5JJNA

Structure of the srii/htrii(g83f) complex in p212121 space group ("v" shape)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
223
structure length
223
Chain Sequence
GLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
total genus 96
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5jjnA00
3WQJA 4L35A 1XJIA 2NTWA 1FBKA 4XT3A 4A4MA 3UTYA 4X31A 1LN6A 4XXJA 3UZCA 4GRVA 3A7KA 5F8UA 2LNLA 4PXKA 3D4SA 1S52A 3QJRB 3MBVA 2M3GA 1M0KA 2HPYA 3UTWA 3C9MA 1XIOA 2KSBA 5AHZA 2I20A 2YDOA 4EA3A 1CWQA 1BRDA 2QPEB 3EH3B 3EMLA 3S3BB 3VG9A 4Y9HA 3P0GA 5G28A 5B2NA 4J4QA 1L0MA 5B6VA 5JJJA 1QKOA 3V2YA 4MQTA 4LDOA 3OE0A 3VHZA 5AWZA 4GP4B 4OV0A 4BWBA 4NC3A 1KG9A 3RZEA 3UZAA 3AYNA 4KNFA 1EHKB 4FAAB 1PXSA 3QBKA 2F93A 4AMJA 4X1HA 5B6WA 1AT9A 4WAVA 3QJQB 2Y01A 1MGYA 1BRXA 3SN6R 2Y03A 1L9HA 5ETZA 3C9LA 3UG9A 1AP9A 4JR8A 3RFMA 2AT9A 4EIYA 1JV7A 1JGJA 3UONA 4BEZA 3OE6A 5G36A 4G7RB 2Z73A 4GYCA 3QDCA 2KSYA 3S3DB 1TN5A 4HWLA 4IB4A 1S8LA 1QKPA 5AZDA 1P8HA 2BRDA 4GBRA 4QI1A 5LWEA 2Z55A 4QRYA 2WJLA 2YCWA 4GPOA 2Y00A 3QJSB 5G2DA 1UAZA 2PEDA 2JAGA 4BV0A 2ZIYA 4N6HA 1X0SA 3AM6A 1C3WA 1X0K1 2G87A 2EI4A 2WJKA 2YCZA 1E12A 3KJ6A 3HAQA 4AMIA 5B6ZA 5A44A 1H68A 3PBLA 4IARA 3QAKA 2YCYA 3HASA 3S8GB 5H2MA 3PDSA 4K5YA 1GUEA 1S53A 2F95A 2RH1A 4JQ6A 4G7SB 5B0WA 4XT1A 1P8IA 4QIDA 2X72A 1KGBA 1HZXA 2ZFEA 5G54A 5B34A 4X32A 4BUOA 1JFPA 1BM1A 3S3CB 4UG2A 4LDEA 1IW6A 5BR5A 4DJHA 4HYXA 3QJUB 2R4SA 5DYSA 4MBSA 4TL3A 1S8JA 4FA7B 1R2NA 1S54A 1M0LA 1KMEA 5B6YA 1P8UA 3VW7A 5DHGA 3DQBA 3ODUA 4DAJA 2JAFA 5FJGA 4MD1A 3OE8A 2I35A 5ITEA 3HAPA 4G71B 2R4RA 3QJVB 4MD2A 5EN0A 1C8RA 2NTUA 5A8EA 4N4WA 5DHHA 3HANA 1X0I1 4GP5B 5H2OA 1DZEA 5B35A 5H2JA 2VT4A 4G72B 1VJMA 4PXFA 3DDLA 3PXOA 3EH4B 4WW3A 5G2CA 4HYJA 3S8FB 4DKLA 4MQSA 2QPDB 1KG8A 5A45A 3CAPA 3UTVA 3REYA 3ZEVA 4BEYA 1PXRA 3NY9A 2KSAA 5JJNA 1QHJA 2YCXA 3HAOA 1M0MA 2ZZLA 3ZPQA 3COCA 2L6XA 4XTNA 5G2AA 3CODA 1PY6A 3VI0A 5C1MA 1FBBA 2YDVA 3NYAA 2J4YA 3QAPA 3T45A 5H2IA 4XTOA 5G53A 4EJ4A 3PWHA 3QBGA 4FBZA 3OAXA 1GZMA 4FPDA 1TN0A 3NSBA 1VGOA 1XMEB 2KS9A 3UTXA 1UCQA 4N4YB 1GU8A 4LDLA 5H2KA 3ABWA 1IXFA 5TGZA 1O0AA 