24A 3U1DA 3F3XA 3GZ5A 4JK1X 1ZRDA 2HDCA 3FMSA 2Z99A 2MBFA 4YIFA 4B8XA 2OZ6A 1RUOA 3MQ0A 2FRHA 4P9UA 3CO6C 3JW4A 1ZRFA 3JSOA 5FFZA 1YW9A 1O7LA 3WTUC 2Y48A 5HOOA 2OAZA 1ZYRF 4KN7X 1OYYA 4EQQA 1MDMA 3KP3A 3BDDA 2EB7A 5HS8A 2HQNA 3L2CA 1QPMA 2QWWA 2IW5A 1WSUA 1W7PD 2Y0MA 2W84A 3HTSB 1FZPB 4G94A 5D8KB 3WTZA 3MZHA 3KETA 2F2EA 2XVCA 2XASA 1ZRCA 4IVNA 2DPUA 2H3JA 1ZH5A 3S2WA 2HKOA 3KCCA 5DUIA 3KE2A 2NNNA 2EFWA 1RI7A 4HX7A 3T0YA 4UVAA 2XIGA 5D5XB 4H0EA 1USSA 2FNAA 1O3SA 1RIOH 2BEOA 1NHAA 3LQRA 2RN7A 4UNOA 3RKWA 4NHJA 2QVOA 5CVIA 4OMZA 1IN7A 4DQ2A 2OA4A 2CG4A 4ASNA 1Y0UA 1IRFA 2XKPA 3I53A 4UVBA 1QZZA 4MEYF 4NB5A 3O3KA 2VBZA 3HRUA 2X4HA 1CF7B 3F6OA 1R5GA 3JSPA 5HDNA 3DQVC 1J7KA 1T38A 3MZYA 4IJAA 3ZMSA 3GYHX 2LX9A 4UXNA 5E1ZB 3GX4X 4EM2A 3SFZA 1U2WA 2XUBA 1Z7UA 3EQLF 1BC7C 1UHMA 1ON2A 4Y15A 4BAYA 1H9GA 2VODA 3E6MA 2GZWA 2LF7A 4MQ9F 4M6XA 3FX3A 1BYMA 1V3FA 1O3QA 4CO8A 1K78B 1EH8A 2OQRA 2ZFWA 2QQ9A 2HQRA 4G8XA 2H09A 2E7XA 3IL2A 5D5VB 4O5VA 1IN6A 2D2WA 3VFZA 1LDDA 3BPVA 2A68F 1FX7A 1I6XA 2ESHA 2E1NA 2JRTA 2FBKA 3QP6A 3GUDA 2ACJA 4OIPF 2CQKA 3R4KA 3E19A 5FLXZ 2V6CA 3IRQA 3BJAA 1YLFA 2P5KA 1B9MA 1J0RA 2FU4A 3G3ZA 2FQ3A 1STZA 4KA4A 1FOKA 2ISYA 3NRVA 1USTA 1L0OC 2HR3A 2HZTA 1IN4A 1F5TA 2O8XA 1KA8A 2LKPA 2OD5A 4HQMA 4IRHA 1LB2A 2XAJA 4IHSA 3LAPA 5ERIA 1MGTA 5K5OA 3OV8A 2Q8KA 1HKTA 5FO5A 4KDPA 3PQKA 2W85A 4L9NA 1IRGA 4FX4A 1Q1HA 4WWCA 3CUQA 3KP2A 5H6RA 3I59A 5CYVA 1KU9A 2F5CA 1XCBA 3ZMVA 3BJ6A 2P7VB 1TW2A 2Z5UA 5CVRA 1ZLKA 4HLYA 2OQGA 1QGPA 2ZNYA 5BPDA 2HTSA 1P6RA 2YPRA 4A0XA 3LA7A 3K69A 1FLIA 3CJNA 3RDIA 3FF5A 3LFKA 3ZN1A 4ENKA 2HYFA 3C7JA 2YX4A 2O0YA 1QW1A 3KLNA 2R7FA 3CUOA 1MJ9A 3P9IA 5LGNA 1REPC 1IXSB 2FMLA 2W57A 3WU0A 2DFIA 1R58A 2DAOA 1RUNA 4R1HA 5JHUA 4M72A 3K2ZA 4P9FA 3TQNA 4KMUX 2UXXA 4UVCA 2VN2A 2VOPA 3BPXA 3LAJA 4WXDA 3J81Z 3ISPA 1K79A 2WC2A 2K7LA 1RNLA 2WV0A 3V7CA 1SD5A 4ENJA 1XMAA 2F5DA 3PFIA 3D0SA 2FXAA 4GXOA 1OR7A 5FGMA 3WU1B 5IT9K 2IA0A 5CLSA 1FWZA 2DK8A 1LNWA 4TV7A 2QZ8A 4F7ZA 2VXZA 5F64A 5L3DA 1BBYA 1KU3A 2NRAC 1SFXA 3HSRA 2V1DA 2L01A 3H3ZA 4ENNA 3WE3A 3ZQ7A 1YW8A 4L5IA 1EH6A 3FXUA 2JT1A 2RC4A 5A2QK 3E6DA 4KIBA 3E6CC 3E5QA 2KJBA 1KYZA 2VT2A 4CGZA 2EJRA 4EGZA 5LHIA 1R1TA 3QAHA 3REOA 4M9ZA 1FP1D 2JSCA 4LJZF 2BBYA 2EFOA 5H6QA 1W5TA 4EJUA 1BI3A 1MDMB 4LK1F 3L09A 3MHXA 1G3SA 1HQCA 3TDZC 2PN6A 2D1HA 3JAMK 3VB2A 4BYYA 2GXGA 1ZREA 2FNPA 3IC7A 1W7PA 3I5UA 4L9JA 5L3FA 1Z9CA 1B9NA 4IF4A 1KQ0A 1SD6A 4ZYDA 4EJOA 4CICA 3PQJA 5HLGA 5LLQA 3M8FA 1U8RA 4XRFA 2HWVA 2MLGA 3C3WA 1LQ1A 3DF8A 3V7SA 1ZG5A 3FM5A 2L02A 5LRSA 1B1BA 4XLNF 2QQBA 1FSEA 3W6KB 2M5WA 3E3VA 1LJ9A 5L3EA 1LDKB 2Z3YA 4U0YA 3R60A 2P8TA 2IT0A 1HSTA 3Q9SA 4LB6B 4D0PA 5F6FA 3F8FA 3WODF 2DPDA 4IXAA 1TLHB 2LDUA 3TO9A 4HDUA 2K27A 2P7CB 4YFKF 5HS9A 4RB2C 3QOPA 3MAJA 5TJJA 4XLPF 5DEQA 5EEHA 2P5VA 2KIUA 4EJVA 1FP2A 2UWMA 1S8NA 3FMQA 3V8LA 1P4AA 2A61A 4G6QA 4M6YA 5ILUA 3EYIA 2GA2A 1P4XA 3ZN0A 1DDNA 4LLNA 3TOBA 4IPAA 2ISZA 4CHUA 1HKSA 1IXRC 2ZCWA 2O6GE 3L00A 3B73A 2XROA 2NYXA 3MFKA 1O3RA 1R00A 5DD8A 2F5FA 2H94A 2R7DA 2CYYA 3NQOA 5E20A 4HLXA 1W4MA 4Q5SF 2Z33A 3LSTA 4I01A 4G6DA 1QZYA 3QU6A 4GO1A 4PCQA 4G9YA 2ADUA 4A0YA 2EWNA 3R61A 5BMZA 2DBBA 1U5TC 2MD5A 4A12A 2V1UA 4BHBA 1G3YA 2B0LA 1HW1A 3GVAA 4I2OA 5BQTA 3FHZA 3WTTC 1YYVA 3WGHA 3WTSC 1XGSA 4HF1A 2X0LA 5CJ9A 4HYEA 2STWA 1T98A 1MJAA 2O3FA 1SFUA 4OIOF 2K4YA 1XSDA 2RV8A 4DNCA 5AONA 4G7HF 3CUQB 2GWRA 5AIQA 3I59B 1I27A 4ETSA 2YX7A 2BGCA 1XGOA 1J9IA 2QQAA 2ZXJA 1H0MA 2M45A 1HKQA 3I54A 2BV6A 3KEQA 3SXYA 3M1EA 3HRSA 4LD5A 2LNBA 4I98B 2VONA 2ESNA 2ZKZA 4WX9A 1O3TA 3D5LA 3WE2A 2VBWA 4EJTA 3LA3A 2GIVA 1GXPA 4A0ZA 1ZARA 5K1YA 5HDKA 4HBLA 2VE8A 2V1XA 2AXLA 2GAUA 2K4JA 3HHGA 1ZGAA 3GEZA 1WWXA 2A6EF 4BNCA 2M1BA 3GWZA 1QNTA 2CGPA 3FM3A 4AIKA 1XCVA 4PGGA 4M74A 3O2PE 4R79A 4Q47A 1DUXC 5D5UB 4LMYA 5K5RA 2DK5A 3K1NA 1XGNA 4M73A 5K5QA 3F22A 1OKRA 2IP2A 3KFWX 1TNTA 4A2UA 4XBFA 4KIFA 3K0LA 2K4BA 2XAGA 1ON1A 1FY7A 2NNYA 1S7AA 3ECOA 4YG2F 3DV8A 2V9VA 2YSRA 2A3SA 3FXRA 2FF4A 2P5LC 3V8KA 5JI6A 2EA4A 4Q4ZF 1WKMA 1BC8C 1WQ2A 2GCXA 3HSFA 3VOEA 3KP4A 3KLOA 3NEUA 1U6GA 5DCMA 4QWQA 1T2KA 5ICFA 2M87A 2JZYA 5LEJA 1UHWA 3R6SA 5IT9Z 4HA8A 2MC3A 3K1PA 1J75A 1C0WA 4L5JA 2ZNZA 3T1BA 4AWXB 1IF1A 1K7AA 3F8MA 3ROUA 5JR3A 5D6EA 1BJAA 4LLLA 4B09A 3RPUA 4U88A 1XGMA 4BHCA 1TBXA 6PAXA 3SHFA 3VODA 1OYWA 2QBYB 2NS0A
chains in the Genus database with same CATH superfamily
