4BEYA

Night blindness causing g90d rhodopsin in complex with gact2 peptide
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
326
structure length
326
Chain Sequence
MCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGDFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords RHODOPSIN
publication title Insights Into Congenital Stationary Night Blindness Based on the Structure of G90D Rhodopsin.
pubmed doi rcsb
source organism Bos taurus
total genus 125
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
A PF10413 Rhodopsin_N Amino terminal of the G-protein receptor rhodopsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4beyA00
2VT4A 3UZAA 3X3BA 5J7AA 3MBVA 3PQRA 3OE9A 3PDSA 3AM6A 2Y04A 1L9HA 4KNFA 4PXFA 5A8EA 3RFMA 3VVKA 1Q5JA 3QBKA 2J4YA 4G71B 3OE0A 3HAQA 3VW7A 3QBLA 4QIDA 5B6WA 1L0MA 2LNLA 1EHKB 1S8LA 4L35A 2I20A 2ZZLA 4G7RB 1AT9A 4X1HA 1F4ZA 3RZEA 5AX0A 5A45A 2X72A 4G7SB 5H2HA 3S8FB 1KG8A 2HPYA 2YCWA 3V2WA 4WAVA 5DYSA 3S3BB 4OV0A 4MQSA 1P8IA 5DHGA 4KLYA 1BM1A 2G87A 5BR5A 5TGZA 4G7QB 1C8SA 3HARA 1H68A 3EH4B 4DAJA 1IXFA 1E12A 4MD1A 4GP4B 3QDCA 2PEDA 4JR8A 4MD2A 3QJQB 1JFPA 3PXOA 3UG9A 3AYNA 5A44A 5AHYA 1PY6A 5JJEA 3V2YA 5B0WA 2KSAA 5FJGA 2QPDB 5H2LA 4XXJA 2BRDA 2KSBA 4FA7B 3COCA 4DJHA 3HANA 4N4WA 5LWEA 1TN0A 1CWQA 1KGBA 2ZFEA 1JV7A 1E0PA 2F93A 4XTNA 5B35A 1M0KA 1P8HA 3NY9A 2R4RA 2RH1A 3X3CA 3C9LA 5B6VA 2I21A 2KS9A 4EA3A 3EMLA 2YCZA 1DZEA 2WJLA 5ETZA 4J4QA 3DDLA 1S54A 2I35A 5G2DA 4X32A 4GRVA 4FBZA 2Y00A 1GU8A 4BEZA 3NS0A 3NYAA 4UG2A 5C1MA 3NY8A 2Y02A 4G70B 1QM8A 4XT1A 4XTOA 1VGOA 3QBGA 4EIYA 3QJRB 5AWZA 2Y03A 4IARA 3UZCA 3AYMA 4XT3A 2AT9A 4TL3A 3DQBA 1MGYA 5H2KA 4AMIA 1R2NA 2Z73A 1PXSA 1Q5IA 4X31A 3KJ6A 4QI1A 4HYJA 4IB4A 3UTYA 4A4MA 3VI0A 4UHRA 1XJIA 5G54A 3VHZA 4BEYA 1F50A 1JGJA 1S8JA 1BRXA 1R84A 3S3CB 2I1XA 1UAZA 5B34A 5H2MA 5EN0A 4L6RA 2YDOA 3S8GB 1QKPA 1M0LA 2R4SA 1O0AA 5B6XA 3EH5B 4AMJA 3EH3B 1XMEB 5G28A 4MQTA 3NSBA 1GUEA 2ZIYA 5AHZA 3HAPA 2NTUA 1XIOA 4BUOA 3QAKA 3OE8A 5H2OA 4WW3A 1AP9A 2YDVA 2JAFA 1HZXA 5BR2A 4LDOA 4LDEA 1U19A 4FAAB 3CODA 4N4YB 4K5YA 1QHJA 1TN5A 1C8RA 1BRDA 3ZPQA 5ITCA 1M0MA 2NTWA 1P8UA 4PXKA 4GP5B 