4UHRA

Thermostabilised human a2a receptor with cgs21680 bound
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
314
structure length
310
Chain Sequence
SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAISTGFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords THERMOSTABILISED HUMAN A2A RECEPTOR
publication title Molecular Determinants of Cgs21680 Binding to the Human Adenosine A2A Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 310
sequence length 314
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4uhrA00
5DYSA 1C8SA 5B6ZA 4BV0A 3C9LA 5ETZA 3DDLA 2ZZLA 3EMLA 5BR2A 5A8EA 1P8UA 1HZXA 4MQTA 5FJGA 2ZFEA 3EH4B 1Q5IA 2KSBA 2YDVA 3QAPA 1R84A 1XIOA 3QJQB 3QJTB 2YDOA 4L6RA 4PXFA 3OE8A 2Y03A 4UHRA 1QHJA 1QKOA 4JQ6A 1DZEA 4XTOA 1M0KA 3V2YA 3ZPQA 2JAGA 1U19A 1XJIA 3BVDB 4UG2A 1Q5JA 1X0K1 1FBKA 1L9HA 1S54A 2YCWA 1C3WA 3QBIA 3UTYA 1AP9A 4N4YB 3NY8A 4GBRA 1BRRA 4JKVA 4L35A 2Y02A 3CODA 2HPYA 4DAJA 5G54A 3S3BB 2JAFA 4N4WA 1L0MA 1IXFA 2YCYA 4LDOA 4MQSA 3VHZA 5H2PA 1S52A 4DKLA 4XT1A 5ITCA 2I20A 3UTXA 4N6HA 3ABWA 1P8IA 1X0I1 5F8UA 1IW6A 4MD1A 4EJ4A 3ZPRA 4EA3A 4A4MA 5DHGA 1JV6A 2BRDA 3NS0A 4IARA 2YCZA 5H2IA 5AZDA 2R4SA 4BUOA 4G72B 3QJUB 3P0GA 1H68A 3QAKA 4FPDA 5JJNA 2L6XA 5G53A 2F95A 3V2WA 5J7AA 1FBBA 1VGOA 1GU8A 5G2CA 3S3CB 5G28A 1S51A 1PXRA 1TN0A 3REYA 4DJHA 3PDSA 2J4YA 3UZCA 5G2DA 4Y9HA 3NY9A 2WJLA 2EI4A 5AX1A 4NC3A 3QDCA 4HYJA 4WW3A 1P8HA 4BEZA 4BEYA 4JR8A 2Y01A 1C8RA 4OV0A 1E12A 3VG9A 3UG9A 3T45A 4MD2A 4TL3A 1TN5A 3RFMA 1BM1A 3C9MA 4AMIA 5H2LA 1LN6A 5LWEA 4J4QA 2NTUA 3DQBA 5JJJA 2RH1A 5B0WA 5B6YA 2X72A 4LDEA 5B6WA 4KLYA 4QIDA 1X0SA 3EH5B 5TGZA 1M0MA 4G7QB 3PXOA 1QKPA 3PWHA 1GUEA 5B2NA 3VI0A 3A7KA 3VW7A 4KNFA 4XTNA 5AWZA 5AHZA 1EHKB 5G2AA 5A45A 4FA7B 3VVKA 5AHYA 4G71B 3UZAA 1AT9A 3QJRB 3HAPA 2Y00A 4GP5B 3NYAA 3X3BA 3RZEA 3X3CA 1JV7A 4AMJA 2NTWA 1XMEB 3PBLA 3PQRA 5ITEA 5EN0A 3UTVA 5DHHA 2LNLA 4IB4A 3QBGA 3OE9A 3HAOA 4MBSA 2I21A 4XT3A 1BRXA 1MGYA 3MBVA 2KSAA 2QPDB 5H2MA 4EIYA 3HANA 1H2SA 3UONA 5B6XA 5AX0A 2KS9A 3VGAA 1JFPA 5B34A 4QI1A 4G7SB 1VJMA 5H2JA 3EH3B 3QBLA 3WQJA 4G70B 4PXKA 4K5YA 1CWQA 5H2KA 5G36A 4BWBA 2I1XA 