3UZCA

Thermostabilised adenosine a2a receptor in complex with 4-(3-amino-5-phenyl-1,2,4-triazin-6-yl)-2-chlorophenol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
299
structure length
291
Chain Sequence
SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Adenosine A2A Receptor
publication title Discovery of 1,2,4-Triazine Derivatives as Adenosine A(2A) Antagonists using Structure Based Drug Design
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 291
sequence length 299
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3uzcA00
2KSBA 5H2OA 4GP5B 3VGAA 3OE9A 3QAPA 1GUEA 3PWHA 2Y01A 2AT9A 4HYJA 4DKLA 3QDCA 1QHJA 1XJIA 1R2NA 4MQSA 2G87A 3ZPRA 5JJNA 4WW3A 5AZDA 3QBKA 2M3GA 4NC3A 2JAFA 1H2SA 1IW9A 3EH5B 3QAKA 3OE8A 2X72A 4MD2A 3NY8A 3V2WA 5G28A 2JAGA 2YCZA 3A7KA 5B0WA 4DAJA 2F93A 2YCYA 3PDSA 1QKOA 3CAPA 4LDLA 4XXJA 5B35A 3QBGA 1P8HA 3HANA 3MBVA 4DJHA 3D4SA 5J7AA 4JKVA 2I35A 1BM1A 3NSBA 4TL3A 2QPEB 4X32A 4HYXA 5ETZA 1TN0A 4XT1A 4X1HA 3VHZA 5EN0A 1P8UA 4G7SB 4MD1A 4GP8B 5B2NA 4FBZA 1S8LA 3ZEVA 3HARA 5JJJA 1E0PA 5H2MA 4AMIA 5B6WA 4GYCA 3ABWA 5DHGA 3WQJA 4AMJA 4G71B 5A45A 2NTUA 2F95A 3UG9A 4JR8A 2Y00A 1VGOA 4L6RA 4XT3A 1CWQA 1M0KA 1AP9A 1LN6A 1M0MA 3VI0A 4K5YA 4LDEA 4GP4B 3X3BA 3OAXA 1UAZA 2Z55A 2WJKA 2ZZLA 1VJMA 3QJUB 3EMLA 2EI4A 4Y9HA 1X0SA 1F50A 3QJQB 1R84A 5G2DA 1C3WA 5G2CA 1BRDA 5G54A 3S3CB 2QPDB 3ZPQA 1L9HA 4EIYA 1HZXA 1IXFA 4BV0A 1P8IA 1IW6A 3VG9A 4UG2A 3QJSB 5B34A 5AX1A 3BVDB 3UTWA 4IAQA 4G72B 1PXSA 2NTWA 1S8JA 3C9LA 4LDOA 2YDVA 1KG9A 3HAPA 1AT9A 4G7RB 4PXFA 5AHYA 4GRVA 3S8FB 3UTYA 2KSYA 1EHKB 1C8RA 5DHHA 2BRDA 5AX0A 5G2AA 3S3BB 4GBRA 5B6VA 1XMEB 5ITEA 4KNFA 1FBKA 5C1MA 4N4WA 5H2IA 5AWZA 3C9MA 4OV0A 4QRYA 2VT4A 1GU8A 5A8EA 3X3CA 3S8GB 2Y03A 4XTNA 3SN6R 3CODA 5BR2A 4G70B 5ITCA 1XIOA 1C8SA 2Y02A 3OE0A 5F8UA 5G36A 3AYNA 3S3DB 4G7QB 4EA3A 2KS9A 5AHZA 3VVKA 1S54A 3DDLA 1F4ZA 4JQ6A 3UTXA 1S52A 1X0K1 1FBBA 4QI1A 4IB4A 5KKHA 1H68A 5H2HA 5DYSA 2L6XA 3NYAA 3NY9A 3P0GA 1KGBA 1QM8A 3HAOA 1S51A 3HASA 2ZIYA 1BRXA 3RFMA 3HAQA 2HPYA 3V2YA 1UCQA 5A44A 3VW7A 1TN5A 3QBIA 3QJTB 4J4QA 2J4YA 1M0LA 3EH3B 4KLYA 4X31A 4BEYA 2YCXA 3PXOA 