4AMJA

Turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist carvedilol
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
299
structure length
287
Chain Sequence
GAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords BETA-1 ADRENERGIC RECEPTOR
publication title Crystal Structures of a Stabilized Beta1-Adrenoceptor Bound to the Biased Agonists Bucindolol and Carvedilol
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 123
structure length 287
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4amjA00
4MBSA 2QPDB 4UHRA 1LN6A 2LNLA 3UZCA 1XMEB 4OV0A 5H2MA 4LDLA 1L9HA 3S8GB 3A7KA 1KMEA 4BWBA 5C1MA 2KS9A 3SN6R 3OE8A 5B6VA 1IW6A 4N6HA 5ETZA 4X31A 1H68A 2WJLA 4GP5B 4Y9HA 3S3BB 5B6YA 3BVDB 1S8LA 4MQSA 3S3CB 1P8UA 2Y03A 2ZFEA 1VGOA 5G2CA 4FAAB 5B6ZA 1DZEA 5TGZA 5BR5A 4QIDA 1VJMA 2AT9A 3UTVA 1M0KA 5A8EA 2G87A 2F95A 3QBGA 2JAGA 1QHJA 5DHHA 3NSBA 1X0SA 1IW9A 3OAXA 3T45A 3NY8A 2Y01A 4NC3A 1P8HA 3ABWA 4MD1A 3S3DB 4XTOA 4KNFA 5DHGA 1PXSA 3ZEVA 4FPDA 1HZXA 5G36A 3PWHA 3QJVB 2BRDA 2M3GA 3X3CA 2VT4A 2YCZA 4BEYA 1E12A 3VW7A 1PXRA 4XXJA 5H2OA 1O0AA 4G7RB 2X72A 4XT1A 1BRXA 3KJ6A 1FBBA 5B6WA 1M0MA 1CWQA 1TN5A 3EH3B 4KLYA 3AYMA 4G7SB 5A44A 5B2NA 3REYA 2YDOA 4L6RA 5B0WA 3HAQA 5JJJA 5B35A 2J4YA 5AZDA 4XT3A 4LDOA 5H2IA 5H2HA 1TN0A 2Y04A 4QI1A 5LWEA 1JFPA 5F8UA 1C3WA 4HYJA 1F88A 1E0PA 1BM1A 3QBKA 4G72B 5ITEA 3RFMA 4AMIA 1AT9A 2KSYA 4L35A 1XJIA 1EHKB 3QJRB 3RZEA 4EJ4A 4BVNA 3UTWA 4G7QB 2YCXA 4IB4A 2YDVA 4GP4B 2F93A 4GRVA 5AX1A 2WJKA 1GU8A 4PXFA 5AHYA 4BV0A 4HYXA 4BUOA 4HWLA 2Z73A 3QJQB 3CAPA 3DQBA 5H2JA 1FBKA 2EI4A 5BR2A 2QPEB 1R84A 3COCA 3UG9A 3ODUA 3DDLA 3QJSB 4GBRA 3PBLA 2ZIYA 2Z55A 5EN0A 2Y02A 1L0MA 2L6XA 2R4RA 4PXKA 2YCWA 4JKVA 4IAQA 1PY6A 4A4MA 3UZAA 1QKOA 5AWZA 4DKLA 1S53A 1Q5JA 3QAKA 5KKHA 3HARA 4AMJA 4MD2A 1JV7A 4G71B 1JGJA 1KG9A 2KSBA 3HAOA 5G2DA 1S8JA 3OE6A 5G2AA 2I21A 1QM8A 3NYAA 3UTXA 3EH4B 1QKPA 1R2NA 4N4WA 4TL3A 3VVKA 1UAZA 4XTLA 3PQRA 1KGBA 5G53A 1F4ZA 2YCYA 1GUEA 3QBLA 1M0LA 2R4SA 4QRYA 4WW3A 2Y00A 1H2SA 5AX0A 1IXFA 3UTYA 2KSAA 3AYNA 4WAVA 3P0GA 3UONA 3VI0A 1BRRA 1U19A 3CODA 3NS0A 3HASA 3OE9A 5H2PA 2NTWA 1X0K1 3QJUB 