3ZPRA

Thermostabilised turkey beta1 adrenergic receptor with 4-methyl-2-(piperazin-1-yl) quinoline bound
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
298
structure length
283
Chain Sequence
GAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords BETA-1 ADRENERGIC RECEPTOR
publication title Biophysical Fragment Screening of the Beta1-Adrenergic Receptor: Identification of High Affinity Aryl Piperazine Leads Using Structure-Based Drug Design.
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 121
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3zprA00
1BRRA 1P8IA 1C3WA 5BR2A 4G70B 4AMIA 1HZXA 3RZEA 2I35A 2RH1A 1M0LA 2VT4A 4GP4B 1S8LA 3A7KA 3X3BA 4HYJA 4G71B 3ZEVA 1XJIA 3UZCA 2ZFEA 3UTWA 4QIDA 1JV7A 5H2MA 4KNFA 1QKPA 5A8EA 3DDLA 1F4ZA 3PWHA 3QBLA 3X3CA 1JFPA 2HPYA 3VVKA 4K5YA 4L6RA 1IW6A 1R84A 4G7RB 1PXSA 4X31A 3S8GB 5F8UA 2NTUA 4MD1A 5AHYA 4N4YB 2I21A 5KKHA 1IW9A 3QJSB 1BRDA 4G72B 1S54A 5B6XA 3ODUA 5DHHA 4XTNA 5JJJA 3KJ6A 4MQSA 3EH3B 3NYAA 4EA3A 3VW7A 3QBGA 5B2NA 3QJRB 2Y01A 5J7AA 2PEDA 1QKOA 4DAJA 1VJMA 4GRVA 1S52A 5G36A 3S3DB 4J4QA 3BVDB 1GU8A 4QI1A 4XT1A 5G2DA 5G28A 3UTVA 3ZPQA 1KG8A 4A4MA 2I20A 1PY6A 4EJ4A 3WQJA 2KSYA 3VHZA 4DKLA 4EIYA 1CWQA 1X0K1 1H2SA 1GZMA 3QAPA 5AZDA 1LN6A 4PXKA 3QDCA 3S3BB 1FBBA 5AHZA 1JGJA 2F95A 1IXFA 3HAOA 4WAVA 5H2OA 3D4SA 4GBRA 1KGBA 2F93A 4BUOA 1JV6A 2ZIYA 5JJNA 3S8FB 5ITEA 3UTXA 3QAKA 4LDLA 1UCQA 3HANA 2KS9A 3EH4B 3CAPA 3QBIA 5A45A 4FA7B 4UHRA 2Y04A 4MD2A 5H2KA 5LWEA 3OE6A 2R4SA 2WJKA 3NSBA 2YCYA 4IAQA 2Y02A 2R4RA 2KSBA 1E12A 2KSAA 3AM6A 4LDOA 4NC3A 1VGOA 4UG2A 1P8UA 3HAPA 2JAFA 1BM1A 4XT3A 5B6YA 4G7QB 1U19A 1AT9A 3OAXA 4JQ6A 5H2IA 3NS0A 5B6ZA 4BEZA 2YCZA 4JKVA 2YDOA 4L35A 4BEYA 3S3CB 3PBLA 3COCA 5H2NA 1FBKA 5AX1A 3PDSA 1TN5A 3OE8A 1O0AA 1MGYA 1L0MA 3QJQB 5EN0A 2BRDA 4FBZA 1M0MA 1KMEA 3CODA 1UAZA 5G53A 3V2YA 1C8RA 5TGZA 3PQRA 4XTLA 1S53A 2JAGA 2YDVA 3QJTB 3EMLA 4FAAB 5H2JA 4BVNA 4GYCA 1H68A 1S8JA 4IARA 4MQTA 2Y03A 5DYSA 2QPDB 3UONA 2YCWA 4FPDA 1XMEB 3EH5B 1X0SA 1BRXA 4GPOA 4N6HA 5B6VA 4DJHA 3QBKA 4X32A 4KLYA 3UZAA 3QJVB 1L9HA 2J4YA 1XIOA 2X72A 4IB4A 1X0I1 3MBVA 4WW3A 5B34A 2QPEB 