2L6XA 1KG9A 5KKHA 1X0I1 1X0K1 2M3GA 2JAGA 2Z55A 3UTVA 3UONA 4Y9HA 3REYA 2EI4A 4BWBA 5G36A 5H2NA 1S51A 3ZEVA 5DHHA 3S3DB 3HASA 3ODUA 1IW9A 3T45A 1F88A 3HAOA 4EJ4A 5G53A 2YCYA 3UTWA 2YCXA 1VJMA 1C3WA 4GBRA 4IAQA 3ZPRA 3PWHA 1JV6A 5JJJA 4G72B 3QJSB 1S52A 4N6HA 3D4SA 3PBLA 4GPOA 3SN6R 4FPDA 1GZMA 4BV0A 4QRYA 1PXRA 1IW6A 2QPEB 2WJKA 5B6YA 5B6ZA 3ABWA 3QJUB 4XTLA 5B2NA 4LDLA 4HYXA 5H2PA 1FBBA 3QJTB 4NC3A 1FBKA 5G2CA 1X0SA 3CAPA 4MBSA 5JJNA 4HWLA 3QAPA 4JKVA 3OAXA 1H2SA 5G2AA 3P0GA 3BVDB 2Y01A 4GYCA 4GP8B 5ITEA 1KMEA 3A7KA 3VGAA 1BRRA 1QKOA 4BVNA 1UCQA 3QJVB 4JQ6A 3UTXA 3VG9A 5H2JA 5H2IA 3OE6A 5F8UA 2F95A 3WQJA 3QBIA 3C9MA 1LN6A 2KSYA 4DKLA 5AX1A 1S53A 5AZDA
chains in the Genus database with same CATH superfamily
2VT4A 3UZAA 3X3BA 5J7AA 3MBVA 3PQRA 3OE9A 3PDSA 3AM6A 2Y04A 1L9HA 4KNFA 4PXFA 5A8EA 3RFMA 3VVKA 1Q5JA 3QBKA 2J4YA 4G71B 3OE0A 3HAQA 3VW7A 3QBLA 4QIDA 5B6WA 1L0MA 2LNLA 1EHKB 1S8LA 4L35A 2I20A 2ZZLA 4G7RB 1AT9A 4X1HA 1F4ZA 3RZEA 5AX0A 5A45A 2X72A 4G7SB 5H2HA 3S8FB 1KG8A 2HPYA 2YCWA 3V2WA 4WAVA 5DYSA 3S3BB 4OV0A 4MQSA 1P8IA 5DHGA 4KLYA 1BM1A 2G87A 5BR5A 5TGZA 4G7QB 1C8SA 3HARA 1H68A 3EH4B 4DAJA 1IXFA 1E12A 4MD1A 4GP4B 3QDCA 2PEDA 4JR8A 4MD2A 3QJQB 1JFPA 3PXOA 3UG9A 3AYNA 5A44A 5AHYA 1PY6A 5JJEA 3V2YA 5B0WA 2KSAA 5FJGA 2QPDB 5H2LA 4XXJA 2BRDA 2KSBA 4FA7B 3COCA 4DJHA 3HANA 4N4WA 5LWEA 1TN0A 1CWQA 1KGBA 2ZFEA 1JV7A 1E0PA 2F93A 4XTNA 5B35A 1M0KA 1P8HA 3NY9A 2R4RA 2RH1A 3X3CA 3C9LA 5B6VA 2I21A 2KS9A 4EA3A 3EMLA 2YCZA 1DZEA 2WJLA 5ETZA 4J4QA 3DDLA 1S54A 2I35A 5G2DA 4X32A 4GRVA 4FBZA 2Y00A 1GU8A 4BEZA 3NS0A 3NYAA 4UG2A 5C1MA 3NY8A 2Y02A 4G70B 1QM8A 4XT1A 4XTOA 1VGOA 3QBGA 4EIYA 3QJRB 5AWZA 2Y03A 4IARA 3UZCA 3AYMA 4XT3A 2AT9A 4TL3A 3DQBA 1MGYA 5H2KA 4AMIA 1R2NA 2Z73A 1PXSA 1Q5IA 4X31A 3KJ6A 4QI1A 4HYJA 4IB4A 3UTYA 4A4MA 3VI0A 4UHRA 1XJIA 5G54A 3VHZA 4BEYA 1F50A 1JGJA 1S8JA 1BRXA 1R84A 3S3CB 2I1XA 1UAZA 5B34A 5H2MA 5EN0A 4L6RA 2YDOA 4DS7E 3S8GB 1QKPA 1M0LA 2R4SA 1O0AA 5B6XA 3EH5B 4AMJA 3EH3B 1XMEB 5G28A 4MQTA 3NSBA 1GUEA 2ZIYA 5AHZA 3HAPA 2NTUA 1XIOA 4BUOA 3QAKA 3OE8A 5H2OA 4WW3A 1AP9A 2YDVA 2JAFA 1HZXA 5BR2A 4LDOA 4LDEA 1U19A 4FAAB 3CODA 4N4YB 4K5YA 