3VVKA

An m-like reaction state of the azide-bound purple form of pharaonis halorhodopsin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
261
structure length
261
Chain Sequence
EVTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLIAVSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGVVTMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAALTTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLLTVVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYLTSNEGVVSGSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Halorhodopsin
publication title Large deformation of helix F during the photoreaction cycle of Pharaonis halorhodopsin in complex with azide
pubmed doi rcsb
total genus 109
structure length 261
sequence length 261
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3vvkA00
2JAFA 3DQBA 1C8SA 2ZFEA 4MD2A 1S53A 5H2MA 4N6HA 4QRYA 5H2KA 3HAOA 1S8JA 4XXJA 2I35A 2AT9A 1KMEA 2QPDB 4L35A 5FJGA 4AMIA 3UZCA 2BRDA 3P0GA 3UZAA 2F95A 2J4YA 3QAKA 3QJQB 4JQ6A 3X3CA 3QJSB 1FBBA 4HYJA 4PXKA 3V2WA 1Q5JA 3COCA 3CODA 3QBKA 2KSYA 3PWHA 5B34A 3EH3B 2X72A 4G7RB 2YCWA 1GU8A 3SN6R 3D4SA 2M3GA 5DYSA 1HZXA 4N4WA 1M0KA 5H2LA 5BR5A 4OV0A 4EA3A 2I20A 1U19A 4FPDA 3ABWA 2Z73A 1P8IA 3QDCA 1S52A 3VHZA 1BRDA 1M0LA 4LDLA 5B35A 2WJKA 1GUEA 4Y9HA 1R2NA 3AM6A 3OAXA 2Y03A 4MD1A 2R4SA 2LNLA 4A4MA 3QJVB 2L6XA 5DHHA 3BVDB 1PY6A 2VT4A 1TN5A 4G7QB 1JFPA 1EHKB 3REYA 5G2AA 5JJEA 2F93A 5A45A 2ZZLA 4FBZA 1VGOA 4UG2A 1X0I1 5G53A 1QHJA 3HAQA 4MQTA 2NTUA 3MBVA 4NC3A 2Y04A 4HWLA 3S3DB 5A44A 5G28A 4QI1A 2EI4A 4K5YA 2PEDA 4G72B 1PXRA 4DJHA 1DZEA 4BEYA 3QJRB 3S8FB 4G71B 4BUOA 3WQJA 5JJJA 4AMJA 4FA7B 1E0PA 1KG8A 5LWEA 3PXOA 4EIYA 1C3WA 5H2NA 4XTNA 3EH5B 4BWBA 1BRRA 5AX0A 3C9MA 3UG9A 1L0MA 3HASA 1XJIA 4JKVA 4IAQA 4LDOA 3HAPA 5ITCA 2YDVA 5ITEA 3HANA 5TGZA 1CWQA 4XTLA 3OE8A 3RFMA 3S3CB 2KSAA 1H2SA 3ZEVA 3HARA 2R4RA 3AYMA 3EH4B 1VJMA 3T45A 3QJTB 1QKPA 3UTWA 5B6VA 4KNFA 4BEZA 1JV7A 1M0MA 3ODUA 4LDEA 3NY9A 3C9LA 2I1XA 5F8UA 1IXFA 4WAVA 5KKHA 3QJUB 2Y00A 1H68A 4EJ4A 5G2DA 5H2IA 1F88A 5AHZA 5H2PA 3AYNA 1P8UA 4QIDA 5H2JA 3UONA 2YCYA 3S3BB 1C8RA 3VGAA 1IW6A 4XT3A 1F4ZA 3VW7A 4N4YB 4X32A 4FAAB 2YCZA 