3VGAA

Crystal structure of human adenosine a2a receptor with an allosteric inverse-agonist antibody at 3.1 a resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
296
Chain Sequence
SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Adenosine receptor A2a
publication title G-protein-coupled receptor inactivation by an allosteric inverse-agonist antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 296
sequence length 303
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3vgaA00
1X0I1 1VJMA 2HPYA 2Y04A 4A4MA 2KSYA 4BVNA 1S52A 3CODA 1C8SA 4EJ4A 2KSAA 3PWHA 1M0MA 4UG2A 5ETZA 1O0AA 3EH5B 5H2OA 5A8EA 3BVDB 3VG9A 3QBLA 1H68A 1L9HA 2JAGA 1C8RA 3NY8A 1PY6A 2Y03A 2WJKA 3AYMA 3NY9A 4FA7B 4UHRA 3AYNA 5LWEA 4GP8B 3PXOA 5FJGA 5G28A 4QI1A 1AT9A 4TL3A 5H2MA 5B6XA 4NC3A 3EH3B 3OE8A 4X32A 2KS9A 3DQBA 1KG9A 5G54A 5H2PA 3OE6A 2R4SA 1R84A 4XTNA 1P8IA 1Q5IA 4WAVA 3VVKA 3RFMA 1JV6A 4XT1A 4G71B 3OAXA 3VW7A 4BEYA 1QKOA 4GP4B 1IW6A 2EI4A 4MD2A 3HAPA 3WQJA 1S54A 4AMJA 1PXSA 4LDEA 5AHZA 2I1XA 1LN6A 5AWZA 1R2NA 2YDVA 3UZAA 2YCWA 1XIOA 1S53A 4GP5B 1X0SA 1X0K1 1PXRA 5ITEA 4N6HA 4BEZA 3QBKA 3EH4B 2YDOA 4QIDA 3QDCA 4L35A 2KSBA 5ITCA 1GUEA 5G53A 3C9LA 4DJHA 1M0KA 2I20A 4GPOA 5H2HA 1BRRA 5B2NA 3PBLA 3QJSB 4IARA 5C1MA 4OV0A 3OE9A 4DKLA 2ZIYA 3ZPRA 3QJVB 3A7KA 3VI0A 3CAPA 1JGJA 4FPDA 3P0GA 2I35A 5AX1A 5DHGA 2ZFEA 4QRYA 3D4SA 1CWQA 3UTYA 3NS0A 4MBSA 1DZEA 5H2KA 4XT3A 3UONA 3SN6R 2AT9A 5B0WA 3UG9A 3C9MA 2F95A 4AMIA 3PDSA 2X72A 1JFPA 5B6YA 2PEDA 5J7AA 3UTWA 4EA3A 2VT4A 1UCQA 3VGAA 3V2YA 5H2IA 1M0LA 4IB4A 4G7QB 3UZCA 3ODUA 3HARA 5B6VA 2Z55A 5A44A 3REYA 4MD1A 4Y9HA 4K5YA 3HANA 3AM6A 3MBVA 1QHJA 5TGZA 1TN5A 3HAOA 1F4ZA 5F8UA 5G36A 1E12A 4DAJA 2YCZA 3V2WA 3S3DB 5A45A 5DHHA 1F88A 3HAQA 2L6XA 4MQSA 5H2LA 4BV0A 1H2SA 4X1HA 1GU8A 1AP9A 3NYAA 4XTLA 1EHKB 5B6WA 2Y02A 2QPDB 3PQRA 3QAKA 1P8HA 2BRDA 5DYSA 4IAQA 4BUOA 2WJLA 4JKVA 1FBKA 4GBRA 3QJRB 4G70B 4J4QA 4LDOA 4WW3A 4GYCA 5AHYA 3ZEVA 2Y01A 2J4YA 2JAFA 1BRXA 4XTOA 1KG8A 4HYXA 1S8LA 1TN0A 4JR8A 5G2AA 2YCXA 3QBGA 5H2JA 1U19A 3ZPQA 4GRVA 3ABWA 5BR2A 2F93A 3S8FB 4KNFA 4XXJA 3X3CA 4BWBA 1IW9A 1FBBA 1F50A 1S51A 