2I21A 5JJEA 5H2PA 2I1XA 5ITCA 4UHRA 1F4ZA 4L6RA 4G70B 3X3BA 3HARA 3VGAA 5H2HA 1QM8A 3OE9A 3PQRA 1F88A 5AHYA 3ZPRA 5AX0A 3QBLA 4XTLA 3BVDB 1U19A 3VVKA 1BRRA 3EH5B 2Y04A 3NY8A 5KKHA 1Q5JA 1E0PA 5H2NA 1Q5IA 2Y02A 5AX1A 5J7AA 1R84A 4KLYA 3V2WA 4BVNA 1H2SA 1JV6A 5B6XA 4G7QB 1IW9A 3AYMA 4JKVA 5H2LA 1S51A 4GP8B 3QJTB 5BR2A 3QBIA 1C8SA 4IAQA 3X3CA 3NS0A 1F50A
chains in the Genus database with same CATH superfamily
3WQJA 4L35A 1XJIA 2NTWA 1FBKA 4XT3A 4A4MA 3UTYA 4X31A 1LN6A 4XXJA 3UZCA 4GRVA 3A7KA 5F8UA 2LNLA 4PXKA 3D4SA 1S52A 3QJRB 3MBVA 2M3GA 1M0KA 2HPYA 3UTWA 3C9MA 1XIOA 2KSBA 5AHZA 2I20A 2YDOA 4EA3A 1CWQA 1BRDA 2QPEB 3EH3B 3EMLA 3S3BB 3VG9A 4Y9HA 3P0GA 5G28A 5B2NA 4J4QA 1L0MA 5B6VA 5JJJA 1QKOA 3V2YA 4MQTA 4LDOA 3OE0A 3VHZA 5AWZA 4GP4B 4OV0A 4BWBA 4NC3A 1KG9A 3RZEA 3UZAA 3AYNA 4KNFA 1EHKB 4FAAB 1PXSA 3QBKA 2F93A 4DS7E 4AMJA 4X1HA 5B6WA 1AT9A 4WAVA 3QJQB 2Y01A 1MGYA 1BRXA 3SN6R 2Y03A 1L9HA 5ETZA 3C9LA 3UG9A 1AP9A 4JR8A 3RFMA 2AT9A 4EIYA 1JV7A 1JGJA 3UONA 4BEZA 3OE6A 5G36A 4G7RB 2Z73A 4GYCA 3QDCA 2KSYA 3S3DB 1TN5A 4HWLA 4IB4A 1S8LA 1QKPA 5AZDA 1P8HA 2BRDA 4GBRA 4QI1A 5LWEA 2Z55A 4QRYA 2WJLA 2YCWA 4GPOA 2Y00A 3QJSB 5G2DA 1UAZA 2PEDA 2JAGA 4BV0A 2ZIYA 4N6HA 1X0SA 3AM6A 1C3WA 1X0K1 2G87A 2EI4A 2WJKA 2YCZA 1E12A 3KJ6A 3HAQA 4AMIA 5B6ZA 5A44A 1H68A 3PBLA 4IARA 3QAKA 2YCYA 3HASA 3S8GB 5H2MA 3PDSA 4K5YA 1GUEA 1S53A 2F95A 2RH1A 4JQ6A 4G7SB 5B0WA 4XT1A 1P8IA 4QIDA 2X72A 1KGBA 1HZXA 2ZFEA 5G54A 5B34A 4X32A 4BUOA 1JFPA 1BM1A 3S3CB 4UG2A 4LDEA 1IW6A 5BR5A 4DJHA 4HYXA 3QJUB 2R4SA 5DYSA 4MBSA 4TL3A 1S8JA 4FA7B 1R2NA 1S54A 1M0LA 1KMEA 5B6YA 1P8UA 3VW7A 5DHGA 3DQBA 3ODUA 4DAJA 2JAFA 5FJGA 4MD1A 3OE8A 2I35A 5ITEA 3HAPA 4G71B 2R4RA 3QJVB 4MD2A 5EN0A 1C8RA 2NTUA 5A8EA 4N4WA 5DHHA 3HANA 1X0I1 4GP5B 5H2OA 1DZEA 5B35A 5H2JA 2VT4A 4G72B 1VJMA 4PXFA 3DDLA 3PXOA 3EH4B 4WW3A 5G2CA 4HYJA 3S8FB 4DKLA 4MQSA 2QPDB 1KG8A 5A45A 3CAPA 3UTVA 3REYA 3ZEVA 4BEYA 1PXRA 3NY9A 2KSAA 5JJNA 1QHJA 2YCXA 3HAOA 1M0MA 2ZZLA 3ZPQA 3COCA 2L6XA 4XTNA 5G2AA 3CODA 1PY6A 3VI0A 5C1MA 1FBBA 2YDVA 3NYAA 2J4YA 3QAPA 3T45A 5H2IA 4XTOA 5G53A 4EJ4A 3PWHA 3QBGA 