3VG9A

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 2.7 a resolution
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
297
Chain Sequence
SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Adenosine receptor A2a
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 297
sequence length 304
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3vg9A00
4A4MA 1H68A 4GYCA 4XTNA 3MBVA 3QJRB 3VGAA 4BWBA 1PXSA 5B2NA 2Y04A 1QKOA 4G71B 2M3GA 1EHKB 4JKVA 3ZPQA 2EI4A 3SN6R 4GPOA 1BM1A 2NTUA 1C3WA 1JV6A 4GRVA 4HWLA 5JJNA 3PQRA 4MD2A 3PXOA 1P8UA 3X3BA 5A45A 5B6ZA 4IB4A 3UG9A 4MQTA 4UHRA 5JJEA 5H2HA 2QPEB 1VJMA 3QAKA 4X32A 5AHYA 3QJQB 4G72B 5B35A 1R2NA 5AX1A 3UONA 4TL3A 4DAJA 1O0AA 4XXJA 5C1MA 5DYSA 1E12A 4MBSA 1Q5JA 5FJGA 3D4SA 4QIDA 4JR8A 1IW9A 4PXFA 1E0PA 4BV0A 3QJUB 3AM6A 5J7AA 1PY6A 4N6HA 5B34A 2J4YA 2YCXA 1JGJA 3S8GB 5B6WA 1F50A 5JJJA 2LNLA 1M0KA 5B6XA 4FBZA 1Q5IA 4XTLA 3UZAA 1X0K1 4UG2A 3HAPA 1FBKA 5H2PA 5G2AA 1QKPA 4MD1A 3NSBA 1KMEA 3RFMA 1TN0A 5EN0A 1C8SA 3KJ6A 4N4YB 3NY9A 4L35A 3VI0A 4EJ4A 4HYXA 3ODUA 3ABWA 3AYMA 1M0MA 2Z55A 3PBLA 1KG9A 1S53A 3QBKA 3ZEVA 3UTXA 1QM8A 1FBBA 3CODA 3VHZA 3COCA 3T45A 4BEYA 2F93A 2Y03A 1JV7A 4G7RB 5AX0A 1R84A 2Y00A 3QDCA 3S8FB 2I1XA 5ETZA 4IAQA 4K5YA 2L6XA 1X0SA 5H2KA 1AP9A 3P0GA 3QJVB 3QJSB 5BR2A 2YDOA 4N4WA 1S54A 1M0LA 2I20A 2YCWA 5AWZA 2RH1A 1P8IA 4GP4B 4DJHA 1PXRA 3NS0A 5ITEA 4OV0A 3WQJA 3X3CA 2I35A 5KKHA 5DHGA 1L0MA 1S51A 4AMJA 1XIOA 1UAZA 3ZPRA 4X1HA 2YCZA 2PEDA 5G53A 4BUOA 2R4RA 3EH5B 2NTWA 3HAQA 3REYA 3HARA 5G54A 3QAPA 3OE0A 2ZIYA 1S8JA 4X31A 4FAAB 3QBIA 1P8HA 1S52A 3NY8A 1VGOA 4FPDA 1KG8A 5B0WA 5B6YA 2YCYA 2WJKA 3DDLA 3OE6A 4QI1A 4GBRA 2VT4A 3OAXA 1GU8A 1TN5A 2JAGA 2KSAA 3AYNA 4FA7B 2YDVA 1X0I1 5G2CA 2WJLA 4IARA 1LN6A 4G7QB 1CWQA 5A8EA 3VVKA 4EIYA 4NC3A 5G36A 3S3DB 3VW7A 3HAOA 3S3CB 4LDLA 1C8RA 4LDOA 2QPDB 2Y02A 4G7SB 3DQBA 3OE8A 3S3BB 4AMIA 3HANA 2I21A 5TGZA 3BVDB 2ZFEA 5DHHA 4MQSA 5H2JA 3QJTB 1QHJA 3PWHA 1XMEB 5F8UA 5H2IA 1BRRA 4QRYA 2G87A 2ZZLA 5AZDA 3RZEA 5BR5A 3V2YA 3HASA 4KLYA 5AHZA 3EMLA 3NYAA 3UTVA 4XT3A 1AT9A 3QBLA 3QBGA 3UTYA 2HPYA 4BEZA 5H2NA 3EH4B 