3S3BB 3QJTB 1P8UA 3VHZA 5JJNA 1MGYA 2NTUA 2YCYA 3UTXA 1E0PA 5G2CA 2Z73A 1KMEA 2M3GA 2G87A 2Y00A 4MQTA 5AZDA 4EIYA 1KGBA 4HYJA 1Q5JA 1XJIA 4HWLA 1BRDA 3UTVA 1XMEB 3HASA 5H2NA 1L0MA 3NSBA 3T45A 4N4WA 3RZEA 4LDLA 4FBZA 4PXFA 5AX0A 3QJUB 1JV7A 2RH1A 5B34A 4KLYA 4FAAB 5G2DA 3QBIA 3QJQB 1QM8A 4JQ6A 4X31A 5B35A 1VGOA 3OE0A 1S8JA 5B6ZA 3X3BA 4N4YB 4G7RB 2QPEB 5JJJA 4G72B 2I21A 4L6RA 3QAPA 1IXFA 2NTWA 1C3WA 1GZMA 3KJ6A 2ZZLA 5JJEA 3DDLA 4G7SB 2R4RA 3EMLA 4PXKA 1QKPA 1UAZA 3S3CB 5BR5A 5KKHA 3COCA 5EN0A 1BM1A 1HZXA 2LNLA 3S8GB
chains in the Genus database with same CATH superfamily
1X0I1 1VJMA 2HPYA 2Y04A 4A4MA 2KSYA 4BVNA 1S52A 3CODA 1C8SA 4EJ4A 2KSAA 3PWHA 1M0MA 4UG2A 5ETZA 1O0AA 3EH5B 5H2OA 5A8EA 3BVDB 3VG9A 3QBLA 1H68A 1L9HA 2JAGA 1C8RA 3NY8A 1PY6A 2Y03A 2WJKA 3AYMA 3NY9A 4FA7B 4UHRA 3AYNA 5LWEA 4GP8B 3PXOA 5FJGA 5G28A 4QI1A 1AT9A 4TL3A 5H2MA 4DS7E 4NC3A 5B6XA 3EH3B 3OE8A 4X32A 2KS9A 3DQBA 1KG9A 5G54A 5H2PA 3OE6A 2R4SA 1R84A 4XTNA 1P8IA 1Q5IA 4WAVA 3VVKA 3RFMA 1JV6A 4XT1A 4G71B 3OAXA 3VW7A 4BEYA 1QKOA 4GP4B 1IW6A 2EI4A 4MD2A 3HAPA 3WQJA 1S54A 4AMJA 1PXSA 4LDEA 5AHZA 2I1XA 1LN6A 5AWZA 1R2NA 2YDVA 3UZAA 2YCWA 1XIOA 1S53A 4GP5B 1X0SA 1X0K1 1PXRA 5ITEA 4N6HA 4BEZA 3QBKA 3EH4B 2YDOA 4QIDA 3QDCA 4L35A 2KSBA 5ITCA 1GUEA 5G53A 3C9LA 4DJHA 1M0KA 2I20A 4GPOA 5H2HA 1BRRA 5B2NA 3PBLA 3QJSB 4IARA 5C1MA 4OV0A 3OE9A 4DKLA 2ZIYA 3ZPRA 3QJVB 3A7KA 3VI0A 3CAPA 1JGJA 4FPDA 3P0GA 2I35A 5AX1A 5DHGA 2ZFEA 4QRYA 3D4SA 1CWQA 3UTYA 3NS0A 4MBSA 1DZEA 5H2KA 4XT3A 3UONA 3SN6R 2AT9A 5B0WA 3UG9A 3C9MA 2F95A 4AMIA 3PDSA 2X72A 1JFPA 5B6YA 2PEDA 5J7AA 3UTWA 4EA3A 2VT4A 1UCQA 3VGAA 3V2YA 5H2IA 1M0LA 4IB4A 4G7QB 3UZCA 3ODUA 3HARA 5B6VA 2Z55A 5A44A 3REYA 4MD1A 4Y9HA 4K5YA 3HANA 3AM6A 3MBVA 1QHJA 5TGZA 1TN5A 3HAOA 1F4ZA 5F8UA 5G36A 1E12A 4DAJA 2YCZA 3V2WA 3S3DB 5A45A 5DHHA 1F88A 3HAQA 2L6XA 4MQSA 5H2LA 4BV0A 1H2SA 4X1HA 1GU8A 1AP9A 3NYAA 4XTLA 1EHKB 5B6WA 2Y02A 2QPDB 3PQRA 3QAKA 1P8HA 2BRDA 5DYSA 4IAQA 4BUOA 2WJLA 4JKVA 1FBKA 4GBRA 3QJRB 4G70B 4J4QA 4LDOA 4WW3A 4GYCA 5AHYA 3ZEVA 2Y01A 2J4YA 2JAFA 1BRXA 4XTOA 1KG8A 4HYXA 1S8LA 1TN0A 4JR8A 5G2AA 2YCXA 3QBGA 5H2JA 1U19A 