2E1MC 2PJRB 2EYQA 2YXYA 4NQWA 2OF7A 2IVWA 1D09B 2ZPEB 4N4HA 1CSKA 2R92J 1I1SA 5E3MA 1VQMI 1JXMA 2ED0A 2RQWA 4QIWN 1RLQC 5DV5A 3S1QJ 4FX0A 2DJQA 3FXQA 2NYSA 3TQ7P 2PU9B 3ZFJA 5A2QZ 2H8HA 1JO8A 1R9TJ 1PHTA 2ZPBB 4D5FA 4GCVA 2UZKA 1NK3P 3QJ6A 4C92E 3I9V2 3SEQA 5DTDA 4OU0A 3S8PA 4HVVA 5ILSA 3E5XA 4XU3A 2HYJA 3FJ5A 3CXCP 1B72B 1Y56A 3KP7A 1UEBA 3HOZJ 2DW4A 3ERMA 1RESA 4C9YA 1NYGA 3BDUA 1XNIA 1Y96B 1IXDA 3VYHB 3PFYA 2PEXA 1NG6A 3HTUA 4A3BJ 2O5RA 4OIQF 1QQJA 2E12A 1W7PB 3FBIB 2IRFG 5LHHA 2FOKA 3G1OA 1WZ2A 5CO7A 3GCMA 3CMYA 2R58A 4HW0A 3PIOF 1UHFA 1I1JA 3H0HA 3QODA 2STTA 4M7AF 3S16J 5A2QR 3BROA 3ZQIA 1BL0A 2ZBKA 3BG3A 1P4WA 4EM0B 2V6EA 2DLPA 3SWNA 4C5GA 5GAOp 1VQ5T 2O9VA 4EIKA 2XGEA 5H20A 2RHZA 1YJWQ 3KYDB 2DT5A 3Q5FA 3TP3A 3ZQCA 1JKOC 4C2TA 2K86A 3QHSA 4KH1B 1OCRH 2QQ8A 2GOMA 2CSOA 3F8CA 1X6GA 2CV1A 3JAMZ 2BOLA 5BOXA 2RHUA 2BY3A 3JCMe 1IRXA 2V4JC 2NVTJ 1YS6A 1NPRA 3DU6A 2R5AA 4M77C 1BIBA 2DA1A 1B6AA 5J6XA 2XAHA 5CK9A 1R4NB 4A6DA 5J40A 3LW5E 4A3LJ 1X01A 1IO2A 1UHSA 3RDVA 2VQLA 2RNJA 3NWSA 3GFIA 2XF7A 5JVGF 1YIOA 5EZGA 1TUDA 5LD2C 4HNTA 4PDKA 3CCUA 3V7RA 4M7DC 1HK9A 1AKHA 5D5WB 5CVJA 2HQAA 1Z6RA 3QRFF 3GFLA 1U3OA 2EGAA 1QO0D 2F6CA 2OU2A 3RI4A 1MSEC 1A0NB 2OTLI 3BQYA 3N4MA 1KFZA 3JAMR 1EZZB 2EGEA 1ABQA 1GXIE 1POGA 3QPSA 2V7FA 3OYBA 1FBSA 1OX8A 3VUZA 3P9KA 1JE8A 1UTIA 1VQOQ 1N8RR 3JRGA 1GLNA 3J7AO 3W2AA 2JA6J 3QBYA 1VQ6Q 1KGSA 1XTDA 4MTDA 5GADJ 3CBOA 2PFBA 4N0BA 3A01B 3M4YA 4NNJA 1BI0A 3LWHA 2OAUA 1WH7A 2P81A 1I6HJ 4OMFB 5AIPA 3JRIA 2WB1A 1RQ6A 4EDUA 2VPRA 4B48A 3P8DA 2HI3A 3PO3J 1YJWT 1VA7A 3Q0VA 5CR2A 1FIAA 3HPHA 1T0HA 1TUGB 2HOEA 1SFEA 3CCRQ 2DVJA 2HTJA 3BZCA 2E7WA 4V2SA 1K83J 1GCQC 5KVRA 1TWHJ 4LK0F 4BQAA 4E6RA 3HOXJ 5IAYA 2KFDA 3TEDA 3ZMZA 5GAN7 2NUZA 3LQQA 4RTYA 2DFHA 2EYZA 5LL6S 2K02A 3UF4A 1D1CA 3G6EQ 2JPCA 4L0ZB 3EGXB 3BTIA 1OYXA 2V8IA 3DKMA 3I64A 3S6WA 4PJOC 4PUSA 1SVLA 1M30A 3TREA 3OA6A 3SYTA 2HDAA 3A8LB 2GXBA 4PKCC 3JRDA 2KDOA 5B5EC 1VYUA 2E2HJ 4B3XA 3E0JB 2LBFA 4M3GA 2ATCB 4MHGA 2ZGWA 1BI1A 2AHQA 4L9VA 4IIOA 3TU4K 5KK1A 1YRNB 1MMSA 5IXFA 4L18B 3NTHA 4RLFA 4M78B 1YCSB 4IRIA 1F9NA 2A69F 2J6OA 3OYEA 1P2FA 3P8BB 2DA7A 2PMZN 3A03A 4U7BA 1E3OC 5LJ5e 2PBIA 3G4SQ 4M3BA 3PSFA 2CP3A 2LK2A 1KQ1A 4HX8A 1L3LA 2KPMA 2MD0A 3BFMA 1JKRC 2HAXA 3AG1H 4MMKA 2M0OA 2HS5A 1FBUA 3UWNA 3OMYA 1VQOT 2XKOC 4MIMA 2FZCB 2IG0A 5KE3A 2CV2A 1VQ6T 1W0TA 1WJ5A 4U0VA 2H8RA 3V8JA 1WGSA 3BG9A 2J6KA 5FWBA 1ZR4A 9ANTA 3E97A 2D6FA 5J4VA 5FROA 2BVMA 4I99C 2HEQA 4A93J 2L9RA 1D0ZA 2O4XA 4EPCA 1S6LA 2A05A 2LLKA 2P4WA 1GXQA 3LA2A 1E7OA 2MF2A 3CMAA 4KICA 2G9WA 1M2OA 1XOVA 4O3MA 5FU7C 2E1CA 5M9OA 2KJCA 3CCRT 4ZTFA 1QKWA 3JRCA 4AG2C 1AOYA 4C3JJ 3C94A 4J9HA 3RR6A 3RPUD 1FOXA 2ZJPF 4HF2A 1R22A 3S3OA 1D0YA 1R77A 4A3KJ 2E6ZA 2EBPA 5CPRB 2LT1A 2QQRA 1X4PA 2DTHA 3GO5A 4FW2A 4AMCA 4IURA 4OWRB 5EGOA 3G6ET 2LSOA 3BTCA 2KRSA 2LTPA 3M9AA 5EEGA 2K5IA 1NE8A 4OF1A 4ESFA 3JRFA 2W25A 4Z89A 1SHGA 4Y52J 5DLOA 2RGVA 4Y33A 2EK5A 2M8GX 3BP8A 4N4GA 1HBXG 1WI3A 1LFPA 4JX4A 2MG4A 1I8FA 2RF0A 3I5RA 4C3HJ 2QBYA 4UUVA 2L7FP 1FNNA 5B3SH 4J01A 2AIRB 4HDVA 4OMLA 4G7ZF 3GLXA 1HC8A 3F23A 3G4ST 1V29B 4Y92A 1DGRM 2VBYA 1QMCA 5GAOn 1YJ9Q 3CCET 1LKXA 3WG9A 3CC7Q 2ZO4A 2IPOB 2HQ5A 5C6SA 3F8BA 5J3BA 2VBXA 2ZFUA 1ULYA 3N97A 1IZ1A 1I4K1 3JTHA 2EJFA 4PJMA 5IT9E 2W82A 3A4CA 2GM4A 3JRBA 2RVCA 1MH4A 4IOCF 4KFCA 1T3SA 1X4OA 3BG5A 3I71A 2DD5A 3I0TA 2L0AA 3PSIA 2RO0A 4XSXF 3I55A 1F4KA 3PM1A 2Y9ZA 4DEXA 3HIFA 1KYWA 2HPMA 3U2RA 1U1SA 4HCKA 2KIFA 4EM1A 1QLYA 1GUUA 3KZZA 1GVJA 2ZMEA 2O7OA 3M8JA 2L54A 4G12A 3ZQQA 1HYOA 1NPPA 2GBYA 4LDVA 2X6OA 1HOMA 2UXNA 4M9XA 3HFNA 3MCZA 3I9QA 4AFUC 1MV3A 3LSMA 1X75C 1TZLA 5DD4A 4BJ6C 4JX6A 1WQWA 2DL5A 2FVUA 4S0HB 2MC4A 2KGTA 3DB3A 5KCMA 1LE8A 3JCMQ 2DETA 1WJBA 1FJLA 1A35A 1VQNQ 2LD5A 1SVOA 3PVQA 1S72Q 5LBQA 2PJPA 2Y31A 1S3JA 5CVUA 2LY2A 3DP7A 4BEHB 1YFNA 1K9MC 3CDIA 1VQ7I 2XGXA 4BI8B 5ED4A 2IVMA 3JR9A 1YX3A 2PMZA 2QA4I 4E7IA 3K1MA 2GF7A 3FRNA 5GAN4 4FTHA 1QVFS 4X9CA 2ECCA 5LGTA 3DKWA 5D6FA 4BBSJ 1WDXA 2A6TA 4D7NA 2DVEA 3FDRA 3M4OJ 1PP7U 1AZEA 1BI2A 1YJ9T 5A2QE 1MD0A 1MZBA 1C1AA 4RTWA 3CC7T 1K9MR 1B8IA 3QDRB 3DBHB 2K3FA 5GAMf 3RQIA 5E3OA 2IEKA 1AHJB 1CGPA 1R4MB 3INZA 2YT6A 2DXBA 4DBHA 4N9IA 2KT0A 2XHCA 3PGGA 3OBYA 5E1XA 5CIUA 1BW5A 3MWMA 3I3LA 3TOAA 4F55A 1LJOA 2FSWA 4I7HA 3ZMUA 3BZ6A 3FK7A 4IZZA 2DXIA 1IJWC 3K70D 2P4TA 1IAWA 2XSDC 3G71I 1J2XA 1XN7A 3OB9A 1YJNQ 5LGUA 5EJCA 2RPNA 2IIMA 4AIHA 4L0YB 5FKNA 2DTOA 3IH2A 