4DS7E

Crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
46
Chain Sequence
ERRLSFKTVALLVLACVRMKRIAFYRRSDDNRLRILRDRISGRISW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Calmodulin
publication title The molecular architecture of the yeast spindle pole body core determined by Bayesian integrative modeling.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 15
structure length 46
sequence length 49
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF18520 Spc110_C Spindle pole body component 110 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.20 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4ds7E00
4DS7E
chains in the Genus database with same CATH superfamily
2KSYA 1QKOA 4Y9HA 5J7AA 5JJEA 4G7SB 3X3BA 3PBLA 2F93A 3UTXA 5JJNA 5DYSA 5H2PA 5G28A 1BRDA 3NY9A 3VG9A 1M0MA 5B35A 5KKHA 2KS9A 5ITEA 4IB4A 5DHHA 3ZEVA 4BUOA 5AX1A 3RFMA 4WW3A 5H2NA 2Y02A 3BVDB 4PXKA 3VHZA 3S3CB 3T45A 1S8LA 1IXFA 3AM6A 3OE8A 4BWBA 4LDEA 1X0I1 2YCXA 4X31A 5ITCA 5G2CA 3OE0A 1P8UA 1S52A 5AHZA 4DAJA 2I20A 4X1HA 1GZMA 2VT4A 1LN6A 4IAQA 2Z55A 1R2NA 1PXRA 4GRVA 2RH1A 1S54A 1EHKB 1KG8A 1S51A 3PWHA 4XXJA 4KLYA 4QI1A 2JAGA 4G72B 1S53A 4GP8B 3CODA 3EH5B 3S8GB 2R4SA 2X72A 1PY6A 3HANA 5FJGA 5H2LA 4IARA 5A8EA 1PXSA 2F95A 2I35A 3AYMA 3QJUB 4XT1A 3A7KA 1E12A 3C9LA 4JR8A 2JAFA 5C1MA 2WJLA 5H2MA 4BVNA 1H68A 4LDOA 5DHGA 5H2JA 4XTLA 3ZPQA 3NSBA 5G53A 4G70B 2NTUA 5AWZA 3EH4B 3NS0A 1KMEA 4MQSA 3OAXA 3NYAA 5B6WA 1DZEA 3NY8A 4L35A 5F8UA 2Y00A 3PQRA 5B6XA 1AT9A 3QAKA 1BM1A 5B6ZA 3QAPA 1GU8A 4A4MA 1L9HA 3V2YA 2KSBA 3MBVA 5H2HA 1R84A 3QDCA 2PEDA 4J4QA 3X3CA 3DQBA 4MD2A 4FAAB 2R4RA 5H2OA 4HYJA 4N4YB 5A45A 4G71B 4XT3A 4DJHA 1F4ZA 4MQTA 1CWQA 5G2AA 5G54A 4BEYA 1GUEA 3PDSA 5ETZA 3EMLA 4DKLA 2HPYA 3ODUA 3D4SA 3UTWA 5B34A 3HAOA 1JV6A 4N4WA 2LNLA 1XJIA 2ZFEA 3KJ6A 4UG2A 4BV0A 4GP4B 3AYNA 2QPEB 5BR2A 4GP5B 5B6VA 3OE6A 3QJQB 4GBRA 3RZEA 3HASA 3UZAA 1FBBA 5LWEA 4MD1A 1VGOA 1Q5JA 3QJTB 3ABWA 3COCA 4FPDA 2G87A 