1JGJA 5KKHA 2ZIYA 3AYNA 1PXSA 3ODUA 2PEDA 1R2NA 3S8GB 1KMEA 4IAQA 3OE0A 4LDLA 4X31A 4X1HA 1KG8A 5B6VA 4GP8B 5H2HA 1S8JA 1UCQA 2Z73A 2Z55A 4BVNA 2M3GA 4HYXA 3AYMA 4WAVA 2R4RA 4G7RB 5BR5A 5B35A 3KJ6A 3QJVB 2KSYA 3UTWA 5H2OA 4GP4B 2I35A 1M0LA 2YCXA 1S8LA 1F50A 2WJKA 2G87A 4XTLA 1UAZA 3OAXA 2F93A 2Y04A 4FAAB 3HARA 3QBKA 1F88A 1KG9A 5A44A 5H2NA 1GZMA 4XXJA 1E0PA 3HASA 4GYCA 2QPEB 1QM8A 3SN6R 3QJSB 4X32A 4QRYA 1F4ZA 3AM6A 3CAPA 3COCA 3ZEVA 4HWLA 2AT9A 2VT4A 3HAQA 3OE6A 3S8FB 4FBZA 3NSBA 4GPOA 5JJEA 1O0AA 1BRDA 3S3DB 4GRVA 1PY6A 1IW9A 3D4SA 1S53A 1KGBA 5C1MA
chains in the Genus database with same CATH superfamily
5DYSA 1C8SA 5B6ZA 4BV0A 3C9LA 5ETZA 3DDLA 2ZZLA 3EMLA 5BR2A 5A8EA 1P8UA 1HZXA 4MQTA 5FJGA 2ZFEA 3EH4B 1Q5IA 2KSBA 2YDVA 3QAPA 1R84A 1XIOA 3QJQB 3QJTB 2YDOA 4L6RA 4PXFA 3OE8A 2Y03A 4UHRA 1QHJA 1QKOA 4JQ6A 1DZEA 4XTOA 1M0KA 3V2YA 3ZPQA 2JAGA 1U19A 1XJIA 3BVDB 4UG2A 1Q5JA 1X0K1 1FBKA 1L9HA 1S54A 2YCWA 1C3WA 3QBIA 3UTYA 1AP9A 4N4YB 3NY8A 4GBRA 1BRRA 4JKVA 4L35A 2Y02A 3CODA 2HPYA 4DAJA 5G54A 3S3BB 2JAFA 4N4WA 1L0MA 1IXFA 2YCYA 4LDOA 4MQSA 3VHZA 5H2PA 1S52A 4DKLA 4XT1A 5ITCA 2I20A 3UTXA 4N6HA 3ABWA 1P8IA 1X0I1 5F8UA 1IW6A 4MD1A 4EJ4A 3ZPRA 4EA3A 4A4MA 5DHGA 1JV6A 2BRDA 3NS0A 4IARA 2YCZA 5H2IA 5AZDA 2R4SA 4BUOA 4G72B 3QJUB 3P0GA 1H68A 3QAKA 4FPDA 5JJNA 2L6XA 5G53A 2F95A 3V2WA 5J7AA 1FBBA 1VGOA 1GU8A 5G2CA 3S3CB 5G28A 1S51A 1PXRA 1TN0A 3REYA 4DJHA 3PDSA 2J4YA 3UZCA 5G2DA 4Y9HA 3NY9A 2WJLA 2EI4A 5AX1A 4NC3A 3QDCA 4HYJA 4WW3A 1P8HA 4BEZA 4BEYA 4JR8A 2Y01A 1C8RA 4OV0A 1E12A 3VG9A 3UG9A 3T45A 4MD2A 4TL3A 1TN5A 3RFMA 1BM1A 3C9MA 4AMIA 5H2LA 1LN6A 5LWEA 4J4QA 2NTUA 3DQBA 5JJJA 2RH1A 5B0WA 5B6YA 2X72A 4LDEA 5B6WA 4KLYA 4QIDA 1X0SA 3EH5B 5TGZA 1M0MA 4G7QB 3PXOA 1QKPA 3PWHA 1GUEA 5B2NA 3VI0A 3A7KA 3VW7A 4KNFA 4XTNA 5AWZA 5AHZA 1EHKB 5G2AA 5A45A 4FA7B 3VVKA 5AHYA 4G71B 3UZAA 1AT9A 3QJRB 3HAPA 2Y00A 4GP5B 3NYAA 3X3BA 3RZEA 3X3CA 1JV7A 4AMJA 2NTWA 1XMEB 3PBLA 3PQRA 5ITEA 5EN0A 3UTVA 5DHHA 2LNLA 4IB4A 3QBGA 4DS7E 3OE9A 3HAOA 4MBSA 2I21A 4XT3A 1BRXA 1MGYA 3MBVA 2KSAA 2QPDB 5H2MA 4EIYA 3HANA 1H2SA 3UONA 5B6XA 5AX0A 2KS9A 3VGAA 1JFPA 5B34A 4QI1A 4G7SB 