3X3BA

Crystal structure of the light-driven sodium pump kr2 in acidic state
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
271
structure length
271
Chain Sequence
LGNANFENFIGATEGFSEIAYQFTSHILTLGYAVMLAGLLYFILTIKNVDKKFQMSNILSAVVMVSAFLLLYAQAQNWTSSFTFNEEVGRYFLDPSGDLFNNGYRYLNWLIDVPMLLFQILFVVSLTTSKFSSVRNQFWFSGAMMIITGYIGQFYEVSNLTAFLVWGAISSAFFFHILWVMKKVINEGKEGISPAGQKILSNIWILFLISWTLYPGAYLMPYLTGVDGFLYSEDGVMARQLVYTIADVSSKVIYGVLLGNLAITLSKNKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium pumping rhodopsin
publication title Structural basis for Na(+) transport mechanism by a light-driven Na(+) pump
pubmed doi rcsb
source organism Dokdonia eikasta
total genus 114
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3x3bA00
3C9MA 2R4SA 2Y01A 2Y00A 3OE9A 4N4YB 4EA3A 2AT9A 2M3GA 3ODUA 3QBGA 5TGZA 4PXFA 5FJGA 3WQJA 5H2IA 4MQTA 2J4YA 3T45A 3VHZA 4GYCA 1FBKA 4FPDA 5EN0A 3QAPA 2KSYA 1XJIA 3PBLA 3QBKA 1QKPA 3DQBA 2NTWA 2YDOA 5A8EA 2X72A 4J4QA 1JV6A 3HAPA 1QM8A 3AYNA 4XXJA 4DAJA 1DZEA 3CODA 2I35A 3AM6A 4GRVA 3UTXA 1JGJA 4N6HA 3ZPQA 3PDSA 2I21A 3HARA 3SN6R 1H2SA 3PWHA 4BUOA 4XTOA 3UZAA 4Y9HA 5H2NA 4QI1A 2Y02A 1R2NA 4GP4B 2YCYA 4MQSA 2ZIYA 3S8FB 1F88A 1L9HA 2HPYA 5H2KA 1M0MA 1P8UA 3UONA 4L6RA 4LDEA 4MD2A 2YCZA 5C1MA 5ETZA 4JQ6A 4G70B 1X0I1 3ABWA 2EI4A 1IW6A 1QKOA 2KS9A 5G36A 2WJLA 5H2LA 1VJMA 4FA7B 4WAVA 3V2WA 4XT1A 1KG9A 1GU8A 4HYJA 4GPOA 4N4WA 3EH5B 3UTVA 3DDLA 4K5YA 1O0AA 1XMEB 2KSBA 4LDLA 4UHRA 4KNFA 3C9LA 4XT3A 3NS0A 1P8HA 4G71B 4IB4A 3QJRB 4X1HA 3CAPA 5AHYA 4G7RB 1KMEA 4A4MA 3BVDB 4MD1A 2F93A 5DHHA 4IAQA 5AX0A 4BVNA 1E0PA 3OE8A 4HYXA 3ZEVA 4BWBA 2YDVA 2YCWA 5H2OA 4OV0A 4GBRA 1GUEA 1BM1A 2Y03A 3S3DB 1HZXA 1C8SA 1F4ZA 5AX1A 3QBIA 4L35A 1U19A 3HASA 1Q5IA 4FAAB 2L6XA 5JJNA 3QJQB 3NY9A 5DYSA 5H2HA 5ITCA 2YCXA 1C3WA 2PEDA 2BRDA 1CWQA 3OE0A 1JV7A 1PXRA 3QJUB 5G2CA 1BRRA 4BEZA 2G87A 5B34A 1AP9A 2WJKA 3EMLA 2F95A 1P8IA 3VGAA 5B6YA 4LDOA 2I1XA 1Q5JA 2QPDB 5B6WA 1H68A 5G28A 1PY6A 3QJVB 4HWLA 3OE6A 5B35A 1UAZA 3D4SA 4JR8A 3UTYA 3QAKA 5H2JA 3V2YA 4G7SB 1BRXA 5BR2A 1L0MA 1LN6A 2I20A 1S8LA 3S3BB 3QBLA 2QPEB 4FBZA 1C8RA 3QDCA 4WW3A 3X3CA 1BRDA 4KLYA 1X0SA 2KSAA 2VT4A 