4QRYA 2EI4A 3QJUB 5H2LA 3P0GA 5JJEA 1Q5JA 1M0KA 1E0PA 2LNLA 2AT9A 5ETZA 3AYMA 5H2HA 3VG9A 4GP8B 3SN6R 1F88A 1Q5IA 2Y00A 4Y9HA 5B6WA 4LDEA 5A44A 2G87A 4OV0A 3ABWA 2M3GA 5DHGA 1PXRA 3C9LA 4XTOA 3DQBA 5G2CA 3UG9A 1S51A 2NTWA 4MBSA 4GP5B 1TN0A 5BR5A 1DZEA 4TL3A 1R2NA 3NY9A 3T45A 1QHJA 4G7SB 3ZPRA 4HWLA 1F50A 4BV0A 3UTYA 2ZZLA 5B35A 5H2PA 3C9MA 3REYA 3AYNA 5FJGA 3V2WA 4PXFA 2Z55A 3VGAA 2WJLA 3PXOA 1C8SA 1GUEA 3RFMA 1P8HA 4BWBA 5B0WA 3HASA 4JR8A 1KG9A 2Z73A 5AX0A 5G54A 2I1XA 4AMJA 1AP9A 5ITCA 1EHKB 4X1HA 3OE9A 4HYXA 3VI0A 3NY8A 3OE0A 2YCXA 1QM8A 2L6XA 5C1MA 3HAQA 3HARA 4XXJA 4N4WA 5AWZA 5G2AA
chains in the Genus database with same CATH superfamily
1BRRA 1P8IA 1C3WA 5BR2A 4G70B 4AMIA 1HZXA 3RZEA 2I35A 2RH1A 1M0LA 2VT4A 4GP4B 1S8LA 3A7KA 3X3BA 4HYJA 4G71B 3ZEVA 1XJIA 3UZCA 2ZFEA 3UTWA 4QIDA 1JV7A 5H2MA 4KNFA 1QKPA 5A8EA 3DDLA 1F4ZA 3PWHA 3QBLA 3X3CA 1JFPA 2HPYA 3VVKA 4K5YA 4L6RA 1IW6A 1R84A 4G7RB 1PXSA 4X31A 3S8GB 5F8UA 2NTUA 4MD1A 5AHYA 4N4YB 2I21A 5KKHA 1IW9A 3QJSB 1BRDA 4G72B 1S54A 5B6XA 3ODUA 5DHHA 4XTNA 5JJJA 3KJ6A 4MQSA 3EH3B 3NYAA 4EA3A 3VW7A 3QBGA 5B2NA 3QJRB 2Y01A 5J7AA 2PEDA 1QKOA 4DAJA 1VJMA 4GRVA 1S52A 5G36A 3S3DB 4J4QA 3BVDB 1GU8A 4QI1A 4XT1A 5G2DA 5G28A 3UTVA 3ZPQA 1KG8A 4A4MA 2I20A 1PY6A 4EJ4A 3WQJA 2KSYA 3VHZA 4DKLA 4EIYA 1CWQA 1X0K1 1H2SA 1GZMA 3QAPA 5AZDA 1LN6A 4PXKA 3QDCA 3S3BB 1FBBA 5AHZA 1JGJA 2F95A 1IXFA 3HAOA 4WAVA 5H2OA 3D4SA 4GBRA 1KGBA 2F93A 4BUOA 1JV6A 4DS7E 2ZIYA 5JJNA 3S8FB 5ITEA 3UTXA 3QAKA 4LDLA 1UCQA 3HANA 2KS9A 3EH4B 3CAPA 3QBIA 5A45A 4FA7B 4UHRA 2Y04A 4MD2A 5H2KA 5LWEA 3OE6A 2R4SA 2WJKA 3NSBA 2YCYA 4IAQA 2Y02A 2R4RA 2KSBA 1E12A 2KSAA 3AM6A 4LDOA 4NC3A 1VGOA 4UG2A 1P8UA 3HAPA 2JAFA 1BM1A 4XT3A 5B6YA 4G7QB 1U19A 1AT9A 3OAXA 4JQ6A 5H2IA 3NS0A 5B6ZA 4BEZA 2YCZA 4JKVA 2YDOA 4L35A 4BEYA 3S3CB 3PBLA 3COCA 5H2NA 1FBKA 5AX1A 3PDSA 1TN5A 3OE8A 1O0AA 1MGYA 1L0MA 3QJQB 5EN0A 2BRDA 4FBZA 1M0MA 1KMEA 3CODA 1UAZA 5G53A 3V2YA 1C8RA 5TGZA 3PQRA 4XTLA 1S53A 2JAGA 2YDVA 3QJTB 3EMLA 4FAAB 5H2JA 4BVNA 4GYCA 1H68A 1S8JA 4IARA 4MQTA 2Y03A 5DYSA 2QPDB 3UONA 2YCWA 4FPDA 1XMEB 3EH5B 1X0SA 1BRXA 4GPOA 4N6HA 5B6VA 4DJHA 3QBKA 4X32A 