4A4MA

Crystal structure of the light-activated constitutively active n2c, m257y,d282c rhodopsin mutant in complex with a peptide resembling the c-terminus of the galpha-protein subunit (gact)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
326
structure length
326
Chain Sequence
MCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIYVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RHODOPSIN
publication title Stabilized G Protein Binding Site in the Structure of Constitutively Active Metarhodopsin-II.
pubmed doi rcsb
source organism Bos taurus
total genus 128
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
A PF10413 Rhodopsin_N Amino terminal of the G-protein receptor rhodopsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4a4mA00
5H2PA 4NC3A 3HAQA 3RZEA 1KG9A 1JV7A 4LDLA 5H2IA 4GYCA 1H2SA 3A7KA 4UHRA 4XTLA 2F95A 1QKPA 3UZCA 1TN5A 3V2YA 1C3WA 4EA3A 3CODA 3S3BB 1GUEA 4QRYA 5BR2A 3REYA 1R84A 1L0MA 2KS9A 1KGBA 1M0MA 1GU8A 2PEDA 2M3GA 5AWZA 2JAFA 3HAPA 5A8EA 4G7QB 4FBZA 4WAVA 5ETZA 3PXOA 4X32A 1MGYA 1U19A 1VGOA 3QJTB 4KNFA 3NY8A 1DZEA 5G36A 5DYSA 4FAAB 1XJIA 3QAPA 2I20A 1P8IA 3AM6A 1E12A 3EH5B 3UONA 5G53A 4BEYA 1M0KA 4QI1A 3UZAA 3NS0A 1TN0A 2J4YA 5B6YA 3X3BA 2KSAA 2Y03A 3UTVA 3QJUB 3HARA 3EMLA 3COCA 2Y02A 4IAQA 1JV6A 3UG9A 3QBIA 4EIYA 3PDSA 3T45A 5KKHA 4BWBA 5FJGA 3SN6R 5H2HA 4MQTA 3P0GA 2I35A 3S8FB 1E0PA 3OE6A 2HPYA 3QJRB 1P8UA 4G7SB 4K5YA 3PQRA 3OE0A 1F50A 5LWEA 2R4RA 3EH3B 5AHZA 2VT4A 3S3DB 3EH4B 1IXFA 2G87A 3OAXA 4GP4B 4TL3A 1UCQA 2Z55A 4FA7B 4G7RB 5H2NA 5AX1A 1AP9A 4HWLA 1JFPA 2QPDB 1HZXA 1CWQA 4XTNA 1XIOA 2AT9A 3QDCA 5J7AA 2WJKA 3NSBA 5ITEA 2I21A 4EJ4A 3ZPQA 1AT9A 4N4WA 1GZMA 5B6XA 3ABWA 1IW6A 4G71B 4GP5B 5AHYA 3C9LA 3HAOA 4HYXA 3QBLA 1BRDA 4BEZA 1S53A 4DKLA 4GRVA 5C1MA 3VGAA 1KG8A 2YCZA 2X72A 3S3CB 3VVKA 2YDVA 3DQBA 1EHKB 2F93A 4QIDA 3UTWA 1UAZA 3VHZA 3PBLA 4FPDA 4MQSA 4L35A 5B6VA 5G54A 3S8GB 4XXJA 2KSBA 1S8JA 3V2WA 2ZFEA 4Y9HA 5AZDA 4L6RA 4XT3A 3AYMA 5B0WA 2Y04A 5F8UA 3MBVA 4GPOA 3PWHA 5B35A 1VJMA 4X1HA 4MD2A 4N6HA 1H68A 2QPEB 4UG2A 4JQ6A 3NYAA 5H2KA 5TGZA 4J4QA 3VW7A 5B34A 3VG9A 4N4YB 5G28A 1C8RA 5DHGA 1X0I1 1M0LA 1S51A 4IARA 