4AMIA

Turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist bucindolol
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
298
structure length
282
Chain Sequence
AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords BETA-1 ADRENERGIC RECEPTOR
publication title Crystal Structures of a Stabilized Beta1-Adrenoceptor Bound to the Biased Agonists Bucindolol and Carvedilol
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 114
structure length 282
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4amiA00
5H2MA 3UZAA 5JJNA 4KLYA 1S8LA 1QKOA 4BEYA 4HWLA 4PXKA 1C3WA 1UCQA 4MQTA 4DKLA 3S8FB 3UZCA 4K5YA 1GU8A 4GPOA 1C8SA 4BUOA 4PXFA 4LDLA 2YDOA 2YCWA 4L35A 4FA7B 2BRDA 2ZIYA 1GUEA 3ZEVA 3ABWA 4G7RB 2KSBA 3QBLA 4G71B 1DZEA 4XTLA 4JKVA 1X0K1 5EN0A 1F50A 1P8UA 3EH3B 5B0WA 3QJSB 5B35A 2I1XA 1S52A 2PEDA 1VJMA 1QM8A 2I35A 1P8HA 5B6XA 5G2DA 4LDEA 1F4ZA 4JR8A 3PWHA 3ODUA 4BWBA 4UG2A 2NTUA 3PDSA 4GP5B 3C9MA 2G87A 1IW9A 3VI0A 3OE9A 1E0PA 1MGYA 4BEZA 4DAJA 5KKHA 1O0AA 4KNFA 5C1MA 1S53A 2EI4A 2KSAA 3S8GB 3V2WA 3HANA 4MBSA 1M0LA 5H2HA 4MQSA 3S3CB 2YCXA 4GRVA 5G54A 4MD1A 1AT9A 4TL3A 1S54A 4NC3A 4XTNA 3SN6R 1CWQA 2ZFEA 4QRYA 3QJQB 1JGJA 5H2LA 5AWZA 5H2KA 1JV6A 5B2NA 3EMLA 4BV0A 3QJUB 5H2IA 3HAQA 1X0SA 3HARA 2KS9A 4XT3A 5BR5A 5H2NA 1FBKA 4IARA 2L6XA 4G7SB 3HAOA 3VHZA 3PBLA 1IXFA 5AHZA 3BVDB 3ZPQA 3UTYA 2ZZLA 5A8EA 4G7QB 5AX0A 1BRRA 4L6RA 5B6WA 4QIDA 3S3BB 3MBVA 3S3DB 3PXOA 3VGAA 3NY9A 5DYSA 5BR2A 1GZMA 4XT1A 3VW7A 1AP9A 3UG9A 4EA3A 2QPDB 4IAQA 1F88A 3V2YA 5AX1A 4XTOA 1XJIA 1H2SA 1S8JA 1PXSA 2Y03A 3RFMA 4J4QA 4JQ6A 4X1HA 1JFPA 1PXRA 3HASA 5TGZA 1BM1A 3ZPRA 3A7KA 1VGOA 3HAPA 4DJHA 3QAKA 4AMJA 2I21A 4EIYA 2J4YA 3P0GA 1FBBA 5JJJA 4EJ4A 1E12A 2YDVA 4Y9HA 2Z55A 5LWEA 1KGBA 4HYXA 3CODA 5B6ZA 1QKPA 5H2PA 3C9LA 4GYCA 4A4MA 3WQJA 1L0MA 3T45A 3RZEA 2HPYA 3NSBA 3NS0A 4G72B 5AHYA 1R84A 1KMEA 3NYAA 3X3BA 5A45A 5H2OA 2YCYA 5ITEA 1BRXA 5H2JA 2QPEB 3NY8A 3OAXA 4QI1A 1XIOA 2JAGA 5AZDA 3UONA 1QHJA 5G2AA 2Y00A 2JAFA 3CAPA 3DQBA 3QJTB 2Y02A 1TN0A 2AT9A 5A44A 2I20A 4IB4A 1KG8A 3QAPA 3EH5B 2Y01A 4UHRA 1PY6A 2LNLA 3QJRB 1M0KA 5J7AA 3EH4B 5DHHA 4N4WA 4G70B 