4DAJA 3VHZA 4JQ6A 3QJTB 5J7AA 3C9LA 3EH5B 2NTUA 1P8IA 2I20A 2ZZLA 3OE0A 3D4SA 5B34A 3VGAA 4GPOA 1C8SA 1C8RA 3WQJA 3X3BA 4GYCA 4BEZA 4GP8B 4IARA 4K5YA 4FBZA 4FA7B 3HAPA 1JV6A 4N4YB 4JR8A 5AHZA 5G54A 3PDSA 3QBIA 4X1HA 3NY9A 4LDEA 1X0I1 2RH1A 4J4QA 5JJEA 4DJHA 5G28A 4UG2A 3QAPA 2I35A 2JAFA 5FJGA 4G70B 1S54A 1BRDA 3EMLA 5H2KA 3ZPQA 4EA3A 1Q5IA 2HPYA 1S51A 1MGYA 3VG9A 5ITCA 2PEDA 4EIYA 2I1XA 3AM6A 1AP9A 3V2YA 1XIOA 5JJNA 1KG8A 5H2LA 1UCQA 3ZPRA 3PXOA 4XTNA 5B6XA 5DYSA 1GZMA 1S52A 3C9MA 1F50A 3S8FB 3HANA 5A45A 3MBVA 4MQTA 5H2NA 4X32A 3V2WA 3QDCA
chains in the Genus database with same CATH superfamily
4MBSA 2QPDB 4UHRA 1LN6A 2LNLA 3UZCA 1XMEB 4DS7E 4OV0A 5H2MA 4LDLA 1L9HA 3S8GB 3A7KA 1KMEA 4BWBA 5C1MA 2KS9A 3SN6R 3OE8A 5B6VA 1IW6A 4N6HA 5ETZA 4X31A 1H68A 2WJLA 4GP5B 4Y9HA 3S3BB 5B6YA 3BVDB 1S8LA 4MQSA 3S3CB 1P8UA 2Y03A 2ZFEA 1VGOA 5G2CA 4FAAB 5B6ZA 1DZEA 5TGZA 5BR5A 4QIDA 1VJMA 2AT9A 3UTVA 1M0KA 5A8EA 2G87A 2F95A 3QBGA 2JAGA 1QHJA 5DHHA 3NSBA 1X0SA 1IW9A 3OAXA 3T45A 3NY8A 2Y01A 4NC3A 1P8HA 3ABWA 4MD1A 3S3DB 4XTOA 4KNFA 5DHGA 1PXSA 3ZEVA 4FPDA 1HZXA 5G36A 3PWHA 3QJVB 2BRDA 2M3GA 3X3CA 2VT4A 2YCZA 4BEYA 1E12A 3VW7A 1PXRA 4XXJA 5H2OA 1O0AA 4G7RB 2X72A 4XT1A 1BRXA 3KJ6A 1FBBA 5B6WA 1M0MA 1CWQA 1TN5A 3EH3B 4KLYA 3AYMA 4G7SB 5A44A 5B2NA 3REYA 2YDOA 4L6RA 5B0WA 3HAQA 5JJJA 5B35A 2J4YA 5AZDA 4XT3A 4LDOA 5H2IA 5H2HA 1TN0A 2Y04A 4QI1A 5LWEA 1JFPA 5F8UA 1C3WA 4HYJA 1F88A 1E0PA 1BM1A 3QBKA 4G72B 5ITEA 3RFMA 4AMIA 1AT9A 2KSYA 4L35A 1XJIA 1EHKB 3QJRB 3RZEA 4EJ4A 4BVNA 3UTWA 4G7QB 2YCXA 4IB4A 2YDVA 4GP4B 2F93A 4GRVA 5AX1A 2WJKA 1GU8A 4PXFA 5AHYA 4BV0A 4HYXA 4BUOA 4HWLA 2Z73A 3QJQB 3CAPA 3DQBA 5H2JA 1FBKA 2EI4A 5BR2A 2QPEB 1R84A 3COCA 3UG9A 3ODUA 3DDLA 3QJSB 4GBRA 3PBLA 2ZIYA 2Z55A 5EN0A 2Y02A 1L0MA 2L6XA 2R4RA 4PXKA 2YCWA 4JKVA 4IAQA 1PY6A 4A4MA 3UZAA 1QKOA 5AWZA 4DKLA 1S53A 1Q5JA 3QAKA 5KKHA 3HARA 4AMJA 4MD2A 1JV7A 4G71B 1JGJA 1KG9A 2KSBA 3HAOA 5G2DA 1S8JA 3OE6A 5G2AA 2I21A 1QM8A 3NYAA 3UTXA 3EH4B 1QKPA 1R2NA 4N4WA 4TL3A 3VVKA 1UAZA 4XTLA 3PQRA 1KGBA 5G53A 1F4ZA 2YCYA 1GUEA 3QBLA 1M0LA 2R4SA 4QRYA 4WW3A 2Y00A 1H2SA 5AX0A 1IXFA 3UTYA 2KSAA 3AYNA 