1QHJA 1TN5A 1C8RA 1BRDA 3ZPQA 5ITCA 1M0MA 2NTWA 1P8UA 4PXKA 4GP5B 2L6XA 1KG9A 5KKHA 1X0I1 1X0K1 2M3GA 2JAGA 2Z55A 3UTVA 3UONA 4Y9HA 3REYA 2EI4A 4BWBA 5G36A 5H2NA 1S51A 3ZEVA 5DHHA 3S3DB 3HASA 3ODUA 1IW9A 3T45A 1F88A 3HAOA 4EJ4A 5G53A 2YCYA 3UTWA 2YCXA 1VJMA 1C3WA 4GBRA 4IAQA 3ZPRA 3PWHA 1JV6A 5JJJA 4G72B 3QJSB 1S52A 4N6HA 3D4SA 3PBLA 4GPOA 3SN6R 4FPDA 1GZMA 4BV0A 4QRYA 1PXRA 1IW6A 2QPEB 2WJKA 5B6YA 5B6ZA 3ABWA 3QJUB 4XTLA 5B2NA 4LDLA 4HYXA 5H2PA 1FBBA 3QJTB 4NC3A 1FBKA 5G2CA 1X0SA 3CAPA 4MBSA 5JJNA 4HWLA 3QAPA 4JKVA 3OAXA 1H2SA 5G2AA 3P0GA 3BVDB 2Y01A 4GYCA 4GP8B 5ITEA 1KMEA 3A7KA 3VGAA 1BRRA 1QKOA 4BVNA 1UCQA 3QJVB 4JQ6A 3UTXA 3VG9A 5H2JA 5H2IA 3OE6A 5F8UA 2F95A 3WQJA 3QBIA 3C9MA 1LN6A 2KSYA 4DKLA 5AX1A 1S53A 5AZDA
chains in the Genus database with same CATH topology
2VT4A 3UZAA 3X3BA 5J7AA 3MBVA 3PQRA 3OE9A 3PDSA 3AM6A 2Y04A 1L9HA 4KNFA 4PXFA 5A8EA 3RFMA 3VVKA 1Q5JA 3QBKA 2J4YA 4G71B 3OE0A 3HAQA 3VW7A 3QBLA 4QIDA 5B6WA 1L0MA 2LNLA 1EHKB 1S8LA 4L35A 2I20A 2ZZLA 4G7RB 1AT9A 4X1HA 1F4ZA 3RZEA 5AX0A 5A45A 2X72A 4G7SB 5H2HA 3S8FB 1KG8A 2HPYA 2YCWA 3V2WA 4WAVA 5DYSA 3S3BB 4OV0A 4MQSA 1P8IA 5DHGA 4KLYA 1BM1A 2G87A 5BR5A 5TGZA 4G7QB 1C8SA 3HARA 1H68A 3EH4B 4DAJA 1IXFA 1E12A 4MD1A 4GP4B 3QDCA 2PEDA 4JR8A 4MD2A 3QJQB 1JFPA 3PXOA 3UG9A 3AYNA 5A44A 5AHYA 1PY6A 5JJEA 3V2YA 5B0WA 2KSAA 5FJGA 2QPDB 5H2LA 4XXJA 2BRDA 2KSBA 4FA7B 3COCA 4DJHA 3HANA 4N4WA 5LWEA 1TN0A 1CWQA 1KGBA 2ZFEA 1JV7A 1E0PA 2F93A 4XTNA 5B35A 1M0KA 1P8HA 3NY9A 2R4RA 2RH1A 3X3CA 3C9LA 5B6VA 2I21A 2KS9A 4EA3A 3EMLA 2YCZA 1DZEA 2WJLA 5ETZA 4J4QA 3DDLA 1S54A 2I35A 5G2DA 4X32A 4GRVA 4FBZA 2Y00A 1GU8A 4BEZA 3NS0A 3NYAA 4UG2A 5C1MA 3NY8A 2Y02A 4G70B 1QM8A 4XT1A 4XTOA 1VGOA 3QBGA 4EIYA 3QJRB 5AWZA 2Y03A 4IARA 3UZCA 3AYMA 4XT3A 2AT9A 4TL3A 3DQBA 1MGYA 5H2KA 4AMIA 1R2NA 2Z73A 1PXSA 1Q5IA 4X31A 3KJ6A 4QI1A 4HYJA 4IB4A 3UTYA 4A4MA 3VI0A 4UHRA 1XJIA 5G54A 3VHZA 4BEYA 1F50A 1JGJA 1S8JA 1BRXA 1R84A 3S3CB 2I1XA 1UAZA 5B34A 5H2MA 5EN0A 4L6RA 2YDOA 4DS7E 3S8GB 1QKPA 1M0LA 2R4SA 1O0AA 5B6XA 3EH5B 4AMJA 3EH3B 1XMEB 5G28A 4MQTA 3NSBA 1GUEA 2ZIYA 5AHZA 3HAPA 2NTUA 1XIOA 4BUOA 3QAKA 3OE8A 5H2OA 4WW3A 1AP9A 2YDVA 