1E12A 1JV7A 5BR5A 4L35A 3UONA 5H2JA 4BUOA 2WJLA 1QKPA 4FA7B 4PXKA 1KG8A 3REYA 1JFPA 3QJRB 5H2PA 3PQRA 2I1XA 2PEDA 2ZFEA 2RH1A 4QIDA 3KJ6A 3EH4B 5H2LA 5B6YA 4A4MA 1Q5JA 2R4RA 1X0I1 4BVNA 1BRRA 4N4YB 3QJVB 5TGZA 3T45A 3ODUA 4BWBA 5G53A 1PY6A 5B6ZA 2Z73A 4EJ4A 3UZCA 4IARA 1Q5IA 1F88A 3PBLA 2Y04A 4MBSA 4FPDA 4GPOA 3DQBA 3NS0A 3COCA 4UHRA 1GZMA 3OE6A 2YCWA 5FJGA 5LWEA 4WAVA 4BEZA 5H2KA 5B6XA 1DZEA 1MGYA 1JV6A 2YDOA 4XTLA 4MQTA 1KMEA 1L0MA 3AYMA 3UTVA 4XTOA 1JGJA 2R4SA 5H2NA 1S53A 4HWLA 4FAAB 3UZAA 1U19A 3RZEA 2KSAA 2I20A 1O0AA 4N6HA 5JJEA 1PXRA 2I21A 3AM6A 3QBLA 2LNLA
chains in the Genus database with same CATH superfamily
2KSBA 5H2OA 4GP5B 3VGAA 3OE9A 3QAPA 1GUEA 3PWHA 2Y01A 2AT9A 4HYJA 4DKLA 3QDCA 1QHJA 1XJIA 1R2NA 4MQSA 2G87A 3ZPRA 5JJNA 4WW3A 5AZDA 3QBKA 2M3GA 4NC3A 2JAFA 1H2SA 1IW9A 3EH5B 3QAKA 3OE8A 2X72A 4MD2A 3NY8A 3V2WA 5G28A 2JAGA 2YCZA 3A7KA 5B0WA 4DAJA 2F93A 2YCYA 3PDSA 1QKOA 3CAPA 4LDLA 4XXJA 5B35A 3QBGA 1P8HA 3HANA 3MBVA 4DJHA 3D4SA 5J7AA 4JKVA 2I35A 1BM1A 3NSBA 4TL3A 2QPEB 4X32A 4HYXA 5ETZA 1TN0A 4XT1A 4X1HA 3VHZA 5EN0A 1P8UA 4G7SB 4MD1A 4GP8B 5B2NA 4FBZA 1S8LA 3ZEVA 3HARA 5JJJA 1E0PA 5H2MA 4AMIA 5B6WA 4GYCA 3ABWA 5DHGA 3WQJA 4AMJA 4G71B 5A45A 2NTUA 2F95A 3UG9A 4JR8A 2Y00A 1VGOA 4L6RA 4XT3A 1CWQA 4DS7E 1M0KA 1AP9A 1LN6A 1M0MA 3VI0A 4K5YA 4LDEA 4GP4B 3X3BA 3OAXA 1UAZA 2Z55A 2WJKA 2ZZLA 1VJMA 3QJUB 3EMLA 2EI4A 4Y9HA 1X0SA 1F50A 3QJQB 1R84A 5G2DA 1C3WA 5G2CA 1BRDA 5G54A 3S3CB 2QPDB 3ZPQA 1L9HA 4EIYA 1HZXA 1IXFA 4BV0A 1P8IA 1IW6A 3VG9A 4UG2A 3QJSB 5B34A 5AX1A 3BVDB 3UTWA 4IAQA 4G72B 1PXSA 2NTWA 1S8JA 3C9LA 4LDOA 2YDVA 1KG9A 3HAPA 1AT9A 4G7RB 4PXFA 5AHYA 4GRVA 3S8FB 3UTYA 2KSYA 1EHKB 1C8RA 5DHHA 2BRDA 5AX0A 5G2AA 3S3BB 4GBRA 5B6VA 1XMEB 5ITEA 4KNFA 1FBKA 5C1MA 4N4WA 5H2IA 5AWZA 3C9MA 4OV0A 4QRYA 2VT4A 1GU8A 5A8EA 3X3CA 3S8GB 2Y03A 4XTNA 3SN6R 3CODA 5BR2A 4G70B 5ITCA 1XIOA 1C8SA 2Y02A 3OE0A 5F8UA 5G36A 3AYNA 3S3DB 4G7QB 4EA3A 2KS9A 5AHZA 3VVKA 1S54A 3DDLA 1F4ZA 4JQ6A 3UTXA 1S52A 1X0K1 1FBBA 4QI1A 4IB4A 5KKHA 1H68A 5H2HA 5DYSA 2L6XA 3NYAA 3NY9A 3P0GA 1KGBA 1QM8A 3HAOA 1S51A 3HASA 2ZIYA 1BRXA 3RFMA 3HAQA 2HPYA 3V2YA 1UCQA 5A44A 