3ZPQA 4GRVA 3ABWA 5BR2A 2F93A 3S8FB 4KNFA 4XXJA 3X3CA 4BWBA 1IW9A 1FBBA 1F50A 1S51A 3S3BB 3QJTB 1P8UA 3VHZA 5JJNA 1MGYA 2NTUA 2YCYA 3UTXA 1E0PA 5G2CA 2Z73A 1KMEA 2M3GA 2G87A 2Y00A 4MQTA 5AZDA 4EIYA 1KGBA 4HYJA 1Q5JA 1XJIA 4HWLA 1BRDA 3UTVA 1XMEB 3HASA 5H2NA 1L0MA 3NSBA 3T45A 4N4WA 3RZEA 4LDLA 4FBZA 4PXFA 5AX0A 3QJUB 1JV7A 2RH1A 5B34A 4KLYA 4FAAB 5G2DA 3QBIA 3QJQB 1QM8A 4JQ6A 4X31A 5B35A 1VGOA 3OE0A 1S8JA 5B6ZA 3X3BA 4N4YB 4G7RB 2QPEB 5JJJA 4G72B 2I21A 4L6RA 3QAPA 1IXFA 2NTWA 1C3WA 1GZMA 3KJ6A 2ZZLA 5JJEA 3DDLA 4G7SB 2R4RA 3EMLA 4PXKA 1QKPA 1UAZA 3S3CB 5BR5A 5KKHA 3COCA 5EN0A 1BM1A 1HZXA 2LNLA 3S8GB
chains in the Genus database with same CATH topology
1X0I1 1VJMA 2HPYA 2Y04A 4A4MA 2KSYA 4BVNA 1S52A 3CODA 1C8SA 4EJ4A 2KSAA 3PWHA 1M0MA 4UG2A 5ETZA 1O0AA 3EH5B 5H2OA 5A8EA 3BVDB 3VG9A 3QBLA 1H68A 1L9HA 2JAGA 1C8RA 3NY8A 1PY6A 2Y03A 2WJKA 3AYMA 3NY9A 4FA7B 4UHRA 3AYNA 5LWEA 4GP8B 3PXOA 5FJGA 5G28A 4QI1A 1AT9A 4TL3A 5H2MA 4DS7E 4NC3A 5B6XA 3EH3B 3OE8A 4X32A 2KS9A 3DQBA 1KG9A 5G54A 5H2PA 3OE6A 2R4SA 1R84A 4XTNA 1P8IA 1Q5IA 4WAVA 3VVKA 3RFMA 1JV6A 4XT1A 4G71B 3OAXA 3VW7A 4BEYA 1QKOA 4GP4B 1IW6A 2EI4A 4MD2A 3HAPA 3WQJA 1S54A 4AMJA 1PXSA 4LDEA 5AHZA 2I1XA 1LN6A 5AWZA 1R2NA 2YDVA 3UZAA 2YCWA 1XIOA 1S53A 4GP5B 1X0SA 1X0K1 1PXRA 5ITEA 4N6HA 4BEZA 3QBKA 3EH4B 2YDOA 4QIDA 3QDCA 4L35A 2KSBA 5ITCA 1GUEA 5G53A 3C9LA 4DJHA 1M0KA 2I20A 4GPOA 5H2HA 1BRRA 5B2NA 3PBLA 3QJSB 4IARA 5C1MA 4OV0A 3OE9A 4DKLA 2ZIYA 3ZPRA 3QJVB 3A7KA 3VI0A 3CAPA 1JGJA 4FPDA 3P0GA 2I35A 5AX1A 5DHGA 2ZFEA 4QRYA 3D4SA 1CWQA 3UTYA 3NS0A 4MBSA 1DZEA 5H2KA 4XT3A 3UONA 3SN6R 2AT9A 5B0WA 3UG9A 3C9MA 2F95A 4AMIA 3PDSA 2X72A 1JFPA 5B6YA 2PEDA 5J7AA 3UTWA 4EA3A 2VT4A 1UCQA 3VGAA 3V2YA 5H2IA 1M0LA 4IB4A 4G7QB 3UZCA 3ODUA 3HARA 5B6VA 2Z55A 5A44A 3REYA 4MD1A 4Y9HA 4K5YA 3HANA 3AM6A 3MBVA 1QHJA 5TGZA 1TN5A 3HAOA 1F4ZA 5F8UA 5G36A 1E12A 4DAJA 2YCZA 3V2WA 3S3DB 5A45A 5DHHA 1F88A 3HAQA 2L6XA 4MQSA 5H2LA 4BV0A 1H2SA 4X1HA 1GU8A 1AP9A 3NYAA 4XTLA 1EHKB 5B6WA 2Y02A 2QPDB 3PQRA 3QAKA 1P8HA 2BRDA 5DYSA 4IAQA 4BUOA 2WJLA 4JKVA 1FBKA 4GBRA 3QJRB 4G70B 4J4QA 4LDOA 4WW3A 4GYCA 5AHYA 3ZEVA 2Y01A 