5KKHA 3VVKA 1IXFA 3PQRA 4AMJA 3RFMA 5A44A 4QRYA 1KGBA 3UG9A 1FBBA 5H2MA 4X32A 1S51A 3MBVA 4XTLA 4G7QB 5H2PA 1AT9A 4TL3A 4GP5B 5AWZA 4DKLA 5ITEA 1S8JA 1E12A 3HANA 4IARA 4BEYA 4NC3A 2LNLA 2JAGA 1M0LA 2JAFA 1X0K1 1S52A 4X31A 2ZFEA 3RZEA 4EIYA 3X3BA 5B0WA 4BV0A 1TN0A 5DHGA 3P0GA 3ZPRA 1GZMA 2R4RA 4JKVA 5G2AA 5J7AA 4GP8B 5B2NA 1XIOA 4XTNA 5F8UA 3HAQA 1F50A 5LWEA 2RH1A 5G2DA 1QHJA 3NYAA 3EH3B 1UCQA 4QIDA 4PXKA 3VW7A 1TN5A 1EHKB 1S54A 5B6XA 2ZZLA 5JJEA 3HAOA 1R84A 4EJ4A 5AHZA 4AMIA 3NSBA 3PXOA 4G72B 2Z73A 2NTUA 3QJTB 1S53A 4MBSA 5G53A 1PXSA 1IW9A 1VGOA 3A7KA 4DJHA 2Z55A 3OAXA 3S3CB 1KG8A 1M0KA 3UTWA 5B6VA 5BR5A 3QJSB 1MGYA 3VG9A 5B6ZA 4UG2A 1JFPA 3COCA 5G54A 3S8GB 3EH4B 3AYMA 5AZDA 5JJJA 3NY8A 3UZCA 2Y04A 3VI0A 5A45A 3REYA 3KJ6A
chains in the Genus database with same CATH superfamily
3C9MA 2R4SA 2Y01A 2Y00A 3OE9A 4N4YB 4EA3A 2AT9A 2M3GA 3ODUA 3QBGA 5TGZA 4PXFA 5FJGA 3WQJA 5H2IA 4MQTA 2J4YA 3T45A 3VHZA 4GYCA 1FBKA 4FPDA 5EN0A 3QAPA 2KSYA 1XJIA 3PBLA 3QBKA 1QKPA 3DQBA 2NTWA 2YDOA 5A8EA 2X72A 4J4QA 1JV6A 3HAPA 1QM8A 3AYNA 4XXJA 4DAJA 1DZEA 3CODA 2I35A 3AM6A 4GRVA 3UTXA 1JGJA 4N6HA 3ZPQA 3PDSA 2I21A 3HARA 3SN6R 1H2SA 3PWHA 4BUOA 4XTOA 3UZAA 4Y9HA 5H2NA 4QI1A 2Y02A 1R2NA 4GP4B 2YCYA 4MQSA 2ZIYA 3S8FB 1F88A 1L9HA 2HPYA 5H2KA 1M0MA 1P8UA 3UONA 4L6RA 4LDEA 4MD2A 2YCZA 5C1MA 5ETZA 4JQ6A 4G70B 1X0I1 3ABWA 2EI4A 1IW6A 1QKOA 2KS9A 5G36A 2WJLA 5H2LA 1VJMA 4FA7B 4WAVA 3V2WA 4XT1A 1KG9A 1GU8A 4HYJA 4GPOA 4N4WA 3EH5B 3UTVA 3DDLA 4K5YA 1O0AA 1XMEB 2KSBA 4LDLA 4UHRA 4KNFA 3C9LA 4XT3A 3NS0A 1P8HA 4G71B 4IB4A 3QJRB 4X1HA 3CAPA 5AHYA 4G7RB 1KMEA 4A4MA 3BVDB 4MD1A 2F93A 5DHHA 4IAQA 5AX0A 4BVNA 1E0PA 3OE8A 4HYXA 3ZEVA 4BWBA 2YDVA 2YCWA 5H2OA 4OV0A 4GBRA 1GUEA 1BM1A 2Y03A 3S3DB 1HZXA 1C8SA 1F4ZA 5AX1A 3QBIA 4L35A 1U19A 3HASA 1Q5IA 4FAAB 2L6XA 5JJNA 3QJQB 3NY9A 5DYSA 5H2HA 5ITCA 2YCXA 1C3WA 2PEDA 2BRDA 1CWQA 3OE0A 1JV7A 1PXRA 3QJUB 5G2CA 1BRRA 4BEZA 2G87A 5B34A 1AP9A 2WJKA 3EMLA 2F95A 1P8IA 3VGAA 5B6YA 4LDOA 2I1XA 1Q5JA 2QPDB 5B6WA 1H68A 5G28A 1PY6A 3QJVB 4HWLA 3OE6A 5B35A 1UAZA 3D4SA 4JR8A 3UTYA 3QAKA 5H2JA 3V2YA 4G7SB 1BRXA 5BR2A 1L0MA 1LN6A 2I20A 1S8LA 3S3BB 3QBLA 2QPEB 4FBZA 1C8RA 