1G3YA

Arg80ala dtxr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
212
Chain Sequence
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHALAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAAMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRHITLSHNGKDVELLDDLAHTIRIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of three diphtheria toxin repressor (DtxR) variants with decreased repressor activity.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
molecule keywords DIPHTHERIA TOXIN REPRESSOR
total genus 67
structure length 212
sequence length 223
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g3yA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1g3yA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g3yA03
2R7DA 3KEOA 2O8XA 1FZPB 1O7LA 3IWFA 4Y17A 1F4KA 2PJPA 1XGMA 1IXCA 2L4AA 3H3UA 4KN4X 3QRFF 5A2QZ 4EV0A 1IXSB 1Z91A 1FYKA 2OQRA 2XUBA 5ED4A 4WX9A 2D1HA 1LNWA 5ICCA 2F5EA 3WODF 4RB1A 2DK5A 1FP1D 4HDUA 3BDDA 3F72A 1EH7A 1LDDA 2W84A 2F5FA 2IT0A 1EV7A 2EFQA 1YW8A 3TOBA 4JQFA 3LQQA 1U5TA 3GF2A 3GEZA 2P8TA 1T6SA 2FSWA 2W57A 4Y15A 4ZZDA 4RAYA 3JTGA 3RIRA 2VC0A 3CJNA 5DCFA 1O3QA 3RPUA 3EDPA 4MEYF 1ONVA 1OYIA 3U9GA 4JK1X 1P2FA 5D6FA 3RYPA 4P55A 5LHIA 4YIFA 1P6RA 3TO6A 4QLCU 4YG2F 2OU2A 4KYWA 1KA8A 1MDMA 1O57A 2HKOA 3W6KB 1CF7B 2M1BA 4PZJA 5BS6A 4RGSA 4EM2A 2GAUA 4RGUA 2YSRA 5JHUA 3ROUA 1X3UA 5TJJA 2FNAA 3GVAA 2PG4A 2LSOA 1XN7A 4OMZA 4UVAA 1YTYA 2EFWA 5E8IA 3QP6A 2KKOA 3Q9SA 4R79A 3I54A 5D8LB 4D0PA 1TLHB 3QPTA 2Z9OA 2JSCA 4RAZA 3WU0A 1G3TA 3ELKA 1GXPA 3MHXA 1FY7A 3JAMZ 3RDIA 4EM1A 1V3FA 1JHFA 5FGMA 1KU7A 2CYYA 5H6RA 3GWZA 4S04A 4CICA 5HLHA 2V6CA 1KYWA 2V9VA 5ICEA 2EFPA 3GLXA 1S3JA 4U0YA 4BYYA 1J2XA 4HF0A 1TQPA 2H6BA 3LA3A 2YX4A 4OIOF 3BP8A 4UHTA 3BY6A 3KFWX 1GXQA 2FBKA 2HYFA 2FNPA 5JFRA 4BH9A 4KNYA 2STWA 3TOAA 3DV8A 4CDGA 2EA2A 1XDSA 1ODDA 4IVNA 3T5XA 4OU0A 2M87A 1HSJA 2ZNZA 2ADUA 4I98B 1B4AA 1YS6A 1RZ4A 2IP2A 4L9NA 3BZ6A 1TBXA 1XSXA 3WGGA 3O3KA 4HW0A 2V1XA 1F1ZA 4M9ZA 1QVPA 3E6CC 3WGIA 1ZN2A 3NEUA 2DW4A 1KQ8A 5L3FA 3SQNA 4LG0A 4KIBA 3C7JA 2Z99A 2E1CA 2F5DA 4CXFA 1R1TA 5IT3A 2H09A 2AXLA 1UCRA 3V8JA 3BPVA 2UXXA 2P4WA 3CUQA 5JI6A 4KIFA 3COAC 1YQAA 3TDZC 2FBIA 2NYXA 1UB9A 5F64A 1IUYA 2P6SA 5JR3A 5LRRA 2BGCA 5LGNA 3VODA 4G7ZF 3KE2A 4XRFA 3U1DA 4HYEA 3HIFA 1LEBA 3J81Z 5D5XB 3V4GA 4L5JA 1WQ2A 2IVMA 5K5OA 1XB4A 2VC1A 4HAMA 1H9GA 2ZXJA 1BI3A 2XROA 4EJOA 1MJBA 3VEPA 1YO5C 1PP8F 2DPDA 4KFCA 1P92A 3CDHA 1B6AA 1W4MA 3VOEA 2K5FA 4DQ2A 3T8RA 2WC2A 3ZN0A 2GIVA 3ABUA 3L00A 1HQCA 4L18B 4KN7X 5BPIA 2QENA 4ZYDA 1YYVA 1XGSA 1KU9A 3F8NA 3HHGA 1QW1A 3D0SA 2EFOA 1MZBA 4Y13A 3FMRA 3LWFA 1FBQA 3DQVC 4LD5A 1ZREA 2CWEA 3L2CA 2XAGA 3M8FA 4L0ZB 5LEKA 1BM9A 2UWMA 1R36A 1EH6A 1XCVA 3ZMVA 5J8CA 3J80Z 5IT9Z 2W25A 2ZBKA 3HRTA 4ZZLA 4ZH4F 2VBYA 5DDGA 4XSZF 3GUDA 1IXRC 5D5VB 3IRRA 2BEOA 4PCQA 1B9MA 4PDKA 3DFGA 5FD5A 2IA2A 4CYDA 4B09A 1G3WA 5D5WB 2O0YA 3GO5A 3T0YA 3I0TA 4Q48A 4KICA 4MNUA 3MWMA 3IKVA 2E1NA 4PGGA 3CLOA 5D8KB 5LBQA 1RIOH 2NS0A 1Z6RA 2VOOA 2MD5A 1XCBA 1S7AA 2GXGA 1W5TA 1XSVA 1ZLJA 3DKWA 3M9AA 5BMZA 1QGPA 2VE8A 5DD8A 1D8KA 4L9VA 1ZHFA 5E1WA 1TNSA 3FHZA 3FXQA 3CTAA 2XKOA 1I5ZA 1FX7A 5HDKA 2IW5A 2D2WA 1U5TB 3SZPA 4KUMA 3GZ5A 2Q8KA 2A6HF 3LA2A 3BJOA 2XGXA 3V8KA 4LB6B 2VBWA 5ICFA 4E70A 1DUXC 5DUIA 2CGPA 1ZGJA 4L9JA 3GX4X 2QBYB 1BC8C 2XASA 1TTYA 3KLOA 1H9TA 3HUGA 2K5IA 2XIGA 3HYIA 5HS9A 2OD5A 4I0BA 3TO7A 3ECHA 2VONA 3F3XA 2RDPA 3GYHX 3QU3A 1W5SA 4HZFA 1FP2A 3WTVC 1K78A 5CJ9A 2DT5A 2Q2EA 4ENKA 4HDVA 1IN7A 1FSEA 3PQKA 3WE2A 3R60A 4R1HA 4G6QA 4NQWA 1RUOA 3MAJA 3AAFA 3F6VA 1YFHA 1J0RA 3FM5A 2BE5F 3C3WA 3F23A 1G4DA 3DPTA 3IKTA 4YIIA 4CZZA 5L3DA 3L09A 4XBFA 5HLIA 2CFXA 3HOTA 1WWXA 4WWCA 4A2UA 2DI3A 3KP4A 1R00A 2H27A 3GZ6A 4AIJA 4IXAA 3RKXA 4HA8A 4BHBA 2QYOA 3F8FA 4U0VA 3BWGA 3DF8A 3Q5FA 5JVTA 5CVVA 1QQIA 2RKHA 3DPLC 2O6GE 4HOBA 2DPUA 1QO0D 4M74A 1J59A 3OV8A 2LF7A 1HW2A 4IJAA 1L0OC 2ZFWA 1G3SA 3ECOA 1DP7P 3S2WA 1D3YA 5A2QK 2LX9A 1MD0A 4GXOA 1IN5A 2C6YA 2XKPA 4Q4ZF 2DU9A 1PUEE 2K27A 3F22A 4TV7A 1Z05A 1REPC 2OBPA 2PN6A 2FRHA 2Y48A 5HS8A 4BQAA 2Y75A 2MA3A 3NQOA 1S6LA 2QZ8A 5CYVA 1QNTA 2ACJA 3E5QA 3FMQA 3ZMZA 5E17F 1TQIA 2B0LA 2WV0A 1FC3A 4LLNA 5E18F 4LFUA 2O03A 1ZRCA 2VT3A 3WTSC 3HOSA 5TRDA 2JPBA 1SD5A 4HX8A 3ZMDA 1FOKA 1LDKB 1G3YA 4OOIA 2HZTA 3V7CA 2Z3YA 3I58A 1BI1A 4LG0B 2JPCA 4LMYA 4IRGA 2V1DA 4KT5C 3LA7A 3SHFA 5FB2A 4UVCA 4IRIA 4MTEA 3BJ6A 2DK8A 5AONA 5ERIA 2ZKZA 1DPUA 4LJZF 4WXCA 3U2RA 2YPRA 1ZGAA 3JSPA 1USTA 3G3ZA 1XMAA 1MKMA 2RC4A 2EA4A 3RJPA 2G9WA 3RKYA 3J81K 2QLZA 1U78A 4Q5SF 2KJCA 4BXUA 4G9YA 2O61A 3OOPA 2XAFA 4IF4A 3MZYA 1T0FA 2IA0A 3FXRA 2DTRA 3CO6C 1P4XA 5E8GA 4P9FA 1FBUA 2FOKA 2QVOA 5IT9K 2AS5F 3P7NA 2ZO4A 3H92A 2GQQA 1VTNC 4XLPF 2YR2A 2EK5A 3IRQA 2QM3A 2HS5A 1JE8A 1O3RA 1AOYA 3JSOA 2CW0F 2ZCWA 3RI4A 1GVJA 1EH8A 4M71A 1RUNA 1HSTA 4I7HA 2VE9A 1PP7U 2FQ3A 2EFNA 4U7DA 4EM0B 3K69A 3MCZA 1XSDA 1W7PD 1XDUA 2P7CB 4XSXF 1T2KA 1SD4A 2GA2A 2QWWA 1USSA 1DDNA 2EB7A 1FLIA 1YS7A 4WCGA 1UHWA 1W7PA 5E1ZB 3KZYA 2JZYA 3E6MA 3WTUC 4HF1A 2DO7A 1FWZA 5D4SA 3IC7A 4QWQA 1HKSA 