4KLYA 3UZAA 3QJVB 1L9HA 2J4YA 1XIOA 2X72A 4IB4A 1X0I1 3MBVA 4WW3A 5B34A 2QPEB 4QRYA 2EI4A 3QJUB 5H2LA 3P0GA 5JJEA 1Q5JA 1M0KA 1E0PA 2LNLA 2AT9A 5ETZA 3AYMA 5H2HA 3VG9A 4GP8B 3SN6R 1F88A 1Q5IA 2Y00A 4Y9HA 5B6WA 4LDEA 5A44A 2G87A 4OV0A 3ABWA 2M3GA 5DHGA 1PXRA 3C9LA 4XTOA 3DQBA 5G2CA 3UG9A 1S51A 2NTWA 4MBSA 4GP5B 1TN0A 5BR5A 1DZEA 4TL3A 1R2NA 3NY9A 3T45A 1QHJA 4G7SB 3ZPRA 4HWLA 1F50A 4BV0A 3UTYA 2ZZLA 5B35A 5H2PA 3C9MA 3REYA 3AYNA 5FJGA 3V2WA 4PXFA 2Z55A 3VGAA 2WJLA 3PXOA 1C8SA 1GUEA 3RFMA 1P8HA 4BWBA 5B0WA 3HASA 4JR8A 1KG9A 2Z73A 5AX0A 5G54A 2I1XA 4AMJA 1AP9A 5ITCA 1EHKB 4X1HA 3OE9A 4HYXA 3VI0A 3NY8A 3OE0A 2YCXA 1QM8A 2L6XA 5C1MA 3HAQA 3HARA 4XXJA 4N4WA 5AWZA 5G2AA
chains in the Genus database with same CATH topology
1BRRA 1P8IA 1C3WA 5BR2A 4G70B 4AMIA 1HZXA 3RZEA 2I35A 2RH1A 1M0LA 2VT4A 4GP4B 1S8LA 3A7KA 3X3BA 4HYJA 4G71B 3ZEVA 1XJIA 3UZCA 2ZFEA 3UTWA 4QIDA 1JV7A 5H2MA 4KNFA 1QKPA 5A8EA 3DDLA 1F4ZA 3PWHA 3QBLA 3X3CA 1JFPA 2HPYA 3VVKA 4K5YA 4L6RA 1IW6A 1R84A 4G7RB 1PXSA 4X31A 3S8GB 5F8UA 2NTUA 4MD1A 5AHYA 4N4YB 2I21A 5KKHA 1IW9A 3QJSB 1BRDA 4G72B 1S54A 5B6XA 3ODUA 5DHHA 4XTNA 5JJJA 3KJ6A 4MQSA 3EH3B 3NYAA 4EA3A 3VW7A 3QBGA 5B2NA 3QJRB 2Y01A 5J7AA 2PEDA 1QKOA 4DAJA 1VJMA 4GRVA 1S52A 5G36A 3S3DB 4J4QA 3BVDB 1GU8A 4QI1A 4XT1A 5G2DA 5G28A 3UTVA 3ZPQA 1KG8A 4A4MA 2I20A 1PY6A 4EJ4A 3WQJA 2KSYA 3VHZA 4DKLA 4EIYA 1CWQA 1X0K1 1H2SA 1GZMA 3QAPA 5AZDA 1LN6A 4PXKA 3QDCA 3S3BB 1FBBA 5AHZA 1JGJA 2F95A 1IXFA 3HAOA 4WAVA 5H2OA 3D4SA 4GBRA 1KGBA 2F93A 4BUOA 1JV6A 4DS7E 2ZIYA 5JJNA 3S8FB 5ITEA 3UTXA 3QAKA 4LDLA 1UCQA 3HANA 2KS9A 3EH4B 3CAPA 3QBIA 5A45A 4FA7B 4UHRA 2Y04A 4MD2A 5H2KA 5LWEA 3OE6A 2R4SA 2WJKA 3NSBA 2YCYA 4IAQA 2Y02A 2R4RA 2KSBA 1E12A 2KSAA 3AM6A 4LDOA 4NC3A 1VGOA 4UG2A 1P8UA 3HAPA 2JAFA 1BM1A 4XT3A 5B6YA 4G7QB 1U19A 1AT9A 3OAXA 4JQ6A 5H2IA 3NS0A 5B6ZA 4BEZA 2YCZA 4JKVA 2YDOA 4L35A 4BEYA 3S3CB 3PBLA 3COCA 5H2NA 1FBKA 5AX1A 3PDSA 1TN5A 3OE8A 1O0AA 1MGYA 1L0MA 3QJQB 5EN0A 2BRDA 4FBZA 1M0MA 1KMEA 3CODA 1UAZA 5G53A 3V2YA 1C8RA 5TGZA 3PQRA 4XTLA 1S53A 2JAGA 2YDVA 3QJTB 3EMLA 4FAAB 5H2JA 4BVNA 4GYCA 1H68A 1S8JA 4IARA 4MQTA 2Y03A 5DYSA 2QPDB 3UONA 