5JJEA

Structure of the srii/htrii complex in i212121 space group ("u" shape)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
221
structure length
221
Chain Sequence
VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
total genus 95
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5jjeA00
3PBLA 3VW7A 4XTLA 4QRYA 3S3DB 5H2LA 4GYCA 4GP5B 5AHYA 5FJGA 3VG9A 2NTWA 2VT4A 4UHRA 5BR2A 1BM1A 1JFPA 4IB4A 1H2SA 2I1XA 2G87A 4DAJA 2Z73A 5H2PA 5B0WA 4AMIA 1IW9A 5J7AA 1L9HA 2Y04A 3NYAA 1C8SA 4G70B 3VI0A 1P8IA 5LWEA 1JV6A 4GP4B 5AX0A 3V2YA 4WAVA 2HPYA 2KSAA 2YCWA 3QBGA 5AZDA 5G2CA 2ZFEA 1C3WA 1M0LA 5A45A 5B6VA 2BRDA 1S52A 4JKVA 2RH1A 1XIOA 4X1HA 4A4MA 3CODA 5B6YA 4G7RB 2F93A 4BEYA 2WJKA 2YCZA 4LDOA 5G28A 4DJHA 5B6WA 1F88A 4FA7B 3ZPQA 3QJSB 1XMEB 5G2AA 1IW6A 3QJTB 5G36A 2ZZLA 3HAQA 3RZEA 3KJ6A 4EIYA 1QM8A 1AP9A 1GZMA 2KSYA 1GU8A 1GUEA 4WW3A 4XT3A 3PQRA 5KKHA 4KNFA 1CWQA 3UTXA 2YDOA 1BRXA 1S54A 4MD1A 3EH4B 2AT9A 3HASA 1UCQA 4BV0A 1EHKB 5G2DA 2YCXA 1E12A 2PEDA 1Q5IA 5EN0A 3BVDB 3EH3B 3UZCA 1BRDA 4DKLA 3CAPA 5A44A 3UG9A 3T45A 1HZXA 1MGYA 1P8UA 3QJUB 4GRVA 2WJLA 3HAPA 3NY8A 1O0AA 1KG9A 2Y00A 3NSBA 3AM6A 4GPOA 3QBLA 3UZAA 3WQJA 5H2HA 1C8RA 1PY6A 3OE0A 2LNLA 4HYJA 4G7QB 4HWLA 3QAPA 1BRRA 1P8HA 1E0PA 5ITEA 1AT9A 3DQBA 1M0MA 5A8EA 4J4QA 4JR8A 3VHZA 1QKPA 2Y01A 4X31A 4PXFA 2M3GA 1S53A 4FBZA 3DDLA 3RFMA 4BWBA 3OAXA 3QBIA 2I20A 3X3BA 1UAZA 4MQSA 5H2JA 2Y03A 1TN5A 3QJRB 5C1MA 3AYMA 4XTNA 3AYNA 1M0KA 1PXSA 5JJJA 2JAGA 4FPDA 4TL3A 5B35A 2I35A 4XXJA 2F95A 2X72A 3A7KA 1DZEA 3QBKA 1KGBA 4EA3A 2Y02A 4IARA 3P0GA 5H2NA 1QHJA 5DHHA 4N6HA 3OE9A 5DYSA 3X3CA 4BVNA 4UG2A 4OV0A 5ETZA 1S8LA 4QI1A 5TGZA 1PXRA 5BR5A 3NS0A 3PDSA 5AX1A 1FBKA 1JGJA 3HAOA 1VGOA 5JJEA 1X0I1 4L35A 3VGAA 5H2OA 3S3BB 4JQ6A 4G7SB 4KLYA 3VVKA 4MD2A 3ODUA 4GBRA 2I21A 3UTVA 2YCYA 5B6ZA 4G71B 2QPDB 4FAAB 3REYA 4LDLA 3ABWA 5G54A 1LN6A 1R2NA 2ZIYA 4QIDA 4L6RA 3OE6A 1X0SA 2KS9A 2J4YA 1Q5JA 4K5YA 2JAFA 1L0MA 3SN6R 2R4RA 2Z55A 3PWHA 3MBVA 1FBBA 4AMJA 3NY9A 1KG8A 3S8GB 3C9LA 4GP8B 3S8FB 1QKOA 3ZPRA 3V2WA 1KMEA 4EJ4A 1S8JA 3D4SA 5AWZA 1F50A 5DHGA 3QJQB 2KSBA 4MQTA 