1DZEA 5G28A 2X72A 3OE9A 1H2SA 4XTOA 1HZXA 3C9MA 1F4ZA 4GP5B 5B6VA 2BRDA 4JQ6A 5ITCA 2KSBA 3EH3B 5LWEA 4EA3A 1S8LA 2F95A 4KNFA 4GP8B 4PXKA 5G2DA 4XT1A 4J4QA 1IW6A 4DKLA 1GUEA 1KGBA 3A7KA 2AT9A 4Y9HA 4BVNA 3VG9A 2Z73A 2KS9A 1MGYA 3CAPA 1BRXA 4HYJA 5H2MA 4LDEA 4G70B 2JAFA 1GZMA 1L9HA 3PDSA 3UTWA 1JFPA 2Y01A 5A44A 5H2OA 1UCQA 4L6RA 3V2WA 4WAVA 1IXFA 3UZCA 1BRDA 1U19A 4WW3A 2KSYA 1F88A 3C9LA 1XJIA 2R4SA 5H2LA
chains in the Genus database with same CATH superfamily
4A4MA 1H68A 4GYCA 4XTNA 3MBVA 3QJRB 3VGAA 4BWBA 1PXSA 5B2NA 2Y04A 1QKOA 4G71B 2M3GA 1EHKB 4JKVA 3ZPQA 2EI4A 3SN6R 4GPOA 1BM1A 2NTUA 1C3WA 1JV6A 4GRVA 4HWLA 5JJNA 3PQRA 4MD2A 3PXOA 1P8UA 3X3BA 5A45A 5B6ZA 4IB4A 3UG9A 4MQTA 4UHRA 5JJEA 5H2HA 2QPEB 1VJMA 3QAKA 4X32A 5AHYA 3QJQB 4G72B 5B35A 1R2NA 5AX1A 3UONA 4TL3A 4DAJA 1O0AA 4XXJA 5C1MA 5DYSA 1E12A 4MBSA 1Q5JA 5FJGA 3D4SA 4QIDA 4JR8A 1IW9A 4PXFA 1E0PA 4BV0A 3QJUB 3AM6A 5J7AA 1PY6A 4N6HA 5B34A 2J4YA 2YCXA 1JGJA 3S8GB 5B6WA 1F50A 5JJJA 2LNLA 1M0KA 5B6XA 4FBZA 1Q5IA 4XTLA 3UZAA 1X0K1 4UG2A 3HAPA 1FBKA 5H2PA 5G2AA 1QKPA 4MD1A 3NSBA 1KMEA 3RFMA 1TN0A 5EN0A 1C8SA 3KJ6A 4N4YB 3NY9A 4L35A 3VI0A 4EJ4A 4HYXA 3ODUA 3ABWA 3AYMA 1M0MA 2Z55A 3PBLA 1KG9A 1S53A 3QBKA 3ZEVA 3UTXA 1QM8A 1FBBA 3CODA 3VHZA 3COCA 3T45A 4BEYA 2F93A 2Y03A 1JV7A 4G7RB 5AX0A 1R84A 2Y00A 3QDCA 3S8FB 2I1XA 5ETZA 4IAQA 4K5YA 2L6XA 1X0SA 5H2KA 1AP9A 3P0GA 3QJVB 3QJSB 5BR2A 2YDOA 4N4WA 1S54A 1M0LA 2I20A 2YCWA 5AWZA 2RH1A 1P8IA 4GP4B 4DJHA 1PXRA 3NS0A 5ITEA 4DS7E 4OV0A 3WQJA 3X3CA 2I35A 5KKHA 5DHGA 1L0MA 1S51A 4AMJA 1XIOA 1UAZA 3ZPRA 4X1HA 2YCZA 2PEDA 5G53A 4BUOA 2R4RA 3EH5B 2NTWA 3HAQA 3REYA 3HARA 5G54A 3QAPA 3OE0A 2ZIYA 1S8JA 4X31A 4FAAB 3QBIA 1P8HA 1S52A 3NY8A 1VGOA 4FPDA 1KG8A 5B0WA 5B6YA 2YCYA 2WJKA 3DDLA 3OE6A 4QI1A 4GBRA 2VT4A 3OAXA 1GU8A 1TN5A 2JAGA 2KSAA 3AYNA 4FA7B 2YDVA 1X0I1 5G2CA 2WJLA 4IARA 1LN6A 4G7QB 1CWQA 5A8EA 3VVKA 4EIYA 4NC3A 5G36A 3S3DB 3VW7A 3HAOA 3S3CB 4LDLA 1C8RA 4LDOA 2QPDB 2Y02A 4G7SB 3DQBA 3OE8A 3S3BB 4AMIA 3HANA 2I21A 5TGZA 3BVDB 2ZFEA 5DHHA 4MQSA 5H2JA 3QJTB 1QHJA 3PWHA 1XMEB 5F8UA 5H2IA 1BRRA 4QRYA 2G87A 2ZZLA 5AZDA 3RZEA 