2RGVA 4G7HF 1LVAA 5K5RA 1KU3A 2G7HA 2BV6A 2L3DA 2FEZA 4KA4A 2M45A 3BJAA 2ETHA 2MH9A 1H0MA 3IL2A 4MEXF 1ZRDA 3I53A 5FD6A 4HX4A 2PEXA 4KDPA 4S05A 3WTZA 4GCVA 1R1VA 5LRSA 2LDUA 3T1BA 3WE3A 4P9UA 4R8HA 1ZRFA 1BIAA 3GFJA 3R0JA 2IRFG 5LGTA 4HQEA 4RB3C 3RTRA 3K2ZA 3QU6A 4P96A 5DCMB 1ZH5A 1SFEA 4UV8A 1I1GA 3BOQA 3V7RA 5BOXA 5KVRA 5DUKA 2KJBA 3P9IA 4LLLA 1YW9A 1WSUA 2XRNA 4A0XA 4EJTA 4OINF 4Q47A 2VN2A 1HKQA 5AIQA 1CGPA 4L0YB 2K02A 2RV8A 1FSHA 2EV0A 3HRUA 4O5VA 3RPQA 1ON2A 2PQ8A 5DCMA 4YFXF 3E19A 2F2EA 2JT1A 3GFMA 2J5PA 3J80K 3KP3A 1O3SA 1O3TA 3E5XA 4WXHA 1BN5A 1R5GA 2M5WA 1BOAA 1R7JA 2LF8A 4BAYA 5FFZA 2R7FA 3ZP5A 1ON1A 2Z5UA 1K78B 4H0EA 2RVCA 1OPCA 4BHPA 1SMTA 2A3SA 3KZZA 3V8LA 4N0BA 4AVPA 3LSTA 5FO5A 1XMKA 2WTEA 1K7AA 4LGWA 4HF2A 3K1MA 2QBYA 3T8TA 1MJAA 1K6OA 4EJWA 1YLFA 4RS8A 3BPXA 2IA1A 3ZMTA 2XAJA 2PI0A 5ICGA 2STTA 3I64A 4EMSA 2MH2A 2D45A 1A04A 3SZTA 2L01A 4KIGA 2DQLA 1YW7A 4ESJA 3LQRA 2GWRA 2NRAC 3IWZA 3B02A 1K79A 3LAPA 3ZPLA 1R1UA 3P9KA 1OMIA 1GHCA 1WI9A 3WU1B 3WGHA 1XGOA 4MQ9F 1B9NA 3KLNA 4Z2YA 3EETA 1U3EM 1SMYF 2VODA 1QZYA 1BYMA 2P5KA 5D4RA 1I6XA 3R0AA 3I59A 2HDCA 3CO7C 2IPQX 3DEUA 3LFKA 2EV5A 2VBXA 4IPAA 2A69F 4EGYA 1TW3A 2KIFA 2F5CA 4KMUX 4XLNF 1ULYA 4ENNA 2L54A 1U5TC 2QUFA 1WKMA 2V1UA 4CGZA 2ELHA 3I4PA 1OKRA 1OYYA 2VXZA 1Z6TA 1R5HA 4G7OF 2VOPA 3QPHA 5LLQA 4B8XA 1TQMA 2EV6A 3HSFA 5DV5A 2A5YB 4UVBA 5CVRA 2OAZA 3KP7A 4OMYA 2ZJ2A 4GYGA 4RGRA 2A68F 3N97A 3WTYC 1SD6A 2FU4A 4HLXA 3M8EA 3REOA 3FWEA 4WF2A 2XAHA 4HX7A 5EEHA 4ON0A 2VT2A 1S7OA 4EJUA 4A0ZA 5ILSA 2KIMA 5L3EA 3SXYA 1LJ9A 4I01A 4G6DA 4I09A 4HBLA 3SFZA 3F8CA 1J7KA 2ISZA 3L9FA 3R61A 1BI2A 3KCCA 4M73A 3W6JB 2RN7A 2ZMEB 3D5LA 3TDUC 3RKWA 3HRMA 3HRSA 4U88A 4ESFA 5EEGA 1F9NA 2HYGD 1O7FA 5FFXA 4A0YA 1FT9A 1MDMB 4I2OA 3F8BA 4FX0A 2Q0OA 2WWYA 1SAXA 2BYVE 2FA5A 2HQRA 1Q1HA 1C0WA 5HOOA 5LHGA 1NHAA 3KEQA 3E97A 2DLLA 2ISYA 1FBSA 4NB5A 3F8MA 5D5UB 1I27A 4EQQA 5K5QA 1LQ1A 2MLGA 2K4YA 4AIHA 1D5VA 4G8XA 1J5YA 2PBIA 2FBHA 2COMA 2XAQA 2M30A 4A12A 1OR7A 2LKPA 1KGSA 3MZHA 5KK1A 1IW7F 3E5UA 3QAHA 3M1EA 3ISPA 1E2XA 3JTHA 4F7ZA 3C1DA 2EWNA 5HVQC 3JAMK 1JHHA 4RB0A 1HBXG 2P5VA 2ESHA 4IHTA 5DD4A 3K0LA 4MTDA 2QQBA 5CVIA 3PFIA 2G7UA 2J5OA 2HWVA 5ILVA 4LK1F 1FNNA 4UNOA 5CVUA 1F5TA 4LK0F 2OZUA 3KETA 4HV6A 5LHHA 2NNNA 3I5UA 4HLYA 4ETSA 4G94A 5D6EA 1LEAA 2ZNYA 1ZLKA 1QPMA 1J75A 3VFZA 2CQKA 3KP2A 2H6CA 5L3GA 1Z7UA 1AWCA 3FF5A 4O3MA 3E6BA 3NRVA 3DP7A 3JW4A 2TDXA 3V7SA 3WTXC 4ESBA 2PMUA 1PDNC 5FLXK 5CLSA 4AD9A 4M9SA 4K2EA 4HQMA 1T38A 4HV5A 2CO5A 4NHJA 5L3CA 3K9TA 3GXOA 3C18A 4I0AA 2OQGA 1YIOA 4OIQF 3F21A 2HFHA 1KQ9A 3RYRA 1LDJA 1OYWA 3F6OA 4OIRF 2DAOA 4ASNA 1HW1A 1QBJA 3KP6A 1IAWA 1Z9CA 1BIBA 3HSRA 5F6FA 1LB2A 4EJVA 2LNBA 3HHHA 2HTJA 2P6TA 2HOEA 4I02A 2FXAA 2P5LC 4A6EA 3TQNA 2MC3A 4AIKA 1S8NA 4N9HA 1BI0A 4M6YA 3Q9VA 5AIPA 3P9CA 1J9IA 1MJ9A 2E7WA 3DXJF 5LGUA 1ZG3A 1SFUA 2NNYA 1ZARA 2FF4A 2FE3A 2EJRA 4UV9A 2GCXA 2GA1A 5H20A 2W24A 3LAJA 3M7GA 3EYIA 3I59B 4ENMA 2DQRA 4O6JA 2L4MA 3KP5A 1V4RA 1FYLA 4L9TA 1U6GA 1JXSA 4UXNA 4EGZA 3EQLF 1IRGA 1D8JA 5DEQA 2L02A 1IF1A 4BNCA 1DPRA 2ZMEA 2FMLA 1S29A 2UXNA 3ERED 5ILUA 1U2WA 1IZ1A 3ZMUA 2QQAA 3J7AO 4LB5A 4MQVA 3GFIA 4WXDA 3FXUA 4CO8A 3O2PE 5E20A 2HGCA 2W85A 1P4WA 5HS7A 3I71A 4FHTA 1B59A 5H6QA 1WRJA 2K4JA 4KMFA 2A61A 3ZN1A 2H3JA 3HTUA 4RGXA 3E3VA 2XVCA 2HQNA 2Z33A 3GFLA 2XV4S 1R22A 5L3BA 4OIPF 2OA4A 3K1PA 4UUVA 1RNLA 2GZWA 1Y0UA 4L5IA 2QQ9A 5BPDA 3FMSA 1T39A 5HDGA 3QP5A 1L3LA 2CG4A 2XHKA 1ZYRF 2HR3A 1IN6A 3MQ0A 4A5NA 5J8FA 5HLGA 1T98A 3BROA 4RB2C 1G6NA 2PLYA 1CF7A 2X0LA 5K1YA 4A5MA 3MEXA 2RQPA 3HSEA 1IRFA 4WK8F 1UFMA 1ZG5A 6PAXA 3K1NA 2X4HA 5LEJA 4N9IA 4ZYGA 1JGSA 4GGGA 1E17A 2JRTA 2M8EA 2YU3A 4ZYEA 3HTSB 2NAZA 1P4AA 2KIUA 4JBAA 3B73A 3L7WA 2IJLA 2A07F 2HKXA 2K4BA 1RI7A 3TGNA 2Y0MA 2JTVA 3CUQC 3WTWC 3MFKA 3N4MA 4P5OA 1R23A 1I1SA 3FX3A 1ZAOA 2MLKA 4LLGF 3VB2A 1STZA 3EUHA 2CSOA 2OZ6A 2V79A 2K86A 2YX7A 3FM3A 5HDNA 4EVIA 4AWXB 2H94A 3TO9A 5FLXZ 3CUQB 1BBYA 4FX4A 2KRFA 3ML6A 1MGTA 3GW2A 2A6EF 1SD7A 2D1VA 3WTTC 2O3FA 1KQ0A 2ESNA 1HW5A 2VBZA 1R58A 4GYIA 4U0WA 2E7XA 3IHUA 3G73A 2RNJA 3EYYA 1U8RA 4YFKF 2PFBA 1HXDA 3FZVA 1KYZA 4M9XA 4A6DA 4FT8A 4GO1A 1IN8A 5BQTA 4ZYHA 2BBYA 4IHSA 3ZQ7A 1B1BA 4YFNF 1FYMA 1SFXA 2UZKA 4PGHA 4MGRA 3O6BB 3TKYA 1W7PB 1BC7C 1YG2A 1XD7A 5DYMA 3R6SA 2HEOA 2DBBA 3ZMSA 3CUOA 1TW2A 1HKTA 1QZZA 5F1RA 2PMHA 4IRHA 1ZG1A 1XGNA 2P7VB 3ABTA 5J6XA 1Z1DA 4BHCA 2R3SA 4M72A 4U7BA 3H3ZA 2DFIA 4CHUA 4ENJA 1IN4A 3WG9A 4DNCA 3E6DA 3QOPA 3PQJA 4MHGA 2K7LA 2FMYA 2K5LA 2HTSA 2GXBA 1UHMA 1KU2A 2MBFA 5E1XA 3ULQB 3R4KA 4M6XA 1FPQA 1BJAA 1TNTA 5CVJA
chains in the Genus database with same CATH superfamily