4GYCA 5AHYA 4EJ4A 5BR5A 2Z73A 4XTOA 3VW7A 1KGBA 4DS7E 3UG9A 3QBIA 1L0MA 2WJKA 1JFPA 2I21A 4HYXA 1F88A 1C8SA 2YCZA 3VI0A 4N6HA 1BRXA 1AP9A 2YDOA 4K5YA 4OV0A 4AMJA 4AMIA 1Q5IA 4UHRA 1VJMA 1F50A 1JGJA 5B0WA 1C3WA 3OE9A 3ZPRA 1UAZA 1UCQA 4NC3A 3HARA 2NTWA 3QJSB 3QJRB 4JQ6A 3UTYA 1XMEB 3S3BB 3UONA 4FA7B 1S8JA 4X32A 1C8RA 1XIOA 1M0LA 2M3GA 5B2NA 3QJVB 4L6RA 3HAQA 4MBSA 3QBKA 2L6XA 3CAPA 1FBKA 4EIYA 4XTNA 1M0KA 4EA3A 4LDLA 3PXOA 3EH3B 2AT9A 5G36A 1TN0A 4QIDA 2KSAA 1H2SA 1BRRA 2I1XA 1JV7A 4WAVA 2EI4A 4G7RB 5AX0A 5A44A 3QBLA 3QBGA 3VGAA 4HWLA 3S3DB 2Y04A 2J4YA 2YDVA 4G7QB 5H2KA 3V2WA 2Y01A 2YCYA 4FBZA 1IW6A 3UZCA 1X0SA 5H2IA 4GPOA 3REYA 2Y03A 4TL3A 2ZIYA 1TN5A 2YCWA 5AZDA 1U19A 3VVKA 2BRDA 5JJJA 1HZXA 2ZZLA 1O0AA 3SN6R 5G2DA 3UTVA 1E0PA 5TGZA 1QKPA 3S8FB 1QM8A 1KG9A 5EN0A 1X0K1 4BEZA 1MGYA 3DDLA 1P8HA 4KNFA 3C9MA 3HAPA 5B6YA 4QRYA 4PXFA 3WQJA 3P0GA 1QHJA 2QPDB 4JKVA 1P8IA 1IW9A
chains in the Genus database with same CATH topology
2KSYA 1QKOA 4Y9HA 5J7AA 5JJEA 4G7SB 3X3BA 3PBLA 2F93A 3UTXA 5JJNA 5DYSA 5H2PA 5G28A 1BRDA 3NY9A 3VG9A 1M0MA 5B35A 5KKHA 2KS9A 5ITEA 4IB4A 5DHHA 3ZEVA 4BUOA 5AX1A 3RFMA 4WW3A 5H2NA 2Y02A 3BVDB 4PXKA 3VHZA 3S3CB 3T45A 1S8LA 1IXFA 3AM6A 3OE8A 4BWBA 4LDEA 1X0I1 2YCXA 4X31A 5ITCA 5G2CA 3OE0A 1P8UA 1S52A 5AHZA 4DAJA 2I20A 4X1HA 1GZMA 2VT4A 1LN6A 4IAQA 2Z55A 1R2NA 1PXRA 4GRVA 2RH1A 1S54A 1EHKB 1KG8A 1S51A 3PWHA 4XXJA 4KLYA 4QI1A 2JAGA 4G72B 1S53A 4GP8B 3CODA 3EH5B 3S8GB 2R4SA 2X72A 1PY6A 3HANA 5FJGA 5H2LA 4IARA 5A8EA 1PXSA 2F95A 2I35A 3AYMA 3QJUB 4XT1A 3A7KA 1E12A 3C9LA 4JR8A 2JAFA 5C1MA 2WJLA 5H2MA 4BVNA 1H68A 4LDOA 5DHGA 5H2JA 4XTLA 3ZPQA 3NSBA 5G53A 4G70B 2NTUA 5AWZA 3EH4B 3NS0A 1KMEA 4MQSA 3OAXA 3NYAA 5B6WA 1DZEA 3NY8A 4L35A 5F8UA 2Y00A 3PQRA 5B6XA 1AT9A 3QAKA 1BM1A 5B6ZA 3QAPA 1GU8A 4A4MA 1L9HA 3V2YA 2KSBA 3MBVA 5H2HA 1R84A 3QDCA 2PEDA 4J4QA 3X3CA 3DQBA 4MD2A 4FAAB 2R4RA 5H2OA 4HYJA 4N4YB 5A45A 4G71B 4XT3A 4DJHA 1F4ZA 4MQTA 1CWQA 5G2AA 5G54A 4BEYA 1GUEA 