3ZPQA

Thermostabilised turkey beta1 adrenergic receptor with 4-(piperazin-1- yl)-1h-indole bound (compound 19)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
299
structure length
287
Chain Sequence
GAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords BETA-1 ADRENERGIC RECEPTOR
publication title Biophysical Fragment Screening of the Beta1-Adrenergic Receptor: Identification of High Affinity Aryl Piperazine Leads Using Structure-Based Drug Design.
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 126
structure length 287
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3zpqA00
5H2LA 4PXFA 2I21A 3VI0A 4MQSA 3HANA 2I35A 1M0KA 2R4SA 3QJQB 3S3BB 3VVKA 4GBRA 3EMLA 3QJUB 2G87A 5B6ZA 1BRXA 4GYCA 3NS0A 5G54A 3ZPQA 5B6YA 3RZEA 4HYJA 4G70B 3VG9A 3S3CB 3AYMA 5JJJA 3REYA 1AT9A 4EJ4A 4GP4B 2AT9A 1TN5A 3V2YA 5A8EA 2PEDA 3UTXA 4FBZA 2KSYA 1C8SA 3ZEVA 3PWHA 3DQBA 1P8HA 4XTLA 5G2DA 4J4QA 3NY8A 1M0MA 4WW3A 3NSBA 5H2PA 3UTYA 3CAPA 5TGZA 2QPDB 5ITCA 5FJGA 5B6XA 2Y02A 3DDLA 3QDCA 5BR5A 5BR2A 4QRYA 5B2NA 5B34A 5KKHA 2F93A 5AZDA 1S53A 1S51A 3EH3B 2VT4A 1F88A 1R84A 4G71B 2YCZA 3EH4B 1JV6A 4BEZA 1F4ZA 3UTWA 3ODUA 5JJEA 3OE0A 2M3GA 2RH1A 1XIOA 1QM8A 2KS9A 4KLYA 3AM6A 4XXJA 4N4WA 3UZAA 3EH5B 4GP5B 4QIDA 4A4MA 2Y04A 3C9MA 1JGJA 4LDLA 1KG8A 3V2WA 4G7RB 1C8RA 4BVNA 4X32A 1F50A 3S3DB 4JR8A 5DHHA 5AWZA 3S8FB 2NTWA 1TN0A 3T45A 1KGBA 3QAKA 4FA7B 2ZZLA 1R2NA 3HARA 3OE8A 3OE9A 4NC3A 3ZPRA 5AHZA 3PQRA 3QJVB 1BRRA 4LDOA 3QJTB 1FBKA 4G7SB 2ZFEA 5DHGA 3RFMA 4IAQA 1PY6A 3KJ6A 4AMJA 3MBVA 5G2AA 1BRDA 4BEYA 4L6RA 1LN6A 4WAVA 1Q5IA 2Y03A 1UAZA 1XJIA 4QI1A 1S54A 2LNLA 3ABWA 4HYXA 2WJKA 4Y9HA 3NY9A 1C3WA 3UG9A 3OAXA 1KMEA 2JAGA 3UTVA 1FBBA 4GPOA 3QBKA 1O0AA 3AYNA 4MD2A 2R4RA 4PXKA 2Y00A 4N6HA 4X31A 4GP8B 5B6VA 3X3BA 5H2JA 1L9HA 5F8UA 1X0SA 3PXOA 4EA3A 3HAOA 3HAQA 5H2MA 1HZXA 1VGOA 1U19A 3OE6A 1DZEA 5EN0A 2KSBA 5G2CA 3UONA 1IW6A 4MD1A 4AMIA 5H2NA 2YDVA 4HWLA 4IB4A 4G7QB 3WQJA 2YCWA 4JKVA 1JV7A 5G36A 3C9LA 1UCQA 1BM1A 2I1XA 1X0K1 3QAPA 4FPDA 1PXRA 3CODA 5H2KA 1JFPA 1EHKB 5J7AA 4IARA 3X3CA 2KSAA 5ITEA 1P8IA 1QKPA 5JJNA 2Z73A 2ZIYA 2WJLA 5AHYA 3A7KA 2NTUA 1XMEB 