1VJMA 5H2JA 3EH3B 3QBLA 3WQJA 4G70B 4PXKA 4K5YA 1CWQA 5H2KA 5G36A 4BWBA 2I1XA 1JGJA 5KKHA 2ZIYA 3AYNA 1PXSA 3ODUA 2PEDA 1R2NA 3S8GB 1KMEA 4IAQA 3OE0A 4LDLA 4X31A 4X1HA 1KG8A 5B6VA 4GP8B 5H2HA 1S8JA 1UCQA 2Z73A 2Z55A 4BVNA 2M3GA 4HYXA 3AYMA 4WAVA 2R4RA 4G7RB 5BR5A 5B35A 3KJ6A 3QJVB 2KSYA 3UTWA 5H2OA 4GP4B 2I35A 1M0LA 2YCXA 1S8LA 1F50A 2WJKA 2G87A 4XTLA 1UAZA 3OAXA 2F93A 2Y04A 4FAAB 3HARA 3QBKA 1F88A 1KG9A 5A44A 5H2NA 1GZMA 4XXJA 1E0PA 3HASA 4GYCA 2QPEB 1QM8A 3SN6R 3QJSB 4X32A 4QRYA 1F4ZA 3AM6A 3CAPA 3COCA 3ZEVA 4HWLA 2AT9A 2VT4A 3HAQA 3OE6A 3S8FB 4FBZA 3NSBA 4GPOA 5JJEA 1O0AA 1BRDA 3S3DB 4GRVA 1PY6A 1IW9A 3D4SA 1S53A 1KGBA 5C1MA
chains in the Genus database with same CATH topology
5DYSA 1C8SA 5B6ZA 4BV0A 3C9LA 5ETZA 3DDLA 2ZZLA 3EMLA 5BR2A 5A8EA 1P8UA 1HZXA 4MQTA 5FJGA 2ZFEA 3EH4B 1Q5IA 2KSBA 2YDVA 3QAPA 1R84A 1XIOA 3QJQB 3QJTB 2YDOA 4L6RA 4PXFA 3OE8A 2Y03A 4UHRA 1QHJA 1QKOA 4JQ6A 1DZEA 4XTOA 1M0KA 3V2YA 3ZPQA 2JAGA 1U19A 1XJIA 3BVDB 4UG2A 1Q5JA 1X0K1 1FBKA 1L9HA 1S54A 2YCWA 1C3WA 3QBIA 3UTYA 1AP9A 4N4YB 3NY8A 4GBRA 1BRRA 4JKVA 4L35A 2Y02A 3CODA 2HPYA 4DAJA 5G54A 3S3BB 2JAFA 4N4WA 1L0MA 1IXFA 2YCYA 4LDOA 4MQSA 3VHZA 5H2PA 1S52A 4DKLA 4XT1A 5ITCA 2I20A 3UTXA 4N6HA 3ABWA 1P8IA 1X0I1 5F8UA 1IW6A 4MD1A 4EJ4A 3ZPRA 4EA3A 4A4MA 5DHGA 1JV6A 2BRDA 3NS0A 4IARA 2YCZA 5H2IA 5AZDA 2R4SA 4BUOA 4G72B 3QJUB 3P0GA 1H68A 3QAKA 4FPDA 5JJNA 2L6XA 5G53A 2F95A 3V2WA 5J7AA 1FBBA 1VGOA 1GU8A 5G2CA 3S3CB 5G28A 1S51A 1PXRA 1TN0A 3REYA 4DJHA 3PDSA 2J4YA 3UZCA 5G2DA 4Y9HA 3NY9A 2WJLA 2EI4A 5AX1A 4NC3A 3QDCA 4HYJA 4WW3A 1P8HA 4BEZA 4BEYA 4JR8A 2Y01A 1C8RA 4OV0A 1E12A 3VG9A 3UG9A 3T45A 4MD2A 4TL3A 1TN5A 3RFMA 1BM1A 3C9MA 4AMIA 5H2LA 1LN6A 5LWEA 4J4QA 2NTUA 3DQBA 5JJJA 2RH1A 5B0WA 5B6YA 2X72A 4LDEA 5B6WA 4KLYA 4QIDA 1X0SA 3EH5B 5TGZA 1M0MA 4G7QB 3PXOA 1QKPA 3PWHA 1GUEA 5B2NA 3VI0A 3A7KA 3VW7A 4KNFA 4XTNA 5AWZA 5AHZA 1EHKB 5G2AA 5A45A 4FA7B 3VVKA 5AHYA 4G71B 3UZAA 1AT9A 3QJRB 3HAPA 2Y00A 4GP5B 3NYAA 3X3BA 3RZEA 3X3CA 1JV7A 4AMJA 2NTWA 1XMEB 3PBLA 3PQRA 5ITEA 5EN0A 3UTVA 5DHHA 2LNLA 4IB4A 3QBGA 4DS7E 3OE9A 3HAOA 4MBSA 2I21A 4XT3A 1BRXA 1MGYA 3MBVA 2KSAA 2QPDB 