2JAFA 1HZXA 5BR2A 4LDOA 4LDEA 1U19A 4FAAB 3CODA 4N4YB 4K5YA 1QHJA 1TN5A 1C8RA 1BRDA 3ZPQA 5ITCA 1M0MA 2NTWA 1P8UA 4PXKA 4GP5B 2L6XA 1KG9A 5KKHA 1X0I1 1X0K1 2M3GA 2JAGA 2Z55A 3UTVA 3UONA 4Y9HA 3REYA 2EI4A 4BWBA 5G36A 5H2NA 1S51A 3ZEVA 5DHHA 3S3DB 3HASA 3ODUA 1IW9A 3T45A 1F88A 3HAOA 4EJ4A 5G53A 2YCYA 3UTWA 2YCXA 1VJMA 1C3WA 4GBRA 4IAQA 3ZPRA 3PWHA 1JV6A 5JJJA 4G72B 3QJSB 1S52A 4N6HA 3D4SA 3PBLA 4GPOA 3SN6R 4FPDA 1GZMA 4BV0A 4QRYA 1PXRA 1IW6A 2QPEB 2WJKA 5B6YA 5B6ZA 3ABWA 3QJUB 4XTLA 5B2NA 4LDLA 4HYXA 5H2PA 1FBBA 3QJTB 4NC3A 1FBKA 5G2CA 1X0SA 3CAPA 4MBSA 5JJNA 4HWLA 3QAPA 4JKVA 3OAXA 1H2SA 5G2AA 3P0GA 3BVDB 2Y01A 4GYCA 4GP8B 5ITEA 1KMEA 3A7KA 3VGAA 1BRRA 1QKOA 4BVNA 1UCQA 3QJVB 4JQ6A 3UTXA 3VG9A 5H2JA 5H2IA 3OE6A 5F8UA 2F95A 3WQJA 3QBIA 3C9MA 1LN6A 2KSYA 4DKLA 5AX1A 1S53A 5AZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VT4 A;  3UZA A;  3X3B A;  5J7A A;  3MBV A;  3PQR A;  3OE9 A;  3PDS A;  3AM6 A;  2Y04 A;  1L9H A;  4KNF A;  4PXF A;  5A8E A;  3RFM A;  3VVK A;  1Q5J A;  3QBK A;  2J4Y A;  4G71 B;  3OE0 A;  3HAQ A;  3VW7 A;  3QBL A;  4QID A;  5B6W A;  1L0M A;  2LNL A;  1EHK B;  1S8L A;  4L35 A;  2I20 A;  2ZZL A;  4G7R B;  1AT9 A;  4X1H A;  1F4Z A;  3RZE A;  5AX0 A;  5A45 A;  2X72 A;  4G7S B;  5H2H A;  3S8F B;  1KG8 A;  2HPY A;  2YCW A;  3V2W A;  4WAV A;  5DYS A;  3S3B B;  4OV0 A;  4MQS A;  1P8I A;  5DHG A;  4KLY A;  1BM1 A;  2G87 A;  5BR5 A;  5TGZ A;  4G7Q B;  1C8S A;  3HAR A;  1H68 A;  3EH4 B;  4DAJ A;  1IXF A;  1E12 A;  4MD1 A;  4GP4 B;  3QDC A;  2PED A;  4JR8 A;  4MD2 A;  3QJQ B;  1JFP A;  3PXO A;  3UG9 A;  3AYN A;  5A44 A;  5AHY A;  1PY6 A;  5JJE A;  3V2Y A;  5B0W A;  2KSA A;  5FJG A;  2QPD B;  5H2L A;  4XXJ A;  2BRD A;  2KSB A;  4FA7 B;  3COC A;  4DJH A;  3HAN A;  4N4W A;  5LWE A;  1TN0 A;  1CWQ A;  1KGB A;  2ZFE A;  1JV7 A;  1E0P A;  2F93 A;  4XTN A;  5B35 A;  1M0K A;  1P8H A;  3NY9 A;  2R4R A;  2RH1 A;  3X3C A;  3C9L A;  5B6V A;  2I21 A;  2KS9 A;  4EA3 A;  3EML A;  2YCZ A;  1DZE A;  2WJL A;  5ETZ A;  4J4Q A;  3DDL A;  1S54 A;  2I35 A;  5G2D A;  4X32 A;  4GRV A;  4FBZ A;  2Y00 A;  1GU8 A;  4BEZ A;  3NS0 A;  3NYA A;  4UG2 A;  5C1M