1AP9A 5B0WA 5DYSA 5LWEA 1E12A 1H2SA 1S8JA 2YDOA 3VGAA 2YCYA 3S8GB 4EIYA 4XT1A 3HAPA 4K5YA 2QPEB 3QJRB 1IXFA 4KNFA 2Z55A 4FAAB 1GUEA 4XT3A 5H2OA 1KG9A 4BUOA 2F95A 3HASA 3PBLA 5H2IA 4BWBA 2I20A 5B6WA 5G28A 1S8LA 1PXSA 4X1HA 3QBGA 1P8UA 4XTOA 1VJMA 5H2HA 3COCA 3VW7A 4TL3A 4DJHA 2Y01A 1QHJA 3SN6R 2X72A 2BRDA 2EI4A 4DAJA 4MBSA 1CWQA 1GZMA 4L35A 4GRVA 5ETZA 2J4YA 4OV0A 3VHZA 4G72B 4MQTA 5A44A 1MGYA 1S52A 1H68A 5B35A 3PDSA 1QKOA 3UZCA 1M0LA 3QBLA 1IW9A 5C1MA 3P0GA 3QJSB 4DKLA 1L0MA 1Q5JA 1X0I1 4UG2A 3D4SA 5G53A 1GU8A 1E0PA 2YCXA 2HPYA 5A45A 4LDEA 2JAFA 3QBIA 5AX0A 4JQ6A 4BV0A 4N4YB 4UHRA 5AX1A 2L6XA 4XTNA 3NYAA 3BVDB
chains in the Genus database with same CATH superfamily
5H2LA 4PXFA 2I21A 3VI0A 4MQSA 3HANA 2I35A 1M0KA 2R4SA 3QJQB 3S3BB 3VVKA 4GBRA 3EMLA 3QJUB 2G87A 4DS7E 5B6ZA 1BRXA 4GYCA 3NS0A 5G54A 3ZPQA 5B6YA 3RZEA 4HYJA 4G70B 3VG9A 3S3CB 3AYMA 5JJJA 3REYA 1AT9A 4EJ4A 4GP4B 2AT9A 1TN5A 3V2YA 5A8EA 2PEDA 3UTXA 4FBZA 2KSYA 1C8SA 3ZEVA 3PWHA 3DQBA 1P8HA 4XTLA 5G2DA 4J4QA 3NY8A 1M0MA 4WW3A 3NSBA 5H2PA 3UTYA 3CAPA 5TGZA 2QPDB 5ITCA 5FJGA 5B6XA 2Y02A 3DDLA 3QDCA 5BR5A 5BR2A 4QRYA 5B2NA 5B34A 5KKHA 2F93A 5AZDA 1S53A 1S51A 3EH3B 2VT4A 1F88A 1R84A 4G71B 2YCZA 3EH4B 1JV6A 4BEZA 1F4ZA 3UTWA 3ODUA 5JJEA 3OE0A 2M3GA 2RH1A 1XIOA 1QM8A 2KS9A 4KLYA 3AM6A 4XXJA 4N4WA 3UZAA 3EH5B 4GP5B 4QIDA 4A4MA 2Y04A 3C9MA 1JGJA 4LDLA 1KG8A 3V2WA 4G7RB 1C8RA 4BVNA 4X32A 1F50A 3S3DB 4JR8A 5DHHA 5AWZA 3S8FB 2NTWA 1TN0A 3T45A 1KGBA 3QAKA 4FA7B 2ZZLA 1R2NA 3HARA 3OE8A 3OE9A 4NC3A 3ZPRA 5AHZA 3PQRA 3QJVB 1BRRA 4LDOA 3QJTB 1FBKA 4G7SB 2ZFEA 5DHGA 3RFMA 4IAQA 1PY6A 3KJ6A 4AMJA 3MBVA 5G2AA 1BRDA 4BEYA 4L6RA 1LN6A 4WAVA 1Q5IA 2Y03A 1UAZA 1XJIA 4QI1A 1S54A 2LNLA 3ABWA 4HYXA 2WJKA 4Y9HA 3NY9A 1C3WA 3UG9A 3OAXA 1KMEA 2JAGA 3UTVA 1FBBA 4GPOA 3QBKA 1O0AA 3AYNA 4MD2A 2R4RA 4PXKA 2Y00A 4N6HA 4X31A 4GP8B 5B6VA 3X3BA 5H2JA 1L9HA 5F8UA 1X0SA 3PXOA 4EA3A 3HAOA 3HAQA 5H2MA 1HZXA 1VGOA 1U19A 3OE6A 1DZEA 5EN0A 2KSBA 5G2CA 3UONA 1IW6A 4MD1A 4AMIA 5H2NA 2YDVA 4HWLA 4IB4A 4G7QB 3WQJA 2YCWA 4JKVA 1JV7A 5G36A 3C9LA 1UCQA 1BM1A 2I1XA 1X0K1 3QAPA 4FPDA 1PXRA 3CODA 5H2KA 1JFPA 1EHKB 5J7AA 4IARA 3X3CA 