2YCWA 4FPDA 1XMEB 3EH5B 1X0SA 1BRXA 4GPOA 4N6HA 5B6VA 4DJHA 3QBKA 4X32A 4KLYA 3UZAA 3QJVB 1L9HA 2J4YA 1XIOA 2X72A 4IB4A 1X0I1 3MBVA 4WW3A 5B34A 2QPEB 4QRYA 2EI4A 3QJUB 5H2LA 3P0GA 5JJEA 1Q5JA 1M0KA 1E0PA 2LNLA 2AT9A 5ETZA 3AYMA 5H2HA 3VG9A 4GP8B 3SN6R 1F88A 1Q5IA 2Y00A 4Y9HA 5B6WA 4LDEA 5A44A 2G87A 4OV0A 3ABWA 2M3GA 5DHGA 1PXRA 3C9LA 4XTOA 3DQBA 5G2CA 3UG9A 1S51A 2NTWA 4MBSA 4GP5B 1TN0A 5BR5A 1DZEA 4TL3A 1R2NA 3NY9A 3T45A 1QHJA 4G7SB 3ZPRA 4HWLA 1F50A 4BV0A 3UTYA 2ZZLA 5B35A 5H2PA 3C9MA 3REYA 3AYNA 5FJGA 3V2WA 4PXFA 2Z55A 3VGAA 2WJLA 3PXOA 1C8SA 1GUEA 3RFMA 1P8HA 4BWBA 5B0WA 3HASA 4JR8A 1KG9A 2Z73A 5AX0A 5G54A 2I1XA 4AMJA 1AP9A 5ITCA 1EHKB 4X1HA 3OE9A 4HYXA 3VI0A 3NY8A 3OE0A 2YCXA 1QM8A 2L6XA 5C1MA 3HAQA 3HARA 4XXJA 4N4WA 5AWZA 5G2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRR A;  1P8I A;  1C3W A;  5BR2 A;  4G70 B;  4AMI A;  1HZX A;  3RZE A;  2I35 A;  2RH1 A;  1M0L A;  2VT4 A;  4GP4 B;  1S8L A;  3A7K A;  3X3B A;  4HYJ A;  4G71 B;  3ZEV A;  1XJI A;  3UZC A;  2ZFE A;  3UTW A;  4QID A;  1JV7 A;  5H2M A;  4KNF A;  1QKP A;  5A8E A;  3DDL A;  1F4Z A;  3PWH A;  3QBL A;  3X3C A;  1JFP A;  2HPY A;  3VVK A;  4K5Y A;  4L6R A;  1IW6 A;  1R84 A;  4G7R B;  1PXS A;  4X31 A;  3S8G B;  5F8U A;  2NTU A;  4MD1 A;  5AHY A;  4N4Y B;  2I21 A;  5KKH A;  1IW9 A;  3QJS B;  1BRD A;  4G72 B;  1S54 A;  5B6X A;  3ODU A;  5DHH A;  4XTN A;  5JJJ A;  3KJ6 A;  4MQS A;  3EH3 B;  3NYA A;  4EA3 A;  3VW7 A;  3QBG A;  5B2N A;  3QJR B;  2Y01 A;  5J7A A;  2PED A;  1QKO A;  4DAJ A;  1VJM A;  4GRV A;  1S52 A;  5G36 A;  3S3D B;  4J4Q A;  3BVD B;  1GU8 A;  4QI1 A;  4XT1 A;  5G2D A;  5G28 A;  3UTV A;  3ZPQ A;  1KG8 A;  4A4M A;  2I20 A;  1PY6 A;  4EJ4 A;  3WQJ A;  2KSY A;  3VHZ A;  4DKL A;  4EIY A;  1CWQ A;  1X0K 1;  1H2S A;  1GZM A;  3QAP A;  5AZD A;  1LN6 A;  4PXK A;  3QDC A;  3S3B B;  1FBB A;  5AHZ A;  1JGJ A;  2F95 A;  1IXF A;  3HAO A;  4WAV A;  5H2O A;  3D4S A;  4GBR A;  1KGB A;  2F93 A;  4BUO A;  1JV6 A;  2ZIY A;  5JJN A;  3S8F B;  5ITE A;  3UTX A;  3QAK A;  4LDL A;  1UCQ A;  3HAN A;  2KS9 A;  3EH4 B;  3CAP A;  3QBI A;  5A45 A;  4FA7 B;  4UHR A;  2Y04 A;  4MD2 A;  