4FBZA 3OAXA 1GZMA 4FPDA 1TN0A 3NSBA 1VGOA 1XMEB 2KS9A 3UTXA 1UCQA 4N4YB 1GU8A 4LDLA 5H2KA 3ABWA 1IXFA 5TGZA 1O0AA 2I21A 5JJEA 5H2PA 2I1XA 5ITCA 4UHRA 1F4ZA 4L6RA 4G70B 3X3BA 3HARA 3VGAA 5H2HA 1QM8A 3OE9A 3PQRA 1F88A 5AHYA 3ZPRA 5AX0A 3QBLA 4XTLA 3BVDB 1U19A 3VVKA 1BRRA 3EH5B 2Y04A 3NY8A 5KKHA 1Q5JA 1E0PA 5H2NA 1Q5IA 2Y02A 5AX1A 5J7AA 1R84A 4KLYA 3V2WA 4BVNA 1H2SA 1JV6A 5B6XA 4G7QB 1IW9A 3AYMA 4JKVA 5H2LA 1S51A 4GP8B 3QJTB 5BR2A 3QBIA 1C8SA 4IAQA 3X3CA 3NS0A 1F50A
chains in the Genus database with same CATH topology
3WQJA 4L35A 1XJIA 2NTWA 1FBKA 4XT3A 4A4MA 3UTYA 4X31A 1LN6A 4XXJA 3UZCA 4GRVA 3A7KA 5F8UA 2LNLA 4PXKA 3D4SA 1S52A 3QJRB 3MBVA 2M3GA 1M0KA 2HPYA 3UTWA 3C9MA 1XIOA 2KSBA 5AHZA 2I20A 2YDOA 4EA3A 1CWQA 1BRDA 2QPEB 3EH3B 3EMLA 3S3BB 3VG9A 4Y9HA 3P0GA 5G28A 5B2NA 4J4QA 1L0MA 5B6VA 5JJJA 1QKOA 3V2YA 4MQTA 4LDOA 3OE0A 3VHZA 5AWZA 4GP4B 4OV0A 4BWBA 4NC3A 1KG9A 3RZEA 3UZAA 3AYNA 4KNFA 1EHKB 4FAAB 1PXSA 3QBKA 2F93A 4DS7E 4AMJA 4X1HA 5B6WA 1AT9A 4WAVA 3QJQB 2Y01A 1MGYA 1BRXA 3SN6R 2Y03A 1L9HA 5ETZA 3C9LA 3UG9A 1AP9A 4JR8A 3RFMA 2AT9A 4EIYA 1JV7A 1JGJA 3UONA 4BEZA 3OE6A 5G36A 4G7RB 2Z73A 4GYCA 3QDCA 2KSYA 3S3DB 1TN5A 4HWLA 4IB4A 1S8LA 1QKPA 5AZDA 1P8HA 2BRDA 4GBRA 4QI1A 5LWEA 2Z55A 4QRYA 2WJLA 2YCWA 4GPOA 2Y00A 3QJSB 5G2DA 1UAZA 2PEDA 2JAGA 4BV0A 2ZIYA 4N6HA 1X0SA 3AM6A 1C3WA 1X0K1 2G87A 2EI4A 2WJKA 2YCZA 1E12A 3KJ6A 3HAQA 4AMIA 5B6ZA 5A44A 1H68A 3PBLA 4IARA 3QAKA 2YCYA 3HASA 3S8GB 5H2MA 3PDSA 4K5YA 1GUEA 1S53A 2F95A 2RH1A 4JQ6A 4G7SB 5B0WA 4XT1A 1P8IA 4QIDA 2X72A 1KGBA 1HZXA 2ZFEA 5G54A 5B34A 4X32A 4BUOA 1JFPA 1BM1A 3S3CB 4UG2A 4LDEA 1IW6A 5BR5A 4DJHA 4HYXA 3QJUB 2R4SA 5DYSA 4MBSA 4TL3A 1S8JA 4FA7B 1R2NA 1S54A 1M0LA 1KMEA 5B6YA 1P8UA 3VW7A 5DHGA 3DQBA 3ODUA 4DAJA 2JAFA 5FJGA 4MD1A 3OE8A 2I35A 5ITEA 3HAPA 4G71B 2R4RA 3QJVB 4MD2A 5EN0A 1C8RA 2NTUA 5A8EA 4N4WA 5DHHA 3HANA 1X0I1 4GP5B 5H2OA 1DZEA 5B35A 5H2JA 2VT4A 4G72B 1VJMA 4PXFA 3DDLA 3PXOA 3EH4B 4WW3A 5G2CA 4HYJA 3S8FB 4DKLA 4MQSA 2QPDB 1KG8A 5A45A 3CAPA 3UTVA 3REYA 3ZEVA 4BEYA 1PXRA 3NY9A 2KSAA 5JJNA 1QHJA 2YCXA 3HAOA 1M0MA 2ZZLA 3ZPQA 3COCA 2L6XA 