5H2MA 4EIYA 3HANA 1H2SA 3UONA 5B6XA 5AX0A 2KS9A 3VGAA 1JFPA 5B34A 4QI1A 4G7SB 1VJMA 5H2JA 3EH3B 3QBLA 3WQJA 4G70B 4PXKA 4K5YA 1CWQA 5H2KA 5G36A 4BWBA 2I1XA 1JGJA 5KKHA 2ZIYA 3AYNA 1PXSA 3ODUA 2PEDA 1R2NA 3S8GB 1KMEA 4IAQA 3OE0A 4LDLA 4X31A 4X1HA 1KG8A 5B6VA 4GP8B 5H2HA 1S8JA 1UCQA 2Z73A 2Z55A 4BVNA 2M3GA 4HYXA 3AYMA 4WAVA 2R4RA 4G7RB 5BR5A 5B35A 3KJ6A 3QJVB 2KSYA 3UTWA 5H2OA 4GP4B 2I35A 1M0LA 2YCXA 1S8LA 1F50A 2WJKA 2G87A 4XTLA 1UAZA 3OAXA 2F93A 2Y04A 4FAAB 3HARA 3QBKA 1F88A 1KG9A 5A44A 5H2NA 1GZMA 4XXJA 1E0PA 3HASA 4GYCA 2QPEB 1QM8A 3SN6R 3QJSB 4X32A 4QRYA 1F4ZA 3AM6A 3CAPA 3COCA 3ZEVA 4HWLA 2AT9A 2VT4A 3HAQA 3OE6A 3S8FB 4FBZA 3NSBA 4GPOA 5JJEA 1O0AA 1BRDA 3S3DB 4GRVA 1PY6A 1IW9A 3D4SA 1S53A 1KGBA 5C1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYS A;  1C8S A;  5B6Z A;  4BV0 A;  3C9L A;  5ETZ A;  3DDL A;  2ZZL A;  3EML A;  5BR2 A;  5A8E A;  1P8U A;  1HZX A;  4MQT A;  5FJG A;  2ZFE A;  3EH4 B;  1Q5I A;  2KSB A;  2YDV A;  3QAP A;  1R84 A;  1XIO A;  3QJQ B;  3QJT B;  2YDO A;  4L6R A;  4PXF A;  3OE8 A;  2Y03 A;  4UHR A;  1QHJ A;  1QKO A;  4JQ6 A;  1DZE A;  4XTO A;  1M0K A;  3V2Y A;  3ZPQ A;  2JAG A;  1U19 A;  1XJI A;  3BVD B;  4UG2 A;  1Q5J A;  1X0K 1;  1FBK A;  1L9H A;  1S54 A;  2YCW A;  1C3W A;  3QBI A;  3UTY A;  1AP9 A;  4N4Y B;  3NY8 A;  4GBR A;  1BRR A;  4JKV A;  4L35 A;  2Y02 A;  3COD A;  2HPY A;  4DAJ A;  5G54 A;  3S3B B;  2JAF A;  4N4W A;  1L0M A;  1IXF A;  2YCY A;  4LDO A;  4MQS A;  3VHZ A;  5H2P A;  1S52 A;  4DKL A;  4XT1 A;  5ITC A;  2I20 A;  3UTX A;  4N6H A;  3ABW A;  1P8I A;  1X0I 1;  5F8U A;  1IW6 A;  4MD1 A;  4EJ4 A;  3ZPR A;  4EA3 A;  4A4M A;  5DHG A;  1JV6 A;  2BRD A;  3NS0 A;  4IAR A;  2YCZ A;  5H2I A;  5AZD A;  2R4S A;  4BUO A;  4G72 B;  3QJU B;  3P0G A;  1H68 A;  3QAK A;  4FPD A;  5JJN A;  2L6X A;  5G53 A;  2F95 A;  3V2W A;  5J7A A;  1FBB A;  1VGO A;  1GU8 A;  5G2C A;  3S3C B;  5G28 A;  1S51 A;  1PXR A;  1TN0 A;  3REY A;  4DJH A;  3PDS A;  2J4Y A;  3UZC A;  5G2D A;  4Y9H A;  3NY9 A;  2WJL A;  2EI4 A;  5AX1 A;  4NC3 A;  3QDC A;  4HYJ A;  4WW3 A;  1P8H A;  4BEZ A;  4BEY A;  4JR8 A;  2Y01 A;  1C8R A;  