2KSAA 5ITEA 1P8IA 1QKPA 5JJNA 2Z73A 2ZIYA 2WJLA 5AHYA 3A7KA 2NTUA 1XMEB 1AP9A 5B0WA 5DYSA 5LWEA 1E12A 1H2SA 1S8JA 2YDOA 3VGAA 2YCYA 3S8GB 4EIYA 4XT1A 3HAPA 4K5YA 2QPEB 3QJRB 1IXFA 4KNFA 2Z55A 4FAAB 1GUEA 4XT3A 5H2OA 1KG9A 4BUOA 2F95A 3HASA 3PBLA 5H2IA 4BWBA 2I20A 5B6WA 5G28A 1S8LA 1PXSA 4X1HA 3QBGA 1P8UA 4XTOA 1VJMA 5H2HA 3COCA 3VW7A 4TL3A 4DJHA 2Y01A 1QHJA 3SN6R 2X72A 2BRDA 2EI4A 4DAJA 4MBSA 1CWQA 1GZMA 4L35A 4GRVA 5ETZA 2J4YA 4OV0A 3VHZA 4G72B 4MQTA 5A44A 1MGYA 1S52A 1H68A 5B35A 3PDSA 1QKOA 3UZCA 1M0LA 3QBLA 1IW9A 5C1MA 3P0GA 3QJSB 4DKLA 1L0MA 1Q5JA 1X0I1 4UG2A 3D4SA 5G53A 1GU8A 1E0PA 2YCXA 2HPYA 5A45A 4LDEA 2JAFA 3QBIA 5AX0A 4JQ6A 4BV0A 4N4YB 4UHRA 5AX1A 2L6XA 4XTNA 3NYAA 3BVDB
chains in the Genus database with same CATH topology
5H2LA 4PXFA 2I21A 3VI0A 4MQSA 3HANA 2I35A 1M0KA 2R4SA 3QJQB 3S3BB 3VVKA 4GBRA 3EMLA 3QJUB 2G87A 4DS7E 5B6ZA 1BRXA 4GYCA 3NS0A 5G54A 3ZPQA 5B6YA 3RZEA 4HYJA 4G70B 3VG9A 3S3CB 3AYMA 5JJJA 3REYA 1AT9A 4EJ4A 4GP4B 2AT9A 1TN5A 3V2YA 5A8EA 2PEDA 3UTXA 4FBZA 2KSYA 1C8SA 3ZEVA 3PWHA 3DQBA 1P8HA 4XTLA 5G2DA 4J4QA 3NY8A 1M0MA 4WW3A 3NSBA 5H2PA 3UTYA 3CAPA 5TGZA 2QPDB 5ITCA 5FJGA 5B6XA 2Y02A 3DDLA 3QDCA 5BR5A 5BR2A 4QRYA 5B2NA 5B34A 5KKHA 2F93A 5AZDA 1S53A 1S51A 3EH3B 2VT4A 1F88A 1R84A 4G71B 2YCZA 3EH4B 1JV6A 4BEZA 1F4ZA 3UTWA 3ODUA 5JJEA 3OE0A 2M3GA 2RH1A 1XIOA 1QM8A 2KS9A 4KLYA 3AM6A 4XXJA 4N4WA 3UZAA 3EH5B 4GP5B 4QIDA 4A4MA 2Y04A 3C9MA 1JGJA 4LDLA 1KG8A 3V2WA 4G7RB 1C8RA 4BVNA 4X32A 1F50A 3S3DB 4JR8A 5DHHA 5AWZA 3S8FB 2NTWA 1TN0A 3T45A 1KGBA 3QAKA 4FA7B 2ZZLA 1R2NA 3HARA 3OE8A 3OE9A 4NC3A 3ZPRA 5AHZA 3PQRA 3QJVB 1BRRA 4LDOA 3QJTB 1FBKA 4G7SB 2ZFEA 5DHGA 3RFMA 4IAQA 1PY6A 3KJ6A 4AMJA 3MBVA 5G2AA 1BRDA 4BEYA 4L6RA 1LN6A 4WAVA 1Q5IA 2Y03A 1UAZA 1XJIA 4QI1A 1S54A 2LNLA 3ABWA 4HYXA 2WJKA 4Y9HA 3NY9A 1C3WA 3UG9A 3OAXA 1KMEA 2JAGA 3UTVA 1FBBA 4GPOA 3QBKA 1O0AA 3AYNA 4MD2A 2R4RA 4PXKA 2Y00A 4N6HA 4X31A 4GP8B 5B6VA 3X3BA 5H2JA 1L9HA 5F8UA 1X0SA 3PXOA 4EA3A 3HAOA 3HAQA 5H2MA 1HZXA 1VGOA 1U19A 3OE6A 1DZEA 5EN0A 2KSBA 5G2CA 3UONA 1IW6A 4MD1A 4AMIA 5H2NA 2YDVA 4HWLA 4IB4A 4G7QB 3WQJA 2YCWA 4JKVA 1JV7A 5G36A 3C9LA 1UCQA 1BM1A 2I1XA 