1JV7A 3QAKA 1TN0A 5B6XA 5G53A 5F8UA 3UTWA 2QPEB 4XT1A 5H2KA 4BUOA 1R84A 4X32A 4N4YB 5B2NA 5B34A 3EMLA 2L6XA 1IXFA 3QJVB 4G72B 4XTOA 5ITCA 3HARA 3UTYA 3S3CB 4PXKA 3HANA 1S51A 4MBSA 1F4ZA 4Y9HA 3ZEVA 3OE8A 4HYXA 3COCA 3UONA 4LDEA 1VJMA 3C9MA 2YDVA 3EH5B 3PXOA 1XJIA 5AHZA 1H68A 2EI4A 2NTUA 1X0K1 4BEZA 5H2IA 2R4SA 5JJNA 4NC3A 1U19A 5H2MA 3QDCA 4IAQA 4N4WA
chains in the Genus database with same CATH superfamily
3PBLA 3VW7A 4XTLA 4QRYA 3S3DB 5H2LA 4GYCA 4GP5B 5AHYA 5FJGA 3VG9A 2NTWA 2VT4A 4UHRA 5BR2A 1BM1A 1JFPA 4IB4A 1H2SA 2I1XA 2G87A 4DAJA 2Z73A 5H2PA 5B0WA 4AMIA 1IW9A 5J7AA 1L9HA 2Y04A 3NYAA 1C8SA 4G70B 3VI0A 1P8IA 5LWEA 1JV6A 4GP4B 5AX0A 3V2YA 4WAVA 2HPYA 2KSAA 2YCWA 3QBGA 5AZDA 5G2CA 2ZFEA 1C3WA 1M0LA 5A45A 5B6VA 2BRDA 1S52A 4JKVA 2RH1A 1XIOA 4X1HA 4A4MA 3CODA 5B6YA 4G7RB 2F93A 4BEYA 2WJKA 2YCZA 4LDOA 5G28A 4DJHA 5B6WA 1F88A 4FA7B 3ZPQA 3QJSB 1XMEB 5G2AA 1IW6A 3QJTB 5G36A 2ZZLA 3HAQA 3RZEA 3KJ6A 4EIYA 1QM8A 1AP9A 1GZMA 2KSYA 1GU8A 1GUEA 4WW3A 4XT3A 3PQRA 5KKHA 4KNFA 1CWQA 3UTXA 2YDOA 1BRXA 1S54A 4MD1A 3EH4B 2AT9A 3HASA 1UCQA 4BV0A 1EHKB 5G2DA 2YCXA 1E12A 2PEDA 1Q5IA 5EN0A 3BVDB 3EH3B 3UZCA 1BRDA 4DKLA 3CAPA 5A44A 3UG9A 3T45A 1HZXA 1MGYA 1P8UA 3QJUB 4GRVA 2WJLA 3HAPA 3NY8A 1O0AA 1KG9A 2Y00A 3NSBA 3AM6A 4GPOA 3QBLA 3UZAA 3WQJA 5H2HA 1C8RA 1PY6A 3OE0A 2LNLA 4HYJA 4G7QB 4HWLA 3QAPA 1BRRA 1P8HA 1E0PA 5ITEA 1AT9A 3DQBA 1M0MA 5A8EA 4J4QA 4JR8A 3VHZA 1QKPA 2Y01A 4X31A 4PXFA 2M3GA 1S53A 4FBZA 3DDLA 3RFMA 4BWBA 3OAXA 3QBIA 2I20A 3X3BA 1UAZA 4MQSA 5H2JA 2Y03A 1TN5A 3QJRB 5C1MA 3AYMA 4XTNA 3AYNA 1M0KA 1PXSA 5JJJA 2JAGA 4FPDA 4TL3A 5B35A 2I35A 4XXJA 2F95A 2X72A 3A7KA 1DZEA 3QBKA 1KGBA 4EA3A 2Y02A 4IARA 3P0GA 5H2NA 1QHJA 5DHHA 4N6HA 3OE9A 5DYSA 3X3CA 4BVNA 4UG2A 4OV0A 5ETZA 1S8LA 4QI1A 5TGZA 1PXRA 5BR5A 3NS0A 3PDSA 4DS7E 5AX1A 1FBKA 1JGJA 3HAOA 1VGOA 5JJEA 1X0I1 4L35A 3VGAA 5H2OA 3S3BB 4JQ6A 4G7SB 4KLYA 3VVKA 4MD2A 3ODUA 4GBRA 2I21A 3UTVA 2YCYA 5B6ZA 4G71B 2QPDB 4FAAB 3REYA 4LDLA 3ABWA 5G54A 1LN6A 1R2NA 2ZIYA 4QIDA 4L6RA 3OE6A 1X0SA 2KS9A 2J4YA 1Q5JA 4K5YA 2JAFA 1L0MA 3SN6R 2R4RA 2Z55A 3PWHA 3MBVA 1FBBA 4AMJA 3NY9A 