5BR5A 3V2YA 3HASA 4KLYA 5AHZA 3EMLA 3NYAA 3UTVA 4XT3A 1AT9A 3QBLA 3QBGA 3UTYA 2HPYA 4BEZA 5H2NA 3EH4B 1DZEA 5G28A 2X72A 3OE9A 1H2SA 4XTOA 1HZXA 3C9MA 1F4ZA 4GP5B 5B6VA 2BRDA 4JQ6A 5ITCA 2KSBA 3EH3B 5LWEA 4EA3A 1S8LA 2F95A 4KNFA 4GP8B 4PXKA 5G2DA 4XT1A 4J4QA 1IW6A 4DKLA 1GUEA 1KGBA 3A7KA 2AT9A 4Y9HA 4BVNA 3VG9A 2Z73A 2KS9A 1MGYA 3CAPA 1BRXA 4HYJA 5H2MA 4LDEA 4G70B 2JAFA 1GZMA 1L9HA 3PDSA 3UTWA 1JFPA 2Y01A 5A44A 5H2OA 1UCQA 4L6RA 3V2WA 4WAVA 1IXFA 3UZCA 1BRDA 1U19A 4WW3A 2KSYA 1F88A 3C9LA 1XJIA 2R4SA 5H2LA
chains in the Genus database with same CATH topology
4A4MA 1H68A 4GYCA 4XTNA 3MBVA 3QJRB 3VGAA 4BWBA 1PXSA 5B2NA 2Y04A 1QKOA 4G71B 2M3GA 1EHKB 4JKVA 3ZPQA 2EI4A 3SN6R 4GPOA 1BM1A 2NTUA 1C3WA 1JV6A 4GRVA 4HWLA 5JJNA 3PQRA 4MD2A 3PXOA 1P8UA 3X3BA 5A45A 5B6ZA 4IB4A 3UG9A 4MQTA 4UHRA 5JJEA 5H2HA 2QPEB 1VJMA 3QAKA 4X32A 5AHYA 3QJQB 4G72B 5B35A 1R2NA 5AX1A 3UONA 4TL3A 4DAJA 1O0AA 4XXJA 5C1MA 5DYSA 1E12A 4MBSA 1Q5JA 5FJGA 3D4SA 4QIDA 4JR8A 1IW9A 4PXFA 1E0PA 4BV0A 3QJUB 3AM6A 5J7AA 1PY6A 4N6HA 5B34A 2J4YA 2YCXA 1JGJA 3S8GB 5B6WA 1F50A 5JJJA 2LNLA 1M0KA 5B6XA 4FBZA 1Q5IA 4XTLA 3UZAA 1X0K1 4UG2A 3HAPA 1FBKA 5H2PA 5G2AA 1QKPA 4MD1A 3NSBA 1KMEA 3RFMA 1TN0A 5EN0A 1C8SA 3KJ6A 4N4YB 3NY9A 4L35A 3VI0A 4EJ4A 4HYXA 3ODUA 3ABWA 3AYMA 1M0MA 2Z55A 3PBLA 1KG9A 1S53A 3QBKA 3ZEVA 3UTXA 1QM8A 1FBBA 3CODA 3VHZA 3COCA 3T45A 4BEYA 2F93A 2Y03A 1JV7A 4G7RB 5AX0A 1R84A 2Y00A 3QDCA 3S8FB 2I1XA 5ETZA 4IAQA 4K5YA 2L6XA 1X0SA 5H2KA 1AP9A 3P0GA 3QJVB 3QJSB 5BR2A 2YDOA 4N4WA 1S54A 1M0LA 2I20A 2YCWA 5AWZA 2RH1A 1P8IA 4GP4B 4DJHA 1PXRA 3NS0A 5ITEA 4DS7E 4OV0A 3WQJA 3X3CA 2I35A 5KKHA 5DHGA 1L0MA 1S51A 4AMJA 1XIOA 1UAZA 3ZPRA 4X1HA 2YCZA 2PEDA 5G53A 4BUOA 2R4RA 3EH5B 2NTWA 3HAQA 3REYA 3HARA 5G54A 3QAPA 3OE0A 2ZIYA 1S8JA 4X31A 4FAAB 3QBIA 1P8HA 1S52A 3NY8A 1VGOA 4FPDA 1KG8A 5B0WA 5B6YA 2YCYA 2WJKA 3DDLA 3OE6A 4QI1A 4GBRA 2VT4A 3OAXA 1GU8A 1TN5A 2JAGA 2KSAA 3AYNA 4FA7B 2YDVA 1X0I1 5G2CA 2WJLA 4IARA 1LN6A 4G7QB 1CWQA 5A8EA 3VVKA 4EIYA 4NC3A 5G36A 3S3DB 3VW7A 3HAOA 3S3CB 4LDLA 1C8RA 4LDOA 2QPDB 2Y02A 4G7SB 3DQBA 3OE8A 3S3BB 4AMIA 3HANA 2I21A 5TGZA 