4GYCA 4HYXA 4GP5B 5G2CA 5B6YA 4GP4B 1JV6A 5AHYA 3NY8A 1KGBA 1E12A 1R84A 4X1HA 3OE9A 4L6RA 2ZIYA 1KG9A 4BV0A 3UTXA 2Z55A 1MGYA 3VVKA 3ZPQA 1F50A 4GBRA 3VG9A 3DDLA 4TL3A 5AZDA 2KS9A 1UAZA 1LN6A 1TN0A 1FBKA 1GZMA 3NYAA 4DKLA 3S8GB 4PXFA 4XTOA 3QBGA 5H2OA 1UCQA 3QBIA 4G70B 1XMEB 2I21A 4JR8A 4BVNA 1L9HA 1BM1A 5J7AA 2RH1A 4MQSA 1X0SA 4GRVA 1BRXA 1S51A 1XIOA 4IARA 2Y02A 5C1MA 2JAGA 3PQRA 3NS0A 3PBLA 5DHGA 5G54A 2QPEB 4GP8B 1Q5IA 1S8LA 3KJ6A 4J4QA 3ZPRA 5B0WA 4WW3A 2G87A 3OE6A 4G7SB 5EN0A 4KLYA 2KSBA 1O0AA 3VI0A 4MBSA 3EMLA 3CAPA 4X31A 1QKOA 3QAPA 1IW9A 2YCXA 5AWZA 1QM8A 4XT1A 2Y01A 5H2HA 3UTYA 4IB4A 2HPYA 5B6XA 5JJNA 1JGJA 1AP9A 3A7KA 5B2NA 5BR2A 4GPOA 3QBLA 3PDSA 5AX1A 4DAJA 3V2YA 3OE0A 5B6ZA 2NTWA 4UHRA 5A8EA 3X3BA 2WJLA 5G36A 1AT9A 2YDOA 5ETZA 3UTVA 3NSBA 5B6WA 3RZEA 1P8HA 1PXSA 1S54A 1X0K1
chains in the Genus database with same CATH superfamily
2JAFA 3DQBA 1C8SA 2ZFEA 4MD2A 1S53A 5H2MA 4N6HA 4QRYA 5H2KA 3HAOA 1S8JA 4XXJA 2I35A 2AT9A 1KMEA 2QPDB 4L35A 5FJGA 4AMIA 3UZCA 2BRDA 3P0GA 3UZAA 2F95A 2J4YA 3QAKA 3QJQB 4JQ6A 3X3CA 3QJSB 1FBBA 4HYJA 4PXKA 3V2WA 1Q5JA 3COCA 3CODA 3QBKA 2KSYA 3PWHA 5B34A 3EH3B 2X72A 4G7RB 2YCWA 1GU8A 3SN6R 3D4SA 2M3GA 5DYSA 1HZXA 4N4WA 1M0KA 5H2LA 5BR5A 4OV0A 4EA3A 2I20A 1U19A 4FPDA 3ABWA 2Z73A 1P8IA 3QDCA 1S52A 3VHZA 1BRDA 1M0LA 4LDLA 5B35A 2WJKA 1GUEA 4Y9HA 1R2NA 3AM6A 3OAXA 2Y03A 4MD1A 2R4SA 2LNLA 4A4MA 3QJVB 2L6XA 5DHHA 3BVDB 1PY6A 2VT4A 1TN5A 4G7QB 1JFPA 1EHKB 3REYA 5G2AA 5JJEA 2F93A 5A45A 2ZZLA 4FBZA 1VGOA 4UG2A 1X0I1 5G53A 1QHJA 3HAQA 4MQTA 2NTUA 3MBVA 4NC3A 2Y04A 4HWLA 3S3DB 5A44A 5G28A 4QI1A 2EI4A 4K5YA 2PEDA 4G72B 1PXRA 4DJHA 1DZEA 4BEYA 3QJRB 3S8FB 4G71B 4BUOA 3WQJA 5JJJA 4AMJA 4FA7B 1E0PA 1KG8A 5LWEA 3PXOA 4EIYA 1C3WA 5H2NA 4XTNA 3EH5B 4BWBA 1BRRA 5AX0A 3C9MA 3UG9A 1L0MA 3HASA 1XJIA 4JKVA 4IAQA 4LDOA 3HAPA 5ITCA 2YDVA 5ITEA 3HANA 5TGZA 1CWQA 4XTLA 3OE8A 3RFMA 3S3CB 2KSAA 1H2SA 3ZEVA 3HARA 2R4RA 3AYMA 3EH4B 1VJMA 3T45A 3QJTB 1QKPA 3UTWA 5B6VA 4KNFA 4BEZA 1JV7A 1M0MA 3ODUA 4LDEA 3NY9A 3C9LA 2I1XA 5F8UA 1IXFA 4WAVA 5KKHA 3QJUB 2Y00A 1H68A 4EJ4A 5G2DA 5H2IA 1F88A 5AHZA 5H2PA 3AYNA 1P8UA 4QIDA 5H2JA 3UONA 2YCYA 3S3BB 1C8RA 3VGAA 1IW6A 4XT3A 