3QJVB 4G70B 4DJHA 1KMEA 3UTYA 4JR8A 2Y00A 4OV0A 1PY6A 4MD1A 4BV0A 2Y01A 3QAKA 3ZEVA 5JJEA 1O0AA 2R4SA 2EI4A 4MBSA 5B6WA 2NTWA 1S8LA 3ZPRA 1LN6A 1BRRA 3CAPA 4LDEA 2KSYA 3QJQB 1R2NA 1Q5IA 2YCXA 4BUOA 2ZZLA 3ODUA 5H2LA 5A45A 4DAJA 2I1XA 3HANA 4WW3A 2YCYA 4JKVA 1P8HA 1PXRA 1QKOA 1BM1A 4LDOA 3QBKA 4IB4A 5H2MA 1QM8A 2WJLA 5EN0A 2Z73A 3DDLA 4KLYA 1X0SA 1BRXA 1L9HA 3WQJA 3UTXA 4AMJA 3X3CA 3KJ6A 5AX0A 2LNLA 3VI0A 4GP8B 5ITCA 3OE8A 4A4MA 5DHHA 1F4ZA 4XT1A 4PXFA 3RFMA 1S54A 1JGJA 3C9MA 5JJNA 5JJJA 4AMIA 1PXSA 5B2NA 3BVDB 2L6XA 2RH1A 3QBGA 5G2AA 1F88A 4XTOA 4GBRA 3QJSB 4PXKA 2JAGA 2ZIYA 5H2JA 4HYJA 1C8SA 3NY9A 5G2DA 5H2OA 2YCWA 1IW9A 1FBKA 1XMEB 5B6ZA 1FBBA 2YDOA 5BR5A 5G2CA 5A44A 3OE9A 4G72B 1S52A 1QHJA 1Q5JA 3HASA 2BRDA 4X31A 3AYNA 2NTUA 1X0K1 4BVNA 3D4SA
chains in the Genus database with same CATH superfamily
5H2PA 4NC3A 3HAQA 3RZEA 1KG9A 1JV7A 4LDLA 5H2IA 4GYCA 1H2SA 3A7KA 4UHRA 4XTLA 2F95A 1QKPA 3UZCA 1TN5A 3V2YA 1C3WA 4EA3A 4DS7E 3CODA 3S3BB 1GUEA 4QRYA 5BR2A 3REYA 1R84A 1L0MA 2KS9A 1KGBA 1M0MA 1GU8A 2PEDA 2M3GA 5AWZA 2JAFA 3HAPA 5A8EA 4G7QB 4FBZA 4WAVA 5ETZA 3PXOA 4X32A 1MGYA 1U19A 1VGOA 3QJTB 4KNFA 3NY8A 1DZEA 5G36A 5DYSA 4FAAB 1XJIA 3QAPA 2I20A 1P8IA 3AM6A 1E12A 3EH5B 3UONA 5G53A 4BEYA 1M0KA 4QI1A 3UZAA 3NS0A 1TN0A 2J4YA 5B6YA 3X3BA 2KSAA 2Y03A 3UTVA 3QJUB 3HARA 3EMLA 3COCA 2Y02A 4IAQA 1JV6A 3UG9A 3QBIA 4EIYA 3PDSA 3T45A 5KKHA 4BWBA 5FJGA 3SN6R 5H2HA 4MQTA 3P0GA 2I35A 3S8FB 1E0PA 3OE6A 2HPYA 3QJRB 1P8UA 4G7SB 4K5YA 3PQRA 3OE0A 1F50A 5LWEA 2R4RA 3EH3B 5AHZA 2VT4A 3S3DB 3EH4B 1IXFA 2G87A 3OAXA 4GP4B 4TL3A 1UCQA 2Z55A 4FA7B 4G7RB 5H2NA 5AX1A 1AP9A 4HWLA 1JFPA 2QPDB 1HZXA 1CWQA 4XTNA 1XIOA 2AT9A 3QDCA 5J7AA 2WJKA 3NSBA 5ITEA 2I21A 4EJ4A 3ZPQA 1AT9A 4N4WA 1GZMA 5B6XA 3ABWA 1IW6A 4G71B 4GP5B 5AHYA 3C9LA 3HAOA 4HYXA 3QBLA 1BRDA 4BEZA 1S53A 4DKLA 4GRVA 5C1MA 3VGAA 1KG8A 2YCZA 2X72A 3S3CB 3VVKA 2YDVA 3DQBA 1EHKB 2F93A 4QIDA 3UTWA 1UAZA 3VHZA 3PBLA 4FPDA 4MQSA 4L35A 5B6VA 5G54A 3S8GB 4XXJA 2KSBA 1S8JA 3V2WA 2ZFEA 4Y9HA 5AZDA 4L6RA 4XT3A 3AYMA 5B0WA 2Y04A 5F8UA 3MBVA 4GPOA 3PWHA 5B35A 1VJMA 4X1HA 4MD2A 4N6HA 1H68A 2QPEB 4UG2A 4JQ6A 3NYAA 5H2KA 5TGZA 4J4QA 3VW7A 5B34A 