3VW7A 1TN5A 3QBIA 3QJTB 4J4QA 2J4YA 1M0LA 3EH3B 4KLYA 4X31A 4BEYA 2YCXA 3PXOA 1E12A 1JV7A 5BR5A 4L35A 3UONA 5H2JA 4BUOA 2WJLA 1QKPA 4FA7B 4PXKA 1KG8A 3REYA 1JFPA 3QJRB 5H2PA 3PQRA 2I1XA 2PEDA 2ZFEA 2RH1A 4QIDA 3KJ6A 3EH4B 5H2LA 5B6YA 4A4MA 1Q5JA 2R4RA 1X0I1 4BVNA 1BRRA 4N4YB 3QJVB 5TGZA 3T45A 3ODUA 4BWBA 5G53A 1PY6A 5B6ZA 2Z73A 4EJ4A 3UZCA 4IARA 1Q5IA 1F88A 3PBLA 2Y04A 4MBSA 4FPDA 4GPOA 3DQBA 3NS0A 3COCA 4UHRA 1GZMA 3OE6A 2YCWA 5FJGA 5LWEA 4WAVA 4BEZA 5H2KA 5B6XA 1DZEA 1MGYA 1JV6A 2YDOA 4XTLA 4MQTA 1KMEA 1L0MA 3AYMA 3UTVA 4XTOA 1JGJA 2R4SA 5H2NA 1S53A 4HWLA 4FAAB 3UZAA 1U19A 3RZEA 2KSAA 2I20A 1O0AA 4N6HA 5JJEA 1PXRA 2I21A 3AM6A 3QBLA 2LNLA
chains in the Genus database with same CATH topology
2KSBA 5H2OA 4GP5B 3VGAA 3OE9A 3QAPA 1GUEA 3PWHA 2Y01A 2AT9A 4HYJA 4DKLA 3QDCA 1QHJA 1XJIA 1R2NA 4MQSA 2G87A 3ZPRA 5JJNA 4WW3A 5AZDA 3QBKA 2M3GA 4NC3A 2JAFA 1H2SA 1IW9A 3EH5B 3QAKA 3OE8A 2X72A 4MD2A 3NY8A 3V2WA 5G28A 2JAGA 2YCZA 3A7KA 5B0WA 4DAJA 2F93A 2YCYA 3PDSA 1QKOA 3CAPA 4LDLA 4XXJA 5B35A 3QBGA 1P8HA 3HANA 3MBVA 4DJHA 3D4SA 5J7AA 4JKVA 2I35A 1BM1A 3NSBA 4TL3A 2QPEB 4X32A 4HYXA 5ETZA 1TN0A 4XT1A 4X1HA 3VHZA 5EN0A 1P8UA 4G7SB 4MD1A 4GP8B 5B2NA 4FBZA 1S8LA 3ZEVA 3HARA 5JJJA 1E0PA 5H2MA 4AMIA 5B6WA 4GYCA 3ABWA 5DHGA 3WQJA 4AMJA 4G71B 5A45A 2NTUA 2F95A 3UG9A 4JR8A 2Y00A 1VGOA 4L6RA 4XT3A 1CWQA 4DS7E 1M0KA 1AP9A 1LN6A 1M0MA 3VI0A 4K5YA 4LDEA 4GP4B 3X3BA 3OAXA 1UAZA 2Z55A 2WJKA 2ZZLA 1VJMA 3QJUB 3EMLA 2EI4A 4Y9HA 1X0SA 1F50A 3QJQB 1R84A 5G2DA 1C3WA 5G2CA 1BRDA 5G54A 3S3CB 2QPDB 3ZPQA 1L9HA 4EIYA 1HZXA 1IXFA 4BV0A 1P8IA 1IW6A 3VG9A 4UG2A 3QJSB 5B34A 5AX1A 3BVDB 3UTWA 4IAQA 4G72B 1PXSA 2NTWA 1S8JA 3C9LA 4LDOA 2YDVA 1KG9A 3HAPA 1AT9A 4G7RB 4PXFA 5AHYA 4GRVA 3S8FB 3UTYA 2KSYA 1EHKB 1C8RA 5DHHA 2BRDA 5AX0A 5G2AA 3S3BB 4GBRA 5B6VA 1XMEB 5ITEA 4KNFA 1FBKA 5C1MA 4N4WA 5H2IA 5AWZA 3C9MA 4OV0A 4QRYA 2VT4A 1GU8A 5A8EA 3X3CA 3S8GB 2Y03A 4XTNA 3SN6R 3CODA 5BR2A 4G70B 5ITCA 1XIOA 1C8SA 2Y02A 3OE0A 5F8UA 5G36A 3AYNA 3S3DB 4G7QB 4EA3A 2KS9A 5AHZA 3VVKA 1S54A 3DDLA 1F4ZA 4JQ6A 3UTXA 1S52A 1X0K1 1FBBA 4QI1A 4IB4A 5KKHA 1H68A 5H2HA 5DYSA 2L6XA 3NYAA 3NY9A 3P0GA 