2J4YA 2JAFA 1BRXA 4XTOA 1KG8A 4HYXA 1S8LA 1TN0A 4JR8A 5G2AA 2YCXA 3QBGA 5H2JA 1U19A 3ZPQA 4GRVA 3ABWA 5BR2A 2F93A 3S8FB 4KNFA 4XXJA 3X3CA 4BWBA 1IW9A 1FBBA 1F50A 1S51A 3S3BB 3QJTB 1P8UA 3VHZA 5JJNA 1MGYA 2NTUA 2YCYA 3UTXA 1E0PA 5G2CA 2Z73A 1KMEA 2M3GA 2G87A 2Y00A 4MQTA 5AZDA 4EIYA 1KGBA 4HYJA 1Q5JA 1XJIA 4HWLA 1BRDA 3UTVA 1XMEB 3HASA 5H2NA 1L0MA 3NSBA 3T45A 4N4WA 3RZEA 4LDLA 4FBZA 4PXFA 5AX0A 3QJUB 1JV7A 2RH1A 5B34A 4KLYA 4FAAB 5G2DA 3QBIA 3QJQB 1QM8A 4JQ6A 4X31A 5B35A 1VGOA 3OE0A 1S8JA 5B6ZA 3X3BA 4N4YB 4G7RB 2QPEB 5JJJA 4G72B 2I21A 4L6RA 3QAPA 1IXFA 2NTWA 1C3WA 1GZMA 3KJ6A 2ZZLA 5JJEA 3DDLA 4G7SB 2R4RA 3EMLA 4PXKA 1QKPA 1UAZA 3S3CB 5BR5A 5KKHA 3COCA 5EN0A 1BM1A 1HZXA 2LNLA 3S8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0I 1;  1VJM A;  2HPY A;  2Y04 A;  4A4M A;  2KSY A;  4BVN A;  1S52 A;  3COD A;  1C8S A;  4EJ4 A;  2KSA A;  3PWH A;  1M0M A;  4UG2 A;  5ETZ A;  1O0A A;  3EH5 B;  5H2O A;  5A8E A;  3BVD B;  3VG9 A;  3QBL A;  1H68 A;  1L9H A;  2JAG A;  1C8R A;  3NY8 A;  1PY6 A;  2Y03 A;  2WJK A;  3AYM A;  3NY9 A;  4FA7 B;  4UHR A;  3AYN A;  5LWE A;  4GP8 B;  3PXO A;  5FJG A;  5G28 A;  4QI1 A;  1AT9 A;  4TL3 A;  5H2M A;  5B6X A;  4NC3 A;  3EH3 B;  3OE8 A;  4X32 A;  2KS9 A;  3DQB A;  1KG9 A;  5G54 A;  5H2P A;  3OE6 A;  2R4S A;  1R84 A;  4XTN A;  1P8I A;  1Q5I A;  4WAV A;  3VVK A;  3RFM A;  1JV6 A;  4XT1 A;  4G71 B;  3OAX A;  3VW7 A;  4BEY A;  1QKO A;  4GP4 B;  1IW6 A;  2EI4 A;  4MD2 A;  3HAP A;  3WQJ A;  1S54 A;  4AMJ A;  1PXS A;  4LDE A;  5AHZ A;  2I1X A;  1LN6 A;  5AWZ A;  1R2N A;  2YDV A;  3UZA A;  2YCW A;  1XIO A;  1S53 A;  4GP5 B;  1X0S A;  1X0K 1;  1PXR A;  5ITE A;  4N6H A;  4BEZ A;  3QBK A;  3EH4 B;  2YDO A;  4QID A;  3QDC A;  4L35 A;  2KSB A;  5ITC A;  1GUE A;  5G53 A;  3C9L A;  4DJH A;  1M0K A;  2I20 A;  4GPO A;  5H2H A;  1BRR A;  5B2N A;  3PBL A;  3QJS B;  4IAR A;  5C1M A;  4OV0 A;  3OE9 A;  4DKL A;  2ZIY A;  3ZPR A;  3QJV B;  3A7K A;  3VI0 A;  3CAP A;  1JGJ A;  4FPD A;  3P0G A;  2I35 A;  5AX1 A;  5DHG A;  2ZFE A;  4QRY A;  3D4S A;  1CWQ A;  3UTY A;  3NS0 A;  4MBS A;  1DZE A;  5H2K A;  4XT3 A;  3UON A;  3SN6 