4BVNA

Ultra-thermostable beta1-adrenoceptor with cyanopindolol bound
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
295
structure length
289
Chain Sequence
LSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASVETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPKWLFVAFNWLGYANSAMNPIILCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BETA-1 ADRENERGIC RECEPTOR
publication title The 2.1 A Resolution Structure of Cyanopindolol-Bound Beta1- Adrenoceptor Identifies an Intramembrane Na+ Ion that Stabilises the Ligand-Free Receptor.
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 126
structure length 289
sequence length 295
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4bvnA00
4FAAB 5EN0A 1F4ZA 3X3CA 2I21A 4MQSA 5H2MA 1AP9A 2RH1A 4WW3A 4GP8B 3T45A 3QBKA 3PDSA 5BR2A 3DQBA 1S8LA 4Y9HA 3UTYA 3UG9A 4EIYA 5KKHA 1UCQA 1S51A 3ABWA 4G71B 3PBLA 4A4MA 3C9LA 1C8SA 1KGBA 1PY6A 3AYMA 4GPOA 5B6YA 2LNLA 4IAQA 5AZDA 3QJRB 2KSAA 5DHGA 2JAGA 2YDOA 4UHRA 3EH3B 2J4YA 1X0SA 4XT3A 1XIOA 3EH4B 2YCXA 5A45A 4HWLA 4N4YB 4G72B 4BUOA 2KSBA 3HARA 4MD1A 3UTWA 3VI0A 2YDVA 1BRDA 4HYJA 3PXOA 4GRVA 3AM6A 5B6WA 5H2JA 1LN6A 2ZZLA 1MGYA 1DZEA 3QJUB 4QI1A 3OE0A 4LDEA 1GZMA 5B6ZA 2BRDA 1IW6A 2HPYA 4MD2A 5B34A 5ITCA 3X3BA 1IW9A 4GP4B 1XMEB 4BEZA 3QDCA 4G7QB 4G7SB 3ODUA 5ETZA 4MBSA 5J7AA 3P0GA 2Y00A 3MBVA 3EMLA 1QKOA 3S8FB 3QJQB 4X1HA 2KS9A 3UTVA 3CAPA 4WAVA 1CWQA 3QAKA 5H2OA 4QRYA 2G87A 1GU8A 3EH5B 1QM8A 2AT9A 3V2YA 2WJLA 1IXFA 5JJNA 3ZEVA 1HZXA 2KSYA 4FA7B 3HANA 3V2WA 4PXKA 1X0I1 5B0WA 1M0MA 3UONA 5H2LA 1BRRA 5B6VA 2YCYA 3VHZA 5LWEA 5TGZA 4KLYA 3VG9A 2M3GA 1GUEA 1BRXA 4KNFA 2I20A 2I1XA 1VGOA 3QJTB 5H2NA 4PXFA 1H2SA 3VVKA 4LDLA 3QBGA 5JJEA 3DDLA 1XJIA 5BR5A 2Y01A 1PXSA 5C1MA 2YCWA 4JR8A 3S8GB 1U19A 3UZCA 3NY8A 1QHJA 2Y02A 3WQJA 3HAOA 3RZEA 1H68A 1C8RA 3OE9A 5B6XA 1C3WA 1JFPA 1X0K1 4G70B 1L0MA 5AX1A 4N4WA 3ZPRA 5DHHA 5H2PA 2F95A 4NC3A 4X31A 3CODA 3NYAA 4JQ6A 3BVDB 4FPDA 3QBIA 2Z73A 1UAZA 4LDOA 4OV0A 2QPEB 5JJJA 1P8IA 4GP5B 4DKLA 4XXJA 2Y03A 4TL3A 3QJVB 2NTUA 4AMJA 1BM1A 1P8UA 5AWZA 3S3DB 1E0PA 5FJGA 1KG8A 2ZFEA 4XTNA 3QJSB 3OAXA 4JKVA 3S3CB 5ITEA 4BVNA 2ZIYA 1L9HA 