2R7DA 1M3CA 3KEOA 1WIEA 2O8XA 2HVRA 1VQNQ 4JYKA 3J7YJ 2R5YB 5C3EJ 1FZPB 2NUPA 2CQXA 1O7LA 5CKBA 3A03A 3IWFA 4Y17A 2AZVA 1F4KA 1GUUA 2PJPA 5J39A 2ZB9A 1YJWA 1XGMA 3KX2A 2GNCA 1B7TA 1IXCA 2VQHA 2VJJA 2KNBB 4XN0A 2L4AA 1SPKA 3H3UA 1FMWA 1Y1VJ 5K7ZA 4BE0A 2W7NA 1JGGA 4KN4X 3QRFF 2BHYA 2K57A 4B4CA 5I2SA 2KXDA 4BE2A 5A2QZ 1MBHA 4EV0A 3G6ET 1IXSB 1Z91A 3PNYA 2RQRA 2WAEA 2XPVA 1FYKA 1YN8A 2LMJA 2OQRA 3CEYA 1OR7C 2YXYA 2XUBA 5ED4A 4KH1B 5A0GA 4CCKA 1LUJB 2M8GX 2NXNB 2D1HA 3IH4A 4WX9A 1LNWA 1FJLA 5ICCA 3DKMA 4OB2B 4M7AF 1M8MA 2WACA 3BG6A 2F5EA 1QHHD 2X1EA 3WODF 3HTRA 1GFDA 4RB1A 1BOBA 1G59A 1X43A 2DK5A 3Q1JA 1FP1D 4PFPA 3SDGA 4HDUA 3BDDA 3MEAA 2CT4A 1YI2A 3F72A 1EH7A 4W97A 1LDDA 2W84A 2IVWA 2D6FA 2F5FA 1VQ8Q 2IT0A 1UEBA 4OGEA 3I9QA 2X3WD 1EV7A 2EFQA 3DTKA 1AWWA 3M0QA 1YW8A 1SEUA 1ETXA 2RO0A 4H4KC 3DB3A 3TOBA 1VQ4I 2OTJT 4JQFA 1OX9A 3LQQA 1U5TA 3GF2A 3URGA 3GEZA 4FM4B 2P8TA 1T6SA 4I6ZA 3TW6A 1YJNI 2LBFB 3HKZA 1M30A 2M16A 2FSWA 1HLVA 2W57A 4Y15A 3W6VA 4ZZDA 4RAYA 2G3RA 2LQ8A 3LOCA 1UB4A 3CCRQ 3MKWB 3JTGA 4A4GA 3A52A 3RIRA 2VC0A 3CJNA 3JCUC 5DCFA 4XKBA 3RPUA 3LSJA 1O3QA 2VJ4A 1AOJA 3EDPA 4D5FA 3NFCA 4MEYF 4J9GA 2LLKA 4J9HA 4OMLA 1FYNA 1ONVA 3M0RA 3JCMP 1OYIA 4ITVA 3U9GA 2R7XA 3CCEI 1N6AA 2MAMA 2K9LA 4JK1X 1P2FA 5F1JA 2M0OA 2A5WA 1JTYA 2BZTA 3GBQA 5D6FA 4M7AG 1WH7A 3S3OA 2AHQA 5JHFA 3EG9B 4MDXA 1JRIA 2XF5A 2Z0WA 1K0SA 5L8RE 4M4ZA 2RK1A 3S3MA 3QUIA 3RYPA 3M9QA 4P55A 4X9CA 4M7AE 5LHIA 2Y0SN 4BE1A 4YIFA 3TL4X 2A28A 1P6RA 3NMZC 3TO6A 2ZPBB 5J3BA 1P7IA 3WXMB 3MJXA 5FKNA 4QLCU 2WSEE 3ZCOA 4YG2F 5GAOq 2OU2A 4KYWA 3ZEHA 1KA8A 4XLCA 4ZYAA 1MDMA 1O57A 2HKOA 2GXAA 5FLXR 3W6KB 2PUKB 1VYVA 4DBHA 1CF7B 4JJNK 2YUSA 2M1BA 4PZJA 4JOMA 5BS6A 1T8IA 2RB6A 2ED0A 1GXIE 2WAFA 4RGSA 4EM2A 2GAUA 4RGUA 1PWTA 2YSRA 1VQKT 3S1NJ 1VQ5I 4LDWA 5JHUA 4M7DG 4HEA2 3ROUA 1UG2A 3W2VA 1X3UA 2XAUA 5TJJA 2FNAA 4ATOA 2ZXIA 4JDSA 1YOVB 3C2HA 3GVAA 2PG4A 2LSOA 2OTLI 3X28B 1XN7A 4OMZA 2AT1B 4UVAA 2F69A 1GBQA 1YTYA 1OCTC 3DBHB 5HODA 3I55I 3MEWA 4XTXA 2EFWA 1YJNT 5E8IA 3QP6A 2KKOA 4J8OA 1YIJT 3DLLF 4HVVA 3L2UA 3Q9SA 2L3SA 4R79A 3QG1A 3I54A 2OC6A 5D8LB 5E3LA 2X98A 4D0PA 5GAOl 1TLHB 3QPTA 1ZA2B 1ZQ1A 3BC8A 4IZZA 2Z9OA 2JSCA 3FK7A 2CDTA 3QDFA 1NH3A 4PJOB 1V55H 4RAZA 3WU0A 2C0IA 2DIGA 1G3TA 3HBLA 2E2IJ 3JCMb 1VQ4Q 3ELKA 2DAQA 2F5KA 3LL7A 2E6ZA 2M2EA 1GXPA 2RHUA 3UPUA 1YJ9A 3CCET 3MCAB 3MHXA 1FY7A 2VKVA 3ERMA 1SFKA 3JAMZ 5GMKm 5D6YA 2KP6A 3RDIA 4EM1A 1OQKA 1V3FA 4J9EA 1K0XA 2DMTA 2X4WA 1ENHA 2RQVA 3JB9H 1VQLA 1JHFA 5FGMA 1KU7A 2DE0X 4TVRA 1QVGA 2PNIA 2CYYA 5H6RA 2DT6A 4QVDA 4CI0C 4JX6A 2E35A 3GWZA 4UB8C 4S04A 4RMNA 4CICA 3DU6A 3H5AA 4J01A 1BU1A 5H2FC 3VS4A 3CPWS 3JRIA 5HLHA 2V6CA 2OJ2A 3JCMf 1KYWA 2JTMA 2V9VA 5ICEA 2EFPA 3GLXA 1Y0MA 2FVUA 1S3JA 1GV2A 2CH0A 2L7FP 2K3YA 4U0YA 4D1QA 2DERA 4BYYA 1X6BA 2HVQA 2EH3A 5CKHA 1RACB 1J2XA 3DKYA 4HF0A 2O8KA 2O9SA 2PTKA 1TQPA 2RQQA 3OBYA 3CC7A 3JSCA 4JS4A 1N8RU 3BTJA 3CMEA 2IGMA 2H6BA 3LA3A 2YX4A 4ELZC 3S15J 3UA6A 4OIOF 2UUZA 2DYRH 2RREA 3CBPA 3BP8A 2Y0SA 2IS1A 3CCLT 4D9JA 2LY1A 4UHTA 1VQKI 1Y71A 2VASA 3LSRA 2VI6A 3BY6A 1QVGS 4KBMB 3KFWX 4DOZA 1GXQA 3A02A 2FBKA 2QAZA 2AK5A 2HYFA 5KE2A 5KHDA 3PIPF 3E9GA 2EYZA 2FNPA 1JBMA 2WA0A 2HXOA 4HSTA 5JFRA 1YITA 8AT1B 1YIJQ 1HD3A 1F43A 1RAGB 4BH9A 4KNYA 1YJNQ 2STWA 3TOAA 3Q0UA 4XU2A 3DV8A 1KONA 4XNFA 2EA2A 1XDSA 4CDGA 1NZ9A 1ODDA 4IVNA 4MMKA 3CCJA 1VQ9I 4UUSA 2HOAA 3T5XA 2V9PA 4OU0A 2M87A 1VQ9A 3DU5A 3N5BB 4PKCC 3UATA 4M77F 2GLOA 1HSJA 3G71A 2ZNZA 1MMAA 1H8KA 2EBPA 3OB9A 1G83A 1U9NA 2ADUA 2WAQA 4I98B 1B4AA 1E0EA 1E7OA 5EG2A 3GZNB 1YS6A 1RZ4A 2ZSIB 4DOWA 2IP2A 1ZA1B 2K5CA 4L9NA 3BZ6A 3PIPA 1TBXA 1XSXA 3WGGA 3H0GJ 3O3KA 3M4OJ 2DFEA 1M90C 2VJ5A 4AIDA 2JQ7A 3BR6A 3ABKH 4HW0A 2V1XA 4RAFA 5EG0B 1F1ZA 2FX0A 2P0KA 3A01A 1D1AA 4XLAA 3BW1A 4C8QA 4M9ZA 3ABLH 4XORA 4C0FA 2X6OA 1AKHB 2M0MA 2HDAA 4OP0A 1QVPA 3E6CC 5KYYB 3WGIA 2KIQA 5J1RA 1ZN2A 3EUHC 9ANTA 2QQSA 1MNEA 1PKTA 3H9NA 3FBNB 3ABMH 2DW4A 3NEUA 1D5YA 5L3FA 1KQ8A 3J81R 1OOTA 2JTEA 4RTXA 1E6HA 3SQNA 4LG0A 2KDOA 3CMAI 3JRFA 2X6WA 5B1BH 3BE3A 2CW8A 1OU8A 4ZJZA 3L2WA 2EKHA 4KIBA 4JJDA 1JTXA 2EPDA 1Y39A 3C7JA 1YI2I 1I07A 2ID6A 2Z99A 4J19A 2VKDA 2E1CA 2F5DA 1I81A 3CPFA 4CXFA 1R1TA 1D0ZA 1XMXA 2XC7A 4QVCA 5IT3A 1MV3A 3QO3A 4M77G 1SVMA 5GMKl 1Y0NA 2H09A 2AXLA 2MIOA 4AFQC 3OYNA 1UCRA 3V8JA 1MMGA 2E4HA 3HGYA 1ZR2A 3BPVA 3PUBA 3PMTA 2UXXA 4C0DB 5LJ5d 2P4WA 1OZ2A 1K73C 3PFSA 3CUQA 4JZ4A 2HOTA 2J05A 5GAOm 2VUMJ 2K9QA 4JP0A 5JI6A 4KIFA 3VWBA 5LJ3f 3COAC 4AMCA 4FW1A 1YQAA 3TDZC 1QKWA 2FBIA 2HPIA 1PHTA 4RTYA 2NYXA 5GANe 2V9KA 1UB9A 2LCLA 2EYYA 1BJZA 4XM3A 1VA7A 5F64A 4BUGA 1IUYA 2P6SA 1RRJA 1VNDA 3QWXX 5JR3A 2E10A 2WY7Q 3FXKA 5LRRA 2BGCA 2R0QC 1T0HA 4DA4A 4GBQA 1YHQA 1Q81C 3CCUI 5LGNA 2L9RA 4IKFA 1M90U 2NUPB 3CCMQ 3VODA 4XIDA 5IYCJ 4V2GA 3KZIC 2VQGA 1MSEC 3HP9A 3S93A 3BR3A 3VU3C 3KE2A 4G7ZF 4XRFA 5GAMd 3U1DA 4E7SA 1K1ZA 4HYEA 1TL8A 3HIFA 1LEBA 4RKUE 2R7VA 2XDDA 1UELB 3J81Z 2QA4T 5D5XB 2DTZA 3V4GA 4L5JA 1U3OA 2RI3A 1VQ6A 1W36D 1WQ2A 4IQ4A 2IVMA 3CCJI 2O9VA 2RH2A 1YI2T 1KC8R 5CCAA 3F9KA 5K5OA 3QXEB 1WA7A 2L3QA 1XB4A 2VC1A 2XG8D 3OW2A 4HAMA 3I5SA 1AKHA 1H9GA 2ZXJA 1BI3A 2QQRA 3MO8A 2XROA 4PSXA 3RQ4A 4C2MJ 1OU9A 3CMAT 1YHQT 1QZEA 3W2WA 4EJOA 1WHJA 1NEBA 4AFSC 5GJWB 4CYCB 2BE7D 1MJBA 2LRDA 2XICA 5EJCA 3EFSA 1SHFA 3X26B 3VEPA 3G71T 3K70D 2PMZN 4QQ6A 1VQMI 1NK3P 4PJOD 2EZLA 1ORKA 3IAM2 3JRZA 2AKKA 1YO5C 1PP8F 2DPDA 2FPFA 2YHTA 5D6WA 3IUOA 3VUZA 3VS1A 4KFCA 4M7DB 1P92A 4EEFG 1AD5A 2WY8Q 2Y4YA 5GAN2 1Q81U 3CDHA 1B6AA 1W4MA 3VOEA 