1K73C 3RTRA 2CP7A 3VEPA 3F21A 2VE9A 2DXUA 2VC8A 4M4ZA 2NAZA 2ED1A 4J7IA 4MZPA 5LRRA 1RAAB 1MBFA 2LNVA 4RGUA 4Y13A 2CWEA 3HOTA 4M77E 2P6TA 2DQRA 4WK8F 1OQKA 2F2VA 2MUNA 2CQQA 1VQNT 3HTRA 1S72T 4LG0A 3JB9H 2NVYJ 1IN5A 5L3GA 2ZJ2A 3JAME 1B7TA 3J80K 5I21A 1MBEA 2IA2A 5KE2A 4HAMA 1K73R 3ZBDA 3ULQB 4UV9A 1MMGA 5F1JA 3TO7A 5HDGA 2BE9B 2EQMA 2OZUA 1G8XA 1WHGA 4PJLA 1MJBA 2BZYA 1R23A 2EV6A 4EGYA 3CCSQ 5ILVA 3LNQA 1Z6TA 1UG0A 5GANf 4X1EA 2DYRH 4ZGJB 1D1AA 2JA7J 5F1RA 4KGVB 3HRTA 2NOJB 3EGXA 3JCMg 5GAOr 1W6XA 1X6OA 3U23A 3HM5A 3QPTA 1PDNC 1XQHA 1J59A 4P55A 2CZ7B 3M53A 2DTZA 2J5PA 2FZKB 3BG7A 2ZC2A 2AZSA 2FJ1A 2X85A 2QASA 2WAFA 2XD0A 4Y4RA 1JTXA 2LY1A 4BQQA 4GYGA 1ZLJA 2QSGX 2HKNA 1B59A 3I4NJ 2B9SA 1UGPB 4XRMA 5E8IA 4WCIA 2DKGA 2IPQX 3KEOA 2ID6A 2QM3A 3M1CA 1N27A 1SFKA 1SANA 2MVTA 1TS9A 1YTYA 2AHJB 5A0DA 3SZTA 3BLYA 4RB0A 4Q48A 2V79A 2RI3A 1FTTA 1ENHA 2VGMA 3VWBA 4IQJA 1VQ5I 2YLBA 1IZ6A 1OPLA 3CC2A 3TVTA 3GW2A 2JPBA 4FSXA 1HW5A 3EDPA 3WG7H 2DEUA 4QQ6A 1IB8A 1O7FA 4PJOE 1UB4A 4L5GA 5J4YA 4XSZF 5D4RA 4G7OF 2CP5A 2K5FA 3KP5A 4NC8A 4LB5A 5LJ5g 3BCAA 2Q1ZB 5EG0B 2X4JA 1SEMA 5GAMe 1QZEA 1MBHA 5HS7A 5LHGA 1U78A 4JYKA 4JLGA 3EG9B 4KT5C 2K6DA 3CCST 1M5Q1 2DQLA 2CW8A 1ERDA 1D5VA 1D3BA 2V8JA 1RADB 1BIAA 1YS7A 2XHKA 3CP8A 3I58A 4ZJZA 1ZQ3P 1FSHA 1N25A 5FJ8J 2O2OA 4PFZA 2NUPB 4IQ4A 1QVFP 3OYNA 2YSQA 3MEXA 1WJEA 3RESA 3GZ6A 4IUQA 2JMAA 3M54A 3ZXSA 4ZZDA 4M75C 3LSPA 4I09A 1Y0NA 1IDYA 1SAUA 1R7JA 2AS5F 3EAEA 1Q1VA 3FIWA 3EG3A 2G7UA 1MMDA 5IOZA 1H3ZA 1VQ8Q 1XB4A 1K0XA 2CQ7A 2W10A 2A07F 1Y39A 3JB9F 2QK0A 2FMYA 3OW2S 1WJFA 1QHGA 1ZG3A 4N4OB 1LDJA 2PG4A 4ESBA 2L2PA 5EZHA 2KEAA 2PUOB 3GFJA 1EJ9A 3AHUA 3BR0A 2O9SA 3EUHA 2XF6A 2JA2A 4HQEA 1PP8F 4EMSA 3M0TA 3GTMJ 2KT8A 2MMPA 1P92A 1U5TA 1UB9A 5K7FA 1YJWI 2D45A 4RG8A 4QVDA 3GXOA 2CW0F 1WXTA 3R0JA 1O4XA 4EJWA 2GBQA 4C0GA 5GAN2 1YITA 1KQSP 4A69C 1IGUA 2XPVA 2H27A 4DZJA 4RB1A 2RHIA 5E18F 4IIMA 5GANe 4I0AA 1SAXA 2ZB9A 3QYFA 5FD5A 2O31A 2FEZA 2L5QA 1R5HA 5DCMB 3JCMJ 1ZAOA 2HKXA 1Q81U 4YIIA 4Z6YA 2NVXJ 2EFNA 2W00A 4HF0A 1WI9A 4QLCU 2DO7A 4AVPA 2Z9OA 1SMYF 2EV0A 3CJQB 1YO5C 3S17J 1GHCA 3LSKA 4C8QG 3LWIA 5KYYA 1BW6A 3DKXA 3K4NA 4RCBA 3RNJA 3FKIJ 2J7IA 3RZDJ 5AYFA 3ABUA 3T5XA 2MAMA 4QPQA 1O9SA 1ZSGA 4R8HA 4DIQA 2KR3A 4PLLA 2Q2EB 4RGXA 3E7LA 2KLOA 4DZPA 4FCYA 2KYBA 2DMQA 4E70A 2EA2A 3CTAA 3HYIA 3TGNA 4Z2YA 4IX7A 3F8NA 3SB2A 3PNYA 4EV0A 2VIXA 3HOVJ 1TQIA 2L7MP 2CREA 4JS5A 3PMIA 1SVMA 1BOAA 3LX7A 1TUCA 4C0DB 3CCMQ 2DILA 1VQ8T 1VQOI 1LEBA 2WA0A 1YN8A 3R6OA 1SMTA 1VQ6I 2WWYA 4HV6A 3WGGA 5ICEA 3OYAA 2BUDA 4BXFA 2W0ZA 3H0GJ 1X1BA 1UHCA 2CKKA 1D8KA 2RJFA 4DYQA 2A37A 2HVRA 1D8JA 2ELHA 4A5NA 5D8LB 1VOMA 1NM7A 2MYSA 4PL6A 4BH9A 5IHKA 2XDDA 1ZSZB 4N9HA 2FBHA 3M55A 2CZ0B 3BC8A 4RMOA 2DXCA 2ZPGB 3OL4A 3CCRI 2R7UA 2LH9A 1WPKA 2XB5A 3MCAB 4NQWB 4HX4A 4KISA 4FYXB 1AEYA 3IKVA 4P5NA 2CFXA 2XRNA 3BR3A 5CKBA 3WTVC 2RNAA 1ZN2A 2VXEA 4M7AG 2A5YB 2V26A 2COWA 1K8AC 3G6EI 1YIJA 1F43A 1Z05A 2QEXQ 4E47A 4N4IA 3H9NA 2KKOA 1SSHA 4CXFA 3ME9A 3GIBA 1T0FA 4YFXF 2L9VA 1VQMA 1M1EB 1UAAA 1CQTA 4IHTA 3EUKL 1QBJA 3A1PA 3EFRA 1BN5A 3RYRA 5F04A 2Q0OA 1MGQA 3CZ6A 1MSFC 8AT1B 2Y4XA 4WF2A 2L3DA 3RJPA 2XAQA 3G4SI 3CCEI 1G3TA 5EF6A 4CA0A 3JREA 2HNIA 3BG6A 4XICA 5GAMj 1KD1U 4ZN1A 3J7AY 4FQGA 4AVZA 5F0CA 4C3IJ 4Y7NJ 5GPCA 2LKSA 2LKXA 1OMIA 1PM3A 2C0IA 2P84A 4OP0A 3SWNB 4BI4A 2QCOA 1W2BP 1SD7A 3T9NA 4HOBA 3ZL7C 1JHFA 3HB9A 4J83A 2Z16A 3HEFA 2VI6A 3NHNA 3K10A 2FYKA 2LZ6B 3OOPA 1W0UA 3QKJA 3HSEA 4JJNK 3MKZA 2FRWA 1T6SA 2OAWA 5HVQC 5KCHA 5GTHC 1QCFA 4ZDPA 2EIMH 4XORA 1Y71A 4E7JA 1ODDA 1WHHA 4JBAA 3HJEA 3BWGA 1YW7A 5FD6A 3RKXA 2BYVE 2DXTA 3LGFA 1VUBA 4J7FA 2HPIA 2HFHA 3K4CA 4Y17A 4ESJA 3UNGC 1T39A 1IREB 2JK3A 1OZ3A 5CAIA 3TKYA 1MIJA 2KHMA 3O6BB 1FEXA 4R55A 3GFMA 2QEXT 1AKHB 2H6BA 3CLOA 3HPWA 2G0EA 5C0MA 3SQNA 3K2AA 1OX9A 1ITYA 3TW6A 3IH4A 1E0EA 1IXCA 4M9SA 2KP6A 3G1JA 2VT3A 3S3MA 5FB2A 4MEXF 3C0CA 4XQFA 3RPQA 3VS4A 1S7EA 2CS7A 3EYYA 3G1LA 1PD1A 2QLZA 3ML6A 2KDSA 2P0WA 4PJ0C 3CDLA 1YQAA 2VKEA 3IHUA 2AKLA 5GANj 4HVUA 2K9SA 1N77A 4KUMA 3I4MJ 2QI2A 1K8AU 1YJ9I 2KNBB 1FPQA 1WJRA 2OTLA 3CC7I 4F93B 4KYWA 2M35A 1M1KU 2L9SA 4OMOA 4FW1A 2GFUA 2P0KA 2XI9A 4DW6A 2HOSA 4I02A 3H5AA 2HYGD 1DPRA 3H3UA 3H9GA 1Z1DA 5BS6A 4QVZA 4F04B 1AHDP 1JTYA 2HSPA 1UFMA 3PUBA 4I0BA 3FZVA 3CDHA 2DYIA 2ETHA 1WJDA 3KP6A 4CZZA 1AT1B 1M2VB 2NUPA 3EHQA 1G5VA 2PVGB 3RIRA 2EVRA 2DU9A 4M71A 1XSVA 4PSWA 1NEGA 3W3CA 