1M0KA 2JAFA 2X72A 1KMEA 3PQRA 4XTOA 1S53A 5AX0A 5A8EA 5H2KA 4G7RB 3D4SA 2R4RA 1AT9A 3SN6R 3A7KA 5B2NA 1E12A 1R2NA 3COCA 4BWBA 4HYXA 4UG2A 1FBBA 1P8HA 3RFMA 4XTLA 4N6HA 2YCZA 3VGAA 3PWHA 1FBKA 5DYSA 4EJ4A 1TN5A 4L35A 4GYCA 4XT1A 1KG9A 1S8JA 5A44A 4FBZA 3UZAA 2PEDA 4GBRA 3HAQA 2VT4A 3C9MA 3VW7A 4J4QA 3NY9A 4BEYA 3HAPA 3REYA 3OE6A 3S3BB 1PXRA 2NTWA 5G2CA 1O0AA 3KJ6A 1F50A 4MQTA 3ZPQA 1F88A 3UTXA 4IB4A 4L6RA 2L6XA 5B35A 5G28A 3HASA 3OE8A 2R4SA 1R84A 1QKPA 4QIDA 1EHKB 4IARA 1M0LA 5G36A 4BV0A 5G53A 2EI4A 4K5YA 5H2IA 2Z55A 4DAJA 1JV6A 3NS0A 4X32A 5G2DA 1TN0A 2WJKA 5G2AA 1JV7A 4EA3A 5G54A 2Y04A 3QBLA 5F8UA 2QPDB 3AYNA 1VJMA 4DJHA 5H2HA 3QAPA 2F93A 4AMIA 1Q5IA 1Q5JA 5AHZA 5AHYA 1S54A 3NSBA 1S52A 1JGJA 2I35A
chains in the Genus database with same CATH superfamily
4FAAB 5EN0A 1F4ZA 3X3CA 2I21A 4MQSA 5H2MA 1AP9A 2RH1A 4WW3A 4GP8B 3T45A 3QBKA 3PDSA 5BR2A 3DQBA 1S8LA 4Y9HA 3UTYA 3UG9A 4EIYA 5KKHA 1UCQA 1S51A 3ABWA 4G71B 3PBLA 4A4MA 3C9LA 1C8SA 1KGBA 1PY6A 3AYMA 4GPOA 5B6YA 2LNLA 4IAQA 5AZDA 3QJRB 2KSAA 5DHGA 2JAGA 2YDOA 4UHRA 3EH3B 2J4YA 1X0SA 4XT3A 1XIOA 3EH4B 2YCXA 5A45A 4HWLA 4N4YB 4G72B 4BUOA 2KSBA 3HARA 4MD1A 3UTWA 3VI0A 2YDVA 1BRDA 4HYJA 3PXOA 4GRVA 3AM6A 5B6WA 5H2JA 1LN6A 2ZZLA 1MGYA 1DZEA 3QJUB 4QI1A 3OE0A 4LDEA 1GZMA 5B6ZA 2BRDA 1IW6A 2HPYA 4MD2A 5B34A 5ITCA 3X3BA 1IW9A 4GP4B 1XMEB 4BEZA 3QDCA 4G7QB 4G7SB 3ODUA 5ETZA 4MBSA 5J7AA 3P0GA 2Y00A 3MBVA 3EMLA 1QKOA 3S8FB 3QJQB 4X1HA 2KS9A 3UTVA 3CAPA 4WAVA 1CWQA 3QAKA 5H2OA 4QRYA 2G87A 1GU8A 3EH5B 1QM8A 2AT9A 3V2YA 2WJLA 1IXFA 5JJNA 3ZEVA 1HZXA 2KSYA 4FA7B 3HANA 3V2WA 4PXKA 1X0I1 5B0WA 1M0MA 3UONA 5H2LA 1BRRA 5B6VA 2YCYA 3VHZA 5LWEA 5TGZA 4KLYA 3VG9A 2M3GA 1GUEA 1BRXA 4KNFA 2I20A 2I1XA 1VGOA 3QJTB 5H2NA 4PXFA 1H2SA 3VVKA 4LDLA 3QBGA 5JJEA 3DDLA 1XJIA 5BR5A 2Y01A 1PXSA 5C1MA 2YCWA 4JR8A 3S8GB 1U19A 3UZCA 3NY8A 1QHJA 2Y02A 3WQJA 3HAOA 3RZEA 1H68A 1C8RA 3OE9A 5B6XA 1C3WA 1JFPA 1X0K1 4G70B 1L0MA 5AX1A 4N4WA 3ZPRA 5DHHA 5H2PA 2F95A 4NC3A 4X31A 3CODA 3NYAA 4JQ6A 3BVDB 4FPDA 3QBIA 2Z73A 1UAZA 4LDOA 4OV0A 2QPEB 5JJJA 1P8IA 4GP5B 4DKLA 4XXJA 2Y03A 4TL3A 3QJVB 2NTUA 4AMJA 1BM1A 1P8UA 5AWZA 3S3DB 1E0PA 5FJGA 1KG8A 2ZFEA 