4WAVA 3P0GA 3UONA 3VI0A 1BRRA 1U19A 3CODA 3NS0A 3HASA 3OE9A 5H2PA 2NTWA 1X0K1 3QJUB 4DAJA 3VHZA 4JQ6A 3QJTB 5J7AA 3C9LA 3EH5B 2NTUA 1P8IA 2I20A 2ZZLA 3OE0A 3D4SA 5B34A 3VGAA 4GPOA 1C8SA 1C8RA 3WQJA 3X3BA 4GYCA 4BEZA 4GP8B 4IARA 4K5YA 4FBZA 4FA7B 3HAPA 1JV6A 4N4YB 4JR8A 5AHZA 5G54A 3PDSA 3QBIA 4X1HA 3NY9A 4LDEA 1X0I1 2RH1A 4J4QA 5JJEA 4DJHA 5G28A 4UG2A 3QAPA 2I35A 2JAFA 5FJGA 4G70B 1S54A 1BRDA 3EMLA 5H2KA 3ZPQA 4EA3A 1Q5IA 2HPYA 1S51A 1MGYA 3VG9A 5ITCA 2PEDA 4EIYA 2I1XA 3AM6A 1AP9A 3V2YA 1XIOA 5JJNA 1KG8A 5H2LA 1UCQA 3ZPRA 3PXOA 4XTNA 5B6XA 5DYSA 1GZMA 1S52A 3C9MA 1F50A 3S8FB 3HANA 5A45A 3MBVA 4MQTA 5H2NA 4X32A 3V2WA 3QDCA
chains in the Genus database with same CATH topology
4MBSA 2QPDB 4UHRA 1LN6A 2LNLA 3UZCA 1XMEB 4DS7E 4OV0A 5H2MA 4LDLA 1L9HA 3S8GB 3A7KA 1KMEA 4BWBA 5C1MA 2KS9A 3SN6R 3OE8A 5B6VA 1IW6A 4N6HA 5ETZA 4X31A 1H68A 2WJLA 4GP5B 4Y9HA 3S3BB 5B6YA 3BVDB 1S8LA 4MQSA 3S3CB 1P8UA 2Y03A 2ZFEA 1VGOA 5G2CA 4FAAB 5B6ZA 1DZEA 5TGZA 5BR5A 4QIDA 1VJMA 2AT9A 3UTVA 1M0KA 5A8EA 2G87A 2F95A 3QBGA 2JAGA 1QHJA 5DHHA 3NSBA 1X0SA 1IW9A 3OAXA 3T45A 3NY8A 2Y01A 4NC3A 1P8HA 3ABWA 4MD1A 3S3DB 4XTOA 4KNFA 5DHGA 1PXSA 3ZEVA 4FPDA 1HZXA 5G36A 3PWHA 3QJVB 2BRDA 2M3GA 3X3CA 2VT4A 2YCZA 4BEYA 1E12A 3VW7A 1PXRA 4XXJA 5H2OA 1O0AA 4G7RB 2X72A 4XT1A 1BRXA 3KJ6A 1FBBA 5B6WA 1M0MA 1CWQA 1TN5A 3EH3B 4KLYA 3AYMA 4G7SB 5A44A 5B2NA 3REYA 2YDOA 4L6RA 5B0WA 3HAQA 5JJJA 5B35A 2J4YA 5AZDA 4XT3A 4LDOA 5H2IA 5H2HA 1TN0A 2Y04A 4QI1A 5LWEA 1JFPA 5F8UA 1C3WA 4HYJA 1F88A 1E0PA 1BM1A 3QBKA 4G72B 5ITEA 3RFMA 4AMIA 1AT9A 2KSYA 4L35A 1XJIA 1EHKB 3QJRB 3RZEA 4EJ4A 4BVNA 3UTWA 4G7QB 2YCXA 4IB4A 2YDVA 4GP4B 2F93A 4GRVA 5AX1A 2WJKA 1GU8A 4PXFA 5AHYA 4BV0A 4HYXA 4BUOA 4HWLA 2Z73A 3QJQB 3CAPA 3DQBA 5H2JA 1FBKA 2EI4A 5BR2A 2QPEB 1R84A 3COCA 3UG9A 3ODUA 3DDLA 3QJSB 4GBRA 3PBLA 2ZIYA 2Z55A 5EN0A 2Y02A 1L0MA 2L6XA 2R4RA 4PXKA 2YCWA 4JKVA 4IAQA 1PY6A 4A4MA 3UZAA 1QKOA 5AWZA 4DKLA 1S53A 1Q5JA 3QAKA 5KKHA 3HARA 4AMJA 4MD2A 1JV7A 4G71B 1JGJA 1KG9A 2KSBA 3HAOA 5G2DA 1S8JA 3OE6A 5G2AA 2I21A 1QM8A 3NYAA 3UTXA 3EH4B 1QKPA 1R2NA 4N4WA 4TL3A 3VVKA 1UAZA 4XTLA 3PQRA 1KGBA 5G53A 1F4ZA 2YCYA 