3PDSA 5ETZA 3EMLA 4DKLA 2HPYA 3ODUA 3D4SA 3UTWA 5B34A 3HAOA 1JV6A 4N4WA 2LNLA 1XJIA 2ZFEA 3KJ6A 4UG2A 4BV0A 4GP4B 3AYNA 2QPEB 5BR2A 4GP5B 5B6VA 3OE6A 3QJQB 4GBRA 3RZEA 3HASA 3UZAA 1FBBA 5LWEA 4MD1A 1VGOA 1Q5JA 3QJTB 3ABWA 3COCA 4FPDA 2G87A 4GYCA 5AHYA 4EJ4A 5BR5A 2Z73A 4XTOA 3VW7A 1KGBA 4DS7E 3UG9A 3QBIA 1L0MA 2WJKA 1JFPA 2I21A 4HYXA 1F88A 1C8SA 2YCZA 3VI0A 4N6HA 1BRXA 1AP9A 2YDOA 4K5YA 4OV0A 4AMJA 4AMIA 1Q5IA 4UHRA 1VJMA 1F50A 1JGJA 5B0WA 1C3WA 3OE9A 3ZPRA 1UAZA 1UCQA 4NC3A 3HARA 2NTWA 3QJSB 3QJRB 4JQ6A 3UTYA 1XMEB 3S3BB 3UONA 4FA7B 1S8JA 4X32A 1C8RA 1XIOA 1M0LA 2M3GA 5B2NA 3QJVB 4L6RA 3HAQA 4MBSA 3QBKA 2L6XA 3CAPA 1FBKA 4EIYA 4XTNA 1M0KA 4EA3A 4LDLA 3PXOA 3EH3B 2AT9A 5G36A 1TN0A 4QIDA 2KSAA 1H2SA 1BRRA 2I1XA 1JV7A 4WAVA 2EI4A 4G7RB 5AX0A 5A44A 3QBLA 3QBGA 3VGAA 4HWLA 3S3DB 2Y04A 2J4YA 2YDVA 4G7QB 5H2KA 3V2WA 2Y01A 2YCYA 4FBZA 1IW6A 3UZCA 1X0SA 5H2IA 4GPOA 3REYA 2Y03A 4TL3A 2ZIYA 1TN5A 2YCWA 5AZDA 1U19A 3VVKA 2BRDA 5JJJA 1HZXA 2ZZLA 1O0AA 3SN6R 5G2DA 3UTVA 1E0PA 5TGZA 1QKPA 3S8FB 1QM8A 1KG9A 5EN0A 1X0K1 4BEZA 1MGYA 3DDLA 1P8HA 4KNFA 3C9MA 3HAPA 5B6YA 4QRYA 4PXFA 3WQJA 3P0GA 1QHJA 2QPDB 4JKVA 1P8IA 1IW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS7 E; 
#chains in the Genus database with same CATH topology
 2KSY A;  1QKO A;  4Y9H A;  5J7A A;  5JJE A;  4G7S B;  3X3B A;  3PBL A;  2F93 A;  3UTX A;  5JJN A;  5DYS A;  5H2P A;  5G28 A;  1BRD A;  3NY9 A;  3VG9 A;  1M0M A;  5B35 A;  5KKH A;  2KS9 A;  5ITE A;  4IB4 A;  5DHH A;  3ZEV A;  4BUO A;  5AX1 A;  3RFM A;  4WW3 A;  5H2N A;  2Y02 A;  3BVD B;  4PXK A;  3VHZ A;  3S3C B;  3T45 A;  1S8L A;  1IXF A;  3AM6 A;  3OE8 A;  4BWB A;  4LDE A;  1X0I 1;  2YCX A;  4X31 A;  5ITC A;  5G2C A;  3OE0 A;  1P8U A;  1S52 A;  5AHZ A;  4DAJ A;  2I20 A;  4X1H A;  1GZM A;  2VT4 A;  1LN6 A;  4IAQ A;  2Z55 A;  1R2N A;  1PXR A;  4GRV A;  2RH1 A;  1S54 A;  1EHK B;  1KG8 A;  1S51 A;  3PWH A;  4XXJ A;  4KLY A;  4QI1 A;  2JAG A;  4G72 B;  1S53 A;  