4XTNA 3QJSB 3OAXA 4JKVA 3S3CB 5ITEA 4BVNA 2ZIYA 1L9HA 1M0KA 2JAFA 2X72A 1KMEA 3PQRA 4XTOA 1S53A 5AX0A 5A8EA 5H2KA 4G7RB 3D4SA 2R4RA 1AT9A 3SN6R 3A7KA 5B2NA 1E12A 1R2NA 3COCA 4BWBA 4HYXA 4UG2A 1FBBA 1P8HA 3RFMA 4XTLA 4N6HA 2YCZA 3VGAA 3PWHA 1FBKA 5DYSA 4EJ4A 1TN5A 4L35A 4GYCA 4XT1A 1KG9A 4DS7E 1S8JA 5A44A 4FBZA 3UZAA 2PEDA 4GBRA 3HAQA 2VT4A 3C9MA 3VW7A 4J4QA 3NY9A 4BEYA 3HAPA 3REYA 3OE6A 3S3BB 1PXRA 2NTWA 5G2CA 1O0AA 3KJ6A 1F50A 4MQTA 3ZPQA 1F88A 3UTXA 4IB4A 4L6RA 2L6XA 5B35A 5G28A 3HASA 3OE8A 2R4SA 1R84A 1QKPA 4QIDA 1EHKB 4IARA 1M0LA 5G36A 4BV0A 5G53A 2EI4A 4K5YA 5H2IA 2Z55A 4DAJA 1JV6A 3NS0A 4X32A 5G2DA 1TN0A 2WJKA 5G2AA 1JV7A 4EA3A 5G54A 2Y04A 3QBLA 5F8UA 2QPDB 3AYNA 1VJMA 4DJHA 5H2HA 3QAPA 2F93A 4AMIA 1Q5IA 1Q5JA 5AHZA 5AHYA 1S54A 3NSBA 1S52A 1JGJA 2I35A
chains in the Genus database with same CATH topology
4FAAB 5EN0A 1F4ZA 3X3CA 2I21A 4MQSA 5H2MA 1AP9A 2RH1A 4WW3A 4GP8B 3T45A 3QBKA 3PDSA 5BR2A 3DQBA 1S8LA 4Y9HA 3UTYA 3UG9A 4EIYA 5KKHA 1UCQA 1S51A 3ABWA 4G71B 3PBLA 4A4MA 3C9LA 1C8SA 1KGBA 1PY6A 3AYMA 4GPOA 5B6YA 2LNLA 4IAQA 5AZDA 3QJRB 2KSAA 5DHGA 2JAGA 2YDOA 4UHRA 3EH3B 2J4YA 1X0SA 4XT3A 1XIOA 3EH4B 2YCXA 5A45A 4HWLA 4N4YB 4G72B 4BUOA 2KSBA 3HARA 4MD1A 3UTWA 3VI0A 2YDVA 1BRDA 4HYJA 3PXOA 4GRVA 3AM6A 5B6WA 5H2JA 1LN6A 2ZZLA 1MGYA 1DZEA 3QJUB 4QI1A 3OE0A 4LDEA 1GZMA 5B6ZA 2BRDA 1IW6A 2HPYA 4MD2A 5B34A 5ITCA 3X3BA 1IW9A 4GP4B 1XMEB 4BEZA 3QDCA 4G7QB 4G7SB 3ODUA 5ETZA 4MBSA 5J7AA 3P0GA 2Y00A 3MBVA 3EMLA 1QKOA 3S8FB 3QJQB 4X1HA 2KS9A 3UTVA 3CAPA 4WAVA 1CWQA 3QAKA 5H2OA 4QRYA 2G87A 1GU8A 3EH5B 1QM8A 2AT9A 3V2YA 2WJLA 1IXFA 5JJNA 3ZEVA 1HZXA 2KSYA 4FA7B 3HANA 3V2WA 4PXKA 1X0I1 5B0WA 1M0MA 3UONA 5H2LA 1BRRA 5B6VA 2YCYA 3VHZA 5LWEA 5TGZA 4KLYA 3VG9A 2M3GA 1GUEA 1BRXA 4KNFA 2I20A 2I1XA 1VGOA 3QJTB 5H2NA 4PXFA 1H2SA 3VVKA 4LDLA 3QBGA 5JJEA 3DDLA 1XJIA 5BR5A 2Y01A 1PXSA 5C1MA 2YCWA 4JR8A 3S8GB 1U19A 3UZCA 3NY8A 1QHJA 2Y02A 3WQJA 3HAOA 3RZEA 1H68A 1C8RA 3OE9A 5B6XA 1C3WA 1JFPA 1X0K1 4G70B 1L0MA 5AX1A 4N4WA 3ZPRA 5DHHA 5H2PA 2F95A 4NC3A 4X31A 3CODA 3NYAA 4JQ6A 3BVDB 4FPDA 3QBIA 2Z73A 1UAZA 4LDOA 4OV0A 2QPEB 5JJJA 1P8IA 4GP5B 4DKLA 4XXJA 2Y03A 4TL3A 3QJVB 