5H2K A;  5LWE A;  3OE6 A;  2R4S A;  2WJK A;  3NSB A;  2YCY A;  4IAQ A;  2Y02 A;  2R4R A;  2KSB A;  1E12 A;  2KSA A;  3AM6 A;  4LDO A;  4NC3 A;  1VGO A;  4UG2 A;  1P8U A;  3HAP A;  2JAF A;  1BM1 A;  4XT3 A;  5B6Y A;  4G7Q B;  1U19 A;  1AT9 A;  3OAX A;  4JQ6 A;  5H2I A;  3NS0 A;  5B6Z A;  4BEZ A;  2YCZ A;  4JKV A;  2YDO A;  4L35 A;  4BEY A;  3S3C B;  3PBL A;  3COC A;  5H2N A;  1FBK A;  5AX1 A;  3PDS A;  1TN5 A;  3OE8 A;  1O0A A;  1MGY A;  1L0M A;  3QJQ B;  5EN0 A;  2BRD A;  4FBZ A;  1M0M A;  1KME A;  3COD A;  1UAZ A;  5G53 A;  3V2Y A;  1C8R A;  5TGZ A;  3PQR A;  4XTL A;  1S53 A;  2JAG A;  2YDV A;  3QJT B;  3EML A;  4FAA B;  5H2J A;  4BVN A;  4GYC A;  1H68 A;  1S8J A;  4IAR A;  4MQT A;  2Y03 A;  5DYS A;  2QPD B;  3UON A;  2YCW A;  4FPD A;  1XME B;  3EH5 B;  1X0S A;  1BRX A;  4GPO A;  4N6H A;  5B6V A;  4DJH A;  3QBK A;  4X32 A;  4KLY A;  3UZA A;  3QJV B;  1L9H A;  2J4Y A;  1XIO A;  2X72 A;  4IB4 A;  1X0I 1;  3MBV A;  4WW3 A;  5B34 A;  2QPE B;  4QRY A;  2EI4 A;  3QJU B;  5H2L A;  3P0G A;  5JJE A;  1Q5J A;  1M0K A;  1E0P A;  2LNL A;  2AT9 A;  5ETZ A;  3AYM A;  5H2H A;  3VG9 A;  4GP8 B;  3SN6 R;  1F88 A;  1Q5I A;  2Y00 A;  4Y9H A;  5B6W A;  4LDE A;  5A44 A;  2G87 A;  4OV0 A;  3ABW A;  2M3G A;  5DHG A;  1PXR A;  3C9L A;  4XTO A;  3DQB A;  5G2C A;  3UG9 A;  1S51 A;  2NTW A;  4MBS A;  4GP5 B;  1TN0 A;  5BR5 A;  1DZE A;  4TL3 A;  1R2N A;  3NY9 A;  3T45 A;  1QHJ A;  4G7S B;  3ZPR A;  4HWL A;  1F50 A;  4BV0 A;  3UTY A;  2ZZL A;  5B35 A;  5H2P A;  3C9M A;  3REY A;  3AYN A;  5FJG A;  3V2W A;  4PXF A;  2Z55 A;  3VGA A;  2WJL A;  3PXO A;  1C8S A;  1GUE A;  3RFM A;  1P8H A;  4BWB A;  5B0W A;  3HAS A;  4JR8 A;  1KG9 A;  2Z73 A;  5AX0 A;  5G54 A;  2I1X A;  4AMJ A;  1AP9 A;  5ITC A;  1EHK B;  4X1H A;  3OE9 A;  4HYX A;  3VI0 A;  3NY8 A;  3OE0 A;  2YCX A;  1QM8 A;  2L6X A;  5C1M A;  3HAQ A;  3HAR A;  4XXJ A;  4N4W A;  5AWZ A;  5G2A A; 
#chains in the Genus database with same CATH topology
