5JJJA

Structure of the srii/htrii complex in p64 space group ("u" shape)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
216
structure length
216
Chain Sequence
GLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
total genus 93
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5jjjA00
3REYA 3EMLA 2JAGA 2KS9A 3VHZA 5H2NA 1LN6A 3QAKA 1S53A 3T45A 2Y00A 3NSBA 3DQBA 5G28A 3HASA 1KMEA 3S8FB 4EIYA 3ZEVA 4IB4A 4GBRA 4DAJA 4BVNA 4Y9HA 5H2LA 3QJUB 2Y03A 4HYXA 3UZAA 5TGZA 3QBLA 1P8IA 4L35A 1S51A 4BV0A 4UHRA 1KG8A 1P8UA 2PEDA 3S3DB 1GZMA 4QI1A 5B6XA 3VW7A 3AYNA 1X0SA 2JAFA 3QJSB 5B6ZA 4HYJA 2X72A 4XTNA 4BEZA 4WW3A 4OV0A 4GP8B 3PXOA 3RZEA 1JFPA 4X1HA 2Y01A 2I35A 5KKHA 3NY9A 4KNFA 1TN5A 2YDVA 5ETZA 4MBSA 5AHYA 2NTWA 2QPDB 3V2WA 3EH4B 1E0PA 4FPDA 3QJVB 2I21A 4MD2A 3QAPA 1XIOA 4G70B 5BR5A 2G87A 4BWBA 2VT4A 1MGYA 3UTVA 3QBGA 4XTOA 2Z55A 3P0GA 3NYAA 1C8SA 4MQSA 4JQ6A 2NTUA 1FBBA 5G53A 3QJTB 4PXFA 1Q5JA 5H2MA 1BRXA 3OAXA 3S3BB 1JV7A 5ITEA 3OE8A 5AX0A 1U19A 4X32A 5B2NA 1BM1A 5JJNA 4EA3A 1PXSA 4GP4B 3D4SA 1DZEA 3OE9A 1H68A 4J4QA 4MQTA 4XT3A 4UG2A 3COCA 2WJKA 1QHJA 3X3BA 3QBKA 1TN0A 4JR8A 3UG9A 1F88A 4LDEA 2WJLA 1R2NA 3DDLA 4BUOA 2RH1A 3SN6R 1FBKA 1BRDA 4XT1A 5H2JA 1KGBA 3HAPA 3UZCA 3EH5B 1VJMA 3PWHA 5C1MA 1VGOA 1C3WA 4N6HA 4DJHA 1S8JA 3QJQB 5AZDA 1S52A 1X0I1 5H2OA 5G2DA 1XJIA 4G71B 3NS0A 1IXFA 4FA7B 1S54A 5F8UA 1AP9A 2HPYA 5B6VA 2L6XA 3A7KA 2EI4A 3NY8A 4BEYA 1PXRA 1F4ZA 3EH3B 4FAAB 1EHKB 2J4YA 4X31A 4GPOA 4GRVA 3CODA 3VGAA 4QRYA 4GP5B 1M0MA 5A8EA 1JGJA 2R4SA 3QDCA 4IARA 1UAZA 1R84A 3VG9A 1AT9A 5DHHA 1XMEB 2R4RA 1H2SA 3AYMA 2LNLA 2Y02A 1GUEA 3PDSA 4DKLA 5J7AA 1QM8A 3QJRB 4KLYA 3VI0A 5AHZA 4EJ4A 3AM6A 5G36A 3UTXA 4A4MA 1CWQA 1L9HA 2YCXA 1PY6A 2YDOA 3KJ6A 3UONA 1GU8A 3OE6A 5ITCA 2F93A 1Q5IA 4L6RA 1BRRA 1JV6A 5DYSA 1X0K1 5FJGA 5B34A 2KSBA 5H2HA 3V2YA 3QBIA 4N4WA 4PXKA 5B35A 5JJJA 4JKVA 1QKPA 2ZFEA 3HANA 1P8HA 4XXJA 2KSAA 4G72B 5AX1A 2KSYA 4AMIA 3S3CB 2Y04A 5A45A 1L0MA 2YCZA 3PQRA 5LWEA 2AT9A 3ODUA 5AWZA 1HZXA 3HARA 1S8LA 4TL3A 4G7QB 5B6YA 5H2KA 3PBLA 2F95A 1M0LA 1QKOA 5G54A 4QIDA 4N4YB 2ZIYA 3OE0A 5G2AA 4XTLA 