3QDCA 4WW3A 3X3CA 1BRDA 4KLYA 1X0SA 2KSAA 2VT4A 5KKHA 3VVKA 1IXFA 3PQRA 4AMJA 3RFMA 5A44A 4QRYA 1KGBA 3UG9A 1FBBA 5H2MA 4X32A 1S51A 3MBVA 4XTLA 4G7QB 5H2PA 1AT9A 4TL3A 4GP5B 5AWZA 4DKLA 5ITEA 1S8JA 1E12A 3HANA 4IARA 4BEYA 4NC3A 2LNLA 2JAGA 1M0LA 2JAFA 1X0K1 1S52A 4X31A 2ZFEA 3RZEA 4EIYA 3X3BA 5B0WA 4BV0A 1TN0A 5DHGA 3P0GA 3ZPRA 1GZMA 2R4RA 4JKVA 5G2AA 5J7AA 4GP8B 5B2NA 1XIOA 4XTNA 5F8UA 3HAQA 1F50A 5LWEA 2RH1A 5G2DA 1QHJA 3NYAA 3EH3B 1UCQA 4QIDA 4PXKA 3VW7A 1TN5A 1EHKB 1S54A 5B6XA 2ZZLA 5JJEA 3HAOA 1R84A 4EJ4A 5AHZA 4AMIA 3NSBA 3PXOA 4G72B 2Z73A 2NTUA 3QJTB 1S53A 4MBSA 5G53A 1PXSA 1IW9A 1VGOA 3A7KA 4DJHA 2Z55A 3OAXA 3S3CB 1KG8A 1M0KA 3UTWA 5B6VA 5BR5A 4DS7E 3QJSB 1MGYA 3VG9A 5B6ZA 4UG2A 1JFPA 3COCA 5G54A 3S8GB 3EH4B 3AYMA 5AZDA 5JJJA 3NY8A 3UZCA 2Y04A 3VI0A 5A45A 3REYA 3KJ6A
chains in the Genus database with same CATH topology
3C9MA 2R4SA 2Y01A 2Y00A 3OE9A 4N4YB 4EA3A 2AT9A 2M3GA 3ODUA 3QBGA 5TGZA 4PXFA 5FJGA 3WQJA 5H2IA 4MQTA 2J4YA 3T45A 3VHZA 4GYCA 1FBKA 4FPDA 5EN0A 3QAPA 2KSYA 1XJIA 3PBLA 3QBKA 1QKPA 3DQBA 2NTWA 2YDOA 5A8EA 2X72A 4J4QA 1JV6A 3HAPA 1QM8A 3AYNA 4XXJA 4DAJA 1DZEA 3CODA 2I35A 3AM6A 4GRVA 3UTXA 1JGJA 4N6HA 3ZPQA 3PDSA 2I21A 3HARA 3SN6R 1H2SA 3PWHA 4BUOA 4XTOA 3UZAA 4Y9HA 5H2NA 4QI1A 2Y02A 1R2NA 4GP4B 2YCYA 4MQSA 2ZIYA 3S8FB 1F88A 1L9HA 2HPYA 5H2KA 1M0MA 1P8UA 3UONA 4L6RA 4LDEA 4MD2A 2YCZA 5C1MA 5ETZA 4JQ6A 4G70B 1X0I1 3ABWA 2EI4A 1IW6A 1QKOA 2KS9A 5G36A 2WJLA 5H2LA 1VJMA 4FA7B 4WAVA 3V2WA 4XT1A 1KG9A 1GU8A 4HYJA 4GPOA 4N4WA 3EH5B 3UTVA 3DDLA 4K5YA 1O0AA 1XMEB 2KSBA 4LDLA 4UHRA 4KNFA 3C9LA 4XT3A 3NS0A 1P8HA 4G71B 4IB4A 3QJRB 4X1HA 3CAPA 5AHYA 4G7RB 1KMEA 4A4MA 3BVDB 4MD1A 2F93A 5DHHA 4IAQA 5AX0A 4BVNA 1E0PA 3OE8A 4HYXA 3ZEVA 4BWBA 2YDVA 2YCWA 5H2OA 4OV0A 4GBRA 1GUEA 1BM1A 2Y03A 3S3DB 1HZXA 1C8SA 1F4ZA 5AX1A 3QBIA 4L35A 1U19A 3HASA 1Q5IA 4FAAB 2L6XA 5JJNA 3QJQB 3NY9A 5DYSA 5H2HA 5ITCA 2YCXA 1C3WA 2PEDA 2BRDA 1CWQA 3OE0A 1JV7A 1PXRA 3QJUB 5G2CA 1BRRA 4BEZA 2G87A 5B34A 1AP9A 2WJKA 3EMLA 2F95A 1P8IA 3VGAA 5B6YA 4LDOA 2I1XA 1Q5JA 2QPDB 5B6WA 1H68A 5G28A 1PY6A 3QJVB 4HWLA 3OE6A 5B35A 1UAZA 3D4SA 4JR8A 3UTYA 3QAKA 5H2JA 3V2YA 4G7SB 1BRXA 5BR2A 