1KGBA 1QM8A 3HAOA 1S51A 3HASA 2ZIYA 1BRXA 3RFMA 3HAQA 2HPYA 3V2YA 1UCQA 5A44A 3VW7A 1TN5A 3QBIA 3QJTB 4J4QA 2J4YA 1M0LA 3EH3B 4KLYA 4X31A 4BEYA 2YCXA 3PXOA 1E12A 1JV7A 5BR5A 4L35A 3UONA 5H2JA 4BUOA 2WJLA 1QKPA 4FA7B 4PXKA 1KG8A 3REYA 1JFPA 3QJRB 5H2PA 3PQRA 2I1XA 2PEDA 2ZFEA 2RH1A 4QIDA 3KJ6A 3EH4B 5H2LA 5B6YA 4A4MA 1Q5JA 2R4RA 1X0I1 4BVNA 1BRRA 4N4YB 3QJVB 5TGZA 3T45A 3ODUA 4BWBA 5G53A 1PY6A 5B6ZA 2Z73A 4EJ4A 3UZCA 4IARA 1Q5IA 1F88A 3PBLA 2Y04A 4MBSA 4FPDA 4GPOA 3DQBA 3NS0A 3COCA 4UHRA 1GZMA 3OE6A 2YCWA 5FJGA 5LWEA 4WAVA 4BEZA 5H2KA 5B6XA 1DZEA 1MGYA 1JV6A 2YDOA 4XTLA 4MQTA 1KMEA 1L0MA 3AYMA 3UTVA 4XTOA 1JGJA 2R4SA 5H2NA 1S53A 4HWLA 4FAAB 3UZAA 1U19A 3RZEA 2KSAA 2I20A 1O0AA 4N6HA 5JJEA 1PXRA 2I21A 3AM6A 3QBLA 2LNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSB A;  5H2O A;  4GP5 B;  3VGA A;  3OE9 A;  3QAP A;  1GUE A;  3PWH A;  2Y01 A;  2AT9 A;  4HYJ A;  4DKL A;  3QDC A;  1QHJ A;  1XJI A;  1R2N A;  4MQS A;  2G87 A;  3ZPR A;  5JJN A;  4WW3 A;  5AZD A;  3QBK A;  2M3G A;  4NC3 A;  2JAF A;  1H2S A;  1IW9 A;  3EH5 B;  3QAK A;  3OE8 A;  2X72 A;  4MD2 A;  3NY8 A;  3V2W A;  5G28 A;  2JAG A;  2YCZ A;  3A7K A;  5B0W A;  4DAJ A;  2F93 A;  2YCY A;  3PDS A;  1QKO A;  3CAP A;  4LDL A;  4XXJ A;  5B35 A;  3QBG A;  1P8H A;  3HAN A;  3MBV A;  4DJH A;  3D4S A;  5J7A A;  4JKV A;  2I35 A;  1BM1 A;  3NSB A;  4TL3 A;  2QPE B;  4X32 A;  4HYX A;  5ETZ A;  1TN0 A;  4XT1 A;  4X1H A;  3VHZ A;  5EN0 A;  1P8U A;  4G7S B;  4MD1 A;  4GP8 B;  5B2N A;  4FBZ A;  1S8L A;  3ZEV A;  3HAR A;  5JJJ A;  1E0P A;  5H2M A;  4AMI A;  5B6W A;  4GYC A;  3ABW A;  5DHG A;  3WQJ A;  4AMJ A;  4G71 B;  5A45 A;  2NTU A;  2F95 A;  3UG9 A;  4JR8 A;  2Y00 A;  1VGO A;  4L6R A;  4XT3 A;  1CWQ A;  1M0K A;  1AP9 A;  1LN6 A;  1M0M A;  3VI0 A;  4K5Y A;  4LDE A;  4GP4 B;  3X3B A;  3OAX A;  1UAZ A;  2Z55 A;  2WJK A;  2ZZL A;  1VJM A;  3QJU B;  3EML A;  2EI4 A;  4Y9H A;  1X0S A;  1F50 A;  3QJQ B;  1R84 A;  5G2D A;  1C3W A;  5G2C A;  1BRD A;  5G54 A;  3S3C B;  2QPD B;  3ZPQ A;  1L9H A;  4EIY A;  1HZX A;  1IXF A;  4BV0 A;  1P8I A;  1IW6 A;  3VG9 A;  4UG2 A;  3QJS B;  5B34 A;  5AX1 A;  3BVD