1F4ZA 3VW7A 4N4YB 4X32A 4FAAB 2YCZA 4GYCA 4HYXA 4GP5B 5G2CA 5B6YA 4GP4B 1JV6A 5AHYA 3NY8A 1KGBA 1E12A 1R84A 4X1HA 3OE9A 4L6RA 2ZIYA 1KG9A 4BV0A 3UTXA 2Z55A 1MGYA 3VVKA 3ZPQA 1F50A 4GBRA 3VG9A 3DDLA 4TL3A 5AZDA 2KS9A 1UAZA 1LN6A 1TN0A 1FBKA 1GZMA 3NYAA 4DKLA 3S8GB 4PXFA 4XTOA 3QBGA 5H2OA 1UCQA 3QBIA 4G70B 1XMEB 2I21A 4JR8A 4BVNA 1L9HA 1BM1A 5J7AA 2RH1A 4MQSA 1X0SA 4GRVA 1BRXA 1S51A 1XIOA 4IARA 2Y02A 5C1MA 2JAGA 3PQRA 3NS0A 3PBLA 5DHGA 5G54A 2QPEB 4GP8B 1Q5IA 1S8LA 3KJ6A 4J4QA 3ZPRA 5B0WA 4WW3A 2G87A 3OE6A 4G7SB 5EN0A 4KLYA 2KSBA 1O0AA 3VI0A 4MBSA 3EMLA 3CAPA 4X31A 1QKOA 3QAPA 1IW9A 2YCXA 5AWZA 1QM8A 4XT1A 2Y01A 5H2HA 3UTYA 4IB4A 2HPYA 5B6XA 5JJNA 1JGJA 1AP9A 3A7KA 5B2NA 4DS7E 5BR2A 4GPOA 3QBLA 3PDSA 5AX1A 4DAJA 3V2YA 3OE0A 5B6ZA 2NTWA 4UHRA 5A8EA 3X3BA 2WJLA 5G36A 1AT9A 2YDOA 5ETZA 3UTVA 3NSBA 5B6WA 3RZEA 1P8HA 1PXSA 1S54A 1X0K1
chains in the Genus database with same CATH topology
2JAFA 3DQBA 1C8SA 2ZFEA 4MD2A 1S53A 5H2MA 4N6HA 4QRYA 5H2KA 3HAOA 1S8JA 4XXJA 2I35A 2AT9A 1KMEA 2QPDB 4L35A 5FJGA 4AMIA 3UZCA 2BRDA 3P0GA 3UZAA 2F95A 2J4YA 3QAKA 3QJQB 4JQ6A 3X3CA 3QJSB 1FBBA 4HYJA 4PXKA 3V2WA 1Q5JA 3COCA 3CODA 3QBKA 2KSYA 3PWHA 5B34A 3EH3B 2X72A 4G7RB 2YCWA 1GU8A 3SN6R 3D4SA 2M3GA 5DYSA 1HZXA 4N4WA 1M0KA 5H2LA 5BR5A 4OV0A 4EA3A 2I20A 1U19A 4FPDA 3ABWA 2Z73A 1P8IA 3QDCA 1S52A 3VHZA 1BRDA 1M0LA 4LDLA 5B35A 2WJKA 1GUEA 4Y9HA 1R2NA 3AM6A 3OAXA 2Y03A 4MD1A 2R4SA 2LNLA 4A4MA 3QJVB 2L6XA 5DHHA 3BVDB 1PY6A 2VT4A 1TN5A 4G7QB 1JFPA 1EHKB 3REYA 5G2AA 5JJEA 2F93A 5A45A 2ZZLA 4FBZA 1VGOA 4UG2A 1X0I1 5G53A 1QHJA 3HAQA 4MQTA 2NTUA 3MBVA 4NC3A 2Y04A 4HWLA 3S3DB 5A44A 5G28A 4QI1A 2EI4A 4K5YA 2PEDA 4G72B 1PXRA 4DJHA 1DZEA 4BEYA 3QJRB 3S8FB 4G71B 4BUOA 3WQJA 5JJJA 4AMJA 4FA7B 1E0PA 1KG8A 5LWEA 3PXOA 4EIYA 1C3WA 5H2NA 4XTNA 3EH5B 4BWBA 1BRRA 5AX0A 3C9MA 3UG9A 1L0MA 3HASA 1XJIA 4JKVA 4IAQA 4LDOA 3HAPA 5ITCA 2YDVA 5ITEA 3HANA 5TGZA 1CWQA 4XTLA 3OE8A 3RFMA 3S3CB 2KSAA 1H2SA 3ZEVA 3HARA 2R4RA 3AYMA 3EH4B 1VJMA 3T45A 3QJTB 1QKPA 3UTWA 5B6VA 4KNFA 4BEZA 1JV7A 1M0MA 3ODUA 4LDEA 3NY9A 3C9LA 2I1XA 5F8UA 1IXFA 4WAVA 5KKHA 3QJUB 2Y00A 1H68A 4EJ4A 5G2DA 5H2IA 1F88A 5AHZA 5H2PA 3AYNA 1P8UA 4QIDA 