1GUEA 3QBLA 1M0LA 2R4SA 4QRYA 4WW3A 2Y00A 1H2SA 5AX0A 1IXFA 3UTYA 2KSAA 3AYNA 4WAVA 3P0GA 3UONA 3VI0A 1BRRA 1U19A 3CODA 3NS0A 3HASA 3OE9A 5H2PA 2NTWA 1X0K1 3QJUB 4DAJA 3VHZA 4JQ6A 3QJTB 5J7AA 3C9LA 3EH5B 2NTUA 1P8IA 2I20A 2ZZLA 3OE0A 3D4SA 5B34A 3VGAA 4GPOA 1C8SA 1C8RA 3WQJA 3X3BA 4GYCA 4BEZA 4GP8B 4IARA 4K5YA 4FBZA 4FA7B 3HAPA 1JV6A 4N4YB 4JR8A 5AHZA 5G54A 3PDSA 3QBIA 4X1HA 3NY9A 4LDEA 1X0I1 2RH1A 4J4QA 5JJEA 4DJHA 5G28A 4UG2A 3QAPA 2I35A 2JAFA 5FJGA 4G70B 1S54A 1BRDA 3EMLA 5H2KA 3ZPQA 4EA3A 1Q5IA 2HPYA 1S51A 1MGYA 3VG9A 5ITCA 2PEDA 4EIYA 2I1XA 3AM6A 1AP9A 3V2YA 1XIOA 5JJNA 1KG8A 5H2LA 1UCQA 3ZPRA 3PXOA 4XTNA 5B6XA 5DYSA 1GZMA 1S52A 3C9MA 1F50A 3S8FB 3HANA 5A45A 3MBVA 4MQTA 5H2NA 4X32A 3V2WA 3QDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBS A;  2QPD B;  4UHR A;  1LN6 A;  2LNL A;  3UZC A;  1XME B;  4OV0 A;  5H2M A;  4LDL A;  1L9H A;  3S8G B;  3A7K A;  1KME A;  4BWB A;  5C1M A;  2KS9 A;  3SN6 R;  3OE8 A;  5B6V A;  1IW6 A;  4N6H A;  5ETZ A;  4X31 A;  1H68 A;  2WJL A;  4GP5 B;  4Y9H A;  3S3B B;  5B6Y A;  3BVD B;  1S8L A;  4MQS A;  3S3C B;  1P8U A;  2Y03 A;  2ZFE A;  1VGO A;  5G2C A;  4FAA B;  5B6Z A;  1DZE A;  5TGZ A;  5BR5 A;  4QID A;  1VJM A;  2AT9 A;  3UTV A;  1M0K A;  5A8E A;  2G87 A;  2F95 A;  3QBG A;  2JAG A;  1QHJ A;  5DHH A;  3NSB A;  1X0S A;  1IW9 A;  3OAX A;  3T45 A;  3NY8 A;  2Y01 A;  4NC3 A;  1P8H A;  3ABW A;  4MD1 A;  3S3D B;  4XTO A;  4KNF A;  5DHG A;  1PXS A;  3ZEV A;  4FPD A;  1HZX A;  5G36 A;  3PWH A;  3QJV B;  2BRD A;  2M3G A;  3X3C A;  2VT4 A;  2YCZ A;  4BEY A;  1E12 A;  3VW7 A;  1PXR A;  4XXJ A;  5H2O A;  1O0A A;  4G7R B;  2X72 A;  4XT1 A;  1BRX A;  3KJ6 A;  1FBB A;  5B6W A;  1M0M A;  1CWQ A;  1TN5 A;  3EH3 B;  4KLY A;  3AYM A;  4G7S B;  5A44 A;  5B2N A;  3REY A;  2YDO A;  4L6R A;  5B0W A;  3HAQ A;  5JJJ A;  5B35 A;  2J4Y A;  5AZD A;  4XT3 A;  4LDO A;  5H2I A;  5H2H A;  1TN0 A;  2Y04 A;  4QI1 A;  5LWE A;  1JFP A;  5F8U A;  1C3W A;  4HYJ A;  1F88 A;  1E0P A;  1BM1 A;  3QBK A;  4G72 B;  5ITE A;  3RFM A;  4AMI A;  1AT9 A;  2KSY A;  4L35 A;  1XJI A;  1EHK B;  3QJR B;  3RZE A;  4EJ4 A;  4BVN A;  3UTW