4GYCA 2M3GA 3WQJA 5A44A 1E12A 4FBZA 4K5YA 4LDOA 4G7SB 1O0AA 3BVDB 2I1XA 5B6WA 4G7RB 3S8GB 3MBVA 3HAOA 1IW6A 1UCQA 4WAVA 5DHGA 3ZPQA 4AMJA 5B0WA 2YCWA 3ZPRA 5JJEA 3HAQA 2ZZLA 4NC3A 3UTWA 1KG9A 2Z73A 3VVKA 4MD1A 2I20A 4LDLA 1F50A 5H2IA 5BR2A 5H2PA 3RFMA 5EN0A 1C8RA 4IAQA 1IW9A 5G2CA 1M0KA 3CAPA 4HWLA 2QPEB 3C9LA 3UTYA 3X3CA 3ABWA 3C9MA 2BRDA 2YCYA
chains in the Genus database with same CATH superfamily
3REYA 3EMLA 2JAGA 2KS9A 3VHZA 5H2NA 4DS7E 1LN6A 3QAKA 1S53A 3T45A 2Y00A 3NSBA 3DQBA 5G28A 3HASA 1KMEA 3S8FB 4EIYA 3ZEVA 4IB4A 4GBRA 4DAJA 4BVNA 4Y9HA 5H2LA 3QJUB 2Y03A 4HYXA 3UZAA 5TGZA 3QBLA 1P8IA 4L35A 1S51A 4BV0A 4UHRA 1KG8A 1P8UA 2PEDA 3S3DB 1GZMA 4QI1A 5B6XA 3VW7A 3AYNA 1X0SA 2JAFA 3QJSB 5B6ZA 4HYJA 2X72A 4XTNA 4BEZA 4WW3A 4OV0A 4GP8B 3PXOA 3RZEA 1JFPA 4X1HA 2Y01A 2I35A 5KKHA 3NY9A 4KNFA 1TN5A 2YDVA 5ETZA 4MBSA 5AHYA 2NTWA 2QPDB 3V2WA 3EH4B 1E0PA 4FPDA 3QJVB 2I21A 4MD2A 3QAPA 1XIOA 4G70B 5BR5A 2G87A 4BWBA 2VT4A 1MGYA 3UTVA 3QBGA 4XTOA 2Z55A 3P0GA 3NYAA 1C8SA 4MQSA 4JQ6A 2NTUA 1FBBA 5G53A 3QJTB 4PXFA 1Q5JA 5H2MA 1BRXA 3OAXA 3S3BB 1JV7A 5ITEA 3OE8A 5AX0A 1U19A 4X32A 5B2NA 1BM1A 5JJNA 4EA3A 1PXSA 4GP4B 3D4SA 1DZEA 3OE9A 1H68A 4J4QA 4MQTA 4XT3A 4UG2A 3COCA 2WJKA 1QHJA 3X3BA 3QBKA 1TN0A 4JR8A 3UG9A 1F88A 4LDEA 2WJLA 1R2NA 3DDLA 4BUOA 2RH1A 3SN6R 1FBKA 1BRDA 4XT1A 5H2JA 1KGBA 3HAPA 3UZCA 3EH5B 1VJMA 3PWHA 5C1MA 1VGOA 1C3WA 4N6HA 4DJHA 1S8JA 3QJQB 5AZDA 1S52A 1X0I1 5H2OA 5G2DA 1XJIA 4G71B 3NS0A 1IXFA 4FA7B 1S54A 5F8UA 1AP9A 2HPYA 5B6VA 2L6XA 3A7KA 2EI4A 3NY8A 4BEYA 1PXRA 1F4ZA 3EH3B 4FAAB 1EHKB 2J4YA 4X31A 4GPOA 4GRVA 3CODA 3VGAA 4QRYA 4GP5B 1M0MA 5A8EA 1JGJA 2R4SA 3QDCA 4IARA 1UAZA 1R84A 3VG9A 1AT9A 5DHHA 1XMEB 2R4RA 1H2SA 3AYMA 2LNLA 2Y02A 1GUEA 3PDSA 4DKLA 5J7AA 1QM8A 3QJRB 4KLYA 3VI0A 5AHZA 4EJ4A 3AM6A 5G36A 3UTXA 4A4MA 1CWQA 1L9HA 2YCXA 1PY6A 2YDOA 3KJ6A 3UONA 1GU8A 3OE6A 5ITCA 2F93A 1Q5IA 4L6RA 1BRRA 1JV6A 5DYSA 1X0K1 5FJGA 5B34A 2KSBA 5H2HA 3V2YA 3QBIA 4N4WA 4PXKA 5B35A 5JJJA 4JKVA 1QKPA 2ZFEA 3HANA 1P8HA 4XXJA 2KSAA 4G72B 5AX1A 2KSYA 4AMIA 3S3CB 2Y04A 5A45A 1L0MA 2YCZA 3PQRA 5LWEA 2AT9A 3ODUA 