5A8EA

Thermostabilised beta1-adrenoceptor with rationally designed inverse agonist 7-methylcyanopindolol bound
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
285
Chain Sequence
LSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASVWTLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIILCRSPDFRKAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BETA1 ADRENERGIC RECEPTOR
publication title Pharmacological Analysis and Structure Determination of 7-Methylcyanopindolol-Bound Beta1-Adrenergic Receptor.
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 119
structure length 285
sequence length 291
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5a8eA00
2KS9A 3VG9A 4BUOA 4KLYA 1S8JA 2BRDA 4JR8A 2L6XA 1PY6A 2F93A 3NSBA 1JV6A 3UZAA 3V2WA 1Q5IA 4MQTA 3EH3B 4FBZA 5JJJA 1QM8A 4G7RB 5H2HA 4XTOA 3NYAA 4LDEA 1GU8A 3ZEVA 1UCQA 3CAPA 2R4SA 1R84A 1X0K1 3ZPRA 4GP8B 1KMEA 3DQBA 5AWZA 3UZCA 4G7SB 1HZXA 1BRRA 4A4MA 5EN0A 4BEYA 4NC3A 3X3CA 2JAFA 4BV0A 5G2DA 5BR5A 3QJQB 3C9MA 5A8EA 5B6XA 3OE8A 1AP9A 2YCZA 3ZPQA 5B6VA 2NTUA 1F50A 5TGZA 4J4QA 1C8SA 4DJHA 1P8UA 1S54A 4MD2A 2M3GA 3OAXA 4G70B 3RFMA 2Y01A 2VT4A 3HASA 1KG9A 4Y9HA 5B2NA 1Q5JA 4FPDA 5A44A 4LDOA 3UTYA 5A45A 5DHHA 3UTXA 1E12A 3KJ6A 3WQJA 2PEDA 4AMJA 3UTVA 3PXOA 3HARA 5B0WA 3S3DB 2QPEB 1L9HA 4N4WA 1M0KA 4GP5B 1P8HA 1R2NA 4BEZA 1XIOA 1S53A 4L6RA 1XJIA 5DHGA 1CWQA 2Y03A 4AMIA 2QPDB 1UAZA 5ETZA 1EHKB 2I1XA 2Y02A 2LNLA 1IW6A 3REYA 3T45A 5H2OA 2KSBA 4PXKA 3VGAA 2YDOA 4WAVA 4JQ6A 1O0AA 1IW9A 3QDCA 4WW3A 5H2MA 3HAOA 4G7QB 2YCWA 4HYJA 5G2CA 3QBGA 2AT9A 1X0I1 3PQRA 3S8FB 4GYCA 3NS0A 5G36A 1TN5A 2X72A 4MQSA 3CODA 3QJTB 2KSYA 5H2PA 4MBSA 4HWLA 1S51A 4MD1A 3NY9A 5AX1A 2NTWA 2Y04A 2G87A 5H2NA 5G28A 4G71B 1DZEA 2R4RA 1C8RA 3S3CB 5LWEA 4L35A 5JJNA 1H68A 3UONA 1AT9A 4N6HA 3P0GA 1M0LA 4BWBA 5AZDA 2I20A 5F8UA 3HAQA 5ITCA 5H2KA 1IXFA 3QAKA 3SN6R 1QKOA 3QJUB 4XTLA 5H2JA 3S3BB 4XTNA 1H2SA 5B6WA 4LDLA 4IARA 1BRDA 1F88A 2EI4A 3VHZA 4GRVA 2Z55A 3ODUA 3OE0A 4X1HA 5G2AA 1FBBA 4PXFA 3A7KA 1PXSA 3QJSB 5DYSA 4N4YB 3NY8A 5C1MA 4FAAB 2Z73A 3QAPA 1L0MA 5J7AA 3VW7A 1GUEA 1X0SA 2JAGA 2ZIYA 3EH5B 3QBIA 3QJRB 3DDLA 5H2IA 4QRYA 