B;  3UTW A;  4IAQ A;  4G72 B;  1PXS A;  2NTW A;  1S8J A;  3C9L A;  4LDO A;  2YDV A;  1KG9 A;  3HAP A;  1AT9 A;  4G7R B;  4PXF A;  5AHY A;  4GRV A;  3S8F B;  3UTY A;  2KSY A;  1EHK B;  1C8R A;  5DHH A;  2BRD A;  5AX0 A;  5G2A A;  3S3B B;  4GBR A;  5B6V A;  1XME B;  5ITE A;  4KNF A;  1FBK A;  5C1M A;  4N4W A;  5H2I A;  5AWZ A;  3C9M A;  4OV0 A;  4QRY A;  2VT4 A;  1GU8 A;  5A8E A;  3X3C A;  3S8G B;  2Y03 A;  4XTN A;  3SN6 R;  3COD A;  5BR2 A;  4G70 B;  5ITC A;  1XIO A;  1C8S A;  2Y02 A;  3OE0 A;  5F8U A;  5G36 A;  3AYN A;  3S3D B;  4G7Q B;  4EA3 A;  2KS9 A;  5AHZ A;  3VVK A;  1S54 A;  3DDL A;  1F4Z A;  4JQ6 A;  3UTX A;  1S52 A;  1X0K 1;  1FBB A;  4QI1 A;  4IB4 A;  5KKH A;  1H68 A;  5H2H A;  5DYS A;  2L6X A;  3NYA A;  3NY9 A;  3P0G A;  1KGB A;  1QM8 A;  3HAO A;  1S51 A;  3HAS A;  2ZIY A;  1BRX A;  3RFM A;  3HAQ A;  2HPY A;  3V2Y A;  1UCQ A;  5A44 A;  3VW7 A;  1TN5 A;  3QBI A;  3QJT B;  4J4Q A;  2J4Y A;  1M0L A;  3EH3 B;  4KLY A;  4X31 A;  4BEY A;  2YCX A;  3PXO A;  1E12 A;  1JV7 A;  5BR5 A;  4L35 A;  3UON A;  5H2J A;  4BUO A;  2WJL A;  1QKP A;  4FA7 B;  4PXK A;  1KG8 A;  3REY A;  1JFP A;  3QJR B;  5H2P A;  3PQR A;  2I1X A;  2PED A;  2ZFE A;  2RH1 A;  4QID A;  3KJ6 A;  3EH4 B;  5H2L A;  5B6Y A;  4A4M A;  1Q5J A;  2R4R A;  1X0I 1;  4BVN A;  1BRR A;  4N4Y B;  3QJV B;  5TGZ A;  3T45 A;  3ODU A;  4BWB A;  5G53 A;  1PY6 A;  5B6Z A;  2Z73 A;  4EJ4 A;  3UZC A;  4IAR A;  1Q5I A;  1F88 A;  3PBL A;  2Y04 A;  4MBS A;  4FPD A;  4GPO A;  3DQB A;  3NS0 A;  3COC A;  4UHR A;  1GZM A;  3OE6 A;  2YCW A;  5FJG A;  5LWE A;  4WAV A;  4BEZ A;  5H2K A;  5B6X A;  1DZE A;  1MGY A;  1JV6 A;  2YDO A;  4XTL A;  4MQT A;  1KME A;  1L0M A;  3AYM A;  3UTV A;  4XTO A;  1JGJ A;  2R4S A;  5H2N A;  1S53 A;  4HWL A;  4FAA B;  3UZA A;  1U19 A;  3RZE A;  2KSA A;  2I20 A;  1O0A A;  4N6H A;  5JJE A;  1PXR A;  2I21 A;  3AM6 A;  3QBL A;  2LNL A; 
#chains in the Genus database with same CATH topology