2K5FA 4DQ2A 3MKDA 4A54A 3FDYA 4CSWA 2QKMB 3T8RA 4NC8A 4IUPA 5GAOp 3LX7A 3CJTB 4M78C 2WC2A 4M75G 3MPUB 3JCMg 5FLXE 2A08A 2X4YA 3E0JB 3ZQLA 2JA2A 3ZN0A 3LSIA 1BCOA 2LKSA 1ZSZC 2DL7A 4IUVA 2E6NA 4B9WA 4B44A 4LUEA 3CCEA 2DYIA 4LG3A 1RLPC 1T56A 1WPYA 2EVRA 2ECBA 2GIVA 5B5EC 2KT1A 1G8XA 2ZXHA 3ABUA 2VQCA 2EZKA 3L00A 5B3SH 1HQCA 1R71A 2Y31A 1IG7A 3GTJJ 4NDLA 4L18B 1MMDA 4BB7A 3EGUA 4L59A 2PJRB 3LW5E 5A0LA 3AHUA 4KN7X 5BPIA 1YE9A 2R7OA 2QENA 3MVPA 2CQNA 3OYFA 1X2QA 3GF5A 4RUGA 4ZYDA 2P0WA 1YYVA 1AZGB 2H3EB 1WJ5A 1Z9ZA 1XGSA 1KU9A 2JTFA 2SRCA 2RPNA 3F8NA 3CC7Q 2EIJH 1PG5B 3HHGA 1QW1A 2R5MA 4DZPA 4B9XA 3D0SA 2EFOA 2W48A 2LOOA 3BG7A 2OTJQ 2P0QA 3CCMI 1MZBA 4Y13A 3FMRA 4C92D 3LWFA 4IURA 3L2RA 2X1CA 3CC7T 3L42A 1FBQA 2AO9A 3WHCA 3DQVC 4LD5A 1ZREA 4BY6C 1VI0A 2CWEA 3JV3A 1Q86R 4M3BA 5FKMA 3L2CA 3CCLQ 2XAGA 3SDBA 3M8FA 1KHIA 1RAFB 4L0ZB 2VYTA 3JCMQ 3Q3SA 5LEKA 2LKXA 1D3BB 2YRCA 4RTWA 3OWTA 5J40A 1ETKA 1Q1VA 2YU9J 4EATA 1WXTA 1BM9A 2J06A 2RQWA 1ZLMA 3VYGA 2UWMA 1R36A 3W3CA 2A7YA 3G4ST 1VQ4A 1PNJA 1EH6A 1XCVA 3A8MB 3EFRA 5FROA 3ZMVA 5J8CA 3J80Z 5IT9Z 5HCKA 1TWFJ 5DLOA 4AYBN 2W25A 2ZBKA 1VQPQ 2DMNA 2LBFA 3HRTA 3PE0A 4A3LJ 4IUTA 2C06A 4ZZLA 4ZH4F 4UY8I 4C92C 2K9MA 2VBYA 2QXFA 2RAEA 4XSZF 5DDGA 1GDTA 3UNGC 1LKXA 4CC4B 3B6AA 4G12A 3GUDA 4M78G 5CIUA 1IXRC 5D5VB 3IRRA 4E47A 1IHVA 4BL0B 2BEOA 2O4XA 1R49A 3ZQFA 5HK3A 4R56A 2QA4A 4E7HA 1BR1A 1WYXA 4PCQA 3CCQT 2M34A 2AXTC 1B9MA 2MGQA 3KBGA 3VSKA 4PDKA 3DFGA 5FD5A 3TEEA 2XKOC 2IA2A 2F4MB 1QMCA 3ZQHA 4CYDA 5LJ5g 2V1NA 4B09A 2OTJI 2LJ0A 1G3WA 5D5WB 5FU7B 3G4SA 1VQ4T 1VQOT 2KMTA 1SG5A 2O0YA 3GO5A 3RZOJ 3GTQJ 1VQNA 3CF5F 1BR4A 2Z1DA 2COZA 3T0YA 3C12A 3I0TA 2HL3A 4Q48A 3CCVQ 5CQGA 3EG1A 4CA0A 3JRDA 4KICA 2VPLA 4MNUA 4MIMA 4XN3A 3OOUA 3HOXJ 1D09B 2LJ3A 3MWMA 5F27A 2HSPA 3IKVA 4ZNXA 1LPLA 2E1NA 2I10A 2FQ4A 2JSPA 4IL6C 3QWYA 5CR2A 4PGGA 3CLOA 3SYTA 4IHVA 5D8KB 4HVUA 2WSFE 2HBPA 2BTTA 5LBQA 4HSRA 1DU6A 1Z9QA 2JA7J 5D7UA 1RIOH 2RNGA 2NS0A 1Z6RA 3IV5A 1IGNA 2MD5A 1XCBA 2VOOA 4JRKA 2I8DA 4M7AC 1S7AA 3GNFB 1XNIA 5IP6A 5KAIC 4RLFA 1TOVA 1A6QA 2GXGA 1Y96A 3GIBA 3H5RA 5FWBA 4AG2C 1W5TA 4ORZA 3UT1A 1XSVA 1ZLJA 1PSEA 1PD1A 3BFMA 3DKWA 2CV1A 1YI2Q 3M9AA 1VQ8T 4FSSA 5BMZA 1QGPA 4EMHA 2VE8A 1T3LA 5DD8A 2ESWA 4FT4A 1D8KA 5TGTA 4M7DA 4L9VA 1ACMB 3CCYA 3PO3J 3DTEA 3LNQA 1GCQC 1ZHFA 5E1WA 1TNSA 3FHZA 2JMWA 2KQRA 4RM3A 5GAMg 2QGGA 1BL0A 4ESRA 4BJTA 2JUCA 1WXUA 3G71Q 2UV1A 1X58A 3FXQA 5LJ5e 2HQEA 4M3GA 1HA8A 3CTAA 1M3AA 5E3MA 5A2QE 2XKOA 1Z7LA 4DJAA 4C8QF 1I5ZA 2LTOA 1VQ7Q 1FX7A 1OCRH 1WHUA 3FXMA 5HDKA 3PJRA 2RN8A 3SFMA 2IW5A 3CJRB 2D2WA 1U5TB 3BT9A 3NWTA 3SZPA 3K7AJ 3A8LB 4KUMA 4XLFA 5J1YA 2F2XA 2QTVA 2E36A 2PX9A 2JA6J 2K40A 2JS2A 3GZ5A 2Q8KA 2A6HF 4I76A 3IAS2 3LA2A 3BJOA 4BXFA 4OAYA 2XGXA 1IO6A 2RHXA 2CZ0B 4KT0E 2DILA 2ECZA 3NTIA 1VQ7A 3V8KA 3FEOA 4LB6B 3AT1B 2KT8A 4MZMA 1FTZA 2OI3A 2VBWA 1OCPA 2LQNA 2NWMA 5ICFA 2RM4A 1UHSA 4E70A 2Y90A 1DUXC 5DUIA 3QZ5B 5IN1A 1W2BA 3TVTA 1B8IB 2KAFA 2WADA 2CGPA 2X4XA 3H0IA 3R6OA 2LT1A 1ZGJA 4L9JA 3TCJA 2FPDA 3WVEB 3CXCA 1JT0A 4XRSG 4CYCA 3GX4X 1TC3C 4KRTA 3PNTA 2QBYB 2VPRA 1RLQC 3EH2A 1BC8C 3FLGA 4M78B 2ROLA 4C0GA 5GANg 2XASA 2VGNA 1TTYA 5L23A 1WHHA 2AKLA 3FRNA 1YJ9I 1F36A 2FEIA 5IT9R 3KLOA 2ELJA 4MLOA 1TT0A 2MUNA 1LFPA 1X1PA 3CCVI 2K85A 1X4OA 1HF0A 1H9TA 3HM5A 5GAHJ 4IO9F 3HUGA 2K5IA 4DBFA 2L7KA 4JJCA 4XAXB 2XIGA 1S72Q 3HYIA 5HS9A 2I5UA 4DGWB 5B1AH 2LVMA 1UFFA 2QK0A 3SD4A 2OD5A 4I0BA 3TO7A 3ECHA 4F04B 1IDYA 2VONA 4A3MJ 3MP6A 1H3ZA 3F3XA 2RDPA 4J00A 3GYHX 1OULA 1N9RA 2MD0A 1UGQB 3QU3A 2YUOA 1W5SA 4PJOA 4HZFA 1FP2A 5LL6S 1TS9A 3WTVC 1K78A 2L3PA 5CJ9A 2M0YA 2C0TA 3M57A 1YWPA 3VYUB 1AVZC 2DT5A 2Q2EA 4ENKA 1VQ6I 5GTIC 2JMCA 3AL0C 3FIFA 3QJ6A 3K10A 4HDVA 4IQJA 3QBYA 4C5EA 1PJRA 1K9MR 4BU2A 3M56A 1IN7A 2LCCA 2O5RA 1FSEA 3PQKA 1KQ1A 2V8KA 3WE2A 1M1KC 2DEQA 2BY0A 2FO0A 2D1XA 1GVDA 1SKUB 2NUZA 2LNHB 2YSQA 3M1CA 3R60A 4C3JJ 2IS6A 1I5LA 4R1HA 4G6QA 4NQWA 2CUDA 2L9SA 3MAJA 1RUOA 3LSGA 3TQ7P 2L9VA 3AAFA 3F6VA 3M55A 4OAZA 1UAAA 1YFHA 1QHGA 4J9BA 1OEBA 1J0RA 1SSFA 2XB5A 2BE5F 3FM5A 2KRCA 1ZUYA 5LJ5j 3FXLA 3C3WA 3F23A 4J9DA 3S8PA 1RQ6A 1G4DA 1HK9A 5TISC 4ZN1A 4K11A 4YTLA 2W4SA 2GF7A 3OYBA 1IRXA 4Y92A 2DJQA 3DPTA 1R4NB 2LG4A 3G1LA 1Z67A 3IKTA 3RR6A 2FZKB 3TU4K 4YIIA 2EZHA 5IHNA 4CZZA 4C5IA 4OB3B 5L3DA 5E3NA 2DXCA 3VYTB 4M75B 3L09A 4XBFA 5HLIA 5CQEA 3BTIA 4CCMA 4C3IJ 2CFXA 5DM6F 3CMYA 3HOTA 4JLIA 1UHFA 4M75F 1KD1R 2NVTJ 2CZ7B 1B34B 1Z21A 1WWXA 4WWCA 3H1CA 4A2UA 2R7UA 1XOVA 2DI3A 3ER0A 1APLC 2DZ9A 1KIKA 3KP4A 1R00A 2H27A 2LVSA 3GZ6A 4AIJA 5LJ3e 2X6XA 3TMOA 5F08A 4V2FA 4IXAA 1PSFA 2BY1A 2IS4A 1AHDP 1A6IA 1U1TA 3RKXA 2YUPA 3ZQCA 4NL3A 4HA8A 1M5Q1 3CLQA 4BHBA 1UHCA 4LUDA 3SEQA 4J6XA 3CC2A 1EFNA 2QYOA 1BB9A 1GLNA 2M35A 2HAXA 2LC4A 3SFIA 2BVLA 3WHBA 4KISA 3GP8A 4M77A 3F8FA 1D1CA 4U0VA 4E7ZA 5IOYA 2K3XA 3MP1A 3BWGA 3DF8A 5JVTA 3Q5FA 2L8DA 5CVVA 1BW5A 2KHMA 1PC0A 1VQ6T 3HOVJ 2HL5C 1QQIA 2NS8A 4HNTA 1IZ6A 1JUPA 2RKHA 1IO2A 3DPLC 4HOBA 2O6GE 3I4NJ 4KGXB 2Y30A 3NARA 4A53A 2MW8A 4KULA 2DPUA 5IH2A 1UG0A 1QO0D 3ZQIA 1HC8A 3SWNA 6AT1B 2E65A 2XD0A 4M74A 