R;  2AT9 A;  5B0W A;  3UG9 A;  3C9M A;  2F95 A;  4AMI A;  3PDS A;  2X72 A;  1JFP A;  5B6Y A;  2PED A;  5J7A A;  3UTW A;  4EA3 A;  2VT4 A;  1UCQ A;  3VGA A;  3V2Y A;  5H2I A;  1M0L A;  4IB4 A;  4G7Q B;  3UZC A;  3ODU A;  3HAR A;  5B6V A;  2Z55 A;  5A44 A;  3REY A;  4MD1 A;  4Y9H A;  4K5Y A;  3HAN A;  3AM6 A;  3MBV A;  1QHJ A;  5TGZ A;  1TN5 A;  3HAO A;  1F4Z A;  5F8U A;  5G36 A;  1E12 A;  4DAJ A;  2YCZ A;  3V2W A;  3S3D B;  5A45 A;  5DHH A;  1F88 A;  3HAQ A;  2L6X A;  4MQS A;  5H2L A;  4BV0 A;  1H2S A;  4X1H A;  1GU8 A;  1AP9 A;  3NYA A;  4XTL A;  1EHK B;  5B6W A;  2Y02 A;  2QPD B;  3PQR A;  3QAK A;  1P8H A;  2BRD A;  5DYS A;  4IAQ A;  4BUO A;  2WJL A;  4JKV A;  1FBK A;  4GBR A;  3QJR B;  4G70 B;  4J4Q A;  4LDO A;  4WW3 A;  4GYC A;  5AHY A;  3ZEV A;  2Y01 A;  2J4Y A;  2JAF A;  1BRX A;  4XTO A;  1KG8 A;  4HYX A;  1S8L A;  1TN0 A;  4JR8 A;  5G2A A;  2YCX A;  3QBG A;  5H2J A;  1U19 A;  3ZPQ A;  4GRV A;  3ABW A;  5BR2 A;  2F93 A;  3S8F B;  4KNF A;  4XXJ A;  3X3C A;  4BWB A;  1IW9 A;  1FBB A;  1F50 A;  1S51 A;  3S3B B;  3QJT B;  1P8U A;  3VHZ A;  5JJN A;  1MGY A;  2NTU A;  2YCY A;  3UTX A;  1E0P A;  5G2C A;  2Z73 A;  1KME A;  2M3G A;  2G87 A;  2Y00 A;  4MQT A;  5AZD A;  4EIY A;  1KGB A;  4HYJ A;  1Q5J A;  1XJI A;  4HWL A;  1BRD A;  3UTV A;  1XME B;  3HAS A;  5H2N A;  1L0M A;  3NSB A;  3T45 A;  4N4W A;  3RZE A;  4LDL A;  4FBZ A;  4PXF A;  5AX0 A;  3QJU B;  1JV7 A;  2RH1 A;  5B34 A;  4KLY A;  4FAA B;  5G2D A;  3QBI A;  3QJQ B;  1QM8 A;  4JQ6 A;  4X31 A;  5B35 A;  1VGO A;  3OE0 A;  1S8J A;  5B6Z A;  3X3B A;  4N4Y B;  4G7R B;  2QPE B;  5JJJ A;  4G72 B;  2I21 A;  4L6R A;  3QAP A;  1IXF A;  2NTW A;  1C3W A;  1GZM A;  3KJ6 A;  2ZZL A;  5JJE A;  3DDL A;  4G7S B;  2R4R A;  3EML A;  4PXK A;  1QKP A;  1UAZ A;  3S3C B;  5BR5 A;  5KKH A;  3COC A;  5EN0 A;  1BM1 A;  1HZX A;  2LNL A;  3S8G B; 
#chains in the Genus database with same CATH topology