2PLYA 1SD4A 4BXUA 5IN1A 1XDUA 1M90U 4RB3C 2G3RA 4PFPA 3IRRA 5K7HA 5DCFA 3COAC 2EYWA 2GQIA 1G6NA 5CVVA 4A5MA 2ROLA 3CPFA 4C8QC 2QYOA 3D5SC 1N75A 4CCMA 1R36A 2FA5A 1I1GA 2ZPIB 3AT1B 1S7OA 3TDUC 2QKMB 4AD9A 1JGGA 2K85A 2YUOA 5HK0A 1G83A 5GAMd 1G4DA 4IUPA 3NFCA 5ICGA 1RI0A 1VQNI 1S72I 2D5VA 4ON0A 3ZMDA 1XC5A 3A98A 2AQEA 3BJOA 3NAUA 3JCMh 2VXFA 4XRSA 4FU6A 3CBMA 2ME6A 1FYMA 4A4KA 3RKYA 2JUCA 3IP4B 2DA3A 2K9LA 4ZC3A 3S93A 3ZPLA 4RAFA 4EVIA 5EEAA 4CYCA 4C92D 5LEKA 2D1VA 3IWZA 4IRGA 2NLUA 3JCMP 2MFZA 1F1BB 2VYTA 5I2SA 1QVGS 1VQ4Q 1ZKGA 4BQNA 2QENA 4BY1J 2E5NA 3L1AA 1ZR2A 4OIRF 1TL8A 3C1DA 2OJ2A 1FC3A 5CKFA 2BHYA 2JVHA 2GTOA 3KFVA 3BDLA 4ZDLA 1Q86R 3LFUA 2MH9A 3QWXX 4Z88A 4RMNA 4C0FA 2F5EA 2IS6A 2EINH 2WTEA 2DJNA 3C2HA 2R4GA 4KUDK 3OSSC 5M5YJ 2VLAA 3FMRA 2KMUA 1C6VX 5DLQE 2OTJQ 4OB1B 4AFZC 2Q2EA 1QPIA 3MEVA 1NEBA 3KUFA 4RAZA 4RTVA 4M7AC 4LFUA 4MTEA 5EGOB 1RL2A 1WQ7A 1TTYA 3WTXC 3JTGA 4B9WA 1KIKA 1ZQ1A 2HBPA 2H6CA 2LY9A 1GVDA 1WJCA 5J8CA 2DBMA 2HMAA 2CS3A 2A0FB 5GANd 1BCMA 1TQMA 3JCMb 3AL0B 3WTWC 2EZKA 4ABZA 1PSFA 2J06A 2IA1A 4GDFA 1WH5A 2O9LA 4XU1A 1Z3XA 3ECHA 1XMKA 4BJTA 2XK0A 1S29A 2R3SA 2JN6A 1NTCA 3BR1A 1HW2A 2IJLA 4P5OA 1RZ4A 2OX7A 2P0PA 4MMLA 3G1MA 1W5SA 2D8HA 2VC0A 4ZZLA 4ENMA 2O61A 4WCGA 2QYZA 1NZ9A 4JJDA 3EETA 1TT5B 3HP9A 3PUFA 3BQZA 3L9FA 5LJ3e 2XAFA 3DEWA 4E4HA 2R7ZJ 5LJ3f 1BCOA 2DA4A 2BE5F 2F2XA 4CC2A 2BKDN 1XMXA 1VQ4T 4ZN3A 4AIJA 1MUZA 1V76A 4QQDA 4ZYHA 3A0HC 4XK4A 5GAN6 3OIPA 3GP8A 1HA8A 4QKUA 1JJ6C 3P9CA 2L3SA 4L9TA 3WVDB 4RS8A 4XLEA 2LT4A 2HDDA 1H89C 1X3ZB 2E65A 2PMHA 5FRNA 2ZMEB 3ZGKA 3D5RC 5HLIA 1WHMA 2EYXA 4WXHA 3GOXA 5IT3A 2M4KA 4OMYA 1JU5C 1YWOA 2QTXA 4AM3A 2LMDA 4LDWA 2OTJT 4HV5A 1D1BA 3L2ZA 2VUMJ 2PI0A 2R7XA 1EH7A 4HRIA 3VS3A 1LE8B 2ZJQF 4LLGF 3R0AA 4RGSA 4A3JJ 3GF2A 1QQIA 3BW1A 3SEZA 3AG2H 5HODA 4PZJA 3MEUA 1BM9A 2BVLA 1MH3A 1GDTA 1XSXA 1K4US 4LD6A 1G3WA 3GBGA 2JTMA 3W6JB 1EX4A 3HOSA 4OVAA 3CD6Q 3DLMA 3F6VA 5FFXA 2MWPA 2KISA 3HBLA 2RAEA 5IY5H 3BOQA 3DEUA 3CUQC 4F17A 1XS9A 1D0XA 4BE2A 2ENMA 2LQNA 1AZGB 2EAYA 2JW4A 1DU6A 4JLIA 3WTYC 3T8TA 2QGUA 4W1UA 5E3LA 3DFGA 2DA9A 1PJRA 2QUFA 4MQVA 3MP6A 1PUEE 1VQ7A 1B8IB 1KQ9A 3REBB 1OYIA 9ATCB 2C0TA 3DB4A 2JUGA 5L3CA 3L1PA 1NLOC 2KI7A 4L6V5 2QA4A 1V4RA 1CF7A 1Z3YA 1QU3A 2AT1B 2PNIA 1JHHA 1RPWA 1BR2A 2L4MA 2V1NA 3FISA 3QPHA 3IKTA 1U3EM 2FE3A 4ORZA 1X2MA 1N8RC 5BPIA 1KC8R 5FLMJ 1X58A 2DE0X 1OJLA 2DMOA 2MLKA 1MKMA 1ZHFA 1JGSA 4J9IA 4UB6C 1MBKA 2F4OB 1BBZA 1RC9A 4D5CA 3QU3A 4KNYA 1QVGP 2XV4S 2C6YA 3AAFA 3EH2A 3DU5A 4RG2A 2A6HF 1IDZA 1LEAA 3ELKA 3K7AJ 5B66C 2D9TA 3W2WA 1YG2A 3M7GA 1Q95G 2E41A 2QKLB 3H8ZA 5GAOq 3I56Q 2MIOA 3G71A 3K6GA 2DN0A 2XU8A 2ZSHB 1OCCH 2L0KA 4C8QD 1QCNA 5IP6A 4XLFA 1FYKA 4JRPA 4LG3A 2EIFA 4LG0B 1X27A 4PJOA 2EYYA 1M1FA 5HLHA 1TC3C 1RETA 2BIVA 3D7SB 4J9FA 4GYIA 4JQFA 4F91B 5DS9A 1SC7A 3CD6T 5E17F 2DFUA 1M2VA 2X1CA 3I4PA 2MH2A 1UZCA 2YR2A 3LMMA 3OR1C 2KK4A 2K9GA 1W36D 1Y07A 3EFOB 4ATOA 5BNGA 1E17A 5HNFA 3HUGA 1YI2Q 2EFPA 5GTIC 3DXJF 4YRVA 3CO7C 3PT9A 4RTXA 3FXMA 1WXBA 3IWFA 2JSPA 2JJ7A 3ONQA 2E6NA 2LFBA 4LOCA 3GF5A 3M0UA 3L7WA 4NC6A 4O6JA 1GV5A 4U7DA 1K78A 5KAIC 2VV5A 4KN4X 3BY6A 2XKOA 5FLXK 5E1WA 4XN0A 2Z1DA 1H9TA 1ONVA 3LWFA 2OBPA 3H0IA 1Y57A 2P6SA 5E8GA 4ZYEA 3DPTA 3KZYA 3G73A 3IH3A 4GFBA 1NG2A 2K79A 1ARKA 1GFDA 3L2QA 4KGZB 2E1OA 2E1HA 2E5KA 1WHLA 3F72A 3J80Z 4OB0B 4XNFA 1XTAA 1ZG1A 1K6OA 3QJYA 4II2A 1RR8C 2YRVA 2DA2A 1UCRA 2JQ7A 2B86A 2M30A 2YU3A 3CBPA 2KIMA 3DWLE 3OL3A 3ZCOA 4LDXA 2PMUA 1N8RU 2F69A 4RDUA 3I56T 1UJ8A 4IUUA 2EV5A 4OAZA 2CU7A 2JA5J 1OLTA 2ZZDA 3VYUB 3P7NA 4JJBA 1T0JA 3H3VK 4HZFA 1VQOA 1WHUA 4HPQA 1I5ZA 4DJAA 2GA1A 4XTVA 1KQ8A 4C8QE 1VQ5A 2NUTA 1OR7C 4ZH4F 1PCXA 3SDGA 2PVDB 1OPCA 2YS9A 5JFRA 1IC8A 2GXAA 4UV8A 4F14A 5GMKm 1JEGA 2VJIA 4ZTJA 2FBIA 4KT6A 4I6ZA 2ECZA 3J80R 3GTOJ 1D3BB 3JB9G 1QVFA 1TG0A 5IOYA 1RAGB 1F1ZA 1X6BA 1CKBA 2DF6A 3AKZA 4ESRA 1YI2T 1IN8A 1VQPQ 3P5JA 1KU2A 1HDPA 3SFIA 2XAUA 4OOIA 2SEMA 3FJPA 2Y75A 2QEXI 1TP4A 2G7HA 1WHKA 5CKDA 1AWCA 1VQKQ 4LGWA 3ZP5A 5GAHJ 3EFSA 2DA5A 4I76A 3JRZA 1WFWA 2L8DA 2VJ5A 4V19K 3PE0A 3ZEHA 4A3CJ 2RQPA 4V2FA 4J19A 2CO5A 4DOVA 4CYDA 1PKSA 4XU0A 3O5ZA 2E70A 4FT8A 3CPWP 4XTWA 5JVTA 1TU0B 2M8EA 1I3AA 2F5VA 1YOVB 1VFCA 2JTEA 3QUIA 1VQLQ 2GQVA 3M0QA 5I11A 1WGXA 1E2XA 1KU7A 1X69A 2GQQA 4JOMA 3VJPA 2EZHA 3HRMA 3PL8A 1QVPA 1TW3A 1WLPB 2ESWA 3TO6A 3G7ZA 4J9DA 1X19A 3X28B 4PJOF 2EQJA 3CP2A 5D6XA 4OGEA 5DUKA 1U5TB 