A;  4G7Q B;  2YCX A;  4IB4 A;  2YDV A;  4GP4 B;  2F93 A;  4GRV A;  5AX1 A;  2WJK A;  1GU8 A;  4PXF A;  5AHY A;  4BV0 A;  4HYX A;  4BUO A;  4HWL A;  2Z73 A;  3QJQ B;  3CAP A;  3DQB A;  5H2J A;  1FBK A;  2EI4 A;  5BR2 A;  2QPE B;  1R84 A;  3COC A;  3UG9 A;  3ODU A;  3DDL A;  3QJS B;  4GBR A;  3PBL A;  2ZIY A;  2Z55 A;  5EN0 A;  2Y02 A;  1L0M A;  2L6X A;  2R4R A;  4PXK A;  2YCW A;  4JKV A;  4IAQ A;  1PY6 A;  4A4M A;  3UZA A;  1QKO A;  5AWZ A;  4DKL A;  1S53 A;  1Q5J A;  3QAK A;  5KKH A;  3HAR A;  4AMJ A;  4MD2 A;  1JV7 A;  4G71 B;  1JGJ A;  1KG9 A;  2KSB A;  3HAO A;  5G2D A;  1S8J A;  3OE6 A;  5G2A A;  2I21 A;  1QM8 A;  3NYA A;  3UTX A;  3EH4 B;  1QKP A;  1R2N A;  4N4W A;  4TL3 A;  3VVK A;  1UAZ A;  4XTL A;  3PQR A;  1KGB A;  5G53 A;  1F4Z A;  2YCY A;  1GUE A;  3QBL A;  1M0L A;  2R4S A;  4QRY A;  4WW3 A;  2Y00 A;  1H2S A;  5AX0 A;  1IXF A;  3UTY A;  2KSA A;  3AYN A;  4WAV A;  3P0G A;  3UON A;  3VI0 A;  1BRR A;  1U19 A;  3COD A;  3NS0 A;  3HAS A;  3OE9 A;  5H2P A;  2NTW A;  1X0K 1;  3QJU B;  4DAJ A;  3VHZ A;  4JQ6 A;  3QJT B;  5J7A A;  3C9L A;  3EH5 B;  2NTU A;  1P8I A;  2I20 A;  2ZZL A;  3OE0 A;  3D4S A;  5B34 A;  3VGA A;  4GPO A;  1C8S A;  1C8R A;  3WQJ A;  3X3B A;  4GYC A;  4BEZ A;  4GP8 B;  4IAR A;  4K5Y A;  4FBZ A;  4FA7 B;  3HAP A;  1JV6 A;  4N4Y B;  4JR8 A;  5AHZ A;  5G54 A;  3PDS A;  3QBI A;  4X1H A;  3NY9 A;  4LDE A;  1X0I 1;  2RH1 A;  4J4Q A;  5JJE A;  4DJH A;  5G28 A;  4UG2 A;  3QAP A;  2I35 A;  2JAF A;  5FJG A;  4G70 B;  1S54 A;  1BRD A;  3EML A;  5H2K A;  3ZPQ A;  4EA3 A;  1Q5I A;  2HPY A;  1S51 A;  1MGY A;  3VG9 A;  5ITC A;  2PED A;  4EIY A;  2I1X A;  3AM6 A;  1AP9 A;  3V2Y A;  1XIO A;  5JJN A;  1KG8 A;  5H2L A;  1UCQ A;  3ZPR A;  3PXO A;  4XTN A;  5B6X A;  5DYS A;  1GZM A;  1S52 A;  3C9M A;  1F50 A;  3S8F B;  3HAN A;  5A45 A;  3MBV A;  4MQT A;  5H2N A;  4X32 A;  3V2W A;  3QDC A; 
#chains in the Genus database with same CATH topology