 1X0I 1;  1VJM A;  2HPY A;  2Y04 A;  4A4M A;  2KSY A;  4BVN A;  1S52 A;  3COD A;  1C8S A;  4EJ4 A;  2KSA A;  3PWH A;  1M0M A;  4UG2 A;  5ETZ A;  1O0A A;  3EH5 B;  5H2O A;  5A8E A;  3BVD B;  3VG9 A;  3QBL A;  1H68 A;  1L9H A;  2JAG A;  1C8R A;  3NY8 A;  1PY6 A;  2Y03 A;  2WJK A;  3AYM A;  3NY9 A;  4FA7 B;  4UHR A;  3AYN A;  5LWE A;  4GP8 B;  3PXO A;  5FJG A;  5G28 A;  4QI1 A;  1AT9 A;  4TL3 A;  5H2M A;  4DS7 E;  4NC3 A;  5B6X A;  3EH3 B;  3OE8 A;  4X32 A;  2KS9 A;  3DQB A;  1KG9 A;  5G54 A;  5H2P A;  3OE6 A;  2R4S A;  1R84 A;  4XTN A;  1P8I A;  1Q5I A;  4WAV A;  3VVK A;  3RFM A;  1JV6 A;  4XT1 A;  4G71 B;  3OAX A;  3VW7 A;  4BEY A;  1QKO A;  4GP4 B;  1IW6 A;  2EI4 A;  4MD2 A;  3HAP A;  3WQJ A;  1S54 A;  4AMJ A;  1PXS A;  4LDE A;  5AHZ A;  2I1X A;  1LN6 A;  5AWZ A;  1R2N A;  2YDV A;  3UZA A;  2YCW A;  1XIO A;  1S53 A;  4GP5 B;  1X0S A;  1X0K 1;  1PXR A;  5ITE A;  4N6H A;  4BEZ A;  3QBK A;  3EH4 B;  2YDO A;  4QID A;  3QDC A;  4L35 A;  2KSB A;  5ITC A;  1GUE A;  5G53 A;  3C9L A;  4DJH A;  1M0K A;  2I20 A;  4GPO A;  5H2H A;  1BRR A;  5B2N A;  3PBL A;  3QJS B;  4IAR A;  5C1M A;  4OV0 A;  3OE9 A;  4DKL A;  2ZIY A;  3ZPR A;  3QJV B;  3A7K A;  3VI0 A;  3CAP A;  1JGJ A;  4FPD A;  3P0G A;  2I35 A;  5AX1 A;  5DHG A;  2ZFE A;  4QRY A;  3D4S A;  1CWQ A;  3UTY A;  3NS0 A;  4MBS A;  1DZE A;  5H2K A;  4XT3 A;  3UON A;  3SN6 R;  2AT9 A;  5B0W A;  3UG9 A;  3C9M A;  2F95 A;  4AMI A;  3PDS A;  2X72 A;  1JFP A;  5B6Y A;  2PED A;  5J7A A;  3UTW A;  4EA3 A;  2VT4 A;  1UCQ A;  3VGA A;  3V2Y A;  5H2I A;  1M0L A;  4IB4 A;  4G7Q B;  3UZC A;  3ODU A;  3HAR A;  5B6V A;  2Z55 A;  5A44 A;  3REY A;  4MD1 A;  4Y9H A;  4K5Y A;  3HAN A;  3AM6 A;  3MBV A;  1QHJ A;  5TGZ A;  1TN5 A;  3HAO A;  1F4Z A;  5F8U A;  5G36 A;  1E12 A;  4DAJ A;  2YCZ A;  3V2W A;  3S3D B;  5A45 A;  5DHH A;  1F88 A;  3HAQ A;  2L6X A;  4MQS A;  5H2L A;  4BV0 A;  1H2S A;  4X1H A;  1GU8 A;  1AP9 A;  3NYA A;  4XTL A;  1EHK B;  5B6W A;  2Y02 A;  2QPD B;  3PQR A;  3QAK A;  1P8H A;  2BRD A;  5DYS A;  4IAQ A;  4BUO A;  2WJL A;  4JKV A;  1FBK A;  4GBR A;  3QJR B;  4G70 B;  4J4Q A;  4LDO A;  4WW3 A;  4GYC A;  5AHY A;  3ZEV A;  2Y01 A;  2J4Y A;  2JAF A;  1BRX A;  4XTO A;  1KG8 A;  4HYX A;  1S8L A;  1TN0 A;  4JR8 A;  5G2A A;  2YCX A;  3QBG A;  5H2J A;  1U19 A;  3ZPQ A;  4GRV A;  3ABW A;  5BR2 