1X0K1 3QAPA 4FPDA 1PXRA 3CODA 5H2KA 1JFPA 1EHKB 5J7AA 4IARA 3X3CA 2KSAA 5ITEA 1P8IA 1QKPA 5JJNA 2Z73A 2ZIYA 2WJLA 5AHYA 3A7KA 2NTUA 1XMEB 1AP9A 5B0WA 5DYSA 5LWEA 1E12A 1H2SA 1S8JA 2YDOA 3VGAA 2YCYA 3S8GB 4EIYA 4XT1A 3HAPA 4K5YA 2QPEB 3QJRB 1IXFA 4KNFA 2Z55A 4FAAB 1GUEA 4XT3A 5H2OA 1KG9A 4BUOA 2F95A 3HASA 3PBLA 5H2IA 4BWBA 2I20A 5B6WA 5G28A 1S8LA 1PXSA 4X1HA 3QBGA 1P8UA 4XTOA 1VJMA 5H2HA 3COCA 3VW7A 4TL3A 4DJHA 2Y01A 1QHJA 3SN6R 2X72A 2BRDA 2EI4A 4DAJA 4MBSA 1CWQA 1GZMA 4L35A 4GRVA 5ETZA 2J4YA 4OV0A 3VHZA 4G72B 4MQTA 5A44A 1MGYA 1S52A 1H68A 5B35A 3PDSA 1QKOA 3UZCA 1M0LA 3QBLA 1IW9A 5C1MA 3P0GA 3QJSB 4DKLA 1L0MA 1Q5JA 1X0I1 4UG2A 3D4SA 5G53A 1GU8A 1E0PA 2YCXA 2HPYA 5A45A 4LDEA 2JAFA 3QBIA 5AX0A 4JQ6A 4BV0A 4N4YB 4UHRA 5AX1A 2L6XA 4XTNA 3NYAA 3BVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2L A;  4PXF A;  2I21 A;  3VI0 A;  4MQS A;  3HAN A;  2I35 A;  1M0K A;  2R4S A;  3QJQ B;  3S3B B;  3VVK A;  4GBR A;  3EML A;  3QJU B;  2G87 A;  5B6Z A;  1BRX A;  4GYC A;  3NS0 A;  5G54 A;  3ZPQ A;  5B6Y A;  3RZE A;  4HYJ A;  4G70 B;  3VG9 A;  3S3C B;  3AYM A;  5JJJ A;  3REY A;  1AT9 A;  4EJ4 A;  4GP4 B;  2AT9 A;  1TN5 A;  3V2Y A;  5A8E A;  2PED A;  3UTX A;  4FBZ A;  2KSY A;  1C8S A;  3ZEV A;  3PWH A;  3DQB A;  1P8H A;  4XTL A;  5G2D A;  4J4Q A;  3NY8 A;  1M0M A;  4WW3 A;  3NSB A;  5H2P A;  3UTY A;  3CAP A;  5TGZ A;  2QPD B;  5ITC A;  5FJG A;  5B6X A;  2Y02 A;  3DDL A;  3QDC A;  5BR5 A;  5BR2 A;  4QRY A;  5B2N A;  5B34 A;  5KKH A;  2F93 A;  5AZD A;  1S53 A;  1S51 A;  3EH3 B;  2VT4 A;  1F88 A;  1R84 A;  4G71 B;  2YCZ A;  3EH4 B;  1JV6 A;  4BEZ A;  1F4Z A;  3UTW A;  3ODU A;  5JJE A;  3OE0 A;  2M3G A;  2RH1 A;  1XIO A;  1QM8 A;  2KS9 A;  4KLY A;  3AM6 A;  4XXJ A;  4N4W A;  3UZA A;  3EH5 B;  4GP5 B;  4QID A;  4A4M A;  2Y04 A;  3C9M A;  1JGJ A;  4LDL A;  1KG8 A;  3V2W A;  4G7R B;  1C8R A;  4BVN A;  4X32 A;  1F50 A;  3S3D B;  4JR8 A;  5DHH A;  5AWZ A;  3S8F B;  2NTW A;  1TN0 A;  3T45 A;  1KGB A;  3QAK A;  4FA7 B;  2ZZL A;  1R2N A;  3HAR A;  3OE8 A;  3OE9 A;  4NC3 A;  3ZPR A;  5AHZ A;  3PQR A;  3QJV B;  1BRR A;  4LDO A;  3QJT B;  1FBK A;  4G7S B;  2ZFE