4OV0 A;  1E12 A;  3VG9 A;  3UG9 A;  3T45 A;  4MD2 A;  4TL3 A;  1TN5 A;  3RFM A;  1BM1 A;  3C9M A;  4AMI A;  5H2L A;  1LN6 A;  5LWE A;  4J4Q A;  2NTU A;  3DQB A;  5JJJ A;  2RH1 A;  5B0W A;  5B6Y A;  2X72 A;  4LDE A;  5B6W A;  4KLY A;  4QID A;  1X0S A;  3EH5 B;  5TGZ A;  1M0M A;  4G7Q B;  3PXO A;  1QKP A;  3PWH A;  1GUE A;  5B2N A;  3VI0 A;  3A7K A;  3VW7 A;  4KNF A;  4XTN A;  5AWZ A;  5AHZ A;  1EHK B;  5G2A A;  5A45 A;  4FA7 B;  3VVK A;  5AHY A;  4G71 B;  3UZA A;  1AT9 A;  3QJR B;  3HAP A;  2Y00 A;  4GP5 B;  3NYA A;  3X3B A;  3RZE A;  3X3C A;  1JV7 A;  4AMJ A;  2NTW A;  1XME B;  3PBL A;  3PQR A;  5ITE A;  5EN0 A;  3UTV A;  5DHH A;  2LNL A;  4IB4 A;  3QBG A;  3OE9 A;  3HAO A;  4MBS A;  2I21 A;  4XT3 A;  1BRX A;  1MGY A;  3MBV A;  2KSA A;  2QPD B;  5H2M A;  4EIY A;  3HAN A;  1H2S A;  3UON A;  5B6X A;  5AX0 A;  2KS9 A;  3VGA A;  1JFP A;  5B34 A;  4QI1 A;  4G7S B;  1VJM A;  5H2J A;  3EH3 B;  3QBL A;  3WQJ A;  4G70 B;  4PXK A;  4K5Y A;  1CWQ A;  5H2K A;  5G36 A;  4BWB A;  2I1X A;  1JGJ A;  5KKH A;  2ZIY A;  3AYN A;  1PXS A;  3ODU A;  2PED A;  1R2N A;  3S8G B;  1KME A;  4IAQ A;  3OE0 A;  4LDL A;  4X31 A;  4X1H A;  1KG8 A;  5B6V A;  4GP8 B;  5H2H A;  1S8J A;  1UCQ A;  2Z73 A;  2Z55 A;  4BVN A;  2M3G A;  4HYX A;  3AYM A;  4WAV A;  2R4R A;  4G7R B;  5BR5 A;  5B35 A;  3KJ6 A;  3QJV B;  2KSY A;  3UTW A;  5H2O A;  4GP4 B;  2I35 A;  1M0L A;  2YCX A;  1S8L A;  1F50 A;  2WJK A;  2G87 A;  4XTL A;  1UAZ A;  3OAX A;  2F93 A;  2Y04 A;  4FAA B;  3HAR A;  3QBK A;  1F88 A;  1KG9 A;  5A44 A;  5H2N A;  1GZM A;  4XXJ A;  1E0P A;  3HAS A;  4GYC A;  2QPE B;  1QM8 A;  3SN6 R;  3QJS B;  4X32 A;  4QRY A;  1F4Z A;  3AM6 A;  3CAP A;  3COC A;  3ZEV A;  4HWL A;  2AT9 A;  2VT4 A;  3HAQ A;  3OE6 A;  3S8F B;  4FBZ A;  3NSB A;  4GPO A;  5JJE A;  1O0A A;  1BRD A;  3S3D B;  4GRV A;  1PY6 A;  1IW9 A;  3D4S A;  1S53 A;  1KGB A;  5C1M A; 
#chains in the Genus database with same CATH topology