5AWZA 1HZXA 3HARA 1S8LA 4TL3A 4G7QB 5B6YA 5H2KA 3PBLA 2F95A 1M0LA 1QKOA 5G54A 4QIDA 4N4YB 2ZIYA 3OE0A 5G2AA 4XTLA 4GYCA 2M3GA 3WQJA 5A44A 1E12A 4FBZA 4K5YA 4LDOA 4G7SB 1O0AA 3BVDB 2I1XA 5B6WA 4G7RB 3S8GB 3MBVA 3HAOA 1IW6A 1UCQA 4WAVA 5DHGA 3ZPQA 4AMJA 5B0WA 2YCWA 3ZPRA 5JJEA 3HAQA 2ZZLA 4NC3A 3UTWA 1KG9A 2Z73A 3VVKA 4MD1A 2I20A 4LDLA 1F50A 5H2IA 5BR2A 5H2PA 3RFMA 5EN0A 1C8RA 4IAQA 1IW9A 5G2CA 1M0KA 3CAPA 4HWLA 2QPEB 3C9LA 3UTYA 3X3CA 3ABWA 3C9MA 2BRDA 2YCYA
chains in the Genus database with same CATH topology
3REYA 3EMLA 2JAGA 2KS9A 3VHZA 5H2NA 4DS7E 1LN6A 3QAKA 1S53A 3T45A 2Y00A 3NSBA 3DQBA 5G28A 3HASA 1KMEA 3S8FB 4EIYA 3ZEVA 4IB4A 4GBRA 4DAJA 4BVNA 4Y9HA 5H2LA 3QJUB 2Y03A 4HYXA 3UZAA 5TGZA 3QBLA 1P8IA 4L35A 1S51A 4BV0A 4UHRA 1KG8A 1P8UA 2PEDA 3S3DB 1GZMA 4QI1A 5B6XA 3VW7A 3AYNA 1X0SA 2JAFA 3QJSB 5B6ZA 4HYJA 2X72A 4XTNA 4BEZA 4WW3A 4OV0A 4GP8B 3PXOA 3RZEA 1JFPA 4X1HA 2Y01A 2I35A 5KKHA 3NY9A 4KNFA 1TN5A 2YDVA 5ETZA 4MBSA 5AHYA 2NTWA 2QPDB 3V2WA 3EH4B 1E0PA 4FPDA 3QJVB 2I21A 4MD2A 3QAPA 1XIOA 4G70B 5BR5A 2G87A 4BWBA 2VT4A 1MGYA 3UTVA 3QBGA 4XTOA 2Z55A 3P0GA 3NYAA 1C8SA 4MQSA 4JQ6A 2NTUA 1FBBA 5G53A 3QJTB 4PXFA 1Q5JA 5H2MA 1BRXA 3OAXA 3S3BB 1JV7A 5ITEA 3OE8A 5AX0A 1U19A 4X32A 5B2NA 1BM1A 5JJNA 4EA3A 1PXSA 4GP4B 3D4SA 1DZEA 3OE9A 1H68A 4J4QA 4MQTA 4XT3A 4UG2A 3COCA 2WJKA 1QHJA 3X3BA 3QBKA 1TN0A 4JR8A 3UG9A 1F88A 4LDEA 2WJLA 1R2NA 3DDLA 4BUOA 2RH1A 3SN6R 1FBKA 1BRDA 4XT1A 5H2JA 1KGBA 3HAPA 3UZCA 3EH5B 1VJMA 3PWHA 5C1MA 1VGOA 1C3WA 4N6HA 4DJHA 1S8JA 3QJQB 5AZDA 1S52A 1X0I1 5H2OA 5G2DA 1XJIA 4G71B 3NS0A 1IXFA 4FA7B 1S54A 5F8UA 1AP9A 2HPYA 5B6VA 2L6XA 3A7KA 2EI4A 3NY8A 4BEYA 1PXRA 1F4ZA 3EH3B 4FAAB 1EHKB 2J4YA 4X31A 4GPOA 4GRVA 3CODA 3VGAA 4QRYA 4GP5B 1M0MA 5A8EA 1JGJA 2R4SA 3QDCA 4IARA 1UAZA 1R84A 3VG9A 1AT9A 5DHHA 1XMEB 2R4RA 1H2SA 3AYMA 2LNLA 2Y02A 1GUEA 3PDSA 4DKLA 5J7AA 1QM8A 3QJRB 4KLYA 3VI0A 5AHZA 4EJ4A 3AM6A 5G36A 3UTXA 4A4MA 1CWQA 1L9HA 2YCXA 1PY6A 2YDOA 3KJ6A 3UONA 1GU8A 3OE6A 5ITCA 2F93A 1Q5IA 4L6RA 1BRRA 1JV6A 5DYSA 1X0K1 5FJGA 5B34A 2KSBA 5H2HA 3V2YA 3QBIA 4N4WA 4PXKA 5B35A 5JJJA 4JKVA 1QKPA 