A;  5DHG A;  3RFM A;  4IAQ A;  1PY6 A;  3KJ6 A;  4AMJ A;  3MBV A;  5G2A A;  1BRD A;  4BEY A;  4L6R A;  1LN6 A;  4WAV A;  1Q5I A;  2Y03 A;  1UAZ A;  1XJI A;  4QI1 A;  1S54 A;  2LNL A;  3ABW A;  4HYX A;  2WJK A;  4Y9H A;  3NY9 A;  1C3W A;  3UG9 A;  3OAX A;  1KME A;  2JAG A;  3UTV A;  1FBB A;  4GPO A;  3QBK A;  1O0A A;  3AYN A;  4MD2 A;  2R4R A;  4PXK A;  2Y00 A;  4N6H A;  4X31 A;  4GP8 B;  5B6V A;  3X3B A;  5H2J A;  1L9H A;  5F8U A;  1X0S A;  3PXO A;  4EA3 A;  3HAO A;  3HAQ A;  5H2M A;  1HZX A;  1VGO A;  1U19 A;  3OE6 A;  1DZE A;  5EN0 A;  2KSB A;  5G2C A;  3UON A;  1IW6 A;  4MD1 A;  4AMI A;  5H2N A;  2YDV A;  4HWL A;  4IB4 A;  4G7Q B;  3WQJ A;  2YCW A;  4JKV A;  1JV7 A;  5G36 A;  3C9L A;  1UCQ A;  1BM1 A;  2I1X A;  1X0K 1;  3QAP A;  4FPD A;  1PXR A;  3COD A;  5H2K A;  1JFP A;  1EHK B;  5J7A A;  4IAR A;  3X3C A;  2KSA A;  5ITE A;  1P8I A;  1QKP A;  5JJN A;  2Z73 A;  2ZIY A;  2WJL A;  5AHY A;  3A7K A;  2NTU A;  1XME B;  1AP9 A;  5B0W A;  5DYS A;  5LWE A;  1E12 A;  1H2S A;  1S8J A;  2YDO A;  3VGA A;  2YCY A;  3S8G B;  4EIY A;  4XT1 A;  3HAP A;  4K5Y A;  2QPE B;  3QJR B;  1IXF A;  4KNF A;  2Z55 A;  4FAA B;  1GUE A;  4XT3 A;  5H2O A;  1KG9 A;  4BUO A;  2F95 A;  3HAS A;  3PBL A;  5H2I A;  4BWB A;  2I20 A;  5B6W A;  5G28 A;  1S8L A;  1PXS A;  4X1H A;  3QBG A;  1P8U A;  4XTO A;  1VJM A;  5H2H A;  3COC A;  3VW7 A;  4TL3 A;  4DJH A;  2Y01 A;  1QHJ A;  3SN6 R;  2X72 A;  2BRD A;  2EI4 A;  4DAJ A;  4MBS A;  1CWQ A;  1GZM A;  4L35 A;  4GRV A;  5ETZ A;  2J4Y A;  4OV0 A;  3VHZ A;  4G72 B;  4MQT A;  5A44 A;  1MGY A;  1S52 A;  1H68 A;  5B35 A;  3PDS A;  1QKO A;  3UZC A;  1M0L A;  3QBL A;  1IW9 A;  5C1M A;  3P0G A;  3QJS B;  4DKL A;  1L0M A;  1Q5J A;  1X0I 1;  4UG2 A;  3D4S A;  5G53 A;  1GU8 A;  1E0P A;  2YCX A;  2HPY A;  5A45 A;  4LDE A;  2JAF A;  3QBI A;  5AX0 A;  4JQ6 A;  4BV0 A;  4N4Y B;  4UHR A;  5AX1 A;  2L6X A;  4XTN A;  3NYA A;  3BVD B; 
#chains in the Genus database with same CATH topology