3QBKA 1U19A 2KSYA 3UTXA 4GP8B 2Z73A 2Y04A 1R2NA 4N4YB 5G36A 2YCZA 4WAVA 4BVNA 2M3GA 1P8IA 4GBRA 1LN6A 4FAAB 4OV0A 5B6VA 2WJLA 5DHGA 1C8RA 2VT4A 1KG9A 5B6YA 3UTWA 5B34A 3AM6A 2NTWA 5ETZA 4LDOA 4AMIA 4WW3A 1Q5JA 3PQRA 4GP4B 3VG9A 2WJKA 3REYA 3UTVA 3D4SA 1JV7A 2F95A 5FJGA 1X0I1 4MD2A 5JJEA 5ITCA 2X72A 3COCA 1Q5IA 1H68A 3OE8A 3KJ6A 3X3CA 2RH1A 3AYMA 4X32A 4XXJA 3AYNA 4X31A 3OE0A 4FBZA 2F93A 3QBIA 1HZXA 4FPDA 4HYJA 3QBGA 3QJVB 1TN5A 5G53A 3OE6A 5G28A 1S51A 1EHKB 5F8UA 1IW6A 3DDLA 1BRDA 2R4RA 1UAZA 1M0MA 3QDCA 3VVKA 1XMEB 4N6HA 2R4SA 1L9HA 5G2CA
chains in the Genus database with same CATH superfamily
5H2MA 3UZAA 5JJNA 4KLYA 1S8LA 1QKOA 4BEYA 4HWLA 4PXKA 1C3WA 1UCQA 4MQTA 4DKLA 3S8FB 3UZCA 4K5YA 1GU8A 4GPOA 1C8SA 4BUOA 4PXFA 4LDLA 2YDOA 2YCWA 4L35A 4FA7B 2BRDA 2ZIYA 1GUEA 3ZEVA 3ABWA 4G7RB 2KSBA 3QBLA 4G71B 1DZEA 4XTLA 4JKVA 1X0K1 5EN0A 1F50A 1P8UA 3EH3B 5B0WA 3QJSB 5B35A 2I1XA 1S52A 2PEDA 1VJMA 1QM8A 2I35A 1P8HA 5B6XA 5G2DA 4LDEA 1F4ZA 4JR8A 3PWHA 3ODUA 4BWBA 4UG2A 2NTUA 3PDSA 4GP5B 3C9MA 2G87A 1IW9A 3VI0A 3OE9A 1E0PA 1MGYA 4BEZA 4DAJA 5KKHA 1O0AA 4KNFA 5C1MA 1S53A 2EI4A 2KSAA 3S8GB 3V2WA 3HANA 4MBSA 1M0LA 5H2HA 4MQSA 3S3CB 2YCXA 4GRVA 5G54A 4MD1A 1AT9A 4TL3A 1S54A 4NC3A 4XTNA 3SN6R 1CWQA 2ZFEA 4QRYA 3QJQB 1JGJA 5H2LA 5AWZA 5H2KA 1JV6A 5B2NA 3EMLA 4BV0A 3QJUB 5H2IA 3HAQA 1X0SA 3HARA 2KS9A 4XT3A 5BR5A 5H2NA 1FBKA 4IARA 2L6XA 4G7SB 3HAOA 3VHZA 3PBLA 1IXFA 5AHZA 3BVDB 3ZPQA 3UTYA 2ZZLA 5A8EA 4G7QB 5AX0A 1BRRA 4L6RA 5B6WA 4QIDA 3S3BB 3MBVA 3S3DB 3PXOA 3VGAA 3NY9A 5DYSA 5BR2A 1GZMA 4XT1A 3VW7A 1AP9A 3UG9A 4EA3A 2QPDB 4IAQA 1F88A 3V2YA 5AX1A 4XTOA 1XJIA 1H2SA 1S8JA 1PXSA 2Y03A 3RFMA 4J4QA 4JQ6A 4X1HA 1JFPA 1PXRA 3HASA 5TGZA 1BM1A 3ZPRA 3A7KA 1VGOA 3HAPA 4DJHA 3QAKA 4AMJA 2I21A 4EIYA 2J4YA 3P0GA 1FBBA 5JJJA 4DS7E 4EJ4A 1E12A 2YDVA 4Y9HA 2Z55A 5LWEA 1KGBA 4HYXA 3CODA 5B6ZA 1QKPA 5H2PA 3C9LA 4GYCA 4A4MA 3WQJA 1L0MA 3T45A 3RZEA 2HPYA 3NSBA 3NS0A 4G72B 5AHYA 1R84A 1KMEA 3NYAA 3X3BA 5A45A 5H2OA 2YCYA 5ITEA 1BRXA 5H2JA 2QPEB 3NY8A 3OAXA 4QI1A 1XIOA 2JAGA 5AZDA 3UONA 1QHJA 5G2AA 2Y00A 2JAFA 3CAPA 3DQBA 3QJTB 2Y02A 1TN0A 2AT9A 5A44A 2I20A 4IB4A 