4GP8 B;  3COD A;  3EH5 B;  3S8G B;  2R4S A;  2X72 A;  1PY6 A;  3HAN A;  5FJG A;  5H2L A;  4IAR A;  5A8E A;  1PXS A;  2F95 A;  2I35 A;  3AYM A;  3QJU B;  4XT1 A;  3A7K A;  1E12 A;  3C9L A;  4JR8 A;  2JAF A;  5C1M A;  2WJL A;  5H2M A;  4BVN A;  1H68 A;  4LDO A;  5DHG A;  5H2J A;  4XTL A;  3ZPQ A;  3NSB A;  5G53 A;  4G70 B;  2NTU A;  5AWZ A;  3EH4 B;  3NS0 A;  1KME A;  4MQS A;  3OAX A;  3NYA A;  5B6W A;  1DZE A;  3NY8 A;  4L35 A;  5F8U A;  2Y00 A;  3PQR A;  5B6X A;  1AT9 A;  3QAK A;  1BM1 A;  5B6Z A;  3QAP A;  1GU8 A;  4A4M A;  1L9H A;  3V2Y A;  2KSB A;  3MBV A;  5H2H A;  1R84 A;  3QDC A;  2PED A;  4J4Q A;  3X3C A;  3DQB A;  4MD2 A;  4FAA B;  2R4R A;  5H2O A;  4HYJ A;  4N4Y B;  5A45 A;  4G71 B;  4XT3 A;  4DJH A;  1F4Z A;  4MQT A;  1CWQ A;  5G2A A;  5G54 A;  4BEY A;  1GUE A;  3PDS A;  5ETZ A;  3EML A;  4DKL A;  2HPY A;  3ODU A;  3D4S A;  3UTW A;  5B34 A;  3HAO A;  1JV6 A;  4N4W A;  2LNL A;  1XJI A;  2ZFE A;  3KJ6 A;  4UG2 A;  4BV0 A;  4GP4 B;  3AYN A;  2QPE B;  5BR2 A;  4GP5 B;  5B6V A;  3OE6 A;  3QJQ B;  4GBR A;  3RZE A;  3HAS A;  3UZA A;  1FBB A;  5LWE A;  4MD1 A;  1VGO A;  1Q5J A;  3QJT B;  3ABW A;  3COC A;  4FPD A;  2G87 A;  4GYC A;  5AHY A;  4EJ4 A;  5BR5 A;  2Z73 A;  4XTO A;  3VW7 A;  1KGB A;  4DS7 E;  3UG9 A;  3QBI A;  1L0M A;  2WJK A;  1JFP A;  2I21 A;  4HYX A;  1F88 A;  1C8S A;  2YCZ A;  3VI0 A;  4N6H A;  1BRX A;  1AP9 A;  2YDO A;  4K5Y A;  4OV0 A;  4AMJ A;  4AMI A;  1Q5I A;  4UHR A;  1VJM A;  1F50 A;  1JGJ A;  5B0W A;  1C3W A;  3OE9 A;  3ZPR A;  1UAZ A;  1UCQ A;  4NC3 A;  3HAR A;  2NTW A;  3QJS B;  3QJR B;  4JQ6 A;  3UTY A;  1XME B;  3S3B B;  3UON A;  4FA7 B;  1S8J A;  4X32 A;  1C8R A;  1XIO A;  1M0L A;  2M3G A;  5B2N A;  3QJV B;  4L6R A;  3HAQ A;  4MBS A;  3QBK A;  2L6X A;  3CAP A;  1FBK A;  4EIY A;  4XTN A;  1M0K A;  4EA3 A;  4LDL A;  3PXO A;  3EH3 B;  2AT9 A;  5G36 A;  1TN0 A;  4QID A;  2KSA A;  1H2S A;  1BRR A;  2I1X A;  1JV7 A;  4WAV A;  2EI4 A;  4G7R B;  5AX0 