 5H2L A;  4PXF A;  2I21 A;  3VI0 A;  4MQS A;  3HAN A;  2I35 A;  1M0K A;  2R4S A;  3QJQ B;  3S3B B;  3VVK A;  4GBR A;  3EML A;  3QJU B;  2G87 A;  4DS7 E;  5B6Z A;  1BRX A;  4GYC A;  3NS0 A;  5G54 A;  3ZPQ A;  5B6Y A;  3RZE A;  4HYJ A;  4G70 B;  3VG9 A;  3S3C B;  3AYM A;  5JJJ A;  3REY A;  1AT9 A;  4EJ4 A;  4GP4 B;  2AT9 A;  1TN5 A;  3V2Y A;  5A8E A;  2PED A;  3UTX A;  4FBZ A;  2KSY A;  1C8S A;  3ZEV A;  3PWH A;  3DQB A;  1P8H A;  4XTL A;  5G2D A;  4J4Q A;  3NY8 A;  1M0M A;  4WW3 A;  3NSB A;  5H2P A;  3UTY A;  3CAP A;  5TGZ A;  2QPD B;  5ITC A;  5FJG A;  5B6X A;  2Y02 A;  3DDL A;  3QDC A;  5BR5 A;  5BR2 A;  4QRY A;  5B2N A;  5B34 A;  5KKH A;  2F93 A;  5AZD A;  1S53 A;  1S51 A;  3EH3 B;  2VT4 A;  1F88 A;  1R84 A;  4G71 B;  2YCZ A;  3EH4 B;  1JV6 A;  4BEZ A;  1F4Z A;  3UTW A;  3ODU A;  5JJE A;  3OE0 A;  2M3G A;  2RH1 A;  1XIO A;  1QM8 A;  2KS9 A;  4KLY A;  3AM6 A;  4XXJ A;  4N4W A;  3UZA A;  3EH5 B;  4GP5 B;  4QID A;  4A4M A;  2Y04 A;  3C9M A;  1JGJ A;  4LDL A;  1KG8 A;  3V2W A;  4G7R B;  1C8R A;  4BVN A;  4X32 A;  1F50 A;  3S3D B;  4JR8 A;  5DHH A;  5AWZ A;  3S8F B;  2NTW A;  1TN0 A;  3T45 A;  1KGB A;  3QAK A;  4FA7 B;  2ZZL A;  1R2N A;  3HAR A;  3OE8 A;  3OE9 A;  4NC3 A;  3ZPR A;  5AHZ A;  3PQR A;  3QJV B;  1BRR A;  4LDO A;  3QJT B;  1FBK A;  4G7S B;  2ZFE A;  5DHG A;  3RFM A;  4IAQ A;  1PY6 A;  3KJ6 A;  4AMJ A;  3MBV A;  5G2A A;  1BRD A;  4BEY A;  4L6R A;  1LN6 A;  4WAV A;  1Q5I A;  2Y03 A;  1UAZ A;  1XJI A;  4QI1 A;  1S54 A;  2LNL A;  3ABW A;  4HYX A;  2WJK A;  4Y9H A;  3NY9 A;  1C3W A;  3UG9 A;  3OAX A;  1KME A;  2JAG A;  3UTV A;  1FBB A;  4GPO A;  3QBK A;  1O0A A;  3AYN A;  4MD2 A;  2R4R A;  4PXK A;  2Y00 A;  4N6H A;  4X31 A;  4GP8 B;  5B6V A;  3X3B A;  5H2J A;  1L9H A;  5F8U A;  1X0S A;  3PXO A;  4EA3 A;  3HAO A;  3HAQ A;  5H2M A;  1HZX A;  1VGO A;  1U19 A;  3OE6 A;  1DZE A;  5EN0 A;  2KSB A;  5G2C A;  3UON A;  1IW6 A;  4MD1 A;  4AMI A;  5H2N A;  2YDV A;  4HWL A;  4IB4 A;  4G7Q B;  3WQJ A;  2YCW A;  4JKV A;  1JV7 A;  5G36 A;  3C9L A;  1UCQ A;  1BM1 A;  2I1X A;  1X0K 1;  3QAP A;  4FPD A;  1PXR A;  3COD A;  5H2K A;  1JFP A;  1EHK B;  5J7A A;  4IAR A;  3X3C A;  2KSA A;  5ITE A;  1P8I A;  1QKP A;  5JJN A;  2Z73 A;  2ZIY A;  2WJL A;  5AHY A;  3A7K A;  2NTU A;  1XME B;  1AP9 A;  5B0W A;  5DYS