2NTUA 4AMJA 1BM1A 1P8UA 5AWZA 3S3DB 1E0PA 5FJGA 1KG8A 2ZFEA 4XTNA 3QJSB 3OAXA 4JKVA 3S3CB 5ITEA 4BVNA 2ZIYA 1L9HA 1M0KA 2JAFA 2X72A 1KMEA 3PQRA 4XTOA 1S53A 5AX0A 5A8EA 5H2KA 4G7RB 3D4SA 2R4RA 1AT9A 3SN6R 3A7KA 5B2NA 1E12A 1R2NA 3COCA 4BWBA 4HYXA 4UG2A 1FBBA 1P8HA 3RFMA 4XTLA 4N6HA 2YCZA 3VGAA 3PWHA 1FBKA 5DYSA 4EJ4A 1TN5A 4L35A 4GYCA 4XT1A 1KG9A 4DS7E 1S8JA 5A44A 4FBZA 3UZAA 2PEDA 4GBRA 3HAQA 2VT4A 3C9MA 3VW7A 4J4QA 3NY9A 4BEYA 3HAPA 3REYA 3OE6A 3S3BB 1PXRA 2NTWA 5G2CA 1O0AA 3KJ6A 1F50A 4MQTA 3ZPQA 1F88A 3UTXA 4IB4A 4L6RA 2L6XA 5B35A 5G28A 3HASA 3OE8A 2R4SA 1R84A 1QKPA 4QIDA 1EHKB 4IARA 1M0LA 5G36A 4BV0A 5G53A 2EI4A 4K5YA 5H2IA 2Z55A 4DAJA 1JV6A 3NS0A 4X32A 5G2DA 1TN0A 2WJKA 5G2AA 1JV7A 4EA3A 5G54A 2Y04A 3QBLA 5F8UA 2QPDB 3AYNA 1VJMA 4DJHA 5H2HA 3QAPA 2F93A 4AMIA 1Q5IA 1Q5JA 5AHZA 5AHYA 1S54A 3NSBA 1S52A 1JGJA 2I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAA B;  5EN0 A;  1F4Z A;  3X3C A;  2I21 A;  4MQS A;  5H2M A;  1AP9 A;  2RH1 A;  4WW3 A;  4GP8 B;  3T45 A;  3QBK A;  3PDS A;  5BR2 A;  3DQB A;  1S8L A;  4Y9H A;  3UTY A;  3UG9 A;  4EIY A;  5KKH A;  1UCQ A;  1S51 A;  3ABW A;  4G71 B;  3PBL A;  4A4M A;  3C9L A;  1C8S A;  1KGB A;  1PY6 A;  3AYM A;  4GPO A;  5B6Y A;  2LNL A;  4IAQ A;  5AZD A;  3QJR B;  2KSA A;  5DHG A;  2JAG A;  2YDO A;  4UHR A;  3EH3 B;  2J4Y A;  1X0S A;  4XT3 A;  1XIO A;  3EH4 B;  2YCX A;  5A45 A;  4HWL A;  4N4Y B;  4G72 B;  4BUO A;  2KSB A;  3HAR A;  4MD1 A;  3UTW A;  3VI0 A;  2YDV A;  1BRD A;  4HYJ A;  3PXO A;  4GRV A;  3AM6 A;  5B6W A;  5H2J A;  1LN6 A;  2ZZL A;  1MGY A;  1DZE A;  3QJU B;  4QI1 A;  3OE0 A;  4LDE A;  1GZM A;  5B6Z A;  2BRD A;  1IW6 A;  2HPY A;  4MD2 A;  5B34 A;  5ITC A;  3X3B A;  1IW9 A;  4GP4 B;  1XME B;  4BEZ A;  3QDC A;  4G7Q B;  4G7S B;  3ODU A;  5ETZ A;  4MBS A;  5J7A A;  3P0G A;  2Y00 A;  3MBV A;  3EML A;  1QKO A;  3S8F B;  3QJQ B;  4X1H A;  2KS9 A;  3UTV A;  3CAP A;  4WAV A;  1CWQ A;  3QAK A;  5H2O A;  4QRY A;  2G87 A;  1GU8 A;  3EH5 B;  1QM8 A;  2AT9 A;  3V2Y A;  2WJL A;  1IXF A;  5JJN A;  3ZEV A;  1HZX A;  2KSY A;  4FA7 B;  3HAN A;  3V2W A;  4PXK A;  1X0I 1;  5B0W A;  1M0M A;  3UON A;  5H2L A;  1BRR