 4MBS A;  2QPD B;  4UHR A;  1LN6 A;  2LNL A;  3UZC A;  1XME B;  4DS7 E;  4OV0 A;  5H2M A;  4LDL A;  1L9H A;  3S8G B;  3A7K A;  1KME A;  4BWB A;  5C1M A;  2KS9 A;  3SN6 R;  3OE8 A;  5B6V A;  1IW6 A;  4N6H A;  5ETZ A;  4X31 A;  1H68 A;  2WJL A;  4GP5 B;  4Y9H A;  3S3B B;  5B6Y A;  3BVD B;  1S8L A;  4MQS A;  3S3C B;  1P8U A;  2Y03 A;  2ZFE A;  1VGO A;  5G2C A;  4FAA B;  5B6Z A;  1DZE A;  5TGZ A;  5BR5 A;  4QID A;  1VJM A;  2AT9 A;  3UTV A;  1M0K A;  5A8E A;  2G87 A;  2F95 A;  3QBG A;  2JAG A;  1QHJ A;  5DHH A;  3NSB A;  1X0S A;  1IW9 A;  3OAX A;  3T45 A;  3NY8 A;  2Y01 A;  4NC3 A;  1P8H A;  3ABW A;  4MD1 A;  3S3D B;  4XTO A;  4KNF A;  5DHG A;  1PXS A;  3ZEV A;  4FPD A;  1HZX A;  5G36 A;  3PWH A;  3QJV B;  2BRD A;  2M3G A;  3X3C A;  2VT4 A;  2YCZ A;  4BEY A;  1E12 A;  3VW7 A;  1PXR A;  4XXJ A;  5H2O A;  1O0A A;  4G7R B;  2X72 A;  4XT1 A;  1BRX A;  3KJ6 A;  1FBB A;  5B6W A;  1M0M A;  1CWQ A;  1TN5 A;  3EH3 B;  4KLY A;  3AYM A;  4G7S B;  5A44 A;  5B2N A;  3REY A;  2YDO A;  4L6R A;  5B0W A;  3HAQ A;  5JJJ A;  5B35 A;  2J4Y A;  5AZD A;  4XT3 A;  4LDO A;  5H2I A;  5H2H A;  1TN0 A;  2Y04 A;  4QI1 A;  5LWE A;  1JFP A;  5F8U A;  1C3W A;  4HYJ A;  1F88 A;  1E0P A;  1BM1 A;  3QBK A;  4G72 B;  5ITE A;  3RFM A;  4AMI A;  1AT9 A;  2KSY A;  4L35 A;  1XJI A;  1EHK B;  3QJR B;  3RZE A;  4EJ4 A;  4BVN A;  3UTW A;  4G7Q B;  2YCX A;  4IB4 A;  2YDV A;  4GP4 B;  2F93 A;  4GRV A;  5AX1 A;  2WJK A;  1GU8 A;  4PXF A;  5AHY A;  4BV0 A;  4HYX A;  4BUO A;  4HWL A;  2Z73 A;  3QJQ B;  3CAP A;  3DQB A;  5H2J A;  1FBK A;  2EI4 A;  5BR2 A;  2QPE B;  1R84 A;  3COC A;  3UG9 A;  3ODU A;  3DDL A;  3QJS B;  4GBR A;  3PBL A;  2ZIY A;  2Z55 A;  5EN0 A;  2Y02 A;  1L0M A;  2L6X A;  2R4R A;  4PXK A;  2YCW A;  4JKV A;  4IAQ A;  1PY6 A;  4A4M A;  3UZA A;  1QKO A;  5AWZ A;  4DKL A;  1S53 A;  1Q5J A;  3QAK A;  5KKH A;  3HAR A;  4AMJ A;  4MD2 A;  1JV7 A;  4G71 B;  1JGJ A;  1KG9 A;  2KSB A;  3HAO A;  5G2D A;  1S8J A;  3OE6 A;  5G2A A;  2I21 A;  1QM8 A;  3NYA A;  3UTX A;  3EH4 B;  1QKP A;  1R2N A;  4N4W A;  4TL3 A;  3VVK A;  1UAZ A;  4XTL A;  3PQR A;  1KGB A;  5G53 A;  1F4Z A;  2YCY A;  1GUE A;  3QBL A;  1M0L A;  2R4S A;  4QRY A;  4WW3 A;  2Y00 A;  1H2S A;  5AX0 A;  1IXF A;  3UTY A;  2KSA A;  3AYN A;  4WAV A;  3P0G A;  3UON A;  3VI0 A;  1BRR A;  1U19 A;  3COD