4XT1A 3D4SA 5AHYA 1E0PA 1KGBA 1U19A 1M0MA 4K5YA 1F4ZA 2ZZLA 5H2LA 1QKPA 3PWHA 3OE9A 3PBLA 4OV0A 4X32A 2KSAA 4TL3A 1GZMA 1JV7A 5KKHA 2RH1A 4XXJA 4QI1A 1FBKA 1KG8A 5B35A 4HYXA 3QBLA 1PXRA 3HAPA 3OE6A 5B34A 4UHRA 5BR2A 4JKVA 5JJEA 4UG2A 4FA7B 3RZEA 2F95A 3AM6A 3EMLA 1LN6A 4GBRA 1BM1A 1P8IA 2WJLA 4IB4A 5B6YA 4EIYA 3C9LA 3VI0A 3UTWA 2YDVA 3AYNA 4KNFA 5G54A 4DAJA 3BVDB 2I21A 3UG9A 4GP4B 4XT3A 1C3WA 3X3BA 1TN0A 4QIDA 2ZFEA 5AX0A 2HPYA 2YCYA 1S8LA 3QBKA 3HANA 3MBVA 3VVKA 3PDSA 1JGJA 4EJ4A 2YCXA 1XMEB 2Y00A 3COCA 5G53A 4G72B 3V2YA 1VJMA 3AYMA 4GPOA 2J4YA 5B6ZA 1BRXA 3EH4B 2I35A 5FJGA 1QHJA 3ABWA 1MGYA 1JFPA 4EA3A 1S52A 5AHZA 3S8GB 4DKLA 2WJKA 3QJVB 4IAQA 4BVNA 5ITEA 1VGOA 4X31A
chains in the Genus database with same CATH superfamily
2KS9A 3VG9A 4BUOA 4KLYA 1S8JA 2BRDA 4JR8A 2L6XA 1PY6A 2F93A 3NSBA 1JV6A 3UZAA 3V2WA 1Q5IA 4MQTA 3EH3B 4FBZA 5JJJA 1QM8A 4G7RB 5H2HA 4XTOA 3NYAA 4LDEA 1GU8A 3ZEVA 1UCQA 3CAPA 2R4SA 1R84A 1X0K1 3ZPRA 4GP8B 1KMEA 3DQBA 5AWZA 3UZCA 4G7SB 1HZXA 1BRRA 4A4MA 5EN0A 4BEYA 4NC3A 3X3CA 2JAFA 4BV0A 5G2DA 5BR5A 3QJQB 3C9MA 5A8EA 5B6XA 3OE8A 1AP9A 2YCZA 3ZPQA 5B6VA 2NTUA 1F50A 5TGZA 4J4QA 1C8SA 4DJHA 1P8UA 1S54A 4MD2A 2M3GA 4DS7E 3OAXA 4G70B 3RFMA 2Y01A 2VT4A 3HASA 1KG9A 4Y9HA 5B2NA 1Q5JA 4FPDA 5A44A 4LDOA 3UTYA 5A45A 5DHHA 3UTXA 1E12A 3KJ6A 3WQJA 2PEDA 4AMJA 3UTVA 3PXOA 3HARA 5B0WA 3S3DB 2QPEB 1L9HA 4N4WA 1M0KA 4GP5B 1P8HA 1R2NA 4BEZA 1XIOA 1S53A 4L6RA 1XJIA 5DHGA 1CWQA 2Y03A 4AMIA 2QPDB 1UAZA 5ETZA 1EHKB 2I1XA 2Y02A 2LNLA 1IW6A 3REYA 3T45A 5H2OA 2KSBA 4PXKA 3VGAA 2YDOA 4WAVA 4JQ6A 1O0AA 1IW9A 3QDCA 4WW3A 5H2MA 3HAOA 4G7QB 2YCWA 4HYJA 5G2CA 3QBGA 2AT9A 1X0I1 3PQRA 3S8FB 4GYCA 3NS0A 5G36A 1TN5A 2X72A 4MQSA 3CODA 3QJTB 2KSYA 5H2PA 4MBSA 4HWLA 1S51A 4MD1A 3NY9A 5AX1A 2NTWA 2Y04A 2G87A 5H2NA 5G28A 4G71B 1DZEA 2R4RA 1C8RA 3S3CB 5LWEA 4L35A 5JJNA 1H68A 3UONA 1AT9A 4N6HA 3P0GA 1M0LA 4BWBA 5AZDA 2I20A 5F8UA 3HAQA 5ITCA 5H2KA 1IXFA 3QAKA 3SN6R 1QKOA 3QJUB 4XTLA 5H2JA 3S3BB 4XTNA 1H2SA 5B6WA 4LDLA 4IARA 1BRDA 1F88A 2EI4A 3VHZA 4GRVA 2Z55A 3ODUA 3OE0A 4X1HA 5G2AA 1FBBA 4PXFA 3A7KA 1PXSA 3QJSB 5DYSA 4N4YB 3NY8A 5C1MA 4FAAB 2Z73A 3QAPA 1L0MA 5J7AA 