 5DYS A;  1C8S A;  5B6Z A;  4BV0 A;  3C9L A;  5ETZ A;  3DDL A;  2ZZL A;  3EML A;  5BR2 A;  5A8E A;  1P8U A;  1HZX A;  4MQT A;  5FJG A;  2ZFE A;  3EH4 B;  1Q5I A;  2KSB A;  2YDV A;  3QAP A;  1R84 A;  1XIO A;  3QJQ B;  3QJT B;  2YDO A;  4L6R A;  4PXF A;  3OE8 A;  2Y03 A;  4UHR A;  1QHJ A;  1QKO A;  4JQ6 A;  1DZE A;  4XTO A;  1M0K A;  3V2Y A;  3ZPQ A;  2JAG A;  1U19 A;  1XJI A;  3BVD B;  4UG2 A;  1Q5J A;  1X0K 1;  1FBK A;  1L9H A;  1S54 A;  2YCW A;  1C3W A;  3QBI A;  3UTY A;  1AP9 A;  4N4Y B;  3NY8 A;  4GBR A;  1BRR A;  4JKV A;  4L35 A;  2Y02 A;  3COD A;  2HPY A;  4DAJ A;  5G54 A;  3S3B B;  2JAF A;  4N4W A;  1L0M A;  1IXF A;  2YCY A;  4LDO A;  4MQS A;  3VHZ A;  5H2P A;  1S52 A;  4DKL A;  4XT1 A;  5ITC A;  2I20 A;  3UTX A;  4N6H A;  3ABW A;  1P8I A;  1X0I 1;  5F8U A;  1IW6 A;  4MD1 A;  4EJ4 A;  3ZPR A;  4EA3 A;  4A4M A;  5DHG A;  1JV6 A;  2BRD A;  3NS0 A;  4IAR A;  2YCZ A;  5H2I A;  5AZD A;  2R4S A;  4BUO A;  4G72 B;  3QJU B;  3P0G A;  1H68 A;  3QAK A;  4FPD A;  5JJN A;  2L6X A;  5G53 A;  2F95 A;  3V2W A;  5J7A A;  1FBB A;  1VGO A;  1GU8 A;  5G2C A;  3S3C B;  5G28 A;  1S51 A;  1PXR A;  1TN0 A;  3REY A;  4DJH A;  3PDS A;  2J4Y A;  3UZC A;  5G2D A;  4Y9H A;  3NY9 A;  2WJL A;  2EI4 A;  5AX1 A;  4NC3 A;  3QDC A;  4HYJ A;  4WW3 A;  1P8H A;  4BEZ A;  4BEY A;  4JR8 A;  2Y01 A;  1C8R A;  4OV0 A;  1E12 A;  3VG9 A;  3UG9 A;  3T45 A;  4MD2 A;  4TL3 A;  1TN5 A;  3RFM A;  1BM1 A;  3C9M A;  4AMI A;  5H2L A;  1LN6 A;  5LWE A;  4J4Q A;  2NTU A;  3DQB A;  5JJJ A;  2RH1 A;  5B0W A;  5B6Y A;  2X72 A;  4LDE A;  5B6W A;  4KLY A;  4QID A;  1X0S A;  3EH5 B;  5TGZ A;  1M0M A;  4G7Q B;  3PXO A;  1QKP A;  3PWH A;  1GUE A;  5B2N A;  3VI0 A;  3A7K A;  3VW7 A;  4KNF A;  4XTN A;  5AWZ A;  5AHZ A;  1EHK B;  5G2A A;  5A45 A;  4FA7 B;  3VVK A;  5AHY A;  4G71 B;  3UZA A;  1AT9 A;  3QJR B;  3HAP A;  2Y00 A;  4GP5 B;  3NYA A;  3X3B A;  3RZE A;  3X3C A;  1JV7 A;  4AMJ A;  2NTW A;  1XME B;  3PBL A;  3PQR A;  5ITE A;  5EN0 A;  3UTV A;  5DHH A;  2LNL A;  4IB4 A;  3QBG A;  4DS7 E;  3OE9 A;  3HAO A;  4MBS A;  2I21 A;  4XT3 A;  1BRX A;  1MGY A;  3MBV A;  2KSA A;  2QPD B;  5H2M A;  4EIY A;  3HAN A;  1H2S A;  3UON A;  5B6X A;  5AX0 A;  2KS9 A;  3VGA A;  1JFP A;  5B34 A;  4QI1 A;  4G7S B;  1VJM A;  5H2J A;  3EH3 B;  3QBL A;  3WQJ A;  4G70 B;  4PXK A;  4K5Y