4XTNA 5G2AA 3CODA 1PY6A 3VI0A 5C1MA 1FBBA 2YDVA 3NYAA 2J4YA 3QAPA 3T45A 5H2IA 4XTOA 5G53A 4EJ4A 3PWHA 3QBGA 4FBZA 3OAXA 1GZMA 4FPDA 1TN0A 3NSBA 1VGOA 1XMEB 2KS9A 3UTXA 1UCQA 4N4YB 1GU8A 4LDLA 5H2KA 3ABWA 1IXFA 5TGZA 1O0AA 2I21A 5JJEA 5H2PA 2I1XA 5ITCA 4UHRA 1F4ZA 4L6RA 4G70B 3X3BA 3HARA 3VGAA 5H2HA 1QM8A 3OE9A 3PQRA 1F88A 5AHYA 3ZPRA 5AX0A 3QBLA 4XTLA 3BVDB 1U19A 3VVKA 1BRRA 3EH5B 2Y04A 3NY8A 5KKHA 1Q5JA 1E0PA 5H2NA 1Q5IA 2Y02A 5AX1A 5J7AA 1R84A 4KLYA 3V2WA 4BVNA 1H2SA 1JV6A 5B6XA 4G7QB 1IW9A 3AYMA 4JKVA 5H2LA 1S51A 4GP8B 3QJTB 5BR2A 3QBIA 1C8SA 4IAQA 3X3CA 3NS0A 1F50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQJ A;  4L35 A;  1XJI A;  2NTW A;  1FBK A;  4XT3 A;  4A4M A;  3UTY A;  4X31 A;  1LN6 A;  4XXJ A;  3UZC A;  4GRV A;  3A7K A;  5F8U A;  2LNL A;  4PXK A;  3D4S A;  1S52 A;  3QJR B;  3MBV A;  2M3G A;  1M0K A;  2HPY A;  3UTW A;  3C9M A;  1XIO A;  2KSB A;  5AHZ A;  2I20 A;  2YDO A;  4EA3 A;  1CWQ A;  1BRD A;  2QPE B;  3EH3 B;  3EML A;  3S3B B;  3VG9 A;  4Y9H A;  3P0G A;  5G28 A;  5B2N A;  4J4Q A;  1L0M A;  5B6V A;  5JJJ A;  1QKO A;  3V2Y A;  4MQT A;  4LDO A;  3OE0 A;  3VHZ A;  5AWZ A;  4GP4 B;  4OV0 A;  4BWB A;  4NC3 A;  1KG9 A;  3RZE A;  3UZA A;  3AYN A;  4KNF A;  1EHK B;  4FAA B;  1PXS A;  3QBK A;  2F93 A;  4AMJ A;  4X1H A;  5B6W A;  1AT9 A;  4WAV A;  3QJQ B;  2Y01 A;  1MGY A;  1BRX A;  3SN6 R;  2Y03 A;  1L9H A;  5ETZ A;  3C9L A;  3UG9 A;  1AP9 A;  4JR8 A;  3RFM A;  2AT9 A;  4EIY A;  1JV7 A;  1JGJ A;  3UON A;  4BEZ A;  3OE6 A;  5G36 A;  4G7R B;  2Z73 A;  4GYC A;  3QDC A;  2KSY A;  3S3D B;  1TN5 A;  4HWL A;  4IB4 A;  1S8L A;  1QKP A;  5AZD A;  1P8H A;  2BRD A;  4GBR A;  4QI1 A;  5LWE A;  2Z55 A;  4QRY A;  2WJL A;  2YCW A;  4GPO A;  2Y00 A;  3QJS B;  5G2D A;  1UAZ A;  2PED A;  2JAG A;  4BV0 A;  2ZIY A;  4N6H A;  1X0S A;  3AM6 A;  1C3W A;  1X0K 1;  2G87 A;  2EI4 A;  2WJK A;  2YCZ A;  1E12 A;  3KJ6 A;  3HAQ A;  4AMI A;  5B6Z A;  5A44 A;  1H68 A;  3PBL A;  4IAR A;  3QAK A;  2YCY A;  3HAS A;  3S8G B;  5H2M A;  3PDS A;  4K5Y A;  1GUE A;  1S53 A;  2F95 A;  2RH1 A;  4JQ6 A;  4G7S B;  5B0W A;  4XT1 A;  