A;  5LWE A;  1E12 A;  1H2S A;  1S8J A;  2YDO A;  3VGA A;  2YCY A;  3S8G B;  4EIY A;  4XT1 A;  3HAP A;  4K5Y A;  2QPE B;  3QJR B;  1IXF A;  4KNF A;  2Z55 A;  4FAA B;  1GUE A;  4XT3 A;  5H2O A;  1KG9 A;  4BUO A;  2F95 A;  3HAS A;  3PBL A;  5H2I A;  4BWB A;  2I20 A;  5B6W A;  5G28 A;  1S8L A;  1PXS A;  4X1H A;  3QBG A;  1P8U A;  4XTO A;  1VJM A;  5H2H A;  3COC A;  3VW7 A;  4TL3 A;  4DJH A;  2Y01 A;  1QHJ A;  3SN6 R;  2X72 A;  2BRD A;  2EI4 A;  4DAJ A;  4MBS A;  1CWQ A;  1GZM A;  4L35 A;  4GRV A;  5ETZ A;  2J4Y A;  4OV0 A;  3VHZ A;  4G72 B;  4MQT A;  5A44 A;  1MGY A;  1S52 A;  1H68 A;  5B35 A;  3PDS A;  1QKO A;  3UZC A;  1M0L A;  3QBL A;  1IW9 A;  5C1M A;  3P0G A;  3QJS B;  4DKL A;  1L0M A;  1Q5J A;  1X0I 1;  4UG2 A;  3D4S A;  5G53 A;  1GU8 A;  1E0P A;  2YCX A;  2HPY A;  5A45 A;  4LDE A;  2JAF A;  3QBI A;  5AX0 A;  4JQ6 A;  4BV0 A;  4N4Y B;  4UHR A;  5AX1 A;  2L6X A;  4XTN A;  3NYA A;  3BVD B; 
#chains in the Genus database with same CATH homology
 5H2L A;  4PXF A;  2I21 A;  3VI0 A;  4MQS A;  3HAN A;  2I35 A;  1M0K A;  2R4S A;  3QJQ B;  3S3B B;  3VVK A;  4GBR A;  3EML A;  3QJU B;  2G87 A;  4DS7 E;  5B6Z A;  1BRX A;  4GYC A;  3NS0 A;  5G54 A;  3ZPQ A;  5B6Y A;  3RZE A;  4HYJ A;  4G70 B;  3VG9 A;  3S3C B;  3AYM A;  5JJJ A;  3REY A;  1AT9 A;  4EJ4 A;  4GP4 B;  2AT9 A;  1TN5 A;  3V2Y A;  5A8E A;  2PED A;  3UTX A;  4FBZ A;  2KSY A;  1C8S A;  3ZEV A;  3PWH A;  3DQB A;  1P8H A;  4XTL A;  5G2D A;  4J4Q A;  3NY8 A;  1M0M A;  4WW3 A;  3NSB A;  5H2P A;  3UTY A;  3CAP A;  5TGZ A;  2QPD B;  5ITC A;  5FJG A;  5B6X A;  2Y02 A;  3DDL A;  3QDC A;  5BR5 A;  5BR2 A;  4QRY A;  5B2N A;  5B34 A;  5KKH A;  2F93 A;  5AZD A;  1S53 A;  1S51 A;  3EH3 B;  2VT4 A;  1F88 A;  1R84 A;  4G71 B;  2YCZ A;  3EH4 B;  1JV6 A;  4BEZ A;  1F4Z A;  3UTW A;  3ODU A;  5JJE A;  3OE0 A;  2M3G A;  2RH1 A;  1XIO A;  1QM8 A;  2KS9 A;  4KLY A;  3AM6 A;  4XXJ A;  4N4W A;  3UZA A;  3EH5 B;  4GP5 B;  4QID A;  4A4M A;  2Y04 A;  3C9M A;  1JGJ A;  4LDL A;  1KG8 A;  3V2W A;  4G7R B;  1C8R A;  4BVN A;  4X32 A;  1F50 A;  3S3D B;  4JR8 A;  5DHH A;  5AWZ A;  3S8F B;  2NTW A;  1TN0 A;  3T45 A;  1KGB