3VG9A 4N4YB 5G28A 1C8RA 5DHGA 1X0I1 1M0LA 1S51A 4IARA 3QJVB 4G70B 4DJHA 1KMEA 3UTYA 4JR8A 2Y00A 4OV0A 1PY6A 4MD1A 4BV0A 2Y01A 3QAKA 3ZEVA 5JJEA 1O0AA 2R4SA 2EI4A 4MBSA 5B6WA 2NTWA 1S8LA 3ZPRA 1LN6A 1BRRA 3CAPA 4LDEA 2KSYA 3QJQB 1R2NA 1Q5IA 2YCXA 4BUOA 2ZZLA 3ODUA 5H2LA 5A45A 4DAJA 2I1XA 3HANA 4WW3A 2YCYA 4JKVA 1P8HA 1PXRA 1QKOA 1BM1A 4LDOA 3QBKA 4IB4A 5H2MA 1QM8A 2WJLA 5EN0A 2Z73A 3DDLA 4KLYA 1X0SA 1BRXA 1L9HA 3WQJA 3UTXA 4AMJA 3X3CA 3KJ6A 5AX0A 2LNLA 3VI0A 4GP8B 5ITCA 3OE8A 4A4MA 5DHHA 1F4ZA 4XT1A 4PXFA 3RFMA 1S54A 1JGJA 3C9MA 5JJNA 5JJJA 4AMIA 1PXSA 5B2NA 3BVDB 2L6XA 2RH1A 3QBGA 5G2AA 1F88A 4XTOA 4GBRA 3QJSB 4PXKA 2JAGA 2ZIYA 5H2JA 4HYJA 1C8SA 3NY9A 5G2DA 5H2OA 2YCWA 1IW9A 1FBKA 1XMEB 5B6ZA 1FBBA 2YDOA 5BR5A 5G2CA 5A44A 3OE9A 4G72B 1S52A 1QHJA 1Q5JA 3HASA 2BRDA 4X31A 3AYNA 2NTUA 1X0K1 4BVNA 3D4SA
chains in the Genus database with same CATH topology
5H2PA 4NC3A 3HAQA 3RZEA 1KG9A 1JV7A 4LDLA 5H2IA 4GYCA 1H2SA 3A7KA 4UHRA 4XTLA 2F95A 1QKPA 3UZCA 1TN5A 3V2YA 1C3WA 4EA3A 4DS7E 3CODA 3S3BB 1GUEA 4QRYA 5BR2A 3REYA 1R84A 1L0MA 2KS9A 1KGBA 1M0MA 1GU8A 2PEDA 2M3GA 5AWZA 2JAFA 3HAPA 5A8EA 4G7QB 4FBZA 4WAVA 5ETZA 3PXOA 4X32A 1MGYA 1U19A 1VGOA 3QJTB 4KNFA 3NY8A 1DZEA 5G36A 5DYSA 4FAAB 1XJIA 3QAPA 2I20A 1P8IA 3AM6A 1E12A 3EH5B 3UONA 5G53A 4BEYA 1M0KA 4QI1A 3UZAA 3NS0A 1TN0A 2J4YA 5B6YA 3X3BA 2KSAA 2Y03A 3UTVA 3QJUB 3HARA 3EMLA 3COCA 2Y02A 4IAQA 1JV6A 3UG9A 3QBIA 4EIYA 3PDSA 3T45A 5KKHA 4BWBA 5FJGA 3SN6R 5H2HA 4MQTA 3P0GA 2I35A 3S8FB 1E0PA 3OE6A 2HPYA 3QJRB 1P8UA 4G7SB 4K5YA 3PQRA 3OE0A 1F50A 5LWEA 2R4RA 3EH3B 5AHZA 2VT4A 3S3DB 3EH4B 1IXFA 2G87A 3OAXA 4GP4B 4TL3A 1UCQA 2Z55A 4FA7B 4G7RB 5H2NA 5AX1A 1AP9A 4HWLA 1JFPA 2QPDB 1HZXA 1CWQA 4XTNA 1XIOA 2AT9A 3QDCA 5J7AA 2WJKA 3NSBA 5ITEA 2I21A 4EJ4A 3ZPQA 1AT9A 4N4WA 1GZMA 5B6XA 3ABWA 1IW6A 4G71B 4GP5B 5AHYA 3C9LA 3HAOA 4HYXA 3QBLA 1BRDA 4BEZA 1S53A 4DKLA 4GRVA 5C1MA 3VGAA 1KG8A 2YCZA 2X72A 3S3CB 3VVKA 2YDVA 3DQBA 1EHKB 2F93A 4QIDA 3UTWA 1UAZA 3VHZA 3PBLA 4FPDA 4MQSA 4L35A 5B6VA 5G54A 3S8GB 4XXJA 2KSBA 1S8JA 3V2WA 2ZFEA 4Y9HA 5AZDA 4L6RA 4XT3A 3AYMA 5B0WA 2Y04A 5F8UA 3MBVA 4GPOA 3PWHA 5B35A 1VJMA 4X1HA 4MD2A 4N6HA 1H68A 2QPEB 