5HNHA 2DK3A 1J59A 3OV8A 2EAYA 1SC7A 1ZELA 2LF7A 3CC4T 1HW2A 2BZYA 2V1RA 4IJAA 2HYJA 2MG4A 3META 4PK4A 1V29B 1L0OC 2OPTA 2ZFWA 2CP5A 1D0XA 4Y3OA 1G3SA 2E1MB 2HDDA 3ECOA 3AG1H 4BJ5C 1YWOA 1MMNA 4XTVA 1DP7P 4QQGA 3CXCP 3G6EQ 2BY2A 1VQLQ 4RDUA 3OMYA 1UGRB 3MEVA 5KYUA 3K4LA 4JZ3A 4J7IA 4XLEA 3S2WA 4HCBA 4DYQA 1D3YA 3OBWA 5A2QK 1RAIB 4F7UE 2LX9A 4N4IA 1MD0A 1UGPB 3A2KA 3EGXB 4C8QE 2QEXQ 4GXOA 1IN5A 5DTDA 3H9QA 1O4XA 1ZSZB 3HFOA 3WU2C 5JLXA 2X85A 2C6YA 2ROTA 3LGLA 2XKPA 3BZCA 4Q4ZF 1U8BA 1Q95G 4GLKA 2DU9A 4QSHA 1VQ5Q 4NQWB 1QVFA 1M4ZA 2XIDA 1PUEE 4II3A 2K27A 1C1AA 1OZ3A 4LNPA 1VQMT 3F22A 3NWSA 2V8IA 4BACA 1N25A 1BKBA 4TV7A 2ZAEA 2IEKA 1Z05A 3KFVA 3LH0A 1TWHJ 3PNWC 1REPC 3RMQA 1IB8A 2AHJB 2DL5A 2KY9A 3NPFA 2OBPA 2O2OA 2PN6A 5IAYA 2FRHA 1ZUKA 1YCYA 5GAMh 1K76A 2Y48A 1LFBA 2QSHX 2PUOB 1JKRC 4F7UB 3I55A 5CKTA 5HS8A 4Z6YA 4BQAA 2XDBA 3OQ5A 3DWLE 4ZDLA 3OYHA 4E7KA 1ZSGA 4C5GA 1R4MB 2Y75A 1AU7A 4Z88A 1W2BS 5K7HA 2G0EA 2MA3A 3NQOA 2BZ8A 3U23A 2JN0A 1TT5B 2DM1A 1S6LA 2QZ8A 4AUXA 3EFOB 5CYVA 2EGCA 5KE3A 2VKNA 1QNTA 3VSLA 4DZJA 5GAGJ 2ACJA 2JJ7A 3E5QA 3FMQA 1I1JA 3HDDA 1MUZA 2LREA 5IHIA 3ZMZA 3OSGA 2O88A 2RI2A 5E17F 1TQIA 4CH7A 3CBMA 2MI6A 1UJ0A 8ATCB 2K9SA 1HDPA 2B0LA 3CC4Q 2WV0A 1R8OB 2DVJA 1FC3A 3K4KA 4LLNA 2OTLQ 1M2VB 2RMOA 4G6TB 3FHNA 2MC4A 3EAEA 3A1YA 1U1SA 5E18F 4LFUA 2O03A 2BUDA 1YHQQ 2DA4A 1ZRCA 4RTTA 2VT3A 3WTSC 3M5AA 3HOSA 2H1KA 3P8HA 5TRDA 2JPBA 3J7ZI 1SD5A 4HX8A 3CJQB 1WCMJ 2CUFA 2JVHA 1N77A 2DA2A 1RI0A 2R4GA 3B6CA 3ZMDA 1FOKA 1LDKB 3SHWA 1MBFA 2FRWA 4II2A 4HT9A 2OTLA 2AQEA 3MN2A 2RHZA 1G3YA 3PFYA 4Z02A 2RF0A 4OOIA 2HZTA 3S1RJ 3V7CA 2Y4XA 4F17A 3CCVT 2KRHA 5C44J 4XLHA 1R0CB 1FOYA 2RJDA 2Z3YA 3I58A 3LSPA 3OIPA 2X9HA 4JLGA 5GADJ 1BI1A 2QCOA 4LG0B 3S17J 1X69A 2QG9B 2JPCA 2XPUA 2ECCA 4M78D 2Y9YA 3LSMA 4LMYA 2R5AA 4IRGA 4M77D 4XKWA 1Q82C 2EQIA 2EIMH 2V1DA 3CCST 4KT5C 1GV5A 3LA7A 4XKCA 3SHFA 5FB2A 2OAUA 4UVCA 4IRIA 4OWRB 3A01B 2FZGB 2B9SA 5GAEJ 3M0TA 2DL4A 2D5VA 4Y91A 1ETOA 4LD6A 1XJWB 2CUEA 4MTEA 3OYGA 3BJ6A 2RJEA 2QEXA 3I4MJ 3H0HA 1OQYA 5EEAA 2A0FB 2JNGA 3LLRA 4M6VA 5FU6B 3FJ5A 1JEGA 2DK8A 3I55Q 1WDXA 3FXJA 5AONA 4CRIA 1K6YA 4FISA 2ZKZA 5ERIA 4PJNA 2JA8J 1DPUA 3LWIA 4LJZF 1PRMC 4WXCA 3AG4H 3U2RA 3JRGA 2YPRA 1ZGAA 5HLTA 3HOZJ 4F14A 2YWWA 5IOZA 4RBOA 4E7JA 1MMSA 3JSPA 1USTA 1A35A 3JCMd 3G3ZA 2EYXA 3MEUA 4QQDA 1XMAA 4MMLA 1TUGB 1MKMA 3X20B 2KXCA 5GMKj 1LE8B 1WGXA 1T0JA 1X2KA 2RC4A 2EA4A 3RJPA 2G9WA 3QYHB 3RKYA 4D7MA 1WNLA 1FEXA 3QPSA 2QLZA 3J81K 4PJMA 1RAEB 2D0QB 3L2ZA 2RJCA 1WPKA 5FKOA 3HG9A 3QHSA 3BDLA 2M7BA 1U78A 4Q5SF 1VOMA 2KJCA 1XPXA 4QKUA 2XF6A 4BXUA 2KRNA 2HKNA 4G9YA 4N4GA 1NG7A 4A3FJ 3AL0B 4ZGDB 5GANd 2ZPHB 2O61A 1YITQ 3OOPA 2XAFA 4PUSA 3S32A 3CCQI 3CMEQ 4IF4A 3MZYA 1T0FA 2IA0A 3DBRB 4I99C 3OYKA 2O9LA 1K9AA 3VKIA 1WQ7A 3FXRA 2DX1A 1VQ8I 3F70A 3HL2A 1D1BA 2DTRA 3CD6Q 1JKQC 4Z8AA 5KAFC 1P4XA 3CO6C 5E8GA 4P9FA 4V19K 4N0AA 1XG1A 1WJAA 2BHZA 1FBUA 2X6YA 3H0DA 1NLOC 2FOKA 1VQ9Q 2CMPA 1JXMA 4M75D 2QVOA 1DU0A 1X6GA 2DTIA 2JUGA 2KK4A 4LD9K 4FCYA 3U21A 5IT9K 4MZTA 3TP0A 5DY9A 1EA3A 2DOAA 3SZGA 3BTLA 2QGUA 3P7NA 2AS5F 1OI1A 1GFCA 1XQHA 2CKKA 2ZO4A 1YRNA 2J6OA 4A4HA 1Q7YC 3CD6T 1D3BA 3H92A 2M51A 1TTHB 2GQQA 1VTNC 2LP5A 4J6WA 4XLPF 4EDUA 3LMMA 1QVGP 2LFBA 2YR2A 2EK5A 3IRQA 1ZHIA 2EQKA 3QIIA 3ZFJA 1KD1C 2QM3A 2HS5A 1JE8A 2B63J 5LJ3h 2DRKA 4A69C 2X51A 1ZR4A 1O3RA 5IP9J 1YJ9Q 3NAUA 2EJ9A 2XDPA 1AOYA 2HVSA 3JSOA 4OGCA 4M77B 2CW0F 1IV6A 3X25B 2ZCWA 4LIUA 3RI4A 1IGUA 5KYYA 5J4VA 1JB0E 1R9TJ 1VQNT 1GVJA 2FRYA 5J47A 4OMOA 1EH8A 2IGNA 4M71A 5IYDJ 5DLQE 3EH1A 3JCMJ 2NS7A 5EG0A 2MYSA 1RUNA 1HSTA 4I7HA 2AIRB 1R5ID 1QP2A 5KCOA 2VE9A 2FZCB 2QF7A 2DF6A 4BS9A 1PP7U 3ONQA 4IEJA 3GTMJ 2CS3A 4C9YA 5EDNA 3Q0WA 2FQ3A 4N4OB 1OPLA 1TP4A 2NVUB 2EQJA 2YLCA 2L7ZA 3DLMA 2KFDA 2EFNA 3OIOA 4U7DA 1VUBA 2HNIA 3HB9A 4EM0B 3K69A 3MCZA 4VUBA 3HPWA 4S0HB 1I6HJ 1VQLT 2EQRA 2JMAA 1IUFA 2E5KA 3IH2A 5M5YJ 2IGKA 4RMOA 1XSDA 2L3RA 1W7PD 1XDUA 2QA4Q 2P7CB 1PUFB 3OSVA 4XSXF 2JT4A 2CSIA 2R57A 1T2KA 1SD4A 1UGVA 3HPGA 2GA2A 2IXSA 1WHGA 2HSEB 2QWWA 1USSA 1DDNA 4DEXA 2EB7A 1NM7A 4A3GJ 4RLQA 1GT0C 4C2TA 1FLIA 1X27A 1YS7A 3IH3A 2RHYA 2XGDA 4WCGA 2Y2ZA 2K9NA 1R0BG 1K73U 2W00A 2MABA 2FL7A 3SDZA 2GTOA 1YJNA 1E3PA 1UHWA 1W7PA 2Z16A 3HPHA 5E1ZB 1SF9A 3GMEA 3KZYA 1K4SA 2ZPGB 2VXEA 3QYEA 4ANJA 1S72I 2JZYA 2W0ZA 3RNJA 3E6MA 2QKLB 3WTUC 1Z0XA 4HF1A 4J83A 2CS7A 2X48A 2DO7A 4A3BJ 1FWZA 3TW7A 1SAUA 5D4SA 2N8GA 3DCFA 1TU0B 3IC7A 2VVKA 1Y6IA 4QWQA 4J7FA 4PJOF 1HKSA 2RGVA 2DOEA 1AA7A 3OYLA 4G7HF 2OAWA 1LVAA 2IAIA 5K5RA 3FBIB 2B8AA 5KYWA 3P8BB 4E4HA 2ZMEC 1VQOQ 4N0AC 1SHGA 1VQ7T 4IHWA 1KU3A 2DT7B 2G7HA 2BV6A 1IGQA 2L3DA 2FEZA 4KA4A 2E12A 1Y56A 2M45A 4MFEA 2ID3A 3ASNH 3BJAA 2ETHA 2MH9A 3ME9A 2F5TX 3I55T 3FXOA 1H0MA 3IL2A 4A3KJ 4MEXF 2HOSA 1ZRDA 4FYVB 3H36A 2K7AA 2CU7A 2XRLA 3I53A 4RG8A 5FD6A 4HX4A 2NOGA 5GMKi 2ED1A 2PEXA 4KDPA 2JZ2A 2ENMA 2KYMA 1WFWA 1OYXA 2LQWA 4JRPA 4S05A 2CW7A 2EPFA 2KPMA 3WTZA 1MH3A 2F6CA 3VPRA 1WFXA 1V5FA 3RZDJ 1YRNB 4BY1J 3DEWA 2WSCE 3M4GA 4EMKB 4GCVA 3DBLB 2CQQA 1R1VA 5LRSA 2LDUA 4RTVA 1RL2A 2WB1A 4MDWA 2ZJRF 