 2KSB A;  5H2O A;  4GP5 B;  3VGA A;  3OE9 A;  3QAP A;  1GUE A;  3PWH A;  2Y01 A;  2AT9 A;  4HYJ A;  4DKL A;  3QDC A;  1QHJ A;  1XJI A;  1R2N A;  4MQS A;  2G87 A;  3ZPR A;  5JJN A;  4WW3 A;  5AZD A;  3QBK A;  2M3G A;  4NC3 A;  2JAF A;  1H2S A;  1IW9 A;  3EH5 B;  3QAK A;  3OE8 A;  2X72 A;  4MD2 A;  3NY8 A;  3V2W A;  5G28 A;  2JAG A;  2YCZ A;  3A7K A;  5B0W A;  4DAJ A;  2F93 A;  2YCY A;  3PDS A;  1QKO A;  3CAP A;  4LDL A;  4XXJ A;  5B35 A;  3QBG A;  1P8H A;  3HAN A;  3MBV A;  4DJH A;  3D4S A;  5J7A A;  4JKV A;  2I35 A;  1BM1 A;  3NSB A;  4TL3 A;  2QPE B;  4X32 A;  4HYX A;  5ETZ A;  1TN0 A;  4XT1 A;  4X1H A;  3VHZ A;  5EN0 A;  1P8U A;  4G7S B;  4MD1 A;  4GP8 B;  5B2N A;  4FBZ A;  1S8L A;  3ZEV A;  3HAR A;  5JJJ A;  1E0P A;  5H2M A;  4AMI A;  5B6W A;  4GYC A;  3ABW A;  5DHG A;  3WQJ A;  4AMJ A;  4G71 B;  5A45 A;  2NTU A;  2F95 A;  3UG9 A;  4JR8 A;  2Y00 A;  1VGO A;  4L6R A;  4XT3 A;  1CWQ A;  4DS7 E;  1M0K A;  1AP9 A;  1LN6 A;  1M0M A;  3VI0 A;  4K5Y A;  4LDE A;  4GP4 B;  3X3B A;  3OAX A;  1UAZ A;  2Z55 A;  2WJK A;  2ZZL A;  1VJM A;  3QJU B;  3EML A;  2EI4 A;  4Y9H A;  1X0S A;  1F50 A;  3QJQ B;  1R84 A;  5G2D A;  1C3W A;  5G2C A;  1BRD A;  5G54 A;  3S3C B;  2QPD B;  3ZPQ A;  1L9H A;  4EIY A;  1HZX A;  1IXF A;  4BV0 A;  1P8I A;  1IW6 A;  3VG9 A;  4UG2 A;  3QJS B;  5B34 A;  5AX1 A;  3BVD B;  3UTW A;  4IAQ A;  4G72 B;  1PXS A;  2NTW A;  1S8J A;  3C9L A;  4LDO A;  2YDV A;  1KG9 A;  3HAP A;  1AT9 A;  4G7R B;  4PXF A;  5AHY A;  4GRV A;  3S8F B;  3UTY A;  2KSY A;  1EHK B;  1C8R A;  5DHH A;  2BRD A;  5AX0 A;  5G2A A;  3S3B B;  4GBR A;  5B6V A;  1XME B;  5ITE A;  4KNF A;  1FBK A;  5C1M A;  4N4W A;  5H2I A;  5AWZ A;  3C9M A;  4OV0 A;  4QRY A;  2VT4 A;  1GU8 A;  5A8E A;  3X3C A;  3S8G B;  2Y03 A;  4XTN A;  3SN6 R;  3COD A;  5BR2 A;  4G70 B;  5ITC A;  1XIO A;  1C8S A;  2Y02 A;  3OE0 A;  5F8U A;  5G36 A;  3AYN A;  3S3D B;  4G7Q B;  4EA3 A;  2KS9 A;  5AHZ A;  3VVK A;  1S54 A;  3DDL A;  1F4Z A;  4JQ6 A;  3UTX A;  1S52 A;  1X0K 1;  1FBB A;  4QI1 A;  4IB4 A;  5KKH A;  1H68 A;  5H2H A;  5DYS A;  2L6X A;  3NYA A;  3NY9 A;  3P0G A;  1KGB A;  1QM8 A;  3HAO A;  1S51 A;  3HAS A;  2ZIY A;  1BRX A;  3RFM A;  3HAQ A;  2HPY A;  3V2Y A;  1UCQ A;  5A44 A;  3VW7 A;  1TN5 A;  3QBI A;  3QJT B;  4J4Q A;  2J4Y A;  1M0L A;  3EH3 B;  4KLY A;  