4UG2A 4JQ6A 3NYAA 5H2KA 5TGZA 4J4QA 3VW7A 5B34A 3VG9A 4N4YB 5G28A 1C8RA 5DHGA 1X0I1 1M0LA 1S51A 4IARA 3QJVB 4G70B 4DJHA 1KMEA 3UTYA 4JR8A 2Y00A 4OV0A 1PY6A 4MD1A 4BV0A 2Y01A 3QAKA 3ZEVA 5JJEA 1O0AA 2R4SA 2EI4A 4MBSA 5B6WA 2NTWA 1S8LA 3ZPRA 1LN6A 1BRRA 3CAPA 4LDEA 2KSYA 3QJQB 1R2NA 1Q5IA 2YCXA 4BUOA 2ZZLA 3ODUA 5H2LA 5A45A 4DAJA 2I1XA 3HANA 4WW3A 2YCYA 4JKVA 1P8HA 1PXRA 1QKOA 1BM1A 4LDOA 3QBKA 4IB4A 5H2MA 1QM8A 2WJLA 5EN0A 2Z73A 3DDLA 4KLYA 1X0SA 1BRXA 1L9HA 3WQJA 3UTXA 4AMJA 3X3CA 3KJ6A 5AX0A 2LNLA 3VI0A 4GP8B 5ITCA 3OE8A 4A4MA 5DHHA 1F4ZA 4XT1A 4PXFA 3RFMA 1S54A 1JGJA 3C9MA 5JJNA 5JJJA 4AMIA 1PXSA 5B2NA 3BVDB 2L6XA 2RH1A 3QBGA 5G2AA 1F88A 4XTOA 4GBRA 3QJSB 4PXKA 2JAGA 2ZIYA 5H2JA 4HYJA 1C8SA 3NY9A 5G2DA 5H2OA 2YCWA 1IW9A 1FBKA 1XMEB 5B6ZA 1FBBA 2YDOA 5BR5A 5G2CA 5A44A 3OE9A 4G72B 1S52A 1QHJA 1Q5JA 3HASA 2BRDA 4X31A 3AYNA 2NTUA 1X0K1 4BVNA 3D4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2P A;  4NC3 A;  3HAQ A;  3RZE A;  1KG9 A;  1JV7 A;  4LDL A;  5H2I A;  4GYC A;  1H2S A;  3A7K A;  4UHR A;  4XTL A;  2F95 A;  1QKP A;  3UZC A;  1TN5 A;  3V2Y A;  1C3W A;  4EA3 A;  3COD A;  3S3B B;  1GUE A;  4QRY A;  5BR2 A;  3REY A;  1R84 A;  1L0M A;  2KS9 A;  1KGB A;  1M0M A;  1GU8 A;  2PED A;  2M3G A;  5AWZ A;  2JAF A;  3HAP A;  5A8E A;  4G7Q B;  4FBZ A;  4WAV A;  5ETZ A;  3PXO A;  4X32 A;  1MGY A;  1U19 A;  1VGO A;  3QJT B;  4KNF A;  3NY8 A;  1DZE A;  5G36 A;  5DYS A;  4FAA B;  1XJI A;  3QAP A;  2I20 A;  1P8I A;  3AM6 A;  1E12 A;  3EH5 B;  3UON A;  5G53 A;  4BEY A;  1M0K A;  4QI1 A;  3UZA A;  3NS0 A;  1TN0 A;  2J4Y A;  5B6Y A;  3X3B A;  2KSA A;  2Y03 A;  3UTV A;  3QJU B;  3HAR A;  3EML A;  3COC A;  2Y02 A;  4IAQ A;  1JV6 A;  3UG9 A;  3QBI A;  4EIY A;  3PDS A;  3T45 A;  5KKH A;  4BWB A;  5FJG A;  3SN6 R;  5H2H A;  4MQT A;  3P0G A;  2I35 A;  3S8F B;  1E0P A;  3OE6 A;  2HPY A;  3QJR B;  1P8U A;  4G7S B;  4K5Y A;  3PQR A;  3OE0 A;  1F50 A;  5LWE A;  2R4R A;  3EH3 B;  5AHZ A;  2VT4 A;  3S3D B;  3EH4 B;  1IXF A;  2G87 A;  3OAX A;  4GP4 B;  4TL3 A;  1UCQ A;  2Z55 A;  4FA7 B;  4G7R B;  5H2N A;  5AX1 A;  1AP9 A;  4HWL A;  1JFP A;  2QPD B;  1HZX A;  1CWQ A;  4XTN A;  1XIO