A;  3NY8 A;  2Y02 A;  4G70 B;  1QM8 A;  4XT1 A;  4XTO A;  1VGO A;  3QBG A;  4EIY A;  3QJR B;  5AWZ A;  2Y03 A;  4IAR A;  3UZC A;  3AYM A;  4XT3 A;  2AT9 A;  4TL3 A;  3DQB A;  1MGY A;  5H2K A;  4AMI A;  1R2N A;  2Z73 A;  1PXS A;  1Q5I A;  4X31 A;  3KJ6 A;  4QI1 A;  4HYJ A;  4IB4 A;  3UTY A;  4A4M A;  3VI0 A;  4UHR A;  1XJI A;  5G54 A;  3VHZ A;  4BEY A;  1F50 A;  1JGJ A;  1S8J A;  1BRX A;  1R84 A;  3S3C B;  2I1X A;  1UAZ A;  5B34 A;  5H2M A;  5EN0 A;  4L6R A;  2YDO A;  3S8G B;  1QKP A;  1M0L A;  2R4S A;  1O0A A;  5B6X A;  3EH5 B;  4AMJ A;  3EH3 B;  1XME B;  5G28 A;  4MQT A;  3NSB A;  1GUE A;  2ZIY A;  5AHZ A;  3HAP A;  2NTU A;  1XIO A;  4BUO A;  3QAK A;  3OE8 A;  5H2O A;  4WW3 A;  1AP9 A;  2YDV A;  2JAF A;  1HZX A;  5BR2 A;  4LDO A;  4LDE A;  1U19 A;  4FAA B;  3COD A;  4N4Y B;  4K5Y A;  1QHJ A;  1TN5 A;  1C8R A;  1BRD A;  3ZPQ A;  5ITC A;  1M0M A;  2NTW A;  1P8U A;  4PXK A;  4GP5 B;  2L6X A;  1KG9 A;  5KKH A;  1X0I 1;  1X0K 1;  2M3G A;  2JAG A;  2Z55 A;  3UTV A;  3UON A;  4Y9H A;  3REY A;  2EI4 A;  4BWB A;  5G36 A;  5H2N A;  1S51 A;  3ZEV A;  5DHH A;  3S3D B;  3HAS A;  3ODU A;  1IW9 A;  3T45 A;  1F88 A;  3HAO A;  4EJ4 A;  5G53 A;  2YCY A;  3UTW A;  2YCX A;  1VJM A;  1C3W A;  4GBR A;  4IAQ A;  3ZPR A;  3PWH A;  1JV6 A;  5JJJ A;  4G72 B;  3QJS B;  1S52 A;  4N6H A;  3D4S A;  3PBL A;  4GPO A;  3SN6 R;  4FPD A;  1GZM A;  4BV0 A;  4QRY A;  1PXR A;  1IW6 A;  2QPE B;  2WJK A;  5B6Y A;  5B6Z A;  3ABW A;  3QJU B;  4XTL A;  5B2N A;  4LDL A;  4HYX A;  5H2P A;  1FBB A;  3QJT B;  4NC3 A;  1FBK A;  5G2C A;  1X0S A;  3CAP A;  4MBS A;  5JJN A;  4HWL A;  3QAP A;  4JKV A;  3OAX A;  1H2S A;  5G2A A;  3P0G A;  3BVD B;  2Y01 A;  4GYC A;  4GP8 B;  5ITE A;  1KME A;  3A7K A;  3VGA A;  1BRR A;  1QKO A;  4BVN A;  1UCQ A;  3QJV B;  4JQ6 A;  3UTX A;  3VG9 A;  5H2J A;  5H2I A;  3OE6 A;  5F8U A;  2F95 A;  3WQJ A;  3QBI A;  3C9M A;  1LN6 A;  2KSY A;  4DKL A;  5AX1 A;  1S53 A;  5AZD A; 
#chains in the Genus database with same CATH topology