3VW7A 1GUEA 1X0SA 2JAGA 2ZIYA 3EH5B 3QBIA 3QJRB 3DDLA 5H2IA 4QRYA 4XT1A 3D4SA 5AHYA 1E0PA 1KGBA 1U19A 1M0MA 4K5YA 1F4ZA 2ZZLA 5H2LA 1QKPA 3PWHA 3OE9A 3PBLA 4OV0A 4X32A 2KSAA 4TL3A 1GZMA 1JV7A 5KKHA 2RH1A 4XXJA 4QI1A 1FBKA 1KG8A 5B35A 4HYXA 3QBLA 1PXRA 3HAPA 3OE6A 5B34A 4UHRA 5BR2A 4JKVA 5JJEA 4UG2A 4FA7B 3RZEA 2F95A 3AM6A 3EMLA 1LN6A 4GBRA 1BM1A 1P8IA 2WJLA 4IB4A 5B6YA 4EIYA 3C9LA 3VI0A 3UTWA 2YDVA 3AYNA 4KNFA 5G54A 4DAJA 3BVDB 2I21A 3UG9A 4GP4B 4XT3A 1C3WA 3X3BA 1TN0A 4QIDA 2ZFEA 5AX0A 2HPYA 2YCYA 1S8LA 3QBKA 3HANA 3MBVA 3VVKA 3PDSA 1JGJA 4EJ4A 2YCXA 1XMEB 2Y00A 3COCA 5G53A 4G72B 3V2YA 1VJMA 3AYMA 4GPOA 2J4YA 5B6ZA 1BRXA 3EH4B 2I35A 5FJGA 1QHJA 3ABWA 1MGYA 1JFPA 4EA3A 1S52A 5AHZA 3S8GB 4DKLA 2WJKA 3QJVB 4IAQA 4BVNA 5ITEA 1VGOA 4X31A
chains in the Genus database with same CATH topology
2KS9A 3VG9A 4BUOA 4KLYA 1S8JA 2BRDA 4JR8A 2L6XA 1PY6A 2F93A 3NSBA 1JV6A 3UZAA 3V2WA 1Q5IA 4MQTA 3EH3B 4FBZA 5JJJA 1QM8A 4G7RB 5H2HA 4XTOA 3NYAA 4LDEA 1GU8A 3ZEVA 1UCQA 3CAPA 2R4SA 1R84A 1X0K1 3ZPRA 4GP8B 1KMEA 3DQBA 5AWZA 3UZCA 4G7SB 1HZXA 1BRRA 4A4MA 5EN0A 4BEYA 4NC3A 3X3CA 2JAFA 4BV0A 5G2DA 5BR5A 3QJQB 3C9MA 5A8EA 5B6XA 3OE8A 1AP9A 2YCZA 3ZPQA 5B6VA 2NTUA 1F50A 5TGZA 4J4QA 1C8SA 4DJHA 1P8UA 1S54A 4MD2A 2M3GA 4DS7E 3OAXA 4G70B 3RFMA 2Y01A 2VT4A 3HASA 1KG9A 4Y9HA 5B2NA 1Q5JA 4FPDA 5A44A 4LDOA 3UTYA 5A45A 5DHHA 3UTXA 1E12A 3KJ6A 3WQJA 2PEDA 4AMJA 3UTVA 3PXOA 3HARA 5B0WA 3S3DB 2QPEB 1L9HA 4N4WA 1M0KA 4GP5B 1P8HA 1R2NA 4BEZA 1XIOA 1S53A 4L6RA 1XJIA 5DHGA 1CWQA 2Y03A 4AMIA 2QPDB 1UAZA 5ETZA 1EHKB 2I1XA 2Y02A 2LNLA 1IW6A 3REYA 3T45A 5H2OA 2KSBA 4PXKA 3VGAA 2YDOA 4WAVA 4JQ6A 1O0AA 1IW9A 3QDCA 4WW3A 5H2MA 3HAOA 4G7QB 2YCWA 4HYJA 5G2CA 3QBGA 2AT9A 1X0I1 3PQRA 3S8FB 4GYCA 3NS0A 5G36A 1TN5A 2X72A 4MQSA 3CODA 3QJTB 2KSYA 5H2PA 4MBSA 4HWLA 1S51A 4MD1A 3NY9A 5AX1A 2NTWA 2Y04A 2G87A 5H2NA 5G28A 4G71B 1DZEA 2R4RA 1C8RA 3S3CB 5LWEA 4L35A 5JJNA 1H68A 3UONA 1AT9A 4N6HA 3P0GA 1M0LA 4BWBA 5AZDA 2I20A 5F8UA 3HAQA 5ITCA 5H2KA 1IXFA 3QAKA 3SN6R 1QKOA 3QJUB 4XTLA 5H2JA 3S3BB 4XTNA 1H2SA 5B6WA 4LDLA 4IARA 1BRDA 1F88A 2EI4A 3VHZA 4GRVA 2Z55A 3ODUA 3OE0A 4X1HA 5G2AA 1FBBA 4PXFA 3A7KA 1PXSA 