A;  3NS0 A;  3HAS A;  3OE9 A;  5H2P A;  2NTW A;  1X0K 1;  3QJU B;  4DAJ A;  3VHZ A;  4JQ6 A;  3QJT B;  5J7A A;  3C9L A;  3EH5 B;  2NTU A;  1P8I A;  2I20 A;  2ZZL A;  3OE0 A;  3D4S A;  5B34 A;  3VGA A;  4GPO A;  1C8S A;  1C8R A;  3WQJ A;  3X3B A;  4GYC A;  4BEZ A;  4GP8 B;  4IAR A;  4K5Y A;  4FBZ A;  4FA7 B;  3HAP A;  1JV6 A;  4N4Y B;  4JR8 A;  5AHZ A;  5G54 A;  3PDS A;  3QBI A;  4X1H A;  3NY9 A;  4LDE A;  1X0I 1;  2RH1 A;  4J4Q A;  5JJE A;  4DJH A;  5G28 A;  4UG2 A;  3QAP A;  2I35 A;  2JAF A;  5FJG A;  4G70 B;  1S54 A;  1BRD A;  3EML A;  5H2K A;  3ZPQ A;  4EA3 A;  1Q5I A;  2HPY A;  1S51 A;  1MGY A;  3VG9 A;  5ITC A;  2PED A;  4EIY A;  2I1X A;  3AM6 A;  1AP9 A;  3V2Y A;  1XIO A;  5JJN A;  1KG8 A;  5H2L A;  1UCQ A;  3ZPR A;  3PXO A;  4XTN A;  5B6X A;  5DYS A;  1GZM A;  1S52 A;  3C9M A;  1F50 A;  3S8F B;  3HAN A;  5A45 A;  3MBV A;  4MQT A;  5H2N A;  4X32 A;  3V2W A;  3QDC A; 
#chains in the Genus database with same CATH homology
 4MBS A;  2QPD B;  4UHR A;  1LN6 A;  2LNL A;  3UZC A;  1XME B;  4DS7 E;  4OV0 A;  5H2M A;  4LDL A;  1L9H A;  3S8G B;  3A7K A;  1KME A;  4BWB A;  5C1M A;  2KS9 A;  3SN6 R;  3OE8 A;  5B6V A;  1IW6 A;  4N6H A;  5ETZ A;  4X31 A;  1H68 A;  2WJL A;  4GP5 B;  4Y9H A;  3S3B B;  5B6Y A;  3BVD B;  1S8L A;  4MQS A;  3S3C B;  1P8U A;  2Y03 A;  2ZFE A;  1VGO A;  5G2C A;  4FAA B;  5B6Z A;  1DZE A;  5TGZ A;  5BR5 A;  4QID A;  1VJM A;  2AT9 A;  3UTV A;  1M0K A;  5A8E A;  2G87 A;  2F95 A;  3QBG A;  2JAG A;  1QHJ A;  5DHH A;  3NSB A;  1X0S A;  1IW9 A;  3OAX A;  3T45 A;  3NY8 A;  2Y01 A;  4NC3 A;  1P8H A;  3ABW A;  4MD1 A;  3S3D B;  4XTO A;  4KNF A;  5DHG A;  1PXS A;  3ZEV A;  4FPD A;  1HZX A;  5G36 A;  3PWH A;  3QJV B;  2BRD A;  2M3G A;  3X3C A;  2VT4 A;  2YCZ A;  4BEY A;  1E12 A;  3VW7 A;  1PXR A;  4XXJ A;  5H2O A;  1O0A A;  4G7R B;  2X72 A;  4XT1 A;  1BRX A;  3KJ6 A;  1FBB A;  5B6W A;  1M0M A;  1CWQ A;  1TN5 A;  3EH3 B;  4KLY A;  3AYM A;  4G7S B;  5A44 A;  5B2N A;  3REY A;  2YDO A;  4L6R A;  5B0W A;  3HAQ A;  5JJJ A;  5B35 A;  2J4Y A;  5AZD A;  4XT3 A;  4LDO A;  5H2I A;  5H2H A;  1TN0 A;  2Y04 A;  4QI1 A;  5LWE A;  1JFP