3BVDB 2ZFEA 5DHHA 4MQSA 5H2JA 3QJTB 1QHJA 3PWHA 1XMEB 5F8UA 5H2IA 1BRRA 4QRYA 2G87A 2ZZLA 5AZDA 3RZEA 5BR5A 3V2YA 3HASA 4KLYA 5AHZA 3EMLA 3NYAA 3UTVA 4XT3A 1AT9A 3QBLA 3QBGA 3UTYA 2HPYA 4BEZA 5H2NA 3EH4B 1DZEA 5G28A 2X72A 3OE9A 1H2SA 4XTOA 1HZXA 3C9MA 1F4ZA 4GP5B 5B6VA 2BRDA 4JQ6A 5ITCA 2KSBA 3EH3B 5LWEA 4EA3A 1S8LA 2F95A 4KNFA 4GP8B 4PXKA 5G2DA 4XT1A 4J4QA 1IW6A 4DKLA 1GUEA 1KGBA 3A7KA 2AT9A 4Y9HA 4BVNA 3VG9A 2Z73A 2KS9A 1MGYA 3CAPA 1BRXA 4HYJA 5H2MA 4LDEA 4G70B 2JAFA 1GZMA 1L9HA 3PDSA 3UTWA 1JFPA 2Y01A 5A44A 5H2OA 1UCQA 4L6RA 3V2WA 4WAVA 1IXFA 3UZCA 1BRDA 1U19A 4WW3A 2KSYA 1F88A 3C9LA 1XJIA 2R4SA 5H2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4M A;  1H68 A;  4GYC A;  4XTN A;  3MBV A;  3QJR B;  3VGA A;  4BWB A;  1PXS A;  5B2N A;  2Y04 A;  1QKO A;  4G71 B;  2M3G A;  1EHK B;  4JKV A;  3ZPQ A;  2EI4 A;  3SN6 R;  4GPO A;  1BM1 A;  2NTU A;  1C3W A;  1JV6 A;  4GRV A;  4HWL A;  5JJN A;  3PQR A;  4MD2 A;  3PXO A;  1P8U A;  3X3B A;  5A45 A;  5B6Z A;  4IB4 A;  3UG9 A;  4MQT A;  4UHR A;  5JJE A;  5H2H A;  2QPE B;  1VJM A;  3QAK A;  4X32 A;  5AHY A;  3QJQ B;  4G72 B;  5B35 A;  1R2N A;  5AX1 A;  3UON A;  4TL3 A;  4DAJ A;  1O0A A;  4XXJ A;  5C1M A;  5DYS A;  1E12 A;  4MBS A;  1Q5J A;  5FJG A;  3D4S A;  4QID A;  4JR8 A;  1IW9 A;  4PXF A;  1E0P A;  4BV0 A;  3QJU B;  3AM6 A;  5J7A A;  1PY6 A;  4N6H A;  5B34 A;  2J4Y A;  2YCX A;  1JGJ A;  3S8G B;  5B6W A;  1F50 A;  5JJJ A;  2LNL A;  1M0K A;  5B6X A;  4FBZ A;  1Q5I A;  4XTL A;  3UZA A;  1X0K 1;  4UG2 A;  3HAP A;  1FBK A;  5H2P A;  5G2A A;  1QKP A;  4MD1 A;  3NSB A;  1KME A;  3RFM A;  1TN0 A;  5EN0 A;  1C8S A;  3KJ6 A;  4N4Y B;  3NY9 A;  4L35 A;  3VI0 A;  4EJ4 A;  4HYX A;  3ODU A;  3ABW A;  3AYM A;  1M0M A;  2Z55 A;  3PBL A;  1KG9 A;  1S53 A;  3QBK A;  3ZEV A;  3UTX A;  1QM8 A;  1FBB A;  3COD A;  3VHZ A;  3COC A;  3T45 A;  4BEY A;  2F93 A;  2Y03 A;  1JV7 A;  4G7R B;  5AX0 A;  1R84 A;  2Y00 A;  3QDC A;  3S8F B;  2I1X A;  5ETZ A;  4IAQ A;  4K5Y A;  2L6X A;  1X0S A;  5H2K A;  1AP9 A;  3P0G A;  3QJV B;  3QJS B;  5BR2 A;  2YDO A;  4N4W A;  1S54 A;  1M0L A;  2I20 A;  2YCW