A;  2AT9 A;  3QDC A;  5J7A A;  2WJK A;  3NSB A;  5ITE A;  2I21 A;  4EJ4 A;  3ZPQ A;  1AT9 A;  4N4W A;  1GZM A;  5B6X A;  3ABW A;  1IW6 A;  4G71 B;  4GP5 B;  5AHY A;  3C9L A;  3HAO A;  4HYX A;  3QBL A;  1BRD A;  4BEZ A;  1S53 A;  4DKL A;  4GRV A;  5C1M A;  3VGA A;  1KG8 A;  2YCZ A;  2X72 A;  3S3C B;  3VVK A;  2YDV A;  3DQB A;  1EHK B;  2F93 A;  4QID A;  3UTW A;  1UAZ A;  3VHZ A;  3PBL A;  4FPD A;  4MQS A;  4L35 A;  5B6V A;  5G54 A;  3S8G B;  4XXJ A;  2KSB A;  1S8J A;  3V2W A;  2ZFE A;  4Y9H A;  5AZD A;  4L6R A;  4XT3 A;  3AYM A;  5B0W A;  2Y04 A;  5F8U A;  3MBV A;  4GPO A;  3PWH A;  5B35 A;  1VJM A;  4X1H A;  4MD2 A;  4N6H A;  1H68 A;  2QPE B;  4UG2 A;  4JQ6 A;  3NYA A;  5H2K A;  5TGZ A;  4J4Q A;  3VW7 A;  5B34 A;  3VG9 A;  4N4Y B;  5G28 A;  1C8R A;  5DHG A;  1X0I 1;  1M0L A;  1S51 A;  4IAR A;  3QJV B;  4G70 B;  4DJH A;  1KME A;  3UTY A;  4JR8 A;  2Y00 A;  4OV0 A;  1PY6 A;  4MD1 A;  4BV0 A;  2Y01 A;  3QAK A;  3ZEV A;  5JJE A;  1O0A A;  2R4S A;  2EI4 A;  4MBS A;  5B6W A;  2NTW A;  1S8L A;  3ZPR A;  1LN6 A;  1BRR A;  3CAP A;  4LDE A;  2KSY A;  3QJQ B;  1R2N A;  1Q5I A;  2YCX A;  4BUO A;  2ZZL A;  3ODU A;  5H2L A;  5A45 A;  4DAJ A;  2I1X A;  3HAN A;  4WW3 A;  2YCY A;  4JKV A;  1P8H A;  1PXR A;  1QKO A;  1BM1 A;  4LDO A;  3QBK A;  4IB4 A;  5H2M A;  1QM8 A;  2WJL A;  5EN0 A;  2Z73 A;  3DDL A;  4KLY A;  1X0S A;  1BRX A;  1L9H A;  3WQJ A;  3UTX A;  4AMJ A;  3X3C A;  3KJ6 A;  5AX0 A;  2LNL A;  3VI0 A;  4GP8 B;  5ITC A;  3OE8 A;  4A4M A;  5DHH A;  1F4Z A;  4XT1 A;  4PXF A;  3RFM A;  1S54 A;  1JGJ A;  3C9M A;  5JJN A;  5JJJ A;  4AMI A;  1PXS A;  5B2N A;  3BVD B;  2L6X A;  2RH1 A;  3QBG A;  5G2A A;  1F88 A;  4XTO A;  4GBR A;  3QJS B;  4PXK A;  2JAG A;  2ZIY A;  5H2J A;  4HYJ A;  1C8S A;  3NY9 A;  5G2D A;  5H2O A;  2YCW A;  1IW9 A;  1FBK A;  1XME B;  5B6Z A;  1FBB A;  2YDO A;  5BR5 A;  5G2C A;  5A44 A;  3OE9 A;  4G72 B;  1S52 A;  1QHJ A;  1Q5J A;  3HAS A;  2BRD A;  4X31 A;  3AYN A;  2NTU A;  1X0K 1;  4BVN A;  3D4S A; 
#chains in the Genus database with same CATH topology