1KG8A 3QAPA 3EH5B 2Y01A 4UHRA 1PY6A 2LNLA 3QJRB 1M0KA 5J7AA 3EH4B 5DHHA 4N4WA 4G70B 3QBKA 1U19A 2KSYA 3UTXA 4GP8B 2Z73A 2Y04A 1R2NA 4N4YB 5G36A 2YCZA 4WAVA 4BVNA 2M3GA 1P8IA 4GBRA 1LN6A 4FAAB 4OV0A 5B6VA 2WJLA 5DHGA 1C8RA 2VT4A 1KG9A 5B6YA 3UTWA 5B34A 3AM6A 2NTWA 5ETZA 4LDOA 4AMIA 4WW3A 1Q5JA 3PQRA 4GP4B 3VG9A 2WJKA 3REYA 3UTVA 3D4SA 1JV7A 2F95A 5FJGA 1X0I1 4MD2A 5JJEA 5ITCA 2X72A 3COCA 1Q5IA 1H68A 3OE8A 3KJ6A 3X3CA 2RH1A 3AYMA 4X32A 4XXJA 3AYNA 4X31A 3OE0A 4FBZA 2F93A 3QBIA 1HZXA 4FPDA 4HYJA 3QBGA 3QJVB 1TN5A 5G53A 3OE6A 5G28A 1S51A 1EHKB 5F8UA 1IW6A 3DDLA 1BRDA 2R4RA 1UAZA 1M0MA 3QDCA 3VVKA 1XMEB 4N6HA 2R4SA 1L9HA 5G2CA
chains in the Genus database with same CATH topology
5H2MA 3UZAA 5JJNA 4KLYA 1S8LA 1QKOA 4BEYA 4HWLA 4PXKA 1C3WA 1UCQA 4MQTA 4DKLA 3S8FB 3UZCA 4K5YA 1GU8A 4GPOA 1C8SA 4BUOA 4PXFA 4LDLA 2YDOA 2YCWA 4L35A 4FA7B 2BRDA 2ZIYA 1GUEA 3ZEVA 3ABWA 4G7RB 2KSBA 3QBLA 4G71B 1DZEA 4XTLA 4JKVA 1X0K1 5EN0A 1F50A 1P8UA 3EH3B 5B0WA 3QJSB 5B35A 2I1XA 1S52A 2PEDA 1VJMA 1QM8A 2I35A 1P8HA 5B6XA 5G2DA 4LDEA 1F4ZA 4JR8A 3PWHA 3ODUA 4BWBA 4UG2A 2NTUA 3PDSA 4GP5B 3C9MA 2G87A 1IW9A 3VI0A 3OE9A 1E0PA 1MGYA 4BEZA 4DAJA 5KKHA 1O0AA 4KNFA 5C1MA 1S53A 2EI4A 2KSAA 3S8GB 3V2WA 3HANA 4MBSA 1M0LA 5H2HA 4MQSA 3S3CB 2YCXA 4GRVA 5G54A 4MD1A 1AT9A 4TL3A 1S54A 4NC3A 4XTNA 3SN6R 1CWQA 2ZFEA 4QRYA 3QJQB 1JGJA 5H2LA 5AWZA 5H2KA 1JV6A 5B2NA 3EMLA 4BV0A 3QJUB 5H2IA 3HAQA 1X0SA 3HARA 2KS9A 4XT3A 5BR5A 5H2NA 1FBKA 4IARA 2L6XA 4G7SB 3HAOA 3VHZA 3PBLA 1IXFA 5AHZA 3BVDB 3ZPQA 3UTYA 2ZZLA 5A8EA 4G7QB 5AX0A 1BRRA 4L6RA 5B6WA 4QIDA 3S3BB 3MBVA 3S3DB 3PXOA 3VGAA 3NY9A 5DYSA 5BR2A 1GZMA 4XT1A 3VW7A 1AP9A 3UG9A 4EA3A 2QPDB 4IAQA 1F88A 3V2YA 5AX1A 4XTOA 1XJIA 1H2SA 1S8JA 1PXSA 2Y03A 3RFMA 4J4QA 4JQ6A 4X1HA 1JFPA 1PXRA 3HASA 5TGZA 1BM1A 3ZPRA 3A7KA 1VGOA 3HAPA 4DJHA 3QAKA 4AMJA 2I21A 4EIYA 2J4YA 3P0GA 1FBBA 5JJJA 4DS7E 4EJ4A 1E12A 2YDVA 4Y9HA 2Z55A 5LWEA 1KGBA 4HYXA 3CODA 5B6ZA 1QKPA 5H2PA 3C9LA 4GYCA 4A4MA 3WQJA 1L0MA 3T45A 3RZEA 2HPYA 3NSBA 3NS0A 4G72B 5AHYA 1R84A 1KMEA 3NYAA 3X3BA 5A45A 5H2OA 2YCYA 5ITEA 1BRXA 5H2JA 2QPEB 3NY8A 3OAXA 4QI1A 1XIOA 2JAGA 5AZDA 3UONA 