A;  5AWZ A;  2RH1 A;  1P8I A;  4GP4 B;  4DJH A;  1PXR A;  3NS0 A;  5ITE A;  4OV0 A;  3WQJ A;  3X3C A;  2I35 A;  5KKH A;  5DHG A;  1L0M A;  1S51 A;  4AMJ A;  1XIO A;  1UAZ A;  3ZPR A;  4X1H A;  2YCZ A;  2PED A;  5G53 A;  4BUO A;  2R4R A;  3EH5 B;  2NTW A;  3HAQ A;  3REY A;  3HAR A;  5G54 A;  3QAP A;  3OE0 A;  2ZIY A;  1S8J A;  4X31 A;  4FAA B;  3QBI A;  1P8H A;  1S52 A;  3NY8 A;  1VGO A;  4FPD A;  1KG8 A;  5B0W A;  5B6Y A;  2YCY A;  2WJK A;  3DDL A;  3OE6 A;  4QI1 A;  4GBR A;  2VT4 A;  3OAX A;  1GU8 A;  1TN5 A;  2JAG A;  2KSA A;  3AYN A;  4FA7 B;  2YDV A;  1X0I 1;  5G2C A;  2WJL A;  4IAR A;  1LN6 A;  4G7Q B;  1CWQ A;  5A8E A;  3VVK A;  4EIY A;  4NC3 A;  5G36 A;  3S3D B;  3VW7 A;  3HAO A;  3S3C B;  4LDL A;  1C8R A;  4LDO A;  2QPD B;  2Y02 A;  4G7S B;  3DQB A;  3OE8 A;  3S3B B;  4AMI A;  3HAN A;  2I21 A;  5TGZ A;  3BVD B;  2ZFE A;  5DHH A;  4MQS A;  5H2J A;  3QJT B;  1QHJ A;  3PWH A;  1XME B;  5F8U A;  5H2I A;  1BRR A;  4QRY A;  2G87 A;  2ZZL A;  5AZD A;  3RZE A;  5BR5 A;  3V2Y A;  3HAS A;  4KLY A;  5AHZ A;  3EML A;  3NYA A;  3UTV A;  4XT3 A;  1AT9 A;  3QBL A;  3QBG A;  3UTY A;  2HPY A;  4BEZ A;  5H2N A;  3EH4 B;  1DZE A;  5G28 A;  2X72 A;  3OE9 A;  1H2S A;  4XTO A;  1HZX A;  3C9M A;  1F4Z A;  4GP5 B;  5B6V A;  2BRD A;  4JQ6 A;  5ITC A;  2KSB A;  3EH3 B;  5LWE A;  4EA3 A;  1S8L A;  2F95 A;  4KNF A;  4GP8 B;  4PXK A;  5G2D A;  4XT1 A;  4J4Q A;  1IW6 A;  4DKL A;  1GUE A;  1KGB A;  3A7K A;  2AT9 A;  4Y9H A;  4BVN A;  3VG9 A;  2Z73 A;  2KS9 A;  1MGY A;  3CAP A;  1BRX A;  4HYJ A;  5H2M A;  4LDE A;  4G70 B;  2JAF A;  1GZM A;  1L9H A;  3PDS A;  3UTW A;  1JFP A;  2Y01 A;  5A44 A;  5H2O A;  1UCQ A;  4L6R A;  3V2W A;  4WAV A;  1IXF A;  3UZC A;  1BRD A;  1U19 A;  4WW3 A;  2KSY A;  1F88 A;  3C9L A;  1XJI A;  2R4S A;  5H2L A; 
#chains in the Genus database with same CATH topology