3QJSB 5DYSA 4N4YB 3NY8A 5C1MA 4FAAB 2Z73A 3QAPA 1L0MA 5J7AA 3VW7A 1GUEA 1X0SA 2JAGA 2ZIYA 3EH5B 3QBIA 3QJRB 3DDLA 5H2IA 4QRYA 4XT1A 3D4SA 5AHYA 1E0PA 1KGBA 1U19A 1M0MA 4K5YA 1F4ZA 2ZZLA 5H2LA 1QKPA 3PWHA 3OE9A 3PBLA 4OV0A 4X32A 2KSAA 4TL3A 1GZMA 1JV7A 5KKHA 2RH1A 4XXJA 4QI1A 1FBKA 1KG8A 5B35A 4HYXA 3QBLA 1PXRA 3HAPA 3OE6A 5B34A 4UHRA 5BR2A 4JKVA 5JJEA 4UG2A 4FA7B 3RZEA 2F95A 3AM6A 3EMLA 1LN6A 4GBRA 1BM1A 1P8IA 2WJLA 4IB4A 5B6YA 4EIYA 3C9LA 3VI0A 3UTWA 2YDVA 3AYNA 4KNFA 5G54A 4DAJA 3BVDB 2I21A 3UG9A 4GP4B 4XT3A 1C3WA 3X3BA 1TN0A 4QIDA 2ZFEA 5AX0A 2HPYA 2YCYA 1S8LA 3QBKA 3HANA 3MBVA 3VVKA 3PDSA 1JGJA 4EJ4A 2YCXA 1XMEB 2Y00A 3COCA 5G53A 4G72B 3V2YA 1VJMA 3AYMA 4GPOA 2J4YA 5B6ZA 1BRXA 3EH4B 2I35A 5FJGA 1QHJA 3ABWA 1MGYA 1JFPA 4EA3A 1S52A 5AHZA 3S8GB 4DKLA 2WJKA 3QJVB 4IAQA 4BVNA 5ITEA 1VGOA 4X31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KS9 A;  3VG9 A;  4BUO A;  4KLY A;  1S8J A;  2BRD A;  4JR8 A;  2L6X A;  1PY6 A;  2F93 A;  3NSB A;  1JV6 A;  3UZA A;  3V2W A;  1Q5I A;  4MQT A;  3EH3 B;  4FBZ A;  5JJJ A;  1QM8 A;  4G7R B;  5H2H A;  4XTO A;  3NYA A;  4LDE A;  1GU8 A;  3ZEV A;  1UCQ A;  3CAP A;  2R4S A;  1R84 A;  1X0K 1;  3ZPR A;  4GP8 B;  1KME A;  3DQB A;  5AWZ A;  3UZC A;  4G7S B;  1HZX A;  1BRR A;  4A4M A;  5EN0 A;  4BEY A;  4NC3 A;  3X3C A;  2JAF A;  4BV0 A;  5G2D A;  5BR5 A;  3QJQ B;  3C9M A;  5A8E A;  5B6X A;  3OE8 A;  1AP9 A;  2YCZ A;  3ZPQ A;  5B6V A;  2NTU A;  1F50 A;  5TGZ A;  4J4Q A;  1C8S A;  4DJH A;  1P8U A;  1S54 A;  4MD2 A;  2M3G A;  3OAX A;  4G70 B;  3RFM A;  2Y01 A;  2VT4 A;  3HAS A;  1KG9 A;  4Y9H A;  5B2N A;  1Q5J A;  4FPD A;  5A44 A;  4LDO A;  3UTY A;  5A45 A;  5DHH A;  3UTX A;  1E12 A;  3KJ6 A;  3WQJ A;  2PED A;  4AMJ A;  3UTV A;  3PXO A;  3HAR A;  5B0W A;  3S3D B;  2QPE B;  1L9H A;  4N4W A;  1M0K A;  4GP5 B;  1P8H A;  1R2N A;  4BEZ A;  1XIO A;  1S53 A;  4L6R A;  1XJI A;  5DHG A;  1CWQ A;  2Y03 A;  4AMI A;  2QPD B;  1UAZ A;  5ETZ A;  1EHK B;  2I1X A;  2Y02 A;  2LNL A;  1IW6 A;  3REY A;  3T45 A;  5H2O A;  2KSB A;  4PXK A;  3VGA A;  2YDO A;  4WAV A;  4JQ6 A;  1O0A A;  1IW9 A;  3QDC A;  4WW3 A;  5H2M A;  3HAO A;  4G7Q B;  