1P8I A;  4QID A;  2X72 A;  1KGB A;  1HZX A;  2ZFE A;  5G54 A;  5B34 A;  4X32 A;  4BUO A;  1JFP A;  1BM1 A;  3S3C B;  4UG2 A;  4LDE A;  1IW6 A;  5BR5 A;  4DJH A;  4HYX A;  3QJU B;  2R4S A;  5DYS A;  4MBS A;  4TL3 A;  1S8J A;  4FA7 B;  1R2N A;  1S54 A;  1M0L A;  1KME A;  5B6Y A;  1P8U A;  3VW7 A;  5DHG A;  3DQB A;  3ODU A;  4DAJ A;  2JAF A;  5FJG A;  4MD1 A;  3OE8 A;  2I35 A;  5ITE A;  3HAP A;  4G71 B;  2R4R A;  3QJV B;  4MD2 A;  5EN0 A;  1C8R A;  2NTU A;  5A8E A;  4N4W A;  5DHH A;  3HAN A;  1X0I 1;  4GP5 B;  5H2O A;  1DZE A;  5B35 A;  5H2J A;  2VT4 A;  4G72 B;  1VJM A;  4PXF A;  3DDL A;  3PXO A;  3EH4 B;  4WW3 A;  5G2C A;  4HYJ A;  3S8F B;  4DKL A;  4MQS A;  2QPD B;  1KG8 A;  5A45 A;  3CAP A;  3UTV A;  3REY A;  3ZEV A;  4BEY A;  1PXR A;  3NY9 A;  2KSA A;  5JJN A;  1QHJ A;  2YCX A;  3HAO A;  1M0M A;  2ZZL A;  3ZPQ A;  3COC A;  2L6X A;  4XTN A;  5G2A A;  3COD A;  1PY6 A;  3VI0 A;  5C1M A;  1FBB A;  2YDV A;  3NYA A;  2J4Y A;  3QAP A;  3T45 A;  5H2I A;  4XTO A;  5G53 A;  4EJ4 A;  3PWH A;  3QBG A;  4FBZ A;  3OAX A;  1GZM A;  4FPD A;  1TN0 A;  3NSB A;  1VGO A;  1XME B;  2KS9 A;  3UTX A;  1UCQ A;  4N4Y B;  1GU8 A;  4LDL A;  5H2K A;  3ABW A;  1IXF A;  5TGZ A;  1O0A A;  2I21 A;  5JJE A;  5H2P A;  2I1X A;  5ITC A;  4UHR A;  1F4Z A;  4L6R A;  4G70 B;  3X3B A;  3HAR A;  3VGA A;  5H2H A;  1QM8 A;  3OE9 A;  3PQR A;  1F88 A;  5AHY A;  3ZPR A;  5AX0 A;  3QBL A;  4XTL A;  3BVD B;  1U19 A;  3VVK A;  1BRR A;  3EH5 B;  2Y04 A;  3NY8 A;  5KKH A;  1Q5J A;  1E0P A;  5H2N A;  1Q5I A;  2Y02 A;  5AX1 A;  5J7A A;  1R84 A;  4KLY A;  3V2W A;  4BVN A;  1H2S A;  1JV6 A;  5B6X A;  4G7Q B;  1IW9 A;  3AYM A;  4JKV A;  5H2L A;  1S51 A;  4GP8 B;  3QJT B;  5BR2 A;  3QBI A;  1C8S A;  4IAQ A;  3X3C A;  3NS0 A;  1F50 A; 
#chains in the Genus database with same CATH topology