5H2JA 3UONA 2YCYA 3S3BB 1C8RA 3VGAA 1IW6A 4XT3A 1F4ZA 3VW7A 4N4YB 4X32A 4FAAB 2YCZA 4GYCA 4HYXA 4GP5B 5G2CA 5B6YA 4GP4B 1JV6A 5AHYA 3NY8A 1KGBA 1E12A 1R84A 4X1HA 3OE9A 4L6RA 2ZIYA 1KG9A 4BV0A 3UTXA 2Z55A 1MGYA 3VVKA 3ZPQA 1F50A 4GBRA 3VG9A 3DDLA 4TL3A 5AZDA 2KS9A 1UAZA 1LN6A 1TN0A 1FBKA 1GZMA 3NYAA 4DKLA 3S8GB 4PXFA 4XTOA 3QBGA 5H2OA 1UCQA 3QBIA 4G70B 1XMEB 2I21A 4JR8A 4BVNA 1L9HA 1BM1A 5J7AA 2RH1A 4MQSA 1X0SA 4GRVA 1BRXA 1S51A 1XIOA 4IARA 2Y02A 5C1MA 2JAGA 3PQRA 3NS0A 3PBLA 5DHGA 5G54A 2QPEB 4GP8B 1Q5IA 1S8LA 3KJ6A 4J4QA 3ZPRA 5B0WA 4WW3A 2G87A 3OE6A 4G7SB 5EN0A 4KLYA 2KSBA 1O0AA 3VI0A 4MBSA 3EMLA 3CAPA 4X31A 1QKOA 3QAPA 1IW9A 2YCXA 5AWZA 1QM8A 4XT1A 2Y01A 5H2HA 3UTYA 4IB4A 2HPYA 5B6XA 5JJNA 1JGJA 1AP9A 3A7KA 5B2NA 4DS7E 5BR2A 4GPOA 3QBLA 3PDSA 5AX1A 4DAJA 3V2YA 3OE0A 5B6ZA 2NTWA 4UHRA 5A8EA 3X3BA 2WJLA 5G36A 1AT9A 2YDOA 5ETZA 3UTVA 3NSBA 5B6WA 3RZEA 1P8HA 1PXSA 1S54A 1X0K1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAF A;  3DQB A;  1C8S A;  2ZFE A;  4MD2 A;  1S53 A;  5H2M A;  4N6H A;  4QRY A;  5H2K A;  3HAO A;  1S8J A;  4XXJ A;  2I35 A;  2AT9 A;  1KME A;  2QPD B;  4L35 A;  5FJG A;  4AMI A;  3UZC A;  2BRD A;  3P0G A;  3UZA A;  2F95 A;  2J4Y A;  3QAK A;  3QJQ B;  4JQ6 A;  3X3C A;  3QJS B;  1FBB A;  4HYJ A;  4PXK A;  3V2W A;  1Q5J A;  3COC A;  3COD A;  3QBK A;  2KSY A;  3PWH A;  5B34 A;  3EH3 B;  2X72 A;  4G7R B;  2YCW A;  1GU8 A;  3SN6 R;  3D4S A;  2M3G A;  5DYS A;  1HZX A;  4N4W A;  1M0K A;  5H2L A;  5BR5 A;  4OV0 A;  4EA3 A;  2I20 A;  1U19 A;  4FPD A;  3ABW A;  2Z73 A;  1P8I A;  3QDC A;  1S52 A;  3VHZ A;  1BRD A;  1M0L A;  4LDL A;  5B35 A;  2WJK A;  1GUE A;  4Y9H A;  1R2N A;  3AM6 A;  3OAX A;  2Y03 A;  4MD1 A;  2R4S A;  2LNL A;  4A4M A;  3QJV B;  2L6X A;  5DHH A;  3BVD B;  1PY6 A;  2VT4 A;  1TN5 A;  4G7Q B;  1JFP A;  1EHK B;  3REY A;  5G2A A;  5JJE A;  2F93 A;  5A45 A;  2ZZL A;  4FBZ A;  1VGO A;  4UG2 A;  1X0I 1;  5G53 A;  1QHJ A;  3HAQ A;  4MQT A;  2NTU A;  3MBV A;  4NC3 A;  2Y04 A;  4HWL A;  3S3D B;  5A44 A;  5G28 A;  4QI1 A;  2EI4 A;  4K5Y A;  2PED A;  4G72 B;  1PXR A;  4DJH A;  1DZE A;  4BEY A;  3QJR B;  3S8F B;  4G71 B;  4BUO A;  3WQJ A;  5JJJ A;  