2YCW A;  4HYJ A;  5G2C A;  3QBG A;  2AT9 A;  1X0I 1;  3PQR A;  3S8F B;  4GYC A;  3NS0 A;  5G36 A;  1TN5 A;  2X72 A;  4MQS A;  3COD A;  3QJT B;  2KSY A;  5H2P A;  4MBS A;  4HWL A;  1S51 A;  4MD1 A;  3NY9 A;  5AX1 A;  2NTW A;  2Y04 A;  2G87 A;  5H2N A;  5G28 A;  4G71 B;  1DZE A;  2R4R A;  1C8R A;  3S3C B;  5LWE A;  4L35 A;  5JJN A;  1H68 A;  3UON A;  1AT9 A;  4N6H A;  3P0G A;  1M0L A;  4BWB A;  5AZD A;  2I20 A;  5F8U A;  3HAQ A;  5ITC A;  5H2K A;  1IXF A;  3QAK A;  3SN6 R;  1QKO A;  3QJU B;  4XTL A;  5H2J A;  3S3B B;  4XTN A;  1H2S A;  5B6W A;  4LDL A;  4IAR A;  1BRD A;  1F88 A;  2EI4 A;  3VHZ A;  4GRV A;  2Z55 A;  3ODU A;  3OE0 A;  4X1H A;  5G2A A;  1FBB A;  4PXF A;  3A7K A;  1PXS A;  3QJS B;  5DYS A;  4N4Y B;  3NY8 A;  5C1M A;  4FAA B;  2Z73 A;  3QAP A;  1L0M A;  5J7A A;  3VW7 A;  1GUE A;  1X0S A;  2JAG A;  2ZIY A;  3EH5 B;  3QBI A;  3QJR B;  3DDL A;  5H2I A;  4QRY A;  4XT1 A;  3D4S A;  5AHY A;  1E0P A;  1KGB A;  1U19 A;  1M0M A;  4K5Y A;  1F4Z A;  2ZZL A;  5H2L A;  1QKP A;  3PWH A;  3OE9 A;  3PBL A;  4OV0 A;  4X32 A;  2KSA A;  4TL3 A;  1GZM A;  1JV7 A;  5KKH A;  2RH1 A;  4XXJ A;  4QI1 A;  1FBK A;  1KG8 A;  5B35 A;  4HYX A;  3QBL A;  1PXR A;  3HAP A;  3OE6 A;  5B34 A;  4UHR A;  5BR2 A;  4JKV A;  5JJE A;  4UG2 A;  4FA7 B;  3RZE A;  2F95 A;  3AM6 A;  3EML A;  1LN6 A;  4GBR A;  1BM1 A;  1P8I A;  2WJL A;  4IB4 A;  5B6Y A;  4EIY A;  3C9L A;  3VI0 A;  3UTW A;  2YDV A;  3AYN A;  4KNF A;  5G54 A;  4DAJ A;  3BVD B;  2I21 A;  3UG9 A;  4GP4 B;  4XT3 A;  1C3W A;  3X3B A;  1TN0 A;  4QID A;  2ZFE A;  5AX0 A;  2HPY A;  2YCY A;  1S8L A;  3QBK A;  3HAN A;  3MBV A;  3VVK A;  3PDS A;  1JGJ A;  4EJ4 A;  2YCX A;  1XME B;  2Y00 A;  3COC A;  5G53 A;  4G72 B;  3V2Y A;  1VJM A;  3AYM A;  4GPO A;  2J4Y A;  5B6Z A;  1BRX A;  3EH4 B;  2I35 A;  5FJG A;  1QHJ A;  3ABW A;  1MGY A;  1JFP A;  4EA3 A;  1S52 A;  5AHZ A;  3S8G B;  4DKL A;  2WJK A;  3QJV B;  4IAQ A;  4BVN A;  5ITE A;  1VGO A;  4X31 A; 
#chains in the Genus database with same CATH topology