A;  5F8U A;  1C3W A;  4HYJ A;  1F88 A;  1E0P A;  1BM1 A;  3QBK A;  4G72 B;  5ITE A;  3RFM A;  4AMI A;  1AT9 A;  2KSY A;  4L35 A;  1XJI A;  1EHK B;  3QJR B;  3RZE A;  4EJ4 A;  4BVN A;  3UTW A;  4G7Q B;  2YCX A;  4IB4 A;  2YDV A;  4GP4 B;  2F93 A;  4GRV A;  5AX1 A;  2WJK A;  1GU8 A;  4PXF A;  5AHY A;  4BV0 A;  4HYX A;  4BUO A;  4HWL A;  2Z73 A;  3QJQ B;  3CAP A;  3DQB A;  5H2J A;  1FBK A;  2EI4 A;  5BR2 A;  2QPE B;  1R84 A;  3COC A;  3UG9 A;  3ODU A;  3DDL A;  3QJS B;  4GBR A;  3PBL A;  2ZIY A;  2Z55 A;  5EN0 A;  2Y02 A;  1L0M A;  2L6X A;  2R4R A;  4PXK A;  2YCW A;  4JKV A;  4IAQ A;  1PY6 A;  4A4M A;  3UZA A;  1QKO A;  5AWZ A;  4DKL A;  1S53 A;  1Q5J A;  3QAK A;  5KKH A;  3HAR A;  4AMJ A;  4MD2 A;  1JV7 A;  4G71 B;  1JGJ A;  1KG9 A;  2KSB A;  3HAO A;  5G2D A;  1S8J A;  3OE6 A;  5G2A A;  2I21 A;  1QM8 A;  3NYA A;  3UTX A;  3EH4 B;  1QKP A;  1R2N A;  4N4W A;  4TL3 A;  3VVK A;  1UAZ A;  4XTL A;  3PQR A;  1KGB A;  5G53 A;  1F4Z A;  2YCY A;  1GUE A;  3QBL A;  1M0L A;  2R4S A;  4QRY A;  4WW3 A;  2Y00 A;  1H2S A;  5AX0 A;  1IXF A;  3UTY A;  2KSA A;  3AYN A;  4WAV A;  3P0G A;  3UON A;  3VI0 A;  1BRR A;  1U19 A;  3COD A;  3NS0 A;  3HAS A;  3OE9 A;  5H2P A;  2NTW A;  1X0K 1;  3QJU B;  4DAJ A;  3VHZ A;  4JQ6 A;  3QJT B;  5J7A A;  3C9L A;  3EH5 B;  2NTU A;  1P8I A;  2I20 A;  2ZZL A;  3OE0 A;  3D4S A;  5B34 A;  3VGA A;  4GPO A;  1C8S A;  1C8R A;  3WQJ A;  3X3B A;  4GYC A;  4BEZ A;  4GP8 B;  4IAR A;  4K5Y A;  4FBZ A;  4FA7 B;  3HAP A;  1JV6 A;  4N4Y B;  4JR8 A;  5AHZ A;  5G54 A;  3PDS A;  3QBI A;  4X1H A;  3NY9 A;  4LDE A;  1X0I 1;  2RH1 A;  4J4Q A;  5JJE A;  4DJH A;  5G28 A;  4UG2 A;  3QAP A;  2I35 A;  2JAF A;  5FJG A;  4G70 B;  1S54 A;  1BRD A;  3EML A;  5H2K A;  3ZPQ A;  4EA3 A;  1Q5I A;  2HPY A;  1S51 A;  1MGY A;  3VG9 A;  5ITC A;  2PED A;  4EIY A;  2I1X A;  3AM6 A;  1AP9 A;  3V2Y A;  1XIO A;  5JJN A;  1KG8 A;  5H2L A;  1UCQ A;  3ZPR A;  3PXO A;  4XTN A;  5B6X A;  5DYS A;  1GZM A;  1S52 A;  3C9M A;  1F50 A;  3S8F B;  3HAN A;  5A45 A;  3MBV A;  4MQT A;  5H2N A;  4X32 A;  3V2W A;  3QDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...