A;  5B6V A;  2YCY A;  3VHZ A;  5LWE A;  5TGZ A;  4KLY A;  3VG9 A;  2M3G A;  1GUE A;  1BRX A;  4KNF A;  2I20 A;  2I1X A;  1VGO A;  3QJT B;  5H2N A;  4PXF A;  1H2S A;  3VVK A;  4LDL A;  3QBG A;  5JJE A;  3DDL A;  1XJI A;  5BR5 A;  2Y01 A;  1PXS A;  5C1M A;  2YCW A;  4JR8 A;  3S8G B;  1U19 A;  3UZC A;  3NY8 A;  1QHJ A;  2Y02 A;  3WQJ A;  3HAO A;  3RZE A;  1H68 A;  1C8R A;  3OE9 A;  5B6X A;  1C3W A;  1JFP A;  1X0K 1;  4G70 B;  1L0M A;  5AX1 A;  4N4W A;  3ZPR A;  5DHH A;  5H2P A;  2F95 A;  4NC3 A;  4X31 A;  3COD A;  3NYA A;  4JQ6 A;  3BVD B;  4FPD A;  3QBI A;  2Z73 A;  1UAZ A;  4LDO A;  4OV0 A;  2QPE B;  5JJJ A;  1P8I A;  4GP5 B;  4DKL A;  4XXJ A;  2Y03 A;  4TL3 A;  3QJV B;  2NTU A;  4AMJ A;  1BM1 A;  1P8U A;  5AWZ A;  3S3D B;  1E0P A;  5FJG A;  1KG8 A;  2ZFE A;  4XTN A;  3QJS B;  3OAX A;  4JKV A;  3S3C B;  5ITE A;  4BVN A;  2ZIY A;  1L9H A;  1M0K A;  2JAF A;  2X72 A;  1KME A;  3PQR A;  4XTO A;  1S53 A;  5AX0 A;  5A8E A;  5H2K A;  4G7R B;  3D4S A;  2R4R A;  1AT9 A;  3SN6 R;  3A7K A;  5B2N A;  1E12 A;  1R2N A;  3COC A;  4BWB A;  4HYX A;  4UG2 A;  1FBB A;  1P8H A;  3RFM A;  4XTL A;  4N6H A;  2YCZ A;  3VGA A;  3PWH A;  1FBK A;  5DYS A;  4EJ4 A;  1TN5 A;  4L35 A;  4GYC A;  4XT1 A;  1KG9 A;  1S8J A;  5A44 A;  4FBZ A;  3UZA A;  2PED A;  4GBR A;  3HAQ A;  2VT4 A;  3C9M A;  3VW7 A;  4J4Q A;  3NY9 A;  4BEY A;  3HAP A;  3REY A;  3OE6 A;  3S3B B;  1PXR A;  2NTW A;  5G2C A;  1O0A A;  3KJ6 A;  1F50 A;  4MQT A;  3ZPQ A;  1F88 A;  3UTX A;  4IB4 A;  4L6R A;  2L6X A;  5B35 A;  5G28 A;  3HAS A;  3OE8 A;  2R4S A;  1R84 A;  1QKP A;  4QID A;  1EHK B;  4IAR A;  1M0L A;  5G36 A;  4BV0 A;  5G53 A;  2EI4 A;  4K5Y A;  5H2I A;  2Z55 A;  4DAJ A;  1JV6 A;  3NS0 A;  4X32 A;  5G2D A;  1TN0 A;  2WJK A;  5G2A A;  1JV7 A;  4EA3 A;  5G54 A;  2Y04 A;  3QBL A;  5F8U A;  2QPD B;  3AYN A;  1VJM A;  4DJH A;  5H2H A;  3QAP A;  2F93 A;  4AMI A;  1Q5I A;  1Q5J A;  5AHZ A;  5AHY A;  1S54 A;  3NSB A;  1S52 A;  1JGJ A;  2I35 A; 
#chains in the Genus database with same CATH topology