2ZFEA 3HANA 1P8HA 4XXJA 2KSAA 4G72B 5AX1A 2KSYA 4AMIA 3S3CB 2Y04A 5A45A 1L0MA 2YCZA 3PQRA 5LWEA 2AT9A 3ODUA 5AWZA 1HZXA 3HARA 1S8LA 4TL3A 4G7QB 5B6YA 5H2KA 3PBLA 2F95A 1M0LA 1QKOA 5G54A 4QIDA 4N4YB 2ZIYA 3OE0A 5G2AA 4XTLA 4GYCA 2M3GA 3WQJA 5A44A 1E12A 4FBZA 4K5YA 4LDOA 4G7SB 1O0AA 3BVDB 2I1XA 5B6WA 4G7RB 3S8GB 3MBVA 3HAOA 1IW6A 1UCQA 4WAVA 5DHGA 3ZPQA 4AMJA 5B0WA 2YCWA 3ZPRA 5JJEA 3HAQA 2ZZLA 4NC3A 3UTWA 1KG9A 2Z73A 3VVKA 4MD1A 2I20A 4LDLA 1F50A 5H2IA 5BR2A 5H2PA 3RFMA 5EN0A 1C8RA 4IAQA 1IW9A 5G2CA 1M0KA 3CAPA 4HWLA 2QPEB 3C9LA 3UTYA 3X3CA 3ABWA 3C9MA 2BRDA 2YCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REY A;  3EML A;  2JAG A;  2KS9 A;  3VHZ A;  5H2N A;  1LN6 A;  3QAK A;  1S53 A;  3T45 A;  2Y00 A;  3NSB A;  3DQB A;  5G28 A;  3HAS A;  1KME A;  3S8F B;  4EIY A;  3ZEV A;  4IB4 A;  4GBR A;  4DAJ A;  4BVN A;  4Y9H A;  5H2L A;  3QJU B;  2Y03 A;  4HYX A;  3UZA A;  5TGZ A;  3QBL A;  1P8I A;  4L35 A;  1S51 A;  4BV0 A;  4UHR A;  1KG8 A;  1P8U A;  2PED A;  3S3D B;  1GZM A;  4QI1 A;  5B6X A;  3VW7 A;  3AYN A;  1X0S A;  2JAF A;  3QJS B;  5B6Z A;  4HYJ A;  2X72 A;  4XTN A;  4BEZ A;  4WW3 A;  4OV0 A;  4GP8 B;  3PXO A;  3RZE A;  1JFP A;  4X1H A;  2Y01 A;  2I35 A;  5KKH A;  3NY9 A;  4KNF A;  1TN5 A;  2YDV A;  5ETZ A;  4MBS A;  5AHY A;  2NTW A;  2QPD B;  3V2W A;  3EH4 B;  1E0P A;  4FPD A;  3QJV B;  2I21 A;  4MD2 A;  3QAP A;  1XIO A;  4G70 B;  5BR5 A;  2G87 A;  4BWB A;  2VT4 A;  1MGY A;  3UTV A;  3QBG A;  4XTO A;  2Z55 A;  3P0G A;  3NYA A;  1C8S A;  4MQS A;  4JQ6 A;  2NTU A;  1FBB A;  5G53 A;  3QJT B;  4PXF A;  1Q5J A;  5H2M A;  1BRX A;  3OAX A;  3S3B B;  1JV7 A;  5ITE A;  3OE8 A;  5AX0 A;  1U19 A;  4X32 A;  5B2N A;  1BM1 A;  5JJN A;  4EA3 A;  1PXS A;  4GP4 B;  3D4S A;  1DZE A;  3OE9 A;  1H68 A;  4J4Q A;  4MQT A;  4XT3 A;  4UG2 A;  3COC A;  2WJK A;  1QHJ A;  3X3B A;  3QBK A;  1TN0 A;  4JR8 A;  3UG9 A;  1F88 A;  4LDE A;  2WJL A;  1R2N A;  3DDL A;  4BUO A;  2RH1 A;  3SN6 R;  1FBK A;  1BRD A;  4XT1 A;  5H2J A;  1KGB A;  3HAP A;  3UZC A;  3EH5 B;  1VJM A;  3PWH A;  5C1M A;  1VGO A;  1C3W A;  4N6H A;  4DJH A;  1S8J