 2VT4 A;  3UZA A;  3X3B A;  5J7A A;  3MBV A;  3PQR A;  3OE9 A;  3PDS A;  3AM6 A;  2Y04 A;  1L9H A;  4KNF A;  4PXF A;  5A8E A;  3RFM A;  3VVK A;  1Q5J A;  3QBK A;  2J4Y A;  4G71 B;  3OE0 A;  3HAQ A;  3VW7 A;  3QBL A;  4QID A;  5B6W A;  1L0M A;  2LNL A;  1EHK B;  1S8L A;  4L35 A;  2I20 A;  2ZZL A;  4G7R B;  1AT9 A;  4X1H A;  1F4Z A;  3RZE A;  5AX0 A;  5A45 A;  2X72 A;  4G7S B;  5H2H A;  3S8F B;  1KG8 A;  2HPY A;  2YCW A;  3V2W A;  4WAV A;  5DYS A;  3S3B B;  4OV0 A;  4MQS A;  1P8I A;  5DHG A;  4KLY A;  1BM1 A;  2G87 A;  5BR5 A;  5TGZ A;  4G7Q B;  1C8S A;  3HAR A;  1H68 A;  3EH4 B;  4DAJ A;  1IXF A;  1E12 A;  4MD1 A;  4GP4 B;  3QDC A;  2PED A;  4JR8 A;  4MD2 A;  3QJQ B;  1JFP A;  3PXO A;  3UG9 A;  3AYN A;  5A44 A;  5AHY A;  1PY6 A;  5JJE A;  3V2Y A;  5B0W A;  2KSA A;  5FJG A;  2QPD B;  5H2L A;  4XXJ A;  2BRD A;  2KSB A;  4FA7 B;  3COC A;  4DJH A;  3HAN A;  4N4W A;  5LWE A;  1TN0 A;  1CWQ A;  1KGB A;  2ZFE A;  1JV7 A;  1E0P A;  2F93 A;  4XTN A;  5B35 A;  1M0K A;  1P8H A;  3NY9 A;  2R4R A;  2RH1 A;  3X3C A;  3C9L A;  5B6V A;  2I21 A;  2KS9 A;  4EA3 A;  3EML A;  2YCZ A;  1DZE A;  2WJL A;  5ETZ A;  4J4Q A;  3DDL A;  1S54 A;  2I35 A;  5G2D A;  4X32 A;  4GRV A;  4FBZ A;  2Y00 A;  1GU8 A;  4BEZ A;  3NS0 A;  3NYA A;  4UG2 A;  5C1M A;  3NY8 A;  2Y02 A;  4G70 B;  1QM8 A;  4XT1 A;  4XTO A;  1VGO A;  3QBG A;  4EIY A;  3QJR B;  5AWZ A;  2Y03 A;  4IAR A;  3UZC A;  3AYM A;  4XT3 A;  2AT9 A;  4TL3 A;  3DQB A;  1MGY A;  5H2K A;  4AMI A;  1R2N A;  2Z73 A;  1PXS A;  1Q5I A;  4X31 A;  3KJ6 A;  4QI1 A;  4HYJ A;  4IB4 A;  3UTY A;  4A4M A;  3VI0 A;  4UHR A;  1XJI A;  5G54 A;  3VHZ A;  4BEY A;  1F50 A;  1JGJ A;  1S8J A;  1BRX A;  1R84 A;  3S3C B;  2I1X A;  1UAZ A;  5B34 A;  5H2M A;  5EN0 A;  4L6R A;  2YDO A;  4DS7 E;  3S8G B;  1QKP A;  1M0L A;  2R4S A;  1O0A A;  5B6X A;  3EH5 B;  4AMJ A;  3EH3 B;  1XME B;  5G28 A;  4MQT A;  3NSB A;  1GUE A;  2ZIY A;  5AHZ A;  3HAP A;  2NTU A;  1XIO A;  4BUO A;  3QAK A;  3OE8 A;  5H2O A;  4WW3 A;  1AP9 A;  2YDV A;  2JAF A;  1HZX A;  5BR2 A;  4LDO A;  4LDE A;  1U19 A;  4FAA B;  3COD A;  4N4Y B;  4K5Y A;  1QHJ A;  1TN5 A;  1C8R A;  1BRD A;  3ZPQ A;  5ITC A;  1M0M A;  2NTW A;  1P8U A;  4PXK A;  4GP5 B;  2L6X A;  1KG9 A;  5KKH A;  1X0I 1;  1X0K 1;  2M3G A;  2JAG A;  2Z55 A;  