 1BRR A;  1P8I A;  1C3W A;  5BR2 A;  4G70 B;  4AMI A;  1HZX A;  3RZE A;  2I35 A;  2RH1 A;  1M0L A;  2VT4 A;  4GP4 B;  1S8L A;  3A7K A;  3X3B A;  4HYJ A;  4G71 B;  3ZEV A;  1XJI A;  3UZC A;  2ZFE A;  3UTW A;  4QID A;  1JV7 A;  5H2M A;  4KNF A;  1QKP A;  5A8E A;  3DDL A;  1F4Z A;  3PWH A;  3QBL A;  3X3C A;  1JFP A;  2HPY A;  3VVK A;  4K5Y A;  4L6R A;  1IW6 A;  1R84 A;  4G7R B;  1PXS A;  4X31 A;  3S8G B;  5F8U A;  2NTU A;  4MD1 A;  5AHY A;  4N4Y B;  2I21 A;  5KKH A;  1IW9 A;  3QJS B;  1BRD A;  4G72 B;  1S54 A;  5B6X A;  3ODU A;  5DHH A;  4XTN A;  5JJJ A;  3KJ6 A;  4MQS A;  3EH3 B;  3NYA A;  4EA3 A;  3VW7 A;  3QBG A;  5B2N A;  3QJR B;  2Y01 A;  5J7A A;  2PED A;  1QKO A;  4DAJ A;  1VJM A;  4GRV A;  1S52 A;  5G36 A;  3S3D B;  4J4Q A;  3BVD B;  1GU8 A;  4QI1 A;  4XT1 A;  5G2D A;  5G28 A;  3UTV A;  3ZPQ A;  1KG8 A;  4A4M A;  2I20 A;  1PY6 A;  4EJ4 A;  3WQJ A;  2KSY A;  3VHZ A;  4DKL A;  4EIY A;  1CWQ A;  1X0K 1;  1H2S A;  1GZM A;  3QAP A;  5AZD A;  1LN6 A;  4PXK A;  3QDC A;  3S3B B;  1FBB A;  5AHZ A;  1JGJ A;  2F95 A;  1IXF A;  3HAO A;  4WAV A;  5H2O A;  3D4S A;  4GBR A;  1KGB A;  2F93 A;  4BUO A;  1JV6 A;  4DS7 E;  2ZIY A;  5JJN A;  3S8F B;  5ITE A;  3UTX A;  3QAK A;  4LDL A;  1UCQ A;  3HAN A;  2KS9 A;  3EH4 B;  3CAP A;  3QBI A;  5A45 A;  4FA7 B;  4UHR A;  2Y04 A;  4MD2 A;  5H2K A;  5LWE A;  3OE6 A;  2R4S A;  2WJK A;  3NSB A;  2YCY A;  4IAQ A;  2Y02 A;  2R4R A;  2KSB A;  1E12 A;  2KSA A;  3AM6 A;  4LDO A;  4NC3 A;  1VGO A;  4UG2 A;  1P8U A;  3HAP A;  2JAF A;  1BM1 A;  4XT3 A;  5B6Y A;  4G7Q B;  1U19 A;  1AT9 A;  3OAX A;  4JQ6 A;  5H2I A;  3NS0 A;  5B6Z A;  4BEZ A;  2YCZ A;  4JKV A;  2YDO A;  4L35 A;  4BEY A;  3S3C B;  3PBL A;  3COC A;  5H2N A;  1FBK A;  5AX1 A;  3PDS A;  1TN5 A;  3OE8 A;  1O0A A;  1MGY A;  1L0M A;  3QJQ B;  5EN0 A;  2BRD A;  4FBZ A;  1M0M A;  1KME A;  3COD A;  1UAZ A;  5G53 A;  3V2Y A;  1C8R A;  5TGZ A;  3PQR A;  4XTL A;  1S53 A;  2JAG A;  2YDV A;  3QJT B;  3EML A;  4FAA B;  5H2J A;  4BVN A;  4GYC A;  1H68 A;  1S8J A;  4IAR A;  4MQT A;  2Y03 A;  5DYS A;  2QPD B;  3UON A;  2YCW A;  4FPD A;  1XME B;  3EH5 B;  1X0S A;  1BRX A;  4GPO A;  4N6H A;  5B6V A;  4DJH A;  3QBK A;  4X32 A;  4KLY A;  3UZA A;  3QJV B;  1L9H A;  2J4Y A;  1XIO A;  2X72 A;  4IB4 A;  1X0I 1;  3MBV A;  4WW3 A;  5B34 A;  