A;  3QJQ B;  5AZD A;  1S52 A;  1X0I 1;  5H2O A;  5G2D A;  1XJI A;  4G71 B;  3NS0 A;  1IXF A;  4FA7 B;  1S54 A;  5F8U A;  1AP9 A;  2HPY A;  5B6V A;  2L6X A;  3A7K A;  2EI4 A;  3NY8 A;  4BEY A;  1PXR A;  1F4Z A;  3EH3 B;  4FAA B;  1EHK B;  2J4Y A;  4X31 A;  4GPO A;  4GRV A;  3COD A;  3VGA A;  4QRY A;  4GP5 B;  1M0M A;  5A8E A;  1JGJ A;  2R4S A;  3QDC A;  4IAR A;  1UAZ A;  1R84 A;  3VG9 A;  1AT9 A;  5DHH A;  1XME B;  2R4R A;  1H2S A;  3AYM A;  2LNL A;  2Y02 A;  1GUE A;  3PDS A;  4DKL A;  5J7A A;  1QM8 A;  3QJR B;  4KLY A;  3VI0 A;  5AHZ A;  4EJ4 A;  3AM6 A;  5G36 A;  3UTX A;  4A4M A;  1CWQ A;  1L9H A;  2YCX A;  1PY6 A;  2YDO A;  3KJ6 A;  3UON A;  1GU8 A;  3OE6 A;  5ITC A;  2F93 A;  1Q5I A;  4L6R A;  1BRR A;  1JV6 A;  5DYS A;  1X0K 1;  5FJG A;  5B34 A;  2KSB A;  5H2H A;  3V2Y A;  3QBI A;  4N4W A;  4PXK A;  5B35 A;  5JJJ A;  4JKV A;  1QKP A;  2ZFE A;  3HAN A;  1P8H A;  4XXJ A;  2KSA A;  4G72 B;  5AX1 A;  2KSY A;  4AMI A;  3S3C B;  2Y04 A;  5A45 A;  1L0M A;  2YCZ A;  3PQR A;  5LWE A;  2AT9 A;  3ODU A;  5AWZ A;  1HZX A;  3HAR A;  1S8L A;  4TL3 A;  4G7Q B;  5B6Y A;  5H2K A;  3PBL A;  2F95 A;  1M0L A;  1QKO A;  5G54 A;  4QID A;  4N4Y B;  2ZIY A;  3OE0 A;  5G2A A;  4XTL A;  4GYC A;  2M3G A;  3WQJ A;  5A44 A;  1E12 A;  4FBZ A;  4K5Y A;  4LDO A;  4G7S B;  1O0A A;  3BVD B;  2I1X A;  5B6W A;  4G7R B;  3S8G B;  3MBV A;  3HAO A;  1IW6 A;  1UCQ A;  4WAV A;  5DHG A;  3ZPQ A;  4AMJ A;  5B0W A;  2YCW A;  3ZPR A;  5JJE A;  3HAQ A;  2ZZL A;  4NC3 A;  3UTW A;  1KG9 A;  2Z73 A;  3VVK A;  4MD1 A;  2I20 A;  4LDL A;  1F50 A;  5H2I A;  5BR2 A;  5H2P A;  3RFM A;  5EN0 A;  1C8R A;  4IAQ A;  1IW9 A;  5G2C A;  1M0K A;  3CAP A;  4HWL A;  2QPE B;  3C9L A;  3UTY A;  3X3C A;  3ABW A;  3C9M A;  2BRD A;  2YCY A; 
#chains in the Genus database with same CATH topology