4AMJ A;  4FA7 B;  1E0P A;  1KG8 A;  5LWE A;  3PXO A;  4EIY A;  1C3W A;  5H2N A;  4XTN A;  3EH5 B;  4BWB A;  1BRR A;  5AX0 A;  3C9M A;  3UG9 A;  1L0M A;  3HAS A;  1XJI A;  4JKV A;  4IAQ A;  4LDO A;  3HAP A;  5ITC A;  2YDV A;  5ITE A;  3HAN A;  5TGZ A;  1CWQ A;  4XTL A;  3OE8 A;  3RFM A;  3S3C B;  2KSA A;  1H2S A;  3ZEV A;  3HAR A;  2R4R A;  3AYM A;  3EH4 B;  1VJM A;  3T45 A;  3QJT B;  1QKP A;  3UTW A;  5B6V A;  4KNF A;  4BEZ A;  1JV7 A;  1M0M A;  3ODU A;  4LDE A;  3NY9 A;  3C9L A;  2I1X A;  5F8U A;  1IXF A;  4WAV A;  5KKH A;  3QJU B;  2Y00 A;  1H68 A;  4EJ4 A;  5G2D A;  5H2I A;  1F88 A;  5AHZ A;  5H2P A;  3AYN A;  1P8U A;  4QID A;  5H2J A;  3UON A;  2YCY A;  3S3B B;  1C8R A;  3VGA A;  1IW6 A;  4XT3 A;  1F4Z A;  3VW7 A;  4N4Y B;  4X32 A;  4FAA B;  2YCZ A;  4GYC A;  4HYX A;  4GP5 B;  5G2C A;  5B6Y A;  4GP4 B;  1JV6 A;  5AHY A;  3NY8 A;  1KGB A;  1E12 A;  1R84 A;  4X1H A;  3OE9 A;  4L6R A;  2ZIY A;  1KG9 A;  4BV0 A;  3UTX A;  2Z55 A;  1MGY A;  3VVK A;  3ZPQ A;  1F50 A;  4GBR A;  3VG9 A;  3DDL A;  4TL3 A;  5AZD A;  2KS9 A;  1UAZ A;  1LN6 A;  1TN0 A;  1FBK A;  1GZM A;  3NYA A;  4DKL A;  3S8G B;  4PXF A;  4XTO A;  3QBG A;  5H2O A;  1UCQ A;  3QBI A;  4G70 B;  1XME B;  2I21 A;  4JR8 A;  4BVN A;  1L9H A;  1BM1 A;  5J7A A;  2RH1 A;  4MQS A;  1X0S A;  4GRV A;  1BRX A;  1S51 A;  1XIO A;  4IAR A;  2Y02 A;  5C1M A;  2JAG A;  3PQR A;  3NS0 A;  3PBL A;  5DHG A;  5G54 A;  2QPE B;  4GP8 B;  1Q5I A;  1S8L A;  3KJ6 A;  4J4Q A;  3ZPR A;  5B0W A;  4WW3 A;  2G87 A;  3OE6 A;  4G7S B;  5EN0 A;  4KLY A;  2KSB A;  1O0A A;  3VI0 A;  4MBS A;  3EML A;  3CAP A;  4X31 A;  1QKO A;  3QAP A;  1IW9 A;  2YCX A;  5AWZ A;  1QM8 A;  4XT1 A;  2Y01 A;  5H2H A;  3UTY A;  4IB4 A;  2HPY A;  5B6X A;  5JJN A;  1JGJ A;  1AP9 A;  3A7K A;  5B2N A;  5BR2 A;  4GPO A;  3QBL A;  3PDS A;  5AX1 A;  4DAJ A;  3V2Y A;  3OE0 A;  5B6Z A;  2NTW A;  4UHR A;  5A8E A;  3X3B A;  2WJL A;  5G36 A;  1AT9 A;  2YDO A;  5ETZ A;  3UTV A;  3NSB A;  5B6W A;  3RZE A;  1P8H A;  1PXS A;  1S54 A;  1X0K 1; 
#chains in the Genus database with same CATH topology