1QHJA 5G2AA 2Y00A 2JAFA 3CAPA 3DQBA 3QJTB 2Y02A 1TN0A 2AT9A 5A44A 2I20A 4IB4A 1KG8A 3QAPA 3EH5B 2Y01A 4UHRA 1PY6A 2LNLA 3QJRB 1M0KA 5J7AA 3EH4B 5DHHA 4N4WA 4G70B 3QBKA 1U19A 2KSYA 3UTXA 4GP8B 2Z73A 2Y04A 1R2NA 4N4YB 5G36A 2YCZA 4WAVA 4BVNA 2M3GA 1P8IA 4GBRA 1LN6A 4FAAB 4OV0A 5B6VA 2WJLA 5DHGA 1C8RA 2VT4A 1KG9A 5B6YA 3UTWA 5B34A 3AM6A 2NTWA 5ETZA 4LDOA 4AMIA 4WW3A 1Q5JA 3PQRA 4GP4B 3VG9A 2WJKA 3REYA 3UTVA 3D4SA 1JV7A 2F95A 5FJGA 1X0I1 4MD2A 5JJEA 5ITCA 2X72A 3COCA 1Q5IA 1H68A 3OE8A 3KJ6A 3X3CA 2RH1A 3AYMA 4X32A 4XXJA 3AYNA 4X31A 3OE0A 4FBZA 2F93A 3QBIA 1HZXA 4FPDA 4HYJA 3QBGA 3QJVB 1TN5A 5G53A 3OE6A 5G28A 1S51A 1EHKB 5F8UA 1IW6A 3DDLA 1BRDA 2R4RA 1UAZA 1M0MA 3QDCA 3VVKA 1XMEB 4N6HA 2R4SA 1L9HA 5G2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2M A;  3UZA A;  5JJN A;  4KLY A;  1S8L A;  1QKO A;  4BEY A;  4HWL A;  4PXK A;  1C3W A;  1UCQ A;  4MQT A;  4DKL A;  3S8F B;  3UZC A;  4K5Y A;  1GU8 A;  4GPO A;  1C8S A;  4BUO A;  4PXF A;  4LDL A;  2YDO A;  2YCW A;  4L35 A;  4FA7 B;  2BRD A;  2ZIY A;  1GUE A;  3ZEV A;  3ABW A;  4G7R B;  2KSB A;  3QBL A;  4G71 B;  1DZE A;  4XTL A;  4JKV A;  1X0K 1;  5EN0 A;  1F50 A;  1P8U A;  3EH3 B;  5B0W A;  3QJS B;  5B35 A;  2I1X A;  1S52 A;  2PED A;  1VJM A;  1QM8 A;  2I35 A;  1P8H A;  5B6X A;  5G2D A;  4LDE A;  1F4Z A;  4JR8 A;  3PWH A;  3ODU A;  4BWB A;  4UG2 A;  2NTU A;  3PDS A;  4GP5 B;  3C9M A;  2G87 A;  1IW9 A;  3VI0 A;  3OE9 A;  1E0P A;  1MGY A;  4BEZ A;  4DAJ A;  5KKH A;  1O0A A;  4KNF A;  5C1M A;  1S53 A;  2EI4 A;  2KSA A;  3S8G B;  3V2W A;  3HAN A;  4MBS A;  1M0L A;  5H2H A;  4MQS A;  3S3C B;  2YCX A;  4GRV A;  5G54 A;  4MD1 A;  1AT9 A;  4TL3 A;  1S54 A;  4NC3 A;  4XTN A;  3SN6 R;  1CWQ A;  2ZFE A;  4QRY A;  3QJQ B;  1JGJ A;  5H2L A;  5AWZ A;  5H2K A;  1JV6 A;  5B2N A;  3EML A;  4BV0 A;  3QJU B;  5H2I A;  3HAQ A;  1X0S A;  3HAR A;  2KS9 A;  4XT3 A;  5BR5 A;  5H2N A;  1FBK A;  4IAR A;  2L6X A;  4G7S B;  3HAO A;  3VHZ A;  3PBL A;  1IXF A;  5AHZ A;  3BVD B;  3ZPQ A;  3UTY A;  2ZZL A;  5A8E A;  4G7Q B;  5AX0 A;  1BRR A;  4L6R A;  5B6W A;  4QID A;  3S3B B;  3MBV A;  3S3D B;  3PXO A;  3VGA A;  