3T1BA 1XC5A 1X1DA 3WE3A 2LQKA 3K4BA 4P9UA 2MOXA 2PZ1A 4R8HA 5EYRA 3OMGA 2NOJB 3CESA 4UUTA 4YELA 3OSSC 4E2FB 1JJ2A 3UR3C 1ZRFA 1BIAA 4F91B 3GFJA 1K8AC 4PFZA 3VRYA 3D5SC 1VQKQ 4PJOG 3M59A 3BCAA 2CT3A 3R0JA 3I9V2 4BBRJ 2HBWA 3GOXA 2IRFG 3VS6A 2E1MC 2ZPIB 4FE7A 2CP3A 3WVDB 5LGTA 5F0FA 4HQEA 9ATCB 4OB0B 4RB3C 3RTRA 3K2ZA 3I35A 3A5ZB 5IY5H 3QU6A 3QOEA 4P96A 5DCMB 4C2UA 1ZH5A 4HNVA 2V6EA 4PJOE 2KRSA 1VQKA 1LCKA 1KFZA 1MBKA 1YJWQ 1SFEA 5I22A 4UV8A 2RQUA 2IIMA 1I1GA 2WAQN 3REAB 2A36A 1JUMA 3JB9G 2VV5A 3BOQA 2MWOA 2XGCA 1I4K1 4M3EA 1K4US 1ETWA 3V7RA 5BOXA 2LRQA 5ECAA 1B3QA 5KVRA 4XU0A 1FIAA 2L2PA 4RG2A 2KQWA 4FETA 5DUKA 3J80E 5FLMJ 3DEEA 5FKKA 2KJBA 3G71I 3A8GB 3P9IA 5CQYA 4LLLA 4XTYA 5B66C 4L6V5 4Y33A 5K7FA 1VQ7I 4QW2A 1YW9A 3DTIA 2DXTA 1WSUA 3CCUA 1FOXA 1HYOA 2M0CA 2XRNA 5DM7F 3LYIA 2GQIA 5GAN6 4JUVA 4A0XA 1H89C 3O5ZA 2DYSH 2FG0A 2ZXWH 4XU1A 1B34A 4EJTA 2JRMA 4Q47A 4OINF 4Y4RA 1W70A 1Y8QB 3I3LA 1DGRM 3VYSB 2VN2A 1HKQA 1MIJA 5AIQA 1CGPA 4KGVB 4XOPA 4L0YB 1TG0A 2K02A 2JJ9A 4HKEA 1ZK8A 2RV8A 2YUQA 2ZPEB 1OISA 1FSHA 2CP0A 3CCQA 2EV0A 3HRUA 4PNOA 3FJPA 3G4SI 2DTHA 4O5VA 2VC8A 1VYUA 1VQPT 2OTJA 4FASD 3K4MA 1ON2A 2PQ8A 5DCMA 3RPQA 4YFXF 1CQTA 1V5GA 1E6GA 1IJWC 1VQOA 3E19A 5IHKA 1BJAA 1ACIA 1M27C 5GAN4 1NPPA 2F2EA 1W1WE 4XRSA 2JT1A 2F1LA 3GFMA 2DBKA 3HKZN 3I56T 4BDYA 1M1EB 2J5PA 4X9DA 3M0UA 4FTHA 2J6FA 3J80K 5D6XA 2PMZA 2EJGA 3KP3A 4B3XA 1S72A 1O3SA 1Q86U 1O3TA 1I3AA 4A3IJ 1JQQA 2HD0A 4XTZA 3E5XA 1A31A 3NHNA 5EC7A 1WZOA 4AU7A 2JUFA 4WXHA 3CCRT 2QDLA 4IUQA 4JJBA 1BN5A 1UDLA 4D8DA 4R55A 1R5GA 2M5WA 5CO7A 1BOAA 1R7JA 3CP2A 1LOJA 3LSHA 1OFCX 1WHMA 3GBGA 2L9NA 2LF8A 3A0BC 4HNUA 1HOMA 4BAYA 4J9FA 3CPWA 5FFZA 2R7FA 3ZP5A 1ON1A 2Z5UA 1JO8A 4EMKA 1K78B 2JXBA 5EGOA 3PVLA 2YRDA 4H0EA 3L1AA 5HY6A 3S16J 2RVCA 1IRZA 2KYBA 1OPCA 4BHPA 2VJIA 1SMTA 2A3SA 3GNGA 4P5NA 3KZZA 3E2UA 3CMET 3V8LA 5CQXA 4N0BA 3JRHA 4AVPA 3LSTA 1QQJA 4II1A 4C92G 3HOYJ 2J7IA 2PQWA 5FO5A 3JCMX 3CC2I 2HQ5A 4C30A 1XMKA 5CPRB 3J7AW 2WTEA 1K7AA 1M90R 4A4KA 2CUBA 4LDXA 2XSDC 3S3NA 4LGWA 2L5QA 4HF2A 1OCCH 2QSGX 3K1MA 2EQMA 3CZ6A 2QBYA 3QDRB 2EILH 1WJEA 1NE8A 3T8TA 4RA2A 4LDVA 1MJAA 3K6GA 2CV2A 1K6OA 4M7AA 2CSQA 5GJVB 3TREA 2TCTA 4M77C 4EJWA 1YLFA 5HK0A 2BY3A 2PU9B 4RS8A 3BPXA 2IA1A 5BNGA 5HNFA 4DIQA 2DETA 1WLPB 3ZMTA 3GTLJ 3D1NI 1VZ0A 1X4PA 4A4EA 2GIZA 2XAJA 1RR7A 2TRTA 2PI0A 5ICGA 2V1QA 2STTA 2DYBA 2BW3A 3I64A 1ZGWA 2VUBA 1VQMQ 3CCRA 4HPQA 4EMSA 3TSWA 2MH2A 4N4NB 3WG7H 4A93J 2IG0A 3H6ZA 2D45A 1A04A 3I56Q 3DLAA 2NYSA 4OMFB 2MWPA 3SZTA 2L01A 1C6VX 4ME7A 3RMSA 3JB9I 3I56I 4KIGA 2OX7A 2DQLA 1YW7A 2VL8A 2LYCA 4ESJA 2GFUA 1W6XA 3K4CA 2OCEA 3LQRA 2GWRA 2NRAC 4HCKA 3IWZA 3B02A 4BXXJ 2YT6A 2DCEA 4F3QA 1K79A 3LAPA 1V5EA 1H641 3JCMh 2OCCH 4JRIA 1LE8A 4ZGEB 4A4FA 4ZGJB 3KYCB 4BQNA 3ZPLA 2LZ6B 3EG0A 1R1UA 5FRMA 3UKGA 3PIOF 2QTXA 3P9KA 1OMIA 3P8DA 1GHCA 1QCNA 4ABZA 1WI9A 3K2AA 2HNHA 3WU1B 3SWNB 3PO2J 4A3DJ 3WGHA 5KH6A 1XGOA 2VB6A 4MQ9F 1B9NA 3KLNA 4RAGA 4NOYA 3OW2P 4Z2YA 3EETA 1U3EM 1SMYF 2YDLA 4PJLA 4AYBA 2VODA 1YCSB 3CCSI 3DB4A 4MZPA 1QZYA 1BYMA 4ELYC 2P5KA 4IIMA 5D4RA 4OMPA 1N5ZA 5IXBA 1I6XA 3R0AA 3I59A 2CGHA 4HT8A 1OCOH 2R7SA 3BZKA 1ABOA 3QYBA 4Y52J 2RNAA 3BLYA 2HDCA 3AKZA 3CO7C 1SFOJ 4C8QB 2LCSA 4XOTA 2IPQX 1N8RC 2I0NA 2E1HA 3CQTA 4QVZA 3DEUA 5GPAA 3GTPJ 3LFKA 3FB9A 1VF9A 1WGSA 2BVMA 2EV5A 1SVLA 2VBXA 4IPAA 2A69F 2DXUA 4EGYA 2FYKA 1TW3A 1X3ZB 1NG2A 3PVQA 2KIFA 2DNUA 1YIJA 1XTAA 3PSFA 2F5CA 5KCMA 3HSBA 4KMUX 1NYFA 1M2OA 3QSUA 4XLNF 4P1WA 2EBIA 3FIWA 1ULYA 1J09A 4RTUA 3JB9D 1YX5A 4IX7A 4ENNA 2DLPA 2L54A 4QIWN 3MMYB 1U5TC 2CQ7A 2QUFA 1EF4A 1Y57A 4XTWA 2EINH 1WQWA 1WKMA 2V1UA 4NS5A 1RADB 4CGZA 1JKOC 4PJJA 2LR8A 2ELHA 1X3WB 4E7LA 3I4PA 2CYZB 2DZCA 2K9GA 4ZN3A 1OKRA 1OYYA 4PSWA 2VXZA 1Z6TA 1R5HA 4CZCA 4G7OF 2VOPA 1S5LC 3M4YA 4HCZA 4B6MA 1M1KR 3QPHA 1MSFC 5LLQA 2EIKH 4OB1B 4CCNA 1FXXA 4BI4A 4E6RA 4B8XA 2VWFA 1TQMA 2JVGA 2KI7A 2EV6A 4CC3A 3HSFA 4M75C 3VJPA 3G6EI 1LJOA 2DBMA 1YX3A 2BW3B 5DV5A 1Y07A 1WVRA 2A5YB 1W4SA 2R58A 2WBMA 4UVBA 1T95A 1OJLA 5CVRA 2OAZA 3L1PA 3EFOA 5I11A 1Q82R 3KP7A 4OMYA 3BTCA 1U5SA 2ZJ2A 3HJEA 1G5VA 5IP7J 4GYGA 5IYBJ 4MFDA 2DL8A 4M7AD 2DFHA 1PM3A 1A0NB 3PMIA 4RGRA 3P5JA 4F7UA 3EHQA 2A68F 3OS2A 4XQ3A 1FMKA 1MGQA 3G7ZA 4JPBW 1GL5A 2QQ8A 3H5NA 3WTYC 3N97A 1SD6A 2FU4A 4HLXA 3CCLI 3M8EA 1S1NA 1TSFA 3REOA 3FWEA 4WF2A 3LFUA 1QRYA 2XAHA 4HX7A 2ATCB 4BJ6C 1UJ8A 1Z77A 1T0FC 3FISA 5EEHA 1VQOI 2K2MA 3EUAA 4AG1C 2CH4A 2CV0A 1KK7A 3SWNC 1PCXA 2V8JA 1CKAA 3S6WA 1X1BA 2P0PA 4ON0A 2HXIA 4A63B 2VT2A 1S7OA 3N05A 4HG2A 4LITA 4NBQA 1QP3A 2IBDA 4BUPA 4EJUA 4DYRA 4A0ZA 5ILSA 2CZ6B 3HHTB 4EIKA 2KIMA 4GRIA 5L3EA 2BE9B 2MF2A 3SXYA 4J5YA 4M78A 3JAME 1S72T 1IC8A 1LJ9A 4I01A 4FL6A 4XU3A 1N27A 3BY7A 4DOVA 1VQ9T 1KC8C 2YRVA 4G6DA 1N8RR 2HCKA 2LX7A 1Y1WJ 2KLOA 4KJZA 4FYXB 3L2VA 3CCRI 2EYWA 2DXIA 5KYUB 3MKLA 4I09A 4Y7NJ 1QKXA 5GAMj 4HBLA 3SFZA 3OS0A 3T9NA 1OPKA 4NC7A 3ZGKA 2DD4A 2L89A 3F8CA 1J7KA 3JREA 4FT2A 2ISZA 3L9FA 1BK2A 2DO3A 1S7EA 2JVVA 3R61A 3CCMA 2OJED 3EHRA 2DMOA 2BXYA 1QCOA 3A8OB 1BI2A 3RQIA 3KCCA 4M73A 5GAMe 3QKJA 1RPWA 5IXFA 1H92A 