 2JAF A;  3DQB A;  1C8S A;  2ZFE A;  4MD2 A;  1S53 A;  5H2M A;  4N6H A;  4QRY A;  5H2K A;  3HAO A;  1S8J A;  4XXJ A;  2I35 A;  2AT9 A;  1KME A;  2QPD B;  4L35 A;  5FJG A;  4AMI A;  3UZC A;  2BRD A;  3P0G A;  3UZA A;  2F95 A;  2J4Y A;  3QAK A;  3QJQ B;  4JQ6 A;  3X3C A;  3QJS B;  1FBB A;  4HYJ A;  4PXK A;  3V2W A;  1Q5J A;  3COC A;  3COD A;  3QBK A;  2KSY A;  3PWH A;  5B34 A;  3EH3 B;  2X72 A;  4G7R B;  2YCW A;  1GU8 A;  3SN6 R;  3D4S A;  2M3G A;  5DYS A;  1HZX A;  4N4W A;  1M0K A;  5H2L A;  5BR5 A;  4OV0 A;  4EA3 A;  2I20 A;  1U19 A;  4FPD A;  3ABW A;  2Z73 A;  1P8I A;  3QDC A;  1S52 A;  3VHZ A;  1BRD A;  1M0L A;  4LDL A;  5B35 A;  2WJK A;  1GUE A;  4Y9H A;  1R2N A;  3AM6 A;  3OAX A;  2Y03 A;  4MD1 A;  2R4S A;  2LNL A;  4A4M A;  3QJV B;  2L6X A;  5DHH A;  3BVD B;  1PY6 A;  2VT4 A;  1TN5 A;  4G7Q B;  1JFP A;  1EHK B;  3REY A;  5G2A A;  5JJE A;  2F93 A;  5A45 A;  2ZZL A;  4FBZ A;  1VGO A;  4UG2 A;  1X0I 1;  5G53 A;  1QHJ A;  3HAQ A;  4MQT A;  2NTU A;  3MBV A;  4NC3 A;  2Y04 A;  4HWL A;  3S3D B;  5A44 A;  5G28 A;  4QI1 A;  2EI4 A;  4K5Y A;  2PED A;  4G72 B;  1PXR A;  4DJH A;  1DZE A;  4BEY A;  3QJR B;  3S8F B;  4G71 B;  4BUO A;  3WQJ A;  5JJJ A;  4AMJ A;  4FA7 B;  1E0P A;  1KG8 A;  5LWE A;  3PXO A;  4EIY A;  1C3W A;  5H2N A;  4XTN A;  3EH5 B;  4BWB A;  1BRR A;  5AX0 A;  3C9M A;  3UG9 A;  1L0M A;  3HAS A;  1XJI A;  4JKV A;  4IAQ A;  4LDO A;  3HAP A;  5ITC A;  2YDV A;  5ITE A;  3HAN A;  5TGZ A;  1CWQ A;  4XTL A;  3OE8 A;  3RFM A;  3S3C B;  2KSA A;  1H2S A;  3ZEV A;  3HAR A;  2R4R A;  3AYM A;  3EH4 B;  1VJM A;  3T45 A;  3QJT B;  1QKP A;  3UTW A;  5B6V A;  4KNF A;  4BEZ A;  1JV7 A;  1M0M A;  3ODU A;  4LDE A;  3NY9 A;  3C9L A;  2I1X A;  5F8U A;  1IXF A;  4WAV A;  5KKH A;  3QJU B;  2Y00 A;  1H68 A;  4EJ4 A;  5G2D A;  5H2I A;  1F88 A;  5AHZ A;  5H2P A;  3AYN A;  1P8U A;  4QID A;  5H2J A;  3UON A;  2YCY A;  3S3B B;  1C8R A;  3VGA A;  1IW6 A;  4XT3 A;  1F4Z A;  3VW7 A;  4N4Y B;  4X32 A;  4FAA B;  2YCZ A;  4GYC A;  4HYX A;  4GP5 B;  5G2C A;  5B6Y A;  4GP4 B;  1JV6 A;  5AHY A;  3NY8 A;  1KGB A;  1E12 A;  1R84 A;  4X1H A;  3OE9 A;  4L6R A;  2ZIY A;  1KG9 A;  4BV0 A;  3UTX A;  2Z55 A;  1MGY A;  3VVK A;  3ZPQ A;  1F50 A;  4GBR A;  3VG9 A;  3DDL A;  4TL3 A;  