 3REY A;  3EML A;  2JAG A;  2KS9 A;  3VHZ A;  5H2N A;  4DS7 E;  1LN6 A;  3QAK A;  1S53 A;  3T45 A;  2Y00 A;  3NSB A;  3DQB A;  5G28 A;  3HAS A;  1KME A;  3S8F B;  4EIY A;  3ZEV A;  4IB4 A;  4GBR A;  4DAJ A;  4BVN A;  4Y9H A;  5H2L A;  3QJU B;  2Y03 A;  4HYX A;  3UZA A;  5TGZ A;  3QBL A;  1P8I A;  4L35 A;  1S51 A;  4BV0 A;  4UHR A;  1KG8 A;  1P8U A;  2PED A;  3S3D B;  1GZM A;  4QI1 A;  5B6X A;  3VW7 A;  3AYN A;  1X0S A;  2JAF A;  3QJS B;  5B6Z A;  4HYJ A;  2X72 A;  4XTN A;  4BEZ A;  4WW3 A;  4OV0 A;  4GP8 B;  3PXO A;  3RZE A;  1JFP A;  4X1H A;  2Y01 A;  2I35 A;  5KKH A;  3NY9 A;  4KNF A;  1TN5 A;  2YDV A;  5ETZ A;  4MBS A;  5AHY A;  2NTW A;  2QPD B;  3V2W A;  3EH4 B;  1E0P A;  4FPD A;  3QJV B;  2I21 A;  4MD2 A;  3QAP A;  1XIO A;  4G70 B;  5BR5 A;  2G87 A;  4BWB A;  2VT4 A;  1MGY A;  3UTV A;  3QBG A;  4XTO A;  2Z55 A;  3P0G A;  3NYA A;  1C8S A;  4MQS A;  4JQ6 A;  2NTU A;  1FBB A;  5G53 A;  3QJT B;  4PXF A;  1Q5J A;  5H2M A;  1BRX A;  3OAX A;  3S3B B;  1JV7 A;  5ITE A;  3OE8 A;  5AX0 A;  1U19 A;  4X32 A;  5B2N A;  1BM1 A;  5JJN A;  4EA3 A;  1PXS A;  4GP4 B;  3D4S A;  1DZE A;  3OE9 A;  1H68 A;  4J4Q A;  4MQT A;  4XT3 A;  4UG2 A;  3COC A;  2WJK A;  1QHJ A;  3X3B A;  3QBK A;  1TN0 A;  4JR8 A;  3UG9 A;  1F88 A;  4LDE A;  2WJL A;  1R2N A;  3DDL A;  4BUO A;  2RH1 A;  3SN6 R;  1FBK A;  1BRD A;  4XT1 A;  5H2J A;  1KGB A;  3HAP A;  3UZC A;  3EH5 B;  1VJM A;  3PWH A;  5C1M A;  1VGO A;  1C3W A;  4N6H A;  4DJH A;  1S8J A;  3QJQ B;  5AZD A;  1S52 A;  1X0I 1;  5H2O A;  5G2D A;  1XJI A;  4G71 B;  3NS0 A;  1IXF A;  4FA7 B;  1S54 A;  5F8U A;  1AP9 A;  2HPY A;  5B6V A;  2L6X A;  3A7K A;  2EI4 A;  3NY8 A;  4BEY A;  1PXR A;  1F4Z A;  3EH3 B;  4FAA B;  1EHK B;  2J4Y A;  4X31 A;  4GPO A;  4GRV A;  3COD A;  3VGA A;  4QRY A;  4GP5 B;  1M0M A;  5A8E A;  1JGJ A;  2R4S A;  3QDC A;  4IAR A;  1UAZ A;  1R84 A;  3VG9 A;  1AT9 A;  5DHH A;  1XME B;  2R4R A;  1H2S A;  3AYM A;  2LNL A;  2Y02 A;  1GUE A;  3PDS A;  4DKL A;  5J7A A;  1QM8 A;  3QJR B;  4KLY A;  3VI0 A;  5AHZ A;  4EJ4 A;  3AM6 A;  5G36 A;  3UTX A;  4A4M A;  1CWQ A;  1L9H A;  2YCX A;  1PY6 A;  2YDO A;  3KJ6 A;  3UON A;  1GU8 A;  3OE6 A;  5ITC A;  2F93 A;  1Q5I A;  4L6R A;  1BRR A;  1JV6 A;  5DYS A;  1X0K 1;  5FJG A;  5B34 A;  2KSB A;  5H2H A;  3V2Y A;  3QBI A;  4N4W A;  4PXK A;  5B35 A;  5JJJ A;  4JKV A;  1QKP A;  2ZFE A;  3HAN A;  1P8H A;  