 5H2P A;  4NC3 A;  3HAQ A;  3RZE A;  1KG9 A;  1JV7 A;  4LDL A;  5H2I A;  4GYC A;  1H2S A;  3A7K A;  4UHR A;  4XTL A;  2F95 A;  1QKP A;  3UZC A;  1TN5 A;  3V2Y A;  1C3W A;  4EA3 A;  4DS7 E;  3COD A;  3S3B B;  1GUE A;  4QRY A;  5BR2 A;  3REY A;  1R84 A;  1L0M A;  2KS9 A;  1KGB A;  1M0M A;  1GU8 A;  2PED A;  2M3G A;  5AWZ A;  2JAF A;  3HAP A;  5A8E A;  4G7Q B;  4FBZ A;  4WAV A;  5ETZ A;  3PXO A;  4X32 A;  1MGY A;  1U19 A;  1VGO A;  3QJT B;  4KNF A;  3NY8 A;  1DZE A;  5G36 A;  5DYS A;  4FAA B;  1XJI A;  3QAP A;  2I20 A;  1P8I A;  3AM6 A;  1E12 A;  3EH5 B;  3UON A;  5G53 A;  4BEY A;  1M0K A;  4QI1 A;  3UZA A;  3NS0 A;  1TN0 A;  2J4Y A;  5B6Y A;  3X3B A;  2KSA A;  2Y03 A;  3UTV A;  3QJU B;  3HAR A;  3EML A;  3COC A;  2Y02 A;  4IAQ A;  1JV6 A;  3UG9 A;  3QBI A;  4EIY A;  3PDS A;  3T45 A;  5KKH A;  4BWB A;  5FJG A;  3SN6 R;  5H2H A;  4MQT A;  3P0G A;  2I35 A;  3S8F B;  1E0P A;  3OE6 A;  2HPY A;  3QJR B;  1P8U A;  4G7S B;  4K5Y A;  3PQR A;  3OE0 A;  1F50 A;  5LWE A;  2R4R A;  3EH3 B;  5AHZ A;  2VT4 A;  3S3D B;  3EH4 B;  1IXF A;  2G87 A;  3OAX A;  4GP4 B;  4TL3 A;  1UCQ A;  2Z55 A;  4FA7 B;  4G7R B;  5H2N A;  5AX1 A;  1AP9 A;  4HWL A;  1JFP A;  2QPD B;  1HZX A;  1CWQ A;  4XTN A;  1XIO A;  2AT9 A;  3QDC A;  5J7A A;  2WJK A;  3NSB A;  5ITE A;  2I21 A;  4EJ4 A;  3ZPQ A;  1AT9 A;  4N4W A;  1GZM A;  5B6X A;  3ABW A;  1IW6 A;  4G71 B;  4GP5 B;  5AHY A;  3C9L A;  3HAO A;  4HYX A;  3QBL A;  1BRD A;  4BEZ A;  1S53 A;  4DKL A;  4GRV A;  5C1M A;  3VGA A;  1KG8 A;  2YCZ A;  2X72 A;  3S3C B;  3VVK A;  2YDV A;  3DQB A;  1EHK B;  2F93 A;  4QID A;  3UTW A;  1UAZ A;  3VHZ A;  3PBL A;  4FPD A;  4MQS A;  4L35 A;  5B6V A;  5G54 A;  3S8G B;  4XXJ A;  2KSB A;  1S8J A;  3V2W A;  2ZFE A;  4Y9H A;  5AZD A;  4L6R A;  4XT3 A;  3AYM A;  5B0W A;  2Y04 A;  5F8U A;  3MBV A;  4GPO A;  3PWH A;  5B35 A;  1VJM A;  4X1H A;  4MD2 A;  4N6H A;  1H68 A;  2QPE B;  4UG2 A;  4JQ6 A;  3NYA A;  5H2K A;  5TGZ A;  4J4Q A;  3VW7 A;  5B34 A;  3VG9 A;  4N4Y B;  5G28 A;  1C8R A;  5DHG A;  1X0I 1;  1M0L A;  1S51 A;  4IAR A;  3QJV B;  4G70 B;  4DJH A;  1KME A;  3UTY A;  4JR8 A;  2Y00 A;  4OV0 A;  1PY6 A;  4MD1 A;  4BV0 A;  2Y01 A;  3QAK A;  3ZEV A;  5JJE A;  1O0A A;  2R4S A;  2EI4 A;  4MBS A;  5B6W A;  2NTW A;  