A;  5A44 A;  3QBL A;  3QBG A;  3VGA A;  4HWL A;  3S3D B;  2Y04 A;  2J4Y A;  2YDV A;  4G7Q B;  5H2K A;  3V2W A;  2Y01 A;  2YCY A;  4FBZ A;  1IW6 A;  3UZC A;  1X0S A;  5H2I A;  4GPO A;  3REY A;  2Y03 A;  4TL3 A;  2ZIY A;  1TN5 A;  2YCW A;  5AZD A;  1U19 A;  3VVK A;  2BRD A;  5JJJ A;  1HZX A;  2ZZL A;  1O0A A;  3SN6 R;  5G2D A;  3UTV A;  1E0P A;  5TGZ A;  1QKP A;  3S8F B;  1QM8 A;  1KG9 A;  5EN0 A;  1X0K 1;  4BEZ A;  1MGY A;  3DDL A;  1P8H A;  4KNF A;  3C9M A;  3HAP A;  5B6Y A;  4QRY A;  4PXF A;  3WQJ A;  3P0G A;  1QHJ A;  2QPD B;  4JKV A;  1P8I A;  1IW9 A; 
#chains in the Genus database with same CATH homology
 2KSY A;  1QKO A;  4Y9H A;  5J7A A;  5JJE A;  4G7S B;  3X3B A;  3PBL A;  2F93 A;  3UTX A;  5JJN A;  5DYS A;  5H2P A;  5G28 A;  1BRD A;  3NY9 A;  3VG9 A;  1M0M A;  5B35 A;  5KKH A;  2KS9 A;  5ITE A;  4IB4 A;  5DHH A;  3ZEV A;  4BUO A;  5AX1 A;  3RFM A;  4WW3 A;  5H2N A;  2Y02 A;  3BVD B;  4PXK A;  3VHZ A;  3S3C B;  3T45 A;  1S8L A;  1IXF A;  3AM6 A;  3OE8 A;  4BWB A;  4LDE A;  1X0I 1;  2YCX A;  4X31 A;  5ITC A;  5G2C A;  3OE0 A;  1P8U A;  1S52 A;  5AHZ A;  4DAJ A;  2I20 A;  4X1H A;  1GZM A;  2VT4 A;  1LN6 A;  4IAQ A;  2Z55 A;  1R2N A;  1PXR A;  4GRV A;  2RH1 A;  1S54 A;  1EHK B;  1KG8 A;  1S51 A;  3PWH A;  4XXJ A;  4KLY A;  4QI1 A;  2JAG A;  4G72 B;  1S53 A;  4GP8 B;  3COD A;  3EH5 B;  3S8G B;  2R4S A;  2X72 A;  1PY6 A;  3HAN A;  5FJG A;  5H2L A;  4IAR A;  5A8E A;  1PXS A;  2F95 A;  2I35 A;  3AYM A;  3QJU B;  4XT1 A;  3A7K A;  1E12 A;  3C9L A;  4JR8 A;  2JAF A;  5C1M A;  2WJL A;  5H2M A;  4BVN A;  1H68 A;  4LDO A;  5DHG A;  5H2J A;  4XTL A;  3ZPQ A;  3NSB A;  5G53 A;  4G70 B;  2NTU A;  5AWZ A;  3EH4 B;  3NS0 A;  1KME A;  4MQS A;  3OAX A;  3NYA A;  5B6W A;  1DZE A;  3NY8 A;  4L35 A;  5F8U A;  2Y00 A;  3PQR A;  5B6X A;  1AT9 A;  3QAK A;  1BM1 A;  5B6Z A;  3QAP A;  1GU8 A;  4A4M A;  1L9H A;  3V2Y A;  2KSB A;  3MBV A;  5H2H A;  1R84 A;  3QDC A;  2PED A;  4J4Q A;  3X3C