3NY9 A;  5DYS A;  5BR2 A;  1GZM A;  4XT1 A;  3VW7 A;  1AP9 A;  3UG9 A;  4EA3 A;  2QPD B;  4IAQ A;  1F88 A;  3V2Y A;  5AX1 A;  4XTO A;  1XJI A;  1H2S A;  1S8J A;  1PXS A;  2Y03 A;  3RFM A;  4J4Q A;  4JQ6 A;  4X1H A;  1JFP A;  1PXR A;  3HAS A;  5TGZ A;  1BM1 A;  3ZPR A;  3A7K A;  1VGO A;  3HAP A;  4DJH A;  3QAK A;  4AMJ A;  2I21 A;  4EIY A;  2J4Y A;  3P0G A;  1FBB A;  5JJJ A;  4EJ4 A;  1E12 A;  2YDV A;  4Y9H A;  2Z55 A;  5LWE A;  1KGB A;  4HYX A;  3COD A;  5B6Z A;  1QKP A;  5H2P A;  3C9L A;  4GYC A;  4A4M A;  3WQJ A;  1L0M A;  3T45 A;  3RZE A;  2HPY A;  3NSB A;  3NS0 A;  4G72 B;  5AHY A;  1R84 A;  1KME A;  3NYA A;  3X3B A;  5A45 A;  5H2O A;  2YCY A;  5ITE A;  1BRX A;  5H2J A;  2QPE B;  3NY8 A;  3OAX A;  4QI1 A;  1XIO A;  2JAG A;  5AZD A;  3UON A;  1QHJ A;  5G2A A;  2Y00 A;  2JAF A;  3CAP A;  3DQB A;  3QJT B;  2Y02 A;  1TN0 A;  2AT9 A;  5A44 A;  2I20 A;  4IB4 A;  1KG8 A;  3QAP A;  3EH5 B;  2Y01 A;  4UHR A;  1PY6 A;  2LNL A;  3QJR B;  1M0K A;  5J7A A;  3EH4 B;  5DHH A;  4N4W A;  4G70 B;  3QBK A;  1U19 A;  2KSY A;  3UTX A;  4GP8 B;  2Z73 A;  2Y04 A;  1R2N A;  4N4Y B;  5G36 A;  2YCZ A;  4WAV A;  4BVN A;  2M3G A;  1P8I A;  4GBR A;  1LN6 A;  4FAA B;  4OV0 A;  5B6V A;  2WJL A;  5DHG A;  1C8R A;  2VT4 A;  1KG9 A;  5B6Y A;  3UTW A;  5B34 A;  3AM6 A;  2NTW A;  5ETZ A;  4LDO A;  4AMI A;  4WW3 A;  1Q5J A;  3PQR A;  4GP4 B;  3VG9 A;  2WJK A;  3REY A;  3UTV A;  3D4S A;  1JV7 A;  2F95 A;  5FJG A;  1X0I 1;  4MD2 A;  5JJE A;  5ITC A;  2X72 A;  3COC A;  1Q5I A;  1H68 A;  3OE8 A;  3KJ6 A;  3X3C A;  2RH1 A;  3AYM A;  4X32 A;  4XXJ A;  3AYN A;  4X31 A;  3OE0 A;  4FBZ A;  2F93 A;  3QBI A;  1HZX A;  4FPD A;  4HYJ A;  3QBG A;  3QJV B;  1TN5 A;  5G53 A;  3OE6 A;  5G28 A;  1S51 A;  1EHK B;  5F8U A;  1IW6 A;  3DDL A;  1BRD A;  2R4R A;  1UAZ A;  1M0M A;  3QDC A;  3VVK A;  1XME B;  4N6H A;  2R4S A;  1L9H A;  5G2C A; 
#chains in the Genus database with same CATH topology