A;  2F93 A;  3S8F B;  4KNF A;  4XXJ A;  3X3C A;  4BWB A;  1IW9 A;  1FBB A;  1F50 A;  1S51 A;  3S3B B;  3QJT B;  1P8U A;  3VHZ A;  5JJN A;  1MGY A;  2NTU A;  2YCY A;  3UTX A;  1E0P A;  5G2C A;  2Z73 A;  1KME A;  2M3G A;  2G87 A;  2Y00 A;  4MQT A;  5AZD A;  4EIY A;  1KGB A;  4HYJ A;  1Q5J A;  1XJI A;  4HWL A;  1BRD A;  3UTV A;  1XME B;  3HAS A;  5H2N A;  1L0M A;  3NSB A;  3T45 A;  4N4W A;  3RZE A;  4LDL A;  4FBZ A;  4PXF A;  5AX0 A;  3QJU B;  1JV7 A;  2RH1 A;  5B34 A;  4KLY A;  4FAA B;  5G2D A;  3QBI A;  3QJQ B;  1QM8 A;  4JQ6 A;  4X31 A;  5B35 A;  1VGO A;  3OE0 A;  1S8J A;  5B6Z A;  3X3B A;  4N4Y B;  4G7R B;  2QPE B;  5JJJ A;  4G72 B;  2I21 A;  4L6R A;  3QAP A;  1IXF A;  2NTW A;  1C3W A;  1GZM A;  3KJ6 A;  2ZZL A;  5JJE A;  3DDL A;  4G7S B;  2R4R A;  3EML A;  4PXK A;  1QKP A;  1UAZ A;  3S3C B;  5BR5 A;  5KKH A;  3COC A;  5EN0 A;  1BM1 A;  1HZX A;  2LNL A;  3S8G B; 
#chains in the Genus database with same CATH homology
 1X0I 1;  1VJM A;  2HPY A;  2Y04 A;  4A4M A;  2KSY A;  4BVN A;  1S52 A;  3COD A;  1C8S A;  4EJ4 A;  2KSA A;  3PWH A;  1M0M A;  4UG2 A;  5ETZ A;  1O0A A;  3EH5 B;  5H2O A;  5A8E A;  3BVD B;  3VG9 A;  3QBL A;  1H68 A;  1L9H A;  2JAG A;  1C8R A;  3NY8 A;  1PY6 A;  2Y03 A;  2WJK A;  3AYM A;  3NY9 A;  4FA7 B;  4UHR A;  3AYN A;  5LWE A;  4GP8 B;  3PXO A;  5FJG A;  5G28 A;  4QI1 A;  1AT9 A;  4TL3 A;  5H2M A;  4DS7 E;  4NC3 A;  5B6X A;  3EH3 B;  3OE8 A;  4X32 A;  2KS9 A;  3DQB A;  1KG9 A;  5G54 A;  5H2P A;  3OE6 A;  2R4S A;  1R84 A;  4XTN A;  1P8I A;  1Q5I A;  4WAV A;  3VVK A;  3RFM A;  1JV6 A;  4XT1 A;  4G71 B;  3OAX A;  3VW7 A;  4BEY A;  1QKO A;  4GP4 B;  1IW6 A;  2EI4 A;  4MD2 A;  3HAP A;  3WQJ A;  1S54 A;  4AMJ A;  1PXS A;  4LDE A;  5AHZ A;  2I1X A;  1LN6 A;  5AWZ A;  1R2N A;  2YDV A;  3UZA A;  2YCW A;  1XIO A;  1S53 A;  4GP5 B;  1X0S A;  1X0K 1;  1PXR A;  5ITE A;  4N6H A;  4BEZ A;  3QBK A;  3EH4 B;  2YDO A;  4QID A;  3QDC A;  4L35 A;  2KSB A;  5ITC A;  1GUE A;  5G53 A;  3C9L A;  4DJH A;  1M0K A;  2I20 A;  4GPO A;  5H2H A;  1BRR A;  5B2N A;  3PBL A;  3QJS B;  4IAR A;  5C1M A;  4OV0 A;  3OE9 A;  4DKL A;  2ZIY A;  