 3WQJ A;  4L35 A;  1XJI A;  2NTW A;  1FBK A;  4XT3 A;  4A4M A;  3UTY A;  4X31 A;  1LN6 A;  4XXJ A;  3UZC A;  4GRV A;  3A7K A;  5F8U A;  2LNL A;  4PXK A;  3D4S A;  1S52 A;  3QJR B;  3MBV A;  2M3G A;  1M0K A;  2HPY A;  3UTW A;  3C9M A;  1XIO A;  2KSB A;  5AHZ A;  2I20 A;  2YDO A;  4EA3 A;  1CWQ A;  1BRD A;  2QPE B;  3EH3 B;  3EML A;  3S3B B;  3VG9 A;  4Y9H A;  3P0G A;  5G28 A;  5B2N A;  4J4Q A;  1L0M A;  5B6V A;  5JJJ A;  1QKO A;  3V2Y A;  4MQT A;  4LDO A;  3OE0 A;  3VHZ A;  5AWZ A;  4GP4 B;  4OV0 A;  4BWB A;  4NC3 A;  1KG9 A;  3RZE A;  3UZA A;  3AYN A;  4KNF A;  1EHK B;  4FAA B;  1PXS A;  3QBK A;  2F93 A;  4DS7 E;  4AMJ A;  4X1H A;  5B6W A;  1AT9 A;  4WAV A;  3QJQ B;  2Y01 A;  1MGY A;  1BRX A;  3SN6 R;  2Y03 A;  1L9H A;  5ETZ A;  3C9L A;  3UG9 A;  1AP9 A;  4JR8 A;  3RFM A;  2AT9 A;  4EIY A;  1JV7 A;  1JGJ A;  3UON A;  4BEZ A;  3OE6 A;  5G36 A;  4G7R B;  2Z73 A;  4GYC A;  3QDC A;  2KSY A;  3S3D B;  1TN5 A;  4HWL A;  4IB4 A;  1S8L A;  1QKP A;  5AZD A;  1P8H A;  2BRD A;  4GBR A;  4QI1 A;  5LWE A;  2Z55 A;  4QRY A;  2WJL A;  2YCW A;  4GPO A;  2Y00 A;  3QJS B;  5G2D A;  1UAZ A;  2PED A;  2JAG A;  4BV0 A;  2ZIY A;  4N6H A;  1X0S A;  3AM6 A;  1C3W A;  1X0K 1;  2G87 A;  2EI4 A;  2WJK A;  2YCZ A;  1E12 A;  3KJ6 A;  3HAQ A;  4AMI A;  5B6Z A;  5A44 A;  1H68 A;  3PBL A;  4IAR A;  3QAK A;  2YCY A;  3HAS A;  3S8G B;  5H2M A;  3PDS A;  4K5Y A;  1GUE A;  1S53 A;  2F95 A;  2RH1 A;  4JQ6 A;  4G7S B;  5B0W A;  4XT1 A;  1P8I A;  4QID A;  2X72 A;  1KGB A;  1HZX A;  2ZFE A;  5G54 A;  5B34 A;  4X32 A;  4BUO A;  1JFP A;  1BM1 A;  3S3C B;  4UG2 A;  4LDE A;  1IW6 A;  5BR5 A;  4DJH A;  4HYX A;  3QJU B;  2R4S A;  5DYS A;  4MBS A;  4TL3 A;  1S8J A;  4FA7 B;  1R2N A;  1S54 A;  1M0L A;  1KME A;  5B6Y A;  1P8U A;  3VW7 A;  5DHG A;  3DQB A;  3ODU A;  4DAJ A;  2JAF A;  5FJG A;  4MD1 A;  3OE8 A;  2I35 A;  5ITE A;  3HAP A;  4G71 B;  2R4R A;  3QJV B;  4MD2 A;  5EN0 A;  1C8R A;  2NTU A;  5A8E A;  4N4W A;  5DHH A;  3HAN A;  1X0I 1;  4GP5 B;  5H2O A;  1DZE A;  5B35 A;  5H2J A;  2VT4 A;  4G72 B;  1VJM A;  4PXF A;  3DDL A;  3PXO A;  3EH4 B;  4WW3 A;  5G2C A;  4HYJ A;  3S8F B;  4DKL A;  4MQS A;  2QPD B;  1KG8 A;  5A45 A;  3CAP A;  3UTV A;  3REY A;  3ZEV A;  4BEY A;  1PXR A;  3NY9 A;  2KSA A;  5JJN A;  1QHJ A;  2YCX A;  3HAO A;  1M0M A;  2ZZL A;  3ZPQ A;  3COC A;  2L6X A;  4XTN A;  5G2A A;  3COD A;  1PY6 