1L0MA 1LN6A 2I20A 1S8LA 3S3BB 3QBLA 2QPEB 4FBZA 1C8RA 3QDCA 4WW3A 3X3CA 1BRDA 4KLYA 1X0SA 2KSAA 2VT4A 5KKHA 3VVKA 1IXFA 3PQRA 4AMJA 3RFMA 5A44A 4QRYA 1KGBA 3UG9A 1FBBA 5H2MA 4X32A 1S51A 3MBVA 4XTLA 4G7QB 5H2PA 1AT9A 4TL3A 4GP5B 5AWZA 4DKLA 5ITEA 1S8JA 1E12A 3HANA 4IARA 4BEYA 4NC3A 2LNLA 2JAGA 1M0LA 2JAFA 1X0K1 1S52A 4X31A 2ZFEA 3RZEA 4EIYA 3X3BA 5B0WA 4BV0A 1TN0A 5DHGA 3P0GA 3ZPRA 1GZMA 2R4RA 4JKVA 5G2AA 5J7AA 4GP8B 5B2NA 1XIOA 4XTNA 5F8UA 3HAQA 1F50A 5LWEA 2RH1A 5G2DA 1QHJA 3NYAA 3EH3B 1UCQA 4QIDA 4PXKA 3VW7A 1TN5A 1EHKB 1S54A 5B6XA 2ZZLA 5JJEA 3HAOA 1R84A 4EJ4A 5AHZA 4AMIA 3NSBA 3PXOA 4G72B 2Z73A 2NTUA 3QJTB 1S53A 4MBSA 5G53A 1PXSA 1IW9A 1VGOA 3A7KA 4DJHA 2Z55A 3OAXA 3S3CB 1KG8A 1M0KA 3UTWA 5B6VA 5BR5A 4DS7E 3QJSB 1MGYA 3VG9A 5B6ZA 4UG2A 1JFPA 3COCA 5G54A 3S8GB 3EH4B 3AYMA 5AZDA 5JJJA 3NY8A 3UZCA 2Y04A 3VI0A 5A45A 3REYA 3KJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9M A;  2R4S A;  2Y01 A;  2Y00 A;  3OE9 A;  4N4Y B;  4EA3 A;  2AT9 A;  2M3G A;  3ODU A;  3QBG A;  5TGZ A;  4PXF A;  5FJG A;  3WQJ A;  5H2I A;  4MQT A;  2J4Y A;  3T45 A;  3VHZ A;  4GYC A;  1FBK A;  4FPD A;  5EN0 A;  3QAP A;  2KSY A;  1XJI A;  3PBL A;  3QBK A;  1QKP A;  3DQB A;  2NTW A;  2YDO A;  5A8E A;  2X72 A;  4J4Q A;  1JV6 A;  3HAP A;  1QM8 A;  3AYN A;  4XXJ A;  4DAJ A;  1DZE A;  3COD A;  2I35 A;  3AM6 A;  4GRV A;  3UTX A;  1JGJ A;  4N6H A;  3ZPQ A;  3PDS A;  2I21 A;  3HAR A;  3SN6 R;  1H2S A;  3PWH A;  4BUO A;  4XTO A;  3UZA A;  4Y9H A;  5H2N A;  4QI1 A;  2Y02 A;  1R2N A;  4GP4 B;  2YCY A;  4MQS A;  2ZIY A;  3S8F B;  1F88 A;  1L9H A;  2HPY A;  5H2K A;  1M0M A;  1P8U A;  3UON A;  4L6R A;  4LDE A;  4MD2 A;  2YCZ A;  5C1M A;  5ETZ A;  4JQ6 A;  4G70 B;  1X0I 1;  3ABW A;  2EI4 A;  1IW6 A;  1QKO A;  2KS9 A;  5G36 A;  2WJL A;  5H2L A;  1VJM A;  4FA7 B;  4WAV A;  3V2W A;  4XT1 A;  1KG9 A;  1GU8 A;  4HYJ A;  4GPO A;  4N4W A;  3EH5 B;  3UTV A;  3DDL A;  4K5Y A;  1O0A A;  1XME B;  2KSB A;  4LDL A;  4UHR A;  4KNF A;  3C9L A;  4XT3 A;  3NS0 A;  1P8H A;  4G71 B;  4IB4 A;  3QJR B;  4X1H A;  3CAP A;  5AHY A;  4G7R B;  1KME A;  4A4M A;  3BVD B;  4MD1 A;  2F93 A;  5DHH A;  4IAQ A;  5AX0 A;  