3ZPR A;  3QJV B;  3A7K A;  3VI0 A;  3CAP A;  1JGJ A;  4FPD A;  3P0G A;  2I35 A;  5AX1 A;  5DHG A;  2ZFE A;  4QRY A;  3D4S A;  1CWQ A;  3UTY A;  3NS0 A;  4MBS A;  1DZE A;  5H2K A;  4XT3 A;  3UON A;  3SN6 R;  2AT9 A;  5B0W A;  3UG9 A;  3C9M A;  2F95 A;  4AMI A;  3PDS A;  2X72 A;  1JFP A;  5B6Y A;  2PED A;  5J7A A;  3UTW A;  4EA3 A;  2VT4 A;  1UCQ A;  3VGA A;  3V2Y A;  5H2I A;  1M0L A;  4IB4 A;  4G7Q B;  3UZC A;  3ODU A;  3HAR A;  5B6V A;  2Z55 A;  5A44 A;  3REY A;  4MD1 A;  4Y9H A;  4K5Y A;  3HAN A;  3AM6 A;  3MBV A;  1QHJ A;  5TGZ A;  1TN5 A;  3HAO A;  1F4Z A;  5F8U A;  5G36 A;  1E12 A;  4DAJ A;  2YCZ A;  3V2W A;  3S3D B;  5A45 A;  5DHH A;  1F88 A;  3HAQ A;  2L6X A;  4MQS A;  5H2L A;  4BV0 A;  1H2S A;  4X1H A;  1GU8 A;  1AP9 A;  3NYA A;  4XTL A;  1EHK B;  5B6W A;  2Y02 A;  2QPD B;  3PQR A;  3QAK A;  1P8H A;  2BRD A;  5DYS A;  4IAQ A;  4BUO A;  2WJL A;  4JKV A;  1FBK A;  4GBR A;  3QJR B;  4G70 B;  4J4Q A;  4LDO A;  4WW3 A;  4GYC A;  5AHY A;  3ZEV A;  2Y01 A;  2J4Y A;  2JAF A;  1BRX A;  4XTO A;  1KG8 A;  4HYX A;  1S8L A;  1TN0 A;  4JR8 A;  5G2A A;  2YCX A;  3QBG A;  5H2J A;  1U19 A;  3ZPQ A;  4GRV A;  3ABW A;  5BR2 A;  2F93 A;  3S8F B;  4KNF A;  4XXJ A;  3X3C A;  4BWB A;  1IW9 A;  1FBB A;  1F50 A;  1S51 A;  3S3B B;  3QJT B;  1P8U A;  3VHZ A;  5JJN A;  1MGY A;  2NTU A;  2YCY A;  3UTX A;  1E0P A;  5G2C A;  2Z73 A;  1KME A;  2M3G A;  2G87 A;  2Y00 A;  4MQT A;  5AZD A;  4EIY A;  1KGB A;  4HYJ A;  1Q5J A;  1XJI A;  4HWL A;  1BRD A;  3UTV A;  1XME B;  3HAS A;  5H2N A;  1L0M A;  3NSB A;  3T45 A;  4N4W A;  3RZE A;  4LDL A;  4FBZ A;  4PXF A;  5AX0 A;  3QJU B;  1JV7 A;  2RH1 A;  5B34 A;  4KLY A;  4FAA B;  5G2D A;  3QBI A;  3QJQ B;  1QM8 A;  4JQ6 A;  4X31 A;  5B35 A;  1VGO A;  3OE0 A;  1S8J A;  5B6Z A;  3X3B A;  4N4Y B;  4G7R B;  2QPE B;  5JJJ A;  4G72 B;  2I21 A;  4L6R A;  3QAP A;  1IXF A;  2NTW A;  1C3W A;  1GZM A;  3KJ6 A;  2ZZL A;  5JJE A;  3DDL A;  4G7S B;  2R4R A;  3EML A;  4PXK A;  1QKP A;  1UAZ A;  3S3C B;  5BR5 A;  5KKH A;  3COC A;  5EN0 A;  1BM1 A;  1HZX A;  2LNL A;  3S8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...