2QPE B;  4QRY A;  2EI4 A;  3QJU B;  5H2L A;  3P0G A;  5JJE A;  1Q5J A;  1M0K A;  1E0P A;  2LNL A;  2AT9 A;  5ETZ A;  3AYM A;  5H2H A;  3VG9 A;  4GP8 B;  3SN6 R;  1F88 A;  1Q5I A;  2Y00 A;  4Y9H A;  5B6W A;  4LDE A;  5A44 A;  2G87 A;  4OV0 A;  3ABW A;  2M3G A;  5DHG A;  1PXR A;  3C9L A;  4XTO A;  3DQB A;  5G2C A;  3UG9 A;  1S51 A;  2NTW A;  4MBS A;  4GP5 B;  1TN0 A;  5BR5 A;  1DZE A;  4TL3 A;  1R2N A;  3NY9 A;  3T45 A;  1QHJ A;  4G7S B;  3ZPR A;  4HWL A;  1F50 A;  4BV0 A;  3UTY A;  2ZZL A;  5B35 A;  5H2P A;  3C9M A;  3REY A;  3AYN A;  5FJG A;  3V2W A;  4PXF A;  2Z55 A;  3VGA A;  2WJL A;  3PXO A;  1C8S A;  1GUE A;  3RFM A;  1P8H A;  4BWB A;  5B0W A;  3HAS A;  4JR8 A;  1KG9 A;  2Z73 A;  5AX0 A;  5G54 A;  2I1X A;  4AMJ A;  1AP9 A;  5ITC A;  1EHK B;  4X1H A;  3OE9 A;  4HYX A;  3VI0 A;  3NY8 A;  3OE0 A;  2YCX A;  1QM8 A;  2L6X A;  5C1M A;  3HAQ A;  3HAR A;  4XXJ A;  4N4W A;  5AWZ A;  5G2A A; 
#chains in the Genus database with same CATH homology
 1BRR A;  1P8I A;  1C3W A;  5BR2 A;  4G70 B;  4AMI A;  1HZX A;  3RZE A;  2I35 A;  2RH1 A;  1M0L A;  2VT4 A;  4GP4 B;  1S8L A;  3A7K A;  3X3B A;  4HYJ A;  4G71 B;  3ZEV A;  1XJI A;  3UZC A;  2ZFE A;  3UTW A;  4QID A;  1JV7 A;  5H2M A;  4KNF A;  1QKP A;  5A8E A;  3DDL A;  1F4Z A;  3PWH A;  3QBL A;  3X3C A;  1JFP A;  2HPY A;  3VVK A;  4K5Y A;  4L6R A;  1IW6 A;  1R84 A;  4G7R B;  1PXS A;  4X31 A;  3S8G B;  5F8U A;  2NTU A;  4MD1 A;  5AHY A;  4N4Y B;  2I21 A;  5KKH A;  1IW9 A;  3QJS B;  1BRD A;  4G72 B;  1S54 A;  5B6X A;  3ODU A;  5DHH A;  4XTN A;  5JJJ A;  3KJ6 A;  4MQS A;  3EH3 B;  3NYA A;  4EA3 A;  3VW7 A;  3QBG A;  5B2N A;  3QJR B;  2Y01 A;  5J7A A;  2PED A;  1QKO A;  4DAJ A;  1VJM A;  4GRV A;  1S52 A;  5G36 A;  3S3D B;  4J4Q A;  3BVD B;  1GU8 A;  4QI1 A;  4XT1 A;  5G2D A;  5G28 A;  3UTV A;  3ZPQ A;  1KG8 A;  4A4M A;  2I20 A;  1PY6 A;  4EJ4 A;  3WQJ A;  2KSY A;  3VHZ A;  4DKL A;  4EIY A;  1CWQ A;  1X0K 1;  1H2S A;  1GZM A;  3QAP A;  5AZD A;  1LN6 A;  4PXK A;  3QDC A;  3S3B B;  1FBB A;  5AHZ A;  1JGJ A;  2F95 A;  1IXF A;  3HAO A;  4WAV A;  5H2O A;  3D4S A;  4GBR A;  1KGB A;  2F93 A;  4BUO A;  1JV6 A;  