4X31 A;  4BEY A;  2YCX A;  3PXO A;  1E12 A;  1JV7 A;  5BR5 A;  4L35 A;  3UON A;  5H2J A;  4BUO A;  2WJL A;  1QKP A;  4FA7 B;  4PXK A;  1KG8 A;  3REY A;  1JFP A;  3QJR B;  5H2P A;  3PQR A;  2I1X A;  2PED A;  2ZFE A;  2RH1 A;  4QID A;  3KJ6 A;  3EH4 B;  5H2L A;  5B6Y A;  4A4M A;  1Q5J A;  2R4R A;  1X0I 1;  4BVN A;  1BRR A;  4N4Y B;  3QJV B;  5TGZ A;  3T45 A;  3ODU A;  4BWB A;  5G53 A;  1PY6 A;  5B6Z A;  2Z73 A;  4EJ4 A;  3UZC A;  4IAR A;  1Q5I A;  1F88 A;  3PBL A;  2Y04 A;  4MBS A;  4FPD A;  4GPO A;  3DQB A;  3NS0 A;  3COC A;  4UHR A;  1GZM A;  3OE6 A;  2YCW A;  5FJG A;  5LWE A;  4WAV A;  4BEZ A;  5H2K A;  5B6X A;  1DZE A;  1MGY A;  1JV6 A;  2YDO A;  4XTL A;  4MQT A;  1KME A;  1L0M A;  3AYM A;  3UTV A;  4XTO A;  1JGJ A;  2R4S A;  5H2N A;  1S53 A;  4HWL A;  4FAA B;  3UZA A;  1U19 A;  3RZE A;  2KSA A;  2I20 A;  1O0A A;  4N6H A;  5JJE A;  1PXR A;  2I21 A;  3AM6 A;  3QBL A;  2LNL A; 
#chains in the Genus database with same CATH homology
 2KSB A;  5H2O A;  4GP5 B;  3VGA A;  3OE9 A;  3QAP A;  1GUE A;  3PWH A;  2Y01 A;  2AT9 A;  4HYJ A;  4DKL A;  3QDC A;  1QHJ A;  1XJI A;  1R2N A;  4MQS A;  2G87 A;  3ZPR A;  5JJN A;  4WW3 A;  5AZD A;  3QBK A;  2M3G A;  4NC3 A;  2JAF A;  1H2S A;  1IW9 A;  3EH5 B;  3QAK A;  3OE8 A;  2X72 A;  4MD2 A;  3NY8 A;  3V2W A;  5G28 A;  2JAG A;  2YCZ A;  3A7K A;  5B0W A;  4DAJ A;  2F93 A;  2YCY A;  3PDS A;  1QKO A;  3CAP A;  4LDL A;  4XXJ A;  5B35 A;  3QBG A;  1P8H A;  3HAN A;  3MBV A;  4DJH A;  3D4S A;  5J7A A;  4JKV A;  2I35 A;  1BM1 A;  3NSB A;  4TL3 A;  2QPE B;  4X32 A;  4HYX A;  5ETZ A;  1TN0 A;  4XT1 A;  4X1H A;  3VHZ A;  5EN0 A;  1P8U A;  4G7S B;  4MD1 A;  4GP8 B;  5B2N A;  4FBZ A;  1S8L A;  3ZEV A;  3HAR A;  5JJJ A;  1E0P A;  5H2M A;  4AMI A;  5B6W A;  4GYC A;  3ABW A;  5DHG A;  3WQJ A;  4AMJ A;  4G71 B;  5A45 A;  2NTU A;  2F95 A;  3UG9 A;  4JR8 A;  2Y00 A;  1VGO A;  4L6R A;  4XT3 A;  1CWQ A;  4DS7 E;  1M0K A;  1AP9 A;  1LN6 A;  1M0M A;  3VI0 A;  4K5Y A;  4LDE A;  4GP4 B;  3X3B A;  3OAX A;  1UAZ A;  2Z55 A;  2WJK A;  2ZZL A;  1VJM A;  3QJU B;  3EML A;  2EI4 A;  4Y9H A;  1X0S A;  1F50 A;  3QJQ B;  1R84 A;  