3UTV A;  3UON A;  4Y9H A;  3REY A;  2EI4 A;  4BWB A;  5G36 A;  5H2N A;  1S51 A;  3ZEV A;  5DHH A;  3S3D B;  3HAS A;  3ODU A;  1IW9 A;  3T45 A;  1F88 A;  3HAO A;  4EJ4 A;  5G53 A;  2YCY A;  3UTW A;  2YCX A;  1VJM A;  1C3W A;  4GBR A;  4IAQ A;  3ZPR A;  3PWH A;  1JV6 A;  5JJJ A;  4G72 B;  3QJS B;  1S52 A;  4N6H A;  3D4S A;  3PBL A;  4GPO A;  3SN6 R;  4FPD A;  1GZM A;  4BV0 A;  4QRY A;  1PXR A;  1IW6 A;  2QPE B;  2WJK A;  5B6Y A;  5B6Z A;  3ABW A;  3QJU B;  4XTL A;  5B2N A;  4LDL A;  4HYX A;  5H2P A;  1FBB A;  3QJT B;  4NC3 A;  1FBK A;  5G2C A;  1X0S A;  3CAP A;  4MBS A;  5JJN A;  4HWL A;  3QAP A;  4JKV A;  3OAX A;  1H2S A;  5G2A A;  3P0G A;  3BVD B;  2Y01 A;  4GYC A;  4GP8 B;  5ITE A;  1KME A;  3A7K A;  3VGA A;  1BRR A;  1QKO A;  4BVN A;  1UCQ A;  3QJV B;  4JQ6 A;  3UTX A;  3VG9 A;  5H2J A;  5H2I A;  3OE6 A;  5F8U A;  2F95 A;  3WQJ A;  3QBI A;  3C9M A;  1LN6 A;  2KSY A;  4DKL A;  5AX1 A;  1S53 A;  5AZD A; 
#chains in the Genus database with same CATH homology
 2VT4 A;  3UZA A;  3X3B A;  5J7A A;  3MBV A;  3PQR A;  3OE9 A;  3PDS A;  3AM6 A;  2Y04 A;  1L9H A;  4KNF A;  4PXF A;  5A8E A;  3RFM A;  3VVK A;  1Q5J A;  3QBK A;  2J4Y A;  4G71 B;  3OE0 A;  3HAQ A;  3VW7 A;  3QBL A;  4QID A;  5B6W A;  1L0M A;  2LNL A;  1EHK B;  1S8L A;  4L35 A;  2I20 A;  2ZZL A;  4G7R B;  1AT9 A;  4X1H A;  1F4Z A;  3RZE A;  5AX0 A;  5A45 A;  2X72 A;  4G7S B;  5H2H A;  3S8F B;  1KG8 A;  2HPY A;  2YCW A;  3V2W A;  4WAV A;  5DYS A;  3S3B B;  4OV0 A;  4MQS A;  1P8I A;  5DHG A;  4KLY A;  1BM1 A;  2G87 A;  5BR5 A;  5TGZ A;  4G7Q B;  1C8S A;  3HAR A;  1H68 A;  3EH4 B;  4DAJ A;  1IXF A;  1E12 A;  4MD1 A;  4GP4 B;  3QDC A;  2PED A;  4JR8 A;  4MD2 A;  3QJQ B;  1JFP A;  3PXO A;  3UG9 A;  3AYN A;  5A44 A;  5AHY A;  1PY6 A;  5JJE A;  3V2Y A;  5B0W A;  2KSA A;  5FJG A;  2QPD B;  5H2L A;  4XXJ A;  2BRD A;  2KSB A;  4FA7 B;  3COC A;  4DJH A;  3HAN A;  4N4W A;  5LWE A;  1TN0 A;  1CWQ A;  1KGB A;  2ZFE A;  1JV7 A;  1E0P A;  2F93 A;  4XTN A;  5B35 A;  1M0K A;  1P8H A;  3NY9 A;  2R4R A;  2RH1 A;  3X3C A;  3C9L A;  5B6V A;  2I21 A;  2KS9 A;  4EA3 A;  3EML A;  2YCZ A;  1DZE A;  2WJL A;  5ETZ A;  