A;  3VI0 A;  5C1M A;  1FBB A;  2YDV A;  3NYA A;  2J4Y A;  3QAP A;  3T45 A;  5H2I A;  4XTO A;  5G53 A;  4EJ4 A;  3PWH A;  3QBG A;  4FBZ A;  3OAX A;  1GZM A;  4FPD A;  1TN0 A;  3NSB A;  1VGO A;  1XME B;  2KS9 A;  3UTX A;  1UCQ A;  4N4Y B;  1GU8 A;  4LDL A;  5H2K A;  3ABW A;  1IXF A;  5TGZ A;  1O0A A;  2I21 A;  5JJE A;  5H2P A;  2I1X A;  5ITC A;  4UHR A;  1F4Z A;  4L6R A;  4G70 B;  3X3B A;  3HAR A;  3VGA A;  5H2H A;  1QM8 A;  3OE9 A;  3PQR A;  1F88 A;  5AHY A;  3ZPR A;  5AX0 A;  3QBL A;  4XTL A;  3BVD B;  1U19 A;  3VVK A;  1BRR A;  3EH5 B;  2Y04 A;  3NY8 A;  5KKH A;  1Q5J A;  1E0P A;  5H2N A;  1Q5I A;  2Y02 A;  5AX1 A;  5J7A A;  1R84 A;  4KLY A;  3V2W A;  4BVN A;  1H2S A;  1JV6 A;  5B6X A;  4G7Q B;  1IW9 A;  3AYM A;  4JKV A;  5H2L A;  1S51 A;  4GP8 B;  3QJT B;  5BR2 A;  3QBI A;  1C8S A;  4IAQ A;  3X3C A;  3NS0 A;  1F50 A; 
#chains in the Genus database with same CATH homology
 3WQJ A;  4L35 A;  1XJI A;  2NTW A;  1FBK A;  4XT3 A;  4A4M A;  3UTY A;  4X31 A;  1LN6 A;  4XXJ A;  3UZC A;  4GRV A;  3A7K A;  5F8U A;  2LNL A;  4PXK A;  3D4S A;  1S52 A;  3QJR B;  3MBV A;  2M3G A;  1M0K A;  2HPY A;  3UTW A;  3C9M A;  1XIO A;  2KSB A;  5AHZ A;  2I20 A;  2YDO A;  4EA3 A;  1CWQ A;  1BRD A;  2QPE B;  3EH3 B;  3EML A;  3S3B B;  3VG9 A;  4Y9H A;  3P0G A;  5G28 A;  5B2N A;  4J4Q A;  1L0M A;  5B6V A;  5JJJ A;  1QKO A;  3V2Y A;  4MQT A;  4LDO A;  3OE0 A;  3VHZ A;  5AWZ A;  4GP4 B;  4OV0 A;  4BWB A;  4NC3 A;  1KG9 A;  3RZE A;  3UZA A;  3AYN A;  4KNF A;  1EHK B;  4FAA B;  1PXS A;  3QBK A;  2F93 A;  4DS7 E;  4AMJ A;  4X1H A;  5B6W A;  1AT9 A;  4WAV A;  3QJQ B;  2Y01 A;  1MGY A;  1BRX A;  3SN6 R;  2Y03 A;  1L9H A;  5ETZ A;  3C9L A;  3UG9 A;  1AP9 A;  4JR8 A;  3RFM A;  2AT9 A;  4EIY A;  1JV7 A;  1JGJ A;  3UON A;  4BEZ A;  3OE6 A;  5G36 A;  4G7R B;  2Z73 A;  4GYC A;  3QDC A;  2KSY A;  3S3D B;  1TN5 A;  4HWL A;  4IB4 A;  1S8L A;  1QKP A;  5AZD A;  1P8H A;  2BRD A;  4GBR A;  4QI1 A;  5LWE A;  2Z55 A;  4QRY A;  2WJL A;  2YCW A;  4GPO A;  2Y00 A;  3QJS B;  5G2D A;  1UAZ A;  2PED A;  2JAG A;  4BV0 A;  2ZIY A;  4N6H A;  1X0S A;  3AM6 