5ICCA 3CEYA 3C18A 5FKKA 2J5OA 3S2HJ 2CP6A 2DA6A 5IHNA 1HCRA 3NWTA 2B8AA 4M78G 4M7AE 1UUEA 4XKBA 4LDUA 3HGGA 4A6EA 3Q9VA 4LDYA 5DYMA 1Y6IA 3NPFA 3WGIA 1FT9A 3U9GA 3M56A 1R1UA 4EMKC 4B43A 1KHCA 4M75G 1ETOA 4QT7A 3EHRA 3JCUC 1UG2A 2E36A 3QIIA 1YJWA 3HC7A 4XOPA 1AD5A 2KY9A 5TRDA 2PQ8A 2RDPA 4A3MJ 1RKTA 1A6QA 5J8FA 1PNJA 5KHDA 4M77D 3ABTA 2DJIA 4JP0A 2AKKA 2EFQA 2COMA 3OIQA 5KYYB 2KXDA 1VQPT 4P1WA 3VRYA 2R7VA 2KT1A 4J6XA 1VQ9Q 3VYRB 5L3BA 2DFEA 3LLRA 4C5EA 2AQFA 1EKEA 2CUZA 4Z02A 1VQKT 4A4HA 3QWLA 3K9TA 4PFOA 3QYBA 2WY8Q 4HG2A 2RD1A 2F2WA 4PNOA 3A1YA 4S05A 4M7DD 3E6BA 3M8EA 1RACB 4DEYA 1AU7A 4L59A 4K2EA 1XDSA 7AT1B 8ATCB 4P96A 3FWEA 4OINF 4BDYA 3BE3A 1DP7P 2RB6A 5GMKh 1VQLT 3BZKA 4FHTA 3HL2A 2TRTA 1WZOA 2K5LA 3H35A 1VTNC 2LF8A 1ETVA 2PTKA 4F7UE 1S9HA 1KONA 4S04A 4GGGA 1FMVA 3EGDA 3MP1A 2DIGA 2XSJC 1TWGJ 3V4GA 4ZYGA 1HDDC 2A08A 2KBTA 5L8RE 2VQHA 2RKHA 4KIGA 1N9SA 1ZBXA 3OS5A 1UGSB 4UHTA 3AG4H 5M5XJ 3DPLC 1M3AA 1YFHA 1PWTA 3CCQQ 1VNDA 3S3NA 4WXCA 3OSVA 4MGRA 1Z91A 3CC4Q 1TXQA 2MA3A 2O03A 3B02A 2Y2ZA 1SSFA 1D3YA 1X2QA 1NJIC 2RNGA 4G6TB 3HHHA 1JXSA 1O57A 2IS4A 1OZ2A 5DDGA 3M59A 4D8KA 2JTVA 3J81K 1SPKA 4WTOB 4NS5A 1DPUA 4IHVA 1KQSS 3CCRA 1UG1A 4RAYA 3UDCA 1A04A 3BTJA 3QP5A 2F5KA 2FPFA 4XK8E 1I39A 3RBBB 4PJOD 1YX5A 2EILH 3KYCB 1J5YA 2DLLA 4RM2A 5M3FJ 2RMOA 2TDXA 5KCOA 1NJIR 3WXMB 2TCTA 5FWCA 4GY5A 1VQ9T 4AYBN 4DBFA 3G6EA 4PJNA 4PGHA 3E5UA 2C0OA 1ZA2B 1WRJA 4C30A 1X3UA 3Q0WA 2FG0A 2BY0A 2IGNA 4B9XA 5B1BH 4Y28E 2LOOA 1ORKA 3ABKH 2RH2A 1YHQQ 4IHWA 1IUYA 4CCOA 4CDGA 3CF2A 2GLOA 4JRQA 2DERA 1IHWA 4J00A 3EFOA 3OMCA 4M7DE 3ZMTA 1S1NA 2W48A 1IW7F 3CESA 3T8RA 2V9KA 4AU7A 3EUAA 2PUKB 1VQ4I 2DI3A 3RYPA 2R7QA 3G4SA 3CCEA 3MEAA 5KYWB 2LVMA 3L2UA 3C4SA 2BHZA 3DTKA 4U0WA 2VOOA 3OW2A 1K9MU 4XLAA 3VS1A 5D6YA 4JUVA 3M4GA 2KMTA 4E2FB 1JQQA 2JWTA 2Z2SB 4AIDA 1PC0A 3CCQT 4QTRA 3JB9J 2UV1A 1AWOA 3TEEA 1FBQA 3CC4T 1U0JA 5IPAA 2KRFA 3MKDA 3OYCA 1OU9A 1OCPA 2OTJI 4JRIA 2L9NA 1ZGJA 3WU2C 2O4XB 5J1YA 2YDLA 1YJNT 2YWWA 3QZ5B 4E7LA 2MGQA 1DGWY 3UR3C 2JVVA 5D6WA 4HVWA 2HGCA 2XC7A 2LQ8A 5LJ3d 2I10A 2VKNA 3L42A 1LVAA 4BUPA 2IGOA 3W2VA 2IS2A 2DOAA 2X1DA 5KYUA 5HKCA 2OV7A 1XD7A 4CCKA 2CV0A 4A3GJ 1E3HA 1TQPA 3ABLH 5J1RA 1FYLA 1WFXA 1JI8A 3NTKA 3GTQJ 4FIBA 2VPLA 1JB0E 2DTRA 4PJJA 1U1TA 2XGCA 1FTZA 4BHPA 4YFNF 2F4IA 1TNSA 3HDDA 1NJIU 2COYA 2H3EB 1EA3A 2L4AA 1R1VA 3A02A 1HSJA 2OJED 2MOXA 5D4SA 1I81A 1N78A 4FETA 5CCAA 4MNUA 1FYNA 2KRMA 1YHQT 4XMYA 2HEOA 4KULA 1HXDA 3H92A 3SZPA 1W70A 3ERED 3VSKA 4KMFA 2D0QB 4EATA 1B34B 2RQVA 4AT1B 2VC1A 1K73U 1EV7A 3WHCA 4C0ZA 1DP3A 1O75A 2UUZA 4RGRA 4Y3OA 4XTXA 2YLCA 1YJ9A 2WV1A 4GLKA 5C3EJ 3QZ9B 4M78C 1B4AA 2W24A 1BK2A 2RJEA 2G6FX 4A3IJ 5E79C 3U1DA 2VASA 2CQXA 1UJYA 3F3XA 2HCKA 1W2BS 2FRYA 2K2VA 4BBRJ 2LJ1A 3GZ5A 4JK1X 1ZRDA 3DBRB 4H4KC 3EG0A 4FM4B 1R71A 2KE9A 2X6WA 1XPXA 1QRYA 2HDCA 3FMSA 1V54H 1KJWA 3CCLQ 1ETWA 2IBDA 2HQEA 2HL5C 2Z99A 2EJ9A 4AG1C 1ETKA 2YUSA 2MBFA 5AT1B 4YIFA 4IOAF 2K3XA 4B8XA 4PLIA 3A0BC 3FDYA 1PUFA 2OZ6A 4MLOA 1RUOA 3MQ0A 4NL2A 4AYBA 2FRHA 4P9UA 4LITA 3JW4A 3CO6C 1ZRFA 1U06A 3JSOA 5FFZA 3CD6I 1OV3A 2I0NA 4YTLA 3DTEA 2E3IA 4BY6B 2A36A 1YW9A 4CYCB 1O7LA 3WTUC 1VQNA 1S72A 2K3BA 2Y48A 2M7BA 3E2UA 3ZOBA 5HOOA 1D5YA 2DO3A 4XM3A 2OAZA 3MMYB 2XDPA 1ZYRF 4KN7X 2CSQA 4C92A 1UELB 1LPQA 1NG7A 1OYYA 3H36A 4J9CA 4XTUA 4EQQA 1MDMA 5CQEA 3KP3A 3BDDA 2EB7A 4OGCA 5HS8A 2ZCFB 5GAGJ 1OQYA 3M0PA 4D8DA 2HQNA 2QSFX 3QPLA 3L2CA 1B07A 2I5UA 1QPMA 2E4HA 1LCKA 3OBWA 1Q82C 3HG9A 1Y8QB 4J5YA 1N9RA 2QWWA 2IW5A 4HSRA 2JMCA 4JZ4A 1PYVA 1WSUA 1W7PD 1VYTA 2Y0MA 2W84A 3HTSB 3GNFB 4BD3A 4CC3A 1FZPB 3JCMX 4G94A 5D8KB 3EUHC 4FISA 3WTZA 3MZHA 2E1MB 3KETA 3MJXA 2F2EA 3VYGA 1OCZH 2R7SA 3FXLA 3QYHB 2XVCA 3CCLT 2XASA 4A3EJ 1ZRCA 4IVNA 4HCCA 3S14J 4CCNA 3I56I 2JM8A 2F48A 5H2FC 2DPUA 2H3JA 1Q82R 3TL4X 5GAN8 3CCJQ 1ZH5A 3S2WA 3ZQFA 1BR1A 2DMUA 2HKOA 3KCCA 2X3WD 3MO8A 4RUGA 4V2GA 4KUIA 4PK4A 2IXSA 5DUIA 1WX6A 3A8GB 3AFHA 3ULRB 3KE2A 4ELYC 3O8GA 2NNNA 1ZLMA 5FU6B 1W1WE 2EFWA 1VIFA 4XLHA 1RI7A 4XKWA 1OFCX 4EMHA 2VKDA 4UUSA 3JRHA 1H88C 2XF5A 4ZNXA 4HSTA 4HX7A 3UATA 2KZGA 3OS0A 3RSNA 3T0YA 1R5ID 4UVAA 2XIGA 1M8MA 2X48A 3GTKJ 1YI2I 5D5XB 1MNEA 1Y1VJ 4H0EA 2MSYA 4CZCA 4J8OA 3CXCA 2H1LA 3CMMA 2RQTA 3GBQA 1USSA 2FNAA 2KRHA 4BE1A 1RIOH 1O3SA 2DJZA 4BY7J 2R5ZA 2BEOA 3META 5J47A 3CQTA 1NHAA 2Y9YA 3LQRA 2K57A 2RN7A 1VIEA 4UNOA 2NS8A 3RKWA 4BB7A 4NHJA 4VUBA 3BR2A 2QVOA 5CVIA 4GBQA 