A;  1CWQ A;  5H2K A;  5G36 A;  4BWB A;  2I1X A;  1JGJ A;  5KKH A;  2ZIY A;  3AYN A;  1PXS A;  3ODU A;  2PED A;  1R2N A;  3S8G B;  1KME A;  4IAQ A;  3OE0 A;  4LDL A;  4X31 A;  4X1H A;  1KG8 A;  5B6V A;  4GP8 B;  5H2H A;  1S8J A;  1UCQ A;  2Z73 A;  2Z55 A;  4BVN A;  2M3G A;  4HYX A;  3AYM A;  4WAV A;  2R4R A;  4G7R B;  5BR5 A;  5B35 A;  3KJ6 A;  3QJV B;  2KSY A;  3UTW A;  5H2O A;  4GP4 B;  2I35 A;  1M0L A;  2YCX A;  1S8L A;  1F50 A;  2WJK A;  2G87 A;  4XTL A;  1UAZ A;  3OAX A;  2F93 A;  2Y04 A;  4FAA B;  3HAR A;  3QBK A;  1F88 A;  1KG9 A;  5A44 A;  5H2N A;  1GZM A;  4XXJ A;  1E0P A;  3HAS A;  4GYC A;  2QPE B;  1QM8 A;  3SN6 R;  3QJS B;  4X32 A;  4QRY A;  1F4Z A;  3AM6 A;  3CAP A;  3COC A;  3ZEV A;  4HWL A;  2AT9 A;  2VT4 A;  3HAQ A;  3OE6 A;  3S8F B;  4FBZ A;  3NSB A;  4GPO A;  5JJE A;  1O0A A;  1BRD A;  3S3D B;  4GRV A;  1PY6 A;  1IW9 A;  3D4S A;  1S53 A;  1KGB A;  5C1M A; 
#chains in the Genus database with same CATH homology
 5DYS A;  1C8S A;  5B6Z A;  4BV0 A;  3C9L A;  5ETZ A;  3DDL A;  2ZZL A;  3EML A;  5BR2 A;  5A8E A;  1P8U A;  1HZX A;  4MQT A;  5FJG A;  2ZFE A;  3EH4 B;  1Q5I A;  2KSB A;  2YDV A;  3QAP A;  1R84 A;  1XIO A;  3QJQ B;  3QJT B;  2YDO A;  4L6R A;  4PXF A;  3OE8 A;  2Y03 A;  4UHR A;  1QHJ A;  1QKO A;  4JQ6 A;  1DZE A;  4XTO A;  1M0K A;  3V2Y A;  3ZPQ A;  2JAG A;  1U19 A;  1XJI A;  3BVD B;  4UG2 A;  1Q5J A;  1X0K 1;  1FBK A;  1L9H A;  1S54 A;  2YCW A;  1C3W A;  3QBI A;  3UTY A;  1AP9 A;  4N4Y B;  3NY8 A;  4GBR A;  1BRR A;  4JKV A;  4L35 A;  2Y02 A;  3COD A;  2HPY A;  4DAJ A;  5G54 A;  3S3B B;  2JAF A;  4N4W A;  1L0M A;  1IXF A;  2YCY A;  4LDO A;  4MQS A;  3VHZ A;  5H2P A;  1S52 A;  4DKL A;  4XT1 A;  5ITC A;  2I20 A;  3UTX A;  4N6H A;  3ABW A;  1P8I A;  1X0I 1;  5F8U A;  1IW6 A;  4MD1 A;  4EJ4 A;  3ZPR A;  4EA3 A;  4A4M A;  5DHG A;  1JV6 A;  2BRD A;  3NS0 A;  4IAR A;  2YCZ A;  5H2I A;  5AZD A;  2R4S A;  4BUO A;  4G72 B;  3QJU B;  3P0G A;  1H68 A;  3QAK A;  4FPD A;  5JJN A;  2L6X A;  5G53 A;  2F95 A;  3V2W A;  5J7A A;  1FBB A;  1VGO A;  1GU8 A;  5G2C A;  3S3C B;  5G28 A;  1S51 A;  1PXR A;  1TN0 A;  3REY A;  4DJH