 4FAA B;  5EN0 A;  1F4Z A;  3X3C A;  2I21 A;  4MQS A;  5H2M A;  1AP9 A;  2RH1 A;  4WW3 A;  4GP8 B;  3T45 A;  3QBK A;  3PDS A;  5BR2 A;  3DQB A;  1S8L A;  4Y9H A;  3UTY A;  3UG9 A;  4EIY A;  5KKH A;  1UCQ A;  1S51 A;  3ABW A;  4G71 B;  3PBL A;  4A4M A;  3C9L A;  1C8S A;  1KGB A;  1PY6 A;  3AYM A;  4GPO A;  5B6Y A;  2LNL A;  4IAQ A;  5AZD A;  3QJR B;  2KSA A;  5DHG A;  2JAG A;  2YDO A;  4UHR A;  3EH3 B;  2J4Y A;  1X0S A;  4XT3 A;  1XIO A;  3EH4 B;  2YCX A;  5A45 A;  4HWL A;  4N4Y B;  4G72 B;  4BUO A;  2KSB A;  3HAR A;  4MD1 A;  3UTW A;  3VI0 A;  2YDV A;  1BRD A;  4HYJ A;  3PXO A;  4GRV A;  3AM6 A;  5B6W A;  5H2J A;  1LN6 A;  2ZZL A;  1MGY A;  1DZE A;  3QJU B;  4QI1 A;  3OE0 A;  4LDE A;  1GZM A;  5B6Z A;  2BRD A;  1IW6 A;  2HPY A;  4MD2 A;  5B34 A;  5ITC A;  3X3B A;  1IW9 A;  4GP4 B;  1XME B;  4BEZ A;  3QDC A;  4G7Q B;  4G7S B;  3ODU A;  5ETZ A;  4MBS A;  5J7A A;  3P0G A;  2Y00 A;  3MBV A;  3EML A;  1QKO A;  3S8F B;  3QJQ B;  4X1H A;  2KS9 A;  3UTV A;  3CAP A;  4WAV A;  1CWQ A;  3QAK A;  5H2O A;  4QRY A;  2G87 A;  1GU8 A;  3EH5 B;  1QM8 A;  2AT9 A;  3V2Y A;  2WJL A;  1IXF A;  5JJN A;  3ZEV A;  1HZX A;  2KSY A;  4FA7 B;  3HAN A;  3V2W A;  4PXK A;  1X0I 1;  5B0W A;  1M0M A;  3UON A;  5H2L A;  1BRR A;  5B6V A;  2YCY A;  3VHZ A;  5LWE A;  5TGZ A;  4KLY A;  3VG9 A;  2M3G A;  1GUE A;  1BRX A;  4KNF A;  2I20 A;  2I1X A;  1VGO A;  3QJT B;  5H2N A;  4PXF A;  1H2S A;  3VVK A;  4LDL A;  3QBG A;  5JJE A;  3DDL A;  1XJI A;  5BR5 A;  2Y01 A;  1PXS A;  5C1M A;  2YCW A;  4JR8 A;  3S8G B;  1U19 A;  3UZC A;  3NY8 A;  1QHJ A;  2Y02 A;  3WQJ A;  3HAO A;  3RZE A;  1H68 A;  1C8R A;  3OE9 A;  5B6X A;  1C3W A;  1JFP A;  1X0K 1;  4G70 B;  1L0M A;  5AX1 A;  4N4W A;  3ZPR A;  5DHH A;  5H2P A;  2F95 A;  4NC3 A;  4X31 A;  3COD A;  3NYA A;  4JQ6 A;  3BVD B;  4FPD A;  3QBI A;  2Z73 A;  1UAZ A;  4LDO A;  4OV0 A;  2QPE B;  5JJJ A;  1P8I A;  4GP5 B;  4DKL A;  4XXJ A;  2Y03 A;  4TL3 A;  3QJV B;  2NTU A;  4AMJ A;  1BM1 A;  1P8U A;  5AWZ A;  3S3D B;  1E0P A;  5FJG A;  1KG8 A;  2ZFE A;  4XTN A;  3QJS B;  3OAX A;  4JKV A;  3S3C B;  5ITE A;  4BVN A;  2ZIY A;  1L9H A;  1M0K A;  2JAF A;  2X72 A;  1KME A;  3PQR A;  4XTO A;  1S53 A;  5AX0 A;  5A8E A;  5H2K A;  4G7R B;  3D4S A;  2R4R A;  1AT9 A;  3SN6 R;  3A7K