 2KS9 A;  3VG9 A;  4BUO A;  4KLY A;  1S8J A;  2BRD A;  4JR8 A;  2L6X A;  1PY6 A;  2F93 A;  3NSB A;  1JV6 A;  3UZA A;  3V2W A;  1Q5I A;  4MQT A;  3EH3 B;  4FBZ A;  5JJJ A;  1QM8 A;  4G7R B;  5H2H A;  4XTO A;  3NYA A;  4LDE A;  1GU8 A;  3ZEV A;  1UCQ A;  3CAP A;  2R4S A;  1R84 A;  1X0K 1;  3ZPR A;  4GP8 B;  1KME A;  3DQB A;  5AWZ A;  3UZC A;  4G7S B;  1HZX A;  1BRR A;  4A4M A;  5EN0 A;  4BEY A;  4NC3 A;  3X3C A;  2JAF A;  4BV0 A;  5G2D A;  5BR5 A;  3QJQ B;  3C9M A;  5A8E A;  5B6X A;  3OE8 A;  1AP9 A;  2YCZ A;  3ZPQ A;  5B6V A;  2NTU A;  1F50 A;  5TGZ A;  4J4Q A;  1C8S A;  4DJH A;  1P8U A;  1S54 A;  4MD2 A;  2M3G A;  4DS7 E;  3OAX A;  4G70 B;  3RFM A;  2Y01 A;  2VT4 A;  3HAS A;  1KG9 A;  4Y9H A;  5B2N A;  1Q5J A;  4FPD A;  5A44 A;  4LDO A;  3UTY A;  5A45 A;  5DHH A;  3UTX A;  1E12 A;  3KJ6 A;  3WQJ A;  2PED A;  4AMJ A;  3UTV A;  3PXO A;  3HAR A;  5B0W A;  3S3D B;  2QPE B;  1L9H A;  4N4W A;  1M0K A;  4GP5 B;  1P8H A;  1R2N A;  4BEZ A;  1XIO A;  1S53 A;  4L6R A;  1XJI A;  5DHG A;  1CWQ A;  2Y03 A;  4AMI A;  2QPD B;  1UAZ A;  5ETZ A;  1EHK B;  2I1X A;  2Y02 A;  2LNL A;  1IW6 A;  3REY A;  3T45 A;  5H2O A;  2KSB A;  4PXK A;  3VGA A;  2YDO A;  4WAV A;  4JQ6 A;  1O0A A;  1IW9 A;  3QDC A;  4WW3 A;  5H2M A;  3HAO A;  4G7Q B;  2YCW A;  4HYJ A;  5G2C A;  3QBG A;  2AT9 A;  1X0I 1;  3PQR A;  3S8F B;  4GYC A;  3NS0 A;  5G36 A;  1TN5 A;  2X72 A;  4MQS A;  3COD A;  3QJT B;  2KSY A;  5H2P A;  4MBS A;  4HWL A;  1S51 A;  4MD1 A;  3NY9 A;  5AX1 A;  2NTW A;  2Y04 A;  2G87 A;  5H2N A;  5G28 A;  4G71 B;  1DZE A;  2R4R A;  1C8R A;  3S3C B;  5LWE A;  4L35 A;  5JJN A;  1H68 A;  3UON A;  1AT9 A;  4N6H A;  3P0G A;  1M0L A;  4BWB A;  5AZD A;  2I20 A;  5F8U A;  3HAQ A;  5ITC A;  5H2K A;  1IXF A;  3QAK A;  3SN6 R;  1QKO A;  3QJU B;  4XTL A;  5H2J A;  3S3B B;  4XTN A;  1H2S A;  5B6W A;  4LDL A;  4IAR A;  1BRD A;  1F88 A;  2EI4 A;  3VHZ A;  4GRV A;  2Z55 A;  3ODU A;  3OE0 A;  4X1H A;  5G2A A;  1FBB A;  4PXF A;  3A7K A;  1PXS A;  3QJS B;  5DYS A;  4N4Y B;  3NY8 A;  5C1M A;  4FAA B;  2Z73 A;  3QAP A;  1L0M A;  5J7A A;  3VW7 A;  1GUE A;  1X0S A;  2JAG A;  2ZIY A;  3EH5 B;  3QBI A;  3QJR B;  3DDL A;  5H2I A;  4QRY A;  4XT1 A;  3D4S A;  5AHY A;  1E0P A;  1KGB A;  1U19 A;  1M0M A;  4K5Y A;  1F4Z A;  2ZZL A;  5H2L