2DODA 2QF7A 4OMZA 3I35A 1IN7A 1W5CC 2EBIA 2OA4A 2A5WA 4DQ2A 5FRMA 1MMAA 1TWBA 2CG4A 3X2QH 4N0AC 2HDWA 4RA2A 4ASNA 1Y0UA 2PQWA 3CMEQ 3CCMT 1IRFA 1V5EA 3EPZA 4FSSA 1X1PA 2XKPA 3I53A 3ZQGA 4UVBA 1QZZA 1VI0A 4ANJA 4KRTA 3CCVQ 2WAQN 2KIQA 2DOFA 4MEYF 4NB5A 4HKEA 3O3KA 3PO2J 4A54A 3X25B 2VBZA 3CCJT 3HRUA 1OU8A 2XIDA 5LJ3j 4E6KG 1GT0C 1NH3A 2FD5A 4C2MJ 2X4HA 2CZ1B 2SRCA 2DM1A 4C92F 3RUXA 5CQYA 4QW2A 5EDNA 3JCMV 1CF7B 1HF0A 3F6OA 2GGRA 1R5GA 4YEJA 1MMNA 2ICWG 3JSPA 1VQPI 2CYZB 2BXYA 3SDZA 5HDNA 3DQVC 2X9DA 3VS2A 1J7KA 4F16A 1VQKI 1T38A 1OCTC 2RREA 3MZYA 4J9BA 1FOYA 1KZHA 3OY9A 2RM4A 3FKJA 4IJAA 2MI6A 3E9GA 2HOAA 3ZMSA 3GYHX 2LX9A 2RJDA 2XGDA 4UXNA 1JJ2S 2F1LA 4M75D 3OYIA 4RAGA 2E5ZA 3TBIA 1VQLI 2NWMA 1K9AA 4M6VA 5JLWA 2XICA 2CUJA 5E1ZB 1YBYA 2JTFA 2RN8A 5KYXA 3F70A 1B34A 3CMET 2VKVA 2ZPFB 3RMQA 4YELA 3GX4X 4PJOB 4EM2A 3SFZA 4KJZA 3CCVT 2LREA 1OOTA 2CUBA 2Y69H 2VVKA 1U2WA 4C8QA 2XUBA 1Z7UA 2K40A 3EQLF 1BC7C 1Q7YC 4A4GA 2QA4Q 4D6WA 1UHMA 1ON2A 3ASOH 4Y15A 5M3MJ 3J7ZI 1I0CA 1A6IA 1PRLC 2QAZA 2BW3A 1ZK8A 3HUGB 1H9GA 4BAYA 5DM6F 2VODA 3E6MA 1ZHIA 3K4MA 2GZWA 2LF7A 3RMSA 4MQ9F 1ABOA 5GAMg 4M6XA 3FX3A 3OYHA 3M3YJ 3CCUQ 1BYMA 1V3FA 1O3QA 3HKSA 4CO8A 3M58A 4QPOA 3J7AF 1K78B 1X2KA 1OULA 1EH8A 1Q7YR 5GAEJ 1SFOJ 2OQRA 2X4XA 2ZFWA 2QQ9A 1LNXA 2W7NA 3SZGA 2HQRA 4G8XA 1VQ9I 2K7AA 1P9QC 4BU2A 2QTVA 2H09A 1V1CA 2QG9B 4RTZA 3ER0A 4DOZA 3GMEA 2E7XA 3IL2A 1JKPC 1UDLA 5D5VB 4CH7A 1M3BA 2RQUA 4O5VA 1Q86C 1IN6A 1V5FA 2M2EA 2D2WA 5GAOm 4M75B 2XB0X 5FU7B 4ZGEB 3VFZA 4M78E 3KPHA 1LDDA 4GRIA 1A5JA 3H0FA 4BXXJ 2R93J 4NL3A 3HL8A 3BPVA 2A68F 1K4TA 3QWYA 2LCSA 1SRMA 5FKOA 1FX7A 3LYIA 4M75E 1I6XA 2WAQA 3VYSB 2ESHA 1LFBA 2E1NA 1LFUP 2JRTA 2FBKA 1IGQA 5DM7F 3Q1JA 3QP6A 2BZ8A 2ZAEA 4LNPA 3GUDA 2ACJA 2NUTB 3CCQI 1UFFA 3RCOA 4OIPF 2CQKA 4R0KA 3R4KA 2HXIA 3CC4I 3B6CA 3LH5A 4DYRA 3E19A 5FLXZ 2HNHA 2V6CA 3HOUJ 1WA7A 2QGGA 1VYVA 1IGNA 1MBGA 2LTOA 1YJNI 3IRQA 3LSRA 2JN0A 5GANg 3BJAA 1IG7A 1YLFA 1KHIA 2JS2A 2YUNA 3I5SA 3JCMf 4OMNA 2P5KA 3CCUT 3LL7A 1LOJA 3K4JA 1WVRA 2JUFA 1B9MA 1J0RA 2KQRA 2PZ1A 4DGWB 4OB2B 3HPGA 2FU4A 3IAM2 2DL8A 5IH2A 3G3ZA 4HCZA 3CJTB 3FLGA 2VJJA 2FQ3A 1STZA 1Z9QA 1WYXA 4KA4A 2DT6A 1FOKA 2YU9J 4MDXA 1ZX6A 2ISYA 3NRVA 3DCFA 3OYMA 3K4LA 6AT1B 2QEXA 2GTJA 2HSEB 1USTA 3ZQLA 1L0OC 3C2BA 3OOUA 3HKZN 4XIDA 1YHQI 2ZXWH 5FLXR 2HR3A 2HZTA 2LG4A 5HNHA 1IN4A 1JRIA 1N5ZA 2RA2A 1TWFJ 4X9DA 1KQ2A 1F5TA 4F7UA 2O8XA 1JUSA 3CMAQ 1U9NA 1KA8A 2LKPA 2OD5A 1WCMJ 2E60A 4HQMA 4XLCA 4EEFG 4F92B 3CCSI 4B4CA 4IRHA 2OUMA 1LB2A 2DRKA 4RKUE 1OISA 5M5WJ 1T08B 2M3AA 2XAJA 2R7RA 3UA7A 2K3YA 4C8QF 2YRCA 1GRIA 3NTIA 4IHSA 3KIOA 4DOWA 1Y1WJ 1K61A 3KBGA 3LAPA 2LRDA 2LX7A 1JJ2P 2ZJRF 5ERIA 1WNLA 1WIEA 1MGTA 5K5OA 2DZ9A 3OV8A 2Q8KA 1HKTA 2P0TA 1Q86U 2ZXIA 1JUMA 3H1CA 5FO5A 4KDPA 3PQKA 4AUXA 1R0BG 5LJ5h 2NVUB 3PMTA 2E2IJ 2L2OA 2HD0A 4C0DC 2W85A 4L9NA 3GTGJ 3HGYA 1IRGA 4Y91A 4FX4A 2O8KA 1AA7A 2XDBA 1LVKA 1YP5A 1Q1HA 4WWCA 3CUQA 4M3DA 3KP2A 5H6RA 3I59A 4L5EA 1N6AA 4LXCA 4NBQA 1KU9A 2F5CA 5CYVA 1XCBA 3ZMVA 3BJ6A 4M77A 2P7VB 4BJ5C 4E7SA 3A8OB 2K2MA 2COBA 3VKIA 1ZSZC 2JJ9A 3UPUA 1TW2A 2Z5UA 3QYGB 5CVRA 5FU6C 3REAB 2QDYB 1ZLKA 4HLYA 1W4SA 2CUEA 1QGPA 2OQGA 2ZNYA 4HEA2 2R5YA 5BPDA 2LCLA 1E6HA 1AWJA 3RZOJ 1M4ZA 2HTSA 1OPKA 2BZXA 1P6RA 3CLQA 2YPRA 4A0XA 2HXOA 4IO9F 2D0NA 4CC7A 1KC8C 4M7DA 5LFAA 2FHDA 4MZMA 4Q5WA 1FIPA 3LA7A 3K69A 4MDWA 4EMGA 1FLIA 3CJNA 2DAQA 1WI7A 3DLAA 3QOEA 3BR5A 3RDIA 3JCMc 3EGDB 5LJ5f 3FF5A 3LFKA 4F52A 3ZN1A 2L89A 4ENKA 2HYFA 3C7JA 3I55Q 3CPWS 3CMAT 1PVEA 4R56A 2YX4A 4NUBA 5EYRA 1FMWA 3THKA 2O0YA 3HHTB 2LR8A 1QW1A 2J6FA 3BR6A 4E7ZA 2F5TX 2CMPA 4XN3A 3KLNA 3ESWB 4GLMA 2D8JA 4RTUA 2R7FA 4JDSA 3CUOA 5CQGA 4J9EA 4OMQA 3VDXA 1MJ9A 4XKVA 3S1NJ 3GPLA 3P9IA 3UA6A 2M0MA 1QCOA 4X34A 2MW8A 2OCEA 5LGNA 2DL4A 3QDFA 4HNVA 1VQ8I 1IRZA 4X1VA 3SWNC 1REPC 1IXSB 3M9QA 2FMLA 4CRIA 1GCQA 3CCLI 2FB7A 1RKWA 3G2BA 2W57A 3WU0A 3A5ZB 4NC7A 4HT9A 5IYBJ 1ZTRA 2E19A 5B1AH 2JRMA 1QP2A 2DFIA 4J6YA 1R58A 2DAOA 3OYFA 1R0CB 1YCYA 1RUNA 3GZNB 4R1HA 4A4FA 2KQWA 4HXJA 5JHUA 3K4KA 2R7WA 4M72A 3K2ZA 4P9FA 3HKZA 1QVTA 3TQNA 4B1RA 4KMUX 4F7UF 5IP7J 2UXXA 1JKQC 4UVCA 5JHFA 2DTIA 2LRQA 4DBRA 2VN2A 3WHBA 2QGFB 4RLQA 2VOPA 3VU3C 3CJRB 3BPXA 3FBNB 4BE0A 3LAJA 4WXDA 3J81Z 3I55T 3P8HA 2ID3A 1Y0MA 2W4SA 3ISPA 1K79A 3OSGA 2WC2A 1ZUKA 2K7LA 1V5GA 1PKTA 5FKLA 2RHYA 1T56A 1RNLA 2WV0A 1VQ4A 3V7CA 1GCPA 2VQGA 2HOTA 2DCEA 4IUTA 1KC8U 1SD5A 