4BVN A;  1E0P A;  3OE8 A;  4HYX A;  3ZEV A;  4BWB A;  2YDV A;  2YCW A;  5H2O A;  4OV0 A;  4GBR A;  1GUE A;  1BM1 A;  2Y03 A;  3S3D B;  1HZX A;  1C8S A;  1F4Z A;  5AX1 A;  3QBI A;  4L35 A;  1U19 A;  3HAS A;  1Q5I A;  4FAA B;  2L6X A;  5JJN A;  3QJQ B;  3NY9 A;  5DYS A;  5H2H A;  5ITC A;  2YCX A;  1C3W A;  2PED A;  2BRD A;  1CWQ A;  3OE0 A;  1JV7 A;  1PXR A;  3QJU B;  5G2C A;  1BRR A;  4BEZ A;  2G87 A;  5B34 A;  1AP9 A;  2WJK A;  3EML A;  2F95 A;  1P8I A;  3VGA A;  5B6Y A;  4LDO A;  2I1X A;  1Q5J A;  2QPD B;  5B6W A;  1H68 A;  5G28 A;  1PY6 A;  3QJV B;  4HWL A;  3OE6 A;  5B35 A;  1UAZ A;  3D4S A;  4JR8 A;  3UTY A;  3QAK A;  5H2J A;  3V2Y A;  4G7S B;  1BRX A;  5BR2 A;  1L0M A;  1LN6 A;  2I20 A;  1S8L A;  3S3B B;  3QBL A;  2QPE B;  4FBZ A;  1C8R A;  3QDC A;  4WW3 A;  3X3C A;  1BRD A;  4KLY A;  1X0S A;  2KSA A;  2VT4 A;  5KKH A;  3VVK A;  1IXF A;  3PQR A;  4AMJ A;  3RFM A;  5A44 A;  4QRY A;  1KGB A;  3UG9 A;  1FBB A;  5H2M A;  4X32 A;  1S51 A;  3MBV A;  4XTL A;  4G7Q B;  5H2P A;  1AT9 A;  4TL3 A;  4GP5 B;  5AWZ A;  4DKL A;  5ITE A;  1S8J A;  1E12 A;  3HAN A;  4IAR A;  4BEY A;  4NC3 A;  2LNL A;  2JAG A;  1M0L A;  2JAF A;  1X0K 1;  1S52 A;  4X31 A;  2ZFE A;  3RZE A;  4EIY A;  3X3B A;  5B0W A;  4BV0 A;  1TN0 A;  5DHG A;  3P0G A;  3ZPR A;  1GZM A;  2R4R A;  4JKV A;  5G2A A;  5J7A A;  4GP8 B;  5B2N A;  1XIO A;  4XTN A;  5F8U A;  3HAQ A;  1F50 A;  5LWE A;  2RH1 A;  5G2D A;  1QHJ A;  3NYA A;  3EH3 B;  1UCQ A;  4QID A;  4PXK A;  3VW7 A;  1TN5 A;  1EHK B;  1S54 A;  5B6X A;  2ZZL A;  5JJE A;  3HAO A;  1R84 A;  4EJ4 A;  5AHZ A;  4AMI A;  3NSB A;  3PXO A;  4G72 B;  2Z73 A;  2NTU A;  3QJT B;  1S53 A;  4MBS A;  5G53 A;  1PXS A;  1IW9 A;  1VGO A;  3A7K A;  4DJH A;  2Z55 A;  3OAX A;  3S3C B;  1KG8 A;  1M0K A;  3UTW A;  5B6V A;  5BR5 A;  3QJS B;  1MGY A;  3VG9 A;  5B6Z A;  4UG2 A;  1JFP A;  3COC A;  5G54 A;  3S8G B;  3EH4 B;  3AYM A;  5AZD A;  5JJJ A;  3NY8 A;  3UZC A;  2Y04 A;  3VI0 A;  5A45 A;  3REY A;  3KJ6 A; 
#chains in the Genus database with same CATH topology