5AZD A;  2KS9 A;  1UAZ A;  1LN6 A;  1TN0 A;  1FBK A;  1GZM A;  3NYA A;  4DKL A;  3S8G B;  4PXF A;  4XTO A;  3QBG A;  5H2O A;  1UCQ A;  3QBI A;  4G70 B;  1XME B;  2I21 A;  4JR8 A;  4BVN A;  1L9H A;  1BM1 A;  5J7A A;  2RH1 A;  4MQS A;  1X0S A;  4GRV A;  1BRX A;  1S51 A;  1XIO A;  4IAR A;  2Y02 A;  5C1M A;  2JAG A;  3PQR A;  3NS0 A;  3PBL A;  5DHG A;  5G54 A;  2QPE B;  4GP8 B;  1Q5I A;  1S8L A;  3KJ6 A;  4J4Q A;  3ZPR A;  5B0W A;  4WW3 A;  2G87 A;  3OE6 A;  4G7S B;  5EN0 A;  4KLY A;  2KSB A;  1O0A A;  3VI0 A;  4MBS A;  3EML A;  3CAP A;  4X31 A;  1QKO A;  3QAP A;  1IW9 A;  2YCX A;  5AWZ A;  1QM8 A;  4XT1 A;  2Y01 A;  5H2H A;  3UTY A;  4IB4 A;  2HPY A;  5B6X A;  5JJN A;  1JGJ A;  1AP9 A;  3A7K A;  5B2N A;  4DS7 E;  5BR2 A;  4GPO A;  3QBL A;  3PDS A;  5AX1 A;  4DAJ A;  3V2Y A;  3OE0 A;  5B6Z A;  2NTW A;  4UHR A;  5A8E A;  3X3B A;  2WJL A;  5G36 A;  1AT9 A;  2YDO A;  5ETZ A;  3UTV A;  3NSB A;  5B6W A;  3RZE A;  1P8H A;  1PXS A;  1S54 A;  1X0K 1; 
#chains in the Genus database with same CATH homology
 2JAF A;  3DQB A;  1C8S A;  2ZFE A;  4MD2 A;  1S53 A;  5H2M A;  4N6H A;  4QRY A;  5H2K A;  3HAO A;  1S8J A;  4XXJ A;  2I35 A;  2AT9 A;  1KME A;  2QPD B;  4L35 A;  5FJG A;  4AMI A;  3UZC A;  2BRD A;  3P0G A;  3UZA A;  2F95 A;  2J4Y A;  3QAK A;  3QJQ B;  4JQ6 A;  3X3C A;  3QJS B;  1FBB A;  4HYJ A;  4PXK A;  3V2W A;  1Q5J A;  3COC A;  3COD A;  3QBK A;  2KSY A;  3PWH A;  5B34 A;  3EH3 B;  2X72 A;  4G7R B;  2YCW A;  1GU8 A;  3SN6 R;  3D4S A;  2M3G A;  5DYS A;  1HZX A;  4N4W A;  1M0K A;  5H2L A;  5BR5 A;  4OV0 A;  4EA3 A;  2I20 A;  1U19 A;  4FPD A;  3ABW A;  2Z73 A;  1P8I A;  3QDC A;  1S52 A;  3VHZ A;  1BRD A;  1M0L A;  4LDL A;  5B35 A;  2WJK A;  1GUE A;  4Y9H A;  1R2N A;  3AM6 A;  3OAX A;  2Y03 A;  4MD1 A;  2R4S A;  2LNL A;  4A4M A;  3QJV B;  2L6X A;  5DHH A;  3BVD B;  1PY6 A;  2VT4 A;  1TN5 A;  4G7Q B;  1JFP A;  1EHK B;  3REY A;  5G2A A;  5JJE A;  2F93 A;  5A45 A;  2ZZL A;  4FBZ A;  1VGO A;  4UG2 A;  1X0I 1;  5G53 A;  1QHJ A;  3HAQ A;  4MQT A;  2NTU A;  3MBV A;  4NC3 A;  2Y04 A;  4HWL A;  3S3D B;  5A44 A;  5G28 A;  4QI1 A;  2EI4 A;  4K5Y A;  2PED A;  4G72 B;  1PXR A;  4DJH