 5H2M A;  3UZA A;  5JJN A;  4KLY A;  1S8L A;  1QKO A;  4BEY A;  4HWL A;  4PXK A;  1C3W A;  1UCQ A;  4MQT A;  4DKL A;  3S8F B;  3UZC A;  4K5Y A;  1GU8 A;  4GPO A;  1C8S A;  4BUO A;  4PXF A;  4LDL A;  2YDO A;  2YCW A;  4L35 A;  4FA7 B;  2BRD A;  2ZIY A;  1GUE A;  3ZEV A;  3ABW A;  4G7R B;  2KSB A;  3QBL A;  4G71 B;  1DZE A;  4XTL A;  4JKV A;  1X0K 1;  5EN0 A;  1F50 A;  1P8U A;  3EH3 B;  5B0W A;  3QJS B;  5B35 A;  2I1X A;  1S52 A;  2PED A;  1VJM A;  1QM8 A;  2I35 A;  1P8H A;  5B6X A;  5G2D A;  4LDE A;  1F4Z A;  4JR8 A;  3PWH A;  3ODU A;  4BWB A;  4UG2 A;  2NTU A;  3PDS A;  4GP5 B;  3C9M A;  2G87 A;  1IW9 A;  3VI0 A;  3OE9 A;  1E0P A;  1MGY A;  4BEZ A;  4DAJ A;  5KKH A;  1O0A A;  4KNF A;  5C1M A;  1S53 A;  2EI4 A;  2KSA A;  3S8G B;  3V2W A;  3HAN A;  4MBS A;  1M0L A;  5H2H A;  4MQS A;  3S3C B;  2YCX A;  4GRV A;  5G54 A;  4MD1 A;  1AT9 A;  4TL3 A;  1S54 A;  4NC3 A;  4XTN A;  3SN6 R;  1CWQ A;  2ZFE A;  4QRY A;  3QJQ B;  1JGJ A;  5H2L A;  5AWZ A;  5H2K A;  1JV6 A;  5B2N A;  3EML A;  4BV0 A;  3QJU B;  5H2I A;  3HAQ A;  1X0S A;  3HAR A;  2KS9 A;  4XT3 A;  5BR5 A;  5H2N A;  1FBK A;  4IAR A;  2L6X A;  4G7S B;  3HAO A;  3VHZ A;  3PBL A;  1IXF A;  5AHZ A;  3BVD B;  3ZPQ A;  3UTY A;  2ZZL A;  5A8E A;  4G7Q B;  5AX0 A;  1BRR A;  4L6R A;  5B6W A;  4QID A;  3S3B B;  3MBV A;  3S3D B;  3PXO A;  3VGA A;  3NY9 A;  5DYS A;  5BR2 A;  1GZM A;  4XT1 A;  3VW7 A;  1AP9 A;  3UG9 A;  4EA3 A;  2QPD B;  4IAQ A;  1F88 A;  3V2Y A;  5AX1 A;  4XTO A;  1XJI A;  1H2S A;  1S8J A;  1PXS A;  2Y03 A;  3RFM A;  4J4Q A;  4JQ6 A;  4X1H A;  1JFP A;  1PXR A;  3HAS A;  5TGZ A;  1BM1 A;  3ZPR A;  3A7K A;  1VGO A;  3HAP A;  4DJH A;  3QAK A;  4AMJ A;  2I21 A;  4EIY A;  2J4Y A;  3P0G A;  1FBB A;  5JJJ A;  4DS7 E;  4EJ4 A;  1E12 A;  2YDV A;  4Y9H A;  2Z55 A;  5LWE A;  1KGB A;  4HYX A;  3COD A;  5B6Z A;  1QKP A;  5H2P A;  3C9L A;  4GYC A;  4A4M A;  3WQJ A;  1L0M A;  3T45 A;  3RZE A;  2HPY A;  3NSB A;  3NS0 A;  4G72 B;  5AHY A;  1R84 A;  1KME A;  3NYA A;  3X3B A;  5A45 A;  5H2O A;  2YCY A;  5ITE A;  1BRX A;  5H2J A;  2QPE B;  3NY8 A;  3OAX A;  4QI1 A;  1XIO A;  2JAG A;  5AZD A;  3UON A;  1QHJ A;  5G2A A;  2Y00 A;  2JAF A;  3CAP A;  3DQB A;  3QJT B;  2Y02 A;  1TN0 A;  2AT9 A;  5A44 A;  2I20 A;  4IB4 A;  1KG8 A;  3QAP A;  3EH5 B;  2Y01 A;  4UHR A;  1PY6 A;  2LNL