The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
PGSMLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb |
molecule tags |
Protein binding/transferase
|
source organism |
Homo sapiens
|
molecule keywords |
Programmed cell death protein 10
|
total genus |
29
|
structure length |
67
|
sequence length |
67
|
ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
pdb deposition date | 2013-03-13 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 3RQF A; 3L8J A; 3RQE A; 3W8H B; 3RQG A; 3AJM A; 4GEH B; 3W8I B; 3L8I A; #chains in the Genus database with same CATH topology 4IZB A; 3MOY A; 2GTR A; 3Q0G A; 2P63 A; 3HRX A; 1DUB A; 1NZY B; 3R0O A; 3SWX A; 3Q1T A; 4OLQ A; 2EJ5 A; 3QXI A; 3MYB A; 1UX4 A; 3A4N A; 1HZD A; 4I42 A; 4WCZ A; 3H81 A; 3ADD A; 4ZU2 A; 5JBW A; 1EY3 A; 4KNP A; 3FDU A; 3IRB A; 3RQF A; 4QII A; 3R9T A; 1WZ8 A; 4U1A A; 3RQG A; 1EF8 A; 3QXZ A; 2QQ3 A; 2VRE A; 2F6Q A; 4U19 A; 4EML A; 2HW5 A; 3RSI A; 2IEX A; 3G64 A; 3KQF A; 1MJ3 A; 3RQE A; 2ZQR A; 3Q0J A; 3T8A A; 3TLF A; 4IZD A; 1UIY A; 1NZY A; 3QK8 A; 3SLL A; 1JXZ A; 4JWV A; 4MOU A; 4FZW C; 1Q51 A; 4JCS A; 4NNQ A; 4K2N A; 3W8I B; 3H02 A; 4FJW D; 1RJN A; 3A4L A; 3HIN A; 3A4M A; 3L8J A; 4JYL A; 2VX2 A; 3W8H B; 4ELW A; 3P5M A; 3L8I A; 4K3W A; 4U18 A; 5KJP A; 1Q52 A; 3T89 A; 1UX5 A; 3AM1 A; 4ELS A; 2PPY A; 1EF9 A; 2FBM A; 3T88 A; 4I4Z A; 5JBX A; 4QIJ A; 3AJM A; 4GEH B; 5C9G A; 3O4X E; 3ADB A; 4IZC A; 4F47 A; 2FW2 A; 4OG1 A; 3PZK A; 2PBP A; 1RJM A; 1Y64 B; 4I52 A; 4JFC A; 3R9S A; 2DUB A; 3TRR A; 3ADC A; 4FZW A; 3I47 A; 4ELX A; 4JOT A; 2ZQQ A; 1DCI A; 3OC7 A; 4MI2 A; 2UZF A; 4NEK A; #chains in the Genus database with same CATH homology 3IRB A; 3RQF A; 3A4L A; 3RQG A; 2P63 A; 3A4M A; 1RJM A; 3L8J A; 3RQE A; 1Y64 B; 3W8H B; 3L8I A; 1UX5 A; 3AM1 A; 3ADC A; 1UX4 A; 3A4N A; 3ADD A; 4NNQ A; 3AJM A; 4GEH B; 3W8I B; 3O4X E; 3ADB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...