3K70C 4ENJA 1XMAA 2EW3A 2F5DA 3H5RA 2WSEE 3PFIA 2EPFA 2X35A 3D0SA 1Z77A 1I07A 1ACIA 1U5SA 4M77F 1QVUA 2FXAA 1Z67A 2L3PA 4GXOA 1OR7A 2EZLA 5FGMA 3WU1B 3CCMI 5IT9K 2E10A 4OB3B 4AFSC 5KYUB 4M7AD 2IA0A 4KT0E 2JS0A 1MBJA 5CLSA 3J81R 3IAS2 2OTJA 2I8DA 1FWZA 3IV5A 2DK8A 4BACA 1V55H 1LNWA 2BXZA 3B6AA 1F36A 3CCJI 3QSUA 4OMMA 2ECBA 5J39A 3MZ8A 1M8VA 4TV7A 2BY2A 2FZGB 3J7YJ 2QZ8A 4M7DF 5F0HA 5I2MA 2JA8J 5J3LA 2HBWA 4F7ZA 2K3PA 2VXZA 2O88A 5F64A 2V8KA 3CCEQ 1NYFA 3D1NI 5L3DA 5IHIA 1BBYA 2X51A 3QO3A 2JOYA 1KU3A 1RAHB 2CGHA 2NRAC 2KRNA 2R57A 3MPUB 1SFXA 3HSRA 5HK3A 4JX5A 5EC7A 4W97A 2V1DA 4ZYAA 1IV6A 4LE9A 1GL5A 2L01A 3OR2C 3KX2A 1YNZA 1P7JA 3H3ZA 3PNVA 4UB8C 2ZPHB 1XJWB 4DA4A 2EPDA 3HXLA 4ENNA 3ASNH 3C12A 4FYWB 3SFMA 3WE3A 3H9QA 3MD2A 1UGVA 1KG1A 3ZQ7A 1YWPA 2JXBA 1YW8A 2N8GA 1Z21A 2YRDA 2NS7A 5CKEA 4L5IA 1EH6A 2DFFA 2ELKA 2XDVA 2HKQB 2CW7A 2LQKA 3GTLJ 1X43A 1P7IA 2JT1A 3FXUA 2LP5A 3KYLA 3H41A 3HSBA 4FYVB 2RQQA 2RC4A 5A2QK 3CC2Q 5GMKi 3WVEB 2OI3A 1JUPA 1Z7LA 3E6DA 4KIBA 3E6CC 3ZQHA 1C0MA 3E5QA 1PD0A 1PSEA 1ZUYA 3CMEI 2KJBA 2DEQA 2PVOB 4BI3A 4EMKA 1PUFB 2M4GA 3VS6A 2MABA 5KYNA 2DPPB 4RCCA 1KYZA 4XONA 4DBQA 2VT2A 1KQSA 3CCVI 4XR6A 5K7ZA 4CGZA 3MEWA 3QG1A 2EJRA 2EH3A 2VL8A 5LHIA 4EGZA 1FXXA 2L3QA 3A8MB 1GBRA 2DD4A 3F9KA 1TTHB 1R1TA 2DZCA 2DMPA 3GTPJ 2GOXB 2LMJA 3QAHA 4U87A 3REOA 1DU0A 1W1FA 4M9ZA 1FP1D 4NDLA 2JSCA 4LJZF 3S2DJ 2LCCA 5FLXE 4A53A 1H3HA 2BBYA 2EFOA 4C5HA 5H6QA 4CCJA 1YE9A 4HNUA 1JT6A 1ACMB 1W5TA 3CD6A 4EJUA 2PJRA 1BI3A 1BKBA 2HVSA 4IEJA 1GFCA 4C92B 2JZ2A 3AL0C 3KEYA 1A36A 4B3AA 4BDZA 1E3PA 1MDMB 4LK1F 2VGNA 1FOWA 4FYYB 3TCJA 3L09A 1IHVA 2X4WA 3MHXA 1G3SA 3X24B 1I3QJ 2KROA 1SG5A 1K0SA 2D1XA 1HQCA 3TDZC 2PN6A 1WPYA 2D1HA 3JAMK 3O8VA 4FT2A 3VB2A 3TW7A 4BYYA 2GXGA 2LJ3A 1IO6A 3UKGA 1ZREA 5GMKl 2B63J 1B72A 1H92A 2M7AA 4QVCA 4ME7A 2HZDA 2FNPA 5GAMh 4LN2A 1Y96A 3LSGA 2DT7B 4CUGA 1WJQA 1IUFA 3IC7A 3LSJA 4ELZC 1W7PA 3ZR8X 3I5UA 3CC2T 3OMGA 4L9JA 5L3FA 1Z9CA 4XU2A 4AC0A 3VS5A 2AZVA 1YITQ 1IV8A 3OSFA 1B9NA 4IF4A 4KBMB 1KQ0A 1SD6A 3BCBA 4D9JA 3M0SA 2PX9A 4ZYDA 4IUVA 4EJOA 2ZMEC 4CICA 2DDAA 1VQ6A 1ETQA 2EIKH 5C4JJ 3H6ZA 2HVQA 2EFIA 3S15J 3PQJA 2IGKA 4ZDOA 5HLGA 4UUSB 2A7YA 2DOEA 1ZBJA 3JSCA 3X20B 5LLQA 3I56A 3M8FA 4A3FJ 1U8RA 2M1HA 2YUQA 4XRFA 3Q3SA 2HWVA 2MLGA 2B7EA 3C3WA 2GIZA 3DF8A 3V7SA 3ZRGA 3CCUI 1ZG5A 1LQ1A 1MNMC 1B3QA 2GFAA 5EG2A 2R5ZB 3FM5A 3MKWB 1QKXA 2IS1A 2WAEA 3FXJA 1K1ZA 1ZGWA 2MCNA 2VWFA 2L02A 1SHFA 5LRSA 1YI2A 1HD3A 4Z8AA 2XPWA 2VXDA 2FL7A 4BUGA 2A3LA 4HT8A 1B1BA 1H641 4XLNF 2LQWA 4J6WA 2QQBA 1FSEA 2EQIA 2M9UA 2H8WA 3W6KB 5GANh 2M5WA 4UC4A 5C44J 3SHWA 3TP0A 5LJ5j 1W2BA 4C92G 3E3VA 3DPUA 3JV3A 4KITB 3OYGA 4N4NB 1R6RA 5F08A 1APLC 1LJ9A 2DBKA 3DKYA 5KAFC 4MFEA 5L3EA 1LDKB 1TSFA 2DL3A 5JLXA 2EIJH 2VKHA 1X1DA 1VF9A 2Z3YA 1AOJA 1M9SA 3JCMd 2QQSA 1G2BA 2KVQG 4U0YA 3A01A 1YITT 2J05A 3R60A 2OC6A 2P8TA 2EGCA 3A8HB 2IT0A 1Z0XA 1MW7A 3VRZA 1J3TA 4LUDA 3MVPA 2DMTA 4D7MA 4LIVA 1OI1A 3QQAA 1XG1A 1HSTA 4XOTA 1YIJQ 3Q9SA 1HSQA 4LB6B 1KK7A 2H1KA 2AXTC 3LGLA 4D0PA 5LJ3g 5F6FA 3F8FA 3WODF 4X0GA 3PFSA 2HQHA 2CDTA 3M0RA 2DPDA 3VS0A 4JS4A 4IXAA 1VQMQ 4LD9K 3N05A 3V42A 5IYDJ 3HFOA 1QHHD 2LJ0A 1TLHB 2R5MA 4C5IA 5GAN5 1U8BA 3NARA 4C2UA 2LDUA 4QSHA 3TO9A 4HDUA 2K27A 4MO7A 2P7CB 4YFKF 4F3QA 2E64A 3NMZC 5HS9A 2EKOA 3VV0A 3A2KA 2L7ZA 1J09A 4RB2C 3QOPA 4OMPA 3R6NA 1ETXA 2X6XA 1JBMA 1RI9A 1VQPA 1LUJB 3S32A 1YRNA 3MAJA 5TJJA 4XLPF 1AVZC 2RI2A 4M78A 1VQKA 3X26B 4FE7A 4XL9A 2Y30A 1T95A 5L23A 5KYXB 5DEQA 5EEHA 4M75A 2JMWA 2P5VA 3VUBA 3RERA 2E34A 4YIRX 2K9NA 2KIUA 4EJVA 3CMAI 3EH1A 3PNTA 3J81E 3E9FA 1QP3A 1Q81C 2X9HA 1FP2A 3JCMW 1VQLA 4B6MA 2UWMA 2FEIA 1KSWA 4C8QB 1S8NA 1X2NA 3DLLA 3FMQA 1BB9A 2JVGA 3SD4A 3PIPA 1BA5A 1M1GA 3CC7A 3V8LA 3LOCA 2CUDA 1WXUA 2KRCA 3OYYA 1P4AA 2A61A 4G6QA 2BW3B 3C95A 4M6YA 5ILUA 3DTIA 3EYIA 4HCBA 2GA2A 1GBQA 3PVLA 1Q81R 1YIJT 1P4XA 5TGTA 3OS2A 3FEOA 3J80E 3ZN0A 1JXOA 3L2VA 1NK2P 5GMKe 1MHNA 1DDNA 1T33A 4M3EA 4LLNA 2I2LA 2M16A 2YHTA 1BJZA 3FC3A 1VQMT 3TOBA 3QYEA 4IPAA 2ISZA 4CHUA 5LJ5d 1HKSA 4KGXB 1IXRC 2ZCWA 3F0CA 1RAIB 4M3FA 1ETYA 4A3DJ 2O6GE 3L00A 1OEBA 4UUTA 1ZELA 3S1MJ 3NGPA 2MWOA 3B73A 2XROA 2HQXA 2OTLQ 2FUG2 1CKAA 1K4SA 2NYXA 3MFKA 2FPDA 2M34A 3LSIA 2R0QC 1O3RA 2XRLA 3EG1A 2CRGA 1R00A 1VQ9A 2F4MB 5DY9A 5DD8A 2F5FA 2H94A 2R7DA 2CYYA 3HZJA 1SRLA 3NQOA 3OWTA 5E20A 4IHYA 2RK1A 4BKXA 2DDBA 4BGDA 3I55I 4M7AB 4HLXA 1W4MA 4Q5SF 3GLLA 2LVSA 