A;  1DZE A;  4BEY A;  3QJR B;  3S8F B;  4G71 B;  4BUO A;  3WQJ A;  5JJJ A;  4AMJ A;  4FA7 B;  1E0P A;  1KG8 A;  5LWE A;  3PXO A;  4EIY A;  1C3W A;  5H2N A;  4XTN A;  3EH5 B;  4BWB A;  1BRR A;  5AX0 A;  3C9M A;  3UG9 A;  1L0M A;  3HAS A;  1XJI A;  4JKV A;  4IAQ A;  4LDO A;  3HAP A;  5ITC A;  2YDV A;  5ITE A;  3HAN A;  5TGZ A;  1CWQ A;  4XTL A;  3OE8 A;  3RFM A;  3S3C B;  2KSA A;  1H2S A;  3ZEV A;  3HAR A;  2R4R A;  3AYM A;  3EH4 B;  1VJM A;  3T45 A;  3QJT B;  1QKP A;  3UTW A;  5B6V A;  4KNF A;  4BEZ A;  1JV7 A;  1M0M A;  3ODU A;  4LDE A;  3NY9 A;  3C9L A;  2I1X A;  5F8U A;  1IXF A;  4WAV A;  5KKH A;  3QJU B;  2Y00 A;  1H68 A;  4EJ4 A;  5G2D A;  5H2I A;  1F88 A;  5AHZ A;  5H2P A;  3AYN A;  1P8U A;  4QID A;  5H2J A;  3UON A;  2YCY A;  3S3B B;  1C8R A;  3VGA A;  1IW6 A;  4XT3 A;  1F4Z A;  3VW7 A;  4N4Y B;  4X32 A;  4FAA B;  2YCZ A;  4GYC A;  4HYX A;  4GP5 B;  5G2C A;  5B6Y A;  4GP4 B;  1JV6 A;  5AHY A;  3NY8 A;  1KGB A;  1E12 A;  1R84 A;  4X1H A;  3OE9 A;  4L6R A;  2ZIY A;  1KG9 A;  4BV0 A;  3UTX A;  2Z55 A;  1MGY A;  3VVK A;  3ZPQ A;  1F50 A;  4GBR A;  3VG9 A;  3DDL A;  4TL3 A;  5AZD A;  2KS9 A;  1UAZ A;  1LN6 A;  1TN0 A;  1FBK A;  1GZM A;  3NYA A;  4DKL A;  3S8G B;  4PXF A;  4XTO A;  3QBG A;  5H2O A;  1UCQ A;  3QBI A;  4G70 B;  1XME B;  2I21 A;  4JR8 A;  4BVN A;  1L9H A;  1BM1 A;  5J7A A;  2RH1 A;  4MQS A;  1X0S A;  4GRV A;  1BRX A;  1S51 A;  1XIO A;  4IAR A;  2Y02 A;  5C1M A;  2JAG A;  3PQR A;  3NS0 A;  3PBL A;  5DHG A;  5G54 A;  2QPE B;  4GP8 B;  1Q5I A;  1S8L A;  3KJ6 A;  4J4Q A;  3ZPR A;  5B0W A;  4WW3 A;  2G87 A;  3OE6 A;  4G7S B;  5EN0 A;  4KLY A;  2KSB A;  1O0A A;  3VI0 A;  4MBS A;  3EML A;  3CAP A;  4X31 A;  1QKO A;  3QAP A;  1IW9 A;  2YCX A;  5AWZ A;  1QM8 A;  4XT1 A;  2Y01 A;  5H2H A;  3UTY A;  4IB4 A;  2HPY A;  5B6X A;  5JJN A;  1JGJ A;  1AP9 A;  3A7K A;  5B2N A;  4DS7 E;  5BR2 A;  4GPO A;  3QBL A;  3PDS A;  5AX1 A;  4DAJ A;  3V2Y A;  3OE0 A;  5B6Z A;  2NTW A;  4UHR A;  5A8E A;  3X3B A;  2WJL A;  5G36 A;  1AT9 A;  2YDO A;  5ETZ A;  3UTV A;  3NSB A;  5B6W A;  3RZE A;  1P8H A;  1PXS A;  1S54 A;  1X0K 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...