4DS7 E;  2ZIY A;  5JJN A;  3S8F B;  5ITE A;  3UTX A;  3QAK A;  4LDL A;  1UCQ A;  3HAN A;  2KS9 A;  3EH4 B;  3CAP A;  3QBI A;  5A45 A;  4FA7 B;  4UHR A;  2Y04 A;  4MD2 A;  5H2K A;  5LWE A;  3OE6 A;  2R4S A;  2WJK A;  3NSB A;  2YCY A;  4IAQ A;  2Y02 A;  2R4R A;  2KSB A;  1E12 A;  2KSA A;  3AM6 A;  4LDO A;  4NC3 A;  1VGO A;  4UG2 A;  1P8U A;  3HAP A;  2JAF A;  1BM1 A;  4XT3 A;  5B6Y A;  4G7Q B;  1U19 A;  1AT9 A;  3OAX A;  4JQ6 A;  5H2I A;  3NS0 A;  5B6Z A;  4BEZ A;  2YCZ A;  4JKV A;  2YDO A;  4L35 A;  4BEY A;  3S3C B;  3PBL A;  3COC A;  5H2N A;  1FBK A;  5AX1 A;  3PDS A;  1TN5 A;  3OE8 A;  1O0A A;  1MGY A;  1L0M A;  3QJQ B;  5EN0 A;  2BRD A;  4FBZ A;  1M0M A;  1KME A;  3COD A;  1UAZ A;  5G53 A;  3V2Y A;  1C8R A;  5TGZ A;  3PQR A;  4XTL A;  1S53 A;  2JAG A;  2YDV A;  3QJT B;  3EML A;  4FAA B;  5H2J A;  4BVN A;  4GYC A;  1H68 A;  1S8J A;  4IAR A;  4MQT A;  2Y03 A;  5DYS A;  2QPD B;  3UON A;  2YCW A;  4FPD A;  1XME B;  3EH5 B;  1X0S A;  1BRX A;  4GPO A;  4N6H A;  5B6V A;  4DJH A;  3QBK A;  4X32 A;  4KLY A;  3UZA A;  3QJV B;  1L9H A;  2J4Y A;  1XIO A;  2X72 A;  4IB4 A;  1X0I 1;  3MBV A;  4WW3 A;  5B34 A;  2QPE B;  4QRY A;  2EI4 A;  3QJU B;  5H2L A;  3P0G A;  5JJE A;  1Q5J A;  1M0K A;  1E0P A;  2LNL A;  2AT9 A;  5ETZ A;  3AYM A;  5H2H A;  3VG9 A;  4GP8 B;  3SN6 R;  1F88 A;  1Q5I A;  2Y00 A;  4Y9H A;  5B6W A;  4LDE A;  5A44 A;  2G87 A;  4OV0 A;  3ABW A;  2M3G A;  5DHG A;  1PXR A;  3C9L A;  4XTO A;  3DQB A;  5G2C A;  3UG9 A;  1S51 A;  2NTW A;  4MBS A;  4GP5 B;  1TN0 A;  5BR5 A;  1DZE A;  4TL3 A;  1R2N A;  3NY9 A;  3T45 A;  1QHJ A;  4G7S B;  3ZPR A;  4HWL A;  1F50 A;  4BV0 A;  3UTY A;  2ZZL A;  5B35 A;  5H2P A;  3C9M A;  3REY A;  3AYN A;  5FJG A;  3V2W A;  4PXF A;  2Z55 A;  3VGA A;  2WJL A;  3PXO A;  1C8S A;  1GUE A;  3RFM A;  1P8H A;  4BWB A;  5B0W A;  3HAS A;  4JR8 A;  1KG9 A;  2Z73 A;  5AX0 A;  5G54 A;  2I1X A;  4AMJ A;  1AP9 A;  5ITC A;  1EHK B;  4X1H A;  3OE9 A;  4HYX A;  3VI0 A;  3NY8 A;  3OE0 A;  2YCX A;  1QM8 A;  2L6X A;  5C1M A;  3HAQ A;  3HAR A;  4XXJ A;  4N4W A;  5AWZ A;  5G2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...