 3C9M A;  2R4S A;  2Y01 A;  2Y00 A;  3OE9 A;  4N4Y B;  4EA3 A;  2AT9 A;  2M3G A;  3ODU A;  3QBG A;  5TGZ A;  4PXF A;  5FJG A;  3WQJ A;  5H2I A;  4MQT A;  2J4Y A;  3T45 A;  3VHZ A;  4GYC A;  1FBK A;  4FPD A;  5EN0 A;  3QAP A;  2KSY A;  1XJI A;  3PBL A;  3QBK A;  1QKP A;  3DQB A;  2NTW A;  2YDO A;  5A8E A;  2X72 A;  4J4Q A;  1JV6 A;  3HAP A;  1QM8 A;  3AYN A;  4XXJ A;  4DAJ A;  1DZE A;  3COD A;  2I35 A;  3AM6 A;  4GRV A;  3UTX A;  1JGJ A;  4N6H A;  3ZPQ A;  3PDS A;  2I21 A;  3HAR A;  3SN6 R;  1H2S A;  3PWH A;  4BUO A;  4XTO A;  3UZA A;  4Y9H A;  5H2N A;  4QI1 A;  2Y02 A;  1R2N A;  4GP4 B;  2YCY A;  4MQS A;  2ZIY A;  3S8F B;  1F88 A;  1L9H A;  2HPY A;  5H2K A;  1M0M A;  1P8U A;  3UON A;  4L6R A;  4LDE A;  4MD2 A;  2YCZ A;  5C1M A;  5ETZ A;  4JQ6 A;  4G70 B;  1X0I 1;  3ABW A;  2EI4 A;  1IW6 A;  1QKO A;  2KS9 A;  5G36 A;  2WJL A;  5H2L A;  1VJM A;  4FA7 B;  4WAV A;  3V2W A;  4XT1 A;  1KG9 A;  1GU8 A;  4HYJ A;  4GPO A;  4N4W A;  3EH5 B;  3UTV A;  3DDL A;  4K5Y A;  1O0A A;  1XME B;  2KSB A;  4LDL A;  4UHR A;  4KNF A;  3C9L A;  4XT3 A;  3NS0 A;  1P8H A;  4G71 B;  4IB4 A;  3QJR B;  4X1H A;  3CAP A;  5AHY A;  4G7R B;  1KME A;  4A4M A;  3BVD B;  4MD1 A;  2F93 A;  5DHH A;  4IAQ A;  5AX0 A;  4BVN A;  1E0P A;  3OE8 A;  4HYX A;  3ZEV A;  4BWB A;  2YDV A;  2YCW A;  5H2O A;  4OV0 A;  4GBR A;  1GUE A;  1BM1 A;  2Y03 A;  3S3D B;  1HZX A;  1C8S A;  1F4Z A;  5AX1 A;  3QBI A;  4L35 A;  1U19 A;  3HAS A;  1Q5I A;  4FAA B;  2L6X A;  5JJN A;  3QJQ B;  3NY9 A;  5DYS A;  5H2H A;  5ITC A;  2YCX A;  1C3W A;  2PED A;  2BRD A;  1CWQ A;  3OE0 A;  1JV7 A;  1PXR A;  3QJU B;  5G2C A;  1BRR A;  4BEZ A;  2G87 A;  5B34 A;  1AP9 A;  2WJK A;  3EML A;  2F95 A;  1P8I A;  3VGA A;  5B6Y A;  4LDO A;  2I1X A;  1Q5J A;  2QPD B;  5B6W A;  1H68 A;  5G28 A;  1PY6 A;  3QJV B;  4HWL A;  3OE6 A;  5B35 A;  1UAZ A;  3D4S A;  4JR8 A;  3UTY A;  3QAK A;  5H2J A;  3V2Y A;  4G7S B;  1BRX A;  5BR2 A;  1L0M A;  1LN6 A;  2I20 A;  1S8L A;  3S3B B;  3QBL A;  2QPE B;  4FBZ A;  1C8R A;  3QDC A;  4WW3 A;  3X3C A;  1BRD A;  4KLY A;  1X0S A;  2KSA A;  2VT4 A;  5KKH A;  3VVK A;  1IXF A;  3PQR A;  4AMJ A;  3RFM A;  5A44 A;  4QRY A;  1KGB A;  3UG9 A;  1FBB A;  5H2M A;  4X32 A;  1S51 A;  3MBV A;  4XTL A;  4G7Q B;  5H2P A;  1AT9 A;  