A;  3DQB A;  4MD2 A;  4FAA B;  2R4R A;  5H2O A;  4HYJ A;  4N4Y B;  5A45 A;  4G71 B;  4XT3 A;  4DJH A;  1F4Z A;  4MQT A;  1CWQ A;  5G2A A;  5G54 A;  4BEY A;  1GUE A;  3PDS A;  5ETZ A;  3EML A;  4DKL A;  2HPY A;  3ODU A;  3D4S A;  3UTW A;  5B34 A;  3HAO A;  1JV6 A;  4N4W A;  2LNL A;  1XJI A;  2ZFE A;  3KJ6 A;  4UG2 A;  4BV0 A;  4GP4 B;  3AYN A;  2QPE B;  5BR2 A;  4GP5 B;  5B6V A;  3OE6 A;  3QJQ B;  4GBR A;  3RZE A;  3HAS A;  3UZA A;  1FBB A;  5LWE A;  4MD1 A;  1VGO A;  1Q5J A;  3QJT B;  3ABW A;  3COC A;  4FPD A;  2G87 A;  4GYC A;  5AHY A;  4EJ4 A;  5BR5 A;  2Z73 A;  4XTO A;  3VW7 A;  1KGB A;  4DS7 E;  3UG9 A;  3QBI A;  1L0M A;  2WJK A;  1JFP A;  2I21 A;  4HYX A;  1F88 A;  1C8S A;  2YCZ A;  3VI0 A;  4N6H A;  1BRX A;  1AP9 A;  2YDO A;  4K5Y A;  4OV0 A;  4AMJ A;  4AMI A;  1Q5I A;  4UHR A;  1VJM A;  1F50 A;  1JGJ A;  5B0W A;  1C3W A;  3OE9 A;  3ZPR A;  1UAZ A;  1UCQ A;  4NC3 A;  3HAR A;  2NTW A;  3QJS B;  3QJR B;  4JQ6 A;  3UTY A;  1XME B;  3S3B B;  3UON A;  4FA7 B;  1S8J A;  4X32 A;  1C8R A;  1XIO A;  1M0L A;  2M3G A;  5B2N A;  3QJV B;  4L6R A;  3HAQ A;  4MBS A;  3QBK A;  2L6X A;  3CAP A;  1FBK A;  4EIY A;  4XTN A;  1M0K A;  4EA3 A;  4LDL A;  3PXO A;  3EH3 B;  2AT9 A;  5G36 A;  1TN0 A;  4QID A;  2KSA A;  1H2S A;  1BRR A;  2I1X A;  1JV7 A;  4WAV A;  2EI4 A;  4G7R B;  5AX0 A;  5A44 A;  3QBL A;  3QBG A;  3VGA A;  4HWL A;  3S3D B;  2Y04 A;  2J4Y A;  2YDV A;  4G7Q B;  5H2K A;  3V2W A;  2Y01 A;  2YCY A;  4FBZ A;  1IW6 A;  3UZC A;  1X0S A;  5H2I A;  4GPO A;  3REY A;  2Y03 A;  4TL3 A;  2ZIY A;  1TN5 A;  2YCW A;  5AZD A;  1U19 A;  3VVK A;  2BRD A;  5JJJ A;  1HZX A;  2ZZL A;  1O0A A;  3SN6 R;  5G2D A;  3UTV A;  1E0P A;  5TGZ A;  1QKP A;  3S8F B;  1QM8 A;  1KG9 A;  5EN0 A;  1X0K 1;  4BEZ A;  1MGY A;  3DDL A;  1P8H A;  4KNF A;  3C9M A;  3HAP A;  5B6Y A;  4QRY A;  4PXF A;  3WQJ A;  3P0G A;  1QHJ A;  2QPD B;  4JKV A;  1P8I A;  1IW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...