A;  3PDS A;  2J4Y A;  3UZC A;  5G2D A;  4Y9H A;  3NY9 A;  2WJL A;  2EI4 A;  5AX1 A;  4NC3 A;  3QDC A;  4HYJ A;  4WW3 A;  1P8H A;  4BEZ A;  4BEY A;  4JR8 A;  2Y01 A;  1C8R A;  4OV0 A;  1E12 A;  3VG9 A;  3UG9 A;  3T45 A;  4MD2 A;  4TL3 A;  1TN5 A;  3RFM A;  1BM1 A;  3C9M A;  4AMI A;  5H2L A;  1LN6 A;  5LWE A;  4J4Q A;  2NTU A;  3DQB A;  5JJJ A;  2RH1 A;  5B0W A;  5B6Y A;  2X72 A;  4LDE A;  5B6W A;  4KLY A;  4QID A;  1X0S A;  3EH5 B;  5TGZ A;  1M0M A;  4G7Q B;  3PXO A;  1QKP A;  3PWH A;  1GUE A;  5B2N A;  3VI0 A;  3A7K A;  3VW7 A;  4KNF A;  4XTN A;  5AWZ A;  5AHZ A;  1EHK B;  5G2A A;  5A45 A;  4FA7 B;  3VVK A;  5AHY A;  4G71 B;  3UZA A;  1AT9 A;  3QJR B;  3HAP A;  2Y00 A;  4GP5 B;  3NYA A;  3X3B A;  3RZE A;  3X3C A;  1JV7 A;  4AMJ A;  2NTW A;  1XME B;  3PBL A;  3PQR A;  5ITE A;  5EN0 A;  3UTV A;  5DHH A;  2LNL A;  4IB4 A;  3QBG A;  4DS7 E;  3OE9 A;  3HAO A;  4MBS A;  2I21 A;  4XT3 A;  1BRX A;  1MGY A;  3MBV A;  2KSA A;  2QPD B;  5H2M A;  4EIY A;  3HAN A;  1H2S A;  3UON A;  5B6X A;  5AX0 A;  2KS9 A;  3VGA A;  1JFP A;  5B34 A;  4QI1 A;  4G7S B;  1VJM A;  5H2J A;  3EH3 B;  3QBL A;  3WQJ A;  4G70 B;  4PXK A;  4K5Y A;  1CWQ A;  5H2K A;  5G36 A;  4BWB A;  2I1X A;  1JGJ A;  5KKH A;  2ZIY A;  3AYN A;  1PXS A;  3ODU A;  2PED A;  1R2N A;  3S8G B;  1KME A;  4IAQ A;  3OE0 A;  4LDL A;  4X31 A;  4X1H A;  1KG8 A;  5B6V A;  4GP8 B;  5H2H A;  1S8J A;  1UCQ A;  2Z73 A;  2Z55 A;  4BVN A;  2M3G A;  4HYX A;  3AYM A;  4WAV A;  2R4R A;  4G7R B;  5BR5 A;  5B35 A;  3KJ6 A;  3QJV B;  2KSY A;  3UTW A;  5H2O A;  4GP4 B;  2I35 A;  1M0L A;  2YCX A;  1S8L A;  1F50 A;  2WJK A;  2G87 A;  4XTL A;  1UAZ A;  3OAX A;  2F93 A;  2Y04 A;  4FAA B;  3HAR A;  3QBK A;  1F88 A;  1KG9 A;  5A44 A;  5H2N A;  1GZM A;  4XXJ A;  1E0P A;  3HAS A;  4GYC A;  2QPE B;  1QM8 A;  3SN6 R;  3QJS B;  4X32 A;  4QRY A;  1F4Z A;  3AM6 A;  3CAP A;  3COC A;  3ZEV A;  4HWL A;  2AT9 A;  2VT4 A;  3HAQ A;  3OE6 A;  3S8F B;  4FBZ A;  3NSB A;  4GPO A;  5JJE A;  1O0A A;  1BRD A;  3S3D B;  4GRV A;  1PY6 A;  1IW9 A;  3D4S A;  1S53 A;  1KGB A;  5C1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...