4XXJ A;  2KSA A;  4G72 B;  5AX1 A;  2KSY A;  4AMI A;  3S3C B;  2Y04 A;  5A45 A;  1L0M A;  2YCZ A;  3PQR A;  5LWE A;  2AT9 A;  3ODU A;  5AWZ A;  1HZX A;  3HAR A;  1S8L A;  4TL3 A;  4G7Q B;  5B6Y A;  5H2K A;  3PBL A;  2F95 A;  1M0L A;  1QKO A;  5G54 A;  4QID A;  4N4Y B;  2ZIY A;  3OE0 A;  5G2A A;  4XTL A;  4GYC A;  2M3G A;  3WQJ A;  5A44 A;  1E12 A;  4FBZ A;  4K5Y A;  4LDO A;  4G7S B;  1O0A A;  3BVD B;  2I1X A;  5B6W A;  4G7R B;  3S8G B;  3MBV A;  3HAO A;  1IW6 A;  1UCQ A;  4WAV A;  5DHG A;  3ZPQ A;  4AMJ A;  5B0W A;  2YCW A;  3ZPR A;  5JJE A;  3HAQ A;  2ZZL A;  4NC3 A;  3UTW A;  1KG9 A;  2Z73 A;  3VVK A;  4MD1 A;  2I20 A;  4LDL A;  1F50 A;  5H2I A;  5BR2 A;  5H2P A;  3RFM A;  5EN0 A;  1C8R A;  4IAQ A;  1IW9 A;  5G2C A;  1M0K A;  3CAP A;  4HWL A;  2QPE B;  3C9L A;  3UTY A;  3X3C A;  3ABW A;  3C9M A;  2BRD A;  2YCY A; 
#chains in the Genus database with same CATH homology
 3REY A;  3EML A;  2JAG A;  2KS9 A;  3VHZ A;  5H2N A;  4DS7 E;  1LN6 A;  3QAK A;  1S53 A;  3T45 A;  2Y00 A;  3NSB A;  3DQB A;  5G28 A;  3HAS A;  1KME A;  3S8F B;  4EIY A;  3ZEV A;  4IB4 A;  4GBR A;  4DAJ A;  4BVN A;  4Y9H A;  5H2L A;  3QJU B;  2Y03 A;  4HYX A;  3UZA A;  5TGZ A;  3QBL A;  1P8I A;  4L35 A;  1S51 A;  4BV0 A;  4UHR A;  1KG8 A;  1P8U A;  2PED A;  3S3D B;  1GZM A;  4QI1 A;  5B6X A;  3VW7 A;  3AYN A;  1X0S A;  2JAF A;  3QJS B;  5B6Z A;  4HYJ A;  2X72 A;  4XTN A;  4BEZ A;  4WW3 A;  4OV0 A;  4GP8 B;  3PXO A;  3RZE A;  1JFP A;  4X1H A;  2Y01 A;  2I35 A;  5KKH A;  3NY9 A;  4KNF A;  1TN5 A;  2YDV A;  5ETZ A;  4MBS A;  5AHY A;  2NTW A;  2QPD B;  3V2W A;  3EH4 B;  1E0P A;  4FPD A;  3QJV B;  2I21 A;  4MD2 A;  3QAP A;  1XIO A;  4G70 B;  5BR5 A;  2G87 A;  4BWB A;  2VT4 A;  1MGY A;  3UTV A;  3QBG A;  4XTO A;  2Z55 A;  3P0G A;  3NYA A;  1C8S A;  4MQS A;  4JQ6 A;  2NTU A;  1FBB A;  5G53 A;  3QJT B;  4PXF A;  1Q5J A;  5H2M A;  1BRX A;  3OAX A;  3S3B B;  1JV7 A;  5ITE A;  3OE8 A;  5AX0 A;  1U19 A;  4X32 A;  5B2N A;  1BM1 A;  5JJN A;  4EA3 A;  1PXS A;  4GP4 B;  3D4S A;  1DZE A;  3OE9 A;  1H68 A;  4J4Q A;  4MQT A;  4XT3 A;  4UG2 A;  3COC