4J4Q A;  3DDL A;  1S54 A;  2I35 A;  5G2D A;  4X32 A;  4GRV A;  4FBZ A;  2Y00 A;  1GU8 A;  4BEZ A;  3NS0 A;  3NYA A;  4UG2 A;  5C1M A;  3NY8 A;  2Y02 A;  4G70 B;  1QM8 A;  4XT1 A;  4XTO A;  1VGO A;  3QBG A;  4EIY A;  3QJR B;  5AWZ A;  2Y03 A;  4IAR A;  3UZC A;  3AYM A;  4XT3 A;  2AT9 A;  4TL3 A;  3DQB A;  1MGY A;  5H2K A;  4AMI A;  1R2N A;  2Z73 A;  1PXS A;  1Q5I A;  4X31 A;  3KJ6 A;  4QI1 A;  4HYJ A;  4IB4 A;  3UTY A;  4A4M A;  3VI0 A;  4UHR A;  1XJI A;  5G54 A;  3VHZ A;  4BEY A;  1F50 A;  1JGJ A;  1S8J A;  1BRX A;  1R84 A;  3S3C B;  2I1X A;  1UAZ A;  5B34 A;  5H2M A;  5EN0 A;  4L6R A;  2YDO A;  4DS7 E;  3S8G B;  1QKP A;  1M0L A;  2R4S A;  1O0A A;  5B6X A;  3EH5 B;  4AMJ A;  3EH3 B;  1XME B;  5G28 A;  4MQT A;  3NSB A;  1GUE A;  2ZIY A;  5AHZ A;  3HAP A;  2NTU A;  1XIO A;  4BUO A;  3QAK A;  3OE8 A;  5H2O A;  4WW3 A;  1AP9 A;  2YDV A;  2JAF A;  1HZX A;  5BR2 A;  4LDO A;  4LDE A;  1U19 A;  4FAA B;  3COD A;  4N4Y B;  4K5Y A;  1QHJ A;  1TN5 A;  1C8R A;  1BRD A;  3ZPQ A;  5ITC A;  1M0M A;  2NTW A;  1P8U A;  4PXK A;  4GP5 B;  2L6X A;  1KG9 A;  5KKH A;  1X0I 1;  1X0K 1;  2M3G A;  2JAG A;  2Z55 A;  3UTV A;  3UON A;  4Y9H A;  3REY A;  2EI4 A;  4BWB A;  5G36 A;  5H2N A;  1S51 A;  3ZEV A;  5DHH A;  3S3D B;  3HAS A;  3ODU A;  1IW9 A;  3T45 A;  1F88 A;  3HAO A;  4EJ4 A;  5G53 A;  2YCY A;  3UTW A;  2YCX A;  1VJM A;  1C3W A;  4GBR A;  4IAQ A;  3ZPR A;  3PWH A;  1JV6 A;  5JJJ A;  4G72 B;  3QJS B;  1S52 A;  4N6H A;  3D4S A;  3PBL A;  4GPO A;  3SN6 R;  4FPD A;  1GZM A;  4BV0 A;  4QRY A;  1PXR A;  1IW6 A;  2QPE B;  2WJK A;  5B6Y A;  5B6Z A;  3ABW A;  3QJU B;  4XTL A;  5B2N A;  4LDL A;  4HYX A;  5H2P A;  1FBB A;  3QJT B;  4NC3 A;  1FBK A;  5G2C A;  1X0S A;  3CAP A;  4MBS A;  5JJN A;  4HWL A;  3QAP A;  4JKV A;  3OAX A;  1H2S A;  5G2A A;  3P0G A;  3BVD B;  2Y01 A;  4GYC A;  4GP8 B;  5ITE A;  1KME A;  3A7K A;  3VGA A;  1BRR A;  1QKO A;  4BVN A;  1UCQ A;  3QJV B;  4JQ6 A;  3UTX A;  3VG9 A;  5H2J A;  5H2I A;  3OE6 A;  5F8U A;  2F95 A;  3WQJ A;  3QBI A;  3C9M A;  1LN6 A;  2KSY A;  4DKL A;  5AX1 A;  1S53 A;  5AZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...