1S8L A;  3ZPR A;  1LN6 A;  1BRR A;  3CAP A;  4LDE A;  2KSY A;  3QJQ B;  1R2N A;  1Q5I A;  2YCX A;  4BUO A;  2ZZL A;  3ODU A;  5H2L A;  5A45 A;  4DAJ A;  2I1X A;  3HAN A;  4WW3 A;  2YCY A;  4JKV A;  1P8H A;  1PXR A;  1QKO A;  1BM1 A;  4LDO A;  3QBK A;  4IB4 A;  5H2M A;  1QM8 A;  2WJL A;  5EN0 A;  2Z73 A;  3DDL A;  4KLY A;  1X0S A;  1BRX A;  1L9H A;  3WQJ A;  3UTX A;  4AMJ A;  3X3C A;  3KJ6 A;  5AX0 A;  2LNL A;  3VI0 A;  4GP8 B;  5ITC A;  3OE8 A;  4A4M A;  5DHH A;  1F4Z A;  4XT1 A;  4PXF A;  3RFM A;  1S54 A;  1JGJ A;  3C9M A;  5JJN A;  5JJJ A;  4AMI A;  1PXS A;  5B2N A;  3BVD B;  2L6X A;  2RH1 A;  3QBG A;  5G2A A;  1F88 A;  4XTO A;  4GBR A;  3QJS B;  4PXK A;  2JAG A;  2ZIY A;  5H2J A;  4HYJ A;  1C8S A;  3NY9 A;  5G2D A;  5H2O A;  2YCW A;  1IW9 A;  1FBK A;  1XME B;  5B6Z A;  1FBB A;  2YDO A;  5BR5 A;  5G2C A;  5A44 A;  3OE9 A;  4G72 B;  1S52 A;  1QHJ A;  1Q5J A;  3HAS A;  2BRD A;  4X31 A;  3AYN A;  2NTU A;  1X0K 1;  4BVN A;  3D4S A; 
#chains in the Genus database with same CATH homology
 5H2P A;  4NC3 A;  3HAQ A;  3RZE A;  1KG9 A;  1JV7 A;  4LDL A;  5H2I A;  4GYC A;  1H2S A;  3A7K A;  4UHR A;  4XTL A;  2F95 A;  1QKP A;  3UZC A;  1TN5 A;  3V2Y A;  1C3W A;  4EA3 A;  4DS7 E;  3COD A;  3S3B B;  1GUE A;  4QRY A;  5BR2 A;  3REY A;  1R84 A;  1L0M A;  2KS9 A;  1KGB A;  1M0M A;  1GU8 A;  2PED A;  2M3G A;  5AWZ A;  2JAF A;  3HAP A;  5A8E A;  4G7Q B;  4FBZ A;  4WAV A;  5ETZ A;  3PXO A;  4X32 A;  1MGY A;  1U19 A;  1VGO A;  3QJT B;  4KNF A;  3NY8 A;  1DZE A;  5G36 A;  5DYS A;  4FAA B;  1XJI A;  3QAP A;  2I20 A;  1P8I A;  3AM6 A;  1E12 A;  3EH5 B;  3UON A;  5G53 A;  4BEY A;  1M0K A;  4QI1 A;  3UZA A;  3NS0 A;  1TN0 A;  2J4Y A;  5B6Y A;  3X3B A;  2KSA A;  2Y03 A;  3UTV A;  3QJU B;  3HAR A;  3EML A;  3COC A;  2Y02 A;  4IAQ A;  1JV6 A;  3UG9 A;  3QBI A;  4EIY A;  3PDS A;  3T45 A;  5KKH A;  4BWB A;  5FJG A;  3SN6 R;  5H2H A;  4MQT A;  3P0G A;  2I35 A;  3S8F B;  1E0P A;  3OE6 A;  2HPY A;  3QJR B;  1P8U A;  4G7S B;  4K5Y A;  3PQR A;  3OE0 A;  1F50 A;  5LWE A;  2R4R A;  3EH3 B;  5AHZ A;  2VT4 A;  3S3D B;  3EH4 B;  1IXF A;  2G87 A;  3OAX A;  4GP4 B;  4TL3 A;  1UCQ A;  2Z55 A;  