 4A4M A;  1H68 A;  4GYC A;  4XTN A;  3MBV A;  3QJR B;  3VGA A;  4BWB A;  1PXS A;  5B2N A;  2Y04 A;  1QKO A;  4G71 B;  2M3G A;  1EHK B;  4JKV A;  3ZPQ A;  2EI4 A;  3SN6 R;  4GPO A;  1BM1 A;  2NTU A;  1C3W A;  1JV6 A;  4GRV A;  4HWL A;  5JJN A;  3PQR A;  4MD2 A;  3PXO A;  1P8U A;  3X3B A;  5A45 A;  5B6Z A;  4IB4 A;  3UG9 A;  4MQT A;  4UHR A;  5JJE A;  5H2H A;  2QPE B;  1VJM A;  3QAK A;  4X32 A;  5AHY A;  3QJQ B;  4G72 B;  5B35 A;  1R2N A;  5AX1 A;  3UON A;  4TL3 A;  4DAJ A;  1O0A A;  4XXJ A;  5C1M A;  5DYS A;  1E12 A;  4MBS A;  1Q5J A;  5FJG A;  3D4S A;  4QID A;  4JR8 A;  1IW9 A;  4PXF A;  1E0P A;  4BV0 A;  3QJU B;  3AM6 A;  5J7A A;  1PY6 A;  4N6H A;  5B34 A;  2J4Y A;  2YCX A;  1JGJ A;  3S8G B;  5B6W A;  1F50 A;  5JJJ A;  2LNL A;  1M0K A;  5B6X A;  4FBZ A;  1Q5I A;  4XTL A;  3UZA A;  1X0K 1;  4UG2 A;  3HAP A;  1FBK A;  5H2P A;  5G2A A;  1QKP A;  4MD1 A;  3NSB A;  1KME A;  3RFM A;  1TN0 A;  5EN0 A;  1C8S A;  3KJ6 A;  4N4Y B;  3NY9 A;  4L35 A;  3VI0 A;  4EJ4 A;  4HYX A;  3ODU A;  3ABW A;  3AYM A;  1M0M A;  2Z55 A;  3PBL A;  1KG9 A;  1S53 A;  3QBK A;  3ZEV A;  3UTX A;  1QM8 A;  1FBB A;  3COD A;  3VHZ A;  3COC A;  3T45 A;  4BEY A;  2F93 A;  2Y03 A;  1JV7 A;  4G7R B;  5AX0 A;  1R84 A;  2Y00 A;  3QDC A;  3S8F B;  2I1X A;  5ETZ A;  4IAQ A;  4K5Y A;  2L6X A;  1X0S A;  5H2K A;  1AP9 A;  3P0G A;  3QJV B;  3QJS B;  5BR2 A;  2YDO A;  4N4W A;  1S54 A;  1M0L A;  2I20 A;  2YCW A;  5AWZ A;  2RH1 A;  1P8I A;  4GP4 B;  4DJH A;  1PXR A;  3NS0 A;  5ITE A;  4DS7 E;  4OV0 A;  3WQJ A;  3X3C A;  2I35 A;  5KKH A;  5DHG A;  1L0M A;  1S51 A;  4AMJ A;  1XIO A;  1UAZ A;  3ZPR A;  4X1H A;  2YCZ A;  2PED A;  5G53 A;  4BUO A;  2R4R A;  3EH5 B;  2NTW A;  3HAQ A;  3REY A;  3HAR A;  5G54 A;  3QAP A;  3OE0 A;  2ZIY A;  1S8J A;  4X31 A;  4FAA B;  3QBI A;  1P8H A;  1S52 A;  3NY8 A;  1VGO A;  4FPD A;  1KG8 A;  5B0W A;  5B6Y A;  2YCY A;  2WJK A;  3DDL A;  3OE6 A;  4QI1 A;  4GBR A;  2VT4 A;  3OAX A;  1GU8 A;  1TN5 A;  2JAG A;  2KSA A;  3AYN A;  4FA7 B;  2YDV A;  1X0I 1;  5G2C A;  2WJL A;  4IAR A;  1LN6 A;  4G7Q B;  1CWQ A;  5A8E A;  3VVK A;  4EIY A;  4NC3 A;  5G36 A;  3S3D B;  3VW7 A;  3HAO A;  3S3C B;  4LDL A;  1C8R A;  4LDO A;  2QPD B;  2Y02 A;  4G7S B;  3DQB A;  3OE8 A;  3S3B B;  4AMI A;  3HAN A;  2I21 A;  5TGZ A;  3BVD B;  2ZFE A;  5DHH A;  4MQS A;  5H2J A;  3QJT B;  1QHJ A;  3PWH A;  