2XU8A 3J81E 3W6JB 1EX4A 2COYA 2ZMEB 3D5LA 2RN7A 1QVTA 3TDUC 2R93J 2EQUA 3HKSA 1LNXA 3LSKA 3NGPA 4QT7A 5LJ3j 3CMEI 2RQTA 3CCQQ 3HRSA 3HRMA 3RKWA 2H1LA 4FQGA 4U88A 2MSYA 5EEGA 4C3HJ 4ESFA 1F9NA 2HYGD 1O7FA 5FFXA 4A0YA 2VLAA 1FT9A 1K61A 3SJMA 1MDMB 1K83J 4I2OA 2P4RA 3UWNA 1KQSP 4NNJA 2D8HA 3F8BA 2DA7A 1R6RA 2Q0OA 4FX0A 2WWYA 1EJ9A 2RHIA 1SAXA 2YLBA 3QJYA 4LIVA 2BYVE 2FA5A 3FC3A 1VQ5T 3S2HJ 2JM9A 5J26A 3GTKJ 2HQRA 1DP3A 2DRMA 3A0HC 1ZTRA 2M1HA 1Q1HA 3UF4A 1KJWA 1B72A 1UZCA 1C0MA 1C0WA 3IP4B 1A5JA 1WX6A 4ZC3A 5HOOA 2QSFX 2COBA 1I3QJ 5LHGA 1NHAA 3KEQA 5C4XJ 2CJJA 1MNDA 3E97A 4KT6A 2M9UA 2ABLA 2DLLA 2HQXA 4C8QC 2ISYA 5M3FJ 1VIFA 4IOCF 3VDXA 1FBSA 4NB5A 1UG1A 3F8MA 1YIJI 5D5UB 2EFIA 2E2JJ 1M1GA 2GBQA 4LN2A 5I21A 1PVEA 3BDUA 3EGDA 1RUWA 1I27A 4EQQA 1FTTA 3V42A 5K5QA 1X2NA 1LQ1A 3M58A 2MLGA 2K4YA 2M7AA 3VS0A 4JS5A 3CC2Q 3G1OA 2B7EA 4M75A 4FYYB 1GRIA 4AIHA 2HEQA 2KZGA 3FK6A 3OYEA 1D5VA 2K6DA 1NEGA 4G8XA 3OYJA 1J5YA 2PBIA 1J3TA 1Q81R 3JRAA 3BG3A 2FBHA 2COMA 5FKLA 2DPPB 2XAQA 2M30A 4A12A 2E70A 3A1PA 3CXCS 1YITT 3CC4A 3C0CA 1OR7A 1K9MC 4ZDOA 2LKPA 1CSKA 1QVFS 2A6TA 4L5EA 2B86A 2CUZA 3PT9A 2KZVA 1KSWA 1KGSA 2W1OA 3G1JA 3MZHA 4OVAA 5KK1A 4M77E 2MCNA 1IW7F 3TBIA 2YS9A 3E5UA 3QAHA 2EW3A 3M1EA 3EGXA 3ISPA 1E2XA 1Q7YR 1DQUA 5AT1B 1G2BA 3AG3H 3HEFA 1W2BP 3JTHA 1VQ5A 2OV7A 4AC0A 1DJ7B 3BG9A 1RI9A 1AWXA 3M0SA 4F7ZA 4OMMA 3GCMA 1MW7A 3M8JA 1WJDA 3C1DA 1SEMA 2EWNA 4MO7A 5HVQC 3JAMK 2K3BA 1RC9A 1SSHA 2ELKA 2KBTA 1KD1U 1JHHA 1RETA 4RB0A 4DYCA 1WJRA 2ZC2A 1HBXG 2P5VA 2Q2EB 1RAHB 2ESHA 1AEYA 4IHTA 4XK4A 5DD4A 2MPXC 3CPWP 4PJ0C 2QEXI 4EMGA 3I56A 1OV3A 4BI8B 3OW2S 5M5XJ 3GPLA 4M7DF 1PKSA 2PVGB 3K0LA 2XMFA 3OSFA 2C0OA 1GCQA 2JOYA 3THKA 4MTDA 5E3OA 2A37A 4DBQA 1UUEA 2QQBA 5CVIA 2LJ1A 2NUTB 2ZJQF 3F0CA 3PFIA 2PVDB 2G7UA 1WI7A 1ZBJA 4OF1A 4FE4A 2E34A 5CKEA 4BY6B 1WHKA 1POGA 2OUMA 2J5OA 1FIPA 2HWVA 5ILVA 4LK1F 3E9FA 3JRCA 2KL4A 4U87A 3A4CA 3VUBA 1FNNA 1RKTA 2K3PA 4UNOA 5CVUA 2GBYA 1ERDA 2ME0A 1PD0A 1F5TA 4W1UA 4LK0F 2E3HA 3ZL7C 2XDVA 2DIQA 5EZGA 1UJYA 2OZUA 4F92B 3TSZA 2HI3A 3KETA 4HV6A 5LHHA 1JKPC 2KMUA 1SRLA 2HMAA 2NNNA 1YITI 2DN0A 5KYXB 4OMQA 3I5UA 2MVTA 1EIFA 1X2MA 3H3VK 4HLYA 4ETSA 4G94A 5D6EA 3H8ZA 1LEAA 2ZNYA 1MH4A 3OA6A 1UGSB 5E79C 1ZLKA 4AFZC 3D7SB 1W5CC 1QLYA 1U9OA 5C0MA 1QPMA 3OR2C 1J75A 3H9JA 5GAN7 2LT4A 3VFZA 2CQKA 3KP2A 3VYRB 4ZTFA 2D8JA 3JCMV 3CCMT 2H6CA 1MBGA 4X0GA 3RSNA 1ETYA 1PYVA 5L3GA 1TWCJ 1Z7UA 2XGEA 1AWCA 3EUKL 3CC7I 5GANf 1IV8A 2BOLA 3BQYA 3FF5A 4UC4A 2LC2A 4O3MA 3E6BA 4XR6A 5DM7R 3NRVA 5FJ8J 4QPOA 2LY9A 1TWGJ 4Z89A 2LY2A 3HOUJ 3DP7A 4J6YA 4HRIA 3JAMR 3M54A 2COWA 1JXOA 1TXQA 3A98A 1NK2P 3BR5A 1NTCA 3CCLA 3JW4A 2TDXA 3V7SA 1RAAB 4JRQA 2E64A 3WTXC 4ESBA 2PMUA 3OIQA 1PDNC 2M3AA 4QPQA 5FLXK 2GQVA 4OMNA 3CCUQ 3MKZA 4C92B 4M3FA 2DMPA 1E3OC 1M2VA 3GLLA 5CLSA 4AD9A 2DXBA 4M7AB 4M9SA 4K2EA 2DDBA 4HQMA 1T38A 4HV5A 1FOWA 2CO5A 3K4NA 4NHJA 2D0NA 2L7MP 5L3CA 5HKCA 1VQ8A 3I5RA 1LFUP 4PJOC 2LDMA 3K9TA 5JVGF 2JN6A 2HQAA 3C18A 3C2GA 3GXOA 4I0AA 5A2QR 2KRMA 2GM4A 4AVZA 3M0PA 3VS7A 1K73R 2R7RA 2GGRA 1NJIC 2OQGA 1N75A 4UB6C 4XTUA 2Z2SB 1YIOA 2P0TA 3ULRB 2ZCFB 2FB7A 4RCBA 1K8AR 4JX4A 4OIQF 4IHXA 3F21A 1HCRA 2H8RA 2LH9A 2M4KA 2H8HA 2HKQB 2VKEA 2RD1A 2HFHA 2X3XD 4FIBA 4KITB 3ZXSA 1KQ9A 4EPCA 1TUCA 1WXBA 3RYRA 5LJ5f 1JJ2S 2R5YA 1LDJA 4C92E 1OYWA 3C4SA 2VGMA 1V76A 5CKDA 1SANA 3F6OA 1MBEA 4OIRF 4PLLA 2E71A 1ITYA 3VS2A 1KQSS 1I50J 1TWBA 2DAOA 3JCMW 4DW6A 4ASNA 3G4SQ 1YFNA 4M7DE 2NVXJ 1KHCA 3REBB 4PFOA 4X6AJ 1B8IA 2E5ZA 3CDLA 1HW1A 1OCZH 1QBJA 2M02A 4C92A 3LWHA 2LTPA 1IREB 3KP6A 2R5ZA 2M4GA 1Z9CA 2W82A 4CUGA 4YIRX 1LPQA 1BIBA 1IAWA 3HSRA 3OYAA 2BXZA 1W1FA 4B43A 2F2VA 3KUFA 2DMUA 5F6FA 2K79A 2NVQJ 1W0UA 1LB2A 3EG3A 2IGOA 4EJVA 1N9SA 2O4XB 2ZPFB 4Q5WA 4WCIA 2LNBA 1YHQI 3JCMe 3CCEQ 3PTAA 1U06A 5LJ5h 3HHHA 1WJFA 3G2BA 2HTJA 2JW4A 2P6TA 3E1SA 2VQLA 3H0FA 4BEHA 2HOEA 4F55A 4I02A 2FXAA 2P5LC 3CQZJ 3CP8A 2FPEA 3HFNA 4L5GA 3O8GA 4A6EA 5AYFA 2DOFA 2KISA 3TQNA 2MC3A 3PNVA 4AIKA 3VS3A 4WTOB 1YNZA 3CD6A 4HXJA 4D8KA 3CCUT 1S8NA 2P81A 5GTHC 3UA7A 4N9HA 3RPUD 1BI0A 3H35A 2R7ZJ 2DJIA 4AT1B 4M6YA 3Q9VA 4C8QG 2VIXA 1TH7A 5AIPA 3P9CA 3TEDA 1J9IA 1MJ9A 2E7WA 3DXJF 2CH4W 7AT1B 5LGUA 1ZG3A 2QA4I 3TP3A 2NNYA 1SFUA 2D9TA 4LDUA 1ZARA 2O01E 1O75A 1UTIA 4ZDPA 2HZYA 3OYMA 3OYCA 1NPRA 2FF4A 1E3HA 2FE3A 3IQLA 4F16A 2EJRA 3E7LA 2BIVA 1QVUA 2NLUA 2F4IA 4M78E 2HQHA 1Q7YU 4UV9A 2GCXA 1TWAJ 4LXCA 4A3EJ 2GA1A 5GAN3 1DGWY 5H20A 2W24A 2ZSHB 3LAJA 3RESA 3M7GA 3EYIA 2JA5J 3BR1A 4FSXA 3I59B 3MKYB 4ENMA 2ICWG 2L0AA 2DQRA 4O6JA 2L4MA 1G2HA 3KP5A 1ZX6A 2KE9A 2X35A 4LDYA 1R77A 5GAOr 1H8AC 1V4RA 1A36A 4XK8E 2NUTA 3ZQQA 4L9TA 1U6GA 1FYLA 1P7JA 4UXNA 3EQLF 4BKXA 4EGZA 1JXSA 2X1DA 1IRGA 4LOCA 2KGTA 1I5OB 3CBOA 4A3JJ 3QYFA 1D8JA 5GAOn 5DEQA 2L02A 1IF1A 4BNCA 5JLWA 1QPIA 3FKJA 1DPRA 2DFFA 2ZMEA 5GP9A 4BEHB 5DS9A 3CCSA 2FMLA 4UUSB 2FD5A 1S29A 2UXNA 5EZHA 3ERED 2FHDA 1I8FA 3DPUA 5J4YA 4A3CJ 2R7WA 5J1UA 5ILUA 1BR2A 1U2WA 1M1FA 1IZ1A 3ZMUA 3VV0A 2QQAA 2XI9A 5GAN8 4BY7J 3J7AO 4B47A 3LGFA 3QQAA 2F4OB 2ZJPF 1JJ6C 4LB5A 2V7FA 2EZIA 2CRGA 3C95A 4MQVA 