A;  2WJK A;  1QHJ A;  3X3B A;  3QBK A;  1TN0 A;  4JR8 A;  3UG9 A;  1F88 A;  4LDE A;  2WJL A;  1R2N A;  3DDL A;  4BUO A;  2RH1 A;  3SN6 R;  1FBK A;  1BRD A;  4XT1 A;  5H2J A;  1KGB A;  3HAP A;  3UZC A;  3EH5 B;  1VJM A;  3PWH A;  5C1M A;  1VGO A;  1C3W A;  4N6H A;  4DJH A;  1S8J A;  3QJQ B;  5AZD A;  1S52 A;  1X0I 1;  5H2O A;  5G2D A;  1XJI A;  4G71 B;  3NS0 A;  1IXF A;  4FA7 B;  1S54 A;  5F8U A;  1AP9 A;  2HPY A;  5B6V A;  2L6X A;  3A7K A;  2EI4 A;  3NY8 A;  4BEY A;  1PXR A;  1F4Z A;  3EH3 B;  4FAA B;  1EHK B;  2J4Y A;  4X31 A;  4GPO A;  4GRV A;  3COD A;  3VGA A;  4QRY A;  4GP5 B;  1M0M A;  5A8E A;  1JGJ A;  2R4S A;  3QDC A;  4IAR A;  1UAZ A;  1R84 A;  3VG9 A;  1AT9 A;  5DHH A;  1XME B;  2R4R A;  1H2S A;  3AYM A;  2LNL A;  2Y02 A;  1GUE A;  3PDS A;  4DKL A;  5J7A A;  1QM8 A;  3QJR B;  4KLY A;  3VI0 A;  5AHZ A;  4EJ4 A;  3AM6 A;  5G36 A;  3UTX A;  4A4M A;  1CWQ A;  1L9H A;  2YCX A;  1PY6 A;  2YDO A;  3KJ6 A;  3UON A;  1GU8 A;  3OE6 A;  5ITC A;  2F93 A;  1Q5I A;  4L6R A;  1BRR A;  1JV6 A;  5DYS A;  1X0K 1;  5FJG A;  5B34 A;  2KSB A;  5H2H A;  3V2Y A;  3QBI A;  4N4W A;  4PXK A;  5B35 A;  5JJJ A;  4JKV A;  1QKP A;  2ZFE A;  3HAN A;  1P8H A;  4XXJ A;  2KSA A;  4G72 B;  5AX1 A;  2KSY A;  4AMI A;  3S3C B;  2Y04 A;  5A45 A;  1L0M A;  2YCZ A;  3PQR A;  5LWE A;  2AT9 A;  3ODU A;  5AWZ A;  1HZX A;  3HAR A;  1S8L A;  4TL3 A;  4G7Q B;  5B6Y A;  5H2K A;  3PBL A;  2F95 A;  1M0L A;  1QKO A;  5G54 A;  4QID A;  4N4Y B;  2ZIY A;  3OE0 A;  5G2A A;  4XTL A;  4GYC A;  2M3G A;  3WQJ A;  5A44 A;  1E12 A;  4FBZ A;  4K5Y A;  4LDO A;  4G7S B;  1O0A A;  3BVD B;  2I1X A;  5B6W A;  4G7R B;  3S8G B;  3MBV A;  3HAO A;  1IW6 A;  1UCQ A;  4WAV A;  5DHG A;  3ZPQ A;  4AMJ A;  5B0W A;  2YCW A;  3ZPR A;  5JJE A;  3HAQ A;  2ZZL A;  4NC3 A;  3UTW A;  1KG9 A;  2Z73 A;  3VVK A;  4MD1 A;  2I20 A;  4LDL A;  1F50 A;  5H2I A;  5BR2 A;  5H2P A;  3RFM A;  5EN0 A;  1C8R A;  4IAQ A;  1IW9 A;  5G2C A;  1M0K A;  3CAP A;  4HWL A;  2QPE B;  3C9L A;  3UTY A;  3X3C A;  3ABW A;  3C9M A;  2BRD A;  2YCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...