A;  3QAK A;  4FA7 B;  2ZZL A;  1R2N A;  3HAR A;  3OE8 A;  3OE9 A;  4NC3 A;  3ZPR A;  5AHZ A;  3PQR A;  3QJV B;  1BRR A;  4LDO A;  3QJT B;  1FBK A;  4G7S B;  2ZFE A;  5DHG A;  3RFM A;  4IAQ A;  1PY6 A;  3KJ6 A;  4AMJ A;  3MBV A;  5G2A A;  1BRD A;  4BEY A;  4L6R A;  1LN6 A;  4WAV A;  1Q5I A;  2Y03 A;  1UAZ A;  1XJI A;  4QI1 A;  1S54 A;  2LNL A;  3ABW A;  4HYX A;  2WJK A;  4Y9H A;  3NY9 A;  1C3W A;  3UG9 A;  3OAX A;  1KME A;  2JAG A;  3UTV A;  1FBB A;  4GPO A;  3QBK A;  1O0A A;  3AYN A;  4MD2 A;  2R4R A;  4PXK A;  2Y00 A;  4N6H A;  4X31 A;  4GP8 B;  5B6V A;  3X3B A;  5H2J A;  1L9H A;  5F8U A;  1X0S A;  3PXO A;  4EA3 A;  3HAO A;  3HAQ A;  5H2M A;  1HZX A;  1VGO A;  1U19 A;  3OE6 A;  1DZE A;  5EN0 A;  2KSB A;  5G2C A;  3UON A;  1IW6 A;  4MD1 A;  4AMI A;  5H2N A;  2YDV A;  4HWL A;  4IB4 A;  4G7Q B;  3WQJ A;  2YCW A;  4JKV A;  1JV7 A;  5G36 A;  3C9L A;  1UCQ A;  1BM1 A;  2I1X A;  1X0K 1;  3QAP A;  4FPD A;  1PXR A;  3COD A;  5H2K A;  1JFP A;  1EHK B;  5J7A A;  4IAR A;  3X3C A;  2KSA A;  5ITE A;  1P8I A;  1QKP A;  5JJN A;  2Z73 A;  2ZIY A;  2WJL A;  5AHY A;  3A7K A;  2NTU A;  1XME B;  1AP9 A;  5B0W A;  5DYS A;  5LWE A;  1E12 A;  1H2S A;  1S8J A;  2YDO A;  3VGA A;  2YCY A;  3S8G B;  4EIY A;  4XT1 A;  3HAP A;  4K5Y A;  2QPE B;  3QJR B;  1IXF A;  4KNF A;  2Z55 A;  4FAA B;  1GUE A;  4XT3 A;  5H2O A;  1KG9 A;  4BUO A;  2F95 A;  3HAS A;  3PBL A;  5H2I A;  4BWB A;  2I20 A;  5B6W A;  5G28 A;  1S8L A;  1PXS A;  4X1H A;  3QBG A;  1P8U A;  4XTO A;  1VJM A;  5H2H A;  3COC A;  3VW7 A;  4TL3 A;  4DJH A;  2Y01 A;  1QHJ A;  3SN6 R;  2X72 A;  2BRD A;  2EI4 A;  4DAJ A;  4MBS A;  1CWQ A;  1GZM A;  4L35 A;  4GRV A;  5ETZ A;  2J4Y A;  4OV0 A;  3VHZ A;  4G72 B;  4MQT A;  5A44 A;  1MGY A;  1S52 A;  1H68 A;  5B35 A;  3PDS A;  1QKO A;  3UZC A;  1M0L A;  3QBL A;  1IW9 A;  5C1M A;  3P0G A;  3QJS B;  4DKL A;  1L0M A;  1Q5J A;  1X0I 1;  4UG2 A;  3D4S A;  5G53 A;  1GU8 A;  1E0P A;  2YCX A;  2HPY A;  5A45 A;  4LDE A;  2JAF A;  3QBI A;  5AX0 A;  4JQ6 A;  4BV0 A;  4N4Y B;  4UHR A;  5AX1 A;  2L6X A;  4XTN A;  3NYA A;  3BVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...