The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
66
|
structure length |
65
|
Chain Sequence |
DLVQTSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb |
| molecule keywords |
Programmed cell death protein 10
|
| molecule tags |
Protein binding/transferase
|
| source organism |
Homo sapiens
|
| total genus |
26
|
| structure length |
65
|
| sequence length |
66
|
| chains with identical sequence |
D
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2012-08-02 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 | Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 3W8H B; 3W8I B; 3RQF A; 3L8J A; 3AJM A; 3L8I A; 3RQG A; 4GEH B; 3RQE A; #chains in the Genus database with same CATH topology 2F6Q A; 4U18 A; 3L8J A; 2HW5 A; 2VX2 A; 4MI2 A; 3W8H B; 1DUB A; 3Q0G A; 2EJ5 A; 4JCS A; 3AJM A; 2ZQQ A; 5KJP A; 4I52 A; 4GEH B; 3RQE A; 4EML A; 4I4Z A; 3MYB A; 3OC7 A; 3PZK A; 2FW2 A; 3QXZ A; 1EF9 A; 1HZD A; 3T89 A; 3QXI A; 1RJN A; 3HIN A; 3W8I B; 4ELX A; 3IRB A; 5JBX A; 4NNQ A; 4ZU2 A; 2FBM A; 3P5M A; 4K3W A; 3T88 A; 3TLF A; 4MOU A; 1RJM A; 3Q0J A; 3R0O A; 3A4N A; 4IZC A; 4F47 A; 3SWX A; 2DUB A; 3O4X E; 4I42 A; 1UX4 A; 4QIJ A; 3RSI A; 1Y64 B; 3QK8 A; 4KNP A; 3H02 A; 3G64 A; 3ADD A; 4FZW C; 4JOT A; 4JWV A; 2P63 A; 3RQG A; 2IEX A; 1DCI A; 1UX5 A; 1Q52 A; 3RQF A; 4IZD A; 1Q51 A; 3I47 A; 2UZF A; 4FJW D; 1UIY A; 1JXZ A; 4OLQ A; 4U1A A; 3R9T A; 3ADB A; 1MJ3 A; 4U19 A; 3H81 A; 4K2N A; 4WCZ A; 3KQF A; 3L8I A; 3T8A A; 2PBP A; 1EY3 A; 4QII A; 3R9S A; 4IZB A; 3Q1T A; 5C9G A; 4JFC A; 2ZQR A; 3MOY A; 1WZ8 A; 3A4L A; 3FDU A; 3TRR A; 2PPY A; 2QQ3 A; 4FZW A; 1NZY A; 5JBW A; 3HRX A; 4OG1 A; 4ELS A; 2GTR A; 4JYL A; 3AM1 A; 2VRE A; 3SLL A; 1NZY B; 4ELW A; 1EF8 A; 3ADC A; 3A4M A; 4NEK A; #chains in the Genus database with same CATH homology 3W8I B; 3L8J A; 3ADD A; 2P63 A; 3RQG A; 3W8H B; 3IRB A; 1UX5 A; 4NNQ A; 3RQF A; 3AJM A; 3A4L A; 4GEH B; 3RQE A; 1RJM A; 3ADB A; 3A4N A; 3AM1 A; 3O4X E; 1UX4 A; 3ADC A; 3A4M A; 3L8I A; 1Y64 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...