A;  1C3W A;  1X0K 1;  2G87 A;  2EI4 A;  2WJK A;  2YCZ A;  1E12 A;  3KJ6 A;  3HAQ A;  4AMI A;  5B6Z A;  5A44 A;  1H68 A;  3PBL A;  4IAR A;  3QAK A;  2YCY A;  3HAS A;  3S8G B;  5H2M A;  3PDS A;  4K5Y A;  1GUE A;  1S53 A;  2F95 A;  2RH1 A;  4JQ6 A;  4G7S B;  5B0W A;  4XT1 A;  1P8I A;  4QID A;  2X72 A;  1KGB A;  1HZX A;  2ZFE A;  5G54 A;  5B34 A;  4X32 A;  4BUO A;  1JFP A;  1BM1 A;  3S3C B;  4UG2 A;  4LDE A;  1IW6 A;  5BR5 A;  4DJH A;  4HYX A;  3QJU B;  2R4S A;  5DYS A;  4MBS A;  4TL3 A;  1S8J A;  4FA7 B;  1R2N A;  1S54 A;  1M0L A;  1KME A;  5B6Y A;  1P8U A;  3VW7 A;  5DHG A;  3DQB A;  3ODU A;  4DAJ A;  2JAF A;  5FJG A;  4MD1 A;  3OE8 A;  2I35 A;  5ITE A;  3HAP A;  4G71 B;  2R4R A;  3QJV B;  4MD2 A;  5EN0 A;  1C8R A;  2NTU A;  5A8E A;  4N4W A;  5DHH A;  3HAN A;  1X0I 1;  4GP5 B;  5H2O A;  1DZE A;  5B35 A;  5H2J A;  2VT4 A;  4G72 B;  1VJM A;  4PXF A;  3DDL A;  3PXO A;  3EH4 B;  4WW3 A;  5G2C A;  4HYJ A;  3S8F B;  4DKL A;  4MQS A;  2QPD B;  1KG8 A;  5A45 A;  3CAP A;  3UTV A;  3REY A;  3ZEV A;  4BEY A;  1PXR A;  3NY9 A;  2KSA A;  5JJN A;  1QHJ A;  2YCX A;  3HAO A;  1M0M A;  2ZZL A;  3ZPQ A;  3COC A;  2L6X A;  4XTN A;  5G2A A;  3COD A;  1PY6 A;  3VI0 A;  5C1M A;  1FBB A;  2YDV A;  3NYA A;  2J4Y A;  3QAP A;  3T45 A;  5H2I A;  4XTO A;  5G53 A;  4EJ4 A;  3PWH A;  3QBG A;  4FBZ A;  3OAX A;  1GZM A;  4FPD A;  1TN0 A;  3NSB A;  1VGO A;  1XME B;  2KS9 A;  3UTX A;  1UCQ A;  4N4Y B;  1GU8 A;  4LDL A;  5H2K A;  3ABW A;  1IXF A;  5TGZ A;  1O0A A;  2I21 A;  5JJE A;  5H2P A;  2I1X A;  5ITC A;  4UHR A;  1F4Z A;  4L6R A;  4G70 B;  3X3B A;  3HAR A;  3VGA A;  5H2H A;  1QM8 A;  3OE9 A;  3PQR A;  1F88 A;  5AHY A;  3ZPR A;  5AX0 A;  3QBL A;  4XTL A;  3BVD B;  1U19 A;  3VVK A;  1BRR A;  3EH5 B;  2Y04 A;  3NY8 A;  5KKH A;  1Q5J A;  1E0P A;  5H2N A;  1Q5I A;  2Y02 A;  5AX1 A;  5J7A A;  1R84 A;  4KLY A;  3V2W A;  4BVN A;  1H2S A;  1JV6 A;  5B6X A;  4G7Q B;  1IW9 A;  3AYM A;  4JKV A;  5H2L A;  1S51 A;  4GP8 B;  3QJT B;  5BR2 A;  3QBI A;  1C8S A;  4IAQ A;  3X3C A;  3NS0 A;  1F50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...