1KG8A 3S8GB 3C9LA 4GP8B 3S8FB 1QKOA 3ZPRA 3V2WA 1KMEA 4EJ4A 1S8JA 3D4SA 5AWZA 1F50A 5DHGA 3QJQB 2KSBA 4MQTA 1JV7A 3QAKA 1TN0A 5B6XA 5G53A 5F8UA 3UTWA 2QPEB 4XT1A 5H2KA 4BUOA 1R84A 4X32A 4N4YB 5B2NA 5B34A 3EMLA 2L6XA 1IXFA 3QJVB 4G72B 4XTOA 5ITCA 3HARA 3UTYA 3S3CB 4PXKA 3HANA 1S51A 4MBSA 1F4ZA 4Y9HA 3ZEVA 3OE8A 4HYXA 3COCA 3UONA 4LDEA 1VJMA 3C9MA 2YDVA 3EH5B 3PXOA 1XJIA 5AHZA 1H68A 2EI4A 2NTUA 1X0K1 4BEZA 5H2IA 2R4SA 5JJNA 4NC3A 1U19A 5H2MA 3QDCA 4IAQA 4N4WA
chains in the Genus database with same CATH topology
3PBLA 3VW7A 4XTLA 4QRYA 3S3DB 5H2LA 4GYCA 4GP5B 5AHYA 5FJGA 3VG9A 2NTWA 2VT4A 4UHRA 5BR2A 1BM1A 1JFPA 4IB4A 1H2SA 2I1XA 2G87A 4DAJA 2Z73A 5H2PA 5B0WA 4AMIA 1IW9A 5J7AA 1L9HA 2Y04A 3NYAA 1C8SA 4G70B 3VI0A 1P8IA 5LWEA 1JV6A 4GP4B 5AX0A 3V2YA 4WAVA 2HPYA 2KSAA 2YCWA 3QBGA 5AZDA 5G2CA 2ZFEA 1C3WA 1M0LA 5A45A 5B6VA 2BRDA 1S52A 4JKVA 2RH1A 1XIOA 4X1HA 4A4MA 3CODA 5B6YA 4G7RB 2F93A 4BEYA 2WJKA 2YCZA 4LDOA 5G28A 4DJHA 5B6WA 1F88A 4FA7B 3ZPQA 3QJSB 1XMEB 5G2AA 1IW6A 3QJTB 5G36A 2ZZLA 3HAQA 3RZEA 3KJ6A 4EIYA 1QM8A 1AP9A 1GZMA 2KSYA 1GU8A 1GUEA 4WW3A 4XT3A 3PQRA 5KKHA 4KNFA 1CWQA 3UTXA 2YDOA 1BRXA 1S54A 4MD1A 3EH4B 2AT9A 3HASA 1UCQA 4BV0A 1EHKB 5G2DA 2YCXA 1E12A 2PEDA 1Q5IA 5EN0A 3BVDB 3EH3B 3UZCA 1BRDA 4DKLA 3CAPA 5A44A 3UG9A 3T45A 1HZXA 1MGYA 1P8UA 3QJUB 4GRVA 2WJLA 3HAPA 3NY8A 1O0AA 1KG9A 2Y00A 3NSBA 3AM6A 4GPOA 3QBLA 3UZAA 3WQJA 5H2HA 1C8RA 1PY6A 3OE0A 2LNLA 4HYJA 4G7QB 4HWLA 3QAPA 1BRRA 1P8HA 1E0PA 5ITEA 1AT9A 3DQBA 1M0MA 5A8EA 4J4QA 4JR8A 3VHZA 1QKPA 2Y01A 4X31A 4PXFA 2M3GA 1S53A 4FBZA 3DDLA 3RFMA 4BWBA 3OAXA 3QBIA 2I20A 3X3BA 1UAZA 4MQSA 5H2JA 2Y03A 1TN5A 3QJRB 5C1MA 3AYMA 4XTNA 3AYNA 1M0KA 1PXSA 5JJJA 2JAGA 4FPDA 4TL3A 5B35A 2I35A 4XXJA 2F95A 2X72A 3A7KA 1DZEA 3QBKA 1KGBA 4EA3A 2Y02A 4IARA 3P0GA 5H2NA 1QHJA 5DHHA 4N6HA 3OE9A 5DYSA 3X3CA 4BVNA 4UG2A 4OV0A 5ETZA 1S8LA 4QI1A 5TGZA 1PXRA 5BR5A 3NS0A 3PDSA 4DS7E 5AX1A 1FBKA 1JGJA 3HAOA 1VGOA 5JJEA 1X0I1 4L35A 3VGAA 5H2OA 3S3BB 4JQ6A 4G7SB 4KLYA 3VVKA 4MD2A 3ODUA 4GBRA 2I21A 3UTVA 2YCYA 5B6ZA 4G71B 2QPDB 4FAAB 3REYA 4LDLA 3ABWA 5G54A 1LN6A 1R2NA 2ZIYA 