A;  5B2N A;  1E12 A;  1R2N A;  3COC A;  4BWB A;  4HYX A;  4UG2 A;  1FBB A;  1P8H A;  3RFM A;  4XTL A;  4N6H A;  2YCZ A;  3VGA A;  3PWH A;  1FBK A;  5DYS A;  4EJ4 A;  1TN5 A;  4L35 A;  4GYC A;  4XT1 A;  1KG9 A;  4DS7 E;  1S8J A;  5A44 A;  4FBZ A;  3UZA A;  2PED A;  4GBR A;  3HAQ A;  2VT4 A;  3C9M A;  3VW7 A;  4J4Q A;  3NY9 A;  4BEY A;  3HAP A;  3REY A;  3OE6 A;  3S3B B;  1PXR A;  2NTW A;  5G2C A;  1O0A A;  3KJ6 A;  1F50 A;  4MQT A;  3ZPQ A;  1F88 A;  3UTX A;  4IB4 A;  4L6R A;  2L6X A;  5B35 A;  5G28 A;  3HAS A;  3OE8 A;  2R4S A;  1R84 A;  1QKP A;  4QID A;  1EHK B;  4IAR A;  1M0L A;  5G36 A;  4BV0 A;  5G53 A;  2EI4 A;  4K5Y A;  5H2I A;  2Z55 A;  4DAJ A;  1JV6 A;  3NS0 A;  4X32 A;  5G2D A;  1TN0 A;  2WJK A;  5G2A A;  1JV7 A;  4EA3 A;  5G54 A;  2Y04 A;  3QBL A;  5F8U A;  2QPD B;  3AYN A;  1VJM A;  4DJH A;  5H2H A;  3QAP A;  2F93 A;  4AMI A;  1Q5I A;  1Q5J A;  5AHZ A;  5AHY A;  1S54 A;  3NSB A;  1S52 A;  1JGJ A;  2I35 A; 
#chains in the Genus database with same CATH homology
 4FAA B;  5EN0 A;  1F4Z A;  3X3C A;  2I21 A;  4MQS A;  5H2M A;  1AP9 A;  2RH1 A;  4WW3 A;  4GP8 B;  3T45 A;  3QBK A;  3PDS A;  5BR2 A;  3DQB A;  1S8L A;  4Y9H A;  3UTY A;  3UG9 A;  4EIY A;  5KKH A;  1UCQ A;  1S51 A;  3ABW A;  4G71 B;  3PBL A;  4A4M A;  3C9L A;  1C8S A;  1KGB A;  1PY6 A;  3AYM A;  4GPO A;  5B6Y A;  2LNL A;  4IAQ A;  5AZD A;  3QJR B;  2KSA A;  5DHG A;  2JAG A;  2YDO A;  4UHR A;  3EH3 B;  2J4Y A;  1X0S A;  4XT3 A;  1XIO A;  3EH4 B;  2YCX A;  5A45 A;  4HWL A;  4N4Y B;  4G72 B;  4BUO A;  2KSB A;  3HAR A;  4MD1 A;  3UTW A;  3VI0 A;  2YDV A;  1BRD A;  4HYJ A;  3PXO A;  4GRV A;  3AM6 A;  5B6W A;  5H2J A;  1LN6 A;  2ZZL A;  1MGY A;  1DZE A;  3QJU B;  4QI1 A;  3OE0 A;  4LDE A;  1GZM A;  5B6Z A;  2BRD A;  1IW6 A;  2HPY A;  4MD2 A;  5B34 A;  5ITC A;  3X3B A;  1IW9 A;  4GP4 B;  1XME B;  4BEZ A;  3QDC A;  4G7Q B;  4G7S B;  3ODU A;  5ETZ A;  4MBS A;  5J7A A;  3P0G A;  2Y00 A;  3MBV A;  3EML A;  1QKO A;  3S8F B;  3QJQ B;  4X1H A;  2KS9 A;  3UTV A;  3CAP A;  4WAV A;  1CWQ A;  3QAK A;  5H2O A;  4QRY A;  2G87 A;  1GU8 A;  3EH5 B;  1QM8 A;  2AT9 A;  3V2Y A;  2WJL A;  1IXF A;  5JJN A;  