2QXFA 2Z33A 3LSTA 4I01A 4G6DA 5IYCJ 1QZYA 1T3LA 3QU6A 4GO1A 5GAN3 2C06A 4PCQA 4G9YA 2ADUA 4A0YA 2CH4W 1BR4A 2EWNA 4FL6A 4JZ3A 4E7KA 3UT1A 4XKCA 2ZXHA 2DNUA 2DK3A 1ZUUA 3CCQA 3R61A 3W6VA 3J7AW 2K5CA 3CC4A 5BMZA 2DBBA 1U5TC 2MD5A 1X1CA 2EQUA 3FHNA 1KD1C 3GTJJ 4A12A 2V1UA 1BU1A 2FQ4A 2ZSIB 2WY7Q 1YJNA 4BHBA 3C2GA 1G3YA 1UMQA 4BL0B 1MV0B 4BQOA 1M27C 2B0LA 1HW1A 3SJMA 3GVAA 2OCCH 4CCLA 2M9HA 3H9JA 2MK5A 4M78F 2FX0A 5CQXA 2LDMA 4I2OA 5BQTA 3FHZA 3OIOA 2V1RA 4BEHA 2Y90A 3WTTC 1YYVA 3WGHA 3RKQA 2OTLT 5F27A 1KD1R 3WTSC 2R7OA 4M75F 4C92C 1HJDA 1XGSA 4HF1A 2NOGA 2X0LA 1QA6A 4F7UB 3VSLA 2E71A 2CFOA 3OQ5A 1JJ2A 5CJ9A 1WHJA 2CT4A 2CH0A 3M57A 4HYEA 2CH4A 5A0GA 3DLLF 2STWA 4X6AJ 1DJ7B 3U21A 4JJCA 4ZGDB 1YHQA 3PIPF 5IXBA 1EIFA 4XTZA 4N0AA 4XTYA 2RQRA 1T98A 2EQRA 1HLVA 1MJAA 2O01E 1WJSA 2ROTA 4XRSG 2IAIA 5KNLA 2EZIA 3ASKA 4QQGA 3CCSA 4XQ3A 2E2JJ 1FMKA 2O3FA 3GNGA 1TH7A 1SFUA 4OIOF 2M0YA 3H5NA 2K4YA 2BY1A 4E7HA 1XSDA 2RV8A 4DNCA 2VB6A 3MP8A 5AONA 4G7HF 2Y0SN 3TSWA 5GPAA 1LPLA 2Z0WA 1H8AC 3CUQB 2GWRA 5AIQA 2FO0A 2CP0A 3I59B 3CCYA 2EQKA 3JB9I 2BTTA 2LP0A 4RTTA 1I27A 2VQCA 4M77B 3JB9D 4ETSA 2YX7A 2BGCA 1SF9A 3JRAA 2OPTA 1XGOA 1J9IA 2KAFA 4IHXA 1M1KC 2LC4A 5GJWB 2HZYA 2FOWA 2QQAA 3LSHA 2R5YB 2ZXJA 1M3CA 1H0MA 2M45A 1HKQA 2KZVA 2AK5A 2V1QA 1Q82U 1A31A 2WADA 3I54A 2BV6A 3KEQA 1SEUA 4M7DB 1G2HA 2COZA 3SXYA 1K8AR 3K4BA 3M1EA 1UJ0A 4CSWA 4IKFA 4MFDA 3E1SA 1MNDA 5FLVA 2WBMA 1M1KR 3O8HA 3IUOA 1TOVA 3HRSA 1T0FC 4LD5A 2MZ4A 2LNBA 1R49A 2QDLA 2CSIA 5HCKA 5GMKj 5FKMA 1M90C 4I98B 2VONA 1PRMC 3TMOA 4AFQC 3DEEA 1ZA1B 3N5BB 2ESNA 3OS1A 4KH0B 5KH6A 1QVGA 4OAYA 2ZKZA 1NBEB 1G59A 5HY6A 4WX9A 1O3TA 3D5LA 3MN2A 2FPEA 3VS7A 4M78D 3WE2A 2CP2A 2VBWA 4EJTA 2LYCA 1UECA 3LA3A 1NLPC 1M90R 2YUPA 3IQLA 2GIVA 3U1KA 4FASD 1GXPA 4F7UG 2K9MA 3A52A 4MZTA 3OW2P 3M5AA 4A0ZA 1ZARA 2JT4A 2DL7A 5K1YA 5HDKA 4HBLA 3CC2I 1BOBA 2VE8A 3VPRA 4RBOA 2KSSA 4FT4A 2XG8D 2V1XA 5HLTA 2AXLA 2GAUA 2K4JA 5TISC 2KXCA 3HHGA 1ZGAA 2LNHB 1JT0A 3OYLA 5D7UA 1RLPC 4ITVA 3GEZA 1X1AA 3BT9A 3S1RJ 1T8IA 2E3HA 1VQ8A 3FXOA 3RQ4A 1QWEA 5F0FA 1WWXA 2A6EF 4UY8I 3HOYJ 2KDZA 3CCLA 4II3A 2CJJA 4BNCA 1VQ7Q 2M1BA 2Y4YA 1SKUB 2QSHX 2DYSH 3GWZA 3M07A 1QNTA 2CGPA 3FM3A 4AIKA 2JM9A 4JPBW 1K76A 5DM7R 1XCVA 3FB9A 3CXCS 4PGGA 4M77G 4M74A 4B47A 5EG0A 3TSZA 3PNWC 3O2PE 4R79A 3PJRA 4XAXB 4Q47A 2L3RA 3BY7A 3EG9A 2CZ6B 5GJVB 2R7TA 1DUXC 2RHXA 3OYJA 5IP9J 4D1QA 3VYTB 5KYWA 5D5UB 4LMYA 3KXTA 4BS9A 1PG5B 1Z9ZA 5K5RA 4K11A 2DK5A 3K1NA 1XGNA 4M73A 4PSXA 5K5QA 3F22A 4M7DG 2CUFA 1OKRA 2RJCA 2Y0SA 1EFNA 1TT0A 3HOWJ 2JNGA 3ABMH 2IP2A 2ABLA 2X4YA 3KFWX 2KYMA 2X3XD 1AWWA 2MPXC 3G71Q 1GV2A 1TNTA 4A2UA 4XBFA 4KIFA 3OYDA 3K0LA 5ECAA 5FW9A 1I5LA 2HU9A 2HL3A 1S5LC 1RRJA 1RR7A 2K4BA 1U9OA 2K9QA 2XAGA 1R8OB 1ON1A 1FY7A 2NNYA 1S7AA 3DBLB 3ECOA 1WJAA 4YG2F 4TVRA 3DV8A 2V9VA 2KL4A 1EF4A 2ME0A 2LBFB 3MKLA 2YSRA 2A3SA 1YITI 2WSCE 3PIOA 4M7AA 3FXRA 2FF4A 3CF5F 2P5LC 2BE7D 3SEMA 3CCMA 5J1UA 1QWFA 3V8KA 3MKYB 5JI6A 2EA4A 4A4EA 4Q4ZF 4J9GA 1WKMA 4LIUA 1BC8C 3QXEB 3FK6A 2DMNA 1W36C 1VQ7T 1WQ2A 2W1OA 2E5QA 2GCXA 3AG3H 1E6GA 4NOYA 2QA4T 1RABB 3CCJA 5E3NA 3HSFA 2EJGA 1TWCJ 3VOEA 2EKHA 3KP4A 2E35A 3L2RA 2DX1A 3KLOA 3NEUA 2WSFE 1U6GA 4FE4A 3LH0A 1OCOH 1RAFB 5C4XJ 3CQZJ 2XPUA 5DCMA 4QWQA 2M0CA 4LUEA 2AO9A 1T2KA 4PJOG 4DYCA 5GP9A 5ICFA 2M87A 2JZYA 2VJ4A 3PTAA 5LEJA 1UHWA 3R6SA 3CPWA 5IT9Z 3OYKA 2M02A 4A63B 4BY6C 5I22A 1UGQB 2P4RA 4JRKA 2IGMA 3L2WA 2DRMA 1Q7YU 4HA8A 3H0DA 2MC3A 1I5OB 2NXNB 3FIFA 3K1PA 1J75A 2L7KA 2RI5A 1C0WA 4L5JA 4IL6C 2ZNZA 5LJ3h 3T1BA 4AWXB 2V9PA 1K7AA 1IF1A 2DIQA 3F8MA 4RM3A 5CKTA 5J26A 3ROUA 3Q0UA 3G71T 5JR3A 3KZIC 4EMKB 1UGRB 2X6YA 5D6EA 1DQUA 2BZTA 1TWAJ 4CI0C 2ELJA 1BJAA 2X98A 2DYBA 4LLLA 4B09A 3RPUA 1JJ8C 1RAEB 2X1EA 3BTLA 1RUWA 1XX5A 3FXKA 4U88A 2NVQJ 5CKHA 1XGMA 1VQ5Q 1H8KA 4BHCA 1UE9A 1AWXA 1K6YA 1TBXA 3SDBA 5IT9R 2RK2A 2WB1N 2M51A 6PAXA 2P0QA 2CQNA 3SHFA 1I50J 3VODA 4II1A 1OYWA 1X3WB 2VUBA 2QBYB 3EGUA 3CMEA 3URGA 2LC2A 2NS0A 4B44A 1Y7XA 2A28A 2XMFA 5A0LA 1VZ0A 3EG2A 2GNCA 2WACA 1ZSZA 2CT3A 5GAOl 3CCVA 4CC4B 1YIJI 1Y8RB
chains in the Genus database with same CATH topology
2EYQA 4NQWA 2IVWA 2ZPEB 4N4HA 1I1SA 5DV5A 4FX0A 3FXQA 3ZFJA 2PU9B 5A2QZ 2ZPBB 4GCVA 2UZKA 3QJ6A 4C92E 4OU0A 5ILSA 3E5XA 4XU3A 3KP7A 1UEBA 2DW4A 3BDUA 1XNIA 1Y96B 3VYHB 2PEXA 3HTUA 2E12A 4OIQF 1W7PB 2IRFG 5LHHA 2FOKA 5CO7A 2R58A 4HW0A 4M7AF 2STTA 3BROA 2ZBKA 4C5GA 1P4WA 4EM0B 3SWN