4QIDA 4L6RA 3OE6A 1X0SA 2KS9A 2J4YA 1Q5JA 4K5YA 2JAFA 1L0MA 3SN6R 2R4RA 2Z55A 3PWHA 3MBVA 1FBBA 4AMJA 3NY9A 1KG8A 3S8GB 3C9LA 4GP8B 3S8FB 1QKOA 3ZPRA 3V2WA 1KMEA 4EJ4A 1S8JA 3D4SA 5AWZA 1F50A 5DHGA 3QJQB 2KSBA 4MQTA 1JV7A 3QAKA 1TN0A 5B6XA 5G53A 5F8UA 3UTWA 2QPEB 4XT1A 5H2KA 4BUOA 1R84A 4X32A 4N4YB 5B2NA 5B34A 3EMLA 2L6XA 1IXFA 3QJVB 4G72B 4XTOA 5ITCA 3HARA 3UTYA 3S3CB 4PXKA 3HANA 1S51A 4MBSA 1F4ZA 4Y9HA 3ZEVA 3OE8A 4HYXA 3COCA 3UONA 4LDEA 1VJMA 3C9MA 2YDVA 3EH5B 3PXOA 1XJIA 5AHZA 1H68A 2EI4A 2NTUA 1X0K1 4BEZA 5H2IA 2R4SA 5JJNA 4NC3A 1U19A 5H2MA 3QDCA 4IAQA 4N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBL A;  3VW7 A;  4XTL A;  4QRY A;  3S3D B;  5H2L A;  4GYC A;  4GP5 B;  5AHY A;  5FJG A;  3VG9 A;  2NTW A;  2VT4 A;  4UHR A;  5BR2 A;  1BM1 A;  1JFP A;  4IB4 A;  1H2S A;  2I1X A;  2G87 A;  4DAJ A;  2Z73 A;  5H2P A;  5B0W A;  4AMI A;  1IW9 A;  5J7A A;  1L9H A;  2Y04 A;  3NYA A;  1C8S A;  4G70 B;  3VI0 A;  1P8I A;  5LWE A;  1JV6 A;  4GP4 B;  5AX0 A;  3V2Y A;  4WAV A;  2HPY A;  2KSA A;  2YCW A;  3QBG A;  5AZD A;  5G2C A;  2ZFE A;  1C3W A;  1M0L A;  5A45 A;  5B6V A;  2BRD A;  1S52 A;  4JKV A;  2RH1 A;  1XIO A;  4X1H A;  4A4M A;  3COD A;  5B6Y A;  4G7R B;  2F93 A;  4BEY A;  2WJK A;  2YCZ A;  4LDO A;  5G28 A;  4DJH A;  5B6W A;  1F88 A;  4FA7 B;  3ZPQ A;  3QJS B;  1XME B;  5G2A A;  1IW6 A;  3QJT B;  5G36 A;  2ZZL A;  3HAQ A;  3RZE A;  3KJ6 A;  4EIY A;  1QM8 A;  1AP9 A;  1GZM A;  2KSY A;  1GU8 A;  1GUE A;  4WW3 A;  4XT3 A;  3PQR A;  5KKH A;  4KNF A;  1CWQ A;  3UTX A;  2YDO A;  1BRX A;  1S54 A;  4MD1 A;  3EH4 B;  2AT9 A;  3HAS A;  1UCQ A;  4BV0 A;  1EHK B;  5G2D A;  2YCX A;  1E12 A;  2PED A;  1Q5I A;  5EN0 A;  3BVD B;  3EH3 B;  3UZC A;  1BRD A;  4DKL A;  3CAP A;  5A44 A;  3UG9 A;  3T45 A;  1HZX A;  1MGY A;  1P8U A;  3QJU B;  4GRV A;  2WJL A;  3HAP A;  3NY8 A;  1O0A A;  1KG9 A;  2Y00 A;  3NSB A;  3AM6 A;  4GPO A;  3QBL A;  3UZA A;  3WQJ A;  5H2H A;  1C8R A;  1PY6 A;  3OE0 A;  2LNL A;  4HYJ A;  4G7Q B;  4HWL A;  3QAP A;  1BRR A;  1P8H A;  1E0P A;  5ITE A;  1AT9 A;  3DQB A;  1M0M A;  5A8E A;  4J4Q A;  