5G2D A;  1C3W A;  5G2C A;  1BRD A;  5G54 A;  3S3C B;  2QPD B;  3ZPQ A;  1L9H A;  4EIY A;  1HZX A;  1IXF A;  4BV0 A;  1P8I A;  1IW6 A;  3VG9 A;  4UG2 A;  3QJS B;  5B34 A;  5AX1 A;  3BVD B;  3UTW A;  4IAQ A;  4G72 B;  1PXS A;  2NTW A;  1S8J A;  3C9L A;  4LDO A;  2YDV A;  1KG9 A;  3HAP A;  1AT9 A;  4G7R B;  4PXF A;  5AHY A;  4GRV A;  3S8F B;  3UTY A;  2KSY A;  1EHK B;  1C8R A;  5DHH A;  2BRD A;  5AX0 A;  5G2A A;  3S3B B;  4GBR A;  5B6V A;  1XME B;  5ITE A;  4KNF A;  1FBK A;  5C1M A;  4N4W A;  5H2I A;  5AWZ A;  3C9M A;  4OV0 A;  4QRY A;  2VT4 A;  1GU8 A;  5A8E A;  3X3C A;  3S8G B;  2Y03 A;  4XTN A;  3SN6 R;  3COD A;  5BR2 A;  4G70 B;  5ITC A;  1XIO A;  1C8S A;  2Y02 A;  3OE0 A;  5F8U A;  5G36 A;  3AYN A;  3S3D B;  4G7Q B;  4EA3 A;  2KS9 A;  5AHZ A;  3VVK A;  1S54 A;  3DDL A;  1F4Z A;  4JQ6 A;  3UTX A;  1S52 A;  1X0K 1;  1FBB A;  4QI1 A;  4IB4 A;  5KKH A;  1H68 A;  5H2H A;  5DYS A;  2L6X A;  3NYA A;  3NY9 A;  3P0G A;  1KGB A;  1QM8 A;  3HAO A;  1S51 A;  3HAS A;  2ZIY A;  1BRX A;  3RFM A;  3HAQ A;  2HPY A;  3V2Y A;  1UCQ A;  5A44 A;  3VW7 A;  1TN5 A;  3QBI A;  3QJT B;  4J4Q A;  2J4Y A;  1M0L A;  3EH3 B;  4KLY A;  4X31 A;  4BEY A;  2YCX A;  3PXO A;  1E12 A;  1JV7 A;  5BR5 A;  4L35 A;  3UON A;  5H2J A;  4BUO A;  2WJL A;  1QKP A;  4FA7 B;  4PXK A;  1KG8 A;  3REY A;  1JFP A;  3QJR B;  5H2P A;  3PQR A;  2I1X A;  2PED A;  2ZFE A;  2RH1 A;  4QID A;  3KJ6 A;  3EH4 B;  5H2L A;  5B6Y A;  4A4M A;  1Q5J A;  2R4R A;  1X0I 1;  4BVN A;  1BRR A;  4N4Y B;  3QJV B;  5TGZ A;  3T45 A;  3ODU A;  4BWB A;  5G53 A;  1PY6 A;  5B6Z A;  2Z73 A;  4EJ4 A;  3UZC A;  4IAR A;  1Q5I A;  1F88 A;  3PBL A;  2Y04 A;  4MBS A;  4FPD A;  4GPO A;  3DQB A;  3NS0 A;  3COC A;  4UHR A;  1GZM A;  3OE6 A;  2YCW A;  5FJG A;  5LWE A;  4WAV A;  4BEZ A;  5H2K A;  5B6X A;  1DZE A;  1MGY A;  1JV6 A;  2YDO A;  4XTL A;  4MQT A;  1KME A;  1L0M A;  3AYM A;  3UTV A;  4XTO A;  1JGJ A;  2R4S A;  5H2N A;  1S53 A;  4HWL A;  4FAA B;  3UZA A;  1U19 A;  3RZE A;  2KSA A;  2I20 A;  1O0A A;  4N6H A;  5JJE A;  1PXR A;  2I21 A;  3AM6 A;  3QBL A;  2LNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...