1XME B;  5F8U A;  5H2I A;  1BRR A;  4QRY A;  2G87 A;  2ZZL A;  5AZD A;  3RZE A;  5BR5 A;  3V2Y A;  3HAS A;  4KLY A;  5AHZ A;  3EML A;  3NYA A;  3UTV A;  4XT3 A;  1AT9 A;  3QBL A;  3QBG A;  3UTY A;  2HPY A;  4BEZ A;  5H2N A;  3EH4 B;  1DZE A;  5G28 A;  2X72 A;  3OE9 A;  1H2S A;  4XTO A;  1HZX A;  3C9M A;  1F4Z A;  4GP5 B;  5B6V A;  2BRD A;  4JQ6 A;  5ITC A;  2KSB A;  3EH3 B;  5LWE A;  4EA3 A;  1S8L A;  2F95 A;  4KNF A;  4GP8 B;  4PXK A;  5G2D A;  4XT1 A;  4J4Q A;  1IW6 A;  4DKL A;  1GUE A;  1KGB A;  3A7K A;  2AT9 A;  4Y9H A;  4BVN A;  3VG9 A;  2Z73 A;  2KS9 A;  1MGY A;  3CAP A;  1BRX A;  4HYJ A;  5H2M A;  4LDE A;  4G70 B;  2JAF A;  1GZM A;  1L9H A;  3PDS A;  3UTW A;  1JFP A;  2Y01 A;  5A44 A;  5H2O A;  1UCQ A;  4L6R A;  3V2W A;  4WAV A;  1IXF A;  3UZC A;  1BRD A;  1U19 A;  4WW3 A;  2KSY A;  1F88 A;  3C9L A;  1XJI A;  2R4S A;  5H2L A; 
#chains in the Genus database with same CATH homology
 4A4M A;  1H68 A;  4GYC A;  4XTN A;  3MBV A;  3QJR B;  3VGA A;  4BWB A;  1PXS A;  5B2N A;  2Y04 A;  1QKO A;  4G71 B;  2M3G A;  1EHK B;  4JKV A;  3ZPQ A;  2EI4 A;  3SN6 R;  4GPO A;  1BM1 A;  2NTU A;  1C3W A;  1JV6 A;  4GRV A;  4HWL A;  5JJN A;  3PQR A;  4MD2 A;  3PXO A;  1P8U A;  3X3B A;  5A45 A;  5B6Z A;  4IB4 A;  3UG9 A;  4MQT A;  4UHR A;  5JJE A;  5H2H A;  2QPE B;  1VJM A;  3QAK A;  4X32 A;  5AHY A;  3QJQ B;  4G72 B;  5B35 A;  1R2N A;  5AX1 A;  3UON A;  4TL3 A;  4DAJ A;  1O0A A;  4XXJ A;  5C1M A;  5DYS A;  1E12 A;  4MBS A;  1Q5J A;  5FJG A;  3D4S A;  4QID A;  4JR8 A;  1IW9 A;  4PXF A;  1E0P A;  4BV0 A;  3QJU B;  3AM6 A;  5J7A A;  1PY6 A;  4N6H A;  5B34 A;  2J4Y A;  2YCX A;  1JGJ A;  3S8G B;  5B6W A;  1F50 A;  5JJJ A;  2LNL A;  1M0K A;  5B6X A;  4FBZ A;  1Q5I A;  4XTL A;  3UZA A;  1X0K 1;  4UG2 A;  3HAP A;  1FBK A;  5H2P A;  5G2A A;  1QKP A;  4MD1 A;  3NSB A;  1KME A;  3RFM A;  1TN0 A;  5EN0 A;  1C8S A;  3KJ6 A;  4N4Y B;  3NY9 A;  4L35 A;  3VI0 A;  4EJ4 A;  4HYX A;  3ODU A;  3ABW A;  3AYM A;  1M0M A;  2Z55 A;  3PBL A;  1KG9 A;  1S53 A;  3QBK A;  3ZEV A;  3UTX A;  1QM8 A;  1FBB A;  3COD A;  3VHZ A;  3COC A;  3T45 A;  4BEY