4JR8 A;  3VHZ A;  1QKP A;  2Y01 A;  4X31 A;  4PXF A;  2M3G A;  1S53 A;  4FBZ A;  3DDL A;  3RFM A;  4BWB A;  3OAX A;  3QBI A;  2I20 A;  3X3B A;  1UAZ A;  4MQS A;  5H2J A;  2Y03 A;  1TN5 A;  3QJR B;  5C1M A;  3AYM A;  4XTN A;  3AYN A;  1M0K A;  1PXS A;  5JJJ A;  2JAG A;  4FPD A;  4TL3 A;  5B35 A;  2I35 A;  4XXJ A;  2F95 A;  2X72 A;  3A7K A;  1DZE A;  3QBK A;  1KGB A;  4EA3 A;  2Y02 A;  4IAR A;  3P0G A;  5H2N A;  1QHJ A;  5DHH A;  4N6H A;  3OE9 A;  5DYS A;  3X3C A;  4BVN A;  4UG2 A;  4OV0 A;  5ETZ A;  1S8L A;  4QI1 A;  5TGZ A;  1PXR A;  5BR5 A;  3NS0 A;  3PDS A;  5AX1 A;  1FBK A;  1JGJ A;  3HAO A;  1VGO A;  5JJE A;  1X0I 1;  4L35 A;  3VGA A;  5H2O A;  3S3B B;  4JQ6 A;  4G7S B;  4KLY A;  3VVK A;  4MD2 A;  3ODU A;  4GBR A;  2I21 A;  3UTV A;  2YCY A;  5B6Z A;  4G71 B;  2QPD B;  4FAA B;  3REY A;  4LDL A;  3ABW A;  5G54 A;  1LN6 A;  1R2N A;  2ZIY A;  4QID A;  4L6R A;  3OE6 A;  1X0S A;  2KS9 A;  2J4Y A;  1Q5J A;  4K5Y A;  2JAF A;  1L0M A;  3SN6 R;  2R4R A;  2Z55 A;  3PWH A;  3MBV A;  1FBB A;  4AMJ A;  3NY9 A;  1KG8 A;  3S8G B;  3C9L A;  4GP8 B;  3S8F B;  1QKO A;  3ZPR A;  3V2W A;  1KME A;  4EJ4 A;  1S8J A;  3D4S A;  5AWZ A;  1F50 A;  5DHG A;  3QJQ B;  2KSB A;  4MQT A;  1JV7 A;  3QAK A;  1TN0 A;  5B6X A;  5G53 A;  5F8U A;  3UTW A;  2QPE B;  4XT1 A;  5H2K A;  4BUO A;  1R84 A;  4X32 A;  4N4Y B;  5B2N A;  5B34 A;  3EML A;  2L6X A;  1IXF A;  3QJV B;  4G72 B;  4XTO A;  5ITC A;  3HAR A;  3UTY A;  3S3C B;  4PXK A;  3HAN A;  1S51 A;  4MBS A;  1F4Z A;  4Y9H A;  3ZEV A;  3OE8 A;  4HYX A;  3COC A;  3UON A;  4LDE A;  1VJM A;  3C9M A;  2YDV A;  3EH5 B;  3PXO A;  1XJI A;  5AHZ A;  1H68 A;  2EI4 A;  2NTU A;  1X0K 1;  4BEZ A;  5H2I A;  2R4S A;  5JJN A;  4NC3 A;  1U19 A;  5H2M A;  3QDC A;  4IAQ A;  4N4W A; 
#chains in the Genus database with same CATH topology