A;  1QKP A;  3PWH A;  3OE9 A;  3PBL A;  4OV0 A;  4X32 A;  2KSA A;  4TL3 A;  1GZM A;  1JV7 A;  5KKH A;  2RH1 A;  4XXJ A;  4QI1 A;  1FBK A;  1KG8 A;  5B35 A;  4HYX A;  3QBL A;  1PXR A;  3HAP A;  3OE6 A;  5B34 A;  4UHR A;  5BR2 A;  4JKV A;  5JJE A;  4UG2 A;  4FA7 B;  3RZE A;  2F95 A;  3AM6 A;  3EML A;  1LN6 A;  4GBR A;  1BM1 A;  1P8I A;  2WJL A;  4IB4 A;  5B6Y A;  4EIY A;  3C9L A;  3VI0 A;  3UTW A;  2YDV A;  3AYN A;  4KNF A;  5G54 A;  4DAJ A;  3BVD B;  2I21 A;  3UG9 A;  4GP4 B;  4XT3 A;  1C3W A;  3X3B A;  1TN0 A;  4QID A;  2ZFE A;  5AX0 A;  2HPY A;  2YCY A;  1S8L A;  3QBK A;  3HAN A;  3MBV A;  3VVK A;  3PDS A;  1JGJ A;  4EJ4 A;  2YCX A;  1XME B;  2Y00 A;  3COC A;  5G53 A;  4G72 B;  3V2Y A;  1VJM A;  3AYM A;  4GPO A;  2J4Y A;  5B6Z A;  1BRX A;  3EH4 B;  2I35 A;  5FJG A;  1QHJ A;  3ABW A;  1MGY A;  1JFP A;  4EA3 A;  1S52 A;  5AHZ A;  3S8G B;  4DKL A;  2WJK A;  3QJV B;  4IAQ A;  4BVN A;  5ITE A;  1VGO A;  4X31 A; 
#chains in the Genus database with same CATH homology
 2KS9 A;  3VG9 A;  4BUO A;  4KLY A;  1S8J A;  2BRD A;  4JR8 A;  2L6X A;  1PY6 A;  2F93 A;  3NSB A;  1JV6 A;  3UZA A;  3V2W A;  1Q5I A;  4MQT A;  3EH3 B;  4FBZ A;  5JJJ A;  1QM8 A;  4G7R B;  5H2H A;  4XTO A;  3NYA A;  4LDE A;  1GU8 A;  3ZEV A;  1UCQ A;  3CAP A;  2R4S A;  1R84 A;  1X0K 1;  3ZPR A;  4GP8 B;  1KME A;  3DQB A;  5AWZ A;  3UZC A;  4G7S B;  1HZX A;  1BRR A;  4A4M A;  5EN0 A;  4BEY A;  4NC3 A;  3X3C A;  2JAF A;  4BV0 A;  5G2D A;  5BR5 A;  3QJQ B;  3C9M A;  5A8E A;  5B6X A;  3OE8 A;  1AP9 A;  2YCZ A;  3ZPQ A;  5B6V A;  2NTU A;  1F50 A;  5TGZ A;  4J4Q A;  1C8S A;  4DJH A;  1P8U A;  1S54 A;  4MD2 A;  2M3G A;  4DS7 E;  3OAX A;  4G70 B;  3RFM A;  2Y01 A;  2VT4 A;  3HAS A;  1KG9 A;  4Y9H A;  5B2N A;  1Q5J A;  4FPD A;  5A44 A;  4LDO A;  3UTY A;  5A45 A;  5DHH A;  3UTX A;  1E12 A;  3KJ6 A;  3WQJ A;  2PED A;  4AMJ A;  3UTV A;  3PXO A;  3HAR A;  5B0W A;  3S3D B;  2QPE B;  1L9H A;  4N4W A;  1M0K A;  4GP5 B;  1P8H A;  1R2N A;  4BEZ A;  1XIO A;  1S53 A;  4L6R A;  1XJI A;  5DHG A;  1CWQ A;  2Y03 A;  4AMI A;  2QPD B;  1UAZ A;  5ETZ A;  1EHK B;  2I1X A;  2Y02 A;  2LNL A;  1IW6 A;  3REY A;  3T45 