3ZEV A;  1HZX A;  2KSY A;  4FA7 B;  3HAN A;  3V2W A;  4PXK A;  1X0I 1;  5B0W A;  1M0M A;  3UON A;  5H2L A;  1BRR A;  5B6V A;  2YCY A;  3VHZ A;  5LWE A;  5TGZ A;  4KLY A;  3VG9 A;  2M3G A;  1GUE A;  1BRX A;  4KNF A;  2I20 A;  2I1X A;  1VGO A;  3QJT B;  5H2N A;  4PXF A;  1H2S A;  3VVK A;  4LDL A;  3QBG A;  5JJE A;  3DDL A;  1XJI A;  5BR5 A;  2Y01 A;  1PXS A;  5C1M A;  2YCW A;  4JR8 A;  3S8G B;  1U19 A;  3UZC A;  3NY8 A;  1QHJ A;  2Y02 A;  3WQJ A;  3HAO A;  3RZE A;  1H68 A;  1C8R A;  3OE9 A;  5B6X A;  1C3W A;  1JFP A;  1X0K 1;  4G70 B;  1L0M A;  5AX1 A;  4N4W A;  3ZPR A;  5DHH A;  5H2P A;  2F95 A;  4NC3 A;  4X31 A;  3COD A;  3NYA A;  4JQ6 A;  3BVD B;  4FPD A;  3QBI A;  2Z73 A;  1UAZ A;  4LDO A;  4OV0 A;  2QPE B;  5JJJ A;  1P8I A;  4GP5 B;  4DKL A;  4XXJ A;  2Y03 A;  4TL3 A;  3QJV B;  2NTU A;  4AMJ A;  1BM1 A;  1P8U A;  5AWZ A;  3S3D B;  1E0P A;  5FJG A;  1KG8 A;  2ZFE A;  4XTN A;  3QJS B;  3OAX A;  4JKV A;  3S3C B;  5ITE A;  4BVN A;  2ZIY A;  1L9H A;  1M0K A;  2JAF A;  2X72 A;  1KME A;  3PQR A;  4XTO A;  1S53 A;  5AX0 A;  5A8E A;  5H2K A;  4G7R B;  3D4S A;  2R4R A;  1AT9 A;  3SN6 R;  3A7K A;  5B2N A;  1E12 A;  1R2N A;  3COC A;  4BWB A;  4HYX A;  4UG2 A;  1FBB A;  1P8H A;  3RFM A;  4XTL A;  4N6H A;  2YCZ A;  3VGA A;  3PWH A;  1FBK A;  5DYS A;  4EJ4 A;  1TN5 A;  4L35 A;  4GYC A;  4XT1 A;  1KG9 A;  4DS7 E;  1S8J A;  5A44 A;  4FBZ A;  3UZA A;  2PED A;  4GBR A;  3HAQ A;  2VT4 A;  3C9M A;  3VW7 A;  4J4Q A;  3NY9 A;  4BEY A;  3HAP A;  3REY A;  3OE6 A;  3S3B B;  1PXR A;  2NTW A;  5G2C A;  1O0A A;  3KJ6 A;  1F50 A;  4MQT A;  3ZPQ A;  1F88 A;  3UTX A;  4IB4 A;  4L6R A;  2L6X A;  5B35 A;  5G28 A;  3HAS A;  3OE8 A;  2R4S A;  1R84 A;  1QKP A;  4QID A;  1EHK B;  4IAR A;  1M0L A;  5G36 A;  4BV0 A;  5G53 A;  2EI4 A;  4K5Y A;  5H2I A;  2Z55 A;  4DAJ A;  1JV6 A;  3NS0 A;  4X32 A;  5G2D A;  1TN0 A;  2WJK A;  5G2A A;  1JV7 A;  4EA3 A;  5G54 A;  2Y04 A;  3QBL A;  5F8U A;  2QPD B;  3AYN A;  1VJM A;  4DJH A;  5H2H A;  3QAP A;  2F93 A;  4AMI A;  1Q5I A;  1Q5J A;  5AHZ A;  5AHY A;  1S54 A;  3NSB A;  1S52 A;  1JGJ A;  2I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...