 3PBL A;  3VW7 A;  4XTL A;  4QRY A;  3S3D B;  5H2L A;  4GYC A;  4GP5 B;  5AHY A;  5FJG A;  3VG9 A;  2NTW A;  2VT4 A;  4UHR A;  5BR2 A;  1BM1 A;  1JFP A;  4IB4 A;  1H2S A;  2I1X A;  2G87 A;  4DAJ A;  2Z73 A;  5H2P A;  5B0W A;  4AMI A;  1IW9 A;  5J7A A;  1L9H A;  2Y04 A;  3NYA A;  1C8S A;  4G70 B;  3VI0 A;  1P8I A;  5LWE A;  1JV6 A;  4GP4 B;  5AX0 A;  3V2Y A;  4WAV A;  2HPY A;  2KSA A;  2YCW A;  3QBG A;  5AZD A;  5G2C A;  2ZFE A;  1C3W A;  1M0L A;  5A45 A;  5B6V A;  2BRD A;  1S52 A;  4JKV A;  2RH1 A;  1XIO A;  4X1H A;  4A4M A;  3COD A;  5B6Y A;  4G7R B;  2F93 A;  4BEY A;  2WJK A;  2YCZ A;  4LDO A;  5G28 A;  4DJH A;  5B6W A;  1F88 A;  4FA7 B;  3ZPQ A;  3QJS B;  1XME B;  5G2A A;  1IW6 A;  3QJT B;  5G36 A;  2ZZL A;  3HAQ A;  3RZE A;  3KJ6 A;  4EIY A;  1QM8 A;  1AP9 A;  1GZM A;  2KSY A;  1GU8 A;  1GUE A;  4WW3 A;  4XT3 A;  3PQR A;  5KKH A;  4KNF A;  1CWQ A;  3UTX A;  2YDO A;  1BRX A;  1S54 A;  4MD1 A;  3EH4 B;  2AT9 A;  3HAS A;  1UCQ A;  4BV0 A;  1EHK B;  5G2D A;  2YCX A;  1E12 A;  2PED A;  1Q5I A;  5EN0 A;  3BVD B;  3EH3 B;  3UZC A;  1BRD A;  4DKL A;  3CAP A;  5A44 A;  3UG9 A;  3T45 A;  1HZX A;  1MGY A;  1P8U A;  3QJU B;  4GRV A;  2WJL A;  3HAP A;  3NY8 A;  1O0A A;  1KG9 A;  2Y00 A;  3NSB A;  3AM6 A;  4GPO A;  3QBL A;  3UZA A;  3WQJ A;  5H2H A;  1C8R A;  1PY6 A;  3OE0 A;  2LNL A;  4HYJ A;  4G7Q B;  4HWL A;  3QAP A;  1BRR A;  1P8H A;  1E0P A;  5ITE A;  1AT9 A;  3DQB A;  1M0M A;  5A8E A;  4J4Q A;  4JR8 A;  3VHZ A;  1QKP A;  2Y01 A;  4X31 A;  4PXF A;  2M3G A;  1S53 A;  4FBZ A;  3DDL A;  3RFM A;  4BWB A;  3OAX A;  3QBI A;  2I20 A;  3X3B A;  1UAZ A;  4MQS A;  5H2J A;  2Y03 A;  1TN5 A;  3QJR B;  5C1M A;  3AYM A;  4XTN A;  3AYN A;  1M0K A;  1PXS A;  5JJJ A;  2JAG A;  4FPD A;  4TL3 A;  5B35 A;  2I35 A;  4XXJ A;  2F95 A;  2X72 A;  3A7K A;  1DZE A;  3QBK A;  1KGB A;  4EA3 A;  2Y02 A;  4IAR A;  3P0G A;  5H2N A;  1QHJ A;  5DHH A;  4N6H A;  3OE9 A;  5DYS A;  3X3C A;  4BVN A;  4UG2 A;  4OV0 A;  5ETZ A;  1S8L A;  4QI1 A;  5TGZ A;  1PXR A;  5BR5 A;  3NS0 A;  3PDS A;  4DS7 E;  5AX1 A;  1FBK A;  1JGJ A;  3HAO A;  1VGO A;  5JJE A;  1X0I 1;  4L35 A;  3VGA A;  5H2O A;  3S3B B;  4JQ6 A;  4G7S B;  4KLY A;  3VVK A;  4MD2 A;  3ODU A;  4GBR A;  2I21 A;  3UTV A;  2YCY A;  5B6Z A;  4G71 B;  2QPD B;  4FAA B;  3REY A;  4LDL A;  3ABW A;  5G54 A;  1LN6 A;  1R2N A;  2ZIY A;  4QID A;  4L6R A;  3OE6 A;  