A;  5H2O A;  2KSB A;  4PXK A;  3VGA A;  2YDO A;  4WAV A;  4JQ6 A;  1O0A A;  1IW9 A;  3QDC A;  4WW3 A;  5H2M A;  3HAO A;  4G7Q B;  2YCW A;  4HYJ A;  5G2C A;  3QBG A;  2AT9 A;  1X0I 1;  3PQR A;  3S8F B;  4GYC A;  3NS0 A;  5G36 A;  1TN5 A;  2X72 A;  4MQS A;  3COD A;  3QJT B;  2KSY A;  5H2P A;  4MBS A;  4HWL A;  1S51 A;  4MD1 A;  3NY9 A;  5AX1 A;  2NTW A;  2Y04 A;  2G87 A;  5H2N A;  5G28 A;  4G71 B;  1DZE A;  2R4R A;  1C8R A;  3S3C B;  5LWE A;  4L35 A;  5JJN A;  1H68 A;  3UON A;  1AT9 A;  4N6H A;  3P0G A;  1M0L A;  4BWB A;  5AZD A;  2I20 A;  5F8U A;  3HAQ A;  5ITC A;  5H2K A;  1IXF A;  3QAK A;  3SN6 R;  1QKO A;  3QJU B;  4XTL A;  5H2J A;  3S3B B;  4XTN A;  1H2S A;  5B6W A;  4LDL A;  4IAR A;  1BRD A;  1F88 A;  2EI4 A;  3VHZ A;  4GRV A;  2Z55 A;  3ODU A;  3OE0 A;  4X1H A;  5G2A A;  1FBB A;  4PXF A;  3A7K A;  1PXS A;  3QJS B;  5DYS A;  4N4Y B;  3NY8 A;  5C1M A;  4FAA B;  2Z73 A;  3QAP A;  1L0M A;  5J7A A;  3VW7 A;  1GUE A;  1X0S A;  2JAG A;  2ZIY A;  3EH5 B;  3QBI A;  3QJR B;  3DDL A;  5H2I A;  4QRY A;  4XT1 A;  3D4S A;  5AHY A;  1E0P A;  1KGB A;  1U19 A;  1M0M A;  4K5Y A;  1F4Z A;  2ZZL A;  5H2L A;  1QKP A;  3PWH A;  3OE9 A;  3PBL A;  4OV0 A;  4X32 A;  2KSA A;  4TL3 A;  1GZM A;  1JV7 A;  5KKH A;  2RH1 A;  4XXJ A;  4QI1 A;  1FBK A;  1KG8 A;  5B35 A;  4HYX A;  3QBL A;  1PXR A;  3HAP A;  3OE6 A;  5B34 A;  4UHR A;  5BR2 A;  4JKV A;  5JJE A;  4UG2 A;  4FA7 B;  3RZE A;  2F95 A;  3AM6 A;  3EML A;  1LN6 A;  4GBR A;  1BM1 A;  1P8I A;  2WJL A;  4IB4 A;  5B6Y A;  4EIY A;  3C9L A;  3VI0 A;  3UTW A;  2YDV A;  3AYN A;  4KNF A;  5G54 A;  4DAJ A;  3BVD B;  2I21 A;  3UG9 A;  4GP4 B;  4XT3 A;  1C3W A;  3X3B A;  1TN0 A;  4QID A;  2ZFE A;  5AX0 A;  2HPY A;  2YCY A;  1S8L A;  3QBK A;  3HAN A;  3MBV A;  3VVK A;  3PDS A;  1JGJ A;  4EJ4 A;  2YCX A;  1XME B;  2Y00 A;  3COC A;  5G53 A;  4G72 B;  3V2Y A;  1VJM A;  3AYM A;  4GPO A;  2J4Y A;  5B6Z A;  1BRX A;  3EH4 B;  2I35 A;  5FJG A;  1QHJ A;  3ABW A;  1MGY A;  1JFP A;  4EA3 A;  1S52 A;  5AHZ A;  3S8G B;  4DKL A;  2WJK A;  3QJV B;  4IAQ A;  4BVN A;  5ITE A;  1VGO A;  4X31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...