4TL3 A;  4GP5 B;  5AWZ A;  4DKL A;  5ITE A;  1S8J A;  1E12 A;  3HAN A;  4IAR A;  4BEY A;  4NC3 A;  2LNL A;  2JAG A;  1M0L A;  2JAF A;  1X0K 1;  1S52 A;  4X31 A;  2ZFE A;  3RZE A;  4EIY A;  3X3B A;  5B0W A;  4BV0 A;  1TN0 A;  5DHG A;  3P0G A;  3ZPR A;  1GZM A;  2R4R A;  4JKV A;  5G2A A;  5J7A A;  4GP8 B;  5B2N A;  1XIO A;  4XTN A;  5F8U A;  3HAQ A;  1F50 A;  5LWE A;  2RH1 A;  5G2D A;  1QHJ A;  3NYA A;  3EH3 B;  1UCQ A;  4QID A;  4PXK A;  3VW7 A;  1TN5 A;  1EHK B;  1S54 A;  5B6X A;  2ZZL A;  5JJE A;  3HAO A;  1R84 A;  4EJ4 A;  5AHZ A;  4AMI A;  3NSB A;  3PXO A;  4G72 B;  2Z73 A;  2NTU A;  3QJT B;  1S53 A;  4MBS A;  5G53 A;  1PXS A;  1IW9 A;  1VGO A;  3A7K A;  4DJH A;  2Z55 A;  3OAX A;  3S3C B;  1KG8 A;  1M0K A;  3UTW A;  5B6V A;  5BR5 A;  4DS7 E;  3QJS B;  1MGY A;  3VG9 A;  5B6Z A;  4UG2 A;  1JFP A;  3COC A;  5G54 A;  3S8G B;  3EH4 B;  3AYM A;  5AZD A;  5JJJ A;  3NY8 A;  3UZC A;  2Y04 A;  3VI0 A;  5A45 A;  3REY A;  3KJ6 A; 
#chains in the Genus database with same CATH homology
 3C9M A;  2R4S A;  2Y01 A;  2Y00 A;  3OE9 A;  4N4Y B;  4EA3 A;  2AT9 A;  2M3G A;  3ODU A;  3QBG A;  5TGZ A;  4PXF A;  5FJG A;  3WQJ A;  5H2I A;  4MQT A;  2J4Y A;  3T45 A;  3VHZ A;  4GYC A;  1FBK A;  4FPD A;  5EN0 A;  3QAP A;  2KSY A;  1XJI A;  3PBL A;  3QBK A;  1QKP A;  3DQB A;  2NTW A;  2YDO A;  5A8E A;  2X72 A;  4J4Q A;  1JV6 A;  3HAP A;  1QM8 A;  3AYN A;  4XXJ A;  4DAJ A;  1DZE A;  3COD A;  2I35 A;  3AM6 A;  4GRV A;  3UTX A;  1JGJ A;  4N6H A;  3ZPQ A;  3PDS A;  2I21 A;  3HAR A;  3SN6 R;  1H2S A;  3PWH A;  4BUO A;  4XTO A;  3UZA A;  4Y9H A;  5H2N A;  4QI1 A;  2Y02 A;  1R2N A;  4GP4 B;  2YCY A;  4MQS A;  2ZIY A;  3S8F B;  1F88 A;  1L9H A;  2HPY A;  5H2K A;  1M0M A;  1P8U A;  3UON A;  4L6R A;  4LDE A;  4MD2 A;  2YCZ A;  5C1M A;  5ETZ A;  4JQ6 A;  4G70 B;  1X0I 1;  3ABW A;  2EI4 A;  1IW6 A;  1QKO A;  2KS9 A;  5G36 A;  2WJL A;  5H2L A;  1VJM A;  4FA7 B;  4WAV A;  3V2W A;  4XT1 A;  1KG9 A;  1GU8 A;  4HYJ A;  4GPO A;  4N4W A;  3EH5 B;  3UTV A;  3DDL A;  4K5Y A;  1O0A A;  1XME B;  2KSB A;  4LDL A;  4UHR A;  4KNF A;  3C9L A;  4XT3 A;  3NS0 A;  1P8H A;  4G71 B;  4IB4 A;  3QJR B;  4X1H