1X0S A;  2KS9 A;  2J4Y A;  1Q5J A;  4K5Y A;  2JAF A;  1L0M A;  3SN6 R;  2R4R A;  2Z55 A;  3PWH A;  3MBV A;  1FBB A;  4AMJ A;  3NY9 A;  1KG8 A;  3S8G B;  3C9L A;  4GP8 B;  3S8F B;  1QKO A;  3ZPR A;  3V2W A;  1KME A;  4EJ4 A;  1S8J A;  3D4S A;  5AWZ A;  1F50 A;  5DHG A;  3QJQ B;  2KSB A;  4MQT A;  1JV7 A;  3QAK A;  1TN0 A;  5B6X A;  5G53 A;  5F8U A;  3UTW A;  2QPE B;  4XT1 A;  5H2K A;  4BUO A;  1R84 A;  4X32 A;  4N4Y B;  5B2N A;  5B34 A;  3EML A;  2L6X A;  1IXF A;  3QJV B;  4G72 B;  4XTO A;  5ITC A;  3HAR A;  3UTY A;  3S3C B;  4PXK A;  3HAN A;  1S51 A;  4MBS A;  1F4Z A;  4Y9H A;  3ZEV A;  3OE8 A;  4HYX A;  3COC A;  3UON A;  4LDE A;  1VJM A;  3C9M A;  2YDV A;  3EH5 B;  3PXO A;  1XJI A;  5AHZ A;  1H68 A;  2EI4 A;  2NTU A;  1X0K 1;  4BEZ A;  5H2I A;  2R4S A;  5JJN A;  4NC3 A;  1U19 A;  5H2M A;  3QDC A;  4IAQ A;  4N4W A; 
#chains in the Genus database with same CATH homology
 3PBL A;  3VW7 A;  4XTL A;  4QRY A;  3S3D B;  5H2L A;  4GYC A;  4GP5 B;  5AHY A;  5FJG A;  3VG9 A;  2NTW A;  2VT4 A;  4UHR A;  5BR2 A;  1BM1 A;  1JFP A;  4IB4 A;  1H2S A;  2I1X A;  2G87 A;  4DAJ A;  2Z73 A;  5H2P A;  5B0W A;  4AMI A;  1IW9 A;  5J7A A;  1L9H A;  2Y04 A;  3NYA A;  1C8S A;  4G70 B;  3VI0 A;  1P8I A;  5LWE A;  1JV6 A;  4GP4 B;  5AX0 A;  3V2Y A;  4WAV A;  2HPY A;  2KSA A;  2YCW A;  3QBG A;  5AZD A;  5G2C A;  2ZFE A;  1C3W A;  1M0L A;  5A45 A;  5B6V A;  2BRD A;  1S52 A;  4JKV A;  2RH1 A;  1XIO A;  4X1H A;  4A4M A;  3COD A;  5B6Y A;  4G7R B;  2F93 A;  4BEY A;  2WJK A;  2YCZ A;  4LDO A;  5G28 A;  4DJH A;  5B6W A;  1F88 A;  4FA7 B;  3ZPQ A;  3QJS B;  1XME B;  5G2A A;  1IW6 A;  3QJT B;  5G36 A;  2ZZL A;  3HAQ A;  3RZE A;  3KJ6 A;  4EIY A;  1QM8 A;  1AP9 A;  1GZM A;  2KSY A;  1GU8 A;  1GUE A;  4WW3 A;  4XT3 A;  3PQR A;  5KKH A;  4KNF A;  1CWQ A;  3UTX A;  2YDO A;  1BRX A;  1S54 A;  4MD1 A;  3EH4 B;  2AT9 A;  3HAS A;  1UCQ A;  4BV0 A;  1EHK B;  5G2D A;  2YCX A;  1E12 A;  2PED A;  1Q5I A;  5EN0 A;  3BVD B;  3EH3 B;  3UZC A;  1BRD A;  4DKL A;  3CAP A;  5A44 A;  3UG9 A;  3T45 A;  1HZX A;  1MGY A;  1P8U A;  3QJU B;  4GRV A;  2WJL