4FA7 B;  4G7R B;  5H2N A;  5AX1 A;  1AP9 A;  4HWL A;  1JFP A;  2QPD B;  1HZX A;  1CWQ A;  4XTN A;  1XIO A;  2AT9 A;  3QDC A;  5J7A A;  2WJK A;  3NSB A;  5ITE A;  2I21 A;  4EJ4 A;  3ZPQ A;  1AT9 A;  4N4W A;  1GZM A;  5B6X A;  3ABW A;  1IW6 A;  4G71 B;  4GP5 B;  5AHY A;  3C9L A;  3HAO A;  4HYX A;  3QBL A;  1BRD A;  4BEZ A;  1S53 A;  4DKL A;  4GRV A;  5C1M A;  3VGA A;  1KG8 A;  2YCZ A;  2X72 A;  3S3C B;  3VVK A;  2YDV A;  3DQB A;  1EHK B;  2F93 A;  4QID A;  3UTW A;  1UAZ A;  3VHZ A;  3PBL A;  4FPD A;  4MQS A;  4L35 A;  5B6V A;  5G54 A;  3S8G B;  4XXJ A;  2KSB A;  1S8J A;  3V2W A;  2ZFE A;  4Y9H A;  5AZD A;  4L6R A;  4XT3 A;  3AYM A;  5B0W A;  2Y04 A;  5F8U A;  3MBV A;  4GPO A;  3PWH A;  5B35 A;  1VJM A;  4X1H A;  4MD2 A;  4N6H A;  1H68 A;  2QPE B;  4UG2 A;  4JQ6 A;  3NYA A;  5H2K A;  5TGZ A;  4J4Q A;  3VW7 A;  5B34 A;  3VG9 A;  4N4Y B;  5G28 A;  1C8R A;  5DHG A;  1X0I 1;  1M0L A;  1S51 A;  4IAR A;  3QJV B;  4G70 B;  4DJH A;  1KME A;  3UTY A;  4JR8 A;  2Y00 A;  4OV0 A;  1PY6 A;  4MD1 A;  4BV0 A;  2Y01 A;  3QAK A;  3ZEV A;  5JJE A;  1O0A A;  2R4S A;  2EI4 A;  4MBS A;  5B6W A;  2NTW A;  1S8L A;  3ZPR A;  1LN6 A;  1BRR A;  3CAP A;  4LDE A;  2KSY A;  3QJQ B;  1R2N A;  1Q5I A;  2YCX A;  4BUO A;  2ZZL A;  3ODU A;  5H2L A;  5A45 A;  4DAJ A;  2I1X A;  3HAN A;  4WW3 A;  2YCY A;  4JKV A;  1P8H A;  1PXR A;  1QKO A;  1BM1 A;  4LDO A;  3QBK A;  4IB4 A;  5H2M A;  1QM8 A;  2WJL A;  5EN0 A;  2Z73 A;  3DDL A;  4KLY A;  1X0S A;  1BRX A;  1L9H A;  3WQJ A;  3UTX A;  4AMJ A;  3X3C A;  3KJ6 A;  5AX0 A;  2LNL A;  3VI0 A;  4GP8 B;  5ITC A;  3OE8 A;  4A4M A;  5DHH A;  1F4Z A;  4XT1 A;  4PXF A;  3RFM A;  1S54 A;  1JGJ A;  3C9M A;  5JJN A;  5JJJ A;  4AMI A;  1PXS A;  5B2N A;  3BVD B;  2L6X A;  2RH1 A;  3QBG A;  5G2A A;  1F88 A;  4XTO A;  4GBR A;  3QJS B;  4PXK A;  2JAG A;  2ZIY A;  5H2J A;  4HYJ A;  1C8S A;  3NY9 A;  5G2D A;  5H2O A;  2YCW A;  1IW9 A;  1FBK A;  1XME B;  5B6Z A;  1FBB A;  2YDO A;  5BR5 A;  5G2C A;  5A44 A;  3OE9 A;  4G72 B;  1S52 A;  1QHJ A;  1Q5J A;  3HAS A;  2BRD A;  4X31 A;  3AYN A;  2NTU A;  1X0K 1;  4BVN A;  3D4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...