A;  3QJR B;  1M0K A;  5J7A A;  3EH4 B;  5DHH A;  4N4W A;  4G70 B;  3QBK A;  1U19 A;  2KSY A;  3UTX A;  4GP8 B;  2Z73 A;  2Y04 A;  1R2N A;  4N4Y B;  5G36 A;  2YCZ A;  4WAV A;  4BVN A;  2M3G A;  1P8I A;  4GBR A;  1LN6 A;  4FAA B;  4OV0 A;  5B6V A;  2WJL A;  5DHG A;  1C8R A;  2VT4 A;  1KG9 A;  5B6Y A;  3UTW A;  5B34 A;  3AM6 A;  2NTW A;  5ETZ A;  4LDO A;  4AMI A;  4WW3 A;  1Q5J A;  3PQR A;  4GP4 B;  3VG9 A;  2WJK A;  3REY A;  3UTV A;  3D4S A;  1JV7 A;  2F95 A;  5FJG A;  1X0I 1;  4MD2 A;  5JJE A;  5ITC A;  2X72 A;  3COC A;  1Q5I A;  1H68 A;  3OE8 A;  3KJ6 A;  3X3C A;  2RH1 A;  3AYM A;  4X32 A;  4XXJ A;  3AYN A;  4X31 A;  3OE0 A;  4FBZ A;  2F93 A;  3QBI A;  1HZX A;  4FPD A;  4HYJ A;  3QBG A;  3QJV B;  1TN5 A;  5G53 A;  3OE6 A;  5G28 A;  1S51 A;  1EHK B;  5F8U A;  1IW6 A;  3DDL A;  1BRD A;  2R4R A;  1UAZ A;  1M0M A;  3QDC A;  3VVK A;  1XME B;  4N6H A;  2R4S A;  1L9H A;  5G2C A; 
#chains in the Genus database with same CATH homology
 5H2M A;  3UZA A;  5JJN A;  4KLY A;  1S8L A;  1QKO A;  4BEY A;  4HWL A;  4PXK A;  1C3W A;  1UCQ A;  4MQT A;  4DKL A;  3S8F B;  3UZC A;  4K5Y A;  1GU8 A;  4GPO A;  1C8S A;  4BUO A;  4PXF A;  4LDL A;  2YDO A;  2YCW A;  4L35 A;  4FA7 B;  2BRD A;  2ZIY A;  1GUE A;  3ZEV A;  3ABW A;  4G7R B;  2KSB A;  3QBL A;  4G71 B;  1DZE A;  4XTL A;  4JKV A;  1X0K 1;  5EN0 A;  1F50 A;  1P8U A;  3EH3 B;  5B0W A;  3QJS B;  5B35 A;  2I1X A;  1S52 A;  2PED A;  1VJM A;  1QM8 A;  2I35 A;  1P8H A;  5B6X A;  5G2D A;  4LDE A;  1F4Z A;  4JR8 A;  3PWH A;  3ODU A;  4BWB A;  4UG2 A;  2NTU A;  3PDS A;  4GP5 B;  3C9M A;  2G87 A;  1IW9 A;  3VI0 A;  3OE9 A;  1E0P A;  1MGY A;  4BEZ A;  4DAJ A;  5KKH A;  1O0A A;  4KNF A;  5C1M A;  1S53 A;  2EI4 A;  2KSA A;  3S8G B;  3V2W A;  3HAN A;  4MBS A;  1M0L A;  5H2H A;  4MQS A;  3S3C B;  2YCX A;  4GRV A;  5G54 A;  4MD1 A;  1AT9 A;  4TL3 A;  1S54 A;  4NC3 A;  4XTN A;  3SN6 R;  1CWQ A;  2ZFE A;  4QRY A;  3QJQ B;  1JGJ A;  5H2L A;  5AWZ A;  5H2K A;  1JV6 A;  5B2N A;  3EML A;  4BV0 A;  3QJU B;  5H2I A;  3HAQ A;  1X0S A;  3HAR A;  2KS9 A;  4XT3 A;  5BR5 A;  5H2N A;  1FBK A;  4IAR A;  2L6X A;  4G7S B;  3HAO