A;  3CAP A;  5AHY A;  4G7R B;  1KME A;  4A4M A;  3BVD B;  4MD1 A;  2F93 A;  5DHH A;  4IAQ A;  5AX0 A;  4BVN A;  1E0P A;  3OE8 A;  4HYX A;  3ZEV A;  4BWB A;  2YDV A;  2YCW A;  5H2O A;  4OV0 A;  4GBR A;  1GUE A;  1BM1 A;  2Y03 A;  3S3D B;  1HZX A;  1C8S A;  1F4Z A;  5AX1 A;  3QBI A;  4L35 A;  1U19 A;  3HAS A;  1Q5I A;  4FAA B;  2L6X A;  5JJN A;  3QJQ B;  3NY9 A;  5DYS A;  5H2H A;  5ITC A;  2YCX A;  1C3W A;  2PED A;  2BRD A;  1CWQ A;  3OE0 A;  1JV7 A;  1PXR A;  3QJU B;  5G2C A;  1BRR A;  4BEZ A;  2G87 A;  5B34 A;  1AP9 A;  2WJK A;  3EML A;  2F95 A;  1P8I A;  3VGA A;  5B6Y A;  4LDO A;  2I1X A;  1Q5J A;  2QPD B;  5B6W A;  1H68 A;  5G28 A;  1PY6 A;  3QJV B;  4HWL A;  3OE6 A;  5B35 A;  1UAZ A;  3D4S A;  4JR8 A;  3UTY A;  3QAK A;  5H2J A;  3V2Y A;  4G7S B;  1BRX A;  5BR2 A;  1L0M A;  1LN6 A;  2I20 A;  1S8L A;  3S3B B;  3QBL A;  2QPE B;  4FBZ A;  1C8R A;  3QDC A;  4WW3 A;  3X3C A;  1BRD A;  4KLY A;  1X0S A;  2KSA A;  2VT4 A;  5KKH A;  3VVK A;  1IXF A;  3PQR A;  4AMJ A;  3RFM A;  5A44 A;  4QRY A;  1KGB A;  3UG9 A;  1FBB A;  5H2M A;  4X32 A;  1S51 A;  3MBV A;  4XTL A;  4G7Q B;  5H2P A;  1AT9 A;  4TL3 A;  4GP5 B;  5AWZ A;  4DKL A;  5ITE A;  1S8J A;  1E12 A;  3HAN A;  4IAR A;  4BEY A;  4NC3 A;  2LNL A;  2JAG A;  1M0L A;  2JAF A;  1X0K 1;  1S52 A;  4X31 A;  2ZFE A;  3RZE A;  4EIY A;  3X3B A;  5B0W A;  4BV0 A;  1TN0 A;  5DHG A;  3P0G A;  3ZPR A;  1GZM A;  2R4R A;  4JKV A;  5G2A A;  5J7A A;  4GP8 B;  5B2N A;  1XIO A;  4XTN A;  5F8U A;  3HAQ A;  1F50 A;  5LWE A;  2RH1 A;  5G2D A;  1QHJ A;  3NYA A;  3EH3 B;  1UCQ A;  4QID A;  4PXK A;  3VW7 A;  1TN5 A;  1EHK B;  1S54 A;  5B6X A;  2ZZL A;  5JJE A;  3HAO A;  1R84 A;  4EJ4 A;  5AHZ A;  4AMI A;  3NSB A;  3PXO A;  4G72 B;  2Z73 A;  2NTU A;  3QJT B;  1S53 A;  4MBS A;  5G53 A;  1PXS A;  1IW9 A;  1VGO A;  3A7K A;  4DJH A;  2Z55 A;  3OAX A;  3S3C B;  1KG8 A;  1M0K A;  3UTW A;  5B6V A;  5BR5 A;  4DS7 E;  3QJS B;  1MGY A;  3VG9 A;  5B6Z A;  4UG2 A;  1JFP A;  3COC A;  5G54 A;  3S8G B;  3EH4 B;  3AYM A;  5AZD A;  5JJJ A;  3NY8 A;  3UZC A;  2Y04 A;  3VI0 A;  5A45 A;  3REY A;  3KJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...