3GFIA 5FWCA 2E19A 2DFUA 3VS5A 1RESA 4WXDA 3C94A 2E3IA 4HVWA 3FXUA 4CO8A 3O2PE 3DLLA 5E20A 3ZOBA 2HGCA 2W85A 3S14J 2DD5A 4R0KA 5M9OA 1W0TA 2RK2A 1X1CA 5I2MA 3CD6I 1P4WA 1ZBXA 1KQSA 4QTRA 3PSIA 5HS7A 4FU6A 3I71A 5CK9A 1HSQA 2F2WA 3CMAA 1WZ2A 1ARKA 1GBRA 2XF7A 4FHTA 1B07A 4M78F 1M8VA 3MZ8A 3RDVA 1BBZA 1JT6A 2AZSA 3CCJQ 4BD3A 1NBEB 1B59A 5H6QA 5GANh 1WRJA 4N4HA 2HDWA 4XRMA 5M3MJ 1O9SA 1X19A 2K4JA 2ZFUA 4KMFA 1I39A 1SRMA 1ZKGA 2A61A 3SEMA 1Q86C 1P9QC 3ZN1A 3HTUA 4RGXA 4M3DA 2H3JA 2L2OA 4M75E 3E3VA 1VQNI 2J6KA 2XVCA 4XICA 3X2QH 2CP6A 2YUNA 2HQNA 1ABQA 2R92J 2Z33A 1YJWT 1HDDC 1S9HA 2I2LA 5J3LA 3EGDB 3D5RC 4J9CA 3RBBB 2LNVA 3M07A 4BDZA 2DA1A 3GFLA 1MHNA 4BI3A 2XV4S 4F52A 4YRVA 1R22A 3GTOJ 3W2AA 5L3BA 3O8HA 3RUXA 2E60A 3NTKA 4IIOA 4OIPF 1ETQA 3BR0A 2GOMA 3CF2A 2BZXA 3INZA 2XB0X 1FMVA 3ASOH 4AM3A 1AWJA 2DJZA 3M3YJ 5FLVA 1AT1B 3G6EA 2OA4A 4YEJA 5CKFA 2OTLT 3K1PA 2X4JA 3VYHB 4UUVA 1I0CA 2M9HA 3O8VA 4GFBA 4XL9A 5EGOB 1U0JA 3PGGA 4F7UG 5IPAA 3UDCA 2DTOA 1RNLA 3OYYA 4C92F 2GZWA 1QWEA 1Y0UA 4L5IA 3PIOA 1WJBA 4EMKC 1T33A 2QQ9A 1AZEA 1KC8U 4RTZA 5BPDA 1ZUUA 2AQFA 4M7DD 1WI3A 3OMCA 3FMSA 1AHJB 4BGDA 1T39A 3LH5A 2QYZA 5HDGA 3QP5A 3HXLA 2O7OA 2RA2A 1N78A 1XTDA 1UMQA 1L3LA 2CG4A 2WV1A 1X75C 2XHKA 2EJFA 1PUFA 1GCPA 1ZYRF 2HR3A 1LVKA 1IN6A 3AG2H 3MQ0A 4X1EA 4A5NA 5J8FA 5HLGA 1MV0B 1RABB 2DA6A 2DA3A 3BR2A 4E6KG 4KGZB 1T98A 2DMQA 3RERA 2X9DA 1Z3YA 3BROA 3MD2A 2JM8A 2DKGA 1RKWA 1UE9A 4RB2C 1G6NA 2PLYA 2Q1ZB 1QVFP 1CF7A 2X0LA 5LJ3d 3CMAQ 5K1YA 4A5MA 5A0DA 3KPHA 4BQQA 2VXFA 3MEXA 2RQPA 3HSEA 1IRFA 3K70C 1VQLI 5EF6A 4GDFA 4CCLA 1X01A 4WK8F 2A3LA 5LJ3g 1UFMA 5FU7C 1ZG5A 4C0ZA 1K9MU 1Y96B 3HGGA 6PAXA 2MK5A 4KH0B 2E41A 3K1NA 3OY9A 5KYXA 2FJ1A 1EKEA 2X4HA 4N9IA 5GPCA 5LEJA 4ZYGA 2MZ4A 1T3SA 1JGSA 2JK3A 4GGGA 3CC4I 2JRTA 1E17A 2M8EA 2YU3A 4ZYEA 1VYTA 1X6OA 2QI2A 3NTHA 3EG2A 3HTSB 2NAZA 1UECA 5GANj 3JR9A 1P4AA 2DA9A 1WHLA 2KIUA 2A05A 4JBAA 3B73A 5F04A 1VQPI 3BCBA 3L7WA 2HPMA 3PUFA 2E2HJ 2IJLA 3RKQA 3EG9A 1IDZA 3QWLA 4D6WA 1Z3XA 5C6SA 3RCOA 2A07F 2SEMA 2HKXA 2XHCA 2K4BA 1RI7A 3KYLA 1VFCA 2P84A 3TGNA 2MFZA 2Y0MA 2JTVA 3CUQC 2XPWA 3WTWC 2L0KA 2Y9ZA 2ME6A 3MFKA 3N4MA 4P5OA 5CAIA 4NC6A 1R23A 1I1SA 2CREA 3FX3A 3Q0VA 1ZAOA 2MLKA 4LLGF 4ZTJA 1JU5C 1NJIR 3VB2A 4V2SA 3PL8A 3FDRA 5FW9A 1STZA 3EUHA 1W36C 4GY5A 1V54H 1VQMA 3U1KA 1KQ2A 2KDSA 2CP7A 5GMKh 2CSOA 2OZ6A 2V79A 2K86A 1F1BB 1VQ6Q 4C5HA 3ZBDA 2HZDA 1KG1A 2KSSA 2YX7A 2LP0A 3FM3A 2LD5A 2DDAA 5HDNA 4EVIA 2EKOA 3HOWJ 2O31A 2VKHA 3SEZA 3FKIJ 4AWXB 5GAN5 3M53A 4IUUA 1ZSZA 4CC2A 4J9IA 1WJSA 2H94A 3TO9A 5FLXZ 3OS5A 2CP2A 2FOWA 4BBSJ 2V26A 3OL3A 4NUBA 1MNMC 5KNLA 4Y28E 3CUQB 1BBYA 2KRFA 3OS1A 3ML6A 1MGTA 5F0HA 4FX4A 3H9GA 1TZLA 2WB1N 3GW2A 1XS9A 3KIOA 2KEAA 4F93B 2Y69H 2A6EF 2DJNA 1TUDA 2K3FA 1SD7A 2D1VA 2DL3A 2EGEA 2KROA 3J7AY 5GMKe 3HC7A 2LMDA 3J80R 1BCMA 1CKBA 3CC2T 3WTTC 3QODA 4LE9A 2O3FA 2XSJC 2K2VA 2KVQG 1JJ8C 2QEXT 1KQ0A 4DBRA 3ZQGA 2ESNA 1BW6A 1HW5A 5LFAA 2VBZA 1R58A 1YJ9T 5KYNA 1AWOA 1XX5A 4GYIA 4U0WA 1ZQ3P 3JB9J 3KXTA 2VXDA 1BA5A 4C0DC 2E7XA 3IHUA 3ESWB 4E7IA 3JB9F 3G73A 1SVOA 2RNJA 3S1QJ 3MP8A 3EYYA 1K8AU 2RJFA 2CUJA 1U8RA 1QA6A 2IS2A 4X34A 2R7QA 4AFUC 4YFKF 3HUGB 1ETVA 2FUG2 5FRNA 2ZGWA 2PFBA 3C2BA 2KT0A 2NVYJ 1NG6A 1HXDA 5FU6C 3FZVA 2RI5A 2HU9A 1VIEA 3DKXA 1OLTA 2DA5A 2JWTA 1KYZA 3JCMc 4CC7A 5LD2C 2DEUA 1H3HA 1X1AA 5IT9E 1YBYA 2EGAA 3BG5A 3J7AF 2E5QA 4M9XA 3S2DJ 1RR8C 4B3AA 1YP5A 4A6DA 4FT8A 4GO1A 3H41A 4FYWB 1IN8A 5BQTA 2XK0A 5F0CA 4D5CA 4ZYHA 1K4TA 4GLMA 3ZR8X 2BBYA 3CCVA 1Q82U 4IHSA 3QZ9B 5GAMf 2PJRA 4M7DC 3ZQ7A 1MBJA 3QYGB 1B1BA 4IOAF 4F7UF 4YFNF 4DEYA 3G1MA 2CFOA 5M5WJ 2MMPA 2JS0A 4PL6A 3HZJA 1SFXA 2UZKA 1FYMA 1B72B 1QWFA 2CZ1B 4PGHA 5KCHA 4MGRA 4XONA 3K4JA 3O6BB 4PLIA 2IPOB 1PRLC 3TKYA 1W7PB 3KEYA 1WJQA 1VQPA 3AFHA 3HL8A 1BC7C 1YG2A 4C8QD 1NJIU 3OYDA 1XD7A 5DYMA 1T08B 3R6SA 2HEOA 3KYDB 2DBBA 3ZMSA 5KYWB 1M1KU 3CUOA 1TW2A 1HKTA 1QZZA 3PM1A 1JUSA 2EIFA 1JJ2P 4XMYA 5F1RA 3S1MJ 3CDIA 2E5NA 2PMHA 3EPZA 4IRHA 3L2QA 1ZG1A 1XGNA 3ZRGA 3OR1C 4CCJA 2GTJA 4RCCA 2EYQA 3R6NA 4XQFA 2DODA 2P7VB 3ABTA 4BQOA 4HCCA 5J6XA 1Z1DA 3OYIA 2QASA 3CCJT 2OF7A 2KDZA 4KUDK 1D0YA 4BHCA 2R3SA 3CMMA 2G6FX 4JX5A 4M72A 4U7BA 2QDYB 3ASKA 4KUIA 2GFAA 3SB2A 1M9SA 3X24B 1IXDA 3H3ZA 2LK2A 2R7TA 4X1VA 2DFIA 4CHUA 1QCFA 4XKVA 1Y8RB 2DVEA 2W10A 1YJWI 1HJDA 3VRZA 4CCOA 1IN4A 2V4JC 3WG9A 4ENJA 5C4JJ 3OL4A 3BQZA 1WJCA 2H8WA 4DNCA 1IHWA 2PVOB 3E6DA 3QOPA 3PQJA 1NYGA 3QPLA 1V1CA 4NL2A 2R5ZB 2ZZDA 4MHGA 3GTGJ 2K7LA 1Y7XA 2FMYA 4IHYA 2HTSA 1OX8A 2K5LA 2GOXB 2P4TA 3A8HB 2GXBA 4B1RA 1QU3A 1M3BA 4FW2A 2BKDN 1UHMA 1JI8A 1NLPC 2KR3A 1KU2A 2F48A 2MBFA 4RM2A 1KZHA 2QGFB 1EZZB 1WH5A 5E1XA 1H88C 4B48A 3ULQB 3R4KA 3JRBA 3CCSQ 4M6XA 1FPQA 2E1OA 2F5VA 1TNTA 5CVJA 4D7NA
chains in the Genus database with same CATH topology
2R7DA 3KEOA 2O8XA 1FZPB 1O7LA 5CKBA 3IWFA 4Y17A 1F4KA 2PJPA 1YJWA 5J39A 1XGMA 1IXCA 2L4AA 3H3UA 4BE0A 4KN4X 3QRFF 2K57A 5I2SA 4BE2A 5A2QZ 4EV0A 3G6ET 1IXSB 1Z91A 3CEYA 1FYKA 2OQRA 2XUBA 5ED4A 5A0GA 4WX9A 2D1HA 4OB2B 1LNWA 5ICCA 3DKMA 4M7AF 2WACA 2F5EA 3WODF 4RB1A 2DK5A 3Q1JA 1FP1D