A;  2F93 A;  2Y03 A;  1JV7 A;  4G7R B;  5AX0 A;  1R84 A;  2Y00 A;  3QDC A;  3S8F B;  2I1X A;  5ETZ A;  4IAQ A;  4K5Y A;  2L6X A;  1X0S A;  5H2K A;  1AP9 A;  3P0G A;  3QJV B;  3QJS B;  5BR2 A;  2YDO A;  4N4W A;  1S54 A;  1M0L A;  2I20 A;  2YCW A;  5AWZ A;  2RH1 A;  1P8I A;  4GP4 B;  4DJH A;  1PXR A;  3NS0 A;  5ITE A;  4DS7 E;  4OV0 A;  3WQJ A;  3X3C A;  2I35 A;  5KKH A;  5DHG A;  1L0M A;  1S51 A;  4AMJ A;  1XIO A;  1UAZ A;  3ZPR A;  4X1H A;  2YCZ A;  2PED A;  5G53 A;  4BUO A;  2R4R A;  3EH5 B;  2NTW A;  3HAQ A;  3REY A;  3HAR A;  5G54 A;  3QAP A;  3OE0 A;  2ZIY A;  1S8J A;  4X31 A;  4FAA B;  3QBI A;  1P8H A;  1S52 A;  3NY8 A;  1VGO A;  4FPD A;  1KG8 A;  5B0W A;  5B6Y A;  2YCY A;  2WJK A;  3DDL A;  3OE6 A;  4QI1 A;  4GBR A;  2VT4 A;  3OAX A;  1GU8 A;  1TN5 A;  2JAG A;  2KSA A;  3AYN A;  4FA7 B;  2YDV A;  1X0I 1;  5G2C A;  2WJL A;  4IAR A;  1LN6 A;  4G7Q B;  1CWQ A;  5A8E A;  3VVK A;  4EIY A;  4NC3 A;  5G36 A;  3S3D B;  3VW7 A;  3HAO A;  3S3C B;  4LDL A;  1C8R A;  4LDO A;  2QPD B;  2Y02 A;  4G7S B;  3DQB A;  3OE8 A;  3S3B B;  4AMI A;  3HAN A;  2I21 A;  5TGZ A;  3BVD B;  2ZFE A;  5DHH A;  4MQS A;  5H2J A;  3QJT B;  1QHJ A;  3PWH A;  1XME B;  5F8U A;  5H2I A;  1BRR A;  4QRY A;  2G87 A;  2ZZL A;  5AZD A;  3RZE A;  5BR5 A;  3V2Y A;  3HAS A;  4KLY A;  5AHZ A;  3EML A;  3NYA A;  3UTV A;  4XT3 A;  1AT9 A;  3QBL A;  3QBG A;  3UTY A;  2HPY A;  4BEZ A;  5H2N A;  3EH4 B;  1DZE A;  5G28 A;  2X72 A;  3OE9 A;  1H2S A;  4XTO A;  1HZX A;  3C9M A;  1F4Z A;  4GP5 B;  5B6V A;  2BRD A;  4JQ6 A;  5ITC A;  2KSB A;  3EH3 B;  5LWE A;  4EA3 A;  1S8L A;  2F95 A;  4KNF A;  4GP8 B;  4PXK A;  5G2D A;  4XT1 A;  4J4Q A;  1IW6 A;  4DKL A;  1GUE A;  1KGB A;  3A7K A;  2AT9 A;  4Y9H A;  4BVN A;  3VG9 A;  2Z73 A;  2KS9 A;  1MGY A;  3CAP A;  1BRX A;  4HYJ A;  5H2M A;  4LDE A;  4G70 B;  2JAF A;  1GZM A;  1L9H A;  3PDS A;  3UTW A;  1JFP A;  2Y01 A;  5A44 A;  5H2O A;  1UCQ A;  4L6R A;  3V2W A;  4WAV A;  1IXF A;  3UZC A;  1BRD A;  1U19 A;  4WW3 A;  2KSY A;  1F88 A;  3C9L A;  1XJI A;  2R4S A;  5H2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...