A;  3VHZ A;  3PBL A;  1IXF A;  5AHZ A;  3BVD B;  3ZPQ A;  3UTY A;  2ZZL A;  5A8E A;  4G7Q B;  5AX0 A;  1BRR A;  4L6R A;  5B6W A;  4QID A;  3S3B B;  3MBV A;  3S3D B;  3PXO A;  3VGA A;  3NY9 A;  5DYS A;  5BR2 A;  1GZM A;  4XT1 A;  3VW7 A;  1AP9 A;  3UG9 A;  4EA3 A;  2QPD B;  4IAQ A;  1F88 A;  3V2Y A;  5AX1 A;  4XTO A;  1XJI A;  1H2S A;  1S8J A;  1PXS A;  2Y03 A;  3RFM A;  4J4Q A;  4JQ6 A;  4X1H A;  1JFP A;  1PXR A;  3HAS A;  5TGZ A;  1BM1 A;  3ZPR A;  3A7K A;  1VGO A;  3HAP A;  4DJH A;  3QAK A;  4AMJ A;  2I21 A;  4EIY A;  2J4Y A;  3P0G A;  1FBB A;  5JJJ A;  4DS7 E;  4EJ4 A;  1E12 A;  2YDV A;  4Y9H A;  2Z55 A;  5LWE A;  1KGB A;  4HYX A;  3COD A;  5B6Z A;  1QKP A;  5H2P A;  3C9L A;  4GYC A;  4A4M A;  3WQJ A;  1L0M A;  3T45 A;  3RZE A;  2HPY A;  3NSB A;  3NS0 A;  4G72 B;  5AHY A;  1R84 A;  1KME A;  3NYA A;  3X3B A;  5A45 A;  5H2O A;  2YCY A;  5ITE A;  1BRX A;  5H2J A;  2QPE B;  3NY8 A;  3OAX A;  4QI1 A;  1XIO A;  2JAG A;  5AZD A;  3UON A;  1QHJ A;  5G2A A;  2Y00 A;  2JAF A;  3CAP A;  3DQB A;  3QJT B;  2Y02 A;  1TN0 A;  2AT9 A;  5A44 A;  2I20 A;  4IB4 A;  1KG8 A;  3QAP A;  3EH5 B;  2Y01 A;  4UHR A;  1PY6 A;  2LNL A;  3QJR B;  1M0K A;  5J7A A;  3EH4 B;  5DHH A;  4N4W A;  4G70 B;  3QBK A;  1U19 A;  2KSY A;  3UTX A;  4GP8 B;  2Z73 A;  2Y04 A;  1R2N A;  4N4Y B;  5G36 A;  2YCZ A;  4WAV A;  4BVN A;  2M3G A;  1P8I A;  4GBR A;  1LN6 A;  4FAA B;  4OV0 A;  5B6V A;  2WJL A;  5DHG A;  1C8R A;  2VT4 A;  1KG9 A;  5B6Y A;  3UTW A;  5B34 A;  3AM6 A;  2NTW A;  5ETZ A;  4LDO A;  4AMI A;  4WW3 A;  1Q5J A;  3PQR A;  4GP4 B;  3VG9 A;  2WJK A;  3REY A;  3UTV A;  3D4S A;  1JV7 A;  2F95 A;  5FJG A;  1X0I 1;  4MD2 A;  5JJE A;  5ITC A;  2X72 A;  3COC A;  1Q5I A;  1H68 A;  3OE8 A;  3KJ6 A;  3X3C A;  2RH1 A;  3AYM A;  4X32 A;  4XXJ A;  3AYN A;  4X31 A;  3OE0 A;  4FBZ A;  2F93 A;  3QBI A;  1HZX A;  4FPD A;  4HYJ A;  3QBG A;  3QJV B;  1TN5 A;  5G53 A;  3OE6 A;  5G28 A;  1S51 A;  1EHK B;  5F8U A;  1IW6 A;  3DDL A;  1BRD A;  2R4R A;  1UAZ A;  1M0M A;  3QDC A;  3VVK A;  1XME B;  4N6H A;  2R4S A;  1L9H A;  5G2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...