A;  3HAP A;  3NY8 A;  1O0A A;  1KG9 A;  2Y00 A;  3NSB A;  3AM6 A;  4GPO A;  3QBL A;  3UZA A;  3WQJ A;  5H2H A;  1C8R A;  1PY6 A;  3OE0 A;  2LNL A;  4HYJ A;  4G7Q B;  4HWL A;  3QAP A;  1BRR A;  1P8H A;  1E0P A;  5ITE A;  1AT9 A;  3DQB A;  1M0M A;  5A8E A;  4J4Q A;  4JR8 A;  3VHZ A;  1QKP A;  2Y01 A;  4X31 A;  4PXF A;  2M3G A;  1S53 A;  4FBZ A;  3DDL A;  3RFM A;  4BWB A;  3OAX A;  3QBI A;  2I20 A;  3X3B A;  1UAZ A;  4MQS A;  5H2J A;  2Y03 A;  1TN5 A;  3QJR B;  5C1M A;  3AYM A;  4XTN A;  3AYN A;  1M0K A;  1PXS A;  5JJJ A;  2JAG A;  4FPD A;  4TL3 A;  5B35 A;  2I35 A;  4XXJ A;  2F95 A;  2X72 A;  3A7K A;  1DZE A;  3QBK A;  1KGB A;  4EA3 A;  2Y02 A;  4IAR A;  3P0G A;  5H2N A;  1QHJ A;  5DHH A;  4N6H A;  3OE9 A;  5DYS A;  3X3C A;  4BVN A;  4UG2 A;  4OV0 A;  5ETZ A;  1S8L A;  4QI1 A;  5TGZ A;  1PXR A;  5BR5 A;  3NS0 A;  3PDS A;  4DS7 E;  5AX1 A;  1FBK A;  1JGJ A;  3HAO A;  1VGO A;  5JJE A;  1X0I 1;  4L35 A;  3VGA A;  5H2O A;  3S3B B;  4JQ6 A;  4G7S B;  4KLY A;  3VVK A;  4MD2 A;  3ODU A;  4GBR A;  2I21 A;  3UTV A;  2YCY A;  5B6Z A;  4G71 B;  2QPD B;  4FAA B;  3REY A;  4LDL A;  3ABW A;  5G54 A;  1LN6 A;  1R2N A;  2ZIY A;  4QID A;  4L6R A;  3OE6 A;  1X0S A;  2KS9 A;  2J4Y A;  1Q5J A;  4K5Y A;  2JAF A;  1L0M A;  3SN6 R;  2R4R A;  2Z55 A;  3PWH A;  3MBV A;  1FBB A;  4AMJ A;  3NY9 A;  1KG8 A;  3S8G B;  3C9L A;  4GP8 B;  3S8F B;  1QKO A;  3ZPR A;  3V2W A;  1KME A;  4EJ4 A;  1S8J A;  3D4S A;  5AWZ A;  1F50 A;  5DHG A;  3QJQ B;  2KSB A;  4MQT A;  1JV7 A;  3QAK A;  1TN0 A;  5B6X A;  5G53 A;  5F8U A;  3UTW A;  2QPE B;  4XT1 A;  5H2K A;  4BUO A;  1R84 A;  4X32 A;  4N4Y B;  5B2N A;  5B34 A;  3EML A;  2L6X A;  1IXF A;  3QJV B;  4G72 B;  4XTO A;  5ITC A;  3HAR A;  3UTY A;  3S3C B;  4PXK A;  3HAN A;  1S51 A;  4MBS A;  1F4Z A;  4Y9H A;  3ZEV A;  3OE8 A;  4HYX A;  3COC A;  3UON A;  4LDE A;  1VJM A;  3C9M A;  2YDV A;  3EH5 B;  3PXO A;  1XJI A;  5AHZ A;  1H68 A;  2EI4 A;  2NTU A;  1X0K 1;  4BEZ A;  5H2I A;  2R4S A;  5JJN A;  4NC3 A;  1U19 A;  5H2M A;  3QDC A;  4IAQ A;  4N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...